3MW2A

Crystal structure of beta-neurexin 1 with the splice insert 4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
205
structure length
195
Chain Sequence
GSTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurexin-1-alpha
publication title Splice Form Dependence of beta-Neurexin/Neuroligin Binding Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 37
structure length 195
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mw2A00
1LHVA 4PBPA 3OY8B 3N7JA 1ULCA 3I4IA 3RG0A 3WVJA 4LBKA 2VH9A 4ITCA 2P2KA 2D44A 4YG3A 4BLJA 4XIOA 2FMDA 2ZHKA 4XJ8A 4YW4A 3ZSJA 2CNAA 2ZHMA 3AZYA 2DVDA 1LCLA 1SCRA 4YZ4A 3ZXFA 1FNZA 2ZGUA 5GLTA 3AFKA 3O0VA 5KXBA 1N1VA 2ARXA 1GKBA 1SLAA 4Q2FA 4PBOA 4XBNA 4M3CB 4LBQA 3IMNA 3LSDA 4ISQA 2NYYA 3JU9A 4BQ1A 2JDZA 1C57A 1WLWA 2PHXA 4U36A 3RSJA 1LTEA 1IS4A 1W6PA 2ENRA 3PVEA 1WBFA 3M3QA 2GMEA 3WDUA 1QDOA 5GLVA 3AYCA 1S0IA 1V6IA 3RRDA 4YM3A 3AYEA 1MZ5A 5FREA 3N35A 2WKKA 3GALA 1JUIA 2JE7A 1F31A 4FPEA 1S0EA 2NZ9A 3WG3A 4KBBA 1OQ1A 2D6MA 5DZGA 5EXOA 4YFWA 3SNMA 1DQ6A 1UZYA 5GZEA 4DRRA 3B00A 4BOWA 4FP2A 2JECA 4FPHA 3TAYA 1DLLA 2PHWA 1O4ZA 1VIWB 2R0HA 2ZGKA 4SLIA 1LHUA 4XJ9A 4ATFA 5IK7A 5JDBA 3A0KA 4JCKA 3AZWA 1LOEA 1Q8VA 2A6ZA 4M3CF 5GALA 2P3KA 3A4UA 3WCSA 1N1YA 4AWDA 1DYKA 2DVBA 3ILNA 4YGBA 2A3WA 1S1AA 1SBDA 3N3HA 3PVNA 4NO4A 4PCRA 1VAVA 2PHUA 4K1YA 1SLTA 2DUOA 3WDYA 1Q8PA 2ZGQA 3D6EA 4NOTA 3OYWA 5E8AA 1DZQA 1JW6A 2ZGLA 1MVEA 5T52A 1DQ2A 1DYPA 1W6OB 3RQ0A 2ZA9A 2GNDA 2VW0A 3V0BB 2EXKA 1IS5A 1V6JA 1A78A 1CVNA 1SFYA 4AGGA 5GZCA 2NP0A 1WBLA 3O5SA 1OFSA 3OY8A 1KITA 4YZ3A 4XJWA 5EWSA 1GANA 3ILRA 2DVGA 4YGCA 1BYHA 2NMNA 2C5DA 3ILFA 1F9KA 1MR5A 4K20A 1V6LA 1DQ1A 3MEPA 1SACA 1SLCA 1YO8A 2AENA 2WT2A 3BODA 1W6PB 5JOYA 1S0FA 3MW4A 1AX0A 3IKWA 3U4XA 1LECA 3VKNA 5F5QA 2ARBA 3UJOA 3DUIA 2P37A 4XMIA 5IK8A 3HN1A 1ULFA 2SLIA 3WUCA 5F9TA 1LOAA 3B01A 1RIRA 1QOSA 3ZYPA 4K1ZA 3ZSMA 1UMZA 1CIWA 2EF6A 2JKBA 4DRVA 2VU9A 2R49A 1MS1A 1A3KA 2R1DA 3INAA 4L8QA 2R1BA 2ES3A 1G8WA 3ZVXA 3AYAA 1I1EA 3AZVA 3O0XA 5JOXA 1WUVA 4DFSA 1IS6A 1AX1A 5T5PA 1AZDA 3POSA 1QF3A 2WQZC 5T5LA 2W39A 3SLIA 1AX2A 3UL2A 1VALA 5CNAA 4YZ5A 1FX5A 1IKQA 3POYA 5DZFA 1DQ4A 1UAIA 3O0WA 1KDKA 1YYNA 2PELA 1FATA 4GALA 1ULDA 5CAZA 4Q8KA 3C2UA 1AXYA 2W52A 1HLCA 2WT0A 4UW4A 1W6QA 1QNYA 5KXDA 1G9FA 3N7MA 1LESA 3M3EA 3AJYA 1LU2A 3W59A 3WOGA 4BLIA 1CR7A 1CN1A 4RA0A 1W0PA 2JD4A 4YZ1A 4GKXA 2H0BA 5EYYA 1W6OA 5DUWA 4FPJA 3VV1A 4AVSA 4ZKTB 2AREA 1ENQA 2DWRA 4YM2A 2EXIA 1S0DA 3AP5A 1GNHA 1DIWA 1DQ5A 2XG3A 1I3HA 5T5OA 1AF9A 5IUQA 2AR6A 1CPNA 5T54A 1S0GA 4WVVA 3DGTA 3NV2A 1N3PA 4XJZA 2ZGSA 3QCWA 5IK5A 1EPWA 4PF5A 4GXLA 4LBQD 3APBA 3B9CA 1N3QA 4BMBA 4W65A 3T1MA 1BKZA 1UX6A 1XQNA 2RHPA 3D5OA 4LBJA 4XTPA 4YM0A 4XYXA 3WG2A 1YRZA 2Z42A 3ZXKA 4XILA 3AZXA 3BIWE 4YG6A 4Y24A 2NMOA 1FYUA 2JJ6A 3UK9A 1BXHA 2EXHA 2XB6C 5HCBA 4R9BA 3RMXA 3SH3A 4BM8A 1GNZA 2ZGRA 1DQ0A 3AP7A 4U2AA 1V6OA 2V73A 1GBGA 4Y1ZA 5KXCA 2UURA 4CRQA 1G86A 1AXZA 4Q1PA 1F5FA 1HQWA 1Z0HA 2P3JA 2PHFA 2ZGOA 1GZWB 1MS0A 2OVUA 4GKYA 1FV2A 1WW4A 4K21A 2B7YA 2A75A 3IPVB 3BTAA 4FOVA 5H9QA 1AJKA 1AXKA 1WD4A 4JC1A 4H55A 2ZGNA 4AVVA 2DTYA 4XJAA 4FPGA 1QGLA 5KXEA 4AGRA 1W6QB 4FPFA 1CPMA 2AYHA 1Z78A 2ZGMA 4Q27A 3KM5A 2UWCA 2WLQA 5H9PA 2A7AA 1LEDA 3JUUA 1DGLA 4XOGA 2ZMNA 2ZHLA 5LK5A 4DQAA 1QU0A 1MZ6A 4ATEA 3M3OA 4GA9A 4FQZA 4Y1UA 2A3XA 1SLIA 3NWKA 2GMMA 5H9RA 2LALA 4HANA 4C1WA 3MPPG 3B3QE 4XE9A 3USUB 3WG4A 4P14A 2D6NA 5T55A 5BYNA 3FLTA 2VW2A 3KQRA 3ENRA 3HR9A 5DG1A 1VLNA 1GZ9A 2SBAA 3ZXEA 1C1FA 1D0HA 4DS0A 1URXA 2D6OX 4D69A 2A3YA 2C9AA 5GLWA 1W6MB 3R05A 1W6NB 4XBQA 2LTNA 1VAMA 3H0OA 2YV8A 4YGDA 5DUUA 1SCSA 2D6KA 4TYSA 5GZGA 2D3RA 2NN8A 1R1ZA 1LULA 3V64A 4C1XA 4FP3A 4FPKA 2ZGPA 4XDQA 1S0JA 2OUJA 4FVVA 5JMCA 2EALA 3ZXLA 4P9YA 2AGSA 3LSEA 3T1LA 4XXPA 2GMPA 1LHNA 4JRAA 1SBEA 3MW3A 2CWMA 3FLRA 1DHKB 3O12A 1RINA 2VY0A 1IKPA 1LOFC 1LENA 2UWAA 2ZZJA 3AP9A 3L2YA 4UW5A 4YM1A 2D3SA 2W08A 4M00A 2G4IA 3WZ1A 5GM0A 3R4UA 4YZ2A 4Y1XA 3WDVA 4Y20B 1UL9A 2V5YA 1V6MA 4CZSA 1GZWA 1WCSA 4P9WA 2KM2A 3FUQA 1BZWA 1QOTA 1QOOA 2CYFA 3AP6A 3IPVA 5EYXA 3ZSLA 1LGBA 5SV8A 1WW6A 5JOWA 2GNMA 2WT1A 1TEIA 4Y1YA 3ASIA 4LBMA 1V00A 1G7YA 4BPZA 4FQ4A 2Q5TA 4ASMB 2BQPA 3WHUA 5DZEA 1C4RA 4XMAA 3VKFC 3ZSKA 3GNEA 3FUOA 4PQ9A 1O4YA 5CBLA 1UPSA 4MYEA 1X50A 5HCFA 1LODA 1S0BA 2AH2A 2GALA 1V6KA 2E51A 3CNAA 1DBNA 2GNTA 1WLDA 3TB0A 2D7FA 4LBNA 2ZHNA 1MS9A 2DU0A 3MW2A 2FHRA 1JHNA 4Q1RA 1MS3A 4YW2A 3USUA 3AK0A 5GLUA 1QNWA 1RITA 1Q8OA 1SLBA 3Q9OA 4YW1A 3V0AA 1LEMA 2YMZA 3NV3A 3ATGA 5CA6A 1H9WA 2A71A 5AVAA 3HMYA 3OPZA 2I2SA 1H9PA 2ZMLA 3LCPA 1GICA 1LHOA 5JOZA 2DVFA 1G9CA 1N3OA 5E89A 2GN3A 1N1SA 3R4SA 4FPLA 1W6MA 2E53A 2D6LX 3IM0A 1W6NA 1LOGA 2VW1A 4P9XA 1CESA 5JVVA 5E88A 4YW5A 2DUPA 1HKDA 4Y22B 2ZKNA 3RS6A 4AVTA 3VUOA 2WSVA 1QMJA 1GZCA 2YXSA 3WHTA 3SITA 1KQRA 1ULGA 1JYCA 3PVOA 1LHWA 1MS5A 4LBOA 3OJBA 3FLPA 5CB7A 4Q26A 2ERFA 3AYDA 5GJ6A 2R0FA 1FAYA 1PZ9A 3T2TA 1J1TA 4YG0A 3OBRA 2D6PA 4DPNA 3V65A 4XBLA 1OKQA 1JOJA 2YY1A 4GWMA 1ULEA 1PZ8A 2VXRA 2E7QA 2A5ZA 1AJOA 1LU1A 2ZGTA 1KRIA 4UW6A 