1URXA

Crystallographic structure of beta-agarase a in complex with oligoagarose
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
268
structure length
268
Chain Sequence
QDWNGIPVPANPGNGMTWQLQDNVSDSFNYTSSEGNRPTAFTSKWKPSYINGWTGPGSTIFNAPQAWTNGSQLAIQAQPAGNGKSYNGIITSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQSIDIMEGYGSDRGGTWFAQRMHLSHHTFIRNPFTDYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHLGGTGLNQATNIIIDCENQTDWRPAATQEELADDSKNIFWVDWIRVYKPVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-AGARASE A
publication title Parallel Substrate Binding Sites in a Beta-Agarase Suggest a Novel Mode of Action on Double-Helical Agarose
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase
total genus 70
structure length 268
sequence length 268
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2003-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1urxA00
1MVEA 1QKQA 1BKZA 4P14A 1AX0A 5DXDA 1KDKA 3AYAA 3R4UA 1EPWA 1HQLA 1DQ0A 2AH2A 4M3CA 2AGSA 2DUPA 5LK5A 1C1LA 1ZA4A 3MPPG 5GLWA 1W6MA 4U36A 1AX2A 2AENA 5FREA 3AXEA 1V6JA 1Q8SA 4ITCA 5KXEA 1IS6A 3OY8B 5H9RA 5H9QA 4XJ8A 5GJ6A 1Q8VA 2ZMKA 4HANA 4XTMA 1HKDA 2FHRA 3A0KA 4PCRA 4XE9A 4SLIA 2P2KA 1HDKA 2NMOA 3SISA 2VUAA 4XJUA 5DUWA 1LHOA 2ZAAA 3IMNA 1LCLA 3FUQA 4P9WA 2UURA 1G9DA 1ULEA 1DBNA 5GLUA 2ZZJA 1WW4A 4Y1VA 3BOPA 4AWDA 4AGGA 1GZ9A 1LJ7A 1DZQA 2ZGLA 3BTAA 1DQ5A 4XZPA 1DYPA 3A4UA 4UW4A 4XTPA 5GZFA 3U4XA 2OUHA 2CWMA 4XILA 5GM0A 3USUA 5L73A 3IKWA 3RQ0A 4Y1XA 1UPSA 1FV3A 1G8WA 1GZCA 1LOCA 1G9CA 1N1YA 1Y7BA 1IS3A 3ENRA 2WKKA 1U0AA 2A6XA 1FNZA 1MR5A 2PHRA 1QNYA 3A0NA 1WW7A 2EXKA 3OYWA 3NWKA 4GWMA 5H9PA 4PQ9A 1LHNA 5E89A 5FRAA 1KRIA 1PZ8A 2A5ZA 2DTYA 4FPKA 4R9DA 4Q26A 4Y22B 2DWRA 4L8QA 1AXYA 3FLRA 2WT1A 3IPVA 1N1TA 3TB0A 4RA0A 1J1TA 1OQ1A 3B00A 1QDOA 2CNAA 1C1FA 2E7TA 2TEPA 3WNXA 5JOZA 2ZGTA 1S0CA 3T1LA 1WLCA 4YZ3A 5EYYA 4GWNA 1MS9A 5EYXA 1SLLA 4FP2A 2A75A 1URXA 3PMEA 5JLVA 3WUDA 3N3HA 3ZXLA 4BLIA 3FUOA 1G9AA 1WBFA 3LSDA 2E7QA 1LGCA 4LBLA 1G86A 1GICA 1UN1A 2UWCA 1DLLA 2ZGKA 4UW5A 3I8TA 1SFYA 4XJWA 5E88A 3SH4A 1FAYA 1GV9A 2ZABA 3AZWA 4H55A 3T1MA 1FATA 3DUIA 4XJ9A 1DQ6A 1HLCA 4Y24A 3WG4A 3AX4A 2UWBA 2ZBJA 2VW1A 3M3QA 4ZXKA 5F9TA 1W6MB 1SCRA 1GANA 2JD4A 3PVEA 1WUVA 2GMPA 1Q8QA 1S0FA 1WCSA 1MS4A 2ZA9A 1FNYA 3HN1A 3PJQA 2YY1A 2DTWA 3V65A 3MW2A 2PHXA 5E8AA 1OKQA 4XIOA 2CTVA 3AP7A 3AXDA 4XJAA 2D44A 4Y1UA 3WDWA 2ZHKA 4ISRA 1MS1A 4Q2FA 3N7KA 4JRAA 4M3CF 4CZSA 2EF6A 1W6NA 1QF3A 2V73A 3AFKA 4YLZA 3USUB 3D4KA 4ATFA 2VW0A 1IKQA 2PHWA 1GYKA 2ZACA 2WQZC 4LBNA 2GN3A 2D6OX 1HQWA 1JOJA 2CWSA 2RHPA 1SLIA 4BM8A 5GZCA 2VXRA 1GBGA 3OYWB 3T2TA 5DUUA 3B69A 4I30A 4M01A 1WW5A 4LBQD 1ONAA 3IPVB 4GKYA 4YGCA 2A6YA 1N3OA 1SLTA 2ERFA 4XMAA 5GLVA 1ENRA 1SACA 1WW6A 2NZ9A 5CAZA 1X50A 1RITA 3LSEA 1CQ9A 1V6KA 1YO8A 2GMMA 4R9BA 1H30A 2GNMA 3ZPYA 1I3HA 5JDBA 2PHTA 1LOFA 3AP5A 2UU8A 5EWSA 2ZHMA 1YI7A 3RS6A 2YROA 2KM2A 4FPOB 1QGLA 5AVAA 1N3QA 3HR9A 1CJPA 1LOGA 4FVVA 4KBBA 4LBJA 3LCPA 1Z0HA 2OUJA 2D7FA 3AYCA 1V6NA 3JU9A 3WOGA 3ZSKA 1YXWA 5IUQA 1JBCA 3PVOA 1F31A 1UKGA 2ARXA 1AJKA 1GLHA 1VLNA 3WDTA 4DPNA 1MS5A 2VY0A 2VH9A 4YM3A 2A3XA 1WLWA 4DRRA 2OVUA 3WCRA 4LBQA 3AJYA 1WBLA 1D0HA 4DQAA 2LALA 3AZXA 2AUYA 2OW4A 5DZFA 1AX1A 2EXHA 2DV9A 4GKXA 5CNAA 5T55A 3INAA 5IK5A 3WHUA 1RIRA 5T54A 3ILRA 2PHUA 1ENSA 2A70A 3POWA 2ZMNA 4FOQA 3OPZA 4K21A 3H0OA 3W58A 2R0HA 2ZGUA 2NYYA 4XBNA 2WT0A 1TEIA 2YV8A 1QOTA 2GMEA 4YW5A 1ULCA 3M3CA 1KJLA 3NV2A 1CR7A 4TZDA 4LBOA 5DZGA 1SBDA 1W6NB 3N7MA 1QU0A 2V5YA 3KQRA 2DVAA 1QNWA 3ZSJA 3UK9A 2WJSA 1S1AA 1S0IA 2Q5TA 1GNHA 1VALA 5KXCA 1UZYA 1W0OA 1V6OA 4ASMB 2A6ZA 2DUQA 2P34A 1V6IA 1GKBA 1KITA 2I2SA 4P9XA 3WLUA 1BZWA 1ENQA 1ULFA 2H0BA 2AR6A 2GNDA 1N3PA 2EAKA 4P9YA 4AGRA 3UJOA 5GLTA 1DIWA 4FQZA 2R1BA 5DG2A 4Y1YA 4XBQA 2SLIA 4C1XA 3ILFA 3M3EA 5HCAA 5GZGA 4XXAA 4YW3A 3PVNA 1JW6A 3SH5A 1YRZA 4GALA 3AYEA 1DQ4A 4FQ4A 1QOOA 1UMZA 3UJQA 3VV1A 4YFZA 3ATGA 2EIGA 4XBLA 3WDVA 4UW6A 1WLDA 2ES3A 2ZGRA 1NXD1 3AP4A 2B7YA 4BLJA 2YZ4A 1IKPA 2R16A 4NO4A 1SLBA 2ENRA 3OJBA 4YM0A 1CPNA 4W65A 4ZKTB 3RRDA 3RSJA 1LENA 4XIKA 1LHUA 1MVQA 5T52A 2CL2A 3VKOA 1G7YA 4YGBA 4DRVA 3OBTA 4WVWA 3Q9OA 4XDQA 1AZDA 1Q8OA 1CN1A 4IQPA 1S0DA 5H9SA 1MS0A 1CONA 2W68A 2D3PA 5GZDA 3WDXA 4YG6A 3ZSLA 2E6VA 1LODA 1CPMA 3ZYPA 5DUXA 2UWAA 4FPGA 3CNAA 3RMYA 4ISQA 1YYNA 2C5DA 4LBQB 1S0BA 1AF9A 5GZEA 1DQ1A 1W6OB 2C9AA 2ZKNA 3VKLA 5IK8A 3B3QE 2ZGSA 4K1ZA 4DS0A 1Q56A 1JHNA 1G9FA 2A7AA 3MW4A 3WG1A 1C57A 2LTNA 1CIWA 3N35A 4XXPA 4YW4A 1QDCA 2D6KA 2AYHA 3NV3A 1BXHA 5IK4A 1SCSA 1KDMA 2EXJA 5T5JA 4FOWA 2WSUA 2R49A 4AVVA 3ZYRA 3D6EA 5BYNA 3O12A 2R0FA 4FOVA 1MACA 2A3WA 1H9WA 2W08A 4FOYA 3AP6A 4YW1A 2NM1A 1BYHA 2DU0A 3AJZA 1AJOA 3NV4A 4Q1PA 4GA9A 3GALA 5SV8A 1O4ZA 5EXOA 4WZFA 1ULGA 1AXKA 2DU1A 3ZXFA 5IT6A 2CY6A 3BODA 3I4IA 4PBOA 2P37A 3AK0A 2ZMLA 1LHVA 4C1WA 2SBAA 4M00A 1A78A 4FPYA 3ILNA 5JVVA 1SLCA 1N1SA 1NLSA 2DVGA 4BMEA 1VAVA 1UAIA 1PZ9A 3C2UA 2ZGNA 1H9PA 1B09A 2YMZA 4CTEA 1UZZA 2JDZA 2A6VA 4JC1A 1A8DA 1AXZA 1W6PA 4AYUA 1JUIA 1V00A 2G4IA 1DFQA 2WNEA 2FMDA 3OBRA 4PF5A 2GALA 4FPCA 4MYEA 1OFSA 1UX6A 2D6NA 4FPHA 