2WAOA

Structure of a family two carbohydrate esterase from clostridium thermocellum in complex with cellohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
GILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDSITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE E
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2waoA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2waoA02
4PF1A 5B4XA 3ABZA 4UAPA 4MO3M 2VZTA 4IUGA 3P6BA 1H6YA 3T2OA 3GM8A 5DQ0A 2OKXA 1ULPA 4K3UA 2J1UA 3BGAA 2QQLA 1PX3A 3WF1A 2E26A 2VCCA 3WNOA 3C7EA 3CKHA 1O59A 3T0DA 3CDZB 3K77A 4YPJA 3LE0A 5C7GA 1ES9A 3T0BA 5CD9A 2ORXA 2Y6GA 3I3BA 4PPYA 3NJVA 3DT8A 3NQHA 1CZVA 4QX0A 3I2GA 2VZOA 1P8JA 2J1TA 3C7FA 2DDUA 2R7EB 3LEIA 4OYUA 3EB7A 1UY0A 1WCQA 4GZ9A 1JZ5A 4MGSA 4QX2A 3LPFA 1K42A 2YFUA 2YG0A 1PX4A 3K4ZA 3OGRA 1GQPA 2RV9A 1JZ8A 1JZ7A 3NRUA 2ID4A 4QPWA 5LA1A 3ECQA 1VJGA 1OD3A 5JR2A 2EIEA 3T09A 1ESEA 2EIDA 2QQOA 1JI6A 1SG3A 3IAPA 4D8MA 3K75B 3OGVA 3AC0A 2VQUA 4DUVA 2VR4A 1W8NA 1TG7A 1XPWA 5HPOA 3IB3A 5IJRA 2DCKA 2HSJA 1UZ0A 1OF3A 3ACHA 4W4ZA 4MADA 2RVAA 2Q0SA 1UMIA 1EUUA 1CX1A 1BWPA 3LQCA 2Z4FA 1V2GA 3U37A 4QX1A 3IAQA 5JXJA 1K3IA 4A3ZA 1ULOA 3K4AA 4QX3A 4DUXA 1NUKA 1UXXX 2J22A 5G04L 5CZKA 4DXTA 4KMQA 4DXRA 1SDDB 2W94A 3NNGA 4RN5A 3SLRA 3CQOA 3GDBA 2BGOA 2WZ8A 1UY1A 3WNPA 3T2QA 3VDAA 1CIYA 3OBAA 4HG6B 3DCIA 3W5NA 2W92A 2YB7A 2W1UA 1GU3A 2Y6JA 4DXSA 1UYZA 3GGLA 4XUPA 2V5DA 4FI9A 2C26A 1OF4A 1J84A 2WO3A 5EIYB 2QQIA 3HN3A 5CYYA 3PT5A 1UXZA 1VYHA 4HF7A 5A4AA 1NX9A 2CDOA 4A45A 1UYXA 1D7PM 2JD9A 3I2HA 1LNSA 1JYWA 2C9KA 2LS6A 2WABA 4QB6A 4TX1A 3DT6A 1RYYA 3WF4A 3DYPA 5LA2A 3CZJA 3MILA 4GWJA 4AG4A 1OH4A 4A6OA 3E1F1 3VD7A 4CU9A 4XUQA 3SKVA 2VMEA 2ZEYA 1JZ3A 1KGYA 2BERA 1K12A 2VMDA 4M4PA 2VOTA 3HP4A 2VC9A 3VD3A 5IHRA 4XVHA 4K7JA 4QAWA 1HN1A 4BK4A 4IYJA 4JKOA 3HPNA 3ZM8A 4DEVA 3FN9A 3MV11 1W8OA 3DYMA 2XONA 5DMYA 2V4VA 3P1IA 3KVNA 2VM9A 4K9SA 3FL7A 4CUAA 4BXSV 4AAXA 2CDPA 1JYNA 5JXIA 1W9SA 1CZTA 4JJ6A 1I5PA 3UETA 1GNYA 1YQ2A 4BJ0A 4DUWA 4K40A 2WAOA 4JKLA 1XC6A 4BK5A 2Y6HA 3IDAA 2YC2A 5HOEA 3I2JA 4MOAA 4XUTA 3MUZ1 4LHSA 3C7OA 4ZZ8A 3HNYM 3I2FA 5EJ1B 2WO2A 2VZ1A 1MPXA 3WF0A 1GUIA 4OMCA 3BZWA 2VMFA 2V72A 2HYXA 2J1RA 1PP4A 5B5SA 1U8UA 2X09A 3T2PA 4OZOA 4ZXEA 3P94A 2VL4A 2Y8KA 2VZQA 2W47A 4L0PA 3IIIA 5JXGA 3VD5A 3A22A 1DP0A 2Y64A 2W1SA 3ACGA 4CVUA 1K45A 3I3DA 4CU7A 3T0AA 1UY4A 5B4NA 1W99A 5I0DA 1WABA 2XHNA 1O8PA 3I97A 3T08A 2VZSA 1NKGA 1XNTA 1IQDC 2QQJA 1JYVA 4OUEA 3OEAA 3WNKA 4RSHA 1UMHA 4CU6A 3DT9A 3MV01 4JGGA 4OAOA 2W87A 2VO5A 2WDBA 3WF2A 1PMJX 2EICA 4NRDA 1ZMBA 3CMGA 3OG2A 2Q0QA 1BWRA 5IFPA 2E31A 4JX0A 1DLCA 1FXWF 3PUIA 2WBKA 5C70A 5F7UA 4D0QA 1EUTA 4I8IA 3RJTA 1T2XA 3BN6A 3D3AA 4OAPA 4ET7A 2WQ8A 1K7CA 1DEXA 4M8KA 1JYXA 1UX7A 2ORZA 2VZVA 4TXWA 3LEKA 3WNMA 1O8SA 2WYSA 3DC7A 2KD7A 4RW0A 2YFZA 4E8CA 2B9VA 3OB8A 4MGQA 2X05A 4DEQA 2BBAA 3JXSA 4XURA 1JZ4A 4ARXA 2Y6KA 3SEPA 1GOGA 4M4RA 4XUOA 1JRLA 2ZEZA 1J00A 2VZ3A 5C71A 5JXHA 3EYPA 4A44A 2BZDA 3HJRA 4KI5M 2WN3A 1WKYA 4LKSA 5G05L 3MO4A 1IVNA 3VD9A 1R64A 5JD3A 4E8DA 3THCA 2HLEA 1JU4A 4QDSA 1JZ6A 3J7HA 4A42A 1ESDA 2XQXA 4CU8A 4OMDA 2E33A 2WUHA 1BHGA 4UI9L 3DECA 2JKXA 4HYQA 2ZEWA 5FUIA 2LW8A 2VCBA 4Z2AA 3PUHA 2VZRA 4JKKA 3WNLA 2BGPA 4PQQA 1TVGA 1JU3A 2W95A 5DN2A 2PQSA 4JHZA 2VZPA 2WO1A 2RJ2A 3C8XA 4QB2A 1YZFA 2J1AA 4BDVB 2E32A 2W3JA 4LQRA 5A1AA 5J1XA 1DYOA 4TTGA 1W9WA 2QQNA 4S1PA 4Q7QA 5BN1A 3ACIA 1DEOA 4JJ4A 3OEBA 1SHWB 1UY2A 1JZ2A 5JUVA 2O14A 1ESCA 3UESA 2W91A 1JHJA 3WEZA 2ZXQA 4P00B 3HOBA 2J7MA 2VPTA 1W0NA 2EIBA 2X10A 3HNBM 5HXMA 3C1UA 2J1EA 3CZUA 2DCJA 2WN2A 4A4AA 2J1VA 1UYYA 4W50A 2Y6LA 3ETPA 1UY3A 3VD4A 2B4KA 2W9XA 3VDBA 4GWIA 4QB1A 2APJA 3I2IA 3W7VA 2W1QA 1J83A 3A21A 4RYDA 2QBXA 3C7HA 1XNAA 3I2KA 4ARYA 1H6XA 3K46A 3WSOA 4Q9AA 5DPNA 2VTFA 2QQKA 3HEIA 2VZUA 4P02B 3F2ZA 3CIHA 2WZEA 1L7RA 2VQTA 1F4HA 2ZEXA 1US3A 3K4DA 2JE8A 4ZY9A 4QDRA 3HNMA 5LA0A 4XUNA 5IFTA 2VMCA 1NAEA 3FHQA 1L7QA 2XOMA 2L9LA 3ACFA 2JDAA 3W5MA 2W5FA 3MBWA 3SEEA 1FXWA 5EJZB 3WNNA 1US2A 5JMOA 4CUCA 1PMHX 1UWWA 4P5YA 3C7GA 5IYYA 4H08A 2VJXA 3DYOA 3FHAA 5LCWL 3A7QA 1BWQA 2YC4A 4LPLA 3WQBA 4KWUA 3NJXA 3UNPA 1GOFA 4W8JA 3MUY1 1GOHA 1KEXA 2QQMA 4PT6A 4UOJA 1Z8HA 1W9TA 4P08A 3LEGA 3LPGA 1F4AA 4JHLA 1CZSA 2VCAA 3I3EA 4ZZ5A 3WF3A 2WAAA 4JKMA 2W46A 3A23A 3SKJE 2J1SA 3THDA 1OT5A 2C4XA 4QDQA 3OGSA 3VDCA 4XZUG 4A41A 1GMMA 3GXUA 2W1WA 4CUBA
chains in the Genus database with same CATH superfamily
