1UYXA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellobiose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate binding module
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uyxA00
1JZ4A 2BZDA 2Y64A 1UXXX 2W9XA 4A41A 2W94A 2J7MA 1UMHA 3PUHA 1T2XA 2VZPA 4JKKA 3OB8A 3I2IA 2B9VA 3OG2A 3C7OA 5HXMA 1IQDC 2RJ2A 2ZXQA 4A6OA 1K3IA 1JU4A 2WAAA 1PMJX 1PMHX 3K75B 3C7EA 2E31A 2VL4A 2ORXA 3K4ZA 2BERA 5G05L 4OYUA 2J1EA 3CZUA 2Y6HA 4BXSV 2W1QA 4W8JA 5G04L 1UYYA 1ULOA 5JXJA 1TG7A 2YG0A 2VQTA 1JZ5A 5JMOA 3FHQA 3VD4A 2C9KA 5B4XA 5I0DA 2VQUA 3VD7A 2CDPA 1XC6A 2W46A 5EJZB 3LEKA 5F7UA 3IIIA 1J84A 2ZEXA 3NJVA 2ID4A 5LA0A 1GU3A 3T09A 2V72A 5C71A 3WNLA 4ARXA 3DECA 2XOMA 3BN6A 4CVUA 3ABZA 1MPXA 3IDAA 2ZEZA 1EUTA 1PX4A 3HNMA 5LCWL 3K4AA 4JX0A 3UESA 3WEZA 4JKMA 2VR4A 3ACFA 4XUPA 3VD3A 3T0BA 2CDOA 2WZ8A 3CZJA 5JR2A 1JZ2A 3GGLA 3DYPA 4XURA 4CU8A 2RV9A 2VZVA 3IAPA 1GQPA 2YC4A 1JZ7A 2WZEA 3P1IA 1HN1A 1JYWA 2LS6A 3ACGA 2WO3A 4D0QA 3EYPA 4P08A 3HNBM 1WCQA 2VCAA 4ARYA 4QPWA 3VD5A 3ZM8A 3MUZ1 4MO3M 3T0AA 4QDQA 3WF2A 5JXHA 3MV01 3WSOA 2XHNA 1F4AA 2VZRA 5IHRA 2VOTA 2VZ1A 3ECQA 3NJXA 3C7FA 1JZ3A 3IB3A 3FL7A 1SDDB 1TVGA 4XVHA 2WYSA 2ZEYA 3DYOA 5DQ0A 3WNMA 5DPNA 3T08A 1UYZA 3VDAA 3WNKA 2Y6KA 2W91A 2W3JA 5C70A 2VZ3A 4MADA 2WDBA 4XUOA 1GOGA 3A21A 3FN9A 4UAPA 3SEPA 3WNOA 1O59A 4ET7A 1W9SA 2BBAA 4L0PA 4QX1A 4AAXA 2XONA 2J1AA 4KWUA 3IAQA 4LHSA 3LEIA 4BK4A 4GWIA 2WN3A 5IJRA 4A4AA 5LA1A 4UOJA 1H6XA 3C7HA 2WBKA 2E32A 4GZ9A 2E26A 2XQXA 4DEQA 3C8XA 3WF0A 4DXRA 1UWWA 3I2HA 3OGSA 1JHJA 1GOFA 5JUVA 4M4PA 2YB7A 3JXSA 3HNYM 3I2FA 1KGYA 1UX7A 2J1VA 1GOHA 4QB1A 2KD7A 4QX2A 4M4RA 2VJXA 4W50A 3CIHA 2VMDA 4MGSA 2W1SA 3U37A 1UY3A 2DCJA 4ZZ5A 3LPFA 3DYMA 4UI9L 4OMDA 2VZOA 1R64A 4XUTA 3MUY1 4JKLA 1PX3A 2VO5A 2DDUA 2J1TA 2YC2A 1XPWA 2JDAA 5HPOA 3CDZB 3SKVA 1CZVA 2Y6JA 3AC0A 2Z4FA 4E8CA 1XNTA 2R7EB 4OZOA 5DMYA 2WO2A 3NQHA 3GXUA 1W9TA 4QB6A 3HOBA 2VC9A 2WUHA 1JYXA 3T2QA 3MO4A 2QQOA 4CUCA 2VZQA 1CIYA 4LPLA 1ULPA 2W1UA 2BGOA 4QAWA 1DLCA 4RYDA 3LE0A 1H6YA 2V4VA 2W92A 3UNPA 1UMIA 1KEXA 3T2OA 5LA2A 4P5YA 1XNAA 4LQRA 3I3BA 3BGAA 2Y6GA 3K77A 4XUNA 4QDRA 2OKXA 4CUAA 3I3EA 1WKYA 4MGQA 5CYYA 4E8DA 2RVAA 1SHWB 1O8PA 1CX1A 3HJRA 3WF4A 2VZSA 4DUXA 3LEGA 1OT5A 1UZ0A 4XUQA 4CUBA 3I97A 1GMMA 2EICA 1GUIA 2X05A 4CU7A 3THDA 3HN3A 3C7GA 4KMQA 4DEVA 3CQOA 3VDBA 2Y6LA 3WNPA 3FHAA 1UYXA 2W95A 2HLEA 5EJ1B 3A23A 3VDCA 5C7GA 3MBWA 2JD9A 2EIBA 2X10A 1JU3A 2QQIA 3MV11 4A42A 4QX3A 4MOAA 3I2JA 2B4KA 3PUIA 2WO1A 2WABA 5B4NA 4OMCA 1SG3A 3SEEA 1JZ6A 3ACIA 1UXZA 2EIEA 4BK5A 1P8JA 4A44A 2VCBA 1YQ2A 4DXTA 4ZZ8A 1OD3A 2JE8A 2X09A 3NRUA 3J7HA 4Z2AA 1NX9A 2QQMA 1RYYA 1NKGA 3OEBA 2QQNA 3OEAA 1CZTA 2YFUA 3E1F1 3LQCA 2VZTA 3THCA 3K4DA 3I2GA 4PT6A 4JHZA 2QQKA 2V5DA 4LKSA 4RN5A 1JZ8A 4QX0A 3WF1A 5DN2A 4A3ZA 4HG6B 5IYYA 2J22A 3OGVA 1UY1A 1K42A 2VCCA 1DYOA 3GDBA 4QB2A 2ORZA 3LPGA 1CZSA 2YFZA 2JKXA 1US2A 1NAEA 3W5MA 5J1XA 1US3A 2W1WA 3OBAA 3UETA 1K45A 2J1UA 2Y8KA 3A7QA 2WN2A 4ZY9A 3ACHA 4BDVB 1J83A 1W0NA 3SKJE 1UY0A 3I3DA 4YPJA 1OH4A 1D7PM 1O8SA 2L9LA 3T0DA 1NUKA 3K46A 4TTGA 3WNNA 3GM8A 4CU9A 1UY2A 2WQ8A 2QBXA 4OUEA 5IFTA 3NNGA 2J1SA 4DUVA 1W8NA 3WF3A 3T2PA 2BGPA 1W9WA 4PF1A 1W8OA 3D3AA 4AG4A 4IUGA 2HYXA 2ZEWA 2VTFA 1JYVA 1LNSA 4ZXEA 2QQLA 2QQJA 4QDSA 4KI5M 1OF4A 4FI9A 5EIYB 2EIDA 2C4XA 2W5FA 4CU6A 1DP0A 2WAOA 1BHGA 5JXGA 4DUWA 3EB7A 4P02B 2J1RA 2VZUA 1OF3A 3A22A 2VMEA 4P00B 3HPNA 2LW8A 5CZKA 1GNYA 1L7QA 2VM9A 5JXIA 2DCKA 2VMFA 3OGRA 1K12A 4BJ0A 5A1AA 1JYNA 3CKHA 2E33A 3F2ZA 1JI6A 2W47A 3HEIA 3W5NA 4A45A 3ETPA 2C26A 4DXSA 5IFPA 3P6BA 4GWJA 1I5PA 5FUIA 3VD9A 1F4HA 2PQSA 1W99A 1L7RA 4W4ZA 2W87A 3CMGA 4D8MA 3I2KA 3WQBA 1UY4A 4TXWA 4XZUG 2VMCA 4PQQA 1EUUA
chains in the Genus database with same CATH superfamily
1C8NA 1ZBE3 2RR11 1KRIA 1JZ4A 2ENRA 2BZDA 5HCFA 5FMOS 3DN7A 4Q4V1 3ON7A 2J7MA 1UMHA 1WMEA 1H30A 2RE9A 3M2MA 5DXDA 2Q8OA 2BJSA 4MXWA 4CA9A 2HWE1 4K9SA 5A7PA 1ZBE1 2R30A 4HZFA 3ZR6A 3L2YA 4EJRA 5HXMA 4YW7A 4EN9B 2PAMA 3LF7A 3MIFA 4NPRA 3DPRA 4DB5A 2CV6A 2G4IA 2WNUB 5BNPC 1HB1A 1BXHA 3TNPB 1LCLA 3NAPA 3WUCA 3QH7A 2NMOA 2WO7A 4OQ8A 2VL4A 3BTZA 4AHWA 1CAXA 1SCSA 2AYHA 2X5IB 2ADDA 3K4ZA 4AQTA 4Z1VA 4LHNA 3CZUA 2WNVA 1WZXA 5A7QA 5KC6A 2JDYA 1YFWA 1VB4A 1ULOA 2ZX3A 5DUUA 5F1RA 4FXKB 4Y1XA 1AJOA 5JXJA 2UYBA 2VQTA 5L36A 5ANQA 2PFWA 3VD4A 3RWKX 3ZYFA 4NJ4A 5B4XA 3HQRA 1QJFA 3IDBB 5FLIA 2O14A 5I0DA 1OUSA 1S1AA 2VQUA 3G7DA 2QQWA 4CPBA 4YZ3A 5EJZB 1L7LA 5DZEA 4URTA 4H55A 1D2SA 4V2WA 3W21A 4CEYB 3AMMA 1SBDA 2V73A 4Q29A 1ULFA 4HFSA 4YVSA 3T09A 5LA0A 4LA3A 3AMHA 1UOGA 4E27A 1IPJA 4TSVA 4MGZE 3SC7X 5BY5A 4CVUA 3CEWA 3ABZA 1MS3A 3PMEA 4QPYA 1GV9A 1BBT2 1TEIA 4A7YA 2TEPA 3HNMA 4XJ9A 4YWAA 4AOCA 5LCWL 3S6PA 1SLCA 3FBYA 5FK7A 1ZVFA 3AP5A 3BTXA 3K4AA 4JX0A 4DY5A 3KVAA 3NWKA 5HBAA 4B8EA 2VR4A 3TNQA 1O3RA 2W52A 3WG3A 4AI9A 3ACFA 4Y20B 4QKNA 2ZA9A 3OGGA 2D6OX 3THTA 2WZ8A 5A6YA 1RINA 3VKOA 3WOGA 1X82A 2HH9A 3ENRA 3ZFGB 2EVXA 4AF9A 2A1XA 1OA2A 3DYPA 4XURA 5BPXA 1BZWA 5ANNA 3J26N 3S7IA 2NZ9A 3RWNA 3IBMA 1IZ3A 4RR3B 2YC4A 2WL1A 3PUSA 3FFQA 3D6EA 5I8TA 4LIUA 1NQDA 1DFQA 1JZ7A 1W28A 1GR3A 1HN1A 1XNKA 3VL8A 1Q5OA 3ACGA 2WO3A 1V70A 2W0XA 1LOEA 1WCQA 1QJX3 3AMPA 4X6QB 4YW4A 4KWJA 1VLNA 3INAA 4ZU5A 2A73B 5IUQA 3ZM8A 3MZHA 1ULDA 1GP4A 3KT7A 4FPGA 5A7NA 1UZYA 2JE7A 4IEYA 2FMYA 3WF2A 1W2OA 3MV01 4HOOA 5EQUA 3AKRA 3MHZA 5A1FA 1QJX1 3K3NA 3BTAA 5K0UC 4Y4RA 4DFSA 5IHRA 1YIPA 4U2AA 2ZZJA 4LEJA 1IGOA 2VMIA 3I3QA 5FBJA 3M70A 2WYSA 2X5IA 3VZJA 5C8WA 5IT6A 2ZGQA 4Q1RA 1Z78A 5DPNA 5FO7B 2QDRA 3T08A 1PGW2 3ZDVA 1AR73 1QIQA 4L99A 4XTMA 5M0TA 1MEC2 1UPIA 1IOAA 2BFUL 4K6BA 4GXLA 2RS52 3B7MA 3M3OA 3WNKA 4AFCA 2DVGA 2RS11 2W3JA 3FLTA 4R4ZA 1AR71 3OY8B 3VKNA 4OHWA 3WG2A 1O3SA 4QGMA 2VZ3A 2XVLA 3NNMA 1ALYA 2P1BA 1REEA 4XUOA 1GOGA 5FREA 3TN93 1NZCA 1R083 2C6SA 3A21A 1X33A 1NA1C 1PZ7A 3FN9A 4UAPA 1ZA7A 3V65A 3WNOA 3ZXFA 3D5OA 5FZAA 4AZZA 1J59A 1HXS3 2R062 4XEZA 4ZS2A 2XONA 4CEYA 4XFAA 2DV9A 5FJKA 3LEIA 4LLOA 3TN91 1R081 1KJRA 2QZ2A 1AX2A 2WN3A 2ZGNA 3TB0A 3ZFFC 4A4AA 4EN8B 5LA1A 1YCIA 1HXS1 4R52A 3KVBA 1PIV3 1LKNA 1W2UA 2XGXA 3POIA 4NVPA 4OVEA 2WNEA 4QPIC 1R1A3 2WBKA 2IC1A 5FKBA 1COV2 2Z79A 1B09A 4GZ9A 5C6CA 1J3QA 3V56A 2WINB 2H6BA 1TNRA 2VXRA 5FP3A 1PIV1 2OS2A 4NN0A 5HI0A 1NCQC 4ZU7A 1J3PA 1R1A1 2ZHLA 3DPRC 2VGDA 3I2HA 5LW9A 3DV8A 1A8DA 1JHJA 1RUG3 4GH4B 5J3UA 4PDWB 3N35A 3R4DB 4Q2FA 2YB7A 4MG2A 1JYTA 3ZFGA 3JXSA 3NNFA 4LJHA 2K2SA 5A3MA 1UX7A 3UK9A 3WW2A 5KHIA 4E2GA 2KD7A 4LLFA 1RUG1 2HWC3 4MHUA 2UWBA 4QX2A 1W3VA 1RJ7A 1ZZ9A 2VMDA 3TEWA 2W1SA 5F6KA 4TYSA 3LPFA 5JZGB 4AI1A 4K3UA 4XJ8A 5DZGA 3DYMA 3O14A 4BIFA 4OMDA 4JGZC 1Z7S3 2HWC1 1RUC2 2RMU3 3MUY1 3M1HA 4A7KA 1M06G 1BQPA 2DU1A 5FZBA 4I30A 4Q5OA 4NROA 1PX3A 4UXAA 4XDPA 2RDSA 1O91A 1OHFA 3CHXA 1C5HA 3VBHB 3W20A 2VO5A 5HCHA 1LGCA 3O1UA 4H14A 1KJLA 1Z7S1 4AEJA 1H8TC 4YVSC 1FNYA 3ZFEB 2PLV2 5J98B 2JDUA 4UFLA 1CZVA 2KR2A 2QZ3A 4XBQA 1G9BA 3JQXA 4K8FA 2WKKA 3UGFA 1XNTA 3BYWA 5C5TA 1V6MA 5C3QA 2Q1ZB 2R7EB 1WBFA 1UU6A 4M0HA 4CCCA 4KG8A 1PNGA 2WO2A 1NCRB 3NQHA 1W9TA 2HWF3 5T5PA 4F3JA 2JD4A 5FBZA 3WP6A 4QX5A 4FQ4A 4CXWA 5AC93 3RDIA 1ENQA 2MEV3 5JOYA 4AEMA 1V0AA 5FY8A 2JDPA 1QJU2 1OOPC 5E1RA 1T6GC 5FRAA 1Q8PA 2VZQA 5CAZA 2FQPA 2HWF1 5AC91 4XFFA 4GKXA 3MFCA 2JG8C 2HYKA 2B9UA 5FMCA 2C5DA 4LPLA 5CBLA 2FCTA 2MEV1 4IEVA 1MQTA 5C4WC 1BEV3 2CL2A 4FSJA 5A32B 4QD2A 1UW8A 1H6YA 1HJGA 1WLWA 3TEZA 2CU5A 5FY7A 4LXLA 4XFGA 4JZRA 4XIKA 1YEWA 3RGBA 4CXXA 1KEXA 1ZBA2 2BFUS 3VN4A 3T2OA 3ZIXA 4ATEA 5LB6A 2G9ZA 1BEV1 3IT8A 1QH7A 1XNAA 1QQP3 3VBOC 4XW3A 3IM0A 3WW3A 2VQ0A 3AZVA 4BM8A 4Y22A 2WFF2 5F5QA 5CG8A 4IW3A 2ZMNA 4GJZA 5LEJA 5FXZA 1ZZ7A 4DPNA 2D3RA 4AW7A 1SBEA 1ZZ8A 4CUAA 3B93A 1DQ1A 4MGQA 5A3WA 4XFCA 4XHXA 1QQP1 5IVYA 2XPJA 2WNUC 1JYCA 1NQJA 3HJRA 2YHJA 1S0CA 1LOFA 4PDWA 4FPCA 3EQEA 2D98A 2X5IC 1UZ0A 3LEGA 3FHIB 1LGBA 1O4TA 4FOYA 1UMZA 4EN6B 5A3TA 4MHRA 1KS5A 5L9VA 2GNBA 3UT0A 3IZOA 3WDYA 4CU7A 3THDA 5F2WA 3FLPA 5FPVA 5FUNA 1QY4A 2NLRA 1W6NA 2OPWA 3U78A 4OUSA 1GANA 2QFEA 3ZYGA 3BIEA 1RUI3 5AVAA 1EP0A 3GYDA 3MBWA 4UW5A 2CY6A 2EIBA 3BUCA 1VBB3 1JU3A 2ILMA 4OI2A 1QNYA 4AVBA 1QF3A 4AHYA 5A6XA 2PXJA 4BISA 3VKLA 5JOXA 4NO4A 1VR3A 1UL9A 1RUI1 3EJKA 3I2JA 3LA3A 1EYBA 2WQ4A 2MHFA 2WABA 1RXGA 1DGWA 1VBB1 1S0DA 2DUPA 3PU3A 2ZBJA 2VTXA 4WZFA 3ZFEA 5B4NA 1O6UA 3B02A 3SEEA 2ZS6B 3ACIA 1G7YA 3OYWB 2EIEA 2GNMA 5F3EA 1MS1A 4PIZA 4BK5A 4GB33 5F5CA 4MGTA 4HT1T 1YQ2A 1NCRA 4RQPB 5DZFA 1DG6A 4IESA 4ZZ8A 1OD3A 5GJ6A 1A8MA 2JE8A 2CGPA 3JBG3 2GP3A 1EV11 2QQMA 4GB31 5I8SA 1C57A 1OMIA 3MEPA 1RYYA 1QEXA 4QQOA 2EAAA 2QQNA 3ZFGC 3JD72 3DXTA 3ACLA 4YGEA 3E1F1 3JBG1 3LQCA 3OOXA 4BLJA 4EROA 3GCXA 2X8KA 2XR4A 3K48A 4RR3C 2VZTA 2WZR1 5GLTA 2BWCA 3EXUA 1OLQA 3K4DA 4NE9A 3I2GA 1VBC2 2ZX2A 2GMEA 2YPJA 4BU2A 4B4RA 2D6NA 1NE6A 1E5SA 5KBFA 2QQKA 3VKFC 2V5DA 3ZX7A 3I4IA 4LKSA 4RN5A 1JZ8A 4QX0A 2Q1MA 3CNAA 1W6PB 3SH4A 5DN2A 2VULA 1Y4WA 4A3ZA 1W6OB 2F6BA 2YBPA 2RDQA 2J22A 1D0HA 1I9RA 1UY1A 5LY1A 4LIVA 2RR12 2HWB3 3IPVB 3GDBA 4H3WA 5EP9A 5GLZA 4QQ2A 2NQYA 4Q4V2 1E5RA 2GN7A 3WNXA 3LPGA 3GALA 3PVBB 4XCBA 1US2A 1W3XA 2HWE2 1O7FA 2P3JA 4HPKB 3VZNA 4Y1YA 1ZBE2 2HWB1 1ST8A 3HT1A 2ZJCA 2W1WA 1G9AA 3RFRA 4LBJA 1K45A 3CJIA 3R4SA 1E57A 2WN2A 4W6YA 2XJQA 1JTZX 2QNKA 3ACHA 1URXA 2ZHKA 3AYAA 3ES1A 1H0BA 1W8TA 3MYXA 3OJBA 3ZMNA 2BVBA 4FBFA 3ZYHA 4XFBA 2JIGA 1BK0A 1UY0A 3I3DA 3MF6A 3KGLA 3USUB 2VCMA 2XMLA 4P9WA 2PHLA 3N7MA 1PVC3 3BVCA 1O8SA 2IXJA 5AVPA 4QX7A 2WNOA 3AP9A 1W05A 1NUKA 3T0DA 3WY6A 4KBBA 3GM8A 5FZDA 3T3YA 3LA2A 3E6BA 4RSUA 4RS5B 1PVC1 2WQ8A 1OBNA 1AR93 2D6PA 3JB4C 2P2KA 3L2HA 3OYWA 4YW6A 1F8VA 4FT8A 3IMNA 2XB6C 1HV0A 1W8ZA 3THPA 4CRQA 4LO5B 4A3XA 1ZZ6A 1F31A 1RMU3 3D3AA 1Q8SA 1AR91 4CDUC 4EWEA 3AKQA 1JYVA 2Z5WA 4OULA 3VDDA 1X9TA 3NO8A 4K40A 4ZXEA 4HBNA 5FXWA 2QQJA 3MLLA 5HCBA 4BMBA 3U75A 4FI9A 4GH4C 5EIYB 5LK5A 1RMU1 2JIJA 5T55A 5K8SA 1IKPA 2WAOA 4UF0A 1XNDA 5FP9A 3KM5A 5FPLA 4DZGA 2J42A 3ZO0B 3EB7A 4P02B 2ZHNA 3AXEA 5KXEA 1YIFA 3A22A 5I8YA 4COWA 2VMEA 4P00B 1JUIA 4FTBA 3BTYA 2VM9A 4BLIA 5JZGC 3LIGA 3IN9A 3VV1A 3Q8EA 1WCDJ 1GQGA 3KQ4B 1K12A 1XQNA 2YZ4A 1JYNA 3R4UA 3MFAA 2E33A 1NG0A 5ISLA 1X8MA 1XSRA 1IS5A 1WW7A 1SLLA 3ETPA 3VBHC 2C26A 3IPVA 5IFPA 1LJ7A 3P6BA 3ST7A 4XYXA 1GICA 1XJAA 4JRAA 5FUIA 3J4UH 5F3IA 2YXSA 4HPKA 2CYFA 1W99A 2BTVC 1SPPB 3AP7A 3JQWA 4AVAA 3PTRB 4CDXB 4HXCA 5BYNA 1QJX2 2WFPA 3VZLA 3NJYA 2I2SA 4L11A 4Z8BA 5CKNA 1NCRC 3T30A 4RGGA 1MS0A 4XZUG 4DMIA 5KWRA 5FPXA 