2WAOA

Structure of a family two carbohydrate esterase from clostridium thermocellum in complex with cellohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
GILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDSITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2waoA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2waoA02
3WF1A 4OAOA 1SHWB 1CX1A 5LA2A 1L7RA 4BDVB 5JUVA 3OEBA 2VO5A 4K7JA 1UYYA 4IYJA 4JHLA 1JHJA 2DCKA 1SDDB 4D0QA 2C26A 4A41A 1F4HA 2VMEA 4QX2A 2YC2A 1BWPA 5FUIA 4M4RA 4A45A 1K42A 1K12A 2WN2A 3I2IA 2WBKA 4A4AA 1UMIA 3WEZA 2V4VA 4LHSA 4P00B 3WF3A 2VCAA 4CU6A 4ET7A 1UZ0A 2EICA 2APJA 5JXIA 3CIHA 3ECQA 1CZVA 1YQ2A 5C7GA 1UXXX 5G04L 4ZZ5A 3A7QA 1CIYA 3E1F1 5B5SA 5DQ0A 4CU9A 1GUIA 3LEGA 3T2QA 3LEKA 2Y6HA 1H6YA 1P8JA 3VDCA 4DXRA 2R7EB 4XUNA 2VCBA 3IDAA 4BK4A 4PPYA 4QDQA 2J1TA 5EJ1B 1D7PM 5JMOA 3NNGA 1PMJX 2BERA 3DYOA 1EUTA 2VCCA 3OGVA 1JZ3A 4JKKA 4MOAA 5CYYA 1BWRA 2RJ2A 1J83A 3A23A 1ULOA 2WYSA 4QDSA 3WF4A 1WABA 1UMHA 3HNMA 1JZ5A 3HNBM 1NUKA 1SG3A 4OMDA 4XUTA 1ZMBA 2J1UA 3HP4A 3DT9A 3IIIA 3THDA 3ZM8A 3WSOA 3C8XA 1IVNA 4CUAA 2VZSA 2QQNA 3VD3A 2VZOA 2VZUA 4MADA 4OAPA 3MILA 1DEOA 1EUUA 3WNNA 3CDZB 1O8PA 2W1SA 4ARXA 3DT6A 2E31A 2JKXA 2L9LA 3GXUA 4K9SA 3EYPA 3T08A 5HOEA 4I8IA 5G05L 5BN1A 1K7CA 4JX0A 3HEIA 2ZXQA 3I3DA 3OEAA 1US2A 3A21A 5B4XA 1O8SA 4D8MA 5IJRA 3MV11 3K4AA 4QX3A 2OKXA 3WNPA 1LNSA 2ORZA 2X05A 5LA1A 2XONA 2W1WA 2J7MA 2WN3A 4DXTA 3SLRA 3WF2A 3LPGA 3HNYM 2XHNA 1U8UA 4M4PA 1IQDC 1DYOA 2B9VA 3CKHA 2E33A 3BGAA 3A22A 3SKJE 2J1EA 3I3BA 5HPOA 2O14A 1UWWA 1R64A 3I3EA 4KI5M 4L0PA 2LW8A 3DECA 4XVHA 3UNPA 2Q0SA 2W94A 1JU4A 1JZ4A 2DCJA 2VZQA 1OD3A 4QX0A 5HXMA 1UX7A 4NRDA 5J1XA 1L7QA 4PF1A 2B4KA 2WAOA 4CU8A 3C7HA 1JYVA 1US3A 3WNKA 4MGQA 3I2JA 1PP4A 3I2HA 1V2GA 1GQPA 2KD7A 1CZTA 2QQOA 4KMQA 4AG4A 3GGLA 2JE8A 2YC4A 1T2XA 1BHGA 4CUBA 5A1AA 3LPFA 3MBWA 4JJ4A 4BK5A 1OF4A 3ACHA 1XNTA 3W5MA 1ULPA 4XZUG 1OF3A 4P02B 1W8OA 2QQIA 3UESA 1OT5A 3CZUA 3IAPA 3D3AA 3W7VA 1YZFA 2J22A 3MO4A 2W9XA 1K45A 1W9WA 3FN9A 1PX3A 4K3UA 1UY3A 2PQSA 4E8DA 2DDUA 2W46A 2JD9A 1UYXA 2VMFA 4GZ9A 3ACGA 2VTFA 1UY4A 4ARYA 5IHRA 4XUPA 5IFTA 1W9SA 5CZKA 5JXHA 2W1UA 3WNOA 4GWIA 2Y6LA 4M8KA 1VJGA 4Q7QA 4HYQA 4RW0A 2EIBA 2ID4A 3DC7A 2VZVA 1UY0A 4P5YA 4CUCA 2VMDA 3HJRA 4A44A 2QQJA 4W50A 2J1SA 2RVAA 5DN2A 4LQRA 3T0BA 4TX1A 2JDAA 2X10A 3OGSA 4HF7A 2C9KA 1J00A 2ZEXA 4JHZA 4DEVA 3HOBA 5EIYB 4MO3M 4TXWA 2CDPA 4JGGA 1NKGA 3MV01 3P6BA 3SKVA 3C7FA 3OB8A 1XNAA 2VPTA 4IUGA 1H6XA 3ACIA 2Z4FA 2QQMA 3T0DA 4JKMA 1OH4A 3BN6A 2C4XA 4RYDA 3CQOA 2E32A 2VZ1A 1NX9A 5JXJA 1W9TA 1ESCA 4UOJA 2EIEA 1XC6A 1VYHA 2Y6GA 1UY2A 4KWUA 2LS6A 1GNYA 3VD5A 2W5FA 2XQXA 3DYMA 4W8JA 2BBAA 2W47A 1JZ7A 5EJZB 1DLCA 4OUEA 2W92A 3WF0A 4A6OA 4BXSV 4S1PA 3W5NA 2YG0A 1JZ6A 2BGPA 2BGOA 4JKLA 3DCIA 3PUIA 2YFZA 4ZY9A 1PX4A 4ZZ8A 2VMCA 3FHAA 4Z2AA 4A42A 3DT8A 5A4AA 2WO1A 3U37A 2VZPA 3C7OA 1GOGA 2Y6KA 3HPNA 4DEQA 4JKOA 3VD4A 2W87A 4GWJA 2W3JA 2CDOA 3OG2A 3CMGA 3JXSA 3VD7A 3SEPA 2J1RA 3GM8A 1KEXA 2WO2A 3K4DA 3NQHA 3T09A 2WO3A 1UXZA 5I0DA 4JJ6A 5DPNA 3I2GA 2WQ8A 3I2KA 2V72A 3LEIA 4YPJA 5JXGA 1GOFA 3C1UA 3CZJA 2VOTA 1W0NA 2W95A 2RV9A 4XURA 2ORXA 1PMHX 1K3IA 4E8CA 4H08A 3LQCA 1F4AA 4W4ZA 4K40A 1TG7A 2QBXA 2W91A 2Y64A 2WZEA 2X09A 2HSJA 2WABA 4OYUA 3KVNA 3NRUA 1W99A 3WNLA 3ETPA 4UI9L 3K77A 4DXSA 5B4NA 1J84A 1KGYA 2VZTA 3OBAA 2Y6JA 3MUY1 4DUVA 4DUXA 1HN1A 1RYYA 5LCWL 1TVGA 4UAPA 2W1QA 1DEXA 3PT5A 4CVUA 4AAXA 3THCA 1JYNA 3AC0A 2Y8KA 4LKSA 5DMYA 3T2OA 3WQBA 4RN5A 4XUOA 4OZOA 1BWQA 3J7HA 2V5DA 5CD9A 3C7GA 4QB1A 2VJXA 3NJXA 1W8NA 1ESDA 3P1IA 2VQUA 2ZEZA 5JD3A 2BZDA 1JRLA 4P08A 3I2FA 3FHQA 4LPLA 3VDBA 2XOMA 5F7UA 3P94A 3K46A 1JU3A 2Q0QA 2QQLA 2ZEYA 4RSHA 5C70A 4FI9A 4PT6A 3IB3A 4Q9AA 1GMMA 1ESEA 4DUWA 1I5PA 4QB2A 5IFPA 3SEEA 3LE0A 2HYXA 1CZSA 2VM9A 1JYWA 2J1AA 4PQQA 4QAWA 2YFUA 4QPWA 2WDBA 2EIDA 2WAAA 3C7EA 4QDRA 3NJVA 4QB6A 1JZ2A 3VD9A 1FXWF 4XUQA 2YB7A 3EB7A 1O59A 3PUHA 2ZEWA 1JYXA 1MPXA 3HN3A 1UYZA 4ZXEA 2J1VA 3T2PA 3BZWA 3ABZA 1JI6A 1WKYA 3GDBA 3K75B 3FL7A 4QX1A 1Z8HA 4BJ0A 1GOHA 2VZRA 3DYPA 3OGRA 3UETA 1ES9A 5LA0A 3IAQA 2VL4A 2VR4A 3K4ZA 5JR2A 2VZ3A 4OMCA 2VC9A 2QQKA 3ACFA 3F2ZA 4CU7A 5C71A 1GU3A 3MUZ1 3VDAA 4TTGA 3RJTA 2WZ8A 3I97A 2WUHA 2HLEA 1FXWA 4HG6B 4A3ZA 1XPWA 5IYYA 2E26A 1NAEA 3T0AA 1UY1A 1WCQA 2VQTA 3WNMA 1JZ8A 1DP0A 4MGSA
chains in the Genus database with same CATH superfamily