4KNWA 1OX4B 1VPLA 4OHZA 4KMMA 3SHWA 2O3SA 4F5EA 2YY5A 3VZRA 1IPFA 4MZUA 4N01A 1PS8A 2YVAA 4MHTA 1JDUA 2O0HA 3KT4A 2G9VA 4ZODA 2VPVA 2PBLA 4CT4B 3F5DA 5IK7A 1YQUA 4P31A 2FPUA 1YV9A 1XTTA 1LEHA 1W0PA 1U5BB 1HV1A 2Q45A 3WP6A 1HYEA 2GVNA 2ORYA 4RY2A 4W63A 1N0UA 4KVAA 1HO3A 2Y05A 3S1SA 1GARA 5TT1A 3DEHA 2F90A 3GGPA 4E5MA 1POWA 1CR6A 2G70A 1MKYA 1BD4A 1CR2A 1WUIS 3GJYA 3IJ5A 1K3TA 5K8IA 1XMJA 1BQPA 1Z6AA 5BNNB 1NQUA 3T3IA 2REXB 3JQFA 3DEFA 4Q8LA 3MELA 4JUFA 4YRJA 3ZHVA 4JL8A 3ST7A 1QGLA 1Z2NX 3RTCA 1WTAA 1ULOA 3EF1A 4IFTA 1LDBA 2QNIA 3VDNB 1TO1E 2ORWA 2GXSA 1VLHA 3D6NB 4CIBA 2HNAA 4AZZA 4FM9A 1XTZA 2A4KA 4G5XA 2NU6A 5THXA 3ETGA 1G9TA 3B82A 2BEUA 1YDFA 4G9EA 2WF6A 1M1YB 4XD7D 1JBCA 3QHAA 2RFLA 1JQKA 4CF7A 5FYVA 1Y1PA 1R081 1I7DA 3EGWA 4OFGA 1CY1A 3PF8A 1L0BA 3BJIC 1K9VF 4ND3A 3T6KA 2VCYA 1CULC 2RGBA 3N59A 1ADBA 3IX7A 3UV7A 2ZATA 2O8DB 5IT9A 3CWCA 1ZWLA 3M4ZA 4GXTA 4J75A 3IZOA 2XJPA 3KB8A 3V7WA 2H1WA 2LCFA 1KXJA 5K8JB 2HBYA 4MGZR 2JFUA 4O4JA 1NMXA 3M33A 3VVMA 2GJSA 3PC4A 4CUAA 1ZD8A 4XILA 1DC5A 1LX7A 2PG3A 2DBYA 4XIJA 1Y63A 1AR73 3MFAA 3ZWKA 4JKLA 5JDCC 4WFKA 2QRLA 4G37A 2GLTA 2OGSA 4YUYA 5B2ZA 2IUTA 2WIJA 5JH7F 5TIIA 4YIKA 2Q6IA 1OMIA 1WOYA 4Q4Y3 1Y8RA 1OOPA 1W99A 5JI3E 5A1LA 1P0FA 4S0ZA 4MW1A 1NCQC 4J03A 2ATCA 1S89A 3SZLA 3EX7C 3IBSA 4BCBA 5DO9A 1R1A1 3AUTA 1U04A 3KPUA 2PMDA 3TBHA 5CFPA 5D8AC 3ELBA 3C6QA 2WT1A 3BOSA 4EPYA 1KAOA 4I8IA 4IO0A 1ZZBA 3VC3A 1DDIA 5L3QA 1S0UA 2AOUA 1X8MA 1UPIA 1J9ZA 4Z0TA 3CGWA 3PE6A 4IG9A 3F6EX 4M4RA 1Y81A 4E33A 2PXHA 3ZOKA 1RIIA 3V0AA 1YS7A 4GQIA 2Y3IA 4A42A 5E7IA 4LN1A 1TM5E 4YACA 5TGZA 5AC92 1CWUA 5KYGA 4GM0A 5IW0A 3SLIA 2C92A 5DYTA 3AHHA 2GN7A 1T5TA 4XWKA 4NFYA 3KZXA 4DCPA 4NKRA 3V1YA 2D2FA 2YHUA 1TPYA 5JAPA 4C4PA 3P5SA 1PGSA 2JDHA 2V65A 3U4GA 4C7KA 1YXWA 1BZWA 2IWRA 4DRXB 1VPVA 5KYTA 5DASA 4D7TA 5LWBA 1HDGO 3UFXB 5D5PA 3U4SA 2EIBA 3SGLA 4HOOA 4P7GA 2H3EA 1FLAA 3T7SA 4OF4A 2EJTA 1EK6A 4LKDA 3S57A 5AD1A 2FPIA 1EDOA 5C3UA 5CB0A 1SQFA 5A4KA 1Y33E 3RS6A 3GJ8A 3V8BA 2H0BA 1E4YA 3ROFA 2PRSA 4JCKA 2BMFA 2G67A 3PK0A 1TUBA 2JRCA 5AM5A 1W3XA 4K8OA 3ELNA 5LCWL 3RAJA 1XRSB 4MW9A 4QPCA 1RD4A 4PZ9A 4DMLA 3JWJA 4FGLA 2I7CA 4XXHA 1E2EA 4K6CA 3OFSA 5F52A 4WVFA 1X7XB 5FV7A 4G2TA 4QDQA 1Z2DA 2F62A 3IKTA 3TPZA 4JIGA 4C87A 4X0EA 1VMIA 4GXLA 4TZ6A 2CSXA 1L4EA 4NIHA 2O5VA 1QGUA 1A4XA 5BSWA 1FP1D 4QM6A 1IXZA 1KFUL 3VBOA 2VH2A 3K0FB 2RGDA 4K6FA 4PZCA 4B34A 1KZYC 4IS3A 1UF2C 1VE9A 3QRWA 1IXSB 2XUMA 2I7VA 1DXQA 4LHZA 2GM9A 3T1OA 1UFOA 1K42A 1ZISA 1C1XA 2KI5A 3HCPA 2Z9DA 5I9BA 3AZOA 1IH8A 3IESA 2I2BA 1KPHA 1ADFA 1KRHA 2XDAA 2OQ7A 2QF7A 5FWXB 1K97A 3I32A 4E14A 1UXGA 4Q4W3 2YOGA 4GSLA 1Y7IA 2BUBA 2VBDA 2CUZA 5EESA 2WA1A 5KINB 4PX2A 1C4WA 5TSWA 3R3YA 3IT1A 4CCYB 1HR0B 2QXUA 3NANA 4QL3A 3WYCA 1ZU5A 2CHVA 1PT6A 3RU3A 1RRPA 4DQ0A 1ISHA 5ECGC 3MMZA 2HXGA 1ZIPA 2HK6A 3W5HA 1QHHA 3H3UA 5CK4A 2WO3A 4MR9A 1I7SB 2ZQZA 1B35B 2GPJA 4ZP1A 1ZNZA 3ON7A 1AJKA 4EZEA 2JHAA 4CR8A 3KEOA 3WY6A 2HH9A 2VUDA 5JAQA 4N5NA 5DG2A 2GXAA 3NDJA 5H70A 4CCCA 4OFWA 5D01A 3GLVA 3QLUA 4HUQB 4PG7A 4PCUA 2VRCA 2EWMA 4U9UA 5CB4B 3IKWA 1MQTC 3KEMA 1EUCB 1PL7A 4WIAA 5F3DA 3VM6A 3MGAA 2UUBB 4QU8A 5K3FB 2NX2A 4CYDA 2ADFA 4I99A 3K9WA 3R9KA 2WW8A 3T9BA 2X6RA 2ZAGA 2Y6HA 1E3EA 2AXPA 4FCVA 5TQVA 4S04A 3RSZA 1U0SY 4KXMA 1T4BA 2PRKA 4RHV2 5EHNA 1GG2A 3FG9A 4MRMA 2ZZJA 1Z6PA 4YPVA 3QOFA 5JO9A 1FS4A 4JU8A 4WVMA 2QPTA 3I97A 3BTVA 2E49A 1E98A 1RUJ3 1WZIA 5FO7B 2H1CA 1M2JA 5AVZA 3D9QX 1NPYA 3WKBA 4QKDA 2WVAA 3LVFO 1IJKA 3OG2A 3JQ9C 1NLQA 3U7FB 4BNVA 4RPGA 5E0OA 5LMUB 4D4MA 1W34A 1C81A 4M21A 4W65A 5EJ6A 1N2ZA 3IUPA 1II9A 4MVJH 1L3CA 3X1MA 4PYLA 4G5FA 2YMLA 4AFMA 3OPYI 3ORJA 1P61B 2CSGA 2HPZA 4UTVA 2Y1XA 3IP7A 1H2NA 2FQ1A 2VECA 4E88A 2Q2WA 4UCXA 1GUYA 1RMU2 4O4IF 2Y71A 3EFOB 3PHCA 5I7HA 2FH5B 1GPDG 5FD8A 4R68A 1SCBA 2A0KA 3DKKA 3ADOA 2DFBA 2WWTA 3SC2B 2KB0A 1Q15A 2YMPA 2E32A 1FRFS 3L4BC 3GAMA 4EARA 5J58A 1NVMB 1CUYA 1SLTA 3LBIA 1UBCA 3DE2X 2Z1DA 1BHSA 5HUJA 3QPAA 3LDKA 3K1YA 3NOXA 3OQ1A 1RC1A 1SC3A 4YI5A 5LCXA 2QM0A 3JAWB 2XH6A 3PDJA 4LQ4A 1SBDA 4RGVA 3W7VA 2Q4DA 2BQPA 3WUCA 3OD5A 4LJ9A 4UUNA 3HO1A 2DHDA 2B8MA 5DVZA 2WFZA 5MHTA 3EHEA 2A3NA 2IHVA 4I50F 1MJHA 1QC5A 3A25A 4DQDA 4QDRA 4TLMB 4Q0VA 2AZ5A 1EJ2A 2OFOA 1DRUA 4BPBA 3U6BA 4ALJA 1XV5A 3IUEA 5AW7A 1UWVA 4EG0A 2FHSA 5HHTA 2HMTA 5G40A 5IYYA 2WZQA 2W2PA 1U5YA 2LTNA 1ZYBA 4K8RB 2W6JA 3CUSA 3QHPA 2IXHA 2NOAA 1OH8A 1EWYA 4PHZA 3GH1A 1DIWA 2WS92 4ZZ5A 4Y2UA 1T5OA 1VAKA 5T52A 4PFSA 4XXPA 3MB8A 3AEXA 3EXEA 3DGFC 1CZOA 5HIJA 4AECA 4IIUA 3SJCA 2JJ8A 1EZZA 4BNDA 1V26A 1E89A 1VSTA 1Z5NA 3PUKA 1X1QA 4HFNA 1L7LA 1MA3A 4K6MA 4EHJA 3H1WA 4YM2A 3WRXC 5J47A 3MBIA 3AUUA 2XMSA 2QGFA 5GZGA 1QR2A 2J0VA 2O2ZA 1XYOA 4YW2A 2DBNA 2YY1A 4MQFA 4XF1A 4Y6PA 3MJFA 4YXFA 3A31A 2P9JA 4FHDA 1PO22 4IWYA 2XXJA 1TRHA 1T9GS 3ASYA 4KMOA 3RG2A 1WUTA 3JBG1 2L17A 4RGGA 1N3YA 5FR3A 1NQJA 1JHZA 2WD9A 2JB8A 3ZJ5A 4N5MA 5JOXA 3HBZA 3GRRA 5FI1B 3DQZA 4RR3C 4I9FA 3GB9A 3RVHA 4ZDKA 1F4PA 5H9PA 4RD6A 3U7HB 1OXMA 5JSKA 4XCVA 1GZ5A 2A9VA 3GP5A 1CIYA 1D2GA 1AMUA 2BKEA 2B69A 2ZU0C 4JWKA 3LIPA 1MX9A 5EJ3A 2ZBFA 8ATCA 3NVKI 3HN3A 1VBD3 3TD9A 4QMAA 5BNNC 2YNMA 5HK8A 1XJQA 3RH0A 5T4HA 2B7LA 3LY9A 4QATA 5B55A 5GIPE 5IPFA 4QX5A 5KOHB 2DV9A 5FBZA 4CM3A 1MQ9A 4NU0A 4D3SA 4EOGA 3ORRA 1GUBA 2WSSA 4LV6A 5EYXA 2ZJBA 4HH1A 4CU9A 5A80A 1KGYA 3ZWCA 4EN6B 2FQQA 2XECA 4FYMA 2AC4A 1BVUA 4WGFA 3OHPA 4L57A 1YFLA 2R5FA 3AV0B 4AYXA 2WYVA 2A9JA 5JFGA 2ZGLA 3R7WB 1K3FA 2R1VA 3OTGA 1OOEA 4CUGA 2X22A 4D44A 4ZO4A 4OGGA 4X85A 4REMA 1P1FA 2AYZA 4AVYA 3RUAA 4XCBA 4MOAA 3E9NA 2D0OB 4ZZ8A 3AEYA 3M5DA 1AYN3 3KKMA 4U7PB 3ANSA 4P6VF 3BICA 1MB4A 1EQAA 