1FYUA

Crystal structure of erythrina corallodendron lectin in hexagonal crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
239
Chain Sequence
b'VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
molecule tags Sugar binding protein
publication title Chemical characteristics of dimer interfaces in the legume lectin family.
pubmed doi rcsb
total genus 49
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fyuA00
1N1TA 3RMXA 5JMCA 3B3QE 1VIWB 2A6ZA 2NP0A 5T5PA 1V6OA 1LEMA 2DTYA 2D6MA 4ATEA 4WVWA 4YGBA 4XE9A 4XZPA 1TEIA 2AYHA 3O0VA 1W6PB 3HN1A 4GWNA 2R1BA 3OYWB 4CTEA 1MACA 2XB6C 3WV6A 4YW2A 1AF9A 1FAYA 5H9PA 3MPPG 1O4ZA 3DUIA 4FPJA 1LOBA 4R9CA 1JXNA 2PHFA 1C1LA 2UWAA 2WLQA 3CNAA 1GZWA 3N7JA 3L2YA 3NV4A 5EWSA 4Y26A 3AZZA 1CN1A 3W58A 2GMPA 1G7YA 1YYNA 4AGGA 2EALA 1A8DA 1G8WA 3AJZA 2JE9A 4NOTA 2CYFA 1AX0A 1NLSA 3UJQA 3ZSLA 3WDUA 2HYKA 2CTVA 1BQPA 3D5OA 5DUUA 4LBLA 5JOWA 1DBNA 1LHOA 1S0DA 4GKYA 2A3WA 3FUQA 4FPOB 4XJ9A 3WDXA 2NN8A 4YZ4A 2EXIA 1AJKA 4XBNA 5T55A 4M00A 2KM2A 3WDYA 3PVNA 3WNXA 3GALA 1JW6A 2ZBJA 1XQNA 4R9DA 4BOWA 1G9DA 3WOGA 5EYYA 3WDWA 5GZGA 4JCKA 3SLIA 4YW1A 5JLVA 2V73A 2D3RA 2WKKA 2FMDA 1QDCA 4YFZA 1BKZA 4OZXA 5SV8A 2ZGQA 1CESA 2C5DA 4NO4A 1S0BA 5FRAA 3ASIA 4ISRA 4LBKA 2B7YA 3V65A 2DVFA 4RL7A 1Q8OA 1W0OA 2D43A 2D44A 2GNMA 2JE7A 1AVBA 2NM1A 4YZ2A 2E7TA 4ZKTB 3OBRA 1G9FA 3WHUA 2ARBA 1I3HA 2A6VA 1H9PA 2YV8A 3C2UA 5T5OA 3UL2A 4BM8A 3U4XA 5GLVA 1KDKA 2ZMLA 2DURA 3MW3A 1UPSA 1GLHA 2OUHA 3IM0A 3LSDA 3O0XA 5DUXA 1MZ5A 2GNTA 2YZ4A 3B01A 1WW6A 2ZHMA 4BLIA 3ZYRA 4YFWA 1GNHA 4LBQA 4GALA 1Q56A 2P34A 4Y1VA 3PJQA 5H9RA 3M3QA 4YM3A 4UW4A 3WG1A 2P2KA 2P37A 2PELA 2VXRA 1LCLA 4K1YA 4YM1A 3ZYPA 1C57A 1MS1A 3FLRA 4IQPA 4XIOA 4BLJA 3WUCA 1JYIA 1HKDA 1X50A 1ENQA 4XBQA 5T50A 1F5FA 1DQ4A 1MS5A 3AYCA 1S0FA 3SH3A 3BOPA 3OPZA 1LOGA 1LGNA 4FP3A 4XBLA 3ZXFA 3WHTA 1HQLA 4Y1XA 4BMBA 5T54A 3RSJA 1HQWA 1Z0HA 1SBFA 2LTNA 4M3CF 3B69A 5CNAA 5EXOA 1GZ9A 3ILRA 2D6KA 1AZDA 1SLTA 3WZ1A 1JUIA 1AXKA 2VW1A 1Q8QA 2TEPA 3ZXLA 2NYYA 3AP5A 4XJZA 2AGSA 1LENA 1MS3A 2ZZJA 4FPEA 3VKOA 2EIGA 4YW4A 3N36A 4P9YA 1LHWA 5BYNA 1JN2P 2ZGNA 3ZVXA 1S1AA 1ENSA 4Q8LA 1ULGA 4R9AA 3V0AB 2UU8A 2R0FA 4FPKA 5IK4A 4Q8KA 3AP9A 5DXDA 5KXBA 4Y20A 1CONA 1ZM1A 2SBAA 1JHNA 2WSVA 5GZCA 4YM2A 2DVGA 4P14A 1LECA 4HL0A 1Z78A 2GN3A 3FUOA 3ATGA 2WNEA 4ATFA 1HLCA 1Q8PA 1UKGA 2DVAA 2ZGOA 3AFKA 3R05A 4ASMB 3V0AA 4F83A 1H9WA 2V5YA 3A4UA 1DIWA 1QGLA 1QOOA 4XXPA 1WCSA 1W6OB 3AJYA 2GDFA 3FLTA 5DUWA 5CAZA 4XJAA 5IUQA 1N1VA 5E88A 1G9BA 3SH4A 5CB7A 1GICA 2XG3A 1JYCA 2LALA 3I8TA 4DRVA 5H9SA 3O12A 1FX5A 1SBEA 2DWRA 3PVEA 3SH5A 1IKQA 1UAIA 1YXWA 2D3PA 4Q1PA 1W0PA 2D6LX 1LTEA 5AVAA 2AUYA 3NV2A 4CZSA 3ILFA 1S0JA 1S0EA 1WLDA 2D6NA 4Y22A 3OYWA 4YGDA 3RG0A 4C1XA 4K20A 5JVVA 3T2TA 1Q8VA 1QOSA 4WZFA 3FFZA 4XIKA 5JOZA 1OQ1A 1SLLA 1GZWB 2D3SA 3AP4A 2EXHA 1DYPA 1DZQA 2AH2A 2WSUA 2NMOA 3RRDA 4Y20B 4RA0A 4WVVA 1ULFA 2ZABA 5DG2A 1RITA 1SLAA 2ZHKA 3MW2A 3TAYA 1QNWA 3AYEA 1V6JA 4AWDA 4L8QA 3OJBA 2EXJA 4DFSA 3POWA 4LBOA 3VKNA 1W6OA 1A78A 3PVOA 1YRZA 2AR6A 2OVUA 4W65A 4YM0A 1FATA 2YROA 1MS8A 1C4RA 1W6MA 2DV9A 4P9WA 2JKBA 4LBMA 1LODA 2DU1A 2PHUA 2YXSA 4FPCA 4JC1A 1GANA 1QMJA 1LEDA 2YMZA 1O4YA 1ULEA 1CIWA 3AZWA 4YLZA 1LOEA 1WW7A 2WJSA 2ZKNA 4SLIA 5E89A 3T1LA 4AYUA 1G9AA 3RMYA 4AVTA 1GKBA 1RINA 2DU0A 4KBBA 2WT0A 5KXEA 1VLNA 2GNBA 2ZMNA 3KQRA 1UMZA 4FOYA 4XHXA 4M3CB 3V64A 2P3IA 1CPNA 1CPMA 4H55A 5GLWA 1QNYA 1SLIA 5T5JA 2VW0A 5GLZA 4BQ1A 5JOXA 4FPFA 2RHPA 2ERFA 2DUPA 3T1MA 2WT2A 2Z42A 5IK7A 1FNYA 1DHKB 3N7KA 4YZ1A 2PHTA 1D2SA 2W68A 4YW3A 3VV1A 3WDTA 4M3CA 4XILA 4XYXA 5E8AA 4TZDA 2R1DA 3O0WA 3WG2A 1GYKA 1IS6A 3A0NA 2ENRA 3ZPYA 1ULDA 1H30A 1W6NA 1AJOA 1S0IA 2WQZC 4FQ4A 5DZGA 2A70A 4ZXKA 3AYAA 1MR5A 1N1YA 1IKPA 1UZYA 3ZXKA 1RIRA 3POYA 1MZ6A 1U0AA 3OGGA 1IS4A 2A5ZA 1W6MB 4K21A 2A6YA 1OFSA 2ZGUA 2A75A 2VY0A 2JECA 1GV9A 2R49A 1HDKA 1N3QA 1WD3A 4XJ8A 3VKFC 3AXDA 3RQ0A 4JRAA 4P9XA 1FYUA 1CVNA 1N3OA 1J1TA 2GALA 2VU9A 3JUUA 3VKMA 3HR9A 4YGEA 3IPVB 1ULCA 1DGLA 2H0BA 2A3YA 3AP7A 4GKXA 2UURA 1AX2A 2GN7A 5GALA 1LOCA 2I2SA 2ZGMA 4AVSA 4WV8A 2CWSA 2A3XA 2BQPA 5HCBA 3R4UA 4Y1ZA 1APNA 4YZ5A 2GNDA 3AK0A 4Y1UA 4XTMA 2EXKA 2SLIA 3R4SA 1VALA 1SACA 3ZSKA 1WBLA 3OY8B 4XXAA 5FREA 3Q9OA 1PZ9A 3SISA 2YY1A 2VW2A 3B00A 3OBTA 2ZMKA 1OKQA 1YIFA 1BJQA 3BODA 2EAKA 1BYHA 1CJPA 2DUOA 1UN1A 1MS9A 1DQ0A 4XJWA 4C1WA 2ZHLA 4Q27A 3USUB 3V0BB 1LGCA 4PCRA 4YW5A 1D0HA 1N3PA 1S0CA 2GMMA 3VUOA 1BXHA 5IK8A 5GZDA 4FPYA 1KJRA 1SBDA 2PHXA 4AVVA 1LULA 1CQ9A 3IKWA 1V6LA 4ISQA 3DGTA 3AXEA 4FOVA 4FOQA 3AZVA 1FV3A 3N35A 3WCSA 3B9CA 1EPWA 1V6MA 1N1SA 5LK5A 4Y1YA 4U2AA 3WG3A 1KITA 3GNEA 1LJ7A 1IS5A 2EF6A 2VUAA 2W39A 4R9BA 4GXLA 2ZAAA 3QCWA 3ZXEA 3HMYA 5F9TA 1LHUA 1KQRA 4Y22B 2WT1A 2A71A 1WLWA 4YG6A 1UZZA 1A3KA 1DYKA 2CWMA 2FHRA 2A6XA 5DZEA 3W59A 3AZYA 4YGCA 3UJOA 1VAMA 4Q26A 1QKQA 5GLTA 4Q1RA 5H9QA 2C9AA 4DPNA 4PBPA 1WD4A 1GNZA 1FNZA 1URXA 5CA6A 5EYXA 1LOAA 2W08A 2D7FA 1V6IA 1F31A 2P3JA 4M3CE 4UW3A 1YI7A 1JBCA 4FPHA 2D6OX 2ZGLA 1WBFA 2P3KA 3APBA 1LGBA 5GJ6A 4XJUA 1LOFC 1AXYA 