1UYXA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellobiose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uyxA00
1JZ8A 1OH4A 1CIYA 1W9WA 2QQOA 4QX2A 1L7RA 2XOMA 4DXSA 1EUUA 1WCQA 1EUTA 4UAPA 1JI6A 1H6YA 5C70A 3VDCA 1GU3A 2WUHA 2VC9A 3WQBA 3VD5A 5A1AA 4DEQA 1GMMA 3CDZB 4A45A 3HNYM 2JKXA 4QB1A 1UZ0A 1JZ6A 4CU6A 2VZQA 2J7MA 2E32A 2EICA 2E26A 4KWUA 4PT6A 2R7EB 2VZVA 3K4ZA 3CMGA 3GXUA 1HN1A 4LPLA 3T08A 3T2OA 2X05A 1JYNA 3D3AA 4M4RA 1GUIA 3C7EA 4MGQA 3OGVA 4M4PA 2RV9A 2J1EA 1W0NA 1JZ2A 2JDAA 4MGSA 2VZPA 3K77A 4XUTA 1R64A 2C9KA 2VZSA 3LPGA 2ZEWA 3T0BA 3DYMA 2VR4A 2EIBA 5G04L 4MO3M 2B4KA 1XNAA 3OEBA 3WNMA 4PQQA 3OGRA 4ZZ5A 3E1F1 4JKLA 3T0DA 4QAWA 1F4AA 1T2XA 3I97A 3OBAA 3IIIA 2VCCA 4FI9A 2Y6GA 3WNOA 1UXZA 4IUGA 1F4HA 2W1WA 1JU4A 4JKKA 5F7UA 4W4ZA 4GZ9A 4JHZA 2YC2A 2CDPA 1UYZA 5DN2A 1ULOA 3BN6A 3LE0A 3JXSA 4D8MA 3LEIA 1PMHX 2QQMA 3VDAA 3I2HA 1RYYA 2VCBA 3A23A 5DQ0A 4Z2AA 2BERA 2VO5A 1BHGA 4XUOA 2X09A 2RVAA 3HPNA 3UNPA 4KMQA 3WF0A 4UOJA 3FL7A 5EJ1B 1DYOA 3I2IA 2VJXA 2KD7A 3ABZA 5IJRA 3CZUA 2PQSA 3C7HA 4AAXA 2ZEZA 2RJ2A 2E31A 5J1XA 4OZOA 2VM9A 2HLEA 3UESA 3J7HA 4P02B 4KI5M 4ZY9A 4CU7A 1XNTA 1GNYA 2V4VA 3I2FA 3EYPA 1WKYA 5CYYA 1GOGA 3HNBM 1JZ5A 3GGLA 3CKHA 2WO1A 1MPXA 4QDQA 5LA1A 4XUNA 1K42A 2VL4A 3IB3A 2J1RA 4A44A 2WDBA 2Y64A 3I2GA 3OB8A 1O8PA 1PX4A 1UY3A 1UY2A 5JXIA 3CIHA 3IDAA 4QB2A 2CDOA 2BZDA 2WZEA 3VD3A 3MUZ1 5CZKA 1ULPA 3I3DA 1XPWA 3MV11 3PUIA 4JX0A 3WF3A 2Z4FA 4QDSA 5C71A 2B9VA 4DUXA 2W95A 3OGSA 5JXGA 1K12A 2YFUA 1UX7A 3GDBA 4W8JA 5B4NA 3NJXA 2VZ3A 4DUWA 1DLCA 3SEPA 2VCAA 1UY0A 2W87A 2WN2A 5LA2A 5HPOA 2ORZA 4P00B 3VDBA 4LHSA 3W5NA 2VZOA 2WBKA 1UYXA 2WAAA 3LQCA 3VD4A 4BK4A 3NQHA 4ARXA 2W9XA 2ZXQA 4A41A 3T2QA 2VMEA 2J1UA 3FHQA 5EIYB 2Y6JA 2Y6LA 1JYVA 3U37A 2WABA 5G05L 3WF1A 1OF3A 2J1TA 1UMIA 2WO3A 5IYYA 4OYUA 1GOFA 4GWIA 3ECQA 2VZTA 4L0PA 2OKXA 2J1AA 4ARYA 2VZ1A 5JR2A 4QPWA 4XVHA 4XURA 1W9TA 2VMCA 4BJ0A 3FHAA 3ETPA 1UWWA 2VQTA 3NJVA 3CZJA 4DEVA 5JUVA 4LKSA 2JE8A 1TVGA 1US3A 2W47A 1SHWB 3IAQA 3A21A 1NX9A 3T0AA 4CUBA 4CUCA 3NRUA 1YQ2A 1W99A 2VTFA 3P1IA 3T2PA 2QQLA 1W9SA 2VMFA 3WSOA 1JYWA 4BK5A 2Y6HA 3WNPA 5LA0A 3LPFA 1H6XA 2C4XA 1DP0A 3HJRA 5IHRA 4OUEA 4TTGA 2XQXA 1TG7A 3A22A 5DPNA 1JYXA 5C7GA 3EB7A 2WO2A 3ACHA 1PMJX 4QX3A 2QQJA 3P6BA 3SKJE 4A42A 3CQOA 1PX3A 4DXRA 1UMHA 4RYDA 1KEXA 3C8XA 5EJZB 3DYPA 2BGOA 3A7QA 4LQRA 2VZUA 3ACFA 4OMDA 3T09A 3C7FA 3GM8A 2QQIA 1JZ7A 4E8CA 4CU8A 3PUHA 2VZRA 2XONA 1GQPA 3THCA 1I5PA 2ORXA 3I2KA 5I0DA 2VQUA 1OF4A 1XC6A 2WN3A 5B4XA 4XUPA 4PF1A 1O8SA 5FUIA 1CX1A 3K46A 3MUY1 4MOAA 3MBWA 2DCKA 4QX0A 2YFZA 3IAPA 1UY4A 3SKVA 2BGPA 1K45A 1OD3A 2QBXA 2Y6KA 3ACIA 4CVUA 3LEKA 4A6OA 5HXMA 3THDA 4QB6A 4W50A 1JU3A 4YPJA 3OEAA 4ZXEA 4E8DA 1K3IA 2DCJA 3HOBA 2J1VA 3I2JA 2YG0A 5JXJA 1NUKA 1IQDC 2W1QA 3I3BA 4AG4A 1US2A 1KGYA 2EIEA 3WNLA 4A3ZA 3WNNA 2X10A 2DDUA 3DECA 3LEGA 3MO4A 3K4DA 2VOTA 4UI9L 4D0QA 4OMCA 1JZ4A 2WAOA 1J83A 4QX1A 1CZSA 2LS6A 4BXSV 4TXWA 2L9LA 5JMOA 3ZM8A 2W1SA 3K4AA 2BBAA 3VD9A 3C7OA 4DUVA 1D7PM 2JD9A 1OT5A 2EIDA 4MADA 2W91A 2C26A 4HG6B 2J22A 2W92A 4P5YA 1LNSA 2XHNA 1L7QA 4DXTA 2Y8KA 5JXHA 3K75B 4XZUG 3I3EA 3WEZA 5IFPA 5LCWL 1GOHA 2QQNA 1JHJA 2W1UA 4ET7A 3FN9A 2E33A 2W3JA 2QQKA 2ZEXA 3HEIA 1W8OA 2LW8A 3F2ZA 3WF2A 4A4AA 2YB7A 2VMDA 1UY1A 2W94A 4XUQA 4P08A 2WYSA 3C7GA 1NAEA 4CU9A 4CUAA 1SG3A 3UETA 3BGAA 1JZ3A 2W46A 2WQ8A 3WNKA 2ID4A 2J1SA 1W8NA 3WF4A 2V72A 3OG2A 3SEEA 1UYYA 5DMYA 3MV01 3VD7A 4JKMA 3ACGA 3HNMA 1CZVA 4RN5A 2W5FA 1NKGA 4GWJA 2WZ8A 2ZEYA 3NNGA 4QDRA 3HN3A 3AC0A 1CZTA 1SDDB 1UXXX 1O59A 3W5MA 2YC4A 1P8JA 5IFTA 1J84A 4ZZ8A 4BDVB 2HYXA 3DYOA 2V5DA
chains in the Genus database with same CATH superfamily
1JZ8A 1YI9A 4G3YC 1OH4A 1W9WA 4QX2A 4Q4Y3 4Z07A 5C3PA 3ELNA 3EHKA 1DF0A 1I3HA 3HWJA 2XOMA 2Q1MA 3AXEA 3WP5A 1EUUA 1MZ5A 5I8YA 1OOPB 1ZZBA 1VMHA 2VTXJ 3MLJA 4CP9A 4BQ2A 4C0HA 1YQCA 1NQDA 4CCCA 5C70A 5FCCA 3R4UA 4HONA 1XU1A 1H1MA 3JD71 3TEXA 3U1XA 2WWUA 5LRRA 4QXKA 2W39A 2D5HA 3OPTA 4HLTA 4NHMA 4OUSA 5HCBA 1IQAA 4QB1A 3O1OA 1J3QA 4IEVA 1CAWB 3RZLA 3S30A 3MIDA 1IZ3A 1WMDA 3OF1A 4UBHA 2E26A 1HX6A 5KC6A 3K4ZA 3RZGA 3MEPA 1UO9A 1AR83 1YO8A 5ABJC 3T08A 3PVBB 4FPYA 3ZIWA 4QM9A 1RUNA 4TN7A 1FNZA 2IXCA 3CLPA 4YM0A 1GUIA 2X5IA 3RJRA 3C7EA 1H30A 3AYAA 4KBBA 3J8F3 4LHNA 4MGQA 4EWDA 3PTRB 3JBG3 3U0ZA 3KV6A 3D0SA 3P3PA 4M4PA 1HB4A 2FCTA 1OUXA 4FVVA 1XXNA 2RV9A 2WZPP 4BIOA 4NIHA 1UOFA 2E9QA 4IE6A 3MIHA 4GMP1 5JOWA 1JZ2A 4EROA 3AZVA 1ZREA 2D7FA 4KGGA 4LKFA 4O65A 5A3WA 1RUG1 3QH7A 2OX0A 4NPMA 1R64A 4LO7A 1PGW2 3J7MA 5FPBA 4XMAA 1OUSA 2AEZA 2VZSA 1OLQA 3WCSA 1RUD2 2EIBA 3KT4A 4OUMA 3U4XA 4BLIA 5JZGC 1TME2 2BFUS 2QUOA 4GB33 4LIUA 2FDGA 1O4TA 1OXCA 2XG3A 3OGRA 3E1F1 1LOFC 2VNRA 1QJX2 2PHTA 1PIV2 2XBO2 3HT1A 2E6VA 2DVAA 4BOWA 3T0DA 5FZCA 1ZRFA 4V2VA 5A1FA 1F4AA 3H8OA 4D6SA 4MX3A 4L99A 1UW8A 4K8RB 4QGMA 3THPA 5CVRA 4RQPA 3ENRA 1WLTA 3T1LA 1UXZA 2IXLA 3MHZA 3VDDA 3NNJA 1NY71 3I8TA 3PUQA 4LLFA 1V6IA 1PO12 4XAAA 1ZBE3 4W6XA 1JU4A 1AXZA 3ZXJA 2F4PA 5LEKA 2HWE1 5F7UA 4W4ZA 1H8TA 3D82A 2NMOA 2CDPA 1UYZA 3LDBA 2DVBA 4GIQA 1KRIA 5FXZA 2VXRA 1HJFA 2WS93 3LEIA 4LBLA 1PMHX 1ZRRA 1U5IA 2Q30A 2XJRA 1H9WA 3B7MA 1EP0A 5H9QA 2UY8A 2Q8EA 1BVP1 5DQ0A 2BERA 1YI7A 4XCBA 1SLLA 3WINE 3H9AA 1RVF2 4XUOA 2DVDA 1W39A 3UK9A 2RVAA 3HPNA 4Q4X3 5C8CA 1DYOA 3OPZA 3I2IA 4AEDB 2BNMA 2ZHNA 2RDSA 3ABZA 2R30A 2BGCA 4WVVA 3CZUA 3M3EA 3RG0A 4CDQB 3DPRB 1NCRA 1GZTA 4L92A 3C7HA 3D4KA 2ARXA 1AX0A 2RM22 5DXDA 2Y33A 4COYA 4DINB 5A6QA 3IDCB 2D44A 2B9UA 1QEXA 2A6XA 4IE0A 1RUD1 1NLSA 4CEYB 1LGCA 3NSTA 4CU7A 1TME1 4Q0SA 3NAPC 1U0AA 4SBVA 1OA3A 1OA4A 2ARBA 2WNEA 2XJSA 1QJX1 2XBO1 1PIV1 2Z79A 1WKYA 2OUHA 4CP2A 3U4SA 1DGRN 5CYYA 5L73A 1VBD1 3H42B 3RPQA 3OUIA 2P6CA 2CGPA 4CCLA 3VBSC 5IAXA 3IM0A 3A4UA 3VGIA 1MPXA 1C4RA 3LGRA 4QDQA 3KCXA 4KWJA 1SCSA 4AI8A 1O5UA 4XUNA 1K42A 1KD7A 1PO11 3ZXDA 3I59A 4HKOA 4A44A 4NHXA 4HPKA 4OI1A 2SBAA 4IV1B 1OLRA 1AYN2 5IVJA 1PX4A 4PHZA 2RJLA 1ULGA 2WT1A 4YNIA 1D2SA 3ZLIA 3IDAA 1J1LA 4QB2A 1XSQA 5IWFA 1PM4A 1B35C 2K2SA 1YEWA 5C3OA 1RJ8A 5T55A 3MUZ1 4B4PA 2P2KA 3ZIXA 1RVF1 2JKBA 2QE3A 4QXCA 4BQ4A 4DIQA 3DKWA 2A3XA 2OUJA 5DG1A 4EE2A 2WNVB 1AR72 1RUC3 3AK0A 3V56A 1N1SA 1W8WA 3BOPA 4LE4A 1JUHA 4CYDA 4DUXA 1DHKB 3NO8A 5FBZA 4CP1A 3RZJA 1UX7A 4C90A 2RM21 4NOTA 2O8OA 5J96B 3Q8EA 1HQNA 4P9YA 1DGLA 1F9KA 2JG8B 1G9BA 2JDMA 1VAVA 1DLCA 1YQ8A 4OHZA 3HQXA 1S2BA 1UY0A 2ZX2A 4HFSA 1ENRA 3ZN5A 2VBDA 5A6YA 2A3YA 5HXVA 4N8MA 3W9AA 1BMV2 1VAKA 4AHWA 5F3GA 2Q1ZB 2PHWA 3G7DA 3NJYA 1AR93 1CAVA 2V5YA 3OGJA 4XFIA 5FREA 3WDYA 5JAXA 1WW7A 2VZOA 1IS6A 2VH9A 3FHIB 3IMNA 1ALYA 4IW3A 3IPVB 4D3WA 3IDEA 3NQHA 2XVLA 5FZ6A 4WVWA 1O3QA 4LOSA 2PHDA 3AZWA 2GH8A 4XTPA 4ARXA 3HR9A 2O8QA 2MHFA 2VMEA 3FHQA 2VD7A 3H7YA 4WZFA 1JYVA 2WABA 3EO6A 2BPA2 3D5OA 1WCDJ 1OURA 1KFXL 1FMD3 4XE9A 5G05L 3WF1A 4NROA 4YVWA 2D6LX 1J3PA 1YRZA 2RDQA 1LHUA 1WD3A 2VNOA 4BH9A 5IVEA 4JC1A 4UW6A 4OYUA 1GOFA 3N35A 4GWIA 5BNOC 1H9PA 3ECQA 4QQ2A 4L0PA 1ACCA 4MXWA 1V9U2 4XVHA 3ES1A 4CXWA 5CKQA 5FMDA 2JENA 1W9TA 2PTMA 1Y43B 4JDNA 3JBG1 5JIUA 5CG9A 4UFHA 4CDWB 2YPDA 2VQTA 4AHXA 3GHNA 2QVSB 3H50A 4P9WA 1C5IA 5A3MA 1LOGA 1LKNA 5I91A 3TRSB 3UKNA 5C4WB 5FPXA 1JYIA 2W47A 1SHWB 1E5IA 4MYEA 1MVEA 4UW5A 1UQXA 4YG6A 1W6PA 1NX9A 2D40A 2P17A 5F3IA 3T0AA 4CUCA 5LW9A 4RL7A 2XKOA 1W99A 3KZ4C 4DB5A 1M4WA 5FYCA 3HQUA 4H55A 1DGWX 4AGVA 2VMFA 2XVKA 3O12A 3G6JB 2DTWA 4LMFA 4ZS3A 3SCFA 3V64A 3VBFC 4AVSA 4BK5A 5LWBA 1BMV1 2JDYA 3ACLA 4Q29A 1C1LA 5E6HA 1AUYA 2C4XA 4OLLA 4AVAA 4XFGA 1DU3D 4Q27A 3CBNA 1OBNA 3HJRA 4XF1A 2DCZA 1G9AA 2D6MA 4HSJA 4NUBA 4RA0A 1TG7A 2KR2A 5FJHA 1QWRA 4MHUA 5LB6A 3QD6A 4C8DA 3E6CC 1WD4A 3J4UH 4JGZB 5C7GA 1A8DA 5KXBA 1GNHA 3U07A 2G19A 1IS3A 3ZYHA 1W3VA 4OI0A 3BU0A 1KS4A 3P6BA 3D8CA 5E1RA 5FLIA 3I59B 4MSVA 1NCQA 3CQOA 4HPKB 1SLBA 1WLWA 5I93A 3FMGA 5FZ8A 4ES9A 1UMHA 3KHBA 3NV4A 4Q4X1 2ZBJA 3C8XA 3H3ZA 5EJZB 4CEWA 1LODA 4P9GA 1RUF3 3U78A 1RHI2 1Y3TA 3ZFEA 3A7QA 5JSRA 1PMIA 1W6MB 1W8ZA 4QPIB 2NPIA 1F5FA 4AR2A 1H0BA 2ARAA 2XKPA 3AZZA 4E8CA 2EVXA 5JWPA 1XE8A 1GQPA 4N53B 4M3CA 2ZA9A 3I2KA 4AHYA 5I0DA 1W6OA 4Q0VA 4D7SA 4PDWC 5GALA 1SEFA 3S7EA 4FBFA 2IVJA 2YPJA 4PF1A 1SLCA 1O8SA 4UFJA 2EALA 5FZLA 1VBA3 1YQ6A 1V0AA 5F9TA 3VBRA 2XJUA 3H3LA 3N9NA 4YZ3A 3I2OA 2ZGSA 4JHTA 2VOKA 1YCIA 2DCKA 4Q26A 4MGZE 5HV4A 2DF7A 5GM0A 2CL2A 3HBZA 4QQOA 1MS4A 5FZ9A 4EN9B 2HKXA 4JGYA 5BNNA 5CFCB 2QNKA 5IK4A 4QPGA 1OD3A 4V2WA 2R0HA 1ZBA3 3JU9A 3UV9A 3P3NA 1D4M3 1MACA 1XJAA 4HL0A 2YHJA 3ACIA 4BLJA 2HWB3 4A6OA 2WNUB 3THDA 5FYTA 1RUI2 4QB6A 2BBVA 1N1VA 4XIKA 4ZXEA 2BOJA 4M3CE 2YZ4A 3ASIA 1K3IA 2BWCA 2FCUA 3LSEA 5FYBA 4W65A 5KC5A 5F2SA 2DUQA 4D94A 1OSGA 5FYUA 2YG0A 3VL9A 3VZLA 2G9ZA 3T4VA 1RUC1 3EBRA 1W6NB 5L7OC 4AVBA 1NUKA 1IQDC 4QU2A 4Y4RA 1UCXA 3I3BA 2VU9A 1NZCA 1MS5A 1JBCA 1HW5A 1KITA 3KM5A 3AP7A 2ERFA 2ZCWA 3MDPA 3KB5A 1XB9A 1KDKA 1C5HA 2DDUA 3LEGA 2GC2A 2DCYA 1W2NA 3K3OA 2B42B 3MO4A 2ZMLA 1YFUA 2W52A 1GZWA 4RFT0 4UI9L 5FOJB 4ZU4A 1PVC2 3GF6A 4QX1A 5KHIA 1CZSA 2LS6A 2ZGMA 5CNAA 1EYBA 1RTVA 3AYDA 3I3QA 4Q0UA 4F7ZA 3MLLA 1N3QA 4AWDA 1IKPA 4QHZA 3SXWA 1FV2A 4I3PA 2OZ6A 3VKFC 1FPN2 1HV0A 2BBAA 4HSLA 5CFDA 3UL2A 1LEMA 3H1WA 1ULDA 1CPMA 1R083 2DFCA 1OT5A 4GJZA 2RDRA 2OYZA 1LESA 3ZSKA 2C26A 2P3KA 4O9EA 2UYAA 2G4IA 1LNSA 5JI9A 1WLCA 1YJKA 1CX4A 1FMD1 3B5LB 3IN9A 1FYUA 3WEZA 4FPHA 5LBBA 4E2SA 2PAEA 5D2AA 4NHLA 1JHJA 1PNGA 4XBQA 1PO22 1QJU2 1H1IA 1RUI1 4UFLA 1LU1A 3O1SA 2OVUA 1WMFA 2MEV2 3SC7X 3WDWA 2GNBA 5FPVA 2W3JA 2QQKA 5FO7B 2XQRA 2ZEXA 4YW7A 3NMBA 3W58A 4YGBA 1RUJ2 4AQ6A 5GJ6A 2CTVA 4L2NA 3RGBA 3CJIC 3SLIA 4SLIA 2VUAA 5LZ6A 1UZWA 2R072 2VMDA 2VUDA 4XFFA 5F6LB 2TBVA 3VBUC 1N3PA 3OJBA 3TOJA 1K5MA 2E53A 4XUQA 4Y5SA 4P08A 2DUPA 1S2KA 4XILA 1NA1A 3HN1A 3VN4A 3C7GA 3ZFEB 1O7FA 3WG2A 1PVXA 2QZ2A 1KJRA 1PVC1 2YMZA 4QXHA 2WQ4A 4AFBA 1UZYA 1NYWA 2A7AA 1BYHA 1MS1A 2J42A 5LBCA 4DNYA 4YVSB 1IHMA 4PLNA 1BK1A 1OPOA 5DDJ2 1H2KA 1VBA2 2JDZA 4M3CB 5GZFA 1FPN1 3TYJA 4COUA 1CIWA 4JKMA 1N1TA 2XXZA 2HWD3 4TZDA 5FQ0A 4OHXA 4Y1XA 2W5FA 4Q4V3 5A7QA 4AQTA 3MICA 2G9GA 3E97A 4XPVA 3NL1A 4QDRA 3HN3A 1G9DA 4ITCA 1CAUA 3AC0A 3GZTB 5FMCA 5GLTA 2ZGUA 3HQRA 2E7TA 4QKDA 3ZFGC 4ZZ8A 1B09A 1JH5A 1PK6A 4GQ7A 4YGDA 1VP6A 5FWJA 4I2OA 1PO21 1S55A 1CIYA 1W0OA 2MEV1 2QQOA 2BEOA 2IVIB 1GZCA 4JQTA 4PIYA 4RR3A 4EN0A 1CAXB 1ZA4A 2Q0AA 1RMU3 4DXSA 1X36A 4JGYB 3DV8A 1FX5A 1Y4WA 3ZR6A 4CCKA 5FY5A 1JI6A 1MQTC 1RUJ1 1GU3A 2VOVA 3INAA 1S0DA 1A78A 1R093 2P6HA 