1URXA

Crystallographic structure of beta-agarase a in complex with oligoagarose
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
268
structure length
268
Chain Sequence
b'QDWNGIPVPANPGNGMTWQLQDNVSDSFNYTSSEGNRPTAFTSKWKPSYINGWTGPGSTIFNAPQAWTNGSQLAIQAQPAGNGKSYNGIITSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQSIDIMEGYGSDRGGTWFAQRMHLSHHTFIRNPFTDYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHLGGTGLNQATNIIIDCENQTDWRPAATQEELADDSKNIFWVDWIRVYKPVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-AGARASE A
molecule tags Hydrolase
source organism Zobellia galactanivorans
publication title Parallel Substrate Binding Sites in a Beta-Agarase Suggest a Novel Mode of Action on Double-Helical Agarose
pubmed doi rcsb
total genus 70
structure length 268
sequence length 268
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2003-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1urxA00
3APBA 3WG4A 4BOWA 1AX1A 2EXHA 4BMBA 1QNWA 4LBQA 4XIKA 2LALA 5CBLA 1S0IA 3M2MA 4AWDA 1AX2A 1PZ9A 1UL9A 4FOWA 1HQWA 4YZ1A 2ZGSA 2GDFA 2D6LX 5DUUA 2A70A 1W6NA 2DUPA 1FX5A 1WLDA 2NYYA 2WJSA 2GMMA 5EWSA 3GALA 3AXDA 2DU0A 3N7JA 4YW3A 4XMAA 1LU2A 3JU9A 4YGEA 1CPNA 4Y1ZA 1QDCA 2GN3A 3OYWA 4YFZA 1DYPA 4JC1A 1LOBA 1FAYA 2WT2A 4I30A 2DUOA 1ENSA 1W6PA 3FUQA 2PHFA 3SH3A 4XDQA 2R1DA 5DZEA 1LECA 2ZGOA 4FQZA 5GM0A 1A3KA 1LULA 4FPYA 2JDZA 2PHXA 2ZZJA 5GALA 3AYDA 4LBKA 4BLJA 5KXDA 1SFYA 5FRAA 2ENRA 2R0FA 4IQPA 3O12A 1N1TA 3HN1A 5JOYA 3I4IA 4ASMB 2AREA 4XJAA 3O0XA 3IMNA 3M3OA 1N1YA 1OFSA 3B9CA 3C2UA 3FBYA 3T1LA 5BYNA 4KBBA 5DG1A 4LBQD 3AP6A 1WW5A 3AZXA 4OZXA 1LOFC 4FPOB 1I1EA 1CN1A 5H9SA 1BYHA 1A78A 1MZ6A 3HMYA 1LGNA 1DZQA 4YM2A 5T54A 4Y20B 5H9RA 1IS6A 2D44A 3ZSMA 3AX4A 5GZCA 1WW7A 2GNBA 1IS3A 1HQLA 2JE7A 1GKBA 5T52A 5GZGA 4L8QA 5LK5A 2EF6A 3BIWE 1CVNA 2W08A 2V73A 3ASIA 1FV3A 3VKLA 4Y1UA 1URXA 2ZKNA 4NOTA 1JUIA 2A3WA 3UJOA 5DXDA 1CPMA 3SISA 4XJ9A 2WNEA 1LESA 2P3JA 1DQ2A 1GZWA 5KXEA 1Q56A 1W0OA 1GNZA 2A5ZA 1ULGA 1LJ7A 3NWKA 4P9XA 3ZYPA 1AXKA 3ZXFA 2ZHMA 1UAIA 5CNAA 2UWCA 3JUUA 3MEPA 5SV8A 1H9PA 5DUXA 3AZWA 3AJZA 3ATGA 4XE9A 1IOAA 1GLHA 1ZA4A 1LODA 4Y22A 1I3HA 3OYWB 1N1SA 3W58A 3R05A 1DQ5A 1JYCA 2WKKA 1YI7A 2A75A 3T2TA 3VV1A 1CIWA 1GSLA 4XBQA 5GLUA 2P37A 3AP9A 1FYUA 4ZKTB 4YFWA 2D7FA 1MS5A 1S0BA 1PZ7A 1WLCA 3ENRA 4LBLA 1V6NA 3AYAA 1V6JA 1JOJA 2CYFA 3ILRA 4ITCA 5DZGA 1OQ1A 1QOTA 2WSUA 3PMEA 3WVJA 4XJWA 1GV9A 1GZ9A 3B00A 5JOXA 4GKXA 1AJKA 2R0HA 5T50A 2FHRA 4PCRA 1RITA 1MR5A 4ISRA 4K1YA 3M1HA 4XIOA 4F83A 1SLCA 4Q1RA 1HKDA 3LCPA 3Q9OA 1KDKA 2P34A 3AZVA 2P2KA 2AR6A 1W6NB 3RG0A 3WCSA 1UZZA 4RL7A 5JDBA 1LENA 4M3CA 2BQPA 1JN2P 4AVTA 1LHOA 1ULFA 2VU9A 4FPHA 1G9FA 1N47A 1R1ZA 4HANA 4WVWA 4XILA 4YGDA 3VKNA 5EYXA 4YZ4A 4XMIA 1HLCA 3WDXA 5F9TA 2DVBA 1SBDA 1KRIA 4ISQA 1YRZA 3FLTA 1Q8VA 2LTNA 2D3SA 1LOFA 2ZAAA 3TB0A 2NP0A 1LEDA 2WT1A 2ZGTA 4YLZA 4XBLA 3WUCA 1NXD1 2A7AA 4YM1A 2YMZA 2AH2A 2JKBA 2UWBA 1W6QB 2HYKA 1W6MA 3AYEA 3O0WA 1W0PA 2VUAA 4YM0A 3M3EA 1MVQA 3GNEA 4M3CF 3N7MA 4Y1YA 1LHUA 1WW4A 4FP2A 2PHUA 1W6PB 3U4XA 1EPWA 4XTMA 1WBFA 3KQRA 3AXEA 1KJRA 4Y24A 1N3PA 2DTYA 4GWNA 4YG3A 1APNA 1UMZA 1RINA 1V00A 1DYKA 2CNAA 2NMNA 1SCRA 4PQ9A 5JOWA 1G9CA 3WOGA 2YROA 3D5OA 3V0BB 2VXRA 3SLIA 3RS6A 4NO4A 1ENQA 3ILFA 3RSJA 3ZXLA 1G9AA 4FVVA 4LBNA 4UW5A 1GICA 5IT6A 3LSDA 3L2YA 5DUWA 2ZGNA 4AGRA 3ZSKA 2DWRA 1A8DA 4ZXKA 5CA6A 1JXNA 3NV1A 3BODA 2ZGMA 4M3CE 5GZEA 2AGSA 2ZA9A 3N35A 1DHKB 2EAKA 5E89A 3WUDA 4C1XA 5HCAA 3ZXJA 1SLBA 1VLNA 1LGBA 1SCSA 2ZGUA 4GA9A 5F5QA 3O5SA 1H9WA 2C5DA 1G8WA 1G9DA 1DQ6A 3PVEA 4FOQA 2OW4A 3AP4A 1GANA 3N3HA 3MW4A 1CR7A 1ZM1A 2JECA 1Z0HA 5DZFA 3WG2A 2ZMLA 1C1FA 3AP5A 3OY8B 2ERFA 3POYA 1QMJA 3TAYA 3ZYRA 4Y1XA 1W6QA 4Y22B 1WBLA 2DVDA 1AF9A 4XJUA 3N7KA 3IPVB 1RIRA 2E6VA 3WNXA 4DFSA 4P9WA 4Y26A 3NV2A 2DURA 4FPGA 1C57A 2TEPA 2VY0A 2EXKA 1H30A 1D2SA 2P3IA 1AZDA 3M3QA 2GNTA 4UW3A 2ZGQA 5JVVA 1LHNA 3SH4A 4LBJA 3RMXA 1MS3A 3POWA 4DRRA 4R9BA 5KXCA 5GLVA 1OKQA 1LTEA 3USUB 2W39A 3H0OA 1DFQA 5DG2A 1V6IA 3PVOA 4GKYA 1SBEA 2ZGKA 1DGLA 1W6OB 3ZPYA 4UW6A 3KM5A 4Q27A 1UZYA 3AK0A 4K1ZA 2XB6C 2DTWA 1MVEA 2H0BA 4AGGA 1YXWA 1AX0A 4MYEA 1LOCA 1TEIA 2EXIA 5L73A 4ATEA 3B69A 2JE9A 1W6OA 4CRQA 1V6MA 4YZ3A 5GJ6A 2UWAA 4DQAA 3QLQA 3WDUA 4CZSA 4FPLA 3A0KA 4U2AA 4BQ1A 2GNMA 3ILNA 5IK8A 1ULDA 2EIGA 2NZ9A 4FQ4A 3WDYA 1Q8QA 4ATFA 1NLSA 4WVVA 1BZWA 4PF5A 2ZGLA 4YM3A 5CB7A 3AJYA 4M3CB 4YW4A 4Z8BA 3VKFC 1F5FA 1S0CA 1S0GA 3AFKA 4DS0A 1MS4A 3VUOA 4FOYA 5GLTA 3WV6A 2B7YA 5JMCA 2D6MA 2CTVA 4WZFA 1GBGA 3ZXEA 4P14A 3BTAA 2E7TA 1V6KA 1LOGA 1KITA 4LBOA 2D3PA 2GMPA 1MZ5A 2ZHLA 3SH5A 1GNHA 2R1BA 4LBMA 2CWSA 4Q2FA 3ZVXA 3N7LA 1FNZA 4DRVA 2A71A 3M3CA 2PHRA 2JJ6A 1QKQA 3USUA 1LHWA 1JYIA 1SACA 1BXHA 1S0JA 3WHUA 3UK9A 1MACA 3O0VA 5GZDA 1FATA 2A3YA 1AJOA 4R9AA 5JLVA 1BJQA 4FPFA 1UX6A 4FPCA 2AUYA 4PBPA 2A6YA 2D6PA 3OY8A 4FPKA 3AZZA 3B01A 1HDKA 3DGTA 5GLWA 1MS0A 2VW0A 2I2SA 3T1MA 2VW2A 5HCFA 1QF3A 3FUOA 3AZYA 4GALA 4YG6A 3MW2A 1U0AA 5AVAA 5T5LA 3WHTA 3V0AB 4JRAA 4YG0A 4XBNA 2R16A 4WV8A 2RHPA 4M01A 2G4IA 1N1VA 4XTPA 1WLWA 4YGBA 5DUVA 2Q5TA 2ARBA 1IKPA 2OUJA 1DLLA 3RMYA 