3NDBB 3DV0B 4Q9KA 5FCDA 5FZHA 3LGAA 1RLIA 4DPLA 3DMPA 1WGPA 1DQNA 2YMMA 4M3CB 4S1NA 2WU3A 3RYHA 5FTWA 3EY4A 5HGXA 4NYMR 1MGPA 2KW5A 7ABPA 1DIHA 4ZVUA 5JPIA 3ME2A 2NTJA 5JD4A 1SG6A 4EUSA 4JEMA 3V4SA 3ZEIA 5CHEA 3K70B 2PAKA 4J25A 7GPBA 2AN3A 4LBVA 1PJRA 1MJ5A 5BQPA 3KSCA 1YZNA 4KLNA 1H8TB 4E5VA 4YV1A 1N3BA 5IVEA 4F9TA 4ETIA 1GEGA 4CDQA 4XTRA 1IIRA 3KAKA 2V9PA 5J2UB 3K53A 5C3PA 4EB6A 5REQB 4B6RA 2PGIA 1W59A 4OBEA 3QKUA 2BKUA 4WV3A 4BU0A 3N2GA 2JD2A 3GUVA 2AA3A 3BRWA 3PZBA 3QVWA 5CIWA 4RVSA 1FCJA 1FFEA 4K6BA 4AMGA 3C8XA 5FUNA 2FKNA 4RSMA 3NVAA 3IA2A 2H17A 5FZKA 5JUVA 4HSGA 1VECA 5H3HA 2PZBA 2WHPB 2XDQA 1TEZA 1GNVA 5D51S 5BV1A 4AYUA 3MSXA 4CR6A 4IMRA 3UJBA 2OD9A 3VPGA 1YQWA 1KOJA 4Q24A 1E79D 3NFRA 4FFVA 2FMXA 1ZINA 1T9CA 3WDTA 4HC4A 3ZDFA 3H3FA 3GLUA 1YFZA 2WFLA 3RMXA 4J1NA 1OXKB 4KNVA 1AN9A 1TUGA 4LY0A 4NAOA 3RUEA 2FPPA 1SWWA 1QJU1 2I87A 3D31A 4R4ZA 5KYVA 3GVCA 2R97A 4P92A 1U98A 1V11B 3QKTA 4JUCA 3HM9A 3KLOA 5JOZA 1XL0A 4C6SA 3MWEA 1WBFA 1UKCA 4TWAA 3JQ8A 3A3PA 5EZSA 2G5GX 4B0PA 3GELA 2WZCA 5K6RA 5IBRA 2YYOA 1N9GB 3CPHA 3UWKA 5IVHA 5JS6A 5B4XA 1GL7A 2O2XA 3KZ1E 1ADCA 1RXVA 4FQ5A 1COZA 1H6YA 3PFKA 4KGVA 5HXVA 1PO7A 5ALXA 2H4HA 1L5FA 3QITA 4MWBA 1D1TA 2X23A 3HKCB 4AS3A 5AI8A 1DZTA 2GAIA 2YIMA 4INOA 2AKAB 4TN7A 4C2BA 2KBFA 5FIXA 5FMBA 3NM5A 1GQGA 4BNZA 3AXEA 4LI0A 1LOBA 2ZYSA 1ND3B 2ZITA 5ALTA 1GTRA 4AVSA 5A3VA 4CMEA 1P2BA 1IXRC 2GVZC 4DIFA 5FA5A 7MDHA 3W7AA 1PR6A 3DYBA 2O8EB 2Z1MA 4MEJA 1OXXK 3V8RA 3QELA 4LXGA 1KDRA 5C46F 2OD2A 3PVZA 2RJ3A 4ENQA 2PQQA 5AESA 1BX3A 3I76A 1RMQA 4E1BA 1TTQB 5I7UA 3INAA 1WIWA 3HH8A 3OCWA 3VHQA 3BCUA 5DW3A 4FCCA 1NWHA 2JAOA 2HPAA 1BJTA 5EERA 5G0TA 5ENDA 1QK5A 1RUD1 5EZQA 3JD73 4IAOA 3HFSA 3UJDA 2CFCA 4E5NA 1ZA2A 2WJAA 4PZYA 1A8UA 5HQ3B 4MGYR 1H6DA 2Z0MA 1W4BA 2BUCA 1X42A 2IY8A 1D1SA 2YHAA 4QPGB 4EG4A 4PQFA 1L1EA 2ADOA 5KBYA 1MW8X 1YHNA 2CLIB 2WUDA 5EV7A 1E1CB 3VLBB 4DQAA 2X13A 1DKNA 4KOAA 3RRZA 4BB6A 2GPNA 2DQYA 1NF3A 2QZ9A 2VKTA 3RIYA 4EZBA 1TGYA 5K01A 2DF7A 3QE9Y 4BMOB 3BSYA 2XBUA 1YRHA 4L22A 5F6KA 3VO8A 3UJ9A 4F6RB 2ZHMA 4HK9A 1BDJA 2VXYA 2QTCA 5EHIA 4KN6A 5C8XA 3II6X 2AZDA 1F2NA 1TA9A 3V42A 2XVZA 4R1PA 5A9TA 1ORRA 1YZTA 5HOEA 4BQYA 4O08A 1KQ3A 5HF5A 3STTA 1YS1X 5AXBA 5KKCA 5IEBA 4JEIA 3IKVA 5C1DA 3COVA 4IH1A 3BT7A 5AVPA 5IUNC 1KPGA 4RTNA 1JVSA 1DP0A 3NQ41 2EX4A 5ER9A 5K4GA 3HNRA 1Z5VA 4MWSA 4LXHA 3GJ5A 4B75A 4EN8B 3WK9A 2H1FA 5IXJA 1KOGA 4GG1A 2FEXA 1Z7S1 1U2EA 5CLHA 1Y3BE 3HA7A 3HJFA 3CLTC 1JDBB 3KQYA 2QLFA 4JI7B 3WCRA 1Z5ZA 3A2LA 5E6UA 5HIAA 3T4VA 2AJBA 2F3QA 3G0IA 3PNPA 3H9JA 4LZOA 1UIRA 1PGW2 3PJGA 2FDKA 2ORZA 1OAAA 3VDDC 3HRHA 1NXPA 4PGMA 3PENA 4MQ5A 3Q8AA 1YWKA 4EKNB 1H8VA 3QYFA 5IBPA 3LA2A 3FPCA 3X2SA 4HZUB 1W8DA 5F2SA 3UAVA 5HGJA 5LP1A 4BDTA 4HN0A 1U5CA 2Q6VA 4JZKA 3TIGA 3E9RA 1J97A 4KJZA 4R9AA 4J1SA 3U1BA 2PGOA 1WCYA 5FRAA 4EECA 1AL23 4UTZA 3M9LA 1PFGA 1FFHA 1PZXA 1RE0A 4LYFA 1LHWA 1E3SA 4R84A 1XZHA 4GPIB 5AIBA 3QEKA 1XTVA 2A71A 2G4CA 4L74A 3WEZA 5DGIA 1GFSA 4JB8A 4A91A 2JLYA 4Z0NA 2JAWA 4KKVA 1GRRA 521PA 2XNKA 2X10A 1VALA 1QDCA 3O7WA 4NH0A 4P53A 5E6SB 3TLGB 4N41A 1F8YA 1U5ZA 5LDDC 3T5AA 1OLUB 5LQMA 1DARA 1O87A 3VU8A 1ADJA 3OFND 3E05A 3NJ8A 1EK2A 1GWLA 4XPIA 4U2DA 1J70A 1XVUA 4LYGA 3UAXA 4MEBA 1N47A 2J9ZB 2AC7A 2OO7A 1Z78A 1DAKA 4HAVA 2JCXA 2DPYA 5A05A 4QYSA 3KK0A 5L36A 4FK8A 4O7XA 1P81A 2IHYA 3HC7A 3OBBA 3LOPA 5CBKA 1OI7A 2R4QA 5EN4A 2XOEA 2HA3A 3H19A 1IZ9A 4X8PA 1OA0A 1H23A 3AJEA 4AX8A 3LIIA 2ISQA 4RDCA 3CVXA 4KQFA 2FZVA 2PD6A 2PHXA 1K86A 2ZT8A 4YVWA 5K20A 3NJZA 4Q7LA 3PEFA 4C05A 3UGKA 4FD2A 4GE0A 4ND5A 2PQMA 1SPXA 2QN1A 3PFFA 5E95A 3O92A 1CLEA 2QL9A 5JI2E 3LEIA 4N7IA 3ED1A 1RHMA 1WHSA 2FSVC 5AKIA 1YONA 2VWPA 4X1KB 2ENUA 2O05A 4QPNA 3ZNQA 1JWBB 2L69A 3G0BA 1P1KA 5JTUA 2QVZX 1ZNXA 5A3MA 3PU8A 3RYRA 2G71A 1IUNA 3DLAA 4ZIRA 1BVP1 1B3BA 2W2QA 4LJ4A 2D7JA 4E2XA 2P7HA 3THWA 4M1EA 2FCTA 2J0SA 2VJLA 1LTEA 1MS1A 2R00C 3A32A 3NTOA 2NZWA 3K4AA 4ASLA 2PA7A 1OC4A 4MWZA 4IDBA 1GZDA 3BAFA 3L41A 1QFMA 4WK6A 5JAXA 3AKSA 4RF4A 3PJRA 2WZ8A 2XPJA 1EWRA 1RUE3 2OV6A 2QEQA 1I3CA 2YB7A 3IBYA 4OB8A 3I2DA 1E3QA 4KRXA 4CCEA 2E5LB 2C9AA 1TEVA 3M6WA 4I6EA 5AXAA 3EPPA 5IAOA 2VDJA 5DAVA 1ZRDA 1EM8B 3R7FA 5CFCC 4ENUA 2PX6A 3I2HA 3JYHA 2RK4A 4NOMA 4QB6A 1P7PA 3IS3A 2R5NA 5B4TA 4NRPA 2RJNA 1LVGA 3NEYA 1PZNA 2DT8A 4K2HA 4U2FA 1DE0A 5AW9A 3G8AA 4MGHA 2X2PA 3RUDA 2HMYB 3RSCA 2H1LA 4OHKA 3KMHA 3SYKA 3BKWA 3LAGA 4DF3A 2GTHA 3H97A 3UC5A 3QVUA 5F5IA 3LDAA 3WMFA 4TROA 2ZCWA 5IC4A 1O2DA 3AEUB 2OGZA 3UETA 1R2QA 4D26A 1S7CA 4MDYA 4C3ZA 3EBPA 2X41A 3MYYA 2QIOA 3VGJA 2M6SA 4L5BA 5A9SB 1QZUA 4P7KA 1WXFA 3I52A 2BGCA 3KOUA 2IOQA 1QH9A 4H1UA 3EAGA 2J1RA 2MPFA 3M3PA 5F7JA 1Y5LA 2ETVA 3WWDA 3ZXGA 2W47A 2ZGQA 1G5FA 3PMEA 4IJWA 1XU1A 4CTEA 3JQ7B 4XQ9A 4WSOA 1OLXA 4IDEA 1OWLA 3IE1A 3DE4X 5CM2Z 2PSDA 4ZCMA 2KJQA 3H6HA 2P35A 3ZE7A 3CZ5A 5GINE 1DZIA 5B58C 1MS5A 1UZUA 3D6HA 3MYRA 4JGGA 4NMWA 2YV5A 3R3WA 1VBB1 2DHEA 3SS9X 5TPZD 5H9VA 3VYRB 2EIHA 2R6JA 1K9SA 4WCDA 2GESA 4NFHA 1Z0KA 5DLDA 3VPFA 3KP1A 2DU1A 4MS3B 4X64B 4LBYA 1SOWA 