4EX6A 1MNAA 3VV2A 5ICMA 2EKQA 2ZRNA 2Z6QA 1DUIA 1KVUA 3CS3A 3B48A 3L84A 5GM0A 1SVSA 2GRJA 2NTYC 4M4SA 1D2AA 2WN2A 5KO2A 4V0MA 3KNZA 1XXLA 1C57A 1FBNA 3A9WA 3A7DA 4RY0A 3ADDA 5KU1A 3IE1A 4PG8A 2CKDA 4J7CA 1GTRA 4IRMA 5A1LA 1H6YA 1C3OA 1YNOA 1PK6C 3EGDA 3L6DA 3MMPA 1UPFA 3QE2A 4RPJA 4KE8A 1MZ5A 5JSZB 2VCCA 2OAP1 4PRLA 2QRLA 1GTG1 5KVAA 3A23A 2ZGUA 4G89A 2XDYA 1JH9A 4BZZA 4MKRA 2X14A 4N48A 3OEEA 4C1NA 2ZAHA 4BO5A 2WZR3 5FMOL 3DWGA 5A70A 1IJEA 3L6UA 1JSZA 4X6XA 1RI3A 2HL6A 2FF7A 3GELA 4XPIA 4FDAA 1QJ4A 1RP1A 4UFNA 1FFGA 5BRNA 2GSYA 4TLFA 2G0NA 3NT4A 1VSUA 1GYKA 3ZJYA 3FB1A 4ACAA 2CD7A 5FY7A 1V3QE 1PFYA 4IGEA 5CVVA 1U1GA 4YC7A 4KAJA 2DETA 2H63A 3DWEX 1RTTA 4X44A 2VDQB 3LT4A 4ZIRA 3BMXA 3FOEC 3WGQA 1ZVMA 1S3SA 1NY71 1OD6A 3OF2A 3EJ6A 1SB8A 4DCOA 4HSEA 2OXEA 5T64A 3PWTA 5LB4A 1H1TA 4R9DA 2JGKA 2I3GA 1Y7PA 1A9YA 3WYEA 1YBHA 4QX7A 2C2BA 2BJSA 4X90A 2H48A 2YXSA 1O8CA 1EVZA 4G1BA 3D3EA 3LHFA 3UICA 4YZ3A 3E7XA 2UYBA 1Y7TA 2DQYA 4D8VA 2D5FA 3SBEA 4IMRA 1JR2A 4WM7C 2FPGB 5E3IA 3OZSA 3AP6A 1C1XB 5CKNA 4ZK6A 2WJYA 3IBFA 3I45A 2P34A 2QAGB 1WL8A 2FR8C 1YUBA 5C80A 4PFQA 4QYXA 3G8YA 3TVYA 1S1MA 1WCIA 1DGRN 1AHSA 2IU4A 4TUYA 4I55F 5E6RA 2OFOA 3C7FA 1E9VA 4L4SA 4UEKA 4HYTA 4R5HA 1LI5A 2B94A 1FEZA 2XJUA 2J3KA 5MF6A 3GAZA 3I4FA 2VPWA 4L8VA 1PK8A 4AHXA 3GYDA 4EJ0A 5FPKA 4ASMB 1GRQA 3GOHA 1NUPA 4BXSV 2FG7C 4JOCA 4TSVA 1KRHA 4JWTA 3WB9A 1W9HA 3RC3A 3ETEA 5DCUA 4P9YA 3L8HA 1AR63 2FE1A 5J40A 1AH2A 5T57A 3NAMA 4H18A 4OU5A 3D7LA 4WK4B 3RROA 3S2UA 2Y60A 4F04A 1QP7A 4GULA 2CMDA 3MWJA 1HB1A 2W2LD 2QRVA 2CF6A 2FRDA 2J7PA 3HB1A 3OIGA 4E8CA 4OVKA 1G63A 1Q16A 3Q8LA 3ETPA 1JHRA 3L7DA 3WLEA 4DG5A 3VDDC 1U99A 4Y6QA 1IONA 1JJIA 1UKAA 1EDEA 2QUKA 1W39A 1P5JA 2B92A 3LZCA 4UHBA 4Q1AA 4C6RA 2B45X 3DPRC 5CD9A 4XM0A 1S4CA 4CXXA 4XTRA 1U1EA 4JDOA 2V7XA 4GA9A 4BMZA 4P9JA 1UN1A 3FUOA 1VL6A 4LA3A 5C53B 1EE2A 3LOQA 4RGBA 4YR7A 5CPBA 3UKJA 5DBHX 5FJJA 2GK7A 4P5HA 2XJRA 3ADOA 2VDWB 4KPEC 4MV9A 4KFTA 1UPCA 3DSRA 3HV2A 5DGDA 4AEKA 1JYWA 3HKBB 2DZDA 3C7EA 4EPXA 2NZYA 4GR4A 2R7MA 4XF1A 2G0TA 1BVYF 4K9PA 5LQAA 1SG9A 2BFPA 4R8LA 4WXPA 5MN4A 1UJNA 5C9AB 4DT1B 5FREA 1V5IA 2IWGB 4CV1A 4P3OA 1IE3A 2MSEB 2XA2A 3P26A 3RQSA 1DQ6A 1ZD1A 1Q7EA 3EAGA 4GVPA 3OGGA 4CM7A 4GKYA 3HKDB 2CJWB 1C5HA 1XZIA 4YJGB 5CBPA 4DSTA 1C3HA 2RGCA 3WLRA 3OIFA 1H2RS 2G28A 1HKUA 2O8CA 4OFXA 1NQJA 3QVOA 1IG0A 4QJBA 5K99A 3IKMB 5FBVB 3JB4C 3EEIA 4I1SA 5DM70 4X6LA 1DHRA 2VTXJ 16PKA 2ONCA 2X5IA 2JIQA 4AJEA 1XU1A 1YFZA 3VN4A 4A4AA 3H2GA 1QFXA 3QVTA 1EAH1 2WY2D 5FY4A 5JXIA 4ERNA 3EH1A 1CZVA 3Q2IA 2X7HA 2IGTA 2IV7A 5LYJF 3BF8A 5KAMA 3C45A 1J3PA 1RXVA 4LMAA 1V9LA 2E5LB 1O3RA 3TW8B 2CMGA 2C9BA 1RHI1 1LZKA 4E30A 1VJ5A 3INGA 4JLKA 4CG2A 5KJCA 2R00C 1Z4JA 3GLHA 1S7CA 3TCNA 2ZYGA 3ZGLA 2YCBA 4ON9A 4HEQA 1QHXA 3THRA 1Z36A 3AKDA 2FCVA 4UMDA 3OFJA 3WK4A 2IUUA 4RY8A 2Q1ZB 2VMIA 1IDOA 2PPVA 3NKFA 2F3QA 1EY2A 1MTZA 1IQRA 1JTVA 1Z0JA 3MFAA 2WYVA 2RHCA 3O83A 4L0DA 3OQPA 1OHFA 1E94E 2R16A 4ZHNA 3PNOA 2CDBA 3TLYA 3NQ41 1MJHA 2EQAA 5BMVF 5I7EA 3BYZA 1U2PA 4XW3A 3LQRA 5T6MA 1GNQA 4MVJA 2R063 1YO8A 2N75A 3RYFA 1FDSA 1MNQA 4GM4A 5T8KC 2VHWA 3MT8A 4WNYA 1V11A 4R7TA 3CHXA 3GT3A 3PPIA 3N8NA 2VHCA 3FUUA 1WPXA 2Q3MA 4YHHB 4G0VA 5JOXA 4QLAA 1NY6A 3LY7A 1DOHA 3F98A 3S1AB 2JLCA 2W48A 1S3FA 1SVIA 4GLFA 4M1YA 3LDKA 2O52A 3C7KA 2FN9A 3SDBA 1PIV3 2I8LA 3A32A 4CCEA 2HV9A 1UJ6A 2FEMA 1ZA1A 1QG4A 4TXMA 4CIYA 4ARSA 4XHBA 3CISA 3WSVA 3IP5A 1ZOLA 1TEZA 4KPYA 3BMQA 1YS2X 3PE4A 3TWOA 4B09A 5BWLA 1G9TA 2WPDD 5D1HA 1W76A 1RM4A 3B1YA 1ZESA 1HI9A 3RUFA 5AIAA 4IV1B 1Z7YA 1QJX3 1RUI1 2P9YA 3VAAA 1JEYB 3VR6A 3L6RA 5DSZA 2FFHA 3ANXA 4KRXA 4F3NA 2BKXA 4LJRA 1IIRA 1X0XA 3OZRA 4WM8C 1WWKA 1UWVA 3GEHA 1FOD1 3VYVA 3KQUA 3QVGB 3BILA 3GGJA 1NE6A 1ETUA 2C7BA 3GLTA 4K6OA 3HLYA 4LRWA 4I2OA 1P7VA 2JIZA 2ATFA 1NM5A 4BO2A 2D5BA 3PEFA 2V65A 1WB4A 1B1AA 3QHQA 1IHOA 5BW6B 2BTOA 1GTL1 4RF4A 4HN0A 2WFMA 3N0TA 1PGSA 1JE0A 1L4MA 3HPNA 4Y2PA 4TZ6A 2ABWA 1C5IA 1MLDA 2C2XA 3U75A 1Z75A 4GNKA 5TARA 4FFRA 4RQTA 1K8YB 2PT9A 3T7EA 4EB0A 4FFHA 1GKIA 4KSCA 3FB4A 4HZFA 1TQ8A 2B42B 3VBOC 4TL7A 5IZCC 4M9QA 2HSJA 1CUXA 1O0SA 2HWE3 3K1YA 3BGDA 5DSTA 4FAHA 1KKLA 3Q7PA 1PDOA 1G7RA 3WNZA 1XD2A 1SD1A 2W6OA 3B1VA 2OAEA 5FX2A 3L7JA 1PVVA 2QB5A 1KK0A 4CCYB 1W5TA 1NN3A 3RHFA 2DQKA 1XVIA 4NMXB 1QRRA 1ZNXA 3EWIA 1IKPA 5BNPA 1SPBS 5EV7A 3UFXA 4XCVA 3LYUA 4KBFA 3LL7A 2Y1WA 3R7DA 1FVFA 4QDXA 4LLFA 5CT9A 1KMCA 2BHNA 4QRDA 1TQ6A 3RU2A 4RHV2 2QU8A 2JLRA 1YONA 2WLPA 2SKEA 1KD7A 1IXYA 2Q6KA 4CKCA 2FHSA 3L49A 4JZRA 1DAEA 3FTNA 4TLMB 2JHPA 4I19A 3TLGB 4RKQA 4QO8A 1GR0A 1KR2A 3GK3A 2IV3A 5H68A 2ENUA 3MWKA 1N1DA 3HB0A 5LZ2A 5BSUA 5KJ1A 3DLAA 5FMOS 3KELA 3IUJA 2XBUA 2NUAA 4YRFA 5THKA 5HV4A 1WIWA 5L95A 4R1QA 3NLLA 5FZ9A 3WWOA 1GZ3A 3PUKA 4AS3A 4QX5A 2VOKA 4HN2A 2CDAA 4X97A 2HBRA 3PEEA 2HWC2 4WN9B 3WF3A 2YBDA 4HQKA 1U8FO 1NATA 1SOWA 2P5TB 2NU7A 3CTMA 1UZ0A 5BMOA 2Q5LA 4XF0A 1JHMA 4JQZA 2BCEA 2I54A 2PMBA 1EQ2A 3SC6A 3V1LA 1CPYA 1YJXA 2JB8A 3BWDD 1ADJA 3THPA 1T2NA 3GO4A 2Y99A 4BLPA 1TAHA 1KI1A 4RF3A 1SPXA 3OF5A 1BOOA 3BIEA 1Q74A 5H3CA 4Z9FA 3JQFA 1J49A 1C1DB 4QTUB 1E0SA 2XUOA 2ZB4A 1CY1A 2G6TA 3IIIA 4W82A 2EGHA 2HLNA 3NONA 3E7DA 1GQQA 4XR4A 1OCEA 3ZZNA 5EE0A 3K6JA 2C2MA 1PFWA 4JFAA 1J8MF 1CS0A 2JKXA 1JWAB 3A31A 1U5AA 4LMBA 2YV5A 3BH6A 5F37A 1OLSA 1DBPA 4C07A 1CD5A 1MOQA 3WNPA 3ZHOA 1NVKA 5AW6A 1CRPA 2CMHA 3M34A 3VPAA 2C98A 4W6QA 2QLBA 4YQFA 3ROXA 2A88A 2I4RA 2WJ6A 1XJWA 5HWSA 3LAGA 1Q0LA 3C4JA 4PM4A 5HPOA 1QIGA 4BO4A 3M0EA 3OZXA 5AM0A 1RYMA 2C0ZA 1POWA 3OMLA 4RD1A 1BXRA 4ND2A 4NBSA 4LFAB 4QDJA 2X8JB 4BRZA 1DUSA 2YXEA 3U17A 2ZB8A 1L1FA 1UADA 3RADC 2B5WA 3JQWA 3CGWA 1WMXA 1GZDA 3G02A 3ZBTA 3ZHBA 4MVJG 1Z68A 