2VZQA

C-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa in complex with digalacturonic acid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
b'DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 23
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzqA00
1H6YA 3EYPA 3MUZ1 3PUHA 4A45A 3C7EA 4QX1A 1OF3A 2X09A 1KEXA 1JZ3A 2YB7A 1W8OA 2BGOA 4CU6A 1GOFA 2VO5A 2J1TA 2JE8A 2WAOA 2VQTA 4XUNA 4MGSA 3SEEA 2J1VA 3A21A 3HNBM 3WSOA 3I3BA 3THCA 4GZ9A 4A42A 4DXSA 3LEIA 2WZEA 3GGLA 3WF2A 3GDBA 1GQPA 1UYYA 3WNOA 4CUAA 2BBAA 3BGAA 3LE0A 5DN2A 3VD9A 1CX1A 1PX4A 2ORXA 1EUTA 1YQ2A 3I97A 4D8MA 2WABA 1US3A 1NKGA 2WBKA 2WAAA 1CZSA 1ULPA 2B4KA 3ABZA 3HEIA 3I2KA 1UYXA 2Y6GA 2QQJA 1O59A 5IJRA 5C70A 3UNPA 2Y6HA 2WQ8A 4QAWA 2W3JA 1JU4A 3CZJA 2WZ8A 3J7HA 5DMYA 5IYYA 5G04L 2C9KA 2WUHA 4XUQA 2Y6KA 2J1EA 3C8XA 2W9XA 3ACGA 2YFUA 3MUY1 1CZVA 3T2PA 1JZ2A 3HNMA 4A3ZA 4A41A 3P1IA 3K75B 3MV01 2LS6A 1F4AA 4BK4A 3OG2A 1J83A 4DUWA 4RYDA 2J1RA 1PX3A 1F4HA 3VD3A 3OEAA 3T0AA 3A23A 1EUUA 2W46A 5F7UA 3P6BA 3FN9A 4CU9A 4QB1A 2WO1A 4DEQA 3C7GA 1JZ6A 2E26A 2VMFA 3A7QA 3NQHA 2VZUA 2RV9A 3OGVA 3OGRA 2VM9A 2VC9A 2V5DA 4QDSA 2KD7A 1JYWA 1UX7A 3I2GA 1JZ8A 4M4RA 5HXMA 3GXUA 5EIYB 3I3EA 2QQLA 3I2FA 4ZY9A 2C4XA 3E1F1 1BHGA 2VCCA 1W0NA 4QDRA 4ARXA 3EB7A 4DEVA 1SG3A 1PMHX 2J1UA 5HPOA 3IAQA 3VDBA 1CIYA 4PF1A 4CUBA 2XONA 4LPLA 2W1WA 4OYUA 3I3DA 3T2QA 4LQRA 3HJRA 4MADA 5LA0A 2W47A 4W50A 3HN3A 2VMEA 2HYXA 2ZXQA 3CQOA 1JHJA 4BDVB 2BERA 2VZVA 2W5FA 4XURA 5C71A 2X10A 3OBAA 4ARYA 2WO3A 2E33A 1GOHA 4MGQA 4BJ0A 2W1UA 3CZUA 2VZPA 3T08A 4GWIA 5EJZB 1GOGA 4GWJA 4W4ZA 2QQNA 3DYPA 3T09A 1SDDB 2ZEYA 1JZ7A 4OUEA 1OF4A 1OH4A 3IB3A 3WNMA 5JUVA 1IQDC 2VZ1A 1K12A 4MOAA 2R7EB 2VMDA 3DYMA 4XVHA 4P08A 3THDA 2VCAA 3WNLA 3FHQA 4P02B 1UY1A 3UESA 2EIDA 3DECA 2C26A 1H6XA 4KWUA 3C7HA 2W92A 3PUIA 1UYZA 2LW8A 2Y6LA 2VMCA 1GMMA 2ID4A 4DXRA 4KMQA 3SEPA 5JXIA 1JZ5A 3C7OA 4FI9A 2QQKA 3VDCA 4A6OA 4XUPA 2WN3A 2XOMA 2YFZA 3MBWA 4MO3M 5EJ1B 3HOBA 2B9VA 4PQQA 1DYOA 2CDOA 5JXGA 3IDAA 3A22A 1W9TA 4ZXEA 5LA1A 2W94A 2W1QA 1T2XA 5JXHA 3WEZA 3U37A 1K42A 2JD9A 2HLEA 3ACFA 4ZZ8A 1JYNA 4RN5A 4P5YA 4QB2A 3T0BA 4BXSV 4CU8A 3MV11 4E8DA 3FL7A 5CYYA 3WF4A 1US2A 4YPJA 3ETPA 4HG6B 3NJXA 3SKVA 4OMDA 3ACIA 1WCQA 2QQMA 3LPFA 5JMOA 4JHZA 1RYYA 1PMJX 4ZZ5A 2J1AA 3I2JA 2Y8KA 2OKXA 4JX0A 3D3AA 3WQBA 2EIEA 1W9SA 2BZDA 4CUCA 1JYXA 1JZ4A 1HN1A 2E32A 3K4DA 2V72A 1MPXA 2VQUA 5LCWL 3C7FA 3NJVA 1K3IA 3LEKA 2EIBA 2J7MA 2W1SA 5JXJA 5G05L 2J22A 3K77A 4LHSA 5LA2A 2JKXA 1LNSA 3VD7A 2Y64A 3K4AA 3BN6A 4QPWA 2VZOA 4DXTA 2QBXA 3FHAA 3K4ZA 1UMHA 1KGYA 2W91A 2VOTA 3CIHA 2BGPA 4A4AA 1NX9A 4CU7A 1P8JA 5IHRA 1JU3A 2Y6JA 2ZEZA 2VZSA 3IIIA 1XNTA 3CDZB 4ET7A 4JKLA 2RVAA 2X05A 1UXXX 2PQSA 4OMCA 1L7QA 5J1XA 2WYSA 5DQ0A 1OD3A 3DYOA 1OT5A 1O8PA 2VJXA 5I0DA 5CZKA 2VZRA 3NNGA 4E8CA 4XUOA 1NUKA 4AAXA 3WF1A 4CVUA 3OB8A 1UY3A 1K45A 3OGSA 2WO2A 1TG7A 3I2HA 5B4XA 3WNPA 1ULOA 3VD5A 3CKHA 4XUTA 3SKJE 2XQXA 1UY0A 3NRUA 1DLCA 4L0PA 4LKSA 5C7GA 4OZOA 1XPWA 5A1AA 4DUXA 5JR2A 2ZEXA 1W9WA 1DP0A 4UOJA 4IUGA 3OEBA 2WN2A 1JYVA 4KI5M 4Z2AA 1UZ0A 2QQIA 3AC0A 3T0DA 2VR4A 3VD4A 1TVGA 1D7PM 3T2OA 3I2IA 1UWWA 4M4PA 5IFTA 2YC2A 1WKYA 5DPNA 2XHNA 5B4NA 2ZEWA 1UXZA 1O8SA 3GM8A 2EICA 4BK5A 1J84A 2QQOA 3K46A 3W5MA 2J1SA 4QX2A 4UAPA 2DDUA 1UMIA 4W8JA 4P00B 3LPGA 4TXWA 3ACHA 3LEGA 5FUIA 2L9LA 3WNKA 4A44A 2Z4FA 3UETA 2WDBA 2VZ3A 3ZM8A 1W8NA 3WF3A 4QX0A 4DUVA 2DCJA 3LQCA 2W95A 3IAPA 5IFPA 2VZTA 1XC6A 3JXSA 1CZTA 4D0QA 3HPNA 2VL4A 4TTGA 4QB6A 2YC4A 4JKKA 3CMGA 3HNYM 2JDAA 1JI6A 1R64A 2V4VA 3F2ZA 3W5NA 3MO4A 2E31A 2VZQA 1GUIA 4XZUG 2VTFA 1SHWB 1UY4A 2DCKA 1GU3A 2ORZA 3ECQA 1W99A 2VCBA 1XNAA 4QDQA 4PT6A 1I5PA 2W87A 2YG0A 4UI9L 1NAEA 1UY2A 4JKMA 4AG4A 1L7RA 3WNNA 2CDPA 1GNYA 4QX3A 3WF0A 3VDAA 2RJ2A
chains in the Genus database with same CATH superfamily
1MZ6A 3H9AA 2JG9B 4XJAA 3PUAA 2E53A 3C7EA 1OF3A 3THTA 4HKWA 1W8OA 2BUKA 1ZREA 1PGL1 4PIYA 5J7MA 2P17A 2G1MA 3I7DA 5LK5A 1W6OB 2VQTA 2PHLA 2CTVA 4BZ4A 2SBAA 3MW4A 4BA6A 2J1VA 3CJIB 2ARCA 2PHUA 1JUHA 3AMQA 3WG1A 1PGW2 5CVRA 4GZ9A 2RG4A 1ZRIA 2WT0A 3KCYA 3AMNA 3MI8A 3IMMA 1VB2A 4B1MA 1CAUB 3KV4A 4IE6A 4UF0A 4ITCA 3GDBA 3HD8B 4RS5C 5K8SA 2JB8A 3NMBA 3ZXJA 2A6VA 3ALQA 1NCQA 4RQPA 2BBAA 1FI2A 5LY2A 1OURA 5BXXA 3TEWA 2A6ZA 3H3LA 1CX1A 2ORXA 1DLLA 4Q5OA 2QTWB 4HSJA 3VBHC 4IGPA 1OHFA 3EHKA 4CDXC 2WAAA 1CZSA 1SMVA 1YYNA 2W52A 3ST7A 2UWCA 1SACA 4GAZA 5EYYA 2UWBA 3ABZA 4BOWA 2ZACA 1UU5A 1RUI3 4H2AA 3I2KA 2A73B 1FNZA 2EALA 3R05A 2R6QA 1UYXA 4LO7A 1XOYA 2YGMA 4JTOA 2HEYF 4N43A 3WQ0A 4CTEA 1REEA 3J7NA 3PNAA 5C8WA 2RE9A 4YW4A 5IJRA 4FAHA 1CPNA 5J3UA 5F3CA 3UNPA 1Y9QA 1SFYA 4QAWA 4D7YA 2JEMA 2W3JA 3H50A 4ASKA 1ZRDA 3CZJA 4LJHA 1C5HA 4J1WA 4AEJA 5A7OA 2F17A 3H3ZA 2WFF2 1QNWA 2IXLA 1NCRC 4XUQA 1QJX3 2Y6KA 1UIKA 3C8XA 4MGIE 5E16A 1NLRA 2GMMA 5T3NA 3S7IA 2W9XA 2WR9A 2D97A 3BPZA 2K0GA 2BGCA 4A7YA 3OCPA 5KXDA 4DMIA 1VMHA 1JZ2A 4N53C 4XFAA 1E5HA 4XQWA 3RPQA 3JBG3 1BCXA 4CYDA 2R49A 4NVPA 2YC0A 2CGNA 1F4AA 2ZHKA 1KITA 2XXZA 4RYDA 5C4WB 1HRI3 4NHLA 4EZHA 1SPPA 2OX0A 3O1UA 3VL9A 4HPKA 2HYKA 1F4HA 3VD3A 3OEAA 2EF6A 1BKZA 1GZWA 3BCWA 4Q4W1 5FUPA 5F7UA 2HWE3 1MR5A 1MS8A 4XTMA 3ZN5A 2ZGNA 1RINA 2XHKA 2GN7A 4XJWA 4CE8A 2TEPA 3T4VA 2XJVA 2PHDA 1TMF2 2VY0A 3U1XA 1HX6A 4AVVA 4L9BA 4K8FA 5FMDA 5IK4A 5FP7A 2N7GA 3BYWA 3OGRA 4RR3B 5DDJ2 2VM9A 1OLME 5CKQA 1VMFA 2VC9A 4OFGA 4K40A 1A6CA 3I2GA 2PMWB 4PDWA 4AHZA 3UKTA 5EIYB 1FYUA 1RGSA 1DGLA 3RNSA 3UYJA 1BHGA 5J48A 3ZSLA 3ROUA 4R9CA 1W0NA 3I3MA 3WHUA 4C0BA 2ZGQA 1PMHX 5HPOA 4AWDA 3VDBA 4PF1A 1LB2A 1RUD1 2B46X 5I8SA 1QQP1 3B69A 2XLAA 3HIFA 4Y3OA 4OYUA 5FZ0A 4YFZA 4MADA 2D6LX 3HJRA 1LU1A 3QACA 4META 3LDKA 5FK7A 4W50A 4AYUA 3BKZA 2P3KA 2WRAA 1KFXL 1C57A 5HBAA 5DG1A 3VBOC 4GQ7A 1W6PB 3QD6A 4S2HA 3CQOA 4BIFA 4AHXA 2RS32 1CAWB 4RGKA 5D21A 1RUOA 4ZS3A 5FYBA 3OYWA 3PVOA 4FPHA 3I49A 4LKDA 1TZOA 2W68A 1PGSA 2NZ9A 1OXCA 1RUG2 3CEWA 3LFIA 3H7YA 3KT1A 3QOPA 5A7WA 4ARYA 4CXWA 1U5IA 1GOHA 2QNKA 3NV1A 1U0AA 1S0CA 2A71A 3NV3A 4FPYA 2BOJA 3BVCA 3R4UA 5FXWA 5H9QA 1UU4A 1VBE1 3IIAA 2XL9A 3T08A 2I45A 4XBQA 4EV0A 5JLVA 2DUOA 4NPMA 4GWJA 4W4ZA 3DV8A 5FRAA 2VTXJ 2DFBA 3DYPA 3KMHA 5FZ9A 1LOFC 3USUB 4CDQC 4HLTA 1UCXA 2GMEA 5GLWA 3SMHA 4AFAA 3M3IA 2YPJA 4LIVA 1HQWA 5T5JA 4WM7B 2WFF3 1X8EA 1K12A 2FZ2A 1DQ0A 1HKDA 1LENA 2Q1MA 2RS12 5GZDA 4CEYC 2R7EB 3DYMA 4V2VA 3KF5A 3J26N 3H8OA 4XDQA 2ZGMA 4BCUA 1C8M2 5F3GA 4GB32 1MEC1 3I3QA 4HXCA 4EN8B 1V9U3 1CESA 3W58A 2FZ1A 3EBRA 2R0HA 3FHQA 4LLOA 3S30A 1RITA 3N9PA 3BU0A 4XQ4A 4XJUA 5A3PA 3BTZA 3PTYA 5JIUA 2UYAA 4JGZA 3C7HA 2W92A 3VLBB 3AJZA 4QPGA 4ASLA 1RUC2 1CAXB 5JAXA 5JPMB 4Z92B 5GZEA 5LB6A 3SH3A 1CIWA 3B01A 1FOD1 1T6BX 1ENQA 2QZ2A 4IGOA 1XSQA 3O1RA 4SBVA 2VBDA 3SEPA 5J36A 5JXIA 3MLLA 5GLZA 4FVVA 4IEUA 5A7SA 1W28A 4MG2A 1PGL2 1JZ5A 4IW3A 3C7OA 1RUJ1 1IG3A 2R063 1CX4A 3AZZA 3E6DA 2PTMA 4QKDA 4LT5A 4XUPA 3BALA 2Y0OA 1DHKB 1RJ7A 3MBWA 4MO3M 2HWC3 2QE3A 2W0XA 2WINB 4LHLA 1AL21 3SITA 4WM8A 1AYN1 1I9RA 5JXGA 3RI8A 3ILFA 4XJ8A 3LGRA 4KGQA 5D8AB 3ZFFB 5CFDB 4XDOA 1W9TA 4OHWA 5LA1A 2W94A 4NIDA 5IATA 4RSUA 1POQA 5FMCA 2DCZA 3MFCA 3Q8CA 3WEZA 3GCWA 2CY6A 4LE3A 2B42B 5FWEA 5GLVA 2ZGLA 4CPBA 5FQ0A 4JDMA 3HT1A 3H7JA 5LRSA 3QCWA 2RDSA 2ET1A 3ON7A 5SV5A 4CSWA 1OMIA 4QB2A 4YVSA 4CU8A 1R081 4IQPA 4N9IA 1ND3B 3ZYRA 3HBZA 2IWGB 2V4AA 4YZ3A 1PVXA 2WSVA 5FPLA 1US2A 2ERFA 2Q5TA 4TLGA 2BNNA 5FO7B 2RJLA 4LO8A 3SKVA 4OMDA 1AX1A 3WQ7A 4URAA 5JMOA 4XIKA 1W3XA 5IT6A 5B2GB 5T5LA 1L7LA 1PMJX 1RYYA 2IUWA 2D5FA 2Y8KA 4OCTA 1RMU1 3H8UA 5GLTA 4XHXA 1ONAA 2RS33 3ZFEC 1S0FA 1DGRN 2BNOA 2VNVA 4NPRA 5E89A 2I07B 1HN1A 5BNNA 2FCUA 4TSVA 3ZSKA 5FMBA 3E97A 4XZPA 2HJIA 5C3OA 3FBYA 1RUG3 5CFCB 5LCWL 4IEOA 5JOXA 3HT2A 3LEKA 2EIBA 4WVMA 3AZYA 5FMOS 2HWF2 2YV8A 1MZ5A 4K21A 2W1SA 1PK6A 3AK0A 3MLJA 5G05L 3POSA 4I02A 2BV4A 4J1XA 4NROA 4XFHA 2A3XA 2YGLA 4XTPA 3WDVA 1YQ8A 5JSRA 1V6JA 3VKMA 1E5RA 2J42A 4AVCA 5CKMA 2P37A 1QOSA 2VZOA 2RS13 4DXTA 3AKTA 2E7TA 4GMP1 5F1RA 4DY3A 3UJOA 4QQHA 2QBXA 1JTZX 1LOBA 3FHAA 3K4ZA 4HFSA 4Q4W2 4WZCA 5EWSA 4LBNA 1VALA 3ZXDA 5HI0A 1OA4A 5IHRA 2Y6JA 2D3SA 3LDRA 4EN0A 2VZSA 3T3YA 1QMJA 2XGXA 2BNMA 4ET7A 3LAGA 1K5MA 5FLJA 3DKWA 1DZRA 3OPZA 4BMEA 2RM21 1KD7A 2HEWF 2X05A 4IE4A 1IOAA 4AGRA 2C6SA 4QT6A 5C8CA 5J1XA 5TSWA 3VKLA 4BYYA 3VBSA 2QQWA 3RMYA 4QHBA 2BDRA 2G4IA 3DXTA 2BP6A 4X6RB 2O1QA 2YPDA 2JDHA 3OD4A 1X7NA 5I0DA 1AL0G 4UYBA 1QIQA 3VBUA 3HAGA 2CGOA 2ARBA 3MYXA 4BQ1A 2BPA2 2WWJA 5BNOC 4E8CA 4XMAA 3MF6A 4XUOA 4A3XA 2E6VA 1XU1A 4G4FA 2YHJA 2XJSA 1QH7A 1W3VA 3ZSEA 2NLRA 3F95A 3ILRA 3TEYA 5J98B 2Y38A 4OI2A 1S0IA 1UY3A 3WDYA 1OLQA 1UZZA 2GC0A 4D6QA 1TG7A 2WNUC 3I2HA 1RVF3 4DY5A 1ULOA 1QQP2 3ZYJB 3BIWE 3PVEA 2MPFA 3JU9A 4LTAA 5M0TA 3WVJA 1MS9A 2D40A 4UBHA 2FBEA 4JRLA 1KXGA 4AQ2A 4DXZA 4EQVA 1DLCA 2KM2A 1IG0A 1LULA 4XFCA 3GJAA 2GNTA 1TQ5A 1RL3A 3PL0A 3VBRB 4DUXA 1GWLA 1W9WA 4YGCA 5JR2A 3NWKA 4K3UA 4LULA 1YHFA 3K3OA 1WA4A 3AKPA 3KVBA 4KWKA 2DF7A 2RDNA 4Y4YA 3ZN6B 4FTEA 1SLTA 1OLRA 2VOWA 4IUGA 1RHI1 4XFIA 5I0RA 3M2MA 4KI5M 1NQDA 1YI9A 2R043 4YARA 1UZWA 1HJGA 2AENA 5CIRA 5FPVA 2EVXA 1RTVA 3E6CC 2YUEA 1AZDA 1WMFA 4W6XA 4C8DA 1WUVA 3LA2A 3S6PA 1DDLA 1VBE2 2B39A 5BY5A 2DUQA 4E4HA 4MXWA 3L9JT 4AHYA 1J3RA 3T2OA 3VZKA 4GWMA 1UWWA 3DUIA 3CHXA 4M4PA 4PIXA 4R52A 5A3TA 4JHTA 5IFTA 1HW5A 1LECA 3U4XA 3FHIB 1MZFA 1O91A 1DZQA 1HB1A 5FZGA 5I8YA 3I8TA 4Q0VA 1UXZA 2JX9A 4IEQA 2DTYA 5L19A 2PHRA 4CDXA 4UT5A 4Y22B 2GAUA 3VHOA 2Z69A 1J84A 2A5ZA 2X5IB 1JOBA 1C5IA 3K46A 1AVBA 4C90A 1CWPA 1XNCA 2X53S 4LBQD 1JN2P 1GZTA 3HMYA 2IXIA 1UX6A 2WWSA 3M1HA 3RZHA 3LPGA 4TXWA 4EWAA 4I01A 1AX2A 3ACHA 1IKPA 3WP6A 5FWJA 3FLTA 4FOYA 1UO9A 1MS1A 1VBA3 3UETA 3KWVA 4Y1UA 3MPBA 4AK3A 1FOD2 2ZX1A 4AI1A 3ZM8A 4V1PA 2VG9A 3WINE 2ZMKA 3U14A 5IWFA 4KU8A 1NCRA 4QX0A 1LR5A 2DCJA 4D6SA 4H55A 3SHRA 1RC6A 1HXS3 4XJ9A 5SV8A 1GICA 4AI3A 2JE9A 3AMMA 1X36A 2VL4A 4N53A 4OVEA 4JKKA 1AYN2 2IVJA 1VBC1 1RUE2 4QKFA 1YLLA 5IAXA 4TYSA 4TWTA 2V4VA 2HWB1 3LOBA 3W5NA 3WUDA 1XJAA 3VGIA 2E31A 2Q8OA 1R1A3 4JGYB 3WG3A 1GUIA 2VD7A 3NKTA 2OW4A 2ZX3A 5JZGB 1SHWB 3KM5A 3GZTB 3APBA 1S1AA 1WCDJ 4IEXA 3OGGA 1S55A 2NMOA 4QD2A 5JVVA 5CB7A 3ZR5A 3NL1A 3DPRB 4UI9L 4Y5SA 1R082 4XF9A 1O7FA 1PNGA 3O14A 2RJKA 4CDUB 1G9FA 3N7MA 4FP2A 1L7RA 3I54A 2CDPA 4C1XA 3Q8EA 4DNYA 3ZKUA 1RUD3 4QPGC 4NWVA 1PZ9A 1YQ6A 1MZEA 4Z07A 3SH5A 1GYKA 2RJ2A 3ZYPA 4YSFA 4CXYA 1BMV1 1H6YA 3VHRA 2MEV1 5C9AC 2R16A 1YCIA 4QGNA 3QBQA 3FZ3A 1OKQA 2VTXA 3NAPC 1JZ3A 