2WAOA

Structure of a family two carbohydrate esterase from clostridium thermocellum in complex with cellohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
GILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDSITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2waoA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2waoA02
1UY3A 4KWUA 5JXIA 2WAAA 3SEEA 3T2OA 4M8KA 1F4HA 2WABA 4BK4A 1JZ7A 2CDPA 1UYXA 1DEXA 3J7HA 4QX0A 4XUPA 2L9LA 1ULOA 2ZEYA 4OAPA 1UX7A 2V5DA 4JX0A 4A3ZA 2WO1A 1H6XA 3FHAA 3NJVA 3WF1A 3W5MA 4NRDA 2RJ2A 3VD3A 3MV01 1UY2A 3WF0A 4D8MA 5EIYB 4H08A 1Z8HA 1NUKA 5JD3A 2E31A 3IIIA 4S1PA 5LA0A 2B9VA 3T0BA 1XPWA 1ESDA 2QQMA 1KGYA 3CMGA 3SEPA 1NKGA 1SDDB 2R7EB 2KD7A 2C26A 4QB1A 3T0DA 4OAOA 3A7QA 2EIBA 1D7PM 4PQQA 4A42A 3HEIA 5JUVA 2WN2A 5DN2A 2YB7A 2BBAA 3NJXA 2J7MA 4Z2AA 4FI9A 3DYMA 4GWJA 3IAPA 1L7RA 2VOTA 1YZFA 3FL7A 5IHRA 3VD5A 1LNSA 2VM9A 1GQPA 4MGSA 2WO2A 3DT6A 2C4XA 3WNPA 3SLRA 2HSJA 2JDAA 2WN3A 1ULPA 3C7FA 2Y6GA 1WKYA 5HXMA 3DT8A 4Q9AA 4RW0A 2DDUA 2OKXA 3OB8A 2XQXA 2J22A 1UYYA 4AG4A 1W8OA 1JYXA 3HN3A 1O8PA 2PQSA 4DUXA 3T08A 1TG7A 3P1IA 4QB2A 5G04L 2EICA 4P08A 3VD7A 3PUIA 5A1AA 1NAEA 3CZJA 4KI5M 4TX1A 4MADA 4PT6A 1W9TA 3ACFA 4XUOA 2QQJA 4P00B 3LPGA 4ZZ8A 2J1UA 4JJ6A 4MOAA 1JYVA 5C71A 1JZ2A 3GGLA 5JR2A 1RYYA 4PF1A 2QQLA 4QB6A 4XUQA 2W94A 2YG0A 4CUAA 3F2ZA 3A22A 2W95A 3GM8A 3C7GA 1BWQA 2VC9A 1JU3A 1OT5A 1P8JA 3MILA 5JMOA 2J1VA 2WBKA 3WNNA 4XUNA 3BGAA 4MO3M 4JJ4A 1PP4A 2QBXA 4XZUG 1F4AA 2VCAA 1J83A 2JE8A 2X10A 3LEGA 2JKXA 3CDZB 1UYZA 2VQUA 2WZEA 3WF2A 1SG3A 4UI9L 3W5NA 2WUHA 4OMCA 2E33A 1GOHA 4A41A 4CU6A 3NQHA 5HPOA 1UXXX 1O8SA 2HLEA 1IQDC 1UY0A 3ECQA 3DYOA 2BERA 1PMJX 2W5FA 2ZEXA 3I2JA 2Q0QA 2VZSA 3EYPA 3BZWA 1MPXA 3I3EA 3IB3A 3P6BA 2RVAA 1JHJA 1PX4A 3ACIA 2W1QA 2ZEZA 2ZEWA 4DEQA 2VO5A 3I2FA 4P02B 1DYOA 4BJ0A 1GMMA 2O14A 3OGVA 4AAXA 3PT5A 3CKHA 4DXRA 3T09A 3DT9A 3FN9A 3HNYM 4DUWA 3T0AA 3UESA 4K40A 4XUTA 2E32A 2EIDA 4UOJA 4Q7QA 3JXSA 4W50A 2VZQA 2J1EA 1NX9A 3BN6A 2LS6A 4OYUA 1W9SA 4CUCA 3C7HA 3WNMA 5G05L 1CZSA 2WQ8A 4QAWA 1ESEA 5I0DA 3MUY1 2W1UA 2YFUA 2J1RA 1U8UA 3IAQA 2X09A 4GWIA 3WNKA 4QX1A 4ARYA 3CIHA 5DQ0A 2VPTA 2Y6JA 5C70A 3RJTA 2YC2A 2VZPA 3ZM8A 3OGRA 2XOMA 1JZ5A 5C7GA 2W46A 1ZMBA 1W9WA 5J1XA 3THCA 2CDOA 4XVHA 5FUIA 4CU8A 5CYYA 3C7EA 2VZ3A 4A45A 2VZRA 1OF4A 3SKJE 3C1UA 1L7QA 3MUZ1 2LW8A 2QQNA 3UETA 2V72A 4JKKA 4HYQA 3HOBA 2VZTA 1XNTA 3I2KA 4UAPA 4M4PA 3AC0A 3K46A 3GDBA 2B4KA 5IYYA 1GOGA 1CX1A 2DCKA 4RYDA 4BXSV 1EUUA 4JHLA 2JD9A 3ACGA 2XONA 4OZOA 1OD3A 2WZ8A 2Y6HA 1JYWA 2VR4A 1US2A 3OG2A 3MO4A 3VDAA 3VDBA 3P94A 3CZUA 1JU4A 4M4RA 1FXWF 2VL4A 4QX3A 4CUBA 3SKVA 3HNMA 4KMQA 1GUIA 5EJ1B 1I5PA 2W1SA 4ET7A 2DCJA 1CIYA 2W92A 4TTGA 4K9SA 2W1WA 3OEBA 4ZXEA 1VYHA 4RSHA 4IYJA 3OEAA 1DLCA 1JI6A 4QDRA 4YPJA 5JXJA 2VTFA 2W3JA 3LE0A 2WAOA 3KVNA 5BN1A 4L0PA 3IDAA 1SHWB 3EB7A 4E8DA 1K45A 2W47A 4JGGA 2VCBA 3WSOA 5LCWL 4RN5A 1EUTA 5DMYA 5B5SA 5F7UA 3THDA 3K4AA 4JHZA 2VZ1A 2BGOA 4DXSA 3UNPA 2WO3A 4A6OA 3I2HA 4ZY9A 2X05A 1DP0A 2VCCA 3K77A 4LKSA 1OF3A 1BHGA 3E1F1 2VMDA 2VMFA 2Y6KA 3VD9A 3I97A 3ACHA 1IVNA 3I2IA 2E26A 2ORXA 1UWWA 1ESCA 5JXGA 4K3UA 1J84A 2XHNA 3I3DA 4QDSA 2Y8KA 2W87A 4JKLA 2ID4A 2VQTA 3WF3A 3PUHA 4QPWA 1UMHA 4A4AA 4K7JA 1O59A 1TVGA 2VZUA 3T2PA 3ETPA 1OH4A 2EIEA 1JZ3A 5B4NA 4LPLA 4DEVA 1GOFA 1UZ0A 3DECA 1JYNA 4GZ9A 4DXTA 3HPNA 4DUVA 4W4ZA 3I3BA 1W99A 1VJGA 5JXHA 1JZ6A 4CU9A 2ZXQA 2W9XA 2C9KA 3MV11 4TXWA 1ES9A 3DCIA 1V2GA 2BGPA 5HOEA 2APJA 3ABZA 1BWRA 4ARXA 1J00A 1UXZA 3VD4A 1CZTA 5IJRA 1JRLA 1CZVA 2VMEA 3DYPA 3FHQA 1UMIA 3A21A 3K4DA 1DEOA 1UY1A 1K3IA 2ORZA 5DPNA 4CVUA 3VDCA 3NNGA 2YC4A 2V4VA 3OBAA 3NRUA 2W91A 4JKMA 5IFPA 1W8NA 3W7VA 1WCQA 4W8JA 3I2GA 3CQOA 3GXUA 3HJRA 2QQOA 4A44A 1W0NA 2Y64A 1K42A 1GNYA 3DC7A 2VMCA 3WNOA 4LQRA 3U37A 4BK5A 5LA1A 3K75B 3HP4A 3WQBA 3T2QA 1XNAA 4HF7A 3D3AA 4JKOA 4MGQA 4CU7A 2YFZA 1JZ4A 1JZ8A 1FXWA 3WF4A 2WDBA 4OUEA 4QDQA 5EJZB 5B4XA 4XURA 2Q0SA 3OGSA 2VJXA 4E8CA 4BDVB 4ZZ5A 2HYXA 5LA2A 3LEKA 2QQKA 5CD9A 1HN1A 2J1TA 2BZDA 3LQCA 3WEZA 1K7CA 1H6YA 2J1SA 1US3A 4OMDA 4LHSA 2Y6LA 2QQIA 5IFTA 2VZOA 1YQ2A 2J1AA 2VZVA 3MBWA 4D0QA 4PPYA 4I8IA 3A23A 1WABA 4QX2A 1GU3A 4IUGA 1K12A 3C8XA 4P5YA 1R64A 1PX3A 1T2XA 2WYSA 3LEIA 5A4AA 1PMHX 1KEXA 1UY4A 3C7OA 3K4ZA 1XC6A 1BWPA 3LPFA 3HNBM 4HG6B 2RV9A 5CZKA 2Z4FA 3WNLA
chains in the Genus database with same CATH superfamily
