2WAOA

Structure of a family two carbohydrate esterase from clostridium thermocellum in complex with cellohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
GILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDSITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE E
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2waoA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2waoA02
5JR2A 3OGSA 5JMOA 1SDDB 2EICA 3C8XA 2HLEA 3HJRA 2YB7A 4UOJA 5HPOA 3LPGA 4JJ6A 2C4XA 3I2GA 2V4VA 3DC7A 3NNGA 2YFUA 1IQDC 1NX9A 2RVAA 1KGYA 1W9WA 1UY2A 4ZXEA 4K7JA 3T0BA 1NUKA 4UAPA 4D8MA 4QPWA 3F2ZA 1W0NA 1GOHA 3PUIA 1NKGA 2O14A 2WABA 4XUOA 4K9SA 3VDCA 4IUGA 2W1SA 1DYOA 3HNYM 4KMQA 4BDVB 5CD9A 5IHRA 2Y6KA 3CKHA 2VQTA 4MGSA 1JZ6A 4DUXA 2X10A 2J1TA 1WKYA 1K7CA 1US2A 3P94A 3LEGA 3WF3A 3WSOA 3C7EA 4CU7A 3WNMA 1UWWA 1ULOA 3LEKA 1D7PM 1ES9A 3T2QA 3RJTA 2QQKA 3K75B 5IYYA 4A41A 1J00A 2QQMA 2PQSA 4KI5M 3K77A 2R7EB 1BWRA 2X05A 3ABZA 4H08A 3T0AA 1XNAA 4A44A 3GXUA 2W3JA 1JZ8A 1JZ4A 4PT6A 4CUAA 3CQOA 4QDQA 1U8UA 4LHSA 1UMHA 5I0DA 3HNMA 4HG6B 1H6XA 2VMEA 4JHZA 1W99A 1ESCA 4Q7QA 4E8CA 4Q9AA 1BHGA 3I2FA 5LA1A 1GNYA 3IDAA 1JYVA 5A4AA 2APJA 4OAOA 1CX1A 3C7OA 1UYXA 1PP4A 2J7MA 2YFZA 4ET7A 5HOEA 5CYYA 1TVGA 3NJVA 1WABA 2ZXQA 1YQ2A 3P6BA 2LW8A 5B4NA 3W5NA 4ZY9A 4QDSA 1DEXA 2E31A 5JXIA 1DP0A 1UXZA 3PT5A 3LPFA 1XNTA 4AAXA 2J1EA 3EYPA 2JE8A 4CU9A 4OAPA 3AC0A 1J83A 2DCJA 1ZMBA 5BN1A 2XOMA 4CU6A 2ZEYA 3ECQA 3C7FA 1ESEA 4QX2A 3MV11 2HYXA 2X09A 1NAEA 2EIDA 1R64A 2Y6JA 3OGVA 3WF4A 2WDBA 4RN5A 1JZ5A 3ETPA 4L0PA 2W94A 1OH4A 4RW0A 2QQIA 2ZEWA 3HPNA 5G05L 3CZJA 3WNPA 3DT6A 5LA0A 3GGLA 2OKXA 2VL4A 3FN9A 4XUTA 1DEOA 4JJ4A 4QX0A 2VCAA 1XPWA 2WO3A 5FUIA 5C71A 1EUTA 2L9LA 1W9TA 4RYDA 5JD3A 3T0DA 4AG4A 5F7UA 3I2HA 1EUUA 3ZM8A 1P8JA 1JYNA 4BK4A 2J1UA 2E33A 4RSHA 2JDAA 4MO3M 3WF2A 3BZWA 3OEBA 1JZ7A 4JGGA 3W5MA 4TTGA 1US3A 3T08A 1FXWA 3DECA 5C7GA 1UYYA 2VZRA 2Y8KA 3KVNA 2VZSA 2VR4A 1UY3A 5DN2A 1CZTA 1Z8HA 4PQQA 2B9VA 4HYQA 4M8KA 1SG3A 3HOBA 1HN1A 2W1QA 1UX7A 2J22A 5DMYA 3I2IA 4XVHA 1GQPA 2WAAA 5JXGA 4NRDA 1PX3A 2W5FA 2CDPA 4DEVA 1GOGA 3EB7A 3DYOA 2VCBA 3J7HA 5DPNA 2Z4FA 2VMDA 3MUY1 2W91A 3JXSA 3UESA 4CVUA 3A7QA 3WQBA 2C26A 4CUBA 2W95A 2Y6LA 3E1F1 3VDBA 1W8OA 4QX1A 4W4ZA 1PMHX 1JU3A 1F4AA 2VC9A 3FL7A 3IAQA 1H6YA 5EIYB 3MUZ1 4LPLA 4ZZ8A 3LQCA 1UMIA 1J84A 1O8SA 2EIBA 4W50A 3K46A 2RJ2A 4P00B 4S1PA 1LNSA 2W87A 2VPTA 3NJXA 3VD3A 2ZEXA 3DYMA 2CDOA 2QQOA 1I5PA 2V72A 1ESDA 3U37A 3MO4A 1L7RA 2VM9A 4MGQA 3LEIA 3T2PA 2VCCA 3ACHA 2VMCA 3I2KA 2WO1A 2Y6GA 5CZKA 3DCIA 4K3UA 1PX4A 2VMFA 3I3DA 1O8PA 4ZZ5A 2VQUA 5IFTA 3A21A 2XHNA 1O59A 4CUCA 4QAWA 3A22A 4PF1A 3WNLA 3K4ZA 1W9SA 4TXWA 1DLCA 5A1AA 4A6OA 2W9XA 2QQJA 4UI9L 3DYPA 2RV9A 1L7QA 4A3ZA 1K3IA 2Q0SA 1BWPA 1JHJA 3ACIA 1JYWA 1UY4A 3MBWA 1PMJX 2EIEA 4YPJA 3WF1A 3DT8A 3CDZB 2VZOA 2YG0A 1UY0A 1OD3A 4JX0A 3VDAA 4A45A 1JI6A 2J1VA 4E8DA 3IAPA 3VD7A 4DXSA 1SHWB 4GWIA 2WN2A 1JRLA 2VTFA 3FHQA 4LKSA 3WNKA 1GU3A 4A42A 2VJXA 3T09A 2W1WA 3MV01 3HNBM 2WN3A 2J1SA 3UNPA 2VZTA 2E26A 4JHLA 4W8JA 2W1UA 2BGPA 3SKJE 3BGAA 1T2XA 4OMCA 2XQXA 4DXRA 4JKKA 2WZEA 1UZ0A 2YC2A 2XONA 4BXSV 1YZFA 3K4DA 4I8IA 4ARYA 2BBAA 4XUNA 2WO2A 4CU8A 2B4KA 4ARXA 5EJZB 4A4AA 4M4PA 2WQ8A 1OF4A 2VZUA 3HN3A 5IFPA 1W8NA 4TX1A 1GMMA 2WZ8A 3VD9A 2LS6A 1K42A 1IVNA 2BGOA 3DT9A 1VYHA 4HF7A 1TG7A 3THDA 2BERA 2W92A 2E32A 4M4RA 3FHAA 5EJ1B 1OT5A 1JZ2A 2Y64A 4QB1A 1UY1A 3MILA 4P08A 1JYXA 3C7GA 4JKOA 4FI9A 2JKXA 3I2JA 4XZUG 2J1AA 3C1UA 5JXHA 3CIHA 5JUVA 3CZUA 1GUIA 4OMDA 3UETA 3OEAA 4QB2A 3IIIA 2Q0QA 3PUHA 4D0QA 1VJGA 4GWJA 4MADA 4QX3A 1FXWF 1CIYA 1ULPA 2Y6HA 3T2OA 3D3AA 2QBXA 2VOTA 3OB8A 3SLRA 1MPXA 3VD5A 2VO5A 1JZ3A 5B4XA 4BJ0A 4KWUA 2ID4A 1KEXA 2WYSA 3IB3A 2WUHA 3WNNA 4DUWA 2KD7A 4BK5A 2C9KA 4QDRA 5JXJA 2QQLA 2JD9A 3K4AA 4GZ9A 1K12A 3SKVA 5B5SA 3NRUA 5DQ0A 4JKLA 3OGRA 3SEEA 2W46A 2BZDA 3NQHA 2VZ3A 2ZEZA 3HEIA 1K45A 2WBKA 5LCWL 2YC4A 3CMGA 3ACFA 4PPYA 3C7HA 4JKMA 2VZPA 3OBAA 4DEQA 2WAOA 2VZ1A 4Z2AA 1JU4A 1F4HA 4DXTA 3THCA 2HSJA 3GDBA 3WEZA 3P1IA 2DDUA 4XUPA 2QQNA 4LQRA 3HP4A 3BN6A 3WF0A 1CZSA 4XUQA 5LA2A 4OYUA 2VZQA 1BWQA 2VZVA 3I3BA 3A23A 1GOFA 3ACGA 4MOAA 4K40A 2W47A 4OZOA 5HXMA 4DUVA 4P02B 1CZVA 3W7VA 1RYYA 3GM8A 1UXXX 3I97A 3LE0A 3I3EA 2ORXA 3VD4A 4IYJA 2ORZA 4QB6A 3SEPA 1UYZA 3OG2A 1V2GA 4P5YA 2DCKA 4OUEA 4XURA 1WCQA 5C70A 5G04L 2V5DA 3WNOA 5IJRA 1OF3A 1XC6A 2J1RA 5J1XA
chains in the Genus database with same CATH superfamily
