1FYUA

Crystal structure of erythrina corallodendron lectin in hexagonal crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LECTIN
publication title Chemical characteristics of dimer interfaces in the legume lectin family.
pubmed doi rcsb
total genus 49
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fyuA00
1C4RA 2GN3A 3BODA 1VIWB 5CNAA 1Z78A 3FFZA 3V64A 5SV8A 4FPJA 4LBJA 1W6PB 3FBYA 4RL7A 5KXCA 1ULCA 2W52A 4CZSA 1LULA 3OBRA 1JYIA 2DVGA 4AGGA 1BYHA 4Q26A 1LOFC 1VALA 4YFZA 3WG2A 3M3EA 2PHUA 4GXLA 4XBQA 3OBTA 2P34A 1ENRA 2JDZA 3AZXA 3Q9OA 5IK5A 2ARBA 3ILNA 3ZSKA 4FPOB 2PELA 5GJ6A 4Z8BA 1F5FA 1JN2P 2JJ6A 4FPGA 4D69A 3DUIA 1FATA 2ZGQA 5T52A 1LGBA 5IT6A 5T54A 3AP9A 2DVBA 2H0BA 3O0WA 2ZBJA 3RMYA 4Y1ZA 2CYFA 3MW4A 1JW6A 2YROA 5CBLA 3ZXJA 3RS6A 2WJSA 4AVTA 4XOGA 3VKFC 1Z0HA 1CR7A 1V6KA 1GZ9A 1CJPA 1QOTA 2E7QA 2EXKA 1NXD1 4FPEA 1UZYA 2DU0A 1QKQA 3AZVA 1DIWA 2WT2A 2GNMA 5DZEA 1G9CA 1N47A 1X50A 3AXDA 2DTYA 5T5LA 3WCRA 2D3SA 4YG3A 2AH2A 2VXRA 4M3CE 1DHKB 3FLRA 5GZGA 1WLCA 2D6OX 4Q27A 2GMPA 4JC1A 1DZQA 1C1FA 2EALA 2EAKA 2NZ9A 4PCRA 3RQ0A 2A5ZA 4YW2A 1HQWA 2ERFA 1GNZA 1SCRA 1ULFA 4BPZA 3VKNA 3V0AA 1QMJA 3OYWB 4I30A 4YW1A 4FPLA 4ASMB 3AYEA 1N1YA 1UX6A 1H9PA 1UZZA 4P9WA 5T5JA 1VLNA 3SLIA 1GZWA 4P9XA 1WD3A 1MS8A 4GWMA 2XG3A 5CB7A 2AYHA 2P2KA 2W68A 1JHNA 2ZGPA 3O12A 3AXEA 1W6QA 4YZ3A 2GDFA 2GNBA 1KQRA 4YM2A 1ONAA 2AREA 2GNDA 2ZGLA 3IMNA 4GKYA 4TZDA 1ULGA 1WW5A 4FOQA 4R9AA 1SACA 3GNEA 4R9DA 5GLZA 3WHUA 1WW6A 2XB6C 3WZ1A 2JECA 1Y7BA 2UURA 4LBNA 1S0DA 1DYKA 2GNTA 4AVVA 2CL2A 2TEPA 1G8WA 1YRZA 2GN7A 2P3IA 1URXA 4OZXA 3UK9A 2ZHKA 2B7YA 4ATEA 4UW5A 3IPVA 1Q56A 3R4UA 3B9CA 1LOGA 1AZDA 2PHTA 3OPZA 5H9RA 2NP0A 2VUAA 3LCPA 5IUQA 2JKBA 4CRQA 1WLWA 3D6EA 1V6NA 4UW6A 2VW2A 5JOYA 3B01A 1F31A 4XBLA 2ZMNA 3AYAA 2DVFA 5GLWA 2WLQA 2ZGRA 1QOSA 3N7LA 1BXHA 1N3PA 4MYEA 5DUVA 2ZMKA 4M00A 3AZZA 5E8AA 3RRDA 5GLVA 3BOPA 3QLQA 1UAIA 5EXOA 2ZGMA 2NM1A 1V6IA 4LBMA 1QF3A 4H55A 5T50A 4PQ9A 5DZFA 3PVEA 3HN1A 3ZYRA 3V0AB 3M1HA 4FP2A 3FLTA 4FOVA 4BLIA 2NN8A 5IK7A 1KDMA 5T5PA 4XHBA 1YO8A 3LSDA 2BQPA 1DQ6A 4C1WA 4FQZA 1IOAA 2E7TA 2CNAA 4XMIA 1TEIA 1GZWB 4Y24A 5KXBA 4XJAA 1G9AA 2A3XA 3SNMA 4R9BA 3USUA 2ES3A 1MS0A 2ENRA 1MZ5A 5HCBA 1KJLA 4JCKA 2EXIA 4YZ5A 4WZFA 3HMYA 1AX2A 3AP6A 3BIWE 1SCSA 4YGDA 2Q5TA 4GALA 1APNA 3AP4A 1MS1A 1S0IA 4XJZA 5T5OA 3WUDA 3ENRA 1OFSA 1LGCA 1Q8VA 5EYXA 2CWSA 1KJRA 4AGVA 2DYCA 1N3OA 3A0KA 3N7KA 4K20A 3PVNA 1LESA 3AJYA 2GMEA 3NV1A 3MPPG 4UW4A 3PVOA 4HANA 4WVVA 3WUCA 4AYUA 2CTVA 2DVAA 1LOFA 3WG4A 1H9WA 3N36A 1LOCA 1QOOA 1WW4A 4AVSA 4YM3A 1YXWA 1CONA 1LU1A 3WDUA 1LHWA 3WHTA 2GMMA 1AJKA 1Q8OA 5AVAA 3W59A 3VV1A 1JYCA 1UN1A 3ILRA 1ULDA 4AWDA 4DS0A 1G7YA 5KXEA 1IKPA 2ZGOA 4AGRA 1YYNA 1IS3A 2DTWA 3D5OA 4M3CF 1DQ2A 4DRRA 1LCLA 2ZGKA 5DUUA 2D6PA 1WCSA 2W39A 4K21A 3TB0A 3ZXFA 4NOTA 4YGEA 1PZ7A 3ZPYA 4ATFA 1QU0A 1EPWA 1LENA 2D6LX 3RG0A 1AF9A 1W6MA 2A6ZA 2YXSA 4XJWA 2ZMLA 3BTAA 2VY0A 5DXDA 2Z42A 5EYYA 3WVJA 1V00A 5H9SA 3ZVXA 5GLUA 5JDBA 1GSLA 2A6XA 1SBEA 1ZA4A 2LTNA 2YY1A 1O4ZA 1RINA 2ZA9A 3USUB 1GV9A 2D44A 3AFKA 4Y20B 1YI7A 1MS5A 2PHXA 1AX1A 3DGTA 3N7MA 1GBGA 2ZGTA 2DV9A 4XILA 3D4KA 3OY8A 3TAYA 1Q8SA 2WKKA 3ATGA 5JVVA 4Y1VA 5DUXA 5IK8A 4XXPA 4XJUA 4FVVA 3VUOA 4YFWA 1V6JA 2AUYA 4YM1A 5E89A 4FPFA 4Y1YA 2ZKNA 1FNZA 1PZ8A 4NO4A 4WVWA 4ZKTB 4XZPA 1QGLA 4XTPA 1MZ6A 1WBFA 1A3KA 5LK5A 4LBQA 1CVNA 2A3WA 5GM0A 4BQ1A 3QCWA 3ZXLA 3FLPA 1LECA 1C1LA 2E53A 3M3QA 2AR6A 1LGNA 3ILFA 1SLAA 4YZ4A 1DFQA 3M3CA 4PBOA 3POYA 4DRVA 1JOJA 1LHVA 5CA6A 3V0BA 1GICA 4Y22A 2A70A 4U2AA 4BOWA 1N1SA 4XE9A 3WOGA 3WDTA 3ASIA 3HR9A 1LTEA 5IK4A 2E51A 1N1VA 3I8TA 1IKQA 5BYNA 3KQRA 2UWBA 1UPSA 2HYKA 3H0OA 1UKGA 1AJOA 3MW2A 4DPNA 1G9DA 1W6PA 2ZAAA 4M01A 1FAYA 4Q2FA 2P3KA 1HQLA 1V6MA 3FUQA 1UL9A 3JUUA 3PMEA 1GKBA 3A4UA 1S0FA 5GZFA 2ZGUA 3WCSA 4LBKA 4YW4A 1LOBA 3VKMA 2A71A 1Q8PA 2A6WA 2VU9A 3AJZA 4R9CA 4FP3A 5JOXA 4Q1PA 1LEMA 1R1ZA 2FHRA 5CAZA 1ENQA 4ITCA 4Y1XA 1MVQA 4FPYA 3AYCA 1S0GA 2WSVA 1G9BA 1DQ4A 2C9AA 1N3QA 1AXYA 1B09A 2DUQA 2KM2A 3OY8B 3C2UA 1ZM1A 3OGGA 4JRAA 4P14A 4DFSA 2RHPA 1AVBA 3T1MA 1BQPA 1H30A 1LJ7A 2PHFA 4L8QA 4XJ9A 1WW7A 2OVUA 1SBFA 3AZYA 4XMAA 4Q8KA 3WDYA 3CNAA 1A8DA 1BJQA 4FOYA 4YGCA 5T55A 1LHUA 1QNYA 4YZ2A 3ZSLA 2W08A 1FYUA 1W6QB 2PHRA 1HDKA 1MACA 1DQ1A 1QDOA 2OUHA 3IKWA 3NWKA 4YW5A 3V65A 1C57A 1FNYA 4BMBA 5HCAA 1DYPA 1N1TA 2OUJA 4ISRA 2CY6A 2D7FA 3UL2A 3B69A 2OW4A 3A0NA 1SBDA 5F5QA 4K1ZA 4Q1RA 4LBOA 1I1EA 2WT0A 4UW3A 5EWSA 3IM0A 4TYSA 5GALA 2WNEA 5KXDA 4C1XA 1W6OA 1S0CA 2YV8A 2R16A 2VW1A 4Y1UA 4BLJA 2FMDA 3IPVB 3T2TA 1QDCA 3VKOA 4PBPA 1GZCA 3I4IA 3B3QE 3RMXA 3AK0A 2CWMA 2YZ4A 4LBQD 1WLDA 3OYWA 4ZXKA 1F9KA 5FRAA 2R0HA 4FPKA 1Q8QA 1AXKA 2EXJA 4YM0A 5DG1A 5JMCA 1VAVA 5GZEA 1MS9A 3VKLA 2DU1A 3O0VA 1S1AA 5DG2A 3SISA 2A3YA 4IQPA 4PF5A 5E88A 3POSA 3AP5A 4XIOA 1MS3A 1V6OA 3WDWA 2ZABA 1U0AA 2VW0A 2ZGSA 1CQ9A 4XTMA 3ZSMA 1D0HA 2JE9A 4YGBA 1VAMA 4M3CA 3SITA 3UJQA 1AX0A 2R49A 5JLVA 1IS4A 1FV2A 3N3HA 4LBLA 4P9YA 3R05A 3ZYPA 2YMZA 1LODA 3NV3A 4ISQA 4RA0A 2LALA 1SLIA 3MEPA 5JOZA 