3APBA

Crystal structure of the galectin-8 n-terminal carbohydrate recognition domain in complex with iodide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
152
structure length
152
Chain Sequence
LSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-8
publication title Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans
rcsb
source organism Homo sapiens
total genus 30
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3apbA00
1FYUA 4YGDA 2ZGLA 3AXDA 3T1MA 1LHVA 2ZAAA 3SNMA 2DVDA 2H0BA 1UL9A 4HL0A 3WG1A 5AVAA 4DRVA 2WT2A 3ZSKA 4XHBA 5H9RA 5JOZA 3WG4A 3RSJA 3QCWA 2CY6A 3WVJA 3B00A 1QOTA 2VW0A 1WLWA 5JLVA 2DU1A 1MACA 1QOOA 2A3YA 2PHUA 4CTEA 1W0OA 5GJ6A 2TEPA 5EYYA 4FPEA 4UW4A 4Q8KA 4C1XA 2HYKA 3RS6A 4NOTA 1CESA 1WCSA 3WG2A 1AJOA 1YIFA 4FVVA 1GYKA 4I30A 4ISQA 1CQ9A 3O0XA 1GNHA 3AFKA 3B3QE 4AYUA 1WW5A 4GALA 3OYWB 1V6LA 1MS0A 1ONAA 1TEIA 3B01A 4DRRA 1Q8SA 3MPPG 1ULEA 4W65A 4BOWA 3WUCA 4LBMA 1Z78A 4RL7A 3GNEA 2WJSA 4UW5A 4XJAA 3N7JA 1UMZA 2SBAA 3HR9A 1RIRA 4M01A 3R05A 2E51A 3ILNA 4XJZA 5CA6A 1OFSA 1SFYA 4FOWA 1DZQA 1BQPA 4GKXA 1KDMA 1WLDA 3AYDA 1CVNA 3VKLA 1G8WA 2DTWA 2D3PA 2P34A 4YM2A 5E8AA 3WG3A 4BMEA 5KXDA 3U4XA 1W6NA 5IK8A 2D6MA 3PVNA 3MW3A 2JE9A 1W6QA 4YGBA 1SCSA 1ZA4A 1N1YA 1C1FA 5DG2A 1QGLA 5JOXA 1VLNA 3FUOA 1MZ6A 1GV9A 1QDCA 1R1ZA 1V6OA 2R0HA 3QLQA 3FFZA 1SLTA 1IS3A 4XMAA 1CJPA 4K20A 3WHTA 1LEMA 2A71A 3AP4A 1W6PB 2KM2A 5DUVA 1JYCA 4ZKTB 1WD4A 1DHKB 1JBCA 4BPZA 4YM0A 2UWAA 3OJBA 3SH4A 3ENRA 2AREA 1W6MB 5T54A 1JYIA 1V6KA 2ZHNA 2A6ZA 1W6PA 1Q8QA 3C2UA 4XOGA 2EALA 5IK4A 2CTVA 2XB6C 3ZXFA 4YGEA 2GNMA 1D0HA 4BM8A 1AZDA 4XTPA 4PF5A 1V6IA 1W6MA 2ZZJA 4YW5A 2JJ6A 4FOYA 1BZWA 4JRAA 1AF9A 1CR7A 2AUYA 1LJ7A 2P3KA 3VKFC 2AH2A 1BXHA 2ENRA 1H30A 2ERFA 1N3PA 2A75A 4FPGA 3WDUA 5BYNA 3RQ0A 4Y1YA 1SBEA 1SBDA 3NV2A 3UL2A 4GA9A 2ARBA 3BOPA 5KXEA 3ZXLA 1J1TA 1LCLA 2D6KA 1PZ9A 2JECA 1FATA 2WLQA 1JUIA 4JCKA 5DUXA 1LODA 1PZ7A 3A0KA 1OQ1A 2A7AA 2PHTA 3FBYA 1YYNA 2AENA 4P9WA 1GLHA 1AXKA 3O0VA 4PCRA 5SV8A 4ATEA 4YZ3A 4DFSA 2PHRA 2JE7A 1GANA 3N7KA 2GNBA 3M3CA 3DGTA 4KBBA 1G86A 1HDKA 1AX1A 4R9CA 3M1HA 5T5LA 4YZ5A 5KXBA 1FNYA 5GM0A 5IT6A 1CONA 4WVVA 3ZVXA 5IK7A 3AZYA 2VUAA 3T2TA 1S1AA 3AZVA 1JHNA 3I8TA 4M3CE 4WZFA 3IM0A 4BLIA 2ZHKA 4C1WA 1DIWA 1MZ5A 1WW7A 3KM5A 1AXYA 3O0WA 5T55A 1B09A 4LBJA 2RHPA 5EYXA 4GWNA 1F31A 2GMMA 3ASIA 1JN2P 1WBFA 2CWSA 1DGLA 1LOEA 1GBGA 1GZWA 2GMEA 2W39A 2ZGTA 3N36A 3PVEA 4FQZA 1KITA 1W6OB 3AX4A 4K1ZA 3SISA 4M00A 2A3WA 1S0DA 2P3JA 3ILRA 2VXRA 1G9CA 2OUHA 2WQZC 5DZEA 4P14A 4Q2FA 1ULCA 1SLAA 4YM1A 2GN3A 1I1EA 1KDKA 1W6OA 1BYHA 2CL2A 3FLTA 4Y20B 1DQ5A 2I2SA 5DG1A 2ES3A 3R4SA 3WDYA 1JOJA 3FLPA 1N3OA 2NMNA 1IKQA 4AGGA 1QNYA 1LHNA 2D44A 3BIWE 4YZ2A 3V0BB 2DURA 1UPSA 2A5ZA 3B9CA 4FP3A 4XILA 4AVTA 5L73A 1G9DA 1FV2A 1UZYA 1Y7BA 2OVUA 1QF3A 3AP7A 4XJ8A 2EF6A 4YG0A 1LOGA 3NV4A 4LBKA 4U36A 2NZ9A 4TYSA 4AGRA 4M3CF 1N1TA 2E7TA 1UN1A 2ZA9A 4GKYA 1V00A 2DU0A 4L8QA 2ZGRA 3POYA 1HQWA 1SACA 3O5SA 4FPFA 5IUQA 3D6EA 3I4IA 4PBPA 3W59A 1DBNA 4FPJA 3WDTA 3N35A 1UKGA 3OYWA 3AYEA 4ITCA 5HCBA 4BLJA 2DYCA 4XBNA 3BTAA 4XDQA 3NV1A 2A70A 2DV9A 3VKMA 4XJUA 2ZACA 4XXAA 4Y24A 3GALA 1ENRA 1V6NA 4Y1XA 3OGGA 1NLSA 2UWBA 2DUQA 4YW1A 1FAYA 1Q8PA 3AYAA 3LSEA 2SLIA 4XJWA 4YG6A 4P9YA 5FREA 3ZSLA 4YW4A 3PJQA 2LALA 4AVSA 3NV3A 5T50A 3V0AB 1AJKA 1G9BA 3V65A 3ZPYA 4R9AA 2DVAA 2FMDA 4XBLA 3WOGA 5DXDA 5E88A 1HLCA 4Q1PA 4DPNA 4XTMA 3SLIA 1DYPA 1ENQA 3ILFA 1LTEA 3Q9OA 2NYYA 4Y22B 1WLCA 4YFWA 3D5OA 2JDZA 4F83A 4PBOA 2PHFA 3V0AA 3AP6A 1RITA 2DVFA 3IPVB 3VV1A 2ZGKA 2ZMNA 1SLBA 3AYCA 5DZFA 5HCAA 2ZMLA 4AGVA 1X50A 2BQPA 3POSA 3IMNA 2UURA 1DQ6A 2CNAA 3WUDA 3IPVA 4LBQB 1FNZA 3HN1A 1KJLA 4XXPA 5DUWA 1GICA 3NWKA 2AGSA 1LOBA 4LBNA 2D6PA 2B7YA 2GN7A 1LU2A 4FOVA 1JXNA 5EWSA 1LESA 4FPKA 1ULFA 4IQPA 3AK0A 1N1VA 4FPHA 2ZKNA 2C5DA 1N3QA 4XZPA 1NXD1 2D3SA 2R49A 2V73A 3H0OA 2DVGA 1CIWA 1KJRA 2ZGPA 1SLIA 3N3HA 2D6OX 4Q8LA 3VUOA 2ZGQA 4PQ9A 2ARXA 3WV6A 3UK9A 3LCPA 1UZZA 1YI7A 1AVBA 2A6XA 3VKNA 1LU1A 3WNXA 4RA0A 4XBQA 5JMCA 1A8DA 1IKPA 2XG3A 5FRAA 2YXSA 2AYHA 1MS8A 4FPOB 4MYEA 4YW2A 4YLZA 5E89A 3WDWA 3RMXA 1Q56A 2ZBJA 4XIKA 1LGCA 2W52A 2OW4A 3RRDA 1LOFC 2A3XA 2ZHMA 4FOQA 2EXIA 4LBOA 1UX6A 5IK5A 4XE9A 1CN1A 3USUB 4YFZA 4K1YA 4XIOA 4M3CB 3LSDA 3RG0A 3AZWA 3M2MA 4CZSA 1LGNA 1GZCA 3AP9A 5GALA 5JVVA 2YROA 4GXLA 3JU9A 4UW6A 1S0CA 1FX5A 2FHRA 4WVWA 2V5YA 4BQ1A 3ZYPA 1LOAA 2VY0A 2R16A 1DLLA 2DVBA 1A3KA 4U2AA 3WZ1A 1C57A 4XHXA 1ENSA 2PHXA 4YZ1A 1LHOA 3O12A 5T5JA 2EAKA 3AZZA 4Y1VA 3A4UA 4DQAA 4YM3A 5H9QA 5CB7A 1SLLA 1W0PA 2EXHA 1KQRA 4H55A 4D69A 1C1LA 1QOSA 4AVVA 1H9PA 1Q8VA 5GZFA 1C4RA 2NN8A 1S0FA 2DTYA 3B69A 5JOYA 1KRIA 1YXWA 3D4KA 4Y20A 1DQ0A 1G9FA 1S0EA 3MEPA 2GNTA 3MW4A 5CNAA 3ZXKA 2D6LX 2W08A 5F5QA 2GDFA 3VKOA 1AX2A 1MS9A 2VW2A 2ZGOA 3N7LA 2WNEA 1F5FA 1N1SA 1S0IA 1EPWA 3PVOA 3POWA 3V0BA 2ZGUA 3IKWA 2R1BA 4BMBA 1F9KA 3KQRA 5JDBA 1VAVA 3CNAA 2R0FA 3DUIA 3WLUA 1MS1A 2WKKA 5GLZA 1Q8OA 2DUPA 1PZ8A 1BKZA 1DQ2A 5GLTA 5F9TA 1I3HA 4UW3A 3V64A 1QNWA 1O4YA 2EXKA 1HKDA 4Y26A 5DUUA 1WD3A 3PMEA 1CPNA 