2VZQA

C-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa in complex with digalacturonic acid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 23
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzqA00
1UY0A 2W92A 2QBXA 4DUXA 3K4AA 3C7HA 2WO2A 2ZEWA 5I0DA 2YFZA 3SKJE 3A22A 2WAOA 5LA0A 1OF3A 3PUHA 2QQJA 4W50A 4AG4A 2C9KA 5C7GA 5HPOA 5LCWL 4P02B 3I3DA 4QB1A 2VM9A 2CDPA 4BDVB 3W5MA 2YB7A 4CUBA 4W4ZA 3FN9A 2W46A 4OMCA 2VZQA 1JI6A 2QQOA 1JYXA 3F2ZA 3K75B 4CU6A 1GUIA 4KMQA 3SEEA 4ET7A 2XHNA 5JXJA 4XUTA 2VZRA 1MPXA 3LQCA 1JYNA 1R64A 2J1EA 2WDBA 3CDZB 3P1IA 4QB2A 2Y6GA 1BHGA 2B9VA 3A23A 3BN6A 5HXMA 3VDBA 2WABA 1JZ2A 2W9XA 1H6YA 4ZY9A 3MUY1 5G05L 2RV9A 4M4RA 2XONA 3T2OA 5DPNA 1UYZA 5DQ0A 1W99A 2WN3A 2VMDA 2RJ2A 4FI9A 3IAPA 5LA2A 2VMFA 1UY1A 2VQUA 1K45A 3IIIA 3C7GA 4BK4A 1IQDC 2VL4A 4DEVA 2J1TA 2X05A 2YFUA 4XZUG 3WNMA 2VZOA 1J84A 1GQPA 4MGSA 1O59A 4JX0A 2V5DA 3I3EA 4PF1A 2WN2A 1LNSA 2VZTA 2W95A 2Z4FA 3LEGA 4DUVA 1OD3A 4ARYA 2J7MA 2VJXA 4XUPA 4A6OA 2ZEZA 1T2XA 1SDDB 4PQQA 4QDRA 1GMMA 3T2PA 2J1RA 2DCKA 3VD3A 3ACGA 2WO1A 2LW8A 5DMYA 4A42A 2VZ1A 3ACHA 3LE0A 4MADA 5IYYA 2VCAA 1F4HA 3A21A 3VDCA 2Y6KA 4LKSA 4XVHA 4OUEA 3VD4A 2VZSA 1PX4A 4GWJA 2J1VA 1JU4A 2WQ8A 2C4XA 2W1SA 2X10A 4GWIA 5EIYB 4MO3M 3I2FA 3HJRA 2C26A 3SKVA 1JZ8A 5JXIA 1JYWA 2EICA 4P08A 2VMEA 3WNLA 3NJXA 2RVAA 2J1SA 1UYXA 4MGQA 4DXRA 2JD9A 3VD7A 4LQRA 4ZXEA 3OBAA 2DCJA 1JYVA 3NRUA 1XC6A 2Y6JA 5IHRA 2VR4A 4BJ0A 4YPJA 5JXGA 2W94A 1PMHX 3T08A 1OH4A 1PX3A 2WO3A 3ABZA 1W9SA 3NJVA 3OGSA 1WKYA 4L0PA 1PMJX 2ZEYA 3D3AA 2V4VA 1O8PA 4A44A 1D7PM 4JKKA 5A1AA 4DXSA 3DYMA 3I2KA 5EJ1B 1JZ6A 3K4DA 2EIDA 3ACIA 3LPFA 2B4KA 4ZZ8A 3CZUA 3OEAA 3MO4A 2W91A 4DUWA 3WF4A 3HNYM 4UI9L 2J1UA 2ORXA 2EIEA 4QB6A 1CZVA 3FL7A 2J1AA 2LS6A 2WUHA 1I5PA 3ECQA 2W1UA 4CVUA 3I2GA 3OB8A 3ETPA 2BERA 1JHJA 1GU3A 3CIHA 3WNPA 3U37A 1CIYA 3WEZA 1DYOA 3W5NA 2YC4A 1F4AA 1K42A 3CQOA 3WQBA 2QQNA 1W9WA 3WF0A 4TTGA 3JXSA 1L7QA 1ULPA 3I3BA 3T0DA 1RYYA 3DYOA 3IDAA 1W8NA 3EB7A 4KI5M 4KWUA 1XNTA 3VD5A 4RYDA 4LHSA 3ACFA 3J7HA 3MV01 2Y6HA 4QAWA 3BGAA 1UZ0A 4TXWA 4A45A 2W47A 1XPWA 1NKGA 5B4XA 2VC9A 2JDAA 2VZ3A 1US2A 3K46A 1W9TA 3T0BA 1JZ7A 2ZEXA 2E31A 3UETA 3WNKA 1CX1A 2Y8KA 2BBAA 3C7FA 5F7UA 3I2JA 2VQTA 2W5FA 3ZM8A 2QQMA 1XNAA 3WF2A 3HPNA 2JE8A 2OKXA 3T09A 4AAXA 2E32A 2ZXQA 3T2QA 3HN3A 3OGVA 4E8CA 4RN5A 4OZOA 2BGPA 2ORZA 3LEIA 4E8DA 2WYSA 4Z2AA 2VCCA 2Y64A 3LPGA 2KD7A 3THDA 3K4ZA 2QQIA 2YC2A 1JU3A 3CMGA 1UMHA 4GZ9A 4MOAA 2WBKA 3P6BA 5IJRA 5B4NA 5C71A 5G04L 1UYYA 1ULOA 2BGOA 2R7EB 4LPLA 5IFTA 4QDQA 3I2HA 1JZ5A 2PQSA 3VDAA 3GM8A 4A4AA 1JZ3A 1TG7A 2W1WA 3MBWA 2EIBA 5EJZB 1CZSA 4ARXA 5J1XA 5IFPA 3WF3A 4W8JA 1OF4A 3HOBA 2W1QA 1NAEA 4OYUA 1J83A 2WAAA 1K12A 4BK5A 4UAPA 4XUQA 3GDBA 1W8OA 2VZVA 1EUTA 1KGYA 2VO5A 2VTFA 2HYXA 3C7EA 3WNOA 2W3JA 3VD9A 3WSOA 1KEXA 1UXZA 4QX1A 3SEPA 3THCA 1GNYA 4HG6B 3MV11 2V72A 1TVGA 3CKHA 4D8MA 5DN2A 1UY4A 3HEIA 2QQLA 3IAQA 3PUIA 1NUKA 1GOFA 2WZEA 3OEBA 1HN1A 3AC0A 3FHQA 1UY2A 4M4PA 2XOMA 1SG3A 3GXUA 5C70A 4CUCA 1OT5A 4JHZA 4P5YA 2J22A 1NX9A 3T0AA 2YG0A 3LEKA 2VOTA 2E33A 1DLCA 3DECA 3NNGA 1DP0A 2JKXA 2XQXA 3I2IA 1YQ2A 4D0QA 2X09A 2BZDA 1UX7A 3CZJA 4QX2A 4CU9A 4DXTA 4IUGA 1GOGA 3HNMA 4QDSA 3WNNA 4UOJA 2VMCA 4P00B 3E1F1 5LA1A 4BXSV 5JMOA 3EYPA 4XURA 1H6XA 4JKLA 1US3A 5JR2A 5CYYA 4A3ZA 4XUNA 1SHWB 3C7OA 4XUOA 3MUZ1 3UNPA 5JUVA 1O8SA 4CUAA 1L7RA 1UWWA 1UMIA 1P8JA 2CDOA 2QQKA 2Y6LA 4OMDA 3FHAA 5FUIA 4QX3A 1JZ4A 2E26A 1UY3A 1WCQA 2VZPA 4A41A 3UESA 3I97A 2VZUA 3C8XA 1GOHA 5CZKA 5JXHA 4QPWA 3GGLA 2HLEA 4CU7A 2ID4A 3NQHA 2W87A 2WZ8A 3IB3A 3WF1A 4JKMA 1CZTA 4DEQA 1W0NA 2L9LA 3OGRA 1EUUA 2VCBA 3A7QA 4PT6A 4CU8A 2DDUA 3DYPA 3K77A 3HNBM 1K3IA 3OG2A 4ZZ5A 4QX0A 1UXXX
chains in the Genus database with same CATH superfamily
1AYN2 4BM8A 4CPBA 1PZ8A 1E5IA 2QBXA 2OPWA 1EV11 1B35A 1YQ5A 5BYNA 4CEWB 5D8AB 2WO2A 5GLWA 3Q8BA 1CESA 2ZEWA 1AYM1 1W0PA 1GZ9A 4YVSC 5I0DA 3E6CC 2YFZA 4OULA 1VAMA 3A22A 3ITQA 4RGAA 1QJU2 1VBE2 1TMF2 4FAGA 2WAOA 2PELA 4A7ZA 3PUHA 5KWRA 1LEDA 1S2BA 3GBGA 4W50A 3RPQA 3AFGA 5LCWL 4P02B 2VM9A 1LHUA 4ONUA 1FMD1 2WT1A 5BY5A 4WV8A 1S0GA 2D98A 2O1QA 3KCXA 4W4ZA 4KBZA 3SH5A 1LTEA 4L99A 1LOFC 5LRSA 1LGCA 4P9IA 3DGTA 4QKFA 2G1MA 4GWNA 3F2ZA 3OBRA 3SITA 4META 2XWBB 4XYXA 3W59A 1GUIA 3ZFFB 3ZIXA 4KMQA 4ET7A 1POV0 2VGDA 2Z69A 2OZ6A 3KMHA 2F17A 1MPXA 2VZRA 3AZXA 3BB6A 3FE5A 4PQ9A 5FPBA 4EN7B 4L11A 3PJQA 2BTVC 1U5XA 2WDBA 3MICA 1QU0A 1SEFA 2ZZJA 3DV8A 3P1IA 1AJKA 3ST7A 4QB2A 2Y6GA 4UFIA 4A6SA 1KXGA 3MW4A 5FZFA 4AVCA 5C5TA 2XXZA 4AI1A 1FV2A 2W9XA 1W05A 1R091 3VBSC 4NAOA 1JZ2A 3BU7A 3AXDA 3Q9OA 2JDHA 4XFFA 4ZY9A 3OCPA 1NA1B 2HWE3 2IXIA 2ZGRA 2JG8A 3WP5A 4YM3A 4WM7B 1W99A 1CJDA 3O1OA 1J3RA 2V4AA 1LOBA 5DAVA 3PVNA 2VMDA 4C1WA 3ZFEA 3CLPA 5LA2A 4AFDA 1WZXA 1UY1A 2WL1A 4O9GA 5K8SA 5F6KA 2VNOA 2FDIA 2YZ4A 3IIIA 2GC1A 3R6SA 1V6NA 2VL4A 4LBJA 2J1TA 3ROUA 3M3OA 5KHGA 5FJHA 1DG6A 4LBQB 3VBUC 2DFBA 1TQ5A 1GP4A 5E1RA 1NCQC 1O59A 2K46A 3VGIA 3LDBA 5KXBA 4DZGA 4YGBA 1W6NA 3I3EA 3ZSJA 2WN2A 3NV3A 4IETA 1LNSA 2GALA 2VZTA 1AXZA 3URFA 2ET7A 1UD1A 2GNDA 2D6MA 2VJXA 2Z79A 1OA2A 3TAYA 1SDDB 4XMAA 4FTBA 5FKCA 3ZOIA 4BWOA 3DPRA 3KQ4B 5C6CA 4CSWA 3VD3A 2WO1A 2IZWA 4QQ2A 1AR91 3M3EA 5LW9A 3ZIWA 1VP6A 2VZ1A 4XIOA 3SH4A 4IDZA 4GB31 3LE0A 1UIKA 1O5LA 4MADA 3TN92 5GZGA 1YQCA 3MEPA 1FPN3 3A21A 5K0UA 2WO7A 3L9JT 2D5HA 3UGFA 4LKSA 3RI8A 4KU7A 5FP4A 2VZSA 1PX4A 4RS5B 1G9BA 4Q4V3 4UBGA 3BALA 3OJBA 5FZHA 5ABJB 1PM7A 5IVJA 1S0FA 2R16A 2E7QA 3VHPA 3H8UA 4NE9A 5APAA 1VMJA 3AYAA 4JDOA 1VE0A 4BMEA 2C4XA 2W1SA 5JOZA 1C8NA 1V9U1 1OKOA 2RS52 5KHIA 1QJX1 4AXOA 3T4VA 4C90A 2VQ0A 1VRH3 3WINE 2HWD3 2F4LA 5JXIA 3AP4A 3LFIA 1XNCA 3PNAA 1OLRA 4NO4A 4S2HA 1CONA 1PM4A 3QOPA 2GP5A 1OFSA 2VUCA 1K5MB 5FPUA 5F5CA 4MGQA 3J7NA 1NCRA 2JD9A 4RQPA 2B39A 4LQRA 1E57A 1IPKA 3KLSA 3ZXEA 4CEYB 4NAMA 3AZVA 1CGPA 4YFWA 5C8CB 4LK7A 4TLFA 1D4M1 4AGRA 5F37A 2R062 5IHRA 1QF3A 2VR4A 2D6OX 2Q5TA 4BJ0A 5CFCB 2Z2SB 2VMIA 4AEDC 4EWAA 1UKGA 3IBMA 1QXPA 3VL8A 3H7JA 1S55A 4QKNA 4GXLA 4AHXA 1RUH2 1O7FA 1YWKA 3FUQA 4PBOA 1JTZX 3O5SA 3NJVA 3W9AA 1C8M1 4L0PA 1PMJX 1HV0A 1S0DA 4C0HA 1V6OA 1YHFA 3OPZA 4GMP0 4YG3A 1W6OA 3N7KA 5A3LA 5B2GB 4ES8A 3HQUA 1AVBA 1HB1A 4A44A 1YJLA 1QJY2 1WLWA 2V73A 3O12A 4FQZA 5A1AA 2O8OA 3ZDSA 4CDWC 3I2KA 5EJ1B 3UJOA 3VV1A 1S2KA 4L9BA 4ATEA 3ACIA 5FUPA 1AYM3 4AVBA 1GLHA 4FFIA 4I30A 4ZZ8A 3ZSKA 3RZMA 3VZKA 2D3RA 3CZUA 4LKEA 2VD7A 4LLOA 5LY2A 4P9XA 4V2VA 2RM21 1ZBA2 2GC3A 2A73B 2WT2A 5I91A 3W21A 2GSYA 1AR62 3B94A 2FDHA 4IV1B 1L7LA 1CAUB 2PLV3 3WY6A 1OUXA 1ZRIA 4CDXB 5FLHA 4N53C 5C3PA 4FPYA 1WW5A 2WS92 4ZS2A 1HV1A 1UQXA 4YW7A 4LLFA 4AOCA 5DG2A 4JV4A 2E7TA 2YBSA 2EF6A 2D44A 3JQXA 4K21A 5L9RA 4D6RA 5A1LA 5CIRA 4LO7A 4J1XA 4XJ9A 2XHKA 1RUJ1 3PMSA 1ZRFA 1SCSA 1YFXA 4IV3A 1KQRA 1DGLA 5L7OA 4IE4A 1GP6A 3WEZA 3ZYRA 1RUG2 3JD72 1RUF1 3UJQA 2DBIA 4HPKA 2YXSA 1BVP1 1YEWA 2VY0A 2Z5WA 3KV4A 4BYYA 5BUVA 3B7MA 4CCNA 4B4QA 5E89A 2ENRA 5F6LB 1R093 3WQBA 1FAYA 2QQNA 2QTWB 4NRPA 1AYN1 1AXKA 1NG0A 1H4HA 2PXJA 1C5HA 1W9WA 2WLPA 3B02A 1HX6A 3NV4A 5FDBA 1BEV2 1RVF2 1F8VA 5JAXA 2WZPP 1W8UA 3VBOB 1W8NA 3SLIA 2ZPXA 2XJPA 4RR3C 1EYBA 2ZCWA 2DCTA 4KWJA 3TNPB 4YGCA 4RYDA 4LHSA 4QPGC 2UU8A 4V1PA 3VHOA 3J7HA 3MV01 2YBPA 4UW3A 5FYTA 1NT0A 3AVRA 4MXWB 3AB0A 2VXJA 2VUAA 4B7EA 4TXWA 5IATA 4A45A 4QX7A 3RJ2X 5CKMA 2VC9A 2JDAA 2XR4A 1FX5A 1WMFA 2JG9A 4Q4X2 2XVLA 3K46A 1W9TA 3WHTA 4M3CA 4FP2A 2ZGQA 5FZ6A 4BQYA 5A3NA 2C0ZA 5HXVA 2DFCA 2AYHA 5GLTA 3C7FA 3MHZA 4I0AA 4IEQA 3I2JA 2VQTA 4YVSA 1WW4A 4LO4B 5C4WC 3ENRA 1H8TA 2VW0A 1XNAA 2RS32 3AMQA 3HPNA 3POYA 4M01A 2DCZA 4AQ6A 3T09A 1GSLA 2RS12 4AAXA 3OD4A 1PK6A 4YW5A 1Q5OA 2G19A 4NPRA 1AR93 2RMU1 2QQWA 4AEJA 3AMPA 3F95A 4Y1VA 4GB33 1CD3G 1REEA 1TZOA 5EYXA 1Y43B 1BMV2 4E8DA 4DMIA 4QQPA 4BH9A 1MVEA 2E51A 3ASIA 1RMU2 1ND3B 2AZ5A 3KHBA 5FZBA 1LU1A 2Y64A 4AEMA 3TEYA 2BJSA 4AGGA 4CCLA 2YC2A 1Y9QA 1JU3A 3TEWA 1UMHA 1OOPB 3NJYA 1POV1 3AKPA 3MPPG 5IUQA 4BQ3A 3VKMA 5FYSA 5IJRA 4S2DA 5B4NA 5C71A 1V9U3 1GKBA 1UYYA 1YRZA 3E5UA 1QJX3 4H14A 1QMJA 3ZPYA 4DB5A 1UPSA 3ZXLA 2WWJA 2I07B 4JGZB 2XDVA 1HN0A 3DF0A 1VBA3 4GALA 1Y4WA 3IPVB 4JRAA 3GCXA 1FPN2 4XFAA 1DCSA 2A3XA 4F3JA 5IK8A 3GM8A 2VOVA 4A4AA 3RI9A 4XMIA 4DXZA 3APBA 1YLLA 4H55A 3MW2A 3HN1A 5CG8A 2O14A 3CU7A 5JMCA 4LIVA 3W58A 5IVEA 1OXCA 2VU9A 5AFEA 3WF3A 5A3MA 1O4YA 3DKQA 2K0GA 4EE2A 5DDJ2 4ZU4A 1OLME 3D6EA 1NAEA 3WDTA 2CGOA 2F4PA 2QDNA 3GDBA 2VUDA 3UT0A 1VRH2 2VZVA 4GJYA 4AI9A 4H2AA 1ACCA 4RGKA 1ZZ9A 3VBUA 1OQEA 2BOJA 3I2DA 1GR3A 1AUYA 1BLZA 2JB8A 4O65A 2P5BA 3TN91 5FYZA 3WW3A 1GZWA 1UYPA 3I59B 3ZKYA 2HEVF 1CAWA 3HMYA 1GV9A 1UXZA 2JDMA 3POBA 3VKFC 4K20A 2P6CA 1ZRRA 3MLKA 1Q8PA 4CPBD 4G4FA 4R52A 1WCUA 3UKTA 4Q4Y2 4NWWA 1UZYA 1STMA 1B35C 2AC1A 2NMOA 4HN1A 4KH9A 4CEWA 2RS51 2JIGA 1W2TA 1DQ1A 2UURA 3S6PA 3EMRA 3FHQA 1UY2A 1WMDA 5FPXA 4P9LA 1S0BA 5I0RA 3U78A 1WBLA 1REDA 2RM23 2XOMA 3JU9A 2E53A 3AP9A 3HT2A 5I0TA 4CUCA 5F1RA 5KXDA 1E5SA 3H42B 2Q8EA 3ZFGB 4JHZA 4Y1UA 3EJKA 3T0AA 1FOD2 3DCQA 5JIAA 3BTYA 2VOTA 4IEOA 2XJQA 1C5IA 3DECA 5FKBA 1JYIA 1HB4A 3M70A 1SDWA 1DP0A 1EV12 2JKXA 5KHHA 4F83A 2WKKA 5T54A 3CHXA 5T3NA 1AYM2 4OFGA 3WOGA 4R8HA 3ZFFA 4QQOA 3B3QE 5LWBA 2XQXA 2NZ9A 2W08A 3I2IA 4CZSA 4QMAA 3O1PA 1RUJ3 3BIWE 3SC7X 3JBG3 1UX7A 4QX2A 4UFMA 2X5IB 1RUF3 2JX9A 3K48A 4HSLA 1ONAA 1MS5A 2R49A 2DUPA 4QDSA 1FMD2 3KS7A 3N9LA 2DVDA 4LITA 3WP6A 4E4ZA 3SCGA 5F3CA 5FOJB 3HQXA 1K5JA 2ARAA 2RDRA 4LHKA 5FZLA 3CJXA 1ND2C 1AYN3 2Y0IA 5KR7A 4IGPA 3RMXA 2QVSB 1APNA 1NA1A 3K3NA 5T52A 3THPA 4FPJA 3W20A 3WX5A 1SLIA 4D7SA 3H3UA 4MXVA 4NWVA 4QXCA 4S2GA 4WM7A 4RA0A 4W6YA 1RITA 4W65A 4HFSA 5CYYA 2ZX0A 4XUNA 4F8AA 4FTSA 1YFUA 3ZO0B 2C1FA 1QJU3 1YI7A 1QWRA 1TMF3 1VBE3 3Q8CA 2KXLA 4CUAA 3UNPA 3MI8A 4HVRA 2CDOA 2Q8DA 3GZTB 3BYWA 2Y6LA 2BNMA 5D21A 4BB3A 4GMP1 1DQ5A 4OMDA 3M3CA 4GJZA 4Q2FA 1F9KA 2E26A 1UY3A 4BQ2A 3P3NA 2D3PA 3I3QA 5I8SA 4R4XA 1FT9A 1O5UA 2XJUA 5LRRA 2WS91 2ZX4A 5JXHA 3RZJA 2HLEA 3MIGA 1ZBE1 5FXWA 4C8DA 3NNJA 2VMGA 3WF1A 1JYCA 5C8WA 1VBC2 2D3SA 4X8NA 4MGIE 2UY9A 3WV6A 1O3RA 2NP0A 2KA3A 2VXRA 3O7OA 1W3XA 1KS5A 2YV8A 3CL1A 4CU8A 4GH4B 1VMHA 4RFRB 1DIWA 3HNBM 3K77A 3DXTA 4ZZ5A 1XYNA 1AL21 3WXPA 2HJIA 4N53A 2K9ZA 3UKNA 4LO5B 1UZVA 1H2NA 2C24A 4FT8A 4XACA 1UY0A 5A7QA 5K0UC 2IFWA 1N3PA 4IE5A 4JQTA 4Y20A 2XWJB 4OHYA 3OY8B 3NNLA 4DUXA 2NN8A 3K4AA 3AP6A 1BEV1 1POV3 5ABJA 2R0HA 4CP0A 2CGPA 1MR5A 1BK0A 4QXKA 3NWKA 3RWKX 3WW1A 5EWSA 5BNOB 4HKOA 3E6BA 