1G9TA 4CIVA 1I8TA 1TNFA 3DOFA 1WUJS 1OYYA 1PJ8A 4DS3A 3R4VA 1X9HA 4CI9A 3R4DB 5FY5A 4EGFA 1IQPA 5K09A 4BNGA 1LU9A 3AR7A 3BSYA 4Q4Y3 1LOCA 1QB7A 2VUDA 3ZXXA 5K8VA 2X6TA 1Y7PA 4DLPA 5C3RA 3QVJA 2E6UX 2PLRA 2GZHA 3MS7A 3LSTA 2IEZA 1Q83A 4TKUA 4HB2A 2ZA9A 5L9RA 3AR8A 4KI5M 2XOKA 4C7MA 3WJ7A 3BF8A 1E0AA 2PX6A 2R7EB 3LUGA 3KWMA 5H5JA 2E9QA 1HQYE 1EQAA 3TXAA 2ADOA 3D1LA 1GRCA 2NZUG 2K87A 1DXQA 5KAMA 1GM5A 3ZFEB 1MEOA 1RWNA 1QJEA 1OA0A 5DXAA 2W83A 3WL7A 1ARZA 4OAOA 1GR3A 5J2TB 4GICA 3K0FB 1U4SA 4RS5C 1WW8A 1SUCA 5DBOA 1HTBA 3OBBA 2IPNA 3PIRA 4KG8A 2L69A 3A9TA 3UA4A 2X6RA 3OESA 4ZKTB 4L8LA 1XN4A 3S2ZA 4JL8A 1UBUS 2IZ5A 5E2AA 2X8LA 2NO0A 2QTZA 3NNMA 2H5IA 4NQRA 4Q4Y1 4MHSA 1KZ4A 1VPTA 1N2HA 1N78A 5E95A 3ESYA 1UD1A 4Q4V1 1E5QA 1KS4A 1UMDB 3F74A 2VHCA 1IPSA 2DPHA 3C39A 3AXDA 2PHWA 5JD3A 3AIKA 2JI8A 4R01A 4KQIA 4ZGBA 4TSVA 1QHXA 4D9NA 4L9RA 1CZLA 3THWA 4RF3A 1F8FA 1MVQA 2I3GA 1Z45A 1GICA 3R5JA 2DZDA 2JGLA 3SF8B 3MDPA 2A9VA 4QC2A 5ITZB 1SZJG 5ITZA 5HQ3A 1D2RA 4R69A 2X5KO 2R6HA 3I2IA 2VH5R 1N0WA 4G37A 3OHMA 3Q3VA 4RV9A 4P83A 1FMTA 2A6WA 4IWNA 3LFTA 3NKGA 3DV2A 1LPAB 1PR2A 1Q22A 3DZGA 1F4PA 2DURA 3EWAA 4PXAA 3TQQA 4LF4B 1JQKA 2B30A 2VL7A 2IYVA 1WRBA 3DYMA 2CDOA 4F5WA 2I74A 4PYOA 4BZZA 4DRVA 1HX7A 1JR3E 2VMCA 3HU1A 5CG1A 1TF7A 2CLCX 3NRCA 5I5GA 4LTAA 1XK7A 2ASVA 2YXPX 4OUDB 4D8WA 2B7YA 2IV2X 2Q9BA 1YHYA 4TV9A 4UCXA 5B3LA 1KTIA 1LJUA 2R7KA 1FSGA 4BP1A 2H4YA 3HDVA 3T06B 3HB4X 1X13A 5D1NA 1C41A 3PXDA 2I7TA 3UVEA 1T36B 4MXVA 3RNOA 4RM2A 3QI2A 5HA5A 3O93A 2WY2D 5K9ZA 3FW1A 3H2IA 3IH5A 5GM2A 2W43A 4KN6A 3IVRA 4KE8A 1VYHA 3EXEA 3WNCA 4YRAA 2Y38A 4CG2A 4EGSA 2GZWA 4RM3A 3U4QB 2CJWB 2P2YA 1E0KA 1U0RA 1ZD2P 4XJ9A 2NYAA 2ENUA 5FBQB 3VKMA 3OYWA 3CKMA 1H0BA 5JD6A 2H1LA 2R6DA 4K6MA 4YV0A 1KYXA 1HPLA 3SI7A 1DRUA 4P84A 3DL4A 5LLSA 1PJ3A 3FDJA 4BZXA 4PI2A 1RI1A 1JN0A 4BPBA 1EFTA 2HCJB 1UK6A 1RQ7A 4FYVA 5JVDB 5LQJA 3O8OB 1O6GA 4Z2AA 2O1XA 5ARCA 2WJ3A 2XLGA 2EP7A 2XKAA 3ZE9A 3R6DA 4UE2A 1KU0A 2RI0A 3SHRA 3GAMA 4NATA 4MGKR 3T1MA 1Y6GA 3BGOS 2G1UA 2COKA 4INPA 3J7TA 2UZ4A 3QY9A 2NV0A 4YROA 3EA4A 6ABPA 4JYZA 4W5TA 2AC1A 4XMIA 2EX0A 1YNOA 1OJLA 2FPWA 2I7XA 3NHUA 3VSCA 2HREA 3HBLA 3OX4A 4ASUA 1SDDB 2HJRA 3K35A 1F31A 1NNSA 5JJ5A 1LD3A 3M6UA 4NSNA 1U3WA 5L7WA 1Z25A 1NT4A 2PUFA 4NVRA 1XZHA 3VV2A 3U4MA 1XG5A 3QLVC 3GMDA 5J4LA 3EJWA 5L3SB 4V3BA 4D9CA 2WWSA 1RNLA 3OEED 2VT2A 1NE2A 1CE8B 5J3JA 421PA 3JATA 1R093 3PIIA 3CUWA 1M2KA 2YW9A 3SEAA 5BV6A 3EQ2A 2PQSA 2P4UA 3SE7A 5A9TA 2ARXA 1A9ZA 5CKNA 1JE0A 1GNPA 3HCPA 4Z9YA 5EZWA 1CIPA 4DR1B 3VDDB 5JUWA 3ZBQA 1PJ4A 3IPCA 1W99A 4D79A 1PHPA 1VJCA 4TLFA 3ZOZA 4OXYA 1JUHA 3DMHA 4JC4A 5IXSA 1MF7A 3NVKI 4YZ3A 1HKHA 1NCQC 4LPKA 2PA7A 4WRRA 4L99A 1W6OB 4RTJA 2EKDA 2ZBJA 1Z34A 3T7AA 2DVMA 4OMUA 1OKKA 4CU6A 3CW2A 4R16A 2JHCA 5DG2A 1XPUA 1SCUB 2BMWA 3I5XA 3PNBA 3EMKA 1YB4A 3ZOIA 4ATFA 3Q7QA 1E57A 4KWCA 1GTMA 3BMXA 1MZPA 1ZCZA 1Z12A 1XTZA 1EUTA 4UARA 1JE1A 2I7CA 1Z0KA 3MINA 2VAMA 3IKMB 3NDRA 3ZM8A 5BPHA 4GE0A 4MQFA 3K70D 5A6QA 3TD2A 2QLTA 4I66A 3IV9A 4JUCA 3IQZA 2JFZA 5GZ3A 1RRPA 1YFZA 3WW3A 4LJ6A 1TKAA 5EZSA 5REQB 4HONA 5C7IO 3LLSA 2R042 3AERA 5LLDA 1RUJ3 4Q1EA 3VVMA 5AVOA 1EP1B 4RNDB 4YW3A 1ZNWA 5BNQA 3CKYA 1QF7A 2OAEA 2R68A 3UAWA 4W5QA 5CU1A 2B7CA 3E1F1 4NI5A 1K97A 4D2IA 5I9LA 4C5CA 1OHHD 4I81A 2ZJ1A 4WM8C 1TM4E 3K46A 3QA9A 2WC1A 5AWFC 5T3NA 1KR5A 2VDQB 4ER7A 2PGDA 3SR0A 4NBNA 1C1FA 1Q0LA 3M3DA 3SN6A 4ZCIA 4PANA 3AP6A 2VUSA 2PHLA 1M1YA 2A75A 2PL3A 2XUOA 4ZU3A 3URMA 1RI5A 5FL7D 3H6KA 3WUCA 1DJLA 1QTIA 4XF4A 4EELA 3P9YA 1MKYA 4RBNA 1JHJA 2VW1A 1ZXXA 1UY4A 3NS7A 1JX6A 1N2BA 1YU9A 4QUJA 3FHLA 3LG2A 1QMGA 1KZ1A 1NVKA 1A96A 4Q3EA 1RWBA 4YCDA 5BYKA 4ZEVA 2IITA 4Y6RA 2BDTA 1NRWA 3PXUA 4HDNB 4OXQA 5DCLA 4KGZA 4OX9Y 5JO0A 3Q7IA 2BM1A 3PNYA 1B41A 5ER9A 5JALA 4TRNA 4KH9A 1WEKA 5JSFA 3LD9A 2IP4A 3LVQE 5EJ1B 1FVXA 4N03A 4D80A 4FE4A 4UDYX 3HXQA 1CYDA 4ID9A 3LZZA 2O2CA 4HH1A 1BGXT 1RUC3 3OJXA 2X9VA 1FTGA 5LBCA 3DTVB 2VO5A 3DTVA 4D1YA 4NP6A 2Z2KA 1W39A 4AVVA 1ZK0A 4NU6A 2C4MA 3EC1A 3ZFGA 2P3SA 4ZJPA 1NKSA 1A3KA 5CA1F 2ZX2A 4CLRB 3OIDA 5L4SA 2Z4TA 4Q9IA 3IUSA 5IWAB 1EDBA 1PVVA 2DDUA 4OG2A 3WDMA 1BS2A 4RA6B 1TE1B 3QPUA 4E2ZA 3ZNQA 2XJ9A 1GQ2A 1NU8A 4L4XA 4LV5B 4LULA 4CN9A 4MGYE 1R092 4OI4A 3W7VA 5K8IA 1UBGA 2FVYA 1PD0A 2JLYA 3U7EB 2CY6A 1XDZA 2GYVA 1D9ZA 4I55F 3EZYA 2JGDA 2J1RA 2YY1A 3I83A 2X5IB 5CEJA 3UKVA 3LBIA 3OGSA 3T2TA 2HMVA 3DZKA 1QH1A 2R48A 5DAXA 2YB7A 5ICCA 1OFSA 4RHV2 2AOWA 2QQ0A 2M6RA 1GGKA 2WWUA 1T3SA 2VHQA 2PRYA 4G0QA 121PA 4UAPA 3I9JA 3RYCA 3KSAC 3CW8X 1ZBA3 3RSZA 3PC8C 3GXBA 4HB3A 221PA 3M49A 4MO9A 2V7UA 1NE4A 3ZFFB 5ICEA 5TS2A 5BV7A 4FXOA 2RS32 5SYAA 1EZZA 5KSWB 1Y8AA 2CXRA 5FWJA 1UJNA 2J0SA 3UHJA 1YZYA 4D6RA 4WDQA 4ZQCB 4G5SA 3CJQA 1G7YA 1JIJA 1A5ZA 3KU4A 2G4VA 5D86A 1EGAA 4TYNA 1NNEA 1U9IC 4WBXC 1X92A 4M0UA 5DX8A 3D31A 1WM1A 1RBZA 1AIPA 5HOEA 1UODA 3NRJA 3ZX5A 3NIDB 1U28C 3U5TA 5HYVA 4UJ5A 5DMHA 4WJLA 3A7EA 2ID9A 5DBHX 2CFRA 3WB9A 1EBUA 2GEFA 5TV2A 2P3JA 5E1BA 3VAYA 5LZ9A 3N7AA 4OL0A 2A1XA 4M4SA 3UGFA 2IZOA 5DIFA 4KDFA 1QSGA 5KJ6A 2PZEA 2UUBB 2PSFA 1BKYA 1EFRA 3ZWAA 5A4IS 2XJRA 3DC2A 4MUJA 3U3KA 3L9WA 1NLUA 1SVSA 1NUTA 1V1RB 2QZJA 4JDNA 5FY1A 1MVNA 3BQMB 3MT0A 5MN5A 1E94E 3BK2A 1Z8HA 4TLBA 1OLUB 2VLBA 2J32A 3RT9A 3A4TA 2CYCA 2O2IA 2IYFA 1CB0A 4ZYWA 2XITA 4ABYA 2JIBA 2KS6A 2FV8A 4QRHA 3JQCA 2HKXA 3CO5A 3TIGA 4E3ZA 2ZGRA 1UFVA 1CVRA 1CQZA 1W8OA 1X14A 3BIOA 3O4IA 3VTFA 3MJSA 4QGHA 3RARA 2PHUA 4JJ7A 2XUIA 4JDPA 5B57C 4P00B 5LBBA 1BXZA 1Q0QA 2BYTA 4MIEA 3MS2A 2OUJA 1QIFA 1OC1A 1XV5A 5HP4A 1MT3A 1ZO8A 1U9IA 1G2OA 5C3UA 1VB2A 4B4DA 1GPJA 4UCFA 5FUNA 5MGBA 4YVSC 1LKNA 1U8XX 3CLTD 