3HMYA 4NO4A 2D3RA 1G7YA 5T52A 3UJOA 4FPCA 2JKBA 2P37A 3AP5A 2D7FA 2G4IA 4ASMB 1AXZA 2R1DA 5CBLA 1WBLA 2CYFA 5GLUA 1LULA 1V6MA 3WDXA 4Q27A 1MS3A 3ZSMA 4Z8BA 1VALA 1FV3A 3WCSA 4P9XA 2D43A 2YZ4A 2VW1A 1YO8A 2WSUA 1LGBA 1MVQA 2AR6A 2DWRA 2OUJA 1UAIA 1W6NB 4Q26A 1S0GA 5GLVA 2NM1A 1MVEA 1W6QB 4Y22A 5JOWA 1SBFA 5H9SA 3TAYA 5KXCA 5CAZA 2WSVA 2ZABA 4FPLA 3MW2A 1DFQA 3FLRA 5GZGA 1GSLA 2WT0A 4LBQD 4XJ9A 3FUQA 2JD4A 4ZXKA 2EXJA 3OY8B 5HCFA 4XYXA 5T5PA 3APBA 2YMZA 3T1LA 1HQLA 3WHUA 5H9PA 4YW3A 1IS6A 1LHWA 2CWMA 4LBLA 2E7QA 4LBQA 4R9DA 1ULGA 1IS4A 1URXA 1LOCA 4TZDA 1Z0HA 2GNDA 3OY8A 1IS5A 1WW6A 4SLIA 3JUUA 2EIGA 1IOAA 1D2SA 1JW6A 3BODA 5DZGA 4Q1RA 2ZHLA 2PHWA 1O4ZA 1QU0A 2VU9A 3AJYA 4HANA 4CRQA 2ZGSA 5T5OA 1SLCA 1GZ9A 1DQ1A 3WDVA 1U0AA 1V6JA 1LEDA 5GZEA 4Y1UA 2A6YA 1DQ4A 3RMYA 3WCRA 1LENA 1MS4A 1OKQA 4WV8A 3ZXJA 1MR5A 3SH3A 2ZGNA 2P2KA 4FPYA 1CPMA 3AZXA 1RINA 1WUVA 3IN9A 4FP2A 4GWMA 1SCRA 2Z42A 5GLWA 3OBTA 1GNZA 1LECA 2PELA 2GMPA 3ZYRA 1G9AA 1H9WA 2W68A 4FQ4A 3AXEA 2D6NA 2GALA 1A78A 3L2YA 1DYKA 1QMJA 1XQNA 4ISRA 3SITA 3AJZA 3USUA 2A6VA 1ULDA 3INAA 4JC1A 2YY1A 1QKQA 4M3CA 1LOFA 4YG3A 1S0JA 4ATFA 3R4UA 3OBRA 5LK5A 1BJQA 1APNA 1ZM1A 2WT1A 3W58A 1VAMA 2A6WA 3UJQA 2ZGMA 2NP0A 3M3EA 4R9BA 4Y1ZA 3SH5A 2P3IA 3OPZA 2DUOA 2E6VA 2LTNA 4XMIA 1S0BA 2E53A 2C9AA 1MS5A 1QDOA 1GKBA 4YZ4A 5GZCA 5EXOA 3ATGA 3M3QA 2YV8A 2VH9A 1GZWB 1YRZA 1WW4A 4K21A 3ZXEA 4DS0A 1N47A 3ZSJA 1LHUA 4AWDA 4YGCA 3N7MA 2NMOA 2UWCA 3TB0A 1VIWB 3M3OA 3A0NA 4OZXA 2UU8A 5GZDA 2Q5TA 2ZMKA 1AX0A
chains in the Genus database with same CATH superfamily
3FC0A 3KQ4B 1FYUA 4YGDA 3AXDA 3T1MA 4JKLA 1O3QA 2ZAAA 2H0BA 3WG1A 4IEQA 1BBT2 5AVAA 4AQ6A 2B4KA 3KS7A 4XUQA 2PTMA 3WVJA 1U5IA 4LK7A 4QX0A 1UNBA 1QOTA 2VW0A 4AFMA 1XU1A 4QPYA 1RVF3 3N9MA 3CZJA 1PK6A 3FL7A 4RFRB 2DU1A 2G9FA 2GH2A 2WS93 1XNTA 1XYNA 2PHUA 1W0OA 1ZVFA 5GJ6A 3WSOA 4HLTA 4CTEA 1H8TC 5JI7A 1OMIA 4DMIA 1OOPB 5FZOA 3GZTB 5F2WA 3H8OA 4UW4A 1WA4A 3VBRC 4Q8KA 5LBCA 4NOTA 1CESA 1PNFA 4E4SA 1WCSA 3WF2A 3FMGA 1BVP1 5HV0A 4FVVA 1SHWB 4BQXA 4JDMA 4F3JA 2QBXA 3LEKA 3OGRA 5FK8A 1YNAA 3VBOC 3OYWB 3T0DA 1MS0A 1TEIA 3B01A 3OEBA 2AEYA 1Q8SA 4MOAA 4NAMA 2ZCWA 1OVSA 1X9TA 4CYDA 2YUEA 1NZIA 3JD73 1NA1A 2UYAA 3WINE 3DN7A 2J42A 1NE6A 4LBMA 3SMHA 1ZBA3 3WW4A 1UY0A 2WJSA 4PDWB 1RUE2 4AEDB 5F3CA 2XR4A 1UMZA 2PLV3 2ATFA 4QPGC 5FZCA 3OPWA 2SBAA 5DDJ1 3KT7A 5EIYB 3D0SA 4QB1A 4W6YA 3MLLA 2BNNA 4DUVA 4FO9A 3ZN6A 5M0TA 4LULA 4TTGA 5ABJA 5LATA 3ZXGA 1KDMA 3AYDA 3JQXA 3AMMA 2DTWA 2XHKA 3AKQA 4DXZA 4OHWA 2ORZA 4FT8A 3WG3A 3WNMA 3HPNA 2RE9A 3WT3A 1ZA4A 3VD9A 1RUNA 1N1YA 1UYYA 1FI2A 4AHWA 3QLQA 3RYPA 3VBSB 1R1ZA 1W06A 2A73B 4CDXA 1RUI2 1ZBE3 5FQ0B 5CFDB 4QKDA 3R0RA 5JMOA 2L9LA 4HFSA 4K20A 3ACHA 1LEMA 1VE0A 4B1MA 3POGA 3TNPB 4ZZ5A 3ZFFC 3ETQA 5F5IA 1UY1A 3CU7A 5A3OA 1DHKB 1JBCA 4QGNA 2H6BA 1E5RA 2PHLA 1T6BX 2XBO1 3AVSA 3ENRA 3OJBA 4V1PA 4NMIA 3LWCA 2ZHNA 4XF4A 4C0BA 3ETPA 3PL0A 4AW7A 3VHPA 4XFFA 1JYIA 3MIDA 3O1PA 3VL8A 4CDQA 3ZXFA 2GNMA 1D0HA 2IUWA 2WR9A 4QPIC 4BM8A 2HWF3 1W6MA 2C9KA 2ZZJA 3DYMA 1KFUL 1COV1 4XQWA 4EWEA 1W03A 1BZWA 2WN3A 5FJHA 1LJ7A 1GOFA 2VUDA 3VKFC 1BXHA 1HW5A 1OQDA 1POV0 2A75A 1LR5A 2V4VA 2WLPA 3NAPB 5DDJ3 4OHYA 1SFNA 3I2IA 1PO22 4GA9A 3ZXLA 4LO6B 3GHNA 1PZ7A 1QJX1 1U12A 2WL1A 4XF0A 5A33A 3MICA 4JGZC 4DXSA 4ARXA 1JODA 2Y64A 4O61A 3O0VA 3PIGA 5SV8A 3ES4A 4ATEA 3OG2A 2P5BA 2JE7A 3N7KA 1RUD3 2W87A 3I59B 4R4XA 3M3CA 2R043 2RJ2A 5T5LA 4Q4W3 5ACA2 2Y6KA 1DLCA 2VZUA 4FSJA 2E9QA 4WVVA 5BNOA 5K8SA 2IXCA 4IV1A 1J59A 3DXTA 3PTYA 2JWPA 5C33A 2VUAA 3KCYA 3VBUB 4C1WA 3IM0A 2ZHKA 2XBO3 4PF1A 3T4HB 3AB0A 1AXYA 4LBJA 1DGRA 3RPQA 5JSOA 4QHOA 2VOVA 2VVDA 3RZLA 2PA7A 1FT9A 3MFAA 3BYWA 2JDNA 1DGLA 2OT7A 3PVEA 2FMYA 1KITA 1W6OB 1COV3 1CWPA 1S0DA 1IPKA 1S2BA 4D3WA 4WM7C 5DZEA 1VBB2 4O65A 3IDCB 2E32A 2UY8A 1NCQB 4YM1A 5IWFA 5A80A 1NX9A 4D7TA 3I2FA 5B4NA 1FOD3 1N3OA 4PIYA 1QJX3 2QDRA 4YZ2A 1AR72 1E5IA 5LEJA 3B9CA 3EB7A 3AMNA 2OA2A 1RUJ2 4SBVA 1D2QA 4ORFA 1XRUA 1Y7BA 5IVEA 4HXCA 4A42A 1AL21 2EF6A 1H8TB 5AC91 5C3PA 5J09A 3NV4A 4LBKA 4R52A 1W9YA 4TYSA 4AGRA 4LA2A 1N1TA 4M3CF 3VBRB 5CKNA 3VD5A 4Q4X1 4OI0A 3AL5A 3OUJA 5DAQA 2WQ8A 3TNQA 3P3PA 1WGPA 5A6QA 1GP5A 1SACA 3O5SA 5FPBA 4FPFA 2ZS6B 5IUQA 3DCQA 1X82A 1ND3A 4FPJA 4HKWA 3VBOB 3I3QA 4O9GA 5HCBA 3UESA 4BLJA 2DYCA 4XBNA 4ZHNA 4K40A 4Q4V3 1VR3A 3PUAA 3E1F1 3WP6A 2DV9A 3VKMA 5HI0A 1M06G 1XSQA 1KS4A 4BYYA 4EN6B 4WVZA 5LZ6A 5J48A 3DF0A 4QPGB 1FMD1 3AYAA 2SLIA 2P17A 2XH6A 1C8M2 4XJWA 4YG6A 1VRH2 1D0GA 3PJQA 4YW4A 4AVSA 4H7MA 1VBC2 3VLBB 2ZZQA 2QZ3A 1QXJA 3NV3A 1AJKA 3KV4A 3LEIA 4KGGA 1BEV3 3VBHC 4XFBA 5G04L 4EV0A 5K7PA 4LXLA 1NT0A 5E88A 4Q1PA 1PIV1 1PGSA 2OZ6A 5JI9A 1JYNA 2O8OA 3S5AA 3Q9OA 3H3UA 1CAVA 1FPN1 2NYYA 1WLCA 3UETA 3D5OA 2JDZA 2R30A 4XUNA 4F83A 3VV1A 1PNGA 1OXCA 4WBBA 5F6KA 2JG8A 2JG9C 4FAHA 2WBKA 3I49A 3B7MA 4LO4B 2HEWF 2BQPA 1J84A 1HQNA 3POSA 2W1WA 4MADA 3JBG3 4CDWA 5BNNA 2N7GA 2UURA 5LBEA 2ZEYA 3S57A 4RR3C 3H9AA 1AL23 4S2HA 1KJLA 3S7EA 5A7WA 3ZFFB 2AGSA 1OA3A 3B94A 4LBNA 3UGGA 5APAA 1BMV1 4I02A 1CAWB 1W9WA 4Q4X3 5LY1A 