1NY71 1EUUA 4O65A 2EXJA 2IFRA 2UURA 1O3QA 2Y60A 4UFIA 4L2NA 2W9XA 4NAMA 2W94A 4A41A 2C0ZA 4MYEA 4QWNA 3ZR5A 3ZIWA 4JKKA 1A6CA 1F35A 4YVWB 2RS12 3O1OA 4N8MA 4W6WA 2ZZQA 1AR72 1HV1A 5CKQA 2O0OA 1H4HA 1X9PA 3FUOA 4JTOA 4FFGA 4A6OA 4Y4YA 3T4HB 3RZLA 1JU4A 2VUCA 3AKPA 3EO6A 5FYSA 2JKBA 4H7LA 3K75B 4Q0PA 5F37A 4KGGA 1LAJA 1FMD3 4LO4B 1WCUA 1NXD1 5G05L 4WM8A 5L19A 4CXYA 3AXDA 4N7UA 3WP4A 2YV8A 3TN92 1R082 4XACA 1KFUL 2TUNA 5C3PA 1FMD1 4Y1ZA 1HXS2 5FPUA 1ODMA 4G3YC 1V6JA 1TG7A 1VMJA 2D6MA 1IS6A 2XQRA 5J96B 1OC1A 1ASJ3 1MACA 1RUJ3 3FHQA 4K1ZA 1UYPA 5A33B 5FCCA 1QXPA 3MI8A 3RZGA 5L73A 1N1YA 1PIV2 1XC6A 3ZKUA 2JWPA 3UJOA 1BJQA 3WG4A 2QUOA 1ZRCA 1R1A2 3KLSA 3IIIA 1LHNA 1RUJ1 3POYA 4GIQA 4AEKA 1J84A 1N3QA 2PHFA 4PQQA 3NJVA 2G9GA 2VUDA 4CDWB 4LKEA 1NLRA 1YJLA 5FY9A 2K0GA 4B7KA 5IK4A 4Y24A 3ZPYA 3VHRA 4BQ5A 3LFMA 3K3OA 5FXXA 4FPKA 3AM2A 2XOMA 2R043 4QXHA 1POQA 4JHTA 2ZMKA 5F2SA 2GC3A 5ERLA 3IDAA 1RUG2 1WCSA 3WV6A 5D8AA 2YU1A 1LOAA 2D93A 2R041 2UU8A 4ES9A 3BIWE 3ZSKA 4CCMA 3UESA 4JKMA 5LATA 2HWC2 5F8PA 3UJQA 4EYUA 2ERFA 3NAPB 3NMBA 5C3RA 1HRI3 1XNCA 4XUPA 2WWJA 5JOZA 4CDXA 1NE4A 2Q4SA 3ITQA 3LDRA 2E7AA 1JZ2A 2XLAA 2JG9B 2BBVA 4DXZA 5HV0A 1Z7S2 3NKTA 3H8XA 2RV9A 5FMDA 2VZVA 3VBOB 4RQPC 3IAPA 1GQPA 1HRI1 5BNOA 4IE7A 3AZXA 4JQTA 4I0BA 2TNFA 1W06A 4SLIA 3P1IA 1CX4A 3EYPA 3URFA 5FZ1A 5T50A 3U07A 4XQWA 3PJQA 2Y26A 2Y34A 1NZIA 3O0WA 2FZ1A 4MO3M 4QPGA 5J36A 4QDQA 1SLBA 5JXHA 3Q9OA 5H9RA 1JODA 1RIRA 4XAAA 5DG1A 4CTEA 2BV4A 3CO2A 2VZRA 1SFNA 3AP6A 2HWF2 2I74A 5AC92 3HWJA 3CJXA 2VZ1A 5FLJA 3ECQA 3ZVXA 4L9BA 3S7EA 2RS33 3BODA 3C7FA 3POFA 4LBQD 3PJYA 3ZXGA 3UKTA 2MEV2 3WCSA 3FL7A 1NLSA 1SDDB 1W8WA 4RHV3 5FR3A 5DQ0A 1LECA 4E4HA 1WMDA 5FZCA 4YGCA 1G9FA 3O0VA 5FDBA 2P3YA 2RS31 3QACA 5FYHA 5FLHA 4GJYA 2AR6A 5FUPA 4XCAA 2QDNA 4K20A 1BEV2 5CKMA 2HEWF 1YQCA 4RHV1 4IEXA 5FYUA 2BVVA 2W91A 3PHMA 2YU2A 2QVSB 4MGYE 4JVAA 5A33A 2A5ZA 1XE8A 5A7SA 1ACCA 2WDBA 3D82A 3B3QE 1RVF3 4BYYA 2HWD3 2OYZA 1QQP2 3SEPA 2WS93 4RL7A 2W68A 1HRV3 3MDPA 4XC9A 4ET7A 5FZIA 4CDWA 1UOJA 4EN7B 2UWCA 4KWUA 3IAQA 1VAKA 2D6KA 4BK4A 3WINE 1RVF1 2HWD1 5CFDA 1UAIA 5DABA 2WS91 3PVNA 1HRV1 4BPZA 4I01A 4X6RB 1QXRA 2VVDA 4C91A 1QDCA 1HW5A 2CWMA 2KXLA 3VBFA 2HBTA 2E32A 4AEDC 2DYCA 2ES3A 4COZA 5GZGA 5JDBA 2F4PA 4YRDA 1S0IA 2WA4A 1I5ZA 3MW2A 2BOJA 5EYYA 5FZFA 1LU2A 4AVSA 2W2IA 3SCGA 4CCDA 4QGNA 4DEQA 1UZZA 4RS5C 4GMP3 4AI2A 4SBVA 3WF0A 4O61A 4NHMA 1IPKA 2YROA 3OGSA 4YG0A 4HKLA 4BHPA 1LESA 1GOFA 2JEMA 4M4PA 4BWOA 3Q8BA 4AQ6A 1W9FA 2WWSA 4XFHA 2AEZA 2JG9A 3HNYM 1RUI2 3A0NA 3I2FA 4FOQA 3JB8A 4GMP1 2EAKA 4XFIA 5FP4A 4QB1A 5GM0A 1VBB2 1AL0G 2WA3A 4Q8KA 1NYWA 2XLGA 1HQWA 2H0VA 1JXNA 3CIHA 4MGSA 4WM7A 1YNAA 2VECA 3ZN4A 2DCJA 2ZMLA 2WZPP 4ZZ5A 1YFUA 4R9DA 4QXKA 3WDXA 2OW4A 2IFWA 2AENA 4EV0A 4XUTA 3N3HA 4CSWA 4EWAA 2VOWA 3GJBA 3BU0A 1EV12 4GB32 4UFKA 1G8WA 2VOVA 4LULA 3P3PA 1V9U3 2BQPA 5F32A 4FPEA 1XRUA 3FE5A 1W03A 1AHSA 5FZKA 3ZXLA 1XPWA 1POV3 4OHXA 4ASMB 4COYA 1JYIA 5ACA3 2EF6A 3JBG2 3SKVA 3JCIA 1OUXA 3AC0A 1W04A 1O5UA 4O9GA 2WZR2 1V9U1 1CPMA 1CPNA 2DVAA 2G9FA 4MH0E 4OZOA 4QX8A 5DMYA 1POV1 1W6QA 1QMJA 1VRH3 4AFBA 5ACA1 2ZGPA 2VC9A 2OIIA 3WP5A 1H2MA 1MR5A 3KCYA 4YYOA 4CEWB 1V6LA 2N7GA 1QOOA 2ET7A 3KQRA 3T2QA 2GNTA 4LBMA 1HIXA 4CUCA 1VRH1 4NHLA 5CISA 1REDA 1SACA 3ETQA 3VZMA 2PHRA 1QJY3 1J3RA 5JLVA 4UW6A 2BGOA 2TBVA 3B01A 5A3PA 3Q8CA 4N9IA 4Q8LA 1DLCA 1D2QA 2G1MA 2BW8A 5KXDA 2BOIA 2V4VA 5GLUA 4WVWA 3WHTA 2JXAA 2HWB2 4XBNA 1DQ2A 1PZ8A 1QJZA 2GZWA 4Y26A 5EJ3A 1QJY1 3UNPA 3DGTA 3KV9A 1PK6B 4P9GA 1FI2A 1DQ5A 3UYJA 4B4PA 4QXBA 4YARA 4TN7A 1VAMA 5L7OB 4UBHA 4LQRA 2PN5A 3ZSJA 3BGAA 2BU9A 1V00A 4N53A 5JI9A 2Y6GA 3K77A 4YVWC 3MIGA 1S0GA 4K8RB 4R4XA 4EE2A 5IVVA 1HX6A 5CYYA 1DYPA 4YGBA 2RVAA 3AKTA 1IPSA 4S2DA 4X8NA 3SCFA 5C3SA 5FYCA 2BNOA 3KS7A 1EPZA 4YM2A 1QH6A 1OT5A 1NOVA 2ZGLA 3RZKA 3T4VA 3I97A 1VP6A 5IVCA 4HLTA 1GMMA 3GNEA 1PVC2 4V1PA 5KXCA 3E5QA 1GUIA 4X8PA 3HN3A 1SDWA 3C7GA 4DEVA 4ISRA 4AVCA 1QOSA 1RGSA 1MS9A 2XG3A 2PHXA 4COVA 1Q3EA 1A3KA 1VALA 4NMIA 3PVOA 2HLEA 1EY2A 1AVBA 5FY5A 3JUUA 2B5HA 3J8F3 1X8EA 3L9JT 5EJ1B 3V64A 3VDCA 1AR92 2JD9A 2VY0A 2XHKA 3TEXA 3ZYBA 1SQ4A 5T5JA 1BCXA 5A1LA 5FZMA 1ND3B 1MQTB 5A3NA 5GKAC 2QQIA 3MV11 2AACA 2DUQA 2ZX4A 5C33A 4JGYA 1BK1A 1MS8A 3HBKA 3LGRA 4QX3A 3KB5A 5FYBA 4CDWC 5CVRA 3V0BA 3J8F1 4AYUA 1RMU2 4Q4Y3 2B4KA 2RM23 1S0EA 3CL1A 3DKQA 3PUIA 4JDOA 2ZGMA 3N9LA 5FIXA 1UN1A 5SV8A 5C9AC 5JWPA 4OMCA 5GZDA 3KT1A 3ZN5A 5FP8A 4INDA 1ZZCA 2F17A 4Y22B 4Q4Y1 2RM21 3S30A 1TME3 2XL7A 2VCBA 1TMF3 1RUF3 1NLQA 1YLLA 3C3VA 4YZ1A 4DO0A 4EZHA 3AZYA 4DXTA 1PZ9A 5H9QA 3ZOIA 2GMPA 4HKOA 2X09A 4CEWA 1S0FA 1XU1A 4NPLA 3WQ0A 4F7ZA 4Z2AA 3HN1A 1TME1 1UU5A 2I45A 1YRZA 1F5JA 2MPFA 1TMF1 1RUF1 3NAPC 3WDWA 3FJSA 4N90A 5FYYA 1PO13 5FPAA 4NIHA 1ZM1A 4FVVA 3RYRA 3FC0A 2WNVC 4XPVA 5F5IA 2BWAA 4ITCA 1JN2P 4QHBA 1RUD3 1LHUA 3RRDA 3OTFA 5DAQA 2D5FA 3WVJA 1MS5A 1PO11 4LO7A 1ZRDA 1H2LA 1W6NB 1Y9QA 1SLIA 3J7NA 3MLJA 5E16A 1OFNA 1PK6A 1G9CA 1UKGA 3WHUA 4AVTA 1K5MA 1RUD1 1SLAA 3LKJA 5L7OA 4JHZA 1AR63 1AYM3 3P3NA 2AH2A 1MZFA 2DFCA 2WLQA 3H9AA 4XJWA 5H9SA 2PAKA 2FDKA 4R8HA 1BKZA 3DF0A 1V6KA 4AGGA 3OGVA 1AR83 1NY72 2NN8A 2YBSA 1PGL1 1AR61 1AYM1 1ENSA 2RMU1 2XVKA 3PU8A 4NHKA 4NOTA 4QB2A 4XBLA 3U11A 4NUBA 5KHHA 2W39A 2BPA2 1AR81 4OLLA 1US3A 1GZTA 3WZ1A 1FXZA 2D6LX 2ZGUA 1JW6A 4D7TA 1I1EA 2NPIA 4HN1A 4KWLA 4UFHA 1G9DA 4DINB 3AYDA 1QOTA 3ZYRA 1W2TA 5LEKA 2GC1A 1PGSA 3LIHA 1VIWB 3B69A 4OFGA 5FYVA 4CPBD 4JRLA 4P9LA 3N9MA 5JPNB 1LR5A 4Q26A 4HVOA 4XZPA 3H3UA 4LE4A 1SFPA 5LASA 3ZXJA 2NYYA 3LB9A 1CQ9A 1CAVA 3ZN6A 2Z69A 2H6CA 3MGUA 1JOBA 1XYPA 4FXGB 1D7PM 1FMD2 1ND3A 3TYJA 1I3HA 4AXOA 3AZZA 4FAGA 5C8CB 4FP3A 1MS4A 1XU2A 3MPBA 1QKQA 3K46A 5EFUA 3WNNA 4TTGA 4ISQA 5HV4A 2VVEA 1FAYA 3FFZA 1S55A 3ASIA 1GNHA 5D21A 3N7KA 5F3GA 1QGLA 1N3OA 2QBXA 4BXFA 4OUEA 5FO9B 3PIJA 4XXAA 3RG0A 4DS0A 3NNGA 2ZGKA 2AUYA 2J1SA 3HIFA 1RUJ2 3NV2A 1PMIA 3I54A 3H3LA 4IGOA 2BGPA 4AQSA 1W8OA 2DCYA 2R32A 1EAH3 1NXMA 4QMAA 5FJHA 1DGWX 2VTFA 3GF6A 1SCRA 5DDJ3 4V2VA 2QQLA 2P6HA 2GDFA 4KI5M 2HBUA 1DZQA 1OF4A 5FPZA 2EIDA 2W5FA 1LEMA 3BU7A 4UFMA 1GLHA 1S2EA 4FPYA 2IXHA 4HK8A 4YLZA 1YQ8A 1YFXA 2R042 2WT1A 5DDJ1 3CJIB 4QU1A 5FZEA 4DUWA 4XQ4A 2OZJA 2YY1A 2J1RA 1WUVA 2R073 2GH2A 4LK6A 3OUIA 5FOBB 4XF4A 4E2QA 1IG3A 1L7QA 3I49A 4OUMA 4CCKA 3JU9A 1AJKA 2ARXA 1JH5A 4LR4A 3OGRA 2R071 4BJ0A 4HMZA 4WV8A 3LDKA 3SLIA 2ZTNA 1HRI2 4NWVA 3EMRA 3F2ZA 1DIWA 1LRHA 4YW2A 4LT5A 2W47A 4A45A 4CEYC 2BRTA 4DXSA 1ZYBA 3MIEA 3KCXA 1OKOA 1SBFA 5FZ0A 4D7YA 3RJ2X 3QOPA 4Q4X3 1VB2A 5AFBA 4GWJA 2ARAA 4S2FA 4ONUA 3R6SA 4J6GA 1VMHA 3E6DA 4NIGA 2WWUA 2EIGA 1W39A 1APNA 2PQSA 2WT2A 4PHZA 2XJSA 2ADEA 3K2OA 4LHKA 4L92A 3OF1A 4QXCA 2W87A 2EALA 4LORA 4Q4X1 1ZREA 2RJKA 2VBDA 1UKRA 3O1RA 4D8MA 3I2KA 1RTVA 1V6IA 3QH6A 4KH9A 4XJAA 3VDDB 4OHYA 4ZONA 4TXWA 5SV5A 1H9WA 2BEOA 2P34A 3BPZA 1HKDA 5FYTA 4JQRA 4UF0B 2RS32 2Y64A 3OCPA 3AMQA 1UXXX 1Z0HA 3VBSA 1QXJA 5EPAA 4RHV2 2DWRA 5E89A 1T2XA 2DTYA 3K51A 5C8CA 2JDZA 3OB8A 3I2IA 1H1AA 3H50A 1IQDC 5FYIA 5E88A 1S0BA 1HB2A 1ND2B 2ZXQA 3PURA 3GHNA 3VKMA 1K3IA 3OD4A 4QM8A 2OQ6A 1C4RA 2JB8A 4AFAA 1PK6C 1PMJX 4AQ2A 1RL3A 3Q8AA 1PMHX 2IXCA 5GLVA 1Q8VA 5L7OC 4E4SA 2DBIA 4CP0A 2Y33A 4AHXA 1GZWB 5F3CA 4HKWA 2B8MA 4MVTA 4FAHA 4Z92B 2IXKA 2K9ZA 4OYUA 4R9BA 5LBFA 2C24A 2J1EA 5FZ6A 5A7WA 1UF2C 3ALQA 2OT7A 4IXLA 5DAXA 2VNGA 1RVF2 5IK7A 2HWD2 4BXSV 3VGIA 2WS92 1HRV2 4MX3A 4D3WA 2Y38A 3HAGA 1SZBA 4OHVA 4DY3A 3I7DA 4H7MA 4D94A 2YG0A 2ZACA 1ENXA 1F9KA 4P9JA 1JZ5A 4NIDA 4LITA 1EPWA 2C9KA 2XL9A 1DQ4A 2R0FA 4D7SA 3B00A 2JDNA 2YGLA 4XMAA 3KSCA 3LOIA 2CDPA 3SITA 2EXHA 1AL23 3RI9A 3KHBA 3MPPG 4DRRA 3LEKA 1QHDA 1GZ9A 2GU9A 3KMHA 5F7UA 1VJ2A 2Q1FA 4G9SB 2ZEXA 1G6NA 4U36A 2XWBB 2ID4A 3UGGA 1PO23 1H2NA 2IXLA 3U0ZA 3VBRA 2DVFA 1WLTA 2V72A 5C71A 1AL21 1CESA 5LBEA 3FBMA 4ARXA 1U12A 3DECA 4IV1B 5FY4A 2P4EA 3B9IA 1DGLA 1PO21 2A75A 2OXBA 2ZEZA 1ND3C 1MQTC 4MGKE 3I2DA 4FP2A 1DF0A 1B35B 2D43A 3AX4A 3ME2A 4QQHA 3T2TA 3EHKA 4YW3A 1ENRA 1VBA3 1L3JA 4FPOB 3WQ1A 2YMZA 3GZAA 2ZX0A 5I0RA 5FOJB 2Q8CA 1GKBA 3N36A 3OPWA 2CDOA 1VBA1 3T0BA 5A3OA 3VD3A 4R9AA 4WM8B 3ZPOA 3NNJA 1TZOA 1UOBA 1CIWA 2CGOA 4XJZA 4D6RA 3SQOA 1N3PA 4CU8A 3POSA 2JB4A 1V6NA 5FYMA 4QT6A 2AREA 4IL7A 5BNNB 4XHBA 1DQ0A 1V9U2 4D0QA 5J37A 1LOFC 2FDFA 4P08A 2ATFA 4PDWC 3VBUA 2RDNA 3KHCA 4TLFA 5CB7A 4ARYA 4NHYA 2IVIB 5ACA2 2ARBA 1DBNA 3DXUA 3MUZ1 1OFSA 2QQVA 2R063 2O1QA 4AFMA 2VTXJ 4OCTA 4LOSA 5LA9A 3WSOA 2R0HA 2XHNA 1ND2A 3VB9A 1CAWA 1QWRA 4LBQA 1VRH2 3ES4A 1GBGA 3WW4A 2C9AA 2PQQA 1TNFA 2VOTA 5E6HA 5JVVA 2QQPA 2FDIA 4CP1A 4BZ4A 4ZU4A 1H9PA 2Y0IA 2XDVA 1DGRA 3TRSB 1TVGA 2VW2A 4HK9A 1GZWA 2HKXA 2ZEYA 3DYOA 3B9CA 4JV4A 5F5AA 4OI1A 5D8AB 3PDQA 2Q5TA 1IKQA 1GP5A 4AAPA 3W58A 3RZJA 1UYZA 5FV3A 2UWAA 4E4DX 1QJY2 1BLZA 3PUAA 4LBNA 4D69A 3HMYA 2Y6KA 3ZFEC 4PI2A 2AC1A 2VH9A 1WLDA 4CZSA 2ZAHA 5C70A 3ILFA 4MADA 3O1TA 4XF1A 1E5IA 2WSVA 5CFCA 1WW6A 3KV6A 3ZXAC 4XMIA 1AX0A 1O59A 3UGHA 5BNOB 1V6OA 2A3YA 4LHSA 4FFIA 3RZZA 1CR7A 4ATFA 1GWKA 3I8TA 1C1FA 1Q8OA 4BIOA 5I0SA 4Y3OA 4GWIA 5IJRA 5A3UA 4UOJA 1H6XA 1Q8QA 1W6MA 2SLIA 4IV1A 1PVXA 3S5AA 3POBA 2R1DA 1BVVA 4A2UA 4QPGB 1UZVA 5I0TA 1IQAA 1B35A 2P6CA 2D97A 1PM4A 1CN1A 2GP5A 2HEYF 4LTAA 5GZFA 2VOXA 4META 4N7IA 1XE7A 3C8XA 2JDHA 4PF5A 1UWWA 3OPTA 4P5HA 3U10A 1XNBA 5KHJA 2VG9A 3SH3A 1RUE3 4JC1A 1DZTA 3J8F2 3O1MA 2BGCA 2ZABA 1KGYA 1IHMA 3DL3A 2J1VA 1GOHA 4P9YA 3DKWA 2XJTA 4C0BA 1RUE1 2UYAA 4YM0A 5FZLA 5BNNA 4K21A 2R49A 2VJXA 3H8RA 3X29B 5KC5A 1UY3A 3RS6A 4KGQA 4Q4Y2 5BNPA 2RM22 4P9IA 3UKVA 3ZXKA 3AVRA 1R64A 2ZOEB 3CJIC 2F4LA 3ZYIB 3ORJA 4I3PA 3RI8A 4JKLA 2X53S 1ASJ1 2UY8A 2VD7A 3ROUA 1TME2 1TMF2 1RUF2 4QHOA 3WLUA 4YFZA 4HL0A 3TAYA 2XJVA 4WVVA 5CFDB 3NV1A 4C0HA 4C1XA 4Q0SA 3HT2A 4DQAA 5HPOA 3G6JB 4LK7A 1PHMA 4CCLA 2Y6JA 2Q8DA 4GWMA 4LO8A 4E8CA 3VBFB 3RMYA 2ZKNA 3IKWA 1PO12 1ULEA 5T3NA 4QB6A 1VAVA 2B7YA 4XILA 5IW0A 4OQ9A 1RUD2 3NW4A 1AXYA 3J7LA 1LULA 4EWDA 1W9YA 2WUHA 4AFDA 5CADA 1CVNA 3O12A 1JYXA 4YFWA 2GSYA 3WQ7A 3MO4A 3UV9A 4PCRA 3ZFFB 1W2AX 2ZX1A 4KNCA 3WDVA 1RUH3 4BH9A 3H8OA 1CIYA 1PGL2 1AR62 1AYM2 1MVQA 2RMU2 4QPIB 3ZDSA 5J09A 3OD0A 2E6VA 1YC61 4IEZA 5IVBA 1U5ZA 1FPN3 4BQ1A 4RYDA 1ZX5A 1Y3TA 3T1LA 3VDDC 3LE0A 1RUNA 1BMV1 1RUH1 1AR82 5KXBA 4WM7B 1O4ZA 1NCQB 4WBBA 5KR7A 3E97A 5LA2A 1CJPA 1A78A 1FPN1 4P5YA 2HJIA 5FWJA 3I3BA 3S0MA 3I2OA 4XUNA 4BOWA 3PMSA 2OQ7A 3S5QA 3V0AA 2OKXA 1LHWA 5F39A 1NT0A 1SEFA 1WKYA 2FDJA 2DCTA 