4YG6A 4FQ4A 2DUOA 3SH5A 4GKXA 1JBCA 3N35A 1G9FA 5JOWA 4BMEA 1S0BA 4WV8A 2G4IA 2WT1A 1GYKA 1DBNA 1MVEA 3WNXA 4BM8A 1LHOA 3L2YA 3M2MA 1RIRA 2D3RA 5DUWA 1AXZA 1NLSA 3M3OA 2V5YA 4DQAA 2DURA 4Q8LA 2DUPA 1OKQA 2ZZJA 2A6VA 2NMNA 1I3HA 1W6OB 2GALA 5DZGA 1LOAA 1WD4A 2E6VA 4XXAA 3U4XA 3AZWA 2UU8A 1DLLA 2NYYA 1GNHA 2A6YA 2DWRA 3GALA 4YG0A 3N7JA 5H9QA 1SFYA 4FOWA 3NV4A 1KRIA 3IN9A 1BKZA 2P3JA 3NV2A 4XBNA 1O4YA 1IS6A 4Y26A 3WV6A 3O5SA 3AX4A 1PZ9A 5GLTA 3WDVA 4XDQA 1W0PA 1CESA 1KITA 2R1DA 3INAA 5GZDA 1YIFA 3WLUA 5GZCA 1SLTA 1ULEA 4SLIA 4FPHA 5L73A 1W6NA 2SBAA 4GA9A 1CPMA 1WBLA 1GLHA 1S0EA 4YLZA 3PJQA 1JUIA 4U36A 4XIKA 5F9TA 4K1YA 2SLIA 3ZXEA 1W0OA 2D6NA 3MW3A 1SLBA 3OJBA 4M3CB 4YW3A 3JU9A 1W6MB 2I2SA 1FX5A 3FUOA 1HKDA 1LU2A 1KDKA 2ZHNA 3R4SA 1CIWA 1GANA 2WSUA 3SH3A 1D2SA 1CN1A 1WUVA 2C5DA 3AP7A 3W58A 3AYDA 2ARXA 1MR5A 2R1BA 4W65A 4F83A 4YZ1A 2D3PA 3ZXKA 2PHWA 2ZGNA 2ZHLA 3ZSJA 2V73A 2A7AA 3POWA 2EIGA 1LEDA 1DGLA 1JXNA 1SLCA 1OQ1A 2UWAA 3KM5A 3SH4A 5HCFA 4XYXA 3UJOA 2DVDA 3O0XA 2A75A 2D43A 2P37A 2ZACA 5FREA 1J1TA 2EXHA 3LSEA 1MS4A 2VH9A 3APBA 1QNWA 1CPNA 1V6LA 1IS5A 4GWNA 1RITA 3WDXA 4LBQB 2NMOA 1LHNA 2D6MA 2ZHMA 2AGSA 1HLCA 2R0FA 2AENA 4CTEA 3T1LA 3WG1A 3RSJA 2EF6A 4XJ8A 4XHXA 3V0BB 1S0JA 3B00A 4Y22B 1SLLA 1XQNA 4KBBA 4FPCA 4HL0A 1DQ0A 2UWCA 1LOEA 3WG3A 1FV3A 2JD4A 2D6KA 1W6NB 1G86A 1DQ5A 1UMZA 1A78A 2WQZC 2JE7A 4Y20A 5H9PA 1ENSA 1BZWA
chains in the Genus database with same CATH superfamily
2XJRA 4HONA 4N43C 1QJU1 3GZTB 5FBJA 2O14A 5LW9A 2JDAA 3HWJA 3CMGA 5L9RA 2C24A 2J7MA 2QQOA 1LULA 5C33A 3FHAA 3LGRA 4PI0A 4Y33A 1UOFA 1W39A 3L9JT 3U14A 4Q26A 1ND2B 3NNMA 2W91A 3VBSA 4CXYA 3RGBA 1L7RA 2P34A 1ENRA 2BRTA 1XU1A 1ZVFA 2XVKA 2ZX1A 3D3AA 3HNMA 3U37A 2LW8A 2WO3A 1S2KA 4JDOA 4FFHA 1BVVA 4FPOB 2R071 4MUVA 4BDVB 2JJ6A 2ILMA 2RDRA 4DOUA 2B5HA 4Z8BA 1AR83 3H42B 5A33A 1FATA 2ZGQA 3ZYIB 4D69A 4RR3B 1RUF2 4E2GA 5BNNB 1H8VA 4V1PA 2H0BA 2QQJA 3DYPA 2ZBJA 2VOVA 4RGGA 2J1SA 3U07A 4N53C 4ZZ5A 5CBLA 2VG9A 2WJSA 1UMIA 4QB6A 3WW3A 5C7GA 5FZEA 4DXTA 1Z0HA 1UCXA 4FO9A 3K4DA 1NG0A 5F32A 1CJPA 2Y6JA 3T09A 1QJZA 2UYAA 1UZYA 2DU0A 1CZTA 2XHKA 4AFDA 2WT2A 5DZEA 1G9CA 2HWC1 4HSJA 1N47A 1W8NA 1WMDA 2RM22 3AXDA 2DTYA 5FXVA 4Q4X2 4YPJA 3ETQA 3NAPA 3QOPA 4UT5A 3ELNA 2OZJA 1WMFA 1WZXA 2FCTA 5GZGA 1TVGA 1K5MA 1AR91 2D6OX 2MHFA 1TE1B 1DZQA 4JC1A 4LHSA 4Q27A 3ZSEA 4JDMA 2EALA 2NZ9A 3KHCA 1RVF2 2A5ZA 4EE2A 3WQ0A 2BEOA 1GNZA 1OOPB 1UY4A 4QPIA 4BPZA 3QACA 5BUVA 3OYWB 5I8YA 1KXGA 1R1A1 1AL0G 2B9VA 4ASMB 3AYEA 1N1YA 3IDCB 4OUMA 5T5JA 1VLNA 2QQUA 1MS8A 4JDNA 2XG3A 2VQAA 1QJX3 2AYHA 4UFKA 2QCSB 1VMJA 1JHNA 2OA2A 4XF9A 3I2GA 4NUBA 2VBPA 1EPZA 3MIGA 2Y0IA 1W2OA 2AREA 2CHHA 2ZGLA 3K3OA 3IMNA 1SACA 2VZUA 1ZREA 1YHFA 2K2SA 2WZR2 4X6QB 3URFA 3M4FA 2EAAA 2JECA 2K46A 3DF0A 5FZMA 2ET1A 2XKPA 3TEYA 3ETPA 3PUQA 2GNTA 3UKNA 5LA2A 3VBUA 5ACA2 2TEPA 1ZNPA 2P3IA 4PIZA 4QU2A 2IUWA 2JB8A 2YC4A 2ZHKA 5FPXA 4QX1A 3AMMA 2FZ1A 1UKRA 5DABA 3WR0A 3R4UA 3B9CA 2CSGA 1H6YA 3J9SA 3OPZA 3E1F1 1QJU3 1NYWA 2EIDA 3C7EA 4NHXA 3LCPA 4M4PA 2JKBA 3POEA 4LO6B 1WLWA 2DDUA 3LB9A 5JZGB 2E26A 3OPTA 5AFBA 1GQGA 2RS11 4PF1A 4PDWA 3B01A 5BV6A 1F31A 2ZMNA 2PAKA 4WM7C 3USSA 2XBO2 2ZGRA 1BEV2 3N7LA 2Z4FA 5C4WB 3NNJA 1O6UA 4MYEA 1GWKA 2ZMKA 3RRDA 3ZM8A 3FWEA 3RJRA 1B35C 5CIRA 1V6IA 5AC91 4H7LA 1QF3A 2R073 4H55A 2WNVA 4E2QA 4A4AA 2JDMA 5A6XA 4CU7A 4QGMA 3W59A 5F6LB 4BE3A 3V0AB 4NJ4A 3FJSA 3OPWA 3RYRA 2NN8A 4CCOA 4LKDA 4AXOA 5DDJ2 5T5PA 4C1WA 4JAAA 2BQPA 4LLOA 4GMP0 4J6GA 2IWGB 3AMQA 2B42B 1TEIA 3AB0A 1VBB2 5CFCB 5FXXA 3TEZA 1OLMA 1U12A 5FP4A 4D6QA 2Y0OA 3SNMA 2NPIA 4CEYB 5A80A 2DF7A 1Y3TA 2QJVA 1MZ5A 5HCBA 1KJLA 1JS9A 4CSWA 3S0MA 4C90A 4GALA 1R091 2HWC3 4N43A 3WUDA 1O59A 2RS33 1OFSA 4N7IA 1PX4A 4MLOA 2CWSA 1KJRA 3BPZA 4IV3B 5APAA 1N3OA 3BIEA 1EV13 1TQ5A 2QQIA 1GOHA 3AJYA 1YFXA 4UW4A 3WUCA 4YVSB 4HANA 4AL9A 4FTBA 2W2IA 4AYUA 2RJKA 1AUYA 2DVAA 3AVRA 3MO4A 1O8SA 4XDOA 1WLTA 2P5BA 5JSOA 3J7NA 1LOCA 4KG8A 3LOBA 1QOOA 3KV6A 3QD6A 4IEQA 4YM3A 1OVPA 3DXUA 4RD7A 5I0UA 4YSFA 3BB6A 1RYYA 1YXWA 5FBZA 3WDUA 2BGCA 1VBE3 4YVWB 1JU3A 2WRAA 5FOJB 1CAXB 2QDRA 1PIV3 3J26N 3MYXA 1UN1A 1ASJ2 1SZBA 1ULDA 2JIGA 5EHDA 1G7YA 3PDQA 5FYUA 3U11A 3RWKX 1MQTC 2AZ5A 2R6QA 2WFF1 4EN6B 1IGOA 1YYNA 3GF6A 4IERA 5LA9A 1K3IA 3VZJA 5I0TA 1NXMA 1LCLA 4RGKA 4JGYB 2D6PA 2QQLA 1WCSA 3NKTA 3ZXFA 3VBRB 1UZ0A 5FQ0A 4NHYA 1LENA 4S2FA 2GC2A 2W92A 3RG0A 4PHZA 1AF9A 3WF1A 1XNKA 3K48A 3CBNA 1F8VA 2XXZA 3ON7A 5A1FA 3BTAA 3O1TA 4AEDC 5H9SA 3ZVXA 5GLUA 2W1QA 1GSLA 4GIQA 5FZ7A 1SBEA 1ZA4A 2LTNA 3HOBA 5C3SA 5IVJA 1ST8A 3LQCA 3HT2A 2ZA9A 3MIFA 3JQXA 3PMSA 2JG9C 5BNPB 1SG3A 4Y20B 3THCA 5BNOA 3DGTA 1GBGA 4XILA 2DV9A 2RS13 1PGL2 1X9PA 3TAYA 2WKKA 1COV2 3HJRA 3WP4A 1S2BA 4XXPA 1JYWA 3KHBA 1V6JA 1RXFA 4BXFA 4YM1A 4XF1A 5A7WA 4NN0A 4O9GA 1RUH3 4ZKTB 4XZPA 5G05L 1QJEA 1HRV1 2K9ZA 1MZ6A 2BNMA 3I2OA 5FZ3A 3ZXAC 5LB6A 4AI8A 4Y3OA 5F2WA 3QCWA 5F1RA 2BUKA 3EXUA 2Q1FA 4AFBA 4MADA 1LGNA 5IWFA 4IDZA 1KS4A 1O3QA 3M3CA 3KB5A 4PBOA 3POYA 1JOJA 1RMU3 1UXZA 5SV5A 4U2AA 5IAXA 4BOWA 5CG8A 