2WAOA

Structure of a family two carbohydrate esterase from clostridium thermocellum in complex with cellohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
b'GILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDSITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2waoA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2waoA02
4PQQA 4A44A 3T2OA 2V72A 2JDAA 1TVGA 3C7FA 4GWIA 4HF7A 2E26A 1U8UA 2W95A 3NRUA 4QDSA 1UYXA 1H6YA 5A1AA 3K4DA 2VO5A 2Y6HA 3GDBA 4GZ9A 2WBKA 4A4AA 3NNGA 1CZTA 3SKVA 1O8SA 5DMYA 3W5MA 5DN2A 3FHAA 5IJRA 4DXSA 4DUXA 1YZFA 4CU7A 2VMCA 1JZ3A 2Y6JA 1UMHA 2VMFA 1KGYA 3WF0A 1GMMA 2B4KA 2XQXA 3VDBA 1PX3A 2YG0A 4AAXA 3MUZ1 3SKJE 3ETPA 3OGSA 2WN2A 4ZY9A 1UWWA 3IAQA 4QX1A 2WO3A 3IAPA 4BDVB 4JKOA 2W47A 3ZM8A 3LEIA 3THDA 4A42A 1K7CA 2YFUA 4QB6A 2WAAA 4K9SA 3WNPA 3E1F1 2WABA 1O8PA 4TX1A 4JHZA 1PP4A 3HPNA 1ESEA 3ECQA 1DYOA 3I2KA 1H6XA 3DYOA 4CUBA 1W99A 1US3A 2QQLA 2VCBA 5F7UA 2VZSA 3LE0A 5A4AA 4FI9A 2VZRA 2W3JA 3BZWA 2BERA 2C4XA 2J1EA 3T08A 1XPWA 4LHSA 2Y6GA 1FXWF 3WNOA 2J1VA 3C1UA 1W9WA 3C7HA 3MBWA 3C7OA 4HG6B 4UAPA 4QDRA 2QQJA 3F2ZA 2VL4A 3KVNA 2E32A 2VCAA 5J1XA 4ZZ5A 3MILA 1J83A 3OGVA 4A3ZA 1BWQA 2J1TA 3NQHA 3T2QA 4K3UA 2XONA 2EICA 4DEQA 5DQ0A 3I2GA 1JZ2A 1IVNA 3GXUA 2J1RA 4QB1A 4YPJA 5JD3A 3ABZA 3FN9A 3VD7A 2L9LA 4RYDA 2WO1A 4UI9L 3OEAA 3LEKA 4NRDA 2QBXA 3DYPA 3T2PA 1Z8HA 1OF4A 2XHNA 1JZ4A 3MO4A 1K12A 1UXZA 4M4RA 2LW8A 2ZXQA 2JKXA 3WSOA 4D8MA 1ESCA 1HN1A 4CU8A 1D7PM 1TG7A 3HJRA 4PF1A 3PT5A 3WNNA 1CZVA 2HSJA 1SHWB 4PT6A 1WCQA 5HXMA 4W8JA 1XNTA 3CZJA 1CX1A 1ULOA 1P8JA 1DEXA 2ORZA 1PMHX 5CZKA 5IHRA 1W0NA 1JRLA 3T0BA 2J22A 2QQKA 3HN3A 3RJTA 4BXSV 4QAWA 4P5YA 1GQPA 2E31A 2VZPA 2E33A 2KD7A 2VMDA 2BGPA 4ZZ8A 1JZ7A 4I8IA 2PQSA 3ACHA 3A7QA 4W50A 1W8OA 2RJ2A 4Q7QA 2EIDA 3A22A 2ZEWA 3VD3A 2W91A 1K3IA 4QX3A 4BK5A 3I97A 2VTFA 4ET7A 4CVUA 2QQNA 2WZ8A 4BJ0A 4JKLA 2RVAA 2QQOA 2Z4FA 5G05L 3K46A 4MGSA 1RYYA 4BK4A 2VZUA 1K45A 2W87A 3WNLA 4JX0A 1OT5A 2QQIA 5CYYA 2C26A 1OH4A 3PUIA 1DP0A 3C7EA 4ARYA 1JZ6A 3HP4A 4OUEA 2VZ3A 1V2GA 4L0PA 3HNYM 2OKXA 1JHJA 1F4HA 4LQRA 3VDCA 1CZSA 5B4XA 4XURA 5LCWL 4LKSA 2DCKA 3SLRA 4LPLA 4M4PA 3JXSA 4QB2A 4XZUG 3UNPA 2VZQA 2VJXA 3CKHA 3HOBA 5C70A 1K42A 1KEXA 2BZDA 4XUNA 3ACGA 3OB8A 1W8NA 3D3AA 2HLEA 3K4AA 3IDAA 3NJVA 3WNKA 4P00B 1BWPA 4K7JA 2WAOA 4XUOA 2W9XA 3WF1A 1CIYA 3I2HA 2ZEXA 3I3EA 4MGQA 1UY0A 4RN5A 4CUAA 2VZOA 1R64A 2Y64A 1NAEA 3FHQA 3HEIA 2Q0SA 4RSHA 3DCIA 1NKGA 3BN6A 1GNYA 5FUIA 4A6OA 3WF4A 3W5NA 1DLCA 4Q9AA 3C8XA 1UYZA 5IYYA 4AG4A 3ACIA 3ACFA 1GU3A 2VQUA 2W46A 4IUGA 4GWJA 4CUCA 3A23A 3T0AA 2VCCA 4QPWA 3EYPA 4DUWA 4MO3M 1UX7A 2QQMA 3LQCA 2YFZA 4OMDA 4XUTA 3P94A 3I3DA 3OG2A 3SEEA 1UY4A 3CZUA 1GOGA 2J1SA 3VD4A 5JUVA 2W5FA 2VPTA 1US2A 1JYNA 3DT6A 5HOEA 5JMOA 1EUTA 2W1SA 2X10A 4OMCA 4IYJA 4PPYA 1UZ0A 5LA2A 1GOFA 4DXTA 3BGAA 2BBAA 2WUHA 1MPXA 2JE8A 2W1QA 4JGGA 4XUQA 1SDDB 2VM9A 1OF3A 1GOHA 5IFPA 3GM8A 1UY2A 2VQTA 3CDZB 4QX2A 2O14A 2W1UA 5JXJA 4JKMA 4A45A 5JXHA 3A21A 3LPFA 3VD9A 2CDPA 1BHGA 2B9VA 1UMIA 3K77A 3UESA 1JZ8A 1J00A 2VZTA 1L7QA 2Y8KA 1UY3A 4JHLA 1OD3A 2YB7A 3I2JA 2DCJA 2WO2A 4OAOA 5DPNA 5B5SA 2CDOA 1T2XA 3P6BA 3OEBA 1IQDC 1L7RA 3DT9A 4JJ6A 2DDUA 4Z2AA 3T09A 1JI6A 3MUY1 3EB7A 1BWRA 4XVHA 4H08A 4E8CA 1XC6A 2ID4A 2APJA 3DECA 3W7VA 4W4ZA 2W1WA 4DEVA 1JU4A 1PMJX 3VDAA 5C7GA 3C7GA 4M8KA 5CD9A 5IFTA 3GGLA 2YC2A 1VYHA 2W92A 1ESDA 5I0DA 3CIHA 4DXRA 2Y6LA 1JU3A 1SG3A 4XUPA 3WF3A 2VZ1A 3I2FA 4TTGA 2Q0QA 1NX9A 1UYYA 1ULPA 3IB3A 3MV11 3DT8A 5B4NA 2Y6KA 1YQ2A 3CQOA 2WDBA 2J1UA 3SEPA 4MOAA 4OYUA 4QDQA 2XOMA 2HYXA 1DEOA 1W9TA 4CU6A 1I5PA 1NUKA 1FXWA 2LS6A 4KMQA 2WYSA 3DYMA 3OBAA 3I2IA 3DC7A 2ZEZA 4D0QA 4OAPA 2VR4A 2J7MA 5EJZB 4OZOA 4S1PA 1LNSA 3IIIA 2X05A 1JYWA 2VZVA 4ZXEA 2X09A 4JKKA 1JYVA 1F4AA 3FL7A 4ARXA 2V5DA 3U37A 1UXXX 4P02B 2WN3A 4HYQA 2VMEA 2YC4A 3I3BA 3J7HA 3MV01 3UETA 3K4ZA 4K40A 3THCA 3WQBA 3HNMA 1JYXA 2V4VA 3VD5A 2C9KA 4QX0A 4JJ4A 4CU9A 3CMGA 3WEZA 2ZEYA 2ORXA 4UOJA 3T0DA 1ZMBA 1O59A 4A41A 1JZ5A 2W94A 2EIBA 4KWUA 3PUHA 2VOTA 3AC0A 2WZEA 5G04L 4E8DA 2WQ8A 2EIEA 4MADA 4P08A 1WABA 1J84A 3HNBM 4TXWA 1UY1A 5EJ1B 5LA1A 1W9SA 5JR2A 1XNAA 3WNMA 3K75B 3LPGA 5LA0A 4DUVA 5EIYB 1VJGA 2BGOA 2J1AA 5HPOA 2RV9A 3OGRA 2VC9A 3NJXA 5JXIA 1ES9A 3WF2A 1GUIA 1PX4A 3LEGA 5BN1A 4RW0A 1EUUA 2JD9A 5C71A 4KI5M 1WKYA 5JXGA 2R7EB 3P1IA
chains in the Genus database with same CATH superfamily