2QN7A 4UDYX 4YACA 2C4UA 1A77A 3TL6A 2DWOA 3WGKA 4KWHA 3RK4A 4RJIA 5K45A 3DGFC 4G8BA 1LZKA 3H3LA 5A1JA 4OHKA 4QGLA 5F21A 1WZXA 3O38A 3L7NA 3B1WA 1F0KA 4AGVA 2CFCA 4YZ1A 3QUSA 5B6IA 1DB3A 3E03A 1HQDA 4BPBA 1ONOA 4LHVA 1DIRA 2QLMA 1QH1A 1T3GA 5AVAA 1JMUB 2QG6A 2VOJA 2P2DA 1DADA 4WZAE 5T4HA 3LUDA 5J4KA 3KWVA 1GSOA 5LXTB 4IG4A 4MKIA 1I4LD 3R7DA 5B2GB 3ZX4A 1MVNA 3JQDA 3NGLA 2R48A 4M21A 3N86A 3JVIA 2X0FA 1DBSA 4RC9A 4K8FA 1ZICA 3CH6A 5DDIP 5A3OA 3GBGA 4OMFG 1IATA 5IDVA 1WQ1R 4KBGA 5AJYA 2JI9A 2HLPA 2POCA 2JFVA 1PO13 1I2CA 3I34X 4TMYA 5JZMA 4PHCA 4II3A 3IEVA 2VCAA 2Z1NA 2QMHA 2AQIA 3F5QA 5BSWA 2OMEA 1FNZA 5CLGA 1O58A 2O54A 3M6LA 4BMOB 2RCYA 5T3NA 2EF0A 3DQQA 4EPXA 4BXOB 5CG1A 5ALQA 1JB9A 2KWIA 4WWHA 1GCAA 4QUAA 3CMMA 1XRQA 3IQDB 2AYHA 4RH0A 3DXXA 3WG3A 3IMMA 3E82A 4G41A 1JLRA 4CT5A 1W8TA 4R84A 2YICA 2GD2A 4YAFA 1VZ3A 1ZGHA 4TSRA 1W96A 5EWLA 1KHTA 4IW3A 2N9UA 4QARA 1UN1A 2C2KA 2QTZA 4ZTZB 1U0SY 3ZY6A 3HL4A 5CYOA 1M6VB 5G05L 1P7WA 3ZHBA 1S55A 5DBIA 2XTMA 5EJ2A 2NZWA 3I4LA 3MIFA 1YWKA 4P7JA 2XY4A 1Z4QA 3NOQA 3FOWA 3CEMA 3G8YA 2HCRA 3ZPXA 2DECA 3A9UA 5JSRA 5G0VA 3VKFA 4U2KA 1D6JA 1DC7A 3JAWB 4M3NA 1A82A 4U7HA 1X38A 3W9UA 4AG5A 2WFZA 4OSEA 4O4IF 3DBVO 3H83A 3C5VA 3ZI0A 5E4FA 2IOFK 1X1BA 3CX6A 4C4RA 5FX2A 4F3TA 1VL0A 2Q4SA 4IESA 1Y4DE 2EKPA 2CL0X 1L1RA 2OV8A 3K72B 1QRTA 3WDKA 1RW4A 1OHHA 3GDGA 3ICQB 1T9KA 4FIDA 3UK2A 3BZUA 3DVAB 1QU2A 2J9FA 1QTQA 3U14A 1JOJA 2DOKA 2Z04A 1J2JA 2CK3A 3KB6A 3QIAA 5JXGA 3DWEX 3E4DA 5C46F 3DGEC 1I3NA 2WF7A 3O92A 2XCTB 3U17A 5JARA 3H87A 1FYWA 4WM8C 5C31A 1BHO1 3BMXA 4XM2A 1HDOA 4TV8F 1EFDN 4JVLA 2QD1A 5BN4B 4S2UA 4P9JA 1VBKA 3VISA 4O8ZA 1TEVA 5CAEA 1T2AA 4MVTA 1RVF3 4G2TA 1IMOA 3GHYA 4Q9LA 1BE0A 2CLOB 3V7YA 2JDUA 3D7MA 4LK7A 3OVMA 2EP8A 2FQWA 2D5FA 4HLUC 3CY6A 4JSTA 1QAQA 2CC2A 4WIAA 3ZVLA 2V09A 4DBLE 3IOMA 1UZLA 4FSHA 2HY7A 5JZBA 1RWKA 1C28A 4FFFA 1UKAA 4DLRA 3RADC 3P0HA 4NNOA 3E5QA 1LDBA 4MV7A 4WKNA 3WISA 3OYWB 2DLDA 4M00A 3VBSC 1WBLA 4YGCA 4ZEXA 4BFTA 2VDWB 4M0DA 2DWUA 1C9DB 4B6RA 5KTNA 1MS4A 2WNVB 2D8AA 1EQ2A 2VVEA 4D3ZA 3PJDA 2Y6LA 3UWOA 4JT2A 2CXRA 1FLNA 4DCOA 1EAYA 4LC1A 4CBVA 5FOTA 3AVUA 5D00A 3EULA 3G7DA 2O4CA 1T9BA 3PFIA 3U80A 1CUAA 1N78A 2RB5A 3D2CA 4RKEA 3VR4D 3ZE2B 2R751 4ZI3A 4KLRA 2SICE 3LQ1A 3K51A 2EJTA 1WUTA 2J3MA 4C2UA 3J81A 3AESA 3Q7TA 2ENWA 4I5GA 3AVQA 5AH0A 4QASA 1YZTA 2ENUA 3QFSA 1BKYA 4IGPA 4MQ6A 5TQ2B 1NY5A 1KAQA 2B9VA 4KXNA 3N0XA 3N2GA 3T3IA 1RWMA 3EIQA 2I74A 3RBXA 2ZBVA 1EZZA 1XXHB 1M1NB 2DTEA 5LRRA 1JLKA 1PJZA 5ERGB 1MO2A 4FI9A 2QTCA 3LDRA 2OZLB 4UW4A 1WZ2A 3MTIA 1KO4A 2VJNA 3BFPA 1XAGA 1VE7A 4QODA 2Y71A 5H7XA 1A34A 4MJ7A 4DQLA 3WGLA 3W5UA 2GM9A 1NI4A 2H1WA 2V3CC 3M3OA 3FZYA 2QWXA 2IGTA 3B8EA 1VI2A 4LSWA 3M6UA 2BHTA 3DCNA 4G09A 2RDSA 4HNHA 3EGWA 4NENA 3CMCO 4TTRA 4CNQA 4UREA 2P8JA 4XWAA 2DUUA 1MVLA 5FZ3A 5EFUA 4DY4A 1YIOA 1G6HA 5B58C 1V0AA 1DGRA 5MFZA 4IGAA 4IV0A 4Q4W2 3WHIA 1H5NA 5BNTA 4C7BA 2X6TA 5LWBA 3ND5A 1W6MB 3CF6E 2VQUA 2QQPA 2WZEA 3HLYA 1N9GA 3CU7A 3UJDA 4IHKA 4IMIB 5FHQA 1YZNA 3RU7A 4YP0A 1ECPA 3P6BA 3E5NA 3WGVA 1BH6A 2PD6A 2E18A 4XM1A 1N1VA 1GXSA 4DAOA 2WDPA 1DBVO 4OYYA 1M4WA 5EE0A 4BMSA 2Y1CA 2HO4A 4K40A 4MW7A 2AQ8A 1PV1A 4DV7B 3EHDA 4ZZ0A 1Z62A 2H0AA 4IXMA 4GR4A 3T12A 1Z2PX 2RD2A 2ABWA 3MQFA 3E8XA 4WJKB 3ZIWA 5CIYA 1W6QA 1TT5B 2OLKA 4OHFA 1QFMA 2O3TA 4ABYA 2UYGA 1HLFA 3LSYA 3IBGA 1J8YF 1D4ZA 4BCCA 3KMHA 3TRHA 2Z2ZA 3E9QA 3ACGA 4DY5A 1JYWA 1ZONA 3GA0A 1MTOA 2RJNA 2VUSA 2PAKA 4XWTA 2REQA 3LX8A 1P0CA 4AHZA 5E1RA 3L3BA 4OBWA 4M01A 5DP1A 2Q1SA 1ZBA2 3H5TA 2F8TA 2IXGA 4LS3A 3RV3A 5C34B 1M7BA 2NU6A 4F83A 2ZQYA 1DU3D 1IZ9A 2VP9A 1EE2A 3TMKA 2RDNA 4COVA 3T38A 4Q1RA 1JDNA 2H17A 3SHVA 1NW5A 1C8VB 1W46A 3TSAA 1YQ5A 3GT3A 1NKSA 1YVRA 4MK4A 4XIOA 1RRCA 2FZWA 4ZFNA 5F7ZA 3MUNA 1S9HA 1JZ3A 5BN5A 1W39A 3CG4A 2Q1UA 2I66A 2BRTA 5F5IA 2VYCA 2QK4A 5A0TA 1U1EA 2DFKB 1Y6JA 2AQHA 4GX1A 4LJ9A 2WAYA 3DEHA 4W9RA 1DF0A 3QUBA 2VJAA 1OVSA 4O2RA 1TTTA 3ALQA 5AQEA 4KFSA 1U5BB 4HSJA 3I05A 5JRJA 4O5OA 5A6ZA 1F8UA 4CQLA 4L07A 2YS6A 4H15A 1XDUA 4I1SA 4TS9A 5AVTA 1QBKC 2DCUA 3CUEF 2K9ZA 3FTPA 1G17A 2A2ZA 3BFXA 2WR9A 4RMGA 4HY3A 3RYFA 4CEYA 3WL6A 1PBNA 3AP6A 1T2VA 4LJYA 4JQSA 4EKDA 3LW7A 5L9AA 1GFF2 4LE4A 4HDKA 5DM0A 2G4CA 2N7GA 3ISJA 1NBME 3KP1A 4E4TA 2NM0A 4E1BA 4Q29A 4MHOA 4R8MA 2Z5VA 1IAVA 3MBWA 4EY6A 4PFKA 1W85A 4R05A 5DE3A 4JDUA 1M3SA 5FULA 4PYOA 3GUVA 3J7MA 5CVCA 821PA 4P6VF 2RBGA 1RUF3 1X7ZB 3WCSA 3KOUA 4QX7A 1ULUA 5HIJA 1FI2A 1KORA 4JX0A 1RZUA 1G9FA 1G8MA 4TZ0A 3PNYA 1FBNA 3GD7A 1VPEA 3G5MA 1NCQA 3FFQA 1Z8HA 3WR0A 5AVRA 1N2SA 1EP0A 2P75A 3TEZA 2ZRDA 3ZDAA 3POSA 2GTIA 3WDXA 1YUMA 2ZT6A 4CEWA 2EW8A 1Q2XA 3SIXA 2XA1A 5DYTA 3R74A 4PC1A 1HDGO 4IUYA 3COWA 4NJMA 4ZHQF 3IWZA 2YPDA 3DAHA 3DMRA 5BWLA 3V3TA 3I6MA 2XDVA 5KTMA 3N8NA 2R6QA 2XGMA 1T3ZA 2FFQA 4Q7EA 4ZQHA 3GLFB 1SXPA 2GPWA 3Q0IA 1BEZA 2Q6KA 1QHXA 3TVDA 4O4JB 3P1IA 2BAGA 1K7EB 3V65A 2FMHA 3CRNA 2H1LA 2OENG 2C7VA 2ZZKA 3VNVA 2FWMX 3RYHA 2O7NA 1I33A 2QMZA 4PIMA 3N3BC 1AKUA 3TJRA 5B3JC 1WP4A 3KKEA 1VPDA 1H4GA 5TB5A 1K6XA 3WQ1A 1S2IA 4JSRA 3PLRA 1WM1A 3O6VA 4X1OA 1B6RA 4DTCA 3WLIA 1DBNA 4DV1B 3U7RA 4G24A 4PBOA 2FF5A 3MRVA 3TNDA 1R6AA 4HB0A 2LXNA 4YFWA 1I2DA 3RUPA 1VE9A 3HE3A 2EHDA 1ND2A 5IKEA 1L7BA 1KP3A 2WYWA 3HY3A 3KQTA 1JFFA 2OAGA 2ODPA 2IV3A 2D44A 5JNTA 1FMD3 4R8RA 4O2BB 2W1QA 1YQTA 3NAGA 2ARXA 4BJ0A 3EUWA 5DEOA 3JBG3 2ECFA 2Q28A 1OH8A 5EMHA 4H16A 1BFDA 3A6GA 5IABA 4RZ3A 5JCJD 3I64A 3K3OA 2IXCA 4MCIA 4YV2A 1N2BA 3EXFB 4PRLA 3AEQB 1M67A 3DVRX 3MFCA 1UDAA 1KXGA 1QH6A 5TQVA 3WV4A 1PWHA 3CZMA 4KMSA 4BQEA 4FP9A 4WXEA 3ONVA 4HGPA 3A06A 1RUG2 1CBUA 2ZJ5A 1GTZA 1N3IA 5GV8A 2AXPA 1MORA 3NVKI 1R0XA 1W9WA 2RGRA 1OLMA 2O8CA 4CEHA 2HA7A 