3U78A 5IVVA 2BFUL 3GZEA 4GQ7A 1OC1A 4LA2A 2W9XA 4JGZC 2Y26A 1NLRA 1QIQA 1VBC1 1I5ZA 4OZOA 1IKQA 5E6HA 1R093 2VULA 3OSDA 4Y4RA 4Z1VA 1CD3G 3H0OA 2D5HA 1FOD2 1EUTA 2PHDA 1AL22 3AKQA 2ZAAA 3KS7A 3MLKA 1HIXA 1HQLA 2XLGA 4D3WA 1V6MA 1RB8G 1ZZ7A 4ZU5A 3H7YA 1UD1A 1GKBA 3G6JB 4WM7A 5FP3A 4LBKA 1F2NA 1E57A 4HKLA 2WNUB 1NUKA 1NKGA 1Q8PA 2LUWA 3LF7A 2Q8CA 2FHRA 2IC1A 4Y1XA 4R8HA 1MVQA 4ONUA 5C8WA 5LZ6A 1AYM3 1G9BA 2PTMA 3UKVA 3OY8B 1AXYA 1B09A 1HXS1 4OUSA 3TN93 1JTZX 1JYTA 5KHJA 3MFAA 1ZM1A 4DFSA 2RHPA 2VQUA 4LIUA 1UYPA 3OBAA 5EQUA 4L8QA 4XMAA 4XJ9A 2WC2A 1SBFA 4HK9A 4RSUA 4CP2A 5LA0A 3WDYA 4FOYA 1A8DA 4CPBA 5T55A 4YZ2A 4FSJA 2W08A 1XPWA 3TNQA 5A1AA 4OHVA 4AI2A 4I09A 4JQTA 1DQ1A 3NWKA 4YW5A 3V65A 1FNYA 4AI3A 2J1RA 5JXJA 3H7JA 3UT0A 4HG6B 3JBG3 4XUOA 1KFXL 2WFPA 5F5QA 3AMHA 2R043 1X9TA 3DPRB 4A41A 5GALA 2BFUS 1RHI2 2WNEA 4E4ZA 3RZLA 1W6OA 1UF2C 2R16A 2VW1A 3ZKYA 2FMDA 1YUDA 3K4AA 3VKOA 1DGWX 2R7EB 1W9YA 3B3QE 3RMXA 3PIJA 3UYJA 4B4PA 3O1UA 1YIPA 2YZ4A 3K3NA 2XDVA 4ZXKA 2FZ2A 1PO12 4FPKA 1Q8QA 2Y6HA 2EXJA 1O8PA 4CP9A 4YM0A 5JMCA 3EO6A 1UY0A 1IPJA 3VKLA 3O0VA 4QQ2A 1MQTA 1TNFA 1K45A 4YW7A 3SISA 1NCRC 1SDDB 4AQ2A 3OD4A 2VJXA 1C3HA 1SPPA 4V2WA 5A3PA 4LOTA 4PLMA 4RFT0 3TYJA 5K7PA 4KMQA 4IL7A 4WM8C 4AFCA 1RJ8A 2VW0A 2ZABA 3NMBA 1JZ3A 1CQ9A 3RZMA 4OQ8A 1D0HA 3ZIXA 1CX4A 3SITA 2WS92 5JLVA 4LO7A 5HI0A 3ZYPA 4XF3A 1U5ZA 4RA0A 1BLZA 4QB1A 2VE1A 3A23A 1PHMA 2TNFA 1RUD2 5KHGA 4YG6A 1ZZ6A 1NAEA 2YPJA 3IWZA 4ES9A 3IDAA 3PNAA 5JOWA 2ZPXA 1BMV2 3AMNA 1OQEA 3LDKA 5FZ6A 4WV8A 1QXJA 2JG9A 3I2HA 2ZCWA 2XH6A 3GM8A 2QDNA 3S5AA 4BM8A 1I5PA 1L3JA 1LHOA 1LKNA 2HEVF 2XMLA 4UFIA 1VAKA 1WA4A 4QAWA 2W0XA 2W1UA 3M3OA 5A3UA 3WT3A 3T0AA 4C0BA 3JD73 1CAUA 2DFBA 2WA3A 1DZTA 4D94A 4DUWA 1I3HA 1SDWA 2ZEZA 1LOAA 2V72A 1WD4A 2DBNA 2E6VA 1OSGA 4XXAA 1W3VA 3VD9A 3KGLA 4E4DX 1XYNA 1GWLA 3WNOA 1W99A 3PL0A 4LT5A 2P3JA 2VCAA 5D1IA 1O4YA 3WV6A 3IIAA 2WBKA 1PMIA 5LASA 1NA1C 3AX4A 3ST7A 2V5DA 4GB33 1KITA 5C5UA 1YIFA 4QQLA 1SLTA 4L99A 2E63A 4RQPC 3WW1A 4GA9A 1CPMA 3VD5A 4Q4V2 3PJQA 3OG2A 5F3CA 2ZX4A 4QX3A 1J1LA 1JI6A 4CUGA 3DCQA 2B8MA 5A6YA 4Q29A 3ZXEA 1ODMA 4R52A 1JOPA 3ZIWA 4D7TA 1W0OA 2MEV3 2XJPA 3MW3A 1SLBA 4NPLA 1XOYA 5CVRA 5FFOC 5ABJB 3P3PA 3JU9A 3JCIA 2H6CA 2I2SA 2ZJCA 1HKDA 5FYZA 5J3UA 5CKNA 2IXCA 4DINB 1QJY1 2YUEA 4OI1A 2YDEA 2VOWA 3MICA 5FIXA 1NCQC 3EMRA 1HW5A 3AP7A 4AEMA 4OCTA 2JB4A 3AYDA 1W90A 2YC0A 2JG8B 2H6BA 2ZHLA 1RUI2 3AMPA 3HIFA 2V73A 2EIGA 5FTTC 1DGLA 1JXNA 2UWAA 1HV0A 4LK7A 3SH4A 1C8M1 2QUOA 2P37A 1RTVA 4QX0A 5L7OC 1HB3A 1J1TA 1PGW1 5A7PA 3DEMA 1QNWA 4KNCA 2J1VA 4LO5B 4AHZA 1IS5A 2LS6A 2Z5WA 1HRI2 3I59B 5FWEA 4D0QA 2OT7A 1CJDA 2HEWF 2Q1MA 4LBQB 2BVBA 1ENXA 3LFMA 1E5SA 4HN0A 4Q4Y1 4AR2A 3WP3A 2RMU3 4EN8B 2JDPA 4K8RB 1REEA 4CDXC 4BIFA 2IFWA 1UY2A 3T1LA 1WA6X 3TEXA 5C3PA 1WCQA 1S0JA 2XUEA 1V70A 1FPN3 3I2IA 1SLLA 2Q1ZB 5FO8B 1POV3 1XQNA 4CCCA 1QHDA 4Q4W2 1DQ0A 1XE8A 1LOEA 3KCXA 2E32A 4Y5Z0 1G86A 1DQ5A 2WQZC 4HPKB 4IEOA 2JE7A 3OGVA 3Q8CA 4MXWA 1ENSA 2XL7A 3BU7A 4H3WA 5E8AA 2GN3A 5FY8A 1ZRFA 5FMDA 4QQPA 1RUG3 5SV8A 2XL9A 3FN9A 4HFSA 4FPJA 4LUKA 3I54A 4DO0A 3AL6A 4INDA 5FYHA 3AC0A 1BBT3 4QPGC 1REFA 2W52A 3VDDC 2W46A 4H14A 3J8F1 4JZRA 1OD5A 4JTNA 3RVHA 3OBRA 3RYPA 4AGGA 5LK7B 1MEC3 4BH9A 1LOFC 3SKJE 2ID4A 3WQ7A 4UI9L 2RDQA 1HN0A 1NCRA 4XBQA 2RJ2A 1PM7A 1TME3 2JDZA 3NSTA 3Q9OA 2D97A 1HB2A 3ILNA 1XJAA 4KGGA 4P02B 4WM8A 1FMD2 3E6BA 4FPGA 3DUIA 5T52A 2LRPA 3PURA 4XFAA 4O61A 2E7AA 5IT6A 3AP9A 3EHKA 2DVBA 1JZ7A 5JCTA 4Y1ZA 1ZRIA 4QKBA 4CP1A 2DCYA 3M70A 1JW6A 2HWF1 2DCTA 3T08A 2BWCA 1CR7A 4IXLA 5FP8A 5BY5A 1O3TA 1V6KA 3IAPA 1GZ9A 1JU4A 1TMF3 3TNPB 3N9MA 2E7QA 2D40A 3J7LA 3AKTA 4IEYA 4AI0A 3KQ4B 4XCBA 2GNMA 5DPNA 4CVUA 1YQ5A 2PXJA 5FZDA 3HQXA 3WCRA 4L92A 4YG3A 3T2OA 3ZR6A 2JDNA 1PK6C 4CYDA 1UW8A 4FFFA 4GJYA 1DHKB 5FMOS 4XAAA 4BQ3A 1K12A 2GMPA 3E5XA 1UIJA 1AR71 1CAVB 1NQDA 1BCXA 5FLHA 4J1XA 2X53S 3I3EA 1EAH2 1HQWA 2ERFA 1H8TC 1OH4A 1ZBA2 1DP0A 4GH4B 1ULFA 3VKNA 5JIAA 5A1LA 1QMJA 2W1WA 4GJZA 1C8M3 5KHIA 5D2AA 4MXVA 5L9VA 5D8AC 5A7QA 3HT1A 5FOBB 4P9WA 3SLIA 2BW8A 4XFHA 4P9XA 2PFWA 5FZCA 4GWMA 1NA1A 1OMIA 2CDPA 3VHOA 2ZGPA 5K0UB 4FXKB 3AXEA 4YZ3A 5FZHA 2PYTA 2GDFA 2TBVA 4Q4Y3 4RQPA 4DMIA 1OBNA 3KLSA 2D5FA 1ULGA 5IW0A 1P8JA 5EJZB 2G9GA 3KVBA 3RWNA 3WZ1A 5A33B 4CDUB 3UGHA 4CDWC 4Q5OA 2UURA 4DY3A 1DYKA 4NRMA 4AVVA 3HNYM 2CL2A 4ORFA 1G8WA 4O7XA 5FKBA 4OUEA 1DYOA 4WZCA 1UYYA 1F4AA 3IPVA 4YYOA 2BWAA 3VBOB 2NP0A 2QQWA 2VUAA 3ACGA 5EFUA 5C71A 4COZA 4QGNA 4MSVA 1OF3A 3CO2A 4CE8A 2GP3A 4UW6A 1FXZA 2PAEA 3I3DA 4K40A 5JOYA 3ORJA 1IHMA 2DVFA 5HBAA 1ND2C 3ACIA 1BXHA 4KG0A 4ZU7A 4K7JA 5J09A 1CAWA 5DUVA 1ZBE3 4IV1B 3HNBM 2J1EA 3PUAA 5GLVA 1K5MB 5J36A 2NM1A 5FZBA 5FLJA 4PQ9A 2WYSA 5DZFA 4ZU4A 3N4MA 3DXTA 2JENA 1W04A 2C26A 4CDQB 2F4LA 3HN1A 1H0BA 4RR3C 3M1HA 3P1IA 2Q8DA 3JQWA 5BNNC 5IK7A 1RUF1 2DCJA 3LSDA 5FKCA 1DQ6A 1E5RA 4CP0A 1YQ2A 4LTAA 2CNAA 2XKOA 1AR82 1GQPA 4XMIA 2CGOA 4OHWA 2CAUA 4IUGA 4B7EA 4Y24A 4MX3A 1D4M1 1XRUA 4XJAA 5KXBA 1G9AA 2XVGA 1PVC1 2ES3A 2YHJA 1JUHA 4JCKA 2HWD3 