2VZQA

C-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa in complex with digalacturonic acid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Amycolatopsis orientalis
total genus 23
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzqA00
4XUQA 1XPWA 2VMDA 4AAXA 2R7EB 3CZJA 3HN3A 2VTFA 2CDPA 3T0AA 2WAAA 1ULOA 4GWIA 1UY1A 2BERA 3CIHA 1UMHA 4OUEA 4ZXEA 2ZXQA 3WNPA 4KWUA 5C7GA 2ZEWA 5HPOA 4QAWA 3HEIA 1W9SA 1JYWA 2VZQA 3C7HA 4CU8A 4KI5M 1WCQA 3C8XA 3MUY1 3LE0A 2J1EA 4M4PA 3I2FA 2VQTA 2WZ8A 1GNYA 3ETPA 3ECQA 2JE8A 2QQJA 2VM9A 4DXRA 1TVGA 4JKLA 3BN6A 1OF4A 4Z2AA 2E32A 3ZM8A 2JD9A 3I2GA 4UAPA 3GXUA 4DUWA 2ORXA 1JZ7A 3GGLA 3J7HA 1W8OA 1UMIA 2WBKA 2YB7A 3WF0A 3ACHA 3MO4A 3FHAA 4QB1A 4PT6A 1JU3A 2QQIA 1J84A 1W0NA 3CZUA 2W95A 1IQDC 2Z4FA 2J22A 2W1SA 3PUIA 4JKKA 4AG4A 2BZDA 1O8PA 4QX0A 2YC2A 1OD3A 3C7EA 3VD5A 3K4AA 3IAPA 3OB8A 4MADA 2EIBA 4QDRA 2Y6KA 2YG0A 2RV9A 3WNLA 2B9VA 2X09A 3VD4A 1H6XA 2ID4A 1GOHA 3PUHA 2QQLA 4DEVA 5LA2A 1PMHX 4DXTA 3T2OA 3K4DA 1WKYA 3I2HA 4QPWA 5I0DA 5C70A 1XC6A 3HPNA 3NJXA 5JXGA 4CU6A 2WAOA 4LQRA 4P5YA 5G04L 2DDUA 4RYDA 2X10A 2BBAA 3GDBA 2WQ8A 1YQ2A 3WNMA 2J1UA 4QDQA 3T2QA 4L0PA 5EIYB 2W3JA 1JYNA 4E8DA 4ARXA 3W5NA 1H6YA 1W8NA 2C9KA 2BGPA 2Y6GA 3HNMA 1UY3A 2WN3A 3E1F1 3C7FA 1UYXA 3CDZB 1JZ3A 1JZ5A 2VC9A 3HOBA 4QX2A 1JYXA 2VR4A 4BDVB 3JXSA 4MGQA 4A42A 1DLCA 1CZVA 3OGVA 2QQOA 1RYYA 1K42A 4TTGA 1JHJA 5JXIA 1EUTA 2VOTA 4FI9A 2Y6LA 4BK5A 2WUHA 1GU3A 4DUXA 1UYYA 4HG6B 2VZSA 3A7QA 4A45A 2WO1A 4W50A 4LKSA 2DCKA 1W9TA 2ZEYA 3UESA 5JUVA 1US3A 1UY4A 2WABA 1D7PM 1R64A 4XURA 3UNPA 5FUIA 1JZ2A 1GMMA 2VL4A 4ZY9A 1UXXX 4IUGA 1OT5A 4QX1A 1OH4A 4XUTA 4MOAA 3T2PA 3SKJE 4W8JA 3WF2A 3D3AA 3WNOA 2C4XA 1K3IA 2C26A 2W94A 2EIDA 3LQCA 2QQKA 5F7UA 3LPFA 1JU4A 4ET7A 3MBWA 3K75B 3P1IA 1W99A 1DP0A 3ABZA 3FN9A 4P02B 1MPXA 2J1AA 3WQBA 3T0BA 4QX3A 2XHNA 1UY0A 3OEBA 2W92A 2W87A 4A41A 4KMQA 3HJRA 4PF1A 2RVAA 3WF1A 2J1VA 5DMYA 3I2JA 4M4RA 1EUUA 5IFPA 3LEGA 3DYOA 3EYPA 2WZEA 4GWJA 1K12A 2W1WA 4OZOA 4YPJA 1W9WA 3IIIA 3K77A 2W47A 2HLEA 3VD7A 4DXSA 1F4HA 3I97A 2YC4A 2W91A 4W4ZA 4JHZA 1CX1A 5EJZB 4OYUA 2Y8KA 4A6OA 1DYOA 1PX3A 2VMFA 2LS6A 4MGSA 5IJRA 2X05A 2YFUA 1JZ6A 3DECA 3UETA 2VCAA 1K45A 1P8JA 3ACIA 5HXMA 2VZUA 3THCA 1NX9A 3CMGA 4XVHA 4XUNA 3MV01 1US2A 1JZ4A 4CUAA 3LPGA 2OKXA 1XNAA 2W1QA 3IAQA 3A22A 5DPNA 2XOMA 2ZEXA 3IDAA 3T0DA 4D8MA 3NRUA 3WSOA 3LEIA 5B4XA 1JZ8A 4P08A 2B4KA 4LPLA 2VQUA 3GM8A 2QBXA 2Y6HA 3I3DA 1CIYA 3EB7A 5C71A 1TG7A 2BGOA 1GUIA 3F2ZA 5B4NA 1UX7A 3NJVA 4PQQA 1J83A 4BJ0A 1OF3A 1L7RA 4JX0A 2XONA 2EICA 3WNNA 1HN1A 2V5DA 1SHWB 5IFTA 1SG3A 2WO3A 3OG2A 2VZ1A 2Y6JA 5DN2A 3CKHA 3OBAA 4XZUG 4OMCA 4ZZ5A 1UWWA 3K46A 1CZSA 3SEEA 3T08A 1F4AA 2VZRA 3FL7A 2RJ2A 1UZ0A 2KD7A 4XUPA 3I3EA 3OGRA 5CZKA 2ORZA 2V4VA 1I5PA 2DCJA 2PQSA 1UY2A 3C7OA 3P6BA 1UXZA 2WDBA 4QDSA 4LHSA 2VCCA 1UYZA 5LCWL 4JKMA 4QB2A 2VO5A 2E26A 2XQXA 3T09A 3HNYM 4D0QA 3DYPA 4CU9A 5G05L 3NQHA 5IYYA 4E8CA 3AC0A 1GOFA 5CYYA 4RN5A 1KGYA 2QQNA 2EIEA 2V72A 2VMEA 4DEQA 2ZEZA 2J1TA 2W1UA 2W46A 3OGSA 3MV11 4A44A 1O8SA 2VMCA 3BGAA 2J7MA 4XUOA 2J1RA 2Y64A 2LW8A 4BXSV 1T2XA 1GQPA 3MUZ1 2W9XA 4OMDA 1LNSA 5JXHA 2VJXA 1NKGA 1KEXA 3W5MA 5JR2A 4ARYA 2W5FA 3ACGA 3WF3A 1NUKA 3VDBA 4UI9L 3FHQA 5IHRA 2WYSA 4GZ9A 3I3BA 2YFZA 3ACFA 2HYXA 4CUBA 5EJ1B 3HNBM 3C7GA 1JI6A 3THDA 3DYMA 4CVUA 3NNGA 4DUVA 2L9LA 3WF4A 1PMJX 4QB6A 3SEPA 5J1XA 5JXJA 2VZ3A 3K4ZA 4BK4A 3VD3A 3VD9A 2VZVA 4UOJA 2WN2A 1L7QA 5A1AA 1CZTA 2VZOA 3OEAA 1JYVA 3LEKA 5JMOA 3I2IA 2JKXA 2VZTA 3CQOA 4P00B 1PX4A 2E33A 4MO3M 4A4AA 4ZZ8A 5LA1A 1ULPA 3I2KA 3SKVA 2E31A 2J1SA 3WEZA 2CDOA 3A23A 1GOGA 2QQMA 3VDAA 2VCBA 2JDAA 3A21A 1XNTA 2WO2A 4CU7A 4CUCA 4TXWA 3VDCA 1NAEA 2VZPA 3U37A 5DQ0A 3WNKA 1SDDB 3IB3A 1O59A 4A3ZA 1BHGA 5LA0A
chains in the Genus database with same CATH superfamily
1XNKA 4DPNA 2IXKA 2VMDA 4AAXA 2R071 3OSDA 5K0UA 2JG8C 5CG8A 3ST7A 3POWA 1X7NA 2IXCA 3T0AA 1ULOA 2GNTA 3R4DB 1Z7S2 1YXWA 2C0ZA 2ZGOA 3O0XA 4INDA 3ETQA 1M06G 2CAUA 1V6OA 1VMHA 5ANNA 2MEV3 1W6QB 5GZFA 1OQ1A 5CISA 2ZEWA 1JS9A 1HX6A 1C28A 5C8CA 3UK9A 2D6PA 3N4MA 1WW4A 3HEIA 1JYWA 2E6VA 5H9QA 2VZQA 2CGOA 1OQEA 4KI5M 4LO7A 1LGNA 5FDBA 1AR73 1ENRA 3NKGA 4UFHA 1ZRDA 4A6SA 2VECA 2P3IA 3VKLA 3OBRA 1LOFC 2QTWB 3D0JA 5HV4A 2ZGNA 4NUBA 2D43A 2QKDA 4FP3A 3I2FA 2UWAA 3ZSLA 1WW7A 4EN8B 1DQ2A 5L7OA 2ZGPA 3VBRC 3KS7A 5FP9A 4AQSA 2JE8A 2QQJA 1NCRC 4W6WA 2WSVA 1A6CA 4V1PA 5KHHA 1X9PA 5HBAA 1Q8VA 4Z2AA 1IPSA 4M3CF 1H2MA 1PIV2 3ZM8A 4F3JA 3ZFGB 1F5JA 5C9AA 1NY72 2E7QA 2VBBA 4BU2A 2VUAA 4B1MA 1VJ2A 1QOSA 3LA2A 3CJIB 1WW5A 4QPYA 4E4ZA 1UU4A 3FHAA 3O14A 4EROA 3O1TA 4CDXA 5JPNB 1JU3A 1Q8SA 4JRAA 4YVSA 3CJXA 3BVCA 1QGLA 3ZYGA 5A3UA 1ZREA 5ABJA 1EYBA 2JDPA 1J84A 3HD8B 3BIEA 4BQWA 1NCQB 3RFRA 1IQDC 1L7LA 3S30A 2PAEA 4WM7B 1AXZA 2JDUA 1W2UA 3SH4A 4ES9A 1PGSA 2YGMA 4QX0A 3AFKA 1OD3A 3BCWA 4OZXA 4XC9A 3C7EA 4IL7A 3R6SA 1LEDA 2R1BA 4EQVA 1VALA 2EIBA 1UO9A 5A6ZA 4LBMA 3FLRA 5AC93 1EV13 4XW3A 1ZVFA 1N1VA 2X09A 1Q8QA 3VD4A 1H6XA 4RHV2 4BIOA 5FREA 3AP5A 3E6DA 3PVEA 2ES3A 4MGYE 4LO4B 1W39A 1N47A 5GLUA 3WLUA 1SPPA 3K4DA 1GQGA 1KJRA 3VBRA 2Z5WA 1BBT3 1I3HA 4QPWA 1R1A2 3AKRA 4MYEA 1X36A 1F8VA 1KS4A 1ZZBA 4LHKA 2QFEA 1DLLA 1YQCA 3HPNA 3NJXA 1QH7A 3W9AA 4YM2A 5LK7B 2BPA2 2LALA 2P3KA 1W9FA 1SLLA 2ZAAA 1MVQA 2HWF3 3GBFA 1E5IA 4RYDA 3AMHA 4Q26A 3KHCA 1GP6A 2ARAA 2KA3A 2J1UA 4P9GA 4Q1PA 4QDQA 4COUA 3FBMA 4K8RB 4MGTA 2VUJA 5F5QA 2XJVA 5I93A 4LIVA 4PLOA 4YG0A 1RMU2 3HT1A 2WR9A 1W6NA 4RR3B 4YVWC 4YW1A 5BXXA 3ZXEA 2ATFA 2UU8A 3FLPA 3CO2A 2ZGQA 2WFF2 3VZMA 4WVMA 5F5IA 5FP7A 3W5NA 4JC1A 1DZQA 2WNUC 4HOOA 2BGPA 1S2EA 1VB4A 2YBSA 2RS31 4AVVA 2WQZC 4LBQD 2IC1A 1YQ8A 2PMWB 2RG4A 5C6CA 2BFUS 3OPWA 3ZFEC 1UYXA 1H1IA 1JZ5A 2ET1A 2YU2A 2OT7A 4TN7A 2FZ1A 2HWC1 1G86A 3BKZA 4GMP1 1JYXA 4BDVB 3AZXA 3VDDC 5JZGA 1JYIA 4I09A 4MGQA 1AYM3 5LA9A 5CIRA 4A42A 4HSJA 1HQWA 1YYNA 1WZXA 1RYYA 3LDKA 1DCSA 1PZ8A 2HKXA 4GB33 1DQ6A 4FCAA 4KBZA 2D3SA 4LBJA 4XBNA 3ZKYA 5DG1A 3AP7A 4E4SA 1ZBA3 3LOIA 5JXIA 3DPRB 4BK5A 2VY0A 2F4LA 1COV2 4GAZA 3ZXDA 3LWCA 3EJKA 2WUHA 3QD6A 1GU3A 5GLZA 3G7DA 5FY0A 4XYXA 3A7QA 4AEJA 4XMIA 4RHV3 3QH7A 1UZYA 1US3A 3PVNA 3FLTA 2ARXA 5DZGA 4EZHA 1HB4A 1UY4A 2WL1A 3J7MA 1R64A 4LKEA 4YVWA 3E6CC 2Q8EA 2BJSA 3OD4A 1QJY3 3UNPA 5FUIA 3AVSA 1GMMA 2VCMA 4IUGA 1WMDA 1OT5A 3ZX7A 4QX1A 1JYCA 4XUTA 2JG9C 4O9GA 3SKJE 2WNUA 3ZIXA 3V0BB 1ND2A 1X33A 3SH3A 2D97A 2SLIA 2VMHA 2C26A 1RINA 3ATGA 1HQNA 2EIDA 3M3EA 4ISRA 1LTEA 4CCDA 1QMJA 2P37A 1FMD3 5F7UA 3BTZA 3O1RA 4X6QB 2OUJA 1BEV2 4QHOA 4ET7A 2FDIA 4PBPA 1H4GA 3OTFA 4Y33A 5FYSA 1WCKA 1W90A 2MEV1 1BCXA 3VDDA 2BQPA 4LIUA 1MS0A 1GWLA 4AOCA 1WLCA 5D8AA 2KR2A 2Q30A 2XG3A 3OF1A 4YNIA 3SC7X 1WBFA 2XHNA 4HKLA 3AYDA 5JI7A 2ZHNA 1AR71 5FZFA 5IVCA 1DZRA 2HJIA 2W87A 5AFEA 5A3MA 1RUI3 3POGA 4JGZA 4NAMA 4NRQA 4Y5Z0 1RHI3 2EA7A 3LIGA 5LB6A 2J1VA 1BVVA 5DMYA 3J7NA 1OPOA 1FYUA 4OI0A 5FMOL 5A3WA 3VBUB 5F6LB 2W1WA 4PDWB 3WP4A 3K77A 2W68A 2IXLA 2WIIB 1B35B 1C1FA 3CLPA 4QKNA 4DXSA 3I97A 3H1WA 3M7AA 2W91A 3AFGA 4CEYB 5APAA 2ZGKA 3IKWA 4NVPA 2RDNA 4A6OA 1PX3A 2JG9A 3ZMNA 1VRH3 2LS6A 1CAUA 2YGLA 5A7WA 4AFDA 2JEMA 2H0BA 3MFAA 4L2NA 3QH6A 5BYNA 2YFUA 1JZ6A 2PYTA 5DABA 1FNZA 2YV8A 3SITA 4AI2A 4AYUA 1IS4A 2GC1A 2VCAA 1K45A 3ROUA 4AEDB 1SFNA 1OC1A 2C9AA 3RI8A 1S0JA 2JDKA 2VZUA 1ND3C 2JENA 4H3WA 5F3GA 4XUNA 5BNOB 5IK8A 1US2A 5JI9A 3H8OA 3MIEA 2VMIA 2VVFA 3KHBA 1V9U2 3MPBA 3OOXA 3R4SA 5EYXA 5FXZA 2OKXA 2DUOA 5FZIA 5AC91 2EXJA 1JW6A 1EV11 3H1MA 4XDPA 3ZYFA 3T0DA 2JX9A 5FZCA 5BNQA 4LBQB 4AF9A 5GLTA 4P08A 3PTYA 3F95A 5FPZA 1VAMA 2B4KA 1O7FA 3NV2A 4KG8A 4HXCA 5DAWA 3ZFGA 3E5QA 1J58A 5FPXA 1F9KA 1BEV3 5CAZA 1BBT1 3U14A 4HONA 2VUDA 3TN93 3VBHB 2QBXA 3MYXA 1GZWB 1HB3A 3I3DA 5B2GB 5JPMB 3EB7A 1J59A 2D6LX 3N9QA 1HJFA 2BU9A 2ZCWA 1U5YA 2BGOA 1NCQA 1H1AA 2CGPA 2G4IA 2IXJA 4HLTA 4PIXA 2HWF1 2YC0A 2F4PA 4WM7A 1UX7A 1R092 3NJVA 4GULA 2IUWA 5JR7B 3ZN6B 1RUD3 1UMZA 1XE8A 4I02A 4BJ0A 4C0HA 5DAPA 3H0OA 1AR83 4CXYA 4CSWA 1YQ6A 4XJ9A 3Q8EA 1BXHA 5EWSA 1JOJA 3B9CA 5FZ7A 2WT1A 3POYA 3CU7A 2HWD2 5IFTA 1W8FA 3S7EA 2B8MA 2JECA 3DUIA 1FATA 2Y6JA 5DN2A 3ZXKA 4OMCA 2FCUA 3JU9A 3D82A 3K46A 4IEPA 4CDUC 2I45A 2D5FA 5FP4A 3T08A 3WG4A 1ODNA 2DFCA 2VZRA 2I2SA 3BTYA 4XTMA 2DVBA 1QXRA 5GLVA 2KD7A 3NW4A 1LHVA 1UIJA 1IPJA 4GD4A 3IMMA 2ZBJA 1NZCA 2ORZA 4IXLA 4Y5SA 3SH5A 1LOCA 2C1FA 1AYM1 2ADDA 1I5PA 2DCJA 2Q8DA 3C7OA 3VBFB 5C3QA 2A73B 3WUDA 4Q1RA 1UXZA 4GB31 3LEMA 1AXKA 3MW4A 5IVEA 1PGW1 2Y0OA 4CXWA 4EJRA 3FZ3A 1U5ZA 1ZBA1 2WFPA 5IVYA 1HXS3 4JV4A 3MZHA 4GH4C 4RS5C 2A1XA 2X29A 5KHGA 4RR3A 2ZMLA 3RMXA 1DYKA 1S55A 4XXAA 3DYPA 4KG0A 2OQ7A 3LA7A 5FYUA 2FMDA 3VL8A 4BQ5A 4OI1A 4LITA 4O65A 2OQ6A 1EAH2 5IYYA 3AMPA 3HMYA 3GZAA 3W59A 5J37A 4TLGA 2XVKA 3OGGA 4P14A 1OSGA 3VKNA 2R072 3LA3A 2EIEA 2UWBA 1QJY1 4R9CA 1I9RA 4XQDA 2CYFA 1PMIA 1UX6A 3VBSC 1IS3A 3GALA 4AHYA 5EQUA 1H4HA 1PHMA 1O8SA 4JQTA 4K7JA 1FMD1 4AVTA 2LW8A 1S0IA 3ZYJB 3U0ZA 1G9FA 3I7DA 2F6BA 2JDZA 4YARA 4JQRA 1OOPB 4ES8A 3WY6A 4QHZA 4OMDA 4MLOA 4UBGA 4JZRA 5EZWA 2FMYA 1W6PB 2XVGA 3GZEA 2GALA 1A78A 1J3QA 4HBNA 3IDBB 1MQTB 1YI7A 2VOWA 1RUI1 2CHHA 3ACGA 4NIIA 1OVSA 4P9LA 1YFXA 1RHI1 3ON7A 2XQRA 2B42B 4CCCA 3FHQA 2VXRA 4RS5A 1A34A 1W2AX 1O6UA 3LDBA 2DVFA 5FY7A 4Y26A 1IOAA 3JD73 5K0UB 4CUBA 5HCFA 3V0AB 4OQ9A 4K6BA 4FOWA 3WHTA 3HNBM 5FCCA 3PNAA 4NMIA 3T3YA 5IAVA 4FOYA 4RQPC 4JTOA 4X8PA 2YDEA 4H2AA 5FUNA 3CHXA 2D5HA 1U0AA 3MPPG 3ORJA 2RS11 4BK4A 1RUJ3 1ZBE3 3GHNA 3SCFA 1VRH1 4ZHNA 3VD3A 1FAYA 2MHFA 2V73A 4AHZA 3H3ZA 1GNZA 3VB9A 2BFUL 4LLOA 5J09A 2R063 4CPBD 1NA1B 4LHNA 4YM1A 5A1AA 4B7EA 2RM23 2VBDA 1CESA 4HPKB 1E5SA 4QGLA 5JMOA 1PVC3 2HEYF 3I2IA 5DZFA 1WLDA 2JKXA 2YROA 4WZCA 4IE6A 1VIWB 2VZTA 4QPGC 3CQOA 4UW4A 1H8TC 1UD1A 2DBNA 5FP3A 1AR63 3B3QE 3FX3A 2FDHA 1FV2A 3LD8A 4IEUA 4CCMA 4A4AA 4ZZ8A 1R081 4TWTA 2A6VA 1DGWX 2EAAA 1D0HA 4EV0A 2OIIA 2UY9A 1OLME 4CEYA 2VNVA 1UKGA 4LE4A 2WO2A 2JG8B 3DKQA 3SCHA 4D7TA 4CUCA 4TXWA 2HBUA 3N7KA 1MS1A 1NAEA 2VZPA 2ERFA 2IZWA 4Q4W1 4YW6A 2UYAA 4YVSB 3TN91 4CDXB 5DQ0A 3VZNA 3WNKA 4AHWA 1NLRA 4S2DA 3Q9OA 4D7SA 2Y38A 1S1AA 5FY5A 2ILMA 3AM2A 5LASA 1QU0A 5LA0A 4AEDA 1SFYA 3NWKA 2ETEA 3FMGA 3TBDA 3CZJA 2VTFA 1RUD1 2CDPA 5EPAA 1GP5A 5LBCA 2P6CA 2VW2A 1AR81 3ZSKA 1YEWA 1ZZ7A 4GWIA 4E9KA 2BERA 1CR7A 3JCIA 3X29B 3CIHA 5JOYA 2JB8A 4OUEA 3VBOA 3WW1A 1PM7A 2GNMA 5FZBA 5CKNA 2ZXQA 3PDQA 2VTXJ 4IEYA 4UYBA 5JIUA 5GJ6A 4QAWA 4QPGA 4LBQA 2RS32 4AVSA 1BQPA 2YPDA 3MFCA 1MEC3 5IK5A 5F5CA 1H8TA 