3P9XA 5CYYA 2Y0PA 3EXEB 2R86A 1S4QA 4LF6B 5KKCA 4AYUA 4RADA 1PZGA 4F0JA 4BKUA 4OIFA 2RMKA 3OZEA 3C1OA 1KH2A 4DREA 4BO0A 2MMCA 3H5RA 5D87A 4B6QA 1Q7TA 1GPLA 3DBRA 5C4MA 1OF1A 3K1AB 3JQQA 1E4EA 3PKZA 4CUBA 2OGWA 2ZAAA 2JFBA 4M3CB 3OX3A 2WJWA 1DAHA 1B0ZA 1OI2A 1GZCA 1JXMA 1AQ6A 1FP4A 1M76A 1SK8A 2H5LA 3PGXA 2IWRA 2O3UA 4QUDA 3QU9A 3H18A 3JQ8A 5L73A 3UPDA 3X43A 2J9GA 1AK1A 4HMQA 3EPJA 4CDWA 4AMBA 4BFZA 3WP1B 2BOVA 2H0RA 2R11A 3QUAA 3F6SA 4BLPA 5B2EA 1BHGA 4UJ3A 3D4OA 4ERNA 1CIWA 1ADJA 4INPA 2G1KA 1I10A 5H9QA 3E48A 2WJ6A 4TLCA 4GLBA 4AT1A 3ZE1B 1R6VA 4IRMA 4TT3D 1ZKDA 5K01A 2NUAA 3R6WA 5JFOA 1KDOA 3R05A 1E3DA 4PRKA 2P5TB 3ROUA 3DEJA 1ODNA 3QBJA 1PHMA 2FEPA 3ETDA 4X6RB 1USIA 3WJ1A 3PL1A 4HLDA 3TM4A 2OCDA 3DCIA 5LZ5A 4F45A 2WLPA 3UBMA 1I3HA 2VMEA 4V39A 4LZOA 3D4KA 5FPYA 3KXPA 3BN3A 3AQIA 4YUXA 4Z8XA 2OEPA 1JKJA 3A05A 3PUVA 1SN7A 3F5MA 1NSFA 1ZEMA 2BFBB 4GRDA 2C59A 3M1IA 3EH2A 4JELA 4NYIQ 2IOQA 4UE2A 4MA5A 3I9NA 4IGOA 1QCZA 3QU2A 3QFCA 3ZWAA 4JKOA 1UKEA 3BGVA 1OAKA 3Q7QA 1QIHA 2CLCX 1O94C 1DKQA 2JE7A 1UM9B 1OXCA 1E79D 2J1TA 1OLXA 5TPZA 1UBLS 3ZE8A 1ESZA 3ULKA 4LHSA 3B5EA 1QC5B 5HF8A 2YRWA 4AS3A 2IUYA 1FLVA 2OAEA 3UJPA 3POIA 3KVYA 1DGRN 1R9MA 1EDBA 4ZVUA 1Z7EA 2VJYA 2WG0A 3G7UA 2V4ZA 3KOWA 4HFJA 3TAHA 3CX7A 5DXJA 4C7OB 2GC3A 3P8ZA 4Q24A 3OQJA 3T9CA 5JBQA 3CS3A 4DBVO 5KNBA 1LC0A 5JC1A 3C45A 1JOBA 1Y98A 4WN9A 3BXHA 3FF1A 5FY7A 1IN1A 2BMVA 4MKHA 3V8MA 3WK9A 1H6XA 5K7PA 4LZPA 1MC4A 3DBLB 5HE9A 5EUQB 2GC1A 5JFGA 5KMGB 2V6BA 5AKEA 2QD2A 3F6RA 2P2GA 2H07A 2YB7A 1TMF1 1HH4A 4IJUA 4IOJA 4RIGA 1BMFD 4XQWA 1T8UA 3MJSA 4YWJA 4FX5A 3V5NA 4TQGA 2HQBA 3WE7A 3NDRA 1SFNA 2CAUA 1NKTA 3O4IA 3LNCA 1FIUA 5TJ9A 4WZ6A 3IV9A 3DVQX 1K2VN 3INGA 2HOQA 4MVXA 1NW7A 2FCVA 3Q8CA 1OUMA 4G0VA 4CL2A 1AKEA 3AY3A 5ED4A 1LD3A 4Q9HA 4D8XA 1VRBA 1CZKA 5AW7A 1AC5A 4IE6A 1VXRA 2FLKA 2W68A 8OHMA 4AJ1A 1O6ZA 3WYNA 3PENA 1DKLA 4MDHA 5BURA 1ULCA 2EW1A 3GHMA 3PCRB 4REMA 1F5JA 1C80A 2ZI4A 4YRIA 1YBFA 2PBZA 2YYYA 4TSVA 5TE9A 4KQJA 4UVHA 5IN5A 1JEDA 4IL5A 1CUVA 3EIEA 2ZB8A 2I80A 3GZEA 3R5FA 3JD2A 4EGFA 1QV9A 1TYEB 1VFNA 4D2IA 1AUOA 4LA3A 2RH4A 1KPGA 1VBC3 1MMFB 1YI1A 1XRNA 2R6JA 3AR5A 1UWKA 3DTVA 4EDHA 1XL1A 4U7GA 1MPXA 1BDMA 4Y30A 1OA1A 4EWAA 2BVVA 1QDLB 2OBLA 3OEHA 2EX4A 1SVIA 1IB6A 4DUWA 5A4MS 3D59A 4FQ7A 4Q9DA 1UBMS 2GJKA 1QGAA 3GRPA 4N49A 4LW8A 5JDCA 2WE8A 4QVGA 3OY2A 3FSEA 1MLDA 2PLNA 2JL1A 2Z9CA 1F8YA 4M8NE 3PQ7A 3QKUA 2EHJA 2C8LA 3DW1X 3K48A 1XU9A 3TKYA 5FZCA 4W8HA 2FPMA 3OGRA 2BHNA 3W34A 1XHEA 3L04A 3AZOA 4XYXA 1CDZA 5T50A 4PAGA 5TT0A 1HKHA 1OMIA 5JFTA 1X9GA 5DI3A 1SPPA 3TIFA 3OP1A 3ZD9A 4O25A 2ZT5A 3OTHA 3VA7A 4C3ZA 5ED0A 2J0UB 4M0MA 4L75A 3I59B 2ZYHA 1JLLB 2HRZA 3R7WA 1TL7C 4JN6B 2WZ8A 2ZJ3A 4RPKA 5DEIA 1T4CA 1E2HA 3ZGLA 4BTLA 4BNUA 4DPNA 3JQRA 2P3YA 5J98B 1HA3A 1XNQB 2Y1GA 2R6FA 5JECA 2B61A 2YS7A 4Y2TA 4GD4A 1AKMA 1NBIA 3BEDA 5BOSA 5JCTA 5EZYA 2V7VA 3A9TA 3UUGA 2WMDA 4WV3A 1ESMA 1MAHA 4ZREA 1MHPA 4E2YA 3AHGA 1VA4A 4CLXA 3ZXFA 4K0RA 1J2YA 3BE6A 2V7UA 7AT1A 1J20A 5F1YA 1NZJA 2FW7A 1I7DA 2CBGA 5ELMA 2GBPA 2EX0A 1NQDA 3PUJA 4PG8A 3CZ5A 1O6BA 4JI3B 2VXRA 3NM6B 4UC0A 4R4JA 1LOBA 1K66A 2X58A 2A9VA 4QJIA 1MW8X 1QYVA 1AH2A 2VYVA 4O0MA 4TRMA 1VAMA 1GNLA 3C3XA 1TMKA 2P7HA 5ILQA 4EF4A 2NZVG 4JCOA 1ALYA 2KHZA 1VJRA 3OM1A 1WCQA 2PWAA 2G0TA 4JI8B 1GN9A 4E5VA 2F8SA 1KIMA 2GCEA 4DYHA 4PIXA 1TW3A 2RIPA 2C1XA 4R2JA 4X1YA 1VGQA 4IH4A 2PSSA 4JGZA 4BH9A 3D3JA 1H2ZA 4DWVA 2FDXA 4DLLA 5B4XA 2DR2A 2OCLA 1X1RA 2ZYWX 3TZLA 3MFYA 4EELA 2BUKA 4QPPA 5K3FA 2HXYA 1K0FA 4G1BA 5HE8A 2BP7A 3OIFA 2EEPA 3ON5A 1J25A 1NN3A 2CHFA 3NMUF 4L0MA 4X3OA 1NF9A 3HJCA 2E6KA 2AG1A 2HZBA 1PX3A 1OYYA 1IXYA 2F4PA 2ZJBA 2WFMA 4GFDA 2Q3EA 2O1EA 5JXIA 1GAWA 2QDNA 3OQBA 4M8KA 1Z6GA 3GRFA 3MPOA 3IIMA 1AYM1 4M55A 4GECA 1R3UA 3TB4A 1CAVA 4C4PA 3MIGA 4EB8A 4JKIA 2WC1A 4NBSA 2FZVA 4AJ4A 1YIPA 3DEFA 2YJZA 5IK7A 3LFHA 3JY6A 2IC5A 4A6EA 3MZ0A 2FWRA 2BP6A 1AIPA 3CKMA 1ICIA 5JUVA 2HBYA 5FUQA 2H1SA 3L0DA 1VL8A 4GWJA 4XE5A 4CF6A 3AZZA 4GKKB 1MKYA 1W9YA 3RTGA 3GYGA 4DQVA 4W7HA 3C6ZA 1RAAA 3IUSA 1L8AA 4CP2A 5HXMA 2V0NA 3UC5A 5GZGA 1SUPA 3F3SA 4DDKA 5COAA 5G04L 1FPMA 5JZGC 4NIMA 3LJKA 4E94A 6YASA 3HGMA 2QOEA 3F7MA 4JI1B 1GAQA 2BEWB 4CV1A 4D69A 4D81A 4UMDA 3RYIB 5TY0A 5BY5A 1MEEA 3DFUA 1PW5A 3DHVA 3LF2A 3KCNA 3L40A 4IWNA 4Q0VA 4CZ2A 1NC1A 5H9VA 4ROTA 1IIBA 1T0IA 2QBXA 1FYXA 4PZCA 3NTRA 4E1VA 1CRLA 1SBCA 1M2EA 2HLDA 5IAAA 4UF0A 5IJ0B 4Y6GB 1N3PA 1UADA 2IW1A 3UJ3X 5LQKA 3H4MA 1R8XA 4BRWA 3N0TA 2ZRJA 1J1TA 2A0YA 3X1JA 4SLIA 3DT9A 3KPWA 3JARA 4CM3A 3LG2A 4L0DA 4E30A 4EARA 2GBLC 4W6YA 3KQOA 1PVC2 3EIUA 5K8LA 3KSAC 4EG8A 1AN0A 3H2KA 3R0IA 2BDRA 5M5BA 1G6NA 3H3ZA 1H66A 1QP0A 3P5BA 1K0UA 1KK2A 1Y80A 3T3MB 4E13A 1E1DA 3SHOA 4CU8A 1BGXT 4D4IA 3G1WA 4RZQA 4WY8A 3G3EA 2R1BA 2IEZA 3IAXA 1U0HC 4UAPA 1Y48E 3OLZA 2C1EA 4A8JA 3NT2A 3ND7A 1UINA 3Q41A 2J0QA 3MRTA 1J99A 5CW1A 5AK5A 4G0UA 3MC1A 5FYSA 4IZIA 4KK4A 4UE3S 1XDDA 4CKEA 3ZSJA 2IUFA 3G17A 1H4HA 5CW2A 1H9CA 4GDMA 1UBRS 1E6LA 2H92A 2PUVA 4EN6B 4DCMA 3PFWO 4G5SA 4MUHA 3LT1A 2WU8A 