1UYXA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellobiose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
molecule keywords CELLULASE B
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uyxA00
1IQDC 4XURA 3ACGA 2Y8KA 2QQNA 4QDSA 1YQ2A 3ACIA 2VC9A 3T08A 2QQIA 2X09A 1JZ6A 2YFZA 3CDZB 2W5FA 3I2GA 3C7EA 3FL7A 1PX3A 3OEBA 1GMMA 4CUBA 5J1XA 4A3ZA 3PUIA 4FI9A 3WNMA 3HPNA 1PMJX 2JD9A 3WQBA 3K4AA 5IHRA 3VDBA 3FHAA 2VZ1A 4MADA 2WO3A 4PQQA 2VZ3A 3T2OA 3WF4A 3T2PA 3D3AA 3VD5A 3P6BA 3WF1A 1GOHA 2Y6JA 2J7MA 1P8JA 3WF2A 2JDAA 5B4NA 3LEIA 3OGRA 5EJ1B 2J1RA 3VD4A 1W9SA 2B9VA 5IFTA 3NJXA 2YG0A 2VCAA 5G04L 2CDOA 4GWJA 1UXXX 1NAEA 5IJRA 4JHZA 4JKKA 3I2FA 2VZPA 3UESA 3JXSA 4E8DA 4ET7A 2VCCA 3A7QA 3MUY1 4LPLA 5HPOA 3I3BA 3K77A 2VM9A 3WSOA 2XONA 4OMDA 5C71A 3HNMA 4M4PA 2RVAA 4ZZ8A 1KEXA 2WN3A 4LHSA 3SKJE 3OEAA 3DECA 4HG6B 2J1EA 2WYSA 4KWUA 3WF0A 4UOJA 4TTGA 1OF3A 1J84A 2W1UA 4ARXA 5IYYA 1ULPA 3LQCA 2C26A 2VOTA 2DCKA 1PX4A 2HLEA 1UY1A 1DLCA 4XUQA 3BN6A 2VMDA 2RV9A 2VZQA 1SHWB 3F2ZA 4QX2A 4YPJA 4CU9A 3I3EA 2EIBA 2J22A 3IAPA 2VZTA 3I2KA 4A6OA 2V4VA 2KD7A 4ZY9A 2W47A 2J1VA 3C7FA 4MO3M 4D0QA 2VO5A 4PT6A 3HNBM 5C70A 3LE0A 2Y6HA 3ZM8A 2VZSA 2J1SA 1LNSA 4XZUG 5LA2A 2VQTA 3OBAA 2E31A 3MV01 1NX9A 2B4KA 1OF4A 2VMEA 3LPFA 4W8JA 4OZOA 3WF3A 2VZUA 3VDCA 3FHQA 3T09A 3WNPA 2WABA 3DYOA 2BGOA 4MGQA 3OGVA 1CX1A 1K3IA 4XVHA 3K4ZA 3WNOA 1TG7A 4KI5M 3HNYM 2RJ2A 4M4RA 1NKGA 2WN2A 4QB1A 3I3DA 2Y6GA 2ORZA 4QX1A 2VR4A 4CVUA 2BERA 2J1UA 3CQOA 3OGSA 2W95A 4DUVA 1JZ8A 5FUIA 2WO1A 4P00B 1EUTA 3GXUA 4RN5A 2WZ8A 2CDPA 4QX3A 4QDQA 2W9XA 1OH4A 1UMIA 3NRUA 3SEPA 1UZ0A 1XPWA 1KGYA 4CUAA 2W3JA 3THCA 3AC0A 2L9LA 2J1TA 5LA0A 3LEKA 3VD3A 3GDBA 2YFUA 2ZEYA 3HEIA 2VJXA 1HN1A 3ABZA 1CZVA 2J1AA 1JZ2A 4DUWA 1JYXA 3T0AA 4DEQA 1TVGA 2QBXA 2VMCA 1W9TA 3EYPA 2JKXA 5JMOA 3J7HA 2W91A 2W94A 3E1F1 2ORXA 3SKVA 2YC2A 2EIEA 4L0PA 1ULOA 3VDAA 3T2QA 2E33A 3OG2A 5JXIA 4CU8A 1O8SA 2WQ8A 1US3A 2PQSA 4QB6A 5F7UA 1SDDB 4A4AA 1K45A 3C8XA 1PMHX 1US2A 5JUVA 1UWWA 3WEZA 3WNLA 3W5NA 1UY0A 2W1WA 1RYYA 2VQUA 3BGAA 1UXZA 5EIYB 4A42A 5G05L 2C9KA 3P1IA 1JZ5A 1UYZA 3FN9A 1JZ3A 4P08A 5LCWL 2DCJA 4P5YA 3CKHA 3W5MA 3MBWA 3DYPA 3K75B 2OKXA 4P02B 3HOBA 3WNNA 2WO2A 1OD3A 1J83A 4XUPA 3C7GA 2WZEA 3SEEA 5I0DA 2WUHA 4GWIA 5JR2A 2BGPA 1JHJA 1JZ4A 4XUNA 2QQJA 3VD9A 3U37A 2VZRA 4AG4A 2X10A 2YB7A 3IIIA 4A45A 4BXSV 4ZZ5A 1JU3A 1WKYA 2WAOA 4MOAA 1L7RA 1UY2A 3PUHA 2V5DA 3I2JA 5C7GA 1O59A 3C7HA 4XUTA 5A1AA 4JKLA 3K4DA 1H6YA 3I97A 4UAPA 3I2HA 2W1SA 3EB7A 1UY4A 4OYUA 2X05A 4CU7A 1CZSA 1D7PM 5B4XA 4XUOA 4BK4A 3A23A 3NJVA 2QQMA 4OUEA 2Y64A 2E26A 1W8OA 2VTFA 2W87A 2VZOA 4IUGA 1W8NA 3ACFA 1L7QA 1XNAA 1UYYA 2ID4A 1XC6A 2WBKA 1SG3A 4Z2AA 1UX7A 2LS6A 4BJ0A 2W92A 3GGLA 2BZDA 2R7EB 5DMYA 1I5PA 3OB8A 3ETPA 2Z4FA 1JYWA 1K12A 2VCBA 1DP0A 1CZTA 3MUZ1 4QB2A 2EICA 3IDAA 4BK5A 2BBAA 4CUCA 3DYMA 3T0BA 4QX0A 4DXSA 4ARYA 4W50A 5LA1A 4DUXA 5IFPA 2Y6KA 3ACHA 1W9WA 5HXMA 4A41A 1UMHA 2XHNA 1GU3A 2V72A 5JXHA 1GUIA 5JXGA 4DEVA 1JYNA 4CU6A 1JYVA 1GOFA 4QAWA 1O8PA 3NQHA 3CMGA 3HJRA 4GZ9A 5DN2A 5CZKA 2VZVA 1W99A 1T2XA 3IAQA 3A22A 4PF1A 4JKMA 5CYYA 1JI6A 4A44A 4AAXA 3K46A 3CZUA 2YC4A 2QQOA 4UI9L 3VD7A 1OT5A 3WNKA 4LKSA 2ZEZA 2QQKA 1MPXA 1WCQA 4LQRA 1W0NA 3MV11 2ZEXA 4QPWA 4DXRA 1EUUA 3THDA 1R64A 2E32A 3MO4A 2WDBA 4OMCA 4MGSA 3HN3A 4DXTA 4JX0A 5DPNA 4D8MA 2DDUA 4QDRA 2ZEWA 1K42A 1UYXA 2W1QA 2VMFA 4E8CA 3UETA 3T0DA 3I2IA 1F4HA 4TXWA 1H6XA 5EJZB 3IB3A 3LEGA 5JXJA 3UNPA 2ZXQA 4KMQA 3C7OA 1UY3A 3LPGA 2XOMA 2Y6LA 2LW8A 2W46A 2JE8A 3NNGA 1NUKA 1GQPA 2VL4A 1F4AA 2QQLA 1GOGA 3ECQA 4BDVB 3GM8A 1CIYA 3CIHA 3CZJA 4RYDA 3A21A 2HYXA 1JZ7A 1GNYA 2EIDA 4W4ZA 1BHGA 5DQ0A 1JU4A 2WAAA 1DYOA 4ZXEA 2XQXA 2C4XA 1XNTA
chains in the Genus database with same CATH superfamily
3SQOA 2UYAA 2WA4A 2Y8KA 1NLQA 5LASA 2QQNA 3W21A 2XVGA 4CDWC 3MIDA 4OI2A 3N35A 3MYXA 3PVOA 2VXJA 3ACIA 4FFGA 2JG8C 5J09A 3AZVA 2QQIA 5FZ9A 4Z92B 3VV1A 2X09A 4QPGB 2YFZA 1RMU3 4BIFA 3IM0A 4GB33 3EXUA 3ILNA 2W5FA 5IATA 3V0AA 2PXJA 5JOZA 3FWEA 3VHRA 1Y4WA 3VZMA 4BB3A 2H0BA 2NZ9A 3MIBA 3OSDA 5KR7A 5KXCA 1FV2A 1LB2A 2R49A 3SISA 4OHZA 2WLQA 1CAWB 2WC2A 3CF6E 4FI9A 5C3RA 3OCPA 3BOPA 4PLMA 2D43A 2D6OX 1NZCA 4RHV3 4NPMA 3ZN5A 1PMJX 1V6JA 2B7YA 2FCUA 5GLZA 2ZGPA 2XUEA 2ATFA 1U5YA 3FHAA 4V1PA 4Y1UA 2HWD3 1DGRN 2P6CA 2RJLA 2CGNA 4QKFA 1ALYA 2G4IA 2KA3A 2ZHLA 4NHKA 4RQPC 3WQ7A 3ZYGA 4PQQA 2CTVA 2B9UA 4EQVA 3M4FA 3U07A 2MEV3 3J9SA 1ENQA 5ABJB 1KDKA 4XDOA 3D3AA 4Q2FA 4KBBA 4QT6A 2VW0A 2CGOA 1CVNA 4NRQA 2Y6JA 4JRAA 2J7MA 2FZ2A 2AEZA 4MVTA 1E5RA 5B4NA 2JIJA 2XR4A 1NCQB 1NOVA 1W3VA 2KM2A 1PMIA 2YMZA 1JOPA 1FNZA 1RUG3 2BU9A 1RGSA 3CLPA 2B9VA 5IFTA 3NJXA 3D6EA 1OOPC 4AVSA 4UFMA 4AK3A 3BTAA 4Y1ZA 1FPN1 2JDHA 4GALA 2FD8A 1GZWB 2IFWA 3I7DA 2XMLA 4LOSA 2QZ2A 1CAWA 4AVCA 3O1OA 4JHZA 4YARA 1NE4A 2JDZA 3I2FA 4JCKA 2VZPA 1REEA 4QPIA 4YW1A 4AAPA 4E4HA 4B1MA 3N9PA 2R32A 3FBMA 4BWOA 2G9ZA 5FYUA 4A3XA 5BNNA 4P9LA 4I02A 4E2GA 3K77A 1DBNA 1Q8PA 1UAIA 2XONA 1W2TA 4DZGA 3V65A 1V9U1 3NV4A 2R6QA 4XQ4A 1IQAA 5A7PA 3TN92 5J36A 3DECA 1KS4A 2DVAA 2VVDA 3ZYFA 5H9QA 4CXYA 2XVLA 2XBO1 4UOJA 3PU3A 1RMU1 3VBUC 4TTGA 1UKRA 3M3QA 3NJYA 5LBFA 1AVBA 1RUH1 1J84A 2QDRA 4ARXA 2ARBA 3B3QE 4B3NA 3GZEA 3WW3A 3QOPA 1S0DA 4D7YA 2F4PA 3LQCA 1JUIA 3LOIA 3U11A 2DCKA 2Q8CA 4NHYA 2WZPP 1HXS2 1PX4A 2Z69A 1UY1A 4XILA 1PM4A 1PZ8A 2R0HA 4P9IA 5FZ7A 3WINE 2RV9A 3GF6A 2BBVA 1MACA 1NZIA 1V6NA 2RMU3 2VZQA 1W39A 4YPJA 4FBFA 3RG0A 1SCRA 1W2UA 3ZFEC 5FY5A 4AFDA 3OD0A 3LFIA 1TE1B 3I2KA 4A6OA 4TWTA 4K8RB 4D0QA 4NO4A 3C7FA 3KLSA 3RQ0A 4LKFA 3JD72 5A7QA 2PHUA 4AHZA 4D3WA 4YFWA 2JEMA 2Q1ZB 4CEWA 5B2GB 1K5MB 3POWA 4XCAA 4YGBA 2D5HA 4MUVA 1VBC2 1OOPB 4FSJA 4XZUG 5LA2A 3OBAA 2HWE1 1OLMA 2E31A 3GALA 3U0ZA 4UF0B 3U1XA 4EN0A 2ZTNA 5GJ6A 2VMEA 3RWKX 1RMU2 5A6ZA 4OZOA 2ZZQA 3M3EA 4COVA 5M0TA 4MV2A 2VZUA 3FHQA 1KFUL 1XSRA 4HN0A 4RGKA 1JYTA 3T09A 4WV8A 3V0BB 3WNPA 4BE3A 4AQ2A 1MS8A 5ERLA 2BGOA 3UGGA 4GWNA 1ZZ7A 3AVSA 4TZDA 2PHXA 4G3YC 5JAXA 2UURA 2VUJA 2CSGA 1N3PA 3K4ZA 2GNTA 5IVYA 1DG6A 1QJU3 2O1QA 2R1DA 4ONUA 5J48A 3ZYPA 2DV9A 3OYWB 1JOJA 2LALA 4LO4B 4Y22B 4XACA 1A8MA 4M3CB 1FPN2 1F5FA 4QB1A 1MVEA 3I3DA 3KCCA 1SLLA 1ZBA2 3HBZA 4QX1A 4BQXA 3H8RA 4CDUA 1YI7A 1VBD3 4CXWA 3MLJA 5I8TA 1LHUA 2BERA 1COV3 5CU1A 3VBHC 2W95A 1CIWA 3IPVB 2WL1A 1J1LA 2RDQA 4YZ1A 5C3PA 4PI0A 4YW6A 5FUIA 2PHLA 4RN5A 2GC3A 5D2AA 1RUI2 3QLQA 3LSDA 4QX3A 1W0PA 5JIUA 1AYM3 1VAVA 4FXGB 1UMIA 4LBMA 3WP5A 3R4DB 4R9DA 3PUAA 3SEPA 1SLAA 5LBCA 4CUAA 1KGYA 3WDUA 3RNSA 2VUCA 2ZACA 5KWRA 2L9LA 2RM21 4DRRA 4IETA 1RVF1 3AMQA 1GP6A 3GDBA 2PA7A 2NQYA 4JTOA 4RS5C 2E9QA 2RR12 2LM3A 2ZMLA 3QD6A 2V09A 3V56A 1LU1A 1TVGA 1C8M3 4EZ4A 3GBGA 1W9TA 5ACA3 2O14A 2ZX0A 3EYPA 1HN0A 4EN6B 1PVC3 3W20A 2UWCA 1RUG2 3E1F1 4PIYA 1OBNA 2JDKA 3U14A 1V6IA 3SKVA 2YC2A 1Y9MA 5LBEA 4L0PA 4PHZA 3VBOC 1WW5A 3MF9A 4HBNA 5JXIA 1POQA 2PELA 5FPBA 3MHZA 3NNMA 5FYSA 3OJBA 5FYTA 3ZYIB 3WDWA 1PIV3 3DKQA 2PQSA 2A6ZA 2GMEA 1PO13 2JX9A 5F7UA 2IXJA 4NRPA 5BV6A 1H9PA 5C4WB 4LBKA 1JOBA 1W04A 2JICA 2TUNA 3UV9A 4CCNA 1UWWA 4ZHNA 4FCAA 2SLIA 3WEZA 2WNUC 3WNLA 4QQOA 4XCBA 5FRAA 1UZVA 2BNOA 1W6NB 2GNDA 2ZZJA 2GC2A 4M3CA 5T55A 1HB1A 2EF6A 5DZGA 3AMMA 4XFGA 1EV12 3WG4A 1CJPA 2VQUA 3LB9A 3MW2A 1OLME 4QGMA 1Q8QA 3KB5A 4YM0A 3RMYA 4AHXA 1ZBA1 4LBNA 3P1IA 3TBDA 3PTRB 4Z1VA 1WMEA 2OXBA 3RYRA 4MX3A 5F5QA 4GA9A 4AL9A 4P08A 4S2HA 2DVBA 4YZ4A 2DCJA 3VHOA 3CKHA 2WNVC 3MBWA 1JXNA 4IEWA 5AC93 3POFA 3W5MA 2D6PA 2A75A 1NQJA 1AR61 2D6KA 4LULA 2OKXA 3KCYA 3WNNA 1IPJA 4BQ3A 1F9KA 2WO2A 5FZLA 1REFA 3POBA 3VBOA 4EWEA 3QH6A 5F37A 5J96B 3TNPB 3C7GA 3NNFA 4CRQA 5LEKA 4BU2A 2ENRA 5C9AB 3TEWA 3PUQA 3SEEA 5I0DA 4YG6A 4QMAA 4UFHA 1ODNA 1G9DA 4XUNA 5CB7A 2A3WA 3J26N 4Q4V3 1OPOA 1AR63 2X10A 2O0OA 3IIIA 1R081 3VBSB 1QJZA 3VZJA 2WZR1 4M3CF 3WW2A 4A45A 4ZPIA 1H0BA 4QQHA 4LEJA 3OOXA 3TEYA 1RUC1 5BYNA 1L7RA 1LAJA 2XJVA 3O1UA 3PUHA 4IDZA 1D0GA 1O59A 4M0HA 1QXJA 4XUTA 5D8AC 1YI9A 4JKLA 4WVMA 3JB8A 2NM1A 1HX6A 4NIDA 3ZXJA 4YM1A 4PBPA 1IS5A 3LKJA 1DGRA 1HRI2 4N9HA 1RUNA 5FK8A 5T54A 4KGGA 3KV9A 3AKPA 3EB7A 3SH5A 5F6KA 2VXRA 5GZFA 4XETA 3E97A 1G9AA 2MHFA 1UD1A 3CJIA 4NPRA 3T4VA 1APNA 1D7PM 4J1XA 1AR92 2IC1A 3PIGA 2GNMA 4XHBA 4B7KA 5K0UC 4XUOA 4RR3A 1S1AA 3NJVA 1XYPA 4OUEA 2E26A 3NAPC 2ZMNA 4YGEA 5L7OC 4RL7A 1Y3TA 2W87A 3ZXFA 1W8NA 1XNAA 3ACLA 1Y9GA 2ZGLA 1SBEA 1AR93 3O1VA 3T3YA 1JUHA 2XBO2 4BQWA 1VIWB 3CU7A 5A6XA 4LA2A 4YRDA 4BJ0A 5LEJA 1HRV1 1GQHA 1QXPA 1YFUA 2BZDA 2LUWA 4JGYA 1LOEA 4QX8A 4CDXA 1TEIA 3JCIA 2EVXA 4HLTA 3M70A 4COYA 5FFOC 5ACA1 3ZIWA 5C33A 1C8M1 2PLV2 2JB8A 2XB6C 1XE8A 4P5HA 1RUD2 3PVBB 2GZWA 4ZONA 1CZTA 3MUZ1 4LK7A 5CFCB 1ODMA 5L36A 1LOAA 1X33A 4IGPA 1HLCA 4S2DA 1NQDA 3WVJA 5GKAC 1LHNA 2EICA 1R1A1 2BBAA 2ZKNA 3DYMA 5IVJA 4I09A 3AX4A 2R072 2E7QA 3MIGA 4AOCA 2OVUA 3K48A 4J25A 3ZSKA 2GMPA 1BMV2 3OBZA 3D4KA 5DG2A 5FO9B 4CP9A 1ULCA 3KGZA 3B9CA 5DABA 3H8OA 2QUOA 1RUE3 4I01A 2XHNA 2JWPA 3LA2A 1D4M2 3OYWA 3U78A 2DYCA 3WUCA 2V72A 1OKOA 1Y7BA 2P4EA 1PO12 1JYNA 1JYVA 5KHHA 5IK4A 1ZM1A 4LJHA 5AC92 3KQ4B 1GQGA 3A0NA 4AEDA 1GZTA 2QQPA 1W6PA 1F2NA 2Y33A 3P3NA 3VBHB 4E2SA 5DZEA 3ZDVA 1W99A 5K0UA 1ZZBA 4S2FA 3IAQA 2VOKA 4HKOA 2H6BA 5JI7A 1S55A 1STMA 2VVFA 2R073 4C91A 4JKMA 3BB6A 4IE0A 2BDRA 3N36A 3PU8A 1GLHA 2YROA 4XABA 5A3OA 3IDEA 3IPVA 1QOTA 5FYBA 2BOIA 2QQOA 5LA9A 5T5OA 4DS0A 4ZU4A 4YW3A 4BQ1A 3V0BA 2JG9A 4N43A 5LB6A 4COZA 1FOD2 2JG9B 4N43B 4LIVA 2QQKA 4JGZA 3AMPA 1AL21 3FBYA 4FPCA 1VBE2 5A3LA 1IS6A 4M00A 1I5ZA 3PMSA 5FUNA 4BOWA 1IG3A 2JXAA 1AYN3 2A7AA 5GZEA 1QEXA 3I49A 3MV11 1GP4A 2ZEXA 3ZDSA 1G9BA 4LR4A 5IK7A 2ZGSA 3HMYA 2JDMA 4QKNA 3ALQA 1AXYA 4CCCA 2CAUA 5HV4A 4IV3C 1OVPA 4AI3A 2WFF3 1FYUA 2VY0A 3ITQA 1RUOA 1S2BA 3RJ2X 5F3CA 1G86A 3T1MA 4MGSA 4AFMA 1AL22 1BXHA 2VNVA 4NOTA 3JD71 4UFIA 5DPNA 4DPNA 5C5UA 3O1PA 4XJAA 1GYKA 2ZEWA 3GYDA 2A1XA 3IKWA 3OGGA 2EAAA 3PNAA 5E16A 4AF9A 1V9U2 1MEC2 1VRH3 2ZAAA 4B29A 4NWVA 4HONA 2RR13 2Y38A 1F4HA 2X29A 5DUXA 4Q4V1 3PVEA 2WNOA 3MIEA 5BNPC 1OA2A 3LEGA 3WDXA 4BQ4A 1GANA 2HH9A 4N90A 5DUVA 4EN9B 1FMD2 1XYNA 1HB2A 1ZNPA 1UY3A 5BNNB 4PIZA 1RUH3 4CDWB 5LW9A 5FZFA 4HVRA 2DF7A 4RD7A 1GQPA 2VL4A 2HEYF 2QQLA 5L9BA 1GOGA 3ECQA 1G9CA 3FLPA 3GM8A 5KHIA 3CZJA 2B46X 1CJDA 3BCWA 3PVNA 4RYDA 5FMBA 5IAXA 5AC91 2QQWA 1RUI3 1SLIA 2JDPA 5I0UA 3IT8A 1QJX1 2HYXA 3HN1A 4BQYA 1JTZX 4DRVA 3ILRA 2EIDA 5C70A 5JLVA 5K0UB 1OD5A 3FX3A 4JC1A 4QU2A 1BHGA 1JU4A 1N3QA 2OPKA 4FPHA 2HWC1 4ORFA 4N53B 2XJQA 