4AEJA 4B4RA 3USUA 4BU2A 2B46X 3AP6A 3TN92 3W59A 3RZMA 4LK7A 5A1AA 1OOPA 1RUF1 4DEQA 4E4HA 5KHJA 2R071 4A45A 4CPBD 2QJVA 4IEQA 4CDXA 2Z2SB 3LD8A 3POEA 1UZ0A 3M3OA 2FDHA 5T54A 4HVRA 5GZCA 2ET1A 2OZJA 1JZ6A 1PGL2 2QDNA 3IKWA 2PELA 4KWUA 1G86A 2R7EB 2A6YA 1TMF3 2ZTNA 3U11A 3RZKA 4QWNA 4ZU7A 5CA6A 1CAWA 1W2AX 2VNGA 4M00A 1GR3A 3A0KA 1WCKA 4XXAA 2P3YA 1KXGA 3HT2A 5I0TA 1EV12 4YM2A 1RUH3 5F32A 4EQVA 1R1A2 3DUIA 3B93A 4NHKA 1VBA1 4BYYA 2Y34A 3LFMA 1XOYA 1Z78A 2WNOA 4QM8A 1W0NA 1HXS3 3CL1A 4RS5A 5FZDA 4YZ1A 3VBHC 1IG3A 1Z7S3 4R4XA 4RSUA 4XJ9A 2F6BA 4QHOA 1AYM2 5A3TA 3RYPA 4S2HA 3V0BA 1Q8VA 2YBSA 4ZHNA 2I07B 1AR63 1VBC2 2RS12 4I0AA 4LO5B 4BISA 4OQ8A 5CFDB 1XYPA 3POWA 1ZBA1 3B9CA 5DZFA 1D4M1 4HT1T 3OEBA 2YROA 1JN2P 3WNMA 1VBB3 4FFFA 2Y26A 2BU9A 3OGGA 4NJ4A 1V6JA 4WVMA 3EJKA 4LBOA 4YWAA 5FZEA 4QPYA 3QBQA 3ZO0B 1QH6A 4FI9A 1C28A 1ULCA 4IUGA 3FBYA 1I6XA 1F4HA 1SFNA 1E5RA 2EA7A 1ULOA 2KXLA 1U5ZA 1UPSA 3BN6A 3UKTA 2C24A 2WWSA 3CO2A 3JXSA 2E51A 4D8MA 2FMDA 5T5JA 5KHHA 1WUVA 2PHRA 1X33A 3MPPG 4Z2AA 1EV11 3K3NA 4NWWA 4WM7B 4AAPA 5IK8A 1QOOA 1R1A1 3E5XA 4UW4A 1RINA 1JYCA 3WF0A 1OC1A 3FL7A 4AOCA 2YV8A 4BZ4A 3QLQA 1DBNA 2PLV2 2VJXA 4FFHA 3NV1A 4W6WA 4BCUA 4DZGA 1TNFA 1RITA 1LGBA 4XW3A 3ZVXA 2PHUA 4Q1PA 5CKMA 3W21A 2GN7A 2HBUA 5J37A 2HWC3 2C0ZA 2VM9A 2WT0A 1X8EA 2JG9B 3ETQA 4YM1A 4CDQA 5DUUA 1SCRA 2GZWA 3RS6A 3FX3A 1GZ9A 3B01A 4PIXA 3UESA 3ES4A 4U2AA 1MS8A 3M8LA 4ZY9A 3M3QA 4IV3C 3ZX7A 5FQ0B 5A6ZA 4NVPA 4BMEA 3FE5A 3TNQA 1GNYA 3EYPA 2SLIA 1GLHA 1CAUB 4XF4A 4Q4W3 4YLZA 1GOGA 4AW7A 3O14A 3PMEA 3PUSA 4YZ4A 3PDQA 4L11A 3X29B 4B1LA 2NP0A 1PZ8A 1W0PA 2F4LA 5LA1A 1WA4A 1RUE3 4RR3B 3URFA 2VL4A 3WW4A 3IB3A 3BODA 1JOBA 3ITQA 3OB8A 1O8PA 4YW6A 5EYYA 2LTNA 3ZYBA 5FPAA 2VCMA 2FDIA 5K0UC 2WYFA 2W0XA 2WFF2 4DFSA 3USUB 5FPLA 4IV1A 2QQUA 1FOD3 2ZAHA 2WRAA 5HI0A 4NAOA 1POV0 3ST7A 1J58A 2IWGB 4CDXB 5FZBA 3AKSA 5ACA2 5CZKA 2FDKA 3DL3A 4NO4A 1W04A 3PUIA 1MEC3 4IEYA 1NY72 4JX0A 2BP6A 2R043 2Z4FA 4NPRA 4AZZA 2B9VA 2PLV1 5FZ1A 5FO8B 2CAVA 1BBT3 1LHVA 1W9YA 2GU9A 2RMU3 2ZZQA 3IT8A 4FFIA 1SBFA 2HWE2 3OGSA 2UWAA 2YFUA 5KHGA 2WNVA 5D1IA 3RNSA 5EPAA 2HWD1 5FYZA 2YY1A 5JPMB 2ZX0A 4ISRA 2ZGPA 3NW4A 4Q4V1 1AL22 4D6QA 3KHCA 1DG6A 2W87A 4ZS2A 4ZU5A 3USSA 1NLQA 3ZXFA 1Z0HA 1QH7A 2JG8A 2OXBA 5HPOA 4RS5B 3RI8A 4QKFA 5C5TA 1Q56A 3LZZA 2H6BA 1NE4A 3U10A 4LHSA 5L36A 1COV3 2BVVA 3AMPA 3V0BB 3W20A 4LO6B 5HV0A 4DOUA 1WGPA 4K21A 1T6GC 4AI9A 4IDZA 4Y26A 3EXUA 4XC9A 4A41A 1L7LA 3PURA 2J1UA 1N3OA 3IPVA 3U37A 2MNGA 2BDRA 4MGTA 3LDKA 1OQDA 4WVMB 2JDUA 3WCRA 4UXAA 4O9GA 1AZDA 1STMA 1Y9QA 2OIIA 3VZOA 1GWMA 2WFF1 1UMIA 4K8FA 4OHVA 5LK5A 1VR3A 1GNZA 2VZTA 3LA2A 5FZAA 2J1AA 4ARYA 1ASJ3 1YYNA 4B8EA 1ZZ8A 1VBD2 2FMYA 5JR2A 4AF9A 5ACA1 5C3SA 4XURA 3N9LA 1LEDA 2WR9A 2H0VA 1B35A 2C9AA 3LB9A 4JTOA 1W3XA 1SFYA 1YFXA 5T5PA 2R063 3TNPB 4CDWA 5FUPA 1US3A 2VG9A 5CEHA 1Z7S1 3ZXEA 2ZJCA 3IAQA 3HAGA 4MGYE 2PAKA 1AL21 2ZX4A 4XCAA 5LK7B 5ABJB 1RIRA 1UKGA 4CUBA 5C4WA 3VHRA 4AYUA 2JE9A 1GWLA 2OQ7A 5FZOB 3P1IA 5K7PA 2CY6A 3VBOC 1W9SA 3QOPA 2FZ1A 3N7JA 1SBDA 3THTA 1JYWA 2EXHA 3OD4A 5IUQA 3H7JA 4URTA 3WNPA 5ISLA 1CONA 2FBEA 1OH3A 1G6NA 1YHFA 1IG0A 3RMYA 3LPFA 1SLAA 2TEPA 1QF3A 5LEJA 1DP0A 5C6CA 1NE6A 1JODA 3VHNA 1GQGA 3JZVA 4IESA 5IHRA 4OUEA 1OQEA 4NMIA 3SCHA 3TAYA 2Y60A 1XE7A 1NT0A 3NKTA 5H9SA 5SV8A 5A6XA 5KXDA 1BK0A 2AEYA 4L8QA 3TEYA 5EFUA 1PHMA 4XETA 2MPFA 5JZGB 1WBLA 2NN8A 4CPBA 5L9VA 3OYWA 1W8UA 1CQ9A 1YXWA 4Q4Y2 1KFUL 3EB7A 2WO2A 1A3KA 1OKQA 1JOJA 1PMJX 1RJ7A 3ACHA 5JOYA 1BEV3 4CCEA 4AI2A 4JGZA 4LLOA 4NRPA 3SKJE 2X5IC 1AX2A 4N90A 1PX3A 5BNOA 4I0BA 4GA9A 5H9PA 1REEA 1NXD1 2BYVE 3KF3A 4NHYA 3POFA 1VJ2A 4AVVA 2K46A 4Y24A 1DFQA 4D6RA 4XABA 4MUVA 1A8MA 4OVEA 1XYNA 2VZUA 5GLUA 3ACFA 4BQ1A 4OMDA 3T09A 3GM8A 4KU7A 4PF5A 2DCTA 5EHDA 1OKOA 1UOBA 1DIWA 1VB2A 1D0GA 4CU8A 2XMLA 5FY1A 1AR82 1ODMA 2RG4A 3BYWA 2HWC1 2BWAA 2VZRA 3PUHA 3ZN4A 1W6MA 2BQPA 4QPIA 2JEMA 5EXOA 2ORXA 3ZXGA 4FTSA 1GQHA 1REDA 2A73B 2QZ3A 2UU8A 3J8F2 3N9QA 1XC6A 3JBG2 3MIEA 1W8TA 1IGOA 1ZRIA 4N53A 2G1MA 4XUPA 5T52A 5T5OA 1ND2C 1ND3C 3WLUA 4AQSA 2VBBA 1CX1A 3K46A 1HQWA 1W2OA 1COV2 4MOAA 4HVQA 3I7DA 4YSFA 1WW4A 5CB7A 3UJQA 4RQPC 1EY2A 1JUIA 3AP9A 3J26N 3VDDC 4F83A 3BPSA 3CJXA 5LY2A 1RUE1 4RHV3 1UY4A 2EXIA 3SKVA 4KG8A 1H8TC 5AVPA 1JMUB 2WJSA 3AMQA 4R9BA 5FJKA 2QBXA 3NAPB 4GB32 3WG3A 4Q4Y1 3WQ1A 1VRH3 2Y6KA 1W03A 1W8FA 4FOQA 1OFSA 4BB3A 3N7MA 5CFCA 5HXMA 1CJPA 2ZZJA 2QQPA 2JIGA 4W50A 1JU3A 1ASJ2 4CCDA 3PJQA 2RS53 3VBSB 4E8DA 1HRV3 4J6GA 3KCCA 5FXXA 1SZBA 2DCJA 2WNUA 3HOBA 3ILRA 5H9RA 2HJIA 4QX8A 5A7PA 3I2JA 5F3CA 5KR7A 2X8KA 4RGKA 5T50A 4GD4A 1MEC1 4I09A 5F2WA 5F3EA 3UGGA 1YUDA 1SPPB 2A6VA 1ZBE2 1NCRC 4JRLA 2P1BA 1US2A 1KGYA 5IVFA 2VECA 2HWF3 1W6NA 4OHYA 2XL7A 1ONAA 4GULA 1GWKA 2ETEA 1QQP3 1AR81 2WLQA 2WS92 2ZHMA 2AACA 4A3ZA 5F37A 1LJ7A 1B35B 1RB8G 3PVEA 2PHXA 4LORA 2ZMKA 2XGXA 2Y0IA 1ZZ7A 3J8F1 3K4DA 1QXPA 1VMJA 2VOTA 3MIFA 2WAOA 1NG0A 4Q4X2 4KWKA 1XU2A 2B45X 3E5UA 2BJSA 3JQWA 2L9LA 2XUEA 1UU5A 1COV1 3L2HA 5FP3A 1Q5OA 4FTEA 5A7WB 5KBFA 2P34A 1Q8OA 2W1SA 3VKLA 4LKEA 4AFAA 4FQ4A 2Z69A 4BQXA 4DUVA 1NLRA 2EIDA 1YLLA 4HMZA 1ZA7A 3BIWE 4Q0QA 2LRPA 2BV4A 3GZUC 3BOWA 2W92A 1LOAA 3K51A 4FPKA 3P5BA 4UFMA 1LOEA 4E4DX 1SACA 4EZHA 2UWBA 4IQPA 4GB31 3I3EA 1SLIA 2HEVF 5IFPA 5LCWL 1GOHA 5FP8A 2QQNA 2W1UA 2CSGA 1QJY3 3H1YA 4FPOB 4L97A 4B7EA 4CDUC 5JDBA 3AX4A 1AHSA 1ASJ1 3O0WA 4CCMA 4IE5A 3ME2A 1D0HA 4JRAA 3F95A 2TUNA 4XJUA 1LECA 2D5FA 3HEIA 3LWCA 3OYWB 2Z5WA 4K9SA 5FZGA 1UZZA 2DYCA 3DN7A 1S0CA 3POYA 3WF2A 1ZBE1 2DU0A 4A4AA 4H2AA 3FUOA 1WZXA 1CGPA 4F3JA 2XJVA 3KQRA 4LBQD 2O0OA 3B94A 1HJGA 5BNOB 2XWBB 2WS91 1QNWA 4TSVA 3SH4A 3AKPA 4WM8C 5JCTA 1MR5A 1QJZA 1SDWA 4TYSA 4Y5Z0 2WYSA 4AGRA 2EAKA 1POQA 4XJWA 4CU9A 1YIFA 4CUAA 1NQJA 1V00A 4BWOA 4AHZA 3O1PA 3BGAA 2YU1A 1JZ3A 3ZPOA 5IATA 5GKAC 1RUC2 3PVNA 4NIAA 3BPZA 3FBMA 3WV6A 3WF4A 4CA9A 5J09A 1IPSA 4LTAA 2XHKA 4E2GA 3VZNA 5DMYA 4YARA 1UIKA 2H6CA 1VBE3 2Q5TA 5IAVA 4C1XA 4YVSA 1JTZX 2JB8A 3TBDA 4N43C 5C9AC 3FLTA 4XDQA 2BW8A 4XHBA 2XLAA 2IXHA 3NKGA 4E27A 2P3JA 2IZWA 4GMP0 2Q8CA 3LCPA 4YVWC 1SDDB 1UXXX 1E5SA 3VBFB 1UYPA 2VMHA 1P8JA 3BTZA 4BDVB 3N7KA 4AEKA 3KWVA 1X9TA 1AR92 2B39A 4YW2A 2A5ZA 1L7RA 3KSCA 4B7KA 1OI6A 5K8SA 3LA7A 3ZYFA 5CU1A 3BB6A 2RS52 1EUTA 4UAPA 4FXGB 1VE0A 1UAIA 2YDEA 3VLBB 2WUHA 2ZGNA 1CAXA 1IPJA 4FOWA 5FIXA 3BTXA 2OPKA 3FFZA 3UJOA 1FMD2 4QQLA 3O1MA 5CAZA 1LENA 1T6BX 1VIWB 5AC93 1LCLA 4M0HA 4DRRA 2E32A 2EICA 4J1WA 1UF2C 4O7XA 5A7OA 4PT6A 4ASKA 2DVGA 2GC3A 2GC1A 2VW0A 2VZVA 5B2GB 1PNFA 1QXJA 3PHMA 4BIFA 2VVEA 4LPLA 2D43A 2R1DA 5D8AC 3T2OA 2WZR3 1JYNA 3MFCA 3DGTA 2WA4A 4NRQA 4K6BA 2PAMA 4GJYA 3AYCA 3HD8B 3KF5A 4I01A 1JXNA 2BUKA 4H14A 2LM3A 4Z82A 5F5CA 2UWCA 4K7JA 3SITA 2J1EA 3NNLA 4FPCA 1PZ9A 2DVFA 2ZKNA 1XNCA 2VMIA 3LIGA 2GP5A 1X8MA 2I45A 2JDAA 4IEWA 1QDOA 2VZPA 1OLMA 3K77A 4JDOA 1CD3G 5F5QA 5L9BA 2WO7A 4XF0A 3WOGA 4PDWB 1OHFA 2C9KA 3S5QA 5DAXA 4DMIA 2JXAA 2ZEWA 1KJLA 2VXJA 3DYMA 2R32A 3T0BA 5E8AA 5G04L 1GICA 5FP7A 4MO3M 3ZYIB 2ZS6B 1C8M3 3GCXA 4IGOA 4XF9A 1AR91 4S2DA 4BE3A 1G9CA 3ORJA 4IETA 1ZNPA 4PQQA 1FAYA 1NCQC 4FPFA 4A7YA 4ATEA 1EPZA 4JKLA 3WHUA 2RS51 4YFZA 2PYTA 1HRI3 5EP9A 3H8RA 1F35A 1T2XA 3NV2A 3I97A 4AVCA 4CEWC 2E7QA 3OBAA 3IIIA 4EV0A 3S0MA 2LROA 1DYPA 3MPBA 2IFRA 2VCCA 3R05A 4LK6A 2DBNA 3WNOA 3UGHA 5AFEA 3UYJA 2HYKA 5CIRA 4JKKA 1C8NA 4LBNA 1Q8QA 1WMXA 1XQNA 4GZ9A 2YC2A 4JHZA 3OSDA 4LUMA 1GP4A 3SCGA 1G7YA 3AP5A 3M7AA 1AJOA 2ZHLA 3LE0A 2D6NA 1OLME 3RDIA 2QQMA 3RWNA 4AI1A 4UT5A 1HB1A 3I2HA 2P3IA 1RYYA 2VW1A 2VCBA 4RFRB 1MZFA 3A23A 3J9SA 1LHOA 2NQYA 5FMOL 5L7OB 3AVSA 2IUWA 3C2UA 4HANA 2GMEA 1H2NA 1RUF2 3VBRC 3UNPA 2ZGKA 1ULEA 4WM7A 3ZFFC 3PJYA 4FQZA 1QKQA 2XLGA 2VTXA 4G9SB 2VBPA 4AAXA 2ZEZA 3LKJA 3K2OA 2E31A 5J1XA 2GMPA 4XTMA 5BNNC 4LEJA 1ST8A 2HEYF 5HCAA 2R0FA 4CXYA 1GP6A 2N7GA 4QPGC 5J98B 1XNKA 2HLEA 5J48A 2XPJA 1MS9A 3LAGA 1TZOA 1XNBA 2ES3A 4KI5M 2JG9A 1KS5A 2D6KA 1JW6A 4P5HA 2Q8DA 3TEWA 2V4VA 4BM8A 1VLNA 2D3PA 1V6LA 3WNXA 1GANA 1OQ1A 4KU8A 4FO9A 5F1RA 1RGSA 3T1MA 1OA2A 2PFWA 1JZ5A 3GGLA 2V73A 5A3PA 4M01A 4Y22B 3Q9OA 2BOIA 2WO1A 1POV3 3WDVA 5E89A 4FP3A 1RUOA 2IXIA 2RJKA 1ENXA 2J1RA 4NE9A 4OHWA 3ZKYA 3JD73 4NN0A 2WDBA 1ZBA2 2Y64A 3H3UA 4QT6A 4Y3OA 1H4HA 5GLVA 1D4M2 4ATFA 4EWAA 1GV9A 4LBJA 2HWB2 3B9IA 1UY2A 4UBGA 3CIHA 4FOYA 1EAH3 2RR13 1DQ6A 2D3RA 1F5JA 3U14A 5GZEA 2WKKA 2HBTA 1M06G 1BCXA 2BZDA 3POIA 3OBTA 2VUJA 1GSLA 4JAAA 5APAA 3CJIB 1MZ6A 5FYSA 3WF3A 1GYKA 3KVAA 3WXPA 3E6BA 3VBUB 4QKNA 3I2DA 2W95A 3MGUA 3QH6A 4GWNA 4XQWA 2K9ZA 2QQWA 5JXGA 1K12A 3BUCA 3GDBA 3RZHA 2JDNA 4W8JA 1LU2A 1QNYA 1QU0A 2NM1A 3NJXA 5A32A 4X8PA 5L9RA 1RUG3 2VCAA 3LSDA 1AXYA 1HIXA 3CNAA 5DAWA 5JOXA 2CWMA 3IBMA 2XL9A 2VNVA 5LA2A 5E16A 4MV2A 4LR4A 4RGAA 4LO8A 4P00B 4R9CA 4UFIA 2XLFA 5I8TA 5BXXA 4XIOA 2WIIB 1APNA 2GAUA 3VKOA 1HQLA 3JCIA 5IVVA 4COVA 3O7OA 2JIJA 2JB4A 4IV3A 5LA9A 1UYXA 2WAAA 1ZZ6A 3GBGA 1R082 4LITA 3VD4A 4H3WA 4EWEA 4HXCA 1DDLA 2PHLA 4AFDA 1YJLA 1I5ZA 4AQ2A 2XR4A 5LBFA 3ZOIA 5A3UA 5EIYB 2Y6JA 2ZX1A 4R4ZA 2XH6A 5I0RA 1K5MC 3ZFGB 2A70A 5FY7A 5I0SA 1OF3A 1O4ZA 2HWB1 5FZIA 5JVVA 3WDXA 3BVCA 4BQYA 3TWIA 1NA1C 5JI7A 4LBQA 3LOBA 2D98A 2WO3A 4PLMA 4KBZA 3B02A 4AL9A 4E2QA 1MQTB 2NZ9A 3FUQA 4QPWA 4R52A 4XEZA 5FPZA 1UIJA 2GNMA 2VMCA 3E5QA 2CHHA 5FXWA 4CCOA 5JPNB 4QGNA 4N9HA 3VZKA 3ZXAC 1UWWA 2QFEA 2UURA 3BU7A 4RGGA 1UZVA 3CZJA 5DZGA 2Y0OA 3WP4A 3ZN6B 4WVZA 4DEVA 1U12A 5JUVA 2ZGTA 5K4LA 4YG3A 2CU5A 3M4FA 5JR7B 2ZGOA 4GXLA 4XQDA 4ZXKA 3A21A 1S0IA 2A6WA 4FAGA 4Q5OA 1YFWA 1HB3A 1S0GA 1GFF2 2HH9A 5BV6A 2VTFA 4LA2A 5IW0A 3Q8BA 1PK6C 3WP3A 5CBLA 3IWZA 3T2PA 4IEZA 4YRDA 1Q3EA 4XDPA 4GH4C 5ABJA 5GLZA 1A6CA 4JZRA 3T3YA 3WSOA 1C8M1 1RUD3 5FZ3A 4XJAA 2Y6HA 5KXEA 4PQ9A 1TE1B 1W6QB 1TME3 5FZOA 1H6XA 3UKVA 3VBHB 1D4VB 3OY8B 1R081 2HWD2 1QJX3 2CYFA 1PIV3 2XBO3 3RSJA 1RL3A 4PCRA 4Q4V2 3AZXA 1OOPC 2FZ2A 3B69A 2YXSA 2ZGLA 3A22A 4LUKA 5DPNA 4BPZA 5FYHA 2OW4A 1PO13 4B29A 3AXDA 2QTWB 2UYBA 1DGWA 2FQPA 1UNBA 3PIJA 4PLOA 4LJHA 1XSRA 4G4FA 4YW5A 1RMU2 5JZGA 1YFYA 3H8XA 3O1TA 3N36A 4A42A 1LOFA 2ADEA 1R092 3SH5A 2DURA 2EXKA 2NMNA 2JD4A 2RS33 5FP9A 5BNPC 1RVF3 5FPUA 5F5IA 1KEXA 1XYOA 3PUAA 4K40A 3TB0A 3WQ0A 5A3LA 3ILFA 5K9YA 2BGOA 4OI4A 1QJFA 2GSYA 2NLRA 4CUGA 3C7FA 2JDPA 4NIDA 1DQ1A 4EN7B 1TMF2 1LB2A 3I54A 2VULA 4YZ2A 5FY4A 3GZAA 4W6YA 2RM23 2WWJA 3KV5A 1NOVA 2ATFA 2AH2A 2KA3A 2VMGA 3CU7A 5A33B 2DBIA 5ANQA 1OF4A 2VOWA 1RUH2 3DCQA 1TEIA 3WG4A 