4YZ3A 3WDVA 3WUDA 2DVDA 5IK5A 5DZFA 1DQ6A 2Q5TA 4XMIA 2ES3A 1W6QB 4LBJA 1NXD1 3WG4A 3I4IA 2NZ9A 3INAA 1WUVA 1YO8A 2AENA 5F5QA 1WW5A 1PZ7A 2DUQA 4UW6A 3UK9A 1MVQA 3N3HA 4Z8BA 3PMEA 4PBOA 1DQ2A 1GBGA 3JU9A 1UL9A 3ZSJA 3POSA 1LESA 3NWKA 1GZCA 3RS6A 3ZSMA 4DQAA 5DG1A 1PZ8A 1DQ5A 1KDMA 4DS0A 1WW4A 2CNAA 3D4KA 1QF3A 1MS0A 1W6NB 3M3CA 3LSEA 5GM0A 3OY8A 1LHVA 3M3OA 3KM5A 3N7MA 1AX1A 3VKLA 1G9CA 1W6PA 4XMAA 4YG3A 5T52A 1ONAA 4GWMA 2DVBA 4XTPA 1C1FA 2ZGPA 2AREA 1GSLA 2ZACA 2W52A 1QDOA 1ENRA 4PF5A 4U36A 1BZWA 3ILNA 3A0KA 2DTWA 3USUA 1Y7BA 2JDZA 1MS4A 2VH9A 1LHNA 1IOAA 3MW4A 5HCAA 3D6EA 4FVVA 1V00A 3IPVA 4TYSA 1FV2A 1AXZA 3AZXA 4I30A 1DFQA 2ZGSA 1LU2A 5DUVA 1LOFA 4Q2FA 2JJ6A 1SCSA 2PHWA 3BIWE 4AGRA 1QU0A 5T5LA 4DRRA 1I1EA 1S0GA 5GLUA 5L73A 4M01A 1W6QA 1VAVA 3AX4A 4FQZA 4AGVA 4XHBA 5KXDA 5JOYA 2OUJA 1SFYA 2D6PA 2A7AA 1LU1A 1WLCA 3M3EA 5HCFA 1G86A 4FPLA 3BTAA 1QOTA 2CL2A 3H0OA 2E6VA 1SLCA 1V6KA 3ENRA 3NV3A 1DLLA 3N7LA 2A6WA 2OW4A 1KJLA 4CRQA 1DQ1A 4ITCA 1JOJA 3WVJA 1Q8SA 4GA9A 2R0HA 5GZFA 2GMEA 2ARXA 4LBQD 4YG0A 3IMNA 4FPGA 2UWBA 2NMNA 4K1ZA 3SNMA 3MEPA 3FLPA 3WCRA 2JD4A 1F9KA 2ZGTA 1SLBA 3AYDA 4PQ9A 5CBLA 1UX6A 2UWCA 4XDQA 3NV1A 4XOGA 3FBYA 2R16A 4D69A 1MVEA 4FOWA 2ZA9A 2CY6A 3IN9A 4Y24A 3AP6A 3SITA 2E7QA 1CR7A 3O5SA 3QLQA 5GZEA 3TB0A 4BMEA 1N47A 2ZGKA 5KXCA 4UW5A 3V0BA 1SCRA 3M1HA 3M2MA 3WLUA 3ZXJA 2DYCA 5IT6A 1V6NA 1B09A 4BPZA 2E51A 4FP2A 1ZA4A 4LBNA 2E53A 3LCPA 1KRIA 2ZGRA 2ZHNA 4HANA 4LBQB 2G4IA 1R1ZA 2PHRA 1IS3A 5JDBA 4MYEA
chains in the Genus database with same CATH superfamily
3A22A 1PMIA 5JMCA 1VIWB 1SG3A 1F2NA 1XNDA 4JHTA 2FDFA 5FYTA 1CZVA 1V6OA 2PXJA 1AL0G 2Q8DA 1LEMA 2DTYA 2HWC1 2JIJA 5FZ7A 4O7XA 5A1LA 1HIXA 4WVWA 2J1TA 3I7DA 1Q43A 2WS93 1W6PB 1NUKA 3HN1A 5A6QA 2R041 2W2IA 3I2JA 2JB4A 2ATFA 4CTEA 4FXKB 2XB6C 1QJY2 3PUIA 3ZX7A 2RM21 2YC4A 4XF1A 4DINB 2CGOA 5F8PA 2Y6KA 4ASKA 1C1LA 2WLQA 3WNXA 3E5UA 5LA1A 4D94A 4BQ4A 1G7YA 1YYNA 3HQXA 4AGGA 5FMDA 3PJYA 1R092 5DN2A 1A8DA 2ZJCA 2JE9A 3VBUB 1QIQA 2WFF3 4N43A 4NOTA 5IHRA 2VOTA 5C4WA 1RUH1 4XEZA 1NLSA 2YFZA 3WW1A 4GH4B 3ZSLA 5A3MA 3WDUA 2CGPA 3KT1A 2ZEYA 4OI0A 2X09A 2MEV2 4QQ2A 4LBLA 5FY7A 1DBNA 5BNNB 4GKYA 3WW4A 3BTZA 3RZJA 4FPOB 3WDXA 4AHWA 3H7YA 1US2A 3I59B 1R082 2HWB3 4YZ4A 2EXIA 5FOJB 3AMQA 4PIXA 3BU0A 3GALA 4Q5OA 2Q0AA 1SZBA 4R9DA 5FP4A 2EICA 1NE4A 5BNNA 2D3RA 4BIFA 2FMDA 1ODMA 4YFZA 1BKZA 4OZXA 4FFFA 2EIEA 4NO4A 1JYNA 3AMPA 5F3GA 3ZFEA 1K12A 4ISRA 5ACA2 2XJVA 5JPMB 1UPIA 1L7QA 3FHIB 2DVFA 1RUF3 4RL7A 2Y34A 2RS52 1MZEA 1GOGA 2GNMA 4JGZA 1AVBA 4YRDA 3W5MA 1GP4A 5F5AA 1RUD3 5FK7A 2FMYA 1G9FA 1I3HA 4BM8A 4CCEA 4GIQA 1S2EA 1K5MB 5LEJA 3HQRA 1YFXA 1YNAA 1DF0A 1UPSA 3LSDA 3S5AA 1V9U3 5DUXA 1MZ5A 4ZONA 2XR4A 3CU7A 3HPNA 5EV7A 1CAXB 1R091 3P6BA 4XFAA 4AAXA 4LUKA 5FKBA 3NNMA 3NQHA 4LTAA 2JIGA 2ZX0A 2LROA 1RUH2 2W0XA 1LR5A 2X5IB 1YIPA 1C3HA 2W5FA 4ZS3A 4UW4A 5FY1A 4QPWA 2P2KA 2YPDA 3BOWA 2VXRA 1LCLA 4JDOA 2GH8A 4YVWB 5F6LB 4LHLA 1MS1A 3LD8A 4CCNA 4BLJA 2ZS6B 1NCQC 5FZ9A 1CAXA 3KWVA 1ULOA 4QHBA 4XBQA 3VDAA 1PK6A 1MS5A 3AYCA 3OPZA 3KS7A 3F2ZA 3MI8A 4D6QA 4HMZA 4FP3A 4CCKA 4AE2A 5K9YA 4A45A 4Z2AA 5T54A 2R061 2W9XA 1HQWA 5A3UA 3MO4A 2YC2A 2HEYF 1AYM3 3NNFA 5EXOA 4RHV2 1BEV3 1FMD1 2WUHA 1SLTA 2XLGA 5K8SA 1AXKA 1MQTC 1Q8QA 2VW1A 3I3EA 4TSVA 4JX0A 3ITQA 2AGSA 3MFAA 4FPEA 3DCQA 1JU3A 1PGW1 3E5QA 2GSYA 2GU9A 4CEWC 2HH9A 2RDQA 3VDCA 2AEYA 3ZYJB 1ENSA 1RUH3 1OA4A 4Q8LA 4QAWA 3RYRA 5DXDA 1CONA 1UKRA 1ZM1A 2HWD3 3AKTA 4X6RB 4LK7A 1ND3B 4XF9A 1F15A 4GMP3 3R0RA 5FUPA 2TUNA 4KWKA 1UYZA 3RZKA 3FUOA 4MHUA 4ATFA 2OXBA 3QACA 5C71A 1UOFA 3H1MA 3H42B 2AEZA 3ZMOA 3IIIA 1H2KA 2PHLA 4HPKA 4PIYA 1UZWA 1QJU3 5FXZA 3RNSA 4I01A 3CBNA 4NRQA 4NHKA 2YB7A 2GDFA 4WVMA 3FLTA 2VVEA 3JB8A 1UMIA 2LRPA 3JD73 5ERLA 3ZYHA 2J1SA 1K45A 4INDA 1GICA 2WZ8A 4XQWA 4IEYA 2JXAA 2WNUA 1R1A2 3J7HA 1IPSA 3SH5A 1C5HA 1EPZA 4LK6A 1CAVA 3TN93 1XYNA 3J4UH 4J1XA 2YG0A 4Q1PA 2OKXA 2QQUA 1DGWX 1LTEA 3SCHA 4TLFA 2Q30A 1W2AX 3LFIA 3NV2A 3ILFA 4I3GA 1S0JA 4MO3M 2GP5A 4OVEA 5B4XA 3DYMA 4C8DA 4LLFA 1OA3A 1RTVA 5JVVA 3T2TA 4PDWC 1Q8VA 1QOSA 1UXZA 5JMOA 2E9QA 2XUEA 4XIKA 3RZZA 4EN0A 4WZCA 1GZWB 2D3SA 3AP4A 1DZQA 2RVAA 5FZFA 5FYUA 5FO9B 3FX3A 4B8EA 3ZMNA 3B5LB 5FZ0A 4RR3B 1WZXA 5CFDA 3LEIA 4IE6A 3VBHC 3C8XA 3GHMA 5JI9A 5A3LA 2WN3A 1BVVA 2ZHKA 1W2TA 4NR1A 4N7IA 3P1IA 4Q4X1 4RN5A 2B45X 2QE3A 3MZHA 3OJBA 3OPWA 2DCTA 3VKNA 4AR2A 4SBVA 5C5UA 2OVUA 2YBKA 1VBA2 4YM0A 4HVQA 1FATA 3ACFA 5EJ3A 1C4RA 1MEC1 3D0JA 1PVC3 1I5ZA 2H0VA 4HN1A 3KCCA 1PO11 2W95A 4NPMA 2PHUA 2YXSA 3WNNA 2VTXA 3DL3A 3KZ4C 2IXKA 2R32A 3OG2A 4KI5M 5A3TA 1LEDA 1JZ6A 1O4YA 3KT4A 1CIWA 4MXWB 1PVC1 3CZUA 4J6GA 1IPJA 2WJSA 2ZKNA 4SLIA 4XF4A 2VMDA 4FI9A 1GKBA 1RINA 2DU0A 1HX6A 2WT0A 4FFGA 4RR3C 5IAXA 1PGSA 3M7AA 2QDRA 3BGAA 4BU2A 1UMZA 5LBEA 4M3CB 4Z07A 3V64A 3WP6A 2J1AA 1CPMA 2HEVF 2Q8EA 1EAH2 3FE5A 1SLIA 2XJQA 5T5JA 3VDDB 1QY4A 1VRBA 5GLZA 5JOXA 4FPFA 3BYWA 4JKMA 2RV9A 2PAKA 2WT2A 1HJFA 1W2UA 1VBC1 3HBZA 3HNMA 4Q0SA 3WT3A 1A34A 4MLOA 5JR7B 5L9RA 3VZNA 4Y3OA 1J3QA 1D2SA 2XBO3 4M4PA 5C8CC 2P6CA 2ADEA 