2VZQA

C-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa in complex with digalacturonic acid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 23
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzqA00
4RYDA 3WF0A 2KD7A 3IAQA 2VCCA 2QQIA 4XUOA 1H6XA 5EJ1B 3WNKA 4A41A 1GOFA 1NKGA 3CMGA 3HOBA 3CZJA 1GNYA 3WNOA 4RN5A 1ULPA 2JD9A 1JZ6A 2VZPA 2Z4FA 3LE0A 4XUTA 2YC2A 3I3EA 2EIBA 2RVAA 5JXIA 2W1UA 5JR2A 1GOGA 2WO1A 3OBAA 3NJXA 4Z2AA 1US3A 1L7RA 1JZ8A 1XNAA 3CIHA 5B4NA 3HN3A 4AAXA 1UX7A 4ARXA 5I0DA 2Y64A 2C9KA 2ORXA 4CU6A 1J83A 2C4XA 4ZZ5A 1W9WA 1NAEA 1OD3A 4IUGA 1J84A 3A22A 1GOHA 5LA2A 4L0PA 1CZSA 1MPXA 1UXXX 2W46A 1NUKA 2CDOA 3BGAA 1W8OA 4KWUA 4UI9L 3LEGA 3OGVA 3VD7A 3LEKA 1YQ2A 3UESA 2CDPA 2VZOA 3THDA 2VZUA 2J1RA 4LHSA 3C7FA 5C71A 1F4HA 2J1VA 2XQXA 2W3JA 1W9TA 2J1UA 2RJ2A 2VZTA 3D3AA 2DCKA 2WAAA 4QX3A 1KEXA 2QQLA 5CZKA 4P02B 4ZZ8A 1UWWA 4DUWA 3VD5A 4QDSA 1OF4A 5EJZB 4MGQA 4LQRA 2XHNA 1PX3A 2PQSA 2J22A 2JKXA 1W9SA 1JZ4A 1XPWA 3WF3A 1OT5A 3CZUA 1EUTA 2W1WA 1RYYA 4ET7A 4XZUG 2VZ3A 3VDBA 4ZXEA 3AC0A 2QQNA 3GM8A 4BJ0A 1UXZA 2WDBA 2B4KA 1GMMA 4BK4A 2VTFA 3WNLA 2VZQA 2L9LA 4DUVA 5DPNA 2OKXA 1I5PA 4QDQA 3C7GA 3VD4A 3F2ZA 5JXHA 5C70A 3BN6A 4CU9A 4P5YA 4GWJA 3IIIA 2V4VA 3T0BA 5C7GA 3ACIA 2WYSA 3OG2A 3IB3A 1JZ5A 1OH4A 2LW8A 2DDUA 2BGPA 1NX9A 3P6BA 5FUIA 3I2KA 2QQOA 4A3ZA 1US2A 4MGSA 1K45A 5JMOA 3WF4A 2VMCA 5J1XA 2W1SA 4GWIA 1CIYA 4AG4A 4LPLA 2VZRA 2QQJA 3WQBA 2Y6GA 4BK5A 2J7MA 3ACHA 3HNYM 3HNMA 3PUIA 2W87A 2VZVA 1UZ0A 3W5NA 3LPFA 3WSOA 3GXUA 2EICA 5G05L 3T2OA 2WO2A 3T2PA 2EIDA 2ORZA 3MV11 4BDVB 4QB1A 2BGOA 2VCAA 3K46A 3I2GA 3C7OA 4GZ9A 3T2QA 1UY2A 3C7EA 1UY1A 3WNMA 3DYMA 2X09A 1UYXA 2E32A 5IHRA 3MO4A 4UAPA 3FL7A 2WN2A 1W8NA 2J1TA 3I3DA 1CZTA 2W94A 3I3BA 2Y6LA 1PMJX 5DQ0A 3U37A 4ARYA 3HPNA 1GU3A 1UY4A 4OMDA 3MBWA 4DXRA 4TTGA 2QQMA 2WZ8A 4OMCA 1PMHX 3T0DA 2VL4A 2V5DA 3P1IA 2ZEYA 3IDAA 3LEIA 2VMEA 1DP0A 3VD3A 2VO5A 2W92A 1W99A 3ZM8A 1O59A 1DYOA 3NJVA 1DLCA 2C26A 4XUPA 5B4XA 3EYPA 4YPJA 1GUIA 4XVHA 1HN1A 4UOJA 4DEVA 3ACFA 1IQDC 1O8SA 3HNBM 1SDDB 5JUVA 5F7UA 4CU7A 4LKSA 4CU8A 2R7EB 1XC6A 3T0AA 2E33A 4PQQA 1WCQA 2BERA 3VDCA 2VZSA 3CDZB 3WNPA 2J1SA 3UNPA 3JXSA 3VDAA 2ZEXA 4DXSA 3THCA 1PX4A 5LA1A 4XUNA 4HG6B 3WF2A 2X10A 2WZEA 1K42A 3IAPA 4CUBA 4A44A 4P00B 4DXTA 1UMIA 1UY3A 2E26A 2Y6JA 1UY0A 4MADA 2J1AA 2EIEA 2YFUA 3W5MA 3ABZA 1JYNA 2YC4A 1CZVA 1UYYA 4D0QA 4PF1A 1H6YA 1JU3A 1KGYA 2Y8KA 3C7HA 3DYOA 2VC9A 3OEBA 3OGSA 2W9XA 2QQKA 5LCWL 4QX0A 2VCBA 3C8XA 5JXGA 2WBKA 3EB7A 2W5FA 1R64A 3NRUA 1XNTA 3K4ZA 1L7QA 4OZOA 3GDBA 4DUXA 3I2IA 2QBXA 3FHQA 1CX1A 1UYZA 1K12A 2B9VA 3LQCA 3OEAA 2LS6A 1EUUA 1JU4A 5IYYA 1JZ3A 3I2HA 5IFPA 4KI5M 3K75B 2JDAA 3NNGA 3WF1A 4QX2A 4FI9A 4XUQA 4QX1A 4CUCA 4TXWA 3I97A 2X05A 3DYPA 2WO3A 3SEEA 4A4AA 1JZ7A 3T08A 4MO3M 2V72A 3MUZ1 4MOAA 4ZY9A 1P8JA 5HPOA 3GGLA 3HJRA 3K4AA 1TVGA 2HLEA 3T09A 4OUEA 4QPWA 4D8MA 5EIYB 2ID4A 1K3IA 3K77A 2WABA 4CVUA 3HEIA 1GQPA 3VD9A 4JHZA 1WKYA 4E8CA 3SKJE 4JKMA 2XOMA 2VR4A 3SKVA 4W8JA 1ULOA 3DECA 3OB8A 4A42A 2VMFA 3CQOA 3J7HA 3K4DA 4W50A 3FHAA 2YG0A 2VZ1A 4KMQA 3PUHA 3A7QA 3I2FA 1SHWB 3OGRA 5CYYA 2WQ8A 4P08A 5JXJA 4M4RA 5HXMA 4DEQA 3CKHA 4M4PA 2XONA 2ZEZA 2VQUA 2VOTA 2DCJA 1UMHA 1JZ2A 2WUHA 4E8DA 1TG7A 2BZDA 2W47A 4PT6A 4XURA 3WEZA 5IFTA 1LNSA 2Y6HA 1O8PA 1OF3A 2JE8A 3MUY1 3ETPA 5LA0A 4QAWA 4JKKA 3A21A 4QDRA 2WAOA 1BHGA 4W4ZA 3LPGA 1JYVA 5DN2A 2VQTA 3ECQA 4BXSV 2YB7A 3MV01 1F4AA 3A23A 4OYUA 3WNNA 3SEPA 1JHJA 4JX0A 2W1QA 2VJXA 2W95A 3E1F1 1W0NA 4QB2A 2VMDA 2RV9A 2ZEWA 5IJRA 2E31A 3NQHA 2YFZA 4CUAA 2ZXQA 1JI6A 5A1AA 3FN9A 4A6OA 4QB6A 4A45A 1JYWA 2VM9A 1T2XA 1JYXA 2Y6KA 5DMYA 5G04L 1D7PM 4JKLA 3I2JA 2BBAA 1SG3A 2WN3A 3ACGA 3UETA 2W91A 2J1EA 2HYXA
chains in the Genus database with same CATH superfamily
2VMGA 3ON7A 2ZX0A 3VBHA 2ZS6B 3PTYA 3Q8FA 2UU8A 2VQAA 4UFJA 4B4QA 3IAQA 2VCCA 5A80A 4L97A 4XUOA 3VZJA 1H6XA 2E7TA 1QU0A 1VAVA 3WNKA 1OPOA 1R083 1NKGA 3AVSA 3VDDB 4ATEA 1AYN1 4CRQA 3CJIB 3CZJA 4V2VA 5BYNA 3T2TA 4CCCA 4N8MA 4IETA 1G9FA 2B42B 2JD9A 5GLUA 2PAMA 4ES8A 2BUKA 1QH7A 5JIUA 4OFGA 4X8NA 4CDUA 1YHFA 1MEC1 1RUF2 2ZGKA 5GALA 5JOYA 2YC2A 1MR5A 2SBAA 5CG8A 1RIRA 1XNDA 3O12A 4MX3A 4AEDC 4CDUB 3WXPA 2RVAA 3D4KA 4IGQA 4XBLA 5SV8A 1H2KA 4I0BA 3ZXGA 3M4FA 2YBKA 4I3PA 4BYYA 4C0HA 2QZ2A 2WZR2 2HWC2 5CBLA 3PVOA 4Z2AA 1US3A 4QKFA 3TEXA 4BXFA 1L7RA 1NA1C 1JZ8A 3LEMA 5B4NA 3APBA 1HIXA 2KR2A 4E4SA 1IHMA 4HPKA 4YFWA 2A71A 3W59A 2C9KA 3WHTA 1UOJA 2ORXA 4CU6A 1I5ZA 5IT6A 4ZZ5A 5KHHA 3ZO0B 4M00A 1UKRA 4RGGA 2ZA9A 5HCAA 2VNVA 3POWA 4IUGA 1DGRA 1W8TA 3RI9A 1VBD1 3WLUA 5K4LA 4AFMA 4WBBA 1MPXA 2WZR1 3UJOA 1IOAA 3JD73 4Y5Z0 1UU6A 3BGAA 1W8OA 4KWUA 3VD7A 3LEGA 2HWE1 3OGVA 2WNUB 3LA2A 4AHXA 1O7FA 1ST8A 3BYWA 2VZOA 1S0JA 4FAHA 1RUI2 5LW9A 2BNMA 3THDA 2A3XA 3UKTA 5AC93 2VZUA 5FYSA 2J1RA 3WHUA 4ZU4A 3RYKA 4XIOA 5J37A 3AP5A 1W2UA 1W0OA 3CNAA 4IV1A 4S2GA 3MIHA 3NAPA 1HXS2 1PVC2 2G9GA 1GSLA 5F2WA 3PMSA 1CGPA 4FOQA 3ZSJA 4QX3A 1O3QA 4YM2A 2HWC3 2XG3A 5CZKA 4PQ9A 4RGAA 4X6QB 3RQ0A 2IVJA 2PELA 5CADA 5FP8A 2RS33 4KG8A 1BBT1 2AREA 4NO4A 2E7AA 5LRRA 1S0BA 3N7LA 1UKGA 4Q2FA 3RNSA 1V00A 2E63A 4LHKA 1K5MB 1XPWA 2NM1A 2BTVC 4LK7A 3WF3A 3H0OA 1CPNA 4Y4YA 5IAVA 3H50A 2DVDA 1RMU2 3N4MA 1WA4A 3WDXA 3X29B 5EP9A 1UXZA 2B4KA 2A75A 2EAAA 3OYWA 3WNLA 2L9LA 3VZNA 1HX6A 1GNZA 1W6OA 5BNNB 1DZRA 3KVAA 1I5PA 4TWTA 4EROA 5K0UC 5J7MA 3OPTA 2B45X 5C70A 1ALYA 2JKBA 2QTWB 2AEYA 2AYHA 3O5SA 4CCOA 4KG0A 2Q4SA 2QFEA 1AUYA 1APNA 3N9PA 3IIIA 2EXJA 2VOWA 3E5QA 4MZUA 4WVMA 3JU9A 5C7GA 1D2QA 5BNNC 1VBE2 2WNVA 4QQHA 3N7JA 4CP9B 3AZXA 2MNGA 4WM7A 4X6RB 2D97A 5DZEA 3PNAA 3ST7A 4AWDA 1NX9A 1YRZA 4META 5FY9A 3NO8A 3PIJA 4FVVA 1Z0HA 4Y3OA 3ZFEC 1EPZA 5GKAC 1KFXL 4CDXC 2ZGSA 1QNWA 4NVPA 1E5IA 2JG9B 1R081 5CFCC 1HQWA 4LE3A 1SLCA 2GNTA 4O9EA 3DEMA 3O14A 3PJYA 2GZWA 1UL9A 3PTRB 4IQPA 2RM21 2AUYA 4JTOA 1PIV2 1LENA 5C9AB 2CNAA 3KM5A 1Q8PA 4QX5A 1VRH1 5J1XA 3ZN4A 4AG4A 1BJQA 4H2AA 2QQJA 4D69A 5DZFA 4FBFA 1OKOA 4Z82A 4BK5A 1LOFC 3ACHA 2W87A 5I8SA 1UZ0A 4LNVA 4E4DX 3OUHA 2EAKA 1WLWA 3RZMA 1SPPB 3AKPA 3VUOA 2A1XA 2F4LA 2PHLA 4R9AA 3ZPYA 4NROA 5G05L 5CU1A 5HV0A 4LIVA 5JOWA 1HW5A 1W2AX 4OI4A 3T2PA 3BKZA 2QVSB 1RUH2 1UPIA 1ZZCA 1VBA3 3TOJA 4XEZA 4MXWB 1NXMA 2BWCA 5FREA 1IPSA 5CAZA 1LR5A 4IEWA 2BGOA 2VCAA 4XJ8A 2LALA 3B00A 4RR3C 3ZFGA 3T2QA 3HAGA 2JJ6A 1N1YA 1GP6A 4GH4B 3U1XA 5CFCA 2O8OA 3WNMA 5A6ZA 1FI2A 3J9SA 2GC1A 2QZ3A 2R6QA 3DYMA 1BBT2 2X5IA 4LMFA 4NHYA 3NMBA 2HYKA 2IXJA 2P3YA 3KV5A 1R093 3KT4A 1JTZX 2E32A 4Y1XA 5EYXA 2WWSA 1ZBE1 3QCWA 5IHRA 4S2DA 4YGCA 3MF9A 1D4VB 1RGSA 2XWBB 4UAPA 1C3HA 2DFCA 1RUJ1 5FFOC 4WZCA 5BNPC 3KCCA 1FX5A 1IQAA 1JOJA 5ABJB 4P9GA 5C8CC 4FXKB 4NPRA 4XTMA 3ZDSA 5A6YA 2ADDA 2VUDA 1OPMA 3RWKX 5FMOS 2EALA 3I3DA 2JB8A 1QH6A 1CZTA 4XJZA 5EHDA 5GZDA 1HRI3 1POV1 2E53A 2IZWA 2Y6LA 5HCBA 4AGGA 4XTPA 4RS5A 2HWD3 1WW6A 5F3CA 2OIIA 1DQ0A 5FAXA 1D4M3 4FPYA 2UYBA 4PLNA 1G7YA 4PI2A 4QGNA 3MBWA 3VBFB 3SXWA 4TTGA 5A3MA 1ENQA 2WZ8A 4GALA 1YUDA 2GP5A 5FZ6A 1VAMA 1HRV1 4Q8KA 3MHZA 4HONA 4KQ7A 2RDNA 3RWNA 3DKQA 1AVBA 3VKNA 2CHHA 3TN91 4LBOA 1DP0A 4XBNA 4BISA 2ILMA 4YVSB 3JQWA 4QPGB 4B3NA 1W99A 4NAMA 3VLBB 3DPRB 4LA3A 3HT1A 1WCDJ 1WW7A 4N53C 4R52A 1GZWB 1VB2A 2EA7A 1UZVA 4O7XA 4XF1A 2ET1A 4UBHA 1YQ5A 3FZ3A 2WINB 3RPQA 4NHXA 3MW2A 1OI6A 1SDDB 1NQDA 4NIAA 1M4WA 1Z7S1 2DUPA 4LKSA 4CU7A 4HT1T 4M01A 2GC0A 3T0AA 1W6QB 2E33A 4PQQA 1WCQA 4N9IA 2ET7A 5A1LA 2X53S 2BERA 3POBA 3RZZA 3TEYA 5LRSA 4XYXA 1Z7S2 1E57A 2RS12 3PJQA 5FXWA 1YLLA 5LBCA 3U14A 3WP5A 5K0UA 4DMIA 1ZZ7A 5KHJA 3NV3A 2GMEA 2OT7A 4QXHA 2ZEXA 1G86A 1DGLA 3K51A 2XJVA 2FMDA 1W6NB 1AXYA 5FK8A 3S5AA 1A8MA 1DDLA 2I45A 5DABA 1W6NA 2WZEA 4WM7C 4CUBA 2JG8B 1F5JA 2ARAA 4DOUA 5FYHA 1UMIA 1TE1B 1UY3A 5FO7B 3VBSC 3W5MA 3ABZA 2A6WA 2RHPA 4FFFA 5APAA 2XJTA 5BV6A 1VBE3 2R043 1U0AA 3MICA 2ZZJA 5C3OA 3TWIA 1JU3A 4ZKTB 3ILFA 4D7TA 1COV2 2W9XA 4QPIC 4YW4A 3WDVA 1V9U1 2CY6A 2IXLA 2PHWA 4QX0A 2OA2A 5AC92 3T4HB 4AVBA 2WBKA 1X9PA 4BZ4A 1R1A3 3I4IA 5IVCA 3SH3A 1S2KA 3AKTA 2RM23 1YFWA 5A70A 1ULFA 3VBOA 5A32B 4FP3A 3U78A 2JE9A 5FMOL 1XU2A 4LLFA 5BPXA 4ZS3A 2VVEA 4OZOA 3BB6A 5A1FA 2Y38A 3FHQA 1COV1 1SLTA 1BK0A 1EAH1 1JHNA 4LBQA 5CVRA 2OZJA 1JZ3A 4CDXB 3FLTA 3K75B 3WNXA 2JDAA 4R4XA 1FMD2 4JAAA 4TN7A 5BXXA 4CDWC 2LTNA 2AGSA 4IV3C 5FYUA 4YGDA 3WF1A 4XFAA 4QX1A 5E1RA 4CUCA 3HT2A 4GB33 2P34A 1QQP2 1D0HA 1HJFA 4GQ7A 5C33A 1B35A 1X33A 3T1LA 5CB7A 2ZGLA 4UW6A 3SEEA 3ZN5A 1RUNA 4ORFA 4A4AA 2C9AA 2ZGOA 5FZMA 4N43A 3KV6A 1JYCA 3NV4A 4YYOA 5KXCA 2ZABA 4BB3A 2ZACA 1PHMA 3RZLA 4AEDA 3VBOB 1WMEA 4I2OA 1TVGA 4JHTA 2VTXJ 2W52A 3AYCA 5IUQA 1QF3A 1FNZA 3ZFFA 4TSVA 1K3IA 1N1TA 4CEYB 3LOBA 2RR12 3OD4A 5H9RA 3ZX7A 3MIBA 4O61A 1ENXA 2PLV2 4MHUA 5FZ4A 4A7ZA 1VPHA 1OQEA 4EN6B 5K7PA 4JQRA 3AKQA 2RR11 3VGIA 1A6CA 1QY4A 1HQLA 3ZPOA 2VMFA 3J7HA 4L9BA 3OUJA 4QQLA 2ARCA 2VZ1A 3HBKA 4GULA 4NRQA 4XJAA 3R6SA 1RUD2 2D6KA 4IV3A 1Z7S3 2OPWA 4XDPA 2YZ4A 3TRSB 5K0UB 3U0ZA 1UU5A 3A7QA 4M3CB 4XW3A 3I2FA 1H1AA 1SHWB 3H8UA 2GH8A 1H8VA 3OGRA 5JXJA 1ND3A 3F95A 5CIRA 3H1YA 1ZA4A 5I0TA 5F9TA 5HXMA 4DEQA 1RUG1 5C5TA 1KDMA 5BNQA 4KBBA 1XBFA 3AYEA 1QQP1 3Q8CA 4K7JA 4M4PA 3W58A 3NW4A 1VALA 1UMHA 4Q1PA 3CJIC 3NV1A 4EZHA 2XJQA 4PLOA 3R05A 5KXDA 2AZ5A 5LWBA 1TG7A 2IXIA 2TNFA 5KHIA 5IFTA 1BYHA 1Y4WA 1AF9A 2WQZC 2JEMA 1AR82 1O8PA 4IL7A 5FRAA 3BUCA 1A34A 1OF3A 3MUY1 1Y9GA 3B5LB 1K5MA 1EV11 1H0BA 3GJAA 4BHPA 4EN9B 1OFSA 2XWJB 3PU8A 1JYVA 5GZEA 5IATA 4SBVA 1ND3B 2CGOA 3WD5A 1NCRC 2CAUA 1H9PA 4HK9A 2VBPA 2WWJA 4QU1A 2WR9A 5FBJA 4CP0A 4QXCA 1QJEA 1UOBA 5FYMA 4GB31 1BBT3 4TLFA 1OVPA 5FUNA 1JODA 4H55A 2YU2A 3JB4C 1QXPA 1PK6A 1NA1B 4IEPA 4ZU5A 3SEPA 1V9U2 3WY6A 1JHJA 5KWRA 3I59B 1KQRA 1PZ8A 2W95A 3V65A 3E1F1 1O3SA 4F3JA 2ADEA 2HWF3 2XL7A 1QJFA 4FXGB 4K3UA 4UFHA 4QB2A 1V6LA 3BVCA 2DU0A 3MFAA 1PO13 1LECA 1XSQA 2YFZA 3BOWA 4LBQB 4CUAA 4YGBA 4Y5SA 3LB9A 3AMMA 3FN9A 3SLIA 4A6OA 1OC1A 1NZCA 3KGLA 4GD4A 1W3XA 1YI9A 2GP3A 3O1UA 1XXNA 2Y6KA 1MS1A 4I01A 1AX1A 4XFCA 5ERLA 3KF3A 3SH4A 1D7PM 2YU1A 1CAUA 4AGVA 4JKLA 2XLFA 1SBFA 4HN0A 3I49A 4Q29A 1MZ6A 4KNCA 1HRV3 3MW3A 5KR7A 3IDCB 2W91A 3ILRA 3LZZA 4FOYA 1GANA 4RYDA 3WF0A 1HDKA 4DY5A 4NOTA 4GAZA 1LOGA 1GWMA 1IPKA 4AEDB 2GC3A 3RFRA 2RDQA 5CKQA 5I8YA 3WDYA 5FY5A 5T5PA 4D6RA 2VD7A 4DINB 4B7EA 1UF2C 3SHRA 1AXKA 2EXHA 5FP4A 1GOFA 4A41A 2A6YA 2RS51 2YMZA 2DCYA 2EXIA 4HSLA 3K3OA 5CKMA 4CYDA 3ZR6A 3HD8B 4HPKB 1W2NA 3HOBA 1W9FA 3L2YA 1ZRDA 1OUSA 1GNYA 1GFF2 1TQ5A 3NV2A 