5D3ZA 5KYYA 1X6VA 4AYTA 4L11A 2PSFA 4AF9A 1ZP6A 2G1MA 3PUWA 5L9VA 1QYRA 3SLKA 3VH2A 3MIHA 3PFBA 4L95C 3R4VA 3QMVA 1ODMA 4M76B 3E81A 2AOTB 4ZQEA 1K5JA 2F1HA 4JBHA 4XIGS 2CF5A 1TQ2A 2QL7A 5JS2A 3W90A 3GRRA 1E59A 3H2YA 4XF9A 5FPVA 5C8YB 1SKBA 2EKZA 3RNSA 2IFTA 3FM9A 1Z22A 4W5WA 2O8QA 2GO1A 4FXGB 3RPQA 1JR4A 4J49A 1XCBA 5C1PA 4WKBA 1LDYA 3LWNA 2ZYIA 1UZWA 3OSDA 1EDEA 1KSGA 4KK3A 1UEXC 1Y6FA 4DQAA 3GCZA 3F8WA 5LZ4A 4QM7A 4D4MA 4RF3A 4BLWA 4FMPA 2HBZA 2H59A 1X1CA 1RTVA 1J2RA 2EAUA 2XB9A 1GDHA 4EMSA 3H5AA 1MEJA 4YK7A 4YP6A 2QE3A 2OL4A 4NMMA 2B78A 1GICA 2BZDA 3U4QA 4XFCA 4IHJF 1K92A 3SZRA 1K86A 1J9GA 3HZRA 3VR1A 4CLRA 4NV1A 3WO1A 1R50A 4AI9A 4Q4AA 1K75A 1HO3A 4EATA 3RIHA 5FMDA 1OMOA 1DWOA 4MHTA 3ASVA 1ZRRA 4EVSA 5FTKA 3DWFA 1TJPB 2WKPA 1GKYA 2VVFA 1XZCA 3OGGA 2L9LA 3M7AA 4TRRA 4CDUC 4COKA 2JJ1A 2P37A 5CDFE 1XN4A 4KODA 1RMQA 4D46A 4HETA 1ADYA 1UBHS 5HXAA 1QJX3 1CHDA 3LKZA 4KL1A 3JALB 2B1QA 3LOPA 4PYMA 1VKJA 1KU0A 2ZHMA 2X22A 2WJPA 4RFT0 4RHXA 3THOA 3H6KA 5CH3A 5T5OA 3FL7A 3EZFA 1Q0LA 3O1UA 3G2JA 3ZJ4A 3NCTA 3FOAA 3NYWA 1AL0G 3ND9A 1NRXA 3BREA 3GPIA 4NFSA 1RXVA 4YMUA 3OFSA 3Q7RA 2JDAA 1C4RA 3SF8A 3C7FA 3N2ZB 3P9RA 3CLRC 2Z56A 3HN3A 3RWKX 2XYHA 3RI8A 3RF6A 2ES3A 4F3NA 1MDFA 1C3LA 3BUSA 2Q2OA 5EP3A 5B1SA 4MOAA 3WGQA 1YVDA 2XVXA 5BXQC 3IPVB 1H5QA 2C5HA 2E7TA 3E35A 1VE0A 3TIVA 5K0UB 1GFZA 3NBMA 3FFWA 1VSBA 4MW2A 4CI9A 4YG3A 4JUFA 3KR1A 1B0PA 5CFDB 2YR0A 4LOAA 3W5NA 4L5YA 5DV9A 1SMKA 1WLCA 1NZCA 3BOSA 4Q1CA 4QKDA 3UHJA 4M89A 3ZCQA 1SZDA 4HYYA 1AUPA 4DLXA 2C7QA 1H1AA 4Q4Y1 2GHTA 3RH0A 4DXRA 1L5MA 5BYKA 3GLGB 3QJ5A 1UPFA 2I03A 3DXYA 2IIVA 3LU1A 5G0WA 1D0VA 1QJU2 1DJPA 3VO8A 1KEEA 4LK3A 3CNAA 5JSFA 2X8WA 4ACAA 1P62B 1MOZA 5FYDA 2P9GA 5LQUA 1ZHHA 4UAVA 1UIJA 5FR2A 2VR1A 1UF2C 3IXLA 4LBLA 1C81A 2C3OA 4M2LA 4C05A 3FWNA 5J5AA 4AXBA 3D9QX 1ECCA 3PIIA 2BTOA 3UYJA 2R1UA 4UNIA 4JJZA 5SV5A 4M4PA 4IKOA 2IZ7A 4D0SA 1YS7A 2JB9A 4MXDA 5DX8A 2VJMA 2VZ0A 4BBJA 2WD7A 1OBOA 3GF6A 5FBWB 1D04A 2I4MA 4YYZA 5J4VA 3EPLA 1K88A 4JB0A 4ADSG 4EQVA 4XXPA 3IKLA 3I49A 2E4ZA 1JTVA 4GMFA 1I4DD 5AHXA 4YMGA 4LRSB 1G4UR 5CEJA 3WRYC 2P9JA 3RG0A 1KY5A 3TLCA 4WNIA 1KI6A 1EWKA 2DTWA 4RGAA 3ZHXA 4DM3A 2EG5A 2A4KA 4K9OA 1W29A 3MGBA 1X9HA 2BFCB 1S0CA 1F4PA 5KEIA 3ZQUA 4OLJA 3WB2A 3I72A 5AW8A 2XQKA 3RHFA 2JIZD 4HONA 2I34A 3CZ9A 2EYUA 2E9QA 5DUUA 1U0FA 4NPMA 4I02A 3ZH9B 4M1KA 2I4IA 2FDJA 4EWEA 1B43A 4E21A 4W5NA 1E69A 4Q66C 5T5JA 3CLKA 3HVJA 5GZ6A 3ECSA 4RL6A 5ICCA 1VL2A 2PYIA 3PJFA 2XMSA 3QG5A 4NIIA 4P0PB 3DJFA 5JS8A 4JX8A 1N77A 2EZ4A 4BQRA 2G9GA 1HE2A 3ROMA 2QPAA 1KDYA 3TWIA 3HP1A 2X5IC 2SBAA 3ESYA 2ZKNA 2B37A 1NGSA 3A37A 1L5SA 3QLTA 1E94E 4G8CA 1HEIA 4XURA 1AUXA 4I46A 2OX0A 3IPCA 1EAH2 1VDMA 5REQB 2WS92 2FG6C 4C07A 3HO8A 3KQPA 4PICA 5HG0A 3R0XA 4BOWA 4YEDA 4JSYA 4LXGA 1OBFO 3D0QA 4HEQA 2B5OA 2Q9CA 5DYIA 2MU1A 2XF2A 2QX4A 1YZ3A 1RXGA 2X3YA 1UY3A 2J6HA 5ARBA 5CA1B 5HQ3A 3W3ZB 2YZ7A 2JAOA 1ZH4A 1QH9A 4ZYLA 3UZUA 4LHZA 3QF4B 2BBVA 2Y38A 4QGMA 1GITA 3RANA 4LHLA 3ZCTA 3JQBA 5ALVA 4DIBA 4AS2A 4D7TA 5IG2A 3AM2A 3A7QA 1E3JA 1V8PA 3W3AD 4Z9AA 1GPBA 5H9PA 3FR7A 4KLNA 1AD2A 3ZVRA 5DN9A 4RELA 1MZFA 1RJ9B 2E1PA 5CFCA 4TROA 2XE8A 3AB0A 3BMCA 2VLBA 4MGKR 1C7RA 2O7VA 4CMBA 4CDXA 1MACA 3P9KA 1AKQA 2UY8A 5K0LA 3IILA 2R7LA 5I9MA 1T2NA 2RAPA 4YPFA 4E70A 1T1JA 1UMKA 3AZQA 5ADUS 4R0MA 3EZ9A 3ISVA 3KYJB 3NIDB 3BC1A 4I36A 3I6QA 1P2GA 3KV5A 1Y1KE 3T7EA 3C6YA 2F17A 1U98A 1Y43B 4EN8B 3JB4C 4B7EA 4AMZA 3AX6A 5J37A 1EWVA 2CKDA 4AWAA 4FPJA 3MILA 3ASZA 4MR7A 3FYCA 5ICGA 4BISA 3N05A 3M7IA 1JIJA 1ZOLA 3NNNA 2WIIB 1NRIA 1PO21 1QAOA 2JFUA 1Q74A 4UBIA 2D5BA 4FQ8A 2R2GA 4QPDA 5EKTA 3DPRB 1PX4A 4CTOA 3IEXA 4OI4A 5A33A 3BMNB 3IDOA 2GK6A 3HSKA 4TKZA 3TXYA 3ABQB 2DX7A 2ZSFA 1U0OC 3HCDA 1Q0ZA 2YW9A 1HOTA 3G85A 4A8TA 5FZ0A 5KYGA 3ET5A 2RJKA 5IZCC 2ZLBA 3FI0A 3EDYA 1VR3A 2JG9C 4NAOA 5LB6A 2IWGB 2AJCA 4UBMA 1N0HA 1T5OA 1L0BA 3VPBA 3VU9A 4GZMA 2B25A 2VSOA 2XKJE 5A03A 4FPEA 1W2GA 1P8AA 4RV9A 2VZRA 1A4XA 1XALA 1FOD2 1VRH3 2AT1A 4C76A 5KHHA 4MYSA 4X1KA 4BXSV 4Z0TA 3DB1A 1UDXA 3IMKA 4LJ4A 1IBKB 5A1FA 4DINB 1Q1NA 4LQDA 2A1XA 1C7EA 2VL4A 5E38A 4ET7A 4AY5A 5BNQA 2VO1A 3WL7A 1WLYA 5L4NA 2PHWA 4AY3A 2IZOA 5TS3A 2W6JA 4NOKA 3CF2A 4WCFA 2JDNA 4B8WA 2OO5C 4ND8A 2PUEA 1GRCA 3LPCA 4FLMA 4F7DA 1RWXA 1G8SA 3RC9A 4AJ2A 1NAIA 4YAOA 1RUI1 2BEUA 3NU1A 1ZR4A 3E1F1 1UPUA 4FZJA 2QQFA 3O91A 5H5JA 1GZWB 4EJRA 5HQTA 3IFSA 3JYHA 3VUEA 4IFBA 4GPIB 1PT9A 3W9BA 2BGWA 4E2WA 1DC4A 4TVSA 2OWEA 2YJ5A 2CCJA 1CEQA 3KXKA 5I4CA 5IBRA 3NHFA 1B93A 2BI7A 5I9SA 3VBSB 1ENZA 4XCBA 1DLJA 1F8XA 3OZBA 1XTVA 3EFEA 5FUWA 4YMLA 3F1KA 1U4NA 4LO5B 3QXHA 3Q3EA 1ZM1A 4L78A 4XI9A 2GILA 2J32A 3FKQA 4XBLA 4LV5B 3TBDA 1ZREA 4BNHA 4QT6A 2J4CA 4JI4B 2JIPA 1TIKA 2HWF3 2D13A 3AFHA 1LBQA 3R3VA 3C24A 1JB1A 3HP4A 3UC9A 8ATCA 2I7CA 2PJRA 2AZXA 3C8MA 3HXPA 3EX7C 4XYMA 4IJWA 3LX5A 2YDEA 4Y3OA 2DEUA 1U1IA 4L7VA 3E05A 2R8OA 2W98A 3PS9A 5JTTA 1W8IA 4HSLA 2V7TA 3E7WA 4BDTA 4KJXA 2JAWA 1GLVA 4LF5B 2QTNA 1DRVA 2VZOA 4ZA2A 5K51A 4V0ME 1PHRA 1ADCA 4G0YA 4LMFA 3WJ7A 4DCJA 3GGOA 