1LGNA 3AZYA 3RMXA 1KJRA 2EALA 5T50A 3R05A 4Q27A 1W6OA 1SLAA 2XB6C 3FLPA 1F5FA 3L2YA 2ZHLA 3ASIA 4FPJA 3M3OA 1R1ZA 3N7LA 1JXNA 4BOWA 3N7JA 4M3CE 3SH3A 5CB7A 3VKFC 5DUVA 3APBA 3ZXKA 2WT2A 3AP9A 1GZWA 1MS3A 2NN8A 5DG1A 5F5QA 4XOGA 1WD3A 3MEPA 1DQ2A 4Z8BA 3O5SA 1WD4A 1O4YA 4Y20A 3V64A 1FV2A 4YGEA 4FPEA 4U2AA 3WUCA 5IK7A 4Y26A 5GALA 4NOTA 2ZHNA 1CVNA 1IS5A 3WVJA 4F83A 1GSLA 3O0VA 4FP3A 1MZ5A 4FPLA 4LBMA 1LECA 3OGGA 3TAYA 4XMIA 4YFWA 2JE7A 2Z42A 1VAMA 5JOYA 3WZ1A 4Y1ZA 3ZVXA 5T5PA 1ULDA 3O0XA 1RINA 3V0BA 3JUUA 3KM5A 1G9BA 5HCBA 1CESA 3NV1A 1SBEA 1BJQA 4YZ2A 1GNZA 1V6MA 2ARBA 4LBKA 1S0JA 4Q1RA 1LEMA 1W6QA 2D3RA 4PBPA 5T5LA 2JECA 2ZGOA 3WDYA 2P3JA 1DHKB 1LULA 1LOBA 1N1VA 1FX5A 5T5OA 3V0AA 2D6MA 1LU2A 1YIFA 2JE9A 1UL9A 3FBYA 4YM1A 3M2MA 1IOAA 1S0EA 2P3IA 4RL7A 4DFSA 2AREA 2D43A 4D69A 3AZVA 3WG3A 3WDUA 3RG0A 1FYUA 4FPFA 3POYA 5CA6A 4WVVA 1KQRA 1V6LA 2EXIA 2VU9A 3B9CA 2XG3A 4K20A 3WG2A 4OZXA 1DGLA 4CRQA 1W6PB 3SLIA 5HCFA 1A3KA 2DURA 3OY8A 1VIWB 3QCWA 3DGTA 3R4SA 2D3SA 4XYXA 1Z78A 3ZXJA 3FFZA 2GNBA 2A3YA 1APNA 2ZGMA 3HMYA 3ZXEA 4XJZA 3WHTA 4Q8KA 4YM2A 3D5OA 2P3KA 3SITA 4M3CB 3WCSA 2DYCA 3GNEA 1Q8PA 2JKBA 2VW2A 1LEDA 3B01A 3QLQA 1SBFA 3VKMA 1S0GA 2DVFA 4R9AA 2PHFA 2WSVA 4BMBA 1LGBA 1I1EA 4YZ5A 3BIWE 2YXSA 2GNTA 1PZ7A 1LOFC 3AYDA 4R9CA 2DVDA 1C4RA 2E53A 2PELA 3UL2A 2ZGPA 4BPZA 1GZWB 4YZ4A 4YG3A 1AVBA 2W39A 2D6LX 3IM0A 3IN9A 3ZSMA 4AGVA 1MZ6A 4YGDA 4YG0A 2R1DA 4Y20B 1LOAA 2A71A 1JYIA 1MS8A 3VKNA 2DUOA 4UW3A 4WV8A 4BQ1A 1D2SA 3SNMA 1F9KA 3FLTA 5DZEA 1W0PA 4K1YA 5JOWA 4Y22A 4YW2A 1LTEA 2JJ6A 4ATEA 5JOXA 5GLZA 4Q8LA 5CBLA 2GDFA 3VUOA 5KXDA 2NMNA 1IS4A 1BQPA 2NP0A 3N36A 1QMJA 2CYFA 2D6PA 3POSA 1DYKA 4HL0A 3W59A 1LOEA 1N47A 4GXLA 4XHXA 3V0BB 4XHBA 3MW3A 1JYCA 1LHWA 2GN7A 2W52A 4AVSA 1LU1A 1ZM1A 2DVBA 3AZZA 2A6WA 2BQPA 3M1HA 4JCKA 5JMCA 3O0WA 5KXBA 2HYKA 1QOSA 1LESA 1XQNA 4TYSA 4AVTA 2WLQA 2ZGQA 1W6QB 3WV6A 2E51A 1JN2P 4YZ1A 3V0AB
chains in the Genus database with same CATH superfamily
1QKQA 4P14A 3PIGA 4Q4Y1 4CUCA 2BFUS 1KDKA 3R4UA 4MGQA 2VR4A 2AH2A 1HQLA 2EIDA 4XUQA 5A3TA 1J1LA 1W2UA 4A7ZA 3MIDA 3MV01 1ZA4A 3MPPG 5GLWA 3T0BA 3S5QA 1DZTA 2BGCA 5FREA 1GR3A 1VBE3 3AXEA 1PMIA 2LUWA 1GOHA 4CDXB 1IS6A 5KXEA 2HEVF 2WA4A 5H9QA 3J4UH 2I07B 4OI1A 4XJ8A 4LK7A 5GJ6A 4FTEA 5K9YA 1ZYBA 4EWDA 5FZCA 2BWAA 1HKDA 4PCRA 4XE9A 2WFF3 1VBE1 1HDKA 4JGYB 1CZSA 2VUAA 4UWDA 2GC3A 3U10A 2VCMA 1CAXA 2VM9A 3GZAA 4CXWA 1RUF2 2WLPA 5FYZA 1J3RA 1DZQA 1OD3A 3LQCA 1JZ3A 1DLCA 1XNAA 1KD7A 3U4XA 3HNBM 2OUHA 3SHRA 2K46A 1OF3A 1US3A 5GM0A 3I3MA 2X29A 3NJVA 1OVPA 3USUA 3RQ0A 1SHWB 1I9RA 3ZM8A 1G8WA 1KS4A 3TNPB 1IS3A 1Y9MA 2MEV2 2RM22 2AC1A 4JQRA 1FNZA 2QQIA 2JICA 1CAVB 3N9OA 3OSDA 3VD3A 3A0NA 2WWUA 3NWKA 5CU1A 1ST8A 2ILMA 2JD9A 5IVBA 1KRIA 4Z82A 2LW8A 4N9IA 1GZTA 3O14A 3IIIA 4L8QA 1HX6A 1AYM3 2JDAA 1WKYA 4RA0A 5DMYA 3W5MA 2CNAA 4Q4V2 2TEPA 1NXMA 4PDWB 3KMHA 1RUG3 4Q0UA 3T1LA 2BEOA 4YZ3A 2VMFA 2W87A 1RUH3 3IAPA 2WFF2 1SLLA 3R4DB 2G1MA 1HV0A 2HEYF 4JKKA 4YWAA 5EYXA 1URXA 1UQXA 4N8MA 4P9IA 5BNPB 5JLVA 5A7OA 5E16A 2XOMA 3KT7A 1KFXL 2RG4A 1G9AA 1XSQA 2GC1A 3OGJA 5EP9A 4BQYA 1QQP3 2E7QA 2VZPA 2VNGA 3GDBA 1G86A 4LJHA 2HWB3 3KHCA 4MX3A 1UN1A 1SPPA 2JDYA 3THPA 4BDVB 2ZGKA 1SFYA 4DXZA 4FAHA 1AUYA 1W90A 4ZONA 1OVSA 3RJ2X 1POV3 3SH4A 1HB4A 5DAXA 2ZABA 3T2PA 4UI9L 3DUIA 1PO13 2QQUA 4IEWA 1RUC3 4Y24A 1TE1B 1GQHA 4IL7A 3DXUA 5FV3A 5FO9B 1ZBE2 1SCRA 4BA6A 3O1OA 3K3OA 2PYTA 3FHQA 3BTYA 1RUC1 4IE0A 3GGLA 1W99A 1XU2A 2DTWA 2KR2A 4R52A 3PL0A 1OURA 4D0QA 1AYM2 1SDWA 2PHXA 4XUOA 3ZFGB 2CTVA 3DECA 3NRUA 4FFFA 5FP7A 3E6BA 4W8JA 4NHMA 3EB7A 1CAXB 1RUG2 4XJAA 4Y1UA 4BU2A 3GBGA 4B29A 4URAA 1XB9A 3N7KA 2VMCA 2J1VA 4BIOA 2VZVA 4CZSA 1YCIA 4DOUA 1RXGA 3TEXA 2QDRA 3OEAA 4AZZA 3PUHA 5FIXA 2BJSA 3USUB 5EV7A 1K12A 3LDRA 1ZZCA 1QQP2 1GFF2 3RI8A 4LBNA 3MUZ1 2GN3A 5CFCC 4FXKB 2HWB2 1H8TA 3BU7A 1ASJ2 2CWSA 5K4LA 3WF3A 3DXTA 5C5TA 4N43B 4EROA 1GBGA 4CEYA 3IMMA 1UY4A 3B69A 3H3UA 4I30A 5IFTA 5KHJA 1NLRA 2ZCWA 3O1UA 1WW5A 4CCCA 4LBQD 1PO12 5I0TA 2VZSA 1PNFA 3AM2A 1QXRA 1ULPA 1N3OA 1SLTA 2ERFA 3IDBB 4XMAA 2VMDA 5I0UA 1XYNA 1H2NA 1SACA 4H14A 3E6CC 1WW6A 3IWZA 3VDDA 3ZR6A 3GYDA 4R9BA 1RUI3 1UY3A 2BGOA 4V2WA 2PHTA 3AP5A 2UU8A 3WR0A 1SMVA 1C8M2 2YROA 2KM2A 4FPOB 3DYOA 1XYPA 1N3QA 3IBMA 3T0AA 3CKHA 4P9JA 4RQPA 3GXUA 3SKVA 1W3VA 3JU9A 3KCXA 1RC6A 3LA2A 3H7YA 4QM8A 5FYMA 1YXWA 4AHZA 5LBCA 5IUQA 1JBCA 1F31A 4I09A 4G4FA 1OF4A 1RMU2 1X82A 2ARXA 4RN5A 1AJKA 2PQQA 1VLNA 1YLLA 2YHJA 3LDKA 2XJUA 4COYA 4BISA 1W06A 1GWKA 4C0HA 1NUKA 2XL7A 3GBWA 4QKDA 5LBBA 1PVC3 3GZTB 2Z4FA 3T2OA 4LBQA 2B4KA 1WBLA 1UKRA 2PN5A 2AUYA 1NX9A 3ROUA 4ZU5A 1PVC1 5A7SA 2DV9A 3BPSA 4CDWA 2XVGA 4LULA 3WHUA 3CJIB 4ASLA 1CAWA 3SCGA 3DKWA 1CJDA 4GJZA 2JDKA 3LPFA 3POWA 2E7AA 3PTRB 1GP5A 4PHZA 3H0OA 4LKEA 3POFA 2ZTNA 1RJ8A 3OUJA 2NYYA 3ZFEA 4BYYA 4RYDA 1RUI2 2WT0A 1TEIA 2YV8A 3LE0A 1QOTA 4YW5A 1W8TA 1ULCA 1KJLA 5A70A 5FZ0A 4IV1A 1JZ6A 1F4HA 2VGDA 1QU0A 2V5YA 3HQRA 5APAA 3TWIA 2DVAA 3AKQA 4QXKA 5FY5A 1U5YA 4Q4W3 3KB5A 5FPVA 5FXXA 3ZSJA 5HXMA 2WJSA 1ZZ7A 2GP5A 1H8TB 1OD5A 1UZYA 1POV0 2VTFA 4L0PA 4XACA 1GUIA 5C9AA 4FI9A 3VBFA 