3R4SA 3WNOA 1MS4A 3M3OA 1X8MA 1W8UA 2MHFA 2VW1A 3TAYA 1WBLA 4YM0A 4CCNA 3S7EA 5A3NA 1WLDA 1RUI3 1CPMA 3AZVA 3LIGA 4CDWA 5C6CA 1Q8QA 5KBFA 5J96B 2D6NA 3I3EA 4K20A 2EIBA 4JGYC 5CISA 1HXS3 1PVC3 1GOGA 2FCUA 2W1UA 2ZTNA 5BNNA 2WNUA 2XH6A 3NNFA 1RHI2 1JXNA 1VP6A 2YDEA 2X29A 3E6BA 4L99A 4ASLA 3A0KA 5DAVA 5JWPA 1RUD1 4DIQA 3FX3A 1LOCA 1D0GA 1XNAA 1GP5A 2RS32 5M0TA 4YZ3A 1MS0A 1UX7A 1RUC3 4IEUA 5FIXA 3V64A 4QHZA 5FYTA 2B9UA 1OOPC 3KVBA 4IGOA 3JZVA 4YZ4A 1PMIA 1NAEA 1AZDA 1ZRIA 1C28A 1QOTA 4LBJA 4RD7A 5GLVA 3S0MA 2V09A 3PUQA 5L19A 1HQNA 1CZSA 4L0PA 2PXJA 4HKOA 4XACA 2QQUA 2W46A 2CSGA 4OCTA 2XVKA 4NR1A 4XJUA 5EJ3A 4YW3A 4HKWA 3GBWA 5I93A 1RUOA 2KM2A 4O65A 4NRPA 2AR6A 4TLGA 1GR3A 3JB8A 5FPAA 3TN93 1H2LA 3CBNA 3HQRA 4AZZA 5F8PA 3JCIA 1G9AA 1GQGA 2HWE2 1V0AA 1LRHA 2Z5WA 2Y34A 3C7FA 4AI8A 5JPMB 2OQ6A 5FPXA 1W3VA 3PHMA 4FFGA 3VBHB 4IXLA 1GICA 3RSJA 4BCUA 1F4HA 2J1VA 4HL0A 3VKMA 4YZ2A 1OH3A 3AMQA 2J1UA 2RJKA 4NHLA 4QPIA 2WAAA 1W8WA 5L9VA 4FPOB 1IZ3A 1LODA 4P02B 1I6XA 1UWWA 1Y43B 2C1FA 4YZ1A 1OOPB 4HMZA 2QUOA 1EAH2 4WM7B 2VUCA 4MGQA 5FUPA 1PX3A 4CEYC 2JKXA 1W9SA 1AR72 1JZ4A 2HBTA 1WCSA 4QGMA 2CGNA 1WMFA 3P5BA 3GBGA 3NWKA 5FYCA 1RYYA 1W9YA 3S5QA 2WYFA 3DL3A 4XZUG 1O3TA 2P6HA 1W6MB 4ZXEA 3GM8A 1AR71 1DGWA 1AR63 4BJ0A 4GKXA 5GM0A 1GMMA 4Y20A 1UNBA 2IWGB 1HB2A 1RVF1 5DPNA 3JD71 3AXDA 4XC9A 1QXRA 1BK1A 1C8M1 3F2ZA 2D5HA 1N1VA 3GYDA 2JDPA 4CU9A 2I74A 2RS52 5IK5A 5T5JA 4GWJA 4HLTA 4EZ4A 4C1XA 3CL1A 2VPVA 3MIFA 3T0BA 3WX5A 1XNBA 3IKWA 1AJKA 1FT9A 5A6QA 1C8M3 1LU1A 3CLPA 1QJX2 4LULA 5AFEA 2DDUA 4COZA 3ENRA 3OD0A 4NIHA 4LJHA 5C4WA 4MXWA 3EHKA 5HCFA 2GSYA 1AL0G 1NY72 2BFUL 5FUIA 4AW7A 1TMF3 4A3ZA 2DVAA 3ZFGB 5HI0A 5E8AA 4XOGA 3EXUA 4R8HA 5A7NA 4NN0A 3ZFFB 1R092 2A73B 2A6XA 3ZR5A 3CU7A 4PDWC 5CEHA 2XVGA 1DCSA 1ND2B 3WF4A 2BOJA 4MYEA 3SCGA 1EY2A 2D7FA 4GWIA 1CIYA 4QXBA 3N36A 2VZRA 4AI3A 2LRPA 2R0FA 4W65A 4W6WA 4MG2A 3HNYM 1VE0A 2VZVA 1J1LA 1SPPA 1X9TA 2DUQA 2EF6A 2H0VA 1DG6A 1G6NA 5DUVA 1Q56A 4CP1A 5FZHA 1UOFA 1ZZ6A 2QNKA 1QIQA 2ZX4A 5DDJ2 1ZZ9A 4KGQA 4COWA 1WLCA 3N9NA 3T2OA 5JMCA 1LHWA 2A5ZA 4QD2A 1S0CA 2WO2A 3LCPA 5FJKA 3FBMA 1RHI3 4GB32 4NE9A 5JPNB 3B9CA 4BDVB 4QB1A 5K9YA 2OUJA 4A6SA 1AX2A 1KJRA 2VAUA 2LM3A 1MVEA 5FOJB 2HEWF 3WW4A 1QJU2 3LF7A 5FZBA 1QJX1 3C7OA 1VBE1 1ND2C 3KB5A 3E6DA 2X5IC 1ENSA 3LOIA 1KJLA 4KWJA 1UYPA 2WFF3 4YG3A 5JSRA 2JDNA 4P9WA 5E89A 5JIAA 4OULA 3AP4A 1S0DA 3FWEA 4NWWA 1REEA 4QU2A 4YARA 4UW5A 3H9AA 2WNVC 1L3JA 5D21A 3S57A 1AL22 1SCSA 1UMZA 1VIWB 3VHOA 4YNIA 1KXGA 3CEWA 2UWBA 4OI1A 3ILNA 1IGOA 2B39A 3L9JT 4URAA 5DG1A 1DZQA 5FKCA 4UFLA 2P5BA 1A3KA 1PVXA 3T3YA 3QOPA 4DO0A 2XBO3 1CJPA 3I2DA 1YEWA 2Q30A 1B35C 3KT1A 4N53B 4EN0A 1ZX5A 3VDDC 1CIWA 1BEV1 3I3BA 1NA1A 3D82A 4LA2A 2GH2A 4C90A 5F1RA 3E6CC 5DQ0A 1W6MA 4Q0UA 1XSRA 4ARYA 1XRUA 5FV3A 1WA6X 1YJLA 5B2GB 1GU3A 2OPKA 2W39A 2Y26A 4KGGA 1JN2P 4OLLA 4DXRA 2QQMA 1ENRA 2XUEA 4ASKA 5CFDB 3QH7A 5F3IA 3RZJA 1PMHX 3BIWE 2VL4A 5FQ0B 2PLV1 4P9LA 3UGFA 3D0JA 4R9CA 2ZZQA 4K40A 2IXKA 5EPAA 4BQ3A 1O4TA 2JG9C 2ZEYA 3IDAA 4RHV1 1N3OA 4WM8C 4XETA 5L7OB 4Y22B 5D1IA 2VUJA 1RUF3 4YW6A 5JI7A 3BU0A 1ODNA 3VD3A 4HKLA 4UT5A 5BY5A 1I3HA 2QQWA 3ZDVA 3MIGA 4J1XA 3RMYA 2FZ1A 3ZM8A 4XFIA 3NJVA 3O1TA 4XUPA 2WT2A 5C5UA 5B4XA 1OD5A 1W04A 5J36A 1VLNA 1ODMA 3KZ4C 4JV4A 2YGMA 1GUIA 4KWKA 2NN8A 4XVHA 2D6PA 2ZGMA 2O1QA 1LU2A 2IFRA 3ACFA 4HVRA 1PNFA 3BTYA 4P5HA 4RS5B 1W8ZA 5JUVA 4UW3A 1CJDA 3ZXEA 2DUOA 5J09A 3WDTA 2R7EB 4CU8A 1OA2A 1ZYBA 5FZ0A 1LJ7A 1Q8VA 4GMP3 1JOBA 4Z1VA 1S2EA 1YFXA 4ATFA 4XQWA 4LEJA 2PAKA 2P3IA 3VDCA 3CO2A 2VZSA 4LR4A 2J1SA 3SCFA 1F31A 3CF6E 2UURA 2XXZA 1G8WA 2EXKA 3O0XA 4R4ZA 3JXSA 4AYUA 2RM22 4QHBA 1G9DA 5E88A 3MEPA 4DXSA 4WM8A 2NMOA 2XDVA 4FPCA 4E2SA 4EWAA 5LA1A 2CAVA 1BQPA 3C3VA 1E5HA 1O5UA 2ZAHA 3HBZA 4UBGA 1DQ5A 4ASMB 1MS5A 1K42A 3DCQA 4YW1A 4P00B 4W6XA 1LOEA 2CWSA 5ANNA 1UCXA 1UU4A 4TYSA 1SFNA 4UF0B 1FPN3 2WT0A 2I2SA 2Y6JA 2ZGQA 4JC1A 1PO21 4LO8A 4MADA 3V0AB 1CD3G 1LHNA 1OFNA 1JYNA 1YFYA 2RMU2 4CCLA 1GLHA 5LBEA 1GWKA 5T52A 2H6BA 4JDMA 4U2AA 3ITQA 5T5LA 5C3RA 2P3JA 4PF1A 1SACA 2VC9A 1URXA 3VBFC 5EZWA 1KS4A 1VBC2 4Z92B 2QQKA 5FR3A 4OQ9A 5J48A 4GMP0 1SMVA 1QNYA 1ZZ8A 2AC1A 2RDSA 1DHKB 3WQ0A 5JXGA 2C24A 1UAIA 1RUH3 3U4SA 3VBSB 4L11A 3AM2A 5A32A 5GJ6A 2ZOEB 4OI0A 1ASJ3 1XNTA 4XHBA 4J6GA 4RHV3 2XKOA 4LHLA 3N9MA 1L7QA 2MEV1 5D8AB 1W05A 5I0UA 3ZYPA 2PLV3 3AP9A 4S2HA 3LDBA 4IEOA 1AHSA 4EN8B 1J59A 1AYM2 1LESA 1CX1A 4LTAA 1SDWA 3ME2A 3K2OA 4KI5M 2LROA 1K5JA 1RUD3 1Y3TA 2GMPA 5JR7B 1AYM1 4NIDA 1V6NA 4HZFA 1DQ1A 4A7KA 1BMV2 4FI9A 3POFA 5FLIA 4AQTA 2WQ4A 4GIQA 4F8AA 2X05A 4AHWA 4Z2WA 5FZ3A 1ZBA1 1CQ9A 3GZUC 4QM9A 4XCAA 3PLQA 3BIEA 1TZOA 4EJRA 1AX0A 2JIJA 3FHIB 4RR3A 4BLIA 4E2QA 2PMWB 1H2MA 1SQ4A 1VBB1 4MO3M 4UYBA 4B8EA 3MUZ1 3AFKA 4LE4A 2P6CA 4IESA 2QDNA 3GJBA 2Q5TA 1I9RA 5LB6A 5HPOA 2OXBA 5HCHA 1PGW1 1Q8OA 2HLEA 4YVWC 5IVVA 3WINE 4BM8A 2VECA 1AL23 2RS53 5EIYB 2GDFA 2N7GA 2K0GA 1EYBA 1RUE3 4CVUA 4EWDA 4LXLA 3VD9A 1C8M2 2A3WA 3DV8A 1HLCA 4JKMA 3SKJE 3ZSEA 1ZRCA 4G3YC 2O14A 3D5OA 3MLJA 2Q8OA 1ULOA 3KCXA 3OB8A 4A42A 4AEJA 3ROUA 3CQOA 4W50A 3FJSA 3QBQA 4ZU7A 4LO4B 5L7OA 3PUHA 2Y0IA 5DG2A 3O1PA 1OBNA 1W8HA 1S0FA 2BW8A 2D5FA 1Y7BA 1O91A 4IERA 4MUVA 2WQ8A 1RL3A 2O0OA 1FOD1 3I7DA 1FOD3 3UT0A 4MH0E 3MIDA 3I8TA 5BNOB 2PN5A 3IMNA 3CKHA 5C8CA 4AAPA 3HIFA 3VBOC 1ZVFA 5FP7A 2XONA 4IW3A 5JLVA 1CVNA 1PO11 2DCJA 2ZMKA 2D6OX 1AR91 3OY8A 5FWEA 4E8DA 1N1SA 2CU5A 1V9U3 3WCSA 1YIFA 2NP0A 3OF1A 5DDJ3 5C3QA 1M06G 1LNSA 1WMXA 5FYBA 4XABA 1U5IA 5AVPA 2YHJA 1RUE2 5HXVA 3NKGA 2AH2A 1G9BA 1F15A 4YM3A 4N43C 2DTYA 1O4YA 4HXCA 1GBGA 5DAWA 4CDWB 3H7YA 1H30A 5KHKA 5I0RA 2WAOA 1BHGA 3O1MA 4ES9A 5T54A 1LGBA 5DN2A 1B35B 5EFUA 4IE7A 3ORJA 3NKTA 5J3UA 5C3PA 4BIOA 4BXSV 1QDCA 2YB7A 3MV01 1W39A 4JCKA 4D7YA 4K1ZA 4DPNA 4OYUA 1IS4A 3WNNA 1HV1A 3USUA 2WS92 4JX0A 1ASJ2 2RMU3 3KGZA 5FPLA 5FZKA 2QE3A 3VKFC 3WP4A 4AVVA 1MZFA 3ZYHA 1W0NA 5HV4A 4Q1RA 2VMDA 2QCSB 2ZEWA 3B3QE 3I54A 4RQPA 4AL9A 1OUXA 1PGSA 2E31A 1SLAA 1VBC3 1H1IA 3L2HA 1EP0A 2ZXQA 5JZGC 2YGLA 4K21A 5A33A 2ZKNA 4KBZA 1RJ8A 4A45A 2VM9A 5A33B 1JYXA 2Q1FA 3VZLA 4DRVA 2VNGA 3WDUA 1HB3A 1YQ8A 2W0XA 2Y0OA 3AFGA 3I2JA 4K6BA 3D0SA 4LOSA 5DUXA 5FYIA 1SG3A 2Q0AA 2TEPA 1AYN3 3ACGA 3AKSA 4FPLA 1KFUL 2DFBA 2VCMA 3LKJA 4BLJA 5L9RA 2HWB1 2HYXA 2A70A 3RMXA 3M8LA 5EWSA 5JOXA 4Q27A 5C8CB 2D3SA 1H4HA 3KQ4B 4RFT0 4B4PA 2QQIA 1D4M2 2XKPA 3Q8BA 3W9AA 1XQNA 1UZWA 4FPJA 4HVOA 2VW0A 3NJZA 3IBMA 1CAWB 1VBD3 3BU7A 3OOXA 3WP3A 3CJIA 1PM4A 1KD7A 3FE5A 4LBNA 2XUMA 3ZKYA 3CMGA 5E16A 1CAXA 1XU1A 4RQPC 1OA4A 3AMHA 4GJYA 1WMDA 4RN5A 2YPJA 4WZFA 2VZPA 1GNHA 2Z4FA 3GZAA 2IFWA 3RZHA 4XUTA 4BWOA 2DVGA 2Y33A 5IAXA 1OKQA 2ZGNA 1S2BA 5JXIA 1HRI1 1POV3 1R1ZA 1UIKA 2IXHA 2WO1A 4M0NA 4ZXKA 3OYWB 3ZYJB 3PUAA 4Q0PA 2VBBA 1SFYA 4QX8A 5A3PA 1A8DA 5KC6A 3MGUA 5H9QA 4C91A 5BNOA 1QEXA 2RS11 2WFPA 4EYUA 2TBVA 2YBPA 2YC0A 3A4UA 1EAH3 3B01A 3HN3A 4AAXA 1ZA7A 5JOZA 2QDRA 4CCJA 4JTNA 3THPA 4ARXA 2Y64A 2JDKA 4FOWA 4QPIB 1HXS1 1OD3A 1PVC1 1BZWA 1R091 4LORA 5FJHA 1S55A 1GOHA 2ZHNA 2K46A 4BH9A 1H2NA 2WRAA 4XMIA 1N47A 2CDOA 2K2SA 1AR62 1BKZA 4UI9L 1CAVA 3VHNA 2FDGA 3LEKA 4YWAA 1YQ2A 5K8SA 3UESA 1FPN2 3MW4A 1H1MA 3MPBA 1H8TC 1MZEA 1OLME 1S4CA 4JZRA 4IEQA 3CJXA 4LHSA 5JZGB 4CE8A 5JDBA 1T6BX 2WSVA 3VZOA 2QJVA 5EQUA 3I2OA 3ZMOA 5A3LA 4CPBD 2R041 2P2KA 2XQXA 2VTXA 3GHNA 4FP2A 3PDQA 2W3JA 1W8FA 1W9TA 3J26N 4E27A 2CGPA 3D3AA 2DCKA 3POJA 2VMIA 5LK7B 1E5RA 3TEZA 2OW4A 2QQLA 4Q4W2 1AL21 3E97A 1LTEA 4MGYE 4BQWA 4C0BA 4V2WA 4C8DA 3B69A 3DPRC 5CFDC 4QDSA 5FK7A 2ZX2A 4QPGC 4HOOA 1DZTA 2ZJCA 4YVSA 4AQ6A 2J22A 4AK3A 1FOD2 3FFQA 5FYVA 3VHPA 1RUG2 4Y26A 3EO6A 1IKQA 4YG0A 4Q4Y2 3CZUA 4GA9A 4PDWA 2W1WA 4ET7A 1FPN1 4XJ9A 2VZ3A 5DAQA 1ZBA3 3VDBA 4N43B 3HWJA 4GH4C 3M3QA 3E5UA 4HSJA 3AMNA 4BOWA 4KL1A 4DY3A 2VTFA 3M70A 1IG0A 2VZQA 4B4RA 2W2IA 3PL0A 2TUNA 4EQVA 4AVCA 3USUB 3RYPA 4RS5C 4LT5A 3SMHA 2V5YA 4QM8A 3I3MA 3IN9A 3C7GA 4NWVA 1WW5A 4QKDA 1C8NA 2DTWA 5FZ7A 1HB4A 1YNAA 1YJKA 5GLZA 5LATA 1S1AA 2JICA 2WYSA 3ACIA 4GKYA 3IB3A 2BVVA 2ZGRA 2VU9A 1JZ5A 2LW8A 3MIEA 3ZN6A 1REFA 1F35A 3P6BA 3WUDA 4AGRA 1TME1 2VG9A 1LHUA 2JG9A 2QQOA 3I2KA 1O5LA 5AVAA 1OLMA 4XFHA 4MGSA 4CUGA 2C6SA 4BQ1A 1V6MA 3H8OA 4NPLA 3ZSMA 4CCKA 2Z79A 3OPWA 1F2NA 1YC61 5ACA2 4K8RB 2W1SA 1C5IA 1CONA 2ERFA 2RDRA 3JUUA 4LPLA 4ONUA 1OMIA 1PO23 2Y6GA 2J7MA 2ZHLA 1F9KA 2G9ZA 4QKNA 3PUIA 4N9HA 4JRLA 4ZS2A 3SH5A 1XE8A 3LFMA 3VDDA 2YV8A 3D8CA 3W5NA 2JDMA 5JAXA 1ZREA 4JDOA 1J58A 5L73A 2F4PA 2YYOA 3EJKA 4AFDA 2AEZA 3AYDA 2EICA 2Y6FA 3IDEA 2A6VA 4IDZA 1MQTA 2ZGPA 4J25A 4COYA 4E9KA 1ZRFA 5LA9A 4AI1A 2EIDA 1W6PB 2ORZA 3I3QA 4XAEA 5AC91 1W28A 2D6LX 1LGCA 1RUJ3 1MVQA 5C8WA 3BTXA 3N9LA 1JBCA 3I2GA 4GZ9A 2E9QA 3FLRA 3VHRA 1UY2A 5A3OA 2ZMLA 3ZIXA 1UY1A 4Y1UA 5FZDA 3V0BA 4N90A 1YI7A 2R32A 2RMU1 1OSGA 3B93A 3KF5A 3POIA 5JVVA 5LZ6A 3V0BB 2V4AA 4AE2A 1WCKA 4BA6A 3J8F1 2HBUA 1GP4A 3DN7A 4IEVA 3AB0A 3PVBB 4Q4V2 4Q4W1 3S6PA 2JG8C 5BNOC 2JDYA 1ULGA 1YWKA 3FL7A 1W8NA 2OZ6A 4OUSA 1JMUB 3LA7A 3AL6A 3ES4A 5FXXA 4F83A 5LEJA 3N9QA 1XE7A 4FT8A 3DF0A 5T50A 2FCTA 2J1TA 2WFF1 1GZCA 4A2UA 1NCRB 2JDZA 4Z07A 4XDQA 1DBNA 4NHMA 5C71A 5CKNA 4LO5B 2GN3A 3NSTA 3V56A 1VAKA 3AYAA 5A7WA 1BCXA 2ZGUA 4PBPA 2BGCA 1GZ9A 4G4FA 3U37A 4DFSA 1MEC3 3HPNA 2KXLA 2Q8DA 2A7AA 1ZBA2 4OMDA 1GQHA 4XQDA 1ULCA 3ZFEB 4YVWA 1RUJ2 5I91A 1X8EA 2X8KA 2XB6C 4Q5OA 4RL7A 5FY8A 5JI9A 4NIGA 5FY1A 3WV6A 4MGKE 4RSUA 2V5DA 3OJBA 4I0WB 1LAJA 3E5XA 1C57A 1AR92 1RC6A 2FD8A 2VVDA 2BPA2 2GNDA 1C5HA 2GN7A 5FYYA 4YFZA 1DF0A 2OUHA 3AKRA 1O59A 5J98B 3ZN6B 2C26A 2VOXA 3EYPA 4IEXA 1RITA 5FZ1A 4G9SB 4YPJA 4DB5A 1HN1A 4XF0A 4XILA 4FTBA 1VBD2 1TMF1 4UFKA 1NLQA 1ZZBA 2R063 1Y9MA 2DBIA 5A7SA 4Y4RA 4W6YA 3AZWA 4GH4A 1POV0 2PAEA 2XJRA 3LD8A 1NG0A 4F7ZA 5A3UA 5F3EA 2ZX3A 1DU3D 1ND2A 4JGZC 2PQQA 2ZMNA 3EBRA 3J7LA 2P3KA 3GCWA 4XE9A 2HH9A 4RFRB 3ATGA 4WVVA 2ZGTA 3CDZB 3U75A 3VL8A 3WW3A 3UNPA 5FDBA 2VW2A 3AP6A 1QJU1 4L92A 5FBZA 4R9BA 5FYZA 3ZYRA 5A7QA 4E4HA 1PX4A 4XXPA 5F5AA 3HR9A 4DZGA 3THTA 3UL2A 3WOGA 1DQ4A 2G4IA 5BNPB 3VBSA 4HG6B 3WF2A 1MZ5A 2BJSA 3WVJA 3N9OA 4AR2A 4KU8A 1AYM3 1IG3A 3IAPA 3MLLA 4A44A 1VJ2A 2E51A 1S0EA 5D8AC 4UFIA 3H1WA 5FPBA 3NNMA 5DAPA 4A3XA 1SFPA 2J1AA 1R1A1 4OHZA 4BQ4A 3N35A 2B46X 1FMD3 2YC4A 4NUBA 2RJLA 5DAXA 1CZVA 2VGDA 2DU1A 2F17A 4IE5A 5FXVA 1JW6A 3J7NA 3RVHA 4CDUC 1H6YA 1KGYA 2WA3A 2Y8KA 3C7HA 3DYOA 2Y60A 4GMP1 2ARBA 4OQ8A 2VCBA 2FCVA 4I0AA 1XJAA 1RUH1 1Q3EA 5A7WB 1STMA 3NRUA 