1KQRA 1PNFA 4ZPIA 2PELA 5DAVA 4UWDA 3OSDA 1O8PA 1GSLA 2Z42A 3WF4A 2VZSA 1RXFA 2XBO3 4RFT0 1CONA 4BQYA 1PM7A 3AZWA 4XUQA 5EHDA 3TWIA 4AGVA 4CUBA 5JPMB 3FWEA 3VLBB 1W6QB 1CAUA 3N9OA 3ZSMA 5A70A 2A6XA 2X05A 2XBO1 4IGPA 4KMQA 3CQOA 1N1SA 3BALA 3PVEA 2Y6LA 1XB9A 2X29A 3O5SA 3WDTA 3FHAA 1W8UA 5K0UA 2W95A 1KD7A 1WWYA 3DUIA 4M0NA 5FZOA 2PHWA 3BB6A 3U1XA 4RGAA 4L97A 2VXJA 3WUDA 2JDMA 2X10A 4JTNA 4A42A 1KXGA 4DOUA 4RA0A 3LD8A 4MOAA 5HXVA 1VMFA 4WVZA 5T54A 1JBCA 1ZNPA 2JECA 3AYCA 4TWTA 5DDJ2 1SG3A 1LOBA 4Y1UA 4IV1C 1VBD3 3TOJA 1JZ6A 2ZPXA 4BQ4A 5DUXA 2V5YA 4N53B 2XKOA 4HSJA 1O4YA 1QDOA 1UU4A 1P8JA 4M3CE 4XQDA 1YUDA 2BNMA 4A44A 1NA1A 3VHOA 2PA7A 4Q4W3 3WR0A 1VBD1 4W6XA 3SCHA 4IEQA 3O0XA 4ES8A 2R072 2BUKA 1VPHA 3J7HA 3OBZA 1NX9A 3AB0A 3H1MA 3LSDA 2XVGA 4LKFA 4MUVA 4XIOA 5EZWA 5A80A 3SMHA 3UKNA 3VHNA 3ZFFA 3O1SA 1XSQA 2WSUA 1NKGA 4Q4W1 2FHRA 4WM8C 1HDKA 1CZTA 4UFJA 4QPIA 5A6ZA 1H1IA 3VZKA 3J7MA 4XOGA 2BNNA 1YQ6A 4GAZA 4M3CB 5BNNC 4WVMA 1NCQA 1N47A 3LEMA 4PT6A 1REFA 2DCZA 1IS4A 1H4GA 2ZGRA 4Q4X2 3MW4A 5JCTA 2O8OA 5K9YA 3UL2A 4IE6A 2G19A 5B2GB 3WF1A 1TQ5A 2PHDA 4XF3A 2IUWA 4MSVA 4KU8A 3AMNA 2QQUA 4JGYB 3RPQA 5FKCA 3GBWA 4K7JA 4PLNA 3V0BB 3VZOA 1OKQA 1Q43A 1K42A 1YI7A 1DYOA 4P9XA 4IEPA 3BI3A 2JX9A 2GC2A 4PIYA 2OVUA 1DDLA 1LOGA 1CZSA 2YFZA 4P14A 1NAEA 3M4FA 1WMFA 1T6BX 1DHKB 5D8AC 3OBAA 2NMNA 4JGZA 3WD5A 4QHZA 3UETA 2D40A 4UBGA 4IV3B 2J1UA 1O3TA 2Y8KA 2DVDA 3A7QA 2YBKA 2RG4A 3U4XA 2WYFA 5L9BA 2RDRA 3MW3A 4CCJA 4HVQA 2CTVA 3LDBA 2VMGA 4PI0A 1LU1A 2CHHA 4HVRA 4PBPA 3E5UA 1H8TA 4BDVB 5IVJA 1J83A 1W0NA 1YWKA 3QD6A 1RHI3 4O9EA 2ZGOA 3KF3A 5IAVA 4BQ2A 4CDXC 4LO6B 3WCRA 2B42B 1OH4A 4YM1A 5K4LA 4IEUA 5F9TA 1A34A 5EXOA 2L9LA 4IERA 1TE1B 3TBDA 5BNOC 1JOPA 3RVHA 1LENA 1RHI1 5JIAA 4I0AA 1FATA 2ARCA 1OD5A 5FAXA 1MVEA 1H8VA 4CU9A 5JAXA 1J1TA 4YW1A 1K5MB 5FY0A 3RNSA 3AVSA 1OOPA 4YZ4A 3T1MA 3SNMA 4QPGC 1W8NA 3WF3A 5ABJB 3T2PA 2JG8A 3FX3A 1W9WA 4LBLA 5EWSA 4JAAA 1S2KA 5D2AA 5C4WA 2ZEWA 1AL22 1YYNA 1GP6A 1W2NA 1AX1A 5FMBA 4BB3A 4J25A 4IEOA 1YI9A 3O7OA 2QKDA 5I0UA 4QDSA 3KCCA 1PO22 4GMP0 2JDKA 4L8QA 2CWSA 4QQLA 4C8DA 3BCWA 1DP0A 1BHGA 1SFYA 3AL6A 3RJRA 5JXGA 3KF5A 3EBRA 4TLGA 3O1VA 3VBOA 3JZVA 1UNBA 3MIBA 3IMMA 2B46X 1OF3A 2VBBA 1UPSA 3HPNA 5CZKA 4M3CA 4Z2WA 4LE3A 1QNWA 1F5FA 1VBA2 3BOPA 2R6QA 2DCKA 1X7NA 4XDQA 2K46A 4OZXA 2WNUA 2VMFA 3PIGA 2O8QA 1CAVB 3KD4A 3MF9A 4KWKA 4XAEA 2VMHA 3ZN6B 4IE4A 1OXCA 5A1AA 2CAUA 1CJDA 3NV3A 4IETA 3CKHA 3APBA 2QTWB 4UT5A 4KBZA 1J58A 2DF7A 3AK0A 4AR2A 2RS13 1JI6A 3HEIA 5A6QA 3W5NA 3E5XA 4OHZA 1YXWA 4S2HA 5FYZA 1I6XA 1WA4A 2QE3A 1FOD3 4Q0VA 1IG0A 1U0AA 1RC6A 3MICA 3OGJA 4FOWA 2Y0OA 4MV2A 5D1IA 3WG1A 2A6YA 4B4QA 5CFDC 5DAPA 4AK3A 3VD9A 1POV0 2D7FA 1F4HA 2IVJA 5CG9A 2Q0AA 1L7RA 2GN3A 2D44A 3LCPA 2WR9A 3O1PA 3VBFC 1XE0A 4Q0UA 4CUGA 1FOD1 5IK8A 4D6SA 1STMA 4IV3A 2E51A 1E5HA 4QU2A 3WQBA 4I02A 1UY4A 2Z2SB 2OUJA 2UY9A 4FOVA 4FO9A 3BOWA 2PHUA 1FV3A 5H9PA 3H42B 4HETA 2EXIA 2VNRA 5JI7A 2JG9C 1H2KA 3PUHA 3FZ3A 2VZPA 3GCWA 4LHLA 5E8AA 2B9VA 3OG2A 3C7OA 1HQLA 2RJ2A 2CGNA 3ZMOA 5I93A 5APAA 5I91A 4WM7C 4AGRA 5DUVA 4A6SA 2A71A 2P3IA 1Q56A 2FCUA 3OBRA 4HANA 4MGIE 2WAAA 4XF9A 5BXXA 4Y20A 3C7EA 1D4VB 2D5HA 2E31A 2ORXA 5ABJA 2BERA 3AJZA 4QQPA 2D3PA 2LALA 2SBAA 3HR9A 2XJRA 4XDOA 1JHNA 3HQUA 2Y6HA 5FZ4A 1C8M3 2FMDA 2W1QA 4RFRB 5JSPA 1SLTA 1D4M3 4W8JA 4RR3A 5G04L 1UYYA 5FQ0B 1OI6A 1YHFA 2V09A 5DAWA 1S4CA 3GZTB 2ZGTA 1KS4A 5JMOA 3VUOA 2DU0A 2A70A 1C8M1 1O5LA 1WCKA 1D4M1 3IDCB 4AWDA 3W9AA 3NVCA 3VD7A 2H0BA 3RZMA 2CSGA 2W46A 5CEHA 5JSRA 4DRVA 2ZHMA 4LKDA 2BDRA 1QJEA 1R093 4DNYA 1OQ1A 2PTMA 3POEA 3SH5A 2IXIA 4CCOA 4OI0A 1AYN3 3IWZA 1YO8A 5BV6A 4FQZA 1GU3A 2GALA 2DBNA 4B3NA 1WD4A 5GZEA 3N4MA 2PMWB 3WNLA 1VBE3 4E4ZA 1R091 2B45X 3VBSB 3BN6A 4FPFA 1MPXA 1ZRRA 1RUE2 1AYN1 5F6LB 1EUTA 2ET1A 1PX4A 1UZWA 5EV7A 1UCXA 4CDQB 1VBE1 2E53A 1OA4A 3R0RA 1U5IA 3H7YA 1D0GA 3WEZA 1GQHA 3D8CA 3MIHA 5L9RA 2YC0A 1ASJ2 1R1ZA 2YGMA 3OY8A 4XETA 4N53C 3CZJA 5JR2A 3ZLIA 3GGLA 4FPJA 5A7WB 3FUQA 4I3GA 2C1FA 4AI3A 2WRAA 3D0JA 1ZRFA 1M4WA 2VQAA 3POGA 4KL1A 5FZGA 4ZHNA 1JOJA 2WZEA 4I2OA 3W59A 2XWJB 3DCQA 3LWCA 4PBOA 4AI0A 2LS6A 2VUAA 1Y7BA 5IAXA 1JYWA 3HNBM 1EAH1 3IDEA 1WGPA 1JUHA 3CLPA 1JMUB 2VCAA 4C90A 1RITA 4QPWA 3VD5A 1WW4A 1YQ5A 2ZAAA 2ZGSA 1QU0A 1AUYA 2A7AA 2VVFA 4H2AA 3T0AA 2GAUA 4FFFA 1X50A 4Z07A 1J1LA 3PNAA 1F4AA 3SHRA 3VBRB 4A7ZA 5FO8B 3VHPA 2FCVA 3NJXA 1OURA 1JZ3A 3IB3A 3U14A 5JSOA 1FV2A 1UD1A 3ZXEA 4GH4A 2KA3A 2XH6A 4XVHA 3LSEA 2RHPA 3WNMA 3D4KA 2B39A 1BMV2 1RUH2 5FK8A 4JGYC 1OLME 5IVEA 3NV4A 3VDAA 1W8FA 1W0PA 3OPZA 5FQ0A 1UQXA 3AJYA 1FPN2 4J1XA 4BQWA 1VRBA 5FWEA 4CE8A 5FXVA 2YDEA 1DYKA 5JZGA 3M8LA 4MXVA 2E7QA 1YFYA 3ZYJB 2ETEA 4JCKA 4LUKA 1HQNA 4QKBA 5TSWA 4IV3C 3ZSEA 4BQXA 4ASLA 4MLOA 1KFXL 3HD8B 1W9SA 1RB8G 1OQEA 2BBAA 2DFBA 3MLKA 4L0PA 4QX1A 4GALA 2J1AA 4AAXA 3VBHA 4CEWC 4BA6A 5LBBA 4IQPA 3A0KA 4IGQA 1ZRIA 4XXPA 3VBUB 4F83A 3C7HA 3KV4A 4M01A 2LROA 3H3ZA 3AYEA 1FNZA 3TEYA 4FTSA 4LBKA 1WA6X 2XBO2 4B1LA 1UIJA 1EV13 2E26A 2KM2A 4CDQA 2PAEA 4N9HA 2XQXA 3LA7A 2DUOA 1CAWB 2GC0A 4GKYA 4LBQB 3NKGA 1F2NA 4N43B 1N1TA 4DXRA 1K5MC 1LGNA 5FFOC 1N1VA 4Y33A 3FLRA 2JJ6A 4Q27A 5JUVA 2WZR3 4AE2A 5CA6A 4NPMA 1BBT3 1BYHA 5ABJC 1C28A 3KGZA 3N9QA 5JOWA 1MZEA 1XBFA 2OPKA 3WP3A 2P5BA 3RMXA 3N7JA 1KDMA 4LMFA 3PLQA 5A32A 4M4RA 2XUMA 1BBT1 4LA2A 4W50A 3U37A 4NRMA 5DUWA 5IATA 1UIKA 3N9NA 3SISA 4UI9L 5CFCB 2VZOA 1WBLA 5IWFA 2FD8A 5J48A 1VBD2 5LRRA 3RSJA 3M3EA 4IEWA 5KHGA 1KITA 3ILRA 4E2SA 3RZHA 4K1YA 2FZ2A 4XJUA 3R05A 4Y5SA 4KU7A 4R9CA 2DDUA 5DG2A 2J1TA 2AEYA 3FMGA 4Q4W2 3GBGA 2YC2A 1WD3A 4GD4A 1HB3A 2JDAA 3I3MA 3CDZB 1X36A 1W6MB 2BP6A 3M3QA 4ORFA 3H1YA 1WLCA 1OLRA 3ZYPA 3E6CC 4YW5A 2Z4FA 4HSLA 1YJKA 1Y9GA 2GH8A 4GQ7A 4NWWA 4EQVA 4YM3A 5JIUA 3CF6E 4IE5A 1FYUA 1OPOA 2VPVA 3BKZA 2ZKLA 3GXUA 5FTTC 4FCAA 1GNZA 4JDMA 2D3SA 3HOBA 3WW1A 3GHMA 2OZ6A 3ZKYA 5JMCA 2Q30A 5C3OA 5FZ8A 1W90A 1MZ5A 4XE9A 2R16A 4W65A 3RYPA 4CDUB 5IVFA 4YSFA 2QQOA 3S57A 4URAA 1GYKA 4COUA 3GBFA 3N9PA 5FZHA 2BYVE 5JR7B 1ULPA 2XLFA 2W1UA 4QAWA 4AEDB 1MEC3 2NM1A 5EYXA 3I59B 2RS53 3D0SA 2GMMA 4ZS3A 1PGW1 3OBTA 1OLMA 2EXKA 5K7PA 2W92A 5BNPB 1UMIA 1OH3A 4CYDA 4BQ3A 1MEC1 3HVDA 1DCSA 2RS51 3AKSA 1XXNA 2A6ZA 2RJLA 5AFEA 4FPHA 3NNLA 2VNOA 4QDRA 3KWVA 1WW5A 2FDHA 1OVSA 4QKFA 5T52A 2XJPA 1ULCA 3LAGA 4RQPA 3I3EA 4Y1VA 4N43A 2CNAA 3C2UA 4E8DA 4HONA 1SHWB 5LZ6A 1CX1A 2OUHA 2R061 3CBNA 2P37A 1U5XA 4DUXA 1LOCA 1COV3 4EN0A 1RHI2 4CCEA 4OI4A 1DLLA 2EICA 4UW4A 1C1LA 1F15A 1K5JA 5GALA 1ULGA 4C1WA 1W0OA 2MNGA 3M7AA 1COV1 3VDBA 2XXZA 3WNPA 2FDGA 1U5YA 2NP0A 2WIIB 1UYXA 2PHTA 4NRPA 4CP9B 5BUVA 3POJA 3A23A 1C3HA 5C7GA 1GWLA 4KG0A 4KQ7A 1CWPA 2PYTA 2VBPA 4RD7A 4F8AA 1W6PA 4AI8A 1LHOA 1AXKA 1W6OA 1DQ6A 5IK5A 4NRQA 3RQ0A 1C5IA 4Q0QA 5J7MA 4Y5Z0 2WO1A 4LNVA 4Z82A 4GULA 2HEVF 1RUC3 3VBSC 1W8HA 1UXZA 1OQDA 4Y5TA 5GZCA 4MZUA 1Y9MA 5C8CC 4JDNA 1DZRA 2YUEA 3OUHA 3V0AB 5LRSA 4CDQC 1OA3A 1XOYA 3ZXDA 1RUC1 2IZWA 5BNQA 2PLV3 3NRUA 4PLMA 4NIIA 3HQXA 4CDUA 5FP7A 1OSGA 3H8UA 1LEDA 5FZ3A 4E9KA 2XJUA 4BMEA 2E63A 2VNVA 3OEBA 4DIQA 3OEAA 2A6WA 4QGLA 3USUA 3WDUA 2YFUA 2A3WA 5LBCA 2PLV1 4LBOA 2VAUA 1CAUB 4RGKA 1Y43B 4AEDA 3I59A 4AHZA 3HBZA 3NJZA 4QM9A 2WT0A 5C5UA 4PQ9A 3THCA 1VE0A 3LOBA 2E9QA 2QJVA 3Q8FA 2QCSB 5K0UB 1QJU3 5FY1A 3ELNA 3GJAA 1ZZBA 5FZOB 4RS5A 1FOD2 3N7LA 4YG6A 4NIAA 4I0WB 3DEMA 1HN0A 3PTYA 3KT4A 4AVVA 4HN0A 3CU7A 1QJU1 4WZCA 4HG6B 5IYYA 3H0OA 2OX0A 4YZ2A 2WJSA 3AFGA 2VCCA 5A3LA 1BVP1 4ZKTB 3VBRC 3IIAA 4TZDA 1ZBA3 3QBQA 2VW1A 2ORZA 2VU9A 3QCWA 1WMXA 3LFIA 5CIRA 2DTWA 5FMOL 5LK7B 3W5MA 2A3XA 2JKXA 4GWNA 2LRPA 2WFF3 4ZXKA 5T5OA 3J9SA 3P5BA 4ASKA 4BE3A 5J1XA 1LB2A 1ZBA1 1NA1B 4UYBA 5FZ7A 3U4SA 4BCUA 1CGPA 2DURA 4XTPA 4NAOA 3WT3A 4J1WA 4ZY9A 2FBEA 5CNAA 2WFF1 4O7XA 4S2GA 1H1MA 1LHVA 4B29A 4CP9A 4XF0A 5C9AB 3SKJE 1OPMA 5T5LA 4LUMA 5CU1A 4EZ4A 2VW0A 5FPBA 3VL9A 4YPJA 1RJ8A 3M3CA 4Q1PA 4MXWB 4FTEA 4XABA 1XYOA 1IS3A 3LZZA 3M3IA 5FZ9A 1HJFA 1UOFA 5HCAA 1MZ6A 2YYOA 1GZCA 2Q8EA 1ONAA 2GNDA 2R1BA 2AZ5A 1C8M2 4WVMB 1LODA 4NR1A 3WXPA 2DVBA 1D4M2 3DPRB 1UY2A 1LTEA 3USSA 3B94A 3VBUC 1DU3D 3MIDA 5IFTA 5KHKA 4YZ5A 1SPPA 4PJYA 1CAXB 4DUVA 1AF9A 3ZSLA 3KV5A 1G86A 4AL9A 1HB4A 4PF1A 1AZDA 2WNVB 1ND2C 4AG4A 4IUGA 1GFF2 2VE1A 2HYXA 4B1MA 3QLQA 4N43C 2JE9A 1UO9A 1R092 2JICA 2VOKA 1LNSA 3GZUC 1S0JA 2LTNA 3A4UA 1AYN2 4CU6A 2C4XA 1DGRN 1RUOA 2XUEA 1XYNA 4B7EA 2P17A 1VBE2 4JGZB 4PIXA 4NHXA 3H7JA 5LWBA 2CAVA 3AL5A 4YVWA 2VZUA 3AP4A 2JENA 4I09A 2EA7A 2LW8A 2WQZC 1AXZA 1KDKA 1GNYA 2WLPA 3H1WA 3PL0A 3B5LB 4FFHA 4G4FA 5GLWA 1H8TB 5JXIA 1JS9A 2I07B 4FPLA 4YG3A 4LOTA 4YVSB 2Y6FA 4IDZA 2P3KA 3JD73 2IWGB 2LM3A 2ZCWA 3POWA 5CFCC 1ODNA 3NSTA 3AFKA 2XKPA 2E7TA 4CCNA 2WC2A 1UX6A 3PUQA 4YNIA 3BPSA 1ZA4A 3OUJA 2A6VA 3F95A 2YPDA 2V4AA 1EAH2 1VBC3 3JD71 1S2BA 2VUJA 3ATGA 4CP2A 3WX5A 1FT9A 4GA9A 1I5PA 1HLCA 3SXWA 1CD3G 1OOPB 2LUWA 4QKDA 1FX5A 1SMVA 4W4ZA 1GWMA 1VBC1 2W08A 5A7OA 1B35C 2AGSA 2JG8B 2RR13 4D6QA 4UW3A 3ILNA 3CMGA 5C4WB 4PLOA 3GZEA 4Q4V3 1OVPA 5LY2A 3RYKA 2OA2A 3KZ4C 4M3CF 4YGDA 3NL1A 2VMCA 2HWE3 4M00A 4IE0A 5C9AA
chains in the Genus database with same CATH topology
