2VZQA

C-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa in complex with digalacturonic acid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 23
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzqA00
4JX0A 3CDZB 1CZSA 1KGYA 4QDSA 2VZ1A 3HEIA 4P00B 4GWIA 2YG0A 1PX4A 4M4PA 5JXGA 3VD5A 3I3DA 4ARYA 4A42A 1TG7A 3ACIA 1GMMA 4DEQA 4W8JA 2VZTA 4CU8A 4DUXA 2V72A 3GDBA 4CVUA 3HOBA 4XUQA 2PQSA 3E1F1 1RYYA 3WNKA 5F7UA 2L9LA 3IAQA 2OKXA 4DUWA 2VM9A 1JZ3A 2VTFA 2W5FA 2Y6GA 3K77A 3ETPA 4Z2AA 3ECQA 3D3AA 3IB3A 1L7RA 1W9SA 2WAOA 2DCKA 3WNPA 3A22A 3I2IA 3LQCA 3LPGA 3CZJA 2E26A 2ZXQA 2WN3A 1O8SA 1PMJX 4XURA 3VD4A 1K42A 3U37A 4MGSA 1XNTA 2WBKA 5JR2A 2BGOA 3MUY1 3HNBM 4LPLA 2ZEXA 1UX7A 3WF0A 1UY3A 5DPNA 2QQKA 3UNPA 2BBAA 3WSOA 4HG6B 2ZEWA 4FI9A 2JE8A 3I2GA 2EIEA 1K45A 2VZOA 4OYUA 5HPOA 2QQMA 3BGAA 5EIYB 1TVGA 3K46A 5B4XA 1GOHA 3FL7A 3LEIA 2WYSA 5LA1A 4QDRA 3OEBA 1OF3A 4DEVA 3I97A 5EJ1B 3HPNA 4AAXA 2QQLA 4DUVA 4PT6A 4ARXA 3HJRA 4A4AA 1J84A 1BHGA 2W87A 2Y64A 3C7FA 2QQOA 2WQ8A 4KWUA 2WZ8A 1EUUA 4CUBA 1LNSA 5A1AA 3C7GA 3I3BA 1SHWB 2WO2A 1UY4A 2EIDA 2W1UA 4QB1A 2X09A 3CKHA 2VCCA 4MGQA 1CIYA 1KEXA 5IJRA 5DMYA 5JXJA 2C9KA 3SKVA 1EUTA 4CU6A 2Y8KA 4P5YA 3WF4A 2WUHA 5CYYA 2WZEA 4TTGA 2VMEA 5DN2A 1W0NA 1UMHA 2JD9A 2VQUA 2RVAA 2W3JA 4BDVB 5JXIA 2YC2A 2W92A 4ZZ8A 4YPJA 3WF3A 3W5NA 3FN9A 2HLEA 3A23A 4ZY9A 1NAEA 3PUHA 1JYVA 2YFUA 3VDCA 3VDBA 3WF2A 3C7OA 1GU3A 1XNAA 1US2A 1OF4A 2X05A 1O59A 5C7GA 3WNNA 2X10A 2R7EB 3OGRA 1NKGA 3ACFA 4QX1A 1UYYA 1YQ2A 2QQJA 2DDUA 5EJZB 5G04L 3T2QA 4P08A 5LA0A 1K3IA 4DXRA 1MPXA 2VMDA 3THCA 3K4AA 1GOFA 1UXXX 5IYYA 4M4RA 2B9VA 1PX3A 3I2FA 3HN3A 3T0AA 4E8CA 2RJ2A 2Y6KA 2VCBA 4CU9A 3P1IA 4A44A 3OGSA 2W1QA 1ULOA 4MO3M 2VZQA 4AG4A 5I0DA 2EICA 4OUEA 3K75B 2E32A 2XONA 4RYDA 4UOJA 3OB8A 5JMOA 1SG3A 3ZM8A 4XUNA 3T2OA 3HNMA 3MV01 2VMFA 1UY0A 4D8MA 3VDAA 1GQPA 2YC4A 1UY2A 2BGPA 3NQHA 4PQQA 2VMCA 3C7HA 5B4NA 2W95A 4JKMA 3GM8A 3JXSA 4JKLA 2CDPA 4QAWA 4OZOA 2WO1A 2DCJA 4CU7A 2VQTA 2VZVA 2J1SA 3DYPA 5G05L 3WEZA 3IAPA 2JDAA 4QX3A 4XVHA 2KD7A 3FHAA 4JKKA 3AC0A 4KMQA 4QPWA 3NRUA 4QB2A 2VZSA 3CZUA 1CZVA 1UYXA 2VZRA 5C70A 2WO3A 3LEKA 3C8XA 2V4VA 1WCQA 3SEEA 3PUIA 1WKYA 2W1WA 2LW8A 3EB7A 3VD7A 3GGLA 1JU4A 4A45A 4CUAA 2VC9A 1JZ8A 3ABZA 2WN2A 1JI6A 1JU3A 4XZUG 4QDQA 3DYOA 2ID4A 4QB6A 1UMIA 4BK4A 1F4AA 2J1UA 3UESA 1US3A 2CDOA 1XPWA 2VCAA 2VOTA 3C7EA 2E31A 2QQNA 3LE0A 2LS6A 1UWWA 4QX0A 3HNYM 4XUPA 4UAPA 1NX9A 2Y6LA 3SEPA 3J7HA 3MV11 4UI9L 4OMDA 3MUZ1 1W9WA 3WQBA 2HYXA 3MBWA 3OG2A 4TXWA 4XUOA 2ZEYA 2XOMA 4MADA 5LCWL 3VD3A 1JZ5A 2JKXA 5IFTA 1DYOA 1DP0A 1NUKA 3IIIA 5JXHA 2Y6HA 1OT5A 1XC6A 2W91A 3F2ZA 4KI5M 1CZTA 4DXSA 3T0DA 3OGVA 4MOAA 3P6BA 2WAAA 1GOGA 3WNOA 1JYXA 3W5MA 2VJXA 3T0BA 5JUVA 2VL4A 2V5DA 3NNGA 4RN5A 2QQIA 5IHRA 2B4KA 3EYPA 2ORXA 1T2XA 2Y6JA 3BN6A 1ULPA 3ACHA 2QBXA 2BERA 1JZ7A 1D7PM 5DQ0A 3NJXA 1GUIA 3I2JA 5C71A 1JZ6A 3I2HA 3DYMA 2BZDA 1PMHX 2YFZA 1HN1A 5LA2A 4D0QA 2J1TA 2XQXA 4JHZA 4DXTA 4W50A 3OEAA 3DECA 4QX2A 4E8DA 4GWJA 1JYWA 4OMCA 1H6XA 1W9TA 2VZPA 2ORZA 1CX1A 1I5PA 2VZUA 3A7QA 3K4ZA 1P8JA 3ACGA 3THDA 3CIHA 3WNMA 3T08A 1F4HA 2J1EA 2Z4FA 5HXMA 2J1VA 4LQRA 5CZKA 3I3EA 1W99A 1OD3A 3MO4A 1L7QA 4LKSA 4BXSV 1K12A 1W8NA 3FHQA 4L0PA 4XUTA 1W8OA 2C26A 3LPFA 4CUCA 1JZ2A 3I2KA 3UETA 1SDDB 2XHNA 1DLCA 4BJ0A 4ET7A 2J1AA 2EIBA 3OBAA 2C4XA 2J7MA 1UY1A 3WF1A 2E33A 2J1RA 2VO5A 2W1SA 4P02B 1GNYA 2RV9A 3T2PA 1IQDC 3NJVA 4W4ZA 4A41A 4GZ9A 2J22A 2WDBA 4LHSA 3CMGA 4A3ZA 1UYZA 1J83A 4IUGA 2W46A 4ZXEA 3T09A 4A6OA 2W94A 2W47A 1H6YA 2VZ3A 5IFPA 1JZ4A 1JYNA 2ZEZA 4BK5A 3IDAA 5J1XA 3LEGA 1UZ0A 1JHJA 1UXZA 3VD9A 1O8PA 2W9XA 3A21A 3K4DA 3CQOA 2YB7A 4PF1A 2WABA 5FUIA 4ZZ5A 1OH4A 2VR4A 3GXUA 3SKJE 1R64A 3WNLA
chains in the Genus database with same CATH superfamily
3WG4A 4DB5A 3DL3A 3R0RA 2AC1A 2WT1A 4I02A 5HBAA 1IOAA 5FPXA 1G6NA 4BISA 4FOWA 3CDZB 4AI1A 3I59A 1OD5A 5ISLA 1NYWA 1CZSA 1KGYA 1RUJ3 4QDSA 3TAYA 5M0TA 3HEIA 1QMJA 1YQ5A 4P00B 1W9FA 1ZM1A 1S0FA 2YG0A 3IKWA 3Q8BA 1G9AA 2DF7A 4ARYA 5FLIA 2WNEA 1O3SA 1TE1B 1S0CA 1ZZ7A 2D5HA 2P3IA 1AXYA 1TG7A 2ZJCA 4Q4W1 2PAKA 3J8F3 2GC2A 1AR61 3AYEA 4PLOA 2RS52 2XL9A 5FFOC 5LA9A 3KCCA 1K5MC 3MPBA 3EBRA 4FPEA 3GDBA 4LJHA 4K21A 1H8TB 4M0HA 4DOUA 5LZ6A 1H9PA 1T6BX 2I07B 5J36A 4YFZA 2NM1A 4PLNA 1VMFA 4B3NA 4I0BA 2ZX3A 4OQ8A 3M7AA 2ERFA 3WNKA 2ZGQA 2WKKA 1RUI1 3P5BA 4B8EA 3IAQA 3T4HB 1W2UA 2WZR2 2VOVA 1RVF3 2VM9A 4XF0A 3ZFFA 5CFDB 2B46X 1VE0A 1DGRA 2Y6GA 3O14A 5FXXA 1S1AA 2WJSA 3AK0A 4X8PA 1IKQA 1YWKA 5FZIA 1AXKA 1C1LA 5FAXA 3WQ1A 4CDQB 2RHPA 1HRI1 5EYYA 2XBO2 4PF5A 1D0GA 1RUE2 3CNAA 5IVEA 1W9SA 2XJPA 2VNRA 2JDHA 1ZZ8A 4LIVA 1D4VB 2UY9A 3LQCA 3UKVA 1CN1A 2ARCA 4IDZA 2YBSA 4EROA 5I8YA 4D6RA 2ZXQA 1YUDA 1UIJA 1S2EA 3O7OA 1UQXA 2IWGB 1SACA 4HFSA 4WM8C 2RR11 3B9CA 3VBSC 4N9IA 5D8AC 3U37A 2A6VA 5JZGC 1XNTA 3PUQA 5JR2A 4AEKA 5B2GB 2ZAAA 4IE5A 1CAXB 2WFPA 5F2WA 5F39A 3M2MA 1UX7A 2XUMA 3WF0A 3J7LA 3W59A 4COVA 1PIV1 5A7QA 2GZWA 1H30A 1PNFA 1UOGA 2I2SA 2JG9B 3POYA 5GKAC 2BBAA 1O5LA 1DGWX 3PLQA 3WSOA 4RS5A 5KWRA 4MV2A 4BQ5A 3D0SA 4Q0UA 5CFDA 1AR81 1FNYA 3QLQA 1RL3A 1PGSA 4OYUA 3AYCA 3Q8FA 1WMXA 2OPKA 4Y22B 4F3JA 3BGAA 1N3PA 1SLIA 3AM2A 2VUDA 4CP9B 5BNPB 3SMHA 2E6VA 4Q4Y2 5IK8A 2ZACA 3H7YA 2F17A 5FKCA 1KJLA 5DG1A 5EJ1B 4DEVA 5FZ7A 1E5HA 2BNMA 4QKNA 5KHKA 3PVNA 4BQ2A 5IVFA 5T5OA 5JIAA 1VIWB 2A6ZA 4GH4C 4AOCA 2RMU1 4AVAA 4ARXA 1EV12 5IT6A 3M70A 5D2AA 3TB0A 3J8F2 1BHGA 2Y64A 3IWZA 3JB4C 1H0BA 4AHZA 2QQOA 2WO7A 3RRDA 3N9PA 4K1ZA 2GH8A 2VE1A 4LEJA 2RJLA 4YZ3A 2GMEA 2BYVE 4V2WA 1LNSA 1VMJA 5A1AA 3I3BA 5FYTA 4BCUA 2E7AA 4ORFA 1R1A3 3NNMA 2EIDA 2IXLA 5JLVA 2PHLA 1SBEA 5E8AA 1WBFA 3J4UH 3EJKA 2VCCA 2WZR1 4MGQA 4P9GA 2ZGTA 4IE4A 2O0OA 2YU1A 4ASMB 4LE3A 5IJRA 2DU1A 5CFCC 1HKDA 5JXJA 1QJX2 3PUAA 3AYAA 4Y22A 4GMP0 4Z92B 4XMIA 4FBFA 2HWF2 2D6NA 2WUHA 4MXVA 4BIOA 1W28A 4O9GA 4YYOA 3WCSA 4CP9A 2TNFA 5DN2A 1YQ8A 3MFAA 5FLJA 3GBWA 1X9PA 2DTYA 3BPZA 4BM8A 4PCRA 1VBA1 2JD9A 2VQUA 4UF0B 5DAVA 5FO7B 3SLIA 4BDVB 4A7YA 3MICA 4UWDA 5F32A 4YPJA 2IFRA 3BTAA 4SLIA 5LBBA 4CDWB 3FN9A 3VL8A 5JZGA 4AVSA 1OUXA 1OKQA 1ULGA 2HLEA 3A23A 4Q0VA 4ZY9A 3UGHA 1VALA 1VBE2 4IETA 5E89A 4BMBA 4QPIC 4CPBD 4LLOA 1NAEA 1W0OA 2RE9A 2YFUA 3IMMA 1NCRC 2RS32 4IV3A 3VDBA 3WF2A 4EE2A 1OXCA 2TEPA 4C1WA 1SFNA 2UY8A 3C2UA 3GNEA 3DKWA 1VBB3 2NN8A 3CJIA 2PELA 3AB0A 1RITA 1ALYA 2VH9A 4P9IA 2PTMA 3TEXA 4AHXA 5A70A 1GBGA 2IUWA 1O59A 2ZX0A 3VBFC 3WNNA 1AHSA 2XJRA 1IHMA 4HKLA 1YJKA 2FQPA 4IEWA 1UN1A 5A3NA 3ACFA 3LEMA 2VBBA 3ZVXA 4FPFA 1SBFA 1OVPA 2QQJA 5EJZB 2RMU3 1RUNA 1AR72 1HRI3 4OHWA 1NE4A 5DUXA 4PHZA 3IIAA 1YI7A 3ZYHA 1R081 3THCA 3Q8CA 4XBNA 2MEV3 4YG6A 1W2AX 4TWTA 1RMU2 5LBEA 1XBFA 4KL1A 1Y7BA 4LBQD 3L2HA 2R071 5IYYA 2WR9A 4M4RA 4XACA 3I2FA 1D4M1 1RVF2 2FCUA 4XFAA 1VRH1 2Y6KA 2VCBA 3HN1A 3NNLA 2B42B 3KV6A 4BLIA 4GMP1 3B00A 2F6BA 4HVRA 4L8QA 4XHXA 3ME2A 4UW4A 1SCRA 2JG8A 4IV3B 3GJAA 5I0DA 1FAYA 3PHMA 4V1PA 2EICA 4OUEA 5I93A 3PUSA 3KCXA 3BOPA 1HXS3 2E32A 1H2KA 4JDNA 5BYNA 2XONA 3LD8A 4AHWA 4B4QA 4AQ6A 1SG3A 1ULFA 3VBFA 3NW4A 2PQQA 5CEHA 4XUNA 3WG1A 3N9NA 2AACA 4XABA 1XYNA 4IGPA 3HNMA 3T2OA 1UD1A 3OPZA 4E2QA 4N43B 5KBFA 2Y0IA 3NNFA 4XXAA 1HB4A 1NE6A 4QMAA 4CUGA 4D8MA 3VDAA 3NQHA 2BGPA 5FZCA 3C7HA 2VGDA 5B4NA 2CGPA 3QCWA 1QJX1 4AW7A 4XJ9A 3GM8A 1KDMA 1K5MB 1QOTA 2CNAA 1Q43A 2OQ6A 3CBNA 2AGSA 3IDBB 3JXSA 4IGQA 5GJ6A 1GICA 2ZHNA 4IV1B 2WYFA 3S7EA 3HQUA 3O1SA 1OOPA 3T1LA 4GH4B 3UT0A 1MQTC 3KT7A 1AF9A 2YU2A 3PU3A 4X6RB 5CFCB 3NKTA 2RR12 5CG9A 2JDAA 1ZVFA 4IV3C 1WBLA 1NCQA 3ZSKA 4XVHA 1HQNA 1RUE3 2YHJA 4KWKA 2IC1A 1FMD2 1LKNA 1TEIA 3OSDA 1OFSA 1U5ZA 2DCZA 2PXJA 1W39A 2KD7A 1WW7A 4KMQA 4IEPA 4LO6B 4QPWA 2VUCA 2HEWF 1RUJ1 5F5AA 4PDWA 3ZXKA 1RHI3 1XXNA 2P1BA 2WNVB 5A3MA 3FJSA 1MZ5A 2HJIA 4FSJA 4AE2A 2PYTA 4NPMA 3BU0A 1NZCA 3WD5A 1WW5A 1VBC1 3I2OA 5ANQA 3EXUA 3N7KA 5ACA3 2WFF3 1AR82 2WNOA 2C6SA 4UFJA 1SLCA 1PNGA 2W1WA 2LW8A 4PI2A 4AVVA 1LB2A 2DFBA 2NZ9A 5LBCA 4XCBA 4JTOA 4A45A 3GZEA 4CUAA 3ABZA 2JD4A 3OTFA 1VBB2 2WN2A 3TNPB 3VBHC 2RM22 3OGGA 4DRVA 4JGZA 2CAUA 1LGNA 2OXBA 3ZDSA 3JQWA 2AH2A 1PO21 4QDQA 3UJQA 1QJU3 2OZJA 2PHRA 4QB6A 3BVCA 2UWCA 3ZX7A 1TME1 3TN91 2RMU2 4Q4V1 3RYRA 4BK4A 4HVQA 4YFWA 2J1UA 4YW5A 4Z1VA 1PZ7A 1US3A 5FY7A 3KHCA 4FTSA 3E6DA 1IPJA 4HN1A 4AI9A 4CEYA 5J37A 3C7EA 3VZOA 1KDKA 3UJOA 1BVP1 1TQ5A 1UU5A 4YG3A 1RUC3 1EPZA 1BXHA 2ZHMA 5FR3A 1XYOA 3WUDA 4XMAA 2VTXJ 4FXKB 4XUPA 1NX9A 2CWMA 2G1MA 2W68A 2FMDA 3AMMA 3KGZA 1UOBA 1GZTA 3KHBA 1G8WA 3MV11 2XJVA 4WV8A 5FZKA 5I0UA 3H8XA 3MUZ1 1W9WA 2ZBJA 1CAVA 1PK6A 3J26N 5IAVA 4R4ZA 2JDMA 4RGKA 2R062 2A5ZA 5FPZA 4QPYA 2F4PA 3F95A 3MIEA 1RUH1 2EA7A 2J42A 3PL0A 5T55A 3T1MA 3WG2A 4LXLA 5LB6A 2CU5A 5FZ6A 2DVDA 2Q8EA 3LCPA 4N53A 4LBNA 3GF6A 4JQTA 1JZ5A 2GC3A 1J3RA 2BVBA 1LENA 3RZKA 3AP6A 5BUVA 5IFTA 1DYOA 2BP6A 3V0AA 1W06A 1W3VA 4EZ4A 5LY1A 5GM0A 3IIIA 2HWC2 3G6JB 1L7LA 1YFWA 2RS11 2W91A 1N1SA 5EHDA 1PO13 3D6EA 5J98B 3T0DA 3S5QA 1QIQA 1JYXA 2ZHLA 3M1HA 3P6BA 1ND3A 4PIZA 1S55A 5F9TA 3T0BA 1Z7S2 4CDQA 1MR5A 5E6HA 1RUF1 3HAGA 3VKOA 4CDUB 3WDUA 2QQIA 3OD4A 1C28A 5IHRA 1V9U3 1SPPA 2QQUA 4XF3A 2ZMLA 5JI7A 2AR6A 5FMOS 5DAQA 1J1LA 4V2VA 2BPA2 1DIWA 5JOZA 2Y6JA 5JWPA 4QKBA 3BTZA 5FMDA 1HV1A 2BERA 2QBXA 3DPRC 3WX5A 1PGL2 2ZOEB 1F5FA 1OQEA 1PK6C 2VMIA 1FXZA 2D7FA 4QPIA 5TSWA 3RZMA 1CAVB 1PK6B 2JWPA 5FMOL 3B01A 3DYMA 1TME3 1CAXA 1DU3D 2P17A 2R1BA 2UURA 3ORJA 2K9ZA 4HT1T 4YW4A 1HN1A 1NOVA 5LA2A 4DIQA 1GZ9A 1XSQA 3TNQA 3PVBB 5L7OC 4GAZA 1ULEA 5CISA 4JRLA 5BNOA 5IK7A 4I0AA 1JUIA 3DECA 2GN3A 1A34A 5HCFA 3CJXA 2KR2A 1BMV1 4KG0A 1W9TA 5JIUA 1CX1A 1PO22 4LOSA 3V0BA 2RS53 5F3GA 1UL9A 4XBQA 3THDA 4CP0A 1I9RA 2QQVA 2J1EA 3AXEA 4JGYC 5JSRA 5FP7A 5DZGA 2GALA 3PIJA 4CEYC 4XILA 3MO4A 1L7QA 5FYMA 3RI8A 3E97A 4LKSA 3MGUA 3RMXA 3H8RA 4MGKE 2EVXA 2XVGA 3OBZA 4L0PA 4LBKA 3ZYGA 2BFUS 2OS2A 3WQ0A 1PVXA 5EYXA 3VKFC 2Y33A 4LLFA 3FMGA 2XHNA 3A4UA 1LR5A 2HWD3 2R32A 3RWNA 4E8DA 5I0RA 4BJ0A 3AJZA 4Y1YA 5KHHA 2J1AA 5JAXA 2EIBA 4N43C 1J58A 2YDEA 3ZFFC 3AZYA 3IPVA 4HN0A 5I91A 5LK7B 1U12A 3BYWA 3ZFGC 2E33A 2J1RA 3IZOA 4H14A 5FXZA 5C8CC 4LULA 2CTVA 4P02B 3ZOIA 2H0VA 1IQDC 3NJVA 5IVJA 5CVRA 1UZYA 5SV5A 4FTBA 3O1OA 2GN7A 4DY3A 3VHOA 2J22A 1HJFA 5LW9A 1O3TA 2P6CA 3CMGA 3UL2A 4OI4A 2OVUA 3AZXA 1W9YA 1S0JA 4ZXEA 4DRRA 3T09A 4NE9A 5FQ0B 4QXKA 1ZREA 1JZ4A 1JYNA 1O3QA 3IDAA 2BFUL 4FOYA 4CEWC 2VXRA 1AR93 1OMIA 4NOTA 1JHJA 1RC6A 1UXZA 3U78A 4EN8B 5KC6A 4IESA 4DQAA 5LEKA 3A21A 1ONAA 3CQOA 2KM2A 