1ZOPA 5BUVA 3OLXA 4HK8A 5KBFA 4WKBA 4C6HA 5HS4A 2M1XA 2OL4A 4BP9A 2VN8A 5EPUA 3ZG6A 4QU8A 4TLEA 2VGDA 1Y3TA 2HSEA 1YZFA 3V0BA 3U39A 4F46A 2HNBA 4YMSA 3PUYA 1IU9A 1K7YA 2AR6A 4QPJC 1AGYA 4F5YA 2UVPA 2VYNA 1RXVA 5I0RA 3A4LA 3VR6A 2V6FA 3Q6MA 4W5WA 1R0KA 5FR1A 3LSYA 3A2KA 1EAYA 4GI1A 2WFAA 2XUIA 4XGQA 3IP3A 2CYAA 1X1AA 5TR9A 2V0CA 4YVSC 4XBQA 2FZKA 5F7UA 4XJSA 3UMJA 1HV8A 3R3WA 2HA6A 3BZBA 4U2KA 2IC1A 3LWDA 3GY0A 1NSTA 1M1NB 1OUXA 1NQUA 1L6IA 2E87A 3RS2A 4RKQA 2J1VA 1WXFA 5FBQB 1Y42X 4I1SA 1C4RA 1YMUA 3PPIA 3BCHA 1XJ0A 5E95A 1SHLA 1POV1 3E7XA 4M8IA 1MP0A 2IH4A 2O2ZA 1BE0A 2WLPA 3WZMA 4M9CA 4HT3B 4TKUA 4CIYA 4AJKA 1MIOA 4H4DA 1PGL2 2ACKA 5FY9A 4RYDA 5F4ZA 1BBT2 4DLLA 3KAJA 1WBLA 1TJPB 3I9LA 4I4NA 3KB6A 3NHZA 1G8AA 3ZE2B 1K75A 1IL0A 3SHQA 1F5SA 4V1CA 4XEZA 4CDUB 1E5IA 2HSJA 2CLMB 1F60A 4JL6A 2XUKA 1U4OA 4XE5A 2FR1A 3LLCA 4M22A 1J23A 5IJ0B 3KCCA 2R8BA 2X0KA 3KJIA 1AOXA 5FTKA 4LJ7A 1SBNE 1WBDA 2JZCA 4ZI3A 4RIFA 1CUEA 2HF2A 1YHYA 4JKYA 4LBQA 2YY1A 4C2UA 1T9AA 1W28A 1W3XA 3VDNB 3KV5A 4IIYA 1JSRA 2OZLB 4JP3A 4LVOA 2RC6A 1Q7TA 1P6UA 4M0NA 2WE8A 3HP4A 3NFYA 1A96A 1ENXA 3OJ0A 3KSUA 4FR5A 2ZUUA 1F3OA 3ORSA 3KPJA 3SZRA 4QG3A 4MW6A 1IPHA 1ZX1A 4PG6A 1D2GA 2WNVB 2CMHA 1NVTA 1US8A 2GHQA 3OQVA 3GWGA 4BO8A 4TQAA 3URFA 1M10A 4AAPA 3IVXA 2XWJI 4L15A 4OUDA 2C92A 2UWCA 2EKPA 1Q83A 4S2UA 3U60B 4ND6A 2HU8A 5TF0A 4YW2A 5L73A 3T06B 3SDSA 3O38A 2A9QA 3UV3A 3MUNA 4HZUB 2J5XA 4BNHA 5EP2A 3EPJA 1VJTA 4CMCA 2IXDA 4ZKDA 1OLUA 2ZBVA 1M34A 2RHHA 1UZWA 4LZNA 1WU8A 4Q0UA 1ISPA 1PO7A 3AJZA 4XFHA 5BNOB 3S2GA 1Q8OA 1R0RE 1F20A 2PO7A 3NEJA 1W0KD 2CDOA 1FBNA 2JE7A 2QORA 4DUZB 4XZPA 4ZT4A 3EG9B 4P54A 1PNOA 2I2BA 5EP1A 4IEIA 3LLSA 3A4TA 2O2HA 4FIZA 5KYTA 1OLXA 4M8KA 1C81A 5KYGA 1U0HC 1VAKA 2FWRA 3EGVA 3KLPX 4KOEC 1MNQA 1NMXA 1TEHA 1Y81A 1CUUA 5A4IS 3KCYA 1PK6A 2XOMA 3SKXA 5LYYA 4COUA 4L5JA 5B3AA 2YZNA 4DCGA 3DV0A 4AHXA 4G4JA 4AS3A 5EJZB 1TAUA 4YUZA 1JTEA 3QVJA 3LVFO 3Q1LA 1NVVQ 2FZ1A 5I7EA 2RGRA 4NHEA 3WNVA 4ZK2A 3TQTA 2VMEA 1FW6A 4DM7A 4QDXA 2YS7A 3JZAA 1U99A 4JKIA 2QZZA 3BJIC 2OGTA 1JFSA 3LL4A 2C82A 4QG7A 1TTHA 3AK4A 1GUAA 2QTLA 1VCNA 4KZPA 2Q5EA 1GUIA 5IAXA 3EEIA 1SBFA 3V6MA 1NOVA 4KAJA 4HDNA 4TMTA 3X2FA 4GUAA 4NBKA 1UL1X 1HB3A 3MAJA 1RHI1 1II9A 4IXDA 1O4VA 2FR8C 4JA2A 1E7QA 3G0HA 3JCIA 3SQOA 3KKKA 4LF7B 3KJFA 2W5UA 5H9QA 3W7AA 3RNSA 1AR62 5DUXA 5BNNC 1I5ZA 2VNVA 3USSA 5DN2A 3WQQA 5KB3A 3FOZA 2RK4A 2F3RA 4DLPA 2P6NA 3IDCB 1FP2A 5CKNA 1GSIA 1KAQA 1H2FA 2Y26A 3SKJE 4S2HA 2OC9A 1XU2A 5EWLB 4IDZA 4BIFA 5M29A 1BJTA 4MGYR 3MTBA 1W5TA 2DWCA 3VNBA 3CVWA 1IULA 3LYAA 5F77A 1LD3A 2P6OA 2AS0A 3B3QA 3BM5A 2QQPA 4YQZA 1F2UB 4KUGA 5HPYB 1OI4A 1LECA 3WSTA 2EJWA 1UPIA 1M75A 4URZR 5CB0A 2DWOA 2YU1A 1W4CA 4V0KA 1AR72 3AHCA 3PUWA 4YT8A 4Z7QB 1BNCA 4BMEA 4O0LA 1APBA 4BNFA 4PZEA 1RUF3 4K9PA 4Z6KA 2I80A 4NDAA 4J3FA 4DEQA 1ZR4A 1QHIA 4KMSA 5FZMA 4YRTA 2R6QA 4OJYA 2P2KA 1G64A 2HV8A 4JVAA 3DBHA 1VBD2 2D2IA 3HVUA 3CRW1 2NT3A 2IXCA 1RUG3 1T26A 5J59A 4K8RB 4MRPA 2F7SA 1VAMA 2JDYA 3SX0A 3OIDA 1LU9A 4EJMA 3V2IA 3PXEA 2OY0A 4XQCA 1PWEA 1E2LA 5BR8B 3AXEA 1FX1A 3H0CA 2YYZA 1E2PA 5KEIA 3L7LA 1S2BA 3UJ7A 1TZOA 3A22A 1VPTA 1GZCA 4N8DA 4CXMA 3VBSC 4CCAA 5HIAA 4I30A 1W6QB 3R23A 3CVOA 2O8NA 3E27A 1ENQA 2P9EA 3OIVA 5FV3A 5F3EA 1J70A 1PZFA 1JBKA 3B6EA 5CM9C 3AB8A 5BY2A 4AZWA 2RE9A 4A3XA 2JLRA 2PCJA 5FAXA 1FP4A 4L0PA 3HN7A 2GZDA 3SBOA 4EHDA 3IE2A 1FFSA 2BCEA 3DFKA 5EKUA 4HUQA 5CCEA 1GAEO 1UMDB 2HD4A 3ZN5A 2PWYA 2WWGA 1WSWA 2HRBA 1J3QA 3L8HA 1ULSA 5C1IA 1V6KA 1WW5A 1LEMA 3F95A 2ZZMA 4WAUA 2CF5A 1X50A 2JVJA 2VHQA 1OMIA 1B74A 3UWMA 4MUHA 1XE7A 3RU3A 1QXPA 2OD2A 4RF4A 4G09A 3ZDFA 1NSYA 2QS9A 1TD1A 5C5EA 4DPKA 2VEOA 5HIKA 1AR92 4YHHB 1JAXA 4RE5A 3HCNA 3CR8A 3NV1A 1JA9A 2HWXA 2G0NA 3GZEA 4ZAZA 3IBYA 4IXWA 2O8CB 1O89A 4CEYC 1D4FA 1NG0A 4CM8B 4IOJA 4JIMA 1WB6A 1G59A 1ZM1A 4H7FA 4RLHA 3DQZA 3VB9A 2C4VA 4A0GA 4R69A 4BB6A 3L1IA 2KE5A 1ODKA 4FBFA 1K92A 4B7ZA 1JWBB 1NZFA 1S4QA 4BYYA 1ZUNB 3EXFB 2HQ1A 4XCQA 4YYOA 1H1DA 4M1WA 1MD9A 2R6DA 2CUTA 4RM3A 1OPOA 3BA6A 2EA7A 3HG7A 3GFSA 3ASUA 3MUY1 1JNYA 4QPNA 1VSTA 1XNBA 1XN1A 1ZMTA 3H3FA 2A9KA 2Z79A 3B38A 1BYUA 1K7FB 1P9NA 3SZMA 2ZU6A 1M5UA 3BH0A 5ALFA 1KFKB 1GZ6A 5IARA 1M76A 3MZ0A 5DASA 3AUYA 2WA3A 1KJWA 3GRRA 1AKQA 3BUCA 2KLHA 4WJKB 2I9KA 3FZ3A 3FFZA 2CLKB 4JR1A 4U6SA 3FR8A 3COWA 5HS6A 1WSBA 4NBSA 2JANA 3KKOA 3Q3EA 4CKYA 2HJIA 2GMEA 4ZXEA 4KIWA 1S02A 3HBKA 5I4BA 1OZ0A 1R091 3MMZA 1OZHA 5DHFA 2ZGPA 1QHNA 1AQLA 3KTDA 3W5HA 4BWOA 1GGKA 3BDAA 3MT0A 4QSMA 5SY6A 3IMEA 1DQ4A 3VU9A 1NVVR 1DAGA 2Y1EA 2BMJA 2G3YA 1Q7CA 3WK8A 2YIJA 2GAIA 1TVKA 1YE5A 4QC2A 1V70A 4OXXA 4MO2A 3ZHXA 3EA5A 1SUWA 3ZIXA 4GWKA 2XYRA 2ZT8A 3TJZA 5IZCC 4Q4W2 3P1IA 4AEDC 1GGVA 3WG9A 3IEVA 4ZI7B 2ALJA 3IO5A 3OAAD 2OFPA 2AA3A 5FYYA 1YXMA 4DV0B 3KZNA 2Y0OA 4A1OA 4YAOA 3E9EA 1QNLA 3AEXA 5EJMA 2P69A 3I09A 3JQ8B 3H84A 2QAGB 1P2UA 5A70A 2JDKA 1KGYA 2FDGA 4NNJA 3RJZA 2GAOA 1A77A 1NCQC 2QTTA 3DKPA 2R073 3T7IA 4C4RA 5AWFC 2E18A 1XSQA 1SZPA 2YXNA 1TFRA 5JJLA 2PRZA 3H16A 4DIFA 2Y1DA 2RAFA 4X6LA 4CKXA 5HEKA 5EY5B 4H1WA 3SQXA 2O5RA 2SNIE 3MICA 4XD7D 4GYYA 5CDFE 5JG7A 3EG9A 1DKPA 4LVUA 4RESA 2NP7A 5DXDA 5CFCC 4Y2VA 1P39A 1CNMA 4DWVA 4ZVPA 4YH1A 2R1BA 5L3QA 1ZINA 2R6ZA 4JQZA 3T2PA 2ZBGA 2JCSA 3QLTA 1SBIA 3N86A 2FQYA 4BCUA 4OBBA 5A0TA 3EXHB 3KLSA 3HI6A 4BLUA 1W85A 4UEOA 1OH6A 3P2JA 3B6IA 4J6FA 5LBCA 3D02A 2J22A 2JHFA 2RS31 4RIGA 2ZTSA 4BE3A 1C3EA 2JLUA 3ACHA 5LZ5A 4RTRA 1VC2A 4U00A 3H7JA 4ET7A 3ECSA 2OPBA 2J30A 1RE1A 3R6WA 4J0FA 2CWWA 3DSRA 1TKCA 3N07A 2ZMLA 3UKOA 1X74A 5EXXA 2YWFA 4JX0A 2OCDA 4M55A 4YZ4A 5I3CA 2IITA 2QPTA 1WXEA 3K1YA 4XB1A 3VBEA 2VH2A 2ZIFA 3SVLA 3AMHA 3LBHA 1CERA 1OH5A 1T5LA 5FNVB 3BMXA 