1PO22 2A6ZA 4CEYB 1BEV2 3IT8A 2VVEA 1VBD3 1GKBA 1KITA 3ZKUA 5BNNC 2DFCA 4OI4A 4P9XA 2IXLA 3WLUA 4NWVA 1YQ6A 2H0BA 3ZYGA 4AGRA 2EAKA 4DXSA 3VHNA 4QHZA 1MEC1 1V0AA 4QX0A 1VBD1 3BB6A 3AKSA 2XBO2 2HEWF 3MIEA 4C1XA 2K9ZA 1DG6A 5DABA 1J3QA 5AVPA 3VDDB 3ITQA 1Y9QA 4OMDA 4GWIA 2B8MA 3AYEA 3K4AA 4B1MA 5ACA3 1JYTA 3K4DA 1ZX5A 4YFZA 5C6CA 3ATGA 2EIGA 4RQPB 1DGWX 2ES3A 1SZBA 2ZGRA 4Q4X1 4RHV3 2YZ4A 1IKPA 1PM4A 2R16A 3UT0A 4DMIA 3SEEA 3IDCB 1UY2A 5A7NA 3RSJA 1JH5A 2RJKA 4OHVA 1T2XA 3OBTA 4PDWC 5FAXA 4GD4A 2B9UA 5GZDA 4Q4W2 2VNOA 4GQ7A 4AEDB 3FE5A 4BQ5A 1NZIA 1KGYA 5FY7A 3OBAA 4FPGA 3VBHA 4EJRA 2RS51 4BCUA 2C5DA 1YJLA 4LBQB 2XHNA 1PVXA 1AF9A 3VZKA 1DYOA 1OPOA 2D97A 4WBBA 3TNQA 4JTNA 5G04L 2HBUA 2OA2A 1OLME 4LKDA 2ZGSA 4K1ZA 5F2SA 4CDWB 4DS0A 1CAWB 1JHNA 5L36A 4FSJA 2OPKA 1AR82 1VB2A 3BI3A 1JODA 4QMAA 1CIWA 1PGW1 3N35A 2GSYA 5B4NA 2AYHA 2VCAA 3NV3A 2GAUA 1BXHA 2RS33 5FP9A 1UU5A 1W0NA 3ZFEB 1JYVA 1SCSA 4NR1A 3UGHA 3WQBA 5CADA 2XWJB 1AL21 4LHSA 1NE4A 4FOWA 2WSUA 1OH4A 1UNBA 4AI9A 5HV4A 5C3QA 2RS31 4IV1B 3AKPA 3FZ3A 1U5XA 1XSRA 3MFCA 4RHV2 3DPRA 4IEYA 2XH6A 1IHMA 1QEXA 2NM1A 1BYHA 2DU0A 4HOOA 4Q1PA 4GA9A 4AI8A 3RZKA 1A8MA 2VMEA 4WZFA 4AFDA 1R093 1AXKA 5C9AB 3VBFB 2BOJA 3RZJA 4IDZA 2X5IC 4DXTA 1UOGA 4M00A 3NNJA 3ILNA 3HOBA 1SLCA 2WNUC 1FPN1 2DVGA 2VZUA 1VAVA 4BMEA 4E27A 4UFHA 3WW4A 1TMF3 3GHMA 1ND2B 4I0WB 3M7AA 2YBKA 5A7QA 3ZYFA 1KXGA 4IUGA 1YQ5A 5A1FA 2CHHA 3SCFA 4MGTA 2BDRA 3J8F3 3VBUB 4FTSA 3OF1A 1VMHA 4KU8A 1JUIA 4W6YA 5HI0A 1DFQA 1TMF1 3FBMA 2RVAA 1YJKA 4PF5A 2GALA 2PTMA 4BXSV 3AMPA 2WAAA 3RWNA 4AQSA 4N53A 1A6CA 1UX6A 2D6NA 4CDUA 2R073 2J1UA 3ZOIA 2VBPA 1KJRA 2EALA 3ACGA 3MF9A 2J1RA 1W8ZA 3R05A 2FDKA 3FLPA 4UF0A 5FY0A 5C3SA 1WMDA 2R071 4LO5B 1JXNA 5EJ3A 5CB7A 4N90A 2WT2A 2YFUA 1GZWA 1W8NA 2JG8A 5DG1A 3VBHB 3POJA 5F5QA 2DDUA 2Y6LA 3MEPA 4N7UA 1R092 1OQDA 2ADDA 1O4YA 4Y20A 1X8EA 2QE3A 3KVBA 1FV2A 2XHKA 4GH4A 2C0ZA 1UY0A 2DCZA 2VE1A 4U2AA 3WUCA 2DBNA 3BVCA 3MPBA 1C28A 1J59A 5GALA 5AFBA 1ZRDA 1CVNA 3O7OA 4F83A 3H8XA 3O0VA 1R083 5AFEA 4LBMA 3NJXA 4NAOA 2XQXA 3K3NA 4YFWA 2JE7A 3LFMA 1VAMA 3ZXAC 2F6BA 3J8F2 3O1VA 1HN0A 3ZVXA 5T5PA 3O0XA 1RINA 3ZMNA 3UYJA 3P1IA 4OHXA 3KT4A 4D6RA 1MQTA 2YDEA 3JUUA 3KM5A 1CESA 3K51A 2Y34A 3O1TA 1BJQA 4UAPA 3WXPA 2ARBA 1O91A 2OT7A 2J1EA 3HT2A 3GJBA 3K75B 2XVKA 1W6QA 2VO5A 2VPVA 4PI2A 4ORFA 4KWUA 4ZPIA 3RZLA 2JECA 4JRLA 5T5OA 1DHKB 3BCWA 1BK0A 3JBG2 2D6MA 3DKQA 1YIFA 3M8LA 1UL9A 2LM3A 3M2MA 1S0EA 3VBRA 3OOXA 5JZGA 3JB8A 3ELNA 2P4EA 1RUNA 1YFXA 4XUNA 3RDIA 1EUUA 4FPFA 2KD7A 5CA6A 4CU6A 1ZZ9A 1H2MA 1DGLA 3KF3A 2VZOA 5AC93 1O3RA 1A3KA 2DURA 3T08A 4CEYC 5A3PA 3QCWA 5KWRA 5LA1A 4KWKA 3R4SA 1R082 4WVMA 5LEKA 3ZXJA 3L9JT 2ZGMA 1APNA 1F35A 4N53B 3ZDVA 3ZXEA 2PHDA 4CDUB 4YM2A 3ZYHA 3D5OA 2P3KA 3SITA 3MLKA 3NNFA 3GNEA 5FZEA 1Q8PA 2O8QA 4MHRA 1LEDA 3VKMA 1SBFA 2R30A 2VCCA 3BYWA 1UPIA 1YQ8A 1QH6A 1S0GA 4UF0B 4R9AA 3VZLA 3OD0A 3QACA 4LO6B 4CCEA 1EPZA 4YZ5A 3U0ZA 3MLLA 2YXSA 3AYDA 1V9U3 2EIBA 2ZGPA 3RJRA 3E1F1 1GZWB 2JG8B 4RQPC 1AVBA 2W39A 2D6LX 4Y5SA 3VHRA 1XE8A 3ZSMA 3D3AA 5A6YA 4MGSA 2R1DA 2XLAA 4Y20B 4GH4B 3WD5A 1HXS1 2G19A 4CSWA 4QPGB 1US2A 5A1AA 4WM8A 4AAXA 3C7HA 2PLV3 2JENA 5KR7A 3ETPA 4HXCA 1W0PA 3NNMA 4K1YA 2Y6FA 4LA2A 4NUBA 1JUHA 2JJ6A 3ZO0B 2YUEA 5JOXA 5JXJA 1YNAA 5F32A 5FQ0A 2GDFA 1UZWA 1IG0A 1X8MA 1V70A 3WNLA 5AC92 4XQWA 4OZOA 4AQTA 4D6SA 2P3YA 3KCYA 1N47A 1OOPA 3HWJA 4XHXA 2Q8CA 3VD5A 2VUJA 3MZHA 1MQTB 3MW3A 1LHWA 1HIXA 2QQPA 1YHFA 2GN7A 1VRBA 2W52A 2WZEA 1LU1A 3AZZA 3M1HA 2GH2A 4IGPA 3O0WA 2OYZA 2HYKA 1QOSA 4AVTA 2FBEA 1W6QB 1CD3G 2CU5A 1UOFA 2YPDA 1ZREA 5EJ1B 4YZ1A 2B39A 1V9U2 1KS5A 2YFZA 4QX5A 4XEZA 5EIYB 3TN91 1AX0A 1EYBA 2XXZA 3FHIB 5FLJA 4QT6A 3AYAA 3VBRB 5JZGB 4MGZE 2VTXJ 1DQ0A 4NROA 4M3CA 4JHTA 4QWNA 1O3QA 2DUPA 1NQJA 3IDAA 3T30A 4AEKA 2JG9A 2YYOA 4AI1A 4U36A 2PLV2 4KL1A 3VD7A 1Q8SA 2BERA 3VBFC 3ZXDA 2DCKA 2OIIA 2W91A 3PLQA 4IGQA 2QKDA 4WVMB 4E2QA 2BOIA 1NY72 3PTYA 2A73B 2OS2A 2NMOA 4X6RB 5DUWA 1OHFA 1LHOA 4XW3A 2ZAAA 3BTZA 1LCLA 3FUQA 5F37A 2UURA 3ES4A 2XJVA 2Z69A 3BTAA 2R062 2ZX4A 5DDJ3 1DQ5A 1HRV2 1VBA2 2IXKA 5EJZB 4JX0A 4B7EA 5GZFA 1S4CA 4D6QA 4RFRB 2CWMA 4D8MA 1W8HA 2PMWB 5A3NA 1O6UA 1W03A 4JVAA 1FV3A 3ENRA 2WKKA 1U0AA 3JB4C 5LY1A 5DAPA 4QKFA 2XGXA 1WW7A 2EXKA 4WM8B 4GWMA 5IYYA 1PGL2 2FCUA 4PQ9A 4BB3A 2IXIA 2Y26A 2RDRA 5F3GA 5FRAA 3MBWA 3AVRA 4CCKA 4Q26A 1M06G 1DGRN 3UV9A 1AXYA 3FLRA 3IPVA 3TB0A 1N1TA 1K3IA 4S2FA 5FQ0B 2Q8DA 1J1TA 1RGSA 2B42B 2JIGA 1OQ1A 3NAPA 4ES8A 5FYCA 1C1FA 5L9VA 3GCWA 3I3EA 1QH7A 5JOZA 2ZGTA 5FKCA 1OOPB 3H8RA 1WLCA 5EYYA 4AWDA 1Y9GA 1BBT1 1MS9A 3UGFA 3WNMA 3PMEA 3WUDA 4K8FA 1UMHA 4XFHA 4QQLA 2VQTA 3O1SA 3FUOA 1REFA 5K0UA 3OBZA 1LGCA 2C1FA 5DDJ2 1YWKA 4LBLA 2R043 3VLBB 3S5AA 1DLLA 3SC7X 4B8EA 4IEUA 4BXFA 4XJWA 3CHXA 3ZIWA 1CGPA 2WR9A 1D4M3 4LO7A 2DBIA 5IJRA 1E5RA 1K5MA 4Q0SA 4XFGA 2R041 4H55A 1NAEA 3DPRC 1FATA 4GB31 4AFMA 1DQ6A 1HLCA 1WA6X 1Y3TA 4HKLA 3VZOA 2HWD3 5LY2A 3WG4A 1D4M1 1TME3 4YYOA 1DU3D 2BGPA 2JG9B 1OSGA 1RUD3 2VW1A 4LEJA 4UFKA 5F1RA 5F9TA 2JD4A 3PVEA 1WUVA 1HB1A 3H8OA 2KA3A 3NNGA 1MS4A 2HWD1 4E8CA 3HN1A 1FNYA 5D1IA 1RUD1 