1DYOA 4R9AA 1ZRFA 1F8VA 1NG0A 5DAVA 2VNGA 4Q27A 2RS33 1R093 2C4XA 3GBFA 4JGYB 5CFCC 2JDNA 1XB9A 2WINB 3KV4A 4MZUA 5H9PA 5JOWA 4P9JA 4YYOA 5FUPA 1UF2C 4QDSA 5GZGA 4P9WA 2VC9A 3POEA 3T08A 1CPMA 2C6SA 2FQPA 1ENXA 3ZOIA 1PGSA 2A5ZA 1JZ6A 3IZOA 2R042 4IGQA 3AL5A 4LITA 5FZ0A 3I2GA 2OUJA 3VKOA 3ME2A 1NA1C 4CE8A 1PX3A 2JE7A 1RUD1 4EV0A 4TYSA 1RHI3 4CUBA 1YEWA 5FZKA 2WIIB 3VBSC 1LHVA 4PJYA 2ZGNA 5D1IA 4Y5TA 3IDCB 4PQ9A 1BQPA 3HPNA 4GB32 5KXBA 1RINA 3J8F3 1LULA 4AZZA 2JD9A 4IEPA 3KV5A 3WQBA 5ABJC 5F2WA 4JAAA 3AXDA 5IHRA 3VDBA 2OA2A 2JG8A 1QU0A 2UU8A 2ZMKA 1YO8A 3TN93 2EA7A 5HCAA 4B4QA 2GSYA 4NIHA 5T5JA 2VZ3A 2CL2A 2B8MA 1CAUB 4YVWA 5ANNA 3ZX7A 3UT0A 5FOBB 3VD5A 3WF1A 4CCEA 1DGLA 1HQLA 3AZZA 2DU1A 1QNYA 4IQPA 3DPRC 4XXAA 3I2OA 5ABJA 1KFXL 1P8JA 3H3UA 2JB4A 1LCLA 2ERFA 1QOSA 2RM23 5CADA 4XF9A 5FPXA 4ZU5A 4DY3A 5DUUA 4DO0A 3ILFA 3V0AB 5J7MA 4NHLA 1WWYA 2ET1A 1NA1B 1VB2A 3HT1A 4EROA 3KS7A 1HRI1 4TLGA 4XJZA 5G04L 3T4HB 3O0VA 2C0ZA 2D6NA 5IJRA 4PBOA 3AMHA 4PCRA 5I0SA 1XOYA 5FZMA 2WNUA 1LGNA 4DQAA 4E2QA 1E5IA 3URFA 3UESA 3APBA 4ET7A 1HRI3 1EAH2 1EAH3 4JGZB 1VBD1 4WVZA 2VCCA 4CCLA 3I3BA 1BCXA 4MGYE 1W9FA 4L97A 4OMDA 5DXDA 4AI9A 5C71A 1AJKA 1DYPA 1WBLA 2RVAA 1KEXA 4LHSA 2VNRA 4LO5B 4DNYA 4ZZ8A 2SBAA 2GALA 4HG6B 4FFIA 2GC1A 4QXBA 3WF0A 5KBFA 1F15A 2YGMA 5A7WA 1OF3A 5F5AA 4EWAA 1CR7A 2W1UA 1C57A 4BLIA 1CGPA 4QKBA 1SCSA 4YZ2A 1UU6A 4K21A 1OQDA 1VRBA 3VBSA 3ZXDA 4QD2A 5BNOB 4Z82A 4Q26A 3H42B 5FLHA 2VCMA 2HLEA 1POV0 1SACA 2EALA 4X6RB 1JN2P 1F31A 3PMEA 5LRRA 4O65A 2NMNA 4N9IA 3DPRA 1JHNA 3J8F1 1RTVA 1W8WA 4Q4Y3 4CU9A 2XHKA 3ZXKA 1WA6X 3I3EA 3G7DA 2EIBA 5T5PA 1JYIA 5FY8A 1PO21 3WDVA 2ZGOA 4CEYC 3Q8EA 4ASLA 2BP6A 3ORJA 2KD7A 4CZSA 3C3VA 2W47A 2PQQA 2E7TA 2VAUA 1TME1 4ZS3A 4AVAA 1D4VB 1OH3A 1DLLA 1WCDJ 1ZA7A 2ZGKA 1B35B 3N7MA 4PT6A 2B45X 4NE9A 3DV8A 3LE0A 5EWSA 4QGNA 4YW2A 5C8CC 2J1SA 3ST7A 2ARXA 3VB9A 4ZU7A 1ZA4A 5C9AA 4XW3A 3NMBA 4YZ3A 3BYWA 1WMXA 2VQTA 4WVWA 4OHWA 1T6BX 4FXKB 4LT5A 2RMU1 5EJ3A 1BYHA 2B4KA 1OF4A 3LPFA 3T2TA 5JOXA 3MDPA 2AYHA 3MF6A 4IESA 4MH0E 4W8JA 1GNZA 4ATEA 4XZPA 1UQXA 1D4M1 5FXZA 4CA9A 4CP9B 1RUJ2 3SCGA 2HWC3 2DUOA 3I59B 3AKQA 4AVVA 1VBA1 4E27A 1TMF3 1OA3A 2CV6A 2A6VA 3JQXA 4M01A 5A1LA 1KQRA 5F5IA 2G1MA 5FZ6A 4BPZA 1ND2A 1QJX3 3H3LA 3N9NA 4QHOA 4AGGA 4Z2WA 1DZRA 3NWKA 2ZGMA 5EFUA 5CVRA 1YFYA 3HNYM 5SV8A 2H6CA 1O5LA 5LRSA 2YV8A 3H0OA 3JBG3 1TQ5A 3VKNA 2FZ1A 5A3TA 3VDDB 4RR3B 5T50A 2VR4A 4FOWA 1GSLA 5FZGA 4OVEA 4I30A 4CVUA 1FX5A 2J1UA 1C8M2 2PLV1 3OGSA 4FPLA 1UMZA 2YC0A 4YW5A 5FPUA 1JZ8A 1VBA3 2RR11 1V70A 3LGRA 2WO1A 4P00B 1E57A 5C9AC 5KXEA 5E8AA 1AR71 3ZXLA 1RVF2 5CG9A 2CDPA 2W9XA 2P3JA 2ZGRA 1TMF1 3F95A 4MXWA 1H8TA 5T52A 2W39A 3I2DA 3NO8A 2YGLA 3LWCA 1YFXA 4CDWA 5I0RA 2Y34A 5JI9A 4WVMB 3THCA 2VTXA 3FC0A 4KNCA 3AYDA 2CHHA 3D82A 2K9ZA 4QM9A 2ZEYA 3E6CC 1FOD3 3M2MA 3QBQA 4HMZA 4KWKA 4Y22A 1PZ9A 2J1AA 3RSJA 2R062 3T0AA 1PO22 2WA3A 4DEQA 1AYN1 4OZXA 1ZVFA 1O91A 2W52A 2BYVE 4BH9A 4CEWB 5FZHA 3S7EA 1VMJA 1B35A 3HQXA 4MGTA 2A70A 3CEWA 5FZCA 1DGWA 2OPWA 2FHRA 3SITA 2X5IB 4RGGA 4BHPA 3GZTB 2ET7A 1WD3A 4AEDC 1QH6A 2EIEA 1C28A 3C2UA 4Q4Y1 5K7PA 2IXIA 1W8HA 5CIRA 3T2QA 3S5AA 3ZFGB 3WDYA 1WMDA 4COUA 4WVVA 3NKTA 1J3PA 4IEZA 1RXFA 3H50A 2YDEA 2UY8A 1ND2C 4WM8A 2BPA2 4QB6A 4XJWA 1QJFA 1SDDB 4J6GA 4A4AA 5C4WC 3BKZA 5A6QA 4R4XA 4MSVA 1PMHX 4URAA 4V2VA 2DVFA 1US2A 2WNVA 3EQEA 1DZQA 4LE3A 4XE9A 5FZOB 4LOTA 2VNOA 5A32B 3WT3A 3IMMA 1QY4A 4S2GA 4I0BA 3TNQA 1EAH1 1XYOA 2W1WA 4HVQA 3BGAA 1YWKA 5FPVA 1Q3EA 3O0XA 4O9GA 2C9KA 4AWDA 2ADEA 4LHNA 4U36A 4IEXA 2HWB1 1LRHA 4LTAA 5FK7A 5F9TA 5KC5A 2BFUS 1JZ5A 3H8XA 1UYZA 1JZ3A 4AHYA 5HXVA 3I3MA 1SFYA 4NRMA 5LCWL 4P5YA 4LA3A 3DXUA 4BZ4A 4FOQA 4P02B 4GULA 3HOBA 4K8FA 1L7LA 2ZHMA 2UWBA 4LORA 2RDSA 2HBTA 5LK7B 1CAUA 2QVSB 2VUAA 2WRAA 2IXLA 1PVXA 4AW7A 1W8FA 1RUF3 1VLNA 4CDQA 1JZ4A 4F8AA 4XF0A 5DAWA 3TN91 2QQJA 3VD9A 2Q8OA 3H1MA 2VZRA 4ZKTB 3H3ZA 5EPAA 1C4RA 1GKBA 4IEVA 4YLZA 4HSJA 4F3JA 4ZZ5A 3P5BA 3IN9A 1JU3A 4LBQA 1YQ8A 4LE4A 2WAOA 3WDTA 2PHDA 4XTPA 1OMIA 2FDJA 1GZWA 2B5HA 5F3IA 5FZ1A 1YYNA 3RZKA 4K7JA 1O3RA 3LOBA 5A1AA 5AFBA 4YSFA 1H6YA 2WJSA 4OUMA 2JG8B 5LBBA 1RUD3 4PLOA 1H1AA 4RQPB 3KHBA 3UKNA 2W1SA 3LA7A 3RGBA 3OPWA 2JE9A 3B7MA 1O5UA 4CPBD 5L9RA 1AR81 5ANQA 4CU7A 3VHNA 5FY9A 4IEYA 4R9CA 1ND3B 2D3RA 1WUVA 3NL1A 1AYM2 2PYTA 2QDNA 5B4XA 1W28A 3M3CA 4NAOA 3NW4A 1UU4A 1GP5A 4BK4A 3E5QA 5ACA2 3A23A 2Y64A 2D97A 2YBSA 3AYCA 3WG1A 1SPPA 2RM22 2VZOA 1NCQA 2RDRA 1L7QA 2P1BA 3KSCA 4QGLA 1UYYA 4ISRA 1O4ZA 2IWGB 1H1MA 1JW6A 2WBKA 4LXLA 3S30A 1W90A 4Z2AA 4C8DA 1RUC3 3JBG2 4PIXA 1LHWA 1ND2B 4CPBA 1F35A 3AVRA 3OF1A 1RUI1 1EP0A 1VE0A 1AX2A 2P17A 3FMGA 2Z4FA 4Y5SA 2E51A 1K12A 1ZZ9A 2GN7A 4C1XA 1ZZ6A 1QJX2 5HCHA 1VALA 2P5BA 4CDQB 3N7JA 1GNHA 1DP0A 2EXKA 2X5IC 2HWF2 3FFQA 4KQ7A 4QPGA 3RMXA 1I3HA 4WM7C 1LEMA 1LODA 3B69A 2FDHA 3IIAA 1M06G 4HT1T 2WKKA 4BK5A 1K5MA 4H55A 1IG0A 2GN3A 1W6QB 3T0BA 2OQ6A 4KG0A 2Q0AA 1FMD1 2DBNA 1VRH1 3DKWA 3KMHA 2J42A 4QM8A 5LA1A 1L3JA 4DUXA 1C5IA 2W2IA 5A6YA 4Q4V2 1OUSA 3HVDA 4WBBA 5GLUA 2EAKA 1W9WA 2ZGUA 4RSUA 3NNLA 4PLNA 4LUKA 1UMHA 2LRPA 2QCSB 4EN8B 3SLIA 4OQ8A 3N9LA 4I3PA 1IS4A 5JXHA 1GV9A 5BUVA 1R1ZA 2PHRA 2VMGA 4URTA 2H0VA 1GOFA 4QAWA 1DQ0A 1UIJA 2VW1A 5KHGA 1KRIA 1PGL1 5DAQA 2YPJA 1X36A 2XQRA 1M4WA 1VBE1 1T6GC 3OUHA 4K20A 2VZVA 4YVSA 4FFFA 4E4DX 3RZZA 3RZJA 2IXKA 1NCRA 1PK6C 2Q1FA 3A22A 1MZFA 2ZABA 4PF1A 2E53A 2P37A 3WHUA 3NSTA 4Q1PA 3DXTA 5FYHA 1O4TA 5CYYA 3OBTA 4UFLA 4A44A 1LR5A 3USUB 4K3UA 3VL9A 4AAXA 2GDFA 5A3UA 1LOBA 2YC4A 2DVGA 1VAMA 1OT5A 1WGPA 4Y4YA 3VD7A 1VMFA 3USSA 1WBFA 5DDJ2 4YWAA 4FPYA 5F5CA 1QWRA 5DAXA 2GMMA 5DZFA 5FBJA 3AFKA 2OT7A 3LIHA 4IEQA 1WCSA 4IE6A 4QPIC 5E88A 5FP7A 1W0NA 1WA4A 1GWKA 4E4ZA 1X7NA 4COWA 1H8VA 3THDA 1R64A 1LU2A 1EPWA 1RVF3 2D7FA 2WQ4A 5HBAA 3AKRA 1YIPA 2VQ0A 3MO4A 1SZBA 4GKXA 3VBHA 3O1TA 2AENA 4QX5A 4Y4RA 4AQ6A 1B35C 5FYZA 3GJBA 4YFZA 2VPVA 3D0JA 2P2KA 3HN3A 4UW3A 4XFFA 4JX0A 4RGAA 4BQ2A 3ZYJB 1QGLA 2DDUA 2VTXJ 4QDRA 1RC6A 2W68A 1KJLA 5AVAA 1C3HA 4AEKA 1AYM1 5BNQA 1GWMA 5FMCA 4Q0QA 5JSPA 1SBFA 4LLFA 2DTWA 1BKZA 3I2IA 1QF3A 4TXWA 3OGJA 2ETEA 2XWBB 4O61A 2HKXA 4RQPA 5JXJA 1UNBA 3UGFA 1O7FA 3TEZA 5IAVA 1VR3A 2XOMA 4Y1XA 1DFQA 3LIGA 1XE0A 3G6JB 4YW7A 3VZKA 1QNWA 1ULGA 3PURA 5F1RA 2RG4A 3K3OA 3ZFFC 1AF9A 5BXXA 1CIYA 1HV0A 3KT1A 4AVTA 4BDVB 2A6XA 4GH4C 1VP6A 4HPKB 3AFGA 1POV3 4KH9A 1JZ7A 3JZVA 1XU2A 4RFRB 1RJ8A 1VBA2 3WQ0A 1HV1A 2BNMA 3KCXA 2PTMA 2WAAA 3WX5A 2VQAA 4WZFA 4D6RA 3INAA 2VOWA 2F17A 3VUOA 2XQXA 3PUIA 3AL6A 2BWAA 1W8ZA 1IQDC 1S0IA 4XURA 3ACGA 4JDOA 4O7XA 3WZ1A 2XVKA 3MI8A 5J98B 1VMHA 2ZPXA 3J4UH 3JB4C 5D8AA 1WLWA 4I0AA 2FDIA 2DFCA 3PJYA 4KG8A 4FPOB 2JD4A 2QKDA 2NYYA 1Z0HA 3CDZB 3R05A 3LDBA 4NIAA 1H1IA 3C7EA 2AGSA 4UFJA 3FL7A 3GZUC 3NAPA 4LHKA 4AI2A 1BBT3 1MS5A 2RS13 4X6QB 4RR3C 4NVPA 5L7OB 1FAYA 2HWB2 5FZ3A 3ZKUA 4HKLA 3OPZA 5C8CA 3TB0A 4A3ZA 3WNMA 5EXOA 2DCTA 1R091 1W6MB 2GH2A 2R043 1HB3A 3PTYA 4IW3A 3VBUA 2PN5A 2JIGA 5JR7B 3LZZA 3K4AA 1GZ9A 4R52A 2BFUL 3UGHA 1OKQA 4M3CE 2VZ1A 5HI0A 5A3MA 4AFCA 2WO3A 2WZR3 1WZXA 3LCPA 1FMD3 1QOOA 3W59A 1R083 5KXDA 1CAXB 4G4FA 2UY9A 3ZSLA 1GOHA 4UFKA 3WLUA 4A6SA 1O3TA 1B09A 3WF2A 1W8UA 1EY2A 2JDAA 3HQUA 3LFMA 4IV1A 4AXOA 1V9U3 1J3QA 3OGRA 2XDVA 1UOBA 5EJ1B 4KU8A 1W9SA 2G9GA 1VPHA 1HXS3 1CPNA 2VCAA 4F7ZA 1YIFA 2CDOA 4GWJA 1UXXX 1V6KA 2DURA 1YCIA 1JS9A 1BVVA 1UZZA 1DU3D 1Y9QA 2XJUA 5C8CB 2VBBA 5HCBA 4ISQA 4JKKA 4YVWB 2DVDA 5FZAA 4IEUA 5FDBA 4IE5A 5FZIA 2VOVA 3MUY1 1DIWA 3A7QA 4LPLA 1Q56A 1IS3A 5F32A 5FY0A 2WNVB 2Q8EA 2YHJA 1AYN2 3AP5A 3AXEA 3WSOA 1MEC3 1BBT1 2RS11 3V64A 4Y33A 4B8EA 2AREA 2WN3A 1F5JA 2ZX1A 1LESA 3OEAA 4FPEA 4HZFA 1GR3A 4P9XA 4IV1B 4Q0PA 2XLFA 1CESA 2PAMA 1HB4A 2WWJA 2WYSA 4LBLA 3DCQA 3N7LA 4KWUA 3K51A 5FXWA 5IVCA 5FXVA 3WY6A 1PO11 3ZR5A 2D3PA 2VW2A 5JDBA 2VMIA 2ES3A 4JZRA 4QXCA 2C26A 4QHZA 3MLLA 2VOTA 4HETA 4IV1C 2ZX3A 4E9KA 2ZJCA 3RWNA 1PIV1 3BN6A 5JZGB 2VMDA 1U12A 3ZYBA 1DQ4A 3LSEA 2D6MA 2KXLA 3QH7A 4RHV1 2TNFA 3VBUB 4H2AA 2OW4A 5I8SA 1SHWB 4QX2A 3WXPA 1BMV1 4FOVA 2R071 4IXLA 4DY5A 4XFAA 4UYBA 3TAYA 2RS53 1FATA 2HBUA 2J22A 1R1A2 2ARAA 1POV1 5FBZA 3IAPA 3ZPOA 3GBWA 2VZTA 2WO7A 4UW4A 5FMOS 2V4VA 5IVVA 1W06A 4RHV2 4YM3A 3KHCA 4CDUB 1ZYBA 2ZKLA 3MPPG 4TLFA 4XAAA 4D94A 2XUMA 1RUF1 1PNGA 1PNFA 3HNBM 5C6CA 3R6SA 5FZ4A 3ZM8A 1NCQC 2P3YA 2VZSA 4XFBA 1CONA 3ZSEA 3E5XA 3AP9A 4NAMA 2ZAHA 3I8TA 3U4XA 2CY6A 2R1BA 4L8QA 5JMCA 3DPRB 5F8PA 1W2NA 2B42B 4UWDA 3ZO0B 5FY7A 3LDRA 3WF3A 1DF0A 3VDCA 1G6NA 1S0EA 4RS5B 2OQ7A 1MR5A 1AX0A 4L99A 1DYKA 2CU5A 4DOUA 2WABA 3DYOA 4AHWA 5FZEA 3RYKA 5IVEA 1CX1A 1RUE2 4AEJA 4Q5OA 1K3IA 4HXCA 4I2OA 4FAGA 1R1A3 5L9VA 4N8MA 2Q4SA 5FIXA 3WP6A 5KHKA 3SCHA 3QACA 4M4RA 3IMNA 5FO7B 2WN2A 5FOJB 4MXVA 4TN7A 4BMBA 4FTSA 2Y6GA 2RDNA 1OLRA 3SC7X 1O3QA 4GAZA 4PI2A 1WLDA 5BNOA 4Y5Z0 4AGVA 4DUVA 1WCUA 2G9FA 1V6OA 4XFHA 5CKNA 4IGOA 1W6OB 3H7YA 3MIFA 2AC1A 2Q30A 2WNEA 3ROUA 1EUTA 3GXUA 3U75A 5D21A 1OH4A 2HWE3 4HN1A 5JVVA 4BISA 2OUHA 3CBNA 1UZ0A 1XPWA 1UU5A 3EO6A 3H1YA 4Y1VA 3AC0A 1OUXA 3FZ3A 2J1TA 5LA0A 3LEKA 5F3EA 2HWE2 3ZFEB 2V4AA 1VBC1 5JOYA 3HEIA 4NWWA 1DHKB 2ZA9A 3O1SA 2D6LX 1CZVA 2QQVA 1GWLA 3ABZA 5LY1A 1JZ2A 5FZ8A 4DMIA 1OOPA 4CCMA 5BY5A 4N53C 1JYXA 3ES4A 1FOD1 4XMAA 5GLTA 1VBD2 2GP5A 2JKXA 1H4HA 1UPIA 3J7HA 2W91A 4W6YA 2AZ5A 4K1ZA 1NXD1 3B5LB 2ORXA 4B7EA 3N9MA 5GZCA 1ZBE2 4I0WB 4GIQA 4Q0VA 4UT5A 1A78A 4QXKA 4XJUA 3OG2A 1FT9A 1UOJA 5FP3A 5EYYA 4D69A 2WQ8A 1QMJA 2YY1A 4AI1A 1ZRCA 2FBEA 3O1RA 3KD4A 1K45A 4A7ZA 1WLTA 3C8XA 3VZLA 1W03A 2OIIA 4U2AA 3MLKA 4B4PA 5A3PA 3BODA 4Q8LA 5JUVA 5DDJ3 1Q5OA 3AP7A 1O6UA 3JBG1 1VB4A 3AKSA 4KGQA 3TWIA 3U4SA 5K9YA 3RVHA 3VKFC 3TYJA 1UY0A 1Z7S1 2A73B 1W6NA 1QXRA 2V5YA 5BNOC 3B9IA 3VZNA 3WW1A 5EIYB 3CNAA 2YZ4A 5I8YA 1Q43A 1AX1A 5L7OA 3KM5A 1TNFA 2MNGA 2VBPA 4AYUA 5CFDA 2Q8DA 2AEYA 1QJY2 3ZVXA 5IWFA 4ASKA 4FP2A 3HQRA 1UX6A 3WUDA 1QDOA 1UZWA 1RUG1 4Z8BA 3MGUA 3J7LA 1D4M3 2GC0A 4META 1ZRDA 1J1TA 4AR2A 2PFWA 2PAKA 3K75B 4OI4A 1SLBA 3R4UA 1OD3A 1OSGA 1H2NA 4RA0A 1BJQA 1J83A 2WT0A 3Q8FA 1QDCA 1NXMA 4P14A 4XUPA 2QQUA 2AACA 3BTXA 2WZEA 2RS32 4UXAA 1AR83 4XC9A 2WUHA 1AXKA 4GWIA 3NV1A 4FPJA 2HJIA 1W05A 2BGPA 2BWCA 2QZ3A 3VBRB 2BOJA 2D98A 1HQWA 3RZHA 3U37A 4AG4A 1MVQA 3ZIXA 1IKQA 1H30A 4BXSV 1OFNA 1WKYA 5FWEA 4MOAA 2D5FA 1UY2A 2JJ6A 4LK6A 2NPIA 4HK8A 3I2JA 3VBRC 4MGKE 5C7GA 1LOFC 1QH7A 1S4CA 3C7HA 4CXXA 5LK5A 4CEYA 1FV3A 3K4DA 4NIGA 3GHMA 3SHRA 1ZRRA 5LWBA 1PVC1 2QFEA 3I97A 