2WAOA

Structure of a family two carbohydrate esterase from clostridium thermocellum in complex with cellohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
GILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDSITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE E
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2waoA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2waoA02
3PUHA 3I2KA 3I2JA 5BN1A 5C7GA 2RV9A 3VD9A 1K3IA 3WF0A 3FL7A 4DXSA 5B4NA 1PX4A 2WO2A 4ZZ5A 1HN1A 3WEZA 1K7CA 1T2XA 3LQCA 3P6BA 2JDAA 4JGGA 1EUTA 1W9TA 3CIHA 4JJ6A 2B9VA 2QQMA 1I5PA 3VDCA 3WF2A 5B5SA 4JHZA 2J1AA 2XQXA 2DCJA 5G05L 4M8KA 1JU4A 1SHWB 4K7JA 1DEXA 2W92A 1OT5A 3UETA 4H08A 2APJA 1NUKA 1UYYA 2Q0QA 2B4KA 2E31A 3K4DA 4OMDA 3OGVA 2YC4A 5JR2A 2VO5A 3SLRA 4GWJA 4QDRA 4ZXEA 5J1XA 4AAXA 3I2GA 4A44A 1ESDA 4P08A 4Q7QA 2EIEA 4LQRA 3HP4A 4CUAA 2ORZA 5JMOA 2HYXA 2JE8A 1UMIA 2Y6KA 2J1UA 3FHQA 1D7PM 5JD3A 5C71A 3C7EA 1DEOA 1XNAA 1NAEA 2LW8A 3A7QA 3OEAA 3C8XA 2YFZA 3K4AA 2OKXA 2ID4A 4W4ZA 1ESEA 2JKXA 1DLCA 2Y64A 3IIIA 1OF3A 3HN3A 5EIYB 3A22A 1GUIA 1W9SA 4XUQA 4BDVB 4XZUG 2WN2A 4QX2A 3WF4A 3LEGA 4BXSV 2WAAA 5DQ0A 2CDOA 4PF1A 4A3ZA 3IB3A 3T2QA 2RVAA 3DCIA 2HSJA 3HNMA 2VOTA 1O8PA 3E1F1 4MO3M 1KGYA 2VJXA 3BZWA 2W1SA 2VC9A 2QQIA 3HOBA 4MGSA 2VZPA 1GNYA 3T0BA 4RN5A 3I2IA 2WZ8A 1JZ8A 4DEVA 5IJRA 5DMYA 1JZ3A 3NQHA 3LPGA 3CZJA 4QB2A 4ET7A 2Y8KA 3CKHA 5EJ1B 3CZUA 3T2OA 3DC7A 1GQPA 2J1EA 3HJRA 1JZ4A 3CMGA 3DYOA 3CQOA 4CU8A 4XVHA 4CU7A 3W7VA 1OH4A 2XHNA 3GM8A 4DUVA 3T09A 2VZRA 4I8IA 4BJ0A 1W9WA 3I3EA 1K45A 1J83A 1NKGA 2ZEYA 1TVGA 1W99A 3CDZB 3T08A 4RW0A 2BERA 1F4AA 4BK5A 4IYJA 2DCKA 3I2FA 4DEQA 4QPWA 3VD5A 1CX1A 3MUZ1 5HXMA 2DDUA 1XNTA 3WNNA 3A21A 2J1VA 3LPFA 2WO1A 5JUVA 1WCQA 3OGRA 5IFTA 3K75B 4M4RA 2W94A 3P94A 3OEBA 1SDDB 4M4PA 5FUIA 2J1RA 4XUNA 3HEIA 4AG4A 3DYPA 4CUBA 5JXJA 3MV11 1GOGA 4FI9A 2W5FA 3SEEA 2LS6A 3WQBA 4D8MA 1PMHX 2VMCA 3BN6A 2YFUA 1LNSA 4OUEA 1UZ0A 2ZEXA 1W0NA 2BGPA 3THCA 1SG3A 4JHLA 2VZ1A 2QQNA 2ORXA 2E33A 3PUIA 2BZDA 4A42A 3SKJE 3WNMA 3C7HA 1FXWF 3U37A 1XC6A 2YG0A 4L0PA 5DPNA 1L7RA 1W8OA 4A6OA 3J7HA 3MBWA 3OG2A 1UY3A 1CZVA 2R7EB 3WF3A 4JJ4A 2VMEA 4ARYA 1BWPA 3K77A 1JZ5A 5B4XA 3VD4A 4P5YA 4A41A 2YC2A 3C1UA 2KD7A 1ESCA 4TX1A 2BGOA 4PPYA 3A23A 3K46A 3I3BA 4JKLA 1K12A 2WQ8A 2WO3A 2VPTA 2E32A 3LEIA 3K4ZA 1ES9A 3VDBA 1JZ7A 3ABZA 4D0QA 2W87A 4Q9AA 1PMJX 2Y6GA 1K42A 3I3DA 2XOMA 4Z2AA 1PP4A 3IDAA 2QQOA 2VQUA 3HNYM 1JZ6A 5JXIA 1YZFA 2PQSA 1NX9A 2J7MA 3NRUA 3DECA 1RYYA 4OMCA 5A1AA 1IQDC 4K9SA 1GU3A 1UY0A 4HYQA 3ACFA 4ZY9A 2J22A 5LA2A 4QX0A 2QBXA 1US3A 5CZKA 3DT9A 4A4AA 3GDBA 4XUPA 3DT8A 1BHGA 2ZEWA 2VMFA 1EUUA 4HG6B 4DXTA 5IHRA 3T0DA 1R64A 4LPLA 3OBAA 1JZ2A 1JU3A 2W47A 3VDAA 3WNPA 3NJVA 4YPJA 1BWQA 3LEKA 4IUGA 1O8SA 4MADA 4LHSA 1JYVA 2VCAA 3HPNA 3THDA 4OAOA 2W95A 3NJXA 3RJTA 4JKKA 5HOEA 5I0DA 1KEXA 1UY2A 3IAQA 4DXRA 1CIYA 1JI6A 2X10A 1YQ2A 4W50A 3SEPA 3W5NA 2W1WA 2EIDA 4XURA 3IAPA 3P1IA 3WF1A 2VQTA 4QDQA 4MGQA 1UXXX 3ACIA 5C70A 3ECQA 5CD9A 3ACHA 3LE0A 1GOHA 2L9LA 2VZTA 4DUWA 5G04L 4ARXA 3ETPA 4MOAA 1IVNA 1GOFA 1UX7A 3WSOA 1UY4A 4CVUA 3ACGA 3I2HA 4OYUA 1JYWA 2Y6HA 5EJZB 2O14A 4HF7A 4QB1A 3ZM8A 2ZEZA 1ZMBA 1ULOA 3F2ZA 3EYPA 2EICA 1JYXA 2X09A 2VM9A 2VMDA 2WAOA 4QDSA 1J00A 2W91A 2W46A 1BWRA 1OF4A 1U8UA 4JKOA 3HNBM 4CU9A 1PX3A 3VD7A 4QAWA 2J1SA 3EB7A 4GZ9A 2V4VA 3W5MA 2QQJA 5HPOA 4K3UA 1XPWA 1US2A 4BK4A 1VJGA 4P02B 1UWWA 2W1UA 5A4AA 2CDPA 1CZTA 2VR4A 1DYOA 4TTGA 2C9KA 2Q0SA 3UNPA 3T2PA 2W1QA 3WNKA 1FXWA 3T0AA 5LA1A 3KVNA 1J84A 2E26A 4TXWA 5CYYA 4ZZ8A 4XUTA 2VZQA 4CU6A 1VYHA 3AC0A 3NNGA 4GWIA 4JX0A 3MO4A 2WDBA 1JRLA 4CUCA 2VCBA 2W3JA 5JXHA 4UI9L 3MV01 1Z8HA 2QQLA 5DN2A 1DP0A 3MILA 3PT5A 1UYZA 4PQQA 3FHAA 1O59A 2ZXQA 3OGSA 1GMMA 2VL4A 1TG7A 1WKYA 2WABA 4DUXA 1P8JA 2VZOA 2VZ3A 2RJ2A 2VZSA 2W9XA 1UXZA 1H6YA 4P00B 3C7GA 2Y6JA 3GXUA 2WN3A 2Y6LA 4LKSA 1CZSA 3GGLA 3VD3A 1WABA 2VZUA 5IYYA 3WNLA 2WZEA 1JYNA 5JXGA 2WUHA 4QX3A 4UAPA 1OD3A 3C7OA 3I97A 3DT6A 2EIBA 1W8NA 3WNOA 2WBKA 3BGAA 4KI5M 2HLEA 3FN9A 3SKVA 2X05A 1UYXA 2VCCA 3JXSA 4QB6A 3MUY1 3OB8A 4JKMA 4OZOA 4QX1A 5IFPA 1UY1A 5LCWL 4KWUA 5F7UA 4S1PA 4K40A 1L7QA 3DYMA 1F4HA 2QQKA 2C4XA 1UMHA 2JD9A 2V72A 2BBAA 1H6XA 2YB7A 4W8JA 1JHJA 3D3AA 2XONA 1V2GA 3C7FA 4KMQA 4XUOA 2C26A 2V5DA 2Z4FA 1MPXA 2J1TA 4E8DA 4PT6A 5LA0A 4UOJA 4RYDA 3UESA 4A45A 4OAPA 4RSHA 2VZVA 4E8CA 1ULPA 2WYSA 4NRDA 2VTFA
chains in the Genus database with same CATH superfamily
