3MW2A

Crystal structure of beta-neurexin 1 with the splice insert 4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
205
structure length
195
Chain Sequence
GSTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Neurexin-1-alpha
publication title Splice Form Dependence of beta-Neurexin/Neuroligin Binding Interactions.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 195
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mw2A00
1OKQA 1JUIA 2WLQA 1SACA 2I2SA 1JW6A 1CPMA 3FUOA 1PZ9A 2NMNA 3AX4A 3B01A 5EYXA 1LENA 4LBOA 3AZXA 5DZFA 4AGVA 3ZYRA 1N1TA 1YYNA 2DURA 5T54A 3ZXEA 4XE9A 1UAIA 1GZWB 1DHKB 1ULDA 1AXYA 2R0FA 3PVEA 4YZ1A 2E6VA 2ZAAA 1DQ1A 1PZ7A 2EIGA 3IM0A 1V00A 3VUOA 1N1SA 3W58A 5H9PA 4YZ5A 3WVJA 3OYWB 3AP5A 1FV2A 1W6QA 4YM3A 4JRAA 1CJPA 3RQ0A 5IK8A 2A6YA 1OQ1A 4HL0A 5JMCA 1W6OB 2VW2A 1CVNA 3PMEA 4FP3A 2GMMA 2OW4A 1N3PA 2EF6A 2P34A 2NYYA 2ZGQA 2ZGUA 3MW2A 5JOZA 2A7AA 1HQWA 1LU1A 3AYAA 4M00A 1LHOA 2ARXA 4FPOB 1UL9A 2GMPA 1WLCA 3WNXA 4FOYA 4ISQA 2ZGOA 1SBFA 4PBPA 2D3SA 4XJ9A 1G86A 1AF9A 3VKLA 1KQRA 2AR6A 3VKNA 1G9CA 1V6KA 4LBKA 1ONAA 1AX2A 3A0NA 3IN9A 3NWKA 2DYCA 4AYUA 1Q56A 4ATFA 1QOTA 2JE7A 5GALA 3NV1A 3RSJA 4FOVA 4AVSA 4YZ2A 1VAVA 3ILRA 5DUVA 2GMEA 4XHXA 5GZFA 3WDTA 1HLCA 4U2AA 2FMDA 2LALA 3MPPG 2R0HA 1LEMA 5IT6A 2UWBA 1WUVA 2A3XA 2D6NA 1FATA 4FOQA 2PHTA 1JBCA 5T5OA 1BZWA 1VALA 4FPEA 4DPNA 4F83A 1ULCA 2AGSA 1QU0A 2JKBA 2GDFA 4GWMA 3POWA 4RL7A 5KXEA 1S0BA 3M3QA 4YW3A 4ZKTB 1MS9A 4FPKA 1N3OA 2FHRA 4HANA 2DVFA 4Y24A 5GLTA 3WDUA 2VXRA 2ZA9A 4UW3A 2EXKA 1QDCA 2ES3A 4AWDA 2DU0A 4XXAA 1SCRA 2PHWA 1QNWA 3AYEA 1IKPA 4D69A 2P37A 1B09A 1F31A 1WBFA 1JYIA 5EYYA 3UJQA 2VW1A 1W0PA 2D6LX 4R9DA 1FV3A 1UPSA 1Q8PA 2ZGMA 1LESA 5SV8A 1GZCA 1SLCA 1A8DA 3UJOA 5F5QA 3WG3A 1GSLA 3UL2A 3SISA 3FLRA 3ZYPA 2D6OX 1UZZA 2E7TA 4P14A 1LHNA 4XJWA 1W6NB 1GNHA 4FPJA 3SLIA 2A6VA 4GXLA 5DUXA 4YGDA 2A6WA 3HMYA 2ZGNA 3IPVA 2C9AA 4FPFA 4UW6A 3V65A 1LOEA 1DGLA 1IS6A 1O4YA 2YXSA 3FFZA 4XIOA 2B7YA 4FOWA 1Y7BA 1GBGA 2DVGA 4PBOA 1Q8VA 5AVAA 1F5FA 2WKKA 3SH5A 1MS8A 3PJQA 2VY0A 4NOTA 4XJ8A 1KRIA 1S0JA 2ZGLA 1C1LA 3O12A 4YW1A 2D6KA 2WNEA 3U4XA 2D3RA 4P9XA 1GNZA 1LOGA 4FPLA 4YG0A 1CPNA 1CESA 1MR5A 2EXIA 3QCWA 4PCRA 3N3HA 5T5LA 5DXDA 1IS4A 2A70A 4Y1VA 4FQZA 4BOWA 1JOJA 1MS3A 1Q8QA 4RA0A 4Y1UA 5T5PA 3TAYA 4AVTA 1BQPA 1RITA 1LOFC 4XMAA 1LGCA 3RMYA 2ZHLA 2ZBJA 1URXA 1H9WA 5E8AA 2DU1A 3RG0A 4XYXA 1AXKA 3WZ1A 3R4UA 1HQLA 2ARBA 1S0IA 3AXDA 3GNEA 4FP2A 4M01A 1MVQA 3VKOA 4C1XA 1DQ2A 2E7QA 3SH3A 2DUQA 1SBDA 3AZVA 3HR9A 1A78A 4Q1PA 5HCBA 2EXJA 3QLQA 4AGRA 4Q8KA 2OUJA 5CA6A 3OJBA 3AYCA 3APBA 5GLWA 3INAA 2PHXA 3ZSMA 1DQ0A 1GZWA 2A5ZA 4XIKA 1DIWA 2W08A 1YI7A 2OUHA 2ZMLA 2PELA 4LBLA 3ENRA 2A6ZA 3W59A 1MS0A 1S0GA 4DS0A 4XBNA 1A3KA 4K1YA 5DUUA 2ZMKA 1VAMA 1DLLA 3OGGA 4YG6A 4IQPA 3ZXFA 1G9BA 2W68A 1J1TA 3AFKA 4FQ4A 3BTAA 5T5JA 1LOAA 4YGCA 3ATGA 4LBQB 1DQ5A 1CIWA 2ZGKA 2RHPA 4JC1A 3WDXA 1IS5A 2NMOA 2VU9A 4FPHA 4R9CA 1BYHA 4BM8A 5BYNA 1W6QB 5GLZA 1YRZA 4UW4A 4DRVA 3M3EA 1GZ9A 3A4UA 3O0XA 1H30A 1WD3A 2EAKA 3MEPA 2P3KA 2NP0A 1DYKA 3R05A 3V0BB 2JECA 1WBLA 2GN3A 1D0HA 3AP6A 3BOPA 3KQRA 3B00A 4M3CA 3WG4A 2Z42A 2DUPA 4BLJA 2R16A 2D7FA 1ENQA 2GNDA 2ZZJA 3M1HA 3POSA 4OZXA 4R9BA 4DRRA 1WW4A 3N35A 1WLWA 5HCFA 1LCLA 1WW5A 3FLTA 3N7MA 1DZQA 1OFSA 2JE9A 1MZ5A 3OPZA 5GJ6A 5JDBA 1WD4A 1G7YA 4CRQA 1IS3A 1LODA 4XXPA 4YW5A 1LHUA 2PHRA 4XOGA 1SLLA 3NV2A 1SBEA 1ZM1A 2PHUA 3N7KA 4GA9A 2AREA 3SH4A 5E89A 2P2KA 1Z0HA 5GM0A 4Y20B 2P3JA 1V6IA 2YMZA 3A0KA 2R1BA 3B3QE 4YGBA 3WV6A 3ZSLA 3N36A 1BXHA 2EXHA 1W6PB 4LBJA 1LHWA 1AZDA 1JN2P 3AP4A 3B9CA 1AJOA 4FPCA 5DG1A 4LBMA 4Q27A 2A3WA 5LK5A 2AENA 2DVDA 2PHFA 3ZSKA 1U0AA 4P9YA 3IMNA 4JCKA 1G8WA 1WCSA 4K20A 2BQPA 3C2UA 1YIFA 2YV8A 4R9AA 5KXDA 1VIWB 1AVBA 2WSVA 5GLUA 2DTYA 4UW5A 3FUQA 1CN1A 4ISRA 2E53A 2ENRA 3AJYA 1GLHA 1KDMA 3V0AB 1LOFA 3WHUA 3ZXKA 2GNMA 1BKZA 1UZYA 3PVNA 4Q26A 3WDYA 3T1MA 5JOYA 2YZ4A 5IUQA 1GYKA 3OY8A 5L73A 4M3CE 2VH9A 5JOXA 1ULGA 4C1WA 5KXBA 4YM2A 4WVWA 1V6OA 1IKQA 3HN1A 4Y22A 3V64A 1LOBA 1ULFA 3AZWA 3M3CA 5CBLA 4ITCA 5GZGA 1C4RA 4XTMA 3ZPYA 2V5YA 1HKDA 1V6NA 2W39A 1C1FA 1S0FA 2CWMA 2R1DA 3IKWA 1WW6A 1FYUA 4Z8BA 3USUB 5IK5A 3NV4A 4XTPA 3CNAA 1RIRA 3ZXLA 4BPZA 1QNYA 4XZPA 4AGGA 2D6MA 2DUOA 2D44A 3LSEA 1KITA 2DWRA 1WW7A 3BIWE 1XQNA 2H0BA 2WT1A 2TEPA 1N47A 4GKYA 2OVUA 1V6LA 3AXEA 2UWAA 2ZMNA 1VLNA 1Z78A 3DUIA 3WG2A 1LJ7A 1V6MA 1W6MB 2UWCA 2ZHMA 3AZYA 3L2YA 4XJUA 1YO8A 1NLSA 4K21A 4YFZA 2SBAA 1X50A 1MS5A 2NN8A 4WV8A 1PZ8A 1G9DA 1N3QA 1QOSA 2G4IA 4Y1ZA 1LECA 2ERFA 1S1AA 3KM5A 1I3HA 2W52A 1MS4A 2KM2A 1KDKA 5F9TA 5T50A 1FNYA 1QF3A 1F9KA 4YW2A 1UN1A 5FREA 3OBRA 4LBQD 5DG2A 1I1EA 1APNA 4BMBA 5CB7A 3D5OA 5FRAA 1MVEA 1SFYA 1LGBA 1CONA 2JJ6A 4YGEA 3Q9OA 4M3CF 2C5DA 1V6JA 1SLBA 4XBQA 3OYWA 3AP9A 1ZA4A 4XDQA 3ASIA 3B69A 1FNZA 1Q8OA 1QGLA 4W65A 1D2SA 5T55A 3ILFA 3R4SA 5EWSA 2Q5TA 3D6EA 1W6OA 1EPWA 2D6PA 1WLDA 2CY6A 2XB6C 4FPGA 4LBQA 3N7LA 3RRDA 2SLIA 4U36A 3WHTA 5E88A 3D4KA 4LBNA 2CNAA 2E51A 3FLPA 5GZDA 5JLVA 4Y1XA 4YZ3A 3WDVA 5HCAA 3M3OA 1ENSA 2HYKA 1GANA 