3VHNA 1OF3A 2P2KA 2Y0OA 3POGA 4FBFA 1DFQA 2QQJA 5FMBA 4AG4A 4I09A 1R1A1 5GLUA 3H1WA 1CIWA 4RGGA 4IEVA 1J58A 3Q8AA 4GB32 2CDPA 3KT7A 4Y3OA 1NZCA 2XMLA 2YB7A 3ZSEA 3BPZA 4CUBA 4XDQA 5LY1A 3V0AA 2SLIA 2BEOA 1OSGA 2BFUL 3VUOA 3FN9A 1J3QA 2W46A 2VZQA 3GHNA 1PVC2 4H7MA 1NCRC 1JI6A 1KDKA 1XB9A 2CY6A 4RR3A 5FXVA 3POFA 3OGJA 2PQQA 3SEEA 2XJTA 3T2TA 4CEYA 5JLVA 1AXYA 4UW4A 4I0WB 4GA9A 4XUTA 4AI3A 2RS31 5JXJA 2WNOA 3H1YA 1F35A 2RS11 5CB7A 3R4SA 4Y26A 2VBBA 3WUCA 4LHLA 4LXLA 3I7DA 4JDNA 1BHGA 2IUWA 1DDLA 5DUXA 3A23A 3TN93 4CCJA 1PIV1 1KFUL 2DVFA 1Z7S2 1RMU1 1H6YA 4AFBA 5G05L 1IOAA 3OD0A 1W8ZA 2XONA 1NQDA 3DUIA 3KCCA 4GKXA 4YW6A 4HZFA 2EALA 2NM1A 5DQ0A 1W2NA 5C4WA 2WN3A 2XPJA 1HRV1 1ZZCA 5JR7B 3Q8FA 2YYOA 2RJ2A 4FI9A 4YM1A 2QJVA 3WR0A 1D4M2 2VMFA 1W6PB 2RS53 2VQUA 5BNPB 3VDDC 2DF7A 4LOSA 1C1FA 1REFA 1CQ9A 2OIIA 1OVPA 3C7GA 1IQDC 2F6BA 5F8PA 4BK4A 4BLJA 4JC1A 4XPVA 4DEVA 1JOBA 2VOWA 3LD8A 5FUNA 4DRVA 4Q1RA 5A32A 1Z78A 5FY8A 4XZUG 4DRRA 4Y5Z0 4BQ4A 1S0EA 4NRQA 3ZN5A 1PO22 1GFF2 4LK6A 1HLCA 1C8M2 4CUGA 1I1EA 4IV1A 5EPAA 2V5DA 4PF1A 3FFZA 1V6KA 3MIEA 1CAUA 4S2FA 1G7YA 1LOGA 5IVFA 3WQ7A 3HAGA 4Y33A 4DUVA 3NVCA 3WD5A 3ZN6A 1ZZ8A 3WG3A 4XXAA 4WZFA 4A6OA 5C3RA 1T2XA 3IMNA 4XFIA 3H9AA 4PQQA 5FXXA 4LMFA 2P1BA 1ULFA 2EXHA 3MZHA 3T2PA 2FDJA 3POSA 3PVEA 2Q4SA 2DCKA 3LIGA 4AGVA 5CKNA 4E4DX 4FPFA 4IQPA 4A42A 4AHZA 1HQNA 4Q0VA 2ZBJA 3ACHA 3SNMA 5FWJA 5L7OC 4YFZA 1IQAA 5IYYA 1RUH3 5ANQA 5A33B 2AR6A 2XL7A 4IE7A 2I45A 4XABA 4K1YA 2NLRA 4R9DA 3LDRA 1UO9A 3D8CA 3AMHA 3VD4A 1H0BA 4KGGA 1QJY3 1UF2C 4YSFA 2J1VA 4HLTA 3CO2A 2WQ8A 3T1LA 5CADA 2X10A 4GWIA 2RR11 3RQ0A 3TRSB 2BGCA 2ES3A 3VBOA 4EQVA 3HJRA 1WCKA 5HCAA 2JDPA 1QKQA 4XFGA 4RFT0 3SKVA 1JZ8A 3ZXGA 1GQHA 4MX3A 2LROA 3VZJA 3THTA 5JOXA 1CVNA 1KDMA 1ZBA3 2XLAA 1N1SA 2PHLA 1A3KA 3NJZA 2WWUA 4MXWA 3WP3A 4GMP3 1YNAA 1AR63 3NJXA 5A7PA 5E88A 2R042 3WNLA 3AYCA 3PIGA 4QWNA 2J1SA 5CG9A 3BOWA 4DXRA 1FOD1 2XGXA 3MIHA 5FPVA 4OQ8A 1BK1A 1QDOA 4XBQA 4NJ4A 5FFOC 3VD7A 4FOYA 4DS0A 3EHKA 4J6GA 3FLRA 2WS93 4PIYA 3OBAA 2CV6A 2XBO1 4A7YA 1XU2A 2XJRA 4G3YC 3V56A 1JW6A 3AM2A 1F5JA 2VAUA 3ETQA 1AHSA 5FZ0A 2W94A 1H8TC 2VNGA 1IS6A 1N1VA 3T08A 5GLZA 1OH4A 3RJRA 4YNIA 4XCBA 1RUG3 4YGDA 3JD73 5DG1A 1PK6C 4YVWB 5LBFA 1JODA 3OGSA 1IG3A 1WKYA 2Q0AA 2BDRA 1AR71 2YBKA 4IEUA 2E6VA 1LR5A 3D3AA 1AL23 2V4VA 1LECA 1WMXA 1JMUB 1LKNA 1ND3A 4XIKA 1N1YA 5FK7A 4LHNA 1JZ6A 2GH8A 2ZZQA 4IESA 4AWDA 5T5PA 4LE4A 4WVZA 3VZNA 1BEV3 1OOPA 1RVF3 1RUE2 3GBWA 2EIDA 3IDCB 4NMIA 5J3UA 3N7JA 2XKOA 1H8VA 4LUMA 3HD8B 3C2UA 1YUDA 3ORJA 4TZDA 5FOBB 4YRDA 4COYA 3OEAA 5FQ0B 1W04A 4DUWA 4LA2A 3AZYA 3HNYM 3VBFB 2RMU2 5CNAA 4GAZA 1R1A3 4B8EA 2EIEA 2ZGUA 1GWMA 3IMMA 2DTYA 2D6NA 3IPVA 3AJZA 4I01A 2UWAA 4Q4X3 4OQ9A 4ES9A 2LS6A 3AFKA 1GYKA 1ND2A 3ECQA 2W1UA 5JSRA 3K3OA 2HBTA 2LALA 3ETPA 5FO9B 5K7PA 2PYTA 1W3VA 2BERA 4UW5A 2H0VA 4UXAA 5JWPA 1GU3A 1NXMA 4Z07A 3WNPA 2W2IA 1ZZ7A 2Z42A 2RG4A 1ZZBA 5C9AB 4JVAA 3NAPB 3U14A 1VPHA 1VBC1 1XSRA 2RS33 2WFPA 1SBEA 3RYRA 5LZ6A 2P34A 2WWSA 1NLSA 2RS13 1HKDA 1DYOA 4HKWA 4RHV1 3W5NA 4M0HA 4X8PA 5DABA 4JGYB 5LASA 3O14A 1F4AA 5FZEA 3WNXA 5F32A 1PIV3 3AKTA 3I59A 3CQOA 2DVGA 3VB9A 1RMU3 2R6QA 3POEA 3D5OA 3N7LA 4ZONA 3LGRA 2MHFA 4NHKA 5LA9A 3WCRA 4EJRA 1WLCA 2PHTA 2WT0A 1FNYA 2EXIA 2GC0A 1QY4A 3EB7A 5JZGB 2FCTA 1H30A 3VD5A 3IZOA 3ZXKA 1DYKA 2I2SA 4GIQA 4UFJA 4CEWC 5D8AC 5HCFA 2ZMLA 3QH6A 2Y6HA 5F5AA 3UYJA 1WLDA 1UZ0A 2RE9A 5FZ8A 5AFBA 1AX0A 4C1XA 1QIQA 1UMZA 4CCCA 1XPWA 1NKGA 5B4XA 2PMWB 1URXA 1RJ7A 1W8HA 1US2A 1LULA 4PDWB 2O8QA 2VULA 3NW4A 2EVXA 1JZ7A 2ZEXA 3I8TA 3KM5A 3KVBA 3L2HA 1JUIA 1SMVA 2DCYA 4YZ5A 3WNKA 1CX1A 3PLQA 2Y8KA 2CHHA 2AEZA 1Y7BA 1PVC1 3KSCA 4YZ1A 5F7UA 2W5FA 3BTZA 3NSTA 3I4IA 3RZZA 3GJBA 2QQMA 3ZM8A 5DDJ3 5FMDA 2OUJA 1O3SA 3WF2A 1S0CA 2RJKA 2JE8A 4IEZA 2ARBA 4CDUB 2ZHLA 3ZFFC 3NO8A 4LBNA 2ZX2A 3PVOA 4AFAA 4N7UA 5T55A 1UU5A 2E32A 3T2QA 2FZ2A 5L73A 3OGVA 4RSUA 3HBZA 4E8CA 1MQTB 4CCKA 4FP3A 3LOIA 2X5IA 2VPVA 4OZOA 2QQPA 4IGQA 1GZTA 5HBAA 5EQUA 1SFPA 4Z2AA 3U0ZA 3J4UH 1Z7S1 1V00A 4HXCA 4PI2A 4XQWA 5F2SA 3RZKA 4GZ9A 1UCXA 3KGZA 4HVOA 1SFYA 2A7AA 3GHMA 4Q4Y3 4JTNA 3BODA 3MDPA 4UT5A 1OI6A 1NA1C 2ZMKA 2XB6C 3LA3A 5FMOS 3JZVA 1DF0A 1ULOA 4WM7C 2TUNA 4FCAA 1OLQA 4P5HA 5TSWA 1ALYA 2IVJA 4QHOA 5FZDA 5L9BA 3WUDA 1KJLA 5FO8B 2ATFA 4NOTA 3I2HA 2FCVA 3NKTA 5I8TA 5IVCA 3KZ4C 1RIRA 4KGQA 1U12A 5LK5A 4GULA 1NE4A 1PO21 2PQSA 3UL2A 3USSA 4R9AA 1JZ3A 5D2AA 2W1WA 4CRQA 1ENSA 2VNVA 4MSVA 3U4SA 3ZYBA 3MBWA 4W6XA 1FOD3 1VB2A 1UOBA 1MZ5A 2ZAHA 4MGTA 2LTNA 1D0HA 1CZSA 2AENA 5GZCA 1EV13 2VTXJ 3O1SA 5K9YA 1SLBA 1Q8SA 2W1QA 2XBO3 4XDOA 1J83A 3VDDA 1YCIA 5FY0A 1NQJA 3J7MA 4CP9B 4BE3A 2VNRA 1EUTA 4HMZA 2DTWA 1KGYA 4CCOA 3RZHA 2OQ6A 4AFCA 3H8XA 4QPYA 3C7EA 3X29B 1COV2 3O0VA 3WW4A 5GKAC 1YFWA 2FHRA 4ATFA 1AR73 3SEPA 1FMD3 2FZ1A 3FC0A 2QDRA 1TVGA 3USUB 1UY4A 3HEIA 1TNFA 1NLQA 4RS5C 3OY8A 1ZBE2 2QQLA 3IAQA 5ABJC 2WRAA 1NUKA 4BZ4A 2WZEA 1F15A 3LF7A 5L9VA 3AC0A 1J59A 3M3IA 5BNOA 2HWB1 5FZ9A 5J36A 4NPMA 5IK4A 1SG3A 1X9PA 3GXUA 3IKWA 3WDUA 4UFKA 1QEXA 4KWKA 3UGHA 2R041 1OT5A 4AW7A 4FXKB 4P5YA 3AMMA 4QD2A 1AL22 2CSGA 2YG0A 3GF6A 1FYUA 5A80A 3ZYPA 5KHKA 2E33A 1DLCA 3NNGA 4AFMA 4WM8B 3VZOA 2B45X 3OF1A 4DO0A 5KC6A 1HXS2 1K5MC 2HEYF 5F9TA 2JD4A 4XDPA 2V5YA 2BFUS 3GJAA 2PAEA 1VBB1 4INDA 4PIXA 4OZXA 2BV4A 5I8YA 4NR1A 3AK0A 3BUCA 5D1IA 4CEYC 1VBC3 3FUOA 3M2MA 3MYXA 3JB8A 3ON7A 2QZ3A 4HT1T 3OYWA 2X09A 2UYBA 4EN6B 2GU9A 3RYKA 5C8CC 3RWNA 5JIUA 4RHV3 1SLTA 4OI0A 1S4CA 3FFQA 3LSEA 1R1A2 5CFCC 2ARXA 1GOGA 4J1WA 3SXWA 2JWPA 2AREA 2KM2A 2ARCA 1UOFA 4X6RB 1LODA 5CBLA 4P00B 3E1F1 4NHLA 4Q29A 4BXSV 4FPEA 5JMOA 2VCMA 3VBHB 3EYPA 1QXJA 4UFHA 1RUE1 5J37A 1VALA 4CP2A 1SBFA 1N3OA 1SHWB 1DLLA 1C4RA 2QFEA 4WVMB 3H8RA 1O8SA 3ILFA 1W6PA 5BNPA 1UWWA 1P8JA 2UYAA 3G6JB 5FZOB 1OPMA 3ZXFA 1OQDA 4Q4W2 3JUUA 4AI0A 5KHJA 1D2SA 3M8LA 5FUIA 3PUQA 2RDNA 2Y33A 1PIV2 1S0IA 4LTAA 4P9YA 1EY2A 1RJ8A 2VZPA 4G9SB 4Q27A 4Y22A 5FZIA 3HIFA 4IV1C 3I97A 1GOHA 1PVC3 1W9YA 3GGLA 5FZ1A 4IL7A 2BQPA 3ACLA 3KQRA 3B9IA 3LIHA 4LJHA 4QGMA 1HRV2 4CDXC 2G9ZA 2WA4A 3N7MA 4HKLA 4XCAA 1JHNA 3U4XA 2ET1A 3IB3A 2JE9A 4OI1A 4JKMA 1CZTA 3SMHA 3ZYFA 5ISLA 4BQ5A 2DUQA 2WINB 2XLFA 1NYWA 3A7QA 5C3QA 3ZVXA 4MVTA 1VBD2 2DDUA 3DYPA 2ZS6B 4BLIA 3N4MA 3FWEA 3OG2A 4Z1VA 2FD8A 1FI2A 3KGLA 4FPHA 4QX0A 2Q30A 5A33A 1UXXX 1Z7S3 2HWF1 5FYBA 4JHTA 2OVUA 5FXZA 3V0BA 4XHXA 2ZKLA 4I2OA 1EAH2 2VTXA 4E2SA 3Q8EA 5FZMA 4Y24A 3C7HA 4V2WA 4AVTA 1WCDJ 1HB2A 3SKJE 4EROA 4HK9A 1H2LA 4LE3A 1J3PA 1D4M3 2VECA 4C91A 5LA0A 1KITA 2WR9A 3VBOC 3NKGA 2P3IA 4KNCA 1TE1B 1YI9A 4XJZA 5C7GA 5HPOA 3MPBA 4YYOA 5DZFA 4BU2A 4QB1A 5A6ZA 2D97A 4BDVB 4Z2WA 3W5MA 2WNVB 2Y6FA 4LUKA 4N43B 1PO23 4UBHA 5CKQA 3KWVA 5SV5A 1C8M3 4GQ7A 2JG8B 3GYDA 1HDKA 1AR82 2C9AA 5FP3A 4LEJA 4OMCA 1O91A 4B1LA 3RMYA 5FPAA 2MEV1 3PU3A 3ZFEB 1T6BX 2QQOA 4D3WA 1OH3A 3K75B 1JYXA 1XNBA 1IKPA 3A4UA 4YW2A 3BOPA 3VBRB 2XHNA 4FFHA 1A78A 3R4UA 5A6YA 1JYTA 2RR12 5D8AA 1DGWX 4LR4A 3CJIB 3H1MA 4Q0UA 4MUVA 4M3CF 1VJ2A 1W9FA 1R64A 1R082 2YGMA 3AZWA 1LEMA 4E9KA 4IXLA 1S0JA 2GC2A 4WVWA 3CDZB 3BKZA 2A6XA 4C0BA 4MG2A 2DWRA 3T4HB 5HXMA 3VDBA 2WABA 5C3SA 4NIDA 2HWC2 3SCFA 1DZQA 1OPOA 3MUY1 3RS6A 1CJPA 5A3OA 4M4RA 3T2OA 4Z92B 3HT1A 4HBNA 1RUOA 4PI0A 3RGBA 3ZDVA 2XJVA 3DPRB 2A6VA 4NIHA 1ND3C 3O0XA 2EA7A 1H9PA 1OQ1A 2XBO2 5CFDA 3ZR6A 1OOPC 4ZU5A 4XTMA 4PF5A 5FV3A 1PMIA 2VOKA 2UWCA 4CCMA 5FQ0A 1MZ6A 3LCPA 2YFUA 2HWB3 2QZ2A 3WNMA 1W28A 3VBFA 2VZOA 1J84A 3N9QA 4QX5A 4EWDA 1A8MA 4OUMA 1NE6A 1AR72 4JGZC 4JX0A 2A6WA 2R043 3EBRA 1RTVA 4IW3A 1BXHA 2ETEA 1AX2A 2YC0A 3H3LA 2HYKA 3KT4A 2OX0A 2AGSA 2Z4FA 3S5QA 4UFLA 1OD3A 4ARYA 2J7MA 1WUVA 2WSVA 5HCBA 4XUPA 1BJQA 5GZFA 2CAUA 1V0AA 4OLLA 4QM8A 3N36A 4XQDA 4QDRA 3LFMA 3SH3A 2PFWA 2GMEA 3ME2A 1SACA 5CAZA 5LBCA 3ACGA 3BI3A 2FCUA 2JICA 2ZGSA 2LW8A 5E16A 5DMYA 1IG0A 1ODMA 3E6DA 1QQP1 5HV4A 2CL2A 5A7WB 1COV1 1F4HA 4RQPB 3VKLA 3VDCA 5EZWA 4LBQA 2Y6KA 4JGYA 4OUEA 4NIGA 1SLCA 3GCWA 1D0GA 2DU0A 4LOTA 2OYZA 3WDWA 4XC9A 1RUI2 1X33A 4GWJA 5A7OA 1XU1A 1W6MB 2D40A 4FVVA 1D2QA 1AF9A 4XFBA 1I6XA 4ZS3A 3TEXA 4BIOA 5EIYB 1RUE3 1PO12 4PJYA 4MO3M 4AE2A 3S0MA 5A7NA 5JZGA 3WG2A 2WNUB 5L36A 2C26A 2WZR1 4YZ3A 1LHVA 1LCLA 5KXCA 3O1VA 1PVXA 3HQRA 2RHPA 4RHV2 2EICA 1V6JA 1W8TA 5FJKA 1N1TA 3WQ1A 1JYWA 1TNRA 3WG1A 1JN2P 2RMU3 4P08A 1XYPA 5LBEA 1XQNA 2VMEA 1D4VB 4B4RA 2ADEA 2RVAA 3MF9A 4RL7A 4SBVA 1UYXA 1RXGA 4YG6A 2WC2A 4PDWA 3POWA 1W6QB 1I5ZA 1UL9A 4COUA 1JOPA 3ZFGC 4EZHA 4ZXEA 4RS5A 1HXS1 3OPWA 1MS0A 2AH2A 2SBAA 3D82A 3PHMA 4LA3A 1W2OA 3ILRA 4A2UA 1GICA 2DCJA 5KC5A 4FOWA 5BPXA 3NRUA 4ITCA 4EZ4A 1OC1A 5JXGA 1PMHX 4NUBA 1HRI2 1LJ7A 1VB4A 2IWGB 3OSDA 2OZJA 2VMHA 4QPIB 1Y9GA 4CDUA 1WW6A 1RC6A 1PX3A 5KXEA 2PAKA 5DXDA 2RJLA 1YQ6A 4UYBA 3OUIA 1HW5A 1W9SA 3B93A 1CWPA 5CVRA 3T1MA 4Q8KA 2GDFA 4I3PA 1MQTA 1N47A 1S2EA 4JQRA 2ZGTA 3QH7A 5F2WA 1MACA 2X5IC 1QH6A 1DYPA 1O8PA 3M7AA 3O1TA 3MFCA 1K5MA 4DXSA 3FMGA 1FXZA 1OLMA 5FYUA 4YM0A 3PUSA 3M3QA 2FMDA 3K4DA 2P6HA 5E6HA 2BWAA 4IV3B 3LPFA 5FREA 5FZ7A 4CXYA 3AL5A 3RFRA 1C28A 3U75A 5C8CA 2C6SA 2ZX3A 3IDEA 5BNNB 4HPKB 5FZCA 1GNZA 2BP6A 4ASKA 4CA9A 4HK8A 5L19A 1IGOA 4HONA 4UI9L 2TNFA 5CFCA 1UPIA 2G4IA 2J1UA 3LZZA 2ORXA 2ZACA 4Q4W1 4M00A 4W6WA 5GZEA 3RNSA 3A0NA 4LBKA 4QB6A 1CZVA 5FZKA 1KJRA 4WZCA 1R1ZA 4AHYA 4MH0E 3ZYJB 3QBQA 4Q0QA 3H8OA 3I2GA 4WBBA 5JPMB 5IVVA 4KU8A 1U0AA 3V64A 2Y34A 4YM2A 3VL9A 4LKDA 1O3QA 4AHWA 1UZWA 3CIHA 5AVPA 4QHBA 3WDVA 2BYVE 2XVGA 5H9QA 2CU5A 1F2NA 5A3WA 1YXWA 4N8MA 3U37A 2YUEA 4B3NA 4FO9A 4IE0A 2ERFA 4LULA 4XQ4A 4CP9A 2JG9B 4QXHA 1J1LA 1LHOA 3OTFA 4OHVA 5M0TA 1H9WA 1KFXL 1VBD1 1AZDA 2DVAA 2YC4A 3MLLA 4FFGA 5LB6A 4EWEA 4Z8BA 4UF0B 1KRIA 1K42A 1PZ9A 4PCRA 5AC92 4YVSB 2R1BA 1HJGA 3SCHA 4GH4C 4BQXA 1LOCA 3S7EA 4NN0A 4I0BA 3M4FA 4CDXA 1EAH1 2R32A 3I3BA 1G9DA 1RYYA 2NPIA 1ZA7A 3T0DA 1JH5A 2OXBA 5EHDA 3ZMNA 1ENRA 3USUA 3O1RA 1QDCA 4KWUA 1EPZA 1XNTA 2AEYA 3EO6A 5FK8A 5JSOA 1LB2A 3DEMA 3AKSA 5FP8A 3ACFA 2D93A 5F3EA 5A3TA 4QAWA 2HKXA 2ZKNA 3OOXA 4N9IA 3RVHA 1AX1A 4TWTA 1W2UA 2PHRA 5J48A 5BNOC 3KV6A 3J9SA 2Q8CA 1GANA 4N90A 2CNAA 4Q4V1 4NIIA 1HB3A 3T0BA 1QJEA 2Q1MA 1JBCA 1L3JA 1QNWA 5ACA2 1AR81 1F5FA 2BBAA 2C5DA 5ERLA 4PLMA 3VKOA 3AYEA 2XH6A 3LAGA 2QCSB 4WM8A 4XILA 2P4EA 4TLGA 3R4DB 5A7SA 1MZEA 3KV9A 4LBMA 1VLNA 4CCDA 2ZGOA 1ULEA 3B01A 5I93A 2XLGA 2RDQA 3QD6A 3PURA 1R081 2ZXQA 3FX3A 2VW1A 3HN3A 3VBSB 1IHMA 2ZGNA 2HWB2 3ZR5A 2OPKA 4MLOA 4RN5A 2R1DA 4YGEA 4BCUA 3BCWA 1COV3 