1Y1RA 1WCIB 4ENSA 3KLSA 1W7AA 2QVLA 1EM6A 5JYEA 2OLEA 1RPAA 1WCDJ 3WVJA 1K7CA 3GFBA 1Y89A 1PR2A 4HWRA 1Z7S3 4QU9A 4DSNA 1N2ZA 5IXJA 4FBGA 5EPUA 3FCAA 3LS2A 3WP1B 3QKIA 1Y9JA 1QG2A 5KQRA 4I4CA 4D4IA 3OWXA 4LYHA 1X92A 3L77A 1VFNA 3JQCA 4QU8A 4RQPC 2R4TA 4KO3S 1G0NA 4AVVA 4MVXA 3I5XA 2OD7A 1XYPA 2RIRA 2YDYA 3PFHA 1N1EA 4K28A 2IYQA 3E1F1 2HA6A 1I4OA 4JJKA 4X3PA 4WVMA 4OQZA 3FNFA 1IG0A 4C4RA 3RI3A 3AKZA 1VDZA 4UZSA 1OUXA 1KDYA 5CX4A 1UAGA 4D74A 4LTMA 4HLCA 4UUBA 3AO0B 4W99A 3K20A 2YZMA 5H9VA 3AJEA 4Q4Y1 1IJFA 3ZW9A 4Q4W3 3POFA 1RLUA 3GJTA 1WUHS 5KOIA 3H75A 4PDWB 1TU4A 3JYPA 2XT0A 5KVCA 4R6XA 3U7QA 2CSUA 3LU1A 4DEQA 2P8JA 3RIXA 4MAAA 4F83A 3REFA 3FVVA 3KR0A 1T5BA 2AEEA 1JTFA 1PUXA 4B2PA 3POWA 4FGLA 1U1FA 4FOLA 4QQLA 3JXEA 1CEXA 3MMNA 3Q88A 4Z49A 1MJFA 2DFCA 2YWBA 2ZGQA 2QTZA 2V9PA 2CUTA 3I04A 2F4NA 3T3OA 2YIMA 5JI2E 2PIDA 2C9OA 2PPVA 2QZ2A 1CPNA 4LR4A 4DLYA 1JIJA 1ZREA 2W2MA 2C9YA 4EHDA 2QYSA 8ABPA 5EE1A 4CT0A 2ATVA 3T7EA 4HEA6 4CPDA 1SXGA 5BOSA 3AMPA 1N9ZA 5EMNA 4BZZA 5ITSA 1YHZA 4JP5A 3I58A 3B9PA 2AS0A 3H13A 1YQUA 1TI7A 2QRQA 3BB1A 4IV0A 3FR7A 1PO22 5A1AA 3OFND 1PEYA 2C2KA 5C3SA 4MUVA 4JV5B 1UK9A 1C9DB 5C5TA 2NAPA 4K1ZA 4L4SA 1F35A 4B4VA 4MR8B 5ELLA 1W2WB 3G7NA 3H6GA 3BFJA 3ZEIA 1ND2C 2A92A 4PHHA 3WYAA 1QOSA 3VBOA 3BYZA 4WADA 1F0NA 2J9YB 1OOPB 2X8WA 3IKJA 4QBHA 4AL9A 1N57A 2R68A 1B16A 5U4QA 4LJ9A 5FYCA 4BUCA 2VPIA 3MVEA 3MGBA 5EIXA 4C08A 2L9LA 3V4VB 2VTDA 3SE7A 3UYKA 5JMCA 3RS9A 3QWIA 3FPSA 2B21A 4EB6A 3WNCA 1SD5A 1EFTA 1JZSA 1LQTA 2WIIB 4YPOA 2QHXA 3W90A 5HS4A 4AJPA 2YYAA 2PVPA 3ZPYA 3CFYA 3C7TA 1YCFA 3L8MA 1QIKA 3BODA 5CW1A 3TMKA 3T06B 4RADA 2C3MA 3OJLA 2X8JB 2E26A 5KC9A 4DXDA 2GWRA 4BCBA 1AN9A 3HYSA 1SOAA 1J8DA 3ASIA 2H2FA 5ALQA 1M2JA 3IBSA 3IKVA 3DF0A 3B82A 2XWPA 3DQZA 1JMVA 2BR3A 1KK0A 2VZOA 3HPRA 5SYAA 1SXJC 3OOSA 3H5VA 3RWKX 3U10A 4GC9A 4QXRA 5NULA 1MPTA 2IHJA 2WMOB 3G59A 3GHHA 3PDQA 2JAHA 1S0FA 2FFHA 4R40A 4DNQA 1Z73A 4LMPA 5ANRB 4P54A 2QK4A 1Q7GA 1II0A 4BCCA 5FDBA 4X6QB 4MS3A 1F1JA 1K8XB 1L1RA 3FVWA 2P4EA 3AZOA 2XCTB 2JDUA 4GSYA 1Z75A 4E31A 1O95D 3CGGA 4AQTA 3R0XA 1MAHA 4JIMA 3VPXA 1E79D 3EZXA 2HBZA 4JENA 2BFCA 2YCBA 5FR3A 3POBA 1YJQA 4G9GA 1RAGA 3FRIA 1NT4A 2WFAA 5CVVA 3K4HA 5K0FA 4MTCA 2OUIA 4MLCA 2QZ3A 4CMIB 1W28A 1MF7A 2GZDA 2IXAA 2NZYA 1R6BX 1P6QA 2TRSB 1JXNA 4EA6A 2G1PA 3D2CA 1DQRA 2WKRA 1IS4A 2P6MA 2JGKA 2J85A 3KTFA 3QLVA 4XBNA 4EKYA 3I37X 1LC0A 5FJJA 2WYUA 3OZUA 4TV8F 4ZT7A 3V2HA 4EHHA 4UT5A 3A8TA 1XSEA 3G7UA 1QJX3 3QH6A 1EHIA 1SZPA 4UEKA 1OF3A 4X1YA 1W9SA 4UPVA 5HV4A 1ZMXA 1V4VA 3AF6A 4MUMA 5H9WA 1ZVMA 3NWPA 2GXQA 3WWYA 4DVJA 2YHJA 5ESRA 1CP2A 3T9EA 1JWLA 3M6UA 3NTXA 3AMHA 4PC6A 2D5BA 2IFRA 1X80A 1JZ8A 1F8UA 3FM9A 5K09A 4YZ1A 4LQLA 5KQPA 3E8SA 2O19A 1LFDB 1XMSA 1Y48E 4ZXFA 4KQ6A 4BV9A 4JTOA 4CDWB 9GPBA 4V1PA 1E66A 1ZVJA 4B2LA 4MA5A 1U2PA 4UE6A 5TVKA 5EPEA 4FFPA 1H9WA 1W9HA 1DBNA 3NNSA 4RR3A 2E85A 1E4EA 2V9ZA 2XJRA 4IH4A 1Y4AE 2WZBA 1JVBA 4POAA 3CYFA 3AY6A 4JC1A 4YJ2A 2QSYA 1UXGA 4C4OA 5DYTA 3NKLA 5JYBA 4LISA 2VZ1A 1LV7A 2R6CA 5BN4A 3G0DA 5DP2A 4YR7A 3LE8A 3S2FA 4QODA 5HDQA 1CLUA 1Y63A 3RJ2X 1YL5A 1R0CA 3D3EA 3RSHA 3NDBB 5BMOA 2DUPA 1IWPB 2IXIA 4BXFA 4CM3A 1J21A 2R9VA 3TGWA 4D3DA 3E9NA 4ITUA 2VXYA 1QHSA 4H7PA 3W5CA 3PXCX 4XJXA 3GV0A 2VZLA 4PG4A 3R3UA 3RU3A 1FNDA 2QJTA 4AZ0B 4CM4A 1LKNA 4HQOA 1TC2A 2FPGA 3QIVA 1LW7A 1V39A 4NZPA 1MACA 2WU4A 3MWJA 4FLEA 3KB6A 5FL7D 2K2SA 5FQOA 5K3FB 5I7OA 5CB7A 4MQFB 4XYEA 2OFFA 5EWLB 4U7WA 1PJ2A 2YROA 3V8RA 3D0RA 4IFEA 1G7YA 4XVQA 3G2KA 2P40A 1JG6A 1F5SA 3WR0A 5LZ9A 3T15A 1DUIA 4W9MC 4X71A 1UDWA 4I50B 3WP4A 1UU6A 4RCYA 3THYB 1XLTA 1DPFA 4GG1A 1FOD1 1H4VB 3ZXAC 3CLRD 2Q9UA 4PO1A 1EPUA 3DV9A 4AUMA 4YHBA 1USIA 3WGIA 1P7WA 3ESBA 3SOPA 2JFYA 2W91A 1KZ1A 4CEIB 4FKBA 5SY9A 2ODPA 4BK4A 1UOJA 3BE5A 2A5LA 3JVIA 1CQJB 1IQAA 1NZDA 2YN0A 1SUCA 5LR6A 4TTRA 1O0BA 5CNJA 2DFNA 3BMOB 4Y1RA 3N35A 2GPJA 5DXFA 4NN0A 4QUBA 2IUUA 4FOYA 3MILA 1AGNA 3KHKA 1F2NA 1HQNA 3LW8A 1T8RA 3QFCA 3TZEA 1G9AA 3VC3A 1STOA 4RPKA 3KVVA 4O63O 4QUGA 1X82A 1SFRA 4KC0A 3UKJA 1P33A 3CR8A 4CEJA 3II6X 3L9JT 4Q05A 2FPGB 1PIV1 4JEUA 7REQA 1HDZA 3LOQA 4YGCA 3MJHA 3P4YA 2AZTA 2BHTA 2CBXA 1U0AA 6PFKA 1U2DC 2ZRLA 3HMYA 1EXDA 3G2JA 4J4HA 3HUUA 2XCIA 2WYFA 4X61A 1E9AA 1G7TA 3EEIA 4EFKA 4EQVA 3PQFA 4ZZ2A 4FFWA 1LKZA 2GKSA 2HIAA 4PDWA 1NP7A 2RB5A 2HJSA 3R3SA 2E5FA 2QA5A 3D8RA 1MQ9A 3G8CA 2OHHA 4ND8A 1QK5A 1CY1A 3OH8A 4JQCA 4MDFA 2N42A 3ADPA 3IXMA 3BIJA 4R4XA 5FHQA 4P98A 5B57C 3SHFA 3HB9A 2IYAA 2L0XA 3LUGA 3WYCA 3TH5A 4B5KA 1M1YE 4HGNA 2P4QA 1KEPA 4RA9B 4F04A 1UOQA 5A4KA 5AESA 1PK6B 3OMXA 5KEIA 3KQHA 1I2AA 2H2WA 3HKBB 1YDGA 4R9CA 5CDYA 4A7ZA 2ZE5A 4H6WA 4PF1A 3AVRA 4Y20A 3EXG1 1NUSA 1DBIA 1X19A 2Q27A 4DR2B 4P80A 2GZRA 1Q22A 2KJQA 3NNMA 4RZ2A 2BOJA 2Q5EA 1GVHA 2OM6A 4I6EA 1W6OA 4DT1A 4DCTA 3EGEA 4ARSA 1S2LA 3A0NA 4C3VA 5HCIA 2A0WA 3HYRA 2PAMA 4OJKA 5COBA 1DEHA 3BWXA 2IXEA 3QXXA 4FQZA 1U2GC 1UBGA 1B93A 2IPAB 3D3JA 3TS1A 1IMJA 3ZFGC 4HKWA 3C6YA 4CODB 1NRXA 3FFXA 3VSBA 2QN1A 2DEUA 4DYVA 2BFFB 4DKXA 5DI9A 5SICE 3EPJA 1R0RE 4LYEA 4EWDA 4AMGA 2ZEXA 1BE1A 5CM8B 3TRKA 1UPUA 2AG6A 3TPCA 3M6FA 3WNMA 4AE2A 2BJSA 4MNTA 4RA9A 5FP4A 3LQKA 3PUVA 1RQNA 1L7RA 4YAUA 3JQGA 5FTLA 2C1FA 4KGQA 3POYA 1JDTA 1ZCAA 3UWKA 3BF8A 3KUUA 1SACA 4CMEC 2UZ4A 3TOXA 2X41A 5FNVB 1SU4A 1GUDA 3THXB 4U2CA 4GT1A 3VAYA 3ZDXB 1NA1C 5ILOA 4BYYA 3H9JA 2VPTA 1BDJA 1Z17A 4WL0A 1PK6C 1Z0ZA 4P3OA 5L7YA 4AYTA 1U8YA 1CUJA 3FX2A 4N53A 4BM8A 3I7DA 3AUFA 4YRGA 2AUYA 4ZT6A 2FZGA 1OOEA 3H8OA 4JSYA 1US3A 4Q24A 1AF9A 1VKRA 1XWIA 5JZGA 1XEWY 2G5GX 1HOTA 3GDWA 2RG7A 4ENUA 3QP9A 2IUYA 5JD6A 3ZCTA 3JVVA 1QYXA 2G3YA 3VTFA 4YMTA 1JX6A 