3MFCA 3Q9OA 4UAPA 5TSWA 3I2HA 4XDQA 2XJSA 1YC61 4MLOA 4FPFA 3GNEA 2ZX2A 4SBVA 4FP3A 1ND3A 4ZXKA 4AFBA 1OC1A 2BQPA 2W0XA 1ZBE1 1LOFA 3FLTA 2BUKA 5FP8A 3RPQA 1CZSA 1HW5A 1ULFA 1UW8A 1KD7A 5C3SA 5AVPA 3MEPA 2JDUA 2P3IA 3AJZA 4TSVA 4BMEA 4QQ2A 2QQMA 4IE4A 5IK8A 1DDLA 5IUQA 4CP1A 4IUGA 3PL0A 3ZPYA 1XC6A 3J7MA 1XNDA 1X8EA 3NV2A 3ZN6A 1OPMA 4F83A 3CJIC 1YRZA 1H4GA 1SG3A 1R082 4FT8A 5CKQA 1UX7A 2LS6A 1NLSA 2VG9A 3I54A 3KF5A 2R16A 2XGXA 4BM8A 2XKPA 3HBKA 3JUUA 2R7EB 1U5IA 3U10A 1COV1 2EXHA 2PAEA 5DMYA 1I5PA 3ZFEA 4LLOA 4IE7A 1JYWA 1OLQA 1FNYA 1W6PB 5H9RA 5CBLA 5T5LA 5AFEA 1WCKA 3SH4A 1ASJ2 3S6PA 2NMOA 2Y60A 1G7YA 3FFZA 1X9TA 3POJA 4QB2A 5A70A 4UBHA 4Q4X2 2I07B 2WSUA 1MQTC 2ZCWA 5FCCA 1VBC3 2ZHKA 4OFGA 1AR62 4QWNA 3LDKA 1DGWX 2BJSA 2QTWB 3DN7A 3LF7A 3BIWE 4X8NA 3ZMNA 4CUCA 3L9JT 3K3NA 4QX0A 1UYPA 3MIHA 4YG3A 1V6LA 2ZOEB 4XQDA 2A6YA 2DCYA 2E7AA 1U0AA 3A0KA 4W50A 3VBFB 1PGW2 1D0HA 4AVBA 2D44A 3ACHA 2ADDA 1ZZCA 4YGCA 1HDKA 5FJHA 5HXMA 1EV11 1TZOA 4R4ZA 4A41A 4BIOA 4B1LA 1IPKA 3RS6A 3ZXAC 2PMWB 1GU3A 5I91A 3L2YA 3EHKA 5BNPB 5JXGA 4YVWC 1H8TC 3D0SA 3PIJA 3HWJA 3WG2A 2I2SA 5F6LB 1RITA 2XLAA 1EYBA 1PZ7A 4N7IA 5FP9A 4LBOA 2XXZA 4YZ5A 3CL1A 1O4YA 3NQHA 4L11A 4Q4Y2 1EPZA 2Z5WA 3CMGA 5FKBA 1UOFA 4LIUA 5FPAA 3OY8B 1N1SA 3HJRA 4GZ9A 2BRTA 4NMIA 2BVBA 2VMHA 3B00A 4HANA 4OHYA 3BI3A 1PK6B 2XLGA 4MGZE 3I3QA 1SDWA 3E6DA 4WZCA 4XF3A 5A7SA 3SCFA 3WCSA 5CAZA 1VBB2 5CG8A 3RFRA 3AB0A 1AZDA 2YXSA 4FOYA 1Q8OA 1JH5A 3GZAA 1WMFA 4XF1A 3RJRA 4FFHA 4IEOA 3VDDC 1AR73 4AQTA 1W2AX 2R061 4UI9L 3H8UA 5LZ6A 3FE5A 3WNKA 4DINB 4LKSA 2ZEZA 3WHTA 3BTZA 1NLRA 2PLV3 1UL9A 4CDXC 4HL0A 1YQ5A 2Q1MA 5C4WA 3EBRA 4DIQA 5JIAA 4D6QA 1WCQA 1OI6A 1ZBE3 3GCXA 3PHMA 4XMIA 4QKDA 3KVBA 2WT1A 3ZSMA 2BV4A 4DXRA 3EMRA 2G19A 1C5HA 1GBGA 3TEXA 2IFRA 3THPA 1W9YA 3B02A 5A33A 1H2LA 1X8MA 1WLCA 2P6HA 2WDBA 5FYYA 2JENA 2UWAA 3I59A 4OMCA 3BOWA 3AYEA 3ZFFA 1VAKA 3RRDA 2NP0A 1K5JA 3BPSA 1X9PA 5CISA 2VULA 4XOGA 1NYWA 3UKVA 1UYXA 2W1QA 1AJOA 2MEV2 2IXHA 4XJ9A 1FPN3 4LO6B 5F2SA 3VZOA 4E8CA 2O8OA 3T0DA 1IPSA 2Q5TA 4INDA 3Q8BA 4FVVA 4QQLA 4A7KA 4P9YA 2CAVA 1H6XA 5EJZB 5FTTC 1MS0A 5FYIA 3UNPA 5I0TA 2ZXQA 4LO8A 4PDWB 3WCRA 3C7OA 4JQRA 3T1LA 2WWUA 4GWMA 2QNKA 2D3SA 2ZGTA 3R4SA 2LW8A 2GP3A 1U5XA 2VE1A 2WFF1 3KT4A 3DUIA 4GJZA 4QXHA 4CCDA 4LKDA 5FWJA 5FREA 5ISLA 3VBOB 4CCKA 4Q8KA 1J58A 3POSA 4JRLA 2D93A 3HR9A 5FKCA 2VECA 3VLBB 3A21A 1NCRB 4GH4B 4XJ8A 3R0RA 4AE2A 3JU9A 1UIKA 2VBDA 3E6BA 2HWD1 5H9SA 3M7AA 4W4ZA 3VGIA 3NNJA 3E5UA 3CJXA 5DQ0A 5FY4A 2IVJA 2VOXA 3M1HA 1BBT2 2RS12 3M3OA 3N9OA 3PDQA 4ZXEA 2A71A 2WWSA 2WZR2 3ZYRA 4ASMB 3O7OA 3POGA 4MADA 1XNTA 2ZGQA 1PHMA 3P3PA 4XAEA 1QQP3 1QQP2 3M8LA 4JGZC 1Z7S3 4XYXA 4EYUA 3NJZA 4JV4A 4HK9A 4NN0A 1YQ2A 1MZEA 5DDJ1 4MYEA 3T30A 1PGW1 1DQ6A 2QE3A 1N3OA 3O12A 4E4SA 1A34A 1MS4A 2PHTA 1R092 2YU1A 5FR3A 3POYA 3H7JA 3LD8A 5E89A 4CYDA 2I45A 1QJY3 2Y26A 1XXNA 3OEBA 5JSOA 1GMMA 1S2EA 1U5ZA 5IT6A 1NY71 2JECA 5J1XA 4Y26A 4Q4X1 3FLRA 3IBMA 1DQ1A 1OVSA 1YHFA 1XRUA 1ASJ1 1S0JA 5FLIA 1MS9A 1YLLA 2DCZA 3L2HA 4HSLA 2WFPA 4EWDA 2DUQA 2YPDA 4EN7B 3BU0A 3AK0A 5F39A 1ZZ8A 3S5QA 3ZSJA 2GNBA 1RUH2 1W0OA 3WF4A 3T2OA 2Z2SB 4K9SA 1YJKA 3T2PA 2BNNA 4QPIB 4GJYA 3P6BA 4ES9A 4YGDA 2IVIB 1UO9A 2RS52 4Y24A 1AHSA 1X82A 2IZWA 4LMFA 3RI9A 1XSQA 3ATGA 2XJRA 2P3KA 3KQRA 5KHJA 3LEIA 5K4LA 1YFWA 4V2WA 4FAHA 3LA3A 5CFDC 2WFF2 2FMYA 2J1RA 3OPTA 2VUDA 1BEV2 2WS91 3VD4A 3D8CA 3GCWA 1UKGA 1YJLA 3TRSB 4UW6A 2YG0A 4OI1A 1PVC2 4CDUC 1IOAA 3UKTA 3VKLA 1OXCA 1NAEA 2GH8A 4XPVA 5FXXA 4LHLA 3O1MA 4XXPA 5A3NA 2FMDA 3FHIB 3MPBA 4XFIA 3JXSA 3ZN6B 5EQUA 4E8DA 4JTNA 1FXZA 2OS2A 2AR6A 4FPKA 1Z78A 2DBIA 3AZYA 4JGYC 4KBZA 4XDPA 5HPOA 1E5SA 1RHI1 4QU1A 3WD5A 1BZWA 2VM9A 4FQ4A 4OCTA 4PDWA 5A7NA 1H8TB 3HNMA 4M4PA 5IW0A 2VD7A 5EV7A 4OUSA 2Z42A 3SKJE 1OHFA 2J1EA 4A7YA 1AL0G 5CA6A 4L2NA 2XPJA 4K40A 1RXGA 1OQEA 4G9SB 3VBFC 1KXGA 1NCRC 1PK6A 2LROA 4Q0SA 2ARCA 2IXCA 5A1FA 4FTBA 5IYYA 1LEDA 1ULDA 1D2SA 1ULPA 3NVCA 5BPXA 3IWZA 4XF4A 1ENSA 4WM8B 1VBB3 3ZFFB 4N53A 3M3IA 1JMUB 2RE9A 2RS31 3OD4A 4CEWC 1DLCA 4XUQA 4ATFA 1SMVA 4KWJA 1LENA 1C8NA 3RYPA 3USUA 3ZLIA 3ASIA 3F2ZA 2C5DA 3N7KA 4OULA 4UBGA 4XBNA 4AI8A 1WW7A 5IVBA 1SLCA 3Q8AA 4Z07A 1BEV1 2DWRA 5FP4A 5FQ0A 3AYAA 2R30A 1QJY1 3J8F2 4ZY9A 3ZKYA 1Z7S2 3I4IA 2J1VA 3DGTA 2Y0IA 4MO3M 4YNIA 4GMP0 3VBRA 5K8SA 2VO5A 3UJOA 3ZMOA 3LAGA 1HQNA 3THTA 3H1WA 1ZRIA 2HWC2 2Z79A 2Y6HA 3MICA 4UF0A 2RS51 1LNSA 1KDMA 2DU0A 5EP9A 2HEWF 2K2SA 3GHNA 4D7SA 1XBFA 3MV01 1NX9A 1SFNA 2A3YA 1MZ5A 2VH9A 3Q8CA 4CUGA 4EZHA 3TOJA 4GMP1 3B01A 3AKTA 5KC6A 1XNKA 4Y20B 1N1YA 2CNAA 1YNAA 4AI0A 2AUYA 3AZXA 3JD73 4XFCA 4HFSA 3KZ4C 2HWF3 4MHUA 3BALA 4MGQA 2IUWA 4OQ9A 3OGVA 4Q4W2 2PHFA 1X50A 4UW5A 4XVHA 1SBDA 1TG7A 3ZYHA 4C90A 1Q8SA 1LGCA 5SV5A 2CGPA 2O8QA 4KI5M 1XQNA 5L73A 3SNMA 2YBKA 1UN1A 4FPGA 5EHDA 4NUBA 3S7IA 4N7UA 2RJ2A 5FYVA 3MW3A 2R0FA 4MHRA 1MEC1 1NKGA 4M0NA 4RFT0 4DFSA 1RB8G 2ORZA 3BVCA 1V0AA 1QJEA 1IGOA 2QJVA 4NHXA 4QQPA 4XIOA 5FQ0B 1AL23 1ENRA 1WW4A 3CQOA 3DL3A 4QX7A 5IVFA 1I1EA 4P9GA 2V73A 1W6QA 3VL8A 4Q4W1 3FUOA 4CTEA 4D6SA 2HWF1 3KVAA 4IERA 5T3NA 2WZ8A 4QDQA 2OZ6A 3W9AA 1HXS1 3AMNA 3BUCA 2XL7A 3NRUA 3PLQA 2YYOA 1W3XA 4GMP3 4HVOA 1ZX5A 4BLJA 1LGBA 1QKQA 2NLRA 2W3JA 3POIA 4CEYB 5JPMB 4LNVA 4GXLA 3VD3A 2YFUA 5FZBA 1CWPA 2VJXA 1H2KA 4H3WA 2D40A 4PF5A 1HN1A 1HJGA 3WP4A 1J3RA 5HV0A 4BYYA 4DUWA 3S0MA 4MG2A 1VRH2 4GD4A 5L19A 4AGRA 3MW4A 1XE7A 2QBXA 1W6OA 2VMCA 3BPZA 1YQCA 1G9FA 1HIXA 3X29B 3UJQA 2RJKA 3A4UA 4AFAA 4CP0A 1SPPB 5JMOA 4FQZA 1MS1A 1S0CA 5JPNB 1LECA 1BEV3 2W94A 1RUE1 3SMHA 4Y20A 4NPLA 1H9WA 3CO2A 5F3GA 2YUEA 1TNRA 2R041 5FYMA 4C0BA 1ZREA 4A2UA 2WQZC 4MGIE 1RL3A 4MXWB 3AM2A 4PDWC 1ULOA 3VDAA 2E33A 4LBQB 4XHXA 4LBQD 4CU8A 4KWLA 1O8SA 4R9BA 1US3A 3ON7A 4LO7A 1KJRA 2FDGA 1NE6A 4K6BA 3NKGA 4FTEA 2CWMA 2Y0OA 1RUJ3 4GQ7A 2JKBA 1HRV2 1N1TA 5C3QA 4FO9A 4L9BA 1RIRA 3W5NA 1AR72 3CJIB 1LOCA 3N9QA 3ZFGC 4EJRA 1S0BA 1S2KA 4NROA 4XBLA 1RYYA 5FMDA 3ZR6A 5E6HA 1UXZA 1QJU1 1C1FA 3HIFA 5G05L 2X8KA 1RUF2 2XG3A 4A42A 3KGLA 3LEMA 1HRV3 1DQ5A 1RHI2 4H14A 1KS5A 1AR82 4GKYA 1AUYA 1C1LA 1EV13 1GFF2 5FYCA 3UK9A 3WG3A 1WD4A 1W8TA 2E63A 1AR91 5GLVA 5FPLA 2FCTA 4KL1A 1E5HA 5GALA 3FN9A 4XQWA 3GJAA 1QHDA 5CEHA 5IK5A 3KWVA 2F4LA 5FPZA 1XU1A 2AH2A 1PIV2 2XJPA 3DEMA 1LJ7A 1AXZA 3DYPA 4JQTA 5A3WA 2XKOA 4QPYA 1IKPA 1OURA 1BK1A 2GAUA 2FCVA 2WT2A 1S0FA 3D5OA 4Y1YA 5BNPA 4C1WA 1IHMA 1G8WA 5JR2A 1RUJ1 4BCUA 1J59A 1JHJA 1SQ4A 2KR2A 2MPFA 3FJSA 3ENRA 1JBCA 2E6VA 2ZS6B 1REDA 1W2OA 2YB7A 3UL2A 2HYKA 1CD3G 2XH6A 4EE2A 3J7NA 3ZXGA 3OBRA 3ZFGA 1VJ2A 1O3SA 1MQTA 4K1YA 1GICA 2V5DA 3AP6A 5FMOL 5LATA 4AEMA 2BTVC 5FAXA 4Q4X3 3O0WA 2X53S 1QIQA 1NY72 4YM2A 3UYJA 4JVAA 1ASJ3 5GM0A 2PHWA 1ACCA 1UCXA 2A3XA 2DUPA 4JDNA 1YUDA 3OUIA 5C3OA 4SLIA 3WR0A 1PM7A 3BU7A 5FJKA 3RZGA 1UY4A 4OYUA 3MFAA 1D2QA 4HOOA 5A7OA 2X05A 1I6XA 1JODA 1BLZA 2WR9A 2XWJB 4Q0UA 4W65A 2XBO3 3WW4A 5FY1A 2VU9A 4OLLA 3ETQA 3H9AA 4J1WA 5LY2A 2JDYA 5FO8B 2N7GA 2EXIA 4YVSC 1MS3A 5FZOA 5A32A 2CYFA 1A8DA 1ONAA 1W8OA 2OZJA 2VTFA 3B94A 4W6XA 3ACFA 4CDQC 2GU9A 3KF3A 2ID4A 1QQP1 4GH4A 4Q29A 4QHBA 4QPGC 4WM7B 1W6MA 1ZBA3 4R8HA 5EYXA 3DF0A 4LUMA 2WNUB 4Q4W3 2W92A 3GGLA 3RI8A 3S57A 5FV3A 1CAXA 5BNNC 2K46A 2EXJA 2F6BA 2HWD2 1OA4A 4CCOA 1UZYA 1VBE3 2BVVA 3ETPA 3OB8A 2ZX4A 2LTNA 2UYBA 3RDIA 4AEDB 2VCBA 3ZN4A 3KV6A 2K0GA 5JZGC 2A6WA 5HCFA 5CNAA 1CX4A 4L92A 5J37A 3QCWA 3FUQA 4C0HA 4CCJA 3IDAA 1SLTA 1CN1A 5JSRA 1SFPA 4DXSA 5JWPA 2MEV1 3N4MA 4ARYA 1JYCA 5IFPA 5DAPA 2X5IA 4XBQA 1LOGA 2YBPA 2Y6KA 3AJYA 4JHTA 4RS5A 4BA6A 3JQWA 2BGCA 1QJU2 5APAA 5GZDA 1CAVA 2EIGA 2BEOA 5D8AB 2OX0A 4ES8A 1LTEA 1UPSA 4WM8C 5CKMA 1GUIA 4CSWA 4NR1A 5I93A 1TMF2 1YQ6A 4B4RA 4DEVA 4CU6A 2DFBA 3WV6A 5C5TA 2JG9C 2XL9A 4N43C 4D7TA 1LHOA 2C9AA 1BVP1 1O8PA 1N1VA 3BIEA 4OI0A 2C24A 2CWSA 1GZCA 1RJ7A 2RMU2 5A33B 4GB31 5CZKA 5DN2A 5C8WA 1V00A 4OHVA 5EZWA 3ELNA 1T2XA 4W6WA 4OHXA 5CFDB 2TEPA 1YXWA 1CQ9A 1Q8VA 2I74A 4HKWA 3PUSA 1IZ3A 4IV3B 4WM7A 3WOGA 1UOGA 4HPKA 4IV3A 4JDMA 2ZHNA 1JI6A 4XEZA 4LKEA 5J3UA 1BK0A 1CAVB 2BW8A 3K46A 1OQ1A 3CZUA 5FLJA 5E1RA 4CP2A 5A80A 3VKMA 5JZGA 3RZLA 2R063 3ES1A 1HKDA 2VGDA 4BQ5A 3VN4A 2TBVA 3WQ1A 4H7MA 4IL7A 1XJAA 2WS92 4CDXB 4KU7A 1VBB1 4YG0A 1MPXA 3SXWA 1N47A 1WW6A 3EJKA 1ST8A 4Q1RA 1XNCA 2C1FA 4H7LA 4Y3OA 3B93A 4LQRA 5FZDA 5A7WB 3WP3A 3BTYA 3RZMA 5CFCA 2ZBJA 4QPWA 1RUC2 3IDBB 1TME3 3K2OA 5JCTA 1V6MA 2DTYA 1EUUA 4LBJA 3AZWA 3HAGA 1K5MC 2RHPA 3CHXA 2E32A 3OY8A 1SEFA 3KT7A 1PO23 1NT0A 3VHPA 4AQSA 3N3HA 1H2MA 2ILMA 4DXTA 1TME2 1DQ2A 1S0GA 4D8MA 1MQTB 1K42A 1DZTA 3HT2A 1HJFA 2VMFA 1OFSA 4ITCA 2NN8A 3PJQA 2WYFA 3UETA 2W08A 1MZ6A 3O5SA 2OYZA 2WLPA 2HEVF 1A6CA 5DUWA 3IB3A 3HD8B 2WS93 4BXFA 4KMQA 1DCSA 4XIKA 3O14A 2WSVA 3LPGA 2YU2A 2Y6FA 2VVEA 4NHMA 2Y6LA 3SH3A 1FI2A 2W46A 1KITA 4NJ4A 1ULEA 2JE8A 3NNGA 1NUKA 3NV3A 4DB5A 1Y43B 4X8PA 1F4AA 4YW4A 3CIHA 3OUJA 3MZHA 4XTMA 5DG1A 4O9EA 1XNBA 1URXA 3NAPB 3VDDA 1A3KA 1I9RA 4NIIA 1NA1A 4DXZA 1GNYA 3AP4A 1PGL2 4YVSB 3WNOA 2FDFA 1LKNA 1COV2 2FDKA 1ND3C 2HWB3 4I3GA 3ZXEA 3WNXA 5GLWA 2XJTA 4ZS2A 2P34A 3W58A 3VBFA 3OTFA 2B39A
chains in the Genus database with same CATH topology