2CL2A 5GLVA 2D3PA 1DYPA 2DVAA 1JYCA 3GALA 1HDKA 1LULA 3O0WA 1TEIA 1LOCA 4DQAA 3WOGA 5JOWA 3V0BA 2V73A 1BJQA 4XMIA 3BODA 3AZZA 5EXOA 3OBTA 3I8TA 5IK7A 1G9FA 2WSUA 4GKXA 1C57A 4YM0A 1QDOA 1SLIA 2P3IA 1DQ4A 3RMXA 4YLZA 1LEDA 5JVVA 3WDWA 1YXWA 4YM1A 5H9RA 2ZHNA 2WT0A 3LSDA 4YFWA 3NV3A 4Q1RA 4GALA 1RINA 3WUCA 2ZGRA 4MYEA 1GV9A 2DVBA 4M3CB 1H9PA 1MZ6A 1S0DA 4KBBA 2WJSA 3POYA 4K1ZA 2VUAA 4Y20A 1G9AA 1ULEA 3WCRA 1CR7A 1N1VA 1SCSA 5T52A 4XHBA 1W6PA 2ZGTA 2R49A 3RS6A 3ILNA 4ASMB 4DFSA 5KXCA 1NXD1 1JXNA 2DTWA 3JUUA 3VV1A 1S0CA 3N7JA 4FPYA 5GZEA 4TZDA 3H0OA 5DUWA 1S0EA 2GALA 1W0OA 1AX0A 1LTEA 5CNAA 3SNMA 1UX6A 3WG1A 3ZSJA 1AX1A 4BQ1A 1JHNA 5DZEA 1FAYA 2ZGPA 4BMEA 1FX5A 4I30A 3AK0A 1Q8SA 4YZ4A 4GWNA 4Q8LA 3V0AA 4Y1YA 4CZSA 2DV9A 1W6NA 3PVOA 1GICA 1DQ6A 1DFQA 1SLTA 1UMZA 4PF5A 1AJKA 1CQ9A 4L8QA 2A3YA 3T1LA 2CTVA 3AYDA 5H9SA 1ENRA 4XBLA 1SLAA 2ZGSA 3FBYA 5DZGA 4YW4A 2AYHA 1IOAA 3ZXJA 2GN7A 2VW0A 4Y26A 4H55A 2AUYA 3UK9A 3AJZA 4WZFA 2XG3A 1QOOA 2WT2A 2ZKNA 2JDZA 3MW3A 2ZABA 3USUA 4AVVA 3OY8B 4FVVA 4BLIA 1LGNA 1UKGA 5IK4A 3IPVB 5H9QA 3T2TA 3WCSA 5GZCA 2JD4A 2CYFA 1GKBA 4PQ9A 2AH2A 3AP7A 2A75A 2GNBA 4Y22B 3VKMA 2WQZC 3O0VA 4ATEA 1LU2A 4SLIA 2NM1A 2UURA 2EALA 3TB0A 4XJZA 4WVVA 4XILA 1W6MA 4TYSA 4YG3A 2ZHKA 1KJLA 2NZ9A 4P9WA 4XJAA 3WLUA 2YY1A 1N1YA 1QKQA 3LCPA 2LTNA 3MW4A 2D43A 2GNTA 3M2MA 2A71A 1MS1A 4ZXKA 1O4ZA 3SITA 3WUDA 3ZVXA 1KJRA 1R1ZA 2UU8A 1LHVA 1QMJA 4Q2FA 4CTEA 2CWSA 3JU9A 3O5SA 5CAZA 2A6XA 1AXZA 3DGTA 2YROA 2ZACA 1MACA 4NO4A 3I4IA 1DBNA 3VKFC
chains in the Genus database with same CATH superfamily
1PO11 1OKQA 1W9SA 2FMYA 5F5CA 4BH9A 2XLFA 1U5YA 1OA3A 1PZ9A 3I3BA 3C8XA 1BK0A 3E6BA 3GCWA 4JGZC 3VZMA 4E2QA 4EZHA 2VQAA 4IERA 3ZYRA 1RUH1 1YYNA 4GH4B 4N53C 4AI8A 1IQAA 4OHZA 3I2IA 4CDQA 5FP9A 2WAOA 3WF3A 1BK1A 1DQ1A 2EIGA 1NA1A 3W58A 5H9PA 3WVJA 2J1VA 4EE2A 1JYNA 2L9LA 2GSYA 4BHPA 3FC0A 1RUOA 4HL0A 1OQ1A 2QZ2A 1BEV3 1H2MA 4HMZA 1IHMA 2VW2A 3PMEA 4HN0A 4B7EA 2X5IC 1V9U3 2NYYA 3HWJA 5A3OA 3H8OA 4I0WB 3PURA 5JPMB 1LU1A 3SEPA 5I8TA 2QQKA 4M00A 1E57A 4SBVA 1JZ7A 3LPFA 1KS4A 4FPOB 4AEJA 2VZPA 2GMPA 4FOYA 2WFPA 2ZGOA 4WVZA 4Z82A 1QEXA 4RSUA 1H6XA 2YHJA 1COV3 4V2VA 4Q4Y3 4XJ9A 5G04L 1AF9A 1WWYA 3VKLA 2VMDA 1KQRA 1G9CA 3ON7A 2JIGA 1GP4A 3GF6A 1EUTA 2VVDA 1GOGA 4S2FA 3HQRA 2VL4A 3T08A 4IGPA 1RGSA 2JE7A 2WS91 2OT7A 3QACA 5GALA 3RSJA 5FZ4A 1AYM1 4GH4C 1VAVA 2QCSB 4IDZA 1XSRA 2Z69A 1KEXA 4OZOA 4F7ZA 1EYBA 3S5AA 1FPN1 4MHUA 4EWAA 3M3IA 3QD6A 1LEMA 2Y34A 2UWBA 1WUVA 2A3XA 3VBSC 1CAVB 4NRQA 2PHLA 5A7NA 1R093 3USSA 1I5ZA 3E5UA 2GH8A 2WLPA 4QPWA 2DBNA 2H0VA 1SG3A 4D8MA 4GWMA 2GDFA 1FT9A 4RL7A 4CSWA 5KXEA 4UFHA 2V4VA 4YW3A 4URAA 2LS6A 4ZKTB 4FSJA 1N3OA 2FHRA 3BOWA 2CGPA 3WDUA 5FXXA 1RL3A 1DF0A 1W9FA 2OQ7A 2ET1A 4AWDA 1ALYA 2DU0A 5C7GA 1UOBA 2PHWA 3KVAA 4URTA 4D69A 2P37A 3RPQA 5ACA1 1B09A 2XJSA 4FAHA 2D6LX 1L7RA 5FPVA 1GZCA 5LBCA 1XU1A 3T0DA 2WNUA 4EWDA 3H1MA 5KC5A 3GHMA 3SISA 3FLRA 1XE0A 4GWIA 3DKWA 1LHNA 1YCIA 1W6NB 3P3NA 2BTVC 1V0AA 5ABJC 4FPJA 1GWLA 4WM8A 2WDBA 2Y26A 1AR91 1D2QA 4P9LA 2ZGNA 3IPVA 1XBFA 1ND3A 1ZA7A 2QDRA 3LB9A 3OBZA 3DYMA 4XAAA 3MBWA 3DV8A 2YXSA 2RM22 4BQ2A 1WCQA 1GP6A 1RHI2 1GBGA 1Y7BA 2DVGA 1H8TC 5AFEA 2Z4FA 4EZ4A 2Q4SA 5AVAA 3WF0A 1F5FA 1ZX5A 1HRI1 3GZEA 3KV9A 1CZTA 1MS8A 3MFCA 2W2IA 2VY0A 3S7EA 2FD8A 2C9KA 2XL7A 3LDKA 1NE4A 2Y60A 4YNIA 3VBRC 4NAOA 5A1FA 1QJY3 1KRIA 1A34A 4AFBA 1QWRA 1XB9A 3NJVA 2HWB2 5FUNA 5F39A 2VMFA 4ET7A 4NPLA 1XE7A 3PUSA 3GM8A 3CJIA 4H2AA 2CAVA 3TAYA 1DZRA 1XYNA 1H1MA 5EQUA 2E33A 1RITA 3SQOA 4WBBA 4JGYC 1ZRRA 4AVCA 3WNMA 2DCTA 3JQWA 3JB8A 2RMU2 4XYXA 1AXKA 2HJIA 1BMV1 1W2UA 3T09A 1JZ6A 2PAEA 2UYAA 2ARBA 5G05L 1OD5A 3SKVA 3T0AA 3K75B 1DQ2A 2E7QA 2VTFA 3CF6E 3SH3A 1SBDA 2C26A 1MZEA 4IUGA 4QX7A 2EXJA 5ANNA 2O0OA 3ZN6A 4Q8KA 3ZXAC 2WA3A 2HEWF 4IW3A 3IDAA 2VMEA 2J42A 2PHXA 4I2OA 3LIHA 3I3MA 1GZWA 5JXIA 3ST7A 1R081 4QU1A 2W08A 4BQYA 1YEWA 2A6ZA 4LEJA 3ZFGC 3K4ZA 3LDBA 4HPKB 4AAXA 2Y6KA 1F4AA 1XNBA 2TBVA 3NKGA 1A3KA 3ZXFA 2P3YA 4ZS3A 1DLLA 3OGGA 3TNPB 5A3NA 3AFKA 3WQ0A 3PUIA 2DFBA 1LOAA 5FYVA 3RGBA 3ATGA 1CX4A 5JXJA 3CL1A 4XQWA 4Q0QA 2JB8A 3J7MA 1PX4A 4L9BA 4R9CA 5I8YA 2D93A 2XQXA 1U5IA 1VBA2 5GLZA 1YRZA 2BJSA 1BBT1 2VZVA 5BNOA 1H30A 1WD3A 2RM23 4FI9A 2RDNA 1RHI3 5IFPA 1W2OA 1SDWA 3IBMA 1DYKA 3J26N 3DPRB 3AP6A 1AL21 1Q5OA 3JD72 4M3CA 2VG9A 2Z42A 2P6CA 5I0RA 4TLGA 2D7FA 2ZZJA 1Z7S2 2PLV2 3POSA 4OZXA 5JIAA 1RMU3 3N35A 5HCFA 3HNMA 2F4LA 4FBFA 4HFSA 2JE9A 4X8NA 2IXIA 5JDBA 4XCBA 2IXHA 3ETQA 2G19A 2X29A 2ATFA 1ZZ8A 1LHUA 2ZCWA 3HOBA 4NR1A 1BLZA 4YW5A 3RZJA 2TUNA 1JYWA 3N7KA 5FPXA 2ZJCA 2AREA 4LKEA 2F17A 2P2KA 4JKMA 4P9IA 3FBMA 2W1QA 5CKNA 1V6IA 1J3RA 2R1BA 3ES1A 2QDNA 1JI6A 2FQPA 1BXHA 2RMU3 3OD0A 3OGJA 1W6PB 2Y33A 2ZOEB 3UETA 1BEV1 3AP4A 3POFA 1RUG2 1SQ4A 2A3WA 3RJRA 1L3JA 5J37A 5FYBA 1XNAA 1S2EA 2QQJA 4K20A 2NLRA 4JDNA 4ZZ5A 2QFEA 1YFUA 1DGRA 3ACIA 3ORJA 4QM9A 4I3GA 5J96B 1OBNA 4LUKA 5KXDA 1AVBA 3HBZA 1JUHA 2JDNA 3E6DA 3DPRC 4ISRA 2ZEZA 3EHKA 2ENRA 2BGOA 4COZA 3AJYA 4GIQA 1DGWX 1GLHA 2JG8B 4AQSA 4CCMA 5LASA 4QWNA 3WP3A 2GNMA 