4LV5B 1H2KA 3NJXA 3MERA 2QT9A 4TQ9A 4M8LA 1IIBA 3ZN2A 3MQ2A 2W2VA 1CIYA 3GFSA 1XYVA 3W9BA 2GI4A 1NCQB 3B9QA 5ED0A 5LIPA 1XXHA 1NJ1A 1GAEO 2HQBA 3K4QA 3FFAA 3DM5A 3ETPA 4M55A 1OPOA 3UICA 2JATA 3OUTA 1MTOA 3MUFA 4KHZA 2RI1A 3REQA 2XR4A 4NY1A 1QF3A 4QDSA 3COSA 4PNPA 4L9WA 3RNLA 3ME2A 2QPLA 2VJOA 1VMFA 1YB7A 4CUJA 4TLEA 3KLMX 3TEXA 3U4XA 2HHCA 4DQVA 2OAQ1 1XQVA 3JQPA 2W3JA 1UMKA 3PFGA 4Y1ZA 2R8OA 4XCVA 2DWUA 5FWAA 3H83A 4WH0A 1CS0A 1O4YA 2DUMA 3FJYA 5E3IA 2OO3A 2OBNA 5CEJA 3IJEB 5CAEB 4CQMD 1Q3HA 2PBLA 1MV5A 1G8SA 2QDNA 2PKWA 4W9NA 1W85A 1ORIA 2YN2A 4JVOA 4DJDC 2JH3A 2BGTA 4WEOA 5SZJA 2XKPA 3LKBA 5LQDA 3OT1B 5DUVA 1AR81 1VE0A 1E7SA 4GB33 4MGEA 3L07A 4BLWA 1TEVA 2I2BA 3NTOA 2ZACA 5U4XA 1EAYA 4LBQB 1T4MA 1JQKA 2ZAMA 1ULPA 5F5IA 1LI7A 4D9BA 4OQYA 1NR5A 3LZDA 2ODEA 3UAGA 4RWZA 4G63A 2DR0A 4EY3A 3OETA 3UJOA 5JV5A 1VL0A 4LE2A 1VCHA 2F9FA 5DBGA 4U2GA 4ZS2A 2Q2VA 1C5KA 4CMCA 1ECPA 5A7OA 4XYBA 2ZBJA 1E5DA 2AOTA 4BS9A 3I9MA 2HF2A 1MFPA 3RO7A 4H1TA 3LT1A 2QN2A 1DG6A 5AM1A 1NE6A 2CWMA 4XQCA 3AX4A 1QJU2 3I2OA 2PT6A 2G36A 2CNAA 1A4IA 2NU6A 4ESOA 4C05A 2Q4RA 2PRIA 2XTNA 2VDWA 1E2IA 4IGKA 2WJAA 2VJMA 3TKAA 1KYZA 3QW2A 2HKXA 4D3SA 4AVYA 4D3WA 3UAOA 2V7PA 4I4TA 1Q15A 3EK2A 2EVXA 4G0VA 1QTQA 4ZV4A 2X76A 1YL7A 5LP6F 4IGAA 4W65A 3MLBA 4G1UC 1HDYA 4QHSA 2WUDA 3RMXA 2L2QA 3RYFB 1LGBA 4I1YA 1P2BA 2PQMA 2WHPA 1HC7A 1JMUB 3WK5A 3I9NA 2RR11 5CNAA 4N39A 3IOYA 2YYYA 5AVPA 3OD5A 3VDDC 1QC5B 1KAEA 2VHVA 4YCMA 3SJAA 2WWVD 3RI9A 2JEMA 1Y8RA 4C4ZA 3W5HA 1CK4A 1F9AA 3D3WA 2XB2A 4H15A 3L7MA 1X7XB 2QN3A 4H4CA 1J3QA 4NMIA 1LZLA 1N5JA 5CIQA 4D69A 1QH6A 1DC8A 2Q5QA 4YYOA 3M4ZA 4AFDA 3PK0A 3M5CA 4JP8A 1CAUA 2JDPA 5AMXA 4XJUA 1AKTA 3G7SA 2VTXJ 3WGLA 2P2GA 2GC1A 2Z5GA 4FN4A 2DGDA 4A42A 1CESA 3ND5A 1EZ1A 3W5UA 4O1HA 1RUI3 4CL2A 1VLLA 3ZU3A 4CFSA 1A9XA 1ZRIA 1EG7A 3PI7A 4FE7A 2N7GA 1X2EA 3WLMA 1FVFA 2ACVA 1EXNA 4UF0A 1KJNA 2WIFA 2ARAA 2IXBA 4E11A 3E5RA 3GHNA 4D4JA 1H2MA 1W6QA 1YU9A 2YGMA 2ZMNA 5CEEA 3PA8A 1K3UB 3OY8A 1K42A 2XOMA 1V26A 3I09A 4QXPA 2MYPA 2JLRA 2VDPB 1PR6A 1JHPA 1N36B 2CWWA 4K6OA 1RIRA 2CXQA 2AEFA 5KYWA 4QWWA 1B35A 4IUCS 3PUXA 1I0IA 5T4FA 3HY3A 4QYIB 4GYJA 4GNRA 3BK2A 1PYDA 3UM9A 3AL6A 4BYMA 5DM4A 3H5RA 4IE6A 2JICA 2WIBA 3TRFA 1OA0A 3ERCA 4J75A 1M5RA 3L7KA 1XTIA 1M0EA 3P4XA 2P41A 3MT9A 2B78A 2AFHB 2IITA 1VMEA 1Y3HA 2Q6TA 3GMIA 4X24A 1II8A 1QANA 2L17A 3T7JA 4U3JA 1VRH1 5L3SA 2I76A 3Q6NA 1OI6A 1LOAA 2O5CA 2EFDB 3EB7A 1NUTA 4K3UA 3ZD6A 3ZGYA 5LIRA 1US2A 1CUDA 4P02B 4K2HA 1MEC2 4GPTA 3GJSA 1K5DA 5LZ4A 3K71B 5DK4A 3EXEA 3HDHA 3E5UA 5B1SA 5CFOA 3QZUA 4BKQA 3NG1A 4AJKA 2BCJQ 1JG7A 2EKPA 1F31A 4I5GA 2XEDA 4G23A 3COVA 2WYVA 1ZUIA 4ZEMA 2CCGA 4WLVA 3I92A 3DEZA 4C88A 2Q46A 3IEVA 4B40A 1T5LA 1M6NA 4TWBA 4Z8XA 3VSDA 5CG1A 1OD3A 4YAEA 3AVPA 3HZZA 5EYXA 1U3TA 1GP2A 2XHEA 2AXEA 4UVEA 3OB8A 4QX1A 5FK8A 5FREA 2XNKA 1R9JA 3L2OB 4HSLA 2QTNA 2RCNA 6Q21A 5EZYA 4INJA 3TRJA 2C26A 4MB2A 5JFOA 2IXLA 5HF9A 4ZTUB 1XMXA 5JCJA 1M1YA 3JTEA 5U9CA 3A70A 3G9QA 1KI4A 4PQRA 3UTDA 3ZYHA 2MTBA 5T4HA 3UXMA 2ADDA 2F8SA 2WFPA 4V3BA 2O48X 1FI2A 3T34A 1AQNA 4YLYA 2BZ1A 1I2CA 3J7MA 3LH5A 1AS2A 2J1LA 2QTRA 2A84A 2JG9B 3OLYA 2PHWA 2PL5A 4Q3NA 5FFOC 4D6QA 1ZM1A 4GLLA 3SHQA 2VNOA 3QE3A 3IULA 3TLGA 5CK4A 1ANKA 4MVJI 2P4HX 1XEWX 1TM3E 3IMGA 3W6PA 5BN5A 3QVTA 2JKVA 2KMLA 2WM3A 4DDUA 3ACBA 2G08A 4JEHA 4B8YA 1T3GA 3ORSA 2IPMA 2G9NA 2A0YA 1U9IC 4D1YA 5KTSA 2WJIA 3IVCA 5JPCA 3UL2A 3WYEA 1EFPA 1TMF2 1SEVA 4XZUG 3I6BA 1NW6A 3DCIA 3IPYA 4R83A 1CNFA 2A3XA 3LBFA 1L7AA 3UHJA 3KSCA 3FZQA 1QP4A 2FZLA 5FUXA 1NG9A 3WYNA 3RFUA 4O4JA 5IG2A 3LPGA 3OSZA 4E5NA 4OJMX 3LVFO 3UOWA 5J37A 3ST7A 4CCKA 3ZDAA 2W4QA 3T41A 1L4NA 5DUWA 1OFGA 3RJRA 1ZVKA 1N2EA 3CTMA 4P32A 2ZUVA 1K5JA 4KWIA 4MKXA 2FCVA 2TBVA 1CUYA 2C59A 3JQ9A 3OFSA 4QUAA 4QD3A 3QH4A 1E0KA 1NE7A 2AXQA 5I7FA 4L72A 1CY4A 3MPPG 3E35A 3B2EA 1B1CA 3L2HA 3S44A 2PX4A 1CE8B 3HAGA 4JT4A 4C03A 5B7GA 3A21A 1O6GA 4NR1A 5FYMA 2FEKA 1NVVQ 3C3YA 1KVUA 3U40A 2X77A 1J0XO 1REQB 4V0NA 1RFLA 1LB2A 4HB2A 2G4IA 5EINA 4D8MA 3QKWA 1LNSA 3NM6B 3BSFA 3UV7A 5EJ4A 4RR3B 2QP9X 2F1HA 3GLIE 5K9ZA 1RQ7A 3HA5A 2CMGA 3WL4A 2CWDA 3OGGA 4ESEA 2ZBGA 3IELA 1QRAA 4N9HA 1IPFA 4MCJA 3QLVC 2DHCA 1BXZA 9ABPA 4HJRA 2PVCA 3ZYBA 4IQ8A 4K88A 2EOAA 3LRXA 2MMCA 2IBTA 2NMOA 1IXKA 2FOIA 1VQ1A 3MLKA 2VBBA 5BNNA 3VKWA 1U5XA 2GEDA 4NPAA 2DM6A 1GU3A 4BASA 3K48A 2NV0A 1ZRSA 4DUZB 1G4HA 1NDUA 1HB1A 2YBEA 1V43A 3WYBA 3LUPA 2FEOA 3IV6A 2CYBA 2W47A 2D6OX 1DHKB 4Q9HA 3LYUA 4LJ7A 2WF6A 4EYEA 2BEUA 3WKAA 2XJ9A 4AIIA 2AW5A 4OAOA 4JKKA 2JFZA 4MUXA 3E9YA 3WC4A 2JVJA 1W2HA 3G1WA 5ICEA 1Y7PA 2AEZA 3CLPA 1U7OA 5LPNA 2O4CA 2HSDA 5EWLA 2PUFA 3I42A 3WZLA 5DLQC 1R50A 5EIBC 2GYWA 2Q3HA 4MOAA 3REQB 3I76A 2BGUA 4DQXA 2PLAA 1PZGA 1U90A 4HETA 4KAXA 3V4ZA 4CLHA 1HV8A 1YRYE 3M83A 1L5LA 3ZS9A 3VZKA 5EJ5A 4CCAA 4HSGA 3EVTA 1BCSB 4JC0A 2GA8A 3JATA 4ZGBA 2VAXA 1RIIA 3FDIA 3VKNA 4YJHB 2IH4A 3DDUA 4MRVA 4XE9A 3EUWA 4UHJA 4XIFA 1E3SA 3UIEA 5BRJA 1NMSA 3PD1A 4D9EA 2NZWA 5JSPA 4ZPIA 1P1IA 2X9NA 3C5WP 1M10A 4LO4B 4LQ4A 3GZEA 1PS9A 4XQDA 1LZKA 