1IQDC 4XURA 3ACGA 2Y8KA 2QQNA 4QDSA 1YQ2A 3ACIA 2VC9A 3T08A 2QQIA 2X09A 1JZ6A 2YFZA 3CDZB 2W5FA 3I2GA 3C7EA 3FL7A 1PX3A 3OEBA 1GMMA 4CUBA 5J1XA 4A3ZA 3PUIA 4FI9A 3WNMA 3HPNA 1PMJX 2JD9A 3WQBA 3K4AA 5IHRA 3VDBA 3FHAA 2VZ1A 4MADA 2WO3A 4PQQA 2VZ3A 3T2OA 3WF4A 3T2PA 3D3AA 3VD5A 3P6BA 3WF1A 1GOHA 2Y6JA 2J7MA 1P8JA 3WF2A 2JDAA 5B4NA 3LEIA 3OGRA 5EJ1B 2J1RA 3VD4A 1W9SA 2B9VA 5IFTA 3NJXA 2YG0A 2VCAA 5G04L 2CDOA 4GWJA 1UXXX 1NAEA 5IJRA 4JHZA 4JKKA 3I2FA 2VZPA 3UESA 3JXSA 4E8DA 4ET7A 2VCCA 3A7QA 3MUY1 4LPLA 5HPOA 3I3BA 3K77A 2VM9A 3WSOA 2XONA 4OMDA 5C71A 3HNMA 4M4PA 2RVAA 4ZZ8A 1KEXA 2WN3A 4LHSA 3SKJE 3OEAA 3DECA 4HG6B 2J1EA 2WYSA 4KWUA 3WF0A 4UOJA 4TTGA 1OF3A 1J84A 2W1UA 4ARXA 5IYYA 1ULPA 3LQCA 2C26A 2VOTA 2DCKA 1PX4A 2HLEA 1UY1A 1DLCA 4XUQA 3BN6A 2VMDA 2RV9A 2VZQA 1SHWB 3F2ZA 4QX2A 4YPJA 4CU9A 3I3EA 2EIBA 2J22A 3IAPA 2VZTA 3I2KA 4A6OA 2V4VA 2KD7A 4ZY9A 2W47A 2J1VA 3C7FA 4MO3M 4D0QA 2VO5A 4PT6A 3HNBM 5C70A 3LE0A 2Y6HA 3ZM8A 2VZSA 2J1SA 1LNSA 4XZUG 5LA2A 2VQTA 3OBAA 2E31A 3MV01 1NX9A 2B4KA 1OF4A 2VMEA 3LPFA 4W8JA 4OZOA 3WF3A 2VZUA 3VDCA 3FHQA 3T09A 3WNPA 2WABA 3DYOA 2BGOA 4MGQA 3OGVA 1CX1A 1K3IA 4XVHA 3K4ZA 3WNOA 1TG7A 4KI5M 3HNYM 2RJ2A 4M4RA 1NKGA 2WN2A 4QB1A 3I3DA 2Y6GA 2ORZA 4QX1A 2VR4A 4CVUA 2BERA 2J1UA 3CQOA 3OGSA 2W95A 4DUVA 1JZ8A 5FUIA 2WO1A 4P00B 1EUTA 3GXUA 4RN5A 2WZ8A 2CDPA 4QX3A 4QDQA 2W9XA 1OH4A 1UMIA 3NRUA 3SEPA 1UZ0A 1XPWA 1KGYA 4CUAA 2W3JA 3THCA 3AC0A 2L9LA 2J1TA 5LA0A 3LEKA 3VD3A 3GDBA 2YFUA 2ZEYA 3HEIA 2VJXA 1HN1A 3ABZA 1CZVA 2J1AA 1JZ2A 4DUWA 1JYXA 3T0AA 4DEQA 1TVGA 2QBXA 2VMCA 1W9TA 3EYPA 2JKXA 5JMOA 3J7HA 2W91A 2W94A 3E1F1 2ORXA 3SKVA 2YC2A 2EIEA 4L0PA 1ULOA 3VDAA 3T2QA 2E33A 3OG2A 5JXIA 4CU8A 1O8SA 2WQ8A 1US3A 2PQSA 4QB6A 5F7UA 1SDDB 4A4AA 1K45A 3C8XA 1PMHX 1US2A 5JUVA 1UWWA 3WEZA 3WNLA 3W5NA 1UY0A 2W1WA 1RYYA 2VQUA 3BGAA 1UXZA 5EIYB 4A42A 5G05L 2C9KA 3P1IA 1JZ5A 1UYZA 3FN9A 1JZ3A 4P08A 5LCWL 2DCJA 4P5YA 3CKHA 3W5MA 3MBWA 3DYPA 3K75B 2OKXA 4P02B 3HOBA 3WNNA 2WO2A 1OD3A 1J83A 4XUPA 3C7GA 2WZEA 3SEEA 5I0DA 2WUHA 4GWIA 5JR2A 2BGPA 1JHJA 1JZ4A 4XUNA 2QQJA 3VD9A 3U37A 2VZRA 4AG4A 2X10A 2YB7A 3IIIA 4A45A 4BXSV 4ZZ5A 1JU3A 1WKYA 2WAOA 4MOAA 1L7RA 1UY2A 3PUHA 2V5DA 3I2JA 5C7GA 1O59A 3C7HA 4XUTA 5A1AA 4JKLA 3K4DA 1H6YA 3I97A 4UAPA 3I2HA 2W1SA 3EB7A 1UY4A 4OYUA 2X05A 4CU7A 1CZSA 1D7PM 5B4XA 4XUOA 4BK4A 3A23A 3NJVA 2QQMA 4OUEA 2Y64A 2E26A 1W8OA 2VTFA 2W87A 2VZOA 4IUGA 1W8NA 3ACFA 1L7QA 1XNAA 1UYYA 2ID4A 1XC6A 2WBKA 1SG3A 4Z2AA 1UX7A 2LS6A 4BJ0A 2W92A 3GGLA 2BZDA 2R7EB 5DMYA 1I5PA 3OB8A 3ETPA 2Z4FA 1JYWA 1K12A 2VCBA 1DP0A 1CZTA 3MUZ1 4QB2A 2EICA 3IDAA 4BK5A 2BBAA 4CUCA 3DYMA 3T0BA 4QX0A 4DXSA 4ARYA 4W50A 5LA1A 4DUXA 5IFPA 2Y6KA 3ACHA 1W9WA 5HXMA 4A41A 1UMHA 2XHNA 1GU3A 2V72A 5JXHA 1GUIA 5JXGA 4DEVA 1JYNA 4CU6A 1JYVA 1GOFA 4QAWA 1O8PA 3NQHA 3CMGA 3HJRA 4GZ9A 5DN2A 5CZKA 2VZVA 1W99A 1T2XA 3IAQA 3A22A 4PF1A 4JKMA 5CYYA 1JI6A 4A44A 4AAXA 3K46A 3CZUA 2YC4A 2QQOA 4UI9L 3VD7A 1OT5A 3WNKA 4LKSA 2ZEZA 2QQKA 1MPXA 1WCQA 4LQRA 1W0NA 3MV11 2ZEXA 4QPWA 4DXRA 1EUUA 3THDA 1R64A 2E32A 3MO4A 2WDBA 4OMCA 4MGSA 3HN3A 4DXTA 4JX0A 5DPNA 4D8MA 2DDUA 4QDRA 2ZEWA 1K42A 1UYXA 2W1QA 2VMFA 4E8CA 3UETA 3T0DA 3I2IA 1F4HA 4TXWA 1H6XA 5EJZB 3IB3A 3LEGA 5JXJA 3UNPA 2ZXQA 4KMQA 3C7OA 1UY3A 3LPGA 2XOMA 2Y6LA 2LW8A 2W46A 2JE8A 3NNGA 1NUKA 1GQPA 2VL4A 1F4AA 2QQLA 1GOGA 3ECQA 4BDVB 3GM8A 1CIYA 3CIHA 3CZJA 4RYDA 3A21A 2HYXA 1JZ7A 1GNYA 2EIDA 4W4ZA 1BHGA 5DQ0A 1JU4A 2WAAA 1DYOA 4ZXEA 2XQXA 2C4XA 1XNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQD C;  4XUR A;  3ACG A;  2Y8K A;  2QQN A;  4QDS A;  1YQ2 A;  3ACI A;  2VC9 A;  3T08 A;  2QQI A;  2X09 A;  1JZ6 A;  2YFZ A;  3CDZ B;  2W5F A;  3I2G A;  3C7E A;  3FL7 A;  1PX3 A;  3OEB A;  1GMM A;  4CUB A;  5J1X A;  4A3Z A;  3PUI A;  4FI9 A;  3WNM A;  3HPN A;  1PMJ X;  2JD9 A;  3WQB A;  3K4A A;  5IHR A;  3VDB A;  3FHA A;  2VZ1 A;  4MAD A;  2WO3 A;  4PQQ A;  2VZ3 A;  3T2O A;  3WF4 A;  3T2P A;  3D3A A;  3VD5 A;  3P6B A;  3WF1 A;  1GOH A;  2Y6J A;  2J7M A;  1P8J A;  3WF2 A;  2JDA A;  5B4N A;  3LEI A;  3OGR A;  5EJ1 B;  2J1R A;  3VD4 A;  1W9S A;  2B9V A;  5IFT A;  3NJX A;  2YG0 A;  2VCA A;  5G04 L;  2CDO A;  4GWJ A;  1UXX X;  1NAE A;  5IJR A;  4JHZ A;  4JKK A;  3I2F A;  2VZP A;  3UES A;  3JXS A;  4E8D A;  4ET7 A;  2VCC A;  3A7Q A;  3MUY 1;  4LPL A;  5HPO A;  3I3B A;  3K77 A;  2VM9 A;  3WSO A;  2XON A;  4OMD A;  5C71 A;  3HNM A;  4M4P A;  2RVA A;  4ZZ8 A;  1KEX A;  2WN3 A;  4LHS A;  3SKJ E;  3OEA A;  3DEC A;  4HG6 B;  2J1E A;  2WYS A;  4KWU A;  3WF0 A;  4UOJ A;  4TTG A;  1OF3 A;  1J84 A;  2W1U A;  4ARX A;  5IYY A;  1ULP A;  3LQC A;  2C26 A;  2VOT A;  2DCK A;  1PX4 A;  2HLE A;  1UY1 A;  1DLC A;  4XUQ A;  3BN6 A;  2VMD A;  2RV9 A;  2VZQ A;  1SHW B;  3F2Z A;  4QX2 A;  4YPJ A;  4CU9 A;  3I3E A;  2EIB A;  2J22 A;  3IAP A;  2VZT A;  3I2K A;  4A6O A;  2V4V A;  2KD7 A;  4ZY9 A;  2W47 A;  2J1V A;  3C7F A;  4MO3 M;  4D0Q A;  2VO5 A;  4PT6 A;  3HNB M;  5C70 A;  3LE0 A;  2Y6H A;  3ZM8 A;  2VZS A;  2J1S A;  1LNS A;  4XZU G;  5LA2 A;  2VQT A;  3OBA A;  2E31 A;  3MV0 1;  1NX9 A;  2B4K A;  1OF4 A;  2VME A;  3LPF A;  4W8J A;  4OZO A;  3WF3 A;  2VZU A;  3VDC A;  3FHQ A;  3T09 A;  3WNP A;  2WAB A;  3DYO A;  2BGO A;  4MGQ A;  3OGV A;  1CX1 A;  1K3I A;  4XVH A;  3K4Z A;  3WNO A;  1TG7 A;  4KI5 M;  3HNY M;  2RJ2 A;  4M4R A;  1NKG A;  2WN2 A;  4QB1 A;  3I3D A;  2Y6G A;  2ORZ A;  4QX1 A;  2VR4 A;  4CVU A;  2BER A;  2J1U A;  3CQO A;  3OGS A;  2W95 A;  4DUV A;  1JZ8 A;  5FUI A;  2WO1 A;  4P00 B;  1EUT A;  3GXU A;  4RN5 A;  2WZ8 A;  2CDP A;  4QX3 A;  4QDQ A;  2W9X A;  1OH4 A;  1UMI A;  3NRU A;  3SEP A;  1UZ0 A;  1XPW A;  1KGY A;  4CUA A;  2W3J A;  3THC A;  3AC0 A;  2L9L A;  2J1T A;  5LA0 A;  3LEK A;  3VD3 A;  3GDB A;  2YFU A;  2ZEY A;  3HEI A;  2VJX A;  1HN1 A;  3ABZ A;  1CZV A;  2J1A A;  1JZ2 A;  4DUW A;  1JYX A;  3T0A A;  4DEQ A;  1TVG A;  2QBX A;  2VMC A;  1W9T A;  3EYP A;  2JKX A;  5JMO A;  3J7H A;  2W91 A;  2W94 A;  3E1F 1;  2ORX A;  3SKV A;  2YC2 A;  2EIE A;  4L0P A;  1ULO A;  3VDA A;  3T2Q A;  2E33 A;  3OG2 A;  5JXI A;  4CU8 A;  1O8S A;  2WQ8 A;  1US3 A;  2PQS A;  4QB6 A;  5F7U A;  1SDD B;  4A4A A;  1K45 A;  3C8X A;  1PMH X;  1US2 A;  5JUV A;  1UWW A;  3WEZ A;  3WNL A;  3W5N A;  1UY0 A;  2W1W A;  1RYY A;  2VQU A;  3BGA A;  1UXZ A;  5EIY B;  4A42 A;  5G05 L;  2C9K A;  3P1I A;  1JZ5 A;  1UYZ A;  3FN9 A;  1JZ3 A;  4P08 A;  5LCW L;  2DCJ A;  4P5Y A;  3CKH A;  3W5M A;  3MBW A;  3DYP A;  3K75 B;  2OKX A;  4P02 B;  3HOB A;  3WNN A;  2WO2 A;  1OD3 A;  1J83 A;  4XUP A;  3C7G A;  2WZE A;  3SEE A;  5I0D A;  2WUH A;  4GWI A;  5JR2 A;  2BGP A;  1JHJ A;  1JZ4 A;  4XUN A;  2QQJ A;  3VD9 A;  3U37 A;  2VZR A;  4AG4 A;  2X10 A;  2YB7 A;  3III A;  4A45 A;  4BXS V;  4ZZ5 A;  1JU3 A;  1WKY A;  2WAO A;  4MOA A;  1L7R A;  1UY2 A;  3PUH A;  2V5D A;  3I2J A;  5C7G A;  1O59 A;  3C7H A;  4XUT A;  5A1A A;  4JKL A;  3K4D A;  1H6Y A;  3I97 A;  4UAP A;  3I2H A;  2W1S A;  3EB7 A;  1UY4 A;  4OYU A;  2X05 A;  4CU7 A;  1CZS A;  1D7P M;  5B4X A;  4XUO A;  4BK4 A;  3A23 A;  3NJV A;  2QQM A;  4OUE A;  2Y64 A;  2E26 A;  1W8O A;  2VTF A;  2W87 A;  2VZO A;  4IUG A;  1W8N A;  3ACF A;  1L7Q A;  1XNA A;  1UYY A;  2ID4 A;  1XC6 A;  2WBK A;  1SG3 A;  4Z2A A;  1UX7 A;  2LS6 A;  4BJ0 A;  2W92 A;  3GGL A;  2BZD A;  2R7E B;  5DMY A;  1I5P A;  3OB8 A;  3ETP A;  2Z4F A;  1JYW A;  1K12 A;  2VCB A;  1DP0 A;  1CZT A;  3MUZ 1;  4QB2 A;  2EIC A;  3IDA A;  4BK5 A;  2BBA A;  4CUC A;  3DYM A;  3T0B A;  4QX0 A;  4DXS A;  4ARY A;  4W50 A;  5LA1 A;  4DUX A;  5IFP A;  2Y6K A;  3ACH A;  1W9W A;  5HXM A;  4A41 A;  1UMH A;  2XHN A;  1GU3 A;  2V72 A;  5JXH A;  1GUI A;  5JXG A;  4DEV A;  1JYN A;  4CU6 A;  1JYV A;  1GOF A;  4QAW A;  1O8P A;  3NQH A;  3CMG A;  3HJR A;  4GZ9 A;  5DN2 A;  5CZK A;  2VZV A;  1W99 A;  1T2X A;  3IAQ A;  3A22 A;  4PF1 A;  4JKM A;  5CYY A;  1JI6 A;  4A44 A;  4AAX A;  3K46 A;  3CZU A;  2YC4 A;  2QQO A;  4UI9 L;  3VD7 A;  1OT5 A;  3WNK A;  4LKS A;  2ZEZ A;  2QQK A;  1MPX A;  1WCQ A;  4LQR A;  1W0N A;  3MV1 1;  2ZEX A;  4QPW A;  4DXR A;  1EUU A;  3THD A;  1R64 A;  2E32 A;  3MO4 A;  2WDB A;  4OMC A;  4MGS A;  3HN3 A;  4DXT A;  4JX0 A;  5DPN A;  4D8M A;  2DDU A;  4QDR A;  2ZEW A;  1K42 A;  1UYX A;  2W1Q A;  2VMF A;  4E8C A;  3UET A;  3T0D A;  3I2I A;  1F4H A;  4TXW A;  1H6X A;  5EJZ B;  3IB3 A;  3LEG A;  5JXJ A;  3UNP A;  2ZXQ A;  4KMQ A;  3C7O A;  1UY3 A;  3LPG A;  2XOM A;  2Y6L A;  2LW8 A;  2W46 A;  2JE8 A;  3NNG A;  1NUK A;  1GQP A;  2VL4 A;  1F4A A;  2QQL A;  1GOG A;  3ECQ A;  4BDV B;  3GM8 A;  1CIY A;  3CIH A;  3CZJ A;  4RYD A;  3A21 A;  2HYX A;  1JZ7 A;  1GNY A;  2EID A;  4W4Z A;  1BHG A;  5DQ0 A;  1JU4 A;  2WAA A;  1DYO A;  4ZXE A;  2XQX A;  2C4X A;  1XNT A; 
#chains in the Genus database with same CATH topology
 3SQO A;  2UYA A;  2WA4 A;  2Y8K A;  1NLQ A;  5LAS A;  2QQN A;  3W21 A;  2XVG A;  4CDW C;  3MID A;  4OI2 A;  3N35 A;  3MYX A;  3PVO A;  2VXJ A;  3ACI A;  4FFG A;  2JG8 C;  5J09 A;  3AZV A;  2QQI A;  5FZ9 A;  4Z92 B;  3VV1 A;  2X09 A;  4QPG B;  2YFZ A;  1RMU 3;  4BIF A;  3IM0 A;  4GB3 3;  3EXU A;  3ILN A;  2W5F A;  5IAT A;  3V0A A;  2PXJ A;  5JOZ A;  3FWE A;  3VHR A;  1Y4W A;  3VZM A;  4BB3 A;  2H0B A;  2NZ9 A;  3MIB A;  3OSD A;  5KR7 A;  5KXC A;  1FV2 A;  1LB2 A;  2R49 A;  3SIS A;  4OHZ A;  2WLQ A;  1CAW B;  2WC2 A;  3CF6 E;  4FI9 A;  5C3R A;  3OCP A;  3BOP A;  4PLM A;  2D43 A;  2D6O X;  1NZC A;  4RHV 3;  4NPM A;  3ZN5 A;  1PMJ X;  1V6J A;  2B7Y A;  2FCU A;  5GLZ A;  2ZGP A;  2XUE A;  2ATF A;  1U5Y A;  3FHA A;  4V1P A;  4Y1U A;  2HWD 3;  1DGR N;  2P6C A;  2RJL A;  2CGN A;  4QKF A;  1ALY A;  2G4I A;  2KA3 A;  2ZHL A;  4NHK A;  4RQP C;  3WQ7 A;  3ZYG A;  4PQQ A;  2CTV A;  2B9U A;  4EQV A;  3M4F A;  3U07 A;  2MEV 3;  3J9S A;  1ENQ A;  5ABJ B;  1KDK A;  4XDO A;  3D3A A;  4Q2F A;  4KBB A;  4QT6 A;  2VW0 A;  2CGO A;  1CVN A;  4NRQ A;  2Y6J A;  4JRA A;  2J7M A;  2FZ2 A;  2AEZ A;  4MVT A;  1E5R A;  5B4N A;  2JIJ A;  2XR4 A;  1NCQ B;  1NOV A;  1W3V A;  2KM2 A;  1PMI A;  2YMZ A;  1JOP A;  1FNZ A;  1RUG 3;  2BU9 A;  1RGS A;  3CLP A;  2B9V A;  5IFT A;  3NJX A;  3D6E A;  1OOP C;  4AVS A;  4UFM A;  4AK3 A;  3BTA A;  4Y1Z A;  1FPN 1;  2JDH A;  4GAL A;  2FD8 A;  1GZW B;  2IFW A;  3I7D A;  2XML A;  4LOS A;  2QZ2 A;  1CAW A;  4AVC A;  3O1O A;  4JHZ A;  4YAR A;  1NE4 A;  2JDZ A;  3I2F A;  4JCK A;  2VZP A;  1REE A;  4QPI A;  4YW1 A;  4AAP A;  4E4H A;  4B1M A;  3N9P A;  2R32 A;  3FBM A;  4BWO A;  2G9Z A;  5FYU A;  4A3X A;  5BNN A;  4P9L A;  4I02 A;  4E2G A;  3K77 A;  1DBN A;  1Q8P A;  1UAI A;  2XON A;  1W2T A;  4DZG A;  3V65 A;  1V9U 1;  3NV4 A;  2R6Q A;  4XQ4 A;  1IQA A;  5A7P A;  3TN9 2;  5J36 A;  3DEC A;  1KS4 A;  2DVA A;  2VVD A;  3ZYF A;  5H9Q A;  4CXY A;  2XVL A;  2XBO 1;  4UOJ A;  3PU3 A;  1RMU 1;  3VBU C;  4TTG A;  1UKR A;  3M3Q A;  3NJY A;  5LBF A;  1AVB A;  1RUH 1;  1J84 A;  2QDR A;  4ARX A;  2ARB A;  3B3Q E;  4B3N A;  3GZE A;  3WW3 A;  3QOP A;  1S0D A;  4D7Y A;  2F4P A;  3LQC A;  1JUI A;  3LOI A;  3U11 A;  2DCK A;  2Q8C A;  4NHY A;  2WZP P;  1HXS 2;  1PX4 A;  2Z69 A;  1UY1 A;  4XIL A;  1PM4 A;  1PZ8 A;  2R0H A;  4P9I A;  5FZ7 A;  3WIN E;  2RV9 A;  3GF6 A;  2BBV A;  1MAC A;  1NZI A;  1V6N A;  2RMU 3;  2VZQ A;  1W39 A;  4YPJ A;  4FBF A;  3RG0 A;  1SCR A;  1W2U A;  3ZFE C;  5FY5 A;  4AFD A;  3OD0 A;  3LFI A;  1TE1 B;  3I2K A;  4A6O A;  4TWT A;  4K8R B;  4D0Q A;  4NO4 A;  3C7F A;  3KLS A;  3RQ0 A;  4LKF A;  3JD7 2;  5A7Q A;  2PHU A;  4AHZ A;  4D3W A;  4YFW A;  2JEM A;  2Q1Z B;  4CEW A;  5B2G B;  1K5M B;  3POW A;  4XCA A;  4YGB A;  2D5H A;  4MUV A;  1VBC 2;  1OOP B;  4FSJ A;  4XZU G;  