2VZQA

C-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa in complex with digalacturonic acid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 23
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzqA00
5JXHA 2J1AA 1L7QA 5JMOA 1W8OA 2W47A 3ACHA 2BGPA 3DYMA 1T2XA 1J83A 3C7EA 3K4AA 3K75B 3A23A 3LEGA 2Y6GA 2QQOA 4QDSA 2QQKA 4MGSA 4MO3M 3EYPA 3HJRA 2W95A 4OYUA 5IFPA 4LPLA 1F4HA 1W0NA 2VZPA 4MGQA 5EJ1B 1WKYA 5EIYB 5I0DA 3WNMA 4DXTA 2ORZA 3LQCA 2EIDA 1JI6A 2J1SA 3OEAA 4ZZ5A 3I2FA 4QX0A 3LE0A 3DYPA 4CU8A 1O8SA 5JXIA 1MPXA 3GM8A 2W3JA 4E8CA 4RN5A 4BK4A 2XQXA 4BXSV 4KI5M 4P5YA 3K4DA 4W50A 1HN1A 2WDBA 4GWIA 4OMCA 3VD7A 4D8MA 4QX2A 5IYYA 3HOBA 2VZ1A 1P8JA 2ZEXA 4BDVB 5LA1A 1KEXA 1GNYA 2Y8KA 2E32A 3D3AA 1EUTA 3C8XA 2W46A 3VD5A 2VJXA 1DLCA 1JYVA 2XOMA 4RYDA 2VZ3A 2WO2A 4JKKA 3WF3A 3CKHA 4DXSA 3BN6A 5FUIA 4QPWA 1LNSA 3I2GA 1JHJA 1NUKA 2VQTA 3LEKA 4YPJA 5DQ0A 5F7UA 4PT6A 5IHRA 2DDUA 1OH4A 3SKVA 2V5DA 3T09A 1US2A 5HXMA 1NAEA 4LQRA 2J1UA 4UOJA 3E1F1 4BK5A 2QQMA 5B4XA 4Z2AA 1JZ5A 4XUTA 2Y6HA 4XUPA 2C26A 3IDAA 2J1TA 3SKJE 3ACIA 2E26A 2VC9A 1K42A 3SEEA 4BJ0A 4KMQA 3WF1A 5G04L 1XC6A 3FN9A 3I2HA 3THDA 3T2OA 3ABZA 2J7MA 1PX4A 1CX1A 2LS6A 3W5NA 3GGLA 3C7HA 3HPNA 4A44A 5DN2A 2BZDA 4A45A 1PMHX 3OB8A 2QQIA 2J22A 1OF3A 1UY3A 2J1RA 1W9SA 3NJVA 1IQDC 2L9LA 3GXUA 1OF4A 4MOAA 3OBAA 4P00B 2JE8A 2QQLA 1JZ7A 2WAOA 1CZSA 2WZ8A 5LA2A 3AC0A 5C70A 1SG3A 4UAPA 4ZZ8A 1EUUA 2YB7A 4GZ9A 2YC2A 3T08A 2W92A 1UZ0A 1XNAA 2VMEA 1UY2A 3NQHA 3UNPA 3UESA 3WQBA 2XHNA 2ZEZA 2JDAA 2C4XA 4XUQA 2VCBA 4KWUA 1UXXX 3T0AA 3FHQA 2B9VA 3FHAA 4D0QA 2WYSA 1JZ8A 3VDCA 3LPGA 2VZOA 1O59A 2Y6LA 3LEIA 4XUOA 3WNOA 4AAXA 3A21A 2VMFA 1SHWB 2W1UA 1UX7A 4JX0A 3CIHA 3PUHA 2VOTA 2WBKA 3C7GA 3HNBM 3THCA 3I2JA 3VD4A 3I2KA 2W94A 4OMDA 3EB7A 3IAPA 1UMHA 2JKXA 2YG0A 4IUGA 3T2QA 5JUVA 2WQ8A 3HNMA 1W9TA 2QBXA 4HG6B 1W8NA 4LKSA 2EICA 4MADA 3I3EA 2ID4A 2CDPA 3BGAA 3CQOA 3U37A 1J84A 1GU3A 3CZUA 1JYNA 5JR2A 2ZEYA 1W99A 2W87A 4A42A 1PX3A 1K3IA 1UXZA 3LPFA 4W8JA 3NJXA 3I3BA 4JKMA 4ARXA 2VMDA 1TVGA 1XPWA 3MV11 3VD9A 2WO1A 2XONA 3K4ZA 3ACFA 3OGSA 1JYXA 2W9XA 2X09A 2DCKA 4CVUA 1OD3A 4CU9A 1RYYA 4ZXEA 2RV9A 2WABA 5C7GA 1GQPA 4DUWA 2WAAA 2ZXQA 5DMYA 5EJZB 4DEVA 3DYOA 3HN3A 2E33A 1UY4A 2W1SA 3I97A 2V72A 2EIBA 3ETPA 5C71A 3CZJA 4JKLA 2VR4A 5JXGA 4ZY9A 1UWWA 2HLEA 2VCCA 3VDBA 3A7QA 2ZEWA 2BBAA 3HEIA 4JHZA 5IFTA 2J1VA 2RJ2A 5LA0A 2VCAA 2WN3A 1K12A 1JU3A 2RVAA 4DUVA 1D7PM 5J1XA 3VD3A 4M4PA 4A3ZA 1UY1A 1K45A 3OGRA 2W1QA 1O8PA 1H6XA 3WNPA 4P08A 1GOFA 1JU4A 1GUIA 4A4AA 3UETA 3P1IA 2VM9A 1UYXA 3OGVA 5IJRA 4QDQA 2JD9A 1JZ6A 3T0BA 3NNGA 2VZVA 1L7RA 3ZM8A 4AG4A 1UY0A 2WO3A 3IB3A 3T0DA 4PQQA 3I3DA 4DUXA 3IIIA 1KGYA 4XURA 3WNNA 1ULPA 3K46A 5A1AA 1OT5A 2R7EB 4A6OA 4PF1A 4QX3A 2B4KA 2EIEA 3WF2A 4CUBA 1SDDB 4ET7A 3WF0A 3W5MA 2BGOA 3OG2A 4L0PA 1GOHA 5JXJA 3SEPA 1ULOA 2WZEA 4A41A 3DECA 2BERA 3MUY1 4QX1A 2KD7A 3WEZA 2LW8A 4TTGA 2V4VA 4OZOA 1NKGA 2VO5A 2HYXA 1R64A 1TG7A 3IAQA 1JZ4A 1I5PA 4CU7A 1NX9A 3MO4A 5CZKA 3OEBA 2DCJA 4FI9A 2QQJA 4CU6A 2E31A 3GDBA 2VTFA 2OKXA 4UI9L 3MBWA 5LCWL 4ARYA 1XNTA 3WF4A 3WNLA 2CDOA 2QQNA 5B4NA 5G05L 2X10A 4CUCA 4QDRA 2VQUA 2Y64A 2Y6KA 3CMGA 4GWJA 4QB2A 3T2PA 4M4RA 1UYZA 1PMJX 2C9KA 4XZUG 3ECQA 4QB6A 1YQ2A 5HPOA 5DPNA 4DXRA 2YC4A 3P6BA 2YFZA 3HNYM 1UMIA 1JYWA 1CZVA 3NRUA 3CDZB 3ACGA 4XVHA 2W91A 2J1EA 4DEQA 2WN2A 2VZRA 4QB1A 4QAWA 4E8DA 3WSOA 1US3A 2ORXA 2WUHA 1BHGA 2Y6JA 3C7OA 3J7HA 1H6YA 4W4ZA 3WNKA 1UYYA 1DP0A 4OUEA 4TXWA 1CZTA 1GMMA 4CUAA 2VL4A 1GOGA 3PUIA 3A22A 2VZSA 3VDAA 3F2ZA 1JZ2A 1F4AA 3MV01 2VZTA 4XUNA 1W9WA 1CIYA 2VZUA 2X05A 2YFUA 5CYYA 3FL7A 3K77A 2VMCA 2Z4FA 4P02B 1DYOA 3I2IA 2W1WA 1WCQA 2W5FA 2VZQA 3MUZ1 3C7FA 3JXSA 4LHSA 1JZ3A 2PQSA
chains in the Genus database with same CATH superfamily
2TEPA 4XABA 2YV8A 1L7QA 4TYSA 3E6DA 3J8F2 3D6EA 1W8OA 2BW8A 3VBHC 1W9YA 4GD4A 1ND2C 1T2XA 1YRZA 1A8DA 1BVP1 3K75B 1LU1A 2GN7A 1XE7A 2FCVA 4QQLA 1UIJA 2QQOA 2Y6GA 4OHWA 3NKGA 2XPJA 4FOYA 2RDRA 4MGSA 1D0GA 4B1MA 3PU8A 4Z1VA 3JQXA 3WW2A 2LROA 3IPVB 1Z0HA 3IPVA 3M3EA 2Q1MA 1WW7A 2ZX2A 1FV2A 4LPLA 2DCZA 4XJAA 3N9QA 2WZPP 3I3MA 4Q29A 3AP7A 4ES8A 2VW0A 2RS53 4C91A 1BK0A 4QXCA 1SBEA 2SBAA 5FYYA 4MGQA 5FR3A 5EJ1B 5EIYB 3GJBA 3P5BA 1Q8PA 3MFAA 5FMDA 3HD8B 1JI6A 2VULA 4FPOB 4AEDB 4HSLA 2JECA 3IM0A 4AEDA 1W8HA 1NZCA 2ZACA 4FCAA 5FXWA 3ZXGA 1S1AA 3OEAA 3I2FA 3ZYIB 2PQQA 1LEMA 4XXAA 4CU8A 1V6LA 1O8SA 2OUHA 5FLJA 5FZKA 2D6MA 2E7TA 5FDBA 3N9MA 1GNHA 2ZGPA 4CPBA 2MEV3 3O12A 2R0FA 3TN91 5ABJC 2I07B 3MIGA 1OH3A 3GHMA 4A3XA 4OI4A 1W9FA 4Q4Y3 2PXJA 3AMQA 1VBB3 1W8UA 2HWD2 3M3IA 2EA7A 2GZWA 3H1WA 4GWIA 1FMD2 2V5YA 5DUWA 3KSCA 4E9KA 2D44A 2WLPA 4S2DA 2CV6A 1AR91 5IUQA 4D8MA 5JLVA 4IEZA 5IYYA 2FZ2A 3A4UA 3WDTA 4F7ZA 3MIDA 5HI0A 3IIAA 2VZ1A 5FYMA 3AVSA 1CGPA 3RI8A 5FRAA 1KEXA 4GKYA 3I4IA 3ZX7A 2E32A 4L9BA 1WCUA 3POFA 4IXLA 1EUTA 3C8XA 3OUIA 4FFHA 4XCAA 4WM7C 4W6XA 4YGEA 4IL7A 1DLCA 2LUWA 3IMNA 3NAPB 3NAPA 4L97A 2QZ3A 2ZABA 3BU0A 2VUDA 3ZSKA 1OVSA 4E2GA 4M3CB 4M3CA 4FOVA 1RUD2 4AW7A 3MZHA 2O1QA 2VG9A 5E89A 3SHRA 3WF3A 1WZXA 1JYIA 3CKHA 4JTNA 5C3RA 1JXNA 4XBQA 1OQ1A 3BTXA 1QJY3 2WZR3 3WG1A 4R4ZA 4YPJA 1AJKA 2BJSA 4ISQA 4QXBA 4XDQA 5F7UA 1W03A 5FCCA 1AX0A 2DDUA 5I0SA 3ZYHA 4QXKA 3BPSA 4M0NA 3SKVA 3H7JA 4FPLA 1A8MA 3VHRA 5HXMA 3A0NA 1WLCA 2NPIA 1NCRC 1LOCA 1QMJA 3BI3A 4XUTA 4XUPA 2C26A 3P3NA 1OA4A 2XDVA 1AR71 4LBQD 3VZNA 1POV3 4E4SA 4PLOA 4YNIA 1DZTA 2JE9A 2E26A 2QCSB 3WD5A 3SEEA 4BJ0A 3WUCA 4OUSA 3AP6A 4KMQA 5L9BA 2Q8EA 2FDGA 2GNMA 2NQYA 4CP9B 4CP9A 3I2HA 3AFKA 5FZCA 1FPN1 3NV1A 1OKQA 4LK6A 3KT4A 1CX1A 5FUPA 2VE1A 4ASMB 3USUB 3USUA 4BQ5A 4A44A 2VXRA 2BZDA 5DN2A 3E5XA 4I3GA 4XF0A 2HBUA 4P5HA 1GSLA 1U12A 5CNAA 3T3YA 2RHPA 4AFAA 4Y4RA 3POJA 1IQDC 2WT0A 1RJ8A 1CR7A 1APNA 1UN1A 4E4DX 2B9UA 3PVEA 4P00B 4Y1YA 4YZ4A 2JE8A 3RJ2X 4DY5A 4D7SA 3HN1A 4Z07A 2GSYA 3TN92 2WNUC 4BISA 1CZSA 4CP0A 5F3CA 4IE0A 5LA2A 5A7PA 1HXS1 2RS12 3DKQA 4KU8A 1SG3A 4ZZ8A 1EUUA 1Z7S1 1YWKA 4N8MA 4HLTA 3PJQA 4O61A 3KLSA 5GKAC 5IVYA 2DYCA 4XDPA 1FV3A 4FOWA 4XETA 5LBCA 1DHKB 4ATFA 5FMBA 1IGOA 3UNPA 4NPMA 4TLGA 2OPKA 5L7OB 2IXJA 5L7OA 1SLLA 2ZEZA 2JDAA 3KV6A 3Q8CA 4XUQA 3KQ4B 5JOYA 1CAVB 2IVIB 1CAVA 2VCBA 2B45X 2HWF3 4AE2A 5FMCA 1UXXX 1GFF2 5KHIA 1XSQA 5GJ6A 2B42B 3VBUC 5A7WB 5FZ1A 5A7WA 1VBE1 1OLMA 3FLTA 3VN4A 2WYSA 2XL9A 2P3IA 3HR9A 3DUIA 3C2UA 5IW0A 1ZBA1 1YJLA 2WWSA 3V56A 3VDCA 2KM2A 2SLIA 2Y6LA 4FQ4A 4ORFA 3ACLA 4AAXA 5GLTA 5A32B 5A32A 4HT1T 1JH5A 4MSVA 3WP4A 3OSDA 5EPAA 2XBO3 3MEPA 4R9DA 3I2JA 2PHUA 2VUCA 1SFPA 2BRTA 4NRPA 2P6HA 4LIVA 3RJRA 4CP2A 5ISLA 1MS9A 1DGLA 4N9HA 1NQDA 2BFUL 3LSDA 1C8M1 1DGRA 1Q8QA 3OTFA 5JUVA 1UOFA 4JC1A 5FBZA 2OVUA 4AFMA 5E1RA 4HG6B 5F5CA 2LM3A 4LKSA 2PTMA 1UD1A 1NY72 2QUOA 1Q3EA 4MADA 3I3EA 1OA3A 1JYCA 3AL5A 2ID4A 3NL1A 4Q4V1 1MVQA 1J84A 1CAXB 1PNFA 1CAXA 4AQSA 2HJIA 3V0AB 3S5AA 3V0AA 5FO8B 2E53A 1FPN2 1MQTB 1MQTA 1TMF3 4LNVA 2WL1A 1QJEA 4YGDA 4LA2A 2D3SA 1OPOA 1VRBA 1W99A 1U0AA 3O0VA 5FYHA 3URFA 2E63A 5J7MA 3OGJA 4IEVA 3THTA 1SLBA 1PX3A 1UAIA 2IXCA 4W8JA 3I3BA 3M3QA 5D8AA 4IE6A 4HETA 5D8AB 1ZA7A 5I0UA 2QQUA 4K3UA 3I54A 3RZLA 1QJU1 1BCXA 4M0HA 1IG3A 5FZ3A 3H8XA 4RHV3 2A3YA 3NNFA 3SH3A 3CO2A 4GA9A 4BB3A 4ZHNA 4AQ2A 2C9AA 3POYA 4LHNA 2GMMA 3KGLA 4Q4W1 3RI9A 2NLRA 4XTPA 4XAEA 1LU2A 1MEC1 1UNBA 1MZEA 1V00A 4NHMA 4O9GA 5A3NA 1Z7S2 2IXLA 1OD3A 3GHNA 4EWAA 4HVRA 1U5YA 4CU9A 5IATA 1WMFA 1AXKA 2WA4A 2ZZQA 1S4CA 1HQLA 1WBFA 2JDUA 3H3UA 4FFGA 2I74A 3PUSA 2DVGA 4GMP0 4KBBA 2WAAA 4LORA 2ZXQA 1G8WA 3TOJA 1D4M3 4WZCA 4DEVA 4CCNA 3HN3A 2ZOEB 2E33A 5CIRA 3I97A 4AI9A 4CDQC 1RUC3 2EIBA 3ETPA 3OOXA 3W9AA 4LT5A 4OQ8A 1ND3B 1ND3A 2BOIA 4ZS3A 4AOCA 1UWWA 4JZRA 1FNYA 5FTTC 5JIUA 1EV13 2B8MA 3VDDB 3VDDA 3A7QA 5JSPA 2ZEWA 4JRAA 5JAXA 3ZXKA 2WN3A 3BOWA 1JU3A 4DUVA 5FZOB 5A6QA 5FZOA 5JOZA 1D7PM 1RVF3 1X82A 1PIV3 2UWCA 5J1XA 5IK8A 1UY1A 1AL23 3LB9A 4UFJA 3ME2A 3ZKYA 3LF7A 4YGCA 1JW6A 1NA1B 1NA1A 5FP3A 4MGTA 3AXEA 1LKNA 3R0RA 3UL2A 2VM9A 4JHTA 1H0BA 3H0OA 1JZ6A 2JD9A 3POIA 1VBA1 3SH4A 1R092 2UWAA 4HK9A 5LK5A 1W6MB 2VVDA 1W6MA 3RNSA 3ALQA 1AF9A 3MLJA 1CVNA 1IKPA 5LB6A 1L7RA 5LBBA 1D4VB 3T0DA 3IB3A 3ZXFA 5JCTA 5AC93 1YQ6A 1TEIA 3IIIA 1PO23 2BTVC 1QJX2 4TLFA 1HDKA 3WNNA 3RS6A 2X5IB 1CJDA 1W05A 2X5IA 4Q4V2 1OT5A 4A6OA 1GR3A 4OVEA 2ZGOA 3M2MA 3JD71 2P5BA 2RM23 3OUHA 4PF1A 3KHCA 3MF9A 4QQ2A 1J1TA 2YU1A 5GLVA 3O1PA 2JG8C 5DG1A 5EQUA 3WF2A 4N53C 1J3RA 3U4SA 1TZOA 3Q8BA 1HIXA 4Q4X1 5FLHA 2X53S 2JENA 2YU2A 3IWZA 3PTRB 5GM0A 1OSGA 2ET7A 2JKBA 2UYAA 3PUAA 3L2YA 2D3RA 4IEWA 1UZYA 4XC9A 3WR0A 2I45A 1GOHA 1CESA 4Y20B 4Y20A 4S2FA 3SEPA 1ULOA 2RR13 2WZEA 3B00A 1QJU2 1UL9A 3J7LA 4I01A 5H9RA 1LTEA 2BERA 3LA2A 3MUY1 4NHLA 4PLMA 1LOAA 5DUUA 1ZBE3 3KM5A 1RUI1 4CRQA 3VKFC 4H55A 5BPXA 4ONUA 1UCXA 2LW8A 4TTGA 4IV3B 4CCLA 1EAH3 4IV3A 4FPGA 3T4HB 1DYPA 3I7DA 1YYNA 2VO5A 4P9GA 4AQTA 2YUEA 2XLGA 5LASA 4DPNA 1JZ4A 4XQ4A 2DF7A 4CU7A 1NX9A 4LBNA 4DIQA 2XLFA 3HQUA 4ASKA 1IS3A 3POEA 1AX1A 2WFF2 4DQAA 4DZGA 1MS4A 1JOPA 1VRH1 4FI9A 4MG2A 4JGYC 3T30A 3DCQA 2HKXA 4RS5C 4CCJA 1YFXA 4ARYA 5FY0A 1QWRA 4P9XA 5APAA 3WF4A 5BY5A 2NZ9A 3PL0A 1FNZA 1SACA 4SBVA 4MVTA 3WP5A 1BVVA 2OW4A 2P1BA 1RHI3 2WQ4A 3ZXDA 3ZYRA 1LR5A 4K20A 4AI3A 1DGWA 1AUYA 1QJZA 4QB2A 3ILNA 3ZR5A 3H8RA 2QQVA 1F5JA 2IFWA 4KBZA 2WT2A 1R1A1 4XZUG 3ECQA 1UOJA 4G9SB 5T55A 1GANA 1NT0A 5DPNA 5LEJA 1DIWA 3UGHA 5LK7B 1SCSA 2WLQA 2YC4A 1ULGA 3HNYM 2RDNA 4YZ3A 5KHHA 3R6SA 3VBRB 3VBRA 1LGNA 3NRUA 3ACGA 5CG9A 3ZIXA 4CCOA 1HRV1 1RGSA 3CLPA 3UGFA 2GNDA 4YG0A 4XBNA 2O0OA 4D7YA 2BV4A 4Y1XA 1BXHA 2R071 2VZRA 2UYBA 4QAWA 5FZAA 1BBT2 1VBA2 3FLPA 1ASJ1 4V1PA 4QX7A 5EHDA 5DUXA 5T52A 3PVOA 4HZFA 3Q8FA 5FREA 4OZXA 5A7NA 3VBHB 3VBHA 4PJYA 1Z78A 3RSJA 1ND2B 2Y33A 1I9RA 1ND2A 4E4HA 5JZGC 2XJTA 4ZU5A 4CEYC 3OPTA 2PLV1 2YC0A 1UPIA 1X9PA 3FWEA 1DGWX 4R8HA 4ZXKA 5CADA 1PGW1 3VL9A 1IZ3A 2EXIA 1W28A 2JIJA 2XKPA 4YW3A 1JZ2A 5J09A 3VKNA 1XJAA 3AL6A 2GMEA 3AMMA 3LA7A 5ERLA 5GZCA 4XUNA 2BFUS 2IVJA 3LIHA 5T50A 2ZX3A 1PGL1 3AX4A 4YM1A 4BHPA 1MVEA 5F5IA 1ZRIA 4ZS2A 4GMP3 2VUAA 1FXZA 2VNGA 1URXA 4IV1C 4PLNA 4PQ9A 4I02A 3S0MA 1DYOA 3QCWA 1AR83 4CTEA 1DDLA 2W5FA 5FJHA 4BLJA 1ZREA 2VZQA 2JDYA 5I0TA 4AI1A 2W2IA 3RGBA 5A3TA 4CDXC 3RMYA 2JICA 2HEYF 5ABJB 5GLUA 5ABJA 3CBNA 4I09A 2XHKA 3WW3A 2GP3A 2PQSA 4XMAA 3KS7A 4PCRA 5JXHA 4IERA 2D5HA 2IXKA 2N7GA 5DZFA 5FOJB 2W47A 2ZGTA 3ACHA 3OPWA 4X6RB 2Q8DA 4NPRA 3BTZA 3K4AA 4CUGA 5T5OA 2ADDA 1VRH2 1UU6A 3A23A 2HWC1 3D8CA 3JZVA 