1XCGB 2HWD2 1PFYA 4B73A 1L3JA 3EIUA 3RJZA 5KHGA 1UT8A 2G1MA 1CVRA 3POEA 1BH6A 1QQP2 3G13A 3EGWA 4A2PA 3H2BA 4F4JA 2IW1A 1N6IA 3QELB 2R2GA 1YA6A 4QB6A 2VR1A 1UY1A 3L0YA 1NUPA 5DB4A 2G17A 4ED9A 4BMYA 2RHGB 4DR3B 1THTA 3IDSA 1SOVA 1SO8A 5CH3A 2D7DA 3IBCA 5C1IA 3KJFA 1IN7A 4BNVA 3AVXA 1HRI1 1BK0A 3F9CA 1ZW6A 2JG8A 1OBHA 4HVAA 5AVYA 5FPHA 4BB9A 3QBJA 2GCPA 4TSKA 1U8CB 1E5TA 3GFFA 5EZSA 1TKAA 1CDEA 2WFLA 2Y9PB 2CHFA 2XYQA 2GHTA 3JPYA 4Y7DA 5DF1A 3G5AA 1J8MF 2RKBA 1QUFA 3A9TA 2XUJA 4MCAA 4EHJA 3BMCA 1WEKA 1NYRA 1P1JA 4RGVA 3ZPXA 2MEV2 4GYWA 2OCDA 1QVRA 3ZK8A 3PP8A 4QDRA 1A50B 1EFVB 2LD4A 5MFZA 2F1OA 5ALRA 1K7EB 3T9AA 3DNPA 2Z6UA 3LDRA 1BRTA 3L7NA 4ITVA 1C8KA 5D8AB 2KX7A 4U7GA 2Z83A 4RPLA 3RUCA 4Y0AA 2QAGB 1GPBA 3WQ7A 4FPLA 4HVLA 4XASA 3MD0A 1GQGA 4RR3C 4X8OA 1FX5A 1KDTA 3HFJA 3OBZA 4MGSA 3VMFA 5A9RA 2V3CC 4YP0A 4HYTA 3S0JA 2BBVA 1KP9A 5KPJA 5JJCA 4BATA 2A78A 4GP7A 4AY5A 3EPRA 4UCFA 4OXYA 4A10A 4ENRA 2R6HA 4OMUA 1CY0A 3EOAI 1KZ4A 4ARCA 3L0ZA 2A8YA 1AQIA 3ESYA 3LOBA 1V9LA 1YGPA 4RTJA 2G4LA 4QYIA 4BRUA 1DTSA 3U6BA 5CM9C 1W6MB 2WSBA 3S7TA 1IUPA 2FDXA 4LE3A 1YF3A 3KZ1E 2WA3A 3Q7QA 5COQA 3VKFC 2IVIB 5IT6A 3RVNA 2BFAA 2CFIA 5D5HA 1W90A 1RB8G 2H2HA 3WWCA 2HBYA 4JYMA 1EAH3 4HPKB 1Z18A 3ED1A 2HWYA 4AS3A 2WICA 1P73A 4I9GA 2IA5A 1A8UA 1W6QB 1S2MA 2Q21A 1EUQA 1C4XA 4P9WA 2FRDC 3S55A 4L74A 3ND8A 2NUPB 1AUQA 3MINA 2ZUFA 1ZC3A 4D82A 1RUH3 3O92A 1OILA 3TAUA 2EXXA 3KJZA 2ZVPX 2F8MA 2CNWD 5IMSA 1OF1A 1OR8A 4P3KA 1EUCA 4HAZA 2CL2A 2FWNA 3DH0A 2GXSA 1TZMA 1VECA 1YOVB 5JJKA 1NVUQ 1NFQA 1T6YA 2ARCA 2FG7C 5KVVA 4G86A 4BAGA 1KS4A 2HJWA 2HA4A 5DN6A 5ANQA 2HEGA 1QMPA 1PG5A 1ZC4A 4DWVA 1RC0A 4G0UA 1XQYA 2RH5A 1R4AA 3KU1A 1T13A 5ADUS 1ZOSA 1LAJA 4EZEA 1EK1A 2ATIA 4Q1EA 3QPWA 2PXXA 3CW8X 4XGNA 1T3ZA 3O84A 3ZIAA 4RCVA 2ZSUA 4DCCA 3T7RA 3N7KA 4V0SA 3E4DA 2R87A 1QYIA 1H42A 5ALUA 1T36B 3B3QA 2ZTLA 4C0JA 2VPVA 1JQJC 5JI7A 2Q9AA 5F2OA 1UMCA 5J4KA 4WOJA 3Q85A 5FPUA 4YP7A 5B4VA 2FUCA 5BMVA 3H3XA 2AVDA 1T6GC 2D0IA 3DXFA 4QHZA 1ZM2A 1VMJA 3QEBZ 1M67A 2CXUA 1HKDA 5JSYA 1Z7S1 4BX0A 2QQUA 1GQQA 3NHRA 3FWEA 2AHOA 2FMYA 4QUIA 1S2DA 4WWHA 4HWPA 5H9QA 1A4UA 4EDFA 2RS11 3KEFA 3CRQA 3WTBA 1YHNA 4R4JA 2W2LD 3IAFA 1PFQA 4II3A 2OG1A 1DRWA 4JUDX 3WK9A 3T99A 1I4DD 2YWFA 4Z9AA 5FZGA 1VB5A 5FIXA 3ZFFB 5JH7B 2WT0A 4KMMA 4AZ0A 4BO5A 4EHLA 3H3UA 5BORA 1QVAA 4M9UA 4RHFA 3NOOA 3NPMA 2XGOA 3WIDA 1XTJA 2WWIA 1VBE1 2IX9A 5HTOA 2PUCA 3JQXA 2R0HA 3ICVA 4O4LF 1CUVA 4MP6A 3VYVA 4RMGA 2CLKB 2HXYA 3RIHA 3AOGA 1WCSA 1DDIA 5LD2B 3EDMA 1Q0TA 3LXUX 4AULA 3DKWA 4M99A 2A3YA 4JNKA 5FYIA 5C9AC 1HM5A 4JGGA 1VBD3 2UY9A 4E2ZA 2DLDA 2ZAHA 3HSSA 2DUUA 4QLOA 2X29A 3Q7EA 1VDMA 4B3FX 4J90A 1E59A 2B46X 3N4MA 1VBA2 2CGOA 4IEQA 2VO5A 3ONDA 4JJFA 4CEYB 1ESDA 3BWDD 1YI8A 1ORRA 3LSTA 5JXWA 4NULA 3RADC 4RSGA 3N8HA 1Z4MA 3GJ0A 4EKEA 2Y1XA 1G6NA 2ZGPA 1P0QA 3M1AA 3NAPC 2HTFA 2XBMA 5JZVA 1S3GA 4MVJG 4C5BA 2MINB 5FOJB 2YW9A 2PWAA 2HK9A 1YWGO 2F8TA 4EY6A 1ZIOA 1W1WA 2YHUA 3DKPA 2G0TA 3MWDA 3EWIA 1LQUA 2CLLB 2GRAA 3AKRA 4DEVA 1DJQA 5FEUA 1YJAA 2IGBA 3FROA 5L73A 3U3MA 3EIQA 4K81B 1G9CA 1ZU4A 5LWBA 3HQUA 4QSHA 4IX9A 2VATA 3W7VA 2C2MA 1AT1A 3EN0A 1FUEA 3K0BA 3JZVA 2Z5VA 4AD8A 4Q9DA 5DDJ3 2GESA 1JR3D 1ZHFA 1W99A 3DL4A 3GF6A 1QXPA 5KYUA 3GUUA 2DCKA 3OX2A 1OGJA 3K5PA 3E2PA 2SKCA 2WT9A 1FY2A 2AWNA 1L4FA 2PQ0A 5GVRA 4XC9A 1Y1LA 5HP4A 3T38A 4IGQA 2WPDA 4M1QA 3TBKA 1TECE 3SFTA 5F76A 1Z78A 2BMVA 5B53A 5IZ4A 2Q8OA 5LD2C 5DUUA 2FQWA 3W7AA 5JSFA 5CHEA 5L4NA 3MIFA 2BGPA 5JBQA 4JHLA 4C1WA 4OATA 4KQCA 2CK3D 1YMQA 1QUEA 4KQIA 1LPOA 2M1ZA 2XF8A 1JEDA 2FSHA 4F92B 1W6RA 4BQ2A 3IGFA 4KU4A 2IXHA 3KQNA 3VUFA 1RABA 2FPSA 1KGSA 4AFCA 1D4VB 2H48A 3FYDA 4GJZA 2W00A 3T52A 3EZ6A 1PMJX 2PKQP 2EFJA 3FDZB 5IUQA 5DX1A 2RK6A 3QKSA 4R84A 1AGPA 3RB8A 3UH0A 1T8TA 3UJ3X 4TMVA 1ENRA 2I6FA 2B83A 3JZAA 1J24A 3NVMB 2JFGA 1XF1A 3U5TA 3I6QA 4BL5A 5IXSA 3ZWAA 1XP5A 5C33A 2R5WA 2HSWA 5CIWA 4TMFA 4DQ0A 3G82C 1YCDA 2BMWA 5LQMA 1VBKA 2XADA 3A6ZA 4LHYA 1Y7TA 5ABJA 1RVF1 2RJOA 4PYQA 4IMRA 1RYBA 1Y4WA 2JLAA 3IPAA 4MWSA 2Z95A 4K3VA 4Y1RB 3B9RA 5IT5A 3WLTA 1R093 1RM5A 1BMV1 1OFTA 3R5TA 2ZZKA 4XLTA 3COPA 5EQJB 2BY4A 3N0XA 3DDWA 3TBHA 3FWNA 1H0HA 3AG6A 1BWRA 2QYHA 3EXEB 3A32A 3CLVA 3NOXA 3OURA 1KDPA 3A27A 4LDNA 2W90A 3AFHA 3TNPB 4Y9UA 4XQEA 3ZDRA 2VAVA 5KINB 2TMDA 1K7XB 2BYVE 3GI1A 2C4NA 4UULA 4PZLA 1DRJA 2BCGY 2Y1CA 3FUOA 3LDGA 1GZ4A 3ZYGA 2IY9A 4WY2A 4G85A 1C5HA 4UNQA 5K3BA 2ZUCA 4X85A 4OQNA 1N2CB 1ONPA 2B8TA 4L9BA 2VUAA 4LEJA 1ST3A 1VPVA 5E16A 4MI1A 1KI8A 3DDNA 4KGVA 4HXCA 2ACKA 4AECA 2Q3CA 1J3PA 1LJ8A 3T1HB 1LLUA 3NYRA 4JKMA 2O2GA 4HG2A 3NFYA 2XSZA 4OFWA 3C14C 2QQKA 3WLIA 4B8ZA 1RBQA 4MWZA 2ZKIA 2BPOA 3UB2A 4BYGA 1XBFA 4JI4B 3GDGA 4QUHA 2Y2VA 4MUHA 3C6QA 2VSNA 1KZ6A 1QKKA 2R6ZA 3AM5A 4E8CA 3VBHC 3L92A 2GBLC 3Q9OA 3LO8A 2NV2B 1VHTA 1UZYA 3ZXIA 1FYUA 4MI6A 1AR72 2QXTA 3F3SA 5CDTA 5A1FA 1ZLYA 1Z62A 3RHSA 4RTOA 1HEIA 3O8CA 4QUDA 4PIYA 1R88A 1A3KA 4Q2FA 2J33A 4A0RA 1GRNA 3DMNA 4FOPA 4IM7A 2PNJA 4LDRA 1DT3A 3VBOC 3LQRA 2XKAA 5EIWA 3TN91 2V8BA 1S0GA 4U7FA 3OFJA 1P77A 1YB1A 