1UYXA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellobiose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
b'MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE B
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uyxA00
2WO1A 1UXZA 2VM9A 2VZ1A 4AAXA 3PUIA 1JZ2A 4OMDA 5JMOA 4JKMA 4ZZ8A 1JI6A 2VCCA 1JYWA 3EB7A 4L0PA 2E26A 1W0NA 2ZEWA 2QQKA 2VQTA 1PX4A 3IAPA 4QB1A 2VZQA 2VMCA 2V4VA 3D3AA 3DYOA 1UY4A 4OYUA 1JZ7A 3ZM8A 2EIDA 2QQOA 2ZXQA 4P00B 5C71A 1J84A 1SDDB 4BXSV 1JYVA 3ABZA 4P08A 2W5FA 1CZVA 4QX0A 2YC2A 3T0AA 2VZRA 1UYYA 3OEAA 3THCA 2XOMA 1EUUA 2KD7A 3NQHA 4PT6A 4CVUA 1TG7A 2X09A 3WF2A 1GOHA 2W1QA 3I3BA 4ARYA 2QQJA 3OEBA 4ZXEA 4QDQA 1W9SA 4BK4A 3C8XA 1OD3A 1L7QA 2W46A 3IAQA 4XURA 1J83A 4D8MA 2BBAA 3FHAA 4LPLA 2VMEA 1OH4A 5F7UA 3SEPA 3WF1A 3T0BA 4OMCA 2C4XA 2Y8KA 2J1AA 3P6BA 3WNKA 4XVHA 3LPFA 4BJ0A 4QX2A 3HEIA 3MO4A 4P02B 3WF0A 2ZEZA 5HXMA 2V72A 4GWIA 2W1WA 2VZSA 3P1IA 3ETPA 3A23A 1GNYA 2WBKA 3FN9A 3DYPA 4W4ZA 4CU6A 4RYDA 2YFZA 1JZ4A 4CUCA 4CUAA 3FL7A 1D7PM 3C7FA 4UI9L 2VR4A 1XC6A 4DUXA 3VDCA 2QQMA 1GU3A 1K3IA 1GOGA 3IIIA 5JXHA 2ID4A 2W1SA 2WQ8A 4UOJA 4TTGA 1OT5A 4JKKA 1US2A 2WO2A 4TXWA 2WYSA 3I2IA 2J1TA 2WDBA 2EIBA 3F2ZA 2WAOA 3I2FA 4DXRA 3UETA 3I2JA 1WKYA 4E8CA 5DN2A 3GDBA 4XZUG 1XPWA 3CMGA 2WZ8A 4QDSA 2J1SA 1NAEA 2LW8A 3HOBA 3I2KA 2J1RA 3FHQA 1OF4A 2VZTA 4A44A 3OGVA 2Z4FA 5IHRA 1UMHA 3NRUA 2VC9A 3EYPA 2VZVA 4MOAA 1SHWB 3OGSA 3WQBA 3WNMA 1W9TA 4JHZA 1UXXX 2YB7A 5EJZB 2YFUA 3HPNA 1W8NA 2RV9A 2W95A 2W94A 4ZZ5A 2EIEA 1K45A 3NJXA 2J1VA 2JKXA 2L9LA 3SKVA 4QAWA 5CZKA 4XUTA 1UY3A 4DXTA 2YC4A 1UY2A 5IFPA 4YPJA 1P8JA 2LS6A 3MV11 2EICA 4A6OA 1CX1A 1PX3A 1GMMA 5FUIA 4P5YA 3MBWA 3K46A 1JYXA 4PQQA 2PQSA 5LA2A 1DYOA 3C7HA 3OB8A 1K42A 4QB6A 3ACGA 3U37A 1I5PA 1UYZA 2CDPA 1US3A 2OKXA 2BZDA 5C70A 2Y6HA 2Y6GA 2VO5A 5G05L 2WZEA 1UYXA 3JXSA 3HNBM 4MADA 5DQ0A 2W91A 2X10A 3VDAA 2B9VA 5JXGA 2WABA 2XQXA 1R64A 3A22A 2E33A 3LEKA 3CZUA 2Y64A 2CDOA 4M4PA 1BHGA 3T09A 3VD7A 4MO3M 2J7MA 4CU9A 4CU8A 1PMHX 4ZY9A 1O59A 3K75B 4E8DA 2WUHA 3I3DA 1W9WA 1W99A 2VOTA 4KWUA 1CZTA 3NNGA 2QQLA 4LHSA 2QQNA 2JDAA 4BDVB 3WNPA 3ACHA 1JZ5A 3I3EA 3DYMA 5J1XA 3WNLA 3K77A 3WF4A 3VD5A 3WF3A 3E1F1 4A3ZA 2ORXA 2ZEXA 5LA1A 4A4AA 1JU3A 4OZOA 1F4HA 4BK5A 3OGRA 5A1AA 3I2HA 3CKHA 1JZ3A 4UAPA 1LNSA 3LE0A 3OG2A 3VDBA 1JZ6A 4DUWA 3LEIA 3ACFA 4MGQA 2VQUA 3WNNA 4CUBA 3I2GA 5B4XA 4DEVA 4GWJA 3T2QA 3W5NA 4JKLA 5EJ1B 2JE8A 5LA0A 1IQDC 4ARXA 5I0DA 3HNYM 4XUNA 3C7EA 2VL4A 2ORZA 4QX3A 4W50A 1KEXA 1MPXA 3OBAA 3NJVA 3HN3A 2Y6LA 2W47A 5LCWL 1OF3A 2V5DA 3DECA 3VD9A 3T08A 3CZJA 1KGYA 4LQRA 2YG0A 2W3JA 3MUZ1 5JXIA 3UNPA 1W8OA 4QB2A 2VZOA 4QPWA 3MV01 2QQIA 1O8PA 1NUKA 1XNAA 3ACIA 4KMQA 3T2PA 2WN2A 3C7GA 5EIYB 1JYNA 2WO3A 1YQ2A 3LEGA 1T2XA 1UWWA 3K4AA 1PMJX 3T0DA 1HN1A 1CIYA 2W92A 1EUTA 2VZUA 3CDZB 4FI9A 3THDA 3WSOA 4AG4A 3W5MA 1WCQA 3C7OA 1F4AA 3SKJE 1DP0A 1RYYA 2B4KA 3I97A 2J1UA 3VD3A 3BGAA 1ULPA 2DCKA 4A45A 2JD9A 3K4ZA 2W87A 1H6YA 1K12A 1TVGA 2XONA 3CIHA 2BERA 3K4DA 3GM8A 1O8SA 2C9KA 2XHNA 3GXUA 2R7EB 1CZSA 4DXSA 3LQCA 5JXJA 3A21A 3J7HA 1JHJA 5C7GA 2VMDA 2HLEA 5B4NA 2DDUA 3UESA 3AC0A 3MUY1 4GZ9A 3T2OA 5JR2A 2X05A 2BGOA 5CYYA 2HYXA 3CQOA 4XUQA 4A41A 2VMFA 5HPOA 3IB3A 2RVAA 5DPNA 5G04L 4Z2AA 5IJRA 4M4RA 4KI5M 5IYYA 3PUHA 4D0QA 1JZ8A 1GOFA 1XNTA 3HNMA 1UX7A 2VZPA 3LPGA 2E32A 2W9XA 1GQPA 4XUOA 5DMYA 4CU7A 2VZ3A 2QBXA 3SEEA 5IFTA 1UY0A 4ET7A 1ULOA 1UMIA 4XUPA 3HJRA 2C26A 5JUVA 2BGPA 2VCBA 1UZ0A 3WNOA 2WAAA 2RJ2A 2VTFA 3BN6A 2VCAA 1H6XA 2ZEYA 3VD4A 4MGSA 4LKSA 4QX1A 1NX9A 1UY1A 1GUIA 2Y6JA 1JU4A 4OUEA 3GGLA 2W1UA 1DLCA 1SG3A 2Y6KA 4A42A 2DCJA 3A7QA 4PF1A 4DEQA 2J1EA 2J22A 3WEZA 2WN3A 3ECQA 4W8JA 4RN5A 4IUGA 4JX0A 3IDAA 1NKGA 4DUVA 4HG6B 1L7RA 2VJXA 4QDRA 2E31A
chains in the Genus database with same CATH superfamily