1D4M2 3I2OA 3WDYA 4IE4A 2YZ4A 1X36A 1F4HA 4BIFA 4D6SA 1ND2B 3N9OA 5C3SA 5C71A 4QM8A 2VH9A 3I3EA 1XPWA 1ULGA 1HJFA 5FBZA 5FP3A 1CD3G 4IV3B 3A7QA 3NNGA 3V64A 2WYFA 1E5HA 3ZYHA 3M3CA 1VBA3 3VHRA 3BKZA 4Q0VA 4XTMA 3JZVA 2CV6A 3S57A 5FZMA 2B39A 1S0FA 1YQ5A 2R1DA 2QTWB 1JZ2A 1O3TA 2WRAA 1XNDA 3CNAA 2HEYF 3J7LA 3ZXLA 1W90A 4XUQA 4CP1A 5CADA 5CISA 3JD73 4P5YA 3BI3A 4AGGA 4RGAA 5L7OB 5FP7A 5JI7A 2HBUA 2ILMA 1OURA 3K3NA 1Z7S3 3FX3A 3BIWE 4YSFA 1OA4A 2J1TA 3B5LB 2H0BA 2WT1A 4GKYA 4K9SA 1TME2 4N43A 3ZDVA 4IE5A 4AOCA 1AR82 3AXEA 5LCWL 2ZMNA 4QXCA 1VBD1 4QXKA 4DNYA 1TNFA 3W20A 4QPIB 2DCKA 4PDWB 2UWCA 2ZHMA 1YO8A 4MLOA 4UF0B 1NLSA 2JG8C 4AI3A 3MIHA 3AL6A 3PNAA 3ZPOA 1N3QA 2Q1FA 3VL8A 4ES8A 2F4PA 4B29A 1LAJA 2JDMA 1MS4A 2MHFA 1ND2C 2V72A 1EPZA 2VVEA 4RR3B 1RVF3 1DLCA 1F9KA 1XOYA 1PK6A 4YW2A 3ZX7A 1I1EA 3UGGA 2BOIA 2RG4A 5LA2A 4BMBA 1HN1A 2VQ0A 4R52A 2OKXA 3ZYGA 1CAWA 1QXRA 1SFYA 4A44A 2OYZA 4XABA 4YGEA 3VBUB 1C8NA 1AR62 2BWCA 4W50A 2HKXA 3O1MA 1FNZA 1H4GA 2BUKA 1D2SA 5FZFA 3RVHA 4R4ZA 4CPBA 5L7OC 3EBRA 4K3UA 4COVA 4AFDA 4LMFA 1X8EA 1EPWA 4BK4A 3PLQA 1PM4A 1QJY1 4CVUA 1XE8A 4XCAA 2R072 1UZ0A 3GJAA 5FWEA 4C0HA 4UBHA 2EIBA 3DYOA 2SLIA 2K9ZA 3AC0A 3NMBA 4FT8A 4QPIC 3WQ1A 4BYYA 3HD8B 4PDWC 4XURA 5FXVA 4OQ8A 1PIV1 1DYOA 1VRBA 2ZX2A 5JCTA 5C9AB 5JLVA 2FDIA 1PO12 3RYPA 2JXAA 1EP0A 1ENSA 2WR9A 3J8F2 2KA3A 2HYKA 1K5MA 2VMHA 2WNOA 1TE1B 2X53S 3GBGA 4H3WA 3PMSA 5BNNA 5E1RA 3NRUA 4DO0A 3G7DA 1PMHX 2DVAA 1WCDJ 1JYCA 3OSDA 4RR3C 5FZ1A 1RUH2 1UU6A 3VZOA 1HDKA 4RGGA 4AL9A 1LULA 3V0BA 5A7SA 3BODA 3AZZA 2VECA 5IATA 2ZTNA 1PM7A 3I8TA 3WQBA 4B4RA 3ACGA 3RMXA 1TME3 4A6OA 3UGHA 3VBUC 1AR83 3LSDA 4YFWA 4D6QA 3H7YA 5C3PA 4ASLA 3KCYA 1NT0A 4CP9B 1XC6A 3OUHA 1S0DA 4WM7A 2ZX0A 4EN8B 3POYA 2VUAA 3I2FA 2PHDA 1ULEA 5LATA 1SCSA 3AKPA 1O3SA 2ZGTA 2V4AA 5EJZB 4CEWA 4KNCA 2R49A 5FOBB 4BQXA 4XFGA 4JQTA 4QKNA 4E8DA 3GXUA 4Y5TA 1SEFA 2ZX1A 3WNNA 1S0CA 3N7JA 5GZEA 3UV9A 4TZDA 1AX0A 1IZ3A 1LTEA 5CNAA 2VNGA 5CKQA 5K0UB 4DINB 4NN0A 1ZRDA 4NWVA 2WS92 3WG1A 2OPWA 1AYM2 2Y6HA 4N9IA 2MEV1 3MIDA 5DZEA 2ZGPA 3S5QA 4BMEA 1FX5A 1FPN2 1Q8SA 2YPJA 3JCIA 5L9RA 4Q8LA 4YVWB 2D5HA 1J58A 1YWKA 4CZSA 4A42A 2IC1A 4IEPA 4CDXA 2VVFA 3BVCA 1DQ6A 1W8NA 1RMU1 2R073 2VQUA 4BWOA 3ZYJB 3VDCA 4I0BA 1E5IA 4EQVA 2A3YA 3D0JA 3AYDA 5H9SA 3VBFC 1PO13 1SLAA 5GKAC 1IG0A 1IOAA 4Y4YA 3KMHA 1ULPA 2VW0A 3H9AA 3I7DA 1K45A 4O9EA 4QQ2A 3BPZA 4Y26A 2IVIB 2XPJA 3IZOA 2XG3A 2J1RA 2WT2A 4NUBA 2JDZA 4LA2A 1RUH3 3U10A 5I0SA 1CWPA 4BLIA 1UKGA 5JZGB 2E26A 3VBHB 1GKBA 3AP7A 3VD3A 4BZ4A 5ACA2 2WQZC 5FBJA 4JHTA 5K0UC 5LA0A 4HBNA 3RNSA 2GH2A 4ZY9A 4SLIA 3JQXA 1XYPA 1OVPA 2WAAA 4QQOA 4XILA 4AAPA 1X8MA 3OF1A 4TYSA 4YG3A 3RZZA 4XJAA 1XRUA 2ZPXA 4P9WA 1POQA 2YY1A 4YVWC 4B7KA 2XOMA 2D43A 1AR92 3NAPB 3M2MA 3FE5A 3VHNA 3C7HA 5JPNB 1MS1A 2RS32 4LO8A 2XVLA 3H1WA 3MF6A 3SITA 1R1ZA 2UU8A 4B4PA 5F5AA 4CTEA 4RS5B 1OVSA 3JU9A 3O5SA 1HRI2 2A6XA 4XAEA 4ARXA 2YROA 2ZACA 4M4PA 4MXWA 1PVC1 4L97A 3TEXA 1UD1A 3UKTA 4FTEA 3I4IA 2WS93 2BRTA 1AYM3 5A3TA 2RS13 4NHYA 4IGOA 1CPMA 5JZGC 5KHIA 1L7LA 3VBHC 1B35B 4WZCA 3B01A 4OVEA 5CG8A 1FPN3 1I5PA 4Q4V1 3JBG1 2H6BA 2DURA 1O8SA 1W8FA 1UAIA 1ULDA 1DHKB 4PIXA 1CJDA 2R0FA 2YU2A 3POGA 3PVEA 4YZ1A 2ZAAA 2ID4A 2FZ2A 3VUOA 2QQVA 1N1SA 3N9NA 1UX7A 4RFT0 1BMV2 4MGYE 2VZQA 3OPTA 5HXVA 4JRAA 3THPA 3VZJA 1LNSA 3C3VA 5JMCA 1W6OB 3NAPC 4K40A 4KU8A 1N3PA 2EF6A 2P34A 2ZGUA 5FY9A 3BTZA 3P3PA 4JQRA 4AHWA 4M0HA 1W2TA 2WWJA 1ZBE1 2BOJA 4MXVA 5JMOA 3Q8EA 4Q0UA 1R082 4RS5C 4OUEA 1PMIA 2XJPA 5LEKA 1RVF1 5ACA3 1SFPA 3GZTB 3GYDA 1SBFA 3OGSA 4KGQA 5FZ7A 4UFMA 2YYOA 5IVFA 2P4EA 2AR6A 5A33A 1V6KA 1YQCA 5FY4A 1ONAA 1AX2A 5FKCA 4D3WA 3IN9A 1B35C 3CO2A 4RQPB 4PIZA 4FO9A 2PA7A 3RZMA 1QOTA 4A2UA 5E6HA 1STMA 3NV1A 2VCAA 1F2NA 4AVSA 4ORFA 2GZWA 5DUVA 1AR93 1YJKA 2GMEA 2R061 2R30A 3ALQA 3CBNA 4NHMA 1HLCA 3MPPG 4D6RA 1BBT2 2CDPA 1JYVA 3VHPA 1K3IA 3GBFA 5IT6A 2XH6A 4K7JA 4LPLA 1XNCA 1FATA 5FO9B 5DN2A 4S2HA 3W5MA 2VUJA 1VAKA 1VALA 1HRI3 3IIAA 4FPEA 4IEZA 4XDOA 4XVHA 5AC91 1AL22 5FZBA 4YW6A 4OYUA 3BTXA 1UOJA 2AGSA 4PHZA 3TEWA 1H0BA 4FFIA 4E4HA 4EN7B 4IE6A 1E5SA 1W8WA 3HT1A 5CFCC 4NHKA 4P02B 4BXSV 3C7EA 4MX3A 1W3VA 2OIIA 1W2NA 2CSGA 4Y4RA 5FAXA 1MS9A 4CDUB 1SPPA 5GLTA 2DVFA 3BN6A 4Y24A 2N7GA 2H6CA 2W91A 4UW3A 2EXKA 4ARYA 3BTYA 3MICA 4H7MA 2PTMA 4XXAA 5A32A 1SCRA 4IGQA 1QNWA 1NX9A 5HPOA 5JUVA 1IKPA 5FZOA 1UY0A 1F31A 1WBFA 1YIPA 2EIDA 4Y5SA 5EFUA 4L0PA 4OMCA 2VW1A 1W0PA 4Q5OA 1FV3A 1UPSA 1Q8PA 1BVP1 2ZGMA 5A80A 1BEV2 2C24A 2EAAA 1A8DA 2R7EB 3UJOA 1YQ8A 4OLLA 5FYYA 1GSLA 3NQHA 3ZYPA 4NWWA 4P14A 2AACA 2C0ZA 3K3OA 4QX0A 3WX5A 3ZXGA 2YGLA 2OS2A 1GNHA 3SKJE 2XKOA 5DUXA 5FKBA 4YGDA 2BGPA 4J1XA 5FY0A 3OGVA 5T3NA 5JR2A 1R083 5FUPA 4FPFA 3ECQA 1LOEA 1DGLA 1DGWA 2HYXA 4NE9A 3B02A 4V2WA 3LZZA 4N53A 2Q8EA 1Q8VA 3VB9A 1KFUL 1OLRA 2WKKA 2XJRA 3I2KA 3POIA 3IDEA 4CDUC 2BZDA 2QQMA 5FYTA 4TLFA 3BYWA 4AFAA 2BW8A 5BY5A 1HXS1 4N90A 2JWPA 4H7LA 5FZ0A 4LUMA 4W6YA 3U4XA 1W8ZA 4C91A 1GNZA 1HW5A 1OPMA 4X8PA 2X5IA 4YG0A 1CESA 3QCWA 5I8SA 1BBT3 3HIFA 4PCRA 5DAXA 3VDAA 4Y1VA 