2JDHA 5FLHA 5B4XA 5FTTC 3B3QE 4Y1YA 2EXJA 1Y9MA 2BTVC 4META 5FUIA 5A32B 3LFIA 5FY9A 3WDUA 4ASLA 4TLGA 4QX7A 1HXS2 3VBOA 4XAEA 4FPJA 2ILMA 2PN5A 4B4QA 3AKQA 3J7LA 1FXZA 1Z7S2 3MBWA 5A7NA 4Q1RA 2RDNA 3ZR5A 3PU8A 3KVBA 5FBJA 4A6SA 1POV1 4PJYA 5FZ0A 1CWPA 3BKZA 2OPWA 1AR62 4KH9A 5FV3A 2A71A 5FYIA 4IV3B 2VGDA 1K45A 4BMBA 4YGCA 2ZX3A 1HN0A 1H2MA 3WUDA 1AYN3 2A6ZA 1CESA 1VBB2 1EAH1 1RMU1 2RR11 2V4AA 3B00A 1JHNA 3I4IA 3LEKA 4IEXA 1ZM1A 5DABA 3WZ1A 4DO0A 3V0AA 4YZ5A 5FZMA 3NAPA 5FZKA 3KD4A 4AXOA 4B1MA 1LGNA 2R49A 4FCAA 4YPJA 1FATA 1DGRA 1R091 2WINB 3MW2A 4PI0A 1FI2A 2VVFA 2J1VA 5IK7A 1UOGA 5BNQA 1V6NA 4LBQB 4Z1VA 5JXJA 3KGLA 4IGPA 2GNDA 3VBSA 2W1QA 5HBAA 5FYYA 1AR73 4FPEA 4YW4A 2ZMNA 4R9DA 2IFWA 5FYMA 3AKRA 1V70A 4IGQA 4LE3A 4AEDC 4ES8A 2VAUA 2EIEA 1TMF1 3RYKA 5K0UB 5EWSA 4XFHA 1SPPA 2R6QA 3WNNA 5FY8A 5LASA 3AJYA 3DPRC 4K1ZA 3WUCA 4CDQC 1HDKA 2X10A 3N9OA 1D2QA 1BKZA 1LOCA 2RE9A 2ZAAA 1RUH1 2D6OX 3WD5A 1N47A 4OMCA 1S1AA 1JZ4A 4DY5A 1J83A 3JQXA 1HLCA 2XWJB 4CEYC 2VUCA 4KWLA 5FMBA 1C3HA 4JDMA 1HXS1 4QD2A 3ZYRA 3ZDSA 3ZPYA 2DUOA 3ZM8A 3FWEA 1ND2A 1ND3A 2YGMA 2ENRA 3GBFA 5FAXA 2EF6A 3C7OA 2Q8OA 3VD9A 4OZXA 5KWRA 1REFA 4Y1VA 1OVSA 2HWC2 2JD9A 4MADA 4DXZA 5A7WA 2FD8A 1AR61 5TSWA 1HB2A 2XVGA 3MF9A 1AXKA 2DU1A 4H7LA 5F5AA 4EN6B 5JXHA 1ZZCA 3K75B 4IEOA 3LOIA 3AZYA 2GDFA 1IOAA 3POJA 3R4SA 4UYBA 4AEMA 5C33A 3MLKA 1VBB1 5IVYA 4EN8B 3FFQA 5FMOS 4IV1C 1HKDA 4LHKA 4FAHA 3DXTA 3PU3A 4HBNA 4E9KA 2WL1A 4Q4W2 1SBEA 3FN9A 5FWEA 2CNAA 2E33A 5FY0A 1OPMA 2Q1FA 1V9U3 3BCWA 3HVDA 3IIAA 5D21A 3ZDVA 1QXRA 1W8OA 4K3UA 2LW8A 3F2ZA 4ORFA 3RI9A 1PGSA 4CXXA 1JS9A 1RUE2 2RS32 4NRMA 2ZOEB 2WNVC 3D6EA 3L2YA 5EYXA 1UY1A 1VB4A 3N4MA 4QHBA 1TNRA 3OPWA 5BYNA 2XJPA 4DS0A 1GBGA 4XJ8A 3VUOA 5ANNA 3LDRA 3KGZA 5A80A 2Q4SA 1NZIA 1FOD2 2HEWF 3DEMA 5FOBB 2W08A 1PGW1 4MXVA 1NAEA 2JG8C 1ZX5A 3NV3A 1ZVFA 2PXJA 3VHOA 3H1MA 2QQVA 2W46A 1X7NA 2WQ8A 3WNKA 1MEC2 4OCTA 2R042 3KQ4B 1VMFA 1W8NA 3VZMA 4KNCA 2V72A 1CPNA 1BBT2 3LEMA 2B5HA 3OG2A 2RMU2 4PIZA 3SEEA 4AK3A 1UYYA 2OT7A 2D6PA 2JWPA 4MHRA 3MV01 4F8AA 4YG0A 2H0BA 1O5LA 3IZOA 3BTYA 4KG0A 1CZVA 4JVAA 3OD0A 1NXMA 4PBOA 2Y38A 3ZSLA 5LBEA 2BRTA 4M3CF 4Q2FA 4QX5A 2ZEYA 3HIFA 3NNGA 5LATA 4CZSA 4DRVA 1S4CA 3VBOB 1W05A 1J84A 1ZRCA 3WHTA 1DQ0A 3AB0A 2HYXA 4YW1A 4CP9B 3VBFA 5BNPB 4Q4W1 4S2FA 4FOVA 1SFPA 1WCQA 1IS5A 2JDKA 1WLDA 1H6YA 3PIGA 1WCSA 3VDCA 4CDUA 1BXHA 1H8VA 4GWMA 5CADA 2AR6A 2VC9A 3WQBA 2RS31 3VD5A 4B3NA 1F8VA 2DV9A 1CN1A 3OUJA 3V0AB 1GMMA 3CDZB 4XMIA 4IL7A 4CDWC 3HNYM 1XE0A 1W9FA 2E63A 2JKXA 5FXVA 1SQ4A 1RHI3 2Y6FA 4LOTA 4AI3A 4CU6A 5EV7A 1IKQA 2VZQA 1URXA 1YNAA 2J7MA 2O1QA 3V65A 3PLQA 3VV1A 1K5JA 5FZ4A 5C4WC 5JSOA 4ZPIA 1FOD1 5BUVA 2OQ6A 2X5IB 2WC2A 3CMGA 1HN1A 3GXUA 4XFCA 1RXGA 1DCSA 2X05A 2JE7A 4R8HA 3CEWA 5C8CC 1XRUA 4WM8A 2BVBA 5IVBA 3D3AA 4Y1ZA 4M4RA 2AC1A 3POSA 3ZYGA 1OFNA 1OMIA 2R041 2YBPA 3ALQA 3N9MA 3POGA 3OGVA 1O3TA 1UX6A 1BBT1 1UPIA 3S7IA 5CG8A 2RMU1 4DY3A 2JX9A 5AFBA 2A75A 1IS4A 2P37A 2R062 5JOZA 3BTAA 3QACA 3D0JA 4MGSA 4ZONA 3O1VA 4LIVA 4MLOA 1A34A 1W8HA 1X50A 4XUTA 5FR3A 4AE2A 1CR7A 1VAMA 4DPNA 1DZTA 3AYEA 3GALA 2R16A 3LPGA 4N43A 5C9AA 2VR4A 2ET7A 2WSUA 4YYOA 5T5LA 2I2SA 3MZHA 1ND2B 1ND3B 3O5SA 4QU1A 1TQ5A 3KT1A 3UT0A 1JOPA 3M1HA 4AI0A 1AYN1 3DKQA 2B4KA 1XNAA 2P4EA 4PDWA 4JGZC 3KT7A 2GMMA 4FTBA 3BIEA 1DZRA 2JICA 2YUEA 4AFCA 4ZZ5A 5F8PA 3MFAA 4OQ9A 4RQPB 1RUI3 2LALA 3E6DA 4QAWA 4N7UA 3ROUA 3VDDB 4NIGA 3BI3A 5BPXA 3MIBA 5DG2A 2ARCA 1QDCA 3ON7A 3ZMOA 2Y6GA 1H8TB 1AR71 2A1XA 1W2TA 3SHRA 2WA3A 4HKWA 2W2IA 3AL5A 1N1YA 2W1WA 3PMSA 3VHPA 5IVCA 1WA6X 2YGLA 5FRAA 3FLPA 5LRSA 1UD1A 4M0NA 4QPIC 5DN2A 1BEV2 1V6KA 5L19A 4AGGA 4D7YA 3AP4A 4A2UA 3PTYA 1EPWA 1J1TA 4NR1A 3KV9A 3MYXA 4X6QB 3VDAA 4CRQA 5C8CB 4S2GA 2XJQA 3NNFA 4HK8A 4N53C 1O3SA 4D69A 2QCSB 2VO5A 1BHGA 4BHPA 3GCWA 3S5AA 2CV6A 2PMWB 2X09A 5A7SA 3WW2A 5D8AA 1PVC3 5F6KA 4KMQA 4UOJA 4IXLA 1NCRB 2R061 5EJ1B 4O61A 1WMEA 3LIHA 5DUWA 1SMVA 5L7OA 3IMMA 2KD7A 5J36A 2OS2A 1WWYA 4Y33A 1ENQA 4I0WB 5IJRA 4FXKB 2PQSA 1FPN3 2D3SA 4XZPA 5FFOC 4X6RB 4ISQA 2RJ2A 1QGLA 4LKDA 1Q8PA 4OZOA 5KHKA 1LOBA 3T2TA 4HOOA 4ZKTB 1UU6A 2WFPA 2FHRA 3AL6A 4URAA 2IXJA 3J7HA 4P02B 4CE8A 2CGOA 5FO9B 5CFCC 1MZEA 1XNTA 2PQQA 3AM2A 4Z92B 2YBKA 3R6SA 4NPLA 3I2FA 2K0GA 1PO23 1QJU3 2EIGA 4QGLA 4XFAA 2EAAA 2WNUC 4MVTA 2MEV3 5DAQA 3CF6E 3HNBM 1V9U1 4HZFA 3WX5A 4JTNA 2AYHA 3WDTA 2E7AA 3CKHA 4XHXA 2WLPA 3GBWA 4RHV2 5JLVA 1X9PA 3ZXLA 1RUJ3 3RZZA 2Z42A 5C8WA 3I2GA 4IEUA 4Y22A 4YM3A 2R073 1LTEA 1VRH2 4EYUA 1BEV1 1UY3A 4CDUB 4TLFA 3WY6A 1MS3A 2TNFA 5JXIA 1DYKA 4H7MA 1S0FA 2GH2A 4COWA 3T4HB 2ZKLA 2CDOA 1DQ2A 3AMNA 1HRV2 4JCKA 1Y7BA 2WZEA 1E5HA 3VD3A 4UF0A 3ZSEA 4DQAA 4HKLA 3A0NA 4KQ7A 2V09A 1UMZA 4U36A 1LRHA 3EQEA 3GHMA 1ULPA 3I3DA 4FSJA 3S57A 1MS0A 1XPWA 3MV11 5FZ7A 4C0BA 4QDSA 2PHFA 4UWDA 5C71A 4R9AA 4AFMA 1SLTA 5BY5A 3CJIA 2HWF2 4J1XA 5DDJ3 4CSWA 4K1YA 4WM8B 4CVUA 1V6OA 1DQ5A 1QQP2 1QOSA 1S2EA 5EQUA 1H1AA 2G9FA 2FDJA 3DF0A 3SMHA 5E88A 3VBUA 5B4NA 3ILNA 4KGQA 3ZFFA 2VZ3A 3LA3A 4DUWA 3SEPA 5IK5A 4LULA 4HVOA 2WN2A 4MZUA 4I30A 1CAVB 3ATGA 1KQRA 4MG2A 4LXLA 2ORZA 3CHXA 3VDBA 2XUMA 2DTYA 2ZHKA 5DZEA 3JUUA 4LBMA 1YIPA 3W5NA 4MGIE 3OBRA 2WBKA 1OD5A 4N43B 5C9AB 3LQCA 3OUHA 4BK4A 2C6SA 3KS7A 1O6UA 2GALA 2ZACA 2W9XA 2ZXQA 4FPGA 4RHV1 1W28A 3N7LA 4YVWB 2CGNA 3T2QA 5FKBA 4A7KA 2Y6LA 3TN93 3AMHA 2DFBA 4XJZA 1RHI1 1VRH1 3S6PA 1AJKA 1O4YA 4BQ5A 4XYXA 4MXWB 1VRBA 1QJY2 2J1TA 2P5BA 1Y9GA 4X8NA 4A7ZA 5IYYA 1ULFA 3K48A 3ZFGA 4BQWA 2KM2A 3PL0A 3KCYA 2OKXA 2QKDA 1HRV1 2VZ1A 3PNAA 2XB6C 3Q8AA 3RQ0A 1JYTA 2F17A 2YC0A 2BFUL 4NWVA 2AZ5A 3ZFEC 4BJ0A 4QXBA 2ZGRA 3ETPA 3FHAA 1MQTA 1UKRA 1EV13 3O1RA 1O91A 1R1A3 3MIGA 4FPLA 3NJVA 3RYRA 2HWF1 4YVSC 4LKSA 4E4ZA 1W6PB 2GN3A 2GP3A 2IC1A 1QQP1 2JE8A 1O3RA 1TVGA 1S0EA 4I3GA 3GYDA 4QQPA 3RRDA 5FK8A 3O0VA 3JB4C 3ZN6A 3GJBA 3RMXA 2D93A 1F31A 4LA3A 5D8AB 1R1ZA 3R4DB 4IERA 3NRUA 1YQ2A 4RD7A 1AYM3 3SISA 4EJRA 2QQLA 3ZYJB 1ZYBA 1VBC3 2RS13 3QCWA 1LULA 4Q8LA 5FZHA 1LR5A 4K20A 1FNYA 5LA0A 3RFRA 4JQRA 3WT3A 1J3RA 1VBE2 3M2MA 3MW4A 4HK9A 2DWRA 4CCJA 1I9RA 4LT5A 1DQ4A 3C3VA 1PZ7A 4ONUA 4FFGA 4JGYC 1W6QA 2UY9A 3AFKA 4Y20A 5C3RA 1S0JA 1IPKA 2YYOA 3VBHA 4OULA 4TTGA 3VKNA 3OY8A 2XQXA 4XACA 5DAVA 4XQ4A 5KXCA 5AVAA 1JYXA 3WP6A 1QOTA 2JECA 3VZJA 4BXFA 4FT8A 2R1BA 1QJY1 4C91A 3AMMA 2VY0A 4QMAA 1NCQB 2PA7A 5HCHA 1FT9A 4OI2A 4QX3A 1LHNA 1H2LA 5I0UA 4XOGA 3MF6A 2QQJA 2IXKA 4CEWB 2GC0A 1RXFA 1YWKA 1VALA 3TEZA 1QY4A 1KDMA 1ODNA 2AGSA 3NWKA 3APBA 2CWSA 4DXRA 4RYDA 4QKBA 1UN1A 3DYPA 4UW3A 1CVNA 5AC92 3LF7A 5GLWA 4LQRA 1DZQA 2PLV3 3OTFA 4UF0B 5C3QA 2QQIA 2XJTA 2ZPXA 1JZ7A 1W6OB 4MGKE 3OBZA 4LO4B 2XONA 2VW2A 2WZR2 1I5PA 3THCA 2AUYA 3M70A 4P9JA 2QDRA 1ZRDA 4ASMB 2X29A 2VQUA 2ZABA 1OVPA 1AVBA 5SV5A 5I8SA 5M0TA 3VBRB 3SH3A 5JSPA 2WN3A 2XDVA 3HMYA 5CFDC 4N9IA 5A33A 3ZFFB 1VBE1 3ZSMA 1QJU1 3MUY1 4GH4A 4L9BA 2VQAA 1WW6A 4HN1A 4GKXA 4GMP3 3RVHA 1G9FA 4COZA 3HBKA 1AF9A 4LNVA 1BVVA 4QX0A 5BNNB 4INDA 5FP4A 2WSVA 4E4SA 2RHPA 3NNMA 2FDFA 4QPGB 3WR0A 1XBFA 2JJ6A 2YFZA 5JIAA 3IAPA 5EJ3A 4WBBA 4XXPA 1UU4A 4OFGA 2BGPA 5LY1A 4GALA 1Q8SA 4UFKA 3H8UA 1C8M2 5DUXA 3JB8A 4HN0A 3I49A 1J59A 3Q8FA 4A3XA 5IT6A 2WFF3 3EMRA 1HRI2 3RJ2X 3DYOA 3OEAA 3GNEA 3RWKX 4IEPA 4CP0A 3U75A 4Q0PA 1W90A 5ACA3 4XFBA 5DAPA 4JV4A 2I74A 4WM7C 4XBLA 4P9XA 5HCFA 1YQ5A 2BNNA 5F39A 1YC61 5AC91 2W68A 4C1WA 4LBKA 2O14A 3KMHA 4FP2A 4WV8A 4Y4YA 4YFWA 3O0XA 5DDJ1 3UGFA 4AG4A 5BNPA 4YW3A 2HWE3 4I02A 4GKYA 3FLRA 3WNLA 4XDOA 1GKBA 1GZWB 2VE1A 2VVDA 1AL0G 2WZR1 4LHLA 3WG1A 2NYYA 3DECA 2WQZC 1F2NA 1QMJA 1UOJA 1AL23 5K0UA 3AFGA 3DXUA 4P9LA 4NAMA 2JG9C 3H0OA 1H4GA 2C5DA 4D0QA 1FV3A 1C1FA 4KL1A 3T30A 3VL8A 2LUWA 4BXSV 4TXWA 4IE7A 1U5XA 3M3IA 3ZYPA 5JMOA 1BZWA 5EZWA 3IDBB 5GZDA 3K4AA 5FZFA 1AX1A 2CAUA 5A1LA 4CTEA 5J3UA 1BJQA 1X82A 3FC0A 5GZGA 3FJSA 3SNMA 1BQPA 1D7PM 3I3MA 4QQHA 2W91A 1W2UA 2D97A 5T3NA 4HG6B 3Q8CA 2J22A 3TN91 4Y5TA 3R0RA 4P5YA 2XHNA 1L7QA 4AVTA 2Y8KA 4DXTA 5JMCA 4RR3C 4XZUG 1QHDA 3WVJA 4N7IA 5CKNA 1QIQA 1WBFA 4Q8KA 5FLJA 1PGL1 1MVQA 4Y20B 5CISA 5A70A 3ZKUA 1S0BA 3AVRA 2YU2A 2GNTA 4P9IA 2AENA 2ADDA 1HRI1 3KV4A 1WCUA 2VQ0A 3OOXA 5FYVA 4ET7A 3BALA 2VPVA 3O1UA 3WW1A 4P14A 4PBPA 3VB9A 1VBD3 3L9JT 4CDXC 2C1FA 4NIIA 5FK7A 1LHWA 2AREA 3MW3A 1K5MB 4GAZA 4WZCA 1ZZ9A 1BLZA 1RC6A 3JD72 2YB7A 4Z8BA 2FCVA 1NA1B 4CCNA 1CJDA 1XNDA 2VOXA 2W94A 1Q43A 1L3JA 1DLLA 1EAH2 2RR12 2X53S 4J25A 4Z2WA 3SQOA 4EZ4A 1W06A 1I1EA 4AEDA 5A3NA 1AYM1 3WW3A 5FDBA 1SG3A 2WT2A 2BNOA 1HV1A 4IE4A 5ERLA 3UETA 5J7MA 1U5YA 3NJZA 3DPRA 3NVCA 4TWTA 1VBC1 2RS11 3VKMA 3WQ7A 3ZMNA 3GJAA 3AJZA 1ENSA 2ID4A 2J1SA 2ZGQA 5FUNA 3KLSA 4RS5C 3N3HA 1E57A 3MI8A 5DUVA 1QJEA 2B7YA 1VPHA 4D7TA 1GP5A 2OA2A 1C57A 3M3CA 3OCPA 4MH0E 3POBA 3VD7A 3ZSJA 4CEYA 3GZEA 4Y1UA 1LAJA 3ACGA 3HNMA 5C5UA 3AKTA 4RN5A 3FZ3A 2B8MA 5FKCA 1NKGA 1RUG2 4GWJA 4YGEA 1F15A 2WZ8A 1PK6B 4BA6A 1WW5A 1V6MA 4PI2A 4BQ3A 1UL9A 4GH4B 1CZTA 3ZXKA 3N9PA 1O59A 3W5MA 4V1PA 2YC4A 4XBNA 1PM7A 3PVOA 5IFTA 5A3OA 1G8WA 3J7NA 4HETA 4XF3A 2A3WA 2V5DA
chains in the Genus database with same CATH topology