1J1TA 4BPZA 1KQRA 2Z42A 5T5PA 1QDOA 1Q8SA 4YW1A 2GALA 3WDTA 3VKOA 1Y7BA 2VH9A 3OPZA 4PBOA 1SLAA 2OVUA 3ZSJA 4GXLA 5H9QA 4BLIA 3V0AA 3UJQA 1VALA 3PJQA 3R4UA 1JBCA 4GWMA 3WG3A 2PHTA 3INAA 1JHNA 3WG1A 1IS4A 3OJBA 5E8AA 4K21A 1LOAA 5EXOA 4Q26A 1GYKA 2WLQA 1IS5A 1O4YA 2UURA 2P3KA 5IK7A 1FV2A 3A0NA 1X50A 2ZMKA 4TZDA 4XXAA 2E53A 3V0BA 2SBAA 2XG3A 4RA0A 4FPJA 4AYUA 2DVFA 5HCBA 2WSVA 4FOVA 4UW4A 5IUQA 1UN1A 1S0DA 2A3XA 3IN9A 3POSA 3PVNA 3SITA 2EXJA 2GN7A 1GZCA 1BQPA 4YW5A 2ZMNA 3BOPA 1VAMA 1BKZA 1UKGA 1WW6A 3N36A 4H55A 3IKWA 1O4ZA 2A6XA 2DU1A 2DVAA 5CAZA 2KM2A 1SLIA 1PZ8A 1LGCA 1LEMA 3R4SA 1ULCA 1Q8OA 3W59A 4BMEA 4P9YA 2WT0A 5GLZA 1KJLA 5IK5A 4M00A 2NMOA 2A6ZA 3A4UA 1CESA 2PHWA 3SNMA 1V6LA 1DQ1A 1CONA 1SLTA 4YZ2A 2YXSA 1DQ0A 2FMDA 1Q8PA 3D6EA 1G7YA 2VW1A 3AYCA 3WCRA 4Q8KA 2D6KA 1WUVA 1S0FA 1F31A 1DBNA 1LOEA 1LCLA 4AVVA 3D4KA 4XZPA 1N3OA 1QOSA 1QGLA 2AENA 2OUHA 3LSEA 4R9CA 4YGCA 4YZ5A 5FREA 2GNDA 3OBRA 5H9PA 1AXZA 3B3QE 3IPVA 1QOOA 2GMEA 5E88A 2EALA 1W6MB 1MS8A 3FFZA 3NV3A 1SLLA 2PELA 2ZACA 2ZHKA 4Q1PA 5EYYA 3RQ0A 1S1AA 2DVGA 1DIWA 1YYNA 4XHBA 3UL2A 1ONAA 3MW3A 1XQNA 1QU0A 4U36A 2CY6A 2DV9A 4FP3A 2WQZC 4SLIA 2YZ4A 2NN8A 4C1WA 1LHVA 2ES3A 2V5YA 4W65A 1G86A 4Y20A 2NM1A 2A6VA 2W52A 1SBFA 3NV4A 1YIFA 1ENRA 1CQ9A 3DUIA 1FNYA 5JOZA 2DUQA 3ZXKA 1WD4A 1GZWB 5IK4A 1JW6A 5T55A 2ZABA 1C1LA 4XXPA 1AVBA 1G9BA 1WCSA 3MPPG 2D43A 2D3RA 3QCWA 2C9AA 5KXBA 1F9KA 3WLUA 3OBTA 1MS9A 1UPSA 3V64A 4AGVA 3V65A 4DPNA 3WDVA 1VIWB 3IM0A 1WD3A 4FPEA 2ZHNA 4K20A 4Y1VA 4HL0A 1B09A 5GZFA 1S0EA 2AYHA 4YW2A 1QNYA 4XYXA 2W68A 1VAVA 2SLIA 4XOGA 2ZBJA 1MS1A 3RRDA 2D6NA 2E7QA 4JCKA 4R9DA 3ZSLA 3FLRA 1IKQA 4BM8A 1YO8A 2D6OX 2YV8A 4D69A 3AP7A 1KDMA 3WZ1A 1C4RA 4XHXA 2ARXA 1DQ4A 2CWMA 2YY1A 2ZGRA 2CL2A 4AVSA 4LBQB 2E51A 2ZGPA 4XJ8A 1AXYA 2DYCA 4XJZA 1Z78A 2A6WA 1ULEA 3CNAA 1CJPA 1LU1A 3VKMA 5T5OA 2UU8A 4CTEA 2JD4A 3HR9A 3OGGA 1V6OA 5T5JA 3WDWA 4Q8LA 4TYSA 3I8TA 3FLPA 2R49A 1N3QA 1D0HA
chains in the Genus database with same CATH superfamily
3APBA 3H3ZA 3WG4A 4BOWA 4BMBA 1QNWA 4LBQA 4QPWA 2WA3A 1UL9A 2IFWA 1BMV1 2VMDA 1HQWA 1HJFA 1AR82 1DLCA 1OPMA 2DUPA 1W6NA 3NNJA 2GC3A 4ZONA 2WJSA 3C8XA 2GMMA 1VRBA 3DXUA 5JXIA 4QXKA 2W3JA 5FUPA 4BU2A 3N7JA 5A7WA 3ZN5A 1YQCA 4FCAA 1YIPA 1ZZ6A 2VZUA 3TYJA 5A80A 2CDPA 4YFZA 5CISA 4QKDA 4HVRA 1LOBA 2WT2A 2DUOA 4XQDA 4HSLA 4P9LA 4L11A 1J3QA 3IAQA 3HNMA 2R1DA 4IGPA 2C1FA 2ZZQA 5DZEA 5FMOL 2MHFA 4ES9A 5CFDC 2PHXA 2ZZJA 2BJSA 4IV1C 5KXDA 1UZ0A 3J26N 3O12A 2FZ1A 3MI8A 1OOPB 4AHZA 4CP1A 2VJXA 3B5LB 1HXS2 3O0XA 5F2WA 2BBAA 3M3OA 4FTBA 4MXWA 2O0OA 5IJRA 1UOBA 1UU4A 4META 5FWJA 4LBQD 1JZ7A 3CDZB 4I0AA 1CZVA 5L7OA 1C5HA 4QHBA 4NUBA 2RS12 3RJ2X 1A78A 2RDRA 3DKQA 3S30A 2WA4A 1LGNA 1DZQA 4LITA 4FT8A 1QJY2 3E6DA 4YPJA 1VRH1 3E1F1 3VGIA 1RUF1 5H9RA 1IS6A 4TSVA 3ZSMA 3E5XA 3J8F3 5GZCA 1PX4A 1IS3A 4XF0A 1K12A 5GZGA 3K48A 1ZRFA 2OZ6A 1HXS3 4AFMA 5F6LB 1UOGA 3FMGA 4HONA 4UFIA 2RR11 2V73A 4KU7A 2QDRA 2A3WA 2WDBA 2WYFA 4E2GA 4XJ9A 1LESA 2YBKA 1H1MA 3EHKA 3KLSA 1AXKA 1RUF3 2MEV3 2ZHMA 4NRMA 4XFHA 5FYZA 2ZAHA 2BTVC 4A6SA 3MFCA 3DYPA 1RC6A 1FT9A 3S0MA 2BPA2 3ZM8A 3KT4A 5FAXA 3OOXA 2RDSA 2Y6LA 5FOBB 2B4KA 3JCIA 5FY5A 1IOAA 1GLHA 5DDJ2 5EPAA 1LODA 4Y22A 5CU1A 1I3HA 1YFYA 1PGSA 3C3VA 1BLZA 2HWD1 3VBFA 1N1SA 1UY4A 2QZ2A 3W58A 3WNMA 1DQ5A 1JYCA 3VBUB 1CAXA 1LB2A 5LRSA 4DXRA 2A75A 3T2TA 2JG8C 4E9KA 5KR7A 3FE5A 2LM3A 5D2AA 1UQXA 4YW7A 4WM8B 3ZYHA 3ES4A 2FDFA 4HVOA 2OA2A 1MS5A 1WLCA 5CFDB 3ZDVA 5FZIA 1ZRDA 1ASJ2 3ES1A 1BK0A 2HWE3 3LIHA 5FYUA 1W8ZA 1JOJA 3TOJA 4AEDC 4I01A 1GV9A 3B00A 2J1TA 3EBRA 4OI4A 4GKXA 1AJKA 2R0HA 1CX1A 2WNUB 1FPN1 2ZCWA 3KF5A 3OD0A 2PXJA 4XIOA 4IGQA 5EV7A 4F83A 4QQOA 1HKDA 3LCPA 4B1MA 5C5UA 1KDKA 1PK6C 4Q0QA 4Y4RA 1Y9MA 4EV0A 5BNQA 1JYVA 2AR6A 2E9QA 4GULA 5JIUA 3RG0A 1ACCA 1OSGA 1YCIA 2JG8A 1PNFA 4QPIA 4AVTA 5JPNB 2BWCA 1L3JA 4F3JA 2EIBA 3QD6A 3VKNA 1ZZ9A 2VBBA 4YGDA 3WDXA 2CU5A 4I0BA 2WNOA 4YZ4A 4XMIA 4DY5A 2K9ZA 2WFF2 4UFJA 2VZPA 1FMD3 2UY8A 5FYBA 5FXXA 3ZN6B 2Y6GA 1NX9A 5LB6A 2VZTA 4OYUA 4MX3A 1OH4A 2HBTA 5IVCA 3FLTA 1Q8VA 4AVCA 2PAKA 5IVVA 5JI7A 2C0ZA 2WT1A 4GD4A 4HPKB 4XBLA 3GBGA 3ZMOA 1AR93 1XYPA 4LJHA 5BNPC 2AH2A 2JKBA 2YC4A 4X6RB 3AYEA 1RJ7A 3MYXA 3I59B 3M3EA 5BUVA 1LHUA 1WW4A 3UKTA 1QXRA 2E33A 1W3XA 4Z92B 3ACFA 2EVXA 1KJRA 4Y24A 3NSTA 2ZS6B 4TXWA 5FPVA 3K4DA 1HN0A 4RD7A 5FO7B 1QJY3 1V00A 1RINA 2GU9A 1XOYA 1ZZ7A 2CNAA 1E5HA 3NQHA 4DMIA 3WOGA 2VUJA 2XR4A 2WO1A 4NN0A 3MHZA 3JD71 3RS6A 1C3HA 3K2OA 3JQXA 4IDZA 3THCA 1KXGA 3ZXLA 1OLME 4FVVA 4UW5A 3CHXA 2PYTA 1ALYA 4RR3C 3RWKX 3Q8AA 1MEC1 2VQAA 2YPDA 5FZ8A 2GAUA 4OFGA 4QU1A 3TN91 4D6QA 5CG9A 4XVHA 2ZX0A 3W5NA 2X5IC 3BODA 2ZGMA 3LEKA 4M3CE 4AF9A 2WN2A 3AM2A 3VD4A 2XQRA 4GIQA 4CCMA 5E89A 1DHKB 1ZX5A 3JD73 4C1XA 3ZXJA 1SLBA 4ES8A 2PQSA 1SCSA 4DINB 1RUC1 4E4HA 1G8WA 3POBA 3VBOA 5FXWA 3AP4A 1GANA 3FHIB 4Y4YA 1GP4A 5IVYA 3KHCA 1ND3A 3BGAA 5DZFA 2ZMLA 3CL1A 3AKSA 2Q1FA 2OS2A 2ERFA 5FQ0A 2ZX2A 3ZYRA 4CU8A 4Y1XA 5I8YA 1W2NA 1W6QA 4K8RB 3BU7A 4Q0PA 5I0UA 5FYMA 1AR91 3HD8B 3PUAA 4EJRA 1PIV2 1UMIA 4FPGA 1V9U2 2DURA 4M4PA 2EXKA 3MLKA 3MV11 5FKBA 2GNTA 3C7HA 2ZGQA 4K8FA 