1FYUA

Crystal structure of erythrina corallodendron lectin in hexagonal crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
239
Chain Sequence
b'VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title Chemical characteristics of dimer interfaces in the legume lectin family.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 49
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fyuA00
1UX6A 1HLCA 3R4SA 1NXD1 4LBQB 1KJRA 3WCSA 3WHUA 5KXEA 2YMZA 3D6EA 4LBMA 4Q8LA 4R9CA 1LECA 1FYUA 2W68A 4XTMA 1GZCA 2B7YA 1YIFA 4XE9A 1IS5A 1QKQA 4Y20B 1JW6A 3BODA 4YW5A 1SLBA 4DRRA 1SBDA 2DV9A 3SITA 1ULFA 1Q8PA 4LBQD 3W59A 5CA6A 1U0AA 3VV1A 4XYXA 2SBAA 2ZGUA 5GLZA 3AP7A 2AGSA 2D43A 2ZAAA 2WT2A 3B9CA 2A6WA 4XJZA 2D3PA 4AYUA 3PVOA 1ONAA 2R1BA 1GKBA 5EYXA 3AP9A 3WCRA 5T5LA 3OJBA 4U2AA 2NMNA 3IKWA 4ISRA 2YY1A 1G9DA 1W6QB 2ZGSA 1MR5A 5HCFA 2NZ9A 3ILFA 2JE7A 4KBBA 1YI7A 1QDOA 2GDFA 4FOWA 3PMEA 1BQPA 3GALA 1AXZA 1V6NA 5F9TA 5JVVA 1DBNA 5DG2A 3I8TA 1Y7BA 3V0BA 1ENRA 2YROA 1GZ9A 3AP4A 1WLCA 1UL9A 5KXBA 3OGGA 1LOEA 1QOOA 3FUOA 1IS4A 5GLVA 1MS4A 1LGNA 3PVNA 2ZA9A 4NO4A 2GALA 4PBPA 5BYNA 2AREA 4Y26A 4Y1UA 5GZEA 4YM3A 2ZBJA 4YG3A 4SLIA 1AXYA 4YZ3A 1JYIA 2FMDA 4M00A 1W6NB 5GZFA 2P3IA 4ITCA 2ZGRA 3GNEA 2C5DA 1DZQA 3UJQA 3VKOA 3HR9A 2NYYA 4GKYA 4XBLA 1Q56A 2NP0A 4BMEA 2ZGNA 2P3JA 3PVEA 4LBKA 5DZEA 5F5QA 3MW4A 1CVNA 4Q27A 3VKMA 2EXJA 1SACA 4L8QA 5T5PA 4PQ9A 4AGRA 4AVTA 3VKFC 1LOGA 2A3YA 1GYKA 2CTVA 3V0BB 5JOYA 4FOVA 2P34A 3NV2A 1DQ2A 5T54A 2HYKA 1UZZA 4I30A 1S0GA 1S0CA 2WT0A 3IPVA 3N7MA 2WLQA 4BPZA 1MVEA 4M3CA 4FPCA 4P9YA 4CRQA 3O5SA 3AP5A 4Y1ZA 3WZ1A 4YM1A 4BMBA 1CIWA 1O4ZA 1ULEA 4GKXA 1W6OA 1BZWA 2AYHA 2D6LX 3WVJA 1LGCA 3FLPA 1YYNA 5DUVA 3O0XA 1Z0HA 1GANA 1ULCA 4XXPA 1QNWA 5T52A 3POWA 3T1MA 3TAYA 1YRZA 1IKQA 1FV3A 2E7TA 1C57A 4XMAA 5DUWA 4WV8A 5GLUA 1JHNA 1FATA 2PHXA 3FUQA 4YGCA 1W0OA 3UJOA 4FPKA 4HANA 3LSEA 3ZSJA 4XZPA 1DHKB 4C1WA 1MS5A 2WNEA 5T5JA 2D44A 1LTEA 2R16A 1VAVA 1Q8SA 2D6OX 5IUQA 2R0FA 3AJZA 4NOTA 2ZKNA 2A71A 3ZXFA 1Q8QA 4Y24A 1N1VA 4YM0A 3WDXA 2Z42A 1AX0A 4FPHA 1N1YA 4DQAA 4PF5A 1LOFA 2WSUA 4JCKA 3I4IA 3T2TA 4IQPA 2G4IA 3ZXKA 1GZWB 4YLZA 3IPVB 5CAZA 3QLQA 4UW6A 3USUA 1RITA 2OUHA 2DURA 1S1AA 2P37A 4M3CB 2DVBA 3WG1A 2WT1A 2ZMLA 1D0HA 4C1XA 4D69A 4Q26A 1DFQA 3FLRA 2JD4A 1I1EA 3FBYA 3M1HA 5CBLA 2XG3A 3ZSKA 1UPSA 2NMOA 2C9AA 3DGTA 4U36A 1QDCA 1W6OB 3FLTA 1SBFA 4UW3A 1SLLA 3L2YA 1AZDA 4DRVA 2ZACA 1CQ9A 1DIWA 1MS8A 1YO8A 3A0KA 3UK9A 4XTPA 4DFSA 5LK5A 3M3QA 4PBOA 1FNYA 1QU0A 4TYSA 3ZSLA 3ZSMA 2A6XA 4ISQA 4JRAA 4LBOA 2EXIA 1WW6A 3ZXLA 1QF3A 4DS0A 1AVBA 1DLLA 2PHRA 2DUOA 3WLUA 2P2KA 4K1ZA 3RMYA 1FNZA 1A3KA 2VXRA 5DUUA 1C1FA 5DZFA 2ENRA 4YGBA 2A70A 2GNMA 1LOCA 3WG4A 3WDWA 2DYCA 3O12A 4FP2A 3TB0A 1ZM1A 4M01A 2JECA 3USUB 1IOAA 2DUQA 1A8DA 2VU9A 1MVQA 5HCAA 2DWRA 2V73A 4YW3A 1V6KA 3A0NA 4LBNA 2CY6A 5DXDA 4K1YA 1QMJA 3T1LA 3ZVXA 1HQLA 2WQZC 1LOBA 1CJPA 1JYCA 4OZXA 3VKNA 3D4KA 4FPJA 2GNBA 1ENSA 1N3QA 1Q8VA 2DU1A 2D6MA 2JJ6A 3O0VA 4K20A 1V6MA 1DQ1A 3B3QE 4YW2A 4YZ2A 1V6IA 1JUIA 3FFZA 1AXKA 2KM2A 4UW5A 3SH4A 2H0BA 2A7AA 2A75A 1DYPA 2WJSA 4Q8KA 3AK0A 1WD4A 3R4UA 1ULDA 2ARXA 3IMNA 2ZGPA 1LEDA 2BQPA 3U4XA 1MS9A 1SFYA 2ZGMA 4FPEA 4FP3A 3WUCA 1SLAA 3AYDA 1OQ1A 5GZDA 3RMXA 4CTEA 1G8WA 1N47A 3AZXA 3BTAA 1C1LA 2PHUA 2DVAA 4XOGA 1I3HA 4UW4A 1DQ6A 3AXEA 3WUDA 1ZA4A 2Q5TA 2DTYA 3M3CA 4BLIA 2GMEA 1TEIA 1X50A 2GN3A 4R9BA 3RS6A 3WNXA 3ZXEA 4ZKTB 2D7FA 1S0EA 2YZ4A 3APBA 1O4YA 3MW2A 2E7QA 3ZXJA 1GSLA 1Z78A 2ZABA 1KQRA 2D6PA 2OUJA 3QCWA 1LCLA 4R9AA 1N1TA 1W6MA 3AZWA 4Y1YA 3WG3A 5IK5A 1HDKA 3AXDA 5E88A 3SH5A 4Q1PA 4Y1VA 4AVVA 1LHWA 3AYCA 2A6YA 4YGEA 2R1DA 3PJQA 1MACA 2EIGA 3SLIA 5T55A 4ZXKA 5H9RA 4FPFA 3N35A 1G9BA 1QOTA 4YFWA 2VUAA 1AX2A 1IKPA 1DQ4A 1LHOA 2ZGLA 2EXHA 4GALA 1LULA 1CPNA 3M2MA 1UAIA 3MEPA 2VH9A 1PZ9A 3RG0A 2XB6C 2E6VA 4YGDA 4YG6A 4FQZA 1ULGA 5GALA 2I2SA 1WLWA 1GNZA 3H0OA 3LSDA 1W6PA 3N7LA 5H9SA 5H9PA 4Y22A 3SH3A 4YFZA 5H9QA 4YZ5A 1R1ZA 1CPMA 4YZ4A 2V5YA 3JU9A 4FOYA 1RINA 5T5OA 4WZFA 4W65A 4LBJA 1WD3A 1LHNA 2YXSA 3W58A 2DVDA 1UN1A 3NV1A 4JC1A 4XJWA 1KITA 3MPPG 4Q2FA 3AP6A 2ZGOA 2OVUA 4R9DA 1LHVA 1AJOA 4GWMA 1JXNA 4Q1RA 1ENQA 2W52A 1CONA 3WOGA 4YM2A 1MS0A 4BQ1A 3N7JA 5T50A 1GV9A 3ENRA 3ZYPA 3UL2A 3N7KA 4HL0A 2UWAA 1FV2A 2ERFA 1J1TA 2VW2A 4BOWA 1A78A 2JDZA 4RL7A 3VUOA 1URXA 5GZGA 1GICA 1GLHA 1VAMA 1W0PA 1PZ7A 3V0AA 3R05A 4CZSA 5CB7A 5KXDA 3AFKA 4XIKA 5GZCA 1Q8OA 3RRDA 4Y22B 2PHWA 1MZ5A 3M3EA 1D2SA 2OW4A 5L73A 5DZGA 1S0FA 3HMYA 4MYEA 1WBLA 5JLVA 2JE9A 2R49A 2VW0A 3WV6A 3C2UA 4ATFA 1UMZA 1WLDA 2CNAA 3OPZA 4RA0A 2A6VA 2WKKA 1N1SA 1KDMA 2ES3A 3AJYA 4XJUA 1F9KA 1LHUA 2UWCA 3N3HA 3BIWE 3NV3A 3AZYA 1CN1A 1V6OA 2UURA 1JN2P 3D5OA 3N36A 4GA9A 4AGVA 2SLIA 4YG0A 2AH2A 5GJ6A 1SLIA 3AYEA 1MS3A 1MZ6A 5JOZA 1S0DA 2EALA 2CWSA 1G9FA 1DQ5A 5SV8A 2PHFA 1G7YA 3WG2A 1CESA 2D6KA 4YZ1A 1W6NA 1SBEA 1VIWB 1JBCA 1WW5A 5IK7A 4FQ4A 1SLTA 4ASMB 4K21A 4FVVA 4GWNA 2EAKA 2VY0A 4AWDA 3VKLA 1G86A 3ASIA 4YW4A 1BYHA 2ZZJA 3LCPA 4FPGA 3V0AB 3AX4A 2DTWA 3WDUA 1QNYA 3INAA 3NWKA 1AJKA 3IM0A 4XJ9A 