4Y26A 3FBYA 3I8TA 3OBTA 5GZFA 3W58A 5GZDA 2R16A 1UKGA 3AZZA 1JXNA 3N7LA 4XHBA 4Y20A 1LOCA 2P3IA 3AX4A 1ONAA 4I30A 4FPYA 5GLZA 2VUAA 3AP4A 3AXEA 5T50A 1WLCA 1A8DA 3PMEA 1G9BA 1Q8QA 1Q8SA 3V0BA 1PZ7A 5T5JA 3PJQA 1Y7BA 2WNEA 1ENSA 1YXWA 1LJ7A 1WD3A 3VKLA 1H30A 3A0NA 4TZDA 1SBFA 4FOYA 1G9DA 3V0AB 4M3CE 1WW7A 1ZA4A 4WVWA 1KDMA 1S0CA 1LGCA 4YLZA 3RMYA 1IOAA 1BQPA 4AGVA 3WLUA 3SH4A 2WJSA 2CTVA 2PHRA 3NV1A 4BMEA 1U0AA 5IT6A 4UW3A 1CJPA 1D2SA 2GN7A 1JBCA 3OGGA 4ISRA 4XTMA 1GV9A 2ZMKA 2P34A 2CY6A 1AVBA 3AXDA 4IQPA 1QDCA 1APNA 1V6NA 4AYUA 3POWA 4F83A 2NM1A 4XXAA 2DV9A 2PHTA 3SISA 3UJQA 4XZPA 2DURA 4YGEA 2DYCA 1GYKA 4XIKA 1ZM1A 1CQ9A 2A6XA 3IN9A 3WNXA 2AUYA 3M2MA 1MS4A 1HQLA 3QLQA 2TEPA 2A6VA 2ZBJA 3SH5A 4XHXA 2D43A 4LBQB 1QKQA 4FOWA 3VKOA 3WG1A 5IK4A 1C1LA 3WCRA 2YROA 4M01A 1FV3A 2EIGA 4LBLA 5JLVA 4WV8A 2YZ4A 4Y22A 1YIFA 4FPCA 5DG2A 1N47A 2DUQA 2CL2A 1YI7A 4WZFA 5DXDA 3ZYRA 2DTWA 1N1TA 4Y1VA 3FFZA 1MS8A 1MACA 3AJZA 1KJRA 2DU1A 3N36A 3WDTA 4ZXKA 4M3CA 4HL0A 3WDWA 3M3CA 2CWSA 1JYIA 4YFZA 3ZXJA 4Z8BA 2WSUA 1LGNA 2ZACA 1G9AA 2ZABA 2A6YA 4R9CA 2E6VA 1JN2P 5DUXA 1LOFA 3WV6A 3B69A 2W68A 3BOPA 1SLLA 2EXJA 3M1HA 3WUDA 2A70A 1UN1A 2UU8A 5L73A 1CONA 3ZPYA 2D3PA 2UWBA 5DUVA 1NLSA 1W0OA 1WW5A 1KJLA 4Q8LA 4XJUA 2OW4A 1DFQA 1LOBA 5HCAA 2E7TA 4RL7A 2GNBA 3NV4A 1B09A 2OUHA 3D4KA 4OZXA 4YW3A 3WDXA 4GWNA 2A6WA 2EAKA 3OYWB 1NXD1 2DVAA 4R9DA 2ZAAA 1BJQA 1GLHA 4FOQA 2GDFA 3N7KA 1IS3A 1GSLA 2HYKA 5FRAA 1HDKA 4R9AA 2JE9A 5H9SA 1ENRA 1MVQA 1Q56A 1FNYA 4FPOB 4CTEA 1UZZA 3VKMA
chains in the Genus database with same CATH superfamily
1H4GA 1VRH2 1O3TA 1ZRFA 2VH9A 2D44A 4YG3A 5A6YA 4XIOA 4LQRA 2MHFA 1CAXA 2ZHKA 4WM7A 3VBFA 3ZSJA 1REFA 2CNAA 2FMYA 3VBSA 1SCRA 2PHLA 2XUMA 5IYYA 4CP2A 3ITQA 2P6CA 5GLTA 3KHBA 2BRTA 3I2IA 4RGGA 5KXBA 1NA1C 4P02B 4JDMA 1W2AX 1WMEA 3CBNA 4IGQA 5IAVA 2ARXA 4ZZ5A 3RYRA 5LRRA 1IPJA 4KWKA 1E57A 2E26A 3HAGA 1NT0A 1PIV1 2VNOA 3RJ2X 2NYYA 3GDBA 3Q8FA 3LFIA 4LO5B 2JDZA 3AMPA 3RSJA 2KA3A 1LTEA 1QHDA 3MYXA 3PVEA 4LOTA 1V70A 2FZ2A 1D4M2 4GJYA 3WDUA 1O6UA 2IUWA 5I0UA 4FFFA 3AYCA 4ASLA 1F2NA 5F37A 2VTFA 3RRDA 3PLQA 1MZ5A 5FREA 2ZEWA 2ZOEB 4FTBA 1JUIA 2WWUA 2VE1A 3O1UA 1WCDJ 4FPEA 1S0EA 4W6YA 5JPNB 4BQ3A 3IZOA 3ZR5A 4EN6B 2D6MA 2UYAA 5EXOA 4DXZA 3POIA 1DQ6A 3GM8A 4NJ4A 5F39A 1WZXA 4LT5A 2JECA 4XUTA 1ASJ1 2ZZQA 4QX2A 4XQ4A 3ZFEB 4AI3A 4IW3A 2FCTA 5IK7A 4JCKA 1PHMA 3U37A 4CPBA 3SKVA 3WCSA 4NWVA 4D94A 5HPOA 1DYKA 2DVBA 3CHXA 3ILNA 2A3WA 4DZGA 1SBDA 1RL3A 1VAVA 1H4HA 3K3OA 1OPOA 4KWUA 1Q8PA 5E8AA 1DZQA 2IXIA 2ZGLA 1X9TA 3KT4A 3I3MA 5I8TA 5FR3A 2ZA9A 1UY0A 3MLLA 2GNDA 4CXYA 3UESA 2VW0A 2EXKA 4HPKA 1A78A 5FZBA 3VBOB 1C3HA 2X53S 1RUD1 5LRSA 4GMP3 3ILRA 4YGCA 3I3DA 4K20A 5EP9A 1V6LA 1RUOA 1QJU2 1VBC2 3MEPA 1TZOA 3BODA 2JDUA 2VM9A 2VZ3A 3IAQA 1AHSA 1OF3A 5A3OA 2W1QA 1PO21 4IGPA 2XPJA 3VKNA 3ZXAC 3NNGA 4OHXA 3RZZA 3ZM8A 5F5QA 5LK7B 1RVF3 2AACA 1NA1B 4CU6A 5EZWA 4HFSA 4F8AA 1WCUA 5J37A 1MQTC 1RUC1 1LOAA 5FO7B 4E4SA 1RIRA 3VL9A 4D6SA 5FPUA 1QJX2 4PQQA 4ZS3A 4UBGA 2EIEA 2RS11 4HXCA 3I2FA 1UMZA 2VQ0A 1TE1B 4D7YA 1T6BX 1P8JA 1YFYA 3AC0A 5A6XA 1BMV1 2WAOA 4QX1A 5FYTA 3HNYM 4QM8A 1RUE1 1A3KA 4OULA 4YARA 2XH6A 5B4NA 3E6BA 5EPAA 1ODMA 2Y6JA 5F3CA 4L8QA 4O7XA 1RHI3 5FZGA 1QJZA 1S55A 3GHMA 2MEV1 1ZBE1 1OOPA 3O0XA 4QKDA 4NIHA 3NW4A 1UMIA 1ZRIA 2W39A 1O4TA 1AX2A 3UL2A 5FZCA 5LY2A 1TNFA 1R091 4YZ5A 1FX5A 2DBIA 1BEV1 4Q4W3 5DZFA 1DQ4A 3WP5A 3ZFEA 1YFXA 3GJAA 4MXVA 3AFGA 2YB7A 1XJAA 1COV2 2W52A 1QNYA 5FXWA 1G9FA 5IVVA 2VCAA 3AJYA 4PI2A 2G9ZA 2Y33A 4Y33A 2W9XA 4RSUA 1XBFA 3UT0A 2JD4A 1SZBA 2H0BA 4FPJA 4KU7A 4TWTA 2DWRA 2ETEA 5A32B 2QQMA 2C4XA 1X9PA 4YM2A 1AUYA 1DQ5A 2XG3A 1UU4A 3A22A 3PUIA 4IETA 1S0GA 1ZBA2 3DGTA 5A1FA 3VBOA 2PFWA 3KS7A 4NPLA 5BV6A 3QCWA 4W6XA 1HRI2 4IL7A 2VMGA 4LBQD 3ETQA 3DKQA 2W1UA 3ACGA 1UX7A 2A73B 3WNPA 4JX0A 4CUCA 3A21A 2RHPA 4B7KA 4LBJA 3OF1A 5CIRA 4JGZC 1BVVA 1YRZA 5A6QA 2P6HA 4XILA 4W4ZA 4BHPA 4QGMA 1IGOA 1K12A 4YG6A 1IHMA 3N4MA 4YNIA 3UK9A 2QKDA 1BXHA 1YI9A 2VD7A 5ERLA 5HCBA 3GCWA 4UFKA 4AZZA 1JZ3A 1DGRN 2VMDA 3AP7A 3T2OA 1AYN3 3M70A 2AEYA 1NE4A 1XYNA 3I3QA 5A6ZA 4Q1PA 2BGPA 3Q8CA 1F5FA 4I3PA 1WKYA 4LO6B 3I2HA 1MQTB 3RWNA 2P3JA 2KXLA 2VQTA 4NAMA 1AYM3 2OVUA 4XCAA 1NCQA 4BB3A 1WW4A 1JZ8A 2WZEA 4LUKA 1FMD2 1QXJA 1RMU1 1U5YA 3IPVB 5FMBA 4LLOA 1U5XA 2G9GA 1FPN3 1AXKA 1WD4A 3OOXA 4P5HA 4I0BA 4CDWB 1NE6A 4BXFA 2JDNA 5C70A 4FPGA 4C0HA 4I02A 1LAJA 4XC9A 1YFUA 3TEXA 1W8UA 2UWCA 2A7AA 2ZX3A 2V5DA 3HQRA 1DGLA 5FUPA 5DAXA 1PO13 1EUTA 3OB8A 5FQ0B 4YVSC 4L99A 1R1A3 1YQ6A 4ATEA 4O65A 4V2WA 4LULA 4FQZA 4IE0A 4Y1UA 2ZX0A 3JBG3 3NWKA 4JKKA 4LKFA 2GSYA 1C8M3 5AVPA 4IE6A 4HKOA 2X8KA 3K51A 2HWC3 3H8UA 3FLTA 2VW2A 4IXLA 4LTAA 3ENRA 4CDXC 4CVUA 2VR4A 5HXMA 4AL9A 1GZ9A 2YPJA 2NQYA 3AVRA 1C1FA 3ZXEA 5A3TA 5IVBA 5BNOC 5JSPA 5FYCA 1JOPA 2B5HA 2A3YA 5GLWA 5A7NA 1UIKA 1UWWA 4CP9B 1W6MB 5A32A 5J98B 1H0BA 3RZGA 4COVA 1VPHA 2W46A 2XL7A 2YV8A 3K48A 3VHPA 3OUHA 2D6KA 1HV1A 1GR3A 3HOBA 1CJDA 5GZGA 1VBE1 5IVYA 3TEWA 1TME1 4NIDA 2VNVA 3I7DA 4FP3A 4UBHA 4AVCA 1K42A 2ZGPA 1OQEA 4NHXA 1S0JA 