1JZ4A 2BZDA 2Y64A 1UXXX 2W9XA 4A41A 2W94A 2J7MA 1UMHA 3PUHA 1T2XA 2VZPA 4JKKA 3OB8A 3I2IA 2B9VA 3OG2A 3C7OA 5HXMA 1IQDC 2RJ2A 2ZXQA 4A6OA 1K3IA 1JU4A 2WAAA 1PMJX 1PMHX 3K75B 3C7EA 2E31A 2VL4A 2ORXA 3K4ZA 2BERA 5G05L 4OYUA 2J1EA 3CZUA 2Y6HA 4BXSV 2W1QA 4W8JA 5G04L 1UYYA 1ULOA 5JXJA 1TG7A 2YG0A 2VQTA 1JZ5A 5JMOA 3FHQA 3VD4A 2C9KA 5B4XA 5I0DA 2VQUA 3VD7A 2CDPA 1XC6A 2W46A 5EJZB 3LEKA 5F7UA 3IIIA 1J84A 2ZEXA 3NJVA 2ID4A 5LA0A 1GU3A 3T09A 2V72A 5C71A 3WNLA 4ARXA 3DECA 2XOMA 3BN6A 4CVUA 3ABZA 1MPXA 3IDAA 2ZEZA 1EUTA 1PX4A 3HNMA 5LCWL 3K4AA 4JX0A 3UESA 3WEZA 4JKMA 2VR4A 3ACFA 4XUPA 3VD3A 3T0BA 2CDOA 2WZ8A 3CZJA 5JR2A 1JZ2A 3GGLA 3DYPA 4XURA 4CU8A 2RV9A 2VZVA 3IAPA 1GQPA 2YC4A 1JZ7A 2WZEA 3P1IA 1HN1A 1JYWA 2LS6A 3ACGA 2WO3A 4D0QA 3EYPA 4P08A 3HNBM 1WCQA 2VCAA 4ARYA 4QPWA 3VD5A 3ZM8A 3MUZ1 4MO3M 3T0AA 4QDQA 3WF2A 5JXHA 3MV01 3WSOA 2XHNA 1F4AA 2VZRA 5IHRA 2VOTA 2VZ1A 3ECQA 3NJXA 3C7FA 1JZ3A 3IB3A 3FL7A 1SDDB 1TVGA 4XVHA 2WYSA 2ZEYA 3DYOA 5DQ0A 3WNMA 5DPNA 3T08A 1UYZA 3VDAA 3WNKA 2Y6KA 2W91A 2W3JA 5C70A 2VZ3A 4MADA 2WDBA 4XUOA 1GOGA 3A21A 3FN9A 4UAPA 3SEPA 3WNOA 1O59A 4ET7A 1W9SA 2BBAA 4L0PA 4QX1A 4AAXA 2XONA 2J1AA 4KWUA 3IAQA 4LHSA 3LEIA 4BK4A 4GWIA 2WN3A 5IJRA 4A4AA 5LA1A 4UOJA 1H6XA 3C7HA 2WBKA 2E32A 4GZ9A 2E26A 2XQXA 4DEQA 3C8XA 3WF0A 4DXRA 1UWWA 3I2HA 3OGSA 1JHJA 1GOFA 5JUVA 4M4PA 2YB7A 3JXSA 3HNYM 3I2FA 1KGYA 1UX7A 2J1VA 1GOHA 4QB1A 2KD7A 4QX2A 4M4RA 2VJXA 4W50A 3CIHA 2VMDA 4MGSA 2W1SA 3U37A 1UY3A 2DCJA 4ZZ5A 3LPFA 3DYMA 4UI9L 4OMDA 2VZOA 1R64A 4XUTA 3MUY1 4JKLA 1PX3A 2VO5A 2DDUA 2J1TA 2YC2A 1XPWA 2JDAA 5HPOA 3CDZB 3SKVA 1CZVA 2Y6JA 3AC0A 2Z4FA 4E8CA 1XNTA 2R7EB 4OZOA 5DMYA 2WO2A 3NQHA 3GXUA 1W9TA 4QB6A 3HOBA 2VC9A 2WUHA 1JYXA 3T2QA 3MO4A 2QQOA 4CUCA 2VZQA 1CIYA 4LPLA 1ULPA 2W1UA 2BGOA 4QAWA 1DLCA 4RYDA 3LE0A 1H6YA 2V4VA 2W92A 3UNPA 1UMIA 1KEXA 3T2OA 5LA2A 4P5YA 1XNAA 4LQRA 3I3BA 3BGAA 2Y6GA 3K77A 4XUNA 4QDRA 2OKXA 4CUAA 3I3EA 1WKYA 4MGQA 5CYYA 4E8DA 2RVAA 1SHWB 1O8PA 1CX1A 3HJRA 3WF4A 2VZSA 4DUXA 3LEGA 1OT5A 1UZ0A 4XUQA 4CUBA 3I97A 1GMMA 2EICA 1GUIA 2X05A 4CU7A 3THDA 3HN3A 3C7GA 4KMQA 4DEVA 3CQOA 3VDBA 2Y6LA 3WNPA 3FHAA 1UYXA 2W95A 2HLEA 5EJ1B 3A23A 3VDCA 5C7GA 3MBWA 2JD9A 2EIBA 2X10A 1JU3A 2QQIA 3MV11 4A42A 4QX3A 4MOAA 3I2JA 2B4KA 3PUIA 2WO1A 2WABA 5B4NA 4OMCA 1SG3A 3SEEA 1JZ6A 3ACIA 1UXZA 2EIEA 4BK5A 1P8JA 4A44A 2VCBA 1YQ2A 4DXTA 4ZZ8A 1OD3A 2JE8A 2X09A 3NRUA 3J7HA 4Z2AA 1NX9A 2QQMA 1RYYA 1NKGA 3OEBA 2QQNA 3OEAA 1CZTA 2YFUA 3E1F1 3LQCA 2VZTA 3THCA 3K4DA 3I2GA 4PT6A 4JHZA 2QQKA 2V5DA 4LKSA 4RN5A 1JZ8A 4QX0A 3WF1A 5DN2A 4A3ZA 4HG6B 5IYYA 2J22A 3OGVA 1UY1A 1K42A 2VCCA 1DYOA 3GDBA 4QB2A 2ORZA 3LPGA 1CZSA 2YFZA 2JKXA 1US2A 1NAEA 3W5MA 5J1XA 1US3A 2W1WA 3OBAA 3UETA 1K45A 2J1UA 2Y8KA 3A7QA 2WN2A 4ZY9A 3ACHA 4BDVB 1J83A 1W0NA 3SKJE 1UY0A 3I3DA 4YPJA 1OH4A 1D7PM 1O8SA 2L9LA 3T0DA 1NUKA 3K46A 4TTGA 3WNNA 3GM8A 4CU9A 1UY2A 2WQ8A 2QBXA 4OUEA 5IFTA 3NNGA 2J1SA 4DUVA 1W8NA 3WF3A 3T2PA 2BGPA 1W9WA 4PF1A 1W8OA 3D3AA 4AG4A 4IUGA 2HYXA 2ZEWA 2VTFA 1JYVA 1LNSA 4ZXEA 2QQLA 2QQJA 4QDSA 4KI5M 1OF4A 4FI9A 5EIYB 2EIDA 2C4XA 2W5FA 4CU6A 1DP0A 2WAOA 1BHGA 5JXGA 4DUWA 3EB7A 4P02B 2J1RA 2VZUA 1OF3A 3A22A 2VMEA 4P00B 3HPNA 2LW8A 5CZKA 1GNYA 1L7QA 2VM9A 5JXIA 2DCKA 2VMFA 3OGRA 1K12A 4BJ0A 5A1AA 1JYNA 3CKHA 2E33A 3F2ZA 1JI6A 2W47A 3HEIA 3W5NA 4A45A 3ETPA 2C26A 4DXSA 5IFPA 3P6BA 4GWJA 1I5PA 5FUIA 3VD9A 1F4HA 2PQSA 1W99A 1L7RA 4W4ZA 2W87A 3CMGA 4D8MA 3I2KA 3WQBA 1UY4A 4TXWA 4XZUG 2VMCA 4PQQA 1EUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZ4 A;  2BZD A;  2Y64 A;  1UXX X;  2W9X A;  4A41 A;  2W94 A;  2J7M A;  1UMH A;  3PUH A;  1T2X A;  2VZP A;  4JKK A;  3OB8 A;  3I2I A;  2B9V A;  3OG2 A;  3C7O A;  5HXM A;  1IQD C;  2RJ2 A;  2ZXQ A;  4A6O A;  1K3I A;  1JU4 A;  2WAA A;  1PMJ X;  1PMH X;  3K75 B;  3C7E A;  2E31 A;  2VL4 A;  2ORX A;  3K4Z A;  2BER A;  5G05 L;  4OYU A;  2J1E A;  3CZU A;  2Y6H A;  4BXS V;  2W1Q A;  4W8J A;  5G04 L;  1UYY A;  1ULO A;  5JXJ A;  1TG7 A;  2YG0 A;  2VQT A;  1JZ5 A;  5JMO A;  3FHQ A;  3VD4 A;  2C9K A;  5B4X A;  5I0D A;  2VQU A;  3VD7 A;  2CDP A;  1XC6 A;  2W46 A;  5EJZ B;  3LEK A;  5F7U A;  3III A;  1J84 A;  2ZEX A;  3NJV A;  2ID4 A;  5LA0 A;  1GU3 A;  3T09 A;  2V72 A;  5C71 A;  3WNL A;  4ARX A;  3DEC A;  2XOM A;  3BN6 A;  4CVU A;  3ABZ A;  1MPX A;  3IDA A;  2ZEZ A;  1EUT A;  1PX4 A;  3HNM A;  5LCW L;  3K4A A;  4JX0 A;  3UES A;  3WEZ A;  4JKM A;  2VR4 A;  3ACF A;  4XUP A;  3VD3 A;  3T0B A;  2CDO A;  2WZ8 A;  3CZJ A;  5JR2 A;  1JZ2 A;  3GGL A;  3DYP A;  4XUR A;  4CU8 A;  2RV9 A;  2VZV A;  3IAP A;  1GQP A;  2YC4 A;  1JZ7 A;  2WZE A;  3P1I A;  1HN1 A;  1JYW A;  2LS6 A;  3ACG A;  2WO3 A;  4D0Q A;  3EYP A;  4P08 A;  3HNB M;  1WCQ A;  2VCA A;  4ARY A;  4QPW A;  3VD5 A;  3ZM8 A;  3MUZ 1;  4MO3 M;  3T0A A;  4QDQ A;  3WF2 A;  5JXH A;  3MV0 1;  3WSO A;  2XHN A;  1F4A A;  2VZR A;  5IHR A;  2VOT A;  2VZ1 A;  3ECQ A;  3NJX A;  3C7F A;  1JZ3 A;  3IB3 A;  3FL7 A;  1SDD B;  1TVG A;  4XVH A;  2WYS A;  2ZEY A;  3DYO A;  5DQ0 A;  3WNM A;  5DPN A;  3T08 A;  1UYZ A;  3VDA A;  3WNK A;  2Y6K A;  2W91 A;  2W3J A;  5C70 A;  2VZ3 A;  4MAD A;  2WDB A;  4XUO A;  1GOG A;  3A21 A;  3FN9 A;  4UAP A;  3SEP A;  3WNO A;  1O59 A;  4ET7 A;  1W9S A;  2BBA A;  4L0P A;  4QX1 A;  4AAX A;  2XON A;  2J1A A;  4KWU A;  3IAQ A;  4LHS A;  3LEI A;  4BK4 A;  4GWI A;  2WN3 A;  5IJR A;  4A4A A;  5LA1 A;  4UOJ A;  1H6X A;  3C7H A;  2WBK A;  2E32 A;  4GZ9 A;  2E26 A;  2XQX A;  4DEQ A;  3C8X A;  3WF0 A;  4DXR A;  1UWW A;  3I2H A;  3OGS A;  1JHJ A;  1GOF A;  5JUV A;  4M4P A;  2YB7 A;  3JXS A;  3HNY M;  3I2F A;  1KGY A;  1UX7 A;  2J1V A;  1GOH A;  4QB1 A;  2KD7 A;  4QX2 A;  4M4R A;  2VJX A;  4W50 A;  3CIH A;  2VMD A;  4MGS A;  2W1S A;  3U37 A;  1UY3 A;  2DCJ A;  4ZZ5 A;  3LPF A;  3DYM A;  4UI9 L;  4OMD A;  2VZO A;  1R64 A;  4XUT A;  3MUY 1;  4JKL A;  1PX3 A;  2VO5 A;  2DDU A;  2J1T A;  2YC2 A;  1XPW A;  2JDA A;  5HPO A;  3CDZ B;  3SKV A;  1CZV A;  2Y6J A;  3AC0 A;  2Z4F A;  4E8C A;  1XNT A;  2R7E B;  4OZO A;  5DMY A;  2WO2 A;  3NQH A;  3GXU A;  1W9T A;  4QB6 A;  3HOB A;  2VC9 A;  2WUH A;  1JYX A;  3T2Q A;  3MO4 A;  2QQO A;  4CUC A;  2VZQ A;  1CIY A;  4LPL A;  1ULP A;  2W1U A;  2BGO A;  4QAW A;  1DLC A;  4RYD A;  3LE0 A;  1H6Y A;  2V4V A;  2W92 A;  3UNP A;  1UMI A;  1KEX A;  3T2O A;  5LA2 A;  4P5Y A;  1XNA A;  4LQR A;  3I3B A;  3BGA A;  2Y6G A;  3K77 A;  4XUN A;  4QDR A;  2OKX A;  4CUA A;  3I3E A;  1WKY A;  4MGQ A;  5CYY A;  4E8D A;  2RVA A;  1SHW B;  1O8P A;  1CX1 A;  3HJR A;  3WF4 A;  2VZS A;  4DUX A;  3LEG A;  1OT5 A;  1UZ0 A;  4XUQ A;  4CUB A;  3I97 A;  1GMM A;  2EIC A;  1GUI A;  2X05 A;  4CU7 A;  3THD A;  3HN3 A;  3C7G A;  4KMQ A;  4DEV A;  3CQO A;  3VDB A;  2Y6L A;  3WNP A;  3FHA A;  1UYX A;  2W95 A;  2HLE A;  5EJ1 B;  3A23 A;  3VDC A;  5C7G A;  3MBW A;  2JD9 A;  2EIB A;  2X10 A;  1JU3 A;  2QQI A;  3MV1 1;  4A42 A;  4QX3 A;  4MOA A;  3I2J A;  2B4K A;  3PUI A;  2WO1 A;  2WAB A;  5B4N A;  4OMC A;  1SG3 A;  3SEE A;  1JZ6 A;  3ACI A;  1UXZ A;  2EIE A;  4BK5 A;  1P8J A;  4A44 A;  2VCB A;  1YQ2 A;  4DXT A;  4ZZ8 A;  1OD3 A;  2JE8 A;  2X09 A;  3NRU A;  3J7H A;  4Z2A A;  1NX9 A;  2QQM A;  1RYY A;  1NKG A;  3OEB A;  2QQN A;  3OEA A;  1CZT A;  2YFU A;  3E1F 1;  3LQC A;  2VZT A;  3THC A;  3K4D A;  3I2G A;  4PT6 A;  4JHZ A;  2QQK A;  2V5D A;  4LKS A;  4RN5 A;  1JZ8 A;  4QX0 A;  3WF1 A;  5DN2 A;  4A3Z A;  4HG6 B;  5IYY A;  2J22 A;  3OGV A;  1UY1 A;  1K42 A;  2VCC A;  1DYO A;  3GDB A;  4QB2 A;  2ORZ A;  3LPG A;  1CZS A;  2YFZ A;  2JKX A;  1US2 A;  1NAE A;  3W5M A;  5J1X A;  1US3 A;  2W1W A;  3OBA A;  3UET A;  1K45 A;  2J1U A;  2Y8K A;  3A7Q A;  2WN2 A;  4ZY9 A;  3ACH A;  4BDV B;  1J83 A;  1W0N A;  3SKJ E;  1UY0 A;  3I3D A;  4YPJ A;  1OH4 A;  1D7P M;  1O8S A;  2L9L A;  3T0D A;  1NUK A;  3K46 A;  4TTG A;  3WNN A;  3GM8 A;  4CU9 A;  1UY2 A;  2WQ8 A;  2QBX A;  4OUE A;  5IFT A;  3NNG A;  2J1S A;  4DUV A;  1W8N A;  3WF3 A;  3T2P A;  2BGP A;  1W9W A;  4PF1 A;  1W8O A;  3D3A A;  4AG4 A;  4IUG A;  2HYX A;  2ZEW A;  2VTF A;  1JYV A;  1LNS A;  4ZXE A;  2QQL A;  2QQJ A;  4QDS A;  4KI5 M;  1OF4 A;  4FI9 A;  5EIY B;  2EID A;  2C4X A;  2W5F A;  4CU6 A;  1DP0 A;  2WAO A;  1BHG A;  5JXG A;  4DUW A;  3EB7 A;  4P02 B;  2J1R A;  2VZU A;  1OF3 A;  3A22 A;  2VME A;  4P00 B;  3HPN A;  2LW8 A;  5CZK A;  1GNY A;  1L7Q A;  2VM9 A;  5JXI A;  2DCK A;  2VMF A;  3OGR A;  1K12 A;  4BJ0 A;  5A1A A;  1JYN A;  3CKH A;  2E33 A;  3F2Z A;  1JI6 A;  2W47 A;  3HEI A;  3W5N A;  4A45 A;  3ETP A;  2C26 A;  4DXS A;  5IFP A;  3P6B A;  4GWJ A;  1I5P A;  5FUI A;  3VD9 A;  1F4H A;  2PQS A;  1W99 A;  1L7R A;  4W4Z A;  2W87 A;  3CMG A;  4D8M A;  3I2K A;  3WQB A;  1UY4 A;  4TXW A;  4XZU G;  2VMC A;  4PQQ A;  1EUU A; 
#chains in the Genus database with same CATH topology
 1C8N A;  1ZBE 3;  2RR1 1;  1KRI A;  1JZ4 A;  2ENR A;  2BZD A;  5HCF A;  5FMO S;  3DN7 A;  4Q4V 1;  3ON7 A;  2J7M A;  1UMH A;  1WME A;  1H30 A;  2RE9 A;  3M2M A;  5DXD A;  2Q8O A;  2BJS A;  4MXW A;  4CA9 A;  2HWE 1;  4K9S A;  5A7P A;  1ZBE 1;  2R30 A;  4HZF A;  3ZR6 A;  3L2Y A;  4EJR A;  5HXM A;  4YW7 A;  4EN9 B;  2PAM A;  3LF7 A;  3MIF A;  4NPR A;  3DPR A;  4DB5 A;  2CV6 A;  2G4I A;  2WNU B;  5BNP C;  1HB1 A;  1BXH A;  3TNP B;  1LCL A;  3NAP A;  3WUC A;  3QH7 A;  2NMO A;  2WO7 A;  4OQ8 A;  2VL4 A;  3BTZ A;  4AHW A;  1CAX A;  1SCS A;  2AYH A;  2X5I B;  2ADD A;  3K4Z A;  4AQT A;  4Z1V A;  4LHN A;  3CZU A;  2WNV A;  1WZX A;  5A7Q A;  5KC6 A;  2JDY A;  1YFW A;  1VB4 A;  1ULO A;  2ZX3 A;  5DUU A;  5F1R A;  4FXK B;  4Y1X A;  1AJO A;  5JXJ A;  2UYB A;  2VQT A;  5L36 A;  5ANQ A;  2PFW A;  3VD4 A;  3RWK X;  3ZYF A;  4NJ4 A;  5B4X A;  3HQR A;  1QJF A;  3IDB B;  5FLI A;  2O14 A;  5I0D A;  1OUS A;  1S1A A;  2VQU A;  3G7D A;  2QQW A;  4CPB A;  4YZ3 A;  5EJZ B;  1L7L A;  5DZE A;  4URT A;  4H55 A;  1D2S A;  4V2W A;  3W21 A;  4CEY B;  3AMM A;  1SBD A;  2V73 A;  4Q29 A;  1ULF A;  4HFS A;  4YVS A;  3T09 A;  5LA0 A;  4LA3 A;  3AMH A;  1UOG A;  4E27 A;  1IPJ A;  4TSV A;  4MGZ E;  3SC7 X;  5BY5 A;  4CVU A;  3CEW A;  3ABZ A;  1MS3 A;  3PME A;  4QPY A;  1GV9 A;  1BBT 2;  1TEI A;  4A7Y A;  2TEP A;  3HNM A;  4XJ9 A;  4YWA A;  4AOC A;  5LCW L;  3S6P A;  1SLC A;  3FBY A;  5FK7 A;  1ZVF A;  3AP5 A;  3BTX A;  3K4A A;  4JX0 A;  4DY5 A;  3KVA A;  3NWK A;  5HBA A;  4B8E A;  2VR4 A;  3TNQ A;  1O3R A;  2W52 A;  3WG3 A;  4AI9 A;  3ACF A;  4Y20 B;  4QKN A;  2ZA9 A;  3OGG A;  2D6O X;  3THT A;  2WZ8 A;  5A6Y A;  1RIN A;  3VKO A;  3WOG A;  1X82 A;  2HH9 A;  3ENR A;  3ZFG B;  2EVX A;  4AF9 A;  2A1X A;  1OA2 A;  3DYP A;  4XUR A;  5BPX A;  1BZW A;  5ANN A;  3J26 N;  3S7I A;  2NZ9 A;  3RWN A;  3IBM A;  1IZ3 A;  4RR3 B;  2YC4 A;  2WL1 A;  3PUS A;  3FFQ A;  3D6E A;  5I8T A;  4LIU A;  1NQD A;  1DFQ A;  1JZ7 A;  1W28 A;  1GR3 A;  1HN1 A;  1XNK A;  3VL8 A;  1Q5O A;  3ACG A;  2WO3 A;  1V70 A;  2W0X A;  1LOE A;  1WCQ A;  1QJX 3;  3AMP A;  4X6Q B;  4YW4 A;  4KWJ A;  1VLN A;  3INA A;  4ZU5 A;  2A73 B;  5IUQ A;  3ZM8 A;  3MZH A;  1ULD A;  1GP4 A;  3KT7 A;  4FPG A;  5A7N A;  1UZY A;  2JE7 A;  4IEY A;  2FMY A;  3WF2 A;  1W2O A;  3MV0 1;  4HOO A;  5EQU A;  3AKR A;  3MHZ A;  5A1F A;  1QJX 1;  3K3N A;  3BTA A;  5K0U C;  4Y4R A;  4DFS A;  5IHR A;  1YIP A;  4U2A A;  2ZZJ A;  4LEJ A;  1IGO A;  2VMI A;  3I3Q A;  5FBJ A;  3M70 A;  2WYS A;  2X5I A;  3VZJ A;  5C8W A;  5IT6 A;  2ZGQ A;  4Q1R A;  1Z78 A;  5DPN A;  5FO7 B;  2QDR A;  3T08 A;  1PGW 2;  3ZDV A;  1AR7 3;  1QIQ A;  4L99 A;  4XTM A;  5M0T A;  1MEC 2;  1UPI A;  1IOA A;  2BFU L;  4K6B A;  4GXL A;  2RS5 2;  3B7M A;  3M3O A;  3WNK A;  4AFC A;  2DVG A;  2RS1 1;  2W3J A;  3FLT A;  4R4Z A;  