4BLJA 1HQWA 3B69A 2GMMA 2R0HA 4XHBA 3ZPYA 2GMPA 2NN8A 1WBFA 1GNHA 1S0JA 3ILRA 1V00A 4Z8BA 1XQNA 2P3KA 4FPYA 2LTNA 3POSA 4F83A 2FHRA 1RIRA 2YV8A 1V6LA 2ZHMA 1MS1A 4WVWA 2DUPA 2A3XA 2A6ZA 2AENA 2VW1A 3O0WA 2DU0A 1LGBA 2E51A 2ZMNA 3AZZA 3WDVA 1H9PA 4WVVA 4BM8A 4AVSA 1GBGA 3IN9A 5JOWA 1AX1A 2ARBA 1JOJA 1G9AA 2TEPA 2ZGQA 3JUUA 2AR6A 1VLNA 3KM5A 5EXOA 1G9CA 2W39A 2D3SA 2NM1A 3M3OA 3OBTA 4M3CF 1WW7A 3WDYA 1EPWA 3A4UA 5GM0A 2AUYA 1LOAA 2ZGTA 2LALA 3ATGA 4FPLA 4LBLA 1OKQA 3B01A 1VALA 1KRIA 2A5ZA 3OY8A 3Q9OA 1LU1A 2UWBA 3OYWA 1F5FA 4XDQA 5FRAA 5GLWA 2EF6A 3ZYRA 2GNDA 3WDTA 1WW4A 1DGLA 1SCRA 2PELA 5JMCA 1WCSA 3SISA 3RSJA 5AVAA 1S0IA 1FAYA 1UZYA 1LU2A 1LENA 4M3CE 1APNA 2RHPA 4PCRA 4XJAA 5DUXA 2CYFA 1N3OA 4TZDA 1FX5A 2ZHKA 1QOSA 3KQRA 4XMIA 4XIOA 3AYAA 2A3WA 1F31A 1BKZA 1V6JA 2CWMA 1CR7A 1GZWA 1B09A 1C4RA 2GN7A 2ZMKA 3POYA 5JDBA 1WUVA 4LBQA 1KJLA 2WSVA 5HCBA 3BOPA 4XXAA 1DQ0A 3V65A 5KXCA 1DYKA 1UKGA 2CL2A 5E8AA 5GLTA 4XBQA 1HKDA 5CNAA 4Y20A 1BXHA 5EYYA 4YW1A 3AZVA 4AGGA 1LOFC 2W08A 1H9WA 1SCSA 1S0BA 2E53A 1QGLA 4DPNA 4P9XA 3ILNA 5E89A 2D3RA 4P9WA 4XHXA 2ZHLA 3SNMA 1IS6A 1KDKA 3OY8B 4FOQA 1W6MB 2DVFA 3OYWB 4FPOB 3B00A 4XILA 4XJ8A 3WHTA 2PHTA 4XBNA 5IT6A 1N3PA 4P14A 4Y1XA 1NLSA 4ATEA 2D6NA 2EXKA 1IS3A 1LESA 2UU8A 2JKBA 2GNTA 1LEMA 3DUIA 5DG1A 1LODA 3RQ0A 5IK4A 1AF9A 5IK8A 1W6QA 2ZGKA 4H55A 5FREA 2ZHNA 3CNAA 3MW3A 3NV4A 3OBRA 2DVGA 5EWSA 1BJQA 1OFSA 1PZ8A 1SLCA 1LJ7A 1W6PB 4GXLA 3V64A 5JOXA 1H30A 3HN1A 1YXWA
chains in the Genus database with same CATH superfamily
1AYN1 3DEMA 5FMOL 3WHUA 4AFBA 2BW8A 4Q8LA 4UI9L 1W2UA 2JG8B 2VQTA 4CTEA 1FYUA 2Y6KA 1YIFA 3I3QA 1SPPB 2EAAA 1XE0A 4XE9A 1IS5A 3BODA 2FDFA 1JI6A 1HRV2 1SZBA 4KNCA 4DRRA 1SBDA 5J1XA 3SITA 5ERLA 2VG9A 1W8ZA 1W39A 2IZWA 1IQAA 5CA6A 2YBKA 4NPLA 5FZDA 4N90A 3KHBA 3GHMA 3AP7A 1ND2B 1R64A 2RMU1 3ZFGB 4P9LA 1HRV1 4GQ7A 1UX7A 4Q0SA 3LPFA 5FZ6A 3O1SA 2D3PA 1GP6A 3G6JB 3U4SA 3S5AA 2R1BA 3MIHA 4NIHA 5T5LA 1ULOA 2F17A 3OJBA 2DCKA 4ISRA 2IXHA 2KD7A 4ZZ8A 4QQOA 5A33B 5J09A 5HCFA 5FOBB 2NZ9A 3AMHA 3ILFA 4FAHA 1ZRFA 2RS12 1EYBA 1A8MA 1YI7A 2K46A 4P02B 4XQDA 3PMEA 3GALA 1JTZX 4YVSB 5IHRA 4LO4B 3WX5A 3I8TA 3TNPB 1XNCA 1GZ9A 1BEV2 2W95A 4FI9A 4CDUB 5A7WA 2I45A 2IXIA 3WP6A 2XMLA 2BOJA 4RYDA 3OGGA 3FUOA 4WM7B 4DMIA 5CEHA 5KHIA 1NKGA 4QDSA 4A7ZA 1LGNA 3NAPC 4LORA 1K5JA 1BEV1 4I09A 2VZOA 4OUMA 2QUOA 5D8AB 3TN92 3FFQA 2AREA 4NHXA 1LB2A 3LA2A 3E5UA 5GZEA 4E27A 1AXYA 3SEPA 5FMBA 3POFA 4BQWA 2VMIA 2K0GA 1W6NB 2EICA 5GZFA 1F15A 5FUNA 3K4AA 4ZXEA 4CVUA 5DQ0A 1O91A 4URTA 5C8WA 3UJQA 3VKOA 4COWA 1L7RA 4XBLA 5C3OA 1PO22 1Q56A 3GM8A 4J25A 5A6XA 2VZ1A 1VBA3 5F5QA 2MEV3 3VDDB 4BE3A 4H7LA 1CVNA 4CCDA 4DXRA 1COV1 3MIDA 4Q27A 4O9EA 1OVPA 1SACA 1U5XA 5LA2A 4IV3B 1PO21 5T5PA 2VULA 1VBC2 4NWVA 3V0BB 1VP6A 2ADEA 5JOYA 1S55A 2ARAA 2EA7A 4GWJA 5T54A 2HYKA 4I30A 1WA6X 4CEYA 4OVEA 5CFCB 2F6BA 3NVCA 1VBC1 4QM9A 3JD72 3PUAA 4BPZA 4P9YA 4HN0A 5A1AA 4KBZA 2FDHA 1CWPA 2J1SA 4M0HA 4Y1ZA 3WZ1A 5EV7A 4A4AA 4BMBA 5CG9A 3C7FA 4N43C 2VZRA 3JD71 4V1PA 2D6LX 3I3MA 2HWC2 2WA3A 4AEDA 1LGCA 3EJKA 3KD4A 3R0RA 1UXZA 4OQ8A 4GD4A 4RGKA 1GANA 1DF0A 1ULCA 5FPUA 2YC0A 1QNWA 2QJVA 4WM8A 2WZ8A 1FV3A 4WV8A 1KRIA 3FUQA 4YGCA 3U10A 3UJOA 3WW2A 4OHVA 3WNKA 2HWC1 3ZSJA 4CXWA 4ARXA 4C1WA 4AZZA 2WNEA 1W90A 1LTEA 1DGWA 1FPN2 5KR7A 1VAVA 1Q8SA 2D6OX 1UZ0A 4I2OA 2A71A 4IETA 2YGLA 1UYXA 4AAPA 3MUZ1 4OYUA 1AX0A 2VNVA 3LOIA 1N1YA 4B1LA 1PMHX 2W94A 4HVOA 5DN2A 2WSUA 1F4AA 1V9U2 3ACGA 3I4IA 3F2ZA 1QJZA 5LK7B 1B35A 1OBNA 4LIUA 3AFGA 3LD8A 1VPHA 4YLZA 3QLQA 4UW6A 4RR3B 3WP3A 5LATA 2ID4A 3GGLA 2EIEA 3MLKA 2OUHA 5C70A 2L9LA 1GWKA 4XDPA 3O1RA 1CX1A 2G1MA 2NLRA 3FLRA 1V9U1 4CEWB 2HEYF 3WQ1A 1VB4A 3WNOA 5FMCA 1I1EA 3M1HA 1OUSA 2XG3A 4XUTA 4AFDA 1LKNA 3ZSKA 1UPSA 4CDXB 3DYOA 3DGTA 1YEWA 4KU8A 4UT5A 4CDWC 5FZMA 3FLTA 1E5IA 1SBFA 2WWJA 4QGMA 1JOBA 2W1UA 4QB2A 3ROUA 5KHGA 3RZHA 1AZDA 2WIIB 4UYBA 1A6CA 1YO8A 4G3YC 4Y5SA 1Q43A 3OD0A 5T3NA 3O1OA 1F5JA 1TME1 1YWKA 3I2KA 3N9QA 4X6RB 2WFF3 5FZ7A 2VNGA 2O0OA 1UWWA 1FNYA 4AI8A 4LK6A 2HWE1 1PGL2 1PMJX 1ZZ6A 4ARYA 3HN3A 4HKOA 1IPKA 5I8SA 1KFUL 4FBFA 4HXCA 4DS0A 1AVBA 1OI6A 5FFOC 4LLOA 2VD7A 3WLUA 2P2KA 1KD7A 3NJXA 1A3KA 1OC1A 2VO5A 1PGL1 2GNMA 4BISA 4CP9A 1CD3G 2VZUA 3MPBA 4FP2A 3TB0A 4M01A 3GBFA 2VBPA 1H0BA 3USUB 2DUQA 4AOCA 4HFSA 3FX3A 2IXJA 1V70A 3AC0A 4BQ2A 2FD8A 5LY1A 1K5MA 3VBUC 4EYUA 5FYHA 3A0NA 2XKPA 4B4RA 2CY6A 5A6QA 2WQ4A 1TVGA 4PLOA 1HQLA 2E63A 2WQZC 5BY5A 1RJ8A 4ZONA 4JTOA 4RQPA 5JMOA 1RMU2 1ENSA 1Q8VA 3AKSA 4K40A 2D6MA 3LZZA 1V6MA 1CX4A 2YYOA 4GH4A 3E5QA 2IFRA 4YW2A 5FZHA 5C4WB 1JUIA 4EWAA 1AXKA 2WNVC 3KVAA 2AZ5A 4L0PA 2A7AA 5FJHA 2X8KA 3AK0A 3OUHA 5CVRA 5FXWA 4LO8A 5CFDA 1RMU1 1SG3A 1F2NA 3RI9A 4IV1C 5CKQA 2ZX2A 3C7EA 2BQPA 1UYYA 1OLQA 4DB5A 1SFYA 5ABJC 4FPEA 3U4XA 4FP3A 3A22A 3NNMA 4HN1A 1NXMA 1RUE3 2A1XA 3BTAA 3I49A 1I3HA 4UW4A 1C8NA 3ZFFA 1YQ8A 3RZZA 2XXZA 2BFUL 5HXVA 5LWBA 4HPKB 3K3OA 3KVBA 4M4PA 2GP3A 3M3CA 4OQ9A 4ZHNA 2GC3A 3VHPA 2GSYA 4EZ4A 2B42B 2ZS6B 2UY8A 1NOVA 3KF3A 4TSVA 1W9TA 4DINB 1GUIA 2D7FA 5A70A 4LHNA 