1RGSA 2ORZA 2W68A 2DUOA 3I54A 3LA7A 1E5HA 1OA3A 2HWC1 1POQA 2OA2A 2VCCA 4KG0A 4MGKE 4PIZA 4QX8A 3TWIA 3LPGA 2KD7A 4K8RB 4ZXKA 3THDA 1BYHA 3K4ZA 2GNBA 2QQIA 2NQYA 4P9GA 3CMGA 2FDFA 3AXEA 3H50A 2YMZA 2WJSA 4QGNA 2WBKA 3WDXA 3RZGA 4MGZE 2ILMA 1VBB2 3IWZA 1ZBE3 2BNNA 3UV9A 4XF1A 3VBUB 4CYDA 1IPJA 4LPLA 4YW4A 1NCQB 4QDQA 2YROA 4OHXA 3QLQA 5GLVA 2WZR3 3TB0A 4XTPA 1GZWB 5H9PA 1RUD1 3N9NA 2GMPA 5BNPC 1XNKA 5FLIA 3AX4A 5LBBA 2EAAA 4AAPA 5CU1A 4B4PA 1OURA 3ZYHA 2ZGLA 3ZXDA 1TG7A 1X50A 3DKWA 2W0XA 3IDBB 3OUJA 4K40A 3KB5A 5FY5A 5K4LA 2EIBA 4B29A 1WWYA 4I3GA 4XAAA 4ARXA 1LAJA 1AJOA 2BOIA 3ILNA 3QACA 5IFPA 2DU1A 1HXS3 1DQ6A 3POJA 3G7DA 1WW7A 2GP3A 2JJ6A 2PA7A 4J25A 5EJ3A 4ORFA 2W39A 3FLTA 3PJYA 2OS2A 1A8DA 3MLJA 4JRLA 5H9SA 1UU4A 3UKVA 1X8MA 5FRAA 4BQWA 1MEC2 2O0OA 3ZSLA 3CEWA 2VTFA 4PBPA 1ENXA 4JGZA 1XXNA 2PLV1 4QGLA 3WNOA 3BTXA 1GWLA 4Y4RA 5J98B 2JDYA 2XL9A 1KEXA 4QX1A 2ZJCA 3THCA 3MV11 1CR7A 1DU3D 2V72A 2YHJA 1S1AA 3CKHA 2A3YA 1XE7A 3MFAA 5LATA 3RDIA 4D8MA 5CEHA 2DURA 1RUI1 2VVFA 3ZLIA 4AL9A 4MHUA 1V70A 4A7KA 3IM0A 4P14A 1MVQA 1MS8A 4U36A 2AACA 3PUIA 1ASJ2 1PO11 1RHI2 2EXJA 1O4ZA 1ENQA 3OEBA 1IZ3A 5DUVA 2E9QA 5T5OA 4YZ2A 1GQGA 2I74A 3BPSA 4JCKA 4K6BA 5C70A 3P5BA 3TYJA 1ZVFA 4LBLA 4Q4W3 4E27A 2RDSA 4DPNA 3AKQA 4KG8A 1G6NA 4AF9A 4GKYA 3ATGA 1XBFA 1NX9A 2BW8A 1UOGA 2WNVA 3WCSA 4N43A 5FP9A 3OBZA 3LDKA 2H6CA 2HWF2 3B00A 3MGUA 2IXCA 5DAXA 3BU0A 1GWKA 3M1HA 5C5UA 1BBT1 4U2AA 4CDQB 4EN9B 4JDMA 3J8F2 4AEDB 3RRDA 1HRV3 2ADDA 4QXBA 4EN0A 3VBRA 4E2GA 4M0NA 3MIDA 2XJSA 4X6QB 4D6SA 1XNDA 1HRI1 3R05A 2UY8A 2ZGMA 1YC61 3CJIA 2IXHA 3V65A 2PAMA 2XG3A 3CZJA 3HWJA 4HL0A 1UNBA 4R4ZA 4R9BA 4QM9A 4UWDA 4DXTA 4IUGA 3N3HA 2FDKA 4AEKA 4D6QA 1VBD3 2BWCA 2W52A 5FZAA 4JTOA 2N7GA 4CDWB 4GD4A 3WNNA 4UOJA 2B9UA 3PTYA 3S5AA 2GNMA 1TEIA 4P9JA 5LA1A 4YVWC 1MZFA 2P3YA 1WBFA 4M3CE 1PNFA 3FHIB 3ZFGA 1GBGA 2WQ4A 5FY7A 2GN7A 1OVSA 2MEV2 3POIA 1EAH3 4XURA 1YIPA 3I49A 4OCTA 4JKLA 4XHBA 4Y5SA 1US3A 3WW2A 2PHUA 3TOJA 2Y38A 4XF3A 1LGNA 2P3JA 3C7OA 4A3XA 5EFUA 3MIFA 3FLPA 2LRPA 3MUZ1 5F5IA 2QQUA 1VR3A 4Y1XA 4DNYA 5CFDC 5FZ4A 2Q1ZB 4BOWA 3RSJA 1UMIA 4B1MA 4RD7A 1UN1A 4LO8A 2VQAA 1Q3EA 2QQKA 5LK7B 2BPA2 4N53B 1O4TA 2JKBA 2XVKA 4LBQD 2WLQA 4QKDA 3VBFC 1JZ4A 5FY1A 4Y20B 2ZGPA 2TEPA 4XFCA 3LOBA 2A71A 2B46X 4AI8A 1AR83 3KHCA 4NHMA 3UESA 5FAXA 4QU1A 3AZZA 3WP4A 3FBYA 4XJUA 4QPWA 2VW2A 1TME2 2JEMA 3DL3A 3NNMA 2FBEA 3NQHA 1PGW2 2PN5A 2WZ8A 2A5ZA 3VZLA 5JDBA 2RR13 1JOJA 4DEQA 3B5LB 5FYHA 1W0NA 3OGRA 4XOGA 5JOYA 1EUUA 3H3ZA 1R083 2VCBA 1VBA1 1XOYA 1NY71 5C9AC 1PZ7A 3NAPC 1G86A 4MGYE 2B7YA 1VAKA 3V0AB 1W06A 1W90A 5A7WA 2D43A 1B09A 2HWC3 2D6LX 3TNQA 5AC91 5GALA 2W92A 4JGYC 2WFF2 1QH7A 4RR3B 2CAVA 4XJ8A 1IKQA 5BV6A 4QPGB 1LRHA 4YG0A 2CYFA 3I3MA 1O3TA 4H3WA 1SCRA 1MS9A 1LENA 3D0SA 3PIJA 2IXKA 3HR9A 4Q1PA 2EIGA 1W6MA 2WSUA 2X53S 3D4KA 1SLAA 3PTRB 4LO6B 4NROA 4XBNA 3DN7A 1X8EA 4CDQC 4ZKTB 4XJAA 4URTA 4LNVA 3U1XA 2WNUA 2A70A 5JZGC 2C9KA 1LGBA 5JPNB 1RUD3 5FBZA 3VN4A 3I3DA 1QQP2 2B8MA 1AL0G 2X8KA 4QHZA 3WZ1A 5T5JA 4GH4A 3AVSA 5C4WB 2ZHKA 3IIAA 5ACA1 3NV2A 2NMNA 4L97A 1H1MA 1SQ4A 4DOUA 1PHMA 4PDWC 5T50A 1W6QA 1IS5A 2LM3A 1CPMA 2P37A 3ZXJA 3WQ0A 4AVAA 4AQSA 4CU6A 2TBVA 1OUSA 4Y4YA 1QOTA 1W2AX 3BTAA 4O9EA 3J26N 3PU8A 3S30A 5JCTA 5A3PA 4YW1A 5A32B 2R072 3LQCA 1JYNA 2IFRA 1PNGA 4BA6A 2J1EA 2WZR2 5DZEA 4K1ZA 1UU6A 4ZU7A 4QPIA 1FV3A 3E5QA 4DY3A 1RUC2 2YPDA 1IPSA 4CDUC 1ZYBA 2B9VA 3BN6A 2A6ZA 1Y3TA 4MZUA 1QJFA 1QGLA 2PHWA 3ZN6B 1MQTC 2RV9A 4FTEA 2KR2A 3GZUC 3KD4A 5DPNA 3T3YA 1UYZA 3PL0A 3EXUA 3K2OA 1RUI3 2D5FA 5DAPA 1OA4A 1CX4A 1Y9MA 3IAPA 4OHWA 1WMEA 1DBNA 4COZA 5IVBA 1PO13 4ZPIA 3TBDA 1ZX5A 3WT3A 3TEZA 1K45A 3JBG1 4COVA 5FWEA 5FZGA 5IAXA 2JDKA 5JOWA 4ASLA 1CAVB 4XE9A 2BBVA 4K3UA 5BNNA 2X05A 1OKQA 1PGSA 1GQPA 4MGSA 4K7JA 5FY4A 3K51A 5CISA 4HETA 3RYPA 2NYYA 1SPPB 3MF6A 5I0SA 4IERA 4NPLA 4K9SA 3NNFA 1SZBA 2HH9A 4P9WA 2D6PA 5EXOA 2W95A 3LEGA 1DQ2A 2JENA 1BBT3 2ZEZA 3U10A 1EP0A 2WYFA 5DUWA 3S57A 1WLTA 1GMMA 2JECA 4I02A 1QJU1 1VBE1 1TMF1 4KWLA 5FYCA 2J1RA 1CAXB 2VVDA 4XJWA 1HRI3 3ES4A 4D7YA 1U5IA 1JS9A 1MEC1 1XE8A 2Q1FA 4ASMB 1YJKA 2VCAA 4Z82A 1WD4A 5EP9A 1Z0HA 1FATA 4XVHA 4UF0A 1YFYA 5J96B 4XZPA 1B35B 4BIFA 2HWE2 1BQPA 4DINB 2VG9A 4EV0A 4E4SA 1HJFA 2GMMA 1IS3A 5GJ6A 1JU4A 2GZWA 4QQHA 4FPLA 1KS4A 3GNEA 4WVVA 4Q0SA 1W39A 4HVQA 1ASJ1 1RHI1 1A34A 1ZM1A 2VBPA 3I2FA 3HVDA 3PMEA 2QNKA 1DZTA 2A3WA 4XW3A 1VIWB 4D69A 1ZNPA 2A75A 4BHPA 4BISA 1XRUA 1I9RA 2AUYA 1UW8A 2CWMA 1CPNA 3UGGA 5I0UA 4BMBA 1LOFA 1Q56A 4YARA 4CP1A 2ZABA 2IC1A 3VKNA 3ZYIB 2FQPA 3BVCA 2BRTA 2XKPA 3O0WA 2JIJA 3R0RA 2WNEA 4FPCA 4ISRA 4URAA 5HCHA 2JDNA 5FZ3A 4DFSA 3J8F1 3INAA 3I2OA 5IT6A 1U5ZA 1JYVA 4WM8C 1XC6A 2Y6JA 2GH2A 3L2YA 4YPJA 4E4HA 4ISQA 1ZA4A 1ZRCA 4BPZA 5FCCA 1V6IA 4OHZA 4B7KA 2A1XA 3ZPOA 2ZX1A 4AZZA 5FIXA 1Q43A 2WO3A 3ABZA 4QU2A 3U11A 3VBSA 1Q8VA 4D94A 3AYDA 1ND2B 5FPZA 1W8FA 4SLIA 4Y1ZA 4MHRA 4NVPA 2CGNA 1GZCA 2ZEYA 1DQ0A 4Q4V2 2BNOA 5DUUA 2BU9A 5AC93 1D7PM 4IEXA 4JKKA 3DYMA 1WA6X 2ZHNA 2H6BA 5IVYA 2CTVA 3B9CA 3N9PA 1IS4A 4CXWA 2XQRA 5GM0A 2B4KA 3ZMOA 3E97A 3VBHC 3MIBA 5FLJA 2HWD2 4IE6A 3MO4A 2W91A 3SHRA 5FR3A 1NOVA 3PDQA 1NCQA 4TSVA 3WF4A 1ZRDA 1RL3A 3LEMA 4R9CA 5JSPA 1LHNA 1C3HA 2UWBA 2OT7A 2HBUA 1W6NB 2GN3A 3DXUA 3HBKA 2EAKA 4YVWA 1SFNA 1I3HA 2FMYA 2J1AA 2WQZC 2WUHA 3FBMA 1I5PA 3FL7A 4LIUA 4CVUA 3OB8A 5ACA3 2YDEA 3VHRA 1JHJA 1ULCA 1TME1 1W0OA 1PGW1 3AKRA 1UZZA 3T30A 4BXFA 3KF3A 5FPLA 5HV0A 3N9MA 4QKBA 1CIYA 1UKRA 3LB9A 4XF4A 4KQ7A 5F5QA 1RUD2 3WG4A 5K0UB 4XBLA 4OUSA 1UAIA 4YLZA 4AK3A 4DY5A 4AR2A 1SBDA 4KBBA 1LESA 4NIAA 1PGL2 4Q8LA 2G9GA 4D7TA 1CN1A 4FPKA 4XXPA 4ZHNA 2BUKA 2P17A 5H9RA 2DBNA 3WF0A 2WFF1 4AQTA 3FJSA 3JXSA 5DAWA 5GZDA 1RINA 4TTGA 1L7QA 1ULPA 1XSQA 4Q0PA 5A70A 1OBNA 3DYOA 3IDAA 3SISA 4KI5M 1QNYA 2R061 1UX6A 4O7XA 1VBB3 5JI9A 2JE7A 2BVBA 1YQ8A 3ZN4A 2VE1A 4NHXA 1G9FA 2MPFA 3BGAA 3NAPA 4PLNA 5C9AA 1OD5A 3H7YA 1U5YA 1W03A 2OW4A 4FPOB 1RUH1 2PTMA 4IGOA 2W47A 4E2QA 1JUHA 3N35A 2VZ3A 1NCRB 2PLV2 2ZA9A 4FSJA 4GWMA 2H0BA 2PHXA 2ZOEB 3CF6E 2YY1A 1RB8G 2YU1A 2E31A 1QOOA 1QJY1 1Q8QA 1ULGA 1YIFA 2JDZA 4YWAA 3UETA 1DGWA 1JXNA 5FMOL 5CA6A 2WNVC 2QUOA 1MS1A 4N43C 4PLOA 5ANNA 1ULDA 4LKFA 2JG8C 1H2KA 3KF5A 1X36A 4CDQA 4FAHA 2BVVA 2CWSA 2YGLA 2HEWF 5FO7B 4AEDA 2OKXA 1XE0A 2K2SA 3J7LA 2GAUA 2R071 4OVEA 3ZFEC 5FMCA 3AP7A 4HANA 4IEPA 2D6KA 4FXGB 4NHYA 3VBRC 1ZBA1 3MW3A 3QCWA 3KVAA 1BCXA 1X9TA 3ELNA 3IT8A 1WA4A 1MEC3 4L8QA 1AR61 3CJIC 3JQWA 3LWCA 2VUJA 4FFFA 4XEZA 1RUC1 2BGPA 2XUEA 5A1FA 1W6OB 3IN9A 1Q8OA 3LEIA 4L2NA 1R092 2WYSA 1NLRA 3S7IA 2QQVA 3WHUA 4XFHA 3UK9A 1HIXA 4CDWA 5FY9A 4NRMA 4LORA 5A6XA 3VZMA 3VDDB 4MOAA 2IVIB 1BBT2 2B42B 3LSDA 4YZ4A 3FZ3A 2IXLA 2PHDA 2A6YA 4TN7A 5IAVA 5IWFA 3OGGA 3N9OA 3P6BA 4HOOA 1DQ4A 2ZHMA 5G04L 4XETA 1ASJ3 2BGOA 1RHI3 2R7EB 5F39A 5IFTA 2FDGA 3DPRC 3LKJA 2D7FA 1UIJA 1E5RA 3WVJA 1RUG1 3JD71 3PUAA 1C1LA 3ZX7A 1LOEA 1N3QA 1M4WA 4TYSA 1G9AA 2WA3A 4HSJA 3KCYA 3O1MA 2P3KA 4KL1A 3WLUA 3OBTA 2VBDA 2E7AA 1DZRA 1JZ5A 3VDAA 4QQLA 4AI2A 3GZAA 2VVEA 4Q26A 1C57A 1QJZA 2PHFA 1LHWA 5EJZB 2HWF3 1VMFA 1RVF1 5J1XA 2ZMNA 2YU2A 4W8JA 1OF4A 3HOBA 4EYUA 1UOJA 3J8F3 4OYUA 5JI7A 4FQ4A 2WAAA 4AYUA 1K12A 2DV9A 2EXKA 4QT6A 4CCEA 5L7OB 4BK5A 4UAPA 1ODNA 5IW0A 4XUQA 1OHFA 1W8OA 1BKZA 4JAAA 4L92A 2JB4A 1AR92 3B69A 1M06G 4LT5A 5FP7A 3D0JA 2ZGKA 3LA2A 4CE8A 2VO5A 1MS3A 2G9FA 2Y26A 2HYXA 3PVBB 1V6MA 4Q4X1 3AP5A 3NV1A 2B5HA 2W3JA 2Q8OA 3U07A 3WSOA 3VD9A 2E63A 2IXJA 1GNYA 4HG6B 1XYOA 4OI4A 1H1AA 2HWE1 2VOXA 1QHDA 4DQAA 4RQPC 5FYYA 1ST8A 1YYNA 4CTEA 1WD3A 4LBOA 5DN2A 3RZLA 3OUHA 2MNGA 2MEV3 1V6LA 1W8WA 4O61A 5IK5A 1V9U2 4QPGA 1QJX2 3C3VA 3OYWB 1VRBA 2ZAAA 1NXD1 1WCSA 1GOFA 3EQEA 3NL1A 1LU2A 4FPGA 1HQLA 1HN1A 1T6GC 4YW3A 3JB4C 5FYVA 1J1TA 1SLLA 4M4PA 5LEKA 1VBA2 4K8FA 1NY72 1EPWA 3SQOA 4AVSA 1DHKB 2WNUC 4M3CB 1ZZ6A 1BMV1 1G9CA 1VAVA 3P3PA 1NZIA 2J22A 3AMNA 3ES1A 1HQWA 3KV5A 3RG0A 3LEKA 1YO8A 1GNHA 4JZRA 3CNAA 1H8TB 3GZEA 2GNTA 5BNQA 1TME3 3GBFA 5E8AA 2R0FA 3NMBA 5SV8A 5F3GA 4XF9A 5DZGA 1PK6B 1X82A 3AJYA 1YQ2A 2JDUA 3H0OA 1RXFA 5DAQA 3WDYA 3CBNA 3ZYGA 4D0QA 1GP5A 2BZDA 4CU9A 2OQ7A 3E5XA 4Y5TA 5JVVA 4HN0A 2J42A 1FPN1 4Y22B 1BZWA 5CFDB 4N9HA 3HNMA 4QPIC 3ZSMA 5C3OA 2YPJA 4IEWA 3ZXAC 2VMCA 2LUWA 4EN8B 1DGRN 2WIIB 2DVBA 4FOVA 4Y1YA 2QKDA 5AVAA 2QE3A 2WFF3 4XAEA 3ALQA 1FNZA 4OI2A 5DDJ1 5FBJA 1H6XA 1OFNA 2OUHA 2VH9A 3OPTA 3O1UA 2ZTNA 5A3UA 4A3ZA 5JR2A 5A6QA 1ZREA 1QXRA 4XUOA 1H2MA 2R063 1RUNA 1VRH1 1G8WA 2HWD1 1A6CA 1OMIA 1MS4A 4UW6A 5FYIA 5JUVA 1KD7A 1L7RA 3JCIA 2DYCA 4MV2A 5BXXA 4IV3C 1QOSA 2RM22 1F31A 1CAVA 1BVVA 5FTTC 5BNNC 1H1IA 1QQP3 3FHAA 4F7ZA 4QX3A 3V0BB 1DGRA 1WCQA 4H7LA 1H4GA 4AVVA 2XUMA 1SPPA 4A41A 4N7IA 5J7MA 2VZUA 3C8XA 5CZKA 3VLBB 4PHZA 4Q4Y1 3ZKUA 5HI0A 3AL6A 4FOQA 4Q5OA 5FYMA 3GALA 1LOAA 4AQ2A 4CU7A 5IK7A 2ID4A 2W87A 3VBHA 2R30A 2X29A 1O6UA 1RUJ2 3BIEA 1X7NA 5KBFA 5T5LA 2L9LA 2R073 3JBG2 5EV7A 5F3IA 2V09A 1CAXA 3A0KA 1RUF2 1XJAA 3KT1A 4PT6A 4WVMA 5EYYA 4BQ1A 2JXAA 5LEJA 1CAWB 2Y60A 5J09A 5C33A 4DIQA 5FZOA 4XF0A 4MYEA 1K3IA 1RUC3 1PGL1 2JG9C 4IEYA 4CXXA 4COWA 1WGPA
chains in the Genus database with same CATH topology