1AR7 1;  3OY8 B;  3VKN A;  4OHW A;  3WG2 A;  1O3S A;  4QGM A;  2VZ3 A;  2XVL A;  3NNM A;  1ALY A;  2P1B A;  1REE A;  4XUO A;  1GOG A;  5FRE A;  3TN9 3;  1NZC A;  1R08 3;  2C6S A;  3A21 A;  1X33 A;  1NA1 C;  1PZ7 A;  3FN9 A;  4UAP A;  1ZA7 A;  3V65 A;  3WNO A;  3ZXF A;  3D5O A;  5FZA A;  4AZZ A;  1J59 A;  1HXS 3;  2R06 2;  4XEZ A;  4ZS2 A;  2XON A;  4CEY A;  4XFA A;  2DV9 A;  5FJK A;  3LEI A;  4LLO A;  3TN9 1;  1R08 1;  1KJR A;  2QZ2 A;  1AX2 A;  2WN3 A;  2ZGN A;  3TB0 A;  3ZFF C;  4A4A A;  4EN8 B;  5LA1 A;  1YCI A;  1HXS 1;  4R52 A;  3KVB A;  1PIV 3;  1LKN A;  1W2U A;  2XGX A;  3POI A;  4NVP A;  4OVE A;  2WNE A;  4QPI C;  1R1A 3;  2WBK A;  2IC1 A;  5FKB A;  1COV 2;  2Z79 A;  1B09 A;  4GZ9 A;  5C6C A;  1J3Q A;  3V56 A;  2WIN B;  2H6B A;  1TNR A;  2VXR A;  5FP3 A;  1PIV 1;  2OS2 A;  4NN0 A;  5HI0 A;  1NCQ C;  4ZU7 A;  1J3P A;  1R1A 1;  2ZHL A;  3DPR C;  2VGD A;  3I2H A;  5LW9 A;  3DV8 A;  1A8D A;  1JHJ A;  1RUG 3;  4GH4 B;  5J3U A;  4PDW B;  3N35 A;  3R4D B;  4Q2F A;  2YB7 A;  4MG2 A;  1JYT A;  3ZFG A;  3JXS A;  3NNF A;  4LJH A;  2K2S A;  5A3M A;  1UX7 A;  3UK9 A;  3WW2 A;  5KHI A;  4E2G A;  2KD7 A;  4LLF A;  1RUG 1;  2HWC 3;  4MHU A;  2UWB A;  4QX2 A;  1W3V A;  1RJ7 A;  1ZZ9 A;  2VMD A;  3TEW A;  2W1S A;  5F6K A;  4TYS A;  3LPF A;  5JZG B;  4AI1 A;  4K3U A;  4XJ8 A;  5DZG A;  3DYM A;  3O14 A;  4BIF A;  4OMD A;  4JGZ C;  1Z7S 3;  2HWC 1;  1RUC 2;  2RMU 3;  3MUY 1;  3M1H A;  4A7K A;  1M06 G;  1BQP A;  2DU1 A;  5FZB A;  4I30 A;  4Q5O A;  4NRO A;  1PX3 A;  4UXA A;  4XDP A;  2RDS A;  1O91 A;  1OHF A;  3CHX A;  1C5H A;  3VBH B;  3W20 A;  2VO5 A;  5HCH A;  1LGC A;  3O1U A;  4H14 A;  1KJL A;  1Z7S 1;  4AEJ A;  1H8T C;  4YVS C;  1FNY A;  3ZFE B;  2PLV 2;  5J98 B;  2JDU A;  4UFL A;  1CZV A;  2KR2 A;  2QZ3 A;  4XBQ A;  1G9B A;  3JQX A;  4K8F A;  2WKK A;  3UGF A;  1XNT A;  3BYW A;  5C5T A;  1V6M A;  5C3Q A;  2Q1Z B;  2R7E B;  1WBF A;  1UU6 A;  4M0H A;  4CCC A;  4KG8 A;  1PNG A;  2WO2 A;  1NCR B;  3NQH A;  1W9T A;  2HWF 3;  5T5P A;  4F3J A;  2JD4 A;  5FBZ A;  3WP6 A;  4QX5 A;  4FQ4 A;  4CXW A;  5AC9 3;  3RDI A;  1ENQ A;  2MEV 3;  5JOY A;  4AEM A;  1V0A A;  5FY8 A;  2JDP A;  1QJU 2;  1OOP C;  5E1R A;  1T6G C;  5FRA A;  1Q8P A;  2VZQ A;  5CAZ A;  2FQP A;  2HWF 1;  5AC9 1;  4XFF A;  4GKX A;  3MFC A;  2JG8 C;  2HYK A;  2B9U A;  5FMC A;  2C5D A;  4LPL A;  5CBL A;  2FCT A;  2MEV 1;  4IEV A;  1MQT A;  5C4W C;  1BEV 3;  2CL2 A;  4FSJ A;  5A32 B;  4QD2 A;  1UW8 A;  1H6Y A;  1HJG A;  1WLW A;  3TEZ A;  2CU5 A;  5FY7 A;  4LXL A;  4XFG A;  4JZR A;  4XIK A;  1YEW A;  3RGB A;  4CXX A;  1KEX A;  1ZBA 2;  2BFU S;  3VN4 A;  3T2O A;  3ZIX A;  4ATE A;  5LB6 A;  2G9Z A;  1BEV 1;  3IT8 A;  1QH7 A;  1XNA A;  1QQP 3;  3VBO C;  4XW3 A;  3IM0 A;  3WW3 A;  2VQ0 A;  3AZV A;  4BM8 A;  4Y22 A;  2WFF 2;  5F5Q A;  5CG8 A;  4IW3 A;  2ZMN A;  4GJZ A;  5LEJ A;  5FXZ A;  1ZZ7 A;  4DPN A;  2D3R A;  4AW7 A;  1SBE A;  1ZZ8 A;  4CUA A;  3B93 A;  1DQ1 A;  4MGQ A;  5A3W A;  4XFC A;  4XHX A;  1QQP 1;  5IVY A;  2XPJ A;  2WNU C;  1JYC A;  1NQJ A;  3HJR A;  2YHJ A;  1S0C A;  1LOF A;  4PDW A;  4FPC A;  3EQE A;  2D98 A;  2X5I C;  1UZ0 A;  3LEG A;  3FHI B;  1LGB A;  1O4T A;  4FOY A;  1UMZ A;  4EN6 B;  5A3T A;  4MHR A;  1KS5 A;  5L9V A;  2GNB A;  3UT0 A;  3IZO A;  3WDY A;  4CU7 A;  3THD A;  5F2W A;  3FLP A;  5FPV A;  5FUN A;  1QY4 A;  2NLR A;  1W6N A;  2OPW A;  3U78 A;  4OUS A;  1GAN A;  2QFE A;  3ZYG A;  3BIE A;  1RUI 3;  5AVA A;  1EP0 A;  3GYD A;  3MBW A;  4UW5 A;  2CY6 A;  2EIB A;  3BUC A;  1VBB 3;  1JU3 A;  2ILM A;  4OI2 A;  1QNY A;  4AVB A;  1QF3 A;  4AHY A;  5A6X A;  2PXJ A;  4BIS A;  3VKL A;  5JOX A;  4NO4 A;  1VR3 A;  1UL9 A;  1RUI 1;  3EJK A;  3I2J A;  3LA3 A;  1EYB A;  2WQ4 A;  2MHF A;  2WAB A;  1RXG A;  1DGW A;  1VBB 1;  1S0D A;  2DUP A;  3PU3 A;  2ZBJ A;  2VTX A;  4WZF A;  3ZFE A;  5B4N A;  1O6U A;  3B02 A;  3SEE A;  2ZS6 B;  3ACI A;  1G7Y A;  3OYW B;  2EIE A;  2GNM A;  5F3E A;  1MS1 A;  4PIZ A;  4BK5 A;  4GB3 3;  5F5C A;  4MGT A;  4HT1 T;  1YQ2 A;  1NCR A;  4RQP B;  5DZF A;  1DG6 A;  4IES A;  4ZZ8 A;  1OD3 A;  5GJ6 A;  1A8M A;  2JE8 A;  2CGP A;  3JBG 3;  2GP3 A;  1EV1 1;  2QQM A;  4GB3 1;  5I8S A;  1C57 A;  1OMI A;  3MEP A;  1RYY A;  1QEX A;  4QQO A;  2EAA A;  2QQN A;  3ZFG C;  3JD7 2;  3DXT A;  3ACL A;  4YGE A;  3E1F 1;  3JBG 1;  3LQC A;  3OOX A;  4BLJ A;  4ERO A;  3GCX A;  2X8K A;  2XR4 A;  3K48 A;  4RR3 C;  2VZT A;  2WZR 1;  5GLT A;  2BWC A;  3EXU A;  1OLQ A;  3K4D A;  4NE9 A;  3I2G A;  1VBC 2;  2ZX2 A;  2GME A;  2YPJ A;  4BU2 A;  4B4R A;  2D6N A;  1NE6 A;  1E5S A;  5KBF A;  2QQK A;  3VKF C;  2V5D A;  3ZX7 A;  3I4I A;  4LKS A;  4RN5 A;  1JZ8 A;  4QX0 A;  2Q1M A;  3CNA A;  1W6P B;  3SH4 A;  5DN2 A;  2VUL A;  1Y4W A;  4A3Z A;  1W6O B;  2F6B A;  2YBP A;  2RDQ A;  2J22 A;  1D0H A;  1I9R A;  1UY1 A;  5LY1 A;  4LIV A;  2RR1 2;  2HWB 3;  3IPV B;  3GDB A;  4H3W A;  5EP9 A;  5GLZ A;  4QQ2 A;  2NQY A;  4Q4V 2;  1E5R A;  2GN7 A;  3WNX A;  3LPG A;  3GAL A;  3PVB B;  4XCB A;  1US2 A;  1W3X A;  2HWE 2;  1O7F A;  2P3J A;  4HPK B;  3VZN A;  4Y1Y A;  1ZBE 2;  2HWB 1;  1ST8 A;  3HT1 A;  2ZJC A;  2W1W A;  1G9A A;  3RFR A;  4LBJ A;  1K45 A;  3CJI A;  3R4S A;  1E57 A;  2WN2 A;  4W6Y A;  2XJQ A;  1JTZ X;  2QNK A;  3ACH A;  1URX A;  2ZHK A;  3AYA A;  3ES1 A;  1H0B A;  1W8T A;  3MYX A;  3OJB A;  3ZMN A;  2BVB A;  4FBF A;  3ZYH A;  4XFB A;  2JIG A;  1BK0 A;  1UY0 A;  3I3D A;  3MF6 A;  3KGL A;  3USU B;  2VCM A;  2XML A;  4P9W A;  2PHL A;  3N7M A;  1PVC 3;  3BVC A;  1O8S A;  2IXJ A;  5AVP A;  4QX7 A;  2WNO A;  3AP9 A;  1W05 A;  1NUK A;  3T0D A;  3WY6 A;  4KBB A;  3GM8 A;  5FZD A;  3T3Y A;  3LA2 A;  3E6B A;  4RSU A;  4RS5 B;  1PVC 1;  2WQ8 A;  1OBN A;  1AR9 3;  2D6P A;  3JB4 C;  2P2K A;  3L2H A;  3OYW A;  4YW6 A;  1F8V A;  4FT8 A;  3IMN A;  2XB6 C;  1HV0 A;  1W8Z A;  3THP A;  4CRQ A;  4LO5 B;  4A3X A;  1ZZ6 A;  1F31 A;  1RMU 3;  3D3A A;  1Q8S A;  1AR9 1;  4CDU C;  4EWE A;  3AKQ A;  1JYV A;  2Z5W A;  4OUL A;  3VDD A;  1X9T A;  3NO8 A;  4K40 A;  4ZXE A;  4HBN A;  5FXW A;  2QQJ A;  3MLL A;  5HCB A;  4BMB A;  3U75 A;  4FI9 A;  4GH4 C;  5EIY B;  5LK5 A;  1RMU 1;  2JIJ A;  5T55 A;  5K8S A;  1IKP A;  2WAO A;  4UF0 A;  1XND A;  5FP9 A;  3KM5 A;  5FPL A;  4DZG A;  2J42 A;  3ZO0 B;  3EB7 A;  4P02 B;  2ZHN A;  3AXE A;  5KXE A;  1YIF A;  3A22 A;  5I8Y A;  4COW A;  2VME A;  4P00 B;  1JUI A;  4FTB A;  3BTY A;  2VM9 A;  4BLI A;  5JZG C;  3LIG A;  3IN9 A;  3VV1 A;  3Q8E A;  1WCD J;  1GQG A;  3KQ4 B;  1K12 A;  1XQN A;  2YZ4 A;  1JYN A;  3R4U A;  3MFA A;  2E33 A;  1NG0 A;  5ISL A;  1X8M A;  1XSR A;  1IS5 A;  1WW7 A;  1SLL A;  3ETP A;  3VBH C;  2C26 A;  3IPV A;  5IFP A;  1LJ7 A;  3P6B A;  3ST7 A;  4XYX A;  1GIC A;  1XJA A;  4JRA A;  5FUI A;  3J4U H;  5F3I A;  2YXS A;  4HPK A;  2CYF A;  1W99 A;  2BTV C;  1SPP B;  3AP7 A;  3JQW A;  4AVA A;  3PTR B;  4CDX B;  4HXC A;  5BYN A;  1QJX 2;  2WFP A;  3VZL A;  3NJY A;  2I2S A;  4L11 A;  4Z8B A;  5CKN A;  1NCR C;  3T30 A;  4RGG A;  1MS0 A;  4XZU G;  4DMI A;  5KWR A;  5FPX A;  1NY7 1;  1EUU A;  4O65 A;  2EXJ A;  2IFR A;  2UUR A;  1O3Q A;  2Y60 A;  4UFI A;  4L2N A;  2W9X A;  4NAM A;  2W94 A;  4A41 A;  2C0Z A;  4MYE A;  4QWN A;  3ZR5 A;  3ZIW A;  4JKK A;  1A6C A;  1F35 A;  4YVW B;  2RS1 2;  3O1O A;  4N8M A;  4W6W A;  2ZZQ A;  1AR7 2;  1HV1 A;  5CKQ A;  2O0O A;  1H4H A;  1X9P A;  3FUO A;  4JTO A;  4FFG A;  4A6O A;  4Y4Y A;  3T4H B;  3RZL A;  1JU4 A;  2VUC A;  3AKP A;  3EO6 A;  5FYS A;  2JKB A;  4H7L A;  3K75 B;  4Q0P A;  5F37 A;  4KGG A;  1LAJ A;  1FMD 3;  4LO4 B;  1WCU A;  1NXD 1;  5G05 L;  4WM8 A;  5L19 A;  4CXY A;  3AXD A;  4N7U A;  3WP4 A;  2YV8 A;  3TN9 2;  1R08 2;  4XAC A;  1KFU L;  2TUN A;  5C3P A;  1FMD 1;  4Y1Z A;  1HXS 2;  5FPU A;  1ODM A;  4G3Y C;  1V6J A;  1TG7 A;  1VMJ A;  2D6M A;  1IS6 A;  2XQR A;  5J96 B;  1OC1 A;  1ASJ 3;  1MAC A;  1RUJ 3;  3FHQ A;  4K1Z A;  1UYP A;  5A33 B;  5FCC A;  1QXP A;  3MI8 A;  3RZG A;  5L73 A;  1N1Y A;  1PIV 2;  1XC6 A;  3ZKU A;  2JWP A;  3UJO A;  1BJQ A;  3WG4 A;  2QUO A;  1ZRC A;  1R1A 2;  3KLS A;  3III A;  1LHN A;  1RUJ 1;  3POY A;  4GIQ A;  4AEK A;  1J84 A;  1N3Q A;  2PHF A;  4PQQ A;  3NJV A;  2G9G A;  2VUD A;  4CDW B;  4LKE A;  1NLR A;  1YJL A;  5FY9 A;  2K0G A;  4B7K A;  5IK4 A;  4Y24 A;  3ZPY A;  3VHR A;  4BQ5 A;  3LFM A;  3K3O A;  5FXX A;  4FPK A;  3AM2 A;  2XOM A;  2R04 3;  4QXH A;  1POQ A;  4JHT A;  2ZMK A;  5F2S A;  2GC3 A;  5ERL A;  3IDA A;  1RUG 2;  1WCS A;  3WV6 A;  5D8A A;  2YU1 A;  1LOA A;  2D93 A;  2R04 1;  2UU8 A;  4ES9 A;  3BIW E;  3ZSK A;  4CCM A;  3UES A;  4JKM A;  5LAT A;  2HWC 2;  5F8P A;  3UJQ A;  4EYU A;  2ERF A;  3NAP B;  3NMB A;  5C3R A;  1HRI 3;  1XNC A;  4XUP A;  2WWJ A;  5JOZ A;  4CDX A;  1NE4 A;  2Q4S A;  3ITQ A;  3LDR A;  2E7A A;  1JZ2 A;  2XLA A;  2JG9 B;  2BBV A;  4DXZ A;  5HV0 A;  1Z7S 2;  3NKT A;  3H8X A;  2RV9 A;  5FMD A;  2VZV A;  3VBO B;  4RQP C;  3IAP A;  1GQP A;  1HRI 1;  5BNO A;  4IE7 A;  3AZX A;  4JQT A;  4I0B A;  2TNF A;  1W06 A;  4SLI A;  3P1I A;  1CX4 A;  3EYP A;  3URF A;  5FZ1 A;  5T50 A;  3U07 A;  4XQW A;  3PJQ A;  2Y26 A;  2Y34 A;  1NZI A;  3O0W A;  2FZ1 A;  4MO3 M;  4QPG A;  5J36 A;  4QDQ A;  1SLB A;  5JXH A;  3Q9O A;  5H9R A;  1JOD A;  1RIR A;  4XAA A;  5DG1 A;  4CTE A;  2BV4 A;  3CO2 A;  2VZR A;  1SFN A;  3AP6 A;  2HWF 2;  2I74 A;  5AC9 2;  3HWJ A;  3CJX A;  2VZ1 A;  5FLJ A;  3ECQ A;  3ZVX A;  4L9B A;  3S7E A;  2RS3 3;  3BOD A;  3C7F A;  3POF A;  4LBQ D;  3PJY A;  3ZXG A;  3UKT A;  2MEV 2;  3WCS A;  3FL7 A;  1NLS A;  1SDD B;  1W8W A;  4RHV 3;  5FR3 A;  5DQ0 A;  1LEC A;  4E4H A;  1WMD A;  5FZC A;  4YGC A;  1G9F A;  3O0V A;  5FDB A;  2P3Y A;  2RS3 1;  3QAC A;  5FYH A;  5FLH A;  4GJY A;  2AR6 A;  5FUP A;  4XCA A;  2QDN A;  4K20 A;  1BEV 2;  5CKM A;  2HEW F;  1YQC A;  4RHV 1;  4IEX A;  5FYU A;  2BVV A;  2W91 A;  3PHM A;  2YU2 A;  2QVS B;  4MGY E;  4JVA A;  5A33 A;  2A5Z A;  1XE8 A;  5A7S A;  1ACC A;  2WDB A;  3D82 A;  3B3Q E;  1RVF 3;  4BYY A;  2HWD 3;  2OYZ A;  1QQP 2;  3SEP A;  2WS9 3;  4RL7 A;  2W68 A;  1HRV 3;  3MDP A;  4XC9 A;  4ET7 A;  5FZI A;  4CDW A;  1UOJ A;  4EN7 B;  2UWC A;  4KWU A;  3IAQ A;  1VAK A;  2D6K A;  4BK4 A;  3WIN E;  1RVF 1;  2HWD 1;  5CFD A;  1UAI A;  5DAB A;  2WS9 1;  3PVN A;  1HRV 1;  4BPZ A;  4I01 A;  4X6R B;  1QXR A;  2VVD A;  4C91 A;  1QDC A;  1HW5 