3VZLA 4W50A 4XF4A 3TNQA 2VQUA 2DFBA 5DAXA 3Q8EA 2WWUA 2C24A 5FQ0A 5IK5A 1UKRA 3AVSA 5FY1A 4PDWB 4YGEA 4PIZA 2A6YA 4Q4V3 3PJQA 1T6BX 4B4QA 4Q4W3 2RR13 3DXUA 1R1A2 4UFKA 1IPJA 4E4DX 2QQLA 3THTA 3VHRA 5H9RA 2VZ3A 1DQ4A 2JDMA 4YARA 1H4GA 3M2MA 4CCMA 2FDGA 3RG0A 2E6VA 4LK7A 1R1A1 1WLWA 3ETPA 3QBQA 4AFCA 2VXJA 1HB1A 3H8UA 5FYCA 3J8F2 4DZGA 3Q8CA 1O59A 3SH3A 4YFZA 1NA1C 1W05A 4XABA 1XYPA 2CGNA 2VC9A 4B29A 1VBA1 2MEV1 4G4FA 2JG8A 5B4XA 4WZFA 5T5OA 4K6BA 1SPPA 3J8F1 5J3UA 2YXSA 4QPIB 4ZU5A 4IE4A 4MGQA 4DUVA 1JZ4A 4L2NA 2WWSA 1D2QA 3WF4A 1UN1A 3NV1A 3GF6A 4W4ZA 4UFJA 1UIKA 4Q2FA 2JG9B 1ND2A 1ODNA 2VMEA 2ZGOA 3AP6A 2QDNA 3I2OA 1AJOA 4DUWA 3AMQA 1PIV3 4CU9A 1YFXA 5ISLA 1XNKA 1ALYA 4HK8A 3WOGA 2ZX0A 2J1RA 3OSDA 1ZRCA 4E2GA 3UL2A 2BVBA 1FV2A 2J1UA 2ERFA 1J1TA 4BOWA 4LJHA 1A78A 2JDZA 4JRLA 4RL7A 5FZ0A 4AE2A 3VL9A 1GICA 1ZZCA 4MZUA 1ZZ7A 2VNOA 4EQVA 3V0AA 2QTWB 5L9VA 5CB7A 3TEXA 2Y6JA 1QJEA 4QQ2A 4BH9A 5I0SA 1Q8OA 1W8HA 2BBVA 2JXAA 3KLSA 5L73A 1X9TA 2YPJA 3AVRA 4L11A 4CDUA 2R49A 1NCRB 2VW0A 4ATFA 2YG0A 3WF0A 2Q30A 3KT1A 3BTYA 2WKKA 3AMPA 1GWLA 4XJUA 1DU3D 2VZPA 2VTXA 3CLPA 1S2BA 3N3HA 1H6XA 3AZYA 1UU6A 3MIFA 2WAOA 3N36A 4GA9A 4IV3C 3EHKA 2WYSA 5D8AA 1MS3A 1XBFA 2VE1A 3I7DA 2EALA 5FLHA 2CWSA 1G9FA 1DQ5A 2VMCA 3H7YA 1F35A 3VBRC 2AEZA 4CUBA 2D6KA 4YZ1A 2E26A 1W6NA 3JQXA 5KC6A 1VIWB 5CADA 5JAXA 1JBCA 1WW5A 5FK7A 2H6CA 1WMDA 4FQ4A 1SLTA 1NZCA 3POBA 5FPLA 4CYDA 4FVVA 5BNPB 2BYVE 2HEVF 3LKJA 2Y6GA 1CZTA 3ASIA 1BYHA 4GMP0 2B8MA 2ZZJA 3LCPA 1CAXB 4PIYA 5D21A 5A3OA 4L92A 3BKZA 1VRBA 4GZ9A 3VDDA 4N9IA 5CU1A 5FAXA 1NT0A 2E32A 4QX0A 1PX4A 4KGGA 3H9AA 4UFIA 3LAGA 2RV9A 4JV4A 4Y5TA 4BLJA 2NN8A 4E4SA 4BIOA 2WFF1 1S0JA 3HBKA 1V00A 2ZEYA 2P3KA 1IQDC 3ILRA 3POSA 3PU3A 4FPYA 3T0BA 2WQ8A 2EIBA 1ZX5A 1WCKA 4GMP3 1MS1A 3IIAA 3J7HA 3OGJA 4Q4Y3 4QM8A 5CFCA 1MEC2 5FIXA 2E51A 5IAVA 3RJRA 1H9PA 1W9FA 4QX5A 4WVVA 5CIRA 1GBGA 4AVSA 1AX1A 3SKVA 3X29B 4IEZA 2AR6A 3HWJA 5J96B 5AFBA 5L19A 1G9CA 1QJX3 4C90A 1HV1A 2NM1A 3OBTA 4P9JA 5ACA3 5L7OB 4NJ4A 3JBG3 3OG2A 4LLFA 5BXXA 4JVAA 4RR3C 2ZCWA 2CHHA 3P3PA 1LOAA 3H3ZA 4FPLA 4LBLA 1DYOA 4XFAA 1OKQA 1QXPA 2J1VA 2A5ZA 4K9SA 1LU1A 2UWBA 3D0JA 5FYMA 1ASJ3 3N4MA 2BGCA 1RUG3 3FL7A 3POGA 4NIAA 5LW9A 5A6ZA 3N9LA 1UD1A 1WCSA 2ZX4A 4YW6A 1JZ5A 1FAYA 2OZ6A 2C6SA 1DLCA 2VZSA 4COUA 1CAWB 4M3CE 5JXHA 4PCRA 5KBFA 2OT7A 2CYFA 1N3OA 3KGLA 4MSVA 3B7MA 5DDJ3 3KQRA 1C5IA 1YIPA 2JDUA 3BN6A 4BQXA 3H1MA 2Y60A 3GCWA 3ZKUA 4HONA 2N7GA 2W2IA 2NPIA 1AYN3 2VOWA 2WSVA 2CGPA 2RM23 5FZBA 2KR2A 1ZZBA 4XXAA 1DQ0A 1UOBA 4I3PA 2UYBA 5E8AA 1UKGA 5KXCA 2GC2A 3NAPB 4XBQA 3R6SA 4YW1A 1BXHA 4JX0A 1L7QA 1OF3A 2XJUA 4MXWB 3PHMA 4YNIA 3RYKA 4CDXA 4DPNA 5K9YA 1TZOA 1M4WA 2VMDA 2V5DA 4XF1A 3KV4A 3MI8A 4P9WA 2YBSA 2GP5A 3E6DA 1HRV3 3OYWB 5C8CC 3B00A 4CDQC 2RS52 5EPAA 1WMXA 1GP4A 3LPGA 1LNSA 5IT6A 1VB2A 3U0ZA 4Q4W1 3WF3A 5GM0A 3RVHA 1DGWX 4AI3A 1JYTA 5K0UA 4Y3OA 3VL8A 5IK8A 3PUQA 1WMEA 5JR7B 5C4WC 2RS51 2ZHNA 1W8UA 3NNFA 3CNAA 3MV11 4QB1A 4IGPA 5FCCA 2WNOA 3LB9A 5FP7A 1D0GA 2D5HA 1OFSA 1OT5A 4W6WA 4AI2A 2ZPXA 3C3VA 4B3NA 3RZJA 3AKPA 2IVJA 4CU8A 3N7JA 3HN1A 1YXWA 1CJDA 3R4SA 4LBQB 1X33A 1KJRA 1HX6A 1W06A 4S2GA 5F6LB 3S0MA 4LBMA 4R9CA 2RS13 3S7EA 2Z79A 3I2FA 1GZCA 1GQGA 2B7YA 3NRUA 3KT4A 4D3WA 4Z1VA 2XBO2 4Y20B 1OVSA 4GJYA 5FP3A 1UZVA 2QZ3A 2XQXA 2DV9A 2GU9A 1ULFA 1BEV3 3HD8B 5CISA 2SBAA 4N43B 3RJ2X 2D43A 1TQ5A 2ZAAA 1HB4A 1PIV1 3PMSA 2IUWA 4KI5M 4XF0A 4ZS2A 2JENA 5FZ9A 4EN7B 3VD3A 3TN93 3QH7A 2BJSA 5E6HA 1GKBA 5FZGA 2DCJA 3AP9A 3WCRA 2Z4FA 1STMA 1UF2C 4NUBA 1WCUA 1QIQA 1W6QB 5FZOB 5FXXA 4F7ZA 3B02A 2W1SA 2OXBA 4HPKA 4KBBA 5ANNA 3CJIC 1GR3A 5JXGA 1VE0A 4MX3A 1BQPA 4DXSA 1AXZA 1PO23 1RC6A 3RI8A 1DBNA 3M3IA 4NWWA 4PHZA 3CU7A 5EJZB 3NJVA 3AP4A 1HJGA 1SFNA 5JIUA 5FMDA 1LOEA 1QOOA 1GQHA 2RVAA 2WAAA 3MYXA 1VBC3 3KV5A 4PDWA 3PVNA 1PHMA 4Y4RA 2GALA 2VUDA 1O3RA 1HN1A 1RUC2 2I07B 4FFHA 1O4TA 4Q5OA 3H50A 3R4DB 4R4XA 4WVZA 4QQPA 4BCUA 1W8OA 2WZR2 4QX3A 1YQ6A 3JD73 4YZ3A 1JYIA 2OQ7A 5FKCA 4UOJA 5J36A 5CZKA 2XONA 5DABA 3RWNA 3GNEA 5G05L 5LEKA 5F5AA 5F5IA 2WZR1 4CCJA 3H1YA 4GKYA 1XYOA 3T2OA 1O5LA 3E1F1 2VAUA 2Z5WA 3B94A 2NP0A 2HWC3 4GB33 3VBOC 4BMEA 2P3JA 1ZYBA 2F4PA 4LBKA 1RVF2 4HG6B 4IUGA 2V09A 3VLBB 4QPIA 1WCDJ 4XCAA 1OSGA 3VBHA 4AGRA 2JDYA 5B2GB 1LOGA 3H3LA 2CTVA 3GZUC 4JKKA 4GJZA 4JGZA 2FMYA 4FTSA 2BRTA 3K77A 5LA9A 2P34A 1FPN3 2JG9A 4GMP1 5K8SA 1UZZA 4BQYA 1ZRIA 5F2SA 3IPVA 1I6XA 3VBUB 4FFGA 1DCSA 4M3CA 4ZU4A 2JDHA 3ACLA 1J3PA 5G04L 5HPOA 3O5SA 1V9U3 5JUVA 3AP5A 4YM1A 2OIIA 4YPJA 2B39A 4QKDA 1O4ZA 2XUMA 3GZTB 1ULEA 4KMQA 2WNVB 1YQ5A 1OQEA 4AQ6A 2XJTA 1HXS2 4B7KA 3CF6E 3LOBA 3IDBB 5T52A 3POWA 3KCCA 2QNKA 4YYOA 4IEVA 4LOSA 5DUWA 4IV1B 1C57A 5GLVA 1FATA 2PHXA 2R7EB 5LRSA 1ASJ1 1UY1A 1JU3A 4XZPA 1DHKB 3WNPA 1NCRA 1UIJA 2WNUA 3FMGA 4N53A 5D2AA 5T5JA 1HXS1 4ZU7A 4A3XA 4XUPA 2R0FA 4MV2A 4NOTA 3ZXFA 1N1VA 1HQNA 3TYJA 3WDXA 3I3DA 5JCTA 2G9FA 1RTVA 2DBIA 2RM22 4PT6A 5F3IA 2YPDA 2FBEA 4GULA 4XACA 1LOFA 5FYSA 4AK3A 2C1FA 3PTRB 3RYRA 4JCKA 4MXVA 2WRAA 4DNYA 2AACA 1WKYA 1F8VA 4Y4YA 4Q4X2 3TRSB 