1LHNA 5JVVA 3ACLA 4OHXA 3K51A 4CCKA 5KBFA 4BXFA 3DXTA 1DFQA 2RMU3 4QKBA 5CFDA 5A33A 2WL1A 4OULA 4EN6B 1TE1B 3ZPYA 3PNAA 5ABJC 4LTAA 3VZMA 1YHFA 1W05A 1UZYA 3AK0A 1IHMA 4IGOA 3TEWA 4NRQA 2EIDA 4IEXA 1LOCA 2DDUA 1W8OA 3N9QA 3W9AA 1ST8A 2IWGB 5IFPA 3DL3A 4OCTA 5T3NA 1PIV3 3VBSB 1ULPA 1K5MB 3H1MA 5G04L 1Q5OA 4LQRA 1V6MA 2XWBB 4CRQA 4LHSA 5JZGA 4EN8B 1H8VA 2VD7A 4AI2A 3O1TA 1HQNA 2JWPA 3JZVA 4TTGA 5JIAA 4BQ1A 3BI3A 3WNLA 2XL9A 3KV5A 1Q43A 1ULDA 1OKOA 2NZ9A 5I0TA 4Q4Y3 5FUIA 1AYM3 1Q8QA 3VL9A 3IDEA 4YM3A 5CB7A 5LA1A 3AJYA 4I3PA 1RJ8A 2PFWA 1QXJA 2BVVA 1S0CA 3PL0A 5LBFA 3S5AA 2VVFA 2H6BA 5TSWA 4FOYA 2QQWA 2B7YA 1C8M2 3KV9A 1VBC1 4FBFA 5JMCA 3CF6E 1RUI1 5C8WA 4N53C 2CTVA 5I93A 2JXAA 2J7MA 1WMDA 1D2QA 1R083 1TMF1 3ZXEA 3HVDA 4P14A 5C4WB 3CQOA 2FDGA 4XURA 2JDNA 1KITA 4LBOA 2GMPA 2BERA 5L9BA 4KWLA 3WQBA 1ULOA 4CE8A 1MZ5A 1F35A 1PX3A 4CDQB 4ZU7A 1GNHA 3VLBB 2DFCA 4Q2FA 3S57A 3N7LA 1FNZA 4OHYA 2XJQA 2A71A 4AZZA 3V56A 2CAUA 3VDDA 2ZEZA 3B94A 1NY72 3O1UA 5DAPA 1Y4WA 3DCQA 3BKZA 4PIYA 1UWWA 4OI0A 1BVP1 2R062 1AJOA 1OI6A 1V9U1 1PIV1 2Y8KA 4Z07A 5LZ6A 4Q4W3 5AC93 2JDAA 1C8NA 4XW3A 2A6YA 3WQ7A 4RSUA 3ZN6A 2XKOA 5FYIA 1RMU3 2VW0A 2JG8B 3ME2A 5HCFA 1JYNA 1QF3A 3FUOA 3AZYA 4GALA 4QKFA 3SCHA 5KC6A 3WHTA 5B2GB 1AUYA 4XBNA 3VBRC 3KSCA 2D93A 4AW7A 1QJX3 2G4IA 1O91A 1FOD3 4M01A 4YGBA 4DNYA 2Q5TA 1PO12 2ARBA 3AC0A 3J7HA 4E2QA 3ITQA 3RMYA 2XL7A 3OPTA 4TLFA 3H7YA 3BPZA 4JTNA 1ZZ8A 4S2GA 3SKVA 4AE2A 3N4MA 1CAWA 2AACA 2QQKA 3VKOA 2RM21 2PAMA 4EROA 1SLAA 3TEXA 3ZSJA 5A3NA 5KHJA 3JBG2 4BLIA 1YFXA 4HOOA 3RZKA 1PMIA 5C3SA 3BTYA 3R4UA 4DUWA 1COV2 5FZ6A 4JZRA 4KL1A 1IPSA 3KGZA 3NW4A 4N90A 2JDPA 1NA1B 3NAPB 4CDQA 1GWKA 2Y33A 4EWDA 1LOAA 3GGLA 4QB2A 1HRV3 2XHNA 4Q26A 2BFUL 4AI8A 1O4YA 1F4AA 1PM4A 1K42A 4OVEA 1JI6A 5FTTC 1X50A 2OT7A 2ARCA 2O8OA 5HCHA 1ZYBA 4XF1A 4NR1A 1HRV1 3A7QA 4WM8C 5HCBA 4UW4A 1TNRA 1UN1A 2A3XA 2HEYF 1T6GC 3POSA 1UCXA 1BEV2 2XGXA 4JQTA 2DCKA 2GN7A 2ARAA 2J1AA 3CJIA 2R30A 1I9RA 4CXXA 4YW5A 1ZBE2 2ZMNA 3NMBA 4AVBA 5BNNC 1VAMA 1BKZA 1LNSA 3SHRA 1WCKA 2DU1A 4S2DA 4F8AA 4JDNA 4CCCA 3DPRA 4GMP0 4KQ7A 4S2HA 1HN1A 1Y9GA 2VQTA 5LY1A 1QJX1 2RDNA 4P9YA 2XVLA 5I0SA 3N9NA 2ET7A 3MV01 2NLRA 4A2UA 1GUIA 1YQ5A 2A6ZA 3AVSA 1CESA 2PHWA 3ACHA 1V6LA 1EAH3 2XLGA 2X5IA 3M3IA 4EQVA 1OA3A 1HRI2 2VOTA 3RVHA 4CDUC 1XRUA 3AYCA 4MO3M 5DDJ3 2QQUA 1WUVA 2I07B 1GFF2 4AQ2A 2JB8A 4C8DA 1BBT2 1SFNA 3LE0A 4KBZA 5FJHA 4Z1VA 1RMU2 5LRRA 5BNOB 2K2SA 4MSVA 4IW3A 3ZYFA 4GWIA 2AENA 3KHBA 1KEXA 2RS31 3LSEA 4YGCA 3WW1A 5K9YA 3WNOA 4GZ9A 4CDXA 5CIRA 1J83A 2W46A 3B3QE 4JAAA 4RR3B 3IPVA 3ZO0B 1O3QA 5ACA3 2VOVA 3NNLA 1RUOA 4LOSA 1IQDC 3FFZA 1SLLA 2PELA 1SZBA 2ZHKA 3NV3A 4Q1PA 1RVF2 5EYYA 3U11A 2DVGA 1EAH2 3ROUA 3ZYIB 1D4M1 5C4WA 1RTVA 2V72A 2VCAA 4UFLA 3QACA 2VZ1A 5A7SA 2WZ8A 1OLRA 1XPWA 4IE6A 1CJDA 3OEBA 4HVQA 4JGZB 4H14A 3A21A 5K7PA 1QQP2 2BZDA 1XSRA 2NN8A 2EICA 4W65A 3H42B 2NM1A 4WBBA 4O65A 3NO8A 3ZMNA 5FP3A 3VD9A 1G6NA 4B8EA 4PIXA 1YEWA 1CQ9A 2QQIA 1FNYA 3DUIA 4L2NA 4D94A 2O8QA 2O14A 4JDMA 1VBD3 5DAWA 5EJ1B 5T55A 3VBHC 5FK7A 2I45A 3T3YA 2JENA 2FCUA 3GHNA 4MGKE 4N9HA 4OI1A 3SMHA 2FDIA 2BNNA 4HN0A 3MFAA 1MPXA 2J22A 1VBD1 4V1PA 2PAEA 4L92A 1HRV2 5A3PA 1OPOA 1TMF2 2HEWF 4C91A 1STMA 2DFBA 1VIWB 1RUI2 1JZ3A 1NZCA 2ZHNA 2Z4FA 5GZFA 1B09A 3LB9A 4IEZA 4JGYB 2O1QA 1VBE2 4XYXA 2W68A 1UZVA 2VCBA 1PVXA 4NHXA 5A7OA 5A6QA 4JCKA 1ZZCA 2IXCA 2VBPA 3FLRA 4K9SA 1IKQA 2MEV1 4AI9A 4BM8A 2YFZA 3SKJE 3LPFA 3AL5A 4A7ZA 5JI9A 2YDEA 3C7GA 4BA6A 1KDMA 5FJKA 3KCYA 4XHXA 4PI2A 1ND2B 4P08A 3MDPA 2ZGRA 5E1RA 2LUWA 3WW2A 2XBO3 2OIIA 3M7AA 4DO0A 2E51A 4XJ8A 1PO23 2A6WA 3PU8A 1LU1A 3LKJA 3WF1A 1Y3TA 3U1XA 1X8MA 3RI8A 1RUD1 1IGOA 3VBHB 1CX4A 1V6OA 2I74A 5T5JA 3RJRA 3ZFGB 1NCRB 3I8TA 4GAZA 4JRAA 1TME3 1MEC3 2EXHA 3LA2A 2LALA 4DUXA 3GZAA 2WR9A 5JR2A 2QUOA 4AWDA 4P00B 1EUTA 5A70A 4FOWA 3LFMA 5C4WC 1RVF3 2D6LX 2DCZA 3EQEA 2A70A 1FX5A 3IIIA 2NYYA 3D0JA 3H3UA 5FMDA 2XJUA 2EA7A 1SDWA 2AEYA 5EJZB 3WP4A 1JMUB 3AXDA 5F7UA 4OQ8A 4XMAA 1R082 4CPBD 1LU2A 3JU9A 4YGEA 4J6GA 4UOJA 1NLQA 1P8JA 4CEWA 3EJKA 4IV3C 4KI5M 4FSJA 5D21A 2E7AA 1ENSA 3C7FA 3FUQA 2R061 3SH3A 2ZEXA 2B9VA 5A3OA 1VBA3 3BOWA 2XWJB 1LECA 4P5YA 5IVJA 5GM0A 3W5MA 3CLPA 5HXVA 4R8HA 4BLJA 1PVC3 4IEWA 5JOYA 1YC61 3I4IA 1W3VA 3CO2A 3N9LA 5FYSA 3WQ1A 3IMNA 2H6CA 2RS33 4W50A 3FBYA 2BUKA 4OZOA 5A7PA 1ZBE1 2ID4A 4RGKA 1AR71 4KBBA 3T1LA 2FDKA 3O1OA 1XE8A 4CUAA 5A3WA 1GOFA 1LOFC 2G9FA 4QX2A 5H9SA 1X82A 1RYYA 4AI0A 4CEWC 1MZ6A 1F4HA 3HMYA 4XFIA 4JKLA 4YM2A 4P9IA 3TEZA 2VO5A 5T54A 4G3YC 4Y20B 1A6CA 3FHAA 4HSJA 2W47A 2D44A 3OF1A 4URAA 4IETA 4QX5A 1H8TA 1U5IA 3NKTA 1OXCA 2GNBA 2OKXA 3NKGA 4AEJA 2JE7A 1GKBA 5T52A 4L8QA 5LK5A 3VHOA 2EF6A 3BIWE 2W08A 1UKRA 4AAXA 3ASIA 1URXA 2ZJCA 3GDBA 1PO22 3K3OA 3PVBB 3SISA 3LOBA 2P3JA 1DQ2A 5KXEA 1Q56A 1W0OA 1GNZA 1ASJ3 1YUDA 2RS51 5A32B 3JUUA 5FY4A 1H9PA 2XXZA 5DUXA 5FO8B 2PHDA 2OQ7A 5FQ0B 3TRSB 1JH5A 2VZ3A 4X8NA 2ZEYA 4B3NA 1HB4A 5K0UA 5F3EA 3PURA 4YVSB 5A3LA 2WKKA 1YI7A 4NIDA 3VV1A 3ZYGA 2W95A 1S2BA 3NNMA 3PUSA 4IE5A 4MGSA 4Q4X3 4INDA 5FP9A 1PVC1 2BGPA 2E31A 1FYUA 2HLEA 2WFF1 2ZTNA 3AP9A 3I97A 4XDOA 4AQ6A 