4FQZA 1WMFA 3AMHA 4AVTA 5BNPB 3OBAA 3TYJA 3LD8A 4XMAA 3RMYA 1OQEA 2ZHLA 3A21A 1AL23 1C8M1 4LO7A 5FK8A 4GD4A 4C0BA 2P6HA 3NNJA 4W6WA 4BJ0A 4BIOA 2X10A 3IAPA 1ULOA 3AXDA 4FP2A 4MADA 4O9GA 5FLIA 5CFDB 2DUQA 4Q1PA 1VBD2 5D8AA 4DXSA 2OUJA 2Y6GA 3OJBA 5GLWA 1OF4A 4GH4A 3LQCA 3ZSMA 1DQ0A 4MHRA 1DIWA 1S4CA 1YJLA 2TNFA 3AFGA 2PELA 1NOVA 4HN1A 4LBLA 5CZKA 5EHDA 5ERLA 3W59A 4AFMA 1DU3D 2E31A 5FZAA 4PJYA 3NW4A 2VCCA 3OTFA 3VBSA 1O91A 5DUUA 4Q0PA 1VAMA 2W92A 4IEXA 4YG6A 4IQPA 3WNLA 2W68A 5T5JA 3BTAA 3UKVA 1UXZA 3MUY1 1VMFA 1J84A 3SMHA 4LBQB 2HWC1 4K6BA 1GQHA 2Q0AA 4QU2A 5DABA 4DB5A 3H8XA 4JC1A 1IS5A 1IG3A 1NA1B 3ZLIA 1O8PA 2VU9A 2Y6LA 5BNPC 1WGPA 1BYHA 5BYNA 1VP6A 3M3OA 2WYSA 3WW3A 1J3QA 1W8TA 2EAKA 4DUVA 1OOPB 5FJKA 2JECA 1QJY2 2GN3A 3KQRA 3OEBA 3LEIA 2BVVA 4PI0A 3WG4A 5CFDC 1OD3A 2VBPA 3EQEA 1ENQA 2C6SA 2RS11 4ONUA 5BPXA 2B4KA 2FDJA 1QJZA 2J22A 1PIV2 3FLTA 3N7MA 4M0NA 5I93A 5CYYA 5GJ6A 3BPSA 3O1RA 2GC0A 1WD4A 2XR4A 5FTTC 5ABJA 1GMMA 1X82A 3POBA 2PHRA 2QE3A 4XOGA 2CGOA 1SLLA 1ZM1A 4IEYA 4GA9A 4Q29A 3GZUC 4MO3M 5E89A 3KCXA 4Y20B 1QHDA 1UOFA 2CHHA 2B42B 3B3QE 4YGBA 3WV6A 3N36A 2EXHA 3B9IA 1W8OA 1H8TA 1JN2P 1NCQB 1OH3A 3K4AA 4R8HA 1UPIA 2J1UA 4I09A 1NAEA 2VOVA 5LK5A 2AENA 2W94A 3K51A 3VBRA 1VBD3 2DVDA 2QQWA 2FZ1A 1HV1A 3LAGA 3R4DB 1A8MA 4JCKA 3NJZA 4P9YA 4YVSB 5FZDA 1WCSA 2MNGA 1PNFA 3C2UA 1YIFA 5DAPA 3HNBM 5KHJA 4P00B 2YV8A 1JZ5A 1OOPC 3W5NA 1PVXA 2WSVA 5GLUA 1NZIA 4UW5A 5B4XA 3WNOA 3TWIA 1WMXA 3LWCA 1OUSA 2WL1A 2VOTA 4DMIA 3LGRA 4JGYA 3PUQA 1BKZA 3HPNA 5A3WA 3LOIA 3PVNA 4Q26A 4META 5F6LB 1EAH1 5IUQA 4XC9A 2C1FA 1GYKA 3A23A 3OY8A 5L73A 2BDRA 2GP3A 2WZPP 4BA6A 5F3CA 4I3PA 1V6OA 1IKQA 2YBPA 5B2GB 3AZWA 1ULFA 5HXMA 4B8EA 2PFWA 2MEV2 2WNUB 3RWKX 3SCFA 4KI5M 4Q4X1 1O4TA 2V5YA 5FO7B 3ZIWA 3IKWA 5EP9A 1WW6A 1FYUA 3VDDA 1NCQC 2OZ6A 3USUB 5IK5A 4XTPA 5KC6A 4QGLA 3K2OA 1W0NA 5K4LA 3ZFGA 2QQIA 2YGMA 3M4FA 2FDKA 4QHBA 1RMU2 3SC7X 2Y64A 3KWVA 4TN7A 2D44A 4YVSC 1ND3B 3E1F1 1WW7A 5FPZA 3QH6A 4QQLA 5IVCA 2XBO3 4CXWA 1JS9A 1XQNA 1PIV3 1N47A 2O1QA 2VNRA 4QX8A 3RI9A 4E2SA 2W95A 1TQ5A 1VLNA 1Z78A 2VBBA 3IWZA 5F8PA 4CP2A 1W6MB 3CDZB 3L2YA 3AZYA 3FJSA 4Q4W1 4YFZA 2SBAA 1X50A 1MS5A 1ZZCA 4HSJA 3OUJA 2G4IA 4Y1ZA 3KM5A 2W52A 4P5HA 4KMQA 4AI2A 2KM2A 1NQDA 2JDHA 2XMLA 1UWWA 5F9TA 4TTGA 2W9XA 4XW3A 2DCJA 5T50A 4XPVA 1QF3A 3CJIB 3HBKA 5B4NA 3E5QA 4LBQD 5FIXA 4HK8A 3WXPA 3ZFFA 2BWAA 2PQSA 2HWD1 2JICA 1V70A 5FRAA 5KBFA 4DY5A 4CUGA 3H50A 2D97A 4AF9A 3Q9OA 3AMPA 3OCPA 1V6JA 4M3CF 3I59B 1POV1 3OYWA 3ASIA 3B69A 1QGLA 4W65A 2XJTA 2WFF1 5T55A 4HPKA 3HVDA 4ASKA 2CDOA 5A1AA 1DP0A 1NYWA 3R4SA 4D7SA 1ND3C 5IAXA 2Q5TA 2ZXQA 2D6PA 2K2SA 3HN3A 3ZN6B 4EWEA 1WLDA 4RD7A 5FMDA 2CY6A 1O59A 3KT4A 1L7QA 2Z5WA 4XETA 4S2GA 3AMQA 3M8LA 1PVC2 3U78A 2WIIB 1C5HA 2CAUA 4DEQA 2E51A 5GZDA 3S30A 4LQRA 3BGAA 4QPYA 4YZ3A 3WDVA 1GR3A 4XF1A 2KD7A 1W9YA 4FXKB 2MEV3 4LKDA 4B3NA 5BV6A 4LITA 1W39A 4L92A 4OI0A 3GDBA 1DYPA 2WO7A 3POJA 3JBG2 4Q4V2 2W1UA 5FQ0B 3RZKA 3GALA 1QQP1 1S2KA 1VMHA 3DPRA 3WOGA 3CJIC 5JOWA 4AEDA 2V73A 1AYN1 4XMIA 4DIQA 5F7UA 3POEA 3JXSA 2NPIA 4GMP1 4QMAA 4GKXA 4YM0A 2YBKA 2ORZA 5BNOB 1LEDA 2VTXJ 5JVVA 5H9RA 5IYYA 2W46A 2ZHNA 3LF7A 1NZCA 2VR4A 5DAVA 5FYCA 1F8VA 3WUCA 2Q30A 3D3AA 5K8SA 2PQQA 4MYEA 1OA2A 1GV9A 4INDA 4XZUG 3VD5A 4M3CB 4RYDA 3WR0A 1X9TA 4HSLA 1G9AA 4K1ZA 1ZBE2 3O1VA 1O5LA 1HB4A 3MGUA 5JAXA 3CQOA 5T52A 3KSCA 1O3RA 4XHBA 1CX1A 1RVF2 1W6PA 1QJU1 2Y8KA 4OHXA 4QXHA 4XACA 5ISLA 4DFSA 5LA1A 3OGRA 1Y9MA 4LOTA 3JUUA 3URFA 2W87A 3S7IA 3ZMNA 5DUWA 1S0EA 4IV1A 1TNRA 4J6GA 3ZO0B 5LEJA 3GCXA 3LFMA 4W4ZA 5FMOS 3ZSJA 3KCCA 4JDOA 4JZRA 5FXZA 2R062 4A4AA 2XL9A 4AG4A 1PNGA 2XVGA 2B5HA 3VHOA 1TZOA 4ZZ8A 2JG8A 1UW8A 2VCMA 3IDBB 3MUZ1 3O14A 4GWNA 4I02A 4Y1YA 1NXMA 3KF5A 4M4RA 5HV0A 1GICA 1UMZA 4W6XA 2UY9A 4E4SA 5AC92 1ND2A 1VBE1 4LR4A 2VOXA 4PF5A 1PVC3 1CQ9A 5L19A 1JZ4A 4GAZA 1TMF1 1E5RA 1ENRA 3FBYA 5DZGA 4YW4A 4LO4B 5APAA 4QDRA 2E9QA 4N7UA 2AYHA 5FXWA 3ME2A 4H55A 3U75A 5F37A 3UK9A 3AJZA 4NHLA 4Q4V3 3WD5A 3JBG3 1RUNA 3MW3A 5FZ8A 4UAPA 2ZABA 4QQPA 4Y33A 3E97A 3KB5A 2JD4A 2CYFA 3ZN5A 4QGNA 2AH2A 3P6BA 5L7OA 2GNBA 4ZXEA 4UFJA 3VKMA 2EIEA 4GJYA 2HWF3 3NKTA 4LTAA 5F3EA 3D82A 4B1LA 1W9TA 2WN3A 3HQUA 3DXUA 2EALA 4JX0A 2RJKA 4LHLA 4PIYA 2PN5A 4QPIA 2YC4A 5FMOL 2ZHKA 4HXCA 4EN0A 3GGLA 1ZZBA 1ZBE3 4IEWA 2VM9A 2HBTA 2A71A 4OI2A 4ZXKA 1RUF3 2Z79A 4N43B 3RYKA 3WP5A 5FOJB 4IV3C 1JH5A 1KJRA 3ZVXA 5JSOA 4JVAA 2FCUA 1QMJA 3G6JB 2PYTA 2CWSA 2RJLA 3HAGA 2BV4A 3B7MA 1QH6A 4NJ4A 4OHWA 4Y3OA 1AXZA 3DGTA 1OKOA 3ZFEB 4IEUA 1MACA 3H7JA 1BHGA 5C5UA 4NIGA 1HXS2 4TSVA 2WBKA 1JUIA 2WLQA 4IESA 2R063 2I2SA 4QHOA 1JW6A 1HRV3 3FUOA 3LEMA 2WZR1 3B94A 5FPAA 5EYXA 3LE0A 2OPKA 1UIJA 3AZXA 4IL7A 1PK6B 5DZFA 4AGVA 3DXTA 1RUI1 3GHNA 4XQ4A 3ROUA 3UKNA 5C8CB 4IEOA 1AXYA 1X9PA 1CAWB 2HLEA 2VUDA 4L99A 3OG2A 5A7WA 4CEYA 2XBO1 4I01A 4CU9A 4UWDA 5AC93 4LT5A 1C8M2 1OI6A 5FJHA 2BBVA 3AP5A 3NJXA 4GWJA 1JZ3A 1FV2A 1NE6A 1W6QA 2WQ4A 5EV7A 5DQ0A 4YM3A 3VD4A 1RUC1 3PUAA 1QJEA 3J9SA 4FP3A 1JU4A 1ZVFA 2GMMA 4TWTA 3MLLA 3SXWA 5JI9A 2RR11 3MW2A 2VNVA 