2WAOA

Structure of a family two carbohydrate esterase from clostridium thermocellum in complex with cellohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
GILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDSITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE E
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2waoA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2waoA02
4JKOA 5JUVA 1O8PA 4BXSV 1JYNA 3WF3A 2V72A 1OF3A 3EYPA 3NQHA 3WNOA 4DXRA 3BGAA 1J84A 2B9VA 1NUKA 1SHWB 2QQMA 4LPLA 2E33A 3I3DA 4JHZA 3IAPA 3T2PA 2CDOA 3CIHA 2VZVA 5EJ1B 1SG3A 4JKKA 1PMJX 1GMMA 2DCKA 1K45A 3MUZ1 4XZUG 5JXJA 1O59A 2XQXA 2QQOA 4E8CA 3DT9A 2OKXA 4OUEA 1UYYA 1L7RA 4A41A 2WN2A 4ET7A 2R7EB 4MGQA 4LQRA 2WZ8A 2LW8A 3K4DA 2VMFA 3I2FA 3WNLA 3DCIA 3EB7A 3VD5A 3DT8A 1K42A 2YG0A 4TTGA 3HNMA 2HSJA 2WAAA 2VPTA 3C7GA 3THCA 1KEXA 4OZOA 2J1AA 2YC4A 3DECA 1F4AA 4XUQA 3CMGA 1NAEA 3NRUA 3MUY1 3I2JA 4QB2A 3VD9A 2WABA 2J1VA 2J1RA 3I2IA 1DYOA 4OAOA 3K4AA 2WUHA 1GQPA 2Y6LA 3KVNA 1VYHA 1T2XA 1ULOA 2W5FA 3LEGA 3K4ZA 1JU3A 1L7QA 4PQQA 3T2OA 5JXHA 1JYXA 2B4KA 4JJ4A 1BWRA 2V5DA 2W47A 2VR4A 3ABZA 2Y64A 2C26A 1U8UA 3UESA 1DEXA 4BK4A 3DT6A 1UY4A 5JXIA 1W9TA 2V4VA 2Y6KA 2QQKA 2VL4A 2Z4FA 3MV11 1UYXA 2RVAA 4ZXEA 5DQ0A 4ARXA 3NJXA 2VZUA 3D3AA 3WNMA 4D8MA 2YFZA 3LQCA 1JZ8A 3CZJA 4XUNA 2JKXA 2WO1A 3LPFA 2W87A 2ZEZA 1JHJA 3ZM8A 2VZQA 1GU3A 2BBAA 5J1XA 1CZSA 2XONA 2J7MA 2WBKA 2VO5A 3ACGA 4QB6A 1UY2A 3DYMA 3DC7A 2VQUA 4GWIA 2Q0SA 4CUAA 2DDUA 3A7QA 2WN3A 4ARYA 2J1UA 5B4XA 3OG2A 4MGSA 4CVUA 2RJ2A 2QQJA 1EUTA 4QB1A 4RW0A 1D7PM 3ACIA 5A1AA 1W9WA 2W91A 4K40A 3HN3A 3GM8A 4QAWA 1IVNA 4P08A 3RJTA 4H08A 1ZMBA 1JZ3A 3JXSA 4DUWA 4L0PA 1CX1A 3DYOA 4OMDA 2YFUA 1JI6A 2WO2A 4JX0A 4A45A 4A4AA 4AG4A 3ACFA 2WZEA 4YPJA 2W1SA 4P00B 3A23A 2WQ8A 1ESEA 1K12A 1KGYA 4QPWA 1EUUA 2Y6JA 2E32A 2VM9A 2W95A 1RYYA 4KWUA 4DXSA 3C7OA 1XNAA 1ES9A 3FHAA 3T08A 1W0NA 2WDBA 2APJA 4TX1A 3J7HA 4IUGA 1DP0A 5A4AA 2WO3A 3SKVA 4XURA 2CDPA 3ETPA 1V2GA 1UY3A 5IFTA 3MV01 4Q9AA 3A22A 3OB8A 2BERA 3UNPA 5LA0A 4HYQA 2VMDA 3IAQA 2EIEA 1UMIA 1UXZA 3WNNA 4DEQA 4TXWA 1PX3A 4A44A 1UWWA 1CZVA 3ACHA 3F2ZA 5JD3A 5HOEA 4CUCA 4A3ZA 3HEIA 3C7EA 1ULPA 4BJ0A 1WABA 2VCCA 2ZEYA 4QDRA 4JJ6A 4A6OA 2W3JA 1MPXA 1DLCA 3LEIA 2J1TA 4QX0A 5DPNA 3VD3A 5JR2A 1JZ4A 1UMHA 1GNYA 1GOGA 3FHQA 4RYDA 3MILA 1UYZA 2ORXA 3WEZA 2W92A 4ZY9A 4W50A 4K3UA 4NRDA 1JZ5A 1OD3A 2VZRA 3DYPA 1CIYA 1W99A 4UAPA 2LS6A 2VCBA 3IIIA 4A42A 2HLEA 3AC0A 3HJRA 4QDSA 4CU6A 1UXXX 4CU8A 4M4PA 4OYUA 1GUIA 4XUTA 2VTFA 3OEBA 1JZ2A 3U37A 1BWQA 3T2QA 2C4XA 3SEPA 2WYSA 3WQBA 1UY1A 5F7UA 1OH4A 2J22A 5I0DA 2QBXA 1W8NA 2VZPA 2VZTA 3T0AA 5IJRA 3A21A 1K7CA 3HNYM 3I2KA 3GDBA 3UETA 5C7GA 2L9LA 4LHSA 3LPGA 4GZ9A 2X10A 3T09A 3W5NA 2QQIA 1OF4A 2O14A 2YB7A 4DXTA 4DEVA 1LNSA 3PUHA 4LKSA 2YC2A 4CU7A 2ZEWA 4JHLA 4M8KA 1BHGA 5IHRA 3HNBM 4P5YA 5FUIA 1DEOA 1XC6A 2J1SA 4QX2A 4GWJA 2EIDA 3WNPA 2VMEA 3PUIA 1GOFA 5G05L 2QQLA 4FI9A 2WAOA 2X05A 2VZOA 4PT6A 4UI9L 4KI5M 4P02B 5G04L 2VQTA 2Y6GA 4K9SA 3IDAA 1IQDC 1TVGA 4OAPA 2Y6HA 2VZ3A 1FXWA 1JZ7A 3SEEA 3P1IA 1OT5A 4XUOA 5DN2A 1W8OA 4MADA 2W1WA 1YQ2A 5CZKA 1BWPA 1GOHA 4OMCA 1US3A 1H6XA 2E31A 1WKYA 1JRLA 1F4HA 1TG7A 1UY0A 4XUPA 4CU9A 4AAXA 3VDCA 2W9XA 3MO4A 1WCQA 3CKHA 1I5PA 4JGGA 5IYYA 1CZTA 5LA1A 4UOJA 4QDQA 3BZWA 4S1PA 1PP4A 2BZDA 1R64A 4W4ZA 3FN9A 4M4RA 4Z2AA 5C71A 4XVHA 4IYJA 3C1UA 1P8JA 4PPYA 3ECQA 5HXMA 3VDBA 4D0QA 1ESCA 2RV9A 2X09A 3MBWA 3BN6A 5LCWL 5C70A 2W94A 2W46A 3K75B 1XNTA 1PX4A 3WF4A 2VCAA 2J1EA 4CUBA 3OGRA 3LE0A 1JZ6A 4QX3A 3WF0A 3PT5A 2ZXQA 4QX1A 3I3BA 3T0BA 5IFPA 4PF1A 3WSOA 1JYVA 3P6BA 3I2HA 1Z8HA 5DMYA 2JD9A 2HYXA 2JDAA 3T0DA 3FL7A 4K7JA 5EJZB 3VD7A 4ZZ8A 1HN1A 1UZ0A 4Q7QA 2Y8KA 3I2GA 3OEAA 2XOMA 4ZZ5A 3I3EA 3VD4A 3C7HA 3SLRA 2W1UA 3THDA 1H6YA 1US2A 3WNKA 4JKMA 4MO3M 3VDAA 1K3IA 3GXUA 2VMCA 2VZSA 3C7FA 5B4NA 5LA2A 2VJXA 2VC9A 5CD9A 3CZUA 4RN5A 5CYYA 2E26A 4BK5A 4BDVB 1O8SA 3W5MA 3K77A 3HPNA 4HF7A 2ORZA 5B5SA 3K46A 2JE8A 5HPOA 3WF2A 3NNGA 2QQNA 3WF1A 1VJGA 1JU4A 2EIBA 1UX7A 2Q0QA 1XPWA 2W1QA 4JKLA 3OGVA 2DCJA 1FXWF 3HP4A 1W9SA 3NJVA 2ZEXA 4KMQA 2VZ1A 3SKJE 3HOBA 1NKGA 2VOTA 3GGLA 3W7VA 3C8XA 4RSHA 2C9KA 4I8IA 5JMOA 3OBAA 1J00A 4E8DA 3E1F1 3P94A 5JXGA 1NX9A 1YZFA 1PMHX 3IB3A 2BGPA 3LEKA 4DUVA 4HG6B 2BGOA 5EIYB 2KD7A 3CDZB 2ID4A 1J83A 4DUXA 2XHNA 2PQSA 4MOAA 3I97A 3CQOA 2EICA 1JYWA 4W8JA 1SDDB 1ESDA 3OGSA 5BN1A
chains in the Genus database with same CATH superfamily