5LA2 A;  3OBA A;  2HWE 1;  1OLM A;  2E31 A;  3GAL A;  3U0Z A;  4UF0 B;  3U1X A;  4EN0 A;  2ZTN A;  5GJ6 A;  2VME A;  3RWK X;  1RMU 2;  5A6Z A;  4OZO A;  2ZZQ A;  3M3E A;  4COV A;  5M0T A;  4MV2 A;  2VZU A;  3FHQ A;  1KFU L;  1XSR A;  4HN0 A;  4RGK A;  1JYT A;  3T09 A;  4WV8 A;  3V0B B;  3WNP A;  4BE3 A;  4AQ2 A;  1MS8 A;  5ERL A;  2BGO A;  3UGG A;  4GWN A;  1ZZ7 A;  3AVS A;  4TZD A;  2PHX A;  4G3Y C;  5JAX A;  2UUR A;  2VUJ A;  2CSG A;  1N3P A;  3K4Z A;  2GNT A;  5IVY A;  1DG6 A;  1QJU 3;  2O1Q A;  2R1D A;  4ONU A;  5J48 A;  3ZYP A;  2DV9 A;  3OYW B;  1JOJ A;  2LAL A;  4LO4 B;  4Y22 B;  4XAC A;  1A8M A;  4M3C B;  1FPN 2;  1F5F A;  4QB1 A;  1MVE A;  3I3D A;  3KCC A;  1SLL A;  1ZBA 2;  3HBZ A;  4QX1 A;  4BQX A;  3H8R A;  4CDU A;  1YI7 A;  1VBD 3;  4CXW A;  3MLJ A;  5I8T A;  1LHU A;  2BER A;  1COV 3;  5CU1 A;  3VBH C;  2W95 A;  1CIW A;  3IPV B;  2WL1 A;  1J1L A;  2RDQ A;  4YZ1 A;  5C3P A;  4PI0 A;  4YW6 A;  5FUI A;  2PHL A;  4RN5 A;  2GC3 A;  5D2A A;  1RUI 2;  3QLQ A;  3LSD A;  4QX3 A;  1W0P A;  5JIU A;  1AYM 3;  1VAV A;  4FXG B;  1UMI A;  4LBM A;  3WP5 A;  3R4D B;  4R9D A;  3PUA A;  3SEP A;  1SLA A;  5LBC A;  4CUA A;  1KGY A;  3WDU A;  3RNS A;  2VUC A;  2ZAC A;  5KWR A;  2L9L A;  2RM2 1;  4DRR A;  4IET A;  1RVF 1;  3AMQ A;  1GP6 A;  3GDB A;  2PA7 A;  2NQY A;  4JTO A;  4RS5 C;  2E9Q A;  2RR1 2;  2LM3 A;  2ZML A;  3QD6 A;  2V09 A;  3V56 A;  1LU1 A;  1TVG A;  1C8M 3;  4EZ4 A;  3GBG A;  1W9T A;  5ACA 3;  2O14 A;  2ZX0 A;  3EYP A;  1HN0 A;  4EN6 B;  1PVC 3;  3W20 A;  2UWC A;  1RUG 2;  3E1F 1;  4PIY A;  1OBN A;  2JDK A;  3U14 A;  1V6I A;  3SKV A;  2YC2 A;  1Y9M A;  5LBE A;  4L0P A;  4PHZ A;  3VBO C;  1WW5 A;  3MF9 A;  4HBN A;  5JXI A;  1POQ A;  2PEL A;  5FPB A;  3MHZ A;  3NNM A;  5FYS A;  3OJB A;  5FYT A;  3ZYI B;  3WDW A;  1PIV 3;  3DKQ A;  2PQS A;  2A6Z A;  2GME A;  1PO1 3;  2JX9 A;  5F7U A;  2IXJ A;  4NRP A;  5BV6 A;  1H9P A;  5C4W B;  4LBK A;  1JOB A;  1W04 A;  2JIC A;  2TUN A;  3UV9 A;  4CCN A;  1UWW A;  4ZHN A;  4FCA A;  2SLI A;  3WEZ A;  2WNU C;  3WNL A;  4QQO A;  4XCB A;  5FRA A;  1UZV A;  2BNO A;  1W6N B;  2GND A;  2ZZJ A;  2GC2 A;  4M3C A;  5T55 A;  1HB1 A;  2EF6 A;  5DZG A;  3AMM A;  4XFG A;  1EV1 2;  3WG4 A;  1CJP A;  2VQU A;  3LB9 A;  3MW2 A;  1OLM E;  4QGM A;  1Q8Q A;  3KB5 A;  4YM0 A;  3RMY A;  4AHX A;  1ZBA 1;  4LBN A;  3P1I A;  3TBD A;  3PTR B;  4Z1V A;  1WME A;  2OXB A;  3RYR A;  4MX3 A;  5F5Q A;  4GA9 A;  4AL9 A;  4P08 A;  4S2H A;  2DVB A;  4YZ4 A;  2DCJ A;  3VHO A;  3CKH A;  2WNV C;  3MBW A;  1JXN A;  4IEW A;  5AC9 3;  3POF A;  3W5M A;  2D6P A;  2A75 A;  1NQJ A;  1AR6 1;  2D6K A;  4LUL A;  2OKX A;  3KCY A;  3WNN A;  1IPJ A;  4BQ3 A;  1F9K A;  2WO2 A;  5FZL A;  1REF A;  3POB A;  3VBO A;  4EWE A;  3QH6 A;  5F37 A;  5J96 B;  3TNP B;  3C7G A;  3NNF A;  4CRQ A;  5LEK A;  4BU2 A;  2ENR A;  5C9A B;  3TEW A;  3PUQ A;  3SEE A;  5I0D A;  4YG6 A;  4QMA A;  4UFH A;  1ODN A;  1G9D A;  4XUN A;  5CB7 A;  2A3W A;  3J26 N;  4Q4V 3;  1OPO A;  1AR6 3;  2X10 A;  2O0O A;  3III A;  1R08 1;  3VBS B;  1QJZ A;  3VZJ A;  2WZR 1;  4M3C F;  3WW2 A;  4A45 A;  4ZPI A;  1H0B A;  4QQH A;  4LEJ A;  3OOX A;  3TEY A;  1RUC 1;  5BYN A;  1L7R A;  1LAJ A;  2XJV A;  3O1U A;  3PUH A;  4IDZ A;  1D0G A;  1O59 A;  4M0H A;  1QXJ A;  4XUT A;  5D8A C;  1YI9 A;  4JKL A;  4WVM A;  3JB8 A;  2NM1 A;  1HX6 A;  4NID A;  3ZXJ A;  4YM1 A;  4PBP A;  1IS5 A;  3LKJ A;  1DGR A;  1HRI 2;  4N9H A;  1RUN A;  5FK8 A;  5T54 A;  4KGG A;  3KV9 A;  3AKP A;  3EB7 A;  3SH5 A;  5F6K A;  2VXR A;  5GZF A;  4XET A;  3E97 A;  1G9A A;  2MHF A;  1UD1 A;  3CJI A;  4NPR A;  3T4V A;  1APN A;  1D7P M;  4J1X A;  1AR9 2;  2IC1 A;  3PIG A;  2GNM A;  4XHB A;  4B7K A;  5K0U C;  4XUO A;  4RR3 A;  1S1A A;  3NJV A;  1XYP A;  4OUE A;  2E26 A;  3NAP C;  2ZMN A;  4YGE A;  5L7O C;  4RL7 A;  1Y3T A;  2W87 A;  3ZXF A;  1W8N A;  1XNA A;  3ACL A;  1Y9G A;  2ZGL A;  1SBE A;  1AR9 3;  3O1V A;  3T3Y A;  1JUH A;  2XBO 2;  4BQW A;  1VIW B;  3CU7 A;  5A6X A;  4LA2 A;  4YRD A;  4BJ0 A;  5LEJ A;  1HRV 1;  1GQH A;  1QXP A;  1YFU A;  2BZD A;  2LUW A;  4JGY A;  1LOE A;  4QX8 A;  4CDX A;  1TEI A;  3JCI A;  2EVX A;  4HLT A;  3M70 A;  4COY A;  5FFO C;  5ACA 1;  3ZIW A;  5C33 A;  1C8M 1;  2PLV 2;  2JB8 A;  2XB6 C;  1XE8 A;  4P5H A;  1RUD 2;  3PVB B;  2GZW A;  4ZON A;  1CZT A;  3MUZ 1;  4LK7 A;  5CFC B;  1ODM A;  5L36 A;  1LOA A;  1X33 A;  4IGP A;  1HLC A;  4S2D A;  1NQD A;  3WVJ A;  5GKA C;  1LHN A;  2EIC A;  1R1A 1;  2BBA A;  2ZKN A;  3DYM A;  5IVJ A;  4I09 A;  3AX4 A;  2R07 2;  2E7Q A;  3MIG A;  4AOC A;  2OVU A;  3K48 A;  4J25 A;  3ZSK A;  2GMP A;  1BMV 2;  3OBZ A;  3D4K A;  5DG2 A;  5FO9 B;  4CP9 A;  1ULC A;  3KGZ A;  3B9C A;  5DAB A;  3H8O A;  2QUO A;  1RUE 3;  4I01 A;  2XHN A;  2JWP A;  3LA2 A;  1D4M 2;  3OYW A;  3U78 A;  2DYC A;  3WUC A;  2V72 A;  1OKO A;  1Y7B A;  2P4E A;  1PO1 2;  1JYN A;  1JYV A;  5KHH A;  5IK4 A;  1ZM1 A;  4LJH A;  5AC9 2;  3KQ4 B;  1GQG A;  3A0N A;  4AED A;  1GZT A;  2QQP A;  1W6P A;  1F2N A;  2Y33 A;  3P3N A;  3VBH B;  4E2S A;  5DZE A;  3ZDV A;  1W99 A;  5K0U A;  1ZZB A;  4S2F A;  3IAQ A;  2VOK A;  4HKO A;  2H6B A;  5JI7 A;  1S55 A;  1STM A;  2VVF A;  2R07 3;  4C91 A;  4JKM A;  3BB6 A;  4IE0 A;  2BDR A;  3N36 A;  3PU8 A;  1GLH A;  2YRO A;  4XAB A;  5A3O A;  3IDE A;  3IPV A;  1QOT A;  5FYB A;  2BOI A;  2QQO A;  5LA9 A;  5T5O A;  4DS0 A;  4ZU4 A;  4YW3 A;  4BQ1 A;  3V0B A;  2JG9 A;  4N43 A;  5LB6 A;  4COZ A;  1FOD 2;  2JG9 B;  4N43 B;  4LIV A;  2QQK A;  4JGZ A;  3AMP A;  1AL2 1;  3FBY A;  4FPC A;  1VBE 2;  5A3L A;  1IS6 A;  4M00 A;  1I5Z A;  3PMS A;  5FUN A;  4BOW A;  1IG3 A;  2JXA A;  1AYN 3;  2A7A A;  5GZE A;  1QEX A;  3I49 A;  3MV1 1;  1GP4 A;  2ZEX A;  3ZDS A;  1G9B A;  4LR4 A;  5IK7 A;  2ZGS A;  3HMY A;  2JDM A;  4QKN A;  3ALQ A;  1AXY A;  4CCC A;  2CAU A;  5HV4 A;  4IV3 C;  1OVP A;  4AI3 A;  2WFF 3;  1FYU A;  2VY0 A;  3ITQ A;  1RUO A;  1S2B A;  3RJ2 X;  5F3C A;  1G86 A;  3T1M A;  4MGS A;  4AFM A;  1AL2 2;  1BXH A;  2VNV A;  4NOT A;  3JD7 1;  4UFI A;  5DPN A;  4DPN A;  5C5U A;  3O1P A;  4XJA A;  1GYK A;  2ZEW A;  3GYD A;  2A1X A;  3IKW A;  3OGG A;  2EAA A;  3PNA A;  5E16 A;  4AF9 A;  1V9U 2;  1MEC 2;  1VRH 3;  2ZAA A;  4B29 A;  4NWV A;  4HON A;  2RR1 3;  2Y38 A;  1F4H A;  2X29 A;  5DUX A;  4Q4V 1;  3PVE A;  2WNO A;  3MIE A;  5BNP C;  1OA2 A;  3LEG A;  3WDX A;  4BQ4 A;  1GAN A;  2HH9 A;  4N90 A;  5DUV A;  4EN9 B;  1FMD 2;  1XYN A;  1HB2 A;  1ZNP A;  1UY3 A;  5BNN B;  4PIZ A;  1RUH 3;  4CDW B;  5LW9 A;  5FZF A;  4HVR A;  2DF7 A;  4RD7 A;  1GQP A;  2VL4 A;  2HEY F;  2QQL A;  5L9B A;  1GOG A;  3ECQ A;  1G9C A;  3FLP A;  3GM8 A;  5KHI A;  3CZJ A;  2B46 X;  1CJD A;  3BCW A;  3PVN A;  4RYD A;  5FMB A;  5IAX A;  5AC9 1;  2QQW A;  1RUI 3;  1SLI A;  2JDP A;  5I0U A;  3IT8 A;  1QJX 1;  2HYX A;  3HN1 A;  4BQY A;  1JTZ X;  4DRV A;  3ILR A;  2EID A;  5C70 A;  5JLV A;  5K0U B;  1OD5 A;  3FX3 A;  4JC1 A;  4QU2 A;  1BHG A;  1JU4 A;  1N3Q A;  2OPK A;  4FPH A;  2HWC 1;  4ORF A;  4N53 B;  2XJQ A;  1DYO A;  4R9A A;  1ZRF A;  1F8V A;  1NG0 A;  5DAV A;  2VNG A;  4Q27 A;  2RS3 3;  1R09 3;  2C4X A;  3GBF A;  4JGY B;  5CFC C;  2JDN A;  1XB9 A;  2WIN B;  3KV4 A;  4MZU A;  5H9P A;  5JOW A;  4P9J A;  4YYO A;  5FUP A;  1UF2 C;  4QDS A;  5GZG A;  4P9W A;  2VC9 A;  3POE A;  3T08 A;  1CPM A;  2C6S A;  2FQP A;  1ENX A;  3ZOI A;  1PGS A;  2A5Z A;  1JZ6 A;  3IZO A;  2R04 2;  4IGQ A;  3AL5 A;  4LIT A;  5FZ0 A;  3I2G A;  2OUJ A;  3VKO A;  3ME2 A;  1NA1 C;  4CE8 A;  1PX3 A;  2JE7 A;  1RUD 1;  4EV0 A;  4TYS A;  1RHI 3;  4CUB A;  1YEW A;  5FZK A;  2WII B;  3VBS C;  1LHV A;  4PJY A;  2ZGN A;  5D1I A;  4Y5T A;  3IDC B;  4PQ9 A;  1BQP A;  3HPN A;  4GB3 2;  5KXB A;  1RIN A;  3J8F 3;  1LUL A;  4AZZ A;  2JD9 A;  4IEP A;  3KV5 A;  3WQB A;  5ABJ C;  5F2W A;  4JAA A;  3AXD A;  5IHR A;  3VDB A;  2OA2 A;  2JG8 A;  1QU0 A;  2UU8 A;  2ZMK A;  1YO8 A;  3TN9 3;  2EA7 A;  5HCA A;  4B4Q A;  2GSY A;  4NIH A;  5T5J A;  2VZ3 A;  2CL2 A;  2B8M A;  1CAU B;  4YVW A;  5ANN A;  3ZX7 A;  3UT0 A;  5FOB B;  3VD5 A;  3WF1 A;  4CCE A;  1DGL A;  1HQL A;  3AZZ A;  2DU1 A;  1QNY A;  4IQP A;  3DPR C;  4XXA A;  3I2O A;  5ABJ A;  1KFX L;  1P8J A;  3H3U A;  2JB4 A;  1LCL A;  2ERF A;  1QOS A;  2RM2 3;  5CAD A;  4XF9 A;  5FPX A;  4ZU5 A;  4DY3 A;  5DUU A;  4DO0 A;  3ILF A;  3V0A B;  5J7M A;  4NHL A;  1WWY A;  2ET1 A;  1NA1 B;  1VB2 A;  3HT1 A;  4ERO A;  3KS7 A;  1HRI 1;  4TLG A;  4XJZ A;  5G04 L;  3T4H B;  3O0V A;  2C0Z A;  2D6N A;  5IJR A;  4PBO A;  3AMH A;  4PCR A;  5I0S A;  1XOY A;  5FZM A;  2WNU A;  1LGN A;  4DQA A;  4E2Q A;  1E5I A;  3URF A;  3UES A;  3APB A;  4ET7 A;  1HRI 3;  1EAH 2;  1EAH 3;  4JGZ B;  1VBD 1;  4WVZ A;  2VCC A;  4CCL A;  3I3B A;  1BCX A;  4MGY E;  1W9F A;  4L97 A;  4OMD A;  5DXD A;  4AI9 A;  5C71 A;  1AJK A;  1DYP A;  1WBL A;  2RVA A;  1KEX A;  4LHS A;  2VNR A;  4LO5 B;  4DNY A;  4ZZ8 A;  2SBA A;  2GAL A;  4HG6 B;  4FFI A;  2GC1 A;  4QXB A;  3WF0 A;  5KBF A;  1F15 A;  2YGM A;  5A7W A;  1OF3 A;  5F5A A;  4EWA A;  1CR7 A;  2W1U A;  1C57 A;  4BLI A;  1CGP A;  4QKB A;  1SCS A;  4YZ2 A;  1UU6 A;  4K21 A;  1OQD A;  1VRB A;  3VBS A;  3ZXD A;  4QD2 A;  5BNO B;  4Z82 A;  4Q26 A;  3H42 B;  5FLH A;  2VCM A;  2HLE A;  1POV 0;  1SAC A;  2EAL A;  4X6R B;  1JN2 P;  1F31 A;  3PME A;  5LRR A;  4O65 A;  2NMN A;  4N9I A;  3DPR A;  1JHN A;  3J8F 1;  1RTV A;  1W8W A;  4Q4Y 3;  4CU9 A;  2XHK A;  3ZXK A;  1WA6 X;  3I3E A;  3G7D A;  2EIB A;  5T5P A;  1JYI A;  5FY8 A;  1PO2 1;  3WDV A;  2ZGO A;  4CEY C;  3Q8E A;  4ASL A;  2BP6 A;  3ORJ A;  2KD7 A;  4CZS A;  3C3V A;  2W47 A;  2PQQ A;  2E7T A;  2VAU A;  1TME 1;  4ZS3 A;  4AVA A;  1D4V B;  1OH3 A;  1DLL A;  1WCD J;  1ZA7 A;  2ZGK A;  1B35 B;  3N7M A;  4PT6 A;  2B45 X;  4NE9 A;  3DV8 A;  3LE0 A;  5EWS A;  4QGN A;  4YW2 A;  5C8C C;  2J1S A;  3ST7 A;  2ARX A;  3VB9 A;  4ZU7 A;  1ZA4 A;  5C9A A;  4XW3 A;  3NMB A;  4YZ3 A;  3BYW A;  1WMX A;  2VQT A;  4WVW A;  4OHW A;  1T6B X;  4FXK B;  4LT5 A;  2RMU 1;  5EJ3 A;  1BYH A;  2B4K A;  1OF4 A;  3LPF A;  3T2T A;  5JOX A;  3MDP A;  2AYH A;  3MF6 A;  4IES A;  4MH0 E;  4W8J A;  1GNZ A;  4ATE A;  4XZP A;  1UQX A;  1D4M 1;  5FXZ A;  4CA9 A;  4CP9 B;  1RUJ 2;  3SCG A;  2HWC 3;  2DUO A;  3I59 B;  3AKQ A;  4AVV A;  1VBA 1;  4E27 A;  1TMF 3;  1OA3 A;  2CV6 A;  2A6V A;  3JQX A;  