1UBUS 1YQGA 5FYDA 2VZVA 2Z5WA 1AZTA 3FFXA 4IHQA 2R7KA 2D5BA 5JXHA 1EGVB 2BWJA 1E1KA 4G9SB 4LBWA 3SKYA 3W90A 5EJEA 1DRJA 2FWPA 3O21A 3GMIA 4PLCA 1YF3A 2R073 4OQFA 4QXHA 4UM5A 3TQIA 3ND5A 2OZLB 1SC1A 3F3YA 5CXSA 1WD3A 5ENZA 4RL4A 4Z2AA 3M4YA 5JCJA 1TVGA 4XJVA 3KJXA 1ULSA 4RGAA 4YWJA 5B64A 3KQLA 2WFF1 1QIHA 1AS2A 5AJHA 1H8TC 2UU9B 1PNGA 5A1AA 3KAPA 3ZYCA 1PK8A 1JEYA 2VMIA 3IMNA 1I24A 1LULA 4RPLA 5JBNA 1VB4A 4KQJA 1PQUA 2SECE 2WUVA 5CDYA 1EWKA 1LHVA 2EGUA 1VP9A 1U0TA 3ETPA 5AKZA 4IEPA 2YU2A 1CJTC 5HZGA 4ZQGA 1LVHA 3PX7A 4JQCA 4BEWA 1CPNA 3HYLA 1W6QB 5KOJA 2VTFA 2VZUA 4OJKA 3M5WA 5JISA 3ZKUA 3BF7A 1UOJA 3S2GA 3UHAA 2H7VA 1O96A 3L7YA 3HQRA 3NIGB 4ZQCB 5IFTA 4CFSA 3V8MA 1L7QA 1K8XB 3DMFA 4RTQA 3OQBA 4WESB 2R6FA 2VPYA 1A8PA 4HWOA 4JR1A 2P67A 2OUHA 3ESDA 4YRKA 3DO6A 4AWBA 3DAFA 2QDRA 2GZRA 5TMDA 2VVDA 1OXBB 5DX8A 5KVCA 1U7HA 1YD7A 5CNIA 4E3ZA 4X8HA 2W6PA 3VR6H 2FYTA 4AUKA 4YAOA 5F1OA 4PC6A 2P3LA 2WAAA 1I1NA 4XMIA 2IXAA 3NHPA 3T1HB 2AEFA 4HNAB 3T9AA 3O91A 1R3UA 4DUZB 4US1R 1FYUA 1ECCA 1Z8FA 3MHTA 3LX6A 5ITZB 3M5PA 2QRPA 4XJXA 2R7MA 1JXMA 3HEMA 4IM7A 3ZXAC 3Q41A 2FLKA 4L3VA 3NNDA 3D4OA 4TKMA 3VBEA 4R8LA 4ZVTA 3O4JA 4YJDA 2GJAA 2IQ5A 5EIAA 1TRKA 1BVVA 3DTVD 2WKSA 4KGQA 4JR2A 1QXJA 4D6QA 1GCIA 2JG3A 5GONF 4JI0B 4FBGA 3OGRA 1O08A 1JZ8A 1Z36A 5FPYA 3KQSA 4FDAA 3TN93 3W3AD 2QQOA 2J1LA 4FNGA 3PICA 1HRV1 2W08A 1VA4A 3DOFA 5CVEA 1T0IA 2PZAA 3GLFA 2FQYA 4KRYA 3AR5A 2NSJA 5CXQA 4S2UA 4E5PA 5EKUA 1RUH3 1ND3C 2R1ZA 3GCDA 1E57A 3PNBA 1S1MA 1R8SA 3PUQA 1K5HA 3B9RA 4D6XA 3HY3A 4Q00A 1RUF1 2ILVA 2JDPA 2J33A 3CKKA 1OZGA 3GGDA 4RHUA 2GNDA 3KSDO 3MGCA 2VTXJ 2R8YA 1F1BA 1HQWA 1EEHA 1KK1A 2Z6QA 2HF9A 4B80A 3LQYA 3TQSA 2I7DA 1RI5A 1OC1A 2PV7A 2G4LA 5T5OA 1YQTA 3TSYA 1EI9A 3W2TA 2V0NA 4FD3A 1XNQB 2DUMA 2OENG 1MVQA 3S28A 4R51A 4F4IA 1O95A 2X6QA 4RENA 4KKXB 2PSHA 1S8OA 2H4WA 3PC3A 2G9QA 3Q9OA 3LUDA 1Q92A 1BOOA 1CYDA 2I6XA 3LX4A 1W8OA 3KQWA 2SCUB 1R6VA 3QE2A 5HDQA 3VPBA 4OSEA 1ZIXA 2DCYA 3CH7A 5TT0A 1CN1A 4EWEA 1X7DA 3G7NA 4PG4A 4R8SA 1UK6A 2HBTA 3BIFA 4KE7A 621PA 1FFXB 1O7JA 5HIIA 1PK6A 3S7EA 4NOTA 4FDVA 1TK2A 3HBAA 3IP8A 2G36A 1HLGA 5KO2A 1YB2A 3DKPA 4RM2A 5AHWA 1FTQA 3CEAA 3T08A 1GDTA 1PD1A 3QLVC 1IQDC 5HJ7A 3FY4A 3ILHA 2EU8A 4RABA 3OE7A 1SKYE 3HWRA 3MWLA 4QRHA 3J26N 1H9AA 2FWIA 3GG9A 1OQAA 3AUSA 1EFPA 2VOXA 5EFZA 2ERCA 2XYPA 3IVXA 2FUNB 3JQWA 4AC9A 5HS6A 2AR0A 1QTIA 3EFBA 4DNOA 3FOAA 3GN1A 2QLBA 3C97A 4H31A 4S1OA 3BWVA 5BSKA 1SVMA 1JDBC 1ZSNA 3WYFA 2IY7A 2ZJ0A 2V45A 3DJYA 1BFKA 4XUDA 4F5WA 3N8IA 4Y6OA 1U7DA 1UZZA 1RMTA 1DZRA 4ZYWA 4LK2A 1JI3A 1ODMA 2H29A 2GU9A 4POOA 1UK8A 4AFDA 2BWAA 5J4KA 5HW0A 4MLOA 1SZJG 5KXDA 3U80A 4RZUA 3P0FA 2YWCA 4IUYA 2DFKB 3MQFA 3L9WA 5FI3A 2Q6LA 2OBMA 2XB6A 3PQDA 4CETA 5JOYA 1DQ0A 3PNOA 1GSAA 2X9VA 2O5RA 1MS9A 4LX0A 4LNUB 4UFKA 4QHBA 2IPNA 2ZB4A 4DBVO 4IBOA 4B2PA 3AIMA 3N36A 1RWQA 5I4CA 2YX1A 5JSOA 4S05A 1WDLA 1GQ2A 4D25A 1LTKA 4P3XA 4BMEA 3F2ZA 1PK7A 4Q4X2 4ZOLF 2EIGA 3ZUPA 4FW8A 2ZULA 3F8TA 1NNEA 2P4EA 1DDOA 1FSFA 2WDPA 1S0EA 1M6VB 1WZNA 4WOPA 4M9RA 5EXOA 4GZ3A 4MW4A 2CW5A 5F23A 3WQBA 1JYCA 1JMUB 4XB1A 2YL2A 2O50A 1Y1RA 2ZSFA 1ZZEA 1EYZA 1HL7A 4FCAA 2YVKA 3E6AA 3U60B 1DX9A 3DCQA 1K5PA 5I3CA 3B5IA 3C6KA 2OQIA 4C06A 2ZYIA 1H6CA 3LT5A 5A32A 3NO4A 3FB1A 1NR1A 4QX6A 3EIXA 2O8OA 3K2OA 4ZAXA 5BR7A 3JALB 1DBIA 2OXEA 1WB9A 3BHJA 4GC5A 1TU3A 3WHTA 1WXEA 1E4EB 2I4NA 1H1MA 1QJY1 4JLJA 4XX1A 3FAKA 3EEOA 2IXLA 1GM5A 4UJ3A 3VSEA 1XXHA 3I8SA 2CDAA 1R0WA 1ZUNB 1UMCB 1X80B 1WQ1R 2VPQA 1YUBA 2FLWA 4LY9A 1L5QA 5L7OC 2JEYA 1QRDA 4Q1EA 2PL9A 1B93A 3QNWA 4W5HA 5CURA 2FXIA 3Q0TA 1UAYA 3OMXA 4P38A 3ESAA 1L4GA 4B82A 3M6UA 4AKEA 1GPYA 5G04L 3ICCA 4GS5A 5JS2A 1HYQA 3DEYX 1UKVY 1E59A 2BM0A 4BE9A 4E11A 1L1RA 4F3TA 1K06A 2C4VA 1K8RA 3SF8A 4KIGA 5FDFA 3I6ZA 1VCOA 3AP2A 1SUAA 1MDFA 5E3IA 1BROA 1L5LA 4IV1A 2L2QA 3HYCA 1NBAA 3B7WA 3SYMA 4W82A 1W44A 1VKOA 4BQ2A 4EH1A 4I1PA 1PM7A 4KPUB 1OPMA 2VYQA 3WF4A 1P3Y1 3CRQA 2VVEA 1U0EA 5ALRA 5KX5A 4GWJA 3KLBA 2C03A 1FOD3 1T5HX 4FKZA 3QJ5A 4Q4AA 1EWTA 2ZSKA 3EZXA 2AOVA 3CLKA 4MH0R 4BVHA 2GBPA 1OW3B 4DMHA 3DE5X 4NCNA 4H7FA 2B99A 3P1IA 3FL7A 4N8SA 5F9TA 3QI2A 3KM5A 1XCJA 1GNYA 3OEHA 1FYFA 4MIKA 4WZAE 2RM21 2DPXA 4AP6A 3CISA 4FONA 1RQLA 4CLHA 1E7QA 5IAGA 1RWPA 3BZWA 1NU6A 3R41A 4P0QB 4IOLA 4BO0A 4D6SA 2NXEA 4B3TB 3DL3A 2E5WA 4S2HA 1T1RA 3RO7A 1UY4A 5CFNA 2QZ4A 4GKVA 2CKDA 1GRNA 4E4YA 1W85A 3AKCA 4UFPA 2YV3A 4PIPA 3CLHA 2VDVE 1C3VA 4P9YA 1GZ9A 2XCLA 4OK6A 1MAWA 1NY71 1Z6QA 4RSGA 3LQQA 5BOVA 1E9SA 3OESA 2PQ6A 2PUBA 3QKRB 4RTMA 5DHSA 3KZCA 4H1VA 4EY4A 1U9CA 1NVVR 4G0MA 1GQYA 4ZCPA 3GAFA 2DFPA 2BSQA 1A4UA 1ONNA 1TYBE 1EG2A 1RE1A 1LCIA 3AHFA 4YJ3F 2Q07A 1V00A 1YRQA 1ZH0A 1U6IA 1TCAA 3JARA 5DG1A 4RSUA 1O3RA 2XB9A 1QQAA 2A9QA 2G07A 2DFNA 3ZZTA 3I64A 5FYYA 3E97A 1JTVA 4KW7A 3RGWS 5EJ7A 5K51A 3ZBTA 5KWJA 2W6QA 5EZYB 2IKSA 4CIDA 1IXKA 4RR3B 3UKNA 4DM4A 4L9WA 1F5NA 4MUAA 1VHQA 1KH1A 3B38A 2VNIA 3HCWA 4X62B 3K8YA 4BATA 4I9NA 5LUBA 3MQ2A 4IEZA 4KXYA 1ONAA 2PZFA 5B53A 7REQB 3N8KA 5DXJA 4I30A 2SKDA 4LBZA 1NVKA 2I1QA 3DZKA 