3K2OA 2ZKNA 1POQA 4PF1A 2WABA 4HKWA 4ZZ5A 3H8OA 2JDYA 1OOPC 3ITQA 1VJ2A 1Z0HA 3KWVA 3M3QA 1A6CA 3H50A 4BU2A 1DQ2A 1YNAA 2VBPA 3GZUC 1L3JA 1WCSA 4O65A 5A3TA 5DAPA 3N35A 2A71A 2YYOA 2P37A 3SH5A 2QZ2A 1S0DA 1STMA 1UZZA 2RDRA 4XF9A 4Y5Z0 3GBGA 4W6YA 4Y1XA 1Y9QA 4QM9A 3W20A 1FT9A 3ETQA 4XDOA 4OI2A 2Z5WA 2YY1A 4M4PA 4GB33 4P9JA 1QHDA 5DZFA 3A0KA 4WM8B 4AR2A 4IEUA 1ZBA2 5JCTA 4W8JA 3RQ0A 4CEWA 4YWAA 4CU8A 2QTWB 1ODNA 2ZGLA 1RUG3 1JOPA 3DV8A 1QNYA 1QQP2 4GJYA 3RGBA 4WM7A 3E1F1 2VAUA 3POJA 4IV1C 4KU8A 1UCXA 3JZVA 1ST8A 5AFEA 1OQ1A 4DUWA 1AX0A 1OURA 1Y43B 3MW2A 2B7YA 5C3QA 1JZ3A 2HWB3 5FZ9A 3AFKA 3TBDA 1ZRFA 2W5FA 1CX4A 2C9AA 2ZGUA 2AEZA 1MQTA 3ETPA 3G7DA 2DVFA 1V6IA 4JDMA 4QD2A 4A7KA 5FYZA 4RD7A 3SCGA 1U5YA 4Z2AA 2D6OX 1HB2A 2DU0A 3WT3A 5E16A 1YI9A 5L7OB 3A22A 3LPGA 2NYYA 1V6JA 5FZDA 2WN3A 1Q8PA 4OHXA 4QKFA 2QJVA 1O8SA 4NPRA 1PMIA 2IXJA 5HCAA 4XURA 1CD3G 3T3YA 3ZR5A 1K42A 3Q8AA 5F6LB 2YGLA 1EP0A 1QGLA 1ZRRA 3ZN6B 3HT1A 4MGSA 4UT5A 3VBRA 4AFCA 4AVBA 5FP3A 1OC1A 1YLLA 2XJQA 4M3CA 3I4IA 1K5MA 3MUY1 4XF4A 3A0NA 1GFF2 4DPNA 4X6QB 1ULCA 2ZHKA 2XLFA 4AF9A 3FFQA 5FKBA 3FFZA 2ET7A 5FZ8A 4UFLA 1FNZA 3UNPA 4JTNA 2GDFA 2WWSA 4HG6B 4M3CF 2G9FA 1BEV2 3I2GA 2EIEA 3OY8A 2Q1MA 3P3PA 1TMF3 4DXTA 1Q3EA 5HPOA 3AVRA 1B35B 1BJQA 4ASLA 5EIYB 1LHUA 2HWF3 2ZCWA 3FUOA 1GOHA 3K46A 4C0HA 5F3IA 4UW6A 5LA1A 4XEZA 2ILMA 3O1TA 1K5JA 2JG9A 4H7MA 1J1TA 1CPMA 1A78A 1W3XA 4AAXA 2QQLA 4OZXA 3PMEA 4RQPA 2DCYA 4KGQA 1AL0G 2DUPA 1OA3A 1VRH3 5J3UA 3S57A 2BW8A 5FRAA 1AR91 4XFCA 4YZ5A 3JBG2 3HMYA 4C91A 1SCSA 1XSRA 1JMUB 1W8ZA 4EN9B 1NT0A 4KWUA 3CU7A 1EUUA 3QBQA 3CJIC 1W8TA 1AR73 1HRI2 2YBPA 1HW5A 4JGZB 5FYSA 1SHWB 1BQPA 1SMVA 4QU1A 4PIXA 2WO2A 3OUJA 2WWUA 4JVAA 3OUIA 5T54A 4QM8A 1DZRA 2CWSA 3LIGA 3CKHA 4IGOA 4B1MA 3MZHA 3CO2A 3NV4A 2LRPA 3OY8B 4YNIA 3NL1A 1UNBA 5FZOB 1WA6X 3MI8A 5HV4A 4E4DX 3SKVA 3POSA 2G9GA 5F5CA 1JOBA 5SV8A 4P5YA 3FBYA 2WZEA 4CCOA 4TTGA 2VMEA 5FY4A 1S0EA 2XR4A 4GB32 4I3PA 2W3JA 1LEDA 2H6BA 3JUUA 5JXIA 1ZNPA 3WF3A 4RQPB 5IVCA 4F7ZA 3R4SA 4YRDA 3DEMA 4TLGA 1W6OB 5FJKA 4W6XA 3RZHA 5FZLA 1KFXL 1IPKA 4Q27A 1PHMA 2WSUA 3PUHA 1JS9A 1JYVA 1NLRA 5DZEA 1MZFA 2SBAA 4LHLA 5K0UC 3TRSB 1OI6A 1GU3A 3H8UA 2VVDA 3V0AB 3NV1A 2VW1A 3I49A 3KVAA 1OF4A 5T5LA 3ZPOA 5T50A 3VBUC 1PO23 1VB2A 2RJKA 3AKQA 2X10A 1W6NB 2R7EB 5LATA 1MS9A 2HYKA 5FK8A 4QX1A 3RZZA 3USUB 3KQRA 3L2YA 5CADA 1R083 1LECA 1K3IA 2RG4A 2WSVA 1O6UA 5FZOA 5JVVA 4XFGA 1DGRN 5H9QA 4CDUA 4DXRA 4IEOA 1WW6A 4QPGB 5CKNA 4O9EA 1DDLA 5FZBA 4Q0QA 1AYN3 2ATFA 2D6MA 3CJIB 3JB8A 2JG9C 1I6XA 3TYJA 3H3UA 3R4UA 1GOFA 4YM3A 1JYCA 4HPKA 4RGGA 2QE3A 2B9VA 4XFIA 1QXPA 5EP9A 3HN3A 3BODA 4CCEA 1XE7A 2RJ2A 5FZMA 1JXNA 2Y34A 2CHHA 1RUH3 1AR83 1MEC1 1QJFA 3P1IA 3LOBA 3JD72 4XW3A 1V6LA 4PJYA 3OGSA 4YGDA 4Q29A 2W1QA 1RUC2 3Q8EA 2YV8A 4FTEA 4MO3M 1HXS1 1Z7S3 2TUNA 5BNOB 1CJDA 5FPVA 4NMIA 2JDUA 3BI3A 5KHGA 1DQ6A 2R16A 4PDWC 3J7NA 5KHIA 5GLTA 2G19A 3HQRA 2HWD2 4OCTA 4R9CA 4FFIA 3U14A 4FAGA 5C9AB 1W6NA 5CG8A 1ASJ1 1CONA 4Q4W3 3PJQA 1U5IA 1UY0A 1W90A 4COYA 2VCMA 1QOOA 1KFUL 1GQPA 4PQQA 3USUA 3CHXA 1VBE1 2D97A 2VMCA 1G7YA 1I3HA 4G3YC 4HSLA 4LHNA 3RWKX 3E6CC 4QX8A 1C1FA 1PIV2 5LASA 3LFIA 4UBGA 4Q8KA 4Y5TA 4QPGA 2CDPA 3VZKA 1YIPA 4TN7A 4K8RB 4YZ2A 4PLMA 4XAAA 3B93A 1LULA 4AFMA 2ZS6B 3NNJA 3E6BA 1RUG2 3VBFB 1JOJA 5CB7A 2C0ZA 4P9LA 3CEWA 3ZXDA 2J1SA 1ULDA 2O8OA 4J6GA 3DYPA 3OF1A 4RHV3 1I5ZA 5HV0A 1PO11 2JJ6A 4P5HA 3AKTA 3H0OA 4AHYA 4YVSA 5J09A 2K2SA 3MLKA 3E5XA 4HVOA 4MUVA 4TYSA 5FZGA 2YZ4A 3D4KA 5A32A 4JCKA 2IZWA 3AC0A 1DG6A 3ILRA 4R8HA 4OHYA 1QJU2 1W2NA 2XKOA 3AL6A 2VZRA 4GH4A 3AZZA 3RDIA 5C70A 5FQ0A 4LBQB 3ACLA 2WO3A 3M4FA 4I0WB 3C8XA 1SBDA 5AVAA 2R042 4Y1VA 1DF0A 5FYHA 1CESA 5AC93 4ISRA 3NJYA 4CU7A 1WKYA 5A3LA 1VAVA 3EB7A 2WFF1 2ZTNA 3GGLA 4W65A 1MEC3 1H1AA 1OSGA 1X7NA 1W8WA 1QQP1 4JAAA 1POV1 3PIGA 4CXWA 1LHVA 1YFUA 3FZ3A 3NAPC 3N3HA 4G4FA 4WM7C 4Y20B 4ZKTB 5H9PA 2O14A 5DDJ3 4ES8A 5A3PA 4BZ4A 3SH3A 1EAH1 1RHI2 5FZEA 5APAA 2VECA 2XG3A 5FY8A 4ZU5A 3ZLIA 4EZHA 1NA1A 4RHV1 2HWE2 4CRQA 5A1LA 2VU9A 3K3NA 5A6YA 2G9ZA 1AXZA 2NLRA 3EQEA 2AUYA 4HONA 1XRUA 2EALA 2CDOA 3O1PA 2XVKA 1RUC1 4YVSB 4BB3A 3VUOA 4CE8A 1DZTA 5DUUA 5KR7A 4HOOA 2XLGA 3FHIB 3E5QA 2VW0A 1BBT1 3NKGA 3NWKA 3J7HA 3S30A 3AYDA 5FYVA 2D5FA 4E27A 4OMDA 4RGAA 1FATA 1IG3A 5EXOA 5F1RA 4Y26A 4WM8A 2EAKA 3MBWA 2WLPA 3B69A 4OQ9A 1KD7A 1R091 2D6PA 4UFHA 5AC92 2BRTA 4CYDA 4XUOA 1QDOA 1GZWA 2XOMA 4MADA 3X29B 4LTAA 1MS4A 1A8DA 4FCAA 4NVPA 2Q5TA 2EF6A 4NHLA 4XC9A 4N90A 1PZ9A 4D6SA 4RR3A 1F9KA 4UBHA 3BTXA 1IQAA 1DP0A 1QH6A 3FLPA 4EJRA 4Z07A 4EWAA 4NWWA 1RUJ2 4LHKA 2B45X 3O0WA 1XC6A 5J48A 5GLWA 1KJRA 1EAH3 4KBBA 1DYPA 4LA2A 4DXSA 5F37A 4QGLA 5IVBA 1NCQC 3W5MA 1VBC2 1TMF1 1F2NA 2ZX2A 1YFXA 3ZKYA 2GNMA 2ZMKA 3VBOA 1V9U1 3NVCA 4FPJA 4CDUC 1QXRA 1WCKA 1DQ1A 1TZOA 4WZCA 1S0GA 3FX3A 1RMU1 2VG9A 1RUF3 2XLAA 3EYPA 1WZXA 4CCDA 1V6KA 3BU7A 2WQZC 2WIIB 4NIHA 2DYCA 3BN6A 4FPKA 5T3NA 3MF6A 1LOFA 2A6YA 2CSGA 1J3PA 4UYBA 3ZN6A 1QJEA 4LUMA 5FXWA 4AL9A 3KD4A 3NJXA 1MS1A 5DQ0A 3PNAA 5ACA1 1JZ7A 5FBJA 1J3QA 5FXVA 1OHFA 4UXAA 5C71A 3I2HA 3RYPA 4IEZA 3WP4A 2BZDA 1V6NA 2JDKA 5K0UA 2YFZA 1JHNA 4HL0A 5FZ1A 4IEVA 4MGIE 1UZVA 2FDKA 1LODA 4XQDA 1UPIA 2D3RA 1F35A 3ZIWA 1CWPA 1S0BA 2F4LA 1WLCA 3RI9A 1UPSA 2XXZA 3MF9A 1VR3A 1QY4A 4Q4Y3 4GWJA 3APBA 1T6GC 1ZA7A 1DFQA 1UU4A 2VVEA 2VZPA 1Q5OA 3KV5A 2V09A 1GLHA 2VZUA 3WW3A 1BBT3 5A6QA 1WCUA 2R043 3THPA 1XE0A 4AQSA 1VB4A 2OPWA 2V4AA 4NIDA 5JMCA 1SLLA 2GNDA 2FZ2A 2Z79A 3WG3A 4FT8A 2ZABA 3FHQA 3OGJA 5FZ3A 3UKNA 2OT7A 4MGZE 3MW3A 4MZUA 4OFGA 1W8OA 2C26A 1QWRA 1QKQA 3LPFA 5E1RA 5F3EA 4D7TA 5HI0A 2BVVA 1RB8G 4C0BA 1JZ2A 3KVBA 1AYN2 1SDDB 2WT2A 1DLCA 5L73A 5H9SA 2ZMNA 3ZXGA 2K0GA 5L9RA 2HWD1 4XFBA 3ZR6A 1C4RA 5C3OA 4OLLA 3WDXA 2GAUA 3KMHA 2JECA 4CCKA 1GQGA 4BQ1A 3E5UA 1ZZ9A 1NY72 3N7JA 2JIJA 1POV3 4WZFA 2VO5A 3HT2A 2FCVA 2FBEA 1GNYA 3K48A 3PVOA 5K0UB 4L9BA 2CL2A 5LY2A 4LIUA 4W4ZA 4C8DA 1QXJA 3O5SA 5FYYA 2FDIA 2JE9A 1X8MA 4BQ4A 4A3ZA 1J83A 4H55A 1OVSA 4K7JA 4IUGA 1MS3A 2DCTA 2W46A 4RA0A 3LIHA 1C5IA 4Y4RA 4D3WA 2VZ3A 3H1YA 5EV7A 1PVC3 4D7SA 5IFPA 1Q56A 2HWE3 4NHMA 2ZGOA 2OYZA 4Q4W2 5K8SA 1UZ0A 3VD9A 1ENQA 2PFWA 4QPGC 3UKTA 1OFNA 2QQWA 3M3IA 1LHOA 1WD4A 3MPPG 1LTEA 4K9SA 1G9FA 2CAVA 2NPIA 5FZFA 4NROA 4AWDA 3VBHA 1XJAA 1Q8OA 1EYBA 2D44A 1LEMA 3AKRA 4Y1UA 1C8M1 4FFHA 4J1XA 1FYUA 2Y0OA 3H3ZA 4NIAA 3JU9A 4Q1RA 4Q0PA 1Q8SA 2JICA 3AZVA 1IS6A 3D0JA 3KT1A 4N7UA 5ACA2 1I1EA 1R64A 1D2SA 1FPN1 2BUKA 4XPVA 1NCRA 3W9AA 2JX9A 3ZFGA 2DTWA 2RDNA 1X9TA 4S2GA 4AGVA 4CCLA 1PGW2 1N3QA 1YEWA 2XQRA 4JX0A 3U10A 2BNOA 5BNNC 1AL23 3LGRA 2VZ1A 5F6KA 1IG0A 3NAPB 5JDBA 5C6CA 3TWIA 3I8TA 3OPTA 4P14A 4MGTA 4QX7A 4GWIA 3RG0A 4XJUA 5A80A 1RUI2 4AFBA 4D94A 3KZ4C 2FDHA 3VD5A 3I3DA 4A42A 3JBG3 3GJBA 1NXD1 4P9WA 3ACIA 5FUNA 3RSJA 5L9VA 2HWE1 1RUF2 4DEQA 1H9WA 5LEJA 3TEYA 1V70A 1LRHA 1MZ6A 2V72A 3GZAA 2Y60A 1U5XA 2PQSA 1RUG1 1KS4A 4AI3A 2RS12 4GKXA 1OPOA 2L9LA 3LF7A 3B02A 4BHPA 2QKDA 3AMNA 1YJLA 2VTFA 1TNFA 3LDKA 1PGL1 4LBLA 1SLBA 1IS3A 3D5OA 3K77A 3WLUA 4DMIA 1S2KA 3WINE 2YPJA 1C3HA 4OULA 4CCJA 5I0SA 2RS51 3T4VA 2P34A 4QQ2A 4CEWB 1SFPA 4CCMA 3TEWA 1GSLA 3ZXJA 1COV1 2V73A 3ECQA 3IT8A 3R05A 4CDXB 2R0FA 4U2AA 4YLZA 3RZJA 2JE7A 3AJYA 2QVSB 4L2NA 4L97A 4FQZA 3SCFA 2VQ0A 2DCKA 3I2IA 4L99A 4UF0A 3CZJA 2DFCA 4NN0A 5A1FA 2HWB2 4ATFA 5FOJB 1UO9A 3HBKA 3VD4A 1URXA 1GP6A 2ZA9A 4M0NA 4AEDA 2CY6A 1MQTB 3AKSA 4EV0A 1WA4A 2WBKA 4XQ4A 2A75A 1XB9A 5KXEA 2XUEA 1JUHA 3J8F1 5JOYA 1TMF2 2JENA 4LPLA 2ZEXA 1UY3A 1DQ4A 2R6QA 2HBUA 4LUKA 3WDWA 4BQWA 4DO0A 5L7OA 2MEV2 4S2FA 2E51A 2C24A 2QQKA 5DPNA 2W0XA 4Y33A 1DYKA 3TOJA 1XNBA 2VW2A 3MLLA 4FI9A 2JE8A 5DDJ2 3AVSA 3HR9A 3VZNA 2VZOA 3QD6A 4MHRA 4HZFA 4LNVA 2ZGPA 5C3RA 3VZMA 3S7IA 1XNKA 3USSA 1RUE1 5A32B 4IL7A 5FZ0A 3S6PA 3GHNA 2XJUA 1TVGA 3NO8A 1AX2A 3LEIA 5DAXA 5IVVA 3KLSA 2N7GA 2B39A 5D1IA 2WYSA 2FD8A 2EIGA 3POWA 3RZLA 3OEBA 2HWF1 4UFKA 3POEA 1WMDA 3I97A 3ZYPA 3NSTA 3HPNA 4LK7A 4P9XA 5C4WA 1LOFC 4DUVA 5JOWA 2GP3A 4LBQA 3KQ4B 4XDPA 2BDRA 1ZBE2 2I45A 1SEFA 2ARAA 5L36A 4A4AA 1R092 1ZBA3 1XYPA 4CDWC 1MVQA 1VBE3 2W87A 1LGCA 1GZCA 4AEJA 3TEZA 4QHBA 3N9MA 4B4PA 2W2IA 4GD4A 3C7FA 3C3VA 3QH6A 1YXWA 2ES3A 5J7MA 2WQ8A 5C8CA 3PDQA 1H4GA 5FIXA 3WW4A 2WZ8A 5FY1A 5JR7B 4CUBA 1LHWA 3B94A 2FDJA 3C7GA 2TBVA 3ZYJB 1C8M3 1UY4A 2W1UA 4QB1A 3NV3A 5K9YA 2JDNA 1G9CA 2X09A 5BXXA 5JPNB 4Y5SA 4MYEA 2FZ1A 3O1VA 1WLWA 4KBZA 3LAGA 2Q30A 2VBDA 1IS4A 5DMYA 2XHKA 2OW4A 4BXFA 1EUTA 1NLSA 4CU6A 2Q8DA 4BQ3A 3WF4A 1O5UA 5KC5A 1BKZA 1R1A2 2GP5A 5FZAA 1YIFA 2BJSA 3DF0A 4KQ7A 3T2TA 5FWJA 4Q8LA 2FDGA 2B5HA 3VB9A 3ZMNA 2VNVA 2R073 1O7FA 4BQYA 4TLFA 5DXDA 2LUWA 1D0HA 2YC2A 2W92A 4BA6A 5C4WB 5IK4A 4NPLA 4OI1A 4D7YA 3SH4A 2XJSA 4WVMB 4H3WA 1LOGA 2UYBA 4WVVA 1ZBA1 1NCQB 1CAUB 4MG2A 2D3PA 4UW3A 5AVPA 4EN0A 2DVBA 1RXGA 2ZZJA 4YG0A 4XXPA 1V6MA 3D82A 1YO8A 3C7OA 4P9YA 1XNAA 3NJZA 3U11A 2SLIA 3VBUB 4Z82A 4D6QA 5C7GA 2VOXA 2A70A 2WNVA 4NJ4A 2H6CA 4BIFA 1WLTA 3K51A 4YGEA 4RSUA 1U0AA 1NKGA 3ELNA 3KCYA 4LO8A 1C8M2 2RS33 1DLLA 2OUJA 1KITA 1YQ2A 2Y26A 2DDUA 3BIEA 5HCHA 1COV3 2BQPA 2GMPA 3ST7A 4YVWA 3N9LA 2BTVC 5A7SA 1MPXA 4H7LA 1AYM1 1OBNA 2Q0AA 1E5SA 2VMDA 4XAEA 5BNPA 2BWCA 5C5TA 4OUSA 4FPYA 3VGIA 3MIDA 1AYN1 4KWJA 5FO8B 2RR13 3GCWA 3QH7A 1ZBE3 1N3OA 5FMCA 2QDRA 2YUEA 4YW7A 1NLQA 5IVYA 3CF6E 2AZ5A 4CU9A 2XL7A 5KXBA 3VBSB 1JYIA 1B35C 1X50A 1FOD3 3J9SA 4WVMA 3ZSLA 2W52A 1F15A 3WP5A 4HSJA 1ULOA 1H8TC 5C3PA 4E2SA 2DVAA 4R4XA 4FO9A 4E4SA 3JQXA 4QGNA 1SZBA 3HVDA 5F3CA 4FOVA 4XBLA 2X5IC 1GWMA 2A3WA 2AEYA 2X5IB 3AZWA 3KF3A 3OB8A 4UOJA 2D6LX 3HBZA 3VBUA 5JMOA 2XBO3 4I2OA 3ZM8A 4GB31 3O1MA 2HWC3 2P6HA 5A6XA 3DGTA 2AENA 3K3OA 3MV01 1HJGA 4JDOA 2BU9A 1PZ8A 1RJ7A 2VNGA 3AP5A 2EAAA 1SLTA 2C5DA 1QJY3 2VOKA 3MIGA 5FP9A 1SQ4A 5EQUA 1KQRA 1QH7A 2JB4A 1Q8VA 4N53B 4Q2FA 1XNDA 4JKMA 5LK5A 2VULA 3M3CA 3I2DA 1DGLA 4JKLA 4OZOA 2WQ4A 3W58A 1JN2P 2WO1A 2OA2A 3KM5A 2DCJA 1VBB1 3BIWE 2H0BA 4JZRA 1ZX5A 2R49A 2VQTA 4RS5C 2HWB1 5GLVA 3U07A 3BUCA 1W6MB 2AREA 4TZDA 3I3QA 3LA3A 5JZGB 5G05L 2ADDA 3IAPA 1FOD2 2A3XA 3MIHA 2DUQA 3T30A 1YRZA 1TME2 4DFSA 4FXGB 4GMP3 5FJHA 2HH9A 1FPN3 4FQ4A 5BPXA 2JG8C 2BGCA 3U4SA 1O3RA 3WQ7A 1ACCA 5EFUA 3ZFEB 1Y4WA 3FHAA 2IXCA 1W6PB 5FZHA 2VMGA 4QB2A 2VY0A 3LA2A 4K8FA 2VMHA 5JI9A 5A7WA 2MEV1 4XJWA 4CP1A 3O1RA 1F5JA 3FE5A 1X36A 2PLV2 3LEKA 3WDVA 5A3OA 4GQ7A 2V4VA 3WOGA 1WCQA 4NRPA 5D21A 1ENSA 1G86A 1GWKA 2DBIA 4Q4V2 4QGMA 5FWEA 1A8MA 3OUHA 1GKBA 3PUIA 1FV2A 4PBPA 