1S0BA 3T4HB 4C90A 3J7MA 4ASKA 3AYAA 3ILRA 2DF7A 1NQDA 1OQ1A 4NPMA 5FZHA 3GBWA 3MLLA 4XJWA 5M0TA 3O1MA 1GZ9A 5FKCA 2XVGA 3HNBM 4CCDA 2Y0IA 3LWCA 4ISRA 3M1HA 4EYUA 1O8SA 1O5LA 2QVSB 2VCCA 3MIEA 1UD1A 4Q4V3 4R4ZA 4RGAA 3VD7A 2VOKA 3WINE 5B4NA 2HWF1 3Q9OA 5FZOB 2P2KA 3MIBA 1WMXA 1W6NB 3SC7X 2WZR2 3KV4A 5JDBA 2WRAA 3R0RA 1JN2P 3FC0A 3TEYA 1LHOA 4WVWA 2BRTA 4XILA 3W20A 3T0DA 4QWNA 5EYXA 3S7IA 2DVBA 1C8M1 5FYHA 1COV3 4AHXA 5A1AA 3VBFC 1WCDJ 4J1WA 4X6QB 3CEWA 1KRIA 1YRZA 1E5IA 1XBFA 3HWJA 2ZAAA 4OHVA 4DY3A 3I3QA 4HKLA 2YMZA 3HNYM 3QH7A 5J1XA 2HYKA 1ND3B 1W6MA 3O0WA 4YM0A 2VUAA 4F7ZA 5FZ9A 3GNEA 3N7MA 2PN5A 4LHLA 4CU7A 2PHUA 4HZFA 5LBEA 1EPWA 1EV13 4XTMA 1WBFA 3KQRA 1I6XA 2CGNA 1VBE1 1YJLA 2DTYA 4BQYA 2VNGA 2JIJA 1DYKA 4O61A 5A7NA 3LA3A 1W8UA 3Q8EA 4AR2A 3EB7A 2JDMA 5BNNA 4EZ4A 3V0BB 3RZJA 2NPIA 1WA4A 2GC1A 2RR12 1R092 3IBMA 4IE7A 4NO4A 2Y6KA 4XAEA 1GICA 3U37A 4AI1A 2W9XA 3I2GA 3L2YA 1CWPA 3GCWA 2DWRA 1JOBA 1GP6A 2RV9A 1XNCA 3LIGA 5C3RA 1UO9A 3I54A 2ZXQA 2VQUA 1ENXA 1WA6X 2ILMA 2EAKA 3WUDA 5JXHA 1VLNA 1XB9A 5J98B 3JXSA 3WNPA 4QX8A 4LO5B 1W8TA 1YQ2A 2QQJA 1DQ6A 2YU1A 4KG8A 2WNVB 3GZEA 1ODNA 3VBOB 1CR7A 3WNKA 1ZM1A 2JECA 2W1QA 5FMBA 4DEQA 5CVRA 1EAH1 4CDXC 3AP5A 4BQ5A 2X09A 3QBQA 1US3A 4XUOA 4QDQA 4CEYB 3RYRA 5DMYA 3TNQA 4KWKA 1ASJ1 3HIFA 3N7KA 4FFIA 4QQHA 1RIRA 5FLJA 1RUG1 4DFSA 1NT0A 5A33B 2VY0A 2P3IA 4P9JA 1AZDA 1ZNPA 3JB4C 2JG9C 3M3QA 1Z7S3 3RZHA 1OF3A 4Z2AA 3ZX7A 3VHNA 3RMXA 2JE8A 1F2NA 5GLVA 1UF2C 3TN92 1LTEA 4PLNA 2W39A 4XUNA 5IATA 4HETA 1MEC2 4WM7B 3PVOA 4IERA 3RDIA 2JICA 2ZGKA 1HRI1 4EWEA 1UIKA 3KB5A 4LE3A 2KA3A 1SG3A 2VE1A 4LHNA 3KM5A 3MIGA 5IHRA 3JD72 4IV3B 4MXVA 2H0BA 2B46X 2W1WA 1AHSA 3U14A 4AGGA 3GM8A 3B7MA 3MIFA 1M06G 4H7MA 3B69A 1OOPC 4M4RA 5IYYA 1E57A 1W6OA 2XJSA 4CEYC 1W8NA 5GJ6A 5C70A 5FBZA 4FFHA 1XU2A 3WDUA 5L19A 1BEV1 3POFA 4U2AA 3ZKUA 1DZTA 1ZRRA 4HMZA 4RQPA 3WDYA 3UGFA 2CHHA 4D0QA 3VBUC 4LR4A 4QM8A 3GHMA 2ZGLA 5ACA2 4CDUB 3VL8A 5A32A 4FTEA 1I5PA 1F5FA 3M70A 4CP9B 3VUOA 1QJFA 2D5HA 5GLTA 1W90A 4OUEA 3ZSEA 5JPMB 4N7IA 4R52A 4B7KA 4BK4A 3PUHA 1DZRA 3CIHA 5CADA 4WM7C 1CAWB 4WZFA 4B29A 3T08A 5L36A 1POV3 1OT5A 1AR73 1W8HA 4OUMA 1V6KA 2DCJA 4QDRA 4LLFA 1J58A 1QQP3 5D8AC 5FMOS 1JU3A 4LBMA 5FZFA 5FP8A 2CWSA 3VBRA 5EP9A 2XOMA 1DGWX 3WF2A 5FY9A 3E6CC 1JYIA 3IAPA 5LBCA 3ZFFA 5ABJA 5FPAA 5L7OB 3WQ0A 3ACGA 3E5QA 2WYSA 4JDOA 1UX7A 2OXBA 5F37A 1K5JA 5BNOC 3O1PA 4EN9B 5FZOA 2QKDA 4NHMA 2FDJA 3OBZA 2BU9A 2RS32 4BQWA 1JYXA 2B8MA 2VMFA 3B01A 3DGTA 5L9VA 2JG9A 3FJSA 1BHGA 2CGPA 1QH7A 2VW2A 3T1MA 3MW2A 2XDVA 4YG0A 4WV8A 1KFUL 2RHPA 2XVKA 5DAVA 5DUVA 1WLWA 2JDKA 1IKPA 1UY3A 4XCAA 3L2HA 5LCWL 1DLLA 5K0UC 1O3TA 1J1TA 1HB2A 1V9U3 2GP5A 2W91A 1R1A2 2W1UA 2WWJA 1QDOA 2Z42A 3E6BA 4MGIE 1KFXL 1QJU1 3GZUC 4Q0VA 1H2NA 2WBKA 3DV8A 2MPFA 4UFHA 4Q5OA 5FZ0A 5FPXA 3BALA 4QQPA 4YVSA 4BJ0A 2QBXA 1RHI2 3SXWA 4FXKB 4RN5A 1XNAA 4CDUA 4NIIA 5JSOA 1IS4A 5FP7A 5FZ7A 1NG0A 5E8AA 4K21A 5ANQA 3B02A 1JS9A 5F2SA 3SCGA 1ODMA 3K46A 4L97A 4QXBA 2PLV1 3OGVA 3BUCA 5FY8A 3WEZA 1FV2A 5BXXA 3FFQA 3QOPA 3ECQA 4HKWA 4QPGB 4YWAA 4Q4V1 1GOGA 2XG3A 2KXLA 4FPJA 1OOPA 2R071 4RA0A 1QEXA 2DVFA 3RGBA 2WSVA 2XLFA 1JYWA 1WMFA 4OUSA 3IN9A 4S2FA 4FTSA 3PTYA 3PVNA 1D4M3 1WCQA 5HV4A 4L99A 4YVWA 4AFAA 3BB6A 5KHHA 1GZCA 2YBPA 2HWC1 2HJIA 2Y6JA 3HBKA 4CP0A 3WD5A 3N36A 1HXS1 4ZPIA 5FCCA 1UOJA 3RYKA 1O4ZA 5LWBA 4KGQA 1CAUA 2KM2A 1COV1 5CAZA 1AR62 3J8F1 1PZ8A 3VDBA 4C0HA 5J3UA 1Q8OA 3LEGA 4RHV1 4BMEA 2FCVA 5A6ZA 1OLQA 5GLZA 1B35B 1SPPA 3SNMA 1W9FA 1JODA 4RQPC 5EQUA 1DQ0A 4XABA 2VULA 3D6EA 4O7XA 1G7YA 1F5JA 2VNOA 2VW1A 1PO11 1NXMA 4D6SA 1S0FA 1EV11 1DBNA 1LCLA 3D4KA 3G6JB 3UV9A 4IEOA 4XFBA 2Y26A 4P02B 4CP9A 1DU3D 4COWA 5A7QA 3LPGA 4YZ5A 1UYXA 3VZKA 2Z5WA 4O9EA 3T0BA 2GNDA 3OBRA 3T2OA 2WFPA 4QPIC 1D0GA 5HBAA 1QOOA 1K3IA 5E88A 1KS5A 2CAVA 2X05A 1NA1C 1OD3A 1MS8A 1UNBA 1YJKA 1LR5A 4Q4X1 4CDWB 4PHZA 4E8DA 5C8CA 2WNVC 4A44A 2RG4A 1J1LA 5KC5A 4DOUA 1TQ5A 1XQNA 3CZJA 1CZSA 4U36A 2JDUA 3WXPA 2EIEA 1B35C 1RUH3 4SLIA 3CJIB 1RXGA 1ZBA1 5C9AA 5FOJB 1LHVA 2V5DA 2F6BA 3ZR5A 1D7PM 1G86A 4Y20A 1EV12 2VMGA 3IB3A 1YIFA 3PUQA 4LKEA 1HV0A 3ZXKA 1WD4A 2RS53 1GZWB 1NUKA 3CU7A 2F17A 1HW5A 2ZABA 1TG7A 3I2KA 4AHWA 1PK6A 4ZY9A 1KS4A 2H0VA 4RYDA 3TN93 3MPPG 3TBDA 2C24A 5KXBA 5HPOA 4AEMA 1UMHA 1UPSA 2WFF3 3USSA 1J84A 4KWJA 2BEOA 4XUPA 3WDVA 2Y6HA 3IM0A 5IAXA 5JSPA 2HWC2 4FPEA 5FZ4A 3D82A 1LKNA 3GF6A 4XFGA 4HPKA 2QQLA 1VAVA 2SLIA 5I8TA 2AZ5A 1OBNA 4XF3A 4NHYA 4R9DA 3VB9A 4UF0B 3ZSLA 2PQQA 4OI2A 4AEKA 4DB5A 5DQ0A 3H8RA 1YO8A 2D6OX 2VAUA 4Q4V2 4FI9A 1JZ6A 1UYPA 5DAQA 3WZ1A 3CJIC 2ARXA 1DQ4A 2CWMA 3CZUA 1GMMA 3I3BA 4R4XA 4UAPA 4MZUA 2DYCA 4E8CA 4XJZA 2C26A 1Z78A 4FAGA 1ULEA 3FL7A 3CNAA 3LDKA 1CJPA 4URTA 2D5FA 2R063 2UU8A 3MIHA 1FMD1 3VHRA 4LUMA 4BQXA 3HR9A 1LAJA 3OGGA 4B1LA 5AVPA 4TYSA 4YM1A 1Z7S2 1D0HA 5A3TA 1AX1A 4PJYA 1S0IA 3M2MA 1DYOA 1QJU2 1AX2A 1QQP1 4GH4A 5I8SA 1RHI3 1R1A1 4LOTA 4O9GA 4UYBA 4K3UA 5DUUA 1WLDA 4JVAA 4CCEA 4B4QA 4E4SA 3ZOIA 1R081 1TMF3 3UYJA 5HV0A 1HX6A 4LO7A 1RVF1 2DU0A 3HBZA 4YW3A 2IC1A 1TME1 4K7JA 4BB3A 2OZJA 4Y1ZA 1GQHA 1QDCA 1W99A 1NCRC 1YNAA 2GN3A 