1TPYA 4RFLA 2GUWA 4AQ2A 4BTEA 2HHHB 1L7OA 2UXDB 3VOAA 3LO8A 3BIWE 3HZZA 4OQDA 4WXMA 1OWPA 3U9TA 3TBHA 1BDIA 1CUBA 1LECA 2HJ9A 3I1FA 2PKYX 5C34B 2YBKA 5JRZA 4IMPA 2Z4SA 4I6GA 1FFSA 2D0IA 4F6RA 3RO7A 4I4IA 4QPIC 4BO0A 4AGRA 2WHQA 5CBKA 3VN4A 3Q9LA 1TMGE 1GVHA 3KGLA 2F8SA 3D6NB 3MCTA 1E2GA 5IW0A 3P9SA 1OT5A 2QV7A 1FRNA 3VR2D 1NA5A 5ALJA 1FDUA 1HIXA 3WLOA 4CT5A 4EJFA 3NO4A 4RA9A 3UETA 1WLSA 1WDTA 3NW4A 5JDBA 3SIRA 3M7AA 4G9GA 3JD3A 2OB1A 3JWGA 5LIRA 4PR0A 2HWUA 3NBZC 2GYWA 4OU4A 3MIGA 1FNBA 2QUKA 3BN3A 3LOIA 4J1NA 1DKRA 3LOQA 4REQA 5EJAA 2V9PA 2HLPA 3DDHA 4ALNA 2NVWA 3WMGA 2Y1DA 3P2JA 3X1DA 1T9BA 4M36A 2GRJA 3VKVA 4RWZA 3WAJA 2FG5A 3C3YA 2ZJYA 2ATFA 4PWYA 2XKOA 3SQWA 2E4AA 1X50A 3FAZA 3MRTA 1THGA 2FPIB 3GJ7A 1KJZA 4QX7A 4EY4A 5EHDA 3KYDA 2P79A 1YS7A 3EJ6A 3OFNA 1NBME 4D9JA 2CAUA 2ZE6A 2X1VA 3IDBB 3CE6A 3OLYA 1PV2A 2WWXA 4D4GA 5JR2A 3PVOA 4GBGA 1DWOA 1GLVA 1KYQA 2PXHA 2Q4OA 4MGHA 1NI5A 3WA6A 3POYA 3PP8A 3EQEA 1XDWA 3A0KA 3AVXA 4O4LF 4N65A 4TLLB 4LJ8A 3NCTA 2IPMA 4CEHA 1VG1A 3RC1A 3EA5A 3G9XA 5D6OA 3RVHA 4DHEA 3ZH9B 1BHSA 3N53A 3Q8BA 2C07A 3QBEA 4FPJA 3W04A 3A4NA 3APBA 1DO0A 5A5FA 2H0RA 2WQ7A 5DYGA 2HA3A 4WADA 3IBGA 3PDJA 4GI7A 4OFZA 4MQMA 1J5EB 1UWKA 2P2SA 1PFWA 3IL2A 3GRZA 2IYLD 3MPPG 2Y05A 2EIGA 2YMMA 1AJEA 2I4LA 3LFIA 2ZPAA 1QY4A 2JICA 3JVIA 1UAAA 1FTNA 4Q9AA 1CG6A 2C3MA 3Q7TA 3KSMA 2QRNA 4C0KA 4DAOA 1W05A 3OKFA 3WLRA 3ANTA 2P4QA 3RRBA 4B17A 2GILA 1T0JB 4R51A 1D04A 2F4LA 2Z5WA 3N8NA 2HSDA 2NGRA 2EJUA 2C5AA 3ZXKA 2Q5JA 2ZAMA 1U3DA 4Q8LA 2Q6LA 5JCZA 2WUFA 3ZGNA 1C9JA 2DY1A 1NG0A 1FYXA 3UB4A 2AI1A 3L3BA 4Q1FA 2ZWVA 4PLHA 5EKXA 1BNCA 3WJ2A 4JLOA 3DFUA 1E2MA 4GI1A 1KZHA 4IRMA 2IFWA 2P8JA 1Z6YA 1UPBA 1XZ8A 4L76A 1CIVA 5FREA 1JB9A 1QE3A 1W8TA 5AR1A 1UADA 1XTRA 1JIKA 4M99A 3AM2A 4R9BA 5LQMA 1YWKA 3K2BA 3RK4A 4I5FA 5J36A 2F1IA 2P9TA 2ES4A 4FI3F 2BTQA 4ZREA 3ZKWB 1F3LA 3EK2A 3A06A 3RRXA 1ASJ1 4NRDA 3K94A 2JLRA 4DJJA 1QZUA 1WCDJ 1MPTA 4B4KA 2RJLA 1G0NA 1JLHA 5F1KA 1V1MA 3LT4A 4YM3A 1UKZA 1WXQA 1O95C 2BLLA 4P7KA 2WJAA 4FB4A 5CGZA 3FSJX 1EVQA 2C7PA 1JSLA 4LCEA 2KYRA 3H4VA 5DDJ3 4RUKA 2B9UA 4I1YA 4N7UA 5AOBA 3GFQA 2JEMA 1Q3HA 1AJKA 5FP4A 4LVCA 1IJBA 4ZV7A 4CMEC 3SSOA 4CLOB 3ZFEC 1IS4A 4V0RA 5FHRA 4OATA 2BTEA 3TZCA 1L4KA 3TGPA 1K5HA 2LV8A 4H0CA 4Q1VA 1YFLA 1JR3A 1TM3E 2QORA 5F4BA 2XCUA 1UPTA 3WMWA 5G1NA 3IP5A 4E2FA 1AHNA 2FF5A 1Q0SA 3K9HA 1C1HA 3QBVA 1J1IA 3OPXA 4DKXA 4M8NE 3VBHC 4IIUA 1OD6A 5AVWA 3HNBM 4ASUD 2XJ4A 3BGAA 1JJVA 4C1NA 5K8UA 2BGKA 3MWYW 1GP2A 5HCFA 1YK1A 3GRUA 5FLEX 4GALA 4JU9A 2IV7A 3HDGA 1L5OA 3R5HA 5HRCA 1HNXB 5WRFA 1QV7A 2HY7A 4Z4FA 3D7LA 4PZLA 2WJWA 3E8SA 4IUYA 2WJJA 2JFWA 2PO5A 5CDFA 2KJQA 5HF5A 1ZOPA 3ENRA 2XQIA 3F6EX 3OIUA 1VMIA 4R81A 4BQ1A 3PLQA 2R25B 1LBSA 2RGBA 4C7OA 3RTAA 3ISJA 2I9PA 5ADHA 3H5OA 4BKRA 1TME1 4MQ6A 2XT9A 1K12A 4DUPA 1HLFA 2EEZA 3EGDB 3C1TA 3TBKA 2CZCA 3VKLA 5AW4A 1GL3A 2OD7A 5KWIA 1BMV2 4MW0A 1P3Y1 3HVRA 1F4HA 3C24A 1RCUA 3FWNA 3IKLA 1IHXA 1OT3A 1SKUA 1YQCA 4DPNA 3O95A 3G7UA 2D6MA 4A7ZA 2J87A 4AWBA 2CMFA 1QJFA 4AE2A 5M5BA 4GWKA 5K8CA 3LUPA 4LQCA 2JB8A 5JI9A 1KDOA 3MWFA 1QNLA 4ZO6A 1MBZA 1VFNA 3MS4A 2D1FA 2P2KA 4LMRA 2ZWOA 5FFOC 2DVFA 4FLEA 4YMTA 4B3TB 4G0MA 3D64A 4CCNA 1UZAA 1FXSA 1QB8A 1XSEA 5DI3B 4YI5A 2RSLA 3DMYA 1LR5A 3W5VA 1JQDA 5FYMA 2YY6A 4MDEA 1ZD3A 3FCUB 1UJCA 1ZOOA 2C20A 1KGYA 2AXNA 5BY2A 2JW5A 5AXBA 3H42B 2GJKA 5REQA 3UANA 1W0NA 1GOHA 3W5BA 2W1SA 2H1WA 3QYAA 1XCBA 3G2IA 4J0QA 4KMQA 3S99A 3SLGA 4CIYA 4HDAA 3ZWWA 2AN1A 2C2KA 1EVKA 5EWLA 4HZUA 3AUJB 4KQ7A 3KCXA 4N6GA 1KPGA 2BEWA 4Y0VA 2QZ9A 1G64A 2FPGB 2XZOA 4DQVA 2Z6QA 4AZZA 3IVXA 1K98A 2ARAA 1EK6A 3ICOA 2NT4A 1I6LA 1N0VC 3A4UA 1BHQ1 4DRZA 3OICA 4BLSA 2FP3A 3EGEA 4NZMA 4PFJA 5KNCH 2G7ZA 1IY8A 1PZEA 1V6NA 3TVYA 3BM5A 4EN0A 3R7DA 4ZS2A 2HHJA 3QF4B 2BFDA 3U62A 4C6SA 5IC4A 2VHTA 1GGEA 1C9KA 4LLFA 2J7MA 3GEIA 2H2FA 5FYDA 1GG8A 4HJRA 1NCQA 1CD3G 1RXSA 2AEMA 4KLNA 5F1PA 1DG3A 4CU9A 3TMAA 2OCBA 5FMDA 4LW8A 1XD2A 4LHNA 4ZEMA 5A3SA 3NHAA 1SVUA 2ZT6A 1CDZA 2JCBA 3MJDA 2ZRDA 1Y4UA 3ENVA 1EZ4A 1FX5A 2REQB 1FVOA 2PGOA 4OCZA 1S0JA 4IMJB 1NASA 1UOFA 3GU3A 5BXQC 2IHUA 1W1IA 3T3OA 1RWXA 1C1YA 3KTAA 1XCJA 2VAWA 1S02A 3HCDA 1XOIA 1OWMA 1WWYA 4YFVA 4XTPA 2B34A 4E21A 4F7WA 4P80A 4LITA 4P4TA 2XSZA 1MMFB 1QIEA 3T12A 5HTOA 4ILKA 1AL22 1U0NA 1DTWB 1DG6A 3FYUA 4J43A 4J91A 2AFIA 4IQFA 2ZQ5A 3VU8A 2XYGA 1ENSA 1J1ZA 1UXJA 2VRBA 1K7EB 2W95A 2EAAA 2O1WA 4DG9A 4AICA 4LDZA 1VBE2 2YWBA 4AYTA 4BNDA 2VPTA 3N9IA 2IDKA 4L9BA 1RXWA 4GI2A 4RA6A 3H17A 1W8UA 3T4XA 5AKIA 4JENA 4KIJA 4MA5A 3JZVA 2Q4DA 3Q5EA 4R1SA 3W9UA 4ONUA 1EEHA 2CL0X 3GQBB 1L7QA 3O1UA 5KIAA 4S2HA 4GAEA 1QJCA 1BGWA 5AVPA 4IILA 3GVIA 2XL7A 3GHYA 3M4NA 5BOSB 4KXYA 3VI3B 3WNKA 3RS6A 1XUOA 3GA5A 2E26A 2VH1A 2YDYA 5FNVF 3TQSA 4FXGB 1SCAA 4WFKA 3N2NA 4UMVA 4JKKA 2W8BA 2VTKA 2OT3B 4AHYA 3H5TA 2JDHA 4BU0A 2WE8A 4DKJA 5EXEA 3BQ9A 2FR1A 4M4PA 1RGSA 2XSZD 2A7AA 1YL6A 1XTSA 4EMTA 2J9YB 5HOQA 3A3YA 4FCCA 3QPAA 1N6PA 4MCIA 3OU6A 1VIVA 2Y64A 4QB1A 4ZI7B 5LDHA 3KUKA 1UBCA 1I33A 4BE4A 1GYPA 2YHJA 3WJ1A 2Q9UA 3Q9NA 