4B1MA 4FVVA 1J3RA 4EWDA 5C3SA 3BVCA 1NX9A 2W92A 3ZPOA 2ORXA 4JGZB 3LSEA 1QIQA 5FAXA 4JRAA 1QJY3 3O12A 1RUF1 3BTXA 4XTPA 1PM4A 1IKPA 1KS4A 1UOFA 2JWPA 2UWAA 2J1SA 2VMCA 3T3YA 2YBPA 2CGNA 2G4IA 2Y60A 4RHV1 4OHYA 1RUH1 2RS52 1RTVA 3OGJA 3ACFA 2WFF3 2XLAA 3KHCA 1MQTA 4QX5A 2C6SA 5F3EA 4CZSA 3UNPA 4OCTA 1WCSA 2ARCA 2R073 4AHWA 3VDAA 4IEUA 4P9WA 1KXGA 2Z69A 3CZUA 1XYOA 4OMDA 5FCCA 1CD3G 1FI2A 5SV5A 3IPVA 4CXWA 3O1SA 3RZJA 5EYXA 4XEZA 3ZSLA 5FJHA 1QQP2 1LGBA 1SHWB 4YYOA 1VP6A 1ZVFA 1WW6A 2TUNA 1H2NA 5BNQA 5JOWA 1QH6A 4F3JA 2GNMA 1PVC1 4DINB 1V00A 1UYZA 4JQRA 1W28A 4OI4A 1AR72 3POBA 4XMAA 3VB9A 5FQ0A 5A1LA 1O4YA 1UPSA 4L97A 1UD1A 3VDDC 5IHRA 1S0BA 3LA2A 5APAA 1V6KA 1UMHA 2JG9C 2E51A 3MBWA 1DBNA 1XNAA 3ZX7A 4AFAA 3OBZA 3DV8A 2D7FA 2YFUA 2ZX4A 4MXWB 1U5IA 4Q1RA 5FYYA 1MS3A 2XDVA 4YW2A 5ACA1 3BU7A 1AR91 3Q9OA 4PHZA 2XQXA 2YMZA 4DNYA 2VNRA 4CDXB 1Z7S3 3NV3A 3BTZA 5CA6A 4LKDA 3VD7A 1PGL1 2A71A 3R0RA 3HMYA 3OPZA 2I2SA 3WQ1A 4D6RA 1O59A 5BNOB 1GICA 1LHOA 2Q8CA 5JOZA 3KF5A 1O8SA 4QX0A 1N3OA 2Z79A 2YUEA 4M0HA 4CP9A 4MG2A 1DLCA 1W6MA 4HSJA 3EYPA 3IM0A 4CCEA 2VZQA 3FHQA 2VQAA 1BK1A 4P9XA 4BIFA 4YW5A 1KEXA 5FZ7A 1O8PA 1PX3A 1VBA1 3VUOA 4A6OA 1TQ5A 3WHTA 1GFF2 2YDEA 5F3GA 4EYUA 4QWNA 4MO3M 4C8DA 1JYCA 1NG0A 3ZLIA 1W2TA 2RJLA 2W1SA 2WZR1 4LBOA 5FKCA 5FLIA 4EQVA 4CDQC 2EVXA 5K4LA 2J1RA 3AYDA 2R0FA 2RDRA 4JGZA 3AB0A 5IVEA 3OBRA 3DXTA 2YGMA 1OKQA 2VC9A 4YWAA 4Q4V3 5J3UA 1PZ8A 3FJSA 3MLKA 2A5ZA 4PF1A 1KRIA 2XLGA 4Y26A 3WQ7A 2R16A 5FOBB 1O3QA 5CKQA 1JXNA 4ET7A 1RVF2 5J96B 4CU8A 1OA2A 2P3IA 2CAUA 3AX4A 4AI0A 1SQ4A 1VRH3 4LNVA 4BE3A 2ZEZA 4AEJA 4UI9L 5C8WA 3JQXA 3AXEA 2VXJA 4NVPA 4CP1A 1A8DA 1Q8QA 2Y38A 3PJQA 5JI7A 3SCHA 5AFBA 1EY2A 1JYWA 1ENSA 1LJ7A 1NQJA 3VKLA 5LA1A 4YW6A 1G9DA 4W6WA 3DYOA 3U07A 1RHI2 2ZTNA 3OEBA 1OURA 3MI8A 4QHOA 4XQWA 5FUNA 3RVHA 4WVWA 3ZN4A 3RMYA 3MUY1 3HEIA 5HV0A 3B94A 3H8OA 1BQPA 1GOFA 4QXHA 2KR2A 2VCBA 3LQCA 3SH4A 4G3YC 4YVSA 5IFTA 4BMEA 1NXMA 4QB6A 4JDNA 1UIJA 3VDDB 1RUD2 5FZ1A 1CJPA 1D2SA 2JG9B 1JBCA 2X09A 1W90A 2HEYF 1UY4A 2ZMKA 4HBNA 2CY6A 1FOD1 1S2EA 2GU9A 4MXWA 4Q4W2 3AXDA 4NE9A 3POWA 1LKNA 3F95A 2C9KA 5FY5A 1HB2A 5EQUA 1TNRA 2ZXQA 4Q4X1 1H1IA 4CDXA 2A6XA 3WNXA 3M2MA 5AC93 4HVRA 4AHZA 1MS4A 4EZ4A 2FBEA 1KFXL 2B46X 4UYBA 5BNOA 1RUG1 1QKQA 5B2GB 3KVBA 4BH9A 1FV3A 2GAUA 3KZ4C 1H8TC 3J26N 3I2JA 5DG2A 2B4KA 2DUQA 1QEXA 3PIGA 2FDHA 4XFHA 2RS12 2Q1FA 1HRV2 1N1TA 3MIBA 3KLSA 4Y1VA 3P1IA 3FFZA 3ZO0B 1BMV2 1MACA 2QDNA 1RUE2 4M3CA 1GOGA 5LA0A 3JCIA 4HL0A 2HWD1 4K6BA 4WBBA 4CDQB 1JYIA 5ANQA 2HBUA 2MEV2 3D8CA 4Z8BA 1LGNA 2WNUC 4R9CA 3LB9A 5FZ6A 1JYTA 2E6VA 4LA3A 5DUXA 4XF9A 4Z82A 3V56A 1W3XA 2RVAA 1SLLA 4LKSA 2XWBB 3JZVA 3KGZA 1UN1A 1QJEA 3VBUC 4OUSA 1AYN2 1CAUB 4DB5A 4Z1VA 5F2SA 4LMFA 4MVTA 1KJLA 4BDVB 2JEMA 4MGQA 4XJUA 2O8QA 1DFQA 3T4VA 2HEWF 4RL7A 1VBC3 4YW3A 4FXGB 5C5TA 4XF0A 2EAKA 2DVAA 1YQ5A 3VBFC 4OFGA 4R9DA 3NL1A 1BJQA 4Z92B 1XC6A 3BCWA 3N7KA 1IS3A 1GSLA 1HDKA 4B4PA 1JZ7A 2QCSB 4WVMB 4NHYA 4CTEA 4BK5A 1UW8A 5FPLA 3HBZA 1LHVA 2WN2A 3H8XA 2OPWA 3PUAA 4FFIA 3NJVA 4F7ZA 3I4IA 4EWAA 1DZRA 1QJX3 3VDDA 4HZFA 2A1XA 2WZPP 3UGFA 3WW3A 2JG9A 1V0AA 2IXKA 4H14A 4ITCA 1AL21 3PUSA 3AMQA 2FMDA 4UFLA 4XJ8A 5K0UA 2ZHMA 3AZYA 4YSFA 4JHTA 3JBG2 1LCLA 4D7SA 3KV6A 2BU9A 1HW5A 3ZXFA 1BBT1 1FNZA 1UXXX 2ZGUA 4XUOA 1JH5A 3AFKA 4TTGA 5F5IA 1Y43B 3LEKA 2FDKA 2HWC2 2K9ZA 4J6GA 1SLAA 1W2NA 4XVHA 3THDA 4PBOA 5I0TA 4XBNA 3KT1A 3IMNA 4DUWA 1CZTA 3LGRA 4BQ1A 2XLFA 2GP5A 1C57A 5CADA 4U36A 2Y8KA 1UPIA 3E97A 5L9RA 1W8OA 1XNCA 1W6PA 2VCMA 3ETPA 3M3QA 1XXNA 5A7WB 2GMEA 1QDOA 3GHNA 3NNMA 4LA2A 1COV3 1V6IA 4GMP0 1WCQA 5EJ3A 3AYEA 5BPXA 1XOYA 2X10A 3N35A 3LDBA 1F31A 3GYDA 1DG6A 4CDQA 4KBBA 4LHLA 2DCYA 4MLOA 5JSRA 1YUDA 4S2FA 4XUNA 4YFWA 4URTA 5K9YA 1R083 2WNUB 2RMU1 4Q0SA 3B00A 4OMCA 3GBGA 4B29A 4BOWA 4FPHA 1QJY2 4LHKA 5CFCC 5LASA 4S2HA 1ZBA3 4Q0PA 3VBUB 1CAUA 2PN5A 4M3CF 2RG4A 5GALA 2A6ZA 2GH8A 3NJXA 1HRI3 1OA3A 1XYPA 2IXHA 3J9SA 3THPA 3N3HA 4NO4A 4K1YA 1BLZA 2YPDA 3MUZ1 2R072 4WVZA 3KV9A 4HETA 4D0QA 1YJLA 3HJRA 3D6EA 2ZGQA 4JVAA 4NOTA 1BHGA 2ET1A 3ZOIA 2I45A 2VMIA 3RWKX 5JZGC 4OI0A 1W6OB 1OHFA 2VZSA 4LHSA 3VBFB 3DYMA 3J7LA 2BGCA 1EYBA 3M8LA 5LZ6A 4QT6A 1X8EA 4R8HA 4WVMA 3NRUA 1CVNA 4AGGA 3FWEA 2NP0A 1WBLA 3O5SA 2Q0AA 4IEYA 3SXWA 1QXRA 2DVGA 3J8F3 3VHNA 1JOBA 5FZ3A 2FD8A 3ILFA 1MR5A 2RDSA 5FP3A 4C0BA 3E6CC 4IEVA 1DQ1A 1TME2 4FBFA 3IWZA 1SACA 1SLCA 5FYUA 3WP4A 3ZKYA 2WDBA 5FTTC 3I2GA 4DY3A 5JOYA 1S0FA 1XRUA 3DKWA 4QB1A 4MGKE 1J3PA 2W1WA 2YYOA 3J7HA 4UT5A 4XZUG 3DUIA 3UJOA 3LPGA 1XU2A 3Q8EA 5DQ0A 1OOPC 3HN1A 3NAPC 2XBO1 2WWJA 4IGOA 4R4ZA 4Q0VA 1ULFA 3WUCA 4RHV2 1CZVA 1RUH2 2BNNA 1JU3A 1W06A 3MV01 1F8VA 2VULA 3ZYPA 3T30A 1H8TA 1A8MA 1CIWA 4DRVA 5A7WA 3VL8A 3OGRA 1MS1A 3O1TA 3U75A 2JIGA 4LIUA 4IV1C 5IVCA 2ES3A 4QDRA 1M4WA 4CYDA 3QACA 5IFPA 1I1EA 4UFIA 3AZVA 5JOXA 3RDIA 4L11A 2VGDA 3OBAA 3POSA 1QF3A 2XGXA 3IAPA 1PVC2 3I3EA 1DDLA 3SLIA 1HXS2 2WNUA 1VALA 2PXJA 3WNOA 4Q4V2 1UAIA 5CFCB 1YYNA 4LLFA 4BJ0A 1FATA 4GALA 1ODNA 2C0ZA 1OBNA 5A7QA 4X6QB 2FDIA 2BW8A 3J7MA 4KH9A 4OHVA 