5FPUA 2R061 3VD7A 3ZXLA 5BNPC 4IQPA 4HLTA 4ZS3A 4IEXA 2JIGA 2VC9A 2XH6A 3AX4A 3IDCB 4KNCA 1YHFA 3RPQA 5I0TA 4R9DA 2NP0A 4HBNA 3B3QE 3KSCA 3LWCA 4WVWA 3I54A 3N36A 4XJ8A 4CXYA 5AFBA 4DZGA 1RUI3 4HMZA 5EPAA 2WNUC 2ARXA 2PN5A 2E9QA 3DPRB 3AMPA 5EZWA 4AEMA 2FHRA 3O0XA 1WGPA 3R6SA 4YZ1A 4XJZA 3UESA 1HDKA 4CDQC 1GP5A 1OUSA 2R0HA 3VBOC 3VLBB 3ZFEC 1LAJA 1XPWA 4KH9A 1Z7S1 1QJY1 2VOTA 1OA4A 4ZPIA 4CA9A 5CBLA 3I3MA 4LE4A 2VOWA 3WDYA 1O91A 2LS6A 1GNZA 1QJX3 1W6PA 3O0VA 3HNYM 4M00A 1OLQA 4NHXA 4QHZA 4AAPA 5LRSA 4UAPA 5CAZA 3IBMA 2Y6LA 3RS6A 4GA9A 4BWOA 4Q5OA 2JDZA 5ABJC 2W08A 5A7WB 1ZRIA 4YW6A 4D69A 1CJPA 1ZZCA 1PVC1 1NA1B 3LSEA 5FV3A 3WQBA 2HKXA 4S2HA 2HYXA 1VBC3 5F5QA 4N43A 4LO5B 3OG2A 4PI0A 2ENRA 4TXWA 5LRRA 2Q8CA 3THTA 1PO12 2ZEYA 2ZGNA 4NO4A 2BV4A 5L9BA 5LCWL 5C3SA 3VD3A 1NQJA 1VBD1 2RM21 1X33A 4I01A 4LKFA 4YZ4A 3ZXFA 3ZYRA 2R30A 4QT6A 1HRV1 2Q1FA 2Y6HA 3VDDA 1H2NA 1LGBA 4K6BA 1DCSA 5DUVA 4IEYA 1QJU1 1JW6A 1MEC2 1CQ9A 1N1YA 3DCQA 4B7KA 3TN93 1UX6A 3OGVA 2WAAA 2ZGMA 2ARBA 1CR7A 4NR1A 4AI0A 1UOJA 2VJXA 3BPSA 2LALA 5GALA 5JUVA 2VL4A 1TNRA 3FUQA 1VRBA 3VKNA 4NAOA 5F8PA 4A3XA 4CDXA 2PA7A 2PAEA 3UV9A 5FY0A 2P3JA 3ZO0B 2VVFA 1W05A 2XBO1 5FK7A 2HWC1 2ORXA 4IERA 2Z69A 1T2XA 4PDWB 1V00A 1ZBE1 3MHZA 4URTA 4XZPA 2RDQA 4RQPC 1BMV2 3Q9OA 3ACHA 3LDBA 2X29A 5JSOA 1XOYA 5ANNA 4CP2A 1HN0A 1F8VA 2GNTA 3IDEA 1UAIA 1RTVA 3ES1A 3V64A 1JZ6A 3LA7A 3VBOB 5C5UA 4FAHA 3M8LA 5FPLA 4C1XA 3VKMA 4N53C 2J1TA 5FYBA 2XQXA 2LROA 3PVEA 3SCHA 4JGZC 4Y24A 2WNVC 1JODA 3OBRA 4XF1A 3HD8B 1ASJ2 4Q4X3 4FPCA 4E4ZA 2VQAA 3M3OA 2WNUA 3BTYA 4LBMA 4FFFA 1VAMA 4GJZA 1YQCA 3ZYIB 4OUMA 5F2SA 2UWBA 3A7QA 3K4ZA 4E4HA 1REDA 5GLUA 3WNMA 1RIRA 4XYXA 1F4HA 5DAWA 3RJ2X 2WT0A 3H3LA 2E7QA 2J1VA 4LA3A 1PM4A 1AR63 1Y3TA 1W99A 1OD3A 4LQRA 4N9HA 5AC91 4R52A 1K12A 4A6SA 1QJY2 4LKDA 2FDFA 4WM7B 3LOIA 3AXDA 5FBZA 3RJRA 5A3WA 4CUCA 2EXKA 1VBD3 1REFA 1W03A 3UETA 5A33A 1YYNA 2CV6A 1LOBA 5FZ4A 1HB3A 5A7PA 3WDTA 3ILFA 3OBAA 4FPLA 4LITA 1LJ7A 1AX1A 5BY5A 4AFDA 1HQWA 1UY1A 3WF1A 5C8CB 3H7JA 1C8NA 1EY2A 1UMZA 2MNGA 2W1SA 1W2OA 1XU1A 2RV9A 5FP4A 3LKJA 2ZKLA 3HQXA 1AZDA 4FPGA 4O61A 3T2PA 2DURA 1ZRDA 2JDPA 2OX0A 4LHSA 3ZSEA 5BNOC 5BNNB 1Z78A 4CSWA 1EAH2 1D2QA 1RHI1 3AKPA 5JOXA 1AJKA 4FVVA 3EHKA 3AFGA 1MS0A 1H4HA 2W47A 2W94A 1H6YA 3JCIA 5FP8A 4XE9A 4B29A 1EV11 1UYPA 3VBRB 1ND3B 4BK5A 2VD7A 4Y1ZA 4LK6A 4M3CB 3QOPA 1HV0A 4QXBA 5BNQA 3H1WA 3GYDA 4LO4B 1CAWA 5FYIA 4AXOA 3K4DA 3RNSA 5FREA 1SPPB 1W6QA 1MS8A 2HEYF 1ZA4A 2VNOA 4ITCA 4CTEA 4K1YA 1BBT2 1WUVA 1DZQA 1M06G 5LWBA 4PBOA 5CNAA 1GP4A 1VBA2 2Q4SA 4NRQA 4RHV2 1FV3A 5A33B 3SHRA 3GXUA 3W21A 2A1XA 2WWJA 3BALA 4AGRA 4GXLA 4PIYA 4Q1PA 4QQLA 1IKPA 1B35A 3WP6A 2JKBA 1APNA 4H2AA 5LBFA 4DXZA 2DUOA 3OCPA 1LOAA 3WXPA 2GSYA 1S2BA 1H8TA 4QKDA 1LHNA 5BV6A 4E9KA 1DHKB 5IAXA 1RMU3 2D93A 4QQOA 4B7EA 1AVBA 3MIBA 2GH2A 3N9OA 1PX4A 5CKMA 5JXGA 2D6KA 3V0BB 2ADEA 4QQPA 3O1UA 2PHFA 2IFWA 5FLHA 4BMEA 1OQDA 1NCRB 1GMMA 1V9U2 1SDWA 4R9BA 3ZFGB 1XQNA 3AP4A 2VZTA 2D43A 4DUXA 4ATEA 4CVUA 3HOBA 2PHXA 1MVEA 4LR4A 2ET1A 3J7MA 2EXHA 4K3UA 1ZZ6A 1CAWB 2KXLA 1QNWA 4QQHA 4XUQA 3UGFA 5GZCA 1H1MA 4IE6A 3LDRA 4QWNA 1RYYA 1YQ6A 1X82A 5CIRA 5F7UA 3SXWA 2OKXA 2YPDA 5C9AC 3HIFA 1AJOA 4R9AA 2EXIA 1D4M2 1IPSA 1RVF1 1YCIA 3IPVB 4NAMA 1PVC2 3ZSJA 5FY9A 3URFA 4NUBA 4GKYA 1AR71 5IW0A 4CDXC 2YMZA 4MVTA 1EV13 2YGMA 4YVSC 3D3AA 3IB3A 3SNMA 4BQXA 1L7RA 1FMD3 1QOSA 2WAOA 3O12A 4BH9A 1HB1A 1R082 2X5IA 5HXVA 3WNPA 4E2GA 2FMYA 5GZFA 2E26A 1OLRA 1RINA 1A3KA 4MSVA 3WR0A 1G9DA 4G9SB 4M01A 1E5IA 4OHZA 2UWAA 2XPJA 1PMJX 2IXIA 4C90A 1HRV2 2PHTA 3DXTA 4FFGA 1E57A 3U1XA 4Q0SA 4Z2WA 1UZWA 2WS91 3OD0A 3VHRA 4B1LA 4AI8A 2VUAA 2BGOA 2IXHA 4NIIA 1OKOA 1RGSA 2PHWA 4MHUA 1PIV3 3HNBM 3AMHA 4SBVA 4XHBA 4MXWA 3RZGA 4RL7A 1KXGA 1GR3A 1GANA 4HK9A 4AVCA 1PGW1 2ZZQA 1MACA 1DQ5A 2XJTA 2WZPP 3HWJA 4Q4X1 4LMFA 5FCCA 5T5PA 2ZEWA 4MX3A 4BLJA 3WZ1A 4LORA 5FMBA 2XGXA 1K45A 4AEDB 1ND3C 3VV1A 1OLME 2RS31 4J25A 4ZONA 3LSDA 2GC0A 4JGYA 2QQMA 5C8WA 2VXJA 1GWLA 2RDSA 2PHUA 3ZFEA 4J1WA 5F5IA 2DBNA 5B4XA 2B8MA 3FL7A 4LT5A 1WCDJ 4DNYA 2ETEA 1FMD1 4GALA 3MW4A 4QDRA 3VN4A 4YM1A 4FPHA 1OF3A 1X8EA 3POBA 5ABJB 2OIIA 2ZGKA 4ZXKA 2HBTA 1JTZX 5D8AB 3VKLA 4XDQA 2JB8A 4PT6A 4XTPA 5I8TA 1ND2B 3HJRA 3MEPA 1BK1A 4S2DA 1J84A 3RYKA 1NY71 1KS5A 5GLZA 1IS5A 3N7MA 3B5LB 4JC1A 4EN7B 2ZX4A 3BCWA 3WP3A 4AZZA 2O8QA 3SQOA 4CXXA 2BOIA 4FP3A 1XNCA 3PJYA 2LTNA 3ILNA 2OQ7A 4QU2A 1COV2 4L11A 3ZXEA 1GYKA 4JV4A 4AK3A 4N7IA 3WNXA 1BEV1 4IE0A 1VRH2 4COZA 4YARA 5C9AA 2DWRA 2IXKA 4AQ2A 1W8UA 3V56A 1REEA 2RS13 1CIYA 3ZYBA 3P3NA 1KEXA 2PHDA 3VL9A 3OOXA 4Y3OA 1HQLA 3JBG1 3GCXA 3TN92 1F31A 4YVWC 2C9KA 4JGYB 1JH5A 4ZU4A 3WV6A 2K46A 2Y8KA 5KXCA 1O4ZA 5CYYA 4ASKA 3UK9A 1W0NA 1UMHA 1YFYA 2WA3A 3LZZA 2RVAA 4LBOA 4NHYA 4EWEA 1WMFA 5ABJA 4QX5A 3SITA 5A3UA 4NHKA 4ZZ8A 1LU1A 1VP6A 5D8AA 3W5NA 4LO7A 1AR92 1FPN2 4JRAA 1ND2A 2GU9A 3WHUA 2JEMA 2AYHA 2NMOA 1O4TA 3LFMA 3VDCA 3JD71 5FTTC 2CYFA 1JBCA 4CCNA 3IM0A 4COWA 5C33A 1B09A 1US2A 3KS7A 2PAMA 2X05A 1MZEA 4BYYA 1C57A 2I74A 4GWNA 4OHVA 1UKGA 4DINB 4BPZA 4EN6B 3GZTB 1ASJ3 2QCSB 3OGRA 1RUD2 4Q4X2 3RVHA 4Q4V3 3AP7A 3N9QA 4M3CE 4WBBA 4CPBA 2Z2SB 1UYYA 4ES9A 3QACA 1CAUA 2Q8OA 1H8VA 2PLV3 5G04L 2WINB 5FY5A 4P08A 3T2QA 5LA0A 4OVEA 4XOGA 1NZIA 3VZJA 2XWJB 2JG8B 3RFRA 1Y9MA 2GMMA 5A7NA 1KRIA 3ALQA 2R1DA 1AYM3 1SFYA 3OJBA 1WD3A 3K4AA 4BOWA 2LM3A 3POIA 4Y20A 1WLDA 1UXXX 3L9JT 1NQDA 2ZAHA 2WS93 1PX3A 3T0AA 4META 4E8CA 2P3KA 3ZFFB 4XJAA 3RMYA 3ES4A 5GZDA 4A44A 1H1IA 4X8NA 3KV4A 1QQP3 2XMLA 4YVWB 1IZ3A 1ENXA 1LESA 2X8KA 4AGGA 2VZQA 4AG4A 4YSFA 2QUOA 3PTRB 1SLAA 4FP2A 4Z8BA 3K75B 4XETA 3H1MA 1VAKA 1R1A1 1RUOA 4RYDA 2A6XA 3POFA 4RFRB 4GULA 4YW1A 4LBJA 1UF2C 3INAA 3N4MA 4HKOA 3FLTA 4LKEA 3DXUA 2Q1ZB 2VMFA 3VBSA 1ODMA 2WLQA 4AEDC 5CFCA 1RJ8A 1R1ZA 2VTXA 2XKPA 2YC4A 1UY2A 3EMRA 1GZWB 4HETA 5FUPA 5I8SA 1HXS2 1AR62 1W0PA 2W95A 3DUIA 3MDPA 1HIXA 4XCAA 2G4IA 1BYHA 4QXCA 4K40A 4RR3B 4QAWA 1W04A 3KF5A 3OBTA 5L19A 1BZWA 2PMWB 3R4DB 4F8AA 5DDJ1 1BCXA 4YW3A 3U4XA 3CL1A 1M4WA 1V0AA 2P5BA 2VZVA 4AVTA 4RS5B 1FX5A 3MYXA 3LB9A 3WEZA 1AUYA 1RUH2 1W6OA 1HLCA 4HANA 2X53S 1V6OA 4F83A 4QX3A 4CZSA 2Y6FA 1GNHA 2MHFA 2QFEA 3ON7A 3WW2A 5K7PA 1Y9GA 2NMNA 4INDA 4JKKA 3NRUA 1XU2A 2E7TA 4DS0A 4FPOB 5BNNA 2VZSA 1G9BA 3CZUA 1CZVA 1UYXA 2D98A 4I3GA 3SISA 1W6MA 1UOFA 3WCRA 4QHOA 3PMSA 4IE7A 4IEQA 4YGBA 1HX6A 1OH3A 2R063 3N7LA 3SEEA 3H42B 4KWLA 2BWAA 2P4EA 3WVJA 1EPWA 4XFFA 4A7ZA 4Q26A 4AI2A 1UKRA 1PM7A 1JU4A 5IUQA 4CEYB 4UFIA 2QNKA 3D8CA 1W6QB 4UW5A 1JZ8A 2QZ3A 2IVIB 3KB5A 3ZMOA 1UU6A 1JI6A 2HEVF 1JU3A 1W2TA 1ZZBA 4NWVA 3VDDC 4YM2A 1BEV3 4HPKB 2MPFA 3ZN5A 2WL1A 2UU8A 4WVZA 4XZUG 5CFDC 3DYOA 2ID4A 5IWFA 3FC0A 1GQHA 4COUA 5IK5A 1UMIA 2D3SA 2DV9A 1CGPA 3ASIA 2ZX1A 2GC1A 5FYCA 1F4AA 1AL22 1S4CA 5FDBA 2Z42A 4BE3A 3BB6A 2VCAA 4W6WA 5DUWA 1YC61 5CA6A 3FLRA 4IW3A 1FI2A 4XFHA 5CU1A 2E31A 2QQNA 3LE0A 4EYUA 4Q4Y1 4NRMA 1LU2A 5JSPA 1LCLA 1UWWA 4QX0A 1NG0A 3V65A 2XDVA 2XWBB 3OYWA 4ZS2A 5FYUA 3SEPA 1H2LA 1UIKA 5DABA 2Y38A 2R041 1N47A 1GV9A 4UI9L 4ZHNA 2WS92 3DPRA 5GZEA 4CDWA 1J59A 4PQ9A 3PTYA 2WFF2 1ZYBA 5FPAA 4I30A 1FOD1 1W8FA 3ZSMA 1AYM2 3S5AA 4GIQA 3AL5A 3VBRC 4AQTA 2JKXA 3M3EA 2BNNA 3OPWA 4YM0A 3B7MA 1UW8A 2VUJA 3MFCA 1CIWA 1NUKA 1POV0 2A6WA 2B9UA 2NQYA 2RM23 2ZPXA 4ONUA 4XQWA 5JXHA 5JPMB 3WY6A 1OT5A 2WZR3 4KI5M 3F2ZA 1OLMA 4A2UA 2W39A 1CZTA 3U0ZA 1WMEA 4MOAA 4QPIB 3WNOA 1GOGA 1O4YA 2PLV1 4RFT0 5EJ3A 5CKQA 2V5DA 3AMQA 3BOWA 3NNGA 4KGGA 5T5JA 4RN5A 1VPHA 4Y4YA 3VZLA 1VBA3 1W8HA 2B4KA 1VLNA 3GHMA 2O1QA 3KV9A 4MLOA 5HCBA 3ATGA 1H2MA 3VBHB 3B9IA 4AFAA 4HXCA 2WA4A 1CVNA 3VDDB 1C5HA 3OYWB 1ULPA 3H9AA 1DQ0A 5J96B 2DVGA 2A7AA 1ND2C 1D7PM 3SC7X 2GNBA 1GUIA 3I2JA 2E63A 1ZRCA 1R093 3IN9A 1RXFA 1PMHX 4KG8A 1QDCA 3ZKUA 4MXWB 1IGOA 2BBVA 4MGYE 4N8MA 4D0QA 1JYTA 5FPBA 2A3YA 2YC0A 2CGNA 2WC2A 4JHZA 4LOTA 3VHNA 1LOEA 1OA2A 2ZGRA 3NAPA 4W50A 2D40A 2WRAA 4AYUA 3GBFA 3OEAA 5DG2A 1BVVA 4QX2A 2C1FA 1E5RA 1DGWA 1RUD3 1ENRA 3ENRA 4YW2A 3U75A 3WUCA 4CCCA 4DY5A 1JYWA 3BKZA 4OMCA 4JQRA 1H6XA 4KU7A 5A6ZA 2ORZA 1I5PA 1S0IA 1LOCA 1WWYA 1P8JA 2BOJA 3ACGA 3CIHA 2YXSA 3FBMA 3I7DA 3PURA 5K4LA 3T08A 4MH0E 2Z4FA 5HXMA 1MS5A 5CZKA 1AL21 3I3EA 4TSVA 4UFMA 3ZIXA 3EO6A 5EWSA 4BXSV 4URAA 4O7XA 1W8NA 3GALA 1VMHA 3UGGA 2P3YA 4EWDA 4EQVA 4XUTA 1VBD2 2OUHA 4XIOA 4ZU7A 5KHJA 4GWMA 5C4WC 4IV1A 1NXMA 3I2KA 1Q8QA 3DN7A 1D4M3 4HK8A 2IVJA 2WNUB 3UYJA 3ZXAC 4OI0A 5FO9B 2UYAA 2VPVA 4YGCA 4ET7A 2R072 1QF3A 1OOPB 4QXHA 3FWEA 2E53A 3ZYFA 2C4XA 3POGA 4ISQA 2V5YA 3AP9A 5E88A 2J7MA 2YROA 4XIKA 2P2KA 3KGLA 5ERLA 5KXDA 3I59B 3IMNA 3MLJA 5A7OA 3WW1A 4I09A 3JD73 4IXLA 4RR3C 3NMBA 4A41A 4XTMA 1QU0A 3WHTA 4GZ9A 1CPNA 2WDBA 3ROUA 1BK0A 1UYZA 2FCTA 1RUD1 1BLZA 4L92A 3S0MA 2KA3A 3MIFA 3ZPYA 2ZGSA 5GZGA 2XB6C 4A6OA 5H9RA 4FOQA 2EXJA 2ZEZA 3ZN4A 4NIGA 2JXAA 5J1XA 1QJZA 3LEGA 4JHTA 5IATA 3CLPA 1N1VA 3VHPA 1O8PA 1OPMA 2W9XA 2XVLA 2BEOA 3NV2A 3PU8A 1WW4A 2YB7A 2QDNA 5FOBB 2CGOA 3KT4A 1QEXA 4K20A 5FUIA 3ZDVA 3DKQA 4U36A 1OH4A 1HRV3 2A73B 2OZ6A 2VR4A 2YBKA 4B4RA 2QQPA 1N1TA 1NA1C 1DBNA 3SKJE 5T52A 3WNLA 1XE8A
chains in the Genus database with same CATH topology