1WWYA 2RM21 4BHPA 4D69A 2ZMLA 1D0HA 4AW7A 4S2HA 4A45A 1RYYA 1U5ZA 5F8PA 5IFTA 3C8XA 3KCXA 2NMOA 5A1FA 3H8RA 1W6OB 3ZDSA 1CAXA 2VQ0A 1VBE3 4MGZE 2VR4A 4UW3A 4WVMB 3ZDVA 3L2YA 1VBD2 4DRVA 3NJYA 5L7OC 4IEYA 1P8JA 4A44A 2J42A 4DFSA 1YLLA 5FY9A 1X8MA 1KGYA 4HKWA 3ZR6A 4BK5A 5F2WA 4NN0A 1QXRA 3ZSLA 1RMU3 3C7OA 3ZSMA 1I5PA 4W6YA 1JYNA 2A6XA 1VBD1 3PVBB 1NA1B 4JRAA 4LQRA 1YI9A 5FR3A 4RFRB 2QQUA 4KGQA 1DLLA 4OULA 3FZ3A 2DUOA 4YVWB 4K1ZA 1NQJA 3RMYA 5JZGC 1FNZA 3WW3A 4MLOA 1US3A 1C1FA 5DUUA 1HB3A 2A70A 2YB7A 4META 1LOCA 4NVPA 3WG4A 4NPMA 4XUOA 5FDBA 4IEXA 2PQQA 2DYCA 4DEQA 3KSCA 2BDRA 2B9UA 3E6BA 3BALA 3D8CA 1H8TC 4LHSA 5JWPA 5A3WA 1PVC3 1ZVFA 4IESA 2VU9A 3HNYM 4ONUA 4MGSA 1Q5OA 3DL3A 2RS11 5I0TA 3UKNA 1QJY2 2LS6A 2DWRA 2Y34A 4YW3A 3P5BA 2Y38A 3O1VA 4LBNA 5DXDA 2XKOA 2Q0AA 3T1LA 3ZVXA 1LOBA 3D4KA 2X10A 2QFEA 3FBMA 3Q8BA 2DU1A 4FPJA 2VCAA 3B3QE 2QBXA 4EJRA 1BCXA 2QQWA 4YZ2A 3FFZA 3HQUA 2BU9A 2KM2A 4UW5A 3DPRB 4OMDA 3KV6A 3MFAA 2Q8OA 1RB8G 1RXGA 1CAWA 4AEJA 4Q8KA 3R4UA 3H8OA 2ARXA 1E57A 3TN91 1KEXA 1R1A3 3IB3A 5FUIA 1MS9A 2C26A 2ZGMA 1XSRA 2CU5A 2JB4A 2WL1A 3RMXA 1BMV2 2QCSB 3DKWA 5FXZA 2PHUA 4LE3A 2Y33A 4OI1A 3W5MA 5LASA 1GQPA 2JEMA 4LKEA 3AXEA 5F39A 3WUDA 4PI0A 3ACIA 1ZA4A 4JKLA 2Q5TA 2P4EA 1RXFA 1RUOA 3J8F3 1JYVA 1BMV1 2GMEA 1REEA 3MIBA 3Q8AA 2XLFA 4MXWA 4UFHA 1JUHA 4TLGA 2GN3A 2CDPA 4J6GA 1OPMA 3RS6A 4QDQA 4CEYC 5M0TA 3B5LB 4QHZA 4UFLA 1J1LA 1I9RA 3APBA 2HH9A 1O4YA 3VBRB 5C9AC 5FK8A 5JXIA 3F95A 1FXZA 3ZXJA 1GSLA 2ZABA 1QQP2 2OUJA 2BNOA 1XC6A 3ZYBA 3QCWA 2RJ2A 1ACCA 5FP8A 1HDKA 1NUKA 2PQSA 2IFWA 3P6BA 4HMZA 4Q1PA 1VMJA 1LHWA 2R1DA 2R042 2XLGA 3WD5A 1C8M2 3U11A 1QQP1 3LDRA 4J1XA 4IGOA 4OHZA 2FZ2A 3VD9A 1QOTA 1NY72 1UY4A 1DP0A 4GALA 4XF3A 3ZYGA 1CPNA 4GB32 4QB6A 4QXBA 1PZ9A 2ZJCA 4YG6A 2R041 4XDOA 1JZ6A 1C8M1 1ULGA 5HV4A 2I2SA 4DIQA 3K75B 1OKOA 4Y22A 1NY71 5E1RA 3M8LA 4MG2A 5EQUA 1OD3A 4GB31 4Q0VA 3DYPA 3JU9A 2AEYA 3B9IA 1JYWA 3UNPA 1RINA 2RDQA 2ZEWA 4HOOA 2R32A 4W65A 4LO6B 4OUEA 4QWNA 5CYYA 5K4LA 1RUI2 3TWIA 1SEFA 3AMMA 4K3UA 3LF7A 2BBAA 3L2HA 5C5UA 3WINE 2JE8A 3RNSA 4D7YA 1ND3A 3ES4A 4OHXA 1B35C 2BFUS 2JB8A 3DKQA 2HWB2 1FPN1 2R072 4E4HA 1RUI1 2AC1A 3UV9A 1LHVA 4GWMA 1CZSA 1ENQA 2W52A 2QQKA 4BQ1A 3ZYPA 1AL22 2VOTA 2HWB1 5A6YA 1FI2A 1FMD2 2VVDA 3J7NA 4YW7A 4BJ0A 3OUJA 4OZOA 5FKBA 1PZ7A 1KXGA 5F37A 1AL21 5A7NA 4JHTA 5FYBA 2VZVA 3AFKA 4XIKA 1FMD1 4HBNA 3C7HA 4QD2A 3MLLA 4RFT0 4HT1T 3PTYA 4OCTA 3MBWA 1OPOA 1AR62 2ET7A 3M3EA 1D2SA 5BUVA 5DZGA 2WS92 4MYEA 3MLJA 1UY0A 5LA0A 4QKFA 2Y26A 3CO2A 3UETA 2W87A 2CNAA 2D40A 4TWTA 5FZLA 5FZFA 3D0SA 1N1SA 3LIGA 1KDMA 3AJYA 4P9GA 1LHUA 2UWCA 3NNJA 4AVCA 3NV3A 3BIWE 3LEMA 3ZPOA 1CN1A 3D5OA 4AGVA 1FT9A 1T6GC 1VR3A 2SLIA 2AH2A 4QXKA 5GJ6A 4CDWA 4QAWA 4I0AA 1MEC3 3I97A 3SCHA 5C5TA 2VBDA 1D4M2 2QQNA 1VBE2 4Y5Z0 5IK7A 4QMAA 3V56A 1H2MA 5C8CB 4CDQB 4A3ZA 1YHFA 3BVCA 4GWNA 1W8NA 4AWDA 2X53S 3VKLA 3OD4A 4BDVB 4GH4C 4YW4A 1RHI2 3HT1A 5JSOA 4FPGA 1D4M1 3KHCA 1VBE1 4NHYA 4QX1A 1J58A 2XUEA 4A6OA 3NWKA 4ASLA 5CFDC 2IXCA 4XJ9A 1HQWA 2H6BA 2GMMA 2WUHA 1POQA 4XHBA 3ST7A 1CGPA 1GNHA 1G9DA 3ZFEA 1XQNA 4LTAA 1GFF2 3RDIA 1RIRA 2YV8A 3IAQA 3ZR5A 1OUXA 2FCVA 5HXMA 2FDKA 5A3MA 1XU2A 3BCWA 3BU0A 2LUWA 1W8TA 2WO3A 4S2FA 2A6ZA 3OBZA 3O0WA 3ZFFC 4JGYA 2OKXA 2Y6LA 4BA6A 2DU0A 4QGLA 3ES1A 2ZMNA 3AZZA 3WDVA 1PVC2 1E5HA 3IN9A 5JOWA 1AL0G 3ZSEA 4AHWA 2ARBA 3DV8A 1G9AA 2TEPA 4HK9A 3JUUA 1VLNA 2QQOA 5EXOA 2J1EA 2W39A 4UFMA 1PVC1 1XE8A 5FJKA 3ZMOA 1WW7A 1EPWA 4LO7A 5A32B 2LALA 3NNGA 4DXZA 3Q9OA 4IV1A 4XDQA 2X29A 1F5FA 4XQ4A 5FWEA 2YC2A 5GLWA 5ABJA 5A7SA 4K8FA 3ZYRA 4QGNA 1QJU2 3W9AA 5FZAA 2V4AA 1SCRA 3ZXDA 1Q3EA 5JMCA 4IDZA 3RSJA 5AVAA 4LHKA 4RS5C 1UZYA 5DUXA 2RS53 4AI9A 1APNA 1QJU1 2VZQA 3CJIB 5FYYA 1FX5A 2ZHKA 1QOSA 4XMIA 5B4NA 5FPAA 3AYAA 3ZX7A 4JQRA 2YFUA 1F31A 2W5FA 4LT5A 1YQCA 2IC1A 2CWMA 3S6PA 5JPMB 2JWPA 2BUKA 1J3RA 2W91A 4HVRA 5HCBA 4YVWC 2P17A 3I2DA 3WF2A 4EN9B 4KG0A 4H3WA 1DYKA 4O65A 4MGKE 1HKDA 4UXAA 4IE0A 5FY7A 4AGGA 1ZZ9A 2E53A 1W3XA 4P9XA 3HPNA 1JU4A 4WVMA 4S2DA 4CU6A 2XBO3 2B4KA 3ZFGA 3OY8B 3WQ7A 4FOQA 4FPOB 3WHTA 4XBNA 3IZOA 2PXJA 1HB2A 1N3PA 1POV0 4P14A 4Y1XA 3VZNA 2WO1A 2HBTA 1IZ3A 1NA1A 2EXKA 4ATEA 1LESA 2UU8A 1L3JA 5DG1A 1T2XA 3PURA 3RQ0A 2WDBA 3K46A 2QQIA 3VBOB 4AEKA 1AHSA 5A33A 3MW3A 3DPRC 4FTBA 2WA4A 3POIA 2DVGA 4D8MA 1QY4A 2EIDA 1LJ7A 4GXLA 4NR1A 2XWJB 3SQOA 3V64A 4W6XA 4YVSA 4IEUA 1U5YA 1MQTC 1H30A 1ODMA 4RN5A 1UX6A 5KXEA 3LA3A 4I0WB 1MPXA 2X05A 2YMZA 3UKVA 1W2AX 2BTVC 1Y9MA 1TG7A 2GH8A 2W68A 3W20A 4WM7A 5FUPA 1JS9A 2MHFA 4LO5B 1S2EA 4NAMA 1YC61 1SDDB 4YW5A 2YDEA 5FZ3A 1K42A 3VV1A 4BXSV 2LRPA 4EV0A 2OPWA 4JZRA 1H4HA 5GLZA 3ZYFA 3WXPA 2AGSA 2WT2A 2VPVA 1BHGA 3B9CA 4A7KA 1VRH2 4Q0QA 3WY6A 4QPGB 1ONAA 5EJ3A 1RUC3 5F32A 4QXCA 2Z2SB 4EWEA 1S2KA 4U2AA 2WZR3 2NMNA 3IKWA 1EUTA 1VRH1 2YY1A 2UY9A 4H2AA 1VAKA 1UMIA 2ZGSA 5A7QA 1O3TA 5BNNC 2JE7A 2R062 4BXFA 1BVVA 1HJFA 4R52A 2ZEXA 4IV3A 1V6NA 3AL6A 5AC92 5JVVA 5DG2A 3V0BA 3T30A 1Y7BA 1ENRA 2YROA 1RVF3 2GAUA 2R061 3VBRA 4QX2A 3PL0A 1UL9A 3HNMA 1ZA7A 3VBFC 4INDA 2K2SA 