4LIUA 2BGOA 2VMGA 2WFPA 2YBPA 1RMU2 4DZGA 4OHVA 2JE8A 3GNEA 4MUVA 1NYWA 4PBPA 3QH6A 1AXYA 1UYPA 4XUNA 2AR6A 5A6XA 1UKRA 4Y26A 3RZMA 4QQPA 4UFMA 1WA6X 2OQ6A 3A21A 4MYEA 4AEDA 1V9U1 2VUCA 1BEV1 4Q1PA 3WUCA 4XIOA 3BODA 4M3CF 4AVSA 1NOVA 4JDNA 4BM8A 4ATEA 2P3JA 3VBFB 5LRRA 2V09A 1HLCA 4LA3A 5GKAC 1WLWA 2WZEA 3GGLA 4E27A 5LBEA 1U5ZA 5FV3A 1GQPA 3MGUA 3POBA 1UYYA 3R0RA 3NNFA 3BGAA 3LE0A 4AXOA 3V65A 5T5PA 3VBOA 2D98A 4RR3C 1YQ2A 3FJSA 4D8MA 2WABA 4CCJA 2WBKA 1JXNA 1YEWA 2YDEA 3O0WA 4Q2FA 3PURA 3WP3A 1ULPA 2FD8A 2B4KA 2JJ6A 2MHFA 4Z2WA 1MEC3 2Y6GA 4BMBA 2LUWA 2JD4A 1CAVA 2FDKA 3UT0A 1RUNA 1BVVA 4MH0E 1KS5A 2RM22 3ZYIB 5DAXA 2JDMA 3MEPA 1RUH1 1FOD3 4KWJA 5G04L 1UOGA 2WUHA 4UF0B 5I0UA 4AFDA 2J1EA 1LOAA 4Y4RA 4E2QA 1ULGA 3ETQA 1U5XA 4MGYE 2YFUA 3PTRB 1NCQB 1RUJ3 4RQPB 3LIGA 1V6MA 4CEYA 1Z78A 2P34A 2VU9A 1XNDA 3KCXA 5FZDA 5FO9B 3KS7A 4OHZA 4FOQA 3AVRA 4GULA 3K75B 1SLIA 4COYA 4I0BA 1AL23 1DYKA 5A3WA 4BK4A 1AYN3 5L9RA 1D4VB 5FJHA 5I8TA 2Y60A 5LEJA 3OPWA 5C3RA 1HV0A 5HV0A 1XQNA 4FFFA 4N43B 1WLTA 5CNAA 1AR63 5LA9A 1APNA 1EUUA 2A75A 2LRPA 1J3PA 3PHMA 2Q8EA 3ES1A 4U36A 1WW7A 3K51A 4PF5A 1DIWA 1TEIA 1QJX2 2R30A 3PDQA 3KV6A 3ZYBA 2WNVA 3OBRA 1VRBA 4DEQA 1WGPA 2NP0A 2VMFA 3FLPA 3NQHA 1K5MC 3AP6A 4AL9A 3CU7A 4Y20A 4K9SA 5LASA 3WDUA 1ENRA 3AZXA 1RHI2 4XILA 1CJPA 3NKGA 5F5CA 4FPOB 3RI9A 2DUPA 2DTWA 2VOVA 4HMZA 4XF1A 3AKRA 1ULFA 3O1MA 5GJ6A 4FSJA 4QDSA 1GLHA 3VBSC 3ZXFA 3N35A 2P2KA 4A2UA 1JYWA 3N9LA 4R9DA 3GCXA 4M4RA 4M0HA 3GXUA 1OFNA 1H4HA 4G9SB 4LBMA 2AZ5A 2BJSA 3I2FA 2R1DA 5A7PA 2DYCA 3E1F1 3NNLA 3U4SA 2PHFA 2VCCA 4LHNA 4XMIA 1QU0A 1H8TC 4EYUA 4QDRA 5FYVA 3UV9A 3ZVXA 4J6GA 2WZPP 1GZWB 2XVKA 2J1UA 1CQ9A 1D0HA 2GC1A 3IAQA 5FZ6A 1CIYA 5IK7A 1OA3A 1BK1A 2EXIA 4I3PA 4XABA 4AI8A 2P1BA 4E4ZA 4EROA 4CEWB 5JOZA 3ZSMA 2W1WA 3T2QA 1SZBA 4QWNA 3I4IA 2ZX2A 1GNZA 2JB4A 5JSOA 2XKOA 1XNBA 3JB8A 2GC3A 1AYM1 1VPHA 3V64A 5DZGA 4UFKA 3B7MA 2VMEA 4L92A 1WD4A 2XH6A 5FYTA 2OUHA 3PJQA 4QPIB 5D8AC 5T54A 5I93A 2WO7A 1SCRA 4BDVB 2D6PA 3VV1A 3ZFEA 4IDZA 4GMP3 5L9BA 2ZGTA 2VZVA 3KVAA 1F35A 3ZDVA 2E9QA 4LO4B 4YM0A 2X10A 4PDWB 1Y4WA 2WO3A 2QDRA 5CKNA 3M3QA 3MW2A 1H4GA 4Q26A 2WA3A 2VZPA 3CZUA 3AMHA 1JOJA 4GWIA 1DF0A 1PVC3 3SCHA 1LGNA 3AFKA 3UGGA 1RVF1 2IVIB 2QQNA 2RM23 1MACA 2Y26A 3CBNA 2IFWA 4O9GA 4OUMA 5JI9A 1KRIA 4GH4B 1SDDB 5GALA 1VBC2 1JZ7A 4OUEA 1OF4A 4XF4A 4COZA 5IVCA 2XJQA 3CL1A 3FLRA 3IB3A 3NV2A 2CAUA 5J96B 1IQDC 1EYBA 2G9FA 4R4XA 2HWB2 4Y33A 4NOTA 4UFLA 4FOVA 1QOOA 3ZIXA 5EJ3A 3THDA 3EMRA 3AP5A 4MX3A 2BYVE 2Z42A 2R041 1UKGA 3OYWB 4P02B 4Y5TA 5FK8A 4XF3A 2EIDA 3UESA 3WNXA 4B7KA 1I1EA 5FZOA 3N36A 4YZ2A 2Y6LA 3CLPA 5F37A 4IV3A 5A7WB 2VMCA 1GMMA 2ID4A 1BMV2 3ZR6A 2WA4A 3AL6A 4LXLA 1GKBA 3KZ4C 5F8PA 1B35C 2GP3A 5JR7B 4NO4A 5E8AA 3P3PA 1SBEA 4O7XA 2E63A 4FI9A 2QQKA 3OD0A 4FXGB 1PM4A 2IXCA 3RDIA 4AAPA 2OA2A 5DUWA 4CP9A 4YVWC 3TNPB 2QQUA 2XOMA 2YFZA 3K2OA 3ZSJA 4F8AA 4QXCA 1OH3A 3SQOA 1RHI3 3HOBA 3VB9A 1V9U2 1BEV2 4DRRA 3IDAA 1S2EA 4XBNA 4FPCA 4CCLA 4D94A 4ZXEA 3H1MA 4JDOA 5JXHA 4NPLA 5T55A 3WT3A 1G9DA 2WNUA 1Q5OA 1IKQA 3LD8A 1S0EA 5IVBA 3WP5A 2JKBA 1VBA1 2R071 4OUSA 2PA7A 4RHV1 3U37A 4YM3A 2PLV1 1CGPA 4OI0A 2HLEA 2HKXA 2XDVA 2XLGA 3FC0A 3ACFA 5FBJA 1Q8OA 5DZFA 1AR91 4CCMA 3WW1A 2VVFA 4RN5A 1HV1A 5I0TA 4N8MA 2JG8B 1V6NA 5FYCA 1ACCA 1XYOA 4E8DA 3FL7A 1N3PA 1HXS1 5CYYA 4HK8A 3SNMA 2JDKA 3WF4A 1UPIA 2R062 4CCEA 4YPJA 1POV0 2FMDA 2ZZQA 3ETPA 5A70A 3NJXA 4IV1C 3VKFC 4P9GA 1UOBA 4KBZA 5FY7A 5BNPC 2HWC2 2Y0IA 2F6BA 5F39A 3WCSA 2YBKA 1DQ6A 1UN1A 4F83A 3IWZA 2NMNA 4RL7A 3I2JA 4ZZ5A 3PUQA 2Y6FA 2XKPA 1WLCA 4ZPIA 3D3AA 3UGFA 4WM8B 1LHUA 1R1A1 5FY8A 1H1IA 3PJYA 3SC7X 3EQEA 5I91A 2BZDA 4CUCA 1JYXA 1JZ4A 4NRPA 1OLMA 2NN8A 3C3VA 1RUH2 3MIFA 2E32A 3VHNA 3TBDA 2V72A 1PZ8A 4AEDC 2VQUA 2OPWA 5FQ0B 2WQZC 2WLPA 3NJVA 1K3IA 5FZ3A 2AYHA 3BB6A 2BVBA 2A6XA 3QH7A 1ZBA1 1Z7S1 1UMZA 4YVSB 4HL0A 4P14A 1EY2A 5FZCA 2RDQA 4I0AA 1W90A 2LALA 2J22A 2BW8A 2ZHLA 1GNHA 2D5HA 4Z82A 3VZJA 1EPZA 1VBC3 3LA7A 3MW3A 3JD73 3CJIA 3VD7A 5AC93 5ACA1 2HWB3 4XAAA 5EYXA 2FQPA 4QPWA 1W8WA 1ST8A 5DZEA 1BLZA 1DQ5A 3W59A 4D6RA 2G19A 5IK8A 4AOCA 3EJKA 3CIHA 5LWBA 2BGPA 3KQRA 4A4AA 4CU7A 3BTXA 4AI2A 2WIIB 4E9KA 2ZEZA 4O9EA 4LITA 3CDZB 1IQAA 3AKSA 5BNNB 1OQDA 4CCNA 1NZIA 2XWBB 2RHPA 2A3YA 4FQ4A 4DS0A 5FLHA 4CRQA 3A0KA 2H6CA 2PQSA 1NT0A 4H7MA 1L7QA 1Y9MA 2OPKA 4WVMB 4ISRA 3ZFGC 1W2OA 2MEV3 1O3TA 2WYSA 1HB4A 1AR71 1S4CA 2GN3A 1OD3A 1QY4A 1OT5A 2JICA 1PK6B 3K48A 1SFNA 4IEZA 1UPSA 2JECA 3RVHA 3I2OA 3Q8AA 1X50A 1GQHA 4GA9A 5DUUA 2DU1A 4KNCA 3IMNA 3VHPA 2VZRA 5LBBA 3OF1A 5HCBA 3S0MA 4QGMA 4AAXA 5KHHA 4COVA 5FREA 3G7DA 2XJUA 1BEV3 1RJ8A 4YZ1A 3U75A 1Z0HA 1ASJ3 1DQ2A 4XHBA 3THPA 3Q8BA 3A4UA 3RZJA 2OIIA 4R4ZA 3WNPA 2ZAAA 4L2NA 1GFF2 4X8NA 2XLFA 2AACA 3R4SA 1YJKA 4HKOA 1UNBA 2EA7A 3LCPA 5FY9A 5C9AA 5EFUA 4L0PA 1AYM2 5AFBA 3AP9A 2EXKA 3LA3A 3NAPA 2O8QA 4OZOA 5LZ6A 2B8MA 2ATFA 1OQ1A 1EPWA 1W2NA 2WNVC 2PHWA 5C8CB 4G3YC 4LO5B 1FAYA 4N7UA 4BQ5A 3RZGA 2DFCA 3OEBA 3AXDA 4JTNA 4P9IA 2WNEA 4GALA 1A34A 4IE5A 2WN2A 3SLIA 3VBUB 2PAEA 2QQIA 4DO0A 3AC0A 1VMJA 4ZU5A 3GZEA 1W8FA 3DPRC 2ZJCA 2WC2A 2C1FA 2AUYA 1RVF2 1UL9A 4HK9A 2FCTA 1AR61 5ABJC 1FV2A 4AZZA 4CDWB 4YFWA 1L3JA 1RUH3 3RMXA 2YC2A 1PO13 4OHYA 1DG6A 1WKYA 3TNQA 5DPNA 5F32A 1ZBE1 5FYSA 5FIXA 4RR3A 1GQGA 3ZXGA 3PMEA 4LBLA 1O8SA 1V0AA 2OZJA 3ZYFA 4L8QA 5A32A 2EICA 1ND2B 2VUJA 4JVAA 4Y5Z0 1VRH3 1Y9GA 3KCCA 3LOIA 1D4M3 4TTGA 2J1SA 2RMU3 2R042 4Q0SA 1ZNPA 4JRAA 4P00B 2ZOEB 1S0DA 4R9BA 3WNKA 1OKOA 2L9LA 5L7OC 4KU7A 4A44A 4AGGA 4KWLA 1PMIA 2F4PA 3K3NA 2Y34A 1JYCA 4IEVA 2A6YA 2WDBA 1OUXA 2P6HA 2VMIA 4HBNA 3RS6A 2EAKA 4GIQA 5C5TA 5KXEA 4MXWB 1G9CA 2QVSB 3WW4A 4YYOA 2VOXA 2R32A 4RS5B 1FT9A 4AQ6A 2ENRA 3LQCA 3Q9OA 5AFEA 1QOTA 1GBGA 5JSPA 1ZRRA 2VZTA 2EXJA 1A3KA 1W6PA 4AFCA 4D0QA 3HPNA 1YFWA 4YG0A 2WLQA 1CAWA 1J58A 3MIBA 4WVZA 4QB6A 2I74A 3AZWA 1W6MA 1YIFA 3VBHB 5ISLA 3U10A 4CDXB 2XL7A 1W6QB 2QJVA 4QXBA 3H1WA 5H9PA 3MO4A 2VZQA 4XYXA 2DVAA 2VTFA 4XZUG 1GU3A 4W6YA 3GBWA 3V0AA 1VBA2 2R072 2ORZA 4RHV2 4AEKA 2PLV2 1VAVA 2ZGKA 3RFRA 1REFA 4FBFA 4PT6A 1AR92 4QMAA 3MIHA 4HONA 3USUA 1LCLA 3AP4A 4YW1A 1LESA 1N1TA 3S5QA 4JKMA 4UW5A 2PQQA 1HXS2 2VE1A 4FPFA 1EP0A 1GNYA 1PVC1 4QX3A 1OC1A 4ZXKA 3WF0A 4YGBA 4IV3C 2UY9A 1SLBA 2QZ3A 4R9AA 2H6BA 2D6KA 3OUJA 3PUHA 3WG4A 1WMEA 2ZABA 5CEHA 2X09A 1AYM3 1KEXA 2YB7A 3HR9A 4GXLA 3VDDC 1GOFA 2VO5A 4N53B 3WLUA 4ES8A 1SLAA 2VCMA 5FY5A 2WAOA 1R1A2 1POV3 4FXKB 4CUGA 3O5SA 1OOPC 3HQXA 4IL7A 2OUJA 1KJLA 1ALYA 3PVBB 1NA1B 3TEZA 1G7YA 5FCCA 5K0UC 3SEEA 3AB0A 1ZA7A 1YRZA 3HNBM 5FP8A 2A3WA 1DQ4A 1H8TA 4NHKA 5FYZA 3DL3A 1UZVA 2JDZA 5FAXA 4BQ4A 1O4TA 4AE2A 3MPPG 2OZ6A 4I09A 4RGAA 4DXSA 2ZGSA 3LEIA 4IXLA 5IVFA 4LBQA 5FZEA 1ZBA2 3WF2A 1Z7S2 2DWRA 2ZPXA 1RUD2 3N7LA 3POGA 1YIPA 3TN91 5LY1A 1SCSA 1W9FA 4FP3A 2ARXA 2IFRA 5FZBA 3WNOA 4XQDA 4CUAA 3E6BA 5DABA 1H1MA 3D0JA 4YG6A 3SISA 3WOGA 1ZVFA 3GBGA 1PX4A 3UGHA 2FCVA 3IZOA 5K4LA 4FFIA 1AJKA 4BH9A 5ACA2 1A8MA 1JBCA 2B45X 5D8AA 3ZFFA 1US3A 2HH9A 1U5YA 3POFA 2VULA 3J9SA 4BPZA 2C9AA 5JOYA 2VUDA 3TRSB 5KHIA 4QX5A 5FR3A 1O5LA 3MLKA 4B4PA 3N7JA 4IE7A 2VXJA 3DCQA 4XCAA 1OFSA 3C2UA 3D6EA 1F9KA 1U12A 3VL8A 2DBNA 1AHSA 4K1YA 3WD5A 4LOTA 1HDKA 5K9YA 2XMLA 1ENSA 3SCGA 2CU5A 5CG9A 2Y6HA 1MQTC 1IHMA 1ULDA 3UKVA 2WQ8A 1ND3A 3T30A 1JU4A 4PHZA 2D6NA 2GNDA 2WZ8A 3J7HA 4NRQA 3RZLA 1AR72 2C9KA 1H30A 3KGZA 5ANQA 5FOJB 3WDTA 2E7QA 3ACGA 1PIV1 2JG9C 5ANNA 2XVGA 2VBPA 5F2SA 2WT2A 1F2NA 1Q8QA 2YROA 4XW3A 1VBD3 3VBOB 5BYNA 4A41A 5FPZA 2ARAA 4GWNA 5F3EA 1C1FA 4S2GA 4LA2A 4TZDA 1MEC2 2LS6A 2ZX0A 1FX5A 2XR4A 1J83A 4DUWA 1GP5A 1YWKA 4NUBA 3WY6A 4N90A 2J1RA 4ONUA 3O1TA 5EP9A 2EXHA 3CJIC 1X82A 4RGGA 4BQYA 2TNFA 2DU0A 4H3WA 3T0AA 2GH2A 3A23A 4I2OA 3JCIA 4KG8A 4RHV3 2R073 3V0BA 2PLV3 2UU8A 4LMFA 3M8LA 1B35A 1AR93 5LBCA 4QB1A 5FP4A 2WO1A 3H42B 4U2AA 2WL1A 4FFHA 1WCSA 1V6KA 2XJRA 1NQJA 2E26A 2JENA 3C7GA 1LOGA 4CDQB 5LK7B 3A7QA 3ZPYA 3RWNA 1RUJ2 1N1VA 2W39A 1ENXA 2VZUA 4GKXA 5JWPA 3R4DB 2TBVA 1R1ZA 3X29B 4YVWA 3OGVA 2ZCWA 1W6NA 4CEYB 3BI3A 4FO9A 1AL22 4FTBA 3AKQA 2JDYA 1W8ZA 2V5DA 1MS5A 1JODA 5BV6A 3B5LB 4LO6B 2VNGA 3WDWA 3JD71 5H9SA 5AC91 3WW3A 1UX7A 3G6JB 5HXMA 1G9BA 1A8DA 5F6KA 2QQLA 5HCFA 1AR62 1YI7A 1MS3A 3PU3A 4O61A 4QPYA 4ZY9A 1QEXA 2WJSA 2P4EA 5KWRA 1HN0A 4ZONA 1KJRA 3EB7A 3VZLA 2Q0AA 2YMZA 1SG3A 2XUEA 4K6BA 5A6YA 4CUBA 1YO8A 1C4RA 5EZWA 4LPLA 1ZBA3 4IV1A 1Z7S3 2ZKNA 1C1LA 5LA0A 3I59A 2JDPA 3M3CA 1GZ9A 5LBFA 5BNPA 4Q4Y1 1E5SA 4Y1XA 2ADEA 3OOXA 3AYAA 2BVVA 4PBOA 1LTEA 2OT7A 2BFUL 3HN3A 1RXGA 2HYXA 2ZXQA 4FOWA 5IUQA 4CP1A 3NVCA 2K9ZA 4DINB 5ACA3 1GV9A 2NM1A 5KHKA 1LJ7A 1Q56A 1RUF3 1NY71 5C4WC 2BERA 2ZZJA 2D7FA 2VW1A 1WMDA 5GZCA 5A3MA 3OBAA 4LUKA 4S2DA 4YLZA 3W20A 3ME2A 5L9VA 2AEZA 2VMHA 1PO23 1COV3 4MGQA 3RRDA 1TNFA 2VNOA 2W1UA 3VZNA 3JZVA 1ASJ1 5BPXA 3ZOIA 4BJ0A 5EJZB 4Q4V2 4LORA 2JG8C 2ZHMA 5FY0A 3VBRA 5IK5A 5CAZA 4AGVA 4BISA 3AZVA 2P6CA 5DAPA 2HEVF 1FXZA 1QJEA 4HVRA 4LOSA 3WG2A 3ZN6A 4Q29A 1Q43A 4AHWA 1ZZBA 1OH4A 4KH9A 1OQEA 1AR73 3WNMA 5JUVA 2JIGA 2VZ1A 5FKBA 3H8RA 1EV13 4MOAA 3TB0A 3LIHA 1Q8VA 3IKWA 1W0OA 5FZFA 1WW6A 3RQ0A 4NAOA 4BQ3A 1YFXA 4TLFA 4HKLA 3ZFEB 1PNFA 1UY1A 5FYHA 2ZMNA 5F9TA 1W8UA 2D44A 3DECA 1V00A 3GZUC 3OY8A 4UWDA 3PU8A 1C3HA 3FMGA 2CWMA 4M3CA 1IPSA 1YQ5A 1AR83 4KWUA 3RYRA 1UYZA 2YBSA 1PVC2 2Z5WA 4NHXA 1OPMA 5LW9A 4Q0PA 4MSVA 1OI6A 2D6OX 3JUUA 4DXRA 2AGSA 1CVNA 2ETEA 3ZFGA 4S2FA 4XXPA 3CF6E 1PO11 4NN0A 3MICA 4AEMA 1K5JA 1O3RA 1D2SA 1F5FA 3VDCA 3ZYGA 5KBFA 2CGPA 4UW4A 4A6OA 1T6GC 1RIRA 2WN3A 4N9HA 5FXZA 2VNRA 1OD5A 5EJ1B 4Q4V1 1VRH1 2D43A 3POEA 1DYOA 4PQQA 2CDOA 1VIWB 4EN9B 1JYTA 1D4M1 4TN7A 2RMU1 2VUAA 3J4UH 3PLQA 4FT8A 3VKNA 4YW2A 2AREA 2W1QA 1T2XA 1V6OA 3HWJA 4QQ2A 3NJZA 2BFUS 4BXFA 3TN92 1IS5A 5FYIA 2BBVA 5APAA 5C3SA 2DVFA 2JDUA 2XG3A 4UBGA 5FZOB 4BQ2A 4ZZ8A 1JYNA 2RS53 4EWDA 2DCYA 3VZOA 5FO8B 1W8TA 1REDA 5A33A 5A6QA 1ZBE3 5EHDA 5FPAA 1SBFA 3M3EA 1LHNA 3EXUA 1BZWA 1JMUB 1W03A 4WM7C 4Y24A 4HG6B 3UJQA 3T1MA 1BBT3 3IN9A 1XE7A 4XAEA 2QQVA 4HANA 4XBLA 3ZN4A 5A1LA 4MVTA 1LODA 4Q4X1 1XRUA 1WCQA 1SFPA 1HB3A 2JDNA 4FQZA 4JZRA 4NR1A 4BLIA 2BWCA 1ZYBA 5IW0A 4Q1RA 1XE8A 4SLIA 1QXJA 5FYMA 3DPRA 2ZGOA 2G9GA 2UWAA 3WQBA 3KGLA 1BYHA 1S2KA 3J7LA 4MHRA 4QGLA 1URXA 1D0GA 3LEMA 4Y1ZA 1YFYA 4ZU4A 4PLNA 1LHVA 3AFGA 4LBOA 4CDUA 4Y1VA 5ABJA 2P3YA 2PAMA 4QU2A 2WNUB 5JI7A 1MPXA 1SPPB 3HQRA 1PZ7A 4H7LA 2R0FA 3WHTA 1H9PA 1V70A 3LB9A 4HPKB 3ZX7A 2D3RA 3N9MA 5GLUA 2IZWA 4NAMA 4XC9A 3RYPA 