4JC1A 3LDRA 3U07A 3VBFB 4I30A 5FPLA 3T2QA 2WAOA 1W6PA 1RUC2 3RPQA 4MG2A 2RM23 4LA2A 1DF0A 1SEFA 5ERLA 4D3WA 2ZGOA 1V0AA 2QZ3A 1LULA 1O5UA 2JDZA 1S4CA 4XFAA 4LBKA 4LK7A 1WZXA 2ENRA 2J1EA 5FRAA 4DIQA 1N1TA 1WCUA 2EAAA 1NE6A 3TWIA 2R32A 4ASMB 2AREA 1XNKA 3R6SA 1OFSA 2IZWA 3C2UA 3NVCA 4M0HA 3VD5A 2J1SA 3ZIWA 1QJZA 3AP6A 2HKXA 3KD4A 3ZXDA 1UU6A 2ZKLA 3P1IA 3AZXA 4I09A 2DBNA 4JGZA 3ST7A 1GWLA 5FY0A 4YVWC 3THTA 5FP4A 3D8CA 3IT8A 2YBSA 3ZN4A 3MO4A 1NLRA 2BFUS 1PGW1 3AX4A 2DCYA 3ORJA 5L7OC 1V70A 1H8TB 2R6QA 1DCSA 3DN7A 3RNSA 3VKLA 3MGUA 3PMSA 4NOTA 4HK9A 4Y1UA 2XBO1 3THPA 2TUNA 1JUIA 3WSOA 2ORZA 5LK7B 1GZWA 1POV0 4Q0SA 4EN7B 2BNMA 3ZYPA 1JZ4A 2IXIA 4GB31 4P9XA 3IDBB 4UBGA 2DBIA 3THDA 3O1VA 5CNAA 2PHLA 4CSWA 1MZEA 4MH0E 1A34A 1BBT3 2WC2A 3IZOA 5BNPA 5C33A 4NHKA 1K5MC 1RUI3 2VR4A 3AJZA 3ATGA 4XE9A 2Q8EA 1C5IA 5K0UB 1AYM2 3T4VA 1UY0A 4MADA 5CKNA 1J3PA 4COZA 1VBE3 3EXUA 3B93A 4HBNA 4RHV3 3VDCA 4EE2A 5EZWA 4NE9A 5E6HA 1CIWA 3IIAA 4XBQA 3OUHA 1E5RA 1OUXA 2WS91 4IE0A 2CV6A 3BTXA 3DYMA 3AMMA 1RUG2 2D7FA 4KH9A 1PZ7A 3ENRA 1V6NA 1TME2 4XUQA 1V6JA 4AFCA 5JWPA 3E97A 3PHMA 2WSUA 1QOTA 5L9RA 3PMEA 4N53B 3LEMA 3VBSC 3WVJA 2WUHA 4CXWA 5JOXA 5FBJA 2OPWA 1K45A 4IESA 5T50A 2FHRA 4A41A 2GSYA 4CU6A 4CVUA 2WS92 4Q1RA 4J1XA 4YVSC 5A6XA 2P34A 4Q4W2 3AZVA 5AC92 4I2OA 1AYN2 3HAGA 5FPZA 2HWD2 5C3PA 1UZZA 2WN3A 1AL0G 2VZSA 4RL7A 1LENA 4LPLA 2BQPA 3KZ4C 4M3CA 4XEZA 5F3GA 1ULFA 4HANA 4BH9A 5DDJ1 2YGLA 1N47A 5D8AA 3V0AA 4ZZ5A 1ZREA 3MF9A 1H1AA 3HQXA 3I3DA 1HLCA 2VUCA 5F9TA 1PVC2 3H1YA 2IFRA 4CCOA 1W2OA 4XZUG 2VVEA 3J7LA 2QJVA 4QXCA 5A6YA 4ZU5A 5A7WB 4YLZA 1QJX2 1UIJA 2ZGTA 3Q8CA 4A6OA 1NYWA 1SQ4A 2UWBA 1X9TA 2Y64A 1W6QB 5FZCA 1W0PA 4M3CF 4BQ4A 2VC9A 4Y3OA 5FPBA 1HIXA 4QGNA 1W6PB 3U4XA 1VBC2 2QNKA 3NJZA 5IW0A 2Q4SA 3T30A 3ZFFC 1N3PA 4YG3A 4IEUA 5C7GA 1APNA 4KNCA 3CJXA 5CFCB 2NMNA 2ORXA 1OA4A 2NQYA 2VTXA 3ZFGC 2YROA 3H1WA 4WVZA 3D5OA 4AFBA 3F95A 1J3RA 2VBDA 3SLIA 2X10A 4COYA 4QB1A 1AYN3 2PA7A 2QQOA 1ENQA 2TBVA 3ILFA 4K6BA 4LBNA 4XPVA 4BHPA 5IVEA 3L9JT 2WNUA 3NJYA 5IT6A 2ZGNA 5EJ3A 3ZSKA 2VOXA 2JIGA 3OUJA 4AGRA 1K5MA 1A8DA 3IDCB 3M4FA 1VE0A 1GWMA 1H2LA 2J1UA 4ZXKA 1JXNA 2VXJA 3O14A 5CA6A 1SFPA 3ETQA 3H50A 2HBUA 3NV1A 4LHKA 5GZEA 3PIJA 3ZYJB 2AGSA 2ZA9A 3LF7A 4FFFA 3N35A 5HCAA 1W0NA 4IXLA 4CA9A 1LGBA 2BGOA 2QQVA 2GC0A 4GA9A 4WVMB 5F5QA 3O5SA 5FZEA 1H9WA 2C5DA 3HT2A 3W21A 3ZLIA 2FCTA 3PVEA 4FOQA 2W0XA 2HWF2 4GH4B 3EYPA 2BW8A 3N3HA 3U78A 2WINB 3WG2A 1Z0HA 2YUEA 2UYAA 3OY8B 3UGHA 2PMWB 3POYA 1QMJA 1SHWB 2BDRA 3AKRA 4LKFA 4CU9A 2VGDA 2IXLA 1YLLA 3BCWA 4Q4X2 4Y5TA 5F3IA 4QT6A 1WBLA 2DVDA 1AF9A 4XJUA 4YYOA 1PGL2 5FDBA 2XKPA 3IPVB 1OC1A 2E6VA 5DPNA 1QHDA 1ND3C 4P9WA 4Y26A 3NAPA 1BMV2 1C57A 3PLQA 1H30A 2XPJA 1RUD3 2YHJA 1VBA1 3URFA 2R041 3WF3A 4JHZA 4QB6A 4UW3A 4COVA 3SH4A 1OURA 3IWZA 5CFCA 3RFRA 4DRRA 1O3SA 2GH8A 1W06A 3NNGA 5KXCA 1NE4A 3USUB 3H0OA 5DG2A 4MHRA 1V6IA 5LASA 4EN0A 1UYYA 1SBEA 3POEA 3WP3A 4PQQA 2HWE2 4AEDA 1MQTB 4LULA 1H2KA 3U10A 1XNTA 5FR3A 1DGLA 1H4HA 1W6OB 2DCTA 1W8FA 2HYXA 2RS52 4UW6A 1OA2A 1R091 4ONUA 3WF0A 1MVEA 2DTWA 4XUTA 1AX0A 3FZ3A 4NPLA 3DPRB 3J8F2 2EXIA 5L73A 4ATEA 4ZS2A 3BVCA 5AFBA 1W9WA 4PLOA 1OQEA 5FYTA 1HV1A 4AK3A 2B5HA 3PIGA 4DEVA 2UWAA 4XFCA 3QLQA 3ZFGA 4TLGA 1OF4A 3WW3A 4LT5A 4FPLA 3A0KA 1UYZA 2YFUA 2V09A 5IK8A 2P1BA 3MBWA 2EIGA 4FQ4A 2MEV2 4DZGA 2VCMA 4XF9A 4ATFA 3DKWA 4GQ7A 4M3CB 4Z8BA 3S7EA 3VKFC 5FLHA 1DP0A 4BYYA 1S0GA 3AFKA 4DS0A 1MS4A 1S2KA 1AR72 2C6SA 4HLTA 5C8CC 5I0RA 5IVBA 3S6PA 4EZHA 2D6MA 2W2IA 1PO13 2QFEA 3KV6A 5JMOA 4MGYE 2HWF3 3KCCA 3BTAA 2E7TA 1YFUA 1LOGA 4W6YA 1H6XA 2WZR1 1H4GA 1IG3A 2ZHLA 2Y0OA 3SH5A 1JTZX 3K77A 3DEMA 3P3PA 3NJVA 4ZU4A 4B4RA 3O1RA 1Q3EA 1QKQA 4NWVA 1QJU3 3AB0A 3I2JA 2RR13 4CDWC 4XFFA 3I2HA 1W2AX 4JGYC 3WHUA 4NRPA 5G05L 2IVJA 2VZOA 1REEA 3NJXA 5GZDA 2R042 4A7KA 2ZOEB 1UX6A 2VTFA 2AUYA 2VM9A 3ZYBA 1EP0A 3A22A 3VZLA 2CGOA 2D6PA 3OUIA 3OY8A 4RS5B 4YVWB 1PGL1 1HDKA 3U4SA 1AL22 1MS0A 4PDWB 5FMCA 2I2SA 5SV5A 1RUJ3 4YG6A 5FPUA 5AVAA 1VR3A 3V0AB 1D4VB 2J1RA 3NRUA 1N1VA 1H8TC 2OUJA 3KGLA 3I59A 4UFKA 4BPZA 1KQRA 1TZOA 5T5PA 1Q8SA 3LGRA 4QX7A 2GALA 2VH9A 4PBOA 1NOVA 2VQ0A 4Q29A 4NIGA 2OVUA 1L7QA 2X8KA 1CIYA 2WABA 4LXLA 4JV4A 4ARYA 5J96B 3X29B 1VALA 1TNFA 3PJQA 3Q8BA 5F6KA 5LATA 1GNYA 3C7EA 4IEQA 5BNOA 3VBRB 3ZXAC 2PHTA 4JHTA 1JHNA 2ADDA 1IPJA 5J09A 3JBG3 2HWB3 2XLAA 3J7NA 1EPZA 1UY1A 1X9PA 3D0SA 3OD4A 5EXOA 3OGSA 2WLQA 1IS5A 1RUJ2 3OGRA 2UURA 4E27A 3A0NA 5BV6A 2ZMKA 4GB32 4XXAA 3VDDC 2XH6A 4Y5SA 1PNGA 1ZBE3 3KF3A 4AYUA 2XBO2 4FOVA 5IUQA 1S0DA 2MNGA 4Q0UA 1NCRA 4N7UA 2EXJA 2WO2A 4A42A 3T2PA 3ETPA 1BQPA 2FD8A 4YNIA 5LY2A 2QDNA 3BOPA 1NCQC 4UWDA 3WX5A 4A3ZA 3IKWA 2A6XA 3AMPA 3WR0A 2DVAA 2BVBA 1RUG3 4NAOA 1UW8A 1O59A 3NNFA 1ULCA 3R4SA 4ASLA 5C9AB 1JZ8A 2WT0A 4QHOA 1KJLA 4X8PA 4QPGC 4MVTA 3UT0A 3A4UA 1RUJ1 2Y6FA 1CONA 1SLTA 2YXSA 2LROA 1UXZA 4PDWA 2FMDA 3SEPA 1ZRIA 1OVSA 3HEIA 3KWVA 4GJYA 4LNVA 1W2UA 1W9YA 3WCRA 4JGYA 4ORFA 5E16A 2D6KA 3BYWA 1EY2A 2E26A 1LOEA 5DABA 3KVBA 2G1MA 4AVVA 1N3OA 1QOSA 1VMJA 1VPHA 3O7OA 1JZ5A 2E32A 3VDDB 1WMEA 2F4PA 1VMFA 2WO7A 2OUHA 3B9IA 4R9CA 1CAVA 5JAXA 