3VUEA 3QKUA 4FT4A 3W7VA 3K9GA 4GKVA 3O9VA 4NE2A 3ZZTA 1YBMA 4DLPA 4ZAXA 5DM2A 1G1MA 3QFCA 3MGAA 4MUIA 5HIKA 1V8BA 2R7KA 1PEAA 5EXXA 2NQTA 4E5UA 4NCNA 4YJHA 3DC7A 1JBQA 1JXNA 1JHOA 2NQ2C 1FMJA 1LFAA 5FORA 2W11A 2A9FA 4NHYA 3CVUA 2ECFA 3LDGA 3TAUA 3KPYA 2XZOA 3C16C 2CE2X 4HGOA 4AY2A 1K5GA 4XEUA 1E4EB 4PYRA 1YIAA 3HV0A 2VPZA 3BXOA 4PTZA 3G9QA 1NJ5A 3H4IA 2Q41A 4FZVA 2XUAA 5TY0A 2FY8A 1HQYE 1M34B 4IY1A 3L2YA 3TIIA 2PKRA 1JR6A 1GRRA 1RWMA 5DTEA 1SLLA 3K15A 4L3OA 4RORA 1ZCAA 3CX7A 1IC6A 2FFJA 4BUCA 1QUEA 1R6VA 4P86A 3VHOA 2YHIB 3ZWXA 3GLIE 2WYUA 4JH0A 1AQNA 5DBFA 4E5NA 5KKNB 2PSEA 4FGZA 4BAUA 1IEWA 4DC0A 4EW3A 1PK6A 4M0FA 3L4BC 1H4SA 4OGKA 1DCMA 2ZIGA 1NJ8A 4F91B 1FQOA 4UNPA 3V8RA 3U3XA 5HBGA 4B32A 3DYVA 2Q1YA 1FJGB 2OYZA 2GKOA 4RKRA 4UMFA 5F5IA 2ZS7A 1J06A 2PGOA 4CMBA 1OR8A 4D3ZA 1AMOA 3VXKA 1MOPA 3QVKA 3ETHA 3U62A 2XWQA 1LSJA 4AHYA 2D5AA 2PQMA 2RGAA 2R8ZA 3H99A 2BGTA 1OBNA 4JC5A 3HR4A 4BU1A 4J4BA 3G1WA 2YHJA 1B09A 3GUHA 4XIGS 1SHZA 4Y1RA 4YJ3F 4CDQA 3SHQA 4BO3A 3UV7A 3WGIA 1SQ0A 1C1LA 5MHTA 4N0MA 3LGAA 3RVQA 4L95C 4R3UC 4ND4A 2CLKB 5EJAA 4P9NA 2BFFA 3S5UA 3CZQA 1EUDB 1TYBE 4RD6A 1GZCA 1NCRA 3ID6C 1AYN3 1BK0A 3JQ8B 1POQA 2FWNA 1LQTA 1P6QA 1U2TA 1S5PA 1UU5A 2I6FA 4ZU6X 2XTMA 4IMIB 4YRTA 3OJBA 3ZQ6A 1KRWA 3OQMA 1K63A 3HACA 4YI5A 4WM7A 1Z15A 2QT9A 3VR4A 3UAZA 3SZGA 2CVHA 4FC6A 3RRNA 1WPQA 1R091 3MYXA 5IYYA 4MQFB 4PNPA 3KJZA 4DA8A 4PCRA 4TLEA 4IV8A 1YB5A 1PJRA 4K7JA 5EY5B 1CUBA 5LMUB 5LSAA 3ZI7A 4HNTA 1N6NA 1Q7GA 3LTNC 4Q18A 2QF7A 1K42A 3VR2A 1ACLA 1EINA 2D6NA 1Z5GA 2VH1A 3AUFA 3HJNA 3X2EA 3W8NA 5T4BA 4FPOB 1TT5B 1ZIDA 3ITQA 3IC5A 4I30A 1TKBA 1NVMB 3K51A 1QF9A 4EPWA 4CM5A 2I2FA 1QOSA 2IS1A 2AUTA 4NQZA 4HDOB 4M0KA 4CMCA 3K30A 3PEVA 5IABA 4W5RA 4P4LA 2UZ1B 3C8XA 4RA9A 3DHEA 4RK0A 3QH6A 5FLJA 5KX5F 1DWOA 3R5TA 1PVDA 1CVLA 4LQ4A 4V2IA 4AG3A 2PCLA 5LXTB 4L4RA 1N6PA 4LIUA 3QEAZ 5JDIA 4UHDA 2ZWVA 1NTRA 3PCRB 5A7OA 1XRMA 2GBLC 4LRQA 3I1IA 3E9DA 3VNUA 3KS9A 1F9EA 1BS9A 4ZD6A 3CKLA 1G7SA 4WW0A 1M4WA 1UDCA 2ZRFA 1VBC3 3CZ4A 1NC1A 2J3IA 4UCWA 3DVSX 2GM9A 2Q1UA 5FO9B 1SCUA 4WT7A 4DSZA 4BTLA 5CLJA 1WKVA 3KB8A 1CF9A 5KNBD 2GSDA 4GC9A 5DSXA 3LBNA 3JS5A 2C24A 2P65A 1PHRA 5D3MA 1RSZA 3BQ9A 4F56A 2A3YA 3TXXA 4PO9A 4YRNA 3H5NA 1XYOA 4I3PA 1V9SA 1ID1A 2IU6A 2D43A 3JASB 2B4QA 3DAYA 4AP9A 1GNRA 3W3ZB 4MROA 3Q15C 3U9LA 4OGGA 1VP6A 2H6CA 4O2BB 3T4XA 1E1CB 4P02B 3AF5A 4HGPA 1T5SA 3KC2A 2NZ8A 2AEFA 3Q8BA 1ZGGA 2R1UA 4O2AB 3R4SA 3ACLA 3I3OA 1L2TA 1TGYA 1E1LA 3VI3B 4DS3A 3FUXA 1A98A 2VOXA 2WHPB 2OZ6A 1GRVA 2WZBA 4Q5OA 1XDWA 3MUNA 2PSSA 3LNCA 5K3OA 5AVOA 4Z4FA 2VATA 2JLXA 5CYPA 1K8ZB 3CIOA 1D6MA 4FQ5A 2Y38A 3G6WA 3G0DA 3TB0A 1ZGCA 1REEA 3TOSA 2VJNA 2G08A 3BHIA 1WUYA 2RGYA 1J99A 2J0EA 3HIFA 3VJRA 2I7CA 4QRHA 3B9QA 4U5QA 3I61A 3L77A 1T5HX 4AMUA 4DFSA 1Q0UA 1XSRA 3AZYA 1E66A 1JPUA 2FEXA 1S96A 2BNMA 3PNSA 4CIVA 4XX0A 4Y7CA 1ZRMA 4CKXA 5DPNA 1PZFA 4HQLA 2R00A 4DLTA 4WIAA 5A6SB 4EIWA 4QTYA 4RL4A 4LXUA 2PLNA 2XCIA 3HO1A 1Q91A 1JR4A 2HPVA 2QMQA 4MK4A 2JJ1A 3V1YA 3EFOB 1PO23 4O9EA 1JYSA 1Z6QA 5IH3A 1KS9A 5AKIA 4ALKA 3A6DA 2GUGA 3IO5A 2UUAB 1R083 2ORYA 4JTOA 3CRW1 3F6SA 5J5AA 2FDGA 2V4AA 2Y0OA 1OBCA 3MUY1 4G85A 2NZVG 2ZAAA 4B81A 1PX0A 3JRNA 1SZDA 1E18A 3X29B 1EFDN 4TVBA 1F51E 1GKLA 4GRIA 2XQIA 5T8KA 1FYUA 1ODTC 1WD7A 2VTXA 3CL1A 4RL7A 5FTWA 4DUYB 1GO2A 2DX7A 4LUMA 1PHMA 4UTPA 2AD1A 2UXDB 4I08A 4DSOA 1QTNA 4BMDA 4ZEVA 3A2NA 4KXUA 2CY6A 4EY8A 3SBXA 4QWMA 2VJLA 5D5PA 4CRQA 3DE3X 2R043 1SBDA 4O4LB 3KB6A 4GOMD 3Q1LA 4GMXA 1E79A 2ZRBA 2GN4A 1UWCA 2DGDA 2NMOA 5I9IA 5GJCA 2WIAA 1QIFA 2CLCX 4D8WA 1C9MA 3VHXA 2VNGA 3O82A 4ZT3A 4P1ZA 3OA2A 3HXPA 5K3CA 4FYHA 1AR92 2ZJCA 3TIVA 2PU7A 2Q2OA 5JSQA 1VE5A 2FP4A 3WMEA 4NZNA 2X1LA 3VHNA 1OOPB 1NLUA 3ZXSA 3NW9A 1YI7A 3KV6A 5EMMA 1E3EA 3V4RA 3KOWA 2R9VA 3DZCA 2Q3JA 3RSZA 1YTLA 3NU1A 1S6YA 1S1CA 3NBFA 1ECPA 1SFNA 4CWAA 3V4FA 3E7FA 1DZIA 2R1ZA 4F1KA 5FBRB 1J22A 3H8OA 4CT4B 3K2IA 2ZGLA 1NONA 5FY0A 5DQ0A 1NMQA 4N3GA 3TRIA 4ITCA 4X5OA 1RKVA 4QYWA 3KQNA 1ILWA 3TDMA 3ZU4A 5IJ0B 3N6VA 3RSHA 3N2ZB 5SYMA 3OJCA 1NRXA 2BGRA 3OGVA 4S1OA 4AKSA 3WDUA 1BWRA 3UOGA 3GFFA 3N3BC 4UREA 3CH7A 5BXYA 3CSUA 2HBZA 3C2UA 4X84A 1CRQA 2IHUA 5IWAB 7AT1A 3CDZB 2JG8A 5B1IA 3INYA 2OKGA 2PVSA 1FFYA 3W2FA 1N34B 2YJ6A 2J4DA 4QPCA 3C6QA 3ITEA 3G2KA 1ODCA 3KPJA 3SLRA 5A3LA 1QG2A 3GFTA 3PK0A 5KQPA 3ZVRA 5GADl 2X15A 2E18A 3SCZA 2LW8A 3SXJA 1IWOA 3ZIXA 3SJCA 1BMDA 2A6ZA 4HFMA 4RVNA 4RZIA 2C84A 2Q8QA 3EVGA 1IZ9A 3OJFA 4KE6A 1UZNA 3S5QA 4CUBA 2HA6A 3IPCA 4V0LA 2GMWA 4Y5Z0 4DM3A 1D2QA 4K3UA 1R5OA 4JCOA 1H8HD 3IT0A 5CHEA 2G1UA 1DIHA 1L5QA 2B6NA 1BE6A 5JJCA 3FJYA 2OLKA 1GQFA 2AXPA 1QV9A 1IBRA 1IPEA 2F4NA 1P2FA 2JDID 2C9KA 4EZHA 5EJMA 4YMWA 4EAAA 4NN0A 1ISMA 1E7RA 3EA4A 1DQZA 2ZROA 4I7EA 5E6SA 1FYEA 3HXQA 3X1KA 1G21E 3NO4A 3C1AA 4QHBA 3O4VA 5M0TA 1ESCA 2YH2A 4UM9D 4Q4V3 4CIWA 4FBLA 1YHYA 5FZHA 3CV3A 2AJ8A 5AI8A 1Z4KA 4CMJA 4Z7JA 4JR1A 4LF9B 2QXTA 3WG1A 1JF8A 2VUHB 5BNQA 4LHXA 2OA2A 4J6FA 1PQYA 4HDMA 4I2VA 1AN0A 1X8EA 3C8UA 2ERFA 5LBCA 4KI7A 4QOFA 2V55B 5FZ8A 2A8YA 