2VQAA 4KU8A 1SPPB 3VBRB 3BOPA 4NPRA 1VBA1 1WCQA 3AP9A 5TSWA 2C24A 3MUY1 5I0SA 1NLQA 2DU1A 2HWC2 3TWIA 1ZRIA 2J1EA 2OX0A 1DGRA 3DN7A 3MLJA 3VBHA 1OVPA 5FZHA 1GZWA 3WINE 4LBLA 3VKOA 2OYZA 3WCRA 1IPKA 2ZX2A 4L92A 4CCKA 3N9LA 1V0AA 4QQLA 2GC2A 4FSJA 2K46A 2WZ8A 2A3YA 1GNYA 2B45X 3Q8BA 3ECQA 3ZN6A 2QDRA 1JOPA 3BN6A 5FO7B 4BQ2A 1HXS1 2C6SA 2X5IC 1QIQA 2JD9A 4DOUA 1W6NB 4MXVA 5KWRA 1X9TA 2DBIA 4Q4X3 1JZ7A 3MIBA 3J7HA 3U1XA 1HV1A 2DTYA 4FFIA 2WBKA 2YB7A 5HCAA 1D4M3 1OD5A 5C4WC 1PO23 3MO4A 4QB1A 1Y7BA 3CF6E 5FYTA 4H7LA 2WSUA 4ONUA 1H0BA 1OLRA 2QQIA 4X6RB 3THTA 3EBRA 3BI3A 3CZUA 2JB4A 2QJVA 2W1SA 1ST8A 3RZJA 5F3IA 4JKKA 3WQ1A 1HB1A 1HJGA 4AG4A 5KXEA 4XFGA 3H7YA 1ZA4A 3LSEA 3MIHA 4Z07A 4FT8A 3VD5A 1I1EA 2ENRA 1UZZA 5LRSA 4OI2A 3KV6A 1JBCA 5FZ9A 1OFSA 2MEV2 2WZR3 4LK6A 5K7PA 3BTXA 1AX2A 2RMU3 4W6XA 4IEXA 4XBQA 4IGQA 3PUHA 2QQLA 3MF9A 5LA2A 1AR72 5FYIA 3ZSJA 2FD8A 4JVAA 3S5QA 2ZGTA 1GANA 4DXTA 3T2OA 1J1TA 5FPVA 4D0QA 1WKYA 5FZ8A 3UYJA 2XPJA 2ARCA 1H30A 2AYHA 3M70A 4N7IA 5I0DA 5L9BA 4CEWC 1YFYA 1SLAA 4D6SA 3CL1A 4ISQA 3UKNA 2Z69A 5KHJA 1VMFA 5JXGA 2P3YA 1AL23 3RS6A 4YVWB 4CU6A 3AMQA 5ACA3 2WAOA 5FZ3A 5CEHA 4LQRA 1M4WA 4P9YA 5G04L 3RYKA 4D94A 4JDOA 2VW0A 4OI4A 3JD71 4WZFA 4AQTA 5C4WA 5KBFA 1S0EA 2QUOA 3KCCA 4YW2A 2BV4A 2WT2A 3GDBA 3ZIWA 3UGFA 4EWEA 2WNUB 1AJOA 1K5JA 1ND2B 2XWBB 4XF1A 3WNMA 4V2WA 1LOGA 3ILFA 1X8MA 2DUQA 2VU9A 4YFWA 1QOTA 3LFIA 3NJYA 5LY2A 5JOZA 5KHIA 1RXGA 4NWWA 3ZFEB 2VH9A 1UZVA 3PLQA 4J1XA 2W3JA 3QCWA 4P9IA 3VDDB 1X50A 1BLZA 4HVQA 4IV3C 1RUJ1 1ZBE1 3BB6A 3WT3A 1Q3EA 4E8DA 5SV5A 4XDOA 5L36A 1VBE3 2PXJA 4BLIA 3LB9A 2Y6GA 3FJSA 2R061 3HNMA 2WN3A 4NOTA 2RM21 3KQRA 1AYN3 4JGZB 1NQDA 1JZ3A 3B5LB 1RGSA 4N9IA 1PVC1 4IW3A 5T54A 3ILRA 3PTRB 1S0CA 2D6OX 4NRPA 1JTZX 2JDNA 1LHNA 4WBBA 3PJQA 1QWRA 5AC92 4XDQA 4E2QA 2RR13 4AXOA 1DLCA 1EV12 1CZVA 3NJZA 3OGVA 1AR61 2NQYA 4ZU5A 4MUVA 5FXXA 4CEWB 4B4RA 3TYJA 3V0AA 2CNAA 1GQHA 2DVAA 4Y1XA 4N53C 1K42A 4TTGA 3KF3A 4AQ2A 1JHJA 1EUTA 2VOKA 4Y4YA 1QDCA 2B39A 4HKWA 4GWMA 2XMLA 1BBT2 2ZGMA 4I0BA 3AP4A 5GKAC 3PIGA 5JLVA 2PFWA 2JG9B 1CAUB 1WD3A 3LZZA 4W50A 4LKSA 5A7WB 3NNFA 2WA4A 4PHZA 4CCJA 4FOVA 4Z8BA 2Z2SB 3T4VA 4GQ7A 2HWF2 5JDBA 1C8NA 1D7PM 1NA1A 2VBPA 4A7ZA 3O0WA 1S0GA 4NWVA 4XURA 3VHRA 2WRAA 4IV1C 4YYOA 4HPKA 3W20A 2VL4A 1LECA 1NLSA 3INAA 2XXZA 4IEOA 4ZY9A 4HMZA 4AFAA 1WGPA 4IETA 1OH4A 4DY5A 5T50A 1QNYA 3AXDA 3WF2A 3WNOA 1O4ZA 2W94A 4IEQA 3ZYPA 3T30A 3LPFA 3JUUA 1JU4A 1KFXL 3K75B 3MBWA 1KS5A 1MZEA 2OW4A 1W99A 3P1IA 4XCBA 1G9DA 4BPZA 4PLNA 1CAVB 3ABZA 3FN9A 4OULA 5F3EA 4UXAA 3U78A 4CDQC 5KC6A 1RUOA 1LOEA 1MEC1 1CD3G 4QX3A 1YJKA 2JG8A 2ZX0A 3THPA 2E51A 1V6KA 3OEBA 3O1VA 4OCTA 2W92A 4E2GA 2GC0A 4N53A 1DBNA 4PF1A 5KXBA 1AYM2 4ZXKA 4DQAA 1AUYA 4QU1A 3WF1A 3ZYBA 2JKBA 1ENQA 3DGTA 2R043 4M4RA 4GB32 2OZ6A 5FZ0A 3H3UA 1PGW2 3IZOA 4P9JA 1ZBA2 3SMHA 2WZEA 1XYOA 5FOJB 3V56A 4K8FA 1A8DA 1WMXA 3IDCB 1VBD3 1W9WA 2DCYA 3I59A 1H9WA 5JIAA 4RD7A 1GFF2 4A2UA 4IV1A 2YC4A 5JVVA 2WLPA 4W4ZA 3T1MA 5JCTA 2WC2A 4Q4X1 1ND3B 4OYUA 1LOFA 3R05A 1C8M3 2WKKA 1D4M1 2Y8KA 1DYOA 4E4HA 3N9OA 1PO21 4MGSA 4GA9A 4YLZA 4QXCA 5IJRA 4W6YA 1BKZA 2X05A 2H6BA 1QQP3 3DEMA 1QJY2 3P5BA 4XFIA 3DECA 3M2MA 2A7AA 2OPWA 1NCRA 4LO5B 4LA2A 3ZPYA 1D4VB 1VAKA 2ZS6B 3ACIA 1OA2A 4ZU4A 5A3PA 5HXMA 5HCHA 3GZUC 3H8XA 3THCA 4Q4V3 1NX9A 2Q8CA 3IT8A 1CAXB 1FMD2 1WD4A 3MV01 5DXDA 5F39A 4S2FA 1IKPA 2P17A 2A70A 4A3XA 3ZFFC 5GZGA 2GMEA 1YJLA 3BTAA 2W1QA 3IAQA 2BVVA 2WZR1 3O12A 4IE4A 3POBA 1UAIA 4UF0B 4AFCA 4EYUA 2XOMA 2RMU1 3IN9A 4D8MA 5B4XA 3ZR5A 5FZEA 4N90A 1RUI2 5FBZA 4NROA 4G9SB 1RHI2 1KJLA 4Z1VA 3S5AA 1KFUL 1ULDA 4LULA 4Q8KA 4L11A 4LUKA 1PVXA 4R9BA 1YRZA 1CIYA 2WS93 3I49A 4QGMA 3Q8CA 1AL21 5ACA1 5C71A 5IT6A 4R52A 1UU6A 3F2ZA 4FAGA 5IVBA 1CJPA 1W2OA 3H3LA 3I3QA 4COVA 3U4XA 1AXYA 1CQ9A 2XHKA 4DB5A 5BNPC 2OVUA 4CDUB 2Q1FA 4QQPA 1LEMA 1L7RA 1AHSA 1WA6X 2IWGB 3S7IA 4AL9A 4HL0A 2V5DA 5DUVA 2RS12 1SHWB 1SZBA 1E5HA 2R49A 4K9SA 1VRH2 3ASIA 4H55A 4CXXA 2VNOA 2P5BA 2E63A 4MVTA 4XXPA 2EXIA 1SDWA 2WO3A 4CPBA 5A6YA 3OBAA 1G9AA 1JXNA 1VBE1 4HK8A 4YGBA 1UWWA 4CZSA 3ZFFA 2IVJA 5FXVA 1ASJ3 2AEYA 2N7GA 1AYN1 4MV2A 4UW6A 2RJ2A 1OH3A 2EXKA 1UZ0A 1LOBA 2GSYA 5DDJ3 5EFUA 1TNFA 1VPHA 3OGRA 3BALA 1VRBA 2CSGA 4GH4B 5FKBA 4RS5B 4Y1ZA 4COYA 1ZZ9A 3MIDA 4AZZA 2RDSA 2V4VA 5ANQA 3WQ0A 5HXVA 2HEVF 2RR11 1R082 4U36A 4Q0VA 4NIGA 4ASLA 3P6BA 5HV0A 3RYPA 2VTXA 2WDBA 3I2DA 5JSPA 4NR1A 3POJA 2LROA 3RVHA 4LBKA 3M3CA 2ZGUA 1H8VA 4GJZA 4KWKA 1WLTA 2SBAA 2BVBA 2CWMA 3J7LA 5LCWL 2DWRA 2OZJA 4Q5OA 1QJX3 4JKMA 2YMZA 4QB2A 1H1MA 3ZFEA 4M0HA 1SQ4A 2VO5A 1QHDA 3VHOA 4X8NA 3T09A 1BMV2 4Q4W2 3TN92 1OLMA 3AVRA 3VBSB 4R4ZA 5G05L 3NQHA 5FPBA 2AREA 2DYCA 4PQ9A 1GZCA 3WP6A 4E8CA 2ZGRA 3AC0A 3ME2A 4J6GA 5CYYA 4L99A 5A7QA 4Q0SA 2QQNA 1PNFA 1HN0A 3ES1A 2WJSA 3O7OA 2XLFA 3S57A 3T4HB 2VMEA 1RUD2 2IFWA 4AVCA 3RG0A 2J1TA 3WDVA 1LGCA 1UZWA 1YUDA 1ZRRA 1AR82 2W2IA 2VOVA 3HQUA 1QH6A 4O9EA 4A44A 4AI1A 4OQ8A 1YC61 3VHPA 3N9MA 5FLJA 4YW4A 4LBNA 4XF0A 4AWDA 5F3CA 4XFBA 4N9HA 4NAOA 3HQXA 4M01A 1OUSA 2C5DA 2WINB 3APBA 3JB8A 4BXSV 1JHNA 1RUE3 1GQPA 1T2XA 2CAVA 3MUZ1 1VBA2 1ZYBA 1ZZ6A 5JXHA 1W8ZA 2VJXA 1WBLA 5CVRA 4GXLA 1KEXA 4Z2WA 5A80A 3W5MA 5JWPA 2V4AA 5FY9A 4ARYA 4B3NA 1GSLA 2RS13 1ULGA 1AL0G 4EN6B 5FYHA 1VBC3 3AZVA 3SLIA 5AFBA 2VE1A 5IHRA 4IEWA 4PIZA 5FYVA 1XSRA 2R041 3CJIC 4GZ9A 2ZX4A 2YFZA 5CFCC 3ACFA 1N1YA 3KF5A 1HXS2 2G9GA 1RUG3 4E4DX 1XSQA 2R0FA 3U07A 2W52A 3I3MA 4YZ2A 1JI6A 3UT0A 1CPMA 1QJFA 1VBD1 3THDA 4XF9A 3J8F3 1J3RA 1V70A 2A5ZA 1DGWA 1DQ5A 2L9LA 3AJZA 3ES4A 3VBOB 1GR3A 4DUVA 1R083 1PMJX 1RC6A 4ASMB 3HBZA 5J1XA 3E5UA 1IZ3A 2VZ3A 3K4ZA 1C8M1 3M3IA 4QPGB 5I8TA 4DZGA 1S0BA 3EMRA 3PUAA 1CAVA 5FJHA 5FPLA 4Z92B 1H8TB 3ZDSA 4UT5A 1OA4A 4OHWA 2VZVA 2G9FA 4UFJA 5F5AA 2JD4A 1QQP1 4UOJA 1C1LA 3SNMA 3TEZA 1L7QA 2VZOA 4Q4W3 4JDMA 1FNYA 4L97A 3VHNA 2QQWA 3KT4A 4K1ZA 1W06A 4WVWA 5IAXA 3LEKA 3OPTA 5BPXA 1FOD3 2Q1ZB 3VKMA 4GJYA 2AH2A 2CTVA 2P3JA 1U5IA 3C2UA 1FT9A 4IEVA 4JGYC 4Q4V1 5J7MA 3HR9A 2RJKA 4HETA 1Q8PA 1R1ZA 3RRDA 4NPLA 1VE0A 4P00B 4AFBA 2FZ2A 1PX4A 1SBFA 2UYBA 4MO3M 4RL7A 5C3OA 3I2KA 1UIKA 3HIFA 1JYTA 3LDRA 2J1SA 4LUMA 4C91A 3GBWA 1AR93 4JAAA 3A23A 5I0RA 1GOGA 2QQMA 3VDAA 1DGLA 4YZ3A 5FYYA 3N9PA 5FUPA 2VCBA 2JDAA 4NO4A 4WV8A 2ZHKA 3O1SA 1UF2C 4F7ZA 1W6MA 2HWB3 4JTNA 1ND3A 2D7FA 4HSLA 3UJOA 2FCTA 4WVZA 5CFCA 3G6JB 2LUWA 4XE9A 3O1OA 3OD0A 1ENSA 1QJZA 3FC0A 3U37A 4CDWC 4OFGA 1SDDB 1SMVA 2WS91 1VBA3 3M4FA 3JD72 3UKVA 4TZDA 1D0GA 3GJAA 5FK8A 4KH9A 3LCPA 4FPFA 4XUQA 3B7MA 3ZMOA 1HRV3 4YFZA 4DINB 2R7EB 3BPSA 3HN3A 4O61A 2Q0AA 2HWE3 2VPVA 3AXEA 1ODMA 1CAXA 4FP2A 2WAAA 4FPOB 3PUSA 3MDPA 1PZ7A 1UY1A 2QNKA 2Y6FA 3WG1A 5LZ6A 1NXD1 4ASKA 3I54A 3TRSB 2GP3A 4ZS3A 4AI3A 1RUJ2 1ZBE2 4UF0A 2RS52 2QDNA 3H1YA 1S2BA 4HN1A 3WNPA 5C7GA 1JH5A 2R062 2UWCA 3RWKX 1IGOA 3WDYA 3ZXJA 2RM22 4FQZA 1XBFA 2WO7A 3C7HA 4CU8A 4Y5TA 5FBJA 1ASJ1 1S0FA 3C8XA 3ILNA 1PVC2 1UPIA 4N43C 4Y20B 4XHBA 5IVJA 4QXBA 1TMF3 4CCNA 2WYFA 3N7MA 3TEXA 5LBBA 5ISLA 3OY8A 1AR62 4QWNA 4Q0UA 4HVRA 4LEJA 2GMPA 3RZKA 2VQTA 2XR4A 3PUQA 4CA9A 1RUNA 1E57A 3WQ7A 5C4WB 1W9YA 1XU2A 4XABA 4FXGB 3O1MA 2TEPA 4XCAA 3AL5A 4CDWA 1V6JA 2VM9A 4CP0A 4DXRA 1TVGA 1NQJA 4FFGA 1DQ4A 4CDUA 3ZSEA 1YLLA 5FP8A 1OF4A 4EN9B 2O14A 1QJX1 2X53S 3NMBA 5FJKA 2I74A 3I2GA 1UOJA 1MS3A 2P1BA 1KQRA 2F17A 2ORXA 2Y60A 3GGLA 3K48A 2Q1MA 4WM8C 4FBFA 3AYAA 2W0XA 1W05A 1RUF3 1XOYA 3AYCA 4XJZA 4XJUA 5FWEA 2O8OA 3WF0A 3ACHA 1CVNA 1O3SA 3JBG3 4FTEA 2PHTA 1IKQA 1W0NA 2R32A 2RJLA 1GLHA 3POEA 1GV9A 2Z4FA 2J22A 3H42B 3NAPC 5CKQA 3ZSMA 5IK4A 4KNCA 1CONA 3VGIA 2BZDA 1O8PA 2R16A 4GH4A 4NIHA 5E88A 2WNOA 2YC2A 4LE3A 5F2WA 1JOBA 3IAPA 1T6GC 3OB8A 4IE5A 4OUMA 1CJDA 1SBEA 4QDRA 2Y6KA 2BDRA 2VNGA 4YZ4A 3NV3A 4RFRB 5JAXA 1MEC2 3UL2A 3O1PA 4P5HA 5A3TA 1RUE1 1QF3A 3VD7A 5FYCA 1Y9MA 4UBHA 1W28A 1W6OB 4DEVA 4XIKA 2R30A 2GMMA 1QY4A 1ZA7A 3VBUC 3ZYHA 4DY3A 3V65A 4Q4Y3 1QXJA 1D2QA 2YXSA 4XHXA 5J3UA 3BPZA 5L9RA 4EN7B 3ELNA 3VBSA 4NHLA 4JCKA 4NHKA 4QPIC 3RJRA 2RS53 2PHDA 4OHXA 2EXHA 3UV9A 5FOBB 4E27A 3HWJA 5C70A 1VBC1 2QCSB 4K21A 2JDYA 2BP6A 5FAXA 5FFOC 1SBDA 3E97A 2DDUA 2NZ9A 1A3KA 4IV3B 2JDHA 1KITA 2Q5TA 1W8HA 1ULEA 4FPHA 1RUG1 2WQ8A 5CFDC 1WCSA 4K40A 3VKFC 3WG3A 3AL6A 3WOGA 1AVBA 4Q4X2 1O91A 4AI8A 1N3QA 3J8F1 1HLCA 3T2QA 1OBNA 1D4M2 1RUH3 1RJ8A 2XDVA 4OUSA 1PO22 1LGBA 3GYDA 5EIYB 1LB2A 1H2NA 4MZUA 3D5OA 5BNOC 1DYPA 1JYNA 3I8TA 1H6YA 1W8NA 2C9KA 3E1F1 4I0WB 4N53B 5C3PA 2I07B 4FAHA 4YZ5A 3OYWA 1XYPA 5CADA 4FPKA 3CDZB 1ZM1A 4XZPA 4ZKTB 3KQ4B 3HOBA 3PVBB 4RQPA 1FOD1 3TNQA 3O5SA 4RGGA 5DDJ1 2Z79A 3E5XA 2VR4A 2FDFA 1A8MA 2GN7A 2PLV3 3JXSA 2WZR2 3EXUA 3D8CA 4FO9A 1PO11 1RVF3 2RMU2 4QPIA 1QJU3 2E7TA 2QQOA 2XWJB 1STMA 2JIJA 1AR91 3I59B 1QKQA 4LHLA 3AKTA 3ZYIB 5LEJA 4IV1B 5E16A 3NV4A 1QEXA 5FMCA 2HWB1 1POQA 1DG6A 4IE0A 5A7SA 4D3WA 1UYYA 4C90A 4LT5A 4S2GA 4A45A 3RZLA 2WO1A 1REFA 1AL22 2DCKA 5ACA2 1K5MC 4YGCA 5FQ0A 2ZEYA 3UESA 5BV6A 4N8MA 2K0GA 5JUVA 3KB5A 5A7NA 5KXDA 2WABA 1NCRB 2H6CA 4QKDA 1LHOA 2XL9A 3ZXLA 3H7JA 1N1TA 4PIYA 1JZ2A 1HRV1 2CL2A 3OBZA 4XTPA 5BNNC 1UXXX 4S2HA 2HWE1 3T2PA 2DU0A 1C5HA 4W65A 3D3AA 4W8JA 1V6LA 4H7MA 1O3QA 5D21A 5EJ3A 3LQCA 2QQKA 4KGQA 1CIWA 4DFSA 3VUOA 2Y33A 2ZX3A 4NJ4A 3UGHA 1RUC3 4OHZA 3RJ2X 4MSVA 1PZ9A 1VMJA 3KVAA 1VBE2 5FYMA 4CP2A 3KCXA 4BQYA 4CCOA 4LBOA 4CCLA 1QJEA 4P02B 1MPXA 1YNAA 2QQUA 1AYN2 3T0BA 1VBB3 1F2NA 1RJ7A 3AKQA 4Q0PA 4EWAA 4WVVA 3FUQA 4A41A 1ACCA 3WDUA 3HJRA 1TMF1 3OBTA 5I0TA 5CG9A 2RR12 2BNNA 3N36A 3IPVB 4JRLA 5K8SA 4JDNA 3I2JA 4BH9A 1EUUA 4LORA 4XILA 4COWA 3LEGA 3DYOA 3EYPA 3AMMA 4MXWA 1K5MA 2XJTA 4M0NA 2VVDA 3LOBA 4GWJA 5E89A 1K12A 4KQ7A 4OZOA 4YW3A 2UURA 5H9PA 4YPJA 1AX1A 4YW7A 4BE3A 5LWBA 2IFRA 3ZKUA 1UL9A 2HLEA 3UGGA 4YSFA 5FZKA 3S0MA 4JHZA 1CX1A 3EHKA 4QQ2A 5EJZB 4YM0A 5BNNA 2ZACA 3KGZA 1KD7A 4QT6A 5F1RA 1RUF1 4C1WA 2WA3A 4Y22A 2NMOA 2VMFA 2XUMA 3JBG1 3VN4A 4B7KA 5A3LA 1QDOA 3ZFFB 1AZDA 2IXHA 4OLLA 3KGLA 5FMBA 3N35A 1FV3A 1WWYA 5LK5A 1POV0 4Y4RA 4N7UA 4R4XA 4Y20A 2PN5A 5H9SA 3ZOIA 3BU7A 1YFWA 5FWJA 5C5UA 2YPJA 2X5IA 4ZU7A 1XNBA 1HV0A 4B1LA 2O1QA 3WD5A 3CMGA 4U2AA 2BEOA 2GNBA 1KDKA 3DXUA 4BZ4A 1PNGA 1GWMA 1LKNA 4FVVA 1MQTC 4CUAA 4F8AA 3LPGA 4A7KA 3H8RA 1XNAA 4I3PA 1SLIA 1XU1A 3A22A 4KL1A 2ZEXA 3IDAA 3ZN4A 4YZ1A 1Q56A 3FE5A 5IUQA 3SISA 1ONAA 3WSOA 3LEIA 4ATFA 3POIA 3MLLA 2BWCA 5F2SA 3RI9A 3WZ1A 5FZDA 4Q4Y1 4LPLA 5EP9A 4G3YC 5DAVA 3WP5A 2OS2A 1BZWA 3GM8A 5BNPB 5CB7A 3W21A 4OHVA 3ZDVA 2KM2A 2RS51 