4M01 A;  5A1L A;  1KQR A;  5F5I A;  2G1M A;  5FZ6 A;  4BPZ A;  1ND2 A;  1QJX 3;  3H3L A;  3N9N A;  4QHO A;  4AGG A;  4Z2W A;  1DZR A;  3NWK A;  2ZGM A;  5EFU A;  5CVR A;  1YFY A;  3HNY M;  5SV8 A;  2H6C A;  1O5L A;  5LRS A;  2YV8 A;  3H0O A;  3JBG 3;  1TQ5 A;  3VKN A;  2FZ1 A;  5A3T A;  3VDD B;  4RR3 B;  5T50 A;  2VR4 A;  4FOW A;  1GSL A;  5FZG A;  4OVE A;  4I30 A;  4CVU A;  1FX5 A;  2J1U A;  1C8M 2;  2PLV 1;  3OGS A;  4FPL A;  1UMZ A;  2YC0 A;  4YW5 A;  5FPU A;  1JZ8 A;  1VBA 3;  2RR1 1;  1V70 A;  3LGR A;  2WO1 A;  4P00 B;  1E57 A;  5C9A C;  5KXE A;  5E8A A;  1AR7 1;  3ZXL A;  1RVF 2;  5CG9 A;  2CDP A;  2W9X A;  2P3J A;  2ZGR A;  1TMF 1;  3F95 A;  4MXW A;  1H8T A;  5T52 A;  2W39 A;  3I2D A;  3NO8 A;  2YGL A;  3LWC A;  1YFX A;  4CDW A;  5I0R A;  2Y34 A;  5JI9 A;  4WVM B;  3THC A;  2VTX A;  3FC0 A;  4KNC A;  3AYD A;  2CHH A;  3D82 A;  2K9Z A;  4QM9 A;  2ZEY A;  3E6C C;  1FOD 3;  3M2M A;  3QBQ A;  4HMZ A;  4KWK A;  4Y22 A;  1PZ9 A;  2J1A A;  3RSJ A;  2R06 2;  3T0A A;  1PO2 2;  2WA3 A;  4DEQ A;  1AYN 1;  4OZX A;  1ZVF A;  1O91 A;  2W52 A;  2BYV E;  4BH9 A;  4CEW B;  5FZH A;  3S7E A;  1VMJ A;  1B35 A;  3HQX A;  4MGT A;  2A70 A;  3CEW A;  5FZC A;  1DGW A;  2OPW A;  2FHR A;  3SIT A;  2X5I B;  4RGG A;  4BHP A;  3GZT B;  2ET7 A;  1WD3 A;  4AED C;  1QH6 A;  2EIE A;  1C28 A;  3C2U A;  4Q4Y 1;  5K7P A;  2IXI A;  1W8H A;  5CIR A;  3T2Q A;  3S5A A;  3ZFG B;  3WDY A;  1WMD A;  4COU A;  4WVV A;  3NKT A;  1J3P A;  4IEZ A;  1RXF A;  3H50 A;  2YDE A;  2UY8 A;  1ND2 C;  4WM8 A;  2BPA 2;  4QB6 A;  4XJW A;  1QJF A;  1SDD B;  4J6G A;  4A4A A;  5C4W C;  3BKZ A;  5A6Q A;  4R4X A;  4MSV A;  1PMH X;  4URA A;  4V2V A;  2DVF A;  1US2 A;  2WNV A;  3EQE A;  1DZQ A;  4LE3 A;  4XE9 A;  5FZO B;  4LOT A;  2VNO A;  5A32 B;  3WT3 A;  3IMM A;  1QY4 A;  4S2G A;  4I0B A;  3TNQ A;  1EAH 1;  1XYO A;  2W1W A;  4HVQ A;  3BGA A;  1YWK A;  5FPV A;  1Q3E A;  3O0X A;  4O9G A;  2C9K A;  4AWD A;  2ADE A;  4LHN A;  4U36 A;  4IEX A;  2HWB 1;  1LRH A;  4LTA A;  5FK7 A;  5F9T A;  5KC5 A;  2BFU S;  1JZ5 A;  3H8X A;  1UYZ A;  1JZ3 A;  4AHY A;  5HXV A;  3I3M A;  1SFY A;  4NRM A;  5LCW L;  4P5Y A;  4LA3 A;  3DXU A;  4BZ4 A;  4FOQ A;  4P02 B;  4GUL A;  3HOB A;  4K8F A;  1L7L A;  2ZHM A;  2UWB A;  4LOR A;  2RDS A;  2HBT A;  5LK7 B;  1CAU A;  2QVS B;  2VUA A;  2WRA A;  2IXL A;  1PVX A;  4AW7 A;  1W8F A;  1RUF 3;  1VLN A;  4CDQ A;  1JZ4 A;  4F8A A;  4XF0 A;  5DAW A;  3TN9 1;  2QQJ A;  3VD9 A;  2Q8O A;  3H1M A;  2VZR A;  4ZKT B;  3H3Z A;  5EPA A;  1C4R A;  1GKB A;  4IEV A;  4YLZ A;  4HSJ A;  4F3J A;  4ZZ5 A;  3P5B A;  3IN9 A;  1JU3 A;  4LBQ A;  1YQ8 A;  4LE4 A;  2WAO A;  3WDT A;  2PHD A;  4XTP A;  1OMI A;  2FDJ A;  1GZW A;  2B5H A;  5F3I A;  5FZ1 A;  1YYN A;  3RZK A;  4K7J A;  1O3R A;  3LOB A;  5A1A A;  5AFB A;  4YSF A;  1H6Y A;  2WJS A;  4OUM A;  2JG8 B;  5LBB A;  1RUD 3;  4PLO A;  1H1A A;  4RQP B;  3KHB A;  3UKN A;  2W1S A;  3LA7 A;  3RGB A;  3OPW A;  2JE9 A;  3B7M A;  1O5U A;  4CPB D;  5L9R A;  1AR8 1;  5ANQ A;  4CU7 A;  3VHN A;  5FY9 A;  4IEY A;  4R9C A;  1ND3 B;  2D3R A;  1WUV A;  3NL1 A;  1AYM 2;  2PYT A;  2QDN A;  5B4X A;  1W28 A;  3M3C A;  4NAO A;  3NW4 A;  1UU4 A;  1GP5 A;  4BK4 A;  3E5Q A;  5ACA 2;  3A23 A;  2Y64 A;  2D97 A;  2YBS A;  3AYC A;  3WG1 A;  1SPP A;  2RM2 2;  2VZO A;  1NCQ A;  2RDR A;  1L7Q A;  2P1B A;  3KSC A;  4QGL A;  1UYY A;  4ISR A;  1O4Z A;  2IWG B;  1H1M A;  1JW6 A;  2WBK A;  4LXL A;  3S30 A;  1W90 A;  4Z2A A;  4C8D A;  1RUC 3;  3JBG 2;  4PIX A;  1LHW A;  1ND2 B;  4CPB A;  1F35 A;  3AVR A;  3OF1 A;  1RUI 1;  1EP0 A;  1VE0 A;  1AX2 A;  2P17 A;  3FMG A;  2Z4F A;  4Y5S A;  2E51 A;  1K12 A;  1ZZ9 A;  2GN7 A;  4C1X A;  1ZZ6 A;  1QJX 2;  5HCH A;  1VAL A;  2P5B A;  4CDQ B;  3N7J A;  1GNH A;  1DP0 A;  2EXK A;  2X5I C;  2HWF 2;  3FFQ A;  4KQ7 A;  4QPG A;  3RMX A;  1I3H A;  4WM7 C;  1LEM A;  1LOD A;  3B69 A;  2FDH A;  3IIA A;  1M06 G;  4HT1 T;  2WKK A;  4BK5 A;  1K5M A;  4H55 A;  1IG0 A;  2GN3 A;  1W6Q B;  3T0B A;  2OQ6 A;  4KG0 A;  2Q0A A;  1FMD 1;  2DBN A;  1VRH 1;  3DKW A;  3KMH A;  2J42 A;  4QM8 A;  5LA1 A;  1L3J A;  4DUX A;  1C5I A;  2W2I A;  5A6Y A;  4Q4V 2;  1OUS A;  3HVD A;  4WBB A;  5GLU A;  2EAK A;  1W9W A;  2ZGU A;  4RSU A;  3NNL A;  4PLN A;  4LUK A;  1UMH A;  2LRP A;  2QCS B;  4EN8 B;  3SLI A;  4OQ8 A;  3N9L A;  4I3P A;  1IS4 A;  5JXH A;  1GV9 A;  5BUV A;  1R1Z A;  2PHR A;  2VMG A;  4URT A;  2H0V A;  1GOF A;  4QAW A;  1DQ0 A;  1UIJ A;  2VW1 A;  5KHG A;  1KRI A;  1PGL 1;  5DAQ A;  2YPJ A;  1X36 A;  2XQR A;  1M4W A;  1VBE 1;  1T6G C;  3OUH A;  4K20 A;  2VZV A;  4YVS A;  4FFF A;  4E4D X;  3RZZ A;  3RZJ A;  2IXK A;  1NCR A;  1PK6 C;  2Q1F A;  3A22 A;  1MZF A;  2ZAB A;  4PF1 A;  2E53 A;  2P37 A;  3WHU A;  3NST A;  4Q1P A;  3DXT A;  5FYH A;  1O4T A;  5CYY A;  3OBT A;  4UFL A;  4A44 A;  1LR5 A;  3USU B;  4K3U A;  3VL9 A;  4AAX A;  2GDF A;  5A3U A;  1LOB A;  2YC4 A;  2DVG A;  1VAM A;  1OT5 A;  1WGP A;  4Y4Y A;  3VD7 A;  1VMF A;  3USS A;  1WBF A;  5DDJ 2;  4YWA A;  4FPY A;  5F5C A;  1QWR A;  5DAX A;  2GMM A;  5DZF A;  5FBJ A;  3AFK A;  2OT7 A;  3LIH A;  4IEQ A;  1WCS A;  4IE6 A;  4QPI C;  5E88 A;  5FP7 A;  1W0N A;  1WA4 A;  1GWK A;  4E4Z A;  1X7N A;  4COW A;  1H8V A;  3THD A;  1R64 A;  1LU2 A;  1EPW A;  1RVF 3;  2D7F A;  2WQ4 A;  5HBA A;  3AKR A;  1YIP A;  2VQ0 A;  3MO4 A;  1SZB A;  4GKX A;  3VBH A;  3O1T A;  2AEN A;  4QX5 A;  4Y4R A;  4AQ6 A;  1B35 C;  5FYZ A;  3GJB A;  4YFZ A;  2VPV A;  3D0J A;  2P2K A;  3HN3 A;  4UW3 A;  4XFF A;  4JX0 A;  4RGA A;  4BQ2 A;  3ZYJ B;  1QGL A;  2DDU A;  2VTX J;  4QDR A;  1RC6 A;  2W68 A;  1KJL A;  5AVA A;  1C3H A;  4AEK A;  1AYM 1;  5BNQ A;  1GWM A;  5FMC A;  4Q0Q A;  5JSP A;  1SBF A;  4LLF A;  2DTW A;  1BKZ A;  3I2I A;  1QF3 A;  4TXW A;  3OGJ A;  2ETE A;  2XWB B;  4O61 A;  2HKX A;  4RQP A;  5JXJ A;  1UNB A;  3UGF A;  1O7F A;  3TEZ A;  5IAV A;  1VR3 A;  2XOM A;  4Y1X A;  1DFQ A;  3LIG A;  1XE0 A;  3G6J B;  4YW7 A;  3VZK A;  1QNW A;  1ULG A;  3PUR A;  5F1R A;  2RG4 A;  3K3O A;  3ZFF C;  1AF9 A;  5BXX A;  1CIY A;  1HV0 A;  3KT1 A;  4AVT A;  4BDV B;  2A6X A;  4GH4 C;  1VP6 A;  4HPK B;  3AFG A;  1POV 3;  4KH9 A;  1JZ7 A;  3JZV A;  1XU2 A;  4RFR B;  1RJ8 A;  1VBA 2;  3WQ0 A;  1HV1 A;  2BNM A;  3KCX A;  2PTM A;  2WAA A;  3WX5 A;  2VQA A;  4WZF A;  4D6R A;  3INA A;  2VOW A;  2F17 A;  3VUO A;  2XQX A;  3PUI A;  3AL6 A;  2BWA A;  1W8Z A;  1IQD C;  1S0I A;  4XUR A;  3ACG A;  4JDO A;  4O7X A;  3WZ1 A;  2XVK A;  3MI8 A;  5J98 B;  1VMH A;  2ZPX A;  3J4U H;  3JB4 C;  5D8A A;  1WLW A;  4I0A A;  2FDI A;  2DFC A;  3PJY A;  4KG8 A;  4FPO B;  2JD4 A;  2QKD A;  2NYY A;  1Z0H A;  3CDZ B;  3R05 A;  3LDB A;  4NIA A;  1H1I A;  3C7E A;  2AGS A;  4UFJ A;  3FL7 A;  3GZU C;  3NAP A;  4LHK A;  4AI2 A;  1BBT 3;  1MS5 A;  2RS1 3;  4X6Q B;  4RR3 C;  4NVP A;  5L7O B;  1FAY A;  2HWB 2;  5FZ3 A;  3ZKU A;  4HKL A;  3OPZ A;  5C8C A;  3TB0 A;  4A3Z A;  3WNM A;  5EXO A;  2DCT A;  1R09 1;  1W6M B;  2GH2 A;  2R04 3;  1HB3 A;  3PTY A;  4IW3 A;  3VBU A;  2PN5 A;  2JIG A;  5JR7 B;  3LZZ A;  3K4A A;  1GZ9 A;  4R52 A;  2BFU L;  3UGH A;  1OKQ A;  4M3C E;  2VZ1 A;  5HI0 A;  5A3M A;  4AFC A;  2WO3 A;  2WZR 3;  1WZX A;  3LCP A;  1FMD 3;  1QOO A;  3W59 A;  1R08 3;  5KXD A;  1CAX B;  4G4F A;  2UY9 A;  3ZSL A;  1GOH A;  4UFK A;  3WLU A;  4A6S A;  1O3T A;  1B09 A;  3WF2 A;  1W8U A;  1EY2 A;  2JDA A;  3HQU A;  3LFM A;  4IV1 A;  4AXO A;  1V9U 3;  1J3Q A;  3OGR A;  2XDV A;  1UOB A;  5EJ1 B;  4KU8 A;  1W9S A;  2G9G A;  1VPH A;  1HXS 3;  1CPN A;  2VCA A;  4F7Z A;  1YIF A;  2CDO A;  4GWJ A;  1UXX X;  1V6K A;  2DUR A;  1YCI A;  1JS9 A;  1BVV A;  1UZZ A;  1DU3 D;  1Y9Q A;  2XJU A;  5C8C B;  2VBB A;  5HCB A;  4ISQ A;  4JKK A;  4YVW B;  2DVD A;  5FZA A;  4IEU A;  5FDB A;  4IE5 A;  5FZI A;  2VOV A;  3MUY 1;  1DIW A;  3A7Q A;  4LPL A;  1Q56 A;  1IS3 A;  5F32 A;  5FY0 A;  2WNV B;  2Q8E A;  2YHJ A;  1AYN 2;  3AP5 A;  3AXE A;  3WSO A;  1MEC 3;  1BBT 1;  2RS1 1;  3V64 A;  4Y33 A;  4B8E A;  2ARE A;  2WN3 A;  1F5J A;  2ZX1 A;  1LES A;  3OEA A;  4FPE A;  4HZF A;  1GR3 A;  4P9X A;  4IV1 B;  4Q0P A;  2XLF A;  1CES A;  2PAM A;  1HB4 A;  2WWJ A;  2WYS A;  4LBL A;  3DCQ A;  3N7L A;  4KWU A;  3K51 A;  5FXW A;  5IVC A;  5FXV A;  3WY6 A;  1PO1 1;  3ZR5 A;  2D3P A;  2VW2 A;  5JDB A;  2VMI A;  2ES3 A;  4JZR A;  4QXC A;  2C26 A;  4QHZ A;  3MLL A;  2VOT A;  4HET A;  4IV1 C;  2ZX3 A;  4E9K A;  2ZJC A;  3RWN A;  1PIV 1;  3BN6 A;  5JZG B;  2VMD A;  1U12 A;  3ZYB A;  1DQ4 A;  3LSE A;  2D6M A;  2KXL A;  3QH7 A;  4RHV 1;  2TNF A;  3VBU B;  4H2A A;  2OW4 A;  5I8S A;  1SHW B;  4QX2 A;  3WXP A;  1BMV 1;  4FOV A;  2R07 1;  4IXL A;  4DY5 A;  4XFA A;  4UYB A;  3TAY A;  2RS5 3;  1FAT A;  2HBU A;  2J22 A;  1R1A 2;  2ARA A;  1POV 1;  5FBZ A;  3IAP A;  3ZPO A;  3GBW A;  2VZT A;  2WO7 A;  4UW4 A;  5FMO S;  2V4V A;  5IVV A;  1W06 A;  4RHV 2;  4YM3 A;  3KHC A;  4CDU B;  1ZYB A;  2ZKL A;  3MPP G;  4TLF A;  4XAA A;  4D94 A;  2XUM A;  1RUF 1;  1PNG A;  1PNF A;  3HNB M;  5C6C A;  3R6S A;  5FZ4 A;  3ZM8 A;  1NCQ C;  2P3Y A;  2VZS A;  4XFB A;  1CON A;  3ZSE A;  3E5X A;  3AP9 A;  4NAM A;  2ZAH A;  3I8T A;  3U4X A;  2CY6 A;  2R1B A;  4L8Q A;  5JMC A;  3DPR B;  5F8P A;  1W2N A;  2B42 B;  4UWD A;  3ZO0 B;  5FY7 A;  3LDR A;  3WF3 A;  1DF0 A;  3VDC A;  1G6N A;  1S0E A;  4RS5 B;  2OQ7 A;  1MR5 A;  1AX0 A;  4L99 A;  1DYK A;  2CU5 A;  4DOU A;  2WAB A;  3DYO A;  4AHW A;  5FZE A;  3RYK A;  5IVE A;  1CX1 A;  1RUE 2;  4AEJ A;  4Q5O A;  1K3I A;  4HXC A;  4I2O A;  4FAG A;  1R1A 3;  5L9V A;  4N8M A;  2Q4S A;  5FIX A;  3WP6 A;  5KHK A;  3SCH A;  3QAC A;  4M4R A;  3IMN A;  5FO7 B;  2WN2 A;  5FOJ B;  4MXV A;  4TN7 A;  4BMB A;  4FTS A;  2Y6G A;  2RDN A;  1OLR A;  3SC7 X;  1O3Q A;  4GAZ A;  4PI2 A;  1WLD A;  5BNO A;  4Y5Z 0;  4AGV A;  4DUV A;  1WCU A;  2G9F A;  1V6O A;  4XFH A;  5CKN A;  4IGO A;  1W6O B;  3H7Y A;  3MIF A;  2AC1 A;  2Q30 A;  2WNE A;  3ROU A;  1EUT A;  3GXU A;  3U75 A;  5D21 A;  1OH4 A;  2HWE 3;  4HN1 A;  5JVV A;  4BIS A;  2OUH A;  3CBN A;  1UZ0 A;  1XPW A;  1UU5 A;  3EO6 A;  3H1Y A;  4Y1V A;  3AC0 A;  1OUX A;  3FZ3 A;  2J1T A;  5LA0 A;  3LEK A;  5F3E A;  2HWE 2;  3ZFE B;  2V4A A;  1VBC 1;  5JOY A;  3HEI A;  4NWW A;  1DHK B;  2ZA9 A;  3O1S A;  2D6L X;  1CZV A;  2QQV A;  1GWL A;  3ABZ A;  5LY1 A;  1JZ2 A;  5FZ8 A;  4DMI A;  1OOP