2PXJA 2A7AA 5FYHA 1HQWA 2RS51 5A3MA 3VZNA 2EA7A 3ZFEC 1UOGA 4ISQA 4BK5A 4E9KA 5FCCA 1K5MB 2D3SA 1G86A 3KGZA 3AKRA 5KHGA 4CDWB 1QJX1 2R6QA 3TNQA 3F2ZA 3I2HA 3PVBB 4GQ7A 3BB6A 4FCAA 3A0NA 3GBWA 4OULA 4BQ3A 4AYUA 2HWC2 1Q56A 1YQ6A 1OSGA 5JR7B 1UF2C 1U5XA 5FZGA 4YZ2A 4HG6B 2IXJA 3VBFA 2GC3A 3LA2A 3IT8A 4Y5Z0 2Q8DA 4BISA 5C8CC 1F15A 1YI9A 3FL7A 5GZFA 3WDTA 3MHZA 2RV9A 2VE1A 1ENXA 2FMDA 4U2AA 4CUCA 2W0XA 5FP4A 2WWSA 3WSOA 4OUSA 1UNBA 2HEVF 2ZX4A 3WW1A 5C9AC 2WC2A 4FOQA 3U14A 2P1BA 2PHTA 1D0GA 1JBCA 5T5OA 1M06G 1BZWA 1RJ8A 1NCRA 4BE3A 3PIJA 1GWKA 4XF9A 4YRDA 3CKHA 4WM7B 1R1A1 2WO2A 4DPNA 3TEZA 5FZ9A 4F83A 1ULCA 5FMBA 5K0UA 1QU0A 1Y43B 1HXS3 2RS12 4XEZA 1HN0A 5LRRA 5C6CA 4WVMB 3T0BA 1KGYA 4CEWB 5EIYB 1JZ8A 1GUIA 4FPKA 4HANA 4AVAA 4YARA 2QQNA 3M70A 5LW9A 2VXRA 2XLAA 4MUVA 4X6RB 5LK7B 2UY8A 1QDCA 2ES3A 1KD7A 1VBB1 2ZEYA 3MFAA 4YVWA 1K5MC 2VCBA 2JENA 1LB2A 4CDWC 4O7XA 4QDQA 3AYEA 1T6GC 3PDQA 1UY4A 1YHFA 3UT0A 5A3LA 4MGTA 1C8M3 3AVSA 3UJQA 4QKDA 5SV8A 1LESA 2EVXA 5SV5A 1FMD1 3U1XA 1NQJA 4L11A 2BPA2 1PGW1 4XFFA 4EROA 1W3XA 1XYOA 1UZZA 2D6OX 3I54A 3KVBA 4XJWA 3ZM8A 4CDXB 5IVBA 4KL1A 5JIUA 4KG0A 3LA3A 1NLQA 3SLIA 2PAMA 4XFIA 1WZXA 2A6WA 5IJRA 3ZXDA 4Z2AA 4O61A 4OI4A 5JZGA 3UGFA 1HIXA 2G9ZA 4RFRB 4UW6A 4ZS2A 3V65A 5CIRA 3ZN4A 4WM7C 1O4YA 2BU9A 1HV0A 5IWFA 1H1AA 2XWBB 4XIOA 2B7YA 2D98A 3FWEA 3UESA 4PBOA 1QXJA 2RE9A 3PJQA 4CEWC 2VOKA 4NOTA 1PX3A 1EAH2 3UYJA 2HWC3 1S0JA 1C1LA 4YW1A 2D6KA 4Z1VA 2XKPA 3WF4A 2D3RA 1EY2A 3E6CC 3NAPA 5JXHA 1LOGA 4FPLA 5KWRA 1MR5A 2EXIA 1T2XA 4UI9L 5T5LA 4Q4X2 4PT6A 4RHV1 5FMCA 2A70A 3T3YA 2ZEWA 5FV3A 4BOWA 1JOJA 1MS3A 4LNVA 4RA0A 4Y1UA 1PO21 5T5PA 4AHZA 4DZGA 1RUE1 4RS5A 1LOFC 1CAUA 1FOD1 4OI1A 1DZTA 1H4HA 2ZBJA 1URXA 1JODA 1H9WA 2YU1A 4GULA 1JTZX 3O1OA 2B9UA 3WZ1A 1IGOA 3R4UA 4LIVA 3ZSEA 1HQLA 3K77A 2GAUA 3UNPA 1MVQA 3VKOA 1NUKA 4C1XA 1MEC3 3VGIA 4NPMA 4MGKE 3AZVA 4NRMA 3HR9A 4BU2A 5HCBA 1UMIA 3QLQA 4AGRA 1ASJ1 5CA6A 3RZGA 4LE4A 4QPGB 1UY1A 3NNFA 1GFF2 4Q4W2 4LKSA 1RUD1 2A5ZA 2YG0A 4XIKA 3SCHA 1PHMA 1YI7A 2OUHA 5FZEA 2HWF1 1IPJA 2G1MA 5A6XA 3TOJA 4XBNA 2JB4A 2W1SA 2WUHA 1J1TA 5FYZA 3THDA 2AZ5A 4HLTA 4LLFA 1DQ5A 1CIWA 1HB1A 4K8FA 2P5BA 5CFCA 4QKFA 2HWD2 3IMMA 4XQDA 2X8KA 1OQDA 3WDXA 1TVGA 2IUWA 3U11A 3THTA 5A6YA 1RUF1 4FPHA 3AKQA 5FY8A 1JYTA 2DFCA 4UW4A 4DRVA 5FYSA 3M3EA 1GZ9A 3A4UA 1VBC1 2WFF2 3MEPA 4CCCA 3CZJA 1UZWA 5J36A 2JDKA 3H1YA 1ZZ9A 3ELNA 1RUJ1 3HEIA 3WINE 4CE8A 4J1WA 1NKGA 3B00A 3LA7A 1EAH3 4RGKA 2DUPA 5D1IA 4BLJA 5BUVA 3BIEA 1PGSA 4PQQA 2GNDA 4R9BA 2JKXA 4DRRA 1HRV1 1WW4A 4QPGC 3VDBA 1WLWA 1LCLA 1WW5A 4CCOA 4CU6A 1OFSA 4BQ5A 3WT3A 1HB3A 1MZ5A 1DDLA 4XF4A 1G7YA 2DCYA 4NRPA 1LODA 5DAWA 4CRQA 3NJYA 4Q4X3 4XXPA 4HETA 4O65A 5DAQA 4YYOA 2VBDA 3NV2A 4A3ZA 2PHUA 3SH4A 4COYA 1Z0HA 2VZUA 3S0MA 2P3JA 1QQP2 3OOXA 1Q3EA 4XDPA 5FZLA 5J3UA 1AYN2 5FLHA 4LLOA 2VC9A 4LBJA 1LHWA 4Q0SA 4YW7A 1AZDA 3B9CA 4FPCA 2VGDA 4MVTA 4HZFA 2JG9B 4LBMA 2HH9A 4CDUA 2O8OA 2PHFA 3ZSKA 3AVRA 1G8WA 2X09A 3AKTA 4AEMA 1CAXB 1KFXL 4Q4W3 2BNNA 3FHAA 4NPRA 4R9AA 2GP5A 4Z07A 4RQPC 2DTYA 4D0QA 4C8DA 1MQTB 2JDAA 4HVOA 2E53A 3VLBB 2JD9A 3QBQA 3RDIA 3IDCB 3T2QA 3U37A 4YWAA 1KDMA 4H14A 1QJU2 2FBEA 3V0AB 3GZAA 3TN93 1UZYA 4KWUA 2IXLA 2WNVB 3T1MA 5F5IA 4M3CE 2HWD3 2W3JA 5JOXA 3K46A 4C1WA 2IWGB 5KXBA 4YM2A 3HN1A 5J98B 4Y22A 2YC2A 4JGZA 1LOBA 5CBLA 3BCWA 1POV3 4ITCA 4AQ6A 1C4RA 4NVPA 3O1PA 2WFF3 3RI8A 1V6NA 2W39A 2CWMA 1Y9GA 4IE7A 4FFGA 3NSTA 5J09A 3OB8A 3NV4A 2JG9C 4NIDA 4LHSA 1OH4A 4BPZA 1QNYA 4EN9B 2D6MA 2DUOA 1UCXA 3WW2A 1OFNA 2W47A 4BQ4A 1VBE2 3LSEA 3PU3A 5FP8A 5HBAA 2WZ8A 3BU0A 2B8MA 2LM3A 2WN2A 4DOUA 2TEPA 1TMF2 2OVUA 4K8RB 1WMEA 4PLOA 1ZRFA 1V6LA 3DKQA 1OUXA 3DUIA 3WG2A 4CXYA 1V6MA 1MQTC 4NROA 3CHXA 1HB2A 4HK9A 4ZU4A 3WP4A 5BNPA 4K21A 3MIEA 2XJQA 1CGPA 1MPXA 2NN8A 2CU5A 1QQP3 1QOSA 1ZBA1 5IVVA 1HQNA 5C4WB 2WNVC 3DN7A 1AYN3 2R041 4PI2A 4NIIA 2NQYA 4BQWA 1KDKA 4FFHA 1YFYA 4GMP3 4LJHA 4MH0E 2A73B 4QX1A 4UFKA 1W06A 1UKRA 1FNYA 1U12A 4AW7A 3Q8BA 3EB7A 3VBOB 5CFDA 5DG2A 4TXWA 3DYPA 1UYZA 2EICA 2Q8OA 3D5OA 1JHJA 4MZUA 1MVEA 1YLLA 1VE0A 1CONA 4AZZA 4XDQA 1Q8OA 4LOSA 3J8F1 3AB0A 5EWSA 4HT1T 4JHZA 3QH7A 2XJUA 3EMRA 1QJU3 2VPVA 5D8AB 2G9FA 2X05A 4CDQB 1VPHA 4LBQA 5LY2A 4MGZE 4RN5A 4U36A 2VMCA 4DUXA 3KV5A 5E88A 4LBNA 4KQ7A 1KS5A 2D40A 2VTXA 2WABA 3MIBA 4LE3A 4Y1XA 3VBSB 5A3PA 5L36A 1QH7A 1GANA 5C4WC 1HJGA 2WZR2 1J1LA 5FLJA 2ZX3A 2FDFA 4V1PA 1J3PA 5DMYA 4B4QA 1OC1A 4KWLA 1NY71 1OOPA 1RUI2 5BNQA 3O0WA 4DQAA 1LOCA 1S55A 1BJQA 3Q8CA 3VBOC 3MI8A 2XBO2 1VBE3 3KHBA 3NO8A 3RWNA 1H2KA 1G9FA 2WSUA 1MEC1 1C57A 2J1AA 2LRPA 1SLIA 2P3IA 1DQ4A 1TMF3 4YLZA 3ZMOA 5C8WA 3WDWA 1YXWA 4YM1A 1RUC2 3MO4A 3NV3A 4A41A 4KBZA 1CAVA 2V5DA 1J83A 1LRHA 2HWE3 2Q1ZB 2ZGRA 2DVBA 2RR12 4ZHNA 2XJVA 3ZYIB 5IW0A 1H9PA 3L9JT 3M7AA 2BP6A 2WJSA 4IETA 4KBBA 5D8AC 2RS52 3C7FA 4Y20A 1XJAA 5A6ZA 4CDQC 5FYMA 1J59A 1YC61 2ZZQA 4MOAA 1QXPA 1IPKA 1CZSA 1NA1C 1OPOA 2BGCA 1NCQA 3DL3A 2Y6FA 4CXXA 5ABJB 1VR3A 1VRH1 3ILNA 3RS6A 2AEYA 2PAKA 2C4XA 1NXD1 3PUHA 1QJX2 1O7FA 2D5FA 3ZKUA 1H2LA 3TEYA 4FPYA 3N9MA 2VQTA 