2WQ4A 3V65A 5F39A 4I2OA 4M4PA 5ISLA 2QQWA 1RUJ3 1R1A1 2XLFA 4XIOA 5FZHA 1NA1C 5FLIA 5FMOS 5FPUA 3EQEA 2HWE2 2VECA 3AP7A 4JGZA 5FZGA 1ZNPA 2VMGA 1D4VB 2D5HA 2E33A 3WDWA 2BVVA 2ZHKA 4R4XA 2IFRA 4ISRA 4K9SA 5LCWL 4Q2FA 4JRAA 4XAEA 5FZ1A 4L11A 4CDQA 1PM7A 2D5FA 3AFKA 1QF3A 2V73A 4ES9A 1EY2A 1RL3A 1PIV3 3HAGA 2VW0A 1IKQA 2PHWA 1GYKA 2ZACA 2WQZC 4BQ2A 4ZXEA 4DO0A 1HQWA 4EN7B 1JOJA 3I2OA 1SLIA 2VXRA 4EWEA 3WEZA 3BKZA 5DAWA 3T2TA 3P3PA 3WP6A 3I3QA 1GOGA 4PF1A 3E5UA 3AL5A 5C3RA 5FZ6A 3WNNA 3O1RA 4XVHA 2YBPA 4AFBA 2WNVC 4F7ZA 4Y4YA 5FZAA 1TME2 3IPVB 4OUMA 2Q1MA 4Q4Y3 5FDBA 5HV0A 3ZXGA 1QWRA 2IZWA 5GLVA 3NAPB 4E4DX 3BPZA 5CAZA 4GH4C 5JSOA 3PDQA 3LKJA 2GMMA 2VZ1A 1H30A 4AEJA 2D93A 2VQUA 3EXUA 1VBB2 1RUJ2 1YI7A 4JZRA 4XDPA 3RS6A 5AVAA 1QGLA 4KBBA 3IDEA 2J7MA 4FVVA 3EBRA 3LCPA 1Z0HA 2OUJA 2D7FA 2QZ3A 4HK8A 3ZSKA 4HFSA 5K0UB 1HB3A 1RVF1 1W8OA 3PVOA 3WSOA 3PURA 4IGOA 4QDRA 1O59A 1UKGA 1AR62 2B5HA 3SMHA 1MS5A 1PIV2 2LS6A 4YVWA 3GHNA 4HSJA 5C5UA 1MQTC 1K5MB 1OC1A 1RUE1 1VBC3 3GZUC 3ZFGA 2AZ5A 1WLWA 4XFIA 2BW8A 1CIYA 2E9QA 2BFUL 2RS13 4A2UA 5I0DA 4GJYA 3AJYA 3ACFA 4JQTA 1VBC1 4IEQA 5CKQA 4KGQA 5DZFA 1AX1A 2RS11 2FDIA 1AHSA 4GKXA 5T55A 5FPAA 4NHLA 3INAA 5IK5A 3LOBA 4OUSA 3LD8A 4KQ7A 4O61A 1VAKA 3KV6A 3ILRA 5JZGC 1FXZA 2A70A 2RJ2A 1ZRRA 1HJGA 2W92A 2XR4A 1O4TA 3KT1A 1COV2 2FD8A 4JGZB 2ZGUA 2ZX1A 2IXJA 4N43A 4W6WA 1HRI1 2GMEA 3M3CA 1EAH3 2XDVA 3I2DA 3I54A 3NV2A 1YI9A 3WINE 4TZDA 4CDQB 1I6XA 4LBOA 3N7MA 5DZGA 1H1AA 2JKXA 4QPIC 2PA7A 5FZFA 1QNWA 1EAH1 3PU3A 1JHJA 3AMHA 3UK9A 4A44A 1VBE2 1S1AA 4PIYA 4CEWC 1GNHA 5KXCA 1JYXA 5CIRA 3RZMA 1D7PM 1L7RA 1XNKA 2BUKA 5KC6A 1ODNA 5FP3A 4ASMB 2DUQA 4CXYA 2I2SA 3KF5A 3CZJA 5FR3A 1BZWA 1ULFA 2AR6A 2GNDA 1N3PA 4P9YA 3HNMA 4QGMA 5GLTA 2UYBA 1DIWA 3P6BA 2BV4A 3PMSA 3U4SA 5C7GA 5I0SA 2R1BA 4K40A 4QX1A 4AI0A 3M3EA 4COVA 5GZGA 2Q1ZB 1Z7S1 1YQCA 2V4VA 2WIIB 4YW3A 3LPGA 3PVNA 1JW6A 2YC0A 2OKXA 1YRZA 3WW1A 4ET7A 4ZY9A 2VZRA 3ZR5A 1UMZA 3VV1A 3I2HA 3VHOA 4XBLA 3WDVA 1LB2A 2VXJA 2WBKA 1BVVA 2IVIB 3I2FA 4O9EA 5F3EA 1U12A 4XURA 1RHI1 1T6BX 2ENRA 3OJBA 3OUIA 4ZKTB 3RRDA 1LHUA 2BBAA 4QX2A 4COZA 4DRVA 1AYN1 1ULOA 2J1SA 4XDQA 1Q8OA 3J7LA 3CJIA 3P3NA 1F8VA 1OOPC 4YVWB 1S0DA 2HYXA 1MS0A 2L9LA 2AEZA 3OCPA 4P5YA 4MVTA 3ZSLA 2E6VA 3ZYPA 1RB8G 3S57A 2Q8OA 4MG2A 4ISQA 3ACLA 1QJY1 2MHFA 1RUH2 3LZZA 2XWBB 5GZEA 1DQ1A 2ZKNA 1JU4A 3VKLA 1NOVA 1DGRA 4P08A 4FXGB 4MH0E 5FYBA 1ZBA3 5CFDA 2W3JA 2ZKLA 1H2KA 3M3IA 2IVJA 2LTNA 5FPXA 4XXPA 4YW4A 1QDCA 2D6KA 4IESA 1HN1A 5L9RA 4KNCA 3VL8A 1ZBA1 2CGNA 3KCCA 1PX3A 1WCUA 2XKOA 2WAOA 3POEA 4MHUA 2EXJA 5TSWA 1RTVA 1VMFA 4AVVA 4E4ZA 1REEA 2VG9A 4IERA 4J6GA 1E5SA 5EFUA 4HN1A 2R0FA 1RUC2 4FOVA 2E32A 2WYFA 1EV13 3H50A 4GAZA 4HONA 2A3WA 4RR3A 5KHHA 4YNIA 2FDJA 4FOYA 5B4XA 4LTAA 2C9KA 4URTA 3SKJE 2W47A 5A7WA 5SV8A 1EV11 4NHYA 1IPSA 3AMMA 5IT6A 2VBBA 3BODA 4J25A 2OZ6A 4XFCA 4Q29A 1UXXX 2ZMLA 1LHVA 3JD71 2UY9A 5CZKA 4YVSA 4O9GA 4FPYA 3C7FA 1WGPA 2Y38A 1NLSA 2AACA 3K77A 4LIUA 3LAGA 3C2UA 4LK6A 4C0BA 2ZGNA 2WN3A 1H9PA 3I97A 5LA0A 3I49A 2YMZA 1BMV1 5JR7B 3B94A 2A6VA 4GMP1 4JC1A 1A8DA 1AXZA 3MIGA 4JHZA 4CP2A 5J96B 1BK1A 1A34A 4AEDA 1WLTA 2W46A 3J7MA 1CZVA 1ZVFA 5IVVA 1OA4A 1F15A 4OFGA 4LA3A 3VDBA 4B4RA 4FPHA 2V09A 3UKVA 3FWEA 4LE3A 2RMU3 1LGNA 3AZYA 4MOAA 4JDNA 5T50A 2HJIA 3RZGA 2B46X 3ZYBA 3P5BA 5F3CA 5J37A 2VVFA 4FPJA 4QXHA 1HV1A 1AR91 2RMU1 3M3OA 2I45A 5D8AA 5E1RA 2NLRA 3N7JA 1UIJA 2IXHA 5L9BA 3WW2A 5C71A 4OHYA 5FFOC 1O3SA 3A7QA 2NN8A 4ARXA 4XOGA 2YB7A 1NG0A 1WD4A 1OKOA 2R7EB 2Y0IA 3DCQA 4A42A 5K0UC 3DYPA 2VUCA 4FPEA 4CDXC 3DYMA 5IK7A 4QPYA 5LW9A 2WZ8A 4IE4A 4NOTA 4TLFA 4F8AA 1IS5A 1RJ7A 2V5DA 5CFDB 5I8SA 5LZ6A 4M0NA 4LR4A 4JGYC 1MZ5A 4O65A 4FPLA 4DY3A 2GC2A 1ACCA 1ZRCA 5KHIA 1BCXA 3H8UA 1MEC3 4HLTA 4Y1ZA 4LIVA 3E5QA 1XBFA 4KG8A 1PVC2 1XPWA 5A33A 3W9AA 1FOD1 2XONA 3USSA 4RR3B 4CCOA 2J1AA 4CPBD 2XLGA 4LHLA 4AI3A 1DZRA 1ND2A 2FDGA 4TSVA 2DCYA 2Y6GA 3TEZA 5A7WB 2KXLA 4A4AA 4C90A 3VBUA 1LEMA 5CVRA 2GC0A 5FZ7A 4Q4X3 4OI2A 1JZ2A 1H1IA 3CDZB 2ZGOA 2UYAA 2P3JA 1LULA 1N1VA 4IXLA 3T4VA 3URFA 2ZEYA 5FZ9A 1LNSA 4LUMA 4YVSB 4IV3A 3AKRA 2XUEA 2P3IA 3U1XA 2W95A 3Q8AA 5DAQA 3AZVA 3WG3A 3K4ZA 2JX9A 3KV4A 1FYUA 2CSGA 4PQQA 3KGZA 2LROA 1V6LA 3B9CA 2XG3A 2XJPA 4OZXA 2QZ2A 2RS53 3SLIA 4XZUG 1UX7A 4QQPA 3OY8A 4AQ2A 2D3SA 1JZ7A 4AQ6A 1Z78A 5BNPC 3FFZA 1NCRA 1OLMA 4LE4A 3HMYA 4XJZA 1GMMA 4GZ9A 2CAUA 1PK6A 1MEC2 5J1XA 4Q0PA 1QJU1 2FQPA 2DYCA 2BYVE 3WCSA 1VBD2 2JKBA 4S2DA 2YC4A 4CPBA 4KMQA 2K2SA 5FZBA 4B4QA 1QY4A 3U37A 2WSVA 2HKXA 4BMBA 2WYSA 5D8AB 3V56A 1I1EA 3PHMA 2GNTA 1PZ7A 1H8VA 1C4RA 1AL23 2PELA 4KWLA 1VE0A 4BPZA 2BRTA 2J42A 2Q8EA 4NIGA 4B3NA 3D0JA 3ZIXA 4CP1A 4Q4X2 5F7UA 2JE8A 4KBZA 4YG0A 2BZDA 4YGDA 5ACA2 1ZA7A 4FCAA 1JYIA 5LWBA 2HWF3 3VKNA 4UW3A 3HQUA 5A7PA 1GU3A 2VOVA 5DZEA 2O8OA 4YW2A 3ZFGC 4RGAA 2HWF1 4A6SA 4ATEA 5GLZA 4Q8LA 4B4PA 4A3XA 2W2IA 2N7GA 4NAMA 2VMIA 2RS52 2NMNA 3NO8A 4BIFA 4JKLA 4COWA 5C33A 1FPN3 3POSA 2CYFA 2D6PA 4LITA 2ADEA 1JYWA 1DYKA 2BU9A 3W59A 1LOEA 3VBOA 4FFGA 2WO3A 3HQXA 4XHBA 5A33B 2VZTA 4DUXA 4IEPA 4PI0A 4JCKA 3JQXA 3WQ7A 5JIUA 2ORZA 1XE7A 2DF7A 4TXWA 4TYSA 