2WAOA

Structure of a family two carbohydrate esterase from clostridium thermocellum in complex with cellohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
GILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDSITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE E
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2waoA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2waoA02
1BHGA 4D0QA 3W7VA 1NKGA 4PQQA 5JXJA 4CU7A 3THCA 2ORZA 3ABZA 4QB6A 2Y6GA 2W1QA 4AAXA 1IVNA 4W8JA 2C9KA 1K42A 3HP4A 3RJTA 4LKSA 3WNLA 1FXWF 4QPWA 1EUTA 5EIYB 2J1AA 1KEXA 2W87A 4P5YA 1GMMA 2DCJA 4W50A 4XUOA 4E8CA 3LE0A 2RVAA 2YB7A 4M4RA 4XURA 1UY2A 2Y6HA 1D7PM 3HEIA 3HPNA 3MUY1 4JHLA 1PMJX 1F4AA 3DECA 3DYMA 2WAAA 1PX4A 2YFZA 4TTGA 2VZQA 4UOJA 5CZKA 2Q0QA 4I8IA 2VCCA 2VCAA 2ZEXA 3W5MA 2HSJA 2VMFA 1JZ2A 1UMHA 1BWQA 4A44A 1FXWA 2RJ2A 1UXXX 4QB1A 3LEIA 3FHAA 5IJRA 1XPWA 2E31A 2C4XA 1DEXA 1F4HA 3GXUA 3VDCA 3THDA 3LEKA 1TG7A 3GM8A 4XUTA 4E8DA 2VQTA 2WO2A 2J1VA 5LA2A 1JYXA 2JD9A 3IB3A 3U37A 4RN5A 1BWPA 4OAOA 4RSHA 3GGLA 3VDBA 1JZ5A 5LA1A 2WN3A 2VZPA 1SG3A 3LQCA 1JYNA 4K3UA 3OGSA 1NUKA 1W99A 5JD3A 2Y6KA 4KMQA 1PX3A 3VD3A 2Y6JA 4XUQA 4BK5A 2EIEA 4DEQA 1OH4A 2VMEA 2W46A 4OUEA 1PP4A 4K7JA 3DYOA 2ZEZA 4A41A 1PMHX 2QQIA 2Z4FA 4Q9AA 3C1UA 1WKYA 3HNBM 2J22A 1OT5A 4XUPA 4BDVB 2JKXA 3BN6A 5DN2A 5J1XA 5C70A 1CZVA 3ACIA 2QQOA 3I3DA 4MGQA 3T2OA 3VD7A 4YPJA 1ZMBA 4MADA 2BBAA 4CUAA 1BWRA 4JJ6A 1J83A 1UYYA 3ECQA 2Q0SA 5JXGA 5DMYA 2ORXA 3C7HA 2XOMA 2B4KA 3DYPA 3T09A 1J84A 2VZOA 3ZM8A 3UESA 3T08A 5A1AA 2W95A 4GWJA 4OAPA 4JGGA 2HLEA 1JZ6A 4W4ZA 3C7EA 2WAOA 3I97A 2EICA 1VYHA 2OKXA 4OYUA 3J7HA 1OF3A 2VZRA 5C71A 5LA0A 3DCIA 4PT6A 2JDAA 4BJ0A 2J1RA 2X05A 3CMGA 2W1UA 3FHQA 2W91A 3CKHA 2RV9A 2WYSA 4DXRA 2E33A 4A6OA 4QB2A 2QQLA 4GWIA 3MUZ1 1K12A 1KGYA 3WNNA 1DLCA 2LW8A 3I3EA 5JXHA 4XZUG 1ESDA 3F2ZA 2LS6A 3I2KA 4OMDA 1CX1A 3A7QA 4RW0A 3SEEA 2J1UA 1K3IA 3T0DA 4JKOA 5C7GA 3VDAA 5JXIA 5B4XA 3WNMA 1UX7A 3OGRA 2ID4A 1O59A 1UY3A 2ZEWA 3LPGA 1W9WA 1DEOA 3CIHA 3I3BA 3P6BA 3PUHA 3CZUA 1VJGA 5JUVA 3K4DA 3PUIA 3I2FA 3IAPA 1I5PA 2W5FA 4D8MA 3P94A 1JU4A 2E26A 2VZSA 3A21A 1XC6A 1US3A 3ACGA 3T2PA 2QBXA 4LPLA 2PQSA 3WNKA 2V4VA 2Y8KA 1K45A 3A22A 1GOGA 4M4PA 1YQ2A 4MO3M 3WSOA 3I2HA 2QQJA 5EJ1B 2XHNA 4L0PA 3IIIA 1GU3A 5B5SA 1DP0A 5HOEA 4HYQA 2WQ8A 2XQXA 1ESCA 2WDBA 2VZUA 3NNGA 1YZFA 4A4AA 1J00A 2X09A 2DDUA 2WBKA 2VC9A 4KWUA 3P1IA 4CU8A 3SKJE 2DCKA 2VQUA 5IYYA 2W9XA 2WN2A 5FUIA 3WF2A 2VZTA 3WF0A 3WNOA 4Z2AA 4BXSV 1U8UA 2BGOA 3EB7A 5I0DA 4CVUA 3MILA 4QX1A 4A3ZA 5JR2A 2CDOA 3KVNA 2EIDA 3K75B 5HPOA 5A4AA 1T2XA 1ULOA 4P08A 4IUGA 2VPTA 2VTFA 2J7MA 3ETPA 1JYWA 1W8NA 3T0AA 3UNPA 1W9TA 2W1WA 3I2IA 2QQNA 3VD9A 1UY0A 1V2GA 4P00B 1JZ3A 3MV01 1ESEA 5BN1A 4TX1A 4HF7A 1EUUA 1JYVA 2BZDA 2YFUA 5G05L 3E1F1 5B4NA 1CIYA 3T2QA 3HOBA 3OBAA 3OEAA 4LQRA 5CYYA 3NQHA 1W0NA 2VOTA 1ULPA 1ES9A 4QDRA 5EJZB 2W92A 3BGAA 3NRUA 4DUVA 2WZ8A 1R64A 4ZXEA 1K7CA 4UI9L 1DYOA 3DT9A 5LCWL 2EIBA 2VZ3A 2Y6LA 3VD4A 2X10A 4P02B 2QQMA 1JZ8A 4PF1A 4JKLA 1UMIA 4XVHA 3ACHA 2J1EA 4CU6A 2APJA 3LPFA 3WF1A 1O8SA 1GNYA 3HJRA 2VO5A 1NX9A 3W5NA 3PT5A 1US2A 4MGSA 2VJXA 4OMCA 2WABA 1O8PA 2V72A 2WUHA 4GZ9A 4NRDA 3C7FA 5IFTA 2W3JA 3LEGA 1TVGA 3AC0A 4UAPA 1IQDC 4JHZA 1H6XA 1JHJA 4QX2A 2VZ1A 5DQ0A 3CZJA 2VCBA 3C8XA 1LNSA 3ACFA 3K4ZA 4DUXA 2J1TA 2VZVA 1H6YA 4BK4A 1GQPA 5F7UA 1UY4A 4A42A 1P8JA 4M8KA 3HNYM 4A45A 3NJVA 4QX3A 3VD5A 2R7EB 3EYPA 1UY1A 3MO4A 2B9VA 1UZ0A 2VR4A 4QDSA 3OG2A 1WCQA 3SLRA 1SHWB 1JZ7A 4CUBA 1JU3A 3T0BA 3UETA 2VM9A 1WABA 3SEPA 5CD9A 1XNAA 1GOFA 3K46A 4IYJA 4DEVA 4CU9A 4DXSA 3WF3A 4MOAA 3WQBA 4JX0A 1HN1A 3WEZA 4ARYA 2V5DA 4TXWA 1XNTA 4K40A 1W9SA 2ZEYA 3DT8A 2VL4A 4KI5M 1GOHA 4XUNA 2XONA 3MV11 1L7QA 2W47A 4OZOA 1GUIA 2E32A 3K4AA 1UYXA 4JJ4A 1MPXA 3C7OA 2O14A 2YG0A 2ZXQA 3OB8A 3FL7A 3A23A 1SDDB 3MBWA 4ARXA 4Q7QA 2CDPA 4JKKA 4PPYA 4AG4A 4HG6B 4DUWA 1UXZA 4QDQA 4S1PA 3WF4A 2C26A 4QX0A 3I2JA 3NJXA 3C7GA 2WO1A 3BZWA 2J1SA 2YC2A 5DPNA 1OD3A 1UYZA 2W94A 2YC4A 2HYXA 2QQKA 2KD7A 3I2GA 5IFPA 4ZZ5A 1Z8HA 2WZEA 1OF4A 1L7RA 2BGPA 2WO3A 1UWWA 4FI9A 4JKMA 2VMCA 3K77A 4ZY9A 4H08A 1W8OA 2VMDA 3GDBA 3IAQA 4LHSA 2BERA 3WNPA 5HXMA 3DC7A 3D3AA 3IDAA 1JRLA 3DT6A 5G04L 4DXTA 1CZSA 5JMOA 1JZ4A 3OEBA 1RYYA 1NAEA 3SKVA 4RYDA 4K9SA 4QAWA 1JI6A 3CDZB 4CUCA 3FN9A 1CZTA 2W1SA 2Y64A 2L9LA 3OGVA 3HN3A 4ZZ8A 3HNMA 3CQOA 4ET7A 3JXSA 5IHRA 2JE8A
chains in the Genus database with same CATH superfamily