4YVSA 3ZXEA 1W0OA 2BNMA 3MF9A 5DDJ1 1UYYA 2JEMA 4UOJA 2XXZA 3SNMA 1UX6A 2Q8CA 1GP5A 1AX1A 3CJXA 3S6PA 1H8TB 2DCZA 2RDQA 4OMDA 4BQ1A 2YC0A 2WO1A 2BFUS 2ARAA 2RDRA 1WLTA 4I30A 4L2NA 1U5ZA 2VZ1A 4YZ4A 5F2SA 1Y9QA 3VBRB 5HCHA 4F3JA 1G6NA 4IE0A 1W6NA 3MDPA 3BU7A 3H3UA 2OQ6A 2QJVA 3T4HB 3WQ7A 1DFQA 5K7PA 1R1A2 1AJKA 4D7YA 2XLGA 4L8QA 1T6BX 3WNKA 3T1LA 2CTVA 4N7IA 1VB4A 3R6SA 4LIUA 4Z2WA 3KD4A 1OF3A 2YFZA 4JGYB 2GN7A 2WZR3 1YFXA 4XUOA 4XUPA 5FYIA 2XHNA 2ZKNA 1QOOA 4WM8B 3WP6A 1VBB2 1AR71 3FMGA 4ZONA 1RUI3 3KZ4C 3OY8B 4FVVA 3USUA 3VZKA 4A7KA 4XFCA 3ACFA 3EJKA 3IPVB 4BCUA 2I74A 2QVSB 2DBIA 3LEKA 2IFRA 2XUMA 4PQ9A 2A75A 3VD9A 3KQ4B 3PU8A 2RS31 3O0VA 4MGIE 4UFLA 2AEZA 1W8UA 1RXGA 4ATEA 1FMD2 5FZKA 3JB4C 3O1UA 1RB8G 1RUC3 1LU2A 2QQUA 4CP0A 4E8CA 5C5TA 4DXTA 3VDDB 1PGW2 4WVVA 5J7MA 1W6MA 2RR13 3ZFGB 1Q43A 2NZ9A 3WLUA 3I2JA 4LHNA 1QKQA 3LCPA 2RS53 2LTNA 3MW4A 2VMIA 2DDUA 3K4DA 2BFUL 2KR2A 5HV4A 2IVJA 3N9LA 5I0UA 1O6UA 5AFBA 2VNOA 4NIAA 4CCKA 4KU7A 3TN91 3LIGA 5F3IA 4QX3A 3WUDA 5LBFA 1LHVA 1I9RA 2WO3A 4Q2FA 2O14A 1UMHA 2WNUC 1QJX3 5EJ3A 5CAZA 3FN9A 3CEWA 5FZ3A 3LFIA 2IZWA 4G4FA 2XUEA 4NO4A 2Y6JA 4WM8C 3VKFC 1YFWA 3I59A 5FZ6A 1SACA 2BNOA 4OUMA 3J7HA 3T2OA 2QZ3A 3X29B 4GZ9A 4FAGA 1Y4WA 2NMNA 3AX4A 1LENA 4LBOA 2QKDA 2XWJB 4RHV2 2A1XA 1N1TA 1EV11 5T54A 3D8CA 2VO5A 1JOBA 4XE9A 3ZFFB 2ZKLA 1GZWB 1PO22 1FXZA 1RUE2 1FOD2 1PGL1 2E6VA 5I91A 1PZ7A 3VDDC 1R1A3 2ETEA 1GQPA 1V00A 3IM0A 5LA9A 4YZ5A 5JWPA 2E7AA 3OYWB 4QGMA 3RQ0A 1CJPA 5IK8A 3N9PA 2A6YA 5C70A 5ANQA 2WA4A 1CVNA 1OLME 2OW4A 2ZGQA 4PLMA 2VUCA 1ASJ2 4W8JA 5JOZA 5FQ0A 1VBB3 5A70A 2GC2A 5A1LA 3AYAA 1LHOA 1RUD2 4KWJA 2ARXA 2YFUA 5JSRA 1GQGA 1UL9A 5FK7A 1WLCA 3WNXA 2HWF2 1ZREA 4NIHA 2Y0OA 4E2GA 2ZAHA 4XFAA 4D7TA 4XFHA 3CIHA 3R0RA 1GZTA 4PBPA 4LK7A 3CMGA 1FMD3 1JMUB 4AI0A 3PTYA 3VKNA 1P8JA 3VZLA 4LBKA 2K46A 2FDGA 4GB31 1H1IA 3NWKA 2QNKA 2DYCA 5DPNA 4FFFA 3ZIXA 4ATFA 4AEDB 3ACHA 4FOVA 3ZFFC 3ILRA 5FPLA 2ZEXA 4DXZA 4XHXA 1RUF2 1W05A 4XF0A 1IQDC 2LALA 1YQ2A 3PIGA 1YUDA 4OHVA 2HWB3 2R0HA 1VBC2 4HOOA 4OFGA 4EYUA 2KXLA 2XGXA 2D6NA 1WCUA 3LOBA 3AMNA 4UXAA 5FUIA 3EXUA 4KWKA 2G9GA 3KT1A 1F35A 1RUJ2 2YB7A 4OCTA 2YDEA 3LKJA 4IEQA 4QB6A 3AL5A 3ETPA 5CU1A 1K42A 3TBDA 2JKBA 3WF1A 4BXFA 2OZJA 1HRV2 3POWA 5LY1A 2VZSA 1S0BA 5KHHA 2K0GA 3M3QA 3OEAA 3Q8FA 5FY7A 4KGGA 3FFQA 1V9U1 2YPDA 2ZA9A 1UYPA 4HKOA 5BNOC 3I97A 4RHV3 1REEA 2GC1A 5KHKA 4LULA 1PO23 5EJ1B 4IV1B 1RUE3 1VMJA 1FOD3 2VD7A 3Q8AA 1JYIA 3B93A 5EYYA 4IV3A 3MPBA 4R9DA 4MGQA 1COV1 3P1IA 4Q4Y1 3W9AA 4ZU7A 2JE8A 1XXNA 5LZ6A 3NNMA 4AEDC 1SLCA 2JDPA 1F5JA 2HWE1 5F5QA 1ZYBA 3PHMA 3UL2A 3WG3A 4C90A 2E7TA 3WY6A 4QKBA 1RXFA 2WQ8A 4AVBA 1ASJ3 4AFCA 2A6VA 1R64A 4GXLA 1UXXX 1RUD3 3HMYA 4QB1A 2RJ2A 2C9AA 4NHXA 1W8HA 4YPJA 1ZNPA 1IS6A 4MSVA 3BUCA 3O1SA 1H6YA 3FFZA 3MYXA 5C3QA 4FOWA 4HONA 3AM2A 1R091 1RTVA 5A7OA 5FR3A 3SH5A 2VJXA 2Q1MA 3FZ3A 4PDWA 4UF0A 5AVPA 1SFNA 1KXGA 4XJ8A 4A45A 1FI2A 4A7YA 1WMDA 2ZGLA 5LRSA 2Y38A 3O12A 2WNEA 4P9XA 1UY2A 4OHYA 2PLV3 1ZZ7A 4IV1C 4CUAA 3CZUA 4RR3A 1CPNA 3RFRA 1AHSA 1CZVA 3KF3A 4HVQA 1VBC3 3N3HA 4QB2A 5DXDA 1IS4A 3WEZA 1Q8QA 2VZTA 3QOPA 1BQPA 3SCGA 2JX9A 1LGCA 1RUJ3 3ZFEA 3K48A 1I6XA 5E8AA 2DU1A 3RG0A 3H8RA 3AMMA 3VBUA 2GU9A 1S0IA 4P9GA 3GNEA 1NG0A 4M01A 3ACLA 2XHKA 2VMGA 1RUG3 1A78A 5IVYA 3V56A 4HKWA 3AYCA 3N4MA 3APBA 3INAA 4N9HA 1JYXA 5C8CA 2ZMLA 5FWJA 3ENRA 1ZBA2 4CYDA 1MS0A 3I2DA 4CU8A 3O7OA 5C9AA 2W5FA 2R042 1S0GA 4DUWA 4DS0A 4G3YC 1OT5A 1X7NA 5BXXA 4K1YA 5TSWA 2P17A 2ZMKA 4UFIA 4AHXA 2OA2A 4CCJA 1G9BA 5E16A 4FQ4A 5KR7A 4AHYA 2VZRA 3MLJA 4N43C 4YGCA 1D4M3 3THCA 1NLRA 1QJFA 3WNPA 4CUBA 2ZGKA 1PMJX 4CEYB 2RHPA 3CLPA 5A7WB 2LW8A 2NMOA 3SEEA 5CKMA 4BM8A 4A3XA 2J1SA 3ZYBA 1W6QB 5IVJA 4COWA 5BNNB 3O0XA 4LORA 3KV6A 2P3KA 1SZBA 4AI9A 2BVBA 2NP0A 4CDWA 3NL1A 5CVRA 5EPAA 3R05A 1AUYA 1OHFA 1WBLA 2O8QA 1D0HA 3BOPA 4CP9A 3V0BB 1PK6C 3VL9A 2QUOA 2R16A 1BVVA 2PMWB 3NVCA 4P9JA 1TG7A 4AQTA 5FY5A 3C7GA 3M1HA 5FDBA 4A6SA 2XQRA 1US2A 5CG9A 2J1EA 1LR5A 1DZQA 3MV11 3OPZA 4LHKA 1GOFA 1IS3A 3U07A 4I0AA 3MIFA 2ORXA 3HT2A 3KHCA 1SBEA 4AR2A 2Y0IA 1NY72 5GM0A 4CCNA 1GNYA 2YMZA 1K12A 3A0KA 2B9VA 1D4VB 3PJYA 3VBFB 5IAVA 1XSQA 3ZSLA 1OXCA 3LEGA 4XF3A 4CEYC 1AJOA 1MEC2 4AI1A 2ET7A 1H8VA 4LO6B 4WVMA 4QXBA 4KG8A 4Q27A 5DG1A 4AQ2A 4LKFA 4JKKA 2XONA 3PTRB 1U0AA 5BNNC 3IMNA 1NCRB 4E27A 5F1RA 2BQPA 3AKSA 3DECA 2CGNA 4AEKA 2BYVE 1VIWB 4X6QB 5LBEA 4D94A 1ZBA3 4P08A 3FUQA 1CN1A 1AL0G 1AR63 2RM21 2R043 3HNYM 1RHI1 1W03A 4PF1A 3ZYFA 1UU4A 1VJ2A 5F3GA 4HKLA 3LDRA 1LOFA 1WKYA 3A22A 3WHUA 3ZXKA 5A3UA 1VRH2 2RDSA 3VN4A 3I49A 5JOYA 1XU2A 4JTNA 3U4SA 1W04A 2QBXA 2XDVA 2ZS6B 1A6CA 3SHRA 5DDJ2 4F8AA 3VBHA 2ADEA 4WVWA 2DF7A 1RYYA 1UYXA 2HWB1 1C3HA 5GZGA 3ZPYA 1XNKA 1HKDA 3J8F3 4E4DX 1C1FA 4Z8BA 3F95A 4FTSA 2W1WA 4Z92B 3H3LA 1REDA 1RIRA 4CCDA 1W9WA 4BDVB 4XZPA 4LO5B 1POV0 2RMU1 3J7NA 4JTOA 1H2NA 3CU7A 3H3ZA 4QQHA 4CA9A 3J4UH 1KITA 1NCRC 2DWRA 4UBGA 4BB3A 4B1MA 5C33A 3RZHA 2E63A 4UT5A 4OQ9A 2UWAA 4DXRA 1SHWB 1ZRCA 1LJ7A 2IFWA 1OLQA 2R32A 4QX5A 1OLMA 4XJUA 3KV4A 1WCKA 1AR72 4R4XA 4WV8A 