4O9EA 1HQWA 4QDSA 4XTMA 1GP5A 3KCYA 4MO3M 4MGKE 1LOBA 5DDJ1 4Q8LA 1RMU1 4FPEA 3HJRA 3PDQA 1AZDA 3CNAA 1F4HA 4QX5A 3QOPA 2QJVA 1HRI3 2WR9A 4BWOA 4FTSA 4K8FA 3ROUA 3QD6A 4WM7B 3M1HA 4WM7A 4E8DA 4WZFA 5I0DA 1VMFA 2YMZA 3DXTA 1QDOA 3LQCA 4NAOA 4V2VA 5A6YA 2VW1A 1SFYA 1ZZ9A 5F39A 1V9U1 3U07A 1R1A2 1FOD3 1H8VA 3NV2A 1EPZA 4COVA 4ZZ5A 5KHGA 4LXLA 2WSUA 4JV4A 4N7UA 1RXFA 2JJ6A 4H7LA 5JXIA 1MPXA 2ZHMA 3AM2A 3GM8A 4GAZA 4CDWC 3KV9A 4E8CA 4RN5A 2R042 1HRV2 3DF0A 1AYN2 3M4FA 4E2SA 1G9BA 3U4XA 1GP4A 1QQP3 4BK4A 4BXSV 3ON7A 4JQRA 2RMU2 1ULEA 4W50A 3LWCA 1WBLA 2XJPA 5IK5A 4LBQB 3HWJA 4LBQA 3D82A 3ZYPA 1GZWB 1GZWA 3IT8A 4YW6A 1RUJ3 4BIFA 4OMCA 1O4ZA 1IHMA 2ZX4A 3GBWA 1N1VA 4KQ7A 1PO11 1BKZA 5FK8A 1GYKA 1G86A 3MIHA 1LOGA 1TME1 2WT1A 4JDMA 1W6NB 2C6SA 1W6NA 3D4KA 4I0WB 4LEJA 4QGMA 4ZKTB 5B2GB 3EMRA 4Y1ZA 3VLBB 5LA1A 2Y8KA 2CU5A 2LALA 1PGW2 3SXWA 3J8F3 1VBC1 1CX4A 1S0DA 4Y26A 5FYVA 2ZMNA 5FZDA 1N3OA 4HXCA 4YVWB 2XOMA 4IGQA 4YVWA 2P2KA 1QH7A 5K4LA 5IVCA 1J1LA 4MXVA 1PMIA 4INDA 3POGA 5LBEA 4NAMA 3T2TA 5GLWA 4D69A 1BEV2 2DVAA 3NNJA 2VU9A 3LA3A 5FO7B 4OHYA 3VZOA 5FUIA 4QPWA 1OFSA 2DTYA 3EHKA 5A7QA 1H9WA 5KC5A 2YGMA 4LUMA 4Q8KA 3PIJA 4QQHA 1OUXA 1BQPA 5DQ0A 4M3CE 2VQ0A 2XUEA 4PT6A 5FO9B 4XACA 4BMBA 1OH4A 4AGGA 1AR62 2WNUB 2WNUA 2YZ4A 1WA6X 2J1UA 4KL1A 4UOJA 3WHTA 3E1F1 1Q8VA 4R9CA 5FZ7A 5CISA 4BK5A 1NXD1 1W0PA 3ZN6B 4Z2AA 3ZN6A 5FYSA 3OY8B 4ZU4A 3OY8A 4TN7A 5C8WA 3U14A 3AZYA 1WLTA 3BPZA 3I3QA 1F35A 3IDAA 4HPKB 4HPKA 2HWB1 2J1TA 2QQWA 3ACIA 3ATGA 5AVPA 3UKNA 3WVJA 4CYDA 2VC9A 2ZCWA 4IEOA 4FAHA 4FBFA 5KXBA 1DCSA 2HWD3 4D3WA 2EAAA 3NKTA 1FMD3 5FPAA 1DQ6A 1VBD1 3ZYBA 1KDMA 2JDPA 4V2WA 3THDA 1PM7A 1EY2A 3KD4A 3ZN5A 1PX4A 1MS5A 4CCKA 2G9FA 2Y34A 3GGLA 3C7HA 4A7YA 3VBUB 3VBUA 1LODA 1UZVA 3U11A 2Q5TA 5A3OA 5A1LA 3MFCA 4EV0A 1HKDA 1OF3A 1H2MA 1W9SA 2VTXA 3K3NA 1W6PB 4SLIA 1W6PA 1DGRN 3OGGA 4XF3A 5JVVA 4MGZE 1PNGA 3GXUA 3H1MA 2CGOA 3LGRA 2AREA 3ZN4A 4AVSA 3AKPA 1KD7A 2QQLA 1R081 2WAOA 2WZ8A 3AYCA 1RUD3 5IK7A 1JS9A 1Q8SA 2Q8CA 2VNOA 3VBFC 5C70A 2GC2A 2R49A 3O1SA 4GZ9A 4QPIC 4S2GA 4DY3A 5JSRA 1QOTA 1WW4A 3MGUA 5GZGA 1VAMA 1GZTA 1DQ0A 3ILRA 4CP1A 4EROA 1PO12 2V09A 3NQHA 2WIIB 2HYKA 1RUE3 1TE1B 1G9AA 1TME2 4AVAA 3ZDVA 3N3HA 4B29A 2RS51 2OZJA 1TNFA 3AMPA 5JOWA 2B7YA 2KR2A 2ERFA 3NVCA 1XSRA 1G9FA 3J26N 3ZR6A 5HCAA 1LGBA 3WOGA 5K0UC 1ENXA 1Y43B 3OD4A 2Q1FA 4KWUA 2G4IA 2Z79A 3BB6A 1AXYA 1W90A 3X29B 4COWA 2B9VA 4HVOA 3B9CA 1XE0A 4IETA 4L8QA 3WW1A 1ZZ7A 3B9IA 3VBSB 2MEV1 1O59A 3UYJA 1PM4A 3VBSA 1OFNA 2Q1ZB 5FXXA 3U78A 2VMFA 1SHWB 3I2OA 3NJYA 1UX7A 1VBB1 2QTWB 2RS33 4Q26A 5H9QA 2P6CA 5F2SA 1OLME 2VOTA 3CEWA 4BMEA 3THCA 2VBBA 4Y22B 1NOVA 3QACA 4Y22A 1QOOA 2RJKA 4LR4A 1WCSA 1AX2A 5BXXA 2EXJA 5JWPA 4W65A 5C8CC 4I30A 1C28A 3U1XA 3SNMA 4AI2A 2UY9A 2RG4A 4XMIA 4PIZA 5F6LB 2WQ8A 2BYVE 3HNMA 2IXHA 5KXDA 2C0ZA 4Q1RA 3WDYA 4LO4B 4CZSA 3B02A 1PGSA 4Z2WA 2EICA 2RS13 4XFBA 5DG2A 5CEHA 1ZZCA 2JD4A 4GXLA 4D7TA 1GU3A 1VBD2 4CDQB 4CDQA 1XYPA 3LZZA 4TWTA 5KR7A 4QHOA 5DAQA 2Z69A 2AH2A 1JYNA 3OUJA 4I0AA 1S0FA 5FP7A 5FZBA 4ZONA 4CE8A 4AK3A 4UW4A 4NIIA 2Q8OA 1JN2P 1PZ9A 1Q5OA 1ZZBA 1QJY1 5I91A 4QKNA 2WZR1 3E6BA 1H8TB 3NSTA 1H8TA 1K3IA 1UXZA 2P34A 2Q30A 2VOKA 3KVAA 4QGNA 5C3SA 3GZUC 1RUOA 4UXAA 4JKMA 2CSGA 5DAVA 1QXJA 2W52A 1O5UA 3MV11 3VD9A 4D6RA 5FKCA 4CXYA 3J4UH 5FMOL 5C5UA 4XFCA 1R082 1KJLA 3ACFA 3OGSA 3PVBB 1YI7A 1V6IA 2FMDA 3RDIA 2W9XA 4FPJA 5JR7B 1HV1A 1AVBA 2F17A 2P3JA 4L99A 4IW3A 1POV1 5F9TA 4Z82A 2P37A 5HCFA 2KXLA 2K2SA 2Y60A 3TNQA 3BIEA 1D0HA 1RUH1 1GQPA 4DUWA 4UW6A 4A7KA 4Y24A 5C3OA 4ZU7A 1QHDA 4YVWC 2RS52 3M7AA 2V72A 5A6XA 3CZJA 4JKLA 5F8PA 1WMXA 5HV4A 2OQ7A 4ZY9A 5JXGA 4A7ZA 3ZXLA 1S0IA 4EN7B 3BTYA 2XVLA 1UU5A 3AKQA 3ZFGC 1B35C 2JB8A 4K7JA 5EZWA 5EYYA 2BNOA 1KRIA 2JG8B 4R4XA 2JG8A 4N53B 4E2QA 4N53A 4JHZA 2CHHA 2J1VA 2RJ2A 3S30A 5LA0A 3IZOA 2V4AA 3VGIA 1OVPA 2K0GA 3LOBA 2FMYA 3HIFA 1H2KA 3NW4A 1FPN3 1LHUA 4M4PA 3N36A 4Y33A 4A3ZA 4C0HA 5I93A 4BQ2A 5L9VA 2VBDA 1CONA 1H6XA 3WNPA 2XVKA 4P08A 4YW1A 1CIWA 2VH9A 4A4AA 5FP4A 1XYNA 2PN5A 3AZVA 1AR92 1O4TA 3ZFEC 3RYPA 3UJQA 3ES4A 3TEZA 4AEMA 5D2AA 3UGGA 4XXPA 1PVC1 5ANQA 2VZVA 3QH6A 1UOGA 1UY0A 2WO3A 2WINB 3M3CA 3MW2A 1QF3A 4N9IA 5FY5A 1REEA 3I3DA 2HWF1 1JOBA 4XURA 1YEWA 2YPJA 3NNMA 5FY7A 4JGYB 4JGYA 4RS5B 2FDFA 4RS5A 1GZ9A 1QNYA 2QFEA 4L11A 2YBKA 2I2SA 2VECA 5FP9A 2OPWA 2Y6FA 4GJZA 5J98B 2A6YA 2E7AA 5FYUA 4ES9A 4QX3A 3QLQA 4KG8A 5FZIA 4COYA 4OULA 4CUBA 1UF2C 4R9AA 1OC1A 3WXPA 3GALA 4QHBA 1ZA4A 1N1SA 3RYKA 3W5MA 2WO7A 4QKBA 5K8SA 4QKFA 2BGOA 2NYYA 1QJY2 1JUIA 2A1XA 2ZA9A 3OG2A 1ODMA 5D1IA 3W58A 1NE4A 4CEWC 4L0PA 3OJBA 2E51A 5JXJA 3WX5A 1E5IA 3MDPA 1O91A 4AZZA 5JPNB 4URAA 4H3WA 4MHRA 4QX1A 4LE3A 3WEZA 2IUWA 2VPVA 2PHFA 1NKGA 2DFBA 3PJYA 4WVVA 3WCRA 2HYXA 1HB1A 4IEPA 2A73B 1R64A 3LOIA 1TG7A 1AR72 2XVGA 3IAQA 4UBGA 2A5ZA 3ITQA 2F4PA 1S0JA 3TB0A 3MO4A 5CZKA 2A3WA 4LKDA 5E88A 2GH2A 4LKEA 3SQOA 4QU1A 3ZOIA 1VP6A 1X33A 1RUH2 3BTAA 3I59B 3I59A 4P9IA 3B94A 2QQJA 2VTFA 4UI9L 3MBWA 4XFAA 5FKBA 5T5PA 1RUF1 1TMF1 5H9SA 4AF9A 5JZGB 5JZGA 1VIWB 4R52A 4MLOA 2VD7A 5IT6A 4I2OA 4YG6A 2W68A 4CEYB 3AKRA 4CEYA 1R093 1BLZA 1UKGA 4JGZA 4JGZB 1LGCA 3O7OA 3MPPG 4MV2A 4AL9A 5FY8A 3VKMA 4CCMA 2O14A 5IVVA 3VBSC 4QQPA 2PAEA 5LY2A 2X10A 4IE5A 4J25A 4FPKA 1AHSA 1REFA 2Y64A 3SCHA 1DFQA 1QJX3 3ZSLA 5JI9A 3WQ1A 4DO0A 4Q4V3 3HQRA 4RHV1 2D7FA 1YQ2A 2ZTNA 1KITA 4FPFA 4BIOA 4UFMA 3P6BA 5DAPA 2YFZA 1SDWA 2DBIA 4IV1A 4IV1B 1JYWA 1HXS2 2A71A 2W08A 1CZVA 2EXKA 3CDZB 2VBPA 4KWLA 1YXWA 1KFXL 3H9AA 3NNLA 1UPSA 3SLIA 3KMHA 5EJ3A 3F95A 3EQEA 4CDXB 4CDXA 4CDUC 3AKTA 2ARCA 4AR2A 3G6JB 1W6OB 1W6OA 5ANNA 5FY4A 3WSOA 1D4M1 1C8NA 4NO4A 3C7OA 2OIIA 1YO8A 2ATFA 3J7HA 4KGQA 4M00A 1QJU3 1H6YA 4R9BA 1PVC2 4BOWA 1MS1A 1RUC1 3IMMA 4DS0A 4TXWA 1GMMA 4CUAA 2QDNA 2VXJA 4NR1A 1W6QB 2XR4A 1W6QA 2UU8A 4NE9A 5FOBB 2OYZA 3GYDA 1EV11 3FJSA 2VZSA 2R063 2PHDA 3DKWA 4KWKA 2DU0A 3RG0A 2VNVA 3EBRA 4IE7A 4KU7A 4LE4A 4W6YA 2XKOA 3F2ZA 3ZSEA 1VBE2 3KVBA 3MIBA 1H8TC 2X8KA 3RWKX 2K46A 2VMGA 2WFF3 4Z92B 1F4AA 1ZBA2 5A7OA 2VZTA 4B8EA 5K7PA 3TEYA 4NIDA 1RVF1 5KXEA 1PIV1 1DU3D 2ZMKA 1UYPA 1K5JA 4O7XA 3GZTB 1AL21 3MICA 1LESA 2YFUA 5CYYA 1V6KA 5F3IA 1LOEA 5T5LA 2VMCA 3RRDA 2D93A 3O0XA 4EWEA 4WM8C 3I2IA 4YZ5A 1XE8A 3J9SA 5LBFA 4H7MA 4QM8A 3HBKA 4AGRA 4NWVA 2HWE1 2QDRA 2GNTA 4UF0A 4UF0B 4CDWA 4CDWB 1C8M2 3C7FA 3M3OA 3PUQA 2DVDA 1DQ1A 4AVCA 4LHSA 5AVAA 4BQ3A 1JZ3A 3WNMA 1O3RA 4NWWA 1GWLA 1ULCA 5AC91 1CPNA 2J1AA 5JDBA 1PO21 3N9OA 5HCHA 5F3EA 2NN8A 1WLDA 5F5QA 2G9GA 3DYMA 1J83A 1HJGA 5JOXA 3T2OA 2RM21 5J96B 1BMV1 1H4HA 1RUG1 2QQKA 1ZZ8A 1RUF2 1GQGA 4N43C 1ULDA 1VLNA 1TNRA 3HVDA 3BYWA 4QXHA 5FMOS 2CY6A 2W39A 3H50A 1LHVA 1BBT3 3EYPA 3H7YA 4OYUA 1YC61 5IFPA 3H3ZA 5GZDA 3PVNA 4EQVA 5KHKA 5E8AA 1NG0A 2VZPA 1WKYA 4MX3A 3FZ3A 2C1FA 2ORZA 4P9WA 1HQNA 2EIDA 2PHRA 2RR11 2XWJB 1NXMA 4XQDA 2E9QA 1O6UA 1MZ5A 2J1SA 2YROA 3N7KA 3UKVA 4BE3A 1AYM3 4XE9A 3KGZA 2JDZA 1RL3A 1DQ4A 1VMHA 3LE0A 4QX0A 1FAYA 2XJRA 1EAH1 4Q4W2 5FLIA 4YLZA 4MXWB 2BDRA 4MXWA 1HLCA 3B3QE 5FZ0A 4LUKA 1MEC2 1RTVA 2JDMA 3TRSB 2H6CA 1MZFA 3U0ZA 2XQXA 3NWKA 2WFPA 4AYUA 4KI5M 2BVBA 3K4DA 4I3PA 4JAAA 1COV3 1GKBA 1HN1A 1Q43A 1QXPA 2WDBA 2XJQA 4P9JA 5FZHA 5JPMB 1D4M2 4JCKA 4QQOA 3IDEA 5KHJA 2WS93 3D0SA 5FUNA 4B4QA 1PK6C 2P17A 4XHBA 4Y1VA 3VD7A 1I1EA 1RITA 3KF3A 3KV5A 4NVPA 5C9AC 4LA3A 3USSA 2XJVA 3GF6A 3MLLA 3N7MA 4XEZA 3RQ0A 3LAGA 4XFHA 3VZMA 4EE2A 2ZEXA 4LBLA 2XB6C 3AK0A 1RHI1 4HKOA 1IKQA 3VHPA 3VHNA 1CAUB 3R4DB 1CAUA 1G6NA 1YIPA 1GNYA 1OLQA 4P9YA 1HB3A 3ELNA 3AB0A 3H1YA 2YHJA 3AMHA 3PIGA 3O1MA 2R6QA 4A2UA 2JDHA 2W46A 3WQ7A 3N35A 2XGXA 4BU2A 1JYVA 4Q2FA 3FUOA 4RYDA 3I2DA 1LHOA 2AGSA 3V65A 3INAA 4JKKA 4BLIA 5CA6A 1GICA 5FY9A 4W6WA 1SPPB 2PMWB 1SPPA 5LW9A 4RGKA 2ARBA 1X7NA 1H2LA 2HEWF 4BQ4A 5A7SA 2JG9A 1WUVA 1NUKA 4XILA 1VR3A 1OI6A 2HWE2 3DN7A 3ZFFC 1C57A 2BU9A 1V6JA 4GB33 2V5DA 1W2NA 1GNZA 1V0AA 3LIGA 3KCCA 1NAEA 1R1A3 1S55A 3FMGA 4LQRA 3VBFB 4DFSA 5E6HA 2YYOA 3IDCB 3VBFA 1MS3A 2PHTA 2AENA 2QQMA 3UV9A 1PO22 1OXCA 4QPIB 3LCPA 4QPIA 1JZ5A 3WLUA 4XJUA 4JGZC 3HT2A 3POBA 2R043 1HRV3 1AYN3 5GZEA 1W8TA 4FTEA 3JD72 3SKJE 2A7AA 1RUG2 4LIUA 2A70A 1K42A 2RMU3 1RJ7A 3PMEA 2DUQA 5F1RA 2VAUA 3AJZA 4XFIA 3WF1A 4Q4X2 4XBLA 2GMPA 5G04L 1XC6A 2O8QA 4XJZA 5FK7A 5L9RA 1KFUL 4FVVA 3ABZA 1NE6A 2J7MA 4GMP1 2R1BA 5KC6A 2TUNA 5K0UB 3K3OA 4HFSA 2LS6A 5K0UA 2YDEA 2WWJA 3LEMA 1OOPC 2VCMA 3HPNA 2WKKA 2PFWA 4A45A 1O4YA 1PMHX 2D6NA 1PZ7A 3OB8A 2QQIA 4HKLA 4D6SA 2ZHLA 1UY3A 1ENQA 2QVSB 2CAUA 2GP5A 3NJVA 1RUI2 3OD0A 5FZ8A 5CKMA 1O3QA 1UMZA 4MZUA 2FDIA 1OF4A 4DINB 4MOAA 1BK1A 4IQPA 1ST8A 1O3TA 3L9JT 3DPRB 1JZ7A 3DPRA 5A3UA 1MR5A 1WD4A 3PU3A 4HMZA 3HBZA 1BEV3 3UT0A 4UAPA 2FHRA 1QJFA 3ORJA 5LEKA 1RC6A 2YC2A 4RSUA 3VBOC 5C8CB 5C8CA 1ZYBA 4LBJA 5BUVA 1ZRCA 5FYTA 1HB4A 2FCTA 2W92A 2WJSA 1UZ0A 4AFBA 4PF5A 5J3UA 5ACA1 4DOUA 2XG3A 5C6CA 1AR63 5FXVA 4XIKA 1HRI1 2JXAA 2OXBA 4QHZA 5DUVA 1UW8A 4YW7A 5IAVA 3WQBA 1ZZ6A 4FSJA 2C4XA 1IQAA 2RE9A 1LHNA 4EN0A 3RZMA 2YBSA 4Q0PA 3R4SA 1EP0A 1FOD1 2Y0OA 2XJUA 3FHQA 4DB5A 2YY1A 3TAYA 1DF0A 1BJQA 5LZ6A 1A78A 4UT5A 1V6MA 3MLKA 4QMAA 5EXOA 1ZRRA 4BZ4A 3GCXA 3S6PA 2VZOA 2Y26A 1H30A 1SLTA 1QQP1 4XUOA 1AXZA 4E27A 3BODA 3SMHA 4LLOA 5KWRA 5FYCA 2R072 3CIHA 1S2EA 2DFCA 2WBKA 1STMA 3HNBM 1NLQA 3ETQA 1OQEA 3JBG3 4AVVA 1ASJ2 1SEFA 1RUJ1 1PZ8A 4YM3A 5FJKA 5M0TA 1W8FA 3E6CC 2GU9A 2W94A 3EB7A 5FY1A 3J7MA 3ZLIA 5I0RA 3AP4A 4AQ6A 1ODNA 3KB5A 2JKXA 4IUGA 4RL7A 3T4VA 3T2QA 5L19A 4K6BA 2CTVA 4HKWA 4KH9A 3WNXA 1W9TA 2PLV2 4HONA 5DABA 5HCBA 1W8NA 1M4WA 3RMXA 3CL1A 2QE3A 3J8F1 3O1OA 1W2AX 2ZAHA 3VZLA 1WLWA 3GCWA 3R05A 3O14A 2P3KA 4QPYA 3WQ0A 2ET1A 3U37A 1PGL2 3NO8A 3ST7A 4XJWA 2A6XA 1NZIA 3SISA 1I5ZA 1PO13 1OBNA 2B5HA 4Q0VA 1B35B 2A3XA 1B35A 4QPGB 4QPGA 3ZFGA 3ZFGB 5J48A 3HT1A 5A3PA 3MIFA 5FZ4A 3ZXAC 1JTZX 2EIGA 1CN1A 4QT6A 1DLLA 2CYFA 5FQ0B 5FQ0A 4BH9A 5BNNC 3FFQA 3NJXA 4XF9A 2AEYA 2ENRA 3FUQA 2BNNA 4NMIA 4AFCA 2WO1A 2ZPXA 1S0CA 2BUKA 4LHLA 1Y9MA 3K4ZA 1POV0 5E16A 3FHIB 1JYXA 1SLCA 2YGLA 4OI1A 5LWBA 2FBEA 2R30A 1YUDA 3CF6E 1O3SA 4P9LA 1C5IA 4CVUA 3ZXEA 1IPSA 4BPZA 1VB2A 1UZZA 5FP8A 3VUOA 3ZFEB 1UQXA 2HWC2 3ZFEA 1CQ9A 1F5FA 4ZXEA 4G3YC 2WABA 1XBFA 3LFMA 4Y5SA 4YARA 5DDJ2 4NOTA 2OS2A 1RMU2 2D98A 5ACA2 5EJZB 3NJZA 4GIQA 3ZDSA 1O7FA 5C71A 2J42A 3B93A 1QGLA 2VR4A 3FX3A 3HAGA 3S7IA 3APBA 2HLEA 2VCCA 2XXZA 4PI0A 4YW2A 1S0BA 3VDBA 3BKZA 2RDSA 2VGDA 3BALA 3Q8AA 4UYBA 1V9U2 3OBRA 3OF1A 2ZKLA 3TEXA 2JG9C 