4AVTA 4YZ4A 1ND3B 2WO1A 4JZRA 1IHMA 5IWFA 3PUIA 1X9PA 4NPMA 1JZ2A 4OMDA 4NO4A 4NHMA 4JKMA 1UKRA 4XACA 4ZZ8A 4NUBA 3GHMA 2W2IA 2QNKA 4XTMA 3AZYA 2RM21 4GXLA 1AR91 1QOSA 3MIHA 4N53A 4RR3B 4CEWA 2E53A 4L0PA 2E26A 1W0NA 1RVF3 3KVAA 4Q4Y1 4FAGA 2FCUA 1S55A 1VALA 2HJIA 2ERFA 2RJKA 3FWEA 4RFT0 4X8PA 3WQ1A 3DXUA 5T52A 1PGW2 2ZZJA 5LASA 1AR71 1LEDA 4MGIE 3GYDA 2V4VA 5AC92 2FZ1A 5C8WA 4XFIA 1H2LA 2EIDA 1LENA 3B5LB 1J84A 4KWLA 5CKMA 5A7NA 1F5FA 2LRPA 3OOXA 4Y20A 4QX0A 2YC2A 3T0AA 5LWBA 1J3RA 1R1A2 4LHLA 4RR3C 2P3YA 2WNEA 1EUUA 1A8DA 2Z69A 4CVUA 1OI6A 1Y9GA 3VLBB 2I45A 3M3OA 1OQ1A 2FDIA 2UY9A 1DQ5A 4EQVA 1X36A 3E5UA 3I3BA 3D82A 4LEJA 1IOAA 3UJQA 3WG4A 1LU2A 3I54A 2UWCA 2VTXA 3KLSA 1XSRA 4NPLA 5KC6A 1QGLA 1LULA 3QCWA 5L9VA 1Q5OA 1UN1A 2UU8A 4XAAA 1VBB1 2W46A 3KS7A 1LB2A 1HRV3 1YQ6A 1ZX5A 1J83A 4YVWA 3NJZA 2JG8A 3M8LA 1X33A 5CADA 1JOPA 4UFKA 2I07B 2Q8EA 5F7UA 2DVGA 3N7JA 2B5HA 2Y8KA 2ZGNA 2GZWA 1UYPA 2AUYA 4O61A 4CA9A 3WNKA 3U07A 3O1UA 3NNLA 3I4IA 2WNVB 2VMGA 2RS31 3DV8A 3MO4A 5FPZA 2ETEA 2ZEZA 1KD7A 1ZREA 1DQ4A 1S2BA 2GC0A 1OPOA 5HXMA 4GWIA 1WGPA 3AL5A 3EHKA 1NCRA 4COWA 1W04A 1YFWA 3ETPA 1G9DA 2R32A 1GNYA 2WIIB 4YVSB 4W4ZA 2Q1FA 3BIWE 5HXVA 5LRRA 5IAVA 4MX3A 4U36A 3T4HB 3B69A 2BGCA 1OHFA 1HIXA 2XMLA 3MLKA 1HW5A 4CUGA 2B42B 3FL7A 5CFDA 3C7FA 4CUAA 3EBRA 3R05A 1W2AX 4K6BA 3RG0A 4DUXA 4XJZA 3INAA 4BM8A 3VDCA 2CHHA 4ZHNA 1RUI3 5FZOB 1GU3A 3IIIA 1GOGA 5JXHA 1VBE3 4H14A 3L2YA 3RNSA 2WQ8A 3M3IA 4N53B 1OT5A 2RS53 1W3XA 2Q8CA 1REEA 3BU0A 2PHDA 1AL0G 2Z5WA 4YVSC 1D4M2 4TXWA 1WA6X 5FP9A 4AVAA 3TN93 2VOWA 2CAVA 4FOWA 1OC1A 2D44A 1NA1A 1GYKA 1T6BX 2WZPP 2HWD1 3O7OA 3V0AA 5L19A 4A7KA 1VIWB 2ZBJA 4BLIA 4AL9A 2FMYA 2WAOA 4H2AA 2C0ZA 1D4VB 2JWPA 3UETA 3MIDA 4HONA 1RUI1 3VL9A 3ZYBA 2WT1A 5FMBA 4RS5A 1VBE1 2LM3A 3KGLA 1QY4A 2D98A 4XDQA 4Y20B 2R16A 5EZWA 3PVOA 2NZ9A 3ZKUA 1EPZA 2XB6C 4IXLA 2RS51 4N53C 4QDSA 3FUOA 5DUXA 4CEWC 2WJSA 2XDVA 4GA9A 2RR13 1MS1A 4HK8A 2UYBA 1GLHA 2W0XA 3HOBA 3I2KA 4HL0A 4Y24A 5KHHA 1XB9A 2FHRA 1QJU3 3NSTA 5C8CA 2O8QA 4NPRA 2J1RA 4E4ZA 5L7OB 4E27A 4P9YA 3OGVA 1OOPA 3WDVA 5IHRA 1H0BA 1AL23 1X82A 2PXJA 2Y33A 2EAAA 4XFFA 5H9SA 1SHWB 1UD1A 1BCXA 2A1XA 1MR5A 3WNMA 1ZZCA 5GZCA 1UXXX 3ZXKA 2YFUA 3HPNA 1PK6B 1PVC2 4IV3A 2JG8B 1APNA 1N47A 2DTWA 2BNOA 2VQ0A 1VAVA 1RUD2 5FYIA 5A3OA 4ZU7A 1K45A 3NJXA 2J1VA 2JKXA 4AGVA 1RUJ3 2GP5A 1QJU1 1OQDA 1DGWA 4IEQA 4IERA 1UY3A 4Z82A 1S0GA 3EQEA 3JCIA 4XQ4A 4IEPA 5FZ0A 4Q5OA 4DXTA 1F9KA 4MGTA 1GBGA 4YG0A 3UGHA 4MSVA 4Q4V3 1AL21 4YPJA 3PVNA 4P9XA 1P8JA 3FC0A 1UQXA 4FBFA 4J1XA 3MV11 4XJ8A 4LUMA 5EHDA 3I3MA 2E7QA 1V70A 1CX1A 4A6OA 1E5HA 1PX3A 2VOVA 1AR63 3LGRA 4LE3A 4P5YA 4YVWC 3OBRA 4P9JA 2JG8C 2DUOA 4NHYA 4ONUA 5FZHA 5IUQA 3VBRB 5I0SA 3CEWA 2XLFA 3BTYA 5KHGA 1NG0A 1MS5A 2VUCA 1DYOA 1K42A 5CFDB 4XTPA 3GZTB 2PTMA 2IXKA 4FP3A 4Q27A 1Q8OA 1RUJ1 2P37A 4AVBA 2QFEA 3ZIWA 5JPNB 5FV3A 1US3A 2OKXA 1J58A 2AR6A 4Y26A 4QGMA 1I6XA 1QH7A 3IMMA 1UYXA 3E6BA 4Q4V1 5DG1A 4BQXA 5DQ0A 4XBNA 5JOYA 4DRVA 2X10A 4CSWA 4IEUA 1NCRC 1BLZA 4K8RB 1VBD3 1Q3EA 3ZXEA 2XLAA 2A3YA 1AR61 4N7UA 4Q4X2 2MHFA 4TLFA 1U5ZA 2P17A 1V6KA 4FPCA 4M0HA 3VN4A 1O4ZA 2WR9A 3RZJA 1NA1B 5KBFA 5FZ9A 5DUUA 4OQ9A 3WCRA 2O0OA 4GMP0 1R64A 5CFDC 3V0AB 3BTZA 2JKBA 1FAYA 1UCXA 3LEKA 4MUVA 2QUOA 2O8OA 3ROUA 3VD7A 2J7MA 2X53S 3AZVA 1BVP1 4MGKE 4R4ZA 4WM8A 4AHYA 4ZY9A 4RS5B 5C3RA 1HRI2 2WUHA 2ZAHA 2D93A 2PQQA 1H4HA 1W99A 4YZ5A 3N4MA 1VBA2 3N9QA 4AQSA 1QDCA 1W9FA 2ZOEB 1ZBA2 4LHSA 1MS8A 4BDVB 5L9BA 1B35A 2D3RA 2D5HA 3I3EA 3WP6A 1JZ5A 2ZPXA 3WNLA 3ZXGA 1FOD3 4N43A 3WF4A 1C28A 2IFRA 3QACA 3VD5A 5C8CB 1NA1C 1VMHA 3S30A 2GH8A 1OOPB 3LOIA 5FPLA 2E6VA 1ZZ9A 3FBYA 1AXKA 2HWC1 3FFZA 5A1AA 4BK5A 3OGRA 1RB8G 1RMU3 3I2HA 1AXYA 1GQHA 2ES3A 3M3EA 4DFSA 3KM5A 4RS5C 4CP9A 3GJBA 1LNSA 3ILNA 3LE0A 5AFBA 2Y26A 3ACFA 4IV3B 4MG2A 1WZXA 3M7AA 2VQUA 5FKBA 3WNNA 5A33B 4M0NA 2E51A 2NMNA 3ILRA 3VHRA 4ES9A 1DU3D 4GWJA 4Y1YA 4DEVA 1RUE3 5FMDA 1ODMA 1FOD1 4PQ9A 4WZFA 5C8CC 5EJ1B 1GSLA 3W59A 3ZXAC 4PLOA 2JJ6A 5CNAA 1OOPC 1BJQA 3CNAA 5F39A 1LOGA 2DU1A 1QXPA 3R4DB 4XUNA 1UPSA 2GMEA 1UW8A 1RUH2 1J1TA 4OHVA 3OBAA 3S7EA 3HN3A 3POFA 1IS4A 1LHNA 3UJOA 1SPPA 2VXJA 5LCWL 1C57A 1UL9A 2OVUA 1OQEA 2XG3A 4IV3C 3AJYA 4CCMA 2NPIA 1QDOA 4FFIA 2ATFA 1COV3 4J6GA 1O7FA 4RD7A 4H3WA 2EXIA 5DZGA 3VD9A 2CTVA 3RYPA 1KGYA 5FZFA 2YY1A 1RUE1 5J09A 2BQPA 3DL3A 3AMNA 3WUCA 1WA4A 4AFDA 1G9AA 3M4FA 2ENRA 4G4FA 4C1XA 4QB2A 2VZOA 3V0BA 4KL1A 4XIOA 4XE9A 4KMQA 3T2PA 4FSJA 3WW2A 5FZCA 2BOIA 1JS9A 5K0UA 2DWRA 3LWCA 3ZSLA 1JYNA 2WO3A 1I3HA 4UBGA 4BYYA 3PIJA 3VB9A 2A6XA 1COV1 4BOWA 1C3HA 1PMJX 3AYDA 1YQCA 1CIYA 1FPN2 4SLIA 4JHTA 5ACA3 3L9JT 1W8ZA 4WM8B 4QT6A 5L36A 4TYSA 2DBIA 1W6OA 2H0VA 1BKZA 3WSOA 