5AVTA 3CPEA 3TUZC 4Q4Y1 1Z6GA 2PA3A 1Q0SA 1K5DA 5H81A 3AZWA 3VR5H 1K88A 5F1RA 4BLIA 4YTEA 2I99A 4Q6WA 4CDMA 2FWAA 2R86A 1KQOA 4P36A 3LUFA 2LALA 4C05A 4MVJH 5CJJA 3H1AA 3UIEA 4LO5B 2WABA 4HH4A 2XXAB 2EXIA 4JI2B 4KFCA 4PIVA 2IWRA 4OGLA 1POV0 3D1LA 1POV1 3HABA 3NBXX 2XGJA 2F1RA 5J1TB 2D7JA 4EP1A 5EIEA 2P6UA 1YI1A 1L7MA 3HZZA 2Z6UA 1QGDA 4MQ5A 4N8DA 1GFIA 2JNWA 2NSLA 2G9FA 2H7XA 1UOJA 1U3UA 1BXGB 1E5XA 4CTJA 5D85A 3ZDYB 3KYDA 2GN1A 2FG6C 3NTOA 2FRDC 2EEZA 2BZSA 2J6BA 3L2HA 2C7GA 2XAUA 2BCJQ 3WJ2A 4GIQA 5JC8A 1DKRA 3ZR5A 4EB6A 2EWVA 2HYXA 1HFEL 4K0KB 4QAWA 5C4WB 5HMLA 2Y4OA 1W2NA 4LDPA 4L02A 4TVKA 1JQ3A 5C7YA 5ICEA 3WOGA 1SLIA 1R50A 3K6KA 4Z0NA 4Q15A 3THXA 4QTXA 4UD2A 1V8FA 1QFJA 1ZH6A 1DAMA 1OFIA 3IUEA 5ENDA 1I1NA 4Q82A 3RFTA 5KDOA 3CW2A 2VKQA 4XJUA 4PBSA 2BEVB 4EHLA 4LE2A 3GLFA 1PNQA 1YCDA 2YWXA 3MFQA 1UBGA 3CKYA 1RZRD 2VRWA 3F2IA 3AKTA 2HCJB 3ZTWA 3E8SA 4YCDA 1ISFA 2UKDA 1D1PA 2CSXA 3MGKA 3L9JT 2IWHA 1D2HA 5LD2B 4Q00A 1SKUA 1CJCA 4BLOA 4J0FA 2ZBRA 3TR5A 3T0AA 3N87A 5JS7A 1W28A 2PUEA 1SACA 1E5LA 4A8JA 3PXUA 4L15A 4UEWA 2JL1A 3INRA 2XMRA 2HB6A 5DTJA 2GMPA 1ST2A 3U0VA 4CM8B 3A9VA 4PIMA 3B7MA 2GA9A 4QNRA 3UL2A 4OP3A 2D6MA 3DPSA 5KNDA 4RD4A 1CQPA 1P4HA 2JLWA 1KEKA 1QZTA 3NJYA 1I3OA 1WLWA 4UBOA 1VLZA 1YZGA 1SLBA 1P2GA 3I3QA 4LIVA 2ETXA 2QM8A 4JEIA 3WL3A 3ZV3A 3DB2A 3SHVA 4E4TA 4DPLA 1TEVA 3T30A 1OV6A 4U9HS 3MMZA 4XYEA 1GGHA 3FCEA 4X8HA 4QGFA 3EVAA 3AUXA 2ZGQA 4TTSA 1GSLA 2WTAA 3AHGA 3RSJA 2X5IC 4BMPB 3LXXA 2XMLA 4EF4A 4OMFG 3OMXA 2VTEA 1JAHA 4PLNA 3WGHA 1SCIA 2H7YA 4BFUA 4XF4A 3GHNA 1AQ6A 1KBOA 1J8YF 4AXXA 3R7WA 5TGDA 5F7JA 2SKDA 4EN0A 1CY4A 3RUEA 5IC5A 3RAEC 3OZEA 4IHAA 1GGFA 1W5EA 1TZJA 3E5XA 3TM5A 4IUCS 2V73A 4RTPA 3KEFA 5EJ8A 5IDXA 1Q3EA 2D8AA 3H8XA 2HYKA 3DL7A 3NIBA 4ETWA 4HL0A 1JS1X 2OV2A 2XYGA 3EVNA 2OV3A 2AH2A 3EGXB 1A78A 3PIRA 4NK4A 1XL0A 2QMUA 1F5SA 1BBT2 1Z6AA 3ZK7A 4MWSA 3T3DA 2DBNA 4PLMA 4BWYA 4XQEA 3ETLA 3WY9A 1CNEA 3EA5A 1P1CA 5D00A 2WWHA 4R9UC 2Y6LA 1B00A 4K1YA 2BGLA 1YB7A 4MCIA 3U9TA 1P0PA 4KNVA 3HVJA 5JO9A 4HAXA 4RMIA 4DLKA 3KHSA 5IVFA 5EKTA 3EFHA 1EXMA 2FZ5A 3DTYA 4LHVA 4M9CA 2VPYA 4PCLA 2JECA 3FHCB 5ANQA 3FLRA 4TXWA 2GWHA 1XVVA 4CPBA 4IHJB 4YCBA 3HN1A 3WICA 3IAFA 1LGBA 1EG2A 3C3BA 2X5NA 4NABA 1RUD2 3WGJA 3MCZA 1DGLA 5FF9A 3JD3A 5H4HA 1MO6A 3GJ6A 2H4HA 3LMKA 4PANA 1MQTB 2ILTA 3WJ7A 1TMGE 2FW1A 4PCUA 3HVUA 4QIHA 4X85A 1QJCA 1GUDA 1SCKA 3NDIA 2ZJZA 4QQRA 3NHYA 5M2QA 2IS6A 2E1RA 1YZLA 4OHBA 3MLJA 3ZC3A 2WO1A 5IMSA 2V9ZA 3LDBA 3S6PA 2LIVA 4JKYA 2GKGA 4E4SA 4U8HA 4CQLA 1CONA 2E63A 4B83A 4W65A 4AS1A 4S1NA 5AKKA 4QVKA 3GIDA 2JGNA 1A3KA 2HJGA 3M4NA 2GF0A 4ZKEA 1KZHA 3ENKA 3VSEA 3BIXA 5KTYA 3G8CA 1NBOA 1A0OA 4TZ0A 3TAXA 5EWMB 4AG5A 2QN7A 3MW3A 4LOKA 3FOFC 4HEJA 2MU1A 4DXHA 3M3QA 1XU4A 3WW3A 4K6HA 3TO5A 1OXSC 3KZMA 1OW3B 4CETA 1A8DA 5BN4B 2HM7A 5I9BA 3U44B 2QNIA 4F6LA 3T2OA 2ZHLA 3ZEAA 1XELA 3VISA 2DFTA 2XVKA 2YV3A 5LIPA 1ZMOA 2QRKA 1M67A 4DEXA 5HQTA 5IUJC 4GX0A 1UMCA 2WAMA 3HWX1 3OICA 2BU9A 4AEDB 3BI3A 5J43A 2BGMA 1XXHB 4F8JA 5FL7A 4DXDA 4GQIA 3H4MA 5FWJA 3PJFA 1Y34E 8GPBA 1Y5IA 5IATA 5EZWA 1BU8A 2WAAA 4BCCA 1JZ2A 3PJRA 5LP1A 5HMMA 2J1VA 4PI0A 5D3KA 3HVDA 2BW8A 3P32A 1N5JA 3AI7A 2VNHA 1Y7LA 1CAVB 1U90A 4WLEA 5HIJA 1U3DA 1ZJZA 1RI4A 4D0LB 1V4BA 4DB2A 4HI0E 3WMXA 5E3HA 1X77A 2V96A 3FPCA 4J3NA 2NTNA 4C7JA 2INGX 1R4MB 1SBYA 1QF6A 1OXKB 1LU9A 1VJ1A 4J91A 3KQMA 1AKYA 4RVGA 4HXEB 4YONB 1FXUA 3MILA 4DDTA 2KR2A 1MA3A 4ZYXA 3EJKA 4XFDA 4WFIA 5E6UA 4F4HA 2VXJA 4KQ2A 3NWEA 2H5IA 1YFYA 4TYSA 4HVTA 4ZI2A 4AI0A 4C3UA 2AIRA 4GAZA 1EAYA 2VAMA 3G7DA 1X3LA 3LDAA 2O8FB 1P8JA 5GZFA 5I7FA 4FU0A 1QTRA 4LA4A 2JIOA 4ZVMA 4X1IB 1JECA 1ULZA 2GALA 2MDTA 3C7AA 2JGJA 2Q3FA 3W90A 4D46A 4E5YA 1GPUA 4XRGA 4LRTB 1QOPB 2MOKA 3QK7A 3QMMA 4PNEA 2ZCWA 4UYBA 2M2IA 1BK1A 4LCJA 1Q77A 2GJAA 1G20B 1J25A 1Y9DA 4G0QA 2XOKD 6REQA 5GVRA 4PAWA 5E9AA 1IN1A 4NUBA 2VSQA 4H3SA 5F6KA 5BSRA 1W8DA 1GNSA 3UTCA 2WU1A 4QX3A 2GN0A 5BVHB 3PC8A 3KYBA 2NWQA 1U4NA 4SBVA 2XRMA 4O61A 4JI7B 4UDOA 4Y20B 4G0MA 2GETA 3HUUA 3CKHA 3RFCA 4ZJYA 2PMCA 1CV2A 4AIIA 1NP7A 2J1EA 4J0HA 3JQFC 1Y6GA 2ZR7A 2BP7B 5I4CA 3RRZA 4E2SA 1RAAA 1ZW1A 3X1WA 2VBDA 1GFF2 3GZNB 4FE7A 3PGKA 1UX7A 1FUYB 3ZHVA 1Z5WA 8OHMA 4J94A 2D13A 4MV2A 2M6LA 3SJAA 3O6VA 4BJHB 4KU7A 5B3LA 3DQPA 4HL6A 3PRKE 3HBLA 2CW5A 1Q1BA 4KVZA 3KQLA 4BECA 3LWNA 1E5SA 4FNGA 4J7UA 1N5OX 2DHEA 2J33A 1TLFA 5L7OA 5DNAA 3FZEA 4FPYA 1DKPA 2ZREA 1KSJA 2FCUA 4HWGA 4M0MA 3JV7A 3PPVA 2IX3A 4PZ0A 3PXEA 1CJBA 1FMD2 1VRH1 3QTTA 1XKQA 2FMTA 2WM2A 1UOEA 2WJAA 2WO7A 2IUFA 2Y1DA 1XPJA 3E53A 1GSOA 5KPJA 2O19A 1X36A 3IT1A 3C48A 4KN6A 1B6TA 1RRFA 1PLLA 1NR7A 4I8DA 1OZAA 3FR8A 3JWHA 1E1QA 2QUHA 5TDHA 1NT0A 1I4LD 3LRTA 1SXJD 3MTJA 2IVFA 1XF9A 5HQ3A 1S8FA 3I01M 1G3UA 1KDRA 3QZUA 1LPOA 4L07A 3DYMA 4LTAA 3W3AH 4B6PA 4HXFB 3A04A 1RWNA 4XJ8A 2V09A 4MSVA 1LNQA 4YACA 3TAYA 4AF9A 3T9AA 4QU9A 1FLAA 2CYBA 4X45A 5HZGA 1TVCA 3H5OA 1WPGA 4BNFA 1Z4QA 2X0DA 2OPWA 1VQ1A 4GWJA 1N36B 3H6HA 2NSDA 2QVSB 2ZABA 2A57A 2OAQ1 2C8VA 3ZFFB 2J3EA 4RADA 1EK2A 2NUBA 2BUKA 