2JD0A 4CM6A 2BGWA 1MA3A 4TTQA 3VD5A 3PUJA 4PO9A 5F7JA 5IUNC 2G4LA 4LBLA 2YJ3A 4PZYA 2XB2A 3I6YA 5ANNA 4CZSA 2FJPA 4E2XA 3PRHA 4XJUA 3PNKA 5FIUA 3DE2X 1OKOA 3KS9A 1C57A 1WB6A 1JU9A 2YC4A 1MO2A 3LXXA 4YVWC 5FUQA 3QJGA 3VBFB 3BH0A 1F60A 3VL8A 1QORA 3G7NA 5BVHA 1KSHA 1U2GA 4WZBB 1ACCA 4WLUA 4W5RA 1T5SA 5F3DA 4EWAA 3KHKA 1RPZA 4NYMR 2KMLA 4LJ9A 1TQ6A 1NC1A 1Q3TA 3PC7A 1P1HA 2WSYB 4Z49A 5HQJA 2XTMA 5B2ZA 3JB4C 3RS5A 3O84A 5JJKA 1IS6A 4RXTA 4FCAA 4TUYF 1QS0A 2UY9A 5JNTA 2PLV3 3TZ6A 1BEV1 1P4AA 4CKBA 2RK3A 4EHAA 3H0CA 1XN1A 3V55A 1I4EB 2QVGA 3N6RA 5EE3A 1NJ8A 1Q77A 3IZOA 2FZKA 3EVFA 4BVFA 4F4CA 3UC5A 1VGRA 3P2KA 4M6WB 3RVQA 1HRI2 4AK9A 1M6VA 1TEHA 3MBKA 1I5OA 4JGYB 3UO8B 3KZKA 4JLVA 3UYJA 4CP0A 2FEAA 1W8ZA 1W2TA 4NOLA 4PGMA 1ORIA 3HCEA 1R1A2 4V02A 1RHQA 2COUA 4W9RA 2I67A 4XDOA 1QAOA 3RZGA 4CHTA 1Z4JA 4TN5A 5FFNA 1QQP1 3EDYA 3Q7PA 4C7KA 1LVUA 2QMQA 1XX6A 1ZU4A 2E55A 3B12A 1G7SA 4RJKA 2JKBA 5ELLA 2QT1A 4NOKA 1W75A 3SJAA 1TA0A 2VZLA 4JHXA 4LHSA 1XTKA 4C03A 2CK3A 3QG1A 1PK9A 5BMOA 1G3MA 5K0CA 4DLKA 4HFJA 1DMRA 2CEKA 4EZEA 4CNBA 3EEOA 5AW1A 5GLTA 5CVEA 4JBYA 1Q1AA 4X54A 4KCGA 5I7AA 4LLOA 2ZB8A 4P0PB 3HV0A 5IK8A 5BNOA 3BHJA 5F3GA 5IDQA 3KOWA 4XF9A 2OYSA 5DM60 1MS9A 1UYPA 2GCPA 2ZEWA 4A0FA 5KWJA 4LE3A 3MGBA 1S2GA 4B7XA 1RJ9B 1T1IA 4IERA 1KIFA 4YQEA 3BJEA 1RKQA 5FJKA 2ONKA 3VNAA 4Z7OB 1XMOB 4RHV1 1WW6A 4JR1A 3B48A 3QV1A 4C0XA 3VR6D 3C4JA 2XA2A 2W39A 2Y68A 2VJMB 2YUIA 2Z3WA 1Z88A 4Y6PA 3LY7A 3DN7A 4YNIA 1S0DA 4RU1A 4UFIA 4YM1A 4KGQA 5CFLA 2BEOA 5DPNA 1DJOA 2CEAA 3QVLA 3EVDA 1V7PC 3LPNA 4HN2A 2ZAAA 1U3TA 5I4CA 4H7MA 1WD7A 5JFGA 3NJRA 1GP5A 4PYKA 3E5HA 2WYHA 3HCFA 3WYEA 5KPJA 4NJMA 1SQ4A 4BGUA 1NXPA 5ALUA 1NJ5A 1DC6A 4ZZ8A 1HB3A 2NUPA 4YPOA 2O2ZA 3QW4B 4QPCA 4G4GA 2QUJA 4NZZA 4UUOA 3NNJA 3R6WA 4F93B 3BCSA 1EHIA 2JCGA 5JNLA 3QFCA 3W9SA 4B3IA 4BGIA 4B81A 2ZJ6A 4HWTA 3CRQA 1RQGA 2BF7A 3H2SA 3OUHA 2D13A 3OQNA 4L07A 3HVJA 4EVSA 2C3UA 4YRNA 13PKA 4FK8A 1SQ0A 2PMFA 2VZ9A 4OBEA 3FZQA 3WKEA 3I2YX 4UBLA 4I5EA 1CUSA 1PWZA 2GD6A 5AJWA 4P38A 5ESRA 3LRTA 5DXDA 4MV1A 4HWSA 5IAXA 3BE4A 3F4BA 1FPN1 1DEKA 2P4HX 2W6QA 4ZAYA 1YU6A 1ZI8A 4ACBA 1N2JA 5F32A 5EJGA 4DNXA 3HXTA 1UMBA 1YE3A 2WWJA 1ZEMA 3EVGA 1Z4LA 1YI8A 3OOSA 3O3MB 1N1TA 1ZI9A 5H02A 3N75A 3WLNA 1XPJA 4BEBA 4GI5A 1B35C 1E9CA 1H2XA 4XABA 2WTMA 2WTUA 1NOKA 1GP6A 5FZKA 1I0ZA 3SCZA 3CZQA 3KEOA 5DHUA 3E0QA 2P3LA 2O4CA 2XMCA 4JTNA 3QELB 4FFBA 3A4YA 3AHHA 3USCS 4I1IA 2OLKA 3G0CA 4ZEOA 2A9JA 3I72A 1L0BA 3ZVLA 4CMEA 2DBIA 3E3LA 3DE7X 3D0RA 2OCIA 4BY9E 3ZMOA 5EXOA 1A69A 3K4AA 2XIJA 5EZ5A 2D5LA 1IGOA 4U7PB 1Q84A 1VIYA 3IEVA 2GMPA 3QUSA 3PVEA 3BYZA 4UVEA 3Q15C 1GANA 1KFEB 4U8HA 4Z99A 4H14A 1OFGA 1LKZA 3U44B 4OXKA 2NU8B 2UU9B 3UMFA 1D2GA 3KR2A 3KFLA 3AEUB 2MDTA 4D3ZA 4Q3DA 3I1YA 1PGW1 4KMSA 3WXMA 3QI7A 1ZUD1 1B6TA 3CVXA 2BM9A 2VHJA 3WP6A 1YRZA 3ELBA 3WDTA 4JV4A 3G2NA 5KQMA 2VOEA 3W90A 2C9CA 4ZEWA 2G6BA 2H18A 3OBIA 4M1MA 1H8EA 2JGNA 3D4NA 4QPPA 2HWF1 4RADA 4KU7A 3D8TA 1O96B 4C1XA 3VAAA 1OZ0A 3DNMA 3VYWA 2IC1A 1ULFA 1K0UA 1U5XA 3U3ZA 3RSQA 1RHI2 5ED4A 4I08A 3H2YA 3DB2A 1FRFS 3MTEA 5KYWB 3RS9A 3NEJA 3VHNA 5A70A 4HDCA 4TZTA 3UZUA 1IQ0A 1P8AA 1IBLB 1UWVA 4PZUA 5MDHA 2BFBA 3S2GA 5LIPA 4MGSA 2Y4OA 4UZEA 5CB7A 4BFWA 1P61B 4X6LA 4L92A 3P2MA 2NSYA 4DNFA 2ZHMA 4DCMA 3KLBA 2Q3DA 5I7HA 3ZHVA 3TCKA 4NE2A 5HE8A 1XU2A 2BKEA 3KR1A 3F78A 5F9TA 1ISPA 3KSCA 3OFND 1O3YA 2VMEA 2WA4A 4MX3A 4X8LA 4HEA6 3I61A 3KJXA 1X86B 4WCVA 2X2OA 3HU2A 2IY7A 3D0SA 2G77B 3L8GA 3JRNA 1EE2A 2C8LA 5F9FA 4G5XA 5B4VA 3GLFE 3TUJC 2CUKA 3CRW1 3I1JA 1DBRA 1P2GA 4RZIA 3ZZ1A 3OTFA 2DTWA 1VBC3 4DMIA 3DFIA 5JZMA 4PYLA 3MV11 2PUGA 4K9DA 4Y1YA 1E18A 4M9QA 4F8YA 3TTSA 2NZWA 4FKZA 4H1VA 2BW8A 3RSLA 2JFHA 3VOSA 2RHDA 3KHUA 1SXIA 4QBFA 1HTTA 1R4AA 5K0UB 4BH9A 2ZTNA 3BORA 1SZBA 4O6VA 3VHOA 2YY5A 4EE2A 4EG4A 3GUZA 1C5IA 3KOYA 4JQYA 1WB4A 2BTOA 4CKCA 1C50A 1SG9A 5JPCA 1OOEA 4QULA 1Y8QB 2BMEA 1DC5A 4E4RA 3BWBA 4RO0A 5L45A 1QJY1 3HPRA 3A14A 2DUMA 1T24A 4JYAB 1NXTA 4QGNA 1T1JA 2ZUEA 1VBA2 1NR7A 1MEEA 5JXGA 1UDAA 4QYXA 3TRJA 3C6QA 3VKNA 4PSVA 2D4HA 1NHWA 3BMOB 2YH2A 1ANKA 4OEHA 5A4MS 1QPGA 3PQ7A 4XM2A 2IVFA 4I9FA 3ZGLA 1DBPA 3U0ZA 1SUPA 2Q7OE 1SXQA 3F67A 3W5AA 5B3JA 5CVTA 1G8YA 3AFKA 3ZKYA 2IK8A 2W6PA 2YCLA 4AI6A 2UVPB 1PJSA 3ZUPA 3R0ZA 3KDSE 1DXHA 1B2RA 1J70A 1QO9A 1TK3A 1FZTA 1JHRA 3FR8A 4IQGA 4YT8A 2Q1YA 5A02A 2EKPA 1KDPA 1ODSA 4XJ8A 1OLSA 1T9GS 1W5AA 4MYCA 1A5SB 4RAOA 1HQWA 3ZVKA 1YKFA 1UY0A 3ADBA 1LDYA 2C2GA 3HJAA 1H8VA 5HGJA 3D0OA 3EEQA 2QJVA 2PRKA 5FKBA 2C5LA 2C7GA 4GNRA 4FMDF 4AKEA 4Y22A 1A5BB 3OSDA 3T5PA 1T2XA 5BNFA 1TKRA 1V2HE 3NWEA 2Q7XA 1P44A 5CCEA 1Q1BA 3DEAA 3QTTA 1MGOA 3NNFA 5CB4B 1E3TA 3QLQA 4XIGS 3P0HA 2VRCA 4QHYA 1R5NA 4Q01A 1QDLB 1AZWA 3EXHB 3GLKA 3GP3A 3VHQA 2JENA 4FJ0A 5IYZF 2XWBF 5KOHA 4XGKA 1I3NA 5FL3A 4MEAA 3DYVA 5CVVA 2ZZMA 5FZAA 1JDJA 3AU8A 5BSFA 4ZVKA 5B3AA 1CB7A 3GDWA 4AYUA 2Q5TA 1ZOSA 5CTJA 2V6FA 3WQHA 1HQLA 2J1LA 2VQAA 3RHZA 1G41A 3ILYA 2ZJAA 3T9FA 3NGXA 1MLDA 2I6GA 1YULA 1Z2PX 1FQJA 5K1ZA 1NJFA 4NARA 4G5OA 1HDXA 3ED1A 3AEZA 4X90A 1RUI1 