4IE0A 5IVYA 1O6UA 4IGPA 3I59A 5FOBB 1NCRA 3KV4A 4I09A 3ZFEA 4CXWA 2B7YA 3KV9A 4KU7A 5D2AA 3JBG3 1FXZA 3JQXA 5C4WC 4DUXA 1MS3A 5CNAA 1G9CA 1QMJA 1TME3 2FMYA 1TNRA 2QBXA 2BP6A 3IWZA 4MLOA 5FQ0A 3J8F2 3RZGA 1K12A 2NLRA 4H3WA 1SBEA 2XLGA 3BODA 3OEAA 5JCTA 1EUUA 1JU4A 2V73A 4BE3A 1D4M1 1KITA 3ACLA 3I2HA 4B1LA 5IYYA 5T5OA 3W20A 3LIHA 3BOPA 4Y22A 3UGHA 1JYTA 1OLQA 4NIIA 3NNGA 4QX2A 4YW7A 2VULA 4X8PA 2F6BA 2A3YA 2UWCA 3DYPA 3HVDA 3ETQA 4L2NA 3RG0A 1UZZA 1BEV2 1REDA 2B8MA 2PFWA 4AF9A 2E6VA 3CHXA 2R49A 1ZM1A 4M3CA 2WNOA 4Q4Y1 4E4ZA 1NOVA 4XFBA 2VY0A 3GGLA 3KLSA 3OCPA 4WVWA 4DRRA 3K4AA 4DQAA 1F5FA 3T09A 2Q1ZB 2XHKA 3IM0A 3KHBA 4D8MA 1QJY3 3R4DB 3K77A 1EV13 4QGLA 3NL1A 3SNMA 4COVA 3OGJA 4PJYA 3VBFA 1YYNA 4NPMA 1OQ1A 2XOMA 2VR4A 3SKVA 2W08A 2WIIB 5FZ9A 2BNNA 2DCZA 4NMIA 5DXDA 2RE9A 5H9PA 3WCRA 4AFCA 3WG4A 4W8JA 3M2MA 4CDQA 1VBA1 1CAWA 5L7OC 5KC5A 4LO7A 4YRDA 4GWMA 1TMF2 1XE0A 3FHAA 3IMMA 4FPFA 3GBFA 1AR83 3GNEA 4RR3B 1QOOA 2FDFA 3WW1A 1V6IA 5BNPA 1HV0A 5IK8A 1YCIA 1QQP3 3VBHC 5FMDA 5FZFA 3O1SA 4M3CF 2DBNA 3LDKA 1DQ2A 4P08A 1WD4A 1BVP1 3HN1A 3R0RA 1W0PA 4NRMA 1FYUA 4PBOA 1OLRA 1QOSA 1N3PA 1XNKA 1V70A 2XVLA 1E5SA 2UYAA 1H4GA 3IPVA 4QMAA 4Y24A 5FPZA 3M3IA 2XPJA 1KDKA 4WVZA 4U36A 1VBA2 2VUAA 4RQPB 4XFFA 1OXCA 2WS93 1BMV1 2BZDA 4XURA 4XDOA 1PIV3 3WEZA 3V0AA 3UJQA 1GWLA 4LKDA 2R071 5LEKA 3VBUC 4XMAA 1U5YA 4I3GA 5FY7A 1C1LA 3ZSKA 1ZBE3 3PUSA 3T1MA 5LA0A 4QAWA 4FPGA 4K9SA 2H6CA 2GNMA 2JB4A 4QDRA 4YM1A 4OVEA 1UX6A 1UQXA 2D98A 1X7NA 1QJU3 2BFUS 4OZXA 4FPEA 5FZEA 2VQTA 5EYYA 5TSWA 4PIXA 3VL9A 3AP7A 5FY0A 4Y20B 3A23A 4YZ5A 3B9IA 4LKEA 3KHCA 4PIZA 3ZXDA 1ZRRA 3VBUB 1YQ6A 4Q8LA 1ONAA 4BQXA 2VJXA 2JE7A 2VXJA 1VMFA 4YSFA 3AVRA 5FZLA 3WG2A 1QGLA 3N7KA 1TNFA 3VKOA 4AQSA 2BVBA 3VBRA 2DVBA 1X36A 3NQHA 5JSPA 3D6EA 4HBNA 3J8F3 2PHRA 5T3NA 2PHTA 4YW5A 2A6ZA 1RHI1 4QB6A 1JYWA 3LWCA 2P1BA 3WW2A 2WWUA 2PA7A 1LGNA 1RVF2 5DMYA 1OQDA 3G7DA 3J4UH 4URTA 5G04L 3OBZA 2BBAA 2VNOA 4IE6A 4P9IA 4EWEA 1SZBA 4LK6A 2QQVA 2WN3A 3FUQA 3UETA 4MGIE 4PDWB 2CL2A 1PMJX 4Q26A 3K48A 4M4RA 5FZOA 1PGL2 3RS6A 1XYNA 2KD7A 3U4XA 3MDPA 2XJPA 4JQTA 5EJ1B 1FMD1 2P17A 2RS13 2FHRA 5T55A 2HWF1 4K8FA 4IV1C 3PURA 5C9AC 2VH9A 3DXUA 2PHUA 2XL9A 1CX4A 1FV3A 2FDJA 2XJSA 2ZKLA 5FWJA 3S7IA 4LIUA 4ZHNA 1S0GA 1ULPA 1PGL1 1JZ6A 4MGTA 4WV8A 1WD3A 2MEV2 1U5ZA 3LE0A 1LEMA 1W6PA 5F5CA 3M1HA 5FPVA 5ISLA 4ITCA 1A78A 3MYXA 4EN7B 4IV3B 5FO8B 1NY71 1NZIA 1TME2 3QLQA 5JR2A 2WNEA 3OBAA 4FPHA 4INDA 3N7MA 4OUMA 2HKXA 2YPDA 1SLBA 3G6JB 3NAPB 4Q4X2 4XF4A 4MV2A 4CA9A 1VMJA 1W6OB 1W03A 3KT7A 2Z2SB 3NJXA 3A0NA 1NXD1 4PHZA 2GNBA 3IDBB 2VOKA 4CDQC 4E2GA 4S2FA 5GZGA 5IW0A 5IVBA 4UWDA 3BALA 2JENA 3CIHA 3DXTA 1AJOA 3OPZA 4IV1B 3ZOIA 4LBMA 3MLKA 5IVEA 5I0DA 2EVXA 3VB9A 2ZHKA 4MHRA 1J83A 2C4XA 2PHFA 1W9WA 4AI9A 2UWAA 1AR73 4HFSA 2WO7A 1UPSA 1RUG3 1J84A 1PM7A 3A22A 5LA2A 4QQOA 4LHNA 2R042 1CAXB 2GC2A 1NT0A 4CCDA 1DGWX 1UXXX 1VB4A 1NUKA 3VN4A 4CEWC 4IE4A 1AR93 1COV3 2D40A 3O7OA 4J1WA 4FCAA 2CDPA 2WA4A 1O4ZA 4BQYA 3URFA 3GZEA 2D44A 1CWPA 1JS9A 3B7MA 1RXGA 1YQCA 5F39A 3T30A 5I0SA 4P14A 4AHZA 2YUEA 4LUKA 3TEWA 1BXHA 5FZIA 5F5IA 1LOFA 2OX0A 3VBUA 4CCMA 4XHXA 1VMHA 3H8XA 3M3EA 5FP9A 2VVFA 2RJ2A 2VZTA 4Y5TA 1DLLA 1KEXA 4CTEA 1IPJA 2UY8A 2YXSA 5L9BA 4Q0SA 1ZBE2 3FC0A 2X5IB 2R062 3W21A 4ZZ8A 1UO9A 3Q8AA 3VD5A 4RA0A 4DUWA 5IVFA 1RUC2 5FXZA 1OF4A 5EJZB 2MPFA 3M7AA 4LQRA 4C1WA 2GMMA 2PQSA 2XHNA 5FMCA 1WGPA 2C0ZA 4XZPA 1OVSA 1FATA 5F32A 1NE4A 3S30A 2K9ZA 4QQPA 1OT5A 2H0BA 1EUTA 1VBB2 2BDRA 2ZHMA 2PYTA 3ELNA 1HB1A 4ZPIA 3TB0A 3AC0A 2QQNA 4P9JA 1Z78A 3IT8A 1NCQA 2WDBA 3ZYFA 1YFUA 3ALQA 4RHV2 3ZYBA 4BK4A 1RUC1 3TN92 3UK9A 4AQ2A 2Q1MA 4DUVA 3FMGA 4H14A 4UXAA 1DYKA 1NLSA 2DCTA 1AYN2 2OKXA 3KSCA 4D6SA 4FSJA 2XGXA 4JGYB 4QX7A 3WDWA 2JIGA 4H7LA 4QT6A 4ZONA 4QDQA 3RJRA 1U12A 3VD4A 5IWFA 5JXHA 2WLQA 2WT1A 3PVNA 3BN6A 4P5YA 1C1FA 4Q0QA 1UN1A 2JXAA 3ZFFC 2V4VA 4AI2A 3OG2A 3NVCA 4MSVA 1GYKA 1OH4A 1PIV1 5C4WB 4XXAA 1JUHA 1RUI1 2ZCWA 5SV5A 1XYPA 4AOCA 2BGPA 2R1BA 3MI8A 4YG6A 1CN1A 3OSDA 4EV0A 2FBEA 4AVAA 1QJY2 4XF3A 4CXYA 4TZDA 3WG1A 1UD1A 1MQTB 1B09A 1US2A 2VQ0A 2UY9A 1V6JA 2FDIA 1K45A 1CESA 5JMOA 5C9AA 4OHWA 3OGGA 4Q4V3 1NCQC 5KXEA 1DIWA 4LBKA 2VMCA 3AJYA 3OY8B 4HN1A 1QJZA 1RUE1 3WQBA 4YVSC 3JBG1 4JDNA 3POGA 2R16A 3AJZA 3HNMA 3ZIWA 1H8TB 2WNVB 3IZOA 1WWYA 3KQRA 4CP9A 5ACA1 3H1MA 1PNGA 2OYZA 1KS5A 3POYA 4XF9A 3LAGA 1VRH3 4OHVA 3LPFA 3LSDA 3TNPB 4QQ2A 3WG3A 3WSOA 4BQ2A 5ABJC 1QHDA 3H8RA 5FP3A 2HWB2 2D3PA 3DPRA 3GXUA 4N53A 5A3WA 3QD6A 3AZYA 1VR3A 1S0IA 2YBSA 3NAPC 1GZWA 1QJY1 4MVTA 2R0HA 4PCRA 1X50A 3MV11 1LOAA 2WC2A 3NNLA 2XBO2 4Y1ZA 1RINA 5F2SA 3OUIA 3QACA 1FAYA 2Z69A 3K46A 1IS3A 4R9DA 4LUMA 3WZ1A 2FZ2A 4DNYA 1NCQB 2Q8EA 1YXWA 3C7EA 2B5HA 4XCBA 3KMHA 1H9WA 5FY4A 1W06A 2X09A 5GZFA 4ISQA 4CDXA 2ETEA 2JX9A 2WLPA 5FPUA 1WUVA 3R4UA 1LB2A 4BQ5A 3WP6A 1UYXA 3H42B 4DS0A 1F8VA 3ZXFA 3MO4A 5FLJA 3H3LA 5LASA 2WZPP 4CEWA 5A3TA 5HBAA 5H9SA 3RJ2X 1LEDA 1R1A2 1SLLA 5FCCA 4FFHA 2WN2A 2C5DA 2JWPA 3UGGA 4XAAA 1T6GC 4BPZA 3WR0A 1PO12 3HQXA 3U10A 1UW8A 2DURA 1KRIA 1PZ9A 3IIAA 3AXEA 4XBQA 2IVIB 4BMBA 5ABJA 3RGBA 1RMU1 1XYOA 1IS6A 1XOYA 2W94A 4K1YA 5DZGA 3P3NA 1NQJA 1QDOA 4V1PA 3O1VA 1O3RA 3SISA 5LY1A 3INAA 4M3CE 5IK7A 2ZX1A 2WFF2 4JGYA 5DUWA 5GLWA 1D2SA 1W2TA 1UY4A 4D3WA 4FTEA 2CYFA 2KA3A 1HRV2 1LULA 2R061 3VZKA 4JRAA 3AZZA 4OMCA 4Y33A 5CFCB 3T0DA 4D6QA 4KWLA 2AENA 1LCLA 2DYCA 2NQYA 5L36A 4P9XA 2XQRA 5A7OA 3P1IA 4BMEA 4QWNA 3ES1A 2NZ9A 3LEIA 2GALA 2VMEA 3DKWA 3O0VA 4LOTA 4IEYA 5CG9A 5FLHA 3BI3A 2RG4A 2ZPXA 2VO5A 1ULEA 1CAUB 2AACA 5FKBA 1PK6C 2VXRA 2W92A 1HRI2 3DGTA 2WSUA 2XMLA 5IK4A 1J3PA 4NAOA 1DYOA 2OVUA 2HWD2 1DLCA 4I30A 4QPYA 3BPZA 4FOVA 3POSA 5E6HA 5FMBA 1FNYA 1LHOA 1WW4A 3RDIA 1YO8A 2RR13 4AXOA 3IPVB 3ZYGA 3T4VA 4AVTA 3VV1A 2ENRA 4UOJA 2HEVF 1DQ6A 1LKNA 4JVAA 4DEVA 1IQDC 4AFBA 1O8SA 3K3NA 3HNBM 2WKKA 2R072 3GF6A 4AI0A 5F7UA 4QKBA 1ULDA 3BTAA 4FTSA 4MXVA 1XC6A 3KWVA 3ZXJA 4UF0A 2SLIA 4B7KA 1MS8A 1PZ7A 4YVWB 3PMEA 4LO6B 2VNRA 5FTTC 1GKBA 2HEYF 2VOVA 3KS7A 4M0HA 3WNPA 4CEWB 3OTFA 5I8TA 1PO22 4COUA 4WVMB 1X82A 3VDAA 4GWNA 1GZTA 3LSEA 3O0WA 2JDHA 3THCA 5KXBA 4CP2A 3ZFGC 4D94A 4XUNA 5IVJA 1NE6A 2D3RA 4AHYA 3PIGA 4BIFA 4QPGA 1CAVB 3EMRA 5BUVA 1BVVA 2X10A 3WQ1A 4BU2A 2BBVA 3FBYA 1V6OA 1DGRN 1W2OA 2XLAA 5FZ8A 3BTZA 4GJZA 3ZVXA 4DXTA 5DDJ1 2BRTA 2NMNA 1TEIA 3WQ7A 2JECA 2E26A 2ES3A 1UY0A 3PU3A 4XJWA 4L8QA 2EIEA 3EQEA 2YFUA 4RGKA 1C4RA 1UOGA 1WZXA 5ANQA 2IUWA 4PI0A 3WT3A 2W68A 1JUIA 2HWF2 3ZSLA 3ZYIB 3AK0A 4SLIA 1UYYA 3AX4A 4D0QA 1EPWA 2XR4A 2R073 3OEBA 2RS31 3OGSA 4FQZA 3VBRC 5LBFA 1DFQA 3ZXLA 1WBFA 2G19A 1H8TA 2HWB3 1UZYA 5GLTA 2WJSA 2WS91 1BEV3 2HWC1 3TBDA 5LCWL 3POEA 3C8XA 4IEZA 4UW4A 3LA3A 1AXZA 1GV9A 5F6LB 4YW2A 1R082 1LHVA 2G1MA 1ZNPA 3LDRA 2XBO1 3EB7A 2PHXA 4O9GA 3VZMA 1U5XA 2W5FA 1R64A 3Q9OA 3SQOA 2FQPA 2WL1A 3O1RA 4Y1VA 1Q43A 3K4ZA 1JOPA 1NYWA 3U11A 1WCUA 1EV12 1FV2A 4YGEA 2IC1A 3GDBA 2JD4A 5CFDA 1VBC1 2GAUA 3I2IA 4XFGA 3VBRB 3ZXKA 3C2UA 4FFIA 2HWE3 1AR81 4Q0VA 1UYZA 2B9VA 2WNUC 2Z42A 3LQCA 4HETA 3RYRA 3VKLA 2LS6A 3ZMNA 1VRH2 4Q4X3 3MPPG 5IFPA 2OS2A 1W6QA 2P4EA 5A6XA 3WUCA 2PHDA 3H3ZA 4OHYA 4P9YA 1MQTC 2VMHA 4XUQA 1VBB3 5CA6A 4Q4W3 3ASIA 4TXWA 3I97A 1MACA 2E7QA 3ZLIA 2G9FA 3BPSA 4D7SA 2WO3A 2D93A 5EXOA 2LUWA 1J3RA 1SCRA 1JZ7A 3T08A 2HWD1 3GZTB 4UFMA 5D8AA 2GU9A 4PF5A 4CSWA 1HJGA 2V72A 2D6MA 3NJYA 4MOAA 4Q4Y3 5F6KA 4ZY9A 5LBBA 1JH5A 1P8JA 3GCXA 1HKDA 5A7PA 1AR61 1OA3A 3HJRA 3J7MA 3TYJA 4XPVA 5EV7A 1NLRA 4LKFA 3DUIA 4OUEA 4QPWA 3RZKA 1QWRA 2ID4A 2YROA 4OI2A 2D43A 2WABA 3PVEA 3HEIA 1GQPA 3KCYA 4FO9A 4FPKA 4CEYA 4JHZA 1IKPA 2I07B 3OBRA 1WKYA 4HK8A 3SC7X 2ZAAA 4E8CA 4PLMA 4CDQB 1YIPA 4NHKA 4YLZA 3O1OA 5F37A 1RXFA 1MS9A 3DECA 3SCHA 2OQ7A 3KD4A 3K4DA 3TNQA 1BLZA 2YG0A 1PGW2 2J42A 2ZBJA 1QXJA 4KMQA 2CTVA 4A7YA 3M3CA 1DYPA 2BV4A 2R1DA 2WZR3 1VRBA 1XNCA 3B94A 3N3HA 2HJIA 4I02A 1PK6B 4ISRA 4QXKA 4WM8B 5CYYA 4CCEA 5FZCA 5ACA3 4FQ4A 3MF6A 4KH9A 2R30A 1OHFA 1ND3C 3LFIA 1ACCA 1HN0A 2YY1A 2ATFA 3RI8A 4AVSA 1POQA 3B02A 1RMU3 2ZEZA 2VE1A 2VQUA 2VOTA 4B29A 3FUOA 1JZ2A 2WUHA 2DWRA 1SEFA 4Q4V1 1SBDA 3AL5A 1J3QA 2BEOA 2BWAA 2W47A 1RJ7A 2ARXA 4N7UA 4N7IA 4PT6A 5FO9B 3AMPA 5LY2A 4AFAA 1RVF3 3P3PA 1JYIA 4LBLA 2Y6HA 3H7JA 3JD72 4EE2A 1L7LA 2IXCA 4QHOA 4JGZB 1W90A 4Y1YA 3H3UA 4B1MA 3MFCA 2JE8A 5DUUA 2BQPA 2XJUA 3ETPA 2EIGA 3USSA 4JKKA 3A21A 3UV9A 2DF7A 4W4ZA 3LPGA 1XB9A 1K5MC 3LGRA 4NJ4A 4CZSA 3GALA 4LBQD 2FDKA 3HMYA 3ECQA 5LK5A 3U07A 4GXLA 1F4AA 4AEKA 2CV6A 3UYJA 4MGZE 4Z8BA 2DV9A 2CWMA 3Q8EA 1QKQA 4LLOA 2QKDA 5FZAA 4CPBA 2O8QA 4HANA 3UKVA 1N3QA 2JG8A 5KHGA 4FAGA 2W1QA 3RRDA 3ZXAC 2NYYA 4XIKA 5JZGA 1LOBA 2P37A 1IS5A 2RV9A 2DVFA 4PIYA 3JBG2 3SITA 3GHMA 4LITA 3BCWA 5IJRA 1J1TA 2QQPA 4DXZA 1Q8SA 3NNJA 5AFBA 2BU9A 1JI6A 5A1AA 4Q4X1 2MEV3 1I1EA 2PTMA 2BOIA 5JSOA 1T2XA 5C3SA 4XQ4A 3UKNA 2BYVE 1Q5OA 4JGZA 1OOPA 3ZKUA 2NPIA 1ASJ1 1V6KA 3FLPA 1RB8G 1CR7A 2JDUA 3OBTA 3HQUA 5F5QA 3MZHA 1SLIA 1OURA 1QJX3 1MEC2 1RUF1 1UIJA 3FFZA 4AEMA 2VBDA 5GZCA 1WLTA 2Q8CA 4OHXA 4H7MA 1RTVA 5F3GA 5FZGA 2BNOA 2FDHA 5FZOB 1Y9QA 4CXXA 4HVQA 2J1EA 3QH6A
chains in the Genus database with same CATH topology