1KDYA 3CNNA 3KXPA 1ZY2A 4O4IB 1SR8A 5HF8A 3NBQA 5HPYB 8ABPA 1KOFA 1YUMA 2J5QA 2PFKA 1Z26A 1CZLA 2YWGA 4X8PA 1ZREA 2ZYWX 1RC1A 3IM0A 2Y6JA 1CY7A 2CGOA 1NVGA 2VAUA 1DFGA 1DX4A 5EMNA 1KNXA 2VK1A 5AUQA 3NORA 4WKOA 1VB3A 4LKRA 1RC6A 2HYDA 1M7BA 4DB5A 1F17A 4FI3C 4C2TA 3QBQA 2P4SA 3OQ6A 5CTAA 4GAEA 3L07A 1C1FA 4S1VA 3KT0A 1DEHA 5J09A 3TOZA 5AR1A 5BORA 1QH9A 1PEYA 1XDUA 4CEYA 2WUWE 4KOAA 5GLUA 2VZ9A 4K86A 1PS0A 5AM4A 3PEWA 1YF3A 4GE0A 1VRVA 2J9FA 4B80A 1VHWA 4I81A 1YS7A 3JZMA 5JR2A 1JLLA 3A05A 4HLUC 2PELA 1WV1A 5D3ZA 5GMOA 4CDQC 3JD4A 4XDYA 2RK6A 4NP6A 4LGVA 2YWJA 4B4PA 3B1WA 2P35A 5DM4A 1M1XB 5NLLA 2YWFA 1UFKA 3T9DA 3H6GA 1WW6A 4WK0B 2F3UA 5LXTF 1UAGA 4S35A 3DOJA 4F84A 3AY6A 2DEUA 3ZE2B 1VHJA 3NBKA 3AVOA 1K12A 3TIGA 1NCRC 4YUWA 5DCYA 5IJ9A 2XYRA 3LA8A 1AT1A 5KXDA 1D7OA 4D8UA 4WCFA 4AXOA 2ZI5A 1SUWA 2NZ9A 2P1RA 1GUIA 5ILGA 5J23A 3N9OA 1LKZA 5DGCA 4C1XA 3OLWA 1JMUB 3M3DA 2XWSA 3D2LA 1XTKA 2ORED 3E22A 1V37A 3D59A 2H1RA 2A5GA 4E22A 4KIJA 5B3KA 2ZWOA 4GC5A 1NUKA 4JLJA 5DVZA 4EHNA 4KWEA 5AJUA 1ANKA 4CUAA 1MB4A 2NV2B 1RAFA 4EVQA 4GKXA 1HBJA 3MHZA 2BEUA 1ICIA 3QWHA 5E7JA 4O2BF 4PC1A 4PO3X 4JJFA 4HK9A 2C2WA 3N2KA 4BWGA 2VYVA 5BN1A 3VPSA 5FK8A 5B4XA 4A92A 4O2AF 1FRFS 4UEOA 4R1SA 5CMLA 3GVHA 4YJFB 5JBIA 3TZLA 2C7PA 1ZXLA 4CDXC 4LJ6A 2QP9X 2P6HA 4EPRA 2Z3VA 4BBJA 2D97A 2JGDB 5IF3A 4XFBA 3E3OA 1ZH0A 2AMYA 3RARA 1FZTA 3RV3A 1S8AA 1VBB2 4IGKA 4NYMR 1U8CB 1BXKA 4BEBA 4CR8A 4G26A 4PEVA 3EULA 3H8UA 3K3OA 4ER5A 2O8DB 5HZKA 2I3AA 3PDQA 3CWQA 1IZ7A 1X13A 2K5UA 3BALA 2UYAA 4MGTA 2XDQB 2V6MA 4HWOA 3DZFA 4B3TB 1RLOA 3GGLA 5JDIC 4BJ5A 2D1FA 2H17A 5GV8A 1JKJA 4WA7A 1W2UA 3HQ4O 4L7VA 4YPVA 3KSAC 4K9LA 2W6ZA 2E4VA 1O4YA 1AG9A 3GNLA 1AV6A 1UYXA 5F1OA 4Y9RA 3ZDDA 3RVSA 5FV7A 2NSJA 1H42A 3F9IA 2W1UA 1IOWA 2OR3A 3ILXA 5BYAA 3AKZA 3N59A 4FMDB 4MGZR 3KR1A 1UFVA 3A4MA 2ZIZA 2ZTUA 2VK4A 4IEXA 3T0BA 3UMVA 2QVLA 5BNFA 3EMRA 3UG6A 4PX3A 2JI8A 4BM8A 1IS6A 3OP4A 3EQ8A 4JGGA 4N49A 2D62A 2QDRA 4F60A 1C4WA 4NFHA 4E1VA 4BXFA 1YACA 4RYDA 4IEFB 1CUZA 2YDYA 2FEKA 4HZUB 4UQOA 1ZIYA 5F64A 1SQGA 5EKDA 4W8JA 1EM6A 3ESRA 2RS11 4OHUA 1L8LA 4KAFA 3ZDVA 2RSLA 3RS8A 1PWZA 3G8AA 2HWB2 5LJIA 2E49A 1TO1E 4HRAA 1IY2A 2C9AA 1E3JA 2H4FA 1E6CA 1XKTA 2DVMA 3EIQA 1TU3A 2VRNA 4WVMA 3H7IA 4N65A 2HHAA 2VVEA 4LKDA 1YFLA 2AREA 4UEJA 2FPIB 5AVAA 2HOQA 2N1MA 3DCYA 1TJPB 3QTLA 2HBUA 1TEHA 2B20A 2NYAA 4Y2HA 4ENSA 3QQPA 1BMFA 1ONPA 4BGVA 4L8LA 5JZBA 3G2HA 3NAZA 4KOEC 1Q2UA 4O4LF 3RU3A 2DFVA 3WBFA 3AR5A 1NBIA 4UZSA 2OZLA 3FI9A 3O1JC 4FTEA 3CNOA 5LZ6A 3GJ5A 4WY8A 2W7TA 4P92A 2OCLA 2Y8KA 2E4AA 2PMFA 2VJOA 1E7YA 3V8QA 2QIPA 4L9AA 1X1DA 4NESA 4EB8A 4YNBA 5JPNB 1JIVA 3I2FA 1W6NA 4CDUC 2Q0QA 5AUOB 2C1ZA 2Z98A 4QQLA 3IDBB 2O0KA 1DX9A 3ES4A 3DW1X 3T3EA 2QV7A 4I4TA 1M72A 2AQKA 4PQRA 3CGGA 4Y0NA 5CX1B 1LDYA 3IKLA 5BV7A 4M76B 1SVNA 1UYZA 1K7FB 3RVOA 1XZDA 1ORTA 3AKYA 4MXVA 2NVUB 4D4IA 1T36B 5JU6A 3TLAA 3ZWAA 5FP9A 4HDRA 4WVVA 3DTVA 4ZJZA 1XA4A 1YMQA 1CAUA 2HSGA 2QR5A 2QUJA 3K0HA 4M54A 5A3RA 3H1PA 4TV9B 5CEFA 1NZFA 1Y1PA 2VQTA 5ABJA 1L7RA 1KJWA 1OX6A 3OQNA 2VO5A 3CEAA 2HWD2 2X0KA 3RZJA 4N5NA 1H2HA 4J90A 4U7TB 4U6NA 2FCRA 2BFMA 4HRXA 4ZI7A 3WRYC 2HWF3 4JX8A 4O33A 1DXYA 5E1DA 3JCZA 2O5VA 1F2UA 4CQMD 1TQDA 5DHFA 5GPBA 4KQFA 5IBPA 3LEGA 4TWRA 1O4VA 1PFKA 1ZVQA 2IP1A 1G6HA 3GRAA 4RL6A 4IHKA 1WD4A 2V5YA 2C0CA 1CAXB 4Z4CA 4CDGA 4UHJA 5CAZA 4GLBA 1DS6A 1MBZA 5CHYA 5GZCA 1JFFB 5L3RA 5K5EA 3M1IA 2GXAA 5A9SB 1VG0B 4ZMSA 2I6UA 1KRXA 1BEUB 1V9U2 2FPRA 1R74A 4Y33A 4ARZB 1U12A 3V4ZA 3DBHB 3IIEA 3RS9A 3BG5A 2QN8A 3Q7RA 2X19A 4W5OA 1WZXA 5DW3A 3NNLA 2P7IA 5LLTA 3QIAA 4ZN6A 4ADSG 3NSTA 1NNI1 2F59A 2XZTA 2JVJA 4LIPD 4A8HA 3B6IA 4C4OA 4HN1A 1QJEA 2WHEA 1ONSA 1MO3A 3KVOA 4FEEA 2FWMX 1ZBE1 2Y66A 3A3YA 2YVLA 3MWDA 4CU8A 2WYFA 4M1OA 3OCVA 2JG8C 4F12A 3DHNA 2VT6A 1Y8RA 2VYFA 1UBUS 1ZLYA 1GQSA 2P2GA 2XITA 4IIYA 3QBVA 3D02A 3MOIA 1DEKA 3ZQJA 5BPHA 4OFZA 4PLGA 4F4FA 3TEJA 2PAMA 1J70A 1WUJS 2IH4A 4J0QA 3SXWA 4CF5A 5DULA 5LBEA 4FE3A 4EW2A 4LR4A 1XN1A 2ECKA 2VNVA 3X1XA 2GAUA 3GMSA 3AK4A 3ZVLA 2Y05A 3CU5A 4LZLA 2W6PA 4IGPA 3T1NA 4KMRA 4UZFA 1EYBA 3O0XA 2WRZA 2RDNA 4ARIA 3EXUA 3L5OA 2DUQA 5CLLA 2Y1KA 2GCOA 1CU1A 4NENA 1N2HA 2DU0A 3SQMA 3TNLA 2GLUA 1YL6A 5IYZA 4PC7A 1DIOB 1ZONA 2GN2A 4HXCA 5KNDH 4RFVA 1ZGHA 3M1YA 4UVGA 2IXCA 1ZQ1A 1ACMA 3V0AB 1LK7A 4HMPA 3BFVA 1PZMA 5J3JA 1UXOA 3WQRA 1NR1A 3C4VA 1QS0A 3F96A 4HKLA 4ZVLA 2YASA 5JJIA 3MLLA 2YOHA 1YFJA 4I0BA 4KLNA 1J1UA 2OBXA 5B6IA 4RTKA 4WLUA 1SWVA 2IPLA 2PYTA 3CMMA 1YRQA 3RASA 3ST7A 4PQEA 5JI9A 3O8QB 3A28A 1QE5A 2XMSA 3RS7A 3QH7A 4YG0A 4EI2A 2NW6A 1GWMA 4OXIA 2IHBA 1DT3A 4CCJA 4EM6A 1YULA 3PS9A 1CY0A 4NO4A 3JQ9C 1K8XB 5FOWA 2HMYB 2UU9B 2AJLI 4ZQCB 1SVOA 2AQIA 5F7XA 3VR0A 4XBNA 2P6OA 2O3TA 2Y92A 1DFHA 3RNLA 3C43A 5BO5A 4Z1VA 2D0DA 3N39C 2YBEA 2J3JA 4M87A 2FPUA 3RRFA 4Q37A 3FHQA 4JJIA 1NG1A 4YW7A 4QICA 4I9NA 1WXQA 3T3IA 1O58A 4EOGA 2JEMA 3THWA 4KQCA 2QTNA 3WWCA 4R2MA 4QPZA 2NUPB 2J32A 3KCCA 5DWVA 1NQVA 1YA8A 2I0FA 4EG3A 4Q1RA 3DO6A 3CUTA 3AEYA 2KJQA 5A3OA 2V0NA 2XA1A 5CFCC 3UYJA 