4TZDA 3GHNA 3MUY1 1OF4A 3A0NA 3TEXA 3NJZA 1FI2A 1B35B 4MXVA 3ZPYA 1ULDA 4BQ5A 5C6CA 1BBT2 3B93A 4D7TA 1MR5A 1QJY1 1OLRA 3ZXKA 1UWWA 4B4QA 5J1XA 4GWJA 4OULA 1V9U2 3ALQA 4W4ZA 2A6YA 4PIZA 1B35A 2A75A 2VY0A 1YLLA 4YVSC 3NL1A 1HDKA 4J25A 3VD4A 3HNYM 5EPAA 2HWD2 2WQ4A 3IAQA 4M0NA 5K4LA 2XKOA 4P9XA 1CJDA 1CVNA 1D7PM 1FYUA 1J1TA 2GALA 3KVAA 3ORJA 3QOPA 3I49A 2X5IC 3HR9A 4RS5A 4YGEA 3KCYA 5C3QA 3WEZA 4GKXA 4QXBA 4W6WA 4PI2A 1PNFA 2VPVA 4IGOA 4UOJA 3ZYIB 1ZA7A 2WS92 5FPZA 1NAEA 1NCRC 1W3VA 2Z5WA 4BB3A 4G3YC 2VC9A 4AVSA 2A3XA 1RJ8A 3JB4C 2JG8B 3U75A 4YZ5A 4CUCA 3O1PA 2OIIA 5FIXA 1NA1A 1AR71 3MPBA 3ZSKA 2WO3A 2P1BA 2ZAHA 3CQOA 3FFQA 2BYVE 4IXLA 2VW2A 2UY8A 4BZ4A 4LKSA 1AR73 1OKQA 1H4GA 2BGCA 1UCXA 2PYTA 1X8MA 5A7WA 3VB9A 1JUHA 1OH3A 4AFCA 1C5IA 1VBE1 3D3AA 1NT0A 1MS9A 1YCIA 5DDJ3 5KHIA 4C1WA 2ZHLA 4Q27A 3USUB 4OUEA 1PVXA 3U0ZA 4PCRA 4YW5A 4M0HA 3POBA 2W92A 5F6KA 2VZUA 1R093 1N3PA 2O8QA 2TBVA 1S0CA 2F6BA 2WWUA 3BALA 3NNLA 1ZRCA 1ALYA 1BXHA 3VDBA 1LKNA 4NPRA 2PHXA 3TWIA 4A3ZA 4AVVA 5FKCA 1CQ9A 3S0MA 4AVAA 1V9U1 1DGRN 4M4RA 5F3IA 3AXEA 4E4HA 3N35A 3RI8A 3ZFGA 4NIDA 2RJLA 4XQ4A 2FZ1A 5LK5A 4Y1YA 2CHHA 2EF6A 2VUAA 1OF3A 4CDWA 4DB5A 2ZAAA 1TQ5A 2DDUA 1LHUA 3HMYA 4AVBA 2JG9C 3HN3A 3VBRB 2I74A 1AR62 2WT1A 1WLWA 4A3XA 1DYKA 2FHRA 3HIFA 4JHZA 5IJRA 5BNPB 3AZYA 2R063 4XFCA 4YGCA 5FZOA 1VAMA 2QJVA 1UIKA 1QKQA 3HEIA 4Q26A 5H9QA 3OTFA 3ACIA 1CZTA 2C6SA 2IVJA 2EVXA 4Y33A 1OQEA 5EYXA 1PK6C 1AUYA 1O8PA 4YARA 5AFBA 4UW3A 2BJSA 2JDAA 4B1MA 1YI7A 5I8TA 5KHJA 1RUG3 2P6HA 2R062 2PFWA 1DZRA 2W1QA 1LGBA 5CFDB 2VZSA 1ZZ7A 3CZJA 3VHPA 2WO2A 5DZFA 1DQ6A 4NIAA 5CZKA 4XMIA 4QX2A 4BCUA 3CO2A 2ES3A 4YYOA 1NQDA 3I4IA 1Y3TA 1GQPA 2XKPA 2NZ9A 2OZ6A 4GMP0 3N3HA 1VBE2 5KHKA 1TNFA 4BQWA 2IXIA 4DY3A 1REFA 1QJX2 1YEWA 4CDXB 2HEWF 3ZSMA 3O1SA 1W2NA 3WY6A 5CADA 3MIGA 5L9VA 2VZ3A 1QJU1 2ET1A 3WSOA 3ZN6A 3CF6E 1QF3A 2WIIB 4Q4Y2 3WF4A 2CAUA 1WMDA 3HAGA 2D93A 3OY8A 5GM0A 2XH6A 4FBFA 4OQ8A 5F5IA 3FHQA 3N7MA 5DABA 4A7KA 1W9YA 4URAA 4OHWA 4Z1VA 1ONAA 1D4VB 1RGSA 3T09A 1RUI2 4QX1A 2Q8CA 4CVUA 5FOBB 1RMU1 2UY9A 5IWFA 4QKNA 1KS4A 1ENRA 4PF5A 1BZWA 2DTWA 4CCDA 4KGGA 1Y7BA 2JDZA 1MS4A 2VH9A 1LHNA 2WNOA 1IOAA 1XSQA 3MDPA 3MW4A 4OUSA 2G19A 5FR3A 2J1VA 3J8F3 4FVVA 4Z82A 1AL22 4TYSA 5IVBA 3ACHA 5LA0A 2F4LA 4CCCA 1LU2A 4R4ZA 3GYDA 5LRSA 1LOFA 1PIV1 2O0OA 3WF0A 1QU0A 2QVSB 4LPLA 4QT6A 4DRRA 4XDPA 3I54A 2RJKA 2XVGA 1AYN2 5L73A 4QPIA 4CUGA 5F37A 4YW6A 3MBWA 4FQZA 5FMOL 4AGVA 2FCVA 4A4AA 4D6RA 2BPA2 4PDWA 1LU1A 1O4TA 5A6YA 1RUE2 3HD8B 4RQPC 3NKGA 1JH5A 1PGL1 1QOTA 2E6VA 3EXUA 4P5HA 1DLLA 1QHDA 3WW2A 3AKQA 3ZPOA 1DQ1A 1JOJA 4NAOA 4CPBD 4Q4X2 1JZ4A 4Y4RA 3J7LA 1JOPA 4LBQD 4YG0A 2FBEA 3IMNA 5KBFA 4LT5A 4LUMA 4LKFA 3SNMA 1EYBA 1L3JA 1AR91 1KGYA 1Y9QA 2KD7A 2VVDA 2WZR3 1UU5A 3FLPA 5F39A 2XPJA 1F9KA 2V4VA 3AYDA 1Y9GA 3PUAA 4PQ9A 4YVWA 1XNCA 5CBLA 2JDUA 3BPZA 5FBJA 5C3OA 1UX7A 2JDHA 1PO12 3BKZA 1RXGA 2B4KA 3J9SA 4K8FA 5L36A 4RGAA 4Q4Y3 4CDXC 1MVEA 4AZZA 3C3VA 1C8NA 1VBD2 3AP6A 3W21A 4OI2A 3VBFB 1N47A 2BVVA 5KXCA 1JTZX 1SCRA 1CIYA 5FDBA 5K0UC 1OPOA 3WLUA 2DYCA 1CAWB 1V6NA 5EFUA 1AL21 1LB2A 4CU9A 2OQ7A 3TYJA 4WBBA 2C0ZA 3WD5A 2ZGRA 3VLBB 5JI7A 5HXVA 4HANA 2G4IA 4H3WA 4LQRA 4N53A 1WLTA 1ACCA 1N1TA 2ZEZA 3B3QE 1PX4A 3E6CC 2NP0A 2F17A 5T5PA 3BI3A 3WR0A 1D0GA 4CP2A 3D8CA 4ATEA 2RS33 4YGBA 3O0VA 4GWNA 2R1BA 5C4WB 3RDIA 2XUMA 1IQAA 4NWWA 3WNOA 4PQQA 5JCTA 2E63A 1SQ4A 1FAYA 2VZRA 3ZDVA 4EN6B 5H9PA 3MPPG 1O4ZA 2JG9B 2JX9A 3VBRC 5HV0A 1BBT1 5JWPA 2PHFA 2UWAA 3CNAA 3N7JA 4TLGA 2D40A 2OPKA 1FPN1 3L2YA 3H8UA 3OEAA 4V1PA 2GMPA 2D5HA 3GZAA 3VD5A 2EALA 2JDYA 4HN0A 3AJZA 3O1VA 3K2OA 4IL7A 5ABJA 2E33A 2CYFA 3T2OA 1JYTA 1AR92 1GR3A 1AX0A 3GXUA 3UJQA 5FYCA 2CTVA 5DUUA 2HWD1 3CDZB 5C9AB 2A3WA 3H3ZA 4ASLA 4GD4A 4B7KA 4KU8A 4W6XA 2BOIA 5D8AC 5T3NA 5FZ3A 5T55A 1H8TC 1LAJA 5BNOC 3WF1A 3KF5A 3O7OA 4N43B 3E1F1 3VBOC 3WOGA 5ACA3 2VNOA 4JCKA 2QZ3A 4YW1A 5FJKA 5FJHA 5JLVA 1SPPB 5I8SA 1K3IA 1W9SA 1U5IA 3MYXA 1NE6A 1QH6A 3LEGA 4X8PA 4CYDA 2ZGQA 1CESA 5AC92 1DDLA 3TN92 1UYYA 4W6YA 2C9KA 5FRAA 4JVAA 1H2MA 1SEFA 1EV11 3V65A 3UT0A 4F7ZA 4LKDA 4F3JA 2D43A 2D44A 5D21A 1XXNA 4BDVB 3MV11 3ECQA 4LIVA 5FYBA 4P9GA 3WW3A 3OBRA 5FY5A 1UY3A 3WHUA 1RUF1 2ARBA 2A6VA 2YV8A 3U4XA 2K2SA 2HBTA 4IV3A 5FV3A 4CCJA 2VULA 5EJZB 3EO6A 2DURA 1WCKA 1J84A 1W8HA 5IAVA 1WCQA 2VZQA 1UYPA 2OUHA 4CXXA 3IM0A 1Y9MA 2YZ4A 2GNTA 3B01A 3ETQA 3OBAA 4QM9A 1FPN2 1OLMA 1VBB3 3B7MA 5CKMA 5A70A 3LDBA 4EQVA 1DP0A 4EN8B 4OYUA 4LO6B 4LBQA 4CEWB 3DECA 1FOD2 4CDUB 4YSFA 2P34A 3USSA 1Y4WA 4QD2A 4W8JA 3PJQA 2YYOA 4CEWA 1ODNA 2ZX2A 3ZFFB 4AI2A 1F5JA 2VAUA 2HWF1 2JB8A 3N9LA 2PELA 4K1YA 4Q4V3 3VL9A 3FLRA 4IQPA 3UESA 1BEV2 4NVPA 1JYIA 1ENQA 1U5YA 1KS5A 1UU4A 3EMRA 5T50A 3FZ3A 2OYZA 4NIHA 3N9NA 5FYVA 4H7MA 4BQ2A 1LOGA 2WNVC 4QMAA 4QDQA 4XDOA 3ZXFA 2V4AA 1HQLA 4Y1XA 4C90A 4MX3A 3ZYBA 3WF3A 1YUDA 4W50A 2VBPA 4H2AA 3ZIXA 5FFOC 1VP6A 2PLV1 3K4AA 5A7NA 1STMA 3R4DB 4K9SA 1JUIA 5JXJA 2NYYA 4O9GA 2VOXA 4UFMA 3VDDC 1HXS2 1LENA 2BBAA 2ZZJA 3VGIA 4HKLA 2DBNA 4ES8A 2WN2A 4P9YA 5BYNA 1AR81 2G9FA 