2VZQA

C-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa in complex with digalacturonic acid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 23
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzqA00
2EIBA 2VZRA 1CZSA 3OGRA 2VZTA 2ORXA 4XZUG 4DXRA 2QQIA 1W0NA 5F7UA 3A22A 2VZQA 1KEXA 3C7FA 1L7RA 1CX1A 3LEGA 3LPGA 2J1EA 2ZEWA 3P1IA 2VCCA 4UAPA 4CUCA 1UMHA 3HPNA 2VZPA 3A23A 2WBKA 2WQ8A 4TXWA 4A44A 4ET7A 1ULOA 4OZOA 2X10A 4P5YA 4A6OA 3C7GA 1WKYA 2E32A 1GU3A 2W1WA 2J22A 3IB3A 3OGVA 3I2JA 1J84A 3NNGA 4LKSA 2QQLA 3WNNA 3T08A 2BBAA 2BGOA 2CDOA 2Y6GA 2VTFA 3T09A 4M4RA 2DDUA 2WZ8A 4GWJA 2Z4FA 2W5FA 2WN2A 3OG2A 4QPWA 1GNYA 3IAPA 3ZM8A 3T2QA 3VD5A 4OUEA 2XQXA 4KMQA 1UYYA 3C7EA 2C4XA 2QQJA 2V72A 4XUOA 4XUQA 1XNAA 2BZDA 1US3A 1SG3A 5IFPA 2VMFA 2J1RA 1KGYA 4D0QA 1PX4A 3ECQA 1SHWB 3MUY1 2VM9A 4P08A 1L7QA 2JE8A 1JZ4A 5IFTA 3THDA 2EIDA 1JZ2A 3DYPA 4OMDA 1F4HA 4IUGA 1UX7A 1JZ7A 3K4ZA 3THCA 4CUAA 2B9VA 1US2A 2J7MA 4XUPA 4RYDA 2OKXA 1OF3A 4OMCA 2YB7A 4QDQA 3HEIA 1I5PA 3FHAA 3P6BA 1JZ8A 1K12A 4MADA 3DYOA 2J1TA 4DEQA 3GXUA 2WYSA 2RV9A 3I97A 3OEBA 3VD3A 5C7GA 2EIEA 2WAOA 4E8DA 1W99A 1NAEA 1NKGA 1UY3A 3ABZA 4JX0A 5JXGA 4CVUA 1PMHX 4QX1A 3DECA 1K3IA 3I2IA 2VQUA 4ZZ5A 3NJXA 1T2XA 1H6XA 3SEPA 4BJ0A 2E33A 5C71A 1O8SA 1UYXA 3W5NA 2VZVA 2VZSA 1JI6A 3WEZA 2QBXA 4UOJA 2EICA 2W92A 1DP0A 3C7OA 3MV11 5LCWL 2JDAA 3WNOA 3FHQA 5JUVA 3NRUA 4A3ZA 4A41A 2YFUA 4W4ZA 1LNSA 1BHGA 1UY2A 2VR4A 1O8PA 1UZ0A 3VD7A 3PUIA 4A42A 3LQCA 3A7QA 2W1QA 2QQMA 2WAAA 3T0BA 4DUVA 3T2PA 3W5MA 3UETA 3I3EA 2XONA 2RVAA 2VO5A 1JHJA 3WNMA 2VL4A 5EIYB 2BERA 5IYYA 1K42A 3WQBA 1EUUA 4LHSA 3WNLA 2VCBA 1W8NA 2W87A 3NJVA 3U37A 2VZ3A 2L9LA 5DPNA 2VMCA 2W3JA 3I2KA 4UI9L 1UY4A 5DQ0A 2X05A 4P00B 2CDPA 4W8JA 2J1VA 2VZ1A 2HLEA 1UY1A 4GWIA 5LA1A 4M4PA 2V4VA 3I2FA 3SKJE 5G04L 1TG7A 1JZ5A 3IDAA 2PQSA 1JU4A 3OGSA 4W50A 4QX0A 2Y6KA 2HYXA 2WDBA 3J7HA 3BGAA 2WZEA 1YQ2A 1UMIA 3WF1A 2QQOA 3C8XA 3CIHA 1TVGA 3WSOA 2WN3A 4ZY9A 2LS6A 3ACHA 2E26A 1EUTA 3SEEA 2RJ2A 3GM8A 3C7HA 1XC6A 2VC9A 3JXSA 4XVHA 4JKKA 4JKLA 3HN3A 3NQHA 4MO3M 3DYMA 5G05L 5IHRA 2W1UA 3LEKA 5CYYA 4TTGA 4BXSV 3SKVA 4JHZA 5CZKA 1P8JA 3IAQA 3FL7A 2W47A 2VOTA 4ZXEA 4CU7A 4A4AA 2YFZA 3F2ZA 3OB8A 2J1AA 4Z2AA 1XNTA 3E1F1 3WF0A 1JYWA 5HXMA 1OT5A 2DCJA 4CU8A 1W9WA 4QB2A 3I2HA 2WO2A 4QB1A 3CMGA 2LW8A 2ZEYA 3WF3A 4BK4A 3FN9A 3UNPA 1JYNA 4E8CA 1CIYA 3K4AA 4P02B 2KD7A 1PMJX 4JKMA 1MPXA 2JD9A 1UYZA 5LA0A 3CZUA 5JXHA 1RYYA 5DN2A 3CQOA 2V5DA 3GGLA 2QQNA 3LPFA 3K75B 2ID4A 4ARXA 5B4XA 3MO4A 1GOFA 4LQRA 3HNYM 2W1SA 4ARYA 5JXIA 4QB6A 1J83A 2DCKA 3PUHA 3T0AA 3CDZB 5LA2A 5B4NA 3T2OA 3K46A 2WUHA 4DUXA 4HG6B 3CKHA 2QQKA 2XOMA 1PX3A 2E31A 4DXSA 2WO1A 1JZ6A 1NUKA 1UWWA 4DUWA 1ULPA 1SDDB 3T0DA 1JZ3A 5EJZB 2YG0A 1GQPA 2J1SA 1JYVA 2VZUA 2J1UA 5C70A 3VDCA 3MV01 1UY0A 4QDRA 2C9KA 5FUIA 3GDBA 2Y6JA 2W9XA 4QX3A 3CZJA 3ACGA 1O59A 4L0PA 4CU6A 3A21A 3LEIA 2W95A 3ETPA 3HOBA 3K77A 3IIIA 1W9SA 4PT6A 4AAXA 1IQDC 3HNBM 3OBAA 4MGSA 1D7PM 1UXXX 2WO3A 5A1AA 5HPOA 4KWUA 5JR2A 2X09A 2VMEA 3UESA 2W94A 3LE0A 4DXTA 2ZEXA 2Y8KA 4YPJA 1GMMA 1DLCA 4QX2A 2VMDA 4KI5M 1OH4A 1NX9A 1JU3A 4QAWA 4CU9A 3MUZ1 5JMOA 3K4DA 1JYXA 1OF4A 3I2GA 1GOGA 4QDSA 2JKXA 1GOHA 4BK5A 3VD4A 3I3BA 1CZVA 4MGQA 2YC2A 2W46A 4PQQA 4GZ9A 1K45A 2W91A 2ZEZA 3WNKA 4LPLA 4DEVA 1DYOA 5J1XA 1GUIA 2Y6LA 2BGPA 1R64A 3WNPA 3WF4A 2C26A 2R7EB 1OD3A 3EYPA 1H6YA 4ZZ8A 1F4AA 2ORZA 2XHNA 3VD9A 5JXJA 4OYUA 4XURA 4MOAA 2WABA 4RN5A 1XPWA 4AG4A 3VDBA 1HN1A 3MBWA 4D8MA 4A45A 3VDAA 5EJ1B 1W8OA 2YC4A 3WF2A 2VQTA 5DMYA 2VCAA 2Y64A 5I0DA 2VJXA 3D3AA 1WCQA 4BDVB 3HJRA 3EB7A 5IJRA 3ACFA 4XUNA 4CUBA 4XUTA 3I3DA 3OEAA 1CZTA 1UXZA 2ZXQA 1W9TA 2VZOA 3AC0A 2Y6HA 3HNMA 3ACIA 2B4KA 3BN6A 4PF1A 4FI9A
chains in the Genus database with same CATH superfamily
3RYKA 1AR82 5K0UA 1YNAA 2GC3A 2VZRA 1UF2C 2JKBA 2HWC3 1CZSA 4QKDA 5FR3A 5A7QA 3O1OA 2ORXA 2B7YA 4J1WA 3PIGA 2WS92 3VBOC 5F7UA 5FZHA 3A4UA 3IDEA 3ZMNA 4FFHA 3C7FA 5FY1A 2ERFA 4EN9B 3LPGA 4K21A 1YIFA 2ZGQA 3LA7A 5K7PA 3P1IA 4IETA 1PO12 4NIAA 3M4FA 1YFXA 1F35A 4UAPA 1NLRA 4IGPA 4XHBA 2OUHA 3DEMA 3NMBA 4CUCA 5FO9B 4GH4B 1AYM2 4FTBA 2VZPA 4NHMA 4FFIA 3H3UA 4IEWA 5D1IA 5CFCC 2K46A 3THTA 3VHRA 4Z92B 1H30A 5CIRA 4AVAA 4TXWA 1YJKA 1EP0A 1NZCA 2P37A 2XL9A 1HDKA 3CJXA 4OUMA 3ME2A 5BNQA 4XE9A 3ZYHA 4LKEA 2DBIA 4OZOA 2R30A 3ZYIB 2FZ2A 3WUCA 1OFNA 4WZFA 1KITA 1WMEA 3ON7A 1VBD2 2D5FA 1UIKA 4UW6A 1ODMA 2R061 3LOBA 2J22A 1V6NA 3IB3A 4DB5A 4FAHA 3CJIA 4JTNA 3FLTA 1PZ8A 1LHUA 3TN91 4WVWA 1IPSA 1R093 4GH4A 3S6PA 4S2FA 2FD8A 2A71A 2CGNA 2WR9A 3HT2A 4W65A 1LOCA 2AUYA 2BBAA 2BGOA 3FWEA 1JTZX 2VTFA 4HSLA 5C33A 4AGVA 1QJX2 1DGLA 3UJOA 4AOCA 2R042 3SH5A 3AMNA 3ZXAC 1G9BA 4JGYA 5FZFA 5C6CA 3ZIXA 1JOBA 2BBVA 2F17A 5FMBA 3BOWA 3VD5A 1OLMA 4OUEA 2XQXA 4KMQA 4QQLA 1B35A 1J3RA 4COZA 5KC5A 4XUOA 1H8TB 1QH7A 5T52A 1US3A 1SG3A 2AYHA 5C3QA 4D7SA 3T4VA 4TLFA 2P6CA 4A3XA 2R071 4XBLA 2VQ0A 1RUC2 2R1BA 2XLAA 2YU2A 1U5XA 4MZUA 3UGFA 1LTEA 2A5ZA 3EQEA 2RDQA 3MUY1 4O61A 3OJBA 4I3GA 4HL0A 4Y1YA 5JOXA 3NAPC 3APBA 4KG8A 1AL21 1WA6X 4DIQA 4PQ9A 1PO21 2BU9A 2RDNA 4AGGA 3ENRA 1TME2 4CE8A 3WDUA 2VTXA 1N1VA 1WBLA 2A1XA 3K4ZA 5AC91 5FPBA 1LCLA 2RJKA 2XKPA 1CWPA 2B9VA 2DUQA 2RS12 5C9AC 2J7MA 4XUPA 2ZGOA 4I09A 5C8CA 1FMD1 4EN6B 2W0XA 3IBMA 1GZWA 4QDQA 3UGGA 4EN0A 1S4CA 3HEIA 5FZBA 3FHAA 1HQNA 5FBZA 1OH3A 2PAEA 4UYBA 2JG8A 1J1LA 5AVPA 4K7JA 5GJ6A 3TEYA 4H7LA 4Y4RA 1S1AA 2WWSA 2ET1A 2JDUA 2XJVA 1Y7BA 3ASIA 5JI9A 1RUH2 4FXKB 1T6GC 2D6LX 5BNOB 2EIEA 4OVEA 2B42B 1C8M1 4Q0PA 4X6RB 2BGCA 1VMJA 2D5HA 1FMD3 3DECA 5FMDA 3DKWA 3I2IA 5F32A 4ZZ5A 4XQDA 2JDZA 4Y1VA 1LOBA 4LNVA 1E57A 3AVSA 4YM1A 1RUD3 5I8TA 3ZMOA 3M3IA 3OCPA 1H2KA 4D3WA 1F5FA 1POV0 1W8UA 1OBNA 2DVBA 1Y4WA 4NUBA 1U0AA 4P9LA 3AZWA 3W5NA 5D8AA 3S5AA 1W9YA 4RR3C 2GAUA 3U11A 3DGTA 4ATFA 1VJ2A 2QQUA 4FPYA 1H0BA 4N7IA 3J8F3 2D6OX 2IXCA 1JBCA 1HB2A 1X82A 2YY1A 1VBB1 4C91A 1PVC1 2Q0AA 4AVTA 4JCKA 2EICA 5FYMA 4CDXA 3C7OA 3OUJA 1DGRN 2RS52 3L9JT 3MV11 3I8TA 3FHQA 3AKTA 4LBOA 4XFAA 4CDQA 5C3PA 3MIBA 5JPNB 1QJZA 3GHNA 1BYHA 5FYIA 3AKSA 1UY2A 2VR4A 1AR61 1X36A 3MW3A 4Q2FA 2Y0IA 4XJ9A 5LBCA 4NHYA 3LAGA 2K0GA 3B3QE 1ZZ9A 2DBNA 5C3SA 1TNFA 2AR6A 4JQTA 3RS6A 5FPVA 1FV2A 3N4MA 2A7AA 1D0HA 2WAAA 4YVSA 2Q8CA 2GH2A 2P17A 1YCIA 2ZCWA 3T0BA 1VRH2 2YYOA 4AHWA 2ZGTA 3T2PA 1UOJA 4CEYA 3C3VA 1PGSA 3I3EA 4LTAA 1UZZA 4X6QB 4FQZA 2RVAA 3D4KA 1A8DA 1JHJA 4BZ4A 3AL5A 5FMOS 3AMPA 3FZ3A 5FYUA 1PMIA 4BQXA 3FHIB 1SBDA 3DPRC 1AF9A 4MGKE 4YZ2A 5BYNA 1K42A 2R1DA 3SCGA 3KQ4B 1DZRA 4LEJA 2VCBA 3USSA 4BIOA 5K4LA 3PTYA 1WBFA 3I3QA 5F6LB 5FY9A 5DDJ1 3H42B 4XF1A 1RTVA 5FLHA 5DPNA 2ZGMA 1NOVA 2W3JA 3AP9A 2OT7A 1GZTA 4ZONA 2YV8A 5DQ0A 2X05A 3UJQA 5F3CA 2BUKA 4Q0QA 3SHRA 4RR3B 4HMZA 4YW7A 1Q3EA 3OPWA 2J1VA 3NV2A 3OBTA 4NHLA 3L2HA 5L7OA 2D93A 4AW7A 4PBOA 1UY1A 5A33A 2GSYA 3OF1A 1OPMA 1W90A 1LHNA 1S2EA 4NVPA 2YXSA 4GH4C 1ND3B 5LA9A 4Q4V2 4NR1A 5IVBA 1NQJA 1YEWA 2Y26A 1CAVA 3U4XA 1HW5A 3RRDA 1EAH1 4AI1A 4P9XA 2BW8A 2F4PA 3ZXEA 1AR92 1JYTA 1UMIA 4HETA 3WF1A 2P3KA 1D4M1 3CIHA 2WJSA 4UW5A 3AYAA 4WM7B 3THPA 1S0JA 2B39A 2QZ3A 2WNEA 2LS6A 3VHOA 4E4DX 5ANQA 2XBO1 3ZXGA 4XXAA 1EUTA 3KSCA 3JXSA 4AYUA 1Q56A 1ZX5A 2Z79A 4DQAA 3AFGA 2QQPA 3IPVB 2A3XA 4JKLA 2D7FA 4L11A 3WP6A 1AYN1 1FAYA 5JZGB 3KCCA 1QJU1 2E53A 1UAIA 4Y22A 1OQDA 3OOXA 4YWAA 3VBHB 2WT0A 3POFA 2N7GA 3H1YA 5FZOB 3VBFA 3UK9A 2ZBJA 5BNPB 4JGZA 5FYSA 5C9AB 1C5HA 4CDQB 5A3UA 3ZFEC 1P8JA 3O1PA 1MZFA 2CU5A 2YC0A 3AZXA 3SCFA 3BU0A 1H8VA 1ALYA 1E5IA 4U2AA 4Y4YA 1QJY3 4AK3A 1H1AA 1F31A 1U5ZA 3OB8A 4YG0A 5H9PA 1XNTA 1S2KA 1ND2C 2QNKA 3LIGA 4DRRA 1OT5A 5L73A 2JDPA 3AKRA 3HBZA 5HXVA 3FBYA 3WQ1A 4R9CA 4CU8A 4Y22B 5A3OA 3T1MA 4MGZE 4NOTA 3JBG3 1BK0A 4QGNA 4CCNA 3POIA 3VKFC 3ZXFA 1PNGA 3IDBB 1I9RA 4IV3A 4BK4A 1PO23 5FDBA 5JIUA 5C4WA 4P02B 1GP6A 4QQ2A 4Y5TA 2R062 3WDXA 1RUD1 2KR2A 1MPXA 2R043 4LR4A 1OI6A 1XYNA 2ZGPA 1F8VA 1MEC2 3HR9A 3CZUA 2ZMKA 3KT1A 2BOIA 5DAWA 1RUOA 5DN2A 5H9SA 4M01A 2V5DA 5HI0A 2JWPA 3GGLA 3HT1A 1LGCA 5FZ4A 3ROUA 2VECA 5DAVA 5KXEA 3LGRA 4LQRA 1QJX1 2W1SA 3ZN6B 4ARYA 2WA4A 4B1LA 4DXZA 4XW3A 3UL2A 3MIFA 2R041 4QB6A 4XFHA 3LB9A 4RQPB 1J83A 4YM2A 5FZEA 3OYWA 4YW1A 2QDRA 1ASJ1 4JDOA 4XXPA 4OHVA 3HVDA 1AR71 2A75A 3ILNA 3WQ7A 1Z7S1 5FP3A 3ZSEA 1JZ6A 3KV6A 1NUKA 5F5AA 5FYVA 2ZHKA 2DVGA 1SDDB 3T0DA 3OY8B 2YG0A 3WG2A 2XHKA 3ZFFA 2J1SA 1JYVA 2W39A 4IV3C 1N47A 2PA7A 1A6CA 4R4ZA 3ELNA 3AXEA 1EPWA 3BKZA 4CCEA 2B45X 3MV01 4YG6A 5F3IA 5IAVA 4CCMA 4I30A 5FLIA 1AYN3 5CFCB 2C9KA 1QXJA 5J48A 4BCUA 3TYJA 4XEZA 3Q9OA 2BWAA 4QX3A 3IWZA 4QXHA 1W3VA 1ASJ3 5IATA 3O12A 4CUGA 4O7XA 1YFUA 2VBDA 1DLLA 3M3QA 4OI0A 3JQXA 2E63A 1G9DA 1WLCA 4HXCA 2CV6A 2GMMA 1FMD2 1JN2P 3LEIA 1RHI3 5FUPA 3B7MA 5F9TA 2VVDA 2D6NA 2UWBA 1KFXL 1BEV3 4XFCA 5EJ3A 5ERLA 3HNBM 1Z78A 1UXXX 1ENXA 2XR4A 2WNVB 4HT1T 2BTVC 1QNWA 4FVVA 3DPRA 4OI4A 2VMEA 4ZS3A 1BZWA 1RUH1 4AQ2A 4RL7A 1N1YA 2W94A 4XDPA 3VGIA 1ZRDA 1DLCA 1YFYA 2DVDA 3PUSA 1RUG1 4JHTA 4KI5M 2B9UA 5EPAA 1GQHA 3GBFA 4RS5C 3M3EA 4YW4A 1AUYA 3MUZ1 2UU8A 5JMOA 5FQ0B 4FCAA 1NCRB 4FSJA 3MIDA 2KXLA 3P3NA 2HKXA 4AEKA 2X5IB 2UYAA 5BY5A 2FDIA 2IWGB 3I3BA 1HLCA 1MR5A 4HOOA 4KGQA 3OGJA 4FFFA 5GM0A 4FOWA 1BMV1 4MGQA 4F3JA 2VE1A 1S0GA 2W46A 3UV9A 4A6SA 5KBFA 2JE7A 4QKFA 1QF3A 2W91A 5FPLA 4I01A 2XBO3 2DTYA 4LPLA 4DEVA 5L9RA 1DYOA 1MS5A 2JJ6A 4FPEA 4INDA 4YYOA 3WW3A 4COVA 5J1XA 4JDMA 2NM1A 1SQ4A 2FCTA 1AR73 3RZLA 2Z5WA 1Z7S3 2R0HA 1BQPA 2CYFA 2ENRA 2R7EB 4R8HA 3EYPA 5BPXA 2QZ2A 1ZBE1 4WBBA 2RE9A 1IPJA 4FPJA 4ZZ8A 2C1FA 1ENSA 1F4AA 1XNBA 4AVCA 2XLGA 2DU0A 1MS1A 1IG0A 2D97A 3N9QA 4H2AA 1A3KA 2A70A 3CJIB 5FRAA 4KQ7A 2NP0A 4RR3A 2JDKA 4QX8A 4ASLA 1X50A 4TN7A 4BQ1A 4URTA 4XURA 1PGW2 4D6QA 1SFYA 1VBA2 2HWE3 2WABA 4C1XA 5AC93 3VDBA 5KR7A 2ZX0A 3MBWA 2WZR3 4D8MA 1OXCA 4YVSB 4IEPA 3WUDA 3AP4A 5EJ1B 2DCZA 4QU2A 5FXXA 2D6KA 4L92A 1WW4A 3BVCA 4GB33 5I0DA 3D3AA 1WCQA 1QJY2 4YZ4A 1GLHA 1DGWX 3HJRA 5DG2A 1FNZA 3OGGA 5GZFA 5IJRA 4LBMA 2BEOA 5FCCA 5FZ7A 5I91A 4LJHA 4XUTA 2WZR1 2CWMA 3I3DA 4Q4X1 2VU9A 1XE0A 4NWWA 5A80A 5FYTA 5JIAA 2Y6HA 4OZXA 4ZXKA 2XWBB 1VBD3 3ACIA 2EXHA 1CVNA 2F4LA 3PVEA 3PDQA 3I4IA 4BA6A 5AFEA 2PQQA 4N9HA 4RA0A 1RUI3 5DUXA 2ZX2A 5FO7B 2AZ5A 3O5SA 3RZZA 2QVSB 4LKFA 1OOPA 4BE3A 2JDHA 1CGPA 1H8TA 2VG9A 2V5YA 4CEWC 4GKXA 3KHCA 1TMF3 3OGRA 2Y60A 2XGXA 3LCPA 1UIJA 4XJAA 3RZGA 1KEXA 1RUI1 4CEWA 3ACLA 1CX1A 1QXPA 3B9IA 3LEGA 1FOD1 4LA2A 1UOBA 4DEQA 2ZEWA 1SPPB 1QOSA 2XUMA 5DZEA 3ZOIA 4CCOA 2PN5A 2ARXA 