2JH9A 3KSUA 4TTIA 1V0JA 1SCSA 1W8FA 1M2EA 2LUWA 1Q91A 3P2IA 2HDOA 1P80A 1NZCA 4CLRA 4JUBA 4CP1A 4OI2A 1GTJ1 4AFNA 3A9UA 5LWHA 1W6PA 5AKGA 3GH3A 1ZBDA 5GLVA 1HT0A 4OEHA 4BKOA 1IKQA 3P0IA 3KB5A 4O5OA 1Z37A 1Z2AA 5JMOA 1IC6A 1D5WA 3ZXYA 1GNTA 4AOCA 1R8YA 4F3NA 2B7YA 1LZLA 1RJ9B 4KU8A 1RKUA 5C8YF 4BJHB 5EHDA 3WWZA 2OL4A 1Z8HA 1D4ZA 4FQ7A 4AAYA 1S55A 3SSMA 2D7FA 2R30A 1GMMA 4CUBA 2R6DA 2Y1DA 1DWPA 5B2EA 3RS2A 1Q7TA 2PFWA 2HWC2 4DUYB 1W581 1W6UA 3ONNA 5ECYA 1OLOA 5DDJ2 2X0KA 3MYXA 4GU5A 4LXLA 4PR3A 4FDTA 4RK6A 1PL0A 3UK0A 1R092 4NCKA 4TLEA 1OYVA 1T1EA 4C5AA 2HMSA 2Q49A 2JFYA 5CVCA 2VQEB 1GGMA 1H8ED 2XBO1 3CUYA 3OX4A 2XW6A 2QTGA 3RMYA 3T09A 1VBA1 4KODA 4L9AA 1XJ5A 1XPWA 2C61A 3DEKA 4Q27A 4Y2RA 3LWNA 3V2GA 2VNSA 5ARCA 3P9NA 5CKQA 1RM4A 1YJAA 1UT5A 2E1RA 2JIZA 5AKKA 4EJFA 3ZTYA 4H0FA 4NF2A 5IDVA 5F5QA 4N76A 4RD0A 1Q95A 4LXQA 4RTOA 1G5IA 3DEJA 3DKQA 2IYOA 2C6SA 5C3RA 1V6JA 4JYZA 4KMQA 1FP4B 4XIYA 3CBGA 5TY0A 3MWDA 2OXCA 2BV4A 4LA4A 4QICA 5K0TA 5D5HA 4Q3KA 4BCCA 3JQ6A 1BMFD 2ZJ5A 1ZC4A 3EUEA 3M5CA 2ONJA 4ASUA 5ALNA 4RHYA 4XIGS 3C7KA 2JI7A 3RS5A 1M75A 5DAXA 3USES 4BLUA 4XQ4A 3O94A 4K88A 3G49A 1XMIA 3Q2KA 1XSEA 3V0BA 3UB2A 4RVFA 1JHPA 1V70A 1XWIA 2DKNA 4YHBA 3U7QA 2Z30A 2H6BA 3GJBA 4ZYTA 4KR3A 1REDA 4AJEA 3WCSA 4TQGA 4RIFA 3WB2A 3RADC 2GPTA 4PSUA 4Z8BA 3B69A 3TRKA 3OJOA 5C5CA 1B15A 1RWOA 4XWYA 1GAEO 4MJXA 3I12A 1CAXB 1YQEA 4RMIA 4BJ0A 1Q1EA 4D6RA 3I34X 2OUIA 1MH1A 2H51A 3PXGA 3R4UA 4OQ9A 4ZJUA 4KFCA 2HNBA 3K72B 4NONA 1L8XA 1S2DA 3QLEA 2I1LA 2P27A 4KNYA 1WXQA 2QMOA 2R3SA 5DBOA 4EB0A 3HD8B 2WFAA 3KKOA 2FN8A 1KD7A 4IX1A 1QUEA 2BJWA 3N9NA 4C2TA 2VUCA 1ISRA 2F1KA 5FZ6A 4RH0A 3E8XA 3OA0A 1JHAA 1LPNA 4OUDA 1ZVQA 2ARAA 3OFVA 5HA5A 3D3AA 4NPCA 4LBNA 3F67A 2BR5A 5BNZA 1M7BA 4M1ZA 1ZRMA 2V7TA 4XDQA 1E7RA 3Q2OA 2ZJ6A 2PRJA 1IBSA 5AVYA 4LE0A 2NP7A 4JVNA 4ATEA 3N35A 1U0HC 1GPLA 4A92A 3HT2A 4PS1A 3I37X 4GJZA 5EJ4A 5CDHA 4G1UC 2AMYA 1TX4B 2ACKA 3TZKA 3ILYA 4ZOAA 4I55F 1QQP2 2JFZA 2BE9A 4EF6A 3E9ZA 1EWVA 1XE0A 1MV8A 3ZVXA 3QWFA 1VZ2A 4KTTE 4EQVA 1GGFA 4J8PA 2OCIA 5CLLA 5IK8A 2GDFA 2XLBA 4AZ3A 3KVBA 3KVRA 4P81A 1AUQA 4BS9A 4YW6A 1GNLA 3OYWB 2XR4A 5KVVA 2HU2A 4R1NA 4QUGA 2QTRA 2DBIA 1YRWA 4PCRA 1M76A 3LA3A 4TKVA 2WMOB 2YHIA 4WM8B 4ARAA 5NULA 2W9XA 1T3LA 5I7AA 3WINE 3WLPA 3OPXA 4CUJA 5CYGA 2PKYX 1YS2X 2CAVA 1RWKA 1B0PA 1IN6A 1YIPA 5DPNA 2F3RA 1L4BA 4NEGA 4P5EA 3IQEA 3BERA 1EB9A 2Z9BA 3FHQA 4BTVA 4OHVA 5FV3A 3HDTA 4IS2A 2FZ1A 4D0SA 3L93A 3WQSB 2R65A 2RDMA 2X1HA 2CHUA 4YSFA 2R62A 4LC1A 3FF4A 3JATB 2H9AA 1IQAA 3Q7QA 1DJPA 4ICIA 1LCLA 1E2PA 2B8EA 5G1OA 2QD4A 4DLLA 4Y2VA 1H9PA 1OX5A 2GASA 2OSVA 1VGQA 5CVTA 3RT7A 2XADA 3KCQA 1YH3A 4MGZE 1JT2A 2FW9A 2FPMA 2PX3A 3QBTA 3FUWA 5I0TA 4OHYA 1ULTA 4O4JF 3OF2A 3S2EA 1ZCAA 1CAUA 1ELOA 3DVAA 2CFIA 5BT9A 5LBTA 1Z56C 3IO5A 2D6NA 4MVWA 1RPZA 4M0FA 2RS31 3DC2A 4YRGA 4ARCA 1KJJA 4DTIA 3DTYA 4DL9A 4NJMB 2X0EA 3ZHZA 5GZCA 2X53S 1X9TA 3K4HA 1Z26A 1RYMA 2HAEA 3E3OA 1UT8A 2CJWB 4IR7A 3OLWA 2XG3A 1Y6JA 1JHDA 1JIIA 3JS5A 5I7EA 3O8QB 3IBCA 1DC6A 1PR0A 3U37A 3VDDB 2MCFA 4UHJA 1GU1A 2EF6A 1CNEA 5T64A 4OCZA 3ROEA 1YDGA 2G1MA 1SEFA 3KJFA 3CJTA 3EQ9A 3ZI0A 5CX1B 1N1TA 4ZCQA 1KJNA 3N6VA 4AURA 3OE1A 3EOZA 1TIPA 4ERNA 4KITB 3TCKA 3HU3A 5A4DA 2GQ0A 4X8MA 1GA1A 5JAUA 4NUBA 1YWGO 2O7NA 4B5KA 1D7PM 3A6ZA 2XSZD 4TV8A 4M8NE 2G9NA 2WT0A 3TSZA 1RHI2 2IEZA 4B74A 1E6UA 4AY6A 3V34A 4A27A 3KFXA 1VP6A 4YJ2F 1Z88A 2HF2A 4B48A 3C8ZA 4K7JA 3WBJA 4A36A 2GK4A 5LL6P 2DH5A 2PAEA 2RMKA 1NW3A 2JLAA 4HDRB 5GOTA 5J1TB 2WHXA 2I3AA 4MWGA 2XDVA 5D3MB 3REGA 3RGBA 4HAUA 5FUPA 4WOJA 1QHGA 2VUSA 3R5KA 4F6CA 5CG9A 3EO6A 3UJ7A 3VVLA 1GUIA 2WE7A 1IPKA 5CP8A 1HTTA 4LLFA 1C29B 2O0OA 3VKOA 4ZS2A 1UOEA 5KYXB 5A7OA 1RYBA 3K9GA 1IPJA 1P0PA 1GG5A 3QEJA 3VHRA 2GA9A 4IJ6A 2WK1A 2KBEA 4R71A 4RA6B 1W0JD 1IOLA 1NJSA 4G26A 4FFIA 2OGUA 4FDLA 1BMQA 5J48A 4JU9A 1QV6A 2CD9A 3A0RB 1YUNA 1YE8A 3EVCA 1UDAA 3VJMA 4QQNA 1O3YA 3HXKA 4OXRA 2OV3A 4D9BA 5HKKD 3DP7A 3LKZA 1P7CA 2B0CA 2PTMA 4PWZA 3FC0A 4RF3A 3DZDA 5ALHA 3F3MA 4D81A 3Q7SA 1Y7PA 4BHTA 3V1KA 1Z0FA 1OQ1A 3MWJA 3ZYGA 4AMZA 1RJGA 1PJTA 3ROUA 4N9WA 1YDHA 2BM9A 3TYXA 5GV8A 3W1VA 2BMWA 3DMGA 4YR9A 2JLBA 4L6IA 4FINA 1IHXA 4PE5B 1KY3A 3BMXA 1SXHA 1D2HA 4D9CA 2GFQA 2BPA2 1EVKA 2YOHA 2VNKA 3ZWXA 1FC0A 5CBPA 2Y67A 2E7TA 2FEMA 4UTNA 3GGGA 5CEFA 4CHTA 4PX3A 4IF4A 1D6JA 1RIRA 2JFHA 5JBQA 4ZDIA 3J7NA 1IZ3A 2QVBA 3PR1A 2PL3A 3T9CA 1TD1A 3B01A 3ZIAD 3FOBA 3GEIA 4WEQA 4XSHA 3HOBA 3E03A 1XHEA 2IH5A 2OHIA 4JB3A 3G6WA 5B1HA 1JOBA 3I4FA 5FK7A 1XZDA 1AKRA 1D1QA 3PA6A 5DHAA 1LPPA 3RS8A 4NL4H 5E4JA 1COWA 4D9GA 3AX4A 4X6LA 1DU4A 3EZ9A 5GQSA 8ABPA 5SV8A 5CFCB 3LRXA 1W1IA 1QE5A 1K5DA 2QP4A 2XCRB 4B44A 3LF2A 5JO0A 1FXWA 4RY9A 5EJZB 1XPRA 4GOMD 3B1ZA 3URMA 1Y4DE 3RIXA 3RBAA 2X5XA 3D8UA 3APBA 2PUHA 3TKAA 5BYKA 2ANCA 4W99A 2YV8A 1GOFA 2E51A 4R05A 4F72A 5FUMA 2V09A 3BGWA 1JDZA 4KXUA 4QXRA 3E2PA 2HWF1 3VR0A 4EO9A 3WRWA 3KL4A 3HJBA 2W1WA 4ZEVA 3UO8B 2G88A 2WA4A 1OHHA 5TR9A 4UUBA 1G4UR 2W0XA 2RC6A 5FA6A 1YZGA 2WNVB 2ONYA 3U17A 2W68A 3WO0A 5HWSA 3O1OA 3HBFA 