3NAPC 1S1AA 3Q8FA 1D4M1 1CWPA 1UD1A 1ULGA 2PA7A 4R9AA 3V0AB 1O3TA 5IFPA 2BU9A 5FZGA 2OA2A 2SBAA 4CDWB 2WSVA 5JIUA 1NLQA 2J42A 1Z7S1 2HLEA 3CL1A 3POGA 4Q4W3 1K42A 4P14A 1LECA 4P9IA 1QJX1 3P3NA 2CAVA 1TMF1 3MICA 3ATGA 1HLCA 1UKGA 3AFKA 3R05A 1QJU2 1GUIA 4F83A 2V5YA 3V0AA 3A4UA 3VZMA 5LZ6A 1QOOA 4BXFA 1WCSA 4QB6A 1XOYA 1Q5OA 2X8KA 4PLOA 5CAZA 4XJAA 4AHZA 5E88A 3J8F1 5CB7A 3ACLA 2MPFA 1XE8A 1UZVA 1O6UA 3VHOA 1QQP3 2BW8A 3I8TA 4AEKA 2PHDA 3PNAA 3BTYA 3MIBA 4I2OA 2DWRA 2BZDA 2XLFA 5I8YA 1UAIA 4PJYA 2BOJA 1MPXA 5BNQA 5C9AA 3MLKA 1W0PA 5FYMA 3OD0A 4YPJA 3RZLA 4A42A 5KR7A 1W2OA 5F7UA 4OHZA 1S0EA 2RDSA 2B46X 3B9IA 3RG0A 3VZOA 4ARYA 3NNJA 1PIV2 3PTRB 4UBHA 4WZFA 4O65A 2JG8C 5JOZA 1SLLA 3ZFFA 1J3RA 1R083 1XU2A 2HWB2 4ET7A 2AH2A 4CDQA 2OX0A 2YPJA 5FYIA 3RRDA 1XC6A 4QPIC 4RA0A 4WVVA 2ZABA 1W8OA 5DG2A 4C91A 2XWBB 1QNWA 3AYEA 1SHWB 2EXJA 1IQDC 2WINB 4DFSA 5FY4A 3KQ4B 2JD9A 3PVOA 2AR6A 5A1AA 1ZBE3 3I3BA 4NRPA 2YROA 5ANNA 1UY2A 3ZXDA 4PF1A 4HVRA 4KG0A 4FTSA 4XFGA 2DV9A 2WZR2 3FL7A 4CEYC 5A3WA 2ARCA 3QD6A 1V70A 2YMZA 3MUZ1 1C8M2 2LW8A 1ND3C 1LOEA 3IIAA 4YLZA 5CVRA 3VBFA 5FZMA 3ZKYA 4LHKA 3N4MA 2YGMA 3IBMA 5F3EA 4ES9A 5EP9A 3LZZA 1VLNA 4RS5C 3NMBA 4XHXA 4HLTA 5FLIA 1U12A 2VD7A 3IMMA 4YVSB 2ARAA 2D5FA 1CPNA 4MZUA 5L7OA 1QNYA 2D98A 3KMHA 2PQSA 3T0BA 4BQ1A 2W1UA 3MF6A 1SDDB 2ERFA 1X7NA 3GBFA 3T1MA 1C8M3 2G9GA 1MZFA 1H6XA 5IK7A 1QXJA 4CDQB 1DGWA 2P3YA 3J26N 3PHMA 3SCGA 4YW3A 2W68A 3MGUA 1AYM2 4M3CA 3WDTA 5FYZA 4WM8A 3PLQA 3WG2A 1GYKA 1IS6A 2ENRA 5CFDC 2HWC3 4AEDA 4FQ4A 1H30A 1W6NA 2WAOA 1S0IA 2WQZC 2ZEXA 4JAAA 1N1YA 3I2HA 4HFSA 5AVPA 4BA6A 1IKPA 1YHFA 1A8MA 3POYA 1U0AA 1YC61 3VBSC 1U5XA 1IS4A 1U5ZA 3U4SA 4E4SA 3H8OA 3N9OA 4KGQA 4P5YA 4CU6A 4KMQA 1W04A 4QXCA 2HWE2 4XJ8A 2PTMA 2XJSA 3VN4A 2IXJA 3AXDA 5ISLA 4JRAA 2WFF1 1N3OA 1WMEA 4NN0A 3JUUA 1PIV3 1YFUA 4IUGA 4QU2A 1UY0A 1DGLA 3WQ7A 2H0BA 2A3YA 2VL4A 5JIAA 4QHZA 1QJX3 1AX2A 2UURA 3HVDA 4XFFA 1X9PA 1G9DA 4KNCA 1GNYA 1LOCA 3O1OA 4BH9A 1EY2A 4RR3A 2VCCA 3SMHA 3A23A 2KXLA 2BQPA 3S57A 4EWDA 1RB8G 3W5NA 1APNA 2YBPA 4DXRA 3AK0A 5KHHA 4AFBA 2Z2SB 2SLIA 4H14A 3LQCA 1WBLA 1OVPA 2HBUA 3OY8B 4GJZA 5FREA 5AC91 1PZ9A 2RS12 3WP4A 4UFKA 1S2BA 2WO7A 3OBTA 4RFT0 3EBRA 5I91A 5ANQA 1NYWA 3T0AA 3PVBB 1COV2 5LY2A 2ETEA 4BIOA 5D1IA 3S5QA 2XOMA 1OXCA 3RJRA 1CJPA 2XVLA 2DUOA 5DPNA 5FAXA 3BTXA 3K46A 4EE2A 2YGLA 1VR3A 4XFBA 4FT8A 2BTVC 4KG8A 4WVMB 2GMMA 3VUOA 2DF7A 5GZDA 4E27A 2BDRA 5DAXA 1VJ2A 3OUIA 2LM3A 4AI0A 1V6LA 4ISQA 4CCMA 3DGTA 1HB3A 2YU2A 1O91A 4FOQA 3Q8BA 1FV3A 4OHXA 3WCSA 5FY9A 1V6MA 1N1SA 2RMU3 2V72A 3UGFA 2R042 3Q8AA 1IS5A 1NZCA 2WFF2 4GXLA 1OVSA 3MLLA 3UKNA 5FUIA 4B29A 4CCOA 3WNPA 4EN7B 5F9TA 4META 5BNNC 5CKQA 2RDNA 3PU8A 4YZ2A 1AR63 2A71A 4YG6A 5FY8A 1A3KA 1RYYA 4CXWA 2A6XA 4IERA 2HWF3 3A21A 1NCRA 1WMXA 4AFMA 5GLTA 3O1UA 5DAWA 4HBNA 2KA3A 3RPQA 2C9AA 2ORXA 2BRTA 1WD4A 4LO4B 4E8DA 5CA6A 4BQXA 3ES4A 3WF2A 5D2AA 5LBFA 1V6IA 2G9ZA 4M3CE 1JBCA 4Q4V2 1S4CA 3H3UA 2ZGLA 5C5TA 1ENXA 3APBA 4PI0A 2X10A 1CAUA 4XJUA 3KGLA 1LOFC 3LB9A 3WDVA 1KEXA 1FOD3 2DVDA 1E57A 4MV2A 3ZSEA 2GZWA 3UETA 4LBJA 4JDMA 4QQPA 1TZOA 3WG4A 4XFHA 3GZUC 4N7UA 1Z7S3 1K5JA 1YO8A 3CHXA 4JGZC 4Q4W1 5F5QA 4IEUA 1AR82 4P02B 2QQMA 4LJHA 3KV4A 3LDKA 3KCXA 3POSA 4DQAA 1D4M3 5A6XA 4R8HA 2ILMA 2VCBA 4UAPA 2CNAA 1MS0A 4IGPA 1W6NB 2BWCA 3PMSA 4MADA 4RD7A 1TMF2 5FTTC 1O8SA 2QQKA 1OOPC 3KM5A 3LFMA 2B5HA 4LE3A 3TBDA 5KHGA 1DGRA 1W6PA 4XMAA 2FCUA 3I2IA 1YQ8A 4GWMA 2DVBA 5FXXA 1C1FA 1YI9A 3ZFGC 5IATA 1NOVA 3AVRA 3WNLA 1K5MC 3ILNA 4YVWC 1RUC2 3GBWA 4DXSA 2HJIA 3EQEA 5HCAA 2AACA 2Z4FA 3DYOA 2WLPA 4RS5B 1FV2A 3JBG1 1JZ5A 2LUWA 2QDNA 1AXZA 3AZXA 4JGZB 1DFQA 3E6DA 2XBO2 5DUVA 3URFA 1SCSA 3BIWE 4AGRA 2VOKA 4LEJA 1WA6X 1QJZA 1NZIA 3K4ZA 4LORA 5T5LA 2GP3A 4JKLA 5FPBA 5GLUA 4UT5A 5M0TA 4LNVA 5JXGA 1RVF3 4EN9B 3CJIC 1VBB1 1HRI3 2VCMA 1SFYA 5JUVA 3GJBA 1PNGA 3WP3A 1ZBA2 3JQXA 2FDIA 1HB1A 2GAUA 5HCFA 1F35A 1F4AA 3K3NA 3MIHA 2N7GA 2ZXQA 3OUJA 3NV3A 3RGBA 2A6WA 4IV1A 4IEWA 4MOAA 5HI0A 3MIEA 5A3PA 2R0HA 3IAPA 5GZFA 1GMMA 5B4NA 3M3IA 4FFHA 4LHSA 4EWEA 4RHV1 2GC2A 1NXMA 1DZTA 2YFUA 3VBUA 4DOUA 1SLBA 3HJRA 1NG0A 1UX6A 3C7HA 4XDQA 3TEWA 4J1WA 1POQA 4G4FA 1ST8A 2GC1A 1O5LA 2WZR1 3FBYA 5ABJC 3B02A 3I97A 1W8WA 2R16A 4QDSA 4D69A 1W06A 4FOWA 4CEYA 2MHFA 3SITA 5FP7A 3O5SA 4BMEA 5LA9A 4UW5A 5FMBA 3M1HA 3M2MA 3MIFA 2RM22 1M4WA 1XNBA 3LA3A 1GWLA 3JBG2 4BPZA 1YQ6A 5JXIA 1ZA4A 4LBNA 2E53A 1XE0A 3BB6A 3W58A 1M06G 2XBO1 5JDBA 4IDZA 1HB2A 1OI6A 1US3A 2QNKA 3ZFEC 1RUOA 4PDWB 4NE9A 4XPVA 3PUQA 4XABA 1OMIA 4JGYC 4O9EA 2BEOA 2D6MA 1OA2A 3P5BA 4XE9A 4XZPA 1TEIA 2CDOA 2DCKA 2W1WA 4OLLA 2FDHA 1GP6A 1ZZCA 3IT8A 4DEVA 5AFEA 4GB31 2VECA 3AMNA 3OYWB 1R1A1 3NW4A 3OOXA 3K75B 5LB6A 1O5UA 4Z92B 1O3QA 5BXXA 4WM8C 3DUIA 1JXNA 4QWNA 1GZWA 4EJRA 4Y26A 3AZZA 2A73B 3NAPB 3E5XA 3K51A 3J7NA 3ZFGB 2VNRA 5FPUA 4G9SB 1RUE3 5FZ4A 4D8MA 3X29B 3TRSB 4OMDA 3THTA 1H1IA 4RSUA 4LOTA 5E16A 4BWOA 1QWRA 5A7SA 2GH2A 3ZR6A 3D5OA 1IPKA 3K3OA 2XJPA 1S0DA 3SCFA 4MGSA 4Q0VA 1AJKA 2Z69A 4M00A 4QX5A 3HT2A 5FBZA 3PVNA 5LEKA 2WWSA 1O59A 1ASJ3 