2JI6A 3FLAA 1U8YA 4OBXA 1A1VA 3I42A 4OU4A 2R1VB 1RI3A 4HAYA 2IS4A 2DVAA 1V1MB 4GKBA 3ITQA 1NBMD 2C9DA 3SEEA 1BK1A 2VECA 2DBZA 3OHMA 1KKMA 3QLUC 2BHSA 4CKBA 2C5BA 5JBIA 1CWPA 4BZZA 4OAPA 4LSMA 1RAGA 3HJGA 2OPWA 3GAAA 4TRNA 5A7WA 1E60A 1FNBA 2OS2A 5DIFA 3BT7A 3KSUA 2MEV2 2XMBA 4YMVA 2OM6A 1TQ6A 1DPFA 1J8QA 2XBO1 2I87A 4KVGA 1DZQA 3ICCA 4AP6A 4JQZA 1FTNA 1UAAA 3E23A 1RKQA 4ZAZA 1VBE2 1FQKA 4OFGA 3VC7A 3ETNA 2CXQA 1MEOA 3REOA 3WSTA 2JLBA 1YVEI 2ZS9A 5DP2A 4LDJA 4FMDB 4QXRA 3SJAA 2V55B 1EVIA 4GSYA 1DQYA 3E9CA 3OWOA 3ZOIA 2ILVA 4HWRA 1MOSA 4M1ZA 5HCIA 3OEED 2B2CA 4QGGA 3DPRC 5BO5A 5K3BA 1TU0A 1X3SA 1A4RA 4R2KA 1UKGA 1JYXA 4GXTA 1KC1A 3PMSA 3QHQA 1DIBA 4GSKA 2ONKA 5KNCA 4TL6A 2G8LA 2OCGA 3P97A 4R9VA 4ZARA 2FWAA 1OREA 1XTTA 2QVLA 3NDIA 3PC8C 2DCZA 4S1TA 2W90A 3AERA 1NU8A 5FNZA 3MLBA 4TMTA 1U3GA 3MMZA 2CD9A 3KZXA 3MAJA 3SQDA 1LB2A 5KYKA 3EMRA 3JD72 5HFAA 3ZSMA 3PHGA 2H1RA 1X74A 5ER6A 1ENRA 2BV3A 1R1DA 1XTKA 1X1TA 1G3IA 1FFCA 1G2PA 2VAWA 1JQBA 3TSZA 4WLOA 1SD5A 1WY7A 3I2FA 4P02B 4J9VA 4GA9A 2NSLA 4O0LA 4NWVA 4A8PA 4L99A 3F67A 4OKNA 3VBOC 1ZN7A 4YCMA 2FPOA 1NF3A 5T4BA 2LGJA 3RJ2X 2GNTA 1T8YA 1L7MA 3KKMA 4NICA 1O97D 2QDRA 3UY4A 1ZK2A 2OESA 1RC0A 1J1UA 3ZFFB 1SHLA 3ONFA 3WMEA 1U8UA 3KF5A 1H2XA 4MRPA 4HATA 5DQ0A 1DEKA 3LV8A 2CE2X 5M0TA 3Q85A 5DULA 3D5TA 5CVTA 3QENA 3CVVA 4R8SA 1UPIA 1L4LA 2XX3A 4BE3A 4AZVA 3ZCVA 4ZYUA 5K6TA 4YHBA 4MGKE 1G5HA 1C8M1 3QYFA 3PTLA 1U12A 1Y7TA 5IVFA 2H4ZA 1PJRA 1SKYB 3OG2A 3JW8A 1H9PA 2XWBF 4UU7A 4JLWA 5I7OA 4IEQA 1H9AA 3E0XA 3KEMA 1QJ4A 4LBMA 3KLSA 1RLJA 2FUEA 4CCDA 1AKNA 2FWNA 3SKXA 3OFND 3EPHA 3NGXA 2EIXA 3MCUA 3QNUA 2K2QB 1C9MA 3RABA 1ODKA 3OBIA 3LD9A 2QTRA 1W04A 3PD0A 2PK3A 2W83A 2RI0A 3IUYA 4BYYA 2OO3A 3W0LB 1IVNA 3E9YA 4N65A 1MJGM 1BH2A 2WNIA 5K9ZA 3TVYA 3FTDA 1SQFA 4MWSA 1QGED 5A9TA 3DKIA 3DE5X 2ZX1A 1Q0SA 3LKDA 3OLWA 1H2FA 3JPWA 2ECPA 2P3KA 2PHLA 3DUFB 3L6EA 4CG1A 1GZUA 1QVZA 3E1GA 2QQGA 2QRVA 4LYEA 1E2JA 5JR3A 2C58A 2R1ZA 3ZX7A 1Y4WA 4I4TB 5IEBA 5HKAA 1LW7A 4B7CA 4GNRA 3RVKA 2A3RA 3PL5A 4IEVA 1BWRA 1R4MB 3CBNA 3L77A 2J5KA 4LWPA 4YGDA 3P32A 4Y2XA 4G5FA 3OBTA 5T55A 3ZSKA 4RH1A 4YQFA 1L1QA 3WLUA 1BW9B 4I4NA 3GY0A 1U2GC 1OZHA 4LYYA 1Q7GA 5BR1A 1EPUA 2PRSA 4QXPA 2AHRA 1T5BA 3TBHA 1Z34A 3LXUX 1W6OB 3EIXA 3I61A 2HU5A 4GGPA 4DJDC 1G7SA 1UF9A 4G4SO 1RYFA 4AICA 2DCYA 5TS2A 1JKIA 1WP9A 2WHYA 5CFMA 3GEHA 4KI0A 4WECA 4CHGA 3L7AA 1CY0A 1D2HA 4Z4QA 2ZAYA 5JSPA 3IBMA 4CCCA 3W9SA 3L06A 3V0AB 1HQKA 3UAGA 1WF6A 4KPGA 4L6IA 5L19A 1BWPA 3AETB 2BZSA 1G4HA 5DHRA 1AYN2 3NS7A 3EIHA 4UOZA 4XUPA 2XOKD 2RHBA 2YUIA 4L8FA 1KZYC 2A6YA 3O95A 2NZ8A 1P7ZA 1NT4A 3IAUA 4QPIA 4GPAA 1KI8A 2Y1EA 1D4M3 3TS1A 2J3DA 1DQ4A 3HKCA 2JCGA 1Y3BE 3OZCA 1B26A 2PFWA 4OLAA 1Z7BA 5HGJA 2ECKA 1R081 1JR3A 2E4UA 3CLVA 4KGVA 5LQAA 3BKWA 3IJEB 4TSFA 2GYUA 4B6SA 3KL4A 5IHRA 1PR3A 2LWIA 3EAGA 4TL9A 1LZLA 2GI4A 2HIHA 3Q8LA 1PG0A 4U36A 1VSVA 2H6BA 3A6LA 3MWYW 2J7PA 4S24A 1Q3HA 4HI0E 2F1OA 4RHTA 1B6SA 4Y2YA 4JOCA 2EA7A 2OCPA 3KKZA 1A8MA 2JFZA 3ZS9A 4JT9A 3GGLA 1FX5A 5G02A 5BV8A 4FFBA 3STYA 1QANA 1RAEA 2JCBA 3I01A 4FOOA 1OAOC 3ZFFC 5JANA 4ALKA 1XE7A 3DEZA 1STOA 4DA4A 4RTQA 1ST3A 1DMSA 4FR2A 2UWAA 2H08A 4UNQA 1I3LA 1ILWA 1SCJA 3A2KA 2L17A 2DU1A 1V16B 4QXQA 1DSSG 5LZ8A 4AULA 4FFVA 1OYVA 3ZHQA 1J83A 3GGSA 4CM7A 2WM8A 1CPYA 1XR3A 4CM6A 1TEHA 3ZU4A 2VCYA 4BLIA 1SJ9A 1D1SA 1ZMXA 5T6MA 3DXUA 1D4VB 1R8JA 4JXKA 2Q1WA 1ZOOA 4UCFA 4AD8A 2VQ0A 2Q21A 2INGX 1FMTA 3CKHA 2VJDA 4KQIA 2Q0HA 5DGDA 4JGYA 4B6EA 2UXBB 2XCUA 3JQGA 1UKYA 4KXMA 1A5SB 2YZNA 1QV7A 1QLWA 2MOKA 4V3CA 2VW0A 2CBZA 4I50F 4O5AA 4RKRA 2WHPB 3H13A 3O8QB 3WK7A 2VMGA 4I2OA 3TQCA 1MT3A 1J56A 1GNTA 1BDJA 2LRHA 4QPZA 4BKQA 3AUTA 4WN3A 3JRNA 5HDQA 3MGUA 2QV0A 2F3SA 1X8LA 3K9GA 1VB5A 2Y6FA 2ZJ8A 2NOAA 1EUUA 1KYQA 5FDBA 4EG3A 3AV0B 2WZR1 4D9KA 2JJ2A 1ZZ6A 3G2IA 2Z08A 3TKLA 4JKYA 3SJBA 3QELB 2A6PA 2OK8A 1TJ4A 4OXIA 3L0ZA 2X6QA 2QRPA 2YXBA 4ZU3A 1Q15A 2MCFA 3N2YA 3HNRA 1QFJA 4LJ8A 3T35A 3LE0A 3OCUA 5HCHA 4F6RA 2OP0A 1ODFA 5KZMB 4Y2UA 1CNFA 3RVDA 1DARA 4P7FA 3N28A 1HC7A 2L42A 3IERA 1PZMA 3A4LA 4CFSA 4X41A 2ECOA 5FZ1A 4PLYA 4BL5A 2YBDA 4K2HA 1WS6A 3FOZA 3VO9A 4HN9A 5J2TB 3AKEA 4FGLA 5FAKA 1ST8A 2QXTA 3K8OE 1YL5A 1RHI2 5LA6A 1EFCA 5EFZA 1Z0KA 2D6PA 4MUXA 4D6XA 2OKCA 4ZI7A 2PV7A 1S0IA 3UAWA 3UW1A 1J0DA 2EKDA 1VAVA 5BVHB 2E7QA 5HOEA 1C5IA 1RUE3 3OJCA 2ZJ0A 3VOAA 1R10A 5CLLA 6REQA 3FCOA 5ALEA 1ULEA 2D6FA 3LRTA 3IQGX 1EFRA 4EG0A 4RMJA 1IKPA 4IILA 2UWCA 2PSJA 3GAMA 2FQYA 2IC1A 3SBOA 4P82A 4P0TA 1XLTA 5BN3B 2W42A 5IFKA 1O7JA 4ER5A 3OETA 3ABIA 2H4HA 3T9AA 3B5JA 2I55A 1PN3A 2GU9A 2JFYA 5F9HA 1B41A 3PI6A 4O08A 3U7GA 4E3WA 1QH8A 3ZV7A 3UWPA 1O95D 3A1WA 4ZRMA 3WXPA 4PLNA 1QX3A 4BVJA 4XX1A 1US3A 4YZ4A 2V4AA 3NV4A 4ETNA 3WFIA 1CUEA 4URXR 5HMLA 2DVDA 1T1SA 4IDDA 3CPJB 4ZONA 3NM4A 1ULSA 2PHTA 2ADMA 2WLQA 1OB2A 4X64B 4XWKA 1E3EA 3ENZA 3DZKA 3AIIA 4G56A 1JILA 3DFZA 5U4XA 1U9IA 3NRCA 1U8EA 2IIQA 4CU2A 4BMYA 3CRRA 4JTNA 1ZYBA 5FAXA 5JSZA 3FPBA 4QQNA 4UFPA 1T4GA 3RHZA 2BNNA 1PUIA 1GNRA 1BKDR 2Q4TA 3LRXA 1KRXA 2A88A 3TSCA 