1POV3 3POEA 3ES1A 1EAH2 2Q8EA 4I0BA 1G6NA 4R9DA 4YLZA 4L97A 2D40A 1GICA 4RGKA 1D4M2 1Q8SA 2WQ8A 3T3YA 1RXFA 3JZVA 3N9MA 4D7TA 1OLME 5ACA2 5L7OB 5KHIA 3AMMA 4RFRB 3PURA 2DUPA 4NHXA 4PLOA 3ZXKA 4A44A 5CAZA 1K5MB 1ULOA 2WIIB 5I93A 1GZ9A 2R16A 3A0NA 1MQTC 3C7GA 2E7AA 4RHV2 3WDWA 5JMCA 4UBHA 3WG4A 3NKGA 4WM8B 2R6QA 3D6EA 1ND2B 2G9GA 3O1RA 1AYN2 4FOVA 3AZZA 3POGA 3WW2A 2P6HA 2C0ZA 1C4RA 1BBT3 1NLQA 1YIPA 4M3CA 1J84A 5F37A 2HWD2 2PAKA 4XIOA 2MEV1 1I5ZA 1Q43A 3VHNA 4BQ3A 1ZZ8A 3WNNA 3ZN6A 3WW4A 1T6BX 1VBE3 2Q5TA 3FFQA 4OI2A 3O1SA 2CDOA 1REEA 5FBJA 3KZ4C 3ZFEB 4PDWA 3TOJA 4CDQC 4DO0A 3P3PA 2WZ8A 3B02A 5C9AA 1HX6A 3RDIA 3IAPA 4AFDA 5JZGC 2QTWB 1LOAA 1UCXA 2OVUA 5EP9A 3ZM8A 4CDWA 4YZ1A 5BNNA 1QOOA 3VDDA 5JZGA 1RC6A 1UYYA 1WLWA 1STMA 3C7EA 2C4XA 2QQJA 4MGYE 4QKNA 2V72A 4MX3A 2BFUS 1ZZ6A 3IIAA 4R9AA 4ZHNA 4XUQA 1GZWB 1DHKB 1W6MA 4AI0A 3SISA 1JXNA 3PUAA 3VKOA 4R52A 1KGYA 3K2OA 4WM7C 3R6SA 4D0QA 2VM9A 3ZYRA 1WMFA 1RUD2 2DCYA 2LUWA 3SH3A 1JZ4A 5A7SA 1VAMA 1H9WA 5ANNA 2EIDA 4OMDA 1R091 1ZRRA 1FT9A 1ND3C 4DS0A 3IDCB 1JZ7A 5DXDA 4N43B 1UYPA 3THCA 4E4SA 1VE0A 2ZGRA 4RS5A 2B5HA 4Y1XA 1REDA 1US2A 4CEYB 2RS31 4MHRA 4B7KA 3RWKX 1UU5A 2FQPA 4LHLA 2YB7A 1ONAA 1OOPC 4FP3A 4Q4W3 1A78A 5JSOA 3P6BA 4BLJA 5GZEA 5HCBA 4CP9A 3JUUA 1WCDJ 5J96B 1ULCA 1JZ8A 3PMEA 3M70A 3HMYA 1AR72 2XVGA 1CAUB 3DYOA 1LULA 1V70A 1WZXA 4IGOA 1NZIA 2WYSA 2XL7A 2ZGUA 4XZPA 3TEXA 1WLTA 5CKNA 5LRRA 3FX3A 4OHXA 5F3GA 4EWEA 3DV8A 2ARBA 3EJKA 2WAOA 4QD2A 3J8F1 3ZDVA 1W99A 3WHTA 1VBC1 4D69A 1NAEA 2OZ6A 2CSGA 2R073 1C8NA 2HWE1 5FJKA 4AF9A 2IXIA 4EN8B 4JX0A 1C3HA 4Q8KA 4RSUA 3VBSC 4QKBA 4KG0A 4P9IA 3TBDA 4QX1A 5FREA 3BTXA 3WV6A 3VUOA 1K3IA 3N36A 3FJSA 3VLBB 2VQUA 5IVEA 1QH6A 2VBBA 3VZNA 1T2XA 1VBB3 4AR2A 2YMZA 2RR12 1S0EA 4BU2A 3UYJA 4FOQA 2WWJA 3LIHA 1RUE3 4E2GA 1AYM3 4D6RA 3KLSA 1LU1A 4B4RA 1MACA 4CXWA 4GULA 4B1MA 4B8EA 1NXMA 3WEZA 3ZYBA 4Y33A 2XH6A 1AL0G 4CCKA 3PNAA 1RUF2 5CISA 3AP7A 4COWA 1PHMA 2JG9C 1VMHA 4QXCA 3Q8BA 2G9ZA 2XDVA 3MF6A 5DG1A 4JGYC 1DP0A 4OCTA 3LDRA 5T3NA 3H8XA 1UKRA 3AFKA 3WNOA 3JBG2 3U0ZA 3NRUA 2WQ4A 4K40A 4A3ZA 4W4ZA 1LNSA 2ZOEB 1BHGA 1BBT2 2GMEA 3D0SA 3PIJA 5FP4A 1AX0A 1W6PB 3NV1A 2FMYA 3NNMA 1O8PA 3KHBA 1HRV3 5BNPA 4V2VA 3T2TA 4L99A 1XRUA 2D3PA 2WYFA 3KF3A 3PUIA 1HV1A 1RVF3 1UMZA 4KL1A 1B35C 1CX4A 1R1A1 3B9CA 4XTMA 1NT0A 2W1QA 2QQMA 4G4FA 1BVP1 4LIUA 5BNNC 3ZVXA 2CAUA 5A7WB 4BYYA 3BIEA 3N7MA 2RS33 2BFUL 5LK7B 3D8CA 4DUVA 3J9SA 3UETA 4YM0A 4PJYA 5JSPA 1IOAA 2HWB1 2XONA 1WA4A 4UFIA 2CTVA 4HLTA 1RVF1 2VO5A 3U78A 1C1FA 1RUE2 2RG4A 2VL4A 2Y33A 5CFCA 2OZJA 2YROA 5EIYB 5KWRA 4BQ2A 5IYYA 1W05A 2GN3A 4Y26A 5T55A 4Y5Z0 3M3OA 4Q4Y2 1EUUA 1V6JA 1ZBE2 2ET7A 3GJAA 3MIHA 2W87A 5A7OA 4TWTA 3SH4A 5J09A 3NJVA 1QJEA 1XBFA 5LY1A 2JEMA 1SFPA 2K9ZA 5ABJB 2L9LA 2VNRA 3I2KA 1UY4A 2ZKNA 1MQTA 5FY8A 2PELA 3H8OA 2YBKA 3BUCA 4Y20B 1VBA1 4AQTA 2WS91 3SC7X 1SMVA 1X9PA 5D8AC 2CNAA 1PVXA 4GWIA 4M4PA 2V4VA 1BJQA 1QY4A 3I2FA 1W03A 5G04L 3SKJE 4BPZA 2PQSA 3PJYA 5J7MA 1JU4A 5CNAA 2VVEA 1LGNA 4QX0A 2Y6KA 4QPIA 1JHNA 1JOJA 2HEYF 4XFBA 3UKVA 1AYM1 2WZEA 1NCQB 1YQ2A 2ADEA 2DFBA 3C8XA 1TZOA 5LB6A 3RZHA 2P3JA 1TVGA 1W06A 4PIXA 4Q4X2 1TQ5A 2WN3A 4FP2A 2Q1FA 2ZJCA 4R4XA 4BH9A 3BU7A 2WNUA 1IS6A 2A6ZA 2WSUA 4GAZA 2VNOA 2VQAA 2XJSA 5FWEA 3SEEA 2DV9A 1G9FA 3NL1A 2ZACA 4XVHA 3VBRB 4ZPIA 2FMDA 4NIGA 3WP4A 1N3OA 1VBD1 3KV9A 4V2WA 5TSWA 5A6ZA 1QGLA 2BQPA 5GZGA 3RMYA 5E89A 5ABJA 3RPQA 4MO3M 3DYMA 3TN92 1QEXA 2ZZJA 4DY5A 1QXRA 1EYBA 1W2AX 2W1UA 4D7YA 1U12A 5CYYA 4YFZA 4ORFA 4W6YA 3LSDA 4LBKA 3W59A 3MLLA 3EBRA 1XQNA 3QOPA 1R1A3 2W47A 2ZHLA 5A32B 4YW2A 1YQ8A 4YW6A 4ZXEA 3ZDSA 4CU7A 3M3CA 2ADDA 4Z2AA 2HWB3 3KMHA 5K9YA 1JYWA 1REFA 3EO6A 4AFMA 3O0WA 4QT6A 1W8ZA 2FHRA 1ZA4A 3I2OA 4IEXA 5A7NA 3E6DA 1AR93 2WO2A 2ZGLA 4QB1A 1PGL2 4IW3A 3AYEA 4C90A 4BHPA 2ZEYA 1G7YA 4RHV1 2H6BA 3UKNA 3RI9A 3LA3A 1GNHA 3NNLA 4E8CA 1OVSA 2AEYA 1LOFC 2WSVA 1PMJX 2QDNA 3H3LA 1GYKA 1Q8QA 1UNBA 4FPGA 5L19A 2HEWF 4A7YA 1UPIA 1UYZA 1HRI1 3GNEA 5FZ6A 3POYA 5I0UA 1TME1 2MEV2 2P2KA 4LK6A 5HCFA 5FXVA 5J3UA 1NCQA 5AC92 1COV2 3LPFA 2QQNA 2ID4A 2BYVE 4X8NA 4M00A 2VBPA 4JC1A 2YZ4A 1DQ2A 1LOEA 1MS3A 5DAPA 3VBOB 1PVC3 5JOWA 5JXIA 4GMP3 4ZKTB 4CCDA 1RJ7A 1EV13 2G1MA 3WDVA 1OUSA 4PBPA 3CHXA 5LA2A 3RYPA 2OPWA 3T2OA 1NG0A 4EJRA 3M1HA 1EAH3 4GD4A 3K46A 4N9IA 4DUXA 2P1BA 2BVVA 2HBTA 3KT7A 4WV8A 4C8DA 1CIWA 1PX3A 4DXSA 2WO1A 1O4YA 3AKQA 3CBNA 3N9LA 4YVWC 2JG9A 1UWWA 2WFF3 5LK5A 2Q8DA 4EYUA 4LO8A 4UFHA 3TRSB 1DYKA 1XNCA 3MLKA 1C8M2 1F5JA 1GQPA 1S0DA 2A6WA 3C2UA 3MIEA 2J1UA 4LORA 1CAXA 1KJRA 4HKWA 3RFRA 5C70A 4FTSA 4LITA 3UKTA 3VBFC 4W6XA 1ZYBA 1CPNA 5FUIA 3N9PA 2IVJA 5I0TA 4XF4A 5D2AA 5SV8A 5LZ6A 4MSVA 5F8PA 3KM5A 1CESA 1R092 4FQ4A 2RMU2 1U5IA 2OW4A 1KD7A 2JB4A 1HQWA 3CZJA 4JVAA 4Q0UA 5LATA 3T1LA 3V65A 4OFGA 4GIQA 2IXHA 4LO6B 5BUVA 4LIVA 5FZMA 5GLTA 5T50A 3OBZA 4BM8A 2WFF1 1W6MB 2R49A 2P3YA 4YRDA 1YFWA 4JDNA 2EXKA 4CP9B 5FY4A 4NPRA 3MHZA 3T4HB 2A73B 1MS9A 3NJZA 4XFGA 1HJGA 4EZHA 1O3TA 5FOBB 1VBB2 1G9AA 4KNCA 3E6BA 4UFJA 1HQLA 1OLRA 1OLQA 1H2MA 3POSA 1X8EA 4JTOA 4OHWA 1SCRA 1L3JA 1WGPA 2Z42A 3CEWA 2DU1A 4KWUA 4U36A 3UESA 5JR2A 1AX1A 3BOPA 4WM7A 2PHFA 2ZEXA 1QQP3 2ZX3A 4LK7A 2Y8KA 1VALA 5AFBA 3U10A 1QMJA 2R32A 3ZFGB 1DFQA 3AB0A 1CONA 4PDWB 2HWE2 5CU1A 4QX2A 5FPUA 5JCTA 2UURA 3SXWA 1XXNA 1CAXB 1JU3A 1CPMA 1GBGA 4XFIA 4CU9A 4UF0B 4NJ4A 1W0PA 2V73A 1OF4A 4OQ9A 1H2NA 2A6VA 3ZO0B 4QDSA 1Y43B 3ZPOA 5IVCA 5LEKA 1GOHA 3E5XA 1O5LA 2D6PA 4WVZA 4P9YA 2WKKA 4BK5A 3O1TA 5LW9A 3ZXJA 1VRBA 2OX0A 1W0OA 3WD5A 4BQYA 1QNYA 2JX9A 1S0BA 1VRH1 1KJLA 3GZAA 2A6XA 4KGGA 5A3MA 4GZ9A 2B46X 4ISQA 5J36A 4C1WA 2JDMA 1H2LA 4B3NA 1JOPA 3WCSA 4AFBA 4YGDA 3HQXA 3ZXDA 2Y6LA 3R05A 1PIV1 1R64A 2BGPA 2GNMA 4GJYA 5DUVA 1RUF1 1RMU1 3WF4A 1JODA 4IE0A 1R082 5FZLA 2ZZQA 3SCHA 1OVPA 3AVRA 2W2IA 4WVMB 3O14A 3MGUA 4EWDA 3DXUA 3AMQA 4H14A 3HQRA 1OC1A 1IGOA 4LOTA 5DDJ2 1BBT1 5JXJA 5FOJB 2FDHA 1VRH3 1AXZA 1VAVA 2EAAA 3FLPA 1OA2A 3EMRA 4DFSA 4GA9A 3S7EA 4KBZA 4AG4A 5M0TA 4BWOA 1HN1A 1W2OA 4XAAA 4QHZA 3WR0A 4A45A 1I6XA 2YC4A 5DMYA 5GALA 3NSTA 2Y64A 1PK6B 1ZZ7A 2VNGA 2VXJA 2ZX1A 3FBMA 4UFKA 4MYEA 4CDXC 2VTXJ 5FYYA 3EB7A 3ACFA 5IW0A 1RIRA 2JENA 2NN8A 1AR91 3SLIA 4CUBA 3B69A 4CP2A 1CZTA 3OEAA 3OPTA 1UXZA 2PYTA 1CQ9A 1W9TA 1NA1C 1FOD3 2VZOA 3AC0A 3ZR6A 4JGZC 4FTEA 3P5BA 1QDCA 2Y34A 1E5RA 3HNMA 4NPMA 1C8M3 4PLNA 5E8AA 2VULA 1VBC3 3CL1A 3LZZA 5CKMA 2B4KA 2GC2A 2AREA 4Q4Y1 2K2SA 5T5PA 5F5QA 1E5SA 4XJUA 4AZZA 1PK6A 2EA7A 2EIBA 3QBQA 5GZDA 3RZMA 1QJU2 4UBGA 5CB7A 2E6VA 4SBVA 5F1RA 1W39A 4HPKB 3ZX7A 5CFDC 4A7KA 4DXRA 5C8CC 2TBVA 3A22A 4XILA 4NO4A 1W6NB 1AVBA 1L7LA 2UY8A 3KCYA 2D44A 5CA6A 3KVBA 1OSGA 2VVFA 4Q0VA 4I0AA 4J1XA 4A2UA 1Y9MA 1UMHA 3A23A 2XG3A 4CYDA 2WBKA 5DABA 1SBFA 3B5LB 3DKQA 1GFF2 3OY8A 4FPKA 4OI1A 1F2NA 1G86A 2YDEA 4XAEA 3ZLIA 2E51A 1O5UA 1HB4A 5FYBA 5C8WA 1XB9A 3BYWA 4A6OA 4QM8A 1X8MA 1PNFA 2JG8B 1C5IA 5I0SA 1GU3A 2VY0A 1W8WA 5A1LA 5C3OA 1TME3 1BKZA 1HRV1 2UWCA 1V6MA 3LDKA 1ZZBA 3ZPYA 1BLZA 3ZR5A 3OGVA 3I2JA 1DGRA 3NAPA 4KU8A 1TMF1 3NNGA 1RXGA 2D98A 1YO8A 3EHKA 2B8MA 4LKSA 4M0NA 4XMIA 5A6XA 5JAXA 1DYPA 4CSWA 1HJFA 5FZIA 2V4AA 1LAJA 2HWC2 2Y6GA 4HK8A 1CAWA 1S55A 4YGCA 5FZCA 2RM23 1NCQC 4AFAA 3T09A 1YWKA 4M4RA 3VBUA 2DDUA 1SPPA 1HKDA 2KM2A 4GWJA 5LBFA 5J37A 4QPWA 4I2OA 2VOXA 5C4WB 3TEZA 2WT1A 3PMSA 4BLIA 1RUH3 1OFSA 4DPNA 4IE5A 3VDDC 3JQWA 3T2QA 2WLPA 5IK4A 3KV4A 2JXAA 1NE6A 4C0HA 4CDWC 4COUA 1C57A 4N53A 4HONA 3N7KA 4Q4X3 3ZN5A 3VKNA 2Q8OA 5K0UB 3OUHA 2X53S 4HANA 1XNAA 2AENA 2G4IA 3KCXA 4O9EA 1PGL1 5KXCA 2YBSA 4D6SA 2E7QA 4QPGC 4HSJA 1OHFA 4AEJA 2VGDA 4ISRA 3O7OA 4MVTA 5ABJC 1FXZA 3WVJA 1PX4A 2VW1A 1UOFA 1WD3A 3ECQA 4NWVA 3MPBA 4YM3A 3VBUB 1L7QA 2NMNA 3UGHA 4FBFA 5JOYA 5IFTA 3THDA 4QU1A 1QDOA 5A6QA 5JI7A 1OPOA 1UZWA 3RJRA 2NYYA 1F4HA 3CU7A 5EV7A 1VBE1 1SEFA 2WNUC 1H1IA 3W21A 4Z1VA 4CUAA 2HJIA 3ZFEA 3VBHA 1GWKA 3OTFA 2HWF3 1WMXA 3HQUA 4S2DA 1SLTA 4RYDA 2YGMA 5JDBA 4HK9A 1OF3A 3B94A 2ZGKA 2ZMNA 1RB8G 4LLOA 3MICA 2SLIA 2VUCA 3USUB 1PZ7A 1RINA 3LOIA 4ZU4A 2FZ1A 1HXS3 4IL7A 5BNNB 3R4DB 1XJAA 2WWUA 4MADA 4XF0A 1B35B 4N90A 4MH0E 1R083 1W8FA 5GZCA 2CWSA 3JB4C 5FAXA 5C7GA 1DF0A 5FYCA 4K9SA 4MGIE 4CCJA 3FUOA 4E8DA 3SNMA 1LR5A 2RDSA 4IGQA 4X8PA 4IEQA 3VBOA 1CN1A 1QJU3 4AEMA 5GLZA 4CVUA 1PMHX 3B93A 3T30A 5HV4A 1NQDA 1XSQA 2LROA 1FNYA 3VZOA 4EWAA 1KS5A 4E9KA 1WCKA 4QPIC 3NJXA 5KXBA 5FV3A 2JG9B 2RMU1 2JIJA 1H6XA 2J42A 1ZBA1 4FFGA 1BMV2 2E33A 4IQPA 4ES8A 2VUJA 1O8SA 1UO9A 4LKDA 4LBJA 1UYXA 4CDUC 5EZWA 3U4SA 3V64A 3KF5A 2WNOA 1MZEA 3G7DA 2DVAA 4LXLA 1XU2A 3VL9A 3BPZA 2RS13 5I0RA 5E16A 3USUA 4Q4Y3 1YHFA 5HCAA 3ZFFC 3OSDA 4RQPA 2GH8A 5ACA3 3J7NA 1NCRA 3AM2A 4XDQA 2QFEA 4K20A 5IT6A 3MZHA 4CA9A 2W92A 4XOGA 5H9RA 1XU1A 4HFSA 4LBQB 3ZFGA 4BB3A 2JDAA 4XETA 1MS8A 3H1WA 1LEMA 5FO8B 3I3MA 3VBSB 2PHLA 5CBLA 1WWYA 4A41A 5CG9A 2YFUA 4Q26A 3MIGA 5IWFA 5JWPA 1W6NA 2YBPA 3MW2A 1QJFA 2XKOA 2TNFA 4HN0A 1PGW1 1PZ9A 3RNSA 1DGWA 2VOWA 1Q8VA 1IS4A 4N53C 3IMMA 3LQCA 2YUEA 4TYSA 2GP3A 3ILFA 3IPVA 1OUXA 2BRTA 2YPDA 5T5JA 1POV1 4CPBA 5FKBA 3VDDB 4ZU5A 4AQSA 1MS0A 1F9KA 1N3QA 3DCQA 5C4WC 4N53B 2HWF1 4QHBA 3B00A 3W5MA 5L36A 3AP5A 1YRZA 2DURA 2RJLA 3PLQA 3RZKA 3HN1A 3LA2A 2WZR2 3BB6A 4KWKA 1VP6A 1MS4A 2A6YA 1J3PA 1E5HA 3OD0A 1DG6A 2BPA2 1V00A 3LEMA 5IK8A 1HXS1 2BERA 2OA2A 3U14A 3LKJA 4META 2XLFA 2NZ9A 4LO5B 1ZVFA 2BNMA 4LHSA 3WNLA 2XQRA 2YHJA 1W8NA 2IC1A 2WLQA 3PTRB 1RMU3 1NY72 4AVBA 3U37A 1YQ5A 2QCSB 5FP7A 4NAMA 5FJHA 3INAA 3ZFFB 3PVNA 1ENRA 1CAUA 4UI9L 1LHWA 4QX7A 3VV1A 3GF6A 2XJTA 2CDPA 1XYOA 1DQ4A 2NPIA 4Y20A 4CDUB 1AL23 2ZTNA 4S2HA 4DRVA 2LTNA 1RUI2 5FP9A 5LA1A 1JZ5A 2HBUA 4QHOA 4LOSA 1FOD2 2RMU3 4F7ZA 4JZRA 3IDAA 2PHDA 5EYXA 1UW8A 1O7FA 1BEV1 2HYXA 3RI8A 1HV0A 2WDBA 1APNA 3WINE 3IKWA 4QPIB 3U07A 5GLWA 5DUUA 3IZOA 5KXDA 2VMIA 1DCSA 3J7HA 4H7MA 5DAXA 1PM4A 1H1MA 1XYPA 1NA1A 3GCWA 1XE7A 3WSOA 5FZ0A 1SDWA 2GP5A 2XUEA 4FOYA 4ZY9A 5A3WA 1QQP1 1JW6A 4YFWA 5ACA1 1LHOA 1BXHA 1DBNA 2QE3A 2E26A 1PO13 3ACHA 3GYDA 4NHKA 2RJ2A 3GM8A 2PHWA 3C7HA 2VC9A 4JQRA 4XACA 3TB0A 1AXYA 4Y5SA 4CDUA 1RUC3 2WFPA 2WNVA 2ZX4A 4LE4A 4NE9A 3IM0A 2DWRA 1NE4A 1WD4A 3WLUA 1AR81 1ULFA 4HN1A 4WM8C 5DDJ3 3ZSKA 4PIYA 3HN3A 2XVLA 5IK7A 3NQHA 1AXKA 1BK1A 5FUNA 1RGSA 2DF7A 1JUIA 1FATA 4QPGA 5G05L 2OUJA 1W04A 3KD4A 5E1RA 5EQUA 5L7OC 4RHV3 1VR3A 4M0HA 4BXSV 2XJRA 3NW4A 5CZKA 3SKVA 5L9VA 2CL2A 3VBSA 2P4EA 1W6QA 3IAQA 2FDKA 2I2SA 2OYZA 3JD72 5FFOC 5A32A 2VOTA 4NIIA 3WW1A 2GNDA 4J6GA 1V6LA 