1JZ8A 1OH4A 1CIYA 1W9WA 2QQOA 4QX2A 1L7RA 2XOMA 4DXSA 1EUUA 1WCQA 1EUTA 4UAPA 1JI6A 1H6YA 5C70A 3VDCA 1GU3A 2WUHA 2VC9A 3WQBA 3VD5A 5A1AA 4DEQA 1GMMA 3CDZB 4A45A 3HNYM 2JKXA 4QB1A 1UZ0A 1JZ6A 4CU6A 2VZQA 2J7MA 2E32A 2EICA 2E26A 4KWUA 4PT6A 2R7EB 2VZVA 3K4ZA 3CMGA 3GXUA 1HN1A 4LPLA 3T08A 3T2OA 2X05A 1JYNA 3D3AA 4M4RA 1GUIA 3C7EA 4MGQA 3OGVA 4M4PA 2RV9A 2J1EA 1W0NA 1JZ2A 2JDAA 4MGSA 2VZPA 3K77A 4XUTA 1R64A 2C9KA 2VZSA 3LPGA 2ZEWA 3T0BA 3DYMA 2VR4A 2EIBA 5G04L 4MO3M 2B4KA 1XNAA 3OEBA 3WNMA 4PQQA 3OGRA 4ZZ5A 3E1F1 4JKLA 3T0DA 4QAWA 1F4AA 1T2XA 3I97A 3OBAA 3IIIA 2VCCA 4FI9A 2Y6GA 3WNOA 1UXZA 4IUGA 1F4HA 2W1WA 1JU4A 4JKKA 5F7UA 4W4ZA 4GZ9A 4JHZA 2YC2A 2CDPA 1UYZA 5DN2A 1ULOA 3BN6A 3LE0A 3JXSA 4D8MA 3LEIA 1PMHX 2QQMA 3VDAA 3I2HA 1RYYA 2VCBA 3A23A 5DQ0A 4Z2AA 2BERA 2VO5A 1BHGA 4XUOA 2X09A 2RVAA 3HPNA 3UNPA 4KMQA 3WF0A 4UOJA 3FL7A 5EJ1B 1DYOA 3I2IA 2VJXA 2KD7A 3ABZA 5IJRA 3CZUA 2PQSA 3C7HA 4AAXA 2ZEZA 2RJ2A 2E31A 5J1XA 4OZOA 2VM9A 2HLEA 3UESA 3J7HA 4P02B 4KI5M 4ZY9A 4CU7A 1XNTA 1GNYA 2V4VA 3I2FA 3EYPA 1WKYA 5CYYA 1GOGA 3HNBM 1JZ5A 3GGLA 3CKHA 2WO1A 1MPXA 4QDQA 5LA1A 4XUNA 1K42A 2VL4A 3IB3A 2J1RA 4A44A 2WDBA 2Y64A 3I2GA 3OB8A 1O8PA 1PX4A 1UY3A 1UY2A 5JXIA 3CIHA 3IDAA 4QB2A 2CDOA 2BZDA 2WZEA 3VD3A 3MUZ1 5CZKA 1ULPA 3I3DA 1XPWA 3MV11 3PUIA 4JX0A 3WF3A 2Z4FA 4QDSA 5C71A 2B9VA 4DUXA 2W95A 3OGSA 5JXGA 1K12A 2YFUA 1UX7A 3GDBA 4W8JA 5B4NA 3NJXA 2VZ3A 4DUWA 1DLCA 3SEPA 2VCAA 1UY0A 2W87A 2WN2A 5LA2A 5HPOA 2ORZA 4P00B 3VDBA 4LHSA 3W5NA 2VZOA 2WBKA 1UYXA 2WAAA 3LQCA 3VD4A 4BK4A 3NQHA 4ARXA 2W9XA 2ZXQA 4A41A 3T2QA 2VMEA 2J1UA 3FHQA 5EIYB 2Y6JA 2Y6LA 1JYVA 3U37A 2WABA 5G05L 3WF1A 1OF3A 2J1TA 1UMIA 2WO3A 5IYYA 4OYUA 1GOFA 4GWIA 3ECQA 2VZTA 4L0PA 2OKXA 2J1AA 4ARYA 2VZ1A 5JR2A 4QPWA 4XVHA 4XURA 1W9TA 2VMCA 4BJ0A 3FHAA 3ETPA 1UWWA 2VQTA 3NJVA 3CZJA 4DEVA 5JUVA 4LKSA 2JE8A 1TVGA 1US3A 2W47A 1SHWB 3IAQA 3A21A 1NX9A 3T0AA 4CUBA 4CUCA 3NRUA 1YQ2A 1W99A 2VTFA 3P1IA 3T2PA 2QQLA 1W9SA 2VMFA 3WSOA 1JYWA 4BK5A 2Y6HA 3WNPA 5LA0A 3LPFA 1H6XA 2C4XA 1DP0A 3HJRA 5IHRA 4OUEA 4TTGA 2XQXA 1TG7A 3A22A 5DPNA 1JYXA 5C7GA 3EB7A 2WO2A 3ACHA 1PMJX 4QX3A 2QQJA 3P6BA 3SKJE 4A42A 3CQOA 1PX3A 4DXRA 1UMHA 4RYDA 1KEXA 3C8XA 5EJZB 3DYPA 2BGOA 3A7QA 4LQRA 2VZUA 3ACFA 4OMDA 3T09A 3C7FA 3GM8A 2QQIA 1JZ7A 4E8CA 4CU8A 3PUHA 2VZRA 2XONA 1GQPA 3THCA 1I5PA 2ORXA 3I2KA 5I0DA 2VQUA 1OF4A 1XC6A 2WN3A 5B4XA 4XUPA 4PF1A 1O8SA 5FUIA 1CX1A 3K46A 3MUY1 4MOAA 3MBWA 2DCKA 4QX0A 2YFZA 3IAPA 1UY4A 3SKVA 2BGPA 1K45A 1OD3A 2QBXA 2Y6KA 3ACIA 4CVUA 3LEKA 4A6OA 5HXMA 3THDA 4QB6A 4W50A 1JU3A 4YPJA 3OEAA 4ZXEA 4E8DA 1K3IA 2DCJA 3HOBA 2J1VA 3I2JA 2YG0A 5JXJA 1NUKA 1IQDC 2W1QA 3I3BA 4AG4A 1US2A 1KGYA 2EIEA 3WNLA 4A3ZA 3WNNA 2X10A 2DDUA 3DECA 3LEGA 3MO4A 3K4DA 2VOTA 4UI9L 4D0QA 4OMCA 1JZ4A 2WAOA 1J83A 4QX1A 1CZSA 2LS6A 4BXSV 4TXWA 2L9LA 5JMOA 3ZM8A 2W1SA 3K4AA 2BBAA 3VD9A 3C7OA 4DUVA 1D7PM 2JD9A 1OT5A 2EIDA 4MADA 2W91A 2C26A 4HG6B 2J22A 2W92A 4P5YA 1LNSA 2XHNA 1L7QA 4DXTA 2Y8KA 5JXHA 3K75B 4XZUG 3I3EA 3WEZA 5IFPA 5LCWL 1GOHA 2QQNA 1JHJA 2W1UA 4ET7A 3FN9A 2E33A 2W3JA 2QQKA 2ZEXA 3HEIA 1W8OA 2LW8A 3F2ZA 3WF2A 4A4AA 2YB7A 2VMDA 1UY1A 2W94A 4XUQA 4P08A 2WYSA 3C7GA 1NAEA 4CU9A 4CUAA 1SG3A 3UETA 3BGAA 1JZ3A 2W46A 2WQ8A 3WNKA 2ID4A 2J1SA 1W8NA 3WF4A 2V72A 3OG2A 3SEEA 1UYYA 5DMYA 3MV01 3VD7A 4JKMA 3ACGA 3HNMA 1CZVA 4RN5A 2W5FA 1NKGA 4GWJA 2WZ8A 2ZEYA 3NNGA 4QDRA 3HN3A 3AC0A 1CZTA 1SDDB 1UXXX 1O59A 3W5MA 2YC4A 1P8JA 5IFTA 1J84A 4ZZ8A 4BDVB 2HYXA 3DYOA 2V5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZ8 A;  1OH4 A;  1CIY A;  1W9W A;  2QQO A;  4QX2 A;  1L7R A;  2XOM A;  4DXS A;  1EUU A;  1WCQ A;  1EUT A;  4UAP A;  1JI6 A;  1H6Y A;  5C70 A;  3VDC A;  1GU3 A;  2WUH A;  2VC9 A;  3WQB A;  3VD5 A;  5A1A A;  4DEQ A;  1GMM A;  3CDZ B;  4A45 A;  3HNY M;  2JKX A;  4QB1 A;  1UZ0 A;  1JZ6 A;  4CU6 A;  2VZQ A;  2J7M A;  2E32 A;  2EIC A;  2E26 A;  4KWU A;  4PT6 A;  2R7E B;  2VZV A;  3K4Z A;  3CMG A;  3GXU A;  1HN1 A;  4LPL A;  3T08 A;  3T2O A;  2X05 A;  1JYN A;  3D3A A;  4M4R A;  1GUI A;  3C7E A;  4MGQ A;  3OGV A;  4M4P A;  2RV9 A;  2J1E A;  1W0N A;  1JZ2 A;  2JDA A;  4MGS A;  2VZP A;  3K77 A;  4XUT A;  1R64 A;  2C9K A;  2VZS A;  3LPG A;  2ZEW A;  3T0B A;  3DYM A;  2VR4 A;  2EIB A;  5G04 L;  4MO3 M;  2B4K A;  1XNA A;  3OEB A;  3WNM A;  4PQQ A;  3OGR A;  4ZZ5 A;  3E1F 1;  4JKL A;  3T0D A;  4QAW A;  1F4A A;  1T2X A;  3I97 A;  3OBA A;  3III A;  2VCC A;  4FI9 A;  2Y6G A;  3WNO A;  1UXZ A;  4IUG A;  1F4H A;  2W1W A;  1JU4 A;  4JKK A;  5F7U A;  4W4Z A;  4GZ9 A;  4JHZ A;  2YC2 A;  2CDP A;  1UYZ A;  5DN2 A;  1ULO A;  3BN6 A;  3LE0 A;  3JXS A;  4D8M A;  3LEI A;  1PMH X;  2QQM A;  3VDA A;  3I2H A;  1RYY A;  2VCB A;  3A23 A;  5DQ0 A;  4Z2A A;  2BER A;  2VO5 A;  1BHG A;  4XUO A;  2X09 A;  2RVA A;  3HPN A;  3UNP A;  4KMQ A;  3WF0 A;  4UOJ A;  3FL7 A;  5EJ1 B;  1DYO A;  3I2I A;  2VJX A;  2KD7 A;  3ABZ A;  5IJR A;  3CZU A;  2PQS A;  3C7H A;  4AAX A;  2ZEZ A;  2RJ2 A;  2E31 A;  5J1X A;  4OZO A;  2VM9 A;  2HLE A;  3UES A;  3J7H A;  4P02 B;  4KI5 M;  4ZY9 A;  4CU7 A;  1XNT A;  1GNY A;  2V4V A;  3I2F A;  3EYP A;  1WKY A;  5CYY A;  1GOG A;  3HNB M;  1JZ5 A;  3GGL A;  3CKH A;  2WO1 A;  1MPX A;  4QDQ A;  5LA1 A;  4XUN A;  1K42 A;  2VL4 A;  3IB3 A;  2J1R A;  4A44 A;  2WDB A;  2Y64 A;  3I2G A;  3OB8 A;  1O8P A;  1PX4 A;  1UY3 A;  1UY2 A;  5JXI A;  3CIH A;  3IDA A;  4QB2 A;  2CDO A;  2BZD A;  2WZE A;  3VD3 A;  3MUZ 1;  5CZK A;  1ULP A;  3I3D A;  1XPW A;  3MV1 1;  3PUI A;  4JX0 A;  3WF3 A;  2Z4F A;  4QDS A;  5C71 A;  2B9V A;  4DUX A;  2W95 A;  3OGS A;  5JXG A;  1K12 A;  2YFU A;  1UX7 A;  3GDB A;  4W8J A;  5B4N A;  3NJX A;  2VZ3 A;  4DUW A;  1DLC A;  3SEP A;  2VCA A;  1UY0 A;  2W87 A;  2WN2 A;  5LA2 A;  5HPO A;  2ORZ A;  4P00 B;  3VDB A;  4LHS A;  3W5N A;  2VZO A;  2WBK A;  1UYX A;  2WAA A;  3LQC A;  3VD4 A;  4BK4 A;  3NQH A;  4ARX A;  2W9X A;  2ZXQ A;  4A41 A;  3T2Q A;  2VME A;  2J1U A;  3FHQ A;  5EIY B;  2Y6J A;  2Y6L A;  1JYV A;  3U37 A;  2WAB A;  5G05 L;  3WF1 A;  1OF3 A;  2J1T A;  1UMI A;  2WO3 A;  5IYY A;  4OYU A;  1GOF A;  4GWI A;  3ECQ A;  2VZT A;  4L0P A;  2OKX A;  2J1A A;  4ARY A;  2VZ1 A;  5JR2 A;  4QPW A;  4XVH A;  4XUR A;  1W9T A;  2VMC A;  4BJ0 A;  3FHA A;  3ETP A;  1UWW A;  2VQT A;  3NJV A;  3CZJ A;  4DEV A;  5JUV A;  4LKS A;  2JE8 A;  1TVG A;  1US3 A;  2W47 A;  1SHW B;  3IAQ A;  3A21 A;  1NX9 A;  3T0A A;  4CUB A;  4CUC A;  3NRU A;  1YQ2 A;  1W99 A;  2VTF A;  3P1I A;  3T2P A;  2QQL A;  1W9S A;  2VMF A;  3WSO A;  1JYW A;  4BK5 A;  2Y6H A;  3WNP A;  5LA0 A;  3LPF A;  1H6X A;  2C4X A;  1DP0 A;  3HJR A;  5IHR A;  4OUE A;  4TTG A;  2XQX A;  1TG7 A;  3A22 A;  5DPN A;  1JYX A;  5C7G A;  3EB7 A;  2WO2 A;  3ACH A;  1PMJ X;  4QX3 A;  2QQJ A;  3P6B A;  3SKJ E;  4A42 A;  3CQO A;  1PX3 A;  4DXR A;  1UMH A;  4RYD A;  1KEX A;  3C8X A;  5EJZ B;  3DYP A;  2BGO A;  3A7Q A;  4LQR A;  2VZU A;  3ACF A;  4OMD A;  3T09 A;  3C7F A;  3GM8 A;  2QQI A;  1JZ7 A;  4E8C A;  4CU8 A;  3PUH A;  2VZR A;  2XON A;  1GQP A;  3THC A;  1I5P A;  2ORX A;  3I2K A;  5I0D A;  2VQU A;  1OF4 A;  1XC6 A;  2WN3 A;  5B4X A;  4XUP A;  4PF1 A;  1O8S A;  5FUI A;  1CX1 A;  3K46 A;  3MUY 1;  4MOA A;  3MBW A;  2DCK A;  4QX0 A;  2YFZ A;  3IAP A;  1UY4 A;  3SKV A;  2BGP A;  1K45 A;  1OD3 A;  2QBX A;  2Y6K A;  3ACI A;  4CVU A;  3LEK A;  4A6O A;  5HXM A;  3THD A;  4QB6 A;  4W50 A;  1JU3 A;  4YPJ A;  3OEA A;  4ZXE A;  4E8D A;  1K3I A;  2DCJ A;  3HOB A;  2J1V A;  3I2J A;  2YG0 A;  5JXJ A;  1NUK A;  1IQD C;  2W1Q A;  3I3B A;  4AG4 A;  1US2 A;  1KGY A;  2EIE A;  3WNL A;  4A3Z A;  3WNN A;  2X10 A;  2DDU A;  3DEC A;  3LEG A;  3MO4 A;  3K4D A;  2VOT A;  4UI9 L;  4D0Q A;  4OMC A;  1JZ4 A;  2WAO A;  1J83 A;  4QX1 A;  1CZS A;  2LS6 A;  4BXS V;  4TXW A;  2L9L A;  5JMO A;  3ZM8 A;  2W1S A;  3K4A A;  2BBA A;  3VD9 A;  3C7O A;  4DUV A;  1D7P M;  2JD9 A;  1OT5 A;  2EID A;  4MAD A;  2W91 A;  2C26 A;  4HG6 B;  2J22 A;  2W92 A;  4P5Y A;  1LNS A;  2XHN A;  1L7Q A;  4DXT A;  2Y8K A;  5JXH A;  3K75 B;  4XZU G;  3I3E A;  3WEZ A;  5IFP A;  5LCW L;  1GOH A;  2QQN A;  1JHJ A;  2W1U A;  4ET7 A;  3FN9 A;  2E33 A;  2W3J A;  2QQK A;  2ZEX A;  3HEI A;  1W8O A;  2LW8 A;  3F2Z A;  3WF2 A;  4A4A A;  2YB7 A;  2VMD A;  1UY1 A;  2W94 A;  4XUQ A;  4P08 A;  2WYS A;  3C7G A;  1NAE A;  4CU9 A;  4CUA A;  1SG3 A;  3UET A;  3BGA A;  1JZ3 A;  2W46 A;  2WQ8 A;  3WNK A;  2ID4 A;  2J1S A;  1W8N A;  3WF4 A;  2V72 A;  3OG2 A;  3SEE A;  1UYY A;  5DMY A;  3MV0 1;  3VD7 A;  4JKM A;  3ACG A;  3HNM A;  1CZV A;  4RN5 A;  2W5F A;  1NKG A;  4GWJ A;  2WZ8 A;  2ZEY A;  3NNG A;  4QDR A;  3HN3 A;  3AC0 A;  1CZT A;  1SDD B;  1UXX X;  1O59 A;  3W5M A;  2YC4 A;  1P8J A;  5IFT A;  1J84 A;  4ZZ8 A;  4BDV B;  2HYX A;  3DYO A;  2V5D A; 
#chains in the Genus database with same CATH topology
 1JZ8 A;  1YI9 A;  4G3Y C;  1OH4 A;  1W9W A;  4QX2 A;  4Q4Y 3;  4Z07 A;  5C3P A;  3ELN A;  3EHK A;  1DF0 A;  1I3H A;  3HWJ A;  2XOM A;  2Q1M A;  3AXE A;  3WP5 A;  1EUU A;  1MZ5 A;  5I8Y A;  1OOP B;  1ZZB A;  1VMH A;  2VTX J;  3MLJ A;  4CP9 A;  4BQ2 A;  4C0H A;  1YQC A;  1NQD A;  4CCC A;  5C70 A;  5FCC A;  3R4U A;  4HON A;  1XU1 A;  1H1M A;  3JD7 1;  3TEX A;  3U1X A;  2WWU A;  5LRR A;  4QXK A;  2W39 A;  2D5H A;  3OPT A;  4HLT A;  4NHM A;  4OUS A;  5HCB A;  1IQA A;  4QB1 A;  3O1O A;  1J3Q A;  4IEV A;  1CAW B;  3RZL A;  3S30 A;  3MID A;  1IZ3 A;  1WMD A;  3OF1 A;  4UBH A;  2E26 A;  1HX6 A;  5KC6 A;  3K4Z A;  3RZG A;  3MEP A;  1UO9 A;  1AR8 3;  1YO8 A;  5ABJ C;  3T08 A;  3PVB B;  4FPY A;  3ZIW A;  4QM9 A;  1RUN A;  4TN7 A;  1FNZ A;  2IXC A;  3CLP A;  4YM0 A;  1GUI A;  2X5I A;  3RJR A;  3C7E A;  1H30 A;  3AYA A;  4KBB A;  3J8F 3;  4LHN A;  4MGQ A;  4EWD A;  3PTR B;  3JBG 3;  3U0Z A;  3KV6 A;  3D0S A;  3P3P A;  4M4P A;  1HB4 A;  2FCT A;  1OUX A;  4FVV A;  1XXN A;  2RV9 A;  2WZP P;  4BIO A;  4NIH A;  1UOF A;  2E9Q A;  4IE6 A;  3MIH A;  4GMP 1;  5JOW A;  1JZ2 A;  4ERO A;  3AZV A;  1ZRE A;  2D7F A;  4KGG A;  4LKF A;  4O65 A;  5A3W A;  1RUG 1;  3QH7 A;  2OX0 A;  4NPM A;  1R64 A;  4LO7 A;  1PGW 2;  3J7M A;  5FPB A;  4XMA A;  1OUS A;  2AEZ A;  2VZS A;  1OLQ A;  3WCS A;  1RUD 2;  2EIB A;  3KT4 A;  4OUM A;  3U4X A;  4BLI A;  5JZG C;  1TME 2;  2BFU S;  2QUO A;  4GB3 3;  4LIU A;  2FDG A;  1O4T A;  1OXC A;  2XG3 A;  3OGR A;  3E1F 1;  1LOF C;  2VNR A;  1QJX 2;  2PHT A;  1PIV 2;  2XBO 2;  3HT1 A;  2E6V A;  2DVA A;  4BOW A;  3T0D A;  5FZC A;  1ZRF A;  4V2V A;  5A1F A;  1F4A A;  3H8O A;  4D6S A;  4MX3 A;  4L99 A;  1UW8 A;  4K8R B;  4QGM A;  3THP A;  5CVR A;  4RQP A;  3ENR A;  1WLT A;  3T1L A;  1UXZ A;  2IXL A;  3MHZ A;  3VDD A;  3NNJ A;  1NY7 1;  3I8T A;  3PUQ A;  4LLF A;  1V6I A;  1PO1 2;  4XAA A;  1ZBE 3;  4W6X A;  1JU4 A;  1AXZ A;  3ZXJ A;  2F4P A;  5LEK A;  2HWE 1;  5F7U A;  4W4Z A;  1H8T A;  3D82 A;  2NMO A;  2CDP A;  1UYZ A;  3LDB A;  2DVB A;  4GIQ A;  1KRI A;  5FXZ A;  2VXR A;  1HJF A;  2WS9 3;  3LEI A;  4LBL A;  1PMH X;  1ZRR A;  1U5I A;  2Q30 A;  2XJR A;  1H9W A;  3B7M A;  1EP0 A;  5H9Q A;  2UY8 A;  2Q8E A;  1BVP 1;  5DQ0 A;  2BER A;  1YI7 A;  4XCB A;  1SLL A;  3WIN E;  3H9A A;  1RVF 2;  4XUO A;  2DVD A;  1W39 A;  3UK9 A;  2RVA A;  3HPN A;  4Q4X 3;  5C8C A;  1DYO A;  3OPZ A;  3I2I A;  4AED B;  2BNM A;  2ZHN A;  2RDS A;  3ABZ A;  2R30 A;  2BGC A;  4WVV A;  3CZU A;  3M3E A;  3RG0 A;  4CDQ B;  3DPR B;  1NCR A;  1GZT A;  4L92 A;  3C7H A;  3D4K A;  2ARX A;  1AX0 A;  2RM2 2;  5DXD A;  2Y33 A;  4COY A;  4DIN B;  5A6Q A;  3IDC B;  2D44 A;  2B9U A;  1QEX A;  2A6X A;  4IE0 A;  1RUD 1;  1NLS A;  4CEY B;  1LGC A;  3NST A;  4CU7 A;  1TME 1;  4Q0S A;  3NAP C;  1U0A A;  4SBV A;  1OA3 A;  1OA4 A;  2ARB A;  2WNE A;  2XJS A;  1QJX 1;  2XBO 1;  