2DFBA 4Y33A 4Y5SA 4XF4A 4D7YA 1DGRN 4FPYA 1GZTA 4RGAA 1DLLA 1F4AA 5A7PA 3GZEA 1QH6A 1DYPA 1RYYA 2XLGA 4N9HA 5FY9A 1H1IA 5I0RA 2J1UA 1B35B 4YM0A 5KWRA 2VMHA 4ZU5A 1A78A 2D6LX 4LK7A 1MEC1 4ATFA 5GLZA 4N43B 4XYXA 4TWTA 1OH3A 1LCLA 2A3WA 1ST8A 2W87A 3I8TA 1H6YA 1QWRA 1K12A 1NLSA 1TVGA 3F95A 4Y3OA 4NIAA 4QM9A 2HWE2 1SCSA 1X8MA 1FI2A 4I02A 4WM8C 1IKQA 1KS5A 2DVFA 1Z7S1 1ULDA 2P4EA 4HKLA 2K9ZA 2XUEA 1C5IA 2YDEA 3MDPA 3KV4A 4A3XA 1JW6A 2WA3A 3APBA 2ZKNA 3MLLA 4DB5A 3HD8B 2I74A 3WLUA 1WD4A 4MGZE 4E4SA 5LBBA 2VUAA 1UIKA 2N7GA 2A70A 4LMFA 5I0TA 4L99A 1HJGA 3ZSEA 2ZMLA 3ATGA 1B35C 4I0AA 2HYKA 4LO6B 1RUOA 4LT5A 1AF9A 5FZIA 2JG9B 4N43C 1LODA 2PAEA 1PM7A 1N1VA 5H9PA 5C7GA 2Q5TA 4FOQA 5FJKA 2HWB2 3KCYA 4HOOA 4LOSA 5JZGA 4XEZA 1UZZA 4GJZA 2WS93 2Q1MA 1TME2 2EXHA 4Z8BA 5IVYA 3AC0A 5FPVA 4JDMA 1SPPB 3CJIA 5E16A 3T2OA 2PAMA 3CF6E 5EPAA 4IEXA 2VMFA 3J8F3 2FBEA 2PLV1 4L8QA 3QLQA 3RSJA 3THTA 5DPNA 5G04L 3GZUC 4LULA 3ES4A 1Q43A 1PMIA 3NNFA 3ES1A 3O1VA 3HT1A 4RFRB 4BQ4A 5ABJA 1G9CA 1KQRA 5SV8A 3Q8BA 3RYRA 1K5MA 1OFSA 2KM2A 4IDZA 3U10A 3CO2A 1GOFA 1CR7A 4BPZA 4PBPA 2CNAA 5AVPA 2E32A 2W9XA 3SCFA 5DMYA 2WS91 3V0BB 2QBXA 3RDIA 1NT0A 1K5JA 1ZA4A 1NY71 3AFGA 4LITA 5IVFA 4L92A 2ZGOA 3SEEA 5K0UB 1H4GA 1JXNA 4ZONA 2W52A 4CDXA 2XGXA 3O1SA 4Y5Z0 1ULOA 3J8F1 2IFWA 4HANA 3RZKA 3FZ3A 4YG6A 1TZOA 4QD2A 2VCBA 1WWYA 3SLIA 3MYXA 1OFNA 2JDHA 4QWNA 4YW4A 4V1PA 1W6OB 5FDBA 1PGL1 2WC2A 2ZCWA 2VCAA 5F3GA 2ZEYA 1WMEA 3Q8AA 3B3QE 3BIEA 4LBOA 3PJYA 1JN2P 1AX1A 1HKDA 1GV9A 5T54A 5K0UC 1UU5A 4XPVA 5KHJA 2Y6JA 1JU4A 1ZBE3 2OQ7A 3WNXA 2J42A 5DAQA 2NLRA 4M3CE 4XXPA 5EYXA 3L2HA 2RMU3 5FYUA 4BMBA 4GWMA 3POEA 1GR3A 4FP2A 5CU1A 1C5HA 4DEQA 1EAH3 4META 4FCAA 3VL8A 3WG1A 5A7WA 4QGNA 5C6CA 4X6RB 3AKSA 4K1YA 4CCCA 1ND2A 3UGGA 3ECQA 2BW8A 3V56A 5A3NA 2HWF2 1LOEA 1O4TA 2XXZA 4DY3A 4IUGA 5J37A 3OD0A 2FDKA 2RS13 2AREA 4D7SA 1H2MA 1NKGA 1Z78A 2ET1A 4DUVA 1ZBE1 3ENRA 1VAMA 1L7RA 4IGQA 2RMU1 1CPNA 2GNDA 2E31A 1S0BA 1AXZA 3N7KA 5HBAA 1F15A 1S0FA 1EAH1 1JYIA 1FNZA 4A6SA 5A32A 3JBG2 4LJHA 3U14A 3KF5A 3LA7A 4CP0A 4EWAA 5JMOA 5DAVA 1JI6A 2LUWA 4YYOA 2OS2A 3CJIB 4EZ4A 4PBOA 1XXNA 5KXEA 5LY1A 4HT1T 2CYFA 3ZXLA 4ZS2A 5DZFA 1Q8QA 4CCKA 1ULFA 3WW4A 2WQZC 4HVRA 5ANNA 5ABJB 2X5IA 2YU2A 1UY4A 3VGIA 1K5MB 5GLTA 1BEV2 2F6BA 2VNVA 2VGDA 1HDKA 4EN9B 1JZ7A 2ZXQA 1FNYA 2R062 4P00B 4H55A 1JBCA 1JUHA 1NZIA 5JZGC 1JODA 2BUKA 5EV7A 1W90A 3UYJA 1JYVA 3ABZA 5FOJB 4WBBA 2W5FA 3E97A 4LLOA 5C3SA 5APAA 2GNBA 1VRH2 3SITA 4AI9A 2E7TA 2VZRA 2WINB 3ZFGB 4CDXB 1QIQA 4HK9A 3DF0A 4BB3A 4PLMA 2KD7A 3NQHA 1QJX2 4KBBA 2IC1A 3N36A 2HEWF 2X09A 1VBC3 3U1XA 3WF2A 4CRQA 5FP7A 3P3NA 1CPMA 3I3QA 3M2MA 2QQJA 3OEBA 1JMUB 2C6SA 5ABJC 4QDQA 1Y9QA 4HVQA 3PU8A 4C1WA 1K5MC 3ZIXA 2R6QA 2ZX2A 3AJZA 1F2NA 1MVQA 2OZ6A 2GC3A 3MPPG 3ZPYA 4LKFA 3WP4A 2GSYA 3C8XA 3W58A 4EE2A 1YUDA 3UGFA 1TNRA 2PHWA 1GWMA 2QQVA 3VKLA 3T1MA 4Z07A 1DFQA 3D5OA 4OHXA 2CAUA 2WYFA 4XXAA 1GKBA 1YCIA 5GLVA 1VBC1 2MEV3 4OMCA 4Y5TA 5A7WB 1IQAA 5HV4A 1OA2A 5T3NA 1E5IA 1ND2B 2WFF2 3H3UA 5T5PA 2LALA 1QJFA 3THPA 1FATA 2W1WA 1GWLA 4QKNA 2VZSA 1W8HA 3ZSMA 4EZHA 1YFUA 3H1MA 1DDLA 3DCQA 3FN9A 4HKWA 3JD71 1LGCA 2WKKA 3B93A 3W20A 3RRDA 5CA6A 4HBNA 1GZWA 1TE1B 2QDRA 2RM22 1AR92 2CGNA 4B8EA 3S0MA 3J7MA 2DCZA 2VBBA 1NCQA 1WCDJ 4UI9L 5LB6A 4Q4Y2 2MEV1 3PNAA 1ASJ3 1R1ZA 3AYAA 5A32B 1C1FA 1XE0A 2QQMA 2D40A 4BHPA 5FUPA 2WQ4A 1KRIA 4ITCA 5FIXA 5FO9B 1AR72 1ND2C 2DUPA 3B02A 4N8MA 4SBVA 3S6PA 2HEYF 2ZHLA 5A3TA 4I30A 1REDA 1RUC3 2W1SA 1N3PA 4PIZA 4BE3A 2BBVA 2WO2A 4F83A 3LCPA 1U12A 5F3EA 2WYSA 1OXCA 2J1TA 2C9AA 2WDBA 4GD4A 2C5DA 2XR4A 4Q4W3 3KHBA 1LECA 3AP9A 2Y6FA 4NWVA 3SMHA 2X5IB 5JI7A 4XF3A 4PHZA 5FYTA 2AACA 3F2ZA 2YBKA 1OA3A 2G9FA 5GZDA 3I2FA 2JDUA 2MPFA 1AR83 1W6QA 2Z42A 1WKYA 2WNVA 4KGQA 4S2DA 1ZRIA 4C91A 3OYWA 3POWA 1LGNA 2VAUA 3NKGA 2PHFA 4OI1A 1QQP3 1RUC1 2WA4A 5A3MA 4COVA 4R9AA 5FMOL 5DXDA 5FYBA 3ZYJB 3IBMA 2J1SA 4L9BA 5LA9A 3UK9A 5LBEA 1VBB2 1A3KA 3ST7A 2MNGA 4Q4W1 3AKPA 1V00A 1OF4A 1Q8VA 2X5IC 2QZ2A 3AP6A 1V6JA 4IE4A 2OPWA 5FMOS 2Z4FA 1UMHA 3ELNA 3EYPA 3NRUA 2VZVA 1WW7A 4HETA 4MOAA 3LSDA 5FZEA 3U4SA 1AR81 2VVFA 2JDYA 4GQ7A 4UFIA 5FZOA 3OGSA 5C3OA 1S2EA 3GJAA 2JDMA 4JHZA 5JSOA 1OUSA 4OHWA 1H1MA 1W8NA 2RS32 3QH7A 3OUJA 5GLUA 2W94A 4JGZA 