1OF4A 4PI0A 1LESA 4BZ4A 4LEJA 1BHGA 3AK0A 1GUIA 4A6SA 1IG0A 3HT2A 3BALA 4XZPA 2V72A 3ZPOA 1HRI2 4BHPA 4LUKA 3U11A 2R49A 2YFUA 3HOBA 4QPIB 3NL1A 1KJRA 2ZGPA 3WD5A 1ODMA 5C9AC 1OUXA 2LUWA 4R4ZA 4RSUA 4AG4A 1RUF1 4IGQA 1SG3A 3UK9A 1OH4A 2IXKA 2LM3A 2XJVA 1UZZA 4QPWA 2B8MA 1WCQA 3CL1A 5A70A 1IZ3A 3LEMA 2D5HA 2RR12 1OA4A 4FPOB 4MYEA 4YW2A 1SZBA 3OF1A 1AHSA 3RMXA 5HCHA 1DG6A 1QJFA 3UNPA 1QQP3 3RRDA 3OD4A 4CDUC 1LOFC 4EN8B 5FYHA 3WF4A 1FPN3 3ZMNA 5HPOA 1JZ4A 4JGZB 3R4DB 2XJPA 4LOTA 5IK5A 4NIAA 4UXAA 1XOYA 1PVXA 1UWWA 2H6CA 3RG0A 2YFZA 3LSDA 5FY1A 4PLOA 4EN7B 3AZWA 3IIAA 3M2MA 3WP4A 1O5LA 4BJ0A 5FR3A 5FMOS 2XWBB 4QXBA 3CQOA 1LGNA 2WWSA 1R091 3DKWA 3CF6E 3IB3A 5DPNA 3JU9A 1GFF2 2FHRA 4XQ4A 5FUIA 2GAUA 2IXHA 5IVCA 4DY3A 5JIUA 2VY0A 2X5IC 4GD4A 4N53A 1GZTA 4YVSA 4Z2WA 1DLLA 4U2AA 2VVFA 4XHXA 1UKRA 2Q8OA 1OI6A 3NJXA 2PHXA 4MV2A 3OBAA 4MZUA 4CCMA 5A3WA 1HN1A 5K0UA 2EAKA 1VBD1 4KWLA 3A4UA 4DQAA 4YSFA 1C5IA 3IWZA 1Y9QA 2HWC2 4CU7A 3J7LA 5LWBA 2VAUA 3GHMA 4AI2A 1RUF3 1PGW1 2MEV2 4HOOA 4WM7B 4D69A 2YPDA 1C1LA 1SFPA 1ND2A 1QOSA 2RDQA 2Y6JA 1QXPA 4NROA 3Q8BA 1AYN1 5FUNA 5JOYA 2DTYA 4ZY9A 1KS5A 3IDAA 3D3AA 3LF7A 5FKCA 3UV9A 1RMU1 5JWPA 1EV12 3ZYJB 3MW4A 1S0EA 4JQTA 3ZXKA 5DAXA 2FDGA 2GDFA 2QQJA 1O3RA 3K48A 1AX2A 1MS9A 2ZGOA 3N7LA 5CKQA 5FPLA 4I2OA 3PVOA 3POWA 3V0BA 4CU8A 1XNKA 1TMF3 1JHJA 4GMP0 3O7OA 4B7EA 3MLKA 4LORA 1R1A2 4GULA 3I2OA 1VAVA 4LTAA 4JRLA 4LMFA 3WLUA 1AR82 1MS1A 4FTBA 1Q8OA 1ASJ1 3WQ1A 3LDRA 2WFF1 1BKZA 2VZ3A 2VUJA 4LHLA 3IAQA 5HBAA 2WINB 1HKDA 1XE7A 4Q5OA 3HMYA 1QJZA 2W9XA 5T52A 3NNFA 2XLAA 4PQQA 3T4VA 2BEOA 2GH8A 2VZOA 3KT1A 1NCQC 5IAXA 3BPZA 4EN9B 1O8SA 3T30A 3GXUA 2EA7A 2OPWA 1S4CA 1ZRIA 5A3MA 2FCTA 3KVBA 2VQAA 4Q27A 4Z8BA 1FV3A 1YQ6A 2Q30A 3UKNA 2FQPA 4P9XA 5FYUA 4E4HA 2C1FA 3VBHB 1ZBA2 1HRV3 3HVDA 4OI1A 2E26A 1ZRFA 2R7EB 1AYN3 4L9BA 3U75A 2AC1A 4QQ2A 5FZ7A 1LGBA 1IQAA 2DWRA 1MVQA 1ST8A 3SEEA 1W6NB 2PLV2 3LFMA 2AEZA 3HNBM 1YQ5A 5JOWA 2Y6LA 5H9SA 1NOVA 5CAZA 1I6XA 4IEPA 1KEXA 4D6QA 2JG9B 5L7OC 1UIJA 4IV3C 2DCYA 4Q0SA 5JXIA 3OY8B 1PO11 5EV7A 3APBA 3WHUA 1YHFA 1HQLA 2FDKA 4FAGA 3MF9A 4RR3B 4YW3A 3PUQA 2VMDA 4LO5B 3LA3A 1IS4A 1URXA 2JICA 1LOCA 4HPKB 4E8DA 4UWDA 1SDWA 2W0XA 4OHXA 2WFF3 2HEVF 5FV3A 2PHWA 3WP3A 4W6WA 3EXUA 1O4ZA 5FLIA 3AJYA 4QU2A 2G19A 3ALQA 3AKPA 4RHV1 4KU7A 3HWJA 2ZKLA 5FWEA 5JSPA 1R083 3MIBA 4LIUA 1LEDA 4Y1UA 4NHXA 5C9AB 2Y6FA 3MZHA 4S2GA 3WCRA 2WA3A 1MS4A 2O14A 2XQXA 3MBWA 1MR5A 4WV8A 3KGLA 5F8PA 3RVHA 3U07A 2BRTA 3E5UA 1W2OA 1RINA 4FP2A 3IN9A 5AFEA 1SCRA 1AYM1 3E6CC 3N9LA 1V9U1 1XXNA 1G6NA 2GU9A 3OBTA 2XUMA 2PELA 1H9WA 5FP3A 3AXEA 1SPPA 2QVSB 4YW6A 3A22A 4CDUB 1K5MA 1YC61 2WQ4A 3WF0A 1QWRA 4UAPA 2JDUA 3TRSB 2VBPA 3KD4A 1AR63 1QMJA 1XYPA 4HVOA 4ISRA 2WDBA 3WNKA 1W2AX 2BOJA 4COZA 1C5HA 2VTXA 4KQ7A 3H7YA 4ATFA 3R4UA 3SCHA 4HSLA 5LK5A 1ZM1A 2QUOA 2R073 3CBNA 4LE3A 2A6WA 2PN5A 4META 2RV9A 2ZGMA 4CA9A 4UYBA 1Y9GA 5D2AA 3OPZA 3GDBA 2HLEA 1UYZA 2E53A 2C9AA 2VOKA 1W0NA 1MS5A 2Q1FA 2VQTA 4MH0E 4XCBA 4YVWA 4YZ4A 3THTA 4NIDA 5GZCA 3GBWA 2ZOEB 3WW3A 1H2KA 4RHV3 4K21A 4A45A 5DN2A 1NCRA 2DFCA 2BGCA 2XBO2 3N7MA 4DUXA 2NMOA 4LLOA 4XDPA 4CPBD 2WC2A 5GZDA 3UGFA 4QHZA 2FCUA 1TNRA 4Q4Y1 3N9NA 4J1XA 4MXWB 1KXGA 2VTXJ 4HL0A 1V9U3 4C90A 1COV2 3K4AA 4DRVA 2VNGA 3ACGA 2WT2A 3ZSKA 5H9RA 3C3VA 3H8UA 1YWKA 3PVBB 4G9SB 3ZYGA 4N9HA 3QCWA 1AUYA 3B00A 5FP4A 5FZ6A 2WA4A 1WLWA 4I09A 5JLVA 2WZR1 3OPTA 1ZZCA 4GQ7A 2WO7A 5CKMA 2TEPA 5LBFA 2Y0OA 2K0GA 1VPHA 2J1AA 4FPEA 5FZ1A 1DDLA 4QDQA 1OA2A 2P4EA 3LEGA 5FZMA 1FXZA 1QJX2 2VXJA 1NQJA 5J96B 1H1AA 4PT6A 1O3TA 2XJRA 1YIFA 3PURA 4YPJA 3LB9A 3MO4A 1GYKA 4I30A 4OQ9A 1UPIA 1CQ9A 1OOPA 3JCIA 3J8F1 3B3QE 4IERA 5DQ0A 4AYUA 4GALA 1JU4A 4DRRA 1V6LA 3CJXA 3MPPG 1MQTA 1ULEA 4W6XA 1OLME 1NKGA 4QU1A 4RL7A 3ON7A 3GYDA 2ADEA 3WEZA 1RB8G 4BQ5A 4UW5A 4LHSA 2Z4FA 3LIGA 5F3GA 1YFUA 1XE8A 2Y33A 1H4GA 4RD7A 4AQ2A 2Y34A 1QHDA 1GQGA 1PMJX 1X7NA 2IFWA 3JZVA 1WMEA 2E51A 1BCXA 3ILNA 5FZ0A 1W8OA 4PDWA 2CAVA 1OFSA 4QM8A 4AEDA 1SFYA 2ZAHA 1BQPA 4GKXA 1WLDA 1YEWA 1G8WA 2J1VA 3B5LB 4YM2A 1LKNA 3GBGA 4BMEA 5KXDA 1CAUB 2D6MA 2JKXA 3I7DA 4Q0QA 1W6QA 4OUEA 4JX0A 1CGPA 1C1FA 1GMMA 3FFQA 4JAAA 5JOXA 5L7OB 2TBVA 1GV9A 4IV3B 3A21A 1UW8A 2Q8CA 2BVBA 3NNGA 1IS3A 2WZR3 4XMAA 2VNOA 4E2SA 1CJPA 1K45A 3LDBA 3LZZA 3WHTA 4BWOA 1OFNA 2PHDA 4ZKTB 2VNVA 5KC6A 2VL4A 3Q8CA 5FFOC 1Z7S1 3VBFC 4UFLA 3T0BA 1RL3A 5D1IA 4YM0A 4BPZA 3AVRA 4MGKE 4QKBA 1JYTA 1K42A 1V6KA 2V4AA 4GWJA 1Q8QA 1O5UA 4XOGA 1AL22 3ZYFA 2Z5WA 2YGMA 5AC92 5A6XA 3AMHA 3MLJA 1K5JA 3AM2A 3VHOA 3M3IA 1RUG1 3JBG1 4PF5A 4Q4X2 2CDPA 1D4M1 3WQBA 1JU3A 2JJ6A 2PAKA 4FFFA 2HBTA 5LB6A 3RFRA 1AF9A 2AUYA 3DYOA 1JZ8A 4CP9B 4DZGA 2E63A 2P3KA 3EO6A 4OUSA 2ERFA 3TWIA 2ENRA 4CEWA 4DY5A 1N3PA 4FPGA 3WDUA 4CEYA 1W05A 5BYNA 3RQ0A 1Y3TA 4OVEA 1PM7A 5EJ3A 5I8SA 3VZOA 5KXEA 3I3DA 5K4LA 5ISLA 1W8ZA 1TZOA 2WLQA 2D6KA 2JECA 2WS91 1G9CA 2VCBA 3RZHA 2IXJA 2PHTA 1YYNA 5FLHA 1FMD2 2NLRA 4P9WA 2YBPA 2VNRA 1AXKA 3KHBA 4BISA 1OURA 2VZ1A 3VZJA 2ZTNA 4N7UA 2JDAA 2PQQA 2EVXA 2BV4A 2GNBA 4GB33 4TXWA 2Y8KA 5J1XA 5FYTA 1F35A 