3GZ4A 3IOCA 3BFXA 3RGWS 3EQEA 3ZJUA 5K8LA 1VGVA 2FX3A 3AKYA 1ILEA 2BBTA 2YB7A 3SH4A 5AK0A 2WQ7A 3QI7A 2WFF3 1UT8A 1ZVMA 2WYWA 2K6GA 3W5UA 1LAJA 2HXYA 5K9ZA 4BO6A 5LXTB 4P5HA 4AJKA 4B2IA 2PUCA 3B52X 3PHIA 1UW8A 1PL8A 2P0AA 1LTEA 2PV0A 2E55A 4IQGA 1DJPA 3MHTA 3M5CA 3GM8A 3VR3A 2XAUA 3OQ6A 4S1OA 5AW2A 2WPNA 1ML4A 4BNDB 4QGHA 5DBIA 3IUBA 1C9KA 2VQDA 3GOQA 3TTSA 4QOFA 1H2HA 1H6AA 4RM2A 2KLBA 1USIA 4MITA 5JDCC 5JXWA 2DHRA 1NRWA 4BZWA 4F46A 2ZEZA 4ZVTA 1ZD5A 1XAHA 4NHLA 4WM8C 1I14A 2OUIA 4B44A 4ZZIA 4F1WA 1GV0A 2O0HA 2VHTA 2WHPA 2VHYA 3R9IA 4E5PA 1JQLB 1CB7A 1SOMA 1Q1QA 5C70A 4F5ZA 3L7YA 2NZUG 1WPQA 1CY2A 4Y1XA 3BYZA 4H1UA 2I87A 1QAQA 4HRAA 3J81A 1SCDA 3AP1A 1VG8A 3GA5A 3PNBA 5H7XA 5A4IS 3EVEA 2G9ZA 1VBKA 2W95A 4UAVA 4M49A 1H6BA 1TC1A 5FYBA 4CCDA 3LZDA 3AB3A 4JGYB 4HXEB 4JJGA 1ONNA 1NSFA 1RQNA 1Z45A 2JKBA 3EF1A 3RQSA 2QZZA 2M6SA 4EYQA 4MR9A 2XUFA 3EVBA 2VP5A 1E9CA 1F3LA 3ORQA 4DLVA 3F6CA 1J5EB 4C0XA 1NLMA 1VBA1 4AUEA 4E2WA 1WLCA 2GMPA 4PAOA 1HUQA 2NSHA 3CM0A 3T5BA 3O1OA 3HFRA 1GYQA 4NNOA 2X9VA 3IT3A 3NLLA 3NTUA 1XNBA 1GAWA 3N5CA 4ZAFA 3P9IA 1T91A 2VUAA 3U7QA 2IX3A 4C5CA 5DMXA 3BUCA 4D9EA 5C8CC 1V0JA 1DHTA 1ZYUA 3I5MA 1DQ4A 3M6MD 3NGXA 1VLVA 2OV4A 3RAFC 4CL8A 3OHPA 5AVTA 4GI5A 4LZPA 3LXXA 1EHIA 3SQOA 4FYYA 4M0UA 3ENQA 4QQPA 4IUCS 1M1YA 2FWBA 2KM1A 4RXMA 5F6KA 3WYFA 1P33A 5AI8A 4BO9A 1EXVA 3EDQA 1YZNA 1P7CA 3OZBA 4D9CA 1DEHA 4F3JA 4N9WA 5BSMA 4ISQA 2DCZA 1QJZA 1RAIA 1XXHB 1QOZA 2IYXA 3OD5A 2YVAA 5ER6A 4Z07A 3NHSA 3ORFA 4E0BA 4D3DA 1G7CA 4BUCA 2A1UA 3NUQA 1V48A 1WZUA 1H0KA 2Q8PA 3DULA 1OSNA 2JARA 3T1QA 4AZ0B 4F7WA 2QMHA 1OBOA 1U5ZA 2RKWA 4TXMA 5AXCA 1MIOA 2JDKA 4MQEB 2XTZA 2XWQA 1O5LA 3IA7A 3OE4A 3IGFA 2ZG6A 5KTYA 3EA5A 2NZWA 1Q0SA 4C06A 6GPBA 1G291 1Y3FE 3DOCA 4RFT0 2HUPA 5DCYA 1MAWA 4HSEA 5G3ZA 1RJEA 3ZXSA 1ZK0A 5DHAA 3W7AA 1J2EA 1NBAA 4W5NA 2B3TA 2AGVA 4JV5B 3A06A 4YR7A 3CKYA 1CZHA 3VD5A 2JJ2A 3AHEA 5CD1A 4LO7A 2YU1A 1HKUA 5CJJA 1W8UA 3QA3E 1SHWB 4RGAA 4IDPA 4NX2A 4R2HA 1AUVA 1EV11 4FXOA 3BE5A 1NUPA 4ZEMA 4V0ME 4HNUA 4Q0SA 1OIVA 2HBTA 4JCKA 5ARBA 1N8KA 2IITA 4BX0A 2ZPTX 1EB8A 1CY6A 3N9MA 5FPSA 3ZC3A 1PO23 2UYOA 4DCUA 4WZZA 2PZKA 1H3FA 4WESB 1X1TA 3EQ8A 2EJVA 1Z4QA 2Q4SA 3O4GA 3JPYA 4EB0A 1TJ4A 4YRSA 2WNEA 2ZR9A 2E4XA 5FR3A 4DSZA 4H08A 1T9ZA 1NWCA 3RANA 4ZTUB 2FP4A 4JJIA 1TE2A 4CLXA 1BC5A 2VNKA 5DKFA 3RDIA 1TIPA 4TZTA 2F2TA 4K3VA 3A4LA 1ZC3A 2Y0PA 4RC9A 5IVIA 2VAXA 2XH6A 1UBFA 1GKUB 1GJRA 4OVKA 4PSDA 4AKSA 4V1CB 3KKNA 3GDHA 3LHSA 2ZVQX 5J4LA 4CU7A 1RVDA 2V4UA 2XZTA 2GH8A 4PG4A 4NCAA 3RVLA 5JCOC 4JSTA 3AM2A 4E8CA 1P45A 4V3CA 4CMCA 4OLJA 1URXA 2NUPB 5C8VA 1YS6A 1U6IA 2G9VA 3S3TA 2VCAA 4B1FA 3KPUA 3DF9A 4XFFA 5KR7A 1R9MA 3H7IA 4RX1A 3HBKA 2E7ZA 3AR6A 2C54A 4R98A 2C4VA 2AFRA 3HCAA 4KWIA 2QQ0A 3NASA 4EF4A 3OGSA 4GICA 3GRUA 4IV1B 4F83A 1H2LA 3FBWA 1QXPA 2JZNA 3LY7A 1JXNA 4I99A 2PX2A 2R3SA 3WDWA 3T4VA 4CEHA 2COUA 1SO8A 1M7BA 1W0JD 2P9HA 4Z9FA 4GR5A 4GMP3 2QOEA 4BEVA 1ZKMA 3HJAA 4IW3A 4XE9A 1MC4A 2QBYA 5G4KB 4HFSA 2DVFA 4CF3A 2XE7A 1E0KA 3D8UA 2AH5A 2J48A 3J7HA 1W2WB 4ZZ2A 3NM4A 1ZONA 1XVUA 2NP6A 4L8WB 1IRXA 2M6RA 3KQMA 3CX8A 3I01M 4TYMA 4AJNA 1ICIA 1CJSA 3OA2A 4AURA 1DBRA 3E9DA 3VYVA 3T5DA 4XDQA 1F0NA 4D9BA 1FJXA 5JFOA 1DO0A 3B3GA 4X5OA 2WU1A 2JHFA 4ZVSA 4N8EA 3UBTA 4NARA 4QXHA 4EZEA 2XGGA 1TPYA 4INZA 3JXEA 1O4WA 1JR3A 3L5OA 3JSXA 5DGCA 2VWQA 3QE4A 2WOOA 4MPDA 1VZ2A 2ANCA 3OIWA 1I7PA 3ND7A 3OCUA 4BO3A 5LN1A 3TCKA 3K09A 5K09A 4KUGA 1BEUB 2GO7A 1PLKA 4LJYA 3HRIA 1BX1A 4KSCA 1C50A 2GSDA 1FU7A 2A3RA 3UJCA 3N6XA 4XEHA 4MZUA 2YJ3A 3BMCA 4G97A 5EWLA 2AZ5A 3GH3A 5FKBA 1GNHA 1O5TA 2DQ4A 3I23A 1XQYA 3V1LA 2Q3JA 4CTOA 3I2IA 1PRYA 3ZIUA 4JBGA 3U56A 1OOPC 3O3CA 2WZQA 1D1SA 3RF7A 3LG2A 2P2ZA 2QW1A 3BUSA 2XGMA 3CWCA 3C8UA 4OJMX 3ILHA 1EGAA 1Z0ZA 2WZ8A 4ZXEA 3AEUA 1SBQA 3RBZA 4B3BA 1KH3A 3JD1A 3WKDA 3S2IA 3RGBA 1G9BA 1CNMA 4ENRA 2GI4A 3T5CA 1BCSB 4M55A 1JAHA 4DXHA 2DOKA 4MW2A 2AKEA 4O2BA 5FTNA 5EE0A 2XVXA 2JRCA 3RFVA 10MHA 2O8EB 2WUHA 2XNJA 2CYCA 2XVKA 3RC1A 4KOEC 2IUYA 3F7NA 2FX5A 3V1YA 1GD1O 2RGRA 2WJGA 2D5CA 2G9RA 2ZI6A 4XD2A 4DMHA 4XAQA 3GJSA 1IOWA 2D0PB 1SCNE 3EMKA 4IHJA 4QHTA 3WIDA 2RGUA 3U9TA 3U4QA 1QQAA 3E8XA 4EUKA 7GPBA 4X63A 3BOWA 3X2EA 3JASB 4MV8A 1Q5OA 2PX6A 4ZDWA 4X92A 2AFVA 4EUNA 3WRVA 2E7QA 4N7MA 4LO8A 2D6PA 5EGNA 1Q0TA 2IW1A 5M3BA 3ZWVA 3COJA 5DOVA 1JLRA 2N3ZA 2HDNB 1XZPA 1NQVA 1UAYA 1QZ3A 1ABEA 4C2UA 1XMOB 4IQ8A 2CBXA 4K6OA 2QTGA 4M37A 3ICVA 4M9RA 4RSRA 1L4MA 2LUWA 3OH8A 5KCMA 1QS0A 1ECLA 1QGUB 4ND6A 2HWXA 2RG4A 1KJNA 1CW2B 2QQKA 2VJLA 1LHWA 4UTZA 3MLBA 3TLJA 4E5SA 3HDVA 3KTOA 4MQBA 3IMMA 1G8PA 2Y4NA 1B2RA 1ZWKA 4ILKA 4LKRA 4RYDA 4TSVA 1CQPA 2JIGA 3A6ZA 3JZMA 3H2YA 4HI0E 3LT4A 3VFDA 4RVCA 1SCRA 3HU3A 4MI1A 3H4VA 4AJIA 1FUUA 4P36A 2CBGA 4HSGA 2Y6GA 3V5NA 4Q7JB 1JH5A 5J2TF 2XUAA 3BB3A 1DYPA 1TADA 3GZAA 5A2QA 3LO8A 5C7YA 2QYTA 1QRTA 4CCSA 4R2KA 5FMCA 1AF9A 3P2MA 3E5HA 4COUA 5A1LA 1LBIA 2C88A 3QFRA 3FE5A 1PUJA 4BX2A 3DYBA 3DBRB 3RFUA 4FN4A 2CNNA 1J3QA 3IB3A 1FS6A 4FFWA 1UCFA 4OAOA 1ACJA 5M0TA 4MKIA 3V6LA 2XTNA 1FIUA 3V8PA 2I2AA 4XUCA 1MBZA 2FZEA 4JH0A 1US8B 2V5VA 2JGKA 2H48A 5CW2A 1N5JA 3A2KA 2VTBB 5EHDA 2PBFA 1GAQA 4KMOA 3LIPA 2GYUA 1TZBA 1SK8A 4X3OA 5M5BA 3VO1A 4Z1MD 4TT3A 2R042 4AZVA 4C29A 2VZOA 1X1DA 1HRV2 1INLA 3W20A 2R96A 2BELA 5FZDA 1LOAA 4CKEB 1RFGE 1XZNA 1YRWA 3W9BA 4NAOA 4DCVA 2ZE8A 4DLTA 3USCS 1XVLA 1G8KA 2QVSB 3N87A 3CO2A 3VU8A 4D8WA 2XNSA 3ADBA 1K5MB 5TQ2A 1PWYE 4CMBA 5GJWC 5EYPA 1O94A 3ESRA 1U0JA 1JSZA 2VZEA 5FTMA 2YZNA 1GP2A 4OFXA 3LCJA 3TBHA 4B73A 1G60A 4RTNA 4QM6A 3I2KA 4HQRA 3WAJA 1K3IA 2IH4A 2WA4A 4OA5A 4MVYA 2ZZQA 3RTGA 1FTSA 1OTHA 3MMSA 5HWSA 1YYNA 4YRAA 