1HLCA 4UW4A 5KXDA 1LESA 5ACA2 3M3EA 3EQEA 1LU2A 4I2OA 1J58A 4EN8B 1W0PA 4GKXA 1MZFA 4MGIE 1W6OA 5DUWA 5JZGB 4AVAA 4ZKTB 3WNNA 3HBKA 1DIWA 5FZDA 2K2SA 5HXVA 4NIAA 3DL3A 3GCXA 1JI6A 5IUQA 1CPNA 5T54A 3BIEA 1X33A 1GP6A 2RS53 1CX1A 3NV2A 1OVSA 1YQ8A 4XJZA 3PNAA 3ZDSA 3POFA 4PF5A 2WO1A 4GXLA 4QAWA 4B7EA 1PK6A 1POQA 4TN7A 1N3QA 2R041 4W65A 3FHAA 1XQNA 1NCQC 4DXRA 2YU1A 4YM0A 1YEWA 1YCIA 4CUGA 1QQP3 3VZKA 4OVEA 2QQLA 5I0RA 4HK9A 4ORFA 1DCSA 4D7TA 2NMOA 5ANNA 1JMUB 2JJ6A 5CFDC 2EXHA 1W8HA 4XFCA 2ZGRA 1DU3D 2FCVA 3GF6A 4CU7A 2V73A 2CV6A 4BYYA 4Y1ZA 2J1AA 1AR73 2UURA 4Z07A 2ADEA 2JICA 1NOVA 1OOPB 3NAPB 4RQPC 1DGRA 5AC92 5HV4A 2XJQA 2OYZA 1Z0HA 2ZGOA 3QH7A 3S30A 1MS0A 3H7JA 4TLGA 2VJXA 4GKYA 1YJKA 4S2DA 4EV0A 4KMQA 4K21A 5FXXA 1HN1A 2P4EA 2WAAA 3B02A 4FT8A 4LHNA 4QQLA 4FOVA 4QQHA 4G9SB 2BUKA 5J7MA 3G7DA 4JC1A 3R4DB 3LEIA 4IV1B 1XSRA 2DTYA 3VZMA 1ZZBA 2Z2SB 5KXEA 2VBBA 1IG0A 5H9PA 1XB9A 3WP3A 3C7HA 2ZMNA 4YPJA 2PYTA 2ZHLA 5LK5A 4DQAA 1W8NA 2RS31 5C7GA 4D3WA 4GA9A 4K8RB 4NN0A 1PMJX 1PIV3 3GJBA 3USSA 5CFCA 4W8JA 4XUPA 1WWYA 5F5CA 3CDZB 4AFMA 1EUUA 3E1F1 1EV11 5FPBA 3MPPG 2X05A 3B3QE 4XE9A 4ES9A 3USUB 3WG4A 2PLV2 5IJRA 5FYIA 3N9NA 1J84A 4AI1A 5C71A 2XJRA 3B7MA 1VLNA 3E5XA 1M06G 3WF1A 4QPWA 4PDWC 1W8ZA 3PU3A 4AFDA 4AW7A 1D0HA 2D6OX 1BK0A 5JZGA 1WA4A 1NUKA 2JX9A 2WUHA 2ZEYA 2WN3A 2WO7A 1RUG2 5E1RA 3FHIB 4INDA 4YGDA 5DUUA 5I93A 2W94A 2C1FA 2V09A 2YC4A 5ISLA 1ASJ3 2NN8A 4XJ9A 2E63A 2G19A 4CEWC 1GNYA 1UQXA 3V64A 3GXUA 4EN9B 3O1OA 5DAWA 2OUJA 5JMCA 1NCQB 4OHWA 1F35A 4M4RA 3D3AA 3EO6A 3LPFA 2HWD2 2FDFA 1SBEA 3MW3A 3FLRA 2IVIB 5CFDB 4UW5A 3LF7A 2ZZJA 4WM8C 2D3SA 3VD4A 5FBJA 2HKXA 3WZ1A 3NKTA 5C3RA 3R4UA 4YZ2A 3CMGA 3NAPA 3WDVA 1GP5A 2AZ5A 1VJ2A 4RQPB 1V6MA 3BTYA 4E27A 4X6RB 3WNKA 4CUAA 4NMIA 2WLPA 1RUD3 1FXZA 4Q29A 2KM2A 4GZ9A 5JR2A 3FUQA 5C3OA 1QOTA 2CYFA 3O1RA 1RUJ1 4MGTA 1W05A 1W9WA 1UYXA 4IV1A 1TEIA 4OLLA 4CCKA 1J83A 5FXVA 5K7PA 5KHGA 4BPZA 1IG3A 3NNLA 1PO23 3AKPA 4AEDC 1I6XA 2VZOA 3W9AA 1DF0A 1LNSA 3ZFFC 1LODA 3D82A 2AH2A 3MO4A 1R082 2HBTA 4XQDA 1RJ8A 1RUC3 2CHHA 3CNAA 2CAVA 3TB0A 2DCTA 3AMMA 4LBNA 4UXAA 3ZSEA 3MW2A 2RS13 3ZN5A 1HRV3 1D7PM 1JYXA 5CG8A 2XJPA 3AK0A 5GLUA 3USUA 1RITA 1Q8OA 4YW1A 1KFUL 2VBPA 3JD72 3VGIA 1LEMA 5F32A 1RUE3 2OX0A 1ACCA 1H9WA 4LXLA 5D21A 3RZMA 1RUI1 4BQ4A 3O14A 4GIQA 2W2IA 4PDWB 5LB6A 3PURA 1GQGA 2MEV3 2QVSB 4B8EA 2BBVA 4MUVA 2DF7A 1W8TA 4M0NA 3VLBB 1FPN1 2E53A 2XQRA 3AL6A 1LOGA 1CESA 3RS6A 4LO4B 2WSVA 1QMJA 4FXKB 5LCWL 1BEV3 4NPRA 2XXZA 4QQPA 4XAEA 5FZHA 3S0MA 3NMBA 5A80A 2P17A 2Z4FA 1ULGA 2QNKA 4CEWB 1OF4A 1UU5A 2BYVE 3S57A 1IZ3A 4GWIA 1R1A1 3J8F2 3OJBA 3FLPA 4MX3A 5FKBA 1K3IA 3TN92 1O3SA 5EHDA 3I2KA 5GJ6A 2CDOA 5FZ4A 4E2QA 1FAYA 3GZEA 1PZ9A 4LK6A 4QXBA 4UFHA 4XDOA 4YG0A 2D6PA 3KF3A 4P00B 1OPMA 4IEQA 1JOJA 5CFDA 1IPKA 4GWMA 4UFJA 4WM8B 1EAH1 1LU1A 2ZGTA 4UW6A 5GZFA 1R64A 3I8TA 3W58A 2RMU2 1I5PA 1STMA 4CUBA 1UKGA 3AZZA 1YIPA 2YFZA 3BOWA 1QJFA 4IDZA 3WD5A 4AK3A 4XHBA 1HJFA 4UWDA 4RQPA 4ONUA 1ONAA 1X36A 3VHRA 4QKBA 5CYYA 3AP4A 3AVSA 2RDQA 3PMEA 5D8AC 1KGYA 3MFAA 1Q8SA 5A33B 2BPA2 1PZ7A 1PGSA 1SPPB 1Y7BA 3ES4A 3ACLA 2BNMA 2WNEA 3ON7A 5BNPC 2B8MA 3A0NA 1OFNA 4AR2A 1ZZ8A 3N9MA 4M3CE 1ZA4A 4AEDB 1UCXA 3DCQA 1KDMA 1S0CA 4PLNA 2BTVC 2Y6GA 3OPWA 2I74A 1IQAA 3I2DA 2WJSA 5FO8B 3ZFFB 3NV1A 3POJA 4UW3A 3A23A 4PIYA 4XTMA 1J3QA 1ST8A 1YLLA 2P34A 4J25A 3PU8A 3I54A 4F83A 2NM1A 2WFF1 2DV9A 2PHTA 3CU7A 4XZPA 3ZFGC 1GYKA 3CF6E 4A42A 1CQ9A 1GQPA 4MZUA 1QH7A 3VZLA 2AUYA 1HJGA 5CEHA 5K8SA 4PDWA 1HQLA 3SKJE 2TEPA 2K0GA 2R32A 3SH5A 1WA6X 2D43A 4LBQB 4XHXA 2WS91 4FOWA 3WG1A 5JIUA 4RGAA 4GB31 2EIGA 2HWB1 2R061 1V9U2 3A7QA 2LM3A 4GH4A 4LBLA 4OYUA 4WV8A 2YZ4A 4HT1T 4XAAA 3H7YA 1H2MA 3ZYRA 5FOJB 2DTWA 3ZR6A 1VBD1 4UOJA 1ZZCA 3KVAA 3AJZA 1KJRA 4CEWA 4NHLA 2VBDA 1W99A 1HX6A 5FZEA 1RYYA 1NKGA 2CWSA 4AFBA 3HT1A 4YFZA 3E5UA 4IEXA 4PLOA 3ZXJA 2A6YA 1UZ0A 4WM8A 2EXJA 2A70A 4HVQA 2VL4A 3K4AA 5FY4A 4JGYC 1WGPA 5L73A 3V0AB 3S5QA 2VPVA 2R30A 3CLPA 4QHZA 1Q5OA 2WINB 1W0OA 4AVBA 4Q8LA 2OZJA 4BQWA 4YVSB 1B09A 1HQNA 1CZSA 4LE3A 1TME3 4FAGA 2OXBA 1JZ4A 3UKTA 5A33A 3RI8A 5D8AB 4A7ZA 1SPPA 2LRPA 4AHXA 5K0UC 1TMF1 5BNPB 4EJRA 5FY9A 1W9FA 4V2VA 4I0WB 4BWOA 2VO5A 2VOKA 4UAPA 1RUF3 2VOTA 4AEDA 5KHIA 4FPOB 4TYSA 5JAXA 1UZZA 5FZLA 5DDJ1 5JMOA 2HEVF 2VVFA 4XUQA 3OY8B 3N7JA 4OUEA 2ATFA 1RUH3 4RHV3 2VQUA 2RJ2A 1E5IA 5A7PA 4GJZA 3ZFFA 3THCA 3W5MA 1GWLA 4HSLA 3RG0A 3WVJA 5LEJA 3RZKA 2VECA 4LBKA 1LB2A 1F15A 2JKXA 4YW4A 1PIV2 4TXWA 4BU2A 2R042 4YZ4A 3UYJA 3T0DA 5C3QA 1C8NA 3VDCA 4A3XA 1N1VA 4Q2FA 1PGW1 1PVC3 2O0OA 4M3CB 4LBQA 5T3NA 1HXS3 4ISQA 4NHKA 3JU9A 2TNFA 2PHXA 2NPIA 1Y9MA 1IS4A 1YQ2A 2ENRA 2JXAA 2TBVA 2W3JA 3LWCA 1DGWA 4GWJA 1DP0A 4QDQA 5A3NA 4P9JA 3AMNA 4XETA 4A7KA 4A44A 2WNVC 5FUIA 1MEC1 2EAAA 1UOJA 5FP7A 4PJYA 1ASJ2 2WKKA 5CU1A 2JE7A 4FO9A 5ACA3 1AR93 5FPAA 1G6NA 2Q8EA 1OQ1A 3KSCA 1D4M1 4Z2WA 1RXGA 2OQ6A 3SNMA 3ZYBA 4BQ2A 3U0ZA 5GZEA 1UZYA 1XSQA 5KHHA 5F6LB 4LKEA 2HWE1 3W21A 4I09A 4Y3OA 4E4ZA 2PTMA 4FP2A 3BYWA 1DLLA 3S7IA 1O4ZA 1L7RA 1VIWB 2JE8A 2OA2A 1LHUA 2R0HA 