4U36A 3WK9A 2CDCA 5DSTA 1H4VB 2Q4RA 2RJOA 5D01A 3JQ7A 4YUWA 3NHLA 3PC3A 2XQKA 1CDOA 4J90A 1Y1RA 4HDRB 5ESXA 2QZ2A 1HG0A 1PRYA 4Q3KA 4H60A 3MJRA 1JR2A 3D7MA 4FD2A 4DLYA 1E2EA 4ARAA 1Y5IA 2WAYA 3GFRA 5CU7A 4QGHA 4UBMA 1HT2E 5B4TA 2YXPX 2CFIA 4PO8A 4HSLA 2ZJ1A 4AYXA 4OH7A 2EKDA 2B8MA 3IM0A 3LUGA 2B30A 1TLFA 2NW6A 2ROQA 4AI9A 5FORA 3N76A 3W77A 3GLGE 5CNKA 1AR83 2ATVA 3I12A 2H1LA 2D40A 3GJYA 1Z3CA 3PNBA 1RQ2A 4Z1MD 3EULA 2O8BA 3GN1A 1TM2A 3V2UA 4JI3B 4LDQA 3AY3A 4CMJA 3LY8A 2X5IB 2GM9A 3RSJA 1P4JA 1Z7GA 4X7PA 1RAFA 2G9RA 2DECA 2O8QA 1JDVA 1PL0A 2WYHA 4X94A 1UMIA 6PFKA 3QEAZ 3EC2A 1CFZA 2P90A 3T5PA 1D9ZA 5KYUB 5H5JA 1QRUA 4XXPA 2A86A 3G68A 1LR5A 3I6YA 1ONBA 4REMA 1M0TA 3OY2A 3GYDA 3SVZA 3X1JA 1E9RA 3HKCB 4NPLA 3NVKI 2OG1A 4N3CA 1OAOC 2I2XB 2PG3A 2Q0QA 4RD1A 5JXWA 1T9ZA 4B4RA 3AG6A 3MV11 3IIAA 4L8LA 3EGWA 4F96A 2JDPA 1VGQA 3S2ZA 3JAKB 2XT6A 4RD7A 4E4ZA 1FLDA 5IT0A 1WVGA 4BU2A 3GNTA 5BQOA 1LHVA 3AYXB 3ES1A 5IWAB 2CEKA 3SSMA 5EEHA 1S0GA 3NWPA 4HPKB 4Q8LA 3TPZA 3WVNA 4B8YA 2DJIA 4BBZA 5CLJA 3VO8A 4UFMA 2BMFA 2FFHA 4HX9A 3RDPA 1Y3CE 4MIKA 2JGEA 3FCOA 4ZDIA 4FJ0A 2C42A 1HRV1 1XF9A 4E4DX 1WU7A 2ZRBA 1FB5A 4GM1A 1AXKA 4U2BA 4WN3A 1OIXA 1RLMA 2JFOA 2ZUWA 1W06A 2BFBB 3AMNA 1H69A 3NKTA 5IUJC 4HATA 4TWBA 3V3KA 2H8KA 3ZQJA 3WZLA 1P4RA 4C4AA 1W5EA 5FWYB 1UOQA 1YF3A 3DLPX 4KE8A 3WL4A 1UJNA 10MHA 4QXRA 2OS2A 3BTOA 4G0ZA 3K6RA 5C34B 2DYCA 5ALYA 1T9GS 2ARAA 3QG5A 4DQVA 2O1QA 4BUCA 1MB3A 1RXGA 1QRRA 3S0MA 1SY7A 5C32A 4RKEA 4RHV2 2D6PA 2X86A 1HLFA 4INDA 2VQ3A 2D3SA 1O8PA 5EWMA 4GD3Q 2R061 3WFJA 2XCSB 4WLVA 5DZFA 4LJ4A 3TTVA 2CYBA 3CISA 4RK1A 4PGAA 1ZUNA 4IHAA 3L0IB 1XPWA 1ENZA 1U8TA 2QP3A 3BTYA 2KYRA 4M54A 1BHQ1 4HMQA 4O02B 3A0RB 2C83A 1OFUA 4HGPA 2GF9A 4LIPD 1HYEA 3UMMA 3LX5A 3PC2A 1TM7E 1J5EB 3TAHA 5A3LA 2HA4A 4HADA 3AVXA 2MCFA 3VD7A 2FDXA 1M6VB 2BV3A 3SIXA 4V0RA 3C6MA 2RC5A 2VNGA 1XYGA 3PWSA 3UB4A 2Q6VA 1XDSA 1U3CA 4FTWA 4CU8A 2WPDD 2W8BB 5E6UA 5JBIA 1F6DA 4KNYA 4TMYA 4JYMA 3AMVA 4UNRA 2Q6LA 1AUQA 4F1WA 4FYIA 5IHRA 1GEGA 3O1IC 4RVCA 3SM3A 1IJKA 1RZRA 4HWTA 3HEBA 1W59A 2IWHA 3PNPA 1JHNA 3TBDA 3CVVA 1NPYA 1Q14A 4HVRA 2SKDA 2G83A 3ZFFA 2X1MA 2ZYIA 4KACA 3JARB 4RF5A 4B3RB 3GFVA 3TZEA 4JMPA 4BGEA 4PYNA 5CNIA 1QWRA 3VVBA 5A2GA 3OCPA 4FOTA 1KJQA 1EK2A 4CXWA 1IHDA 4MXDA 4PHGA 1K98A 2K5UA 4UCQA 1VLVA 3QE3A 3UICA 3H8WA 2OV2A 3HDHA 1NV8A 1FUIA 3SFTA 3W8FA 4CKEB 5FLJA 3GXBA 3FYUA 3M2TA 2PHRA 1A4UA 1RHQA 4NVRA 4WVVA 5DBEX 4AZVA 3SI7A 5FXMA 2BFFB 2CBZA 1YL6A 3ZS9A 3SH3A 1V1RA 2YNMC 1OKKD 3JQ8A 2DHRA 5FUIA 1ULDA 1R9JA 1UYZA 1LOFA 1E32A 4IINA 3FOEC 1GSOA 1R50A 1IN7A 4CTKA 1KYZA 3U40A 3HBMA 5DNWA 3P5BA 3ZFEA 1KZ7B 1CUSA 4PLPA 4MVJI 2NUAB 4X63A 4DC9A 3VD4A 4EYGA 4KPEC 5KYWA 4LCBA 3CRNA 4B9EA 4I1OA 3ESZA 4Z9FA 3R7WB 5T5QA 3MRTA 2GF0A 2PXHA 4QX2A 2Q30A 4YVFA 2XVZA 3K35A 1E58A 5TV2A 4LBZA 3QLUA 2F6BA 4OTZA 5REQA 2GPSA 2H6BA 3EUFA 1J1IA 4U7WA 1NNUA 4P9XA 4HDKA 5ITWA 2ID4A 3ZO0B 2FZGA 5AVVA 5C7GA 2Z8YA 5CEFA 5NULA 2H11A 4OXKA 2FP4A 4MYUA 2EKLA 2XRMA 4KN6A 5K20A 1M2VB 2DWUA 3MHZA 4RR3C 2Q2OA 3ELBA 3QLQA 1DLJA 4NR0A 3CWZA 4KK4A 5L6LB 3HMQA 3PLNA 3TBKA 1CAXA 3G0GA 4TKMA 3VKUA 4KL8S 4P9NA 1ISFA 1G8FA 2PFKA 1NY6A 2PUWA 1T6BX 1U12A 4N9HA 3IQEA 1ZOLA 3Q9OA 4C2AA 3H6HA 4Q26A 4IQ8A 1V5IA 4AMVA 3UOGA 2XMCA 1E9FA 3T0DA 4F04A 1JJ7A 2ZJFA 1KDOA 2AN5A 2B9EA 4PVDA 4PRZA 2DUMA 5HGXA 1LV7A 2OHIA 1V8BA 2WTEA 2AOVA 3TEMA 1KFCB 1T8TA 5CLFA 2G09A 1X7WB 5KU1A 1T9DA 1K06A 5LZ7A 1TVMA 2QRMA 3S55A 4GWLA 2QRPA 4D4HA 3AR4A 1ZNQO 2QTFA 4F91B 3MJ4A 4CDGA 3UVEA 1YRLA 4EW2A 3ZDBA 3HCAA 5BSTA 4WFIA 5L36A 2ZYWX 3GJZA 2WFLB 3OOHA 4C2TA 4AAXA 4UOZA 3R9IA 5FK8A 4URYR 3O82A 5ESDA 3WIOA 3OM0A 1TCBA 3QVOA 1W9YA 1STOA 3DNPA 5C5DA 3RGBA 3AOEA 2XWBB 1UO9A 5E4JA 4YARA 4QLAA 4WZAB 3FPJA 3V6LA 3RIHA 1HLPA 2FZ5A 3LCVB 1XB9A 1AQJA 4NULA 3I76A 3MZHA 5KXCA 3C7HA 5DYIA 1YS7A 3NIGB 4JLBA 5GGYA 1A1SA 4V0QA 1E6KA 2W08A 1BHO1 1OA2A 2ZB8A 4DG8A 5TX7A 4EATA 4MDFA 2BBOA 3AKYA 3FROA 4MWEA 1VJ2A 3T0IA 2WF7A 3T1QA 1Y33E 1LC3A 1Z07A 3MWGA 5LIPA 4H18A 1Z4IA 2QZ4A 4UE3S 3T4UA 4QDJA 1WJGA 2PRKA 1G7YA 1EU1A 1VBC1 1Z7EA 1NI5A 1DEXA 4CF7A 2PX2A 3VR2D 4BFLA 2OCLA 2D7JA 1ISMA 1W36B 3IAHA 1PU2A 2BZSA 4A4DA 4F4HA 4NZYA 3GARA 4BX0A 3E2MA 3FH0A 5KNDA 1QH8B 3U4QA 4WLOA 2C5EA 4QU0A 4EOGA 1O77A 3FD8A 1JAHA 1XQ9A 2OYZA 3OIWA 1KNQA 1K45A 2CCJA 1OA4A 4BP3A 3NVMB 3PXAA 2JJYA 1RBYA 1PZXA 3C3MA 1H8EA 1U4NA 1WXIA 5AVUA 1T6BY 5CFDB 3CPEA 1WWKA 4XZUG 2F00A 2Z8YM 1JKJA 2EL9A 1YFXA 1IN6A 1Q5OA 1K8RA 4XXAA 4UUOA 4E4HA 1UOFA 1FJGB 3K20A 4TLFA 2PBFA 1IHYA 1G21A 1UODA 1NY72 4A26A 4FHCA 4KLZA 1VB5A 1YVPA 4QO7A 2P6HA 4WCVA 1S55A 2PZGA 4QMAA 1EGVB 3ZPYA 4A6OA 3WF4A 3PFGA 2PXXA 1U6IA 1N57A 3V4RA 4GZ5A 1RWBA 2EQBA 3M6LA 4K26A 5FPLA 3HHEA 4IRMA 1U2GA 3MMPA 4R9RA 4MXWA 3W20A 3QFRA 1GOGA 2IV7A 3EJ6A 4A9AA 4IF6A 3M5CA 4MP8A 3O0WA 1ZI8A 2P1DA 1UM9B 3VC7A 1RUH3 1AG9A 1K9SA 4OQZA 2X0DA 4JGGA 5IM4F 4DN6A 1D5WA 3O8QB 2GWRA 4IEOA 2RSLA 4WIAA 1BEZA 2FRVA 2XE8A 1ZNPA 3MTEA 3HLTA 5DK6A 3AILA 2OIIA 4LDAA 2IXFA 1SVKA 3FWHA 2OUHA 4O2BF 1TMF2 2Q6TA 3RFUA 