1MV8A 2OHHA 2B7YA 5CVRA 4HN4B 1XRRA 5AW0A 4C22A 3EF3A 4RPIA 5BY2A 5CPFA 3LRPA 4R5HA 2R87A 1ODIA 4TVBA 1GAJA 5JH7B 1OFSA 4C6RA 1DAEA 3ZKYA 4GBED 5G40A 2KBEA 3INGA 3B1ZA 4PEVA 4L4YA 4FP2A 3HQ4O 1YZUA 2NPFA 2EQ5A 2Q7XA 3WF2A 3JWIA 1IHXA 2QHXA 5LA6B 2KPOA 2JA2A 3GT4A 3PTRB 4KLCA 5HCBA 1DDLA 5DBFA 2OT3B 4JJFA 4UBLA 4X6XA 2P41A 4I46A 5B4NA 1CAUA 2KM2A 2JCGA 1G4UR 2GXUA 3HN1A 3RVJA 2A9QA 2IIBA 2NACA 1UDCA 2XD4A 5JBIA 3K9WA 2D59A 3R75A 4TMXA 1A2BA 4EWLA 3LIHA 1CP2A 5A02A 3W5SA 2F9LA 3RK0A 1GQOA 3QU2A 5AVAA 3MMXA 3VOTA 1HORA 1JJAA 4B74A 2DHQA 4IQ0A 5IM4A 3K70B 1VR3A 3UPDA 3I9V6 4ZQHA 1R8QA 4FHEA 4XIGS 1IGOA 5T5PA 3NNLA 1O96B 3OEEA 4Y9DA 8ABPA 5A3JA 4BECA 4TSKA 2DE0X 3A4TA 3SLRA 3QTBA 4UNPA 2VW2A 2GCOA 2CXSA 1W2GA 4YRBA 1RI4A 1GZUA 4WGFA 2YVQA 1BJQA 3TNJA 4PN3A 2V5DA 1GPMA 3BB1A 2K2QB 2PFKA 2WJHA 3GJ3A 4N49A 4IHQA 3LT2A 2E32A 5JW6A 2O14A 1VSQA 5DW0A 4DMGA 2G7ZA 1AUOA 1YA8A 2W68A 3GLGB 1EUZA 1KEUA 1QG4A 2VT2A 4M9ZA 4LGMA 3ZDSA 1JZTA 2VFAA 1O94C 3RK1A 3ZNNA 2PTGA 2JJ1D 2I3GA 4M0KA 4CP2A 5DBGA 3HH8A 3TEWA 4DWJA 1SJ9A 1EIZA 1JR2A 1NQJA 1KAEA 4OJNA 4WI1A 3K16A 1ESNA 5AVZA 4QASA 2Q1FA 1QQP2 3AF6A 4DBLC 3E9CA 2J7KA 1DV1A 5E7JA 1AHPA 5IJ9A 4B3NA 1E58A 4IHJF 4P22A 2GZDA 5T50A 2CNWA 2BFDB 3DB1A 1P60A 4MLOA 2V9ZA 1YE8A 4D6SA 5CT9A 2GCNA 1TKCA 4TKUA 1ZRIA 4HDSA 4JHLA 4RKEA 2BKXA 3CR7A 1UC8A 4AWDA 2JI7A 3MQ4A 5SY4A 4PYIA 3K9FC 3TDMA 1QYDA 2IEYA 3DDSA 4AI3A 3SCGA 1ND5A 2VAVA 4KYUA 2DPXA 3ZN4A 4DUGA 1TG7A 2Q1YA 2GU9A 5DZFA 1KZGB 1G0OA 4GX2A 3WL7A 3WYBA 1C3XA 1SA0A 5BYNA 4RVFA 3QU5A 5BWLA 3WMFA 1POV1 5JC8A 3FWKA 2PXJA 3VD3A 5ISLA 3PTLA 1S2NA 3L0DA 5FZLA 3OCCA 4ZVRA 4DNXA 3ZLBA 1VCIA 5EZ6B 5C46F 3K70C 5B58C 4E88A 2PUDA 1NA1B 2OGTA 2JDIA 4XVRA 1PQ4A 4CQMA 3V7NA 2CHVA 3L3BA 4YX9A 3RSLA 3ZZUA 5K5EA 1RLUA 1KO8A 1Y3CE 2BMFA 4QQRA 1OOEA 2W6PA 2ZRKA 1KU0A 2I6XA 2DBVO 4MP3A 3OU2A 1O5UA 5EUCA 2P9EA 2VAPA 3OPQA 2JEYA 1FUEA 1V8BA 2ZFUA 3C6ZA 1RUG3 3SU8A 3NWOA 1NE2A 4JTOA 1IHYA 5GLUA 5CR9A 4RW0A 5JWRA 1O59A 2ZGMA 3PQFA 2WLSA 3BIJA 1FPN3 2AFIE 1N1YA 1Q1NA 3O1SA 3NM6B 3TUZC 1VJDA 3RW9A 2VPIA 2PQSA 4HLQB 4MWBA 3LF7A 4RKWA 1ZMTA 2F4VB 4BVFA 1MB9A 1YCIA 5JE8A 3NEJA 4G8JA 1ECJA 4XVUA 2B9UA 2ZYDA 3MTEA 1QDCA 3P9ZA 3R40A 5K0TA 1KQOA 1YZVA 2O2ZA 3W05A 1UMDA 2I2XB 1RAFA 2IPOA 4HGRA 1R1A1 4Q1DA 1P72A 4JNCA 4BFCA 3QZUA 2JLXA 3O1VA 3O73A 4CF4A 1OFIA 1QHIA 5JI9A 2OG2A 1J5XA 2ZDGA 1AL0G 2C2HA 5G4LA 3HFGA 3RYRA 1MVQA 4I9FA 3GALA 3RC9A 2X8LA 1J1TA 4RO0A 1O95A 1ZRRA 4ZDJA 2C94A 1ALYA 3OEAA 4LQRA 4G4FA 4MUFA 3R76A 1OLXA 4KWCA 1VGRA 4MVJF 2AQIA 3PDQA 4G36A 1XRPA 4CHGA 2ZXEA 1PIV1 4HVRA 5KWSA 3MPBA 1YFKA 5IK5A 3EUAA 3PDWA 4EM6A 1G8WA 3WGQA 4YRDA 1Z75A 3IBSA 3NAPA 1TTQB 5T4EA 4YALA 5SZKB 2W8BA 3VZPA 1ZY2A 1RLMA 4B31A 2YNMA 3GEIA 2XHEA 4YMIA 4FP9A 2PA0A 1H6XA 2ZK7A 4NBNA 1XEWY 5GLVA 3ACFA 3K4ZA 2B20A 3BWVA 1U5BA 2ORVA 1EA5A 4I50A 2YXBA 1XAGA 3VL9A 3JQAB 4ZT3A 4DV7B 1VRCA 2YL2A 1E2UA 3IKMB 2TEPA 3W7BA 2IHYA 2XBUA 4EO4A 1F2VA 3NB0A 1W47A 1P6XA 2VTEA 2HNBA 2CDAA 3C74A 5MGNA 1F15A 3B8EA 2ZJ8A 2JCXA 4XB6B 2B6HA 3EWIA 4OGFA 4FT4A 4DBZA 4QQKA 1BEEA 2G5GX 4BE7B 1Z0DA 2A7XA 3DL0A 2BHNA 4C7OB 1XDSA 3KB6A 1XDBA 3B1VA 1Q6YA 1A7UA 2ZI7A 4C2AA 4QDQA 5DMHA 3HGMA 2VUTA 1M5UA 1EAMA 1UFKA 1SUIA 3GYBA 5GZCA 4C9BA 2LCQA 3W2EA 5TJ9A 4KR7A 1ZBE3 3GEDA 3TFOA 2CYBA 4BVKA 2QLMA 3GUCA 4PO8A 1W34A 4IYRA 1P4JA 4X9XA 5IJXA 1X7NA 1WZCA 1X7WB 4IILA 2I45A 1BMDA 2ZSHA 1GKKA 2VMDA 3I6IA 1KWGA 1BXRB 2VULA 3C14C 2CSUA 3LDFA 4FGJA 1X9GA 5F2WA 4LUMA 1JZ4A 2WG1A 3K8YA 2ZS6B 2UYQA 3HIFA 1KEZA 4CUCA 2OC4A 1RKQA 3QI2A 3GCZA 2P9CA 4BRZA 3PNOA 4U36A 5L4SA 4N6GA 4ET7A 3N3AC 1PG5A 3U16A 3FWZA 2DT5A 4QB6A 1VI6A 1VRH1 4WNYA 4MH0R 4JC8A 1UIJA 2VPYA 2OV1A 2P2YA 2XUOA 3RH0A 4YCLA 4TQGA 5FZOA 4KFCA 2PU5A 2JDYA 3W6NA 2O0MA 2VDOB 4MS3B 1G6NA 2CVPA 4F4CA 2P34A 4IE0A 3NDJA 4BEWA 1Y1KE 4KFUA 1RCTE 1OA3A 2FRVA 3W78A 4DREA 1WMAA 1DE0A 1AK2A 4NKRA 4ND2A 4NABA 2IUUA 3L82B 1ZM1A 1HDIA 3C6MA 1PDOA 2PLV2 4AP5A 4GWMA 2XEXA 2AXPA 2XLFA 4Q5IA 4JL6A 1T9DA 3T5GA 4Q26A 4ZPIA 2FU5C 4BISA 1GR0A 2QEQA 3MMZA 1RUF1 2GMEA 3DBLA 4C0KA 3KQVA 3UTDA 4NZOA 4QG3A 3U78A 1D07A 4Q4Y3 1ASJ3 1MHTA 5FX2A 3HCDA 4I4TA 1BWRA 1N0WA 1W36D 5T4BA 5FY4A 1WCYA 3DV2A 2IHVA 5FYVA 2WAOA 1L5YA 3OOEA 2AE1A 5BN4A 8ATCA 1W8IA 3DP9A 5D3ZA 5SYMA 3RK4A 5LQKA 3LVQE 4NDZA 4JFAA 4I50F 3RM3A 1F06A 1CUSA 3MUZ1 1WMXA 3QOPA 1DRWA 3UMCA 3EGDB 2J46A 2C8KA 1QP0A 1KJYA 3MAJA 2AQ8A 1HQCA 3EW9A 3FPSA 1G5PA 4GVPA 1UD1A 4UW4A 2G7MC 1SFRA 3FLTA 1U2PA 2W6JD 1F8UA 1NQXA 4MVXA 121PA 1X8EA 2HAEA 4NR0A 4PLWA 4Q03A 2P2KA 2QW0X 3PFIA 1TMF3 3SC6A 5TQJA 2VZUA 4Q93A 3FLRA 3NV7A 3V4PB 3EOAI 2PRIA 5KEIA 2DDUA 2AXNA 1T6NA 1G41A 1E9AA 5AW6A 4D4GA 3MZ0A 2UZ0A 5KYNA 3RUIA 1MEC3 2AGSA 4HAXA 1GZWA 1VBNA 3LFUA 1E0JA 1M2NA 4GKXA 1N6OA 5KS2A 3TVDA 1U2EA 2J0UA 4DADA 1QM5A 4I6JA 1CZRA 3CW8X 4C43A 1LJUA 3KYCB 3HR8A 2E3JA 1I01A 4FGLA 1M2OA 1D2GA 4M0FA 3OMWA 5HA5A 3FYHA 1CDZA 3SX4A 1CY4A 3C6KA 1B73A 5CDSA 4PQGA 1ZN9A 4EN8B 2D8MA 5IHXA 3PIJA 5MHTA 2B8WA 5JSFA 1H3NA 1TKBA 1O9BA 3DM9B 5I4BA 1P1RA 4JGZA 1A04A 4G1FA 