2UY8A 2ZGKA 3NNFA 4MV2A 5EV7A 4MGZE 4JGYB 1UKRA 5JDBA 2QUOA 3AZWA 1LOEA 5JI9A 1VBA3 2BP6A 1X8MA 2P3KA 4AWDA 2WNOA 4QKNA 1S1AA 3PVNA 4ARYA 1ZX5A 1SLTA 3PUQA 3WDYA 4AQSA 3HNMA 2W87A 4N7IA 4R52A 5D8AA 4AAXA 2WZR3 1JW6A 2XVGA 1MVEA 2J7MA 5T52A 1DQ2A 1DYPA 2B45X 5BNPA 5K0UB 1TVGA 3V0BB 3LEMA 5C4WC 1NY71 2XHKA 1VE0A 4XDPA 1SFYA 4JAAA 5GZCA 2B39A 1PO22 1OFSA 3OY8A 1KITA 5EWSA 4XJWA 1WMFA 1GANA 3WXPA 2NMNA 2C5DA 1F9KA 3AKQA 2VMHA 1F4AA 3W20A 1XPWA 5FY8A 5A3UA 2WT2A 1AR81 1RUC2 2N7GA 1POV1 1ZREA 1W6PB 4KWJA 3U4XA 1LECA 3RPQA 3VBRC 1E5HA 2VMFA 4QPGC 2ARBA 4CEYC 2E7AA 3H1WA 5IK8A 1QJU1 1KS5A 2MNGA 4IV3C 3ZYJB 2RM21 1SG3A 1VMHA 5F9TA 3B01A 1C5IA 1ZBE2 1PVXA 4AI9A 4K1ZA 1H8VA 1OD5A 2EF6A 4CP0A 5IATA 2VU9A 5JPMB 2R49A 2VZ1A 2XVKA 3LOIA 2R1DA 3NVCA 3FMGA 1R092 3INAA 2I07B 2WNVB 3ELNA 5KC6A 2PLV3 1BEV2 2QTWB 1FOD3 2YBKA 4CCCA 4DFSA 3RYPA 3S6PA 1AX1A 1VR3A 1AZDA 2XOMA 5T5PA 2WQZC 1JUHA 5FYHA 2VG9A 4Q4X3 4CCMA 5DMYA 5T5LA 3BPSA 3RNSA 4IEOA 3AM2A 1ENXA 1RUG3 4LO7A 1IKQA 3POYA 5FY1A 2RR11 3O0WA 1KDKA 1UU6A 2PELA 3OD4A 1B35C 1FT9A 4NIGA 1ULDA 4JGYA 5CAZA 3POEA 3C2UA 4Q8KA 3P3NA 4KG0A 1VBB1 2VUJA 2WT0A 2HWF1 1O5LA 1W3VA 1W6QA 2GC0A 2WC2A 2BVVA 4EROA 1CWPA 1PK6C 4ASKA 3W59A 2Y0OA 1UY2A 4BLIA 3PDQA 1CR7A 4XABA 1CN1A 3H42B 4NROA 3TNQA 5KWRA 3BPZA 5EYYA 2HWD3 3T08A 5HBAA 5FLJA 1ZZ9A 1OT5A 2EXIA 1S0DA 2Y6LA 3LFMA 2JIJA 5T5OA 3UETA 3V0BA 1AF9A 2JDYA 3VZJA 2YC2A 3U11A 4BZ4A 1OSGA 1N3PA 5FZ0A 2ZGSA 2VZPA 5IK5A 1EPWA 1XU1A 1YWKA 2QQWA 2Z5WA 4FFHA 3MLJA 2NLRA 4V1PA 4BMBA 1W9TA 1DGWX 1BKZA 4ZU4A 3NSTA 1JODA 4QQ2A 4QX7A 2HLEA 3NQHA 4MGYE 3QBQA 3WG2A 4CDUA 1H8TB 1ZBA1 3U14A 3AZXA 5F1RA 3BIWE 3N9OA 3ZYHA 1E5SA 3HNBM 4Y24A 3TYJA 2FQPA 5FJKA 3IIIA 5LY1A 4R4XA 3VBRB 1HRI1 4R9BA 3RMXA 3SH3A 4BM8A 1RMU2 1DQ0A 3PTRB 4QPGB 1V6OA 3MGUA 4U2AA 4CEYB 4CSWA 4E2GA 3RJRA 4N9HA 4BQXA 4CRQA 1G86A 1AXZA 1Q3EA 1W8FA 2ZX1A 4RGKA 5F6KA 5JWPA 1EAH2 3OSDA 1HQWA 1VRBA 4IV3B 1O5UA 4TLFA 2LUWA 5FPVA 5FXZA 4QQOA 3IDAA 2ZX2A 1SFNA 3MIHA 1W8WA 4Q4Y1 2B7YA 1TG7A 3MIDA 2WQ4A 2ET7A 5FZ9A 2GC2A 3CKHA 1AL23 1HB1A 2WNVA 5FMOL 2IXLA 2ZGNA 3ES1A 3JD73 3CZJA 2D5HA 1QGLA 4XJAA 1AR61 1ZZ6A 4AGRA 2UYBA 1BBT3 2QQKA 1Z78A 2ZGMA 2MPFA 3ZKUA 1FMD1 4HKWA 1LEDA 1T2XA 4XOGA 1RC6A 3C3VA 1BCXA 4DEVA 1MPXA 1QU0A 2CSGA 4ZHNA 1MZ6A 1SDWA 2XJTA 3ZXGA 3I2OA 3WW2A 5H9RA 5FWJA 1B35B 4OI2A 2LALA 3I49A 1RB8G 1ULOA 2XONA 3AKTA 1C5HA 2BFUS 3LEGA 4NRMA 5T55A 5FP4A 3OGSA 1F4HA 3AMHA 3HR9A 4LR4A 5DG1A 2VTXJ 3POGA 1BVP1 2XR4A 4QU2A 5EFUA 2SBAA 1PK6B 3SCFA 3TN93 4QMAA 4LORA 4Z2AA 1REEA 4DS0A 3VBHC 1VBE2 3OTFA 1URXA 4HLTA 4RYDA 4HN1A 3K4DA 4IERA 4D69A 5L19A 5A3WA 5I8YA 2C9AA 5IVFA 2J22A 2V4VA 4EN7B 1W6NB 3SMHA 3UKNA 1JS9A 4AI2A 5JXJA 2F6BA 2PAEA 2RDNA 1QY4A 4K9SA 5LBEA 2RMU3 2IWGB 5C4WA 4BISA 3H0OA 3T0AA 1CIYA 4GB32 4E9KA 5HI0A 1RUF2 4MADA 2UY9A 1OQDA 4KBZA 2BWCA 4NIIA 1XE8A 5GKAC 3IIAA 3M4FA 4C1XA 2PQQA 5CZKA 3JB8A 4FPKA 4K8FA 3CO2A 1VBD2 2WR9A 4XPVA 2QFEA 4XFIA 4N53A 2E32A 2EALA 2VTXA 4JRLA 2Q8OA 3ZXLA 2BOIA 2P3YA 2AGSA 5G04L 3FBMA 3T1LA 2GMPA 1SFPA 3EJKA 3WQ0A 2CWMA 3VBRA 2VY0A 3L2YA 1LOFC 1OH4A 2B9UA 3AP9A 2BZDA 4QPGA 2QQUA 4CEYA 4M00A 1OD3A 1W2OA 1QWRA 1W2UA 2G9FA 4GULA 1NAEA 2X5IC 4IV3A 4J1XA 4Y20B 3MDPA 4XFFA 1YC61 4XF3A 4XF4A 5CG9A 4A2UA 3ABZA 5EIYB 2PAMA 3CJXA 3AP6A 2QQNA 3K2OA 5I0DA 1ULPA 3KD4A 4QGLA 2JD9A 3WSOA 5KBFA 2FDJA 3FZ3A 4LBMA 2Q8DA 4OHZA 4NAOA 1TMF2 4FQ4A 3ECQA 1H1MA 2Q5TA 3WHUA 4ASMB 1ZYBA 4RFT0 5DZEA 3LDKA 3VKFC 1RGSA 3GNEA 1AR92 1XNTA 3NJYA 3ZSKA 5FBZA 2VZTA 2W95A 3AKRA 1QQP1 3WX5A 4MYEA 5HCFA 1PGL2 1NCRC 2GALA 1V9U3 4IEWA 4LOSA 3K3NA 4NRPA 2BGOA 2DU0A 1B35A 1AR71 1JHNA 3JXSA 4BCUA 1QNWA 3J4UH 1UY3A 4LUMA 5F2WA 3Q8BA 1VBA2 5AFEA 4IEPA 4LPLA 2XUEA 2WFPA 4BQ5A 4DOUA 4H3WA 2W0XA 2ZMLA 3LCPA 3VBHB 1G9CA 2GN3A 3R4SA 2BBAA 2WZR2 2D6LX 1PGW2 1W6NA 2D40A 1A34A 5JVVA 5E88A 2DUPA 3BU0A 1HKDA 5FZIA 1HIXA 2ZKNA 3HQXA 4B4QA 1GZCA 2YXSA 4FI9A 5BUVA 4L92A 4FCAA 4I3GA 2Y6FA 3PJYA 1ZA7A 1U5ZA 2V72A 1KQRA 3KMHA 4K40A 1YNAA 3PVOA 1LHWA 4OQ9A 4OZOA 1MEC2 3K75B 4H7MA 2V4AA 3H50A 5CB7A 4MOAA 4Q0QA 5LW9A 1XNDA 4PIZA 4M4PA 4P08A 5G05L 5F8PA 4NPMA 5FZAA 3RFRA 3T2TA 3ZYIB 4BK4A 4AI8A 3V65A 4XBLA 4DPNA 4Y4YA 5A7OA 1ULEA 5JUVA 2E7QA 2QZ3A 4ZZ8A 1AJOA 5FFOC 5J36A 3PVBB 3FBYA 3GZAA 3B5LB 3IDCB 3OBTA 4GMP1 4A7YA 4NR1A 4LIVA 2HWE2 1JU4A 2XL9A 2W47A 3N7LA 5DABA 4Y20A 2XJSA 1K5MC 1LOCA 2Q30A 2X5IB 4K7JA 2ZJCA 4I30A 5E16A 4P9GA 3FN9A 4QB2A 4X8PA 4C90A 5F5AA 4ES8A 2VUAA 3ZMOA 5A3LA 1WLCA 2VUCA 1G9BA 2Q1MA 2H0VA 4P5YA 2R043 5BXXA 4A4AA 3BI3A 2OKXA 3WQBA 1RVF1 4OQ8A 2YGLA 2BDRA 4GD4A 1PMHX 5A3PA 1JYVA 4FOYA 1PX4A 1DYOA 3KQ4B 5LATA 2FDGA 5A3MA 4RS5C 1FOD2 1WW7A 5J09A 1NQDA 3VN4A 3ZDVA 1REDA 1LGCA 4YLZA 4D6QA 1IOAA 4BA6A 1NY72 3WLUA 2QE3A 4Q4X2 5J48A 4O9EA 2CTVA 4RR3A 2PHRA 3UGHA 1NCRB 5IT6A 2EIBA 3WF0A 3OGGA 2GN7A 4PIXA 1GV9A 4GH4C 1OLMA 1RHI1 1AVBA 3P6BA 4MGSA 2C26A 1QDCA 1APNA 2VZUA 3ZYGA 4HK8A 2AEZA 4XXAA 1AR82 4JTOA 3UJQA 4YGEA 3OEAA 3DYPA 5A70A 2PAKA 2DYCA 3WNMA 3IN9A 4PT6A 5I91A 2D98A 2XKOA 3HN3A 3C7EA 3VBHA 1SDDB 4HKLA 4EWEA 5JIAA 