5FZFA 2WO2A 1PIV2 3NNLA 4R9CA 4RQPA 1CONA 1FPN2 1DZRA 3ZVXA 1PGL1 1YFWA 5DABA 3JD71 1WCDJ 1H6YA 2DBIA 4NPLA 4QXHA 5IK7A 4Z82A 1Z7S3 2E7AA 4M3CE 3IMMA 3ZFEC 4OQ8A 3VDCA 1WW7A 3KM5A 4N7IA 4A7KA 1W3XA 3MPBA 4UFKA 2WAOA 4GWNA 1F31A 4NHMA 3W20A 3MDPA 2XUEA 3VBUA 4BQ2A 2HWB3 5FZGA 1NLRA 1RUG3 1GBGA 1S2EA 2OX0A 4URAA 1BMV2 4QB2A 5CISA 4E4DX 1D4M3 4M00A 1J58A 2Q1ZB 3ILRA 4KL1A 1W28A 4RS5A 4P14A 5E1RA 5A3LA 1GWLA 4AVCA 1J3QA 1W6OA 1BYHA 2GSYA 3GBFA 1JOPA 5DG1A 3POBA 1ZBE1 3WDYA 4AXOA 1JOJA 3FLPA 4BQ3A 1B35A 1IKQA 2NMNA 3NNMA 4AGGA 1RUF2 2Q8DA 4AVBA 4Q0UA 1NCQA 3BIWE 3EQEA 2DURA 2VZPA 3TEXA 1PK6C 4ZXEA 1SDDB 3KSCA 1FV2A 1UZYA 3NKTA 4BA6A 3E6BA 5IYYA 3RZGA 1PMIA 3AP7A 4JHZA 4MXVA 4YG0A 4LO8A 5FZKA 4NIGA 5AFBA 4M4PA 4HSJA 4BXFA 2ZA9A 5IVJA 1O59A 2DU0A 2VMFA 4L8QA 3POYA 1HQWA 4LKDA 3NW4A 4AEJA 4NPRA 2HWF1 3I4IA 3PMSA 5EZWA 3W59A 1YUDA 2BWCA 3GCXA 3GJAA 3M70A 2R063 3AYEA 2HBUA 3BGAA 2YPJA 3BTAA 5JR2A 1NA1C 5BNPC 3S6PA 2A70A 4HT1T 3KLSA 4EWAA 5FOBB 1UY3A 1R092 4BB3A 1WMDA 1V6NA 3OGGA 4AEMA 2UWBA 4H7LA 4TLGA 1QJU1 2VQUA 2WNVA 4BK5A 3ZSLA 2PMWB 4JGYA 5CFCC 4GJYA 5I8YA 1OHFA 1GNYA 2FBEA 3V0AB 2PXJA 4EYUA 5JUVA 4ZU7A 3HBKA 4G3YC 2DVAA 2FMDA 4LKFA 5DXDA 3MUZ1 4FBFA 1VMJA 4XTMA 3SLIA 3T2PA 4D94A 3ILFA 1LTEA 2CGNA 1RUD1 4K9SA 1F15A 1VBD2 4Y22B 4YFWA 1R64A 4PBOA 2R041 2VULA 3NJVA 2DVFA 1NG0A 2DF7A 4Q4W1 1ZRDA 2OZJA 1PGW2 2ZMNA 3D8CA 2IZWA 1L7QA 4XABA 3ZXDA 5JAXA 1X50A 1AYN2 3PU8A 4RGAA 4OULA 2CNAA 1RMU2 2K2SA 2XJQA 2ADDA 5DAVA 4TLFA 3NWKA 2D6PA 2GN7A 3RDIA 3VBFB 1XPWA 4M0HA 4CP0A 5C70A 4ES9A 3B93A 4IQPA 1UZVA 4FPHA 4W50A 2ZKNA 4CCLA 1STMA 4CDQC 4UFMA 1N3QA 4B4PA 4Q0PA 1E5HA 2P6CA 4KH9A 1I5ZA 5FOJB 3H0OA 2FZ2A 4IE7A 2DVGA 2FZ1A 1ASJ2 4P00B 4NHYA 2WFF2 4MG2A 2XONA 3WV6A 2BBAA 5FYIA 1F5JA 1XNDA 4CP1A 3FN9A 5E16A 1FOD1 1QJU3 4KMQA 4GJZA 4E2GA 2A6XA 1LU1A 3W9AA 4RA0A 5JMCA 1A8DA 2XG3A 2ZX3A 4K8RB 2AYHA 1Y43B 2EAAA 2HWD3 4XZUG 5FYBA 3NSTA 5E89A 1G9AA 1Q56A 2ZBJA 2R32A 2OW4A 4RGGA 3O1UA 1QJY3 2A3XA 5A32B 2ZHMA 1RHI3 4OUMA 4WM8A 2VBBA 4LBOA 5KHHA 3HQRA 1UX6A 2ZJCA 4XE9A 3USUB 2C4XA 4BQWA 4XIOA 3KF5A 4M3CB 2O1QA 4Y4YA 4B4QA 4LKEA 1YQ8A 2BJSA 3K4ZA 2HWE3 2XJUA 5BNOC 4IV1C 1GZCA 4QX5A 4Q4V1 3JB8A 5GALA 5JVVA 2W1UA 2XLFA 4HMZA 1S0CA 5EFUA 3ZFEB 2V5YA 4WZCA 3ZYPA 4B8EA 2UY9A 1LOAA 4H3WA 1ACCA 1PO12 5LBBA 2DVBA 4HG6B 4IW3A 3BUCA 1RJ7A 2ARCA 4AAXA 1C57A 2W47A 4NRMA 3UKVA 1J83A 2HEYF 3HAGA 3ACLA 1LHOA 2IXLA 1BEV1 3AZZA 3PNAA 2PYTA 4IE0A 4Y1VA 5T5JA 5BY5A 3BTYA 2EXHA 1JZ6A 1VBE1 2H0VA 2QQLA 1HXS1 4DB5A 4QB6A 4PIXA 4AVVA 1H9PA 1Q8VA 2VZTA 4DEVA 1C4RA 3OUHA 4RHV2 4LR4A 5LRRA 2VG9A 3D4KA 4Y20A 3ZN5A 2RS51 3NO8A 2E31A 3S7IA 2JDHA 1O91A 3ZKUA 3KV6A 5FZEA 3IZOA 2VW2A 4XF1A 2WNEA 2J1RA 1C8NA 1QH6A 3AC0A 4NRQA 5A1LA 1PK6B 2QZ2A 1HX6A 1UO9A 4XVHA 1Q3EA 4MUVA 4EZ4A 5BNQA 2VTFA 3MHZA 1XE0A 5FY5A 4JZRA 1AYM2 4A44A 5JDBA 1V9U2 1UIKA 3VZNA 1CAXA 2WZPP 3WF3A 4YNIA 5EPAA 3RGBA 4DIQA 3DUIA 1ULOA 3ZIXA 2QQPA 2WKKA 3CHXA 3WXPA 4M0NA 5E6HA 1VP6A 2V5DA 1DQ2A 1IPJA 2WWUA 1I3HA 1K3IA 4UW3A 1H1IA 3KF3A 2EXKA 3DEMA 4YARA 5DUUA 3PMEA 5C71A 3ZFGA 1CPNA 1GP6A 4AL9A 1A34A 1NA1B 5BNPB 2YB7A 2P37A 2AZ5A 2VZVA 3ZR6A 2O0OA 4B1LA 2VOXA 3THDA 2G4IA 4QD2A 3THCA 5FYYA 4IGPA 2IC1A 1YJLA 5GLUA 1V6MA 2LRPA 1QQP1 1VBE3 2R6QA 3CJIA 4E8CA 5CFCB 1HXS3 3K46A 1LB2A 3ZN6B 1XU2A 4AK3A 3M7AA 1OKOA 3ZXAC 2OPKA 1EP0A 4A3ZA 2ZXQA 5A3UA 1YO8A 2WSUA 5F37A 4FTEA 1VRBA 2AR6A 5I8TA 1O4TA 1UAIA 5GLVA 1UXXX 4MVTA 3RZMA 2RS53 5KXCA 3HQUA 3TAYA 3VUOA 1W39A 1HV1A 3VBHA 3MW2A 4CSWA 1DFQA 4JKKA 4K7JA 5C8CA 1UY4A 2BYVE 1GSLA 1RUH3 4LBQD 3LGRA 4KWUA 4NHLA 4CDWC 1D4VB 4HN0A 4Q4Y2 2WYFA 4UF0A 1WWYA 2JXAA 5H9PA 4PJYA 3ZMOA 3AKSA 4IL7A 4LBQA 4P9LA 4R9DA 5A7OA 1JMUB 3NVCA 3KVAA 2GNDA 1XJAA 3OY8A 4GH4A 1VBA1 2OYZA 3TN91 4B29A 4BDVB 4S2FA 1JW6A 5DZGA 4KNCA 3PUHA 1AR91 2WZR2 1JYWA 1QU0A 4CDQB 2VECA 3RI8A 3RZKA 5SV5A 4QDSA 1HB3A 4Z2AA 5F6LB 5LCWL 1V6JA 4QX7A 4EQVA 2A6YA 2VO5A 4L99A 3MIHA 2WO1A 5LK7B 3I3EA 3RZZA 1LENA 3U4SA 3J8F2 3LKJA 5FMBA 1EAH1 3SH3A 3VHRA 2RS13 2ID4A 3O14A 4NE9A 2GC0A 1V70A 1W8HA 1US2A 1KD7A 1U5YA 1WUVA 4GWMA 4W8JA 2Z42A 5GLWA 2CU5A 2B9UA 5JSRA 1TMF1 4LT5A 1LECA 4AHYA 5CEHA 2GMPA 2K46A 2XJTA 3K3NA 3EYPA 2X10A 1ZZ8A 3WF1A 3ZYRA 4BE3A 5A33B 2GALA 4A4AA 1PVC1 4P9JA 3BTZA 4CXWA 1ZREA 1OLRA 5LA9A 4WVMB 1UD1A 4NR1A 1XQNA 2YG0A 3UGHA 3BI3A 4JC1A 1ULDA 2C26A 2YY1A 5ANQA 1LOFA 4AF9A 4EWDA 2WAAA 2W95A 3HQXA 3C8XA 3WNLA 1EUTA 5BNOB 4IV1B 3W58A 4HVRA 4R9BA 1DP0A 4Y1ZA 2LS6A 2WN2A 4HK9A 2E6VA 4JKMA 1VBA3 3AKTA 5FZBA 3TN93 2BFUS 4YVSC 1QDOA 5FP7A 1H8VA 4OLLA 1AR93 1GKBA 1SEFA 3EMRA 1OF3A 3ATGA 3M3QA 5FZ8A 2Y6GA 5A3NA 3WP5A 2VH9A 3TYJA 5K0UC 4DS0A 1WW4A 1N47A 1OD3A 4K8FA 1Z7S2 1HRV1 3J7HA 2MHFA 2X5IA 4DXRA 2RJKA 5FY8A 4LNVA 5IAVA 3JXSA 4N43A 1VIWB 2NQYA 1JZ3A 1K12A 2D98A 2UU8A 5IATA 1EAH3 2J1SA 4A3XA 4CXXA 5LEKA 1BBT3 2EIDA 5A6ZA 3W5MA 2ZGLA 1DU3D 2DDUA 5JZGA 1RUG2 2DVDA 3JBG2 1UL9A 3OGVA 4MGTA 1D4M2 3ZYBA 2XL9A 5JOZA 4XHBA 3H7JA 5FXWA 3RSJA 1UOBA 4JV4A 1PVC3 2WNUA 3FWEA 3B02A 5I91A 1O6UA 2VOTA 1ZA7A 2A3YA 2BNMA 3KWVA 4P9GA 3EBRA 1RVF2 