2RS52 2BVVA 3AP6A 1KGYA 1WKYA 3BIWE 3SKVA 1VRH2 4YGDA 3VD3A 2GC0A 2Q5TA 4RS5B 1QXRA 2WWSA 3OGJA 4I02A 4OHZA 3VBFB 1LGCA 4QPYA 1Q8VA 2RM21 5EYXA 5DAVA 1UYXA 4Q4X1 2CU5A 2W47A 1EP0A 2Y60A 5IVBA 3RI9A 3NV1A 1XBFA 2GMEA 4LEJA 3FBMA 4WVVA 1O7FA 3PVOA 1WMXA 4ZHNA 3GXUA 4WBBA 4X8NA 1LOFA 3LIHA 1QY4A 4BWOA 3N36A 1OOPC 4AVSA 3WQ1A 1OD3A 4LMFA 4GULA 1CONA 2JE8A 1LU1A 2YFUA 4K9SA 3W21A 3WHTA 3SEEA 1NX9A 2GMMA 4CEWA 1AJKA 3IB3A 5AVAA 4PQQA 4AVAA 4IEUA 4OI2A 5A32A 2E33A 2GP5A 5KXEA 2VMGA 1OT5A 3DECA 4HKWA 3KT4A 3BKZA 2IXLA 4NAOA 2PQQA 5HXVA 1UU5A 3D5OA 2ORXA 4M3CF 5CFDB 1QJX2 3C7GA 5T3NA 5IAVA 3WF0A 4DUVA 1HB1A 3U0ZA 5DUUA 1NY71 4BHPA 5LBEA 5FPUA 2W39A 2WNVB 5I8TA 1V9U3 4ATFA 5FZGA 2WZR1 3IAQA 5J7MA 2D6LX 2GH8A 2R32A 3P3NA 1W6MA 2A6ZA 5K4LA 4NPRA 3LE0A 4D8MA 3FC0A 4QXHA 5DXDA 5ACA1 4LKSA 3U4SA 3LEGA 2VTFA 3EJKA 1NQJA 2R061 1GZTA 3B02A 2YY1A 2W3JA 3ACHA 1O4ZA 1UQXA 1VBD1 1R083 4XFCA 3AFKA 2AEYA 2QZ3A 2X8KA 4R4ZA 3X29B 3OBZA 1KD7A 4GD4A 3D4KA 3PU3A 1H8TA 1VRBA 3LPFA 1QJU2 3NNGA 4RN5A 5JVVA 2VM9A 1RUOA 2KXLA 5DUXA 3WW4A 3UGGA 4Z2AA 3BCWA 3CL1A 5C4WC 3O1PA 2XBO1 1BEV1 5D8AA 3VHPA 2ZKNA 1FNZA 1PZ8A 3POFA 4UFLA 4AFMA 1A3KA 3BUCA 1CIYA 2A3WA 4BQ1A 4BQYA 1SMVA 3WF4A 3FLPA 3UETA 2WA4A 5B4XA 3S7IA 4CCKA 2WZ8A 2XLAA 2R072 2OQ7A 5HV4A 2WO2A 3LIGA 4LHLA 4YZ4A 1DFQA 5DDJ1 1H2KA 3V0BA 1GICA 1LNSA 4LKEA 4Y22A 5ERLA 3MHZA 5CFCC 4CDWA 1D4M3 2A70A 4JKMA 2RR13 3ZFFA 1N1SA 4XE9A 2PQSA 3VD7A 1AYN2 1XNDA 3H50A 4CEYC 1PVC3 3D0SA 4FCAA 1C5IA 3WDTA 2ADEA 4QHBA 5JXGA 2BOIA 4UF0A 4Z82A 2HEYF 3OUJA 4OI0A 1HN1A 4PT6A 1AJOA 1YJLA 3MW2A 5C8CB 1D7PM 5FQ0B 1QH6A 5LEJA 3VN4A 4KWLA 4M01A 4IV3C 2XGXA 5LBFA 1UL9A 5L19A 1HB4A 4LJHA 4YVSC 4AQSA 1S0FA 2RS32 1YJKA 5GZFA 3B94A 1ND2A 5KBFA 1S55A 3VKMA 3E6CC 1EV12 2X5IB 4QKNA 1G6NA 2ZZQA 5A3LA 1YFYA 4KWUA 3C7FA 4QDQA 5FY9A 4XUNA 5BNOB 2VQTA 3I97A 4YVWC 2WSVA 4TLFA 1DQ4A 4FFGA 3VL9A 5JWPA 2XLFA 2DUQA 2MNGA 4RR3A 3J7HA 1ASJ1 3OD0A 2X10A 3OGGA 5BNNA 4E2SA 1H6XA 4I3PA 2XJVA 4LE3A 2YGMA 4DEQA 1VBE2 3T1MA 4Q8KA 1PIV2 1WW7A 3ZN4A 5FPVA 5A7WB 4COVA 2V09A 3H3LA 1LHUA 4TXWA 2FQPA 4JGYC 1FYUA 1POV0 1W6QB 3H1YA 1K42A 1QDOA 3DKQA 3VBRC 1QQP1 2IXJA 3IKWA 4BK5A 1C57A 4AQ6A 1DYPA 4A3ZA 1N1TA 3MIDA 2OUJA 5I0DA 1M06G 2G19A 3KMHA 3I2FA 2VTXA 3A0NA 3MUY1 3MIBA 2PLV1 4K1ZA 2R063 4IGQA 3OEBA 5EWSA 1AR93 1J3PA 2VAUA 1LR5A 1PX3A 3GBWA 3IM0A 4N90A 4TYSA 4D6SA 1VBD3 4UXAA 4ZXEA 4K6BA 1S0CA 2YV8A 4BLJA 5BNPC 1MPXA 3IDEA 3THTA 1KEXA 3SQOA 4OMCA 1OOPA 3MV01 1R1A3 4OULA 1RGSA 1OLME 3M7AA 3OUIA 3VZNA 1PGL1 3OYWA 1COV1 1F9KA 4IE0A 3RZGA 1QWRA 2XBO3 4HVQA 2EVXA 2RS12 2WN3A 1UNBA 5DG1A 1VAVA 3H8RA 3ZFGB 2DU1A 3GZUC 5A3OA 2KD7A 4N53A 2QBXA 5IVFA 1XE7A 5E88A 1W9WA 3WNNA 1UIKA 1RUH2 5FZ1A 2QQMA 1VBA2 3ZKUA 3BI3A 2VZOA 4B29A 3ZSMA 4A7YA 2JE9A 1GP5A 4W4ZA 4YGBA 4M3CA 2VZVA 2R49A 4P9YA 3N3HA 4LBLA 4Q0VA 3R05A 4B1MA 1LODA 2PMWB 4QWNA 1SLIA 4FQ4A 4CCDA 1RMU2 4JVAA 4DIQA 3RZHA 5JI7A 1STMA 4QB2A 4TN7A 3THPA 5I91A 2G4IA 1FOD1 3C3VA 5CISA 3FZ3A 1AL21 1DBNA 2B46X 3VBHB 4LO8A 3WW2A 1R092 1RUC2 3ZO0B 3M2MA 1RIRA 2QTWB 4G9SB 4IEZA 4KU8A 2Z69A 4P08A 3WD5A 4JKKA 3CKHA 3SCHA 1OFNA 2JEMA 2WNUC 3B7MA 2F6BA 5AC93 4D6RA 3KVAA 4FXGB 1W6OB 1IQAA 3GJBA 5DZGA 4CPBD 2P3YA 4EN7B 5FZOA 3I7DA 4YG0A 3GALA 3LFIA 2DWRA 1JMUB 5H9QA 3FFQA 3FX3A 1KS5A 4XBNA 5C3RA 1AYM2 3O5SA 1X8EA 4GAZA 4AVTA 3CF6E 3TN92 5CFCA 1PZ9A 5GLTA 4XDQA 3INAA 5GZCA 3H8OA 2OPKA 5GZDA 4JHZA 5FPLA 4NR1A 4CEYA 2SBAA 2W5FA 1QQP3 2XVLA 4YLZA 4UFJA 1GLHA 1SPPB 4HK8A 3RPQA 2VR4A 5A3WA 3LD8A 4C8DA 5EP9A 2WUHA 4XF4A 5F9TA 3I3BA 4JX0A 2BBVA 2SLIA 2J1UA 2Y8KA 5DQ0A 3VDCA 3GBGA 2D6NA 2PLV3 3NL1A 4ZONA 4IV3A 1FX5A 3DPRC 4SBVA 1LU2A 4XFGA 2JX9A 1Z7S1 2VECA 3N9OA 3JBG2 4D7YA 1WCDJ 1ND3B 1OKOA 1RHI1 4KU7A 4QXKA 2R042 1D2SA 1CN1A 1UU4A 2C5DA 3U10A 5JR2A 3W58A 1B35A 1YQCA 1DG6A 2E31A 2ETEA 2VMFA 4UBGA 4F83A 4YZ1A 3ZXKA 4JV4A 2PHWA 4LA3A 1PO11 1I1EA 1CAXA 1OQ1A 2WFF3 2YFZA 1IPKA 1X82A 3LA2A 4DEVA 2IXHA 2XR4A 4N9IA 2ZACA 4LULA 2ATFA 4FAHA 1RUE1 2NLRA 3NW4A 2WYFA 1HV1A 1MS4A 2EICA 4Z07A 3VGIA 5A7NA 3FHQA 4GWNA 4JGYA 3GJAA 4S2HA 1DDLA 2NMOA 3N9LA 3ZFEB 3PUSA 3VBRA 4J1WA 2Z2SB 4OHXA 2D6MA 3KV9A 3PJYA 4AEKA 2ZHMA 2YBSA 4HBNA 3VZMA 2EF6A 1RJ7A 3TOJA 5CZKA 2VVEA 4I01A 1HJGA 4PLOA 5EJ1B 4FPCA 2YBKA 2ZEXA 4BISA 1J3QA 1FI2A 3FHIB 2JD4A 1UWWA 1WWYA 2WAAA 1QEXA 4EWAA 2ZXQA 3LZZA 1A78A 5BNPA 4Y20A 4A6OA 1BMV1 4EZHA 3CJIB 3POIA 2VBBA 2HJIA 3V64A 2BTVC 4QX7A 4LBJA 4CCNA 1W6PB 3FBYA 5FY4A 4UFHA 1ULCA 4CZSA 2HLEA 1HRV3 1JYIA 2DVGA 3NNFA 1JZ8A 1BYHA 3GHMA 1VALA 2VXJA 5FPAA 3WG2A 3M3EA 2PHUA 4GXLA 4YFZA 4OMDA 2FDHA 5F37A 2V4AA 4NAMA 3JD72 2J1AA 3OBTA 4W6YA 2J42A 2WWJA 5FCCA 3ZYJB 2ARBA 1JN2P 2HYXA 2F4PA 2XJUA 1JOBA 3K77A 5FO9B 4AOCA 3NKGA 2FMYA 4N8MA 1W8WA 3O0WA 1X8MA 2W87A 4UYBA 4CUAA 4AEDA 1VBC3 1BVP1 4G3YC 4NWVA 1ZRRA 5FY7A 3NO8A 1HX6A 1YWKA 2WL1A 1D4VB 4GB32 3PIGA 4Q0PA 4Q4V1 2UYBA 5CYYA 3TRSB 4MH0E 3LDBA 2QFEA 5ABJC 2EXKA 3ZDSA 1RUNA 2OKXA 4FPEA 3UKTA 4XPVA 1YI9A 2VL4A 1JZ6A 3AZVA 3WINE 1DIWA 1I9RA 1Z7S3 1X50A 4UOJA 2FDIA 2MEV2 4AAXA 5T5LA 2QQNA 