4RYDA 3WF0A 2KD7A 3IAQA 2VCCA 2QQIA 4XUOA 1H6XA 5EJ1B 3WNKA 4A41A 1GOFA 1NKGA 3CMGA 3HOBA 3CZJA 1GNYA 3WNOA 4RN5A 1ULPA 2JD9A 1JZ6A 2VZPA 2Z4FA 3LE0A 4XUTA 2YC2A 3I3EA 2EIBA 2RVAA 5JXIA 2W1UA 5JR2A 1GOGA 2WO1A 3OBAA 3NJXA 4Z2AA 1US3A 1L7RA 1JZ8A 1XNAA 3CIHA 5B4NA 3HN3A 4AAXA 1UX7A 4ARXA 5I0DA 2Y64A 2C9KA 2ORXA 4CU6A 1J83A 2C4XA 4ZZ5A 1W9WA 1NAEA 1OD3A 4IUGA 1J84A 3A22A 1GOHA 5LA2A 4L0PA 1CZSA 1MPXA 1UXXX 2W46A 1NUKA 2CDOA 3BGAA 1W8OA 4KWUA 4UI9L 3LEGA 3OGVA 3VD7A 3LEKA 1YQ2A 3UESA 2CDPA 2VZOA 3THDA 2VZUA 2J1RA 4LHSA 3C7FA 5C71A 1F4HA 2J1VA 2XQXA 2W3JA 1W9TA 2J1UA 2RJ2A 2VZTA 3D3AA 2DCKA 2WAAA 4QX3A 1KEXA 2QQLA 5CZKA 4P02B 4ZZ8A 1UWWA 4DUWA 3VD5A 4QDSA 1OF4A 5EJZB 4MGQA 4LQRA 2XHNA 1PX3A 2PQSA 2J22A 2JKXA 1W9SA 1JZ4A 1XPWA 3WF3A 1OT5A 3CZUA 1EUTA 2W1WA 1RYYA 4ET7A 4XZUG 2VZ3A 3VDBA 4ZXEA 3AC0A 2QQNA 3GM8A 4BJ0A 1UXZA 2WDBA 2B4KA 1GMMA 4BK4A 2VTFA 3WNLA 2VZQA 2L9LA 4DUVA 5DPNA 2OKXA 1I5PA 4QDQA 3C7GA 3VD4A 3F2ZA 5JXHA 5C70A 3BN6A 4CU9A 4P5YA 4GWJA 3IIIA 2V4VA 3T0BA 5C7GA 3ACIA 2WYSA 3OG2A 3IB3A 1JZ5A 1OH4A 2LW8A 2DDUA 2BGPA 1NX9A 3P6BA 5FUIA 3I2KA 2QQOA 4A3ZA 1US2A 4MGSA 1K45A 5JMOA 3WF4A 2VMCA 5J1XA 2W1SA 4GWIA 1CIYA 4AG4A 4LPLA 2VZRA 2QQJA 3WQBA 2Y6GA 4BK5A 2J7MA 3ACHA 3HNYM 3HNMA 3PUIA 2W87A 2VZVA 1UZ0A 3W5NA 3LPFA 3WSOA 3GXUA 2EICA 5G05L 3T2OA 2WO2A 3T2PA 2EIDA 2ORZA 3MV11 4BDVB 4QB1A 2BGOA 2VCAA 3K46A 3I2GA 3C7OA 4GZ9A 3T2QA 1UY2A 3C7EA 1UY1A 3WNMA 3DYMA 2X09A 1UYXA 2E32A 5IHRA 3MO4A 4UAPA 3FL7A 2WN2A 1W8NA 2J1TA 3I3DA 1CZTA 2W94A 3I3BA 2Y6LA 1PMJX 5DQ0A 3U37A 4ARYA 3HPNA 1GU3A 1UY4A 4OMDA 3MBWA 4DXRA 4TTGA 2QQMA 2WZ8A 4OMCA 1PMHX 3T0DA 2VL4A 2V5DA 3P1IA 2ZEYA 3IDAA 3LEIA 2VMEA 1DP0A 3VD3A 2VO5A 2W92A 1W99A 3ZM8A 1O59A 1DYOA 3NJVA 1DLCA 2C26A 4XUPA 5B4XA 3EYPA 4YPJA 1GUIA 4XVHA 1HN1A 4UOJA 4DEVA 3ACFA 1IQDC 1O8SA 3HNBM 1SDDB 5JUVA 5F7UA 4CU7A 4LKSA 4CU8A 2R7EB 1XC6A 3T0AA 2E33A 4PQQA 1WCQA 2BERA 3VDCA 2VZSA 3CDZB 3WNPA 2J1SA 3UNPA 3JXSA 3VDAA 2ZEXA 4DXSA 3THCA 1PX4A 5LA1A 4XUNA 4HG6B 3WF2A 2X10A 2WZEA 1K42A 3IAPA 4CUBA 4A44A 4P00B 4DXTA 1UMIA 1UY3A 2E26A 2Y6JA 1UY0A 4MADA 2J1AA 2EIEA 2YFUA 3W5MA 3ABZA 1JYNA 2YC4A 1CZVA 1UYYA 4D0QA 4PF1A 1H6YA 1JU3A 1KGYA 2Y8KA 3C7HA 3DYOA 2VC9A 3OEBA 3OGSA 2W9XA 2QQKA 5LCWL 4QX0A 2VCBA 3C8XA 5JXGA 2WBKA 3EB7A 2W5FA 1R64A 3NRUA 1XNTA 3K4ZA 1L7QA 4OZOA 3GDBA 4DUXA 3I2IA 2QBXA 3FHQA 1CX1A 1UYZA 1K12A 2B9VA 3LQCA 3OEAA 2LS6A 1EUUA 1JU4A 5IYYA 1JZ3A 3I2HA 5IFPA 4KI5M 3K75B 2JDAA 3NNGA 3WF1A 4QX2A 4FI9A 4XUQA 4QX1A 4CUCA 4TXWA 3I97A 2X05A 3DYPA 2WO3A 3SEEA 4A4AA 1JZ7A 3T08A 4MO3M 2V72A 3MUZ1 4MOAA 4ZY9A 1P8JA 5HPOA 3GGLA 3HJRA 3K4AA 1TVGA 2HLEA 3T09A 4OUEA 4QPWA 4D8MA 5EIYB 2ID4A 1K3IA 3K77A 2WABA 4CVUA 3HEIA 1GQPA 3VD9A 4JHZA 1WKYA 4E8CA 3SKJE 4JKMA 2XOMA 2VR4A 3SKVA 4W8JA 1ULOA 3DECA 3OB8A 4A42A 2VMFA 3CQOA 3J7HA 3K4DA 4W50A 3FHAA 2YG0A 2VZ1A 4KMQA 3PUHA 3A7QA 3I2FA 1SHWB 3OGRA 5CYYA 2WQ8A 4P08A 5JXJA 4M4RA 5HXMA 4DEQA 3CKHA 4M4PA 2XONA 2ZEZA 2VQUA 2VOTA 2DCJA 1UMHA 1JZ2A 2WUHA 4E8DA 1TG7A 2BZDA 2W47A 4PT6A 4XURA 3WEZA 5IFTA 1LNSA 2Y6HA 1O8PA 1OF3A 2JE8A 3MUY1 3ETPA 5LA0A 4QAWA 4JKKA 3A21A 4QDRA 2WAOA 1BHGA 4W4ZA 3LPGA 1JYVA 5DN2A 2VQTA 3ECQA 4BXSV 2YB7A 3MV01 1F4AA 3A23A 4OYUA 3WNNA 3SEPA 1JHJA 4JX0A 2W1QA 2VJXA 2W95A 3E1F1 1W0NA 4QB2A 2VMDA 2RV9A 2ZEWA 5IJRA 2E31A 3NQHA 2YFZA 4CUAA 2ZXQA 1JI6A 5A1AA 3FN9A 4A6OA 4QB6A 4A45A 1JYWA 2VM9A 1T2XA 1JYXA 2Y6KA 5DMYA 5G04L 1D7PM 4JKLA 3I2JA 2BBAA 1SG3A 2WN3A 3ACGA 3UETA 2W91A 2J1EA 2HYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RYD A;  3WF0 A;  2KD7 A;  3IAQ A;  2VCC A;  2QQI A;  4XUO A;  1H6X A;  5EJ1 B;  3WNK A;  4A41 A;  1GOF A;  1NKG A;  3CMG A;  3HOB A;  3CZJ A;  1GNY A;  3WNO A;  4RN5 A;  1ULP A;  2JD9 A;  1JZ6 A;  2VZP A;  2Z4F A;  3LE0 A;  4XUT A;  2YC2 A;  3I3E A;  2EIB A;  2RVA A;  5JXI A;  2W1U A;  5JR2 A;  1GOG A;  2WO1 A;  3OBA A;  3NJX A;  4Z2A A;  1US3 A;  1L7R A;  1JZ8 A;  1XNA A;  3CIH A;  5B4N A;  3HN3 A;  4AAX A;  1UX7 A;  4ARX A;  5I0D A;  2Y64 A;  2C9K A;  2ORX A;  4CU6 A;  1J83 A;  2C4X A;  4ZZ5 A;  1W9W A;  1NAE A;  1OD3 A;  4IUG A;  1J84 A;  3A22 A;  1GOH A;  5LA2 A;  4L0P A;  1CZS A;  1MPX A;  1UXX X;  2W46 A;  1NUK A;  2CDO A;  3BGA A;  1W8O A;  4KWU A;  4UI9 L;  3LEG A;  3OGV A;  3VD7 A;  3LEK A;  1YQ2 A;  3UES A;  2CDP A;  2VZO A;  3THD A;  2VZU A;  2J1R A;  4LHS A;  3C7F A;  5C71 A;  1F4H A;  2J1V A;  2XQX A;  2W3J A;  1W9T A;  2J1U A;  2RJ2 A;  2VZT A;  3D3A A;  2DCK A;  2WAA A;  4QX3 A;  1KEX A;  2QQL A;  5CZK A;  4P02 B;  4ZZ8 A;  1UWW A;  4DUW A;  3VD5 A;  4QDS A;  1OF4 A;  5EJZ B;  4MGQ A;  4LQR A;  2XHN A;  1PX3 A;  2PQS A;  2J22 A;  2JKX A;  1W9S A;  1JZ4 A;  1XPW A;  3WF3 A;  1OT5 A;  3CZU A;  1EUT A;  2W1W A;  1RYY A;  4ET7 A;  4XZU G;  2VZ3 A;  3VDB A;  4ZXE A;  3AC0 A;  2QQN A;  3GM8 A;  4BJ0 A;  1UXZ A;  2WDB A;  2B4K A;  1GMM A;  4BK4 A;  2VTF A;  3WNL A;  2VZQ A;  2L9L A;  4DUV A;  5DPN A;  2OKX A;  1I5P A;  4QDQ A;  3C7G A;  3VD4 A;  3F2Z A;  5JXH A;  5C70 A;  3BN6 A;  4CU9 A;  4P5Y A;  4GWJ A;  3III A;  2V4V A;  3T0B A;  5C7G A;  3ACI A;  2WYS A;  3OG2 A;  3IB3 A;  1JZ5 A;  1OH4 A;  2LW8 A;  2DDU A;  2BGP A;  1NX9 A;  3P6B A;  5FUI A;  3I2K A;  2QQO A;  4A3Z A;  1US2 A;  4MGS A;  1K45 A;  5JMO A;  3WF4 A;  2VMC A;  5J1X A;  2W1S A;  4GWI A;  1CIY A;  4AG4 A;  4LPL A;  2VZR A;  2QQJ A;  3WQB A;  2Y6G A;  4BK5 A;  2J7M A;  3ACH A;  3HNY M;  3HNM A;  3PUI A;  2W87 A;  2VZV A;  1UZ0 A;  3W5N A;  3LPF A;  3WSO A;  3GXU A;  2EIC A;  5G05 L;  3T2O A;  2WO2 A;  3T2P A;  2EID A;  2ORZ A;  3MV1 1;  4BDV B;  4QB1 A;  2BGO A;  2VCA A;  3K46 A;  3I2G A;  3C7O A;  4GZ9 A;  3T2Q A;  1UY2 A;  3C7E A;  1UY1 A;  3WNM A;  3DYM A;  2X09 A;  1UYX A;  2E32 A;  5IHR A;  3MO4 A;  4UAP A;  3FL7 A;  2WN2 A;  1W8N A;  2J1T A;  3I3D A;  1CZT A;  2W94 A;  3I3B A;  2Y6L A;  1PMJ X;  5DQ0 A;  3U37 A;  4ARY A;  3HPN A;  1GU3 A;  1UY4 A;  4OMD A;  3MBW A;  4DXR A;  4TTG A;  2QQM A;  2WZ8 A;  4OMC A;  1PMH X;  3T0D A;  2VL4 A;  2V5D A;  3P1I A;  2ZEY A;  3IDA A;  3LEI A;  2VME A;  1DP0 A;  3VD3 A;  2VO5 A;  2W92 A;  1W99 A;  3ZM8 A;  1O59 A;  1DYO A;  3NJV A;  1DLC A;  2C26 A;  4XUP A;  5B4X A;  3EYP A;  4YPJ A;  1GUI A;  4XVH A;  1HN1 A;  4UOJ A;  4DEV A;  3ACF A;  1IQD C;  1O8S A;  3HNB M;  1SDD B;  5JUV A;  5F7U A;  4CU7 A;  4LKS A;  4CU8 A;  2R7E B;  1XC6 A;  3T0A A;  2E33 A;  4PQQ A;  1WCQ A;  2BER A;  3VDC A;  2VZS A;  3CDZ B;  3WNP A;  2J1S A;  3UNP A;  3JXS A;  3VDA A;  2ZEX A;  4DXS A;  3THC A;  1PX4 A;  5LA1 A;  4XUN A;  4HG6 B;  3WF2 A;  2X10 A;  2WZE A;  1K42 A;  3IAP A;  4CUB A;  4A44 A;  4P00 B;  4DXT A;  1UMI A;  1UY3 A;  2E26 A;  2Y6J A;  1UY0 A;  4MAD A;  2J1A A;  2EIE A;  2YFU A;  3W5M A;  3ABZ A;  1JYN A;  2YC4 A;  1CZV A;  1UYY A;  4D0Q A;  4PF1 A;  1H6Y A;  1JU3 A;  1KGY A;  2Y8K A;  3C7H A;  3DYO A;  2VC9 A;  3OEB A;  3OGS A;  2W9X A;  2QQK A;  5LCW L;  4QX0 A;  2VCB A;  3C8X A;  5JXG A;  2WBK A;  3EB7 A;  2W5F A;  1R64 A;  3NRU A;  1XNT A;  3K4Z A;  1L7Q A;  4OZO A;  3GDB A;  4DUX A;  3I2I A;  2QBX A;  3FHQ A;  1CX1 A;  1UYZ A;  1K12 A;  2B9V A;  3LQC A;  3OEA A;  2LS6 A;  1EUU A;  1JU4 A;  5IYY A;  1JZ3 A;  3I2H A;  5IFP A;  4KI5 M;  3K75 B;  2JDA A;  3NNG A;  3WF1 A;  4QX2 A;  4FI9 A;  4XUQ A;  4QX1 A;  4CUC A;  4TXW A;  3I97 A;  2X05 A;  3DYP A;  2WO3 A;  3SEE A;  4A4A A;  1JZ7 A;  3T08 A;  4MO3 M;  2V72 A;  3MUZ 1;  4MOA A;  4ZY9 A;  1P8J A;  5HPO A;  3GGL A;  3HJR A;  3K4A A;  1TVG A;  2HLE A;  3T09 A;  4OUE A;  4QPW A;  4D8M A;  5EIY B;  2ID4 A;  1K3I A;  3K77 A;  2WAB A;  4CVU A;  3HEI A;  1GQP A;  3VD9 A;  4JHZ A;  1WKY A;  4E8C A;  3SKJ E;  4JKM A;  2XOM A;  2VR4 A;  3SKV A;  4W8J A;  1ULO A;  3DEC A;  3OB8 A;  4A42 A;  2VMF A;  3CQO A;  3J7H A;  3K4D A;  4W50 A;  3FHA A;  2YG0 A;  2VZ1 A;  4KMQ A;  3PUH A;  3A7Q A;  3I2F A;  1SHW B;  3OGR A;  5CYY A;  2WQ8 A;  4P08 A;  5JXJ A;  4M4R A;  5HXM A;  4DEQ A;  3CKH A;  4M4P A;  2XON A;  2ZEZ A;  2VQU A;  2VOT A;  2DCJ A;  1UMH A;  1JZ2 A;  2WUH A;  4E8D A;  1TG7 A;  2BZD A;  2W47 A;  4PT6 A;  4XUR A;  3WEZ A;  5IFT A;  1LNS A;  2Y6H A;  1O8P A;  1OF3 A;  2JE8 A;  3MUY 1;  3ETP A;  5LA0 A;  4QAW A;  4JKK A;  3A21 A;  4QDR A;  2WAO A;  1BHG A;  4W4Z A;  3LPG A;  1JYV A;  5DN2 A;  2VQT A;  3ECQ A;  4BXS V;  2YB7 A;  3MV0 1;  1F4A A;  3A23 A;  4OYU A;  3WNN A;  3SEP A;  1JHJ A;  4JX0 A;  2W1Q A;  2VJX A;  2W95 A;  3E1F 1;  1W0N A;  4QB2 A;  2VMD A;  2RV9 A;  2ZEW A;  5IJR A;  2E31 A;  3NQH A;  2YFZ A;  4CUA A;  2ZXQ A;  1JI6 A;  5A1A A;  3FN9 A;  4A6O A;  4QB6 A;  4A45 A;  1JYW A;  2VM9 A;  1T2X A;  1JYX A;  2Y6K A;  5DMY A;  5G04 L;  1D7P M;  4JKL A;  3I2J A;  2BBA A;  1SG3 A;  2WN3 A;  3ACG A;  3UET A;  2W91 A;  2J1E A;  2HYX A; 
#chains in the Genus database with same CATH topology
 2VMG A;  3ON7 A;  2ZX0 A;  3VBH A;  2ZS6 B;  3PTY A;  3Q8F A;  2UU8 A;  2VQA A;  4UFJ A;  4B4Q A;  3IAQ A;  2VCC A;  5A80 A;  4L97 A;  4XUO A;  3VZJ A;  1H6X A;  2E7T A;  1QU0 A;  1VAV A;  3WNK A;  1OPO A;  1R08 3;  1NKG A;  3AVS A;  3VDD B;  4ATE A;  1AYN 1;  4CRQ A;  3CJI B;  3CZJ A;  4V2V A;  5BYN A;  3T2T A;  4CCC A;  4N8M A;  4IET A;  1G9F A;  2B42 B;  2JD9 A;  5GLU A;  2PAM A;  4ES8 A;  2BUK A;  1QH7 A;  5JIU A;  4OFG A;  4X8N A;  4CDU A;  1YHF A;  1MEC 1;  1RUF 2;  2ZGK A;  5GAL A;  5JOY A;  2YC2 A;  1MR5 A;  2SBA A;  5CG8 A;  1RIR A;  1XND A;  3O12 A;  4MX3 A;  4AED C;  4CDU B;  3WXP A;  2RVA A;  3D4K A;  4IGQ A;  4XBL A;  5SV8 A;  1H2K A;  4I0B A;  3ZXG A;  3M4F A;  2YBK A;  4I3P A;  4BYY A;  4C0H A;  2QZ2 A;  2WZR 2;  2HWC 2;  5CBL A;  3PVO A;  4Z2A A;  1US3 A;  4QKF A;  3TEX A;  4BXF A;  1L7R A;  1NA1 C;  1JZ8 A;  3LEM A;  5B4N A;  3APB A;  1HIX A;  2KR2 A;  4E4S A;  1IHM A;  4HPK A;  4YFW A;  2A71 A;  3W59 A;  2C9K A;  3WHT A;  1UOJ A;  2ORX A;  4CU6 A;  1I5Z A;  5IT6 A;  4ZZ5 A;  5KHH A;  3ZO0 B;  4M00 A;  1UKR A;  4RGG A;  2ZA9 A;  5HCA A;  2VNV A;  3POW A;  4IUG A;  1DGR A;  1W8T A;  3RI9 A;  1VBD 1;  3WLU A;  5K4L A;  4AFM A;  4WBB A;  1MPX A;  2WZR 1;  3UJO A;  1IOA A;  3JD7 3;  4Y5Z 0;  1UU6 A;  3BGA A;  1W8O A;  4KWU A;  3VD7 A;  3LEG A;  2HWE 1;  3OGV A;  2WNU B;  3LA2 A;  4AHX A;  1O7F A;  1ST8 A;  3BYW A;  2VZO A;  1S0J A;  4FAH A;  1RUI 2;  5LW9 A;  2BNM A;  3THD A;  2A3X A;  3UKT A;  5AC9 3;  2VZU A;  5FYS A;  2J1R A;  3WHU A;  4ZU4 A;  3RYK A;  4XIO A;  5J37 A;  3AP5 A;  1W2U A;  1W0O A;  3CNA A;  4IV1 A;  4S2G A;  3MIH A;  3NAP A;  1HXS 2;  1PVC 2;  2G9G A;  1GSL A;  5F2W A;  3PMS A;  1CGP A;  4FOQ A;  3ZSJ A;  4QX3 A;  1O3Q A;  4YM2 A;  2HWC 3;  2XG3 A;  5CZK A;  4PQ9 A;  4RGA A;  4X6Q B;  3RQ0 A;  2IVJ A;  2PEL A;  5CAD A;  5FP8 A;  2RS3 3;  4KG8 A;  1BBT 1;  2ARE A;  4NO4 A;  2E7A A;  5LRR A;  1S0B A;  3N7L A;  1UKG A;  4Q2F A;  3RNS A;  1V00 A;  2E63 A;  4LHK A;  1K5M B;  1XPW A;  2NM1 A;  2BTV C;  4LK7 A;  3WF3 A;  3H0O A;  1CPN A;  4Y4Y A;  5IAV A;  3H50 A;  2DVD A;  1RMU 2;  3N4M A;  1WA4 A;  3WDX A;  3X29 B;  5EP9 A;  1UXZ A;  2B4K A;  2A75 A;  2EAA A;  3OYW A;  3WNL A;  2L9L A;  3VZN A;  1HX6 A;  1GNZ A;  1W6O A;  5BNN B;  1DZR A;  3KVA A;  1I5P A;  4TWT A;  4ERO A;  5K0U C;  5J7M A;  3OPT A;  2B45 X;  5C70 A;  1ALY A;  2JKB A;  2QTW B;  2AEY A;  2AYH A;  3O5S A;  4CCO A;  4KG0 A;  2Q4S A;  2QFE A;  1AUY A;  1APN A;  3N9P A;  3III A;  2EXJ A;  2VOW A;  3E5Q A;  4MZU A;  4WVM A;  3JU9 A;  5C7G A;  1D2Q A;  5BNN C;  1VBE 2;  2WNV A;  4QQH A;  3N7J A;  4CP9 B;  3AZX A;  2MNG A;  4WM7 A;  4X6R B;  2D97 A;  5DZE A;  3PNA A;  3ST7 A;  4AWD A;  1NX9 A;  1YRZ A;  4MET A;  5FY9 A;  3NO8 A;  3PIJ A;  4FVV A;  1Z0H A;  4Y3O A;  3ZFE C;  1EPZ A;  