5IVCA 1PMJX 4LKEA 3D0SA 1NCQA 4ZZ5A 5GZGA 4NROA 3WDWA 2Q4SA 1JI6A 2B9VA 5C3RA 1H2NA 4FTBA 5I0UA 2V73A 4L2NA 4CP1A 3THDA 4L11A 5SV8A 3WQBA 2BV4A 1MEC2 3JD71 2C5DA 1R64A 2YU1A 2VUCA 5FPLA 3ASIA 4LBKA 2IZWA 3GDBA 4LXLA 1I6XA 2B7YA 1Q8OA 2W91A 2JE7A 5IVYA 1LRHA 4COZA 3OGRA 2HWE3 3ZDSA 3WQ0A 2QUOA 2EIDA 4HKWA 2B42B 1H9PA 1CD3G 1YQ5A 2IVIB 4ZU5A 5T5OA 1XSRA 2YUEA 1QH7A 1KDKA 1X9TA 2W3JA 4Y5SA 5GLVA 3UGHA 3KSCA 3RI9A 3OGVA 4GB32 2P4EA 3ZOIA 1EAH1 3H1WA 2Y0IA 1W03A 3O0XA 5DDJ1 5BNOB 4N8MA 1MQTB 4QPGA 2I45A 2AC1A 4H7LA 4OZOA 3ZYRA 1HW5A 2R6QA 1NKGA 3H7JA 4IV3B 5A7QA 2BNMA 3E6BA 4Y1VA 1FMD2 1XYOA 2IXCA 1WA4A 4YM3A 3WG1A 2H6BA 4CPBA 2P37A 1QJFA 4YM1A 3K77A 5FZ1A 5CG8A 4V2WA 5FO7B 1X50A 4CEYB 1DQ4A 2Y26A 2QQPA 4JRLA 1LGNA 4QM8A 4XBLA 3WHTA 3UKTA 4ZHNA 3ZR5A 5BPXA 1SBFA 4HONA 4Q29A 5C9AC 2WFPA 1JZ3A 1PMHX 1GZ9A 5IW0A 3H8RA 3AKSA 4TXWA 3WZ1A 1RHI3 4QPYA 1XE7A 3ZXLA 5C3SA 4XJZA 4MGIE 4KU7A 1MS3A 2EIGA 4YW4A 3N36A 4JDNA 1OLME 5I0SA 1GU3A 1JN2P 1X33A 2ZGNA 3ZVXA 2C24A 4IEZA 4E2QA 4QKBA 4BXSV 2R0FA 1IGOA 1XNAA 4DZGA 5IK4A 1SMVA 3AP9A 3VZJA 4Y20A 1H8VA 2XHNA 1JHNA 4MGKE 5GZCA 4YM2A 4R52A 2B8MA 3ROUA 4GH4C 2DVGA 1DCSA 3ZLIA 4HL0A 5DDJ2 4CDUA 2VNGA 2QKDA 3O14A 1Q3EA 1Q8PA 2GC0A 2ZGOA 3M70A 1PO23 1H0BA 4DXZA 1VE0A 3POJA 4GB33 3H1YA 4LO8A 1TME2 3AJYA 5FLJA 1RC6A 4P08A 5FLHA 5DUWA 5FZEA 5A7OA 4OUMA 2HWC2 3NNGA 4UFIA 1JYCA 5HCHA 5BUVA 3DEMA 4Q0UA 4ZZ8A 4N53B 5H9SA 1WKYA 3O12A 2IC1A 1FX5A 1RUC1 5LA2A 1IKQA 1YXWA 2D3PA 2QQIA 2D6LX 5AVAA 4LULA 3VBOA 1VAKA 2W94A 3N9MA 3Q8CA 3ZN4A 2ZPXA 2Q8OA 4AFDA 4CZSA 3I2OA 1O3RA 1WLDA 4HOOA 5L19A 4Y22A 3OYWA 5A7PA 4C1XA 1ZRRA 1H1MA 1VB4A 5J37A 1ASJ1 2VE1A 2VUDA 2VOWA 1PHMA 5EHDA 1YFWA 2X05A 4NAMA 1IZ3A 1REEA 2DCJA 2MEV1 2Y38A 3E97A 3NJYA 3LIHA 4EZHA 1R081 1ULFA 1KFXL 2RMU1 1RITA 1SLAA 3LA2A 3MW2A 4XCBA 3TAYA 4GAZA 1V6JA 4AWDA 4XUPA 4L8QA 4N43C 4NHXA 4QQLA 3RJ2X 1EV13 1OC1A 4LBOA 1OH4A 1A78A 2QQWA 4E4ZA 3I2FA 1YRZA 4HPKB 4W65A 4KWUA 3C7FA 1MS8A 1YJKA 3T0DA 4FFIA 5J98B 4P9WA 2JKBA 5J48A 4LBMA 1JU4A 2DU1A 2TNFA 2BFUS 5CFCB 4FPCA 4JC1A 3FC0A 2RS51 2OT7A 4UYBA 2JG9A 5EQUA 3AMHA 1WW7A 3T1LA 4AYUA 1G9AA 3RMYA 5JZGA 4BHPA 1RHI1 5KXEA 1T6BX 2QTWB 2GNBA 2ZMNA 2EIBA 1W0NA 3AC0A 5FZAA 3PU3A 2K9ZA 3KQRA 4FOYA 1CZSA 1UNBA 2X53S 3DKQA 2P3IA 3NVCA 1DU3D 4H55A 1VBA1 4B1LA 4IV1B 1T6GC 5K0UA 5CFCA 2VW0A 3NKTA 4I0AA 1UZ0A 3RVHA 5LBBA 2DUPA 3CLPA 4GZ9A 1W28A 3MFCA 2UYBA 2C4XA 2VBBA 2VO5A 3BU7A 4GMP1 2Z42A 3WNMA 2PAMA 5IVJA 3N7KA 1BLZA 3SKJE 1ZRFA 2PHTA 3VV1A 1PVC2 2P17A 2J1RA 1ASJ2 5LATA 4XYXA 4AXOA 3VBHA 2R1DA 2WBKA 2IWGB 2FDJA 4OCTA 3SXWA 5DZGA 5JXHA 5CIRA 4E2SA 1RUJ3 4ORFA 2A70A 4ZXKA 4Z2WA 3AYAA 2WS91 3ZN6B 1TME3 4JGYB 5FXWA 1HV0A 4A7YA 2PLV3 4QGLA 4BQ3A 3KGZA 1MZ6A 1CAVB 2IUWA 3OGGA 2A5ZA 1W6MB 4K21A 1VBC2 2J22A 3MF9A 4OQ9A 2ZGUA 1W05A 1GV9A 2R49A 3U37A 1WCDJ 3UL2A 2XGXA 1W8NA 3VBHB 1JYVA 3HBKA 3OPTA 3RQ0A 4AI8A 2VU9A 2CDPA 4HXCA 1REDA 4LITA 3IPVB 2NLRA 4AEMA 3AB0A 1FXZA 4UBGA 1EUTA 1BCXA 1JZ8A 3VBFC 4DNYA 2GN7A 2ZGMA 4PLMA 2R7EB 1RHI2 2CWSA 2Y33A 1OT5A 2G1MA 4NHMA 5HCBA 5I0TA 3R4UA 3PTYA 2F4PA 4E9KA 5K0UB 2WO1A 1JODA 1VRH3 2GNDA 2WA3A 4Q0QA 3S30A 4BISA 4Y1UA 1UY4A 4A2UA 5A6ZA 1W9TA 4QU1A 1VALA 1XU1A 3LIGA 3ZYGA 5FYSA 2R073 4XXAA 3Q9OA 3JD72 5JR2A 4XAAA 1QQP1 3VBSB 1QXRA 2YC0A 5A33A 3D82A 1RUC3 3KHCA 3DYPA 1NQJA 5F32A 1EUUA 1VBD1 3HWJA 3M8LA 4KH9A 3QH6A 4XZUG 3UV9A 5LBCA 2Y8KA 1BYHA 3N9PA 2VZTA 5DQ0A 3T3YA 4CUAA 1DQ0A 2IXHA 4XJWA 2VM9A 5EJ1B 5FZCA 5A3OA 2W46A 3POIA 3DV8A 1JYWA 4CU8A 3I2DA 1D0HA 5CU1A 2Y6FA 4KL1A 1HRV2 4ZXEA 1XNKA 2J1EA 3WQ1A 1NCRB 1S55A 1OUSA 3I2KA 1KJRA 1SBDA 5C33A 2OZJA 3IKWA 3VHNA 5LK7B 1H6YA 1RUJ2 3ZXGA 3G6JB 2MNGA 3B9CA 4RYDA 1OLQA 2X5IA 4CSWA 3WG3A 2OQ6A 3GNEA 1LJ7A 4R9BA 5IFTA 1OOPA 4MGYE 3AL6A 3QCWA 3LF7A 5F5CA 1KQRA 2DFBA 3C7GA 2DCZA 2W87A 4Y22B 4B7EA 5DZEA 4BLIA 1UZZA 2CGNA 2CWMA 4CA9A 3W59A 1NA1B 4MHRA 3U10A 3UJOA 2RJ2A 2XWJB 1VMHA 4Q1RA 3UGGA 1RVF2 4DPNA 1AR61 1GNZA 2WNVA 1URXA 1UOBA 2D7FA 2P3JA 1F31A 1QEXA 3B94A 4FPHA 3O1RA 5C70A 4Q4Y1 1WBFA 1MQTA 4QPGB 5GJ6A 3C7EA 4KBZA 4E4DX 4NUBA 1AXYA 4XAEA 1DG6A 3WUDA 2WDBA 1SFNA 5IK5A 1OD3A 1GFF2 4AL9A 2Y0OA 1RUI1 4UF0B 4QPIB 5E1RA 1NXD1 4AQTA 2RR12 1GP5A 1WUVA 5I93A 2AENA 3V0BA 3IDEA 4UW6A 3ZFEB 3SHRA 3UK9A 1F8VA 3LEKA 4PLNA 3PMEA 2VQAA 4PBOA 1DQ2A 1POV0 3JU9A 3BCWA 5BY5A 1PM7A 3JCIA 4KWLA 4QX3A 3I3QA 1LNSA 4WM7C 1KDMA 4MUVA 4D6SA 1WW4A 1HRV1 2BUKA 5FZIA 3S7IA 1EV12 1JHJA 1TVGA 1XRUA 3LSEA 3M3CA 5EZWA 4AG4A 3PUSA 3M3OA 3T2QA 4UWDA 2QBXA 3U11A 3I59A 3C7OA 2JE8A 4OHVA 5J96B 1RUJ1 4ZPIA 1AYN1 1RUF2 1UIJA 1ZBA3 3LWCA 2W52A 1TME1 2VCAA 4AF9A 4QQOA 1QDOA 5E6HA 1SDWA 1X8EA 2V5DA 2YHJA 2RG4A 4AOCA 2VTFA 3A0KA 1DLCA 1YWKA 3USUA 1NY71 3M4FA 2ET7A 1RUE1 2WL1A 2FDGA 3D6EA 1VMJA 1V00A 3K4DA 1WWYA 3CMGA 1P8JA 3H8XA 4I30A 3RWNA 2Y6LA 4BK4A 1TNRA 2XONA 4C0HA 3GBGA 3GJAA 1RVF1 3WNKA 5FYYA 4XUQA 3OCPA 2BERA 2JJ6A 2ADDA 4COUA 5FO8B 3NO8A 4BQYA 1I1EA 5HXMA 1UF2C 2MEV3 2HKXA 4M01A 3WINE 1BVP1 5DAQA 3AX4A 5FK8A 2HWF2 3VD9A 5KXDA 2XJRA 5JOYA 2IXLA 4IEVA 2D6PA 2XDVA 1WLCA 3CEWA 3M3EA 