1ZZ8A 2AH2A 2GC3A 1PO22 1SFNA 4A7KA 2WNUA 3FLRA 1WLCA 1FT9A 1H4HA 1RC6A 3AKRA 2JG8C 1C1FA 4QU1A 4QHOA 5JXIA 4PCRA 2PAMA 3ZXDA 4IETA 1HXS3 1RUI1 4L0PA 1PM4A 1SCRA 2FDJA 3MV11 5FDBA 4I30A 3RZKA 1W05A 4XQWA 4LITA 1RUE3 1UZZA 1MZFA 2VMDA 1GZWA 1EYBA 3OUHA 4X6RB 4QKDA 5CB7A 4EYUA 2QKDA 2P2KA 5EV7A 3WNPA 3Q8AA 3O12A 4XUQA 1HRI1 4MHRA 4YM2A 3H9AA 1ONAA 4JGZA 4CCEA 2VZPA 4BQXA 4FAGA 5C70A 1WW5A 4FOQA 3GNEA 2JDYA 4R9DA 4HSLA 1NT0A 4MGKE 3ZMNA 5HCHA 2XB6C 4WVMA 1O3SA 2VMIA 5FJKA 2RMU2 3SEPA 1Y7BA 4LBNA 3ZN6B 1O5UA 3POGA 2P6CA 4YRDA 3NJXA 1W9TA 3MLJA 1FPN2 2B7YA 2WAOA 4UW5A 2HWE1 3CU7A 1JYNA 1AZDA 2PHTA 1UZWA 2FCUA 1XYOA 4IGOA 3QH6A 4MGZE 4AG4A 3LPGA 5IUQA 3ES1A 4C0HA 4AHWA 5I0SA 4I2OA 4TWTA 4CRQA 4CUBA 2XJSA 4DB5A 1RUG2 3LWCA 4BA6A 3LA3A 4BJ0A 1BBT2 4Q0SA 4V2VA 5CADA 4KL1A 1CGPA 4E8CA 3RNSA 4B8EA 2WINB 4M00A 3AZZA 4AFAA 3H3UA 3BOPA 1UAIA 2YU2A 1MEC2 5EXOA 5FK7A 1NZCA 2HWB2 5J1XA 4LBMA 5BNQA 2DBIA 4I0BA 5A6ZA 1GR3A 3H8XA 4P9JA 3W5MA 3ZYRA 1TME2 3BVCA 1DGRA 5CEHA 5KC6A 4EN9B 4FQZA 1UOBA 4QT6A 3K51A 4RHV1 3Q8BA 3ZYGA 1PMHX 3VZLA 4ASKA 3VHRA 4R9BA 1IQDC 3USUA 4LR4A 1MS0A 4I3GA 4X8PA 3W5NA 2BP6A 3MIEA 3NJVA 3HMYA 3F2ZA 5C9AB 3T30A 1SCSA 5FO7B 2ZKLA 3O7OA 4XJZA 5T5OA 1MS1A 3DYOA 5FPZA 1TMF2 5K8SA 3OF1A 1US2A 2VOTA 4OYUA 4P9IA 4QX5A 2DYCA 4AGVA 3A0KA 3P5BA 4N9HA 3S30A 3N7KA 4K20A 2A1XA 1LESA 3PVNA 1WGPA 3MPPG 5FUIA 2WLPA 2VTXJ 3S57A 2ZS6B 2CTVA 1XYPA 4HMZA 5FV3A 1J83A 3WG4A 3ZOIA 1H9WA 3M8LA 5EZWA 1GU3A 4GWIA 1RUI3 4PJYA 4GH4C 1ZBA1 1AR61 5LEKA 3UGFA 3CHXA 4NHLA 5JOXA 1JYCA 2D98A 2VZ1A 3ILRA 4AVCA 1IPSA 1UPIA 1IKPA 1Y9GA 1C8M2 4KQ7A 5IVCA 2ZGOA 3FL7A 5K0UC 3AM2A 3RZZA 3OTFA 1JHJA 2DTWA 1OURA 2QQPA 4A2UA 2BNNA 2ZGKA 3M3IA 4Y5SA 3WF3A 5LCWL 2VQ0A 5LY1A 1UU6A 2XOMA 4K21A 4NOTA 4Q4Y2 2XHNA 4LHKA 5FAXA 1EPWA 4CDUC 2PN5A 3GCXA 2YPDA 3R0RA 3DV8A 4ZS2A 1QJY3 2YXSA 1UY1A 2ZMLA 4A45A 5J37A 3WVJA 2Z42A 5JDBA 1V00A 2JDHA 1ALYA 2HBTA 5C6CA 1AHSA 2A6XA 2ET7A 5AVPA 1PVXA 2HWE3 4BCUA 1YFUA 4O9EA 2Y33A 1OUXA 2VNGA 3HQRA 1W2AX 3VBOC 2ZEWA 3CZJA 1J3RA 1YNAA 1GV9A 1IG0A 2JG8A 1MS5A 5ANQA 1US3A 1GOFA 2ZGTA 5A3NA 3KF5A 2VGDA 1Q8SA 3ATGA 5C3OA 2YBPA 4FVVA 5A3TA 4YFWA 1ZRCA 1H1IA 5DAXA 1T6BX 3FE5A 5E89A 4Y1YA 3LEMA 3AVSA 3H1MA 4IV1C 1RUJ2 3BTXA 4NO4A 4WVWA 5I93A 3ZLIA 1K5MC 3VBSB 2OIIA 5FZIA 4XTPA 4IEVA 1H2MA 2C1FA 2VO5A 1ZZCA 3AFGA 4LBQA 1CVNA 1ZBE2 5GM0A 4CDQC 3GYDA 1LECA 1C1LA 2E53A 3T2PA 3ZYHA 2XWJB 3MFCA 4GZ9A 3ILFA 4NWWA 1A34A 1XNBA 3BALA 5IFPA 1SLAA 2CDOA 4CEWB 4DRVA 1TNRA 1LHVA 4E8DA 5CA6A 4RHV3 3MF6A 1AR81 5A32B 2IXKA 4S2GA 5CKMA 3JB8A 3W9AA 1QXPA 4BQ4A 1W8OA 1ZRDA 5IFTA 1NCQA 2C4XA 5J48A 2GSYA 3HR9A 1LTEA 4HPKA 5IK4A 2E51A 3WX5A 3I8TA 2RS51 5BYNA 3KQRA 2UWBA 1UPSA 4DZGA 4FBFA 2W95A 1VRH1 3I3QA 4RS5C 3VBFC 4ES8A 2JD9A 4DPNA 2HWD2 1FAYA 3J8F3 2P3KA 3VDAA 1DCSA 3FUQA 1ZX5A 3JUUA 2OYZA 1XE0A 3A4UA 3NAPB 5L7OA 1ZA7A 1W3XA 2ZGUA 4MGIE 3WCSA 1QJFA 4FFIA 4XFFA 5FZFA 3UNPA 4P9GA 4YW4A 5BPXA 2A6WA 3AJZA 4R9CA 2FDKA 1ZBA3 4Q1PA 1LEMA 3PVBB 2CGPA 5CAZA 4KI5M 1W9SA 3WXPA 1AR63 5FZ0A 1ACCA 2FBEA 1S0GA 2BBAA 4QPIB 1V0AA 4KBZA 4OVEA 1VB4A 4CDXA 1YEWA 4QMAA 4P14A 5FUPA 1AVBA 2HWF3 4N7UA 3CDZB 1BQPA 1H30A 1X33A 2PHFA 1I6XA 3MLLA 2OVUA 4D7SA 4XDPA 5FY0A 4YGCA 1BJQA 4Y4YA 4EWDA 5CFDC 3ALQA 2PHRA 2WNVC 2VBDA 2X05A 4AI9A 1GP4A 5HCAA 4ISRA 2BPA2 2CY6A 2D7FA 1V9U2 3B69A 3UL2A 2OW4A 4BIOA 5A3MA 4QPGA 3VV1A 4Q1RA 3KV4A 4LBOA 3VDDA 2WT0A 4UW3A 2C0ZA 2OS2A 4HETA 3VBUB 4TLGA 3ZFFB 1AR73 4AHYA 1H2NA 5KXDA 3LA7A 4P00B 5IVYA 2LM3A 1CAVA 3H3ZA 5JSPA 1RVF1 1QDCA 5JSRA 3I4IA 2H0VA 4BYYA 3AK0A 2BNOA 4GH4A 1W2TA 1VMHA 1S2EA 5FZLA 1R082 1W8UA 2G9ZA 1JZ5A 3A21A 3POJA 3WEZA 2TUNA 4LO4B 4PDWB 5M0TA 2QE3A 5GZEA 1E5HA 1MS9A 2VUJA 2VC9A 1S1AA 5DG2A 5K0UA 1POQA 1A8MA 3ZR5A 4IQPA 3POSA 3AP5A 5JUVA 4I0WB 3WDWA 3R6SA 2ZGSA 1U0AA 3QH7A 4XTMA 3VD4A 3PU8A 2FDGA 1UY3A 2XJQA 4XW3A 3EBRA 1XU2A 4ET7A 1JZ2A 1BK0A 3UJQA 1AX0A 3Q8EA 4BQ2A 4CDUA 1IS4A 1FV2A 1GP6A 3KGZA 1XSRA 2VCBA 3PTYA 2YMZA 5JPNB 2LALA 1XXNA 1AYN1 2BGPA 3NJZA 1PK6A 1YLLA 4LOSA 3SH5A 1D4M2 4LUMA 2RS53 4GKXA 2RR12 4NIIA 4ZS3A 3T0DA 3N35A 4E4HA 1PVC2 1VRH3 1S0BA 3VBOA 5C8CC 2Q30A 3S6PA 2WO1A 3S7EA 3WNMA 2WT1A 5FP7A 3MF9A 1MVEA 2GC1A 4N43B 5FUNA 2D3RA 2WN2A 2YU1A 3R4DB 2V5YA 2RS31 4NRPA 2VNVA 4EROA 3SCFA 4FT8A 5FJHA 4W50A 1O4TA 2X5IC 1O5LA 2IFRA 1O91A 1OKQA 1EV11 2VMCA 4IV1A 5I8SA 2NMNA 3OGSA 4AW7A 1PNFA 4COUA 3CJXA 5BNOC 3U4XA 4XABA 3KD4A 2NYYA 1DLLA 2A6YA 3BGAA 2X29A 3HQUA 4O65A 3N7JA 2VUDA 1RUF3 3ZXGA 3KCCA 4CDQA 1KRIA 3ZN5A 3IN9A 4P5YA 3O1MA 4B4RA 4Y26A 1GFF2 3NVCA 4BU2A 4NROA 2QVSB 1VBE1 1VBB1 4IESA 1OXCA 1PIV1 3J7MA 2B45X 1W0PA 3WLUA 2R1DA 1SEFA 4QD2A 1ULEA 4SLIA 4FPHA 1OPOA 1W6NA 4N53B 5LBBA 3JB4C 1WBLA 1NZIA 1JUIA 1W8FA 2C6SA 4XIKA 2FDFA 5FZ8A 4K1YA 1NY72 3U1XA 4MGTA 2RM23 5JPMB 4Q4X3 4RS5A 3VBFA 3ZYBA 1J84A 3IMMA 3OJBA 4M3CB 5IJRA 2OXBA 5ISLA 3L2HA 3MBWA 2HWC2 4AQTA 3MZHA 5JZGC 2GH2A 2ZHNA 2DCKA 3R4SA 1GANA 1NLQA 3HBKA 3SH3A 4MO3M 2EA7A 1RVF3 2R062 2VD7A 1AR92 2JIJA 2ARXA 1ZZBA 1MR5A 1TG7A 2Q4SA 2R1BA 1VBD2 5FXZA 5HXMA 1Y9MA 