5GKA C;  1KFX L;  4CDX C;  2ZGS A;  1QNW A;  4NVP A;  1E5I A;  2JG9 B;  1R08 1;  5CFC C;  1HQW A;  4LE3 A;  1SLC A;  2GNT A;  4O9E A;  3DEM A;  3O14 A;  3PJY A;  2GZW A;  1UL9 A;  3PTR B;  4IQP A;  2RM2 1;  2AUY A;  4JTO A;  1PIV 2;  1LEN A;  5C9A B;  2CNA A;  3KM5 A;  1Q8P A;  4QX5 A;  1VRH 1;  5J1X A;  3ZN4 A;  4AG4 A;  1BJQ A;  4H2A A;  2QQJ A;  4D69 A;  5DZF A;  4FBF A;  1OKO A;  4Z82 A;  4BK5 A;  1LOF C;  3ACH A;  2W87 A;  5I8S A;  1UZ0 A;  4LNV A;  4E4D X;  3OUH A;  2EAK A;  1WLW A;  3RZM A;  1SPP B;  3AKP A;  3VUO A;  2A1X A;  2F4L A;  2PHL A;  4R9A A;  3ZPY A;  4NRO A;  5G05 L;  5CU1 A;  5HV0 A;  4LIV A;  5JOW A;  1HW5 A;  1W2A X;  4OI4 A;  3T2P A;  3BKZ A;  2QVS B;  1RUH 2;  1UPI A;  1ZZC A;  1VBA 3;  3TOJ A;  4XEZ A;  4MXW B;  1NXM A;  2BWC A;  5FRE A;  1IPS A;  5CAZ A;  1LR5 A;  4IEW A;  2BGO A;  2VCA A;  4XJ8 A;  2LAL A;  3B00 A;  4RR3 C;  3ZFG A;  3T2Q A;  3HAG A;  2JJ6 A;  1N1Y A;  1GP6 A;  4GH4 B;  3U1X A;  5CFC A;  2O8O A;  3WNM A;  5A6Z A;  1FI2 A;  3J9S A;  2GC1 A;  2QZ3 A;  2R6Q A;  3DYM A;  1BBT 2;  2X5I A;  4LMF A;  4NHY A;  3NMB A;  2HYK A;  2IXJ A;  2P3Y A;  3KV5 A;  1R09 3;  3KT4 A;  1JTZ X;  2E32 A;  4Y1X A;  5EYX A;  2WWS A;  1ZBE 1;  3QCW A;  5IHR A;  4S2D A;  4YGC A;  3MF9 A;  1D4V B;  1RGS A;  2XWB B;  4UAP A;  1C3H A;  2DFC A;  1RUJ 1;  5FFO C;  4WZC A;  5BNP C;  3KCC A;  1FX5 A;  1IQA A;  1JOJ A;  5ABJ B;  4P9G A;  5C8C C;  4FXK B;  4NPR A;  4XTM A;  3ZDS A;  5A6Y A;  2ADD A;  2VUD A;  1OPM A;  3RWK X;  5FMO S;  2EAL A;  3I3D A;  2JB8 A;  1QH6 A;  1CZT A;  4XJZ A;  5EHD A;  5GZD A;  1HRI 3;  1POV 1;  2E53 A;  2IZW A;  2Y6L A;  5HCB A;  4AGG A;  4XTP A;  4RS5 A;  2HWD 3;  1WW6 A;  5F3C A;  2OII A;  1DQ0 A;  5FAX A;  1D4M 3;  4FPY A;  2UYB A;  4PLN A;  1G7Y A;  4PI2 A;  4QGN A;  3MBW A;  3VBF B;  3SXW A;  4TTG A;  5A3M A;  1ENQ A;  2WZ8 A;  4GAL A;  1YUD A;  2GP5 A;  5FZ6 A;  1VAM A;  1HRV 1;  4Q8K A;  3MHZ A;  4HON A;  4KQ7 A;  2RDN A;  3RWN A;  3DKQ A;  1AVB A;  3VKN A;  2CHH A;  3TN9 1;  4LBO A;  1DP0 A;  4XBN A;  4BIS A;  2ILM A;  4YVS B;  3JQW A;  4QPG B;  4B3N A;  1W99 A;  4NAM A;  3VLB B;  3DPR B;  4LA3 A;  3HT1 A;  1WCD J;  1WW7 A;  4N53 C;  4R52 A;  1GZW B;  1VB2 A;  2EA7 A;  1UZV A;  4O7X A;  4XF1 A;  2ET1 A;  4UBH A;  1YQ5 A;  3FZ3 A;  2WIN B;  3RPQ A;  4NHX A;  3MW2 A;  1OI6 A;  1SDD B;  1NQD A;  4NIA A;  1M4W A;  1Z7S 1;  2DUP A;  4LKS A;  4CU7 A;  4HT1 T;  4M01 A;  2GC0 A;  3T0A A;  1W6Q B;  2E33 A;  4PQQ A;  1WCQ A;  4N9I A;  2ET7 A;  5A1L A;  2X53 S;  2BER A;  3POB A;  3RZZ A;  3TEY A;  5LRS A;  4XYX A;  1Z7S 2;  1E57 A;  2RS1 2;  3PJQ A;  5FXW A;  1YLL A;  5LBC A;  3U14 A;  3WP5 A;  5K0U A;  4DMI A;  1ZZ7 A;  5KHJ A;  3NV3 A;  2GME A;  2OT7 A;  4QXH A;  2ZEX A;  1G86 A;  1DGL A;  3K51 A;  2XJV A;  2FMD A;  1W6N B;  1AXY A;  5FK8 A;  3S5A A;  1A8M A;  1DDL A;  2I45 A;  5DAB A;  1W6N A;  2WZE A;  4WM7 C;  4CUB A;  2JG8 B;  1F5J A;  2ARA A;  4DOU A;  5FYH A;  1UMI A;  1TE1 B;  1UY3 A;  5FO7 B;  3VBS C;  3W5M A;  3ABZ A;  2A6W A;  2RHP A;  4FFF A;  5APA A;  2XJT A;  5BV6 A;  1VBE 3;  2R04 3;  1U0A A;  3MIC A;  2ZZJ A;  5C3O A;  3TWI A;  1JU3 A;  4ZKT B;  3ILF A;  4D7T A;  1COV 2;  2W9X A;  4QPI C;  4YW4 A;  3WDV A;  1V9U 1;  2CY6 A;  2IXL A;  2PHW A;  4QX0 A;  2OA2 A;  5AC9 2;  3T4H B;  4AVB A;  2WBK A;  1X9P A;  4BZ4 A;  1R1A 3;  3I4I A;  5IVC A;  3SH3 A;  1S2K A;  3AKT A;  2RM2 3;  1YFW A;  5A70 A;  1ULF A;  3VBO A;  5A32 B;  4FP3 A;  3U78 A;  2JE9 A;  5FMO L;  1XU2 A;  4LLF A;  5BPX A;  4ZS3 A;  2VVE A;  4OZO A;  3BB6 A;  5A1F A;  2Y38 A;  3FHQ A;  1COV 1;  1SLT A;  1BK0 A;  1EAH 1;  1JHN A;  4LBQ A;  5CVR A;  2OZJ A;  1JZ3 A;  4CDX B;  3FLT A;  3K75 B;  3WNX A;  2JDA A;  4R4X A;  1FMD 2;  4JAA A;  4TN7 A;  5BXX A;  4CDW C;  2LTN A;  2AGS A;  4IV3 C;  5FYU A;  4YGD A;  3WF1 A;  4XFA A;  4QX1 A;  5E1R A;  4CUC A;  3HT2 A;  4GB3 3;  2P34 A;  1QQP 2;  1D0H A;  1HJF A;  4GQ7 A;  5C33 A;  1B35 A;  1X33 A;  3T1L A;  5CB7 A;  2ZGL A;  4UW6 A;  3SEE A;  3ZN5 A;  1RUN A;  4ORF A;  4A4A A;  2C9A A;  2ZGO A;  5FZM A;  4N43 A;  3KV6 A;  1JYC A;  3NV4 A;  4YYO A;  5KXC A;  2ZAB A;  4BB3 A;  2ZAC A;  1PHM A;  3RZL A;  4AED A;  3VBO B;  1WME A;  4I2O A;  1TVG A;  4JHT A;  2VTX J;  2W52 A;  3AYC A;  5IUQ A;  1QF3 A;  1FNZ A;  3ZFF A;  4TSV A;  1K3I A;  1N1T A;  4CEY B;  3LOB A;  2RR1 2;  3OD4 A;  5H9R A;  3ZX7 A;  3MIB A;  4O61 A;  1ENX A;  2PLV 2;  4MHU A;  5FZ4 A;  4A7Z A;  1VPH A;  1OQE A;  4EN6 B;  5K7P A;  4JQR A;  3AKQ A;  2RR1 1;  3VGI A;  1A6C A;  1QY4 A;  1HQL A;  3ZPO A;  2VMF A;  3J7H A;  4L9B A;  3OUJ A;  4QQL A;  2ARC A;  2VZ1 A;  3HBK A;  4GUL A;  4NRQ A;  4XJA A;  3R6S A;  1RUD 2;  2D6K A;  4IV3 A;  1Z7S 3;  2OPW A;  4XDP A;  2YZ4 A;  3TRS B;  5K0U B;  3U0Z A;  1UU5 A;  3A7Q A;  4M3C B;  4XW3 A;  3I2F A;  1H1A A;  1SHW B;  3H8U A;  2GH8 A;  1H8V A;  3OGR A;  5JXJ A;  1ND3 A;  3F95 A;  5CIR A;  3H1Y A;  1ZA4 A;  5I0T A;  5F9T A;  5HXM A;  4DEQ A;  1RUG 1;  5C5T A;  1KDM A;  5BNQ A;  4KBB A;  1XBF A;  3AYE A;  1QQP 1;  3Q8C A;  4K7J A;  4M4P A;  3W58 A;  3NW4 A;  1VAL A;  1UMH A;  4Q1P A;  3CJI C;  3NV1 A;  4EZH A;  2XJQ A;  4PLO A;  3R05 A;  5KXD A;  2AZ5 A;  5LWB A;  1TG7 A;  2IXI A;  2TNF A;  5KHI A;  5IFT A;  1BYH A;  1Y4W A;  1AF9 A;  2WQZ C;  2JEM A;  1AR8 2;  1O8P A;  4IL7 A;  5FRA A;  3BUC A;  1A34 A;  1OF3 A;  3MUY 1;  1Y9G A;  3B5L B;  1K5M A;  1EV1 1;  1H0B A;  3GJA A;  4BHP A;  4EN9 B;  1OFS A;  2XWJ B;  3PU8 A;  1JYV A;  5GZE A;  5IAT A;  4SBV A;  1ND3 B;  2CGO A;  3WD5 A;  1NCR C;  2CAU A;  1H9P A;  4HK9 A;  2VBP A;  2WWJ A;  4QU1 A;  2WR9 A;  5FBJ A;  4CP0 A;  4QXC A;  1QJE A;  1UOB A;  5FYM A;  4GB3 1;  1BBT 3;  4TLF A;  1OVP A;  5FUN A;  1JOD A;  4H55 A;  2YU2 A;  3JB4 C;  1QXP A;  1PK6 A;  1NA1 B;  4IEP A;  4ZU5 A;  3SEP A;  1V9U 2;  3WY6 A;  1JHJ A;  5KWR A;  3I59 B;  1KQR A;  1PZ8 A;  2W95 A;  3V65 A;  3E1F 1;  1O3S A;  4F3J A;  2ADE A;  2HWF 3;  2XL7 A;  1QJF A;  4FXG B;  4K3U A;  4UFH A;  4QB2 A;  1V6L A;  3BVC A;  2DU0 A;  3MFA A;  1PO1 3;  1LEC A;  1XSQ A;  2YFZ A;  3BOW A;  4LBQ B;  4CUA A;  4YGB A;  4Y5S A;  3LB9 A;  3AMM A;  3FN9 A;  3SLI A;  4A6O A;  1OC1 A;  1NZC A;  3KGL A;  4GD4 A;  1W3X A;  1YI9 A;  2GP3 A;  3O1U A;  1XXN A;  2Y6K A;  1MS1 A;  4I01 A;  1AX1 A;  4XFC A;  5ERL A;  3KF3 A;  3SH4 A;  1D7P M;  2YU1 A;  1CAU A;  4AGV A;  4JKL A;  2XLF A;  1SBF A;  4HN0 A;  3I49 A;  4Q29 A;  1MZ6 A;  4KNC A;  1HRV 3;  3MW3 A;  5KR7 A;  3IDC B;  2W91 A;  3ILR A;  3LZZ A;  4FOY A;  1GAN A;  4RYD A;  3WF0 A;  1HDK A;  4DY5 A;  4NOT A;  4GAZ A;  1LOG A;  1GWM A;  1IPK A;  4AED B;  2GC3 A;  3RFR A;  2RDQ A;  5CKQ A;  5I8Y A;  3WDY A;  5FY5 A;  5T5P A;  4D6R A;  2VD7 A;  4DIN B;  4B7E A;  1UF2 C;  3SHR A;  1AXK A;  2EXH A;  5FP4 A;  1GOF A;  4A41 A;  2A6Y A;  2RS5 1;  2YMZ A;  2DCY A;  2EXI A;  4HSL A;  3K3O A;  5CKM A;  4CYD A;  3ZR6 A;  3HD8 B;  4HPK B;  1W2N A;  3HOB A;  1W9F A;  3L2Y A;  1ZRD A;  1OUS A;  1GNY A;  1GFF 2;  1TQ5 A;  3NV2 A;  3R4S A;  3WNO A;  1MS4 A;  3M3O A;  1X8M A;  1W8U A;  2MHF A;  2VW1 A;  3TAY A;  1WBL A;  4YM0 A;  4CCN A;  3S7E A;  5A3N A;  1WLD A;  1RUI 3;  1CPM A;  3AZV A;  3LIG A;  4CDW A;  5C6C A;  1Q8Q A;  5KBF A;  5J96 B;  2D6N A;  3I3E A;  4K20 A;  2EIB A;  4JGY C;  5CIS A;  1HXS 3;  1PVC 3;  1GOG A;  2FCU A;  2W1U A;  2ZTN A;  5BNN A;  2WNU A;  2XH6 A;  3NNF A;  1RHI 2;  1JXN A;  1VP6 A;  2YDE A;  2X29 A;  3E6B A;  4L99 A;  4ASL A;  3A0K A;  5DAV A;  5JWP A;  1RUD 1;  4DIQ A;  3FX3 A;  1LOC A;  1D0G A;  1XNA A;  1GP5 A;  2RS3 2;  5M0T A;  4YZ3 A;  1MS0 A;  1UX7 A;  1RUC 3;  4IEU A;  5FIX A;  3V64 A;  4QHZ A;  5FYT A;  2B9U A;  1OOP C;  3KVB A;  4IGO A;  3JZV A;  4YZ4 A;  1PMI A;  1NAE A;  1AZD A;  1ZRI A;  1C28 A;  1QOT A;  4LBJ A;  4RD7 A;  5GLV A;  3S0M A;  2V09 A;  3PUQ A;  5L19 A;  1HQN A;  1CZS A;  4L0P A;  2PXJ A;  4HKO A;  4XAC A;  2QQU A;  2W46 A;  2CSG A;  4OCT A;  2XVK A;  4NR1 A;  4XJU A;  5EJ3 A;  4YW3 A;  4HKW A;  3GBW A;  5I93 A;  1RUO A;  2KM2 A;  4O65 A;  4NRP A;  2AR6 A;  4TLG A;  1GR3 A;  3JB8 A;  5FPA A;  3TN9 3;  1H2L A;  3CBN A;  3HQR A;  4AZZ A;  5F8P A;  3JCI A;  1G9A A;  1GQG A;  2HWE 2;  1V0A A;  1LRH A;  2Z5W A;  2Y34 A;  3C7F A;  4AI8 A;  5JPM B;  2OQ6 A;  5FPX A;  1W3V A;  3PHM A;  4FFG A;  3VBH B;  4IXL A;  1GIC A;  3RSJ A;  4BCU A;  1F4H A;  2J1V A;  4HL0 A;  3VKM A;  4YZ2 A;  1OH3 A;  3AMQ A;  2J1U A;  2RJK A;  4NHL A;  4QPI A;  2WAA A;  1W8W A;  5L9V A;  4FPO B;  1IZ3 A;  1LOD A;  4P02 B;  1I6X A;  1UWW A;  1Y43 B;  2C1F A;  4YZ1 A;  1OOP B;  4HMZ A;  2QUO A;  1EAH 2;  4WM7 B;  2VUC A;  4MGQ A;  5FUP A;  1PX3 A;  4CEY C;  2JKX A;  1W9S A;  1AR7 2;  1JZ4 A;  2HBT A;  1WCS A;  4QGM A;  2CGN A;  1WMF A;  3P5B A;  3GBG A;  3NWK A;  5FYC A;  1RYY A;  1W9Y A;  3S5Q A;  2WYF A;  3DL3 A;  4XZU G;  1O3T A;  2P6H A;  1W6M B;  4ZXE A;  3GM8 A;  1AR7 1;  1DGW A;  1AR6 3;  4BJ0 A;  4GKX A;  5GM0 A;  1GMM A;  4Y20 A;  1UNB A;  2IWG B;  1HB2 A;  1RVF 1;  5DPN A;  3JD7 1;  3AXD A;  4XC9 A;  1QXR A;  1BK1 A;  1C8M 1;  3F2Z A;  2D5H A;  1N1V A;  3GYD A;  2JDP A;  4CU9 A;  2I74 A;  2RS5 2;  5IK5 A;  5T5J A;  4GWJ A;  4HLT A;  4EZ4 A;  4C1X A;  3CL1 A;  2VPV A;  3MIF A;  3T0B A;  3WX5 A;  1XNB A;  3IKW A;  1AJK A;  1FT9 A;  5A6Q A;  1C8M 3;  1LU1 A;  3CLP A;  1QJX 2;  4LUL A;  5AFE A;  2DDU A;  4COZ A;  3ENR A;  3OD0 A;  4NIH A;  4LJH A;  5C4W A;  4MXW A;  3EHK A;  5HCF A;  2GSY A;  1AL0 G;  1NY7 2;  2BFU L;  5FUI A;  4AW7 A;  1TMF 3;  4A3Z A;  2DVA A;  3ZFG B;  5HI0 A;  5E8A A;  4XOG A;  3EXU A;  4R8H A;  5A7N A;  4NN0 A;  3ZFF B;  1R09 2;  2A73 B;  2A6X A;  3ZR5 A;  3CU7 A;  4PDW C;  5CEH A;  2XVG A;  1DCS A;  1ND2 B;  3WF4 A;  2BOJ A;  4MYE A;  3SCG A;  1EY2 A;  2D7F A;  4GWI A;  1CIY A;  4QXB A;  3N36 A;  2VZR A;  4AI3 A;  2LRP A;  2R0F A;  4W65 A;  4W6W A;  4MG2 A;  3HNY M;  1VE0 A;  2VZV A;  1J1L A;  1SPP A;  1X9T A;  2DUQ A;  2EF6 A;  2H0V A;  1DG6 A;  1G6N A;  5DUV A;  1Q56 A;  4CP1 A;  5FZH A;  1UOF A;  1ZZ6 A;  2QNK A;  1QIQ A;  2ZX4 A;  5DDJ 2;  1ZZ9 A;  4KGQ A;  4COW A;  1WLC A;  3N9N A;  3T2O A;  5JMC A;  1LHW A;  2A5Z A;  4QD2 A;  1S0C A;  2WO2 A;  3LCP A;  5FJK A;  3FBM A;  1RHI 3;  4GB3 2;  4NE9 A;  5JPN B;  3B9C A;  4BDV B;  4QB1 A;  5K9Y A;  2OUJ A;  4A6S A;  1AX2 A;  1KJR A;  2VAU