1PGW2 2QQMA 5IAVA 2ZGQA 1ZZBA 4N43C 4LMFA 2E51A 3ALQA 3KD4A 5KC5A 4LOTA 1MVEA 1BKZA 1AL22 3GM8A 4IV3B 5DXDA 1XNTA 2RS32 3OGRA 2DFBA 3R6SA 4J1XA 2E26A 5C4WA 1W39A 2QQNA 4PJYA 4JDMA 1O7FA 4KWJA 5CEHA 2PXJA 3ZN6A 3RGBA 1K42A 1AR71 1WCDJ 1AX2A 2AENA 1UCXA 2FZ1A 3OY8B 2VOXA 2Q0AA 4INDA 5H9RA 2ZAHA 1OT5A 3LIHA 1Q8VA 2ZMKA 4HANA 4XTMA 1TZOA 3A0KA 4UBGA 1NCRB 3RYPA 4SLIA 2P2KA 2WINB 4HKOA 4XJUA 2PQSA 1PK6B 5F3IA 1FPN2 4A41A 4P9WA 2OZJA 3MDPA 1G9DA 1W9FA 1ULEA 1DBNA 2ZZJA 3PUSA 4QPGA 1SG3A 2F17A 2O14A 2OQ7A 4OHWA 3JZVA 1GZ9A 1LJ7A 2WRAA 2ZGLA 4PIZA 5DPNA 4AGGA 1DYPA 3BUCA 4UW4A 4TN7A 1JS9A 1BLZA 1TMF2 2EIEA 3OGVA 3ZFFA 1B35A 3KGLA 5L73A 5BNOA 4UBHA 1LOCA 1G9CA 5FYIA 5IVYA 4K8RB 1YC61 3SEPA 5J7MA 2A6XA 4AL9A 1MR5A 4NRQA 1QNYA 3OYWA 5H9PA 1JZ5A 1O5UA 3CJIC 1FMD1 3VZMA 2R072 2FDHA 1PZ8A 2A5ZA 2OX0A 4W6XA 3FMGA 2DWRA 4GULA 1QXJA 3CQOA 1XOYA 4FFHA 2IC1A 2ZOEB 2C26A 4XAAA 3T2QA 1QDOA 3WP5A 1XNBA 4FO9A 5FJKA 3WNXA 3THDA 3HBKA 4QPWA 1S0CA 4K6BA 1D2QA 4LHNA 3VBOB 1LR5A 4XCBA 4GWNA 4H3WA 3MHZA 4QHBA 5LBFA 3AMNA 2A75A 3RVHA 4BHPA 5C3OA 5CFDC 1SDDB 3J9SA 5JXGA 3N3HA 3Q8BA 4BLIA 2ZZQA 4FBFA 1UU6A 2XMLA 1H8TC 3TOJA 1WBFA 5CG9A 3LSDA 3QD6A 2W9XA 4UFLA 3E97A 3EHKA 3H1WA 3LA3A 1OUXA 4UW5A 2WDBA 1FI2A 2WZR1 4X8NA 5CYYA 5E88A 4AHYA 5I91A 1FAYA 4IEVA 1GV9A 4K3UA 5C4WB 4XQ4A 5JWPA 1UD1A 2WNOA 4XJ9A 4Z1VA 3LEIA 4AVCA 2CAVA 2EA7A 4I01A 2ZBJA 3UKTA 2Y60A 3IIAA 1GANA 3VDDC 3NNLA 3SQOA 1Q8QA 1S0FA 1GWMA 2W1QA 1NLQA 3S30A 3PJQA 3OD4A 1HXS3 2YY1A 4YVSC 1UZ0A 5E8AA 1OKQA 2QUOA 3M70A 1WA4A 4QU1A 5A3LA 3AXDA 1C5HA 2D44A 4N7IA 4DUWA 3PUAA 1MS1A 3ZN6B 1GWLA 5IVFA 5J3UA 2VCBA 2EF6A 1QIQA 2WS93 5CISA 2QDNA 5D2AA 4AEDC 3ZFFB 3BTXA 1TNRA 1B35B 2AEYA 3D4KA 3NW4A 3TBDA 4ATFA 5BNOB 1ENXA 3J26N 3GCXA 2WS91 5ABJB 2D6OX 4QX7A 5FPLA 4DEVA 4UXAA 4DIQA 2X53S 5FO8B 3FL7A 2YBSA 3OYWB 5DUUA 4I0AA 4CDWC 4HSLA 2HBTA 4M01A 5D8AC 5KBFA 2TBVA 4AFCA 3MUY1 4BZ4A 5A6XA 4NPLA 1ONAA 2BNNA 4XUTA 4JKMA 5A3WA 1K5JA 4GKYA 4YGCA 3TN93 3ZFEC 1WZXA 4LUKA 1ENRA 5FLHA 1OUSA 4E4HA 2NZ9A 3I3BA 1GP6A 1RITA 2QBXA 1HXS2 1UW8A 2WO1A 4M0HA 4XFFA 3ZPYA 4IV1C 1UO9A 1LOFA 3CO2A 5EWSA 2ZHMA 4DB5A 1JTZX 2XJQA 3HR9A 2BNMA 2CGOA 4MZUA 1QXPA 1C3HA 3PJYA 3AYCA 4RGKA 5LRSA 5J48A 1UYPA 5C9AC 1OMIA 5IVEA 3OTFA 2QQKA 3SCHA 3I2IA 1VBA1 1STMA 4MGIE 3MIBA 1XU1A 4SBVA 2VY0A 3RI9A 4H7LA 4IE5A 4QXCA 4UFIA 5FMCA 3I2KA 5IATA 3DN7A 2A3XA 2W94A 4EN9B 3A22A 4FAGA 4DRRA 1ND2C 2OVUA 1UYZA 3WCRA 3C7GA 5FBJA 3A23A 5F2WA 2TNFA 4NMIA 4CUBA 1D0HA 4RS5A 4DQAA 3VBUC 2FCTA 2OW4A 3WNOA 3RZZA 2EXHA 5I8TA 5CNAA 4FT8A 1O8PA 3B5LB 4D3WA 1RIRA 5T54A 5C8CA 4RFT0 4NIHA 3TN92 3MO4A 5FZLA 2R6QA 1XXNA 2VZ3A 4OQ8A 3OPZA 4D94A 1W9YA 3LA7A 2R0HA 3KV5A 4XBNA 5I8YA 4XFBA 1SFPA 1JMUB 2ZX2A 4OCTA 3FHAA 2BVBA 1H4HA 4QXBA 4UFJA 3ETQA 2ZX0A 1E5HA 1SBDA 5FKBA 4WZCA 1XNDA 2QQOA 4I3GA 3LF7A 3VBHC 1UYXA 3N4MA 2RR11 1BBT3 2RV9A 5FZ8A 1QJX1 1CX1A 1VALA 1PK6C 1V6OA 4P02B 5L7OA 2F4LA 1V6IA 1L7QA 4S2GA 3B7MA 4QQ2A 4LPLA 1J58A 4GIQA 3H3LA 3ZSEA 1ENQA 2VQAA 4RD7A 2ARAA 3ZFFC 2ET7A 2B9VA 2WN2A 4EN6B 1WWYA 3IAQA 3UJOA 1I5PA 4FQZA 2PAEA 4Y1YA 4XBQA 2SLIA 4YPJA 5EHDA 5HCAA 2CDOA 1TNFA 1SQ4A 4GB33 4XXAA 3G6JB 3SH5A 4GALA 5FPBA 5LA9A 1DQ4A 5FZDA 1QOOA 4H7MA 3UJQA 4XUPA 3VBSA 5IVCA 2VOKA 4AHXA 2QJVA 3EO6A 3TEYA 4IEZA 2GP3A 3WF2A 4W65A 2BBVA 1R1A3 2ORXA 3Q8FA 1MVQA 3BGAA 4PLNA 3VKOA 1G7YA 3Q9OA 3O1PA 2G9ZA 1CN1A 2VAUA 5A3MA 4NRMA 5F6KA 1VRH3 5C3PA 5H9SA 4TTGA 1WCKA 2W68A 2D3PA 4MO3M 3KLSA 3W20A 3CL1A 4B1LA 1BBT2 4CCJA 1CPMA 1IGOA 3CNAA 3RMYA 2W1SA 5CFCB 1VRH1 1S0BA 2H6CA 3BU0A 2FCVA 4RS5B 3WF1A 1W6OB 2C9AA 3POBA 3H9AA 3CJXA 1Q56A 5BNNA 1NCQA 4XQDA 5C8CB 5BPXA 3WT3A 2A7AA 3MW4A 4N53C 4CDUC 4CUAA 1C57A 1OI6A 4E8DA 3ON7A 3U14A 2R042 4NWWA 2HWC1 3ZN5A 2DCJA 3K2OA 4EN0A 4GB32 4W4ZA 5FUNA 5FY4A 4ONUA 2XJRA 5FMOL 5FY9A 5IFPA 2CV6A 2XKPA 1IPJA 1D4M2 5JMOA 1ZZ8A 1OPMA 3BOWA 4YRDA 5T5JA 4HPKA 3FC0A 3ZYRA 2WL1A 5LRRA 3D6EA 5BYNA 3O12A 4AOCA 2HWD2 4LKFA 1MACA 3QOPA 2JEMA 1S2EA 1RUD2 2JG8C 1H9WA 2F4PA 3AP6A 4BQWA 3B9IA 1J83A 1R1A2 3NV4A 5IW0A 2BNOA 2X8KA 3GALA 3N9QA 1O4ZA 5EXOA 1HB2A 1ULGA 4QPGC 3ZMOA 4CA9A 3ZXFA 2PAKA 2CY6A 5L7OB 3N9PA 3I4IA 4PBOA 4OULA 3NKGA 4DINB 3RZHA 1RVF3 2JDNA 4C1WA 4Z07A 2VNVA 1A78A 1UY1A 5JVVA 2Q30A 2OXBA 2YU1A 5IAXA 1UAIA 2JIJA 2Z2SB 4HVQA 1RUF1 4NRPA 1RUE3 5FYVA 1UZZA 2JDZA 4EN8B 4CXXA 3NJYA 2MEV3 4HVRA 2RM23 1U5ZA 2WNEA 1V00A 2G4IA 5IWFA 2FMDA 2BPA2 3VBSB 4FPCA 3POGA 2MEV1 4OQ9A 2RM21 4TWTA 1OFSA 1VR3A 2R32A 3NVCA 4P00B 4QM9A 1COV1 3AL6A 3OPTA 4LLFA 1W8UA 3RMXA 3EJKA 2XB6C 1F5FA 3L2YA 1LKNA 2ZHLA 1DP0A 1OLQA 4Q0QA 1R1ZA 3N7LA 4L2NA 5FP8A 3S6PA 4BOWA 4Q4Y2 1HRI3 3AVSA 4Q4V3 3VKFC 3VBRC 4C8DA 5IVJA 5DAVA 3APBA 3HT1A 3E6DA 3ZXKA 4F3JA 2VOTA 5KHKA 2WQ8A 3VN4A 1Y43B 1DQ2A 1L3JA 4Q4V1 1W05A 1W04A 2JDHA 1ZRIA 3L2HA 1PNGA 1UXZA 2J1TA 1RVF2 3OUHA 5BNQA 4IE6A 2O0OA 2WFF1 5JUVA 1W3XA 4OLLA 2ZHNA 2XJTA 3C7EA 5JXIA 5BNNB 3WVJA 1NCQB 2X5IA 1GSLA 4BH9A 2D40A 1Q43A 4FP3A 2WABA 1RUE2 1LECA 3TAYA 2WNUA 4XMIA 5FZ4A 1SEFA 5GKAC 3I2GA 4EYUA 1HQNA 4EQVA 5L19A 5LATA 1BVP1 3WZ1A 1JYNA 2W1UA 4BK5A 4Y4RA 5FCCA 1VBC2 4HPKB 1YFUA 4NHXA 5HXVA 