5CU1A 2WS92 1X8MA 5FBZA 4C1XA 1CZSA 1WKYA 4Q0VA 4X8PA 3LFIA 4X6QB 1AJOA 3VDDC 3USSA 4TSVA 2WNOA 4LKSA 2XPJA 3MI8A 1R081 3O0XA 1GNHA 3AFKA 1WW5A 1ONAA 5A7NA 4S2DA 1M4WA 1VJ2A 5F7UA 2YU1A 4Z07A 1RUE3 3WY6A 3H50A 3WUCA 1W8WA 3GF6A 4JTNA 4OI4A 4J6GA 1PGL2 2JB8A 4JVAA 1IPSA 3JD72 4XJAA 4ZZ8A 3N7JA 2X53S 3OB8A 4FFGA 4IEZA 5GKAC 2C24A 2IVJA 1LAJA 1CZTA 1RIRA 5FXVA 3J7MA 2JE8A 1OSGA 1YI9A 2QQUA 1REDA 5CA6A 4XJZA 3D0JA 4FOWA 4D7YA 4XFCA 3VKLA 1AR61 1CAVB 2VBDA 3U4XA 2X09A 5IK8A 3AKRA 3PVNA 3MW3A 2X8KA 3QH7A 1SCSA 2R071 5FY7A 3F95A 5DMYA 1RC6A 1QGLA 4MSVA 4J1WA 1VLNA 4KGQA 1KFXL 1MZ6A 1V6OA 2FDIA 4CDWB 4AE2A 1CAUA 1SLTA 5FY0A 5C3QA 3ZO0B 1TG7A 4YYOA 2B42B 1PHMA 2BBVA 1ZBE2 2DCTA 3J26N 1W6PB 5DUVA 5CYYA 4LJHA 1WD4A 5A3TA 2G9ZA 4ZPIA 3PIJA 5EHDA 2UWAA 3E5XA 1DGWA 5C3RA 2AREA 5T54A 1GR3A 1UOGA 5IHRA 2A6ZA 3WNPA 1XYOA 2QQIA 1DZTA 5IK4A 2FDHA 2Z79A 2XB6C 4YGEA 3RI9A 1POV3 2WYSA 1AZDA 1UOFA 3C7GA 2XDVA 3K77A 5FZDA 3WQ0A 4YW5A 4FOYA 2KA3A 4JRAA 1CR7A 2HWF2 1PO23 4N8MA 5A1AA 4D0QA 1H30A 2IVIB 3QH6A 3GZAA 3P1IA 4URTA 1SBEA 1SBDA 3NV2A 4OHZA 3UL2A 4XAEA 2NPIA 4AI1A 3TOJA 3CEWA 1AR71 5KHGA 5IVVA 2QFEA 5DDJ2 1PZ9A 1FATA 1JUIA 1RUJ1 4XACA 1LODA 3A0KA 3TEWA 1OQ1A 1K5MC 2A7AA 3NRUA 5D8AA 3FBYA 2AENA 3DPRA 4MX3A 4NRPA 2BFUL 3CZUA 1GLHA 4QDRA 5LY2A 3A7QA 2XXZA 2QQKA 1F8VA 4BU2A 1UY2A 4D6SA 4V2WA 1GANA 3ZR5A 4XFAA 2W1QA 5L36A 3NJZA 4TN7A 1G86A 4EN0A 1HDKA 3M1HA 4YZ5A 1RUD2 5GM0A 5IT6A 4P9IA 3RZJA 3PHMA 5CZKA 2R042 3ZLIA 4Q4W2 3JB4C 1RUC1 1ZYBA 1S1AA 3I8TA 1JHNA 4WZFA 4BLIA 1DIWA 3ECQA 1MZ5A 4YVWC 4YVSB 5T55A 1B09A 1MZEA 5EYXA 3TEYA 3SC7X 2GMMA 3NMBA 3ASIA 1JN2P 3O1TA 5FLJA 1WBFA 2OQ6A 5FZ9A 5K0UB 2ET1A 1LOEA 3N36A 1GZWA 5E8AA 1NCRC 5EJ1B 4A6OA 3LA7A 3PDQA 1OPMA 2VD7A 4FQZA 4K1ZA 2A3WA 1ZX5A 3SQOA 3A23A 1QH7A 2VXRA 1JUHA 2OUHA 2WQZC 3GZEA 4HKOA 3FHIB 1WCKA 3DL3A 4NWWA 2GN3A 1KDKA 3FLTA 3G6JB 3IDEA 5KR7A 3MV11 4ONUA 2I2SA 1AR73 3R4SA 4CVUA 2B5HA 3FBMA 4LIVA 1NZCA 3NQHA 1RUJ3 3VB9A 1QNYA 2XJSA 1LHNA 2QE3A 4IDZA 5FYSA 4DNYA 2PQSA 3V0BB 3C7OA 3KZ4C 2A5ZA 3LIHA 1G9DA 1FOD2 1W8TA 4AVTA 2BPA2 2JIJA 1S55A 1WMXA 1W99A 2W92A 2OS2A 3AMQA 5HV4A 3MFCA 3POFA 1LOGA 3ZSEA 4U36A 2BOIA 2NZ9A 5G05L 4QT6A 2WFPA 2E7TA 3OEAA 2TUNA 2G1MA 1V00A 3URFA 5FYZA 3VDDB 2ZGRA 3WW2A 4AQTA 5B2GB 4CCDA 3D6EA 1RUC3 3WDTA 5JXHA 1UKGA 2DBNA 1XNCA 3OYWA 1MQTC 3ACIA 4I0BA 4QGLA 4QAWA 5FWJA 1JYVA 3WNNA 3NV1A 1W2NA 1HN0A 1RGSA 4AR2A 4XXAA 3T09A 3GALA 1ENRA 4Q4V2 2ZEZA 1NLSA 4RFT0 4UFIA 1VBC3 2DUQA 4GAZA 4YW1A 1FAYA 2RDSA 4E9KA 4ZS3A 4CCNA 2LALA 1W90A 3V65A 1NYWA 3ZPYA 4R9AA 5C4WC 1HLCA 3C7EA 1DYPA 5L9RA 4GB31 5FMDA 4JTOA 1BEV2 5ANNA 3V0AA 1U5ZA 1VB4A 2PHFA 3AP6A 3IPVB 1VBE2 1HXS2 5HCAA 5DZFA 1VAKA 2ZMLA 4KG8A 2BERA 4QHBA 5F3EA 5FPZA 3VBSA 4AGVA 2W2IA 2EIEA 4N9IA 5CFDA 5JIAA 3Q8FA 1QY4A 5FQ0A 3RYRA 1Q5OA 1HJGA 4XXPA 2RS52 1NE4A 1LOBA 2RM21 3GJBA 2B7YA 5JXGA 3EHKA 4FOVA 1JXNA 5EWSA 4L2NA 1UZ0A 2D93A 2HWB1 4FPKA 1O3SA 1ULFA 3UKTA 4CUBA 3L9JT 4BXSV 1HRI3 5I93A 3VZKA 5FJKA 4M4RA 2AACA 2F4LA 5IW0A 3OOXA 5J37A 4MGZE 2GC3A 3CIHA 4D8MA 2VVEA 2ZGQA 1JZ7A 1V0AA 4CEWC 2YU2A 2CHHA 3LCPA 4CEYC 1EV11 4CCJA 1RUOA 1YI7A 4L0PA 5KBFA 1AVBA 3CO2A 2VMCA 5ERLA 5FPAA 4XBQA 3WNXA 2QQMA 4QQPA 3ZX7A 3ACFA 3NAPA 5FO8B 2YXSA 1TNFA 4GMP1 4YLZA 5A6YA 1SPPB 1W04A 1K5MB 1E57A 2P3YA 5FP9A 3GZUC 2YBKA 4C8DA 4XAAA 5A1FA 4YW7A 1QQP2 1CN1A 4YFZA 3ES1A 2VMIA 1UX7A 4PIZA 2WRAA 3I59A 4JDOA 1ENXA 4RQPC 1HB4A 3MUY1 2KR2A 4CZSA 5FO9B 1H2MA 2R061 4QXKA 4X8NA 2RVAA 3AP9A 1CZVA 1BVVA 2RJLA 5IFPA 2RM23 2YROA 2Z2SB 4GXLA 1EYBA 5A7PA 4UW6A 5CG9A 4WVWA 3S30A 4BQ1A 4B3NA 4YVWB 4XW3A 5C6CA 2Q1MA 2XVLA 3WZ1A 1OPOA 5EJZB 3LQCA 1ENSA 2TNFA 4YZ1A 3ZFEA 1IG3A 2Y60A 2MEV3 2RS31 1VMFA 4QQOA 1NCRB 3SCFA 4CUGA 3V56A 4YM3A 5H9QA 5CB7A 1SLLA 3KMHA 3TN92 5I0SA 1UZWA 1KQRA 3KV5A 1RJ8A 4H55A 4RS5C 4MGSA 5FUPA 1AR92 4NVPA 4I0WB 1OBNA 3DECA 3RJRA 1EV13 1GOHA 5GZFA 4RGKA 3QACA 4A7ZA 2YC4A 2NN8A 3B69A 5A7QA 1YXWA 3DYPA 4OZOA 1G9FA 3MEPA 2HKXA 5CNAA 1B35C 4GMP3 5FMCA 3TBDA 2D6LX 1W9SA 5I0TA 2W08A 5LW9A 1EUUA 3BTXA 1UMIA 1F5FA 1IQDC 1EAH2 1N1SA 1EPWA 1R1A3 2YYOA 4ZU5A 2ZGUA 3I97A 3VGIA 1TME1 2J22A 4BMBA 2JB4A 4AFDA 1AR83 4HVQA 1YFYA 3SXWA 5FCCA 4XFIA 2J1UA 2R0FA 4OMDA 2WIIB 1H8TA 1NUKA 1TMF2 4EJRA 1W8NA 2CGPA 3THPA 3VBRA 1CJDA 1X36A 3MIEA 1PVC2 1S2KA 2XVGA 5CVRA 4OMCA 5GLZA 4L92A 4BCUA 3J4UH 2PAMA 1O4YA 4R8HA 1WZXA 2IXIA 4Y26A 1H2NA 3MYXA 2ZX1A 1MQTB 3VBOA 4COYA 3Q8AA 4HKLA 4NO4A 4DO0A 1G7YA 2JKBA 2XOMA 3OD0A 5L9VA 1F2NA 3LOBA 2DCKA 1QEXA 2KD7A 2VZQA 3C7HA 5CBLA 3OGSA 3I3MA 5ABJC 2ZEXA 3ORJA 2RS33 2HWD1 3QD6A 2Y0IA 3FX3A 2WNVC 2CYFA 5BNPA 1LULA 4JGYC 4QPGA 3WDXA 4AHZA 1MS3A 1NY71 1POQA 1GU3A 1QJY1 4A2UA 2O8QA 4KBZA 3WCSA 1RHI1 2D43A 4GIQA 2YZ4A 5CIRA 1MEC1 4IEOA 3J7NA 2CAUA 5C4WB 4CDXC 2VJXA 2XLGA 2VMHA 4Q26A 5FP8A 2OUJA 2P6HA 1HRV2 1U5XA 1MVEA 1W6QB 4LE4A 5F5CA 3ZOIA 2P1BA 5CFCA 2ETEA 3BU0A 4FPLA 4COUA 2HWE1 2V09A 5GZGA 4LITA 5A3PA 3O1RA 2WT0A 2LROA 2J1TA 3AL6A 1XNBA 2F4PA 1H0BA 1WMFA 5HCFA 4XYXA 1TME3 5T5PA 2YMZA 1W9TA 1YIPA 1IS6A 4HN1A 1F4HA 3KHCA 1LHWA 1SMVA 