4ZZ5A 3TRSB 4HVOA 2FDHA 3LEMA 5KC5A 1WW5A 4FFGA 4YW5A 3VKOA 5DAXA 3SKVA 2VOKA 4FOYA 5CZKA 1SFPA 1X8EA 4XUTA 1C8M3 1CAUB 3VBUA 1ND3C 4FQZA 3DN7A 3U78A 1IPSA 3R0RA 1CD3G 3N7MA 2LS6A 2V5YA 3VUOA 2AZ5A 1CX4A 5BYNA 1DGLA 3DEMA 5HCFA 4R9BA 3ZXFA 5IK4A 1J1LA 3SC7X 3VZOA 1UZVA 5JAXA 1GMMA 5FUIA 2Q30A 4CP2A 3K46A 4UWDA 3LD8A 1RJ8A 1UU4A 1GZWB 1RVF1 3OPWA 5LA2A 4F3JA 3H8RA 4GH4B 4UF0A 2BOJA 2Y38A 5F32A 4EYUA 1NCQB 2BDRA 3ACGA 2W68A 5L7OA 4K20A 4GULA 5KXCA 1UYZA 4K7JA 2CDPA 4QXHA 4LXLA 5FRAA 1V6MA 1C8M1 4YGEA 4YSFA 2CV6A 2Y6HA 5FZ7A 5I8SA 3VHOA 4Y1ZA 5G05L 2HWD2 2ZKLA 3JXSA 5FP8A 4UW4A 3MICA 2YPJA 2W91A 4E9KA 2PHTA 5LZ6A 1YI7A 4AEDA 5F2WA 1UKGA 4EJRA 1PK6A 5J7MA 1RUI2 3TAYA 1WLWA 4WVMA 3HBZA 4P5HA 4NIGA 1VBE2 1WW6A 1ENRA 2GALA 3WD5A 1NQJA 3KMHA 1RUF3 2B9VA 1SLAA 2RS52 3IDEA 1XYOA 4GMP3 1NCQC 5EWSA 4FXGB 3IM0A 1IPKA 3T09A 1W6QB 4B1MA 1PMHX 2SBAA 2WWUA 1G9FA 3OYWB 1SFNA 4LLFA 5E8AA 4E8DA 2OYZA 3BPSA 2YV8A 4GIQA 5D1IA 4YW7A 4KWUA 1CZTA 4GALA 1HQLA 2VUJA 3DPRA 4HLTA 5A7OA 3U11A 5AC93 1HRV1 2QQNA 4AFCA 4YARA 4E2QA 3ACHA 1UF2C 2C24A 4MH0E 3VBRA 2PA7A 3M1HA 1HV1A 3VKFC 2ZX1A 2BVBA 3WF3A 2XJQA 1RUF1 2IVJA 3K48A 4YFWA 1N1YA 2ILMA 4AQ2A 2WO7A 4XF0A 1HB3A 1OKQA 1JU3A 4XQDA 1RUG3 5A1LA 3FLRA 1OA4A 2BEOA 4QXKA 1QJU2 1POV0 2WNVC 2P6HA 4Q0UA 3RJRA 4AI0A 1JZ3A 1WLCA 3OG2A 5BNNB 2YXSA 4LA3A 4AVVA 3POBA 4DZGA 3GBWA 2JX9A 1AL22 3S57A 4CEYA 4JGZB 2RJLA 1Q8PA 2XJRA 4CUBA 1D2QA 1URXA 4HPKB 5FZ3A 4IL7A 2B8MA 3DXTA 3T2QA 2XVLA 1XE7A 3KF3A 3OCPA 3RI8A 5AFEA 3VBUB 3AMPA 3S5QA 3N9LA 1RINA 5I0DA 4NROA 1MS9A 5D8AA 1RUG1 4QX3A 3ZKYA 3AKRA 1RUJ2 1MPXA 4GKXA 4BQ2A 4R8HA 5AVAA 1SLIA 3RWNA 2R0FA 1CVNA 1MVEA 3D6EA 3SXWA 4QPGA 3E6CC 3ITQA 4TZDA 2RDRA 2H6BA 4Q4V2 1QOTA 4HZFA 2B7YA 3DECA 2YMZA 2AH2A 4JGZC 1LHOA 3J4UH 4UF0B 3TN91 5BNOA 1QEXA 2DUQA 1GQGA 1UIJA 1AR62 2G9GA 3HQXA 3H7YA 1KITA 4LO8A 1GICA 3E6DA 1VE0A 3MF6A 3VBUC 3ZFFB 2ZGKA 2XQRA 3PMSA 1DF0A 2BJSA 3MV01 3P3PA 1LRHA 1O8PA 4AEDB 4YM3A 3C7GA 3ON7A 1OLME 3WDUA 5CBLA 5C4WB 4FPGA 4WVMB 1YQ2A 4DQAA 5A33A 1KFUL 1VMFA 2RR11 4IGOA 5BNPA 2DBNA 4FQ4A 3MLJA 4JRAA 2BFUS 2WWSA 3HVDA 4W6XA 2JB4A 4CCDA 2ZGSA 5L7OC 2ARXA 1W05A 1SQ4A 4XHBA 1WMFA 4FPJA 4PDWB 3FLPA 2ZHMA 2C1FA 4UW6A 4L97A 3THDA 1PGSA 1E57A 1WBFA 1WCQA 5KR7A 2A6VA 3WG2A 3DPRB 3MFAA 4AEDC 5IVEA 2HWC2 2DFCA 3D4KA 2O1QA 1PK6C 1H2NA 3I97A 5FZLA 3MEPA 5DABA 3RMXA 3LF7A 1CESA 2FD8A 3PUSA 4V2VA 5C33A 3WUDA 3K4ZA 4XC9A 3TEWA 2XONA 1XYNA 3CIHA 1XOYA 2X8KA 2DVAA 3BALA 4XMAA 1DQ0A 5LATA 3IIAA 1GFF2 1FOD2 2B9UA 2ADEA 3QD6A 1C1LA 1QNWA 4JCKA 5I0UA 2BYVE 1O8SA 3LB9A 2XHNA 2R7EB 3KGZA 2CY6A 1AYN3 4MXVA 3LQCA 5JXJA 1UZYA 2DCYA 2QDNA 4J25A 3DPRC 5KXDA 4KQ7A 4CEYB 2PHXA 3A21A 4LBQA 1F35A 1KFXL 3WZ1A 4MXWA 1R083 3VBRC 4HSJA 4I0BA 1O3TA 2R073 3VBFA 2BWAA 4WVWA 2VUDA 2A73B 5FTTC 5I93A 3Q8CA 2RE9A 2QE3A 4CDWA 1RITA 1SDWA 3GNEA 3WT3A 3MFCA 2XUMA 3H3ZA 3HAGA 3EJKA 4IESA 5D8AB 2ZGRA 5T50A 1LKNA 2VNRA 5JVVA 1RUE2 4XFGA 1RUD3 1GNHA 2RDNA 4KU7A 4AVCA 4H7LA 5FYCA 5FLIA 3WHTA 4QPGB 1WMDA 4BQWA 3MW4A 4MV2A 1O5LA 2X05A 4RHV3 2BGOA 5CYYA 4LIVA 1AYN1 1VBD1 5SV5A 3HR9A 4A41A 4N90A 4AR2A 2EIGA 5HPOA 4CEYC 3IB3A 3W9AA 5BNOB 5F1RA 4K8FA 3ZYPA 4YGDA 1R081 4Z2AA 5IJRA 2YGLA 2R071 4M4RA 3OPTA 2KXLA 3KV5A 4QMAA 1BBT3 2X29A 1COV2 3LA3A 3NNMA 5J36A 4XFCA 4QX7A 5D8AC 1UX7A 3OD4A 5C5TA 1N1SA 3O0WA 4XUOA 1VB2A 5LY2A 5F6KA 1W9YA 3R6SA 2LROA 4TSVA 5GZGA 4COYA 4B1LA 5FPXA 5IFTA 3NV2A 4RHV1 2CU5A 3VZLA 5BNPB 3FUQA 1UMIA 3PU3A 2ZTNA 5BNOC 4AEKA 5J48A 3NV1A 3LDKA 3HJRA 3VZNA 5JUVA 1W6NB 2BGPA 2JG9A 2UURA 5F3IA 3D0JA 4EN6B 2QKDA 3HN1A 1AUYA 1HN0A 4G9SB 3GHNA 4O9GA 1MEC2 3H1WA 4AFMA 4EV0A 2GC2A 3PDQA 2RJ2A 3MW2A 1BBT1 4Q4X3 3S5AA 3POYA 4FPFA 3LFMA 4EN0A 1H6XA 1ZM1A 1YXWA 1RMU1 2JDZA 2BTVC 3AYCA 4X6QB 4OFGA 1DBNA 3CBNA 4QX1A 1Z7S2 4MZUA 2K0GA 3T4VA 1DLCA 3RMYA 1REFA 4YW6A 4COZA 2XVKA 5BNPC 1W28A 1KDMA 1DHKB 2DCJA 3BODA 4PF1A 1HRI3 3NL1A 4K3UA 2J1EA 1O5UA 1SZBA 3BOWA 4IEYA 3WEZA 2A7AA 5D21A 5FCCA 1G6NA 1YYNA 5LBFA 5C3QA 2WN3A 2GH2A 1GZ9A 1QF3A 4ZPIA 1SCRA 1RJ7A 4B29A 5JOZA 3B01A 5JSPA 4LBQB 3IDAA 2R1DA 4MXWB 3NVCA 4FT8A 2ARAA 4HG6B 1UZWA 5A6QA 3VBFB 3ZYRA 1WD3A 4QGLA 2JE9A 4CDWB 1VAKA 2G9ZA 4BU2A 2PLV2 3POJA 1UXZA 4A2UA 3A4UA 4AAXA 2VPVA 1HX6A 4KWJA 4L11A 4AGRA 1S0EA 