3JQWA 2HTFA 3CS3A 4FQ8A 4RVOA 5A5EA 1OIVA 4RMJA 4ZJPA 4B83A 3EVNA 3DBLB 3L7YA 1C5HA 1ST3A 1ND2A 1X3LA 1UJBA 1CJMA 1AS2A 1WMSA 1IN4A 1LF0A 5GM0A 1QRAA 4MS3A 1NMEA 1M72A 3DT9A 2WYOA 5K6RA 1ZCZA 2A6ZA 3UC9A 1XVUA 1PEAA 2I3BA 2H1IA 4AWAA 2EJBA 2NAPA 1YIAA 4FSXA 1TMKA 4EHJA 4WFKA 4L2IA 3QWHA 1Y7HA 4MWSA 1XTZA 4ES9A 4WVMB 1LJ7A 2PYDA 4R9VA 4QTTB 3RR2A 3P0HA 2BGLA 4P5EA 4NV3A 1K8QA 5EY5B 1XQ6A 5DFAA 3PWTA 2W87A 4H0FA 3LT1A 1D4M2 4DJDC 3CW9A 1FRZA 4GOLD 2IV2X 4DBLE 1J99A 2ZQYA 3DYMA 2H4ZA 4KWEA 2YRFA 3AP9A 4MGHA 2DXIA 3MLLA 3VM6A 3ZE7A 3CVXA 3HCCA 3MMSA 4H3WA 3C43A 1RCFA 4JLUA 4FLEA 3TAYA 3M6IA 3ABIA 5EIAA 4YJ3A 4RA9A 3THYA 3TGLA 3L82B 4Y1XA 1B1CA 1G9BA 1W6PA 1PZEA 1GDTA 2AGVA 2XZTA 2CGNA 4D8YA 3H97A 3DEYX 4ODIA 4IF6A 3VKWA 4FXPA 4XDYA 1YHFA 2HSZA 4Y22A 4Z0PA 1AL23 2JDUA 1CUWA 2A9JA 5J63A 5CCEA 5AVZA 5EFUA 2A6PA 2BPA2 4UEWA 2R1VB 4FZVA 3E5MA 3GHMA 4AMVA 1TJYA 2ECQA 4BOYA 1NMSA 1SPXA 1PD1A 1TD1A 4RIGA 4IJVA 5EHGA 3G13A 4EY8A 2VZRA 3GEGA 4QX7A 1VHWA 1K0UA 1JKIA 3B60A 3RQ0A 5G4KB 1UBLS 1KEWA 5ALWA 8ABPA 1YHNA 1EFUA 3O14A 4D46A 1J2TA 3RODA 5JXWA 1QG4A 1XFAA 4RDCA 3MLBA 4CM4B 1OWMA 3ZZUA 4IS2A 5JNLA 1CLUA 4EQVA 4Z9FA 1CK4A 3LBYA 4B48A 4Z4IA 3O1RA 2AH5A 5FO1A 4ZYLA 3BIWA 3OZ7A 3U3ZA 2Q7DA 4KQ2A 2GBLC 3I6IA 3R41A 3OZGA 2CHGA 1IS5A 4PYMA 1GOFA 1YZHA 2ZIGA 5LEJA 1QDEA 2ZBDA 5BNPA 5FO8B 5EQDA 3KAKA 2XOKD 4AYXA 5LBIA 2JJYA 5T50A 2GETA 2W39A 1OQ1A 3TBHA 1Z6TA 1MX9A 1N5OX 1Q8VA 3JYHA 4RV5A 4B8YA 3KT7A 4R1QA 1QAQA 5ERGB 4E46A 3EIXA 5DT9A 3V7NA 2R751 1ISIA 1CIVA 2PJUA 2VC2B 4HZUB 2E7TA 4EFDA 3W59A 2YJGA 2BFWA 5HM6A 3VNAA 1HL7A 1VCHA 4L11A 1W87A 1GWKA 4FDUA 2ET1A 3WF0A 5KTSA 2D5LA 1WULS 5I9NA 4WERA 1BCXA 4R2HA 3NHLA 4J9UE 1X94A 1R6TA 1QCYA 1GUFA 2AG6A 5FFOC 3HXQA 2F3UA 5F7OA 4L5AA 4YP7A 4MO3M 4WXHA 3WE7A 3NBFA 4KWTA 3TNDA 1QOOA 3OESA 5A5VA 4PNZA 4C05A 2OPKA 5IW0A 2GZMA 4QAQA 3G82C 1UPSA 4LZNA 3G0GA 5E6SA 4UAJA 1FFGA 2E9SA 1YJ5A 2CWDA 1E9AA 4OHPA 4UHFA 4U7HA 3IXLA 5B3LA 4RENA 3SWWA 4EAQA 3ZBUA 1E1YA 2Q28A 1YKFA 1KS2A 2CMKA 1NA1C 3ZS9A 2IYSA 3K0AA 2NZJA 3QVLA 1W1WA 4IJWA 3A1TA 4MQUA 3ADPA 1AGNA 1C8KA 2R60A 2X8LA 3CQOA 1C30A 1CVIA 4PLTA 3T3DA 3O9VA 1AVTA 5D8DA 1W0OA 3FRHA 2V72A 1OF3A 3OF1A 3DL4A 4DLUA 1DRWA 3O1TA 2KW5A 3CUYA 1EP0A 3I04A 4YG3A 4LMBA 3AP5A 5EJ1B 1SG3A 1X50A 2X4DA 4XTRA 4KQIA 2IU3A 3WIOA 4HQKA 1G1MA 3HMKA 1BGWA 1C1LA 3D5QA 1L7RA 3K1TA 2R7EB 2OCKA 1E2HA 4MAAA 1SHTX 1A3CA 4EJFA 4U6QA 2CNKA 3SYNA 3LPDA 1EBUA 3CVJA 1BMFA 2J1VA 4AF9A 4LF7B 3EYWA 1B16A 1ENPA 2H1LA 4YUAA 1K86A 1RM3A 5FZDA 2GM4A 4ND5A 3HB4X 4G67A 3TCNA 3GZ4A 4AHYA 4FDVA 3QIVA 1BE8A 3P4YA 2JKXA 3PNSA 1KU6A 1NKVA 2YIJA 2WZBA 1SQFA 5JQWA 2ZTUA 3BTAA 4WY8A 5L51A 4QBFA 3INTA 4CJXA 2BGMA 1COV1 5LBTA 3FR8A 1IBLB 4FO9A 1VRH2 2F8LA 4QDTA 4HETA 1WL8A 4MVJH 5IC6A 5LBCA 4HQ6A 3AUYA 3FKSA 1UQUA 2GWRA 5F39A 4QATA 2CE7A 5JNRA 1GGEA 3ROUA 4GP9A 1K12A 2CNOA 2D5HA 1S89A 1K0FA 3CO0S 1CX4A 2BLNA 1S2EA 3J7TA 3VKFC 1VG1A 4N5MA 4IEUA 4V0SA 5BNQA 2D0OB 1KVSA 3NWJA 2PMFA 4B7EA 3OD5A 5E88A 2QQ5A 1NP7A 1GTRA 4IIGA 1IONA 1CEXA 3IBMA 3R0RA 5CA1B 4CXXA 1UFKA 5JD3A 1P1HA 2FCAA 4IMRA 2LWIA 3AUKA 3ZJ5A 4PNEA 4F3JA 3KSMA 4I5GA 2HXSA 4JSRA 2YCBA 1AKTA 1E79D 3EUAA 1VL1A 4GUDA 1G8YA 1TVCA 4YH1A 1NE7A 4HG2A 4KR2A 2XVLA 2AFHE 5AKEA 1NQWA 4UAPA 2JA1A 4IZOA 4XXHA 2IHTA 1XDDA 3ZY2A 2WDPA 4P35A 4E07A 1CD3G 3DLPX 1KRWA 4H31A 3H0OA 1HURA 1N6RA 3T9EA 3NM6B 2FCUA 1Z6YA 4G36A 3OLWA 1LDYA 5J96B 3LT0A 3PC8A 5FYCA 1C30B 1YEWA 1RLUA 1LF5A 2MR5A 5CFNA 3BH6A 3QTBA 3RVQA 3O8DA 3UO8B 4DEVA 5D8AC 2F90A 4GS5A 4WVMA 1IDOA 1KJLA 1USVA 2C58A 5GADl 1S2IA 3M6VA 3AHCA 2AUYA 5AJTA 2BBSA 3QEMB 1JPJA 2GN0A 3JQPA 1TVGA 3SMVA 1C7EA 4G0QA 5A3QA 4ZC8A 4B4RA 1GFF2 1YD7A 5GV7A 2HV8A 5T4BA 2D97A 3CRZA 3FLPA 4KWJA 1W88B 4LYEA 5C5CA 4N39A 1UJ4A 3GVPA 1BMV1 2P7IA 1JEYA 4DOMA 4IEZA 1GQFA 1DRUA 3UPTA 2AZ4A 2BOJA 4JI5B 1CY1A 3UM9A 1RI3A 4O0MA 3ED1A 3EHDA 1IVSA 2DULA 3TMKA 1E4VA 2FZKA 4WM7C 4E4SA 4LRQA 4BTLA 3IUBA 3SZGA 1JDJA 5EJZB 2HBUA 1WB6A 4NU5A 2O8DB 3NZEA 2YHIA 3NVDA 4Y1RB 1MGOA 2HJHA 2LRPA 1PJCA 1PJ2A 2IY8A 1IM8A 2RS51 1HT2E 1L6RA 2CVFA 5IUKC 1Q1AA 4PIZA 5ALPA 2O2XA 3KVAA 4CF3A 2CDNA 1JAHA 2JW5A 1PTKA 4H3HB 1C3HA 2WNEA 1K6XA 1KQRA 3TIIA 2QR2A 4BDTA 3OYWA 2ORVA 1VB4A 4TTQA 5EIHA 2FW7A 1T8WA 1JWLA 1KAOA 2WJYA 1QGED 3HWSA 4G4IA 2O8FB 2HWC3 3M0EA 2IE8A 4KO4S 3R7WB 1Y43B 4KMSA 4N9QA 4HAZA 3QBVA 3GUZA 4JUBA 2R8RA 5DHRA 5CFQA 3TUIC 4PDWC 5ALMA 3AINA 1X8EA 4HDRA 3SGLA 4M3CE 4PLHA 2FEWB 2BMVA 2D1SA 4Z2WA 1ESMA 3OBIA 3B1YA 2VQSA 2XY4A 5DO9A 1K45A 1EK5A 1RM5A 1Z47A 2VVFA 5EQFA 4AS1A 2OHIA 3I59B 1NRXA 2LCQA 4F3RA 3OIGA 2DM6A 3E6AA 4HEJA 2W2LD 3C5WP 1K8YB 4BYYA 2FWIA 3LIGA 1A78A 4LI3X 1ZMTA 1FYFA 1VLNA 2JDZA 4N3GA 5BV1A 2IXBA 5CXQA 2UVPB 3JQ8B 2C26A 1DFHA 3HYCA 4IGQA 4JC5A 2OBYA 2R7LA 4Z07A 4XLTA 1UMCA 1AGRA 3CZJA 2OHJA 4CMBA 2WF8A 1AXZA 3F6CA 2BFDB 2JC3A 1GZVA 4N7BA 3LFIA 3ZGNA 1Z0FA 4HDMA 4LXUA 1WA5A 3OC0A 2VATA 1T9BA 3U4QA 3R8XA 1EXNA 3TRIA 4BJ6A 2NXWA 3B7WA 4KV9A 5HF6A 4XFHA 5FCDA 4N01A 1NLMA 4XWAA 1FDIA 1Q0TA 1D2GA 3ZKWB 4I4TA 2G4IA 3MT7A 5CG9A 1F20A 4QYTA 2JGJA 4OM8A 1TD9A 4ZODA 2PN1A 2WNUB 3DTYA 2VAUA 2WPDD 3FNRA 4RA6B 1IY1A 3KWLA 3Q3IA 4IJQA 3LZZA 5CVVA 3FN4A 4AWXA 2DWCA 2BFOA 1BDMA 3FROA 1LHUA 1COWD 3TRFA 3IAFA 4LOHA 1P9RA 1VHLA 1I3NA 1SD5A 4M0PA 4CEHB 1VAVA 1MDBA 2WZR2 5EHDA 1T6GC 1OVPA 2FKNA 3OTHA 5M2QA 4K3UA 2YWHA 3QEOA 5DHFA 4PIPA 3I49A 4QGFA 2YV5A 2GZ3A 2UAGA 4J0KA 1XXHA 4Q05A 2CTVA 1QK3A 3ZLUA 4NVRA 4HX9A 1D2RA 3EH1A 5IVIA 4YCAA 3Q0EA 2A9QA 1TTTA 2ZJ4A 1P6XA 3D8UA 4N43C 2KB0A 4YJHB 4YRCA 3I3QA 3HQ4O 1URPA 4BMCA 3ESRA 4G0UA 5J1SB 2FEXA 1NMZA 2FZCA 3S2FA 4I46A 4IDDA 5JUWA 1KBOA 2XUMA 