5A7PA 1PZ8A 3ZR6A 4CDXC 4DEVA 1G9DA 1UIKA 3T30A 4CPBD 1LECA 2ERFA 5F32A 4MG2A 1S1AA 5J1XA 1I3HA 2FDHA 1O3QA 2IXCA 4FXGB 5C3RA 2VOWA 1B35A 4MGSA 3NNLA 4ZPIA 5FREA 1UN1A 4EV0A 3OBRA 1APNA 3FHIB 5CB7A 5EZWA 4LA3A 1CAUB 1HX6A 4MXWB 5I0DA 3IB3A 2J7MA 4QPGA 4AK3A 5I0TA 4GMP0 1LGBA 3I3DA 2JJ6A 4LK6A 4XBQA 2C5DA 1SLBA 1VBA1 4IXLA 3BALA 3I2GA 3AP9A 1ZA4A 3MIGA 2WINB 3ILFA 3TN92 4A7ZA 4ES9A 3WF2A 2OX0A 3D6EA 1W6OA 4CCEA 1DCSA 1O5UA 1VRH3 1GWMA 4ZU5A 2QQOA 5IVEA 1IPSA 1OMIA 2LUWA 2XB6C 2ARCA 3JD71 2JIJA 4FPGA 3VD7A 3ZR5A 5FYUA 1ODMA 3N7LA 1XNTA 3RRDA 1Z7S1 2PLV1 3WW4A 1VB2A 4UYBA 5DDJ3 3WHTA 3D4KA 4JRLA 2CNAA 5C3OA 3FLPA 4QX2A 3RJ2X 1UY3A 3L2HA 5HCAA 4NAMA 3HQXA 1M4WA 1GU3A 2CL2A 5GLVA 2D3PA 3GJBA 4XUNA 1ZRIA 1REFA 1EV12 5IHRA 2JDYA 4LXLA 3MLKA 4RQPA 5FZCA 5FZHA 1TEIA 4AE2A 5CFCB 4CU7A 3ZOIA 1PGL2 5EXOA 5FPBA 3OBTA 5IK7A 1W99A 1DG6A 4QAWA 1BCXA 1RJ7A 1W2AX 1X33A 5LB6A 2VAUA 1QDOA 1RUG1 5FZIA 3T4VA 2I45A 3IIIA 5F2WA 3OD4A 5A33B 2BERA 2WT0A 4QD2A 4Q1RA 4GALA 1RINA 3ES4A 5IFTA 3RZLA 5FFOC 1QY4A 3ZDSA 2E32A 4JV4A 5A7QA 1MZ6A 5M0TA 2VZ3A 1AR73 2JDUA 3U0ZA 2WZEA 3WCRA 3H42B 1WA4A 1CR7A 1N1VA 4CCLA 1Y3TA 4PLNA 2V09A 3E5XA 2VULA 2RS33 1YNAA 3EYPA 3OUIA 4DY3A 1D4M1 4ASMB 2JG9A 4JKLA 1UQXA 5KXCA 1UZVA 1JXNA 1SDDB 1UO9A 4KH9A 2DTWA 3VV1A 5L9BA 5L9VA 1RC6A 4GB32 3H0OA 2GALA 1K5JA 2YUEA 5F6KA 2IXKA 1CAXA 2UYBA 3C7OA 2MPFA 4GJZA 3W21A 3T2PA 2QQPA 1QIQA 3HJRA 1JHNA 1MQTA 1SPPB 1FAYA 2OXBA 2B46X 4NMIA 2Z2SB 5HI0A 3O1TA 3AK0A 3H8UA 4HVRA 1WA6X 3MV01 1JOPA 1EUUA 4J25A 5D21A 3ZKYA 3V0AA 5LWBA 2DV9A 2BBAA 3PVOA 5A32B 3IAQA 3N9QA 2WNVA 2XVKA 2QQLA 5D2AA 1SLTA 5FZOB 3PL0A 2FCVA 2WWUA 4IEVA 1TME1 4XBLA 4QHZA 2ZGSA 1AR81 4N8MA 4XFBA 5JSPA 2B45X 1ST8A 3EO6A 3ZXJA 3KGLA 5CEHA 5FPUA 5FO8B 1V9U2 2AUYA 4XUTA 4MV2A 4QT6A 4WZFA 3DCQA 4AVVA 1EV13 4JAAA 1JU3A 1SMVA 3I3QA 2BEOA 3ITQA 2VXJA 5LBBA 1LGNA 5IK4A 4FTBA 5H9QA 3T2TA 4G9SB 3WCSA 5GZCA 5A6QA 2AC1A 2ADDA 4Y22B 4JGZB 3RYRA 1COV2 3P5BA 4Q4Y2 1W28A 4N53B 2I07B 2RVAA 3DEMA 2HWE2 2NM1A 1C5IA 2UURA 3KT7A 3DF0A 3TB0A 4XJZA 3D0SA 5JXGA 3ABZA 1KJLA 5K9YA 1N1YA 1AR61 2F6BA 2YBSA 1ACCA 1US3A 2GNTA 5C4WA 3OPWA 1S2BA 2X5IB 2VZOA 1O4ZA 1ODNA 2FCTA 1MZFA 1GOHA 1ZZ6A 3TRSB 4COUA 3MZHA 4EN6B 2LROA 4E4ZA 4QDSA 1UU5A 5FY1A 1R092 3KS7A 3LPGA 1DGRN 3VBOA 1CIYA 2R071 1C28A 4GB33 4EJRA 3FHQA 1D7PM 3KLSA 4S2DA 5J48A 4JDMA 1DBNA 1LKNA 4AXOA
chains in the Genus database with same CATH topology
1PO11 1OKQA 2FMYA 4BH9A 2XLFA 1U5YA 1OA3A 1PZ9A 3E6BA 4E2QA 4JGZC 3VZMA 2VQAA 4IERA 3ZYRA 1RUH1 1YYNA 4GH4B 4N53C 4AI8A 1IQAA 4OHZA 4CDQA 1BK1A 1DQ1A 2EIGA 1NA1A 3W58A 5H9PA 3WVJA 2GSYA 4BHPA 3FC0A 1RUOA 4HL0A 1OQ1A 2QZ2A 1BEV3 1H2MA 4HMZA 1IHMA 2VW2A 3PMEA 4HN0A 4B7EA 2X5IC 1V9U3 2NYYA 3HWJA 4I0WB 5JPMB 1LU1A 5I8TA 4M00A 1E57A 4SBVA 4FPOB 1KS4A 4AEJA 2GMPA 4FOYA 2WFPA 2ZGOA 4WVZA 4Z82A 4RSUA 2YHJA 1COV3 4Q4Y3 4XJ9A 1AF9A 3VKLA 1KQRA 1G9CA 3GF6A 2VVDA 4S2FA 1RGSA 2JE7A 2WS91 3QACA 5GALA 3RSJA 1AYM1 4GH4C 1VAVA 2QCSB 2Z69A 4F7ZA 1EYBA 1FPN1 4EWAA 3M3IA 3QD6A 1LEMA 2UWBA 1WUVA 2A3XA 3VBSC 1CAVB 2PHLA 1R093 3USSA 1I5ZA 3E5UA 2GH8A 2WLPA 2H0VA 4GWMA 2GDFA 1FT9A 4RL7A 5KXEA 4YW3A 4ZKTB 4FSJA 1N3OA 2FHRA 3BOWA 2CGPA 3WDUA 1RL3A 1DF0A 2ET1A 4AWDA 1ALYA 2DU0A 2PHWA 4URTA 4D69A 2P37A 3RPQA 5ACA1 1B09A 2XJSA 4FAHA 2D6LX 1GZCA 1XU1A 2WNUA 4EWDA 3H1MA 5KC5A 3GHMA 3SISA 3FLRA 3DKWA 1LHNA 1YCIA 1W6NB 3P3NA 2BTVC 5ABJC 4FPJA 4WM8A 2Y26A 1AR91 1D2QA 4P9LA 2ZGNA 3IPVA 1ND3A 2QDRA 3LB9A 3DV8A 2YXSA 2RM22 5AFEA 1Y7BA 1RHI2 1GBGA 2DVGA 1H8TC 2Q4SA 5AVAA 1F5FA 1ZX5A 1HRI1 3MFCA 1MS8A 2VY0A 3S7EA 2XL7A 4YNIA 1NE4A 3VBRC 1QJY3 1KRIA 4AFBA 1QWRA 2HWB2 1XE7A 3CJIA 2CAVA 3TAYA 1DZRA 1XYNA 1H1MA 1RITA 4WBBA 4JGYC 1ZRRA 4AVCA 2DCTA 3JQWA 3JB8A 2RMU2 4XYXA 1AXKA 2HJIA 1BMV1 1W2UA 2PAEA 2UYAA 2ARBA 1OD5A 1DQ2A 2E7QA 3CF6E 3SH3A 1SBDA 1MZEA 2EXJA 3ZN6A 2O0OA 4Q8KA 3ZXAC 2WA3A 2HEWF 2PHXA 4I2OA 1GZWA 3ST7A 1R081 2W08A 2A6ZA 4LEJA 3ZFGC 4HPKB 1XNBA 2TBVA 3NKGA 1A3KA 3ZXFA 1DLLA 3OGGA 3TNPB 3AFKA 3WQ0A 2DFBA 1LOAA 3ATGA 1CX4A 3CL1A 4XQWA 4Q0QA 4L9BA 4R9CA 5I8YA 2D93A 1U5IA 1VBA2 5GLZA 1YRZA 1BBT1 5BNOA 1H30A 1WD3A 2RM23 1RHI3 1SDWA 3IBMA 1DYKA 3J26N 3DPRB 3AP6A 1AL21 1Q5OA 3JD72 4M3CA 2VG9A 2Z42A 5I0RA 2D7FA 2ZZJA 1Z7S2 2PLV2 3POSA 4OZXA 5JIAA 1RMU3 3N35A 5HCFA 4FBFA 4HFSA 2JE9A 4X8NA 2IXIA 5JDBA 2IXHA 3ETQA 2X29A 2ATFA 1ZZ8A 1LHUA 2ZCWA 4NR1A 4YW5A 2TUNA 3N7KA 5FPXA 2ZJCA 2AREA 4P9IA 2P2KA 3FBMA 1V6IA 1J3RA 2R1BA 3ES1A 2QDNA 2FQPA 2RMU3 1BXHA 3OD0A 3OGJA 1W6PB 2ZOEB 1BEV1 3AP4A 1RUG2 1SQ4A 2A3WA 3RJRA 1L3JA 5J37A 4K20A 2NLRA 4JDNA 2QFEA 1YFUA 1DGRA 5J96B 4QM9A 4I3GA 5KXDA 4LUKA 1AVBA 3HBZA 1JUHA 3E6DA 3DPRC 4ISRA 3EHKA 2ENRA 4COZA 3AJYA 4GIQA 1DGWX 1GLHA 2JG8B 4AQSA 3WP3A 2GNMA 1D4M2 3WDYA 2YZ4A 1X36A 4BIFA 1ND2B 4QM8A 2VH9A 1ULGA 5FBZA 1CD3G 4IV3B 3V64A 3M3CA 1VBA3 3VHRA 4Q0VA 4XTMA 3JZVA 2CV6A 2B39A 1S0FA 2R1DA 1O3TA 1XNDA 3CNAA 2HEYF 3ZXLA 4CP1A 5CADA 3JD73 4AGGA 4RGAA 5L7OB 5JI7A 2ILMA 1Z7S3 3FX3A 3BIWE 4YSFA 1OA4A 3B5LB 2WT1A 2H0BA 4GKYA 4K9SA 1TME2 4N43A 1AR82 3AXEA 2ZMNA 