3V4VB 5FZ8A 3B1YA 3GHYA 1M34E 4E33A 1EGQA 1QC5A 1NUAA 3O5AA 1KQNA 4YJ3B 4PNEA 5LB4A 2V7TA 1ML3A 1X80B 1MTOA 5HP4A 1BH2A 1GSLA 3ZDRA 1YQ2A 2RMU3 2WDBA 3F97A 1PJRA 2J7KA 5KNDH 3CLTD 5TARA 3W9SA 2LCQA 2IDKA 4ZMSA 4Z0NA 3D3WB 1DX4A 1Z25A 3A1FA 4PPQA 1JJFA 1L7NA 4WESB 4KW7A 3BU7A 3AKCA 1XGKA 3A4MA 3DZBA 1CW2B 1PQPA 1XEXB 4LPKA 2GK4A 1DQ1A 3U14A 2IGTA 4HGRA 1NI4A 3BALA 2DGDA 5HXAA 1GTG1 4BO4A 2AG0A 5D2CA 2RFLA 3RARA 2V7QD 2OPHA 2WI8A 5I8SA 3QD6A 3T7AA 4D79A 1T35A 2I6TA 2MSCB 3SH4A 5ELLA 5LVAA 5F2WA 3V1MA 2XNSA 1V6LA 2EAKA 3MINB 3VH2A 4A7KA 1TQ6A 1O4ZA 2JFVA 1LOGA 1XUOA 1NJGA 1Q7EA 2HF7A 1TGVA 4NE7A 1U8FO 2Y6HA 3GLVA 3S99A 3RTDA 3ES9A 3WD5A 1OX4A 4C0SA 1ZO8A 4CUJA 4BH9A 3FTFA 1QDUA 2FSSA 2YG0A 3J4UH 3FBGA 3V8NA 5KMGA 2C9MA 3WKBA 2H4YA 4OQ4A 4DDKA 4I1YA 3FKJA 5AM0A 1W73A 3JQAB 4AL4A 3D6NB 1MG0A 2NSHA 1X3LA 4JEHA 1I14A 1NE7A 2PLV3 4R98A 4CUBA 5FZ9A 3ON5A 3R5SA 4N7IA 1A9ZA 4L7VA 1W8FA 1SUCA 5LOVF 1HQLA 4PCAA 4IWNA 4ZHNA 4KIJA 2P0EA 1KYIA 2RHGB 3TI7A 3SKYA 2QN8A 4PI0A 3GLGA 5LC1A 3DNFA 2XUZA 5C31A 3KT4A 1SD1A 1CAVA 1YXWA 1QHHA 4BPZA 3LRXA 4PX5A 4G4SP 3B3QE 1JTFA 4AFBA 2WF8A 3RBVA 1XFDA 3V0BB 2XV1A 4YJ3F 2BSAA 3QTTA 1E2BA 1R8SA 4E6PA 2H06A 2UVPB 1U3FA 4BNMA 2Q4BA 2XE7A 1NW9B 1ECBA 3ICCA 1G9TA 3AINA 5P8WA 3H2SA 3GA7A 1S5PA 4LTAA 5KTRA 1W0NA 3FMOB 1ZVVA 2IXEA 3T7RA 5AYVA 5EZWA 3W4IA 1CUCA 4YI5A 3G9ZA 4BJ5A 5ELMA 4LJRA 3O47A 5LA9A 4UU0A 4LOKA 3SZLA 4X92A 4O0MA 3L43A 5ALSA 4I5GA 1EAH1 3AVYA 3VL9A 1UQUA 1QZZA 1R74A 5L40A 2YHAA 3WJ1A 4RHTA 2VP2A 5FYQA 5ALKA 1QEXA 1LBTA 4E2XA 1LNQA 1MIOB 4CV2A 1D4VB 1Z4QA 3QWAA 3KPUA 2H2AA 3LBFA 2YCBA 5THXA 3FVTA 4V1CB 1NVMB 1K9VF 4JYCA 4YEDA 5TXGA 4XGRA 1H22A 3GT4A 4H3VA 3AQIA 3MD0A 2C24A 1AIPA 2YFKA 5LA6A 1XU9A 4MYCA 3MIGA 2YV4A 3H3UA 2D2FA 4ECEA 1C1DB 2JEYA 2IU6A 3EZYA 3CLPA 5HZKA 2QTCA 2W71A 4DUGA 5G40A 4HLUC 4LBQB 5IYYA 5K0LA 1UKGA 2XNDD 1KPHA 2IUSA 3POBA 3AYEA 3EYPA 3JYNA 1VSUA 4YRLA 4M98A 3ZY6A 4RYLA 2EHJA 1E3DA 4TSKA 3LXUX 3P94A 3ENZA 4Q1BA 3IQGX 4HAXA 1XU1A 1UY4A 4ZT2A 3DVLA 4DBZA 5JUVA 4RV4A 2CAVA 3D1VA 1ZRHA 2FUEA 3W3AA 3ATGA 1US8B 2CCGA 4GAZA 2X7JA 2DFLA 1UWKA 2RG4A 2IOFK 3DPIA 3SPXA 4PZYA 2AQIA 2OZKA 4OUDB 3ZWPA 2Q27A 5I8ZA 4D9CA 3Q85A 4RH3A 3CN7A 1K7EB 4Y1VA 5K09A 4RH0A 1EKXA 3A3OA 3CLKA 1CJBA 3BL8A 3HJBA 2PXCA 2ZGRA 2X4GA 4C1XA 2WD9A 1RPAA 1IFXA 5AOCA 2ZB4A 3OECA 3WYDA 1F7UA 3LIHA 2PT5A 1FXWA 3DYMA 1MFZA 1M34B 4X95A 1AL0G 1HA3A 2CMFA 1JB9A 3IEKA 1XQ1A 3WFZA 3G7DA 5LUBA 4B0PA 4Q8KA 4AZZA 3AKPA 2H3EA 4XH9B 1JIXA 2W0XA 4DV6B 2IEIA 1Z6ZA 4HXGA 3JZMA 4JJ4A 4R9SA 3MNFA 5KPJA 3DE4X 5IK2A 2W8ZA 3DLIA 4MI3A 1NAIA 5K0TA 3HNRA 1LOCA 4QNNA 1XNAA 1OLXB 3PX7A 4BJ3A 3FUUA 2BGOA 3LA2A 2WWJA 1RS0A 3ZKUA 1YB1A 1L5QA 3M4JA 4UULA 4R0MA 3IPRA 1KAOA 3KMHA 5DK4A 3PEFA 2VQ6A 1RHI2 4COOA 1DBNA 1Q3KA 2QXYA 1RIIA 3PB3A 2GNOA 4R6XA 3DV0B 3OWOA 3W7BA 1MVNA 3CUYA 2ORYA 3BWYA 4NRQA 3VYSB 4MGZR 4DLRA 4M1OA 4BNIA 5IBRA 2Z95A 3M9XA 3OBTA 4CCWA 3MGUA 3Q5GA 1A88A 2QW1A 3UV9A 3WB1A 3OGSA 1DO8A 8AT1A 1V9SA 4XQGA 1XWIA 1BEV1 5KVQA 4XYLA 3RAFC 3FVRA 1P1JA 4WK2B 4B2PA 5C7LO 2OM6A 3W3AH 5GZEA 1NXQA 4P9JA 2DTEA 4KMOA 3D5TA 2JG9A 5HILA 1M2JA 2NU9A 1Y63A 3ROGA 4HT1T 5M5BA 5KUTA 1YA6A 4CM7A 2SCUA 1OWPA 2CSGA 1SXJD 4M60A 4LDPA 3SNKA 5HXVA 1JR3D 2Z98A 2VUIB 3C7OA 4G97A 2JCVA 2CXSA 3NOOA 3VC1A 5EZYF 4AP9A 3SMHA 2Z4RA 1RBMA 1VZ3A 1TECE 4JXKA 4WM8C 4DMLA 3VRHA 2G5GX 3NBUA 2AN3A 2FMDA 3K8OE 1LPOA 1S2DA 2PT6A 4HZGA 3EAFA 5T52A 2IEYA 3MO4A 5D3KA 3K51A 3WW2A 3SG0A 4OU4A 2YR0A 3SHVA 3M89A 3HJRA 1PW7A 4OGFA 3I83A 2O6LA 4HOOA 1OC1A 2O54A 1PX2A 3IHWA 1BX1A 3F78A 3LA3A 3O4HA 3GLKA 1IG0A 5I9TA 1LVUA 4LHZA 4ZRNA 4RK7A 3VBSA 1V3UA 3ZHRA 1FQOA 4ZVRA 4RSMA 1EBUA 1F8FA 2GCIA 4ZVNA 2OBMA 1UK7A 1QTRA 3CRMA 4B4KA 3UM9A 1GFWA 4BRZA 1IRIA 5E9AA 4O2AF 3N9NA 2E2WA 3WWDA 5FTNA 2ECPA 4MS1B 3VDQA 2C0PA 3DBHB 4A7YA 2NTYC 1ATZA 2J3EA 3H05A 4JX8A 1UJ4A 2B4YA 4WUVA 3ROXA 2NO1A 2LIPA 3G8CA 2DLCX 3BJMA 1Z7BA 2ZRCA 3LUAA 5KNBH 4XUNA 3Q40A 3UIEA 5D1HA 4TROA 1X7XA 4MUJA 2RDRA 5DEIA 3KEQA 3B8HA 2VUSA 1QJ4A 4NN0A 1G60A 3ZZ0A 1V9U2 2B1QA 3FHQA 4AZTA 2RM23 4RFRB 2R79A 5FO0A 3U7FB 4LJ5A 3WGYA 3UG6A 1KD7A 3G5TA 4YWHA 2ZSEA 2AFRA 3H8SA 5BN4A 3W4KA 4HN1A 2B69A 2J9FA 1VGVA 2F62A 3GRCA 3ZFGA 3WP0A 2GXSA 4HKWA 3CZUA 3FPBA 2WA4A 5C3QA 1FP4B 3DXFA 1KSHA 3AJDA 3B01A 3LCUA 4X45A 2WUWE 4FFGA 1KI9A 4HUQB 1QNFA 3NT4A 3RJMA 3RK1A 1RRVA 3VDDC 2VZ8A 4B83A 1V47A 1HYHA 3ZLTA 2HY7A 2QI9C 1PCXA 1X3SA 2ZW9A 5EWSA 3SS8A 4HUTA 3Q8XB 1XI2A 3LH5A 1S1AA 4X71A 4LECA 2RHCA 3CMMA 5TEWA 3FYTA 4LFCB 3H1EA 1J1TA 4PLMA 2Q3FA 3RVDA 2WJYA 5ITZA 1YR2A 4DRVA 3PDCA 2IIVA 2H7VA 2G5PA 2R6FA 1C57A 1YD7A 4GI2A 1Y3FE 1JU3A 1GYRA 1JDTA 2O0MA 4MDYA 5HFNA 821PA 3CV3A 4YCSA 5DDJ1 4OHMA 3NTQA 1DQRA 5I0SA 1F17A 1IZ3A 1KZHA 3CFYA 3ZV3A 4D9JA 4F5DA 4PBOA 1NVDA 3ZK8A 3RZHA 2X09A 1J7JA 1OXXK 3HXQA 1BMQA 3CF0A 1VIVA 2QUJA 5A03A 2ZUBA 1OC4A 3RABA 3BHJA 3T1TA 2PMBA 2QNRA 4ZC1A 3WEZA 1RW4A 1YCFA 5JAXA 3HU1A 5G1NA 2J6CA 4BE7B 3V4PB 3AI3A 3TL3A 4LKFA 3C0KA 4MVJA 4XFCA 1RRPA 3WL5A 3ZVRA 4MRAA 1MZFA 3F4BA 1YMVA 1Y6RA 