4JGZC 5H9PA 3AFGA 4Q4Y1 4QM9A 4A45A 4CEWB 5DN2A 4JKMA 5JXGA 5A1FA 4RFRB 3VBOC 1W6MB 2ZACA 3K3NA 4NIHA 2VMCA 1IPKA 2A1XA 1AR63 1S1AA 2VTXJ 4QGLA 3T09A 4KU8A 1QXPA 4P9GA 4E4ZA 2BYVE 2JB4A 3UL2A 4AEDB 4CCNA 1QU0A 2JX9A 3H8OA 2CY6A 1M4WA 3QH6A 4W8JA 2JDHA 4BWOA 1DGWA 1NKGA 4FP3A 3GZTB 1RMU1 2HWD3 1OD5A 2VMEA 2X53S 2Y38A 2YZ4A 1UXXX 3C7OA 4C1WA 2Q1ZB 2ES3A 2V5YA 3FBMA 3ZPOA 4QQ2A 3OPWA 3IDAA 1VBC3 2A6VA 2FQPA 1GP5A 4WVMA 2WWSA 3NV4A 2G19A 2IXKA 4GB33 1NY71 5JOZA 1X8EA 4IUGA 3VDAA 4XC9A 4AOCA 4FO9A 2W92A 4LMFA 5FYYA 3K4AA 3AMHA 1QIQA 4XDPA 1C1LA 3GJBA 2V4VA 2VOWA 4ARXA 5ACA1 4LO6B 4QMAA 1G9BA 2KR2A 1WCSA 1QWRA 4CCJA 5C71A 2D43A 3H7JA 2V4AA 1C8M3 1T2XA 5FZAA 1A8MA 4CPBA 3WLUA 2IUWA 3OBTA 4NHLA 4QX0A 5B4XA 4AGVA 2P6HA 2YPJA 3GYDA 4MGZE 1BVVA 1DG6A 3RZGA 1F8VA 3ON7A 1H6YA 1S0EA 2AYHA 1QNYA 4OMDA 1VRH3 1RUE3 4D7SA 1PMJX 4XOGA 4CDWA 2YGMA 3POJA 2KD7A 1I5ZA 4D69A 4CUGA 5FXVA 1UZWA 3HJRA 1C4RA 1F15A 1X36A 2P3YA 1VBB1 4LK6A 4LBQB 2WLPA 4OHZA 4D6RA 4L9BA 3RZZA 4M0NA 4CYDA 3FN9A 5JZGB 1D4M2 1EYBA 4LO4B 4CTEA 4UXAA 2GZWA 2BWAA 5FWEA 3WDWA 3LFIA 3FLPA 2R49A 1UU5A 1O6UA 2IXJA 1N3QA 2OQ6A 5F5AA 4N43C 1CZTA 2Q1MA 3HQRA 4XIKA 4QU2A 3VZOA 3I2FA 3MZHA 1X7NA 5CBLA 1ZBA2 1PZ9A 2LS6A 2B45X 4YZ1A 2ADEA 2CSGA 2GDFA 2ZGSA 2W5FA 4I3GA 3OG2A 4KGGA 5FLIA 4NIAA 1BK1A 2ETEA 5CG8A 1OHFA 4HK8A 5EWSA 3GALA 3PTRB 1R1A3 2N7GA 3MPBA 3NAPC 3KT1A 1CPNA 1KGYA 3OYWA 4BXSV 3FX3A 1DYPA 3FWEA 1FAYA 1AR81 3LAGA 3MF6A 2PHFA 3JB8A 4IEVA 4AAPA 4XDQA 3AKTA 1UPIA 5CKMA 1TVGA 4FQZA 4WZCA 4LE4A 1A3KA 4FPYA 3E5UA 5GALA 4AI3A 3AYDA 1FMD2 3JQWA 1SFYA 4IQPA 2R0FA 4FFGA 5C8CB 4CDXB 1OLMA 1IQAA 2UY9A 1AL23 2E63A 3HN1A 3J9SA 4BCUA 1GOHA 1ND2A 4XJAA 5BNNB 5C6CA 1XNBA 1JYTA 4W6XA 1N1YA 3B9CA 5BYNA 1ZVFA 4XQWA 4NPRA 2XONA 5DG1A 1CD3G 4AQSA 3OBAA 1CAVB 4RS5C 1WW5A 3J4UH 4OZXA 4FPOB 1I1EA 1RGSA 3PDQA 1CN1A 1JU4A 2IVIB 1BYHA 5FZMA 2GP3A 1JUHA 3CBNA 1W2TA 3P6BA 1AR61 3BPSA 3N9OA 1S55A 3LA7A 3N9MA 1WW7A 3K4ZA 1HQLA 4GMP3 3KS7A 4D8MA 4NAMA 4DUVA 1CVNA 3U75A 1BEV3 1FV3A 1B35A 1SPPB 2G9GA 2ZKNA 3VHPA 3UJOA 5DXDA 1CPMA 3HQUA 2WNEA 4BE3A 3VD3A 3NWKA 4RQPB 2A5ZA 2YC2A 1ULGA 1LJ7A 2PTMA 3LD8A 4MUVA 4N43A 3ZXFA 3BU0A 2RM22 1UAIA 4IV1A 1YWKA 2UWCA 2HEVF 1XU1A 3LOIA 2VL4A 5LA2A 2Y34A 3MEPA 4HG6B 5SV8A 4CP2A 4E2SA 5CYYA 2VZQA 2LRPA 3AZWA 4B7EA 3RYPA 3KCXA 1OFNA 1ZA7A 1ZA4A 2B39A 3AKPA 5A1LA 4LLOA 1HRI3 2GC2A 1NCQB 5J37A 2JKXA 2Y60A 3AKQA 3OYWB 3R05A 3WT3A 4G9SB 5F3CA 4IL7A 4B4PA 1AL21 2RE9A 1FPN3 2HWE1 4WM8A 2QCSB 1GSLA 2W1SA 3OEAA 4KWUA 4COUA 2QQNA 1L7RA 5GLUA 2P37A 5C5TA 4ZKTB 3UNPA 4YFWA 3WNNA 5IVFA 4LBLA 5LBBA 2HH9A 4N53A 3U0ZA 5DZGA 5KWRA 1ZRCA 2CYFA 3ABZA 4ITCA 2WS93 3K75B 2FMYA 3NL1A 4UT5A 2ZPXA 5FZKA 5J48A 1AYN1 1MQTA 1W9TA 2XUMA 1RITA 4PCRA 1MR5A 4NROA 4YARA 4K1YA 1SLCA 5A3UA 4RGGA 3RZMA 1JOPA 1FPN2 2IXHA 2PLV3 4QPIB 1VB4A 2Z2SB 1O4TA 2RJLA 2A73B 3WCSA 5I91A 5IFTA 2ZX3A 3AMNA 4MLOA 1H0BA 1REFA 2VU9A 3ACIA 4FPHA 1G9FA 1R1ZA 1R64A 4OHWA 3VBHA 1JZ2A 2RDQA 3MUY1 5C3OA 1RUD2 3F2ZA 4G4FA 4LO8A 2D97A 4UBHA 5F8PA 3ZIXA 2VZVA 2QQMA 3ZFEB 1SBDA 1JHJA 1O8PA 2J42A 4ISQA 4QPYA 1CAUB 5JXJA 2NP0A 1WLTA 2D3SA 1LOFA 2LTNA 3TB0A 1LEDA 2XJPA 3WUCA 1NXD1 2A7AA 3MUZ1 4DXSA 5JCTA 4W6WA 1PO21 5FY7A 2JD9A 3KQ4B 1H2MA 1OMIA 1MVQA 4QXHA 4BK5A 4Y1YA 4FP2A 3GBFA 2OPKA 5FUNA 3I2IA 4E4DX 4OLLA 3AXEA 5LEJA 1HB3A 2X29A 3VBUA 2VMHA 4GWNA 2VECA 1XYNA 2WIIB 1C28A 1GQPA 4PLMA 1UMZA 1G9CA 3A23A 1POQA 1SCRA 3ELNA 4PQ9A 3WY6A 5JOWA 1HJGA 3RI9A 1GQGA 1OUSA 3WP6A 3LQCA 2K46A 2VXRA 3I7DA 1YI9A 1YQ6A 2Z79A 5ABJB 2PLV2 2XHKA 5F5CA 3RSJA 3TNPB 4K40A 1G9AA 5IWFA 5F39A 1VAKA 3LSDA 3ZKYA 5DUWA 2YB7A 3SQOA 4HXCA 4QKNA 2LW8A 4MGTA 1W04A 4IEYA 3H8XA 5JSRA 3I49A 4JKKA 2OYZA 1WGPA 4BQ2A 3CMGA 2YG0A 3CKHA 4BZ4A 4AFDA 1HB1A 1OVPA 1L7LA 5ANNA 1MZFA 3UESA 2ZGUA 5FV3A 3VN4A 4TN7A 1G9DA 1DDLA 3RWNA 1U5ZA 2OW4A 2R073 2ZX1A 1NCQA 3MW4A 1XE7A 4XCBA 2VZRA 4Z82A 1XYOA 1RUE2 1PHMA 1C1FA 4NMIA 1W39A 3TAYA 3AL6A 2VVDA 4W4ZA 3WW4A 4AVAA 5CKQA 1VJ2A 4Y22B 5JUVA 1IG0A 2F4LA 3ZFEA 4GJZA 4Q4Y2 5C3QA 4V2VA 3WNXA 4N43B 5KHIA 3NV2A 3HN3A 1US2A 1BCXA 2TEPA 1DGRA 1D2SA 4JTOA 1VB2A 4GWJA 1FOD2 4PT6A 1W9SA 3VZJA 2Q0AA 4XAAA 4LBJA 1MS3A 2G9ZA 2C9KA 3BN6A 3POWA 1QY4A 4QPGA 4R9BA 3ZFFB 2BP6A 2XUEA 1OKQA 3OB8A 4C0BA 5FZLA 3PUIA 2WWUA 1DGRN 3HOBA 4D7YA 4GKYA 3WP5A 1XJAA 3DF0A 4XETA 3AVRA 4DXZA 4UFMA 1GU3A 4Q27A 3D3AA 2VNRA 2WZEA 3O1SA 1RUH2 3I2OA 1IZ3A 4K1ZA 1YQ8A 2XB6C 4JX0A 4L0PA 1EUUA 4QHZA 1YXWA 4MYEA 1TEIA 2VUDA 2XQXA 2L9LA 3H8UA 4I0WB 4MOAA 4MV2A 4QGMA 5J7MA 2JE9A 5FZGA 3T0AA 3DECA 5F5IA 1XSQA 2VMIA 2P6CA 4NWWA 2RS13 4YZ3A 1VP6A 5AFEA 4DQAA 4CZSA 5C9AC 4MHUA 2FBEA 1VRH2 2GNMA 3ILNA 4IEPA 5HXMA 2Q8CA 4GH4C 5FZ1A 2RS11 4ZXEA 1NLSA 4WVVA 1BZWA 2WQ8A 4PF5A 4YW4A 1UY2A 5LEKA 1H1IA 5BY5A 4A4AA 3LDBA 4SBVA 4JQRA 3WV6A 2TNFA 4QDSA 3MIDA 4HN1A 4ZHNA 1QJY1 2R7EB 5D1IA 1RXFA 3Q8FA 4XF4A 1FI2A 1GBGA 4LEJA 5KHKA 1RUH1 4CUCA 4LIVA 3OGJA 2D3PA 4LUKA 4BDVB 1OH3A 2R1BA 3JBG1 4OMCA 4CCLA 2HWB1 4Q4W1 5AC91 3ZVXA 4DXTA 4DRVA 3KT7A 4OQ9A 4WM7A 3M3CA 2PHRA 2GH2A 2JJ6A 4UF0A 3USUA 4A3XA 1LHWA 4AG4A 5CZKA 2P17A 4QD2A 3UETA 1SACA 4RS5A 1BXHA 1S0JA 4IE4A 