2AYYA 5EE5B 5CP8A 2WICA 1OUXA 3QVJA 4BAUA 4O3MA 1LUAA 3CNEA 1WCQA 2JNWA 4NJOA 1NMYA 1ZK2A 4DY3A 4QKFA 3ZCUA 1O1YA 3PPXA 3FHLA 5ELLA 1VYUA 1SVSA 4KWJA 4GD3Q 4URZR 4XIYA 1QTIA 4EG0A 4TT3D 3R8CA 3T3GA 5AHOA 4IQ4A 2QROA 1BVYF 4KIWA 1QIDA 4ZT2A 3EA0A 4NK5A 3A23A 4QYXA 2BFAA 1NN1A 4L9WA 2P9ZA 4C0AC 4F9GA 4I4CA 3FZYA 4U0JA 4EPTA 4DUWA 4D92A 1B35B 4HAUA 1W85A 2O3QA 3POBA 4LQ4A 5HIMA 2WO1A 1PX0A 4B1MA 3B1XA 3K1AB 2A6ZA 2JGLA 1IZ9A 2D6MA 2F1OA 1EPWA 2AJDA 1L7EA 3C15C 2B2CA 4DWWA 3EZ6A 1HMPA 4MVJH 2I6UA 4QGMA 5ENDA 4JLOA 1HRI2 4RWEA 4ASLA 4WNIA 3AEYA 5LQSA 2IXCA 5FA5A 1GZHB 2YMMA 5TQ0A 3INTA 2A1TR 5EZYB 1A1SA 5IJAA 1LWOA 2AEMA 2DBZA 1FNDA 2OGWA 5A5VA 5JHGB 2B5HA 2G77B 5IWFA 4W1SA 4H1TA 5JSYA 5BYBA 1D7OA 2BV3A 4N9IA 1JEQB 4OG2A 5I5EA 2FPKA 1FXWF 2QM3A 4P6VF 1O95C 3O31A 1I6MA 4TXHA 4GL4A 3LW7A 4BNGA 4V1CA 1XJ5A 2B1QA 4FX2A 1GZDA 1HC7A 2YQZA 2G0NA 3S8EA 1TF2A 1YKFA 4D9FA 2Q4DA 5HFJA 5A6XA 2IODA 1E3TA 3AI2A 3L1JA 2Z69A 3A1UA 1W8ZA 5K0EA 4JXXA 3DBOB 3UHOA 1LEHA 1LOBA 2VGDA 4ALKA 3ID6C 5BW8A 5L8VA 1T5SA 3O8NA 5I9IA 1FCJA 2FCRA 2AN9A 4ZZ1A 1QH6A 3HB1A 1WHTB 2VDNB 3WQ7A 4CEYA 3PFWO 3AU9A 4YRCA 3ZVKA 1P2TA 3ZBQA 5GINE 1KQFA 3OX3A 2FZLA 1JXOA 1WKYA 1O4YA 1Z5NA 2IYTA 1OX4A 1UZAA 1QOQB 1R18A 1REQA 2XH8A 3RO7A 4DV4B 3PX2A 4PBPA 2TBVA 2DTEA 5BPXA 4PG6A 1SZDA 4QVGA 3FHCB 1OWOA 5CEFA 4JL5A 2GCEA 3C98A 3K9HA 5DHQA 1UBOS 3LDGA 2QLJA 2UZAA 5D3QA 4WACA 1I6KA 3COPA 2QZJA 1J58A 3ADOA 2BEUB 1BDHA 2O8DB 3D9QX 3IUPA 3GUYA 3F6SA 3FDZB 3UW1A 1KAOA 3HDHA 2FDKA 4FPGA 1KPHA 1CYDA 1E20A 4ENQA 4NVRA 1PGQA 1ZZ8A 3SEEA 3GYGA 1XEWX 3VAZA 4XQ9A 2J08A 1XQXA 5AW9A 1XMQB 4MVJD 1II8A 1OQDA 3EJWA 4MR8B 5FZKA 1RPTA 1WA4A 1XC7A 1DRUA 3M82A 3KJZA 2RE8A 4F97A 2Y8KA 1P1KA 2WT9A 3Q3JB 3ESXA 4LDPA 1PGSA 4DRYA 4P98A 2BMVA 2REXB 4UMVA 4EARA 4EN6B 1AYM2 3FVRA 4ECEA 4J07A 3IDQA 1QR2A 1X2BA 4KP7A 4FC6A 3TOJA 1W3VA 4JSRA 1Y9GA 1SQGA 4YPVA 2V97A 3NHWA 3WGKA 2EX1A 4GQIA 4HEA1 1DAIA 1E4YA 1SMKA 1OFUA 4YJGA 2QN1A 5I7RA 1E6CA 2JD1A 2XJRA 4W5TA 1P74A 1QIKA 2M6LA 4CCAA 1RUI1 4YM3A 1ZVVA 4BHPA 2X0KA 1E3EA 3NAPC 2CLCX 3D4BA 1RXIA 4CDWC 4RMJA 3LHFA 4Q9JA 1T4MA 1PK6B 2R1UA 1NVMB 4ABYA 5JQWA 4IIDA 1ND3C 5FLYA 4K9QA 2W2PA 5H8WA 1R0ZA 1PHPA 5CFOA 4NRQA 5JPDA 2QYOA 5F23A 1POV0 3DTVB 1PR9A 5KYKA 3ZGYA 5L9BA 3O1LA 4AYWA 4XJ8A 5DYYA 4ZYYA 1H6DA 4BMEA 5HZKA 4ER7A 5C81A 4N41A 1QP8A 4ZQBA 3WCSA 4LOIA 1HDGO 2JLUA 2HEIA 1M0WA 3IBMA 1TK2A 4KX3A 1ZD3A 1JIQA 4BK4A 4JHXA 2IELA 4XB2A 3JQRA 1A5BB 3H9QA 1XRUA 3LBIA 3AKZA 3ZW8A 5KQRA 3PC7A 3D1LA 1VOTA 1DAPA 2GZSA 2ZX0A 2DSTA 1BS2A 5DHRA 4DEVA 1AG9A 4Q4W3 3M4XA 1PUIA 4JI1B 3I8OA 4L99A 1G5TA 3NFRA 4RAQA 3RS0A 1ZUIA 1N2CE 5IVJA 1CCWA 5CAZA 4JYCA 4JGYA 3F74A 4YXFA 5DGXA 3HLYA 3W58A 3LQ4A 3ZHZA 1JJIA 4I5IA 5F5NA 2X3UA 1RVV1 2FFRA 4KU8A 4YWAA 2QRQA 2WPDD 1O03A 3SBOA 1V1JA 5T8KA 1F8FA 1K4MA 1U65A 4L07A 4M1OA 4O4IB 5L4NA 3L41A 2XB6C 1AR72 4W1RA 4PLOA 1JQEA 4A2PA 1DQPA 1UBNA 3M4YA 2UZ1B 2M32A 3BTSA 1QKKA 4ALNA 4RKQA 3AR8A 2QN3A 2CXXA 2DTWA 5HRCA 3NHAA 3SXJA 4KK4A 2XMDA 3BHJA 4URHA 4V38A 1Q0HA 1CUXA 3HCCA 3HYCA 1S89A 4DVGA 3WDSA 4QTZA 5AOCA 3HCOA 1QIJA 3ZQ4A 4Y5TA 1JDPA 3GRZA 4X41A 1NXMA 3NETA 4MRMA 1E2KA 5IABA 5LZ2A 1PTKA 4L6IA 3O2SB 3FNHA 1XF1A 4XURA 1WHTA 1ZOPA 3T9DA 1QX4A 3SHQA 3TZ6A 4MH0E 2GBLA 3E8MA 2ATXA 4HSLA 1H0SA 3AUKA 3RUHA 1WUJS 2ADEA 5ALHA 4YM0A 5JECA 1F9KA 3O5SA 1T2AA 2FOLA 2EP5A 2GNBA 3GXBA 2GC0A 2O06A 2Q07A 2X2PA 2CJPA 4MX8A 1PN3A 4FXKB 1Z83A 3R6DA 3N6VA 1ULAA 3AVRA 2WD7B 1N6PA 4XJ9A 3EVDA 3C4JA 4JB3A 3WMRA 4AVYA 1SB9A 1A9YA 1OROA 4RSHA 4YS6A 3L1UA 4UE6A 3EGOA 5HM6A 5LD2C 3K0AB 3SEFA 3LDRA 2VF4X 4UVDA 3PVCA 5KMGA 2JFYA 2JFPA 4PPFA 5IW0A 2ZRMA 3S2EA 3QJYA 2VTVA 4F2PA 3K6KA 3G5TA 1OLQA 3CW2A 3KYIB 1C7QA 1N1EA 4RS4A 1PM7A 3I3DA 2VJMA 3IUQA 4NAHA 4MADA 3U7QB 3IWZA 5E9JA 5EHIA 3OFSA 3DYPA 5CKQA 1UKRA 3V0AB 3UJNA 1XLTC 1YB6A 1N6KA 2OQVA 2EICA 4YAGA 4AVCA 3FSGA 1OUSA 3HCPA 4A4DA 3H9GA 3EQ9A 2BP7B 3RI8A 1TLTA 2PQQA 3JSAA 1V8OA 4X3CA 4BTEA 4M1MA 1UBEA 1USWA 2NUAB 3TQCA 3HYLA 1TZCA 4NE2A 3MCVA 4XIKA 4LBQA 2ZWVA 4QFDA 1C0LA 4FEGA 3PTZA 1C3OB 2Q28A 1AXKA 4MV5A 5KOJA 4BE9A 5AW8A 2Y3IA 2FPSA 4MRVA 4CP1A 2C9DA 1AH2A 3PUIA 2QX7A 2GZMA 4UARA 3SWWA 1TJPB 4QSMA 3TDKA 2G8NA 3OM9A 2GPSA 4YG6A 4M4PA 4A0QA 1YQ2A 5EJ1B 4EO7A 4X8OA 2JGNA 4F60A 5D21A 3DUFA 5TB5A 4UPVA 3WRWA 2WWHA 2XUEA 1W6QB 5F3DA 1JB1A 1TOAA 4AICA 1E0SA 4FS3A 3LGAA 4IF6A 3ONVA 2JLAA 3OIYA 3A6HA 1YXWA 4N03A 3SFVA 4PYLA 3N2ZB 2GZ1A 2VPTA 5JBNA 2GCPA 1LK5A 2QUJA 2ZUUA 1F8GA 1EFVB 2W1WA 4HANA 5AKZA 5I45A 4AQSA 1V2GA 4I3GA 2E51A 2ZI5A 521PA 2GVNA 3X0DA 2BBVA 2WTNA 3HE3A 3C6QA 3UUFA 1D6NA 4HK4A 3S1SA 4KG8A 4PHGA 3TZLA 4QA9A 1YQXA 2OWDA 3LOPA 3X1JA 4BKPA 3BJMA 4W6YA 4RE5A 4X3PA 3E2IA 1GAXA 5AHWA 3BWCA 3UT5A 3ESQA 1LENA 4E70A 5CM8B 3U1XA 2VS1A 1AR81 2XMPA 1GYPA 3CTPA 4JRLA 5FZ9A 1ZAKA 1MR3F 3O21A 5GJBA 1K1EA 5CVVA 1V8DA 3IT1A 1IS5A 1VMEA 2QP4A 2EGUA 2F3PA 4CWAA 3NHUA 2YDYA 1GFSA 1TME2 4UE2A 4AY3A 3W6OA 4OHPA 2VM9A 4HNGA 4D9KA 5FPBA 5H59A 4XDZA 4PHHA 3LQRA 3R3XA 2HNKA 2FHSA 1U7OA 5DNVA 4UU7A 3ZPOA 1GQSA 1ULTA 3EXUA 