5CB7A 2VVFA 2IXIA 3NV3A 4UWDA 4AFDA 1CWPA 4XJ8A 1K12A 3Q8EA 2BNMA 2RVAA 4IDZA 5SV8A 4ASLA 3RZKA 4OUMA 4CEWB 4CEWA 1GV9A 1JMUB 1QU0A 1ZX5A 5F6KA 3AJYA 1LAJA 1K45A 3HMYA 1H2NA 2ZGNA 1QH6A 4K21A 4XW3A 1GLHA 3MPBA 3VHOA 1YIFA 1GOFA 1GUIA 3U75A 4FPYA 2FZ1A 1I6XA 3AZXA 1UYXA 2GN3A 3KV4A 3OGVA 5FZMA 2VNRA 5IJRA 4LO5B 4QDQA 1J59A 3T0BA 1RUE1 1U5IA 1SZBA 3WP3A 1AJOA 1LECA 3ZM8A 4AG4A 4OQ9A 1X8EA 5CFDC 4J1WA 1R083 3ZXJA 4YVSC 2GC0A 4DXZA 1VBC2 5EV7A 2EVXA 1DG6A 1ULPA 2HBTA 3K46A 1W06A 4META 2DURA 1OLRA 4Y5TA 3BVCA 5CKQA 4MHUA 2R7EB 1H1MA 2E7QA 1KQRA 3PTYA 4HOOA 1BYHA 4RFT0 2P4EA 1W04A 4N90A 3WUDA 2IWGB 2B4KA 1XB9A 3WG3A 1SDDB 5FV3A 4ET7A 3VL8A 2QKDA 3BOPA 3WF0A 4RFRB 3DXUA 4BM8A 3W59A 4HBNA 4C1WA 2MNGA 1OURA 4Q4Y1 2RS31 4U36A 2DV9A 3DPRC 1C4RA 4B1LA 1H1IA 3NMBA 5FXZA 4AHYA 2ZBJA 1XU1A 5FFOC 3LFIA 1WWYA 4WBBA 5CKNA 4PDWB 4KGGA 4PDWA 4O65A 1L7LA 2EF6A 4H14A 2KD7A 3WZ1A 4AVTA 2PELA 3JQWA 1C5HA 2V4VA 1F15A 3E5QA 5EWSA 1CPMA 3THPA 2F6BA 5F3GA 4CDUB 3AKSA 1OUSA 4CDUA 3TN93 1BZWA 2HWB2 4COZA 4JDNA 2RS11 1S0GA 2FQPA 4GJYA 3ZIWA 5IWFA 1FX5A 1ZVFA 4X8PA 1Y9GA 2DCYA 1W39A 3VZKA 2Q4SA 4NIHA 1AR93 4YW5A 4K8RB 3S7EA 1XNTA 3WG2A 3ZKUA 1U5ZA 1DYKA 2G1MA 2VVEA 5DAWA 5F37A 3WNLA 3ZPYA 5B4NA 2FCUA 2JB4A 1NYWA 2ARXA 4CUCA 3VKOA 2XUMA 1ALYA 2ETEA 4Y5Z0 4GWJA 2VW2A 3LDRA 4M4RA 4OLLA 1Q8OA 1PMJX 2C9KA 4URTA 3GNEA 5GLZA 4WVZA 4XZPA 4K1YA 4Q0QA 5FZEA 3B69A 3RZHA 4JRLA 4AI8A 1UMIA 1VMJA 4OFGA 1S2BA 4OHXA 4YFWA 2AC1A 2RDQA 2WQZC 1T6GC 3M70A 4WM8A 4WM8B 1PVXA 4XVHA 5L73A 4TZDA 5A3LA 1QOSA 2AEZA 1YLLA 2H6BA 4DEQA 2WN2A 4NIAA 3AZWA 5FZFA 4PIXA 5CVRA 5KBFA 3BUCA 1US3A 2ORXA 3WCSA 1YQ8A 2WUHA 1Y4WA 1BHGA 1RUE2 2Y6JA 4NRQA 4YM0A 5IVFA 1XQNA 2FDHA 1D2QA 2Z2SB 1I3HA 1DP0A 1HW5A 1UYYA 4S2HA 1CZTA 2QZ2A 2DTWA 3WNKA 2VL4A 1E5RA 3SC7X 4PHZA 3A22A 4YSFA 2OA2A 1IOAA 4QPGC 4Y1UA 5FPVA 2PHWA 4CA9A 1YQ5A 1XXNA 2MPFA 3W20A 4AI0A 1AR73 4N43B 3VDAA 3KWVA 4N43A 3TWIA 3ZPOA 1K5MC 1NY71 3ZYGA 1OKOA 1B09A 3Q9OA 2ZX0A 1SFNA 2JDKA 2R0HA 5FPBA 1RB8G 1DQ5A 1RUH3 3AP5A 3KT1A 5F32A 4QGLA 5J37A 3DV8A 2MEV2 2F4LA 5T54A 1DZQA 1W9WA 3FFZA 2LTNA 3B7MA 1CIYA 4Q4Y2 4FT8A 2D6LX 1VBB2 2RS32 2VQAA 5DZEA 3KQRA 3FL7A 3PNAA 2Z4FA 4P02B 2D43A 1S2KA 4GULA 1ZNPA 1WCQA 3S5QA 1NQJA 1L3JA 4NHKA 5IVJA 3I49A 3MUZ1 1ENRA 4I0BA 3L2HA 4ITCA 2FDKA 4K9SA 4B4PA 5I8YA 5FYZA 1F9KA 1CD3G 4YM2A 2NMOA 4AHZA 1LJ7A 2ZX1A 4FP2A 2AR6A 3EO6A 3MW4A 4IE4A 2VTXJ 2JIGA 5FZ6A 5CFCC 5JMOA 1HXS3 1YJKA 3AMNA 3IDBB 2BGPA 2EALA 2Q0AA 1A6CA 1PK6B 2ZGQA 1PK6A 2WNVC 3AP9A 1NLRA 1Z7S3 3C7EA 5FIXA 5FYBA 4B3NA 4XFFA 2FD8A 1YFUA 2GH8A 3LEGA 4PIYA 5C9AB 2BQPA 5C9AA 5J36A 2PHXA 2UURA 2ILMA 1JBCA 4RQPC 3FBYA 4ISRA 2ZJCA 1Q56A 1J3PA 2W95A 4K40A 2E6VA 4WVMB 1ZRDA 4WVMA 3AYEA 1FT9A 2JE7A 3K2OA 1W0NA 3SH5A 1E5SA 1PVC3 1YCIA 4XF1A 2WZR2 1WMDA 2XBO1 5FYIA 4GALA 4DXTA 2ZAAA 4LJHA 1YQCA 4UFHA 1WCKA 4FXKB 3IN9A 3ZYJB 2Z5WA 2BBVA 1KDKA 2CAVA 3V64A 3RYRA 2XLAA 4C90A 4FP3A 1RUNA 3N7LA 5JSOA 5GALA 1HB2A 2ZS6B 2NM1A 4EYUA 1VBE3 1XNCA 3DYPA 1PHMA 5GZFA 3WT3A 4F83A 2ZMLA 1LOFC 2W3JA 1ZBA3 4RGAA 4CXWA 2DUOA 3KZ4C 1HN0A 4AWDA 3ZFFB 4B7EA 1J58A 3ZFFA 4P5YA 3AYAA 4L2NA 5T3NA 4NROA 2OUJA 3ES1A 4CCEA 4DRRA 3FLRA 1WW6A 1XNDA 5A3WA 2QQPA 3N9PA 4CCCA 4IEQA 4F3JA 3OCPA 1H1AA 5FBJA 3CJXA 4QX2A 1JYTA 1F31A 3M8LA 4FXGB 1SMVA 3RVHA 1R091 3G7DA 3HOBA 1C8M3 1P8JA 4BDVB 1OHFA 5IVEA 1FATA 2A6ZA 2GALA 3D3AA 1UX6A 3MHZA 4UW3A 2WRAA 1QJX1 2CL2A 4YYOA 2PHLA 3UKTA 4A6SA 1DBNA 1N3PA 2VJXA 5FZLA 5H9PA 5C4WA 3VD5A 2CNAA 4H2AA 1IG0A 4NPLA 4QD2A 5C4WB 4AEDC 2VZ3A 4QU2A 5AFBA 4PDWC 1C1FA 4J1XA 2ZGKA 1HX6A 1RUF3 2WO2A 1RIRA 4HN1A 3T1MA 1OOPB 5HBAA 1OOPA 3A0KA 3E97A 4BQXA 2WWUA 2ZHKA 4DXSA 3OPZA 3BN6A 3E5UA 4CSWA 4FFIA 1LNSA 1SLAA 3I2GA 2EXHA 1JHJA 4RGGA 2VQTA 3LEKA 3S57A 3N4MA 4KG0A 4NUBA 4EZHA 4BA6A 1LHWA 5A6ZA 5IHRA 1XYOA 3PMSA 3JUUA 5CG8A 3T09A 1N3QA 3VKLA 1US2A 2Y0IA 3WY6A 4CPBD 5JMCA 1W0OA 3O5SA 1SLIA 2PAKA 1IS6A 5B4XA 1A34A 4Q4W3 1S0EA 1ZM1A 2HWF2 3VBOB 3VBOA 2R061 2G9ZA 2BEOA 3CJIB 5KXCA 3CJIA 2Y38A 2Y6HA 1MEC3 3JB4C 4XIOA 2XMLA 1G9DA 2K9ZA 1YI9A 2WYFA 1IPJA 4RA0A 1ONAA 2BOJA 5I8SA 3O1VA 2P3YA 4COUA 4PI2A 2WFF1 2GC1A 3KT7A 1WMEA 3N9LA 2BWAA 3FN9A 4BYYA 2CGNA 2OZ6A 4EN9B 2ZGSA 3NAPC 2D3PA 3LSEA 1D2SA 1HV0A 4X8NA 5HXVA 3ENRA 2D6KA 1RXGA 2XBO2 4JDOA 2CWMA 4BQ1A 3W5NA 2BPA2 2QNKA 5A70A 4HK8A 2WSVA 2BWCA 3KCXA 4OHZA 4MGIE 3ZSJA 1QKQA 2HEVF 3IBMA 3GJAA 2J22A 1LCLA 2J1RA 4ZPIA 4EN6B 1A3KA 1XU2A 1QEXA 1WGPA 2L9LA 3LDKA 2OQ6A 5BNPA 5BNPB 1ENSA 3VV1A 3CU7A 1O5LA 5A80A 3K48A 4B7KA 4E4ZA 4WV8A 3TYJA 3OBAA 4DRVA 5LY1A 4IESA 4XAAA 3CHXA 1MS0A 5IK4A 3NV4A 5DZGA 3BCWA 3O1RA 3JB8A 2AACA 3AC0A 4Z8BA 1IS5A 2CWSA 2YB7A 4OCTA 1W2OA 4NJ4A 2ZGRA 1E5HA 3T08A 4P14A 4YZ1A 2WC2A 5T5JA 4XPVA 2ZGUA 1TMF2 4RR3B 3RPQA 4RR3A 1X50A 5FZGA 4EZ4A 1XNAA 2VMEA 1UY2A 3P3PA 1BBT1 5BV6A 1QXRA 2ZKNA 2HWE3 1VBA3 4JVAA 4GKXA 1KXGA 3ZSMA 2OT7A 3UESA 4ATEA 2DVFA 3AZZA 1GWKA 2R16A 3POWA 4FPHA 4HSJA 2XHNA 3OBTA 4B4RA 4QKDA 4GQ7A 3BU7A 1UKRA 2UWBA 1T6BX 4QM9A 1Y3TA 2R32A 3T0AA 1X36A 1AYM1 1VAVA 1ZBE1 3O0WA 4RHV2 2HH9A 3JD73 3LDBA 1RUG3 3FHAA 3VB9A 4D0QA 5HV0A 2VUJA 1JZ8A 1HJFA 2NMNA 1VB4A 2W0XA 2WNEA 2R1DA 3LPGA 4Q4X3 2ZZJA 3LEIA 4AEKA 4EWDA 1Y7BA 2ZGMA 3N7JA 4RD7A 1ZRFA 3WNOA 5BNNB 5BNNA 3O1UA 3A21A 4PBPA 3TBDA 4G4FA 2W1UA 4QWNA 4JX0A 1COV1 3WP6A 2A75A 3PUHA 5LRRA 5A1FA 3C7GA 3WDUA 1QIQA 3VD4A 2WS91 1G7YA 4LOSA 5FWJA 3I2KA 1VPHA 2XWBB 1REDA 1RUC2 4OMDA 3TEWA 1GP6A 2BVVA 1RUI3 4IEYA 1OD5A 3IAPA 4LBKA 1UMHA 1DQ2A 2PA7A 2MHFA 2YG0A 3QBQA 4GH4A 4GH4B 4GWNA 1EV12 1NCQB 2R062 1NCQA 4XJ9A 3OBZA 4LULA 2AZ5A 2QBXA 2IFRA 4K1ZA 2UY8A 4YG3A 5K9YA 2NP0A 5L7OC 1QY4A 2JWPA 4JTOA 4DNYA 4XF4A 3FBMA 1OQDA 3RWNA 2DBNA 2CDPA 3BGAA 1H9PA 3CQOA 1VRH3 2ES3A 1RVF2 1FYUA 1PIV2 3CZUA 5F2WA 1QDCA 3EJKA 1AL22 4YZ2A 1KS5A 4AHWA 5JR2A 1N1YA 3B5LB 5F5AA 2D97A 5EFUA 5FWEA 2WNOA 2ZEYA 2IZWA 2W87A 2C24A 3MF6A 4FQZA 4YWAA 3WDVA 2JG9B 4F8AA 4A42A 1YNAA 3LPFA 5C5TA 2VOXA 2XJSA 4QX8A 4EN8B 4C8DA 4HVQA 4LO6B 3ZVXA 5A33A 4GB31 4ARXA 5A33B 2VMDA 1VJ2A 1TVGA 1XPWA 1XRUA 2DWRA 4LO8A 5LRSA 1V6NA 2D6PA 2G19A 5IAXA 3J7NA 1X8MA 5D21A 1GZCA 2XONA 3SCGA 3JU9A 5AC92 4IEUA 5CAZA 2X09A 2ZGLA 4FOQA 2DCKA 3POSA 4LKFA 4NHXA 2R041 1AYN1 1SCRA 4CCDA 4XFGA 2RM22 1U5XA 3DEMA 1BMV2 4YRDA 1RYYA 3ZMOA 3MW3A 2RV9A 1J3QA 2RMU1 1NLSA 1LEDA 1MS8A 2R073 5C7GA 2ZHNA 2B39A 2BGCA 5DMYA 4L92A 2XQRA 1ASJ3 1WD3A 5CFDA 2FDJA 5TSWA 5BNOB 5BNOA 3PLQA 5CFDB 1JHNA 1EPWA 3DYOA 5C4WC 1UY4A 2W1SA 2WA3A 4YVSB 4YVSA 4X6QB 5FAXA 4C0BA 2Z42A 1W2TA 3H8OA 2PYTA 4WVWA 1MQTC 4MH0E 3W21A 5JI7A 2RR12 1POQA 1AR81 2PLV3 3BIWE 4Q1PA 1AYM2 1ZBE2 2DCTA 5BNQA 2A6VA 2XH6A 2BBAA 3HEIA 5IFTA 1EAH2 2VOWA 3GZAA 4OI0A 4XHXA 2JX9A 4HN0A 1E57A 2VCAA 2H0VA 5D8AC 2CGPA 2EAKA 3DL3A 3H42B 1SQ4A 2GNBA 3VD3A 4EJRA 3KHBA 1BEV1 4BCUA 3WW4A 2RJLA 3FC0A 3OGRA 5EYXA 1COV2 1SBDA 1O8PA 2D5FA 2W1QA 4HANA 4MYEA 4Q5OA 2VY0A 1JU4A 4UBHA 2WS92 3CJIC 3UETA 3ILFA 3P1IA 2C5DA 1XOYA 3C3VA 2BP6A 4PBOA 1ACCA 4JQTA 5FZ9A 4FAGA 2DVBA 4M01A 5CBLA 2O8OA 1AR61 1UU4A 2H0BA 4NRMA 3NNGA 3WHUA 3UK9A 3VZJA 1RHI2 4AAPA 5JIAA 4AGVA 1YFYA 4N7IA 4PQQA 4DUXA 1KGYA 1N1TA 2JEMA 3D0JA 4OI2A 1ND3C 4FPCA 1W3XA 3H8UA 5A1AA 5I8TA 3VDDC 3ASIA 2HWC3 2TBVA 5L36A 2EIEA 4C1XA 3MIEA 2GC3A 1VE0A 3N9NA 1UZWA 1M06G 1LB2A 5DDJ3 5ACA3 1RMU3 5BNPC 2OX0A 1EYBA 2XL7A 1V70A 2X29A 1C3HA 3MYXA 5SV5A 4AXOA 5A3MA 5C3QA 5C33A 3JBG1 1GBGA 4GB32 3WG4A 1R1ZA 3WV6A 1VALA 2LRPA 4A41A 3DECA 4AEJA 4MGYE 4XCBA 1V9U3 3RZZA 4LK7A 1NA1C 1V6OA 2B46X 4M3CF 1MZ6A 4UFKA 1YHFA 3LD8A 4RR3C 4FFFA 4FTBA 1UOBA 4LO7A 4OZOA 4D94A 2VMHA 5DXDA 1YFWA 4UFIA 1KS4A 3GZEA 2V73A 2DU1A 1JODA 1OA2A 3WDWA 2AUYA 3WINE 3KF5A 1I5PA 3IKWA 5BYNA 3O1TA 3SCFA 3ZYFA 3OEBA 4IEXA 4Y3OA 3EXUA 2DCJA 1G9CA 4D6QA 1JOJA 3ZMNA 4CU6A 2E31A 3GDBA 4LMFA 2OKXA 2X5IC 4XDOA 1NCRB 1NCRA 4XQWA 5LCWL 3FE5A 1W8ZA 2DUPA 3PURA 2D6OX 3R4UA 3ZO0B 1XNKA 3OYWB 2CDOA 1RINA 1TME3 2QQNA 1K5MB 1XNBA 1K5MA 3HQXA 3MI8A 3OYWA 1AR82 4BQYA 4YFZA 5G05L 1W2UA 1WW5A 4U2AA 5FPLA 3UJOA 2YPDA 4QDRA 2VQUA 5DAXA 3CMGA 2Y6KA 5CU1A 3AFGA 1VBC3 4FO9A 3T2PA 2GDFA 1F8VA 1N47A 3TNPB 1UYZA 3RZGA 3T1LA 5FPUA 4NHYA 4QB6A 5LATA 1QNWA 4BXFA 5HPOA 4DXRA 4AVBA 1C1LA 4MUVA 2YBPA 1IS4A 2GAUA 4LBMA 4NN0A 1VAKA 4DMIA 3JCIA 5EP9A 1KJRA 1CAWB 4AHXA 1CAWA 4GH4C 1GWMA 2W91A 3GBGA 1ULFA 3LKJA 4IV3C 2J1EA 1NCQC 1DZRA 4LHKA 4BQWA 4HL0A 4CXXA 2HWD1 4QB1A 1MACA 1H4GA 1FMD1 1FI2A 1Y9QA 1AL0G 2AYHA 2JDNA 3PHMA 4IGOA 1OPMA 4Q0SA 4UFLA 2ARAA 3D5OA 4W4ZA 2TNFA 3AVRA 1HRI2 4YGBA 5CFCB 1TQ5A 2IC1A 3B01A 4OUEA 4Q0UA 5CFCA 5IVBA 1GOGA 1W8WA 3PUIA 2WNVB 3SITA 2WNVA 3AYDA 3DGTA 1UO9A 4UW5A 1X9TA 4Q27A 5AFEA 4LTAA 5LA9A 1FOD2 2KA3A 4RQPB 5FPZA 4RQPA 2HWB3 3U10A 4KNCA 4NIGA 1IPKA 1LRHA 3RFRA 5FPXA 1SBFA 3V0BB 3V0BA 3MV01 1VBD3 4XOGA 3I8TA 4Y4YA 2VMIA 1WA4A 3K51A 1QQP2 1RUD1 2PAMA 1W3VA 2VZUA 3RZJA 1JUHA 2X05A 3H3LA 1CJPA 3K77A 4OHVA 5C3PA 1GQHA 2D40A 3GBFA 3JBG2 4GWMA 3QH7A 2YXSA 4LITA 1LULA 3VBRC 2A6WA 1RUJ2 2W1WA 4KWJA 4YW4A 1F2NA 2VOVA 4LOTA 3AXDA 1UIKA 1LENA 4LBOA 2ADEA 1LOFA 4XYXA 3WDXA 4LLFA 1WCDJ 3JXSA 4J6GA 4TSVA 4IGPA 5BNOC 1OMIA
chains in the Genus database with same CATH topology