3U80A 3MUEA 4XXPA 4X6YA 3T12A 1WLYA 3QF4A 4RTMA 1K06A 3NHLA 3LZZA 1A82A 4J25A 3PGMA 4M0PA 3TSWA 5J37A 4ZVOA 3W05A 2VC9A 3HDYA 1EX7A 2G9UA 4NBRA 5AC91 3ETNA 3KAKA 1DXQA 2PUCA 4YT8A 4KG7A 2R6CA 4H60A 4F85A 2O3JA 1GAWA 4IX9A 5FYCA 3S0JA 1UK7A 2JFWA 4ZOEA 3UANA 2X6RA 2H52A 5MGBA 3QWBA 2RGXA 3AFHA 1QC5A 2ANBA 3RYIA 3BWXA 3L1JA 3RBAA 1Z34A 2OGUA 4PSVA 3RWMB 2FW7A 5AOBA 2HIAA 5DDJ1 2C3PA 1M8KA 3CUKA 5FUXA 1RM3A 4R52A 5EC8A 2YJTD 1JODA 2BI4A 1LK0A 1GPDG 4K0RA 4DNQA 5JR7B 5K8IA 1CYEA 8AT1A 2MSWA 1UL9A 1V48A 3T1LA 2OZPA 5A80A 4Q9NA 3Q3HA 4B76A 1NVVQ 2IJGX 2IYSA 4NHEA 4MUMA 4A8JC 1G0NA 4HD8A 2PQ2A 4HGRA 1E1YA 4L3WA 3KSCA 2C61A 2B8TA 3AY0A 2IHTA 2D1YA 4PQGA 1RUF3 4LGCA 2JCXA 3T6KA 1J7KA 3F47A 2FQQA 5KTPA 3HB9A 3C97A 3N36A 1D4M2 3QPUA 5B4UA 3VBSB 3S4YA 2ECQA 1Y7IA 4WUVA 4AGVA 4NBKA 2P2DA 4OHRA 1LLDA 2Q2NA 3A22A 3ND8A 1AR83 3I04A 5KKCA 3MTBA 3ESQA 4HY3A 5SZIA 5FTLA 3WL5A 2JAXA 4KV7A 4BVJA 2CFTA 4GLLA 3K0SA 3O3CA 4DNPA 1AXEA 3BE6A 4IHJF 4F71A 4YM0A 2VDLB 4J16C 5FQ0A 5KYYB 3DMPA 1CJSA 1GQPA 1OTXA 1C28A 4S2GA 2OGSA 5FP7A 1D1QA 2JFQA 1YR6A 4E4YA 5A7GA 2XCSB 3TNYA 1PAUA 1C5KA 4G1EB 5AVWA 1EPUA 3EMKA 3IRUA 5K0EA 2BTVC 3ZV5A 3GRKA 2X5OA 4AHWA 5FJHA 1QGZA 3GEBA 2Q1TA 4H14A 3USUA 3F9RA 3W4IA 4R9CA 1XRRA 1L5NA 4E08A 2NSHA 4B6JA 3FBWA 4W50A 1XC7A 2H2AA 4ES6A 1WBFA 3NWBA 4TX1A 2UWAA 2NM1A 2E82A 4CLRA 3DMNA 4HLUA 3W6UA 2CGEA 4JMPA 2EP7A 1SUFA 4NCXA 3K73O 1R6DA 1T24A 2HMSA 3IAM1 4TQAA 2C5FA 1T9GS 4KWHA 2VLIA 2Z2KA 4MZXA 1FXZA 1NLFA 1ILEA 1MEEA 2QXUA 3AHDA 3MFYA 3DMFA 5HR5A 1XQ9A 3QEBZ 3JBG3 3BL6A 1BWSA 1E1RD 4URWR 3A6HA 3NHPA 1TYDE 4ZI5A 5FOSA 2JRCA 4RTRA 3EXFA 4UW3A 3DUIA 4YFWA 2ILMA 3VBFC 3DL3A 5LPNA 1A7UA 5FRAA 4I99A 4L97A 4U8GA 1KEZA 5E7QA 3F0TA 2DR0A 2EBUA 1XALA 1CPMA 1WKBA 1I4DD 1O5LA 3QE4A 3PEYA 1PJQA 5HKBA 2XTZA 4M9XA 3AVUA 3Q8XB 1J5EB 3P5SA 4QU0A 4I4NA 4K8RB 2XADA 2QBXA 3GD7A 4JD5A 2OMKA 4ROTA 1U7TA 4C4YA 2CDCA 4V03A 2QYTA 2WU8A 4LQCA 3HU3A 4KUGA 1QWSA 5NULA 4FHFA 1NVEA 5HBAA 3L2OB 1FNNA 1HB3A 5BOSB 4N7JA 1OXVA 3KM5A 3HR8A 3W8FA 1DRVA 2RKWA 3QD6A 4YLZA 1QIHA 3RYRA 1E59A 2BUBA 2R0FA 4CDXA 3E3MA 4EQ6A 3Q3IA 1BKYA 4ZHSA 3TD2A 1E2QA 4MI1A 1ND6A 3TQTA 2XOMA 3PF8A 2PHLA 2VDRB 2BCGY 5L4NA 2X2FA 1WLTA 1Q1EA 1FUIA 4XD7A 3EDRA 1MT0A 4NKRA 5DWQA 4GUDA 3CEHA 1MV8A 1QGED 3R20A 4ABTA 3AV0B 1P6XA 4Z1MA 3AT1A 1JQEA 2EJCA 3SSMA 2J0UB 3EEQA 5E16A 4DDHA 1GG2A 3FRIA 2QRQA 5IFLA 1HC7A 3H0OA 4RANA 4F38A 5ALZA 1W36B 1T2AA 5A5DA 2ZM6B 3FPSA 1A8MA 5JASA 2CMFA 4GWLA 4WOCA 3AERA 1J8DA 1V16A 2GPNA 3KVVA 1DGQA 3OETA 3KXIA 1AS2A 1DP0A 5IU6A 5ES4B 1FP7A 3EYWA 1GYRA 3QUBA 3AR7A 1X42A 2RR13 3BC1A 1IN8A 1M74A 1XA0A 4MS3B 3ASVA 1R4NA 4GECA 2DXIA 3ZV6A 5ESXA 4WWHA 4EUEA 4ZVRA 1R5JA 3GDGA 4FDTA 4QTZA 4MR9B 3U0BA 2PX3A 4N43A 4FYXA 2AYHA 5FZ1A 4AURA 4XSGA 4LZOA 5G4KB 1Z7EA 2R8BA 4V2UA 3HADA 4BN5A 4R51A 4MOAA 3G59A 2H2HA 2VTVA 5DK4A 2H85A 5HFAA 3THDA 3DYIA 1DDIA 4AMGA 1QYCA 3WYFA 1T1EA 3LFHA 1CY6A 2CY0A 1AM4D 4RPIA 1PZEA 1CUAA 2XUKA 3UCEA 3KXDA 4WNCA 1PZHA 1IOLA 1PL0A 3LI2A 2BFBA 1S3IA 3SCFA 2Q8NA 4DCTA 3S8YA 3GBWA 4IEOA 4QC2A 2ZTSA 2WN3A 2VBFA 2K7FA 3O1TA 2GJ8A 1QHSA 1WNFA 2VZ8A 3QIVA 3QLEA 3HUDA 3HFGA 1OA4A 4JK3A 2QENA 5JWPA 2L19A 1KDMA 5EZ5A 3UWOA 3AW8A 1TZCA 2QG9A 3EXHB 4XWYA 3VH1A 3EXIB 1QNFA 4CMIA 2DHDA 4ZAWA 4BS9A 4HPXB 2GT1A 3LVQE 2IYUA 3LQFA 2PXCA 3GLQA 1JJ7A 5KDDA 2VJBA 4LF8B 3PUSA 4CDUA 2R1TA 1PMIA 2ZGNA 5IC6A 3O7OA 1Z5OA 2GRUA 4EJSC 2MSKA 3SEZA 3PC8C 3AO0B 4W6XA 3IDEA 2J5RA 2VS1A 5IK2A 2MYTA 3ZDRA 2IV2X 4JP3A 4CCMA 4XF9A 2GP5A 1FS5A 1BMV2 3FPFA 1U9ZA 1YC5A 5DUUA 5JOWA 2H92A 4B6QA 1NBHA 2Z04A 5A7WB 1J2RA 1J00A 4B0PA 3R9WA 1NKGA 3WIUA 2XUQA 1TC2A 5D51S 2PLFA 4KR0A 3W0LB 2NMNA 4S2FA 2PZGA 3RKUA 5KMGA 5IXSA 1WUIS 4IFIA 4O4IF 2MSCB 3MAJA 3LK7A 6GPBA 1SCNE 2WKSA 4DO0A 2HEIA 2FW8A 2EDAA 4WZAA 1PF7E 1UBRS 2HH9A 4UXIA 5L7OC 2BBTA 4PRYA 1EWKA 2GWRA 3IAAA 3ZYFA 3VBUC 2ZJFA 2OLEA 3WRYA 1AX9A 5KYKA 1I2DA 5LQJA 2BDRA 1JDBC 3EZFA 4ZK2A 4RD2A 5FY1A 1K6MA 4IXLA 2LUOA 1ZWLA 4IQ8A 2PKQO 3I2GA 4YN3A 1YQEA 4OJMX 3F5DA 3R1IA 5T50A 1U8EA 4IPTA 4OHFA 2X0JA 1PWYE 2B0JA 4AXBA 3UHAA 1Q11A 1O3YA 1RCUA 1DGRA 4H7JA 1Z7GA 5C3PA 3B36A 3J8F3 1COWA 1S2NA 1X1CA 3JZIA 3QI2A 3ZYIB 2RHRA 3K77A 1P2TA 2FZCA 5G40A 4XMAA 4K2HA 4US1R 2AFHB 1DLIA 3TUJC 4EBFA 1V96A 4Z9YA 1YVUA 2RMU2 3WQ1A 4O08A 2V7QD 1GV0A 1RINA 3D54D 3J7HA 3DOIA 1PZ7A 3KLPX 3NJXA 2G72A 4MW1A 3QFTA 3WIDA 1Z74A 1HWYA 2WV7A 4BRSA 2BFEB 2CAVA 2FSIA 1DSSG 4PZCA 1H2EA 5HA5A 1QNYA 4LI3X 5TS2A 4HAVA 5BYBA 3DFUA 2AG6A 2XJVA 4ZRNA 1V6MA 3GBGA 3UW3A 4IINA 1XBFA 5JW6A 4XLZA 4ZOQI 4NX2A 3TTVA 1F5FA 2PZJA 1L6RA 2C4HA 1JQ5A 2ATIA 1U1DA 2B8WA 1LDBA 3QEMB 4OEHA 1ITZA 1DAIA 3ICCA 5CB6A 3K8ZA 2H29A 3VA7A 3RIXA 4FLEA 4YCJA 4BFLA 2XBO3 2WS93 1KYXA 5KB3A 5CVDA 5BWOA 3R3WA 2JF0A 3T99A 4I0AA 4Z8XA 1XYNA 3RJTA 4I0WB 5FYZA 2FAXA 1ZSNA 1XN4A 2O8BA 1YCGA 2HX1A 2QLJA 2UZ3A 4ZVPA 1W2OA 1L5HB 1NASA 5I0SA 4RKEA 4YIHA 1ZKDA 3H42B 3N2NA 4BNVA 1Y1RA 5I0UA 4CEYC 2YC2A 4I2NA 1ENZA 2E7QA 5JDBA 3BAFA 3UOAB 4ND1A 1SY7A 2GCPA 5C8YA 3FLEA 1NAIA 3FHLA 3AMQA 1U7WA 