3G9QA 2EGGA 3IDSA 5IYZB 3OFVA 3SSAA 3TN92 3IPVB 3M6FA 2ZGUA 4R2IA 4EB8A 4EH1A 4Y20A 3RU7A 5LRRA 1T36B 1HIXA 5H16A 3L79A 4RK7A 4TLCA 4D5GA 1ORWA 1LPNA 3X1DA 5HUJA 1TW3A 5IT5A 5KSWB 3C3MA 1MG5A 2IU6A 1OI2A 3E18A 2WWJA 1JMKC 2BGMA 1P0MA 1WPGA 1V43A 4UHFA 3SYMA 1N32B 2HSZA 1U5BB 2FXIA 3MPPG 1GKLA 4P9NA 4CGZA 5G04L 3CZCA 4EHLA 3FPHA 1LJ8A 2HHAA 3ZDFA 2HTFA 2JB4A 4EL5A 1CIVA 3HN3A 4ASKA 1FSGA 4RQUA 1UEXC 4BZQA 3PTYA 4KLNA 1BK0A 3JRWA 2CXOA 3UQZA 2DUUA 5FMDA 2IUTA 2JFUA 1GGVA 5KTSA 3ZCRA 2RVAA 4J90A 2W6ID 4WVLA 1UY2A 3EXG2 5A32A 3QLQA 2VVFA 4RVHA 1ACMA 5A4DA 4PGFA 3FYUA 1WMDA 1CNEA 4R9VA 3ACBA 2A5GA 3LFMA 1GNLA 1R6DA 3FSEA 2ZIWB 3HLTA 5HTOA 1A9ZA 1CEXA 1HA3A 6YASA 1KITA 4DL9A 5FYUA 1MO4A 4YJ3F 4YMHA 2O23A 3RTAA 1V26A 3C5EA 3MGGA 3B13B 3V4FA 5BSTA 1OKQA 3DKWA 3CLSD 3N0TA 5LB6A 3GGLA 3IXLA 1XDGA 4YBRA 4B09A 3QE0A 1YIOA 3DMTC 2C78A 3R09A 2A5FA 1F17A 4ARSA 1WW2A 1LZKA 5CG1A 5BWMA 2Z2ZA 3ESZA 4E9KA 2SCUB 3TX6A 4TKMA 3VBEA 1Q7RA 4RF5A 1ANKA 4NHXA 4QPPA 4PNHA 3KT0A 1XZFA 1I30A 4JUIA 3ZFEA 4QWNA 4P9WA 5KAPA 2J3EA 3H3ZA 2CDCA 1D4M2 3WLAA 2J45A 2ZACA 1TA4A 2W98A 1X1SA 4CHTA 1DS6A 2GN6A 4MARA 1FT9A 4TQ9A 1KL7A 2PSDA 2ZAIA 1Y4UA 1HQWA 4YC7A 3A9WA 1KAGA 2OHIA 9ATCA 3KD3A 3SR0A 4HLCA 1O6GA 1S2LA 3LRXA 1NLRA 4KHZA 1GHTA 1L4LA 2FZCA 5GM0A 5ILOA 5LR6A 4WUTA 5B4XA 3D8SA 5FXMA 5KX5F 3ZTTA 2YS7A 1XU7A 1Q0PA 3L7IA 3CUVA 4KQGA 1JA1A 3O1MA 1ULZA 1KDTA 1O6UA 2DCUA 4N1AA 1VHDA 3H18A 3JX9A 1G7SA 1WP4A 5B5SA 3PU6A 2IVFA 2MHCA 3OJBA 3GZNB 2HC9A 4FYWA 3TSWA 1YZFA 1VMFA 1TMOA 4WH0A 3FTNA 2PSJA 3JD71 1KY5A 4Y9RA 2DB3A 2Y60A 4D74A 3MJVA 3HV2A 1MAVA 5KAMA 5FWNA 3WO0A 4IXWA 1D9ZA 3ND8A 4DYDA 4CT0A 2C42A 4JA0A 2WS93 3U2QA 4F84A 5AJUA 3OCVA 1JYWA 4NF2A 4C4TA 2N1MA 5ITVA 3NORA 1ZH8A 2J9GA 2FI1A 1NYTA 3OG9A 4HK9A 2PHXA 2QTAA 3KB2A 2ZI4A 4Y9TA 4B4OA 5D8AC 3S30A 4PLFA 3AVTA 1R093 3BAFA 2HKIA 1MRZA 2EBFX 3EEBA 4ITUA 3TOVA 1HV0A 1X7XB 4X54A 1XVIA 4PF1A 1CIJA 5HJ5A 2I33A 1YQQA 4P33A 1KDPA 2H5LA 4MPRA 1X38A 2C95A 4HN2A 2ZGOA 1XP5A 2B4YA 1WCSA 2O5VA 4KPYA 4O1HA 1YLLA 1L5MA 3JWGA 2EQAA 3KQYA 3EBPA 1FDTA 4GRDA 3N2NA 3MJ4A 4F85A 3MD9A 5DNDA 5A6VA 1PFVA 1WRBA 5C34B 3Q9UA 2IWHA 1Y5IA 4YFZA 3DCNA 2A1XA 1Z8NA 3K51A 3MYYA 4HNRA 4DLBA 1CR2A 1MOQA 2VSYA 1QV6A 3RG8A 3V48A 1EFHA 4WQMA 4R8KA 1KFXL 1SFPA 2H1OA 2GX6A 1ST3A 3N70A 3GEMA 4M1EA 2WU3A 3EFOA 4UBHA 1UK7A 4R69A 2EWVA 4CMAA 5JTTA 3C43A 1G3RA 1NT2A 4L51A 2GKGA 2R061 2ZB7A 4EDHA 1NCQC 1LTKA 3T12A 4D8TA 5GLWA 3M1HA 4S1PA 1LDNA 5THKA 2C5HA 1U5CA 1SKMA 3DP7A 1SBNE 4XI9A 3ZLTA 1ZX5A 1CPNA 1E1NA 3G7UA 3IBYA 4KPFC 4GP7A 1L4HA 2OO7A 3Q8BA 4OHRA 1Z6AA 2Q0XA 1B6TA 4WXRA 1TM5E 2PZ8A 4HLDA 1HKDA 3ZV4A 3CE6A 3HABA 1QIEA 1O3RA 3JVUA 5KJEA 3ZWCA 1I2BA 3EULA 2RHCA 3EGCA 2O8BB 5FYCA 4EZHA 1CZTA 4BWGA 5FWEA 1L7MA 2FN8A 3VBUB 4KITB 1T0HB 4QMAA 5CFDB 3CSUA 1SVUA 4RHV2 2W6NA 1ST8A 1K7EB 2GN3A 3PP8A 3C1AA 3IO5A 2CB0A 2YFZA 1BTOA 1RI5A 5EIHA 1OV4A 2IHKA 2V1XA 5LA6A 3W5MA 4W8GA 4F04A 1EVZA 1N2IA 5KHJA 2RGWA 3TW0A 3ANTA 1JHZA 4BNUA 2W2KA 4QKBA 1NVVQ 1NHWA 4BQFA 2JGAA 3I59A 1SBIA 2DR3A 3ZK7A 1T34A 4F4IA 4AJHA 4EB6A 1WDWB 2XT0A 1JDBB 5MGBA 4L5BA 3HC7A 5NLLA 2D06A 1O0CA 3ZDCA 2RR11 3C3EA 3KV5A 3A9SA 1NONA 1XEFA 5K0SA 4V0RA 2OQ2A 2NN8A 4U5QA 1GM5A 1EBBA 4HTFB 4KJZA 4E31A 2EXXA 1QONA 5FZ7A 4BMVA 3KZKA 1HW5A 1DJLA 4LOLA 5ALNA 3OC0A 5KYGA 2R9VA 1Y5NA 1NCQA 5DIFA 2BBAA 4Q3AA 1IPJA 4N9QA 1K2WA 1G18A 4H27A 5J63A 3RREA 3KEOA 2KQUA 2G4CA 1CKEA 5FDFA 3C7EA 3PYXA 2VVTA 4Q9NA 2PS3A 1RS0A 1MO3A 2JLYA 4M6WA 1ZGGA 3NL1A 5H9PA 3FGPA 1M8PA 3QBEA 2NXEA 3AUXA 2BF4A 3OPMA 4D4MA 3GJ4A 4BNTA 5JPMB 2VPPA 1NCRA 3MUFA 1NURA 3SBDA 1X8JA 4HB3A 2J6BA 4EPVA 5HQ3A 3VXKA 2EHJA 5F2NA 4X8HA 2ECKA 2BZGA 3USZA 3PUYA 1ZCAA 3EXHB 2WWTA 2QQJA 1QJU1 1QZUA 3UHJA 1QG6A 3IIKA 1Z47A 3DBVO 1ZSVA 3AZQA 5IYZA 4N3NA 3L43A 4DCPA 1ZFNA 2QL5A 2C9YA 3LOBA 3BD6A 1REDA 4I5FA 4K9RA 5EIBC 5HXVA 4YVSB 3QWHA 2QPAA 3PURA 2BNNA 3BVCA 3QKIA 3BA1A 2Y1EA 2C3OA 2PKCA 2V98A 2D1TA 2VJYA 3GGSA 2G6TA 5H5JA 1XDZA 4DGQA 3OJWA 5F7ZA 3P8ZA 4NVPA 3QOWA 4R01A 1KR2A 4J75A 3MV01 2YOFA 3OOWA 5TSWA 1G5QA 3DHWC 3L7NA 4Q4W1 4DMLA 3S7IA 2A59A 4QVKA 3MFCA 3NAQA 5KQGA 1XL1A 4J25A 4FKBA 5GALA 3K5PA 4ABTA 2OXEA 1U8XX 4FYJA 3WX5A 4EMUA 2IEDA 2A2ZA 4IHAA 5C4IA 1W46A 5ALGA 1EM8A 1QG0A 3D6HA 4UEWA 4UXAA 4Q24A 5F1PA 4W9NA 1U98A 3VJRA 2PN1A 4Y1RA 1D2RA 1KFEB 1XJAA 3Q3EA 2JI4A 3AC0A 1V6NA 3PV0A 4PR0A 3UT5B 2H2GA 3P1JA 3E6BA 1KI3A 2O59A 4DR7B 3BXZA 3CH5A 2O2IA 2MT9A 3CJIA 3FTCA 1DARA 3RUPA 2F8LA 4AROA 3CFYA 3ZHOA 4NLLA 5IC4A 1TCUA 3KVOA 4CUBA 2V58A 5L9VA 4U6NA 4ALMA 5K3OA 1Z3IX 1THTA 3M0EA 3MEQA 1OIWA 1J9ZA 2GAFA 3K9GA 1NN5A 4LJRA 4XUNA 2HF9A 1BXGB 5ECDA 4FPOB 1JW9B 1DKUA 3EIFA 3PLRA 4QAQA 5FPPA 4GBJA 4JKKA 1CNFA 1O95D 2ODEA 4F6RA 1ORDA 2G70A 2WSBA 2WWVD 3OPVA 2CWSA 4EB3A 5BSWA 3COWA 3O94A 2C04A 2O9JA 1D4VB 1R092 4QBTA 2K87A 3EMBA 4LK6A 3VU1A 1TQ8A 2NNLD 2DCTA 3Q3VA 2P35A 4FDAA 2FQYA 2V7PA 1TQ2A 4OSOA 3UVEA 3GGGA 2WUFA 4YRPA 4MMYB 3VNQA 5AI6A 2QDKA 2CYAA 2ZYTX 3ZEIA 1E1QA 4FMPA 1EFLA 3C7KA 4N65A 4QYIB 3MERA 5BSRA 2Q3CA 1YFLA 1G64A 