1PIV 1;  2Z79 A;  1WKY A;  2OUH A;  4CP2 A;  3U4S A;  1DGR N;  5CYY A;  5L73 A;  1VBD 1;  3H42 B;  3RPQ A;  3OUI A;  2P6C A;  2CGP A;  4CCL A;  3VBS C;  5IAX A;  3IM0 A;  3A4U A;  3VGI A;  1MPX A;  1C4R A;  3LGR A;  4QDQ A;  3KCX A;  4KWJ A;  1SCS A;  4AI8 A;  1O5U A;  4XUN A;  1K42 A;  1KD7 A;  1PO1 1;  3ZXD A;  3I59 A;  4HKO A;  4A44 A;  4NHX A;  4HPK A;  4OI1 A;  2SBA A;  4IV1 B;  1OLR A;  1AYN 2;  5IVJ A;  1PX4 A;  4PHZ A;  2RJL A;  1ULG A;  2WT1 A;  4YNI A;  1D2S A;  3ZLI A;  3IDA A;  1J1L A;  4QB2 A;  1XSQ A;  5IWF A;  1PM4 A;  1B35 C;  2K2S A;  1YEW A;  5C3O A;  1RJ8 A;  5T55 A;  3MUZ 1;  4B4P A;  2P2K A;  3ZIX A;  1RVF 1;  2JKB A;  2QE3 A;  4QXC A;  4BQ4 A;  4DIQ A;  3DKW A;  2A3X A;  2OUJ A;  5DG1 A;  4EE2 A;  2WNV B;  1AR7 2;  1RUC 3;  3AK0 A;  3V56 A;  1N1S A;  1W8W A;  3BOP A;  4LE4 A;  1JUH A;  4CYD A;  4DUX A;  1DHK B;  3NO8 A;  5FBZ A;  4CP1 A;  3RZJ A;  1UX7 A;  4C90 A;  2RM2 1;  4NOT A;  2O8O A;  5J96 B;  3Q8E A;  1HQN A;  4P9Y A;  1DGL A;  1F9K A;  2JG8 B;  1G9B A;  2JDM A;  1VAV A;  1DLC A;  1YQ8 A;  4OHZ A;  3HQX A;  1S2B A;  1UY0 A;  2ZX2 A;  4HFS A;  1ENR A;  3ZN5 A;  2VBD A;  5A6Y A;  2A3Y A;  5HXV A;  4N8M A;  3W9A A;  1BMV 2;  1VAK A;  4AHW A;  5F3G A;  2Q1Z B;  2PHW A;  3G7D A;  3NJY A;  1AR9 3;  1CAV A;  2V5Y A;  3OGJ A;  4XFI A;  5FRE A;  3WDY A;  5JAX A;  1WW7 A;  2VZO A;  1IS6 A;  2VH9 A;  3FHI B;  3IMN A;  1ALY A;  4IW3 A;  3IPV B;  4D3W A;  3IDE A;  3NQH A;  2XVL A;  5FZ6 A;  4WVW A;  1O3Q A;  4LOS A;  2PHD A;  3AZW A;  2GH8 A;  4XTP A;  4ARX A;  3HR9 A;  2O8Q A;  2MHF A;  2VME A;  3FHQ A;  2VD7 A;  3H7Y A;  4WZF A;  1JYV A;  2WAB A;  3EO6 A;  2BPA 2;  3D5O A;  1WCD J;  1OUR A;  1KFX L;  1FMD 3;  4XE9 A;  5G05 L;  3WF1 A;  4NRO A;  4YVW A;  2D6L X;  1J3P A;  1YRZ A;  2RDQ A;  1LHU A;  1WD3 A;  2VNO A;  4BH9 A;  5IVE A;  4JC1 A;  4UW6 A;  4OYU A;  1GOF A;  3N35 A;  4GWI A;  5BNO C;  1H9P A;  3ECQ A;  4QQ2 A;  4L0P A;  1ACC A;  4MXW A;  1V9U 2;  4XVH A;  3ES1 A;  4CXW A;  5CKQ A;  5FMD A;  2JEN A;  1W9T A;  2PTM A;  1Y43 B;  4JDN A;  3JBG 1;  5JIU A;  5CG9 A;  4UFH A;  4CDW B;  2YPD A;  2VQT A;  4AHX A;  3GHN A;  2QVS B;  3H50 A;  4P9W A;  1C5I A;  5A3M A;  1LOG A;  1LKN A;  5I91 A;  3TRS B;  3UKN A;  5C4W B;  5FPX A;  1JYI A;  2W47 A;  1SHW B;  1E5I A;  4MYE A;  1MVE A;  4UW5 A;  1UQX A;  4YG6 A;  1W6P A;  1NX9 A;  2D40 A;  2P17 A;  5F3I A;  3T0A A;  4CUC A;  5LW9 A;  4RL7 A;  2XKO A;  1W99 A;  3KZ4 C;  4DB5 A;  1M4W A;  5FYC A;  3HQU A;  4H55 A;  1DGW X;  4AGV A;  2VMF A;  2XVK A;  3O12 A;  3G6J B;  2DTW A;  4LMF A;  4ZS3 A;  3SCF A;  3V64 A;  3VBF C;  4AVS A;  4BK5 A;  5LWB A;  1BMV 1;  2JDY A;  3ACL A;  4Q29 A;  1C1L A;  5E6H A;  1AUY A;  2C4X A;  4OLL A;  4AVA A;  4XFG A;  1DU3 D;  4Q27 A;  3CBN A;  1OBN A;  3HJR A;  4XF1 A;  2DCZ A;  1G9A A;  2D6M A;  4HSJ A;  4NUB A;  4RA0 A;  1TG7 A;  2KR2 A;  5FJH A;  1QWR A;  4MHU A;  5LB6 A;  3QD6 A;  4C8D A;  3E6C C;  1WD4 A;  3J4U H;  4JGZ B;  5C7G A;  1A8D A;  5KXB A;  1GNH A;  3U07 A;  2G19 A;  1IS3 A;  3ZYH A;  1W3V A;  4OI0 A;  3BU0 A;  1KS4 A;  3P6B A;  3D8C A;  5E1R A;  5FLI A;  3I59 B;  4MSV A;  1NCQ A;  3CQO A;  4HPK B;  1SLB A;  1WLW A;  5I93 A;  3FMG A;  5FZ8 A;  4ES9 A;  1UMH A;  3KHB A;  3NV4 A;  4Q4X 1;  2ZBJ A;  3C8X A;  3H3Z A;  5EJZ B;  4CEW A;  1LOD A;  4P9G A;  1RUF 3;  3U78 A;  1RHI 2;  1Y3T A;  3ZFE A;  3A7Q A;  5JSR A;  1PMI A;  1W6M B;  1W8Z A;  4QPI B;  2NPI A;  1F5F A;  4AR2 A;  1H0B A;  2ARA A;  2XKP A;  3AZZ A;  4E8C A;  2EVX A;  5JWP A;  1XE8 A;  1GQP A;  4N53 B;  4M3C A;  2ZA9 A;  3I2K A;  4AHY A;  5I0D A;  1W6O A;  4Q0V A;  4D7S A;  4PDW C;  5GAL A;  1SEF A;  3S7E A;  4FBF A;  2IVJ A;  2YPJ A;  4PF1 A;  1SLC A;  1O8S A;  4UFJ A;  2EAL A;  5FZL A;  1VBA 3;  1YQ6 A;  1V0A A;  5F9T A;  3VBR A;  2XJU A;  3H3L A;  3N9N A;  4YZ3 A;  3I2O A;  2ZGS A;  4JHT A;  2VOK A;  1YCI A;  2DCK A;  4Q26 A;  4MGZ E;  5HV4 A;  2DF7 A;  5GM0 A;  2CL2 A;  3HBZ A;  4QQO A;  1MS4 A;  5FZ9 A;  4EN9 B;  2HKX A;  4JGY A;  5BNN A;  5CFC B;  2QNK A;  5IK4 A;  4QPG A;  1OD3 A;  4V2W A;  2R0H A;  1ZBA 3;  3JU9 A;  3UV9 A;  3P3N A;  1D4M 3;  1MAC A;  1XJA A;  4HL0 A;  2YHJ A;  3ACI A;  4BLJ A;  2HWB 3;  4A6O A;  2WNU B;  3THD A;  5FYT A;  1RUI 2;  4QB6 A;  2BBV A;  1N1V A;  4XIK A;  4ZXE A;  2BOJ A;  4M3C E;  2YZ4 A;  3ASI A;  1K3I A;  2BWC A;  2FCU A;  3LSE A;  5FYB A;  4W65 A;  5KC5 A;  5F2S A;  2DUQ A;  4D94 A;  1OSG A;  5FYU A;  2YG0 A;  3VL9 A;  3VZL A;  2G9Z A;  3T4V A;  1RUC 1;  3EBR A;  1W6N B;  5L7O C;  4AVB A;  1NUK A;  1IQD C;  4QU2 A;  4Y4R A;  1UCX A;  3I3B A;  2VU9 A;  1NZC A;  1MS5 A;  1JBC A;  1HW5 A;  1KIT A;  3KM5 A;  3AP7 A;  2ERF A;  2ZCW A;  3MDP A;  3KB5 A;  1XB9 A;  1KDK A;  1C5H A;  2DDU A;  3LEG A;  2GC2 A;  2DCY A;  1W2N A;  3K3O A;  2B42 B;  3MO4 A;  2ZML A;  1YFU A;  2W52 A;  1GZW A;  4RFT 0;  4UI9 L;  5FOJ B;  4ZU4 A;  1PVC 2;  3GF6 A;  4QX1 A;  5KHI A;  1CZS A;  2LS6 A;  2ZGM A;  5CNA A;  1EYB A;  1RTV A;  3AYD A;  3I3Q A;  4Q0U A;  4F7Z A;  3MLL A;  1N3Q A;  4AWD A;  1IKP A;  4QHZ A;  3SXW A;  1FV2 A;  4I3P A;  2OZ6 A;  3VKF C;  1FPN 2;  1HV0 A;  2BBA A;  4HSL A;  5CFD A;  3UL2 A;  1LEM A;  3H1W A;  1ULD A;  1CPM A;  1R08 3;  2DFC A;  1OT5 A;  4GJZ A;  2RDR A;  2OYZ A;  1LES A;  3ZSK A;  2C26 A;  2P3K A;  4O9E A;  2UYA A;  2G4I A;  1LNS A;  5JI9 A;  1WLC A;  1YJK A;  1CX4 A;  1FMD 1;  3B5L B;  3IN9 A;  1FYU A;  3WEZ A;  4FPH A;  5LBB A;  4E2S A;  2PAE A;  5D2A A;  4NHL A;  1JHJ A;  1PNG A;  4XBQ A;  1PO2 2;  1QJU 2;  1H1I A;  1RUI 1;  4UFL A;  1LU1 A;  3O1S A;  2OVU A;  1WMF A;  2MEV 2;  3SC7 X;  3WDW A;  2GNB A;  5FPV A;  2W3J A;  2QQK A;  5FO7 B;  2XQR A;  2ZEX A;  4YW7 A;  3NMB A;  3W58 A;  4YGB A;  1RUJ 2;  4AQ6 A;  5GJ6 A;  2CTV A;  4L2N A;  3RGB A;  3CJI C;  3SLI A;  4SLI A;  2VUA A;  5LZ6 A;  1UZW A;  2R07 2;  2VMD A;  2VUD A;  4XFF A;  5F6L B;  2TBV A;  3VBU C;  1N3P A;  3OJB A;  3TOJ A;  1K5M A;  2E53 A;  4XUQ A;  4Y5S A;  4P08 A;  2DUP A;  1S2K A;  4XIL A;  1NA1 A;  3HN1 A;  3VN4 A;  3C7G A;  3ZFE B;  1O7F A;  3WG2 A;  1PVX A;  2QZ2 A;  1KJR A;  1PVC 1;  2YMZ A;  4QXH A;  2WQ4 A;  4AFB A;  1UZY A;  1NYW A;  2A7A A;  1BYH A;  1MS1 A;  2J42 A;  5LBC A;  4DNY A;  4YVS B;  1IHM A;  4PLN A;  1BK1 A;  1OPO A;  5DDJ 2;  1H2K A;  1VBA 2;  2JDZ A;  4M3C B;  5GZF A;  1FPN 1;  3TYJ A;  4COU A;  1CIW A;  4JKM A;  1N1T A;  2XXZ A;  2HWD 3;  4TZD A;  5FQ0 A;  4OHX A;  4Y1X A;  2W5F A;  4Q4V 3;  5A7Q A;  4AQT A;  3MIC A;  2G9G A;  3E97 A;  4XPV A;  3NL1 A;  4QDR A;  3HN3 A;  1G9D A;  4ITC A;  1CAU A;  3AC0 A;  3GZT B;  5FMC A;  5GLT A;  2ZGU A;  3HQR A;  2E7T A;  4QKD A;  3ZFG C;  4ZZ8 A;  1B09 A;  1JH5 A;  1PK6 A;  4GQ7 A;  4YGD A;  1VP6 A;  5FWJ A;  4I2O A;  1PO2 1;  1S55 A;  1CIY A;  1W0O A;  2MEV 1;  2QQO A;  2BEO A;  2IVI B;  1GZC A;  4JQT A;  4PIY A;  4RR3 A;  4EN0 A;  1CAX B;  1ZA4 A;  2Q0A A;  1RMU 3;  4DXS A;  1X36 A;  4JGY B;  3DV8 A;  1FX5 A;  1Y4W A;  3ZR6 A;  4CCK A;  5FY5 A;  1JI6 A;  1MQT C;  1RUJ 1;  1GU3 A;  2VOV A;  3INA A;  1S0D A;  1A78 A;  1R09 3;  2P6H A;  4AEJ A;  4B4R A;  3USU A;  4BU2 A;  2B46 X;  3AP6 A;  3TN9 2;  3W59 A;  3RZM A;  4LK7 A;  5A1A A;  1OOP A;  1RUF 1;  4DEQ A;  4E4H A;  5KHJ A;  2R07 1;  4A45 A;  4CPB D;  2QJV A;  4IEQ A;  4CDX A;  2Z2S B;  3LD8 A;  3POE A;  1UZ0 A;  3M3O A;  2FDH A;  5T54 A;  4HVR A;  5GZC A;  2ET1 A;  2OZJ A;  1JZ6 A;  1PGL 2;  2QDN A;  3IKW A;  2PEL A;  4KWU A;  1G86 A;  2R7E B;  2A6Y A;  1TMF 3;  2ZTN A;  3U11 A;  3RZK A;  4QWN A;  4ZU7 A;  5CA6 A;  1CAW A;  1W2A X;  2VNG A;  4M00 A;  1GR3 A;  3A0K A;  1WCK A;  4XXA A;  2P3Y A;  1KXG A;  3HT2 A;  5I0T A;  1EV1 2;  4YM2 A;  1RUH 3;  5F32 A;  4EQV A;  1R1A 2;  3DUI A;  3B93 A;  4NHK A;  1VBA 1;  4BYY A;  2Y34 A;  3LFM A;  1XOY A;  1Z78 A;  2WNO A;  4QM8 A;  1W0N A;  1HXS 3;  3CL1 A;  4RS5 A;  5FZD A;  4YZ1 A;  3VBH C;  1IG3 A;  1Z7S 3;  4R4X A;  4RSU A;  4XJ9 A;  2F6B A;  4QHO A;  1AYM 2;  5A3T A;  3RYP A;  4S2H A;  3V0B A;  1Q8V A;  2YBS A;  4ZHN A;  2I07 B;  1AR6 3;  1VBC 2;  2RS1 2;  4I0A A;  4LO5 B;  4BIS A;  4OQ8 A;  5CFD B;  1XYP A;  3POW A;  1ZBA 1;  3B9C A;  5DZF A;  1D4M 1;  4HT1 T;  3OEB A;  2YRO A;  1JN2 P;  3WNM A;  1VBB 3;  4FFF A;  2Y26 A;  2BU9 A;  3OGG A;  4NJ4 A;  1V6J A;  4WVM A;  3EJK A;  4LBO A;  4YWA A;  5FZE A;  4QPY A;  3QBQ A;  3ZO0 B;  1QH6 A;  4FI9 A;  1C28 A;  1ULC A;  4IUG A;  3FBY A;  1I6X A;  1F4H A;  1SFN A;  1E5R A;  2EA7 A;  1ULO A;  2KXL A;  1U5Z A;  1UPS A;  3BN6 A;  3UKT A;  2C24 A;  2WWS A;  3CO2 A;  3JXS A;  2E51 A;  4D8M A;  2FMD A;  5T5J A;  5KHH A;  1WUV A;  2PHR A;  1X33 A;  3MPP G;  4Z2A A;  1EV1 1;  3K3N A;  4NWW A;  4WM7 B;  4AAP A;  5IK8 A;  1QOO A;  1R1A 1;  3E5X A;  4UW4 A;  1RIN A;  1JYC A;  3WF0 A;  1OC1 A;  3FL7 A;  4AOC A;  2YV8 A;  4BZ4 A;  3QLQ A;  1DBN A;  2PLV 2;  2VJX A;  4FFH A;  3NV1 A;  4W6W A;  4BCU A;  4DZG A;  1TNF A;  1RIT A;  1LGB A;  4XW3 A;  3ZVX A;  2PHU A;  4Q1P A;  5CKM A;  3W21 A;  2GN7 A;  2HBU A;  5J37 A;  2HWC 3;  2C0Z A;  2VM9 A;  2WT0 A;  1X8E A;  2JG9 B;  3ETQ A;  4YM1 A;  4CDQ A;  5DUU A;  1SCR A;  2GZW A;  3RS6 A;  3FX3 A;  1GZ9 A;  3B01 A;  4PIX A;  3UES A;  3ES4 A;  4U2A A;  1MS8 A;  3M8L A;  4ZY9 A;  3M3Q A;  4IV3 C;  3ZX7 A;  5FQ0 B;  5A6Z A;  4NVP A;  4BME A;  3FE5 A;  3TNQ A;  1GNY A;  3EYP A;  2SLI A;  1GLH A;  1CAU B;  4XF4 A;  4Q4W 3;  4YLZ A;  1GOG A;  4AW7 A;  3O14 A;  3PME A;  3PUS A;  4YZ4 A;  3PDQ A;  4L11 A;  3X29 B;  4B1L A;  2NP0 A;  1PZ8 A;  1W0P A;  2F4L A;  5LA1 A;  1WA4 A;  1RUE 3;  4RR3 B;  3URF A;  2VL4 A;  3WW4 A;  3IB3 A;  3BOD A;  1JOB A;  3ITQ A;  3OB8 A;  1O8P A;  4YW6 A;  5EYY A;  2LTN A;  3ZYB A;  5FPA A;  2VCM A;  2FDI A;  5K0U C;  2WYF A;  2W0X A;  2WFF 2;  4DFS A;  3USU B;  5FPL A;  4IV1 A;  2QQU A;  1FOD 3;  2ZAH A;  2WRA A;  5HI0 A;  4NAO A;  1POV 0;  3ST7 A;  1J58 A;  2IWG B;  4CDX B;  5FZB A;  3AKS A;  5ACA 2;  5CZK A;  2FDK A;  3DL3 A;  4NO4 A;  1W04 A;  3PUI A;  1MEC 3;  4IEY A;  1NY7 2;  4JX0 A;  2BP6 A;  2R04 3;  2Z4F A;  4NPR A;  4AZZ A;  2B9V A;  2PLV 1;  5FZ1 A;  5FO8 B;  2CAV A;  1BBT 3;  1LHV A;  1W9Y A;  2GU9 A;  2RMU 3;  2ZZQ A;  3IT8 A;  4FFI A;  1SBF A;  2HWE 2;  3OGS A;  2UWA A;  2YFU A;  5KHG A;  2WNV A;  5D1I A;  3RNS A;  5EPA A;  2HWD 1;  5FYZ A;  2YY1 A;  5JPM