5JXHA 2J1AA 1L7QA 5JMOA 1W8OA 2W47A 3ACHA 2BGPA 3DYMA 1T2XA 1J83A 3C7EA 3K4AA 3K75B 3A23A 3LEGA 2Y6GA 2QQOA 4QDSA 2QQKA 4MGSA 4MO3M 3EYPA 3HJRA 2W95A 4OYUA 5IFPA 4LPLA 1F4HA 1W0NA 2VZPA 4MGQA 5EJ1B 1WKYA 5EIYB 5I0DA 3WNMA 4DXTA 2ORZA 3LQCA 2EIDA 1JI6A 2J1SA 3OEAA 4ZZ5A 3I2FA 4QX0A 3LE0A 3DYPA 4CU8A 1O8SA 5JXIA 1MPXA 3GM8A 2W3JA 4E8CA 4RN5A 4BK4A 2XQXA 4BXSV 4KI5M 4P5YA 3K4DA 4W50A 1HN1A 2WDBA 4GWIA 4OMCA 3VD7A 4D8MA 4QX2A 5IYYA 3HOBA 2VZ1A 1P8JA 2ZEXA 4BDVB 5LA1A 1KEXA 1GNYA 2Y8KA 2E32A 3D3AA 1EUTA 3C8XA 2W46A 3VD5A 2VJXA 1DLCA 1JYVA 2XOMA 4RYDA 2VZ3A 2WO2A 4JKKA 3WF3A 3CKHA 4DXSA 3BN6A 5FUIA 4QPWA 1LNSA 3I2GA 1JHJA 1NUKA 2VQTA 3LEKA 4YPJA 5DQ0A 5F7UA 4PT6A 5IHRA 2DDUA 1OH4A 3SKVA 2V5DA 3T09A 1US2A 5HXMA 1NAEA 4LQRA 2J1UA 4UOJA 3E1F1 4BK5A 2QQMA 5B4XA 4Z2AA 1JZ5A 4XUTA 2Y6HA 4XUPA 2C26A 3IDAA 2J1TA 3SKJE 3ACIA 2E26A 2VC9A 1K42A 3SEEA 4BJ0A 4KMQA 3WF1A 5G04L 1XC6A 3FN9A 3I2HA 3THDA 3T2OA 3ABZA 2J7MA 1PX4A 1CX1A 2LS6A 3W5NA 3GGLA 3C7HA 3HPNA 4A44A 5DN2A 2BZDA 4A45A 1PMHX 3OB8A 2QQIA 2J22A 1OF3A 1UY3A 2J1RA 1W9SA 3NJVA 1IQDC 2L9LA 3GXUA 1OF4A 4MOAA 3OBAA 4P00B 2JE8A 2QQLA 1JZ7A 2WAOA 1CZSA 2WZ8A 5LA2A 3AC0A 5C70A 1SG3A 4UAPA 4ZZ8A 1EUUA 2YB7A 4GZ9A 2YC2A 3T08A 2W92A 1UZ0A 1XNAA 2VMEA 1UY2A 3NQHA 3UNPA 3UESA 3WQBA 2XHNA 2ZEZA 2JDAA 2C4XA 4XUQA 2VCBA 4KWUA 1UXXX 3T0AA 3FHQA 2B9VA 3FHAA 4D0QA 2WYSA 1JZ8A 3VDCA 3LPGA 2VZOA 1O59A 2Y6LA 3LEIA 4XUOA 3WNOA 4AAXA 3A21A 2VMFA 1SHWB 2W1UA 1UX7A 4JX0A 3CIHA 3PUHA 2VOTA 2WBKA 3C7GA 3HNBM 3THCA 3I2JA 3VD4A 3I2KA 2W94A 4OMDA 3EB7A 3IAPA 1UMHA 2JKXA 2YG0A 4IUGA 3T2QA 5JUVA 2WQ8A 3HNMA 1W9TA 2QBXA 4HG6B 1W8NA 4LKSA 2EICA 4MADA 3I3EA 2ID4A 2CDPA 3BGAA 3CQOA 3U37A 1J84A 1GU3A 3CZUA 1JYNA 5JR2A 2ZEYA 1W99A 2W87A 4A42A 1PX3A 1K3IA 1UXZA 3LPFA 4W8JA 3NJXA 3I3BA 4JKMA 4ARXA 2VMDA 1TVGA 1XPWA 3MV11 3VD9A 2WO1A 2XONA 3K4ZA 3ACFA 3OGSA 1JYXA 2W9XA 2X09A 2DCKA 4CVUA 1OD3A 4CU9A 1RYYA 4ZXEA 2RV9A 2WABA 5C7GA 1GQPA 4DUWA 2WAAA 2ZXQA 5DMYA 5EJZB 4DEVA 3DYOA 3HN3A 2E33A 1UY4A 2W1SA 3I97A 2V72A 2EIBA 3ETPA 5C71A 3CZJA 4JKLA 2VR4A 5JXGA 4ZY9A 1UWWA 2HLEA 2VCCA 3VDBA 3A7QA 2ZEWA 2BBAA 3HEIA 4JHZA 5IFTA 2J1VA 2RJ2A 5LA0A 2VCAA 2WN3A 1K12A 1JU3A 2RVAA 4DUVA 1D7PM 5J1XA 3VD3A 4M4PA 4A3ZA 1UY1A 1K45A 3OGRA 2W1QA 1O8PA 1H6XA 3WNPA 4P08A 1GOFA 1JU4A 1GUIA 4A4AA 3UETA 3P1IA 2VM9A 1UYXA 3OGVA 5IJRA 4QDQA 2JD9A 1JZ6A 3T0BA 3NNGA 2VZVA 1L7RA 3ZM8A 4AG4A 1UY0A 2WO3A 3IB3A 3T0DA 4PQQA 3I3DA 4DUXA 3IIIA 1KGYA 4XURA 3WNNA 1ULPA 3K46A 5A1AA 1OT5A 2R7EB 4A6OA 4PF1A 4QX3A 2B4KA 2EIEA 3WF2A 4CUBA 1SDDB 4ET7A 3WF0A 3W5MA 2BGOA 3OG2A 4L0PA 1GOHA 5JXJA 3SEPA 1ULOA 2WZEA 4A41A 3DECA 2BERA 3MUY1 4QX1A 2KD7A 3WEZA 2LW8A 4TTGA 2V4VA 4OZOA 1NKGA 2VO5A 2HYXA 1R64A 1TG7A 3IAQA 1JZ4A 1I5PA 4CU7A 1NX9A 3MO4A 5CZKA 3OEBA 2DCJA 4FI9A 2QQJA 4CU6A 2E31A 3GDBA 2VTFA 2OKXA 4UI9L 3MBWA 5LCWL 4ARYA 1XNTA 3WF4A 3WNLA 2CDOA 2QQNA 5B4NA 5G05L 2X10A 4CUCA 4QDRA 2VQUA 2Y64A 2Y6KA 3CMGA 4GWJA 4QB2A 3T2PA 4M4RA 1UYZA 1PMJX 2C9KA 4XZUG 3ECQA 4QB6A 1YQ2A 5HPOA 5DPNA 4DXRA 2YC4A 3P6BA 2YFZA 3HNYM 1UMIA 1JYWA 1CZVA 3NRUA 3CDZB 3ACGA 4XVHA 2W91A 2J1EA 4DEQA 2WN2A 2VZRA 4QB1A 4QAWA 4E8DA 3WSOA 1US3A 2ORXA 2WUHA 1BHGA 2Y6JA 3C7OA 3J7HA 1H6YA 4W4ZA 3WNKA 1UYYA 1DP0A 4OUEA 4TXWA 1CZTA 1GMMA 4CUAA 2VL4A 1GOGA 3PUIA 3A22A 2VZSA 3VDAA 3F2ZA 1JZ2A 1F4AA 3MV01 2VZTA 4XUNA 1W9WA 1CIYA 2VZUA 2X05A 2YFUA 5CYYA 3FL7A 3K77A 2VMCA 2Z4FA 4P02B 1DYOA 3I2IA 2W1WA 1WCQA 2W5FA 2VZQA 3MUZ1 3C7FA 3JXSA 4LHSA 1JZ3A 2PQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXH A;  2J1A A;  1L7Q A;  5JMO A;  1W8O A;  2W47 A;  3ACH A;  2BGP A;  3DYM A;  1T2X A;  1J83 A;  3C7E A;  3K4A A;  3K75 B;  3A23 A;  3LEG A;  2Y6G A;  2QQO A;  4QDS A;  2QQK A;  4MGS A;  4MO3 M;  3EYP A;  3HJR A;  2W95 A;  4OYU A;  5IFP A;  4LPL A;  1F4H A;  1W0N A;  2VZP A;  4MGQ A;  5EJ1 B;  1WKY A;  5EIY B;  5I0D A;  3WNM A;  4DXT A;  2ORZ A;  3LQC A;  2EID A;  1JI6 A;  2J1S A;  3OEA A;  4ZZ5 A;  3I2F A;  4QX0 A;  3LE0 A;  3DYP A;  4CU8 A;  1O8S A;  5JXI A;  1MPX A;  3GM8 A;  2W3J A;  4E8C A;  4RN5 A;  4BK4 A;  2XQX A;  4BXS V;  4KI5 M;  4P5Y A;  3K4D A;  4W50 A;  1HN1 A;  2WDB A;  4GWI A;  4OMC A;  3VD7 A;  4D8M A;  4QX2 A;  5IYY A;  3HOB A;  2VZ1 A;  1P8J A;  2ZEX A;  4BDV B;  5LA1 A;  1KEX A;  1GNY A;  2Y8K A;  2E32 A;  3D3A A;  1EUT A;  3C8X A;  2W46 A;  3VD5 A;  2VJX A;  1DLC A;  1JYV A;  2XOM A;  4RYD A;  2VZ3 A;  2WO2 A;  4JKK A;  3WF3 A;  3CKH A;  4DXS A;  3BN6 A;  5FUI A;  4QPW A;  1LNS A;  3I2G A;  1JHJ A;  1NUK A;  2VQT A;  3LEK A;  4YPJ A;  5DQ0 A;  5F7U A;  4PT6 A;  5IHR A;  2DDU A;  1OH4 A;  3SKV A;  2V5D A;  3T09 A;  1US2 A;  5HXM A;  1NAE A;  4LQR A;  2J1U A;  4UOJ A;  3E1F 1;  4BK5 A;  2QQM A;  5B4X A;  4Z2A A;  1JZ5 A;  4XUT A;  2Y6H A;  4XUP A;  2C26 A;  3IDA A;  2J1T A;  3SKJ E;  3ACI A;  2E26 A;  2VC9 A;  1K42 A;  3SEE A;  4BJ0 A;  4KMQ A;  3WF1 A;  5G04 L;  1XC6 A;  3FN9 A;  3I2H A;  3THD A;  3T2O A;  3ABZ A;  2J7M A;  1PX4 A;  1CX1 A;  2LS6 A;  3W5N A;  3GGL A;  3C7H A;  3HPN A;  4A44 A;  5DN2 A;  2BZD A;  4A45 A;  1PMH X;  3OB8 A;  2QQI A;  2J22 A;  1OF3 A;  1UY3 A;  2J1R A;  1W9S A;  3NJV A;  1IQD C;  2L9L A;  3GXU A;  1OF4 A;  4MOA A;  3OBA A;  4P00 B;  2JE8 A;  2QQL A;  1JZ7 A;  2WAO A;  1CZS A;  2WZ8 A;  5LA2 A;  3AC0 A;  5C70 A;  1SG3 A;  4UAP A;  4ZZ8 A;  1EUU A;  2YB7 A;  4GZ9 A;  2YC2 A;  3T08 A;  2W92 A;  1UZ0 A;  1XNA A;  2VME A;  1UY2 A;  3NQH A;  3UNP A;  3UES A;  3WQB A;  2XHN A;  2ZEZ A;  2JDA A;  2C4X A;  4XUQ A;  2VCB A;  4KWU A;  1UXX X;  3T0A A;  3FHQ A;  2B9V A;  3FHA A;  4D0Q A;  2WYS A;  1JZ8 A;  3VDC A;  3LPG A;  2VZO A;  1O59 A;  2Y6L A;  3LEI A;  4XUO A;  3WNO A;  4AAX A;  3A21 A;  2VMF A;  1SHW B;  2W1U A;  1UX7 A;  4JX0 A;  3CIH A;  3PUH A;  2VOT A;  2WBK A;  3C7G A;  3HNB M;  3THC A;  3I2J A;  3VD4 A;  3I2K A;  2W94 A;  4OMD A;  3EB7 A;  3IAP A;  1UMH A;  2JKX A;  2YG0 A;  4IUG A;  3T2Q A;  5JUV A;  2WQ8 A;  3HNM A;  1W9T A;  2QBX A;  4HG6 B;  1W8N A;  4LKS A;  2EIC A;  4MAD A;  3I3E A;  2ID4 A;  2CDP A;  3BGA A;  3CQO A;  3U37 A;  1J84 A;  1GU3 A;  3CZU A;  1JYN A;  5JR2 A;  2ZEY A;  1W99 A;  2W87 A;  4A42 A;  1PX3 A;  1K3I A;  1UXZ A;  3LPF A;  4W8J A;  3NJX A;  3I3B A;  4JKM A;  4ARX A;  2VMD A;  1TVG A;  1XPW A;  3MV1 1;  3VD9 A;  2WO1 A;  2XON A;  3K4Z A;  3ACF A;  3OGS A;  1JYX A;  2W9X A;  2X09 A;  2DCK A;  4CVU A;  1OD3 A;  4CU9 A;  1RYY A;  4ZXE A;  2RV9 A;  2WAB A;  5C7G A;  1GQP A;  4DUW A;  2WAA A;  2ZXQ A;  5DMY A;  5EJZ B;  4DEV A;  3DYO A;  3HN3 A;  2E33 A;  1UY4 A;  2W1S A;  3I97 A;  2V72 A;  2EIB A;  3ETP A;  5C71 A;  3CZJ A;  4JKL A;  2VR4 A;  5JXG A;  4ZY9 A;  1UWW A;  2HLE A;  2VCC A;  3VDB A;  3A7Q A;  2ZEW A;  2BBA A;  3HEI A;  4JHZ A;  5IFT A;  2J1V A;  2RJ2 A;  5LA0 A;  2VCA A;  2WN3 A;  1K12 A;  1JU3 A;  2RVA A;  4DUV A;  1D7P M;  5J1X A;  3VD3 A;  4M4P A;  4A3Z A;  1UY1 A;  1K45 A;  3OGR A;  2W1Q A;  1O8P A;  1H6X A;  3WNP A;  4P08 A;  1GOF A;  1JU4 A;  1GUI A;  4A4A A;  3UET A;  3P1I A;  2VM9 A;  1UYX A;  3OGV A;  5IJR A;  4QDQ A;  2JD9 A;  1JZ6 A;  3T0B A;  3NNG A;  2VZV A;  1L7R A;  3ZM8 A;  4AG4 A;  1UY0 A;  2WO3 A;  3IB3 A;  3T0D A;  4PQQ A;  3I3D A;  4DUX A;  3III A;  1KGY A;  4XUR A;  3WNN A;  1ULP A;  3K46 A;  5A1A A;  1OT5 A;  2R7E B;  4A6O A;  4PF1 A;  4QX3 A;  2B4K A;  2EIE A;  3WF2 A;  4CUB A;  1SDD B;  4ET7 A;  3WF0 A;  3W5M A;  2BGO A;  3OG2 A;  4L0P A;  1GOH A;  5JXJ A;  3SEP A;  1ULO A;  2WZE A;  4A41 A;  3DEC A;  2BER A;  3MUY 1;  4QX1 A;  2KD7 A;  3WEZ A;  2LW8 A;  4TTG A;  2V4V A;  4OZO A;  1NKG A;  2VO5 A;  2HYX A;  1R64 A;  1TG7 A;  3IAQ A;  1JZ4 A;  1I5P A;  4CU7 A;  1NX9 A;  3MO4 A;  5CZK A;  3OEB A;  2DCJ A;  4FI9 A;  2QQJ A;  4CU6 A;  2E31 A;  3GDB A;  2VTF A;  2OKX A;  4UI9 L;  3MBW A;  5LCW L;  4ARY A;  1XNT A;  3WF4 A;  3WNL A;  2CDO A;  2QQN A;  5B4N A;  5G05 L;  2X10 A;  4CUC A;  4QDR A;  2VQU A;  2Y64 A;  2Y6K A;  3CMG A;  4GWJ A;  4QB2 A;  3T2P A;  4M4R A;  1UYZ A;  1PMJ X;  2C9K A;  4XZU G;  3ECQ A;  4QB6 A;  1YQ2 A;  5HPO A;  5DPN A;  4DXR A;  2YC4 A;  3P6B A;  2YFZ A;  3HNY M;  1UMI A;  1JYW A;  1CZV A;  3NRU A;  3CDZ B;  3ACG A;  4XVH A;  2W91 A;  2J1E A;  4DEQ A;  2WN2 A;  2VZR A;  4QB1 A;  4QAW A;  4E8D A;  3WSO A;  1US3 A;  2ORX A;  2WUH A;  1BHG A;  2Y6J A;  3C7O A;  3J7H A;  1H6Y A;  4W4Z A;  3WNK A;  1UYY A;  1DP0 A;  4OUE A;  4TXW A;  1CZT A;  1GMM A;  4CUA A;  2VL4 A;  1GOG A;  3PUI A;  3A22 A;  2VZS A;  3VDA A;  3F2Z A;  1JZ2 A;  1F4A A;  3MV0 1;  2VZT A;  4XUN A;  1W9W A;  1CIY A;  2VZU A;  2X05 A;  2YFU A;  5CYY A;  3FL7 A;  3K77 A;  2VMC A;  2Z4F A;  4P02 B;  1DYO A;  3I2I A;  2W1W A;  1WCQ A;  2W5F A;  2VZQ A;  3MUZ 1;  3C7F A;  3JXS A;  4LHS A;  1JZ3 A;  2PQS A; 
#chains in the Genus database with same CATH topology
 2TEP A;  4XAB A;  2YV8 A;  1L7Q A;  4TYS A;  3E6D A;  3J8F 2;  3D6E A;  1W8O A;  2BW8 A;  3VBH C;  1W9Y A;  4GD4 A;  1ND2 C;  1T2X A;  1YRZ A;  1A8D A;  1BVP 1;  3K75 B;  1LU1 A;  2GN7 A;  1XE7 A;  2FCV A;  4QQL A;  1UIJ A;  2QQO A;  2Y6G A;  4OHW A;  3NKG A;  2XPJ A;  4FOY A;  2RDR A;  4MGS A;  1D0G A;  4B1M A;  3PU8 A;  4Z1V A;  3JQX A;  3WW2 A;  2LRO A;  3IPV B;  1Z0H A;  3IPV A;  3M3E A;  2Q1M A;  1WW7 A;  2ZX2 A;  1FV2 A;  4LPL A;  2DCZ A;  4XJA A;  3N9Q A;  2WZP P;  3I3M A;  4Q29 A;  3AP7 A;  4ES8 A;  2VW0 A;  2RS5 3;  4C91 A;  1BK0 A;  4QXC A;  1SBE A;  2SBA A;  5FYY A;  4MGQ A;  5FR3 A;  5EJ1 B;  5EIY B;  3GJB A;  3P5B A;  1Q8P A;  3MFA A;  5FMD A;  3HD8 B;  1JI6 A;  2VUL A;  4FPO B;  4AED B;  4HSL A;  2JEC A;  3IM0 A;  4AED A;  1W8H A;  1NZC A;  2ZAC A;  4FCA A;  5FXW A;  3ZXG A;  1S1A A;  3OEA A;  3I2F A;  3ZYI B;  2PQQ A;  1LEM A;  4XXA A;  4CU8 A;  1V6L A;  1O8S A;  2OUH A;  5FLJ A;  5FZK A;  2D6M A;  2E7T A;  5FDB A;  3N9M A;  1GNH A;  2ZGP A;  4CPB A;  2MEV 3;  3O12 A;  2R0F A;  3TN9 1;  5ABJ C;  2I07 B;  3MIG A;  1OH3 A;  3GHM A;  4A3X A;  4OI4 A;  1W9F A;  4Q4Y 3;  2PXJ A;  3AMQ A;  1VBB 3;  1W8U A;  2HWD 2;  3M3I A;  2EA7 A;  2GZW A;  3H1W A;  4GWI A;  1FMD 2;  2V5Y A;  5DUW A;  3KSC A;  4E9K A;  2D44 A;  2WLP A;  4S2D A;  2CV6 A;  1AR9 1;  5IUQ A;  4D8M A;  5JLV A;  4IEZ A;  5IYY A;  2FZ2 A;  3A4U A;  3WDT A;  4F7Z A;  3MID A;  5HI0 A;  3IIA A;  2VZ1 A;  5FYM A;  3AVS A;  1CGP A;  3RI8 A;  5FRA A;  1KEX A;  4GKY A;  3I4I A;  3ZX7 A;  2E32 A;  4L9B A;  1WCU A;  3POF A;  4IXL A;  1EUT A;  3C8X A;  3OUI A;  4FFH A;  4XCA A;  4WM7 C;  4W6X A;  4YGE A;  4IL7 A;  1DLC A;  2LUW A;  3IMN A;  3NAP B;  3NAP A;  4L97 A;  2QZ3 A;  2ZAB A;  3BU0 A;  2VUD A;  3ZSK A;  1OVS A;  4E2G A;  4M3C B;  4M3C A;  4FOV A;  1RUD 2;  4AW7 A;  3MZH A;  2O1Q A;  2VG9 A;  5E89 A;  3SHR A;  3WF3 A;  1WZX A;  1JYI A;  3CKH A;  4JTN A;  5C3R A;  1JXN A;  4XBQ A;  1OQ1 A;  3BTX A;  1QJY 3;  2WZR 3;  3WG1 A;  4R4Z A;  4YPJ A;  1AJK A;  2BJS A;  4ISQ A;  4QXB A;  4XDQ A;  5F7U A;  1W03 A;  5FCC A;  1AX0 A;  2DDU A;  5I0S A;  3ZYH A;  4QXK A;  3BPS A;  4M0N A;  3SKV A;  3H7J A;  4FPL A;  1A8M A;  3VHR A;  5HXM A;  3A0N A;  1WLC A;  2NPI A;  1NCR C;  1LOC A;  1QMJ A;  3BI3 A;  4XUT A;  4XUP A;  2C26 A;  3P3N A;  1OA4 A;  2XDV A;  1AR7 1;  4LBQ D;  3VZN A;  1POV 3;  4E4S A;  4PLO A;  4YNI A;  1DZT A;  2JE9 A;  2E26 A;  2QCS B;  3WD5 A;  3SEE A;  4BJ0 A;  3WUC A;  4OUS A;  3AP6 A;  4KMQ A;  5L9B A;  2Q8E A;  2FDG A;  2GNM A;  2NQY A;  4CP9 B;  4CP9 A;  3I2H A;  3AFK A;  5FZC A;  1FPN 1;  3NV1 A;  1OKQ A;  4LK6 A;  3KT4 A;  1CX1 A;  5FUP A;  2VE1 A;  4ASM B;  3USU B;  3USU A;  4BQ5 A;  4A44 A;  2VXR A;  2BZD A;  5DN2 A;  3E5X A;  4I3G A;  4XF0 A;  2HBU A;  4P5H A;  1GSL A;  1U12 A;  5CNA A;  