A;  2LM3 A;  1MVE A;  5FOJ B;  2HEW F;  3WW4 A;  1QJU 2;  3LF7 A;  5FZB A;  1QJX 1;  3C7O A;  1VBE 1;  1ND2 C;  3KB5 A;  3E6D A;  2X5I C;  1ENS A;  3LOI A;  1KJL A;  4KWJ A;  1UYP A;  2WFF 3;  4YG3 A;  5JSR A;  2JDN A;  4P9W A;  5E89 A;  5JIA A;  4OUL A;  3AP4 A;  1S0D A;  3FWE A;  4NWW A;  1REE A;  4QU2 A;  4YAR A;  4UW5 A;  3H9A A;  2WNV C;  1L3J A;  5D21 A;  3S57 A;  1AL2 2;  1SCS A;  1UMZ A;  1VIW B;  3VHO A;  4YNI A;  1KXG A;  3CEW A;  2UWB A;  4OI1 A;  3ILN A;  1IGO A;  2B39 A;  3L9J T;  4URA A;  5DG1 A;  1DZQ A;  5FKC A;  4UFL A;  2P5B A;  1A3K A;  1PVX A;  3T3Y A;  3QOP A;  4DO0 A;  2XBO 3;  1CJP A;  3I2D A;  1YEW A;  2Q30 A;  1B35 C;  3KT1 A;  4N53 B;  4EN0 A;  1ZX5 A;  3VDD C;  1CIW A;  1BEV 1;  3I3B A;  1NA1 A;  3D82 A;  4LA2 A;  2GH2 A;  4C90 A;  5F1R A;  3E6C C;  5DQ0 A;  1W6M A;  4Q0U A;  1XSR A;  4ARY A;  1XRU A;  5FV3 A;  1WA6 X;  1YJL A;  5B2G B;  1GU3 A;  2OPK A;  2W39 A;  2Y26 A;  4KGG A;  1JN2 P;  4OLL A;  4DXR A;  2QQM A;  1ENR A;  2XUE A;  4ASK A;  5CFD B;  3QH7 A;  5F3I A;  3RZJ A;  1PMH X;  3BIW E;  2VL4 A;  5FQ0 B;  2PLV 1;  4P9L A;  3UGF A;  3D0J A;  4R9C A;  2ZZQ A;  4K40 A;  2IXK A;  5EPA A;  4BQ3 A;  1O4T A;  2JG9 C;  2ZEY A;  3IDA A;  4RHV 1;  1N3O A;  4WM8 C;  4XET A;  5L7O B;  4Y22 B;  5D1I A;  2VUJ A;  1RUF 3;  4YW6 A;  5JI7 A;  3BU0 A;  1ODN A;  3VD3 A;  4HKL A;  4UT5 A;  5BY5 A;  1I3H A;  2QQW A;  3ZDV A;  3MIG A;  4J1X A;  3RMY A;  2FZ1 A;  3ZM8 A;  4XFI A;  3NJV A;  3O1T A;  4XUP A;  2WT2 A;  5C5U A;  5B4X A;  1OD5 A;  1W04 A;  5J36 A;  1VLN A;  1ODM A;  3KZ4 C;  4JV4 A;  2YGM A;  1GUI A;  4KWK A;  2NN8 A;  4XVH A;  2D6P A;  2ZGM A;  2O1Q A;  1LU2 A;  2IFR A;  3ACF A;  4HVR A;  1PNF A;  3BTY A;  4P5H A;  4RS5 B;  1W8Z A;  5JUV A;  4UW3 A;  1CJD A;  3ZXE A;  2DUO A;  5J09 A;  3WDT A;  2R7E B;  4CU8 A;  1OA2 A;  1ZYB A;  5FZ0 A;  1LJ7 A;  1Q8V A;  4GMP 3;  1JOB A;  4Z1V A;  1S2E A;  1YFX A;  4ATF A;  4XQW A;  4LEJ A;  2PAK A;  2P3I A;  3VDC A;  3CO2 A;  2VZS A;  4LR4 A;  2J1S A;  3SCF A;  1F31 A;  3CF6 E;  2UUR A;  2XXZ A;  1G8W A;  2EXK A;  3O0X A;  4R4Z A;  3JXS A;  4AYU A;  2RM2 2;  4QHB A;  1G9D A;  5E88 A;  3MEP A;  4DXS A;  4WM8 A;  2NMO A;  2XDV A;  4FPC A;  4E2S A;  4EWA A;  5LA1 A;  2CAV A;  1BQP A;  3C3V A;  1E5H A;  1O5U A;  2ZAH A;  3HBZ A;  4UBG A;  1DQ5 A;  4ASM B;  1MS5 A;  1K42 A;  3DCQ A;  4YW1 A;  4P00 B;  4W6X A;  1LOE A;  2CWS A;  5ANN A;  1UCX A;  1UU4 A;  4TYS A;  1SFN A;  4UF0 B;  1FPN 3;  2WT0 A;  2I2S A;  2Y6J A;  2ZGQ A;  4JC1 A;  1PO2 1;  4LO8 A;  4MAD A;  3V0A B;  1CD3 G;  1LHN A;  1OFN A;  1JYN A;  1YFY A;  2RMU 2;  4CCL A;  1GLH A;  5LBE A;  1GWK A;  5T52 A;  2H6B A;  4JDM A;  4U2A A;  3ITQ A;  5T5L A;  5C3R A;  2P3J A;  4PF1 A;  1SAC A;  2VC9 A;  1URX A;  3VBF C;  5EZW A;  1KS4 A;  1VBC 2;  4Z92 B;  2QQK A;  5FR3 A;  4OQ9 A;  5J48 A;  4GMP 0;  1SMV A;  1QNY A;  1ZZ8 A;  2AC1 A;  2RDS A;  1DHK B;  3WQ0 A;  5JXG A;  2C24 A;  1UAI A;  1RUH 3;  3U4S A;  3VBS B;  4L11 A;  3AM2 A;  5A32 A;  5GJ6 A;  2ZOE B;  4OI0 A;  1ASJ 3;  1XNT A;  4XHB A;  4J6G A;  4RHV 3;  2XKO A;  4LHL A;  3N9M A;  1L7Q A;  2MEV 1;  5D8A B;  1W05 A;  5I0U A;  3ZYP A;  2PLV 3;  3AP9 A;  4S2H A;  3LDB A;  4IEO A;  1AHS A;  4EN8 B;  1J59 A;  1AYM 2;  1LES A;  1CX1 A;  4LTA A;  1SDW A;  3ME2 A;  3K2O A;  4KI5 M;  2LRO A;  1K5J A;  1RUD 3;  1Y3T A;  2GMP A;  5JR7 B;  1AYM 1;  4NID A;  1V6N A;  4HZF A;  1DQ1 A;  4A7K A;  1BMV 2;  4FI9 A;  3POF A;  5FLI A;  4AQT A;  2WQ4 A;  4GIQ A;  4F8A A;  2X05 A;  4AHW A;  4Z2W A;  5FZ3 A;  1ZBA 1;  1CQ9 A;  3GZU C;  4QM9 A;  4XCA A;  3PLQ A;  3BIE A;  1TZO A;  4EJR A;  1AX0 A;  2JIJ A;  3FHI B;  4RR3 A;  4BLI A;  4E2Q A;  2PMW B;  1H2M A;  1SQ4 A;  1VBB 1;  4MO3 M;  4UYB A;  4B8E A;  3MUZ 1;  3AFK A;  4LE4 A;  2P6C A;  4IES A;  2QDN A;  3GJB A;  2Q5T A;  1I9R A;  5LB6 A;  5HPO A;  2OXB A;  5HCH A;  1PGW 1;  1Q8O A;  2HLE A;  4YVW C;  5IVV A;  3WIN E;  4BM8 A;  2VEC A;  1AL2 3;  2RS5 3;  5EIY B;  2GDF A;  2N7G A;  2K0G A;  1EYB A;  1RUE 3;  4CVU A;  4EWD A;  4LXL A;  3VD9 A;  1C8M 2;  2A3W A;  3DV8 A;  1HLC A;  4JKM A;  3SKJ E;  3ZSE A;  1ZRC A;  4G3Y C;  2O14 A;  3D5O A;  3MLJ A;  2Q8O A;  1ULO A;  3KCX A;  3OB8 A;  4A42 A;  4AEJ A;  3ROU A;  3CQO A;  4W50 A;  3FJS A;  3QBQ A;  4ZU7 A;  4LO4 B;  5L7O A;  3PUH A;  2Y0I A;  5DG2 A;  3O1P A;  1OBN A;  1W8H A;  1S0F A;  2BW8 A;  2D5F A;  1Y7B A;  1O91 A;  4IER A;  4MUV A;  2WQ8 A;  1RL3 A;  2O0O A;  1FOD 1;  3I7D A;  1FOD 3;  3UT0 A;  4MH0 E;  3MID A;  3I8T A;  5BNO B;  2PN5 A;  3IMN A;  3CKH A;  5C8C A;  4AAP A;  3HIF A;  3VBO C;  1ZVF A;  5FP7 A;  2XON A;  4IW3 A;  5JLV A;  1CVN A;  1PO1 1;  2DCJ A;  2ZMK A;  2D6O X;  1AR9 1;  3OY8 A;  5FWE A;  4E8D A;  1N1S A;  2CU5 A;  1V9U 3;  3WCS A;  1YIF A;  2NP0 A;  3OF1 A;  5DDJ 3;  5C3Q A;  1M06 G;  1LNS A;  1WMX A;  5FYB A;  4XAB A;  1U5I A;  5AVP A;  2YHJ A;  1RUE 2;  5HXV A;  3NKG A;  2AH2 A;  1G9B A;  1F15 A;  4YM3 A;  4N43 C;  2DTY A;  1O4Y A;  4HXC A;  1GBG A;  5DAW A;  4CDW B;  3H7Y A;  1H30 A;  5KHK A;  5I0R A;  2WAO A;  1BHG A;  3O1M A;  4ES9 A;  5T54 A;  1LGB A;  5DN2 A;  1B35 B;  5EFU A;  4IE7 A;  3ORJ A;  3NKT A;  5J3U A;  5C3P A;  4BIO A;  4BXS V;  1QDC A;  2YB7 A;  3MV0 1;  1W39 A;  4JCK A;  4D7Y A;  4K1Z A;  4DPN A;  4OYU A;  1IS4 A;  3WNN A;  1HV1 A;  3USU A;  2WS9 2;  4JX0 A;  1ASJ 2;  2RMU 3;  3KGZ A;  5FPL A;  5FZK A;  2QE3 A;  3VKF C;  3WP4 A;  4AVV A;  1MZF A;  3ZYH A;  1W0N A;  5HV4 A;  4Q1R A;  2VMD A;  2QCS B;  2ZEW A;  3B3Q E;  3I54 A;  4RQP A;  4AL9 A;  1OUX A;  1PGS A;  2E31 A;  1SLA A;  1VBC 3;  1H1I A;  3L2H A;  1EP0 A;  2ZXQ A;  5JZG C;  2YGL A;  4K21 A;  5A33 A;  2ZKN A;  4KBZ A;  1RJ8 A;  4A45 A;  2VM9 A;  5A33 B;  1JYX A;  2Q1F A;  3VZL A;  4DRV A;  2VNG A;  3WDU A;  1HB3 A;  1YQ8 A;  2W0X A;  2Y0O A;  3AFG A;  3I2J A;  4K6B A;  3D0S A;  4LOS A;  5DUX A;  5FYI A;  1SG3 A;  2Q0A A;  2TEP A;  1AYN 3;  3ACG A;  3AKS A;  4FPL A;  1KFU L;  2DFB A;  2VCM A;  3LKJ A;  4BLJ A;  5L9R A;  2HWB 1;  2HYX A;  2A70 A;  3RMX A;  3M8L A;  5EWS A;  5JOX A;  4Q27 A;  5C8C B;  2D3S A;  1H4H A;  3KQ4 B;  4RFT 0;  4B4P A;  2QQI A;  1D4M 2;  2XKP A;  3Q8B A;  3W9A A;  1XQN A;  1UZW A;  4FPJ A;  4HVO A;  2VW0 A;  3NJZ A;  3IBM A;  1CAW B;  1VBD 3;  3BU7 A;  3OOX A;  3WP3 A;  3CJI A;  1PM4 A;  1KD7 A;  3FE5 A;  4LBN A;  2XUM A;  3ZKY A;  3CMG A;  5E16 A;  1CAX A;  1XU1 A;  4RQP C;  1OA4 A;  3AMH A;  4GJY A;  1WMD A;  4RN5 A;  2YPJ A;  4WZF A;  2VZP A;  1GNH A;  2Z4F A;  3GZA A;  2IFW A;  3RZH A;  4XUT A;  4BWO A;  2DVG A;  2Y33 A;  5IAX A;  1OKQ A;  2ZGN A;  1S2B A;  5JXI A;  1HRI 1;  1POV 3;  1R1Z A;  1UIK A;  2IXH A;  2WO1 A;  4M0N A;  4ZXK A;  3OYW B;  3ZYJ B;  3PUA A;  4Q0P A;  2VBB A;  1SFY A;  4QX8 A;  5A3P A;  1A8D A;  5KC6 A;  3MGU A;  5H9Q A;  4C91 A;  5BNO A;  1QEX A;  2RS1 1;  2WFP A;  4EYU A;  2TBV A;  2YBP A;  2YC0 A;  3A4U A;  1EAH 3;  3B01 A;  3HN3 A;  4AAX A;  1ZA7 A;  5JOZ A;  2QDR A;  4CCJ A;  4JTN A;  3THP A;  4ARX A;  2Y64 A;  2JDK A;  4FOW A;  4QPI B;  1HXS 1;  1OD3 A;  1PVC 1;  1BZW A;  1R09 1;  4LOR A;  5FJH A;  1S55 A;  1GOH A;  2ZHN A;  2K46 A;  4BH9 A;  1H2N A;  2WRA A;  4XMI A;  1N47 A;  2CDO A;  2K2S A;  1AR6 2;  1BKZ A;  4UI9 L;  1CAV A;  3VHN A;  2FDG A;  3LEK A;  4YWA A;  1YQ2 A;  5K8S A;  3UES A;  1FPN 2;  3MW4 A;  1H1M A;  3MPB A;  1H8T C;  1MZE A;  1OLM E;  1S4C A;  4JZR A;  4IEQ A;  3CJX A;  4LHS A;  5JZG B;  4CE8 A;  5JDB A;  1T6B X;  2WSV A;  3VZO A;  2QJV A;  5EQU A;  3I2O A;  3ZMO A;  5A3L A;  4CPB D;  2R04 1;  2P2K A;  2XQX A;  2VTX A;  3GHN A;  4FP2 A;  3PDQ A;  2W3J A;  1W8F A;  1W9T A;  3J26 N;  4E27 A;  2CGP A;  3D3A A;  2DCK A;  3POJ A;  2VMI A;  5LK7 B;  1E5R A;  3TEZ A;  2OW4 A;  2QQL A;  4Q4W 2;  1AL2 1;  3E97 A;  1LTE A;  4MGY E;  4BQW A;  4C0B A;  4V2W A;  4C8D A;  3B69 A;  3DPR C;  5CFD C;  4QDS A;  5FK7 A;  2ZX2 A;  4QPG C;  4HOO A;  1DZT A;  2ZJC A;  4YVS A;  4AQ6 A;  2J22 A;  4AK3 A;  1FOD 2;  3FFQ A;  5FYV A;  3VHP A;  1RUG 2;  4Y26 A;  3EO6 A;  1IKQ A;  4YG0 A;  4Q4Y 2;  3CZU A;  4GA9 A;  4PDW A;  2W1W A;  4ET7 A;  1FPN 1;  4XJ9 A;  2VZ3 A;  5DAQ A;  1ZBA 3;  3VDB A;  4N43 B;  3HWJ A;  4GH4 C;  3M3Q A;  3E5U A;  4HSJ A;  3AMN A;  4BOW A;  4KL1 A;  4DY3 A;  2VTF A;  3M70 A;  1IG0 A;  2VZQ A;  4B4R A;  2W2I A;  3PL0 A;  2TUN A;  4EQV A;  4AVC A;  3USU B;  3RYP A;  4RS5 C;  4LT5 A;  3SMH A;  2V5Y A;  4QM8 A;  3I3M A;  3IN9 A;  3C7G A;  4NWV A;  1WW5 A;  4QKD A;  1C8N A;  2DTW A;  5FZ7 A;  1HB4 A;  1YNA A;  1YJK A;  5GLZ A;  5LAT A;  1S1A A;  2JIC A;  2WYS A;  3ACI A;  4GKY A;  3IB3 A;  2BVV A;  2ZGR A;  2VU9 A;  1JZ5 A;  2LW8 A;  3MIE A;  3ZN6 A;  1REF A;  1F35 A;  3P6B A;  3WUD A;  4AGR A;  1TME 1;  2VG9 A;  1LHU A;  2JG9 A;  2QQO A;  3I2K A;  1O5L A;  5AVA A;  1OLM A;  4XFH A;  4MGS A;  4CUG A;  2C6S A;  4BQ1 A;  1V6M A;  3H8O A;  4NPL A;  3ZSM A;  4CCK A;  2Z79 A;  3OPW A;  1F2N A;  1YC6 1;  5ACA 2;  4K8R B;  2W1S A;  1C5I A;  1CON A;  2ERF A;  2RDR A;  3JUU A;  4LPL A;  4ONU A;  1OMI A;  1PO2 3;  2Y6G A;  2J7M A;  2ZHL A;  1F9K A;  2G9Z A;  4QKN A;  3PUI A;  4N9H A;  4JRL A;  4ZS2 A;  3SH5 A;  1XE8 A;  3LFM A;  3VDD A;  2YV8 A;  3D8C A;  3W5N A;  2JDM A;  5JAX A;  1ZRE A;  4JDO A;  1J58 A;  5L73 A;  2F4P A;  2YYO A;  3EJK A;  4AFD A;  2AEZ A;  3AYD A;  2EIC A;  2Y6F A;  3IDE A;  2A6V A;  4IDZ A;  1MQT A;  2ZGP A;  4J25 A;  4COY A;  4E9K A;  1ZRF A;  5LA9 A;  4AI1 A;  2EID A;  1W6P B;  2ORZ A;  3I3Q A;  4XAE A;  5AC9 1;  1W28 A;  2D6L X;  1LGC A;  1RUJ 3;  1MVQ A;  5C8W A;  3BTX A;  3N9L A;  1JBC A;  3I2G A;  4GZ9 A;  2E9Q A;  3FLR A;  3VHR A;  1UY2 A;  5A3O A;  2ZML A;  3ZIX A;  1UY1 A;  4Y1U A;  5FZD A;  3V0B A;  4N90 A;  1YI7 A;  2R32 A;  2RMU 1;  1OSG A;  3B93 A;  3KF5 A;  3POI A;  5JVV A;  5LZ6 A;  3V0B B;  2V4A A;  4AE2 A;  1WCK A;  4BA6 A;  3J8F 1;  2HBU A;  1GP4 A;  3DN7 A;  4IEV A;  3AB0 A;  3PVB B;  4Q4V 2;  4Q4W 1;  3S6P A;  2JG8 C;  5BNO C;  2JDY A;  1ULG A;  1YWK A;  3FL7 A;  1W8N A;  2OZ6 A;  4OUS A;  1JMU B;  3LA7 A;  3AL6 A;  3ES4 A;  5FXX A;  4F83 A;  5LEJ A;  3N9Q A;  1XE7 A;  4FT8 A;  3DF0 A;  5T50 A;  2FCT A;  2J1T A;  2WFF 1;  1GZC A;  4A2U A;  1NCR B;  2JDZ A;  4Z07 A;  4XDQ A;  1DBN A;  4NHM A;  5C71 A;  5CKN A;  4LO5 B;  2GN3 A;  3NST A;  3V56 A;  1VAK A;  3AYA A;  