B;  2ZX0 A;  4ISR A;  2ZGP A;  3NW4 A;  4Q4V 1;  1AL2 2;  4D6Q A;  3KHC A;  1DG6 A;  2W87 A;  4ZS2 A;  4ZU5 A;  3USS A;  1NLQ A;  3ZXF A;  1Z0H A;  1QH7 A;  2JG8 A;  2OXB A;  5HPO A;  4RS5 B;  3RI8 A;  4QKF A;  5C5T A;  1Q56 A;  3LZZ A;  2H6B A;  1NE4 A;  3U10 A;  4LHS A;  5L36 A;  1COV 3;  2BVV A;  3AMP A;  3V0B B;  3W20 A;  4LO6 B;  5HV0 A;  4DOU A;  1WGP A;  4K21 A;  1T6G C;  4AI9 A;  4IDZ A;  4Y26 A;  3EXU A;  4XC9 A;  4A41 A;  1L7L A;  3PUR A;  2J1U A;  1N3O A;  3IPV A;  3U37 A;  2MNG A;  2BDR A;  4MGT A;  3LDK A;  1OQD A;  4WVM B;  2JDU A;  3WCR A;  4UXA A;  4O9G A;  1AZD A;  1STM A;  1Y9Q A;  2OII A;  3VZO A;  1GWM A;  2WFF 1;  1UMI A;  4K8F A;  4OHV A;  5LK5 A;  1VR3 A;  1GNZ A;  2VZT A;  3LA2 A;  5FZA A;  2J1A A;  4ARY A;  1ASJ 3;  1YYN A;  4B8E A;  1ZZ8 A;  1VBD 2;  2FMY A;  5JR2 A;  4AF9 A;  5ACA 1;  5C3S A;  4XUR A;  3N9L A;  1LED A;  2WR9 A;  2H0V A;  1B35 A;  2C9A A;  3LB9 A;  4JTO A;  1W3X A;  1SFY A;  1YFX A;  5T5P A;  2R06 3;  3TNP B;  4CDW A;  5FUP A;  1US3 A;  2VG9 A;  5CEH A;  1Z7S 1;  3ZXE A;  2ZJC A;  3IAQ A;  3HAG A;  4MGY E;  2PAK A;  1AL2 1;  2ZX4 A;  4XCA A;  5LK7 B;  5ABJ B;  1RIR A;  1UKG A;  4CUB A;  5C4W A;  3VHR A;  4AYU A;  2JE9 A;  1GWL A;  2OQ7 A;  5FZO B;  3P1I A;  5K7P A;  2CY6 A;  3VBO C;  1W9S A;  3QOP A;  2FZ1 A;  3N7J A;  1SBD A;  3THT A;  1JYW A;  2EXH A;  3OD4 A;  5IUQ A;  3H7J A;  4URT A;  3WNP A;  5ISL A;  1CON A;  2FBE A;  1OH3 A;  1G6N A;  1YHF A;  1IG0 A;  3RMY A;  3LPF A;  1SLA A;  2TEP A;  1QF3 A;  5LEJ A;  1DP0 A;  5C6C A;  1NE6 A;  1JOD A;  3VHN A;  1GQG A;  3JZV A;  4IES A;  5IHR A;  4OUE A;  1OQE A;  4NMI A;  3SCH A;  3TAY A;  2Y60 A;  1XE7 A;  1NT0 A;  3NKT A;  5H9S A;  5SV8 A;  5A6X A;  5KXD A;  1BK0 A;  2AEY A;  4L8Q A;  3TEY A;  5EFU A;  1PHM A;  4XET A;  2MPF A;  5JZG B;  1WBL A;  2NN8 A;  4CPB A;  5L9V A;  3OYW A;  1W8U A;  1CQ9 A;  1YXW A;  4Q4Y 2;  1KFU L;  3EB7 A;  2WO2 A;  1A3K A;  1OKQ A;  1JOJ A;  1PMJ X;  1RJ7 A;  3ACH A;  5JOY A;  1BEV 3;  4CCE A;  4AI2 A;  4JGZ A;  4LLO A;  4NRP A;  3SKJ E;  2X5I C;  1AX2 A;  4N90 A;  1PX3 A;  5BNO A;  4I0B A;  4GA9 A;  5H9P A;  1REE A;  1NXD 1;  2BYV E;  3KF3 A;  4NHY A;  3POF A;  1VJ2 A;  4AVV A;  2K46 A;  4Y24 A;  1DFQ A;  4D6R A;  4XAB A;  4MUV A;  1A8M A;  4OVE A;  1XYN A;  2VZU A;  5GLU A;  3ACF A;  4BQ1 A;  4OMD A;  3T09 A;  3GM8 A;  4KU7 A;  4PF5 A;  2DCT A;  5EHD A;  1OKO A;  1UOB A;  1DIW A;  1VB2 A;  1D0G A;  4CU8 A;  2XML A;  5FY1 A;  1AR8 2;  1ODM A;  2RG4 A;  3BYW A;  2HWC 1;  2BWA A;  2VZR A;  3PUH A;  3ZN4 A;  1W6M A;  2BQP A;  4QPI A;  2JEM A;  5EXO A;  2ORX A;  3ZXG A;  4FTS A;  1GQH A;  1RED A;  2A73 B;  2QZ3 A;  2UU8 A;  3J8F 2;  3N9Q A;  1XC6 A;  3JBG 2;  3MIE A;  1W8T A;  1IGO A;  1ZRI A;  4N53 A;  2G1M A;  4XUP A;  5T52 A;  5T5O A;  1ND2 C;  1ND3 C;  3WLU A;  4AQS A;  2VBB A;  1CX1 A;  3K46 A;  1HQW A;  1W2O A;  1COV 2;  4MOA A;  4HVQ A;  3I7D A;  4YSF A;  1WW4 A;  5CB7 A;  3UJQ A;  4RQP C;  1EY2 A;  1JUI A;  3AP9 A;  3J26 N;  3VDD C;  4F83 A;  3BPS A;  3CJX A;  5LY2 A;  1RUE 1;  4RHV 3;  1UY4 A;  2EXI A;  3SKV A;  4KG8 A;  1H8T C;  5AVP A;  1JMU B;  2WJS A;  3AMQ A;  4R9B A;  5FJK A;  2QBX A;  3NAP B;  4GB3 2;  3WG3 A;  4Q4Y 1;  3WQ1 A;  1VRH 3;  2Y6K A;  1W03 A;  1W8F A;  4FOQ A;  1OFS A;  4BB3 A;  3N7M A;  5CFC A;  5HXM A;  1CJP A;  2ZZJ A;  2QQP A;  2JIG A;  4W50 A;  1JU3 A;  1ASJ 2;  4CCD A;  3PJQ A;  2RS5 3;  3VBS B;  4E8D A;  1HRV 3;  4J6G A;  3KCC A;  5FXX A;  1SZB A;  2DCJ A;  2WNU A;  3HOB A;  3ILR A;  5H9R A;  2HJI A;  4QX8 A;  5A7P A;  3I2J A;  5F3C A;  5KR7 A;  2X8K A;  4RGK A;  5T50 A;  4GD4 A;  1MEC 1;  4I09 A;  5F2W A;  5F3E A;  3UGG A;  1YUD A;  1SPP B;  2A6V A;  1ZBE 2;  1NCR C;  4JRL A;  2P1B A;  1US2 A;  1KGY A;  5IVF A;  2VEC A;  2HWF 3;  1W6N A;  4OHY A;  2XL7 A;  1ONA A;  4GUL A;  1GWK A;  2ETE A;  1QQP 3;  1AR8 1;  2WLQ A;  2WS9 2;  2ZHM A;  2AAC A;  4A3Z A;  5F37 A;  1LJ7 A;  1B35 B;  1RB8 G;  3PVE A;  2PHX A;  4LOR A;  2ZMK A;  2XGX A;  2Y0I A;  1ZZ7 A;  3J8F 1;  3K4D A;  1QXP A;  1VMJ A;  2VOT A;  3MIF A;  2WAO A;  1NG0 A;  4Q4X 2;  4KWK A;  1XU2 A;  2B45 X;  3E5U A;  2BJS A;  3JQW A;  2L9L A;  2XUE A;  1UU5 A;  1COV 1;  3L2H A;  5FP3 A;  1Q5O A;  4FTE A;  5A7W B;  5KBF A;  2P34 A;  1Q8O A;  2W1S A;  3VKL A;  4LKE A;  4AFA A;  4FQ4 A;  2Z69 A;  4BQX A;  4DUV A;  1NLR A;  2EID A;  1YLL A;  4HMZ A;  1ZA7 A;  3BIW E;  4Q0Q A;  2LRP A;  2BV4 A;  3GZU C;  3BOW A;  2W92 A;  1LOA A;  3K51 A;  4FPK A;  3P5B A;  4UFM A;  1LOE A;  4E4D X;  1SAC A;  4EZH A;  2UWB A;  4IQP A;  4GB3 1;  3I3E A;  1SLI A;  2HEV F;  5IFP A;  5LCW L;  1GOH A;  5FP8 A;  2QQN A;  2W1U A;  2CSG A;  1QJY 3;  3H1Y A;  4FPO B;  4L97 A;  4B7E A;  4CDU C;  5JDB A;  3AX4 A;  1AHS A;  1ASJ 1;  3O0W A;  4CCM A;  4IE5 A;  3ME2 A;  1D0H A;  4JRA A;  3F95 A;  2TUN A;  4XJU A;  1LEC A;  2D5F A;  3HEI A;  3LWC A;  3OYW B;  2Z5W A;  4K9S A;  5FZG A;  1UZZ A;  2DYC A;  3DN7 A;  1S0C A;  3POY A;  3WF2 A;  1ZBE 1;  2DU0 A;  4A4A A;  4H2A A;  3FUO A;  1WZX A;  1CGP A;  4F3J A;  2XJV A;  3KQR A;  4LBQ D;  2O0O A;  3B94 A;  1HJG A;  5BNO B;  2XWB B;  2WS9 1;  1QNW A;  4TSV A;  3SH4 A;  3AKP A;  4WM8 C;  5JCT A;  1MR5 A;  1QJZ A;  1SDW A;  4TYS A;  4Y5Z 0;  2WYS A;  4AGR A;  2EAK A;  1POQ A;  4XJW A;  4CU9 A;  1YIF A;  4CUA A;  1NQJ A;  1V00 A;  4BWO A;  4AHZ A;  3O1P A;  3BGA A;  2YU1 A;  1JZ3 A;  3ZPO A;  5IAT A;  5GKA C;  1RUC 2;  3PVN A;  4NIA A;  3BPZ A;  3FBM A;  3WV6 A;  3WF4 A;  4CA9 A;  5J09 A;  1IPS A;  4LTA A;  2XHK A;  4E2G A;  3VZN A;  5DMY A;  4YAR A;  1UIK A;  2H6C A;  1VBE 3;  2Q5T A;  5IAV A;  4C1X A;  4YVS A;  1JTZ X;  2JB8 A;  3TBD A;  4N43 C;  5C9A C;  3FLT A;  4XDQ A;  2BW8 A;  4XHB A;  2XLA A;  2IXH A;  3NKG A;  4E27 A;  2P3J A;  2IZW A;  4GMP 0;  2Q8C A;  3LCP A;  4YVW C;  1SDD B;  1UXX X;  1E5S A;  3VBF B;  1UYP A;  2VMH A;  1P8J A;  3BTZ A;  4BDV B;  3N7K A;  4AEK A;  3KWV A;  1X9T A;  1AR9 2;  2B39 A;  4YW2 A;  2A5Z A;  1L7R A;  3KSC A;  4B7K A;  1OI6 A;  5K8S A;  3LA7 A;  3ZYF A;  5CU1 A;  3BB6 A;  2RS5 2;  1EUT A;  4UAP A;  4FXG B;  1VE0 A;  1UAI A;  2YDE A;  3VLB B;  2WUH A;  2ZGN A;  1CAX A;  1IPJ A;  4FOW A;  5FIX A;  3BTX A;  2OPK A;  3FFZ A;  3UJO A;  1FMD 2;  4QQL A;  3O1M A;  5CAZ A;  1LEN A;  1T6B X;  1VIW B;  5AC9 3;  1LCL A;  4M0H A;  4DRR A;  2E32 A;  2EIC A;  4J1W A;  1UF2 C;  4O7X A;  5A7O A;  4PT6 A;  4ASK A;  2DVG A;  2GC3 A;  2GC1 A;  2VW0 A;  2VZV A;  5B2G B;  1PNF A;  1QXJ A;  3PHM A;  4BIF A;  2VVE A;  4LPL A;  2D43 A;  2R1D A;  5D8A C;  3T2O A;  2WZR 3;  1JYN A;  3MFC A;  3DGT A;  2WA4 A;  4NRQ A;  4K6B A;  2PAM A;  4GJY A;  3AYC A;  3HD8 B;  3KF5 A;  4I01 A;  1JXN A;  2BUK A;  4H14 A;  2LM3 A;  4Z82 A;  5F5C A;  2UWC A;  4K7J A;  3SIT A;  2J1E A;  3NNL A;  4FPC A;  1PZ9 A;  2DVF A;  2ZKN A;  1XNC A;  2VMI A;  3LIG A;  2GP5 A;  1X8M A;  2I45 A;  2JDA A;  4IEW A;  1QDO A;  2VZP A;  1OLM A;  3K77 A;  4JDO A;  1CD3 G;  5F5Q A;  5L9B A;  2WO7 A;  4XF0 A;  3WOG A;  4PDW B;  1OHF A;  2C9K A;  3S5Q A;  5DAX A;  4DMI A;  2JXA A;  2ZEW A;  1KJL A;  2VXJ A;  3DYM A;  2R32 A;  3T0B A;  5E8A A;  5G04 L;  1GIC A;  5FP7 A;  4MO3 M;  3ZYI B;  2ZS6 B;  1C8M 3;  3GCX A;  4IGO A;  4XF9 A;  1AR9 1;  4S2D A;  4BE3 A;  1G9C A;  3ORJ A;  4IET A;  1ZNP A;  4PQQ A;  1FAY A;  1NCQ C;  4FPF A;  4A7Y A;  4ATE A;  1EPZ A;  4JKL A;  3WHU A;  2RS5 1;  4YFZ A;  2PYT A;  1HRI 3;  5EP9 A;  3H8R A;  1F35 A;  1T2X A;  3NV2 A;  3I97 A;  4AVC A;  4CEW C;  2E7Q A;  3OBA A;  3III A;  4EV0 A;  3S0M A;  2LRO A;  1DYP A;  3MPB A;  2IFR A;  2VCC A;  3R05 A;  4LK6 A;  2DBN A;  3WNO A;  3UGH A;  5AFE A;  3UYJ A;  2HYK A;  5CIR A;  4JKK A;  1C8N A;  4LBN A;  1Q8Q A;  1WMX A;  1XQN A;  4GZ9 A;  2YC2 A;  4JHZ A;  3OSD A;  4LUM A;  1GP4 A;  3SCG A;  1G7Y A;  3AP5 A;  3M7A A;  1AJO A;  2ZHL A;  3LE0 A;  2D6N A;  1OLM E;  3RDI A;  2QQM A;  3RWN A;  4AI1 A;  4UT5 A;  1HB1 A;  3I2H A;  2P3I A;  1RYY A;  2VW1 A;  2VCB A;  4RFR B;  1MZF A;  3A23 A;  3J9S A;  1LHO A;  2NQY A;  5FMO L;  5L7O B;  3AVS A;  2IUW A;  3C2U A;  4HAN A;  2GME A;  1H2N A;  1RUF 2;  3VBR C;  3UNP A;  2ZGK A;  1ULE A;  4WM7 A;  3ZFF C;  3PJY A;  4FQZ A;  1QKQ A;  2XLG A;  2VTX A;  4G9S B;  2VBP A;  4AAX A;  2ZEZ A;  3LKJ A;  3K2O A;  2E31 A;  5J1X A;  2GMP A;  4XTM A;  5BNN C;  4LEJ A;  1ST8 A;  2HEY F;  5HCA A;  2R0F A;  4CXY A;  1GP6 A;  2N7G A;  4QPG C;  5J98 B;  1XNK A;  2HLE A;  5J48 A;  2XPJ A;  1MS9 A;  3LAG A;  1TZO A;  1XNB A;  2ES3 A;  4KI5 M;  2JG9 A;  1KS5 A;  2D6K A;  1JW6 A;  4P5H A;  2Q8D A;  3TEW A;  2V4V A;  4BM8 A;  1VLN A;  2D3P A;  1V6L A;  3WNX A;  1GAN A;  1OQ1 A;  4KU8 A;  4FO9 A;  5F1R A;  1RGS A;  3T1M A;  1OA2 A;  2PFW A;  1JZ5 A;  3GGL A;  2V73 A;  5A3P A;  4M01 A;  4Y22 B;  3Q9O A;  2BOI A;  2WO1 A;  1POV 3;  3WDV A;  5E89 A;  4FP3 A;  1RUO A;  2IXI A;  2RJK A;  1ENX A;  2J1R A;  4NE9 A;  4OHW A;  3ZKY A;  3JD7 3;  4NN0 A;  2WDB A;  1ZBA 2;  2Y64 A;  3H3U A;  4QT6 A;  4Y3O A;  1H4H A;  5GLV A;  1D4M 2;  4ATF A;  4EWA A;  1GV9 A;  4LBJ A;  2HWB 2;  3B9I A;  1UY2 A;  4UBG A;  3CIH A;  4FOY A;  1EAH 3;  2RR1 3;  1DQ6 A;  2D3R A;  1F5J A;  3U14 A;  5GZE A;  2WKK A;  2HBT A;  1M06 G;  1BCX A;  2BZD A;  3POI A;  3OBT A;  2VUJ A;  1GSL A;  4JAA A;  5APA A;  3CJI B;  1MZ6 A;  5FYS A;  3WF3 A;  1GYK A;  3KVA A;  3WXP A;  3E6B A;  3VBU B;  4QKN A;  3I2D A;  2W95 A;  3MGU A;  3QH6 A;  4GWN A;  4XQW A;  2K9Z A;  2QQW A;  5JXG A;  1K12 A;  3BUC A;  3GDB A;  3RZH A;  2JDN A;  4W8J A;  1LU2 A;  1QNY A;  1QU0 A;  2NM1 A;  3NJX A;  5A32 A;  4X8P A;  5L9R A;  1RUG 3;  2VCA A;  3LSD A;  1AXY A;  1HIX A;  3CNA A;  5DAW A;  5JOX A;  2CWM A;  3IBM A;  2XL9 A;  2VNV A;  5LA2 A;  5E16 A;  4MV2 A;  4LR4 A;  4RGA A;  4LO8 A;  4P00 B;  4R9C A;  4UFI A;  2XLF A;  5I8T A;  5BXX A;  4XIO A;  2WII B;  1APN A;  2GAU A;  3VKO A;  1HQL A;  3JCI A;  5IVV A;  4COV A;  3O7O A;  2JIJ A;  2JB4 A;  4IV3 A;  5LA9 A;  1UYX A;  2WAA A;  1ZZ6 A;  3GBG A;  1R08 2;  4LIT A;  3VD4 A;  4H3W A;  4EWE A;  4HXC A;  1DDL A;  2PHL A;  4AFD A;  1YJL A;  1I5Z A;  4AQ2 A;  2XR4 A;  5LBF A;  3ZOI A;  5A3U A;  5EIY B;  2Y6J A;  2ZX1 A;  4R4Z A;  2XH6 A;  5I0R A;  1K5M C;  3ZFG B;  2A70 A;  5FY7 A;  5I0S A;  1OF3 A;  1O4Z A;  2HWB 1;  5FZI A;  5JVV A;  3WDX A;  3BVC