4FAHA 3D0JA 2YU2A 4Q4W1 4CCOA 1C1LA 3WCRA 2YROA 4I01A 3F2ZA 1W9SA 3P3PA 1US3A 2RM22 5JXHA 5JLVA 1JZ5A 4FPCA 5C6CA 3KGLA 1N47A 4KGQA 2RS33 3FFQA 1YI7A 4J1WA 5FLHA 2ARAA 3DPRC 5DXDA 4CXXA 1HB4A 2JDAA 3GBWA 3MPBA 4Q0UA 1OC1A 2K46A 2JDMA 1XNBA 3WDTA 1EV13 4O61A 4DIQA 5JCTA 4ZXKA 3U78A 4CU9A 3WDWA 3M3CA 1W39A 3NNJA 5FZFA 3SEPA 4RN5A 2JG8C 4N90A 5L36A 3I97A 1G9AA 4XW3A 2ZABA 1YQCA 1HRV1 1NZIA 3WP6A 3GZUC 1LOFA 4KGGA 2ADDA 3WV6A 1IQDC 1ND2C 2W68A 3BOPA 3KV5A 3M1HA 3H3UA 4CDWC 2UU8A 4WZCA 4EE2A 1CONA 3ZPYA 4QD2A 2D3PA 2X5IA 2UWBA 5DUVA 2HJIA 2RR12 1K5MB 2J1TA 2QQOA 1NLSA 2GP3A 4JKMA 4Y4RA 1WW5A 4XACA 2Y6KA 1HB3A 1LOBA 2OW4A 1VBB2 3MF6A 5HCAA 2E7TA 4YRDA 2GNBA 3NV4A 4HG6B 2OUHA 4OZXA 1XE7A 2HWF2 2XWJB 3FC0A 4W50A 4XF1A 3T0BA 3CEWA 1GWKA 3WDXA 2A6WA 3OYWB 3IDBB 2O14A 3ZXDA 3VD9A 3MIFA 1AYN1 1GLHA 4XFAA 1GU3A 2GDFA 4KQ7A 3U4SA 2D5FA 1AL22 2HYKA 3LA3A 5FRAA 4R9AA 3DN7A 4L9BA 2JE9A 5LBBA 1ENRA 4RS5B 3GGLA 3MICA 5DPNA 1AYM1 5ABJC 2FZ1A 4PBPA 3WR0A 1BBT2 5FMOS 5KHKA 1RJ7A 1ULCA 3HQUA 1ZBE3 2OPKA 1NCRA 4BIOA 1S2KA 2P2KA 4BLJA 3I59B 1GOHA 4GH4B 5JR7B 2WA3A 2DVDA 1ZRCA 1R093 4FTSA 3Q8AA 1GMMA 2XJVA 5C3PA 1RUJ3 2WQ8A 3LKJA 3O0VA 3PHMA 3O1VA 1PO11 5A1AA 3N9LA 1GKBA 3GBFA 4LJHA 2C24A 3WNLA 5FO9B 3LSDA 4XURA 5FY0A 3JBG1 1Y9GA 4LE4A 4C91A 4P9LA 1WLWA 3CJIC 2CDPA 1C8M1 3NJZA 1WBFA 1JHJA 4KWLA 3SHRA 2HWC1 4LEJA 4QDSA 5F3IA 1I5ZA 3WW4A 4Q4Y2 5GLVA 1L3JA 4HN0A 3DPRB 4ZONA 3TOJA 1S0IA 1UY1A 3SQOA 1ZNPA 4YM3A 3EXUA 1NA1A 3WW1A 4A41A 1Y3TA 1KD7A 3GALA 5FPZA 2NZ9A 3WG3A 4COYA 4N9IA 1UOBA 3LIHA 4Y5TA 5DZGA 2VZVA 1AR62 2JG8B 1O3RA 1PM7A 2VOVA 1RUI3 1Q43A 4RD7A 3KCXA 4I0AA 4QU1A 4AEMA 4HVOA 3OPTA 3T09A 4DRRA 3TAYA 1JYNA 3T2QA 2PHWA 1ND2B 4SLIA 4AXOA 2R6QA 2Y0IA 4PLMA 4ATFA 1EPZA 3A0KA 4IE4A 1Q8VA 1K5MA 1UZWA 3A4UA 1N1YA 1PNFA 4YGBA 3EHKA 3IT8A 4PCRA 2PHUA 5F7UA 2DUOA 1QJY1 3W5NA 2IVJA 2WO3A 1X82A 3E6DA 3OYWA 5FYZA 3ROUA 4COUA 2ZKLA 3RQ0A 1L7QA 2RV9A 4B3NA 1RMU3 2F4PA 4QXKA 1IS5A 2B9VA 1V6JA 4RS5A 4FSJA 2R071 1OUXA 5ABJB 1EAH3 4YZ3A 2Y26A 1BYHA 4E4HA 2CGPA 2LW8A 4UF0B 5L9VA 4A45A 3I59A 5I8SA 4SBVA 2XBO2 1J1LA 4QM9A 1YO8A 2AENA 1CX4A 2IFRA 5LBFA 1POV0 1AX0A 3IKWA 3MW4A 3ACIA 5L7OC 5FP9A 5FY7A 4B1LA 5FYBA 3TEYA 2XVLA 2WL1A 3VD3A 4CCDA 3LIGA 2VAUA 5BNNC 3BUCA 1A6CA 2P37A 4XMIA 3QD6A 1O91A 2BNOA 4DEQA 3LZZA 3TNPB 4COWA 5EJZB 2F4LA 2J1EA 1H6XA 2SLIA 3S7EA 2BWAA 4IESA 1YHFA 3H3ZA 2WA4A 1QOSA 2O1QA 1GWMA 1D0GA 3ZSMA 4JHZA 2WO2A 2JKBA 3CJIB 2BFUL 3T4HB 5BYNA 1LR5A 2B42B 2XKPA 4N8MA 5FZKA 4IE5A 3RI9A 3KT7A 4H2AA 5M0TA 2JB4A 1GZTA 3DPRA 1Z7S1 3ZN6B 3ZFGB 1HV0A 4LO8A 4QPIC 4XFGA 3VZOA 2R1BA 1ZZ7A 1G8WA 3ZVXA 3AYAA 3MF9A 2QQPA 5FIXA 1WUVA 1IS6A 2BEOA 2XJUA 3FL7A 4NWWA 4YVWC 1W9YA 1VBE3 2JG8A 3C7OA 2X29A 2KD7A 4CE8A 5LWBA 2GH2A 2QQVA 4JQTA 5CNAA 3WINE 5CVRA 5HCHA 4E8CA 2WS93 1W0NA 5CKNA 1ND2A 4EZHA 5KC5A 3M3IA 4DUXA 3HIFA 2VVDA 4GB33 4QPYA 3RGBA 2HWB3 2R063 4RFRB 3TBDA 4CDWA 1AL0G 4CCJA 1AXYA 4HOOA 3VDBA 3RZHA 1UO9A 2Y64A 3ZIXA 1HXS1 2YC0A 2Q1ZB 3N7MA 4ZY9A 3H8RA 1ZRDA 2H6BA 1VBD3 3TWIA 3WOGA 4Q5OA 4Q4V1 2J1UA 2QZ2A 4RA0A 3DECA 4YZ1A 1D4VB 1OH3A 2D93A 3VV1A 4AVSA 2BJSA 2F17A 2ZEXA 3K4ZA 4CDUC 5IAXA 2AREA 1ENQA 4KL1A 4AQ2A 3AP5A 1GNHA 1I3HA 2DDUA 3C8XA 2AR6A 4X8NA 4WVVA 1VRH1 3CQOA 2XHNA 5ABJA 3U1XA 3H9AA 3IB3A 1F5JA 2OZ6A 2AC1A 3APBA 3B9CA 3C7FA 4QGNA 4UF0A 5L9BA 3T1MA 1UX6A 3D5OA 2JB8A 4O9GA 4QX8A 4XYXA 4QX3A 2Z42A 3PUHA 3ZXKA 2HH9A 4E4DX 1OXCA 1FYUA 3EB7A 4IE7A 1UOGA 5FYSA 4CCNA 2XB6C 4ZS2A 5L7OB 4ARXA 4N7UA 1GNZA 2LROA 5DN2A 5BNNB 1GBGA 1TMF3 2O8OA 4AEKA 5KXCA 2ORZA 2VUDA 1SMVA 2WBKA 3KB5A 4E2SA 3FX3A 2LS6A 2PHFA 4CA9A 5C9AC 1GZWB 3KWVA 5DDJ3 5DAQA 2Y6HA 1FV2A 3CJIA 2CU5A 5FZOB 2A75A 2ZCWA 2EA7A 3M7AA 3BTAA 2XMLA 3OUIA 5E6HA 2FCUA 2BERA 5FP8A 1E5RA 5H9QA 3ZN6A 1AJKA 2RS32 1OLQA 3ZFGA 2JDPA 4H55A 4QPIB 5J1XA 4AVVA 3PTYA 3BB6A 5AC91 2W91A 2OIIA 3RYKA 2EICA 1W04A 1W6QB 1CPMA 2AYHA 3MV11 1EV12 4FPFA 3KM5A 4Q27A 2WLQA 5CKMA 4YVWB 3BKZA 2WZ8A 1NZCA 3JUUA 1OMIA 5CISA 3MFCA 1GQHA 3M3OA 3S5AA 2JDKA 4AQTA 2A3XA 1SLIA 4GAZA 2WRAA 1ZRRA 2GMMA 2G1MA 2BVBA 5DAPA 4QXCA 2D97A 4HANA 4C1WA 2PMWB 2YBSA 2VVEA 3LDRA 4KNCA 1ND3C 2D6NA 3QOPA 4G4FA 4P14A 3T2PA 4DXTA 5KHJA 3KQRA 4ZPIA 3E5QA 1NYWA 2DCJA 1MEC3 5BY5A 2DFCA 4NRQA 1C28A 3MIEA 1Y4WA 5FK8A 2VNGA 3IBMA 2QQIA 3QH6A 2GZWA 4N53C 3ST7A 1UYPA 3H3LA 4OI1A 4CDUB 4N43C 3R05A 1OA4A 3HPNA 4XBQA 1D4M3 2PLV1 4AE2A 4PI0A 5EJ1B 2LTNA 1VAMA 2HWE3 3J7NA 3JQWA 1SCSA 2DBNA 3PL0A 5C8CC 2D3RA 4FFGA 4MH0E 1VBC1 3O1PA 1R1ZA 1LULA 5D2AA 4AHYA 3DXUA 3GZTB 2OS2A 3D0SA 4MSVA 1U12A 1OLRA 2CGOA 4XDQA 3LOBA 4P9YA 3ME2A 3ORJA 4XXPA 1LHNA 4AAPA 1DHKB 3LA7A 1RINA 4YM1A 2IZWA 5L7OA 1LENA 2VMEA 5BNNA 2W08A 3OD0A 1JZ6A 1RUJ2 4ZXEA 3ALQA 5GM0A 1QJX1 3VD5A 2GC3A 4Y1XA 4JZRA 3R6SA 4EN0A 1UL9A 2V5YA 2QQJA 5FWEA 2RJKA 2OQ7A 1GZWA 3EMRA 1K45A 3WF2A 3MHZA 5C9AB 3WY6A 1S2BA 5C5UA 4OUMA 4QHBA 1H6YA 5FZOA 5C33A 1BZWA 1QOOA 3C7GA 2EIDA 1OI6A 3PIJA 3KV4A 5I0SA 5SV8A 1UNBA 2VOXA 3KCYA 1WCKA 4QPIA 1AR83 2WT1A 3PMSA 1POV3 4Y1YA 1NLRA 2JENA 5KR7A 3ASIA 1G7YA 4COZA 3CIHA 4KU8A 3EBRA 