3BXFA 4JROA 5IDYA 3HDJA 2LD4A 2A5ZA 3GNLA 3R75A 1R0KA 2X0FA 1WD7A 4OAQA 4K9PA 4ZS3A 1KAQA 1BEV3 3JRXA 3D5EA 4Y7DA 1ZRRA 3A2KA 4OQNA 4GLBA 1Q2XA 4M9ZA 3H11A 3B1FA 5SY4A 4JRLA 1KYIA 3L9XA 521PA 4OUKX 1UOJA 2W9XA 2WWJA 2BBVA 3MWDA 2VDMB 1WMEA 2W2KA 3FN9A 4RYLA 5L53A 4GYYA 1U5BA 3ZE2B 5LUBA 3B3FA 3ZI4A 1TQ2A 4XOGA 2V1XA 4KDRA 4GAZA 5EJEA 1A8IA 1TM5E 1QP4A 3DLTA 3QVJA 1JKMA 4V24A 3PNMA 1WD5A 4IKPA 2TYSB 2PEZA 2SHKA 1Z6PA 3R3HA 3S8EA 2NZ8A 1VP3A 3BTYA 1PZNA 4OL9A 5DV9A 4W6YA 2PQ2A 2IEYA 3SY8A 3WIEA 1XYPA 4CSWA 4WLOA 1QFZA 1M8GA 5BVGB 3WISA 4HL6A 2E26A 1QIQA 3T5DA 4CZSA 1DARA 3WF2A 3NNGA 5J2UA 1DRKA 1E2DA 4XRRA 3K2BA 3OIVA 1AR71 1XZMA 3T0GA 2RB5A 2GYUA 2B61A 2FSUA 2J9FB 4FONA 1W04A 3ZFEC 2CLLB 2CVPA 1JQDA 1P77A 2Q8EA 2PLV1 1NT2A 4G24A 2OV1A 3PNKA 4DIUA 3BTOA 1DBRA 2GP5A 2D5FA 5IVKA 1MPTA 3DXXA 1TNFA 4A27A 4RLQA 2NYVA 4JQCA 4YUWA 4NK5A 3C3VA 4LI0A 3L1IA 1IMJA 3NB0A 4YT4A 3R05A 4QLAA 4ND8B 3COWA 1ST8A 5FUMA 3RYTC 3VHNA 4MP6A 2HFJA 1N6LA 5ANNA 1E63A 2JFGA 1SURA 2P3LA 2XLBA 4XZUG 4NCXA 3H5WA 5E9JA 4AE2A 2HV9A 2HYKA 4Q3LA 5LXTA 4R1LA 3FRJA 1OBNA 2A0YA 4N8MA 5ARDA 3AFKA 4CFSA 3ACBA 2J9YB 2WY2D 4Z9YA 1RMTA 3H7JA 3B9RA 3L4KA 3IBCA 4OBXA 5F37A 1ULOA 1CF9A 1EUCA 5D00A 1J22A 3BPSA 2I65A 1OBOA 2VO1A 3DE1X 3NNLA 3QE0A 4OPMA 3C6KA 4S0XA 4C4OA 5CG1A 3UHJA 2IGTA 2P5TB 3VSAA 1U0NA 5MFZA 4N7RA 4MLCA 2CHHA 1D09A 4AW7A 3KXLA 3P19A 3D6UA 2VMGA 1HXS1 3C3CA 1ORDA 1ORWA 2QUJA 3OLZA 1YZKA 3DD1A 1TKRA 4EYEA 4TN7A 1E2MA 4E2YA 2W91A 3C70A 2XCLA 3LPMA 2ZX1A 2XJUA 2RGYA 5ERXA 1ZREA 4RTKA 3OTWA 2BQPA 1LLQA 2WUWE 2DOKA 4GEKA 3D8TA 1E5IA 2LTNA 1XK6A 1DJOA 5AVAA 5B1DA 4BQ5A 5D3MB 2ZJ5A 4MQLA 3OM0A 1VBD1 3REFA 2C7PA 1ZJYA 1UPCA 5LYJF 5LD2B 4EV0A 2HCFA 4QU1A 4DLRA 2FB9A 1SC6A 1X86B 2RHGB 2ZAYA 3B9QA 2XDYA 3KQTA 1F15A 1HRI3 4FX5A 3AIIA 5A0FA 4CEHA 4RHTA 1ZR2A 3PQ5A 1DLCA 2NU6B 2B8EA 4QDOA 5A0VA 2NZYA 3JYLA 1BHQ1 4QQNA 3DYPA 3QUAA 4O4LA 3FOZA 1AQJA 3TTXA 4DCTA 1EZ4A 5EP1A 1QXJA 4YVWA 2O8EA 4OB8A 3NV9A 1RHQA 2HWB2 5FPLA 3TPZA 3CJRA 1XOYA 4CCDA 4ARSA 2HQBA 3G9XA 3BU7A 4HRVA 1V00A 1Z7WA 3CLTD 3G5TA 3DFZA 4GKXA 2BVNA 2GCOA 2GJ9A 5FMCA 4M8KA 4TWIA 3R6LA 5BSGA 2NTEA 4PFKA 4Q4X1 1I1HA 4UI9L 2FUEA 3OFND 2R1VA 3VHXB 4PLPA 1POWA 1ZM9A 1TNRA 4RD4A 4TL6A 3QVGB 1V6LA 5JJCA 1JN0A 1TF2A 3VAAA 4PO3X 3BRSA 5G0TA 2DBQA 4JC4A 3D1JA 4NIAA 1KRXA 2XXAB 4TRNA 5FPAA 5CIQA 3BIEA 1EJ0A 4P98A 5DTRA 4CQMA 3GFRA 1LULA 2O8EB 4E94A 4HGQA 2QAGB 1S55A 1B73A 4Q4W2 5I8YA 3OE4A 4HMQA 2ZSFA 2B8TA 1RLTA 3TRJA 1QB7A 3H87A 3ZMNA 3VR6H 1UWKA 1JH9A 1SU4A 4LVNA 1WB4A 1ECGA 1VB3A 3W5SA 4EGAA 3D6NB 4DNFA 2XMSA 2JFOA 2R47A 4AJEA 3TB4A 3AYCA 2OCIA 4Q0SA 2Z3ZA 1Z35A 2XQFA 2FZGA 2EP5A 3GAFA 1M67A 1CUAA 1A5SB 1DFIA 3L8FA 3MBIA 2JLWA 2I2XB 4PZZA 2HWE3 2DFNA 2FWNA 4N5IX 5D5PA 4ZTBA 2AN3A 3ZNPA 4C0BA 4NEGA 4JP1A 5KQGA 4MX8A 1I2CA 3MEQA 4ND1A 2DE0X 3BAFA 5FPSA 4Q5IA 2YU2A 3W9SA 1ONPA 1ELOA 1JHMA 2NTJA 3N0RA 3AUTA 3LDAA 4KNWA 4V0RA 4HOYA 2Y2UA 4J43A 4HS4A 4X8OA 1G8KA 3DBVO 8AT1A 5I7AA 3NYRA 4CEWC 3TOVA 2C84A 2W6OA 3OEHA 3M4FA 2GEKA 5F1KA 1ZZ9A 3D9QX 1FJ2A 4HFNA 1A34A 1Z74A 4QTYA 4NY1A 1FC0A 1YDMA 1CAUB 2WHPB 2ZXUA 4Q1AA 2UWAA 4KQGA 3A6PC 1Y1SA 3PHMA 3UK0A 4KGDA 3RHZA 4J2HA 3TQSA 1PG0A 1UXKA 1OIWA 1WZUA 1AXKA 2J7PD 2XXJA 2WN2A 5ENVA 5IFLA 5TPZD 1E7MA 2OQRA 1T1GA 3AF5A 4IDHA 1A9PA 3JQAB 2VH5R 1FLAA 2DWPA 2ZYUX 3A6GA 4F3KA 3ISVA 3IUSA 5B4UA 1APNA 2BYVE 3NO8A 1RLJA 4OYHA 4UF0B 4J6GA 1NMYA 3D6MA 2YC4C 4LWPA 5EHQA 1C7ZA 2GESA 3F8WA 2QX8A 1V45E 1H0HA 2Z4FA 1T9ZA 3I4CA 4LBYA 3N8IA 2BJHA 3ASZA 3LBIA 1SBNE 1MFZA 1WLYA 3GFPA 5LL6P 4U0JA 3LMKA 3OBTA 4LJSA 2L69A 5LXTF 2XONA 2GKSA 4LOKA 2ZYHA 5L4LA 3TW4A 5A3PA 2ZJ0A 2EZ9A 5AM2A 1CJSA 1QIFA 2DPXA 4N7UA 3HB0A 5CCDA 4M7PA 3ZG6A 3GYDA 4KTTE 4HVOA 2H4YA 3E9QA 5GLZA 2BGGA 3AP3A 4FYWA 3D8BA 2HYDA 3O7WA 4BQ3A 3AM4A 2O5EA 4FR2A 2NVOA 4R3UC 3CXRA 4R41A 2YBKA 1OFTA 2V7UA 1GKYA 5CVRA 4O2AA 4FPXA 2WUVA 3ZNQA 3ZPOA 3RNOA 3N8HA 1I13A 5HILA 4WBNA 4WXRA 4ONUA 3NNDA 1KEUA 3STWA 3NNFA 2ECOA 2ADMA 4A2PA 3ZX7A 3TIFA 3IAAA 4Q6WA 3KXIA 2OO7A 5IAOA 4I1PA 4ALNA 4QDRA 2B9EA 4ATEA 2Q6LA 3NKVA 2A33A 5COBA 3NIDB 3ECSA 3Q4GA 3RADC 1ULFA 4YRLA 1NG9A 2ZT5A 3B7MA 1GZ5A 2IVZA 1KHTA 5BNIA 4HK8A 2W22A 6REQB 4X90A 2XCIA 3FVWA 4C4TA 2NOAA 2G04A 1U8CB 3HXPA 2JGIA 4FP2A 2Q5QA 5A3NA 1YI9A 3QP9A 1C7JA 3IDBB 1NCQC 1UOQA 4X97A 4FB4A 4RY8A 5LP6C 2AXEA 3O2JA 3ZJUA 4Z3KA 1WHTB 3HBJA 1MQ9A 1ODNA 3M4YA 3RARA 4J1XA 1YKSA 4B7UA 2Z58A 3WGHA 2VG9A 3K4PA 2ZX2A 3TKLA 2XSZA 3HDTA 2X0KA 1M2WA 5FZMA 1BN6A 4XARA 3AVRA 2BGTA 1Q3TA 1Q77A 5CAEA 1LS1A 3N28A 3TLCA 3PT9A 1YZQA 1W19A 2X1VA 2YN4A 1MTOA 1L5QA 4PCRA 2GJKA 3I5UA 4PHZA 1BIFA 1D5CA 3DXZA 2IXJA 3C6BA 2V4ZA 2UU8A 1IAQA 2IYFA 2BEOA 1OH8A 1QE0A 2BJSA 2Z1DA 2J5RA 3DB1A 3OF3A 5PGMA 3TLJA 5BN5A 4PPYA 2UDPA 3ZC3A 3P9NA 1XNGA 5DHAA 4ISCA 2RV9A 5JS2A 5EJIA 3TZCA 1XQWA 2RDQA 1SBHA 4YVWC 2ZCJA 3LE0A 4RMGA 5L95A 6YASA 16PKA 4A0GA 3JB8A 3HR4A 5ACA3 4TLGA 3M9LA 3VHLB 1XD2A 3FNHA 4G0XA 1M33A 2IYYA 3RZMA 5A06A 2XOMA 5L7OA 3TJMA 1DXYA 4JKMA 4BO8A 3P0FA 3HQRA 2PS9A 4JJEA 3WVNA 1W6OA 3PQ8A 