1LKNA 2Y33A 3DKQA 2GMPA 1PIV2 2IC1A 2J7MA 3E5UA 1LHOA 3IPVA 1ZA4A 3WP4A 1FV3A 5EPAA 3T2TA 4YW5A 4YWAA 1H0BA 3FWEA 2CYFA 4A7KA 4F3JA 5A6ZA 5LA2A 3WDXA 5E88A 1YUDA 3OBZA 3Q8FA 4UXAA 4J25A 2PN5A 3B94A 4XJZA 1LNSA 2W2IA 1GWKA 2Y64A 1SBDA 3BN6A 3TYJA 3KHBA 1POV1 4YNIA 3ZFFC 4DOUA 3L2HA 4BLJA 5CFDC 5L7OA 4MLOA 3HBKA 4HVOA 2OXBA 3VBFA 2IXKA 4ES9A 1KGYA 2XWJB 5KHJA 2VOTA 2Q1ZB 5FYYA 4QX7A 2ZKLA 3NJYA 5JIAA 3JB4C 4W65A 2E51A 4FFGA 3CJXA 3IIIA 4UFHA 4XOGA 1VAKA 2XPJA 4JKLA 5C5UA 4UFJA 5F2WA 1W0PA 5FZAA 1UD1A 1AXZA 4WVVA 2PFWA 2NYYA 1HRV3 4OMCA 4QXHA 1ND3C 3OBTA 1ND2C 2RR11 4OI1A 1QDOA 4HN1A 3PUSA 3LFMA 3VN4A 3DYOA 5FUNA 4LK6A 3FUOA 1XYPA 3O7OA 3JD72 1O8PA 5AC92 2V73A 2WWUA 4AW7A 2GNMA 2XBO3 3H0OA 5CZKA 1Q3EA 1G8WA 1OUSA 3N3HA 5DUVA 1WWYA 3NNGA 5EXOA 4AF9A 4MGKE 4HN0A 3RWKX 3WF1A 1QWRA 3J7MA 1CJDA 1VBB1 4CVUA 1FPN3 5CU1A 1DFQA 4LEJA 3NO8A 5ERLA 3OGSA 1N3OA 1S0BA 1ZZ6A 3LDBA 4R8HA 2WO2A 4P5HA 2YXSA 5B4XA 1TME3 3DXUA 5CFCC 3LKJA 4B1LA 4E4DX 1G9AA 3CKHA 3KQ4B 1FATA 3TN93 1TE1B 5FOBB 1Y7BA 1ZZ7A 2XQXA 4Q4Y2 4CCCA 4M00A 3NRUA 2WZR3 2MEV2 2ZGPA 4QKBA 1AUYA 3SCFA 4CZSA 4LKSA 4E2SA 5C7GA 1XPWA 2WQ4A 2VXRA 4QX8A 5A1AA 3VDDA 4BHPA 2ZEXA 3IBMA 1ZZCA 1DP0A 4PCRA 4UOJA 5AVAA 1OOPA 4QM8A 1NY72 5DG2A 3BIEA 1VBD1 1F31A 3RJRA 1BVP1 5K0UA 1W2AX 4K8RB 3ITQA 4KG0A 5D1IA 5F3IA 1PM7A 3GBFA 3OTFA 3VKOA 4Z2AA 5HCAA 1NXD1 1JYVA 1H8VA 1LEDA 2D93A 1TVGA 2VW2A 4XEZA 1D7PM 2NPIA 1ASJ2 2QKDA 3VD4A 2VPVA 1LHWA 4V2WA 3NW4A 4DB5A 3SXWA 1OBNA 5C6CA 1KDKA 3I2IA 3PIGA 1QJU1 1LOEA 3BTAA 4MHUA 2WS91 3B00A 5T52A 1N1YA 4JGZB 5FY4A 2FDHA 4QPGB 1EAH3 4B7EA 2Q4SA 5B4NA 1QKQA 1F8VA 2HWF1 2ZEWA 5C9AB 3ZIWA 1PIV3 1DGWX 5C3QA 3KSCA 1LOCA 3NAPB 1VE0A 1W04A 4BK5A 5FDBA 4UFIA 2GH8A 5JOWA 3W5MA 1UIJA 2ET7A 2OQ7A 1NA1C 1BXHA 1MS4A 1R091 4L97A 1UMIA 4UAPA 4W8JA 3GJBA 5T5OA 5LEKA 2B5HA 1QJY1 3U0ZA 1VR3A 3UL2A 4OULA 3WXPA 1LU2A 1AJOA 1XU2A 5HV4A 3VUOA 3IDCB 1MQTA 1GR3A 4GD4A 1QJZA 5L73A 1J1LA 3AM2A 3D82A 2BEOA 4CEWA 1PO12 4AI9A 4DUVA 5IVEA 2H0BA 4JCKA 5FZ7A 5JPNB 3IAPA 5FZMA 3ZPOA 2JG9A 4HZFA 4ZU7A 3ASIA 1GANA 1GSLA 1XC6A 3J8F3 1CZTA 3GF6A 5FTTC 3TWIA 1WLDA 4QPIA 5I0SA 3VBRC 2FDIA 2Z79A 3FX3A 4IE0A 3KV9A 4NHYA 1H2KA 1QJFA 1VRH2 1O5UA 2Q30A 3JQWA 1YNAA 1CR7A 5A32B 1D4M2 2X8KA 3CMGA 5FPBA 2RMU2 1W6OA 3DGTA 3WR0A 2JDAA 1JI6A 3TEXA 2BWAA 4OHXA 4JV4A 3RZZA 4YRDA 3OPTA 3UK9A 3KB5A 4CXXA 1UY4A 2AEYA 2HWD1 2LROA 1H2MA 1YJLA 1RUF1 3ECQA 1W99A 2BTVC 2VCBA 4IEWA 5D2AA 5F6LB 2IXJA 4D3WA 4F7ZA 1XNAA 1CAUA 1I5PA 3GALA 3IDBB 4I3GA 2W87A 1LAJA 2D6MA 5EV7A 5FYUA 4ATFA 2XJTA 4GH4A 2DBIA 1NAEA 1PO21 1COV1 4LUMA 3W21A 1WW5A 1VLNA 5FLIA 4AI0A 2DURA 2FMYA 4EZ4A 3EYPA 2OS2A 3MUZ1 4Q4X2 2DVGA 2FDJA 4A45A 2DVBA 3AP7A 4Q4Y3 2GSYA 4QX1A 4CP0A 1SLCA 1UOFA 4GKYA 3TAYA 2X5IC 4CU6A 2J1TA 1EV11 1W6MB 1RB8G 5IVJA 2A7AA 4KQ7A 5HXVA 4IGQA 1W05A 1IS6A 3WV6A 3N9OA 2KXLA 4MGSA 1NLSA 1NG0A 1WMXA 3OSDA 3WSOA 1IZ3A 4NIAA 1KFUL 2AC1A 3O0VA 3I3BA 4YW7A 4QKNA 3THCA 4AFMA 4AR2A 3V0AB 4A42A 4HVQA 5FZ1A 4MGTA 3RJ2X 4FTSA 2GZWA 2UYBA 1UU6A 3A0NA 1AR81 4MGZE 3ZDSA 1STMA 3IDEA 5LATA 4I0WB 4P9WA 1FNYA 2GDFA 2HBTA 3AMPA 4E4SA 2GU9A 4QQLA 5A7NA 3LSEA 1K5MB 5DN2A 2XUMA 1O6UA 4ISQA 5IAVA 1SLLA 3VD9A 4IERA 1EUTA 2WNOA 4YW3A 3I97A 3KT4A 1NKGA 3E5XA 2ZS6B 1J1TA 3O1PA 5H9RA 2YY1A 2ILMA 1GP4A 4ASMB 3OUIA 5BNQA 3ZXKA 5C4WA 5KR7A 3VBSB 3DEMA 1CN1A 4JGYC 3HEIA 4NIGA 5JZGC 5FMOL 1Y3TA 2NQYA 3AYEA 2QQJA 1DYPA 5FBZA 5CADA 1O59A 1E57A 2BOIA 4AVBA 3IM0A 5A80A 4DRVA 5C70A 3P5BA 5CG8A 1OVSA 5A1FA 2K2SA 3OJBA 1H8TB 1ULEA 1BJQA 2JG8A 1VAMA 3BOWA 1B09A 3EO6A 4N7IA 2AH2A 4KL1A 4CDUC 5DMYA 1XE0A 5IYYA 2RR12 5F5QA 4LBQB 4URTA 2RS51 3M3OA 4JAAA 1XNKA 2VQ0A 4A7ZA 4O65A 2PHTA 1TMF3 4PQ9A 3MUY1 1CZVA 1DGRA 1X9TA 2A1XA 2ZGRA 3T2PA 4LE4A 3LWCA 3S5AA 3HNMA 1W9YA 4A3ZA 1BBT1 3P1IA 1RUE1 1HQLA 1XB9A 4Q4V3 5DDJ3 5FPUA 3MV01 1X9PA 1VBB2 3OG2A 2C5DA 2YU1A 1UF2C 3AJYA 4HT1T 4X8PA 2JIJA 4Y1YA 4B3NA 4LKFA 4BIOA 3ZMOA 5JDBA 3ZXAC 5FZ8A 5DAWA 1PX3A 1ODMA 2Z2SB 4B8EA 2C24A 3V56A 4QHOA 1W8HA 2PAKA 1HJFA 5GZFA 2W46A 3VBFC 3LSDA 2QDNA 1JHNA 2JXAA 3P6BA 2ZTNA 4FPEA 3FN9A 5T50A 3U07A 4CU9A 4K1ZA 3NNMA 3ZXLA 1JZ6A 5FXVA 1ZZ9A 2UURA 1C28A 2IXHA 4P9LA 1E5IA 4H14A 4I30A 4QHZA 2FDFA 5KC6A 3NNJA 4WZFA 4HOOA 4JC1A 2RV9A 1M06G 1VBD2 2ZA9A 3O0XA 3ZXEA 5FZKA 4K20A 4Q4X3 5FJKA 1GP6A 1QH6A 3MIEA 2TUNA 3IT8A 5GM0A 2QQPA 2KD7A 4IESA 1FMD1 3BPSA 1JOPA 5FP3A 1JZ8A 1WW4A 4M01A 2PELA 3BU7A 3I3EA 1M4WA 2ES3A 3KF3A 3POWA 3FE5A 3NV4A 2C4XA 2CAVA 1QJU2 2CSGA 3D4KA 4LKEA 2ZMLA 2WS92 2C0ZA 1OA2A 4WV8A 1DGWA 4ARXA 4DEVA 2CWSA 4LR4A 3CO2A 2Q1FA 1YQCA 2BQPA 4NWWA 3RYKA 3V0BB 3HVDA 2Q8DA 1G6NA 1GZCA 3N9QA 1UW8A 1B35B 2XONA 4WM7A 3I3DA 3L2YA 1HRV1 1Q8PA 4LQRA 1NCRB 2QFEA 4PLOA 1N1SA 4OI4A 3ZMNA 2W47A 4BB3A 4CCDA 3RZKA 1NCQC 4RQPC 1F5JA 1MS0A 4CCOA 4Z8BA 5A3UA 1R092 1X8MA 4PIZA 3O1OA 4CPBD 4YVWB 5BUVA 1QJY2 1JHJA 4Q8KA 1W6NB 3W9AA 4AQTA 5KHGA 2XBO1 3KHCA 3ES4A 4Q8LA 1IPKA 3RG0A 1C8M3 4BE3A 3BTYA 4GB33 5FY1A 2W5FA 2F4LA 4XURA 5C71A 1CAXA 5FKCA 4N43C 2E33A 3ZYHA 1FPN1 1ODNA 2GC2A 4INDA 4RD7A 3AYCA 3O1SA 4HSLA 4MXVA 3DF0A 4DQAA 5CA6A 4FPJA 4PLMA 1RUC3 1UAIA 1GOGA 1TME1 4IEYA 4D7SA 4A6SA 3ATGA 1F15A 3ORJA 1HIXA 2BRTA 2YU2A 2OYZA 2I2SA 5E6HA 3T09A 2ZEYA 4LK7A 2ZHNA 4XFBA 2WZR1 2XJPA 2RR13 3I2DA 4NHMA 3VZMA 4IV1B 4DFSA 2FDGA 3N9NA 3I59B 5BNPB 2WKKA 3CNAA 2W08A 3M7AA 2VMDA 3D0SA 2HWD2 3M70A 4XVHA 5FZIA 5CFDA 1JW6A 3O1VA 1RUF2 2A6WA 4P08A 3HQUA 1UOJA 1RUI1 4ZHNA 2G9ZA 2VCAA 3E5QA 4FPKA 2O14A 4RA0A 3WNLA 3BOPA 1O4YA 3POIA 4QU1A 4YGEA 2CV6A 1VBB3 2K46A 4CDWA 2C26A 1H6XA 1PO22 1COV2 2MNGA 3B9IA 3INAA 5F5AA 4NIIA 1X33A 2O8OA 3D8CA 3PUIA 2LW8A 3SH4A 4AEDB 4K7JA 4LLFA 1GWMA 5E1RA 1IPJA 4XCBA 1RXFA 4KMQA 5A7QA 1ND2A 1QJX1 4P9JA 2JWPA 4CEWC 1NE4A 3H8XA 1ZRFA 3B93A 3MIDA 1EAH1 4PI0A 4YM2A 1EV12 4EN6B 2VH9A 1D2QA 4UW6A 1BQPA 3ACLA 1JS9A 4B29A 3H1YA 2YYOA 2ZAHA 3JBG1 4FPLA 4QPIC 4FPGA 5C3PA 1LEMA 2B9VA 4QQOA 4MZUA 4NJ4A 4UW3A 3USSA 1UQXA 3KD4A 3A22A 1HRI1 4OZXA 3WX5A 2WT1A 1DQ1A 4LBJA 1NXMA 4PDWC 1AR82 4RS5A 3AYDA 5CFCA 1H2LA 1AX0A 3POYA 1QGLA 3WW2A 4P9YA 5DAVA 4XFFA 2O0OA 3OY8B 2JD9A 1K42A 1KDMA 1CAVB 2HWE1 4IETA 4M3CB 5FFOC 1JH5A 1QJU3 4PI2A 4CA9A 4XE9A 1S2BA 2WS93 3FBMA 4QM9A 3ELNA 4P5YA 3T0BA 4XPVA 4BU2A 4BXSV 3VBHA 4EWEA 1Y43B 1SEFA 3MV11 4GH4C 3S57A 2D3PA 3ZFGB 1DZTA 1W6QA 2HWF3 2XVLA 3J8F1 4GMP0 4OQ9A 4AVAA 3P3NA 3ACIA 5KC5A 4RFT0 5J09A 2QQMA 3LPFA 1C8NA 2EIGA 4JHZA 3MZHA 2LTNA 1UZYA 2J1AA 1G86A 1R093 2OKXA 4JX0A 3ENRA 5DAQA 1QJY3 1W9SA 2B7YA 2EIEA 4EE2A 5IVYA 4YGDA 1JYIA 4DIQA 2BU9A 1OVPA 3M4FA 4B4QA 4Q4W3 1O3SA 3O12A 1IGOA 2XB6C 3MFAA 1O3QA 2PXJA 3K4DA 1AXKA 4BQWA 3AX4A 2RS52 5FZ4A 4LHKA 1PGW1 3OGJA 3C7FA 4XXAA 3KT7A 4CCKA 1IS4A 1N3QA 4KBBA 4XACA 1ZBE2 1LRHA 1CONA 4WBBA 5JMCA 1DBNA 2WYFA 1WCUA 2KA3A 2CNAA 1CD3G 1J3QA 5A33B 5JXJA 1DCSA 1NLQA 1BBT2 1JUIA 2LM3A 5CBLA 3BUCA 1YXWA 2WNVB 1VJ2A 1WBFA 3K77A 4LBKA 2B9UA 4LHSA 1OPOA 2JKXA 3FFQA 1NA1A 3B9CA 5CISA 2UY8A 4Y20B 4AFBA 4C0HA 1H2NA 3K4AA 1XXNA 4KGGA 4NE9A 4E2GA 5K7PA 1TNRA 3B02A 1SDWA 2SLIA 2HWD3 3S7EA 2VBBA 5FXXA 1UMHA 2W91A 4BQXA 4FCAA 4XF0A 1NX9A 1IS3A 5A3OA 3DN7A 1P8JA 2P3IA 3MDPA 4AVTA 1JU3A 4EN7B 2GP5A 3AL5A 4XFGA 4NIHA 1VP6A 5ABJB 4L11A 1XNTA 1ZX5A 1NE6A 4GJYA 4JGZC 3WCRA 1XYNA 1VB4A 3LZZA 1PHMA 2RVAA 4ZS2A 1N47A 1QQP3 2GNBA 4OQ8A 1UXXX 4RFRB 3IPVB 4PJYA 1ZRCA 3AVSA 4Q0UA 5DQ0A 2WFF1 2OVUA 2E7AA 1FMD2 2RDRA 3H3UA 3URFA 1YFUA 1O4ZA 1KQRA 1S0GA 2VJXA 2ZBJA 2ZX4A 4OLLA 1KS4A 2CHHA 2DVDA 4L99A 1QHDA 3ZO0B 2YZ4A 1NUKA 4NMIA 4WM8C 1XBFA 1A78A 1AF9A 5L7OB 1QNYA 5C33A 5HCHA 3OB8A 4NRMA 3HN1A 4D69A 1VBE3 2WSUA 3T4HB 4C1WA 5FPXA 5DUXA 1S0JA 3RGBA 3PMSA 3WZ1A 2QUOA 3VD5A 4ZKTB 1HRV2 3QLQA 5F5IA 4XUTA 3SKJE 1LGBA 1UY0A 2QCSB 3ZLIA 2Q8CA 4LNVA 4YM1A 3U11A 4Y22A 4YVSC 4HETA 1HQNA 2X5IA 4FAGA 2PHXA 2A70A 1XSRA 1V6LA 2P5BA 2R061 3OUHA 1TMF1 4JQRA 1J59A 1I3HA 2XBO2 4IEPA 4M3CE 4XDPA 2HWC1 4GJZA 1QF3A 3LF7A 1QDCA 2KR2A 5DDJ1 3D5OA 1CPMA 3R6SA 1Q8SA 1UZ0A 4YG3A 1FPN2 3T0DA 2VR4A 2XQRA 4YZ5A 4D7TA 1V6IA 2DV9A 5EQUA 4BWOA 3GYDA 3GZAA 1TME2 3MHZA 3FFZA 2EAAA 5BNOA 2VVEA 1LOFA 2VAUA 3JQXA 3POJA 4CDQA 5BNNC 4B4RA 4YW6A 5A3LA 2WZR2 2CL2A 1WBLA 2ZGUA 1I5ZA 4IV3B 1SQ4A 2XHNA 3NSTA 1W06A 2VW0A 1W39A 3GM8A 3KV5A 4P9XA 5JCTA 3N4MA 1W2UA 2H0VA 1PK6C 4M0NA 2V5YA 1RUI2 2QQOA 4W6WA 3VDDB 4CP2A 2DCTA 2X29A 4MV2A 4JGYA 4C91A 1RUE3 1YC61 5JZGA 1OOPB 4QX2A 3PVNA 4DPNA 2DDUA 5A3NA 4CP9B 3MIGA 3WQ1A 1ULCA 5K0UB 3FUQA 4X6QB 5BNOB 3LEGA 2RS31 5FUIA 1NZCA 4QXKA 2Z4FA 5KXBA 4XETA 5L36A 1WD3A 1HB2A 4ORFA 2VZ3A 1RUG1 1W8NA 3ILNA 3WF3A 1OSGA 1R083 1ZZ8A 2VQAA 3MF9A 1EAH2 2FHRA 2HBUA 2W95A 1MVQA 3UKNA 2VECA 5GZGA 5IFPA 4JQTA 5FZHA 5IVVA 1H1AA 3JXSA 3ZKYA 2VVDA 1LGCA 1MVEA 3JBG2 4EJRA 3U78A 1QXPA 3N7KA 4COWA 2YC4A 5C8CC 3AXEA 3PIJA 1QXRA 1I6XA 4Z1VA 3HNYM 4AQSA 1HRI2 4Q27A 1R64A 2GALA 5FP9A 3F2ZA 1RMU3 4Q0QA 3B3QE 1FMD3 3RSJA 4COUA 2RS11 5J37A 2R1BA 2DCKA 3VBUC 3KLSA 2PYTA 1DU3D 1H9WA 1C8M1 4GB31 4WVWA 2HWE2 1WZXA 4QDQA 5DXDA 3TOJA 2YG0A 1MQTB 2VOKA 3GHNA 2VGDA 1UY2A 4YZ4A 4AG4A 4CDWC 5FZLA 5AVPA 3WNNA 2ADDA 1RUC1 1BK0A 2JE7A 3GHMA 3J8F2 5KXCA 1W2TA 3T1LA 1ZM1A 3VDAA 1K45A 1WCKA
chains in the Genus database with same CATH topology