1W3XA 1KP2A 3GCXA 4E5YA 2R16A 1NT2A 3TFQA 1YZQA 4CXWA 1P91A 1TNFA 3C7AA 3L7JA 4XDZA 1WCUA 1JSLA 1TUBB 2V7GA 1UO9A 5DM70 4QPGB 2Q0AA 1MS9A 2XCIA 1G9AA 3LBYA 3V8QA 3TQTA 1B00A 2AHOA 3B69A 4WBSA 4LNHA 5LMUB 5KVSA 1HMYA 1ZBDA 1N8SA 1Z9BA 2MJLA 2HWB1 1W2NA 5DT9A 2JJYA 3BDIA 4MYCA 3DO8A 1BN7A 5ECGC 4MADA 1L8XA 4F1WA 3U9LA 4QVIA 4BCBA 5F4ZA 1B14A 3GM8A 3AYCA 4ZVKA 2XMZA 2YWJA 3UQZA 1YR3A 3BGAA 5JW6A 2VDNB 3ML1A 5AJXA 5FL7D 3T7AA 3VVMA 5JWRA 4Y20A 4YVWA 2OVBA 1R6UA 2R7NA 1AXGA 3WX0A 3KLOA 3VU3A 5SY9A 3MS2A 3UL2A 2MR6A 3NWPA 4E08A 3WGZA 3KLBA 3KQYA 2XSZD 2HRRA 3BG5A 2IZWA 2WT0A 2GF2A 5EXDA 3MW2A 3ECAA 1PK7A 2HBUA 2V7PA 5B12A 5BV0A 2Q3CA 1F51E 4BQ4A 3VR4H 3SYLA 1L4BA 2BJSA 5IT0A 3U75A 4CLOB 1QRDA 1G66A 1VSTA 3M6AA 4BLVA 1C0EA 5K5EA 1YUBA 3WL8A 1YJQA 2E5FA 1BBT1 1QNLA 1RYNA 2UZ0A 3MUY1 1EP9A 4DCGA 3IP7A 3CSSA 3T5GA 4H6PA 1IXRC 4QSHA 5COQA 1G5RA 3RJTA 5AKKA 4RE6A 5F3DA 3IDCB 3UJ6A 4HYTA 3EVCA 3PIDA 2VZTA 1NBOA 3HKDB 3I3MA 5CJPA 2H29A 4DS3A 3TYXA 5FPUA 1GQSA 2J0VA 2XVMA 4OZXA 4OQNA 5JVDB 1C9YA 3JX9A 3PIRA 1MZ5A 4DLZA 2A9KA 1KJLA 2GRAA 4XJTA 4G25A 5KWVA 2F43B 1A96A 4DUGD 1P45A 2OHHA 1U8XX 1GYPA 1REQB 4WK0B 4GBJA 4NZYA 1EUTA 5F7JA 1QIKA 5CKMA 2COUA 2ZJ2A 2YWEA 4TMXA 1L5KA 5BPFA 1ORVA 5LKRA 3DHYA 4MHUA 1JFVA 4BU2A 2ZR8A 2H4WA 2JDKA 4PTLA 4O2AB 2JJ6A 3JAKA 2PA0A 1E1CA 1MRSA 3RI3A 1C9EA 3SR4A 1O59A 2XT9A 3T2PA 4P5EA 1SU4A 2KA3A 1NE2A 5F3GA 2HRDA 1RBZA 1UBOS 3DMHA 1PZ8A 4GXLA 3OOEA 2PVSA 1XQ1A 2A1TR 3BBLA 5LB2A 3VNRA 3JU9A 3D7NA 2IXBA 4WLVA 1A2BA 1M10A 2YOHA 4R5MA 3SIRA 5JH7F 4YP7A 3KEGA 3C3JA 3U7QB 1XXLA 2WJHA 2DUPA 5DZFA 3O8OA 4ER7A 2X7JA 4EHHA 4G5QA 2WYFA 3UMRA 4OQMA 2YC4A 4UDXX 4F3YA 1W52X 2V4VA 2C83A 4MJ3A 1X50A 1XNJA 3KTAB 2FQPA 2W7TA 5FEMA 3QBEA 4FM9A 4JUIA 4FTSA 1C7IA 2AKAB 4U2DA 4BC1A 5KOHA 2X9NA 1N8NA 3WWYA 3GJQA 1CX9B 4BQ1A 1OIWA 1VL5A 4GO1A 4TWRA 1E6MA 2N0SA 1Q17A 2WFLB 2NVUA 1A2OA 4GI7A 4CP9B 4N0PA 3DV8A 3GFGA 4QPGC 1A8UA 1C7JA 2VG8A 3WP3A 2PMDA 3H0OA 3UQYS 3FOFC 1AV6A 121PA 1BU5A 3BTSA 1QNYA 4HPKA 1PLKA 1S96A 3ZZMA 5JNVA 1XVUA 4A0FA 4EGJA 1GZ6A 1NONA 3H0EA 3GNEA 1EUDA 5ANQA 1PK6B 2C2OA 2D6NA 4DC0A 5A9SB 2BUAA 1A2QA 3PKIA 2UYCA 4LK6A 1AR92 1S3GA 2OO7A 3FPGA 4X8MA 5T5QA 3M1LA 1L4KA 3LK6A 3W5MA 5KOIA 3TN91 1LRLA 1XRSB 1BXGA 3EZ6A 4IDBA 1H4QA 1NLMA 3G9XA 4EW3A 3WWCA 5E2AA 4Y22B 1TME3 3TLMA 4G5OA 4ZO6A 4R8LA 3SC2A 5JZGB 3QWHA 4E5UA 1FF9A 3CG0A 5AVJA 3KOZA 3DMYA 4OHMA 4BFLA 4M87A 1J23A 4FGUA 4HCJA 5C32A 1FFXB 4TMVA 3RSLA 3RQIA 3B78A 3MMXA 4C2TA 1LF0A 3LIIA 4KR3A 4HVTA 4JLOA 2WPDA 1R0YA 4O2LA 3LECA 5LKAA 4P3NA 2VP2A 5J4LA 1N7HA 4Z8BA 4B34A 3SCHA 3KSCA 1P5JA 2XA9A 2QZSA 4JITA 1WD3A 1CJTC 2QX9A 3H11A 3Q8BA 1DDLA 1CAUA 2AENA 2OUIA 3V48A 4UBJA 3BRQA 1F5SA 4GPBA 2NSHA 5FLJA 4KQGA 1B0AA 4MS1A 1FJHA 2FZCA 3OZXA 5C53B 3ITEA 4R0VA 3KEFA 4MO3M 1H0KA 3GARA 2OIIA 5CCXA 5AXCA 3JQPA 3MHZA 2GK4A 1R091 1UXXX 2VJKA 4JJKA 1AR63 1HWYA 4LOLA 2W6NA 3RW9A 3Q88A 4LYFA 5C3RA 4IYRA 3HLKA 4MVJD 4NX2A 5FLXA 1YJLA 2HMYB 3WLHA 4HX5A 4L4SA 5L6LB 3AL2A 4C0QC 4RFRB 5FXXA 4OGLA 2R62A 4DY3A 1QKJA 1YFUA 2FMIA 4H2AA 4JC8A 3K94A 3TJMA 5FV4A 4BN0A 4XUTA 1XTBA 4IDPA 1QMGA 4TOIA 3QTLA 1DELA 2VZQA 3UT0A 1NW9B 4ARBA 3WOGA 3IVRA 2I4RA 1QXSA 3HMQA 3POFA 2HA6A 4RTKA 1SXHA 3ZD6A 3R1IA 2FWBA 4CKCA 1AHSA 4ND4A 1LXCA 4XRRA 1V9CA 2RHHA 1RLMA 3KB1A 3M3QA 1LLUA 1GKUB 5KYWA 2CDOA 1ZM7A 2H3HA 3E84A 4U63A 1IB0A 3UTDA 3AJDA 4RF4A 3DOOA 5B1DA 4KC0A 4M6WA 2V0GA 4KH0A 3U4SA 4R40A 2O3QA 2ZMKA 3TFWA 2FQQA 4P7KA 5F5LA 3SX2A 1W8UA 2Z79A 1RKBA 2YV3A 3FHOA 4BIOA 4D8YA 4J4TA 2F00A 4K20A 1OBVA 5I8WA 2JGFA 4A8HA 3G68A 1JVNA 4PBPA 4BE4A 1ZRNA 2A9JA 2ZIGA 1HE5A 1ZRHA 4YBRA 2P30A 5L3ZA 1UL9A 4GI1A 1M1UA 1QIGA 4RHUA 13PKA 4EVQA 4EOGA 1M2JA 2QJOA 1LGNA 1Y1RA 2VYNA 5F7UA 3KIPA 4WNAA 1D2EA 3FFBA 4DXSA 5E6UA 2AGVA 2ZR7A 1T3LA 1H2HA 5C1IA 3LZZA 3I2IA 5EJ5A 2GESA 4ZODA 4JCCA 1YQXA 3RVLA 5DOZA 1V6MA 3P2JA 1UEJA 3VAAA 4EL0A 2P9EA 3JVUA 3K70C 2UZ1A 4LPLA 3R23A 1H2RS 1ZMRA 3OPVA 1KQOA 1SIBE 2FTKE 3SIWA 1SB8A 1PK6C 5EG5A 1V6NA 3KEQA 4D8TA 1U1DA 1GWLA 2B45X 1PTJC 4BO8A 3CVYA 4B40A 1LSSA 1G2IA 3M3HA 4MCAA 4IV1A 1SUBA 2CDCA 2VJOA 3C7KA 1P7YA 3R4UA 1JKFA 1VKZA 1HDRA 1XLVA 2ZAOA 1N3LA 4R68A 4ZT4A 1SC4A 1LDGA 2XUOA 3DC7A 4H3KB 3PIGA 4P9LA 4UBOA 3OLVA 4X7MA 2QKYA 1PSWA 2VNAA 1HRDA 1JAZA 1FNDA 3K1JA 3PUQA 3MJRA 1NU6A 2I91A 1XXNA 3BB4A 3TLAA 2ZB3A 3RGWS 1FTYA 4CDUB 2BWAA 3DP9A 2RGNA 2YXNA 2WWSA 4QDXA 4C0AC 2OC9A 1ZCFA 3ZD8A 4BFXA 1UJMA 2QAIA 2Q30A 1RVV1 3RRMA 2RM23 2WL1A 1F5NA 4RAOA 4GW3A 5HKKD 4M1MA 2PYZA 5I91A 5HP4A 5AC93 1U8FO 5EUMA 5B58T 1PFKA 3WNLA 1OBHA 5ESDA 1P4SA 5FNVB 4JT4A 2GCIA 2ODAA 1SVOA 4YUWA 3P2YA 2O8VA 4YAWA 3QCWA 5KPDA 1XO1A 5AJHA 4L28A 3SD7A 3KPJA 1F3LA 2CNLA 3EEFA 2I7XA 1X3LA 3B2NA 1IOLA 4A42A 1A72A 4RE5A 4B3IA 1JDTA 2IS2A 1N2CA 5IKXA 3M81A 2E5WA 2GEFA 1SQSA 5JHHB 2GB4A 3T7DA 1WWYA 4DLAA 3ZZUA 4KFUA 5C9ZA 3TL3A 4LIUA 1GPJA 4FW8A 4EH1A 2DPGA 3OCPA 4KRXA 4NECA 2R073 2EBWA 5ITWA 5TLSA 3IP1A 4RZHA 4C4YA 1F4LA 4YQZA 4NHYA 3OSUA 2XZOA 1EGVB 1V47A 4V1CA 4N0DA 1KZ6A 1SBHA 2O8EA 5FUMA 4MGZR 