4JX0A 3CDZB 1CZSA 1KGYA 4QDSA 2VZ1A 3HEIA 4P00B 4GWIA 2YG0A 1PX4A 4M4PA 5JXGA 3VD5A 3I3DA 4ARYA 4A42A 1TG7A 3ACIA 1GMMA 4DEQA 4W8JA 2VZTA 4CU8A 4DUXA 2V72A 3GDBA 4CVUA 3HOBA 4XUQA 2PQSA 3E1F1 1RYYA 3WNKA 5F7UA 2L9LA 3IAQA 2OKXA 4DUWA 2VM9A 1JZ3A 2VTFA 2W5FA 2Y6GA 3K77A 3ETPA 4Z2AA 3ECQA 3D3AA 3IB3A 1L7RA 1W9SA 2WAOA 2DCKA 3WNPA 3A22A 3I2IA 3LQCA 3LPGA 3CZJA 2E26A 2ZXQA 2WN3A 1O8SA 1PMJX 4XURA 3VD4A 1K42A 3U37A 4MGSA 1XNTA 2WBKA 5JR2A 2BGOA 3MUY1 3HNBM 4LPLA 2ZEXA 1UX7A 3WF0A 1UY3A 5DPNA 2QQKA 3UNPA 2BBAA 3WSOA 4HG6B 2ZEWA 4FI9A 2JE8A 3I2GA 2EIEA 1K45A 2VZOA 4OYUA 5HPOA 2QQMA 3BGAA 5EIYB 1TVGA 3K46A 5B4XA 1GOHA 3FL7A 3LEIA 2WYSA 5LA1A 4QDRA 3OEBA 1OF3A 4DEVA 3I97A 5EJ1B 3HPNA 4AAXA 2QQLA 4DUVA 4PT6A 4ARXA 3HJRA 4A4AA 1J84A 1BHGA 2W87A 2Y64A 3C7FA 2QQOA 2WQ8A 4KWUA 2WZ8A 1EUUA 4CUBA 1LNSA 5A1AA 3C7GA 3I3BA 1SHWB 2WO2A 1UY4A 2EIDA 2W1UA 4QB1A 2X09A 3CKHA 2VCCA 4MGQA 1CIYA 1KEXA 5IJRA 5DMYA 5JXJA 2C9KA 3SKVA 1EUTA 4CU6A 2Y8KA 4P5YA 3WF4A 2WUHA 5CYYA 2WZEA 4TTGA 2VMEA 5DN2A 1W0NA 1UMHA 2JD9A 2VQUA 2RVAA 2W3JA 4BDVB 5JXIA 2YC2A 2W92A 4ZZ8A 4YPJA 3WF3A 3W5NA 3FN9A 2HLEA 3A23A 4ZY9A 1NAEA 3PUHA 1JYVA 2YFUA 3VDCA 3VDBA 3WF2A 3C7OA 1GU3A 1XNAA 1US2A 1OF4A 2X05A 1O59A 5C7GA 3WNNA 2X10A 2R7EB 3OGRA 1NKGA 3ACFA 4QX1A 1UYYA 1YQ2A 2QQJA 2DDUA 5EJZB 5G04L 3T2QA 4P08A 5LA0A 1K3IA 4DXRA 1MPXA 2VMDA 3THCA 3K4AA 1GOFA 1UXXX 5IYYA 4M4RA 2B9VA 1PX3A 3I2FA 3HN3A 3T0AA 4E8CA 2RJ2A 2Y6KA 2VCBA 4CU9A 3P1IA 4A44A 3OGSA 2W1QA 1ULOA 4MO3M 2VZQA 4AG4A 5I0DA 2EICA 4OUEA 3K75B 2E32A 2XONA 4RYDA 4UOJA 3OB8A 5JMOA 1SG3A 3ZM8A 4XUNA 3T2OA 3HNMA 3MV01 2VMFA 1UY0A 4D8MA 3VDAA 1GQPA 2YC4A 1UY2A 2BGPA 3NQHA 4PQQA 2VMCA 3C7HA 5B4NA 2W95A 4JKMA 3GM8A 3JXSA 4JKLA 2CDPA 4QAWA 4OZOA 2WO1A 2DCJA 4CU7A 2VQTA 2VZVA 2J1SA 3DYPA 5G05L 3WEZA 3IAPA 2JDAA 4QX3A 4XVHA 2KD7A 3FHAA 4JKKA 3AC0A 4KMQA 4QPWA 3NRUA 4QB2A 2VZSA 3CZUA 1CZVA 1UYXA 2VZRA 5C70A 2WO3A 3LEKA 3C8XA 2V4VA 1WCQA 3SEEA 3PUIA 1WKYA 2W1WA 2LW8A 3EB7A 3VD7A 3GGLA 1JU4A 4A45A 4CUAA 2VC9A 1JZ8A 3ABZA 2WN2A 1JI6A 1JU3A 4XZUG 4QDQA 3DYOA 2ID4A 4QB6A 1UMIA 4BK4A 1F4AA 2J1UA 3UESA 1US3A 2CDOA 1XPWA 2VCAA 2VOTA 3C7EA 2E31A 2QQNA 3LE0A 2LS6A 1UWWA 4QX0A 3HNYM 4XUPA 4UAPA 1NX9A 2Y6LA 3SEPA 3J7HA 3MV11 4UI9L 4OMDA 3MUZ1 1W9WA 3WQBA 2HYXA 3MBWA 3OG2A 4TXWA 4XUOA 2ZEYA 2XOMA 4MADA 5LCWL 3VD3A 1JZ5A 2JKXA 5IFTA 1DYOA 1DP0A 1NUKA 3IIIA 5JXHA 2Y6HA 1OT5A 1XC6A 2W91A 3F2ZA 4KI5M 1CZTA 4DXSA 3T0DA 3OGVA 4MOAA 3P6BA 2WAAA 1GOGA 3WNOA 1JYXA 3W5MA 2VJXA 3T0BA 5JUVA 2VL4A 2V5DA 3NNGA 4RN5A 2QQIA 5IHRA 2B4KA 3EYPA 2ORXA 1T2XA 2Y6JA 3BN6A 1ULPA 3ACHA 2QBXA 2BERA 1JZ7A 1D7PM 5DQ0A 3NJXA 1GUIA 3I2JA 5C71A 1JZ6A 3I2HA 3DYMA 2BZDA 1PMHX 2YFZA 1HN1A 5LA2A 4D0QA 2J1TA 2XQXA 4JHZA 4DXTA 4W50A 3OEAA 3DECA 4QX2A 4E8DA 4GWJA 1JYWA 4OMCA 1H6XA 1W9TA 2VZPA 2ORZA 1CX1A 1I5PA 2VZUA 3A7QA 3K4ZA 1P8JA 3ACGA 3THDA 3CIHA 3WNMA 3T08A 1F4HA 2J1EA 2Z4FA 5HXMA 2J1VA 4LQRA 5CZKA 3I3EA 1W99A 1OD3A 3MO4A 1L7QA 4LKSA 4BXSV 1K12A 1W8NA 3FHQA 4L0PA 4XUTA 1W8OA 2C26A 3LPFA 4CUCA 1JZ2A 3I2KA 3UETA 1SDDB 2XHNA 1DLCA 4BJ0A 4ET7A 2J1AA 2EIBA 3OBAA 2C4XA 2J7MA 1UY1A 3WF1A 2E33A 2J1RA 2VO5A 2W1SA 4P02B 1GNYA 2RV9A 3T2PA 1IQDC 3NJVA 4W4ZA 4A41A 4GZ9A 2J22A 2WDBA 4LHSA 3CMGA 4A3ZA 1UYZA 1J83A 4IUGA 2W46A 4ZXEA 3T09A 4A6OA 2W94A 2W47A 1H6YA 2VZ3A 5IFPA 1JZ4A 1JYNA 2ZEZA 4BK5A 3IDAA 5J1XA 3LEGA 1UZ0A 1JHJA 1UXZA 3VD9A 1O8PA 2W9XA 3A21A 3K4DA 3CQOA 2YB7A 4PF1A 2WABA 5FUIA 4ZZ5A 1OH4A 2VR4A 3GXUA 3SKJE 1R64A 3WNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX0 A;  3CDZ B;  1CZS A;  1KGY A;  4QDS A;  2VZ1 A;  3HEI A;  4P00 B;  4GWI A;  2YG0 A;  1PX4 A;  4M4P A;  5JXG A;  3VD5 A;  3I3D A;  4ARY A;  4A42 A;  1TG7 A;  3ACI A;  1GMM A;  4DEQ A;  4W8J A;  2VZT A;  4CU8 A;  4DUX A;  2V72 A;  3GDB A;  4CVU A;  3HOB A;  4XUQ A;  2PQS A;  3E1F 1;  1RYY A;  3WNK A;  5F7U A;  2L9L A;  3IAQ A;  2OKX A;  4DUW A;  2VM9 A;  1JZ3 A;  2VTF A;  2W5F A;  2Y6G A;  3K77 A;  3ETP A;  4Z2A A;  3ECQ A;  3D3A A;  3IB3 A;  1L7R A;  1W9S A;  2WAO A;  2DCK A;  3WNP A;  3A22 A;  3I2I A;  3LQC A;  3LPG A;  3CZJ A;  2E26 A;  2ZXQ A;  2WN3 A;  1O8S A;  1PMJ X;  4XUR A;  3VD4 A;  1K42 A;  3U37 A;  4MGS A;  1XNT A;  2WBK A;  5JR2 A;  2BGO A;  3MUY 1;  3HNB M;  4LPL A;  2ZEX A;  1UX7 A;  3WF0 A;  1UY3 A;  5DPN A;  2QQK A;  3UNP A;  2BBA A;  3WSO A;  4HG6 B;  2ZEW A;  4FI9 A;  2JE8 A;  3I2G A;  2EIE A;  1K45 A;  2VZO A;  4OYU A;  5HPO A;  2QQM A;  3BGA A;  5EIY B;  1TVG A;  3K46 A;  5B4X A;  1GOH A;  3FL7 A;  3LEI A;  2WYS A;  5LA1 A;  4QDR A;  3OEB A;  1OF3 A;  4DEV A;  3I97 A;  5EJ1 B;  3HPN A;  4AAX A;  2QQL A;  4DUV A;  4PT6 A;  4ARX A;  3HJR A;  4A4A A;  1J84 A;  1BHG A;  2W87 A;  2Y64 A;  3C7F A;  2QQO A;  2WQ8 A;  4KWU A;  2WZ8 A;  1EUU A;  4CUB A;  1LNS A;  5A1A A;  3C7G A;  3I3B A;  1SHW B;  2WO2 A;  1UY4 A;  2EID A;  2W1U A;  4QB1 A;  2X09 A;  3CKH A;  2VCC A;  4MGQ A;  1CIY A;  1KEX A;  5IJR A;  5DMY A;  5JXJ A;  2C9K A;  3SKV A;  1EUT A;  4CU6 A;  2Y8K A;  4P5Y A;  3WF4 A;  2WUH A;  5CYY A;  2WZE A;  4TTG A;  2VME A;  5DN2 A;  1W0N A;  1UMH A;  2JD9 A;  2VQU A;  2RVA A;  2W3J A;  4BDV B;  5JXI A;  2YC2 A;  2W92 A;  4ZZ8 A;  4YPJ A;  3WF3 A;  3W5N A;  3FN9 A;  2HLE A;  3A23 A;  4ZY9 A;  1NAE A;  3PUH A;  1JYV A;  2YFU A;  3VDC A;  3VDB A;  3WF2 A;  3C7O A;  1GU3 A;  1XNA A;  1US2 A;  1OF4 A;  2X05 A;  1O59 A;  5C7G A;  3WNN A;  2X10 A;  2R7E B;  3OGR A;  1NKG A;  3ACF A;  4QX1 A;  1UYY A;  1YQ2 A;  2QQJ A;  2DDU A;  5EJZ B;  5G04 L;  3T2Q A;  4P08 A;  5LA0 A;  1K3I A;  4DXR A;  1MPX A;  2VMD A;  3THC A;  3K4A A;  1GOF A;  1UXX X;  5IYY A;  4M4R A;  2B9V A;  1PX3 A;  3I2F A;  3HN3 A;  3T0A A;  4E8C A;  2RJ2 A;  2Y6K A;  2VCB A;  4CU9 A;  3P1I A;  4A44 A;  3OGS A;  2W1Q A;  1ULO A;  4MO3 M;  2VZQ A;  4AG4 A;  5I0D A;  2EIC A;  4OUE A;  3K75 B;  2E32 A;  2XON A;  4RYD A;  4UOJ A;  3OB8 A;  5JMO A;  1SG3 A;  3ZM8 A;  4XUN A;  3T2O A;  3HNM A;  3MV0 1;  2VMF A;  1UY0 A;  4D8M A;  3VDA A;  1GQP A;  2YC4 A;  1UY2 A;  2BGP A;  3NQH A;  4PQQ A;  2VMC A;  3C7H A;  5B4N A;  2W95 A;  4JKM A;  3GM8 A;  3JXS A;  4JKL A;  2CDP A;  4QAW A;  4OZO A;  2WO1 A;  2DCJ A;  4CU7 A;  2VQT A;  2VZV A;  2J1S A;  3DYP A;  5G05 L;  3WEZ A;  3IAP A;  2JDA A;  4QX3 A;  4XVH A;  2KD7 A;  3FHA A;  4JKK A;  3AC0 A;  4KMQ A;  4QPW A;  3NRU A;  4QB2 A;  2VZS A;  3CZU A;  1CZV A;  1UYX A;  2VZR A;  5C70 A;  2WO3 A;  3LEK A;  3C8X A;  2V4V A;  1WCQ A;  3SEE A;  3PUI A;  1WKY A;  2W1W A;  2LW8 A;  3EB7 A;  3VD7 A;  3GGL A;  1JU4 A;  4A45 A;  4CUA A;  2VC9 A;  1JZ8 A;  3ABZ A;  2WN2 A;  1JI6 A;  1JU3 A;  4XZU G;  4QDQ A;  3DYO A;  2ID4 A;  4QB6 A;  1UMI A;  4BK4 A;  1F4A A;  2J1U A;  3UES A;  1US3 A;  2CDO A;  1XPW A;  2VCA A;  2VOT A;  3C7E A;  2E31 A;  2QQN A;  3LE0 A;  2LS6 A;  1UWW A;  4QX0 A;  3HNY M;  4XUP A;  4UAP A;  1NX9 A;  2Y6L A;  3SEP A;  3J7H A;  3MV1 1;  4UI9 L;  4OMD A;  3MUZ 1;  1W9W A;  3WQB A;  2HYX A;  3MBW A;  3OG2 A;  4TXW A;  4XUO A;  2ZEY A;  2XOM A;  4MAD A;  5LCW L;  3VD3 A;  1JZ5 A;  2JKX A;  5IFT A;  1DYO A;  1DP0 A;  1NUK A;  3III A;  5JXH A;  2Y6H A;  1OT5 A;  1XC6 A;  2W91 A;  3F2Z A;  4KI5 M;  1CZT A;  4DXS A;  3T0D A;  3OGV A;  4MOA A;  3P6B A;  2WAA A;  1GOG A;  3WNO A;  1JYX A;  3W5M A;  2VJX A;  3T0B A;  5JUV A;  2VL4 A;  2V5D A;  3NNG A;  4RN5 A;  2QQI A;  5IHR A;  2B4K A;  3EYP A;  2ORX A;  1T2X A;  2Y6J A;  3BN6 A;  1ULP A;  3ACH A;  2QBX A;  2BER A;  1JZ7 A;  1D7P M;  5DQ0 A;  3NJX A;  1GUI A;  3I2J A;  5C71 A;  1JZ6 A;  3I2H A;  3DYM A;  2BZD A;  1PMH X;  2YFZ A;  1HN1 A;  5LA2 A;  4D0Q A;  2J1T A;  2XQX A;  4JHZ A;  4DXT A;  4W50 A;  3OEA A;  3DEC A;  4QX2 A;  4E8D A;  4GWJ A;  1JYW A;  4OMC A;  1H6X A;  1W9T A;  2VZP A;  2ORZ A;  1CX1 A;  1I5P A;  2VZU A;  3A7Q A;  3K4Z A;  1P8J A;  3ACG A;  3THD A;  3CIH A;  3WNM A;  3T08 A;  1F4H A;  2J1E A;  2Z4F A;  5HXM A;  2J1V A;  4LQR A;  5CZK A;  3I3E A;  1W99 A;  1OD3 A;  3MO4 A;  1L7Q A;  4LKS A;  4BXS V;  1K12 A;  1W8N A;  3FHQ A;  4L0P A;  4XUT A;  1W8O A;  2C26 A;  3LPF A;  4CUC A;  1JZ2 A;  3I2K A;  3UET A;  1SDD B;  2XHN A;  1DLC A;  4BJ0 A;  4ET7 A;  2J1A A;  2EIB A;  3OBA A;  2C4X A;  2J7M A;  1UY1 A;  3WF1 A;  2E33 A;  2J1R A;  2VO5 A;  2W1S A;  4P02 B;  1GNY A;  2RV9 A;  3T2P A;  1IQD C;  3NJV A;  4W4Z A;  4A41 A;  4GZ9 A;  2J22 A;  2WDB A;  4LHS A;  3CMG A;  4A3Z A;  1UYZ A;  1J83 A;  4IUG A;  2W46 A;  4ZXE A;  3T09 A;  4A6O A;  2W94 A;  2W47 A;  1H6Y A;  2VZ3 A;  5IFP A;  1JZ4 A;  1JYN A;  2ZEZ A;  4BK5 A;  3IDA A;  5J1X A;  3LEG A;  1UZ0 A;  1JHJ A;  1UXZ A;  3VD9 A;  1O8P A;  2W9X A;  3A21 A;  3K4D A;  3CQO A;  2YB7 A;  4PF1 A;  2WAB A;  5FUI A;  4ZZ5 A;  1OH4 A;  2VR4 A;  3GXU A;  3SKJ E;  1R64 A;  3WNL A; 
#chains in the Genus database with same CATH topology
 3WG4 A;  4DB5 A;  3DL3 A;  3R0R A;  2AC1 A;  2WT1 A;  4I02 A;  5HBA A;  1IOA A;  5FPX A;  1G6N A;  4BIS A;  4FOW A;  3CDZ B;  4AI1 A;  3I59 A;  1OD5 A;  5ISL A;  1NYW A;  1CZS A;  1KGY A;  1RUJ 3;  4QDS A;  3TAY A;  5M0T A;  3HEI A;  1QMJ A;  1YQ5 A;  4P00 B;  1W9F A;  1ZM1 A;  1S0F A;  2YG0 A;  3IKW A;  3Q8B A;  1G9A A;  2DF7 A;  4ARY A;  5FLI A;  2WNE A;  1O3S A;  1TE1 B;  1S0C A;  1ZZ7 A;  2D5H A;  2P3I A;  1AXY A;  1TG7 A;  2ZJC A;  4Q4W 1;  2PAK A;  3J8F 3;  2GC2 A;  1AR6 1;  3AYE A;  4PLO A;  2RS5 2;  2XL9 A;  5FFO C;  5LA9 A;  3KCC A;  1K5M C;  3MPB A;  3EBR A;  4FPE A;  3GDB A;  4LJH A;  4K21 A;  1H8T B;  4M0H A;  4DOU A;  5LZ6 A;  1H9P A;  1T6B X;  2I07 B;  5J36 A;  4YFZ A;  2NM1 A;  4PLN A;  1VMF A;  4B3N A;  4I0B A;  2ZX3 A;  4OQ8 A;  3M7A A;  2ERF A;  3WNK A;  2ZGQ A;  2WKK A;  1RUI 1;  3P5B A;  4B8E A;  3IAQ A;  3T4H B;  1W2U A;  2WZR 2;  2VOV A;  1RVF 3;  2VM9 A;  4XF0 A;  3ZFF A;  5CFD B;  2B46 X;  1VE0 A;  1DGR A;  2Y6G A;  3O14 A;  5FXX A;  1S1A A;  2WJS A;  3AK0 A;  4X8P A;  1IKQ A;  1YWK A;  5FZI A;  1AXK A;  1C1L A;  5FAX A;  3WQ1 A;  4CDQ B;  2RHP A;  1HRI 1;  5EYY A;  2XBO 2;  4PF5 A;  1D0G A;  1RUE 2;  3CNA A;  5IVE A;  1W9S A;  2XJP A;  2VNR A;  2JDH A;  1ZZ8 A;  4LIV A;  1D4V B;  2UY9 A;  3LQC A;  3UKV A;  1CN1 A;  2ARC A;  4IDZ A;  2YBS A;  4ERO A;  5I8Y A;  4D6R A;  2ZXQ A;  1YUD A;  1UIJ A;  1S2E A;  3O7O A;  1UQX A;  2IWG B;  1SAC A;  4HFS A;  4WM8 C;  2RR1 1;  3B9C A;  3VBS C;  4N9I A;  5D8A C;  3U37 A;  2A6V A;  5JZG C;  1XNT A;  3PUQ A;  5JR2 A;  4AEK A;  5B2G B;  2ZAA A;  4IE5 A;  1CAX B;  2WFP A;  5F2W A;  5F39 A;  3M2M A;  1UX7 A;  2XUM A;  3WF0 A;  3J7L A;  3W59 A;  4COV A;  1PIV 1;  5A7Q A;  2GZW A;  1H30 A;  1PNF A;  1UOG A;  2I2S A;  2JG9 B;  3POY A;  5GKA C;  2BBA A;  1O5L A;  1DGW X;  3PLQ A;  3WSO A;  4RS5 A;  5KWR A;  4MV2 A;  4BQ5 A;  3D0S A;  4Q0U A;  5CFD A;  1AR8 1;  1FNY A;  3QLQ A;  1RL3 A;  1PGS A;  4OYU A;  3AYC A;  3Q8F A;  1WMX A;  2OPK A;  4Y22 B;  4F3J A;  3BGA A;  1N3P A;  1SLI A;  3AM2 A;  2VUD A;  4CP9 B;  5BNP B;  3SMH A;  2E6V A;  4Q4Y 2;  5IK8 A;  2ZAC A;  3H7Y A;  2F17 A;  5FKC A;  1KJL A;  5DG1 A;  5EJ1 B;  4DEV A;  5FZ7 A;  1E5H A;  2BNM A;  4QKN A;  5KHK A;  3PVN A;  4BQ2 A;  5IVF A;  5T5O A;  5JIA A;  1VIW B;  2A6Z A;  4GH4 C;  4AOC A;  2RMU 1;  4AVA A;  4ARX A;  1EV1 2;  5IT6 A;  3M70 A;  5D2A A;  3TB0 A;  3J8F 2;  1BHG A;  2Y64 A;  3IWZ A;  3JB4 C;  1H0B A;  4AHZ A;  2QQO A;  2WO7 A;  3RRD A;  3N9P A;  4K1Z A;  2GH8 A;  2VE1 A;  4LEJ A;  2RJL A;  4YZ3 A;  2GME A;  2BYV E;  4V2W A;  1LNS A;  1VMJ A;  5A1A A;  3I3B A;  5FYT A;  4BCU A;  2E7A A;  4ORF A;  1R1A 3;  3NNM A;  2EID A;  2IXL A;  5JLV A;  2PHL A;  1SBE A;  5E8A A;  1WBF A;  3J4U H;  3EJK A;  2VCC A;  2WZR 1;  4MGQ A;  4P9G A;  2ZGT A;  4IE4 A;  