3R09A 5ELXA 2IXLA 3W5MA 1PGPA 3A4TA 1A7KA 3G2MA 4BQOA 1E6LA 3KT4A 2AWOA 1JB9A 3FYHA 3CR7A 5KO2A 3RT9A 1OXXK 4MGKE 4B29A 1KJIA 2F3RA 3PEWA 1HXS3 1W5BA 1L5MA 2VD7A 4G65A 3WLTA 1N2XA 2PZFA 4EI9A 5A03A 1MO5A 1Y8QB 2GAAA 5KR7A 5I4CA 4YDQA 5T3NA 2DTEA 4HNQA 2YS7A 4K5QA 4PCAA 2RR13 1IRIA 3L1HA 4UBNA 3NAQA 1HRKA 3FZYA 1FUEA 4QGGA 1J84A 4EKDA 3CBNA 1V8PA 3FDFA 1Z4PX 5GZ3A 1P7CA 4FYPA 4M0UA 5ISMA 2JDYA 2A75A 2DBIA 4INDA 2RDRA 4AMYA 1KKMA 3UT6A 1NZFA 3GUCA 1G21B 1OWLA 3M5CA 4K0RA 3MD9A 4YO8A 2PMEA 3TW6A 1GPUA 5I8SA 3PGJA 2EVXA 2WIGA 4UVDA 2G7MC 5A3SA 2ZRKA 2EKDA 2ZBEA 1WUVA 3DE7X 3IRUA 4K0KB 1ACJA 3F3KA 3AEKB 1T2XA 3K4ZA 1PGW2 1Z2EA 1UC4B 5LA6A 3FDZA 3RUFA 3ROEA 1I6MA 3K3NA 2B39A 3L79A 5ARCA 3BXZA 2JDID 2H63A 2A3NA 4NCIA 4JUAA 5C9AC 2LIPA 2GAIA 4O4JF 4HDRB 3WNMA 2Z42A 2IBTA 3MVEA 2FR0A 3SLIA 4YZ4A 5DUUA 2NO5A 5D3KA 4CPDA 3IP8A 2QGFA 4YZ1A 5ESDA 4ME6A 2IWGB 4IINA 3A4MA 1U7ZA 2DB3A 4XQ4A 2O2YA 4XYGA 2ADDA 2ERXA 2OXRA 2C82A 1DZQA 1GL9B 1RCUA 1FRNA 1OHHD 4UUAA 1IY2A 1OSNA 5SV2A 1ZXLA 1T36B 2I1QA 2W2QA 4BQPA 1T1RA 4D3ZA 3WR0A 1DQYA 2G1MA 1RYBA 3I2DA 4Q4HB 4KXMA 4M1QA 1Y9QA 2RJKA 3LIIA 4ZVLA 1R18A 4IEPA 3G5AA 4OX9B 3RYKA 2X13A 3JY6A 1AMOA 3QRWA 3I73A 1SVIA 2AS0A 4Y1RA 3UJBA 4LV5B 5BRJA 5JDCC 1Y1RA 4Q4V1 3L4SO 4OHWA 1NJFA 2BKVA 4FFBB 1RP7A 1UXHA 5M04A 3E5NA 5CFMA 4EJMA 4Z1OA 3D8HA 4L4SA 2HWWA 4WM8A 1P0PA 4UT5A 4KYUA 2P4EA 4QGBA 4RZ3A 1QRRA 1PWXA 2V96A 1C7FA 5L7WA 2CXHA 1X9GA 3ZTYA 4MUEA 1EKXA 1KYYA 4NVPA 2P2ZA 3A1WA 4CYMA 4E70A 5BW5A 1VZ2A 3KZKA 1F2DA 3SVLA 3UHAA 4YM0A 2AVNA 1F0PA 3GJSA 4TRJA 3HY3A 3VKUA 3ZSEA 4RL6A 1I4DD 4K6FA 2B42B 3ZR6A 4ZOLA 1QFSA 3OGGA 2JLZA 2JLBA 5EWMA 4G1BA 1PR3A 2QD2A 1CP2A 2ZHKA 1PFVA 1QBGA 4WHMA 3VR1A 2D8MA 3DMPA 3TFWA 1U3CA 5DUVA 5T7BA 1H4GA 1TB4A 4L27A 1XNQB 3EEBA 4LZLA 3ETDA 5A6QA 2H57A 5JSZB 4XVQA 1MX1A 4W9RA 4ZVQA 4V1CA 3HBLA 5DOVA 1IXYA 2X5IA 3ZD7A 1Z5VA 4H77A 3FUOA 2XL9A 5E3IA 2XJ4A 4L2NA 4QUGA 3V8EA 4BNDA 1JJAA 3AETB 3LUJA 3USSA 4YAGA 1UIRA 1KI2A 2VF2A 3SZMA 5JMTA 4BECA 5FYDA 1DMRA 5AW1A 2QLMA 4X45A 3FJ1A 4OULA 3WKAA 4IO1A 2JLRA 4C4AA 3A2LA 2WKQA 4PONA 1MABB 4PIVA 3IP5A 4AR2A 1AYN3 4HX2A 4TMVA 4ZU6X 3HN1A 4OQMA 4WM8C 3EGIA 5A9TA 4ARZB 1HC7A 4CP9A 3ISTA 4DSUA 2XYRA 1SVMA 3SLRA 1VMDA 5HQJA 4QJ4A 2VZSA 2YROA 4RHUA 4RF2A 3OBRA 1MEC1 4DV2B 3F97A 4DMFA 5LDGA 1W76A 1DAMA 2JE8A 3TH5A 4CDQA 5KHAA 2WRAA 4Q4W3 1GFZA 3CPJB 3NVMB 4A8HA 3OZCA 4RACA 4AMGA 3V1YA 4RHEA 1KS5A 2E21A 3TDMA 3ITQA 1MS1A 2E49A 1JB1A 4UNIA 5AIBA 1NNSA 4BVBA 2YFHA 2I67A 1F9EA 4RGBA 4JDUA 2J5KA 1BTOA 1SHZA 3VU8A 3DW1X 3C3EA 2GEFA 2HF2A 4BN0A 9MHTA 5ALQA 3WF3A 5IYZA 1QHHB 5J59A 2D4AA 3OFVA 1IHUA 3B00A 2CJYA 3TVDA 2BNOA 2K87A 1DZIA 2BEJA 2ZRMA 3UXMA 1PT8A 4TOIA 4Z0NA 3WNDA 4CIYA 4Y33A 5F5XA 1WTAA 2BGCA 3RIXA 3CN9A 1UBEA 1IG3A 4RPLA 3NV7A 2VWQA 4R9SA 3C15C 2CMFA 4ZKTB 3O92A 4BE4A 3QELB 2BMWA 2IYAA 3IERA 2VR4A 2Q3LA 4FDMA 4QD3A 1L8AA 4GLJA 2NACA 2W6IA 4ZOEA 2QJVA 1E3WB 3BGDA 5CA1F 2P9ZA 3P9YA 4Z7NB 1QQ6A 1FNCA 4YDHB 4JQZA 2HU7A 1QCDA 4MUXA 3VOAA 3L7JA 3BYZA 3JQ7A 5ICCA 4KB5A 4GWIA 2QUAA 1NE4A 5DWDA 2J0UA 4D8XA 3NFYA 5J43A 1PV4A 2OBNA 3IA2A 2C29D 4G5RA 4TQGA 1HE8B 2GNAA 3PZRA 1E1RD 2BFBA 1X13A 1TO1E 4C3UA 4L0QA 2QTLA 3IUEA 4B3CA 3DPRC 4IJ6A 1U8EA 1H6DA 3VBFC 1CJVC 2RS13 4HNAB 5KNCH 1UF2C 1MRSA 1NXTA 3VAYA 4LRTB 3ER6A 1O3RA 1FSGA 2D54A 4KVGA 2OQVA 3UGQA 1QJU3 4BFXA 5LZ8A 1QC5B 4JOCA 3ANSA 1N9GB 3AIKA 2RAPA 2Q8PA 3M9WA 1Z7S1 2W11A 4OEHA 2AXQA 3L0PA 2JLAA 2YJTD 3NBQA 3KKZA 2R6CA 4G0YA 2DWOA 2NYAA 5BNOC 5ALEA 3AKPA 4RGQA 1ZVFA 3KYCB 1T25A 1VKRA 3DEAA 3VAZA 3RSHA 4EECA 5ELMA 3C6ZA 4YJGB 4A36A 5FV7A 3OPXA 1PVDA 2VTFA 2HF7A 4Q7LA 3AVSA 3ESDA 3CCFA 3QSGA 3HKDA 4Y2HA 4B2PA 3NYWA 1DJLA 3LOIA 1TUGA 4M0HA 1K7CA 4H3VA 2YN2A 5H02A 3WK4A 3GALA 5HRUA 2PIAA 3L1UA 4CMJA 3BDIA 2PLRA 4M99A 1LRJA 3VU9B 4HRAA 2ZEWA 1XT6A 5JCTA 3T0FA 1W0CA 3HI4A 1QF7A 2O1WA 2AL7A 4R9AA 1SUPA 3QD6A 2AIRA 4M8NE 5BPXA 4HZIA 1KTVA 5CX1B 4RKWA 3A0NA 1NXPA 1OC4A 3WK8A 3IDSA 4ETMA 4BLVA 5FQ0B 1BYIA 3NX4A 2J1LA 4TWAA 2HEYF 1BWPA 4P34A 4DM3A 5K0TA 4G84A 4BBAA 4BVKA 4F8YA 5SYMA 4IL7A 3RYIA 4D0GA 2IHKA 3LBFA 2NX2A 4WLEA 1EXDA 1B3BA 1T0UA 1LDGA 3WL5A 4PO1A 2H1VA 5DLPA 4F7DA 2A58A 1CWPA 4G0MA 2JFHA 4S1NA 3EYAA 4MS4B 2QW8A 2C95A 4U2CA 3MYYA 4OSOA 3EXHB 5GLUA 2NN8A 1MHPA 1M0SA 1U3DA 4NONA 1N47A 2PA3A 4RK4A 4BNVA 4PBPA 2VTXJ 2BRTA 1NY6A 2Q3HA 4Z82A 5K6TA 1G20E 3RIYA 4QOSA 1Z4KA 2QX7A 2QN1A 2H3HA 3GRFA 4OHMA 3ZHUA 4KO1S 4UHJA 4RDXA 3HUFA 1MS0A 1GDHA 5KREA 3KOXA 1RUNA 5KCMA 2B5HA 1SMVA 2FW6A 4J94A 2QP3A 2FPPA 3OLVA 4NOMA 2ARAA 3PFCA 2BDUA 5FWNA 3NHBA 3SSOA 1W9SA 5KX5B 2TMYA 2PH5A 4FOSA 2C07A 2ZE5A 3I2OA 3I04M 1AXEA 1V8BA 3ZQ4A 5BUCA 1PO21 2XL7A 4LVUA 1FFHA 3X29B 1GRNA 2CHFA 3ZVLA 3EZGA 1BA3A 2GWHA 1JR4A 4HQRA 5JMPA 3TSOA 2WT0A 4XPZA 1T4BA 3HCAA 1QQTA 4AFBA 2CN1A 3LBHA 5FBVB 2VBPA 4PNHA 4RWEA 1O6CA 4BXSV 4C88A 5F23A 4QRIA 4G3XA 1TOAA 5D5QA 4HV4A 4X60A 3VC3A 3GMIA 4M1KA 1FVFA 1KF0A 2VBGA 3PXUA 3CHXA 1ZN2A 1O0BA 1VOTA 2GSYA 3P7MA 4CM5A 3EPKA 3L7OA 3LYAA 1DKOA 5I7RA 1LNQA 1CDOA 4HXCA 1U90A 1X1AA 4FYMA 