A;  4CCM A;  5BY5 A;  4N53 C;  1JYX A;  3ES4 A;  1FOD 1;  4XMA A;  5GLT A;  1VBD 2;  2GP5 A;  2JKX A;  1H4H A;  1UPI A;  3J7H A;  2W91 A;  4W6Y A;  2AZ5 A;  4K1Z A;  1NXD 1;  3B5L B;  2ORX A;  4B7E A;  3N9M A;  5GZC A;  1ZBE 2;  4I0W B;  4GIQ A;  4Q0V A;  4UT5 A;  1A78 A;  4QXK A;  4XJU A;  3OG2 A;  1FT9 A;  1UOJ A;  5FP3 A;  5EYY A;  4D69 A;  2WQ8 A;  1QMJ A;  2YY1 A;  4AI1 A;  1ZRC A;  2FBE A;  3O1R A;  3KD4 A;  1K45 A;  4A7Z A;  1WLT A;  3C8X A;  3VZL A;  1W03 A;  2OII A;  4U2A A;  3MLK A;  4B4P A;  5A3P A;  3BOD A;  4Q8L A;  5JUV A;  5DDJ 3;  1Q5O A;  3AP7 A;  1O6U A;  3JBG 1;  1VB4 A;  3AKS A;  4KGQ A;  3TWI A;  3U4S A;  5K9Y A;  3RVH A;  3VKF C;  3TYJ A;  1UY0 A;  1Z7S 1;  2A73 B;  1W6N A;  1QXR A;  2V5Y A;  5BNO C;  3B9I A;  3VZN A;  3WW1 A;  5EIY B;  3CNA A;  2YZ4 A;  5I8Y A;  1Q43 A;  1AX1 A;  5L7O A;  3KM5 A;  1TNF A;  2MNG A;  2VBP A;  4AYU A;  5CFD A;  2Q8D A;  2AEY A;  1QJY 2;  3ZVX A;  5IWF A;  4ASK A;  4FP2 A;  3HQR A;  1UX6 A;  3WUD A;  1QDO A;  1UZW A;  1RUG 1;  4Z8B A;  3MGU A;  3J7L A;  1D4M 3;  2GC0 A;  4MET A;  1ZRD A;  1J1T A;  4AR2 A;  2PFW A;  2PAK A;  3K75 B;  4OI4 A;  1SLB A;  3R4U A;  1OD3 A;  1OSG A;  1H2N A;  4RA0 A;  1BJQ A;  1J83 A;  2WT0 A;  3Q8F A;  1QDC A;  1NXM A;  4P14 A;  4XUP A;  2QQU A;  2AAC A;  3BTX A;  2WZE A;  2RS3 2;  4UXA A;  1AR8 3;  4XC9 A;  2WUH A;  1AXK A;  4GWI A;  3NV1 A;  4FPJ A;  2HJI A;  1W05 A;  2BGP A;  2BWC A;  2QZ3 A;  3VBR B;  2BOJ A;  2D98 A;  1HQW A;  3RZH A;  3U37 A;  4AG4 A;  1MVQ A;  3ZIX A;  1IKQ A;  1H30 A;  4BXS V;  1OFN A;  1WKY A;  5FWE A;  4MOA A;  2D5F A;  1UY2 A;  2JJ6 A;  4LK6 A;  2NPI A;  4HK8 A;  3I2J A;  3VBR C;  4MGK E;  5C7G A;  1LOF C;  1QH7 A;  1S4C A;  3C7H A;  4CXX A;  5LK5 A;  4CEY A;  1FV3 A;  3K4D A;  4NIG A;  3GHM A;  3SHR A;  1ZRR A;  5LWB A;  1PVC 1;  2QFE A;  3I97 A;  3MFC A;  3Q9O A;  4UAP A;  5TSW A;  3I2H A;  4XDQ A;  2XJS A;  1YC6 1;  4MLO A;  4FPF A;  3GNE A;  2ZX2 A;  4SBV A;  4FP3 A;  1ND3 A;  4ZXK A;  4AFB A;  1OC1 A;  2BQP A;  2W0X A;  1ZBE 1;  1LOF A;  3FLT A;  2BUK A;  5FP8 A;  3RPQ A;  1CZS A;  1HW5 A;  1ULF A;  1UW8 A;  1KD7 A;  5C3S A;  5AVP A;  3MEP A;  2JDU A;  2P3I A;  3AJZ A;  4TSV A;  4BME A;  4QQ2 A;  2QQM A;  4IE4 A;  5IK8 A;  1DDL A;  5IUQ A;  4CP1 A;  4IUG A;  3PL0 A;  3ZPY A;  1XC6 A;  3J7M A;  1XND A;  1X8E A;  3NV2 A;  3ZN6 A;  1OPM A;  4F83 A;  3CJI C;  1YRZ A;  1H4G A;  1SG3 A;  1R08 2;  4FT8 A;  5CKQ A;  1UX7 A;  2LS6 A;  1NLS A;  2VG9 A;  3I54 A;  3KF5 A;  2R16 A;  2XGX A;  4BM8 A;  2XKP A;  3HBK A;  3JUU A;  2R7E B;  1U5I A;  3U10 A;  1COV 1;  2EXH A;  2PAE A;  5DMY A;  1I5P A;  3ZFE A;  4LLO A;  4IE7 A;  1JYW A;  1OLQ A;  1FNY A;  1W6P B;  5H9R A;  5CBL A;  5T5L A;  5AFE A;  1WCK A;  3SH4 A;  1ASJ 2;  3S6P A;  2NMO A;  2Y60 A;  1G7Y A;  3FFZ A;  1X9T A;  3POJ A;  4QB2 A;  5A70 A;  4UBH A;  4Q4X 2;  2I07 B;  2WSU A;  1MQT C;  2ZCW A;  5FCC A;  1VBC 3;  2ZHK A;  4OFG A;  1AR6 2;  4QWN A;  3LDK A;  1DGW X;  2BJS A;  2QTW B;  3DN7 A;  3LF7 A;  3BIW E;  4X8N A;  3ZMN A;  4CUC A;  3L9J T;  3K3N A;  4QX0 A;  1UYP A;  3MIH A;  4YG3 A;  1V6L A;  2ZOE B;  4XQD A;  2A6Y A;  2DCY A;  2E7A A;  1U0A A;  3A0K A;  4W50 A;  3VBF B;  1PGW 2;  1D0H A;  4AVB A;  2D44 A;  3ACH A;  2ADD A;  1ZZC A;  4YGC A;  1HDK A;  5FJH A;  5HXM A;  1EV1 1;  1TZO A;  4R4Z A;  4A41 A;  4BIO A;  4B1L A;  1IPK A;  3RS6 A;  3ZXA C;  2PMW B;  1GU3 A;  5I91 A;  3L2Y A;  3EHK A;  5BNP B;  5JXG A;  4YVW C;  1H8T C;  3D0S A;  3PIJ A;  3HWJ A;  3WG2 A;  2I2S A;  5F6L B;  1RIT A;  2XLA A;  1EYB A;  1PZ7 A;  4N7I A;  5FP9 A;  4LBO A;  2XXZ A;  4YZ5 A;  3CL1 A;  1O4Y A;  3NQH A;  4L11 A;  4Q4Y 2;  1EPZ A;  2Z5W A;  3CMG A;  5FKB A;  1UOF A;  4LIU A;  5FPA A;  3OY8 B;  1N1S A;  3HJR A;  4GZ9 A;  2BRT A;  4NMI A;  2BVB A;  2VMH A;  3B00 A;  4HAN A;  4OHY A;  3BI3 A;  1PK6 B;  2XLG A;  4MGZ E;  3I3Q A;  1SDW A;  3E6D A;  4WZC A;  4XF3 A;  5A7S A;  3SCF A;  3WCS A;  5CAZ A;  1VBB 2;  5CG8 A;  3RFR A;  3AB0 A;  1AZD A;  2YXS A;  4FOY A;  1Q8O A;  1JH5 A;  3GZA A;  1WMF A;  4XF1 A;  3RJR A;  4FFH A;  4IEO A;  3VDD C;  1AR7 3;  4AQT A;  1W2A X;  2R06 1;  4UI9 L;  3H8U A;  5LZ6 A;  3FE5 A;  3WNK A;  4DIN B;  4LKS A;  2ZEZ A;  3WHT A;  3BTZ A;  1NLR A;  2PLV 3;  1UL9 A;  4CDX C;  4HL0 A;  1YQ5 A;  2Q1M A;  5C4W A;  3EBR A;  4DIQ A;  5JIA A;  4D6Q A;  1WCQ A;  1OI6 A;  1ZBE 3;  3GCX A;  3PHM A;  4XMI A;  4QKD A;  3KVB A;  2WT1 A;  3ZSM A;  2BV4 A;  4DXR A;  3EMR A;  2G19 A;  1C5H A;  1GBG A;  3TEX A;  2IFR A;  3THP A;  1W9Y A;  3B02 A;  5A33 A;  1H2L A;  1X8M A;  1WLC A;  2P6H A;  2WDB A;  5FYY A;  2JEN A;  2UWA A;  3I59 A;  4OMC A;  3BOW A;  3AYE A;  3ZFF A;  1VAK A;  3RRD A;  2NP0 A;  1K5J A;  3BPS A;  1X9P A;  5CIS A;  2VUL A;  4XOG A;  1NYW A;  3UKV A;  1UYX A;  2W1Q A;  1AJO A;  2MEV 2;  2IXH A;  4XJ9 A;  1FPN 3;  4LO6 B;  5F2S A;  3VZO A;  4E8C A;  2O8O A;  3T0D A;  1IPS A;  2Q5T A;  4IND A;  3Q8B A;  4FVV A;  4QQL A;  4A7K A;  4P9Y A;  2CAV A;  1H6X A;  5EJZ B;  5FTT C;  1MS0 A;  5FYI A;  3UNP A;  5I0T A;  2ZXQ A;  4LO8 A;  4PDW B;  3WCR A;  3C7O A;  4JQR A;  3T1L A;  2WWU A;  4GWM A;  2QNK A;  2D3S A;  2ZGT A;  3R4S A;  2LW8 A;  2GP3 A;  1U5X A;  2VE1 A;  2WFF 1;  3KT4 A;  3DUI A;  4GJZ A;  4QXH A;  4CCD A;  4LKD A;  5FWJ A;  5FRE A;  5ISL A;  3VBO B;  4CCK A;  4Q8K A;  1J58 A;  3POS A;  4JRL A;  2D93 A;  3HR9 A;  5FKC A;  2VEC A;  3VLB B;  3A21 A;  1NCR B;  4GH4 B;  4XJ8 A;  3R0R A;  4AE2 A;  3JU9 A;  1UIK A;  2VBD A;  3E6B A;  2HWD 1;  5H9S A;  3M7A A;  4W4Z A;  3VGI A;  3NNJ A;  3E5U A;  3CJX A;  5DQ0 A;  5FY4 A;  2IVJ A;  2VOX A;  3M1H A;  1BBT 2;  2RS1 2;  3M3O A;  3N9O A;  3PDQ A;  4ZXE A;  2A71 A;  2WWS A;  2WZR 2;  3ZYR A;  4ASM B;  3O7O A;  3POG A;  4MAD A;  1XNT A;  2ZGQ A;  1PHM A;  3P3P A;  4XAE A;  1QQP 3;  1QQP 2;  3M8L A;  4JGZ C;  1Z7S 3;  4XYX A;  4EYU A;  3NJZ A;  4JV4 A;  4HK9 A;  4NN0 A;  1YQ2 A;  1MZE A;  5DDJ 1;  4MYE A;  3T30 A;  1PGW 1;  1DQ6 A;  2QE3 A;  1N3O A;  3O12 A;  4E4S A;  1A34 A;  1MS4 A;  2PHT A;  1R09 2;  2YU1 A;  5FR3 A;  3POY A;  3H7J A;  3LD8 A;  5E89 A;  4CYD A;  2I45 A;  1QJY 3;  2Y26 A;  1XXN A;  3OEB A;  5JSO A;  1GMM A;  1S2E A;  1U5Z A;  5IT6 A;  1NY7 1;  2JEC A;  5J1X A;  4Y26 A;  4Q4X 1;  3FLR A;  3IBM A;  1DQ1 A;  1OVS A;  1YHF A;  1XRU A;  1ASJ 1;  1S0J A;  5FLI A;  1MS9 A;  1YLL A;  2DCZ A;  3L2H A;  4HSL A;  2WFP A;  4EWD A;  2DUQ A;  2YPD A;  4EN7 B;  3BU0 A;  3AK0 A;  5F39 A;  1ZZ8 A;  3S5Q A;  3ZSJ A;  2GNB A;  1RUH 2;  1W0O A;  3WF4 A;  3T2O A;  2Z2S B;  4K9S A;  1YJK A;  3T2P A;  2BNN A;  4QPI B;  4GJY A;  3P6B A;  4ES9 A;  4YGD A;  2IVI B;  1UO9 A;  2RS5 2;  4Y24 A;  1AHS A;  1X82 A;  2IZW A;  4LMF A;  3RI9 A;  1XSQ A;  3ATG A;  2XJR A;  2P3K A;  3KQR A;  5KHJ A;  3LEI A;  5K4L A;  1YFW A;  4V2W A;  4FAH A;  3LA3 A;  5CFD C;  2WFF 2;  2FMY A;  2J1R A;  3OPT A;  2VUD A;  1BEV 2;  2WS9 1;  3VD4 A;  3D8C A;  3GCW A;  1UKG A;  1YJL A;  3TRS B;  4UW6 A;  2YG0 A;  4OI1 A;  1PVC 2;  4CDU C;  1IOA A;  3UKT A;  3VKL A;  1OXC A;  1NAE A;  2GH8 A;  4XPV A;  5FXX A;  4LHL A;  3O1M A;  4XXP A;  5A3N A;  2FMD A;  3FHI B;  3MPB A;  4XFI A;  3JXS A;  3ZN6 B;  5EQU A;  4E8D A;  4JTN A;  1FXZ A;  2OS2 A;  2AR6 A;  4FPK A;  1Z78 A;  2DBI A;  3AZY A;  4JGY C;  4KBZ A;  4XDP A;  5HPO A;  1E5S A;  1RHI 1;  4QU1 A;  3WD5 A;  1BZW A;  2VM9 A;  4FQ4 A;  4OCT A;  4PDW A;  5A7N A;  1H8T B;  3HNM A;  4M4P A;  5IW0 A;  2VD7 A;  5EV7 A;  4OUS A;  2Z42 A;  3SKJ E;  1OHF A;  2J1E A;  4A7Y A;  1AL0 G;  5CA6 A;  4L2N A;  2XPJ A;  4K40 A;  1RXG A;  1OQE A;  4G9S B;  3VBF C;  1KXG A;  1NCR C;  1PK6 A;  2LRO A;  4Q0S A;  2ARC A;  2IXC A;  5A1F A;  4FTB A;  5IYY A;  1LED A;  1ULD A;  1D2S A;  1ULP A;  3NVC A;  5BPX A;  3IWZ A;  4XF4 A;  1ENS A;  4WM8 B;  1VBB 3;  3ZFF B;  4N53 A;  3M3I A;  1JMU B;  2RE9 A;  2RS3 1;  3OD4 A;  4CEW C;  1DLC A;  4XUQ A;  4ATF A;  1SMV A;  4KWJ A;  1LEN A;  1C8N A;  3RYP A;  3USU A;  3ZLI A;  3ASI A;  3F2Z A;  2C5D A;  3N7K A;  4OUL A;  4UBG A;  4XBN A;  4AI8 A;  1WW7 A;  5IVB A;  1SLC A;  3Q8A A;  4Z07 A;  1BEV 1;  2DWR A;  5FP4 A;  5FQ0 A;  3AYA A;  2R30 A;  1QJY 1;  3J8F 2;  4ZY9 A;  3ZKY A;  1Z7S 2;  3I4I A;  2J1V A;  3DGT A;  2Y0I A;  4MO3 M;  4YNI A;  4GMP 0;  3VBR A;  5K8S A;  2VO5 A;  3UJO A;  3ZMO A;  3LAG A;  1HQN A;  3THT A;  3H1W A;  1ZRI A;  2HWC 2;  2Z79 A;  2Y6H A;  3MIC A;  4UF0 A;  2RS5 1;  1LNS A;  1KDM A;  2DU0 A;  5EP9 A;  2HEW F;  2K2S A;  3GHN A;  4D7S A;  1XBF A;  3MV0 1;  1NX9 A;  1SFN A;  2A3Y A;  1MZ5 A;  2VH9 A;  3Q8C A;  4CUG A;  4EZH A;  3TOJ A;  4GMP 1;  3B01 A;  3AKT A;  5KC6 A;  1XNK A;  4Y20 B;  1N1Y A;  2CNA A;  1YNA A;  4AI0 A;  2AUY A;  3AZX A;  3JD7 3;  4XFC A;  4HFS A;  3KZ4 C;  2HWF 3;  4MHU A;  3BAL A;  4MGQ A;  2IUW A;  4OQ9 A;  3OGV A;  4Q4W 2;  2PHF A;  1X50 A;  4UW5 A;  4XVH A;  1SBD A;  1TG7 A;  3ZYH A;  4C90 A;  1Q8S A;  1LGC A;  5SV5 A;  2CGP A;  2O8Q A;  4KI5 M;  1XQN A;  5L73 A;  3SNM A;  2YBK A;  1UN1 A;  4FPG A;  5EHD A;  4NUB A;  3S7I A;  4N7U A;  2RJ2 A;  5FYV A;  3MW3 A;  2R0F A;  4MHR A;  1MEC 1;  1NKG A;  4M0N A;  4RFT 0;  4DFS A;  1RB8 G;  2ORZ A;  3BVC A;  1V0A A;  1QJE A;  1IGO A;  2QJV A;  4NHX A;  4QQP A;  4XIO A;  5FQ0 B;  1AL2 3;  1ENR A;  1WW4 A;  3CQO A;  3DL3 A;  4QX7 A;  5IVF A;  1I1E A;  4P9G A;  2V73 A;  1W6Q A;  3VL8 A;  4Q4W 1;  3FUO A;  4CTE A;  4D6S A;  2HWF 1;  3KVA A;  4IER A;  5T3N A;  2WZ8 A;  4QDQ A;  2OZ6 A;  3W9A A;  1HXS 1;  3AMN A;  3BUC A;  2XL7 A;  3NRU A;  3PLQ A;  2YYO A;  1W3X A;  4GMP 3;  4HVO A;  1ZX5 A;  4BLJ A;  1LGB A;  1QKQ A;  2NLR A;  2W3J A;  3POI A;  4CEY B;  5JPM B;  4LNV A;  4GXL A;  3VD3 A;  2YFU A;  5FZB A;  1CWP A;  2VJX A;  1H2K A;  4H3W A;  2D40 A;  4PF5 A;  1HN1 A;  1HJG A;  3WP4 A;  1J3R A;  5HV0 A;  4BYY A;  4DUW A;  3S0M A;  4MG2 A;  1VRH 2;  4GD4 A;  5L19 A;  4AGR A;  3MW4 A;  1XE7 A;  2QBX A;  1W6O A;  2VMC A;  3BPZ A;  1YQC A;  1G9F A;  1HIX A;  3X29 B;  3UJQ A;  2RJK A;  3A4U A;  4AFA A;  4CP0 A;  1SPP B;  5JMO A;  4FQZ A;  1MS1 A;  1S0C A;  5JPN B;  1LEC A;  1BEV 3;  2W94 A;  1RUE 1;  3SMH A;  4Y20 A;  4NPL A;  1H9W A;  3CO2 A;  5F3G A;  2YUE A;  1TNR A;  2R04 1;  5FYM A;  4C0B A;  1ZRE A;  4A2U A;  2WQZ C;  4MGI E;  1RL3 A;  4MXW B;  3AM2 A;  4PDW C;  1ULO A;  3VDA A;  2E33 A;  