2BUKA 3MI8A 5GLWA 1HDKA 4AVBA 1REEA 1DGRN 4DNYA 1U12A 1MR5A 2R042 2CU5A 3I4IA 3J4UH 3PMSA 3I2OA 2FDGA 2A71A 5BUVA 1Y9QA 3C3VA 3POSA 3R4UA 3GHMA 3AP6A 1TG7A 2XJRA 5C8CC 1FPN3 1GUIA 4GALA 2DVGA 1IG0A 1RITA 5LEKA 3Q8FA 2ARBA 2VNRA 1VBD2 2XJSA 4LNVA 3J26N 5M0TA 1J83A 3ZXFA 3HBKA 1OF3A 2YUEA 1LESA 1G8WA 2D3PA 3DCQA 4F83A 4K1YA 1UOGA 5A3OA 3MIGA 4JX0A 4DIQA 2WQ4A 1E5RA 2UY8A 5FKCA 1C8M2 1RUH1 3WNNA 4CEWA 1DDLA 3KT1A 3NL1A 4QM9A 1SLCA 2Y34A 4ZS2A 2JDMA 4QD2A 1SG3A 1Y4WA 1QQP2 3TEWA 5FZAA 3OG2A 5L7OC 1OI6A 1W6OA 1NE4A 3CKHA 3KV9A 2YBPA 2WNVC 4ZZ5A 1XXNA 3OUHA 2AR6A 2QQVA 2Y26A 1CZSA 1TME3 5K9YA 1F4AA 5A3NA 4LTAA 4Q4V2 4MX3A 1DF0A 5A7PA 4HN0A 2R0HA 3BIWE 5IATA 3I3EA 5C9AC 4XAAA 1G7YA 2TNFA 3WVJA 5KHKA 3KMHA 2D3RA 1UKRA 1VP6A 2FDJA 4KU7A 2PLV1 1W8WA 1OHFA 4CDXC 5C3RA 1RVF1 1UY2A 2PQSA 2VUCA 3JQXA 4IV3A 4YVSC 1QJU1 2D6MA 2XJQA 3L2HA 5ABJC 4LHSA 2WZPP 4URTA 3S6PA 4AQ6A 4AAPA 5T5OA 4QX7A 2VCCA 1UYZA 3AZZA 3BOWA 5LY1A 2Y0IA 3RWNA 4BIFA 2IXIA 1V6NA 4I2OA 3IM0A 2E26A 5IWFA 2XQXA 4DRVA 2ZX1A 3MIFA 4CU9A 3HVDA 3AMNA 2WS92 3BU0A 1C4RA 1GBGA 3HAGA 4BQ3A 1XB9A 3PVOA 5DAQA 1WW6A 2VAUA 4XFCA 4RN5A 5FZMA 1KGYA 1N3PA 4HANA 3NKTA 3O0VA 1B09A 1J1LA 3MGUA 1C3HA 2AZ5A 4DEQA 4AE2A 1CAWB 2W46A 2D6KA 4BYYA 3FWEA 2TBVA 3PMEA 4AFMA 4MHUA 2WNVA 3AKPA 3D0SA 3AX4A 3M3OA 5T55A 4XMAA 4D69A 5CA6A 5E8AA 5IVFA 1HRI1 2J7MA 4D6RA 2XBO3 1RUC1 1RL3A 3PJYA 2J1RA 1OFNA 5FK7A 1G9CA 1JN2P 3ZPOA 1O4TA 2R1DA 3WDXA 2ZAHA 1ASJ2 1LHUA 2W9XA 4XJAA 3BODA 2LM3A 1LNSA 5FR3A 2WLQA 1PGL1 1W6MB 5CFCB 3AYEA 5JR2A 1VBB1 2DFBA 2VMGA 5L73A 5FY1A 1OKQA 4GKXA 3USUA 2GH2A 5F6KA 2GZWA 4SLIA 4Y1VA 4NHYA 1GYKA 1C57A 3T1LA 3WCSA 5I91A 3RZHA 4LK7A 1U5XA 1PK6C 2ADEA 3I3BA 2V09A 1EPZA 5SV8A 5C3SA 4AHXA 2VQ0A 1OUXA 1YWKA 3DF0A 3FFQA 3AKSA 2CV6A 2ZJCA 1BYHA 3FHIB 4QU2A 5EJ1B 4XQWA 5FLHA 1QJX2 3B00A 3RZMA 5EXOA 2VGDA 1SLBA 3C7GA 1YO8A 3P3NA 5CBLA 4CVUA 2K9ZA 4RFT0 1ZZCA 1BJQA 3WF4A 3DKWA 2GU9A 1GKBA 2Q4SA 3SCGA 1Z7S3 4QB6A 3KVBA 1JUIA 3RPQA 5JZGC 4JGYB 1MZFA 3GZTB 5LRRA 3MW3A 1CX4A 1LOAA 1IHMA 2JWPA 4CCEA 1H2LA 5L19A 4DUWA 1O5LA 2WT0A 5A32B 3JQWA 3VD9A 3TB0A 4DRRA 3MEPA 4BHPA 4QM8A 4CE8A 2WN2A 4FPLA 4LO6B 1ZNPA 5FY4A 1UN1A 4QKBA 5T5LA 3OY8B 4IERA 2A6ZA 1W8TA 5K4LA 2CY6A 4AI0A 3IPVA 3VZJA 3EQEA 5JOWA 2B46X 1Z0HA 4XIOA 2VVEA 1UOBA 1XNCA 1RUE2 2E33A 4CDWB 5LA1A 1ULPA 5GZCA 1YIPA 3IBMA 4DMIA 5C8WA 3WEZA 1H9PA 2VOXA 3KT7A 3PU3A 1NZIA 3AJYA 4Q8LA 5A1LA 5CKMA 1PK6A 3A21A 4QMAA 4XF4A 5E6HA 3USSA 1W0PA 4R8HA 2PHXA 1UYPA 4RSUA 2FBEA 4YGEA 1ND2C 4LMFA 2B7YA 1OPMA 3MHZA 1VBC2 3VDCA 1PIV3 1I6XA 4MH0E 2LRPA 4AGVA 1EY2A 1UNBA 3OGJA 4XBLA 1ULCA 2NN8A 2XB6C 2A75A 1WLWA 3NSTA 1H2KA 1JUHA 1DU3D 5AVPA 3GBGA 1FPN1 5ERLA 1RUG2 1BHGA 3MF6A 1XPWA 4R9AA 2WWSA 4Y1YA 2NMNA 5D8AC 4B8EA 4SBVA 4B4PA 2DCTA 3GNEA 3MICA 3J8F2 3HN1A 3FBYA 4M3CE 4YM3A 4N43B 4UWDA 4JGZC 5FZ1A 1UMHA 2DTWA 3K3OA 2PHWA 4I3GA 4ZXEA 2K2SA 3PU8A 1FX5A 1NXMA 2WWJA 2D98A 4KWUA 5HPOA 1X82A 3ZN5A 1AX0A 2CWSA 4HK9A 1G6NA 2E9QA 5C5TA 5FPAA 1W9SA 3B01A 2LTNA 2VD7A 4LOTA 2ET7A 4OHYA 1WMFA 1TME1 5BNPA 1LULA 1FOD2 3A0KA 3ITQA 5LATA 5DDJ2 3A0NA 3LE0A 3EO6A 5HCBA 2RE9A 4M4PA 3PIJA 1O3RA 1REDA 2IVIB 2ZHLA 2XJPA 5JSRA 1PO12 3RNSA 1R1A3 4QXKA 1WCDJ 2E7AA 2PQQA 2QZ3A 4WM8B 5GM0A 5F9TA 2O0OA 1OXCA 3BYWA 3W58A 1S2KA 4E2SA 4BQ4A 1AR92 2ZZQA 3PURA 3ETPA 4CP9A 4PJYA 4CYDA 4J1WA 4HT1T 4JKLA 2GH8A 5A33A 3WG2A 1MS5A 1Y43B 1IS6A 4BA6A 2X8KA 2DV9A 2HWB2 4RGAA 3NAPB 2XH6A 1XQNA 2E32A 2NM1A 2QE3A 2Z42A 4LKDA 4UAPA 2D40A 3GXUA 1VLNA 1POV3 4BCUA 4CDQA 1W8OA 1CGPA 1UMIA 1ALYA 4LA3A 4HVOA 2XL7A 3WW4A 1RMU3 4PT6A 5J98B 2WFF3 5FYBA 5GALA 1HRV2 2G19A 2W39A 3RZGA 1QXPA 2W95A 3OYWB 3SXWA 3PUIA 5FV3A 1YQ5A 2HWE2 2CGNA 4PI2A 5A70A 1UW8A 3E6BA 4RQPB 1XJAA 3AZWA 2J42A 3RGBA 3ZFGC 4DS0A 4MGIE 4R9DA 5J96B 1N3OA 1X8EA 3UJQA 2P34A 3K4AA 4QPIB 4FOQA 5E1RA 5I0UA 3U11A 1LODA 4MADA 1G9BA 2JICA 2XBO1 2YG0A 2RV9A 3WNLA 5FPUA 1RXFA 2B9VA 1ZRCA 1NCQC 3PL0A 1N1SA 2OA2A 2ZHMA 4LXLA 1LU2A 2ID4A 4WM7C 1GOHA 3DXTA 1W6QA 3ZR6A 5IVVA 4NIDA 1PMHX 5I8SA 1URXA 2AACA 2AC1A 3NV1A 3NVCA 1HKDA 4BQXA 3OPZA 1TMF2 3RMYA 5CFDB 1COV3 3I2HA 3NNLA 5FQ0B 4IGOA 2QZ2A 1XC6A 4QGNA 5FRAA 4EWDA 1C5IA 2HH9A 5JMCA 3N7JA 4XACA 2V5YA 1FXZA 1AF9A 5GZEA 3VLBB 3HQRA 3V64A 4P5YA 2EF6A 5FZOB 3JB4C 2GDFA 2X10A 2A6YA 1CAWA 4BLJA 2BBAA 5A6QA 2D44A 2ZMNA 1TEIA 5CNAA 1YQ2A 1GZ9A 3D6EA 4XFHA 1O3TA 1W0OA 4TYSA 4CTEA 1PO13 5FIXA 1RB8G 1RUF2 4L0PA 1F5FA 3MLKA 4AGRA 4PF5A 1JODA 2GC3A 5FZLA 4L8QA 1Z7S1 3JBG2 4META 4BISA 4MGKE 5J48A 1J3PA 3OJBA 2FCVA 3CJIA 4XFAA 4ARXA 3WUCA 4I01A 4LJHA 4P9XA 5KXCA 1YCIA 3U4SA 3CEWA 3H50A 5KR7A 4TLFA 5A1FA 4PBOA 4RA0A 1Y3TA 4I30A 1UY3A 5L9VA 2G1MA 5T5JA 3B93A 3WW2A 3C7FA 3KV5A 4ATEA 2VC9A 3U75A 2GNDA 4IGPA 4MGZE 4QX2A 4RR3C 3B94A 1L3JA 3QBQA 5F37A 4GIQA 1SFPA 2RHPA 3LAGA 4Y1UA 4C0BA 1OA3A 2ZOEB 4M3CB 3P3PA 2PHLA 2WNEA 3KLSA 4XAEA 4MXWB 1K5MB 4GMP0 1XE7A 1MS4A 5FZ6A 4NIAA 1VAVA 2ZTNA 2XLGA 4Q4Y2 2VOTA 3K3NA 1MS8A 4FI9A 2Y6LA 4PLMA 4K3UA 2NPIA 1LRHA 3D4KA 5BNNB 3M8LA 3KM5A 2BNMA 2P4EA 4YG3A 4JGYA 5DUXA 4DUXA 1PIV1 2BOJA 4Y22B 4HG6B 3UKTA 4NRMA 2VZSA 1PM4A 1CWPA 3LFMA 3WX5A 1NY71 1W9TA 3K2OA 5LW9A 5A32A 4HZFA 2NLRA 1APNA 4IQPA 3KD4A 1EP0A 2AENA 3DPRC 1ZRFA 5GZDA 1XRUA 1D2SA 1QNWA 4LR4A 4ZONA 2X5IB 1F35A 4AI9A 5HI0A 5IK7A 5FLIA 2EIGA 4MOAA 4D6QA 1LR5A 1RUH2 2DVDA 2VULA 2C4XA 4XPVA 1K3IA 1ZX5A 5FZ4A 1HQLA 2BNOA 1ENXA 2XUEA 1LAJA 1V9U3 4XJWA 4M00A 5F32A 5T52A 4UFIA 1DP0A 3FFZA 5FYZA 3VL9A 2PAMA 2J1AA 4Q29A 4RHV1 2QVSB 1YHFA 3WQBA 4AW7A 4YRDA 5FXWA 1SCRA 1UY0A 2YY1A 2B5HA 3DV8A 4Z82A 3ACLA 4UW3A 4UW5A 1DIWA 4KMQA 4FTSA 2PLV2 2WWUA 3JZVA 1LCLA 4Q0QA 2OUHA 5EYYA 4YW5A 2ZKLA 2RVAA 1HB2A 1RVF2 2MNGA 3KCYA 1R1A1 5DUUA 1QJU2 1TQ5A 4Q2FA 2QQPA 2BWAA 2XVLA 4XJ8A 5IFPA 3WP3A 3Q8AA 1W3VA 1TZOA 1R093 3IIIA 4N43A 2W47A 5FMDA 2BTVC 2O8QA 3DPRA 4I0AA 1F4HA 5FTTC 2ZKNA 5LBEA 3TAYA 2PHRA 1OURA 1NT0A 2GP5A 2NYYA 4LKFA 1POV1 4URAA 1RMU1 3WV6A 2DF7A 2HWD3 1AJKA 1V6IA 4K20A 4TSVA 5DZEA 2JXAA 2RDRA 5LBFA 2WFF1 3ALQA 3ZXAC 4PDWC 1DQ0A 4YWAA 4PCRA 1XE0A 3UETA 3VZKA 1IQAA 3DL3A 4C1XA 1B35C 2ZA9A 1P8JA 4FQ4A 4D7YA 4CEYC 1JZ4A 1V00A 2XGXA 4BM8A 5I8YA 4HKOA 2A6XA 4P9WA 1HRI2 3LF7A 5IW0A 4XVHA 4DXZA 4WM8A 5C33A 5JOXA 1BMV1 4COZA 1RUC2 4UFMA 3V0BA 2ZGSA 1NYWA 1S4CA 3WXPA 1LHWA 1Q8OA 3VV1A 1W2TA 4BB3A 5DPNA 4NHXA 1PGL2 4KBBA 3L9JT 3KZ4C 4AEDC 1OMIA 3NRUA 4A7YA 1VBB2 5C8CB 2A6WA 3NAPA 1JZ8A 2PHFA 1T6BX 2PELA 3VZOA 1XYNA 1MZ6A 2VQUA 3IIAA 4KGGA 2HBTA 1YI9A 1COV1 1CN1A 1VB2A 3QOPA 3KV4A 5H9RA 1GZTA 4H14A 4G4FA 3VBOC 1DFQA 4DO0A 2Y6HA 4BMBA 2DUPA 4BMEA 1W3XA 1EAH3 3N7LA 2E53A 3O1UA 4QHBA 1NE6A 4L9BA 5B4NA 3NO8A 5L7OB 2R073 4PQQA 3VBUA 1OLQA 2WNVB 4XEZA 3URFA 1GWKA 1UPSA 4NE9A 4QXHA 1BK1A 5F8PA 3VBHC 2ZPXA 4PDWA 2XONA 3B02A 4AVAA 4NN0A 2EICA 4JHTA 1B35A 1HN1A 5C9AB 4AGGA 5FZGA 1SLTA 1DZTA 2ZZJA 4YG6A 1BEV1 2EVXA 1F31A 2VZ1A 4OVEA 2HYKA 4QKFA 4V2VA 4HFSA 4XZUG 1Z78A 5AVAA 4BWOA 3H8UA 4FPEA 4J25A 4UFLA 3TOJA 2BGCA 4CP1A 1YIFA 5ABJB 3SEEA 3USUB 2P6HA 3GF6A 3J9SA 5CFDA 1MS9A 1SEFA 3MW2A 3FL7A 4AEKA 2XLAA 3SHRA 2A3XA 4EZ4A 1NOVA 4XUPA 5D1IA 2TUNA 5DUWA 1CPNA 3ZVXA 4FXKB 5CZKA 5J36A 1Q43A 5FY8A 5KC5A 1KXGA 5BNOA 1WMEA 3WHUA 1Q5OA 3GJBA 3WDTA 3WW3A 4CDQB 5FZOA 2JJ6A 3ZXGA 4XOGA 2MPFA 4RGKA 4QDSA 1UQXA 3U10A 2ZGLA 1LJ7A 1UOFA 4BQ1A 2DURA 1HRI3 2OPKA 1W8UA 1VR3A 3VZLA 4NHMA 3HNYM 1XNDA 3OUIA 3AZYA 3VBFC 1ZZ8A 4MHRA 2H0VA 3L2YA 4Y24A 2YZ4A 1MVEA 2FQPA 2BRTA 3H9AA 1FPN2 1GOFA 1IS5A 1GNHA 1DHKB 1TE1B 4EE2A 5D2AA 5BY5A 1BK0A 4XQ4A 2V72A 2AUYA 4ORFA 2VG9A 2R6QA 3LSDA 2ZEZA 2W1UA 2DCZA 1YFUA 3QLQA 4Q27A 2AEZA 3OGSA 4CRQA 3MV11 3WR0A 4C8DA 3B9IA 1WCUA 1OQDA 2HEWF 2ZMKA 4BXFA 3FUOA 1W04A 2BW8A 4FPYA 4KWLA 4M3CA 2VMCA 4EN0A 5EHDA 3BGAA 4XUOA 3OUJA 2FHRA 2JIGA 3M3QA 4ZPIA 2Y64A 3WNXA 1IG3A 1V6MA 3RYRA 1V9U1 1QOOA 3N3HA 4KWJA 1PK6B 2A3WA 4LO8A 4WVMB 4XETA 2EAKA 1TME2 4QX8A 3K51A 1HW5A 1I5ZA 1NKGA 2PTMA 3LKJA 4IESA 4IDZA 3LGRA 1Y9GA 4YGDA 3IDEA 3M1HA 2FDKA 2ZABA 2D93A 2AGSA 3HT2A 3RZZA 2NP0A 2W5FA 4FPGA 3SQOA 4BOWA 3A4UA 2PAKA 3RQ0A 1LENA 3WF3A 1NUKA 4LOSA 4UI9L 5DAXA 2YU1A 3VDBA 5FO8B 1RIRA 3CNAA 3NNMA 5JZGB 1OOPC 1HIXA 2WYSA 3T2TA 2RDQA 3LIHA 2YBKA 3VBFA 1WA4A 1O5UA 2KXLA 2HYXA 4CUGA 1SACA 4FFFA 1ULFA 3ZYRA 3B69A 4MG2A 1MZ5A 4FPJA 4QQOA 5FMOS 4O7XA 4LLFA 1DQ1A 1GP4A 1R091 3IWZA 4QX5A 3DYMA 5JSOA 3NNGA 1SCSA 2YHJA 3SEPA 3OCPA 5JXJA 1FI2A 4B29A 4IEZA 4PI0A 3GCWA 1S0DA 5FO9B 4B4QA 3ZLIA 5K0UC 1TNRA 1UCXA 2GAUA 1O4YA 2HWD1 3N9NA 4GKYA 1OKOA 4FTBA 1W2NA 2RS33 2XKPA 4UFKA 1RTVA 4XF3A 4AK3A 1BVP1 1CZTA 3OEAA 2JE9A 4QQHA 2EALA 3ZO0B 1JYVA 4Y3OA 2OXBA 4FPCA 2VXJA 5EV7A 3RDIA 2HWC3 3WDWA 3AK0A 4GMP3 2JE7A 2YYOA 3IMNA 1GICA 2Q8OA 2XBO2 2G9ZA 5A6XA 3RSJA 2XJUA 4ITCA 1LU1A 5A7OA 2XKOA 3GCXA 4CP9B 4AEMA 5T5PA 5DG2A 1NA1C 3SKVA 2E31A 5A33B 4IE7A 2BBVA 2CDOA 2BYVE 4XFFA 4AR2A 2D6NA 5CU1A 1OOPA 3CBNA 2GN3A 3NNJA 4FFHA 5D8AB 3QACA 3TNPB 1XNTA 1W6PA 4CU7A 3BUCA 1MACA 5T3NA 2B9UA 1KDMA 3ENRA 2PA7A 1W03A 1KRIA 3POFA 1MQTA 1WUVA 1F15A 3AB0A 1EPWA 2VW1A 1NG0A 4NPMA 3IB3A 1UU5A 2PHUA 3PHMA 1O59A 2BOIA 4GWNA 1EAH1 1JMUB 3R0RA 2W08A 4A3ZA 3TEYA 2P2KA 3KWVA 3KSCA
chains in the Genus database with same CATH topology