2D3PA 4EJRA 2OPWA 3JXSA 5J96B 1J59A 3O14A 5FY5A 1MZEA 1VP6A 2I45A 2J22A 1SLCA 4OFGA 3KM5A 1R1A2 5HCFA 4M0HA 3WSOA 3O0XA 2A75A 3KWVA 1RXGA 3PTRB 3ZFGC 1S4CA 5IHRA 5FREA 2F17A 2EXHA 1PGSA 2P6HA 2N7GA 4UBHA 3APBA 1V6LA 5CFDA 1RUH1 2ZOEB 1RITA 2CAVA 1VBA1 4ASLA 2WZR3 5LY2A 3ME2A 5FZOB 1GMMA 3SMHA 2PHLA 4QHZA 1HLCA 2JXAA 4CA9A 3WG1A 3RSJA 5ACA3 1BHGA 4L11A 2A73B 1AYN3 4AF9A 2UWCA 3ROUA 1RMU1 4CU8A 1OHFA 1RL3A 4JHTA 5DMYA 4CCMA 4XUTA 2P1BA 5C3QA 4XEZA 5H9PA 1UMZA 5IYYA 3B5LB 1PNGA 3RYKA 1C4RA 3BODA 2VMHA 1VIWB 3VBHC 3WNLA 3KT1A 5CNAA 1Z78A 1DLCA 3FFZA 2EIBA 1RUC1 4L2NA 4FI9A 4RL7A 5CKQA 1BEV3 3SCGA 3E97A 5KXCA 1A6CA 3I49A 2VOXA 3MPBA 2YB7A 5FWJA 1F15A 4HKOA 4WM7B 5FR3A 4EQVA 3O1SA 2D93A 2YG0A 1B35B 5AC92 2VNOA 3AZXA 4XZUG 2XONA 4DXSA 5IK5A 1OA2A 3AL5A 3ZSKA 5DDJ3 3RFRA 2PELA 5E16A 5GJ6A 1F5FA 2JDKA 1Y9QA 1X36A 1VBB3 5HPOA 1WCKA 1LGBA 3NQHA 1AYM1 4CXXA 4AE2A 3VB9A 5T54A 4AI1A 4BK4A 3TN91 4YNIA 2AACA 4J25A 2I07B 5E1RA 3RMYA 2UY9A 3MI8A 2CYFA 3MW4A 2YROA 2HBUA 1UXXX 4MGSA 3RS6A 3ZXJA 1XSQA 4XOGA 3VKFC 2P4EA 4MGYE 4E4SA 2O8OA 4DY5A 5EJ3A 4ZPIA 3G7DA 1QOTA 1QQP2 3DYMA 1NXD1 5C8CA 5EIYB 4EN0A 5HV0A 4URTA 4XFIA 2C9KA 1QKQA 1HJFA 2J1TA 1M4WA 2CGNA 4E27A 2PLV2 1ND3C 2D3SA 2WO7A 5C4WA 3JBG1 4OQ9A 3O1OA 2R041 2VXRA 2O0OA 4M3CE 5FYVA 1C28A 2X5IA 1W9FA 5EPAA 3D0JA 3DN7A 5FYCA 1YQ6A 3WP5A 2EAKA 3RQ0A 3H1WA 3KT7A 2IVIB 4YW2A 3GHNA 2ZEYA 3K46A 3V0AA 1ASJ3 4UWDA 4TSVA 3EB7A 2VZSA 1C5HA 3T2QA 2ARCA 4YW1A 3PUHA 4FPLA 4IW3A 1UX6A 2BERA 1H9PA 5DAPA 4BB3A 4CP9B 3TEWA 4JRLA 1WD3A 2WFF2 1OUSA 5I0RA 1MQTB 3BN6A 3P6BA 4A7ZA 2W68A 4HT1T 4QQHA 4AK3A 4ARXA 3CQOA 1VBA3 2GZWA 5FYTA 1W6QA 3ACLA 2GNBA 5KC5A 1KQRA 3ZFEC 2GU9A 2GNDA 3HEIA 4LXLA 4TZDA 4GKYA 4PI2A 5A6QA 3NJYA 4R9AA 3TWIA 5GLZA 3WHUA 4XCAA 1WW6A 3ZX7A 1UZVA 3CIHA 3J4UH 4H7MA 5FYSA 1S0DA 4R4XA 4YVSA 5JZGA 2LROA 2YYOA 3CZUA 4MHUA 4XAEA 1YRZA 2GN7A 4AEDB 1URXA 3KSCA 4OZXA 3UK9A 5B4NA 4ATEA 2G1MA 2WZEA 1Q56A 1LOGA 3CJIC 5FMCA 5H9RA 1W03A 1COV3 3WQBA 1RUC3 3IIIA 1X7NA 2JG9B 2XQRA 2XUMA 4BQ5A 2NQYA 1F35A 2VZ3A 3D6EA 5DAWA 1V6NA 4YVWA 3TBDA 4LKFA 1GUIA 4XC9A 1W28A 4XBLA 3AYAA 5GLWA 2WLQA 4G4FA 1QOSA 3ZFGA 3K4ZA 3B9IA 3LEIA 4QKFA 3ITQA 5FLIA 1CAUB 1N3PA 4JKLA 4NE9A 3JZVA 3E5QA 1HRV2 5A7OA 3QLQA 3JD71 1EUUA 2ZGMA 4K3UA 5T50A 3MDPA 4HXCA 4S2DA 1GWMA 3PVEA 4XUPA 3VZOA 4W6WA 4XF0A 3WNKA 2WS91 4FP2A 4BLIA 3FLTA 4FOVA 2P17A 2VNRA 1KDMA 4E9KA 4XHBA 1YO8A 2WABA 2W94A 5KHHA 1IOAA 2E7TA 2YGLA 4YARA 1OF4A 1YQ8A 1RUD1 1GZWB 3BTYA 2BV4A 3EYPA 4DUXA 5JMOA 1UX7A 2A3XA 4RYDA 3RJ2X 4GB31 3GBFA 3WF2A 5F6KA 3OGRA 1FOD3 2ENRA 2JWPA 2KR2A 1AL23 1VBC2 2JKXA 4QDSA 1XNCA 2EXIA 4JGZB 5F3EA 4WZFA 4MVTA 5FZAA 4YZ5A 1CWPA 1AX2A 2WQ4A 1JH5A 3PUIA 4NIHA 1APNA 3AP4A 3VBHA 1S0IA 3U75A 4TTGA 3ENRA 3NRUA 4NPMA 4QGLA 4WVMB 3IBMA 4NRQA 2MEV1 5FP9A 3BU0A 2E9QA 4L9BA 5B2GB 1VB2A 1Z7S2 1PO21 4FTEA 4HZFA 2Q8OA 4Z2WA 3HAGA 1GOGA 1SFPA 1OLQA 3ACFA 4EV0A 2Q0AA 2Y34A 3FMGA 3LEKA 1ODNA 1W2UA 4Q0UA 3UV9A 1WW4A 1ULOA 2RJLA 4A42A 3WP6A 1NE6A 1W06A 2BGOA 4QXCA 4KH9A 4ARYA 2VZRA 4FTSA 1LHWA 1HXS2 1Q8OA 4IE4A 4IGPA 4COWA 4DS0A 4AWDA 4YW6A 1IG3A 4EWEA 5A7SA 4BQWA 4DXRA 4AGRA 1C8NA 1RUE2 1IS3A 5CG9A 2AC1A 1DQ2A 1Q43A 1VPHA 4DRRA 4MGQA 4PIXA 3I2DA 1XB9A 3IT8A 3Q8FA 4F3JA 1XNAA 3VLBB 5JI9A 4W8JA 3TB0A 1T2XA 3OEAA 1PZ7A 3MUZ1 4RGAA 1QU0A 4YGEA 3ZPYA 2BU9A 5JXHA 5L36A 2Z79A 2RMU1 4GMP1 5F5AA 4LNVA 1RHI3 4XJWA 4HVOA 3KZ4C 2VY0A 1U5YA 1OA4A 5EYYA 4B4QA 1SQ4A 3BTZA 1ND3A 4M4RA 4XQDA 4BXSV 1FPN1 2DCZA 1POV1 5G04L 4MZUA 4AAPA 2XJTA 2B4KA 1RINA 4QDRA 5FMBA 3SXWA 3USUB 2D44A 1Q5OA 3E6DA 1YI7A 4GWJA 1PO13 4MXWB 2PHXA 1AX1A 3ZPOA 2V4VA 3N7MA 1DF0A 5LBCA 3OY8A 3T4VA 3ZDVA 4Y1VA 5IK8A 3RDIA 4XJUA 5F5IA 3VUOA 4QX2A 1RUG1 2AUYA 1DU3D 3VDBA 4EZ4A 4FPFA 1O3RA 1BBT1 3ES4A 5ANNA 1UYZA 1D0GA 2YC2A 1QGLA 2QQKA 4LPLA 2HKXA 1MEC1 2UY8A 1NCRB 1WBFA 2HWB1 3C7HA 3LDRA 5CU1A 4LORA 5L9BA 1R64A 5LK5A 3F95A 3LKJA 3IDBB 5K9YA 2WS93 4MOAA 3ZFEA 3ZXLA 4ZZ8A 3M3QA 2AR6A 3BYWA 3N9NA 1TME1 4WM8B 4XETA 1DGRN 2VOKA 1UMHA 2JICA 4CCLA 2B39A 4B3NA 1VMFA 2RDNA 1RUD3 2VPVA 3C8XA 1OLRA 3BOWA 3VL8A 3DPRA 3IZOA 4Q4W1 3D8CA 5KHKA 1ZZ9A 1CZSA 2CV6A 2ORZA 2XWBB 5DAQA 3WOGA 2VZTA 1QH7A 3LAGA 5F5CA 3ASIA 5C9AC 3EQEA 1N1VA 4XVHA 3CJIA 2HYKA 1UKGA 1ULPA 3T4HB 4IEXA 1U5IA 1L7LA 2ADDA 2ZX2A 2BZDA 1W6PA 1TMF1 3GGLA 4Q2FA 1G9DA 1TZOA 2IXIA 1L7QA 1W2NA 3HD8B 4AEJA 1W8TA 1PO23 3PMEA 1Y4WA 4P9LA 5FPBA 4CUCA 3PHMA 1JZ4A 4IEPA 4UFMA 4URAA 2X09A 3D82A 4XFBA 2R30A 2FD8A 4A44A 2ZTNA 1LOBA 3GCWA 2A71A 3ZMOA 5F7UA 2VU9A 4FP3A 4M0NA 5LRRA 3B93A 1R1ZA 2ZX0A 3K2OA 1ENQA 4ITCA 1Q3EA 4A6SA 3POBA 4FPYA 5FXWA 4QQOA 1FMD1 3AYCA 2FCVA 2C9AA 3LOIA 3KF3A 1N3QA 2KM2A 4AVBA 3C2UA 4META 4JRAA 2WQ8A 4KGQA 3I2KA 2DFCA 4JTOA 5F2SA 5FYYA 1LJ7A 3RZJA 1NA1B 4W6XA 3AZYA 4Q4V3 4A3XA 1CX1A 3CNAA 1QNYA 2VCCA 1NE4A 3ZSLA 4OLLA 5LATA 4UAPA 4RQPB 4B7KA 1HDKA 1MACA 1Y43B 4NIAA 3OCPA 3A22A 2OUHA 4IE5A 4NMIA 4BMBA 1DGWA 1XNTA 3VZKA 1UOJA 4GMP3 3AKPA 1JYXA 4B1LA 2BDRA 2BOJA 1LAJA 1SBDA 4Y5TA 5IATA 5KWRA 3MGUA 2VUCA 3N9QA 3SHRA 1QJY2 3V56A 