1UY0A 2W92A 2QBXA 4DUXA 3K4AA 3C7HA 2WO2A 2ZEWA 5I0DA 2YFZA 3SKJE 3A22A 2WAOA 5LA0A 1OF3A 3PUHA 2QQJA 4W50A 4AG4A 2C9KA 5C7GA 5HPOA 5LCWL 4P02B 3I3DA 4QB1A 2VM9A 2CDPA 4BDVB 3W5MA 2YB7A 4CUBA 4W4ZA 3FN9A 2W46A 4OMCA 2VZQA 1JI6A 2QQOA 1JYXA 3F2ZA 3K75B 4CU6A 1GUIA 4KMQA 3SEEA 4ET7A 2XHNA 5JXJA 4XUTA 2VZRA 1MPXA 3LQCA 1JYNA 1R64A 2J1EA 2WDBA 3CDZB 3P1IA 4QB2A 2Y6GA 1BHGA 2B9VA 3A23A 3BN6A 5HXMA 3VDBA 2WABA 1JZ2A 2W9XA 1H6YA 4ZY9A 3MUY1 5G05L 2RV9A 4M4RA 2XONA 3T2OA 5DPNA 1UYZA 5DQ0A 1W99A 2WN3A 2VMDA 2RJ2A 4FI9A 3IAPA 5LA2A 2VMFA 1UY1A 2VQUA 1K45A 3IIIA 3C7GA 4BK4A 1IQDC 2VL4A 4DEVA 2J1TA 2X05A 2YFUA 4XZUG 3WNMA 2VZOA 1J84A 1GQPA 4MGSA 1O59A 4JX0A 2V5DA 3I3EA 4PF1A 2WN2A 1LNSA 2VZTA 2W95A 2Z4FA 3LEGA 4DUVA 1OD3A 4ARYA 2J7MA 2VJXA 4XUPA 4A6OA 2ZEZA 1T2XA 1SDDB 4PQQA 4QDRA 1GMMA 3T2PA 2J1RA 2DCKA 3VD3A 3ACGA 2WO1A 2LW8A 5DMYA 4A42A 2VZ1A 3ACHA 3LE0A 4MADA 5IYYA 2VCAA 1F4HA 3A21A 3VDCA 2Y6KA 4LKSA 4XVHA 4OUEA 3VD4A 2VZSA 1PX4A 4GWJA 2J1VA 1JU4A 2WQ8A 2C4XA 2W1SA 2X10A 4GWIA 5EIYB 4MO3M 3I2FA 3HJRA 2C26A 3SKVA 1JZ8A 5JXIA 1JYWA 2EICA 4P08A 2VMEA 3WNLA 3NJXA 2RVAA 2J1SA 1UYXA 4MGQA 4DXRA 2JD9A 3VD7A 4LQRA 4ZXEA 3OBAA 2DCJA 1JYVA 3NRUA 1XC6A 2Y6JA 5IHRA 2VR4A 4BJ0A 4YPJA 5JXGA 2W94A 1PMHX 3T08A 1OH4A 1PX3A 2WO3A 3ABZA 1W9SA 3NJVA 3OGSA 1WKYA 4L0PA 1PMJX 2ZEYA 3D3AA 2V4VA 1O8PA 4A44A 1D7PM 4JKKA 5A1AA 4DXSA 3DYMA 3I2KA 5EJ1B 1JZ6A 3K4DA 2EIDA 3ACIA 3LPFA 2B4KA 4ZZ8A 3CZUA 3OEAA 3MO4A 2W91A 4DUWA 3WF4A 3HNYM 4UI9L 2J1UA 2ORXA 2EIEA 4QB6A 1CZVA 3FL7A 2J1AA 2LS6A 2WUHA 1I5PA 3ECQA 2W1UA 4CVUA 3I2GA 3OB8A 3ETPA 2BERA 1JHJA 1GU3A 3CIHA 3WNPA 3U37A 1CIYA 3WEZA 1DYOA 3W5NA 2YC4A 1F4AA 1K42A 3CQOA 3WQBA 2QQNA 1W9WA 3WF0A 4TTGA 3JXSA 1L7QA 1ULPA 3I3BA 3T0DA 1RYYA 3DYOA 3IDAA 1W8NA 3EB7A 4KI5M 4KWUA 1XNTA 3VD5A 4RYDA 4LHSA 3ACFA 3J7HA 3MV01 2Y6HA 4QAWA 3BGAA 1UZ0A 4TXWA 4A45A 2W47A 1XPWA 1NKGA 5B4XA 2VC9A 2JDAA 2VZ3A 1US2A 3K46A 1W9TA 3T0BA 1JZ7A 2ZEXA 2E31A 3UETA 3WNKA 1CX1A 2Y8KA 2BBAA 3C7FA 5F7UA 3I2JA 2VQTA 2W5FA 3ZM8A 2QQMA 1XNAA 3WF2A 3HPNA 2JE8A 2OKXA 3T09A 4AAXA 2E32A 2ZXQA 3T2QA 3HN3A 3OGVA 4E8CA 4RN5A 4OZOA 2BGPA 2ORZA 3LEIA 4E8DA 2WYSA 4Z2AA 2VCCA 2Y64A 3LPGA 2KD7A 3THDA 3K4ZA 2QQIA 2YC2A 1JU3A 3CMGA 1UMHA 4GZ9A 4MOAA 2WBKA 3P6BA 5IJRA 5B4NA 5C71A 5G04L 1UYYA 1ULOA 2BGOA 2R7EB 4LPLA 5IFTA 4QDQA 3I2HA 1JZ5A 2PQSA 3VDAA 3GM8A 4A4AA 1JZ3A 1TG7A 2W1WA 3MBWA 2EIBA 5EJZB 1CZSA 4ARXA 5J1XA 5IFPA 3WF3A 4W8JA 1OF4A 3HOBA 2W1QA 1NAEA 4OYUA 1J83A 2WAAA 1K12A 4BK5A 4UAPA 4XUQA 3GDBA 1W8OA 2VZVA 1EUTA 1KGYA 2VO5A 2VTFA 2HYXA 3C7EA 3WNOA 2W3JA 3VD9A 3WSOA 1KEXA 1UXZA 4QX1A 3SEPA 3THCA 1GNYA 4HG6B 3MV11 2V72A 1TVGA 3CKHA 4D8MA 5DN2A 1UY4A 3HEIA 2QQLA 3IAQA 3PUIA 1NUKA 1GOFA 2WZEA 3OEBA 1HN1A 3AC0A 3FHQA 1UY2A 4M4PA 2XOMA 1SG3A 3GXUA 5C70A 4CUCA 1OT5A 4JHZA 4P5YA 2J22A 1NX9A 3T0AA 2YG0A 3LEKA 2VOTA 2E33A 1DLCA 3DECA 3NNGA 1DP0A 2JKXA 2XQXA 3I2IA 1YQ2A 4D0QA 2X09A 2BZDA 1UX7A 3CZJA 4QX2A 4CU9A 4DXTA 4IUGA 1GOGA 3HNMA 4QDSA 3WNNA 4UOJA 2VMCA 4P00B 3E1F1 5LA1A 4BXSV 5JMOA 3EYPA 4XURA 1H6XA 4JKLA 1US3A 5JR2A 5CYYA 4A3ZA 4XUNA 1SHWB 3C7OA 4XUOA 3MUZ1 3UNPA 5JUVA 1O8SA 4CUAA 1L7RA 1UWWA 1UMIA 1P8JA 2CDOA 2QQKA 2Y6LA 4OMDA 3FHAA 5FUIA 4QX3A 1JZ4A 2E26A 1UY3A 1WCQA 2VZPA 4A41A 3UESA 3I97A 2VZUA 3C8XA 1GOHA 5CZKA 5JXHA 4QPWA 3GGLA 2HLEA 4CU7A 2ID4A 3NQHA 2W87A 2WZ8A 3IB3A 3WF1A 4JKMA 1CZTA 4DEQA 1W0NA 2L9LA 3OGRA 1EUUA 2VCBA 3A7QA 4PT6A 4CU8A 2DDUA 3DYPA 3K77A 3HNBM 1K3IA 3OG2A 4ZZ5A 4QX0A 1UXXX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UY0 A;  2W92 A;  2QBX A;  4DUX A;  3K4A A;  3C7H A;  2WO2 A;  2ZEW A;  5I0D A;  2YFZ A;  3SKJ E;  3A22 A;  2WAO A;  5LA0 A;  1OF3 A;  3PUH A;  2QQJ A;  4W50 A;  4AG4 A;  2C9K A;  5C7G A;  5HPO A;  5LCW L;  4P02 B;  3I3D A;  4QB1 A;  2VM9 A;  2CDP A;  4BDV B;  3W5M A;  2YB7 A;  4CUB A;  4W4Z A;  3FN9 A;  2W46 A;  4OMC A;  2VZQ A;  1JI6 A;  2QQO A;  1JYX A;  3F2Z A;  3K75 B;  4CU6 A;  1GUI A;  4KMQ A;  3SEE A;  4ET7 A;  2XHN A;  5JXJ A;  4XUT A;  2VZR A;  1MPX A;  3LQC A;  1JYN A;  1R64 A;  2J1E A;  2WDB A;  3CDZ B;  3P1I A;  4QB2 A;  2Y6G A;  1BHG A;  2B9V A;  3A23 A;  3BN6 A;  5HXM A;  3VDB A;  2WAB A;  1JZ2 A;  2W9X A;  1H6Y A;  4ZY9 A;  3MUY 1;  5G05 L;  2RV9 A;  4M4R A;  2XON A;  3T2O A;  5DPN A;  1UYZ A;  5DQ0 A;  1W99 A;  2WN3 A;  2VMD A;  2RJ2 A;  4FI9 A;  3IAP A;  5LA2 A;  2VMF A;  1UY1 A;  2VQU A;  1K45 A;  3III A;  3C7G A;  4BK4 A;  1IQD C;  2VL4 A;  4DEV A;  2J1T A;  2X05 A;  2YFU A;  4XZU G;  3WNM A;  2VZO A;  1J84 A;  1GQP A;  4MGS A;  1O59 A;  4JX0 A;  2V5D A;  3I3E A;  4PF1 A;  2WN2 A;  1LNS A;  2VZT A;  2W95 A;  2Z4F A;  3LEG A;  4DUV A;  1OD3 A;  4ARY A;  2J7M A;  2VJX A;  4XUP A;  4A6O A;  2ZEZ A;  1T2X A;  1SDD B;  4PQQ A;  4QDR A;  1GMM A;  3T2P A;  2J1R A;  2DCK A;  3VD3 A;  3ACG A;  2WO1 A;  2LW8 A;  5DMY A;  4A42 A;  2VZ1 A;  3ACH A;  3LE0 A;  4MAD A;  5IYY A;  2VCA A;  1F4H A;  3A21 A;  3VDC A;  2Y6K A;  4LKS A;  4XVH A;  4OUE A;  3VD4 A;  2VZS A;  1PX4 A;  4GWJ A;  2J1V A;  1JU4 A;  2WQ8 A;  2C4X A;  2W1S A;  2X10 A;  4GWI A;  5EIY B;  4MO3 M;  3I2F A;  3HJR A;  2C26 A;  3SKV A;  1JZ8 A;  5JXI A;  1JYW A;  2EIC A;  4P08 A;  2VME A;  3WNL A;  3NJX A;  2RVA A;  2J1S A;  1UYX A;  4MGQ A;  4DXR A;  2JD9 A;  3VD7 A;  4LQR A;  4ZXE A;  3OBA A;  2DCJ A;  1JYV A;  3NRU A;  1XC6 A;  2Y6J A;  5IHR A;  2VR4 A;  4BJ0 A;  4YPJ A;  5JXG A;  2W94 A;  1PMH X;  3T08 A;  1OH4 A;  1PX3 A;  2WO3 A;  3ABZ A;  1W9S A;  3NJV A;  3OGS A;  1WKY A;  4L0P A;  1PMJ X;  2ZEY A;  3D3A A;  2V4V A;  1O8P A;  4A44 A;  1D7P M;  4JKK A;  5A1A A;  4DXS A;  3DYM A;  3I2K A;  5EJ1 B;  1JZ6 A;  3K4D A;  2EID A;  3ACI A;  3LPF A;  2B4K A;  4ZZ8 A;  3CZU A;  3OEA A;  3MO4 A;  2W91 A;  4DUW A;  3WF4 A;  3HNY M;  4UI9 L;  2J1U A;  2ORX A;  2EIE A;  4QB6 A;  1CZV A;  3FL7 A;  2J1A A;  2LS6 A;  2WUH A;  1I5P A;  3ECQ A;  2W1U A;  4CVU A;  3I2G A;  3OB8 A;  3ETP A;  2BER A;  1JHJ A;  1GU3 A;  3CIH A;  3WNP A;  3U37 A;  1CIY A;  3WEZ A;  1DYO A;  3W5N A;  2YC4 A;  1F4A A;  1K42 A;  3CQO A;  3WQB A;  2QQN A;  1W9W A;  3WF0 A;  4TTG A;  3JXS A;  1L7Q A;  1ULP A;  3I3B A;  3T0D A;  1RYY A;  3DYO A;  3IDA A;  1W8N A;  3EB7 A;  4KI5 M;  4KWU A;  1XNT A;  3VD5 A;  4RYD A;  4LHS A;  3ACF A;  3J7H A;  3MV0 1;  2Y6H A;  4QAW A;  3BGA A;  1UZ0 A;  4TXW A;  4A45 A;  2W47 A;  1XPW A;  1NKG A;  5B4X A;  2VC9 A;  2JDA A;  2VZ3 A;  1US2 A;  3K46 A;  1W9T A;  3T0B A;  1JZ7 A;  2ZEX A;  2E31 A;  3UET A;  3WNK A;  1CX1 A;  2Y8K A;  2BBA A;  3C7F A;  5F7U A;  3I2J A;  2VQT A;  2W5F A;  3ZM8 A;  2QQM A;  1XNA A;  3WF2 A;  3HPN A;  2JE8 A;  2OKX A;  3T09 A;  4AAX A;  2E32 A;  2ZXQ A;  3T2Q A;  3HN3 A;  3OGV A;  4E8C A;  4RN5 A;  4OZO A;  2BGP A;  2ORZ A;  3LEI A;  4E8D A;  2WYS A;  4Z2A A;  2VCC A;  2Y64 A;  3LPG A;  2KD7 A;  3THD A;  3K4Z A;  2QQI A;  2YC2 A;  1JU3 A;  3CMG A;  1UMH A;  4GZ9 A;  4MOA A;  2WBK A;  3P6B A;  5IJR A;  5B4N A;  5C71 A;  5G04 L;  1UYY A;  1ULO A;  2BGO A;  2R7E B;  4LPL A;  5IFT A;  4QDQ A;  3I2H A;  1JZ5 A;  2PQS A;  3VDA A;  3GM8 A;  4A4A A;  1JZ3 A;  1TG7 A;  2W1W A;  3MBW A;  2EIB A;  5EJZ B;  1CZS A;  4ARX A;  5J1X A;  5IFP A;  3WF3 A;  4W8J A;  1OF4 A;  3HOB A;  2W1Q A;  1NAE A;  4OYU A;  1J83 A;  2WAA A;  1K12 A;  4BK5 A;  4UAP A;  4XUQ A;  3GDB A;  1W8O A;  2VZV A;  1EUT A;  1KGY A;  2VO5 A;  2VTF A;  2HYX A;  3C7E A;  3WNO A;  2W3J A;  3VD9 A;  3WSO A;  1KEX A;  1UXZ A;  4QX1 A;  3SEP A;  3THC A;  1GNY A;  4HG6 B;  3MV1 1;  2V72 A;  1TVG A;  3CKH A;  4D8M A;  5DN2 A;  1UY4 A;  3HEI A;  2QQL A;  3IAQ A;  3PUI A;  1NUK A;  1GOF A;  2WZE A;  3OEB A;  1HN1 A;  3AC0 A;  3FHQ A;  1UY2 A;  4M4P A;  2XOM A;  1SG3 A;  3GXU A;  5C70 A;  4CUC A;  1OT5 A;  4JHZ A;  4P5Y A;  2J22 A;  1NX9 A;  3T0A A;  2YG0 A;  3LEK A;  2VOT A;  2E33 A;  1DLC A;  3DEC A;  3NNG A;  1DP0 A;  2JKX A;  2XQX A;  3I2I A;  1YQ2 A;  4D0Q A;  2X09 A;  2BZD A;  1UX7 A;  3CZJ A;  4QX2 A;  4CU9 A;  4DXT A;  4IUG A;  1GOG A;  3HNM A;  4QDS A;  3WNN A;  4UOJ A;  2VMC A;  4P00 B;  3E1F 1;  5LA1 A;  4BXS V;  5JMO A;  3EYP A;  4XUR A;  1H6X A;  4JKL A;  1US3 A;  5JR2 A;  5CYY A;  4A3Z A;  4XUN A;  1SHW B;  3C7O A;  4XUO A;  3MUZ 1;  3UNP A;  5JUV A;  1O8S A;  4CUA A;  1L7R A;  1UWW A;  1UMI A;  1P8J A;  2CDO A;  2QQK A;  2Y6L A;  4OMD A;  3FHA A;  5FUI A;  4QX3 A;  1JZ4 A;  2E26 A;  1UY3 A;  1WCQ A;  2VZP A;  4A41 A;  3UES A;  3I97 A;  2VZU A;  3C8X A;  1GOH A;  5CZK A;  5JXH A;  4QPW A;  3GGL A;  2HLE A;  4CU7 A;  2ID4 A;  3NQH A;  2W87 A;  2WZ8 A;  3IB3 A;  3WF1 A;  4JKM A;  1CZT A;  4DEQ A;  1W0N A;  2L9L A;  3OGR A;  1EUU A;  2VCB A;  3A7Q A;  4PT6 A;  4CU8 A;  2DDU A;  3DYP A;  3K77 A;  3HNB M;  1K3I A;  3OG2 A;  4ZZ5 A;  4QX0 A;  1UXX X; 
#chains in the Genus database with same CATH topology
 1AYN 2;  4BM8 A;  4CPB A;  1PZ8 A;  1E5I A;  2QBX A;  2OPW A;  1EV1 1;  1B35 A;  1YQ5 A;  5BYN A;  4CEW B;  5D8A B;  2WO2 A;  5GLW A;  3Q8B A;  1CES A;  2ZEW A;  1AYM 1;  1W0P A;  1GZ9 A;  4YVS C;  5I0D A;  3E6C C;  2YFZ A;  4OUL A;  1VAM A;  3A22 A;  3ITQ A;  4RGA A;  1QJU 2;  1VBE 2;  1TMF 2;  4FAG A;  2WAO A;  2PEL A;  4A7Z A;  3PUH A;  5KWR A;  1LED A;  1S2B A;  3GBG A;  4W50 A;  3RPQ A;  3AFG A;  5LCW L;  4P02 B;  2VM9 A;  1LHU A;  4ONU A;  1FMD 1;  2WT1 A;  5BY5 A;  4WV8 A;  1S0G A;  2D98 A;  2O1Q A;  3KCX A;  4W4Z A;  4KBZ A;  3SH5 A;  1LTE A;  4L99 A;  1LOF C;  5LRS A;  1LGC A;  4P9I A;  3DGT A;  4QKF A;  2G1M A;  4GWN A;  3F2Z A;  3OBR A;  3SIT A;  4MET A;  2XWB B;  4XYX A;  3W59 A;  1GUI A;  3ZFF B;  3ZIX A;  4KMQ A;  4ET7 A;  1POV 0;  2VGD A;  2Z69 A;  2OZ6 A;  3KMH A;  2F17 A;  1MPX A;  2VZR A;  3AZX A;  3BB6 A;  3FE5 A;  4PQ9 A;  5FPB A;  4EN7 B;  4L11 A;  3PJQ A;  2BTV C;  1U5X A;  2WDB A;  3MIC A;  1QU0 A;  1SEF A;  2ZZJ A;  3DV8 A;  3P1I A;  1AJK A;  3ST7 A;  4QB2 A;  2Y6G A;  4UFI A;  4A6S A;  1KXG A;  3MW4 A;  5FZF A;  4AVC A;  5C5T A;  2XXZ A;  4AI1 A;  1FV2 A;  2W9X A;  1W05 A;  1R09 1;  3VBS C;  4NAO A;  1JZ2 A;  3BU7 A;  3AXD A;  3Q9O A;  2JDH A;  4XFF A;  4ZY9 A;  3OCP A;  1NA1 B;  2HWE 3;  2IXI A;  2ZGR A;  2JG8 A;  3WP5 A;  4YM3 A;  4WM7 B;  1W99 A;  1CJD A;  3O1O A;  1J3R A;  2V4A A;  1LOB A;  5DAV A;  3PVN A;  2VMD A;  4C1W A;  3ZFE A;  3CLP A;  5LA2 A;  4AFD A;  1WZX A;  1UY1 A;  2WL1 A;  4O9G A;  5K8S A;  5F6K A;  2VNO A;  2FDI A;  2YZ4 A;  3III A;  2GC1 A;  3R6S A;  1V6N A;  2VL4 A;  4LBJ A;  2J1T A;  3ROU A;  3M3O A;  5KHG A;  5FJH A;  1DG6 A;  4LBQ B;  3VBU C;  2DFB A;  1TQ5 A;  1GP4 A;  5E1R A;  1NCQ C;  1O59 A;  2K46 A;  3VGI A;  3LDB A;  5KXB A;  4DZG A;  4YGB A;  1W6N A;  3I3E A;  3ZSJ A;  2WN2 A;  3NV3 A;  4IET A;  1LNS A;  2GAL A;  2VZT A;  1AXZ A;  3URF A;  2ET7 A;  1UD1 A;  2GND A;  2D6M A;  2VJX A;  2Z79 A;  1OA2 A;  3TAY A;  1SDD B;  4XMA A;  4FTB A;  5FKC A;  3ZOI A;  4BWO A;  3DPR A;  3KQ4 B;  5C6C A;  4CSW A;  3VD3 A;  2WO1 A;  2IZW A;  4QQ2 A;  1AR9 1;  3M3E A;  5LW9 A;  3ZIW A;  1VP6 A;  2VZ1 A;  4XIO A;  3SH4 A;  4IDZ A;  4GB3 1;  3LE0 A;  1UIK A;  1O5L A;  4MAD A;  3TN9 2;  5GZG A;  1YQC A;  3MEP A;  1FPN 3;  3A21 A;  5K0U A;  2WO7 A;  3L9J T;  2D5H A;  3UGF A;  4LKS A;  3RI8 A;  4KU7 A;  5FP4 A;  2VZS A;  1PX4 A;  4RS5 B;  1G9B A;  4Q4V 3;  4UBG A;  3BAL A;  3OJB A;  5FZH A;  5ABJ B;  1PM7 A;  5IVJ A;  1S0F A;  2R16 A;  2E7Q A;  3VHP A;  3H8U A;  4NE9 A;  5APA A;  1VMJ A;  3AYA A;  4JDO A;  1VE0 A;  4BME A;  2C4X A;  2W1S A;  5JOZ A;  1C8N A;  1V9U 1;  1OKO A;  2RS5 2;  5KHI A;  1QJX 1;  4AXO A;  3T4V A;  4C90 A;  2VQ0 A;  1VRH 3;  3WIN E;  2HWD 3;  2F4L A;  5JXI A;  3AP4 A;  3LFI A;  1XNC A;  3PNA A;  1OLR A;  4NO4 A;  