3T3Y A;  2RHP A;  4AFA A;  4Y4R A;  3POJ A;  1IQD C;  2WT0 A;  1RJ8 A;  1CR7 A;  1APN A;  1UN1 A;  4E4D X;  2B9U A;  3PVE A;  4P00 B;  4Y1Y A;  4YZ4 A;  2JE8 A;  3RJ2 X;  4DY5 A;  4D7S A;  3HN1 A;  4Z07 A;  2GSY A;  3TN9 2;  2WNU C;  4BIS A;  1CZS A;  4CP0 A;  5F3C A;  4IE0 A;  5LA2 A;  5A7P A;  1HXS 1;  2RS1 2;  3DKQ A;  4KU8 A;  1SG3 A;  4ZZ8 A;  1EUU A;  1Z7S 1;  1YWK A;  4N8M A;  4HLT A;  3PJQ A;  4O61 A;  3KLS A;  5GKA C;  5IVY A;  2DYC A;  4XDP A;  1FV3 A;  4FOW A;  4XET A;  5LBC A;  1DHK B;  4ATF A;  5FMB A;  1IGO A;  3UNP A;  4NPM A;  4TLG A;  2OPK A;  5L7O B;  2IXJ A;  5L7O A;  1SLL A;  2ZEZ A;  2JDA A;  3KV6 A;  3Q8C A;  4XUQ A;  3KQ4 B;  5JOY A;  1CAV B;  2IVI B;  1CAV A;  2VCB A;  2B45 X;  2HWF 3;  4AE2 A;  5FMC A;  1UXX X;  1GFF 2;  5KHI A;  1XSQ A;  5GJ6 A;  2B42 B;  3VBU C;  5A7W B;  5FZ1 A;  5A7W A;  1VBE 1;  1OLM A;  3FLT A;  3VN4 A;  2WYS A;  2XL9 A;  2P3I A;  3HR9 A;  3DUI A;  3C2U A;  5IW0 A;  1ZBA 1;  1YJL A;  2WWS A;  3V56 A;  3VDC A;  2KM2 A;  2SLI A;  2Y6L A;  4FQ4 A;  4ORF A;  3ACL A;  4AAX A;  5GLT A;  5A32 B;  5A32 A;  4HT1 T;  1JH5 A;  4MSV A;  3WP4 A;  3OSD A;  5EPA A;  2XBO 3;  3MEP A;  4R9D A;  3I2J A;  2PHU A;  2VUC A;  1SFP A;  2BRT A;  4NRP A;  2P6H A;  4LIV A;  3RJR A;  4CP2 A;  5ISL A;  1MS9 A;  1DGL A;  4N9H A;  1NQD A;  2BFU L;  3LSD A;  1C8M 1;  1DGR A;  1Q8Q A;  3OTF A;  5JUV A;  1UOF A;  4JC1 A;  5FBZ A;  2OVU A;  4AFM A;  5E1R A;  4HG6 B;  5F5C A;  2LM3 A;  4LKS A;  2PTM A;  1UD1 A;  1NY7 2;  2QUO A;  1Q3E A;  4MAD A;  3I3E A;  1OA3 A;  1JYC A;  3AL5 A;  2ID4 A;  3NL1 A;  4Q4V 1;  1MVQ A;  1J84 A;  1CAX B;  1PNF A;  1CAX A;  4AQS A;  2HJI A;  3V0A B;  3S5A A;  3V0A A;  5FO8 B;  2E53 A;  1FPN 2;  1MQT B;  1MQT A;  1TMF 3;  4LNV A;  2WL1 A;  1QJE A;  4YGD A;  4LA2 A;  2D3S A;  1OPO A;  1VRB A;  1W99 A;  1U0A A;  3O0V A;  5FYH A;  3URF A;  2E63 A;  5J7M A;  3OGJ A;  4IEV A;  3THT A;  1SLB A;  1PX3 A;  1UAI A;  2IXC A;  4W8J A;  3I3B A;  3M3Q A;  5D8A A;  4IE6 A;  4HET A;  5D8A B;  1ZA7 A;  5I0U A;  2QQU A;  4K3U A;  3I54 A;  3RZL A;  1QJU 1;  1BCX A;  4M0H A;  1IG3 A;  5FZ3 A;  3H8X A;  4RHV 3;  2A3Y A;  3NNF A;  3SH3 A;  3CO2 A;  4GA9 A;  4BB3 A;  4ZHN A;  4AQ2 A;  2C9A A;  3POY A;  4LHN A;  2GMM A;  3KGL A;  4Q4W 1;  3RI9 A;  2NLR A;  4XTP A;  4XAE A;  1LU2 A;  1MEC 1;  1UNB A;  1MZE A;  1V00 A;  4NHM A;  4O9G A;  5A3N A;  1Z7S 2;  2IXL A;  1OD3 A;  3GHN A;  4EWA A;  4HVR A;  1U5Y A;  4CU9 A;  5IAT A;  1WMF A;  1AXK A;  2WA4 A;  2ZZQ A;  1S4C A;  1HQL A;  1WBF A;  2JDU A;  3H3U A;  4FFG A;  2I74 A;  3PUS A;  2DVG A;  4GMP 0;  4KBB A;  2WAA A;  4LOR A;  2ZXQ A;  1G8W A;  3TOJ A;  1D4M 3;  4WZC A;  4DEV A;  4CCN A;  3HN3 A;  2ZOE B;  2E33 A;  5CIR A;  3I97 A;  4AI9 A;  4CDQ C;  1RUC 3;  2EIB A;  3ETP A;  3OOX A;  3W9A A;  4LT5 A;  4OQ8 A;  1ND3 B;  1ND3 A;  2BOI A;  4ZS3 A;  4AOC A;  1UWW A;  4JZR A;  1FNY A;  5FTT C;  5JIU A;  1EV1 3;  2B8M A;  3VDD B;  3VDD A;  3A7Q A;  5JSP A;  2ZEW A;  4JRA A;  5JAX A;  3ZXK A;  2WN3 A;  3BOW A;  1JU3 A;  4DUV A;  5FZO B;  5A6Q A;  5FZO A;  5JOZ A;  1D7P M;  1RVF 3;  1X82 A;  1PIV 3;  2UWC A;  5J1X A;  5IK8 A;  1UY1 A;  1AL2 3;  3LB9 A;  4UFJ A;  3ME2 A;  3ZKY A;  3LF7 A;  4YGC A;  1JW6 A;  1NA1 B;  1NA1 A;  5FP3 A;  4MGT A;  3AXE A;  1LKN A;  3R0R A;  3UL2 A;  2VM9 A;  4JHT A;  1H0B A;  3H0O A;  1JZ6 A;  2JD9 A;  3POI A;  1VBA 1;  3SH4 A;  1R09 2;  2UWA A;  4HK9 A;  5LK5 A;  1W6M B;  2VVD A;  1W6M A;  3RNS A;  3ALQ A;  1AF9 A;  3MLJ A;  1CVN A;  1IKP A;  5LB6 A;  1L7R A;  5LBB A;  1D4V B;  3T0D A;  3IB3 A;  3ZXF A;  5JCT A;  5AC9 3;  1YQ6 A;  1TEI A;  3III A;  1PO2 3;  2BTV C;  1QJX 2;  4TLF A;  1HDK A;  3WNN A;  3RS6 A;  2X5I B;  1CJD A;  1W05 A;  2X5I A;  4Q4V 2;  1OT5 A;  4A6O A;  1GR3 A;  4OVE A;  2ZGO A;  3M2M A;  3JD7 1;  2P5B A;  2RM2 3;  3OUH A;  4PF1 A;  3KHC A;  3MF9 A;  4QQ2 A;  1J1T A;  2YU1 A;  5GLV A;  3O1P A;  2JG8 C;  5DG1 A;  5EQU A;  3WF2 A;  4N53 C;  1J3R A;  3U4S A;  1TZO A;  3Q8B A;  1HIX A;  4Q4X 1;  5FLH A;  2X53 S;  2JEN A;  2YU2 A;  3IWZ A;  3PTR B;  5GM0 A;  1OSG A;  2ET7 A;  2JKB A;  2UYA A;  3PUA A;  3L2Y A;  2D3R A;  4IEW A;  1UZY A;  4XC9 A;  3WR0 A;  2I45 A;  1GOH A;  1CES A;  4Y20 B;  4Y20 A;  4S2F A;  3SEP A;  1ULO A;  2RR1 3;  2WZE A;  3B00 A;  1QJU 2;  1UL9 A;  3J7L A;  4I01 A;  5H9R A;  1LTE A;  2BER A;  3LA2 A;  3MUY 1;  4NHL A;  4PLM A;  1LOA A;  5DUU A;  1ZBE 3;  3KM5 A;  1RUI 1;  4CRQ A;  3VKF C;  4H55 A;  5BPX A;  4ONU A;  1UCX A;  2LW8 A;  4TTG A;  4IV3 B;  4CCL A;  1EAH 3;  4IV3 A;  4FPG A;  3T4H B;  1DYP A;  3I7D A;  1YYN A;  2VO5 A;  4P9G A;  4AQT A;  2YUE A;  2XLG A;  5LAS A;  4DPN A;  1JZ4 A;  4XQ4 A;  2DF7 A;  4CU7 A;  1NX9 A;  4LBN A;  4DIQ A;  2XLF A;  3HQU A;  4ASK A;  1IS3 A;  3POE A;  1AX1 A;  2WFF 2;  4DQA A;  4DZG A;  1MS4 A;  1JOP A;  1VRH 1;  4FI9 A;  4MG2 A;  4JGY C;  3T30 A;  3DCQ A;  2HKX A;  4RS5 C;  4CCJ A;  1YFX A;  4ARY A;  5FY0 A;  1QWR A;  4P9X A;  5APA A;  3WF4 A;  5BY5 A;  2NZ9 A;  3PL0 A;  1FNZ A;  1SAC A;  4SBV A;  4MVT A;  3WP5 A;  1BVV A;  2OW4 A;  2P1B A;  1RHI 3;  2WQ4 A;  3ZXD A;  3ZYR A;  1LR5 A;  4K20 A;  4AI3 A;  1DGW A;  1AUY A;  1QJZ A;  4QB2 A;  3ILN A;  3ZR5 A;  3H8R A;  2QQV A;  1F5J A;  2IFW A;  4KBZ A;  2WT2 A;  1R1A 1;  4XZU G;  3ECQ A;  1UOJ A;  4G9S B;  5T55 A;  1GAN A;  1NT0 A;  5DPN A;  5LEJ A;  1DIW A;  3UGH A;  5LK7 B;  1SCS A;  2WLQ A;  2YC4 A;  1ULG A;  3HNY M;  2RDN A;  4YZ3 A;  5KHH A;  3R6S A;  3VBR B;  3VBR A;  1LGN A;  3NRU A;  3ACG A;  5CG9 A;  3ZIX A;  4CCO A;  1HRV 1;  1RGS A;  3CLP A;  3UGF A;  2GND A;  4YG0 A;  4XBN A;  2O0O A;  4D7Y A;  2BV4 A;  4Y1X A;  1BXH A;  2R07 1;  2VZR A;  2UYB A;  4QAW A;  5FZA A;  1BBT 2;  1VBA 2;  3FLP A;  1ASJ 1;  4V1P A;  4QX7 A;  5EHD A;  5DUX A;  5T52 A;  3PVO A;  4HZF A;  3Q8F A;  5FRE A;  4OZX A;  5A7N A;  3VBH B;  3VBH A;  4PJY A;  1Z78 A;  3RSJ A;  1ND2 B;  2Y33 A;  1I9R A;  1ND2 A;  4E4H A;  5JZG C;  2XJT A;  4ZU5 A;  4CEY C;  3OPT A;  2PLV 1;  2YC0 A;  1UPI A;  1X9P A;  3FWE A;  1DGW X;  4R8H A;  4ZXK A;  5CAD A;  1PGW 1;  3VL9 A;  1IZ3 A;  2EXI A;  1W28 A;  2JIJ A;  2XKP A;  4YW3 A;  1JZ2 A;  5J09 A;  3VKN A;  1XJA A;  3AL6 A;  2GME A;  3AMM A;  3LA7 A;  5ERL A;  5GZC A;  4XUN A;  2BFU S;  2IVJ A;  3LIH A;  5T50 A;  2ZX3 A;  1PGL 1;  3AX4 A;  4YM1 A;  4BHP A;  1MVE A;  5F5I A;  1ZRI A;  4ZS2 A;  4GMP 3;  2VUA A;  1FXZ A;  2VNG A;  1URX A;  4IV1 C;  4PLN A;  4PQ9 A;  4I02 A;  3S0M A;  1DYO A;  3QCW A;  1AR8 3;  4CTE A;  1DDL A;  2W5F A;  5FJH A;  4BLJ A;  1ZRE A;  2VZQ A;  2JDY A;  5I0T A;  4AI1 A;  2W2I A;  3RGB A;  5A3T A;  4CDX C;  3RMY A;  2JIC A;  2HEY F;  5ABJ B;  5GLU A;  5ABJ A;  3CBN A;  4I09 A;  2XHK A;  3WW3 A;  2GP3 A;  2PQS A;  4XMA A;  3KS7 A;  4PCR A;  5JXH A;  4IER A;  2D5H A;  2IXK A;  2N7G A;  5DZF A;  5FOJ B;  2W47 A;  2ZGT A;  3ACH A;  3OPW A;  4X6R B;  2Q8D A;  4NPR A;  3BTZ A;  3K4A A;  4CUG A;  5T5O A;  2ADD A;  1VRH 2;  1UU6 A;  3A23 A;  2HWC 1;  3D8C A;  3JZV A;  4O9E A;  1HQW A;  4QDS A;  4XTM A;  1GP5 A;  3KCY A;  4MO3 M;  4MGK E;  1LOB A;  5DDJ 1;  4Q8L A;  1RMU 1;  4FPE A;  3HJR A;  3PDQ A;  1AZD A;  3CNA A;  1F4H A;  4QX5 A;  3QOP A;  2QJV A;  1HRI 3;  2WR9 A;  4BWO A;  4FTS A;  4K8F A;  3ROU A;  3QD6 A;  4WM7 B;  3M1H A;  4WM7 A;  4E8D A;  4WZF A;  5I0D A;  1VMF A;  2YMZ A;  3DXT A;  1QDO A;  3LQC A;  4NAO A;  4V2V A;  5A6Y A;  2VW1 A;  1SFY A;  1ZZ9 A;  5F39 A;  1V9U 1;  3U07 A;  1R1A 2;  1FOD 3;  1H8V A;  3NV2 A;  1EPZ A;  4COV A;  4ZZ5 A;  5KHG A;  4LXL A;  2WSU A;  4JV4 A;  4N7U A;  1RXF A;  2JJ6 A;  4H7L A;  5JXI A;  1MPX A;  2ZHM A;  3AM2 A;  3GM8 A;  4GAZ A;  4CDW C;  3KV9 A;  4E8C A;  4RN5 A;  2R04 2;  1HRV 2;  3DF0 A;  1AYN 2;  3M4F A;  4E2S A;  1G9B A;  3U4X A;  1GP4 A;  1QQP 3;  4BK4 A;  4BXS V;  3ON7 A;  4JQR A;  2RMU 2;  1ULE A;  4W50 A;  3LWC A;  1WBL A;  2XJP A;  5IK5 A;  4LBQ B;  3HWJ A;  4LBQ A;  3D82 A;  3ZYP A;  1GZW B;  1GZW A;  3IT8 A;  4YW6 A;  1RUJ 3;  4BIF A;  4OMC A;  1O4Z A;  1IHM A;  2ZX4 A;  3GBW A;  1N1V A;  4KQ7 A;  1PO1 1;  1BKZ A;  5FK8 A;  1GYK A;  1G86 A;  3MIH A;  1LOG A;  1TME 1;  2WT1 A;  4JDM A;  1W6N B;  2C6S A;  1W6N A;  3D4K A;  4I0W B;  4LEJ A;  4QGM A;  4ZKT B;  5B2G B;  3EMR A;  4Y1Z A;  3VLB B;  5LA1 A;  2Y8K A;  2CU5 A;  2LAL A;  1PGW 2;  3SXW A;  3J8F 3;  1VBC 1;  1CX4 A;  1S0D A;  4Y26 A;  5FYV A;  2ZMN A;  5FZD A;  1N3O A;  4HXC A;  4YVW B;  2XOM A;  4IGQ A;  4YVW A;  2P2K A;  1QH7 A;  5K4L A;  5IVC A;  1J1L A;  4MXV A;  1PMI A;  4IND A;  3POG A;  5LBE A;  4NAM A;  3T2T A;  5GLW A;  4D69 A;  1BEV 2;  2DVA A;  3NNJ A;  2VU9 A;  3LA3 A;  5FO7 B;  4OHY A;  3VZO A;  5FUI A;  4QPW A;  1OFS A;  2DTY A;  3EHK A;  5A7Q A;  1H9W A;  5KC5 A;  2YGM A;  4LUM A;  4Q8K A;  3PIJ A;  4QQH A;  1OUX A;  1BQP A;  5DQ0 A;  4M3C E;  2VQ0 A;  2XUE A;  4PT6 A;  5FO9 B;  4XAC A;  4BMB A;  1OH4 A;  4AGG A;  1AR6 2;  2WNU B;  2WNU A;  2YZ4 A;  1WA6 X;  2J1U A;  4KL1 A;  4UOJ A;  3WHT A;  3E1F 1;  1Q8V A;  4R9C A;  5FZ7 A;  5CIS A;  4BK5 A;  1NXD 1;  1W0P A;  3ZN6 B;  4Z2A A;  3ZN6 A;  5FYS A;  3OY8 B;  4ZU4 A;  3OY8 A;  4TN7 A;  5C8W A;  3U14 A;  3AZY A;  1WLT A;  3BPZ A;  3I3Q A;  1F35 A;  3IDA A;  4HPK B;  4HPK A;  2HWB 1;  2J1T A;  2QQW A;  3ACI A;  3ATG A;  5AVP A;  3UKN A;  3WVJ A;  4CYD A;  2VC9 A;  2ZCW A;  4IEO A;  4FAH A;  4FBF A;  5KXB A;  1DCS A;  2HWD 3;  4D3W A;  2EAA A;  3NKT A;  1FMD 3;  5FPA A;  1DQ6 A;  1VBD 1;  3ZYB A;  1KDM A;  2JDP A;  4V2W A;  3THD A;  1PM7 A;  1EY2 A;  3KD4 A;  3ZN5 A;  1PX4 A;  1MS5 A;  4CCK A;  2G9F A;  2Y34 A;  3GGL A;  3C7H A;  4A7Y A;  3VBU B;  3VBU A;  1LOD A;  1UZV A;  3U11 A;  2Q5T A;  5A3O A;  5A1L A;  3MFC A;  4EV0 A;  1HKD A;  1OF3 A;  1H2M A;  1W9S A;  2VTX A;  3K3N A;  1W6P B;  4SLI A;  1W6P A;  1DGR N;  3OGG A;  4XF3 A;  5JVV A;  4MGZ E;  1PNG A;  3GXU A;  3H1M A;  2CGO A;  3LGR A;  2ARE A;  3ZN4 A;  4AVS A;  3AKP A;  1KD7 A;  2QQL A;  1R08 1;  2WAO A;  2WZ8 A;  3AYC A;  1RUD 3;  5IK7 A;  1JS9 A;  1Q8S A;  2Q8C A;  2VNO A;  3VBF C;  5C70 A;  2GC2 A;  2R49 A;  3O1S A;  4GZ9 A;  4QPI C;  4S2G A;  4DY3 A;  5JSR A;  1QOT A;  1WW4 A;  3MGU A;  5GZG A;  1VAM A;  1GZT A;  1DQ0 A;  3ILR A;  4CP1 A;  4ERO A;  1PO1 2;  2V09 A;  3NQH A;  2WII B;  2HYK A;  1RUE 3;  1TE1 B;  1G9A A;  1TME 2;  4AVA