3O0XA 4IE7A 2DYCA 2YFZA 4CDXB 4S2GA 4ONUA 3VHPA 2ZKLA 3RMXA 4CPBD 1PK6C 2E9QA 3VBUC 4C0BA 3E1F1 2ARAA 3BCWA 3GZTB 3ATGA 5HXMA 1SLBA 3O1UA 2P3IA 3WCRA 4BMBA 4RD7A 4QPGB 5A3LA 1HN0A 4CRQA 3QLQA 4QB2A 3I2HA 1LRHA 3CMGA 4F8AA 2LW8A 5JPMB 3LFMA 3Q8FA 1QIQA 3AJYA 4XJZA 3WF3A 1YXWA 2VNVA 4XBQA 5H9QA 3WP5A 1GKBA 1JYNA 1OURA 4Q1PA 1ENQA 3J7LA 3K4AA 1OD5A 3U75A 5B2GB 1EPZA 4M3CE 3WP3A 5KHKA 3GCXA 1HRV2 2JDNA 5E88A 4CDWB 1ZBA3 4JKMA 2JIGA 3LSEA 1GWLA 5FMCA 2JD9A 4AI3A 1EV11 5LA0A 1DQ1A 2ATFA 1POQA 1AHSA 3A0KA 4XYXA 5LBEA 1TMF2 3KGZA 1RYYA 4Q27A 5EXOA 3CQOA 3WNXA 1YC61 1Y9GA 3POWA 4MG2A 4ARXA 4TLGA 5B4XA 4IE4A 4NIDA 2DVFA 3ILRA 4YNIA 1LOGA 2ZAAA 4GB32 1RUJ3 2XPJA 2DCKA 3I2DA 4GWMA 1UQXA 3PUHA 3T0AA 3CDZB 4WVVA 3I49A 5B4NA 3V0BA 1IHMA 3VB9A 2RM21 4Q8LA 1J3QA 1ND2A 2WUHA 1W2TA 2XJUA 3CKHA 5FTTC 5GLVA 1D2SA 2QQKA 3POBA 4YVSC 3ZYPA 1KXGA 2W68A 4Z07A 4CCCA 4DUWA 1AX2A 3AXDA 1BCXA 4YW3A 5C5TA 1F15A 1LODA 5EJZB 2RS53 1JZ3A 1VAKA 4GALA 2LRPA 1VBC2 2VZUA 4MGTA 3MEPA 3VDCA 4BQ4A 2HYKA 2BJSA 4PDWC 3H8RA 1MZ6A 1UY0A 3E97A 4QDRA 3WG1A 1AL22 2UYBA 3GDBA 1PO22 3F95A 2Y6JA 4G9SB 3KGLA 2DFCA 1S0FA 2IXJA 3ACGA 1O59A 5JR7B 1VBE2 2RR11 4K8FA 3AJZA 4CU6A 2XVKA 4B4QA 4XQWA 2RS11 1SLIA 1QJX3 3A21A 2WINB 4YGEA 1ST8A 2ARCA 2WA3A 3ETPA 1B09A 5C8CB 4QPYA 4EQVA 1COV3 3M8LA 3IIIA 1W9SA 3RGBA 4AL9A 4COYA 4D94A 4AAXA 1HB1A 3S7IA 2SBAA 4YVWA 1GWMA 3LF7A 1YLLA 3W9AA 4H55A 1XNDA 4MGSA 1X7NA 4XCBA 2Q4SA 1GV9A 3DF0A 2X5IC 3H0OA 3NKTA 5HPOA 5IVVA 5F3EA 1VPHA 4LBLA 1N1SA 3LE0A 4DXTA 4FXGB 5EWSA 1VB2A 5A3TA 3BTYA 3RJ2X 1CAWB 2LM3A 1GMMA 3POJA 2IXLA 3NVCA 4JGZB 3RQ0A 1PIV3 2EXIA 2VMDA 3GJBA 3H8UA 1NA1B 2Q1MA 2O8QA 3NWKA 1ZA7A 4Y1ZA 1VIWB 2OS2A 5D21A 5FZAA 3RG0A 3LDBA 1CJPA 4QAWA 2XXZA 3K4DA 3SQOA 5GKAC 3AZVA 4FPCA 1ND3A 1UU4A 1GOGA 5T54A 3VD4A 4GKYA 3SMHA 1CZVA 2DTWA 2ZGSA 5JSRA 3PU3A 1W6OA 1V0AA 1SFNA 1YQCA 4K6BA 1K45A 1UPSA 3AK0A 4MUVA 2ZAHA 4MLOA 3CF6E 4ES9A 1UKGA 3WNKA 1DZTA 1DU3D 3CLPA 1WCUA 4HKLA 1RVF2 3G6JB 4P14A 2PHXA 1HB3A 3Q8AA 1RHI2 3NJYA 1VMFA 2XJQA 4AQ6A 1AR83 1TEIA 3MFCA 5L9BA 4QM9A 4LUKA 1G9CA 3R4UA 3AL6A 4LBQD 4NIHA 1A8MA 1WCSA 2ORZA 2QKDA 3ORJA 4NMIA 5BNOA 3VD9A 1XNKA 5AVAA 4IV3B 4OYUA 2MNGA 4HPKA 4P9JA 1GANA 5FZ1A 4KWJA 1Y9QA 1SLAA 1OA4A 4MOAA 3N9OA 1ULEA 4AI9A 4MXVA 4RN5A 2QJVA 4FPOB 1X33A 4IEVA 4MXWB 3VDAA 3E5UA 2QUOA 1VB4A 1W8OA 4NAOA 2VQTA 3WZ1A 2VCAA 4RGAA 3V0BB 1WUVA 1V6OA 1RITA 2PLV2 2VJXA 1ZZCA 1YI9A 5DUWA 4BDVB 2HWF2 4CTEA 3N9NA 5FPZA 4RQPC 1DQ0A 5EFUA 5KHJA 4BXFA 1S0CA 4FO9A 2GC1A 1LU2A 3V0AA 5EHDA 3RWNA 2ZXQA 4JRLA 4PCRA 1RUF3 4HVRA 2TEPA 1HXS2 1YUDA 3Q8EA 2WT2A 4IESA 1ULGA 2CHHA 4Q0SA 1OKOA 4XC9A 3WXPA 4AVVA 1Q8PA 2VUDA 3BN6A 2RDRA 3S5QA 1J1TA 2R0FA 3PVOA 4FI9A 1JS9A 4XIKA 4J25A 3OBRA 2KA3A 2GDFA 1W8HA 4IEUA 4R9BA 2O14A 5FZGA 4E4HA 1J58A 3H50A 5KHHA 3ALQA 4Q4V3 1LJ7A 1FX5A 3KQRA 4PHZA 5IK5A 2O8OA 4UWDA 2VZTA 4QQPA 4XZUG 2JD4A 3K3OA 2D6MA 2QQIA 2OIIA 1W0NA 3AZYA 1RUJ1 4GMP1 4Q5OA 4TSVA 5A6YA 2VZQA 4PI2A 1L7RA 2ZABA 2J1EA 5KHGA 1PM7A 1WW5A 3WT3A 1YYNA 2MHFA 2VCCA 4Q4V1 3S30A 1BEV2 4IEYA 1SLCA 4K8RB 1IS3A 4YG3A 1C28A 4CP0A 3H9AA 4HBNA 3HPNA 3AYDA 3WDTA 3FLRA 2PLV3 3W20A 1U5YA 3VKLA 3VBFB 5F2SA 2ZPXA 4LHNA 2PHRA 3PL0A 1D0GA 2ILMA 2WQZC 1QQP2 2ZHMA 3WOGA 4ET7A 3ZYGA 3VBHC 4F83A 1AZDA 2EXJA 1Y3TA 2X10A 3SITA 4P5YA 2Y38A 3NNJA 3B01A 4JRAA 1WKYA 2E32A 5FIXA 5IUQA 3O1MA 4FAGA 1MVEA 1LOFA 2W1WA 4AAPA 4K3UA 1IKQA 1BVVA 4JAAA 2X29A 1HRI2 4LE3A 2I07B 4RFT0 5J98B 1W2NA 1OMIA 1WMDA 3VZKA 1LEDA 3N35A 3QD6A 4XJ8A 2QQLA 2Y0OA 1COV1 3T08A 4LMFA 3EXUA 5T5LA 3JD71 2WZPP 1KDKA 3ZKUA 3ZIWA 4Q29A 4KU7A 4B4PA 2C6SA 2FDFA 1GZCA 2Z4FA 2W5FA 1LENA 1FV3A 1H4HA 2WN2A 3OG2A 1GNYA 5F2WA 1SLLA 4Y3OA 1ZNPA 3AKPA 5LBBA 3ZSLA 2JICA 2ZA9A 2EALA 3O0VA 4AHYA 2MPFA 2R063 1KFUL 4OLLA 4XHXA 1MVQA 5A7WA 2PTMA 1QOTA 3BPSA 1MEC3 3HWJA 2BZDA 2I45A 2VUAA 5IFPA 4L2NA 2IVIB 1OA3A 2VMFA 4XF3A 2J1RA 4QGLA 2JE9A 1V9U1 4LA3A 1SHWB 3VZLA 1O3SA 2HH9A 1X9TA 4UFLA 4P08A 1VBA3 2JE8A 5F6KA 1IG3A 5CG8A 2AEZA 1EV12 3X29B 4JGYB 3FUQA 1MEC1 1JZ2A 3DYPA 4JV4A 3DPRB 5T5OA 4NROA 3BTZA 4IUGA 3WDYA 1UX7A 4EE2A 3ST7A 1V9U3 5JLVA 2Z69A 1ACCA 2VOVA 4V1PA 2WFF2 3L2YA 2O1QA 4YZ5A 4B7EA 5SV5A 4EV0A 2OKXA 1JMUB 1LESA 4OMCA 1NXD1 2A3WA 2ES3A 4GB31 2YPJA 3J4UH 1I5PA 3FC0A 1R1ZA 1XE8A 2E7TA 1VLNA 2P34A 4BQ5A 1LB2A 1EY2A 2RM22 1ASJ2 2GNBA 5FPXA 3PUQA 3I7DA 1K12A 3N7LA 3KWVA 2J1TA 1Z7S2 3GXUA 4YGBA 3OEBA 2RV9A 3I97A 4LO7A 3VBRC 3S0MA 2NLRA 3VD3A 4ASMB 1ZRFA 2JDYA 2VH9A 1JUHA 5DAQA 1NKGA 2BOJA 1UY3A 3ABZA 5JXGA 1UD1A 2W52A 4IERA 4FPHA 3AP6A 5FYHA 2PAMA 1QHDA 4O65A 4AXOA 3JU9A 3VZJA 3TN93 4YW5A 3WY6A 5ISLA 3ES4A 2ETEA 2V09A 4K1ZA 4BQWA 3SEPA 4EN7B 4BJ0A 5C71A 1O91A 1KRIA 4FT8A 3QCWA 1QU0A 2VW2A 1DIWA 5D8AB 2ZGNA 2OQ6A 1IQAA 3HAGA 5F5IA 2VZVA 4BMEA 1OOPB 3NV3A 4L9BA 4LUMA 4IV1A 4P5HA 4FPLA 2CGPA 5JOZA 4Q4W1 1K5MA 3MFAA 5FZ8A 3UT0A 2VZSA 5FYZA 3K3NA 1XSRA 1JI6A 4ATEA 3QH7A 2JB8A 1PIV2 2QBXA 4N43C 5CFDA 4UOJA 1QWRA 1RMU2 2XMLA 3I59A 3E6CC 1R081 4OULA 5LY2A 4OHYA 2NMOA 2XJPA 2BP6A 2VD7A 2VPVA 3PJQA 4I0WB 5F39A 5LCWL 3FE5A 5JUVA 1GP4A 2WO7A 3NNFA 3QH6A 2CAVA 3OPZA 5FLJA 1K5JA 4GMP0 1RUG2 4MHUA 1HRI3 5CADA 4BIFA 4BISA 1JH5A 2C9AA 3O1VA 1UZ0A 3K51A 3VD7A 5BNOC 3N7JA 1IPKA 1W3XA 1M06G 2WS93 5DZGA 5C5UA 4A42A 4NRQA 4QX5A 1O6UA 1AJOA 4IEOA 3A7QA 2MEV3 4DY3A 1FPN2 3R0RA 1WW7A 2FCVA 3J7MA 4HVQA 4XABA 2VW0A 3JB8A 1O4ZA 2I74A 3R4SA 2ZMLA 4ITCA 2EAKA 1MZ5A 1LGBA 3BALA 2IFWA 4XMAA 3VN4A 1D4M3 2EIGA 2LALA 3WNMA 5HV0A 1RHI1 2EF6A 5IVFA 1I3HA 1YQ6A 1ULDA 2G19A 3I59B 3DL3A 4XDOA 1GNZA 1UX6A 3WQBA 2C5DA 1N3PA 4YSFA 3Q8CA 1CAVB 4Y24A 3NAPB 4DOUA 4UFMA 2OXBA 3KT4A 4M3CB 2VZ3A 5DZFA 3RSJA 4DMIA 4LULA 2VMCA 3WX5A 3ZSJA 3GZEA 5A1FA 3ZYJB 1K5MC 1W2UA 2UWAA 1ODNA 3LFIA 3GZUC 4KWLA 4P00B 1O3RA 2BDRA 4UT5A 1H8TC 4I3PA 4W8JA 1JYIA 1FI2A 3WHUA 2VZ1A 1CR7A 3PVBB 2HLEA 3ETQA 4P9WA 1TE1B 2VXRA 3IMNA 1TG7A 1FYUA 5FQ0A 2WNUB 3OGSA 2ZS6B 4W50A 5FKCA 4WVMA 2FBEA 2PLV1 1PO11 1QJY1 3GBGA 3TNQA 4AEDA 1ZRIA 5I8YA 3FFZA 3LWCA 4CXXA 2QQWA 3MF9A 1V6IA 1M4WA 1DQ5A 3AMHA 3AYCA 1UOGA 3BGAA 3MPPG 4IDZA 4DZGA 2QQOA 3VL8A 2X8KA 4B29A 5A33B 1OQ1A 2PFWA 4GQ7A 4LO4B 4PI0A 1Q5OA 5C3RA 2GU9A 5FZ3A 4CEWB 1GQGA 4L8QA 1XC6A 4G3YC 3H7JA 5K0UC 4JKKA 1SZBA 4AWDA 4QMAA 5LEJA 3URFA 2UY9A 4IXLA 4DINB 4ZU7A 1DZQA 2TUNA 2ZHNA 1S2BA 4Q1RA 3DN7A 4NRMA 3QACA 1N1TA 2X5IA 3RVHA 2GZWA 5LRSA 5IHRA 3M2MA 1W6PA 5IVJA 3HIFA 3MYXA 3LEKA 4EROA 1DQ6A 1RL3A 4XPVA 1RUJ2 4TTGA 5FXZA 4XQ4A 4OHZA 4JHZA 3ZN4A 4CEYC 2HWC1 3FL7A 2QQVA 3CO2A 5FZ9A 1OQEA 4LHKA 1O4TA 3TNPB 5I8SA 4ASKA 4YZ3A 4A4AA 5FK8A 5IAXA 3F2ZA 4A7ZA 4LBQA 2GNTA 2J1AA 5FXWA 2GALA 3WG3A 3WF0A 3ZSMA 2IFRA 2WL1A 3KVAA 3V56A 5FP8A 4TZDA 2CY6A 1DDLA 3D82A 3I54A 4QQOA 4PIZA 2JG8C 2DCJA 3HBKA 4E4ZA 4E2QA 1SACA 1W9WA 5A3NA 1XOYA 4QQHA 2HWD3 4AE2A 1IS5A 2H6CA 4MXWA 1OKQA 1AJKA 2W08A 4Z82A 2R072 1RUC1 2F6BA 2VCMA 3CJIC 2FDJA 2AGSA 3FN9A 3UNPA 2PHTA 1CIYA 2KD7A 1WW6A 1D2QA 5FMOL 4MV2A 3LD8A 4QXBA 4OQ8A 1RJ8A 4CXYA 5JXHA 4AI2A 2HWD1 2Z2SB 5HCHA 3FMGA 4CZSA 3S57A 3K75B 3MDPA 4GJZA 3VZMA 4UW3A 3MO4A 1GOFA 3HNYM 5GLUA 1S0IA 2O0OA 4NN0A 4ZS2A 3TAYA 4H3WA 5CFDB 1Q8OA 3U1XA 4LT5A 3BTAA 2WC2A 4WM8A 3NV4A 4Z8BA 2PXJA 3HD8B 2OPKA 3GALA 4HG6B 5LASA 2FCUA 3IT8A 4UXAA 2XOMA 2VOKA 2E31A 4CP1A 1UU6A 2D43A 1W6OB 1WLDA 1V6KA 1ULPA 1MQTB 5CKQA 4OUSA 2YGLA 4RS5B 3J26N 3KV5A 4K1YA 1V9U2 1QKQA 5HBAA 4XFFA 5E6HA 4HVOA 4AI8A 3KB5A 5FWJA 4AFCA 2A3YA 3ITQA 5FPAA 2GMPA 3W58A 1A34A 3VKMA 3JCIA 2GC0A 2W9XA 4UW4A 4AHXA 5A70A 2WNVC 5JVVA 1ZBA2 2VMHA 5FZOA 2IUWA 4L0PA 1W28A 1FPN3 2NQYA 2H0VA 2Q30A 4NRPA 1ZREA 2RS32 3PU8A 5CVRA 3ZKYA 3AX4A 2W95A 1JYCA 3DUIA 3HOBA 1HIXA 3K77A 1KS4A 2XWJB 2H0BA 4KBBA 1W8TA 4O9GA 4PT6A 2BNOA 5FY7A 4XBNA 4URAA 2HEVF 3KS7A 1IQDC 3WQ0A 3DXTA 4IV1C 5BV6A 2DUOA 3D0JA 3MLJA 4FPFA 1NLSA 1PVC2 3NO8A 3OBAA 1D7PM 2WO3A 4E2SA 1I1EA 2BVBA 4DNYA 5A1AA 3VBRA 4UF0A 3GBWA 4N7UA 3H3ZA 2X09A 1LKNA 4AEDC 1ZBE3 2Y6FA 4W6WA 5FY0A 2YU1A 2RS51 4BOWA 4YPJA 1SBEA 1UN1A 3J8F2 2CGOA 1CD3G 2AH2A 4LBNA 4QXKA 1OH4A 4QWNA 4N8MA 3RYRA 1GP5A 3GHMA 1NX9A 2IZWA 3OUIA 3H1MA 1O3QA 1AR62 4IE6A 1YJLA 5FY5A 1JYXA 1SCSA 2AC1A 4KH9A 4AEDB 3I2GA 2WRAA 3MI8A 3MW4A 4PLMA 4Z2WA 2JECA 3JD73 2C24A 2JKXA 4IEZA 1W9FA 5IVYA 1RUG3 2BWCA 4P9GA 3ZYFA 1GR3A 5CEHA 1LHVA 2YC2A 4IV1B 5APAA 3H7YA 4YARA 5LWBA 3N3HA 4PQQA 4XCAA 5FK7A 2D3RA 3CNAA 4GXLA 4Q4W2 2DCTA 2ZEZA 4QGMA 1TNRA 1J59A 4NPLA 2FDGA 3OYWB 4LLFA 4SLIA 5A7PA 1KQRA 1GUIA 4PF5A 3WNPA 1KDMA 5EYYA 3PHMA 5FZKA 3ZFGC 3K48A 1UZYA 3RZJA 3E5QA 1RUNA 2C26A 1UZVA 4XF9A 1UL9A 1OD3A 1ZM1A 4E27A 1H6YA 4WZCA 1Z0HA 3BIWE 4CCLA 5K8SA 5F5CA 2PMWB 1NY71 3JBG1 5KC6A 5A3PA 2XHNA 3BI3A 2BV4A 1ZRCA 1IKPA 3M7AA 4HKOA 5BXXA 2PHUA 5FZDA 4AVSA 1XPWA 4AHZA 2G9FA 2VMGA 2P5BA 3WF2A 1R1A2 1AR63 2RR13 1D4VB 1IZ3A 1FPN1 4XJWA 1LECA 4I02A 1GSLA 1NCRC 2D3SA 2OQ7A 3D5OA 1C1LA 1URXA 2Q1ZB 2BNNA 4XUNA 4HZFA 3BODA 4N43A 2HWB2 2VAUA 1CJDA 4RGGA 3V0AB 1RUE1 2XB6C 2GN7A 1NYWA 5BNPC 3TWIA 3TEWA 1H4GA 4GWNA 2XBO2 1YI7A 3OD4A 4AGRA 1W6QB 3ZXLA 1G8WA 4M3CF 3IN9A 2IXKA 2AACA 4Y1UA 2EVXA 1H9PA 4PF1A 2RHPA 4XTPA 4YVWB 4EZ4A
chains in the Genus database with same CATH topology