1ULPA 3J7MA 4O61A 1OD5A 1G86A 4IE4A 1J59A 3NSTA 2WABA 1V6KA 3ENRA 3NJXA 5A3NA 3N7LA 3L2HA 4N90A 1ZBE1 4UXAA 2BGPA 2RMU2 4FSJA 4B4PA 3ZN5A 4CRQA 2K46A 2ZCWA 4ITCA 5A80A 3WVJA 4TTGA 4XF3A 1GWKA 1HJGA 5FZ8A 1ZRIA 2GMEA 4IEOA 2VMHA 3G7DA 4FPGA 5FZOB 2UWBA 3ZO0B 2NMNA 2PLV2 1JS9A 1AR72 3IDAA 1XYPA 1OQDA 1HXS1 5G04L 2UWCA 3V56A 5BNPC 5JAXA 5FXVA 3NRUA 2NQYA 1XPWA 3NV1A 1J58A 2E32A 2WZPP 3ZXAC 1JYXA 1GQGA 1BMV2 2VXJA 4FTEA 2VR4A 3KD4A 4LO7A 3ME2A 2ZA9A 2CY6A 3IN9A 2JDKA 3OSDA 3SC7X 2PMWB 3ACGA 2E7QA 1CR7A 1J3PA 1HRI2 1RXFA 3DPRB 4K40A 4P9JA 4QKDA 5D8AA 5IVEA 2XL9A 2ZGKA 4RQPB 1COV3 2JKXA 3PDQA 4OI1A 3GCWA 2C1FA 4XQDA 5IT6A 1B09A 3I2GA 1ZYBA 2HYXA 2ZKLA 4CUBA 4GQ7A 3LCPA 2RR13 2Q1FA 2D97A 4LA3A 4LBQB 1R1ZA 1HQNA 1IS3A 3GZTB 4Q0PA 3WDYA 4XACA 3DF0A 1DYOA 3RMXA 3U07A 3ST7A 2A6ZA 2R072 3FMGA 3J8F2 3LOIA 4NIIA 3JZVA 3RFRA 4COVA 3MHZA 1H1AA 3IZOA 1O7FA 3TOJA 2AYHA 3THPA 3KV6A 5FP9A 1NLRA 1Y43B 1UOGA 3JQWA 1MACA 4OMCA 3WV6A 4YW2A 5LWBA 1AF9A 4JTNA 4QGNA 4D7SA 4FPJA 1LOBA 2ORZA 4GULA 3DPRC 4R9CA 3VD3A 3NV4A 5EWSA 2VMEA 3WCRA 5LCWL 1ZBE2 1CN1A 2VQ0A 4RGKA 5A33B 4P00B 3VBSA 1B35C 1G8WA 2QFEA 3RYKA 2Y60A 4RGGA 3TN91 4URTA 4XETA 4UFJA 5FP8A 3JXSA 2HWB1 4EWAA 4JKKA 1GQHA 1GOHA 4L9BA 2DCYA 3P3PA 2HYKA 1L7LA 5JOWA 1BQPA 3GM8A 1LHOA 4XJ9A 2WNUC 3FUQA 4AK3A 2NN8A 3RWKX 4XBNA 2KM2A 2BGOA 4PT6A 1JW6A 1HRV3 3R6SA 4AHXA 2ZBJA 1XQNA 2Q1ZB 5SV5A 4BOWA 2WAAA 5EYYA 1HRI1 3LAGA 3LDRA 3SLIA 3U78A 5KWRA 2P5BA 4EV0A 4LE4A 4XUTA 3ETPA 5FZKA 5GKAC 3UYJA 4AI1A 2WKKA 4HK9A 1QDCA 3KV9A 5DAPA 4N53C 3BIEA 1PK6B 1S0BA 3BVCA 4AAPA 2E26A 4XUNA 4XF0A 1OHFA 1W0OA 1POV3 1QQP2 3A7QA 2NM1A 3ES1A 3L9JT 2R071 4N9IA 2XVKA 2E7TA 4XVHA 4ZKTB 1RMU2 2BP6A 5J09A 2UYAA 3C2UA 1OSGA 3HOBA 2ZMLA 1PO13 2DBIA 5HV4A 4PHZA 1H8TB 2VQTA 3MW3A 1GLHA 5FPAA 2H6CA 4CP9A 2FDKA 3KVBA 1T2XA 4IETA 3H9AA 1W8UA 1YQ2A 1ZZ6A 2BFUL 4MGZE 4QB2A 3MV01 4CCLA 2RE9A 2JENA 4HZFA 1WW6A 2ZHMA 4QX8A 3UNPA 2YDEA 4DY5A 4YFWA 4QQHA 1GNHA 4GALA 4BE3A 5C3PA 1BK0A 1Q56A 3SKVA 2WWJA 3SEEA 3UKVA 4YW7A 1E5HA 4RFRB 4TN7A 5H9RA 1HV1A 4HT1T 3M3QA 2ZOEB 5FZBA 3VD7A 2PQQA 1VBC3 3ZYPA 2VVFA 1C57A 1H2LA 2R30A 4XIOA 4A41A 3WUCA 4AQ2A 1HKDA 1W39A 2CV6A 2CSGA 4COYA 1D4M2 1BK1A 1F5FA 4QB1A 4LR4A 1PGL2 1S0FA 2EAAA 2RDRA 3BOPA 3OBZA 3SH3A 1UQXA 1F4HA 1W90A 2RS13 2XHKA 4I09A 1UO9A 1Z7S2 4BMBA 3POEA 1AHSA 3RSJA 1X82A 1YQCA 2RM23 4IGQA 1Z0HA 2LTNA 1FOD1 2Y6JA 4IESA 4M3CF 3B69A 2VTXJ 2QQJA 4F8AA 2VOVA 3W9AA 4AW7A 5CNAA 5J36A 3ILRA 2Y6GA 2D6KA 1AZDA 1X36A 4EROA 2TEPA 3AP5A 3VKOA 2JEMA 2VNVA 5FPXA 4IV3C 3CKHA 1BEV1 1FMD3 1LHWA 4WM7B 4B4RA 1VBA3 5JSRA 3RZHA 5B2GB 5DMYA 2UU8A 2RR11 2VUJA 4FPKA 2WYFA 4Q8KA 5KXBA 1RUI3 5KC5A 3O1TA 4UFHA 3AFGA 1OOPB 1XBFA 1ZVFA 3VZLA 3H50A 1J1LA 4QKFA 4AEJA 4JQTA 4FAHA 3CIHA 1SPPA 4DUWA 1Z78A 4YWAA 2GN3A 4XFIA 2WNEA 1OBNA 2WNUB 2DVAA 2JWPA 3HT1A 4ASMB 1H9WA 1RUNA 1VB2A 2R043 2VGDA 1DIWA 1QGLA 1HN1A 3CJXA 4WM7A 4XXPA 3WX5A 1QXPA 1PO22 2L9LA 2ZEWA 4DEQA 1W6OB 4E2GA 3OF1A 2ZTNA 4DIQA 4LMFA 3AVSA 1BBT3 4KQ7A 1N1VA 1WMFA 3NJVA 1CAUB 4UI9L 5IUQA 1ZNPA 3SH4A 1G9BA 2XG3A 1HB4A 3BPSA 1V0AA 1K5MA 2LALA 4DRVA 2FQPA 4UFLA 2VJXA 5C8CB 4HK8A 1NA1C 1SBEA 1NY72 2ZX1A 3PVEA 1VBD3 2VZPA 4I3PA 4FXGB 4LOSA 2Y6HA 3GCXA 2XL7A 4LLOA 3I3MA 3T4VA 2BNOA 2AUYA 2J1UA 3S7EA 4EYUA 4QX0A 3TEZA 2D6NA 5HPOA 4YGDA 4NHYA 1ND2A 4K20A 1EAH3 4I0WB 5CFCC 2WQ8A 3FFZA 1IG3A 1IG0A 3OB8A 1OQ1A 2I07B 4X6QB 5EIYB 4A6OA 4NJ4A 4A6SA 2EXHA 1DYPA 2WSUA 5FQ0B 3CJIA 1ZZBA 2NMOA 2V09A 2QQVA 4Y20B 4Q4X3 5IYYA 5LRRA 3K48A 1GZTA 5FZ6A 3WXPA 3TEYA 5KC6A 2ZX4A 3SEPA 4WM8B 4LA2A 4IEQA 1CAWA 1VMFA 3POWA 5FMOS 1W6OA 4GH4A 4CP9B 3ZIWA 5APAA 3LKJA 4OHYA 4JV4A 1OURA 2NPIA 4ONUA 5FP3A 2RS53 2Z79A 1W6MA 1OPMA 3T4HB 1CX4A 3PURA 1UYXA 1LODA 4XCAA 1JZ7A 4DUVA 4RHV3 1GANA 1QMJA 4CDXA 1ULEA 5IVFA 3AZWA 1AYM1 1W99A 1BMV1 5E89A 5BNPA 1UXXX 3FHAA 2BBVA 5D8AB 2EA7A 4AVTA 1W9WA 4KBBA 1AL23 3VBOB 3ZM8A 4NPLA 3OEBA 1NX9A 2B39A 5GLWA 3FN9A 3KT7A 4S2DA 2FCTA 5C8WA 5CG9A 2RHPA 1UY1A 2WZEA 1ZZ8A 2J7MA 2VMCA 1I5PA 1CGPA 1FNYA 2VMFA 1DHKB 1FT9A 3CJIB 3DKWA 3AM2A 4YZ1A 5FQ0A 3W20A 1R1A3 1C8M1 3N9QA 1OUXA 2VQUA 3AKPA 4L97A 4XILA 3LGRA 5E8AA 4FO9A 5FWEA 5K7PA 3O0WA 1UW8A 5A1FA 1TG7A 2QQOA 4LHNA 5A32B 2QZ2A 4L92A 3LE0A 3VBRA 1AJOA 4HG6B 3KV5A 1W3XA 1WCUA 2OPWA 2WC2A 4IW3A 4LIUA 1UZYA 4HVOA 1RIRA 4KWJA 2XJTA 5C4WC 4K7JA 5CKNA 2DFCA 2BNNA 4IV1C 4P9LA 4C0BA 4AEDB 1OFSA 1YFYA 2W1SA 2JECA 3TNQA 4Y4YA 1ZREA 2KR2A 1C28A 4BJ0A 1E5SA 1N3QA 1WD3A 1WGPA 3AMMA 2QQLA 3GGLA 3MIDA 1L7RA 4S2FA 3VKFC 1W8FA 1XNTA 4K3UA 4CDUC 5IVVA 1OKOA 3VKMA 4S2HA 4FAGA 3VBUC 4D3WA 1OFNA 1ULCA 1H8TA 1RJ7A 3AP7A 2VG9A 5FZLA 4BK5A 3RZMA 4AI9A 3WP5A 5GALA 2RS32 2I2SA 5JZGC 2B9UA 3FJSA 5LW9A 4COWA 5C7GA 4DUXA 4WV8A 2X29A 4QXHA 5L7OB 4Y1ZA 5AC93 2JICA 4GJYA 3MLJA 3EJKA 4XTMA 2EXKA 3PIGA 3QBQA 3R4SA 4MH0E 5FZHA 4A44A 1SACA 5ACA1 2HWE1 2JDMA 3SISA 1H4HA 2JDNA 2YY1A 4XURA 2ID4A 3B00A 4K8RB 5FYHA 1UMHA 2ZMKA 3NAPA 1YIFA 3IDCB 1BJQA 2JG8A 3BODA 1O3SA 4QDRA 3JBG3 1TE1B 2EAKA 4NHLA 4AFAA 1MEC3 1SFPA 3LOBA 4CXYA 1UN1A 2BWAA 2XQXA 3V0BB 3KLSA 