A;  3ZDV A;  3N3H A;  4B29 A;  2RS5 1;  2OZJ A;  1TNF A;  3AMP A;  5JOW A;  2B7Y A;  2KR2 A;  2ERF A;  3NVC A;  1XSR A;  1G9F A;  3J26 N;  3ZR6 A;  5HCA A;  1LGB A;  3WOG A;  5K0U C;  1ENX A;  1Y43 B;  3OD4 A;  2Q1F A;  4KWU A;  2G4I A;  2Z79 A;  3BB6 A;  1AXY A;  1W90 A;  3X29 B;  4COW A;  2B9V A;  4HVO A;  3B9C A;  1XE0 A;  4IET A;  4L8Q A;  3WW1 A;  1ZZ7 A;  3B9I A;  3VBS B;  2MEV 1;  1O59 A;  3UYJ A;  1PM4 A;  3VBS A;  1OFN A;  2Q1Z B;  5FXX A;  3U78 A;  2VMF A;  1SHW B;  3I2O A;  3NJY A;  1UX7 A;  1VBB 1;  2QTW B;  2RS3 3;  4Q26 A;  5H9Q A;  2P6C A;  5F2S A;  1OLM E;  2VOT A;  3CEW A;  4BME A;  3THC A;  2VBB A;  4Y22 B;  1NOV A;  3QAC A;  4Y22 A;  1QOO A;  2RJK A;  4LR4 A;  1WCS A;  1AX2 A;  5BXX A;  2EXJ A;  5JWP A;  4W65 A;  5C8C C;  4I30 A;  1C28 A;  3U1X A;  3SNM A;  4AI2 A;  2UY9 A;  2RG4 A;  4XMI A;  4PIZ A;  5F6L B;  2WQ8 A;  2BYV E;  3HNM A;  2IXH A;  5KXD A;  2C0Z A;  4Q1R A;  3WDY A;  4LO4 B;  4CZS A;  3B02 A;  1PGS A;  4Z2W A;  2EIC A;  2RS1 3;  4XFB A;  5DG2 A;  5CEH A;  1ZZC A;  2JD4 A;  4GXL A;  4D7T A;  1GU3 A;  1VBD 2;  4CDQ B;  4CDQ A;  1XYP A;  3LZZ A;  4TWT A;  5KR7 A;  4QHO A;  5DAQ A;  2Z69 A;  2AH2 A;  1JYN A;  3OUJ A;  4I0A A;  1S0F A;  5FP7 A;  5FZB A;  4ZON A;  4CE8 A;  4AK3 A;  4UW4 A;  4NII A;  2Q8O A;  1JN2 P;  1PZ9 A;  1Q5O A;  1ZZB A;  1QJY 1;  5I91 A;  4QKN A;  2WZR 1;  3E6B A;  1H8T B;  3NST A;  1H8T A;  1K3I A;  1UXZ A;  2P34 A;  2Q30 A;  2VOK A;  3KVA A;  4QGN A;  5C3S A;  3GZU C;  1RUO A;  4UXA A;  4JKM A;  2CSG A;  5DAV A;  1QXJ A;  2W52 A;  1O5U A;  3MV1 1;  3VD9 A;  4D6R A;  5FKC A;  4CXY A;  3J4U H;  5FMO L;  5C5U A;  4XFC A;  1R08 2;  1KJL A;  3ACF A;  3OGS A;  3PVB B;  1YI7 A;  1V6I A;  2FMD A;  3RDI A;  2W9X A;  4FPJ A;  5JR7 B;  1HV1 A;  1AVB A;  2F17 A;  2P3J A;  4L99 A;  4IW3 A;  1POV 1;  5F9T A;  4Z82 A;  2P37 A;  5HCF A;  2KXL A;  2K2S A;  2Y60 A;  3TNQ A;  3BIE A;  1D0H A;  1RUH 1;  1GQP A;  4DUW A;  4UW6 A;  4A7K A;  4Y24 A;  5C3O A;  4ZU7 A;  1QHD A;  4YVW C;  2RS5 2;  3M7A A;  2V72 A;  5A6X A;  3CZJ A;  4JKL A;  5F8P A;  1WMX A;  5HV4 A;  2OQ7 A;  4ZY9 A;  5JXG A;  4A7Z A;  3ZXL A;  1S0I A;  4EN7 B;  3BTY A;  2XVL A;  1UU5 A;  3AKQ A;  3ZFG C;  1B35 C;  2JB8 A;  4K7J A;  5EZW A;  5EYY A;  2BNO A;  1KRI A;  2JG8 B;  4R4X A;  2JG8 A;  4N53 B;  4E2Q A;  4N53 A;  4JHZ A;  2CHH A;  2J1V A;  2RJ2 A;  3S30 A;  5LA0 A;  3IZO A;  2V4A A;  3VGI A;  1OVP A;  2K0G A;  3LOB A;  2FMY A;  3HIF A;  1H2K A;  3NW4 A;  1FPN 3;  1LHU A;  4M4P A;  3N36 A;  4Y33 A;  4A3Z A;  4C0H A;  5I93 A;  4BQ2 A;  5L9V A;  2VBD A;  1CON A;  1H6X A;  3WNP A;  2XVK A;  4P08 A;  4YW1 A;  1CIW A;  2VH9 A;  4A4A A;  5FP4 A;  1XYN A;  2PN5 A;  3AZV A;  1AR9 2;  1O4T A;  3ZFE C;  3RYP A;  3UJQ A;  3ES4 A;  3TEZ A;  4AEM A;  5D2A A;  3UGG A;  4XXP A;  1PVC 1;  5ANQ A;  2VZV A;  3QH6 A;  1UOG A;  1UY0 A;  2WO3 A;  2WIN B;  3M3C A;  3MW2 A;  1QF3 A;  4N9I A;  5FY5 A;  1REE A;  3I3D A;  2HWF 1;  1JOB A;  4XUR A;  1YEW A;  2YPJ A;  3NNM A;  5FY7 A;  4JGY B;  4JGY A;  4RS5 B;  2FDF A;  4RS5 A;  1GZ9 A;  1QNY A;  2QFE A;  4L11 A;  2YBK A;  2I2S A;  2VEC A;  5FP9 A;  2OPW A;  2Y6F A;  4GJZ A;  5J98 B;  2A6Y A;  2E7A A;  5FYU A;  4ES9 A;  4QX3 A;  3QLQ A;  4KG8 A;  5FZI A;  4COY A;  4OUL A;  4CUB A;  1UF2 C;  4R9A A;  1OC1 A;  3WXP A;  3GAL A;  4QHB A;  1ZA4 A;  1N1S A;  3RYK A;  3W5M A;  2WO7 A;  4QKB A;  5K8S A;  4QKF A;  2BGO A;  2NYY A;  1QJY 2;  1JUI A;  2A1X A;  2ZA9 A;  3OG2 A;  1ODM A;  5D1I A;  3W58 A;  1NE4 A;  4CEW C;  4L0P A;  3OJB A;  2E51 A;  5JXJ A;  3WX5 A;  1E5I A;  3MDP A;  1O91 A;  4AZZ A;  5JPN B;  4URA A;  4H3W A;  4MHR A;  4QX1 A;  4LE3 A;  3WEZ A;  2IUW A;  2VPV A;  2PHF A;  1NKG A;  2DFB A;  3PJY A;  4WVV A;  3WCR A;  2HYX A;  1HB1 A;  4IEP A;  2A73 B;  1R64 A;  3LOI A;  1TG7 A;  1AR7 2;  2XVG A;  3IAQ A;  4UBG A;  2A5Z A;  3ITQ A;  2F4P A;  1S0J A;  3TB0 A;  3MO4 A;  5CZK A;  2A3W A;  4LKD A;  5E88 A;  2GH2 A;  4LKE A;  3SQO A;  4QU1 A;  3ZOI A;  1VP6 A;  1X33 A;  1RUH 2;  3BTA A;  3I59 B;  3I59 A;  4P9I A;  3B94 A;  2QQJ A;  2VTF A;  4UI9 L;  3MBW A;  4XFA A;  5FKB A;  5T5P A;  1RUF 1;  1TMF 1;  5H9S A;  4AF9 A;  5JZG B;  5JZG A;  1VIW B;  4R52 A;  4MLO A;  2VD7 A;  5IT6 A;  4I2O A;  4YG6 A;  2W68 A;  4CEY B;  3AKR A;  4CEY A;  1R09 3;  1BLZ A;  1UKG A;  4JGZ A;  4JGZ B;  1LGC A;  3O7O A;  3MPP G;  4MV2 A;  4AL9 A;  5FY8 A;  3VKM A;  4CCM A;  2O14 A;  5IVV A;  3VBS C;  4QQP A;  2PAE A;  5LY2 A;  2X10 A;  4IE5 A;  4J25 A;  4FPK A;  1AHS A;  1REF A;  2Y64 A;  3SCH A;  1DFQ A;  1QJX 3;  3ZSL A;  5JI9 A;  3WQ1 A;  4DO0 A;  4Q4V 3;  3HQR A;  4RHV 1;  2D7F A;  1YQ2 A;  2ZTN A;  1KIT A;  4FPF A;  4BIO A;  4UFM A;  3P6B A;  5DAP A;  2YFZ A;  1SDW A;  2DBI A;  4IV1 A;  4IV1 B;  1JYW A;  1HXS 2;  2A71 A;  2W08 A;  1CZV A;  2EXK A;  3CDZ B;  2VBP A;  4KWL A;  1YXW A;  1KFX L;  3H9A A;  3NNL A;  1UPS A;  3SLI A;  3KMH A;  5EJ3 A;  3F95 A;  3EQE A;  4CDX B;  4CDX A;  4CDU C;  3AKT A;  2ARC A;  4AR2 A;  3G6J B;  1W6O B;  1W6O A;  5ANN A;  5FY4 A;  3WSO A;  1D4M 1;  1C8N A;  4NO4 A;  3C7O A;  2OII A;  1YO8 A;  2ATF A;  3J7H A;  4KGQ A;  4M00 A;  1QJU 3;  1H6Y A;  4R9B A;  1PVC 2;  4BOW A;  1MS1 A;  1RUC 1;  3IMM A;  4DS0 A;  4TXW A;  1GMM A;  4CUA A;  2QDN A;  2VXJ A;  4NR1 A;  1W6Q B;  2XR4 A;  1W6Q A;  2UU8 A;  4NE9 A;  5FOB B;  2OYZ A;  3GYD A;  1EV1 1;  3FJS A;  2VZS A;  2R06 3;  2PHD A;  3DKW A;  4KWK A;  2DU0 A;  3RG0 A;  2VNV A;  3EBR A;  4IE7 A;  4KU7 A;  4LE4 A;  4W6Y A;  2XKO A;  3F2Z A;  3ZSE A;  1VBE 2;  3KVB A;  3MIB A;  1H8T C;  2X8K A;  3RWK X;  2K46 A;  2VMG A;  2WFF 3;  4Z92 B;  1F4A A;  1ZBA 2;  5A7O A;  2VZT A;  4B8E A;  5K7P A;  3TEY A;  4NID A;  1RVF 1;  5KXE A;  1PIV 1;  1DU3 D;  2ZMK A;  1UYP A;  1K5J A;  4O7X A;  3GZT B;  1AL2 1;  3MIC A;  1LES A;  2YFU A;  5CYY A;  1V6K A;  5F3I A;  1LOE A;  5T5L A;  2VMC A;  3RRD A;  2D93 A;  3O0X A;  4EWE A;  4WM8 C;  3I2I A;  4YZ5 A;  1XE8 A;  3J9S A;  5LBF A;  4H7M A;  4QM8 A;  3HBK A;  4AGR A;  4NWV A;  2HWE 1;  2QDR A;  2GNT A;  4UF0 A;  4UF0 B;  4CDW A;  4CDW B;  1C8M 2;  3C7F A;  3M3O A;  3PUQ A;  2DVD A;  1DQ1 A;  4AVC A;  4LHS A;  5AVA A;  4BQ3 A;  1JZ3 A;  3WNM A;  1O3R A;  4NWW A;  1GWL A;  1ULC A;  5AC9 1;  1CPN A;  2J1A A;  5JDB A;  1PO2 1;  3N9O A;  5HCH A;  5F3E A;  2NN8 A;  1WLD A;  5F5Q A;  2G9G A;  3DYM A;  1J83 A;  1HJG A;  5JOX A;  3T2O A;  2RM2 1;  5J96 B;  1BMV 1;  1H4H A;  1RUG 1;  2QQK A;  1ZZ8 A;  1RUF 2;  1GQG A;  4N43 C;  1ULD A;  1VLN A;  1TNR A;  3HVD A;  3BYW A;  4QXH A;  5FMO S;  2CY6 A;  2W39 A;  3H50 A;  1LHV A;  1BBT 3;  3EYP A;  3H7Y A;  4OYU A;  1YC6 1;  5IFP A;  3H3Z A;  5GZD A;  3PVN A;  4EQV A;  5KHK A;  5E8A A;  1NG0 A;  2VZP A;  1WKY A;  4MX3 A;  3FZ3 A;  2C1F A;  2ORZ A;  4P9W A;  1HQN A;  2EID A;  2PHR A;  2RR1 1;  2XWJ B;  1NXM A;  4XQD A;  2E9Q A;  1O6U A;  1MZ5 A;  2J1S A;  2YRO A;  3N7K A;  3UKV A;  4BE3 A;  1AYM 3;  4XE9 A;  3KGZ A;  2JDZ A;  1RL3 A;  1DQ4 A;  1VMH A;  3LE0 A;  4QX0 A;  1FAY A;  2XJR A;  1EAH 1;  4Q4W 2;  5FLI A;  4YLZ A;  4MXW B;  2BDR A;  4MXW A;  1HLC A;  3B3Q E;  5FZ0 A;  4LUK A;  1MEC 2;  1RTV A;  2JDM A;  3TRS B;  2H6C A;  1MZF A;  3U0Z A;  2XQX A;  3NWK A;  2WFP A;  4AYU A;  4KI5 M;  2BVB A;  3K4D A;  4I3P A;  4JAA A;  1COV 3;  1GKB A;  1HN1 A;  1Q43 A;  1QXP A;  2WDB A;  2XJQ A;  4P9J A;  5FZH A;  5JPM B;  1D4M 2;  4JCK A;  4QQO A;  3IDE A;  5KHJ A;  2WS9 3;  3D0S A;  5FUN A;  4B4Q A;  1PK6 C;  2P17 A;  4XHB A;  4Y1V A;  3VD7 A;  1I1E A;  1RIT A;  3KF3 A;  3KV5 A;  4NVP A;  5C9A C;  4LA3 A;  3USS A;  2XJV A;  3GF6 A;  3MLL A;  3N7M A;  4XEZ A;  3RQ0 A;  3LAG A;  4XFH A;  3VZM A;  4EE2 A;  2ZEX A;  4LBL A;  2XB6 C;  3AK0 A;  1RHI 1;  4HKO A;  1IKQ A;  3VHP A;  3VHN A;  1CAU B;  3R4D B;  1CAU A;  1G6N A;  1YIP A;  1GNY A;  1OLQ A;  4P9Y A;  1HB3 A;  3ELN A;  3AB0 A;  3H1Y A;  2YHJ A;  3AMH A;  3PIG A;  3O1M A;  2R6Q A;  4A2U A;  2JDH A;  2W46 A;  3WQ7 A;  3N35 A;  2XGX A;  4BU2 A;  1JYV A;  4Q2F A;  3FUO A;  4RYD A;  3I2D A;  1LHO A;  2AGS A;  3V65 A;  3INA A;  4JKK A;  4BLI A;  5CA6 A;  1GIC A;  5FY9 A;  4W6W A;  1SPP B;  2PMW B;  1SPP A;  5LW9 A;  4RGK A;  2ARB A;  1X7N A;  1H2L A;  2HEW F;  4BQ4 A;  5A7S A;  2JG9 A;  1WUV A;  1NUK A;  4XIL A;  1VR3 A;  1OI6 A;  2HWE 2;  3DN7 A;  3ZFF C;  1C57 A;  2BU9 A;  1V6J A;  4GB3 3;  2V5D A;  1W2N A;  1GNZ A;  1V0A A;  3LIG A;  3KCC A;  1NAE A;  1R1A 3;  1S55 A;  3FMG A;  4LQR A;  3VBF B;  4DFS A;  5E6H A;  2YYO A;  3IDC B;  3VBF A;  1MS3 A;  2PHT A;  2AEN A;  2QQM A;  3UV9 A;  1PO2 2;  1OXC A;  4QPI B;  3LCP A;  4QPI A;  1JZ5 A;  3WLU A;  4XJU A;  4JGZ C;  3HT2 A;  3POB A;  2R04 3;  1HRV 3;  1AYN 3;  5GZE A;  1W8T A;  4FTE A;  3JD7 2;  3SKJ E;  2A7A A;  1RUG 2;  4LIU A;  2A70 A;  1K42 A;  2RMU 3;  1RJ7 A;  3PME A;  2DUQ A;  5F1R A;  2VAU A;  3AJZ A;  4XFI A;  3WF1 A;  4Q4X 2;  4XBL A;  2GMP A;  5G04 L;  1XC6 A;  2O8Q A;  4XJZ A;  5FK7 A;  5L9R A;  1KFU L;  4FVV A;  3ABZ A;  1NE6 A;  2J7M A;  4GMP 1;  2R1B A;  5KC6 A;  2TUN A;  5K0U B;  3K3O A;  4HFS A;  2LS6 A;  5K0U A;  2YDE A;  2WWJ A;  3LEM A;  1OOP C;  2VCM A;  3HPN A;  2WKK A;  2PFW A;  4A45 A;  1O4Y A;  1PMH X;  2D6N A;  1PZ7 A;  3OB8 A;  2QQI A;  4HKL A;  4D6S A;  2ZHL A;  1UY3 A;  1ENQ A;  2QVS B;  2CAU A;  2GP5 A;  3NJV A;  1RUI 2;  3OD0 A;  5FZ8 A;  5CKM A;  1O3Q A;  1UMZ A;  4MZU A;  2FDI A;  1OF4 A;  4DIN B;  4MOA A;  1BK1 A;  4IQP A;  1ST8 A;  1O3T A;  3L9J T;  3DPR B;  1JZ7 A;  3DPR A;  5A3U A;  1MR5 A;  1WD4 A;  3PU3 A;  4HMZ A;  3HBZ A;  1BEV 3;  3UT0 A;  4UAP A;  2FHR A;  1QJF A;  3ORJ A;  5LEK A;  1RC6 A;  2YC2 A;  4RSU A;  3VBO C;  5C8C B;  5C8C A;  1ZYB A;  4LBJ A;  5BUV A;  1ZRC A;  5FYT A;  1HB4 A;  2FCT A;  2W92 A;  2WJS A;  1UZ0 A;  4AFB A;  4PF5 A;  5J3U A;  5ACA 1;  4DOU A;  2XG3 A;  5C6C A;  1AR6 3;  5FXV A;  4XIK A;  1HRI 1;  2JXA A;  2OXB A;  4QHZ A;  5DUV A;  1UW8 A;  4YW7 A;  5IAV A;  3WQB A;  1ZZ6 A;  4FSJ A;  2C4X A;  1IQA A;  2RE9 A;  1LHN A;  4EN0 A;  3RZM A;  2YBS A;  4Q0P A;  3R4S A;  1EP0 A;  1FOD 1;  2Y0O A;  2XJU A;  3FHQ A;  4DB5 A;  2YY1 A;  3TAY A;  1DF0 A;  1BJQ A;  5LZ6 A;  1A78 A;  4UT5 A;  1V6M A;  3MLK A;  4QMA A;  5EXO A;  1ZRR A;  4BZ4 A;  3GCX A;  3S6P A;  2VZO A;  2Y26 A;  1H30 A;  1SLT A;  1QQP 1;  4XUO A;  1AXZ A;  4E27 