1H6YA 3EYPA 3MUZ1 3PUHA 4A45A 3C7EA 4QX1A 1OF3A 2X09A 1KEXA 1JZ3A 2YB7A 1W8OA 2BGOA 4CU6A 1GOFA 2VO5A 2J1TA 2JE8A 2WAOA 2VQTA 4XUNA 4MGSA 3SEEA 2J1VA 3A21A 3HNBM 3WSOA 3I3BA 3THCA 4GZ9A 4A42A 4DXSA 3LEIA 2WZEA 3GGLA 3WF2A 3GDBA 1GQPA 1UYYA 3WNOA 4CUAA 2BBAA 3BGAA 3LE0A 5DN2A 3VD9A 1CX1A 1PX4A 2ORXA 1EUTA 1YQ2A 3I97A 4D8MA 2WABA 1US3A 1NKGA 2WBKA 2WAAA 1CZSA 1ULPA 2B4KA 3ABZA 3HEIA 3I2KA 1UYXA 2Y6GA 2QQJA 1O59A 5IJRA 5C70A 3UNPA 2Y6HA 2WQ8A 4QAWA 2W3JA 1JU4A 3CZJA 2WZ8A 3J7HA 5DMYA 5IYYA 5G04L 2C9KA 2WUHA 4XUQA 2Y6KA 2J1EA 3C8XA 2W9XA 3ACGA 2YFUA 3MUY1 1CZVA 3T2PA 1JZ2A 3HNMA 4A3ZA 4A41A 3P1IA 3K75B 3MV01 2LS6A 1F4AA 4BK4A 3OG2A 1J83A 4DUWA 4RYDA 2J1RA 1PX3A 1F4HA 3VD3A 3OEAA 3T0AA 3A23A 1EUUA 2W46A 5F7UA 3P6BA 3FN9A 4CU9A 4QB1A 2WO1A 4DEQA 3C7GA 1JZ6A 2E26A 2VMFA 3A7QA 3NQHA 2VZUA 2RV9A 3OGVA 3OGRA 2VM9A 2VC9A 2V5DA 4QDSA 2KD7A 1JYWA 1UX7A 3I2GA 1JZ8A 4M4RA 5HXMA 3GXUA 5EIYB 3I3EA 2QQLA 3I2FA 4ZY9A 2C4XA 3E1F1 1BHGA 2VCCA 1W0NA 4QDRA 4ARXA 3EB7A 4DEVA 1SG3A 1PMHX 2J1UA 5HPOA 3IAQA 3VDBA 1CIYA 4PF1A 4CUBA 2XONA 4LPLA 2W1WA 4OYUA 3I3DA 3T2QA 4LQRA 3HJRA 4MADA 5LA0A 2W47A 4W50A 3HN3A 2VMEA 2HYXA 2ZXQA 3CQOA 1JHJA 4BDVB 2BERA 2VZVA 2W5FA 4XURA 5C71A 2X10A 3OBAA 4ARYA 2WO3A 2E33A 1GOHA 4MGQA 4BJ0A 2W1UA 3CZUA 2VZPA 3T08A 4GWIA 5EJZB 1GOGA 4GWJA 4W4ZA 2QQNA 3DYPA 3T09A 1SDDB 2ZEYA 1JZ7A 4OUEA 1OF4A 1OH4A 3IB3A 3WNMA 5JUVA 1IQDC 2VZ1A 1K12A 4MOAA 2R7EB 2VMDA 3DYMA 4XVHA 4P08A 3THDA 2VCAA 3WNLA 3FHQA 4P02B 1UY1A 3UESA 2EIDA 3DECA 2C26A 1H6XA 4KWUA 3C7HA 2W92A 3PUIA 1UYZA 2LW8A 2Y6LA 2VMCA 1GMMA 2ID4A 4DXRA 4KMQA 3SEPA 5JXIA 1JZ5A 3C7OA 4FI9A 2QQKA 3VDCA 4A6OA 4XUPA 2WN3A 2XOMA 2YFZA 3MBWA 4MO3M 5EJ1B 3HOBA 2B9VA 4PQQA 1DYOA 2CDOA 5JXGA 3IDAA 3A22A 1W9TA 4ZXEA 5LA1A 2W94A 2W1QA 1T2XA 5JXHA 3WEZA 3U37A 1K42A 2JD9A 2HLEA 3ACFA 4ZZ8A 1JYNA 4RN5A 4P5YA 4QB2A 3T0BA 4BXSV 4CU8A 3MV11 4E8DA 3FL7A 5CYYA 3WF4A 1US2A 4YPJA 3ETPA 4HG6B 3NJXA 3SKVA 4OMDA 3ACIA 1WCQA 2QQMA 3LPFA 5JMOA 4JHZA 1RYYA 1PMJX 4ZZ5A 2J1AA 3I2JA 2Y8KA 2OKXA 4JX0A 3D3AA 3WQBA 2EIEA 1W9SA 2BZDA 4CUCA 1JYXA 1JZ4A 1HN1A 2E32A 3K4DA 2V72A 1MPXA 2VQUA 5LCWL 3C7FA 3NJVA 1K3IA 3LEKA 2EIBA 2J7MA 2W1SA 5JXJA 5G05L 2J22A 3K77A 4LHSA 5LA2A 2JKXA 1LNSA 3VD7A 2Y64A 3K4AA 3BN6A 4QPWA 2VZOA 4DXTA 2QBXA 3FHAA 3K4ZA 1UMHA 1KGYA 2W91A 2VOTA 3CIHA 2BGPA 4A4AA 1NX9A 4CU7A 1P8JA 5IHRA 1JU3A 2Y6JA 2ZEZA 2VZSA 3IIIA 1XNTA 3CDZB 4ET7A 4JKLA 2RVAA 2X05A 1UXXX 2PQSA 4OMCA 1L7QA 5J1XA 2WYSA 5DQ0A 1OD3A 3DYOA 1OT5A 1O8PA 2VJXA 5I0DA 5CZKA 2VZRA 3NNGA 4E8CA 4XUOA 1NUKA 4AAXA 3WF1A 4CVUA 3OB8A 1UY3A 1K45A 3OGSA 2WO2A 1TG7A 3I2HA 5B4XA 3WNPA 1ULOA 3VD5A 3CKHA 4XUTA 3SKJE 2XQXA 1UY0A 3NRUA 1DLCA 4L0PA 4LKSA 5C7GA 4OZOA 1XPWA 5A1AA 4DUXA 5JR2A 2ZEXA 1W9WA 1DP0A 4UOJA 4IUGA 3OEBA 2WN2A 1JYVA 4KI5M 4Z2AA 1UZ0A 2QQIA 3AC0A 3T0DA 2VR4A 3VD4A 1TVGA 1D7PM 3T2OA 3I2IA 1UWWA 4M4PA 5IFTA 2YC2A 1WKYA 5DPNA 2XHNA 5B4NA 2ZEWA 1UXZA 1O8SA 3GM8A 2EICA 4BK5A 1J84A 2QQOA 3K46A 3W5MA 2J1SA 4QX2A 4UAPA 2DDUA 1UMIA 4W8JA 4P00B 3LPGA 4TXWA 3ACHA 3LEGA 5FUIA 2L9LA 3WNKA 4A44A 2Z4FA 3UETA 2WDBA 2VZ3A 3ZM8A 1W8NA 3WF3A 4QX0A 4DUVA 2DCJA 3LQCA 2W95A 3IAPA 5IFPA 2VZTA 1XC6A 3JXSA 1CZTA 4D0QA 3HPNA 2VL4A 4TTGA 4QB6A 2YC4A 4JKKA 3CMGA 3HNYM 2JDAA 1JI6A 1R64A 2V4VA 3F2ZA 3W5NA 3MO4A 2E31A 2VZQA 1GUIA 4XZUG 2VTFA 1SHWB 1UY4A 2DCKA 1GU3A 2ORZA 3ECQA 1W99A 2VCBA 1XNAA 4QDQA 4PT6A 1I5PA 2W87A 2YG0A 4UI9L 1NAEA 1UY2A 4JKMA 4AG4A 1L7RA 3WNNA 2CDPA 1GNYA 4QX3A 3WF0A 3VDAA 2RJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6Y A;  3EYP A;  3MUZ 1;  3PUH A;  4A45 A;  3C7E A;  4QX1 A;  1OF3 A;  2X09 A;  1KEX A;  1JZ3 A;  2YB7 A;  1W8O A;  2BGO A;  4CU6 A;  1GOF A;  2VO5 A;  2J1T A;  2JE8 A;  2WAO A;  2VQT A;  4XUN A;  4MGS A;  3SEE A;  2J1V A;  3A21 A;  3HNB M;  3WSO A;  3I3B A;  3THC A;  4GZ9 A;  4A42 A;  4DXS A;  3LEI A;  2WZE A;  3GGL A;  3WF2 A;  3GDB A;  1GQP A;  1UYY A;  3WNO A;  4CUA A;  2BBA A;  3BGA A;  3LE0 A;  5DN2 A;  3VD9 A;  1CX1 A;  1PX4 A;  2ORX A;  1EUT A;  1YQ2 A;  3I97 A;  4D8M A;  2WAB A;  1US3 A;  1NKG A;  2WBK A;  2WAA A;  1CZS A;  1ULP A;  2B4K A;  3ABZ A;  3HEI A;  3I2K A;  1UYX A;  2Y6G A;  2QQJ A;  1O59 A;  5IJR A;  5C70 A;  3UNP A;  2Y6H A;  2WQ8 A;  4QAW A;  2W3J A;  1JU4 A;  3CZJ A;  2WZ8 A;  3J7H A;  5DMY A;  5IYY A;  5G04 L;  2C9K A;  2WUH A;  4XUQ A;  2Y6K A;  2J1E A;  3C8X A;  2W9X A;  3ACG A;  2YFU A;  3MUY 1;  1CZV A;  3T2P A;  1JZ2 A;  3HNM A;  4A3Z A;  4A41 A;  3P1I A;  3K75 B;  3MV0 1;  2LS6 A;  1F4A A;  4BK4 A;  3OG2 A;  1J83 A;  4DUW A;  4RYD A;  2J1R A;  1PX3 A;  1F4H A;  3VD3 A;  3OEA A;  3T0A A;  3A23 A;  1EUU A;  2W46 A;  5F7U A;  3P6B A;  3FN9 A;  4CU9 A;  4QB1 A;  2WO1 A;  4DEQ A;  3C7G A;  1JZ6 A;  2E26 A;  2VMF A;  3A7Q A;  3NQH A;  2VZU A;  2RV9 A;  3OGV A;  3OGR A;  2VM9 A;  2VC9 A;  2V5D A;  4QDS A;  2KD7 A;  1JYW A;  1UX7 A;  3I2G A;  1JZ8 A;  4M4R A;  5HXM A;  3GXU A;  5EIY B;  3I3E A;  2QQL A;  3I2F A;  4ZY9 A;  2C4X A;  3E1F 1;  1BHG A;  2VCC A;  1W0N A;  4QDR A;  4ARX A;  3EB7 A;  4DEV A;  1SG3 A;  1PMH X;  2J1U A;  5HPO A;  3IAQ A;  3VDB A;  1CIY A;  4PF1 A;  4CUB A;  2XON A;  4LPL A;  2W1W A;  4OYU A;  3I3D A;  3T2Q A;  4LQR A;  3HJR A;  4MAD A;  5LA0 A;  2W47 A;  4W50 A;  3HN3 A;  2VME A;  2HYX A;  2ZXQ A;  3CQO A;  1JHJ A;  4BDV B;  2BER A;  2VZV A;  2W5F A;  4XUR A;  5C71 A;  2X10 A;  3OBA A;  4ARY A;  2WO3 A;  2E33 A;  1GOH A;  4MGQ A;  4BJ0 A;  2W1U A;  3CZU A;  2VZP A;  3T08 A;  4GWI A;  5EJZ B;  1GOG A;  4GWJ A;  4W4Z A;  2QQN A;  3DYP A;  3T09 A;  1SDD B;  2ZEY A;  1JZ7 A;  4OUE A;  1OF4 A;  1OH4 A;  3IB3 A;  3WNM A;  5JUV A;  1IQD C;  2VZ1 A;  1K12 A;  4MOA A;  2R7E B;  2VMD A;  3DYM A;  4XVH A;  4P08 A;  3THD A;  2VCA A;  3WNL A;  3FHQ A;  4P02 B;  1UY1 A;  3UES A;  2EID A;  3DEC A;  2C26 A;  1H6X A;  4KWU A;  3C7H A;  2W92 A;  3PUI A;  1UYZ A;  2LW8 A;  2Y6L A;  2VMC A;  1GMM A;  2ID4 A;  4DXR A;  4KMQ A;  3SEP A;  5JXI A;  1JZ5 A;  3C7O A;  4FI9 A;  2QQK A;  3VDC A;  4A6O A;  4XUP A;  2WN3 A;  2XOM A;  2YFZ A;  3MBW A;  4MO3 M;  5EJ1 B;  3HOB A;  2B9V A;  4PQQ A;  1DYO A;  2CDO A;  5JXG A;  3IDA A;  3A22 A;  1W9T A;  4ZXE A;  5LA1 A;  2W94 A;  2W1Q A;  1T2X A;  5JXH A;  3WEZ A;  3U37 A;  1K42 A;  2JD9 A;  2HLE A;  3ACF A;  4ZZ8 A;  1JYN A;  4RN5 A;  4P5Y A;  4QB2 A;  3T0B A;  4BXS V;  4CU8 A;  3MV1 1;  4E8D A;  3FL7 A;  5CYY A;  3WF4 A;  1US2 A;  4YPJ A;  3ETP A;  4HG6 B;  3NJX A;  3SKV A;  4OMD A;  3ACI A;  1WCQ A;  2QQM A;  3LPF A;  5JMO A;  4JHZ A;  1RYY A;  1PMJ X;  4ZZ5 A;  2J1A A;  3I2J A;  2Y8K A;  2OKX A;  4JX0 A;  3D3A A;  3WQB A;  2EIE A;  1W9S A;  2BZD A;  4CUC A;  1JYX A;  1JZ4 A;  1HN1 A;  2E32 A;  3K4D A;  2V72 A;  1MPX A;  2VQU A;  5LCW L;  3C7F A;  3NJV A;  1K3I A;  3LEK A;  2EIB A;  2J7M A;  2W1S A;  5JXJ A;  5G05 L;  2J22 A;  3K77 A;  4LHS A;  5LA2 A;  2JKX A;  1LNS A;  3VD7 A;  2Y64 A;  3K4A A;  3BN6 A;  4QPW A;  2VZO A;  4DXT A;  2QBX A;  3FHA A;  3K4Z A;  1UMH A;  1KGY A;  2W91 A;  2VOT A;  3CIH A;  2BGP A;  4A4A A;  1NX9 A;  4CU7 A;  1P8J A;  5IHR A;  1JU3 A;  2Y6J A;  2ZEZ A;  2VZS A;  3III A;  1XNT A;  3CDZ B;  4ET7 A;  4JKL A;  2RVA A;  2X05 A;  1UXX X;  2PQS A;  4OMC A;  1L7Q A;  5J1X A;  2WYS A;  5DQ0 A;  1OD3 A;  3DYO A;  1OT5 A;  1O8P A;  2VJX A;  5I0D A;  5CZK A;  2VZR A;  3NNG A;  4E8C A;  4XUO A;  1NUK A;  4AAX A;  3WF1 A;  4CVU A;  3OB8 A;  1UY3 A;  1K45 A;  3OGS A;  2WO2 A;  1TG7 A;  3I2H A;  5B4X A;  3WNP A;  1ULO A;  3VD5 A;  3CKH A;  4XUT A;  3SKJ E;  2XQX A;  1UY0 A;  3NRU A;  1DLC A;  4L0P A;  4LKS A;  5C7G A;  4OZO A;  1XPW A;  5A1A A;  4DUX A;  5JR2 A;  2ZEX A;  1W9W A;  1DP0 A;  4UOJ A;  4IUG A;  3OEB A;  2WN2 A;  1JYV A;  4KI5 M;  4Z2A A;  1UZ0 A;  2QQI A;  3AC0 A;  3T0D A;  2VR4 A;  3VD4 A;  1TVG A;  1D7P M;  3T2O A;  3I2I A;  1UWW A;  4M4P A;  5IFT A;  2YC2 A;  1WKY A;  5DPN A;  2XHN A;  5B4N A;  2ZEW A;  1UXZ A;  1O8S A;  3GM8 A;  2EIC A;  4BK5 A;  1J84 A;  2QQO A;  3K46 A;  3W5M A;  2J1S A;  4QX2 A;  4UAP A;  2DDU A;  1UMI A;  4W8J A;  4P00 B;  3LPG A;  4TXW A;  3ACH A;  3LEG A;  5FUI A;  2L9L A;  3WNK A;  4A44 A;  2Z4F A;  3UET A;  2WDB A;  2VZ3 A;  3ZM8 A;  1W8N A;  3WF3 A;  4QX0 A;  4DUV A;  2DCJ A;  3LQC A;  2W95 A;  3IAP A;  5IFP A;  2VZT A;  1XC6 A;  3JXS A;  1CZT A;  4D0Q A;  3HPN A;  2VL4 A;  4TTG A;  4QB6 A;  2YC4 A;  4JKK A;  3CMG A;  3HNY M;  2JDA A;  1JI6 A;  1R64 A;  2V4V A;  3F2Z A;  3W5N A;  3MO4 A;  2E31 A;  2VZQ A;  1GUI A;  4XZU G;  2VTF A;  1SHW B;  1UY4 A;  2DCK A;  1GU3 A;  2ORZ A;  3ECQ A;  1W99 A;  2VCB A;  1XNA A;  4QDQ A;  4PT6 A;  1I5P A;  2W87 A;  2YG0 A;  4UI9 L;  1NAE A;  1UY2 A;  4JKM A;  4AG4 A;  1L7R A;  3WNN A;  2CDP A;  1GNY A;  4QX3 A;  3WF0 A;  3VDA A;  2RJ2 A; 
#chains in the Genus database with same CATH topology
 1MZ6 A;  3H9A A;  2JG9 B;  4XJA A;  3PUA A;  2E53 A;  3C7E A;  1OF3 A;  3THT A;  4HKW A;  1W8O A;  2BUK A;  1ZRE A;  1PGL 1;  4PIY A;  5J7M A;  2P17 A;  2G1M A;  3I7D A;  5LK5 A;  1W6O B;  2VQT A;  2PHL A;  2CTV A;  4BZ4 A;  2SBA A;  3MW4 A;  4BA6 A;  2J1V A;  3CJI B;  2ARC A;  2PHU A;  1JUH A;  3AMQ A;  3WG1 A;  1PGW 2;  5CVR A;  4GZ9 A;  2RG4 A;  1ZRI A;  2WT0 A;  3KCY A;  3AMN A;  3MI8 A;  3IMM A;  1VB2 A;  4B1M A;  1CAU B;  3KV4 A;  4IE6 A;  4UF0 A;  4ITC A;  3GDB A;  3HD8 B;  4RS5 C;  5K8S A;  2JB8 A;  3NMB A;  3ZXJ A;  2A6V A;  3ALQ A;  1NCQ A;  4RQP A;  2BBA A;  1FI2 A;  5LY2 A;  1OUR A;  5BXX A;  3TEW A;  2A6Z A;  3H3L A;  1CX1 A;  2ORX A;  1DLL A;  4Q5O A;  2QTW B;  4HSJ A;  3VBH C;  4IGP A;  1OHF A;  3EHK A;  4CDX C;  2WAA A;  1CZS A;  1SMV A;  1YYN A;  2W52 A;  3ST7 A;  2UWC A;  1SAC A;  4GAZ A;  5EYY A;  2UWB A;  3ABZ A;  4BOW A;  2ZAC A;  1UU5 A;  1RUI 3;  4H2A A;  3I2K A;  2A73 B;  1FNZ A;  2EAL A;  3R05 A;  2R6Q A;  1UYX A;  4LO7 A;  1XOY A;  2YGM A;  4JTO A;  2HEY F;  4N43 A;  3WQ0 A;  4CTE A;  1REE A;  3J7N A;  3PNA A;  5C8W A;  2RE9 A;  4YW4 A;  5IJR A;  4FAH A;  1CPN A;  5J3U A;  5F3C A;  3UNP A;  1Y9Q A;  1SFY A;  4QAW A;  4D7Y A;  2JEM A;  2W3J A;  3H50 A;  4ASK A;  1ZRD A;  3CZJ A;  4LJH A;  1C5H A;  4J1W A;  4AEJ A;  5A7O A;  2F17 A;  3H3Z A;  2WFF 2;  1QNW A;  2IXL A;  1NCR C;  4XUQ A;  1QJX 3;  2Y6K A;  1UIK A;  3C8X A;  4MGI E;  5E16 A;  1NLR A;  2GMM A;  5T3N A;  3S7I A;  2W9X A;  2WR9 A;  2D97 A;  3BPZ A;  2K0G A;  2BGC A;  4A7Y A;  3OCP A;  5KXD A;  4DMI A;  1VMH A;  1JZ2 A;  4N53 C;  4XFA A;  1E5H A;  4XQW A;  3RPQ A;  3JBG 3;  1BCX A;  4CYD A;  2R49 A;  4NVP A;  2YC0 A;  2CGN A;  1F4A A;  2ZHK A;  1KIT A;  2XXZ A;  4RYD A;  5C4W B;  1HRI 3;  4NHL A;  4EZH A;  1SPP A;  2OX0 A;  3O1U A;  3VL9 A;  4HPK A;  2HYK A;  1F4H A;  3VD3 A;  3OEA A;  2EF6 A;  1BKZ A;  1GZW A;  3BCW A;  4Q4W 1;  5FUP A;  5F7U A;  2HWE 3;  1MR5 A;  1MS8 A;  4XTM A;  3ZN5 A;  2ZGN A;  1RIN A;  2XHK A;  2GN7 A;  4XJW A;  4CE8 A;  2TEP A;  3T4V A;  2XJV A;  2PHD A;  1TMF 2;  2VY0 A;  3U1X A;  1HX6 A;  4AVV A;  4L9B A;  4K8F A;  5FMD A;  5IK4 A;  5FP7 A;  2N7G A;  3BYW A;  3OGR A;  4RR3 B;  5DDJ 2;  2VM9 A;  1OLM E;  5CKQ A;  1VMF A;  2VC9 A;  4OFG A;  4K40 A;  1A6C A;  3I2G A;  2PMW B;  4PDW A;  4AHZ A;  3UKT A;  5EIY B;  1FYU A;  1RGS A;  1DGL A;  3RNS A;  3UYJ A;  1BHG A;  5J48 A;  3ZSL A;  3ROU A;  4R9C A;  1W0N A;  3I3M A;  3WHU A;  4C0B A;  2ZGQ A;  1PMH X;  5HPO A;  4AWD A;  3VDB A;  4PF1 A;  1LB2 A;  1RUD 1;  2B46 X;  5I8S A;  1QQP 1;  3B69 A;  2XLA A;  3HIF A;  4Y3O A;  4OYU A;  5FZ0 A;  4YFZ A;  4MAD A;  2D6L X;  3HJR A;  1LU1 A;  3QAC A;  4MET A;  3LDK A;  5FK7 A;  4W50 A;  4AYU A;  3BKZ A;  2P3K A;  2WRA A;  1KFX L;  1C57 A;  5HBA