2RS12 1ZBE3 3THCA 4Y5TA 1Z7S3 5HCBA 5SV5A 2WA3A 4EZ4A 4KGGA 2P6HA 3NV1A 3ECQA 4JV4A 4BJ0A 1OQEA 3TEWA 4AVAA 3ZLIA 1GNZA 1ZBE1 2WO7A 1S0JA 1PX4A 3CMGA 5B2GB 3PU8A 2VUDA 4XF9A 3BIEA 4PBPA 4DUVA 4L92A 4WM8C 3OEBA 5FYUA 1HRI2 1RHI3 5T5LA 1LOBA 1FX5A 2C24A 3T3YA 1LU2A 1AYM1 1UOJA 2ZS6B 3FBYA 4DXRA 1AYN3 3ZX7A 4RL7A 4DFSA 2D43A 5JPMB 4D69A 2VBDA 3WDUA 1RUG1 1PMJX 3FN9A 1EAH2 2EVXA 3POYA 3RG0A 4HK9A 3JCIA 5J36A 1KQRA 2EXIA 1RUH1 2VU9A 4XABA 4K20A 3WG2A 4CE8A 4CRQA 2W5FA 4R4ZA 1QJY3 1I5ZA 2PHLA 1ASJ3 1VIWB 4S2HA 5A3OA 2Z79A 3DGTA 4QKNA 3WF4A 4C91A 5JAXA 4XYXA 5LA2A 1M4WA 4I02A 3AC0A 3FX3A 1Q5OA 1QQP1 2GNBA 5F5IA 5FY8A 4Q8KA 2HWB1 1ASJ1 3LGRA 4P9GA 4Y33A 2P17A 2VW2A 1OXCA 3B01A 1MZFA 1POV1 5ERLA 2O1QA 4LO4B 3THTA 1Z7S2 3BIWE 4RSUA 4XF1A 1PO11 4AE2A 1LOFC 1WMEA 3NMBA 2E53A 3MF6A 3UL2A 3LFIA 4YZ4A 2ETEA 5C8WA 3U78A 1X33A 2RJLA 2VZQA 4HMZA 5FYTA 4NVPA 2ET1A 1C8M3 3DF0A 4ARYA 1MZ6A 2JG9C 3A21A 1WMFA 3KVAA 3PIJA 1LOAA 3F95A 1RHI2 4E2GA 1MS8A 1UIKA 1CWPA 2DUOA 4BQ1A 3VD9A 1VMJA 1C8M1 1AYN2 1X36A 4QB2A 1D2SA 1SFNA 4MUVA 1F9KA 3SNMA 3KV9A 2X5IB 5JOWA 1RMU3 4Y22A 2ZEZA 1LTEA 4OVEA 5BXXA 4EV0A 2WNUB 3JD73 4QDQA 5CBLA 3ZPOA 2ZEXA 3MICA 2PFWA 1IS4A 1QJY2 1EUTA 1RMU1 1UMIA 3N36A 2NQYA 4RS5C 1X9PA 4HL0A 4UOJA 4GXLA 1X7NA 2Q4SA 3POIA 1W2AX 4NPRA 1KEXA 3VZJA 4GMP3 2XVLA 5FP4A 3ZYJB 4AVSA 1ZM1A 1F4AA 2BQPA 5C8CC 1XC6A 4M4RA 3N9MA 2VOWA 4EE2A 2A1XA 4QGNA 2TUNA 5A3UA 1ZBA2 1VB4A 4LORA 3CF6E 1JN2P 1GQGA 2EICA 3KS7A 1GQPA 1JZ8A 1NZCA 3W21A 4AR2A 1IPKA 1EPWA 1AR93 3GBFA 2AGSA 1PGSA 5LK5A 3NAPC 1RUI1 3U07A 1C1LA 1W9WA 2QFEA 1W6MA 2J22A 4ZS2A 4AFAA 3MV11 2XUMA 4ZU7A 1EV12 1V6JA 5JCTA 4ITCA 5FO7B 5L7OC 3H7JA 1SPPB 4BQ3A 3QH7A 4KH9A 3E5XA 1PO23 3QBQA 3R0RA 3JD72 2VC9A 1BEV3 2FHRA 3SISA 4D7TA 3JXSA 3J7NA 1BHGA 1UU4A 2VJXA 3HEIA 3IMNA 5JSPA 2VL4A 4ZZ5A 5GLUA 1PO21 1R64A 1BMV2 1WW4A 4Y1VA 1BEV1 3BOPA 3X29B 4MV2A 3ORJA 3IB3A 2XBO3 3A4UA 4XZPA 5FOBB 5LASA 3AFGA 3M4FA 4XTPA 1K5MC 1YUDA 3H3ZA 4XILA 4HT1T 3EMRA 4CCMA 5FYYA 3VBSC 2D98A 4DNYA 3IKWA 4Y1XA 2YPJA 4NIDA 1UPSA 1GZCA 2XBO1 1N1YA 1FOD3 1H4GA 1Y7BA 2RDSA 4Y3OA 2XPJA 2C6SA 5FZOA 3VDAA 1YEWA 1E5IA 1OFNA 2PHRA 3CEWA 2ZPXA 4Y5Z0 2Y6KA 5FXWA 3WF0A 2WFPA 4DEQA 1W2OA 3VD4A 1E57A 1KFUL 1LHNA 5E89A 4ZHNA 2RMU2 1AR92 1J84A 3LB9A 2DTYA 4FPKA 4R9DA 4Y22B 5JR2A 4HVOA 2WT1A 4AK3A 4JGZC 1IQAA 3WY6A 3B00A 1J3PA 2E7TA 1OA2A 1UYYA 4CDQC 3OGSA 4Q4W1 4Z2AA 4CCLA 2DCTA 2Z5WA 4FP2A 3TRSB 1NCQC 3WNPA 3KHBA 3ZXLA 3GZEA 1CAUA 4O7XA 1AR83 1MZEA 4Q0VA 1TVGA 1AL0G 1GICA 4LKSA 2UWCA 4A3ZA 4BK4A 3T4HB 1QJU3 1ZZ6A 3I8TA 4H2AA 1NQDA 5JI7A 1AR81 2QTWB 4RGGA 4IEXA 4HG6B 2GZWA 5JSRA 3ES1A 5A6QA 1FOD2 3T1MA 3AZWA 1UF2C 3RWKX 4AVBA 4G3YC 3HBZA 4MGYE 4AF9A 5G05L 3AX4A 2UWBA 4ZXKA 3M3QA 5ACA1 4WM7A 1W6MB 5BUVA 1QHDA 2GMPA 2ZXQA 4QQOA 4FTBA 1WCSA 2ZA9A 4RHV1 5JI9A 3O1MA 3MW2A 4CP9A 4P5HA 1ALYA 4MADA 5LK7B 4OYUA 4GMP0 4HETA 3RYKA 1ND3A 4PLMA 1OBNA 4M3CF 4YVWC 3ST7A 1W6NA 2CDPA 4YLZA 3LWCA 5HCHA 4QX3A 1EP0A 5ANQA 1T6GC 4UT5A 3D8CA 3HNYM 3VB9A 2XJSA 2XL9A 1XJAA 2X10A 3ZDSA 5A1LA 5FZOB 4QU2A 2QQVA 1QJU2 2RHPA 3KQ4B 1Y4WA 4BM8A 4L99A 5GZCA 1C8NA 1GNYA 5FMBA 3MGUA 2QQJA 2RDNA 2E63A 3HPNA 1P8JA 2I74A 4R8HA 3DEMA 4L97A 4XPVA 4XC9A 5A6ZA 3WQ0A 4P9LA 5FTTC 2A6YA 5FPZA 1G6NA 4IE7A 2ARCA 4MXVA 2K0GA 2NPIA 1X50A 5JPNB 3LSEA 4A45A 1CQ9A 1V6KA 1YO8A 5JDBA 4NJ4A 3UESA 2GNMA 4QAWA 1I3HA 2JB4A 2P6CA 5FY1A 1AR73 2QVSB 5FUPA 3ZKYA 4B7KA 3D0SA 4MLOA 1JOBA 4IW3A 1CJPA 1LOGA 4LBJA 5F6LB 1R091 3LOIA 1NT0A 5J98B 1CAUB 3OPWA 3WOGA 4YARA 1NA1A 1V6NA 2HWF2 5LEJA 5EZWA 4E2SA 3W5NA 3LEMA 1W8FA 4A7YA 3AMQA 4I3PA 4XF3A 1GLHA 5FYHA 3WDTA 4DPNA 1QJEA 3B93A 2VH9A 5FZ3A 4AW7A 4YM3A 2VMHA 3NQHA 2VNRA 3K48A 1S55A 3J8F1 4CUGA 2FMYA 2MPFA 5BV6A 3I7DA 1XNCA 3GF6A 3ZN4A 2V72A 3H42B 4WM7B 4YW7A 4QX8A 2LALA 3AZXA 1OA3A 1W2NA 3WP4A 5E6HA 4BQXA 5FMDA 2W0XA 4LHKA 1QJZA 1VPHA 1YQ2A 4CP9B 2ZJCA 2PHUA 1ENSA 3JBG3 2WNVA 5ABJA 2ZMNA 3J7HA 1FMD3 4FOQA 1F2NA 4K21A 3W58A 2BWCA 2H6BA 4CU8A 1ND3B 4N9HA 1RXFA 3RPQA 3U75A 3N9LA 1H6YA 1AR72 3GJAA 3JBG1 3HVDA 1MPXA 4BWOA 4CYDA 4E4SA 1CR7A 2Y8KA 4DZGA 1U5IA 3MYXA 1IZ3A 1W6NB 4W50A 4NN0A 3KQRA 1WMXA 3AB0A 1YIPA 3PVBB 3BALA 1PHMA 1S0IA 2Q5TA 5FZMA 5J09A 1W0OA 4ZZ8A 1IQDC 1UOBA 2B45X 2Y0OA 2P34A 4AXOA 1R081 1S2BA 4LNVA 3FFQA 1JU3A 2VVDA 3WNKA 3IZOA 3MIHA 4KU7A 1L7LA 2JB8A 3PUQA 2JXAA 3CZUA 2Y64A 3CU7A 1JI6A 2LRPA 3DPRB 3ACIA 4COUA 2WZR3 2IUWA 1IG3A 5DG2A 2RE9A 5FWJA 3ILFA 2P5BA 5FBZA 4AHWA 2VULA 3ZYIB 3D82A 2ID4A 4FFIA 2WO2A 5KHGA 5FUIA 4E9KA 4FQ4A 1JZ4A 4RR3C 1FMD2 2P1BA 4UW6A 5F5CA 4XCAA 5I93A 1O3TA 1WLDA 3AP4A 4GWJA 1NXD1 2B7YA 4BLJA 4Z92B 1NA1B 5F8PA 4NO4A 1SLBA 3HD8B 4YM0A 4CP0A 1CPNA 5JXHA 1DGWA 1LENA 3FJSA 3OB8A 4K7JA 4META 2CL2A 4XIKA 3B02A 4YGBA 5T52A 4WVWA 1FT9A 3MIFA 4UYBA 1AZDA 4IQPA 1OLRA 3VHPA 2PAMA 4PT6A 5EQUA 3WDXA 1CONA 1NE6A 2WZPP 3VZNA 4YG6A 4HN0A 4PLOA 4QPIA 1LODA 5A80A 4AG4A 5DUXA 2UWAA 3LIGA 1DDLA 1YYNA 5AC91 2ATFA 3LDBA 2WC2A 4LO8A 4CEWA 3S7EA 1W9SA 4WVZA 1H6XA 1NYWA 4QQHA 4MSVA 3B3QE 3MFAA 4QD2A 4LXLA 2QNKA 4Z2WA 1G9FA 4CU9A 3WG1A 2WZR2 5M0TA 2WNVB 5FJHA 2Y6JA 4ASKA 5IK4A 5FK7A 1KDMA 1V9U1 