2O0O A;  2YU1 A;  4ASM B;  4LE3 A;  5IJR A;  2DU1 A;  5CFC C;  1HKD A;  5JXJ A;  1QJX 2;  3PUA A;  3AYA A;  4Y22 A;  4GMP 0;  4Z92 B;  4XMI A;  4FBF A;  2HWF 2;  2D6N A;  2WUH A;  4MXV A;  4BIO A;  1W28 A;  4O9G A;  4YYO A;  3WCS A;  4CP9 A;  2TNF A;  5DN2 A;  1YQ8 A;  3MFA A;  5FLJ A;  3GBW A;  1X9P A;  2DTY A;  3BPZ A;  4BM8 A;  4PCR A;  1VBA 1;  2JD9 A;  2VQU A;  4UF0 B;  5DAV A;  5FO7 B;  3SLI A;  4BDV B;  4A7Y A;  3MIC A;  4UWD A;  5F32 A;  4YPJ A;  2IFR A;  3BTA A;  4SLI A;  5LBB A;  4CDW B;  3FN9 A;  3VL8 A;  5JZG A;  4AVS A;  1OUX A;  1OKQ A;  1ULG A;  2HLE A;  3A23 A;  4Q0V A;  4ZY9 A;  3UGH A;  1VAL A;  1VBE 2;  4IET A;  5E89 A;  4BMB A;  4QPI C;  4CPB D;  4LLO A;  1NAE A;  1W0O A;  2RE9 A;  2YFU A;  3IMM A;  1NCR C;  2RS3 2;  4IV3 A;  3VDB A;  3WF2 A;  4EE2 A;  1OXC A;  2TEP A;  4C1W A;  1SFN A;  2UY8 A;  3C2U A;  3GNE A;  3DKW A;  1VBB 3;  2NN8 A;  3CJI A;  2PEL A;  3AB0 A;  1RIT A;  1ALY A;  2VH9 A;  4P9I A;  2PTM A;  3TEX A;  4AHX A;  5A70 A;  1GBG A;  2IUW A;  1O59 A;  2ZX0 A;  3VBF C;  3WNN A;  1AHS A;  2XJR A;  1IHM A;  4HKL A;  1YJK A;  2FQP A;  4IEW A;  1UN1 A;  5A3N A;  3ACF A;  3LEM A;  2VBB A;  3ZVX A;  4FPF A;  1SBF A;  1OVP A;  2QQJ A;  5EJZ B;  2RMU 3;  1RUN A;  1AR7 2;  1HRI 3;  4OHW A;  1NE4 A;  5DUX A;  4PHZ A;  3IIA A;  1YI7 A;  3ZYH A;  1R08 1;  3THC A;  3Q8C A;  4XBN A;  2MEV 3;  4YG6 A;  1W2A X;  4TWT A;  1RMU 2;  5LBE A;  1XBF A;  4KL1 A;  1Y7B A;  4LBQ D;  3L2H A;  2R07 1;  5IYY A;  2WR9 A;  4M4R A;  4XAC A;  3I2F A;  1D4M 1;  1RVF 2;  2FCU A;  4XFA A;  1VRH 1;  2Y6K A;  2VCB A;  3HN1 A;  3NNL A;  2B42 B;  3KV6 A;  4BLI A;  4GMP 1;  3B00 A;  2F6B A;  4HVR A;  4L8Q A;  4XHX A;  3ME2 A;  4UW4 A;  1SCR A;  2JG8 A;  4IV3 B;  3GJA A;  5I0D A;  1FAY A;  3PHM A;  4V1P A;  2EIC A;  4OUE A;  5I93 A;  3PUS A;  3KCX A;  3BOP A;  1HXS 3;  2E32 A;  1H2K A;  4JDN A;  5BYN A;  2XON A;  3LD8 A;  4AHW A;  4B4Q A;  4AQ6 A;  1SG3 A;  1ULF A;  3VBF A;  3NW4 A;  2PQQ A;  5CEH A;  4XUN A;  3WG1 A;  3N9N A;  2AAC A;  4XAB A;  1XYN A;  4IGP A;  3HNM A;  3T2O A;  1UD1 A;  3OPZ A;  4E2Q A;  4N43 B;  5KBF A;  2Y0I A;  3NNF A;  4XXA A;  1HB4 A;  1NE6 A;  4QMA A;  4CUG A;  4D8M A;  3VDA A;  3NQH A;  2BGP A;  5FZC A;  3C7H A;  2VGD A;  5B4N A;  2CGP A;  3QCW A;  1QJX 1;  4AW7 A;  4XJ9 A;  3GM8 A;  1KDM A;  1K5M B;  1QOT A;  2CNA A;  1Q43 A;  2OQ6 A;  3CBN A;  2AGS A;  3IDB B;  3JXS A;  4IGQ A;  5GJ6 A;  1GIC A;  2ZHN A;  4IV1 B;  2WYF A;  3S7E A;  3HQU A;  3O1S A;  1OOP A;  3T1L A;  4GH4 B;  3UT0 A;  1MQT C;  3KT7 A;  1AF9 A;  2YU2 A;  3PU3 A;  4X6R B;  5CFC B;  3NKT A;  2RR1 2;  5CG9 A;  2JDA A;  1ZVF A;  4IV3 C;  1WBL A;  1NCQ A;  3ZSK A;  4XVH A;  1HQN A;  1RUE 3;  2YHJ A;  4KWK A;  2IC1 A;  1FMD 2;  1LKN A;  1TEI A;  3OSD A;  1OFS A;  1U5Z A;  2DCZ A;  2PXJ A;  1W39 A;  2KD7 A;  1WW7 A;  4KMQ A;  4IEP A;  4LO6 B;  4QPW A;  2VUC A;  2HEW F;  1RUJ 1;  5F5A A;  4PDW A;  3ZXK A;  1RHI 3;  1XXN A;  2P1B A;  2WNV B;  5A3M A;  3FJS A;  1MZ5 A;  2HJI A;  4FSJ A;  4AE2 A;  2PYT A;  4NPM A;  3BU0 A;  1NZC A;  3WD5 A;  1WW5 A;  1VBC 1;  3I2O A;  5ANQ A;  3EXU A;  3N7K A;  5ACA 3;  2WFF 3;  1AR8 2;  2WNO A;  2C6S A;  4UFJ A;  1SLC A;  1PNG A;  2W1W A;  2LW8 A;  4PI2 A;  4AVV A;  1LB2 A;  2DFB A;  2NZ9 A;  5LBC A;  4XCB A;  4JTO A;  4A45 A;  3GZE A;  4CUA A;  3ABZ A;  2JD4 A;  3OTF A;  1VBB 2;  2WN2 A;  3TNP B;  3VBH C;  2RM2 2;  3OGG A;  4DRV A;  4JGZ A;  2CAU A;  1LGN A;  2OXB A;  3ZDS A;  3JQW A;  2AH2 A;  1PO2 1;  4QDQ A;  3UJQ A;  1QJU 3;  2OZJ A;  2PHR A;  4QB6 A;  3BVC A;  2UWC A;  3ZX7 A;  1TME 1;  3TN9 1;  2RMU 2;  4Q4V 1;  3RYR A;  4BK4 A;  4HVQ A;  4YFW A;  2J1U A;  4YW5 A;  4Z1V A;  1PZ7 A;  1US3 A;  5FY7 A;  3KHC A;  4FTS A;  3E6D A;  1IPJ A;  4HN1 A;  4AI9 A;  4CEY A;  5J37 A;  3C7E A;  3VZO A;  1KDK A;  3UJO A;  1BVP 1;  1TQ5 A;  1UU5 A;  4YG3 A;  1RUC 3;  1EPZ A;  1BXH A;  2ZHM A;  5FR3 A;  1XYO A;  3WUD A;  4XMA A;  2VTX J;  4FXK B;  4XUP A;  1NX9 A;  2CWM A;  2G1M A;  2W68 A;  2FMD A;  3AMM A;  3KGZ A;  1UOB A;  1GZT A;  3KHB A;  1G8W A;  3MV1 1;  2XJV A;  4WV8 A;  5FZK A;  5I0U A;  3H8X A;  3MUZ 1;  1W9W A;  2ZBJ A;  1CAV A;  1PK6 A;  3J26 N;  5IAV A;  4R4Z A;  2JDM A;  4RGK A;  2R06 2;  2A5Z A;  5FPZ A;  4QPY A;  2F4P A;  3F95 A;  3MIE A;  1RUH 1;  2EA7 A;  2J42 A;  3PL0 A;  5T55 A;  3T1M A;  3WG2 A;  4LXL A;  5LB6 A;  2CU5 A;  5FZ6 A;  2DVD A;  2Q8E A;  3LCP A;  4N53 A;  4LBN A;  3GF6 A;  4JQT A;  1JZ5 A;  2GC3 A;  1J3R A;  2BVB A;  1LEN A;  3RZK A;  3AP6 A;  5BUV A;  5IFT A;  1DYO A;  2BP6 A;  3V0A A;  1W06 A;  1W3V A;  4EZ4 A;  5LY1 A;  5GM0 A;  3III A;  2HWC 2;  3G6J B;  1L7L A;  1YFW A;  2RS1 1;  2W91 A;  1N1S A;  5EHD A;  1PO1 3;  3D6E A;  5J98 B;  3T0D A;  3S5Q A;  1QIQ A;  1JYX A;  2ZHL A;  3M1H A;  3P6B A;  1ND3 A;  4PIZ A;  1S55 A;  5F9T A;  3T0B A;  1Z7S 2;  4CDQ A;  1MR5 A;  5E6H A;  1RUF 1;  3HAG A;  3VKO A;  4CDU B;  3WDU A;  2QQI A;  3OD4 A;  1C28 A;  5IHR A;  1V9U 3;  1SPP A;  2QQU A;  4XF3 A;  2ZML A;  5JI7 A;  2AR6 A;  5FMO S;  5DAQ A;  1J1L A;  4V2V A;  2BPA 2;  1DIW A;  5JOZ A;  2Y6J A;  5JWP A;  4QKB A;  3BTZ A;  5FMD A;  1HV1 A;  2BER A;  2QBX A;  3DPR C;  3WX5 A;  1PGL 2;  2ZOE B;  1F5F A;  1OQE A;  1PK6 C;  2VMI A;  1FXZ A;  2D7F A;  4QPI A;  5TSW A;  3RZM A;  1CAV B;  1PK6 B;  2JWP A;  5FMO L;  3B01 A;  3DYM A;  1TME 3;  1CAX A;  1DU3 D;  2P17 A;  2R1B A;  2UUR A;  3ORJ A;  2K9Z A;  4HT1 T;  4YW4 A;  1HN1 A;  1NOV A;  5LA2 A;  4DIQ A;  1GZ9 A;  1XSQ A;  3TNQ A;  3PVB B;  5L7O C;  4GAZ A;  1ULE A;  5CIS A;  4JRL A;  5BNO A;  5IK7 A;  4I0A A;  1JUI A;  3DEC A;  2GN3 A;  1A34 A;  5HCF A;  3CJX A;  2KR2 A;  1BMV 1;  4KG0 A;  1W9T A;  5JIU A;  1CX1 A;  1PO2 2;  4LOS A;  3V0B A;  2RS5 3;  5F3G A;  1UL9 A;  4XBQ A;  3THD A;  4CP0 A;  1I9R A;  2QQV A;  2J1E A;  3AXE A;  4JGY C;  5JSR A;  5FP7 A;  5DZG A;  2GAL A;  3PIJ A;  4CEY C;  4XIL A;  3MO4 A;  1L7Q A;  5FYM A;  3RI8 A;  3E97 A;  4LKS A;  3MGU A;  3RMX A;  3H8R A;  4MGK E;  2EVX A;  2XVG A;  3OBZ A;  4L0P A;  4LBK A;  3ZYG A;  2BFU S;  2OS2 A;  3WQ0 A;  1PVX A;  5EYX A;  3VKF C;  2Y33 A;  4LLF A;  3FMG A;  2XHN A;  3A4U A;  1LR5 A;  2HWD 3;  2R32 A;  3RWN A;  4E8D A;  5I0R A;  4BJ0 A;  3AJZ A;  4Y1Y A;  5KHH A;  2J1A A;  5JAX A;  2EIB A;  4N43 C;  1J58 A;  2YDE A;  3ZFF C;  3AZY A;  3IPV A;  4HN0 A;  5I91 A;  5LK7 B;  1U12 A;  3BYW A;  3ZFG C;  2E33 A;  2J1R A;  3IZO A;  4H14 A;  5FXZ A;  5C8C C;  4LUL A;  2CTV A;  4P02 B;  3ZOI A;  2H0V A;  1IQD C;  3NJV A;  5IVJ A;  5CVR A;  1UZY A;  5SV5 A;  4FTB A;  3O1O A;  2GN7 A;  4DY3 A;  3VHO A;  2J22 A;  1HJF A;  5LW9 A;  1O3T A;  2P6C A;  3CMG A;  3UL2 A;  4OI4 A;  2OVU A;  3AZX A;  1W9Y A;  1S0J A;  4ZXE A;  4DRR A;  3T09 A;  4NE9 A;  5FQ0 B;  4QXK A;  1ZRE A;  1JZ4 A;  1JYN A;  1O3Q A;  3IDA A;  2BFU L;  4FOY A;  4CEW C;  2VXR A;  1AR9 3;  1OMI A;  4NOT A;  1JHJ A;  1RC6 A;  1UXZ A;  3U78 A;  4EN8 B;  5KC6 A;  4IES A;  4DQA A;  5LEK A;  3A21 A;  1ONA A;  3CQO A;  2KM2 A;  3K2O A;  2ZKN A;  1POQ A;  4PF1 A;  2WAB A;  4HKW A;  4ZZ5 A;  3H8O A;  2JDY A;  1OOP C;  3ITQ A;  1VJ2 A;  1Z0H A;  3KWV A;  3M3Q A;  1A6C A;  3H50 A;  4BU2 A;  1DQ2 A;  1YNA A;  2VBP A;  3GZU C;  1L3J A;  1WCS A;  4O65 A;  5A3T A;  5DAP A;  3N35 A;  2A71 A;  2YYO A;  2P37 A;  3SH5 A;  2QZ2 A;  1S0D A;  1STM A;  1UZZ A;  2RDR A;  4XF9 A;  4Y5Z 0;  3GBG A;  4W6Y A;  4Y1X A;  1Y9Q A;  4QM9 A;  3W20 A;  1FT9 A;  3ETQ A;  4XDO A;  4OI2 A;  2Z5W A;  2YY1 A;  4M4P A;  4GB3 3;  4P9J A;  1QHD A;  5DZF A;  3A0K A;  4WM8 B;  4AR2 A;  4IEU A;  1ZBA 2;  5JCT A;  4W8J A;  3RQ0 A;  4CEW A;  4YWA A;  4CU8 A;  2QTW B;  1ODN A;  2ZGL A;  1RUG 3;  1JOP A;  3DV8 A;  1QNY A;  1QQP 2;  4GJY A;  3RGB A;  4WM7 A;  3E1F 1;  2VAU A;  3POJ A;  4IV1 C;  4KU8 A;  1UCX A;  3JZV A;  1ST8 A;  5AFE A;  1OQ1 A;  4DUW A;  1AX0 A;  1OUR A;  1Y43 B;  3MW2 A;  2B7Y A;  5C3Q A;  1JZ3 A;  2HWB 3;  5FZ9 A;  3AFK A;  3TBD A;  1ZRF A;  2W5F A;  1CX4 A;  2C9A A;  2ZGU A;  2AEZ A;  1MQT A;  3ETP A;  3G7D A;  2DVF A;  1V6I A;  4JDM A;  4QD2 A;  4A7K A;  5FYZ A;  4RD7 A;  3SCG A;  1U5Y A;  4Z2A A;  2D6O X;  1HB2 A;  2DU0 A;  3WT3 A;  5E16 A;  1YI9 A;  5L7O B;  3A22 A;  3LPG A;  2NYY A;  1V6J A;  5FZD A;  2WN3 A;  1Q8P A;  4OHX A;  4QKF A;  2QJV A;  1O8S A;  4NPR A;  1PMI A;  2IXJ A;  5HCA A;  4XUR A;  1CD3 G;  3T3Y A;  3ZR5 A;  1K42 A;  3Q8A A;  5F6L B;  2YGL A;  1EP0 A;  1QGL A;  1ZRR A;  3ZN6 B;  3HT1 A;  4MGS A;  4UT5 A;  3VBR A;  4AFC A;  4AVB A;  5FP3 A;  1OC1 A;  1YLL A;  2XJQ A;  4M3C A;  3I4I A;  1K5M A;  3MUY 1;  4XF4 A;  3A0N A;  1GFF 2;  4DPN A;  4X6Q B;  1ULC A;  2ZHK A;  2XLF A;  4AF9 A;  3FFQ A;  5FKB A;  3FFZ A;  2ET7 A;  5FZ8 A;  4UFL A;  1FNZ A;  3UNP A;  4JTN A;  2GDF A;  2WWS A;  4HG6 B;  4M3C F;  2G9F A;  1BEV 2;  3I2G A;  2EIE A;  3OY8 A;  2Q1M A;  3P3P A;  1TMF 3;  4DXT A;  1Q3E A;  5HPO A;  3AVR A;  1B35 B;  1BJQ A;  4ASL A;  5EIY B;  1LHU A;  2HWF 3;  2ZCW A;  3FUO A;  1GOH A;  3K46 A;  4C0H A;  5F3I A;  4UW6 A;  5LA1 A;  4XEZ A;  2ILM A;  3O1T A;  1K5J A;  2JG9 A;  4H7M A;  1J1T A;  1CPM A;  1A78 A;  1W3X A;  4AAX A;  2QQL A;  4OZX A;  3PME A;  4RQP A;  2DCY A;  4KGQ A;  1AL0 G;  2DUP A;  1OA3 A;  1VRH 3;  5J3U A;  3S57 A;  2BW8 A;  5FRA A;  1AR9 1;  4XFC A;  4YZ5 A;  3JBG 2;  3HMY A;  4C91 A;  1SCS A;  1XSR A;  1JMU B;  1W8Z A;  4EN9 B;  1NT0 A;  4KWU A;  3CU7 A;  1EUU A;  3QBQ A;  3CJI C;  1W8T A;  1AR7 3;  1HRI 2;  2YBP A;  1HW5 A;  4JGZ B;  5FYS A;  1SHW B;  1BQP A;  1SMV A;  4QU1 A;  4PIX A;  2WO2 A;  3OUJ A;  2WWU A;  4JVA A;  3OUI A;  5T54 A;  4QM8 A;  1DZR A;  2CWS A;  3LIG A;  3CKH A;  4IGO A;  4B1M A;  3MZH A;  3CO2 A;  3NV4 A;  2LRP A;  3OY8 B;  4YNI A;  3NL1 A;  1UNB A;  5FZO B;  1WA6 X;  3MI8 A;  5HV4 A;  4E4D X;  3SKV A;  3POS A;  2G9G A;  5F5C A;  1JOB A;  5SV8 A;  4P5Y A;  3FBY A;  2WZE A;  4CCO A;  4TTG A;  2VME A;  5FY4 A;  1S0E A;  2XR4 A;  4GB3 2;  4I3P A;  2W3J A;  1LED A;  2H6B A;  3JUU A;  5JXI A;  1ZNP A;  3WF3 A;  4RQP B;  5IVC A;  4F7Z A;  3R4S A;  4YRD A;  3DEM A;  4TLG A;  1W6O B;  5FJK A;  4W6X A;  3RZH A;  5FZL A;  1KFX L;  1IPK A;  4Q27 A;  1PHM A;  2WSU A;  3PUH A;  1JS9 A;  1JYV A;  1NLR A;  5DZE A;  1MZF A;  2SBA A;  4LHL A;  5K0U C;  3TRS B;  1OI6 A;  1GU3 A;  3H8U A;  2VVD A;  3V0A B;  3NV1 