A;  5DG1 A;  3VBO C;  4GQ7 A;  1W6P B;  3QD6 A;  4S2H A;  3CQO A;  4BIF A;  4AHX A;  2RS3 2;  1CAW B;  4RGK A;  5D21 A;  1RUO A;  4ZS3 A;  5FYB A;  3OYW A;  3PVO A;  4FPH A;  3I49 A;  4LKD A;  1TZO A;  2W68 A;  1PGS A;  2NZ9 A;  1OXC A;  1RUG 2;  3CEW A;  3LFI A;  3H7Y A;  3KT1 A;  3QOP A;  5A7W A;  4ARY A;  4CXW A;  1U5I A;  1GOH A;  2QNK A;  3NV1 A;  1U0A A;  1S0C A;  2A71 A;  3NV3 A;  4FPY A;  2BOJ A;  3BVC A;  3R4U A;  5FXW A;  5H9Q A;  1UU4 A;  1VBE 1;  3IIA A;  2XL9 A;  3T08 A;  2I45 A;  4XBQ A;  4EV0 A;  5JLV A;  2DUO A;  4NPM A;  4GWJ A;  4W4Z A;  3DV8 A;  5FRA A;  2VTX J;  2DFB A;  3DYP A;  3KMH A;  5FZ9 A;  1LOF C;  3USU B;  4CDQ C;  4HLT A;  1UCX A;  2GME A;  5GLW A;  3SMH A;  4AFA A;  3M3I A;  2YPJ A;  4LIV A;  1HQW A;  5T5J A;  4WM7 B;  2WFF 3;  1X8E A;  1K12 A;  2FZ2 A;  1DQ0 A;  1HKD A;  1LEN A;  2Q1M A;  2RS1 2;  5GZD A;  4CEY C;  2R7E B;  3DYM A;  4V2V A;  3KF5 A;  3J26 N;  3H8O A;  4XDQ A;  2ZGM A;  4BCU A;  1C8M 2;  5F3G A;  4GB3 2;  1MEC 1;  3I3Q A;  4HXC A;  4EN8 B;  1V9U 3;  1CES A;  3W58 A;  2FZ1 A;  3EBR A;  2R0H A;  3FHQ A;  4LLO A;  3S30 A;  1RIT A;  3N9P A;  3BU0 A;  4XQ4 A;  4XJU A;  5A3P A;  3BTZ A;  3PTY A;  5JIU A;  2UYA A;  4JGZ A;  3C7H A;  2W92 A;  3VLB B;  3AJZ A;  4QPG A;  4ASL A;  1RUC 2;  1CAX B;  5JAX A;  5JPM B;  4Z92 B;  5GZE A;  5LB6 A;  3SH3 A;  1CIW A;  3B01 A;  1FOD 1;  1T6B X;  1ENQ A;  2QZ2 A;  4IGO A;  1XSQ A;  3O1R A;  4SBV A;  2VBD A;  3SEP A;  5J36 A;  5JXI A;  3MLL A;  5GLZ A;  4FVV A;  4IEU A;  5A7S A;  1W28 A;  4MG2 A;  1PGL 2;  1JZ5 A;  4IW3 A;  3C7O A;  1RUJ 1;  1IG3 A;  2R06 3;  1CX4 A;  3AZZ A;  3E6D A;  2PTM A;  4QKD A;  4LT5 A;  4XUP A;  3BAL A;  2Y0O A;  1DHK B;  1RJ7 A;  3MBW A;  4MO3 M;  2HWC 3;  2QE3 A;  2W0X A;  2WIN B;  4LHL A;  1AL2 1;  3SIT A;  4WM8 A;  1AYN 1;  1I9R A;  5JXG A;  3RI8 A;  3ILF A;  4XJ8 A;  3LGR A;  4KGQ A;  5D8A B;  3ZFF B;  5CFD B;  4XDO A;  1W9T A;  4OHW A;  5LA1 A;  2W94 A;  4NID A;  5IAT A;  4RSU A;  1POQ A;  5FMC A;  2DCZ A;  3MFC A;  3Q8C A;  3WEZ A;  3GCW A;  2CY6 A;  4LE3 A;  2B42 B;  5FWE A;  5GLV A;  2ZGL A;  4CPB A;  5FQ0 A;  4JDM A;  3HT1 A;  3H7J A;  5LRS A;  3QCW A;  2RDS A;  2ET1 A;  3ON7 A;  5SV5 A;  4CSW A;  1OMI A;  4QB2 A;  4YVS A;  4CU8 A;  1R08 1;  4IQP A;  4N9I A;  1ND3 B;  3ZYR A;  3HBZ A;  2IWG B;  2V4A A;  4YZ3 A;  1PVX A;  2WSV A;  5FPL A;  1US2 A;  2ERF A;  2Q5T A;  4TLG A;  2BNN A;  5FO7 B;  2RJL A;  4LO8 A;  3SKV A;  4OMD A;  1AX1 A;  3WQ7 A;  4URA A;  5JMO A;  4XIK A;  1W3X A;  5IT6 A;  5B2G B;  5T5L A;  1L7L A;  1PMJ X;  1RYY A;  2IUW A;  2D5F A;  2Y8K A;  4OCT A;  1RMU 1;  3H8U A;  5GLT A;  4XHX A;  1ONA A;  2RS3 3;  3ZFE C;  1S0F A;  1DGR N;  2BNO A;  2VNV A;  4NPR A;  5E89 A;  2I07 B;  1HN1 A;  5BNN A;  2FCU A;  4TSV A;  3ZSK A;  5FMB A;  3E97 A;  4XZP A;  2HJI A;  5C3O A;  3FBY A;  1RUG 3;  5CFC B;  5LCW L;  4IEO A;  5JOX A;  3HT2 A;  3LEK A;  2EIB A;  4WVM A;  3AZY A;  5FMO S;  2HWF 2;  2YV8 A;  1MZ5 A;  4K21 A;  2W1S A;  1PK6 A;  3AK0 A;  3MLJ A;  5G05 L;  3POS A;  4I02 A;  2BV4 A;  4J1X A;  4NRO A;  4XFH A;  2A3X A;  2YGL A;  4XTP A;  3WDV A;  1YQ8 A;  5JSR A;  1V6J A;  3VKM A;  1E5R A;  2J42 A;  4AVC A;  5CKM A;  2P37 A;  1QOS A;  2VZO A;  2RS1 3;  4DXT A;  3AKT A;  2E7T A;  4GMP 1;  5F1R A;  4DY3 A;  3UJO A;  4QQH A;  2QBX A;  1JTZ X;  1LOB A;  3FHA A;  3K4Z A;  4HFS A;  4Q4W 2;  4WZC A;  5EWS A;  4LBN A;  1VAL A;  3ZXD A;  5HI0 A;  1OA4 A;  5IHR A;  2Y6J A;  2D3S A;  3LDR A;  4EN0 A;  2VZS A;  3T3Y A;  1QMJ A;  2XGX A;  2BNM A;  4ET7 A;  3LAG A;  1K5M A;  5FLJ A;  3DKW A;  1DZR A;  3OPZ A;  4BME A;  2RM2 1;  1KD7 A;  2HEW F;  2X05 A;  4IE4 A;  1IOA A;  4AGR A;  2C6S A;  4QT6 A;  5C8C A;  5J1X A;  5TSW A;  3VKL A;  4BYY A;  3VBS A;  2QQW A;  3RMY A;  4QHB A;  2BDR A;  2G4I A;  3DXT A;  2BP6 A;  4X6R B;  2O1Q A;  2YPD A;  2JDH A;  3OD4 A;  1X7N A;  5I0D A;  1AL0 G;  4UYB A;  1QIQ A;  3VBU A;  3HAG A;  2CGO A;  2ARB A;  3MYX A;  4BQ1 A;  2BPA 2;  2WWJ A;  5BNO C;  4E8C A;  4XMA A;  3MF6 A;  4XUO A;  4A3X A;  2E6V A;  1XU1 A;  4G4F A;  2YHJ A;  2XJS A;  1QH7 A;  1W3V A;  3ZSE A;  2NLR A;  3F95 A;  3ILR A;  3TEY A;  5J98 B;  2Y38 A;  4OI2 A;  1S0I A;  1UY3 A;  3WDY A;  1OLQ A;  1UZZ A;  2GC0 A;  4D6Q A;  1TG7 A;  2WNU C;  3I2H A;  1RVF 3;  4DY5 A;  1ULO A;  1QQP 2;  3ZYJ B;  3BIW E;  3PVE A;  2MPF A;  3JU9 A;  4LTA A;  5M0T A;  3WVJ A;  1MS9 A;  2D40 A;  4UBH A;  2FBE A;  4JRL A;  1KXG A;  4AQ2 A;  4DXZ A;  4EQV A;  1DLC A;  2KM2 A;  1IG0 A;  1LUL A;  4XFC A;  3GJA A;  2GNT A;  1TQ5 A;  1RL3 A;  3PL0 A;  3VBR B;  4DUX A;  1GWL A;  1W9W A;  4YGC A;  5JR2 A;  3NWK A;  4K3U A;  4LUL A;  1YHF A;  3K3O A;  1WA4 A;  3AKP A;  3KVB A;  4KWK A;  2DF7 A;  2RDN A;  4Y4Y A;  3ZN6 B;  4FTE A;  1SLT A;  1OLR A;  2VOW A;  4IUG A;  1RHI 1;  4XFI A;  5I0R A;  3M2M A;  4KI5 M;  1NQD A;  1YI9 A;  2R04 3;  4YAR A;  1UZW A;  1HJG A;  2AEN A;  5CIR A;  5FPV A;  2EVX A;  1RTV A;  3E6C C;  2YUE A;  1AZD A;  1WMF A;  4W6X A;  4C8D A;  1WUV A;  3LA2 A;  3S6P A;  1DDL A;  1VBE 2;  2B39 A;  5BY5 A;  2DUQ A;  4E4H A;  4MXW A;  3L9J T;  4AHY A;  1J3R A;  3T2O A;  3VZK A;  4GWM A;  1UWW A;  3DUI A;  3CHX A;  4M4P A;  4PIX A;  4R52 A;  5A3T A;  4JHT A;  5IFT A;  1HW5 A;  1LEC A;  3U4X A;  3FHI B;  1MZF A;  1O91 A;  1DZQ A;  1HB1 A;  5FZG A;  5I8Y A;  3I8T A;  4Q0V A;  1UXZ A;  2JX9 A;  4IEQ A;  2DTY A;  5L19 A;  2PHR A;  4CDX A;  4UT5 A;  4Y22 B;  2GAU A;  3VHO A;  2Z69 A;  1J84 A;  2A5Z A;  2X5I B;  1JOB A;  1C5I A;  3K46 A;  1AVB A;  4C90 A;  1CWP A;  1XNC A;  2X53 S;  4LBQ D;  1JN2 P;  1GZT A;  3HMY A;  2IXI A;  1UX6 A;  2WWS A;  3M1H A;  3RZH A;  3LPG A;  4TXW A;  4EWA A;  4I01 A;  1AX2 A;  3ACH A;  1IKP A;  3WP6 A;  5FWJ A;  3FLT A;  4FOY A;  1UO9 A;  1MS1 A;  1VBA 3;  3UET A;  3KWV A;  4Y1U A;  3MPB A;  4AK3 A;  1FOD 2;  2ZX1 A;  4AI1 A;  3ZM8 A;  4V1P A;  2VG9 A;  3WIN E;  2ZMK A;  3U14 A;  5IWF A;  4KU8 A;  1NCR A;  4QX0 A;  1LR5 A;  2DCJ A;  4D6S A;  4H55 A;  3SHR A;  1RC6 A;  1HXS 3;  4XJ9 A;  5SV8 A;  1GIC A;  4AI3 A;  2JE9 A;  3AMM A;  1X36 A;  2VL4 A;  4N53 A;  4OVE A;  4JKK A;  1AYN 2;  2IVJ A;  1VBC 1;  1RUE 2;  4QKF A;  1YLL A;  5IAX A;  4TYS A;  4TWT A;  2V4V A;  2HWB 1;  3LOB A;  3W5N A;  3WUD A;  1XJA A;  3VGI A;  2E31 A;  2Q8O A;  1R1A 3;  4JGY B;  3WG3 A;  1GUI A;  2VD7 A;  3NKT A;  2OW4 A;  2ZX3 A;  5JZG B;  1SHW B;  3KM5 A;  3GZT B;  3APB A;  1S1A A;  1WCD J;  4IEX A;  3OGG A;  1S55 A;  2NMO A;  4QD2 A;  5JVV A;  5CB7 A;  3ZR5 A;  3NL1 A;  3DPR B;  4UI9 L;  4Y5S A;  1R08 2;  4XF9 A;  1O7F A;  1PNG A;  3O14 A;  2RJK A;  4CDU B;  1G9F A;  3N7M A;  4FP2 A;  1L7R A;  3I54 A;  2CDP A;  4C1X A;  3Q8E A;  4DNY A;  3ZKU A;  1RUD 3;  4QPG C;  4NWV A;  1PZ9 A;  1YQ6 A;  1MZE A;  4Z07 A;  3SH5 A;  1GYK A;  2RJ2 A;  3ZYP A;  4YSF A;  4CXY A;  1BMV 1;  1H6Y A;  3VHR A;  2MEV 1;  5C9A C;  2R16 A;  1YCI A;  4QGN A;  3QBQ A;  3FZ3 A;  1OKQ A;  2VTX A;  3NAP C;  1JZ3 A;  4LIU A;  2BGO A;  2VMG A;  2WFP A;  2YBP A;  1RMU 2;  4DZG A;  4OHV A;  2JE8 A;  3GNE A;  4MUV A;  1NYW A;  4PBP A;  3QH6 A;  1AXY A;  1UYP A;  4XUN A;  2AR6 A;  5A6X A;  1UKR A;  4Y26 A;  3RZM A;  4QQP A;  4UFM A;  1WA6 X;  2OQ6 A;  3A21 A;  4MYE A;  4AED A;  1V9U 1;  2VUC A;  1BEV 1;  4Q1P A;  3WUC A;  4XIO A;  3BOD A;  4M3C F;  4AVS A;  1NOV A;  4JDN A;  4BM8 A;  4ATE A;  2P3J A;  3VBF B;  5LRR A;  2V09 A;  1HLC A;  4LA3 A;  5GKA C;  1WLW A;  2WZE A;  3GGL A;  4E27 A;  5LBE A;  1U5Z A;  5FV3 A;  1GQP A;  3MGU A;  3POB A;  1UYY A;  3R0R A;  3NNF A;  3BGA A;  3LE0 A;  4AXO A;  3V65 A;  5T5P A;  3VBO A;  2D98 A;  4RR3 C;  1YQ2 A;  3FJS A;  4D8M A;  2WAB A;  4CCJ A;  2WBK A;  1JXN A;  1YEW A;  2YDE A;  3O0W A;  4Q2F A;  3PUR A;  3WP3 A;  1ULP A;  2FD8 A;  2B4K A;  2JJ6 A;  2MHF A;  4Z2W A;  1MEC 3;  2Y6G A;  4BMB A;  2LUW A;  2JD4 A;  1CAV A;  2FDK A;  3UT0 A;  1RUN A;  1BVV A;  4MH0 E;  1KS5 A;  2RM2 2;  3ZYI B;  5DAX A;  2JDM A;  3MEP A;  1RUH 1;  1FOD 3;  4KWJ A;  5G04 L;  1UOG A;  2WUH A;  4UF0 B;  5I0U A;  4AFD A;  2J1E A;  1LOA A;  4Y4R A;  4E2Q A;  1ULG A;  3ETQ A;  1U5X A;  4MGY E;  2YFU A;  3PTR B;  1NCQ B;  1RUJ 3;  4RQP B;  3LIG A;  1V6M A;  4CEY A;  1Z78 A;  2P34 A;  2VU9 A;  1XND A;  3KCX A;  5FZD A;  5FO9 B;  3KS7 A;  4OHZ A;  4FOQ A;  3AVR A;  4GUL A;  3K75 B;  1SLI A;  4COY A;  4I0B A;  1AL2 3;  1DYK A;  5A3W A;  4BK4 A;  1AYN 3;  5L9R A;  1D4V B;  5FJH A;  5I8T A;  2Y60 A;  5LEJ A;  3OPW A;  5C3R A;  1HV0 A;  5HV0 A;  1XQN A;  4FFF A;  4N43 B;  1WLT A;  5CNA A;  1AR6 3;  5LA9 A;  1APN A;  1EUU A;  2A75 A;  2LRP A;  1J3P A;  3PHM A;  2Q8E A;  3ES1 A;  4U36 A;  1WW7 A;  3K51 A;  4PF5 A;  1DIW A;  1TEI A;  1QJX 2;  2R30 A;  3PDQ A;  3KV6 A;  3ZYB A;  2WNV A;  3OBR A;  1VRB A;  4DEQ A;  1WGP A;  2NP0 A;  2VMF A;  3FLP A;  3NQH A;  1K5M C;  3AP6 A;  4AL9 A;  3CU7 A;  4Y20 A;  4K9S A;  5LAS A;  3WDU A;  1ENR A;  3AZX A;  1RHI 2;  4XIL A;  1CJP A;  3NKG A;  5F5C A;  4FPO B;  3RI9 A;  2DUP A;  2DTW A;  2VOV A;  4HMZ A;  4XF1 A;  3AKR A;  1ULF A;  3O1M A;  5GJ6 A;  4FSJ A;  4QDS A;  1GLH A;  3VBS C;  3ZXF A;  3N35 A;  2P2K A;  4A2U A;  1JYW A;  3N9L A;  4R9D A;  3GCX A;  4M4R A;  4M0H A;  3GXU A;  1OFN A;  1H4H A;  4G9S B;  4LBM A;  2AZ5 A;  2BJS A;  3I2F A;  2R1D A;  5A7P A;  2DYC A;  3E1F 1;  3NNL A;  3U4S A;  2PHF A;  2VCC A;  4LHN A;  4XMI A;  1QU0 A;  1H8T C;  4EYU A;  4QDR A;  5FYV A;  3UV9 A;  3ZVX A;  4J6G A;  2WZP P;  1GZW B;  2XVK A;  2J1U A;  1CQ9 A;  1D0H A;  2GC1 A;  3IAQ A;  5FZ6 A;  1CIY A;  5IK7 A;  1OA3 A;  1BK1 A;  2EXI A;  4I3P A;  4XAB A;  4AI8 A;  2P1B A;  4E4Z A;  4ERO A;  4CEW B;  5JOZ A;  3ZSM A;  2W1W A;  3T2Q A;  1SZB A;  4QWN A;  3I4I A;  2ZX2 A;  1GNZ A;  2JB4 A;  5JSO A;  2XKO A;  1XNB A;  3JB8 A;  2GC3 A;  1AYM 1;  1VPH A;  3V64 A;  5DZG A;  4UFK A;  3B7M A;  2VME A;  4L92 A;  1WD4 A;  2XH6 A;  5FYT A;  2OUH A;  3PJQ A;  4QPI B;  5D8A C;  5T54 A;  5I93 A;  2WO7 A;  1SCR A;  4BDV B;  2D6P A;  3VV1 A;  3ZFE A;  4IDZ A;  4GMP 3;  5L9B A;  2ZGT A;  2VZV A;  3KVA A;  1F35 A;  3ZDV A;  2E9Q A;  4LO4 B;  4YM0 A;  2X10 A;  4PDW B;  1Y4W A;  2WO3 A;  2QDR A;  5CKN A;  3M3Q A;  3MW2 A;  1H4G A;  4Q26 A;  2WA3 A;  2VZP A;  3CZU A;  3AMH A;  1JOJ A;  4GWI A;  1DF0 A;  1PVC 3;  3SCH A;  1LGN A;  3AFK A;  3UGG A;  1RVF 1;  2IVI B;  