4S2H A;  1CON A;  1PM4 A;  3QOP A;  2GP5 A;  1OFS A;  2VUC A;  1K5M B;  5FPU A;  5F5C A;  4MGQ A;  3J7N A;  1NCR A;  2JD9 A;  4RQP A;  2B39 A;  4LQR A;  1E57 A;  1IPK A;  3KLS A;  3ZXE A;  4CEY B;  4NAM A;  3AZV A;  1CGP A;  4YFW A;  5C8C B;  4LK7 A;  4TLF A;  1D4M 1;  4AGR A;  5F37 A;  2R06 2;  5IHR A;  1QF3 A;  2VR4 A;  2D6O X;  2Q5T A;  4BJ0 A;  5CFC B;  2Z2S B;  2VMI A;  4AED C;  4EWA A;  1UKG A;  3IBM A;  1QXP A;  3VL8 A;  3H7J A;  1S55 A;  4QKN A;  4GXL A;  4AHX A;  1RUH 2;  1O7F A;  1YWK A;  3FUQ A;  4PBO A;  1JTZ X;  3O5S A;  3NJV A;  3W9A A;  1C8M 1;  4L0P A;  1PMJ X;  1HV0 A;  1S0D A;  4C0H A;  1V6O A;  1YHF A;  3OPZ A;  4GMP 0;  4YG3 A;  1W6O A;  3N7K A;  5A3L A;  5B2G B;  4ES8 A;  3HQU A;  1AVB A;  1HB1 A;  4A44 A;  1YJL A;  1QJY 2;  1WLW A;  2V73 A;  3O12 A;  4FQZ A;  5A1A A;  2O8O A;  3ZDS A;  4CDW C;  3I2K A;  5EJ1 B;  3UJO A;  3VV1 A;  1S2K A;  4L9B A;  4ATE A;  3ACI A;  5FUP A;  1AYM 3;  4AVB A;  1GLH A;  4FFI A;  4I30 A;  4ZZ8 A;  3ZSK A;  3RZM A;  3VZK A;  2D3R A;  3CZU A;  4LKE A;  2VD7 A;  4LLO A;  5LY2 A;  4P9X A;  4V2V A;  2RM2 1;  1ZBA 2;  2GC3 A;  2A73 B;  2WT2 A;  5I91 A;  3W21 A;  2GSY A;  1AR6 2;  3B94 A;  2FDH A;  4IV1 B;  1L7L A;  1CAU B;  2PLV 3;  3WY6 A;  1OUX A;  1ZRI A;  4CDX B;  5FLH A;  4N53 C;  5C3P A;  4FPY A;  1WW5 A;  2WS9 2;  4ZS2 A;  1HV1 A;  1UQX A;  4YW7 A;  4LLF A;  4AOC A;  5DG2 A;  4JV4 A;  2E7T A;  2YBS A;  2EF6 A;  2D44 A;  3JQX A;  4K21 A;  5L9R A;  4D6R A;  5A1L A;  5CIR A;  4LO7 A;  4J1X A;  4XJ9 A;  2XHK A;  1RUJ 1;  3PMS A;  1ZRF A;  1SCS A;  1YFX A;  4IV3 A;  1KQR A;  1DGL A;  5L7O A;  4IE4 A;  1GP6 A;  3WEZ A;  3ZYR A;  1RUG 2;  3JD7 2;  1RUF 1;  3UJQ A;  2DBI A;  4HPK A;  2YXS A;  1BVP 1;  1YEW A;  2VY0 A;  2Z5W A;  3KV4 A;  4BYY A;  5BUV A;  3B7M A;  4CCN A;  4B4Q A;  5E89 A;  2ENR A;  5F6L B;  1R09 3;  3WQB A;  1FAY A;  2QQN A;  2QTW B;  4NRP A;  1AYN 1;  1AXK A;  1NG0 A;  1H4H A;  2PXJ A;  1C5H A;  1W9W A;  2WLP A;  3B02 A;  1HX6 A;  3NV4 A;  5FDB A;  1BEV 2;  1RVF 2;  1F8V A;  5JAX A;  2WZP P;  1W8U A;  3VBO B;  1W8N A;  3SLI A;  2ZPX A;  2XJP A;  4RR3 C;  1EYB A;  2ZCW A;  2DCT A;  4KWJ A;  3TNP B;  4YGC A;  4RYD A;  4LHS A;  4QPG C;  2UU8 A;  4V1P A;  3VHO A;  3J7H A;  3MV0 1;  2YBP A;  4UW3 A;  5FYT A;  1NT0 A;  3AVR A;  4MXW B;  3AB0 A;  2VXJ A;  2VUA A;  4B7E A;  4TXW A;  5IAT A;  4A45 A;  4QX7 A;  3RJ2 X;  5CKM A;  2VC9 A;  2JDA A;  2XR4 A;  1FX5 A;  1WMF A;  2JG9 A;  4Q4X 2;  2XVL A;  3K46 A;  1W9T A;  3WHT A;  4M3C A;  4FP2 A;  2ZGQ A;  5FZ6 A;  4BQY A;  5A3N A;  2C0Z A;  5HXV A;  2DFC A;  2AYH A;  5GLT A;  3C7F A;  3MHZ A;  4I0A A;  4IEQ A;  3I2J A;  2VQT A;  4YVS A;  1WW4 A;  4LO4 B;  5C4W C;  3ENR A;  1H8T A;  2VW0 A;  1XNA A;  2RS3 2;  3AMQ A;  3HPN A;  3POY A;  4M01 A;  2DCZ A;  4AQ6 A;  3T09 A;  1GSL A;  2RS1 2;  4AAX A;  3OD4 A;  1PK6 A;  4YW5 A;  1Q5O A;  2G19 A;  4NPR A;  1AR9 3;  2RMU 1;  2QQW A;  4AEJ A;  3AMP A;  3F95 A;  4Y1V A;  4GB3 3;  1CD3 G;  1REE A;  1TZO A;  5EYX A;  1Y43 B;  1BMV 2;  4E8D A;  4DMI A;  4QQP A;  4BH9 A;  1MVE A;  2E51 A;  3ASI A;  1RMU 2;  1ND3 B;  2AZ5 A;  3KHB A;  5FZB A;  1LU1 A;  2Y64 A;  4AEM A;  3TEY A;  2BJS A;  4AGG A;  4CCL A;  2YC2 A;  1Y9Q A;  1JU3 A;  3TEW A;  1UMH A;  1OOP B;  3NJY A;  1POV 1;  3AKP A;  3MPP G;  5IUQ A;  4BQ3 A;  3VKM A;  5FYS A;  5IJR A;  4S2D A;  5B4N A;  5C71 A;  1V9U 3;  1GKB A;  1UYY A;  1YRZ A;  3E5U A;  1QJX 3;  4H14 A;  1QMJ A;  3ZPY A;  4DB5 A;  1UPS A;  3ZXL A;  2WWJ A;  2I07 B;  4JGZ B;  2XDV A;  1HN0 A;  3DF0 A;  1VBA 3;  4GAL A;  1Y4W A;  3IPV B;  4JRA A;  3GCX A;  1FPN 2;  4XFA A;  1DCS A;  2A3X A;  4F3J A;  5IK8 A;  3GM8 A;  2VOV A;  4A4A A;  3RI9 A;  4XMI A;  4DXZ A;  3APB A;  1YLL A;  4H55 A;  3MW2 A;  3HN1 A;  5CG8 A;  2O14 A;  3CU7 A;  5JMC A;  4LIV A;  3W58 A;  5IVE A;  1OXC A;  2VU9 A;  5AFE A;  3WF3 A;  5A3M A;  1O4Y A;  3DKQ A;  2K0G A;  4EE2 A;  5DDJ 2;  4ZU4 A;  1OLM E;  3D6E A;  1NAE A;  3WDT A;  2CGO A;  2F4P A;  2QDN A;  3GDB A;  2VUD A;  3UT0 A;  1VRH 2;  2VZV A;  4GJY A;  4AI9 A;  4H2A A;  1ACC A;  4RGK A;  1ZZ9 A;  3VBU A;  1OQE A;  2BOJ A;  3I2D A;  1GR3 A;  1AUY A;  1BLZ A;  2JB8 A;  4O65 A;  2P5B A;  3TN9 1;  5FYZ A;  3WW3 A;  1GZW A;  1UYP A;  3I59 B;  3ZKY A;  2HEV F;  1CAW A;  3HMY A;  1GV9 A;  1UXZ A;  2JDM A;  3POB A;  3VKF C;  4K20 A;  2P6C A;  1ZRR A;  3MLK A;  1Q8P A;  4CPB D;  4G4F A;  4R52 A;  1WCU A;  3UKT A;  4Q4Y 2;  4NWW A;  1UZY A;  1STM A;  1B35 C;  2AC1 A;  2NMO A;  4HN1 A;  4KH9 A;  4CEW A;  2RS5 1;  2JIG A;  1W2T A;  1DQ1 A;  2UUR A;  3S6P A;  3EMR A;  3FHQ A;  1UY2 A;  1WMD A;  5FPX A;  4P9L A;  1S0B A;  5I0R A;  3U78 A;  1WBL A;  1RED A;  2RM2 3;  2XOM A;  3JU9 A;  2E53 A;  3AP9 A;  3HT2 A;  5I0T A;  4CUC A;  5F1R A;  5KXD A;  1E5S A;  3H42 B;  2Q8E A;  3ZFG B;  4JHZ A;  4Y1U A;  3EJK A;  3T0A A;  1FOD 2;  3DCQ A;  5JIA A;  3BTY A;  2VOT A;  4IEO A;  2XJQ A;  1C5I A;  3DEC A;  5FKB A;  1JYI A;  1HB4 A;  3M70 A;  1SDW A;  1DP0 A;  1EV1 2;  2JKX A;  5KHH A;  4F83 A;  2WKK A;  5T54 A;  3CHX A;  5T3N A;  1AYM 2;  4OFG A;  3WOG A;  4R8H A;  3ZFF A;  4QQO A;  3B3Q E;  5LWB A;  2XQX A;  2NZ9 A;  2W08 A;  3I2I A;  4CZS A;  4QMA A;  3O1P A;  1RUJ 3;  3BIW E;  3SC7 X;  3JBG 3;  1UX7 A;  4QX2 A;  4UFM A;  2X5I B;  1RUF 3;  2JX9 A;  3K48 A;  4HSL A;  1ONA A;  1MS5 A;  2R49 A;  2DUP A;  4QDS A;  1FMD 2;  3KS7 A;  3N9L A;  2DVD A;  4LIT A;  3WP6 A;  4E4Z A;  3SCG A;  5F3C A;  5FOJ B;  3HQX A;  1K5J A;  2ARA A;  2RDR A;  4LHK A;  5FZL A;  3CJX A;  1ND2 C;  1AYN 3;  2Y0I A;  5KR7 A;  4IGP A;  3RMX A;  2QVS B;  1APN A;  1NA1 A;  3K3N A;  5T52 A;  3THP A;  4FPJ A;  3W20 A;  3WX5 A;  1SLI A;  4D7S A;  3H3U A;  4MXV A;  4NWV A;  4QXC A;  4S2G A;  4WM7 A;  4RA0 A;  4W6Y A;  1RIT A;  4W65 A;  4HFS A;  5CYY A;  2ZX0 A;  4XUN A;  4F8A A;  4FTS A;  1YFU A;  3ZO0 B;  2C1F A;  1QJU 3;  1YI7 A;  1QWR A;  1TMF 3;  1VBE 3;  3Q8C A;  2KXL A;  4CUA A;  3UNP A;  3MI8 A;  4HVR A;  2CDO A;  2Q8D A;  3GZT B;  3BYW A;  2Y6L A;  2BNM A;  5D21 A;  4BB3 A;  4GMP 1;  1DQ5 A;  4OMD A;  3M3C A;  4GJZ A;  4Q2F A;  1F9K A;  2E26 A;  1UY3 A;  4BQ2 A;  3P3N A;  2D3P A;  3I3Q A;  5I8S A;  4R4X A;  1FT9 A;  1O5U A;  2XJU A;  5LRR A;  2WS9 1;  2ZX4 A;  5JXH A;  3RZJ A;  2HLE A;  3MIG A;  1ZBE 1;  5FXW A;  4C8D A;  3NNJ A;  2VMG A;  3WF1 A;  1JYC A;  5C8W A;  1VBC 2;  2D3S A;  4X8N A;  4MGI E;  2UY9 A;  3WV6 A;  1O3R A;  2NP0 A;  2KA3 A;  2VXR A;  3O7O A;  1W3X A;  1KS5 A;  2YV8 A;  3CL1 A;  4CU8 A;  4GH4 B;  1VMH A;  4RFR B;  1DIW A;  3HNB M;  3K77 A;  3DXT A;  4ZZ5 A;  1XYN A;  1AL2 1;  3WXP A;  2HJI A;  4N53 A;  2K9Z A;  3UKN A;  4LO5 B;  1UZV A;  1H2N A;  2C24 A;  4FT8 A;  4XAC A;  1UY0 A;  5A7Q A;  5K0U C;  2IFW A;  1N3P A;  4IE5 A;  4JQT A;  4Y20 A;  2XWJ B;  4OHY A;  3OY8 B;  3NNL A;  4DUX A;  2NN8 A;  3K4A A;  3AP6 A;  1BEV 1;  1POV 3;  5ABJ A;  2R0H A;  4CP0 A;  2CGP A;  1MR5 A;  1BK0 A;  4QXK A;  3NWK A;  3RWK X;  3WW1 A;  5EWS A;  5BNO B;  4HKO A;  3E6B A;  3VHN A;  1OF3 A;  2P2K A;  2Y0O A;  3POG A;  4FBF A;  1DFQ A;  2QQJ A;  5FMB A;  4AG4 A;  4I09 A;  1R1A 1;  5GLU A;  3H1W A;  1CIW A;  4RGG A;  4IEV A;  1J58 A;  3Q8A A;  4GB3 2;  2CDP A;  3KT7 A;  4Y3O A;  1NZC A;  2XML A;  2YB7 A;  3ZSE A;  3BPZ A;  4CUB A;  4XDQ A;  5LY1 A;  3V0A A;  2SLI A;  2BEO A;  1OSG A;  2BFU L;  3VUO A;  3FN9 A;  1J3Q A;  2W46 A;  2VZQ A;  3GHN A;  1PVC 2;  4H7M A;  1NCR C;  1JI6 A;  1KDK A;  1XB9 A;  2CY6 A;  4RR3 A;  5FXV A;  3POF A;  3OGJ A;  2PQQ A;  3SEE A;  2XJT A;  3T2T A;  4CEY A;  5JLV A;  1AXY A;  4UW4 A;  4I0W B;  4GA9 A;  4XUT A;  4AI3 A;  2RS3 1;  5JXJ A;  2WNO A;  3H1Y A;  1F35 A;  2RS1 1;  5CB7 A;  3R4S A;  4Y26 A;  2VBB A;  3WUC A;  4LHL A;  4LXL A;  3I7D A;  4JDN A;  1BHG A;  2IUW A;  1DDL A;  5DUX A;  3A23 A;  3TN9 3;  4CCJ A;  1PIV 1;  1KFU L;  2DVF A;  1Z7S 2;  1RMU 1;  1H6Y A;  4AFB A;  5G05 L;  1IOA A;  3OD0 A;  1W8Z A;  2XON A;  1NQD A;  3DUI A;  3KCC A;  4GKX A;  4YW6 A;  4HZF A;  2EAL A;  2NM1 A;  5DQ0 A;  1W2N A;  5C4W A;  2WN3 A;  2XPJ A;  1HRV 1;  1ZZC A;  5JR7 B;  3Q8F A;  2YYO A;  2RJ2 A;  4FI9 A;  4YM1 A;  2QJV A;  3WR0 A;  1D4M 2;  2VMF A;  1W6P B;  2RS5 3;  2VQU A;  5BNP B;  3VDD C;  2DF7 A;  4LOS A;  1C1F A;  1REF A;  1CQ9 A;  2OII A;  1OVP A;  3C7G A;  1IQD C;  2F6B A;  5F8P A;  4BK4 A;  4BLJ A;  4JC1 A;  4XPV A;  4DEV A;  1JOB A;  2VOW A;  3LD8 A;  5FUN A;  4DRV A;  4Q1R A;  5A32 A;  1Z78 A;  5FY8 A;  4XZU G;  4DRR A;  4Y5Z 0;  4BQ4 A;  1S0E A;  4NRQ A;  3ZN5 A;  1PO2 2;  1GFF 2;  4LK6 A;  1HLC A;  1C8M 2;  4CUG A;  1I1E A;  4IV1 A;  5EPA A;  2V5D A;  4PF1 A;  3FFZ A;  1V6K A;  3MIE A;  1CAU A;  4S2F A;  1G7Y A;  1LOG A;  5IVF A;  3WQ7 A;  3HAG A;  4Y33 A;  4DUV A;  3NVC A;  3WD5 A;  3ZN6 A;  1ZZ8 A;  3WG3 A;  4XXA A;  4WZF A;  4A6O A;  5C3R A;  1T2X A;  3IMN A;  4XFI A;  3H9A A;  4PQQ A;  5FXX A;  4LMF A;  2P1B A;  1ULF A;  2EXH A;  3MZH A;  3T2P A;  2FDJ A;  3POS A;  3PVE A;  2Q4S A;  2DCK A;  3LIG A;  4AGV A;  5CKN A;  4E4D X;  4FPF A;  4IQP A;  4A42 A;  4AHZ A;  1HQN A;  4Q0V A;  2ZBJ A;  3ACH A;  3SNM A;  5FWJ A;  5L7O C;  4YFZ A;  1IQA A;  5IYY A;  1RUH 3;  5ANQ A;  5A33 B;  2AR6 A;  2XL7 A;  4IE7 A;  2I45 A;  4XAB A;  4K1Y A;  2NLR A;  4R9D A;  3LDR A;  1UO9 A;  3D8C A;  3AMH A;  3VD4 A;  1H0B A;  4KGG A;  1QJY 3;  1UF2 C;  4YSF A;  2J1V A;  4HLT A;  3CO2 A;  2WQ8 A;  3T1L A;  5CAD A;  2X10 A;  4GWI A;  2RR1 1;  3RQ0 A;  3TRS B;  2BGC A;  2ES3 A;  3VBO A;  4EQV A;  3HJR A;  1WCK A;  5HCA A;  2JDP A;  1QKQ A;  4XFG A;  4RFT 0;  3SKV A;  1JZ8 A;  3ZXG A;  1GQH A;  4MX3 A;  2LRO A;  3VZJ A;  3THT A;  5JOX A;  1CVN A;  1KDM A;  1ZBA 3;  2XLA A;  1N1S A;  2PHL A;  1A3K A;  3NJZ A;  2WWU A;  4MXW A;  3WP3 A;  4GMP 3;  1YNA A;  1AR6 3;  3NJX A;  5A7P A;  5E88 A;  2R04 2;  3WNL A;  3AYC A;  3PIG A;  4QWN A;  2J1S A;  5CG9 A;  3BOW A;  4DXR A;  1FOD 1;  2XGX A;  3MIH A;  5FPV A;  4OQ8 A;  1BK1 A;  1QDO A;  4XBQ A;  4NJ4 A;  5FFO C;  3VD7 A;  4FOY A;  4DS0 A;  3EHK A;  4J6G A;  3FLR A;  2WS9 3;  4PIY A;  3OBA A;  2CV6 A;  2XBO 1;  4A7Y A;  1XU2 A;  2XJR A;  4G3Y C;  3V56 A;  1JW6 A;  3AM2 A;  1F5J A;  2VAU A;  3ETQ A;  1AHS A;  5FZ0 A;  2W94 A;  1H8T C;  2VNG A;  1IS6 A;  1N1V A;  3T08 A;  5GLZ A;  1OH4 A;  3RJR A;  4YNI A;  4XCB A;  1RUG 3;  4YGD