1IM8A 2GXQA 1JVNA 1JAZA 4MYUA 4OOFA 2YYZA 2EDCA 3OZXA 4BNVA 2GEJA 3SKXA 4UU1A 5FO0A 5HXMA 1QCZA 2OVUA 1KY5A 5H70A 1VL6A 1E2EA 3ACLA 4QKBA 1WCIA 2PTMA 2QRMA 1ULEA 3CZ5A 4NPAA 2HM7A 4MPDA 4CG0A 3II6X 1PWHA 2QN6A 1L4NA 4LJ5A 1NXQA 1KY4A 3KT7A 4G1MB 4PTLA 2BC9A 5ICFA 4COYA 4UOJA 4FKMA 2WSIA 4IEVA 5LZ7A 4YRCA 3ZFGC 3LSDA 1TKBA 1V7ZA 1T15A 1G9CA 1D4AA 4MR7A 1UY2A 3U4SA 4UDOA 3NYQA 3GHHA 3WAGA 4KRFA 1URPA 1KNQA 3NXSA 2WKRA 4IJMA 1L7BA 4HT1T 4RLFA 2H1RA 1ZUWA 3JU3A 2FSVC 3WKCA 1V16B 4JI7B 3HT2A 4WOCA 4XGRA 3R7WB 3R7WA 1A76A 2GN7A 4U9UA 3E3OA 3QXGA 4EZBA 1IPJA 3U13A 4P9WA 2AR9A 4DCVA 2C4WA 3A1WA 3DZDA 1UFQA 1UBKS 3NV1A 1S55A 5FT9A 3I28A 1VYUA 1HTWA 1DE0A 1X8MA 3A9CA 2BCGY 4ON9A 3BWCA 4C2AA 4CEIA 4KR2A 1C8BA 1Z62A 1MXFA 2G5TA 4ZO4A 3R7BA 2Q9CA 3IA7A 4EABA 4ASKA 2R86A 3LD8A 2WW8A 5FR1A 4AYWA 1X3LA 2D1SA 5LJIA 5IYZB 1W4ZA 1P39A 1M0EA 1B43A 4QXCA 3W8NA 4A0GA 1CLEA 1V0JA 3NTLA 1M5RA 7MHTA 3BB4A 4OGWA 2HBZA 3EUEA 2P9GA 3MGKA 4BWYA 1G5PA 5JOQA 1C0LA 1FV2A 3HBJA 3HPNA 1X15A 4MQEA 5A7HA 1U0EA 4WXEA 4BZ4A 4CYDA 3CJXA 4RSUA 3AVRA 1X8JA 2WLSA 3H8UA 3WBKA 1GNRA 1A27A 1KL7A 1P45A 4MQFB 1NG1A 2AX3A 2G71A 4WVMA 1HZZA 3OTOB 1MZFA 2ERFA 2CKMA 4FOPA 3U0BA 1CEQA 3D9QX 3PHBE 2VJCA 3QBJA 2VZRA 4N0DA 3M81A 3WY6A 1ZITA 4GW3A 4ZMSA 3CLRD 3WW1A 3SNKA 1RVDA 3ANXA 2IELA 3WGKA 4D02A 1MVLA 1QP4A 3E4CA 5K3BA 4YSFA 1EX1A 2M6KA 5FULA 5IJAA 1PEAA 4LJLA 5E8RA 4CXWA 3RVRA 1Q0RA 3PC2A 2V6MA 1TTPB 3ZN2A 1POV1 1C2YA 3NX4A 3UMYA 3VDRA 5C4WC 5ALDA 1RUH3 5A3OA 4HQ0A 4IQ8A 1LCLA 2HMYB 4DQXA 4DB4A 4C8DA 5GZEA 4KAJA 1R5BA 3KT3A 5FA5A 3KYDB 2VDOB 3MJEA 3OBRA 5FWNA 4DXAA 1TMYA 1HUQA 1QQ5A 1QKQA 4UM7A 5LU9A 3X1ZA 2WJVA 2Q41A 4I8DA 5GONB 2TUNA 4CEJA 2GALA 2YUTA 3QEKA 3LP5A 4FPFA 1Z2OX 1Z2EA 5TQ2B 5CT6A 1YR8A 3EY9A 2L2QA 1JJBA 4IOKA 4NPLA 1X9TA 1CFJA 2FP4B 2FP4A 1K63A 2XIQA 3W59A 4DSTA 1ZH2A 4RF5A 3AW9A 3RHTA 2JLVA 1LLUA 3E3NA 1Z6AA 3IMKA 3RKRA 3V34A 3FMOB 3ZEAA 2OFPA 4AHWA 3B1WA 3FYHA 4R1MA 2VWQA 4Y2XA 5KINB 5E16A 3ZE7A 4UU8A 4NAHA 1KY3A 2XCOA 1JG7A 2R5FA 1OLXB 4JJAA 4JGZA 1Q1QA 1SVMA 3H65A 3QYFA 2ZTSA 1TZJA 3VBOB 5GZCA 4CKXA 1E3QA 2ZRAA 3D3QA 3I2JA 1U98A 5IU6A 4MROA 1RUOA 2VCYA 4NBTA 3W8RA 2ZW9A 3TZKA 5FUMA 2Z6AA 4YFYA 4K9LA 3U4HA 1H6AA 3GWZA 4RGAA 3AZVA 3IAS1 3VSBA 1A5AB 1NBWB 3TW6A 4C4YA 3HR7A 2J9RA 5F5CA 1ZICA 2C0CA 3U14A 5JWRA 2J6IA 5F98A 1Y42X 1V5EA 2FK7A 3BWEA 2EXJA 1KXZA 2P6OA 3QLVA 4IM7A 3W1VA 2X77A 1BU8A 3AL3A 1UKVY 2PD3A 3GDBA 3O14A 3ZDQA 2DT8A 3HI6A 5C4WB 1JEQB 4LQRA 2E0IA 1G5QA 3HA3A 4I6JA 1ZX5A 1H8HA 4LK3A 3VI4B 3E1SA 3UMGA 1P31A 1EYZA 1YCGA 5K8TA 1KEUA 4WNAA 3EHEA 5FR2A 5IVHA 1M2VA 2CE2X 4Q1CA 2R6CA 3QU9A 1T4BA 3PDQA 3URFA 4WTOA 5A0TA 1PK6B 5JLJA 4Y26A 5FA6A 1W85B 3LOUA 4M0DA 1KYIA 1K5GA 5KHOC 2KBEA 3MUOA 5FUWA 1P74A 3I2GA 2XBO3 3NNGA 4MMZB 5FEMA 1SLCA 1FFYA 2VSFA 2I54A 4OHMA 3HG7A 721PA 1QR2A 5DN9A 3L49A 4FS8A 3H84A 4OH7A 3PR1A 1SVWA 2ONJA 1Z5GA 3AQ4A 3QD6A 1BFDA 5A03A 3BWYA 4UBHA 4BRWA 2QQKA 4KYVA 2C2BA 4KQFA 4KE6A 1EFVB 3T0AA 3GRPA 3QOYA 1EFVA 3WIEA 4YCJA 5HFNA 2EQAA 3ROFA 2B0CA 2DR0A 3F4LA 3VC1A 5ALVA 5EHIA 1R6AA 3P2EA 2XDYA 3VBUC 3EG5A 1QJX3 4LCJA 1J5XA 3UTDA 1R0YA 4PYIA 1X7XB 5E8AA 3A3NA 3O0VA 2H63A 3P6BA 3D6MA 3R40A 3KAKA 1ML3A 2QQFA 2QU8A 3K32A 2GFIA 2DJIA 2QE6A 2NTJA 4IQ0A 3ZVXA 3K0AB 4F9FA 2OT7A 3NV4A 2JXAA 5J09A 1BMDA 1LEDA 3CHYA 3OIVA 3N7LA 3MFCA 2IOFK 2XGMA 4TKVB 4CGZA 2IEAA 1EP3B 1T0BA 3B8EA 2ODAA 4BWOA 4V1CI 2RBEA 1E96A 2N0SA 1ZC4A 3UMRA 3TQCA 4ALKA 3ETJA 2YXEA 3A3KA 4ZU1X 1UT5A 1Z5NA 3QKWA 4KN9S 1CF9A 4XI9A 3DF0A 1G42A 3ECSA 2BSXA 2A6PA 4ZALA 3FYDA 4KQGA 1DV2A 3K1AA 4QXOA 1YE5A 2O3UA 4URTA 2QGZA 2ZSAA 1XLUA 3CEMA 2NT3A 3G2QA 5HCAA 1ZJWA 2O8CB 5FO7B 4ZHQA 1H94A 1QOPB 5TMPA 4N43A 5J5CA 1H1LA 2VTXA 4IH4A 2OXCA 1T1RA 3TTTA 1EWKA 1WZIA 2ERXA 4F7DA 3WIDA 4KQEA 1LNZA 4D0LB 4U7FA 1RQNA 4FN4A 1J8QA 1U5CA 2G25A 3GPLA 4CRQA 1WX1A 2YS6A 1J84A 4FGUA 2ZCVA 5JI3E 4EVIA 5ITWA 2EIBA 1YHFA 2NZ9A 2W87A 3H4MA 1LGYA 1PQUA 8LDHA 3AP4A 4XCXA 5CAEB 5K3AA 5DRYA 4Y6GB 1T1EA 2C95A 3LDFA 1QVRA 3VU1A 4NRQA 2DQZA 2P5BA 4PAOA 5CZKA 1SB8A 2FPPA 3BH6A 4I0BA 1A34A 3I3DA 4WNCA 1KMQA 2I4TA 2HU5A 4RMNA 1K5DA 4QGGA 1CJCA 4PHCA 2I1WA 4LMBA 3NAPB 3VU3A 1R50A 2FZ5A 1FDRA 2ZIXB 2VBGA 2BP6A 2C8JA 1D4M1 2ES3A 2VF4X 1JYWA 1U65A 5D1HA 1PEDA 1TFRA 3ZQKA 1NM5C 1J1UA 4CM8B 4FOSA 3VPSA 2GVZC 1D2CA 4J7XA 4I99A 4LRQA 3CUSA 4PFSA 3I73A 2I6FA 5I8TA 4TZ0A 4EM6A 1GU3A 3DMGA 1OPXA 3LQYA 3CNNA 4YJ3B 1ZEJA 1HWYA 2NYRA 2IC5A 5TQJA 3MJFA 3PLRA 2I07B 1IN5A 4EA7A 4JUAA 4PX9A 1X7WA 2DG2A 3FF4A 5B37A 5I7RA 4R4ZA 2ZVQX 4MV6A 1U63A 3WK9A 4B87A 5SZKB 1K42A 1R8SA 1KI1A 4NBRA 3IBMA 4Q1RA 4PLYA 1ATZA 1UY1A 1ETUA 1NZIA 4TZDA 1I0LA 1KZYC 3TZQA 5TJ9A 4D5EA 3ED5A 3GL9A 1H8TC 3V4SA 4WAUA 1DCSA 2ZR8A 4DGQA 4KWUA 5EEGA 4YG6A 4RVDA 3UHFA 4HVAA 1AZSC 1U02A 2WIGA 4EDHA 2E53A 1H4VB 3FN4A 5F3EA 2VT7A 3SXWA 3VZRA 4PCVA 4L6CA 2O2EA 1P6XA 3K72B 3JAWB 2GJSA 1AH2A 1B2LA 2WTAA 2FDHA 2QW0X 4DFSA 4GL2A 3CZMA 5HRUA 3FVRA 4TL6A 5F5XA 3O2QB 3W2FA 1RI2A 5ICSA 4G1EB 4GB32 3ORQA 1KO8A 4Q4AB 3K8QA 2VZVA 1TMF1 3BREA 3OM0A 4NNJA 