5FZ1A 3TOJA 5FFOC 4CE8A 4FTEA 1S0CA 2VCCA 4BWOA 1JYWA 1MZ5A 3FE5A 1R093 3EB7A 2YHJA 2JEMA 3PHMA 5GJ6A 2WS92 2ZHNA 4B4QA 5BUVA 1UNBA 2F4LA 4IEZA 4QB1A 4YRDA 1NY72 1GWKA 4BIOA 2VZQA 3J26N 3RGBA 3VBFC 2OIIA 1XU2A 4NWWA 1IS5A 2DU0A 4CDWC 3DUIA 3DYOA 4M3CA 1Z0HA 3J8F2 4OYUA 4YFZA 2QQOA 5FY0A 2A75A 4FAHA 4YM1A 5ACA1 2GMMA 4JTOA 5DAWA 5C71A 1SDDB 2XJVA 3T1LA 4BXSV 4FPLA 4XDPA 4P08A 3OGJA 3RFRA 4LBQD 1YLLA 1CZVA 1SLLA 2D6NA 5C5UA 3MHZA 1YWKA 3IZOA 1PGL2 1R091 3OEAA 4GB33 3BPZA 1N1TA 3KHCA 5HCAA 1EV13 4QPIA 5GM0A 5JDBA 1TG7A 1GOHA 1SACA 2E7AA 1GP5A 2W1QA 1UOGA 4I09A 4ZXEA 1DG6A 1LESA 2DV9A 1LHVA 1GP6A 1W9SA 4BQYA 2EA7A 1GP4A 5CFCB 1O3RA 2RDSA 3JB4C 5ERLA 2EVXA 4CDQA 1IG0A 1OD3A 2OW4A 4OI2A 5F5QA 3URFA 4DIQA 2CSGA 3FBMA 3ALQA 3IAQA 3UL2A 3HMYA 4AI2A 4XURA 2KR2A 1N3QA 1FMD3 2BBAA 3FHAA 4QQHA 2DTYA 3Q8FA 3M70A 1NOVA 4GB31 1AVBA 4YM2A 3PJQA 2VMEA 4QPYA 5JCTA 1PNFA 4Q0VA 3NV4A 1EV11 1OH4A 3E5XA 3EXUA 4K1ZA 3FHIB 1G86A 4LBNA 2VE1A 1FX5A 2A71A 3WF1A 2JG9C 3NV3A 1HB1A 2ZX3A 3T0BA 3M3QA 4YW3A 2J1AA 1STMA 1YJLA 1ZBE2 3JZVA 3PVEA 2BP6A 3FX3A 4QX2A 3O1MA 2RMU2 1RIRA 2XJTA 3ZMOA 4BH9A 4CPBD 3VZJA 2V72A 4QQPA 1EAH2 2JDPA 3BVCA 3RWKX 3VBSB 3P1IA 3AXEA 4XIKA 1ZZ6A 1CAWA 2WBKA 1XE8A 2BWCA 2PMWB 2WZR3 2XVGA 4UFJA 3ZFGA 2YFZA 1FMD1 2VECA 5JLVA 2ZGUA 1JZ4A 3G6JB 3LFIA 3IMNA 5IT6A 3ILFA 3LDBA 1TQ5A 4JAAA 2OT7A 3D0SA 1D7PM 1AHSA 1ACCA 4EN7B 2D97A 4FOVA 1LHWA 1XC6A 1S0JA 1TMF3 1ZRFA 5A70A 2GNMA 1W2UA 3KSCA 1LOCA 4BIFA 3D8CA 2B46X 5DG2A 1NXMA 2HKXA 4PF5A 4CCJA 4PI0A 5K8SA 2NM1A 2YPDA 5T55A 4UOJA 3ZN5A 4TTGA 4NAOA 1U5XA 2VVEA 4XBQA 3SCHA 5IK5A 3VDDB 3I2IA 2WZR1 3AKTA 4FPOB 2GNTA 2IXJA 5FY8A 1LTEA 1W39A 1W2TA 3H3LA 2EIBA 2JDKA 3NJYA 4K9SA 2A6YA 4OHZA 1OVSA 4M3CB 3H50A 5FP4A 3H8OA 1E5SA 1TMF1 4Y4RA 1W2NA 1OLQA 3LIHA 4DXRA 3TWIA 4LK6A 5FY7A 5CAZA 4O9EA 5FREA 4UT5A 4XZUG 3U4XA 3WW1A 1MZFA 4CTEA 3K3OA 1QU0A 2R0HA 3OJBA 4Q29A 2HBUA 3LAGA 1QXJA 5JPMB 2WZ8A 3ASIA 5HI0A 4I3GA 2Q0AA 3KZ4C 2AENA 1V6LA 1RUNA 3O1OA 2LW8A 4JRLA 4QPIB 3PURA 1UOBA 4HN1A 3I2DA 5TSWA 3AKQA 4XF1A 1BK1A 3FHQA 4U2AA 3SCGA 4A44A 3H9AA 4M00A 3CJXA 2FCVA 4AFBA 3U0ZA 1XJAA 1YIPA 2VC9A 3B9CA 3N3HA 4LOTA 1VBC2 4CDQB 1RHI3 2HH9A 2JICA 3IKWA 4FFHA 4COUA 1W9TA 4UXAA 4XETA 3PL0A 3ZYHA 5FOBB 2A3XA 5EJZB 4MYEA 3WVJA 4QXBA 1W03A 1W2OA 2W95A 2RS11 4KNCA 1AYM3 1W8FA 4Q0PA 4QPIC 1UO9A 2Z79A 4YZ1A 4OI0A 1CN1A 3JD72 3W21A 1Y7BA 3MIFA 2ZABA 4LBMA 3LOBA 3VBOB 3SNMA 5FBJA 1UY2A 1T6GC 4TLGA 1H30A 2CWSA 4XQWA 4CDQC 1RHI1 2MEV2 1S4CA 4OULA 1MQTB 4AOCA 5C9AA 1CAWB 3CJIC 1YI9A 4IEWA 4W65A 3MBWA 3WCSA 3ZOIA 4HFSA 4OQ8A 1L7LA 4NIIA 3KT4A 4H7MA 1PO13 1AYM1 4NOTA 2JE7A 2F4PA 4YGCA 1LAJA 3V65A 3OB8A 1DZTA 5A7SA 5E1RA 1YRZA 4C90A 1I5PA 4WM7A 4OCTA 5GZEA 1H8TA 5DDJ3 2BZDA 2OA2A 4LA2A 2VO5A 4HMZA 4CYDA 3HNBM 5HV0A 1IZ3A 4MADA 4QHZA 3TEZA 4LBJA 3IPVB 1UOFA 5FZGA 3WP3A 3VHPA 4YG3A 1W3VA 4CZSA 3ZFGC 4CDXC 2WT0A 5FYHA 1HB4A 2P6CA 4B4PA 3KCXA 3WG3A 3WDYA 4QX5A 1RUC2 1PO11 2G19A 4LO7A 2FDFA 5JXGA 3R4SA 2WABA 2XQXA 2XWBB 4IE0A 3WHUA 1I5ZA 4DOUA 2DYCA 4P9WA 3A22A 3TNPB 3O1PA 4YWAA 1BXHA 3FFQA 3CZUA 2Y64A 1CAUA 1XNCA 1BHGA 1L3JA 1F5JA 3JB8A 5DDJ1 1PIV3 4CU9A 4CU8A 4Q4W2 3AYEA 4OI4A 2WRAA 2GN7A 3K75B 4F8AA 2BV4A 5EYYA 5FYYA 2IXHA 1AJKA 1W9WA 2WLPA 1DYKA 3I3DA 4FPKA 2VOTA 1JOJA 1QJEA 3B94A 3O5SA 2QQLA 3LZZA 1AR82 5CIRA 2JDAA 5T5OA 3MIBA 4CDUA 5DZEA 1G7YA 3FJSA 3K2OA 3NO8A 5J1XA 3WW3A 4GH4A 2GP3A 2IXLA 2IZWA 3E1F1 3IT8A 4QQLA 2ORXA 3RYKA 3ZFEB 4A3ZA 1OPMA 2JDNA 5LA1A 5J98B 3PVBB 4NR1A 1XNDA 3C3VA 1PHMA 2ZGTA 3AP4A 4FXKB 1CJPA 4LE4A 1F4HA 4HN0A 1PIV1 4OZOA 4DPNA 1POV3 2AEYA 3CKHA 4LKDA 4D7TA 4L2NA 4UAPA 4EN8B 4DUWA 2AC1A 3AXDA 1SEFA 4MGQA 4CCOA 1JH5A 2VU9A 4UBHA 1PO23 3I2GA 2EALA 3MI8A 4R9CA 4GAZA 2Y34A 5FWJA 4Q0SA 2XBO3 3BUCA 4B3NA 1V9U3 4JKLA 4XILA 4KH9A 5LEKA 4FTSA 3BTXA 2FZ2A 1RVF2 5A3LA 3ORJA 1H1AA 5LA0A 1NZCA 3O1RA 4AK3A 1ASJ1 3HNYM 5FR3A 4KU8A 3H7JA 4NIHA 2VL4A 2ORZA 4LR4A 1KEXA 1POV1 5JSRA 1JUIA 5BXXA 5C9AB 2Y6LA 2W47A 1C8M2 3ZR6A 1AX0A 2DURA 4K40A 1HLCA 3OY8B 3USUA 1OF3A 1DGRA 5L73A 2V5DA 5HCHA 1YNAA 1QMJA 2OUHA 3O1TA 3I49A 1PO21 2VNGA 4QKDA 4PJYA 4LQRA 5DUWA 2XBO1 2PAKA 1IG3A 2YG0A 4WM7B 5BPXA 1H8TB 1V9U1 5BV6A 3MUZ1 4CCEA 4DRRA 3DGTA 5DAPA 5JXIA 2EF6A 3VHNA 3OF1A 2JXAA 4QPWA 3WX5A 