5A7W A;  1BCX A;  2ZGU A;  4PBP A;  2BGC A;  1GZ9 A;  4G4F A;  3U37 A;  4DFS A;  1MEC 3;  3HPN A;  2KXL A;  2Q8D A;  2A7A A;  1ZBA 2;  4OMD A;  1GQH A;  4XQD A;  1ULC A;  3ZFE B;  4YVW A;  1RUJ 2;  5I91 A;  1X8E A;  2X8K A;  2XB6 C;  4Q5O A;  4RL7 A;  5FY8 A;  5JI9 A;  4NIG A;  5FY1 A;  3WV6 A;  4MGK E;  4RSU A;  2V5D A;  3OJB A;  4I0W B;  1LAJ A;  3E5X A;  1C57 A;  1AR9 2;  1RC6 A;  2FD8 A;  2VVD A;  2BPA 2;  2GND A;  1C5H A;  2GN7 A;  5FYY A;  4YFZ A;  1DF0 A;  2OUH A;  3AKR A;  1O59 A;  5J98 B;  3ZN6 B;  2C26 A;  2VOX A;  3EYP A;  4IEX A;  1RIT A;  5FZ1 A;  4G9S B;  4YPJ A;  4DB5 A;  1HN1 A;  4XF0 A;  4XIL A;  4FTB A;  1VBD 2;  1TMF 1;  4UFK A;  1NLQ A;  1ZZB A;  2R06 3;  1Y9M A;  2DBI A;  5A7S A;  4Y4R A;  4W6Y A;  3AZW A;  4GH4 A;  1POV 0;  2PAE A;  2XJR A;  3LD8 A;  1NG0 A;  4F7Z A;  5A3U A;  5F3E A;  2ZX3 A;  1DU3 D;  1ND2 A;  4JGZ C;  2PQQ A;  2ZMN A;  3EBR A;  3J7L A;  2P3K A;  3GCW A;  4XE9 A;  2HH9 A;  4RFR B;  3ATG A;  4WVV A;  2ZGT A;  3CDZ B;  3U75 A;  3VL8 A;  3WW3 A;  3UNP A;  5FDB A;  2VW2 A;  3AP6 A;  1QJU 1;  4L92 A;  5FBZ A;  4R9B A;  5FYZ A;  3ZYR A;  5A7Q A;  4E4H A;  1PX4 A;  4XXP A;  5F5A A;  3HR9 A;  4DZG A;  3THT A;  3UL2 A;  3WOG A;  1DQ4 A;  2G4I A;  5BNP B;  3VBS A;  4HG6 B;  3WF2 A;  1MZ5 A;  2BJS A;  3WVJ A;  3N9O A;  4AR2 A;  4KU8 A;  1AYM 3;  1IG3 A;  3IAP A;  3MLL A;  4A44 A;  1VJ2 A;  2E51 A;  1S0E A;  5D8A C;  4UFI A;  3H1W A;  5FPB A;  3NNM A;  5DAP A;  4A3X A;  1SFP A;  2J1A A;  1R1A 1;  4OHZ A;  4BQ4 A;  3N35 A;  2B46 X;  1FMD 3;  2YC4 A;  4NUB A;  2RJL A;  5DAX A;  1CZV A;  2VGD A;  2DU1 A;  2F17 A;  4IE5 A;  5FXV A;  1JW6 A;  3J7N A;  3RVH A;  4CDU C;  1H6Y A;  1KGY A;  2WA3 A;  2Y8K A;  3C7H A;  3DYO A;  2Y60 A;  4GMP 1;  2ARB A;  4OQ8 A;  2VCB A;  2FCV A;  4I0A A;  1XJA A;  1RUH 1;  1Q3E A;  5A7W B;  1STM A;  3NRU A;  4IE0 A;  5IVY A;  1O6U A;  4IGP A;  3I59 A;  5FOB B;  1NCR A;  3KV4 A;  4I09 A;  3ZFE A;  4CXW A;  2B7Y A;  3KV9 A;  4KU7 A;  5D2A A;  3JBG 3;  1FXZ A;  3JQX A;  5C4W C;  4DUX A;  1MS3 A;  5CNA A;  1G9C A;  1QMJ A;  1TME 3;  2FMY A;  1TNR A;  2QBX A;  2BP6 A;  3IWZ A;  4MLO A;  5FQ0 A;  3J8F 2;  3RZG A;  1K12 A;  2NLR A;  4H3W A;  1SBE A;  2XLG A;  3BOD A;  3OEA A;  5JCT A;  1EUU A;  1JU4 A;  2V73 A;  4BE3 A;  1D4M 1;  1KIT A;  3ACL A;  3I2H A;  4B1L A;  5IYY A;  5T5O A;  3W20 A;  3LIH A;  3BOP A;  4Y22 A;  3UGH A;  1JYT A;  1OLQ A;  4NII A;  3NNG A;  4QX2 A;  4YW7 A;  2VUL A;  4X8P A;  2F6B A;  2A3Y A;  2UWC A;  3DYP A;  3HVD A;  3ETQ A;  4L2N A;  3RG0 A;  1UZZ A;  1BEV 2;  1RED A;  2B8M A;  2PFW A;  4AF9 A;  2E6V A;  3CHX A;  2R49 A;  1ZM1 A;  4M3C A;  2WNO A;  4Q4Y 1;  4E4Z A;  1NOV A;  4XFB A;  2VY0 A;  3GGL A;  3KLS A;  3OCP A;  4WVW A;  4DRR A;  3K4A A;  4DQA A;  1F5F A;  3T09 A;  2Q1Z B;  2XHK A;  3IM0 A;  3KHB A;  4D8M A;  1QJY 3;  3R4D B;  3K77 A;  1EV1 3;  4QGL A;  3NL1 A;  3SNM A;  4COV A;  3OGJ A;  4PJY A;  3VBF A;  1YYN A;  4NPM A;  1OQ1 A;  2XOM A;  2VR4 A;  3SKV A;  2W08 A;  2WII B;  5FZ9 A;  2BNN A;  2DCZ A;  4NMI A;  5DXD A;  2RE9 A;  5H9P A;  3WCR A;  4AFC A;  3WG4 A;  4W8J A;  3M2M A;  4CDQ A;  1VBA 1;  1CAW A;  5L7O C;  5KC5 A;  4LO7 A;  4YRD A;  4GWM A;  1TMF 2;  1XE0 A;  3FHA A;  3IMM A;  4FPF A;  3GBF A;  1AR8 3;  3GNE A;  4RR3 B;  1QOO A;  2FDF A;  3WW1 A;  1V6I A;  5BNP A;  1HV0 A;  5IK8 A;  1YCI A;  1QQP 3;  3VBH C;  5FMD A;  5FZF A;  3O1S A;  4M3C F;  2DBN A;  3LDK A;  1DQ2 A;  4P08 A;  1WD4 A;  1BVP 1;  3HN1 A;  3R0R A;  1W0P A;  4NRM A;  1FYU A;  4PBO A;  1OLR A;  1QOS A;  1N3P A;  1XNK A;  1V70 A;  2XVL A;  1E5S A;  2UYA A;  1H4G A;  3IPV A;  4QMA A;  4Y24 A;  5FPZ A;  3M3I A;  2XPJ A;  1KDK A;  4WVZ A;  4U36 A;  1VBA 2;  2VUA A;  4RQP B;  4XFF A;  1OXC A;  2WS9 3;  1BMV 1;  2BZD A;  4XUR A;  4XDO A;  1PIV 3;  3WEZ A;  3V0A A;  3UJQ A;  1GWL A;  4LKD A;  2R07 1;  5LEK A;  3VBU C;  4XMA A;  1U5Y A;  4I3G A;  5FY7 A;  1C1L A;  3ZSK A;  1ZBE 3;  3PUS A;  3T1M A;  5LA0 A;  4QAW A;  4FPG A;  4K9S A;  2H6C A;  2GNM A;  2JB4 A;  4QDR A;  4YM1 A;  4OVE A;  1UX6 A;  1UQX A;  2D98 A;  1X7N A;  1QJU 3;  2BFU S;  4OZX A;  4FPE A;  5FZE A;  2VQT A;  5EYY A;  5TSW A;  4PIX A;  3VL9 A;  3AP7 A;  5FY0 A;  4Y20 B;  3A23 A;  4YZ5 A;  3B9I A;  4LKE A;  3KHC A;  4PIZ A;  3ZXD A;  1ZRR A;  3VBU B;  1YQ6 A;  4Q8L A;  1ONA A;  4BQX A;  2VJX A;  2JE7 A;  2VXJ A;  1VMF A;  4YSF A;  3AVR A;  5FZL A;  3WG2 A;  1QGL A;  3N7K A;  1TNF A;  3VKO A;  4AQS A;  2BVB A;  3VBR A;  2DVB A;  1X36 A;  3NQH A;  5JSP A;  3D6E A;  4HBN A;  3J8F 3;  2PHR A;  5T3N A;  2PHT A;  4YW5 A;  2A6Z A;  1RHI 1;  4QB6 A;  1JYW A;  3LWC A;  2P1B A;  3WW2 A;  2WWU A;  2PA7 A;  1LGN A;  1RVF 2;  5DMY A;  1OQD A;  3G7D A;  3J4U H;  4URT A;  5G04 L;  3OBZ A;  2BBA A;  2VNO A;  4IE6 A;  4P9I A;  4EWE A;  1SZB A;  4LK6 A;  2QQV A;  2WN3 A;  3FUQ A;  3UET A;  4MGI E;  4PDW B;  2CL2 A;  1PMJ X;  4Q26 A;  3K48 A;  4M4R A;  5FZO A;  1PGL 2;  3RS6 A;  1XYN A;  2KD7 A;  3U4X A;  3MDP A;  2XJP A;  4JQT A;  5EJ1 B;  1FMD 1;  2P17 A;  2RS1 3;  2FHR A;  5T55 A;  2HWF 1;  4K8F A;  4IV1 C;  3PUR A;  5C9A C;  2VH9 A;  3DXU A;  2PHU A;  2XL9 A;  1CX4 A;  1FV3 A;  2FDJ A;  2XJS A;  2ZKL A;  5FWJ A;  3S7I A;  4LIU A;  4ZHN A;  1S0G A;  1ULP A;  1PGL 1;  1JZ6 A;  4MGT A;  4WV8 A;  1WD3 A;  2MEV 2;  1U5Z A;  3LE0 A;  1LEM A;  1W6P A;  5F5C A;  3M1H A;  5FPV A;  5ISL A;  4ITC A;  1A78 A;  3MYX A;  4EN7 B;  4IV3 B;  5FO8 B;  1NY7 1;  1NZI A;  1TME 2;  3QLQ A;  5JR2 A;  2WNE A;  3OBA A;  4FPH A;  4IND A;  3N7M A;  4OUM A;  2HKX A;  2YPD A;  1SLB A;  3G6J B;  3NAP B;  4Q4X 2;  4XF4 A;  4MV2 A;  4CA9 A;  1VMJ A;  1W6O B;  1W03 A;  3KT7 A;  2Z2S B;  3NJX A;  3A0N A;  1NXD 1;  4PHZ A;  2GNB A;  3IDB B;  2VOK A;  4CDQ C;  4E2G A;  4S2F A;  5GZG A;  5IW0 A;  5IVB A;  4UWD A;  3BAL A;  2JEN A;  3CIH A;  3DXT A;  1AJO A;  3OPZ A;  4IV1 B;  3ZOI A;  4LBM A;  3MLK A;  5IVE A;  5I0D A;  2EVX A;  3VB9 A;  2ZHK A;  4MHR A;  1J83 A;  2C4X A;  2PHF A;  1W9W A;  4AI9 A;  2UWA A;  1AR7 3;  4HFS A;  2WO7 A;  1UPS A;  1RUG 3;  1J84 A;  1PM7 A;  3A22 A;  5LA2 A;  4QQO A;  4LHN A;  2R04 2;  1CAX B;  2GC2 A;  1NT0 A;  4CCD A;  1DGW X;  1UXX X;  1VB4 A;  1NUK A;  3VN4 A;  4CEW C;  4IE4 A;  1AR9 3;  1COV 3;  2D40 A;  3O7O A;  4J1W A;  4FCA A;  2CDP A;  2WA4 A;  1O4Z A;  4BQY A;  3URF A;  3GZE A;  2D44 A;  1CWP A;  1JS9 A;  3B7M A;  1RXG A;  1YQC A;  5F39 A;  3T30 A;  5I0S A;  4P14 A;  4AHZ A;  2YUE A;  4LUK A;  3TEW A;  1BXH A;  5FZI A;  5F5I A;  1LOF A;  2OX0 A;  3VBU A;  4CCM A;  4XHX A;  1VMH A;  3H8X A;  3M3E A;  5FP9 A;  2VVF A;  2RJ2 A;  2VZT A;  4Y5T A;  1DLL A;  1KEX A;  4CTE A;  1IPJ A;  2UY8 A;  2YXS A;  5L9B A;  4Q0S A;  1ZBE 2;  3FC0 A;  2X5I B;  2R06 2;  3W21 A;  4ZZ8 A;  1UO9 A;  3Q8A A;  3VD5 A;  4RA0 A;  4DUW A;  5IVF A;  1RUC 2;  5FXZ A;  1OF4 A;  5EJZ B;  2MPF A;  3M7A A;  4LQR A;  4C1W A;  2GMM A;  2PQS A;  2XHN A;  5FMC A;  1WGP A;  2C0Z A;  4XZP A;  1OVS A;  1FAT A;  5F32 A;  1NE4 A;  3S30 A;  2K9Z A;  4QQP A;  1OT5 A;  2H0B A;  1EUT A;  1VBB 2;  2BDR A;  2ZHM A;  2PYT A;  3ELN A;  1HB1 A;  4ZPI A;  3TB0 A;  3AC0 A;  2QQN A;  4P9J A;  1Z78 A;  3IT8 A;  1NCQ A;  2WDB A;  3ZYF A;  1YFU A;  3ALQ A;  4RHV 2;  3ZYB A;  4BK4 A;  1RUC 1;  3TN9 2;  3UK9 A;  4AQ2 A;  2Q1M A;  4DUV A;  3FMG A;  4H14 A;  4UXA A;  1DYK A;  1NLS A;  2DCT A;  1AYN 2;  2OKX A;  3KSC A;  4D6S A;  4FSJ A;  2XGX A;  4JGY B;  4QX7 A;  3WDW A;  2JIG A;  4H7L A;  4QT6 A;  4ZON A;  4QDQ A;  3RJR A;  1U12 A;  3VD4 A;  5IWF A;  5JXH A;  2WLQ A;  2WT1 A;  3PVN A;  3BN6 A;  4P5Y A;  1C1F A;  4Q0Q A;  1UN1 A;  2JXA A;  3ZFF C;  2V4V A;  4AI2 A;  3OG2 A;  3NVC A;  4MSV A;  1GYK A;  1OH4 A;  1PIV 1;  5C4W B;  4XXA A;  1JUH A;  1RUI 1;  2ZCW A;  5SV5 A;  1XYP A;  4AOC A;  2BGP A;  2R1B A;  3MI8 A;  4YG6 A;  1CN1 A;  3OSD A;  4EV0 A;  2FBE A;  4AVA A;  1QJY 2;  4XF3 A;  4CXY A;  4TZD A;  3WG1 A;  1UD1 A;  1MQT B;  1B09 A;  1US2 A;  2VQ0 A;  2UY9 A;  1V6J A;  2FDI A;  1K45 A;  1CES A;  5JMO A;  5C9A A;  4OHW A;  3OGG A;  4Q4V 3;  1NCQ C;  5KXE A;  1DIW A;  4LBK A;  2VMC A;  3AJY A;  3OY8 B;  4HN1 A;  1QJZ A;  1RUE 1;  3WQB A;  4YVS C;  3JBG 1;  4JDN A;  3POG A;  2R16 A;  3AJZ A;  3HNM A;  3ZIW A;  1H8T B;  2WNV B;  3IZO A;  1WWY A;  3KQR A;  4CP9 A;  5ACA 1;  3H1M A;  1PNG A;  2OYZ A;  1KS5 A;  3POY A;  4XF9 A;  3LAG A;  1VRH 3;  4OHV A;  3LPF A;  3LSD A;  3TNP B;  4QQ2 A;  3WG3 A;  3WSO A;  4BQ2 A;  5ABJ C;  1QHD A;  3H8R A;  5FP3 A;  2HWB 2;  2D3P A;  3DPR A;  3GXU A;  4N53 A;  5A3W A;  3QD6 A;  3AZY A;  1VR3 A;  1S0I A;  2YBS A;  3NAP C;  1GZW A;  1QJY 1;  4MVT A;  2R0H A;  4PCR A;  1X50 A;  3MV1 1;  1LOA A;  2WC2 A;  3NNL A;  2XBO 2;  4Y1Z A;  1RIN A;  5F2S A;  3OUI A;  3QAC A;  1FAY A;  2Z69 A;  3K46 A;  1IS3 A;  4R9D A;  4LUM A;  3WZ1 A;  2FZ2 A;  4DNY A;  1NCQ B;  2Q8E A;  1YXW A;  3C7E A;  2B5H A;  4XCB A;  3KMH A;  1H9W A;  5FY4 A;  1W06 A;  2X09 A;  5GZF A;  4ISQ A;  4CDX A;  2ETE A;  2JX9 A;  2WLP A;  5FPU A;  1WUV A;  3R4U A;  1LB2 A;  4BQ5 A;  3WP6 A;  1UYX A;  3H42 B;  4DS0 A;  1F8V A;  3ZXF A;  3MO4 A;  5FLJ A;  3H3L A;  5LAS A;  2WZP P;  4CEW A;  5A3T A;  5HBA A;  5H9S A;  3RJ2 X;  1LED A;  1R1A 2;  1SLL A;  5FCC A;  4FFH A;  2WN2 A;  2C5D A;  2JWP A;  3UGG A;  4XAA A;  1T6G C;  4BPZ A;  3WR0 A;  1PO1 2;  3HQX A;  3U10 A;  1UW8 A;  2DUR A;  1KRI A;  1PZ9 A;  3IIA A;  3AXE A;  4XBQ A;  2IVI B;  4BMB A;  5ABJ A;  3RGB A;  1RMU 1;  1XYO A;  1IS6 A;  1XOY A;  2W94 A;  4K1Y A;  5DZG A;  3P3N A;  1NQJ A;  1QDO A;  4V1P A;  3O1V A;  1O3R A;  3SIS A;  5LY1 A;  3INA A;  4M3C E;  5IK7 A;  2ZX1 A;  2WFF 2;  4JGY A;  5DUW A;  5GLW A;  1D2S A;  1W2T A;  1UY4 A;  4D3W A;  4FTE A;  2CYF A;  2KA3 A;  1HRV 2;  1LUL A;  2R06 1;  3VZK A;  4JRA A;  3AZZ A;  4OMC A;  4Y33 A;  5CFC B;  3T0D A;  4D6Q A;  4KWL A;  2AEN A;  1LCL A;  2DYC A;  2NQY A;  5L36 A;  4P9X A;  2XQR A;  5A7O A;  3P1I A;  4BME A;  4QWN A;  3ES1 A;  2NZ9 A;  3LEI A;  2GAL A;  2VME A;  3DKW A;  3O0V A;  4LOT A;  4IEY A;  5CG9 A;  5FLH A;  3BI3 A;  2RG4 A;  2ZPX A;  2VO5 A;  1ULE A;  1CAU B;  2AAC A;  5FKB A;  1PK6 C;  2VXR A;  2W92 A;  1HRI 2;  3DGT A;  2WSU A;  2XML A;  5IK4 A;  1J3P A;  4NAO A;  1DYO A;  2OVU A;  2HWD 2;  1DLC A;  4I30 A;  4QPY A;  3BPZ A;  4FOV A;  3POS A;  5E6H A;  5FMB A;  