4XUQA 1XPWA 2VMDA 4AAXA 2R7EB 3CZJA 3HN3A 2VTFA 2CDPA 3T0AA 2WAAA 1ULOA 4GWIA 1UY1A 2BERA 3CIHA 1UMHA 4OUEA 4ZXEA 2ZXQA 3WNPA 4KWUA 5C7GA 2ZEWA 5HPOA 4QAWA 3HEIA 1W9SA 1JYWA 2VZQA 3C7HA 4CU8A 4KI5M 1WCQA 3C8XA 3MUY1 3LE0A 2J1EA 4M4PA 3I2FA 2VQTA 2WZ8A 1GNYA 3ETPA 3ECQA 2JE8A 2QQJA 2VM9A 4DXRA 1TVGA 4JKLA 3BN6A 1OF4A 4Z2AA 2E32A 3ZM8A 2JD9A 3I2GA 4UAPA 3GXUA 4DUWA 2ORXA 1JZ7A 3GGLA 3J7HA 1W8OA 1UMIA 2WBKA 2YB7A 3WF0A 3ACHA 3MO4A 3FHAA 4QB1A 4PT6A 1JU3A 2QQIA 1J84A 1W0NA 3CZUA 2W95A 1IQDC 2Z4FA 2J22A 2W1SA 3PUIA 4JKKA 4AG4A 2BZDA 1O8PA 4QX0A 2YC2A 1OD3A 3C7EA 3VD5A 3K4AA 3IAPA 3OB8A 4MADA 2EIBA 4QDRA 2Y6KA 2YG0A 2RV9A 3WNLA 2B9VA 2X09A 3VD4A 1H6XA 2ID4A 1GOHA 3PUHA 2QQLA 4DEVA 5LA2A 1PMHX 4DXTA 3T2OA 3K4DA 1WKYA 3I2HA 4QPWA 5I0DA 5C70A 1XC6A 3HPNA 3NJXA 5JXGA 4CU6A 2WAOA 4LQRA 4P5YA 5G04L 2DDUA 4RYDA 2X10A 2BBAA 3GDBA 2WQ8A 1YQ2A 3WNMA 2J1UA 4QDQA 3T2QA 4L0PA 5EIYB 2W3JA 1JYNA 4E8DA 4ARXA 3W5NA 1H6YA 1W8NA 2C9KA 2BGPA 2Y6GA 3HNMA 1UY3A 2WN3A 3E1F1 3C7FA 1UYXA 3CDZB 1JZ3A 1JZ5A 2VC9A 3HOBA 4QX2A 1JYXA 2VR4A 4BDVB 3JXSA 4MGQA 4A42A 1DLCA 1CZVA 3OGVA 2QQOA 1RYYA 1K42A 4TTGA 1JHJA 5JXIA 1EUTA 2VOTA 4FI9A 2Y6LA 4BK5A 2WUHA 1GU3A 4DUXA 1UYYA 4HG6B 2VZSA 3A7QA 4A45A 2WO1A 4W50A 4LKSA 2DCKA 1W9TA 2ZEYA 3UESA 5JUVA 1US3A 1UY4A 2WABA 1D7PM 1R64A 4XURA 3UNPA 5FUIA 1JZ2A 1GMMA 2VL4A 4ZY9A 1UXXX 4IUGA 1OT5A 4QX1A 1OH4A 4XUTA 4MOAA 3T2PA 3SKJE 4W8JA 3WF2A 3D3AA 3WNOA 2C4XA 1K3IA 2C26A 2W94A 2EIDA 3LQCA 2QQKA 5F7UA 3LPFA 1JU4A 4ET7A 3MBWA 3K75B 3P1IA 1W99A 1DP0A 3ABZA 3FN9A 4P02B 1MPXA 2J1AA 3WQBA 3T0BA 4QX3A 2XHNA 1UY0A 3OEBA 2W92A 2W87A 4A41A 4KMQA 3HJRA 4PF1A 2RVAA 3WF1A 2J1VA 5DMYA 3I2JA 4M4RA 1EUUA 5IFPA 3LEGA 3DYOA 3EYPA 2WZEA 4GWJA 1K12A 2W1WA 4OZOA 4YPJA 1W9WA 3IIIA 3K77A 2W47A 2HLEA 3VD7A 4DXSA 1F4HA 3I97A 2YC4A 2W91A 4W4ZA 4JHZA 1CX1A 5EJZB 4OYUA 2Y8KA 4A6OA 1DYOA 1PX3A 2VMFA 2LS6A 4MGSA 5IJRA 2X05A 2YFUA 1JZ6A 3DECA 3UETA 2VCAA 1K45A 1P8JA 3ACIA 5HXMA 2VZUA 3THCA 1NX9A 3CMGA 4XVHA 4XUNA 3MV01 1US2A 1JZ4A 4CUAA 3LPGA 2OKXA 1XNAA 2W1QA 3IAQA 3A22A 5DPNA 2XOMA 2ZEXA 3IDAA 3T0DA 4D8MA 3NRUA 3WSOA 3LEIA 5B4XA 1JZ8A 4P08A 2B4KA 4LPLA 2VQUA 3GM8A 2QBXA 2Y6HA 3I3DA 1CIYA 3EB7A 5C71A 1TG7A 2BGOA 1GUIA 3F2ZA 5B4NA 1UX7A 3NJVA 4PQQA 1J83A 4BJ0A 1OF3A 1L7RA 4JX0A 2XONA 2EICA 3WNNA 1HN1A 2V5DA 1SHWB 5IFTA 1SG3A 2WO3A 3OG2A 2VZ1A 2Y6JA 5DN2A 3CKHA 3OBAA 4XZUG 4OMCA 4ZZ5A 1UWWA 3K46A 1CZSA 3SEEA 3T08A 1F4AA 2VZRA 3FL7A 2RJ2A 1UZ0A 2KD7A 4XUPA 3I3EA 3OGRA 5CZKA 2ORZA 2V4VA 1I5PA 2DCJA 2PQSA 1UY2A 3C7OA 3P6BA 1UXZA 2WDBA 4QDSA 4LHSA 2VCCA 1UYZA 5LCWL 4JKMA 4QB2A 2VO5A 2E26A 2XQXA 3T09A 3HNYM 4D0QA 3DYPA 4CU9A 5G05L 3NQHA 5IYYA 4E8CA 3AC0A 1GOFA 5CYYA 4RN5A 1KGYA 2QQNA 2EIEA 2V72A 2VMEA 4DEQA 2ZEZA 2J1TA 2W1UA 2W46A 3OGSA 3MV11 4A44A 1O8SA 2VMCA 3BGAA 2J7MA 4XUOA 2J1RA 2Y64A 2LW8A 4BXSV 1T2XA 1GQPA 3MUZ1 2W9XA 4OMDA 1LNSA 5JXHA 2VJXA 1NKGA 1KEXA 3W5MA 5JR2A 4ARYA 2W5FA 3ACGA 3WF3A 1NUKA 3VDBA 4UI9L 3FHQA 5IHRA 2WYSA 4GZ9A 3I3BA 2YFZA 3ACFA 2HYXA 4CUBA 5EJ1B 3HNBM 3C7GA 1JI6A 3THDA 3DYMA 4CVUA 3NNGA 4DUVA 2L9LA 3WF4A 1PMJX 4QB6A 3SEPA 5J1XA 5JXJA 2VZ3A 3K4ZA 4BK4A 3VD3A 3VD9A 2VZVA 4UOJA 2WN2A 1L7QA 5A1AA 1CZTA 2VZOA 3OEAA 1JYVA 3LEKA 5JMOA 3I2IA 2JKXA 2VZTA 3CQOA 4P00B 1PX4A 2E33A 4MO3M 4A4AA 4ZZ8A 5LA1A 1ULPA 3I2KA 3SKVA 2E31A 2J1SA 3WEZA 2CDOA 3A23A 1GOGA 2QQMA 3VDAA 2VCBA 2JDAA 3A21A 1XNTA 2WO2A 4CU7A 4CUCA 4TXWA 3VDCA 1NAEA 2VZPA 3U37A 5DQ0A 3WNKA 1SDDB 3IB3A 1O59A 4A3ZA 1BHGA 5LA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUQ A;  1XPW A;  2VMD A;  4AAX A;  2R7E B;  3CZJ A;  3HN3 A;  2VTF A;  2CDP A;  3T0A A;  2WAA A;  1ULO A;  4GWI A;  1UY1 A;  2BER A;  3CIH A;  1UMH A;  4OUE A;  4ZXE A;  2ZXQ A;  3WNP A;  4KWU A;  5C7G A;  2ZEW A;  5HPO A;  4QAW A;  3HEI A;  1W9S A;  1JYW A;  2VZQ A;  3C7H A;  4CU8 A;  4KI5 M;  1WCQ A;  3C8X A;  3MUY 1;  3LE0 A;  2J1E A;  4M4P A;  3I2F A;  2VQT A;  2WZ8 A;  1GNY A;  3ETP A;  3ECQ A;  2JE8 A;  2QQJ A;  2VM9 A;  4DXR A;  1TVG A;  4JKL A;  3BN6 A;  1OF4 A;  4Z2A A;  2E32 A;  3ZM8 A;  2JD9 A;  3I2G A;  4UAP A;  3GXU A;  4DUW A;  2ORX A;  1JZ7 A;  3GGL A;  3J7H A;  1W8O A;  1UMI A;  2WBK A;  2YB7 A;  3WF0 A;  3ACH A;  3MO4 A;  3FHA A;  4QB1 A;  4PT6 A;  1JU3 A;  2QQI A;  1J84 A;  1W0N A;  3CZU A;  2W95 A;  1IQD C;  2Z4F A;  2J22 A;  2W1S A;  3PUI A;  4JKK A;  4AG4 A;  2BZD A;  1O8P A;  4QX0 A;  2YC2 A;  1OD3 A;  3C7E A;  3VD5 A;  3K4A A;  3IAP A;  3OB8 A;  4MAD A;  2EIB A;  4QDR A;  2Y6K A;  2YG0 A;  2RV9 A;  3WNL A;  2B9V A;  2X09 A;  3VD4 A;  1H6X A;  2ID4 A;  1GOH A;  3PUH A;  2QQL A;  4DEV A;  5LA2 A;  1PMH X;  4DXT A;  3T2O A;  3K4D A;  1WKY A;  3I2H A;  4QPW A;  5I0D A;  5C70 A;  1XC6 A;  3HPN A;  3NJX A;  5JXG A;  4CU6 A;  2WAO A;  4LQR A;  4P5Y A;  5G04 L;  2DDU A;  4RYD A;  2X10 A;  2BBA A;  3GDB A;  2WQ8 A;  1YQ2 A;  3WNM A;  2J1U A;  4QDQ A;  3T2Q A;  4L0P A;  5EIY B;  2W3J A;  1JYN A;  4E8D A;  4ARX A;  3W5N A;  1H6Y A;  1W8N A;  2C9K A;  2BGP A;  2Y6G A;  3HNM A;  1UY3 A;  2WN3 A;  3E1F 1;  3C7F A;  1UYX A;  3CDZ B;  1JZ3 A;  1JZ5 A;  2VC9 A;  3HOB A;  4QX2 A;  1JYX A;  2VR4 A;  4BDV B;  3JXS A;  4MGQ A;  4A42 A;  1DLC A;  1CZV A;  3OGV A;  2QQO A;  1RYY A;  1K42 A;  4TTG A;  1JHJ A;  5JXI A;  1EUT A;  2VOT A;  4FI9 A;  2Y6L A;  4BK5 A;  2WUH A;  1GU3 A;  4DUX A;  1UYY A;  4HG6 B;  2VZS A;  3A7Q A;  4A45 A;  2WO1 A;  4W50 A;  4LKS A;  2DCK A;  1W9T A;  2ZEY A;  3UES A;  5JUV A;  1US3 A;  1UY4 A;  2WAB A;  1D7P M;  1R64 A;  4XUR A;  3UNP A;  5FUI A;  1JZ2 A;  1GMM A;  2VL4 A;  4ZY9 A;  1UXX X;  4IUG A;  1OT5 A;  4QX1 A;  1OH4 A;  4XUT A;  4MOA A;  3T2P A;  3SKJ E;  4W8J A;  3WF2 A;  3D3A A;  3WNO A;  2C4X A;  1K3I A;  2C26 A;  2W94 A;  2EID A;  3LQC A;  2QQK A;  5F7U A;  3LPF A;  1JU4 A;  4ET7 A;  3MBW A;  3K75 B;  3P1I A;  1W99 A;  1DP0 A;  3ABZ A;  3FN9 A;  4P02 B;  1MPX A;  2J1A A;  3WQB A;  3T0B A;  4QX3 A;  2XHN A;  1UY0 A;  3OEB A;  2W92 A;  2W87 A;  4A41 A;  4KMQ A;  3HJR A;  4PF1 A;  2RVA A;  3WF1 A;  2J1V A;  5DMY A;  3I2J A;  4M4R A;  1EUU A;  5IFP A;  3LEG A;  3DYO A;  3EYP A;  2WZE A;  4GWJ A;  1K12 A;  2W1W A;  4OZO A;  4YPJ A;  1W9W A;  3III A;  3K77 A;  2W47 A;  2HLE A;  3VD7 A;  4DXS A;  1F4H A;  3I97 A;  2YC4 A;  2W91 A;  4W4Z A;  4JHZ A;  1CX1 A;  5EJZ B;  4OYU A;  2Y8K A;  4A6O A;  1DYO A;  1PX3 A;  2VMF A;  2LS6 A;  4MGS A;  5IJR A;  2X05 A;  2YFU A;  1JZ6 A;  3DEC A;  3UET A;  2VCA A;  1K45 A;  1P8J A;  3ACI A;  5HXM A;  2VZU A;  3THC A;  1NX9 A;  3CMG A;  4XVH A;  4XUN A;  3MV0 1;  1US2 A;  1JZ4 A;  4CUA A;  3LPG A;  2OKX A;  1XNA A;  2W1Q A;  3IAQ A;  3A22 A;  5DPN A;  2XOM A;  2ZEX A;  3IDA A;  3T0D A;  4D8M A;  3NRU A;  3WSO A;  3LEI A;  5B4X A;  1JZ8 A;  4P08 A;  2B4K A;  4LPL A;  2VQU A;  3GM8 A;  2QBX A;  2Y6H A;  3I3D A;  1CIY A;  3EB7 A;  5C71 A;  1TG7 A;  2BGO A;  1GUI A;  3F2Z A;  5B4N A;  1UX7 A;  3NJV A;  4PQQ A;  1J83 A;  4BJ0 A;  1OF3 A;  1L7R A;  4JX0 A;  2XON A;  2EIC A;  3WNN A;  1HN1 A;  2V5D A;  1SHW B;  5IFT A;  1SG3 A;  2WO3 A;  3OG2 A;  2VZ1 A;  2Y6J A;  5DN2 A;  3CKH A;  3OBA A;  4XZU G;  4OMC A;  4ZZ5 A;  1UWW A;  3K46 A;  1CZS A;  3SEE A;  3T08 A;  1F4A A;  2VZR A;  3FL7 A;  2RJ2 A;  1UZ0 A;  2KD7 A;  4XUP A;  3I3E A;  3OGR A;  5CZK A;  2ORZ A;  2V4V A;  1I5P A;  2DCJ A;  2PQS A;  1UY2 A;  3C7O A;  3P6B A;  1UXZ A;  2WDB A;  4QDS A;  4LHS A;  2VCC A;  1UYZ A;  5LCW L;  4JKM A;  4QB2 A;  2VO5 A;  2E26 A;  2XQX A;  3T09 A;  3HNY M;  4D0Q A;  3DYP A;  4CU9 A;  5G05 L;  3NQH A;  5IYY A;  4E8C A;  3AC0 A;  1GOF A;  5CYY A;  4RN5 A;  1KGY A;  2QQN A;  2EIE A;  2V72 A;  2VME A;  4DEQ A;  2ZEZ A;  2J1T A;  2W1U A;  2W46 A;  3OGS A;  3MV1 1;  4A44 A;  1O8S A;  2VMC A;  3BGA A;  2J7M A;  4XUO A;  2J1R A;  2Y64 A;  2LW8 A;  4BXS V;  1T2X A;  1GQP A;  3MUZ 1;  2W9X A;  4OMD A;  1LNS A;  5JXH A;  2VJX A;  1NKG A;  1KEX A;  3W5M A;  5JR2 A;  4ARY A;  2W5F A;  3ACG A;  3WF3 A;  1NUK A;  3VDB A;  4UI9 L;  3FHQ A;  5IHR A;  2WYS A;  4GZ9 A;  3I3B A;  2YFZ A;  3ACF A;  2HYX A;  4CUB A;  5EJ1 B;  3HNB M;  3C7G A;  1JI6 A;  3THD A;  3DYM A;  4CVU A;  3NNG A;  4DUV A;  2L9L A;  3WF4 A;  1PMJ X;  4QB6 A;  3SEP A;  5J1X A;  5JXJ A;  2VZ3 A;  3K4Z A;  4BK4 A;  3VD3 A;  3VD9 A;  2VZV A;  4UOJ A;  2WN2 A;  1L7Q A;  5A1A A;  1CZT A;  2VZO A;  3OEA A;  1JYV A;  3LEK A;  5JMO A;  3I2I A;  2JKX A;  2VZT A;  3CQO A;  4P00 B;  1PX4 A;  2E33 A;  4MO3 M;  4A4A A;  4ZZ8 A;  5LA1 A;  1ULP A;  3I2K A;  3SKV A;  2E31 A;  2J1S A;  3WEZ A;  2CDO A;  3A23 A;  1GOG A;  2QQM A;  3VDA A;  2VCB A;  2JDA A;  3A21 A;  1XNT A;  2WO2 A;  4CU7 A;  4CUC A;  4TXW A;  3VDC A;  1NAE A;  2VZP A;  3U37 A;  5DQ0 A;  3WNK A;  1SDD B;  3IB3 A;  1O59 A;  4A3Z A;  1BHG A;  5LA0 A; 
#chains in the Genus database with same CATH topology
 1XNK A;  4DPN A;  2IXK A;  2VMD A;  4AAX A;  2R07 1;  3OSD A;  5K0U A;  2JG8 C;  5CG8 A;  3ST7 A;  3POW A;  1X7N A;  2IXC A;  3T0A A;  1ULO A;  2GNT A;  3R4D B;  1Z7S 2;  1YXW A;  2C0Z A;  2ZGO A;  3O0X A;  4IND A;  3ETQ A;  1M06 G;  2CAU A;  1V6O A;  1VMH A;  5ANN A;  2MEV 3;  1W6Q B;  5GZF A;  1OQ1 A;  5CIS A;  2ZEW A;  1JS9 A;  1HX6 A;  1C28 A;  5C8C A;  3UK9 A;  2D6P A;  3N4M A;  1WW4 A;  3HEI A;  1JYW A;  2E6V A;  5H9Q A;  2VZQ A;  2CGO A;  1OQE A;  4KI5 M;  4LO7 A;  1LGN A;  5FDB A;  1AR7 3;  1ENR A;  3NKG A;  4UFH A;  1ZRD A;  4A6S A;  2VEC A;  2P3I A;  3VKL A;  3OBR A;  1LOF C;  2QTW B;  3D0J A;  5HV4 A;  2ZGN A;  4NUB A;  2D43 A;  2QKD A;  4FP3 A;  3I2F A;  2UWA A;  3ZSL A;  1WW7 A;  4EN8 B;  1DQ2 A;  5L7O A;  2ZGP A;  3VBR C;  3KS7 A;  5FP9 A;  4AQS A;  2JE8 A;  2QQJ A;  1NCR C;  4W6W A;  2WSV A;  1A6C A;  4V1P A;  5KHH A;  1X9P A;  5HBA A;  1Q8V A;  4Z2A A;  1IPS A;  4M3C F;  1H2M A;  1PIV 2;  3ZM8 A;  4F3J A;  3ZFG B;  1F5J A;  5C9A A;  1NY7 2;  2E7Q A;  2VBB A;  4BU2 A;  2VUA A;  4B1M A;  1VJ2 A;  1QOS A;  3LA2 A;  3CJI B;  1WW5 A;  4QPY A;  4E4Z A;  1UU4 A;  3FHA A;  3O14 A;  4ERO A;  3O1T A;  4CDX A;  5JPN B;  1JU3 A;  1Q8S A;  4JRA A;  4YVS A;  3CJX A;  3BVC A;  1QGL A;  3ZYG A;  5A3U A;  1ZRE A;  5ABJ A;  1EYB A;  2JDP A;  1J84 A;  3HD8 B;  3BIE A;  4BQW A;  1NCQ B;  3RFR A;  1IQD C;  1L7L A;  3S30 A;  2PAE A;  4WM7 B;  1AXZ A;  2JDU A;  1W2U A;  3SH4 A;  4ES9 A;  1PGS A;  2YGM A;  4QX0 A;  3AFK A;  1OD3 A;  3BCW A;  4OZX A;  4XC9 A;  3C7E A;  4IL7 A;  3R6S A;  1LED A;  2R1B A;  4EQV A;  1VAL A;  2EIB A;  1UO9 A;  5A6Z A;  4LBM A;  3FLR A;  5AC9 3;  1EV1 3;  4XW3 A;  1ZVF A;  1N1V A;  2X09 A;  1Q8Q A;  3VD4 A;  1H6X A;  4RHV 2;  4BIO A;  5FRE A;  3AP5 A;  3E6D A;  3PVE A;  2ES3 A;  4MGY E;  4LO4 B;  1W39 A;  1N47 A;  5GLU A;  3WLU A;  1SPP A;  3K4D A;  1GQG A;  1KJR A;  3VBR A;  2Z5W A;  1BBT 3;  1I3H A;  4QPW A;  1R1A 2;  3AKR A;  4MYE A;  1X36 A;  1F8V A;  1KS4 A;  1ZZB A;  4LHK A;  2QFE A;  1DLL A;  1YQC A;  3HPN A;  3NJX A;  1QH7 A;  3W9A A;  4YM2 A;  5LK7 B;  2BPA 2;  2LAL A;  2P3K A;  1W9F A;  1SLL A;  2ZAA A;  1MVQ A;  2HWF 3;  3GBF A;  1E5I A;  4RYD A;  3AMH A;  4Q26 A;  3KHC A;  1GP6 A;  2ARA A;  2KA3 A;  2J1U A;  4P9G A;  4Q1P A;  4QDQ A;  4COU A;  3FBM A;  4K8R B;  4MGT A;  2VUJ A;  5F5Q A;  2XJV A;  5I93 A;  4LIV A;  4PLO A;  4YG0 A;  1RMU 2;  3HT1 A;  2WR9 A;  1W6N A;  4RR3 B;  4YVW C;  4YW1 A;  5BXX A;  3ZXE A;  2ATF A;  2UU8 A;  3FLP A;  3CO2 A;  2ZGQ A;  2WFF 2;  3VZM A;  4WVM A;  5F5I A;  5FP7 A;  3W5N A;  4JC1 A;  1DZQ A;  2WNU C;  4HOO A;  2BGP A;  1S2E A;  1VB4 A;  2YBS A;  2RS3 1;  4AVV A;  2WQZ C;  4LBQ D;  2IC1 A;  1YQ8 A;  2PMW B;  2RG4 A;  5C6C A;  2BFU S;  3OPW A;  3ZFE C;  1UYX A;  1H1I A;  1JZ5 A;  2ET1 A;  