1WCKA 1EY2A 4CXWA 3ACIA 1NUKA 1ULCA 1W06A 2WN2A 5BNNA 5EIYB 1QQP1 1QJY3 1UAIA 2XKOA 1BMV1 3LEGA 4AF9A 3I7DA 1ZRCA 3VV1A 4HPKA 4S2FA 1UWWA 3K4AA 3T0DA 1HRV2 2OZJA 1CAVA 1NE6A 4OLLA 3S7IA 2HEVF 3AK0A 4WM7C 4O65A 1H8TC 1HXS3 5IATA 3IN9A 1RUF2 2VZUA 3CDZB 5FYSA 3RPQA 4HSLA 4AG4A 1NYWA 2R043 3GBFA 5GLWA 3GCXA 3MZHA 1JHNA 1DP0A 4CDUB 2V09A 5FQ0A 3A0KA 1QJY1 3U75A 3VD3A 3BGAA 4AI8A 1ULPA 2DCKA 2Z2SB 2VCMA 2ZGPA 3HWJA 4W6YA 5FZ4A 1NLRA 4A45A 2OX0A 1GANA 2XJPA 4P9IA 2XPJA 2AYHA 2LTNA 2G1MA 5JIUA 3OGGA 2W39A 2BERA 5FWEA 4AZZA 3ZFFA 1SLBA 3BB6A 4WZCA 1HXS1 2NQYA 1MS4A 2WL1A 3POGA 4Y4YA 2IWGB 3GM8A 2FDGA 1WCSA 1ULGA 1VBB3 4FFFA 3PIGA 4I0WB 4IE6A 4OVEA 4Q1PA 2VW1A 1NQDA 2D6PA 1CZSA 2R041 3BCWA 3WQ7A 4JDOA 4DXSA 5F5CA 1RUG2 5C4WA 4QQ2A 4CDUC 1Q8SA 4NRPA 4C0BA 5JMCA 3MIEA 3AP7A 4QKFA 3KV6A 1OLMA 1KS4A 1W6MA 2VOXA 3J7HA 1JHJA 4GH4C 3SQOA 2YYOA 2ARCA 2RG4A 2W08A 2QQWA 4B7KA 5FYVA 3V64A 5FZMA 4JV4A 3TN92 2RS33 3NWKA 4JC1A 2TBVA 2V73A 2KA3A 2VULA 2YBSA 4PDWA 4S2HA 2QCSB 5B4NA 4JDNA 1PNGA 1XRUA 5F3CA 4Y22B 3WP5A 3MUY1 3HBKA 4GZ9A 1OLRA 1H9WA 1KDKA 2B45X 3H8UA 3NAPA 3UKTA 3USUB 2Y60A 4AFAA 5FPUA 4XUQA 3K3NA 4RA0A 1ZRRA 4J1WA 5EJ3A 1IKPA 3KD4A 2ZS6B 2ZA9A 1MS0A 3WDXA 3ETQA 1I9RA 4P14A 4LHKA 4DY5A 4Y1XA 1DQ6A 3PUHA 4GMP1 3PLQA 1WMXA 4UFHA 2RR12 1D0HA 1JZ8A 1R1A3 3WINE 4S2GA 5JOWA 1WW4A 3LPGA 2RDQA 1GQPA 4YZ3A 3POSA 1J3QA 3Q9OA 3EO6A 4YGBA 5IK7A 2YU1A 1OSGA 1PGW1 3DKQA 5AC91 4XJ9A 4XCBA 2I2SA 2VY0A 3QH6A 4KWKA 2HWD3 2D5FA 3C2UA 4D3WA 4D94A 1CAVB 1DZRA 3AVRA 3WR0A 3WNOA 3RZMA 1EYBA 2WAAA 4TN7A 5IK8A 5FY5A 3RZZA 5CG9A 3ZO0B 1R1A1 2VTFA 4AGGA 3LA2A 4ZXKA 1ZRDA 1VPHA 4QM8A 4XMIA 4B4RA 4KG0A 4CEWB 1FV2A 1C4RA 3M3CA 4MGSA 5FQ0B 2ET7A 1VJ2A 4OUSA 5BNNC 2BPA2 1UY1A 1FYUA 1GUIA 4QKBA 3I59A 5E89A 2W1UA 3OPZA 4E4DX 5ANQA 5F9TA 1OURA 4OZXA 3A7QA 3RJ2X 4NRQA 4QQOA 1GZCA 2J22A 3USSA 1YQ5A 3WXPA 5FKCA 3MW3A 2NN8A 1DZQA 1QOOA 4XJUA 1HQNA 2SLIA 3ZXDA 1ZVFA 3NNJA 1X50A 3QBQA 4RN5A 2O14A 4Y1VA 4HKOA 4LO5B 4JX0A 1X7NA 1SFYA 1XQNA 1Q56A 4AQTA 2ARBA 4EWDA 1W6MB 2IVIB 4B7EA 1QJZA 5CISA 1S1AA 2VJXA 4QDRA 1VBD2 1AYN2 1YHFA 1W6NA 5CVRA 4FPEA 4Q0QA 3LKJA 4YW1A 3BU7A 2VM9A 1ONAA 2VZ1A 1R082 1POQA 2ZX0A 4OUMA 3ZFFC 5A3UA 1D4M3 2R072 2BU9A 3KT7A 3LSEA 3WV6A 5IAXA 4FPHA 3VKNA 4Q26A 5LK7B 5LBCA 2XKPA 1LOFA 3NAPB 4YVWB 4A7ZA 5FK8A 5M0TA 4NRMA 2ZEWA 2VD7A 5C4WC 1H8VA 2QQKA 2VQAA 2VQTA 1PX4A 3IAPA 4ASMB 4Q1RA 2TEPA 3VBHA 1OUXA 2ADDA 3OUHA 2VMCA 2UYAA 1VR3A 4RHV2 2IXIA 2EAKA 3D3AA 2JD4A 3FLTA 3O0VA 4XDOA 2GU9A 3ZM8A 4MHUA 4I01A 1DQ2A 2WNUA 2D43A 2VH9A 1O3SA 4NE9A 1J3PA 4PDWC 5IVJA 1D4M1 4Q2FA 1NCRB 5FLHA 1KJLA 1BBT2 1JYTA 1EPWA 1VLNA 1UYYA 2UY8A 2R30A 3NAPC 3THCA 2XOMA 3ZYIB 1RMU2 5FMCA 4PT6A 4BZ4A 4YW2A 2H6CA 3N9OA 3SHRA 2VW0A 1UPIA 4RSUA 2VBDA 4XW3A 4ARYA 4URAA 2WWJA 2CWMA 3SH4A 1PVC3 1YC61 3AX4A 3AMMA 4M01A 4IW3A 1ALYA 4AHZA 4BK4A 4D6QA 1J59A 1WBLA 3J7NA 3J7LA 1DCSA 3AP5A 4HXCA 1L7QA 2EXJA 3CLPA 1PZ7A 4I3PA 4P9GA 4QU2A 4Q8KA 1YFYA 4D8MA 3DKWA 2BVVA 3I59B 5A1FA 2CGPA 2D6KA 2P1BA 3KQ4B 4LPLA 4ZS3A 5FAXA 1ENQA 3TEYA 1X9TA 3MPBA 5FPAA 1CONA 1TNFA 1ZZ8A 2PHLA 3TBDA 1IGOA 3SEPA 4AHXA 1I1EA 2C4XA 1BQPA 4RGGA 5E6HA 4IV1A 1DGWX 1CIWA 3J9SA 5FZKA 3P6BA 4XVHA 2HWC3 3KCCA 3LPFA 4PIXA 4BJ0A 1PVC1 3HEIA 4V2WA 1MS3A 1MZ6A 4P02B 4QX8A 3WF0A 3RZLA 2Q1ZB 5FY4A 3RQ0A 4AEJA 1RUD1 1A8MA 2A5ZA 1WCUA 2RHPA 3BYWA 5LW9A 4CPBA 3A23A 5FXVA 4QPGC 2R1BA 3DYPA 1RXGA 4N9IA 4CU6A 4RYDA 1ULEA 3E5QA 5J3UA 2P3JA 2BNNA 2BNMA 4UFLA 3B7MA 4ISRA 3WQ0A 4CUCA 2ZX4A 3AMHA 1SBDA 5CKQA 1XNBA 1S2KA 2VR4A 4JGYA 2GN3A 4ORFA 1W6PA 1IS3A 3BKZA 5K4LA 2P34A 3H1YA 4CCNA 3GZAA 4XF9A 4E2GA 1K3IA 5CEHA 3ZR5A 4AEMA 5CFCA 2GMPA 2ID4A 4ATEA 3TB0A 2NYYA 1M06G 1KXGA 5C3PA 3ZPOA 1G9BA 2QJVA 4JKKA 1OVPA 1US2A 4FO9A 4RQPA 5FPBA 1ENXA 3ZN4A 5ACA2 5I8YA 5H9RA 5J96B 5JWPA 3VBHB 3CL1A 4LHNA 3ZDSA 1AJOA 1R092 3PMEA 3RZHA 2XL7A 1FXZA 3OSDA 5I91A 4PI2A 4XABA 1W8WA 1VBA3 5GKAC 2WNUB 2YBPA 4Z92B 4O7XA 1OD5A 2ZGQA 1ZBA3 3I2JA 4Q4X1 4FVVA 4E8CA 1H2KA 2VG9A 3GDBA 5DN2A 2QZ3A 1XPWA 4LKEA 1G8WA 4URTA 5FO7B 5KXBA 3VBSA 3PUQA 1WLDA 3CMGA 2YZ4A 3O14A 1EP0A 2P2KA 1LOFC 2XWJB 3AVSA 1LEMA 1NXD1 1XU1A 3PUAA 2XHKA 1NAEA 2JB8A 3SH3A 3OBTA 3PTYA 5FBZA 3VBHC 4R9DA 3H0OA 1QNYA 4INDA 2VZTA 1HRI1 2ZGMA 4GB32 4XFHA 