A;  2VW1 A;  3I49 A;  3KVA A;  1OF4 A;  5T5L A;  3ZPO A;  5T50 A;  3VBU C;  1PO2 3;  1VB2 A;  2RJK A;  3AKQ A;  2X10 A;  1W6N B;  2R7E B;  5LAT A;  1MS9 A;  2HYK A;  5FK8 A;  4QX1 A;  3RZZ A;  3USU B;  3KQR A;  3L2Y A;  5CAD A;  1R08 3;  1LEC A;  1K3I A;  2RG4 A;  2WSV A;  1O6U A;  5FZO A;  5JVV A;  4XFG A;  1DGR N;  5H9Q A;  4CDU A;  4DXR A;  4IEO A;  1WW6 A;  4QPG B;  5CKN A;  4O9E A;  1DDL A;  5FZB A;  4Q0Q A;  1AYN 3;  2ATF A;  2D6M A;  3CJI B;  3JB8 A;  2JG9 C;  1I6X A;  3TYJ A;  3H3U A;  3R4U A;  1GOF A;  4YM3 A;  1JYC A;  4HPK A;  4RGG A;  2QE3 A;  2B9V A;  4XFI A;  1QXP A;  5EP9 A;  3HN3 A;  3BOD A;  4CCE A;  1XE7 A;  2RJ2 A;  5FZM A;  1JXN A;  2Y34 A;  2CHH A;  1RUH 3;  1AR8 3;  1MEC 1;  1QJF A;  3P1I A;  3LOB A;  3JD7 2;  4XW3 A;  1V6L A;  4PJY A;  3OGS A;  4YGD A;  4Q29 A;  2W1Q A;  1RUC 2;  3Q8E A;  2YV8 A;  4FTE A;  4MO3 M;  1HXS 1;  1Z7S 3;  2TUN A;  5BNO B;  1CJD A;  5FPV A;  4NMI A;  2JDU A;  3BI3 A;  5KHG A;  1DQ6 A;  2R16 A;  4PDW C;  3J7N A;  5KHI A;  5GLT A;  2G19 A;  3HQR A;  2HWD 2;  4OCT A;  4R9C A;  4FFI A;  3U14 A;  4FAG A;  5C9A B;  1W6N A;  5CG8 A;  1ASJ 1;  1CON A;  4Q4W 3;  3PJQ A;  1U5I A;  1UY0 A;  1W90 A;  4COY A;  2VCM A;  1QOO A;  1KFU L;  1GQP A;  4PQQ A;  3USU A;  3CHX A;  1VBE 1;  2D97 A;  2VMC A;  1G7Y A;  1I3H A;  4G3Y C;  4HSL A;  4LHN A;  3RWK X;  3E6C C;  4QX8 A;  1C1F A;  1PIV 2;  5LAS A;  3LFI A;  4UBG A;  4Q8K A;  4Y5T A;  4QPG A;  2CDP A;  3VZK A;  1YIP A;  4TN7 A;  4K8R B;  4YZ2 A;  4PLM A;  4XAA A;  3B93 A;  1LUL A;  4AFM A;  2ZS6 B;  3NNJ A;  3E6B A;  1RUG 2;  3VBF B;  1JOJ A;  5CB7 A;  2C0Z A;  4P9L A;  3CEW A;  3ZXD A;  2J1S A;  1ULD A;  2O8O A;  4J6G A;  3DYP A;  3OF1 A;  4RHV 3;  1I5Z A;  5HV0 A;  1PO1 1;  2JJ6 A;  4P5H A;  3AKT A;  3H0O A;  4AHY A;  4YVS A;  5J09 A;  2K2S A;  3MLK A;  3E5X A;  4HVO A;  4MUV A;  4TYS A;  5FZG A;  2YZ4 A;  3D4K A;  5A32 A;  4JCK A;  2IZW A;  3AC0 A;  1DG6 A;  3ILR A;  4R8H A;  4OHY A;  1QJU 2;  1W2N A;  2XKO A;  3AL6 A;  2VZR A;  4GH4 A;  3AZZ A;  3RDI A;  5C70 A;  5FQ0 A;  4LBQ B;  3ACL A;  2WO3 A;  3M4F A;  4I0W B;  3C8X A;  1SBD A;  5AVA A;  2R04 2;  4Y1V A;  1DF0 A;  5FYH A;  1CES A;  5AC9 3;  4ISR A;  3NJY A;  4CU7 A;  1WKY A;  5A3L A;  1VAV A;  3EB7 A;  2WFF 1;  2ZTN A;  3GGL A;  4W65 A;  1MEC 3;  1H1A A;  1OSG A;  1X7N A;  1W8W A;  1QQP 1;  4JAA A;  1POV 1;  3PIG A;  4CXW A;  1LHV A;  1YFU A;  3FZ3 A;  3NAP C;  3N3H A;  4G4F A;  4WM7 C;  4Y20 B;  4ZKT B;  5H9P A;  2O14 A;  5DDJ 3;  4ES8 A;  5A3P A;  4BZ4 A;  3SH3 A;  1EAH 1;  1RHI 2;  5FZE A;  5APA A;  2VEC A;  2XG3 A;  5FY8 A;  4ZU5 A;  3ZLI A;  4EZH A;  1NA1 A;  4RHV 1;  2HWE 2;  4CRQ A;  5A1L A;  2VU9 A;  3K3N A;  5A6Y A;  2G9Z A;  1AXZ A;  2NLR A;  3EQE A;  2AUY A;  4HON A;  1XRU A;  2EAL A;  2CDO A;  3O1P A;  2XVK A;  1RUC 1;  4YVS B;  4BB3 A;  3VUO A;  4CE8 A;  1DZT A;  5DUU A;  5KR7 A;  4HOO A;  2XLG A;  3FHI B;  3E5Q A;  2VW0 A;  1BBT 1;  3NKG A;  3NWK A;  3J7H A;  3S30 A;  3AYD A;  5FYV A;  2D5F A;  4E27 A;  4OMD A;  4RGA A;  1FAT A;  1IG3 A;  5EXO A;  5F1R A;  4Y26 A;  4WM8 A;  2EAK A;  3MBW A;  2WLP A;  3B69 A;  4OQ9 A;  1KD7 A;  1R09 1;  2D6P A;  4UFH A;  5AC9 2;  2BRT A;  4CYD A;  4XUO A;  1QDO A;  1GZW A;  2XOM A;  4MAD A;  3X29 B;  4LTA A;  1MS4 A;  1A8D A;  4FCA A;  4NVP A;  2Q5T A;  2EF6 A;  4NHL A;  4XC9 A;  4N90 A;  1PZ9 A;  4D6S A;  4RR3 A;  1F9K A;  4UBH A;  3BTX A;  1IQA A;  1DP0 A;  1QH6 A;  3FLP A;  4EJR A;  4Z07 A;  4EWA A;  4NWW A;  1RUJ 2;  4LHK A;  2B45 X;  3O0W A;  1XC6 A;  5J48 A;  5GLW A;  1KJR A;  1EAH 3;  4KBB A;  1DYP A;  4LA2 A;  4DXS A;  5F37 A;  4QGL A;  5IVB A;  1NCQ C;  3W5M A;  1VBC 2;  1TMF 1;  1F2N A;  2ZX2 A;  1YFX A;  3ZKY A;  2GNM A;  2ZMK A;  3VBO A;  1V9U 1;  3NVC A;  4FPJ A;  4CDU C;  1QXR A;  1WCK A;  1DQ1 A;  1TZO A;  4WZC A;  1S0G A;  3FX3 A;  1RMU 1;  2VG9 A;  1RUF 3;  2XLA A;  3EYP A;  1WZX A;  4CCD A;  1V6K A;  3BU7 A;  2WQZ C;  2WII B;  4NIH A;  2DYC A;  3BN6 A;  4FPK A;  5T3N A;  3MF6 A;  1LOF A;  2A6Y A;  2CSG A;  1J3P A;  4UYB A;  3ZN6 A;  1QJE A;  4LUM A;  5FXW A;  4AL9 A;  3KD4 A;  3NJX A;  1MS1 A;  5DQ0 A;  3PNA A;  5ACA 1;  1JZ7 A;  5FBJ A;  1J3Q A;  5FXV A;  1OHF A;  4UXA A;  5C71 A;  3I2H A;  3RYP A;  4IEZ A;  3WP4 A;  2BZD A;  1V6N A;  2JDK A;  5K0U A;  2YFZ A;  1JHN A;  4HL0 A;  5FZ1 A;  4IEV A;  4MGI E;  1UZV A;  2FDK A;  1LOD A;  4XQD A;  1UPI A;  2D3R A;  1F35 A;  3ZIW A;  1CWP A;  1S0B A;  2F4L A;  1WLC A;  3RI9 A;  1UPS A;  2XXZ A;  3MF9 A;  1VR3 A;  1QY4 A;  4Q4Y 3;  4GWJ A;  3APB A;  1T6G C;  1ZA7 A;  1DFQ A;  1UU4 A;  2VVE A;  2VZP A;  1Q5O A;  3KV5 A;  2V09 A;  1GLH A;  2VZU A;  3WW3 A;  1BBT 3;  5A6Q A;  1WCU A;  2R04 3;  3THP A;  1XE0 A;  4AQS A;  1VB4 A;  2OPW A;  2V4A A;  4NID A;  5JMC A;  1SLL A;  2GND A;  2FZ2 A;  2Z79 A;  3WG3 A;  4FT8 A;  2ZAB A;  3FHQ A;  3OGJ A;  5FZ3 A;  3UKN A;  2OT7 A;  4MGZ E;  3MW3 A;  4MZU A;  4OFG A;  1W8O A;  2C26 A;  1QWR A;  1QKQ A;  3LPF A;  5E1R A;  5F3E A;  4D7T A;  5HI0 A;  2BVV A;  1RB8 G;  4C0B A;  1JZ2 A;  3KVB A;  1AYN 2;  1SDD B;  2WT2 A;  1DLC A;  5L73 A;  5H9S A;  2ZMN A;  3ZXG A;  2K0G A;  5L9R A;  2HWD 1;  4XFB A;  3ZR6 A;  1C4R A;  5C3O A;  4OLL A;  3WDX A;  2GAU A;  3KMH A;  2JEC A;  4CCK A;  1GQG A;  4BQ1 A;  3E5U A;  1ZZ9 A;  1NY7 2;  3N7J A;  2JIJ A;  1POV 3;  4WZF A;  2VO5 A;  3HT2 A;  2FCV A;  2FBE A;  1GNY A;  3K48 A;  3PVO A;  5K0U B;  4L9B A;  2CL2 A;  5LY2 A;  4LIU A;  4W4Z A;  4C8D A;  1QXJ A;  3O5S A;  5FYY A;  2FDI A;  2JE9 A;  1X8M A;  4BQ4 A;  4A3Z A;  1J83 A;  4H55 A;  1OVS A;  4K7J A;  4IUG A;  1MS3 A;  2DCT A;  2W46 A;  4RA0 A;  3LIH A;  1C5I A;  4Y4R A;  4D3W A;  2VZ3 A;  3H1Y A;  5EV7 A;  1PVC 3;  4D7S A;  5IFP A;  1Q56 A;  2HWE 3;  4NHM A;  2ZGO A;  2OYZ A;  4Q4W 2;  5K8S A;  1UZ0 A;  3VD9 A;  1ENQ A;  2PFW A;  4QPG C;  3UKT A;  1OFN A;  2QQW A;  3M3I A;  1LHO A;  1WD4 A;  3MPP G;  1LTE A;  4K9S A;  1G9F A;  2CAV A;  2NPI A;  5FZF A;  4NRO A;  4AWD A;  3VBH A;  1XJA A;  1Q8O A;  1EYB A;  2D44 A;  1LEM A;  3AKR A;  4Y1U A;  1C8M 1;  4FFH A;  4J1X A;  1FYU A;  2Y0O A;  3H3Z A;  4NIA A;  3JU9 A;  4Q1R A;  4Q0P A;  1Q8S A;  2JIC A;  3AZV A;  1IS6 A;  3D0J A;  3KT1 A;  4N7U A;  5ACA 2;  1I1E A;  1R64 A;  1D2S A;  1FPN 1;  2BUK A;  4XPV A;  1NCR A;  3W9A A;  2JX9 A;  3ZFG A;  2DTW A;  2RDN A;  1X9T A;  4S2G A;  4AGV A;  4CCL A;  1PGW 2;  1N3Q A;  1YEW A;  2XQR A;  4JX0 A;  3U10 A;  2BNO A;  5BNN C;  1AL2 3;  3LGR A;  2VZ1 A;  5F6K A;  1IG0 A;  3NAP B;  5JDB A;  5C6C A;  3TWI A;  3I8T A;  3OPT A;  4P14 A;  4MGT A;  4QX7 A;  4GWI A;  3RG0 A;  4XJU A;  5A80 A;  1RUI 2;  4AFB A;  4D94 A;  3KZ4 C;  2FDH A;  3VD5 A;  3I3D A;  4A42 A;  3JBG 3;  3GJB A;  1NXD 1;  4P9W A;  3ACI A;  5FUN A;  3RSJ A;  5L9V A;  2HWE 1;  1RUF 2;  4DEQ A;  1H9W A;  5LEJ A;  3TEY A;  1V70 A;  1LRH A;  1MZ6 A;  2V72 A;  3GZA A;  2Y60 A;  1U5X A;  2PQS A;  1RUG 1;  1KS4 A;  4AI3 A;  2RS1 2;  4GKX A;  1OPO A;  2L9L A;  3LF7 A;  3B02 A;  4BHP A;  2QKD A;  3AMN A;  1YJL A;  2VTF A;  1TNF A;  3LDK A;  1PGL 1;  4LBL A;  1SLB A;  1IS3 A;  3D5O A;  3K77 A;  3WLU A;  4DMI A;  1S2K A;  3WIN E;  2YPJ A;  1C3H A;  4OUL A;  4CCJ A;  5I0S A;  2RS5 1;  3T4V A;  2P34 A;  4QQ2 A;  4CEW B;  1SFP A;  4CCM A;  3TEW A;  1GSL A;  3ZXJ A;  1COV 1;  2V73 A;  3ECQ A;  3IT8 A;  3R05 A;  4CDX B;  2R0F A;  4U2A A;  4YLZ A;  3RZJ A;  2JE7 A;  3AJY A;  2QVS B;  4L2N A;  4L97 A;  4FQZ A;  3SCF A;  2VQ0 A;  2DCK A;  3I2I A;  4L99 A;  4UF0 A;  3CZJ A;  2DFC A;  4NN0 A;  5A1F A;  2HWB 2;  4ATF A;  5FOJ B;  1UO9 A;  3HBK A;  3VD4 A;  1URX A;  1GP6 A;  2ZA9 A;  4M0N A;  4AED A;  2CY6 A;  1MQT B;  3AKS A;  4EV0 A;  1WA4 A;  2WBK A;  4XQ4 A;  2A75 A;  1XB9 A;  5KXE A;  2XUE A;  1JUH A;  3J8F 1;  5JOY A;  1TMF 2;  2JEN A;  4LPL A;  2ZEX A;  1UY3 A;  1DQ4 A;  2R6Q A;  2HBU A;  4LUK A;  3WDW A;  4BQW A;  4DO0 A;  5L7O A;  2MEV 2;  4S2F A;  2E51 A;  2C24 A;  2QQK A;  5DPN A;  2W0X A;  4Y33 A;  1DYK A;  3TOJ A;  1XNB A;  2VW2 A;  3MLL A;  4FI9 A;  2JE8 A;  5DDJ 2;  3AVS A;  3HR9 A;  3VZN A;  2VZO A;  3QD6 A;  4MHR A;  4HZF A;  4LNV A;  2ZGP A;  5C3R A;  3VZM A;  3S7I A;  1XNK A;  3USS A;  1RUE 1;  5A32 B;  4IL7 A;  5FZ0 A;  3S6P A;  3GHN A;  2XJU A;  1TVG A;  3NO8 A;  1AX2 A;  3LEI A;  5DAX A;  5IVV A;  3KLS A;  2N7G A;  2B39 A;  5D1I A;  2WYS A;  2FD8 A;  2EIG A;  3POW A;  3RZL A;  3OEB A;  2HWF 1;  4UFK A;  3POE A;  1WMD A;  3I97 A;  3ZYP A;  3NST A;  3HPN A;  4LK7 A;  4P9X A;  5C4W A;  1LOF C;  4DUV A;  5JOW A;  2GP3 A;  4LBQ A;  3KQ4 B;  4XDP A;  2BDR A;  1ZBE 2;  2I45 A;  1SEF A;  2ARA A;  5L36 A;  4A4A A;  1R09 2;  1ZBA 3;  1XYP A;  4CDW C;  1MVQ A;  1VBE 3;  2W87 A;  1LGC A;  1GZC A;  4AEJ A;  3TEZ A;  4QHB A;  3N9M A;  4B4P A;  2W2I A;  4GD4 A;  3C7F A;  3C3V A;  3QH6 A;  1YXW A;  2ES3 A;  5J7M A;  2WQ8 A;  5C8C A;  3PDQ A;  1H4G A;  5FIX A;  3WW4 A;  2WZ8 A;  5FY1 A;  5JR7 B;  4CUB A;  1LHW A;  3B94 A;  2FDJ A;  3C7G A;  2TBV A;  3ZYJ B;  1C8M 3;  1UY4 A;  2W1U A;  4QB1 A;  3NV3 A;  5K9Y A;  2JDN A;  1G9C A;  2X09 A;  5BXX A;  5JPN B;  4Y5S A;  4MYE A;  2FZ1 A;  3O1V A;  1WLW A;  4KBZ A;  3LAG A;  2Q30 A;  2VBD A;  1IS4 A;  5DMY A;  2XHK A;  2OW4 A;  4BXF A;  1EUT A;  1NLS A;  4CU6 A;  2Q8D A;  4BQ3 A;  3WF4 A;  1O5U A;  5KC5 A;  1BKZ A;  1R1A 2;  2GP5 A;  5FZA A;  1YIF A;  2BJS A;  3DF0 A;  4KQ7 A;  3T2T A;  5FWJ A;  4Q8L A;  2FDG A;  2B5H A;  3VB9 A;  3ZMN A;  2VNV A;  2R07 3;  1O7F A;  4BQY A;  4TLF A;  5DXD A;  2LUW A;  1D0H A;  2YC2 A;  2W92 A;  4BA6 A;  5C4W B;  5IK4 A;  4NPL A;  4OI1 A;  4D7Y A;  3SH4 A;  2XJS A;  4WVM B;  4H3W A;  1LOG A;  2UYB A;  4WVV A;  1ZBA 1;  1NCQ B;  1CAU B;  4MG2 A;  2D3P A;  4UW3 A;  5AVP A;  4EN0 A;  2DVB A;  1RXG A;  2ZZJ A;  4YG0 A;  4XXP A;  1V6M A;  3D82 A;  1YO8 A;  3C7O A;  4P9Y A;  1XNA A;  3NJZ A;  3U11 A;  2SLI A;  3VBU B;  4Z82 A;  4D6Q A;  5C7G A;  2VOX A;  2A70 A;  2WNV A;  4NJ4 A;  2H6C A;  4BIF A;  1WLT A;  3K51 A;  4YGE A;  4RSU A;  1U0A A;  1NKG A;  3ELN A;  3KCY A;  4LO8 A;  1C8M 2;  2RS3 3;  1DLL A;  2OUJ A;  1KIT A;  1YQ2 A;  2Y26 A;  2DDU A;  3BIE A;  5HCH A;  1COV 3;  2BQP A;  2GMP A;  3ST7 A;  4YVW A;  3N9L A;  2BTV C;  5A7S A;  1MPX A;  4H7L A;  1AYM 1;  1OBN A;  2Q0A A;  1E5S A;  2VMD A;  4XAE A;  5BNP A;  2BWC A;  5C5T A;  4OUS A;  4FPY