4CP0A 1PM4A 3GZEA 3OGJA 1LGCA 1J83A 2VZOA 3ZKUA 4NWVA 1KD7A 1KFUL 2XLAA 3HNBM 1HN0A 4YVSA 4ZS2A 4D0QA 2WRAA 4NIGA 1W8ZA 4E8CA 1UOJA 5IK8A 3S6PA 4FPYA 2XQRA 4CE8A 1JZ2A 1LULA 2IFRA 4QGMA 5BV6A 4FOVA 4Q4V1 2LS6A 3AZVA 4ZU7A 1EPWA 4Y5Z0 2ZX3A 4U2AA 1QJEA 4MSVA 3THCA 1KITA 2W39A 3PIJA 3VZKA 4N9HA 4R4XA 3KF3A 4V2VA 3ZXEA 4AQSA 1ZX5A 2VMIA 3VL8A 5JPNB 4WVZA 1RUD2 3T2PA 4MG2A 4X8NA 4CU7A 4Q4W2 4MGTA 4TWTA 4MXWA 4NRMA 2RS31 4IE0A 4OI4A 5FCCA 1UU6A 1W9FA 2XXZA 1RUG1 3H3LA 2FZ2A 1GOFA 4PBPA 2AZ5A 3AL5A 3DXTA 1FNZA 4XC9A 3RYPA 1LOAA 2W08A 5HBAA 3FBMA 4BYYA 1NCQB 1JOBA 3IWZA 4DXTA 2W47A 2D6OX 2P3KA 3DXUA 1XJAA 3VDDA 5A7WB 4ARXA 3U14A 1PGW2 4YZ3A 4XW3A 5J3UA 2Q5TA 4DO0A 1VRH2 3BUCA 5FMCA 1W6QB 2QQNA 4RQPA 3TNPB 4A7ZA 3INAA 1GWMA 5DAVA 3T30A 4XUOA 5JSPA 1WW5A 1PZ7A 2DUQA 2E31A 4OFGA 1MVQA 2PAEA 4Z8BA 5I0RA 4JTOA 4AEDC 2O14A 5LY1A 1GBGA 4DMIA 1I9RA 1UL9A 1ZZ9A 3Q8EA 4MGQA 3ZSJA 1LESA 2VMGA 1GZCA 1IHMA 3NWKA 3RS6A 5DG1A 1PZ8A 1DQ5A 4DS0A 3EYPA 3D4KA 1CX1A 2A1XA 1ZRDA 3PL0A 1RMU3 2Q1MA 4GWIA 2VZ1A 1LHVA 4ZY9A 4CDWC 1D2QA 3DN7A 3OGSA 4L0PA 1AX1A 2O1QA 4QX7A 3VKLA 4YG3A 1TMF3 4UF0A 5T52A 5CEHA 1G9CA 4XTPA 2ZGPA 3ELNA 2AREA 5L9BA 1E5IA 5BNOA 2FD8A 1PO21 1GSLA 2ZACA 1QJY3 4QXKA 1BHGA 4U36A 1G6NA 2JDPA 2VBDA 1VBB2 4FCAA 1FPN3 4NMIA 1RL3A 4QHOA 3SQOA 3LPGA 1AYN3 1ZBA1 3BN6A 3RZGA 3ON7A 3IPVA 2E7AA 4I0BA 1RUD1 2WNVB 4AI3A 4D7YA 2C26A 2XMLA 5CISA 4YNIA 4HSJA 3I3DA 2ZGSA 1E5RA 2WR9A 1RUG2 4IE7A 4Q2FA 2PHWA 5ABJB 3IDBB 3KB5A 1S0GA 3ZFFC 1W6QA 2ZZQA 4S2GA 3LPFA 2PN5A 1YJLA 4IEPA 1VAVA 5G05L 4CDQC 4XHBA 4EZ4A 4AVCA 2K0GA 2OUJA 4HKOA 1ND2C 5F1RA 2A7AA 4JGYA 3EB7A 2XJUA 1PX3A 3F95A 3GF6A 1VRH1 3OD4A 2QCSB 4AQ6A 4FPLA 3ZYFA 3BTAA 4L99A 2CL2A 5TSWA 3H0OA 3IB3A 5J7MA 1SLCA 3POFA 2WYSA 5FWJA 2OW4A 1KJLA 1A6CA 2CU5A 2GC3A 2OS2A 1Q8SA 2Y64A 3ABZA 1EP0A 1VPHA 4GA9A 4QPGC 1POV1 1KXGA 2ARXA 5FZDA 5FPVA 1JMUB 5LASA 5I0DA 4K1ZA 3MEPA 2WA4A 3DPRA 4HSLA 4B3NA 3HQUA 4IEXA 2JD4A 4Y5TA 4K6BA 1VBE3 2ZGTA 4IE5A 4JZRA 4JQRA 1S2KA 5FUNA 2RS11 2O8OA 3LA7A 4XOGA 4AHYA 1AR93 5F2SA 3T08A 5F2WA 3OUHA 1ND3A 1W8TA 1COV1 1HXS3 3KHBA 1ND2B 4Y24A 5A32A 3QLQA 5F3CA 5JZGB 4HETA 3EHKA 5GZEA 3TB0A 5JSOA 3VHRA 2VZVA 4I02A 4MVTA 5L7OC 3AKRA 3FWEA 1XB9A 3ZXJA 2YBSA 1AR83 4ZU4A 2E51A 3QH7A 4FP2A 3PUHA 4LO5B 5FY0A 3U1XA 2IFWA 3LEMA 1KRIA 2ZHNA 5C8CA 2BVBA 3O1MA 2PHRA 5CYYA 4MYEA
chains in the Genus database with same CATH topology
1PMIA 5JMCA 1VIWB 1F2NA 1XNDA 1V6OA 1AL0G 1LEMA 2DTYA 2HWC1 1HIXA 4WVWA 3I7DA 1Q43A 2WS93 1W6PB 3HN1A 2R041 2ATFA 4CTEA 4FXKB 2XB6C 1QJY2 3ZX7A 2RM21 4XF1A 4DINB 2CGOA 1C1LA 2WLQA 3WNXA 3E5UA 4D94A 1G7YA 1YYNA 3HQXA 4AGGA 3PJYA 1R092 1A8DA 2ZJCA 2JE9A 3VBUB 2WFF3 4N43A 4NOTA 5C4WA 1RUH1 4XEZA 1NLSA 3WW1A 4GH4B 3ZSLA 5A3MA 3WDUA 2CGPA 3KT1A 4OI0A 4QQ2A 2MEV2 5BNNB 4LBLA 1DBNA 4GKYA 3WW4A 4FPOB 3WDXA 4AHWA 3H7YA 3I59B 5FOJB 1R082 2HWB3 4YZ4A 2EXIA 3AMQA 4PIXA 3GALA 2Q0AA 4R9DA 1NE4A 5BNNA 2D3RA 4BIFA 2FMDA 4YFZA 1BKZA 4OZXA 4NO4A 3AMPA 3ZFEA 5ACA2 4ISRA 2XJVA 5JPMB 1UPIA 3FHIB 2DVFA 1RUF3 4RL7A 2RS52 1MZEA 2GNMA 4JGZA 4YRDA 1AVBA 1RUD3 2FMYA 1G9FA 1I3HA 4BM8A 4GIQA 1K5MB 5LEJA 1YFXA 1YNAA 1DF0A 1UPSA 3LSDA 1V9U3 5DUXA 1MZ5A 3CU7A 5EV7A 1CAXB 1R091 4XFAA 4LUKA 4LTAA 2ZX0A 2W0XA 1RUH2 1LR5A 2X5IB 1YIPA 1C3HA 4UW4A 4YVWB 2P2KA 3BOWA 2VXRA 1LCLA 4JDOA 2GH8A 5F6LB 4LHLA 1MS1A 4BLJA 2ZS6B 1NCQC 1CAXA 4QHBA 4XBQA 1PK6A 1MS5A 3AYCA 3OPZA 3KS7A 3MI8A 4HMZA 4FP3A 5K9YA 4AE2A 5T54A 2R061 1HQWA 2HEYF 1AYM3 5EXOA 4RHV2 1BEV3 1FMD1 2XLGA 1SLTA 5K8SA 1AXKA 1MQTC 1Q8QA 2VW1A 4TSVA 2AGSA 3MFAA 4FPEA 3E5QA 1PGW1 2GSYA 2GU9A 4CEWC 3ZYJB 1ENSA 1RUH3 1OA4A 4Q8LA 3RYRA 5DXDA 1CONA 1UKRA 1ZM1A 2HWD3 3AKTA 4X6RB 1ND3B 4XF9A 4GMP3 3R0RA 2TUNA 4KWKA 3FUOA 4ATFA 3QACA 3H1MA 3ZMOA 1H2KA 2PHLA 4HPKA 4PIYA 1QJU3 3RNSA 4I01A 4NHKA 4WVMA 2GDFA 3FLTA 2VVEA 3JB8A 3JD73 4INDA 1GICA 4XQWA 4IEYA 2JXAA 2WNUA 1R1A2 3SH5A 1C5HA 1EPZA 3TN93 1CAVA 1XYNA 3J4UH 4J1XA 4Q1PA 1DGWX 1LTEA 3SCHA 4TLFA 2Q30A 3NV2A 3ILFA 4I3GA 1S0JA 4OVEA 4LLFA 1OA3A 1RTVA 5JVVA 3T2TA 4PDWC 1Q8VA 1QOSA 2E9QA 3RZZA 4XIKA 4EN0A 4WZCA 3AP4A 1GZWB 2D3SA 1DZQA 5FO9B 3FX3A 4B8EA 3ZMNA 3B5LB 4RR3B 5CFDA 3VBHC 3GHMA 5JI9A 5A3LA 1BVVA 2ZHKA 4NR1A 4N7IA 4Q4X1 3MZHA 2B45X 2QE3A 3OJBA 2DCTA 3VKNA 4SBVA 2OVUA 1VBA2 4YM0A 4HVQA 1FATA 5EJ3A 1C4RA 1MEC1 3D0JA 1PVC3 1I5ZA 2H0VA 4HN1A 3KCCA 1PO11 2PHUA 2YXSA 3KZ4C 3DL3A 2IXKA 2R32A 1LEDA 1O4YA 3KT4A 1CIWA 4MXWB 1PVC1 4J6GA 1IPJA 2WJSA 2ZKNA 4SLIA 4XF4A 1GKBA 1RINA 2DU0A 1HX6A 2WT0A 4RR3C 1PGSA 3M7AA 2QDRA 1UMZA 4M3CB 4Z07A 3V64A 3WP6A 1CPMA 2HEVF 1EAH2 3FE5A 1SLIA 2XJQA 5T5JA 3VDDB 1QY4A 5GLZA 5JOXA 4FPFA 2PAKA 2WT2A 1W2UA 1VBC1 3HBZA 4Q0SA 3WT3A 4MLOA 5JR7B 3VZNA 5C8CC 1J3QA 1D2SA 2XBO3 4TZDA 3GHNA 3A0NA 5C6CA 3NJZA 1FI2A 1B35B 4MXVA 3ZPYA 1ULDA 1BBT2 3B93A 4D7TA 1MR5A 1QJY1 1OLRA 3ZXKA 4B4QA 4OULA 1V9U2 3ALQA 2A6YA 4PIZA 1B35A 2A75A 2VY0A 1YLLA 4YVSC 3NL1A 1HDKA 2HWD2 2WQ4A 4M0NA 2XKOA 4P9XA 1CJDA 1CVNA 1FYUA 2GALA 1J1TA 3QOPA 2X5IC 3HR9A 4RS5A 4YGEA 3KCYA 4GKXA 4W6WA 1PNFA 2VPVA 3ZYIB 2WS92 5FPZA 