4PQ9A 5I5EA 4OX9Y 5BSUA 1WUIS 4J43A 1GEGA 3TW4A 4PR3A 2IEDA 1HNNA 1G21A 1AHNA 5GPBA 1H8TC 3IPYA 1E9BA 2FDRA 3H5OA 2JWPA 3P0IA 4V0OA 3BGSA 5CIWA 1Q84A 2VP6A 1Z4MA 4CLHA 2H00A 1U8CB 3WAKA 1VLZA 3PQ4A 3MDPA 2X19A 4BMEA 4ZJUA 2DRIA 4HDNB 4L57A 3TSOA 4WZBA 4EFKA 1WXDA 1Z25A 1A71A 2NMVA 4H14A 3D8NA 4PYIA 2EVWX 3ZDDA 4TKVA 4XYLA 3WRXC 1I0ZA 4N54A 3KLPX 1GGFA 1T36A 2VDJA 1FY2A 4BBAA 4K46A 4US0R 1XZJA 3NKVA 4OF4A 3G2QA 1AKWA 5I0RA 1OA3A 4TTSA 2WNOA 1U4SA 1Z33A 2HKIA 3BWBA 5DG2A 5DLYA 5F12A 1L5FA 1PE0A 2HI0A 4K88A 1FS4A 2GK3A 2PT5A 3CHXA 2ZRKA 2W2KB 2J9RA 1AX0A 5AUNB 2XDQA 2X09A 4YG6A 3ED1A 2FUCA 5TGTA 2JFOA 4NDZA 2NXNA 1C2YA 2W46A 3PGVA 3HA7A 3UKVA 4I1UA 4TRJA 3QG1A 5BNOA 3ZVNA 4EYEA 2D1TA 1JEYA 2VZLA 2HF9A 3IEPA 4J1NA 1PVXA 2QYHA 1J59A 1ZKMA 1FTWA 1M2KA 3K0SA 4IQFA 3ENRA 3VBUB 4F7ZA 1JIUA 3ZFGC 1A50B 3LA7A 1P0MA 4QYSA 3RZKA 3DJYA 3DHNA 2XGOA 1ZD3A 1T8PA 1K7YA 2RH8A 4KMQA 2GETA 2RG1A 5ALWA 4DG8A 1ECFA 1YQUA 4OKIA 1L9KA 3IQEA 3AY0A 1ZOIA 3AR2A 4EVIA 4TS3A 4P9YA 3AYXB 3QMWA 1VA5A 2ET7A 4Y18A 2FLWA 4PLPA 3AP2A 1G59A 3WYDA 4NOLA 4NH0A 1T2DA 3AR7A 5JIUA 1KEWA 2Z3ZA 2IHKA 2KQUA 4FLFA 3GRZA 2C3PA 4YUZA 4RPGA 4WACA 3TRFA 3T2TA 5AW1A 2ZW9A 3M49A 3NO8A 2EZTA 3SNKA 5EN4A 1S4MA 1EMDA 1ENYA 4E11A 4NCAA 1Z28A 4NIGA 4DXTA 5DX0A 1S02A 1RLIA 3GVXA 1GCUA 1V5GA 3OM0A 2X5IB 4U9UA 1IN4A 1SDWA 2HV8A 4FB5A 3H6HA 3OZDA 4W5JA 4P38A 3BCRA 3U0BA 1O5OA 5LP6A 3FWYA 3F6YA 2P68A 1QO0D 3NETA 4ZCMA 3L8MA 3WLOA 2XL7A 4YQYA 2OG2A 2W2VA 4Y9SA 4AMUA 1E3SA 3C3AA 3P5SA 3FKSD 4EMTA 2WT8A 1BC5A 3PIJA 4TN5A 4HLUA 5LA2A 2AFHA 4MR9A 2MR5A 3ANSA 1ASJ3 5U9CA 1ZRDA 4A73A 1HQWA 1M66A 3EZ2A 3UMGA 4MVJE 4QXKA 2DR0A 1Z36A 1NMQA 1JJFA 1O5IA 3KOMA 1LGCA 4C4OA 4IFIA 3DYIA 2H7VA 1KVRA 6LDHA 2RV9A 5I9LA 4XJ8A 4IMPA 2Y9MB 1Z8FA 1NIPA 1OX5A 2CY0A 421PA 1Q1QA 2WU1A 4B75A 4BGDA 4RTLA 5FPQA 4YRFA 1JJIA 1UZAA 3A9CA 4CMKA 3VN4A 2C04A 2AFRA 4NO4A 1T3TA 2X0RA 3WF0A 1GYRA 4Q7MB 2Q2VA 1QONA 2X76A 5KO2A 3LXRA 2ZGOA 1BNCA 2Q4DA 2VHUA 1NLZA 2R6CA 2XI4A 5AVZA 4L4UA 1KEPA 3L6OO 4FFOA 2QI9C 5EC8A 1T9GR 3KOYA 4DMGA 4X0EA 4CKYA 2AREA 1IONA 4TS1A 4FE7A 3KDAA 3O0WA 5HIMA 4QKBA 4KGQA 1J58A 4KPFC 1ND5A 4CDQB 4PI2A 4Q4W1 2BUBA 4KQXA 1TFUA 1UCXA 3C41J 1YBMA 3BU7A 3MLJA 4HJRA 2CTVA 5IVIA 2Z5LA 2FETA 4YG0A 3M2PA 3HUEA 3MT0A 5A3PA 1D7OA 1WPQA 3DLHA 4OFWA 3EC7A 3IEMA 4OFBA 3I62A 3H1MA 4BXOA 3PEFA 1JZTA 4AI0A 3T15A 5CM8B 1QLHA 1IMJA 4F4FA 2CL5A 3QGMA 2BKUA 5AW5A 4G85A 1XNBA 4R3UC 4CU5A 5ALLA 2NYAA 2G7MC 3URMA 1L1EA 2L19A 4UQLA 2D74A 3CJXA 2PJUA 5JOZA 1UXKA 3FPEA 4DDMA 4W6XA 1C8BA 4ECEA 3NWOA 1AN9A 2EJVA 3R9WA 4CM1A 1HIXA 1N0VC 5LP1A 4IICA 5I45A 3ECQA 3AI2A 3VBUC 2JG9B 4MLZA 2EARA 3GELA 4HFMA 2ZYGA 4QYWA 3EYPA 5JD5A 1XOYA 4M98A 3K15A 4HZGA 2ZEZA 2FSVC 2IE8A 1QQBA 3FWZA 3JSAA 2Y0DA 1ZEJA 5FK8A 2QV7A 1ULFA 4ASUA 2FW1A 4QYMA 4Q7QA 3DCQA 4TL7A 5GP1A 1XNKA 4C90A 4UCWA 4ORFA 2EIGA 3ZV6A 3JAWA 1PIV3 3TLKA 3SC3A 1F2DA 5GKAC 4HAUA 4W8GA 1NZFA 2DBQA 2AXNA 2JIDA 4MEBA 1ZBA1 3OZSA 4KAAA 4BO7A 2WRZA 2ZS8A 1N6PA 2BRUC 3O21A 1OA2A 4N0QA 3ACCA 1X2EA 4XDGA 1XE3A 5KNDD 3DVAA 1TAQA 5CT6A 4ABTA 3MW4A 4AKSA 2KX7A 2GH2A 4HZUA 3S57A 3WZMA 2IXHA 3STUA 3GJTA 3M70A 1PQ4A 4KQKA 2D2EA 4ZV4A 5AUPB 4MGZE 3SF0A 4NN0A 3U7JA 1B8OA 3M1YA 4OUKX 1HNXB 5BN4A 1SXGA 2W0XA 4HXEB 3K20A 2VNRA 2KE5A 5KCZA 3KDPA 1Z8DA 2YX1A 1LOEA 1YTUA 5JAPA 1E5HA 1JXQA 3SH3A 4U2AA 1G0OA 3GEDA 3TOVA 4ZCQA 3FUXA 1XKLA 2DJ5A 4PNEA 1LOFC 3SVZA 1JDSA 4M7PA 1WA6X 4A6XA 2VRNA 2BGMA 1IJBA 2NU7B 1GZ4A 3OH8A 3G8CA 1T2EA 3R6TA 4NCHA 4FOLA 5C8CA 4NWIA 3EGDB 3L02A 3NTXA 2VDWA 2FUKA 3PD1A 2EL7A 4HAZA 4BLTA 5FZ9A 1W0JA 3JQAD 1EBUA 1USVA 4YRMA 2SBTA 2WF5A 2WNVA 5F35A 2VHEA 2GM5A 2H52A 1AXKA 4EAQA 4D3SA 5E2BA 3V42A 2QF7A 4ZEMA 4MP3A 4L9BA 2WA2A 3PR1A 5KKAA 3WP0A 1PBTA 2BGIA 4BNNA 4PVDA 2XZPA 3NEYA 3ZWQA 5JYDA 2FGJA 4MQLA 4E07A 3RWOA 4D97A 4UNRA 3H9EO 2BONA 1X7XA 3TTUA 4EG1A 1EIWA 1K4MA 2H4JA 3MOSA 4JASB 1WF3A 3DKWA 1Q14A 2YBSA 4DDUA 2REXB 2QLBA 2RR12 4P34A 4CDQC 5TQ2A 3OCXA 1KRWA 4A10A 3VJRA 5K4AA 3L0IB 2IJGX 1A7UA 2YWFA 1M1NA 3NKTA 4D57A 3OZWA 4RTMA 1Z6PA 4K21A 1P1FA 3OI7A 2YZ4A 5CVDA 4ESEA 2K2SA 1W4ZA 5G0UA 4RKFA 5IVEA 2OZLA 3ETGA 3I7DA 3KV4A 3CURA 4HRXA 3H1FA 3DOHA 2I07B 4CCMA 4QIHA 4KIFA 1CG6A 3EMBA 1YQ9A 4ME6A 5A3NA 1P4AA 5TT1A 2AZMA 2XB4A 2VNSA 3OMLA 4CXYA 1MD9A 4N7JA 1H2EA 5KDDA 1PI3A 2SECE 1NHWA 4COOA 3A25A 1E2IA 1U2ZA 1XYYA 2FU5C 5FTJA 5JY6A 2V58A 2N1BA 2O8BB 4LBVA 1PEYA 1AR72 1CCWA 2Z58A 4AJHA 4O29A 2X8JA 3L01A 3D54D 2FR8C 4J0DA 4HDOB 4L51A 1DKMA 4AG4A 1S1MA 2ID9A 3CT4A 4XW3A 3Q2OA 4XD7A 5F3IA 1VOTA 1XTZA 3C6MA 5FXVA 1RXCA 4GBMA 4Z3KA 4CCYB 3AUXA 2C4NA 4K05A 3PPWA 2I2CA 3FLPA 1ZN2A 3CO5A 2UUOA 2FOXA 3HYNA 4LXHA 3AMHA 4W5TA 4UWDA 1P0IA 2QGZA 1RWPA 3VBOB 2IU3A 3GJ6A 4AJJA 2HDHA 4AEMA 2QGNA 3IUMA 1FVHA 4I7EA 4DLBA 4JHXA 2CJWA 4JMPA 3O31A 4CU6A 2ZBUA 3EMKA 2QX7A 4RGBA 5DYWA 1PMJX 1Y5LA 3K09C 5FTTC 5F2NA 1RUG1 2WOJA 4YMWA 3CXRA 3AKDA 5IDXA 3S99A 3OU7A 4QBTA 4KQ7A 4E9KA 2PX6A 1TT5A 2XHZA 5GZCA 5HBAA 4RK4A 2GPTA 2ZSUA 4DMRA 5F5AA 1H3NA 1U1GA 2IUSA 2JFNA 4Y1EA 4O4LA 