2E7QA 1ULGA 4Y33A 5J7MA 3U14A 3ZFFA 2WO3A 2MNGA 4NUBA 2VMEA 3VD4A 4TZDA 2QTWB 1IS5A 2JDYA 1WW6A 1CAWA 4MLOA 4SLIA 2X05A 5JPNB 1L7RA 1IOAA 2EIGA 2VMGA 4YRDA 3FJSA 3RWKX 4IXLA 4Q1RA 2BNOA 2ZHLA 3X29B 4NJ4A 4PLNA 2VU9A 4HANA 4CRQA 5T5OA 4BQ4A 4B7KA 1SLCA 3LOIA 3HBZA 4E2QA 3B9IA 1U0AA 3WDVA 4QPIA 5GZEA 3HT1A 3RMYA 4XQDA 4CXYA 1ZRRA 2GP3A 3ITQA 1R082 1OKQA 3ZXJA 4CEWB 3BOWA 4CEYB 4CCKA 4MGIE 4H14A 2P2KA 2IWGB 2VE1A 4FPYA 1CPMA 3WQ7A 1X9PA 2ZX0A 4KG0A 3S0MA 5CADA 1MEC3 3JQWA 3SKVA 1CX4A 3NKGA 4P08A 3O1OA 3HD8B 1OH3A 2W68A 2D6NA 4WM8C 1PX4A 1PMHX 2EIBA 3IBMA 4ASKA 4UT5A 1PX3A 1A78A 4JGZA 4EE2A 2BDRA 3L2YA 5F32A 1DYKA 2BVVA 4I01A 3OCPA 3AJZA 3SITA 1CX1A 1EY2A 3U1XA 3FHAA 5F5AA 4YG3A 1S0JA 4RQPB 4GWIA 1AR62 2Y26A 2RMU1 3OBRA 1APNA 1PM4A 2WT1A 3N9OA 4H2AA 4WVMA 3E5QA 4BH9A 4AI3A 4DOUA 3SH5A 1MPXA 2P3IA 2R072 2YDEA 5AVPA 4E4ZA 2DUOA 2QQWA 4XMIA 1S0BA 4IGOA 1WCUA 4IETA 3CMGA 5EXOA 4F7ZA 2YV8A 1BK0A 4EZHA 2B9VA 3ZXEA 1YRZA 4LLFA 1QXRA 3ZSJA 1HJFA 3FHQA 2B45X 2C0ZA 4AWDA 2YC2A 4INDA 2FDJA 4RS5B 4OZXA 4WM7A 2W91A 2Q5TA 4AEKA 4OYUA 1AX0A 4AI8A 2OXBA 3RNSA 1RUH1 1LHVA 3RYKA 3T3YA 3SNMA 1DYOA 3LD8A 1B35B 2B39A 3LPFA 2JIGA 3WG4A 3SHRA 3LPGA 2BTVC 2CY6A 5FZOB 4Y4RA 1LRHA 5I0UA 1W3VA 2I07B 1DGWX 2D40A 4IEYA 1XB9A 1MACA 1QOOA 3F2ZA 5EYYA 5FDBA 5IFTA 1ZRCA 4UBHA 3FE5A 1ND3C 1ODNA 2VM9A 3O1VA 2HYKA 3SKJE 1GQHA 3RS6A 4AI0A 2RMU3 3WG2A 3G7DA 4K6BA 2ARAA 1H2LA 2GZWA 2X29A 4ISQA 1BK1A 4XCAA 3N9PA 3ZFGC 3KT4A 2BZDA 3KV9A 4W65A 3DKQA 2G9GA 2RS11 4BOWA 3KGZA 1UYPA 1H6XA 1Z78A 1BLZA 2W5FA 3GNEA 4XDOA 2I45A 5FO7B 3Q8EA 2OIIA 4IEVA 4QXCA 5ABJB 1RUC2 4IUGA 3ZIWA 4DUWA 2RDNA 2W94A 2WNVB 3NNJA 5KHKA 3CJIC 4JGYB 5CG8A 3HR9A 2W1SA 3HNYM 1T6GC 1L7LA 2VQ0A 3R05A 4M01A 5HXMA 5HXVA 3D82A 5BPXA 3VL9A 1DZQA 2JDKA 2JG8C 3MV01 1CVNA 3L2HA 4CDXB 3OBZA 3LAGA 2D3PA 2P34A 5BNNC 1W2UA 2PAEA 1W6NA 3NJYA 4Y5Z0 3ST7A 2JE9A 2WUHA 4ZS2A 4YGBA 5C8CC 1AL0G 1QJEA 5DG2A 3O1MA 3FUOA 1QDCA 1UU6A 2JG9A 2R0HA 3CKHA 5FXXA 5C7GA 3FFZA 3H3ZA 1MZFA 1RTVA 1JH5A 3GCWA 4LHKA 4NIHA 1YQCA 2A71A 3MIFA 4AFBA 4RR3A 3AP4A 2KM2A 4AFCA 1JYCA 1DGRN 1YCIA 3HN3A 4GH4C 4HPKA 5JCTA 1T2XA 5FPXA 1REFA 3BIEA 3SH4A 5AC93 1W6MB 2DCZA 4BK4A 1UQXA 2D5FA 2CDOA 1W6PA 4XF9A 4XFGA 1UXZA 4NAOA 3C2UA 5BUVA 4LO7A 2EALA 2CTVA 5FZAA 3VZMA 1WLTA 2XVKA 4XTPA 3K4DA 1BBT1 1V6IA 4PI2A 3KCXA 2Y38A 5JXJA 5C9AA 4UFJA 4IESA 2QQVA 2Y6HA 4FFHA 4LOSA 2W46A 4COVA 2AH2A 1C28A 3PJYA 5KHJA 2UYBA 4Y1YA 2YHJA 4RYDA 4Y5TA 5FXZA 3M8LA 4RN5A 2ARBA 4AOCA 3BOPA 3T2OA 2JEMA 1J1TA 1LCLA 4JCKA 1FMD3 5DUXA 1HV0A 1D7PM 2Z69A 3HEIA 4BIOA 4WM8B 1GOGA 4CDUA 1ZNPA 3I2HA 4L97A 4PCRA 3N9QA 4YZ3A 4DFSA 2JDPA 1PIV3 2PHRA 1YLLA 1ZZ9A 2JDMA 3PU3A 1ZZ6A 3ZN4A 3QBQA 4QQLA 2Q4SA 3DGTA 4KBBA 4DINB 1AX1A 2FDFA 5KXBA 5I0RA 4GB32 5FIXA 1FNYA 3CDZB 3QOPA 2BP6A 4N53C 1RUE1 3AZYA 3IIIA 5KHIA 3T2TA 3AZVA 3I2JA 3VN4A 3I54A 1IGOA 5A7SA 4MHRA 3O0WA 2RHPA 5FZLA 3I2DA 3BVCA 1HB1A 2ZEWA 3N4MA 1ND2C 2CWSA 3T2QA 3BKZA 3CLPA 2RM22 2ZGTA 4DEQA 2W39A 2GMEA 4MO3M 3SISA 3AX4A 4N43C 1XC6A 2HWB2 2P3JA 4QX2A 4Q2FA 1ULCA 1RUI1 1RYYA 2QQOA 1SLAA 2WZ8A 1UF2C 4JHTA 5JZGC 1I1EA 2CL2A 4Y20B 2J1EA 4MXWA 1DQ5A 2ES3A 4XETA 1UCXA 3POEA 3RWNA 2CV6A 1I5PA 2WNUC 2D44A 4XUPA 2QJVA 4COWA 4XC9A 4LA3A 2W3JA 1UPSA 4FP3A 2ILMA 4XILA 5L73A 2VGDA 5LRSA 2XQRA 1JOBA 3H1WA 4ARYA 3PLQA 2OVUA 2RDRA 2ORXA 1QF3A 1ZZ7A 4XJ8A 1CAXB 5IJRA 3S5QA 1TE1B 4A41A 2FD8A 3E97A 4LK6A 5L19A 1ND3B 2QCSB 5K9YA 4UFHA 1UN1A 3AMPA 4GKYA 2VCAA 3VD3A 5BV6A 1POV1 2XKPA 2YGLA 4PBPA 1DBNA 1OT5A 4P5HA 3N35A 4ET7A 3H1YA 3AFGA 2ZPXA 4OCTA 4ITCA 3ZFGB 4AHXA 4AQSA 1R093 4NHKA 3K51A 1H4HA 4J25A 1W8FA 4P5YA 4XDQA 1PO21 4NWVA 5FZ4A 4I3GA 3VDDA 4QGMA 4CCCA 2ZX2A 4XJUA 2ZACA 5JR7B 1ALYA 2R062 3UYJA 4Y24A 1UU5A 4Y1XA 4XUTA 5KWRA 3ZYHA 1Q8PA 1RXFA 3LSEA 5F2SA 2ZX4A 3CJIB 5FREA 4P9YA 1XNAA 4D6RA 3UT0A 1L3JA 4UBGA 5T50A 4QX3A 3VHNA 1G9BA 1YJKA 1VBD3 4XBLA 3WOGA 1RUI3 2JG8B 4DPNA 2CGOA 4HBNA 1ENQA 5ACA1 4P02B 2RS32 1Y4WA 3H3LA 4PHZA 4CU9A 5BNNB 3ME2A 2VCCA 3U37A 1RITA 1GWMA 3FZ3A 4JQRA 4DXTA 5C8CB 2ZGKA 1P8JA 1SLBA 3AYCA 5A7WB 4FI9A 3W21A 1RMU3 2I74A 4V2VA 3PTRB 2K9ZA 4N90A 4UF0B 3J9SA 5L7OA 4IV3A 3IMNA 5FZIA 4YWAA 5C5UA 3LDKA 3WW1A 1DQ6A 2VOWA 4BQYA 3WUDA 3IPVA 4LBQB 1FNZA 2D97A 3HN1A 4KWJA 4CCEA 5DUWA 1GICA 5C3SA 3OTFA 4GH4B 1LU2A 3ZM8A 3MF6A 1NXMA 3H1MA 1I9RA 5C8WA 1N1VA 1NQDA 5J3UA 1TME2 1VBB1 5FY4A 1HB2A 3DV8A 2BW8A 4XFHA 2C5DA 3WX5A 4CP2A 4AAPA 4Y3OA 1ASJ3 2OKXA 1NXD1 2D3SA 1GQPA 1ZZBA 2V73A 4CE8A 4IE5A 1CIWA 3PUSA 3N3HA 1SLIA 3SCGA 2D6OX 4Q8LA 4PQ9A 2ARXA 4IE4A 3M4FA 5DAPA 3IAPA 4CP9A 1NLQA 1UMHA 1VMHA 3VKNA 4C91A 4F8AA 3K3OA 1JZ5A 1IKPA 3MIGA 3LE0A 5FRAA 1QJU2 2XWJB 4EROA 1MS8A 2VZSA 3WDWA 1JZ2A 4IE6A 4XIKA 1LGCA 2W52A 5D8AC 3RJ2X 3T0AA 5ACA3 3DPRC 5FMOL 2HWD2 4LHNA 2Q8EA 3BCWA 5B4XA 1UYXA 2EXIA 3POIA 4FOQA 4HONA 1NY72 1JTZX 1YFXA 4L11A 1QJY2 5LASA 4ES8A 1F4AA 3KCCA 4K1YA 1RHI2 5F3IA 3GM8A 1MEC2 2VZRA 4KU8A 4Y5SA 5FKBA 4BIFA 3H8XA 1IHMA 5F39A 5FPUA 4HZFA 2HJIA 2DCJA 2Q0AA 4QQHA 4X6RB 4N53B 1OD5A 4OHVA 2FCVA 5FYCA 1W9FA 1RXGA 2HWE2 5J36A 1PO13 