4UYBA 1HJFA 2ZZQA 5K7PA 1EV12 4XCAA 1VBA1 2WNUC 3T2TA 3KVBA 1ZBA1 4DMIA 1O91A 2E9QA 2OUJA 3KWVA 3WQBA 4UFMA 2PHUA 2YB7A 3O0XA 4BQ3A 2RV9A 2NP0A 1JOBA 2ZACA 1MEC3 2OPKA 2EIEA 3VDDA 5CG8A 2VW2A 3ACLA 4XJWA 3X29B 2L9LA 2WNOA 3TEXA 1RUH3 4BXFA 2VXRA 4IV1B 4QAWA 2FCTA 3JU9A 3VZKA 1FMD2 4DS0A 1F8VA 5A6YA 2B39A 3WDWA 1AX2A 1ZNPA 1PZ9A 2YC4A 4IEOA 5BNQA 1Z7S3 1E5RA 4DINB 5IFPA 2PFWA 3N9MA 2TNFA 1LJ7A 2EICA 3GF6A 4BCUA 4UW3A 2XJSA 2FDJA 1OBNA 1JYXA 2XH6A 4PQQA 4YNIA 2PQSA 1CWPA 4DXZA 1XNKA 1NLQA 3WOGA 3QOPA 2Y0IA 4XJAA 5FYMA 1CQ9A 4WVVA 2D3SA 2FQPA 1LU1A 2PHRA 3C7HA 4LUKA 1JYCA 1U5YA 4M3CF 4QB6A 4JGYB 1GNZA 3OTFA 3U37A 1RUH1 5A6XA 4AI3A 2WZR2 1W6PB 4IV1C 4QHBA 4UW5A 2ZAAA 5C70A 4RGKA 2D6MA 4WVZA 1FV3A 2Y6GA 2WZEA 1PZ8A 4IQPA 1XSQA 4AYUA 4CP9B 3BTAA 3VKMA 3ME2A 1TMF2 4RQPB 4PLNA 4DO0A 1YO8A 3KT1A 1IS6A 1FPN3 2PLV3 3I2OA 3VDAA 3P5BA 4XOGA 5EP9A 2WSVA 5JR7B 5EQUA 5FUNA 2D7FA 2YGMA 4BA6A 1OKOA 4NVPA 5EXOA 2AGSA 2JENA 5FP3A 1ZYBA 2PELA 4JGYC 4LBKA 2E33A 1U5IA 4D69A 3MF9A 2CDOA 4M4PA 3VBOA 4EWEA 1YJKA 4MO3M 4IE5A 1Y43B 4NJ4A 4KG8A 1O59A 1B09A 4CP1A 5FJHA 5CFCC 5DUVA 3ZXJA 3UV9A 2GC1A 5CB7A 3PTRB 3NMBA 4AVSA 3BI3A 1VRBA 1MQTA 1MACA 4F7ZA 2IUWA 3JUUA 3NNGA 4RQPC 4JVAA 1LHUA 2WT2A 1FPN1 3LIGA 3WNPA 3DYMA 1U0AA 1ZA7A 2HWE3 3K77A 1A6CA 5KHKA 3IDBB 2VMIA 2WLQA 3RI9A 2FMDA 2DVDA 1V6IA 2RS12 2ZEXA 3HQRA 1VMJA 1WUVA 3GBGA 4NHKA 4P9LA 4A4AA 1W8UA 1V6NA 3AZXA 3RZGA 1XBFA 4N7IA 3CHXA 1CGPA 4GKYA 1A34A 5LEJA 3IPVA 3VDBA 4XFAA 1JZ6A 3LEIA 3VBSC 3SH5A 3N7LA 1SLTA 2UWAA 2V4AA 1F31A 2VNOA 5FZ6A 3HIFA 2PYTA 5FXWA 1RHI2 4Z1VA 2HWB3 1LR5A 5FYZA 5B4XA 2HWE1 5JOXA 3FMGA 1TME3 3AB0A 3W5NA 4XZPA 1DIWA 1LGBA 4ZKTB 5F5AA 2JE8A 1AYM2 1IQDC 3O12A 1UOJA 3ZSJA 4ARXA 4IEVA 1HQWA 3KQRA 1CJDA 3N9NA 3C7EA 1SMVA 3AM2A 3POIA 4W50A 4QHOA 3GALA 1DQ1A 5JIAA 3NJVA 2JIGA 4NIDA 1PVXA 2Q4SA 1YEWA 3MGUA 4GJYA 4AXOA 2XJUA 3T3YA 4KBZA 5L9RA 4NAMA 5FZDA 5FZBA 5FK7A 3T08A 3VDDC 4ASKA 3NKTA 1O6UA 1ENSA 3CZJA 2WSUA 2HWB1 1M4WA 5FZAA 1CAXA 1O4YA 3T30A 3ZN6A 4DNYA 1VP6A 2WFPA 5GALA 1TME1 3ZFEA 1VB4A 5F6LB 2W3JA 1YQ8A 2YROA 2R49A 1PO12 5D2AA 3UNPA 3WDTA 4LO4B 1W8OA 1Y9MA 5LK5A 5ISLA 2DCTA 3JQWA 1QHDA 3G7DA 1UX6A 1BYHA 1LOBA 2QQIA 3R4UA 4XAEA 1XNAA 5T5JA 3VZMA 5DDJ2 2H0BA 5F37A 5BY5A 1RXFA 1HV0A 3BOPA 1C8NA 1T2XA 4D6RA 5F2SA 4LORA 2P3IA 4CXXA 4RL7A 1FT9A 2E63A 1HN1A 2W92A 5IVBA 1Y4WA 3HQUA 2BRTA 4LIUA 5JZGB 1EUTA 3ZYGA 4JTNA 4ISQA 4FI9A 5LRSA 4BQ1A 3W5MA 4PCRA 1UU6A 2JIJA 3C7OA 5IVVA 3H42B 5GZFA 3SKJE 5H9QA 4BISA 1BK0A 4YZ2A 1PIV2 3OY8A 2B4KA 4R52A 4D6SA 4PIYA 3TYJA 3AFKA 4EROA 2G4IA 4NHXA 2VBPA 1H9PA 2JD9A 2P3KA 1KJRA 2HWF3 3B00A 5T5LA 5FXXA 2F17A 3RVHA 2YUEA 4QXCA 1MZEA 4NMIA 2GAUA 5FY1A 5FXZA 3VBOC 4QU1A 5A3WA 2HBTA 3K4DA 3UKVA 3UT0A 1LOAA 2NMOA 3IDCB 4GWNA 1RL3A 2C9KA 3GXUA 4W6WA 5A6ZA 1ASJ2 2OXBA 1ODNA 1MQTC 2BFUL 4LTAA 4Z2WA 4KGGA 5IW0A 1S0IA 2XL9A 4C0HA 1BZWA 4MVTA 1PM4A 1IPJA 3JBG3 5A80A 3IWZA 1N3OA 3MIGA 4AE2A 5EFUA 1ZZ7A 5KHIA 3ZVXA 2IXCA 5F8PA 3NW4A 2HWF1 1ND3A 3OUIA 4X8NA 2VMDA 3N35A 4AWDA 2VTXJ 2HLEA 1UMZA 1PO22 4LNVA 1RTVA 2ZMNA 5HCBA 2DDUA 4I2OA 2XBO2 4IETA 3UESA 4AI1A 4AW7A 1V9U2 1O3QA 1Y3TA 5JR2A 1BVVA 3JD73 1D2SA 3H8XA 2QTWB 2A6WA 2HYXA 3CQOA 4RR3A 4XFBA 5E88A 1BEV3 1S0DA 4E2SA 2RVAA 4CXYA 2R063 1D0GA 2EXKA 3LDRA 1CAXB 4CCLA 3JBG1 1QQP2 2Q8DA 5A3PA 3ZN6B 4ES8A 4KI5M 1RGSA 2D3PA 4WV8A 1BMV2 4NN0A 5IYYA 1QXRA 3AZZA 3Q8EA 5IVCA 1VRH3 4D0QA 4BMEA 2TUNA 5F5IA 2OQ6A 1XNTA 3ZX7A 3HNMA 2VZPA 3N9PA 4Y1UA 2QQUA 2YC0A 4AHWA 4AAPA 4JQTA 3ZYFA 1QJX3 2K46A 2QVSB 2VZ3A 4CU7A 4JQRA 1V0AA 4OHYA 2GDFA 1YFXA 2ZGLA 4YLZA 4AQ6A 2UWBA 4XBLA 1UY0A 2PN5A 3EMRA 4ET7A 3ZMNA 1WLTA 1BEV1 3KV9A 3AL6A 1AZDA 4XUPA 2R061 2C26A 3RS6A 2Y0OA 1NE4A 2D6OX 1QJY2 5CKNA 1UZ0A 3CU7A 3ZFEC 1RC6A 2Q8OA 3HT2A 3UKNA 3ZSKA 2DVBA 1VRH1 2VVDA 4G3YC 5K9YA 4MGYE 5FO8B 2AEZA 4IGPA 3BN6A 1SBEA 3OBZA 2A6ZA 3AZWA 1QJX1 4Y22A 2CGOA 3VD4A 1HXS2 2ZJCA 1W0PA 4LKSA 1NX9A 4R4XA 4OUEA 4MLOA 1W8TA 1XYPA 2ZMKA 2CL2A 1JTZX 1SBFA 3GGLA 4BLJA 5I8TA 1SG3A 1TEIA 2WFF3 2Y6KA 1SLCA 1YIFA 2R042 1QKQA 4A42A 3A0NA 4Q8LA 4ZU4A 5JI9A 5A7QA 1ZZBA 3B9IA 4IE7A 4MHRA 1V6OA 3ZLIA 2ZHKA 3SISA 4ASLA 5FLJA 1OMIA 4E4HA 4FTBA 3TNQA 3KB5A 3GCWA 4W8JA 3WY6A 4C8DA 1W0OA 3ZDVA 2RM23 4NHLA 2K2SA 4BQ5A 1AR93 5B2GB 4XHXA 5C9AC 4LBLA 4YVSA 1HB2A 4Q4Y3 2JECA 2QQPA 3JQXA 2DF7A 2P5BA 3AMQA 4K21A 2WFF1 1AR73 3K51A 5FZ8A 4A7YA