2EIBA 2VZRA 1CZSA 3OGRA 2VZTA 2ORXA 4XZUG 4DXRA 2QQIA 1W0NA 5F7UA 3A22A 2VZQA 1KEXA 3C7FA 1L7RA 1CX1A 3LEGA 3LPGA 2J1EA 2ZEWA 3P1IA 2VCCA 4UAPA 4CUCA 1UMHA 3HPNA 2VZPA 3A23A 2WBKA 2WQ8A 4TXWA 4A44A 4ET7A 1ULOA 4OZOA 2X10A 4P5YA 4A6OA 3C7GA 1WKYA 2E32A 1GU3A 2W1WA 2J22A 3IB3A 3OGVA 3I2JA 1J84A 3NNGA 4LKSA 2QQLA 3WNNA 3T08A 2BBAA 2BGOA 2CDOA 2Y6GA 2VTFA 3T09A 4M4RA 2DDUA 2WZ8A 4GWJA 2Z4FA 2W5FA 2WN2A 3OG2A 4QPWA 1GNYA 3IAPA 3ZM8A 3T2QA 3VD5A 4OUEA 2XQXA 4KMQA 1UYYA 3C7EA 2C4XA 2QQJA 2V72A 4XUOA 4XUQA 1XNAA 2BZDA 1US3A 1SG3A 5IFPA 2VMFA 2J1RA 1KGYA 4D0QA 1PX4A 3ECQA 1SHWB 3MUY1 2VM9A 4P08A 1L7QA 2JE8A 1JZ4A 5IFTA 3THDA 2EIDA 1JZ2A 3DYPA 4OMDA 1F4HA 4IUGA 1UX7A 1JZ7A 3K4ZA 3THCA 4CUAA 2B9VA 1US2A 2J7MA 4XUPA 4RYDA 2OKXA 1OF3A 4OMCA 2YB7A 4QDQA 3HEIA 1I5PA 3FHAA 3P6BA 1JZ8A 1K12A 4MADA 3DYOA 2J1TA 4DEQA 3GXUA 2WYSA 2RV9A 3I97A 3OEBA 3VD3A 5C7GA 2EIEA 2WAOA 4E8DA 1W99A 1NAEA 1NKGA 1UY3A 3ABZA 4JX0A 5JXGA 4CVUA 1PMHX 4QX1A 3DECA 1K3IA 3I2IA 2VQUA 4ZZ5A 3NJXA 1T2XA 1H6XA 3SEPA 4BJ0A 2E33A 5C71A 1O8SA 1UYXA 3W5NA 2VZVA 2VZSA 1JI6A 3WEZA 2QBXA 4UOJA 2EICA 2W92A 1DP0A 3C7OA 3MV11 5LCWL 2JDAA 3WNOA 3FHQA 5JUVA 3NRUA 4A3ZA 4A41A 2YFUA 4W4ZA 1LNSA 1BHGA 1UY2A 2VR4A 1O8PA 1UZ0A 3VD7A 3PUIA 4A42A 3LQCA 3A7QA 2W1QA 2QQMA 2WAAA 3T0BA 4DUVA 3T2PA 3W5MA 3UETA 3I3EA 2XONA 2RVAA 2VO5A 1JHJA 3WNMA 2VL4A 5EIYB 2BERA 5IYYA 1K42A 3WQBA 1EUUA 4LHSA 3WNLA 2VCBA 1W8NA 2W87A 3NJVA 3U37A 2VZ3A 2L9LA 5DPNA 2VMCA 2W3JA 3I2KA 4UI9L 1UY4A 5DQ0A 2X05A 4P00B 2CDPA 4W8JA 2J1VA 2VZ1A 2HLEA 1UY1A 4GWIA 5LA1A 4M4PA 2V4VA 3I2FA 3SKJE 5G04L 1TG7A 1JZ5A 3IDAA 2PQSA 1JU4A 3OGSA 4W50A 4QX0A 2Y6KA 2HYXA 2WDBA 3J7HA 3BGAA 2WZEA 1YQ2A 1UMIA 3WF1A 2QQOA 3C8XA 3CIHA 1TVGA 3WSOA 2WN3A 4ZY9A 2LS6A 3ACHA 2E26A 1EUTA 3SEEA 2RJ2A 3GM8A 3C7HA 1XC6A 2VC9A 3JXSA 4XVHA 4JKKA 4JKLA 3HN3A 3NQHA 4MO3M 3DYMA 5G05L 5IHRA 2W1UA 3LEKA 5CYYA 4TTGA 4BXSV 3SKVA 4JHZA 5CZKA 1P8JA 3IAQA 3FL7A 2W47A 2VOTA 4ZXEA 4CU7A 4A4AA 2YFZA 3F2ZA 3OB8A 2J1AA 4Z2AA 1XNTA 3E1F1 3WF0A 1JYWA 5HXMA 1OT5A 2DCJA 4CU8A 1W9WA 4QB2A 3I2HA 2WO2A 4QB1A 3CMGA 2LW8A 2ZEYA 3WF3A 4BK4A 3FN9A 3UNPA 1JYNA 4E8CA 1CIYA 3K4AA 4P02B 2KD7A 1PMJX 4JKMA 1MPXA 2JD9A 1UYZA 5LA0A 3CZUA 5JXHA 1RYYA 5DN2A 3CQOA 2V5DA 3GGLA 2QQNA 3LPFA 3K75B 2ID4A 4ARXA 5B4XA 3MO4A 1GOFA 4LQRA 3HNYM 2W1SA 4ARYA 5JXIA 4QB6A 1J83A 2DCKA 3PUHA 3T0AA 3CDZB 5LA2A 5B4NA 3T2OA 3K46A 2WUHA 4DUXA 4HG6B 3CKHA 2QQKA 2XOMA 1PX3A 2E31A 4DXSA 2WO1A 1JZ6A 1NUKA 1UWWA 4DUWA 1ULPA 1SDDB 3T0DA 1JZ3A 5EJZB 2YG0A 1GQPA 2J1SA 1JYVA 2VZUA 2J1UA 5C70A 3VDCA 3MV01 1UY0A 4QDRA 2C9KA 5FUIA 3GDBA 2Y6JA 2W9XA 4QX3A 3CZJA 3ACGA 1O59A 4L0PA 4CU6A 3A21A 3LEIA 2W95A 3ETPA 3HOBA 3K77A 3IIIA 1W9SA 4PT6A 4AAXA 1IQDC 3HNBM 3OBAA 4MGSA 1D7PM 1UXXX 2WO3A 5A1AA 5HPOA 4KWUA 5JR2A 2X09A 2VMEA 3UESA 2W94A 3LE0A 4DXTA 2ZEXA 2Y8KA 4YPJA 1GMMA 1DLCA 4QX2A 2VMDA 4KI5M 1OH4A 1NX9A 1JU3A 4QAWA 4CU9A 3MUZ1 5JMOA 3K4DA 1JYXA 1OF4A 3I2GA 1GOGA 4QDSA 2JKXA 1GOHA 4BK5A 3VD4A 3I3BA 1CZVA 4MGQA 2YC2A 2W46A 4PQQA 4GZ9A 1K45A 2W91A 2ZEZA 3WNKA 4LPLA 4DEVA 1DYOA 5J1XA 1GUIA 2Y6LA 2BGPA 1R64A 3WNPA 3WF4A 2C26A 2R7EB 1OD3A 3EYPA 1H6YA 4ZZ8A 1F4AA 2ORZA 2XHNA 3VD9A 5JXJA 4OYUA 4XURA 4MOAA 2WABA 4RN5A 1XPWA 4AG4A 3VDBA 1HN1A 3MBWA 4D8MA 4A45A 3VDAA 5EJ1B 1W8OA 2YC4A 3WF2A 2VQTA 5DMYA 2VCAA 2Y64A 5I0DA 2VJXA 3D3AA 1WCQA 4BDVB 3HJRA 3EB7A 5IJRA 3ACFA 4XUNA 4CUBA 4XUTA 3I3DA 3OEAA 1CZTA 1UXZA 2ZXQA 1W9TA 2VZOA 3AC0A 2Y6HA 3HNMA 3ACIA 2B4KA 3BN6A 4PF1A 4FI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIB A;  2VZR A;  1CZS A;  3OGR A;  2VZT A;  2ORX A;  4XZU G;  4DXR A;  2QQI A;  1W0N A;  5F7U A;  3A22 A;  2VZQ A;  1KEX A;  3C7F A;  1L7R A;  1CX1 A;  3LEG A;  3LPG A;  2J1E A;  2ZEW A;  3P1I A;  2VCC A;  4UAP A;  4CUC A;  1UMH A;  3HPN A;  2VZP A;  3A23 A;  2WBK A;  2WQ8 A;  4TXW A;  4A44 A;  4ET7 A;  1ULO A;  4OZO A;  2X10 A;  4P5Y A;  4A6O A;  3C7G A;  1WKY A;  2E32 A;  1GU3 A;  2W1W A;  2J22 A;  3IB3 A;  3OGV A;  3I2J A;  1J84 A;  3NNG A;  4LKS A;  2QQL A;  3WNN A;  3T08 A;  2BBA A;  2BGO A;  2CDO A;  2Y6G A;  2VTF A;  3T09 A;  4M4R A;  2DDU A;  2WZ8 A;  4GWJ A;  2Z4F A;  2W5F A;  2WN2 A;  3OG2 A;  4QPW A;  1GNY A;  3IAP A;  3ZM8 A;  3T2Q A;  3VD5 A;  4OUE A;  2XQX A;  4KMQ A;  1UYY A;  3C7E A;  2C4X A;  2QQJ A;  2V72 A;  4XUO A;  4XUQ A;  1XNA A;  2BZD A;  1US3 A;  1SG3 A;  5IFP A;  2VMF A;  2J1R A;  1KGY A;  4D0Q A;  1PX4 A;  3ECQ A;  1SHW B;  3MUY 1;  2VM9 A;  4P08 A;  1L7Q A;  2JE8 A;  1JZ4 A;  5IFT A;  3THD A;  2EID A;  1JZ2 A;  3DYP A;  4OMD A;  1F4H A;  4IUG A;  1UX7 A;  1JZ7 A;  3K4Z A;  3THC A;  4CUA A;  2B9V A;  1US2 A;  2J7M A;  4XUP A;  4RYD A;  2OKX A;  1OF3 A;  4OMC A;  2YB7 A;  4QDQ A;  3HEI A;  1I5P A;  3FHA A;  3P6B A;  1JZ8 A;  1K12 A;  4MAD A;  3DYO A;  2J1T A;  4DEQ A;  3GXU A;  2WYS A;  2RV9 A;  3I97 A;  3OEB A;  3VD3 A;  5C7G A;  2EIE A;  2WAO A;  4E8D A;  1W99 A;  1NAE A;  1NKG A;  1UY3 A;  3ABZ A;  4JX0 A;  5JXG A;  4CVU A;  1PMH X;  4QX1 A;  3DEC A;  1K3I A;  3I2I A;  2VQU A;  4ZZ5 A;  3NJX A;  1T2X A;  1H6X A;  3SEP A;  4BJ0 A;  2E33 A;  5C71 A;  1O8S A;  1UYX A;  3W5N A;  2VZV A;  2VZS A;  1JI6 A;  3WEZ A;  2QBX A;  4UOJ A;  2EIC A;  2W92 A;  1DP0 A;  3C7O A;  3MV1 1;  5LCW L;  2JDA A;  3WNO A;  3FHQ A;  5JUV A;  3NRU A;  4A3Z A;  4A41 A;  2YFU A;  4W4Z A;  1LNS A;  1BHG A;  1UY2 A;  2VR4 A;  1O8P A;  1UZ0 A;  3VD7 A;  3PUI A;  4A42 A;  3LQC A;  3A7Q A;  2W1Q A;  2QQM A;  2WAA A;  3T0B A;  4DUV A;  3T2P A;  3W5M A;  3UET A;  3I3E A;  2XON A;  2RVA A;  2VO5 A;  1JHJ A;  3WNM A;  2VL4 A;  5EIY B;  2BER A;  5IYY A;  1K42 A;  3WQB A;  1EUU A;  4LHS A;  3WNL A;  2VCB A;  1W8N A;  2W87 A;  3NJV A;  3U37 A;  2VZ3 A;  2L9L A;  5DPN A;  2VMC A;  2W3J A;  3I2K A;  4UI9 L;  1UY4 A;  5DQ0 A;  2X05 A;  4P00 B;  2CDP A;  4W8J A;  2J1V A;  2VZ1 A;  2HLE A;  1UY1 A;  4GWI A;  5LA1 A;  4M4P A;  2V4V A;  3I2F A;  3SKJ E;  5G04 L;  1TG7 A;  1JZ5 A;  3IDA A;  2PQS A;  1JU4 A;  3OGS A;  4W50 A;  4QX0 A;  2Y6K A;  2HYX A;  2WDB A;  3J7H A;  3BGA A;  2WZE A;  1YQ2 A;  1UMI A;  3WF1 A;  2QQO A;  3C8X A;  3CIH A;  1TVG A;  3WSO A;  2WN3 A;  4ZY9 A;  2LS6 A;  3ACH A;  2E26 A;  1EUT A;  3SEE A;  2RJ2 A;  3GM8 A;  3C7H A;  1XC6 A;  2VC9 A;  3JXS A;  4XVH A;  4JKK A;  4JKL A;  3HN3 A;  3NQH A;  4MO3 M;  3DYM A;  5G05 L;  5IHR A;  2W1U A;  3LEK A;  5CYY A;  4TTG A;  4BXS V;  3SKV A;  4JHZ A;  5CZK A;  1P8J A;  3IAQ A;  3FL7 A;  2W47 A;  2VOT A;  4ZXE A;  4CU7 A;  4A4A A;  2YFZ A;  3F2Z A;  3OB8 A;  2J1A A;  4Z2A A;  1XNT A;  3E1F 1;  3WF0 A;  1JYW A;  5HXM A;  1OT5 A;  2DCJ A;  4CU8 A;  1W9W A;  4QB2 A;  3I2H A;  2WO2 A;  4QB1 A;  3CMG A;  2LW8 A;  2ZEY A;  3WF3 A;  4BK4 A;  3FN9 A;  3UNP A;  1JYN A;  4E8C A;  1CIY A;  3K4A A;  4P02 B;  2KD7 A;  1PMJ X;  4JKM A;  1MPX A;  2JD9 A;  1UYZ A;  5LA0 A;  3CZU A;  5JXH A;  1RYY A;  5DN2 A;  3CQO A;  2V5D A;  3GGL A;  2QQN A;  3LPF A;  3K75 B;  2ID4 A;  4ARX A;  5B4X A;  3MO4 A;  1GOF A;  4LQR A;  3HNY M;  2W1S A;  4ARY A;  5JXI A;  4QB6 A;  1J83 A;  2DCK A;  3PUH A;  3T0A A;  3CDZ B;  5LA2 A;  5B4N A;  3T2O A;  3K46 A;  2WUH A;  4DUX A;  4HG6 B;  3CKH A;  2QQK A;  2XOM A;  1PX3 A;  2E31 A;  4DXS A;  2WO1 A;  1JZ6 A;  1NUK A;  1UWW A;  4DUW A;  1ULP A;  1SDD B;  3T0D A;  1JZ3 A;  5EJZ B;  2YG0 A;  1GQP A;  2J1S A;  1JYV A;  2VZU A;  2J1U A;  5C70 A;  3VDC A;  3MV0 1;  1UY0 A;  4QDR A;  2C9K A;  5FUI A;  3GDB A;  2Y6J A;  2W9X A;  4QX3 A;  3CZJ A;  3ACG A;  1O59 A;  4L0P A;  4CU6 A;  3A21 A;  3LEI A;  2W95 A;  3ETP A;  3HOB A;  3K77 A;  3III A;  1W9S A;  4PT6 A;  4AAX A;  1IQD C;  3HNB M;  3OBA A;  4MGS A;  1D7P M;  1UXX X;  2WO3 A;  5A1A A;  5HPO A;  4KWU A;  5JR2 A;  2X09 A;  2VME A;  3UES A;  2W94 A;  3LE0 A;  4DXT A;  2ZEX A;  2Y8K A;  4YPJ A;  1GMM A;  1DLC A;  4QX2 A;  2VMD A;  4KI5 M;  1OH4 A;  1NX9 A;  1JU3 A;  4QAW A;  4CU9 A;  3MUZ 1;  5JMO A;  3K4D A;  1JYX A;  1OF4 A;  3I2G A;  1GOG A;  4QDS A;  2JKX A;  1GOH A;  4BK5 A;  3VD4 A;  3I3B A;  1CZV A;  4MGQ A;  2YC2 A;  2W46 A;  4PQQ A;  4GZ9 A;  1K45 A;  2W91 A;  2ZEZ A;  3WNK A;  4LPL A;  4DEV A;  1DYO A;  5J1X A;  1GUI A;  2Y6L A;  2BGP A;  1R64 A;  3WNP A;  3WF4 A;  2C26 A;  2R7E B;  1OD3 A;  3EYP A;  1H6Y A;  4ZZ8 A;  1F4A A;  2ORZ A;  2XHN A;  3VD9 A;  5JXJ A;  4OYU A;  4XUR A;  4MOA A;  2WAB A;  4RN5 A;  1XPW A;  4AG4 A;  3VDB A;  1HN1 A;  3MBW A;  4D8M A;  4A45 A;  3VDA A;  5EJ1 B;  1W8O A;  2YC4 A;  3WF2 A;  2VQT A;  5DMY A;  2VCA A;  2Y64 A;  5I0D A;  2VJX A;  3D3A A;  1WCQ A;  4BDV B;  3HJR A;  3EB7 A;  5IJR A;  3ACF A;  4XUN A;  4CUB A;  4XUT A;  3I3D A;  3OEA A;  1CZT A;  1UXZ A;  2ZXQ A;  1W9T A;  2VZO A;  3AC0 A;  2Y6H A;  3HNM A;  3ACI A;  2B4K A;  3BN6 A;  4PF1 A;  4FI9 A; 
#chains in the Genus database with same CATH topology
 3RYK A;  1AR8 2;  5K0U A;  1YNA A;  2GC3 A;  2VZR A;  1UF2 C;  2JKB A;  2HWC 3;  1CZS A;  4QKD A;  5FR3 A;  5A7Q A;  3O1O A;  2ORX A;  2B7Y A;  4J1W A;  3PIG A;  2WS9 2;  3VBO C;  5F7U A;  5FZH A;  3A4U A;  3IDE A;  3ZMN A;  4FFH A;  3C7F A;  5FY1 A;  2ERF A;  4EN9 B;  3LPG A;  4K21 A;  1YIF A;  2ZGQ A;  3LA7 A;  5K7P A;  3P1I A;  4IET A;  1PO1 2;  4NIA A;  3M4F A;  1YFX A;  1F35 A;  4UAP A;  1NLR A;  4IGP A;  4XHB A;  2OUH A;  3DEM A;  3NMB A;  4CUC A;  5FO9 B;  4GH4 B;  1AYM 2;  4FTB A;  2VZP A;  4NHM A;  4FFI A;  3H3U A;  4IEW A;  5D1I A;  5CFC C;  2K46 A;  3THT A;  3VHR A;  4Z92 B;  1H30 A;  5CIR A;  4AVA A;  4TXW A;  1YJK A;  1EP0 A;  1NZC A;  2P37 A;  2XL9 A;  1HDK A;  3CJX A;  4OUM A;  3ME2 A;  5BNQ A;  4XE9 A;  3ZYH A;  4LKE A;  2DBI A;  4OZO A;  2R30 A;  3ZYI B;  2FZ2 A;  3WUC A;  1OFN A;  4WZF A;  1KIT A;  1WME A;  3ON7 A;  1VBD 2;  2D5F A;  1UIK A;  4UW6 A;  1ODM A;  2R06 1;  3LOB A;  2J22 A;  1V6N A;  3IB3 A;  4DB5 A;  4FAH A;  3CJI A;  4JTN A;  3FLT A;  1PZ8 A;  1LHU A;  3TN9 1;  4WVW A;  1IPS A;  1R09 3;  4GH4 A;  3S6P A;  4S2F A;  2FD8 A;  2A71 A;  2CGN A;  2WR9 A;  3HT2 A;  4W65 A;  1LOC A;  2AUY A;  2BBA A;  2BGO A;  3FWE A;  1JTZ X;  2VTF A;  4HSL A;  5C33 A;  4AGV A;  1QJX 2;  1DGL A;  3UJO A;  4AOC A;  2R04 2;  3SH5 A;  3AMN A;  3ZXA C;  1G9B A;  4JGY A;  5FZF A;  5C6C A;  3ZIX A;  1JOB A;  2BBV A;  2F17 A;  5FMB A;  3BOW A;  3VD5 A;  1OLM A;  4OUE A;  2XQX A;  4KMQ A;  4QQL A;  1B35 A;  1J3R A;  4COZ A;  5KC5 A;  4XUO A;  1H8T B;  1QH7 A;  5T52 A;  1US3 A;  1SG3 A;  2AYH A;  5C3Q A;  4D7S A;  3T4V A;  4TLF A;  2P6C A;  4A3X A;  2R07 1;  4XBL A;  2VQ0 A;  1RUC 2;  2R1B A;  2XLA A;  2YU2 A;  1U5X A;  4MZU A;  3UGF A;  1LTE A;  2A5Z A;  3EQE A;  2RDQ A;  3MUY 1;  4O61 A;  3OJB A;  4I3G A;  4HL0 A;  4Y1Y A;  5JOX A;  3NAP C;  3APB A;  4KG8 A;  1AL2 1;  1WA6 X;  4DIQ A;  4PQ9 A;  1PO2 1;  2BU9 A;  2RDN A;  4AGG A;  3ENR A;  1TME 2;  4CE8 A;  3WDU A;  2VTX A;  1N1V A;  1WBL A;  2A1X A;  3K4Z A;  5AC9 1;  5FPB A;  1LCL A;  2RJK A;  2XKP A;  1CWP A;  2B9V A;  2DUQ A;  2RS1 2;  5C9A C;  2J7M A;  4XUP A;  2ZGO A;  4I09 A;  5C8C A;  1FMD 1;  4EN6 B;  2W0X A;  3IBM A;  1GZW A;  4QDQ A;  3UGG A;  4EN0 A;  1S4C A;  3HEI A;  5FZB A;  3FHA A;  1HQN A;  5FBZ A;  1OH3 A;  2PAE A;  4UYB A;  2JG8 A;  1J1L A;  5AVP A;  4K7J A;  5GJ6 A;  3TEY A;  4H7L A;  4Y4R A;  1S1A A;  2WWS A;  2ET1 A;  2JDU A;  2XJV A;  1Y7B A;  3ASI A;  5JI9 A;  1RUH 2;  4FXK B;  1T6G C;  2D6L X;  5BNO B;  2EIE A;  4OVE A;  2B42 B;  1C8M 1;  4Q0P A;  4X6R B;  2BGC A;  1VMJ A;  2D5H A;  1FMD 3;  3DEC A;  5FMD A;  3DKW A;  3I2I A;  5F32 A;  4ZZ5 A;  4XQD A;  2JDZ A;  4Y1V A;  1LOB A;  4LNV A;  1E57 A;  3AVS A;  4YM1 A;  1RUD 3;  5I8T A;  3ZMO A;  3M3I A;  3OCP A;  1H2K A;  4D3W A;  1F5F A;  1POV 0;  