4EZHA 4OMCA 4YRDA 1MS4A 5F3GA 1H1MA 3BPZA 2VOVA 1YJKA 2ZA9A 4AHZA 3J4UH 5BYNA 2XWBB 2R30A 4AFMA 2QQMA 4BWOA 4Q0UA 4Y1UA 1V0AA 1MEC1 1O5UA 5FYZA 4AAXA 2ZBJA 2HWF2 2FMDA 5DAVA 3WW4A 2P3IA 2XDVA 3K2OA 3I3BA 1FOD2 4QX8A 2PLV2 1QH7A 2O1QA 2ZGRA 3EXUA 4LKFA 2C5DA 3LEIA 4JQTA 2VM9A 4IEWA 2NYYA 4TXWA 3SXWA 5FY0A 3JB4C 2HBUA 4LEJA 3PVEA 2OA2A 5DZEA 1FOD1 3FE5A 3NJZA 4ZS3A 1HXS3 3MW4A 4NHLA 3N9MA 5FV3A 4E9KA 5JZGB 1AUYA 3K4ZA 3VKMA 2XQRA 1ZBA2 2PA7A 3O1TA 4XURA 3SCFA 4AR2A 4C91A 1ST8A 2BGPA 4NRQA 3VKFC 2A3YA 3ZN6B 4P08A 4XVHA 3L9JT 4R8HA 3S7IA 1QH6A 1H8TB 2B45X 5A80A 3H8XA 1ZBA1 3IT8A 3CL1A 4RR3A 1KFXL 4N9HA 1IG0A 3N7MA 5I8YA 1UPIA 3HT2A 4B4PA 4FPCA 4CRQA 5JXJA 2YHJA 2G19A 4CEWA 3JCIA 1EV13 1UOFA 4OI4A 5IVCA 4A7YA 3CKHA 4AHXA 4LUKA 2XJPA 4Q4X3 1BZWA 2X5IC 2OQ6A 3ALQA 5FWJA 3U1XA 3FLPA 1YYNA 1EUUA 3O0XA 3GZEA 1DZRA 4NHMA 4CCLA 1OD5A 1C5HA 1VMHA 4XXPA 1TMF2 4COYA 5A3UA 3T1MA 1YRZA 1C28A 5GLUA 4D6RA 4XFIA 3I59B 1JHNA 2VL4A 2OZJA 2W1WA 4FPKA 4HANA 3LSEA 5A3PA 2OPKA 5K0UC 1VBD3 1MS5A 3ECQA 3VBSC 4XAAA 1O3SA 4MADA 4N7UA 1TMF1 4X6QB 5IUQA 4PF1A 4QX7A 3OPTA 1H6YA 1Q8QA 4Y24A 1PK6C 5CG8A 1Z7S2 4FPHA 5C7GA 5IATA 4DQAA 3T4VA 3URFA 1R082 4PF5A 2BV4A 2ILMA 3T2TA 4IQPA 4CEYB 3ZXKA 1RUD2 2Z69A 2XL9A 2Q8EA 5C9AB 4KQ7A 3GDBA 5CAZA 1SQ4A 3USUA 3CBNA 3M7AA 1Z7S1 2W9XA 4CU7A 1RITA 2QKDA 3CDZB 3CJXA 3UT0A 4DO0A 1D7PM 2DVBA 4C1XA 4CA9A 1R081 2Y0IA 2JD4A 5C8CA 2YBPA 3FBYA 5BV6A 3BI3A 1RUD1 1REFA 4PIXA 2QQPA 3O1MA 3VZJA 2C9AA 1PNGA 4U36A 1QDCA 5FO7B 2LM3A 3AKRA 2W1QA 4O7XA 3IMMA 1SLLA 1QJY3 2HJIA 2ZACA 1DIWA 3UK9A 5C4WA 2Q4SA 2O14A 2UYAA 2XBO1 3DN7A 3J9SA 4EN8B 5ANQA 5LK5A 3M3QA 4PBOA 5KHHA 1GOGA 1QU0A 3U75A 4DEVA 4CXYA 2VUCA 2DCZA 5FPBA 3H7JA 2WZEA 1SMVA 4Z2AA 2EXIA 1WW6A 3C7GA 4IEOA 2XHKA 3ZXLA 1W28A 1QF3A 2HKXA 4AI0A 2PHRA 1XYNA 1NZIA 1DDLA 2FCTA 2ENRA 3RZLA 4ZY9A 3BOWA 2BGOA 1WLTA 3O12A 3ETQA 1ZM1A 1POV1 1B35B 3HVDA 2QZ2A 3VB9A 3OUIA 1IOAA 1XNAA 2WN3A 3KB5A 4QHOA 4L99A 5TSWA 3SHRA 1MVQA 5EIYB 3PNAA 5A32A 2V73A 1OOPC 1V6KA 3GYDA 4FO9A 4NROA 3ZKYA 5HV0A 2Q1ZB 1XE7A 4K1YA 1QMJA 5FMOS 1GMMA 4FFIA 4L97A 2WYFA 4P9IA 2YGMA 3VKNA 2GNBA 3O0VA 2JJ6A 2NQYA 1ZZ8A 3I3EA 3HJRA 1QQP3 1V6IA 4MHRA 3VZMA 5BNOC 2WJSA 1DYPA 5L9RA 1UU5A 4XAEA 4AQ2A 1CZVA 4BQ4A 2ZGPA 2R043 3U37A 4AI1A 1C8M3 1LEDA 3VD7A 1RUC1 2VBBA 1R092 3WUCA 3AYDA 2YC4A 5GZDA 3S30A 1AR92 3AZXA 2QVSB 1YCIA 4XOGA 1HV0A 1NLRA 5FLIA 1DQ6A 1I5ZA 4ZPIA 4CXXA 1X36A 4LKSA 3VBHC 1HRI2 4CP9B 1R091 2WFPA 5IVEA 3VDBA 4JGZC 2MNGA 4J1WA 3PUSA 4NMIA 3ZXEA 1RVF1 1S0EA 3AM2A 4FSJA 3MW2A 1GWMA 3LWCA 2E7QA 1RUI3 2WLPA 3NL1A 4UAPA 1Z78A 2KA3A 4WZCA 2D6PA 3UGFA 1H2KA 2RJLA 3MO4A 3AZWA 4Y1YA 3WG3A 5FZ4A 2VOKA 3AXDA 1H1AA 2W46A 3SH5A 4Y1VA 4AVVA 1M06G 5DAPA 2HWB3 2R073 3IDEA 3A7QA 4FCAA 3JZVA 5T55A 4GH4B 3OOXA 3ABZA 3I54A 3I2HA 3NW4A 4FPFA 3N35A 1E5SA 4AVAA 2FQPA 5FO8B 2E7AA 1W99A 1IKPA 1OH4A 1LHOA 3OGSA 2EXHA 1L7LA 1W9YA 1AL23 5SV5A 5CFDB 5CKMA 4D7TA 4YGDA 1FMD3 4KWLA 4A42A 4K8RB 4SBVA 4FTEA 3LSDA 5LCWL 3MF9A 3QD6A 3N7LA 2VCCA 3N9OA 1OH3A 1W04A 2DFCA 2WNUC 3FHQA 4QPGC 5H9SA 1R1ZA 2ETEA 3LDBA 1CPMA 2V5YA 3HOBA 4E8CA 3ZFFB 2E33A 4FOYA 2IXKA 2WO2A 5IW0A 2DCYA 2WO7A 2ZKLA 3D3AA 4IEPA 1WD3A 1AR63 3ZIXA 1PO12 5KHJA 2WS93 2DVDA 5F1RA 4XFHA 5C3QA 2RS32 1RJ7A 3SKJE 1W8WA 1NCQC 2OVUA 4OHWA 4HLTA 1EV12 1A34A 4Q1RA 1PO11 4MGIE 5C33A 5JPNB 1VJ2A 4L9BA 4YM2A 3ACHA 1MS0A 5T50A 1GV9A 3ENRA 1VBB2 3FWEA 2RS31 3N7KA 3UGGA 2UWAA 3S5QA 3WNMA 3RYPA 1EV11 4AXOA 3AKTA 3VUOA 5BNPA 1URXA 3T3YA 4Q4X1 1W0PA 4NHKA 3PLQA 5FPXA 1D4M3 2HWD2 2Y8KA 1W9SA 3WQ0A 4RS5B 2PTMA 3MIGA 3OBAA 5KHKA 4BB3A 4H7MA 1QEXA 1BBT2 1RHI3 2OW4A 3ZXGA 3PJYA 2HWD1 3FHAA 4AFAA 2JE9A 3WV6A 1WCQA 1EAH2 3C2UA 1UMZA 1WLDA 3WT3A 4RHV2 5FP9A 4FT8A 1NG0A 3A21A 3OPZA 4JDNA 2FDJA 2YU1A 1BK0A 2ES3A 2RMU2 1BBT1 3LDKA 2P1BA 1EPZA 4HSLA 5F3EA 3CZUA 3UESA 1V6OA 2UURA 1JN2P 1EAH1 4V2WA 5EZWA 2WZPP 4RHV1 2XJVA 3AYEA 4BZ4A 1K12A 2P5BA 4XC9A 5FBJA 3RFRA 3T2QA 1PM7A 3UGHA 4BQ3A 3MDPA 3PU8A 3U78A 3WP4A 5A1LA 1UCXA 2E9QA 2VVFA 5SV8A 5J98B 2PHFA 1G7YA 3WG2A 1EY2A 2VJXA 1ZRRA 2I74A 5L7OA 3MF6A 4P00B 1SBEA 1OA3A 2Y0OA 4ASMB 1ZNPA 4K21A 2ORXA 2XVKA 4UF0B 2GC1A 1OMIA 4EN0A 2RE9A 5FPZA 2ARCA 2BZDA 5IVYA 4AHYA 4ET7A 3KWVA 5GKAC 3V0AB 5DPNA 1UNBA 3O1UA 5FZCA 3WDUA 2OS2A 1QJY1 5FZKA 1QNYA 1OLMA 2J1AA 5JR2A 1AJKA 4PI2A 1IGOA 5JZGA 1O3QA 5C3SA 1S4CA 3ZPYA 2GMPA 1WBFA 4BK4A 1W2NA 1QJU3 3ZN6A 3ME2A 4HETA 2DF7A 1MQTB 1H8TA 1V6LA 3PUHA 3RGBA 2ZZQA 4XUNA 1XPWA 2A3XA 4XQWA 3KT7A 3THPA 3O7OA 1LGBA 3FN9A 5I0UA 1VMFA 2GH2A 1UQXA 3MZHA 1YFWA 5IFPA 2ZGQA 3NAPA 5C3PA 4NAOA 1O7FA 3MIEA 3JB8A 3KM5A 3W21A 4NIDA 5IVBA 1TNRA 2V72A 4KU7A 2XOMA 3WDYA 1TE1B 2B46X 1UXXX 2C9KA 2ZGTA 4XFCA 5HBAA 4IE5A 1LAJA 3B01A 4XF9A 5LY2A 1COV2 3VHNA 3BPSA 3OYWA 3POJA 3P3NA 3I59A 4UWDA 1KS4A 5FRAA 4BU2A 2EF6A 5IAXA 2GNDA 2ZAHA 1Y9GA 2PELA 3USSA 3QH6A 4PJYA 1J59A 4AEDC 4W8JA 2LW8A 5BNNB 1S0IA 2ZX3A 2XVGA 2RHPA 5EJ1B 4TZDA 1JYXA 4WM8C 4Q0PA 4DY5A 2QE3A 4LUMA 2WBKA 3PIJA 4XIOA 2A3WA 4PLNA 1NYWA 3KF5A 4EN6B 3K51A 1YFYA 2XR4A 5A3TA 1V6JA 3T0AA 1CR7A 5C9AA 