A;  3VGI A;  3MID A;  1AYN 1;  4KWJ A;  5FO8 B;  2RR1 3;  3GCW A;  3QH7 A;  1ZBE 3;  1N3O A;  5FMC A;  2QDR A;  2YUE A;  4YW7 A;  1NLQ A;  5IVY A;  3CF6 E;  2AZ5 A;  4CU9 A;  2XL7 A;  5KXB A;  3VBS B;  1JYI A;  1B35 C;  1X50 A;  1FOD 3;  3J9S A;  4WVM A;  3ZSL A;  2W52 A;  1F15 A;  3WP5 A;  4HSJ A;  1ULO A;  1H8T C;  5C3P A;  4E2S A;  2DVA A;  4R4X A;  4FO9 A;  4E4S A;  3JQX A;  4QGN A;  1SZB A;  3HVD A;  5F3C A;  4FOV A;  4XBL A;  2X5I C;  1GWM A;  2A3W A;  2AEY A;  2X5I B;  3AZW A;  3KF3 A;  3OB8 A;  4UOJ A;  2D6L X;  3HBZ A;  3VBU A;  5JMO A;  2XBO 3;  4I2O A;  3ZM8 A;  4GB3 1;  3O1M A;  2HWC 3;  2P6H A;  5A6X A;  3DGT A;  2AEN A;  3K3O A;  3MV0 1;  1HJG A;  4JDO A;  2BU9 A;  1PZ8 A;  1RJ7 A;  2VNG A;  3AP5 A;  2EAA A;  1SLT A;  2C5D A;  1QJY 3;  2VOK A;  3MIG A;  5FP9 A;  1SQ4 A;  5EQU A;  1KQR A;  1QH7 A;  2JB4 A;  1Q8V A;  4N53 B;  4Q2F A;  1XND A;  4JKM A;  5LK5 A;  2VUL A;  3M3C A;  3I2D A;  1DGL A;  4JKL A;  4OZO A;  2WQ4 A;  3W58 A;  1JN2 P;  2WO1 A;  2OA2 A;  3KM5 A;  2DCJ A;  1VBB 1;  3BIW E;  2H0B A;  4JZR A;  1ZX5 A;  2R49 A;  2VQT A;  4RS5 C;  2HWB 1;  5GLV A;  3U07 A;  3BUC A;  1W6M B;  2ARE A;  4TZD A;  3I3Q A;  3LA3 A;  5JZG B;  5G05 L;  2ADD A;  3IAP A;  1FOD 2;  2A3X A;  3MIH A;  2DUQ A;  3T30 A;  1YRZ A;  1TME 2;  4DFS A;  4FXG B;  4GMP 3;  5FJH A;  2HH9 A;  1FPN 3;  4FQ4 A;  5BPX A;  2JG8 C;  2BGC A;  3U4S A;  1O3R A;  3WQ7 A;  1ACC A;  5EFU A;  3ZFE B;  1Y4W A;  3FHA A;  2IXC A;  1W6P B;  5FZH A;  2VMG A;  4QB2 A;  2VY0 A;  3LA2 A;  4K8F A;  2VMH A;  5JI9 A;  5A7W A;  2MEV 1;  4XJW A;  4CP1 A;  3O1R A;  1F5J A;  3FE5 A;  1X36 A;  2PLV 2;  3LEK A;  3WDV A;  5A3O A;  4GQ7 A;  2V4V A;  3WOG A;  1WCQ A;  4NRP A;  5D21 A;  1ENS A;  1G86 A;  1GWK A;  2DBI A;  4Q4V 2;  4QGM A;  5FWE A;  1A8M A;  3OUH A;  1GKB A;  3PUI A;  1FV2 A;  4PBP A;  5FPU A;  2R06 1;  3VD7 A;  3ZXL A;  5BNP C;  4IQP A;  4HLT A;  4ZS3 A;  4IEX A;  2JIG A;  2VC9 A;  2XH6 A;  3AX4 A;  3IDC B;  4KNC A;  1YHF A;  3RPQ A;  5I0T A;  4R9D A;  2NP0 A;  4HBN A;  3B3Q E;  3KSC A;  3LWC A;  4WVW A;  3I54 A;  3N36 A;  4XJ8 A;  4CXY A;  5AFB A;  4DZG A;  1RUI 3;  4HMZ A;  5EPA A;  2WNU C;  2ARX A;  2PN5 A;  2E9Q A;  3DPR B;  3AMP A;  5EZW A;  4AEM A;  2FHR A;  3O0X A;  1WGP A;  3R6S A;  4YZ1 A;  4XJZ A;  3UES A;  1HDK A;  4CDQ C;  1GP5 A;  1OUS A;  2R0H A;  3VBO C;  3VLB B;  3ZFE C;  1LAJ A;  1XPW A;  4KH9 A;  1Z7S 1;  1QJY 1;  2VOT A;  1OA4 A;  4ZPI A;  4CA9 A;  5CBL A;  3I3M A;  4LE4 A;  2VOW A;  3WDY A;  1O91 A;  2LS6 A;  1GNZ A;  1QJX 3;  1W6P A;  3O0V A;  3HNY M;  4M00 A;  1OLQ A;  4NHX A;  4QHZ A;  4AAP A;  5LRS A;  4UAP A;  5CAZ A;  3IBM A;  2Y6L A;  3RS6 A;  4GA9 A;  4BWO A;  4Q5O A;  2JDZ A;  5ABJ C;  2W08 A;  5A7W B;  1ZRI A;  4YW6 A;  4D69 A;  1CJP A;  1ZZC A;  1PVC 1;  1NA1 B;  3LSE A;  5FV3 A;  3WQB A;  2HKX A;  4S2H A;  2HYX A;  1VBC 3;  5F5Q A;  4N43 A;  4LO5 B;  3OG2 A;  4PI0 A;  2ENR A;  4TXW A;  5LRR A;  2Q8C A;  3THT A;  1PO1 2;  2ZEY A;  2ZGN A;  4NO4 A;  2BV4 A;  5L9B A;  5LCW L;  5C3S A;  3VD3 A;  1NQJ A;  1VBD 1;  2RM2 1;  1X33 A;  4I01 A;  4LKF A;  4YZ4 A;  3ZXF A;  3ZYR A;  2R30 A;  4QT6 A;  1HRV 1;  2Q1F A;  2Y6H A;  3VDD A;  1H2N A;  1LGB A;  4K6B A;  1DCS A;  5DUV A;  4IEY A;  1QJU 1;  1JW6 A;  1MEC 2;  1CQ9 A;  1N1Y A;  3DCQ A;  4B7K A;  3TN9 3;  1UX6 A;  3OGV A;  2WAA A;  2ZGM A;  2ARB A;  1CR7 A;  4NR1 A;  4AI0 A;  1UOJ A;  2VJX A;  3BPS A;  2LAL A;  5GAL A;  5JUV A;  2VL4 A;  1TNR A;  3FUQ A;  1VRB A;  3VKN A;  4NAO A;  5F8P A;  4A3X A;  4CDX A;  2PA7 A;  2PAE A;  3UV9 A;  5FY0 A;  2P3J A;  3ZO0 B;  2VVF A;  1W05 A;  2XBO 1;  5FK7 A;  2HWC 1;  2ORX A;  4IER A;  2Z69 A;  1T2X A;  4PDW B;  1V00 A;  1ZBE 1;  3MHZ A;  4URT A;  4XZP A;  2RDQ A;  4RQP C;  1BMV 2;  3Q9O A;  3ACH A;  3LDB A;  2X29 A;  5JSO A;  1XOY A;  5ANN A;  4CP2 A;  1HN0 A;  1F8V A;  2GNT A;  3IDE A;  1UAI A;  1RTV A;  3ES1 A;  3V64 A;  1JZ6 A;  3LA7 A;  3VBO B;  5C5U A;  4FAH A;  3M8L A;  5FPL A;  4C1X A;  3VKM A;  4N53 C;  2J1T A;  5FYB A;  2XQX A;  2LRO A;  3PVE A;  3SCH A;  4JGZ C;  4Y24 A;  2WNV C;  1JOD A;  3OBR A;  4XF1 A;  3HD8 B;  1ASJ 2;  4Q4X 3;  4FPC A;  4E4Z A;  2VQA A;  3M3O A;  2WNU A;  3BTY A;  4LBM A;  4FFF A;  1VAM A;  4GJZ A;  1YQC A;  3ZYI B;  4OUM A;  5F2S A;  2UWB A;  3A7Q A;  3K4Z A;  4E4H A;  1RED A;  5GLU A;  3WNM A;  1RIR A;  4XYX A;  1F4H A;  5DAW A;  3RJ2 X;  2WT0 A;  3H3L A;  2E7Q A;  2J1V A;  4LA3 A;  1PM4 A;  1AR6 3;  1Y3T A;  1W99 A;  1OD3 A;  4LQR A;  4N9H A;  5AC9 1;  4R52 A;  1K12 A;  4A6S A;  1QJY 2;  4LKD A;  2FDF A;  4WM7 B;  3LOI A;  3AXD A;  5FBZ A;  3RJR A;  5A3W A;  4CUC A;  2EXK A;  1VBD 3;  1REF A;  1W03 A;  3UET A;  5A33 A;  1YYN A;  2CV6 A;  1LOB A;  5FZ4 A;  1HB3 A;  5A7P A;  3WDT A;  3ILF A;  3OBA A;  4FPL A;  4LIT A;  1LJ7 A;  1AX1 A;  5BY5 A;  4AFD A;  1HQW A;  1UY1 A;  3WF1 A;  5C8C B;  3H7J A;  1C8N A;  1EY2 A;  1UMZ A;  2MNG A;  2W1S A;  1W2O A;  1XU1 A;  2RV9 A;  5FP4 A;  3LKJ A;  2ZKL A;  3HQX A;  1AZD A;  4FPG A;  4O61 A;  3T2P A;  2DUR A;  1ZRD A;  2JDP A;  2OX0 A;  4LHS A;  3ZSE A;  5BNO C;  5BNN B;  1Z78 A;  4CSW A;  1EAH 2;  1D2Q A;  1RHI 1;  3AKP A;  5JOX A;  1AJK A;  4FVV A;  3EHK A;  3AFG A;  1MS0 A;  1H4H A;  2W47 A;  2W94 A;  1H6Y A;  3JCI A;  5FP8 A;  4XE9 A;  4B29 A;  1EV1 1;  1UYP A;  3VBR B;  1ND3 B;  4BK5 A;  2VD7 A;  4Y1Z A;  4LK6 A;  4M3C B;  3QOP A;  1HV0 A;  4QXB A;  5BNQ A;  3H1W A;  3GYD A;  4LO4 B;  1CAW A;  5FYI A;  4AXO A;  3K4D A;  3RNS A;  5FRE A;  1SPP B;  1W6Q A;  1MS8 A;  2HEY F;  1ZA4 A;  2VNO A;  4ITC A;  4CTE A;  4K1Y A;  1BBT 2;  1WUV A;  1DZQ A;  1M06 G;  5LWB A;  4PBO A;  5CNA A;  1GP4 A;  1VBA 2;  2Q4S A;  4NRQ A;  4RHV 2;  1FV3 A;  5A33 B;  3SHR A;  3GXU A;  3W21 A;  2A1X A;  2WWJ A;  3BAL A;  4AGR A;  4GXL A;  4PIY A;  4Q1P A;  4QQL A;  1IKP A;  1B35 A;  3WP6 A;  2JKB A;  1APN A;  4H2A A;  5LBF A;  4DXZ A;  2DUO A;  3OCP A;  1LOA A;  3WXP A;  2GSY A;  1S2B A;  1H8T A;  4QKD A;  1LHN A;  5BV6 A;  4E9K A;  1DHK B;  5IAX A;  1RMU 3;  2D93 A;  4QQO A;  4B7E A;  1AVB A;  3MIB A;  2GH2 A;  3N9O A;  1PX4 A;  5CKM A;  5JXG A;  2D6K A;  3V0B B;  2ADE A;  4QQP A;  3O1U A;  2PHF A;  2IFW A;  5FLH A;  4BME A;  1OQD A;  1NCR B;  1GMM A;  1V9U 2;  1SDW A;  4R9B A;  3ZFG B;  1XQN A;  3AP4 A;  2VZT A;  2D43 A;  4DUX A;  4ATE A;  4CVU A;  3HOB A;  2PHX A;  1MVE A;  4LR4 A;  2ET1 A;  3J7M A;  2EXH A;  4K3U A;  1ZZ6 A;  1CAW B;  2KXL A;  1QNW A;  4QQH A;  4XUQ A;  3UGF A;  5GZC A;  1H1M A;  4IE6 A;  3LDR A;  4QWN A;  1RYY A;  1YQ6 A;  1X82 A;  5CIR A;  5F7U A;  3SXW A;  2OKX A;  2YPD A;  5C9A C;  3HIF A;  1AJO A;  4R9A A;  2EXI A;  1D4M 2;  1IPS A;  1RVF 1;  1YCI A;  3IPV B;  4NAM A;  1PVC 2;  3ZSJ A;  5FY9 A;  3URF A;  4NUB A;  4GKY A;  1AR7 1;  5IW0 A;  4CDX C;  2YMZ A;  4MVT A;  1EV1 3;  2YGM A;  4YVS C;  3D3A A;  3IB3 A;  3SNM A;  4BQX A;  1L7R A;  1FMD 3;  1QOS A;  2WAO A;  3O12 A;  4BH9 A;  1HB1 A;  1R08 2;  2X5I A;  5HXV A;  3WNP A;  4E2G A;  2FMY A;  5GZF A;  2E26 A;  1OLR A;  1RIN A;  1A3K A;  4MSV A;  3WR0 A;  1G9D A;  4G9S B;  4M01 A;  1E5I A;  4OHZ A;  2UWA A;  2XPJ A;  1PMJ X;  2IXI A;  4C90 A;  1HRV 2;  2PHT A;  3DXT A;  4FFG A;  1E57 A;  3U1X A;  4Q0S A;  4Z2W A;  1UZW A;  2WS9 1;  3OD0 A;  3VHR A;  4B1L A;  4AI8 A;  2VUA A;  2BGO A;  2IXH A;  4NII A;  1OKO A;  1RGS A;  2PHW A;  4MHU A;  1PIV 3;  3HNB M;  3AMH A;  4SBV A;  4XHB A;  4MXW A;  3RZG A;  4RL7 A;  1KXG A;  1GR3 A;  1GAN A;  4HK9 A;  4AVC A;  1PGW 1;  2ZZQ A;  1MAC A;  1DQ5 A;  2XJT A;  2WZP P;  3HWJ A;  4Q4X 1;  4LMF A;  5FCC A;  5T5P A;  2ZEW A;  4MX3 A;  4BLJ A;  3WZ1 A;  4LOR A;  5FMB A;  2XGX A;  1K45 A;  4AED B;  1ND3 C;  3VV1 A;  1OLM E;  2RS3 1;  4J25 A;  4ZON A;  3LSD A;  2GC0 A;  4JGY A;  2QQM A;  5C8W A;  2VXJ A;  1GWL A;  2RDS A;  2PHU A;  3ZFE A;  4J1W A;  5F5I A;  2DBN A;  5B4X A;  2B8M A;  3FL7 A;  4LT5 A;  1WCD J;  4DNY A;  2ETE A;  1FMD 1;  4GAL A;  3MW4 A;  4QDR A;  3VN4 A;  4YM1 A;  4FPH A;  1OF3 A;  1X8E A;  3POB A;  5ABJ B;  2OII A;  2ZGK A;  4ZXK A;  2HBT A;  1JTZ X;  5D8A B;  3VKL A;  4XDQ A;  2JB8 A;  4PT6 A;  4XTP A;  5I8T A;  1ND2 B;  3HJR A;  3MEP A;  1BK1 A;  4S2D A;  1J84 A;  3RYK A;  1NY7 1;  1KS5 A;  5GLZ A;  1IS5 A;  3N7M A;  3B5L B;  4JC1 A;  4EN7 B;  2ZX4 A;  3BCW A;  3WP3 A;  4AZZ A;  2O8Q A;  3SQO A;  4CXX A;  2BOI A;  4FP3 A;  1XNC A;  3PJY A;  2LTN A;  3ILN A;  2OQ7 A;  4QU2 A;  1COV 2;  4L11 A;  3ZXE A;  1GYK A;  4JV4 A;  4AK3 A;  4N7I A;  3WNX A;  1BEV 1;  4IE0 A;  1VRH 2;  4COZ A;  4YAR A;  5C9A A;  2DWR A;  2IXK A;  4AQ2 A;  1W8U A;  3V56 A;  1REE A;  2RS1 3;  1CIY A;  3ZYB A;  3P3N A;  1KEX A;  2PHD A;  3VL9 A;  3OOX A;  4Y3O A;  1HQL A;  3JBG 1;  3GCX A;  3TN9 2;  1F31 A;  4YVW C;  2C9K A;  4JGY B;  1JH5 A;  4ZU4 A;  3WV6 A;  2K46 A;  2Y8K A;  5KXC A;  1O4Z A;  5CYY A;  4ASK A;  3UK9 A;  1W0N A;  1UMH A;  1YFY A;  2WA3 A;  3LZZ A;  2RVA A;  4LBO A;  4NHY A;  4EWE A;  1WMF A;  5ABJ A;  4QX5 A;  3SIT A;  5A3U A;  4NHK A;  4ZZ8 A;  1LU1 A;  1VP6 A;  5D8A A;  3W5N A;  4LO7 A;  1AR9 2;  1FPN 2;  4JRA A;  1ND2 A;  2GU9 A;  3WHU A;  2JEM A;  2AYH A;  2NMO A;  1O4T A;  3LFM A;  3VDC A;  3JD7 1;  5FTT C;  2CYF A;  1JBC A;  4CCN A;  3IM0 A;  4COW A;  5C33 A;  1B09 A;  1US2 A;  3KS7 A;  2PAM A;  2X05 A;  1MZE A;  4BYY A;  1C57 A;  2I74 A;  4GWN A;  4OHV A;  1UKG A;  4DIN B;  4BPZ A;  4EN6 B;  3GZT B;  1ASJ 3;  2QCS B;  3OGR A;  1RUD 2;  4Q4X 2;  3RVH A;  4Q4V 3;  3AP7 A;  3N9Q A;  4M3C E;  4WBB A;  4CPB A;  2Z2S B;  1UYY A;  4ES9 A;  3QAC A;  1CAU A;  2Q8O A;  1H8V A;  2PLV 3;  5G04 L;  2WIN B;  5FY5 A;  4P08 A;  3T2Q A;  5LA0 A;  4OVE A;  4XOG A;  1NZI A;  3VZJ A;  2XWJ B;  2JG8 B;  3RFR A;  1Y9M A;  2GMM A;  5A7N A;  1KRI A;  3ALQ A;  2R1D A;  1AYM 3;  1SFY A;  3OJB A;  1WD3 A;  3K4A A;  4BOW A;  2LM3 A;  3POI A;  4Y20 A;  1WLD A;  1UXX X;  3L9J T;  1NQD A;  2ZAH A;  2WS9 3;  1PX3 A;  3T0A A;  4MET A;  4E8C A;  2P3K A;  3ZFF B;  4XJA A;  3RMY A;  3ES4 A;  5GZD A;  4A44 A;  1H1I A;  4X8N A;  3KV4 A;  1QQP 3;  2XML A;  4YVW B;  1IZ3 A;  1ENX A;  1LES A;  2X8K A;  4AGG A;  2VZQ A;  4AG4 A;  4YSF A;  2QUO A;  3PTR B;  1SLA A;  4FP2 A;  4Z8B A;  3K75 B;  4XET A;  3H1M A;  1VAK A;  1R1A 1;  1RUO A;  4RYD A;  2A6X A;  3POF A;  4RFR B;  4GUL A;  4YW1 A;  4LBJ A;  