2YU2 A;  2OT7 A;  4TN7 A;  2FZ1 A;  2HWC 1;  1G86 A;  3BKZ A;  4GMP 1;  1JYX A;  4BDV B;  3AZX A;  3VDD C;  5JZG A;  1JYI A;  4I09 A;  4MGQ A;  1AYM 3;  5LA9 A;  5CIR A;  4A42 A;  4HSJ A;  1HQW A;  1YYN A;  1WZX A;  1RYY A;  3LDK A;  1DCS A;  1PZ8 A;  2HKX A;  4GB3 3;  1DQ6 A;  4FCA A;  4KBZ A;  2D3S A;  4LBJ A;  4XBN A;  3ZKY A;  5DG1 A;  3AP7 A;  4E4S A;  1ZBA 3;  3LOI A;  5JXI A;  3DPR B;  4BK5 A;  2VY0 A;  2F4L A;  1COV 2;  4GAZ A;  3ZXD A;  3LWC A;  3EJK A;  2WUH A;  3QD6 A;  1GU3 A;  5GLZ A;  3G7D A;  5FY0 A;  4XYX A;  3A7Q A;  4AEJ A;  4XMI A;  4RHV 3;  3QH7 A;  1UZY A;  1US3 A;  3PVN A;  3FLT A;  2ARX A;  5DZG A;  4EZH A;  1HB4 A;  1UY4 A;  2WL1 A;  3J7M A;  1R64 A;  4LKE A;  4YVW A;  3E6C C;  2Q8E A;  2BJS A;  3OD4 A;  1QJY 3;  3UNP A;  5FUI A;  3AVS A;  1GMM A;  2VCM A;  4IUG A;  1WMD A;  1OT5 A;  3ZX7 A;  4QX1 A;  1JYC A;  4XUT A;  2JG9 C;  4O9G A;  3SKJ E;  2WNU A;  3ZIX A;  3V0B B;  1ND2 A;  1X33 A;  3SH3 A;  2D97 A;  2SLI A;  2VMH A;  2C26 A;  1RIN A;  3ATG A;  1HQN A;  2EID A;  3M3E A;  4ISR A;  1LTE A;  4CCD A;  1QMJ A;  2P37 A;  1FMD 3;  5F7U A;  3BTZ A;  3O1R A;  4X6Q B;  2OUJ A;  1BEV 2;  4QHO A;  4ET7 A;  2FDI A;  4PBP A;  1H4G A;  3OTF A;  4Y33 A;  5FYS A;  1WCK A;  1W90 A;  2MEV 1;  1BCX A;  3VDD A;  2BQP A;  4LIU A;  1MS0 A;  1GWL A;  4AOC A;  1WLC A;  5D8A A;  2KR2 A;  2Q30 A;  2XG3 A;  3OF1 A;  4YNI A;  3SC7 X;  1WBF A;  2XHN A;  4HKL A;  3AYD A;  5JI7 A;  2ZHN A;  1AR7 1;  5FZF A;  5IVC A;  1DZR A;  2HJI A;  2W87 A;  5AFE A;  5A3M A;  1RUI 3;  3POG A;  4JGZ A;  4NAM A;  4NRQ A;  4Y5Z 0;  1RHI 3;  2EA7 A;  3LIG A;  5LB6 A;  2J1V A;  1BVV A;  5DMY A;  3J7N A;  1OPO A;  1FYU A;  4OI0 A;  5FMO L;  5A3W A;  3VBU B;  5F6L B;  2W1W A;  4PDW B;  3WP4 A;  3K77 A;  2W68 A;  2IXL A;  2WII B;  1B35 B;  1C1F A;  3CLP A;  4QKN A;  4DXS A;  3I97 A;  3H1W A;  3M7A A;  2W91 A;  3AFG A;  4CEY B;  5APA A;  2ZGK A;  3IKW A;  4NVP A;  2RDN A;  4A6O A;  1PX3 A;  2JG9 A;  3ZMN A;  1VRH 3;  2LS6 A;  1CAU A;  2YGL A;  5A7W A;  4AFD A;  2JEM A;  2H0B A;  3MFA A;  4L2N A;  3QH6 A;  5BYN A;  2YFU A;  1JZ6 A;  2PYT A;  5DAB A;  1FNZ A;  2YV8 A;  3SIT A;  4AI2 A;  4AYU A;  1IS4 A;  2GC1 A;  2VCA A;  1K45 A;  3ROU A;  4AED B;  1SFN A;  1OC1 A;  2C9A A;  3RI8 A;  1S0J A;  2JDK A;  2VZU A;  1ND3 C;  2JEN A;  4H3W A;  5F3G A;  4XUN A;  5BNO B;  5IK8 A;  1US2 A;  5JI9 A;  3H8O A;  3MIE A;  2VMI A;  2VVF A;  3KHB A;  1V9U 2;  3MPB A;  3OOX A;  3R4S A;  5EYX A;  5FXZ A;  2OKX A;  2DUO A;  5FZI A;  5AC9 1;  2EXJ A;  1JW6 A;  1EV1 1;  3H1M A;  4XDP A;  3ZYF A;  3T0D A;  2JX9 A;  5FZC A;  5BNQ A;  4LBQ B;  4AF9 A;  5GLT A;  4P08 A;  3PTY A;  3F95 A;  5FPZ A;  1VAM A;  2B4K A;  1O7F A;  3NV2 A;  4KG8 A;  4HXC A;  5DAW A;  3ZFG A;  3E5Q A;  1J58 A;  5FPX A;  1F9K A;  1BEV 3;  5CAZ A;  1BBT 1;  3U14 A;  4HON A;  2VUD A;  3TN9 3;  3VBH B;  2QBX A;  3MYX A;  1GZW B;  1HB3 A;  3I3D A;  5B2G B;  5JPM B;  3EB7 A;  1J59 A;  2D6L X;  3N9Q A;  1HJF A;  2BU9 A;  2ZCW A;  1U5Y A;  2BGO A;  1NCQ A;  1H1A A;  2CGP A;  2G4I A;  2IXJ A;  4HLT A;  4PIX A;  2HWF 1;  2YC0 A;  2F4P A;  4WM7 A;  1UX7 A;  1R09 2;  3NJV A;  4GUL A;  2IUW A;  5JR7 B;  3ZN6 B;  1RUD 3;  1UMZ A;  1XE8 A;  4I02 A;  4BJ0 A;  4C0H A;  5DAP A;  3H0O A;  1AR8 3;  4CXY A;  4CSW A;  1YQ6 A;  4XJ9 A;  3Q8E A;  1BXH A;  5EWS A;  1JOJ A;  3B9C A;  5FZ7 A;  2WT1 A;  3POY A;  3CU7 A;  2HWD 2;  5IFT A;  1W8F A;  3S7E A;  2B8M A;  2JEC A;  3DUI A;  1FAT A;  2Y6J A;  5DN2 A;  3ZXK A;  4OMC A;  2FCU A;  3JU9 A;  3D82 A;  3K46 A;  4IEP A;  4CDU C;  2I45 A;  2D5F A;  5FP4 A;  3T08 A;  3WG4 A;  1ODN A;  2DFC A;  2VZR A;  2I2S A;  3BTY A;  4XTM A;  2DVB A;  1QXR A;  5GLV A;  2KD7 A;  3NW4 A;  1LHV A;  1UIJ A;  1IPJ A;  4GD4 A;  3IMM A;  2ZBJ A;  1NZC A;  2ORZ A;  4IXL A;  4Y5S A;  3SH5 A;  1LOC A;  2C1F A;  1AYM 1;  2ADD A;  1I5P A;  2DCJ A;  2Q8D A;  3C7O A;  3VBF B;  5C3Q A;  2A73 B;  3WUD A;  4Q1R A;  1UXZ A;  4GB3 1;  3LEM A;  1AXK A;  3MW4 A;  5IVE A;  1PGW 1;  2Y0O A;  4CXW A;  4EJR A;  3FZ3 A;  1U5Z A;  1ZBA 1;  2WFP A;  5IVY A;  1HXS 3;  4JV4 A;  3MZH A;  4GH4 C;  4RS5 C;  2A1X A;  2X29 A;  5KHG A;  4RR3 A;  2ZML A;  3RMX A;  1DYK A;  1S55 A;  4XXA A;  3DYP A;  4KG0 A;  2OQ7 A;  3LA7 A;  5FYU A;  2FMD A;  3VL8 A;  4BQ5 A;  4OI1 A;  4LIT A;  4O65 A;  2OQ6 A;  1EAH 2;  5IYY A;  3AMP A;  3HMY A;  3GZA A;  3W59 A;  5J37 A;  4TLG A;  2XVK A;  3OGG A;  4P14 A;  1OSG A;  3VKN A;  2R07 2;  3LA3 A;  2EIE A;  2UWB A;  1QJY 1;  4R9C A;  1I9R A;  4XQD A;  2CYF A;  1PMI A;  1UX6 A;  3VBS C;  1IS3 A;  3GAL A;  4AHY A;  5EQU A;  1H4H A;  1PHM A;  1O8S A;  4JQT A;  4K7J A;  1FMD 1;  4AVT A;  2LW8 A;  1S0I A;  3ZYJ B;  3U0Z A;  1G9F A;  3I7D A;  2F6B A;  2JDZ A;  4YAR A;  4JQR A;  1OOP B;  4ES8 A;  3WY6 A;  4QHZ A;  4OMD A;  4MLO A;  4UBG A;  4JZR A;  5EZW A;  2FMY A;  1W6P B;  2XVG A;  3GZE A;  2GAL A;  1A78 A;  1J3Q A;  4HBN A;  3IDB B;  1MQT B;  1YI7 A;  2VOW A;  1RUI 1;  2CHH A;  3ACG A;  4NII A;  1OVS A;  4P9L A;  1YFX A;  1RHI 1;  3ON7 A;  2XQR A;  2B42 B;  4CCC A;  3FHQ A;  2VXR A;  4RS5 A;  1A34 A;  1W2A X;  1O6U A;  3LDB A;  2DVF A;  5FY7 A;  4Y26 A;  1IOA A;  3JD7 3;  5K0U B;  4CUB A;  5HCF A;  3V0A B;  4OQ9 A;  4K6B A;  4FOW A;  3WHT A;  3HNB M;  5FCC A;  3PNA A;  4NMI A;  3T3Y A;  5IAV A;  4FOY A;  4RQP C;  4JTO A;  4X8P A;  2YDE A;  4H2A A;  5FUN A;  3CHX A;  2D5H A;  1U0A A;  3MPP G;  3ORJ A;  2RS1 1;  4BK4 A;  1RUJ 3;  1ZBE 3;  3GHN A;  3SCF A;  1VRH 1;  4ZHN A;  3VD3 A;  1FAY A;  2MHF A;  2V73 A;  4AHZ A;  3H3Z A;  1GNZ A;  3VB9 A;  2BFU L;  4LLO A;  5J09 A;  2R06 3;  4CPB D;  1NA1 B;  4LHN A;  4YM1 A;  5A1A A;  4B7E A;  2RM2 3;  2VBD A;  1CES A;  4HPK B;  1E5S A;  4QGL A;  5JMO A;  1PVC 3;  2HEY F;  3I2I A;  5DZF A;  1WLD A;  2JKX A;  2YRO A;  4WZC A;  4IE6 A;  1VIW B;  2VZT A;  4QPG C;  3CQO A;  4UW4 A;  1H8T C;  1UD1 A;  2DBN A;  5FP3 A;  1AR6 3;  3B3Q E;  3FX3 A;  2FDH A;  1FV2 A;  3LD8 A;  4IEU A;  4CCM A;  4A4A A;  4ZZ8 A;  1R08 1;  4TWT A;  2A6V A;  1DGW X;  2EAA A;  1D0H A;  4EV0 A;  2OII A;  2UY9 A;  1OLM E;  4CEY A;  2VNV A;  1UKG A;  4LE4 A;  2WO2 A;  2JG8 B;  3DKQ A;  3SCH A;  4D7T A;  4CUC A;  4TXW A;  2HBU A;  3N7K A;  1MS1 A;  1NAE A;  2VZP A;  2ERF A;  2IZW A;  4Q4W 1;  4YW6 A;  2UYA A;  4YVS B;  3TN9 1;  4CDX B;  5DQ0 A;  3VZN A;  3WNK A;  4AHW A;  1NLR A;  4S2D A;  3Q9O A;  4D7S A;  2Y38 A;  1S1A A;  5FY5 A;  2ILM A;  3AM2 A;  5LAS A;  1QU0 A;  5LA0 A;  4AED A;  1SFY A;  3NWK A;  2ETE A;  3FMG A;  3TBD A;  3CZJ A;  2VTF A;  1RUD 1;  2CDP A;  5EPA A;  1GP5 A;  5LBC A;  2P6C A;  2VW2 A;  1AR8 1;  3ZSK A;  1YEW A;  1ZZ7 A;  4GWI A;  4E9K A;  2BER A;  1CR7 A;  3JCI A;  3X29 B;  3CIH A;  5JOY A;  2JB8 A;  4OUE A;  3VBO A;  3WW1 A;  1PM7 A;  2GNM A;  5FZB A;  5CKN A;  2ZXQ A;  3PDQ A;  2VTX J;  4IEY A;  4UYB A;  5JIU A;  5GJ6 A;  4QAW A;  4QPG A;  4LBQ A;  2RS3 2;  4AVS A;  1BQP A;  2YPD A;  3MFC A;  1MEC 3;  5IK5 A;  5F5C A;  1H8T A;  2VQA A;  4KU8 A;  1SPP B;  3VBR B;  3BOP A;  4NPR A;  1VBA 1;  1WCQ A;  3AP9 A;  5TSW A;  2C24 A;  3MUY 1;  5I0S A;  1NLQ A;  2DU1 A;  2HWC 2;  3TWI A;  1ZRI A;  2J1E A;  2OX0 A;  1DGR A;  3DN7 A;  3MLJ A;  3VBH A;  1OVP A;  5FZH A;  1GZW A;  3WIN E;  4LBL A;  3VKO A;  2OYZ A;  3WCR A;  1IPK A;  2ZX2 A;  4L92 A;  4CCK A;  3N9L A;  1V0A A;  4QQL A;  2GC2 A;  4FSJ A;  2K46 A;  2WZ8 A;  2A3Y A;  1GNY A;  2B45 X;  3Q8B A;  3ECQ A;  3ZN6 A;  2QDR A;  1JOP A;  3BN6 A;  5FO7 B;  4BQ2 A;  1HXS 1;  2C6S A;  2X5I C;  1QIQ A;  2JD9 A;  4DOU A;  1W6N B;  4MXV A;  5KWR A;  1X9T A;  2DBI A;  4Q4X 3;  1JZ7 A;  3MIB A;  3J7H A;  3U1X A;  1HV1 A;  2DTY A;  4FFI A;  2WBK A;  2YB7 A;  5HCA A;  1D4M 3;  1OD5 A;  5C4W C;  1PO2 3;  3MO4 A;  4QB1 A;  1Y7B A;  3CF6 E;  5FYT A;  4H7L A;  2WSU A;  4ONU A;  1H0B A;  1OLR A;  2QQI A;  4X6R B;  3THT A;  3EBR A;  3BI3 A;  3CZU A;  2JB4 A;  2QJV A;  2W1S A;  1ST8 A;  3RZJ A;  5F3I A;  4JKK A;  3WQ1 A;  1HB1 A;  1HJG A;  4AG4 A;  5KXE A;  4XFG A;  3H7Y A;  1ZA4 A;  3LSE A;  3MIH A;  4Z07 A;  4FT8 A;  3VD5 A;  1I1E A;  2ENR A;  1UZZ A;  5LRS A;  4OI2 A;  3KV6 A;  1JBC A;  5FZ9 A;  1OFS A;  2MEV 2;  2WZR 3;  4LK6 A;  5K7P A;  3BTX A;  1AX2 A;  2RMU 3;  4W6X A;  4IEX A;  4XBQ A;  4IGQ A;  3PUH A;  2QQL A;  3MF9 A;  5LA2 A;  1AR7 2;  5FYI A;  3ZSJ A;  2FD8 A;  4JVA A;  3S5Q A;  2ZGT A;  1GAN A;  4DXT A;  3T2O A;  1J1T A;  5FPV A;  4D0Q A;  1WKY A;  5FZ8 A;  3UYJ A;  2XPJ A;  2ARC A;  1H30 A;  2AYH A;  3M70 A;  4N7I A;  5I0D A;  5L9B A;  4CEW C;  1YFY A;  1SLA A;  4D6S A;  3CL1 A;  4ISQ A;  3UKN A;  2Z69 A;  5KHJ A;  1VMF A;  5JXG A;  2P3Y A;  1AL2 3;  3RS6 A;  4YVW B;  4CU6 A;  3AMQ A;  5ACA 3;  2WAO A;  5FZ3 A;  5CEH A;  4LQR A;  1M4W A;  4P9Y A;  5G04 L;  3RYK A;  4D94 A;  4JDO A;  2VW0 A;  4OI4 A;  3JD7 1;  4WZF A;  4AQT A;  5C4W A;  5KBF A;  1S0E A;  2QUO A;  3KCC A;  4YW2 A;  2BV4 A;  2WT2 A;  3GDB A;  3ZIW A;  3UGF A;  4EWE A;  2WNU B;  1AJO A;  1K5J A;  1ND2 B;  2XWB B;  4XF1 A;  3WNM A;  4V2W A;  1LOG A;  3ILF A;  1X8M A;  2DUQ A;  2VU9 A;  4YFW A;  1QOT A;  3LFI A;  3NJY A;  5LY2 A;  5JOZ A;  5KHI A;  1RXG A;  4NWW A;  3ZFE B;  2VH9 A;  1UZV A;  3PLQ A;  4J1X A;  2W3J A;  3QCW A;  4P9I A;  3VDD B;  1X50 A;  1BLZ A;  4HVQ A;  4IV3 C;  1RUJ 1;  1ZBE 1;  3BB6 A;  3WT3 A;  1Q3E A;  4E8D A;  5SV5 A;  4XDO A;  5L36 A;  1VBE 3;  2PXJ A;  4BLI A;  3LB9 A;  2Y6G A;  3FJS A;  2R06 1;  3HNM A;  2WN3 A;  4NOT A;  2RM2 1;  3KQR A;  1AYN 3;  4JGZ B;  1NQD A;  1JZ3 A;  3B5L B;  1RGS A;  4N9I A;  1PVC 1;  4IW3 A;  5T54 A;  3ILR A;  3PTR B;  1S0C A;  2D6O X;  4NRP A;  1JTZ X;  2JDN A;  1LHN A;  4WBB A;  3PJQ A;  1QWR A;  5AC9 2;  4XDQ A;  4E2Q A;  2RR1 3;  4AXO A;  1DLC A;  1EV1 2;  1CZV A;  3NJZ A;  3OGV A;  1AR6 1;  2NQY A;  4ZU5 A;  4MUV A;  5FXX A;  4CEW B;  4B4R A;  3TYJ A;  3V0A A;  2CNA A;  1GQH A;  2DVA A;  4Y1X A;  4N53 C;  1K42 A;  4TTG A;  3KF3 A;  4AQ2 A;  1JHJ A;  1EUT A;  2VOK A;  4Y4Y A;  1QDC A;  2B39 A;  4HKW A;  4GWM A;  2XML A;  1BBT 2;  2ZGM A;  4I0B A;  3AP4 A;  5GKA C;  3PIG A;  5JLV A;  2PFW A;  2JG9 B;  1CAU B;  1WD3 A;  3LZZ A;  4W50 A;  4LKS A;  5A7W B;  3NNF A;  2WA4 A;  4PHZ A;  4CCJ A;  4FOV A;  4Z8B A;  2Z2S B;  3T4V A;  4GQ7 A;  2HWF 2;  5JDB A;  1C8N A;  1D7P M;  1NA1 A;  2VBP A;  4A7Z A;  3O0W A;  