A;  3JD7 3;  5DG1 A;  1PK6 C;  4YVW B;  5LBF A;  1JOD A;  3OGS A;  1IG3 A;  1WKY A;  2Q0A A;  2BDR A;  1AR7 1;  2YBK A;  4IEU A;  2E6V A;  1LR5 A;  3D3A A;  1AL2 3;  2V4V A;  1LEC A;  1WMX A;  1JMU B;  1LKN A;  1ND3 A;  4XIK A;  1N1Y A;  5FK7 A;  4LHN A;  1JZ6 A;  2GH8 A;  2ZZQ A;  4IES A;  4AWD A;  5T5P A;  4LE4 A;  4WVZ A;  3VZN A;  1BEV 3;  1OOP A;  1RVF 3;  1RUE 2;  3GBW A;  2EID A;  3IDC B;  4NMI A;  5J3U A;  3N7J A;  2XKO A;  1H8V A;  4LUM A;  3HD8 B;  3C2U A;  1YUD A;  3ORJ A;  4TZD A;  5FOB B;  4YRD A;  4COY A;  3OEA A;  5FQ0 B;  1W04 A;  4DUW A;  4LA2 A;  3AZY A;  3HNY M;  3VBF B;  2RMU 2;  5CNA A;  4GAZ A;  1R1A 3;  4B8E A;  2EIE A;  2ZGU A;  1GWM A;  3IMM A;  2DTY A;  2D6N A;  3IPV A;  3AJZ A;  4I01 A;  2UWA A;  4Q4X 3;  4OQ9 A;  4ES9 A;  2LS6 A;  3AFK A;  1GYK A;  1ND2 A;  3ECQ A;  2W1U A;  5JSR A;  3K3O A;  2HBT A;  2LAL A;  3ETP A;  5FO9 B;  5K7P A;  2PYT A;  1W3V A;  2BER A;  4UW5 A;  2H0V A;  4UXA A;  5JWP A;  1GU3 A;  1NXM A;  4Z07 A;  3WNP A;  2W2I A;  1ZZ7 A;  2Z42 A;  2RG4 A;  1ZZB A;  5C9A B;  4JVA A;  3NAP B;  3U14 A;  1VPH A;  1VBC 1;  1XSR A;  2RS3 3;  2WFP A;  1SBE A;  3RYR A;  5LZ6 A;  2P34 A;  2WWS A;  1NLS A;  2RS1 3;  1HKD A;  1DYO A;  4HKW A;  4RHV 1;  3W5N A;  4M0H A;  4X8P A;  5DAB A;  4JGY B;  5LAS A;  3O14 A;  1F4A A;  5FZE A;  3WNX A;  5F32 A;  1PIV 3;  3AKT A;  3I59 A;  3CQO A;  2DVG A;  3VB9 A;  1RMU 3;  2R6Q A;  3POE A;  3D5O A;  3N7L A;  4ZON A;  3LGR A;  2MHF A;  4NHK A;  5LA9 A;  3WCR A;  4EJR A;  1WLC A;  2PHT A;  2WT0 A;  1FNY A;  2EXI A;  2GC0 A;  1QY4 A;  3EB7 A;  5JZG B;  2FCT A;  1H30 A;  3VD5 A;  3IZO A;  3ZXK A;  1DYK A;  2I2S A;  4GIQ A;  4UFJ A;  4CEW C;  5D8A C;  5HCF A;  2ZML A;  3QH6 A;  2Y6H A;  5F5A A;  3UYJ A;  1WLD A;  1UZ0 A;  2RE9 A;  5FZ8 A;  5AFB A;  1AX0 A;  4C1X A;  1QIQ A;  1UMZ A;  4CCC A;  1XPW A;  1NKG A;  5B4X A;  2PMW B;  1URX A;  1RJ7 A;  1W8H A;  1US2 A;  1LUL A;  4PDW B;  2O8Q A;  2VUL A;  3NW4 A;  2EVX A;  1JZ7 A;  2ZEX A;  3I8T A;  3KM5 A;  3KVB A;  3L2H A;  1JUI A;  1SMV A;  2DCY A;  4YZ5 A;  3WNK A;  1CX1 A;  3PLQ A;  2Y8K A;  2CHH A;  2AEZ A;  1Y7B A;  1PVC 1;  3KSC A;  4YZ1 A;  5F7U A;  2W5F A;  3BTZ A;  3NST A;  3I4I A;  3RZZ A;  3GJB A;  2QQM A;  3ZM8 A;  5DDJ 3;  5FMD A;  2OUJ A;  1O3S A;  3WF2 A;  1S0C A;  2RJK A;  2JE8 A;  4IEZ A;  2ARB A;  4CDU B;  2ZHL A;  3ZFF C;  3NO8 A;  4LBN A;  2ZX2 A;  3PVO A;  4AFA A;  4N7U A;  5T55 A;  1UU5 A;  2E32 A;  3T2Q A;  2FZ2 A;  5L73 A;  3OGV A;  4RSU A;  3HBZ A;  4E8C A;  1MQT B;  4CCK A;  4FP3 A;  3LOI A;  2X5I A;  2VPV A;  4OZO A;  2QQP A;  4IGQ A;  1GZT A;  5HBA A;  5EQU A;  1SFP A;  4Z2A A;  3U0Z A;  3J4U H;  1Z7S 1;  1V00 A;  4HXC A;  4PI2 A;  4XQW A;  5F2S A;  3RZK A;  4GZ9 A;  1UCX A;  3KGZ A;  4HVO A;  1SFY A;  2A7A A;  3GHM A;  4Q4Y 3;  4JTN A;  3BOD A;  3MDP A;  4UT5 A;  1OI6 A;  1NA1 C;  2ZMK A;  2XB6 C;  3LA3 A;  5FMO S;  3JZV A;  1DF0 A;  1ULO A;  4WM7 C;  2TUN A;  4FCA A;  1OLQ A;  4P5H A;  5TSW A;  1ALY A;  2IVJ A;  4QHO A;  5FZD A;  5L9B A;  3WUD A;  1KJL A;  5FO8 B;  2ATF A;  4NOT A;  3I2H A;  2FCV A;  3NKT A;  5I8T A;  5IVC A;  3KZ4 C;  1RIR A;  4KGQ A;  1U12 A;  5LK5 A;  4GUL A;  1NE4 A;  1PO2 1;  2PQS A;  3UL2 A;  3USS A;  4R9A A;  1JZ3 A;  5D2A A;  2W1W A;  4CRQ A;  1ENS A;  2VNV A;  4MSV A;  3U4S A;  3ZYB A;  3MBW A;  4W6X A;  1FOD 3;  1VB2 A;  1UOB A;  1MZ5 A;  2ZAH A;  4MGT A;  2LTN A;  1D0H A;  1CZS A;  2AEN A;  5GZC A;  1EV1 3;  2VTX J;  3O1S A;  5K9Y A;  1SLB A;  1Q8S A;  2W1Q A;  2XBO 3;  4XDO A;  1J83 A;  3VDD A;  1YCI A;  5FY0 A;  1NQJ A;  3J7M A;  4CP9 B;  4BE3 A;  2VNR A;  1EUT A;  4HMZ A;  2DTW A;  1KGY A;  4CCO A;  3RZH A;  2OQ6 A;  4AFC A;  3H8X A;  4QPY A;  3C7E A;  3X29 B;  1COV 2;  3O0V A;  3WW4 A;  5GKA C;  1YFW A;  2FHR A;  4ATF A;  1AR7 3;  3SEP A;  1FMD 3;  2FZ1 A;  3FC0 A;  2QDR A;  1TVG A;  3USU B;  1UY4 A;  3HEI A;  1TNF A;  1NLQ A;  4RS5 C;  3OY8 A;  1ZBE 2;  2QQL A;  3IAQ A;  5ABJ C;  2WRA A;  1NUK A;  4BZ4 A;  2WZE A;  1F15 A;  3LF7 A;  5L9V A;  3AC0 A;  1J59 A;  3M3I A;  5BNO A;  2HWB 1;  5FZ9 A;  5J36 A;  4NPM A;  5IK4 A;  1SG3 A;  1X9P A;  3GXU A;  3IKW A;  3WDU A;  4UFK A;  1QEX A;  4KWK A;  3UGH A;  2R04 1;  1OT5 A;  4AW7 A;  4FXK B;  4P5Y A;  3AMM A;  4QD2 A;  1AL2 2;  2CSG A;  2YG0 A;  3GF6 A;  1FYU A;  5A80 A;  3ZYP A;  5KHK A;  2E33 A;  1DLC A;  3NNG A;  4AFM A;  4WM8 B;  3VZO A;  2B45 X;  3OF1 A;  4DO0 A;  5KC6 A;  1HXS 2;  1K5M C;  2HEY F;  5F9T A;  2JD4 A;  4XDP A;  2V5Y A;  2BFU S;  3GJA A;  2PAE A;  1VBB 1;  4IND A;  4PIX A;  4OZX A;  2BV4 A;  5I8Y A;  4NR1 A;  3AK0 A;  3BUC A;  5D1I A;  4CEY C;  1VBC 3;  3FUO A;  3M2M A;  3MYX A;  3JB8 A;  3ON7 A;  2QZ3 A;  4HT1 T;  3OYW A;  2X09 A;  2UYB A;  4EN6 B;  2GU9 A;  3RYK A;  5C8C C;  3RWN A;  5JIU A;  4RHV 3;  1SLT A;  4OI0 A;  1S4C A;  3FFQ A;  3LSE A;  1R1A 2;  5CFC C;  2ARX A;  1GOG A;  4J1W A;  3SXW A;  2JWP A;  2ARE A;  2KM2 A;  2ARC A;  1UOF A;  4X6R B;  1LOD A;  5CBL A;  4P00 B;  3E1F 1;  4NHL A;  4Q29 A;  4BXS V;  4FPE A;  5JMO A;  2VCM A;  3VBH B;  3EYP A;  1QXJ A;  4UFH A;  1RUE 1;  5J37 A;  1VAL A;  4CP2 A;  1SBF A;  1N3O A;  1SHW B;  1DLL A;  1C4R A;  2QFE A;  4WVM B;  3H8R A;  1O8S A;  3ILF A;  1W6P A;  5BNP A;  1UWW A;  1P8J A;  2UYA A;  3G6J B;  5FZO B;  1OPM A;  3ZXF A;  1OQD A;  4Q4W 2;  3JUU A;  4AI0 A;  5KHJ A;  1D2S A;  3M8L A;  5FUI A;  3PUQ A;  2RDN A;  2Y33 A;  1PIV 2;  1S0I A;  4LTA A;  4P9Y A;  1EY2 A;  1RJ8 A;  2VZP A;  4G9S B;  4Q27 A;  4Y22 A;  5FZI A;  3HIF A;  4IV1 C;  3I97 A;  1GOH A;  1PVC 3;  1W9Y A;  3GGL A;  5FZ1 A;  4IL7 A;  2BQP A;  3ACL A;  3KQR A;  3B9I A;  3LIH A;  4LJH A;  4QGM A;  1HRV 2;  4CDX C;  2G9Z A;  2WA4 A;  3N7M A;  4HKL A;  4XCA A;  1JHN A;  3U4X A;  2ET1 A;  3IB3 A;  2JE9 A;  4OI1 A;  4JKM A;  1CZT A;  3SMH A;  3ZYF A;  5ISL A;  4BQ5 A;  2DUQ A;  2WIN B;  2XLF A;  1NYW A;  3A7Q A;  5C3Q A;  3ZVX A;  4MVT A;  1VBD 2;  2DDU A;  3DYP A;  2ZS6 B;  4BLI A;  3N4M A;  3FWE A;  3OG2 A;  4Z1V A;  2FD8 A;  1FI2 A;  3KGL A;  4FPH A;  4QX0 A;  2Q30 A;  5A33 A;  1UXX X;  1Z7S 3;  2HWF 1;  5FYB A;  4JHT A;  2OVU A;  5FXZ A;  3V0B A;  4XHX A;  2ZKL A;  4I2O A;  1EAH 2;  2VTX A;  4E2S A;  3Q8E A;  5FZM A;  4Y24 A;  3C7H A;  4V2W A;  4AVT A;  1WCD J;  1HB2 A;  3SKJ E;  4ERO A;  4HK9 A;  1H2L A;  4LE3 A;  1J3P A;  1D4M 3;  2VEC A;  4C91 A;  5LA0 A;  1KIT A;  2WR9 A;  3VBO C;  3NKG A;  2P3I A;  4KNC A;  1TE1 B;  1YI9 A;  4XJZ A;  5C7G A;  5HPO A;  3MPB A;  4YYO A;  5DZF A;  4BU2 A;  4QB1 A;  5A6Z A;  2D97 A;  4BDV B;  4Z2W A;  3W5M A;  2WNV B;  2Y6F A;  4LUK A;  4N43 B;  1PO2 3;  4UBH A;  5CKQ A;  3KWV A;  5SV5 A;  1C8M 3;  4GQ7 A;  2JG8 B;  3GYD A;  1HDK A;  1AR8 2;  2C9A A;  5FP3 A;  4LEJ A;  4OMC A;  1O91 A;  4B1L A;  3RMY A;  5FPA A;  2MEV 1;  3PU3 A;  3ZFE B;  1T6B X;  2QQO A;  4D3W A;  1OH3 A;  3K75 B;  1JYX A;  1XNB A;  1IKP A;  3A4U A;  4YW2 A;  3BOP A;  3VBR B;  2XHN A;  4FFH A;  1A78 A;  3R4U A;  5A6Y A;  1JYT A;  2RR1 2;  5D8A A;  1DGW X;  4LR4 A;  3CJI B;  3H1M A;  4Q0U A;  4MUV A;  4M3C F;  1VJ2 A;  1W9F A;  1R64 A;  1R08 2;  2YGM A;  3AZW A;  1LEM A;  4E9K A;  4IXL A;  1S0J A;  2GC2 A;  4WVW A;  3CDZ B;  3BKZ A;  2A6X A;  4C0B A;  4MG2 A;  2DWR A;  3T4H B;  5HXM A;  3VDB A;  2WAB A;  5C3S A;  4NID A;  2HWC 2;  3SCF A;  1DZQ A;  1OPO A;  3MUY 1;  3RS6 A;  1CJP A;  5A3O A;  4M4R A;  3T2O A;  4Z92 B;  3HT1 A;  4HBN A;  1RUO A;  4PI0 A;  3RGB A;  3ZDV A;  2XJV A;  3DPR B;  2A6V A;  4NIH A;  1ND3 C;  3O0X A;  2EA7 A;  1H9P A;  1OQ1 A;  2XBO 2;  5CFD A;  3ZR6 A;  1OOP C;  4ZU5 A;  4XTM A;  4PF5 A;  5FV3 A;  1PMI A;  2VOK A;  2UWC A;  4CCM A;  5FQ0 A;  1MZ6 A;  3LCP A;  2YFU A;  2HWB 3;  2QZ2 A;  3WNM A;  1W28 A;  3VBF A;  2VZO A;  1J84 A;  3N9Q A;  4QX5 A;  4EWD A;  1A8M A;  4OUM A;  1NE6 A;  1AR7 2;  4JGZ C;  4JX0 A;  2A6W A;  2R04 3;  3EBR A;  1RTV A;  4IW3 A;  1BXH A;  2ETE A;  1AX2 A;  2YC0 A;  3H3L A;  2HYK A;  3KT4 A;  2OX0 A;  2AGS A;  2Z4F A;  3S5Q A;  4UFL A;  1OD3 A;  4ARY A;  2J7M A;  1WUV A;  2WSV A;  5HCB A;  4XUP A;  1BJQ A;  5GZF A;  2CAU A;  1V0A A;  4OLL A;  4QM8 A;  3N36 A;  4XQD A;  4QDR A;  3LFM A;  3SH3 A;  2PFW A;  2GME A;  3ME2 A;  1SAC A;  5CAZ A;  5LBC A;  3ACG A;  3BI3 A;  2FCU A;  2JIC A;  2ZGS A;  2LW8 A;  5E16 A;  5DMY A;  1IG0 A;  1ODM A;  3E6D A;  1QQP 1;  5HV4 A;  2CL2 A;  5A7W B;  1COV 1;  1F4H A;  4RQP B;  3VKL A;  3VDC A;  5EZW A;  4LBQ A;  2Y6K A;  4JGY A;  4OUE A;  4NIG A;  1SLC A;  3GCW A;  1D0G A;  2DU0 A;  4LOT A;  2OYZ A;  3WDW A;  4XC9 A;  1RUI 2;  1X33 A;  4GWJ A;  5A7O A;  1XU1 A;  1W6M B;  2D40 A;  4FVV A;  1D2Q A;  1AF9 A;  4XFB A;  1I6X A;  4ZS3 A;  3TEX A;  4BIO A;  5EIY B;  1RUE 3;  1PO1 2;  4PJY A;  4MO3 M;  4AE2 A;  3S0M A;  5A7N A;  5JZG A;  3WG2 A;  2WNU B;  5L36 A;  2C26 A;  2WZR 1;  4YZ3 A;  1LHV A;  1LCL A;  5KXC A;  3O1V A;  1PVX A;  3HQR A;  2RHP A;  4RHV 2;  2EIC A;  1V6J A;  1W8T A;  5FJK A;  1N1T A;  3WQ1 A;  1JYW A;  1TNR A;  3WG1 A;  1JN2 P;  2RMU 3;  4P08 A;  1XYP A;  5LBE A;  1XQN A;  2VME A;  1D4V B;  4B4R A;  2ADE A;  2RVA A;  3MF9 A;  4RL7 A;  4SBV A;  1UYX A;  1RXG A;  4YG6 A;  2WC2 A;  4PDW A;  3POW A;  1W6Q B;  1I5Z A;  1UL9 A;  4COU A;  1JOP A;  3ZFG C;  4EZH A;  4ZXE A;  4RS5 A;  1HXS 1;  3OPW A;  1MS0 A;  2AH2 A;  2SBA A;  3D82 A;  3PHM A;  4LA3 A;  1W2O A;  3ILR A;  4A2U A;  1GIC A;  2DCJ A;  5KC5 A;  4FOW A;  5BPX A;  3NRU A;  4ITC A;  4EZ4 A;  1OC1 A;  5JXG A;  1PMH X;  4NUB A;  1HRI 2;  1LJ7 A;  1VB4 A;  2IWG B;  3OSD A;  2OZJ A;  2VMH A;  4QPI B;  1Y9G A;  4CDU A;  1WW6 A;  1RC6 A;  1PX3 A;  5KXE A;  2PAK A;  5DXD A;  2RJL A;  1YQ6 A;  4UYB A;  3OUI A;  1HW5 A;  1W9S A;  3B93 A;  1CWP A;  5CVR A;  3T1M A;  4Q8K A;  2GDF A;  4I3P A;  1MQT A;  1N47 A;  1S2E A;  4JQR A;  2ZGT A;  3QH7 A;  5F2W A;  1MAC A;  2X5I C;  1QH6 A;  1DYP A;  1O8P A;  3M7A A;  3O1T A;  3MFC A;  1K5M A;  4DXS A;  3FMG A;  1FXZ A;  1OLM A;  5FYU A;  4YM0 A;  3PUS A;  3M3Q A;  2FMD A;  3K4D A;  2P6H A;  5E6H A;  2BWA A;  4IV3 B;  3LPF A;  5FRE A;  5FZ7 A;  4CXY A;  3AL5 A;  3RFR A;  1C28 A;  3U75 A;  5C8C A;  2C6S A;  2ZX3 A;  3IDE A;  5BNN B;  4HPK B;  5FZC A;  1GNZ A;  2BP6 A;  4ASK A;  4CA9 A;  4HK8 A;  5L19 A;  1IGO A;  4HON A;  4UI9 L;  2TNF A;  5CFC A;  1UPI A;  2G4I A;  2J1U A;  3LZZ A;  2ORX