3ZOIA 2ZMKA 3U14A 5EP9A 1WUVA 4LBQA 1KJLA 1LRHA 3VBFB 4QPYA 1JH5A 1GOFA 3WP5A 3BOPA 2W3JA 2XH6A 3V65A 1RGSA 1ND3C 1JZ3A 2CL2A 4D6QA 5HCHA 3DCQA 4Y20A 5CNAA 3GJBA 1Y43B 2BERA 4OLLA 4XFGA 1IHMA 5DAWA 1SCSA 1QGLA 1XOYA 1KS5A 3ILNA 1US2A 3WNNA 1ULPA 5IJRA 5E89A 4N43A 2D3RA 4XHXA 2ZHLA 2QDRA 3SNMA 5J7MA 1IS6A 3DYMA 4XILA 1W6MB 4CCCA 1CAVB 2PHTA 4I3GA 1NE6A 1REDA 1NLSA 2G9GA 2R071 5FY8A 2D6NA 4RD7A 5IK4A 2JKBA 2GNTA 3DUIA 4FXKB 4HZFA 1LODA 3CHXA 1OLRA 5FY4A 1VRH3 3HQRA 4UBHA 1W6QA 2ZGKA 4H55A 5FREA 5FZOA 4B1MA 3ZYJB 3DECA 1IG3A 3OBRA 4IERA 1TNFA 5EWSA 1BJQA 3T2PA 1SDWA 1PZ8A 3RZKA 1RUH2 1SLCA 1U5IA 3LIHA 1W6PB 1Y9QA 5D1IA 3THCA 5JOXA 1UY2A 4FOVA 1ZBE3 3ORJA 3WCSA 1HLCA 1NXD1 3D6EA 2R063 2Y6HA 5F5CA 1LECA 2W92A 3OF1A 1RUH1 2J1TA 1UU4A 3QACA 4XTMA 5FYUA 5LZ6A 3RZMA 1AR61 1UY3A 2CSGA 4GAZA 1QKQA 2DCTA 2YFZA 4KWKA 5AC93 1JW6A 5C71A 1TME2 1SLBA 2WS91 4FAGA 3W59A 1H1IA 5JI9A 1Q8PA 4LBQD 3J7LA 1U0AA 2HWE2 3OPWA 4XYXA 3GJAA 5C3RA 2ZGUA 5F3CA 2GC0A 2XLAA 2O8OA 1AR72 2X5IB 5BNQA 1K5MC 2QQVA 3AKQA 4QHBA 4DY3A 3EO6A 4LMFA 4AEMA 2A6WA 4XJZA 3SMHA 1OFNA 1PVXA 1UO9A 4AYUA 4B7EA 3PVOA 2CDOA 2VTXJ 4IGQA 1JHJA 1AR71 2BNNA 5EYXA 3WQBA 3NO8A 4RQPC 1OF4A 3KGZA 5K0UB 3VBSB 2HWF3 4GIQA 4AL9A 3POEA 1HW5A 1MR5A 1FOD3 2CV6A 2PLV3 3MGUA 3ZXAC 5A3NA 1HIXA 3KCYA 1PK6B 3ZFEC 2PAKA 2A73B 3LFMA 4MO3M 1GZTA 3BTZA 3RZGA 1QDOA 2GDFA 4FOWA 2FDIA 3KZ4C 1RHI1 5F9TA 1QWRA 4F3JA 2TBVA 3EQEA 2ZEZA 4JKMA 4JGYC 3LGRA 5IVFA 1W0NA 1WLCA 2D97A 5FZ1A 4URAA 5KXBA 1ZBA3 1BK1A 1IS4A 2ADDA 4CP0A 1H2NA 1UYPA 3VBUA 1WA4A 2G9ZA 2XJRA 1JZ2A 2JD9A 1UMHA 2WINB 3HNBM 4NO4A 4PBPA 3TEZA 4FXGB 5IVJA 1RUF3 1W03A 3H1WA 4XFFA 4Y26A 3NSTA 4YM3A 4OUSA 4YG3A 4SLIA 3GBGA 4M00A 1PGW2 2WNVA 2BNMA 4ITCA 3WNLA 2P6CA 2VCBA 3OGRA 2P6HA 3WF1A 5FYTA 1DZQA 3DF0A 3HR9A 5FZEA 4HSJA 2PN5A 2R6QA 4DUXA 1PGW1 5DMYA 2ZGNA 2PFWA 1JZ8A 4AQTA 1NQDA 3H3UA 3BIEA 5FTTC 1OXCA 3M4FA 1TMF3 5FYVA 4BYYA 1X7NA 2EXJA 4L8QA 1K45A 2JIJA 4PQ9A 3ZN4A 5JI7A 4AVTA 5HI0A 1GYKA 2Y6FA 1NAEA 1JZ7A 3RPQA 3NV2A 1DQ2A 2VMHA 1S0GA 1S0CA 2WT0A 4TN7A 2JG8C 4XUQA 1Z7S3 4TLFA 2H0VA 1OOPB 2WLQA 1MVEA 2J22A 1XRUA 2ORZA 2VECA 3NKGA 4XETA 1R083 5IVVA 3S57A 4N7IA 2BOIA 2Q1MA 2JDAA 1IPSA 1NE4A 1PGSA 1RUD3 4K7JA 4LA3A 4MH0E 4QXHA 5C6CA 2B9VA 1DGRA 1CIWA 2VQAA 1ND2C 4GKXA 1W6OA 4MGTA 2AYHA 3HAGA 3ZFGC 3WVJA 2BWCA 3LEKA 5LBBA 4D0QA 1JODA 1VBA2 2MEV2 2PAMA 4LOTA 4RS5A 5DUVA 1Z0HA 4Z07A 5BNOB 3ZYIB 3TAYA 1MZEA 1XXNA 4CSWA 1PNFA 4MVTA 1IKQA 2WC2A 2E7TA 5AFEA 3SEEA 4XMAA 5F6KA 4QU2A 1W0OA 1F4HA 4QQLA 2DDUA 2D44A 4LR4A 5A7PA 5IYYA 2R16A 3TOJA 2V4VA 3AJZA 2RDSA 4LIVA 2ZKNA 4YVWA 4NIIA 3VBHB 3KV9A 4YM0A 5JSRA 1CAUB 2Z42A 1XU1A 1AR83 4JGZB 3CMGA 4YVSC 3NQHA 3OB8A 1W9WA 4CDUC 2G4IA 1POV3 1GZWB 5LB6A 4CCNA 3IPVB 1YJLA 4WM7C 2DURA 1S1AA 2P37A 4LE4A 4M3CB 3WG1A 2WT1A 3BTXA 3AL5A 4Q26A 1DFQA 1H2LA 2RDNA 4LPLA 3VDCA 4NRPA 3ZLIA 4NIGA 3LA7A 5CBLA 4UF0A 1D4VB 5D8AC 1OURA 3VZKA 4RSUA 4CP2A 4I0BA 4AF9A 3BU7A 1CQ9A 2VGDA 1MS8A 3A0KA 5EHDA 5FOJB 2TNFA 3DPRA 3EBRA 1G6NA 1YQ2A 4TYSA 3ZIWA 3GZAA 4KWUA 2WNUB 4ISQA 4LBOA 1MQTA 4N53B 4QPWA 4ES9A 3OGVA 2J7MA 3VDDC 3IBMA 3LE0A 1RUJ3 1ZBE2 2RJKA 2VXRA 5DZFA 4MUVA 4YGBA 2FZ1A 3SC7X 1YNAA 1YUDA 3WDWA 1R093 1O6UA 2W0XA 2RG4A 5DAQA 2X09A 2PHLA 2RDRA 1AR93 4MHUA 1J84A 2JECA 2TUNA 2Q1FA 5JIAA 4JDMA 2Q8CA 1ZBE1 1NCQB 3LEGA 1A8DA 4F8AA 2D5FA 3I2GA 3J26N 4LKDA 5CFCC 1HRI3 2F4LA 3CZJA 5HCAA 2ZX1A 3ZN5A 4EE2A 5AC91 3I2JA 3FC0A 2WFF2 4OZXA 1CJPA 1JYCA 5KC5A 3GXUA 1N3QA 2DBNA 3I2IA 4K20A 4E4ZA 1DQ1A 3LFIA 3O14A 3SH4A 2HLEA 2H0BA 4QDRA 5BNNA 2A75A 1JOPA 1PMIA 1WD4A 1ULDA 4N8MA 3CIHA 3MUY1 3IMNA 4A6SA 1UOGA 5FO9B 4LULA 4CUCA 4GWIA 2PAEA 2P3YA 1SLAA 1OQ1A 1XJAA 2K9ZA 3P1IA 1G8WA 2BP6A 1N47A 4XEZA 2HWF1 1C1LA 1EP0A 1AYM3 3VBFA 2BVVA 5JSPA 4X8PA 2KXLA 3BUCA 2PLV1 4D7SA 5L36A 5BPXA 3ZYHA 1DZTA 2ET1A 4XFBA 2DTYA 4BLIA 5FPVA 1OA4A 4V2VA 3B93A 1TEIA 1X82A 1PX3A 1X50A 3G7DA 4Y33A 4D94A 4AQSA 4R9BA 3BGAA 3WNXA 2VMGA 4ZKTB 1RUNA 1QHDA 1RL3A 1Y4WA 2YZ4A 4XCBA 5LBCA 5A7WB 3WW1A 2VNRA 3T09A 3VZOA 4JTNA 1KQRA 1RUF2 3K3NA 3WEZA 1PO13 1LCLA 4LHLA 4R9AA 4OHYA 1J3QA 4R4ZA 1N1TA 1W6MA 3OCPA 2PHDA 4CEWC 5K7PA 1CAVA 4CCKA 5E88A 5AVPA 4G9SB 4Z92B 2RS33 4JDOA 2JICA 3AYCA 3SLIA 3IIIA 3TEWA 1MACA 2EIGA 4CDXC 3UKTA 4ZXKA 1CIYA 1RUF1 3W5NA 4OFGA 1XNBA 1G9BA 4YFWA 2VUAA 1AX2A 2ZGLA 1RUE2 1QJFA 2ZOEB 1LULA 3CQOA 3MV01 1VBB3 2B5HA 1UAIA 2Y64A 3MEPA 2VH9A 3VN4A 1ZRDA 2XB6C 5GALA 3UYJA 1XB9A 4FQZA 3VD5A 4ORFA 2HEWF 4AVBA 1GNZA 3H0OA 3QOPA 1W6PA 5H9PA 5H9QA 4YZ5A 1RUE1 3ACFA 3IAPA 4QQHA 5I0DA 1E5RA 2HWD3 3Q8FA 4COZA 2CAVA 4YZ4A 1YFUA 1NX9A 5APAA 1HN0A 2C0ZA 4LBJA 1OHFA 3EB7A 4C0HA 1LHNA 4P5HA 3W58A 1BBT3 4C0BA 3GBWA 2IXLA 4Z2WA 1JMUB 1NLQA 4QKBA 2ZXQA 4YSFA 2XGXA 4A2UA 1EAH3 1WZXA 4JC1A 4XJWA 2XVLA 4RHV3 4Q4V2 1KITA 3MPPG 1Y3TA 4Q4W2 2RR12 2X5IA 3IWZA 4R9DA 1OQDA 2RMU3 5FZ8A 5LBEA 1JXNA 4AG4A 1CONA 2E31A 3VGIA 4IE6A 4NE9A 5KWRA 4HL0A 5CKNA 4YWAA 4Q4V1 4ASKA 3VHOA 2RR11 3A23A 2VW2A 3GHNA 4CDQA 3MFCA 2D98A 4Q29A 5GZGA 4LXLA 1W2TA 1GLHA 4IXLA 3VBSA 4IEQA 3NMBA 1VAMA 4O9GA 