A;  2CWM A;  2KXL A;  3VBF A;  2HBT A;  2E32 A;  4AED C;  2DYC A;  2ES3 A;  4COZ A;  5GZG A;  5JDB A;  2F4P A;  4YRD A;  1S0I A;  2WA4 A;  1I5Z A;  3MW2 A;  2BOJ A;  5EYY A;  5FZF A;  1LU2 A;  4AVS A;  2W2I A;  3SCG A;  4CCD A;  4QGN A;  4DEQ A;  1UZZ A;  4RS5 C;  4GMP 3;  4AI2 A;  4SBV A;  3WF0 A;  4O61 A;  4NHM A;  1IPK A;  2YRO A;  3OGS A;  4YG0 A;  4HKL A;  4BHP A;  1LES A;  1GOF A;  2JEM A;  4M4P A;  4BWO A;  3Q8B A;  4AQ6 A;  1W9F A;  2WWS A;  4XFH A;  2AEZ A;  2JG9 A;  3HNY M;  1RUI 2;  3A0N A;  3I2F A;  4FOQ A;  3JB8 A;  4GMP 1;  2EAK A;  4XFI A;  5FP4 A;  4QB1 A;  5GM0 A;  1VBB 2;  1AL0 G;  2WA3 A;  4Q8K A;  1NYW A;  2XLG A;  1HQW A;  2H0V A;  1JXN A;  3CIH A;  4MGS A;  4WM7 A;  1YNA A;  2VEC A;  3ZN4 A;  2DCJ A;  2ZML A;  2WZP P;  4ZZ5 A;  1YFU A;  4R9D A;  4QXK A;  3WDX A;  2OW4 A;  2IFW A;  2AEN A;  4EV0 A;  4XUT A;  3N3H A;  4CSW A;  4EWA A;  2VOW A;  3GJB A;  3BU0 A;  1EV1 2;  4GB3 2;  4UFK A;  1G8W A;  2VOV A;  4LUL A;  3P3P A;  1V9U 3;  2BQP A;  5F32 A;  4FPE A;  1XRU A;  3FE5 A;  1W03 A;  1AHS A;  5FZK A;  3ZXL A;  1XPW A;  1POV 3;  4OHX A;  4ASM B;  4COY A;  1JYI A;  5ACA 3;  2EF6 A;  3JBG 2;  3SKV A;  3JCI A;  1OUX A;  3AC0 A;  1W04 A;  1O5U A;  4O9G A;  2WZR 2;  1V9U 1;  1CPM A;  1CPN A;  2DVA A;  2G9F A;  4MH0 E;  4OZO A;  4QX8 A;  5DMY A;  1POV 1;  1W6Q A;  1QMJ A;  1VRH 3;  4AFB A;  5ACA 1;  2ZGP A;  2VC9 A;  2OII A;  3WP5 A;  1H2M A;  1MR5 A;  3KCY A;  4YYO A;  4CEW B;  1V6L A;  2N7G A;  1QOO A;  2ET7 A;  3KQR A;  3T2Q A;  2GNT A;  4LBM A;  1HIX A;  4CUC A;  1VRH 1;  4NHL A;  5CIS A;  1RED A;  1SAC A;  3ETQ A;  3VZM A;  2PHR A;  1QJY 3;  1J3R A;  5JLV A;  4UW6 A;  2BGO A;  2TBV A;  3B01 A;  5A3P A;  3Q8C A;  4N9I A;  4Q8L A;  1DLC A;  1D2Q A;  2G1M A;  2BW8 A;  5KXD A;  2BOI A;  2V4V A;  5GLU A;  4WVW A;  3WHT A;  2JXA A;  2HWB 2;  4XBN A;  1DQ2 A;  1PZ8 A;  1QJZ A;  2GZW A;  4Y26 A;  5EJ3 A;  1QJY 1;  3UNP A;  3DGT A;  3KV9 A;  1PK6 B;  4P9G A;  1FI2 A;  1DQ5 A;  3UYJ A;  4B4P A;  4QXB A;  4YAR A;  4TN7 A;  1VAM A;  5L7O B;  4UBH A;  4LQR A;  2PN5 A;  3ZSJ A;  3BGA A;  2BU9 A;  1V00 A;  4N53 A;  5JI9 A;  2Y6G A;  3K77 A;  4YVW C;  3MIG A;  1S0G A;  4K8R B;  4R4X A;  4EE2 A;  5IVV A;  1HX6 A;  5CYY A;  1DYP A;  4YGB A;  2RVA A;  3AKT A;  1IPS A;  4S2D A;  4X8N A;  3SCF A;  5C3S A;  5FYC A;  2BNO A;  3KS7 A;  1EPZ A;  4YM2 A;  1QH6 A;  1OT5 A;  1NOV A;  2ZGL A;  3RZK A;  3T4V A;  3I97 A;  1VP6 A;  5IVC A;  4HLT A;  1GMM A;  3GNE A;  1PVC 2;  4V1P A;  5KXC A;  3E5Q A;  1GUI A;  4X8P A;  3HN3 A;  1SDW A;  3C7G A;  4DEV A;  4ISR A;  4AVC A;  1QOS A;  1RGS A;  1MS9 A;  2XG3 A;  2PHX A;  4COV A;  1Q3E A;  1A3K A;  1VAL A;  4NMI A;  3PVO A;  2HLE A;  1EY2 A;  1AVB A;  5FY5 A;  3JUU A;  2B5H A;  3J8F 3;  1X8E A;  3L9J T;  5EJ1 B;  3V64 A;  3VDC A;  1AR9 2;  2JD9 A;  2VY0 A;  2XHK A;  3TEX A;  3ZYB A;  1SQ4 A;  5T5J A;  1BCX A;  5A1L A;  5FZM A;  1ND3 B;  1MQT B;  5A3N A;  5GKA C;  2QQI A;  3MV1 1;  2AAC A;  2DUQ A;  2ZX4 A;  5C33 A;  4JGY A;  1BK1 A;  1MS8 A;  3HBK A;  3LGR A;  4QX3 A;  3KB5 A;  5FYB A;  4CDW C;  5CVR A;  3V0B A;  3J8F 1;  4AYU A;  1RMU 2;  4Q4Y 3;  2B4K A;  2RM2 3;  1S0E A;  3CL1 A;  3DKQ A;  3PUI A;  4JDO A;  2ZGM A;  3N9L A;  5FIX A;  1UN1 A;  5SV8 A;  5C9A C;  5JWP A;  4OMC A;  5GZD A;  3KT1 A;  3ZN5 A;  5FP8 A;  4IND A;  1ZZC A;  2F17 A;  4Y22 B;  4Q4Y 1;  2RM2 1;  3S30 A;  1TME 3;  2XL7 A;  2VCB A;  1TMF 3;  1RUF 3;  1NLQ A;  1YLL A;  3C3V A;  4YZ1 A;  4DO0 A;  4EZH A;  3AZY A;  4DXT A;  1PZ9 A;  5H9Q A;  3ZOI A;  2GMP A;  4HKO A;  2X09 A;  4CEW A;  1S0F A;  1XU1 A;  4NPL A;  3WQ0 A;  4F7Z A;  4Z2A A;  3HN1 A;  1TME 1;  1UU5 A;  2I45 A;  1YRZ A;  1F5J A;  2MPF A;  1TMF 1;  1RUF 1;  3NAP C;  3WDW A;  3FJS A;  4N90 A;  5FYY A;  1PO1 3;  5FPA A;  4NIH A;  1ZM1 A;  4FVV A;  3RYR A;  3FC0 A;  2WNV C;  4XPV A;  5F5I A;  2BWA A;  4ITC A;  1JN2 P;  4QHB A;  1RUD 3;  1LHU A;  3RRD A;  3OTF A;  5DAQ A;  2D5F A;  3WVJ A;  1MS5 A;  1PO1 1;  4LO7 A;  1ZRD A;  1H2L A;  1W6N B;  1Y9Q A;  1SLI A;  3J7N A;  3MLJ A;  5E16 A;  1OFN A;  1PK6 A;  1G9C A;  1UKG A;  3WHU A;  4AVT A;  1K5M A;  1RUD 1;  1SLA A;  3LKJ A;  5L7O A;  4JHZ A;  1AR6 3;  1AYM 3;  3P3N A;  2AH2 A;  1MZF A;  2DFC A;  2WLQ A;  3H9A A;  4XJW A;  5H9S A;  2PAK A;  2FDK A;  4R8H A;  1BKZ A;  3DF0 A;  1V6K A;  4AGG A;  3OGV A;  1AR8 3;  1NY7 2;  2NN8 A;  2YBS A;  1PGL 1;  1AR6 1;  1AYM 1;  1ENS A;  2RMU 1;  2XVK A;  3PU8 A;  4NHK A;  4NOT A;  4QB2 A;  4XBL A;  3U11 A;  4NUB A;  5KHH A;  2W39 A;  2BPA 2;  1AR8 1;  4OLL A;  1US3 A;  1GZT A;  3WZ1 A;  1FXZ A;  2D6L X;  2ZGU A;  1JW6 A;  4D7T A;  1I1E A;  2NPI A;  4HN1 A;  4KWL A;  4UFH A;  1G9D A;  4DIN B;  3AYD A;  1QOT A;  3ZYR A;  1W2T A;  5LEK A;  2GC1 A;  1PGS A;  3LIH A;  1VIW B;  3B69 A;  4OFG A;  5FYV A;  4CPB D;  4JRL A;  4P9L A;  3N9M A;  5JPN B;  1LR5 A;  4Q26 A;  4HVO A;  4XZP A;  3H3U A;  4LE4 A;  1SFP A;  5LAS A;  3ZXJ A;  2NYY A;  3LB9 A;  1CQ9 A;  1CAV A;  3ZN6 A;  2Z69 A;  2H6C A;  3MGU A;  1JOB A;  1XYP A;  4FXG B;  1D7P M;  1FMD 2;  1ND3 A;  3TYJ A;  1I3H A;  4AXO A;  3AZZ A;  4FAG A;  5C8C B;  4FP3 A;  1MS4 A;  1XU2 A;  3MPB A;  1QKQ A;  3K46 A;  5EFU A;  3WNN A;  4TTG A;  4ISQ A;  5HV4 A;  2VVE A;  1FAY A;  3FFZ A;  1S55 A;  3ASI A;  1GNH A;  5D21 A;  3N7K A;  5F3G A;  1QGL A;  1N3O A;  2QBX A;  4BXF A;  4OUE A;  5FO9 B;  3PIJ A;  4XXA A;  3RG0 A;  4DS0 A;  3NNG A;  2ZGK A;  2AUY A;  2J1S A;  3HIF A;  1RUJ 2;  3NV2 A;  1PMI A;  3I54 A;  3H3L A;  4IGO A;  2BGP A;  4AQS A;  1W8O A;  2DCY A;  2R32 A;  1EAH 3;  1NXM A;  4QMA A;  5FJH A;  1DGW X;  2VTF A;  3GF6 A;  1SCR A;  5DDJ 3;  4V2V A;  2QQL A;  2P6H A;  2GDF A;  4KI5 M;  2HBU A;  1DZQ A;  1OF4 A;  5FPZ A;  2EID A;  2W5F A;  1LEM A;  3BU7 A;  4UFM A;  1GLH A;  1S2E A;  4FPY A;  2IXH A;  4HK8 A;  4YLZ A;  1YQ8 A;  1YFX A;  2R04 2;  2WT1 A;  5DDJ 1;  3CJI B;  4QU1 A;  5FZE A;  4DUW A;  4XQ4 A;  2OZJ A;  2YY1 A;  2J1R A;  1WUV A;  2R07 3;  2GH2 A;  4LK6 A;  3OUI A;  5FOB B;  4XF4 A;  4E2Q A;  1IG3 A;  1L7Q A;  3I49 A;  4OUM A;  4CCK A;  3JU9 A;  1AJK A;  2ARX A;  1JH5 A;  4LR4 A;  3OGR A;  2R07 1;  4BJ0 A;  4HMZ A;  4WV8 A;  3LDK A;  3SLI A;  2ZTN A;  1HRI 2;  4NWV A;  3EMR A;  3F2Z A;  1DIW A;  1LRH A;  4YW2 A;  4LT5 A;  2W47 A;  4A45 A;  4CEY C;  2BRT A;  4DXS A;  1ZYB A;  3MIE A;  3KCX A;  1OKO A;  1SBF A;  5FZ0 A;  4D7Y A;  3RJ2 X;  3QOP A;  4Q4X 3;  1VB2 A;  5AFB A;  4GWJ A;  2ARA A;  4S2F A;  4ONU A;  3R6S A;  4J6G A;  1VMH A;  3E6D A;  4NIG A;  2WWU A;  2EIG A;  1W39 A;  1APN A;  2PQS A;  2WT2 A;  4PHZ A;  2XJS A;  2ADE A;  3K2O A;  4LHK A;  4L92 A;  3OF1 A;  4QXC A;  2W87 A;  2EAL A;  4LOR A;  4Q4X 1;  1ZRE A;  2RJK A;  2VBD A;  1UKR A;  3O1R A;  4D8M A;  3I2K A;  1RTV A;  1V6I A;  3QH6 A;  4KH9 A;  4XJA A;  3VDD B;  4OHY A;  4ZON A;  4TXW A;  5SV5 A;  1H9W A;  2BEO A;  2P34 A;  3BPZ A;  1HKD A;  5FYT A;  4JQR A;  4UF0 B;  2RS3 2;  2Y64 A;  3OCP A;  3AMQ A;  1UXX X;  1Z0H A;  3VBS A;  1QXJ A;  5EPA A;  4RHV 2;  2DWR A;  5E89 A;  1T2X A;  2DTY A;  3K51 A;  5C8C A;  2JDZ A;  3OB8 A;  3I2I A;  1H1A A;  3H50 A;  1IQD C;  5FYI A;  5E88 A;  1S0B A;  1HB2 A;  1ND2 B;  2ZXQ A;  3PUR A;  3GHN A;  3VKM A;  1K3I A;  3OD4 A;  4QM8 A;  2OQ6 A;  1C4R A;  2JB8 A;  4AFA A;  1PK6 C;  1PMJ X;  4AQ2 A;  1RL3 A;  3Q8A A;  1PMH X;  2IXC A;  5GLV A;  1Q8V A;  5L7O C;  4E4S A;  2DBI A;  4CP0 A;  2Y33 A;  4AHX A;  1GZW B;  5F3C A;  4HKW A;  2B8M A;  4MVT A;  4FAH A;  4Z92 B;  2IXK A;  2K9Z A;  4OYU A;  4R9B A;  5LBF A;  2C24 A;  2J1E A;  5FZ6 A;  5A7W A;  1UF2 C;  3ALQ A;  2OT7 A;  4IXL A;  5DAX A;  2VNG A;  1RVF 2;  5IK7 A;  2HWD 2;  4BXS V;  3VGI A;  2WS9 2;  1HRV 2;  4MX3 A;  4D3W A;  2Y38 A;  3HAG A;  1SZB A;  4OHV A;  4DY3 A;  3I7D A;  4H7M A;  4D94 A;  2YG0 A;  2ZAC A;  1ENX A;  1F9K A;  4P9J A;  1JZ5 A;  4NID A;  4LIT A;  1EPW A;  2C9K A;  2XL9 A;  1DQ4 A;  2R0F A;  4D7S A;  3B00 A;  2JDN A;  2YGL A;  4XMA A;  3KSC A;  3LOI A;  2CDP A;  3SIT A;  2EXH A;  1AL2 3;  3RI9 A;  3KHB A;  3MPP G;  4DRR A;  3LEK A;  1QHD A;  1GZ9 A;  2GU9 A;  3KMH A;  5F7U A;  1VJ2 A;  2Q1F A;  4G9S B;  2ZEX A;  1G6N A;  4U36 A;  2XWB B;  2ID4 A;  3UGG A;  1PO2 3;  1H2N A;  2IXL A;  3U0Z A;  3VBR A;  2DVF A;  1WLT A;  2V72 A;  5C71 A;  1AL2 1;  1CES A;  5LBE A;  3FBM A;  4ARX A;  1U12 A;  3DEC A;  4IV1 B;  5FY4 A;  2P4E A;  3B9I A;  1DGL A;  1PO2 1;  2A75 A;  2OXB A;  2ZEZ A;  1ND3 C;  1MQT C;  4MGK E;  3I2D A;  4FP2 A;  1DF0 A;  1B35 B;  2D43 A;  3AX4 A;  3ME2 A;  4QQH A;  3T2T A;  3EHK A;  4YW3 A;  1ENR A;  1VBA 3;  1L3J A;  4FPO B;  3WQ1 A;  2YMZ A;  3GZA A;  2ZX0 A;  5I0R A;  5FOJ B;  2Q8C A;  1GKB A;  3N36 A;  3OPW A;  2CDO A;  1VBA 1;  3T0B A;  5A3O A;  3VD3 A;  4R9A A;  4WM8 B;  3ZPO A;  3NNJ A;  1TZO A;  1UOB A;  1CIW A;  2CGO A;  4XJZ A;  4D6R A;  3SQO A;  1N3P A;  4CU8 A;  3POS A;  2JB4 A;  1V6N A;  5FYM A;  4QT6 A;  2ARE A;  4IL7 A;  5BNN B;  4XHB A;  1DQ0 A;  1V9U 2;  4D0Q A;  5J37 A;  1LOF C;  2FDF A;  4P08 A;  2ATF A;  4PDW C;  3VBU A;  2RDN A;  3KHC A;  4TLF A;  5CB7 A;  4ARY A;  4NHY A;  2IVI B;  5ACA 2;  2ARB A;  1DBN A;  3DXU A;  3MUZ 1;  1OFS A;  2QQV A;  2R06 3;  2O1Q A;  4AFM A;  2VTX J;  4OCT A;  4LOS A;  5LA9 A;  3WSO A;  2R0H A;  2XHN A;  1ND2 A;  3VB9 A;  1CAW A;  1QWR A;  4LBQ A;  1VRH 2;  3ES4 A;  1GBG A;  3WW4 A;  2C9A A;  2PQQ A;  1TNF A;  2VOT A;  5E6H A;  5JVV A;  2QQP A;  2FDI A;  4CP1 A;  4BZ4 A;  4ZU4 A;  1H9P A;  2Y0I A;  2XDV A;  1DGR A;  3TRS B;  1TVG A;  2VW2 A;  4HK9 A;  1GZW A;  2HKX A;  2ZEY A;  3DYO A;  3B9C A;  4JV4 A;  5F5A A;  4OI1 A;  5D8A B;  3PDQ A;  2Q5T A;  1IKQ A;  1GP5 A;  4AAP A;  3W58 A;  3RZJ A;  1UYZ A;  5FV3 A;  2UWA A;  4E4D X;  1QJY 2;  1BLZ A;  3PUA A;  4LBN A;  4D69 A;  3HMY A;  2Y6K A;  3ZFE C;  4PI2 A;  2AC1 A;  2VH9 A;  1WLD A;  4CZS A;  2ZAH A;  5C70 A;  3ILF A;  4MAD A;  3O1T A;  4XF1 A;  1E5I A;  2WSV A;  5CFC A;  1WW6 A;  3KV6 A;  3ZXA C;  4XMI A;  1AX0 A;  1O59 A;  3UGH A;  5BNO B;  1V6O A;  2A3Y A;  4LHS A;  4FFI A;  3RZZ A;  1CR7 A;  4ATF A;  1GWK A;  3I8T A;  1C1F A;  1Q8O A;  4BIO A;  5I0S A;  4Y3O A;  4GWI A;  5IJR A;  5A3U A;  4UOJ A;  1H6X A;  1Q8Q A;  1W6M A;  2SLI A;  4IV1 A;  1PVX A;  3S5A A;  3POB A;  2R1D A;  1BVV A;  4A2U A;  4QPG B;  1UZV A;  5I0T A;  1IQA