A;  2ZAC A;  4Q4W 1;  4M00 A;  4W6W A;  5GZE A;  3RNS A;  3A0N A;  4LBK A;  4QB6 A;  1CZV A;  5FZK A;  1KJR A;  4WZC A;  1R1Z A;  4AHY A;  4MH0 E;  3ZYJ B;  3QBQ A;  4Q0Q A;  3H8O A;  3I2G A;  4WBB A;  5JPM B;  5IVV A;  4KU8 A;  1U0A A;  3V64 A;  2Y34 A;  4YM2 A;  3VL9 A;  4LKD A;  1O3Q A;  4AHW A;  1UZW A;  3CIH A;  5AVP A;  4QHB A;  3WDV A;  2BYV E;  2XVG A;  5H9Q A;  2CU5 A;  1F2N A;  5A3W A;  1YXW A;  4N8M A;  3U37 A;  2YUE A;  4B3N A;  4FO9 A;  4IE0 A;  2ERF A;  4LUL A;  4XQ4 A;  4CP9 A;  2JG9 B;  4QXH A;  1J1L A;  1LHO A;  3OTF A;  4OHV A;  5M0T A;  1H9W A;  1KFX L;  1VBD 1;  1AZD A;  2DVA A;  2YC4 A;  3MLL A;  4FFG A;  5LB6 A;  4EWE A;  4Z8B A;  4UF0 B;  1KRI A;  1K42 A;  1PZ9 A;  4PCR A;  5AC9 2;  4YVS B;  2R1B A;  1HJG A;  3SCH A;  4GH4 C;  4BQX A;  1LOC A;  3S7E A;  4NN0 A;  4I0B A;  3M4F A;  4CDX A;  1EAH 1;  2R32 A;  3I3B A;  1G9D A;  1RYY A;  2NPI A;  1ZA7 A;  3T0D A;  1JH5 A;  2OXB A;  5EHD A;  3ZMN A;  1ENR A;  3USU A;  3O1R A;  1QDC A;  4KWU A;  1EPZ A;  1XNT A;  2AEY A;  3EO6 A;  5FK8 A;  5JSO A;  1LB2 A;  3DEM A;  3AKS A;  5FP8 A;  3ACF A;  2D93 A;  5F3E A;  5A3T A;  4QAW A;  2HKX A;  2ZKN A;  3OOX A;  4N9I A;  3RVH A;  1AX1 A;  4TWT A;  1W2U A;  2PHR A;  5J48 A;  5BNO C;  3KV6 A;  3J9S A;  2Q8C A;  1GAN A;  4N90 A;  2CNA A;  4Q4V 1;  4NII A;  1HB3 A;  3T0B A;  1QJE A;  2Q1M A;  1JBC A;  1L3J A;  1QNW A;  5ACA 2;  1AR8 1;  1F5F A;  2BBA A;  2C5D A;  5ERL A;  4PLM A;  3VKO A;  3AYE A;  2XH6 A;  3LAG A;  2QCS B;  4WM8 A;  4XIL A;  2P4E A;  4TLG A;  3R4D B;  5A7S A;  1MZE A;  3KV9 A;  4LBM A;  1VLN A;  4CCD A;  2ZGO A;  1ULE A;  3B01 A;  5I93 A;  2XLG A;  2RDQ A;  3QD6 A;  3PUR A;  1R08 1;  2ZXQ A;  3FX3 A;  2VW1 A;  3HN3 A;  3VBS B;  1IHM A;  2ZGN A;  2HWB 2;  3ZR5 A;  2OPK A;  4MLO A;  4RN5 A;  2R1D A;  4YGE A;  4BCU A;  3BCW A;  1COV 3;  1RGS A;  2ORZ A;  2W68 A;  2DUO A;  3I54 A;  3LA7 A;  1E5H A;  1OA3 A;  2HWC 1;  1POQ A;  2OA2 A;  2VCC A;  4KG0 A;  4MGK E;  4PIZ A;  4QX8 A;  3TWI A;  3LPG A;  2KD7 A;  4K8R B;  4ZXK A;  3THD A;  1BYH A;  3K4Z A;  2GNB A;  2QQI A;  2NQY A;  4P9G A;  3CMG A;  2FDF A;  3AXE A;  3H50 A;  2YMZ A;  2WJS A;  4QGN A;  2WBK A;  3WDX A;  3RZG A;  4MGZ E;  2ILM A;  1VBB 2;  3IWZ A;  1ZBE 3;  2BNN A;  3UV9 A;  4XF1 A;  3VBU B;  4CYD A;  1IPJ A;  4LPL A;  4YW4 A;  1NCQ B;  4QDQ A;  2YRO A;  4OHX A;  3QLQ A;  5GLV A;  2WZR 3;  3TB0 A;  4XTP A;  1GZW B;  5H9P A;  1RUD 1;  3N9N A;  2GMP A;  5BNP C;  1XNK A;  5FLI A;  3AX4 A;  5LBB A;  2EAA A;  4AAP A;  5CU1 A;  4B4P A;  1OUR A;  3ZYH A;  2ZGL A;  3ZXD A;  1TG7 A;  1X50 A;  3DKW A;  2W0X A;  3IDB B;  3OUJ A;  4K40 A;  3KB5 A;  5FY5 A;  5K4L A;  2EIB A;  4B29 A;  1WWY A;  4I3G A;  4XAA A;  4ARX A;  1LAJ A;  1AJO A;  2BOI A;  3ILN A;  3QAC A;  5IFP A;  2DU1 A;  1HXS 3;  1DQ6 A;  3POJ A;  3G7D A;  1WW7 A;  2GP3 A;  2JJ6 A;  2PA7 A;  4J25 A;  5EJ3 A;  4ORF A;  2W39 A;  3FLT A;  3PJY A;  2OS2 A;  1A8D A;  3MLJ A;  4JRL A;  5H9S A;  1UU4 A;  3UKV A;  1X8M A;  5FRA A;  4BQW A;  1MEC 2;  2O0O A;  3ZSL A;  3CEW A;  2VTF A;  4PBP A;  1ENX A;  4JGZ A;  1XXN A;  2PLV 1;  4QGL A;  3WNO A;  3BTX A;  1GWL A;  4Y4R A;  5J98 B;  2JDY A;  2XL9 A;  1KEX A;  4QX1 A;  2ZJC A;  3THC A;  3MV1 1;  1CR7 A;  1DU3 D;  2V72 A;  2YHJ A;  1S1A A;  3CKH A;  2A3Y A;  1XE7 A;  3MFA A;  5LAT A;  3RDI A;  4D8M A;  5CEH A;  2DUR A;  1RUI 1;  2VVF A;  3ZLI A;  4AL9 A;  4MHU A;  1V70 A;  4A7K A;  3IM0 A;  4P14 A;  1MVQ A;  1MS8 A;  4U36 A;  2AAC A;  3PUI A;  1ASJ 2;  1PO1 1;  1RHI 2;  2EXJ A;  1O4Z A;  1ENQ A;  3OEB A;  1IZ3 A;  5DUV A;  2E9Q A;  5T5O A;  4YZ2 A;  1GQG A;  2I74 A;  3BPS A;  4JCK A;  4K6B A;  5C70 A;  3P5B A;  3TYJ A;  1ZVF A;  4LBL A;  4Q4W 3;  4E27 A;  2RDS A;  4DPN A;  3AKQ A;  4KG8 A;  1G6N A;  4AF9 A;  4GKY A;  3ATG A;  1XBF A;  1NX9 A;  2BW8 A;  1UOG A;  2WNV A;  3WCS A;  4N43 A;  5FP9 A;  3OBZ A;  3LDK A;  2H6C A;  2HWF 2;  3B00 A;  3MGU A;  2IXC A;  5DAX A;  3BU0 A;  1GWK A;  3M1H A;  5C5U A;  1BBT 1;  4U2A A;  4CDQ B;  4EN9 B;  4JDM A;  3J8F 2;  4AED B;  3RRD A;  1HRV 3;  2ADD A;  4QXB A;  4EN0 A;  3VBR A;  4E2G A;  4M0N A;  3MID A;  2XJS A;  4X6Q B;  4D6S A;  1XND A;  1HRI 1;  3R05 A;  2UY8 A;  2ZGM A;  1YC6 1;  3CJI A;  2IXH A;  3V65 A;  2PAM A;  2XG3 A;  3CZJ A;  3HWJ A;  4HL0 A;  1UNB A;  4R4Z A;  4R9B A;  4QM9 A;  4UWD A;  4DXT A;  4IUG A;  3N3H A;  2FDK A;  4AEK A;  4D6Q A;  1VBD 3;  2BWC A;  2W52 A;  5FZA A;  4JTO A;  2N7G A;  4CDW B;  4GD4 A;  3WNN A;  4UOJ A;  2B9U A;  3PTY A;  3S5A A;  2GNM A;  1TEI A;  4P9J A;  5LA1 A;  4YVW C;  1MZF A;  2P3Y A;  1WBF A;  4M3C E;  1PNF A;  3FHI B;  3ZFG A;  1GBG A;  2WQ4 A;  5FY7 A;  2GN7 A;  1OVS A;  2MEV 2;  3POI A;  1EAH 3;  4XUR A;  1YIP A;  3I49 A;  4OCT A;  4JKL A;  4XHB A;  4Y5S A;  1US3 A;  3WW2 A;  2PHU A;  3TOJ A;  2Y38 A;  4XF3 A;  1LGN A;  2P3J A;  3C7O A;  4A3X A;  5EFU A;  3MIF A;  3FLP A;  2LRP A;  3MUZ 1;  5F5I A;  2QQU A;  1VR3 A;  4Y1X A;  4DNY A;  5CFD C;  5FZ4 A;  2Q1Z B;  4BOW A;  3RSJ A;  1UMI A;  4B1M A;  4RD7 A;  1UN1 A;  4LO8 A;  2VQA A;  1Q3E A;  2QQK A;  5LK7 B;  2BPA 2;  4N53 B;  1O4T A;  2JKB A;  2XVK A;  4LBQ D;  2WLQ A;  4QKD A;  3VBF C;  1JZ4 A;  5FY1 A;  4Y20 B;  2ZGP A;  2TEP A;  4XFC A;  3LOB A;  2A71 A;  2B46 X;  4AI8 A;  1AR8 3;  3KHC A;  4NHM A;  3UES A;  5FAX A;  4QU1 A;  3AZZ A;  3WP4 A;  3FBY A;  4XJU A;  4QPW A;  2VW2 A;  1TME 2;  2JEM A;  3DL3 A;  3NNM A;  2FBE A;  3NQH A;  1PGW 2;  2PN5 A;  2WZ8 A;  2A5Z A;  3VZL A;  5JDB A;  2RR1 3;  1JOJ A;  4DEQ A;  3B5L B;  5FYH A;  1W0N A;  3OGR A;  4XOG A;  5JOY A;  1EUU A;  3H3Z A;  1R08 3;  2VCB A;  1VBA 1;  1XOY A;  1NY7 1;  5C9A C;  1PZ7 A;  3NAP C;  1G86 A;  4MGY E;  2B7Y A;  1VAK A;  3V0A B;  1W06 A;  1W90 A;  5A7W A;  2D43 A;  1B09 A;  2HWC 3;  2D6L X;  3TNQ A;  5AC9 1;  5GAL A;  2W92 A;  4JGY C;  2WFF 2;  1QH7 A;  4RR3 B;  2CAV A;  4XJ8 A;  1IKQ A;  5BV6 A;  4QPG B;  1LRH A;  4YG0 A;  2CYF A;  3I3M A;  1O3T A;  4H3W A;  1SCR A;  1MS9 A;  1LEN A;  3D0S A;  3PIJ A;  2IXK A;  3HR9 A;  4Q1P A;  2EIG A;  1W6M A;  2WSU A;  2X53 S;  3D4K A;  1SLA A;  3PTR B;  4LO6 B;  4NRO A;  4XBN A;  3DN7 A;  1X8E A;  4CDQ C;  4ZKT B;  4XJA A;  4URT A;  4LNV A;  3U1X A;  2WNU A;  2A70 A;  5JZG C;  2C9K A;  1LGB A;  5JPN B;  1RUD 3;  5FBZ A;  3VN4 A;  3I3D A;  1QQP 2;  2B8M A;  1AL0 G;  2X8K A;  4QHZ A;  3WZ1 A;  5T5J A;  4GH4 A;  3AVS A;  5C4W B;  2ZHK A;  3IIA A;  5ACA 1;  3NV2 A;  2NMN A;  4L97 A;  1H1M A;  1SQ4 A;  4DOU A;  1PHM A;  4PDW C;  5T50 A;  1W6Q A;  1IS5 A;  2LM3 A;  1CPM A;  2P37 A;  3ZXJ A;  3WQ0 A;  4AVA A;  4AQS A;  4CU6 A;  2TBV A;  1OUS A;  4Y4Y A;  1QOT A;  1W2A X;  3BTA A;  4O9E A;  3J26 N;  3PU8 A;  3S30 A;  5JCT A;  5A3P A;  4YW1 A;  5A32 B;  2R07 2;  3LQC A;  1JYN A;  2IFR A;  1PNG A;  4BA6 A;  2J1E A;  2WZR 2;  5DZE A;  4K1Z A;  1UU6 A;  4ZU7 A;  4QPI A;  1FV3 A;  3E5Q A;  4DY3 A;  1RUC 2;  2YPD A;  1IPS A;  4CDU C;  1ZYB A;  2B9V A;  3BN6 A;  2A6Z A;  1Y3T A;  4MZU A;  1QJF A;  1QGL A;  2PHW A;  3ZN6 B;  1MQT C;  2RV9 A;  4FTE A;  2KR2 A;  3GZU C;  3KD4 A;  5DPN A;  3T3Y A;  1UYZ A;  3PL0 A;  3EXU A;  3K2O A;  1RUI 3;  2D5F A;  5DAP A;  1OA4 A;  1CX4 A;  1Y9M A;  3IAP A;  4OHW A;  1WME A;  1DBN A;  4COZ A;  5IVB A;  1PO1 3;  4ZPI A;  3TBD A;  1ZX5 A;  3WT3 A;  3TEZ A;  1K45 A;  3JBG 1;  4COV A;  5FWE A;  5FZG A;  5IAX A;  2JDK A;  5JOW A;  4ASL A;  1CAV B;  4XE9 A;  2BBV A;  4K3U A;  5BNN A;  2X05 A;  1OKQ A;  1PGS A;  1GQP A;  4MGS A;  4K7J A;  5FY4 A;  3K51 A;  5CIS A;  4HET A;  3RYP A;  2NYY A;  1SPP B;  3MF6 A;  5I0S A;  4IER A;  4NPL A;  4K9S A;  3NNF A;  1SZB A;  2HH9 A;  4P9W A;  2D6P A;  5EXO A;  2W95 A;  3LEG A;  1DQ2 A;  2JEN A;  1BBT 3;  2ZEZ A;  3U10 A;  1EP0 A;  2WYF A;  5DUW A;  3S57 A;  1WLT A;  1GMM A;  2JEC A;  4I02 A;  1QJU 1;  1VBE 1;  1TMF 1;  4KWL A;  5FYC A;  2J1R A;  1CAX B;  2VVD A;  4XJW A;  1HRI 3;  3ES4 A;  4D7Y A;  1U5I A;  1JS9 A;  1MEC 1;  1XE8 A;  2Q1F A;  4ASM B;  1YJK A;  2VCA A;  4Z82 A;  1WD4 A;  5EP9 A;  1Z0H A;  1FAT A;  4XVH A;  4UF0 A;  1YFY A;  5J96 B;  4XZP A;  1B35 B;  4BIF A;  2HWE 2;  1BQP A;  4DIN B;  2VG9 A;  4EV0 A;  4E4S A;  1HJF A;  2GMM A;  1IS3 A;  5GJ6 A;  1JU4 A;  2GZW A;  4QQH A;  4FPL A;  1KS4 A;  3GNE A;  4WVV A;  4Q0S A;  1W39 A;  4HVQ A;  1ASJ 1;  1RHI 1;  1A34 A;  1ZM1 A;  2VBP A;  3I2F A;  3HVD A;  3PME A;  2QNK A;  1DZT A;  2A3W A;  4XW3 A;  1VIW B;  4D69 A;  1ZNP A;  2A75 A;  4BHP A;  4BIS A;  1XRU A;  1I9R A;  2AUY A;  1UW8 A;  2CWM A;  1CPN A;  3UGG A;  5I0U A;  4BMB A;  1LOF A;  1Q56 A;  4YAR A;  4CP1 A;  2ZAB A;  2IC1 A;  3VKN A;  3ZYI B;  2FQP A;  3BVC A;  2BRT A;  2XKP A;  3O0W A;  2JIJ A;  3R0R A;  2WNE A;  4FPC A;  4ISR A;  4URA A;  5HCH A;  2JDN A;  5FZ3 A;  4DFS A;  3J8F 1;  3INA A;  3I2O A;  5IT6 A;  1U5Z A;  1JYV A;  4WM8 C;  1XC6 A;  2Y6J A;  2GH2 A;  3L2Y A;  4YPJ A;  4E4H A;  4ISQ A;  1ZA4 A;  1ZRC A;  4BPZ A;  5FCC A;  1V6I A;  4OHZ A;  4B7K A;  2A1X A;  3ZPO A;  2ZX1 A;  4AZZ A;  5FIX A;  1Q43 A;  2WO3 A;  3ABZ A;  4QU2 A;  3U11 A;  3VBS A;  1Q8V A;  4D94 A;  3AYD A;  1ND2 B;  5FPZ A;  1W8F A;  4SLI A;  4Y1Z A;  4MHR A;  4NVP A;  2CGN A;  1GZC A;  2ZEY A;  1DQ0 A;  4Q4V 2;  2BNO A;  5DUU A;  2BU9 A;  5AC9 3;  1D7P M;  4IEX A;  4JKK A;  3DYM A;  1WA6 X;  2ZHN A;  2H6B A;  5IVY A;  2CTV A;  3B9C A;  3N9P A;  1IS4 A;  4CXW A;  2XQR A;  5GM0 A;  2B4K A;  3ZMO A;  3E97 A;  3VBH C;  3MIB A;  5FLJ A;  2HWD 2;  4IE6 A;  3MO4 A;  2W91 A;  3SHR A;  5FR3 A;  1NOV A;  3PDQ A;  1NCQ A;  4TSV A;  3WF4 A;  1ZRD A;  1RL3 A;  3LEM A;  4R9C A;  5JSP A;  1LHN A;  1C3H A;  2UWB A;  2OT7 A;  2HBU A;  1W6N B;  2GN3 A;  3DXU A;  3HBK A;  2EAK A;  4YVW A;  1SFN A;  1I3H A;  2FMY A;  2J1A A;  2WQZ C;  2WUH A;  3FBM A;  1I5P A;  3FL7 A;  4LIU A;  4CVU A;  3OB8 A;  5ACA 3;  2YDE A;  3VHR A;  1JHJ A;  1ULC A;  1TME 1;  1W0O A;  1PGW 1;  3AKR A;  1UZZ A;  3T30 A;  4BXF A;  3KF3 A;  5FPL A;  5HV0 A;  3N9M A;  4QKB A;  1CIY A;  1UKR A;  3LB9 A;  4XF4 A;  4KQ7 A;  5F5Q A;  1RUD 2;  3WG4 A;  5K0U B;  4XBL A;  4OUS A;  1UAI A;  4YLZ A;  4AK3 A;  4DY5 A;  4AR2 A;  1SBD A;  4KBB A;  1LES A;  4NIA A;  1PGL 2;  4Q8L A;  2G9G A;  4D7T A;  1CN1 A;  4FPK A;  4XXP A;  4ZHN A;  2BUK A;  2P17 A;  5H9R A;  2DBN A;  3WF0 A;  2WFF 1;  4AQT A;  3FJS A;  3JXS A;  