1UINA 3A9TA 3N7LA 2XYVA 5JAHA 1HV8A 5ADHA 2V55B 1EUTA 5G1OA 3RZHA 5DGTA 5JMCA 4ZDKA 5DSZA 1OUMA 2WNSA 1Y4ZA 2OYCA 1KYZA 3HQXA 2GK3A 3CEPB 3G0HA 5IANA 2IF0A 4MYEA 2VI5A 1NXPA 3PIDA 1OQEA 3O75A 2E37A 3ET5A 2FQWA 1QFZA 1NP7A 3OEWA 4WLEA 5FNVF 4ECAA 4XM0A 4XJVA 2IVIB 4HONA 5I4IA 1FMLA 3PQCA 3HYNA 2ZAMA 3O2NA 3EVZA 4HRVA 2EG9A 3H50A 1WX1A 4QVIA 2Y0CA 3K2BA 3RS7A 1UOFA 3OO1A 1ZOSA 1KY4A 4LDJA 1UKGA 1TQ6A 4HQ6A 4GMXA 5T3YA 1GYRA 4X7RA 1NTRA 2Z98A 3WXBA 2DWOA 1W88A 1YVEI 5A06A 3OE7D 5D3MA 2J6HA 2ADOA 1UYYA 2QRVA 5CA1B 3AEKA 4EHAA 1J97A 1KYWA 2WSLA 2BY4A 4FFGA 2B34A 5LQDA 1E1MA 4Z9XA 4X95A 2QSYA 5FOSA 1U3GA 4BO1A 4OP1A 4B6PA 3AEXA 2ZLBA 3AM5A 4HAWA 3VSDA 2IZ1A 3H1WA 5FLIA 2OKXA 3VJMA 3VR1A 3DM5A 2YXPX 4P3KA 4PT6A 1SHJA 1FX5A 2L82A 3I8XA 3JQ8B 4FE3A 2W91A 3G2JA 4BU1A 1RVF1 1QFSA 4FEEA 3N7UA 4CMHA 2JLRA 5HFAA 3M3CA 4D79A 2X6QA 3WB2A 3FWPA 3SCHA 1S02A 2V4AA 4YJHB 4MXDA 1FNBA 5K0NA 4US1R 4GDFA 6CHYA 4GRAA 5ENVA 3WS7A 3EZFA 3ZYBA 3EISA 4FT8A 3WP3A 1KFBB 5DLYA 1U0RA 1ZRDA 2FK8A 5AK4A 4BV3A 2PMDA 1BA3A 1UC5B 4RFSA 4IZOA 2ZUSA 3IJPA 1JKIA 3OFND 4I1UA 1UK8A 1ETUA 5D2CA 5C4MA 1H2FA 1H9CA 3G1UA 3E3NA 2EL7A 1MZEA 3TTTA 3MJCA 3V32A 3IKVA 1ND6A 5A7GA 4DFSA 4GZLA 1E4VA 1U1CA 2P3JA 1Y9EA 1R0CA 2XRMA 5JS1A 2QN7A 2PMEA 5EZSA 4HX9A 1I1HA 3SS9X 2ZRJA 2YY1A 2A6WA 3GN2A 3BALA 2ZJOA 5JDBA 5ED4A 4AEDA 4U7FA 2NSJA 2PA3A 2X40A 2HWD2 4J03A 1NJ1A 4L4SA 4X62B 2ID8A 3RT1A 1GKBA 1BHQ1 2OCXA 1C0IA 4OLFA 2Y05A 2YJ4A 3FTEA 2NM0A 4BGUA 5A0VA 3ND5A 4HNAA 4J3NA 1JYSA 1LRHA 2O2EA 1QKJA 3C5WP 1IZYA 3ZY6A 2XJ9A 1MOSA 2C9BA 3BREA 4H7FA 3MINA 3BRWA 4BZXA 4OI0A 2PKXA 2PVPA 3DMNA 3G8YA 2V7TA 4IETA 5K6RA 1LW7A 1C4RA 4KR6A 4C3UA 2X41A 3VPHA 1OMOA 4GOMD 2P4QA 1VJ0A 1PZ9A 1G19A 4PGMA 2C1EA 1W1UA 3LJKA 3G0GA 4PYQA 5MFPA 3IBTA 2YHSA 2NV6A 4ND1A 4AZTA 3K0AA 1KYTA 1QDUA 2WFLA 4IH1A 2DU0A 2HHCA 1QLHA 2UYAA 3H6KA 4KQMA 4ZGWA 2HYKA 4HDRA 1MPXA 5JS7A 2VP9A 1RQLA 4R0MA 2C59A 1SDDB 1PVOA 5ECGC 3WSWA 5K3FB 2D74A 2Z4TA 2XI4A 4B0PA 1CQIA 1W8TA 4DG9A 3ZY3A 4FZRA 3KOUA 4MSUA 3JAKB 1HQNA 1E6EA 5IVHA 4UFIA 5B2EA 1NRXA 3LZCA 3URFA 3DEYX 1TU0A 1C1HA 3T3HA 3AUFA 2XQJA 3OQVA 2WRAA 4F96A 1ZSYA 4E5NA 1AHSA 5GJCA 1XCGB 3OWXA 1B0AA 2A0KA 2CLMB 3LB9A 3K2OA 1A50B 4R05A 1F1BA 4XFCA 2E6UX 3OHSX 4LNHA 2V8OA 3EAFA 2VF7A 2A0FA 2V96A 2XHKA 1JJ7A 4A7PA 1CV2A 1AN0A 1B8OA 3N58A 4AS2A 4OHMA 2F6RA 3IXQA 4RELA 5IC6A 4FEYA 1PMJX 2XB9A 3PVEA 1H9PA 5LUAA 1J3RA 1W6QA 2A1TS 3POWA 3C3CA 3MWYW 1W2TA 4LKOA 2ADDA 5EKTA 1NBHA 1Z7YA 2JGMA 1LS6A 3EVTA 1DIOB 3HO8A 1GA1A 2XNDD 4LPKA 3LFTA 2IOHA 4U3JA 3LP6A 4K46A 4FBLA 5A6SA 4H60A 4JP2A 1VPEA 5BSFA 1SCSA 1CUIA 1SCUB 4A8JA 2C3YA 2Z2SB 4V03A 1E5IA 2VQAA 4TQAA 1RSZA 1XMPA 5K3CA 1FL9A 2ZX3A 1ZP6A 5EESA 1BVHA 4UU1A 1W1WA 2PRJA 2PGJA 3GJQA 2O2HA 5FYDA 2VUUA 3HB4X 3JQFC 2P6MA 4ISCA 4EA7A 3F6EX 1MS8A 3ECQA 5IT6A 1PR0A 2Q5JA 5BVGB 2FNAA 3ZY4A 1PFKA 1HDZA 2BEWB 1A9OA 4D44A 2YROA 1N7JA 4I6EA 4ETIA 1XMSA 3ZKAA 1OVSA 1H4VB 3POFA 1VLNA 3G0DA 1GG5A 1Y98A 4Y6SA 3DDZX 5C71A 3NNMA 3O3OB 1R1ZA 4Z92B 5ILQA 4PHFA 3V2GA 3KQSA 4TL6A 3IUYA 4I1YA 5E0KB 1OAAA 1DIGA 3OT5A 4MICA 1ACLA 1MEC2 1FOEB 2BI7A 5KSPA 1M2JA 3RRMA 4UPEA 2EOAA 1I10A 3VPGA 3KE8A 1LRJA 2X1VA 3BGWA 1E66A 5J2TB 3K20A 2FOXA 5JXIA 3EXIA 1UL9A 2CCKA 4DR1B 3GDFA 1JEYA 5BP7A 1FDIA 3WJ1A 1Y4WA 3NO8A 1G7RA 2AEFA 3BX1A 2F62A 3OU7A 3DW3X 4MW7A 4DRVA 2RH5A 2GNTA 5IU6A 4YGBA 3MXOA 3UFXA 1GU3A 4XD7A 3KSUA 5B3LA 5JVDA 5F4BA 3JQXA 1CG6A 5HOEA 1O5IA 5I9TA 4JV4A 1UMBA 4QPZA 3MS7A 2C5AA 4YFWA 4AR2A 4F5DA 3LECA 4KWUA 5IBPA 5DZEA 1PTJA 1A5ZA 4TMFA 4N3BA 1ZBE1 4ZHQB 1UMCA 1SHUX 1YCDA 3NM5A 2Y34A 1D2HA 3H2KA 3VKVA 3GBSA 5BNNA 4CTNA 4CI9A 2H1SA 4RTPA 1R00A 1OBHA 1W9FA 4BX8A 3KHTA 4HNVA 2JFXA 2K7ZA 4QRHA 2RHMA 5JNVA 4PBOA 3FYSA 4WXYB 2ERYA 3B3QE 4R0VA 4PQFA 2BUCA 4FOLA 4KKXB 4NU5A 2WWIA 3CUKA 3I92A 4FFPA 1L5NA 2CV6A 1P4SA 5IBCA 3R4CA 3MIIA 4UFNA 3F7TA 1U9CA 2QVGA 1R8XA 3SEZA 5TRTA 1KYYA 4O4JB 2F48A 4HZIA 1SUPA 5F2KA 2ZWPA 2XOEA 4BMDA 2NO0A 4MPPA 1WIWA 2LDBA 4LTNA 3ELWA 1HEIA 3QVVA 3UZUA 5DHSA 5CA6A 1GQYA 4B47A 4GGMX 3WADA 5DXJA 3X1KA 2PTMA 2H2FA 1T9GR 2ZVDA 3ESDA 4XFKA 4HH4A 4D6QA 2XDVA 3KXDA 3GN1A 2J3DA 4IDBA 1NXQA 1RMTA 3UFBA 1NKVA 1H4SA 2OHGA 2IYZA 2BSQA 4XWTA 5LOVA 3HG7A 5FO1A 3OB8A 4FN5A 2YIJA 5CDUA 4KU4A 3PQ2A 3V8QA 3JCIA 3NBKA 1N1VA 1PNQA 2OV3A 2CXQA 4E09A 1CVNA 4NBWA 1MH1A 1ZU4A 4QUEA 1Z08A 1MC8A 3VHPA 2OCKA 5FBLB 4RTQA 4CIBA 5T55A 2VR1A 1ODNA 4P92A 1IBMB 1V6IA 5FRDA 3W2HA 3FI0A 2HPZA 5CM9C 2ZXUA 1OHHA 4JCOA 3SKVA 2W48A 1W87A 4GPTA 2HWYA 2WJZB 2ARAA 2TYSB 1YCHA 4QJ3A 3CHYA 1CD5A 2G9UA 5IAVA 2OCYC 1KJ9A 3TNPB 4W8JA 2PDAA 1DIAA 3D59A 5E2AA 1BYHA 3R6LA 1S7GA 5SY9A 1OASA 2R7LA 2WT0A 4NRPA 2JKZA 3ZGLA 3DYMA 3J81k 1DFIA 5LBFA 1KO7A 1N1SA 1NOVA 1RZUA 1PFUA 4S1TA 5CLGA 1DXOA 1B6SA 3ZVMA 1CUEA 1YVDA 2PLWA 4FILA 2RIPA 1BZWA 2DF8A 4E8DA 2VLBA 2ECOA 2QMOA 3BTUA 3CX6A 5FTKA 3MM4A 1XA0A 1FLVA 3KUUA 5CYPA 2F4NA 4UHKA 3C85A 4ZI5A 1ZW1A 1VB2A 1KFUL 1L3CA 3O0XA 4XUQA 1MS9A 1NOKA 3GBVA 1X80B 3G1WA 5GLZA 1MIHA 2HWE1 4ID3A 4CLDA 3BQ9A 3HZHA 2E82A 4UTXA 1UODA 