5HBGA 4YWHA 5L19A 4EF4A 3HM9A 2ZJ8A 4H3KB 3A28A 2VSNA 5KDDA 1BKYA 3DB2A 5LD2C 2V0CA 3RWBA 2GK3A 1KO5A 1E5DA 3FJYA 1U8FO 4HN9A 1Q56A 1MV5A 1OOPC 1YWKA 1DYOA 3QPWA 2TMKA 1GNSA 2VP5A 2Y6LA 3NUGA 4DY3A 5HOQA 4TVBA 4IDPA 1SBZA 1R8JA 3WRYA 1SKMA 3TR5A 4PRLA 2P78A 2WA2A 4L78A 5K09A 4K6MA 5E89A 2WRZA 1OLXB 3G5UA 2CAUA 3RIMA 1UXGA 1IJFA 3NP7A 5DRTA 4MXDA 5K3BA 5BUSA 3EZFA 3RQSA 3I72A 2EJTA 1J8DA 3JVDA 3NI2A 4MUHA 1E1CA 2VXRA 3A1SA 4AJOA 2ARXA 4XFCA 3OJ0A 1EHCA 1ZX1A 1E0JA 3JATA 4WKNA 2ZB7A 4MXWB 2COEA 5CDSA 3KOYA 5FAKA 4PAWA 5IDWA 3E0XA 4M7RA 1CESA 2O2HA 1V25A 3DKRA 3MLKA 2P2DA 4HGPA 5F9HA 4JAAA 1Z5NA 3K51A 4BB0A 1IKQA 1WBJB 2OVBA 3VBFA 4CCNA 3VTFA 1FDSA 4GECA 5A32B 1SUAA 1X7XA 4ENVA 3TNYA 3ZXDA 3I1FA 4FBGA 3L06A 2KPOA 4XF3A 1T5IA 2ZSUA 4CUCA 1Q3HA 2QVCA 5DI3A 1VLJA 3OLXA 5U1PA 1MOQA 2AC2A 4NPLA 2W2MA 3F78A 1V70A 3AERA 2XKOA 1DUSA 2JAQA 4X64B 3KPYA 4DTCA 1KK0A 2DUMA 3HVIA 3FLAA 4GMKA 4KTVE 4N43A 2OYRA 3SJBA 4L9AA 3AX4A 4DLVA 4J0GA 1ZM2A 2H8GA 3OCVA 4AK3A 2QTNA 3M89A 2DJIA 2J22A 3D7KA 4DEXA 4MRNA 5K0CA 3ADCA 2R85A 4JXXA 3BD6A 3B5LB 3WSTA 2A1XA 4UHKA 3RU7A 1J9EA 5B37A 1IHOA 3T1HB 3HXKA 3E53A 3PP8A 2ZR0A 3PCXA 2ZM6B 3THTA 3ZKYA 3ESCA 2V3CC 4QXQA 5JSHA 3B3JA 1Q21A 5IM4A 5HKLA 5BNFA 5JLVA 5B2FA 2Y0OA 2D1QA 2AWNA 1E2IA 3OECA 2XLGA 4B3JA 2JKYA 1U31A 3M6AA 5LWBA 3D1LA 3VU3A 3E5XA 2W6NA 3JQQA 3MW3A 1WCDJ 3KV5A 4F06A 3TJZA 4OMCA 5LYYA 3IR6A 3T5BA 2F8TA 3CJXA 1TG7A 4Y26A 3F47A 5K6AC 4OJMX 5EP4A 1PJZA 5CA0F 2IYUA 2XVAA 2NO4A 1NA1B 2RI1A 3JD3A 2ZTLA 5ADHA 2IKQA 1AN9A 4Z3OA 1W47A 2XMRA 1CPNA 1QSGA 3RT7A 3U2QA 3PC6A 3DVRX 4MVJM 2BWJA 3BMNA 3E22A 2P2CA 1YOVA 1J0CA 3MIGA 3WF4A 1FPN1 4XJWA 1TC1A 5DXJA 4YT8A 5AW9A 2JAWA 3ZY3A 3A4NA 2O0HA 4FMCF 1PJLA 1QJFA 1O94C 3WYDA 5HCIA 4GI3A 4KGGA 4CF7A 4RJJA 3M6UA 2J48A 4Q3AA 1G9SA 5F32A 1GV1A 1ENRA 2P6OA 4MZUA 4E2ZA 4E7OA 2M98A 1G8WA 3VBEA 3QJ5A 4BEWA 4UU0A 3VYSB 2PFKA 4DUGA 4IWYA 3I59A 2W2PA 1U0FA 4RIIA 4OTZA 1UX7A 5K8VA 3ONFA 2AD5A 2XPCA 1E6EA 1KAMA 1JA1A 3P0EA 1Q83A 1PMIA 1I4WA 1SVSA 2GM5A 2XZOA 3U0BA 2OGWA 3EK2A 2ATCA 5IVEA 4OFXA 2JFUA 4BO0A 5K9YA 4DLWA 2DR3A 2WU8A 4PRKA 4ZARA 5HA5A 1CUCA 2PANA 1R4NA 3MG9A 2OMEA 1N2SA 3IVXA 1ECJA 2X2EA 1HSZA 2BR3A 3A4IA 3P9CA 5JD5A 3O84A 2W4QA 1JMUB 2P1RA 1I80A 4M55A 4RTMA 3TLGA 4P36A 2JVJA 2IWHA 1UDBA 4KPUB 1ZAYA 4UDXX 5FFMA 2CYBA 3B3GA 5F4ZA 1ZM3A 3U4QB 1YK1A 3OJWA 3DR5A 1KARA 2VH2A 4P5DA 1SUSA 1CSEE 3VJLA 1TM4E 1ZDMA 4MVJD 1AF4A 2C1XA 1OZGA 4WVFA 1ODMA 3DM5A 3D64A 1RXIA 2Y99A 5KNCD 1UMKA 2V5YA 3PDQA 4Y22B 4GQBA 1N6OA 1W8DA 5AXDA 4H6PA 4XD2A 1S0GA 1U9IC 4JU9A 4MCHA 2QYHA 3F1KA 1MOSA 4C06A 2I4IA 2VJPA 4WOJA 3WYFA 2V6JA 4E4RA 4KPGA 1UK9A 3A04A 3KDPA 1PJRA 2JJ2A 1CTQA 3VSDA 3WQHA 2PY6A 1ISHA 5IT5A 1SZBA 2GFHA 2H5IA 3KLOA 1LRHA 3D3JA 4YAFA 4ZVNA 4YCJA 4PW0A 3UT5B 4G1VA 2DBZA 4OU4A 1QNYA 3RJRA 3CJIA 1SXJD 5FA5A 3ZE8A 3BODA 1DPGA 3K2OA 2AE2A 2IPXA 3HPQA 5BSEA 4U6NA 3BCWA 3I9OA 4GX2A 1OV6A 2A14A 2PHRA 4MRVA 5IABA 3ME5A 3QWFA 3FBGA 2QHXA 3CB4A 4CM1A 4YW5A 1F8GA 4W6XA 4W99A 2G5CA 1O08A 2NZ2A 3WLHA 5IWFA 3FCAA 1EZ1A 2IODA 1XQ1A 1I24A 3AKSA 3LA2A 1JOBA 1BMV2 2XNJA 4MI3A 3TQQA 2C4NA 3GELA 1GITA 2NZVG 4CL8A 2CDPA 3LLCA 4HQ0A 1D03A 3OBZA 4DJEC 5C51B 1QC5A 3JQ9C 3R7BA 1RAFA 1XCGB 3FWYA 3L2YA 4PYQA 3FSGD 3C7EA 2DFBA 1JSZA 4B7CA 1KWKA 4EB6B 5CIYA 1AMUA 3K9FC 4NE7A 3MS4A 2C98A 4BRUA 2QVXX 2TNFA 4CU6A 1GPH1 4D74A 3HDQA 3OEBA 1HQLA 1PNVA 4MQEB 3TSCA 1NFFA 1S4MA 3DDNA 1LHWA 4BMBA 1T0IA 2ZIVB 5BR8B 1GFSA 2HLDD 2VP6A 3UK1A 1IS3A 4JR1A 5J48A 2GF2A 3AX6A 3Q6IA 5JADA 3DFIA 3RKSA 1FY2A 2GBLA 2OZJA 2HADA 3TCKA 1J3QA 4C2TA 3HYTA 2DVFA 2ILVA 2X10A 2C1FA 4NHMA 1H4VB 3Q7EA 3KVVA 3U9SA 4MVYA 1RMU1 1J49A 4FHZA 1UM9B 1DC7A 4IIJF 1XU9A 4BLIA 3AEQA 1M6VA 3U1BA 4AFCA 2BBOA 4LFAB 1EGVB 5D2CA 3LQFA 2W90A 4D9HA 3HE3A 1S3FA 2FFJA 4FCAA 4NJ4A 2BCGY 4ZXFA 1XLWA 1UFQA 1G5HA 3SISA 4L57A 4XUOA 2XDAA 3IUMA 3SF8B 4JC1A 1MVLA 3N36A 2AFHB 2PX4A 1BCSA 2WKWA 3GBWA 3Q8CA 1YS1X 3SEAA 3CF2A 1U2QA 2PS0A 4YDRA 4BX3A 1QF3A 1JDBC 4NAVA 4ZOBA 1XQVA 4KBBA 2CU5A 1BK0A 1AZWA 1SRRA 1PJBA 3AMVA 1XZEA 5E9WA 3VDBA 1ORTA 4UWDA 1P2BA 4BZXA 3PURA 2HRRA 1E66A 3A4UA 1ZUWA 3NG1A 1PR4A 5EHXA 1U8TA 5EHIA 2XA9A 2ZXQA 3V3TA 4R7ZA 4BQFA 3SM3A 3I83A 4MQFB 1M74A 3C2UA 2JD9A 5ICEA 3GBVA 1XMJA 3FTQA 4UTNA 4AKSA 2BNMA 4C7OA 3E81A 2A30A 3ZHXA 4OHFA 5IXYA 5KKCA 5B1SA 5H1YA 1UKZA 2YVKA 1VP6A 1RAHA 4U2BA 5AESA 4KI0A 2YDXA 4RS5C 4CR6A 3U11A 2ENWA 4DRVA 3OZWA 5DGHA 1NJ6A 3F96A 2BW8A 1OAOC 3AP7A 2VECA 2VOTA 4LDPA 4PZLA 4MR9B 3R5XA 2GN9A 2J3IA 2FEAA 4KXNA 3WLUA 3T61A 1THGA 4MWGA 2ZUFA 4ZDKA 2OOSA 2CF6A 2P9BA 4HTAA 3A9RA 4XF4A 5ABPA 1KFEB 2H7VA 1L7XA 1C7QA 2XH8A 4OQXA 4CLRB 1PGNA 4DCVA 3RKUA 3K73O 4BPBA 1XNJA 1N77A 2H4JA 4Z9AA 2JKZA 2V65A 4FFVA 2AFIA 1JFVA 4G3YC 1A7AA 2QN9A 5AFSA 3AI1A 2C5HA 4YFWA 4O1HA 4ZT2A 3I28A 2I54A 4ZQHA 1W6OB 3PFHA 2BHSA 3QKRB 1B00A 1VI6A 2A84A 3I8TA 4QBIA 3PVZA 2X41A 4JLWA 1G9XA 3K0EA 2WZ8A 3NAZA 5JV5A 5AVSA 3TEZA 4JB0A 1KH1A 4BFWA 2OK7A 1J25A 4R8SA 4AVBA 1W8WA 3I2JA 4LX8A 5BSTA 4HN1A 2M6KA 3DMYA 2HWE2 2YV2A 4PCVA 1IUNA 