2OP1A 4OJKA 3OUJA 2FCVA 3JYHA 4FFHA 4PYRA 3MMNA 1LGBA 1XE7A 4OLFA 3BCUA 1HE5A 4ARZA 4HDMA 3QCWA 3NMBA 5CIWA 3GX1A 1W3VA 3CX6A 2WUGA 4LC1A 3AUFA 5DHTA 2OILA 4B9AA 3WLJA 1O57A 1ZKMA 3UV9A 2VS1A 3DBRA 3FOZA 5AFSA 1KQPA 3HJBA 5KX5F 3D2BA 2VYQA 4LKOA 2HMSA 1SJ9A 4X6UA 4D7YA 1ZWKA 1QOTA 1VA4A 3ESDA 2I3AA 4AG3A 4CLRA 4X5OA 4QTZA 2XRFA 1FOEB 1RRVA 4GVLA 4C5BA 2IXGA 1J00A 1PQPA 4DMHA 2O5VA 2DSNA 2R9VA 4KITB 2JZOA 3D8HA 2IXJA 3UWKA 3ZXSA 1UZYA 4ERNA 4BMBA 4MQBA 5I0DA 2GDFA 1Z56C 2JFPA 3AY7A 2I2WA 1EAH2 2MEV1 1UANA 5K05A 4YP6A 2ESRA 3K20A 3DOUA 1JHAA 1HDGO 4BO1A 1D5CA 4JFAA 3SJUA 3RB8A 4NE7A 4LYEA 4INOA 3K1YA 4DJ5X 4F5ZA 5JDCC 4AAXA 4O3FA 5TT1A 1Z6XA 3CBNA 3UKJA 1M72A 1UOJA 1U0FA 3Q7RA 2RS13 3BE8A 1QZ3A 1S2DA 1PL6A 4QX2A 3L7KA 5AUPB 1JEQA 4EAAA 3T3PB 3KJIA 1VLVA 1KO4A 1M83A 3A25A 2QNBA 2KBFA 3P20A 2IA5A 1QC5B 5E89A 1IPKA 2QWXA 2ZYDA 4JJ4A 3LW7A 5A4FS 1Y1LA 4EI7A 1M2VB 2XUGA 3MQ2A 3NG1A 4YGYA 3RCBA 2DQSA 5DHSA 5J96B 1S8AA 4JQZA 1PUXA 3OUZA 3UYLA 1GG2A 3Q3JB 4TWZA 3PPXA 4IRXA 2RDSA 3G5AA 3DKQA 3WVNA 2ZBRA 1UYYA 1ZVVA 5LMCA 2EW2A 2ZIFA 3A31A 4KVZA 4LNUA 5A9SB 1UMKA 1DMSA 1PCXA 2CDPA 1JLRA 5BORA 4ES9A 3NHKA 5CB6A 1OZAA 3UJ3X 2GEUA 1W19A 3RYKA 3CGWA 4XVRA 1YMQA 2VK1A 4NDAA 4QQKA 2ZCUA 4W1SA 1PHMA 2CCJA 5CW2A 4N48A 2C03A 3ZWVA 4BNKA 4WZFA 3MYXA 4BXOA 2VPQA 4DC9A 1DX6A 5D5HA 3NFYA 5FBKA 2VH2A 3KMHA 5G41A 3O1VA 4MH0R 2KWIA 2QQ5A 2DFBA 2IODA 1QX4A 4I0WB 4PF1A 1VAKA 1TADA 1FYDA 4UEJA 2OXRA 2I2BA 3BGDA 4HTFA 4RNCA 3U1BA 3AJRA 4UTVA 3KJNA 1LRHA 4CMHA 5DSTA 3H3UA 2HBUA 1XNQB 2LM3A 1ZFNA 3SK0A 1E0JA 5D7BA 2FDRA 2HFJA 1VBKA 4QPDA 2V3WA 1LPOA 4U5QA 5CCXA 2LKDA 2PUTA 3U39A 3WLLA 3WW2A 3JYLA 1CY2A 3ZDAA 4FUTA 4TGLA 2CNBA 4ARYA 3S2FA 2D3WA 4L51A 5CK4A 4N6NA 3HN3A 2RIPA 1QBGA 2C58A 5B6IA 5A6SA 1ZW6A 1UXHA 4DLSA 1TOAA 4AQSA 3AF5A 1XRUA 4JWKA 2IPOA 4DJAA 2DQYA 4N3GA 2C29D 1ZA7A 2GPJA 2H65A 4WN3A 2R1ZA 1V4VA 5AHXA 2X4GA 1FOD3 1VJGA 2GERA 5A7SA 1RUD2 2GN1A 2YIVX 2ZR0A 3WLAA 2ADEA 3UUWA 4AQ6A 4D9IA 3CZPA 1O6FA 1TQ2A 1CZOA 2FZLA 4W5JA 3WTBA 1YR2A 2OHVA 3H13A 2GWRA 4B4UA 1A9YA 4RH1A 5JE8A 1D9XA 1NZCA 4FFDA 2YWXA 3REQA 2Y1CA 1H5UA 1EAMA 3GAAA 3QE4A 2JGAA 4U9HS 1IH8A 1KDKA 2ZB3A 1DTSA 1HQKA 2JDIA 5F1YA 3NDPA 3L1JA 3N9LA 4ZT7A 4LBOA 2ODPA 3MJTA 2D5IA 2FI1A 1Z0ZA 1Y1TA 1LFDB 3HS3A 4P86A 1CV2A 3KQVA 3ZR6A 3KOUA 3WQ7A 2O8DA 1V47A 1W6RA 4QARA 4K1XA 5FRAA 3NOOA 2H92A 2WIBA 4C90A 4OUEA 1NSTA 2PFGA 3H3FA 5JDIC 3ZZNA 2WQZC 3M1LA 5FYVA 4QDKA 3LIIA 4KYIB 4N7JA 3FFTA 1SQGA 4FFIA 1VI6A 1QMJA 2FJ0A 3UIEA 1N3OA 4KQ6A 3K0FA 2JECA 3B3AA 2E37A 4MDFA 4QFCA 1B1AA 1W2GA 4YYOA 5F76A 4UQOA 4HQNA 3IAXA 2FE4A 1KMMA 2QYSA 1SBZA 1MV5A 3CSUA 4J0CA 3D8NA 1RBYA 2XJVA 1Z35A 3GD7A 4RCZA 1AKQA 5BVHB 4NJMB 4Q21A 3Q10A 1Y0BA 4B0OA 4B1FA 1ES9A 3GFTA 3RBZA 2BFEA 1II8B 5JEDA 1IHMA 2RHPA 2PTGA 2BGTA 2LPMA 2D2EA 4LZPA 2A5YB 4M0FA 3DVAB 1EPZA 4CUAA 1ZJ5A 2HF8A 4XQ0A 4BN0A 2FQ1A 3DBIA 4I46A 2BEJA 4G26A 4AQYB 1C30A 5EJ5A 2GA8A 4GLFA 3NDBB 4EG5A 1GNYA 2EVXA 3H8XA 1H2EA 4QX5A 2JIDA 5EJ6A 3RASA 3EGXA 4DQUA 3L0BA 4X1IA 2XNJA 2V4AA 5KZMB 3BFVA 4MCAA 3MWDA 3GCDA 2J1EA 2WFF2 2XVYA 4CTOA 3ESQA 1ZMBA 4M6WA 4UBKA 3JTEA 3MPBA 4X3CA 2WNHA 1HT1E 4C9BA 4JGYA 3FMVA 1Y8RB 5TT0A 2YGMA 4CCAA 1TD9A 2N42A 5IAOA 4BIOA 4CLXA 2QL6A 5LRRA 2R8RA 5IVYA 4BWFB 5HDBB 3STTA 3LVRE 3F3YA 4LRUA 4X93A 4JRAA 3DCYA 1XZAA 5ICGA 3V7WA 3A37A 4KSYA 2RGWA 1Y6ZA 3ZY6A 1IAQA 5ALMA 4JNCA 3THPA 1QXPA 1TU0A 1KR2A 4B8ZA 1MHPA 4AZ3B 4AZ3A 5COBA 4GPBA 5SY4A 1GQRA 3TVDA 4NEGA 1F6DA 1P2FA 4YM0A 2G76A 3EN0A 2QP4A 3L4JA 5DHQA 3LUCA 2PMDA 3FAKA 2BR5A 3EZLA 1L7AA 2DFNA 5JAIA 5F33A 4ALIA 3D43A 4Y6LA 2O8FA 4EN8B 4Y2RA 3ORSA 5B1SA 3P32A 2G1KA 5A1TA 4PWZA 5ERYA 4HEJA 4PO8A 2ZBVA 4KVAA 4CCDA 4V3CA 4J6EA 3FNHA 4JBNA 1JPUA 3AJYA 2D3SA 5FADA 4J76A 4TXLA 3Q9OA 1MOSA 5JMCA 3EHKA 2IIQA 3JQ9A 1RJWA 2BBWA 4JP1A 4CDNA 2ZBPA 4R2WA 5HJ2A 3ZHRA 5FXWA 2ZYAA 4TN1A 1ONBA 5HXAA 2QB5A 1D8TA 1UFOA 4DW8A 3IUBA 2GDJA 5TF4A 1FLAA 3HY6A 4ITCA 4AKSA 1KFBB 2G72A 2ZIAA 4YVSA 4YVSB 4ZPIA 1RPTA 4EUSA 1XBTA 3FX3A 2BFUS 5CURA 5E1DA 4CEYA 3HKDA 2HWB1 1S0UA 2HWD2 1NYTA 1EVLA 3QVWA 1COZA 1D6MA 3VNVA 1BCRB 5JADA 4B71A 1AXYA 4JU8A 2YHAA 2D97A 4HKTA 3RC2A 3CRVA 4UFJA 2K2SA 2QPTA 1A71A 1U2RA 4KO4S 3FVQA 2P9JA 1ZINA 4D44A 3OJFA 4DREA 1XE8A 9ATCA 2HIAA 1YBHA 4LOAA 2Z2SB 4LHYA 4O4JB 2QRVA 3KZVA 4DDHA 1N4AA 1W0CA 4CQLA 2VNSA 3AKDA 2ZRGA 1CX4A 1NPYA 1VBE3 2GLUA 4Y9UA 1CEXA 1KAHA 4CJXA 4BLIA 4CDXB 4CDXA 2PGNA 2Q2WA 3MTDA 5BWCA 4IJVA 4UNPA 5J2UF 2YC0A 1M54A 1CT9A 2R4TA 1CRQA 3GN2A 5FOJB 3GLGE 2WS92 3W2GA 3TM5A 3WTCA 2CFOA 2CDNA 3TIFA 2VATA 3OOHA 4AUKA 2FVXA 5YASA 1XLTC 4KSCA 2WZR3 4QU0A 1L7LA 1LULA 1NZFA 2AR7A 3MHZA 4G0YA 4MGIR 3C7HA 4D94A 2KB0A 1XNBA 5AKZA 3GB9A 1RUJ1 4RTNA 2VNHA 3MWEB 4E4ZA 3HP4A 3KWFA 3TAHA 1KYWA 1P4GA 5LQUA 4FZ5A 4DUVA 4HV4A 5DNUA 3V65A 1MEJA 4XILA 1DDOA 3BXHA 3SHFA 3F5QA 5C8YA 3RAFC 3TLJA 2HBRA 1S6YA 4BNHA 3SEPA 4KWLA 5DW0A 2V09A 2M9MA 3ORHA 4DNQA 1SZCA 4JXXA 2XQRA 3GELA 3NO8A 1ZM2A 3V4OA 1PT6A 4ABTA 4QD2A 5D51S 4MTCA 1JA9A 5KQRA 1L3CA 1TYBE 2RH5A 2RVAA 2DBVO 3E2MA 