3S7IA 2VTXA 2R49A 4EWAA 2GH8A 1CZTA 4JDOA 1RUOA 4ZU4A 3CBNA 1W9TA 2W08A 1HJFA 4YW1A 1Q3EA 3AJZA 3F2ZA 1AJOA 5FYSA 2PLV1 4QHOA 4CVUA 2Q1FA 3Q8EA 2GU9A 2DU1A 2G9FA 4CCDA 5A32A 2P37A 3QH6A 3AK0A 4A7KA 4Q5OA 2JDMA 4D7SA 1NY71 2SBAA 1NKGA 3C7OA 1TQ5A 4PIXA 2R063 1PMHX 4XF0A 1HRV3 1N1SA 1VBA3 1JOPA 1HW5A 1PZ9A 1XE0A 2JDUA 3ABZA 1B09A 3TYJA 4CTEA 1QJFA 4V2VA 2WS92 2R061 3BN6A 4KI5M 1HRV1 1W28A 1W6PA 4AYUA 4QB6A 2C4XA 3OBRA 2E31A 4AAPA 1H0BA 3K46A 3NJZA 4HBNA 5F5AA 3I59A 4MYEA 4XETA 5D21A 4JTOA 5CFCA 5FOJB 1DF0A 5CG8A 2HLEA 4OMCA 2IWGB 1GOFA 1UWWA 4NIAA 4YW6A 1H1MA 5HPOA 4Q27A 1W6OA 1SLAA 1PGL1 4YSFA 4OI0A 3DV8A 4QDSA 5IHRA 3ASIA 4IV3C 4M3CE 1F5JA 4V1PA 5FZKA 3SH3A 5DUVA 1O8SA 1K45A 4QPIB 3AP9A 1MS3A 1POQA 1UZVA 4HKWA 3NSTA 3N9NA 5CKNA 1WD3A 4L9BA 3UETA 3S0MA 2QQLA 2H0VA 3O5SA 4CEWB 4LT5A 3V64A 1VJ2A 3VDCA 2YGMA 1W8WA 4YGEA 2XQRA 2RR13 5I0RA 1QJX3 4Y26A 1C5IA 4AEMA 4MGKE 3UGGA 4MXWA 4CU7A 1XRUA 1NCRC 5IK8A 3H1YA 3U11A 3PNAA 3OGGA 3KZ4C 3VL9A 1OH3A 4XF4A 5DDJ1 2Z42A 2IXCA 4QKBA 5JOYA 5K7PA 5FZIA 4WM7C 3ACHA 3ME2A 1ULDA 1DCSA 3LEKA 2FDFA 2Y6HA 3V0BA 2Y33A 5FXVA 1G9BA 4X6QB 5LB6A 2WUHA 5FXZA 4CCNA 1SBEA 4YZ2A 1V6MA 4X8PA 4LBKA 2VD7A 3T09A 2X05A 2MNGA 3MLJA 4Q1RA 4OHZA 2FZ2A 2D3RA 2UY8A 3G7DA 1ND3C 3KSCA 4IEOA 3RYRA 2HWE3 5A32B 3WDYA 2YU2A 3CIHA 2YG0A 3UNPA 3V0AA 3VGIA 4HZFA 2JE9A 4YM1A 4G9SB 1IOAA 1CX4A 1W2TA 3SXWA 1RYYA 2AREA 2HWE1 2YC2A 4NIIA 1H2LA 4XDOA 3HIFA 4KG0A 5DN2A 2RR12 1YFWA 4BE3A 4WVVA 5LBEA 1QJX2 4LOSA 4Z8BA 3AKTA 3Q8CA 1W6PB 3EYPA 3H1MA 3VBOC 2JWPA 5HCFA 4CDXA 1X9TA 1TG7A 4D7YA 3RFRA 3I59B 5JIAA 1YFYA 3T0DA 2A3YA 4NE9A 4EZHA 4A6OA 4JGYA 1LAJA 3WHTA 4DY5A 2V4AA 4M3CB 3NKTA 2BP6A 3JQWA 1XYOA 3QLQA 5EPAA 3WP3A 1VP6A 2DVFA 2HWC3 2PHFA 3C3VA 3WX5A 2BTVC 3HN3A 1LGBA 4LQRA 4I0BA 3PUIA 2OPWA 4BQ4A 5HBAA 4R9CA 5CKMA 2DVDA 2QCSB 1TME1 5C4WC 3RNSA 4YG3A 5K8SA 1VBB3 2X09A 4QGLA 3IM0A 3IN9A 4AGVA 1REDA 5BY5A 1CAVA 5FWEA 2A71A 2ZEWA 2OQ6A 3MI8A 5ANNA 5FK8A 4JAAA 1VBB1 4WV8A 1RUJ1 4NPMA 2JDPA 2CGPA 3KWVA 4MXWB 3FLTA 5C70A 1AR63 3NL1A 1ZRFA 3UKNA 1D0GA 4UFMA 4QB1A 4LLOA 3VUOA 1ODMA 2G9GA 5KXDA 4ZS3A 2NP0A 1AR61 1BQPA 1VRH2 3I2JA 1QMJA 2W1WA 2WWJA 3CLPA 3LEGA 4PDWA 1PIV1 2HH9A 1RUF3 4AI2A 2VQ0A 3V0BB 1S2KA 3C8XA 2IFWA 4IETA 1JYCA 5DQ0A 2WWSA 3OG2A 3WW3A 3DL3A 1B35C 4NHKA 4OUEA 1GP4A 3HJRA 2DVBA 4J1WA 2A6WA 5BNOC 5BNPA 5JMCA 1O5LA 2RDQA 5KXBA 3I3DA 3WQ1A 1LRHA 1WCQA 4TLGA 4XFAA 1LESA 5ABJC 1XQNA 2WLQA 2HWC2 5T3NA 2YGLA 3WV6A 2ZX3A 1COV3 2EAAA 3V0AB
chains in the Genus database with same CATH topology
1QKQA 4P14A 4Q4Y1 2BFUS 1KDKA 3R4UA 2AH2A 1HQLA 1J1LA 1W2UA 4A7ZA 3MIDA 1ZA4A 3MPPG 5GLWA 1DZTA 2BGCA 5FREA 1GR3A 1VBE3 3AXEA 1PMIA 2LUWA 4CDXB 5KXEA 1IS6A 2HEVF 2WA4A 5H9QA 3J4UH 2I07B 4OI1A 4XJ8A 5GJ6A 4FTEA 5K9YA 1ZYBA 4EWDA 2BWAA 1HKDA 4PCRA 4XE9A 2WFF3 1VBE1 1HDKA 4JGYB 2VUAA 2GC3A 3U10A 3GZAA 1CAXA 1RUF2 2WLPA 1J3RA 1DZQA 1KD7A 3U4XA 2OUHA 3SHRA 5GM0A 2X29A 3USUA 3RQ0A 1I9RA 1G8WA 1KS4A 3TNPB 1IS3A 2MEV2 2RM22 4JQRA 1FNZA 2JICA 1CAVB 3A0NA 3NWKA 5CU1A 2ILMA 1KRIA 4Z82A 4N9IA 3O14A 4L8QA 1HX6A 1AYM3 4RA0A 2CNAA 4Q4V2 2TEPA 1NXMA 4PDWB 3KMHA 1RUG3 4Q0UA 3T1LA 2BEOA 4YZ3A 1RUH3 2WFF2 1SLLA 3R4DB 2HEYF 1HV0A 5EYXA 5BV6A 1URXA 4P9IA 5BNPB 5JLVA 5E16A 3KT7A 1KFXL 1G9AA 2GC1A 3OGJA 1QQP3 2E7QA 2VNGA 1G86A 2HWB3 4MX3A 1UN1A 3THPA 2ZGKA 1SFYA 4DXZA 4FAHA 1AUYA 3RJ2X 1POV3 3SH4A 2ZABA 3DUIA 1PO13 4IEWA 1RUC3 4Y24A 1TE1B 1GQHA 4IL7A 5FO9B 1ZBE2 1SCRA 4BA6A 2PYTA 1RUC1 1XU2A 2DTWA 4R52A 1AYM2 1SDWA 2PHXA 3ZFGB 2CTVA 3E6BA 4NHMA 1CAXB 1RUG2 4XJAA 4Y1UA 3GBGA 4B29A 3N7KA 4BIOA 4CZSA 1YCIA 4DOUA 2QDRA 3USUB 5EV7A 5CFCC 1ZZCA 1QQP2 1GFF2 3RI8A 4LBNA 2GN3A 4FXKB 2HWB2 1H8TA 3BU7A 1ASJ2 2CWSA 4N43B 4EROA 1GBGA 4CEYA 3B69A 3H3UA 4I30A 5KHJA 1NLRA 2ZCWA 1WW5A 4LBQD 1PO12 5I0TA 1PNFA 3AM2A 1QXRA 1N3OA 1SLTA 2ERFA 3IDBB 4XMAA 5I0UA 1XYNA 1H2NA 1SACA 4H14A 3E6CC 1WW6A 3IWZA 3VDDA 3GYDA 4R9BA 1RUI3 2PHTA 3AP5A 2UU8A 3WR0A 1SMVA 1C8M2 2YROA 2KM2A 4FPOB 1XYPA 1N3QA 3IBMA 4P9JA 4RQPA 3KCXA 3JU9A 1RC6A 3LA2A 3H7YA 4QM8A 4AHZA 1YXWA 5IUQA 1JBCA 1F31A 4I09A 4G4FA 1RMU2 1X82A 2ARXA 1AJKA 2PQQA 1VLNA 1YLLA 2YHJA 2XJUA 4COYA 4C0HA 2XL7A 3GBWA 1PVC3 3GZTB 4LBQA 1WBLA 1UKRA 2PN5A 2AUYA 3ROUA 4ZU5A 1PVC1 2DV9A 4CDWA 2XVGA 4LULA 3WHUA 3CJIB 4ASLA 1CAWA 3SCGA 3DKWA 1CJDA 3POWA 2E7AA 3H0OA 3ZFEA 4BYYA 2ZTNA 1RJ8A 2NYYA 1RUI2 2WT0A 1TEIA 2YV8A 1QOTA 4YW5A 1ULCA 1KJLA 4IV1A 3TWIA 2VGDA 1QU0A 2V5YA 2DVAA 3AKQA 4QXKA 1U5YA 4Q4W3 3KB5A 3ZSJA 2WJSA 1ZZ7A 1H8TB 1OD5A 1UZYA 1POV0 5C9AA 3VBFA 1PO22 2A6ZA 4CEYB 1BEV2 3IT8A 2VVEA 1VBD3 1GKBA 1KITA 5BNNC 2DFCA 4OI4A 4P9XA 2IXLA 3WLUA 4NWVA 2H0BA 3ZYGA 4AGRA 2EAKA 3VHNA 1MEC1 1VBD1 3BB6A 3AKSA 2XBO2 2HEWF 3MIEA 4C1XA 2K9ZA 1DG6A 1J3QA 5AVPA 3VDDB 1Y9QA 2B8MA 3AYEA 5ACA3 1ZX5A 4YFZA 5C6CA 3ATGA 2EIGA 4RQPB 1DGWX 2ES3A 2ZGRA 4Q4X1 4RHV3 2YZ4A 1IKPA 4DMIA 2R16A 3IDCB 3RSJA 1JH5A 2RJKA 4OHVA 3OBTA 4PDWC 5FAXA 2B9UA 5GZDA 4Q4W2 2VNOA 4GQ7A 4AEDB 3FE5A 4FPGA 3VBHA 4EJRA 2RS51 4BCUA 2C5DA 1YJLA 4LBQB 1PVXA 1AF9A 3VZKA 4WBBA 1OPOA 2D97A 3TNQA 4JTNA 2OA2A 4CDWB 5IK8A 2ZGSA 4K1ZA 4DS0A 5L36A 1CAWB 