4MYSA 2QUIA 3CH5A 2R47A 1EE2A 1KKLA 4WW0A 4LF9B 1CX9B 1PX0A 3P0JA 2PWYA 1QU3A 4Z0HO 1NUQA 1H94A 2NUBA 2NYRA 3IHLA 3D2CA 3DPRA 3O1JC 1Z13A 3I28A 1WX1A 2RS51 1CRLA 1S2GA 5E1OA 2YYZA 1JQJC 2QTHA 1CR1A 4L8GA 3GZNA 1BWSA 1C57A 2GK3A 4MAMA 5DT9A 3IRVA 3PRKE 1DG6A 1LW7A 5AQ1A 2WT9A 3NWEA 1HDKA 4Q4V1 1G4AE 2H4ZA 4LOSA 4CHGA 4MADA 4PGFA 1XXLA 5AR1A 1GA4A 3H1BA 1OUMA 3V7FA 3COSA 4KSBA 5JOQA 3W6ZA 4YCMA 2SHKA 3GK3A 4UFNA 1A71A 4LOTA 4BQPA 3SZGA 4TL9A 3FE5A 2RGGA 1NVXQ 2G9GA 1KYIA 2HW8A 2XX3A 4UDYX 1I2MA 2C3UA 2FDJA 2WTMA 1CUWA 1VI5A 2LW7A 4MW0A 3HJGA 1NMEA 1U4OA 4Y9RA 1Y3AA 5LRSA 1W9YA 4OVEA 3PJEA 3HSKA 1M4WA 4FN4A 3LWDA 3GDHA 4Q0UA 2Z43A 3PXUA 3P20A 5SZIA 2WABA 3OE5A 1E5HA 2J0UA 3T2TA 3SKXA 2FF5A 2X8LA 3EXFB 3K0BA 4JAAA 1GY8A 3VD7A 3ZDQA 1SVWA 1OZFA 1KI3A 3B7GA 1CQPA 4KYTA 4RSRA 1TME2 5BSEA 2M6KA 1CUIA 4IYJA 4D99A 4ARIA 3TNFA 1EGAA 2BMJA 2OWDA 3PC7A 4Z4FA 1PFKA 2X4GA 1GFWA 1DKLA 5EIXA 5AFBA 221PA 2CUKA 1C8VB 4S3MA 1E3WA 2E7ZA 2UVQA 3USCS 2R0QC 1AQYA 3PSAA 1ZYUA 1RHRA 4L50A 3SNKA 2J3QA 2A73B 3BHNA 5C7OO 2VL4A 1KGSA 3TMAA 1OX6A 1CS0B 2Y64A 2WIBA 3M4NA 4QOHA 4DLRA 5IJ9A 3UV9A 1CTQA 2J5QA 3AEKB 2IHUA 1GR1A 1Z4NA 1JR3A 4RDIA 3QSGA 4ZCRA 1AN0A 2G1KA 4O3FA 1P7WA 3A3YA 5JHGB 2FPOA 1Y6FA 1AHIA 4S35A 2Q0QA 3ZIWA 1DC8A 1NRXA 4XDPA 3E9CA 3I59A 4BRSA 2HRDA 3V8PA 1KZGB 3FD8A 3P27A 1VG0B 2VBCA 2D0PB 2P2CA 1QJFA 5C71A 4PDWB 4CTJA 4LMRA 4LBQA 1Y9AA 4KBZA 1UJBA 2IE0A 5A3JA 3REQB 1F8XA 1JR6A 2ATIA 1A8QA 3ZE6A 2VDOB 4UM7A 2QZZA 3ZN4A 4WKGA 1S0BA 1G20A 3I3QA 1YNOA 5THQA 3JD3A 2VCBA 2PT5A 2QYSA 5JSZB 2NO0A 2UWBA 1RDFA 1H2EA 4ER6A 3O26A 2YIJA 1XCBA 4PYJA 1PWYE 3ZNPA 1ORVA 2FRXA 2I2DA 3LXUX 1HXS1 1DBNA 1J2YA 4DAEA 3H5AA 3I9KA 4L0CA 1U2DA 2AVDA 1Z33A 4WXMA 2CLDX 2G8NA 3EIQA 4WTOA 4Q3OA 2O8QA 3ZY6A 4NIMA 3SIXA 1JSLA 1KL7A 3HFJA 3D5TA 3FLMA 4RK7A 5KNBH 1NN3A 1XNAA 2NUTB 1J0BA 4EA7A 3OF5A 3WGMA 5JG7A 3G2PA 5T3UA 3UAYA 5FWYA 3KE8A 2YFHA 5H9WA 2JE8A 3BVPA 4ZVRA 3SEFA 5TE9A 1WUKS 2C5SA 2R6ZA 3PNVA 3W59A 1AXGA 2ZDGA 5EPUA 4ZHQB 3FTCA 4PG8A 3VQTA 1KGDA 3F3SA 4YEDA 3JB4C 5FZGA 3KNZA 3I6YA 4G1CA 3CVWA 3VBUB 4WM8C 2BOVA 4PZ0A 4BMVA 4JV4A 3I0ZA 1CLUA 2BBTA 3AVOA 2FRDA 5DM70 2PIDA 1J1LA 4Q21A 1NRIA 4WDQA 4FMDB 4BBZA 4IY1A 4HN4B 2A59A 2OPKA 2DH6A 4FMCB 4HDMB 4MITA 2ZZNA 5LY1A 3VDMA 2JIQA 3RFTA 1JVNA 3UK9A 4QXOA 1UBRS 4R2LA 4AZSA 3U3RA 3LWZA 3ETNA 3PEVA 5E8AA 5IJ0B 1OKOA 1UKYA 3CRW1 1EBUA 1DB3A 5BV0A 2F55A 4L5JA 1QZZA 2FG7C 1KMCA 1DCKA 2QK4A 5HCIA 1RUG3 5C4WC 2YFUA 5AC91 2YBKA 4Y20A 1ML4A 4H7KA 4NYMQ 2NXNA 1I1QB 5C51B 1L5VA 5CBLA 2RHPA 2WNUB 4YGDA 2IC5A 5JECA 4NRQA 4EEZA 3PURA 1WP4A 4Z4IA 5KHKA 2HMAA 4HNTA 3LPLA 1DLLA 1UM9B 1GXSA 4M76B 2EZ9A 1I5OA 5JDIA 1VTKA 3A1FA 1H6BA 5A33B 1I5ZA 1QH8A 4BX8A 4Z1VA 2D3WA 4FE3A 4FS8A 1M74A 4A03A 1STMA 1K3IA 1A7JA 3CJQA 3GJ4A 4L92A 5CUQA 3O83A 5KC8A 5CNJA 4DC1A 1V16A 4B84A 5JU6A 1NTOA 2Q8NA 1ZRSA 1HDYA 2W92A 4C91A 3M3IA 1CAVA 4KXVA 3RYCB 1Y4WA 2HEGA 4OL9A 3NAGA 2PRYA 2HF8A 4KZPA 5EWSA 3FN4A 3RHTA 5K9YA 4H60A 1RITA 4AIRA 1VYHA 4PZZA 4ZTZB 1OXVA 3CEHA 2D93A 1G8YA 5LOVF 1SLBA 2MSCB 1Y1TA 4D4HA 1E9DA 1UANA 1E64A 1RPJA 1NJ5A 3WGNA 3PU6A 3BWMA 3R4DB 1Q1ZA 1YRAA 2BCGY 1DJNA 1GAWA 2WWJA 2F6RA 3RU7A 4BQIA 3RRFA 4ISBA 3OAAD 4BK4A 2HN9A 4BC1A 4LPKA 3ZM8A 2CFTA 4QQHA 3GAAA 1CAWA 4DR7B 4WN9A 4LMFA 3D5QA 1KQPA 5KB3A 2ODTX 2F9FA 4WBSA 3CX6A 3EC7A 3X1JA 3GLHB 1SHLA 2GN1A 1P18A 1IGOA 3A1EA 1AC5A 3KUCA 1T9AA 3MLAA 4BFXA 5EJ1B 2V6FA 4Y6SA 2PT6A 4EPWA 2C57A 3KSRA 4KH1A 3T52A 1Q0PA 3GZTB 4F5ZA 2ZRFA 3LUHA 4QELA 1JKJB 2JKVA 4KH9A 5B1EA 4KXWA 3DO5A 3VR2D 4HLUC 3RC2A 3PNQA 4Z3KA 4YFWA 2PLWA 1KMQA 3PUSA 3EDOA 3O8OB 3MV01 4K20A 4OFXA 2J3HA 3MUOA 4FOWA 3GLGE 4NEQA 1RXYA 3AGPA 3LC0A 3HB9A 1OFUA 1OU0A 4P9NA 5TVGA 2UUAB 4HWTA 5HYVA 4U36A 2OCBA 1UJ5A 4WACA 4JB2A 2EQAA 4I6GA 1SFNA 2B30A 3I58A 2I4TA 1RFLA 3VYTB 5DEOA 1FUKA 4FPKA 4EI8A 2AREA 3QH6A 5JSYA 5HBRA 4HPXB 4DLSA 3JQAB 4BGDA 2AG1A 2WT2A 1XRMA 2WFMA 3T8YA 3BEDA 5FUWA 4M54A 1NAHA 2Z6VA 1L4FA 3GC6A 3NDIA 2VZRA 2NM0A 1MX3A 1T35A 4DLAA 3B3JA 3K9LA 5FR2A 4IV3A 4HAOA 2XJ9A 5L7OB 3U2QA 3TOSA 2BGNA 1W5BA 3GFVA 1L5HB 4C4YA 4ZHNA 2Q27A 4D4IA 3BF8A 4AGVA 2RI1A 1OXUA 1SHWB 4W7IA 3HU2A 2QRHA 3MW2A 4OJYA 3POFA 3QNUA 3W34A 2LUOA 1YFKA 3QX8A 4YRIA 3NCHA 5K8UA 3EA5A 1A34A 3PYMA 1SUWA 2VQ0A 3WSWA 1A5BB 4CW7A 3QVJA 4UW4A 2UVDA 3WGIA 2Y6LA 1G3UA 2HV9A 1FDOA 2VAUA 1N3QA 2XTAA 1BEV3 4ZYUA 4L73A 2JFNA 4PPNA 3B6MA 4PIZA 5LA0A 3CW8X 3NIDB 3OTIA 1E7WA 1Q19A 1M34B 4JT2A 3TS1A 4MVJA 4KIFA 4V2IA 4XBLA 4M1MA 4MGYE 3T4XA 3C7GA 1S2EA 4MR8A 1WULS 4YRMA 3A6EA 3OUUA 3JSXA 1POQA 3MUY1 3BGSA 4GYKA 5JCZA 3PIJA 1GGKA 5FLEX 2JDID 4JBNA 5ELXA 4MUFA 5A4IS 3PGLA 2VKQA 4BJ5A 3AVWA 4OXXA 2G4VA 3HQXA 1SCJA 3IUSA 2OLJA 4ETWA 4J43A 1GPJA 1N5LA 1YJXA 4LSZA 3P32A 4UNSA 4MUVA 5AW5A 3HDQA 3FOEC 1RADA 2KM1A 2CHEA 1FTYA 2GN4A 4LHWA 3EG9A 3ELWA 4CCKA 2GGSA 1SA0A 3GZ4A 1Q6ZA 4S1WA 3BQMB 4WVVA 4GICA 4R9CA 3K4ZA 4GOLD 1GQPA 5KTMA 2WNVC 1A2QA 3M4FA 2JI6A 2Z4SA 3VO1A 4DMFA 1SEVA 4O29A 4JP1A 2IIPA 1NDHA 4PXAA 1GPNA 3OZWA 3IB3A 3T1NA 1S8NA 4XJUA 3CEWA 4Q7KA 