2V8BA 1DWPA 1OFTA 1XI2A 2NNLD 1ZSVA 2O14A 3LPDA 4C7XA 4Q6BA 5F37A 1GA1A 4GMP1 3E0XA 3ZC3A 1SC6A 4A1OA 2WIDA 3BTOA 1U31A 1G0OA 1WVIA 1NXD1 1B0ZA 1D1PA 1RVF3 3PSAA 4H7JA 3KVBA 3PYLA 1FDVA 4EPVA 1RXUA 2ECQA 4EG8A 2N1BA 2QI9C 3IM0A 2OZLB 1GTRA 4MEJA 3O92A 4YUXA 3N39C 2EAKA 1QDOA 1PLKA 5JSZB 3NJZA 2R00C 1SCNE 2VP4A 5EVJA 1WEHA 1TUIA 2VW0A 3JVUA 1YFXA 2AX4A 4O4JF 2A1IA 5BXXA 4AMGA 4TV8F 3ZPOA 3O6VA 4H7EA 1ZBA2 2VD7A 4GKBA 4WW0A 4PAGA 1L5GB 4EENA 1TLFA 1L4FA 2HAEA 1YQ2A 1NCRB 1V48A 5F4ZA 2WQ6A 2I4OA 1RUD1 3MPUA 4Q29A 1XU1A 1LBTA 1OTHA 2IYZA 1ZIYA 2VYCA 3HGQA 4KV9A 1E99A 3V46A 5AI5A 2A6XA 2XCRB 2WT9A 2OCYC 4KX5A 5BMVF 1E64A 1DQSA 1OLRA 4OXRA 2IX3A 4H0FA 5EXSA 4D6PA 2LROA 5T5LA 2OWDA 2YV2A 3OO1A 1QONA 3PX3A 1X1EA 4LFCB 3ZJTA 4XRRA 1FMD2 2E33A 5ILOA 1SKYE 1RQPA 4QJIA 1PFKA 2OBBA 1XEAA 4TUYB 4YM2A 4KO3S 4MUNA 4RH3A 4BASA 4MV9A 4XR9A 2W48A 3EXIB 3CEJA 4RORA 1JQLB 3E7FA 3POEA 1K8XB 3TBDA 3U9SA 5L7YA 2QKDA 3LJKA 2J09A 4CVUA 3P0JA 4QAJA 1O2DA 1PMHX 1DKMA 1II0A 3WDUA 4LKEA 3UJAA 3THTA 2PO7A 4X65B 1CONA 1WXDA 1M1YE 1VP3A 5KYXA 3AVWA 2W7TA 3GMTA 1FFHA 1E2LA 2CXOA 4XAAA 2JJYA 2O9JA 3ZYRA 2Y6GA 5KS2A 1OXMA 1M5TA 2N75A 1TYEB 3HKBA 3IKJA 1Q7GA 4IV5A 2OV4A 5AK4A 3FSGD 3E58A 5K0TA 4UI9L 4NIMA 3KOOA 3LPMA 2YMPA 3T4EA 1W5SA 3A9UA 4ZV9A 1CPMA 1Z5WA 3EEBA 1XXNA 3KT1A 1RYNA 2ZWMA 1L4LA 4XFKA 4JP5A 1N92A 1CUYA 3LDGA 4D9BA 4EH1A 2NO7A 1NBIA 2BFFA 4PPQA 5IHXA 2EW8A 1QIDA 3RH0A 1RZRD 3LBYA 4S1NA 3QPDA 3PI6A 3SEZA 4GS5A 3MCAA 1GUDA 1VJDA 3TLGB 1GJRA 3D1VA 4TXJA 2GCGA 4TLDA 4WM8A 2O8VA 5CD1A 1I1HA 4J16C 1HXHA 4R4XA 4KIGA 3ELWA 2YL2A 2WNUB 1NVTA 1JDUA 2WYUA 4WH0A 1JN2P 3UGTA 2FR8A 5CVDA 5C8DA 1L4MA 4KR3A 3BL8A 1KEWA 4ND5A 3L2OB 2P90A 3EGIA 3POIA 3RABA 2ZI6A 4DXDA 3RI8A 4ETWA 1O9BA 3IELA 4OMDA 2E21A 3AUUA 2VPPA 4WASA 3I04M 2IP1A 2NP7A 2H1VA 1C0IA 4XYXA 1UU5A 1IZZA 2DPYA 4W99A 3SH5A 5L7OC 1W73A 1XXHE 1CJSA 2Z2JA 2OCPA 3DEKA 3TE7A 2Y77A 4TYWA 2ACKA 4HDOB 1YGYA 5T6MA 2A92A 1CR7A 4D3YA 1TK9A 4QMAA 1IB6A 1Y3IA 4E2SA 4YHBA 3MC1A 4FHEA 5FX2A 1JPJA 5A3WA 2H2HA 1EV11 1XZBA 5FZ8A 1OOPB 2ZSUA 3WDVA 5KR7A 1NW3A 3C8ZA 5ARBA 1MEC1 1P9RA 4UWDA 5JBQA 4KIWA 3NV2A 2ZXFA 2JH3A 3NTVA 1QJU3 5J98B 2X15A 4TT3A 4KPFC 3EXG1 1U5BA 4AF6A 3AESA 5A7PA 4MLCA 3EXHA 4E03A 3B1ZA 1CY6A 4HHEA 3VD4A 2GMEA 4IH9A 1X38A 2W52A 1I2CA 3VPHA 2CJWA 5IFKA 4H1UA 2E82A 3FWZA 4TM7A 1QNFA 1KZ9A 3QVGA 1XC6A 4A73A 3A1FA 3IOYA 2JVJA 1O0BA 3S7IA 1UXKA 3JWHA 1ZCBA 4YS6A 1U2ZA 2B5HA 3LGAA 4L6IA 3CJTA 3WHUA 4GGMX 4HX9A 5C35A 2YCBA 3TNLA 1DHTA 5A71A 5K3FA 3C45A 3IJPA 1R15A 5DW3A 5C1BA 1KJQA 2OCGA 1YL7A 3PA8A 1ASJ3 2BL4A 3F3SA 3GVPA 2NQYA 1V1MB 3EWSA 4XUGB 2J3IA 3R3JA 2Q0XA 2O0MA 4G9EA 2C5HA 4EOGA 4UTRA 5CFQA 1E7SA 3B7WA 5AJZA 2VTXJ 1AURA 3W20A 5JO9A 1VL0A 2JGEA 4K8RB 4R1UA 4RMIA 1FPN2 1C4RA 2NPOA 1SDWA 4XX0A 1UBSB 1CX1A 1T25A 1TX4B 5JQGF 4FQ4A 3OZVA 1T29A 5JASA 2CVOA 3IJEB 4RZ2A 4P35A 2G1PA 4IETA 1IUNA 2TEPA 5J63A 3EVAA 5DZSA 1F5JA 1FS6A 4NCKA 5EMKA 1OU4A 3VBFC 3E9MA 1X7HA 4MPPA 2B21A 1ZAYA 5G0TA 1VCIA 2LUWA 3EIFA 2R79A 2WJYA 4HLTA 3I5YA 3UAZA 5AT1A 3HTXA 4BNYA 4MDHA 1EUDB 2EWWA 5A5EA 4DLBA 3VHXA 4LBQA 3TR6A 3EF0A 3GPIA 4QEZA 2PUDA 2B36A 3AMVA 3KYJB 1L5HB 2RJOA 4TXNA 3JD72 2PCJA 3O0XA 1JKFA 1CUEA 5ALPA 2VSQA 1WMSA 1LHNA 1V5WA 4IIHA 4ZARA 1B3BA 1JZ7A 3U48A 3ZDRA 2DJ5A 5L3QB 1V6KA 2BSQA 4QGSA 1AUQA 2ISQA 2IE0A 3Q98A 4X6RB 2LNDA 3FVTA 3G82C 3J9SA 4P4GA 4DQLA 4BFSA 5IYZA 5KYUA 4KRGA 3BJIC 1AUVA 5JS2A 3RI9A 4PG5A 5JCPA 3PUQA 4RLHA 2WFZA 4OHPA 4MHOA 2CXXA 3IAM6 1NT0A 4A1FA 3B1JA 4QHBA 4CPBA 3IO5A 1JALA 3ZS9A 4IZHA 3H8RA 2Z30A 3SDZA 3BTUA 4TT3D 1H4QA 4PLOA 4HQFA 4I1PA 5FUBA 1YB2A 1U7OA 3MO4A 1E1MA 3I6ZA 4RABA 4UBMA 5IWFA 3IE2A 3AX6A 2BSAA 2WT4A 1A77A 1ISJA 4GP9A 3N70A 3KE8A 3REGA 4EWLA 2FPOA 2Y34A 1SD5A 2ZDQA 1I9CA 3T30A 4HNRA 3WWDA 4JP2A 3ST7A 4OQ9A 1XTPA 1FQWA 5F3WB 1JYFA 1SPPB 1HW5A 3GCWA 3OFSA 1IS5A 2IYUA 2QD1A 1ZXLA 4QXHA 3VNQA 3HBAA 2WS91 5IK2A 2UZ3A 4FX2A 4DV3B 5F5NA 2BGPA 1YI0A 3UOGA 2BP7B 3ONVA 2QMOA 3OJWA 5EZYF 2D7DA 1Q16A 2YROA 3BCWA 1L5MA 4UPVA 1PO23 1LBEA 1UPXA 1WR8A 3EGCA 2I66A 1JB1A 1OB5A 3M7IA 5DLPA 2WQ8A 2PWBA 1NBAA 4A2QA 4Z1OA 2BGOA 1VJ2A 1VSBA 5CB4A 4HF7A 1DFHA 2GJ8A 4RETA 1KHTA 4PIZA 1BK1A 1FX1A 1CAWA 1L7EA 5JHHB 1JT9A 1OKKD 3GJAA 1MP0A 2A35A 8GPBA 4NCBA 3J7NA 6PFKA 2Y6HA 5ADWA 4E5VA 4URZR 5C3OA 1ZM7A 2C9ZA 3A4IA 2H00A 4M1OA 2ZK7A 3M3PA 4LO8A 2L17A 3THWB 4GULA 3NRBA 5HK8A 3C5VA 4BNNA 4R9NA 1A95A 1U0LA 1K45A 1ZR2A 4OHYA 5C5UA 4LORA 2QDKA 2VZ1A 1KWKA 3GRCA 3K6KA 1NGSA 2HCTA 4JBLA 2WSVA 4NCHA 4ETMA 5A7QA 4CKEA 5K6AC 1IOLA 2PQ6A 1TM1E 1Z82A 3TF5A 2HA0A 3MIBA 1UBLS 5LXTB 1JWAB 1TUBB 1O97C 1RUI2 4QB6A 1Z2DA 4YP1A 4CDWB 1V35A 4F1WA 2IU0A 2PXXA 1MFPA 1GPKA 4XUCA 1RM0A 4XUEA 4KG0A 4BGDA 3SICE 4D56A 1L1FA 2OLJA 3T6KA 2D6LX 5ALXA 4HUQB 1MDBA 4IV3C 4PS1A 4ZYYA 2V7XA 1YZUA 3RYRA 2GXSA 3DGTA 2ZS7A 4K7JA 3TOCA 4FYHA 4Q9JA 4CNQA 2JVKA 1EESA 2BFCA 4OMFG 2YOHA 3AJ9A 3HB9A 5BQXA 1T0UA 3L6BA 3VOTA 1QYIA 1RHJA 4M7OA 4QUBA 2IEIA 1VQ1A 2KPOA 4BYGA 2BFDB 1BQ4A 4IDGA 3IBTA 4X41A 3NHZA 4D5GA 5JH7A 3UJCA 1GWMA 