1S0G A;  4NWV A;  4XUR A;  3VHR A;  2WRA A;  4IV1 C;  4YYO A;  4HPK A;  3W20 A;  2VL4 A;  1LEC A;  1NLS A;  3INA A;  2XXZ A;  4IEO A;  4ZY9 A;  4HMZ A;  4AFA A;  1WGP A;  4IET A;  1OH4 A;  4DY5 A;  5T50 A;  1QNY A;  3AXD A;  3WF2 A;  3WNO A;  1O4Z A;  2W94 A;  4IEQ A;  3ZYP A;  3T30 A;  3LPF A;  3JUU A;  1JU4 A;  1KFX L;  3K75 B;  3MBW A;  1KS5 A;  1MZE A;  2OW4 A;  1W99 A;  3P1I A;  4XCB A;  1G9D A;  4BPZ A;  4PLN A;  1CAV B;  3ABZ A;  3FN9 A;  4OUL A;  5F3E A;  4UXA A;  3U78 A;  4CDQ C;  5KC6 A;  1RUO A;  1LOE A;  1MEC 1;  1CD3 G;  4QX3 A;  1YJK A;  2JG8 A;  2ZX0 A;  3THP A;  2E51 A;  1V6K A;  3OEB A;  3O1V A;  4OCT A;  2W92 A;  4E2G A;  2GC0 A;  4N53 A;  1DBN A;  4PF1 A;  5KXB A;  1AYM 2;  4ZXK A;  4DQA A;  1AUY A;  4QU1 A;  3WF1 A;  3ZYB A;  2JKB A;  1ENQ A;  3DGT A;  2R04 3;  4M4R A;  4GB3 2;  2OZ6 A;  5FZ0 A;  3H3U A;  1PGW 2;  3IZO A;  4P9J A;  1ZBA 2;  3SMH A;  2WZE A;  1XYO A;  5FOJ B;  3V56 A;  4K8F A;  1A8D A;  1WMX A;  3IDC B;  1VBD 3;  1W9W A;  2DCY A;  3I59 A;  1H9W A;  5JIA A;  4RD7 A;  1GFF 2;  4A2U A;  4IV1 A;  2YC4 A;  5JVV A;  2WLP A;  4W4Z A;  3T1M A;  5JCT A;  2WC2 A;  4Q4X 1;  1ND3 B;  4OYU A;  1LOF A;  3R05 A;  1C8M 3;  2WKK A;  1D4M 1;  2Y8K A;  1DYO A;  4E4H A;  3N9O A;  1PO2 1;  4MGS A;  4GA9 A;  4YLZ A;  4QXC A;  5IJR A;  4W6Y A;  1BKZ A;  2X05 A;  2H6B A;  1QQP 3;  3DEM A;  1QJY 2;  3P5B A;  4XFI A;  3DEC A;  3M2M A;  2A7A A;  2OPW A;  1NCR A;  4LO5 B;  4LA2 A;  3ZPY A;  1D4V B;  1VAK A;  2ZS6 B;  3ACI A;  1OA2 A;  4ZU4 A;  5A3P A;  5HXM A;  5HCH A;  3GZU C;  3H8X A;  3THC A;  4Q4V 3;  1NX9 A;  2Q8C A;  3IT8 A;  1CAX B;  1FMD 2;  1WD4 A;  3MV0 1;  5DXD A;  5F39 A;  4S2F A;  1IKP A;  2P17 A;  2A70 A;  4A3X A;  3ZFF C;  5GZG A;  2GME A;  1YJL A;  3BTA A;  2W1Q A;  3IAQ A;  2BVV A;  2WZR 1;  3O12 A;  4IE4 A;  3POB A;  1UAI A;  4UF0 B;  4AFC A;  4EYU A;  2XOM A;  2RMU 1;  3IN9 A;  4D8M A;  5B4X A;  3ZR5 A;  5FZE A;  4N90 A;  1RUI 2;  5FBZ A;  4NRO A;  4G9S B;  1RHI 2;  1KJL A;  4Z1V A;  3S5A A;  1KFU L;  1ULD A;  4LUL A;  4Q8K A;  4L11 A;  4LUK A;  1PVX A;  4R9B A;  1YRZ A;  1CIY A;  2WS9 3;  3I49 A;  4QGM A;  3Q8C A;  1AL2 1;  5ACA 1;  5C71 A;  5IT6 A;  4R52 A;  1UU6 A;  3F2Z A;  4FAG A;  5IVB A;  1CJP A;  1W2O A;  3H3L A;  3I3Q A;  4COV A;  3U4X A;  1AXY A;  1CQ9 A;  2XHK A;  4DB5 A;  5BNP C;  2OVU A;  4CDU B;  2Q1F A;  4QQP A;  1LEM A;  1L7R A;  1AHS A;  1WA6 X;  2IWG B;  3S7I A;  4AL9 A;  4HL0 A;  2V5D A;  5DUV A;  2RS1 2;  1SHW B;  1SZB A;  1E5H A;  2R49 A;  4K9S A;  1VRH 2;  3ASI A;  4H55 A;  4CXX A;  2VNO A;  2P5B A;  2E63 A;  4MVT A;  4XXP A;  2EXI A;  1SDW A;  2WO3 A;  4CPB A;  5A6Y A;  3OBA A;  1G9A A;  1JXN A;  1VBE 1;  4HK8 A;  4YGB A;  1UWW A;  4CZS A;  3ZFF A;  2IVJ A;  5FXV A;  1ASJ 3;  2AEY A;  2N7G A;  1AYN 1;  4MV2 A;  4UW6 A;  2RJ2 A;  1OH3 A;  2EXK A;  1UZ0 A;  1LOB A;  2GSY A;  5DDJ 3;  5EFU A;  1TNF A;  1VPH A;  3OGR A;  3BAL A;  1VRB A;  2CSG A;  4GH4 B;  5FKB A;  4RS5 B;  4Y1Z A;  4COY A;  1ZZ9 A;  3MID A;  4AZZ A;  2RDS A;  2V4V A;  5ANQ A;  3WQ0 A;  5HXV A;  2HEV F;  2RR1 1;  1R08 2;  4U36 A;  4Q0V A;  4NIG A;  4ASL A;  3P6B A;  5HV0 A;  3RYP A;  2VTX A;  2WDB A;  3I2D A;  5JSP A;  4NR1 A;  3POJ A;  2LRO A;  3RVH A;  4LBK A;  3M3C A;  2ZGU A;  1H8V A;  4GJZ A;  4KWK A;  1WLT A;  2SBA A;  2BVB A;  2CWM A;  3J7L A;  5LCW L;  2DWR A;  2OZJ A;  4Q5O A;  1QJX 3;  4JKM A;  2YMZ A;  4QB2 A;  1H1M A;  3ZFE A;  4M0H A;  1SQ4 A;  2VO5 A;  1QHD A;  3VHO A;  4X8N A;  3T09 A;  1BMV 2;  4Q4W 2;  3TN9 2;  1OLM A;  3AVR A;  3VBS B;  4R4Z A;  5G05 L;  3NQH A;  5FPB A;  2ARE A;  2DYC A;  4PQ9 A;  1GZC A;  3WP6 A;  4E8C A;  2ZGR A;  3AC0 A;  3ME2 A;  4J6G A;  5CYY A;  4L99 A;  5A7Q A;  4Q0S A;  2QQN A;  1PNF A;  1HN0 A;  3ES1 A;  2WJS A;  3O7O A;  2XLF A;  3S57 A;  3T4H B;  2VME A;  1RUD 2;  2IFW A;  4AVC A;  3RG0 A;  2J1T A;  3WDV A;  1LGC A;  1UZW A;  1YUD A;  1ZRR A;  1AR8 2;  2W2I A;  2VOV A;  3HQU A;  1QH6 A;  4O9E A;  4A44 A;  4AI1 A;  4OQ8 A;  1YC6 1;  3VHP A;  3N9M A;  5FLJ A;  4YW4 A;  4LBN A;  4XF0 A;  4AWD A;  5F3C A;  4XFB A;  4N9H A;  4NAO A;  3HQX A;  4M01 A;  1OUS A;  2C5D A;  2WIN B;  3APB A;  3JB8 A;  4BXS V;  1JHN A;  1RUE 3;  1GQP A;  1T2X A;  2CAV A;  3MUZ 1;  1VBA 2;  1ZYB A;  1ZZ6 A;  5JXH A;  1W8Z A;  2VJX A;  1WBL A;  5CVR A;  4GXL A;  1KEX A;  4Z2W A;  5A80 A;  3W5M A;  5JWP A;  2V4A A;  5FY9 A;  4ARY A;  4B3N A;  1GSL A;  2RS1 3;  1ULG A;  1AL0 G;  4EN6 B;  5FYH A;  1VBC 3;  3AZV A;  3SLI A;  5AFB A;  2VE1 A;  5IHR A;  4IEW A;  4PIZ A;  5FYV A;  1XSR A;  2R04 1;  3CJI C;  4GZ9 A;  2ZX4 A;  2YFZ A;  5CFC C;  3ACF A;  1N1Y A;  3KF5 A;  1HXS 2;  2G9G A;  1RUG 3;  4E4D X;  1XSQ A;  2R0F A;  3U07 A;  2W52 A;  3I3M A;  4YZ2 A;  1JI6 A;  3UT0 A;  1CPM A;  1QJF A;  1VBD 1;  3THD A;  4XF9 A;  3J8F 3;  1J3R A;  1V70 A;  2A5Z A;  1DGW A;  1DQ5 A;  2L9L A;  3AJZ A;  3ES4 A;  3VBO B;  1GR3 A;  4DUV A;  1R08 3;  1PMJ X;  1RC6 A;  4ASM B;  3HBZ A;  5J1X A;  3E5U A;  1IZ3 A;  2VZ3 A;  3K4Z A;  1C8M 1;  3M3I A;  4QPG B;  5I8T A;  4DZG A;  1S0B A;  3EMR A;  3PUA A;  1CAV A;  5FJH A;  5FPL A;  4Z92 B;  1H8T B;  3ZDS A;  4UT5 A;  1OA4 A;  4OHW A;  2VZV A;  2G9F A;  4UFJ A;  5F5A A;  2JD4 A;  1QQP 1;  4UOJ A;  1C1L A;  3SNM A;  3TEZ A;  1L7Q A;  2VZO A;  4Q4W 3;  4JDM A;  1FNY A;  4L97 A;  3VHN A;  2QQW A;  3KT4 A;  4K1Z A;  1W06 A;  4WVW A;  5IAX A;  3LEK A;  3OPT A;  5BPX A;  1FOD 3;  2Q1Z B;  3VKM A;  4GJY A;  2AH2 A;  2CTV A;  2P3J A;  1U5I A;  3C2U A;  1FT9 A;  4IEV A;  4JGY C;  4Q4V 1;  5J7M A;  3HR9 A;  2RJK A;  4HET A;  1Q8P A;  1R1Z A;  3RRD A;  4NPL A;  1VE0 A;  4P00 B;  4AFB A;  2FZ2 A;  1PX4 A;  1SBF A;  2UYB A;  4MO3 M;  4RL7 A;  5C3O A;  3I2K A;  1UIK A;  3HIF A;  1JYT A;  3LDR A;  2J1S A;  4LUM A;  4C91 A;  3GBW A;  1AR9 3;  4JAA A;  3A23 A;  5I0R A;  1GOG A;  2QQM A;  3VDA A;  1DGL A;  4YZ3 A;  5FYY A;  3N9P A;  5FUP A;  2VCB A;  2JDA A;  4NO4 A;  4WV8 A;  2ZHK A;  3O1S A;  1UF2 C;  4F7Z A;  1W6M A;  2HWB 3;  4JTN A;  1ND3 A;  2D7F A;  4HSL A;  3UJO A;  2FCT A;  4WVZ A;  5CFC A;  3G6J B;  2LUW A;  4XE9 A;  3O1O A;  3OD0 A;  1ENS A;  1QJZ A;  3FC0 A;  3U37 A;  4CDW C;  4OFG A;  1SDD B;  1SMV A;  2WS9 1;  1VBA 3;  3M4F A;  3JD7 2;  3UKV A;  4TZD A;  1D0G A;  3GJA A;  5FK8 A;  4KH9 A;  3LCP A;  4FPF A;  4XUQ A;  3B7M A;  3ZMO A;  1HRV 3;  4YFZ A;  4DIN B;  2R7E B;  3BPS A;  3HN3 A;  4O61 A;  2Q0A A;  2HWE 3;  2VPV A;  3AXE A;  1ODM A;  1CAX A;  4FP2 A;  2WAA A;  4FPO B;  3PUS A;  3MDP A;  1PZ7 A;  1UY1 A;  2QNK A;  2Y6F A;  3WG1 A;  5LZ6 A;  1NXD 1;  4ASK A;  3I54 A;  3TRS B;  2GP3 A;  4ZS3 A;  4AI3 A;  1RUJ 2;  1ZBE 2;  4UF0 A;  2RS5 2;  2QDN A;  3H1Y A;  1S2B A;  4HN1 A;  3WNP A;  5C7G A;  1JH5 A;  2R06 2;  2UWC A;  3RWK X;  1IGO A;  3WDY A;  3ZXJ A;  2RM2 2;  4FQZ A;  1XBF A;  2WO7 A;  3C7H A;  4CU8 A;  4Y5T A;  5FBJ A;  1ASJ 1;  1S0F A;  3C8X A;  3ILN A;  1PVC 2;  1UPI A;  4N43 C;  4Y20 B;  4XHB A;  5IVJ A;  4QXB A;  1TMF 3;  4CCN A;  2WYF A;  3N7M A;  3TEX A;  5LBB A;  5ISL A;  3OY8 A;  1AR6 2;  4QWN A;  4Q0U A;  4HVR A;  4LEJ A;  2GMP A;  3RZK A;  2VQT A;  2XR4 A;  3PUQ A;  4CA9 A;  1RUN A;  1E57 A;  3WQ7 A;  5C4W B;  1W9Y A;  1XU2 A;  4XAB A;  4FXG B;  3O1M A;  2TEP A;  4XCA A;  3AL5 A;  4CDW A;  1V6J A;  2VM9 A;  4CP0 A;  4DXR A;  1TVG A;  1NQJ A;  4FFG A;  1DQ4 A;  4CDU A;  3ZSE A;  1YLL A;  5FP8 A;  1OF4 A;  4EN9 B;  2O14 A;  1QJX 1;  2X53 S;  3NMB A;  5FJK A;  2I74 A;  3I2G A;  1UOJ A;  1MS3 A;  2P1B A;  1KQR A;  2F17 A;  2ORX A;  2Y60 A;  3GGL A;  3K48 A;  2Q1M A;  4WM8 C;  4FBF A;  3AYA A;  2W0X A;  1W05 A;  1RUF 3;  1XOY A;  3AYC A;  4XJZ A;  4XJU A;  5FWE A;  2O8O A;  3WF0 A;  3ACH A;  1CVN A;  1O3S A;  3JBG 3;  4FTE A;  2PHT A;  1IKQ A;  1W0N A;  2R32 A;  2RJL A;  1GLH A;  3POE A;  1GV9 A;  2Z4F A;  2J22 A;  3H42 B;  3NAP C;  5CKQ A;  3ZSM A;  5IK4 A;  4KNC A;  1CON A;  3VGI A;  2BZD A;  1O8P A;  2R16 A;  4GH4 A;  4NIH A;  5E88 A;  2WNO A;  2YC2 A;  4LE3 A;  5F2W A;  1JOB A;  3IAP A;  1T6G C;  3OB8 A;  4IE5 A;  4OUM A;  1CJD A;  1SBE A;  4QDR A;  2Y6K A;  2BDR A;  2VNG A;  4YZ4 A;  3NV3 A;  4RFR B;  5JAX A;  1MEC 2;  3UL2 A;  3O1P A;  4P5H A;  5A3T A;  1RUE 1;  1QF3 A;  3VD7 A;  5FYC A;  1Y9M A;  4UBH A;  1W28 A;  1W6O B;  4DEV A;  4XIK A;  2R30 A;  2GMM A;  1QY4 A;  1ZA7 A;  3VBU C;  3ZYH A;  4DY3 A;  3V65 A;  4Q4Y 3;  1QXJ A;  1D2Q A;  2YXS A;  4XHX A;  5J3U A;  3BPZ A;  5L9R A;  4EN7 B;  3ELN A;  3VBS A;  4NHL A;  4JCK A;  4NHK A;  4QPI C;  3RJR A;  2RS5 3;  2PHD A;  4OHX A;  2EXH A;  3UV9 A;  5FOB B;  4E27 A;  3HWJ A;  5C70 A;  1VBC 1;  2QCS B;  4K21 A;  2JDY A;  2BP6 A;  5FAX A;  5FFO C;  1SBD A;  3E97 A;  2DDU A;  2NZ9 A;  1A3K A;  4IV3 B;  2JDH A;  1KIT A;  2Q5T A;  1W8H A;  1ULE A;  4FPH A;  1RUG 1;  2WQ8 A;  5CFD C;  1WCS A;  4K40 A;  3VKF C;  3WG3 A;  3AL6 A;  3WOG A;  1AVB A;  4Q4X 2;  1O91 A;  4AI8 A;  1N3Q A;  3J8F 1;  1HLC A;  3T2Q A;  1OBN A;  1D4M 2;  1RUH 3;  1RJ8 A;  2XDV A;  4OUS A;  1PO2 2;  1LGB A;  3GYD A;  5EIY B;  1LB2 A;  1H2N A;  4MZU A;  3D5O A;  5BNO C;  1DYP A;  1JYN A;  3I8T A;  1H6Y A;  1W8N A;  2C9K A;  3E1F 1;  4I0W B;  4N53 B;  5C3P A;  2I07 B;  4FAH A;  4YZ5 A;  3OYW A;  1XYP A;  5CAD A;  4FPK A;  3CDZ B;  1ZM1 A;  4XZP A;  4ZKT B;  3KQ4 B;  3HOB A;  3PVB B;  4RQP A;  1FOD 1;  3TNQ A;  3O5S A;  4RGG A;  5DDJ 1;  2Z79 A;  3E5X A;  2VR4 A;  2FDF A;  1A8M A;  2GN7 A;  2PLV 3;  3JXS A;  2WZR 2;  3EXU A;  3D8C A;  4FO9 A;  1PO1 1;  1RVF 3;  2RMU 2;  4QPI A;  1QJU 3;  2E7T A;  2QQO A;  2XWJ B;  1STM A;  2JIJ A;  1AR9 1;  3I59 B;  1QKQ A;  4LHL A;  3AKT A;  3ZYI B;  5LEJ A;  4IV1 B;  5E16 A;  3NV4 A;  1QEX A;  5FMC A;  2HWB 1;  1POQ A;  1DG6 A;  4IE0 A;  5A7S A;  4D3W A;  1UYY A;  4C90 A;  4LT5 A;  4S2G A;  4A45 A;  3RZL A;  2WO1 A;  1REF A;  1AL2 2;  2DCK A;  5ACA 2;  1K5M C;  4YGC A;  5FQ0 A;  2ZEY A;  3UES A;  5BV6 A;  4N8M A;  2K0G A;  5JUV A;  3KB5 A;  5A7N A;  5KXD A;  2WAB A;  1NCR B;  2H6C A;  4QKD A;  1LHO A;  2XL9 A;  3ZXL A;  3H7J A;  1N1T A;  4PIY A;  1JZ2 A;  1HRV 1;  2CL2 A;  3OBZ A;  4XTP A;  5BNN C;  1UXX X;  4S2H A;  2HWE 1;  3T2P A;  2DU0 A;  1C5H A;  4W65 A;  3D3A A;  4W8J A;  1V6L A;  4H7M A;  1O3Q A;  5D21 A;  5EJ3 A;  3LQC A;  2QQK A;  4KGQ A;  1CIW A;  4DFS A;  3VUO A;  2Y33 A;  2ZX3 A;  4NJ4 A;  3UGH