3QVXA 2JE8A 1COV3 1F8YA 3IA2A 2QT0A 2LW8A 3E9ZA 3G8DA 5FUVA 1VBE2 1XLTC 1Z0IA 4F60A 1AUPA 1E1QD 4XIGS 2YYSA 4Y2YA 4O4JB 5IVJA 1O8PA 4KAAA 2R0FA 1E8NA 3HCFA 1XVIA 3SICE 4EN8B 3HACA 2Y76A 1TEXA 5F5AA 3LHSA 1HXS2 1G3MA 3DZDA 5IK2A 3QLQA 2AE2A 1RUC2 1YD7A 2BFPA 4H35A 1X1BA 2YVLA 2XNDA 3QEMB 1QR2A 1SA0A 3HPQA 1X80B 3QVUA 4TPKA 4UU7A 5HKBA 2FPXA 1LPNA 2QT1A 3IEPA 5B58T 3NUZA 3W2IA 2HJRA 2OA2A 4AEDC 4BQYA 3ULKA 2BFFA 3W3AD 3IO3A 3GAMA 3KP1A 4FBMA 4S1WA 1AHIA 1E6LA 1UJBA 4FHEA 4K0KB 3WG9A 4YRBA 3ZJ5A 3DF9A 3SC2A 2H6EA 4QGFA 4AN4A 4A6SA 1QJZA 3FWPA 4JDNA 1V8BA 3SEEA 1QU0A 1MS5A 2VF2A 3NHMA 3AY7A 4M1ZA 1X7GA 5TNXA 3TLBA 3V4LA 1ADFA 4BOYA 3NBUA 4A6OA 2AFVA 1ODTC 5J2UF 1K8YB 2Q29A 2JGLA 1F60A 2OBLA 4RD4A 1KQRA 2YXBA 3V9AA 1QHEA 4A41A 4NUBA 1FFSA 5JS6A 4BJHB 3TE6A 4J0DA 5EE3A 4DCNA 5LVAA 4OEHA 3KXPA 3HJUA 1W581 1Y3DE 2R79A 2WG1A 1X2BA 1Q6YA 1YIFA 4HFSA 4FFVA 1N78A 3SDBA 4ENPA 3NRUA 2OKGA 3G0BA 1O8CA 4H7IA 4TRNA 2WWRA 4W7SA 3B2NA 3NGXA 3KTAB 4D5EA 4CCYB 1IRXA 5FWNA 1R64A 3KB5A 3B12A 1IBMB 4JR0A 3RSJA 3GYBA 3YASA 4PTZA 4KV9A 3WY9A 4P3XA 2VQDA 3VR2A 1SCJA 4LIUA 4YAJA 4WXMA 2ZRKA 1ODMA 1Z8FA 2OEPA 3T7CA 5HTKA 1IBCA 5J1SB 3RRBA 1GZWA 2VUHB 5HJEA 3QOPA 3QPCA 5JAOA 2XOEA 4CR6A 3CZRA 4M8IA 1TYZA 2LTAA 2NTEA 3ZHYA 4MQLA 4W63A 1QYVA 8ADHA 5GJWC 3NDIA 3SIPA 1GNVA 1GCAA 1P3JA 4IZOA 5G04L 4I8DA 1T0UA 4IERA 1UOOA 4HRAA 2AREA 4QB1A 4FHDA 3ZM8A 4EG7A 3M33A 1U1CA 4N7JA 5EGSA 5J2UA 4GGOA 4HBGA 1OXSC 3U7QB 5CVUA 5DSTA 5F4BA 1V6OA 4UVIA 1H8HA 1LHNA 3P32A 3ZXLA 5E0OA 3WNKA 5DGTA 1T9GS 3U80A 5BPXA 2UYBA 2OZEA 1AYM1 3IPVA 3ZCVA 3WRXA 1QRUA 2QN8A 4N7UA 2OZLA 1N6KA 4I5EA 2C7QA 1QRSA 2XX3A 1CTQA 3DP9A 1DP0A 3ZFEB 2CN1A 3FNRA 3NC0C 1J2RA 1GITA 3DP7A 2XVZA 1EV13 3E23A 2X42A 2A3RA 1JHAA 1NJGA 4TV9B 1L4KA 5K01A 4BEJA 1DAHA 5C34B 1LVUA 1BD3A 1JEYB 1IOWA 3CH5A 3RLFA 5K8LA 4YEDA 2IC5A 4Q3EA 5F7ZA 2IIVA 2VSOA 1IHOA 1KU0A 1SBHA 4G65A 3NOVA 3SVZA 4E2XA 2VPXA 3D43A 3OT4A 4R2HA 1OFNA 3SITA 5K0UB 1T0HB 2NP7A 5DUXA 2OHXA 4RKWA 4QJ4A 4K87A 4IMJB 4DXSA 1LDBA 3L1KA 4HNQA 2NSYA 2OESA 4ZI2A 4R9NA 3KRTA 4E5UA 4XGQA 2J1AA 4R8KA 1YZLA 2JH8A 2O8BB 2VPPA 3FC0A 5A7WA 2HAEA 4BX2A 3SGLA 1QFYA 3BFKA 1L5NA 1ISPA 1B00A 2CEAA 5B12A 4IJQA 3DEKA 3A1DA 4EGFA 2ORZA 3OA2A 1V6SA 5TSWA 2JLCA 3RVPA 3VBEA 3J26N 5H5JA 3A7QA 4D9FA 3PV0A 4IHAA 2C5SA 4Q9NA 3S8YA 3A1NA 1XDDA 2ZYUX 4DN6A 1PFVA 3CNOA 3D8TA 3DZIA 2J46A 4ZPXA 2FU5C 2ETXA 5IATA 3K9LA 3PUAA 2FJPA 2P9FA 2RMKA 1VPDA 2WD7B 1NN0A 1VMDA 4AVAA 2ZX1A 4LITA 1YBFA 2DJIA 1T1EA 4F8EA 2VS1A 1P7CA 5DT2A 2AC1A 2JK0A 1NDQA 4CEHA 2CVZA 3DYOA 3PTRB 4NAUA 2RDSA 4WKBA 3O9VA 1RUD3 3JD1A 5B7PA 1VBC1 4X66B 2XJQA 4RW0A 5K7PA 4R8VA 1RYEA 1BCXA 1TZKA 3HZRA 1BLZA 5LN1A 2I03A 2DDUA 5KNDD 4X8HA 3PJYA 4OVEA 2XIQA 3O9ZA 4GAEA 4AURA 4IKOA 1I7DA 1XO1A 3K72B 1XXLA 1UZAA 3KZCA 5DBHX 1FP6A 3AL3A 2WIGA 2OCKA 4ND4A 4AOCA 5KQSA 5BN5B 2DULA 4XF4A 3G0HA 2C9ZA 1WBLA 4RK1A 2RHLA 3V1LA 1TCAA 1XEXA 4HDRA 3AJ8A 2HV9A 4A82A 1NT0A 3EHEA 5IAAA 4BOWA 4XXHA 5KHIA 2OA0A 4CXMA 3RNOA 2NP6A 2X0RA 1BGXT 4JLJA 4PLMA 3FSJX 5BOSB 1KIAA 1S2BA 1D07A 1AS0A 3SX2A 1Z0DA 2V03A 3Q0EA 3UG7A 2WD8A 5DXJA 4RENA 1ZINA 1HQKA 5A5VA 2I29A 1KY4A 1U4OA 2GHRA 2P1ZA 4JA2A 2EEZA 4TV9F 3U1BA 1LJUA 2GKGA 3B6KA 2ZGTA 5K4HA 1QIFA 4QXMA 3RTAA 2QQOA 4QZVA 3TFOA 1DAPA 4GD3Q 4JOCA 2FH5B 2W6MA 3E9RA 2JVKA 1KEVA 1NHWA 4JGBA 1CS0B 4J0CA 2JJQA 4LC0A 1NC3A 4YAGA 3KF5A 4HAUA 2IOFK 3GC6A 1F7VA 2AG8A 4P93A 3AI1A 4OB6A 1E96A 2X9GA 1QIQA 2OB1A 5H7XA 2ZZQA 4B76A 1IPJA 5DYYA 3O8QA 3KSUA 5KDLA 1JNXX 3W6NA 3M81A 3BE4A 4OLFA 2VHEA 1S0IA 3LXRA 1WZUA 5FZIA 1ZAYA 1FMJA 3DO5A 4LDAA 4AVCA 4L8YA 3A0KA 4R1TA 1D6JA 4Q1DA 1ULAA 1YULA 2C84A 3RG0A 4C1BA 5AK5A 2K5UA 4YUAA 3DUWA 5F2KA 5C37A 2HMYB 2BISA 1ACCA 3CNAA 1BQEA 1AUOA 4KP7A 5M5BA 1VBC2 4FZJA 3IB6A 1I4EB 5HQ3B 3MGUA 3UJ8A 1AR83 3ON5A 2Z43A 2CFOA 3OZEA 4CM8B 2V97A 3CF6R 4GBED 4JXKA 4OCZA 3K9FC 1PYOA 4DZTA 1L7MA 5E6SA 4G36A 3KUDA 4Z1OA 4MH0E 4OQQA 3IAM6 2W9XA 1T4GA 2H4YA 1JQLB 4BNIA 1O94A 1Q57A 5CVEA 2PZGA 1XJ0A 4EECA 1BGWA 2VDWB 2CVHA 1NP3A 3EDYA 5IC4A 3IH5A 5DGCA 2BFDB 5FPZA 2ORED 3VR0A 3D7RA 3ZJUA 3WG2A 1XKQA 4V0LA 1UYPA 3BSWA 1RMU2 5EJ6A 2JD4A 1F6DA 4Z7NB 5FKCA 1Y82A 1NCRB 3O7OA 4ZTBA 5EXDA 1MRZA 3H7YA 2AXNA 3AEQB 3LT2A 3I3QA 4MYHA 1OTXA 4F6CA 3NV3A 1T25A 1XHEA 5CDUA 2IDKA 2PEYA 2WO2A 1ULFA 1E20A 3WK8A 4ER7A 5LWQA 2R8RA 3R5SA 2CYAA 4H3SA 2ZPXA 3B00A 1PW7A 4A6DA 1LOEA 1ULSA 3RU9A 5BYAA 5JO9A 1PL0A 3F3YA 5DHAA 4RWEA 1A5SB 3U1VA 1TD1A 3B3AA 3VBFC 1SCUB 3G0GA 1VRH2 1GT6A 1EYBA 1JMYA 4LEIA 3W4JA 4AWDA 3C7DB 1ZW1A 3FB4A 3AZYA 5L45A 4A44A 4YCJA 2KQUA 1SFNA 1A9PA 4OXQA 1RCUA 2JCXA 5BSUA 1XNQB 1LOBA 1BE6A 4E5PA 3IS3A 4Y8VA 3K4AA 2OKXA 4NRPA 1FFBA 1DV2A 4Z6KA 1JUHA 2YHSA 5T5LA 4ITCA 3HN3A 1YC5A 3K05A 4R51A 3KV3O 4LOIA 3X3HA 4EL5A 4G24A 3IB3A 1YI0A 2G9GA 3OT1A 1Z07A 4YG6A 3UG6A 4CV2A 4N7IA 3KE9A 1IDOA 4JBNA 4YXWD 1D4M3 3MWEA 5LZ5A 1M2WA 4QPIB 3W2TA 2HLDD 1EXVA 3KTAA 1AIPA 4G4JA 4WY8A 4YYEA 3HWJA 3ZVXA 1GZDA 2HTEA 1RQLA 1OTHA 3DFKA 3EULA 4O8CA 1QIIA 1J1IA 2IP2A 4R2XA 4NBTA 5JOQA 3GRKA 5K2MA 