4GMP1 3UK9A 1MACA 3O0VA 5EFUA 1FOD1 1MQTC 1FATA 1Y43B 5BPXA 2WZR3 1ND2C 2A3YA 4R9AA 3ZXGA 5JLVA 1BJQA 1T6BX 4BIFA 1VMHA 4FPFA 4FPCA 4LKSA 1CGPA 4EWAA 4PBPA 2Z69A 3I3MA 3H9AA 5FZBA 4FPKA 3I2DA 2UYBA 1Y9QA 3AZZA 3DPRC 1UOFA 3VBSA 5GLWA 5FZDA 4CEYA 4QQLA 4ZZ8A 1U0AA 4MGQA 5T5LA 1XC6A 1BBT1 2R16A 1RUE1 4NVPA 1U5YA 2BNOA 2ZEWA 3GJAA 1AYM1 1SDDB 2VG9A 4XTPA 5F32A 2D40A 1U5XA 4PIZA 5F1RA 4YW1A 4JRLA 3WDTA 4ET7A 4FAHA 1Y7BA 3OPZA 2HWC3 5KHGA 1QH6A 4LIUA 4GXLA 5H9QA 1Z7S1 3HT1A 3UJQA 2P5BA 5FO9B 2P4EA 1AR83 3WG3A 1JBCA 4GWMA 5HI0A 1RUNA 5APAA 4PDWC 3INAA 3WG1A 2BOIA 1VBB3 1W03A 3OJBA 4LA3A 4MXWB 4Y33A 1PMHX 2WO3A 4QAWA 4KG0A 5CFCC 4HKOA 4PI0A 3UKVA 4YSFA 4BISA 1NA1A 1W8WA 1GYKA 1PGW2 2AC1A 2WZPP 2P3KA 5DAXA 5IK7A 1RUF2 5LW9A 4TZDA 1S2EA 5I0DA 2E53A 3V0BA 2SBAA 1FXZA 4Y5Z0 4N9IA 2FDHA 4V2WA 1O7FA 2B9UA 3SITA 1ZZBA 1WWYA 2RMU1 1KD7A 2YC0A 5J36A 4YW6A 4QX1A 4FXGB 2Q8DA 5FK8A 3WF4A 1UKGA 1U12A 1WW6A 2RJ2A 1XNDA 4H55A 2Q8OA 4H3WA 3EO6A 4A7YA 1SLIA 5LA0A 4H7LA 1LGCA 1LEMA 4CDQC 3W59A 3S5QA 2FZ2A 1J59A 4D7TA 2BOJA 4LORA 5FYCA 1NZIA 5IK5A 4M00A 3LEIA 2NMOA 4HT1T 5FIXA 3P5BA 5K8SA 4YZ2A 1DQ1A 3LZZA 5BNPB 2WNVA 1RB8G 1PK6B 2JG9B 2D98A 4BQ3A 1Q8PA 3BIEA 4AHYA 4Q8KA 2BV4A 2YU2A 2ATFA 1F31A 3G7DA 2WNUC 5FFOC 5JZGC 1REDA 1CAXB 1X33A 3N9PA 1RHI1 3PJYA 4XZPA 1GR3A 2XJTA 3ZFEC 3AMQA 2QTWB 4RFT0 4PF1A 4XACA 1VBA2 3POGA 1QGLA 1WKYA 4CXYA 3BTZA 5FREA 1RUC3 1AXZA 1AR92 4H2AA 2GMEA 2Q30A 2RJKA 5ISLA 3SCFA 4KMQA 2EALA 2R043 3UGGA 1QJEA 2WAAA 1W28A 2CDOA 1PM7A 2QE3A 3RQ0A 3I3EA 1DIWA 1YYNA 4XHBA 3ZDSA 3H3LA 3GCXA 1ONAA 3MW3A 2BGCA 2XMLA 2XJVA 2DV9A 3POIA 4I02A 2WQZC 5FZ3A 1LRHA 4AQTA 4Z2WA 2JEMA 2YYOA 1R093 4NJ4A 5K4LA 3ALQA 3M8LA 4AL9A 2AEZA 2W52A 3RZLA 4CUBA 1NAEA 3MICA 1SBFA 2OX0A 3HPNA 5A3MA 2ET1A 4TWTA 1ENRA 4ZS3A 1O3RA 5FXZA 2DUQA 4UI9L 5IK4A 4P5HA 1JW6A 1GZTA 3P3NA 4YRDA 4BIOA 4XXPA 3IMMA 2HWB2 4J25A 5FY1A 1AVBA 2RMU2 5EHDA 2X5IB 1VBB2 4QX3A 4RHV2 4AXOA 2D3RA 3QCWA 2C9AA 5D8AB 1F9KA 2XJRA 3DYOA 4HFSA 1MS9A 3KVAA 3V64A 3V65A 1SMVA 3SEEA 4IV1B 1XXNA 4DPNA 3ZR6A 4XQ4A 1WD3A 3FHQA 4K20A 2C4XA 4Y1VA 2QQPA 4HL0A 1E5SA 5FYVA 1POV1 3KMHA 4YW2A 1XE0A 3OTFA 1ZBA3 2J1VA 2W87A 2ZBJA 1MS1A 3GXUA 1OQDA 2D6NA 2E7QA 2R072 3RRDA 5GKAC 5LA9A 5JR7B 2VNVA 2YV8A 4RR3A 2RVAA 3AP7A 3EMRA 4LKDA 1VBD2 4IV3A 2BBVA 5IAVA 2YY1A 1RL3A 2CL2A 3OCPA 2W94A 4AVSA 5CEHA 1YFWA 2ZGPA 1AXYA 3PU3A 3VZNA 5EIYB 3OSDA 2WQ4A 2B42B 2JDYA 2VPVA 3MLJA 2ZX4A 3R4DB 3VKMA 5T5OA 4N8MA 2JD4A 3UKNA 2K0GA 4Q8LA 1NQJA
chains in the Genus database with same CATH topology
3APBA 3H3ZA 3WG4A 4BOWA 4BMBA 1QNWA 4LBQA 2WA3A 1UL9A 2IFWA 1BMV1 1HQWA 1AR82 1OPMA 2DUPA 1W6NA 2GC3A 2WJSA 2GMMA 4QXKA 3N7JA 3ZN5A 4FCAA 1YIPA 1ZZ6A 3TYJA 4YFZA 4HVRA 1LOBA 2WT2A 2DUOA 4XQDA 4HSLA 4P9LA 4L11A 1J3QA 2R1DA 2C1FA 2ZZQA 5DZEA 5FMOL 2MHFA 4ES9A 5CFDC 2PHXA 2ZZJA 4IV1C 5KXDA 3J26N 3O12A 2FZ1A 3MI8A 1OOPB 4AHZA 4CP1A 3B5LB 1HXS2 3O0XA 4FTBA 3M3OA 4MXWA 2O0OA 1UU4A 4META 4LBQD 4I0AA 5L7OA 1C5HA 4QHBA 3RJ2X 2RS12 1A78A 3S30A 2WA4A 1LGNA 1DZQA 4FT8A 1QJY2 3E6DA 3VGIA 1VRH1 1RUF1 5H9RA 1IS6A 4TSVA 3ZSMA 3E5XA 3J8F3 5GZCA 1IS3A 4XF0A 5GZGA 3K48A 1ZRFA 2OZ6A 1HXS3 4AFMA 5F6LB 3FMGA 2RR11 2V73A 4KU7A 2QDRA 2A3WA 4E2GA 4XJ9A 1LESA 1H1MA 3EHKA 3KLSA 1AXKA 1RUF3 2MEV3 2ZHMA 4XFHA 2ZAHA 2BTVC 3MFCA 1RC6A 1FT9A 3S0MA 2BPA2 3KT4A 5FAXA 5FOBB 3JCIA 1IOAA 1GLHA 5DDJ2 1LODA 4Y22A 5CU1A 1I3HA 1YFYA 1PGSA 3C3VA 2HWD1 3VBFA 1N1SA 2QZ2A 3W58A 1LB2A 1DQ5A 1JYCA 3VBUB 1CAXA 5LRSA 2A75A 3T2TA 2JG8C 4E9KA 3FE5A 2LM3A 4WM8B 3ES4A 4HVOA 2OA2A 1MS5A 1WLCA 5CFDB 1ZRDA 1ASJ2 3ES1A 2HWE3 1JOJA 3TOJA 4AEDC 4I01A 1GV9A 3B00A 3EBRA 4OI4A 4GKXA 1AJKA 2R0HA 2WNUB 1FPN1 2ZCWA 3OD0A 4XIOA 5EV7A 4F83A 4QQOA 1HKDA 3LCPA 1KDKA 1PK6C 4Q0QA 4EV0A 5BNQA 2AR6A 2E9QA 4GULA 5JIUA 3RG0A 1OSGA 1YCIA 2JG8A 1PNFA 4QPIA 4AVTA 5JPNB 2BWCA 1L3JA 4F3JA 3QD6A 3VKNA 1ZZ9A 4YGDA 4DY5A 3WDXA 4I0BA 4YZ4A 4XMIA 2K9ZA 2WFF2 1FMD3 2UY8A 3ZN6B 4MX3A 3FLTA 1Q8VA 4AVCA 2PAKA 5JI7A 2C0ZA 2WT1A 4HPKB 4XBLA 3ZMOA 3GBGA 1AR93 1XYPA 5BNPC 2AH2A 2JKBA 4X6RB 3AYEA 1RJ7A 3MYXA 3I59B 3M3EA 5BUVA 1LHUA 1WW4A 3UKTA 1QXRA 4Z92B 2EVXA 1KJRA 4Y24A 3NSTA 2ZS6B 4RD7A 5FO7B 1QJY3 1V00A 1RINA 1ZZ7A 2CNAA 2GU9A 4DMIA 3WOGA 2VUJA 4NN0A 3JD71 3RS6A 1C3HA 3JQXA 1KXGA 3ZXLA 4FVVA 4UW5A 2PYTA 1ALYA 4RR3C 1MEC1 2VQAA 2GAUA 4OFGA 3TN91 5CG9A 2ZX0A 2X5IC 3BODA 2ZGMA 4M3CE 4AF9A 3AM2A 4GIQA 5E89A 1DHKB 1ZX5A 3JD73 4C1XA 3ZXJA 1SLBA 4ES8A 1SCSA 4DINB 1RUC1 1G8WA 3VBOA 3AP4A 1GANA 3FHIB 4Y4YA 1ND3A 5DZFA 2ZMLA 3CL1A 3AKSA 2ERFA 5FQ0A 2ZX2A 3ZYRA 4Y1XA 5I8YA 1W6QA 3BU7A 4Q0PA 5I0UA 1AR91 3HD8B 4EJRA 1PIV2 4FPGA 1V9U2 2DURA 2EXKA 3MLKA 2GNTA 5JVVA 2ZGQA 4K8FA 1LHNA 3ACLA 4OHXA 3K51A 5KBFA 1DFQA 2RMU3 5CFDA 5A33A 2WL1A 4OULA 4EN6B 1TE1B 3ZPYA 3PNAA 5ABJC 4LTAA 3VZMA 1YHFA 1UZYA 3AK0A 1IHMA 4IEXA 1LOCA 3W9AA 2IWGB 3DL3A 3VBSB 5T3NA 1PIV3 1K5MB 3H1MA 1Q5OA 4CRQA 1V6MA 2XWBB 5JZGA 4EN8B 1H8VA 4AI2A 1HQNA 3JZVA 5JIAA 4BQ1A 2XL9A 1Q43A 1ULDA 5I0TA 2NZ9A 4Q4Y3 1AYM3 1Q8QA 3VL9A 3IDEA 4YM3A 5CB7A 3AJYA 4I3PA 1RJ8A 2PFWA 1QXJA 2BVVA 1S0CA 2VVFA 2H6BA 5TSWA 4FOYA 5JMCA 2B7YA 1C8M2 