A;  4BQY A;  3TWI A;  1NA1 C;  5JI7 A;  4LBQ A;  3LOB A;  2D98 A;  2WO3 A;  4PLM A;  4KBZ A;  3B02 A;  4AL9 A;  4E2Q A;  1MQT B;  2NZ9 A;  3FUQ A;  4QPW A;  4R52 A;  4XEZ A;  5FPZ A;  1UIJ A;  2GNM A;  2VMC A;  3E5Q A;  2CHH A;  5FXW A;  4CCO A;  5JPN B;  4QGN A;  4N9H A;  3VZK A;  3ZXA C;  1UWW A;  2QFE A;  2UUR A;  3BU7 A;  4RGG A;  1UZV A;  3CZJ A;  5DZG A;  2Y0O A;  3WP4 A;  3ZN6 B;  4WVZ A;  4DEV A;  1U12 A;  5JUV A;  2ZGT A;  5K4L A;  4YG3 A;  2CU5 A;  3M4F A;  5JR7 B;  2ZGO A;  4GXL A;  4XQD A;  4ZXK A;  3A21 A;  1S0I A;  2A6W A;  4FAG A;  4Q5O A;  1YFW A;  1HB3 A;  1S0G A;  1GFF 2;  2HH9 A;  5BV6 A;  2VTF A;  4LA2 A;  5IW0 A;  3Q8B A;  1PK6 C;  3WP3 A;  5CBL A;  3IWZ A;  3T2P A;  4IEZ A;  4YRD A;  1Q3E A;  4XDP A;  4GH4 C;  5ABJ A;  5GLZ A;  1A6C A;  4JZR A;  3T3Y A;  3WSO A;  1C8M 1;  1RUD 3;  5FZ3 A;  4XJA A;  2Y6H A;  5KXE A;  4PQ9 A;  1TE1 B;  1W6Q B;  1TME 3;  5FZO A;  1H6X A;  3UKV A;  3VBH B;  1D4V B;  3OY8 B;  1R08 1;  2HWD 2;  1QJX 3;  2CYF A;  1PIV 3;  2XBO 3;  3RSJ A;  1RL3 A;  4PCR A;  4Q4V 2;  3AZX A;  1OOP C;  2FZ2 A;  3B69 A;  2YXS A;  2ZGL A;  3A22 A;  4LUK A;  5DPN A;  4BPZ A;  5FYH A;  2OW4 A;  1PO1 3;  4B29 A;  3AXD A;  2QTW B;  2UYB A;  1DGW A;  2FQP A;  1UNB A;  3PIJ A;  4PLO A;  4LJH A;  1XSR A;  4G4F A;  4YW5 A;  1RMU 2;  5JZG A;  1YFY A;  3H8X A;  3O1T A;  3N36 A;  4A42 A;  1LOF A;  2ADE A;  1R09 2;  3SH5 A;  2DUR A;  2EXK A;  2NMN A;  2JD4 A;  2RS3 3;  5FP9 A;  5BNP C;  1RVF 3;  5FPU A;  5F5I A;  1KEX A;  1XYO A;  3PUA A;  4K40 A;  3TB0 A;  3WQ0 A;  5A3L A;  3ILF A;  5K9Y A;  2BGO A;  4OI4 A;  1QJF A;  2GSY A;  2NLR A;  4CUG A;  3C7F A;  2JDP A;  4NID A;  1DQ1 A;  4EN7 B;  1TMF 2;  1LB2 A;  3I54 A;  2VUL A;  4YZ2 A;  5FY4 A;  3GZA A;  4W6Y A;  2RM2 3;  2WWJ A;  3KV5 A;  1NOV A;  2ATF A;  2AH2 A;  2KA3 A;  2VMG A;  3CU7 A;  5A33 B;  2DBI A;  5ANQ A;  1OF4 A;  2VOW A;  1RUH 2;  3DCQ A;  1TEI A;  3WG4 A;  2JDH A;  5FLH A;  5B4X A;  5FTT C;  3B3Q E;  4Y1Y A;  2EXJ A;  1Y9M A;  2BTV C;  4MET A;  5FUI A;  5A32 B;  3LFI A;  5FY9 A;  3WDU A;  4ASL A;  4TLG A;  4QX7 A;  1HXS 2;  3VBO A;  4XAE A;  4FPJ A;  2ILM A;  2PN5 A;  4B4Q A;  3AKQ A;  3J7L A;  1FXZ A;  1Z7S 2;  3MBW A;  5A7N A;  4Q1R A;  2RDN A;  3ZR5 A;  3PU8 A;  3KVB A;  5FBJ A;  4A6S A;  1POV 1;  4PJY A;  5FZ0 A;  1CWP A;  3BKZ A;  2OPW A;  1AR6 2;  4KH9 A;  5FV3 A;  2A71 A;  5FYI A;  4IV3 B;  2VGD A;  1K45 A;  4BMB A;  4YGC A;  2ZX3 A;  1HN0 A;  1H2M A;  3WUD A;  1AYN 3;  2A6Z A;  1CES A;  1VBB 2;  1EAH 1;  1RMU 1;  2RR1 1;  2V4A A;  3B00 A;  1JHN A;  3I4I A;  3LEK A;  4IEX A;  1ZM1 A;  5DAB A;  3WZ1 A;  4DO0 A;  3V0A A;  4YZ5 A;  5FZM A;  3NAP A;  5FZK A;  3KD4 A;  4AXO A;  4B1M A;  1LGN A;  2R49 A;  4FCA A;  4YPJ A;  1FAT A;  1DGR A;  1R09 1;  2WIN B;  3MW2 A;  4PI0 A;  1FI2 A;  2VVF A;  2J1V A;  5IK7 A;  1UOG A;  5BNQ A;  1V6N A;  4LBQ B;  4Z1V A;  5JXJ A;  3KGL A;  4IGP A;  2GND A;  3VBS A;  2W1Q A;  5HBA A;  5FYY A;  1AR7 3;  4FPE A;  4YW4 A;  2ZMN A;  4R9D A;  2IFW A;  5FYM A;  3AKR A;  1V70 A;  4IGQ A;  4LE3 A;  4AED C;  4ES8 A;  2VAU A;  2EIE A;  1TMF 1;  3RYK A;  5K0U B;  5EWS A;  4XFH A;  1SPP A;  2R6Q A;  3WNN A;  5FY8 A;  5LAS A;  3AJY A;  3DPR C;  4K1Z A;  3WUC A;  4CDQ C;  1HDK A;  2X10 A;  3N9O A;  1D2Q A;  1BKZ A;  1LOC A;  2RE9 A;  2ZAA A;  1RUH 1;  2D6O X;  3WD5 A;  1N47 A;  4OMC A;  1S1A A;  1JZ4 A;  4DY5 A;  1J83 A;  3JQX A;  1HLC A;  2XWJ B;  4CEY C;  2VUC A;  4KWL A;  5FMB A;  1C3H A;  4JDM A;  1HXS 1;  4QD2 A;  3ZYR A;  3ZDS A;  3ZPY A;  2DUO A;  3ZM8 A;  3FWE A;  1ND2 A;  1ND3 A;  2YGM A;  2ENR A;  3GBF A;  5FAX A;  2EF6 A;  3C7O A;  2Q8O A;  3VD9 A;  4OZX A;  5KWR A;  1REF A;  4Y1V A;  1OVS A;  2HWC 2;  2JD9 A;  4MAD A;  4DXZ A;  5A7W A;  2FD8 A;  1AR6 1;  5TSW A;  1HB2 A;  2XVG A;  3MF9 A;  1AXK A;  2DU1 A;  4H7L A;  5F5A A;  4EN6 B;  5JXH A;  1ZZC A;  3K75 B;  4IEO A;  3LOI A;  3AZY A;  2GDF A;  1IOA A;  3POJ A;  3R4S A;  4UYB A;  4AEM A;  5C33 A;  3MLK A;  1VBB 1;  5IVY A;  4EN8 B;  3FFQ A;  5FMO S;  4IV1 C;  1HKD A;  4LHK A;  4FAH A;  3DXT A;  3PU3 A;  4HBN A;  4E9K A;  2WL1 A;  4Q4W 2;  1SBE A;  3FN9 A;  5FWE A;  2CNA A;  2E33 A;  5FY0 A;  1OPM A;  2Q1F A;  1V9U 3;  3BCW A;  3HVD A;  3IIA A;  5D21 A;  3ZDV A;  1QXR A;  1W8O A;  4K3U A;  2LW8 A;  3F2Z A;  4ORF A;  3RI9 A;  1PGS A;  4CXX A;  1JS9 A;  1RUE 2;  2RS3 2;  4NRM A;  2ZOE B;  2WNV C;  3D6E A;  3L2Y A;  5EYX A;  1UY1 A;  1VB4 A;  3N4M A;  4QHB A;  1TNR A;  3OPW A;  5BYN A;  2XJP A;  4DS0 A;  1GBG A;  4XJ8 A;  3VUO A;  5ANN A;  3LDR A;  3KGZ A;  5A80 A;  2Q4S A;  1NZI A;  1FOD 2;  2HEW F;  3DEM A;  5FOB B;  2W08 A;  1PGW 1;  4MXV A;  1NAE A;  2JG8 C;  1ZX5 A;  3NV3 A;  1ZVF A;  2PXJ A;  3VHO A;  3H1M A;  2QQV A;  2W46 A;  1X7N A;  2WQ8 A;  3WNK A;  1MEC 2;  4OCT A;  2R04 2;  3KQ4 B;  1VMF A;  1W8N A;  3VZM A;  4KNC A;  2V72 A;  1CPN A;  1BBT 2;  3LEM A;  2B5H A;  3OG2 A;  2RMU 2;  4PIZ A;  3SEE A;  4AK3 A;  1UYY A;  2OT7 A;  2D6P A;  2JWP A;  4MHR A;  3MV0 1;  4F8A A;  4YG0 A;  2H0B A;  1O5L A;  3IZO A;  3BTY A;  4KG0 A;  1CZV A;  4JVA A;  3OD0 A;  1NXM A;  4PBO A;  2Y38 A;  3ZSL A;  5LBE A;  2BRT A;  4M3C F;  4Q2F A;  4QX5 A;  2ZEY A;  3HIF A;  3NNG A;  5LAT A;  4CZS A;  4DRV A;  1S4C A;  3VBO B;  1W05 A;  1J84 A;  1ZRC A;  3WHT A;  1DQ0 A;  3AB0 A;  2HYX A;  4YW1 A;  4CP9 B;  3VBF A;  5BNP B;  4Q4W 1;  4S2F A;  4FOV A;  1SFP A;  1WCQ A;  1IS5 A;  2JDK A;  1WLD A;  1H6Y A;  3PIG A;  1WCS A;  3VDC A;  4CDU A;  1BXH A;  1H8V A;  4GWM A;  5CAD A;  2AR6 A;  2VC9 A;  3WQB A;  2RS3 1;  3VD5 A;  4B3N A;  1F8V A;  2DV9 A;  1CN1 A;  3OUJ A;  3V0A B;  1GMM A;  3CDZ B;  4XMI A;  4IL7 A;  4CDW C;  3HNY M;  1XE0 A;  1W9F A;  2E63 A;  2JKX A;  5FXV A;  1SQ4 A;  1RHI 3;  2Y6F A;  4LOT A;  4AI3 A;  4CU6 A;  5EV7 A;  1IKQ A;  2VZQ A;  1URX A;  1YNA A;  2J7M A;  2O1Q A;  3V65 A;  3PLQ A;  3VV1 A;  1K5J A;  5FZ4 A;  5C4W C;  5JSO A;  4ZPI A;  1FOD 1;  5BUV A;  2OQ6 A;  2X5I B;  2WC2 A;  3CMG A;  1HN1 A;  3GXU A;  4XFC A;  1RXG A;  1DCS A;  2X05 A;  2JE7 A;  4R8H A;  3CEW A;  5C8C C;  1XRU A;  4WM8 A;  2BVB A;  5IVB A;  3D3A A;  4Y1Z A;  4M4R A;  2AC1 A;  3POS A;  3ZYG A;  1OFN A;  1OMI A;  2R04 1;  2YBP A;  3ALQ A;  3N9M A;  3POG A;  3OGV A;  1O3T A;  1UX6 A;  1BBT 1;  1UPI A;  3S7I A;  5CG8 A;  2RMU 1;  4DY3 A;  2JX9 A;  5AFB A;  2A75 A;  1IS4 A;  2P37 A;  2R06 2;  5JOZ A;  3BTA A;  3QAC A;  3D0J A;  4MGS A;  4ZON A;  3O1V A;  4LIV A;  4MLO A;  1A34 A;  1W8H A;  1X50 A;  4XUT A;  5FR3 A;  4AE2 A;  1CR7 A;  1VAM A;  4DPN A;  1DZT A;  3AYE A;  3GAL A;  2R16 A;  3LPG A;  4N43 A;  5C9A A;  2VR4 A;  2ET7 A;  2WSU A;  4YYO A;  5T5L A;  2I2S A;  3MZH A;  1ND2 B;  1ND3 B;  3O5S A;  4QU1 A;  1TQ5 A;  3KT1 A;  3UT0 A;  1JOP A;  3M1H A;  4AI0 A;  1AYN 1;  3DKQ A;  2B4K A;  1XNA A;  2P4E A;  4PDW A;  4JGZ C;  3KT7 A;  2GMM A;  4FTB A;  3BIE A;  1DZR A;  2JIC A;  2YUE A;  4AFC A;  4ZZ5 A;  5F8P A;  3MFA A;  4OQ9 A;  4RQP B;  1RUI 3;  2LAL A;  3E6D A;  4QAW A;  4N7U A;  3ROU A;  3VDD B;  4NIG A;  3BI3 A;  5BPX A;  3MIB A;  5DG2 A;  2ARC A;  1QDC A;  3ON7 A;  3ZMO A;  2Y6G A;  1H8T B;  1AR7 1;  2A1X A;  1W2T A;  3SHR A;  2WA3 A;  4HKW A;  2W2I A;  3AL5 A;  1N1Y A;  2W1W A;  3PMS A;  3VHP A;  5IVC A;  1WA6 X;  2YGL A;  5FRA A;  3FLP A;  5LRS A;  1UD1 A;  4M0N A;  4QPI C;  5DN2 A;  1BEV 2;  1V6K A;  5L19 A;  4AGG A;  4D7Y A;  3AP4 A;  4A2U A;  3PTY A;  1EPW A;  1J1T A;  4NR1 A;  3KV9 A;  3MYX A;  4X6Q B;  3VDA A;  4CRQ A;  5C8C B;  4S2G A;  2XJQ A;  3NNF A;  4HK8 A;  4N53 C;  1O3S A;  4D69 A;  2QCS B;  2VO5 A;  1BHG A;  4BHP A;  3GCW A;  3S5A A;  2CV6 A;  2PMW B;  2X09 A;  5A7S A;  3WW2 A;  5D8A A;  1PVC 3;  5F6K A;  4KMQ A;  4UOJ A;  4IXL A;  1NCR B;  2R06 1;  5EJ1 B;  4O61 A;  1WME A;  3LIH A;  5DUW A;  1SMV A;  5L7O A;  3IMM A;  2KD7 A;  5J36 A;  2OS2 A;  1WWY A;  4Y33 A;  1ENQ A;  4I0W B;  5IJR A;  4FXK B;  2PQS A;  1FPN 3;  2D3S A;  4XZP A;  5FFO C;  4X6R B;  4ISQ A;  2RJ2 A;  1QGL A;  4LKD A;  1Q8P A;  4OZO A;  5KHK A;  1LOB A;  3T2T A;  4HOO A;  4ZKT B;  1UU6 A;  2WFP A;  2FHR A;  3AL6 A;  4URA A;  2IXJ A;  3J7H A;  4P02 B;  4CE8 A;  2CGO A;  5FO9 B;  5CFC C;  1MZE A;  1XNT A;  2PQQ A;  3AM2 A;  4Z92 B;  2YBK A;  3R6S A;  4NPL A;  3I2F A;  2K0G A;  1PO2 3;  1QJU 3;  2EIG A;  4QGL A;  4XFA A;  2EAA A;  2WNU C;  4MVT A;  2MEV 3;  5DAQ A;  3CF6 E;  3HNB M;  1V9U 1;  4HZF A;  3WX5 A;  4JTN A;  2AYH A;  3WDT A;  2E7A A;  3CKH A;  4XHX A;  2WLP A;  3GBW A;  4RHV 2;  5JLV A;  1X9P A;  3ZXL A;  1RUJ 3;  3RZZ A;  2Z42 A;  5C8W A;  3I2G A;  4IEU A;  4Y22 A;  4YM3 A;  2R07 3;  1LTE A;  1VRH 2;  4EYU A;  1BEV 1;  1UY3 A;  4CDU B;  4TLF A;  3WY6 A;  1MS3 A;  2TNF A;  5JXI A;  1DYK A;  4H7M A;  1S0F A;  2GH2 A;  4COW A;  3T4H B;  2ZKL A;  2CDO A;  1DQ2 A;  3AMN A;  1HRV 2;  4JCK A;  1Y7B A;  2WZE A;  1E5H A;  3VD3 A;  4UF0 A;  3ZSE A;  4DQA A;  4HKL A;  3A0N A;  4KQ7 A;  2V09 A;  1UMZ A;  4U36 A;  1LRH A;  3EQE A;  3GHM A;  1ULP A;  3I3D A;  4FSJ A;  3S57 A;  1MS0 A;  1XPW A;  3MV1 1;  5FZ7 A;  4C0B A;  4QDS A;  2PHF A;  4UWD A;  5C71 A;  4R9A A;  4AFM A;  1SLT A;  5BY5 A;  3CJI A;  2HWF 2;  4J1X A;  5DDJ 3;  4CSW A;  4K1Y A;  4WM8 B;  4CVU A;  1V6O A;  1DQ5 A;  1QQP 2;  1QOS A;  1S2E A;  5EQU A;  1H1A A;  2G9F A;  2FDJ A;  3DF0 A;  3SMH A;  5E88 A;  3VBU A;  5B4N A;  3ILN A;  4KGQ A;  3ZFF A;  2VZ3 A;  3LA3 A;  4DUW A;  3SEP A;  5IK5 A;  4LUL A;  4HVO A;  2WN2 A;  4MZU A;  4I30 A;  1CAV B;  3ATG A;  1KQR A;  4MG2 A;  4LXL A;  2ORZ A;  3CHX A;  3VDB A;  2XUM A;  2DTY A;  2ZHK A;  5DZE A;  3JUU A;  4LBM A;  1YIP A;  3W5N A;  4MGI E;  3OBR A;  2WBK A;  1OD5 A;  4N43 B;  5C9A B;  3LQC A;  3OUH A;  4BK4 A;  2C6S A;  3KS7 A;  1O6U A;  2GAL A;  2ZAC A;  2W9X A;  2ZXQ A;  4FPG A;  4RHV 1;  1W28 A;  3N7L A;  4YVW B;  2CGN A;  3T2Q A;  5FKB A;  4A7K A;  2Y6L A;  3TN9 3;  3AMH A;  2DFB A;  4XJZ A;  1RHI 1;  1VRH 1;  3S6P A;  1AJK A;  1O4Y A;  4BQ5 A;  4XYX A;  4MXW B;  1VRB A;  1QJY 2;  2J1T A;  2P5B A;  1Y9G A;  4X8N A;  4A7Z A;  5IYY A;  1ULF A;  3K48 A;  3ZFG A;  4BQW A;  2KM2 A;  3PL0 A;  3KCY A;  2OKX A;  2QKD A;  1HRV 1;  2VZ1 A;  3PNA A;  2XB6 C;  3Q8A A;  3RQ0 A;  1JYT A;  2F17 A;  2YC0 A;  2BFU L;  4NWV A;  2AZ5 A;  3ZFE C;  4BJ0 A;  4QXB A;  2ZGR A;  3ETP A;  3FHA A;  