A;  1RUC 3;  4OHZ A;  3RJ2 X;  4MSV A;  1PZ9 A;  1VMJ A;  3KVA A;  1VBE 2;  5FYM A;  4CP2 A;  3KCX A;  4BQY A;  4CCO A;  4LBO A;  4CCL A;  1QJE A;  4P02 B;  1MPX A;  1YNA A;  2QQU A;  1AYN 2;  3T0B A;  1VBB 3;  1F2N A;  1RJ7 A;  3AKQ A;  4Q0P A;  4EWA A;  4WVV A;  3FUQ A;  4A41 A;  1ACC A;  3WDU A;  3HJR A;  1TMF 1;  3OBT A;  5I0T A;  5CG9 A;  2RR1 2;  2BNN A;  3N36 A;  3IPV B;  4JRL A;  5K8S A;  4JDN A;  3I2J A;  4BH9 A;  1EUU A;  4LOR A;  4XIL A;  4COW A;  3LEG A;  3DYO A;  3EYP A;  3AMM A;  4MXW A;  1K5M A;  2XJT A;  4M0N A;  2VVD A;  3LOB A;  4GWJ A;  5E89 A;  1K12 A;  4KQ7 A;  4OZO A;  4YW3 A;  2UUR A;  5H9P A;  4YPJ A;  1AX1 A;  4YW7 A;  4BE3 A;  5LWB A;  2IFR A;  3ZKU A;  1UL9 A;  2HLE A;  3UGG A;  4YSF A;  5FZK A;  3S0M A;  4JHZ A;  1CX1 A;  3EHK A;  4QQ2 A;  5EJZ B;  4YM0 A;  5BNN A;  2ZAC A;  3KGZ A;  1KD7 A;  4QT6 A;  5F1R A;  1RUF 1;  4C1W A;  2WA3 A;  4Y22 A;  2NMO A;  2VMF A;  2XUM A;  3JBG 1;  3VN4 A;  4B7K A;  5A3L A;  1QDO A;  3ZFF B;  1AZD A;  2IXH A;  4OLL A;  3KGL A;  5FMB A;  3N35 A;  1FV3 A;  1WWY A;  5LK5 A;  1POV 0;  4Y4R A;  4N7U A;  4R4X A;  4Y20 A;  2PN5 A;  5H9S A;  3ZOI A;  3BU7 A;  1YFW A;  5FWJ A;  5C5U A;  2YPJ A;  2X5I A;  4ZU7 A;  1XNB A;  1HV0 A;  4B1L A;  2O1Q A;  3WD5 A;  3CMG A;  4U2A A;  2BEO A;  2GNB A;  1KDK A;  3DXU A;  4BZ4 A;  1PNG A;  1GWM A;  1LKN A;  4FVV A;  1MQT C;  4CUA A;  4F8A A;  3LPG A;  4A7K A;  3H8R A;  1XNA A;  4I3P A;  1SLI A;  1XU1 A;  3A22 A;  4KL1 A;  2ZEX A;  3IDA A;  3ZN4 A;  4YZ1 A;  1Q56 A;  3FE5 A;  5IUQ A;  3SIS A;  1ONA A;  3WSO A;  3LEI A;  4ATF A;  3POI A;  3MLL A;  2BWC A;  5F2S A;  3RI9 A;  3WZ1 A;  5FZD A;  4Q4Y 1;  4LPL A;  5EP9 A;  4G3Y C;  5DAV A;  3WP5 A;  2OS2 A;  1BZW A;  3GM8 A;  5BNP B;  5CB7 A;  3W21 A;  4OHV A;  3ZDV A;  2KM2 A;  2RS5 1;  2BUK A;  3MI8 A;  5GLW A;  1HDK A;  4AVB A;  1REE A;  1DGR N;  4DNY A;  1U12 A;  1MR5 A;  2R04 2;  2CU5 A;  3I4I A;  3J4U H;  3PMS A;  3I2O A;  2FDG A;  2A71 A;  5BUV A;  1Y9Q A;  3C3V A;  3POS A;  3R4U A;  3GHM A;  3AP6 A;  1TG7 A;  2XJR A;  5C8C C;  1FPN 3;  1GUI A;  4GAL A;  2DVG A;  1IG0 A;  1RIT A;  5LEK A;  3Q8F A;  2ARB A;  2VNR A;  1VBD 2;  2XJS A;  4LNV A;  3J26 N;  5M0T A;  1J83 A;  3ZXF A;  3HBK A;  1OF3 A;  2YUE A;  1LES A;  1G8W A;  2D3P A;  3DCQ A;  4F83 A;  4K1Y A;  1UOG A;  5A3O A;  3MIG A;  4JX0 A;  4DIQ A;  2WQ4 A;  1E5R A;  2UY8 A;  5FKC A;  1C8M 2;  1RUH 1;  3WNN A;  4CEW A;  1DDL A;  3KT1 A;  3NL1 A;  4QM9 A;  1SLC A;  2Y34 A;  4ZS2 A;  2JDM A;  4QD2 A;  1SG3 A;  1Y4W A;  1QQP 2;  3TEW A;  5FZA A;  3OG2 A;  5L7O C;  1OI6 A;  1W6O A;  1NE4 A;  3CKH A;  3KV9 A;  2YBP A;  2WNV C;  4ZZ5 A;  1XXN A;  3OUH A;  2AR6 A;  2QQV A;  2Y26 A;  1CZS A;  1TME 3;  5K9Y A;  1F4A A;  5A3N A;  4LTA A;  4Q4V 2;  4MX3 A;  1DF0 A;  5A7P A;  4HN0 A;  2R0H A;  3BIW E;  5IAT A;  3I3E A;  5C9A C;  4XAA A;  1G7Y A;  2TNF A;  3WVJ A;  5KHK A;  3KMH A;  2D3R A;  1UKR A;  1VP6 A;  2FDJ A;  4KU7 A;  2PLV 1;  1W8W A;  1OHF A;  4CDX C;  5C3R A;  1RVF 1;  1UY2 A;  2PQS A;  2VUC A;  3JQX A;  4IV3 A;  4YVS C;  1QJU 1;  2D6M A;  2XJQ A;  3L2H A;  5ABJ C;  4LHS A;  2WZP P;  4URT A;  3S6P A;  4AQ6 A;  4AAP A;  5T5O A;  4QX7 A;  2VCC A;  1UYZ A;  3AZZ A;  3BOW A;  5LY1 A;  2Y0I A;  3RWN A;  4BIF A;  2IXI A;  1V6N A;  4I2O A;  3IM0 A;  2E26 A;  5IWF A;  2XQX A;  4DRV A;  2ZX1 A;  3MIF A;  4CU9 A;  3HVD A;  3AMN A;  2WS9 2;  3BU0 A;  1C4R A;  1GBG A;  3HAG A;  4BQ3 A;  1XB9 A;  3PVO A;  5DAQ A;  1WW6 A;  2VAU A;  4XFC A;  4RN5 A;  5FZM A;  1KGY A;  1N3P A;  4HAN A;  3NKT A;  3O0V A;  1B09 A;  1J1L A;  3MGU A;  1C3H A;  2AZ5 A;  4DEQ A;  4AE2 A;  1CAW B;  2W46 A;  2D6K A;  4BYY A;  3FWE A;  2TBV A;  3PME A;  4AFM A;  4MHU A;  2WNV A;  3AKP A;  3D0S A;  3AX4 A;  3M3O A;  5T55 A;  4XMA A;  4D69 A;  5CA6 A;  5E8A A;  5IVF A;  1HRI 1;  2J7M A;  4D6R A;  2XBO 3;  1RUC 1;  1RL3 A;  3PJY A;  2J1R A;  1OFN A;  5FK7 A;  1G9C A;  1JN2 P;  3ZPO A;  1O4T A;  2R1D A;  3WDX A;  2ZAH A;  1ASJ 2;  1LHU A;  2W9X A;  4XJA A;  3BOD A;  2LM3 A;  1LNS A;  5FR3 A;  2WLQ A;  1PGL 1;  1W6M B;  5CFC B;  3AYE A;  5JR2 A;  1VBB 1;  2DFB A;  2VMG A;  5L73 A;  5FY1 A;  1OKQ A;  4GKX A;  3USU A;  2GH2 A;  5F6K A;  2GZW A;  4SLI A;  4Y1V A;  4NHY A;  1GYK A;  1C57 A;  3T1L A;  3WCS A;  5I91 A;  3RZH A;  4LK7 A;  1U5X A;  1PK6 C;  2ADE A;  3I3B A;  2V09 A;  1EPZ A;  5SV8 A;  5C3S A;  4AHX A;  2VQ0 A;  1OUX A;  1YWK A;  3DF0 A;  3FFQ A;  3AKS A;  2CV6 A;  2ZJC A;  1BYH A;  3FHI B;  4QU2 A;  5EJ1 B;  4XQW A;  5FLH A;  1QJX 2;  3B00 A;  3RZM A;  5EXO A;  2VGD A;  1SLB A;  3C7G A;  1YO8 A;  3P3N A;  5CBL A;  4CVU A;  2K9Z A;  4RFT 0;  1ZZC A;  1BJQ A;  3WF4 A;  3DKW A;  2GU9 A;  1GKB A;  2Q4S A;  3SCG A;  1Z7S 3;  4QB6 A;  3KVB A;  1JUI A;  3RPQ A;  5JZG C;  4JGY B;  1MZF A;  3GZT B;  5LRR A;  3MW3 A;  1CX4 A;  1LOA A;  1IHM A;  2JWP A;  4CCE A;  1H2L A;  5L19 A;  4DUW A;  1O5L A;  2WT0 A;  5A32 B;  3JQW A;  3VD9 A;  3TB0 A;  4DRR A;  3MEP A;  4BHP A;  4QM8 A;  4CE8 A;  2WN2 A;  4FPL A;  4LO6 B;  1ZNP A;  5FY4 A;  1UN1 A;  4QKB A;  5T5L A;  3OY8 B;  4IER A;  2A6Z A;  1W8T A;  5K4L A;  2CY6 A;  4AI0 A;  3IPV A;  3VZJ A;  3EQE A;  5JOW A;  2B46 X;  1Z0H A;  4XIO A;  2VVE A;  1UOB A;  1XNC A;  1RUE 2;  2E33 A;  4CDW B;  5LA1 A;  1ULP A;  5GZC A;  1YIP A;  3IBM A;  4DMI A;  5C8W A;  3WEZ A;  1H9P A;  2VOX A;  3KT7 A;  3PU3 A;  1NZI A;  3AJY A;  4Q8L A;  5A1L A;  5CKM A;  1PK6 A;  3A21 A;  4QMA A;  4XF4 A;  5E6H A;  3USS A;  1W0P A;  4R8H A;  2PHX A;  1UYP A;  4RSU A;  2FBE A;  4YGE A;  1ND2 C;  4LMF A;  2B7Y A;  1OPM A;  3MHZ A;  1VBC 2;  3VDC A;  1PIV 3;  1I6X A;  4MH0 E;  2LRP A;  4AGV A;  1EY2 A;  1UNB A;  3OGJ A;  4XBL A;  1ULC A;  2NN8 A;  2XB6 C;  2A75 A;  1WLW A;  3NST A;  1H2K A;  1JUH A;  1DU3 D;  5AVP A;  3GBG A;  1FPN 1;  5ERL A;  1RUG 2;  1BHG A;  3MF6 A;  1XPW A;  4R9A A;  2WWS A;  4Y1Y A;  2NMN A;  5D8A C;  4B8E A;  4SBV A;  4B4P A;  2DCT A;  3GNE A;  3MIC A;  3J8F 2;  3HN1 A;  3FBY A;  4M3C E;  4YM3 A;  4N43 B;  4UWD A;  4JGZ C;  5FZ1 A;  1UMH A;  2DTW A;  3K3O A;  2PHW A;  4I3G A;  4ZXE A;  2K2S A;  3PU8 A;  1FX5 A;  1NXM A;  2WWJ A;  2D98 A;  4KWU A;  5HPO A;  1X82 A;  3ZN5 A;  1AX0 A;  2CWS A;  4HK9 A;  1G6N A;  2E9Q A;  5C5T A;  5FPA A;  1W9S A;  3B01 A;  2LTN A;  2VD7 A;  4LOT A;  2ET7 A;  4OHY A;  1WMF A;  1TME 1;  5BNP A;  1LUL A;  1FOD 2;  3A0K A;  3ITQ A;  5LAT A;  5DDJ 2;  3A0N A;  3LE0 A;  3EO6 A;  5HCB A;  2RE9 A;  4M4P A;  3PIJ A;  1O3R A;  1RED A;  2IVI B;  2ZHL A;  2XJP A;  5JSR A;  1PO1 2;  3RNS A;  1R1A 3;  4QXK A;  1WCD J;  2E7A A;  2PQQ A;  2QZ3 A;  4WM8 B;  5GM0 A;  5F9T A;  2O0O A;  1OXC A;  3BYW A;  3W58 A;  1S2K A;  4E2S A;  4BQ4 A;  1AR9 2;  2ZZQ A;  3PUR A;  3ETP A;  4CP9 A;  4PJY A;  4CYD A;  4J1W A;  4HT1 T;  4JKL A;  2GH8 A;  5A33 A;  3WG2 A;  1MS5 A;  1Y43 B;  1IS6 A;  4BA6 A;  2X8K A;  2DV9 A;  2HWB 2;  4RGA A;  3NAP B;  2XH6 A;  1XQN A;  2E32 A;  2NM1 A;  2QE3 A;  2Z42 A;  4LKD A;  4UAP A;  2D40 A;  3GXU A;  1VLN A;  1POV 3;  4BCU A;  4CDQ A;  1W8O A;  1CGP A;  1UMI A;  1ALY A;  4LA3 A;  4HVO A;  2XL7 A;  3WW4 A;  1RMU 3;  4PT6 A;  5J98 B;  2WFF 3;  5FYB A;  5GAL A;  1HRV 2;  2G19 A;  2W39 A;  3RZG A;  1QXP A;  2W95 A;  3OYW B;  3SXW A;  3PUI A;  5FV3 A;  1YQ5 A;  2HWE 2;  2CGN A;  4PI2 A;  5A70 A;  1UW8 A;  3E6B A;  4RQP B;  1XJA A;  3AZW A;  2J42 A;  3RGB A;  3ZFG C;  4DS0 A;  4MGI E;  4R9D A;  5J96 B;  1N3O A;  1X8E A;  3UJQ A;  2P34 A;  3K4A A;  4QPI B;  4FOQ A;  5E1R A;  5I0U A;  3U11 A;  1LOD A;  4MAD A;  1G9B A;  2JIC A;  2XBO 1;  2YG0 A;  2RV9 A;  3WNL A;  5FPU A;  1RXF A;  2B9V A;  1ZRC A;  1NCQ C;  3PL0 A;  1N1S A;  2OA2 A;  2ZHM A;  4LXL A;  1LU2 A;  2ID4 A;  4WM7 C;  1GOH A;  3DXT A;  1W6Q A;  3ZR6 A;  5IVV A;  4NID A;  1PMH X;  5I8S A;  1URX A;  2AAC A;  2AC1 A;  3NV1 A;  3NVC A;  1HKD A;  4BQX A;  3OPZ A;  1TMF 2;  3RMY A;  5CFD B;  1COV 3;  3I2H A;  3NNL A;  5FQ0 B;  4IGO A;  2QZ2 A;  1XC6 A;  4QGN A;  5FRA A;  4EWD A;  1C5I A;  2HH9 A;  5JMC A;  3N7J A;  4XAC A;  2V5Y A;  1FXZ A;  1AF9 A;  5GZE A;  3VLB B;  3HQR A;  3V64 A;  4P5Y A;  2EF6 A;  5FZO B;  3JB4 C;  2GDF A;  2X10 A;  2A6Y A;  1CAW A;  4BLJ A;  2BBA A;  5A6Q A;  2D44 A;  2ZMN A;  1TEI A;  5CNA A;  1YQ2 A;  1GZ9 A;  3D6E A;  4XFH A;  1O3T A;  1W0O A;  4TYS A;  4CTE A;  1PO1 3;  5FIX A;  1RB8 G;  1RUF 2;  4L0P A;  1F5F A;  3MLK A;  4AGR A;  4PF5 A;  1JOD A;  2GC3 A;  5FZL A;  4L8Q A;  1Z7S 1;  3JBG 2;  4MET A;  4BIS A;  4MGK E;  5J48 A;  1J3P A;  3OJB A;  2FCV A;  3CJI A;  4XFA A;  4ARX A;  3WUC A;  4I01 A;  4LJH A;  4P9X A;  5KXC A;  1YCI A;  3U4S A;  3CEW A;  3H50 A;  5KR7 A;  4TLF A;  5A1F A;  4PBO A;  4RA0 A;  1Y3T A;  4I30 A;  1UY3 A;  5L9V A;  2G1M A;  5T5J A;  3B93 A;  3WW2 A;  3C7F A;  3KV5 A;  4ATE A;  2VC9 A;  3U75 A;  2GND A;  4IGP A;  4MGZ E;  4QX2 A;  4RR3 C;  3B94 A;  1L3J A;  3QBQ A;  5F37 A;  4GIQ A;  1SFP A;  2RHP A;  3LAG A;  4Y1U A;  4C0B A;  1OA3 A;  2ZOE B;  4M3C B;  3P3P A;  2PHL A;  2WNE A;  3KLS A;  4XAE A;  4MXW B;  1K5M B;  4GMP 0;  1XE7 A;  1MS4 A;  5FZ6 A;  4NIA A;  1VAV A;  2ZTN A;  2XLG A;  4Q4Y 2;  2VOT A;  3K3N A;  1MS8 A;  4FI9 A;  2Y6L A;  4PLM A;  4K3U A;  2NPI A;  1LRH A;  3D4K A;  5BNN B;  3M8L A;  3KM5 A;  2BNM A;  2P4E A;  4YG3 A;  4JGY A;  5DUX A;  4DUX A;  1PIV 1;  2BOJ A;  4Y22 B;  4HG6 B;  3UKT A;  4NRM A;  2VZS A;  1PM4 A;  1CWP A;  3LFM A;  3WX5 A;  1NY7 1;  1W9T A;  3K2O A;  5LW9 A;  5A32 A;  4HZF A;  2NLR A;  1APN A;  4IQP A;  3KD4 A;  1EP0 A;  2AEN A;  3DPR C;  1ZRF A;  5GZD A;  1XRU A;  1D2S A;  1QNW A;  4LR4 A;  4ZON A;  2X5I B;  1F35 A;  4AI9 A;  5HI0 A;  5IK7 A;  5FLI A;  2EIG A;  4MOA A;  4D6Q A;  1LR5 A;  1RUH 2;  2DVD A;  2VUL A;  2C4X A;  4XPV A;  1K3I A;  1ZX5 A;  5FZ4 A;  1HQL A;  2BNO A;  1ENX A;  2XUE A;  1LAJ A;  1V9U 3;  4XJW A;  4M00 A;  5F32 A;  5T52 A;  4UFI A;  1DP0 A;  3FFZ A;  5FYZ A;  3VL9 A;  2PAM A;  2J1A A;  4Q29 A;  4RHV 1;  2QVS B;  1YHF A;  3WQB A;  4AW7 A;  4YRD A;  5FXW A;  1SCR A;  1UY0 A;  2YY1 A;  2B5H A;  3DV8 A;  4Z82 A;  3ACL A;  4UW3 A;  4UW5 A;  1DIW A;  4KMQ A;  4FTS A;  2PLV 2;  2WWU A;  3JZV A;  1LCL A;  4Q0Q A;  2OUH A;  5EYY A;  4YW5 A;  2ZKL A;  2RVA A;  1HB2 A;  1RVF 2;  2MNG A;  3KCY A;  1R1A 1;  5DUU A;  1QJU 2;  1TQ5 A;  4Q2F A;  2QQP A;  2BWA