1RIFA 4AVVA 2IXTA 1W2WB 2RJOA 4NJEA 1JDPA 3P0HA 3M34A 2VUJA 1UDWA 5I9NA 2YICA 5CFQA 2RAFA 5DZEA 5JIUA 4JDOA 3FZ3A 4Y9UA 4EPRA 5EZ6B 4RZ2A 5JR7B 3O4IA 1I6LA 4PC7A 4JK3A 2EZ8A 1OSGA 1K98A 4JMPA 4CIXA 3K4QA 4BUJA 3QU9A 1XZIA 1J2RA 3HCEA 4RULA 4K1ZA 3K9CA 4J3NA 4CCLA 2XUIA 2HMWA 1Z74A 4DLYA 1IPSA 4KGXA 2O7VA 1HBJA 1OH4A 4B33A 2BF4A 1BKYA 1UCXA 1Z5UA 2A1TS 1DELA 1OBHA 3NFYA 1E5VA 3V4OA 3LA7A 1JH9A 1NNSA 2QPLA 1K6JA 2VATA 5CFRA 2Z57A 2C42A 4I4CA 3BDIA 1H2YA 3Q15C 1R4AA 2F6BA 1AYM3 4O4LB 2MHFA 1BXGA 1NUUA 2LKCA 4AT1A 5LBFA 3DMTC 1RJ7A 2WNOA 3O82A 2R5WA 5IYZB 4Y2GA 1ISJA 4UNNA 3GPBA 4N0QA 2ZRQA 1SPBS 5FDBA 4DY3A 4HRAA 5A6ZA 2JCYA 3TQFA 5K0CA 3NP7A 1UZYA 1PO21 4RVUA 1KJYA 2OMEA 2Q5FA 2EARA 1F5JA 4HDCA 4BX0A 3GEBA 3SE0A 1PZEA 1ODTC 1N2JA 3TEMA 5G0UA 1QLWA 4Q4Y2 3HFRA 3DT9A 2IUEA 2WLSA 3CNOA 3MNFA 4YG0A 1NKSA 2WDBA 2CLKB 1PMJX 4IXWA 1Z4KA 4YRPA 5JJBA 4FPJA 5HP4A 2AKYA 2P2DA 3DF7A 4QREA 4RFVA 4U63A 4AKTA 4NZ9A 3L84A 2BRUC 2ATEA 3IMFA 1P33A 3DDNA 5BNIA 3TUJC 2V73A 4YRSA 2X3FA 4AJ2A 3PDIA 2PCLA 2VHEA 4YMHA 1EVLA 5EP2A 5DT2A 1RXFA 4FVVA 1YMQA 2NT4A 2YZ7A 1T1JA 1GZWB 3PKZA 2DETA 3N7AA 3AHDA 5J59A 2AE2A 2WM2A 2YBEA 5G05L 4OFBA 1I9CA 2AZXA 2Q7OE 4L6AA 3CVVA 1CP3A 2CUTA 1LNQA 5CK5A 3TW0A 4HNUA 3P2JA 3DOHA 3ZTWA 2XGMA 5SV2A 4M1QA 3SR3A 3A10A 1E63A 2ECKA 3A4VA 1Q3KA 3ZWVA 1PJQA 4IRXA 4ADSG 4EHFA 2WC1A 4CF6A 1II8A 5FL7A 4PDWC 1OAOC 1KS2A 3MPOA 2JGIA 1LKZA 3G82C 4J0KA 4WBBA 4YW3A 2Z79A 3Q40A 3V4LA 2N42A 3FW1A 1MZEA 5D1HA 2JK1A 4MUMA 4NOJA 1YJ5A 1A1VA 1SDWA 4R1LA 3GJRA 4P9LA 4IVNA 1QRAA 1D4AA 4B46A 1YBHA 3TR6A 1Y98A 3PC8A 1IY9A 1YBMA 4KG7A 1Q1QA 1BMDA 4JLMA 1WCDJ 1DKUA 5A2GA 4KBBA 5FPAA 1T36B 1A27A 1C1YA 1EV13 3GGCA 3L0ZA 4JMLA 2AVNA 2Q2VA 2Q3EA 4L8QA 4QFBA 4QGNA 4A8JB 1AL0G 1N6KA 2CNLA 2QN8A 1UBNA 3ZX7A 4FI3C 5EKDA 3ETJA 3QG5A 2ZS7A 3AFGA 2R042 3DHNA 4KFRA 4DCTA 2O6LA 1S4QA 3QYAA 5JADA 3PV0A 1XZGA 1J33A 1YC5A 1G17A 3LIGA 2VC2B 4MO3M 1NZFA 2XZPA 1QJX3 1VIMA 3G0CA 2YN4A 1ZH2A 1GYRA 3KPJA 5KNLA 1DDLA 3VBUC 2XMZA 3RQIA 2BNMA 2IU3A 1ES9A 3WLSA 4GAEA 4Z9XA 4DV6B 2AG0A 2GMPA 2GS9A 4AMYA 4ZYXA 3G89A 4DJEC 1IQPA 1A50B 1GCUA 1P4RA 3MT9A 1I80A 3NHBA 2Z69A 5GJBA 1GAJA 2IXIA 4BEJA 4Y22B 4UNIA 1U5XA 4TPKA 4YT5A 2FI1A 4PRKA 1JYFA 4Z7OB 2X0RA 3QFHA 5IJRA 2XODA 1RS0A 3GHMA 3RSHA 3B36A 3QF4A 3LUGA 4BEVA 4NMMA 5C9AA 1AGPA 5BYAA 1YFJA 4MYHA 5K3BA 1UKBA 4DNPA 4NK5A 1V4BA 3VNBA 1WAMA 1AKQA 2OV4A 3ENZA 4HVLA 1ZUWA 5KNDH 1RQ2A 4PYKA 3KQPA 2WNUC 3BTZA 2WYWA 3LHFA 5IM5A 4R9UC 2BGWA 5DI3B 1Q77A 3HHPA 3LV8A 2AFIB 2AX4A 5AM3A 3FVRA 2HGSA 4J0DA 4HPWA 3I23A 3VJLA 2GH1A 2I29A 3DUFB 4GKKB 2HHCA 3UJQA 5C1OA 4HN9A 1QIJA 2VXJA 1EFVB 4RADA 5KOIA 2QTLA 3OF1A 1SIUA 2BJHA 4I9HA 2LXNA 4DOUA 1K12A 1D04A 2WF8A 3DFMA 5H16A 4GKYA 2WILA 4XFJA 2VTVA 4NECA 4R2WA 3HRIA 1Y1SA 4JQOA 4UXIA 3ZE1B 5G0VA 4AGRA 2PPLA 1VIWB 1S0FA 1QXSA 1QRTA 5ICCA 4B1MA 3QKSA 1GZUA 5CXUA 3SWWA 3U7GA 3P5BA 2OFFA 3DE7X 3D3EA 4RD4A 1RI4A 3ILNA 2RGCA 4PYOA 2JDNA 2V72A 4D0GA 5MFZA 3VXKA 4BUCA 1FU7A 5I48A 2GM5A 4F92B 4XM2A 2GZ2A 1X7WA 5DWQA 1B74A 1U4NA 2QRVA 3JRNA 4UAJA 3ZX5A 5ICFA 4HB4A 4AXOA 3LXXA 3KVYA 1OIXA 3CSDA 3EY9A 2PWAA 1D4M3 1Y37A 3GG2A 2HEVF 2GN9A 3URFA 1RUJ2 3L8FA 3RG8A 5A02A 4TLBA 1VL2A 1JYXA 3ZWWA 3DYIA 2QQWA 3GDWA 2XXAA 4A6DA 4MV2A 4NENA 4U7TB 4A2PA 4SLIA 1UH5A 3M3CA 5CAEA 2X8AA 2X76A 4X92A 1P0MA 3IEUA 1NW9B 2LP4Y 3VBSA 2NYUA 4AHXA 3E7WA 2D5FA 1NW6A 3KB2A 3OZUA 3G2MA 5ICGA 1MAHA 2NO4A 4F97A 1QVZA 4EO4A 4PBTA 4LFCB 1W2HA 1B8NA 5CJJA 2OQVA 2AEJA 1JIKA 3VKWA 4A6EA 2ZEWA 3BMQA 3MJVA 4BMSA 3JASA 3DZIA 2AN4A 4CKWB 1NSTA 4NI5A 1BCRB 3JU9A 2XE4A 1JHOA 3UENA 2WO1A 5FZOB 4Y2PA 5BW8A 4BZXA 4A2UA 3NI2A 1AZDA 3ZWBA 4TSFD 1TJYA 1G4HA 4Q4HB 3OLYA 3CZCA 3OQVA 3W3ZB 4K28A 3V8QA 2FQPA 1DIGA 2F4VB 4HVTA 3R5FA 2ZKLA 1RMYA 4XFDA 2ZIFA 1X1TA 3HKEB 2Y4NA 3TWIA 1SQGA 1ZBA2 3MWYW 4PBPA 2FN7A 3TJRA 1T8UA 4D92A 1V3TA 3PQ4A 1RWXA 2VWGA 4RD3A 4CL0A 1JXQA 2JE7A 4HQFA 4QASA 5JE8A 1H4GA 3O5SA 5IWFA 4P33A 4TWRA 2ZTUA 3FFTA 3LY8A 5SY6A 1PMHX 4UUMA 4EATA 2OM2A 5J4LA 3QU4A 1OUSA 2D43A 3SXUB 4X6QB 4NHKA 3M3EA 1JB9A 3ZDVA 3FUOA 5JCPA 2JHPA 5CVUA 4KO1S 4URAA 4PGGA 4GD4A 4YMVA 4M1WA 4HFMA 4RD1A 1N33B 2HMVA 2PX8A 1TC2A 1PGW1 3OSZA 5F5CA 4EIWA 2H59A 2IYEA 2PHLA 4H55A 5JWHA 1GT6A 1ICIA 2VHZA 3BK1A 5J63A 4N43A 3DM9B 1TAGA 2NQYA 4HTFA 5HCNA 2AQHA 3KELA 4GQ7A 4QG3A 4IGQA 5DXDA 5EXXA 2C9MA 4P7BA 5HF8A 1BXZA 2EERA 3KGZA 2W4QA 4MHOA 3WHUA 2ZSJA 2RH4A 2YDEA 4UAGA 4DWOA 3SIWA 1GKBA 2VTKA 4YFZA 1LK7A 3JRWA 4BGVA 2JD4A 5KU7A 4XIKA 3FPLA 3PITA 3ICQB 3QV1A 2XKOA 2JEMA 4LO7A 1BS1A 4DUXA 3GGJA 2FLVA 2W2XA 1ISGA 2M1XA 3TFOA 4YO7A 1QPZA 1PVC3 3CW2A 2PA3A 3D2BA 1WHTA 3LUBA 3AZYA 4FCTA 2FMHA 3QEOA 1FVFA 4BPRA 4LY3A 4WXPA 1JA9A 4YDSA 1U7PA 5EIYB 5CLGA 5E0KB 4KRFA 1PJLA 1RFGE 5I8ZA 1ZN9A 3T9DA 1VBD2 2YWDA 3E7FA 4M8SA 3T3EA 3MGBA 2IP1A 4IMIB 5HMLA 1ZHOA 4UEWA 1YO8A 1W76A 1PQWA 3ONVA 3HYNA 1NLYA 4XYMA 1KVRA 4AEDB 4XZPA 1DAHA 1F6WA 2FZWA 4FOLA 3DKRA 4R40A 1RL3A 1FRZA 1ZJJA 1LAJA 1TKCA 1CZKA 4YRCA 4CEWA 3ZNOA 2WT4A 1T2AA 2OHVA 4DA6A 4GMP1 1KIFA 3HCCA 1YZLA 4BK5A 