5JH7B 3U44A 3G8DA 4PFKA 3PLAE 3QMVA 3IS3A 4Z92B 5CFDA 5CFDB 3F7OA 3UT5A 2P11A 3R76A 1LPPA 2NUAB 3TOZA 3ZDXB 3SM9A 5IJXA 3NHWA 2Y9MB 4DBZA 5EC8A 3LI2A 8ATCA 4BBJA 5HKAA 1FP1D 1KC3A 1E5SA 3OYWB 1I1OA 3WE7A 4URVR 4NAUA 5L9AA 3O90A 1AR93 1XZEA 1A9XA 3TL3A 2ZEYA 1F20A 1QYDA 4FCVA 2HYXA 2WP8J 5JPMB 2WUVA 4BE7B 5TNXA 5HVNA 4JASB 2W94A 3PZRA 4JYBA 1U0GA 3LHFA 5IAVA 3PFNA 2V5AA 5D5PA 4YRSA 4EY3A 4RELA 5CVJA 5BP7A 1OBOA 3JVEA 1Q7TA 2YQZA 1QCYA 2ZFUA 3QEMB 1NKTA 4KLZA 1RAIA 1J20A 4RZSA 3DWIA 2ZUWA 3ZWKA 5LA6A 3E9DA 5LP6B 1OFHA 1HT2E 4C2BA 4D41A 3VZJA 1NNUA 1F8YA 4XYEA 4Z2WA 1UX7A 1EVZA 3OLVA 1OLQA 3BRQA 1K06A 4GOKA 1T6NA 4JOBA 3T1OA 2DVBA 4QYIA 1WULS 1LQUA 3ER6A 3SP1A 4XZ3A 2OGWA 3K0AA 1X2BA 1GA4A 1XYYA 1VALA 1VMDA 2V9ZA 4YJFB 2QJTA 3CA8A 1TAQA 2J08A 3FM9A 3WZ1A 1S3IA 5J58A 2MHCA 1GSHA 5AW2A 3GBPA 3ZSKA 4K28A 4Q4AA 2X53S 3NI2A 1T2UA 2G9GA 4QT0A 1U90A 3PJQA 5HM6A 1ND3A 1VE0A 5BVGA 3LA2A 3R2JA 4HK8A 4JYPA 4P9LA 3OPYA 1C7EA 3B13B 2GCOA 4YAFA 1YTUA 3ENQA 1YZKA 4S3MA 3RDIA 3WS7A 5C52B 1QGOA 1SM4A 2I71A 4OHUA 1QHEA 3VO9A 3ZY5A 4FQ7A 1YUNA 4Y1UA 4WNYA 2EL7A 3GJXC 3ID6C 1G1MA 3K15A 2MR6A 1AF4A 4R9AA 3C3KA 2VUJA 2MINB 3QXJA 4TZKA 3I9FA 1XFDA 2H2IA 4Q0VA 1QTRA 5DN6D 2O3JA 4GIBA 2I99A 1LW6E 3WOGA 3HVUA 3FOEC 4QHSA 1NA1A 2P17A 2ZABA 1XAJA 2J5BA 3F7NA 4YMGA 1J8VA 5FPZA 5C37A 2R1TA 3V00A 1HDCA 5AJTA 3KWLA 5AI9A 2ZGTA 4OQXA 5FMOL 1VPWA 2R751 3FYTA 3ZGYA 1PVOA 3OEAA 2J0VA 2FG6C 1JHXA 3HL4A 4H77A 1XP8A 4AX4A 4DLXA 2PWPA 4OSOA 4RZXA 5J1TB 1G5FA 2Q8NA 5FBVB 1IZ7A 4TQUS 1J9ZA 4UASA 4D4KA 2FPUA 4MITA 2VAPA 3DBLB 4RTOA 2BE7A 3RUEA 4M0CA 4A7KA 2CV6A 2JVIA 3TNPB 2FDFA 2ZLBA 3M83A 4UC0A 1KYVA 2K2QB 3IUJA 2V7EA 3EZ9A 1NWHA 2JEZA 2BCJQ 5CNMA 4TVKA 2JJ2D 1QG6A 3CWQA 3NVMB 5HZKA 1OBVA 2B82A 4F8EA 1T9KA 1COWA 3ZWNA 3UKNA 3P8ZA 1R0BA 4Y22B 5B58C 4BO6A 2H1OA 2F6RA 4A03A 2AW3A 3GH1A 4ZAWA 3ZNNA 2GRUA 1SIBE 1EP2B 4OK3A 5AKLA 4DA4A 2RJNA 3W9AA 1JWBB 3WWZA 1DQ5A 5KEIA 1Y5NA 1K66A 3DM5A 3VJKA 4M1WA 5FYYA 1M6WA 1JIXA 1TYAE 3BMQB 2WP0A 1BBT2 3HNRA 1CAUB 1B8PA 4HXFB 2BHSA 4UHJA 1Z2NX 3HLTA 1BX3A 4KO2S 1J5PA 2FW8A 1VSUA 3M6VA 1BD4A 1XYPA 5IHRA 1ESMA 4ADSG 3PFIA 2OGTA 1IN1A 5E7QA 1WKYA 2ADDA 1R0ZA 4NOMA 2R4UA 2INGX 2GBFA 1H2AS 2CGPA 2ZS8A 4G09A 1TCVA 1LX7A 4ZC8A 1SFNA 3HYNA 4RKQA 3GZJA 2WJ6A 5KCMA 3TRIA 1DC8A 1OH3A 3IMGA 3GXUA 1VBFA 3WG9A 1Z83A 3DO5A 3VRHA 1LI5A 4HMPA 4N9WA 2R00A 3IT0A 4ARZB 4FOLA 5I7WA 5ULLA 5IC6A 2A3YA 4JBIA 3H8WA 5KTMA 4MLDA 2Q8DA 1JEJA 2FA9A 3F2IA 4GF5A 3JU9A 3VDXA 5L3ZA 4TMZA 2A4KA 2HRQA 4R98A 4ZOQI 5LNK1 3LUDA 4BFVA 4UNSA 4MUXA 5CFMA 1KJIA 4BBZA 2Y1KA 1J3RA 3FF1A 3NANA 4FMCB 3U26A 3U7GA 1UDCA 5K0SA 1LOGA 4TVBA 2HBYA 3SLKA 4NV1A 4IE0A 3DPRB 3RQIA 3V0AB 2DTYA 1JLKA 4WVLA 3T0DA 1HJGA 3K70C 4BZWA 4M8IA 4CDWA 3OLCX 1CU1A 5AW7A 3UJ7A 3RVBA 1GR1A 5EJFA 4JMLA 2MMCA 3TDKA 4XWKA 4O9EA 4HYTA 3UAXA 5EZYA 1P5ZB 1HE8B 4IIGA 5H4GA 2GNPA 1VXOA 4L74A 4MVJF 4XVHA 4A3XA 3KHTA 4ONEA 1KARA 1JQJC 3OD4A 5AJVB 2DHCA 4E4TA 1P5RA 2HMUA 5ANRB 4FDMA 2F4VB 1QDCA 1B09A 3ABOB 1XYVA 3K71B 4HGOA 3EO6A 5EYPA 4B6FA 4XVUA 1P19A 1G291 2Q21A 1RITA 2CLSA 5KJ1A 1G9SA 4W50A 2XLCA 3R9XB 3TTXA 2JFUA 2NYUA 3VZLA 4ZZ2A 1PJLA 5FJJA 1CIWA 9LDBA 3USZA 1DADA 1K75A 3GC6A 4IW3A 1O8PA 4IW3B 3FNFA 2VQUA 3A21A 3TG2A 3SMHA 1JPVA 2QVBA 1V96A 5A1AA 4EWEA 4X91A 3ROEA 2RV9A 2J5KA 3ZXUB 4Y5SA 4H9GA 1MX1A 4ZFNA 1QIKA 3VZOA 3IAAA 3TTWA 1KJ8A 2GAAA 2GBLA 2WRZA 2RGUA 3AHIA 2SBTA 5DIZA 3DCNA 4MULA 5A7GA 3OCWA 3BXFA 2QLNA 5AC92 3PFBA 4EGJA 4D0RA 3R7FA 3QHPA 4OQYA 1JAIA 3WRXC 4MVTA 3T1VA 1JVBA 2I4MA 2LXNA 2TMKA 2P91A 4A9AA 1MS1A 2XHKA 4J4BA 4L4UA 3P9KA 2CY0A 3THSA 3I9NA 5CLJA 1DKPA 1D2SA 3AVUA 2X0NA 4WXHA 4MXDA 1P4SA 2AQHA 2ZYVX 4OPMA 1S8NA 4IDDA 3KJEA 3FDZA 3ZQUA 3IIIA 5FCCA 2NSJA 1GZUA 4DJEC 5I8PA 4RD0A 5B7QA 4C6TA 1U1FA 3T7SA 3BOSA 2ID4A 5GLZA 1K88A 4ZOEA 2HBTA 2WK1A 2QL7A 5FQ0B 1M2JA 3F46A 2AW5A 4XKJA 1QJZA 3BTVA 1JXAA 4HLQB 1PL8A 4F7ZA 2CLEB 4R40A 2HDOA 3EF1A 1M6VB 3QVVA 1TQ8A 3IQDB 4DS0A 2WDZA 4DRXB 2OZKA 3KDPA 1E2DA 4ZO8A 3IOEA 4XUPA 4FPYA 3B89A 2PIDA 1FUEA 1XO1A 3UJOA 2XNSA 4XSGA 1ECPA 4FBMA 3D4BA 4MRSA 2D7FA 4AVBA 1IOZA 3UWPA 4NHXA 5BN5B 5H59A 1QAMA 3UAOA 1TVCA 3MXOA 2W2TA 3H11A 3FPCA 1FW8A 2NO1A 2CLHB 3OPMA 4O5AA 5BPXA 5BNPA 3A0RB 2V54A 5IK2D 1Q7CA 3CEWA 3QPCA 3LK7A 3QOWA 1NBEA 4C87A 4OKIA 4ZD6A 2DKOA 1X1RA 3GLHE 1OHFA 1KSGA 3GN1A 4EL5A 3VZKA 1MX5A 1MB0A 2EEPA 5HWSA 2E6KA 4A0HA 1WOYA 2JBHA 4LKRA 1T5LA 4IUGA 3GLRA 3A1NA 3DAGA 1C5KA 5JECA 2I78A 2HFKA 2CHQA 2WZDA 1C9NA 2AF3C 3TQHA 4XD7D 3LLUA 4RGVA 1HNNA 5K0ZA 4ZJUA 3NUQA 2RHOA 2A1TR 5MN4A 1BJTA 1RJ9A 3DP7A 2C04A 4DIMA 2DECA 4UCWA 4E5KA 3FHCB 4EA9A 1H3EA 4XE9A 3RWKX 4GH5A 1MJHA 4JT9A 3SYMA 3EVTA 5BWBA 5LA1A 3VTAA 4DMRA 2W6OA 2ZSIA 1UYXA 1WSDA 1N0HA 4BVHA 2E85A 2XKBA 4FGZA 1TNRA 3NH6A 2QMYA 4HATA 4QDSA 4MV7A 3CN9A 2E4WA 4ZK2A 2IBTA 4GNKA 4N4AA 2GFQA 1M7BA 1THMA 3KTFA 2JAHA 3BTSA 4NV0A 5KJCA 3WF4A 3RVKA 5DZGA 2J7KA 1FSFA 4CKCB 5BSMA 3LDUA 1QVAA 3RYCB 2ZYIA 4QWNA 2VG8A 3T8YA 2C82A 1IY2A 1QCCA 2BI4A 2LIPA 2Q1WA 2GKGA 1WPRA 2O8NA 3ME2A 3UNXA 5IT0A 1N7I