A;  1B35 A;  2P6C A;  2D97 A;  1PM4 A;  1CN1 A;  2GP5 A;  2HEY F;  4LTA A;  5GZF A;  2VOX A;  4MET A;  4N7I A;  1XE7 A;  3C8X A;  2JDH A;  4PF5 A;  1UWW A;  3OPT A;  4P5H A;  3U10 A;  1XNB A;  5KHJ A;  2VG9 A;  3SH3 A;  1RUE 3;  4JC1 A;  1DZT A;  3J8F 2;  3O1M A;  2BGC A;  2ZAB A;  1KGY A;  1IHM A;  3DL3 A;  2J1V A;  1GOH A;  4P9Y A;  3DKW A;  2XJT A;  4C0B A;  1RUE 1;  2UYA A;  4YM0 A;  5FZL A;  5BNN A;  4K21 A;  2R49 A;  2VJX A;  3H8R A;  3X29 B;  5KC5 A;  1UY3 A;  3RS6 A;  4KGQ A;  4Q4Y 2;  5BNP A;  2RM2 2;  4P9I A;  3UKV A;  3ZXK A;  3AVR A;  1R64 A;  2ZOE B;  3CJI C;  2F4L A;  3ZYI B;  3ORJ A;  4I3P A;  3RI8 A;  4JKL A;  2X53 S;  1ASJ 1;  2UY8 A;  2VD7 A;  3ROU A;  1TME 2;  1TMF 2;  1RUF 2;  4QHO A;  3WLU A;  4YFZ A;  4HL0 A;  3TAY A;  2XJV A;  4WVV A;  5CFD B;  3NV1 A;  4C0H A;  4C1X A;  4Q0S A;  3HT2 A;  4DQA A;  5HPO A;  3G6J B;  4LK7 A;  1PHM A;  4CCL A;  2Y6J A;  2Q8D A;  4GWM A;  4LO8 A;  4E8C A;  3VBF B;  3RMY A;  2ZKN A;  3IKW A;  1PO1 2;  1ULE A;  5T3N A;  4QB6 A;  1VAV A;  2B7Y A;  4XIL A;  5IW0 A;  4OQ9 A;  1RUD 2;  3NW4 A;  1AXY A;  3J7L A;  1LUL A;  4EWD A;  1W9Y A;  2WUH A;  4AFD A;  5CAD A;  1CVN A;  3O12 A;  1JYX A;  4YFW A;  2GSY A;  3WQ7 A;  3MO4 A;  3UV9 A;  4PCR A;  3ZFF B;  1W2A X;  2ZX1 A;  4KNC A;  3WDV A;  1RUH 3;  4BH9 A;  3H8O A;  1CIY A;  1PGL 2;  1AR6 2;  1AYM 2;  1MVQ A;  2RMU 2;  4QPI B;  3ZDS A;  5J09 A;  3OD0 A;  2E6V A;  1YC6 1;  4IEZ A;  5IVB A;  1U5Z A;  1FPN 3;  4BQ1 A;  4RYD A;  1ZX5 A;  1Y3T A;  3T1L A;  3VDD C;  3LE0 A;  1RUN A;  1BMV 1;  1RUH 1;  1AR8 2;  5KXB A;  4WM7 B;  1O4Z A;  1NCQ B;  4WBB A;  5KR7 A;  3E97 A;  5LA2 A;  1CJP A;  1A78 A;  1FPN 1;  4P5Y A;  2HJI A;  5FWJ A;  3I3B A;  3S0M A;  3I2O A;  4XUN A;  4BOW A;  3PMS A;  2OQ7 A;  3S5Q A;  3V0A A;  2OKX A;  1LHW A;  5F39 A;  1NT0 A;  1SEF A;  1WKY A;  2FDJ A;  2DCT A;  1KQR A;  1PNF A;  4ZPI A;  2PEL A;  5DAV A;  4UWD A;  3OSD A;  1O8P A;  1GSL A;  2Z42 A;  3WF4 A;  2VZS A;  1RXF A;  2XBO 3;  4RFT 0;  1CON A;  4BQY A;  1PM7 A;  3AZW A;  4XUQ A;  5EHD A;  3TWI A;  4AGV A;  4CUB A;  5JPM B;  3FWE A;  3VLB B;  1W6Q B;  1CAU A;  3N9O A;  3ZSM A;  5A70 A;  2A6X A;  2X05 A;  2XBO 1;  4IGP A;  4KMQ A;  3CQO A;  1N1S A;  3BAL A;  3PVE A;  2Y6L A;  1XB9 A;  2X29 A;  3O5S A;  3WDT A;  3FHA A;  1W8U A;  5K0U A;  2W95 A;  1KD7 A;  1WWY A;  3DUI A;  4M0N A;  5FZO A;  2PHW A;  3BB6 A;  3U1X A;  4RGA A;  4L97 A;  2VXJ A;  3WUD A;  2JDM A;  2X10 A;  4JTN A;  4A42 A;  1KXG A;  4DOU A;  4RA0 A;  3LD8 A;  4MOA A;  5HXV A;  1VMF A;  4WVZ A;  5T54 A;  1JBC A;  1ZNP A;  2JEC A;  3AYC A;  4TWT A;  5DDJ 2;  1SG3 A;  1LOB A;  4Y1U A;  4IV1 C;  1VBD 3;  3TOJ A;  1JZ6 A;  2ZPX A;  4BQ4 A;  5DUX A;  2V5Y A;  4N53 B;  2XKO A;  4HSJ A;  1O4Y A;  1QDO A;  1UU4 A;  1P8J A;  4M3C E;  4XQD A;  1YUD A;  2BNM A;  4A44 A;  1NA1 A;  3VHO A;  2PA7 A;  4Q4W 3;  3WR0 A;  1VBD 1;  4W6X A;  3SCH A;  4IEQ A;  3O0X A;  4ES8 A;  2R07 2;  2BUK A;  1VPH A;  3J7H A;  3OBZ A;  1NX9 A;  3AB0 A;  3H1M A;  3LSD A;  2XVG A;  4LKF A;  4MUV A;  4XIO A;  5EZW A;  5A80 A;  3SMH A;  3UKN A;  3VHN A;  3ZFF A;  3O1S A;  1XSQ A;  2WSU A;  1NKG A;  4Q4W 1;  2FHR A;  4WM8 C;  1HDK A;  1CZT A;  4UFJ A;  4QPI A;  5A6Z A;  1H1I A;  3VZK A;  3J7M A;  4XOG A;  2BNN A;  1YQ6 A;  4GAZ A;  4M3C B;  5BNN C;  4WVM A;  1NCQ A;  1N47 A;  3LEM A;  4PT6 A;  1REF A;  2DCZ A;  1IS4 A;  1H4G A;  2ZGR A;  4Q4X 2;  3MW4 A;  5JCT A;  2O8O A;  5K9Y A;  3UL2 A;  4IE6 A;  2G19 A;  5B2G B;  3WF1 A;  1TQ5 A;  2PHD A;  4XF3 A;  2IUW A;  4MSV A;  4KU8 A;  3AMN A;  2QQU A;  4JGY B;  3RPQ A;  5FKC A;  3GBW A;  4K7J A;  4PLN A;  3V0B B;  3VZO A;  1OKQ A;  1Q43 A;  1K42 A;  1YI7 A;  1DYO A;  4P9X A;  4IEP A;  3BI3 A;  2JX9 A;  2GC2 A;  4PIY A;  2OVU A;  1DDL A;  1LOG A;  1CZS A;  2YFZ A;  4P14 A;  1NAE A;  3M4F A;  1WMF A;  1T6B X;  1DHK B;  5D8A C;  3OBA A;  2NMN A;  4JGZ A;  3WD5 A;  4QHZ A;  3UET A;  2D40 A;  4UBG A;  4IV3 B;  2J1U A;  1O3T A;  2Y8K A;  2DVD A;  3A7Q A;  2YBK A;  2RG4 A;  3U4X A;  2WYF A;  5L9B A;  2RDR A;  3MW3 A;  4CCJ A;  4HVQ A;  2CTV A;  3LDB A;  2VMG A;  4PI0 A;  1LU1 A;  2CHH A;  4HVR A;  4PBP A;  3E5U A;  1H8T A;  4BDV B;  5IVJ A;  1J83 A;  1W0N A;  1YWK A;  3QD6 A;  1RHI 3;  4O9E A;  2ZGO A;  3KF3 A;  5IAV A;  4BQ2 A;  4CDX C;  4LO6 B;  3WCR A;  2B42 B;  1OH4 A;  4YM1 A;  5K4L A;  4IEU A;  5F9T A;  1A34 A;  5EXO A;  2L9L A;  4IER A;  1TE1 B;  3TBD A;  5BNO C;  1JOP A;  3RVH A;  1LEN A;  1RHI 1;  5JIA A;  4I0A A;  1FAT A;  2ARC A;  1OD5 A;  5FAX A;  1MVE A;  1H8V A;  4CU9 A;  5JAX A;  1J1T A;  4YW1 A;  1K5M B;  5FY0 A;  3RNS A;  3AVS A;  1OOP A;  4YZ4 A;  3T1M A;  3SNM A;  4QPG C;  1W8N A;  3WF3 A;  5ABJ B;  3T2P A;  2JG8 A;  3FX3 A;  1W9W A;  4LBL A;  5EWS A;  4JAA A;  1S2K A;  5D2A A;  5C4W A;  2ZEW A;  1AL2 2;  1YYN A;  1GP6 A;  1W2N A;  1AX1 A;  5FMB A;  4BB3 A;  4J25 A;  4IEO A;  1YI9 A;  3O7O A;  2QKD A;  5I0U A;  4QDS A;  3KCC A;  1PO2 2;  4GMP 0;  2JDK A;  4L8Q A;  2CWS A;  4QQL A;  4C8D A;  3BCW A;  1DP0 A;  1BHG A;  1SFY A;  3AL6 A;  3RJR A;  5JXG A;  3KF5 A;  3EBR A;  4TLG A;  3O1V A;  3VBO A;  3JZV A;  1UNB A;  3MIB A;  3IMM A;  2B46 X;  1OF3 A;  2VBB A;  1UPS A;  3HPN A;  5CZK A;  4M3C A;  4Z2W A;  4LE3 A;  1QNW A;  1F5F A;  1VBA 2;  3BOP A;  2R6Q A;  2DCK A;  1X7N A;  4XDQ A;  2K46 A;  4OZX A;  2WNU A;  2VMF A;  3PIG A;  2O8Q A;  1CAV B;  3KD4 A;  3MF9 A;  4KWK A;  4XAE A;  2VMH A;  3ZN6 B;  4IE4 A;  1OXC A;  5A1A A;  2CAU A;  1CJD A;  3NV3 A;  4IET A;  3CKH A;  3APB A;  2QTW B;  4UT5 A;  4KBZ A;  1J58 A;  2DF7 A;  3AK0 A;  4AR2 A;  2RS1 3;  1JI6 A;  3HEI A;  5A6Q A;  3W5N A;  3E5X A;  4OHZ A;  1YXW A;  4S2H A;  5FYZ A;  1I6X A;  1WA4 A;  2QE3 A;  1FOD 3;  4Q0V A;  1IG0 A;  1U0A A;  1RC6 A;  3MIC A;  3OGJ A;  4FOW A;  2Y0O A;  4MV2 A;  5D1I A;  3WG1 A;  2A6Y A;  4B4Q A;  5CFD C;  5DAP A;  4AK3 A;  3VD9 A;  1POV 0;  2D7F A;  1F4H A;  2IVJ A;  5CG9 A;  2Q0A A;  1L7R A;  2GN3 A;  2D44 A;  3LCP A;  2WR9 A;  3O1P A;  3VBF C;  1XE0 A;  4Q0U A;  4CUG A;  1FOD 1;  5IK8 A;  4D6S A;  1STM A;  4IV3 A;  2E51 A;  1E5H A;  4QU2 A;  3WQB A;  4I02 A;  1UY4 A;  2Z2S B;  2OUJ A;  2UY9 A;  4FOV A;  4FO9 A;  3BOW A;  2PHU A;  1FV3 A;  5H9P A;  3H42 B;  4HET A;  2EXI A;  2VNR A;  5JI7 A;  2JG9 C;  1H2K A;  3PUH A;  3FZ3 A;  2VZP A;  3GCW A;  4LHL A;  5E8A A;  2B9V A;  3OG2 A;  3C7O A;  1HQL A;  2RJ2 A;  2CGN A;  3ZMO A;  5I93 A;  5APA A;  5I91 A;  4WM7 C;  4AGR A;  5DUV A;  4A6S A;  2A71 A;  2P3I A;  1Q56 A;  2FCU A;  3OBR A;  4HAN A;  4MGI E;  2WAA A;  4XF9 A;  5BXX A;  4Y20 A;  3C7E A;  1D4V B;  2D5H A;  2E31 A;  2ORX A;  5ABJ A;  2BER A;  3AJZ A;  4QQP A;  2D3P A;  2LAL A;  2SBA A;  3HR9 A;  2XJR A;  4XDO A;  1JHN A;  3HQU A;  2Y6H A;  5FZ4 A;  1C8M 3;  2FMD A;  2W1Q A;  4RFR B;  5JSP A;  1SLT A;  1D4M 3;  4W8J A;  4RR3 A;  5G04 L;  1UYY A;  5FQ0 B;  1OI6 A;  1YHF A;  2V09 A;  5DAW A;  1S4C A;  3GZT B;  2ZGT A;  1KS4 A;  5JMO A;  3VUO A;  2DU0 A;  2A70 A;  1C8M 1;  1O5L A;  1WCK A;  1D4M 1;  3IDC B;  4AWD A;  3W9A A;  3NVC A;  3VD7 A;  2H0B A;  3RZM A;  2CSG A;  2W46 A;  5CEH A;  5JSR A;  4DRV A;  2ZHM A;  4LKD A;  2BDR A;  1QJE A;  1R09 3;  4DNY A;  1OQ1 A;  2PTM A;  3POE A;  3SH5 A;  2IXI A;  4CCO A;  4OI0 A;  1AYN 3;  3IWZ A;  1YO8 A;  5BV6 A;  4FQZ A;  1GU3 A;  2GAL A;  2DBN A;  4B3N A;  1WD4 A;  5GZE A;  3N4M A;  2PMW B;  3WNL A;  1VBE 3;  4E4Z A;  1R09 1;  2B45 X;  3VBS B;  3BN6 A;  4FPF A;  1MPX A;  1ZRR A;  1RUE 2;  1AYN 1;  5F6L B;  1EUT A;  2ET1 A;  1PX4 A;  1UZW A;  5EV7 A;  1UCX A;  4CDQ B;  1VBE 1;  2E53 A;  1OA4 A;  3R0R A;  1U5I A;  3H7Y A;  1D0G A;  3WEZ A;  1GQH A;  3D8C A;  3MIH A;  5L9R A;  2YC0 A;  1ASJ 2;  1R1Z A;  2YGM A;  3OY8 A;  4XET A;  4N53 C;  3CZJ A;  5JR2 A;  3ZLI A;  3GGL A;  4FPJ A;  5A7W B;  3FUQ A;  4I3G A;  2C1F A;  4AI3 A;  2WRA A;  3D0J A;  1ZRF A;  1M4W A;  2VQA A;  3POG A;  4KL1 A;  5FZG A;  4ZHN A;  1JOJ A;  2WZE A;  4I2O A;  3W59 A;  2XWJ B;  3DCQ A;  3LWC A;  4PBO A;  4AI0 A;  2LS6 A;  2VUA A;  1Y7B A;  5IAX A;  1JYW A;  3HNB M;  1EAH 1;  3IDE A;  1WGP A;  1JUH A;  3CLP A;  1JMU B;  2VCA A;  4C90 A;  1RIT A;  4QPW A;  3VD5 A;  1WW4 A;  1YQ5 A;  2ZAA A;  2ZGS A;  1QU0 A;  1AUY A;  2A7A A;  2VVF A;  4H2A A;  3T0A A;  2GAU A;  4FFF A;  1X50 A;  4Z07 A;  1J1L A;  3PNA A;  1F4A A;  3SHR A;  3VBR B;  4A7Z A;  5FO8 B;  3VHP A;  2FCV A;  3NJX A;  1OUR A;  1JZ3 A;  3IB3 A;  3U14 A;  5JSO A;  1FV2 A;  1UD1 A;  3ZXE A;  4GH4 A;  2KA3 A;  2XH6 A;  4XVH A;  3LSE A;  2RHP A;  3WNM A;  3D4K A;  2B39 A;  1BMV 2;  1RUH 2;  5FK8 A;  4JGY C;  1OLM E;  5IVE A;  3NV4 A;  3VDA A;  1W8F A;  1W0P A;  3OPZ A;  5FQ0 A;  1UQX A;  3AJY A;  1FPN 2;  4J1X A;  4BQW A;  1VRB A;  5FWE A;  4CE8 A;  5FXV A;  2YDE A;  1DYK A;  5JZG A;  3M8L A;  4MXV A;  2E7Q A;  1YFY A;  3ZYJ B;  2ETE A;  4JCK A;  4LUK A;  1HQN A;  4QKB A;  5TSW A;  4IV3 C;  3ZSE A;  4BQX A;  4ASL A;  4MLO A;  1KFX L;  3HD8 B;  1W9S A;  1RB8 G;  1OQE A;  2BBA A;  2DFB A;  3MLK A;  4L0P A;  4QX1 A;  4GAL A;  2J1A A;  4AAX A;  3VBH A;  4CEW C;  4BA6 A;  5LBB A;  4IQP A;  3A0K A;  4IGQ A;  1ZRI A;  4XXP A;  3VBU B;  4F83 A;  3C7H A;  3KV4 A;  4M01 A;  2LRO A;  3H3Z A;  3AYE A;  1FNZ A;  3TEY A;  4FTS A;  4LBK A;  1WA6 X;  2XBO 2;  4B1L A;  1UIJ A;  1EV1 3;  2E26 A;  2KM2 A;  4CDQ A;  2PAE A;  4N9H A;  2XQX A;  3LA7 A;  2DUO A;  1CAW B;  2GC0 A;  4GKY A;  4LBQ B;  3NKG A;  1F2N A;  4N43 B;  1N1T A;  4DXR A;  1K5M C;  1LGN A;  5FFO C;  1N1V A;  4Y33 A;  3FLR A;  2JJ6 A;  4Q27 A;  5JUV A;  2WZR 3;  4AE2 A;  5CA6 A;  4NPM A;  1BBT 3;  1BYH A;  5ABJ C;  1C28 A;  3KGZ A;  3N9Q A;  5JOW A;  1MZE A;  1XBF A;  2OPK A;  3WP3 A;  2P5B A;  3RMX A;  3N7J A;  1KDM A;  4LMF A;  3PLQ A;  5A32 A;  4M4R A;  2XUM A;  1BBT 1;  4LA2 A;  4W50 A;  3U37 A;  4NRM A;  5DUW A;  5IAT A;  1UIK A;  3N9N A;  3SIS A;  4UI9 L;  5CFC B;  2VZO A;  1WBL A;  5IWF A;  2FD8 A;  5J48 A;  1VBD 2;  5LRR A;  3RSJ A;  3M3E A;  4IEW A;  5KHG A;  1KIT A;  3ILR A;  4E2S A;  3RZH A;  4K1Y A;  2FZ2 A;  4XJU A;  3R05 A;  4Y5S A;  4KU7 A;  4R9C A;  2DDU A;  5DG2 A;  2J1T A;  2AEY A;  3FMG A;  4Q4W 2;  3GBG A;  2YC2 A;  1WD3 A;  4GD4 A;  1HB3 A;  2JDA A;  3I3M A;  3CDZ B;  1X36 A;  1W6M B;  2BP6 A;  3M3Q A;  4ORF A;  3H1Y A;  1WLC A;  1OLR A;  3ZYP A;  