4LBQ B;  4XHX A;  4LBQ D;  4CU8 A;  4KWL A;  1O8S A;  4R9B A;  1US3 A;  3ON7 A;  4LO7 A;  1KJR A;  2FDG A;  1NE6 A;  4K6B A;  3NKG A;  4FTE A;  2CWM A;  2Y0O A;  1RUJ 3;  4GQ7 A;  2JKB A;  1HRV 2;  1N1T A;  5C3Q A;  4FO9 A;  4L9B A;  1RIR A;  3W5N A;  1AR7 2;  3CJI B;  1LOC A;  3N9Q A;  3ZFG C;  4EJR A;  1S0B A;  1S2K A;  4NRO A;  4XBL A;  1RYY A;  5FMD A;  3ZR6 A;  5E6H A;  1UXZ A;  1QJU 1;  1C1F A;  3HIF A;  5G05 L;  2X8K A;  1RUF 2;  2XG3 A;  4A42 A;  3KGL A;  3LEM A;  1HRV 3;  1DQ5 A;  1RHI 2;  4H14 A;  1KS5 A;  1AR8 2;  4GKY A;  1AUY A;  1C1L A;  1EV1 3;  1GFF 2;  5FYC A;  3UK9 A;  3WG3 A;  1WD4 A;  1W8T A;  2E63 A;  1AR9 1;  5GLV A;  5FPL A;  2FCT A;  4KL1 A;  1E5H A;  5GAL A;  3FN9 A;  4XQW A;  3GJA A;  1QHD A;  5CEH A;  5IK5 A;  3KWV A;  2F4L A;  5FPZ A;  1XU1 A;  2AH2 A;  1PIV 2;  2XJP A;  3DEM A;  1LJ7 A;  1AXZ A;  3DYP A;  4JQT A;  5A3W A;  2XKO A;  4QPY A;  1IKP A;  1OUR A;  1BK1 A;  2GAU A;  2FCV A;  2WT2 A;  1S0F A;  3D5O A;  4Y1Y A;  5BNP A;  4C1W A;  1IHM A;  1G8W A;  5JR2 A;  1RUJ 1;  4BCU A;  1J59 A;  1JHJ A;  1SQ4 A;  2KR2 A;  2MPF A;  3FJS A;  3ENR A;  1JBC A;  2E6V A;  2ZS6 B;  1RED A;  1W2O A;  2YB7 A;  3UL2 A;  2HYK A;  1CD3 G;  2XH6 A;  4EE2 A;  3J7N A;  3ZXG A;  3OBR A;  3ZFG A;  1VJ2 A;  1O3S A;  1MQT A;  4K1Y A;  1GIC A;  2V5D A;  3AP6 A;  5FMO L;  5LAT A;  4AEM A;  2BTV C;  5FAX A;  4Q4X 3;  3O0W A;  2X53 S;  1QIQ A;  1NY7 2;  4YM2 A;  3UYJ A;  4JVA A;  1ASJ 3;  5GM0 A;  2PHW A;  1ACC A;  1UCX A;  2A3X A;  2DUP A;  4JDN A;  1YUD A;  3OUI A;  5C3O A;  4SLI A;  3WR0 A;  1PM7 A;  3BU7 A;  5FJK A;  3RZG A;  1UY4 A;  4OYU A;  3MFA A;  1D2Q A;  4HOO A;  5A7O A;  2X05 A;  1I6X A;  1JOD A;  1BLZ A;  2WR9 A;  2XWJ B;  4Q0U A;  4W65 A;  2XBO 3;  3WW4 A;  5FY1 A;  2VU9 A;  4OLL A;  3ETQ A;  3H9A A;  4J1W A;  5LY2 A;  2JDY A;  5FO8 B;  2N7G A;  2EXI A;  4YVS C;  1MS3 A;  5FZO A;  5A32 A;  2CYF A;  1A8D A;  1ONA A;  1W8O A;  2OZJ A;  2VTF A;  3B94 A;  4W6X A;  3ACF A;  4CDQ C;  2GU9 A;  3KF3 A;  2ID4 A;  1QQP 1;  4GH4 A;  4Q29 A;  4QHB A;  4QPG C;  4WM7 B;  1W6M A;  1ZBA 3;  4R8H A;  5EYX A;  3DF0 A;  4LUM A;  2WNU B;  4Q4W 3;  2W92 A;  3GGL A;  3RI8 A;  3S57 A;  5FV3 A;  1CAX A;  5BNN C;  2K46 A;  2EXJ A;  2F6B A;  2HWD 2;  1OA4 A;  4CCO A;  1UZY A;  1VBE 3;  2BVV A;  3ETP A;  3OB8 A;  2ZX4 A;  2LTN A;  2UYB A;  3RDI A;  4AED B;  2VCB A;  3ZN4 A;  3KV6 A;  2K0G A;  5JZG C;  2A6W A;  5HCF A;  5CNA A;  1CX4 A;  4L92 A;  5J37 A;  3QCW A;  3FUQ A;  4C0H A;  4CCJ A;  3IDA A;  1SLT A;  1CN1 A;  5JSR A;  1SFP A;  4DXS A;  5JWP A;  2MEV 1;  3N4M A;  4ARY A;  1JYC A;  5IFP A;  5DAP A;  2X5I A;  4XBQ A;  1LOG A;  2YBP A;  2Y6K A;  3AJY A;  4JHT A;  4RS5 A;  4BA6 A;  3JQW A;  2BGC A;  1QJU 2;  5APA A;  5GZD A;  1CAV A;  2EIG A;  2BEO A;  5D8A B;  2OX0 A;  4ES8 A;  1LTE A;  1UPS A;  4WM8 C;  5CKM A;  1GUI A;  4CSW A;  4NR1 A;  5I93 A;  1TMF 2;  1YQ6 A;  4B4R A;  4DEV A;  4CU6 A;  2DFB A;  3WV6 A;  5C5T A;  2JG9 C;  2XL9 A;  4N43 C;  4D7T A;  1LHO A;  2C9A A;  1BVP 1;  1O8P A;  1N1V A;  3BIE A;  4OI0 A;  2C24 A;  2CWS A;  1GZC A;  1RJ7 A;  2RMU 2;  5A33 B;  4GB3 1;  5CZK A;  5DN2 A;  5C8W A;  1V00 A;  4OHV A;  5EZW A;  3ELN A;  1T2X A;  4W6W A;  4OHX A;  5CFD B;  2TEP A;  1YXW A;  1CQ9 A;  1Q8V A;  2I74 A;  4HKW A;  3PUS A;  1IZ3 A;  4IV3 B;  4WM7 A;  3WOG A;  1UOG A;  4HPK A;  4IV3 A;  4JDM A;  2ZHN A;  1JI6 A;  4XEZ A;  4LKE A;  5J3U A;  1BK0 A;  1CAV B;  2BW8 A;  3K46 A;  1OQ1 A;  3CZU A;  5FLJ A;  5E1R A;  4CP2 A;  5A80 A;  3VKM A;  5JZG A;  3RZL A;  2R06 3;  3ES1 A;  1HKD A;  2VGD A;  4BQ5 A;  3VN4 A;  2TBV A;  3WQ1 A;  4H7M A;  4IL7 A;  1XJA A;  2WS9 2;  4CDX B;  4KU7 A;  1VBB 1;  4YG0 A;  1MPX A;  3SXW A;  1N47 A;  1WW6 A;  3EJK A;  1ST8 A;  4Q1R A;  1XNC A;  2C1F A;  4H7L A;  4Y3O A;  3B93 A;  4LQR A;  5FZD A;  5A7W B;  3WP3 A;  3BTY A;  3RZM A;  5CFC A;  2ZBJ A;  4QPW A;  1RUC 2;  3IDB B;  1TME 3;  3K2O A;  5JCT A;  1V6M A;  2DTY A;  1EUU A;  4LBJ A;  3AZW A;  3HAG A;  1K5M C;  2RHP A;  3CHX A;  2E32 A;  3OY8 A;  1SEF A;  3KT7 A;  1PO2 3;  1NT0 A;  3VHP A;  4AQS A;  3N3H A;  1H2M A;  2ILM A;  4DXT A;  1TME 2;  1DQ2 A;  1S0G A;  4D8M A;  1MQT B;  1K42 A;  1DZT A;  3HT2 A;  1HJF A;  2VMF A;  1OFS A;  4ITC A;  2NN8 A;  3PJQ A;  2WYF A;  3UET A;  2W08 A;  1MZ6 A;  3O5S A;  2OYZ A;  2WLP A;  2HEV F;  1A6C A;  5DUW A;  3IB3 A;  3HD8 B;  2WS9 3;  4BXF A;  4KMQ A;  1DCS A;  4XIK A;  3O14 A;  2WSV A;  3LPG A;  2YU2 A;  2Y6F A;  2VVE A;  4NHM A;  2Y6L A;  3SH3 A;  1FI2 A;  2W46 A;  1KIT A;  4NJ4 A;  1ULE A;  2JE8 A;  3NNG A;  1NUK A;  3NV3 A;  4DB5 A;  1Y43 B;  4X8P A;  1F4A A;  4YW4 A;  3CIH A;  3OUJ A;  3MZH A;  4XTM A;  5DG1 A;  4O9E A;  1XNB A;  1URX A;  3NAP B;  3VDD A;  1A3K A;  1I9R A;  4NII A;  1NA1 A;  4DXZ A;  1GNY A;  3AP4 A;  1PGL 2;  4YVS B;  3WNO A;  2FDF A;  1LKN A;  1COV 2;  2FDK A;  1ND3 C;  2HWB 3;  4I3G A;  3ZXE A;  3WNX A;  5GLW A;  2XJT A;  4ZS2 A;  2P34 A;  3W58 A;  3VBF A;  3OTF A;  2B39 A; 
#chains in the Genus database with same CATH homology
 1IQD C;  4XUR A;  3ACG A;  2Y8K A;  2QQN A;  4QDS A;  1YQ2 A;  3ACI A;  2VC9 A;  3T08 A;  2QQI A;  2X09 A;  1JZ6 A;  2YFZ A;  3CDZ B;  2W5F A;  3I2G A;  3C7E A;  3FL7 A;  1PX3 A;  3OEB A;  1GMM A;  4CUB A;  5J1X A;  4A3Z A;  3PUI A;  4FI9 A;  3WNM A;  3HPN A;  1PMJ X;  2JD9 A;  3WQB A;  3K4A A;  5IHR A;  3VDB A;  3FHA A;  2VZ1 A;  4MAD A;  2WO3 A;  4PQQ A;  2VZ3 A;  3T2O A;  3WF4 A;  3T2P A;  3D3A A;  3VD5 A;  3P6B A;  3WF1 A;  1GOH A;  2Y6J A;  2J7M A;  1P8J A;  3WF2 A;  2JDA A;  5B4N A;  3LEI A;  3OGR A;  5EJ1 B;  2J1R A;  3VD4 A;  1W9S A;  2B9V A;  5IFT A;  3NJX A;  2YG0 A;  2VCA A;  5G04 L;  2CDO A;  4GWJ A;  1UXX X;  1NAE A;  5IJR A;  4JHZ A;  4JKK A;  3I2F A;  2VZP A;  3UES A;  3JXS A;  4E8D A;  4ET7 A;  2VCC A;  3A7Q A;  3MUY 1;  4LPL A;  5HPO A;  3I3B A;  3K77 A;  2VM9 A;  3WSO A;  2XON A;  4OMD A;  5C71 A;  3HNM A;  4M4P A;  2RVA A;  4ZZ8 A;  1KEX A;  2WN3 A;  4LHS A;  3SKJ E;  3OEA A;  3DEC A;  4HG6 B;  2J1E A;  2WYS A;  4KWU A;  3WF0 A;  4UOJ A;  4TTG A;  1OF3 A;  1J84 A;  2W1U A;  4ARX A;  5IYY A;  1ULP A;  3LQC A;  2C26 A;  2VOT A;  2DCK A;  1PX4 A;  2HLE A;  1UY1 A;  1DLC A;  4XUQ A;  3BN6 A;  2VMD A;  2RV9 A;  2VZQ A;  1SHW B;  3F2Z A;  4QX2 A;  4YPJ A;  4CU9 A;  3I3E A;  2EIB A;  2J22 A;  3IAP A;  2VZT A;  3I2K A;  4A6O A;  2V4V A;  2KD7 A;  4ZY9 A;  2W47 A;  2J1V A;  3C7F A;  4MO3 M;  4D0Q A;  2VO5 A;  4PT6 A;  3HNB M;  5C70 A;  3LE0 A;  2Y6H A;  3ZM8 A;  2VZS A;  2J1S A;  1LNS A;  4XZU G;  5LA2 A;  2VQT A;  3OBA A;  2E31 A;  3MV0 1;  1NX9 A;  2B4K A;  1OF4 A;  2VME A;  3LPF A;  4W8J A;  4OZO A;  3WF3 A;  2VZU A;  3VDC A;  3FHQ A;  3T09 A;  3WNP A;  2WAB A;  3DYO A;  2BGO A;  4MGQ A;  3OGV A;  1CX1 A;  1K3I A;  4XVH A;  3K4Z A;  3WNO A;  1TG7 A;  4KI5 M;  3HNY M;  2RJ2 A;  4M4R A;  1NKG A;  2WN2 A;  4QB1 A;  3I3D A;  2Y6G A;  2ORZ A;  4QX1 A;  2VR4 A;  4CVU A;  2BER A;  2J1U A;  3CQO A;  3OGS A;  2W95 A;  4DUV A;  1JZ8 A;  5FUI A;  2WO1 A;  4P00 B;  1EUT A;  3GXU A;  4RN5 A;  2WZ8 A;  2CDP A;  4QX3 A;  4QDQ A;  2W9X A;  1OH4 A;  1UMI A;  3NRU A;  3SEP A;  1UZ0 A;  1XPW A;  1KGY A;  4CUA A;  2W3J A;  3THC A;  3AC0 A;  2L9L A;  2J1T A;  5LA0 A;  3LEK A;  3VD3 A;  3GDB A;  2YFU A;  2ZEY A;  3HEI A;  2VJX A;  1HN1 A;  3ABZ A;  1CZV A;  2J1A A;  1JZ2 A;  4DUW A;  1JYX A;  3T0A A;  4DEQ A;  1TVG A;  2QBX A;  2VMC A;  1W9T A;  3EYP A;  2JKX A;  5JMO A;  3J7H A;  2W91 A;  2W94 A;  3E1F 1;  2ORX A;  3SKV A;  2YC2 A;  2EIE A;  4L0P A;  1ULO A;  3VDA A;  3T2Q A;  2E33 A;  3OG2 A;  5JXI A;  4CU8 A;  1O8S A;  2WQ8 A;  1US3 A;  2PQS A;  4QB6 A;  5F7U A;  1SDD B;  4A4A A;  1K45 A;  3C8X A;  1PMH X;  1US2 A;  5JUV A;  1UWW A;  3WEZ A;  3WNL A;  3W5N A;  1UY0 A;  2W1W A;  1RYY A;  2VQU A;  3BGA A;  1UXZ A;  5EIY B;  4A42 A;  5G05 L;  2C9K A;  3P1I A;  1JZ5 A;  1UYZ A;  3FN9 A;  1JZ3 A;  4P08 A;  5LCW L;  2DCJ A;  4P5Y A;  3CKH A;  3W5M A;  3MBW A;  3DYP A;  3K75 B;  2OKX A;  4P02 B;  3HOB A;  3WNN A;  2WO2 A;  1OD3 A;  1J83 A;  4XUP A;  3C7G A;  2WZE A;  3SEE A;  5I0D A;  2WUH A;  4GWI A;  5JR2 A;  2BGP A;  1JHJ A;  1JZ4 A;  4XUN A;  2QQJ A;  3VD9 A;  3U37 A;  2VZR A;  4AG4 A;  2X10 A;  2YB7 A;  3III A;  4A45 A;  4BXS V;  4ZZ5 A;  1JU3 A;  1WKY A;  2WAO A;  4MOA A;  1L7R A;  1UY2 A;  3PUH A;  2V5D A;  3I2J A;  5C7G A;  1O59 A;  3C7H A;  4XUT A;  5A1A A;  4JKL A;  3K4D A;  1H6Y A;  3I97 A;  4UAP A;  3I2H A;  2W1S A;  3EB7 A;  1UY4 A;  4OYU A;  2X05 A;  4CU7 A;  1CZS A;  1D7P M;  5B4X A;  4XUO A;  4BK4 A;  3A23 A;  3NJV A;  2QQM A;  4OUE A;  2Y64 A;  2E26 A;  1W8O A;  2VTF A;  2W87 A;  2VZO A;  4IUG A;  1W8N A;  3ACF A;  1L7Q A;  1XNA A;  1UYY A;  2ID4 A;  1XC6 A;  2WBK A;  1SG3 A;  4Z2A A;  1UX7 A;  2LS6 A;  4BJ0 A;  2W92 A;  3GGL A;  2BZD A;  2R7E B;  5DMY A;  1I5P A;  3OB8 A;  3ETP A;  2Z4F A;  1JYW A;  1K12 A;  2VCB A;  1DP0 A;  1CZT A;  3MUZ 1;  4QB2 A;  2EIC A;  3IDA A;  4BK5 A;  2BBA A;  4CUC A;  3DYM A;  3T0B A;  4QX0 A;  4DXS A;  4ARY A;  4W50 A;  5LA1 A;  4DUX A;  5IFP A;  2Y6K A;  3ACH A;  1W9W A;  5HXM A;  4A41 A;  1UMH A;  2XHN A;  1GU3 A;  2V72 A;  5JXH A;  1GUI A;  5JXG A;  4DEV A;  1JYN A;  4CU6 A;  1JYV A;  1GOF A;  4QAW A;  1O8P A;  3NQH A;  3CMG A;  3HJR A;  4GZ9 A;  5DN2 A;  5CZK A;  2VZV A;  1W99 A;  1T2X A;  3IAQ A;  3A22 A;  4PF1 A;  4JKM A;  5CYY A;  1JI6 A;  4A44 A;  4AAX A;  3K46 A;  3CZU A;  2YC4 A;  2QQO A;  4UI9 L;  3VD7 A;  1OT5 A;  3WNK A;  4LKS A;  2ZEZ A;  2QQK A;  1MPX A;  1WCQ A;  4LQR A;  1W0N A;  3MV1 1;  2ZEX A;  4QPW A;  4DXR A;  1EUU A;  3THD A;  1R64 A;  2E32 A;  3MO4 A;  2WDB A;  4OMC A;  4MGS A;  3HN3 A;  4DXT A;  4JX0 A;  5DPN A;  4D8M A;  2DDU A;  4QDR A;  2ZEW A;  1K42 A;  1UYX A;  2W1Q A;  2VMF A;  4E8C A;  3UET A;  3T0D A;  3I2I A;  1F4H A;  4TXW A;  1H6X A;  5EJZ B;  3IB3 A;  3LEG A;  5JXJ A;  3UNP A;  2ZXQ A;  4KMQ A;  3C7O A;  1UY3 A;  3LPG A;  2XOM A;  2Y6L A;  2LW8 A;  2W46 A;  2JE8 A;  3NNG A;  1NUK A;  1GQP A;  2VL4 A;  1F4A A;  2QQL A;  1GOG A;  3ECQ A;  4BDV B;  3GM8 A;  1CIY A;  3CIH A;  3CZJ A;  4RYD A;  3A21 A;  2HYX A;  1JZ7 A;  1GNY A;  2EID A;  4W4Z A;  1BHG A;  5DQ0 A;  1JU4 A;  2WAA A;  1DYO A;  4ZXE A;  2XQX A;  2C4X A;  1XNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...