2WYFA 4AG4A 2BQPA 4FTEA 1CAWB 1VAKA 2QDRA 1C4RA 1D2QA 4KI5M 4YVWA 3THTA 4BQYA 4LITA 3FUOA 2DCZA 3KCCA 4PQ9A 2PA7A 3URFA 1VMJA 5CBLA 3ZIWA 1QJU3 1X50A 1US2A 1AYM2 3OG2A 4DY5A 1S4CA 1RUI2 2RM23 2VCCA 4HMZA 4JKLA 2GNTA 1OVPA 1WLDA 1COV1 2JDHA 2ZHNA 4WM7C 1MS9A 5FZ8A 4QKFA 2FHRA 2VOWA 3VBSC 5C4WB 2J1VA 1FPN2 5A7SA 1SLBA 2BV4A 3V0AA 3IMMA 1ND3B 2QJVA 3VZNA 4LK7A 3AL5A 3ATGA 5AVAA 3WF4A 1R081 1X7NA 1O7FA 4MHRA 1H9PA 2DVFA 1PO12 3DEMA 5E89A 1N1SA 4FPLA 2E31A 1GP4A 4N53B 3O1MA 1R1A2 2VW1A 4JV4A 4N43B 4ZU7A 3JD71 4E8DA 3BGAA 4Y22B 4AVTA 2IFWA 3LE0A 3U10A 3SEEA 1C8M2 1VB2A 2RR13 4HONA 3SITA 1JTZX 2R7EB 1W03A 5C8CB 5LA2A 5FYVA 2E9QA 1NLQA 3L2HA 2WIIB 1MS5A 1VBB3 5JSOA 3TEZA 4Q26A 2HWF3 3B93A 2ERFA 3WEZA 1OLME 5FYMA 4B4RA 3SCGA 2ID4A 5DAVA 5FZMA 1RUNA 1J1TA 2BOJA 3H1MA 1T6GC 5FK7A 4AOCA 2YY1A 4AFCA 2H6CA 2E33A 2VXRA 4YW7A 3I3BA 4DUVA 1VMFA 3BN6A 5JXIA 4A6SA 3WT3A 5GZDA 4CPBD 3J8F1 3MZHA 2HYXA 1UF2C 3TN91 1MZEA 3OCPA 5IVJA 3LAGA 2ZPXA 4FPYA 5C9AA 4Y5Z0 5GLZA 4RR3C 5T50A 1CAVB 3DF0A 1J59A 1IPSA 1WMDA 1OKOA 4ZU5A 3HVDA 1K5JA 5T5JA 1PNGA 1RXFA 1YXWA 3CL1A 4A3ZA 4L2NA 3SC7X 1WD3A 5FDBA 5LEKA 1H30A 4TZDA 1Y9QA 1JZ2A 1PMIA 1SBFA 4DXSA 1XNKA 5FMDA 1XE0A 4AQ6A 3H1YA 1L7LA 4URAA 1CAWA 4S2GA 2WFF2 4Y5SA 4AGVA 2IXJA 3LD8A 5LBCA 2Q4SA 3K46A 2DFBA 1U0AA 5FMCA 2VZRA 1LRHA 4DMIA 3UGGA 4ISRA 2J42A 2YHJA 3AKSA 4IEZA 1CAXB 2WS92 4WM7B 3G6JB 3P5BA 4Q4Y3 2GC1A 4IQPA 3VBSB 4AYUA 1V6NA 2W5FA 3K77A 3VHOA 2HWB2 2R062 4GQ7A 4UFMA 1ND3A 3SISA 2DURA 3UKVA 4CCLA 4XIKA 3NKGA 4DO0A 1ZM1A 3IDEA 2PHDA 2DCKA 1HN0A 2IXCA 4TSVA 3HWJA 3QLQA 1H2LA 2A6VA 2ZBJA 2ZS6B 1AR63 3OGVA 1H2KA 2WABA 3BALA 3VKOA 1GUIA 5IK4A 4KG8A 1FMD3 2L9LA 4N43A 4M01A 5LA9A 4JDOA 4D8MA 1UYYA 5JXGA 3OUJA 4Y22A 1YIFA 4BXSV 3HD8B 2CL2A 2ILMA 3B9IA 4NHMA 4WZFA 5IW0A 1I9RA 5C8CA 1CGPA 1MS8A 4H7LA 2DU1A 1OUSA 2IC1A 1WLTA 3N36A 1Z7S2 2P1BA 5IWFA 1V9U1 2P5BA 2QBXA 2WWSA 2WSUA 3L9JT 3ZYFA 3FE5A 2ZACA 5D1IA 1SEFA 2RS51 1JN2P 4MHUA 2Y34A 1UXZA 2YG0A 2ZAHA 3B69A 2PQSA 3TRSB 4JTNA 3UV9A 3WUDA 4L0PA 4META 3ZFEC 3N9PA 4K3UA 1QXPA 4AF9A 1WMXA 3ACHA 4IUGA 4P9IA 4XCBA 3N9QA 3O7OA 5TSWA 2OT7A 3NO8A 5FPXA 2RE9A 2WYSA 4RR3B 1CAVA 1VB4A 5DDJ2 2XBO3 3D4KA 3RZLA 4GWNA 3ZMNA 1NXD1 4XFBA 3WF3A 3X29B 2ZAAA 4FOQA 3JB4C 3HT2A 1H1AA 1UZVA 1ALYA 1DZTA 5FV3A 3VBUA 4HPKB 5H9SA 4NUBA 1MVQA 3VBOC 1Q56A 1FNYA 1EP0A 3MIGA 5B4XA 3VKMA 1YFWA
chains in the Genus database with same CATH topology
1H4GA 1VRH2 1O3TA 1ZRFA 2VH9A 2D44A 4YG3A 4XIOA 2MHFA 1CAXA 2ZHKA 4WM7A 3VBFA 3ZSJA 1REFA 2CNAA 2FMYA 3VBSA 1SCRA 2PHLA 2XUMA 4CP2A 5GLTA 4RGGA 5KXBA 1NA1C 4JDMA 1WMEA 2ARXA 3RYRA 5LRRA 1IPJA 4KWKA 1E57A 3HAGA 1PIV1 2VNOA 3RJ2X 2NYYA 4LO5B 2JDZA 3AMPA 3RSJA 2KA3A 1LTEA 1QHDA 3MYXA 3PVEA 1V70A 2FZ2A 1D4M2 3WDUA 5I0UA 3AYCA 4ASLA 1F2NA 3RRDA 3PLQA 1MZ5A 5FREA 2ZOEB 4FTBA 1JUIA 1WCDJ 4FPEA 1S0EA 4W6YA 5JPNB 4EN6B 2D6MA 2UYAA 5EXOA 4DXZA 1DQ6A 4LT5A 2JECA 1ASJ1 2ZZQA 4XQ4A 3ZFEB 4AI3A 5IK7A 4JCKA 1PHMA 3WCSA 4NWVA 4D94A 1DYKA 2DVBA 3ILNA 4DZGA 2A3WA 1SBDA 1RL3A 1VAVA 1H4HA 1OPOA 1Q8PA 5E8AA 1DZQA 2IXIA 2ZGLA 3KT4A 5I8TA 2ZA9A 3MLLA 2GNDA 2VW0A 2EXKA 4HPKA 1A78A 3VBOB 1C3HA 2X53S 1RUD1 5LRSA 4GMP3 3ILRA 4YGCA 4K20A 1V6LA 1RUOA 1QJU2 1VBC2 3MEPA 3BODA 1AHSA 1PO21 2XPJA 3VKNA 3ZXAC 4OHXA 3RZZA 5LK7B 5F5QA 1RVF3 1NA1B 5EZWA 4HFSA 4F8AA 5J37A 1MQTC 1RUC1 1LOAA 5FO7B 4E4SA 1RIRA 3VL9A 1QJX2 4UBGA 2RS11 4D7YA 1UMZA 2VQ0A 1TE1B 1YFYA 1BMV1 4QM8A 4YARA 1RUE1 1A3KA 4OULA 2XH6A 3E6BA 4L8QA 1RHI3 1QJZA 1S55A 3GHMA 2MEV1 1ZBE1 1OOPA 3O0XA 3NW4A 2W39A 1O4TA 1AX2A 3UL2A 1TNFA 1R091 4YZ5A 1FX5A 1BEV1 4Q4W3 5DZFA 1DQ4A 3WP5A 3ZFEA 1YFXA 4MXVA 3AFGA 1COV2 2W52A 1QNYA 1G9FA 3AJYA 4RSUA 2JD4A 2H0BA 4FPJA 4KU7A 4TWTA 2DWRA 2ETEA 5A32B 4YM2A 1AUYA 1DQ5A 2XG3A 1UU4A 4IETA 1S0GA 1ZBA2 3DGTA 3VBOA 2PFWA 3KS7A 5BV6A 3QCWA 4W6XA 1HRI2 4IL7A 2VMGA 4LBQD 3ETQA 2A73B 2RHPA 4B7KA 4LBJA 3OF1A 5CIRA 4JGZC 1BVVA 1YRZA 4XILA 4BHPA 4QGMA 1IGOA 4YG6A 1IHMA 3N4MA 4YNIA 3UK9A 2QKDA 1BXHA 1YI9A 5HCBA 1DGRN 3AP7A 1AYN3 3M70A 1NE4A 1XYNA 4Q1PA 1F5FA 4I3PA 4LO6B 3RWNA 1MQTB 2P3JA 2KXLA 1AYM3 2OVUA 1NCQA 1WW4A 4LUKA 1FMD2 1QXJA 1RMU1 1U5YA 3IPVB 4LLOA 1U5XA 2G9GA 1FPN3 1AXKA 1WD4A 4P5HA 4I0BA 4CDWB 1NE6A 4FPGA 4C0HA 4I02A 1YFUA 2UWCA 2A7AA 2ZX3A 1DGLA 1PO13 5FQ0B 4YVSC 4L99A 1R1A3 4ATEA 4LULA 4FQZA 4Y1UA 2ZX0A 3JBG3 3NWKA 2GSYA 1C8M3 5AVPA 4HKOA 2X8KA 3K51A 2HWC3 3H8UA 3FLTA 2VW2A 4IXLA 4LTAA 3ENRA 4CDXC 5BYNA 1GZ9A 2YPJA 2NQYA 3ZXEA 1C1FA 5JSPA 5BNOC 2B5HA 2A3YA 5GLWA 1UIKA 5A32A 1W6MB 5J98B 1H0BA 4COVA 2XL7A 2YV8A 3K48A 3VHPA 2D6KA 1HV1A 1GR3A 5GZGA 1CJDA 1VBE1 1TME1 3I7DA 4FP3A 4UBHA 4AVCA 2ZGPA 1OQEA 1S0JA 4FVVA 1J3RA 4EWDA 4JGZB 3LSEA 5FAXA 4JRAA 1QJY3 3O12A 1RUF1 4XTPA 1IKPA 1KS4A 2UWAA 2CGNA 2G4IA 4OHYA 4RHV1 1RUH1 2RS52 1RTVA 3OGJA 2WFF3 2XLAA 1MQTA 4QX5A 4CZSA 1WCSA 2R073 4AHWA 4IEUA 4P9WA 1KXGA 2Z69A 5FCCA 1XYOA 5SV5A 1CD3G 1FI2A 3IPVA 5EYXA 4XEZA 3ZSLA 1QQP2 1LGBA 4YYOA 1VP6A 1ZVFA 1WW6A 2TUNA 1H2NA 5BNQA 5JOWA 1QH6A 4F3JA 2GNMA 1PVC1 4DINB 1V00A 4JQRA 4OI4A 1AR72 4XMAA 5FQ0A 1O4YA 