2PDAA 1KC3A 4MQBA 2IZ7A 2QU7A 3VGPA 3ULKA 4AEDA 1ODNA 1PX4A 5JANA 3S5AA 3TSOA 4L4RA 2C7BA 1DT3A 2P5YA 2R62A 1I6XA 4NZ9A 1C1DA 4C05A 4PYQA 4RMIA 3ISVA 4BIOA 3TRDA 1O4YA 4EYQA 1A9TA 1CCWA 5GZGA 1DJMA 4M1EA 1B6GA 1FMCA 3SITA 3Q3HA 1CV2A 1OWNA 1NCQA 5M7EA 3ZWXA 2XDYA 2Q3HA 3NM5A 4PINA 3G85A 1B3BA 3CH5A 4IJWA 5JO0A 4R54A 3B9IA 1CB0A 3H5RA 4GM4A 3VU9B 3WR5A 4CEJA 2A6XA 4AK3A 3VH4A 3GVXA 4S0XA 3OF1A 5A3SA 2YZ2A 1TVKB 3RH0A 4NOKA 4RVUA 4BNLA 5GY7A 3IC5A 2FDJA 2BERA 4MUGA 4FKBA 4XE9A 3ZV7A 1ZGJA 1OH7A 2G9NA 3UJNA 3LFIA 4ZT6A 3VYRB 2A30A 3BN3A 2YYSA 4ETMA 4XFAA 3I2OA 4O4LA 2OOKA 4D3WA 4ATNA 4IQ0A 4Q6BA 3WMEA 3WGIA 3TM4A 3MA0A 3ZZUA 3OURA 3CLHA 3VR6H 5T57A 3LT5A 2UZAA 1WRBA 3HFRA 3RM3A 1Q8VA 1VECA 1CGPA 5CH8A 3N7JA 4ZCRA 1PFVA 3WSOA 3PR1A 4OK6A 2XR1A 4Q3NA 4PF1A 1MO4A 4ZCTA 4KBGA 1T9CA 4DQKA 3P3NA 4P3PA 1KYYA 1GTL1 3L4BA 4F7DA 1FT9A 4NABA 4UMVA 4BZXA 4CCLA 4PLCA 3OEEA 2RS32 2QVXX 1GP5A 4RTSA 4MQMA 2PZAA 1PW5A 2RS11 2JICA 1G66A 2MOKA 3FUCA 4R6WA 4W50A 4DCCA 2O8DA 1NP7A 3BK1A 3EXUA 5BVHA 1YS1X 1MEC1 1U2DC 4P2BA 3SSAA 4EPWA 1H8TA 4OHOA 4BL5A 1PTKA 4KBFA 2KPOA 4OK3A 4WN9A 1B35C 3G5UA 2NP0A 4HVAA 1Y37A 3UJ9A 3FPKA 4JUCA 2IYRA 5L3QB 1DQZA 4KHZA 2WD8A 4RXMA 5MFZA 3L41A 3FPEA 2DPGA 3ZLJA 3BKWA 3O92A 3I6MA 1PO22 4RAOA 3LNTA 4AQDA 2D2XA 1JHRA 1TB4A 3A9TA 2J9ZB 5C8XA 3RG0A 1TEVA 1K88A 4DJJA 2HK9A 2QJOA 2WIDA 1W85B 4DZTA 1XNDA 2WHEA 3SJBA 1BWPA 1UP7A 4K7JA 3NWJA 2E82A 1FXSA 2XBO3 1KQGA 4F2WA 3O2JA 4W5RA 2CGEA 1RPJA 2GEDA 5HKOA 3L6BA 4YAIA 3DZGA 3VHLB 1KIFA 3PNMA 3FGZA 3ISJA 1L8QA 1ND3C 1RLUA 1BA3A 1FSZA 3ZE9A 2FSVC 3EVFA 1QGDA 3NJ8A 3OUHA 4MUKA 1IBSA 2WKKA 2PX3A 5IM5A 2ZKNA 3AOGA 4AJNA 4NTZA 4AW9A 5KWVA 5EYXA 1QIJA 2PLFA 4DRYA 3TOXA 1HNNA 4ZYZA 4O8CA 3JQ7B 1IEXA 2JFGA 2ZG6A 3EH1A 4LYFA 4Q3BA 3Q2IA 1ADGA 4GI5A 3R3VA 1FLAA 3WTCA 4C4ZA 4B3DA 3MW8A 1KDYA 3VR1A 2FPLA 3E05A 1IBMB 2W39A 4WBNA 4E5YA 3UKDA 3I4CA 1V5EA 4LYHA 1X42A 1BROA 1OAOA 3FUTA 4HGOA 5FL7D 4JP8A 3E7PA 3R3JA 4S12A 2BW8A 1XZDA 4QBTA 2YXLA 1W96A 1TDJA 3U3OA 1H5UA 5FCCA 4K86A 1QG4A 1MEJA 2HYDA 3TMYA 2GZRA 4XD2A 4H4CA 3NG1A 3DWGA 2O8BB 1LXCA 1LS6A 3CW2A 2WSSA 5J2UA 2QVBA 2Q5CA 5AK6A 1P44A 4DA8A 1CLEA 4Y6RA 1J06A 3L04A 2NZWA 3R6SA 3EOBI 4G5FA 2ZYTX 2A5ZA 3UETA 4I7EA 3H3LA 2ZWMA 1BVHA 1NASA 4MYSA 3ZJVA 3S8MA 1UPUA 2KLBA 4MS1A 1YS4A 1CJCA 5IWCA 1NVKA 3W9UA 5A1TA 4HD8A 4B43A 1QANA 4TXWA 1THMA 3POYA 3U1VA 3VOSA 1MMFB 4ZTZB 3DDOA 5H4GA 1WXHA 4HAOA 4K2AA 4YIHA 5ALVA 4L4SA 4C7KA 3N7TA 2BNNA 3LEGA 4ZVKA 4OY3A 2NSJA 4MW5A 5IHXA 4WOBA 5JOZA 3RLFA 1F14A 3JD71 1M7BA 2PUAA 3DDSA 1QR2A 2HPVA 2D3PA 3FKSD 2D5LA 4L75A 2X1VA 1OVGA 3U11A 5EFZA 1PFYA 4NQRA 4E08A 3RRMA 2D98A 2RG7A 3PLAE 2XEDA 1DKUA 2OXFA 1O0CA 3MUZ1 4QOGA 2AYXA 4YQFA 1YRBA 2AVDA 1XVTA 2VNKA 1QXJA 2OKCA 3FYDA 3WR0A 3DMRA 3THDA 3VA7A 1YZNA 2C54A 1UDCA 1A9YA 2BWAA 2R062 4MVXA 1AQYA 5H70A 3ONDA 5A4AA 1UP6A 4LNUA 1G42A 1T9KA 3H8XA 3NRJA 1XPUA 1PM4A 1RP1A 3BIJA 1KY4A 2UY9A 1ZK3A 3FSGD 4NCBA 2WM9B 1TIPA 1WL8A 2WY2D 4PHZA 4DY6A 2GBLA 3GDHA 3CLRD 3NBXX 4HTFA 2D3WA 4NJOA 3S2FA 2V7WA 4PHHA 2A3YA 3IRVA 4U7HA 4GBMA 2RH4A 4R8MA 3R3YA 3C3VA 1U1CA 2GZ3A 4CPBD 4R4ZA 4QD2A 3QUBA 3ZWBA 4CCOA 4HQKA 2VXRA 1OD6A 2XWQA 4KR6A 5EWMB 5FKJA 1C8M2 4A6DA 2R1VA 2BGPA 3GZAA 4ZZ8A 3TLKA 4AVBA 1Y7LA 4BO3A 2HF8A 5DN6A 1FDTA 4IL7A 4I5FA 4Y7DA 3HN2A 1J2EA 5AI4A 2CKDA 2P3QA 4NG4A 5FLHA 4EUNA 1Q1GA 3TB0A 1N25A 2HEWF 4J29A 3T1LA 2B42B 5G1PA 1AMUA 2VF5X 2AC7A 3R7AA 4L8WB 4RKWA 2JJ8A 2BJSA 2PBRA 2QJTA 5FMOS 1L5VA 3PC4A 2VJXA 2R48A 2YN4A 5E6UB 3QBJA 3CZ9A 1Y1TA 4RK4A 4F2GA 3ENNA 5HIJA 2FEPA 4JJAA 5D1NA 3NJVA 1BZWA 1G6OA 1P7ZA 3DKWA 3ROPA 1Z28A 3L7OA 4W7IA 2JENA 1GCAA 3VDRA 2EQAA 3WLMA 2A4KA 1SUBA 4EG3A 4O1MA 2IH2A 3OQJA 4X6RB 3ZFFB 3FMIA 2VDQB 1U0GA 3OKCA 4KVFA 1G21E 5JWPA 2HMYB 1C9JA 4PZPA 2JZOA 1P91A 1Z6YA 4HYTA 2VQFB 2GYWA 3H3ZA 5DUVA 1QP4A 1JXOA 3RC3A 1ZG3A 5E6HA 3CZCA 1SOAA 3ZKAA 2BFMA 4IH1A 3F9IA 5TJ9A 5F1RA 4B4QA 3PGXA 1KJ9A 2QL5A 3PQ7A 4TL7A 4P1ZA 3FYUB 1KTVA 2ETXA 4EJ6A 1PJAA 4WK6A 3GUZA 5IHPA 3UWDA 2BI4A 2F43A 2CL5A 4XWYA 5AI6A 2ZGLA 2WWYA 1V1RB 5DHTA 4GKBA 2PUTA 5FLYA 4AMGA 3HVKA 1EWTA 1E9BA 4E2WA 4RR3A 4KG7A 5ISMA 3ILXA 3TFQA 3C6XA 3ZFEB 4BVHA 2OZ6A 4XQDA 4BNJA 1FRVA 3TZ6A 2NU7A 3I8XA 5B4NA 1M8KA 1AQNA 4QX7A 3WMRA 3HO8A 5KYWB 3OI7A 1FPN3 4RDCA 3PEVA 4H59A 3C8HA 2Q5IA 3A4IA 3FDXA 1RCUA 4D2IA 3VSAA 2IL1A 2B3TA 3WHKA 3S7TA 1WF6A 3R7BA 4G3YC 1N3BA 3QE4A 1Z6QA 4UASA 1NF3A 4QX0A 1P0FA 2IODA 3I73A 3DLCA 4HGZA 4XOIA 5REQB 4TSFD 1KI7A 5TPZD 3QUQA 1CTQA 3PA6A 4HDKB 2P9YA 2Q49A 2FW6A 1O8BA 2B5WA 1R12A 2FP4B 2N1BA 3ASYA 3AP3A 5J4YA 4DVGA 3VYVA 4G0WA 5BSVA 1XZEA 1GZ3A 5BN1A 3RFXA 3OY7A 2QG9A 3E5MA 3A7EA 4IV3A 1D0SA 3EEYA 3VC3A 1JN2P 5B1EA 2GPBA 2O1EA 3AU8A 2XWJB 1CAXB 4HK4A 2RDQA 1O1YA 4EFMA 5BYBA 1IONA 1NXPA 2LBPA 1CR0A 4BZPA 5JJ5A 1PEDA 5LQRA 4LK7A 3P9ZA 2XZDA 3IWZA 1DKRA 4YMWA 1PNTA 4Q1AA 4KQKA 1RL3A 3C8DA 1LBHA 2UVDA 3EDMA 4EG0A 4LA3A 5D3QA 4DBVO 5AW2A 1OXMA 3QVUA 1Q19A 3MJEA 4LGYA 1ZW1A 3JPWA 3JWHA 1A5TA 1KP9A 2ATXA 4KAFA 1I3CA 1C3LA 2BEUA 1LGYA 1ZIDA 4ZI7F 