1W8U A;  1OBN A;  2DVB A;  1Y4W A;  4NUB A;  1U0A A;  4P9L A;  3AZW A;  3W5N A;  5D8A A;  3S5A A;  1W9Y A;  4RR3 C;  2GAU A;  3U11 A;  3DGT A;  4ATF A;  1VJ2 A;  2QQU A;  4FPY A;  1H0B A;  4N7I A;  3J8F 3;  2D6O X;  2IXC A;  1JBC A;  1HB2 A;  1X82 A;  2YY1 A;  1VBB 1;  4C91 A;  1PVC 1;  2Q0A A;  4AVT A;  4JCK A;  2EIC A;  5FYM A;  4CDX A;  3C7O A;  3OUJ A;  1DGR N;  2RS5 2;  3L9J T;  3MV1 1;  3I8T A;  3FHQ A;  3AKT A;  4LBO A;  4XFA A;  4CDQ A;  5C3P A;  3MIB A;  5JPN B;  1QJZ A;  3GHN A;  1BYH A;  5FYI A;  3AKS A;  1UY2 A;  2VR4 A;  1AR6 1;  1X36 A;  3MW3 A;  4Q2F A;  2Y0I A;  4XJ9 A;  5LBC A;  4NHY A;  3LAG A;  2K0G A;  3B3Q E;  1ZZ9 A;  2DBN A;  5C3S A;  1TNF A;  2AR6 A;  4JQT A;  3RS6 A;  5FPV A;  1FV2 A;  3N4M A;  2A7A A;  1D0H A;  2WAA A;  4YVS A;  2Q8C A;  2GH2 A;  2P17 A;  1YCI A;  2ZCW A;  3T0B A;  1VRH 2;  2YYO A;  4AHW A;  2ZGT A;  3T2P A;  1UOJ A;  4CEY A;  3C3V A;  1PGS A;  3I3E A;  4LTA A;  1UZZ A;  4X6Q B;  4FQZ A;  2RVA A;  3D4K A;  1A8D A;  1JHJ A;  4BZ4 A;  3AL5 A;  5FMO S;  3AMP A;  3FZ3 A;  5FYU A;  1PMI A;  4BQX A;  3FHI B;  1SBD A;  3DPR C;  1AF9 A;  4MGK E;  4YZ2 A;  5BYN A;  1K42 A;  2R1D A;  3SCG A;  3KQ4 B;  1DZR A;  4LEJ A;  2VCB A;  3USS A;  4BIO A;  5K4L A;  3PTY A;  1WBF A;  3I3Q A;  5F6L B;  5FY9 A;  5DDJ 1;  3H42 B;  4XF1 A;  1RTV A;  5FLH A;  5DPN A;  2ZGM A;  1NOV A;  2W3J A;  3AP9 A;  2OT7 A;  1GZT A;  4ZON A;  2YV8 A;  5DQ0 A;  2X05 A;  3UJQ A;  5F3C A;  2BUK A;  4Q0Q A;  3SHR A;  4RR3 B;  4HMZ A;  4YW7 A;  1Q3E A;  3OPW A;  2J1V A;  3NV2 A;  3OBT A;  4NHL A;  3L2H A;  5L7O A;  2D93 A;  4AW7 A;  4PBO A;  1UY1 A;  5A33 A;  2GSY A;  3OF1 A;  1OPM A;  1W90 A;  1LHN A;  1S2E A;  4NVP A;  2YXS A;  4GH4 C;  1ND3 B;  5LA9 A;  4Q4V 2;  4NR1 A;  5IVB A;  1NQJ A;  1YEW A;  2Y26 A;  1CAV A;  3U4X A;  1HW5 A;  3RRD A;  1EAH 1;  4AI1 A;  4P9X A;  2BW8 A;  2F4P A;  3ZXE A;  1AR9 2;  1JYT A;  1UMI A;  4HET A;  3WF1 A;  2P3K A;  1D4M 1;  3CIH A;  2WJS A;  4UW5 A;  3AYA A;  4WM7 B;  3THP A;  1S0J A;  2B39 A;  2QZ3 A;  2WNE A;  2LS6 A;  3VHO A;  4E4D X;  5ANQ A;  2XBO 1;  3ZXG A;  4XXA A;  1EUT A;  3KSC A;  3JXS A;  4AYU A;  1Q56 A;  1ZX5 A;  2Z79 A;  4DQA A;  3AFG A;  2QQP A;  3IPV B;  2A3X A;  4JKL A;  2D7F A;  4L11 A;  3WP6 A;  1AYN 1;  1FAY A;  5JZG B;  3KCC A;  1QJU 1;  2E53 A;  1UAI A;  4Y22 A;  1OQD A;  3OOX A;  4YWA A;  3VBH B;  2WT0 A;  3POF A;  2N7G A;  3H1Y A;  5FZO B;  3VBF A;  3UK9 A;  2ZBJ A;  5BNP B;  4JGZ A;  5FYS A;  5C9A B;  1C5H A;  4CDQ B;  5A3U A;  3ZFE C;  1P8J A;  3O1P A;  1MZF A;  2CU5 A;  2YC0 A;  3AZX A;  3SCF A;  3BU0 A;  1H8V A;  1ALY A;  1E5I A;  4U2A A;  4Y4Y A;  1QJY 3;  4AK3 A;  1H1A A;  1F31 A;  1U5Z A;  3OB8 A;  4YG0 A;  5H9P A;  1XNT A;  1S2K A;  1ND2 C;  2QNK A;  3LIG A;  4DRR A;  1OT5 A;  5L73 A;  2JDP A;  3AKR A;  3HBZ A;  5HXV A;  3FBY A;  3WQ1 A;  4R9C A;  4CU8 A;  4Y22 B;  5A3O A;  3T1M A;  4MGZ E;  4NOT A;  3JBG 3;  1BK0 A;  4QGN A;  4CCN A;  3POI A;  3VKF C;  3ZXF A;  1PNG A;  3IDB B;  1I9R A;  4IV3 A;  4BK4 A;  1PO2 3;  5FDB A;  5JIU A;  5C4W A;  4P02 B;  1GP6 A;  4QQ2 A;  4Y5T A;  2R06 2;  3WDX A;  1RUD 1;  2KR2 A;  1MPX A;  2R04 3;  4LR4 A;  1OI6 A;  1XYN A;  2ZGP A;  1F8V A;  1MEC 2;  3HR9 A;  3CZU A;  2ZMK A;  3KT1 A;  2BOI A;  5DAW A;  1RUO A;  5DN2 A;  5H9S A;  4M01 A;  2V5D A;  5HI0 A;  2JWP A;  3GGL A;  3HT1 A;  1LGC A;  5FZ4 A;  3ROU A;  2VEC A;  5DAV A;  5KXE A;  3LGR A;  4LQR A;  1QJX 1;  2W1S A;  3ZN6 B;  4ARY A;  2WA4 A;  4B1L A;  4DXZ A;  4XW3 A;  3UL2 A;  3MIF A;  2R04 1;  4QB6 A;  4XFH A;  3LB9 A;  4RQP B;  1J83 A;  4YM2 A;  5FZE A;  3OYW A;  4YW1 A;  2QDR A;  1ASJ 1;  4JDO A;  4XXP A;  4OHV A;  3HVD A;  1AR7 1;  2A75 A;  3ILN A;  3WQ7 A;  1Z7S 1;  5FP3 A;  3ZSE A;  1JZ6 A;  3KV6 A;  1NUK A;  5F5A A;  5FYV A;  2ZHK A;  2DVG A;  1SDD B;  3T0D A;  3OY8 B;  2YG0 A;  3WG2 A;  2XHK A;  3ZFF A;  2J1S A;  1JYV A;  2W39 A;  4IV3 C;  1N47 A;  2PA7 A;  1A6C A;  4R4Z A;  3ELN A;  3AXE A;  1EPW A;  3BKZ A;  4CCE A;  2B45 X;  3MV0 1;  4YG6 A;  5F3I A;  5IAV A;  4CCM A;  4I30 A;  5FLI A;  1AYN 3;  5CFC B;  2C9K A;  1QXJ A;  5J48 A;  4BCU A;  3TYJ A;  4XEZ A;  3Q9O A;  2BWA A;  4QX3 A;  3IWZ A;  4QXH A;  1W3V A;  1ASJ 3;  5IAT A;  3O12 A;  4CUG A;  4O7X A;  1YFU A;  2VBD A;  1DLL A;  3M3Q A;  4OI0 A;  3JQX A;  2E63 A;  1G9D A;  1WLC A;  4HXC A;  2CV6 A;  2GMM A;  1FMD 2;  1JN2 P;  3LEI A;  1RHI 3;  5FUP A;  3B7M A;  5F9T A;  2VVD A;  2D6N A;  2UWB A;  1KFX L;  1BEV 3;  4XFC A;  5EJ3 A;  5ERL A;  3HNB M;  1Z78 A;  1UXX X;  1ENX A;  2XR4 A;  2WNV B;  4HT1 T;  2BTV C;  1QNW A;  4FVV A;  3DPR A;  4OI4 A;  2VME A;  4ZS3 A;  1BZW A;  1RUH 1;  4AQ2 A;  4RL7 A;  1N1Y A;  2W94 A;  4XDP A;  3VGI A;  1ZRD A;  1DLC A;  1YFY A;  2DVD A;  3PUS A;  1RUG 1;  4JHT A;  4KI5 M;  2B9U A;  5EPA A;  1GQH A;  3GBF A;  4RS5 C;  3M3E A;  4YW4 A;  1AUY A;  3MUZ 1;  2UU8 A;  5JMO A;  5FQ0 B;  4FCA A;  1NCR B;  4FSJ A;  3MID A;  2KXL A;  3P3N A;  2HKX A;  4AEK A;  2X5I B;  2UYA A;  5BY5 A;  2FDI A;  2IWG B;  3I3B A;  1HLC A;  1MR5 A;  4HOO A;  4KGQ A;  3OGJ A;  4FFF A;  5GM0 A;  4FOW A;  1BMV 1;  4MGQ A;  4F3J A;  2VE1 A;  1S0G A;  2W46 A;  3UV9 A;  4A6S A;  5KBF A;  2JE7 A;  4QKF A;  1QF3 A;  2W91 A;  5FPL A;  4I01 A;  2XBO 3;  2DTY A;  4LPL A;  4DEV A;  5L9R A;  1DYO A;  1MS5 A;  2JJ6 A;  4FPE A;  4IND A;  4YYO A;  3WW3 A;  4COV A;  5J1X A;  4JDM A;  2NM1 A;  1SQ4 A;  2FCT A;  1AR7 3;  3RZL A;  2Z5W A;  1Z7S 3;  2R0H A;  1BQP A;  2CYF A;  2ENR A;  2R7E B;  4R8H A;  3EYP A;  5BPX A;  2QZ2 A;  1ZBE 1;  4WBB A;  2RE9 A;  1IPJ A;  4FPJ A;  4ZZ8 A;  2C1F A;  1ENS A;  1F4A A;  1XNB A;  4AVC A;  2XLG A;  2DU0 A;  1MS1 A;  1IG0 A;  2D97 A;  3N9Q A;  4H2A A;  1A3K A;  2A70 A;  3CJI B;  5FRA A;  4KQ7 A;  2NP0 A;  4RR3 A;  2JDK A;  4QX8 A;  4ASL A;  1X50 A;  4TN7 A;  4BQ1 A;  4URT A;  4XUR A;  1PGW 2;  4D6Q A;  1SFY A;  1VBA 2;  2HWE 3;  2WAB A;  4C1X A;  5AC9 3;  3VDB A;  5KR7 A;  2ZX0 A;  3MBW A;  2WZR 3;  4D8M A;  1OXC A;  4YVS B;  4IEP A;  3WUD A;  3AP4 A;  5EJ1 B;  2DCZ A;  4QU2 A;  5FXX A;  2D6K A;  4L92 A;  1WW4 A;  3BVC A;  4GB3 3;  5I0D A;  3D3A A;  1WCQ A;  1QJY 2;  4YZ4 A;  1GLH A;  1DGW X;  3HJR A;  5DG2 A;  1FNZ A;  3OGG A;  5GZF A;  5IJR A;  4LBM A;  2BEO A;  5FCC A;  5FZ7 A;  5I91 A;  4LJH A;  4XUT A;  2WZR 1;  2CWM A;  3I3D A;  4Q4X 1;  2VU9 A;  1XE0 A;  4NWW A;  5A80 A;  5FYT A;  5JIA A;  2Y6H A;  4OZX A;  4ZXK A;  2XWB B;  1VBD 3;  3ACI A;  2EXH A;  1CVN A;  2F4L A;  3PVE A;  3PDQ A;  3I4I A;  4BA6 A;  5AFE A;  2PQQ A;  4N9H A;  4RA0 A;  1RUI 3;  5DUX A;  2ZX2 A;  5FO7 B;  2AZ5 A;  3O5S A;  3RZZ A;  2QVS B;  4LKF A;  1OOP A;  4BE3 A;  2JDH A;  1CGP A;  1H8T A;  2VG9 A;  2V5Y A;  4CEW C;  4GKX A;  3KHC A;  1TMF 3;  3OGR A;  2Y60 A;  2XGX A;  3LCP A;  1UIJ A;  4XJA A;  3RZG A;  1KEX A;  1RUI 1;  4CEW A;  3ACL A;  1CX1 A;  1QXP A;  3B9I A;  3LEG A;  1FOD 1;  4LA2 A;  1UOB A;  4DEQ A;  2ZEW A;  1SPP B;  1QOS A;  2XUM A;  5DZE A;  3ZOI A;  4CCO A;  2PN5 A;  2ARX A;  1POV 3;  3POE A;  3ES1 A;  1EAH 2;  2Q8E A;  4I0B A;  1G6N A;  4R9D A;  4YLZ A;  4L97 A;  2D40 A;  1GIC A;  4RGK A;  1D4M 2;  1Q8S A;  2WQ8 A;  3T3Y A;  1RXF A;  3JZV A;  3N9M A;  4D7T A;  1OLM E;  5ACA 2;  5L7O B;  5KHI A;  3AMM A;  4RFR B;  3PUR A;  2DUP A;  4NHX A;  4PLO A;  3ZXK A;  4A44 A;  5CAZ A;  1K5M B;  1ULO A;  2WII B;  5I93 A;  1GZ9 A;  2R16 A;  3A0N A;  1MQT C;  3C7G A;  2E7A A;  4RHV 2;  3WDW A;  5JMC A;  4UBH A;  3WG4 A;  3NKG A;  4WM8 B;  2R6Q A;  3D6E A;  1ND2 B;  2G9G A;  3O1R A;  1AYN 2;  4FOV A;  3AZZ A;  3POG A;  3WW2 A;  2P6H A;  2C0Z A;  1C4R A;  1BBT 3;  1NLQ A;  1YIP A;  4M3C A;  1J84 A;  5F37 A;  2HWD 2;  2PAK A;  4XIO A;  2MEV 1;  1I5Z A;  1Q43 A;  3VHN A;  4BQ3 A;  1ZZ8 A;  3WNN A;  3ZN6 A;  3WW4 A;  1T6B X;  1VBE 3;  2Q5T A;  3FFQ A;  4OI2 A;  3O1S A;  2CDO A;  1REE A;  5FBJ A;  3KZ4 C;  3ZFE B;  4PDW A;  3TOJ A;  4CDQ C;  4DO0 A;  3P3P A;  2WZ8 A;  3B02 A;  5C9A A;  1HX6 A;  3RDI A;  3IAP A;  4AFD A;  5JZG C;  2QTW B;  1LOA A;  1UCX A;  2OVU A;  5EP9 A;  3ZM8 A;  4CDW A;  4YZ1 A;  5BNN A;  1QOO A;  3VDD A;  5JZG A;  1RC6 A;  1UYY A;  1WLW A;  1STM A;  3C7E A;  2C4X A;  2QQJ A;  4MGY E;  4QKN A;  2V72 A;  4MX3 A;  2BFU S;  1ZZ6 A;  3IIA A;  4R9A A;  4ZHN A;  4XUQ A;  1GZW B;  1DHK B;  1W6M A;  4AI0 A;  3SIS A;  1JXN A;  3PUA A;  3VKO A;  4R52 A;  1KGY A;  3K2O A;  4WM7 C;  3R6S A;  4D0Q A;  2VM9 A;  3ZYR A;  1WMF A;  1RUD 2;  2DCY A;  2LUW A;  3SH3 A;  1JZ4 A;  5A7S A;  1VAM A;  1H9W A;  5ANN A;  2EID A;  4OMD A;  1R09 1;  1ZRR A;  1FT9 A;  1ND3 C;  4DS0 A;  3IDC B;  1JZ7 A;  5DXD A;  4N43 B;  1UYP A;  3THC A;  4E4S A;  1VE0 A;  2ZGR A;  4RS5 A;  2B5H A;  4Y1X A;  1RED A;  1US2 A;  4CEY B;  2RS3 1;  4MHR A;  4B7K A;  3RWK X;  1UU5 A;  2FQP A;  4LHL A;  2YB7 A;  1ONA A;  1OOP C;  4FP3 A;  4Q4W 3;  1A78 A;  5JSO A;  3P6B A;  4BLJ A;  5GZE A;  5HCB A;  4CP9 A;  3JUU A;  1WCD J;  5J96 B;  1ULC A;  1JZ8 A;  3PME A;  3M70 A;  3HMY A;  1AR7 2;  2XVG A;  1CAU B;  3DYO A;  1LUL A;  1V70 A;  1WZX A;  4IGO A;  1NZI A;  2WYS A;  2XL7 A;  2ZGU A;  4XZP A;  3TEX A;  1WLT A;  5CKN A;  5LRR A;  3FX3 A;  4OHX A;  5F3G A;  4EWE A;  3DV8 A;  2ARB A;  3EJK A;  2WAO A;  4QD2 A;  3J8F 1;  3ZDV A;  1W99 A;  3WHT A;  1VBC 1;  4D69 A;  1NAE A;  2OZ6 A;  2CSG A;  2R07 3;  1C8N A;  2HWE 1;  5FJK A;  4AF9 A;  2IXI A;  4EN8 B;  4JX0 A;  1C3H A;  4Q8K A;  4RSU A;  3VBS C;  4QKB A;  4KG0 A;  4P9I A;  3TBD A;  4QX1 A;  5FRE A;  3BTX A;  3WV6 A;  3VUO A;  1K3I A;  3N36 A;  3FJS A;  3VLB B;  2VQU A;  5IVE A;  1QH6 A;  2VBB A;  3VZN A;  1T2X A;  1VBB 3;  4AR2 A;  2YMZ A;  2RR1 2;  1S0E A;  4BU2 A;  3UYJ A;  4FOQ A;  2WWJ A;  3LIH A;  1RUE 3;  4E2G A;  1AYM 3;  4D6R A;  3KLS A;  1LU1 A;  4B4R A;  1MAC A;  4CXW A;  4GUL A;  4B1M A;  4B8E A;  1NXM A;  3WEZ A;  3ZYB A;  4Y33 A;  2XH6 A;  1AL0 G;  4CCK A;  3PNA A;  1RUF 2;  5CIS A;  3AP7 A;  4COW A;  1PHM A;  2JG9 C;  1VMH A;  4QXC A;  3Q8B A;  2G9Z A;  2XDV A;  3MF6 A;  5DG1 A;  4JGY C;  1DP0 A;  4OCT A;  3LDR A;  5T3N A;  3H8X A;  1UKR A;  3AFK A;  3WNO A;  3JBG 2;  3U0Z A;  3NRU A;  2WQ4 A;  4K40 A;  4A3Z A;  4W4Z A;  1LNS A;  2ZOE B;  1BHG A;  1BBT 2;  2GME A;  3D0S A;  3PIJ A;  5FP4 A;  1AX0 A;  1W6P B;  3NV1 A;  2FMY A;  3NNM A;  1O8P A;  3KHB A;  1HRV 3;  5BNP