3E6C C;  4YW5 A;  2Z4F A;  4HSL A;  1YJK A;  1Y9G A;  2GH8 A;  4GQ7 A;  4NWW A;  4EQV A;  4YM3 A;  5JIU A;  3CF6 E;  4IE5 A;  1FYU A;  1OPO A;  2VPV A;  3BKZ A;  2ZKL A;  3GXU A;  5FTT C;  4FCA A;  1GNZ A;  4JDM A;  2D3S A;  3HOB A;  3WW1 A;  3GHM A;  2OZ6 A;  3ZKY A;  5JMC A;  2Q30 A;  5C3O A;  5FZ8 A;  1W90 A;  1MZ5 A;  4XE9 A;  2R16 A;  4W65 A;  3RYP A;  4CDU B;  5IVF A;  4YSF A;  2QQO A;  3S57 A;  4URA A;  1GYK A;  4COU A;  3GBF A;  3N9P A;  5FZH A;  2BYV E;  5JR7 B;  1ULP A;  2XLF A;  2W1U A;  4QAW A;  4AED B;  1MEC 3;  2NM1 A;  5EYX A;  3I59 B;  2RS5 3;  3D0S A;  2GMM A;  4ZS3 A;  1PGW 1;  3OBT A;  1OLM A;  2EXK A;  5K7P A;  2W92 A;  5BNP B;  1UMI A;  1OH3 A;  4CYD A;  4BQ3 A;  1MEC 1;  3HVD A;  1DCS A;  2RS5 1;  3AKS A;  1XXN A;  2A6Z A;  2RJL A;  5AFE A;  4FPH A;  3NNL A;  2VNO A;  4QDR A;  3KWV A;  1WW5 A;  2FDH A;  1OVS A;  4QKF A;  5T52 A;  2XJP A;  1ULC A;  3LAG A;  4RQP A;  3I3E A;  4Y1V A;  4N43 A;  2CNA A;  3C2U A;  4E8D A;  4HON A;  1SHW B;  5LZ6 A;  1CX1 A;  2OUH A;  2R06 1;  3CBN A;  2P37 A;  1U5X A;  4DUX A;  1LOC A;  1COV 3;  4EN0 A;  1RHI 2;  4CCE A;  4OI4 A;  1DLL A;  2EIC A;  4UW4 A;  1C1L A;  1F15 A;  1K5J A;  5GAL A;  1ULG A;  4C1W A;  1W0O A;  2MNG A;  3M7A A;  1COV 1;  3VDB A;  2XXZ A;  3WNP A;  2FDG A;  1U5Y A;  2NP0 A;  2WII B;  1UYX A;  2PHT A;  4NRP A;  4CP9 B;  5BUV A;  3POJ A;  3A23 A;  1C3H A;  5C7G A;  1GWL A;  4KG0 A;  4KQ7 A;  1CWP A;  2PYT A;  2VBP A;  4RD7 A;  4F8A A;  1W6P A;  4AI8 A;  1LHO A;  1AXK A;  1W6O A;  1DQ6 A;  5IK5 A;  4NRQ A;  3RQ0 A;  1C5I A;  4Q0Q A;  5J7M A;  4Y5Z 0;  2WO1 A;  4LNV A;  4Z82 A;  4GUL A;  2HEV F;  1RUC 3;  3VBS C;  1W8H A;  1UXZ A;  1OQD A;  4Y5T A;  5GZC A;  4MZU A;  1Y9M A;  5C8C C;  4JDN A;  1DZR A;  2YUE A;  3OUH A;  3V0A B;  5LRS A;  4CDQ C;  1OA3 A;  1XOY A;  3ZXD A;  1RUC 1;  2IZW A;  5BNQ A;  2PLV 3;  3NRU A;  4PLM A;  4NII A;  3HQX A;  4CDU A;  5FP7 A;  1OSG A;  3H8U A;  1LED A;  5FZ3 A;  4E9K A;  2XJU A;  4BME A;  2E63 A;  2VNV A;  3OEB A;  4DIQ A;  3OEA A;  2A6W A;  4QGL A;  3USU A;  3WDU A;  2YFU A;  2A3W A;  5LBC A;  2PLV 1;  4LBO A;  2VAU A;  1CAU B;  4RGK A;  1Y43 B;  4AED A;  3I59 A;  4AHZ A;  3HBZ A;  3NJZ A;  4QM9 A;  2WT0 A;  5C5U A;  4PQ9 A;  3THC A;  1VE0 A;  3LOB A;  2E9Q A;  2QJV A;  3Q8F A;  2QCS B;  5K0U B;  1QJU 3;  5FY1 A;  3ELN A;  3GJA A;  1ZZB A;  5FZO B;  4RS5 A;  1FOD 2;  3N7L A;  4YG6 A;  4NIA A;  4I0W B;  3DEM A;  1HN0 A;  3PTY A;  3KT4 A;  4AVV A;  4HN0 A;  3CU7 A;  1QJU 1;  4WZC A;  4HG6 B;  5IYY A;  3H0O A;  2OX0 A;  4YZ2 A;  2WJS A;  3AFG A;  2VCC A;  5A3L A;  1BVP 1;  4ZKT B;  3VBR C;  3IIA A;  4TZD A;  1ZBA 3;  3QBQ A;  2VW1 A;  2ORZ A;  2VU9 A;  3QCW A;  1WMX A;  3LFI A;  5CIR A;  2DTW A;  5FMO L;  5LK7 B;  3W5M A;  2A3X A;  2JKX A;  4GWN A;  2LRP A;  2WFF 3;  4ZXK A;  5T5O A;  3J9S A;  3P5B A;  4ASK A;  4BE3 A;  5J1X A;  1LB2 A;  1ZBA 1;  1NA1 B;  4UYB A;  5FZ7 A;  3U4S A;  4BCU A;  1CGP A;  2DUR A;  4XTP A;  4NAO A;  3WT3 A;  4J1W A;  4ZY9 A;  2FBE A;  5CNA A;  2WFF 1;  4O7X A;  4S2G A;  1H1M A;  1LHV A;  4B29 A;  4CP9 A;  4XF0 A;  5C9A B;  3SKJ E;  1OPM A;  5T5L A;  4LUM A;  5CU1 A;  4EZ4 A;  2VW0 A;  5FPB A;  3VL9 A;  4YPJ A;  1RJ8 A;  3M3C A;  4Q1P A;  4MXW B;  4FTE A;  4XAB A;  1XYO A;  1IS3 A;  3LZZ A;  3M3I A;  5FZ9 A;  1HJF A;  1UOF A;  5HCA A;  1MZ6 A;  2YYO A;  1GZC A;  2Q8E A;  1ONA A;  2GND A;  2R1B A;  2AZ5 A;  1C8M 2;  4WVM B;  1LOD A;  4NR1 A;  3WXP A;  2DVB A;  1D4M 2;  3DPR B;  1UY2 A;  1LTE A;  3USS A;  3B94 A;  3VBU C;  1DU3 D;  3MID A;  5IFT A;  5KHK A;  4YZ5 A;  1SPP A;  4PJY A;  1CAX B;  4DUV A;  1AF9 A;  3ZSL A;  3KV5 A;  1G86 A;  4AL9 A;  1HB4 A;  4PF1 A;  1AZD A;  2WNV B;  1ND2 C;  4AG4 A;  4IUG A;  1GFF 2;  2VE1 A;  2HYX A;  4B1M A;  3QLQ A;  4N43 C;  2JE9 A;  1UO9 A;  1R09 2;  2JIC A;  2VOK A;  1LNS A;  3GZU C;  1S0J A;  2LTN A;  3A4U A;  1AYN 2;  4CU6 A;  2C4X A;  1DGR N;  1RUO A;  2XUE A;  1XYN A;  4B7E A;  2P17 A;  1VBE 2;  4JGZ B;  4PIX A;  4NHX A;  3H7J A;  5LWB A;  2CAV A;  3AL5 A;  4YVW A;  2VZU A;  3AP4 A;  2JEN A;  4I09 A;  2EA7 A;  2LW8 A;  2WQZ C;  1AXZ A;  1KDK A;  1GNY A;  2WLP A;  3H1W A;  3PL0 A;  3B5L B;  4FFH A;  4G4F A;  5GLW A;  1H8T B;  5JXI A;  1JS9 A;  2I07 B;  4FPL A;  4YG3 A;  4LOT A;  4YVS B;  2Y6F A;  4IDZ A;  2P3K A;  3JD7 3;  2IWG B;  2LM3 A;  2ZCW A;  3POW A;  5CFC C;  1ODN A;  3NST A;  3AFK A;  2XKP A;  2E7T A;  4CCN A;  2WC2 A;  1UX6 A;  3PUQ A;  4YNI A;  3BPS A;  1ZA4 A;  3OUJ A;  2A6V A;  3F95 A;  2YPD A;  2V4A A;  1EAH 2;  1VBC 3;  3JD7 1;  1S2B A;  2VUJ A;  3ATG A;  4CP2 A;  3WX5 A;  1FT9 A;  4GA9 A;  1I5P A;  1HLC A;  3SXW A;  1CD3 G;  1OOP B;  2LUW A;  4QKD A;  1FX5 A;  1SMV A;  4W4Z A;  1GWM A;  1VBC 1;  2W08 A;  5A7O A;  1B35 C;  2AGS A;  2JG8 B;  2RR1 3;  4D6Q A;  4UW3 A;  3ILN A;  3CMG A;  5C4W B;  4PLO A;  3GZE A;  4Q4V 3;  1OVP A;  5LY2 A;  3RYK A;  2OA2 A;  3KZ4 C;  4M3C F;  4YGD A;  3NL1 A;  2VMC A;  2HWE 3;  4M00 A;  4IE0 A;  5C9A A; 
#chains in the Genus database with same CATH homology
 1JZ4 A;  2BZD A;  2Y64 A;  1UXX X;  2W9X A;  4A41 A;  2W94 A;  2J7M A;  1UMH A;  3PUH A;  1T2X A;  2VZP A;  4JKK A;  3OB8 A;  3I2I A;  2B9V A;  3OG2 A;  3C7O A;  5HXM A;  1IQD C;  2RJ2 A;  2ZXQ A;  4A6O A;  1K3I A;  1JU4 A;  2WAA A;  1PMJ X;  1PMH X;  3K75 B;  3C7E A;  2E31 A;  2VL4 A;  2ORX A;  3K4Z A;  2BER A;  5G05 L;  4OYU A;  2J1E A;  3CZU A;  2Y6H A;  4BXS V;  2W1Q A;  4W8J A;  5G04 L;  1UYY A;  1ULO A;  5JXJ A;  1TG7 A;  2YG0 A;  2VQT A;  1JZ5 A;  5JMO A;  3FHQ A;  3VD4 A;  2C9K A;  5B4X A;  5I0D A;  2VQU A;  3VD7 A;  2CDP A;  1XC6 A;  2W46 A;  5EJZ B;  3LEK A;  5F7U A;  3III A;  1J84 A;  2ZEX A;  3NJV A;  2ID4 A;  5LA0 A;  1GU3 A;  3T09 A;  2V72 A;  5C71 A;  3WNL A;  4ARX A;  3DEC A;  2XOM A;  3BN6 A;  4CVU A;  3ABZ A;  1MPX A;  3IDA A;  2ZEZ A;  1EUT A;  1PX4 A;  3HNM A;  5LCW L;  3K4A A;  4JX0 A;  3UES A;  3WEZ A;  4JKM A;  2VR4 A;  3ACF A;  4XUP A;  3VD3 A;  3T0B A;  2CDO A;  2WZ8 A;  3CZJ A;  5JR2 A;  1JZ2 A;  3GGL A;  3DYP A;  4XUR A;  4CU8 A;  2RV9 A;  2VZV A;  3IAP A;  1GQP A;  2YC4 A;  1JZ7 A;  2WZE A;  3P1I A;  1HN1 A;  1JYW A;  2LS6 A;  3ACG A;  2WO3 A;  4D0Q A;  3EYP A;  4P08 A;  3HNB M;  1WCQ A;  2VCA A;  4ARY A;  4QPW A;  3VD5 A;  3ZM8 A;  3MUZ 1;  4MO3 M;  3T0A A;  4QDQ A;  3WF2 A;  5JXH A;  3MV0 1;  3WSO A;  2XHN A;  1F4A A;  2VZR A;  5IHR A;  2VOT A;  2VZ1 A;  3ECQ A;  3NJX A;  3C7F A;  1JZ3 A;  3IB3 A;  3FL7 A;  1SDD B;  1TVG A;  4XVH A;  2WYS A;  2ZEY A;  3DYO A;  5DQ0 A;  3WNM A;  5DPN A;  3T08 A;  1UYZ A;  3VDA A;  3WNK A;  2Y6K A;  2W91 A;  2W3J A;  5C70 A;  2VZ3 A;  4MAD A;  2WDB A;  4XUO A;  1GOG A;  3A21 A;  3FN9 A;  4UAP A;  3SEP A;  3WNO A;  1O59 A;  4ET7 A;  1W9S A;  2BBA A;  4L0P A;  4QX1 A;  4AAX A;  2XON A;  2J1A A;  4KWU A;  3IAQ A;  4LHS A;  3LEI A;  4BK4 A;  4GWI A;  2WN3 A;  5IJR A;  4A4A A;  5LA1 A;  4UOJ A;  1H6X A;  3C7H A;  2WBK A;  2E32 A;  4GZ9 A;  2E26 A;  2XQX A;  4DEQ A;  3C8X A;  3WF0 A;  4DXR A;  1UWW A;  3I2H A;  3OGS A;  1JHJ A;  1GOF A;  5JUV A;  4M4P A;  2YB7 A;  3JXS A;  3HNY M;  3I2F A;  1KGY A;  1UX7 A;  2J1V A;  1GOH A;  4QB1 A;  2KD7 A;  4QX2 A;  4M4R A;  2VJX A;  4W50 A;  3CIH A;  2VMD A;  4MGS A;  2W1S A;  3U37 A;  1UY3 A;  2DCJ A;  4ZZ5 A;  3LPF A;  3DYM A;  4UI9 L;  4OMD A;  2VZO A;  1R64 A;  4XUT A;  3MUY 1;  4JKL A;  1PX3 A;  2VO5 A;  2DDU A;  2J1T A;  2YC2 A;  1XPW A;  2JDA A;  5HPO A;  3CDZ B;  3SKV A;  1CZV A;  2Y6J A;  3AC0 A;  2Z4F A;  4E8C A;  1XNT A;  2R7E B;  4OZO A;  5DMY A;  2WO2 A;  3NQH A;  3GXU A;  1W9T A;  4QB6 A;  3HOB A;  2VC9 A;  2WUH A;  1JYX A;  3T2Q A;  3MO4 A;  2QQO A;  4CUC A;  2VZQ A;  1CIY A;  4LPL A;  1ULP A;  2W1U A;  2BGO A;  4QAW A;  1DLC A;  4RYD A;  3LE0 A;  1H6Y A;  2V4V A;  2W92 A;  3UNP A;  1UMI A;  1KEX A;  3T2O A;  5LA2 A;  4P5Y A;  1XNA A;  4LQR A;  3I3B A;  3BGA A;  2Y6G A;  3K77 A;  4XUN A;  4QDR A;  2OKX A;  4CUA A;  3I3E A;  1WKY A;  4MGQ A;  5CYY A;  4E8D A;  2RVA A;  1SHW B;  1O8P A;  1CX1 A;  3HJR A;  3WF4 A;  2VZS A;  4DUX A;  3LEG A;  1OT5 A;  1UZ0 A;  4XUQ A;  4CUB A;  3I97 A;  1GMM A;  2EIC A;  1GUI A;  2X05 A;  4CU7 A;  3THD A;  3HN3 A;  3C7G A;  4KMQ A;  4DEV A;  3CQO A;  3VDB A;  2Y6L A;  3WNP A;  3FHA A;  1UYX A;  2W95 A;  2HLE A;  5EJ1 B;  3A23 A;  3VDC A;  5C7G A;  3MBW A;  2JD9 A;  2EIB A;  2X10 A;  1JU3 A;  2QQI A;  3MV1 1;  4A42 A;  4QX3 A;  4MOA A;  3I2J A;  2B4K A;  3PUI A;  2WO1 A;  2WAB A;  5B4N A;  4OMC A;  1SG3 A;  3SEE A;  1JZ6 A;  3ACI A;  1UXZ A;  2EIE A;  4BK5 A;  1P8J A;  4A44 A;  2VCB A;  1YQ2 A;  4DXT A;  4ZZ8 A;  1OD3 A;  2JE8 A;  2X09 A;  3NRU A;  3J7H A;  4Z2A A;  1NX9 A;  2QQM A;  1RYY A;  1NKG A;  3OEB A;  2QQN A;  3OEA A;  1CZT A;  2YFU A;  3E1F 1;  3LQC A;  2VZT A;  3THC A;  3K4D A;  3I2G A;  4PT6 A;  4JHZ A;  2QQK A;  2V5D A;  4LKS A;  4RN5 A;  1JZ8 A;  4QX0 A;  3WF1 A;  5DN2 A;  4A3Z A;  4HG6 B;  5IYY A;  2J22 A;  3OGV A;  1UY1 A;  1K42 A;  2VCC A;  1DYO A;  3GDB A;  4QB2 A;  2ORZ A;  3LPG A;  1CZS A;  2YFZ A;  2JKX A;  1US2 A;  1NAE A;  3W5M A;  5J1X A;  1US3 A;  2W1W A;  3OBA A;  3UET A;  1K45 A;  2J1U A;  2Y8K A;  3A7Q A;  2WN2 A;  4ZY9 A;  3ACH A;  4BDV B;  1J83 A;  1W0N A;  3SKJ E;  1UY0 A;  3I3D A;  4YPJ A;  1OH4 A;  1D7P M;  1O8S A;  2L9L A;  3T0D A;  1NUK A;  3K46 A;  4TTG A;  3WNN A;  3GM8 A;  4CU9 A;  1UY2 A;  2WQ8 A;  2QBX A;  4OUE A;  5IFT A;  3NNG A;  2J1S A;  4DUV A;  1W8N A;  3WF3 A;  3T2P A;  2BGP A;  1W9W A;  4PF1 A;  1W8O A;  3D3A A;  4AG4 A;  4IUG A;  2HYX A;  2ZEW A;  2VTF A;  1JYV A;  1LNS A;  4ZXE A;  2QQL A;  2QQJ A;  4QDS A;  4KI5 M;  1OF4 A;  4FI9 A;  5EIY B;  2EID A;  2C4X A;  2W5F A;  4CU6 A;  1DP0 A;  2WAO A;  1BHG A;  5JXG A;  4DUW A;  3EB7 A;  4P02 B;  2J1R A;  2VZU A;  1OF3 A;  3A22 A;  2VME A;  4P00 B;  3HPN A;  2LW8 A;  5CZK A;  1GNY A;  1L7Q A;  2VM9 A;  5JXI A;  2DCK A;  2VMF A;  3OGR A;  1K12 A;  4BJ0 A;  5A1A A;  1JYN A;  3CKH A;  2E33 A;  3F2Z A;  1JI6 A;  2W47 A;  3HEI A;  3W5N A;  4A45 A;  3ETP A;  2C26 A;  4DXS A;  5IFP A;  3P6B A;  4GWJ A;  1I5P A;  5FUI A;  3VD9 A;  1F4H A;  2PQS A;  1W99 A;  1L7R A;  4W4Z A;  2W87 A;  3CMG A;  4D8M A;  3I2K A;  3WQB A;  1UY4 A;  4TXW A;  4XZU G;  2VMC A;  4PQQ A;  1EUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...