A;  3BOD A;  3SMH A;  4LLO A;  5KWR A;  5FYC A;  2R07 2;  3CIH A;  1S2E A;  2DFC A;  2WBK A;  1STM A;  3HNB M;  1NLQ A;  3ETQ A;  1OQE A;  3JBG 3;  4AVV A;  1ASJ 2;  1SEF A;  1RUJ 1;  1PZ8 A;  4YM3 A;  5FJK A;  5M0T A;  1W8F A;  3E6C C;  2GU9 A;  2W94 A;  3EB7 A;  5FY1 A;  3J7M A;  3ZLI A;  5I0R A;  3AP4 A;  4AQ6 A;  1ODN A;  3KB5 A;  2JKX A;  4IUG A;  4RL7 A;  3T4V A;  3T2Q A;  5L19 A;  4K6B A;  2CTV A;  4HKW A;  4KH9 A;  3WNX A;  1W9T A;  2PLV 2;  4HON A;  5DAB A;  5HCB A;  1W8N A;  1M4W A;  3RMX A;  3CL1 A;  2QE3 A;  3J8F 1;  3O1O A;  1W2A X;  2ZAH A;  3VZL A;  1WLW A;  3GCW A;  3R05 A;  3O14 A;  2P3K A;  4QPY A;  3WQ0 A;  2ET1 A;  3U37 A;  1PGL 2;  3NO8 A;  3ST7 A;  4XJW A;  2A6X A;  1NZI A;  3SIS A;  1I5Z A;  1PO1 3;  1OBN A;  2B5H A;  4Q0V A;  1B35 B;  2A3X A;  1B35 A;  4QPG B;  4QPG A;  3ZFG A;  3ZFG B;  5J48 A;  3HT1 A;  5A3P A;  3MIF A;  5FZ4 A;  3ZXA C;  1JTZ X;  2EIG A;  1CN1 A;  4QT6 A;  1DLL A;  2CYF A;  5FQ0 B;  5FQ0 A;  4BH9 A;  5BNN C;  3FFQ A;  3NJX A;  4XF9 A;  2AEY A;  2ENR A;  3FUQ A;  2BNN A;  4NMI A;  4AFC A;  2WO1 A;  2ZPX A;  1S0C A;  2BUK A;  4LHL A;  1Y9M A;  3K4Z A;  1POV 0;  5E16 A;  3FHI B;  1JYX A;  1SLC A;  2YGL A;  4OI1 A;  5LWB A;  2FBE A;  2R30 A;  1YUD A;  3CF6 E;  1O3S A;  4P9L A;  1C5I A;  4CVU A;  3ZXE A;  1IPS A;  4BPZ A;  1VB2 A;  1UZZ A;  5FP8 A;  3VUO A;  3ZFE B;  1UQX A;  2HWC 2;  3ZFE A;  1CQ9 A;  1F5F A;  4ZXE A;  4G3Y C;  2WAB A;  1XBF A;  3LFM A;  4Y5S A;  4YAR A;  5DDJ 2;  4NOT A;  2OS2 A;  1RMU 2;  2D98 A;  5ACA 2;  5EJZ B;  3NJZ A;  4GIQ A;  3ZDS A;  1O7F A;  5C71 A;  2J42 A;  3B93 A;  1QGL A;  2VR4 A;  3FX3 A;  3HAG A;  3S7I A;  3APB A;  2HLE A;  2VCC A;  2XXZ A;  4PI0 A;  4YW2 A;  1S0B A;  3VDB A;  3BKZ A;  2RDS A;  2VGD A;  3BAL A;  3Q8A A;  4UYB A;  1V9U 2;  3OBR A;  3OF1 A;  2ZKL A;  3TEX A;  2JG9 C;  5CB7 A;  2VVF A;  2IXI A;  3NV3 A;  4UWD A;  4AFD A;  1CWP A;  4XJ8 A;  1K12 A;  3Q8E A;  2BNM A;  2RVA A;  4IDZ A;  5SV8 A;  4ASL A;  3RZK A;  4OUM A;  4CEW B;  4CEW A;  1GV9 A;  1JMU B;  1QU0 A;  1ZX5 A;  5F6K A;  3AJY A;  1LAJ A;  1K45 A;  3HMY A;  1H2N A;  2ZGN A;  1QH6 A;  4K21 A;  4XW3 A;  1GLH A;  3MPB A;  3VHO A;  1YIF A;  1GOF A;  1GUI A;  3U75 A;  4FPY A;  2FZ1 A;  1I6X A;  3AZX A;  1UYX A;  2GN3 A;  3KV4 A;  3OGV A;  5FZM A;  2VNR A;  5IJR A;  4LO5 B;  4QDQ A;  1J59 A;  3T0B A;  1RUE 1;  1U5I A;  1SZB A;  3WP3 A;  1AJO A;  1LEC A;  3ZM8 A;  4AG4 A;  4OQ9 A;  1X8E A;  5CFD C;  4J1W A;  1R08 3;  3ZXJ A;  4YVS C;  2GC0 A;  4DXZ A;  1VBC 2;  5EV7 A;  2EVX A;  1DG6 A;  1ULP A;  2HBT A;  3K46 A;  1W06 A;  4MET A;  2DUR A;  1OLR A;  4Y5T A;  3BVC A;  5CKQ A;  4MHU A;  2R7E B;  1H1M A;  2E7Q A;  1KQR A;  3PTY A;  4HOO A;  1BYH A;  4RFT 0;  2P4E A;  1W04 A;  4N90 A;  3WUD A;  2IWG B;  2B4K A;  1XB9 A;  3WG3 A;  1SDD B;  5FV3 A;  4ET7 A;  3VL8 A;  2QKD A;  3BOP A;  3WF0 A;  4RFR B;  3DXU A;  4BM8 A;  3W59 A;  4HBN A;  4C1W A;  2MNG A;  1OUR A;  4Q4Y 1;  2RS3 1;  4U36 A;  2DV9 A;  3DPR C;  1C4R A;  4B1L A;  1H1I A;  3NMB A;  5FXZ A;  4AHY A;  2ZBJ A;  1XU1 A;  5FFO C;  3LFI A;  1WWY A;  4WBB A;  5CKN A;  4PDW B;  4KGG A;  4PDW A;  4O65 A;  1L7L A;  2EF6 A;  4H14 A;  2KD7 A;  3WZ1 A;  4AVT A;  2PEL A;  3JQW A;  1C5H A;  2V4V A;  1F15 A;  3E5Q A;  5EWS A;  1CPM A;  3THP A;  2F6B A;  5F3G A;  4CDU B;  3AKS A;  1OUS A;  4CDU A;  3TN9 3;  1BZW A;  2HWB 2;  4COZ A;  4JDN A;  2RS1 1;  1S0G A;  2FQP A;  4GJY A;  3ZIW A;  5IWF A;  1FX5 A;  1ZVF A;  4X8P A;  1Y9G A;  2DCY A;  1W39 A;  3VZK A;  2Q4S A;  4NIH A;  1AR9 3;  4YW5 A;  4K8R B;  3S7E A;  1XNT A;  3WG2 A;  3ZKU A;  1U5Z A;  1DYK A;  2G1M A;  2VVE A;  5DAW A;  5F37 A;  3WNL A;  3ZPY A;  5B4N A;  2FCU A;  2JB4 A;  1NYW A;  2ARX A;  4CUC A;  3VKO A;  2XUM A;  1ALY A;  2ETE A;  4Y5Z 0;  4GWJ A;  2VW2 A;  3LDR A;  4M4R A;  4OLL A;  1Q8O A;  1PMJ X;  2C9K A;  4URT A;  3GNE A;  5GLZ A;  4WVZ A;  4XZP A;  4K1Y A;  4Q0Q A;  5FZE A;  3B69 A;  3RZH A;  4JRL A;  4AI8 A;  1UMI A;  1VMJ A;  4OFG A;  1S2B A;  4OHX A;  4YFW A;  2AC1 A;  2RDQ A;  2WQZ C;  1T6G C;  3M70 A;  4WM8 A;  4WM8 B;  1PVX A;  4XVH A;  5L73 A;  4TZD A;  5A3L A;  1QOS A;  2AEZ A;  1YLL A;  2H6B A;  4DEQ A;  2WN2 A;  4NIA A;  3AZW A;  5FZF A;  4PIX A;  5CVR A;  5KBF A;  3BUC A;  1US3 A;  2ORX A;  3WCS A;  1YQ8 A;  2WUH A;  1Y4W A;  1BHG A;  1RUE 2;  2Y6J A;  4NRQ A;  4YM0 A;  5IVF A;  1XQN A;  2FDH A;  1D2Q A;  2Z2S B;  1I3H A;  1DP0 A;  1HW5 A;  1UYY A;  4S2H A;  1CZT A;  2QZ2 A;  2DTW A;  3WNK A;  2VL4 A;  1E5R A;  3SC7 X;  4PHZ A;  3A22 A;  4YSF A;  2OA2 A;  1IOA A;  4QPG C;  4Y1U A;  5FPV A;  2PHW A;  4CA9 A;  1YQ5 A;  1XXN A;  2MPF A;  3W20 A;  4AI0 A;  1AR7 3;  4N43 B;  3VDA A;  3KWV A;  4N43 A;  3TWI A;  3ZPO A;  1K5M C;  1NY7 1;  3ZYG A;  1OKO A;  1B09 A;  3Q9O A;  2ZX0 A;  1SFN A;  2JDK A;  2R0H A;  5FPB A;  1RB8 G;  1DQ5 A;  1RUH 3;  3AP5 A;  3KT1 A;  5F32 A;  4QGL A;  5J37 A;  3DV8 A;  2MEV 2;  2F4L A;  5T54 A;  1DZQ A;  1W9W A;  3FFZ A;  2LTN A;  3B7M A;  1CIY A;  4Q4Y 2;  4FT8 A;  2D6L X;  1VBB 2;  2RS3 2;  2VQA A;  5DZE A;  3KQR A;  3FL7 A;  3PNA A;  2Z4F A;  4P02 B;  2D43 A;  1S2K A;  4GUL A;  1ZNP A;  1WCQ A;  3S5Q A;  1NQJ A;  1L3J A;  4NHK A;  5IVJ A;  3I49 A;  3MUZ 1;  1ENR A;  4I0B A;  3L2H A;  4ITC A;  2FDK A;  4K9S A;  4B4P A;  5I8Y A;  5FYZ A;  1F9K A;  1CD3 G;  4YM2 A;  2NMO A;  4AHZ A;  1LJ7 A;  2ZX1 A;  4FP2 A;  2AR6 A;  3EO6 A;  3MW4 A;  4IE4 A;  2VTX J;  2JIG A;  5FZ6 A;  5CFC C;  5JMO A;  1HXS 3;  1YJK A;  3AMN A;  3IDB B;  2BGP A;  2EAL A;  2Q0A A;  1A6C A;  1PK6 B;  2ZGQ A;  1PK6 A;  2WNV C;  3AP9 A;  1NLR A;  1Z7S 3;  3C7E A;  5FIX A;  5FYB A;  4B3N A;  4XFF A;  2FD8 A;  1YFU A;  2GH8 A;  3LEG A;  4PIY A;  5C9A B;  2BQP A;  5C9A A;  5J36 A;  2PHX A;  2UUR A;  2ILM A;  1JBC A;  4RQP C;  3FBY A;  4ISR A;  2ZJC A;  1Q56 A;  1J3P A;  2W95 A;  4K40 A;  2E6V A;  4WVM B;  1ZRD A;  4WVM A;  3AYE A;  1FT9 A;  2JE7 A;  3K2O A;  1W0N A;  3SH5 A;  1E5S A;  1PVC 3;  1YCI A;  4XF1 A;  2WZR 2;  1WMD A;  2XBO 1;  5FYI A;  4GAL A;  4DXT A;  2ZAA A;  4LJH A;  1YQC A;  4UFH A;  1WCK A;  4FXK B;  3IN9 A;  3ZYJ B;  2Z5W A;  2BBV A;  1KDK A;  2CAV A;  3V64 A;  3RYR A;  2XLA A;  4C90 A;  4FP3 A;  1RUN A;  3N7L A;  5JSO A;  5GAL A;  1HB2 A;  2ZS6 B;  2NM1 A;  4EYU A;  1VBE 3;  1XNC A;  3DYP A;  1PHM A;  5GZF A;  3WT3 A;  4F83 A;  2ZML A;  1LOF C;  2W3J A;  1ZBA 3;  4RGA A;  4CXW A;  2DUO A;  3KZ4 C;  1HN0 A;  4AWD A;  3ZFF B;  4B7E A;  1J58 A;  3ZFF A;  4P5Y A;  3AYA A;  4L2N A;  5T3N A;  4NRO A;  2OUJ A;  3ES1 A;  4CCE A;  4DRR A;  3FLR A;  1WW6 A;  1XND A;  5A3W A;  2QQP A;  3N9P A;  4CCC A;  4IEQ A;  4F3J A;  3OCP A;  1H1A A;  5FBJ A;  3CJX A;  4QX2 A;  1JYT A;  1F31 A;  3M8L A;  4FXG B;  1SMV A;  3RVH A;  1R09 1;  3G7D A;  3HOB A;  1C8M 3;  1P8J A;  4BDV B;  1OHF A;  5IVE A;  1FAT A;  2A6Z A;  2GAL A;  3D3A A;  1UX6 A;  3MHZ A;  4UW3 A;  2WRA A;  1QJX 1;  2CL2 A;  4YYO A;  2PHL A;  3UKT A;  4A6S A;  1DBN A;  1N3P A;  2VJX A;  5FZL A;  5H9P A;  5C4W A;  3VD5 A;  2CNA A;  4H2A A;  1IG0 A;  4NPL A;  4QD2 A;  5C4W B;  4AED C;  2VZ3 A;  4QU2 A;  5AFB A;  4PDW C;  1C1F A;  4J1X A;  2ZGK A;  1HX6 A;  1RUF 3;  2WO2 A;  1RIR A;  4HN1 A;  3T1M A;  1OOP B;  5HBA A;  1OOP A;  3A0K A;  3E97 A;  4BQX A;  2WWU A;  2ZHK A;  4DXS A;  3OPZ A;  3BN6 A;  3E5U A;  4CSW A;  4FFI A;  1LNS A;  1SLA A;  3I2G A;  2EXH A;  1JHJ A;  4RGG A;  2VQT A;  3LEK A;  3S57 A;  3N4M A;  4KG0 A;  4NUB A;  4EZH A;  4BA6 A;  1LHW A;  5A6Z A;  5IHR A;  1XYO A;  3PMS A;  3JUU A;  5CG8 A;  3T09 A;  1N3Q A;  3VKL A;  1US2 A;  2Y0I A;  3WY6 A;  4CPB D;  5JMC A;  1W0O A;  3O5S A;  1SLI A;  2PAK A;  1IS6 A;  5B4X A;  1A34 A;  4Q4W 3;  1S0E A;  1ZM1 A;  2HWF 2;  3VBO B;  3VBO A;  2R06 1;  2G9Z A;  2BEO A;  3CJI B;  5KXC A;  3CJI A;  2Y38 A;  2Y6H A;  1MEC 3;  3JB4 C;  4XIO A;  2XML A;  1G9D A;  2K9Z A;  1YI9 A;  2WYF A;  1IPJ A;  4RA0 A;  1ONA A;  2BOJ A;  5I8S A;  3O1V A;  2P3Y A;  4COU A;  4PI2 A;  2WFF 1;  2GC1 A;  3KT7 A;  1WME A;  3N9L A;  2BWA A;  3FN9 A;  4BYY A;  2CGN A;  2OZ6 A;  4EN9 B;  2ZGS A;  3NAP C;  2D3P A;  3LSE A;  1D2S A;  1HV0 A;  4X8N A;  5HXV A;  3ENR A;  2D6K A;  1RXG A;  2XBO 2;  4JDO A;  2CWM A;  4BQ1 A;  3W5N A;  2BPA 2;  2QNK A;  5A70 A;  4HK8 A;  2WSV A;  2BWC A;  3KCX A;  4OHZ A;  4MGI E;  3ZSJ A;  1QKQ A;  2HEV F;  3IBM A;  3GJA A;  2J22 A;  1LCL A;  2J1R A;  4ZPI A;  4EN6 B;  1A3K A;  1XU2 A;  1QEX A;  1WGP A;  2L9L A;  3LDK A;  2OQ6 A;  5BNP A;  5BNP B;  1ENS A;  3VV1 A;  3CU7 A;  1O5L A;  5A80 A;  3K48 A;  4B7K A;  4E4Z A;  4WV8 A;  3TYJ A;  3OBA A;  4DRV A;  5LY1 A;  4IES A;  4XAA A;  3CHX A;  1MS0 A;  5IK4 A;  3NV4 A;  5DZG A;  3BCW A;  3O1R A;  3JB8 A;  2AAC A;  3AC0 A;  4Z8B A;  1IS5 A;  2CWS A;  2YB7 A;  4OCT A;  1W2O A;  4NJ4 A;  2ZGR A;  1E5H A;  3T08 A;  4P14 A;  4YZ1 A;  2WC2 A;  5T5J A;  4XPV A;  2ZGU A;  1TMF 2;  4RR3 B;  3RPQ A;  4RR3 A;  1X50 A;  5FZG A;  4EZ4 A;  1XNA A;  2VME A;  1UY2 A;  3P3P A;  1BBT 1;  5BV6 A;  1QXR A;  2ZKN A;  2HWE 3;  1VBA 3;  4JVA A;  4GKX A;  1KXG A;  3ZSM A;  2OT7 A;  3UES A;  4ATE A;  2DVF A;  3AZZ A;  1GWK A;  2R16 A;  3POW A;  4FPH A;  4HSJ A;  2XHN A;  3OBT A;  4B4R A;  4QKD A;  4GQ7 A;  3BU7 A;  1UKR A;  2UWB A;  1T6B X;  4QM9 A;  1Y3T A;  2R32 A;  3T0A A;  1X36 A;  1AYM 1;  1VAV A;  1ZBE 1;  3O0W A;  4RHV 2;  2HH9 A;  3JD7 3;  3LDB A;  1RUG 3;  3FHA A;  3VB9 A;  4D0Q A;  5HV0 A;  2VUJ A;  1JZ8 A;  1HJF A;  2NMN A;  1VB4 A;  2W0X A;  2WNE A;  2R1D A;  3LPG A;  4Q4X 3;  2ZZJ A;  3LEI A;  4AEK A;  4EWD A;  1Y7B A;  2ZGM A;  3N7J A;  4RD7 A;  1ZRF A;  3WNO A;  5BNN B;  5BNN A;  3O1U A;  3A21 A;  4PBP A;  3TBD A;  4G4F A;  2W1U A;  4QWN A;  4JX0 A;  1COV 1;  3WP6 A;  2A75 A;  3PUH A;  5LRR A;  5A1F A;  3C7G A;  3WDU A;  1QIQ A;  3VD4 A;  2WS9 1;  1G7Y A;  4LOS A;  5FWJ A;  3I2K A;  1VPH A;  2XWB B;  1RED A;  1RUC 2;  4OMD A;  3TEW A;  1GP6 A;  2BVV A;  1RUI 3;  4IEY A;  1OD5 A;  3IAP A;  4LBK A;  1UMH A;  1DQ2 A;  2PA7 A;  2MHF A;  2YG0 A;  3QBQ A;  4GH4 A;  4GH4 B;  4GWN A;  1EV1 2;  1NCQ B;  2R06 2;  1NCQ A;  4XJ9 A;  3OBZ A;  4LUL A;  2AZ5 A;  2QBX A;  2IFR A;  4K1Z A;  2UY8 A;  4YG3 A;  5K9Y A;  2NP0 A;  5L7O C;  1QY4 A;  2JWP A;  4JTO A;  4DNY A;  4XF4 A;  3FBM A;  1OQD A;  3RWN A;  2DBN A;  2CDP A;  3BGA A;  