1ZZCA 5I7HA 2WM2A 3R8FA 1UOBA 3N4MA 3U4IA 3UL2A 4BCCA 3ER9A 4ZYXA 1E1MA 1I3OA 3M70A 2R00C 4R1OA 2AG8A 1LLFA 1EIZA 3HVRA 2JE9A 1ECLA 2Z8ZA 2Y6FA 3MT8A 3CF6R 3ADKA 4RF2A 4X0EA 2FZEA 1CUZA 2QD1A 1E2JA 3BCWA 1VBC2 4RNDB 3AUKA 3KSCA 2DQZA 3KZXA 4YRPA 4YCLA 2WNOA 4K20A 1HORA 3P97A 4Q4HA 3MQFA 4B85A 1ZZEA 2GPYA 3H0OA 1SZBA 5G02A 4HXCA 2FF7A 4FFWA 3ZEAA 3VSBA 4BNZA 1KKLA 2JCXA 4QDZA 4MVYA 5ALJA 5B3JC 3T9AA 3C98A 1XOYA 2R0HA 3TSCA 1AJEA 3PI7A 4IIVA 4RIHA 4BN5A 1NN3A 2OCGA 1P2FA 4OJQA 3GLSA 2NT4A 3UNXA 3POGA 3WOHA 4M49A 4LKSA 3GT3A 3U7IA 4FTSA 1BMFD 4ZI5A 3GJQA 2IS2A 2XB6C 1FSGA 1B43A 4MV3A 4KRGA 3T9FA 2G4IA 1J0XO 3HHPA 5JWOA 4MVTA 2CLIB 1QK5A 1FV3A 3RV4A 1EHIA 1DCMA 1IRXA 3BWXA 3LT4A 1UBEA 3GJAA 3ICOA 2ZEXA 3G2NA 3JQWA 4ZPJA 3UAWA 4DB4A 1EDZA 3VYTB 4D25A 1QAOA 2ZFUA 3LBNA 4LBKA 1GILA 4J75A 3M3HA 3U4QB 2Z3VA 3DDWA 1Q74A 1RAAA 2Q99A 2PLNA 2W00A 2WHPA 3N8DA 4AFCA 1OQAA 4HQRA 1Y9QA 3I6QA 3BFKA 5FH9A 4MJ7A 1AD2A 2ZBEA 3NIBA 3THOA 5C3MA 5FNVF 1GUZA 1C0EA 2A0FA 4FPOB 2PPVA 1SUPA 1JKJB 4HKLA 5CA6A 5JPNB 5D7BA 1UEIA 3OLYA 4U2EA 3RGWS 3W2IA 2WVHA 3K3NA 2HJGA 2GI4A 1M8FA 5JZGA 2X1LA 5IVHA 3WGLA 1G21B 3FNBA 2W93A 4AQ6A 2EWWA 5J4LA 1YRYE 1KJ8A 2GZMA 2XT0A 1XNKA 1D6JA 2FEXA 2VLBA 2Q1YA 1BLZA 3TRKA 4G8DA 1HEYA 4J1XA 4BEWA 3DECA 4OHRA 5G0WA 3PHHA 1XSRA 1GAWA 1RUNA 2FMHA 5F9MA 1DX6A 3N6RA 2MNGA 4I02A 3O1RA 2OHFA 1TMGE 1TADA 2PHDA 3NS7A 4X60A 4MXWB 5K0UC 1Q1BA 2XI4A 3P9IA 1MQ9A 4F5WA 1GA4A 3ED5A 2JDHA 4OAPA 2GJKA 4UUBA 1D4M3 1OVPA 3WG4A 5BV6A 1KL7A 3AMMA 3D59A 3IAUA 1EVYA 4V03A 3WRWA 4XABA 3LUPA 1YUBA 3L4JA 4I1VA 2HV9A 3L1VA 1YQQA 4CU2A 2ZIVB 1DQ6A 2CCKA 5LIRA 1E5RA 3QIVA 4OFBA 2YC4C 5IXYA 5A7SA 4GP7A 2VDPB 4WSOA 2ONCA 1Z15A 1WABA 4F4CA 2O4CA 1QC5B 3TVTA 1PT8A 3PQEA 1YE8A 1SACA 3AVUA 2EJTA 3OGRA 6GPBA 3QNUA 4I5DA 1CZOA 2GZ2A 1D3AA 2FZLA 4AVVA 1VCMA 4E1BA 2KM2A 1Y3BE 1SBQA 4PQEA 4HG2A 1GPJA 3VR5D 2WHYA 2QT9A 1TGYA 3DLHA 3I4LA 2V4ZA 3W6NA 1L1FA 1XA4A 4Y1YA 2CVOA 3L6DA 1JZSA 4DQUA 1DWPA 4GZ6A 2Q0XA 5KQMA 3D0SA 1UFKA 3TTUA 1NVAA 4EJ0A 1SRRA 4A6PA 4RM2A 4BDVB 4N43C 5TEVA 1ACJA 3IAS6 1NI4B 3W34A 4CCYA 2VCEA 1AYM3 3ZDCA 4F11A 1XYOA 3ECQA 4L8FA 2FCAA 4QBGB 3DYIA 1HK7A 2RB4A 1SLCA 2H4XA 4NENA 5I0UA 2W3JA 3TWIA 4S2DA 2DQKA 2R3SA 3VU8A 1P2GA 3L6UA 2ZHKA 1VLLA 2PZJA 3F6YA 4CQMA 5CLGA 3M3CA 3HWJA 4X8HA 1K6IA 4ZZIA 2QX4A 4JMLA 5JDCA 3WNQA 4QB1A 1OX4B 4LRTB 4ZV4A 5IT4A 3Q41A 2GC1A 1GDHA 2TS1A 1E1QD 2HRRA 4NRPA 1NYTA 4GFDA 3D9QX 4TLBA 5I9NA 5E7MA 5KMGB 5AJYA 1LFAA 3JD3A 2PWBA 1PWXA 2TBVA 1LESA 1E89A 2YGMA 3TK1A 2HB6A 4V0LA 5C8DA 2BUKA 4WT7A 5HBAA 4DXHA 2HSDA 4HQOA 1VM6A 2ZZJA 2RDMA 1ICEA 4MV2A 2E0IA 1W35A 3SYLA 4Q7KA 1JAYA 4HFSA 3UJBA 3VD3A 2D93A 5CLIA 5M34A 3QEOA 2GFQA 5JEEA 2WZR3 1EAH2 4UW4A 4WRRA 3N2LA 4Z4IA 2B21A 3TCNA 4I01A 1NMQA 3QEKA 2CE2X 1G2PA 3GLGB 2GCNA 2AZ4A 1V5GA 3NMUF 1YACA 1EXWA 1CAVB 1QHHB 1R4NA 4FQ4A 4F2PA 3HN1A 2J45A 4H55A 2PTMA 2BUCA 1W19A 2X8AA 5C3OA 2HLDA 4YW4A 2G9GA 1A2OA 4NEGA 1DCSA 2ZYAA 1XQWA 1N5MA 4CCSA 1IWBB 3VKWA 3FCEA 4Q03A 4L2IA 4XIIA 2BVVA 2ODBA 2KMLA 2WQ7A 2FKNA 4IE5A 4C3OB 1YOBA 1C4XA 2Y77A 1MEEA 2QG6A 1M6HA 3G0OA 1GZ4A 3ZOIA 4INOA 4HLUA 2QN1A 4W5JA 1XJAA 4BNGA 3PT9A 3OPZA 3HJGA 4TV8A 4PYKA 2VBGA 5KJEA 3HB0A 1AK9A 4R1NA 1SC6A 5EJ2A 5CB6A 4JBWA 1YDGA 1J42A 3MTJA 5ABJC 1S1CA 3OJXA 3DHEA 4HBZA 3WL8A 3OMWA 5B55A 3STWA 5CISA 4R68A 1NT4A 5E2IA 3A58B 1I7QB 4TKLA 2ON6A 1N77A 3JY6A 1VDMA 2K7ZA 5DU2A 3QTBA 2X6TA 2GN1A 3EJWA 2I3ZA 5LA6B 3I9JA 5LP1A 5AR1A 3RQSA 3GOHA 4PAMA 3SYTA 2CXTA 1KSGA 3TOSA 3M6AA 3VZJA 5F7XA 4JVMA 2YJTD 3ZX5A 3NYWA 3D8HA 3ICEA 4G5YA 2VPIA 3HVDA 2GASA 2ZWPA 2ES4A 1ZKDA 1L4LA 4QKDA 3VNAA 1S3FA 3K8YA 3RTAA 4EPTA 3RT1A 3WF3A 3PHBE 4R1SA 1GRVA 1QWOA 3K9WA 4IE0A 3DDUA 2W2LA 5CGQB 1RHRA 2OB2A 4AM8A 1CT9A 3HGQA 1JVSA 4JLWA 1QDCA 1E2FA 2FN4A 5K4HA 1OYYA 2AFIA 3ZY5A 4FVVA 2DFPA 5KSPA 1LI5A 4IOKA 1B00A 1NONA 3FHJA 1LBIA 2IGBA 5KZMB 5DSXA 5D5HA 3K1TA 1JFVA 1UFOA 2O5CA 3IMCA 3V97A 4NCXA 4MHSA 4Z0HO 2QN2A 3A14A 1ZISA 3V2HA 3CMGA 3YASA 2OX0A 2J3IA 1YL7A 1TOAA 3GMTA 4N7BA 5FZOA 3L4EA 1BA2A 2W2KA 1PWYE 4L3VA 3UT0A 3SDZA 3EMKA 1FMD1 4G5GA 5FRAA 1MEOA 4D82A 4NBTA 5HMLA 1ZBDA 3G89A 3KSBC 2HM7A 1FRNA 4MVJE 2P9TA 1ASJ3 2FH5B 1DX9A 1HYQA 1EFAA 2ZGNA 3WDUA 4HGYA 3Q7RA 1WWYA 5KKNB 5IJRA 3O4RA 3F6SA 3ZHOA 1BK0A 5CXXA 1MVLA 1E9VA 5ED0A 1LPSA 1U4SA 5LBEA 2FB9A 3R3HA 2AHRA 1S7CA 3R0QA 1WV0A 5T8KA 4Q3EA 1J5XA 3A1WA 1NQJA 4QX1A 2VDMB 1PQ4A 2J1LA 2WT4A 3EODA 2IYEA 4QUAA 2GJSA 3EGEA 1UAAA 3WGGA 5I7AA 1Z74A 5JAOA 1C8LA 2PRIA 4M0LA 3IH5A 4N6GA 5FP9A 1DLIA 3ZYIB 3ZXFA 1KP2A 3ZPXA 3PQDA 1JOBA 2J1EA 1G5RA 4E6EA 4ERXA 5HA5A 1RLTA 1W9WA 3ZCVA 4LOJA 2O0JA 4QYSA 1QUEA 1AGNA 2RH8A 1Q1ZA 1HDOA 1BWQA 3UHOA 1C2YA 4QFBA 3D8SA 3ECAA 4QTYA 1NVWQ 1FIUA 3OSUA 3ABZA 1VPLA 5G0TA 4FCAA 2WWTA 3QHAA 1YI1A 1O87A 3B7PA 2QP4A 4FMBB 1T6GC 5AVWA 1VLMA 4IUCS 4M4SA 2YZKA 3U3KA 3NNDA 3ZGXA 2I9PA 5E1MA 2XWBF 3WX5A 5HXMA 4LE1A 1WKVA 1GNQA 2VPWA 3EQ6A 4YM0A 1RBZA 3VPCA 1Z4KA 1JXQA 2JG9B 4MB0A 2VZPA 2NU9B 3DYBA 3N2YA 4CKZA 2SCUB 1DKLA 3S1SA 4XACA 1HE4A 3JQEA 5C3SA 