2QQN A;  2RM2 3;  1MAC A;  2Y26 A;  3CBN A;  2IFW A;  4O9G A;  4OUM A;  5JI9 A;  1KRI A;  4GH4 B;  1SDD B;  5GAL A;  1VBC 2;  1JZ7 A;  4OUE A;  1OF4 A;  4XF4 A;  4COZ A;  5IVC A;  2XJQ A;  3CL1 A;  3FLR A;  3IB3 A;  3NV2 A;  2CAU A;  5J96 B;  1IQD C;  1EYB A;  2G9F A;  4R4X A;  2HWB 2;  4Y33 A;  4NOT A;  4UFL A;  4FOV A;  1QOO A;  3ZIX A;  5EJ3 A;  3THD A;  3EMR A;  3AP5 A;  4MX3 A;  2BYV E;  2Z42 A;  2R04 1;  1UKG A;  3OYW B;  4P02 B;  4Y5T A;  5FK8 A;  4XF3 A;  2EID A;  3UES A;  3WNX A;  4B7K A;  1I1E A;  5FZO A;  3N36 A;  4YZ2 A;  2Y6L A;  3CLP A;  5F37 A;  4IV3 A;  5A7W B;  2VMC A;  1GMM A;  2ID4 A;  1BMV 2;  3ZR6 A;  2WA4 A;  3AL6 A;  4LXL A;  1GKB A;  3KZ4 C;  5F8P A;  1B35 C;  2GP3 A;  5JR7 B;  4NO4 A;  5E8A A;  3P3P A;  1SBE A;  4O7X A;  2E63 A;  4FI9 A;  2QQK A;  3OD0 A;  4FXG B;  1PM4 A;  2IXC A;  3RDI A;  4AAP A;  2OA2 A;  5DUW A;  4CP9 A;  4YVW C;  3TNP B;  2QQU A;  2XOM A;  2YFZ A;  3K2O A;  3ZSJ A;  4F8A A;  4QXC A;  1OH3 A;  3SQO A;  1RHI 3;  3HOB A;  3VB9 A;  1V9U 2;  1BEV 2;  4DRR A;  3IDA A;  1S2E A;  4XBN A;  4FPC A;  4CCL A;  4D94 A;  4ZXE A;  3H1M A;  4JDO A;  5JXH A;  4NPL A;  5T55 A;  3WT3 A;  1G9D A;  2WNU A;  1Q5O A;  1IKQ A;  3LD8 A;  1S0E A;  5IVB A;  3WP5 A;  2JKB A;  1VBA 1;  2R07 1;  4OUS A;  2PA7 A;  4RHV 1;  3U37 A;  4YM3 A;  2PLV 1;  1CGP A;  4OI0 A;  2HLE A;  2HKX A;  2XDV A;  2XLG A;  3FC0 A;  3ACF A;  5FBJ A;  1Q8O A;  5DZF A;  1AR9 1;  4CCM A;  3WW1 A;  2VVF A;  4RN5 A;  1HV1 A;  5I0T A;  4N8M A;  2JG8 B;  1V6N A;  5FYC A;  1ACC A;  1XYO A;  4E8D A;  3FL7 A;  1N3P A;  1HXS 1;  5CYY A;  4HK8 A;  3SNM A;  2JDK A;  3WF4 A;  1UPI A;  2R06 2;  4CCE A;  4YPJ A;  1POV 0;  2FMD A;  2ZZQ A;  3ETP A;  5A70 A;  3NJX A;  4IV1 C;  3VKF C;  4P9G A;  1UOB A;  4KBZ A;  5FY7 A;  5BNP C;  2HWC 2;  2Y0I A;  2F6B A;  5F39 A;  3WCS A;  2YBK A;  1DQ6 A;  1UN1 A;  4F83 A;  3IWZ A;  2NMN A;  4RL7 A;  3I2J A;  4ZZ5 A;  3PUQ A;  2Y6F A;  2XKP A;  1WLC A;  4ZPI A;  3D3A A;  3UGF A;  4WM8 B;  1LHU A;  1R1A 1;  5FY8 A;  1H1I A;  3PJY A;  3SC7 X;  3EQE A;  5I91 A;  2BZD A;  4CUC A;  1JYX A;  1JZ4 A;  4NRP A;  1OLM A;  2NN8 A;  3C3V A;  1RUH 2;  3MIF A;  2E32 A;  3VHN A;  3TBD A;  2V72 A;  1PZ8 A;  4AED C;  2VQU A;  2OPW A;  5FQ0 B;  2WQZ C;  2WLP A;  3NJV A;  1K3I A;  5FZ3 A;  2AYH A;  3BB6 A;  2BVB A;  2A6X A;  3QH7 A;  1ZBA 1;  1Z7S 1;  1UMZ A;  4YVS B;  4HL0 A;  4P14 A;  1EY2 A;  5FZC A;  2RDQ A;  4I0A A;  1W90 A;  2LAL A;  2J22 A;  2BW8 A;  2ZHL A;  1GNH A;  2D5H A;  4Z82 A;  3VZJ A;  1EPZ A;  1VBC 3;  3LA7 A;  3MW3 A;  3JD7 3;  3CJI A;  3VD7 A;  5AC9 3;  5ACA 1;  2HWB 3;  4XAA A;  5EYX A;  2FQP A;  4QPW A;  1W8W A;  1ST8 A;  5DZE A;  1BLZ A;  1DQ5 A;  3W59 A;  4D6R A;  2G19 A;  5IK8 A;  4AOC A;  3EJK A;  3CIH A;  5LWB A;  2BGP A;  3KQR A;  4A4A A;  4CU7 A;  3BTX A;  4AI2 A;  2WII B;  4E9K A;  2ZEZ A;  4O9E A;  4LIT A;  3CDZ B;  1IQA A;  3AKS A;  5BNN B;  1OQD A;  4CCN A;  1NZI A;  2XWB B;  2RHP A;  2A3Y A;  4FQ4 A;  4DS0 A;  5FLH A;  4CRQ A;  3A0K A;  2H6C A;  2PQS A;  1NT0 A;  4H7M A;  1L7Q A;  1Y9M A;  2OPK A;  4WVM B;  4ISR A;  3ZFG C;  1W2O A;  2MEV 3;  1O3T A;  2WYS A;  1HB4 A;  1AR7 1;  1S4C A;  2GN3 A;  1OD3 A;  1QY4 A;  1OT5 A;  2JIC A;  1PK6 B;  3K48 A;  1SFN A;  4IEZ A;  1UPS A;  2JEC A;  3RVH A;  3I2O A;  3Q8A A;  1X50 A;  1GQH A;  4GA9 A;  5DUU A;  2DU1 A;  4KNC A;  3IMN A;  3VHP A;  2VZR A;  5LBB A;  3OF1 A;  5HCB A;  3S0M A;  4QGM A;  4AAX A;  5KHH A;  4COV A;  5FRE A;  3G7D A;  2XJU A;  1BEV 3;  1RJ8 A;  4YZ1 A;  3U75 A;  1Z0H A;  1ASJ 3;  1DQ2 A;  4XHB A;  3THP A;  3Q8B A;  3A4U A;  3RZJ A;  2OII A;  4R4Z A;  3WNP A;  2ZAA A;  4L2N A;  1GFF 2;  4X8N A;  2XLF A;  2AAC A;  3R4S A;  1YJK A;  4HKO A;  1UNB A;  2EA7 A;  3LCP A;  5FY9 A;  5C9A A;  5EFU A;  4L0P A;  1AYM 2;  5AFB A;  3AP9 A;  2EXK A;  3LA3 A;  3NAP A;  2O8Q A;  4OZO A;  5LZ6 A;  2B8M A;  2ATF A;  1OQ1 A;  1EPW A;  1W2N A;  2WNV C;  2PHW A;  5C8C B;  4G3Y C;  4LO5 B;  1FAY A;  4N7U A;  4BQ5 A;  3RZG A;  2DFC A;  3OEB A;  3AXD A;  4JTN A;  4P9I A;  2WNE A;  4GAL A;  1A34 A;  4IE5 A;  2WN2 A;  3SLI A;  3VBU B;  2PAE A;  2QQI A;  4DO0 A;  3AC0 A;  1VMJ A;  4ZU5 A;  3GZE A;  1W8F A;  3DPR C;  2ZJC A;  2WC2 A;  2C1F A;  2AUY A;  1RVF 2;  1UL9 A;  4HK9 A;  2FCT A;  1AR6 1;  5ABJ C;  1FV2 A;  4AZZ A;  4CDW B;  4YFW A;  1L3J A;  1RUH 3;  3RMX A;  2YC2 A;  1PO1 3;  4OHY A;  1DG6 A;  1WKY A;  3TNQ A;  5DPN A;  5F32 A;  1ZBE 1;  5FYS A;  5FIX A;  4RR3 A;  1GQG A;  3ZXG A;  3PME A;  4LBL A;  1O8S A;  1V0A A;  2OZJ A;  3ZYF A;  4L8Q A;  5A32 A;  2EIC A;  1ND2 B;  2VUJ A;  4JVA A;  4Y5Z 0;  1VRH 3;  1Y9G A;  3KCC A;  3LOI A;  1D4M 3;  4TTG A;  2J1S A;  2RMU 3;  2R04 2;  4Q0S A;  1ZNP A;  4JRA A;  4P00 B;  2ZOE B;  1S0D A;  4R9B A;  3WNK A;  1OKO A;  2L9L A;  5L7O C;  4KU7 A;  4A44 A;  4AGG A;  4KWL A;  1PMI A;  2F4P A;  3K3N A;  2Y34 A;  1JYC A;  4IEV A;  2A6Y A;  2WDB A;  1OUX A;  2P6H A;  2VMI A;  4HBN A;  3RS6 A;  2EAK A;  4GIQ A;  5C5T A;  5KXE A;  4MXW B;  1G9C A;  2QVS B;  3WW4 A;  4YYO A;  2VOX A;  2R32 A;  4RS5 B;  1FT9 A;  4AQ6 A;  2ENR A;  3LQC A;  3Q9O A;  5AFE A;  1QOT A;  1GBG A;  5JSP A;  1ZRR A;  2VZT A;  2EXJ A;  1A3K A;  1W6P A;  4AFC A;  4D0Q A;  3HPN A;  1YFW A;  4YG0 A;  2WLQ A;  1CAW A;  1J58 A;  3MIB A;  4WVZ A;  4QB6 A;  2I74 A;  3AZW A;  1W6M A;  1YIF A;  3VBH B;  5ISL A;  3U10 A;  4CDX B;  2XL7 A;  1W6Q B;  2QJV A;  4QXB A;  3H1W A;  5H9P A;  3MO4 A;  2VZQ A;  4XYX A;  2DVA A;  2VTF A;  4XZU G;  1GU3 A;  4W6Y A;  3GBW A;  3V0A A;  1VBA 2;  2R07 2;  2ORZ A;  4RHV 2;  4AEK A;  2PLV 2;  1VAV A;  2ZGK A;  3RFR A;  1REF A;  4FBF A;  4PT6 A;  1AR9 2;  4QMA A;  3MIH A;  4HON A;  3USU A;  1LCL A;  3AP4 A;  4YW1 A;  1LES A;  1N1T A;  3S5Q A;  4JKM A;  4UW5 A;  2PQQ A;  1HXS 2;  2VE1 A;  4FPF A;  1EP0 A;  1GNY A;  1PVC 1;  4QX3 A;  1OC1 A;  4ZXK A;  3WF0 A;  4YGB A;  4IV3 C;  2UY9 A;  1SLB A;  2QZ3 A;  4R9A A;  2H6B A;  2D6K A;  3OUJ A;  3PUH A;  3WG4 A;  1WME A;  2ZAB A;  5CEH A;  2X09 A;  1AYM 3;  1KEX A;  2YB7 A;  3HR9 A;  4GXL A;  3VDD C;  1GOF A;  2VO5 A;  4N53 B;  3WLU A;  4ES8 A;  1SLA A;  2VCM A;  5FY5 A;  2WAO A;  1R1A 2;  1POV 3;  4FXK B;  4CUG A;  3O5S A;  1OOP C;  3HQX A;  4IL7 A;  2OUJ A;  1KJL A;  1ALY A;  3PVB B;  1NA1 B;  3TEZ A;  1G7Y A;  5FCC A;  5K0U C;  3SEE A;  3AB0 A;  1ZA7 A;  1YRZ A;  3HNB M;  5FP8 A;  2A3W A;  1DQ4 A;  1H8T A;  4NHK A;  5FYZ A;  3DL3 A;  1UZV A;  2JDZ A;  5FAX A;  4BQ4 A;  1O4T A;  4AE2 A;  3MPP G;  2OZ6 A;  4I09 A;  4RGA A;  4DXS A;  2ZGS A;  3LEI A;  4IXL A;  5IVF A;  4LBQ A;  5FZE A;  1ZBA 2;  3WF2 A;  1Z7S 2;  2DWR A;  2ZPX A;  1RUD 2;  3N7L A;  3POG A;  1YIP A;  3TN9 1;  5LY1 A;  1SCS A;  1W9F A;  4FP3 A;  2ARX A;  2IFR A;  5FZB A;  3WNO A;  4XQD A;  4CUA A;  3E6B A;  5DAB A;  1H1M A;  3D0J A;  4YG6 A;  3SIS A;  3WOG A;  1ZVF A;  3GBG A;  1PX4 A;  3UGH A;  2FCV A;  3IZO A;  5K4L A;  4FFI A;  1AJK A;  4BH9 A;  5ACA 2;  1A8M A;  1JBC A;  2B45 X;  5D8A A;  3ZFF A;  1US3 A;  2HH9 A;  1U5Y A;  3POF A;  2VUL A;  3J9S A;  4BPZ A;  2C9A A;  5JOY A;  2VUD A;  3TRS B;  5KHI A;  4QX5 A;  5FR3 A;  1O5L A;  3MLK A;  4B4P A;  3N7J A;  4IE7 A;  2VXJ A;  3DCQ A;  4XCA A;  1OFS A;  3C2U A;  3D6E A;  1F9K A;  1U12 A;  3VL8 A;  2DBN A;  1AHS A;  4K1Y A;  3WD5 A;  4LOT A;  1HDK A;  5K9Y A;  2XML A;  1ENS A;  3SCG A;  2CU5 A;  5CG9 A;  2Y6H A;  1MQT C;  1IHM A;  1ULD A;  3UKV A;  2WQ8 A;  1ND3 A;  3T30 A;  1JU4 A;  4PHZ A;  2D6N A;  2GND A;  2WZ8 A;  3J7H A;  4NRQ A;  3RZL A;  1AR7 2;  2C9K A;  1H30 A;  3KGZ A;  5ANQ A;  5FOJ B;  3WDT A;  2E7Q A;  3ACG A;  1PIV 1;  2JG9 C;  5ANN A;  2XVG A;  2VBP A;  5F2S A;  2WT2 A;  1F2N A;  1Q8Q A;  2YRO A;  4XW3 A;  1VBD 3;  3VBO B;  5BYN A;  4A41 A;  5FPZ A;  2ARA A;  4GWN A;  5F3E A;  1C1F A;  4S2G A;  4LA2 A;  4TZD A;  1MEC 2;  2LS6 A;  2ZX0 A;  1FX5 A;  2XR4 A;  1J83 A;  4DUW A;  1GP5 A;  1YWK A;  4NUB A;  3WY6 A;  4N90 A;  2J1R A;  4ONU A;  3O1T A;  5EP9 A;  2EXH A;  3CJI C;  1X82 A;  4RGG A;  4BQY A;  2TNF A;  2DU0 A;  4H3W A;  3T0A A;  2GH2 A;  3A23 A;  4I2O A;  3JCI A;  4KG8 A;  4RHV 3;  2R07 3;  3V0B A;  2PLV 3;  2UU8 A;  4LMF A;  3M8L A;  1B35 A;  1AR9 3;  5LBC A;  4QB1 A;  5FP4 A;  2WO1 A;  3H42 B;  4U2A A;  2WL1 A;  4FFH A;  1WCS A;  1V6K A;  2XJR A;  1NQJ A;  2E26 A;  2JEN A;  3C7G A;  1LOG A;  4CDQ B;  5LK7 B;  3A7Q A;  3ZPY A;  3RWN A;  1RUJ 2;  1N1V A;  2W39 A;  1ENX A;  2VZU A;  4GKX A;  5JWP A;  3R4D B;  2TBV A;  1R1Z A;  3X29 B;  4YVW A;  3OGV A;  2ZCW A;  1W6N A;  4CEY B;  3BI3 A;  4FO9 A;  1AL2 2;  4FTB A;  3AKQ A;  2JDY A;  1W8Z A;  2V5D A;  1MS5 A;  1JOD A;  5BV6 A;  3B5L B;  4LO6 B;  2VNG A;  3WDW A;  3JD7 1;  5H9S A;  5AC9 1;  3WW3 A;  1UX7 A;  3G6J B;  5HXM A;  1G9B A;  1A8D A;  5F6K A;  2QQL A;  5HCF A;  1AR6 2;  1YI7 A;  1MS3 A;  3PU3 A;  4O61 A;  4QPY A;  4ZY9 A;  1QEX A;  2WJS A;  2P4E A;  5KWR A;  1HN0 A;  4ZON A;  1KJR A;  3EB7 A;  3VZL A;  2Q0A A;  2YMZ A;  1SG3 A;  2XUE A;  4K6B A;  5A6Y A;  4CUB A;  1YO8 A;  1C4R A;  5EZW A;  4LPL A;  1ZBA 3;  4IV1 A;  1Z7S 3;  2ZKN A;  1C1L A;  5LA0 A;  3I59 A;  2JDP A;  3M3C A;  1GZ9 A;  5LBF A;  5BNP A;  4Q4Y 1;  1E5S A;  4Y1X A;  2ADE A;  3OOX A;  3AYA A;  2BVV A;  4PBO A;  1LTE A;  2OT7 A;  2BFU L;  3HN3 A;  1RXG A;  2HYX A;  2ZXQ A;  4FOW A;  5IUQ A;  4CP1 A;  3NVC A;  2K9Z A;  4DIN B;  5ACA 3;  1GV9 A;  2NM1 A;  5KHK A;  1LJ7 A;  1Q56 A;  1RUF 3;  1NY7 1;  5C4W C;  2BER A;  2ZZJ A;  2D7F A;  2VW1 A;  1WMD A;  5GZC A;  5A3M A;  3OBA A;  4LUK A;  4S2D A;  4YLZ A;  3W20 A;  3ME2 A;  5L9V A;  2AEZ A;  2VMH A;  1PO2 3;  1COV 3;  4MGQ A;  3RRD A;  1TNF A;  2VNO A;  2W1U A;  3VZN A;  3JZV A;  1ASJ 1;  5BPX A;  3ZOI A;  4BJ0 A;  5EJZ B;  4Q4V 2;  4LOR A;  2JG8 C;  2ZHM A;  5FY0 A;  3VBR A;  5IK5 A;  5CAZ A;  4AGV A;  4BIS A;  3AZV A;  2P6C A;  5DAP A;  2HEV F;  1FXZ A;  1QJE A;  4HVR A;  4LOS A;  3WG2 A;  3ZN6 A;  4Q29 A;  1Q43 A;  4AHW A;  1ZZB A;  1OH4 A;  4KH9 A;  1OQE A;  1AR7 3;  3WNM A;  5JUV A;  2JIG A;  2VZ1 A;  5FKB A;  3H8R A;  1EV1 3;  4MOA A;  3TB0 A;  3LIH A;  1Q8V A;  3IKW A;  1W0O A;  5FZF A;  1WW6 A;  3RQ0 A;  4NAO A;  4BQ3 A;  1YFX A;  4TLF A;  4HKL A;  3ZFE B;  1PNF A;  1UY1 A;  5FYH A;  2ZMN A;  5F9T A;  1W8U A;  2D44 A;  3DEC A;  1V00 A;  3GZU C;  3OY8 A;  4UWD A;  3PU8 A;  1C3H