1H9P A;  3CQO A;  1VRH 3;  2ES3 A;  1RVF 2;  1FYU A;  1PIV 2;  3CZU A;  5F2W A;  1QDC A;  3EJK A;  1AL2 2;  4YZ2 A;  1KS5 A;  4AHW A;  5JR2 A;  1N1Y A;  3B5L B;  5F5A A;  2D97 A;  5EFU A;  5FWE A;  2WNO A;  2ZEY A;  2IZW A;  2W87 A;  2C24 A;  3MF6 A;  4FQZ A;  4YWA A;  3WDV A;  2JG9 B;  4F8A A;  4A42 A;  1YNA A;  3LPF A;  5C5T A;  2VOX A;  2XJS A;  4QX8 A;  4EN8 B;  4C8D A;  4HVQ A;  4LO6 B;  3ZVX A;  5A33 A;  4GB3 1;  4ARX A;  5A33 B;  2VMD A;  1VJ2 A;  1TVG A;  1XPW A;  1XRU A;  2DWR A;  4LO8 A;  5LRS A;  1V6N A;  2D6P A;  2G19 A;  5IAX A;  3J7N A;  1X8M A;  5D21 A;  1GZC A;  2XON A;  3SCG A;  3JU9 A;  5AC9 2;  4IEU A;  5CAZ A;  2X09 A;  2ZGL A;  4FOQ A;  2DCK A;  3POS A;  4LKF A;  4NHX A;  2R04 1;  1AYN 1;  1SCR A;  4CCD A;  4XFG A;  2RM2 2;  1U5X A;  3DEM A;  1BMV 2;  4YRD A;  1RYY A;  3ZMO A;  3MW3 A;  2RV9 A;  1J3Q A;  2RMU 1;  1NLS A;  1LED A;  1MS8 A;  2R07 3;  5C7G A;  2ZHN A;  2B39 A;  2BGC A;  5DMY A;  4L92 A;  2XQR A;  1ASJ 3;  1WD3 A;  5CFD A;  2FDJ A;  5TSW A;  5BNO B;  5BNO A;  3PLQ A;  5CFD B;  1JHN A;  1EPW A;  3DYO A;  5C4W C;  1UY4 A;  2W1S A;  2WA3 A;  4YVS B;  4YVS A;  4X6Q B;  5FAX A;  4C0B A;  2Z42 A;  1W2T A;  3H8O A;  2PYT A;  4WVW A;  1MQT C;  4MH0 E;  3W21 A;  5JI7 A;  2RR1 2;  1POQ A;  1AR8 1;  2PLV 3;  3BIW E;  4Q1P A;  1AYM 2;  1ZBE 2;  2DCT A;  5BNQ A;  2A6V A;  2XH6 A;  2BBA A;  3HEI A;  5IFT A;  1EAH 2;  2VOW A;  3GZA A;  4OI0 A;  4XHX A;  2JX9 A;  4HN0 A;  1E57 A;  2VCA A;  2H0V A;  5D8A C;  2CGP A;  2EAK A;  3DL3 A;  3H42 B;  1SQ4 A;  2GNB A;  3VD3 A;  4EJR A;  3KHB A;  1BEV 1;  4BCU A;  3WW4 A;  2RJL A;  3FC0 A;  3OGR A;  5EYX A;  1COV 2;  1SBD A;  1O8P A;  2D5F A;  2W1Q A;  4HAN A;  4MYE A;  4Q5O A;  2VY0 A;  1JU4 A;  4UBH A;  2WS9 2;  3CJI C;  3UET A;  3ILF A;  3P1I A;  2C5D A;  1XOY A;  3C3V A;  2BP6 A;  4PBO A;  1ACC A;  4JQT A;  5FZ9 A;  4FAG A;  2DVB A;  4M01 A;  5CBL A;  2O8O A;  1AR6 1;  1UU4 A;  2H0B A;  4NRM A;  3NNG A;  3WHU A;  3UK9 A;  3VZJ A;  1RHI 2;  4AAP A;  5JIA A;  4AGV A;  1YFY A;  4N7I A;  4PQQ A;  4DUX A;  1KGY A;  1N1T A;  2JEM A;  3D0J A;  4OI2 A;  1ND3 C;  4FPC A;  1W3X A;  3H8U A;  5A1A A;  5I8T A;  3VDD C;  3ASI A;  2HWC 3;  2TBV A;  5L36 A;  2EIE A;  4C1X A;  3MIE A;  2GC3 A;  1VE0 A;  3N9N A;  1UZW A;  1M06 G;  1LB2 A;  5DDJ 3;  5ACA 3;  1RMU 3;  5BNP C;  2OX0 A;  1EYB A;  2XL7 A;  1V70 A;  2X29 A;  1C3H A;  3MYX A;  5SV5 A;  4AXO A;  5A3M A;  5C3Q A;  5C33 A;  3JBG 1;  1GBG A;  4GB3 2;  3WG4 A;  1R1Z A;  3WV6 A;  1VAL A;  2LRP A;  4A41 A;  3DEC A;  4AEJ A;  4MGY E;  4XCB A;  1V9U 3;  3RZZ A;  4LK7 A;  1NA1 C;  1V6O A;  2B46 X;  4M3C F;  1MZ6 A;  4UFK A;  1YHF A;  3LD8 A;  4RR3 C;  4FFF A;  4FTB A;  1UOB A;  4LO7 A;  4OZO A;  4D94 A;  2VMH A;  5DXD A;  1YFW A;  4UFI A;  1KS4 A;  3GZE A;  2V73 A;  2DU1 A;  1JOD A;  1OA2 A;  3WDW A;  2AUY A;  3WIN E;  3KF5 A;  1I5P A;  3IKW A;  5BYN A;  3O1T A;  3SCF A;  3ZYF A;  3OEB A;  4IEX A;  4Y3O A;  3EXU A;  2DCJ A;  1G9C A;  4D6Q A;  1JOJ A;  3ZMN A;  4CU6 A;  2E31 A;  3GDB A;  4LMF A;  2OKX A;  2X5I C;  4XDO A;  1NCR B;  1NCR A;  4XQW A;  5LCW L;  3FE5 A;  1W8Z A;  2DUP A;  3PUR A;  2D6O X;  3R4U A;  3ZO0 B;  1XNK A;  3OYW B;  2CDO A;  1RIN A;  1TME 3;  2QQN A;  1K5M B;  1XNB A;  1K5M A;  3HQX A;  3MI8 A;  3OYW A;  1AR8 2;  4BQY A;  4YFZ A;  5G05 L;  1W2U A;  1WW5 A;  4U2A A;  5FPL A;  3UJO A;  2YPD A;  4QDR A;  2VQU A;  5DAX A;  3CMG A;  2Y6K A;  5CU1 A;  3AFG A;  1VBC 3;  4FO9 A;  3T2P A;  2GDF A;  1F8V A;  1N47 A;  3TNP B;  1UYZ A;  3RZG A;  3T1L A;  5FPU A;  4NHY A;  4QB6 A;  5LAT A;  1QNW A;  4BXF A;  5HPO A;  4DXR A;  4AVB A;  1C1L A;  4MUV A;  2YBP A;  1IS4 A;  2GAU A;  4LBM A;  4NN0 A;  1VAK A;  4DMI A;  3JCI A;  5EP9 A;  1KJR A;  1CAW B;  4AHX A;  1CAW A;  4GH4 C;  1GWM A;  2W91 A;  3GBG A;  1ULF A;  3LKJ A;  4IV3 C;  2J1E A;  1NCQ C;  1DZR A;  4LHK A;  4BQW A;  4HL0 A;  4CXX A;  2HWD 1;  4QB1 A;  1MAC A;  1H4G A;  1FMD 1;  1FI2 A;  1Y9Q A;  1AL0 G;  2AYH A;  2JDN A;  3PHM A;  4IGO A;  1OPM A;  4Q0S A;  4UFL A;  2ARA A;  3D5O A;  4W4Z A;  2TNF A;  3AVR A;  1HRI 2;  4YGB A;  5CFC B;  1TQ5 A;  2IC1 A;  3B01 A;  4OUE A;  4Q0U A;  5CFC A;  5IVB A;  1GOG A;  1W8W A;  3PUI A;  2WNV B;  3SIT A;  2WNV A;  3AYD A;  3DGT A;  1UO9 A;  4UW5 A;  1X9T A;  4Q27 A;  5AFE A;  4LTA A;  5LA9 A;  1FOD 2;  2KA3 A;  4RQP B;  5FPZ A;  4RQP A;  2HWB 3;  3U10 A;  4KNC A;  4NIG A;  1IPK A;  1LRH A;  3RFR A;  5FPX A;  1SBF A;  3V0B B;  3V0B A;  3MV0 1;  1VBD 3;  4XOG A;  3I8T A;  4Y4Y A;  2VMI A;  1WA4 A;  3K51 A;  1QQP 2;  1RUD 1;  2PAM A;  1W3V A;  2VZU A;  3RZJ A;  1JUH A;  2X05 A;  3H3L A;  1CJP A;  3K77 A;  4OHV A;  5C3P A;  1GQH A;  2D40 A;  3GBF A;  3JBG 2;  4GWM A;  3QH7 A;  2YXS A;  4LIT A;  1LUL A;  3VBR C;  2A6W A;  1RUJ 2;  2W1W A;  4KWJ A;  4YW4 A;  1F2N A;  2VOV A;  4LOT A;  3AXD A;  1UIK A;  1LEN A;  4LBO A;  2ADE A;  1LOF A;  4XYX A;  3WDX A;  4LLF A;  1WCD J;  3JXS A;  4J6G A;  4TSV A;  4IGP A;  5BNO C;  1OMI A; 
#chains in the Genus database with same CATH homology
 5JXH A;  2J1A A;  1L7Q A;  5JMO A;  1W8O A;  2W47 A;  3ACH A;  2BGP A;  3DYM A;  1T2X A;  1J83 A;  3C7E A;  3K4A A;  3K75 B;  3A23 A;  3LEG A;  2Y6G A;  2QQO A;  4QDS A;  2QQK A;  4MGS A;  4MO3 M;  3EYP A;  3HJR A;  2W95 A;  4OYU A;  5IFP A;  4LPL A;  1F4H A;  1W0N A;  2VZP A;  4MGQ A;  5EJ1 B;  1WKY A;  5EIY B;  5I0D A;  3WNM A;  4DXT A;  2ORZ A;  3LQC A;  2EID A;  1JI6 A;  2J1S A;  3OEA A;  4ZZ5 A;  3I2F A;  4QX0 A;  3LE0 A;  3DYP A;  4CU8 A;  1O8S A;  5JXI A;  1MPX A;  3GM8 A;  2W3J A;  4E8C A;  4RN5 A;  4BK4 A;  2XQX A;  4BXS V;  4KI5 M;  4P5Y A;  3K4D A;  4W50 A;  1HN1 A;  2WDB A;  4GWI A;  4OMC A;  3VD7 A;  4D8M A;  4QX2 A;  5IYY A;  3HOB A;  2VZ1 A;  1P8J A;  2ZEX A;  4BDV B;  5LA1 A;  1KEX A;  1GNY A;  2Y8K A;  2E32 A;  3D3A A;  1EUT A;  3C8X A;  2W46 A;  3VD5 A;  2VJX A;  1DLC A;  1JYV A;  2XOM A;  4RYD A;  2VZ3 A;  2WO2 A;  4JKK A;  3WF3 A;  3CKH A;  4DXS A;  3BN6 A;  5FUI A;  4QPW A;  1LNS A;  3I2G A;  1JHJ A;  1NUK A;  2VQT A;  3LEK A;  4YPJ A;  5DQ0 A;  5F7U A;  4PT6 A;  5IHR A;  2DDU A;  1OH4 A;  3SKV A;  2V5D A;  3T09 A;  1US2 A;  5HXM A;  1NAE A;  4LQR A;  2J1U A;  4UOJ A;  3E1F 1;  4BK5 A;  2QQM A;  5B4X A;  4Z2A A;  1JZ5 A;  4XUT A;  2Y6H A;  4XUP A;  2C26 A;  3IDA A;  2J1T A;  3SKJ E;  3ACI A;  2E26 A;  2VC9 A;  1K42 A;  3SEE A;  4BJ0 A;  4KMQ A;  3WF1 A;  5G04 L;  1XC6 A;  3FN9 A;  3I2H A;  3THD A;  3T2O A;  3ABZ A;  2J7M A;  1PX4 A;  1CX1 A;  2LS6 A;  3W5N A;  3GGL A;  3C7H A;  3HPN A;  4A44 A;  5DN2 A;  2BZD A;  4A45 A;  1PMH X;  3OB8 A;  2QQI A;  2J22 A;  1OF3 A;  1UY3 A;  2J1R A;  1W9S A;  3NJV A;  1IQD C;  2L9L A;  3GXU A;  1OF4 A;  4MOA A;  3OBA A;  4P00 B;  2JE8 A;  2QQL A;  1JZ7 A;  2WAO A;  1CZS A;  2WZ8 A;  5LA2 A;  3AC0 A;  5C70 A;  1SG3 A;  4UAP A;  4ZZ8 A;  1EUU A;  2YB7 A;  4GZ9 A;  2YC2 A;  3T08 A;  2W92 A;  1UZ0 A;  1XNA A;  2VME A;  1UY2 A;  3NQH A;  3UNP A;  3UES A;  3WQB A;  2XHN A;  2ZEZ A;  2JDA A;  2C4X A;  4XUQ A;  2VCB A;  4KWU A;  1UXX X;  3T0A A;  3FHQ A;  2B9V A;  3FHA A;  4D0Q A;  2WYS A;  1JZ8 A;  3VDC A;  3LPG A;  2VZO A;  1O59 A;  2Y6L A;  3LEI A;  4XUO A;  3WNO A;  4AAX A;  3A21 A;  2VMF A;  1SHW B;  2W1U A;  1UX7 A;  4JX0 A;  3CIH A;  3PUH A;  2VOT A;  2WBK A;  3C7G A;  3HNB M;  3THC A;  3I2J A;  3VD4 A;  3I2K A;  2W94 A;  4OMD A;  3EB7 A;  3IAP A;  1UMH A;  2JKX A;  2YG0 A;  4IUG A;  3T2Q A;  5JUV A;  2WQ8 A;  3HNM A;  1W9T A;  2QBX A;  4HG6 B;  1W8N A;  4LKS A;  2EIC A;  4MAD A;  3I3E A;  2ID4 A;  2CDP A;  3BGA A;  3CQO A;  3U37 A;  1J84 A;  1GU3 A;  3CZU A;  1JYN A;  5JR2 A;  2ZEY A;  1W99 A;  2W87 A;  4A42 A;  1PX3 A;  1K3I A;  1UXZ A;  3LPF A;  4W8J A;  3NJX A;  3I3B A;  4JKM A;  4ARX A;  2VMD A;  1TVG A;  1XPW A;  3MV1 1;  3VD9 A;  2WO1 A;  2XON A;  3K4Z A;  3ACF A;  3OGS A;  1JYX A;  2W9X A;  2X09 A;  2DCK A;  4CVU A;  1OD3 A;  4CU9 A;  1RYY A;  4ZXE A;  2RV9 A;  2WAB A;  5C7G A;  1GQP A;  4DUW A;  2WAA A;  2ZXQ A;  5DMY A;  5EJZ B;  4DEV A;  3DYO A;  3HN3 A;  2E33 A;  1UY4 A;  2W1S A;  3I97 A;  2V72 A;  2EIB A;  3ETP A;  5C71 A;  3CZJ A;  4JKL A;  2VR4 A;  5JXG A;  4ZY9 A;  1UWW A;  2HLE A;  2VCC A;  3VDB A;  3A7Q A;  2ZEW A;  2BBA A;  3HEI A;  4JHZ A;  5IFT A;  2J1V A;  2RJ2 A;  5LA0 A;  2VCA A;  2WN3 A;  1K12 A;  1JU3 A;  2RVA A;  4DUV A;  1D7P M;  5J1X A;  3VD3 A;  4M4P A;  4A3Z A;  1UY1 A;  1K45 A;  3OGR A;  2W1Q A;  1O8P A;  1H6X A;  3WNP A;  4P08 A;  1GOF A;  1JU4 A;  1GUI A;  4A4A A;  3UET A;  3P1I A;  2VM9 A;  1UYX A;  3OGV A;  5IJR A;  4QDQ A;  2JD9 A;  1JZ6 A;  3T0B A;  3NNG A;  2VZV A;  1L7R A;  3ZM8 A;  4AG4 A;  1UY0 A;  2WO3 A;  3IB3 A;  3T0D A;  4PQQ A;  3I3D A;  4DUX A;  3III A;  1KGY A;  4XUR A;  3WNN A;  1ULP A;  3K46 A;  5A1A A;  1OT5 A;  2R7E B;  4A6O A;  4PF1 A;  4QX3 A;  2B4K A;  2EIE A;  3WF2 A;  4CUB A;  1SDD B;  4ET7 A;  3WF0 A;  3W5M A;  2BGO A;  3OG2 A;  4L0P A;  1GOH A;  5JXJ A;  3SEP A;  1ULO A;  2WZE A;  4A41 A;  3DEC A;  2BER A;  3MUY 1;  4QX1 A;  2KD7 A;  3WEZ A;  2LW8 A;  4TTG A;  2V4V A;  4OZO A;  1NKG A;  2VO5 A;  2HYX A;  1R64 A;  1TG7 A;  3IAQ A;  1JZ4 A;  1I5P A;  4CU7 A;  1NX9 A;  3MO4 A;  5CZK A;  3OEB A;  2DCJ A;  4FI9 A;  2QQJ A;  4CU6 A;  2E31 A;  3GDB A;  2VTF A;  2OKX A;  4UI9 L;  3MBW A;  5LCW L;  4ARY A;  1XNT A;  3WF4 A;  3WNL A;  2CDO A;  2QQN A;  5B4N A;  5G05 L;  2X10 A;  4CUC A;  4QDR A;  2VQU A;  2Y64 A;  2Y6K A;  3CMG A;  4GWJ A;  4QB2 A;  3T2P A;  4M4R A;  1UYZ A;  1PMJ X;  2C9K A;  4XZU G;  3ECQ A;  4QB6 A;  1YQ2 A;  5HPO A;  5DPN A;  4DXR A;  2YC4 A;  3P6B A;  2YFZ A;  3HNY M;  1UMI A;  1JYW A;  1CZV A;  3NRU A;  3CDZ B;  3ACG A;  4XVH A;  2W91 A;  2J1E A;  4DEQ A;  2WN2 A;  2VZR A;  4QB1 A;  4QAW A;  4E8D A;  3WSO A;  1US3 A;  2ORX A;  2WUH A;  1BHG A;  2Y6J A;  3C7O A;  3J7H A;  1H6Y A;  4W4Z A;  3WNK A;  1UYY A;  1DP0 A;  4OUE A;  4TXW A;  1CZT A;  1GMM A;  4CUA A;  2VL4 A;  1GOG A;  3PUI A;  3A22 A;  2VZS A;  3VDA A;  3F2Z A;  1JZ2 A;  1F4A A;  3MV0 1;  2VZT A;  4XUN A;  1W9W A;  1CIY A;  2VZU A;  2X05 A;  2YFU A;  5CYY A;  3FL7 A;  3K77 A;  2VMC A;  2Z4F A;  4P02 B;  1DYO A;  3I2I A;  2W1W A;  1WCQ A;  2W5F A;  2VZQ A;  3MUZ 1;  3C7F A;  3JXS A;  4LHS A;  1JZ3 A;  2PQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...