1VBD1 4QXKA 4DNYA 1TNFA 4QPIB 2DCKA 4PDWB 2UWCA 2ZHMA 1YO8A 4MLOA 1NLSA 2JG8C 4AI3A 3MIHA 3PNAA 1N3QA 3VL8A 4ES8A 2F4PA 4B29A 1MS4A 2MHFA 1ND2C 1EPZA 2VVEA 4RR3B 1RVF3 1F9KA 1PK6A 4YW2A 3ZX7A 1I1EA 4BMBA 2VQ0A 4R52A 3ZYGA 1CAWA 1QXRA 1SFYA 2OYZA 4YGEA 3VBUB 1C8NA 1AR62 2BWCA 2HKXA 1FNZA 1H4GA 2BUKA 1D2SA 4R4ZA 5L7OC 3EBRA 4K3UA 4COVA 4AFDA 1X8EA 1EPWA 3PLQA 1QJY1 1XE8A 2R072 4C0HA 4UBHA 3WQ1A 4FT8A 2SLIA 2K9ZA 4QPIC 4BYYA 3HD8B 4PDWC 1PIV1 2ZX2A 5JCTA 5JLVA 5C9AB 1PO12 3RYPA 2JXAA 1EP0A 1ENSA 3M3OA 3J8F2 2KA3A 2HYKA 1K5MA 2VMHA 2X53S 1TE1B 3GBGA 4H3WA 5BNNA 3PMSA 5E1RA 3G7DA 2DVAA 1WCDJ 1JYCA 4AQ2A 4RR3C 1RUH2 1UU6A 3VZOA 1HDKA 4RGGA 1LULA 3V0BA 3BODA 3AZZA 2VECA 2ZTNA 1PM7A 3I8TA 4B4RA 3RMXA 1TME3 3VBUC 1AR83 3LSDA 4YFWA 3H7YA 4ASLA 3KCYA 1S0DA 4WM7A 2ZX0A 4EN8B 3POYA 2VUAA 2PHDA 1ULEA 1SCSA 3AKPA 1O3SA 2ZGTA 4CEWA 4KNCA 2R49A 5FOBB 4XFGA 1SEFA 2ZX1A 1S0CA 3N7JA 5GZEA 3UV9A 4TZDA 1AX0A 1IZ3A 1LTEA 5CNAA 2VNGA 5K0UB 4DINB 4NN0A 1ZRDA 4NWVA 2WS92 3WG1A 1AYM2 4N9IA 2MEV1 3MIDA 5DZEA 2ZGPA 4BMEA 1FX5A 1FPN2 1Q8SA 2YPJA 3JCIA 4Q8LA 4YVWB 2D5HA 1J58A 1YWKA 4CZSA 4CDXA 2IC1A 4IEPA 2VVFA 1DQ6A 1RMU1 2R073 4BWOA 3ZYJB 4I0BA 2A3YA 3D0JA 3AYDA 5H9SA 3VBFC 1PO13 1SLAA 5GKAC 1IOAA 4Y4YA 3KMHA 2VW0A 3H9AA 3I7DA 4O9EA 4Y26A 4QQ2A 3BPZA 2XPJA 2XG3A 3U10A 2WT2A 5I0SA 2JDZA 4LA2A 1RUH3 4BLIA 1UKGA 5JZGB 3VBHB 1GKBA 3AP7A 4BZ4A 5ACA2 2WQZC 5K0UC 4HBNA 3RNSA 2GH2A 4SLIA 3JQXA 1XYPA 4QQOA 4XILA 1X8MA 3OF1A 4TYSA 4YG3A 3RZZA 4XJAA 1XRUA 2ZPXA 4P9WA 2YY1A 4YVWC 4B7KA 2D43A 1AR92 3NAPB 3M2MA 3FE5A 3VHNA 5JPNB 1MS1A 2RS32 4LO8A 2XVLA 3H1WA 3MF6A 3SITA 1R1ZA 2UU8A 4B4PA 4CTEA 4RS5B 3JU9A 3O5SA 1HRI2 2A6XA 2YROA 2ZACA 4MXWA 1PVC1 4L97A 1UD1A 3UKTA 4FTEA 3I4IA 2WS93 1AYM3 2RS13 5JZGC 1CPMA 5KHIA 3VBHC 1B35B 4WZCA 3B01A 4OVEA 5CG8A 1FPN3 4Q4V1 3JBG1 2H6BA 2DURA 1UAIA 1ULDA 1DHKB 4PIXA 1CJDA 2R0FA 3PVEA 4YZ1A 2ZAAA 2FZ2A 3VUOA 1N1SA 4RFT0 1BMV2 4MGYE 5HXVA 4JRAA 3THPA 3VZJA 3C3VA 5JMCA 1W6OB 3NAPC 4K40A 4KU8A 1N3PA 2EF6A 2P34A 2ZGUA 3P3PA 4JQRA 4AHWA 4M0HA 1ZBE1 4MXVA 4RS5C 4Q0UA 1R082 1PMIA 2XJPA 5LEKA 1RVF1 5ACA3 3GZTB 3GYDA 1SBFA 4KGQA 2YYOA 2AR6A 5A33A 1V6KA 4D3WA 1ONAA 1AX2A 3IN9A 1B35C 3CO2A 4RQPB 4PIZA 4FO9A 2PA7A 1QOTA 4A2UA 4AVSA 3NV1A 1F2NA 4ORFA 2GZWA 5DUVA 1AR93 1YJKA 2GMEA 2R061 2R30A 3ALQA 4NHMA 1HLCA 3MPPG 1BBT2 3VHPA 5IT6A 3GBFA 2XH6A 4K7JA 1XNCA 1FATA 5FO9B 4S2HA 2VUJA 1VAKA 1VALA 1HRI3 3IIAA 4FPEA 4IEZA 5AC91 1AL22 2AGSA 1H0BA 5CFCC 4EN7B 3HT1A 4NHKA 4MX3A 2OIIA 5FAXA 1MS9A 4CDUB 5GLTA 2DVFA 4Y24A 2N7GA 2H6CA 4UW3A 2EXKA 3MICA 4H7MA 2PTMA 4XXAA 5A32A 1SCRA 1QNWA 1IKPA 1YIPA 1F31A 1WBFA 5EFUA 2VW1A 1W0PA 1FV3A 1UPSA 1Q8PA 1BVP1 2ZGMA 1BEV2 2EAAA 1A8DA 3UJOA 4OLLA 1GSLA 3ZYPA 4NWWA 4P14A 2C0ZA 3WX5A 3ZXGA 2YGLA 1GNHA 2XKOA 5DUXA 4YGDA 4J1XA 5T3NA 1R083 4FPFA 3ECQA 1LOEA 1DGLA 1DGWA 3B02A 3LZZA 4N53A 1Q8VA 1KFUL 1OLRA 2WKKA 2XJRA 3IDEA 4CDUC 4TLFA 4AFAA 2BW8A 5BY5A 1HXS1 4N90A 4H7LA 4LUMA 4W6YA 3U4XA 4C91A 1GNZA 1HW5A 1OPMA 4X8PA 2X5IA 4YG0A 1CESA 3QCWA 5I8SA 1BBT3 3HIFA 4PCRA 4Y1VA 4FQZA 1WMFA 3AMHA 4AVTA 5BNPB 3TYJA 4XMAA 3RMYA 1OQEA 2ZHLA 1AL23 1C8M1 4LO7A 4C0BA 4W6WA 4BIOA 3AXDA 4FP2A 4O9GA 5FLIA 5CFDB 2DUQA 4Q1PA 1VBD2 5D8AA 2OUJA 3OJBA 5GLWA 4GH4A 3ZSMA 1DQ0A 1DIWA 1YJLA 2TNFA 3AFGA 4HN1A 2PELA 1NOVA 4LBLA 4AFMA 4CP0A 3W59A 1DU3D 4PJYA 3NW4A 3OTFA 3VBSA 1O91A 5DUUA 4Q0PA 1VAMA 4IEXA 4YG6A 4IQPA 2W68A 5T5JA 3BTAA 3UKVA 3SMHA 4LBQB 2HWC1 4K6BA 1GQHA 2Q0AA 4QU2A 4DB5A 4JC1A 1IS5A 1NA1B 5BNPC 2VU9A 1WGPA 1BYHA 5BYNA 1VP6A 3WW3A 1J3QA 2EAKA 1OOPB 2JECA 1QJY2 2GN3A 3KQRA 2BVVA 3WG4A 5CFDC 3EQEA 1ENQA 2RS11 4ONUA 5BPXA 1QJZA 1PIV2 3FLTA 3N7MA 4M0NA 5I93A 5GJ6A 2GC0A 1WD4A 5FTTC 5ABJA 1X82A 2PHRA 2QE3A 4XOGA 2CGOA 1SLLA 1ZM1A 4IEYA 4GA9A 4Q29A 3GZUC 5E89A 3KCXA 4Y20B 1QHDA 2B42B 3B3QE 4YGBA 3WV6A 3N36A 2EXHA 3B9IA 1H8TA 1JN2P 1NCQB 4R8HA 1UPIA 4I09A 2VOVA 5LK5A 2AENA 3K51A 3VBRA 1VBD3 2DVDA 2FZ1A 1HV1A 3LAGA 3R4DB 1A8MA 4JCKA 3NJZA 4P9YA 4YVSB 1WCSA 2MNGA 1PNFA 3C2UA 1YIFA 5KHJA 2YV8A 1OOPC 1PVXA 2WSVA 5GLUA 4UW5A 3TWIA 3LWCA 2WL1A 4DMIA 3LGRA 4JGYA 1BKZA 3LOIA 3PVNA 4Q26A 4META 5F6LB 1EAH1 5IUQA 2C1FA 1GYKA 3OY8A 5L73A 2WZPP 4BA6A 4I3PA 1V6OA 1IKQA 5B2GB 3AZWA 1ULFA 4B8EA 2PFWA 2MEV2 2WNUB 3SCFA 4Q4X1 1O4TA 2V5YA 5FO7B 3ZIWA 3IKWA 1WW6A 1FYUA 3VDDA 1NCQC 2OZ6A 3USUB 5IK5A 4XTPA 5KC6A 4QGLA 3ZFGA 3M4FA 2YGMA 4QHBA 1RMU2 2D44A 4YVSC 1ND3B 5FPZA 1WW7A 3QH6A 4QQLA 2XBO3 1XQNA 1PIV3 1N47A 2O1QA 2VNRA 3RI9A 4E2SA 1TQ5A 1VLNA 1Z78A 3IWZA 4CP2A 1W6MB 3L2YA 3AZYA 3FJSA 4Q4W1 4YFZA 2SBAA 1X50A 1MS5A 1ZZCA 4HSJA 2G4IA 4Y1ZA 3KM5A 2W52A 4P5HA 4AI2A 2KM2A 1NQDA 5F9TA 4XW3A 2DCJA 5T50A 4XPVA 1QF3A 3CJIB 3E5QA 4LBQD 4HK8A 3WXPA 3ZFFA 2BWAA 2HWD1 2JICA 1V70A 5FRAA 5KBFA 4DY5A 3H50A 2D97A 4AF9A 3Q9OA 3AMPA 3OCPA 1V6JA 4M3CF 3I59B 1POV1 3OYWA 3ASIA 3B69A 1QGLA 4W65A 2XJTA 2WFF1 5T55A 4HPKA 1NYWA 3R4SA 4D7SA 1ND3C 2Q5TA 2D6PA 2K2SA 3ZN6B 4EWEA 1WLDA 4RD7A 2CY6A 3KT4A 2Z5WA 4XETA 4S2GA 3AMQA 3M8LA 1PVC2 2WIIB 1C5HA 2CAUA 2E51A 5GZDA 3S30A 4QPYA 4YZ3A 3WDVA