4UZEA 1UKGA 4P4SB 5F51A 4OK5A 1E0KA 1HRV2 4CW7A 1OXTA 2G82A 2CLDX 1YZVA 2Q7XA 1HN0A 2PHFA 4IGIA 4NCHA 3AOEA 7ADHA 1RIRA 4LSMA 3KZ4C 3KJNA 1DGWA 2FLWA 4FFNA 2P5SA 1HNXB 5LA6A 2XGMA 2OSVA 3S99A 2P3OA 2XVZA 5C9ZA 4YMUA 1P6UA 4ZARA 4MICA 3QUSA 3MLAA 2JLUA 2EJBA 5AVRA 3ROUA 4ISRA 4WCFC 2ZI4A 2WR8A 1US2A 1TA9A 2IXFA 1Q17A 1W8FA 4PQFA 1MQ8B 1SBCA 3U3ZA 2TYSB 2VQDA 1PD1A 4WGGA 4HDSA 4LV5B 4C5AA 2Q21A 1N3LA 5HCBA 3O1OA 1JDJA 2BKAA 3JQ9A 3P2OA 5IK8A 3HB4X 3ZDCA 3HCAA 4TS9A 4AFAA 2RJLA 4L0CA 4BV2A 3WE7A 1VLVA 2C31A 3GNQA 4MZDA 2CLMB 1R0KA 2F7SA 2GXQA 1VHTA 2XWJB 3MIFA 3DQZA 2WAOA 1XCGB 3PGLA 4IUBS 1RLJA 2CDRA 4QNNA 2OWEA 1A27A 2SLIA 3FTFA 2P62A 2WWSA 5EP1A 2P2KA 1SBIA 3KTAB 4QULA 2ZKIA 3DDSA 3TXYA 4OP2A 3IAHA 4UU7A 1A5ZA 3ZFGB 3G9ZA 4R98A 2OHXA 4J0DA 4CZ2A 5E4FA 3ZFEB 3UKTA 1CZHA 1PGW1 3QBTA 4C2UA 5CFCA 4M8KA 4DJDC 3QKSB 1OKKA 2QZ9A 1D04A 4YHBA 1T2FA 1BHSA 1Y1KE 3VGIA 2ZACA 2JD0A 2QDXA 5F5XA 2QRJA 1JG1A 4TN7A 2W2MA 4X66B 5IAOA 5FFFA 1CT9A 3EN0A 1QHDA 1JFSA 4DMKA 1X1SA 1DUVG 4Q1PA 1ODSA 1ZH2A 1NY72 4JBWA 3O2NA 3SQXA 3BD6A 5A3MA 3AMMA 4DOUA 1V8DA 4MKHA 1GT6A 3LOUA 4M7RA 1EFPA 1PGL1 5J98B 4B33A 1JMYA 1BYIA 1REQA 3M5PA 1F06A 4GQBA 4AMZA 2J5BA 2YMZA 4I5EA 2ZSUA 1WXFA 4RAQA 3FN4A 2A0FA 4YV0A 2DF7A 3RT1A 4Q9DA 4ODIA 3LLUA 4KN5A 1SBZA 1DDGA 1QJY3 5FYTA 1RUH3 4WJZA 4QU2A 3PHHA 1R081 3UVEA 4IF4A 3I1FA 1SVWA 4EG1A 1FDVA 3DL0A 3VR6H 4UF0A 4UDYX 4A6SA 3GVPA 2Z2IA 3EOAI 1KP3A 4FTWA 2SECE 2CLEB 3DLIA 4ISCA 3MTIA 1EPZA 5BSVA 2P3JA 3P9ZA 2PX0A 1TYCA 4YFVA 3UH1A 1JLRA 1ZA7A 1E0AA 3DEHA 4MR8A 4U2FA 1UC8A 3AEQB 5AW3A 5IXYA 2J3DA 4GI3A 2JLVA 3I2OA 4IOMA 1YAJA 4CVUA 2J6HA 3ASIA 3EOBI 5DLYA 5TPZD 1QO0A 1MJ5A 2Q5TA 4RN5A 3LHIA 3DAOA 2VJXA 2QNRA 4TV9F 3Q9LA 1GDHA 1FS4A 4B8EA 2OP1A 1W6QB 2WJGA 2XMPA 3MIHA 1W4BA 4C78A 1V6KA 3B94A 3EUFA 1Z6XA 1AK9A 4E33A 3GPCA 5IFPA 1OURA 3VZCA 5ACA3 4J07A 4PS1A 2XLGA 4J16A 1NA1B 4DR1B 4PFJA 3H18A 3SYKA 4RIHA 3STXA 3MYRA 3RCBA 4KTVE 3RNOA 1ML4A 1AYM2 3M4JA 2Z6AA 1JDNA 2P67A 4M3CB 2W22A 3ZLVA 1VKRA 3IBSA 3BTUA 2W6JA 3D81A 1GL6A 2VZ3A 3NWKA 5FUMA 4D9GA 3OKFA 1FP4A 2ZTMA 4F3TA 5AQ1A 1MQAA 3D3QA 4M0EA 4RJTA 2GU9A 1U80A 5KKAA 3FSEA 4QVGA 3J7NA 4KX3A 2WT0A 2J67A 3BGIA 2TNFA 1FFWA 4GPD1 2FCTA 2YQZA 3FX3A 4KQ7A 1YRLA 5HTKA 1AKQA 3D6UA 1VRCA 3AL0C 2B46X 3L7KA 4JBNA 4WKNA 4UCFA 2C3MA 2DPLA 1F31A 2XVAA 4NNJA 2ZU6A 3WEZA 3M49A 3WP1B 2RH9B 5H83A 2XXJA 5FIXA 2G5CA 4G23A 3QGMA 4PYKA 2P5UA 3TFQA 4LF6B 2X0EA 1Q50A 1CQJB 2JAHA 1BFUA 3LCMA 2ADOA 4YGDA 1FYVA 4MCHA 1DBRA 3JY6A 4N7RA 1BN6A 3O38A 5J2UA 3VBFA 3KT3A 1DARA 3H9CA 4PAMA 4RSUA 2CEKA 3GA5A 2WYSA 4Z0PA 1XTVA 3AZQA 5ABJC 1ZM7A 4D74A 1EWYA 1HM5A 2D8MA 3KBOA 2QLFA 3B2EA 1UMKA 3PPYA 1VPLA 1UMZA 2C0QA 3QKRA 3K2QA 1U0BB 1QFMA 3QX8A 4Z7NB 4CR6A 4F3JA 2KQUA 3ZIAA 3WMGA 1BHO1 4QGMA 1Y8AA 3ZWKA 4B8YA 1DZ3A 4D8MA 1LTQA 5D84A 4DIBA 1IY9A 4PFSA 1NUAA 1RUG1 4MUAA 3CNAA 4I4IA 2B9VA 3FJOA 4Y1FA 1GU1A 1ZOIA 2HQ1A 1N9GA 3DMYA 3HDJA 3HB5X 2CJPA 4KG0A 2D2EA 2GPSA 1Z0FA 4YSFA 1TE2A 2QVYX 2W94A 2HNAA 1D4ZA 2RDQA 4Q1BA 4D45A 3I9JA 3V1KA 4HX5A 1PVXA 2DKFA 1ULBA 1HURA 4TVSA 1DZQA 1VXRA 1PRYA 1MRNA 4MB2A 2CNKA 4BB0A 2WU0A 4EUKA 5ALDA 4PPNA 1ZM2A 3UCFA 4BVBA 1W6MB 1Z29A 1XO1A 1F6WA 4INAA 5B6PA 4LT5A 1W9WA 1KI6A 4EI7A 3JW8A 2A92A 3J9SA 4D79A 1EFVB 4H6VA 5ALTA 1H8TB 4NPMA 4ARYA 1K8RA 4NOMA 4Z86A 2VP0A 2P3SA 5KYNA 2BDEA 1XQXA 3IAUA 5KYVA 3WNXA 3F1KA 2EJTA 5DN2A 2OW4A 2RVAA 1QXJA 1E3MA 4QUEA 3TI9A 1S55A 4FFLA 2OILA 4ND8A 1ODKA 4LEIA 3FPEA 1ND3B 4QGNA 1FPN3 3WNVA 2CDPA 5A32B 5TMEA 3F73A 3SWWA 2IZZA 3SR4A 4ITRC 2GBFA 2CFOA 4PRKA 3TSOA 1DWQA 4YRLA 1H1LB 4N1AA 3H2BA 2IPMA 5FK7A 1Z2NX 1TNRA 2ZK7A 3UA3A 3QLTA 4ARCA 3JATB 2JHAA 3DGEC 1T29A 5CNMA 3FLBA 3E5MA 5JAMA 1NI3A 4NJMB 2Y0EA 4L5BA 2D3TA 4CKZA 4IL7A 1NQOA 4J7XA 2OCAA 5LB2A 2MEV2 4Q4W3 2CDOA 2BJWA 1DL5A 4XPZA 3J80A 4NMIA 1RUI2 3KPWA 4AFCA 1P5FA 4GE3A 3UAVA 2PH3A 4K6GA 4YDSA 3QTBA 3EUEA 2JK0A 4NHLA 4JLPA 3ZNPA 2AJCA 4FXGB 2RGEA 2JEZA 4ZU3A 2QK4A 3KDAA 1B23P 1GAJA 3HA7A 5E4TA 1FOD2 4KQ1A 2ETVA 2KLHA 1MAVA 1YHNA 3HP1A 1JEAA 2WTBA 1OPMA 3NEJA 1KO1A 2PJDA 2V3CC 5H9SA 5TT1A 4MQ6A 3WGKA 1TJ4A 3S57A 5K6TA 3MPPG 3OH8A 3AKCA 5JD3A 4GBGA 3L8YA 4R4ZA 3UMYA 4KXXA 2P9FA 4E5KA 4G97A 3F46A 4YMGA 2XRZA 1EK1A 2Q4BA 3AF1A 4RVCA 3SD7A 1U28C 1EP2B 4A8TA 2O2XA 2UVQA 4BEVA 4PZ9A 3H1YA 5IVKA 3PNAA 1EE1A 3NTXA 4UUBA 3RIYA 1R1A3 1XBTA 3ZSLA 4GXLA 1JQJC 3RW9A 1IOZA 2VHUA 4EJSA 1TU0A 3F71A 4LPKA 3OWXA 1WW2A 3BIJA 2DB3A 3DYPA 1E5QA 2QUAA 3QWIA 4CV2A 5I8YA 2DVFA 5IVDA 4LE1A 2I87A 1QOZA 1NZCA 4GB31 4UXJA 4XGQA 3B6MA 5C71A 2AGVA 5EESA 4ZQGA 1KOLA 2PJZA 2DBYA 3WDWA 5DM1A 4A3ZA 2HMAA 2UU8A 1F35A 4C3OB 4B4QA 4P38A 3MC1A 3K35A 1DYKA 4BX3A 3TR6A 3DE1X 3NTUA 2QN6A 1DKUA 1EUCB 3VBRC 1N5RA 4W99A 5EERA 2QTMA 2P3KA 4UAUA 2V4VA 1F6BA 4GLJA 5E0KB 4URFA 4KLRA 2APJA 3DE4X 4JOBA 2ZSDA 4WV8A 3ND9A 4RY9A 2IZ7A 4COYA 3UCXA 3W7BA 2OCDA 5AFBA 1RT9A 3VR4H 3VBUA 2ZX3A 1BNCA 3SHOA 3F6YA 3HQUA 3TTYA 2QYSA 4QM7A 3WQ0A 5EQTA 1E89A 2OQ2A 3AJYA 4HQ6A 3EPPA 4DB4A 3UJ8A 4WGFA 3WSOA 4JLAA 2ADDA 2KSQA 3PIIA 1D8TA 