1MQT A;  1UKR A;  1EV1 3;  3O1R A;  1O91 A;  1R1A 3;  3MIG A;  4FPL A;  3NJV A;  3RYR A;  2HWF 1;  4YVS C;  4LKS A;  4E4Z A;  1W6P B;  2GN3 A;  2GP3 A;  2IC1 A;  1QQP 1;  2JE8 A;  1O3R A;  1TVG A;  1S0E A;  4I3G A;  3GYD A;  4QQP A;  3RRD A;  5FK8 A;  3O0V A;  3JB4 C;  3ZN6 A;  3GJB A;  3RMX A;  2D93 A;  1F31 A;  4LA3 A;  5D8A B;  1R1Z A;  3R4D B;  4IER A;  3NRU A;  1YQ2 A;  4RD7 A;  1AYM 3;  3SIS A;  4EJR A;  2QQL A;  3ZYJ B;  1ZYB A;  1VBC 3;  2RS1 3;  3QCW A;  1LUL A;  4Q8L A;  5FZH A;  1LR5 A;  4K20 A;  1FNY A;  5LA0 A;  3RFR A;  4JQR A;  3WT3 A;  1J3R A;  1VBE 2;  3M2M A;  3MW4 A;  4HK9 A;  2DWR A;  4CCJ A;  1I9R A;  4LT5 A;  1DQ4 A;  3C3V A;  1PZ7 A;  4ONU A;  4FFG A;  4JGY C;  1W6Q A;  2UY9 A;  3AFK A;  4Y20 A;  5C3R A;  1S0J A;  1IPK A;  2YYO A;  3VBH A;  4OUL A;  4TTG A;  3VKN A;  3OY8 A;  2XQX A;  4XAC A;  5DAV A;  4XQ4 A;  5KXC A;  5AVA A;  1JYX A;  3WP6 A;  1QOT A;  2JEC A;  3VZJ A;  4BXF A;  4FT8 A;  2R1B A;  1QJY 1;  4C91 A;  3AMM A;  2VY0 A;  4QMA A;  1NCQ B;  2PA7 A;  5HCH A;  1FT9 A;  4OI2 A;  4QX3 A;  1LHN A;  1H2L A;  5I0U A;  4XOG A;  3MF6 A;  2QQJ A;  2IXK A;  4CEW B;  2GC0 A;  1RXF A;  1YWK A;  1VAL A;  3TEZ A;  1QY4 A;  1KDM A;  1ODN A;  2AGS A;  3NWK A;  3APB A;  2CWS A;  4DXR A;  4RYD A;  4QKB A;  1UN1 A;  3DYP A;  4UW3 A;  1CVN A;  5AC9 2;  3LF7 A;  5GLW A;  4LQR A;  1DZQ A;  2PLV 3;  3OTF A;  4UF0 B;  5C3Q A;  2QQI A;  2XJT A;  2ZPX A;  1JZ7 A;  1W6O B;  4MGK E;  3OBZ A;  4LO4 B;  2XON A;  2VW2 A;  2WZR 2;  1I5P A;  3THC A;  2AUY A;  3M70 A;  4P9J A;  2QDR A;  1ZRD A;  4ASM B;  2X29 A;  2VQU A;  2ZAB A;  1OVP A;  1AVB A;  5SV5 A;  5I8S A;  5M0T A;  3VBR B;  3SH3 A;  5JSP A;  2WN3 A;  2XDV A;  3HMY A;  5CFD C;  4N9I A;  5A33 A;  3ZFF B;  1VBE 1;  3ZSM A;  1QJU 1;  3MUY 1;  4GH4 A;  4L9B A;  2VQA A;  1WW6 A;  4HN1 A;  4GKX A;  4GMP 3;  3RVH A;  1G9F A;  4COZ A;  3HBK A;  1AF9 A;  4LNV A;  1BVV A;  4QX0 A;  5BNN B;  4IND A;  5FP4 A;  2WSV A;  4E4S A;  2RHP A;  3NNM A;  2FDF A;  4QPG B;  3WR0 A;  1XBF A;  2JJ6 A;  2YFZ A;  5JIA A;  3IAP A;  5EJ3 A;  4WBB A;  4XXP A;  1UU4 A;  4OFG A;  2BGP A;  5LY1 A;  4GAL A;  1Q8S A;  4UFK A;  3H8U A;  1C8M 2;  5DUX A;  3JB8 A;  4HN0 A;  3I49 A;  1J59 A;  3Q8F A;  4A3X A;  5IT6 A;  2WFF 3;  3EMR A;  1HRI 2;  3RJ2 X;  3DYO A;  3OEA A;  3GNE A;  3RWK X;  4IEP A;  4CP0 A;  3U75 A;  4Q0P A;  1W90 A;  5ACA 3;  4XFB A;  5DAP A;  4JV4 A;  2I74 A;  4WM7 C;  4XBL A;  4P9X A;  5HCF A;  1YQ5 A;  2BNN A;  5F39 A;  1YC6 1;  5AC9 1;  2W68 A;  4C1W A;  4LBK A;  2O14 A;  3KMH A;  4FP2 A;  4WV8 A;  4Y4Y A;  4YFW A;  3O0X A;  5DDJ 1;  3UGF A;  4AG4 A;  5BNP A;  4YW3 A;  2HWE 3;  4I02 A;  4GKY A;  3FLR A;  3WNL A;  4XDO A;  1GKB A;  1GZW B;  2VE1 A;  2VVD A;  1AL0 G;  2WZR 1;  4LHL A;  3WG1 A;  2NYY A;  3DEC A;  2WQZ C;  1F2N A;  1QMJ A;  1UOJ A;  1AL2 3;  5K0U A;  3AFG A;  3DXU A;  4P9L A;  4NAM A;  2JG9 C;  3H0O A;  1H4G A;  2C5D A;  4D0Q A;  1FV3 A;  1C1F A;  4KL1 A;  3T30 A;  3VL8 A;  2LUW A;  4BXS V;  4TXW A;  4IE7 A;  1U5X A;  3M3I A;  3ZYP A;  5JMO A;  1BZW A;  5EZW A;  3IDB B;  5GZD A;  3K4A A;  5FZF A;  1AX1 A;  2CAU A;  5A1L A;  4CTE A;  5J3U A;  1BJQ A;  1X82 A;  3FC0 A;  5GZG A;  3FJS A;  3SNM A;  1BQP A;  1D7P M;  3I3M A;  4QQH A;  2W91 A;  1W2U A;  2D97 A;  5T3N A;  4HG6 B;  3Q8C A;  2J22 A;  3TN9 1;  4Y5T A;  3R0R A;  4P5Y A;  2XHN A;  1L7Q A;  4AVT A;  2Y8K A;  4DXT A;  5JMC A;  4RR3 C;  4XZU G;  1QHD A;  3WVJ A;  4N7I A;  5CKN A;  1QIQ A;  1WBF A;  4Q8K A;  5FLJ A;  1PGL 1;  1MVQ A;  4Y20 B;  5CIS A;  5A70 A;  3ZKU A;  1S0B A;  3AVR A;  2YU2 A;  2GNT A;  4P9I A;  2AEN A;  2ADD A;  1HRI 1;  3KV4 A;  1WCU A;  2VQ0 A;  3OOX A;  5FYV A;  4ET7 A;  3BAL A;  2VPV A;  3O1U A;  3WW1 A;  4P14 A;  4PBP A;  3VB9 A;  1VBD 3;  3L9J T;  4CDX C;  2C1F A;  4NII A;  5FK7 A;  1LHW A;  2ARE A;  3MW3 A;  1K5M B;  4GAZ A;  4WZC A;  1ZZ9 A;  1BLZ A;  1RC6 A;  3JD7 2;  2YB7 A;  4Z8B A;  2FCV A;  1NA1 B;  4CCN A;  1CJD A;  1XND A;  2VOX A;  2W94 A;  1Q43 A;  1L3J A;  1DLL A;  1EAH 2;  2RR1 2;  2X53 S;  4J25 A;  4Z2W A;  3SQO A;  4EZ4 A;  1W06 A;  1I1E A;  4AED A;  5A3N A;  1AYM 1;  3WW3 A;  5FDB A;  1SG3 A;  2WT2 A;  2BNO A;  1HV1 A;  4IE4 A;  5ERL A;  3UET A;  5J7M A;  1U5Y A;  3NJZ A;  3DPR A;  3NVC A;  4TWT A;  1VBC 1;  2RS1 1;  3VKM A;  3WQ7 A;  3ZMN A;  3GJA A;  3AJZ A;  1ENS A;  2ID4 A;  2J1S A;  2ZGQ A;  5FUN A;  3KLS A;  4RS5 C;  3N3H A;  1E57 A;  3MI8 A;  5DUV A;  1QJE A;  2B7Y A;  1VPH A;  4D7T A;  1GP5 A;  2OA2 A;  1C57 A;  3M3C A;  3OCP A;  4MH0 E;  3POB A;  3VD7 A;  3ZSJ A;  4CEY A;  3GZE A;  4Y1U A;  1LAJ A;  3ACG A;  3HNM A;  5C5U A;  3AKT A;  4RN5 A;  3FZ3 A;  2B8M A;  5FKC A;  1NKG A;  1RUG 2;  4GWJ A;  4YGE A;  1F15 A;  2WZ8 A;  1PK6 B;  4BA6 A;  1WW5 A;  1V6M A;  4PI2 A;  4BQ3 A;  1UL9 A;  4GH4 B;  1CZT A;  3ZXK A;  3N9P A;  1O59 A;  3W5M A;  4V1P A;  2YC4 A;  4XBN A;  1PM7 A;  3PVO A;  5IFT A;  5A3O A;  1G8W A;  3J7N A;  4HET A;  4XF3 A;  2A3W A;  2V5D A; 
#chains in the Genus database with same CATH homology
 1JZ8 A;  1OH4 A;  1CIY A;  1W9W A;  2QQO A;  4QX2 A;  1L7R A;  2XOM A;  4DXS A;  1EUU A;  1WCQ A;  1EUT A;  4UAP A;  1JI6 A;  1H6Y A;  5C70 A;  3VDC A;  1GU3 A;  2WUH A;  2VC9 A;  3WQB A;  3VD5 A;  5A1A A;  4DEQ A;  1GMM A;  3CDZ B;  4A45 A;  3HNY M;  2JKX A;  4QB1 A;  1UZ0 A;  1JZ6 A;  4CU6 A;  2VZQ A;  2J7M A;  2E32 A;  2EIC A;  2E26 A;  4KWU A;  4PT6 A;  2R7E B;  2VZV A;  3K4Z A;  3CMG A;  3GXU A;  1HN1 A;  4LPL A;  3T08 A;  3T2O A;  2X05 A;  1JYN A;  3D3A A;  4M4R A;  1GUI A;  3C7E A;  4MGQ A;  3OGV A;  4M4P A;  2RV9 A;  2J1E A;  1W0N A;  1JZ2 A;  2JDA A;  4MGS A;  2VZP A;  3K77 A;  4XUT A;  1R64 A;  2C9K A;  2VZS A;  3LPG A;  2ZEW A;  3T0B A;  3DYM A;  2VR4 A;  2EIB A;  5G04 L;  4MO3 M;  2B4K A;  1XNA A;  3OEB A;  3WNM A;  4PQQ A;  3OGR A;  4ZZ5 A;  3E1F 1;  4JKL A;  3T0D A;  4QAW A;  1F4A A;  1T2X A;  3I97 A;  3OBA A;  3III A;  2VCC A;  4FI9 A;  2Y6G A;  3WNO A;  1UXZ A;  4IUG A;  1F4H A;  2W1W A;  1JU4 A;  4JKK A;  5F7U A;  4W4Z A;  4GZ9 A;  4JHZ A;  2YC2 A;  2CDP A;  1UYZ A;  5DN2 A;  1ULO A;  3BN6 A;  3LE0 A;  3JXS A;  4D8M A;  3LEI A;  1PMH X;  2QQM A;  3VDA A;  3I2H A;  1RYY A;  2VCB A;  3A23 A;  5DQ0 A;  4Z2A A;  2BER A;  2VO5 A;  1BHG A;  4XUO A;  2X09 A;  2RVA A;  3HPN A;  3UNP A;  4KMQ A;  3WF0 A;  4UOJ A;  3FL7 A;  5EJ1 B;  1DYO A;  3I2I A;  2VJX A;  2KD7 A;  3ABZ A;  5IJR A;  3CZU A;  2PQS A;  3C7H A;  4AAX A;  2ZEZ A;  2RJ2 A;  2E31 A;  5J1X A;  4OZO A;  2VM9 A;  2HLE A;  3UES A;  3J7H A;  4P02 B;  4KI5 M;  4ZY9 A;  4CU7 A;  1XNT A;  1GNY A;  2V4V A;  3I2F A;  3EYP A;  1WKY A;  5CYY A;  1GOG A;  3HNB M;  1JZ5 A;  3GGL A;  3CKH A;  2WO1 A;  1MPX A;  4QDQ A;  5LA1 A;  4XUN A;  1K42 A;  2VL4 A;  3IB3 A;  2J1R A;  4A44 A;  2WDB A;  2Y64 A;  3I2G A;  3OB8 A;  1O8P A;  1PX4 A;  1UY3 A;  1UY2 A;  5JXI A;  3CIH A;  3IDA A;  4QB2 A;  2CDO A;  2BZD A;  2WZE A;  3VD3 A;  3MUZ 1;  5CZK A;  1ULP A;  3I3D A;  1XPW A;  3MV1 1;  3PUI A;  4JX0 A;  3WF3 A;  2Z4F A;  4QDS A;  5C71 A;  2B9V A;  4DUX A;  2W95 A;  3OGS A;  5JXG A;  1K12 A;  2YFU A;  1UX7 A;  3GDB A;  4W8J A;  5B4N A;  3NJX A;  2VZ3 A;  4DUW A;  1DLC A;  3SEP A;  2VCA A;  1UY0 A;  2W87 A;  2WN2 A;  5LA2 A;  5HPO A;  2ORZ A;  4P00 B;  3VDB A;  4LHS A;  3W5N A;  2VZO A;  2WBK A;  1UYX A;  2WAA A;  3LQC A;  3VD4 A;  4BK4 A;  3NQH A;  4ARX A;  2W9X A;  2ZXQ A;  4A41 A;  3T2Q A;  2VME A;  2J1U A;  3FHQ A;  5EIY B;  2Y6J A;  2Y6L A;  1JYV A;  3U37 A;  2WAB A;  5G05 L;  3WF1 A;  1OF3 A;  2J1T A;  1UMI A;  2WO3 A;  5IYY A;  4OYU A;  1GOF A;  4GWI A;  3ECQ A;  2VZT A;  4L0P A;  2OKX A;  2J1A A;  4ARY A;  2VZ1 A;  5JR2 A;  4QPW A;  4XVH A;  4XUR A;  1W9T A;  2VMC A;  4BJ0 A;  3FHA A;  3ETP A;  1UWW A;  2VQT A;  3NJV A;  3CZJ A;  4DEV A;  5JUV A;  4LKS A;  2JE8 A;  1TVG A;  1US3 A;  2W47 A;  1SHW B;  3IAQ A;  3A21 A;  1NX9 A;  3T0A A;  4CUB A;  4CUC A;  3NRU A;  1YQ2 A;  1W99 A;  2VTF A;  3P1I A;  3T2P A;  2QQL A;  1W9S A;  2VMF A;  3WSO A;  1JYW A;  4BK5 A;  2Y6H A;  3WNP A;  5LA0 A;  3LPF A;  1H6X A;  2C4X A;  1DP0 A;  3HJR A;  5IHR A;  4OUE A;  4TTG A;  2XQX A;  1TG7 A;  3A22 A;  5DPN A;  1JYX A;  5C7G A;  3EB7 A;  2WO2 A;  3ACH A;  1PMJ X;  4QX3 A;  2QQJ A;  3P6B A;  3SKJ E;  4A42 A;  3CQO A;  1PX3 A;  4DXR A;  1UMH A;  4RYD A;  1KEX A;  3C8X A;  5EJZ B;  3DYP A;  2BGO A;  3A7Q A;  4LQR A;  2VZU A;  3ACF A;  4OMD A;  3T09 A;  3C7F A;  3GM8 A;  2QQI A;  1JZ7 A;  4E8C A;  4CU8 A;  3PUH A;  2VZR A;  2XON A;  1GQP A;  3THC A;  1I5P A;  2ORX A;  3I2K A;  5I0D A;  2VQU A;  1OF4 A;  1XC6 A;  2WN3 A;  5B4X A;  4XUP A;  4PF1 A;  1O8S A;  5FUI A;  1CX1 A;  3K46 A;  3MUY 1;  4MOA A;  3MBW A;  2DCK A;  4QX0 A;  2YFZ A;  3IAP A;  1UY4 A;  3SKV A;  2BGP A;  1K45 A;  1OD3 A;  2QBX A;  2Y6K A;  3ACI A;  4CVU A;  3LEK A;  4A6O A;  5HXM A;  3THD A;  4QB6 A;  4W50 A;  1JU3 A;  4YPJ A;  3OEA A;  4ZXE A;  4E8D A;  1K3I A;  2DCJ A;  3HOB A;  2J1V A;  3I2J A;  2YG0 A;  5JXJ A;  1NUK A;  1IQD C;  2W1Q A;  3I3B A;  4AG4 A;  1US2 A;  1KGY A;  2EIE A;  3WNL A;  4A3Z A;  3WNN A;  2X10 A;  2DDU A;  3DEC A;  3LEG A;  3MO4 A;  3K4D A;  2VOT A;  4UI9 L;  4D0Q A;  4OMC A;  1JZ4 A;  2WAO A;  1J83 A;  4QX1 A;  1CZS A;  2LS6 A;  4BXS V;  4TXW A;  2L9L A;  5JMO A;  3ZM8 A;  2W1S A;  3K4A A;  2BBA A;  3VD9 A;  3C7O A;  4DUV A;  1D7P M;  2JD9 A;  1OT5 A;  2EID A;  4MAD A;  2W91 A;  2C26 A;  4HG6 B;  2J22 A;  2W92 A;  4P5Y A;  1LNS A;  2XHN A;  1L7Q A;  4DXT A;  2Y8K A;  5JXH A;  3K75 B;  4XZU G;  3I3E A;  3WEZ A;  5IFP A;  5LCW L;  1GOH A;  2QQN A;  1JHJ A;  2W1U A;  4ET7 A;  3FN9 A;  2E33 A;  2W3J A;  2QQK A;  2ZEX A;  3HEI A;  1W8O A;  2LW8 A;  3F2Z A;  3WF2 A;  4A4A A;  2YB7 A;  2VMD A;  1UY1 A;  2W94 A;  4XUQ A;  4P08 A;  2WYS A;  3C7G A;  1NAE A;  4CU9 A;  4CUA A;  1SG3 A;  3UET A;  3BGA A;  1JZ3 A;  2W46 A;  2WQ8 A;  3WNK A;  2ID4 A;  2J1S A;  1W8N A;  3WF4 A;  2V72 A;  3OG2 A;  3SEE A;  1UYY A;  5DMY A;  3MV0 1;  3VD7 A;  4JKM A;  3ACG A;  3HNM A;  1CZV A;  4RN5 A;  2W5F A;  1NKG A;  4GWJ A;  2WZ8 A;  2ZEY A;  3NNG A;  4QDR A;  3HN3 A;  3AC0 A;  1CZT A;  1SDD B;  1UXX X;  1O59 A;  3W5M A;  2YC4 A;  1P8J A;  5IFT A;  1J84 A;  4ZZ8 A;  4BDV B;  2HYX A;  3DYO A;  2V5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...