A;  3FMG A;  2CWM A;  4M3C A;  1IPS A;  1YQ5 A;  1AR8 3;  4KWU A;  3RYR A;  1UYZ A;  2YBS A;  1PVC 2;  2Z5W A;  4NHX A;  1OPM A;  5LW9 A;  4Q0P A;  4MSV A;  1OI6 A;  2D6O X;  3JUU A;  4DXR A;  2AGS A;  1CVN A;  2ETE A;  3ZFG A;  4S2F A;  4XXP A;  3CF6 E;  1PO1 1;  4NN0 A;  3MIC A;  4AEM A;  1K5J A;  1O3R A;  1D2S A;  1F5F A;  3VDC A;  3ZYG A;  5KBF A;  2CGP A;  4UW4 A;  4A6O A;  1T6G C;  1RIR A;  2WN3 A;  4N9H A;  5FXZ A;  2VNR A;  1OD5 A;  5EJ1 B;  4Q4V 1;  1VRH 1;  2D43 A;  3POE A;  1DYO A;  4PQQ A;  2CDO A;  1VIW B;  4EN9 B;  1JYT A;  1D4M 1;  4TN7 A;  2RMU 1;  2VUA A;  3J4U H;  3PLQ A;  4FT8 A;  3VKN A;  4YW2 A;  2ARE A;  2W1Q A;  1T2X A;  1V6O A;  3HWJ A;  4QQ2 A;  3NJZ A;  2BFU S;  4BXF A;  3TN9 2;  1IS5 A;  5FYI A;  2BBV A;  5APA A;  5C3S A;  2DVF A;  2JDU A;  2XG3 A;  4UBG A;  5FZO B;  4BQ2 A;  4ZZ8 A;  1JYN A;  2RS5 3;  4EWD A;  2DCY A;  3VZO A;  5FO8 B;  1W8T A;  1RED A;  5A33 A;  5A6Q A;  1ZBE 3;  5EHD A;  5FPA A;  1SBF A;  3M3E A;  1LHN A;  3EXU A;  1BZW A;  1JMU B;  1W03 A;  4WM7 C;  4Y24 A;  4HG6 B;  3UJQ A;  3T1M A;  1BBT 3;  3IN9 A;  1XE7 A;  4XAE A;  2QQV A;  4HAN A;  4XBL A;  3ZN4 A;  5A1L A;  4MVT A;  1LOD A;  4Q4X 1;  1XRU A;  1WCQ A;  1SFP A;  1HB3 A;  2JDN A;  4FQZ A;  4JZR A;  4NR1 A;  4BLI A;  2BWC A;  1ZYB A;  5IW0 A;  4Q1R A;  1XE8 A;  4SLI A;  1QXJ A;  5FYM A;  3DPR A;  2ZGO A;  2G9G A;  2UWA A;  3WQB A;  3KGL A;  1BYH A;  1S2K A;  3J7L A;  4MHR A;  4QGL A;  1URX A;  1D0G A;  3LEM A;  4Y1Z A;  1YFY A;  4ZU4 A;  4PLN A;  1LHV A;  3AFG A;  4LBO A;  4CDU A;  4Y1V A;  5ABJ A;  2P3Y A;  2PAM A;  4QU2 A;  2WNU B;  5JI7 A;  1MPX A;  1SPP B;  3HQR A;  1PZ7 A;  4H7L A;  2R0F A;  3WHT A;  1H9P A;  1V70 A;  3LB9 A;  4HPK B;  3ZX7 A;  2D3R A;  3N9M A;  5GLU A;  2IZW A;  4NAM A;  4XC9 A;  3RYP A;  1LKN A;  2Y33 A;  3DKQ A;  2GMP A;  1PIV 2;  2IC1 A;  2J7M A;  3E5U A;  1LHO A;  3IPV A;  1ZA4 A;  3WP4 A;  1FV3 A;  5EPA A;  3T2T A;  4YW5 A;  4YWA A;  1H0B A;  3FWE A;  2CYF A;  4A7K A;  4F3J A;  5A6Z A;  5LA2 A;  3WDX A;  5E88 A;  1YUD A;  3OBZ A;  3Q8F A;  4UXA A;  4J25 A;  2PN5 A;  3B94 A;  4XJZ A;  1LNS A;  2W2I A;  1GWK A;  2Y64 A;  1SBD A;  3BN6 A;  3TYJ A;  3KHB A;  1POV 1;  4YNI A;  3ZFF C;  4DOU A;  3L2H A;  4BLJ A;  5CFD C;  5L7O A;  4MLO A;  3HBK A;  4HVO A;  2OXB A;  3VBF A;  2IXK A;  4ES9 A;  1KGY A;  2XWJ B;  5KHJ A;  2VOT A;  2Q1Z B;  5FYY A;  4QX7 A;  2ZKL A;  3NJY A;  5JIA A;  3JB4 C;  4W65 A;  2E51 A;  4FFG A;  3CJX A;  3III A;  4UFH A;  4XOG A;  1VAK A;  2XPJ A;  4JKL A;  5C5U A;  4UFJ A;  5F2W A;  1W0P A;  5FZA A;  1UD1 A;  1AXZ A;  4WVV A;  2PFW A;  2NYY A;  1HRV 3;  4OMC A;  4QXH A;  1ND3 C;  3OBT A;  1ND2 C;  2RR1 1;  4OI1 A;  1QDO A;  4HN1 A;  3PUS A;  3LFM A;  3VN4 A;  3DYO A;  5FUN A;  4LK6 A;  3FUO A;  1XYP A;  3O7O A;  3JD7 2;  1O8P A;  5AC9 2;  2V73 A;  2WWU A;  4AW7 A;  2GNM A;  2XBO 3;  3H0O A;  5CZK A;  1Q3E A;  1G8W A;  1OUS A;  3N3H A;  5DUV A;  1WWY A;  3NNG A;  5EXO A;  4AF9 A;  4MGK E;  4HN0 A;  3RWK X;  3WF1 A;  1QWR A;  3J7M A;  1CJD A;  1VBB 1;  4CVU A;  1FPN 3;  5CU1 A;  1DFQ A;  4LEJ A;  3NO8 A;  5ERL A;  3OGS A;  1N3O A;  1S0B A;  1ZZ6 A;  3LDB A;  4R8H A;  2WO2 A;  4P5H A;  2YXS A;  5B4X A;  1TME 3;  3DXU A;  5CFC C;  3LKJ A;  4B1L A;  4E4D X;  1G9A A;  3CKH A;  3KQ4 B;  1FAT A;  3TN9 3;  1TE1 B;  5FOB B;  1Y7B A;  1ZZ7 A;  2XQX A;  4Q4Y 2;  4CCC A;  4M00 A;  3NRU A;  2WZR 3;  2MEV 2;  2ZGP A;  4QKB A;  1AUY A;  3SCF A;  4CZS A;  4LKS A;  4E2S A;  5C7G A;  1XPW A;  2WQ4 A;  2VXR A;  4QX8 A;  5A1A A;  3VDD A;  4BHP A;  2ZEX A;  3IBM A;  1ZZC A;  1DP0 A;  4PCR A;  4UOJ A;  5AVA A;  1OOP A;  4QM8 A;  1NY7 2;  5DG2 A;  3BIE A;  1VBD 1;  1F31 A;  3RJR A;  1BVP 1;  5K0U A;  1W2A X;  4K8R B;  3ITQ A;  4KG0 A;  5D1I A;  5F3I A;  1PM7 A;  3GBF A;  3OTF A;  3VKO A;  4Z2A A;  5HCA A;  1NXD 1;  1JYV A;  1H8V A;  1LED A;  2D93 A;  1TVG A;  2VW2 A;  4XEZ A;  1D7P M;  2NPI A;  1ASJ 2;  2QKD A;  3VD4 A;  2VPV A;  1LHW A;  4V2W A;  3NW4 A;  4DB5 A;  3SXW A;  1OBN A;  5C6C A;  1KDK A;  3I2I A;  3PIG A;  1QJU 1;  1LOE A;  3BTA A;  4MHU A;  2WS9 1;  3B00 A;  5T52 A;  1N1Y A;  4JGZ B;  5FY4 A;  2FDH A;  4QPG B;  1EAH 3;  4B7E A;  2Q4S A;  5B4N A;  1QKQ A;  1F8V A;  2HWF 1;  2ZEW A;  5C9A B;  3ZIW A;  1PIV 3;  1DGW X;  5C3Q A;  3KSC A;  1LOC A;  3NAP B;  1VE0 A;  1W04 A;  4BK5 A;  5FDB A;  4UFI A;  2GH8 A;  5JOW A;  3W5M A;  1UIJ A;  2ET7 A;  2OQ7 A;  1NA1 C;  1BXH A;  1MS4 A;  1R09 1;  4L97 A;  1UMI A;  4UAP A;  4W8J A;  3GJB A;  5T5O A;  5LEK A;  2B5H A;  1QJY 1;  3U0Z A;  1VR3 A;  3UL2 A;  4OUL A;  3WXP A;  1LU2 A;  1AJO A;  1XU2 A;  5HV4 A;  3VUO A;  3IDC B;  1MQT A;  1GR3 A;  4GD4 A;  1QJZ A;  5L73 A;  1J1L A;  3AM2 A;  3D82 A;  2BEO A;  4CEW A;  1PO1 2;  4AI9 A;  4DUV A;  5IVE A;  2H0B A;  4JCK A;  5FZ7 A;  5JPN B;  3IAP A;  5FZM A;  3ZPO A;  2JG9 A;  4HZF A;  4ZU7 A;  3ASI A;  1GAN A;  1GSL A;  1XC6 A;  3J8F 3;  1CZT A;  3GF6 A;  5FTT C;  3TWI A;  1WLD A;  4QPI A;  5I0S A;  3VBR C;  2FDI A;  2Z79 A;  3FX3 A;  4IE0 A;  3KV9 A;  4NHY A;  1H2K A;  1QJF A;  1VRH 2;  1O5U A;  2Q30 A;  3JQW A;  1YNA A;  1CR7 A;  5A32 B;  1D4M 2;  2X8K A;  3CMG A;  5FPB A;  2RMU 2;  1W6O A;  3DGT A;  3WR0 A;  2JDA A;  1JI6 A;  3TEX A;  2BWA A;  4OHX A;  4JV4 A;  3RZZ A;  4YRD A;  3OPT A;  3UK9 A;  3KB5 A;  4CXX A;  1UY4 A;  2AEY A;  2HWD 1;  2LRO A;  1H2M A;  1YJL A;  1RUF 1;  3ECQ A;  1W99 A;  2BTV C;  2VCB A;  4IEW A;  5D2A A;  5F6L B;  2IXJ A;  4D3W A;  4F7Z A;  1XNA A;  1CAU A;  1I5P A;  3GAL A;  3IDB B;  4I3G A;  2W87 A;  1LAJ A;  2D6M A;  5EV7 A;  5FYU A;  4ATF A;  2XJT A;  4GH4 A;  2DBI A;  1NAE A;  1PO2 1;  1COV 1;  4LUM A;  3W21 A;  1WW5 A;  1VLN A;  5FLI A;  4AI0 A;  2DUR A;  2FMY A;  4EZ4 A;  3EYP A;  2OS2 A;  3MUZ 1;  4Q4X 2;  2DVG A;  2FDJ A;  4A45 A;  2DVB A;  3AP7 A;  4Q4Y 3;  2GSY A;  4QX1 A;  4CP0 A;  1SLC A;  1UOF A;  4GKY A;  3TAY A;  2X5I C;  4CU6 A;  2J1T A;  1EV1 1;  1W6M B;  1RB8 G;  5IVJ A;  2A7A A;  4KQ7 A;  5HXV A;  4IGQ A;  1W05 A;  1IS6 A;  3WV6 A;  3N9O A;  2KXL A;  4MGS A;  1NLS A;  1NG0 A;  1WMX A;  3OSD A;  3WSO A;  1IZ3 A;  4NIA A;  1KFU L;  2AC1 A;  3O0V A;  3I3B A;  4YW7 A;  4QKN A;  3THC A;  4AFM A;  4AR2 A;  3V0A B;  4A42 A;  4HVQ A;  5FZ1 A;  4MGT A;  3RJ2 X;  4FTS A;  2GZW A;  2UYB A;  1UU6 A;  3A0N A;  1AR8 1;  4MGZ E;  3ZDS A;  1STM A;  3IDE A;  5LAT A;  4I0W B;  4P9W A;  1FNY A;  2GDF A;  2HBT A;  3AMP A;  4E4S A;  2GU9 A;  4QQL A;  5A7N A;  3LSE A;  1K5M B;  5DN2 A;  2XUM A;  1O6U A;  4ISQ A;  5IAV A;  1SLL A;  3VD9 A;  4IER A;  1EUT A;  2WNO A;  4YW3 A;  3I97 A;  3KT4 A;  1NKG A;  3E5X A;  2ZS6 B;  1J1T A;  3O1P A;  5H9R A;  2YY1 A;  2ILM A;  1GP4 A;  4ASM B;  3OUI A;  5BNQ A;  3ZXK A;  5C4W A;  5KR7 A;  3VBS B;  3DEM A;  1CN1 A;  4JGY C;  3HEI A;  4NIG A;  5JZG C;  5FMO L;  1Y3T A;  2NQY A;  3AYE A;  2QQJ A;  1DYP A;  5FBZ A;  5CAD A;  1O59 A;  1E57 A;  2BOI A;  4AVB A;  3IM0 A;  5A80 A;  4DRV A;  5C70 A;  3P5B A;  5CG8 A;  1OVS A;  5A1F A;  2K2S A;  3OJB A;  1H8T B;  1ULE A;  1BJQ A;  2JG8 A;  1VAM A;  3BOW A;  1B09 A;  3EO6 A;  4N7I A;  2AH2 A;  4KL1 A;  4CDU C;  5DMY A;  1XE0 A;  5IYY A;  2RR1 2;  5F5Q A;  4LBQ B;  4URT A;  2RS5 1;  3M3O A;  4JAA A;  1XNK A;  2VQ0 A;  4A7Z A;  4O65 A;  2PHT A;  1TMF 3;  4PQ9 A;  3MUY 1;  1CZV A;  1DGR A;  1X9T A;  2A1X A;  2ZGR A;  3T2P A;  4LE4 A;  3LWC A;  3S5A A;  3HNM A;  1W9Y A;  4A3Z A;  1BBT 1;  3P1I A;  1RUE 1;  1HQL A;  1XB9 A;  4Q4V 3;  5DDJ 3;  5FPU A;  3MV0 1;  1X9P A;  1VBB 2;  3OG2 A;  2C5D A;  2YU1 A;  1UF2 C;  3AJY A;  4HT1 T;  4X8P A;  2JIJ A;  4Y1Y A;  4B3N A;  4LKF A;  4BIO A;  3ZMO A;  5JDB A;  3ZXA C;  5FZ8 A;  5DAW A;  1PX3 A;  1ODM A;  2Z2S B;  4B8E A;  2C24 A;  3V56 A;  4QHO A;  1W8H A;  2PAK A;  1HJF A;  5GZF A;  2W46 A;  3VBF C;  3LSD A;  2QDN A;  1JHN A;  2JXA A;  3P6B A;  2ZTN A;  4FPE A;  3FN9 A;  5T50 A;  3U07 A;  4CU9 A;  4K1Z A;  3NNM A;  3ZXL A;  1JZ6 A;  5FXV A;  1ZZ9 A;  2UUR A;  1C28 A;  2IXH A;  4P9L A;  1E5I A;  4H14 A;  4I30 A;  4QHZ A;  2FDF A;  5KC6 A;  3NNJ A;  4WZF A;  4HOO A;  4JC1 A;  2RV9 A;  1M06 G;  1VBD 2;  2ZA9 A;  3O0X A;  3ZXE A;  5FZK A;  4K20 A;  4Q4X 3;  5FJK A;  1GP6 A;  1QH6 A;  3MIE A;  2TUN A;  3IT8 A;  5GM0 A;  2QQP A;  2KD7 A;  4IES A;  1FMD 1;  3BPS A;  1JOP A;  5FP3 A;  1JZ8 A;  1WW4 A;  4M01 A;  2PEL A;  3BU7 A;  3I3E A;  1M4W A;  2ES3 A;  3KF3 A;  3POW A;  3FE5 A;  3NV4 A;  2C4X A;  2CAV A;  1QJU 2;  2CSG A;  3D4K A;  4LKE A;  2ZML A;  2WS9 2;  2C0Z A;  1OA2 A;  4WV8 A;  1DGW A;  4ARX A;  4DEV A;  2CWS A;  4LR4 A;  3CO2 A;  2Q1F A;  1YQC A;  2BQP A;  4NWW A;  3RYK A;  3V0B B;  3HVD A;  2Q8D A;  1G6N A;  1GZC A;  3N9Q A;  1UW8 A;  1B35 B;  2XON A;  4WM7 A;  3I3D A;  3L2Y A;  1HRV 1;  1Q8P A;  4LQR A;  1NCR B;  2QFE A;  4PLO A;  1N1S A;  4OI4 A;  3ZMN A;  2W47 A;  4BB3 A;  4CCD A;  3RZK A;  1NCQ C;  4RQP C;  1F5J A;  1MS0 A;  4CCO A;  4Z8B A;  5A3U A;  1R09 2;  1X8M A;  4PIZ A;  3O1O A;  4CPB D;  4YVW B;  5BUV A;  1QJY 2;  1JHJ A;  4Q8K A;  1W6N B;  3W9A A;  4AQT A;  5KHG A;  2XBO 1;  3KHC A;  3ES4 A;  4Q8L A;  1IPK A;  3RG0 A;  1C8M 3;  4BE3 A;  3BTY A;  4GB3 3;  5FY1 A;  2W5F A;  2F4L A;  4XUR A;  5C71 A;  1CAX A;  5FKC A;  4N43 C;  2E33 A;  3ZYH A;  1FPN 1;  1ODN A;  2GC2 A;  4IND A;  4RD7 A;  3AYC A;  3O1S A;  4HSL A;  4MXV A;  3DF0 A;  4DQA A;  5CA6 A;  4FPJ A;  4PLM A;  1RUC 3;  1UAI A;  1GOG A;  1TME 1;  4IEY A;  4D7S A;  4A6S A;  3ATG A;  1F15 A;  3ORJ A;  1HIX A;  2BRT A;  2YU2 A;  2OYZ A;  2I2S A;  5E6H A;  3T09 A;  2ZEY A;  4LK7 A;  2ZHN A;  4XFB A;  2WZR 1;  2XJP A;  2RR1 3;  3I2D A;  4NHM A;  3VZM A;  4IV1 B;  4DFS A;  2FDG A;  3N9N A;  3I59 B;  5BNP B;  2WKK A;  3CNA A;  2W08 A;  3M7A A;  2VMD A;  3D0S A;  2HWD 2;  3M70 A;  4XVH A;  5FZI A;  5CFD A;  1JW6 A;  3O1V A;  1RUF 2;  2A6W A;  4P08 A;  3HQU A;  1UOJ A;  1RUI 1;  4ZHN A;  2G9Z A;  2VCA A;  3E5Q A;  4FPK A;  2O14 A;  4RA0 A;  3WNL A;  3BOP A;  1O4Y A;  3POI A;  4QU1 A;  4YGE A;  2CV6 A;  1VBB 3;  2K46 A;  4CDW A;  2C26 A;  1H6X A;  1PO2 2;  1COV 2;  2MNG A;  3B9I A;  3INA A;  5F5A A;  4NII A;  1X33 A;  2O8O A;  3D8C A;  3PUI A;  2LW8 A;  3SH4 A;  4AED B;  4K7J A;  4LLF A;  1GWM A;  5E1R A;  1IPJ A;  4XCB A;  1RXF A;  4KMQ A;  5A7Q A;  1ND2 A;  1QJX 1;  4P9J A;  2JWP A;  4CEW C;  1NE4 A;  