5T3UA 4J1SA 5I3CA 1EUUA 3WNNA 1O8PA 1I94B 4PLOA 4UBIA 4AN4A 1MTOA 3TVTA 1T4CB 2PWBA 2O0HA 4YY3B 5K9ZA 5HKKD 5F4BA 1ADGA 2ZYRA 2FMIA 4NMMA 3HA2A 5DM60 3OY8A 3H65A 3PTYA 4F8EA 1G9FA 2BE7A 4A7YA 4AGRA 5D86A 3HNOA 2CYFA 1W2GA 2GAOA 4KQEA 1BKSB 3S2YA 3DL4A 1BFKA 4D1YA 2FDFA 5KTMA 4IOLA 2B4KA 1XCMA 2JE9A 3Q7SA 3NOOA 4RIGA 2CYCA 1T2XA 1CQXA 3K4PA 3FNBA 3TMAA 2ZMKA 3M89A 1FCJA 4ZC8A 3D0RA 3S29A 3M82A 4BMVA 3V7FA 2OPKA 4EGAA 3GLIA 2Z79A 1NYQA 3BMCA 1O6CA 5F78A 2AI3A 3RIMA 1DZRA 5JNRA 3GFVA 2PMKA 1UYPA 3U07A 1GA6A 2P9GA 1QM5A 2C2KA 3HG7A 2YHBA 1YBAA 5KQRA 2RG1A 4DSUA 4PQYA 2X4DA 3NHFA 5J4KA 4Y1GA 3TUIC 1RUJ1 5CITA 1VYVA 3PVSA 2YPJA 1P5HA 1JQBA 2X42A 1DBSA 1THTA 3BTZA 2HWKA 4PHTA 3WSWA 1UJ2A 3H50A 2IP4A 1DLCA 3KZXA 4AHZA 5HILA 3AJ9A 2JAPA 3U16A 4GOKA 4YPFA 4X1YB 2PYZA 2VP6A 4YARA 5H9WA 3VBCA 4GM1A 1X7YA 3B3FA 1MC4A 3WWPA 1KYTA 521PA 5BWNA 4LYDA 1UXIA 4BQWA 1OQDA 4MP3A 5BW4A 5J5VA 1G9AA 1NXD1 1TAUA 2H4ZA 2VOTA 2HO4A 5EHIA 3H05A 4N53B 1XV5A 2G9RA 1IMOA 3E9MA 4AX8A 4IIGA 4DCPA 1PM4A 1H9PA 2RE8A 2PUVA 1UM9A 1K9SA 1VLMA 1U2SA 2JAOA 2K6GA 2L18A 2GEUA 1GJRA 2BSXA 5F7OA 2IYXA 4G1VA 1J84A 4IH1A 4MJ7A 3JR7A 4E2XA 5KYTA 3POJA 4GZMA 5K01A 1VE3A 3QEKA 1NUSA 4Y6PA 2ZAYA 5KYWB 1Z7BA 4V1CB 4DQKA 1L7LA 3SQOA 3NCHA 3G6JB 5LMNB 3R5FA 1R6BX 5JDCA 5ED0A 3PFBA 2ZS6B 3OSDA 2WFLB 1A2QA 1N2CB 2BR3A 2JIBA 3HYSA 1S0UA 1HETA 1WW4A 3KJIA 3PLQA 4L8YA 3QOWA 4XB2A 4OQZA 1EWVA 1ND5A 1Q1GA 4IVRA 1KFXL 4UE6A 2GNMA 1MPXA 1FMTA 2K2WA 1RKQA 5EMHA 2IFWA 4OB8A 5FI3A 1YOBA 4XYLA 1DKMA 1XT6A 4Z2YA 4H4DA 3KJGA 3L9WA 5KYUA 2OV8A 1Z2EA 3UGFA 2PK3A 2ZDHA 4Z4GA 3MJHA 3BSYA 4R2IA 1AB5A 4JV4A 5I01A 1BCRB 3MWYW 4X3CA 1W90A 3WJ1A 4EFNA 3DOOA 3IOBA 2ATCA 3D6VA 4KK4A 5EVJA 5KXCA 2F1JA 4B7UA 2PUJA 5FUQA 2DWRA 2D7CA 4B4KA 3D0SA 4HXGA 2BKLA 3GGOA 4HRVA 1D1TA 2AYZA 3DEFA 1BTOA 2CWWA 3QMVA 1W6OB 3UK0A 3B53X 2C42A 5DG1A 3BERA 1G9DA 4QPGB 5LWBA 1O3TA 3THYA 4WNIA 3DJYA 1J2TA 1FTYA 4GMP3 3TLZA 2HMTA 1FFDA 4NLLA 3WAGA 4EY7A 2KBFA 2VEDA 5H3HA 3Q0IA 3N8DA 2XQVA 1TQ5A 4HQFA 3D4PA 3VSCA 3TDKA 2PXAA 4UHEA 4ZCIA 1JTFA 1M6HA 1UZMA 5C3UA 4AAYA 2PVPA 2LP4Y 4N90A 3OLZA 5CEHA 3OUJA 2AHOA 2HAEA 3K5IA 3RRDA 1B2RA 1KMNA 2R751 1OGYA 3DE0X 1IM5A 3HDQA 1OLXB 3GXUA 2EVWX 3BGOS 4NJEB 4LUCA 3QFSA 3VZMA 1I5RA 4KGXA 5KYXB 4K03A 4EHIA 4NMHA 4KYTA 1DX6A 2GI4A 2R96A 4RKYA 2H5JA 3RZKA 4N43C 4AZSA 2EF0A 2PSDA 2P2NA 2EX1A 1WV0A 5FZIA 4RDHA 2P6PA 2WSUA 1LW6E 3RLIA 4QVIA 5AXDA 1T9ZA 5HIAA 5FTTC 5D01A 4ZZ0A 4R40A 2Q0SA 1EK5A 4QAJA 1QDEA 4EFDA 1W52X 3VV1A 2ZRJA 3RF6A 1U0NA 1J0DA 1VLLA 4NRDA 3EG5A 1JIJA 1LKNA 1PJBA 5ES3A 3RI3A 3DZDA 5AICA 5ALPA 5F76A 2NO9A 2VXOA 3X1DA 2TEPA 1HB2A 2ZJOA 4UWDA 5JSKA 3NEYA 4AEMA 4TV8B 5K4GA 2A86A 1UY4A 1SPPA 1JWLA 3GMIA 2R4QA 5FV3A 5EJ9A 4OK3A 5ARCA 4LWPA 4JC1A 5AW2A 5KS2A 4B7KA 4D9CA 1W8WA 2NTVA 2M9MA 1JQKA 2NLRA 4ND3A 5AVSA 3F5QA 2HK8A 2JLQA 3HCEA 3DBLA 3PFHA 3OPQA 1S0EA 2D2XA 2I3BA 4LV8B 3K1AA 2NO7A 4EARA 4QT0A 2DVAA 2IITA 3LY5A 1M1NA 1G8MA 4NZYA 4B4UA 2HKIA 2PS3A 3QVMA 1WJGA 5EP9A 1JT9A 2IKQA 2YNMA 4BQEA 4OLLA 3KKPA 4FBMA 5LP6B 4RS3A 1VSBA 1N3IA 4CMAA 3C6KA 1FYXA 1R0XA 3IBMA 2RC6A 5KHHA 1OWPA 1PKXA 3EZNA 5B4TA 4A4DA 4FS3A 1YUNA 2AMFA 3LLSA 4KACA 2Z69A 3K3NA 4JVLA 3MGCA 1IAQA 1W4AA 4ZCSA 4KE7A 2PTGA 3GZAA 1CHNA 1LF0A 4S04A 1EVQA 3SEPA 4B4RA 3BZUA 1AJOA 1UXGA 1WXEA 1QU3A 4EF6A 1DCFA 3VLBB 4QHSA 3ZTYA 3H8VA 1QCZA 3I1YA 4F21A 4C30A 4MKXA 3AIMA 1F12A 4OJQA 5AKJA 2Z3WA 4RFT0 4ZDKA 1EM8A 3RGWS 4ES8A 4EKYA 5AHOA 1SMVA 3UGGA 3N9NA 3FWEA 2V74B 3QYPA 2WZR1 3CN9A 1AGYA 1KE1A 3POFA 3MJRA 2Y6FA 4QJ3A 3F2VA 3KG2A 4ALNA 4EZBA 1UCFA 1KI2A 1JYNA 3OKAA 4MQMA 5JALA 1I9RA 4DXZA 1M76A 3G2NA 3HZHA 4BTVA 1S2GA 2FSVA 1QHGA 1RHQA 4CKEA 4FD3A 2QUIA 3PZRA 2GZMA 1JHYA 4CF3A 4V0NA 4RSHA 1FX0B 1R88A 1W8UA 2ZU0C 4DHEA 3GGDA 2Z08A 3W1VA 3FVWA 5FPBA 4RA6A 3X1YA 4F5DA 4JT8A 1KYVA 5AI4A 5FMDA 2ZPUA 1XMOB 4TKUA 4EW6A 2IZWA 4XIOA 3ZLJA 1L6IA 3Q9UA 3NYIA 4OI0A 3CJQA 3OPMA 1K9VF 3CF2A 4GPEA 2YYSA 2GMEA 4TM7A 4HOYA 3S8MA 2VL4A 5KXBA 4LV6A 1BH2A 3F78A 3IUYA 5J2TB 1AGXA 3GRCA 3L40A 4Y6RA 4MX8A 4Q4HB 3IUSA 3LCVB 1G5PA 3P2YA 2CNDA 2EC5A 2P2CA 3M5WA 1H85A 4BDVB 2GK6A 5FNZA 3M3HA 1SA0B 1K97A 4PCVA 2HRDA 4E03A 2YDXA 2VZLA 4J49A 2FHRA 1WVGA 1FYFA 2EDCA 2C9MA 4RVHA 1TECE 3ANTA 2QGZA 3QPWA 3PIDA 5FNVB 4BL5A 4ZT2A 3SF8B 2CHQA 2DUNA 4Z5XA 2BERA 3WGZA 3NKLA 2PKXA 2Z8YM 3O94A 2CCGA 3MINA 2DCTA 3V34A 4S0ZA 2B35A 1OILA 3ZZ0A 3UK9A 4F6RB 4QDKA 2JG3A 4YREA 4D4KA 1AR61 3Q2KA 1P1HA 3QELB 2YC2C 2BBWA 3X44A 4DWWA 5FR1A 4JDPA 3LOBA 1IK6A 1QMJA 2E37A 1NVXQ 3C5VA 4AY6A 2JKZA 4F8YA 3BIFA 1USWA 2I45A 1WHSB 4TT3A 2OHJA 1QJU2 4US0R 4Z99A 3OF1A 4OP1A 1A8PA 1Z4MA 1HY3A 2H2WA 4WESB 4DV2B 3AOEC 3I3EA 1H1IA 4LTDA 1JUDA 1UPXA 1JN0A 1T0JB 5D8AB 1DLLA 3I9NA 4Q4CA 2JJ2D 4XIIA 2SHKA 3T1MA 1L7QA 2QT1A 1DPFA 1P39A 4HH1A 3I2JA 3G1TA 1G21A 4NV1A 2GN3A 4CFSA 3R44A 3DOFA 1NP6A 1X70A 5DJ5A 3CX4A 2IIQA 3CNQS 2JDYA 4RQPA 2Q07A 1LHOA 1J7JA 3QVJA 4FFBB 1U28A 3S7IA 3KYCA 4DR2B 3PT9A 5KHJA 1X86B 3MLEA 2W46A 3PX7A 3RFUA 1XTIA 5LEJA 3SCGA 5BW5A 4M01A 4OFGA 5JPDA