1RBMA 3DZHA 4E4ZA 3IUEA 4KPUB 2JGIA 4R98A 1JBEA 5AW8A 3T3MB 1Z7EA 2PN1A 1NDHA 4LVCA 2AJDA 3K92A 1DTWA 2X58A 3AF2A 4G5FA 5LA6F 2P5BA 4YGXB 3WO0A 2GN0A 1ENQA 2C9DA 2ILVA 3MIEA 4PR3A 4UFKA 1T9AA 3E05A 3PQ6A 4LXTA 2NTVA 2ZSHA 2G28A 2R8XA 1T10A 5FXWA 3M6AA 2YY7A 4JITA 3KM5A 1SKQA 2ORIA 4YMWA 1R8JA 1NNSA 4ATFA 8MHTA 2ZAAA 1XXNA 1R6XA 2AMVA 5K20A 1P4JA 1W73A 5ABJB 4W5TA 3PXEA 1FLNA 4XFCA 4KR6A 1J22A 3WO1A 3PWSA 1LTQA 2I7TA 4NYIR 2OO7A 3ZGLA 4Q1RA 3LHKA 3UUWA 1FMCA 2N3ZA 4BEWA 2HWC2 4OUSA 5CA6A 4COZA 4HFRA 1E92A 1TUGA 2C8JA 4EFLA 4XMIA 1JQBA 4C04A 4MX8A 4OJQA 1EXMA 3TLAA 2NYUA 1SHZA 3GBVA 3EVFA 4GX1A 4NR0A 3T4EA 3OJ0A 1J58A 5LYYA 4EEZA 4URVR 3N7JA 2VNHA 2Z2YA 2BFBB 2X0EA 4DKJA 3IESA 1SCUA 2AFIE 3VNQA 1NVAA 4JFRA 5LA6A 2IZOA 3U7JA 4CTKA 3TSAA 3B1ZA 2BUKA 4NWVA 4C29A 3S5QA 1E9FA 1VFPA 4G97A 3A6JA 4PIPA 1GD1O 3M3OA 3FAKA 3VNRA 4KR9A 2VOEA 3IUJA 2A4KA 3RSSA 3L5OA 3GJ5A 4IE4A 2P91A 3DUFB 3NH6A 1D2SA 2DVMA 2X0KA 2VZEA 1C3OA 5LBIA 1WPGA 3B8EA 1C8M1 4BO4A 1I7LA 2C7RA 2A9QA 4OUMA 2QMEA 4GPZA 2PGIA 2EIHA 3UT5A 3T5MA 2JA2A 3QVWA 3CNHA 2P3OA 4JUBA 3I2DA 4Y20B 3MF4A 1IQRA 4O9GA 1JZTA 4BMBA 2D2VA 3RPEA 2VBIA 4B83A 3TBDA 3CG0A 2GZWA 5C7LO 5DNUA 3ODGA 3BDIA 2OBBA 3U3DA 3A2NA 1RHI1 1D7AA 4FOVA 2UYOA 3RS5A 4HEQA 1SBIA 4DIEA 2E21A 1NF3A 4B82A 2GD1O 4H1VA 1HX6A 3EQ9A 5LBUA 2B5HA 3WDVA 2W6CX 1PVC1 2EXHA 1C7ZA 3GFVA 4H60A 4MVTA 2AW3A 1X7ZA 3K0KA 4OCTA 1CF9A 3N7MA 2ZGSA 1QX4A 4EBFA 2AN5A 3CBGA 1K0UA 4OLLA 3ZOIA 1QIHA 2GCIA 4PLFA 2Y6UA 3I9KA 3A1UA 2JDAA 4JJ6A 3LSEA 1U0NA 3D6VA 5J9FA 1JDZA 2W0SA 1S0UA 3AHDA 3GJRA 4ZT2A 4PGAA 2E5LB 1NWHA 3HXQA 1WDWB 4G8CA 2VP6A 2O2XA 3OTWA 1GYPA 4Q4LA 3PNBA 4P08A 4OP1A 4ON9A 2ZG6A 3DO8A 3PQ4A 3UWPA 5L8VA 3C7EA 4OY3A 1G2PA 2H1FA 1KFCB 2UUOA 3BX1A 4MGIR 2O2IA 3L3BA 4D6YA 4URTA 4RV4A 1XZKA 3BMQA 1NA5A 2R063 2EP8A 4PLZA 2JLXA 4OYYA 4DJ5X 2DPLA 1XZGA 5A3QA 4LPKA 2XVXA 2PX8A 1LS1A 1ADCA 4WZZA 1Z22A 4K2AA 4RPCA 2I6QA 4RN5A 4D9JA 1TVEA 4NJMA 1J1TA 2XUFA 1YVDA 4OHFA 4Z92B 1ML3A 3D8HA 1OXXK 1D9ZA 3WICA 2JDKA 2J3IA 3DPIA 4U1RA 1H2LA 3FLRA 4TRMA 3TRSB 5HCBA 4ASMB 1XZLA 3POJA 3A04A 3LIPA 5DW0A 3QU9A 1U7TA 4QDOA 2YBDA 4LWOA 2HPAA 3MJRA 1E79A 4A5OA 1ZD3A 3UMYA 3NEJA 1E58A 3K53A 2FVYA 4YCSA 4ZZ1A 1WHTA 2YJZA 1LVHA 1OI4A 4XUNA 4MQ4A 3V3KA 1C8LA 4DYDA 2KA3A 4HMOA 2OKCA 1PGOA 3VR6D 1SLCA 1MG5A 2XVKA 4H0FA 2EV9A 5H3HA 1G9TA 3QFSA 1Z7WA 3RVKA 4HK8A 3HRIA 3JQFC 3WK4A 4DV1B 4L4RA 4GOLD 2IYRA 3L0SA 4MQ5A 3CSUA 4F0JA 1DG3A 3KTDA 1SUFA 1EEHA 3DZGA 3QWFA 3BTZA 4FTBA 1XRSB 5LY2A 1IWBB 5TXGA 1QO7A 4TUYA 3E7PA 3NALA 5BR7A 4PPQA 1M1NA 3JQ6A 4NICA 3OHSX 4BTLA 6LDHA 1F2UA 2OOKA 2INGX 4GSLA 2D54A 4ZKDA 2Y99A 1VE1A 1Y1SA 5ITZB 3DL2A 3BGIA 1ZU5A 2CTVA 1OC2A 3KPVA 3ILFA 1IDN1 1PJBA 1R0ZA 4X7PA 4F3YA 4RABA 2XXJA 4NJMB 1SMVA 2QPTA 5JOZA 1XLUA 4DREA 3ZR4B 1U5BA 4F4HA 1JZ2A 3Q3VA 1RCFA 3H1MA 1KOFA 1SOWA 4MGZR 4MV2A 2N0SA 3OLVA 1X36A 1QIMA 4WRRA 2AKEA 3UUFA 4ZRDA 3M1LA 4CVNA 4X7BA 2MMGA 1GU7A 3GRCA 1JLLB 2GC2A 5JAIA 4EPYA 1T2NA 3CT4A 5EXPA 1WD3A 5J48A 2D6KA 4ZDWA 3QK7A 3MB5A 4KR0A 3TNFA 4C76A 1DARA 2CNWA 5LK7B 1U0GA 2O52A 1JQEA 4WNIA 5DYWA 2ZU0C 1KJIA 2H4XA 2R66A 2N1MA 4W1SA 3MM4A 4MXDA 4MV8A 1JYWA 2O14A 2C29D 4UHFA 3X44A 1SBNE 1ASJ1 4RE5A 1POV1 1BTOA 1SKAA 3LWZA 1CDDA 3BE8A 3DMTA 2ZSFA 1OF4A 1LVGA 1V45E 1M1NB 2OHVA 3KWFA 4AYUA 5JTUA 4IEWA 4XFIA 1Y81A 3L02A 4ALKA 1K75A 1JHOA 2A5YB 2QJOA 4P3YA 1W59A 2AF3C 3EXHB 3OO1A 3AHJA 1ZR2A 4UXIA 2M6KA 1B8NA 1W6UA 5E8AA 4FZRA 5DN2A 1QO0D 1NF9A 3QACA 3O1MA 1A1SA 3KZVA 3EE6A 1FXSA 3TLCA 3KKNA 4FSXA 1DF0A 2FZEA 2C2ZA 4O7XA 2OGTA 4DRVA 5A6XA 4CCNA 3O73A 1KF0A 4HN4B 3LUDA 2BGLA 2JPDA 4ML3A 5E0KB 4LSMA 3OGJA 5ERYA 1K5PA 2D2XA 3JXSA 3MCUA 3VBUA 2ET6A 1NUQA 3FD8A 3PDHA 4RQAA 3VKHA 3QFFA 5F52A 5LY1A 1C9NA 1JEEA 1K3FA 4Y6OA 1I4TD 2IDMA 3QXJA 4E8DA 1CSEE 4TXJA 2ZGUA 2H3HA 5AJYA 3KDSE 2PUAA 5JDCC 4RTPA 1UM8A 4FPHA 3ZHRA 1RUJ2 1Q8SA 2VVTA 1BROA 1AZSC 4UATA 4D97A 1QOTA 3GLGA 4M6WB 4R6WA 2R6AA 3SZGA 3D3WB 1ATIA 3LUHA 4YB8A 3PNOA 4E2FA 4XH9B 5FZOB 1QX3A 3DPUA 4Q0VA 3UK9A 1TKBA 4F5EA 2RHOA 3P9RA 4V1CA 5T5PA 3VPHA 1EFUA 5D3ZA 3W2GA 3HCOA 3MA0A 3B01A 2FLKA 2CVQA 3RKSA 5FB3A 3OTGA 2AFHA 4NCBA 2BI7A 5BPFA 4XTMA 3FWZA 4XFKA 5CT4A 1RP1A 1VBNA 3I01M 1W4RA 4YW1A 4ZVQA 3WBFA 2XXAA 4XUQA 1E5HA 2FUEA 1GTRA 4Z9YA 2CK3A 3S40A 3ZLBA 1GP4A 2YZ4A 3TTTA 3RYIB 4AB1A 4B6QA 3MF9A 1OAAA 3AIKA 3R3VA 1LGNA 1KGYA 4HRYA 1E1LA 2GTIA 2W58A 2QY9A 4PZYA 2CLFB 1TZCA 3RU2A 4LTDA 5KCMA 4K6HA 1WDKA 4OJYA 4UBNA 3PXXA 4Q4Y3 2WNOA 4YRZA 4LMAA 4Y18A 1XWFA 2E87A 2OCBA 1G8MA 5HF6A 1U94A 1Q17A 4PLYA 2O0MA 2NLRA 4AJ2A 1H2YA 1W9WA 3OPTA 2HQOA 3AVOA 5LNK1 3K1AB 3SQMA 1ECBA 4BWVA 3RVJA 821PA 1KD7A 2D5AA 3TQSA 2F64A 4URFA 4I4LA 3EA4A 5A4FS 6GPBA 3Q40A 1DZ3A 1OIWA 4FZ5A 5A62A 1TTQB 3NYWA 2FSFA 1NUUA 1QJY3 3I34X 1TFRA 1DGWX 3JV7A 3PRJA 4TMTA 2JI9A 4DJEC 5C2JB 1EUDB 3LCMA 1J5PA 2ZZNA 4R05A 4Y3OA 1RJWA 2VCMA 1DCFA 3K7EA 1RKUA 5KVSA 4NRQA 3ASUA 3PC6A 4JGZB 4QMAA 2PUWA 2QVZX 1IJEA 4UFNA 1N2CA 1PEAA 3FRJA 4RDIA 1PVOA 2C9CA 1GLVA 2OXCA 4C4TA 2DT5A 1CW2B 4AXOA 4XEZA 2QL5A 3PE4A 