1UF2 C;  3INA A;  3N4M A;  4HKO A;  3FLT A;  4LKE A;  3DXU A;  2Q1Z B;  2VMF A;  3VBS A;  1ODM A;  2WLQ A;  4AED C;  5CFC A;  1RJ8 A;  1R1Z A;  2VTX A;  2XKP A;  2YC4 A;  1UY2 A;  3EMR A;  1GZW B;  4HET A;  5FUP A;  5I8S A;  1HXS 2;  1AR6 2;  1W0P A;  2W95 A;  3DUI A;  3MDP A;  1HIX A;  4XCA A;  2G4I A;  1BYH A;  4QXC A;  4K40 A;  4RR3 B;  4QAW A;  1W04 A;  3KF5 A;  3OBT A;  5L19 A;  1BZW A;  2PMW B;  3R4D B;  4F8A A;  5DDJ 1;  1BCX A;  4YW3 A;  3U4X A;  3CL1 A;  1M4W A;  1V0A A;  2P5B A;  2VZV A;  4AVT A;  4RS5 B;  1FX5 A;  3MYX A;  3LB9 A;  3WEZ A;  1AUY A;  1RUH 2;  1W6O A;  1HLC A;  4HAN A;  2X53 S;  1V6O A;  4F83 A;  4QX3 A;  4CZS A;  2Y6F A;  1GNH A;  2MHF A;  2QFE A;  3ON7 A;  3WW2 A;  5K7P A;  1Y9G A;  2NMN A;  4IND A;  4JKK A;  3NRU A;  1XU2 A;  2E7T A;  4DS0 A;  4FPO B;  5BNN A;  2VZS A;  1G9B A;  3CZU A;  1CZV A;  1UYX A;  2D98 A;  4I3G A;  3SIS A;  1W6M A;  1UOF A;  3WCR A;  4QHO A;  3PMS A;  4IE7 A;  4IEQ A;  4YGB A;  1HX6 A;  1OH3 A;  2R06 3;  3N7L A;  3SEE A;  3H42 B;  4KWL A;  2BWA A;  2P4E A;  3WVJ A;  1EPW A;  4XFF A;  4A7Z A;  4Q26 A;  4AI2 A;  1UKR A;  1PM7 A;  1JU4 A;  5IUQ A;  4CEY B;  4UFI A;  2QNK A;  3D8C A;  1W6Q B;  4UW5 A;  1JZ8 A;  2QZ3 A;  2IVI B;  3KB5 A;  3ZMO A;  1UU6 A;  1JI6 A;  2HEV F;  1JU3 A;  1W2T A;  1ZZB A;  4NWV A;  3VDD C;  4YM2 A;  1BEV 3;  4HPK B;  2MPF A;  3ZN5 A;  2WL1 A;  2UU8 A;  4WVZ A;  4XZU G;  5CFD C;  3DYO A;  2ID4 A;  5IWF A;  3FC0 A;  1GQH A;  4COU A;  5IK5 A;  1UMI A;  2D3S A;  2DV9 A;  1CGP A;  3ASI A;  2ZX1 A;  2GC1 A;  5FYC A;  1F4A A;  1AL2 2;  1S4C A;  5FDB A;  2Z42 A;  4BE3 A;  3BB6 A;  2VCA A;  4W6W A;  5DUW A;  1YC6 1;  5CA6 A;  3FLR A;  4IW3 A;  1FI2 A;  4XFH A;  5CU1 A;  2E31 A;  2QQN A;  3LE0 A;  4EYU A;  4Q4Y 1;  4NRM A;  1LU2 A;  5JSP A;  1LCL A;  1UWW A;  4QX0 A;  1NG0 A;  3V65 A;  2XDV A;  2XWB B;  3OYW A;  4ZS2 A;  5FYU A;  3SEP A;  1H2L A;  1UIK A;  5DAB A;  2Y38 A;  2R04 1;  1N47 A;  1GV9 A;  4UI9 L;  4ZHN A;  2WS9 2;  3DPR A;  5GZE A;  4CDW A;  1J59 A;  4PQ9 A;  3PTY A;  2WFF 2;  1ZYB A;  5FPA A;  4I30 A;  1FOD 1;  1W8F A;  3ZSM A;  1AYM 2;  3S5A A;  4GIQ A;  3AL5 A;  3VBR C;  4AQT A;  2JKX A;  3M3E A;  2BNN A;  3OPW A;  4YM0 A;  3B7M A;  1UW8 A;  2VUJ A;  3MFC A;  1CIW A;  1NUK A;  1POV 0;  2A6W A;  2B9U A;  2NQY A;  2RM2 3;  2ZPX A;  4ONU A;  4XQW A;  5JXH A;  5JPM B;  3WY6 A;  1OT5 A;  2WZR 3;  4KI5 M;  3F2Z A;  1OLM A;  4A2U A;  2W39 A;  1CZT A;  3U0Z A;  1WME A;  4MOA A;  4QPI B;  3WNO A;  1GOG A;  1O4Y A;  2PLV 1;  4RFT 0;  5EJ3 A;  5CKQ A;  2V5D A;  3AMQ A;  3BOW A;  3NNG A;  4KGG A;  5T5J A;  4RN5 A;  1VPH A;  4Y4Y A;  3VZL A;  1VBA 3;  1W8H A;  2B4K A;  1VLN A;  3GHM A;  2O1Q A;  3KV9 A;  4MLO A;  5HCB A;  3ATG A;  1H2M A;  3VBH B;  3B9I A;  4AFA A;  4HXC A;  2WA4 A;  1CVN A;  3VDD B;  1C5H A;  3OYW B;  1ULP A;  3H9A A;  1DQ0 A;  5J96 B;  2DVG A;  2A7A A;  1ND2 C;  1D7P M;  3SC7 X;  2GNB A;  1GUI A;  3I2J A;  2E63 A;  1ZRC A;  1R09 3;  3IN9 A;  1RXF A;  1PMH X;  4KG8 A;  1QDC A;  3ZKU A;  4MXW B;  1IGO A;  2BBV A;  4MGY E;  4N8M A;  4D0Q A;  1JYT A;  5FPB A;  2A3Y A;  2YC0 A;  2CGN A;  2WC2 A;  4JHZ A;  4LOT A;  3VHN A;  1LOE A;  1OA2 A;  2ZGR A;  3NAP A;  4W50 A;  2D40 A;  2WRA A;  4AYU A;  3GBF A;  3OEA A;  5DG2 A;  1BVV A;  4QX2 A;  2C1F A;  1E5R A;  1DGW A;  1RUD 3;  1ENR A;  3ENR A;  4YW2 A;  3U75 A;  3WUC A;  4CCC A;  4DY5 A;  1JYW A;  3BKZ A;  4OMC A;  4JQR A;  1H6X A;  4KU7 A;  5A6Z A;  2ORZ A;  1I5P A;  1S0I A;  1LOC A;  1WWY A;  1P8J A;  2BOJ A;  3ACG A;  3CIH A;  2YXS A;  3FBM A;  3I7D A;  3PUR A;  5K4L A;  3T08 A;  4MH0 E;  2Z4F A;  5HXM A;  1MS5 A;  5CZK A;  1AL2 1;  3I3E A;  4TSV A;  4UFM A;  3ZIX A;  3EO6 A;  5EWS A;  4BXS V;  4URA A;  4O7X A;  1W8N A;  3GAL A;  1VMH A;  3UGG A;  2P3Y A;  4EWD A;  4EQV A;  4XUT A;  1VBD 2;  2OUH A;  4XIO A;  4ZU7 A;  5KHJ A;  4GWM A;  5C4W C;  4IV1 A;  1NXM A;  3I2K A;  1Q8Q A;  3DN7 A;  1D4M 3;  4HK8 A;  2IVJ A;  2WNU B;  3UYJ A;  3ZXA C;  4OI0 A;  5FO9 B;  2UYA A;  2VPV A;  4YGC A;  4ET7 A;  2R07 2;  1QF3 A;  1OOP B;  4QXH A;  3FWE A;  2E53 A;  3ZYF A;  2C4X A;  3POG A;  4ISQ A;  2V5Y A;  3AP9 A;  5E88 A;  2J7M A;  2YRO A;  4XIK A;  2P2K A;  3KGL A;  5ERL A;  5KXD A;  3I59 B;  3IMN A;  3MLJ A;  5A7O A;  3WW1 A;  4I09 A;  3JD7 3;  4IXL A;  4RR3 C;  3NMB A;  4A41 A;  4XTM A;  1QU0 A;  3WHT A;  4GZ9 A;  1CPN A;  2WDB A;  3ROU A;  1BK0 A;  1UYZ A;  2FCT A;  1RUD 1;  1BLZ A;  4L92 A;  3S0M A;  2KA3 A;  3MIF A;  3ZPY A;  2ZGS A;  5GZG A;  2XB6 C;  4A6O A;  5H9R A;  4FOQ A;  2EXJ A;  2ZEZ A;  3ZN4 A;  4NIG A;  2JXA A;  5J1X A;  1QJZ A;  3LEG A;  4JHT A;  5IAT A;  3CLP A;  1N1V A;  3VHP A;  1O8P A;  1OPM A;  2W9X A;  2XVL A;  2BEO A;  3NV2 A;  3PU8 A;  1WW4 A;  2YB7 A;  2QDN A;  5FOB B;  2CGO A;  3KT4 A;  1QEX A;  4K20 A;  5FUI A;  3ZDV A;  3DKQ A;  4U36 A;  1OH4 A;  1HRV 3;  2A73 B;  2OZ6 A;  2VR4 A;  2YBK A;  4B4R A;  2QQP A;  1N1T A;  1NA1 C;  1DBN A;  3SKJ E;  5T52 A;  3WNL A;  1XE8 A; 
#chains in the Genus database with same CATH homology
 4JX0 A;  3CDZ B;  1CZS A;  1KGY A;  4QDS A;  2VZ1 A;  3HEI A;  4P00 B;  4GWI A;  2YG0 A;  1PX4 A;  4M4P A;  5JXG A;  3VD5 A;  3I3D A;  4ARY A;  4A42 A;  1TG7 A;  3ACI A;  1GMM A;  4DEQ A;  4W8J A;  2VZT A;  4CU8 A;  4DUX A;  2V72 A;  3GDB A;  4CVU A;  3HOB A;  4XUQ A;  2PQS A;  3E1F 1;  1RYY A;  3WNK A;  5F7U A;  2L9L A;  3IAQ A;  2OKX A;  4DUW A;  2VM9 A;  1JZ3 A;  2VTF A;  2W5F A;  2Y6G A;  3K77 A;  3ETP A;  4Z2A A;  3ECQ A;  3D3A A;  3IB3 A;  1L7R A;  1W9S A;  2WAO A;  2DCK A;  3WNP A;  3A22 A;  3I2I A;  3LQC A;  3LPG A;  3CZJ A;  2E26 A;  2ZXQ A;  2WN3 A;  1O8S A;  1PMJ X;  4XUR A;  3VD4 A;  1K42 A;  3U37 A;  4MGS A;  1XNT A;  2WBK A;  5JR2 A;  2BGO A;  3MUY 1;  3HNB M;  4LPL A;  2ZEX A;  1UX7 A;  3WF0 A;  1UY3 A;  5DPN A;  2QQK A;  3UNP A;  2BBA A;  3WSO A;  4HG6 B;  2ZEW A;  4FI9 A;  2JE8 A;  3I2G A;  2EIE A;  1K45 A;  2VZO A;  4OYU A;  5HPO A;  2QQM A;  3BGA A;  5EIY B;  1TVG A;  3K46 A;  5B4X A;  1GOH A;  3FL7 A;  3LEI A;  2WYS A;  5LA1 A;  4QDR A;  3OEB A;  1OF3 A;  4DEV A;  3I97 A;  5EJ1 B;  3HPN A;  4AAX A;  2QQL A;  4DUV A;  4PT6 A;  4ARX A;  3HJR A;  4A4A A;  1J84 A;  1BHG A;  2W87 A;  2Y64 A;  3C7F A;  2QQO A;  2WQ8 A;  4KWU A;  2WZ8 A;  1EUU A;  4CUB A;  1LNS A;  5A1A A;  3C7G A;  3I3B A;  1SHW B;  2WO2 A;  1UY4 A;  2EID A;  2W1U A;  4QB1 A;  2X09 A;  3CKH A;  2VCC A;  4MGQ A;  1CIY A;  1KEX A;  5IJR A;  5DMY A;  5JXJ A;  2C9K A;  3SKV A;  1EUT A;  4CU6 A;  2Y8K A;  4P5Y A;  3WF4 A;  2WUH A;  5CYY A;  2WZE A;  4TTG A;  2VME A;  5DN2 A;  1W0N A;  1UMH A;  2JD9 A;  2VQU A;  2RVA A;  2W3J A;  4BDV B;  5JXI A;  2YC2 A;  2W92 A;  4ZZ8 A;  4YPJ A;  3WF3 A;  3W5N A;  3FN9 A;  2HLE A;  3A23 A;  4ZY9 A;  1NAE A;  3PUH A;  1JYV A;  2YFU A;  3VDC A;  3VDB A;  3WF2 A;  3C7O A;  1GU3 A;  1XNA A;  1US2 A;  1OF4 A;  2X05 A;  1O59 A;  5C7G A;  3WNN A;  2X10 A;  2R7E B;  3OGR A;  1NKG A;  3ACF A;  4QX1 A;  1UYY A;  1YQ2 A;  2QQJ A;  2DDU A;  5EJZ B;  5G04 L;  3T2Q A;  4P08 A;  5LA0 A;  1K3I A;  4DXR A;  1MPX A;  2VMD A;  3THC A;  3K4A A;  1GOF A;  1UXX X;  5IYY A;  4M4R A;  2B9V A;  1PX3 A;  3I2F A;  3HN3 A;  3T0A A;  4E8C A;  2RJ2 A;  2Y6K A;  2VCB A;  4CU9 A;  3P1I A;  4A44 A;  3OGS A;  2W1Q A;  1ULO A;  4MO3 M;  2VZQ A;  4AG4 A;  5I0D A;  2EIC A;  4OUE A;  3K75 B;  2E32 A;  2XON A;  4RYD A;  4UOJ A;  3OB8 A;  5JMO A;  1SG3 A;  3ZM8 A;  4XUN A;  3T2O A;  3HNM A;  3MV0 1;  2VMF A;  1UY0 A;  4D8M A;  3VDA A;  1GQP A;  2YC4 A;  1UY2 A;  2BGP A;  3NQH A;  4PQQ A;  2VMC A;  3C7H A;  5B4N A;  2W95 A;  4JKM A;  3GM8 A;  3JXS A;  4JKL A;  2CDP A;  4QAW A;  4OZO A;  2WO1 A;  2DCJ A;  4CU7 A;  2VQT A;  2VZV A;  2J1S A;  3DYP A;  5G05 L;  3WEZ A;  3IAP A;  2JDA A;  4QX3 A;  4XVH A;  2KD7 A;  3FHA A;  4JKK A;  3AC0 A;  4KMQ A;  4QPW A;  3NRU A;  4QB2 A;  2VZS A;  3CZU A;  1CZV A;  1UYX A;  2VZR A;  5C70 A;  2WO3 A;  3LEK A;  3C8X A;  2V4V A;  1WCQ A;  3SEE A;  3PUI A;  1WKY A;  2W1W A;  2LW8 A;  3EB7 A;  3VD7 A;  3GGL A;  1JU4 A;  4A45 A;  4CUA A;  2VC9 A;  1JZ8 A;  3ABZ A;  2WN2 A;  1JI6 A;  1JU3 A;  4XZU G;  4QDQ A;  3DYO A;  2ID4 A;  4QB6 A;  1UMI A;  4BK4 A;  1F4A A;  2J1U A;  3UES A;  1US3 A;  2CDO A;  1XPW A;  2VCA A;  2VOT A;  3C7E A;  2E31 A;  2QQN A;  3LE0 A;  2LS6 A;  1UWW A;  4QX0 A;  3HNY M;  4XUP A;  4UAP A;  1NX9 A;  2Y6L A;  3SEP A;  3J7H A;  3MV1 1;  4UI9 L;  4OMD A;  3MUZ 1;  1W9W A;  3WQB A;  2HYX A;  3MBW A;  3OG2 A;  4TXW A;  4XUO A;  2ZEY A;  2XOM A;  4MAD A;  5LCW L;  3VD3 A;  1JZ5 A;  2JKX A;  5IFT A;  1DYO A;  1DP0 A;  1NUK A;  3III A;  5JXH A;  2Y6H A;  1OT5 A;  1XC6 A;  2W91 A;  3F2Z A;  4KI5 M;  1CZT A;  4DXS A;  3T0D A;  3OGV A;  4MOA A;  3P6B A;  2WAA A;  1GOG A;  3WNO A;  1JYX A;  3W5M A;  2VJX A;  3T0B A;  5JUV A;  2VL4 A;  2V5D A;  3NNG A;  4RN5 A;  2QQI A;  5IHR A;  2B4K A;  3EYP A;  2ORX A;  1T2X A;  2Y6J A;  3BN6 A;  1ULP A;  3ACH A;  2QBX A;  2BER A;  1JZ7 A;  1D7P M;  5DQ0 A;  3NJX A;  1GUI A;  3I2J A;  5C71 A;  1JZ6 A;  3I2H A;  3DYM A;  2BZD A;  1PMH X;  2YFZ A;  1HN1 A;  5LA2 A;  4D0Q A;  2J1T A;  2XQX A;  4JHZ A;  4DXT A;  4W50 A;  3OEA A;  3DEC A;  4QX2 A;  4E8D A;  4GWJ A;  1JYW A;  4OMC A;  1H6X A;  1W9T A;  2VZP A;  2ORZ A;  1CX1 A;  1I5P A;  2VZU A;  3A7Q A;  3K4Z A;  1P8J A;  3ACG A;  3THD A;  3CIH A;  3WNM A;  3T08 A;  1F4H A;  2J1E A;  2Z4F A;  5HXM A;  2J1V A;  4LQR A;  5CZK A;  3I3E A;  1W99 A;  1OD3 A;  3MO4 A;  1L7Q A;  4LKS A;  4BXS V;  1K12 A;  1W8N A;  3FHQ A;  4L0P A;  4XUT A;  1W8O A;  2C26 A;  3LPF A;  4CUC A;  1JZ2 A;  3I2K A;  3UET A;  1SDD B;  2XHN A;  1DLC A;  4BJ0 A;  4ET7 A;  2J1A A;  2EIB A;  3OBA A;  2C4X A;  2J7M A;  1UY1 A;  3WF1 A;  2E33 A;  2J1R A;  2VO5 A;  2W1S A;  4P02 B;  1GNY A;  2RV9 A;  3T2P A;  1IQD C;  3NJV A;  4W4Z A;  4A41 A;  4GZ9 A;  2J22 A;  2WDB A;  4LHS A;  3CMG A;  4A3Z A;  1UYZ A;  1J83 A;  4IUG A;  2W46 A;  4ZXE A;  3T09 A;  4A6O A;  2W94 A;  2W47 A;  1H6Y A;  2VZ3 A;  5IFP A;  1JZ4 A;  1JYN A;  2ZEZ A;  4BK5 A;  3IDA A;  5J1X A;  3LEG A;  1UZ0 A;  1JHJ A;  1UXZ A;  3VD9 A;  1O8P A;  2W9X A;  3A21 A;  3K4D A;  3CQO A;  2YB7 A;  4PF1 A;  2WAB A;  5FUI A;  4ZZ5 A;  1OH4 A;  2VR4 A;  3GXU A;  3SKJ E;  1R64 A;  3WNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...