1FNY A;  1LHO A;  1WW4 A;  3RDI A;  1YO8 A;  2RR1 3;  4AXO A;  3IPV B;  3ZYG A;  3T4V A;  4AVT A;  3VV1 A;  2ENR A;  4UOJ A;  2HEV F;  1DQ6 A;  1LKN A;  4JVA A;  4DEV A;  1IQD C;  4AFB A;  1O8S A;  3K3N A;  3HNB M;  2WKK A;  2R07 2;  3GF6 A;  4AI0 A;  5F7U A;  4QKB A;  1ULD A;  3BTA A;  4FTS A;  4MXV A;  1XC6 A;  3KWV A;  3ZXJ A;  4UF0 A;  2SLI A;  4B7K A;  1MS8 A;  1PZ7 A;  4YVW B;  3PME A;  4LO6 B;  2VNR A;  5FTT C;  1GKB A;  2HEY F;  2VOV A;  3KS7 A;  4M0H A;  3WNP A;  4CEW B;  3OTF A;  5I8T A;  1PO2 2;  4COU A;  4WVM B;  1X82 A;  3VDA A;  4GWN A;  1GZT A;  3LSE A;  3O0W A;  2JDH A;  3THC A;  5KXB A;  4CP2 A;  3ZFG C;  4D94 A;  4XUN A;  5IVJ A;  1NE6 A;  2D3R A;  4AHY A;  3PIG A;  4BIF A;  4QPG A;  1CAV B;  3EMR A;  5BUV A;  1BVV A;  2X10 A;  3WQ1 A;  4BU2 A;  2BBV A;  3FBY A;  1V6O A;  1DGR N;  1W2O A;  2XLA A;  5FZ8 A;  3BTZ A;  4GJZ A;  3ZVX A;  4DXT A;  5DDJ 1;  2BRT A;  2NMN A;  1TEI A;  3WQ7 A;  2JEC A;  2E26 A;  2ES3 A;  1UY0 A;  3PU3 A;  4XJW A;  4L8Q A;  2EIE A;  3EQE A;  2YFU A;  4RGK A;  1C4R A;  1UOG A;  1WZX A;  5ANQ A;  2IUW A;  4PI0 A;  3WT3 A;  2W68 A;  1JUI A;  2HWF 2;  3ZSL A;  3ZYI B;  3AK0 A;  4SLI A;  1UYY A;  3AX4 A;  4D0Q A;  1EPW A;  2XR4 A;  2R07 3;  3OEB A;  2RS3 1;  3OGS A;  4FQZ A;  3VBR C;  5LBF A;  1DFQ A;  3ZXL A;  1WBF A;  2G19 A;  1H8T A;  2HWB 3;  1UZY A;  5GLT A;  2WJS A;  2WS9 1;  1BEV 3;  2HWC 1;  3TBD A;  5LCW L;  3POE A;  3C8X A;  4IEZ A;  4UW4 A;  3LA3 A;  1AXZ A;  1GV9 A;  5F6L B;  4YW2 A;  1R08 2;  1LHV A;  2G1M A;  1ZNP A;  3LDR A;  2XBO 1;  3EB7 A;  2PHX A;  4O9G A;  3VZM A;  1U5X A;  2W5F A;  1R64 A;  3Q9O A;  3SQO A;  2FQP A;  2WL1 A;  3O1R A;  4Y1V A;  1Q43 A;  3K4Z A;  1JOP A;  1NYW A;  3U11 A;  1WCU A;  1EV1 2;  1FV2 A;  4YGE A;  2IC1 A;  3GDB A;  2JD4 A;  5CFD A;  1VBC 1;  2GAU A;  3I2I A;  4XFG A;  3VBR B;  3ZXK A;  3C2U A;  4FFI A;  2HWE 3;  1AR8 1;  4Q0V A;  1UYZ A;  2B9V A;  2WNU C;  2Z42 A;  3LQC A;  4HET A;  3RYR A;  3VKL A;  2LS6 A;  3ZMN A;  1VRH 2;  4Q4X 3;  3MPP G;  5IFP A;  2OS2 A;  1W6Q A;  2P4E A;  5A6X A;  3WUC A;  2PHD A;  3H3Z A;  4OHY A;  4P9Y A;  1MQT C;  2VMH A;  4XUQ A;  1VBB 3;  5CA6 A;  4Q4W 3;  3ASI A;  4TXW A;  3I97 A;  1MAC A;  2E7Q A;  3ZLI A;  2G9F A;  3BPS A;  4D7S A;  2WO3 A;  2D93 A;  5EXO A;  2LUW A;  1J3R A;  1SCR A;  1JZ7 A;  3T08 A;  2HWD 1;  3GZT B;  4UFM A;  5D8A A;  2GU9 A;  4PF5 A;  4CSW A;  1HJG A;  2V72 A;  2D6M A;  3NJY A;  4MOA A;  4Q4Y 3;  5F6K A;  4ZY9 A;  5LBB A;  1JH5 A;  1P8J A;  3GCX A;  1HKD A;  5A7P A;  1AR6 1;  1OA3 A;  3HJR A;  3J7M A;  3TYJ A;  4XPV A;  5EV7 A;  1NLR A;  4LKF A;  3DUI A;  4OUE A;  4QPW A;  3RZK A;  1QWR A;  2ID4 A;  2YRO A;  4OI2 A;  2D43 A;  2WAB A;  3PVE A;  3HEI A;  1GQP A;  3KCY A;  4FO9 A;  4FPK A;  4CEY A;  4JHZ A;  1IKP A;  2I07 B;  3OBR A;  1WKY A;  4HK8 A;  3SC7 X;  2ZAA A;  4E8C A;  4PLM A;  4CDQ B;  1YIP A;  4NHK A;  4YLZ A;  3O1O A;  5F37 A;  1RXF A;  1MS9 A;  3DEC A;  3SCH A;  2OQ7 A;  3KD4 A;  3K4D A;  3TNQ A;  1BLZ A;  2YG0 A;  1PGW 2;  2J42 A;  2ZBJ A;  1QXJ A;  4KMQ A;  2CTV A;  4A7Y A;  3M3C A;  1DYP A;  2BV4 A;  2R1D A;  2WZR 3;  1VRB A;  1XNC A;  3B94 A;  3N3H A;  2HJI A;  4I02 A;  1PK6 B;  4ISR A;  4QXK A;  4WM8 B;  5CYY A;  4CCE A;  5FZC A;  5ACA 3;  4FQ4 A;  3MF6 A;  4KH9 A;  2R30 A;  1OHF A;  1ND3 C;  3LFI A;  1ACC A;  1HN0 A;  2YY1 A;  2ATF A;  3RI8 A;  4AVS A;  1POQ A;  3B02 A;  1RMU 3;  2ZEZ A;  2VE1 A;  2VQU A;  2VOT A;  4B29 A;  3FUO A;  1JZ2 A;  2WUH A;  2DWR A;  1SEF A;  4Q4V 1;  1SBD A;  3AL5 A;  1J3Q A;  2BEO A;  2BWA A;  2W47 A;  1RJ7 A;  2ARX A;  4N7U A;  4N7I A;  4PT6 A;  5FO9 B;  3AMP A;  5LY2 A;  4AFA A;  1RVF 3;  3P3P A;  1JYI A;  4LBL A;  2Y6H A;  3H7J A;  3JD7 2;  4EE2 A;  1L7L A;  2IXC A;  4QHO A;  4JGZ B;  1W90 A;  4Y1Y A;  3H3U A;  4B1M A;  3MFC A;  2JE8 A;  5DUU A;  2BQP A;  2XJU A;  3ETP A;  2EIG A;  3USS A;  4JKK A;  3A21 A;  3UV9 A;  2DF7 A;  4W4Z A;  3LPG A;  1XB9 A;  1K5M C;  3LGR A;  4NJ4 A;  4CZS A;  3GAL A;  4LBQ D;  2FDK A;  3HMY A;  3ECQ A;  5LK5 A;  3U07 A;  4GXL A;  1F4A A;  4AEK A;  2CV6 A;  3UYJ A;  4MGZ E;  4Z8B A;  2DV9 A;  2CWM A;  3Q8E A;  1QKQ A;  4LLO A;  2QKD A;  5FZA A;  4CPB A;  2O8Q A;  4HAN A;  3UKV A;  1N3Q A;  2JG8 A;  5KHG A;  4FAG A;  2W1Q A;  3RRD A;  3ZXA C;  2NYY A;  4XIK A;  5JZG A;  1LOB A;  2P37 A;  1IS5 A;  2RV9 A;  2DVF A;  4PIY A;  3JBG 2;  3SIT A;  3GHM A;  4LIT A;  3BCW A;  5IJR A;  1J1T A;  2QQP A;  4DXZ A;  1Q8S A;  3NNJ A;  5AFB A;  2BU9 A;  1JI6 A;  5A1A A;  4Q4X 1;  2MEV 3;  1I1E A;  2PTM A;  2BOI A;  5JSO A;  1T2X A;  5C3S A;  4XQ4 A;  3UKN A;  2BYV E;  1Q5O A;  4JGZ A;  1OOP A;  3ZKU A;  2NPI A;  1ASJ 1;  1V6K A;  3FLP A;  1RB8 G;  1CR7 A;  2JDU A;  3OBT A;  3HQU A;  5F5Q A;  3MZH A;  1SLI A;  1OUR A;  1QJX 3;  1MEC 2;  1RUF 1;  1UIJ A;  3FFZ A;  4AEM A;  2VBD A;  5GZC A;  1WLT A;  2Q8C A;  4OHX A;  4H7M A;  1RTV A;  5F3G A;  5FZG A;  2BNO A;  2FDH A;  5FZO B;  1Y9Q A;  4CXX A;  4HVQ A;  2J1E A;  3QH6 A; 
#chains in the Genus database with same CATH homology
 4RYD A;  3WF0 A;  2KD7 A;  3IAQ A;  2VCC A;  2QQI A;  4XUO A;  1H6X A;  5EJ1 B;  3WNK A;  4A41 A;  1GOF A;  1NKG A;  3CMG A;  3HOB A;  3CZJ A;  1GNY A;  3WNO A;  4RN5 A;  1ULP A;  2JD9 A;  1JZ6 A;  2VZP A;  2Z4F A;  3LE0 A;  4XUT A;  2YC2 A;  3I3E A;  2EIB A;  2RVA A;  5JXI A;  2W1U A;  5JR2 A;  1GOG A;  2WO1 A;  3OBA A;  3NJX A;  4Z2A A;  1US3 A;  1L7R A;  1JZ8 A;  1XNA A;  3CIH A;  5B4N A;  3HN3 A;  4AAX A;  1UX7 A;  4ARX A;  5I0D A;  2Y64 A;  2C9K A;  2ORX A;  4CU6 A;  1J83 A;  2C4X A;  4ZZ5 A;  1W9W A;  1NAE A;  1OD3 A;  4IUG A;  1J84 A;  3A22 A;  1GOH A;  5LA2 A;  4L0P A;  1CZS A;  1MPX A;  1UXX X;  2W46 A;  1NUK A;  2CDO A;  3BGA A;  1W8O A;  4KWU A;  4UI9 L;  3LEG A;  3OGV A;  3VD7 A;  3LEK A;  1YQ2 A;  3UES A;  2CDP A;  2VZO A;  3THD A;  2VZU A;  2J1R A;  4LHS A;  3C7F A;  5C71 A;  1F4H A;  2J1V A;  2XQX A;  2W3J A;  1W9T A;  2J1U A;  2RJ2 A;  2VZT A;  3D3A A;  2DCK A;  2WAA A;  4QX3 A;  1KEX A;  2QQL A;  5CZK A;  4P02 B;  4ZZ8 A;  1UWW A;  4DUW A;  3VD5 A;  4QDS A;  1OF4 A;  5EJZ B;  4MGQ A;  4LQR A;  2XHN A;  1PX3 A;  2PQS A;  2J22 A;  2JKX A;  1W9S A;  1JZ4 A;  1XPW A;  3WF3 A;  1OT5 A;  3CZU A;  1EUT A;  2W1W A;  1RYY A;  4ET7 A;  4XZU G;  2VZ3 A;  3VDB A;  4ZXE A;  3AC0 A;  2QQN A;  3GM8 A;  4BJ0 A;  1UXZ A;  2WDB A;  2B4K A;  1GMM A;  4BK4 A;  2VTF A;  3WNL A;  2VZQ A;  2L9L A;  4DUV A;  5DPN A;  2OKX A;  1I5P A;  4QDQ A;  3C7G A;  3VD4 A;  3F2Z A;  5JXH A;  5C70 A;  3BN6 A;  4CU9 A;  4P5Y A;  4GWJ A;  3III A;  2V4V A;  3T0B A;  5C7G A;  3ACI A;  2WYS A;  3OG2 A;  3IB3 A;  1JZ5 A;  1OH4 A;  2LW8 A;  2DDU A;  2BGP A;  1NX9 A;  3P6B A;  5FUI A;  3I2K A;  2QQO A;  4A3Z A;  1US2 A;  4MGS A;  1K45 A;  5JMO A;  3WF4 A;  2VMC A;  5J1X A;  2W1S A;  4GWI A;  1CIY A;  4AG4 A;  4LPL A;  2VZR A;  2QQJ A;  3WQB A;  2Y6G A;  4BK5 A;  2J7M A;  3ACH A;  3HNY M;  3HNM A;  3PUI A;  2W87 A;  2VZV A;  1UZ0 A;  3W5N A;  3LPF A;  3WSO A;  3GXU A;  2EIC A;  5G05 L;  3T2O A;  2WO2 A;  3T2P A;  2EID A;  2ORZ A;  3MV1 1;  4BDV B;  4QB1 A;  2BGO A;  2VCA A;  3K46 A;  3I2G A;  3C7O A;  4GZ9 A;  3T2Q A;  1UY2 A;  3C7E A;  1UY1 A;  3WNM A;  3DYM A;  2X09 A;  1UYX A;  2E32 A;  5IHR A;  3MO4 A;  4UAP A;  3FL7 A;  2WN2 A;  1W8N A;  2J1T A;  3I3D A;  1CZT A;  2W94 A;  3I3B A;  2Y6L A;  1PMJ X;  5DQ0 A;  3U37 A;  4ARY A;  3HPN A;  1GU3 A;  1UY4 A;  4OMD A;  3MBW A;  4DXR A;  4TTG A;  2QQM A;  2WZ8 A;  4OMC A;  1PMH X;  3T0D A;  2VL4 A;  2V5D A;  3P1I A;  2ZEY A;  3IDA A;  3LEI A;  2VME A;  1DP0 A;  3VD3 A;  2VO5 A;  2W92 A;  1W99 A;  3ZM8 A;  1O59 A;  1DYO A;  3NJV A;  1DLC A;  2C26 A;  4XUP A;  5B4X A;  3EYP A;  4YPJ A;  1GUI A;  4XVH A;  1HN1 A;  4UOJ A;  4DEV A;  3ACF A;  1IQD C;  1O8S A;  3HNB M;  1SDD B;  5JUV A;  5F7U A;  4CU7 A;  4LKS A;  4CU8 A;  2R7E B;  1XC6 A;  3T0A A;  2E33 A;  4PQQ A;  1WCQ A;  2BER A;  3VDC A;  2VZS A;  3CDZ B;  3WNP A;  2J1S A;  3UNP A;  3JXS A;  3VDA A;  2ZEX A;  4DXS A;  3THC A;  1PX4 A;  5LA1 A;  4XUN A;  4HG6 B;  3WF2 A;  2X10 A;  2WZE A;  1K42 A;  3IAP A;  4CUB A;  4A44 A;  4P00 B;  4DXT A;  1UMI A;  1UY3 A;  2E26 A;  2Y6J A;  1UY0 A;  4MAD A;  2J1A A;  2EIE A;  2YFU A;  3W5M A;  3ABZ A;  1JYN A;  2YC4 A;  1CZV A;  1UYY A;  4D0Q A;  4PF1 A;  1H6Y A;  1JU3 A;  1KGY A;  2Y8K A;  3C7H A;  3DYO A;  2VC9 A;  3OEB A;  3OGS A;  2W9X A;  2QQK A;  5LCW L;  4QX0 A;  2VCB A;  3C8X A;  5JXG A;  2WBK A;  3EB7 A;  2W5F A;  1R64 A;  3NRU A;  1XNT A;  3K4Z A;  1L7Q A;  4OZO A;  3GDB A;  4DUX A;  3I2I A;  2QBX A;  3FHQ A;  1CX1 A;  1UYZ A;  1K12 A;  2B9V A;  3LQC A;  3OEA A;  2LS6 A;  1EUU A;  1JU4 A;  5IYY A;  1JZ3 A;  3I2H A;  5IFP A;  4KI5 M;  3K75 B;  2JDA A;  3NNG A;  3WF1 A;  4QX2 A;  4FI9 A;  4XUQ A;  4QX1 A;  4CUC A;  4TXW A;  3I97 A;  2X05 A;  3DYP A;  2WO3 A;  3SEE A;  4A4A A;  1JZ7 A;  3T08 A;  4MO3 M;  2V72 A;  3MUZ 1;  4MOA A;  4ZY9 A;  1P8J A;  5HPO A;  3GGL A;  3HJR A;  3K4A A;  1TVG A;  2HLE A;  3T09 A;  4OUE A;  4QPW A;  4D8M A;  5EIY B;  2ID4 A;  1K3I A;  3K77 A;  2WAB A;  4CVU A;  3HEI A;  1GQP A;  3VD9 A;  4JHZ A;  1WKY A;  4E8C A;  3SKJ E;  4JKM A;  2XOM A;  2VR4 A;  3SKV A;  4W8J A;  1ULO A;  3DEC A;  3OB8 A;  4A42 A;  2VMF A;  3CQO A;  3J7H A;  3K4D A;  4W50 A;  3FHA A;  2YG0 A;  2VZ1 A;  4KMQ A;  3PUH A;  3A7Q A;  3I2F A;  1SHW B;  3OGR A;  5CYY A;  2WQ8 A;  4P08 A;  5JXJ A;  4M4R A;  5HXM A;  4DEQ A;  3CKH A;  4M4P A;  2XON A;  2ZEZ A;  2VQU A;  2VOT A;  2DCJ A;  1UMH A;  1JZ2 A;  2WUH A;  4E8D A;  1TG7 A;  2BZD A;  2W47 A;  4PT6 A;  4XUR A;  3WEZ A;  5IFT A;  1LNS A;  2Y6H A;  1O8P A;  1OF3 A;  2JE8 A;  3MUY 1;  3ETP A;  5LA0 A;  4QAW A;  4JKK A;  3A21 A;  4QDR A;  2WAO A;  1BHG A;  4W4Z A;  3LPG A;  1JYV A;  5DN2 A;  2VQT A;  3ECQ A;  4BXS V;  2YB7 A;  3MV0 1;  1F4A A;  3A23 A;  4OYU A;  3WNN A;  3SEP A;  1JHJ A;  4JX0 A;  2W1Q A;  2VJX A;  2W95 A;  3E1F 1;  1W0N A;  4QB2 A;  2VMD A;  2RV9 A;  2ZEW A;  5IJR A;  2E31 A;  3NQH A;  2YFZ A;  4CUA A;  2ZXQ A;  1JI6 A;  5A1A A;  3FN9 A;  4A6O A;  4QB6 A;  4A45 A;  1JYW A;  2VM9 A;  1T2X A;  1JYX A;  2Y6K A;  5DMY A;  5G04 L;  1D7P M;  4JKL A;  3I2J A;  2BBA A;  1SG3 A;  2WN3 A;  3ACG A;  3UET A;  2W91 A;  2J1E A;  2HYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...