3OP1A 3KSAC 4YV7A 2D3PA 2B4TO 3IEUA 2DR3A 4UOEA 3KQOA 1WV0A 4L99A 2CXHA 5L3RA 1E6WA 2A71A 3C6MA 4OKSA 3SISA 3WLKX 5APAA 1RJFA 4LOJA 4FAGA 5CFCC 3DL3A 3CEAA 4ZVVA 1I3NA 2PTGA 4QSMA 3GA5A 3NAMA 2RS33 2BYTA 5FYQA 3K70B 3KQSA 1GL6A 3H4IA 4EBBA 4I0WB 5F32A 5F1OA 1A2OA 2VXOA 3AM1A 2G71A 1U7WA 5DTMA 5HKKA 1BKSB 1B26A 3ILRA 2HUPA 1D0HA 4COKA 4CF4A 3WOHA 2R60A 1GKBA 4H16A 1L1EA 2F3QA 4GKYA 2IEYA 4R5MA 1N7IA 4QDQA 1N6RA 2H1HA 4H7KA 4ZTZB 3T35A 3WGTA 1Z33A 4ZEWA 1ZZ9A 3SC2B 4CE6A 4HNUA 2ICAA 5A9TA 4R52A 3HVKA 4FTEA 4M3CE 2IEIA 1GPNA 4RQPB 1OASA 2YX1A 3R7WB 4FFDA 5MHTA 2K87A 3O75A 4I5FA 5AK3A 5LMCA 3WAGA 1YE3A 4FIZA 3WL8A 4LIPD 1T91A 3VBRC 4KLAA 1U5ZA 3QPUA 1N0VC 5T8KC 3FNGA 1ICIA 2W2LA 3PZRA 4B0PA 4K21A 3PXGA 2ODQA 2JI4A 4C4XA 1RRCA 4PZCA 3USSA 2O54A 4NS4A 3E7DA 2HKIA 4GPEA 4TT3D 2RGEA 4C6RA 2WZPP 4FC7A 4NCXA 621PA 4YMIA 5A5DA 3HDGA 1NWCA 3DBHB 4ZAZA 4WVZA 5LUAA 5LKAA 1VBFA 4YZ2A 4B7CA 4WZCA 1T6XA 1ZGBA 2R8BA 2RONA 5K03A 3AF5A 2B25A 5HBGA 3VI3B 3JVUA 4YN3A 5JI9A 3TSOA 4PZZA 4UNPA 3G79A 4A0SA 3AF1A 4WZAA 4FQ7A 1GKKA 5I7SA 2RGXA 2ZIVB 3MEPA 3L0CA 4YRLA 4QKBA 3C43A 2VDQB 2DU1A 1U8EA 4A6EA 4Q15A 3KLOA 3FL7A 2HWB3 4F7ZA 1P7ZA 2ZM5A 3BJRA 2Z4SA 3L4JA 5ALFA 1VIDA 4KRGA 3ZCPA 1PGQA 1I36A 2POCA 4PFQA 1A27A 4JIGA 3JB8A 4QM7A 3VH1A 3ROGA 1ZQ1A 4AJEA 5ICSA 4PS1A 5IT9A 3DS8A 1Z08A 3F3MA 5FMOS 4F38A 5AHOA 1ZGAA 1CRLA 4WD3A 5FOXA 3MTEA 5FMOL 1UPXA 1SQ0A 1V5GA 4JT2A 5TT0A 2D1YA 4GPIB 1H8EA 5ELMA 3R9KA 1Z26A 4BA6A 1ZRMA 3PNSA 4RPGA 1M6HA 3UFBA 1ESEA 3T1LA 3VB9A 3GAAA 3K6KA 3GJXC 4UM9B 3I9V1 5YASA 1N6OA 4CCWA 4E6EA 3LA7A 1NZFA 1ESMA 1LNZA 2V6JA 4QO8A 4UARA 5JNLA 4FHCA 4DDVA 5HXAA 1DHRA 2H4WA 4A8JB 5IDQA 1NQWA 2QUHA 1SIOA 2QZJA 2B92A 3FFBA 3HP1A 2IQ5A 1AKUA 1QHHB 1H1IA 4KK3A 1F2VA 4WM8C 2ZJ3A 3VBRA 1BOOA 4MJ3A 5EV7A 1SVNA 1WEHA 4QO7A 3ZY6A 5AHXA 2B8EA 1XQWA 2BFOA 4ERNA 4K9LA 3RUDA 3OPNA 4FNGA 5JD5A 1QJ4A 3FYHA 4LOAA 1M5UA 3D3NA 4UBHA 4FFOA 2VVFA 1ZPDA 3K51A 1PDVA 1TNFA 1LODA 1RHI3 2LR0A 1W0KD 2QMHA 1XCLA 2O8VA 4OF4A 4MYSA 2GK6A 2JLQA 4ZI7B 1W8OA 3UJ9A 3KQYA 5KYWB 4RVUA 3TQHA 3QNWA 5ACA1 2IYTA 1YZ3A 1C41A 3L43A 3ZXSA 5IZCC 3OI7A 2Y2UA 5AFSA 5EKTA 3B6IA 4V0MA 3KV5A 3ZN5A 2EZ8A 3LDUA 3R44A 3AR9A 4JC8A 4XIIA 3PRYA 2BF7A 3CZ5A 4JGYA 4J1WA 2OCXA 2TMKA 1VJDA 3U49A 5TPWA 4ZVNA 4RJKA 3ZYFA 3I05A 2P78A 4TSVA 4N5NA 5GY7A 1JLKA 5FBWB 1JXOA 1AV6A 4F3TA 4BCDA 4QPGB 4BJ3A 1O7FA 4NHEA 4AY2A 5CVTA 4HZGA 4IUGA 2G9RA 2DOKA 4AJNA 5C4WB 1U02A 1ADBA 1WSAA 2RS53 2GALA 2XG3A 3SJCA 2QTVA 3DNMA 4NMWA 1JT9A 1TCBA 1RE1A 1D7OA 4XB2A 1MC4A 1GKYA 4ASUD 1LRHA 1RVF2 2E82A 2I6UA 4BVEA 2VAPA 5EIOA 4C4SA 2LRPA 1MIHA 5COAA 3UXYA 5HUHA 1U3DA 3SXUA 3DW3X 3HKEA 4RIGA 3WLSA 3RUFA 2VWGA 2C3YA 2D93A 1MO3A 2BZGA 5ENZA 3PFCA 4BMCA 4DNPA 3N2LA 4TYPA 2VLIA 1N8SA 4LC9A 3U9LA 4D26A 4NXMB 3ZZUA 1NVXQ 5G4KB 2FR1A 3LT4A 3ROXA 1HA3A 1LESA 4ZZ8A 3FBYA 3NORA 3MC1A 4BPBA 3CUYA 4PC2A 1ZMOA 5DAQA 1QQ7A 3OOEA 3O8OB 1VB4A 2H0VA 1F4LA 3RBAA 4BIOA 3ZLTA 1VR3A 3FFZA 4HGRA 1V5EA 1W9FA 3K0FB 4TTTS 2VUIB 1HDEA 1JW9B 4F4IA 1ZRCA 2FPIA 4ZOEA 5FY8A 1TJYA 2SKEA 2W8ZA 2W2OA 4G07A 3ZLVA 2IVFA 3T94A 2BKEA 2JX9A 3HP7A 1W47A 3SC3A 3JW8A 5E6UA 1Q0LA 3DOHA 2Q2OA 3F46A 4BMDA 1QAQA 1K7SN 2BUBA 1XTZA 3FLEA 1YRBA 2V72A 3Q3GE 4FEEA 1SBQA 2BM0A 5DZGA 1RR6A 3SYKA 3I4IA 3ETHA 4XUEA 4RYDA 4OAPA 5A7QA 1GN8A 5AKXA 2GYUA 4LE1A 1BBT2 2J0VA 2OORC 3BORA 4REQB 1CVLA 3AFKA 2NYVA 4S1TA 5AVTA 1HE2A 3HFSA 4QPYA 4OHMA 1ECJA 1HXHA 1Z3CA 3CE6A 1DRKA 2YQ4A 5B5SA 1QV9A 3GRUA 3E9QA 5G05L 3N6VA 1QR6A 3DTVB 3R8FA 1M9NA 4GMP1 1PZHA 2ZIWB 1MENA 4MYRA 3TZCA 4HGPA 3QKSB 4AC9A 1TE2A 3LXXA 4Q27A 5HX7A 4NJEA 2WNVA 2CNDA 2Y6KA 3UAVA 1Q43A 2VQ3A 3TEMA 1NNUA 4AF8A 5KMGA 1DLCA 2NU9A 1H6AA 1YCHA 2QX7A 2O7VA 1KO5A 2MU1A 3M82A 1RUG2 4BQOA 2IZZA 1BDHA 1WHSA 3G49A 2OZPA 5HS6A 5AW3A 1ZDMA 1NFFA 4M9RA 1NN5A 4KGXA 3S7IA 3KJGA 1G55A 4BJ1A 1Y6RA 2ZJ4A 3RRMA 5I48A 5KXEA 4KQ2A 4O6VA 1REQA 2JB8A 3GMDA 4B3HA 1REDA 1UFRA 3DMRA 4KMOA 3DB2A 4RVOA 3W58A 5FZMA 5A3PA 3ABOB 4P2BA 4Y2RA 4TTVA 3OX4A 4ZO9A 2AZMA 3GZ4A 4N48A 4KAFA 3T5AA 4IWYA 4QEDA 2DFDA 5JH7A 4IG9A 1F4AA 2V7WA 4HPXB 3OKAA 4BDSA 5HCFA 2ZJYA 2P9BA 4GL4A 4YTEA 4N01A 4R2WA 1HE5A 2OC4A 3Q8BA 1RPJA 4TLDA 4LRWA 3OGRA 3A14A 3L8CA 1RYDA 4JEIA 5GONB 2B4QA 1QF9A 3WP3A 1PIWA 4HDMA 1W5BA 1GNLA 3AU8A 3I53A 3U6KA 3H2JA 3RUIA 5F2EA 2O9JA 2XWBF 5A6ZA 4X62B 4ZIRA 1O0SA 1AZLA 1ZSVA 4ZREA 3FI0A 4A92A 5C4WC 3W9AA 3VV2A 2CL7X 2ZE8A 1N5OX 7GPBA 1KMHB 3BXFA 1JYFA 1GRQA 2QTHA 2XDAA 1FU7A 5ELXA 3T7KA 3UHOA 3OCJA 1Y9QA 1F2TB 1XPOA 1WDTA 1RRKA 4NI5A 4HEHA 2H1VA 3BEDA 1ZRDA 2FRDA 4PPYA 1ONSA 2VHZA 3QLEA 1T36A 3ZS8A 4CU2A 2X5IB 3J80A 5LP6B 3PPWA 4IILA 3SYLA 3PB3A 4MMZB 4ZWNA 1B43A 5GIOE 4ND3A 2BIFA 4ND5A 3HHPA 1IQDC 3IE0A 5K6TA 5AW0A 2XNHA 1FVOA 4H6PA 1MZ6A 4BNDB 3GDBA 5ALJA 2P75A 5F5QA 2R7KA 5FY4A 3OZWA 2XWBB 2VYCA 2YZGA 4QFMA 4YZ3A 1GLGA 2HR1A 1X8XA 4NPCA 1HMPA 4M9CA 3DE7X 3OPYB 2A0UA 5A4JA 5A4MS 4GZMA 3EVGA 5JSRA 4WN3A 2MYTA 4LKDA 1ISJA 2FEMA 3EC7A 4R8MA 3WINE 1GUAA 1J0BA 2WU8A 1X1QA 4ZT4A 4BLTA 4CEWB 1DV1A 4D8XA 3NJYA 1A7AA 2FDKA 