A;  4V2V A;  3T2T A;  4L99 A;  1XRU A;  2D3P A;  2WYF A;  3KF3 A;  3PUI A;  1HV1 A;  1RVF 3;  1UMZ A;  4KL1 A;  1B35 C;  1CX4 A;  1R1A 1;  3B9C A;  4XTM A;  1NT0 A;  2W1Q A;  2QQM A;  4G4F A;  1BVP 1;  4LIU A;  5BNN C;  3ZVX A;  2CAU A;  5A7W B;  4BYY A;  3BIE A;  3N7M A;  2RS3 3;  2BFU L;  5LK7 B;  3D8C A;  4DUV A;  3J9S A;  3UET A;  4YM0 A;  4PJY A;  5JSP A;  1IOA A;  2HWB 1;  2XON A;  1WA4 A;  4UFI A;  2CTV A;  4HLT A;  1RVF 1;  2VO5 A;  3U78 A;  1C1F A;  1RUE 2;  2RG4 A;  2VL4 A;  2Y33 A;  5CFC A;  2OZJ A;  2YRO A;  5EIY B;  5KWR A;  4BQ2 A;  5IYY A;  1W05 A;  2GN3 A;  4Y26 A;  5T55 A;  4Y5Z 0;  3M3O A;  4Q4Y 2;  1EUU A;  1V6J A;  1ZBE 2;  2ET7 A;  3GJA A;  3MIH A;  2W87 A;  5A7O A;  4TWT A;  3SH4 A;  5J09 A;  3NJV A;  1QJE A;  1XBF A;  5LY1 A;  2JEM A;  1SFP A;  2K9Z A;  5ABJ B;  2L9L A;  2VNR A;  3I2K A;  1UY4 A;  2ZKN A;  1MQT A;  5FY8 A;  2PEL A;  3H8O A;  2YBK A;  3BUC A;  4Y20 B;  1VBA 1;  4AQT A;  2WS9 1;  3SC7 X;  1SMV A;  1X9P A;  5D8A C;  2CNA A;  1PVX A;  4GWI A;  4M4P A;  2V4V A;  1BJQ A;  1QY4 A;  3I2F A;  1W03 A;  5G04 L;  3SKJ E;  4BPZ A;  2PQS A;  3PJY A;  5J7M A;  1JU4 A;  5CNA A;  2VVE A;  1LGN A;  4QX0 A;  2Y6K A;  4QPI A;  1JHN A;  1JOJ A;  2HEY F;  4XFB A;  3UKV A;  1AYM 1;  2WZE A;  1NCQ B;  1YQ2 A;  2ADE A;  2DFB A;  3C8X A;  1TZO A;  5LB6 A;  3RZH A;  2P3J A;  1TVG A;  1W06 A;  4PIX A;  4Q4X 2;  1TQ5 A;  2WN3 A;  4FP2 A;  2Q1F A;  2ZJC A;  4R4X A;  4BH9 A;  3BU7 A;  2WNU A;  1IS6 A;  2A6Z A;  2WSU A;  4GAZ A;  2VNO A;  2VQA A;  2XJS A;  5FWE A;  3SEE A;  2DV9 A;  1G9F A;  3NL1 A;  2ZAC A;  4XVH A;  3VBR B;  4ZPI A;  2FMD A;  4NIG A;  3WP4 A;  1N3O A;  1VBD 1;  3KV9 A;  4V2W A;  5TSW A;  5A6Z A;  1QGL A;  2BQP A;  5GZG A;  3RMY A;  5E89 A;  5ABJ A;  3RPQ A;  4MO3 M;  3DYM A;  3TN9 2;  1QEX A;  2ZZJ A;  4DY5 A;  1QXR A;  1EYB A;  1W2A X;  2W1U A;  4D7Y A;  1U12 A;  5CYY A;  4YFZ A;  4ORF A;  4W6Y A;  3LSD A;  4LBK A;  3W59 A;  3MLL A;  3EBR A;  1XQN A;  3QOP A;  1R1A 3;  2W47 A;  2ZHL A;  5A32 B;  4YW2 A;  1YQ8 A;  4YW6 A;  4ZXE A;  3ZDS A;  4CU7 A;  3M3C A;  2ADD A;  4Z2A A;  2HWB 3;  3KMH A;  5K9Y A;  1JYW A;  1REF A;  3EO6 A;  4AFM A;  3O0W A;  4QT6 A;  1W8Z A;  2FHR A;  1ZA4 A;  3I2O A;  4IEX A;  5A7N A;  3E6D A;  1AR9 3;  2WO2 A;  2ZGL A;  4QB1 A;  1PGL 2;  4IW3 A;  3AYE A;  4C90 A;  4BHP A;  2ZEY A;  1G7Y A;  4RHV 1;  2H6B A;  3UKN A;  3RI9 A;  3LA3 A;  1GNH A;  3NNL A;  4E8C A;  1OVS A;  2AEY A;  1LOF C;  2WSV A;  1PMJ X;  2QDN A;  3H3L A;  1GYK A;  1Q8Q A;  1UNB A;  4FPG A;  5L19 A;  2HEW F;  4A7Y A;  1UPI A;  1UYZ A;  1HRI 1;  3GNE A;  5FZ6 A;  3POY A;  5I0U A;  1TME 1;  2MEV 2;  2P2K A;  4LK6 A;  5HCF A;  5FXV A;  5J3U A;  1NCQ A;  5AC9 2;  1COV 2;  3LPF A;  2QQN A;  2ID4 A;  2BYV E;  4X8N A;  4M00 A;  2VBP A;  4JC1 A;  2YZ4 A;  1DQ2 A;  1LOE A;  1MS3 A;  5DAP A;  3VBO B;  1PVC 3;  5JOW A;  5JXI A;  4GMP 3;  4ZKT B;  4CCD A;  1RJ7 A;  1EV1 3;  2G1M A;  3WDV A;  1OUS A;  4PBP A;  3CHX A;  5LA2 A;  3RYP A;  2OPW A;  3T2O A;  1NG0 A;  4EJR A;  3M1H A;  1EAH 3;  4GD4 A;  3K46 A;  4N9I A;  4DUX A;  2P1B A;  2BVV A;  2HBT A;  3KT7 A;  4WV8 A;  4C8D A;  1CIW A;  1PX3 A;  4DXS A;  2WO1 A;  1O4Y A;  3AKQ A;  3CBN A;  3N9L A;  4YVW C;  2JG9 A;  1UWW A;  2WFF 3;  5LK5 A;  2Q8D A;  4EYU A;  4LO8 A;  4UFH A;  3TRS B;  1DYK A;  1XNC A;  3MLK A;  1C8M 2;  1F5J A;  1GQP A;  1S0D A;  2A6W A;  3C2U A;  3MIE A;  2J1U A;  4LOR A;  1CAX A;  1KJR A;  4HKW A;  3RFR A;  5C70 A;  4FTS A;  4LIT A;  3UKT A;  3VBF C;  4W6X A;  1ZYB A;  1CPN A;  5FUI A;  3N9P A;  2IVJ A;  5I0T A;  4XF4 A;  5D2A A;  5SV8 A;  5LZ6 A;  4MSV A;  5F8P A;  3KM5 A;  1CES A;  1R09 2;  4FQ4 A;  2RMU 2;  1U5I A;  2OW4 A;  1KD7 A;  2JB4 A;  1HQW A;  3CZJ A;  4JVA A;  4Q0U A;  5LAT A;  3T1L A;  3V65 A;  4OFG A;  4GIQ A;  2IXH A;  4LO6 B;  5BUV A;  4LIV A;  5FZM A;  5GLT A;  5T50 A;  3OBZ A;  4BM8 A;  2WFF 1;  1W6M B;  2R49 A;  2P3Y A;  4YRD A;  1YFW A;  4JDN A;  2EXK A;  4CP9 B;  5FY4 A;  4NPR A;  3MHZ A;  3T4H B;  2A73 B;  1MS9 A;  3NJZ A;  4XFG A;  1HJG A;  4EZH A;  1O3T A;  5FOB B;  1VBB 2;  1G9A A;  4KNC A;  3E6B A;  4UFJ A;  1HQL A;  1OLR A;  1OLQ A;  1H2M A;  3POS A;  1X8E A;  4JTO A;  4OHW A;  1SCR A;  1L3J A;  1WGP A;  2Z42 A;  3CEW A;  2DU1 A;  4KWU A;  4U36 A;  3UES A;  5JR2 A;  1AX1 A;  3BOP A;  4WM7 A;  2PHF A;  2ZEX A;  1QQP 3;  2ZX3 A;  4LK7 A;  2Y8K A;  1VAL A;  5AFB A;  3U10 A;  1QMJ A;  2R32 A;  3ZFG B;  1DFQ A;  3AB0 A;  1CON A;  4PDW B;  2HWE 2;  5CU1 A;  4QX2 A;  5FPU A;  5JCT A;  2UUR A;  3SXW A;  1XXN A;  1CAX B;  1JU3 A;  1CPM A;  1GBG A;  4XFI A;  4CU9 A;  4UF0 B;  4NJ4 A;  1W0P A;  2V73 A;  1OF4 A;  4OQ9 A;  1H2N A;  2A6V A;  3ZO0 B;  4QDS A;  1Y43 B;  3ZPO A;  5IVC A;  5LEK A;  1GOH A;  3E5X A;  1O5L A;  2D6P A;  4WVZ A;  4P9Y A;  2WKK A;  4BK5 A;  3O1T A;  5LW9 A;  3ZXJ A;  1VRB A;  2OX0 A;  1W0O A;  3WD5 A;  4BQY A;  1QNY A;  2JX9 A;  1S0B A;  1VRH 1;  1KJL A;  3GZA A;  2A6X A;  4KGG A;  5A3M A;  4GZ9 A;  2B46 X;  4ISQ A;  5J36 A;  4C1W A;  2JDM A;  1H2L A;  4B3N A;  1JOP A;  3WCS A;  4AFB A;  4YGD A;  3HQX A;  3ZXD A;  2Y6L A;  3R05 A;  1PIV 1;  1R64 A;  2BGP A;  2GNM A;  4GJY A;  5DUV A;  1RUF 1;  1RMU 1;  3WF4 A;  1JOD A;  4IE0 A;  1R08 2;  5FZL A;  2ZZQ A;  3SCH A;  1OVP A;  3AVR A;  2W2I A;  4WVM B;  3O14 A;  3MGU A;  4EWD A;  3DXU A;  3AMQ A;  4H14 A;  3HQR A;  1OC1 A;  1IGO A;  4LOT A;  5DDJ 2;  1BBT 1;  5JXJ A;  5FOJ B;  2FDH A;  1VRH 3;  1AXZ A;  1VAV A;  2EAA A;  3FLP A;  1OA2 A;  3EMR A;  4DFS A;  4GA9 A;  3S7E A;  4KBZ A;  4AG4 A;  5M0T A;  4BWO A;  1HN1 A;  1W2O A;  4XAA A;  4QHZ A;  3WR0 A;  4A45 A;  1I6X A;  2YC4 A;  5DMY A;  5GAL A;  3NST A;  2Y64 A;  1PK6 B;  1ZZ7 A;  2VNG A;  2VXJ A;  2ZX1 A;  3FBM A;  4UFK A;  4MYE A;  4CDX C;  2VTX J;  5FYY A;  3EB7 A;  3ACF A;  5IW0 A;  1RIR A;  2JEN A;  2NN8 A;  1AR9 1;  3SLI A;  4CUB A;  3B69 A;  4CP2 A;  1CZT A;  3OEA A;  3OPT A;  1UXZ A;  2PYT A;  1CQ9 A;  1W9T A;  1NA1 C;  1FOD 3;  2VZO A;  3AC0 A;  3ZR6 A;  4JGZ C;  4FTE A;  3P5B A;  1QDC A;  2Y34 A;  1E5R A;  3HNM A;  4NPM A;  1C8M 3;  4PLN A;  5E8A A;  2VUL A;  1VBC 3;  3CL1 A;  3LZZ A;  5CKM A;  2B4K A;  2GC2 A;  2ARE A;  4Q4Y 1;  2K2S A;  5T5P A;  5F5Q A;  1E5S A;  4XJU A;  4AZZ A;  1PK6 A;  2EA7 A;  2EIB A;  3QBQ A;  5GZD A;  3RZM A;  1QJU 2;  4UBG A;  5CB7 A;  2E6V A;  4SBV A;  5F1R A;  1W39 A;  4HPK B;  3ZX7 A;  5CFD C;  4A7K A;  4DXR A;  5C8C C;  2TBV A;  3A22 A;  4XIL A;  4NO4 A;  1W6N B;  1AVB A;  1L7L A;  2UY8 A;  3KCY A;  2D44 A;  5CA6 A;  3KVB A;  1OSG A;  2VVF A;  4Q0V A;  4I0A A;  4J1X A;  4A2U A;  1Y9M A;  1UMH A;  3A23 A;  2XG3 A;  4CYD A;  2WBK A;  5DAB A;  1SBF A;  3B5L B;  3DKQ A;  1GFF 2;  3OY8 A;  4FPK A;  4OI1 A;  1F2N A;  1G86 A;  2YDE A;  4XAE A;  3ZLI A;  2E51 A;  1O5U A;  1HB4 A;  5FYB A;  5C8W A;  1XB9 A;  3BYW A;  4A6O A;  4QM8 A;  1X8M A;  1PNF A;  2JG8 B;  1C5I A;  5I0S A;  1GU3 A;  2VY0 A;  1W8W A;  5A1L A;  5C3O A;  1TME 3;  1BKZ A;  1HRV 1;  2UWC A;  1V6M A;  3LDK A;  1ZZB A;  3ZPY A;  1BLZ A;  3ZR5 A;  3OGV A;  3I2J A;  1DGR A;  3NAP A;  4KU8 A;  1TMF 1;  3NNG A;  1RXG A;  2D98 A;  1YO8 A;  3EHK A;  2B8M A;  4LKS A;  4M0N A;  4XMI A;  5A6X A;  5JAX A;  1DYP A;  4CSW A;  1HJF A;  5FZI A;  2V4A A;  1LAJ A;  2HWC 2;  2Y6G A;  4HK8 A;  1CAW A;  1S55 A;  4YGC A;  5FZC A;  2RM2 3;  1NCQ C;  4AFA A;  3T09 A;  1YWK A;  4M4R A;  3VBU A;  2DDU A;  1SPP A;  1HKD A;  2KM2 A;  4GWJ A;  5LBF A;  5J37 A;  4QPW A;  4I2O A;  2VOX A;  5C4W B;  3TEZ A;  2WT1 A;  3PMS A;  4BLI A;  1RUH 3;  1OFS A;  4DPN A;  4IE5 A;  3VDD C;  3JQW A;  3T2Q A;  2WLP A;  5IK4 A;  3KV4 A;  2JXA A;  1NE6 A;  4C0H A;  4CDW C;  4COU A;  1C57 A;  4N53 A;  4HON A;  3N7K A;  4Q4X 3;  3ZN5 A;  3VKN A;  2Q8O A;  5K0U B;  3OUH A;  2X53 S;  4HAN A;  1XNA A;  2AEN A;  2G4I A;  3KCX A;  4O9E A;  1PGL 1;  5KXC A;  2YBS A;  4D6S A;  2E7Q A;  4QPG C;  4HSJ A;  1OHF A;  4AEJ A;  2VGD A;  4ISR A;  3O7O A;  4MVT A;  5ABJ C;  1FXZ A;  3WVJ A;  1PX4 A;  2VW1 A;  1UOF A;  1WD3 A;  3ECQ A;  4NWV A;  3MPB A;  4YM3 A;  3VBU B;  1L7Q A;  2NMN A;  3UGH A;  4FBF A;  5JOY A;  5IFT A;  3THD A;  4QU1 A;  1QDO A;  5A6Q A;  5JI7 A;  1OPO A;  1UZW A;  3RJR A;  2NYY A;  1F4H A;  3CU7 A;  5EV7 A;  1VBE 1;  1SEF A;  2WNU C;  1H1I A;  3W21 A;  4Z1V A;  4CUA A;  2HJI A;  3ZFE A;  3VBH A;  1GWK A;  3OTF A;  2HWF 3;  1WMX A;  3HQU A;  4S2D A;  1SLT A;  4RYD A;  2YGM A;  5JDB A;  4HK9 A;  1OF3 A;  3B94 A;  2ZGK A;  2ZMN A;  1RB8 G;  4LLO A;  3MIC A;  2SLI A;  2VUC A;  3USU B;  1PZ7 A;  1RIN A;  3LOI A;  4ZU4 A;  2FZ1 A;  1HXS 3;  4IL7 A;  5BNN B;  3R4D B;  1XJA A;  2WWU A;  4MAD A;  4XF0 A;  1B35 B;  4N90 A;  4MH0 E;  1R08 3;  1W8F A;  5GZC A;  2CWS A;  3JB4 C;  5FAX A;  5C7G A;  1DF0 A;  5FYC A;  4K9S A;  4MGI E;  4CCJ A;  3FUO A;  4E8D A;  3SNM A;  1LR5 A;  2RDS A;  4IGQ A;  4X8P A;  4IEQ A;  3VBO A;  1CN1 A;  1QJU 3;  4AEM A;  5GLZ A;  4CVU A;  1PMH X;  3B93 A;  3T30 A;  5HV4 A;  1NQD A;  1XSQ A;  2LRO A;  1FNY A;  3VZO A;  4EWA A;  1KS5 A;  4E9K A;  1WCK A;  4QPI C;  3NJX A;  5KXB A;  5FV3 A;  2JG9 B;  2RMU 1;  2JIJ A;  1H6X A;  2J42 A;  1ZBA 1;  4FFG A;  1BMV 2;  2E33 A;  4IQP A;  4ES8 A;  2VUJ A;  1O8S A;  1UO9 A;  4LKD A;  4LBJ A;  1UYX A;  4CDU C;  5EZW A;  3U4S A;  3V64 A;  3KF5 A;  2WNO A;  1MZE A;  3G7D A;  2DVA A;  4LXL A;  1XU2 A;  3VL9 A;  3BPZ A;  2RS1 3;  5I0R A;  5E16 A;  3USU A;  4Q4Y 3;  1YHF A;  5HCA A;  3ZFF C;  3OSD A;  4RQP A;  2GH8 A;  5ACA 3;  3J7N A;  1NCR A;  3AM2 A;  4XDQ A;  2QFE A;  4K20 A;  5IT6 A;  3MZH A;  4CA9 A;  2W92 A;  4XOG A;  5H9R A;  1XU1 A;  4HFS A;  4LBQ B;  3ZFG A;  4BB3 A;  2JDA A;  4XET A;  1MS8 A;  3H1W A;  1LEM A;  5FO8 B;  3I3M A;  3VBS B;  2PHL A;  5CBL A;  1WWY A;  4A41 A;  5CG9 A;  2YFU A;  4Q26 A;  3MIG A;  5IWF A;  5JWP A;  1W6N A;  2YBP A;  3MW2 A;  1QJF A;  2XKO A;  2TNF A;  4HN0 A;  1PGW 1;  1PZ9 A;  3RNS A;  1DGW A;  2VOW A;  1Q8V A;  1IS4 A;  4N53 C;  3IMM A;  3LQC A;  2YUE A;  4TYS A;  2GP3 A;  3ILF A;  3IPV A;  1OUX A;  2BRT A;  2YPD A;  5T5J A;  1POV 1;  4CPB A;  5FKB A;  3VDD B;  4ZU5 A;  4AQS A;  1MS0 A;  1F9K A;  1N3Q A;  3DCQ A;  5C4W C;  4N53 B;  2HWF 1;  4QHB A;  3B00 A;  3W5M A;  5L36 A;  3AP5 A;  1YRZ A;  2DUR A;  2RJL A;  3PLQ A;  3RZK A;  3HN1 A;  3LA2 A;  2WZR 2;  3BB6 