3ZMNA 3D82A 3HBZA 2PYTA 2JDKA 3R05A 4LITA 4AEDB 4CZSA 3ITQA 5A3LA 5KXDA 5LEJA 4NRMA 1W3VA 1PK6A 3PDQA 5GZCA 3RRDA 4CP1A 3T4HB 4A41A 1K3IA 4WM8B 4Y22B 1O8SA 1MZ5A 2MPFA 2PHWA 2WN2A 1S0FA 5FXVA 3HMYA 3FHIB 3WR0A 1WBLA 4IW3A 5I93A 5JLVA 1GNYA 1AR82 1OA2A 2CGOA 1XSQA 3H42B 4RA0A 2LROA 2A6VA 5L9BA 2O8QA 4XPVA 4MGYE 5FLJA 1PIV2 1F9KA 1ND3B 3NKTA 1AR81 4C8DA 3FJSA 4YG0A 3TBDA 1SLIA 2XHNA 1MZ6A 2Q8DA 5JOZA 1S0DA 4CUAA 2VUJA 4O61A 2XJQA 2HYXA 2IVIB 1CESA 4I01A 5FP4A 3EMRA 5EFUA 1XNTA 3DXTA 1OLME 3ELNA 4UBGA 1W2OA 1WGPA 2JIGA 4CPBA 1UYZA 3KS7A 2EVXA 4OI2A 4PDWC 2EAKA 2VY0A 4M4RA 1G86A 3OTFA 1U12A 4B8EA 4KWJA 4BQ5A 3IDCB 3AX4A 4X8NA 2DTWA 3EYPA 3BB6A 3INAA 4NPRA 3VD4A 3IM0A 3NNLA 1COV3 1WMFA 3B69A 4LA2A 2R0HA 4H14A 1UZWA 4RGGA 4Z8BA 3CEWA 1RUJ2 2LTNA 2FCUA 3CJIA 4F83A 1XNDA 4LNVA 2BPA2 2FHRA 4CE8A 5FY5A 5FZIA 3MICA 2ZHMA 1ENXA 3THDA 4WVWA 3AMNA 2DUPA 2AENA 4FFFA 2VW1A 3T0DA 3E5XA 3WSOA 4TTGA 1RUJ1 2D93A 1OOPA 4BM8A 1UW8A 4QPIC 4OI0A 4DXTA 4BIFA 1J83A 3GCXA 2PMWB 3IDAA 5J37A 1JOJA 1W8FA 4CDWB 2YU2A 2VVEA 1AR91 2ZTNA 4Z82A 3M70A 2JG9C 2D3SA 4RGAA 3MHZA 3M3OA 4M3CF 3O1PA 1HRI1 1K5MB 5BNOA 3BYWA 3A4UA 3OEBA 2AUYA 1C3HA 2WABA 3ATGA 4JAAA 1GOHA 1VALA 1LR5A 4M0NA 1O8PA 3OY8A 2JDNA 5FBZA 4QU1A 2VZTA 4RQPB 3WDTA 1WW4A 5LRRA 1DGLA 2YUEA 2BWAA 3OEAA 4D6SA 4JHZA 3SISA 3VBOA 4CPBD 4Q4Y2 3N9PA 4KH9A 1QXJA 1LU2A 1CAUA 1LENA 4IE7A 4XJAA 1AYM2 3JQWA 3ZFEB 4KG8A 5I91A 2VOXA 2VCMA 3LQCA 4WBBA 1BKZA 3ZM8A 4Q4Y1 4QKNA 1GZWA 1B09A 1C4RA 1NCRC 2GN7A 3ON7A 4N53C 4JGYB 3RWKX 4E8DA 4EROA 3HQXA 3POYA 4ZZ5A 1AYM1 4EWDA 3KMHA 4CCOA 5I0RA 5JDBA 1QJX2 2XPJA 2W47A 2ATFA 3PUIA 4QT6A 4E2QA 5ACA2 3K4DA 2WR9A 3JBG2 3JXSA 4MOAA 5FYIA 1RUH3 3TEYA 3T08A 5A7OA 5GLTA 2JKXA 5F7UA 1UOJA 1DG6A 5EYYA 3U07A 5I8TA 3AZVA 1MZFA 2C4XA 1LOFC 2W08A 3K48A 1H9WA 1S0BA 4PQQA 2VMFA 4CUGA 1QJX1 1X8EA 3HEIA 4PLMA 1ASJ2 2XL7A 5ACA1 1RUG2 3JBG1 4HKLA 2QQJA 1BVP1 1GU3A 3KQ4B 4KL1A 1ZREA 1TME3 5J48A 1KDKA 1PM4A 2IWGB 2DVFA 2JX9A 4IL7A 3ZO0B 5FQ0B 2XJSA 4XW3A 4XJ8A 5ABJB 3N9NA 4I02A 2HWE3 4P5YA 4QPGA 1RUG1 5DDJ2 4DOUA 5BNPC 2CAUA 5LA1A 3J7MA 3PIGA 1AR73 1IS3A 4CCEA 3AB0A 3VDAA 1LEMA 2GZWA 5E16A 2OYZA 1AF9A 5LBFA 1BLZA 1X9PA 4COVA 2VTFA 3E6CC 4ES8A 3E97A 1AYN2 1H8VA 1VBB1 5DDJ1 3NV4A 1SHWB 1DGRN 4HVQA 5IWFA 2OX0A 4E2SA 2JDPA 1GP5A 4XZUG 3HIFA 1SFPA 4XTPA 2DVAA 2BEOA 3SCGA 1NCQA
chains in the Genus database with same CATH topology
1AYN1 5FMOL 3WHUA 4AFBA 2BW8A 4Q8LA 1W2UA 2JG8B 1FYUA 1YIFA 2EAAA 4XE9A 1IS5A 3BODA 1HRV2 4KNCA 4DRRA 1SBDA 3SITA 5CA6A 2VG9A 1W39A 2IZWA 1IQAA 4N90A 3GHMA 3AP7A 1ND2B 2RMU1 3ZFGB 4P9LA 1HRV1 4GQ7A 4Q0SA 2D3PA 3G6JB 2R1BA 3MIHA 5T5LA 3OJBA 2DCKA 4ISRA 2IXHA 4QQOA 5A33B 5J09A 5HCFA 5FOBB 2NZ9A 3AMHA 3ILFA 4FAHA 1ZRFA 2RS12 1EYBA 1A8MA 1YI7A 4XQDA 3PMEA 3GALA 1JTZX 4YVSB 4LO4B 3WX5A 3I8TA 3TNPB 1XNCA 1GZ9A 1BEV2 4CDUB 2I45A 2IXIA 3WP6A 4WM7B 3OGGA 3FUOA 4DMIA 5KHIA 4A7ZA 1LGNA 3NAPC 1BEV1 4I09A 4OUMA 2QUOA 5D8AB 3TN92 3FFQA 2AREA 1LB2A 3LA2A 3E5UA 5GZEA 4E27A 1AXYA 2VMIA 2K0GA 1W6NB 5GZFA 1O91A 4URTA 5C8WA 3UJQA 3VKOA 4COWA 4XBLA 1PO22 1Q56A 1VBA3 5F5QA 2MEV3 3VDDB 4BE3A 4H7LA 1CVNA 1COV1 3MIDA 4Q27A 4O9EA 1SACA 1U5XA 5T5PA 4IV3B 1PO21 2VULA 1VBC2 4NWVA 3V0BB 1VP6A 5JOYA 1S55A 2EA7A 5T54A 2HYKA 4I30A 4CEYA 4OVEA 5CFCB 2F6BA 3NVCA 1VBC1 4QM9A 3JD72 4BPZA 4P9YA 4HN0A 4M0HA 4Y1ZA 3WZ1A 5EV7A 4BMBA 4N43C 3JD71 4V1PA 2D6LX 2HWC2 2WA3A 4AEDA 1LGCA 3EJKA 3KD4A 3R0RA 1GANA 1DF0A 1ULCA 2YC0A 1QNWA 2QJVA 4WM8A 1FV3A 4WV8A 1KRIA 3FUQA 4YGCA 3U10A 3UJOA 3WW2A 4OHVA 4ES8A 2HWC1 3ZSJA 4C1WA 2WNEA 1LTEA 1DGWA 1FPN2 1VAVA 1Q8SA 2D6OX 4I2OA 2A71A 4IETA 2YGLA 1AX0A 3LOIA 1N1YA 4HVOA 2WSUA 1V9U2 5LK7B 3I4IA 1QJZA 1B35A 3AFGA 4YLZA 3QLQA 4UW6A 4RR3B 3WP3A 3MLKA 2OUHA 2NLRA 3FLRA 1V9U1 4CEWB 2HEYF 3WQ1A 1VB4A 1I1EA 3M1HA 2XG3A 4AFDA 1LKNA 3ZSKA 1UPSA 4CDXB 3DGTA 4KU8A 4CDWC 3FLTA 1SBFA 4QGMA 5KHGA 3ROUA 1AZDA 2WIIB 1A6CA 1YO8A 4G3YC 5T3NA 1Q43A 3OD0A 1F5JA 1TME1 1YWKA 4X6RB 2WFF3 2VNGA 2O0OA 4AI8A 1FNYA 2HWE1 1PGL2 1ZZ6A 4HKOA 1IPKA 5I8SA 1KFUL 4FBFA 4DS0A 1AVBA 1OI6A 5FFOC 4LLOA 3WLUA 2P2KA 1KD7A 1A3KA 1PGL1 2GNMA 1CD3G 3MPBA 4FP2A 3TB0A 4M01A 3GBFA 1H0BA 3USUB 2DUQA 4HFSA 3FX3A 2IXJA 1V70A 1K5MA 3VBUC 3A0NA 2XKPA 4B4RA 2CY6A 2WQ4A 4PLOA 1HQLA 2E63A 2WQZC 5BY5A 1RJ8A 4JTOA 4RQPA 1RMU2 1ENSA 1Q8VA 3AKSA 4K40A 2D6MA 3LZZA 1V6MA 1CX4A 2YYOA 4GH4A 3E5QA 2IFRA 4YW2A 5C4WB 1JUIA 4EWAA 1AXKA 2WNVC 2AZ5A 2A7AA 2X8KA 3AK0A 5CVRA 5CFDA 4LO8A 1RMU1 1F2NA 3RI9A 4IV1C 2ZX2A 2BQPA 1OLQA 4DB5A 1SFYA 5ABJC 4FPEA 3U4XA 4FP3A 4HN1A 1NXMA 1RUE3 3BTAA 1I3HA 4UW4A 1C8NA 3ZFFA 3RZZA 2BFUL 5HXVA 4HPKB 3M3CA 2GC3A 3VHPA 2GSYA 2B42B 2ZS6B 2UY8A 1NOVA 4TSVA 4DINB 2D7FA 4LHNA 3VZLA 4XF4A 3TNQA 2DFBA 5FQ0A 5IK5A 1UKRA 4PDWB 4YGEA 4PIZA 2A6YA 4Q4V3 3PJQA 4B4QA 4Q4W3 2RR13 1R1A2 1IPJA 4E4DX 3THTA 3VHRA 5H9RA 1DQ4A 4YARA 1H4GA 3M2MA 3RG0A 2E6VA 1R1A1 1WLWA 3QBQA 4AFCA 3H8UA 4DZGA 3J8F2 3SH3A 4YFZA 1NA1C 1XYPA 2CGNA 4B29A 1VBA1 2MEV1 4G4FA 2JG8A 5T5OA 4WZFA 4K6BA 5J3UA 3J8F1 2YXSA 4QPIB 4ZU5A 4L2NA 2WWSA 1D2QA 1UN1A 