1BK1A 3ECQA 2B9UA 3C7OA 5TSWA 4BZ4A 2MPFA 4C1XA 5FMOL 4Y1UA 1NCQB 3IPVB 3T2TA 1EAH1 1T6GC 2HWE2 4PBPA 1GZCA 5FYMA 4L97A 2CWMA 4XACA 4LBQD 4XQ4A 1WLDA 4DNYA 2OX0A 2Y64A 3ABZA 5FRAA 2KA3A 4Z92B 2R0HA 2I74A 1J58A 1D2QA 1DZRA 1VJ2A 3AKSA 1AXKA 5FYBA 3S5QA 5C5TA 1JYVA 1W8HA 4KWJA 2GAUA 4KWKA 1HRI3 1RUJ1 3VBSC 5L7OB 1PGW2 4RFRB 3RI8A 1CAWB 1U5XA 2HWB3 1LB2A 3I2JA 2A3YA 3A7QA 4PF5A 2Y6KA 4Q0QA 4ZY9A 4XIOA 1MS3A 1V6OA 4CCJA 1ZBE1 4QXBA 3VHNA 5J98B 2XQXA 1W8ZA 5ABJA 1HQNA 1VAMA 4IE7A 4LQRA 2RV9A 4CEWC 4HN1A 4HVRA 2BJSA 2VVFA 3K75B 5F3IA 4CDXB 4Q4W3 4NHKA 3T3YA 2VZQA 3H8UA 3OB8A 3ZN6A 4ISQA 3NV3A 1K5JA 5JR7B 3GDBA 3MEPA 5JOZA 3HN3A 2DUOA 2VVDA 4RHV2 2IVJA 1YC61 1JBCA 1YCIA 4XURA 2RG4A 1G9FA 4CXWA 4BMEA 2WNOA 2ZAHA 4OHYA 4IEWA 2WIIB 1KFUL 2QZ2A 1GYKA 4COYA 2RDSA 2HWD1 3WNXA 1H1AA 5FZ9A 4K8FA 2O1QA 3CEWA 3L2YA 4I0AA 4OI4A 4QM9A 5DUWA 1AXZA 4IE6A 3NAPC 5DN2A 1NLSA 4LE4A 5D21A 2QNKA 2EIEA 4HOOA 3J8F2 4QPGB 4DQAA 2DURA 3VDDB 4Q8LA 1YFWA 3DKWA 1WMEA 2DUPA 2Y6FA 2ZZJA 3GZAA 3I3MA 2A6VA 3I59A 3ZYFA 2GALA 1W0NA 3KCYA 3WY6A 1XC6A 5KR7A 1FMD3 4QM8A 5LWBA 3AZWA 2O8QA 2UU8A 1F5JA 1GNHA 2OZ6A 3HBZA 4QPIC 3THDA 3HPNA 1VE0A 1F4HA 1SFYA 4FOWA 2PA7A 3NV4A 5BXXA 3T0BA 3SC7X 2Q8EA 1BKZA 5F39A 3UESA 3NV2A 1AR62 1IS6A 2RE9A 3O1VA 5IVEA 2ARAA 5FK8A 1E5IA 3WDVA 4QPWA 5FY1A 5JIUA 1CESA 3BPSA 3OOXA 2WR9A 2L9LA 2Y6GA 2HWF2 4AZZA 5L73A 3HVDA 2BYVE 1S0EA 1WCUA 2AEZA 2ZX3A 1OH3A 5F8PA 1REDA 4U36A 2WZPP 4CU9A 4LK6A 5C9AA 4HLTA 2OQ6A 4LIVA 2WWUA 4YW3A 3N9PA 2HH9A 1OVSA 1W6MB 1V9U1 1CZVA 3FUOA 3VBUC 1KDKA 3ZFFC 1VR3A 1CIWA 1ZYBA 3PLQA 5FZ4A 1PMJX 2WSUA 1OQDA 2XPJA 4NHMA 2W1SA 1EAH3 1H1MA 1PK6B 1WUVA 5JAXA 3NNLA 4MG2A 1NOVA 1AR72 2Y38A 4W65A 4P5HA 2Y6LA 2G9FA 2WDBA 2ZGNA 3ZSJA 1R081 3POWA 2A7AA 2JDUA 1GQHA 1H8TB 1LEDA 3MIHA 4PDWC 3UJOA 5FZKA 4JQRA 4PIYA 4C91A 4DXZA 4NIDA 4XYXA 2RVAA 1SHWB 3W20A 2DVDA 1RUJ3 3KV5A 2D43A 5FYIA 5D8AB 2VCMA 5AFEA 3LSEA 3QBQA 1GNYA 2VH9A 5LRSA 4YWAA 4NIGA 1CPNA 1UO9A 1QJX1 4PLNA 3E5UA 3WDXA 4CU6A 4LHNA 4QX8A 4WVZA 1UOGA 1LHNA 1OI6A 5LA1A 2AGSA 2K0GA 2QQVA 1LRHA 2AENA 2R0FA 1OPMA 1IZ3A 4CTEA 4XJ8A 4XHXA 5A70A 3V0BB 5GKAC 3B00A 4NVPA 4Y22B 1H4GA 3CLPA 4CDWB 2VMEA 4KBBA 4F8AA 1EY2A 4HL0A 1OA3A 2IZWA 4MV2A 4H2AA 3WG3A 1FV3A 2RR11 2D6KA 5F3GA 1JODA 4AHXA 3O1RA 1W6NB 4LLFA 4UF0B 3DL3A 4F7ZA 2VW2A 1BZWA 1H2LA
chains in the Genus database with same CATH topology
2XJRA 4N43C 1QJU1 3GZTB 3HWJA 1LULA 5C33A 3LGRA 1W39A 3L9JT 4Q26A 1ND2B 3VBSA 2P34A 1ENRA 1XU1A 1ZVFA 2XVKA 2ZX1A 4JDOA 4MUVA 1S2KA 1BVVA 4FPOB 2R071 4Z8BA 2JJ6A 2ILMA 4DOUA 2B5HA 1AR83 5A33A 4D69A 1FATA 2ZGQA 3ZYIB 4RR3B 1RUF2 4E2GA 5BNNB 1H8VA 4V1PA 2H0BA 2ZBJA 2VOVA 4RGGA 3U07A 4N53C 5CBLA 2VG9A 2WJSA 3WW3A 1Z0HA 1UCXA 4FO9A 1NG0A 1CJPA 1QJZA 2UYAA 1UZYA 2DU0A 2XHKA 4AFDA 2WT2A 5DZEA 1G9CA 2HWC1 4HSJA 1N47A 1WMDA 2RM22 3AXDA 2DTYA 4Q4X2 3ETQA 3NAPA 3QOPA 3ELNA 2OZJA 1WMFA 5GZGA 1K5MA 2MHFA 1AR91 2D6OX 4Q27A 1TE1B 1DZQA 4JC1A 3ZSEA 4JDMA 2EALA 2NZ9A 1RVF2 2A5ZA 3WQ0A 1OOPB 1GNZA 2BEOA 4BPZA 4QPIA 3QACA 5BUVA 3OYWB 5I8YA 1KXGA 1R1A1 1AL0G 4ASMB 3AYEA 1N1YA 3IDCB 4OUMA 5T5JA 1VLNA 4JDNA 1MS8A 2XG3A 2VQAA 1QJX3 2AYHA 2QCSB 1JHNA 2OA2A 4XF9A 1EPZA 3MIGA 2Y0IA 2AREA 2ZGLA 3IMNA 1SACA 1ZREA 1YHFA 2K2SA 2WZR2 4X6QB 3URFA 3M4FA 2EAAA 2JECA 3DF0A 2ET1A 2XKPA 2GNTA 3UKNA 3VBUA 5ACA2 2TEPA 1ZNPA 2P3IA 4PIZA 4QU2A 2ZHKA 5FPXA 3AMMA 2FZ1A 1UKRA 3WR0A 3R4UA 3B9CA 3J9SA 3OPZA 1QJU3 1NYWA 3LCPA 2JKBA 4LO6B 1WLWA 3LB9A 5AFBA 1GQGA 2RS11 4PDWA 3B01A 5BV6A 1F31A 2ZMNA 2PAKA 4WM7C 3USSA 2XBO2 2ZGRA 1BEV2 3N7LA 5C4WB 4MYEA 2ZMKA 3RRDA 3FWEA 3RJRA 1B35C 5CIRA 1V6IA 5AC91 4H7LA 1QF3A 2R073 4H55A 2WNVA 4E2QA 4QGMA 5F6LB 4BE3A 3V0AB 3RYRA 3FJSA 2NN8A 4AXOA 5DDJ2 5T5PA 4C1WA 4JAAA 2BQPA 4LLOA 4GMP0 4J6GA 2IWGB 3AMQA 2B42B 1TEIA 3AB0A 1VBB2 5CFCB 1U12A 2Y0OA 3SNMA 2NPIA 4CEYB 2DF7A 1Y3TA 2QJVA 1MZ5A 5HCBA 1KJLA 3S0MA 4C90A 4GALA 1R091 2HWC3 4N43A 3WUDA 2RS33 1OFSA 4N7IA 4MLOA 2CWSA 1KJRA 3BPZA 4IV3B 1N3OA 1EV13 1TQ5A 3AJYA 3WUCA 1YFXA 4UW4A 4YVSB 4HANA 4FTBA 4AYUA 2RJKA 1AUYA 2DVAA 1WLTA 5JSOA 1LOCA 4KG8A 3LOBA 1QOOA 3QD6A 4IEQA 4YM3A 4YSFA 4RD7A 5I0UA 3BB6A 1YXWA 5FBZA 3WDUA 2BGCA 1VBE3 4YVWB 5FOJB 1CAXB 2QDRA 1PIV3 3J26N 3MYXA 1UN1A 1ASJ2 3U11A 1ULDA 3VV1A 3W59A 1G7YA 1MQTC 2AZ5A 2R6QA 2WFF1 4EN6B 1IGOA 1YYNA 3GF6A 4IERA 3VZJA 5I0TA 1NXMA 1LCLA 4JGYB 2D6PA 1WCSA 3NKTA 3ZXFA 3VBRB 5FQ0A 1LENA 4S2FA 2GC2A 3RG0A 1AF9A 1XNKA 3K48A 1F8VA 3BTAA 4AEDC 5H9SA 3ZVXA 5GLUA 1GSLA 4GIQA 1SBEA 1ZA4A 2LTNA 3HT2A 2ZA9A 3MIFA 3JQXA 3PMSA 2JG9C 5BNPB 4Y20B 5BNOA 3DGTA 1GBGA 4XILA 2DV9A 2RS13 1PGL2 3TAYA 2WKKA 1COV2 3WP4A 1S2BA 4XXPA 1V6JA 4YM1A 4XF1A 4NN0A 4O9GA 1RUH3 4ZKTB 4XZPA 1HRV1 2K9ZA 1MZ6A 2BNMA 3ZXAC 4AI8A 3QCWA 5F1RA 2BUKA 3EXUA 4AFBA 1LGNA 1KS4A 1O3QA 3M3CA 3KB5A 4PBOA 3POYA 1JOJA 1RMU3 5SV5A 4U2AA 5CG8A 4BOWA 2BFUL 4GQ7A 4LA2A 4JGZC 2Y26A 1NLRA 1VBC1 1I5ZA 1IKQA 1R093 2VULA 4Z1VA 1CD3G 3H0OA 2D5HA 1FOD2 2PHDA 1AL22 3AKQA 2ZAAA 3KS7A 3MLKA 1HIXA 1HQLA 2XLGA 4D3WA 1V6MA 1RB8G 1ZZ7A 4ZU5A 3H7YA 1UD1A 1GKBA 