A;  4KWK A;  1VP6 A;  1MS4 A;  2A6Y A;  1J3P A;  1E5H A;  3OD0 A;  1DG6 A;  2BPA 2;  1V00 A;  3LEM A;  5IK8 A;  1HXS 1;  2BER A;  2OA2 A;  3U14 A;  3LKJ A;  4MET A;  2XLF A;  2NZ9 A;  4LO5 B;  1ZVF A;  2BNM A;  4LHS A;  3WNL A;  2XQR A;  2YHJ A;  1W8N A;  2IC1 A;  2WLQ A;  3PTR B;  1RMU 3;  1NY7 2;  4AVB A;  3U37 A;  1YQ5 A;  2QCS B;  5FP7 A;  4NAM A;  5FJH A;  3INA A;  3ZFF B;  3PVN A;  1ENR A;  1CAU A;  4UI9 L;  1LHW A;  4QX7 A;  3VV1 A;  3GF6 A;  2XJT A;  2CDP A;  1XYO A;  1DQ4 A;  2NPI A;  4Y20 A;  4CDU B;  1AL2 3;  2ZTN A;  4S2H A;  4DRV A;  2LTN A;  1RUI 2;  5FP9 A;  5LA1 A;  1JZ5 A;  2HBU A;  4QHO A;  4LOS A;  1FOD 2;  2RMU 3;  4F7Z A;  4JZR A;  3IDA A;  2PHD A;  5EYX A;  1UW8 A;  1O7F A;  1BEV 1;  2HYX A;  3RI8 A;  1HV0 A;  2WDB A;  1APN A;  3WIN E;  3IKW A;  4QPI B;  3U07 A;  5GLW A;  5DUU A;  3IZO A;  5KXD A;  2VMI A;  1DCS A;  3J7H A;  4H7M A;  5DAX A;  1PM4 A;  1H1M A;  1XYP A;  1NA1 A;  3GCW A;  1XE7 A;  3WSO A;  5FZ0 A;  1SDW A;  2GP5 A;  2XUE A;  4FOY A;  4ZY9 A;  5A3W A;  1QQP 1;  1JW6 A;  4YFW A;  5ACA 1;  1LHO A;  1BXH A;  1DBN A;  2QE3 A;  2E26 A;  1PO1 3;  3ACH A;  3GYD A;  4NHK A;  2RJ2 A;  3GM8 A;  2PHW A;  3C7H A;  2VC9 A;  4JQR A;  4XAC A;  3TB0 A;  1AXY A;  4Y5S A;  4CDU A;  1RUC 3;  2WFP A;  2WNV A;  2ZX4 A;  4LE4 A;  4NE9 A;  3IM0 A;  2DWR A;  1NE4 A;  1WD4 A;  3WLU A;  1AR8 1;  1ULF A;  4HN1 A;  4WM8 C;  5DDJ 3;  3ZSK A;  4PIY A;  3HN3 A;  2XVL A;  5IK7 A;  3NQH A;  1AXK A;  1BK1 A;  5FUN A;  1RGS A;  2DF7 A;  1JUI A;  1FAT A;  4QPG A;  5G05 L;  2OUJ A;  1W04 A;  3KD4 A;  5E1R A;  5EQU A;  5L7O C;  4RHV 3;  1VR3 A;  4M0H A;  4BXS V;  2XJR A;  3NW4 A;  5CZK A;  3SKV A;  5L9V A;  2CL2 A;  3VBS A;  2P4E A;  1W6Q A;  3IAQ A;  2FDK A;  2I2S A;  2OYZ A;  3JD7 2;  5FFO C;  5A32 A;  2VOT A;  4NII A;  3WW1 A;  2GND A;  4J6G A;  1V6L A;  3O0X A;  4IE7 A;  2DYC A;  2YFZ A;  4CDX B;  4S2G A;  4ONU A;  3VHP A;  2ZKL A;  3RMX A;  4CPB D;  1PK6 C;  2E9Q A;  3VBU C;  4C0B A;  3E1F 1;  2ARA A;  3BCW A;  3GZT B;  3ATG A;  5HXM A;  1SLB A;  3O1U A;  2P3I A;  3WCR A;  4BMB A;  4RD7 A;  4QPG B;  5A3L A;  1HN0 A;  4CRQ A;  3QLQ A;  4QB2 A;  3I2H A;  1LRH A;  3CMG A;  4F8A A;  2LW8 A;  5JPM B;  3LFM A;  3Q8F A;  1QIQ A;  3AJY A;  4XJZ A;  3WF3 A;  1YXW A;  2VNV A;  4XBQ A;  5H9Q A;  3WP5 A;  1GKB A;  1JYN A;  1OUR A;  4Q1P A;  1ENQ A;  3J7L A;  3K4A A;  1OD5 A;  3U75 A;  5B2G B;  1EPZ A;  4M3C E;  3WP3 A;  5KHK A;  3GCX A;  1HRV 2;  2JDN A;  5E88 A;  4CDW B;  1ZBA 3;  4JKM A;  2JIG A;  3LSE A;  1GWL A;  5FMC A;  2JD9 A;  4AI3 A;  1EV1 1;  5LA0 A;  1DQ1 A;  2ATF A;  1POQ A;  1AHS A;  3A0K A;  4XYX A;  5LBE A;  1TMF 2;  3KGZ A;  1RYY A;  4Q27 A;  5EXO A;  3CQO A;  3WNX A;  1YC6 1;  1Y9G A;  3POW A;  4MG2 A;  4ARX A;  4TLG A;  5B4X A;  4IE4 A;  4NID A;  2DVF A;  3ILR A;  4YNI A;  1LOG A;  2ZAA A;  4GB3 2;  1RUJ 3;  2XPJ A;  2DCK A;  3I2D A;  4GWM A;  1UQX A;  3PUH A;  3T0A A;  3CDZ B;  4WVV A;  3I49 A;  5B4N A;  3V0B A;  1IHM A;  3VB9 A;  2RM2 1;  4Q8L A;  1J3Q A;  1ND2 A;  2WUH A;  1W2T A;  2XJU A;  3CKH A;  5FTT C;  5GLV A;  1D2S A;  2QQK A;  3POB A;  4YVS C;  3ZYP A;  1KXG A;  2W68 A;  4Z07 A;  4CCC A;  4DUW A;  1AX2 A;  3AXD A;  1BCX A;  4YW3 A;  5C5T A;  1F15 A;  1LOD A;  5EJZ B;  2RS5 3;  1JZ3 A;  1VAK A;  4GAL A;  2LRP A;  1VBC 2;  2VZU A;  4MGT A;  3MEP A;  3VDC A;  4BQ4 A;  2HYK A;  2BJS A;  4PDW C;  3H8R A;  1MZ6 A;  1UY0 A;  3E97 A;  4QDR A;  3WG1 A;  1AL2 2;  2UYB A;  3GDB A;  1PO2 2;  3F95 A;  2Y6J A;  4G9S B;  3KGL A;  2DFC A;  1S0F A;  2IXJ A;  3ACG A;  1O59 A;  5JR7 B;  1VBE 2;  2RR1 1;  4K8F A;  3AJZ A;  4CU6 A;  2XVK A;  4B4Q A;  4XQW A;  2RS1 1;  1SLI A;  1QJX 3;  3A21 A;  2WIN B;  4YGE A;  1ST8 A;  2ARC A;  2WA3 A;  3ETP A;  1B09 A;  5C8C B;  4QPY A;  4EQV A;  1COV 3;  3M8L A;  3III A;  1W9S A;  3RGB A;  4AL9 A;  4COY A;  4D94 A;  4AAX A;  1HB1 A;  3S7I A;  2SBA A;  4YVW A;  1GWM A;  3LF7 A;  1YLL A;  3W9A A;  4H55 A;  1XND A;  4MGS A;  1X7N A;  4XCB A;  2Q4S A;  1GV9 A;  3DF0 A;  2X5I C;  3H0O A;  3NKT A;  5HPO A;  5IVV A;  5F3E A;  1VPH A;  4LBL A;  1N1S A;  3LE0 A;  4DXT A;  4FXG B;  5EWS A;  1VB2 A;  5A3T A;  3BTY A;  3RJ2 X;  1CAW B;  2LM3 A;  1GMM A;  3POJ A;  2IXL A;  3NVC A;  4JGZ B;  3RQ0 A;  1PIV 3;  2EXI A;  2VMD A;  3GJB A;  3H8U A;  1NA1 B;  2Q1M A;  2O8Q A;  3NWK A;  1ZA7 A;  4Y1Z A;  1VIW B;  2OS2 A;  5D21 A;  5FZA A;  3RG0 A;  3LDB A;  1CJP A;  4QAW A;  2XXZ A;  3K4D A;  3SQO A;  5GKA C;  3AZV A;  4FPC A;  1ND3 A;  1UU4 A;  1GOG A;  5T54 A;  3VD4 A;  4GKY A;  3SMH A;  1CZV A;  2DTW A;  2ZGS A;  5JSR A;  3PU3 A;  1W6O A;  1V0A A;  1SFN A;  1YQC A;  4K6B A;  1K45 A;  1UPS A;  3AK0 A;  4MUV A;  2ZAH A;  4MLO A;  3CF6 E;  4ES9 A;  1UKG A;  3WNK A;  1DZT A;  1DU3 D;  3CLP A;  1WCU A;  4HKL A;  1RVF 2;  3G6J B;  4P14 A;  2PHX A;  1HB3 A;  3Q8A A;  1RHI 2;  3NJY A;  1VMF A;  2XJQ A;  4AQ6 A;  1AR8 3;  1TEI A;  3MFC A;  5L9B A;  4QM9 A;  4LUK A;  1G9C A;  3R4U A;  3AL6 A;  4LBQ D;  4NIH A;  1A8M A;  1WCS A;  2ORZ A;  2QKD A;  3ORJ A;  4NMI A;  5BNO A;  3VD9 A;  1XNK A;  5AVA A;  4IV3 B;  4OYU A;  2MNG A;  4HPK A;  4P9J A;  1GAN A;  5FZ1 A;  4KWJ A;  1Y9Q A;  1SLA A;  1OA4 A;  4MOA A;  3N9O A;  1ULE A;  4AI9 A;  4MXV A;  4RN5 A;  2QJV A;  4FPO B;  1X33 A;  4IEV A;  4MXW B;  3VDA A;  3E5U A;  2QUO A;  1VB4 A;  1W8O A;  4NAO A;  2VQT A;  3WZ1 A;  2VCA A;  4RGA A;  3V0B B;  1WUV A;  1V6O A;  1RIT A;  2PLV 2;  2VJX A;  1ZZC A;  1YI9 A;  5DUW A;  4BDV B;  2HWF 2;  4CTE A;  3N9N A;  5FPZ A;  4RQP C;  1DQ0 A;  5EFU A;  5KHJ A;  4BXF A;  1S0C A;  4FO9 A;  2GC1 A;  1LU2 A;  3V0A A;  5EHD A;  3RWN A;  2ZXQ A;  4JRL A;  4PCR A;  1RUF 3;  4HVR A;  2TEP A;  1HXS 2;  1YUD A;  3Q8E A;  2WT2 A;  4IES A;  1ULG A;  2CHH A;  4Q0S A;  1OKO A;  4XC9 A;  3WXP A;  4AVV A;  1Q8P A;  2VUD A;  3BN6 A;  2RDR A;  3S5Q A;  1J1T A;  2R0F A;  3PVO A;  4FI9 A;  1JS9 A;  4XIK A;  4J25 A;  3OBR A;  2KA3 A;  2GDF A;  1W8H A;  4IEU A;  4R9B A;  2O14 A;  5FZG A;  4E4H A;  1J58 A;  3H50 A;  5KHH A;  3ALQ A;  4Q4V 3;  1LJ7 A;  1FX5 A;  3KQR A;  4PHZ A;  5IK5 A;  2O8O A;  4UWD A;  2VZT A;  4QQP A;  4XZU G;  2JD4 A;  3K3O A;  2D6M A;  2QQI A;  2OII A;  1W0N A;  3AZY A;  1RUJ 1;  4GMP 1;  4Q5O A;  4TSV A;  5A6Y A;  2VZQ A;  4PI2 A;  1L7R A;  2ZAB A;  2J1E A;  5KHG A;  1PM7 A;  1WW5 A;  3WT3 A;  1YYN A;  2MHF A;  2VCC A;  4Q4V 1;  3S30 A;  1BEV 2;  4IEY A;  1SLC A;  4K8R B;  1IS3 A;  4YG3 A;  1C28 A;  4CP0 A;  3H9A A;  4HBN A;  3HPN A;  3AYD A;  3WDT A;  3FLR A;  2PLV 3;  3W20 A;  1U5Y A;  3VKL A;  3VBF B;  5F2S A;  2ZPX A;  4LHN A;  2PHR A;  3PL0 A;  1D0G A;  2ILM A;  2WQZ C;  1QQP 2;  2ZHM A;  3WOG A;  4ET7 A;  3ZYG A;  3VBH C;  4F83 A;  1AZD A;  2EXJ A;  1Y3T A;  2X10 A;  3SIT A;  4P5Y A;  2Y38 A;  3NNJ A;  3B01 A;  4JRA A;  1WKY A;  2E32 A;  5FIX A;  5IUQ A;  3O1M A;  4FAG A;  1MVE A;  1LOF A;  2W1W A;  4AAP A;  4K3U A;  1IKQ A;  1BVV A;  4JAA A;  2X29 A;  1HRI 2;  4LE3 A;  2I07 B;  4RFT 0;  5J98 B;  1W2N A;  1OMI A;  1WMD A;  3VZK A;  1LED A;  3N35 A;  3QD6 A;  4XJ8 A;  2QQL A;  2Y0O A;  1COV 1;  3T08 A;  4LMF A;  3EXU A;  5T5L A;  3JD7 1;  2WZP P;  1KDK A;  3ZKU A;  3ZIW A;  4Q29 A;  4KU7 A;  4B4P A;  2C6S A;  2FDF A;  1GZC A;  2Z4F A;  2W5F A;  1LEN A;  1FV3 A;  1H4H A;  2WN2 A;  3OG2 A;  1GNY A;  5F2W A;  1SLL A;  4Y3O A;  1ZNP A;  3AKP A;  5LBB A;  3ZSL A;  2JIC A;  2ZA9 A;  2EAL A;  3O0V A;  4AHY A;  2MPF A;  2R06 3;  1KFU L;  4OLL A;  4XHX A;  1MVQ A;  5A7W A;  2PTM A;  1QOT A;  3BPS A;  1MEC 3;  3HWJ A;  2BZD A;  2I45 A;  2VUA A;  5IFP A;  4L2N A;  2IVI B;  1OA3 A;  2VMF A;  4XF3 A;  2J1R A;  4QGL A;  2JE9 A;  1V9U 1;  4LA3 A;  1SHW B;  3VZL A;  1O3S A;  2HH9 A;  1X9T A;  4UFL A;  4P08 A;  1VBA 3;  2JE8 A;  5F6K A;  1IG3 A;  5CG8 A;  2AEZ A;  1EV1 2;  3X29 B;  4JGY B;  3FUQ A;  1MEC 1;  1JZ2 A;  3DYP A;  4JV4 A;  3DPR B;  5T5O A;  4NRO A;  3BTZ A;  4IUG A;  3WDY A;  1UX7 A;  4EE2 A;  3ST7 A;  1V9U 3;  5JLV A;  2Z69 A;  1ACC A;  2VOV A;  4V1P A;  2WFF 2;  3L2Y A;  2O1Q A;  4YZ5 A;  4B7E A;  5SV5 A;  4EV0 A;  2OKX A;  1JMU B;  1LES A;  4OMC A;  1NXD 1;  2A3W A;  2ES3 A;  4GB3 1;  2YPJ A;  3J4U H;  1I5P A;  3FC0 A;  1R1Z A;  1XE8 A;  2E7T A;  1VLN A;  2P34 A;  4BQ5 A;  1LB2 A;  1EY2 A;  2RM2 2;  1ASJ 2;  2GNB A;  5FPX A;  3PUQ A;  3I7D A;  1K12 A;  3N7L A;  3KWV A;  2J1T A;  1Z7S 2;  3GXU A;  4YGB A;  3OEB A;  2RV9 A;  3I97 A;  4LO7 A;  3VBR C;  3S0M A;  2NLR A;  3VD3 A;  4ASM B;  1ZRF A;  2JDY A;  2VH9 A;  1JUH A;  5DAQ A;  1NKG A;  2BOJ A;  1UY3 A;  3ABZ A;  5JXG A;  1UD1 A;  2W52 A;  4IER A;  4FPH A;  3AP6 A;  5FYH A;  2PAM A;  1QHD A;  4O65 A;  4AXO A;  3JU9 A;  3VZJ A;  3TN9 3;  4YW5 A;  3WY6 A;  5ISL A;  3ES4 A;  2ETE A;  2V09 A;  4K1Z A;  4BQW A;  3SEP A;  4EN7 B;  4BJ0 A;  5C71 A;  1O91 A;  1KRI A;  4FT8 A;  3QCW A;  1QU0 A;  2VW2 A;  1DIW A;  5D8A B;  2ZGN A;  2OQ6 A;  1IQA A;  3HAG A;  5F5I A;  2VZV A;  4BME A;  1OOP B;  3NV3 A;  4L9B A;  4LUM A;  4IV1 A;  4P5H A;  4FPL A;  2CGP A;  5JOZ A;  4Q4W 1;  1K5M A;  3MFA A;  5FZ8 A;  3UT0 A;  2VZS A;  5FYZ A;  3K3N A;  1XSR A;  1JI6 A;  4ATE A;  3QH7 A;  2JB8 A;  1PIV 2;  2QBX A;  4N43 C;  5CFD A;  4UOJ A;  1QWR A;  1RMU 2;  2XML A;  3I59 A;  3E6C C;  1R08 1;  4OUL A;  5LY2 A;  4OHY A;  2NMO A;  2XJP A;  2BP6 A;  2VD7 A;  2VPV A;  3PJQ A;  4I0W B;  5F39 A;  5LCW L;  3FE5 A;  5JUV A;  1GP4 A;  2WO7 A;  3NNF A;  3QH6 A;  2CAV A;  3OPZ A;  5FLJ A;  1K5J A;  4GMP 0;  1RUG 2;  4MHU A;  1HRI 3;  5CAD A;  4BIF A;  4BIS A;  1JH5 A;  2C9A A;  3O1V A;  1UZ0 A;  3K51 A;  3VD7 A;  5BNO C;  3N7J A;  1IPK A;  1W3X A;  1M06 G;  2WS9 3;  5DZG A;  5C5U A;  4A42 A;  4NRQ A;  4QX5 A;  1O6U A;  1AJO A;  4IEO A;  3A7Q A;  2MEV 3;  4DY3 A;  1FPN 2;  3R0R A;  1WW7 A;  2FCV A;  3J7M A;  4HVQ A;  4XAB A;  2VW0 A;  3JB8 A;  1O4Z A;  2I74 A;  3R4S A;  2ZML A;  4ITC A;  2EAK A;  1MZ5 A;  1LGB A;  3BAL A;  2IFW A;  4XMA A;  3VN4 A;  1D4M 3;  2EIG A;  2LAL A;  3WNM A;  5HV0 A;  1RHI 1;  2EF6 A;  5IVF A;  1I3H A;  1YQ6 A;  1ULD A;  2G19 A;  3I59 B;  3DL3 A;  4XDO A;  1GNZ A;  1UX6 A;  3WQB A;  2C5D A;  1N3P A;  4YSF A;  3Q8C A;  1CAV B;  4Y24 A;  3NAP B;  4DOU A;  4UFM A;  2OXB A;  3KT4 A;  4M3C B;  2VZ3 A;  5DZF A;  3RSJ A;  4DMI A;  4LUL A;  2VMC A;  3WX5 A;  3ZSJ A;  3GZE A;  5A1F A;  