3WZ1A 4CDWA 4XDPA 4LUMA 4NZPA 5JSPA 4MI6A 5BPXA 4DPLA 3O1LA 4LVNA 3WAGA 3OT5A 3H19A 1UBMS 4WM7A 5LNK6 4PVCA 3BD7A 3DLTA 3NVDA 2JA1A 1C2TA 4EHIA 4Q1RA 4ZTBA 4ZCIA 3MM4A 1UP4A 2WKWA 5IVVA 4I9UA 5BR4A 4JBYA 1OZFA 4MI1A 4WOJA 2ZWOA 1TME2 4NHMA 2D6FA 1E8DA 2HPHA 2WJ4A 3R0IA 3RG2A 1VHDA 3RYFA 1PJ8A 3LF7A 3KV6A 3VBSB 3FR7A 2HC9A 2C9AA 4RU1A 4QHBA 3K09C 4EHBA 5FO8B 5BOSB 3WLPA 3O8NA 4PBTA 3WY9A 3QI2A 2OCBA 4CM9D 4AJ4A 2BN4A 2VT7A 1MHPA 5CDSA 3NWEA 5EKDA 5FLXA 4GMP0 1A98A 4I5IA 1ABBA 5CYGA 1D8AA 1TF2A 2V5UA 3O4IA 4CQLA 4NCNA 3L0DA 4F56A 4AECA 2ZKIA 3PX2A 4YCAA 3VDDA 4JBNA 4D0LB 4XJUA 1X0VA 1O95C 3F71A 3B5JA 4WLUA 5ES4B 1NBWB 3D4BA 3W8NA 1C28A 1UC5B 2GHTA 4G86A 5I9MA 5K99A 2QU8A 1NUTA 4Y2SA 1X7XB 3EA4A 1OD3A 1OBOA 2I67A 1DGWX 3WV4A 1RINA 2QUBA 2OQVA 1TA0A 3R0ZA 3DVQX 1RC1A 3JSAA 4R9AA 4CR7A 3ZDSA 4MZDA 3U0BA 3K70C 2IXLA 1KDVA 3EIHA 3FDJA 1NLSA 1W2UA 1DG6A 4KQJA 5FI1B 4LFAB 2NMVA 1SG6A 3CUTA 1ZPDA 5BN4B 2J9FB 4YVSA 3THXA 3ZFGB 2JA2A 4HANA 1K4KA 1X8JA 4KQFA 3QLVC 5DDJ2 3C6ZA 3KV1A 4CUGA 3AFKA 1WS6A 1Z73A 1CZLA 4OIFA 1CF4A 4CR8A 4B4PA 5K4LA 3HNPA 4QODA 2O2YA 4MKGA 1O6CA 2O5EA 1M4WA 1OXSC 3MPPG 2Z2YA 3QFSA 1F4AA 5IVBA 3KQPA 1NQTA 3S2SA 3MV01 4A2PA 4BDSA 3H97A 3SX4A 2ORXA 4HXFB 4E32A 3R40A 2Y0PA 4XTCS 3IE1A 4XWAA 1FBTA 3GNEA 3J80A 4WOKA 1IB6A 5ITZB 4QVGA 4DINB 4OGWA 4YP6A 1KJNA 2R4UA 3L9WA 1LHOA 4ZKTB 2XD9A 4U2FA 5JIBA 2AR0A 4PFSA 3MYYA 121PA 2PLAA 2OYRA 1WQ4A 3ZU3A 4FP2A 5JCXA 3WGNA 4FTBA 2VO5A 2C1ZA 4UCWA 1VKZA 3OJCA 2ENRA 4II3A 1XYVA 4J0HA 5FOVA 4UM9B 3R7NA 2YOHA 1UBUS 4XPIA 3PQ2A 5BWLA 4QX5A 2R84A 1NJ8A 3OHMA 2P5UA 5C18A 5FPSA 3ASZA 5BYJA 2HWD1 3IHKA 4SLIA 3AMQA 1RXWA 5CX4A 3NALA 5KWIA 4J4HA 4AEDB 4ZAYA 4UZFA 5JOQA 4W5NA 1OLSA 5FPBA 1KEZA 5I8YA 4M21A 4B44A 1YDMA 2PT9A 1JPVA 2GUGA 2PU7A 4TT3A 1CC1S 4C0AC 5FKBA 4M1YA 3MJFA 4CTNA 1QKKA 1PJZA 5LBBA 3PD7A 2GC0A 2RK6A 1NCQB 2RI0A 1ZA7A 2EFDB 5G1OA 1JSCA 2QBXA 4OSOA 4IJVA 1IE3A 1ZMRA 1HN1A 5H9PA 4Q0SA 1TCUA 5FBWB 1RQ7A 1L1QA 3HYCA 1XRQA 3SQNA 4DLKA 1JDNA 3VKLA 4MKXA 3NW9A 2XLAA 3SC2A 4CEJB 5P21A 4UVGA 2VBFA 5D1IA 5KOJA 1YJ5A 5EKXA 4QAWA 2QLMA 1Z0UA 3I53A 5I6DA 7MHTA 4UXIA 5FBKA 5EE0A 2WKQA 1JJVA 4DDWA 3WP6A 3E2IA 1MEC2 2JFUA 5JTUA 1IOLA 3DF7A 4U2GA 5JWRA 1PR2A 2OM2A 2EX0A 4NEHB 4FGZA 4O4LB 5BQXA 1LODA 1L3BA 3B89A 1V25A 4OG2A 4C5BA 2CGPA 3RR2A 2I6XA 2G5TA 3C2QA 3HDQA 1VBB3 5AJTA 1JZ6A 2Q1WA 3H5TA 1HW5A 2GP3A 4Q24A 1EFRA 2OKXA 3ROUA 4J3JA 1EINA 5C8CC 1PYDA 4IMIB 2QE3A 4GI3A 4AWAA 4YGDA 1RUE3 2VJNA 4WBSA 1YJ8A 5CTAA 3LFTA 1YA4A 5FBVB 1TKBA 1OOPC 3FRJA 3WO0A 2ZLBA 1VHQA 3HL0A 2WAOA 3A9VA 3JQXA 3IV7A 4QHZA 3I9NA 5G3ZA 3OUTA 2BOJA 2Y64A 2O8DB 1GV9A 5BVHB 1Y7TA 3Q9NA 1GNYA 5FPAA 4EQ6A 5JMPA 1ZDMA 1H8TB 2QX7A 2ECFA 4R1TA 3LKJA 1RHJA 1ISJA 4TWTA 3AH8A 4WN9B 2WJ3A 1LJUA 4EEKA 2PU5A 1BTOA 4PLTA 4R01A 1JHDA 1QIDA 4G9SB 3TXXA 2AZDA 4AQ2A 1NP3A 2QD3A 3CEAA 4COZA 5LLTA 2P2ZA 3ZGZA 2VHYA 4MUEA 3UATA 2PHWA 2H5JA 1XMPA 3OFND 3LO5A 3MAAC 2BBAA 3VBRC 5JNWA 2FR8A 3MGBA 1KS2A 1DRJA 4EY4A 3CZMA 3RC2A 3EIQA 13PKA 4JSYA 4P83A 4RPLA 3O9MA 3IAFA 2JH3A 1AUPA 5BNNA 3E5QA 2HPZA 4KMRA 3TG2A 3W2HA 5JZSA 3CUWA 1QFZA 1L5ZA 4QL3A 5CMLA 3QOYA 4B84A 4ILKA 1U0NA 1V5WA 1WB4A 4NYMQ 3E9ZA 2GPWA 3TD9A 3DO6A 2XQGA 3ACBA 1VL5A 2Q46A 1LEHA 4NHKA 3KNZA 4JR0A 3K73O 2XKBA 4OLFA 2DKNA 1Z5NA 4CV1A 2BFCA 4GX5A 2JAUA 3OU7A 3FB4A 4G1CA 1CUGA 3PVOA 2M6LA 1HQCA 1Y1PA 4NCAA 3B2QA 4K1ZA 3SF0A 1ZCFA 4NFHA 5IDQA 3E58A 1PN3A 4RY0A 4QGMA 4YECA 4EI8A 2FFQA 1FFWA 1GZ5A 1SUFA 2VZVA 1JYVA 3AKEA 2ZAIA 2JJ1D 1N6NA 1CEEA 3ZSLA 2QL7A 1HDRA 4JQRA 2EXHA 1DBIA 4A6XA 4Z8YA 1IHPA 3MIIA 2P75A 3H04A 1H93A 2J5KA 2HKXA 1DRWA 4UW6A 3RBZA 4WBNB 1YA8A 4A36A 3II6X 4RK6A 3KAPA 1UMCA 4D8UA 1W46A 2GWHA 1JKFA 5JR2A 4S2GA 1MA3A 4FFNA 1OWOA 3SBEA 2HU2A 1Y34E 5EMMA 3J8F1 3IR5A 1I7NA 3BD9A 4DXAA 4YAGA 4FDTA 5FTLA 2HHJA 3QU2A 3H75A 3OT1A 3NYRA 2XMGA 3JD72 4LJSA 2D43A 1MRZA 5EQDA 4EN8B 1HG1A 5J2UB 3HGTA 1QCZA 4IDEA 3EWIA 3HY3A 5BOSA 1E20A 1FJ2A 4R9DA 3VHOA 2GZAA 3LXMA 2CY0A 3V7FA 1DAEA 4KZKA 1CS4C 1NW6A 1XTUA 1PX3A 2COKA 3WSVA 5A3TA 1QG0A 1UZVA 5IP5A 2A92A 5HCFA 3B5LB 1ZBE3 2EBUA 4CFZA 4BZ4A 1SXQA 3KXDA 4Q7JB 5GKAC 4LKOA 3OSZA 3W05A 2VVFA 5DYYA 1EZ4A 5HMMA 1J9ZA 3VOTA 3O1TA 4GGOA 1RVF1 2C5GA 1AHNA 1J2TA 2LXNA 5TS3A 4W6YA 2EEZA 5JSUA 4BFTA 4A2CA 1Y3AA 1EY2A 3ST7A 2YOFA 1L4FA 2NQTA 3A3YA 2VDWA 2IW3A 4QECA 5F78A 3Q9SA 1H8HA 2WJWA 3DXZA 2ZI9A 2BQPA 3WZ2A 3PUSA 2P1BA 1POQA 2PWPA 2QAIA 1GRNA 4JRLA 2ZRJA 3T5BA 1OZGA 4M4RA 3INRA 4CEYA 3G8BA 4IYRA 1MZPA 4BQPA 3WY6A 2HTFA 4DG9A 3FE5A 1QDOA 2H1RA 2OSVA 1CX1A 2V6JA 4M1ZA 3QPBA 1UDBA 4X20A 1TMKA 1DO0A 1OI7A 2PSHA 4PFQA 1ODJA 1XWFA 3PF9A 2W48A 1W94A 4DLZA 4N0EA 4MPPA 2IZ1A 3ZXSA 3EZLA 3PIJA 4LNUB 1QIHA 2DHDA 3TEJA 4E14A 2OD9A 3NKVA 1VE7A 4AE2A 1BIFA 1W8WA 1KKUA 3O74A 2ZE6A 3DEFA 3TTYA 1T5HX 2Y0EA 4M36A 3RO7A 1SG9A 2FLKA 1WKCA 3QWBA 5A9RA 4OF4A 3MCZA 4HTFB 2RDNA 3EZ2A 4KXVA 1YLLA 1FU4A 3ZGOA 1FFEA 2PSEA 4S3MA 1V37A 4Z7OB 3PHGA 4UFKA 3UJ3X 1AA9A 3HH8A 5L4SA 2O5VA 2JAOA 4IKPA 3TH5A 4CCJA 3QWFA 2REOA 4KXQA 5JCJA 1UKCA 2MR5A 