3G6JB 4WM7A 4LBKA 1F2NA 1E57A 4HKLA 2WNUB 1Q8PA 2LUWA 2FHRA 2IC1A 4Y1XA 4R8HA 1MVQA 4ONUA 5C8WA 1AYM3 1G9BA 2PTMA 3UKVA 3OY8B 1AXYA 1B09A 1HXS1 4OUSA 3TN93 1JTZX 5KHJA 3MFAA 1ZM1A 4DFSA 2RHPA 4L8QA 4XMAA 4XJ9A 2WC2A 1SBFA 4HK9A 4RSUA 4CP2A 3WDYA 4FOYA 1A8DA 5T55A 4YZ2A 4FSJA 2W08A 3TNQA 4OHVA 4AI2A 4I09A 1DQ1A 3NWKA 4YW5A 3V65A 1FNYA 4AI3A 3H7JA 3JBG3 1KFXL 2WFPA 5F5QA 3AMHA 2R043 3DPRB 5GALA 2BFUS 1RHI2 2WNEA 4E4ZA 1W6OA 1UF2C 2R16A 2VW1A 2FMDA 1YUDA 3VKOA 1DGWX 3B3QE 3RMXA 4B4PA 1YIPA 2YZ4A 4ZXKA 2FZ2A 1PO12 4FPKA 1Q8QA 2EXJA 4YM0A 5JMCA 3EO6A 1IPJA 3VKLA 3O0VA 4QQ2A 1MQTA 1TNFA 3SISA 1NCRC 4AQ2A 3OD4A 1C3HA 4PLMA 4RFT0 3TYJA 5K7PA 4IL7A 4WM8C 4AFCA 1RJ8A 2VW0A 2ZABA 1CQ9A 1D0HA 3ZIXA 1CX4A 3SITA 2WS92 5JLVA 4LO7A 5HI0A 3ZYPA 4XF3A 1U5ZA 4RA0A 1PHMA 2TNFA 1RUD2 5KHGA 4YG6A 1ZZ6A 2YPJA 3IWZA 4ES9A 3PNAA 5JOWA 2ZPXA 1BMV2 3AMNA 1OQEA 4WV8A 1QXJA 2JG9A 2ZCWA 2XH6A 2QDNA 4BM8A 1L3JA 2HEVF 1LHOA 1LKNA 1VAKA 1WA4A 2W0XA 3M3OA 3WT3A 4C0BA 3JD73 1CAUA 2DFBA 2WA3A 1DZTA 4D94A 1I3HA 1SDWA 1LOAA 1WD4A 2E6VA 4XXAA 1OSGA 3KGLA 4E4DX 1XYNA 4LT5A 2P3JA 5D1IA 1O4YA 3WV6A 3IIAA 1PMIA 1NA1C 3AX4A 3ST7A 4GB33 1KITA 1YIFA 4QQLA 1SLTA 4L99A 2E63A 4RQPC 3WW1A 4GA9A 1CPMA 4Q4V2 3PJQA 2ZX4A 1J1LA 2B8MA 4Q29A 3ZXEA 4R52A 4D7TA 3ZIWA 1W0OA 2MEV3 2XJPA 3MW3A 1SLBA 5FFOC 5ABJB 5CVRA 3P3PA 3JU9A 3JCIA 2H6CA 2I2SA 2ZJCA 1HKDA 5J3UA 2IXCA 4DINB 2YUEA 1QJY1 4OI1A 2YDEA 2VOWA 3MICA 1NCQC 1HW5A 3AP7A 4AEMA 3AYDA 2YC0A 2JG8B 2H6BA 2ZHLA 1RUI2 3AMPA 3HIFA 2V73A 2EIGA 5FTTC 1DGLA 1JXNA 2UWAA 1HV0A 3SH4A 1C8M1 2QUOA 2P37A 1RTVA 5L7OC 1J1TA 1PGW1 1QNWA 4KNCA 4LO5B 4AHZA 1IS5A 2Z5WA 1HRI2 3I59B 1CJDA 2HEWF 2Q1MA 4LBQB 2BVBA 1ENXA 4HN0A 4Q4Y1 3WP3A 2RMU3 4EN8B 1REEA 4CDXC 4BIFA 2IFWA 3T1LA 1S0JA 1V70A 1FPN3 5FO8B 1SLLA 2Q1ZB 1POV3 1XQNA 1QHDA 4Q4W2 1DQ0A 1XE8A 1LOEA 3KCXA 4Y5Z0 1G86A 1DQ5A 2WQZC 4HPKB 4IEOA 2JE7A 5E8AA 4MXWA 2XL7A 1ENSA 3BU7A 4H3WA 2GN3A 1ZRFA 4QQPA 1RUG3 5SV8A 2XL9A 4HFSA 4LUKA 4FPJA 3I54A 4INDA 1BBT3 4QPGC 1REFA 2W52A 3VDDC 4H14A 3RYPA 3J8F1 1OD5A 4JTNA 3OBRA 4AGGA 5LK7B 1MEC3 4BH9A 1LOFC 3WQ7A 1NCRA 4XBQA 1PM7A 1TME3 2JDZA 3NSTA 3Q9OA 2D97A 3ILNA 4KGGA 4WM8A 1FMD2 3E6BA 4FPGA 3DUIA 5T52A 4XFAA 2E7AA 5IT6A 3AP9A 3EHKA 2DVBA 5JCTA 4Y1ZA 4CP1A 2DCYA 3M70A 1JW6A 2HWF1 2DCTA 2BWCA 1CR7A 4IXLA 5BY5A 1O3TA 1V6KA 3TNPB 1GZ9A 1TMF3 2E7QA 2D40A 3AKTA 4IEYA 4AI0A 2GNMA 3HQXA 3WCRA 4L92A 4YG3A 1PK6C 4CYDA 1UW8A 1DHKB 5FMOS 2GMPA 3E5XA 1UIJA 1AR71 1CAVB 1NQDA 1BCXA 5FLHA 4J1XA 2X53S 1EAH2 1HQWA 2ERFA 1H8TC 1ZBA2 4GH4B 1ULFA 3VKNA 5JIAA 1QMJA 1C8M3 5KHIA 4MXVA 5D8AC 3HT1A 5FOBB 4P9WA 3SLIA 2BW8A 4XFHA 4P9XA 2PFWA 4GWMA 1NA1A 1OMIA 3VHOA 2ZGPA 5K0UB 4FXKB 3AXEA 4YZ3A 2PYTA 2GDFA 2TBVA 4Q4Y3 4RQPA 4DMIA 3KLSA 2D5FA 1ULGA 2G9GA 3WZ1A 3RWNA 5A33B 4CDUB 4CDWC 4DY3A 2UURA 1DYKA 4AVVA 2CL2A 4ORFA 1G8WA 4WZCA 3IPVA 4YYOA 2BWAA 3VBOB 2NP0A 2VUAA 5EFUA 4COZA 4QGNA 4MSVA 3CO2A 4UW6A 1FXZA 2PAEA 4K40A 5JOYA 1IHMA 2DVFA 5HBAA 1ND2C 1BXHA 4KG0A 4ZU7A 4K7JA 5J09A 1CAWA 5DUVA 1ZBE3 4IV1B 5GLVA 1K5MB 5J36A 2NM1A 5FLJA 4PQ9A 5DZFA 4ZU4A 3N4MA 2JENA 4CDQB 3HN1A 1H0BA 4RR3C 3M1HA 5BNNC 3JQWA 5IK7A 1RUF1 2DCJA 3LSDA 1DQ6A 4CP0A 4LTAA 2CNAA 2XKOA 1AR82 4XMIA 2CGOA 4OHWA 2CAUA 4B7EA 4Y24A 4MX3A 1D4M1 1XRUA 4XJAA 5KXBA 1G9AA 2XVGA 1PVC1 2ES3A 2YHJA 1JUHA 4JCKA 2HWD3 2RS52 2BVVA 3AP6A 3BIWE 1VRH2 4YGDA 2GC0A 2Q5TA 4RS5B 1QXRA 2WWSA 3OGJA 4I02A 4OHZA 3VBFB 1LGCA 4QPYA 1Q8VA 2RM21 5EYXA 4Q4X1 1EP0A 3RI9A 3NV1A 4LEJA 2GMEA 4WVVA 3FBMA 1O7FA 3PVOA 4WBBA 4X8NA 1LOFA 1QY4A 4BWOA 3N36A 1OOPC 4AVSA 3WQ1A 4GULA 1CONA 4K9SA 1LU1A 3WHTA 4CEWA 2GMMA 1AJKA 5AVAA 4AVAA 4IEUA 4OI2A 5A32A 5KXEA 2VMGA 4HKWA 3KT4A 2IXLA 2PQQA 5HXVA 1UU5A 3D5OA 4M3CF 5CFDB 1QJX2 5T3NA 3U0ZA 5DUUA 1NY71 4BHPA 2W39A 2WNVB 5I8TA 1V9U3 4ATFA 2WZR1 5J7MA 2D6LX 2GH8A 2R32A 3P3NA 1W6MA 2A6ZA 4NPRA 3FC0A 5DXDA 5ACA1 3EJKA 1NQJA 2R061 3B02A 2YY1A 1O4ZA 1VBD1 1R083 4XFCA 3AFKA 3X29B 2QZ3A 2X8KA 4R4ZA 1KD7A 3D4KA 1H8TA 1QJU2 1RUOA 5JVVA 2KXLA 5DUXA 3WW4A 3BCWA 3CL1A 5C4WC 2XBO1 1BEV1 5D8AA 3VHPA 2ZKNA 1FNZA 1PZ8A 4AFMA 1A3KA 2A3WA 4BQ1A 1SMVA 3FLPA 2WA4A 3S7IA 2XLAA 2R072 4LHLA 4YZ4A 1DFQA 5DDJ1 1H2KA 3V0BA 1GICA 5CFCC 4Y22A 4CDWA 1D4M3 2A70A 4EN9B 2RR13 3ZFFA 1N1SA 4XE9A 1AYN2 1XNDA 3H50A 4CEYC 1PVC3 3D0SA 4FCAA 1C5IA 3WDTA 4QHBA 4Z82A 2HEYF 4OI0A 1AJOA 1YJLA 3MW2A 5C8CB 5FQ0B 1QH6A 5LEJA 3VN4A 4KWLA 4M01A 4IV3C 2XGXA 1UL9A 5L19A 4YVSC 4AQSA 1S0FA 2RS32 1YJKA 5GZFA 3B94A 1ND2A 5KBFA 1S55A 3VKMA 3E6CC 1EV12 2X5IB 1G6NA 2ZZQA 5A3LA 1YFYA 5BNOB 4YVWC 2WSVA 4TLFA 1DQ4A 3VL9A 5JWPA 2XLFA 2DUQA 2MNGA 4RR3A 3OD0A 1ASJ1 3OGGA 5BNNA 4E2SA 4I3PA 2XJVA 4LE3A 2YGMA 1VBE2 3T1MA 4Q8KA 1PIV2 1WW7A 3ZN4A 4COVA 2V09A 1LHUA 2FQPA 4JGYC 1FYUA 1POV0 1W6QB 3H1YA 1QDOA 3VBRC 1QQP1 2IXJA 3IKWA 1C57A 4AQ6A 1DYPA 1N1TA 3MIDA 2OUJA 1M06G 3KMHA 3A0NA 3MIBA 2PLV1 4K1ZA 2R063 5EWSA 4AVBA 1AR93 1J3PA 3GBWA 1LR5A 3IM0A 4N90A 4TYSA 4E27A 5JZGB 1VBD3 4UXAA 4K6BA 1S0CA 2YV8A 4BLJA 5BNPC 3IDEA 3THTA 1OOPA 4OULA 1R1A3 1RGSA 3M7AA 3VZNA 1PGL1 3OYW