3NV1A 3GF6A 1UIKA 4Q2FA 2JG9B 1ND2A 3AP6A 2ZGOA 2QDNA 1AJOA 3AMQA 1PIV3 1YFXA 1XNKA 1ALYA 4HK8A 3WOGA 2ZX0A 1ZRCA 4E2GA 3UL2A 2BVBA 1FV2A 2ERFA 1J1TA 4BOWA 4AE2A 1A78A 2JDZA 4JRLA 4RL7A 3VL9A 1GICA 1ZZCA 4MZUA 1ZZ7A 2VNOA 3V0AA 5CB7A 4QQ2A 4BH9A 5I0SA 1Q8OA 2BBVA 2JXAA 3KLSA 5L73A 2YPJA 4L11A 4CDUA 2R49A 1NCRB 2VW0A 4ATFA 2Q30A 3KT1A 2WKKA 3AMPA 4XJUA 1DU3D 3CLPA 1S2BA 3N3HA 3AZYA 1UU6A 3MIFA 3N36A 4GA9A 4IV3C 3EHKA 5D8AA 1MS3A 3I7DA 2EALA 5FLHA 2CWSA 1G9FA 1DQ5A 3H7YA 3VBRC 2D6KA 4YZ1A 1W6NA 3JQXA 5KC6A 1VIWB 5CADA 5JAXA 1JBCA 1WW5A 2H6CA 1WMDA 4FQ4A 1SLTA 1NZCA 4CYDA 4FVVA 5BNPB 2BYVE 2HEVF 3LKJA 3ASIA 1BYHA 4GMP0 2B8MA 2ZZJA 3LCPA 1CAXB 4PIYA 4L92A 3VDDA 4N9IA 5CU1A 5FAXA 4KGGA 4BLJA 3H9AA 3LAGA 4JV4A 2NN8A 4E4SA 4BIOA 2WFF1 1S0JA 3ILRA 1V00A 2P3KA 4FPYA 3POSA 1ZX5A 1WCKA 4GMP3 1MS1A 3IIAA 3OGJA 4Q4Y3 4QM8A 5CFCA 1MEC2 2E51A 3RJRA 1H9PA 4WVVA 4QX5A 4AVSA 5CIRA 1GBGA 1AX1A 3X29B 4IEZA 2AR6A 3HWJA 5J96B 5AFBA 5L19A 1G9CA 1QJX3 4C90A 1HV1A 2NM1A 3OBTA 4P9JA 5ACA3 5L7OB 3JBG3 4LLFA 5BXXA 4JVAA 4RR3C 2ZCWA 3P3PA 1LOAA 3H3ZA 4FPLA 4LBLA 4XFAA 1OKQA 1QXPA 2A5ZA 4K9SA 1LU1A 2UWBA 3D0JA 1ASJ3 3N4MA 2BGCA 1RUG3 1UD1A 1WCSA 2ZX4A 1FAYA 2OZ6A 4COUA 1CAWB 4M3CE 4PCRA 5KBFA 3KGLA 2CYFA 1N3OA 5DDJ3 4MSVA 3B7MA 3KQRA 1C5IA 1YIPA 3H1MA 2N7GA 2NPIA 1AYN3 2VOWA 2WSVA 2CGPA 2RM23 1ZZBA 4XXAA 1DQ0A 4I3PA 2UYBA 5E8AA 1UKGA 5KXCA 2GC2A 3NAPB 4XBQA 3R6SA 4YW1A 1BXHA 2XJUA 4MXWB 3PHMA 4YNIA 3RYKA 4CDXA 4DPNA 5K9YA 1M4WA 4XF1A 3MI8A 4P9WA 3E6DA 1HRV3 3OYWB 5C8CC 3B00A 4CDQC 2RS52 5IT6A 1VB2A 3U0ZA 4Q4W1 5GM0A 1DGWX 4AI3A 5K0UA 3VL8A 5IK8A 5JR7B 1WMEA 5C4WC 2RS51 2ZHNA 5FCCA 3CNAA 3LB9A 1D0GA 2D5HA 1OFSA 4W6WA 4AI2A 2ZPXA 3C3VA 4B3NA 3AKPA 3N7JA 3HN1A 1YXWA 1CJDA 3R4SA 4LBQB 1X33A 1KJRA 1HX6A 4S2GA 5F6LB 3S0MA 4LBMA 4R9CA 2RS13 3S7EA 2Z79A 4D3WA 1GZCA 1GQGA 2B7YA 3KT4A 4Z1VA 2XBO2 4Y20B 2QZ3A 2DV9A 2GU9A 1ULFA 1BEV3 3HD8B 2SBAA 4N43B 3RJ2X 2D43A 1TQ5A 2ZAAA 1PIV1 3PMSA 4XF0A 2JENA 4EN7B 3TN93 3QH7A 1GKBA 2DCJA 3AP9A 3WCRA 1UF2C 1W6QB 4F7ZA 3B02A 4HPKA 4KBBA 3CJIC 1GR3A 4MX3A 1BQPA 1AXZA 1PO23 1RC6A 3RI8A 1DBNA 3M3IA 4NWWA 3CU7A 3AP4A 1SFNA 5JIUA 1LOEA 1QOOA 1GQHA 3MYXA 1VBC3 4PDWA 3PVNA 1PHMA 2GALA 1O3RA 1RUC2 2I07B 1O4TA 4WVZA 3H50A 3R4DB 4R4XA 4BCUA 4QQPA 2WZR2 4YZ3A 1JYIA 3JD73 5J36A 3RWNA 3GNEA 5LEKA 2WZR1 3H1YA 4GKYA 1XYOA 1O5LA 2NP0A 2Z5WA 3B94A 2HWC3 4GB33 3VBOC 4BMEA 2P3JA 1ZYBA 2F4PA 4LBKA 1RVF2 2V09A 3VLBB 4QPIA 1WCDJ 1OSGA 3VBHA 4AGRA 5B2GB 1LOGA 3GZUC 2CTVA 4JGZA 2FMYA 4FTSA 2P34A 1FPN3 2JG9A 4GMP1 5K8SA 1UZZA 3IPVA 1I6XA 3VBUB 4M3CA 4ZU4A 3ACLA 1J3PA 3O5SA 1V9U3 3AP5A 4YM1A 2OIIA 2B39A 1O4ZA 2XUMA 3GZTB 1ULEA 2WNVB 1OQEA 4AQ6A 2XJTA 1HXS2 4B7KA 3CF6E 3LOBA 3IDBB 5T52A 3POWA 3KCCA 2QNKA 4YYOA 4IEVA 5DUWA 4IV1B 1C57A 5GLVA 1FATA 2PHXA 5LRSA 1ASJ1 4XZPA 1DHKB 1NCRA 1UIJA 2WNUA 3FMGA 4N53A 5T5JA 4ZU7A 1HXS1 4A3XA 2R0FA 4MV2A 4NOTA 3ZXFA 1N1VA 1HQNA 3TYJA 3WDXA 5JCTA 2G9FA 1RTVA 2RM22 4GULA 2FBEA 1LOFA 4AK3A 2C1FA 3RYRA 4JCKA 4MXVA 4DNYA 1F8VA 4Y4YA 4Q4X2 3TRSB 2RM21 4BHPA 4D69A 2ZMLA 1D0HA 4AW7A 4S2HA 1U5ZA 3KCXA 2NMOA 1W6OB 3ZDSA 1CAXA 2VQ0A 1VBE3 4MGZE 4UW3A 4WVMB 3L2YA 1VBD2 4DRVA 5L7OC 4IEYA 4DFSA 1YLLA 1X8MA 4HKWA 4NN0A 1QXRA 3ZSLA 1RMU3 3ZSMA 4W6YA 2A6XA 1VBD1 3PVBB 1NA1B 4JRAA 1YI9A 4KGQA 1DLLA 4OULA 3FZ3A 2DUOA 4YVWB 4K1ZA 1NQJA 3RMYA 5JZGC 1FNZA 3WW3A 4MLOA 5DUUA 1C1FA 4META 2A70A 1LOCA 4NVPA 3WG4A 5FDBA 4IEXA 2PQQA 2DYCA 3KSCA 3E6BA 2B9UA 3BALA 3D8CA 1H8TC 5JWPA 1PVC3 1ZVFA 4IESA 2VU9A 4ONUA 1Q5OA 3DL3A 2RS11 5I0TA 3UKNA 1QJY2 2DWRA 4YW3A 2Y38A 4LBNA 5DXDA 2XKOA 2Q0AA 3T1LA 3ZVXA 1LOBA 3D4KA 4FPJA 2QFEA 3FBMA 2DU1A 3B3QE 4EJRA 1BCXA 4YZ2A 3FFZA 2KM2A 4UW5A 3DPRB 1RB8G 3MFAA 2Q8OA 4Q8KA 1CAWA 4AEJA 3R4UA 2ARXA 1E57A 3TN91 1R1A3 1MS9A 2ZGMA 3RMXA 2WL1A 1BMV2 2QCSB 3DKWA 2PHUA 4LE3A 4OI1A 2JEMA 3AXEA 3WUDA 1ZA4A 2Q5TA 1RUOA 3J8F3 1BMV1 2GMEA 1REEA 3MIBA 2XLFA 4MXWA 1JUHA 2GN3A 4J6GA 1OPMA 3RS6A 4CEYC 3B5LB 1J1LA 1I9RA 3APBA 5C9AC 1O4YA 3VBRB 1FXZA 3ZXJA 1GSLA 2ZABA 1QQP2 2OUJA 2BNOA 3QCWA 1HDKA 2IFWA 4HMZA 4Q1PA 1LHWA 2R1DA 2R042 2XLGA 3WD5A 1C8M2 3U11A 1QQP1 4J1XA 4OHZA 2FZ2A 1QOTA 1NY72 4GALA 4XF3A 3ZYGA 1CPNA 4GB32 1PZ9A 2ZJCA 4YG6A 2R041 1C8M1 1ULGA 2I2SA 4Y22A 1NY71 5E1RA 3M8LA 4GB31 4Q0VA 3JU9A 3B9IA 1RINA 2R32A 4W65A 4LO6B 1RUI2 3TWIA 1SEFA 3AMMA 4K3UA 3L2HA 3WINE 3RNSA 4D7YA 1ND3A 3ES4A 4OHXA 1B35C 2BFUS 2HWB2 1FPN1 2R072 1RUI1 3UV9A 1LHVA 4GWMA 1ENQA 2W52A 4BQ1A 3ZYPA 1AL22 2HWB1 1FI2A 1FMD2 2VVDA 1PZ7A 1KXGA 1AL21 3AFKA 4XIKA 1FMD1 4HBNA 4RFT0 4QD2A 3MLLA 4HT1T 3PTYA 1OPOA 1AR62 2ET7A 3M3EA 1D2SA 5BUVA 5DZGA 2WS92 4MYEA 3MLJA 2Y26A 3CO2A 4TWTA 2CNAA 2D40A 3D0SA 1N1SA 1KDMA 3AJYA 4P9GA 1LHUA 2UWCA 4AVCA 3NV3A 3BIWE 1CN1A 3D5OA 4AGVA 1FT9A 1T6GC 1VR3A 2SLIA 2AH2A 4QXKA 5GJ6A 4CDWA 4I0AA 1MEC3 3SCHA 1D4M2 1VBE2 4Y5Z0 5IK7A 4QMAA 3V56A 1H2MA 5C8CB 4CDQB 1YHFA 4GWNA 4AWDA 2X53S 3VKLA 3OD4A 4GH4C 4YW4A 1RHI2 3HT1A 5JSOA 4FPGA 1D4M1 1VBE1 1J58A 3NWKA 4ASLA 5CFDC 2IXCA 4XJ9A 1HQWA 2H6BA 2GMMA 4XHBA 3ST7A 1CGPA 1GNHA 1G9DA 3ZFEA