1NCRC 2Z5WA 4G3YC 4AVSA 2A3XA 1RJ8A 3JB4C 2JG8B 4YZ5A 2OIIA 1NA1A 1AR71 3MPBA 3ZSKA 2ZAHA 3FFQA 2BYVE 4IXLA 2VW2A 2UY8A 4BZ4A 1AR73 1OKQA 1H4GA 2BGCA 1UCXA 2PYTA 1X8MA 1JUHA 4AFCA 1C5IA 1VBE1 1MS9A 1YCIA 5DDJ3 5KHIA 4C1WA 2ZHLA 4Q27A 3USUB 1PVXA 3U0ZA 4PCRA 4YW5A 4M0HA 5F6KA 1R093 1N3PA 2O8QA 2TBVA 1S0CA 2F6BA 3BALA 1ZRCA 1ALYA 1BXHA 1LKNA 4NPRA 2PHXA 3TWIA 4AVVA 1CQ9A 3S0MA 4AVAA 1V9U1 1DGRN 3AXEA 3N35A 3RI8A 3ZFGA 2RJLA 4XQ4A 2FZ1A 5LK5A 4Y1YA 2EF6A 2VUAA 4CDWA 4DB5A 2ZAAA 1TQ5A 3HMYA 1LHUA 4AVBA 2JG9C 3VBRB 2I74A 1AR62 2WT1A 1WLWA 4A3XA 1DYKA 2FHRA 3HIFA 5BNPB 3AZYA 2R063 4XFCA 4YGCA 1VAMA 2QJVA 1UIKA 1QKQA 4Q26A 5H9QA 3OTFA 2EVXA 1OQEA 5EYXA 1PK6C 1AUYA 4YARA 5AFBA 4UW3A 5I8TA 1YI7A 5KHJA 1RUG3 2R062 2PFWA 1DZRA 1LGBA 5CFDB 1ZZ7A 3VHPA 5DZFA 1DQ6A 4XMIA 4BCUA 3CO2A 2ES3A 4YYOA 1NQDA 3I4IA 1Y3TA 2XKPA 2NZ9A 2OZ6A 4GMP0 3N3HA 1VBE2 5KHKA 1TNFA 2IXIA 4DY3A 1REFA 1QJX2 4CDXB 2HEWF 3ZSMA 3WY6A 5CADA 3MIGA 3ZN6A 1QJU1 2ET1A 3CF6E 1QF3A 2WIIB 4Q4Y2 2CAUA 1WMDA 3HAGA 2D93A 3OY8A 5GM0A 2XH6A 4FBFA 3N7MA 4A7KA 4OHWA 4Z1VA 1ONAA 1D4VB 1RGSA 5FOBB 1RUI2 1RMU1 2UY9A 1KS4A 1ENRA 4PF5A 1BZWA 2DTWA 4KGGA 1Y7BA 2JDZA 1MS4A 2VH9A 1LHNA 3MDPA 1IOAA 4OUSA 3MW4A 3J8F3 4FVVA 4Z82A 1AL22 4TYSA 1LU2A 4R4ZA 3GYDA 5LRSA 1LOFA 1PIV1 2O0OA 1QU0A 2QVSB 4QT6A 4DRRA 3I54A 2RJKA 2XVGA 1AYN2 5L73A 4QPIA 4FQZA 5FMOL 4AGVA 2BPA2 4PDWA 1LU1A 1O4TA 1RUE2 3HD8B 4RQPC 3NKGA 1JH5A 1PGL1 1QOTA 2E6VA 3EXUA 4P5HA 1DLLA 1QHDA 3WW2A 3AKQA 1DQ1A 1JOJA 4Q4X2 4LBQD 4YG0A 2FBEA 3IMNA 5KBFA 4LT5A 4LUMA 3SNMA 1EYBA 1L3JA 1AR91 1Y9QA 2VVDA 2WZR3 1UU5A 3FLPA 1F9KA 3AYDA 4PQ9A 4YVWA 1XNCA 5CBLA 3BPZA 1PO12 3J9SA 4K8FA 5L36A 4RGAA 4Q4Y3 4CDXC 1MVEA 3C3VA 1C8NA 1VBD2 3AP6A 4OI2A 3VBFB 1N47A 2BVVA 5KXCA 1JTZX 1SCRA 5FDBA 5K0UC 1OPOA 3WLUA 2DYCA 1CAWB 1V6NA 5EFUA 1AL21 1LB2A 3TYJA 4WBBA 2C0ZA 3WD5A 2ZGRA 3VLBB 5JI7A 5HXVA 4HANA 2G4IA 4H3WA 4N53A 1WLTA 1N1TA 3B3QE 3E6CC 2NP0A 5T5PA 3WR0A 1D0GA 4CP2A 3D8CA 4ATEA 2RS33 4YGBA 3O0VA 4GWNA 2R1BA 5C4WB 3RDIA 2XUMA 1IQAA 4NWWA 5JCTA 2E63A 1SQ4A 1FAYA 4EN6B 5H9PA 3MPPG 1O4ZA 2JG9B 2JX9A 3VBRC 1BBT1 5JWPA 2PHFA 2UWAA 3CNAA 3N7JA 2D40A 2OPKA 1FPN1 3L2YA 3H8UA 4V1PA 2GMPA 2D5HA 3GZAA 2EALA 4HN0A 3AJZA 4IL7A 5ABJA 2CYFA 1AR92 1GR3A 1AX0A 3UJQA 2CTVA 5DUUA 2HWD1 5C9AB 2A3WA 3H3ZA 4ASLA 4B7KA 4KU8A 4W6XA 5D8AC 5T3NA 5T55A 1H8TC 5BNOC 3O7OA 4N43B 3VBOC 3WOGA 5ACA3 2VNOA 4JCKA 2QZ3A 4YW1A 5JLVA 5I8SA 1U5IA 3MYXA 1NE6A 1QH6A 4X8PA 4CYDA 2ZGQA 1CESA 5AC92 1DDLA 3TN92 4W6YA 5FRAA 4JVAA 1H2MA 1SEFA 1EV11 3V65A 4F7ZA 4F3JA 2D43A 2D44A 1XXNA 3ECQA 4P9GA 3WW3A 3OBRA 3WHUA 1RUF1 2ARBA 2A6VA 2YV8A 3U4XA 2K2SA 4IV3A 2VULA 3EO6A 2DURA 1WCKA 2OUHA 3IM0A 2YZ4A 2GNTA 3B01A 3ETQA 4QM9A 1FPN2 3B7MA 1VBB3 4EN8B 4LO6B 4LBQA 4CEWB 1FOD2 4CDUB 4YSFA 2P34A 3USSA 4QD2A 3PJQA 2YYOA 2ZX2A 3ZFFB 4AI2A 1F5JA 2HWF1 4Q4V3 2PELA 4K1YA 3VL9A 3FLRA 4IQPA 1BEV2 4NVPA 1JYIA 1ENQA 1U5YA 1KS5A 1UU4A 5T50A 2OYZA 3FZ3A 4H7MA 1LOGA 2WNVC 4QMAA 3ZXFA 1HQLA 4Y1XA 4C90A 4MX3A 1YUDA 3ZIXA 5FFOC 1VP6A 2PLV1 3R4DB 4K9SA 1JUIA 2NYYA 4O9GA 2VOXA 3VDDC 3VGIA 1HXS2 1LENA 2ZZJA 4HKLA 4ES8A 4P9YA 5BYNA 1AR81 2G9FA 3NAPC 1S1AA 1D4M1 1UD1A 1ULGA 2PA7A 4R9AA 3V0AB 1O3TA 2OA2A 2SBAA 4CDWB 2WSVA 5JIUA 1Z7S1 4Q4W3 3CL1A 4P14A 1LECA 4P9IA 1QJX1 3P3NA 2CAVA 1TMF1 3MICA 3ATGA 1HLCA 1UKGA 3AFKA 3R05A 1QJU2 3V0AA 4F83A 2V5YA 3A4UA 3VZMA 1QOOA 1WCSA 1Q5OA 2X8KA 4PLOA 5CAZA 4XJAA 4AHZA 5E88A 3J8F1 5CB7A 3ACLA 2MPFA 1XE8A 3VHOA 1QQP3 2BW8A 3I8TA 4AEKA 2PHDA 3PNAA 3MIBA 4I2OA 2DWRA 2XLFA 5I8YA 1UAIA 4PJYA 5C9AA 5BNQA 3MLKA 1W0PA 3OD0A 4OHZA 1S0EA 2B46X 3B9IA 3RG0A 3VZOA 1PIV2 4UBHA 4WZFA 2JG8C 5JOZA 1SLLA 3ZFFA 1J3RA 1R083 1XU2A 2HWB2 2AH2A 4CDQA 2YPJA 3RRDA 4QPIC 4RA0A 4WVVA 2ZABA 5DG2A 4C91A 2XWBB 1QNWA 3AYEA 2EXJA 2WINB 4DFSA 3PVOA 2AR6A 1ZBE3 2YROA 3ZXDA 4HVRA 4KG0A 4FTSA 4XFGA 2DV9A 2WZR2 4CEYC 3QD6A 1V70A 2YMZA 1C8M2 1ND3C 1LOEA 3IIAA 4YLZA 5CVRA 3VBFA 3N4MA 4LHKA 2YGMA 3IBMA 4ES9A 3LZZA 1VLNA 4RS5C 4XHXA 4HLTA 5FLIA 1U12A 4YVSB 2D5FA 1CPNA 4MZUA 5L7OA 1QNYA 2D98A 3KMHA 4BQ1A 3MF6A 2ERFA 1X7NA 3GBFA 3T1MA 1C8M3 2G9GA 1MZFA 5IK7A 1QXJA 4CDQB 1DGWA 3J26N 3PHMA 3SCGA 4YW3A 2W68A 3MGUA 1AYM2 4M3CA 3WDTA 4WM8A 3PLQA 3WG2A 1GYKA 1IS6A 2ENRA 5CFDC 2HWC3 4AEDA 4FQ4A 1H30A 1W6NA 2WQZC 1S0IA 4JAAA 1N1YA 4HFSA 5AVPA 4BA6A 1IKPA 1YHFA 1A8MA 3POYA 1U0AA 3VBSC 1U5XA 1IS4A 1U5ZA 4E4SA 4KGQA 2HWE2 4XJ8A 2PTMA 2XJSA 3VN4A 2IXJA 3AXDA 4JRAA 2WFF1 1N3OA 1WMEA 4NN0A 3JUUA 1PIV3 1YFUA 4QU2A 1DGLA 3WQ7A 2H0BA 2A3YA 5JIAA 1QJX3 1AX2A 2UURA 4XFFA 4KNCA 1LOCA 4BH9A 1EY2A 4RR3A 3SMHA 2KXLA 2BQPA 4EWDA 1RB8G 1APNA 3AK0A 5KHHA 4AFBA 2Z2SB 2SLIA 4H14A 1WBLA 3OY8B 5FREA 5AC91 1PZ9A 2RS12 3WP4A 1S2BA 3OBTA 4RFT0 3EBRA 5I91A 1NYWA 3PVBB 1COV2 2ETEA 4BIOA 5D1IA 3RJRA 2XVLA 1CJPA 2DUOA 5FAXA 2YGLA 1VR3A 4XFBA 4FT8A 2BTVC 4KG8A 4WVMB 2GMMA 3VUOA 2DF7A 5GZDA 1VJ2A 2LM3A 4AI0A 1V6LA 4ISQA 3DGTA 1O91A 4FOQA 4OHXA 1FV3A 3WCSA 1V6MA 1N1SA 2RMU3 2R042 1IS5A 1NZCA 2WFF2 4GXLA 3UKNA 3MLLA 4B29A 4EN7B 5F9TA 4META 4YZ2A 1AR63 2A71A 4YG6A 1A3KA