1FX5A 4Z1VA 1C8M1 1OC1A 4QKFA 5FZ3A 1VRH1 4Z92B 1J3RA 3SEPA 1VBC1 1VBB3 2GC2A 2R16A 2BGOA 4OFGA 1A3KA 4FXGB 2KXLA 3VDBA 1ND2B 1GP4A 2WWJA 3DXUA 3IT8A 3O12A 2X5IB 1VB2A 3U78A 4AVAA 1W0PA 4N43B 2JD9A 1JI6A 4O9EA 4Q29A 5KC5A 5L9BA 3W5NA 2RG4A 5FYMA 5FK7A 4NIIA 1O7FA 4MHUA 2WZEA 4CCOA 2MPFA 3VDAA 4E27A 4XPVA 1S0FA 5JZGB 1KRIA 3ZDVA 3WR0A 5J98B 4IEUA 1DQ0A 4XF3A 4UI9L 2QQNA 2GNTA 2JX9A 3MGUA 2QNKA 5F5QA 3ELNA 5TSWA 3VKOA 3O1SA 2WNUB 1WA6X 1S0IA 1AYM3 4CPBA 2EICA 2F17A 3IKWA 2R1BA 4XUOA 1F9KA 3KQRA 3ABZA 3HJRA 1YQ2A 3PUIA 2YBSA 1OOPC 3CNAA 3R6SA 1HRI1 1W2TA 4LPLA 2DUPA 1OLMA 4FXKB 1PZ8A 5GLTA 5F9TA 2BWAA 3V64A 3K2OA 5DAWA 1QNWA 4XURA 4CU6A 3GGLA 1WD3A 4HK8A 1C8M3 4K3UA 2QDNA 1VRH3 4LUMA 2OQ7A 2D3RA 3UJOA 4G4FA 4FPCA 3AP5A 5IVYA 2RR11 2D7FA 2RMU2 4QM9A 5LA0A 1XSRA 2XGXA 2VC9A 2J7MA 4PDWC 4AEDC 4ASMB 1AXZA 2R1DA 4W4ZA 1WBLA 4FCAA 3U0ZA 1CD3G 4KI5M 1HIXA 4AFAA 4ZU4A 3ZSMA 5C3OA 1VALA 4GZ9A 2VCMA 2JENA 2PFWA 2VW1A 1JYXA 2GP5A 2F6BA 5IVBA 2VPVA 3P5BA 2YC0A 2GC1A 5FAXA 5FZHA 2DFBA 3C7FA 1S0GA 5JPMB 2NM1A 1J1LA 4Y22A 4B4RA 1SBFA 1X33A 4Q4Y3 2WSVA 2ZABA 3BN6A 2C6SA 5FY9A 3I2GA 3FLRA 4AI9A 5C4WA 1H1MA 1W8UA 3VD7A 4XJ9A 4ZXKA 3FUQA 2JD4A 4I0AA 3VBSC 5CFDC 2EXJA 5EQUA 3LA2A 3ZDSA 4QMAA 1Y9MA 3E6DA 1RUH2 3T1LA 1QIQA 2BUKA 2CWMA 3IDBB 4LBLA 4AZZA 4QKNA 1Z0HA 2XKOA 4MGQA 3VBFA 2HWC1 3I2KA 3JUUA 2CSGA 1D2SA 2HYXA 2BU9A 3KB5A 3HIFA 2MEV1 1OLQA 3BODA 4I3PA 1JS9A 2LW8A 4LQRA 5LA1A 2ZGSA 3ZKYA 4A7YA 2XMLA 5LA2A 5FYVA 1GZ9A 1DCSA 4QX1A 4NPMA 1DQ1A 1CIYA 3TEZA 2B46X 2RR13 2VUCA 3J8F3 4QX8A 3BPSA 3U10A 5EP9A 1DQ4A 5C5TA 4O7XA 1UU4A 5FPVA 1DF0A 1EPZA 5BXXA 2ZGNA 1ULPA 4TWTA 1TVGA 5I0DA 1Q43A 3NAPC 3AZXA 1O8PA 5FTTC 2A1XA 3WNOA 1R1A1 2IFRA 2RS12 4IEXA 1OQEA 1GNZA 1A8MA 4KWKA 1GWKA 3POJA 1AR81 4FQ4A 5D8AB 4XEZA 3DPRB 4IEWA 3OGJA 1RVF1 2BGPA 1E5SA 5A32A 4D7SA 5T3NA 4PLMA 4C0HA 1XBFA 5D21A 3T08A 4QWNA 3USUA 2E33A 1LNSA 2A6VA 3HNMA 3INAA 3P3NA 1KGYA 1QKQA 4M3CA 4FFIA 3ZYIB 4CUAA 4CUCA 2VR4A 1SQ4A 1OVPA 4UOJA 3EJKA 1BJQA 4JDNA 5F1RA 5IVFA 1UOJA 1VAMA 2XL7A 2ET7A 4HETA 3UJQA 2NP0A 1TQ5A 3M3EA 4NN0A 3VBUC 2XHNA 3VZLA 1J3PA 5FBJA 3OUIA 2HWC3 1OUSA 2LTNA 3BU7A 2QKDA 3BB6A 1C3HA 4ZONA 1VBA2 1ZBA1 1REEA 2HH9A 1GZWB 3H8RA 4FTSA 1US3A 2PLV1 4OI2A 1A6CA 1LHUA 4MGYE 4YGCA 3ROUA 3H42B 3I3BA 3OSDA 2UWCA 3TB0A 3K75B 3M3OA 3A0NA 3P6BA 4ASLA 2ZMKA 1NAEA 2WABA 1X8EA
chains in the Genus database with same CATH topology
3FC0A 1FYUA 4YGDA 3AXDA 3T1MA 1O3QA 2ZAAA 2H0BA 3WG1A 4IEQA 1BBT2 5AVAA 4AQ6A 3KS7A 2PTMA 3WVJA 1U5IA 1QOTA 2VW0A 4AFMA 1XU1A 4QPYA 1RVF3 5I0RA 1PK6A 2DU1A 2G9FA 2GH2A 2WS93 1XYNA 2PHUA 4CTEA 1W0OA 1ZVFA 5GJ6A 4HLTA 1H8TC 5JI7A 1OMIA 4DMIA 1OOPB 3GZTB 4UW4A 1WA4A 3VBRC 4Q8KA 4NOTA 1CESA 1PNFA 4E4SA 1WCSA 3FMGA 1BVP1 4FVVA 4JDMA 4F3JA 1YNAA 3VBOC 3OYWB 1MS0A 1TEIA 3B01A 1Q8SA 2ZCWA 4CYDA 2YUEA 3JD73 1NA1A 2UYAA 3WINE 3DN7A 4LBMA 1NE6A 3SMHA 1ZBA3 3WW4A 2WJSA 4PDWB 1RUE2 4AEDB 1UMZA 2PLV3 2ATFA 4QPGC 2SBAA 5DDJ1 3KT7A 3D0SA 4W6YA 3MLLA 2BNNA 4FO9A 3ZN6A 4LULA 5ABJA 3ZXGA 1KDMA 3AYDA 3JQXA 3AMMA 2DTWA 2XHKA 3AKQA 4DXZA 4OHWA 3WG3A 4FT8A 2RE9A 3WT3A 1ZA4A 1RUNA 1N1YA 1FI2A 4AHWA 3QLQA 3RYPA 3VBSB 1R1ZA 4CDXA 2A73B 1RUI2 1ZBE3 5FQ0B 5CFDB 3R0RA 4HFSA 4K20A 1LEMA 3TNPB 3ZFFC 3ETQA 3CU7A 1DHKB 1JBCA 4QGNA 2H6BA 2XBO1 2PHLA 3OJBA 4V1PA 3ENRA 3LWCA 2ZHNA 4XF4A 4C0BA 4AW7A 1JYIA 3VHPA 4XFFA 3MIDA 3VL8A 4CDQA 3ZXFA 2GNMA 1D0HA 4QPIC 4BM8A 2HWF3 1W6MA 2ZZJA 4XQWA 1KFUL 1COV1 4EWEA 1BZWA 1LJ7A 3VKFC 1BXHA 1HW5A 1OQDA 1POV0 2A75A 1LR5A 2WLPA 5DDJ3 3NAPB 4OHYA 1SFNA 1PO22 4GA9A 3ZXLA 4LO6B 3GHNA 1PZ7A 1QJX1 1U12A 2WL1A 4XF0A 5A33A 3MICA 4JGZC 3O0VA 4ATEA 5SV8A 3ES4A 2JE7A 3N7KA 1RUD3 3I59B 4R4XA 3M3CA 2R043 5T5LA 4Q4W3 5ACA2 4FSJA 2E9QA 4WVVA 5BNOA 5K8SA 2IXCA 4IV1A 1J59A 3PTYA 5C33A 2VUAA 3KCYA 3VBUB 4C1WA 3IM0A 2ZHKA 2XBO3 3AB0A 1AXYA 4LBJA 1DGRA 3RPQA 5JSOA 2VOVA 2VVDA 2PA7A 1FT9A 3MFAA 1DGLA 3PVEA 2FMYA 1KITA 1W6OB 1COV3 1S0DA 1IPKA 1S2BA 4D3WA 4WM7C 5DZEA 1VBB2 3IDCB 2UY8A 1NCQB 4YM1A 4D7TA 1FOD3 1N3OA 4PIYA 1QJX3 2QDRA 4YZ2A 1AR72 5LEJA 3B9CA 3AMNA 2OA2A 1RUJ2 4SBVA 1D2QA 4ORFA 1XRUA 1Y7BA 1AL21 2EF6A 1H8TB 5AC91 5J09A 3NV4A 4LBKA 4R52A 4TYSA 4AGRA 4LA2A 1N1TA 4M3CF 3VBRB 4OI0A 4Q4X1 3TNQA 3P3PA 1WGPA 3O5SA 1SACA 4FPFA 2ZS6B 5IUQA 1X82A 1ND3A 4FPJA 4HKWA 3VBOB 4O9GA 5HCBA 4BLJA 2DYCA 4XBNA 4K40A 4Q4V3 1VR3A 3WP6A 2DV9A 3VKMA 5HI0A 1M06G 1KS4A 4BYYA 4EN6B 4WVZA 5J48A 3DF0A 4QPGB 1FMD1 3AYAA 2SLIA 2P17A 2XH6A 1C8M2 4XJWA 4YG6A 1VRH2 1D0GA 3PJQA 4YW4A 4AVSA 4H7MA 1VBC2 3VLBB 2ZZQA 2QZ3A 1QXJA 3NV3A 1AJKA 4KGGA 1BEV3 3VBHC 4XFBA 4EV0A 5K7PA 5E88A 4Q1PA 1PIV1 1PGSA 2OZ6A 5JI9A 2O8OA 3Q9OA 3H3UA 1CAVA 1FPN1 2NYYA 1WLCA 3D5OA 2JDZA 2R30A 4F83A 3VV1A 1PNGA 4WBBA 5F6KA 2JG8A 2JG9C 4FAHA 3B7MA 4LO4B 2HEWF 2BQPA 1HQNA 3POSA 5BNNA 4CDWA 2N7GA 2UURA 4RR3C 3H9AA 1AL23 4S2HA 1KJLA 3S7EA 3ZFFB 2AGSA 1OA3A 3B94A 4LBNA 1BMV1 4I02A 1CAWB 4Q4X3 4BZ4A 1LESA 4LEJA 3AK0A 3HT2A 3BALA 4XZPA 1HRI2 4BHPA 4LUKA 3U11A 2R49A 4QPIB 3NL1A 1KJRA 2ZGPA 3WD5A 5C9AC 2LUWA 4R4ZA 4RSUA 4AG4A 1RUF1 3UK9A 2IXKA 