4YVWB 2ZR8A 5KQLA 2CV1A 4HS9A 1GL7A 3KZCA 3U11A 1PW5A 1KKLA 4INJA 2WNHA 2OZPA 4BRSA 3L1KA 1SXPA 3B2EA 3I3MA 1XK6A 4UTVA 3GWGA 1P77A 2IYQA 3P32A 1E1RA 2NQTA 1C4KA 3FZEA 4ERNA 2GAOA 4GUDA 4RY8A 1B15A 4AWXA 3JPWA 4Q7EA 1KDMA 4NPMA 3PPVA 4G1CA 3NVMB 2EVWX 1MRSA 2UYHA 4YW5A 1FU4A 2PZAA 1YL6A 2LR0A 2G63A 5IW8A 4JVLA 1V6MA 4AL9A 4D82A 2H4HA 1MLDA 3ZPYA 4YFVA 1RMU3 3QW2A 4XPIB 5AO9A 1ZOOA 2FSHA 3FJ1A 2D13A 2QSUA 1LDMA 3M2TA 2JH8A 1UH5A 3C1TA 5ARCA 4Z4IA 1TZ2A 2BL4A 3OUJA 1E99A 3LCCA 3GUUA 4RZHA 3HDGA 1JDVA 4IOLA 3PJDA 1LOFA 1XZAA 1U63A 1M2KA 1CQIB 4BMCA 1OZFA 3ZX5A 5GZDA 1F38A 1UBKS 4PLTA 1YI8A 3JQPA 3GAZA 1P73A 4LW8A 2FPUA 1KMCA 2A4MA 1EUUA 5AQ1A 1NXSA 2NZXA 3PNYA 1GUAA 1W0NA 3L0PA 1PL0A 3SXUA 3E9MA 5HP4A 3HI4A 3Q98A 3ZI0A 1NXOA 3B7GA 1LBTA 2G36A 3HBMA 3IPRA 1JT2A 4NJEB 3B93A 3Q5DA 3CF6R 5G0VA 5BORA 4PX2A 4Y2TA 3KQWA 1FOD1 3AX6A 4EKEA 4Q7KA 3KCNA 2G88A 4EGSA 1N9KA 5DTQA 1EVQA 2C7BA 3VPFA 1H6YA 1S4MA 1P8JA 2MHFA 4ZKDA 3HM9A 1UY1A 3JARA 3ILFA 3EEFA 1CT9A 1FX0A 1M0SA 1EM6A 3KLOA 2P6CA 1BVRA 3K4QA 2GFHA 4WBSA 5LDHA 1O87A 1KMHA 1SUAA 5GIPE 5GZFA 3AK0A 4IHJB 4IIXA 2EU8A 4LYEA 1N8SA 1V96A 5JG7A 2WINB 2VYCA 1XWIA 3O8CA 4DV6B 4DM7A 1BS1A 4LEJA 1QYRA 5FXXA 4AXOA 2GMWA 3I5AA 1GQGA 2YG0A 5K6TA 2DWCA 4CCNA 1GTJ1 1V5WA 1REEA 2OK7A 3JATB 3U81A 3RBAA 3I2JA 2V0CA 3PFHA 4ZTZB 3O4FA 1N1TA 4RF3A 4LQLA 5J7MA 2QZ9A 3P2YA 3KOYA 3F1LA 5FIUA 4M7RA 1T9KA 5LZ7A 2DPMA 2HF2A 1YK0A 4D97A 4GR4A 4IKPA 1GV9A 1BQ3A 3WZMA 1CR6A 1TFUA 2QT0A 4GMP0 4QU5A 1MO6A 3HTXA 2X14A 3JQ6A 1PVVA 4YT5A 3GLFA 3PQEA 5BMVA 1BN7A 4PC3A 1S7CA 3ISVA 4W9RA 2BCEA 1VHWA 4DY4A 1D4OA 4R7ZA 2LXNA 1U1DA 5DLPA 2QG6A 4JAAA 3JXSA 1FYFA 5FNVA 1UBCA 3ENWA 3T3OA 2I9PA 1E9SA 4KXWA 4AP9A 3D5EA 1UP6A 4EBBA 2I4LA 3LBNA 1BE0A 4TYNA 3U1VA 2KX7A 3JD73 3H05A 5KQMA 3OKPA 4J2OA 2VMFA 3QVXA 2WDZA 4DS0A 4AW7A 5L6LB 2WS91 4U7JA 4PANA 1NSTA 1OXUA 2R6HA 4G37A 4EG1A 3T9FA 4XUTA 1C3JA 3KNZA 3P5BA 5HE8A 3KSZO 4WKCA 1R12A 5KU1A 2XGOA 5F78A 3PUZA 5DZSA 1PEAA 1E2IA 5JR7B 3TSAA 3TEJA 2RR12 4MQ5A 1LK0A 4ZV9A 3UOGA 4R31A 2BV4A 2QQIA 2R0HA 3G5LA 4AKTA 1BW9A 2FSSA 1Z26A 2CE7A 2HDOA 1UYPA 4Q01A 3B7PA 4D46A 3PITA 3OETA 5IH7A 3L02A 1SCQA 5AI5A 4MUAA 5J9FA 4KBBA 3NHLA 1ODCA 1L7AA 5HIKA 2IEGA 4X00A 1ZZCA 4L7QA 4MB0A 3F8WA 2HRZA 2HLEA 4MP8A 4RS3A 5HUQA 4Z53A 2JCBA 1NLYA 1N6LA 2WLPA 2JDAA 1U7DA 2QE6A 4LAFA 4IF4A 5E1RA 2ST1A 2P0EA 2YYAA 2WUVA 4HKLA 3MSCA 3PR2B 2EIGA 1KGYA 1ZUWA 2XGXA 4RETA 2VK2A 5K0BA 1KO5A 3A2LA 5FOBB 2WPDA 4ROSA 1T36A 2G5CA 1B26A 5JUVA 3QEOA 1Q3HA 1EXMA 3Q8LA 4M3CE 1YR7A 2C4HA 4WEQA 4BPRA 1DG1G 3OFJA 3AZXA 1BDIA 3DL7A 4KX5A 1EGHA 2QTTA 3Q0TA 1BA2A 4HT3B 2HA2A 5I93A 4YDSA 3EZNA 1XOIA 4TYSA 3RZLA 3KZNA 1ESCA 1D0GA 1Q84A 1R0SA 3FA2A 1NW4A 3FG9A 1UBRS 4B6OA 3NDPA 2H1HA 4N47A 4FVTA 2VECA 2QD4A 5FXWA 5BUSA 2ZYSA 2HU5A 2OVUA 4FTWA 3HJNA 2R6GA 5JCXA 2IYWA 3FBMA 4UYBA 3GMSA 3R7FA 2P62A 4Y0NA 4WECA 1LU2A 2F3SA 2JIZD 1TAHA 1B8UA 2PR2A 1SG9A 1N34B 2A3NA 4NNPA 4XCQA 3AJAA 5DN6D 2P3SA 4DUVA 5FJHA 4HJRA 1P7VA 4LQCA 4REMA 4OX9Y 1IK6A 4R9CA 3WV6A 3RD5A 2YIDA 3QF7A 5FP8A 1AQIA 4JEMA 5CGQB 1AL21 1T8RA 2UYBA 2VAMA 4CL3A 3WOGA 3KXKA 3HP7A 5EQFA 4IICA 3DPSA 3PZBA 1P6UA 1QV9A 1T9HA 2YUEA 1E9BA 4ZI7F 3F90A 4RULA 1L1RA 3E3AA 3BSFA 3CT6A 3EWAA 2Z2KA 3TSZA 1WVIA 4XQEA 3LNTA 4EKYA 2L0XA 3ZWPA 4JDMA 3ZHTA 2HA0A 3CEJA 1BX0A 5F1RA 3OEYA 4FQ5A 1K92A 4CLRB 2ILVA 3BCWA 4D42A 4L8GA 5I8SA 3W2TA 4LO4B 5KYXB 4NMWA 1RMU1 1EVIA 1NW6A 4YG0A 2OM6A 2XWPA 3NJZA 4Q2FA 1AZWA 1TMF2 2PCJA 1G9FA 2Y9PB 1E63A 1M1YE 4NL4H 4J4TA 3IDBB 1E5VA 4GVLA 2DUPA 4H9GA 1RHMA 1RKUA 1QIGA 1F8XA 1VKJA 3SZGA 5I4CA 4JGBA 4MUKA 3AUJB 1DKMA 1M34A 2BFFB 5A7FA 3VBFB 3DGFC 4GZMA 5F9HA 4AQ2A 1F0PA 2Q1TA 1N6NA 3H8XA 2J5BA 1QB8A 3DC2A 1AZLA 4OH7A 3JALA 3D3KA 3W4KA 3GFFA 4ZAXA 4D7TA 5I8YA 1T35A 4XGKA 4TTJA 3VC7A 3K2QA 4JCCA 4XQCA 3B6IA 1BO6A 1K42A 3WKCA 1MCZA 4P5YA 4L6AA 4Q4Y2 1Z17A 5ELMA 3I49A 5DLEA 1A8SA 2FQ1A 2BM8A 1P4AA 2ZJ2A 1GTSA 4J0FA 2ON6A 3E2PA 4TLFA 4D3XA 3NBQA 3G79A 3PC8C 2XNCA 2I1QA 2A33A 4BZZA 3K1ZA 4TYWA 3ENRA 1IONA 5LEKA 4W6WA 3R0VA 4G9GA 1FFCA 1ENSA 1V7PC 2PT7A 3ABOB 2B8EA 3AG5A 4FNAA 1PJSA 1KVRA 2BLLA 5I0RA 4MWTA 4WTOA 1F6WA 3GG9A 2H4FA 4KLRA 2J22A 2CSXA 3QG1A 3VDXA 1YE3A 3D2LA 1XWFA 1CAXA 3O8QB 2E0IA 1W6PA 1PQYA 1K7YA 3DMHA 3HU2A 4KPEC 3KP1A 1T1EA 1IBLB 4X6QB 3UC9A 3KVAA 1GLGA 3NKLA 5CLQA 4B40A 1DQYA 2FPIA 5D84A 4CVNA 4PRZA 2CFTA 1OF3A 2OPWA 1H2ZA 4B6EA 3ISJA 2IS6A 2WWSA 2XKAA 4P34A 4MQEA 3L18A 4D8VA 1F2TA 3I3EA 1OX4B 1MX9A 2O2JA 8GPBA 3F2ZA 4HDRB 2IXBA 2AN1A 5LBCA 2G19A 4RTOA 1VAKA 5TPZD 4IV1C 2J3LA 3ZXIA 2XOXA 3NDRA 4LHNA 1A9SA 1C8BA 1QGUA 2JG3A 4YBZA 2X0NA 1KI2A 3AVYA 2CUNA 1X3LA 2ZS8A 1G3IA 5HX7A 4BQNA 1BH2A 1LF0A 1RR6A 2Q8QA 2WQ8A 1CDOA 4YXWA 3FCOA 3CVVA 2JHPA 3GVHA 4TKUB 4LBVA 2RK4A 1Z63A 1YQDA 1FZTA 4MGHA 2WJ6A 3ZV3A 4E08A 2VHZA 3WW3A 3QH7A 1PAUA 1ADCA 3CVWA 2Q0AA 1ZU5A 3WK8A 1CUHA 1G20A 1B42A 1QH9A 4B4VA 4O63O 1C3EA 3HKDA 3LPDA 3ZHQA 5I3ZA 5E9WA 4XWGA 1YUMA 1GPWB 1U28C 1JQKA 3DCQA 2ZRAA 2UWCA 3JV7A 4BU2A 4O2BB 1J99A 3IE1A 4D43A 4D7YA 2NO5A 3AMQA 