3H8X A;  1ZRF A;  3B93 A;  3MID A;  1EAH 1;  4PI0 A;  4YM2 A;  1EV1 2;  4EN6 B;  2VH9 A;  1D2Q A;  4UW6 A;  1BQP A;  3ACL A;  1JS9 A;  4B29 A;  3H1Y A;  2YYO A;  2ZAH A;  3JBG 1;  4FPL A;  4QPI C;  4FPG A;  5C3P A;  1LEM A;  2B9V A;  4QQO A;  4MZU A;  4NJ4 A;  4UW3 A;  3USS A;  1UQX A;  3KD4 A;  3A22 A;  1HRI 1;  4OZX A;  3WX5 A;  2WT1 A;  1DQ1 A;  4LBJ A;  1NXM A;  4PDW C;  1AR8 2;  4RS5 A;  3AYD A;  5CFC A;  1H2L A;  1AX0 A;  3POY A;  1QGL A;  3WW2 A;  4P9Y A;  5DAV A;  4XFF A;  2O0O A;  3OY8 B;  2JD9 A;  1K42 A;  1KDM A;  1CAV B;  2HWE 1;  4IET A;  4M3C B;  5FFO C;  1JH5 A;  1QJU 3;  4PI2 A;  4CA9 A;  4XE9 A;  1S2B A;  2WS9 3;  3FBM A;  4QM9 A;  3ELN A;  4P5Y A;  3T0B A;  4XPV A;  4BU2 A;  4BXS V;  3VBH A;  4EWE A;  1Y43 B;  1SEF A;  3MV1 1;  4GH4 C;  3S57 A;  2D3P A;  3ZFG B;  1DZT A;  1W6Q A;  2HWF 3;  2XVL A;  3J8F 1;  4GMP 0;  4OQ9 A;  4AVA A;  3P3N A;  3ACI A;  5KC5 A;  4RFT 0;  5J09 A;  2QQM A;  3LPF A;  1C8N A;  2EIG A;  4JHZ A;  3MZH A;  2LTN A;  1UZY A;  2J1A A;  1G86 A;  1R09 3;  2OKX A;  4JX0 A;  3ENR A;  5DAQ A;  1QJY 3;  1W9S A;  2B7Y A;  2EIE A;  4EE2 A;  5IVY A;  4YGD A;  1JYI A;  4DIQ A;  2BU9 A;  1OVP A;  3M4F A;  4B4Q A;  4Q4W 3;  1O3S A;  3O12 A;  1IGO A;  2XB6 C;  3MFA A;  1O3Q A;  2PXJ A;  3K4D A;  1AXK A;  4BQW A;  3AX4 A;  2RS5 2;  5FZ4 A;  4LHK A;  1PGW 1;  3OGJ A;  3C7F A;  4XXA A;  3KT7 A;  4CCK A;  1IS4 A;  1N3Q A;  4KBB A;  4XAC A;  1ZBE 2;  1LRH A;  1CON A;  4WBB A;  5JMC A;  1DBN A;  2WYF A;  1WCU A;  2KA3 A;  2CNA A;  1CD3 G;  1J3Q A;  5A33 B;  5JXJ A;  1DCS A;  1NLQ A;  1BBT 2;  1JUI A;  2LM3 A;  5CBL A;  3BUC A;  1YXW A;  2WNV B;  1VJ2 A;  1WBF A;  3K77 A;  4LBK A;  2B9U A;  4LHS A;  1OPO A;  2JKX A;  3FFQ A;  1NA1 A;  3B9C A;  5CIS A;  2UY8 A;  4Y20 B;  4AFB A;  4C0H A;  1H2N A;  3K4A A;  1XXN A;  4KGG A;  4NE9 A;  4E2G A;  5K7P A;  1TNR A;  3B02 A;  1SDW A;  2SLI A;  2HWD 3;  3S7E A;  2VBB A;  5FXX A;  1UMH A;  2W91 A;  4BQX A;  4FCA A;  4XF0 A;  1NX9 A;  1IS3 A;  5A3O A;  3DN7 A;  1P8J A;  2P3I A;  3MDP A;  4AVT A;  1JU3 A;  4EN7 B;  2GP5 A;  3AL5 A;  4XFG A;  4NIH A;  1VP6 A;  5ABJ B;  4L11 A;  1XNT A;  1ZX5 A;  1NE6 A;  4GJY A;  4JGZ C;  3WCR A;  1XYN A;  1VB4 A;  3LZZ A;  1PHM A;  2RVA A;  4ZS2 A;  1N47 A;  1QQP 3;  2GNB A;  4OQ8 A;  1UXX X;  4RFR B;  3IPV B;  4PJY A;  1ZRC A;  3AVS A;  4Q0U A;  5DQ0 A;  2WFF 1;  2OVU A;  2E7A A;  1FMD 2;  2RDR A;  3H3U A;  3URF A;  1YFU A;  1O4Z A;  1KQR A;  1S0G A;  2VJX A;  2ZBJ A;  2ZX4 A;  4OLL A;  1KS4 A;  2CHH A;  2DVD A;  4L99 A;  1QHD A;  3ZO0 B;  2YZ4 A;  1NUK A;  4NMI A;  4WM8 C;  1XBF A;  1A78 A;  1AF9 A;  5L7O B;  1QNY A;  5C33 A;  5HCH A;  3OB8 A;  4NRM A;  3HN1 A;  4D69 A;  1VBE 3;  2WSU A;  3T4H B;  4C1W A;  5FPX A;  5DUX A;  1S0J A;  3RGB A;  3PMS A;  3WZ1 A;  2QUO A;  3VD5 A;  4ZKT B;  1HRV 2;  3QLQ A;  5F5I A;  4XUT A;  3SKJ E;  1LGB A;  1UY0 A;  2QCS B;  3ZLI A;  2Q8C A;  4LNV A;  4YM1 A;  3U11 A;  4Y22 A;  4YVS C;  4HET A;  1HQN A;  2X5I A;  4FAG A;  2PHX A;  2A70 A;  1XSR A;  1V6L A;  2P5B A;  2R06 1;  3OUH A;  1TMF 1;  4JQR A;  1J59 A;  1I3H A;  2XBO 2;  4IEP A;  4M3C E;  4XDP A;  2HWC 1;  4GJZ A;  1QF3 A;  3LF7 A;  1QDC A;  2KR2 A;  5DDJ 1;  3D5O A;  1CPM A;  3R6S A;  1Q8S A;  1UZ0 A;  4YG3 A;  1FPN 2;  3T0D A;  2VR4 A;  2XQR A;  4YZ5 A;  4D7T A;  1V6I A;  2DV9 A;  5EQU A;  4BWO A;  3GYD A;  3GZA A;  1TME 2;  3MHZ A;  3FFZ A;  2EAA A;  5BNO A;  2VVE A;  1LOF A;  2VAU A;  3JQX A;  3POJ A;  4CDQ A;  5BNN C;  4B4R A;  4YW6 A;  5A3L A;  2WZR 2;  2CL2 A;  1WBL A;  2ZGU A;  1I5Z A;  4IV3 B;  1SQ4 A;  2XHN A;  3NST A;  1W06 A;  2VW0 A;  1W39 A;  3GM8 A;  3KV5 A;  4P9X A;  5JCT A;  3N4M A;  1W2U A;  2H0V A;  1PK6 C;  4M0N A;  2V5Y A;  1RUI 2;  2QQO A;  4W6W A;  3VDD B;  4CP2 A;  2DCT A;  2X29 A;  4MV2 A;  4JGY A;  4C91 A;  1RUE 3;  1YC6 1;  5JZG A;  1OOP B;  4QX2 A;  3PVN A;  4DPN A;  2DDU A;  5A3N A;  4CP9 B;  3MIG A;  3WQ1 A;  1ULC A;  5K0U B;  3FUQ A;  4X6Q B;  5BNO B;  3LEG A;  2RS3 1;  5FUI A;  1NZC A;  4QXK A;  2Z4F A;  5KXB A;  4XET A;  5L36 A;  1WD3 A;  1HB2 A;  4ORF A;  2VZ3 A;  1RUG 1;  1W8N A;  3ILN A;  3WF3 A;  1OSG A;  1R08 3;  1ZZ8 A;  2VQA A;  3MF9 A;  1EAH 2;  2FHR A;  2HBU A;  2W95 A;  1MVQ A;  3UKN A;  2VEC A;  5GZG A;  5IFP A;  4JQT A;  5FZH A;  5IVV A;  1H1A A;  3JXS A;  3ZKY A;  2VVD A;  1LGC A;  1MVE A;  3JBG 2;  4EJR A;  3U78 A;  1QXP A;  3N7K A;  4COW A;  2YC4 A;  5C8C C;  3AXE A;  3PIJ A;  1QXR A;  1I6X A;  4Z1V A;  3HNY M;  4AQS A;  1HRI 2;  4Q27 A;  1R64 A;  2GAL A;  5FP9 A;  3F2Z A;  1RMU 3;  4Q0Q A;  3B3Q E;  1FMD 3;  3RSJ A;  4COU A;  2RS1 1;  5J37 A;  2R1B A;  2DCK A;  3VBU C;  3KLS A;  2PYT A;  1DU3 D;  1H9W A;  1C8M 1;  4GB3 1;  4WVW A;  2HWE 2;  1WZX A;  4QDQ A;  5DXD A;  3TOJ A;  2YG0 A;  1MQT B;  2VOK A;  3GHN A;  2VGD A;  1UY2 A;  4YZ4 A;  4AG4 A;  4CDW C;  5FZL A;  5AVP A;  3WNN A;  2ADD A;  1RUC 1;  1BK0 A;  2JE7 A;  3GHM A;  3J8F 2;  5KXC A;  1W2T A;  3T1L A;  1ZM1 A;  3VDA A;  1K45 A;  1WCK A; 
#chains in the Genus database with same CATH homology
 1H6Y A;  3EYP A;  3MUZ 1;  3PUH A;  4A45 A;  3C7E A;  4QX1 A;  1OF3 A;  2X09 A;  1KEX A;  1JZ3 A;  2YB7 A;  1W8O A;  2BGO A;  4CU6 A;  1GOF A;  2VO5 A;  2J1T A;  2JE8 A;  2WAO A;  2VQT A;  4XUN A;  4MGS A;  3SEE A;  2J1V A;  3A21 A;  3HNB M;  3WSO A;  3I3B A;  3THC A;  4GZ9 A;  4A42 A;  4DXS A;  3LEI A;  2WZE A;  3GGL A;  3WF2 A;  3GDB A;  1GQP A;  1UYY A;  3WNO A;  4CUA A;  2BBA A;  3BGA A;  3LE0 A;  5DN2 A;  3VD9 A;  1CX1 A;  1PX4 A;  2ORX A;  1EUT A;  1YQ2 A;  3I97 A;  4D8M A;  2WAB A;  1US3 A;  1NKG A;  2WBK A;  2WAA A;  1CZS A;  1ULP A;  2B4K A;  3ABZ A;  3HEI A;  3I2K A;  1UYX A;  2Y6G A;  2QQJ A;  1O59 A;  5IJR A;  5C70 A;  3UNP A;  2Y6H A;  2WQ8 A;  4QAW A;  2W3J A;  1JU4 A;  3CZJ A;  2WZ8 A;  3J7H A;  5DMY A;  5IYY A;  5G04 L;  2C9K A;  2WUH A;  4XUQ A;  2Y6K A;  2J1E A;  3C8X A;  2W9X A;  3ACG A;  2YFU A;  3MUY 1;  1CZV A;  3T2P A;  1JZ2 A;  3HNM A;  4A3Z A;  4A41 A;  3P1I A;  3K75 B;  3MV0 1;  2LS6 A;  1F4A A;  4BK4 A;  3OG2 A;  1J83 A;  4DUW A;  4RYD A;  2J1R A;  1PX3 A;  1F4H A;  3VD3 A;  3OEA A;  3T0A A;  3A23 A;  1EUU A;  2W46 A;  5F7U A;  3P6B A;  3FN9 A;  4CU9 A;  4QB1 A;  2WO1 A;  4DEQ A;  3C7G A;  1JZ6 A;  2E26 A;  2VMF A;  3A7Q A;  3NQH A;  2VZU A;  2RV9 A;  3OGV A;  3OGR A;  2VM9 A;  2VC9 A;  2V5D A;  4QDS A;  2KD7 A;  1JYW A;  1UX7 A;  3I2G A;  1JZ8 A;  4M4R A;  5HXM A;  3GXU A;  5EIY B;  3I3E A;  2QQL A;  3I2F A;  4ZY9 A;  2C4X A;  3E1F 1;  1BHG A;  2VCC A;  1W0N A;  4QDR A;  4ARX A;  3EB7 A;  4DEV A;  1SG3 A;  1PMH X;  2J1U A;  5HPO A;  3IAQ A;  3VDB A;  1CIY A;  4PF1 A;  4CUB A;  2XON A;  4LPL A;  2W1W A;  4OYU A;  3I3D A;  3T2Q A;  4LQR A;  3HJR A;  4MAD A;  5LA0 A;  2W47 A;  4W50 A;  3HN3 A;  2VME A;  2HYX A;  2ZXQ A;  3CQO A;  1JHJ A;  4BDV B;  2BER A;  2VZV A;  2W5F A;  4XUR A;  5C71 A;  2X10 A;  3OBA A;  4ARY A;  2WO3 A;  2E33 A;  1GOH A;  4MGQ A;  4BJ0 A;  2W1U A;  3CZU A;  2VZP A;  3T08 A;  4GWI A;  5EJZ B;  1GOG A;  4GWJ A;  4W4Z A;  2QQN A;  3DYP A;  3T09 A;  1SDD B;  2ZEY A;  1JZ7 A;  4OUE A;  1OF4 A;  1OH4 A;  3IB3 A;  3WNM A;  5JUV A;  1IQD C;  2VZ1 A;  1K12 A;  4MOA A;  2R7E B;  2VMD A;  3DYM A;  4XVH A;  4P08 A;  3THD A;  2VCA A;  3WNL A;  3FHQ A;  4P02 B;  1UY1 A;  3UES A;  2EID A;  3DEC A;  2C26 A;  1H6X A;  4KWU A;  3C7H A;  2W92 A;  3PUI A;  1UYZ A;  2LW8 A;  2Y6L A;  2VMC A;  1GMM A;  2ID4 A;  4DXR A;  4KMQ A;  3SEP A;  5JXI A;  1JZ5 A;  3C7O A;  4FI9 A;  2QQK A;  3VDC A;  4A6O A;  4XUP A;  2WN3 A;  2XOM A;  2YFZ A;  3MBW A;  4MO3 M;  5EJ1 B;  3HOB A;  2B9V A;  4PQQ A;  1DYO A;  2CDO A;  5JXG A;  3IDA A;  3A22 A;  1W9T A;  4ZXE A;  5LA1 A;  2W94 A;  2W1Q A;  1T2X A;  5JXH A;  3WEZ A;  3U37 A;  1K42 A;  2JD9 A;  2HLE A;  3ACF A;  4ZZ8 A;  1JYN A;  4RN5 A;  4P5Y A;  4QB2 A;  3T0B A;  4BXS V;  4CU8 A;  3MV1 1;  4E8D A;  3FL7 A;  5CYY A;  3WF4 A;  1US2 A;  4YPJ A;  3ETP A;  4HG6 B;  3NJX A;  3SKV A;  4OMD A;  3ACI A;  1WCQ A;  2QQM A;  3LPF A;  5JMO A;  4JHZ A;  1RYY A;  1PMJ X;  4ZZ5 A;  2J1A A;  3I2J A;  2Y8K A;  2OKX A;  4JX0 A;  3D3A A;  3WQB A;  2EIE A;  1W9S A;  2BZD A;  4CUC A;  1JYX A;  1JZ4 A;  1HN1 A;  2E32 A;  3K4D A;  2V72 A;  1MPX A;  2VQU A;  5LCW L;  3C7F A;  3NJV A;  1K3I A;  3LEK A;  2EIB A;  2J7M A;  2W1S A;  5JXJ A;  5G05 L;  2J22 A;  3K77 A;  4LHS A;  5LA2 A;  2JKX A;  1LNS A;  3VD7 A;  2Y64 A;  3K4A A;  3BN6 A;  4QPW A;  2VZO A;  4DXT A;  2QBX A;  3FHA A;  3K4Z A;  1UMH A;  1KGY A;  2W91 A;  2VOT A;  3CIH A;  2BGP A;  4A4A A;  1NX9 A;  4CU7 A;  1P8J A;  5IHR A;  1JU3 A;  2Y6J A;  2ZEZ A;  2VZS A;  3III A;  1XNT A;  3CDZ B;  4ET7 A;  4JKL A;  2RVA A;  2X05 A;  1UXX X;  2PQS A;  4OMC A;  1L7Q A;  5J1X A;  2WYS A;  5DQ0 A;  1OD3 A;  3DYO A;  1OT5 A;  1O8P A;  2VJX A;  5I0D A;  5CZK A;  2VZR A;  3NNG A;  4E8C A;  4XUO A;  1NUK A;  4AAX A;  3WF1 A;  4CVU A;  3OB8 A;  1UY3 A;  1K45 A;  3OGS A;  2WO2 A;  1TG7 A;  3I2H A;  5B4X A;  3WNP A;  1ULO A;  3VD5 A;  3CKH A;  4XUT A;  3SKJ E;  2XQX A;  1UY0 A;  3NRU A;  1DLC A;  4L0P A;  4LKS A;  5C7G A;  4OZO A;  1XPW A;  5A1A A;  4DUX A;  5JR2 A;  2ZEX A;  1W9W A;  1DP0 A;  4UOJ A;  4IUG A;  3OEB A;  2WN2 A;  1JYV A;  4KI5 M;  4Z2A A;  1UZ0 A;  2QQI A;  3AC0 A;  3T0D A;  2VR4 A;  3VD4 A;  1TVG A;  1D7P M;  3T2O A;  3I2I A;  1UWW A;  4M4P A;  5IFT A;  2YC2 A;  1WKY A;  5DPN A;  2XHN A;  5B4N A;  2ZEW A;  1UXZ A;  1O8S A;  3GM8 A;  2EIC A;  4BK5 A;  1J84 A;  2QQO A;  3K46 A;  3W5M A;  2J1S A;  4QX2 A;  4UAP A;  2DDU A;  1UMI A;  4W8J A;  4P00 B;  3LPG A;  4TXW A;  3ACH A;  3LEG A;  5FUI A;  2L9L A;  3WNK A;  4A44 A;  2Z4F A;  3UET A;  2WDB A;  2VZ3 A;  3ZM8 A;  1W8N A;  3WF3 A;  4QX0 A;  4DUV A;  2DCJ A;  3LQC A;  2W95 A;  3IAP A;  5IFP A;  2VZT A;  1XC6 A;  3JXS A;  1CZT A;  4D0Q A;  3HPN A;  2VL4 A;  4TTG A;  4QB6 A;  2YC4 A;  4JKK A;  3CMG A;  3HNY M;  2JDA A;  1JI6 A;  1R64 A;  2V4V A;  3F2Z A;  3W5N A;  3MO4 A;  2E31 A;  2VZQ A;  1GUI A;  4XZU G;  2VTF A;  1SHW B;  1UY4 A;  2DCK A;  1GU3 A;  2ORZ A;  3ECQ A;  1W99 A;  2VCB A;  1XNA A;  4QDQ A;  4PT6 A;  1I5P A;  2W87 A;  2YG0 A;  4UI9 L;  1NAE A;  1UY2 A;  4JKM A;  4AG4 A;  1L7R A;  3WNN A;  2CDP A;  1GNY A;  4QX3 A;  3WF0 A;  3VDA A;  2RJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...