4FBFA 1VBC1 3CF6E 1RUI1 5C8WA 4N53C 2CTVA 5I93A 2JXAA 1WMDA 1D2QA 1R083 1TMF1 3ZXEA 4P14A 5C4WB 4EN7B 1KITA 4LBOA 2GMPA 4KWLA 4CDQB 1MZ5A 4ZU7A 1GNHA 3VLBB 2DFCA 4Q2FA 3N7LA 1FNZA 4OHYA 2XJQA 2A71A 3V56A 2CAUA 3VDDA 3B94A 1NY72 4PIYA 4OI0A 1BVP1 2R062 1AJOA 1OI6A 1V9U1 1PIV1 4Z07A 4Q4W3 5AC93 1C8NA 4XW3A 2A6YA 3WQ7A 4RSUA 3ZN6A 2XKOA 1RMU3 2VW0A 2JG8B 3ME2A 5HCFA 1QF3A 3FUOA 3AZYA 4GALA 3SCHA 5KC6A 3WHTA 5B2GB 1AUYA 4XBNA 3VBRC 3KSCA 2D93A 4AW7A 1QJX3 2G4IA 1O91A 1FOD3 4M01A 4YGBA 4DNYA 2Q5TA 1PO12 2ARBA 4E2QA 3RMYA 2XL7A 4TLFA 3H7YA 3BPZA 4JTNA 1ZZ8A 4S2GA 4AE2A 3N4MA 1CAWA 3VKOA 2RM21 2PAMA 4EROA 1SLAA 3ZSJA 5KHJA 3JBG2 4BLIA 1YFXA 1PMIA 3R4UA 1COV2 4KL1A 3KGZA 3NW4A 4N90A 4CDQA 1NA1B 3NAPB 4EWDA 1LOAA 1HRV3 4Q26A 2BFUL 4AI8A 1O4YA 4OVEA 5FTTC 1X50A 2O8OA 1ZYBA 4XF1A 4NR1A 1HRV1 4WM8C 5HCBA 4UW4A 1TNRA 1UN1A 2A3XA 2HEYF 1T6GC 3POSA 1UCXA 1BEV2 2XGXA 2DCKA 2GN7A 3CJIA 2R30A 1I9RA 4YW5A 1ZBE2 2ZMNA 4AVBA 5BNNC 1VAMA 1BKZA 3SHRA 1WCKA 2DU1A 4S2DA 4F8AA 4JDNA 3DPRA 4GMP0 4KQ7A 4S2HA 1QJX1 4P9YA 2XVLA 5I0SA 2ET7A 2NLRA 4A2UA 2A6ZA 1CESA 2PHWA 3M3IA 1V6LA 1EAH3 2XLGA 2X5IA 1OA3A 1HRI2 4CDUC 1XRUA 3AYCA 5DDJ3 1WUVA 2I07B 1GFF2 4AQ2A 1BBT2 1SFNA 4Z1VA 1RMU2 5LRRA 5BNOB 2K2SA 4MSVA 2AENA 3LSEA 5K9YA 2RS31 4YGCA 3WW1A 4CDXA 5CIRA 3B3QE 4JAAA 4RR3B 3IPVA 3ZO0B 1O3QA 5ACA3 2VOVA 1RUOA 3FFZA 3NV3A 1SLLA 2PELA 2ZHKA 4Q1PA 1RVF2 5EYYA 3U11A 2DVGA 1EAH2 3ROUA 3ZYIB 1D4M1 5C4WA 1RTVA 3QACA 1OLRA 1CJDA 4HVQA 4JGZB 4H14A 5K7PA 1QQP2 2NN8A 4W65A 2NM1A 4WBBA 3NO8A 3ZMNA 1G6NA 4B8EA 4PIXA 4D94A 1CQ9A 3DUIA 1FNYA 1ZRCA 4L2NA 2O8QA 4JDMA 1VBD3 5T55A 3VBHC 2I45A 2JENA 4MGKE 3GHNA 4N9HA 4OI1A 3SMHA 2BNNA 4HN0A 3MFAA 1VBD1 4V1PA 2PAEA 4L92A 1HRV2 1OPOA 1TMF2 2HEWF 4C91A 2DFBA 1VIWB 1RUI2 1NZCA 2ZHNA 5GZFA 1B09A 3LB9A 4IEZA 4JGYB 2O1QA 1VBE2 4XYXA 2W68A 1PVXA 4JCKA 1ZZCA 2IXCA 3FLRA 4K9SA 1IKQA 2MEV1 4BM8A 5JI9A 4A7ZA 2YDEA 4BA6A 1KDMA 3KCYA 4XHXA 1ND2B 3MDPA 2ZGRA 5E1RA 2LUWA 3WW2A 2XBO3 2OIIA 3M7AA 2E51A 4XJ8A 1PO23 2A6WA 1LU1A 3LKJA 1Y3TA 1X8MA 3RI8A 1RUD1 1IGOA 3VBHB 1CX4A 1V6OA 2I74A 5T5JA 3RJRA 3ZFGB 1NCRB 3I8TA 4JRAA 1TME3 1MEC3 2EXHA 3LA2A 2LALA 3GZAA 2QUOA 4AWDA 4FOWA 5C4WC 1RVF3 2D6LX 2DCZA 3EQEA 2A70A 1FX5A 2NYYA 3D0JA 3H3UA 2XJUA 2EA7A 1SDWA 3WP4A 3AXDA 4XMAA 1R082 1LU2A 3JU9A 4YGEA 4J6GA 4CEWA 3EJKA 4IV3C 4FSJA 2E7AA 1ENSA 3FUQA 2R061 3SH3A 1VBA3 3BOWA 2XWJB 1LECA 5GM0A 3CLPA 5HXVA 4R8HA 4BLJA 1PVC3 4IEWA 5JOYA 3I4IA 3CO2A 3WQ1A 3IMNA 2H6CA 2RS33 3FBYA 2BUKA 3T1LA 1ZBE1 1AR71 4KBBA 1XE8A 2G9FA 1LOFC 5H9SA 1X82A 4CEWC 4AI0A 1MZ6A 3HMYA 4XFIA 4YM2A 4P9IA 5T54A 4G3YC 4Y20B 1A6CA 4HSJA 2D44A 3OF1A 4IETA 4QX5A 1H8TA 1U5IA 3NKTA 4AEJA 2GNBA 3NKGA 2JE7A 1GKBA 5T52A 4L8QA 5LK5A 3VHOA 2EF6A 3BIWE 2W08A 1UKRA 3ASIA 1URXA 2ZJCA 1PO22 3PVBB 3SISA 3LOBA 2P3JA 1DQ2A 5KXEA 1Q56A 1W0OA 1GNZA 1ASJ3 1YUDA 2RS51 5A32B 3JUUA 1H9PA 5DUXA 5FO8B 2PHDA 5FQ0B 3TRSB 1JH5A 4X8NA 4B3NA 5K0UA 4YVSB 5A3LA 2WKKA 1YI7A 3VV1A 3ZYGA 1S2BA 4Q4X3 4INDA 1PVC1 2ZTNA 3AP9A 1FYUA 2WFF1 4AQ6A 1S0BA 4C90A 3AYAA 3ILRA 2DF7A 1NQDA 1OQ1A 3GBWA 3MLLA 4XJWA 1GZ9A 2XVGA 2Y0IA 3LWCA 4ISRA 3M1HA 1O5LA 2QVSB 3MIEA 4R4ZA 1UD1A 4Q4V3 4RGAA 3WINE 2VOKA 2HWF1 3Q9OA 2P2KA 3MIBA 1W6NB 2WZR2 5JDBA 3R0RA 1JN2P 3FC0A 1LHOA 4WVWA 4XILA 5EYXA 3S7IA 2DVBA 1C8M1 1COV3 4AHXA 3VBFC 1WCDJ 4J1WA 4X6QB 3CEWA 1KRIA 1YRZA 3HWJA 2ZAAA 4OHVA 4DY3A 4HKLA 2YMZA 3QH7A 2HYKA 1ND3B 1W6MA 3O0WA 4YM0A 2VUAA 4F7ZA 3GNEA 3N7MA 2PN5A 4LHLA 2PHUA 4HZFA 1EPWA 1EV13 4XTMA 1WBFA 3KQRA 1I6XA 2CGNA 1VBE1 1YJLA 2DTYA 2VNGA 1DYKA 3LA3A 5BNNA 3V0BB 2NPIA 1WA4A 2GC1A 2RR12 1R092 3IBMA 4NO4A 1GICA 4AI1A 3L2YA 2DWRA 1XNCA 3I54A 1ENXA 2ILMA 2EAKA 3WUDA 1VLNA 5J98B 4LO5B 1DQ6A 4KG8A 2WNVB 3VBOB 1CR7A 1ZM1A 2JECA 5CVRA 1EAH1 4CDXC 3AP5A 3QBQA 4CEYB 3RYRA 3TNQA 4KWKA 1ASJ1 3HIFA 3N7KA 4QQHA 1RIRA 5FLJA 1RUG1 4DFSA 5A33B 2VY0A 2P3IA 4P9JA 1AZDA 1ZNPA 3JB4C 2JG9C 3M3QA 1Z7S3 3ZX7A 3VHNA 3RMXA 1F2NA 5GLVA 1UF2C 3TN92 1LTEA 4PLNA 2W39A 4HETA 1MEC2 4WM7B 3PVOA 4IERA 3RDIA 2JICA 2ZGKA 1HRI1 4EWEA 1UIKA 3KB5A 4LE3A 2KA3A 4LHNA 3KM5A 3MIGA 3JD72 4IV3B 4MXVA 2H0BA 2B46X 4AGGA 1AHSA 3B7MA 3MIFA 1M06G 4H7MA 3B69A 1OOPC 1E57A 1W6OA 2XJSA 4CEYC 5GJ6A 5FBZA 1XU2A 3WDUA 5L19A 1BEV1 4U2AA 1DZTA 1ZRRA 4HMZA 4RQPA 3WDYA 3VBUC 4LR4A 4QM8A 3GHMA 2ZGLA 5ACA2 4CDUB 3VL8A 5A32A 4FTEA 1F5FA 3M70A 3VUOA 2D5HA 5GLTA 3ZSEA 5JPMB 4N7IA 4R52A 4B7KA 5CADA 1DZRA 4WM7C 1CAWB 4WZFA 4B29A 5L36A 1POV3 4OUMA 1AR73 1V6KA 2DCJA 4LLFA 1J58A 1QQP3 5D8AC 5FMOS 4LBMA 2CWSA 3VBRA 1DGWX 3E6CC 1JYIA 3ZFFA 5ABJA 5L7OB 3WQ0A 3E5QA 4JDOA 5BNOC 4EN9B 2QKDA 4NHMA 2RS32 2B8MA 3B01A 3DGTA 2JG9A 3FJSA 2CGPA 1QH7A 2VW2A 3T1MA 3MW2A 4YG0A 4WV8A 1KFUL 2RHPA 2XVKA 5DUVA 1WLWA 1IKPA 3L2HA 1DLLA 5K0UC 1O3TA 1J1TA 1V9U3 1R1A2 2Z42A 1QDOA 4MGIE 3E6BA 1KFXL 1QJU1 3GZUC 4Q0VA 1H2NA 3DV8A 2MPFA 5FPXA 3BALA 4QQPA 4YVSA 1RHI2 3SXWA 4FXKB 4CDUA 5JSOA 1IS4A 1NG0A 5E8AA 4K21A 3B02A 3SCGA 4L97A 2PLV1 1FV2A 5BXXA 3FFQA 3QOPA 3ECQA 4HKWA 4QPGB 4Q4V1 2XG3A 2KXLA 4FPJA 1OOPA 2R071 4RA0A 2DVFA 2WSVA 2XLFA 1WMFA 4OUSA 3IN9A 4S2FA 4FTSA 3PTYA 3PVNA 1D4M3 4L99A 4YVWA