2DSNA 2VZ0A 5I0TA 3LCRA 3WIOA 4NENB 5TRTA 2QIPA 3L41A 3N0RA 3VPSA 3BRQA 4URUR 2VYQA 2I45A 2QRGA 5CNMA 4QXAA 1J00A 4UU0A 1AXKA 4M3CB 4LJLA 3HNBM 1PVC2 1ND2B 3UJAA 5BNIA 3CF6E 1R082 3QXSA 1WZXA 2O50A 4CLOB 1S9DA 3WADA 3R2JA 4DR5B 5JSHA 3ABQB 1YJCA 3GLUA 3MTGA 1AUYA 5IVVA 4O5AA 4IQ0A 5FP7A 2MNGA 3GGPA 4FXPA 2YVUA 5E7QA 5JCXA 3S4YA 3N9QA 5JLJA 4X1KA 3CKYA 3EEOA 3P9YA 2AOXA 3T1QA 1YFLA 4K9RA 2XUHA 1MH9A 1FS5A 1ACJA 3ZDZB 3Q3IA 3ZX4A 2I66A 1OQ1A 2WPDD 5H70A 5EGNA 3WNOA 5F8PA 2IF0A 3ECCA 2O8EA 4AMUA 3W6OA 4OZOA 3DZJA 1BVVA 2IYNA 3THRA 1YHFA 2O7RA 3GUZA 4RKFA 2R86A 4B4DA 3CJIB 1SGWA 4PYRA 3OF3A 1B09A 2O0KA 5F35A 2WA4A 3MOGA 1HI9A 1J23A 3LF1A 4WNAA 5LSAA 2CE7A 3S57A 2B8JA 4GRIA 1IQPA 6CHYA 3U4QA 1R0KA 4C0SA 1N77A 1QLJA 2HYDA 3N87A 4A1OA 4AFAA 4OUDA 2JDZA 4GGPA 1K92A 4GHWA 2VYFA 2QS9A 2Q5TA 3GFQA 1O96B 3SJUA 3M1YA 1KRHA 1HDRA 1Y3TA 3RGWS 4ZYLA 5B3JC 1XXHE 2V6IA 3O94A 2IXCA 1UKBA 1OHHA 4KWCA 1ODSA 4PZAA 1JDJA 3NGMA 4WEQA 1G3QA 4GVPA 5T50A 1TA4A 4OXIA 2PSSA 4LHNA 1T6ZA 1NCRA 1RRGA 2KI5A 5LK5A 5LXTA 1UH5A 4LVOA 1Y3AA 2QP3A 4F6RA 5J43A 1V6AA 5TARA 3QTTA 3KOMA 1YDMA 4M21A 3NMUF 2X4LA 3UHPA 3OYWA 1P3DA 1NJSA 3IDBB 2VJCA 1RRFA 5IJWA 3KWVA 4NATA 1I7NA 5DM2A 3CKHA 2ZJ6A 3UV6A 3K09A 2NW6A 4XMAA 1IEXA 2Z58A 3ZWBA 1E2NA 1JECA 3ZD7A 3D81A 3DC2A 1W6MA 3VZRA 4WE3A 1QHIA 2CKMA 4RS3A 5T7BA 2PMKA 5JVVA 4IDZA 3CDZB 3ZLIA 3S5JA 1CUXA 2A9KA 4FE3A 2J3LA 1BE8A 3L0IB 4A26A 4BFUA 3ICWA 2I7CA 2PLV1 1VG0B 4KWLA 1G1MA 5AFBA 1GOGA 1XFDA 5AP9A 1M6WA 2YU2A 1NZIA 1UZ0A 3H5OA 4MSVA 1TCVA 3RF6A 3LHDA 4DV0B 5G1NA 5ITWA 3C7HA 4HY3A 3ZE2B 2QVGA 2GLXA 4E5DA 2I9KA 3P3PA 3IDEA 3AR6A 1ODFA 1DKUA 2RJNA 5IAJA 3KELA 1PGW1 2AEJA 3G5UA 4D8TA 2KD7A 3VOTA 3WKEA 1BBT1 1DZRA 1RC8A 4NK5A 4YRAA 4GWLA 3TG2A 2PT5A 4IINA 1Z5VA 3C3JA 3GLVA 2WO3A 3JQ7A 3IJ5A 3O21A 5GLZA 3M3PA 2E2WA 1L2TA 4CM1A 4KVAA 4FI3C 1LSUA 3IT0A 1DGLA 1FF9A 2BSQA 1HT3A 2I6XA 4PGFA 4EJFA 4US2R 3H9GA 2JCGA 3UAYA 5F2SA 5BR1A 2XLAA 2J41A 1E1DA 5HZHA 3K0FA 3S2UA 1DPGA 2V9CA 3KJNA 4B35A 4DLSA 1Y8ZA 3T0DA 2Y33A 4F93B 1H6DA 3ORRA 1Y9DA 3A2KA 1HE8B 2WZCA 1U98A 4HXGA 3PYLA 1XU9A 3BTSA 2O6LA 2HMSA 4PXYA 2V98A 5DDJ2 4UPDA 3OZDA 3UF0A 4A8PA 2VTKA 2L42A 4TRRA 4XAEA 3NBXX 4UHKA 1D2HA 1TNRA 4L9SA 4D80A 3TWOA 1ZYUA 3CUEF 4BE3A 3ETNA 4N12A 4IV3C 3HB5X 3ZKAA 2BTQB 3TUZC 1J0DA 3ZIAD 2G9FA 3I2HA 5FNVF 3OHPA 3EARA 2KPOA 2Z69A 4NCKA 4LV6A 2ZEZA 1ULOA 3MJSA 4LBOA 1ESZA 4GZ6A 5CJ2A 1L5HA 3J8F1 3CJIC 4QGHA 1PD1A 2ZR0A 1PT6A 1T1IA 1Y5MA 1GP6A 3UMJA 1IONA 1T9KA 2C77A 1V11B 2A70A 5FMCA 5LLSA 3S99A 5K8TA 1GGVA 1QIGA 3VHQA 1QH0A 1RWOA 4LY6A 3MG9A 5KOJB 1LPSA 2COUA 2EL9A 3ZFFA 2FPIB 4H55A 4GA9A 2ZMKA 4RPIA 4W8GA 1ZD2P 1SCSA 4GKJB 2W43A 2XRYA 2AUMA 1SUEA 3CWQA 3W0LB 3GCDA 3OZXA 4RGGA 4D6XA 1X8KA 2RK4A 3ZYCA 3WSVA 4DHEA 4F12A 1W8NA 1JEQA 3R3ZA 2IP1A 4N0MA 3OT5A 1T9GR 4MYCA 4S1PA 2QQVA 1TRKA 1S7CA 4BGUA 3R0ZA 2YNMA 2NU7B 1V1MB 5JVDF 1X38A 5IK2D 3V48A 2GFIA 2ZIFA 3RRZA 1SEFA 3A6LA 1LSOA 1NXSA 1DO2A 4M0HA 3STHA 3CPHA 1K8RA 3D7KA 1EQUA 1OU4A 4BNGA 3K0HA 3N2ZB 5JMPA 4DLKA 3ZE8A 1UFOA 2AYXA 1RTTA 3QQ5A 1ZK4A 4P1ZA 2QLJA 3GVCA 1GANA 5HF8A 3MBKA 4ZICA 3E22A 1E7YA 5I9LA 1UC5B 1APBA 3RTBA 3DR3A 2JS7A 5D2CA 1E2LA 1UJ2A 2PNFA 3EA5A 3TYJA 1MZEA 2PIAA 2H7VA 5FBQB 1XJWA 2RARA 3NNDA 5KHLB 5J36A 2XVAA 4UUAA 2WJ4A 1YQ6A 4ZHQF 4BMXA 1KVQA 1HLFA 2D13A 2NU6B 3BERA 1S8NA 2HSEA 2H6BA 4EHKA 1WUKS 3OX3A 4FCVA 5DTEA 3OF2A 5JOYA 4J4BA 5C9AA 2IEBA 1MB2A 1V96A 4U2AA 4U7DA 2GUWA 3OQOA 4QX8A 1URXA 3ZO0B 2VTEA 1N4AA 3T0IA 2CV6A 4YC7A 1YZYA 3TOZA 2YWEA 4BKRA 3F74A 3U1XA 4YMLA 2RGDA 4L2IA 4ZGWA 3PDIB 1UFKA 3KEOA 1KRWA 4WZBB 4NNJA 4M1SA 2RGYA 4CYDA 2BONA 2ABWA 3LA8A 1ZGGA 2HRZA 2FP3A 2IY7A 3H1TA 3I2FA 1UBJS 3E9MA 3FHJA 2FDFA 3VOSA 1SPPB 5BUSA 1OHFA 1QAOA 1LI4A 1IY9A 5IUJC 1PO7A 4J4TA 1IIRA 4ZA2A 2F90A 1DC3A 5CR9A 4XFJA 2ZRPA 1L0BA 4E6PA 4U39A 3FW1A 3PJGA 1J8VA 2P35A 3E61A 2ZQYA 2ORXA 5JZ9A 4DRXA 2OV6A 1N6LA 4S05A 3ANNA 1F2TA 4DMUB 3BWVA 2NNWB 3K9QO 3INAA 4BNNA 1QV7A 1F2UB 2GZAA 1T2UA 4S04A 1UZZA 2UWCA 1JAZA 3GELA 3HN6A 1H4TA 4PYIA 3FGPA 3IT1A 4OHOA 1P4RA 4MS4A 2HK7A 1UWVA 3THYA 3DBIA 1COWA 1QKIA 4DE5A 5CGZA 2E32A 4CP9A 1LPBB 2W2XA 4XVUA 1H1LA 2HJHA 4DWJA 1W0JA 2UUAB 4O4IF 4HADA 4J1XA 1K68A 5J4VA 4EYQA 1M34E 4MRNA 2X9QA 4M3CA 4XSHA 4YNBA 2QBYA 3IPLA 3UT5B 4SLIA 2IPOA 3SZLA 2D8AA 1WNTA 3N6XA 2HK6A 2FRXA 3BWYA 3GDFA 1M2NA 1YOVA 3IQIX 2PK3A 2XCLA 1EUDA 1GTMA 4I3FA 3ITNA 1P61B 1E6EA 4MQBA 1RYZA 4JUIA 2H0AA 4RF3A 5ED4A 1JYVA 1YASA 1Z0UA 1P6XA 3K0SA 5HZGA 2CD7A 4UHDA 1T1JA 3EAFA 3J7AC 1Z12A 3AYDA 2B82A 5HGJA 3FOWA 4TTAA 5F5CA 4XURA 3L6CA 4L5BA 4U8HA 4W5WA 1JBQA 3ZTWA 2D3WA 3L1JA 4KXFB 2H85A 4EX6A 3W1VA 3ACGA 2ZCJA 5F1RA 1JA0A 4B75A 4JTNA 1QDOA 1NU8A 1BEV2 2IC1A 1JODA 3E70C 4BNLA 2LROA 4ZEOA 3ELYA 5CHYA 3Q98A 1WBDA 1H5QA 3RUPA 1PT7A 3LQYA 3IAEA 2VP2A 4L73A 5JQGF 1LLQA 1N6HA 2QAGC 3ZCSA 1AR93 3MMXA 1D8TA 1UL9A 1IB6A 2ZXEA 5I7AA 3H6KA 4RGYA 2AZXA 4HK4A 2PXCA 1ONOA 4PBSA 4RVGA 1P5ZB 4G0WA 2AGVA 4WCDA 1VA5A 3MYXA 5CKMA 1YQEA 2VZ9A 1KFBB 3ZSMA 4PX9A 3KD4A 1AJKA 2ASEA 5EJ3A 4Q4HB 1DSS