2XJVA 2LM3A 1UZZA 2B8MA 3CL1A 1IZ3A 2D5HA 2RR12 1OA4A 4FPOB 4MYEA 4YW2A 3OF1A 1AHSA 3RMXA 1DG6A 1QQP3 3RRDA 3OD4A 4CDUC 1LOFC 4EN8B 3ZMNA 1FPN3 4JGZB 3R4DB 2XJPA 5IK5A 4UXAA 1PVXA 2H6CA 3RG0A 4EN7B 3LSDA 4PLOA 3AZWA 3IIAA 3M2MA 3WP4A 1O5LA 5FMOS 2XWBB 1LGNA 2WWSA 1R091 3DKWA 3CF6E 3JU9A 1GFF2 2FHRA 4XQ4A 2GAUA 2IXHA 4DY3A 5JIUA 2VY0A 2X5IC 4Z2WA 4N53A 4YVSA 1DLLA 4U2AA 2VVFA 4XHXA 1UKRA 2Q8OA 1OI6A 2PHXA 4MV2A 4MZUA 5K0UA 2EAKA 1VBD1 4KWLA 3A4UA 4DQAA 4YSFA 1C5IA 3IWZA 1Y9QA 2HWC2 4AI2A 3GHMA 1RUF3 1PGW1 2MEV2 4WM7B 4D69A 1C1LA 1ND2A 1QOSA 1QXPA 1AYN1 5JOYA 2DTYA 1KS5A 3UV9A 5JWPA 1RMU1 1EV12 3ZYJB 3MW4A 1S0EA 3ZXKA 2GDFA 1O3RA 3K48A 1AX2A 1MS9A 2ZGOA 3N7LA 4I2OA 3PVOA 3POWA 3V0BA 1XNKA 1TMF3 4GMP0 3O7OA 4B7EA 3MLKA 1R1A2 4GULA 1VAVA 4LTAA 4JRLA 3WLUA 1AR82 1MS1A 4FTBA 1Q8OA 1ASJ1 3WQ1A 2WFF1 1BKZA 2VUJA 4LHLA 5HBAA 2WINB 1HKDA 1XE7A 3HMYA 1QJZA 5T52A 2XLAA 2BEOA 2GH8A 3KT1A 1NCQC 3BPZA 4EN9B 2EA7A 5A3MA 2VQAA 4Q27A 4Z8BA 1FV3A 2Q30A 3UKNA 2FQPA 4P9XA 2C1FA 3VBHB 1ZBA2 1HRV3 4OI1A 1ZRFA 1AYN3 4L9BA 4QQ2A 1LGBA 1IQAA 1MVQA 2DWRA 2PLV2 1W6NB 5JOWA 5H9SA 1NOVA 5CAZA 1I6XA 4IEPA 2JG9B 5L7OC 1UIJA 4IV3C 2DCYA 4Q0SA 3OY8B 1PO11 5EV7A 3APBA 3WHUA 1YHFA 1HQLA 4FAGA 3MF9A 4RR3B 4YW3A 4LO5B 3LA3A 1IS4A 1URXA 2JICA 1LOCA 4HPKB 1SDWA 2W0XA 4OHXA 2WFF3 2HEVF 3WP3A 2PHWA 4W6WA 3EXUA 1O4ZA 5FLIA 3AJYA 4QU2A 3ALQA 3AKPA 4RHV1 4KU7A 3HWJA 2ZKLA 5JSPA 1R083 3MIBA 1LEDA 4Y1UA 5C9AB 3MZHA 4S2GA 3WCRA 2WA3A 1MS4A 4WV8A 1MR5A 3U07A 3KGLA 3E5UA 1RINA 4FP2A 3IN9A 5AFEA 1SCRA 1AYM1 3E6CC 1V9U1 1XXNA 1G6NA 2GU9A 3OBTA 2XUMA 2PELA 1H9WA 3AXEA 2QVSB 4CDUB 1K5MA 2WQ4A 1QWRA 3TRSB 3KD4A 1AR63 1QMJA 1XYPA 4HVOA 4ISRA 4COZA 1C5HA 4KQ7A 3H7YA 4ATFA 3R4UA 3SCHA 4HSLA 5LK5A 1ZM1A 2QUOA 2R073 4LE3A 2A6WA 2PN5A 4META 2ZGMA 3OPZA 2E53A 2C9AA 2VOKA 1MS5A 4MH0E 4YVWA 4YZ4A 3THTA 5GZCA 3GBWA 2ZOEB 3WW3A 1H2KA 4RHV3 4K21A 1NCRA 2DFCA 2BGCA 2XBO2 3N7MA 2NMOA 4LLOA 2WC2A 5GZDA 1TNRA 4Q4Y1 4MXWB 4J1XA 1KXGA 4HL0A 1V9U3 4C90A 1COV2 4DRVA 2VNGA 2WT2A 3ZSKA 5H9RA 3C3VA 3H8UA 1YWKA 3PVBB 4G9SB 3ZYGA 4N9HA 3QCWA 1AUYA 3B00A 2WA4A 1WLWA 4I09A 5JLVA 2WZR1 1ZZCA 4GQ7A 2TEPA 2Y0OA 2K0GA 4FPEA 1DDLA 1OA2A 1FXZA 1QJX2 5J96B 1NQJA 1H1AA 1O3TA 2XJRA 1YIFA 3LB9A 1GYKA 4I30A 1UPIA 1CQ9A 1OOPA 3JCIA 3J8F1 3B3QE 4IERA 4AYUA 4GALA 4DRRA 1V6LA 3CJXA 3MPPG 1MQTA 1ULEA 4W6XA 4RL7A 3GYDA 1RB8G 4UW5A 1YFUA 1XE8A 1H4GA 4RD7A 4AQ2A 1QHDA 1GQGA 1X7NA 2IFWA 3JZVA 1WMEA 2E51A 1BCXA 3ILNA 4PDWA 2CAVA 1OFSA 4QM8A 4AEDA 1SFYA 2ZAHA 1BQPA 4GKXA 1WLDA 1G8WA 3B5LB 4YM2A 1LKNA 3GBGA 4BMEA 5KXDA 1CAUB 2D6MA 3I7DA 4Q0QA 1W6QA 1CGPA 1C1FA 3FFQA 4JAAA 5JOXA 5L7OB 2TBVA 1GV9A 4IV3B 1UW8A 2BVBA 1IS3A 2WZR3 4XMAA 2VNOA 4E2SA 1CJPA 3LZZA 3WHTA 4BWOA 1OFNA 2PHDA 4ZKTB 5KC6A 3VBFC 5FFOC 1Z7S1 1RL3A 5D1IA 4YM0A 4BPZA 4MGKE 1V6KA 1Q8QA 1O5UA 4XOGA 1AL22 2Z5WA 2YGMA 5AC92 3AMHA 3MLJA 3AM2A 3VHOA 3M3IA 1RUG1 3JBG1 4PF5A 4Q4X2 1D4M1 2JJ6A 2PAKA 1AF9A 2AUYA 4DZGA 2E63A 2P3KA 3EO6A 4OUSA 2ERFA 3TWIA 2ENRA 4CEWA 4DY5A 1N3PA 4FPGA 3WDUA 4CEYA 5BYNA 3RQ0A 1Y3TA 4OVEA 1PM7A 5EJ3A 5I8SA 3VZOA 5KXEA 2WLQA 2D6KA 2JECA 2WS91 1G9CA 2IXJA 2PHTA 1YYNA 5FLHA 1FMD2 2NLRA 4P9WA 2VNRA 1AXKA 3VZJA 2ZTNA 4N7UA 2PQQA 2EVXA 4GB33 2GNBA 1PIV2 4R9CA 4RQPA 1CONA 1FPN2 1DZRA 3ZVXA 1PGL1 1YFWA 3JD71 1WCDJ 5IK7A 4Z82A 1Z7S3 2E7AA 4M3CE 3ZFEC 1WW7A 3KM5A 4N7IA 4A7KA 3MPBA 4GWNA 4NHMA 1F31A 3MDPA 3VBUA 2HWB3 1BMV2 1NLRA 1RUG3 1GBGA 4E4DX 1D4M3 4M00A 1J58A 2Q1ZB 3ILRA 4KL1A 4RS5A 4P14A 5E1RA 5A3LA 4AVCA 1J3QA 1W6OA 1BYHA 2GSYA 3GBFA 5DG1A 3WDYA 1ZBE1 4AXOA 1JOJA 3FLPA 1B35A 1IKQA 2NMNA 4AGGA 1RUF2 4AVBA 4Q0UA 1NCQA 3BIWE 3EQEA 2DURA 1PK6C 3KSCA 1FV2A 1UZYA 3NKTA 4BA6A 3E6BA 1PMIA 3AP7A 4MXVA 4YG0A 4LO8A 5AFBA 4HSJA 2ZA9A 2DU0A 4L8QA 3POYA 1HQWA 3NW4A 4AEJA 4NPRA 2HWF1 3I4IA 3PMSA 5EZWA 3W59A 1YUDA 2BWCA 3M70A 2R063 3AYEA 2YPJA 3BTAA 1NA1C 5BNPC 3S6PA 2A70A 4HT1T 3KLSA 4EWAA 5FOBB 1R092 1WMDA 1V6NA 3OGGA 4AEMA 2UWBA 4H7LA 1QJU1 2WNVA 3ZSLA 4JGYA 5CFCC 5I8YA 1OHFA 3V0AB 2FBEA 4ZU7A 4G3YC 2DVAA 2FMDA 5DXDA 4FBFA 4D94A 4XTMA 3SLIA 3ILFA 1LTEA 2CGNA 1RUD1 4K9SA 1VBD2 4Y22B 4YFWA 4PBOA 2R041 2VULA 2DVFA 1NG0A 2DF7A 4Q4W1 1ZRDA 2OZJA 1PGW2 2ZMNA 3D8CA 2IZWA 3ZXDA 5JAXA 1X50A 1AYN2 4RGAA 4OULA 2CNAA 1RMU2 2K2SA 2XJQA 4TLFA 3NWKA 2D6PA 2GN7A 3RDIA 3VBFB 4M0HA 4CP0A 4ES9A 3B93A 4IQPA 4FPHA 2ZKNA 4CDQC 1N3QA 4B4PA 4Q0PA 4KH9A 1I5ZA 5FOJB 3H0OA 2FZ2A 2DVGA 2FZ1A 1ASJ2 2WFF2 3WV6A 1F5JA 1XNDA 4CP1A 5E16A 1FOD1 1QJU3 4E2GA 2A6XA 1LU1A 3W9AA 4RA0A 5JMCA 1A8DA 2XG3A 2ZX3A 2AYHA 1Y43B 2EAAA 2HWD3 3NSTA 5E89A 1Q56A 2ZBJA 2R32A 2OW4A 4RGGA 1QJY3 2A3XA 5A32B 2ZHMA 1RHI3 4OUMA 4WM8A 4LBOA 5KHHA 1UX6A 2ZJCA 4XE9A 3USUB 4XIOA 4B4QA 4M3CB 2O1QA 4Y4YA 5BNOC 2HWE3 2XJUA 4IV1C 1GZCA 4QX5A 4Q4V1 3JB8A 5GALA 5JVVA 2XLFA 4HMZA 1S0CA 5EFUA 3ZFEB 2V5YA 4WZCA 3ZYPA 4B8EA 2UY9A 1LOAA 4H3WA 1PO12 2DVBA 1RJ7A 1C57A 3UKVA 2HEYF 3HAGA 3ACLA 1LHOA 2IXLA 1BEV1 3AZZA 3PNAA 2PYTA 4Y1VA 5T5JA 5BY5A 2EXHA 1VBE1 2H0VA 1HXS1 4DB5A 4PIXA 4AVVA 1H9PA 1Q8VA 1C4RA 4RHV2 4LR4A 5LRRA 2VG9A 3D4KA