2QN2A 1V6SA 2EAKA 2WSBA 3TD2A 5JZSA 4LNUB 3F6BX 4KUGA 1RJ8A 3B1WA 2QQGA 4AZ0B 1DAFA 2ACEA 2BEWA 2WBLC 3UG7A 2ZHLA 4LOIA 3NC0C 3T54A 1Y3BE 2JD4A 2X4IA 1O95A 1JT2A 4QB6A 4OQ9A 1KY3A 4JCOA 2E0IA 1EUZA 2D5BA 3F90A 1J9GA 4H7FA 1P5RA 1G17A 3NPAA 2MSNA 1RUC2 4AX4A 5L4SA 3T30A 5F6KA 1SLLA 1G8JA 2GEJA 1KMNA 1OJ7A 3JB4C 1P81A 3OE7D 2PL5A 1WTCA 1SKBA 4X71A 3DZKA 3P2OA 2WSUA 4DKJA 3RCBA 4RH0A 1E3TA 3GZTB 1NY5A 2FSVA 1I4EB 3ZHOA 5LRRA 4AWBA 3SSAA 4LBZA 1BS1A 3WOHA 4PC7A 1S2BA 2AG5A 4D9NA 4DUPA 4HRXA 3NWPA 2PMKA 4ENQA 1PDVA 3VO1A 2HQSA 1KL7A 4GI2A 1BHSA 4BN5A 3GMSA 4HYQA 1E9EA 2WUGA 3BRCA 3IDOA 1K89A 2WS91 1BW9B 2XJVA 2VDQB 4KKVA 4YASA 4BNGA 4Q9NA 3ZUGA 4Z1MD 3O74A 4EG4A 5BUVA 1PZHA 3U7QA 3TR0A 3U48A 2F6BA 1YBAA 4KN9S 4LA3A 2H92A 1Y4AE 4OP2A 5I0TA 4ESOA 4BB6A 3ZNNA 1A8SA 4ZMRA 1ZRNA 4CW7A 4RETA 3PPXA 1RP1A 1EUDB 4BQWA 4L9BA 2YY1A 1UBGA 1PFGA 3BMXA 5DHPA 3S0JA 2Y0IA 4LRXA 3VV1A 3CL1A 4B32A 3P3NA 4D69A 4QODA 1WCKA 3AJDA 3KT0A 1JFTA 1RWPA 1X70A 1DAOA 2QQIA 1SFRA 4RA6A 2D2EA 2OGZA 3ATGA 2ONYA 3AOGA 3EXUA 4F4CA 2PUHA 1NXVA 1G5FA 3QPBA 1NN0A 1G3RA 5E1MA 4LWZA 5TMDA 2EP8A 2MHCA 1OU0A 1CERA 2QL6A 1MB2A 3W5DA 3POGA 5KTNA 1V35A 5E7JA 2ZJ6A 3MHPA 1UP7A 5EPUA 3U16A 1FFEA 3ZIAD 3G68A 3G6WA 5BMOA 1D6SA 1MQAA 1IOLA 1H6XA 3VISA 4P9JA 2FJPA 1F0YA 4LJHA 1NQOA 4LSGA 4QHOA 1LSOA 1LODA 4M4RA 4R9CA 3H17A 3W3AD 3C1UA 3RSZA 3B52X 2HBRA 2AK2A 4W5QA 3UMCA 1U0EA 3SU8A 2ZR7A 5C70A 3RVLA 3KAPA 1XLVA 2KE5A 2G77B 1VB2A 5HF9A 1GPNA 3BFPA 3FBYA 5JSPA 1ONBA 1F8YA 2GNDA 2ORYA 3ICEA 3PUVA 1D2EA 1TJ3A 5CXXA 1LPOA 3P5BA 5AMXA 5LKRA 1AZTA 3A14A 1LBTA 3C7HA 2Z8YM 5JWOA 4GOOD 3OFSA 2AMFA 3TIGA 3V1UA 1LA2A 2NPOA 2WHYA 3B1JA 3DF9A 2GD1O 2F1JA 3LPLA 1VBC3 4RSGA 5EZQA 2BGJA 2ZITA 4JBHA 2A59A 3TZEA 4RKEA 4Q4X3 5C9ZA 4QGNA 5AXCA 1HQCA 3U49A 4L4ZA 2AXPA 1WW7A 5DN6A 1W9HA 2EGUA 3EXG1 1ND3B 1N5RA 5JSRA 2BGOA 2ZRQA 2JI4A 1NSYA 3KUXA 3SZOA 3R5KA 5CNKA 1ID8A 1LX6A 3OT5A 3EXEB 2R3SA 4W8JA 3UXEA 4NAOA 1V48A 3SHTA 1XVVA 3LOPA 2OGTA 2PRIA 3VGIA 4K28A 2CJPA 5FWAA 2BTQB 2XT6A 1GLNA 5ILGA 4I7EA 3QE3A 5FDFA 2P17A 3R5JA 1IJEA 1P4JA 2RGRA 2J3EA 3M3EA 4FQ5A 2BUKA 3U1XA 2OD7A 4F2DA 5AJZA 1W6MA 4RORA 4QJBA 3AMHA 4N8EA 1J2YA 1WXXA 3DT8A 1X9PA 2GH8A 5T5QA 2F1HA 2DPLA 3WL4A 5CM2Z 2V55B 3E6DA 4XA8A 2CLSA 2Y9PB 1EIZA 3GDOA 2AT1A 4IDQA 3ADKA 3KQLA 1ZU4A 3I9FA 4UTPA 1MS9A 1JJIA 1CRZA 3KCYA 2J59A 3OEYA 2G67A 3BJEA 2R8EA 4R3NA 4X1IA 1FX0A 4XVRA 1EDDA 2QLJA 4Z4HA 2O3RA 3D0RA 4EHNA 3BULA 2IYZA 3N53A 1JHJA 3U9TA 4A5OA 3G2HA 3EO6A 5EL0A 4WESA 2GXQA 3RWOA 3FF4A 3RGWS 3EEOA 1NR7A 1E3MA 2H8KA 2D1RA 5FUBA 4C1XA 3DZHA 3K2QA 3LH5A 2KQUA 2VF8A 2C7BA 3W6ZA 4GC9A 1OSGA 3KKLA 3H5AA 4HUQB 4MARA 4P00B 2G9GA 3A23A 4M6WB 1GPWB 1JR3A 2PVCA 3FHAA 5LZ9A 1Y3HA 2YIMA 2X6TA 2AHOA 4ZCSA 1WWYA 3C3YA 2VU9A 3RSOA 4BNWA 4J29A 4IVRA 3FSEA 3REGA 3G1UA 5DBEX 4AN0A 1RPNA 1XNRB 1FMJA 2YDYA 3H9EO 3LUCA 3CUVA 2P4UA 3TX2A 4FTWA 1HZZA 3GK3A 4Y2GA 3PTAA 4EYGA 2K2SA 2ZI5A 4XM2A 3ZDVA 4NMIA 4DO0A 1OD5A 4CL3A 3OZIA 1L7EA 1XYOA 5YASA 2WJVA 5JJIA 5KVVA 3WG3A 3T0IA 1Y1TA 4TV9F 4JLKA 2WSMA 3C8UA 3HNYM 3KVYA 3H86A 4NCNA 5C7GA 3BRQA 2J3QA 3RT1A 4M9UA 1N4AA 3GR6A 4NENA 2Q6OA 4DZTA 3AZVA 1G6HA 5F4BA 1CAUA 2WHPA 1SWWA 4AFDA 3L02A 5J3UA 1NN1A 4NRMA 1WOYA 3T5AA 3PKZA 1DEOA 5T6BA 2I66A 2C0CA 3NANA 1SU6A 3L46A 4IEYA 4G0VA 3KCCA 2QTBA 1SU8A 5ENDA 5CU1A 5SV5A 3BK7A 1CNMA 2H85A 1W6MB 5AH0A 1RKXA 3EQZA 3N70A 1RUC1 5FCCA 2JG8A 4A8JA 1GUYA 1QV7A 1W9YA 2YWDA 4TMXA 2IHYA 4W5RA 1PVOA 4AKHA 5KYWA 3L8YA 1RQNA 3L4JA 4EY5A 3QYFA 3IOMA 3O4JA 4YW3A 4CIBA 4YAIA 4PG7A 2V7QA 4YUVA 3ZWWA 1YZVA 4ZJUA 1H3NA 2RG7A 3QUCA 2Z8YA 5CKMA 3CN7A 2PAKA 4ZOLF 3H1MA 5C4IA 4MQMA 3NC4A 3PVBB 1XCOA 1TRHA 2DFTA 1H5UA 4CUZA 1UEXC 5CFCA 3E05A 3N2KB 3V4OA 4BZWA 1AKEA 1WMXA 5CX4A 2JI8A 2F8SA 4GD4A 1KYVA 3K1ZA 2CVQA 3LYUA 1FRQA 3SHVA 4NCKA 1U9IA 4XFDA 4O9EA 3MUNA 1G16A 1EGAA 2JGNA 3GPDG 3GCWA 3JCZA 4NBNA 3QVKA 2E1PA 1C0EA 4H2DA 4X1KB 3Q0TA 4WKGA 2A5LA 1DTWB 4LXGA 1UINA 2NG1A 4NKRA 4BUJA 3ZV4A 4AURA 1F9KA 3D4LA 1W8TA 3P32A 1F12A 1XKLA 4LS3A 3FPHA 4RC9A 4EDFA 4I0WB 3O3CA 7MHTA 2PCLA 7AT1A 3LUKA 1PKEA 3WQRA 1YUDA 5EJ2A 4DPLA 1ZN9A 3AEUA 4FC6A 1KFXL 4LK3A 4YRRA 3K0AB 3RRJA 3TI7A 1RLOA 3QMPA 3R3YA 1ZISA 4JKYA 1U8ZA 4ZOLB 2YBSA 2H4WA 3FUXA 1O89A 3FDXA 1WW5A 5AVUA 1NIPA 2HDWA 3L4EA 3UQYS 1DOZA 1NQXA 2QTFA 1ZVJA 1J0BA 4FVVA 1JHVA 1ENXA 1EVLA 2YHJA 4DCOA 3SR4A 4CKWB 2E89A 2DPHA 3C4VA 3MS7A 3ZVXA 3E97A 4IV3A 5IMBA 4JL6A 1N9ZA 2JGFA 2P2NA 2WA1A 4YJDA 3SBOA 1XTVA 5ILQA 4AZ3B 1UPFA 1TVKB 1GARA 2CV2A 3KTAB 4X1YA 4TUYF 1H23A 4E11A 1IS4A 4YCNA 4LE3A 1BMTA 3SIWA 4QC2A 4A6EA 2ONJA 4XFKA 3HCBA 3ACDA 5EQJB 4BOWA 1YS9A 1XCBA 2WPNA 4D4KA 5I7OA 1JF8A 1WLCA 3CLUC 1QM5A 3TRHA 2FOIA 3LUHA 4RPIA 4K87A 5FY7A 4G5YA 4NYIR 3MS2A 2YFYA 4YJHA 4MDYA 4HDSB 2D74A 2CKMA 1OFUA 2EZ8A 3T4XA 3TXYA 1Z17A 3RJTA 1EESA 3BMNB 4LR4A 4U2EA 1JI6A 2WZEA 1O3YA 3G8AA 2VPXA 1R74A 1WB5A 1KGYA 3TLAA 5EIWA 4E5NA 4LQDA 4M8IA 4PRZA 4HDCA 1YJQA 4AK9A 3PIJA 4GLOA 2PKRA 5KHIA 2I2SA 2RFLA 1T8RA 5AQEA 5U4QA 2HWXA 1PUJA 1ND3A 4HX5A 5DK4A 5GQSA 3CF4G 