1UPSA 4L97A 1UD1A 3VDDC 1S0BA 3LA2A 1V6KA 3ZX7A 2JG9C 2E51A 1DBNA 4AFAA 3DV8A 2D7FA 2ZX4A 4MXWB 1U5IA 4Q1RA 1MS3A 5ACA1 4YW2A 3BU7A 1AR91 3Q9OA 2YMZA 4DNYA 2VNRA 4CDXB 1Z7S3 3NV3A 1PGL1 5CA6A 2A71A 3R0RA 3HMYA 3OPZA 2I2SA 3WQ1A 5BNOB 1GICA 1LHOA 5JOZA 1N3OA 2Z79A 2YUEA 4M0HA 1W6MA 4HSJA 3IM0A 2VQAA 1BK1A 4P9XA 4BIFA 4YW5A 1VBA1 3VUOA 1TQ5A 3WHTA 1GFF2 2YDEA 1JYCA 1NG0A 2WZR1 2RJLA 4LBOA 5FLIA 4CDQC 2EVXA 3AYDA 2R0FA 4JGZA 3AB0A 3OBRA 2YGMA 1OKQA 4Q4V3 5J3UA 1PZ8A 3FJSA 3MLKA 2A5ZA 1KRIA 2XLGA 4Y26A 3WQ7A 2R16A 5FOBB 1O3QA 1JXNA 5J96B 1RVF2 1OA2A 2P3IA 2CAUA 3AX4A 4AI0A 1SQ4A 1VRH3 4LNVA 4BE3A 4AEJA 5C8WA 3JQXA 3AXEA 4NVPA 4CP1A 1A8DA 1Q8QA 2Y38A 3PJQA 5JI7A 3SCHA 5AFBA 1EY2A 1ENSA 1LJ7A 1NQJA 3VKLA 1G9DA 4W6WA 3V0AB 3U07A 1RHI2 2ZTNA 3MI8A 4XQWA 4WVWA 3ZN4A 3RMYA 3B94A 1BQPA 3SH4A 4G3YC 4YVSA 4BMEA 1NXMA 3VDDB 4JDNA 1UIJA 1RUD2 1CJPA 1D2SA 2JG9B 1JBCA 2HEYF 2ZMKA 4HBNA 2CY6A 1FOD1 2GU9A 4MXWA 4Q4W2 3AXDA 3POWA 1LKNA 1TNRA 4Q4X1 1H1IA 4CDXA 2A6XA 3WNXA 3M2MA 5AC93 4HVRA 4AHZA 1MS4A 2FBEA 1KFXL 2B46X 5BNOA 1RUG1 1QKQA 5B2GB 4BH9A 1FV3A 2GAUA 3KZ4C 1H8TC 3J26N 5DG2A 2DUQA 4XFHA 2RS12 1HRV2 1N1TA 3MIBA 3KLSA 4Y1VA 1BMV2 3FFZA 3ZO0B 1MACA 2QDNA 1RUE2 4M3CA 3JCIA 4HL0A 2HWD1 4K6BA 4WBBA 4CDQB 1JYIA 2MEV2 4Z8BA 3D8CA 1LGNA 2WNUC 4R9CA 3LB9A 2E6VA 4LA3A 5DUXA 4XF9A 4Z82A 3V56A 1SLLA 2XWBB 3JZVA 3KGZA 1UN1A 3VBUC 4OUSA 1AYN2 1CAUB 4DB5A 4Z1VA 4MVTA 1KJLA 2JEMA 4XJUA 2O8QA 1DFQA 2HEWF 4RL7A 1VBC3 4YW3A 4FXGB 4XF0A 2EAKA 2DVAA 3VBFC 4OFGA 4R9DA 3NL1A 1BJQA 4Z92B 3BCWA 3N7KA 1IS3A 1GSLA 1HDKA 4B4PA 2QCSB 4WVMB 4CTEA 1UW8A 3HBZA 1LHVA 4F7ZA 3I4IA 4EWAA 1DZRA 1QJX3 3VDDA 4HZFA 2WZPP 3WW3A 2JG9A 2IXKA 4H14A 4ITCA 1AL21 3AMQA 2FMDA 4XJ8A 5K0UA 2ZHMA 3AZYA 4YSFA 3JBG2 1LCLA 4D7SA 1HW5A 3ZXFA 1BBT1 1FNZA 2ZGUA 1JH5A 3AFKA 1Y43B 2HWC2 2K9ZA 4J6GA 1SLAA 4PBOA 5I0TA 4XBNA 3KT1A 3IMNA 3LGRA 4BQ1A 2XLFA 1C57A 5CADA 4U36A 1UPIA 3E97A 1XNCA 1W6PA 3M3QA 1XXNA 2GMEA 1QDOA 3GHNA 4LA2A 1COV3 1V6IA 4GMP0 5EJ3A 3AYEA 5BPXA 3N35A 1F31A 3GYDA 1DG6A 4CDQA 4KBBA 4LHLA 2DCYA 4MLOA 5JSRA 1YUDA 4S2FA 4YFWA 4URTA 5K9YA 1R083 2WNUB 2RMU1 4Q0SA 3B00A 4B29A 3GBGA 4BOWA 4FPHA 1QJY2 4LHKA 5CFCC 4S2HA 1ZBA3 4Q0PA 3VBUB 1CAUA 2PN5A 4M3CF 5GALA 2A6ZA 2GH8A 1HRI3 1OA3A 1XYPA 2IXHA 3J9SA 3THPA 3N3HA 4NO4A 4K1YA 4WVZA 2R072 4HETA 1YJLA 3D6EA 2ZGQA 4JVAA 4NOTA 2ET1A 2I45A 2VMIA 5JZGC 4OI0A 1W6OB 1OHFA 3VBFB 2BGCA 1EYBA 3M8LA 4QT6A 1X8EA 4R8HA 4WVMA 1CVNA 4AGGA 3FWEA 2NP0A 1WBLA 3O5SA 2Q0AA 4IEYA 3SXWA 1QXRA 2DVGA 3J8F3 3VHNA 3ILFA 1MR5A 4C0BA 3E6CC 4IEVA 1DQ1A 1TME2 4FBFA 3IWZA 1SACA 1SLCA 4DY3A 3WP4A 5FTTC 5JOYA 1S0FA 1XRUA 3DKWA 4MGKE 1J3PA 2YYOA 3UJOA 3DUIA 1XU2A 1OOPC 3HN1A 3NAPC 2XBO1 4R4ZA 4Q0VA 1ULFA 3WUCA 4RHV2 2BNNA 1RUH2 1F8VA 2VULA 3ZYPA 1H8TA 1A8MA 1CIWA 4DRVA 3VL8A 1MS1A 4IV1C 2ES3A 4CYDA 1M4WA 3QACA 1I1EA 3AZVA 5JOXA 3RDIA 4L11A 2VGDA 3POSA 1QF3A 2XGXA 1PVC2 1DDLA 3SLIA 1HXS2 2WNUA 1VALA 4Q4V2 1UAIA 5CFCB 1YYNA 4LLFA 1FATA 4GALA 2C0ZA 4X6QB 2BW8A 4KH9A 4OHVA 1HLCA 4UW4A 5KXDA 1LESA 5ACA2 3M3EA 3EQEA 1LU2A 4I2OA 1J58A 4EN8B 1W0PA 4GKXA 1MZFA 4MGIE 1W6OA 5DUWA 5JZGB 4AVAA 4ZKTB 1DIWA 5HXVA 2K2SA 3DL3A 5IUQA 1CPNA 5T54A 1X33A 2RS53 3NV2A 4XJZA 3PNAA 3ZDSA 4PF5A 4GXLA 4B7EA 1PK6A 1N3QA 2R041 4W65A 1XQNA 1NCQC 4YM0A 1YCIA 1QQP3 3VZKA 4OVEA 5I0RA 4HK9A 4ORFA 4D7TA 2NMOA 2JJ6A 5CFDC 2EXHA 4XFCA 2ZGRA 1DU3D 3GF6A 2V73A 2CV6A 4BYYA 4Y1ZA 1AR73 2UURA 4Z07A 2JICA 1NOVA 1OOPB 3NAPB 4RQPC 1DGRA 5AC92 2XJQA 2OYZA 1Z0HA 2ZGOA 3QH7A 3S30A 1MS0A 3H7JA 4GKYA 4EV0A 1YJKA 4S2DA 4K21A 3B02A 4FT8A 4LHNA 4QQLA 4FOVA 4QQHA 4G9SB 2BUKA 5J7MA 3G7DA 4JC1A 3R4DB 4IV1B 2DTYA 3VZMA 1ZZBA 2Z2SB 5KXEA 5H9PA 3WP3A 2ZMNA 2PYTA 2ZHLA 5LK5A 4DQAA 2RS31 4D3WA 4GA9A 4NN0A 1PIV3 3USSA 5CFCA 4AFMA 1EV11 3MPPG 3B3QE 4XE9A 4ES9A 3USUB 3WG4A 2PLV2 4AI1A 2XJRA 3B7MA 1VLNA 3E5XA 1M06G 4PDWC 4AW7A 4AFDA 1D0HA 2D6OX 5JZGA 1WA4A 2JX9A 1RUG2 5E1RA 3FHIB 4INDA 4YGDA 5DUUA 5I93A 2C1FA 2V09A 1ASJ3 2NN8A 2E63A 4CEWC 3V64A 4EN9B 2OUJA 5JMCA 1NCQB 4OHWA 3EO6A 2HWD2 1SBEA 3MW3A 3FLRA 5CFDB 4UW5A 4WM8C 2ZZJA 2D3SA 2HKXA 3WZ1A 3NKTA 3R4UA 4YZ2A 3NAPA 3WDVA 2AZ5A 1VJ2A 4RQPB 1V6MA 4E27A 4X6RB 2WLPA 1RUD3 1FXZA 4Q29A 2KM2A 3FUQA 1QOTA 2CYFA 1RUJ1 4IV1A 1TEIA 4OLLA 5K7PA 5KHGA 4BPZA 4AEDC 1PO23 3AKPA 1I6XA 3W9AA 1DF0A 3ZFFC 1LODA 3D82A 2AH2A 1R082 4XQDA 1RJ8A 1RUC3 3CNAA 2CAVA 3TB0A 2DCTA 3AMMA 4LBNA 4UXAA 3ZSEA 3MW2A 2RS13 3ZN5A 1HRV3 5CG8A 2XJPA 3AK0A 5GLUA 3USUA 1RITA 1Q8OA 4YW1A 1KFUL 3JD72 3VGIA 1LEMA 1RUE3 1H9WA 1RUI1 3O14A 4GIQA 4PDWB 2BBVA 4B8EA 1GQGA 2MEV3 2QVSB 4MUVA 2DF7A 4M0NA 3VLBB 1FPN1 2E53A 1LOGA 1CESA 3RS6A 4LO4B 2WSVA 1QMJA 4FXKB 1BEV3 4NPRA 4QQPA 3S0MA 2P17A 1ULGA 2QNKA 4CEWB 1UU5A 2BYVE 1IZ3A 4MX3A 1R1A1 3J8F2 3OJBA 3FLPA 3TN92 1O3SA 5GJ6A 4E2QA 1FAYA 1PZ9A 4YG0A 2D6PA 1OPMA 4IEQA 1JOJA 5CFDA 1IPKA 4GWMA 4WM8B 1EAH1 1LU1A 2ZGTA 4UW6A 5GZFA 3I8TA 3W58A 2RMU2 1UKGA 3AZZA 1YIPA 3BOWA 3WD5A 4AK3A 4XHBA 4RQPA 4ONUA 1ONAA 1X36A 3VHRA 3AP4A 3PMEA 5D8AC 3MFAA 1Q8SA 5A33B 2BPA2 1PZ7A 1PGSA 1Y7BA 3ES4A 3ACLA