1JHNA 4FSJA 2OPKA 1AR82 1VB2A 4QMAA 1CIWA 1PGW1 3N35A 2GSYA 2AYHA 3NV3A 2GAUA 1BXHA 2RS33 3ZFEB 1UU5A 1SCSA 4NR1A 5CADA 2XWJB 1AL21 1NE4A 4FOWA 2WSUA 2RS31 4IV1B 3AKPA 3FZ3A 1U5XA 3MFCA 4RHV2 3DPRA 4IEYA 2XH6A 1IHMA 2NM1A 1BYHA 2DU0A 4Q1PA 4GA9A 4AI8A 1A8MA 4WZFA 4AFDA 1R093 1AXKA 5C9AB 3VBFB 2X5IC 4M00A 3ILNA 1SLCA 2WNUC 1FPN1 2DVGA 4BMEA 1VAVA 4E27A 3WW4A 1TMF3 3GHMA 1ND2B 4I0WB 3M7AA 1KXGA 3SCFA 3VBUB 3J8F3 4FTSA 3OF1A 4KU8A 5HI0A 1JUIA 4W6YA 1DFQA 1TMF1 3FBMA 1YJKA 4PF5A 2GALA 2PTMA 3AMPA 3RWNA 4AQSA 4N53A 1A6CA 1UX6A 2D6NA 4CDUA 2R073 1KJRA 2EALA 3MF9A 3R05A 3FLPA 1WMDA 2R071 4LO5B 1JXNA 5EJ3A 5CB7A 4N90A 2WT2A 1GZWA 5DG1A 2JG8A 3VBHB 5F5QA 3MEPA 4N7UA 1R092 1OQDA 1O4YA 4Y20A 1X8EA 2QE3A 4GH4A 1FV2A 2XHKA 2C0ZA 2DCZA 4U2AA 3WUCA 3MPBA 1C28A 1J59A 5GALA 5AFBA 1ZRDA 1CVNA 3O7OA 4F83A 3O0VA 1R083 5AFEA 4LBMA 4YFWA 2JE7A 1VAMA 3ZXAC 2F6BA 3J8F2 3ZVXA 5T5PA 3O0XA 1RINA 3ZMNA 4OHXA 3KT4A 1MQTA 2YDEA 3JUUA 3KM5A 1CESA 3K51A 1BJQA 3WXPA 2ARBA 1O91A 3HT2A 2XVKA 1W6QA 2VPVA 4ORFA 2JECA 4JRLA 5T5OA 1DHKB 3BCWA 3JBG2 2D6MA 1YIFA 3M8LA 1UL9A 2LM3A 3M2MA 1S0EA 3VBRA 5JZGA 3JB8A 3ELNA 1RUNA 1YFXA 3RDIA 4FPFA 5CA6A 1ZZ9A 1H2MA 1DGLA 5AC93 1O3RA 1A3KA 2DURA 4CEYC 3QCWA 5KWRA 4KWKA 3R4SA 1R082 4WVMA 5LEKA 3ZXJA 3L9JT 2ZGMA 1APNA 3ZXEA 4N53B 4CDUB 2PHDA 4YM2A 3D5OA 2P3KA 3SITA 3MLKA 3GNEA 1Q8PA 2O8QA 1LEDA 3VKMA 1SBFA 2R30A 3VZLA 1UPIA 1QH6A 1S0GA 4R9AA 3OD0A 3QACA 4LO6B 1EPZA 4YZ5A 3U0ZA 3MLLA 2YXSA 3AYDA 1V9U3 3RJRA 2ZGPA 1GZWB 2JG8B 4RQPC 1AVBA 2W39A 2D6LX 3VHRA 1XE8A 3ZSMA 2R1DA 2XLAA 4Y20B 4GH4B 3WD5A 1HXS1 4QPGB 4WM8A 2PLV3 2JENA 1W0PA 4K1YA 4LA2A 3ZO0B 1JUHA 2JJ6A 2YUEA 5JOXA 1YNAA 5FQ0A 2GDFA 1X8MA 1V70A 5AC92 4XQWA 4AQTA 3KCYA 1N47A 1OOPA 3HWJA 4XHXA 2VUJA 3MZHA 1MQTB 3MW3A 1LHWA 1HIXA 2QQPA 1YHFA 2GN7A 2W52A 1LU1A 3AZZA 3M1HA 2GH2A 3O0WA 2OYZA 2HYKA 1QOSA 4AVTA 2FBEA 1W6QB 1CD3G 1ZREA 4YZ1A 2B39A 1V9U2 1KS5A 4QX5A 4XEZA 3TN91 1AX0A 1EYBA 5FLJA 3FHIB 4QT6A 3AYAA 3VBRB 5JZGB 4MGZE 1DQ0A 4M3CA 1O3QA 2DUPA 1NQJA 4AEKA 2JG9A 2YYOA 4AI1A 4U36A 2PLV2 4KL1A 1Q8SA 3VBFC 3ZXDA 2DCKA 2OIIA 3PLQA 2QKDA 4WVMB 4E2QA 1NY72 3PTYA 2A73B 2NMOA 4X6RB 5DUWA 1OHFA 1LHOA 4XW3A 2ZAAA 1LCLA 3FUQA 2UURA 3ES4A 2XJVA 2Z69A 3BTAA 2R062 2ZX4A 5DDJ3 1DQ5A 1HRV2 1VBA2 2IXKA 4B7EA 5GZFA 2CWMA 4JVAA 1FV3A 3ENRA 2WKKA 1U0AA 3JB4C 2XGXA 1WW7A 2EXKA 4WM8B 4GWMA 1PGL2 4PQ9A 2IXIA 2Y26A 5FRAA 4Q26A 1M06G 1DGRN 3UV9A 1AXYA 3FLRA 3IPVA 3TB0A 1N1TA 4S2FA 5FQ0B 1J1TA 1RGSA 2B42B 3NAPA 1OQ1A 4ES8A 1C1FA 1QH7A 5JOZA 2ZGTA 1OOPB 1WLCA 5EYYA 1BBT1 1MS9A 3PMEA 3WUDA 4K8FA 4XFHA 4QQLA 3FUOA 1REFA 5K0UA 1LGCA 2C1FA 5DDJ2 1YWKA 4LBLA 2R043 3VLBB 1DLLA 4B8EA 4IEUA 1CGPA 4XJWA 3ZIWA 1D4M3 4LO7A 4XFGA 1K5MA 4Q0SA 2R041 4H55A 3DPRC 1FATA 4GB31 4AFMA 1DQ6A 1HLCA 1Y3TA 4HKLA 3VZOA 2HWD3 3WG4A 1D4M1 1TME3 4YYOA 1DU3D 2JG9B 1OSGA 1RUD3 2VW1A 4LEJA 5F1RA 5F9TA 2JD4A 3PVEA 1WUVA 2KA3A 1MS4A 2HWD1 3HN1A 1FNYA 5D1IA 1RUD1 2WQ4A 3V65A 4I2OA 1RUJ3 1R1A1 2XLFA 4XIOA 1NA1C 5FLIA 5FMOS 3EQEA 2HWE2 2VECA 3AP7A 4JGZA 1ZNPA 2VMGA 1D4VB 2D5HA 3WDWA 2BVVA 2ZHKA 4R4XA 2IFRA 4ISRA 4K9SA 4Q2FA 4JRAA 4L11A 4CDQA 1PM7A 2D5FA 3AFKA 1QF3A 2V73A 4ES9A 1EY2A 1RL3A 1PIV3 3HAGA 2VW0A 1IKQA 2PHWA 1GYKA 2ZACA 2WQZC 1HQWA 4EN7B 1JOJA 1SLIA 2VXRA 4EWEA 3T2TA 3P3PA 3WP6A 3E5UA 4AFBA 2WNVC 4F7ZA 4Y4YA 1TME2 3IPVB 4OUMA 2Q1MA 4Q4Y3 5FDBA 3ZXGA 1QWRA 2IZWA 5GLVA 3NAPB 4E4DX 3BPZA 5CAZA 4GH4C 5JSOA 3LKJA 2GMMA 4AEJA 1H30A 2D93A 3EXUA 1VBB2 1RUJ2 1YI7A 3RS6A 5AVAA 1QGLA 4KBBA 3IDEA 4FVVA 3EBRA 3LCPA 1Z0HA 2OUJA 2D7FA 2QZ3A 4HK8A 3ZSKA 4HFSA 5K0UB 1RVF1 3PVOA 1UKGA 1AR62 2B5HA 3SMHA 1MS5A 1PIV2 4YVWA 3GHNA 4HSJA 1MQTC 1K5MB 1RUE1 1VBC3 3GZUC 3ZFGA 2AZ5A 1WLWA 4XFIA 2BW8A 2E9QA 4A2UA 2BFUL 2RS13 3AJYA 1VBC1 4IEQA 4KGQA 5DZFA 1AX1A 2RS11 1AHSA 4GKXA 5T55A 4NHLA 3INAA 5IK5A 3LOBA 4OUSA 4KQ7A 1VAKA 3ILRA 5JZGC 1FXZA 2A70A 1ZRRA 1O4TA 3KT1A 1COV2 4JGZB 2ZGUA 2ZX1A 2IXJA 4N43A 4W6WA 1HRI1 2GMEA 3M3CA 1EAH3 3I54A 3I2DA 3NV2A 1YI9A 3WINE 4TZDA 4CDQB 1I6XA 4LBOA 3N7MA 5DZGA 1H1AA 4QPIC 2PA7A 1QNWA 1EAH1 3AMHA 3UK9A 1VBE2 1S1AA 4PIYA 4CEWC 1GNHA 5KXCA 5CIRA 1XNKA 2BUKA 5KC6A 4ASMB 2DUQA 2I2SA 1BZWA 1ULFA 2AR6A 2GNDA 1N3PA 4P9YA 4QGMA 5GLTA 2UYBA 1DIWA 5I0SA 3PMSA 2R1BA 4K40A 4AI0A 3M3EA 4COVA 5GZGA 2Q1ZB 1Z7S1 2WIIB 4YW3A 3PVNA 3WW1A 1JW6A 2YC0A 1YRZA 1UMZA 3VV1A 3VHOA 4XBLA 3WDVA 1LB2A 4O9EA 1BVVA 1U12A 1RHI1 2ENRA 3OJBA 4ZKTB 3RRDA 1LHUA 4COZA 4DRVA 1AYN1 4XDQA 1Q8OA 3CJIA 3P3NA 1F8VA 1OOPC 4YVWB 1S0DA 1MS0A 3OCPA 4MVTA 3ZSLA 2E6VA 3ZYPA 1RB8G 2Q8OA 4ISQA 3ACLA 1QJY1 2MHFA 1RUH2 3LZZA 2XWBB 5GZEA 1DQ1A 2ZKNA 3VKLA 1NOVA 1DGRA 4FXGB 4MH0E 1ZBA3 5CFDA 2ZKLA 1H2KA 3M3IA 2LTNA 5FPXA 4XXPA 4YW4A 1QDCA 2D6KA 4IESA 4KNCA 3VL8A 1ZBA1 2CGNA 3KCCA 2XKOA 2EXJA 5TSWA 1RTVA 4E4ZA 4AVVA 1REEA 2VG9A 4IERA 4J6GA 5EFUA 4HN1A 2R0FA 1RUC2 4FOVA 3H50A 1EV13 5KHHA 4RR3A 2A3WA 4YNIA 4FOYA 4LTAA 4URTA 5SV8A 1EV11 3AMMA 5IT6A 3BODA 2OZ6A 4XFCA 4Q29A 2ZMLA 1LHVA 3JD71 2UY9A 4YVSA 4O9GA 4FPYA 1WGPA 2Y38A 1NLSA 3LAGA 3C2UA 4C0BA 2ZGNA 1BMV1 1H9PA 2YMZA 5JR7B 3B94A 2A6VA 4GMP1 4JC1A 1A8DA 1AXZA 3MIGA 5J96B 4C