1KTIA 4KWHA 1UT6A 4R3WA 2O8OA 1DAHA 5T57A 1W36B 3GF6A 2XR4A 3P20A 3AIMA 1NRJB 4D4LA 3SMQA 4MGSA 1W8DA 4P14A 3BRSA 4YLEA 4G4JA 1M76A 2H8GA 3BRQA 5HCFA 4QX2A 5F32A 2ZJCA 4TLGA 3CKLA 1ZUD1 4RNDB 3NJVA 1SEFA 4Q5OA 1KVSA 5LCXA 1B0PA 1AKMA 2X0RA 1YA4A 2HBUA 2DY0A 1XYOA 4IDGA 3RKUA 4UUQA 1W90A 4BOWA 1OYYA 1E7RA 3V3KA 2GARA 1IMOA 3KUDA 5DG2A 1DX9A 1FNNA 4B3TB 3MVEA 2QTMA 2P4EA 5FO0A 3ESCA 4OK3A 5DTMA 4F7DA 4JYAB 4EHJA 1Z7S2 5CTJA 3ZHVA 4MVTA 2W6JA 4Y9SA 2DTXA 1T3SA 2H1CA 3CRZA 3N86A 1U8FO 3D6AA 5GZ1A 2VOJA 4REQA 5FPXA 3VKGA 2JAQA 1NQWA 3ZUPA 3RZJA 5JJKA 1J8QA 4RJJA 1GP4A 1DINA 1DXQA 1EVJA 3J8F1 4R4XA 3WLKX 1YACA 5DAWA 5L3SB 3OPWA 1GQHA 4KVGA 3AY7A 4LVUA 7REQA 3GLGE 1OXKB 4BL5A 5AVVA 2EYUA 2SLIA 3E7WA 3VA7A 3IPXA 1NUQA 5D7BA 1T2FA 2YC2C 4IJQA 5CAEA 3I9MA 1AS0A 2VXRA 2Q3LA 1XZIA 4XD7D 3IH5A 2W58A 3JQ8A 2Z57A 4LLOA 1Z2NX 3CYFA 1MA3A 2KLHA 3SQDA 2XQIA 3U3DA 5KREA 2VUCA 3SEAA 3S7TA 2XYHA 3MGUA 2HSJA 1Z4OA 3CKMA 1X33A 3RJ2X 2W2TA 2YZ2A 4EMTA 3KK0A 3GLFB 1VCHA 2I6TA 5IAJA 4TWRA 4HAVA 4GL2A 3E6DA 3O8QA 3MTGA 1GA4A 1ZN2A 3DOEA 4QGAA 1N6HA 3EEYA 1NQ5A 1RL3A 3BF7A 1KI6A 5ERGB 3WLLA 2VZ8A 5JROA 1YAHA 3AVSA 4XSVA 4ZT4A 1R8YA 1O91A 2EC5A 1C7IA 3WZ2A 2JIBA 4EVIA 5FYIA 4INOA 4PW0A 2REOA 5JZGB 3KXLA 3P0HA 1LV7A 4K0RA 4DIKA 2WAMA 3JYHA 3BFPA 5A5DA 2XOMA 1W7AA 2D5AA 3AETB 3U75A 3SBXA 4LO6B 3SM3A 4WOKA 4AMYA 5IUNC 4ARZA 4KFRA 3L4BA 4ZO8A 2RHDA 1NSYA 2J6CA 2AFIA 1GRQA 2V5YA 2R751 1WHSA 2WJYA 4CN9A 3NTRA 3WNDA 2H0RA 2Q9BA 4YNBA 2KWIA 4KYVA 2NUBA 3AJYA 1XO1A 4DIFA 5BNOB 5L45A 2XTJA 3M81A 2ZBEA 5B7GA 4Y5SA 2EFEB 4KH1A 4AKHA 4JZRA 2H5EA 2FMKA 3GL9A 1IDN1 2BFNA 2XUHA 1R8SA 5HG0A 2XY4A 2H3EA 1UXKA 3LC0A 2ZBVA 1VCMA 4C2TA 2IXFA 1E5QA 2BT4A 4DRZA 3WBJA 3K0BA 2HQSA 2O50A 2PKWA 4UCFA 1VPDA 3AZPA 1JQ5A 2RHRA 1TJNA 4TMWA 4L95C 1UX6A 3NIBA 5BNWA 2WBKA 3UKOA 2HR1A 4OHYA 1AVTA 3BOPA 2F1RA 3H1MA 1FFYA 3TN7A 1EDDA 1J59A 1WSAA 2NN3C 3L0OA 2VP0A 4Q3CA 2VTFA 4RD0A 3K70D 3NFYA 3EGXA 2O5RA 1QO0A 1M0TA 1L1FA 4ASUD 2WMOB 2PAFA 4OHVA 1G5RA 3KYDA 2VXYA 1OI7A 4GLFA 5FZGA 3SH3A 4D0NA 4QT6A 2GA8A 3E15A 3N2IA 2ZOSA 2OLJA 2QRJA 1ZJ5A 3VQTA 3AMNA 2RI1A 2ZRHA 4JYPA 3L6UA 4TLDA 2EKPA 3S29A 4JBHA 2VDWB 1PJLA 4FQ8A 2H51A 1JEDA 3UAYA 5FT9A 2J1EA 1BBT2 1SQ4A 5GLTA 4Q3EA 4DQAA 4K1ZA 1TM7E 5FOUA 4Q1VA 4ZCSA 5IDVA 5IDWA 4W6ZA 4I1OA 5EN4A 4IINA 4UAPA 4BNYA 3GEPA 5I3CA 1PMIA 4JVOA 5KNDH 1J09A 4C7OA 3T4PA 1SBFA 2VCYA 4QPJC 3FHJA 3JRXA 1QLJA 3GUZA 3SEQA 1RUJ1 2EW8A 3HEMA 1QXJA 2WNVB 1GPLA 2YJTD 4AY6A 1SM4A 4YUYA 1Y80A 4ESHA 4IZIA 1RC6A 1R37A 2XONA 2Z9CA 4WZAA 2JI6A 4FR5A 5LB4A 1UWVA 2ZIGA 1Y48E 1RTKA 3QVUA 3X1WA 1QYIA 4DBVO 3EBOA 3TMYA 3OUUA 5EJEA 5DWDA 3W2GA 4IEZA 2E6VA 3QKTA 1OLOA 3L92A 4JR0A 3JYOA 4CPDA 2RE9A 3ZLVA 4MXWB 3VSAA 1G5IA 4CCMA 4J16C 1JXMA 3HVKA 4BQWA 1VP6A 5DM4A 3ZXKA 3BMNB 4KZPA 5IVDA 4URUR 4JLMA 2H07A 4RQAA 2I8LA 4FYXA 3W3AH 3OEBA 1RQ7A 1C7FA 1U3CA 5COQA 4IUBS 1TM3E 2R8BA 4DJAA 4MW1A 2QRMA 1Q7GA 3CQOA 4DEXA 4RVDA 4HGQA 4UHJA 2O7VA 1YRAA 4GEKA 1OQ1A 2CNKA 1Z2EA 4WCFB 1UPSA 4UM9D 5BSEA 4EMBA 2YMLA 1UQUA 4DMRA 4YQZA 4PQ9A 4JLBA 4AEDC 3I6BA 1WUHS 3ANLA 2HMSA 3C8ZA 4YP5A 2F43A 3GQBB 1KI6B 1OC1A 1XD8A 4QDTA 3VNAA 1RQXA 1V9U1 1ASJ2 4IP0A 1Q22A 4WM8B 3K05A 3BA6A 3MWDA 5IAGA 2I65A 2ZHNA 4BKRA 2H92A 2PGIA 3VLBB 4DLRA 3HV0A 3I0ZA 4HDSB 3ZYCA 1BW9B 1A7KA 2A3YA 1C30B 4MVJE 4I2OA 3WRYC 3LX6A 3EARA 2TUNA 4CUJA 4HMZA 2FJPA 5BO5A 1OZHA 1EA7A 5K3DA 3ZI4A 2BHLA 1SDWA 5YASA 3FUTA 4INPA 4LY3A 2AG5A 1L4NA 3PL5A 1X42A 2WNUB 5T3NA 2DFCA 5H83A 4XQDA 2ABWA 5AXBA 2B82A 3FHTA 5EHNA 5AOBA 1RLIA 4KI7A 4QULA 4IGEA 3KQQA 4S0XA 5EP4A 3PQDA 4YYOA 4NFHA 4EFKA 1BKZA 1H0BA 1ENXA 1UJBA 5BMVB 4XGRA 2ORXA 2IV7A 3O82A 1QOTA 2QAGA 4NAVA 3A27A 2D2VA 1DKOA 2YCLA 4WT7A 3QFFA 2GN7A 2VRCD 2I7VA 3WOVA 3SS8A 3L6DA 1UZVA 4OYUA 1N2EA 4YCCA 1UC9A 3MF9A 3Q6NA 3TZKA 3ETJA 2O8FA 5C7OO 3JWEA 1G2OA 1O3TA 3LY5A 3WYCA 1JR4A 3KOXA 2QGFA 1K12A 2HEYF 1W8HA 3FCUB 3PS9A 4XZUG 9LDTA 1QE5A 3F8SA 1JDNA 2H7YA 1GNRA 1RJGA 1X1EA 5IMBA 3GPCA 3WUDA 3ETCA 3OPYI 1N1DA 2CT8A 1OLUA 1JU4A 3NCTA 3IN9A 4EN9B 3E9QA 1JQDA 4HEQA 3OP4A 3KV9A 4QXOA 1UAIA 2XHNA 1PQWA 4IAOA 4LR4A 1GR3A 1HE5A 2D3WA 3FLPA 4IMJB 3KS9A 4FI3C 5F5XA 1VFPA 4YMSA 4G3XA 4OYHA 2GZAA 1S3SA 3FDZA 1W2AX 5KJCA 2MDTA 4Q02A 1YUNA 4B87A 4DUPA 2VE1A 2OR3A 4HO1X 5K8SA 1IIBA 4ZOLB 3JAWA 3T7JA 2HSEA 3UENA 2QUOA 1RBQA 2ZAGA 4IVNA 3P2IA 2O52A 1LVGA 1WSBA 1ZM9A 5AHRA 3HNRA 3VD9A 4YP9A 2A5JA 5EHQA 4JEHA 4R40A 4MGIR 4XWWA 1CDEA 5CFCA 3BKZA 5K51A 1UU5A 1SU4A 2DFKB 2RGYA 5EERA 4CMIA 5A3NA 3VL8A 1MUUA 4X66B 3QLVA 4RK1A 3VOAA 1W93A 1CRZA 1XALA 3S2SA 5TVKA 2ZUBA 1D1TA 1XNQB 2AIRA 3A9VA 4ZVNA 2OV2A 3KHUA 5IM4F 2GHRA 4Y2UA 4POOA 3ZDYB 1NZCA 4G3YC 3R0XA 4LHLA 4NJ4A 1QHGA 4GB31 4H0FA 1W2OA 1LPPA 4G8BA 4AN0A 4BC1A 1DUSA 4RA6A 1K5DA 3DN7A 2DFLA 1PQPA 5FLEX 4W6XA 4WHMA 1YQEA 2R8PA 3CBNA 4I9UA 4EHBA 1E3DA 3NMBA 1DBVO 2RGEA 3N2EA 4IRXA 2I67A 4MCHA 5FOTA 2MU1A 5B7QA 4K8RB 3WI7A 2WF5A 3PC3A 2BTVC 1NM5A 4C0BA 4JMPA 4XETA 1UPIA 3ZD6A 2OZKA 1K3TA 4P7FA 3Q72A 4LRWA 4KW7A 1EPUA 4ZVPA 1UJMA 3TZCA 3HYRA 1MACA 3V2U