A;  2XVL A;  4XJ8 A;  5IFP A;  3WP3 A;  3Q8A A;  1W3V A;  1TZO A;  1R09 3;  3III A;  4N43 A;  2W47 A;  5FMD A;  2BTV C;  2O8Q A;  3DPR A;  4I0A A;  1F4H A;  5FTT C;  2ZKN A;  5LBE A;  3TAY A;  2PHR A;  1OUR A;  1NT0 A;  2GP5 A;  2NYY A;  4LKF A;  1POV 1;  4URA A;  1RMU 1;  3WV6 A;  2DF7 A;  2HWD 3;  1AJK A;  1V6I A;  4K20 A;  4TSV A;  5DZE A;  2JXA A;  2RDR A;  5LBF A;  2WFF 1;  3ALQ A;  3ZXA C;  4PDW C;  1DQ0 A;  4YWA A;  4PCR A;  1XE0 A;  3UET A;  3VZK A;  1IQA A;  3DL3 A;  4C1X A;  1B35 C;  2ZA9 A;  1P8J A;  4FQ4 A;  4D7Y A;  4CEY C;  1JZ4 A;  1V00 A;  2XGX A;  4BM8 A;  5I8Y A;  4HKO A;  2A6X A;  4P9W A;  1HRI 2;  3LF7 A;  5IW0 A;  4XVH A;  4DXZ A;  4WM8 A;  5C33 A;  5JOX A;  1BMV 1;  4COZ A;  1RUC 2;  4UFM A;  3V0B A;  2ZGS A;  1NYW A;  1S4C A;  3WXP A;  1LHW A;  1Q8O A;  3VV1 A;  1W2T A;  4BB3 A;  5DPN A;  4NHX A;  1PGL 2;  4KBB A;  3L9J T;  3KZ4 C;  4AED C;  1OMI A;  3NRU A;  4A7Y A;  1VBB 2;  5C8C B;  2A6W A;  3NAP A;  1JZ8 A;  2PHF A;  1T6B X;  2PEL A;  3VZO A;  1XYN A;  1MZ6 A;  2VQU A;  3IIA A;  4KGG A;  2HBT A;  1YI9 A;  1COV 1;  1CN1 A;  1VB2 A;  3QOP A;  3KV4 A;  5H9R A;  1GZT A;  4H14 A;  4G4F A;  3VBO C;  1DFQ A;  4DO0 A;  2Y6H A;  4BMB A;  2DUP A;  4BME A;  1W3X A;  1EAH 3;  3N7L A;  2E53 A;  3O1U A;  4QHB A;  1NE6 A;  4L9B A;  5B4N A;  3NO8 A;  5L7O B;  2R07 3;  4PQQ A;  3VBU A;  1OLQ A;  2WNV B;  4XEZ A;  3URF A;  1GWK A;  1UPS A;  4NE9 A;  4QXH A;  1BK1 A;  5F8P A;  3VBH C;  2ZPX A;  4PDW A;  2XON A;  3B02 A;  4AVA A;  4NN0 A;  2EIC A;  4JHT A;  1B35 A;  1HN1 A;  5C9A B;  4AGG A;  5FZG A;  1SLT A;  1DZT A;  2ZZJ A;  4YG6 A;  1BEV 1;  2EVX A;  1F31 A;  2VZ1 A;  4OVE A;  2HYK A;  4QKF A;  4V2V A;  4HFS A;  4XZU G;  1Z78 A;  5AVA A;  4BWO A;  3H8U A;  4FPE A;  4J25 A;  4UFL A;  3TOJ A;  2BGC A;  4CP1 A;  1YIF A;  5ABJ B;  3SEE A;  3USU B;  2P6H A;  3GF6 A;  3J9S A;  5CFD A;  1MS9 A;  1SEF A;  3MW2 A;  3FL7 A;  4AEK A;  2XLA A;  3SHR A;  2A3X A;  4EZ4 A;  1NOV A;  4XUP A;  5D1I A;  2TUN A;  5DUW A;  1CPN A;  3ZVX A;  4FXK B;  5CZK A;  5J36 A;  1Q43 A;  5FY8 A;  5KC5 A;  1KXG A;  5BNO A;  1WME A;  3WHU A;  1Q5O A;  3GJB A;  3WDT A;  3WW3 A;  4CDQ B;  5FZO A;  2JJ6 A;  3ZXG A;  4XOG A;  2MPF A;  4RGK A;  4QDS A;  1UQX A;  3U10 A;  2ZGL A;  1LJ7 A;  1UOF A;  4BQ1 A;  2DUR A;  1HRI 3;  2OPK A;  1W8U A;  1VR3 A;  3VZL A;  4NHM A;  3HNY M;  1XND A;  3OUI A;  3AZY A;  3VBF C;  1ZZ8 A;  4MHR A;  2H0V A;  3L2Y A;  4Y24 A;  2YZ4 A;  1MVE A;  2FQP A;  2BRT A;  3H9A A;  1FPN 2;  1GOF A;  1IS5 A;  1GNH A;  1DHK B;  1TE1 B;  4EE2 A;  5D2A A;  5BY5 A;  1BK0 A;  4XQ4 A;  2V72 A;  2AUY A;  4ORF A;  2VG9 A;  2R6Q A;  3LSD A;  2ZEZ A;  2W1U A;  2DCZ A;  1YFU A;  3QLQ A;  4Q27 A;  2AEZ A;  3OGS A;  4CRQ A;  3MV1 1;  3WR0 A;  4C8D A;  3B9I A;  1WCU A;  1OQD A;  2HEW F;  2ZMK A;  4BXF A;  3FUO A;  1W04 A;  2BW8 A;  4FPY A;  4KWL A;  4M3C A;  2VMC A;  4EN0 A;  5EHD A;  3BGA A;  4XUO A;  3OUJ A;  2FHR A;  2JIG A;  3M3Q A;  4ZPI A;  2Y64 A;  3WNX A;  1IG3 A;  1V6M A;  3RYR A;  1V9U 1;  1QOO A;  3N3H A;  4KWJ A;  1PK6 B;  2A3W A;  4LO8 A;  4WVM B;  4XET A;  2EAK A;  1TME 2;  4QX8 A;  3K51 A;  1HW5 A;  1I5Z A;  1NKG A;  2PTM A;  3LKJ A;  4IES A;  4IDZ A;  3LGR A;  1Y9G A;  4YGD A;  3IDE A;  3M1H A;  2FDK A;  2ZAB A;  2D93 A;  2AGS A;  3HT2 A;  3RZZ A;  2NP0 A;  2W5F A;  4FPG A;  3SQO A;  4BOW A;  3A4U A;  2PAK A;  3RQ0 A;  1LEN A;  3WF3 A;  1NUK A;  4LOS A;  4UI9 L;  5DAX A;  2YU1 A;  3VDB A;  5FO8 B;  1RIR A;  3CNA A;  3NNM A;  5JZG B;  1OOP C;  1HIX A;  2WYS A;  3T2T A;  2RDQ A;  3LIH A;  2YBK A;  3VBF A;  1WA4 A;  1O5U A;  2KXL A;  2HYX A;  4CUG A;  1SAC A;  4FFF A;  1ULF A;  3ZYR A;  3B69 A;  4MG2 A;  1MZ5 A;  4FPJ A;  4QQO A;  5FMO S;  4O7X A;  4LLF A;  1DQ1 A;  1GP4 A;  1R09 1;  3IWZ A;  4QX5 A;  3DYM A;  5JSO A;  3NNG A;  1SCS A;  2YHJ A;  3SEP A;  3OCP A;  5JXJ A;  1FI2 A;  4B29 A;  4IEZ A;  4PI0 A;  3GCW A;  1S0D A;  5FO9 B;  4B4Q A;  3ZLI A;  5K0U C;  1TNR A;  1UCX A;  2GAU A;  1O4Y A;  2HWD 1;  3N9N A;  4GKY A;  1OKO A;  4FTB A;  1W2N A;  2RS3 3;  2XKP A;  4UFK A;  1RTV A;  4XF3 A;  4AK3 A;  1BVP 1;  1CZT A;  3OEA A;  2JE9 A;  4QQH A;  2EAL A;  3ZO0 B;  1JYV A;  4Y3O A;  2OXB A;  4FPC A;  2VXJ A;  5EV7 A;  3RDI A;  2HWC 3;  3WDW A;  3AK0 A;  4GMP 3;  2JE7 A;  2YYO A;  3IMN A;  1GIC A;  2Q8O A;  2XBO 2;  2G9Z A;  5A6X A;  3RSJ A;  2XJU A;  4ITC A;  1LU1 A;  5A7O A;  2XKO A;  3GCX A;  4CP9 B;  4AEM A;  5T5P A;  5DG2 A;  1NA1 C;  3SKV A;  2E31 A;  5A33 B;  4IE7 A;  2BBV A;  2CDO A;  2BYV E;  4XFF A;  4AR2 A;  2D6N A;  5CU1 A;  1OOP A;  3CBN A;  2GN3 A;  3NNJ A;  4FFH A;  5D8A B;  3QAC A;  3TNP B;  1XNT A;  1W6P A;  4CU7 A;  3BUC A;  1MAC A;  5T3N A;  2B9U A;  1KDM A;  3ENR A;  2PA7 A;  1W03 A;  1KRI A;  3POF A;  1MQT A;  1WUV A;  1F15 A;  3AB0 A;  1EPW A;  2VW1 A;  1NG0 A;  4NPM A;  3IB3 A;  1UU5 A;  2PHU A;  3PHM A;  1O59 A;  2BOI A;  4GWN A;  1EAH 1;  1JMU B;  3R0R A;  2W08 A;  4A3Z A;  3TEY A;  2P2K A;  3KWV A;  3KSC A; 
#chains in the Genus database with same CATH homology
 4XUQ A;  1XPW A;  2VMD A;  4AAX A;  2R7E B;  3CZJ A;  3HN3 A;  2VTF A;  2CDP A;  3T0A A;  2WAA A;  1ULO A;  4GWI A;  1UY1 A;  2BER A;  3CIH A;  1UMH A;  4OUE A;  4ZXE A;  2ZXQ A;  3WNP A;  4KWU A;  5C7G A;  2ZEW A;  5HPO A;  4QAW A;  3HEI A;  1W9S A;  1JYW A;  2VZQ A;  3C7H A;  4CU8 A;  4KI5 M;  1WCQ A;  3C8X A;  3MUY 1;  3LE0 A;  2J1E A;  4M4P A;  3I2F A;  2VQT A;  2WZ8 A;  1GNY A;  3ETP A;  3ECQ A;  2JE8 A;  2QQJ A;  2VM9 A;  4DXR A;  1TVG A;  4JKL A;  3BN6 A;  1OF4 A;  4Z2A A;  2E32 A;  3ZM8 A;  2JD9 A;  3I2G A;  4UAP A;  3GXU A;  4DUW A;  2ORX A;  1JZ7 A;  3GGL A;  3J7H A;  1W8O A;  1UMI A;  2WBK A;  2YB7 A;  3WF0 A;  3ACH A;  3MO4 A;  3FHA A;  4QB1 A;  4PT6 A;  1JU3 A;  2QQI A;  1J84 A;  1W0N A;  3CZU A;  2W95 A;  1IQD C;  2Z4F A;  2J22 A;  2W1S A;  3PUI A;  4JKK A;  4AG4 A;  2BZD A;  1O8P A;  4QX0 A;  2YC2 A;  1OD3 A;  3C7E A;  3VD5 A;  3K4A A;  3IAP A;  3OB8 A;  4MAD A;  2EIB A;  4QDR A;  2Y6K A;  2YG0 A;  2RV9 A;  3WNL A;  2B9V A;  2X09 A;  3VD4 A;  1H6X A;  2ID4 A;  1GOH A;  3PUH A;  2QQL A;  4DEV A;  5LA2 A;  1PMH X;  4DXT A;  3T2O A;  3K4D A;  1WKY A;  3I2H A;  4QPW A;  5I0D A;  5C70 A;  1XC6 A;  3HPN A;  3NJX A;  5JXG A;  4CU6 A;  2WAO A;  4LQR A;  4P5Y A;  5G04 L;  2DDU A;  4RYD A;  2X10 A;  2BBA A;  3GDB A;  2WQ8 A;  1YQ2 A;  3WNM A;  2J1U A;  4QDQ A;  3T2Q A;  4L0P A;  5EIY B;  2W3J A;  1JYN A;  4E8D A;  4ARX A;  3W5N A;  1H6Y A;  1W8N A;  2C9K A;  2BGP A;  2Y6G A;  3HNM A;  1UY3 A;  2WN3 A;  3E1F 1;  3C7F A;  1UYX A;  3CDZ B;  1JZ3 A;  1JZ5 A;  2VC9 A;  3HOB A;  4QX2 A;  1JYX A;  2VR4 A;  4BDV B;  3JXS A;  4MGQ A;  4A42 A;  1DLC A;  1CZV A;  3OGV A;  2QQO A;  1RYY A;  1K42 A;  4TTG A;  1JHJ A;  5JXI A;  1EUT A;  2VOT A;  4FI9 A;  2Y6L A;  4BK5 A;  2WUH A;  1GU3 A;  4DUX A;  1UYY A;  4HG6 B;  2VZS A;  3A7Q A;  4A45 A;  2WO1 A;  4W50 A;  4LKS A;  2DCK A;  1W9T A;  2ZEY A;  3UES A;  5JUV A;  1US3 A;  1UY4 A;  2WAB A;  1D7P M;  1R64 A;  4XUR A;  3UNP A;  5FUI A;  1JZ2 A;  1GMM A;  2VL4 A;  4ZY9 A;  1UXX X;  4IUG A;  1OT5 A;  4QX1 A;  1OH4 A;  4XUT A;  4MOA A;  3T2P A;  3SKJ E;  4W8J A;  3WF2 A;  3D3A A;  3WNO A;  2C4X A;  1K3I A;  2C26 A;  2W94 A;  2EID A;  3LQC A;  2QQK A;  5F7U A;  3LPF A;  1JU4 A;  4ET7 A;  3MBW A;  3K75 B;  3P1I A;  1W99 A;  1DP0 A;  3ABZ A;  3FN9 A;  4P02 B;  1MPX A;  2J1A A;  3WQB A;  3T0B A;  4QX3 A;  2XHN A;  1UY0 A;  3OEB A;  2W92 A;  2W87 A;  4A41 A;  4KMQ A;  3HJR A;  4PF1 A;  2RVA A;  3WF1 A;  2J1V A;  5DMY A;  3I2J A;  4M4R A;  1EUU A;  5IFP A;  3LEG A;  3DYO A;  3EYP A;  2WZE A;  4GWJ A;  1K12 A;  2W1W A;  4OZO A;  4YPJ A;  1W9W A;  3III A;  3K77 A;  2W47 A;  2HLE A;  3VD7 A;  4DXS A;  1F4H A;  3I97 A;  2YC4 A;  2W91 A;  4W4Z A;  4JHZ A;  1CX1 A;  5EJZ B;  4OYU A;  2Y8K A;  4A6O A;  1DYO A;  1PX3 A;  2VMF A;  2LS6 A;  4MGS A;  5IJR A;  2X05 A;  2YFU A;  1JZ6 A;  3DEC A;  3UET A;  2VCA A;  1K45 A;  1P8J A;  3ACI A;  5HXM A;  2VZU A;  3THC A;  1NX9 A;  3CMG A;  4XVH A;  4XUN A;  3MV0 1;  1US2 A;  1JZ4 A;  4CUA A;  3LPG A;  2OKX A;  1XNA A;  2W1Q A;  3IAQ A;  3A22 A;  5DPN A;  2XOM A;  2ZEX A;  3IDA A;  3T0D A;  4D8M A;  3NRU A;  3WSO A;  3LEI A;  5B4X A;  1JZ8 A;  4P08 A;  2B4K A;  4LPL A;  2VQU A;  3GM8 A;  2QBX A;  2Y6H A;  3I3D A;  1CIY A;  3EB7 A;  5C71 A;  1TG7 A;  2BGO A;  1GUI A;  3F2Z A;  5B4N A;  1UX7 A;  3NJV A;  4PQQ A;  1J83 A;  4BJ0 A;  1OF3 A;  1L7R A;  4JX0 A;  2XON A;  2EIC A;  3WNN A;  1HN1 A;  2V5D A;  1SHW B;  5IFT A;  1SG3 A;  2WO3 A;  3OG2 A;  2VZ1 A;  2Y6J A;  5DN2 A;  3CKH A;  3OBA A;  4XZU G;  4OMC A;  4ZZ5 A;  1UWW A;  3K46 A;  1CZS A;  3SEE A;  3T08 A;  1F4A A;  2VZR A;  3FL7 A;  2RJ2 A;  1UZ0 A;  2KD7 A;  4XUP A;  3I3E A;  3OGR A;  5CZK A;  2ORZ A;  2V4V A;  1I5P A;  2DCJ A;  2PQS A;  1UY2 A;  3C7O A;  3P6B A;  1UXZ A;  2WDB A;  4QDS A;  4LHS A;  2VCC A;  1UYZ A;  5LCW L;  4JKM A;  4QB2 A;  2VO5 A;  2E26 A;  2XQX A;  3T09 A;  3HNY M;  4D0Q A;  3DYP A;  4CU9 A;  5G05 L;  3NQH A;  5IYY A;  4E8C A;  3AC0 A;  1GOF A;  5CYY A;  4RN5 A;  1KGY A;  2QQN A;  2EIE A;  2V72 A;  2VME A;  4DEQ A;  2ZEZ A;  2J1T A;  2W1U A;  2W46 A;  3OGS A;  3MV1 1;  4A44 A;  1O8S A;  2VMC A;  3BGA A;  2J7M A;  4XUO A;  2J1R A;  2Y64 A;  2LW8 A;  4BXS V;  1T2X A;  1GQP A;  3MUZ 1;  2W9X A;  4OMD A;  1LNS A;  5JXH A;  2VJX A;  1NKG A;  1KEX A;  3W5M A;  5JR2 A;  4ARY A;  2W5F A;  3ACG A;  3WF3 A;  1NUK A;  3VDB A;  4UI9 L;  3FHQ A;  5IHR A;  2WYS A;  4GZ9 A;  3I3B A;  2YFZ A;  3ACF A;  2HYX A;  4CUB A;  5EJ1 B;  3HNB M;  3C7G A;  1JI6 A;  3THD A;  3DYM A;  4CVU A;  3NNG A;  4DUV A;  2L9L A;  3WF4 A;  1PMJ X;  4QB6 A;  3SEP A;  5J1X A;  5JXJ A;  2VZ3 A;  3K4Z A;  4BK4 A;  3VD3 A;  3VD9 A;  2VZV A;  4UOJ A;  2WN2 A;  1L7Q A;  5A1A A;  1CZT A;  2VZO A;  3OEA A;  1JYV A;  3LEK A;  5JMO A;  3I2I A;  2JKX A;  2VZT A;  3CQO A;  4P00 B;  1PX4 A;  2E33 A;  4MO3 M;  4A4A A;  4ZZ8 A;  5LA1 A;  1ULP A;  3I2K A;  3SKV A;  2E31 A;  2J1S A;  3WEZ A;  2CDO A;  3A23 A;  1GOG A;  2QQM A;  3VDA A;  2VCB A;  2JDA A;  3A21 A;  1XNT A;  2WO2 A;  4CU7 A;  4CUC A;  4TXW A;  3VDC A;  1NAE A;  2VZP A;  3U37 A;  5DQ0 A;  3WNK A;  1SDD B;  3IB3 A;  1O59 A;  4A3Z A;  1BHG A;  5LA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...