3TINA 3KD4A 4CNBA 4F4UA 3OUIA 1SBFA 3GUCA 5FTNA 4BMYA 4ZICA 1TNRA 2W58A 2YGLA 4X45A 1NJ6A 2MEV2 4BAUA 4LWZA 2A5YB 3TTSA 3UTCA 1J21A 1H1LA 3IXQA 4JL6A 3TLCA 4Q6BA 1AYN2 5F7OA 5AW0A 4J6EA 3P4XA 4B8YA 4YP7A 3NOVA 1GGHA 1BN7A 3HS3A 2YVUA 2EJUA 2JJYA 5MN4A 1CIJA 1T5DX 5E9AA 3STXA 1JBKA 2WICA 4FS3A 3ZWQA 5IWCA 4ZEOA 3PUIA 1DG3A 2GRUA 5IC6A 3WNBA 3DOCA 4FFSA 4ISCA 3N7UA 3ZY5A 2J9FA 3R6LA 3PRYA 2BGJA 2ZMNA 4A0RA 2XNHA 5JZGA 1Q57A 3ITDA 4GNRA 1E77A 2PN1A 5JARA 1CF2O 2XYHA 2XWJI 1DHKB 4TQAA 1FFAA 3MOSA 2HA0A 3KZOA 2C7GA 1UKEA 2FP4B 3ITKA 3ZX4A 4RA9B 2IV3A 4YMUA 4KQXA 5LXTB 1MRNA 4FNOA 1K6XA 1N6RA 4NS1A 1OYYA 4D45A 5EZWA 4PZDA 2R1TB 2XE6A 4HNGA 3THXB 4LXTA 2WNEA 2ILTA 2WYHA 4DLVA 2WF7A 1OA2A 5DGCA 5ELLA 1LEDA 4L97A 1SQ6A 3TN7A 4URZR 2BVNA 3H4MA 4H7LA 4ZAZA 3C1UA 3BFXA 3WK6A 2NU7B 1KHTA 4D56A 3GW8A 2QRKA 1O5OA 4Y1FA 4CEYB 4L6CA 2PWBA 3GD5A 2WQ4A 2D5LA 4L27A 4JLKA 1N3PA 4NZMA 4YAGA 3DV8A 1X3LA 1LJUA 4KDFA 1L4MA 1E7MA 3TEZA 1Q3HA 1N8SA 4M6WA 4PLNA 2P3JA 1MVEA 1TNDA 1N5RA 3LCMA 3GP3A 4OLJA 3TLXA 1HE2A 3KDAA 1HZZC 3RUPA 1C0IA 4IZOA 4AE2A 1YI1A 3DMHA 2IXGA 2AGVA 1X92A 1U0AA 1JPJA 1W6NA 4ENPA 2JGAA 4IGFA 5C3SA 3QE3A 3IIEA 1UBGA 2WKRA 3O6VA 3GT0A 2E7AA 2PJZA 4MH0E 3E3AA 2AEYA 3M6LA 3OGJA 4Z99A 2A58A 2FNAA 1I6MA 3CVUA 4R0MA 2OBBA 4A8JC 4DCVA 1E2KA 4H3WA 1T5BA 3QM1A 4HZIA 1QONA 3LE0A 5C7GA 3F49S 4U2AA 4X7BA 2PUWA 1OI4A 1Q0SA 3E27A 4XLZA 3WG1A 3IGFA 1KR5A 5C3OA 1ZKMA 4MGSA 1XFAA 2J41A 5A62A 2DBVO 4W1PA 3N8HA 3ANTA 2Q9BA 2ONZA 2EIEA 3THYB 2FG6C 4XA8A 5IAVA 1EDDA 2D1RA 1V9U3 3OY8B 5CA1F 1A5TA 1S7GA 3D5EA 3AL3A 4EX6A 3AUYA 4LKEA 3ML1A 2HA6A 5EINA 5EQDA 4J16A 3LKDA 5F98A 1ISMA 4N5IX 3WTCA 1EP9A 4PN3A 4R7TA 2J22A 1FDIA 1O4YA 2W43A 3NV7A 3VH3A 3DVQX 3VR6A 1ENRA 1SKAA 3K6JA 2R79A 4TYMA 5BORA 6AT1A 2OLKA 4QGLA 1TQ4A 5DNEA 1ZGGA 2B8WA 1H5NA 2CMDA 2CE7A 1WEKA 1HE5A 2E48A 3H3JA 2QORA 1CJDA 4AKIA 3H3LA 1FJHA 4I0AA 3D43A 1L7AA 4MTLA 1KYZA 3LUPA 4JSRA 2P6HA 3U4AA 2IXCA 4YUXA 5E8JA 5D7BA 3QBEA 4ZQEA 3QBQA 3K5PA 4GP6A 1OFUX 4HDNB 3EODA 3SKVA 2X5IA 3RVPA 4F3YA 4WXEA 1WW4A 1OREA 4ZT6A 3ZKWA 4QAWA 2ES3A 1VIDA 4N6OA 2V4VA 1U3VA 4CCOA 5B7PA 2VOVA 2YJ5A 5TEWA 1X19A 2GFHA 2PKQP 3QVOA 3Q85A 2FMDA 4JV5B 3BJZA 4KG8A 4HS4A 1ZZ6A 4NAMA 3HQ4O 1IAQA 1QH0A 4N8EA 3R0VA 3KVAA 4V1CI 3VZOA 1FUYB 4P4GA 1KJ9A 5IN4A 3W5BA 2Q9UA 1HDEA 3UJHA 1VI2A 3TEJA 4JYAB 2FWAA 3R44A 1ZOIA 2VWQA 2O0JA 4HZFA 3WAGA 3K32A 2HWB3 4AL4A 1KU0A 3KQKA 1MS0A 4OXKA 3L6UA 5K1ZA 2G1AA 5MFPA 2GEFA 2ZSAA 5TARA 5H5JA 4CGYA 2FSSA 3HCAA 2ZIUB 5AVXA 2ZPUA 1QO9A 4EKGA 5T55A 3AIIA 3E84A 1GCAA 4FFBB 2WYSA 1UZAA 2XD9A 4N3GA 4D6YA 4S2FA 3OG9A 4NPMA 5AUOB 5I01A 2J3DA 1TEXA 5KSYA 4JD5A 4GX2A 1XVAA 1SQSA 2DUPA 5JD3A 4LQLA 1EESA 3EVTA 3CKLA 1DDGA 1I4EB 4IJ5A 1VRVA 2TMKA 3EXG2 5C4WB 3ZI4A 2HGZA 3B3GA 5LYYA 3SE7A 1KVSA 2ZYGA 1WLDA 3OZAA 3GRAA 2R6GA 4PAWA 5BSVA 4WFJA 1TI7A 2GO7A 1E9EA 4MVYA 3CVJA 1XNCA 1V1RB 3EQ6A 2QRZA 3CONA 3UQZA 2W95A 5JD5A 1BX1A 4IEIA 1UZLA 1RP7A 4DXAA 4FP2A 5H3LA 3HIFA 1T0PA 3ANYB 2FR8A 3QVGA 4W5JA 4CKEA 2V3CC 5ES3A 3CZAA 4OK5A 1AL22 3OH8A 4XJWA 3RUFA 3L4EA 4COYA 3ZVNA 3AKQA 1SUEA 3I53A 4OQZA 4DJJA 1XYNA 1G7YA 2ECQA 3RROA 2VH9A 1UBEA 3DV9A 3EDMA 5DKFA 1TYDE 2C5EA 4MV4A 3FYHA 3WD5A 2A88A 3IEXA 4HXFB 1OI6A 1WLSA 3F1KA 3IPYA 4O59O 2O2IA 3NSTA 4WNYA 4P0PB 1M10A 5E38A 6PFKA 2FN9A 3F6YA 2VBBA 4HP8A 3HU1A 3RRDA 3P97A 3V4PB 4QE3A 3SSAA 2LIPA 3D8BA 1YR3A 2CYBA 2XMGA 3HZHA 2WHYA 4UPEA 2Y2UA 1VBMA 2NW6A 3RK4A 2I99A 3OJLA 3BILA 1Z62A 1AR61 2I6SA 4RQUA 3ZFGC 2PYTA 5FMDA 4MUNA 3TXYA 3H9UA 1AKMA 3IPVB 1CVRA 4EELA 2IZOA 5DH9A 5LLDA 4WPGA 2CK3D 4PRLA 2Q7DA 2E87A 3VR4D 4JS0A 2VUIB 3IR6A 5CEHA 3A58B 1QH1B 3U39A 2HQRA 2I1VB 4JENA 4M4SA 4MX8A 4JH0A 5AVOA 4Y7DA 4B5LA 1OXCA 4RKWA 5KKAA 5A1TA 4BQXA 4H7EA 3SZ3A 1G6HA 4P5HA 1TTHA 4KH0A 1FNDA 3P7MA 2O8FA 5HE8A 2VGDA 4A0HA 3VHXB 3IAQA 2CWDA 5E4FA 4IH4A 5TEVA 4E7PA 4BRUA 4CU2A 4KAJA 2JJ1D 5L51A 4RFSB 5LN1A 2IU4A 4G85A 1BE0A 3OSUA 1U8AA 4TKUB 2GRJA 3OLVA 3IHWA 1W03A 3EVAA 1Q83A 1WCV1 2FSUA 3K6SB 1Q43A 2C26A 5FQOA 1O4WA 4Q4X1 5BUCA 1RUE2 3QUSA 2GKGA 5I4BA 4OHRA 3WLAA 2W2MA 4LTMA 1S2LA 4D3DA 2HZ7A 1ZCBA 1ORTA 2WF9A 5BUZA 3QOXA 1JZ3A 4G4SP 2BFBA 2DPGA 4J29A 1FRQA 2FEWB 1Z83A 2CL5A 3Q3CA 2H2HA 1I4DD 1J0AA 3JPYA 3UUGA 3TCXB 4TXMA 3FN9A 3MV11 1TXGA 4IRUB 4EJSA 1V3VA 3IQWA 3HN6A 1Q11A 1YR8A 1ZESA 1LOEA 4CQMB 1O5LA 1CC1S 2CZQA 4XJSA 2EBUA 4FPLA 1D6NA 3UG7A 2QL5A 3L46A 2N46A 2WUWE 4PO3X 3MUZ1 4F1WA 2ERFA 2BEKA 2Q5OA 2QTAA 1NKVA 1ZO8A 1ZJWA 4AEDC 2GM3A 3WJ7A 2D2IA 2XQJA 2XMRA 2FSGA 2VVFA 2R8EA 3PTZA 3SNMA 4ON9A 4Z1OA 4FEEA 1RKXA 2NZXA 1TLTA 1WNTA 3JQCA 3LTNC 2C00A 5AM2A 3GRYA 3IH5A 4YR7A 1NXSA 5F5AA 3TYJA 2Q4BA 5ICSA 3MRTA 2FMIA 4ECAA 2I3GA 1XYYA 2VLIA 3V9PA 3C7DB 1IOWA 5A6SA 4XQEA 5L53A 1I1HA 2Y1OA 1J20A 4KHZA 1H2FA 3HNPA 3KYDB 5BQ3A 3MLLA 4MWOA 4YRQA 1EHCA 1DEXA 3ZV4A 5K3CA 3WDUA 3TXAA 1I10A 3Q6IA 2CGPA 3HPRA 1I6XA 4ARXA 3WL7A 1I94B 4XFHA 3UB3A 1TVKB 1DHTA 4GH4B 4YBZA 5AICA 2XNDD 5JYCA 3MO4A 3NAPA 4Z86A 5DHPA 4EY8A 2WM8A 4XWTA 1EVYA 3JD4A 3N75A 4DVGA 3RT9A 3BMOB 5DM0A 2R072