5DAW A;  5GZD A;  1RIN A;  4TTG A;  1L7Q A;  1ULP A;  1XSQ A;  4Q0P A;  5A70 A;  1OBN A;  3DYO A;  3IDA A;  3SIS A;  4KI5 M;  1QNY A;  2R06 1;  1UX6 A;  4O7X A;  1VBB 3;  5JI9 A;  2JE7 A;  2BVB A;  1YQ8 A;  3ZN4 A;  2VE1 A;  4NHX A;  1G9F A;  2MPF A;  3BGA A;  3NAP A;  4PLN A;  5C9A A;  1OD5 A;  3H7Y A;  1U5Y A;  1W03 A;  2OW4 A;  4FPO B;  1RUH 1;  2PTM A;  4IGO A;  2W47 A;  4E2Q A;  1JUH A;  3N35 A;  2VZ3 A;  1NCR B;  2PLV 2;  2ZA9 A;  4FSJ A;  4GWM A;  2H0B A;  2PHX A;  2ZOE B;  3CF6 E;  2YY1 A;  1RB8 G;  2YU1 A;  2E31 A;  1QOO A;  1QJY 1;  1Q8Q A;  1ULG A;  1YIF A;  2JDZ A;  4YWA A;  3UET A;  1DGW A;  1JXN A;  5FMO L;  5CA6 A;  2WNV C;  2QUO A;  1MS1 A;  4N43 C;  4PLO A;  5ANN A;  1ULD A;  4LKF A;  2JG8 C;  1H2K A;  3KF5 A;  1X36 A;  4CDQ A;  4FAH A;  2BVV A;  2CWS A;  2YGL A;  2HEW F;  5FO7 B;  4AED A;  2OKX A;  1XE0 A;  2K2S A;  3J7L A;  2GAU A;  2R07 1;  4OVE A;  3ZFE C;  5FMC A;  3AP7 A;  4HAN A;  4IEP A;  2D6K A;  4FXG B;  4NHY A;  3VBR C;  1ZBA 1;  3MW3 A;  3QCW A;  3KVA A;  1BCX A;  1X9T A;  3ELN A;  3IT8 A;  1WA4 A;  1MEC 3;  4L8Q A;  1AR6 1;  3CJI C;  3JQW A;  3LWC A;  2VUJ A;  4FFF A;  4XEZ A;  1RUC 1;  2BGP A;  2XUE A;  5A1F A;  1W6O B;  3IN9 A;  1Q8O A;  3LEI A;  4L2N A;  1R09 2;  2WYS A;  1NLR A;  3S7I A;  2QQV A;  3WHU A;  4XFH A;  3UK9 A;  1HIX A;  4CDW A;  5FY9 A;  4NRM A;  4LOR A;  5A6X A;  3VZM A;  3VDD B;  4MOA A;  2IVI B;  1BBT 2;  2B42 B;  3LSD A;  4YZ4 A;  3FZ3 A;  2IXL A;  2PHD A;  2A6Y A;  4TN7 A;  5IAV A;  5IWF A;  3OGG A;  3N9O A;  3P6B A;  4HOO A;  1DQ4 A;  2ZHM A;  5G04 L;  4XET A;  1ASJ 3;  2BGO A;  1RHI 3;  2R7E B;  5F39 A;  5IFT A;  2FDG A;  3DPR C;  3LKJ A;  2D7F A;  1UIJ A;  1E5R A;  3WVJ A;  1RUG 1;  3JD7 1;  3PUA A;  1C1L A;  3ZX7 A;  1LOE A;  1N3Q A;  1M4W A;  4TYS A;  1G9A A;  2WA3 A;  4HSJ A;  3KCY A;  3O1M A;  2P3K A;  4KL1 A;  3WLU A;  3OBT A;  2VBD A;  2E7A A;  1DZR A;  1JZ5 A;  3VDA A;  4QQL A;  4AI2 A;  3GZA A;  2VVE A;  4Q26 A;  1C57 A;  1QJZ A;  2PHF A;  1LHW A;  5EJZ B;  2HWF 3;  1VMF A;  1RVF 1;  5J1X A;  2ZMN A;  2YU2 A;  4W8J A;  1OF4 A;  3HOB A;  4EYU A;  1UOJ A;  3J8F 3;  4OYU A;  5JI7 A;  4FQ4 A;  2WAA A;  4AYU A;  1K12 A;  2DV9 A;  2EXK A;  4QT6 A;  4CCE A;  5L7O B;  4BK5 A;  4UAP A;  1ODN A;  5IW0 A;  4XUQ A;  1OHF A;  1W8O A;  1BKZ A;  4JAA A;  4L92 A;  2JB4 A;  1AR9 2;  3B69 A;  1M06 G;  4LT5 A;  5FP7 A;  3D0J A;  2ZGK A;  3LA2 A;  4CE8 A;  2VO5 A;  1MS3 A;  2G9F A;  2Y26 A;  2HYX A;  3PVB B;  1V6M A;  4Q4X 1;  3AP5 A;  3NV1 A;  2B5H A;  2W3J A;  2Q8O A;  3U07 A;  3WSO A;  3VD9 A;  2E63 A;  2IXJ A;  1GNY A;  4HG6 B;  1XYO A;  4OI4 A;  1H1A A;  2HWE 1;  2VOX A;  1QHD A;  4DQA A;  4RQP C;  5FYY A;  1ST8 A;  1YYN A;  4CTE A;  1WD3 A;  4LBO A;  5DN2 A;  3RZL A;  3OUH A;  2MNG A;  2MEV 3;  1V6L A;  1W8W A;  4O61 A;  5IK5 A;  1V9U 2;  4QPG A;  1QJX 2;  3C3V A;  3OYW B;  1VRB A;  2ZAA A;  1NXD 1;  1WCS A;  1GOF A;  3EQE A;  3NL1 A;  1LU2 A;  4FPG A;  1HQL A;  1HN1 A;  1T6G C;  4YW3 A;  3JB4 C;  5FYV A;  1J1T A;  1SLL A;  4M4P A;  5LEK A;  1VBA 2;  4K8F A;  1NY7 2;  1EPW A;  3SQO A;  4AVS A;  1DHK B;  2WNU C;  4M3C B;  1ZZ6 A;  1BMV 1;  1G9C A;  1VAV A;  3P3P A;  1NZI A;  2J22 A;  3AMN A;  3ES1 A;  1HQW A;  3KV5 A;  3RG0 A;  3LEK A;  1YO8 A;  1GNH A;  4JZR A;  3CNA A;  1H8T B;  3GZE A;  2GNT A;  5BNQ A;  1TME 3;  3GBF A;  5E8A A;  2R0F A;  3NMB A;  5SV8 A;  5F3G A;  4XF9 A;  5DZG A;  1PK6 B;  1X82 A;  3AJY A;  1YQ2 A;  2JDU A;  3H0O A;  1RXF A;  5DAQ A;  3WDY A;  3CBN A;  3ZYG A;  4D0Q A;  1GP5 A;  2BZD A;  4CU9 A;  2OQ7 A;  3E5X A;  4Y5T A;  5JVV A;  4HN0 A;  2J42 A;  1FPN 1;  4Y22 B;  1BZW A;  5CFD B;  4N9H A;  3HNM A;  4QPI C;  3ZSM A;  5C3O A;  2YPJ A;  4IEW A;  3ZXA C;  2VMC A;  2LUW A;  4EN8 B;  1DGR N;  2WII B;  2DVB A;  4FOV A;  4Y1Y A;  2QKD A;  5AVA A;  2QE3 A;  2WFF 3;  4XAE A;  3ALQ A;  1FNZ A;  4OI2 A;  5DDJ 1;  5FBJ A;  1H6X A;  1OFN A;  2OUH A;  2VH9 A;  3OPT A;  3O1U A;  2ZTN A;  5A3U A;  4A3Z A;  5JR2 A;  5A6Q A;  1ZRE A;  1QXR A;  4XUO A;  1H2M A;  2R06 3;  1RUN A;  1VRH 1;  1G8W A;  2HWD 1;  1A6C A;  1OMI A;  1MS4 A;  4UW6 A;  5FYI A;  5JUV A;  1KD7 A;  1L7R A;  3JCI A;  2DYC A;  4MV2 A;  5BXX A;  4IV3 C;  1QOS A;  2RM2 2;  1F31 A;  1CAV A;  1BVV A;  5FTT C;  5BNN C;  1H1I A;  1QQP 3;  3FHA A;  4F7Z A;  4QX3 A;  3V0B B;  1DGR A;  1WCQ A;  4H7L A;  1H4G A;  4AVV A;  2XUM A;  1SPP A;  4A41 A;  4N7I A;  5J7M A;  2VZU A;  3C8X A;  5CZK A;  3VLB B;  4PHZ A;  4Q4Y 1;  3ZKU A;  5HI0 A;  3AL6 A;  4FOQ A;  4Q5O A;  5FYM A;  3GAL A;  1LOA A;  4AQ2 A;  4CU7 A;  5IK7 A;  2ID4 A;  2W87 A;  3VBH A;  2R30 A;  2X29 A;  1O6U A;  1RUJ 2;  3BIE A;  1X7N A;  5KBF A;  5T5L A;  2L9L A;  2R07 3;  3JBG 2;  5EV7 A;  5F3I A;  2V09 A;  1CAX A;  3A0K A;  1RUF 2;  1XJA A;  3KT1 A;  4PT6 A;  4WVM A;  5EYY A;  4BQ1 A;  2JXA A;  5LEJ A;  1CAW B;  2Y60 A;  5J09 A;  5C33 A;  4DIQ A;  5FZO A;  4XF0 A;  4MYE A;  1K3I A;  1RUC 3;  1PGL 1;  2JG9 C;  4IEY A;  4CXX A;  4COW A;  1WGP A; 
#chains in the Genus database with same CATH homology
 1UY0 A;  2W92 A;  2QBX A;  4DUX A;  3K4A A;  3C7H A;  2WO2 A;  2ZEW A;  5I0D A;  2YFZ A;  3SKJ E;  3A22 A;  2WAO A;  5LA0 A;  1OF3 A;  3PUH A;  2QQJ A;  4W50 A;  4AG4 A;  2C9K A;  5C7G A;  5HPO A;  5LCW L;  4P02 B;  3I3D A;  4QB1 A;  2VM9 A;  2CDP A;  4BDV B;  3W5M A;  2YB7 A;  4CUB A;  4W4Z A;  3FN9 A;  2W46 A;  4OMC A;  2VZQ A;  1JI6 A;  2QQO A;  1JYX A;  3F2Z A;  3K75 B;  4CU6 A;  1GUI A;  4KMQ A;  3SEE A;  4ET7 A;  2XHN A;  5JXJ A;  4XUT A;  2VZR A;  1MPX A;  3LQC A;  1JYN A;  1R64 A;  2J1E A;  2WDB A;  3CDZ B;  3P1I A;  4QB2 A;  2Y6G A;  1BHG A;  2B9V A;  3A23 A;  3BN6 A;  5HXM A;  3VDB A;  2WAB A;  1JZ2 A;  2W9X A;  1H6Y A;  4ZY9 A;  3MUY 1;  5G05 L;  2RV9 A;  4M4R A;  2XON A;  3T2O A;  5DPN A;  1UYZ A;  5DQ0 A;  1W99 A;  2WN3 A;  2VMD A;  2RJ2 A;  4FI9 A;  3IAP A;  5LA2 A;  2VMF A;  1UY1 A;  2VQU A;  1K45 A;  3III A;  3C7G A;  4BK4 A;  1IQD C;  2VL4 A;  4DEV A;  2J1T A;  2X05 A;  2YFU A;  4XZU G;  3WNM A;  2VZO A;  1J84 A;  1GQP A;  4MGS A;  1O59 A;  4JX0 A;  2V5D A;  3I3E A;  4PF1 A;  2WN2 A;  1LNS A;  2VZT A;  2W95 A;  2Z4F A;  3LEG A;  4DUV A;  1OD3 A;  4ARY A;  2J7M A;  2VJX A;  4XUP A;  4A6O A;  2ZEZ A;  1T2X A;  1SDD B;  4PQQ A;  4QDR A;  1GMM A;  3T2P A;  2J1R A;  2DCK A;  3VD3 A;  3ACG A;  2WO1 A;  2LW8 A;  5DMY A;  4A42 A;  2VZ1 A;  3ACH A;  3LE0 A;  4MAD A;  5IYY A;  2VCA A;  1F4H A;  3A21 A;  3VDC A;  2Y6K A;  4LKS A;  4XVH A;  4OUE A;  3VD4 A;  2VZS A;  1PX4 A;  4GWJ A;  2J1V A;  1JU4 A;  2WQ8 A;  2C4X A;  2W1S A;  2X10 A;  4GWI A;  5EIY B;  4MO3 M;  3I2F A;  3HJR A;  2C26 A;  3SKV A;  1JZ8 A;  5JXI A;  1JYW A;  2EIC A;  4P08 A;  2VME A;  3WNL A;  3NJX A;  2RVA A;  2J1S A;  1UYX A;  4MGQ A;  4DXR A;  2JD9 A;  3VD7 A;  4LQR A;  4ZXE A;  3OBA A;  2DCJ A;  1JYV A;  3NRU A;  1XC6 A;  2Y6J A;  5IHR A;  2VR4 A;  4BJ0 A;  4YPJ A;  5JXG A;  2W94 A;  1PMH X;  3T08 A;  1OH4 A;  1PX3 A;  2WO3 A;  3ABZ A;  1W9S A;  3NJV A;  3OGS A;  1WKY A;  4L0P A;  1PMJ X;  2ZEY A;  3D3A A;  2V4V A;  1O8P A;  4A44 A;  1D7P M;  4JKK A;  5A1A A;  4DXS A;  3DYM A;  3I2K A;  5EJ1 B;  1JZ6 A;  3K4D A;  2EID A;  3ACI A;  3LPF A;  2B4K A;  4ZZ8 A;  3CZU A;  3OEA A;  3MO4 A;  2W91 A;  4DUW A;  3WF4 A;  3HNY M;  4UI9 L;  2J1U A;  2ORX A;  2EIE A;  4QB6 A;  1CZV A;  3FL7 A;  2J1A A;  2LS6 A;  2WUH A;  1I5P A;  3ECQ A;  2W1U A;  4CVU A;  3I2G A;  3OB8 A;  3ETP A;  2BER A;  1JHJ A;  1GU3 A;  3CIH A;  3WNP A;  3U37 A;  1CIY A;  3WEZ A;  1DYO A;  3W5N A;  2YC4 A;  1F4A A;  1K42 A;  3CQO A;  3WQB A;  2QQN A;  1W9W A;  3WF0 A;  4TTG A;  3JXS A;  1L7Q A;  1ULP A;  3I3B A;  3T0D A;  1RYY A;  3DYO A;  3IDA A;  1W8N A;  3EB7 A;  4KI5 M;  4KWU A;  1XNT A;  3VD5 A;  4RYD A;  4LHS A;  3ACF A;  3J7H A;  3MV0 1;  2Y6H A;  4QAW A;  3BGA A;  1UZ0 A;  4TXW A;  4A45 A;  2W47 A;  1XPW A;  1NKG A;  5B4X A;  2VC9 A;  2JDA A;  2VZ3 A;  1US2 A;  3K46 A;  1W9T A;  3T0B A;  1JZ7 A;  2ZEX A;  2E31 A;  3UET A;  3WNK A;  1CX1 A;  2Y8K A;  2BBA A;  3C7F A;  5F7U A;  3I2J A;  2VQT A;  2W5F A;  3ZM8 A;  2QQM A;  1XNA A;  3WF2 A;  3HPN A;  2JE8 A;  2OKX A;  3T09 A;  4AAX A;  2E32 A;  2ZXQ A;  3T2Q A;  3HN3 A;  3OGV A;  4E8C A;  4RN5 A;  4OZO A;  2BGP A;  2ORZ A;  3LEI A;  4E8D A;  2WYS A;  4Z2A A;  2VCC A;  2Y64 A;  3LPG A;  2KD7 A;  3THD A;  3K4Z A;  2QQI A;  2YC2 A;  1JU3 A;  3CMG A;  1UMH A;  4GZ9 A;  4MOA A;  2WBK A;  3P6B A;  5IJR A;  5B4N A;  5C71 A;  5G04 L;  1UYY A;  1ULO A;  2BGO A;  2R7E B;  4LPL A;  5IFT A;  4QDQ A;  3I2H A;  1JZ5 A;  2PQS A;  3VDA A;  3GM8 A;  4A4A A;  1JZ3 A;  1TG7 A;  2W1W A;  3MBW A;  2EIB A;  5EJZ B;  1CZS A;  4ARX A;  5J1X A;  5IFP A;  3WF3 A;  4W8J A;  1OF4 A;  3HOB A;  2W1Q A;  1NAE A;  4OYU A;  1J83 A;  2WAA A;  1K12 A;  4BK5 A;  4UAP A;  4XUQ A;  3GDB A;  1W8O A;  2VZV A;  1EUT A;  1KGY A;  2VO5 A;  2VTF A;  2HYX A;  3C7E A;  3WNO A;  2W3J A;  3VD9 A;  3WSO A;  1KEX A;  1UXZ A;  4QX1 A;  3SEP A;  3THC A;  1GNY A;  4HG6 B;  3MV1 1;  2V72 A;  1TVG A;  3CKH A;  4D8M A;  5DN2 A;  1UY4 A;  3HEI A;  2QQL A;  3IAQ A;  3PUI A;  1NUK A;  1GOF A;  2WZE A;  3OEB A;  1HN1 A;  3AC0 A;  3FHQ A;  1UY2 A;  4M4P A;  2XOM A;  1SG3 A;  3GXU A;  5C70 A;  4CUC A;  1OT5 A;  4JHZ A;  4P5Y A;  2J22 A;  1NX9 A;  3T0A A;  2YG0 A;  3LEK A;  2VOT A;  2E33 A;  1DLC A;  3DEC A;  3NNG A;  1DP0 A;  2JKX A;  2XQX A;  3I2I A;  1YQ2 A;  4D0Q A;  2X09 A;  2BZD A;  1UX7 A;  3CZJ A;  4QX2 A;  4CU9 A;  4DXT A;  4IUG A;  1GOG A;  3HNM A;  4QDS A;  3WNN A;  4UOJ A;  2VMC A;  4P00 B;  3E1F 1;  5LA1 A;  4BXS V;  5JMO A;  3EYP A;  4XUR A;  1H6X A;  4JKL A;  1US3 A;  5JR2 A;  5CYY A;  4A3Z A;  4XUN A;  1SHW B;  3C7O A;  4XUO A;  3MUZ 1;  3UNP A;  5JUV A;  1O8S A;  4CUA A;  1L7R A;  1UWW A;  1UMI A;  1P8J A;  2CDO A;  2QQK A;  2Y6L A;  4OMD A;  3FHA A;  5FUI A;  4QX3 A;  1JZ4 A;  2E26 A;  1UY3 A;  1WCQ A;  2VZP A;  4A41 A;  3UES A;  3I97 A;  2VZU A;  3C8X A;  1GOH A;  5CZK A;  5JXH A;  4QPW A;  3GGL A;  2HLE A;  4CU7 A;  2ID4 A;  3NQH A;  2W87 A;  2WZ8 A;  3IB3 A;  3WF1 A;  4JKM A;  1CZT A;  4DEQ A;  1W0N A;  2L9L A;  3OGR A;  1EUU A;  2VCB A;  3A7Q A;  4PT6 A;  4CU8 A;  2DDU A;  3DYP A;  3K77 A;  3HNB M;  1K3I A;  3OG2 A;  4ZZ5 A;  4QX0 A;  1UXX X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...