3ZYJ B;  1K5M C;  1W2U A;  2UWA A;  1ODN A;  3LFI A;  3GZU C;  4KWL A;  4P00 B;  1O3R A;  2BDR A;  4UT5 A;  1H8T C;  4I3P A;  4W8J A;  1JYI A;  1FI2 A;  3WHU A;  2VZ1 A;  1CR7 A;  3PVB B;  2HLE A;  3ETQ A;  4P9W A;  1TE1 B;  2VXR A;  3IMN A;  1TG7 A;  1FYU A;  5FQ0 A;  2WNU B;  3OGS A;  2ZS6 B;  4W50 A;  5FKC A;  4WVM A;  2FBE A;  2PLV 1;  1PO1 1;  1QJY 1;  3GBG A;  3TNQ A;  4AED A;  1ZRI A;  5I8Y A;  3FFZ A;  3LWC A;  4CXX A;  2QQW A;  3MF9 A;  1V6I A;  1M4W A;  1DQ5 A;  3AMH A;  3AYC A;  1UOG A;  3BGA A;  3MPP G;  4IDZ A;  4DZG A;  2QQO A;  3VL8 A;  2X8K A;  4B29 A;  5A33 B;  1OQ1 A;  2PFW A;  4GQ7 A;  4LO4 B;  4PI0 A;  1Q5O A;  5C3R A;  2GU9 A;  5FZ3 A;  4CEW B;  1GQG A;  4L8Q A;  1XC6 A;  4G3Y C;  3H7J A;  5K0U C;  4JKK A;  1SZB A;  4AWD A;  4QMA A;  5LEJ A;  3URF A;  2UY9 A;  4IXL A;  4DIN B;  4ZU7 A;  1DZQ A;  2TUN A;  2ZHN A;  1S2B A;  4Q1R A;  3DN7 A;  4NRM A;  3QAC A;  1N1T A;  2X5I A;  3RVH A;  2GZW A;  5LRS A;  5IHR A;  3M2M A;  1W6P A;  5IVJ A;  3HIF A;  3MYX A;  3LEK A;  4ERO A;  1DQ6 A;  1RL3 A;  4XPV A;  1RUJ 2;  4TTG A;  5FXZ A;  4XQ4 A;  4OHZ A;  4JHZ A;  3ZN4 A;  4CEY C;  2HWC 1;  3FL7 A;  2QQV A;  3CO2 A;  5FZ9 A;  1OQE A;  4LHK A;  1O4T A;  3TNP B;  5I8S A;  4ASK A;  4YZ3 A;  4A4A A;  5FK8 A;  5IAX A;  3F2Z A;  4A7Z A;  4LBQ A;  2GNT A;  2J1A A;  5FXW A;  2GAL A;  3WG3 A;  3WF0 A;  3ZSM A;  2IFR A;  2WL1 A;  3KVA A;  3V56 A;  5FP8 A;  4TZD A;  2CY6 A;  1DDL A;  3D82 A;  3I54 A;  4QQO A;  4PIZ A;  2JG8 C;  2DCJ A;  3HBK A;  4E4Z A;  4E2Q A;  1SAC A;  1W9W A;  5A3N A;  1XOY A;  4QQH A;  2HWD 3;  4AE2 A;  1IS5 A;  2H6C A;  4MXW A;  1OKQ A;  1AJK A;  2W08 A;  4Z82 A;  2R07 2;  1RUC 1;  2F6B A;  2VCM A;  3CJI C;  2FDJ A;  2AGS A;  3FN9 A;  3UNP A;  2PHT A;  1CIY A;  2KD7 A;  1WW6 A;  1D2Q A;  5FMO L;  4MV2 A;  3LD8 A;  4QXB A;  4OQ8 A;  1RJ8 A;  4CXY A;  5JXH A;  4AI2 A;  2HWD 1;  2Z2S B;  5HCH A;  3FMG A;  4CZS A;  3S57 A;  3K75 B;  3MDP A;  4GJZ A;  3VZM A;  4UW3 A;  3MO4 A;  1GOF A;  3HNY M;  5GLU A;  1S0I A;  2O0O A;  4NN0 A;  4ZS2 A;  3TAY A;  4H3W A;  5CFD B;  1Q8O A;  3U1X A;  4LT5 A;  3BTA A;  2WC2 A;  4WM8 A;  3NV4 A;  4Z8B A;  2PXJ A;  3HD8 B;  2OPK A;  3GAL A;  4HG6 B;  5LAS A;  2FCU A;  3IT8 A;  4UXA A;  2XOM A;  2VOK A;  2E31 A;  4CP1 A;  1UU6 A;  2D43 A;  1W6O B;  1WLD A;  1V6K A;  1ULP A;  1MQT B;  5CKQ A;  4OUS A;  2YGL A;  4RS5 B;  3J26 N;  3KV5 A;  4K1Y A;  1V9U 2;  1QKQ A;  5HBA A;  4XFF A;  5E6H A;  4HVO A;  4AI8 A;  3KB5 A;  5FWJ A;  4AFC A;  2A3Y A;  3ITQ A;  5FPA A;  2GMP A;  3W58 A;  1A34 A;  3VKM A;  3JCI A;  2GC0 A;  2W9X A;  4UW4 A;  4AHX A;  5A70 A;  2WNV C;  5JVV A;  1ZBA 2;  2VMH A;  5FZO A;  2IUW A;  4L0P A;  1W28 A;  1FPN 3;  2NQY A;  2H0V A;  2Q30 A;  4NRP A;  1ZRE A;  2RS3 2;  3PU8 A;  5CVR A;  3ZKY A;  3AX4 A;  2W95 A;  1JYC A;  3DUI A;  3HOB A;  1HIX A;  3K77 A;  1KS4 A;  2XWJ B;  2H0B A;  4KBB A;  1W8T A;  4O9G A;  4PT6 A;  2BNO A;  5FY7 A;  4XBN A;  4URA A;  2HEV F;  3KS7 A;  1IQD C;  3WQ0 A;  3DXT A;  4IV1 C;  5BV6 A;  2DUO A;  3D0J A;  3MLJ A;  4FPF A;  1NLS A;  1PVC 2;  3NO8 A;  3OBA A;  1D7P M;  2WO3 A;  4E2S A;  1I1E A;  2BVB A;  4DNY A;  5A1A A;  3VBR A;  4UF0 A;  3GBW A;  4N7U A;  3H3Z A;  2X09 A;  1LKN A;  4AED C;  1ZBE 3;  2Y6F A;  4W6W A;  5FY0 A;  2YU1 A;  2RS5 1;  4BOW A;  4YPJ A;  1SBE A;  1UN1 A;  3J8F 2;  2CGO A;  1CD3 G;  2AH2 A;  4LBN A;  4QXK A;  1OH4 A;  4QWN A;  4N8M A;  3RYR A;  1GP5 A;  3GHM A;  1NX9 A;  2IZW A;  3OUI A;  3H1M A;  1O3Q A;  1AR6 2;  4IE6 A;  1YJL A;  5FY5 A;  1JYX A;  1SCS A;  2AC1 A;  4KH9 A;  4AED B;  3I2G A;  2WRA A;  3MI8 A;  3MW4 A;  4PLM A;  4Z2W A;  2JEC A;  3JD7 3;  2C24 A;  2JKX A;  4IEZ A;  1W9F A;  5IVY A;  1RUG 3;  2BWC A;  4P9G A;  3ZYF A;  1GR3 A;  5CEH A;  1LHV A;  2YC2 A;  4IV1 B;  5APA A;  3H7Y A;  4YAR A;  5LWB A;  3N3H A;  4PQQ A;  4XCA A;  5FK7 A;  2D3R A;  3CNA A;  4GXL A;  4Q4W 2;  2DCT A;  2ZEZ A;  4QGM A;  1TNR A;  1J59 A;  4NPL A;  2FDG A;  3OYW B;  4LLF A;  4SLI A;  5A7P A;  1KQR A;  1GUI A;  4PF5 A;  3WNP A;  1KDM A;  5EYY A;  3PHM A;  5FZK A;  3ZFG C;  3K48 A;  1UZY A;  3RZJ A;  3E5Q A;  1RUN A;  2C26 A;  1UZV A;  4XF9 A;  1UL9 A;  1OD3 A;  1ZM1 A;  4E27 A;  1H6Y A;  4WZC A;  1Z0H A;  3BIW E;  4CCL A;  5K8S A;  5F5C A;  2PMW B;  1NY7 1;  3JBG 1;  5KC6 A;  5A3P A;  2XHN A;  3BI3 A;  2BV4 A;  1ZRC A;  1IKP A;  3M7A A;  4HKO A;  5BXX A;  2PHU A;  5FZD A;  4AVS A;  1XPW A;  4AHZ A;  2G9F A;  2VMG A;  2P5B A;  3WF2 A;  1R1A 2;  1AR6 3;  2RR1 3;  1D4V B;  1IZ3 A;  1FPN 1;  4XJW A;  1LEC A;  4I02 A;  1GSL A;  1NCR C;  2D3S A;  2OQ7 A;  3D5O A;  1C1L A;  1URX A;  2Q1Z B;  2BNN A;  4XUN A;  4HZF A;  3BOD A;  4N43 A;  2HWB 2;  2VAU A;  1CJD A;  4RGG A;  3V0A B;  1RUE 1;  2XB6 C;  2GN7 A;  1NYW A;  5BNP C;  3TWI A;  3TEW A;  1H4G A;  4GWN A;  2XBO 2;  1YI7 A;  3OD4 A;  4AGR A;  1W6Q B;  3ZXL A;  1G8W A;  4M3C F;  3IN9 A;  2IXK A;  2AAC A;  4Y1U A;  2EVX A;  1H9P A;  4PF1 A;  2RHP A;  4XTP A;  4YVW B;  4EZ4 A; 
#chains in the Genus database with same CATH homology
 2EIB A;  2VZR A;  1CZS A;  3OGR A;  2VZT A;  2ORX A;  4XZU G;  4DXR A;  2QQI A;  1W0N A;  5F7U A;  3A22 A;  2VZQ A;  1KEX A;  3C7F A;  1L7R A;  1CX1 A;  3LEG A;  3LPG A;  2J1E A;  2ZEW A;  3P1I A;  2VCC A;  4UAP A;  4CUC A;  1UMH A;  3HPN A;  2VZP A;  3A23 A;  2WBK A;  2WQ8 A;  4TXW A;  4A44 A;  4ET7 A;  1ULO A;  4OZO A;  2X10 A;  4P5Y A;  4A6O A;  3C7G A;  1WKY A;  2E32 A;  1GU3 A;  2W1W A;  2J22 A;  3IB3 A;  3OGV A;  3I2J A;  1J84 A;  3NNG A;  4LKS A;  2QQL A;  3WNN A;  3T08 A;  2BBA A;  2BGO A;  2CDO A;  2Y6G A;  2VTF A;  3T09 A;  4M4R A;  2DDU A;  2WZ8 A;  4GWJ A;  2Z4F A;  2W5F A;  2WN2 A;  3OG2 A;  4QPW A;  1GNY A;  3IAP A;  3ZM8 A;  3T2Q A;  3VD5 A;  4OUE A;  2XQX A;  4KMQ A;  1UYY A;  3C7E A;  2C4X A;  2QQJ A;  2V72 A;  4XUO A;  4XUQ A;  1XNA A;  2BZD A;  1US3 A;  1SG3 A;  5IFP A;  2VMF A;  2J1R A;  1KGY A;  4D0Q A;  1PX4 A;  3ECQ A;  1SHW B;  3MUY 1;  2VM9 A;  4P08 A;  1L7Q A;  2JE8 A;  1JZ4 A;  5IFT A;  3THD A;  2EID A;  1JZ2 A;  3DYP A;  4OMD A;  1F4H A;  4IUG A;  1UX7 A;  1JZ7 A;  3K4Z A;  3THC A;  4CUA A;  2B9V A;  1US2 A;  2J7M A;  4XUP A;  4RYD A;  2OKX A;  1OF3 A;  4OMC A;  2YB7 A;  4QDQ A;  3HEI A;  1I5P A;  3FHA A;  3P6B A;  1JZ8 A;  1K12 A;  4MAD A;  3DYO A;  2J1T A;  4DEQ A;  3GXU A;  2WYS A;  2RV9 A;  3I97 A;  3OEB A;  3VD3 A;  5C7G A;  2EIE A;  2WAO A;  4E8D A;  1W99 A;  1NAE A;  1NKG A;  1UY3 A;  3ABZ A;  4JX0 A;  5JXG A;  4CVU A;  1PMH X;  4QX1 A;  3DEC A;  1K3I A;  3I2I A;  2VQU A;  4ZZ5 A;  3NJX A;  1T2X A;  1H6X A;  3SEP A;  4BJ0 A;  2E33 A;  5C71 A;  1O8S A;  1UYX A;  3W5N A;  2VZV A;  2VZS A;  1JI6 A;  3WEZ A;  2QBX A;  4UOJ A;  2EIC A;  2W92 A;  1DP0 A;  3C7O A;  3MV1 1;  5LCW L;  2JDA A;  3WNO A;  3FHQ A;  5JUV A;  3NRU A;  4A3Z A;  4A41 A;  2YFU A;  4W4Z A;  1LNS A;  1BHG A;  1UY2 A;  2VR4 A;  1O8P A;  1UZ0 A;  3VD7 A;  3PUI A;  4A42 A;  3LQC A;  3A7Q A;  2W1Q A;  2QQM A;  2WAA A;  3T0B A;  4DUV A;  3T2P A;  3W5M A;  3UET A;  3I3E A;  2XON A;  2RVA A;  2VO5 A;  1JHJ A;  3WNM A;  2VL4 A;  5EIY B;  2BER A;  5IYY A;  1K42 A;  3WQB A;  1EUU A;  4LHS A;  3WNL A;  2VCB A;  1W8N A;  2W87 A;  3NJV A;  3U37 A;  2VZ3 A;  2L9L A;  5DPN A;  2VMC A;  2W3J A;  3I2K A;  4UI9 L;  1UY4 A;  5DQ0 A;  2X05 A;  4P00 B;  2CDP A;  4W8J A;  2J1V A;  2VZ1 A;  2HLE A;  1UY1 A;  4GWI A;  5LA1 A;  4M4P A;  2V4V A;  3I2F A;  3SKJ E;  5G04 L;  1TG7 A;  1JZ5 A;  3IDA A;  2PQS A;  1JU4 A;  3OGS A;  4W50 A;  4QX0 A;  2Y6K A;  2HYX A;  2WDB A;  3J7H A;  3BGA A;  2WZE A;  1YQ2 A;  1UMI A;  3WF1 A;  2QQO A;  3C8X A;  3CIH A;  1TVG A;  3WSO A;  2WN3 A;  4ZY9 A;  2LS6 A;  3ACH A;  2E26 A;  1EUT A;  3SEE A;  2RJ2 A;  3GM8 A;  3C7H A;  1XC6 A;  2VC9 A;  3JXS A;  4XVH A;  4JKK A;  4JKL A;  3HN3 A;  3NQH A;  4MO3 M;  3DYM A;  5G05 L;  5IHR A;  2W1U A;  3LEK A;  5CYY A;  4TTG A;  4BXS V;  3SKV A;  4JHZ A;  5CZK A;  1P8J A;  3IAQ A;  3FL7 A;  2W47 A;  2VOT A;  4ZXE A;  4CU7 A;  4A4A A;  2YFZ A;  3F2Z A;  3OB8 A;  2J1A A;  4Z2A A;  1XNT A;  3E1F 1;  3WF0 A;  1JYW A;  5HXM A;  1OT5 A;  2DCJ A;  4CU8 A;  1W9W A;  4QB2 A;  3I2H A;  2WO2 A;  4QB1 A;  3CMG A;  2LW8 A;  2ZEY A;  3WF3 A;  4BK4 A;  3FN9 A;  3UNP A;  1JYN A;  4E8C A;  1CIY A;  3K4A A;  4P02 B;  2KD7 A;  1PMJ X;  4JKM A;  1MPX A;  2JD9 A;  1UYZ A;  5LA0 A;  3CZU A;  5JXH A;  1RYY A;  5DN2 A;  3CQO A;  2V5D A;  3GGL A;  2QQN A;  3LPF A;  3K75 B;  2ID4 A;  4ARX A;  5B4X A;  3MO4 A;  1GOF A;  4LQR A;  3HNY M;  2W1S A;  4ARY A;  5JXI A;  4QB6 A;  1J83 A;  2DCK A;  3PUH A;  3T0A A;  3CDZ B;  5LA2 A;  5B4N A;  3T2O A;  3K46 A;  2WUH A;  4DUX A;  4HG6 B;  3CKH A;  2QQK A;  2XOM A;  1PX3 A;  2E31 A;  4DXS A;  2WO1 A;  1JZ6 A;  1NUK A;  1UWW A;  4DUW A;  1ULP A;  1SDD B;  3T0D A;  1JZ3 A;  5EJZ B;  2YG0 A;  1GQP A;  2J1S A;  1JYV A;  2VZU A;  2J1U A;  5C70 A;  3VDC A;  3MV0 1;  1UY0 A;  4QDR A;  2C9K A;  5FUI A;  3GDB A;  2Y6J A;  2W9X A;  4QX3 A;  3CZJ A;  3ACG A;  1O59 A;  4L0P A;  4CU6 A;  3A21 A;  3LEI A;  2W95 A;  3ETP A;  3HOB A;  3K77 A;  3III A;  1W9S A;  4PT6 A;  4AAX A;  1IQD C;  3HNB M;  3OBA A;  4MGS A;  1D7P M;  1UXX X;  2WO3 A;  5A1A A;  5HPO A;  4KWU A;  5JR2 A;  2X09 A;  2VME A;  3UES A;  2W94 A;  3LE0 A;  4DXT A;  2ZEX A;  2Y8K A;  4YPJ A;  1GMM A;  1DLC A;  4QX2 A;  2VMD A;  4KI5 M;  1OH4 A;  1NX9 A;  1JU3 A;  4QAW A;  4CU9 A;  3MUZ 1;  5JMO A;  3K4D A;  1JYX A;  1OF4 A;  3I2G A;  1GOG A;  4QDS A;  2JKX A;  1GOH A;  4BK5 A;  3VD4 A;  3I3B A;  1CZV A;  4MGQ A;  2YC2 A;  2W46 A;  4PQQ A;  4GZ9 A;  1K45 A;  2W91 A;  2ZEZ A;  3WNK A;  4LPL A;  4DEV A;  1DYO A;  5J1X A;  1GUI A;  2Y6L A;  2BGP A;  1R64 A;  3WNP A;  3WF4 A;  2C26 A;  2R7E B;  1OD3 A;  3EYP A;  1H6Y A;  4ZZ8 A;  1F4A A;  2ORZ A;  2XHN A;  3VD9 A;  5JXJ A;  4OYU A;  4XUR A;  4MOA A;  2WAB A;  4RN5 A;  1XPW A;  4AG4 A;  3VDB A;  1HN1 A;  3MBW A;  4D8M A;  4A45 A;  3VDA A;  5EJ1 B;  1W8O A;  2YC4 A;  3WF2 A;  2VQT A;  5DMY A;  2VCA A;  2Y64 A;  5I0D A;  2VJX A;  3D3A A;  1WCQ A;  4BDV B;  3HJR A;  3EB7 A;  5IJR A;  3ACF A;  4XUN A;  4CUB A;  4XUT A;  3I3D A;  3OEA A;  1CZT A;  1UXZ A;  2ZXQ A;  1W9T A;  2VZO A;  3AC0 A;  2Y6H A;  3HNM A;  3ACI A;  2B4K A;  3BN6 A;  4PF1 A;  4FI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...