1LCLA 2GNTA 3G8AA 3G0IA 1XCMA 5D3ZA 3RPEA 3PCTA 4DHEA 3IDAA 4Q3AA 4W82A 1I0ZA 2R1VB 5DUUA 4LC9A 5KTKA 3SH5A 3CPHA 4PW0A 2AD5A 3B3FA 4ZQEA 1IEQA 1MQAA 1CIJA 1JHYA 3DB2A 5FY1A 1R092 2C5SA 2L0XA 1F3LA 1COV1 1YULA 1XNJA 3LG2A 1OXBB 4LV5B 4LWOA 1LI7A 3NJ4A 2Q28A 2HFJA 4D9NA 1NJ6A 4DIUA 5BMOA 3SNMA 2F3SA 2J1SA 4QT0A 3EASA 5CVEA 3EGXA 5FULA 5IZCA 2B0CA 1XQXA 2DU8A 2YMZA 3F4KA 5IFPA 3A11A 1TE2A 2IYYA 1Z6PA 2GEVA 1KPIA 1G7SA 4RO0A 3URMA 2Y8KA 1NR7A 5DH9A 2PTGA 2C59A 1IATA 1YDWA 4AVAA 3OT4A 4ZQIA 3H1GA 5ERXA 4QARA 5AP9A 3RMYA 5KHGA 2FCRA 3ORFA 2WU8A 3M81A 5CPFA 5ESWA 3AETA 1XC6A 2BKLA 4OB7A 1TCVA 1ZXXA 3IT3A 2ZX0A 3C14C 2IZZA 4YJFA 5F5AA 3VPHA 1HI9A 2Q5OA 4MV0A 2V45A 4L78A 1P3Y1 4R1MA 4KYVA 2VI5A 1YFYA 1BMV1 2VNJA 1LLDA 3R9XA 4NYMR 4KREA 3MEQA 5CDHA 1U0AA 5A6ZA 1N5KA 4XJZA 1QGAA 1QG6A 1A71A 4B80A 2G19A 2XMSA 4CLRA 3WJ7A 3ZR5A 1DKNA 1SPBS 5CFCA 3O12A 5DAVA 1GICA 4FIDA 5TQ0A 3RJ9A 3I5AA 3BYWA 1TPYA 1VPEA 2F43B 2WM3A 4O1HA 4MKIA 2VSQA 1RM5A 1SEFA 2EIEA 5JIUA 2A0YA 1YJAA 1N47A 4EKEA 4OX9Y 4RR3B 1IN4A 2DKFA 3NXKA 3HCFA 4PO3X 2XRFA 4ZWNA 2KM1A 2NNWB 3PGA1 3NAGA 2C61A 3HV2A 2JB4A 3UXYA 5I8PA 1XL0A 5JYEA 3I5YA 2XUPA 2C1XA 2NU7B 3CLSC 1KI2A 4FFLA 3E6CC 5K8JB 4JC1A 1UH5A 1BCXA 3A6PC 2W95A 1ZN2A 4FMDB 4B6GA 1TJ3A 3F6BX 5FO1A 1QQTA 4HQLA 1IIRA 1XFAA 2AR9A 1KZGB 3BHMA 4BKRA 2ZTUA 3KALA 4ZU5A 4ARSA 3GJRA 2HAEA 4MVJH 2YS6A 3KOXA 1FMJA 1IPSA 2V9CA 3DOHA 4EARA 1Z13A 4R3NA 4NLLA 4RE6A 3HVHA 3CSDA 1NQDA 3OZIA 4Y2RA 2JCYA 4F97A 2VCBA 1MAUA 4FLEA 4ORFA 2ZRAA 3KOOA 4ATFA 5A3OA 1KEUA 1Z6GA 2OWEA 2Z09A 5HBRA 4IV3B 1VBNA 2WEKA 3GCWA 3MQ4A 5B4UA 3M5PA 3RJRA 2Q50A 4YFYA 1U5AA 2R00A 3OOYA 4G9EA 3EIXA 4ZIRA 1J83A 3KYDA 2AQ8A 3DKRA 8LDHA 2XONA 2E9SA 3NBQA 4OJKA 4MAAA 4P92A 4QU5A 3RVNA 3SLKA 1KGSA 2C5HA 5JHGB 4QOFA 3WDSA 2GVZC 3HD8B 3DFIA 4XVQA 3QPCA 1LDEA 3VI4B 4CP9A 4DJEC 1XTVA 2V98A 4Z3DA 3KQ4B 1PR3A 5IJWA 4F8JA 3OA2A 1MB0A 1RXCA 2JHAA 1OOEA 3U48A 5E2BA 2P77A 5L45A 4MVJM 2RBKA 4CG2A 5APAA 3OEHD 3PK0A 2HIHA 2I55A 5MFPA 3CXUA 3T5DA 2J9GA 2Z4SA 1UWVA 1T6ZA 1W8OA 3DFZA 3S1LA 1K3IA 2BEUB 3OICA 2TMKA 2XGMA 3M5DA 5I01A 4XW3A 1T0PA 2XCTB 1NW5A 5I5EA 3K46A 4ER7A 2B6NA 4ESHA 4DLBA 2Z1DA 4JUIA 2QENA 1UIJA 3UGKA 5L3ZA 3DDZX 1ZD8A 5H9WA 2BT4A 3T41A 5ERYA 1G3MA 3WLJA 5C3UA 2FA9A 5IAVA 3PE6A 4PWYA 4XURA 2QFEA 5FY7A 5KC6A 2RE8A 1L6RA 5CHEA 3PZRA 1DJNA 2P8SA 3L5KA 5TQ2A 5T4BA 4RD3A 3T3MB 2FQ1A 1JS1X 2HFKA 4Q4HB 4E88A 1DEKA 5I51A 2IUWA 4F06A 3KT3A 4YP0A 5INTA 1P9OA 1YCIA 4E0BA 1WUHS 4XRGA 5FUWA 3DQPA 2X8KA 3GBWA 4RSHA 1ZBA1 5B58C 4KVZA 1VBA1 3CO2A 3IE0A 3A9SA 1ZCJA 4BWVA 3N7AA 5H9SA 4LKEA 4MMZB 5FP0A 4AKEA 5KSOA 1SD2A 1HRV2 4TZTA 2QZSA 3IKLA 5J4HA 1IM5A 4C1WA 1SAYA 2Y1KA 3PJDA 1TVEA 4ME6A 3TRSB 4DANA 4F3TA 4DARA 4XFKA 5L8VA 5GQSA 5LA2A 1Y6ZA 2WTMA 1WEHA 3D6FA 2RR13 4C0JA 2EZ4A 1YZYA 3U75A 2VZTA 3A0UA 4TRMA 1T29A 1CYDA 3DXYA 4HAVA 2YH2A 5DX0A 2KJQA 3F5QA 1N36B 4DY5A 3PP8A 3ZKYA 1QJY1 2FX3A 1R0LA 1WIWA 4HLNA 3STHA 4EJ2A 4D69A 2D1TA 3BF8A 3GGLA 4H0CA 1CRPA 2WHPB 2PZFA 1NKVA 3QU4A 2YXDA 2Q8QA 1AXZA 5JJBA 5JRDS 5DIZA 1L1RA 2FXIA 3L46A 2DFDA 1YCDA 1I51A 4Z49A 2JIZD 2DETA 1NUKA 5KX5A 4IDHA 3L06A 4BP1A 5GLZA 3MIFA 1JBCA 3M49A 1HJGA 4YW1A 2FQXA 2M6KA 5F2SA 3NKLA 4F9GA 5JZGB 2ZROA 3DO8A 4ASUA 3FHLA 2YC4A 3CS3A 1ZNXA 1Z29A 4N9WA 4ND8A 2V74B 3OEWA 1CJTC 3ZYPA 1D0IA 2W2NA 4IEFB 3Q7TA 3C3DA 5J5CA 2AFIE 4G8JA 4FC7A 1U8CB 2LRHA 5G0UA 1WLCA 2I5PO 3TMKA 1NA1C 4KQXA 4QVIA 4ARZA 1BWSA 2JG8C 1C0IA 1QXRA 2W6PA 3U16A 2IDMA 4JFAA 4UBIA 5JCOC 1L5NA 3AP4A 1M1YA 2II6A 1LUAA 3EIFA 1EE9A 3IL2A 3C87A 3PFHA 2QQGA 5IS2A 5BOVA 2NV2B 2C00A 4PGHA 1QF9A 5HIIA 2X29A 3U61B 1HRI1 3U4GA 4C4TA 1PNFA 2Y33A 3TB4A 1RC6A 4BCDA 3W06A 1DRKA 4HNRA 2MYUA 2KWIA 2V4UA 5A62A 2JHGA 2JGAA 4L74A 4A8PA 2O0LA 4D6XA 1DG9A 1K6XA 3M6IA 4INZA 5BQ3A 1LF5A 1ILWA 1C41A 4D45A 2YNMA 2BOVA 4CMAA 3MILA 3MPOA 4BEVA 3AL6A 2IXBA 2NLRA 1W39A 4WZZA 2G72A 4OQYA 1CUIA 1XZIA 3E9YA 3TZQA 5HDQA 4KTTE 2FPRA 1LOEA 1U81A 1NA5A 1W52X 5DW0A 4Z4CA 4F9EA 1YONA 1MXHA 1GNZA 1AGRA 3PQ5A 4A8JC 4BQ1A 4CCYB 1KORA 3V7UA 2SLIA 4LZWA 5G41A 2WLTA 3P0JA 1E6LA 4R3WA 2B8JA 1HFJA 1N3QA 2KD7A 1F7VA 4ZRDA 2PGJA 3IBTA 4UQOA 1RQPA 3H7IA 4NENB 2EJBA 4FCWA 2EIDA 2PO5A 3I97A 4CQMB 2VJYA 1QXSA 2R8ZA 1F6BA 3MHPA 3HLYA 1NMSA 1E5SA 4EVIA 1LBQA 3OLQA 2FKAA 2V7BA 4ZQGA 5TVKA 2OBXA 3L18A 1YBAA 4OPMA 4GP9A 4FGUA 3N5CA 1CD3G 4AD8A 4CM1A 4R0VA 2BELA 4LJLA 3K4AA 2RBEA 1C7IA 1JQLB 1YI7A 1VDZA 3L7AA 3PQ4A 4Q19A 2QDNA 2X5KO 1EFTA 1Y6FA 3X1MA 1XZFA 3C85A 2YYOA 2L42A 3I8OA 3HZHA 4QQRA 4UREA 4AG4A 1NXTA 4XTMA 3D82A 2Y8EA 4ZHQB 1U7XA 5KDDA 3HRHA 3HACA 4OXYA 4Y9SA 1GP4A 2JAXA 3T0AA 4MR8A 4BFYA 1F6WA 5CPBA 3U07A 1R4NB 4O1IA 4MOWA 3QKRA 5BQPA 1SG0A 2X22A 4P4UA 4YRKA 3BIWA 1K1EA 3I0NA 1X15A 4KHPB 3G2HA 1XPJA 2Y76A 4DKJA 2GNDA 1K0UA 2X3FA 5F5XA 3I28A 1QU3A 4MLPA 3LV8A 3X1KA 1Q7GA 4L2IB 4ABYA 1QFXA 5EPAA 5FO7B 1DU4A 3SS7X 5CVVA 1FATA 4FPYA 2YB7A 3M3EA 1WW2A 1JUIA 4GU5A 4XGKA 4CLEA 5BWOA 3B85A 2C4NA 4CIWA 1W93A 4OL0A 3WLTA 4KQHA 4YGBA 4TV8B 4JOBA 2VJCA 4XJTA 2P67A 4G8CA 4DSOA 1C3HA