1HTTA 1BE0A 1S5PA 3PC3A 5DDIP 1CUBA 3R8FA 1WY7A 3KPWA 1U8XX 5DI3B 5DTJA 2BTVC 2EBHX 3B1XA 5EJGA 3OT4A 3BSSA 3K0FB 3C1OA 3DTVD 2EV9A 3L49A 4J2OA 2BEVA 5EXDA 4BRWA 2EW8A 3JW8A 1BWQA 5FOTA 1PNQA 4D82A 5KOHB 5DU2A 4ND7A 3W6PA 3N0XA 3GHHA 4AYTA 4M9CA 5FZEA 1KDVA 1VMEA 3RS6A 3MFQA 1M2KA 3G85A 1CV2A 3C6QA 1VJ5A 1JJVA 2VS1A 2FLKA 4F9GA 2HPAA 1VE1A 4PS0A 3GVXA 4L0CA 1V6NA 4GOND 5LJLA 4JHLA 1A4IA 5FZGA 5IVPA 4PCLA 5BN4B 1M5UA 3GLTA 3HUUA 2ZJOA 4I1IA 4OUMA 1QZ3A 2X05A 3KO8A 3QM1A 1BDBA 1NWHA 1BOOA 3O1LA 2AEYA 2O3UA 4KAJA 4YMUA 1W4AA 2AR9A 3C6YA 5AXBA 4B9EA 1XRLA 1KI8A 3OQOA 1W4ZA 3O73A 1Y81A 1S2DA 2XUKA 2E55A 2IYXA 4TTAA 1W05A 2GHQA 3H5TA 1ZN8A 3DBOB 4CDQB 2B46X 5DE3A 2O3TA 3TM4A 4WLFA 4MW2A 4GBJA 4G97A 3VBHC 1CZLA 3ECQA 3S7IA 1Z18A 5LQAA 1Q50A 4X1OA 2VI5A 1YRBA 3UWPA 4GB32 3AYZB 1HDGO 4GXQA 3MN1A 2XVGA 5FDBA 1IOAA 2Y4NA 2VNKA 4PLWA 4JELA 2ZK7A 2R68A 3ND8A 5I0UA 5CFCC 3H8XA 3EXHC 3KTFA 1ZGAA 4PLMA 2PMWB 3GJBA 3I9NA 2F17A 4Q9KA 1PQ4A 1JN2P 4JGYA 3WDKA 4RN5A 1Y9EA 2AG0A 2XGXA 4BXOA 3TG8A 5JJ5A 3T3EA 1FJHA 5L3RA 3ABSB 2LCFA 2FMTA 3ELUA 2QQNA 4IEIA 5F3DA 2UUPA 1FFAA 2BRUC 3RAEC 2DFLA 2CFSA 1VJGA 2H00A 5EE3A 2ZUBA 2NXEA 4NMHA 4KJXA 2XGSA 5C5EA 3OMLA 5ITSA 2MMGA 3LZ6A 4EKYA 1OY1A 1EJ6A 3RJ9A 3F98A 3Q15C 4S24A 2WS93 4HAVA 3KWJA 4E2XA 3C3DA 2OHHA 3I4IA 1JR3E 3LO8A 5JE8A 5K6AA 4H7IA 1PAUA 1IEQA 4KPEC 4L51A 4E4TA 2BFUS 4MWBA 2OV4A 1G291 2JEMA 4Q1CA 4JYAB 5DIFA 5I0SA 3MGUA 1WG8A 1U3WA 1QQAA 3W1WA 3QVXA 5HMLA 3QLUA 4TTPA 1YZGA 5A3OA 5IMSA 1Z6XA 1ECBA 1VMIA 1YB6A 4XTMA 4A03A 3KQUA 1QOTA 5K0UC 1NLRA 1XXNA 2FSHA 4QVIA 4XHXA 1E6MA 2GN7A 3PX3A 1KKUA 3RZHA 1KXJA 3BJZA 3LX5A 3V42A 3W5BA 4MR7A 3MJRA 4PGMA 2YC4A 2V7QD 1QWOA 4FHGA 3WGZA 3GZJA 3ZX4A 3VD9A 3VZRA 5A6SA 2FMFA 5IATA 1PVC1 3CZ9A 1GAWA 4O1IA 1PQPA 3KLMX 4B45A 2CCKA 5JXHA 1XG5A 3ZVMA 2B4KA 4TWTA 2E18A 4WCVA 2JJQA 1KJWA 1HR0B 4BA6A 1GU7A 4QPDA 1YIPA 2H6CA 4OUSA 4RSMA 5FTTC 1OLXA 1ZU5A 5CYPA 4POAA 5ULLA 2QZ3A 1WMFA 1B4DA 4RS5A 1K08A 1OZHA 2P40A 3I6ZA 1CS0B 1V2HE 2F1OA 4PDWA 3HC7A 2O8DA 3OG2A 5EIFA 4V03A 3FX3A 3JASA 3PX2A 5G41A 1SKUA 3CIFA 4R84A 1S01A 3ANNA 2QJTA 1KJJA 2EKZA 3WBJA 3WV5A 3BQNB 1H93A 2GZSA 1ADBA 2ZYDA 3UWDA 4YQZA 5CBLA 1WGPA 4FSHA 4BGUA 2R87A 3FTPA 4J49A 3HU5A 3DVAB 3M5PA 2L17A 1X9IA 4D9JA 1NOIA 3HO1A 3TK1A 4FDLA 4NWWA 1QWSA 1Q8PA 3ZDEA 5DT2A 1ZGJA 2NQ8A 2IU6A 3TGPA 4WLNA 5K0UA 3D5OA 3CZ5A 1EUCB 3PC4A 2EC5A 4RZIA 1Y1LA 5EGNA 3BU0A 1H4QA 1EFHA 3BERA 2IW3A 5AVTA 1C1FA 3QEMA 1ZGCA 3QFHA 4UFOA 3O8OA 1R4MA 3NVKI 3UT5A 3BN3A 4PYIA 1RUD3 3RBZA 4FMDB 3CT6A 1JPUA 5CFPA 1RBZA 5IBRA 2I8CA 1YVEI 3QH6A 1RUG1 3OQPA 3VFDA 1IPKA 2AX4A 4JGZB 3LJKA 4WI1A 4K6KA 4MWEA 5C8YB 1XUOA 4NBSA 4N5DA 4XFAA 4EFMA 1DUVG 2R6HA 1X39A 2NZ9A 1JEEA 2Z4RA 5FYSA 3LBAA 1VYVA 3LPGA 4IH1A 1ZVVA 3H5OA 3T09A 1ZS9A 1V7CA 4QPGA 1WNTA 4XGNA 3ZXYA 2GA8A 3HDHA 3OIUA 1UC8A 3T3YA 2P62A 2D2VA 1SVUA 4YRKA 5EP9A 1B7GO 4QKBA 4EGCB 3AB7A 3BGVA 3LXMA 5BUQA 1GWNA 3I64A 4X20B 3RWNA 1YS6A 4NESA 4WEOA 3HMQA 3FNBA 3PNAA 5JSOA 3H1WA 3HBAA 3RI8A 2WE8A 3QH7A 5ALDA 3WDMA 3BOSA 4BC1A 1RHJA 1QXPA 3HCPA 5LA1A 2JAUA 1OXCA 4W4ZA 1CR7A 1PL7A 4IIXA 1N2CA 4MLPA 1AKQA 3AI3A 1OXKB 2B0CA 3ECCA 1SCKA 4C89A 2TBVA 2PGAA 3ZOZA 3AP1A 4WZAA 5FP8A 3QKSA 2DPGA 1P3JA 2YL2A 5EXPA 2QSUA 4LZAA 1R1A2 3WMFA 2ZX3A 1PT7A 4HAWA 1TLLA 4LJ7A 2QI9C 4C1BA 1QCZA 3F5MA 4OGGA 4ZRMA 4LKDA 4ZOCA 1Z56C 3HEBA 3H9JA 4I5DA 1ZNYA 4IV1C 1B0UA 4CL0A 1HDYA 5LQKA 5FPBA 3MIIA 4KPUA 3UJ8A 3K70D 4QYMA 4Q4Y3 2VJKA 4G4FA 3Q2KA 4YJ3B 3KQHA 2ZIEA 3HD8B 4YJ2B 5DWVA 3PI6A 2QTZA 3WMWA 4KPFC 7ADHA 4OY3A 1NVUQ 3BBPA 4L6IA 2G25A 1VKOA 3B12A 1KH3A 4XE9A 3TLZA 2J3MA 2PRSA 3FVRA 1OT3A 5EN4A 4M9RA 4ZALA 3U10A 3O21A 3UW3A 1XYNA 2V54A 2LM3A 5CDFE 3GLKA 2BDRA 4F04A 4F56A 1OLME 4KSYA 5CBPB 4XJVA 2W98A 2PXCA 3I97A 3MA0A 2JKVA 4KVFA 1JJFA 1R4MB 9GPBA 5HMMA 2I2DA 3NQHA 3EIQA 3E3AA 1GOTA 5H68A 3F1LA 5HPYB 4H7KA 5DASA 3GGDA 1NF3A 3JZMA 5ANQA 4ZPJA 2HCRA 2HIGA 2PAAA 2MYTA 3ESBA 4WUTA 3CZ4A 2YY7A 3L01A 1OC2A 1B0AA 1GP2A 4US0R 2JDHA 1WCUA 2Q5IA 3ADDA 2J6IA 4UQOA 2GC2A 3LKVA 3LY7A 3ZY4A 4OVKA 2FPKA 4UNRA 5KBFA 4HDQB 3HSKA 4TYMA 2QN6A 1JKJB 1MAAA 3ZH2A 5B2ZA 2Q4BA 5FY9A 4ZAWA 2Q4TA 2KXLA 3WL8A 2R6JA 2CDAA 2JLVA 5DYWA 5MGBA 1SELA 2JCVA 2BM1A 5EHZA 3AR7A 1A97A 5AM1A 1R88A 4WZAE 3IBGA 2I4TA 4ZT5A 3CZPA 1FX5A 4NMLA 2MTBA 2NTVA 1JEQA 2BF4A 4HDNA 4Y1EA 1G7SA 1AR93 1ZOIA 1ZQ9A 5B4TA 4UOQA 2DSNA 1EFVB 1D7PM 4LAFA 2ZHMA 2F4NA 2O1EA 4O6VA 2FRXA 3IQZA 1LX7A 4H08A 3WYAA 4KR3A 5HDQA 1OBCA 2C42A 2C2OA 5KIAA 1CP3A 2VJOA 4B1LA 5AVWA 3J7MA 3O95A 1Y4UA 3NMBA 2VTXA 2E32A 5KQSA 3KZOA 4UPEA 4PZEA 2NM0A 3SI7A 1VMJA 4XH9B 1POV3 1AR91 2PL1A 3EXIB 2HWD2 2X5OA 5KHKA 2V7GA 4AM8A 4JLPA 1U7TA 5EUQB 2WIJA 4L22A 4MULA 4O5OA 4L5BA 1S9HA 1DLJA 3PB3A 1Z4MA 4YRBA 2ICAA 2QTAA 3HKBA 3U81A 2AXNA 3E8SA 4IKEA 4NPRA 5A6XA 4DPMA 2AFHA 1T1IA 1AXGA 1HXHA 4GQAA 1JZ2A 1TTQB 2Q41A 4URHA 1W46A 1I1OA 4L4YA 4ZV9A 5G0VA 3ILNA 3FDJA 3RH0A 1NAHA 5EPEA 2AYHA 4G5XA 2BMDA 4IEXA 4XFBA 2O8NA 3PTYA 4C7JA 1KJYA 3VOSA 4EX6A 2O57A 2ZRFA 5E7IA 1FPN3 2VJNA 2DY1A 1YQQA 