3HDYA 3ZXIA 1WGPA 2C9CA 1S89A 3O75A 4FPLA 4MGTA 3O8BA 4EJ2A 4RLQA 2YFUA 2EFHB 1E0SA 4DW8A 1OFSA 4BJHB 2WJYA 3FHTA 1WZIA 1Y9MA 1MOQA 3CUUA 5FWYB 4PRZA 2IPOA 2Y3IA 5GADl 3GLIE 1U1CA 4DS0A 1XDGA 2WJIA 3ZJYA 1QXRA 3EZGA 3PLAE 4XXHA 4TTVA 4U8GA 1SKUA 1L5VA 4BO4A 3PUZA 2I4NA 3NBQA 1THGA 1YQWA 2NYYA 3UKOA 3QKIA 1CD3G 3RS8A 4M0CA 1JBCA 5A7SA 5IWCA 1GUIA 4R9BA 5B6JA 2ZGVA 2IVJA 1VE1A 4YZ5A 4UM5A 4JBYA 2WWFA 3ZKWB 4KYUA 2DETA 5LCWL 1LV7A 3S8MA 3CR3C 1JOPA 5JOXA 4ZCTA 3UA3A 2FP4B 4IRUB 4HADA 4LX0A 1CIVA 2VF4X 1YRWA 1GT91 4OIMA 1ULDA 3MINA 2VMDA 4IF6A 4DHEA 3C8UA 1XVLA 1VYTA 2AN1A 3L6UA 4IIFA 1QZZA 1TVGA 5KCMA 4HOOA 4BFCA 1LTQA 2JDZA 2Q8OA 1EJ6A 4IOMA 3KT6A 3DF9A 5AIAA 4NTZA 1XP5A 3JYLA 4L8WB 4BN4A 3KKQA 1N1TA 2IDJA 5B53A 5JROA 1DRJA 3Q5EA 4LE2A 4DMHA 4JI0B 3QEMB 1LU2A 3AVVA 1V6JA 1J42A 4MPPA 2XGGA 1M0SA 3RSJA 1U28C 1OQAA 4YM3A 1LLCA 2V7WA 3LHFA 3B3QA 4JL5A 3VBRB 1O3YA 3U37A 1M1YB 4L74A 3PNLA 3N7MA 1WOMA 4JLVA 2ZEJA 2R65A 1NIJA 2PGIA 2NZXA 4H59A 4G9GA 1FBTA 2C4KA 4Z4IA 1OLUB 2WPNA 1GNSA 3WWZA 3LP6A 1F14A 1QV6A 1VBA2 1MV8A 1ZH6A 6PFKA 2FCRA 3Q15C 3F71A 4OK3A 4KR0A 2X5JO 1IG0A 1V7QA 5EHDA 2WJ3A 3EXHB 5CFPA 1MJNA 2B69A 2XUHA 3EYAA 1GTVA 3TLBA 4I3PA 1UY4A 1PZ9A 4Y9UA 3HDHA 2KJQA 4PX3A 3DAPA 1NVFA 1QFXA 5C6CA 2B34A 3SICE 4QPJC 1VMIA 4BMDA 4F21A 2JA2A 3B3AA 2WMNB 4RX1A 4TV9B 4LDAA 3OFKA 3LBIA 2IH2A 5A3UA 4IEXA 4EHFA 1FTQA 2P2SA 3GFOA 1YASA 1XPWA 2OCYC 1Z29A 3JWPA 2E87A 2XF8A 2XT6A 1V95A 4O4JA 5E9AA 4B76A 3HEIA 3KKKA 3ZZTA 4X8PA 2ZRLA 3IP9A 3EXG2 1EVQA 5CX1B 3PC4A 4YRKA 1E66A 3HS3A 2W2OA 3ZOZA 2R49A 1ONBA 4BAUA 2EW2A 4F91B 5E0KB 5A4IS 4XJVA 1GPUA 1NN5A 5FJIA 4HH4A 1P31A 1OKOA 2WC2A 3NVAA 4BV3A 4KMRA 3QTBA 1W94A 1U7XA 2ZMNA 1MC5A 4RR3B 5LA9A 4JBNA 5KQGA 2BWCA 4LI0A 3IBFA 4MDFA 4O7XA 1JIQA 3SXUB 2RHTA 3H1WA 1XQXA 4FFSA 3TLGA 4MGYE 2WVGA 5EWSA 2VRCA 5EZYF 1IK6A 3T94A 1PX0A 1KD7A 2XMQA 5HIIA 1G3QA 1ZA2A 2L18A 3Q4GA 4OCZA 5ABPA 3OD1A 3V1YA 3C14C 1DYPA 2W5FA 1ANKA 3M9XA 3WGJA 3LCPA 4AYWA 4P31A 2N75A 1TKCA 2JRLA 2ZGKA 2V4MA 5KOJB 1RAFA 1NW6A 5H0IA 5A6SB 4LTDA 3N7JA 4DB5A 1PWYE 4GOND 2FG5A 1F4VA 4LECA 2PUTA 5K03A 3EXEA 5KINB 2PH3A 1ZQ9A 3QPVA 3ZW7A 3S40A 2VTDA 2AEJA 1J8MF 3AVTA 1F8FA 4KNCA 4W1QA 2QNIA 3L0CA 3IKJA 1TCBA 2RSLA 1TC2A 3U4MA 1POV3 3FHCB 3GQVA 2OFPA 2PMKA 2ESRA 3ONEA 2Y33A 1MB2A 3PITA 1HRV3 2CUTA 3T4VA 5JLAA 2KR2A 1E0KA 1NY72 3DKRA 2GZWA 1L5OA 3W3AH 4G97A 4LWOA 4KN5A 4GP6A 3AEKA 3D4BA 5AI6A 5J43A 2V7BA 3E61A 3M4FA 5KQMA 3GV0A 4EJSC 3JD3A 4PPQA 3SEAA 4B35A 3FSGD 4QWWA 3FBYA 4M4RA 4RH3A 4MEAA 2W1SA 4KQ1A 1W0PA 5M2QA 2PUGA 4BO2A 1SAYA 4Y67A 2PD4A 4YN3A 3W6NA 2F90A 3EB7A 1GTL1 2BCJQ 4QXBA 2IIBA 1IM5A 3PNAA 2AR9A 3VBRC 2UVDA 3EXAA 5EHNA 3QE3A 4XDYA 1J8VA 2WT1A 1T26A 1TQHA 2XUGA 3O82A 4PBSA 3J7AC 1D0HA 4QNRA 3KZNA 2OCIA 2B2XA 5JHGB 5FXZA 3THWB 1HX7A 2W87A 1EZ1A 4G84A 2JBAB 1S2KA 5FP3A 3O5AA 2QR3A 4I1IA 3TBKA 3ITKA 4DCVA 2VK2A 3NVMB 2UV8A 2HNAA 2V8OA 4Q3DA 3WY6A 5K8TA 1W19A 2H18A 2BFBA 3KL2A 2FMTA 3I3BA 3EXHC 3AM1A 1LB1B 2XQRA 2Z5WA 3OX1A 4J0IA 1N9ZA 1H1MA 3I6IA 4HXGA 3TE6A 3WFZA 1UM9A 4XM0A 4XLTA 3RLIA 3FNEA 4UQOA 4W9NC 1W5BA 4NYMQ 1M1XB 1RIIA 1QC5A 4XIFA 5IZ4A 1XCGB 1K5DA 4NBLA 2W93A 3FVRA 4CIAA 3UN1A 3VKMA 3AUUA 3S3TA 5IK5A 1LS1A 2P6MA 2QDKA 1XG5A 4CU7A 2P3JA 4C7OA 2XUKA 2XR4A 1VMKA 4BECA 5IJ9B 4F4CA 2W2TA 2M6KA 5FCCA 4NEGA 5C3UA 4QT4A 4QDQA 2GAOA 3UG6A 4FXKB 4MQMA 1AURA 2A0XA 2FMYA 1JAYA 2OZEA 2B1RA 4KQ6A 1VYVA 3TZKA 4JYAB 3OD5A 2NPIA 2O52A 1K6IA 2DMRA 2FR0A 2JKZA 1NXSA 5L3RA 3PU6A 2KXLA 2IF0A 1CQJB 1T6BY 1H2LA 2QM7A 3T4PA 5BOVA 2GC0A 3KKOA 3LEIA 4JYPA 1R3DA 4R9SA 3MAGA 2ZT8A 3ZIXA 1CZLA 3W1EA 3R5KA 4HGQA 4ZD6A 4IVNA 4N4AA 5FKCA 3FMFA 2HU2A 3WDWA 2W2QA 5D1IA 3FI9A 2Q1YA 1AXYA 1L5ZA 4EW2A 1YFXA 4RR3C 4D43A 1U6JA 4NESA 1KXJA 2ZUSA 1CY8A 3TNYA 2GZHA 1E1QD 5AOCA 4YFZA 5CXUA 3SGLA 1Z18A 4DJ5X 1RD4A 3QOYA 1VG9B 1BHQ1 1XU1A 5GOTA 3A2NA 1MXHA 2PEZA 4M0HA 1YJCA 1AE1A 2J9XB 1YI0A 4O3MA 1WW7A 2CV6A 4V0QA 4YW3A 1FYUA 1IPHA 1Z0AA 4M9QA 3BCUA 4URWR 2FDKA 5EXXA 5K8VA 2PQSA 4MJXA 4Y4RA 3EIWA 4JBIA 5AO9A 3KD3A 4LJAA 1RWQA 2YKGA 1NOKA 5CU1A 1RUD3 4EYUA 3U31A 5FCDA 2C77A 3M4NA 3GLKA 5IKOA 1S2DA 4B4QA 3FMPB 3V4OA 5JBNA 4KKXB 1G9DA 2A6VA 4N7IA 5IKPA 1QKQA 4R2LA 2FHSA 3OICA 4K1ZA 3AGQA 3DNFA 3NHLA 3VVBA 2GNMA 2ATFA 1XA3A 1Z3IX 1W34A 1Z68A 3P26A 1UBFA 3N9LA 2WE7A 1PVC1 1WXHA 4LMAA 1WY5A 3H04A 1XDWA 2OWDA 5TSDA 1LKNA 2Q7OE 1V7ZA 3AUAA 2ZUBA 4F6LA 1WMAA 2QUKA 4TWTA 4FDMA 1AR83 4PG6A 1PR0A 1GMMA 3T1LA 1Z78A 4E46A 5IK2D 1Y9JA 4B3NA 1AOXA 1RM4A 4Q12A 4J16A 1T6XA 2HNBA 1T6BX 4IIVA 1SPXA 1MJ5A 1PG5A 1A78A 3TNJA 2J0UA 4LF8B 3EWAA 1V4BA 3IALA 3WI7A 2BMFA 2V97A 2ZT7A 3B60A 1GQQA 1JLLA 4C0JA 5CM9C 4RY2A 4BC0A 3IJ5A 1SG6A 2VBIA 4MZDA 4XB2A 1N6HA 4RLSA 5K0BA 1PZNA 3RS0A 3WNKA 4MGHA 1WTCA 1TVEA 3NBKA 2P2KA 1QPZA 2JEOA 2A5FA 5ECWA 2GBLA 3RCBA 2IYSA 3HT1A 1Q3TA 2VDKB 5GJWC 4DIMA 2FOIA 4Y9RA 2PH5A 4LBKA 4YO7A 5K3OA 4NHKA 2WWRA 1BXKA 2MHFA 1RWBA 3KXLA 3WFJA 3ZBTA 5EIBC 3D6EA 3HC7A 1HM5A 3W59A 4BA6A 1HFEL 3DVSX 4N0MA 1OI6A 4UAGA 5LBCA 3F0TA 3SOZA 5JO9A 4DNPA