4XJSA 1V6OA 1V5GA 4R83A 4HBGA 2Z1NA 1G7TA 4U7TB 1QDUA 1K7YA 1IJKA 4Q1FA 4GBED 4ZZ3A 1PZXA 5EG5A 2CVZA 4TUYA 4H4CA 4C2AA 2B1RA 5TGTA 3URMA 4OB7A 2GM3A 3FOFC 5DBOA 1RI4A 3TTUA 1JKJA 1Z62A 4DLSA 1XN4A 2ZGSA 5KS2A 3GFBA 4B3BA 1WUTA 1ZGHA 1AH2A 2QAGA 4DLBA 3VNQA 3DGEC 1DEAA 5C8CA 1EQUA 3ZU2A 1ECFA 3HY6A 1PZ9A 4HSLA 3FGOA 1KOLA 3WIUA 3EQ2A 1G8PA 4DIDA 1QFXA 4ZIRA 4GSLA 3ZCVA 4MUKA 1VC2A 4JVMA 1XTUA 4UZSA 3HCWA 3L7KA 4CPBD 1JLRA 1ZSYA 4ZZ8A 4RBNA 1LLFA 3CZMA 1NXD1 1MC1A 3KLPX 4CCWA 4YLGA 2ZUEA 2PLNA 2RS52 1ZXBA 3PXGA 1I5ZA 2VSFA 3OQHA 3LQYA 3UYLA 2ZDHA 2ZZMA 2PBFA 4O4JA 5CYYA 4X62B 4OP3A 1SBFA 1SM4A 1D2CA 5C7IO 3G02A 1CUIA 4R9RA 1ZD4A 5EINA 5E6SB 4EB8A 3PEEA 2IXKA 5BNNA 5DOZA 5CDGA 2PFWA 2ASEA 5JWRA 5DBIA 4ZZ0A 1YFUA 1Y80A 1R16A 5TT1A 2Q45A 2UY9A 1Q7TA 2QR5A 3OSUA 1FT9A 2CHQA 2IYNA 2PBZA 4KV7A 3RVOA 2A9FA 2H0VA 4DR1B 1KFUL 3O4GA 4AP5A 2QEQA 1AS0A 2G9UA 1Z8DA 5CFOA 3DKVA 4Z92B 1CQWA 3Q0IA 4CDUA 1SULA 3H2HA 4UM8B 1O58A 1HL3A 3I3DA 3U7IA 5IJ9A 3DL3A 3QQ5A 2H0RA 2V5UA 1ZICA 3WGVA 1Y1PA 1UBTS 2Q5LA 1T3TA 2GERA 1XRRA 2AOXA 4YB8A 1UWVA 4M98A 2PG3A 4J9VA 1SA0A 1YFYA 3SVZA 4HHEA 2HA4A 5I8TA 2QMHA 2XR1A 3DWEX 3JS5A 3ORRA 4AOCA 5HF8A 2ZI7A 1CUVA 3I58A 1AR73 3SDZA 2WS92 2ZKNA 4LMFA 2XYQA 5FY5A 1V11A 2GPNA 1TF5A 4LBQA 3KV3O 4FEEA 5JNSA 1V47A 3FDIA 4R2KA 2E6UX 4M60A 4CEIA 1DQRA 1IHYA 5SY9A 1JYFA 3AOEA 3COPA 3AO0B 5ALNA 2XVXA 3BIFA 3DXUA 2OSVA 2BUAA 1CUJA 5EE5B 4KR6A 1BKDR 1X6VA 1F1JA 2GAUA 4PLOA 2VZEA 1NY72 4F86A 4EUHA 3HWWA 1H1AA 2C04A 2CXTA 1CUDA 1LOGA 1HB1A 2ATXA 1D4ZA 1JTZX 4H27A 2FZ2A 2WIIB 1S1AA 3WLSA 4P9NA 4QOJA 1EAH2 1T0BA 3PFGA 1DCTA 2FP4B 3JX9A 2IZ6A 5CW1A 5ER6A 3D02A 3HFJA 1AX2A 4B5LA 3AL2A 1GADO 1DVRA 3AMNA 2J42A 5K0NA 4GLFA 2WP8J 3RK0A 4AZVA 3BMCA 1FL9A 3GLIB 2VOKA 2Q9BA 1X7GA 4UE2A 4CPBA 3OUIA 4XD7D 3AJAA 1REQB 4FX2A 1QHGA 5IJAA 3FWZA 4R1UA 5DHTA 3MWKA 4DWOA 2I33A 4XBLA 1W6NB 3WB2A 4QTZA 3GF6A 1QBKC 1WR8A 4RFVA 2AG8A 1NAIA 3GEBA 2L2QA 3DPUA 5THXA 1H2XA 2P9FA 1M1ZA 4I14A 1X8LA 2PIDA 4UCWA 1LBIA 3C3AA 4AN4A 2C4WA 3FNEA 2ZWMA 2C9CA 1QIIA 3V7WA 2VQDA 4LV6A 1WQ4A 1QH7A 4AULA 3THSA 1CR2A 3WDLA 1NBMD 2IW1A 4A42A 3AC0A 2AC1A 4QDSA 4LIUA 1U7DA 3PC7A 2QFEA 1EWVA 1LPNA 3TF5A 1EXWA 3MIBA 2JLXA 4CGYA 2OKGA 3PVCA 1PR1A 3VNRA 2QG9A 5IG2A 4OI1A 1TZ2A 3GQVA 4E5KA 2JLYA 3F4KA 4HDKA 3ELDA 3CNOA 1F5SA 4YW6A 3G0IA 5CHYA 5EIBC 5DTMA 2BFEA 4LKSA 4DKXA 4OQ4A 3NTRA 5FPYA 3OC6A 5EWLA 4B43A 3EZXA 2Z8XA 1L5OA 3QELA 3MI8A 3LGXA 1XDSA 1W8FA 1POXA 3EVBA 5FUIA 3U3MA 5JFGA 4IQFA 1TEVA 4UKDA 2VHEA 4KI5M 4CDRA 2M9MA 5HR5A 5I7UA 7YASA 4FQZA 3VHRA 2C7VA 4JJKA 4RY9A 5FRDA 1X7WA 2HF9A 6PFKA 3A0UA 1PNRA 4WZBE 3BM5A 4D7AA 3VXKA 5J2TB 4JGYB 2BZSA 1VZ3A 4HB2A 3SEQA 4DMKA 2J9FA 4YDSA 2P3QA 2QUOA 5IASA 3QEKA 4NFYA 2HK9A 3B7GA 5BP7A 2AJBA 3BIJA 1GM5A 4NBTA 3ZXFA 1IPEA 1G0OA 4Z2AA 1BNCA 4QU9A 2BBTA 5KDLA 1DIGA 1XBFA 2EYQA 2VN8A 3C87A 3MBWA 3FHTA 2HMTA 5IUQA 4GL4A 1AR82 3LS2A 4X65B 4YWAA 4NAUA 4H17A 1O87A 3KPJA 1Y9MA 3ZFEB 5CBPA 4TMYA 3RS4A 2X3FA 5KYGA 5ACA1 3OCJA 3QOXA 3L7DA 4ZYVA 4H15A 2YWXA 4ZDWA 2UYGA 2RR12 4Q7QA 3FXAA 2O07A 3SC7X 1AYM1 5HDBB 4GM0A 3NTLA 4EE2A 2G9FA 4FDTA 1TYCA 1SHKA 3N58A 2OC9A 3UG6A 2HJWA 3DO8A 1MOZA 2OM6A 1NVMB 4Q18A 5KWEA 4OLLA 4Q3NA 3C1TA 4N0EA 2W6CX 1AKWA 1K27A 4JENA 4B35A 2PUVA 3EG5A 4S04A 5DYNA 1DMSA 5EMJA 2V7EA 1U9CA 2EVWX 3WWDA 2C9MA 2FSFA 4N1AA 4LN1A 2IEAA 4F2PA 3EHEA 5BNNC 1TMYA 1ANKA 4D44A 1GUDA 2KD7A 3WDXA 2P3SA 1NUPA 3CIOA 1WD3A 1ZUD1 4B1FA 3T3HA 4XB1A 3GV0A 1X87A 2HL6A 4QSMA 2MYNA 3OCXA 2X1MA 1ZR4A 5IKOA 4LF8B 3ZWDA 2Q21A 3D3WA 2JFNA 3ASVA 3SITA 5JZOA 5HCNA 5IF3A 2ORED 1U2SA 1HJFA 3AILA 5JS6A 4CCMA 2GMEA 3JQBA 3PEVA 2H52A 3LSYA 3ZR4B 4F2WA 3D1VA 1M4WA 1GANA 3O83A 1C3LA 2ZYRA 1NU8A 1IOWA 3UUGA 3EZYA 3VO2A 3ND9A 5LWHA 2IJGX 2CVHA 4PAGA 3SFZA 5J4YA 4PHHA 2Q5EA 1UOPA 5E9AA 1NURA 1PX0A 5KSOA 5E2BA 1L7QA 4L16A 4CGZA 3DBRA 4ZWNA 4NF2A 1F7VA 5L40A 2NP6A 1DX6A 5KTOA 4GNRA 1NVXQ 3T7DA 1B35C 3GL9A 2WWXA 3ZIUA 4B80A 2UYBA 3IURA 3MMPA 1UY2A 4ZCRA 2H1CA 5LLTA 1VL0A 5FEUA 2VSOA 4IHKA 1BDJA 2OECA 4F3YA 3HFSA 2O7NA 3ORSA 4MUMA 2A67A 1BCRB 1B3RA 4V2UA 3THXB 3OY2A 4UBLA 3GM8A 3S5AA 3BTSA 3PGA1 4G5OA 3N7KA 3CF0A 4K9RA 1YBMA 1O54A 2HYIC 3SD7A 2O2GA 3LGSA 4Z0TA 3RIHA 5A4JA 3UZUA 4G26A 5L3SA 2FMUA 1DOHA 5JS7A 1ES9A 2Q30A 2JGRA 1W0NA 2PH7A 1U98A 1KR2A 2JLQA 4G2NA 3DL0A 2WILA 2RS12 3LPCA 3FPFA 4WEQA 1UKYA 5HGXA 2R9VA 2F4VB 3ZK9A 5L6MB 5AUOB 4X0EA 3LCJA 2FR1A 4EPVA 2GBFA 1BO6A 1QEXA 3ZWNA 3E1GA 4HGRA 3QV1A 4GWNA 4EG0A 1JQKA 4B84A 4RIEA 2V8OA 2XYVA 5K01A 2IA5A 1XNCA 4F96A 2DX7A 4C04A 3EGXB 5EE9A 1PWHA 2VNIA 1S3SA 3BKWA 3IFSA 4JR0A 4MB6A 1F2TB 1ZM4A 3VPCA 4PDWB 4RPJA 1KEVA 4ERXA 2VHVA 2CC2A 4DR3B 1RC6A 3E61A 5H9VA 3VNSA 2W6MA 4Y9DA 2C3OA 4O3FA 5FBQB 4PBRA 1A4RA 3RG0A 1PO7A 1Y9JA 1B26A 3W5NA 4H7PA 3DQZA 2O14A 3PUHA 3CYFA 2RAUA 2CGEA 4HLUA 2EGHA 4ZYWA 3O4VA 4QEKA 1IXRC 4J0QA 4QUKA 2QORA 2AYXA 3IJ5A 3LXUX 4G8JA 1EFRA 3L6UA 3WNVA 3B51X 4V0NA 5KCZA 1LHVA 4A8JC 1KNQA 1Z73A 3NVAA 1I3MA 4R3WA 2XQGA 1OZAA 3JAKB 4W1PA 1X1QA 2REBA 4AI6A 4KBFA 3LECA 4B3SB 3ZE6A 5FUP