chains in the Genus database with same CATH topology
2WO1A 1UXZA 2VM9A 2VZ1A 4AAXA 3PUIA 1JZ2A 4OMDA 5JMOA 4JKMA 4ZZ8A 1JI6A 2VCCA 1JYWA 3EB7A 4L0PA 2E26A 1W0NA 2ZEWA 2QQKA 2VQTA 1PX4A 3IAPA 4QB1A 2VZQA 2VMCA 2V4VA 3D3AA 3DYOA 1UY4A 4OYUA 1JZ7A 3ZM8A 2EIDA 2QQOA 2ZXQA 4P00B 5C71A 1J84A 1SDDB 4BXSV 1JYVA 3ABZA 4P08A 2W5FA 1CZVA 4QX0A 2YC2A 3T0AA 2VZRA 1UYYA 3OEAA 3THCA 2XOMA 1EUUA 2KD7A 3NQHA 4PT6A 4CVUA 1TG7A 2X09A 3WF2A 1GOHA 2W1QA 3I3BA 4ARYA 2QQJA 3OEBA 4ZXEA 4QDQA 1W9SA 4BK4A 3C8XA 1OD3A 1L7QA 2W46A 3IAQA 4XURA 1J83A 4D8MA 2BBAA 3FHAA 4LPLA 2VMEA 1OH4A 5F7UA 3SEPA 3WF1A 3T0BA 4OMCA 2C4XA 2Y8KA 2J1AA 3P6BA 3WNKA 4XVHA 3LPFA 4BJ0A 4QX2A 3HEIA 3MO4A 4P02B 3WF0A 2ZEZA 5HXMA 2V72A 4GWIA 2W1WA 2VZSA 3P1IA 3ETPA 3A23A 1GNYA 2WBKA 3FN9A 3DYPA 4W4ZA 4CU6A 4RYDA 2YFZA 1JZ4A 4CUCA 4CUAA 3FL7A 1D7PM 3C7FA 4UI9L 2VR4A 1XC6A 4DUXA 3VDCA 2QQMA 1GU3A 1K3IA 1GOGA 3IIIA 5JXHA 2ID4A 2W1SA 2WQ8A 4UOJA 4TTGA 1OT5A 4JKKA 1US2A 2WO2A 4TXWA 2WYSA 3I2IA 2J1TA 2WDBA 2EIBA 3F2ZA 2WAOA 3I2FA 4DXRA 3UETA 3I2JA 1WKYA 4E8CA 5DN2A 3GDBA 4XZUG 1XPWA 3CMGA 2WZ8A 4QDSA 2J1SA 1NAEA 2LW8A 3HOBA 3I2KA 2J1RA 3FHQA 1OF4A 2VZTA 4A44A 3OGVA 2Z4FA 5IHRA 1UMHA 3NRUA 2VC9A 3EYPA 2VZVA 4MOAA 1SHWB 3OGSA 3WQBA 3WNMA 1W9TA 4JHZA 1UXXX 2YB7A 5EJZB 2YFUA 3HPNA 1W8NA 2RV9A 2W95A 2W94A 4ZZ5A 2EIEA 1K45A 3NJXA 2J1VA 2JKXA 2L9LA 3SKVA 4QAWA 5CZKA 4XUTA 1UY3A 4DXTA 2YC4A 1UY2A 5IFPA 4YPJA 1P8JA 2LS6A 3MV11 2EICA 4A6OA 1CX1A 1PX3A 1GMMA 5FUIA 4P5YA 3MBWA 3K46A 1JYXA 4PQQA 2PQSA 5LA2A 1DYOA 3C7HA 3OB8A 1K42A 4QB6A 3ACGA 3U37A 1I5PA 1UYZA 2CDPA 1US3A 2OKXA 2BZDA 5C70A 2Y6HA 2Y6GA 2VO5A 5G05L 2WZEA 1UYXA 3JXSA 3HNBM 4MADA 5DQ0A 2W91A 2X10A 3VDAA 2B9VA 5JXGA 2WABA 2XQXA 1R64A 3A22A 2E33A 3LEKA 3CZUA 2Y64A 2CDOA 4M4PA 1BHGA 3T09A 3VD7A 4MO3M 2J7MA 4CU9A 4CU8A 1PMHX 4ZY9A 1O59A 3K75B 4E8DA 2WUHA 3I3DA 1W9WA 1W99A 2VOTA 4KWUA 1CZTA 3NNGA 2QQLA 4LHSA 2QQNA 2JDAA 4BDVB 3WNPA 3ACHA 1JZ5A 3I3EA 3DYMA 5J1XA 3WNLA 3K77A 3WF4A 3VD5A 3WF3A 3E1F1 4A3ZA 2ORXA 2ZEXA 5LA1A 4A4AA 1JU3A 4OZOA 1F4HA 4BK5A 3OGRA 5A1AA 3I2HA 3CKHA 1JZ3A 4UAPA 1LNSA 3LE0A 3OG2A 3VDBA 1JZ6A 4DUWA 3LEIA 3ACFA 4MGQA 2VQUA 3WNNA 4CUBA 3I2GA 5B4XA 4DEVA 4GWJA 3T2QA 3W5NA 4JKLA 5EJ1B 2JE8A 5LA0A 1IQDC 4ARXA 5I0DA 3HNYM 4XUNA 3C7EA 2VL4A 2ORZA 4QX3A 4W50A 1KEXA 1MPXA 3OBAA 3NJVA 3HN3A 2Y6LA 2W47A 5LCWL 1OF3A 2V5DA 3DECA 3VD9A 3T08A 3CZJA 1KGYA 4LQRA 2YG0A 2W3JA 3MUZ1 5JXIA 3UNPA 1W8OA 4QB2A 2VZOA 4QPWA 3MV01 2QQIA 1O8PA 1NUKA 1XNAA 3ACIA 4KMQA 3T2PA 2WN2A 3C7GA 5EIYB 1JYNA 2WO3A 1YQ2A 3LEGA 1T2XA 1UWWA 3K4AA 1PMJX 3T0DA 1HN1A 1CIYA 2W92A 1EUTA 2VZUA 3CDZB 4FI9A 3THDA 3WSOA 4AG4A 3W5MA 1WCQA 3C7OA 1F4AA 3SKJE 1DP0A 1RYYA 2B4KA 3I97A 2J1UA 3VD3A 3BGAA 1ULPA 2DCKA 4A45A 2JD9A 3K4ZA 2W87A 1H6YA 1K12A 1TVGA 2XONA 3CIHA 2BERA 3K4DA 3GM8A 1O8SA 2C9KA 2XHNA 3GXUA 2R7EB 1CZSA 4DXSA 3LQCA 5JXJA 3A21A 3J7HA 1JHJA 5C7GA 2VMDA 2HLEA 5B4NA 2DDUA 3UESA 3AC0A 3MUY1 4GZ9A 3T2OA 5JR2A 2X05A 2BGOA 5CYYA 2HYXA 3CQOA 4XUQA 4A41A 2VMFA 5HPOA 3IB3A 2RVAA 5DPNA 5G04L 4Z2AA 5IJRA 4M4RA 4KI5M 5IYYA 3PUHA 4D0QA 1JZ8A 1GOFA 1XNTA 3HNMA 1UX7A 2VZPA 3LPGA 2E32A 2W9XA 1GQPA 4XUOA 5DMYA 4CU7A 2VZ3A 2QBXA 3SEEA 5IFTA 1UY0A 4ET7A 1ULOA 1UMIA 4XUPA 3HJRA 2C26A 5JUVA 2BGPA 2VCBA 1UZ0A 3WNOA 2WAAA 2RJ2A 2VTFA 3BN6A 2VCAA 1H6XA 2ZEYA 3VD4A 4MGSA 4LKSA 4QX1A 1NX9A 1UY1A 1GUIA 2Y6JA 1JU4A 4OUEA 3GGLA 2W1UA 1DLCA 1SG3A 2Y6KA 4A42A 2DCJA 3A7QA 4PF1A 4DEQA 2J1EA 2J22A 3WEZA 2WN3A 3ECQA 4W8JA 4RN5A 4IUGA 4JX0A 3IDAA 1NKGA 4DUVA 4HG6B 1L7RA 2VJXA 4QDRA 2E31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WO1 A;  1UXZ A;  2VM9 A;  2VZ1 A;  4AAX A;  3PUI A;  1JZ2 A;  4OMD A;  5JMO A;  4JKM A;  4ZZ8 A;  1JI6 A;  2VCC A;  1JYW A;  3EB7 A;  4L0P A;  2E26 A;  1W0N A;  2ZEW A;  2QQK A;  2VQT A;  1PX4 A;  3IAP A;  4QB1 A;  2VZQ A;  2VMC A;  2V4V A;  3D3A A;  3DYO A;  1UY4 A;  4OYU A;  1JZ7 A;  3ZM8 A;  2EID A;  2QQO A;  2ZXQ A;  4P00 B;  5C71 A;  1J84 A;  1SDD B;  4BXS V;  1JYV A;  3ABZ A;  4P08 A;  2W5F A;  1CZV A;  4QX0 A;  2YC2 A;  3T0A A;  2VZR A;  1UYY A;  3OEA A;  3THC A;  2XOM A;  1EUU A;  2KD7 A;  3NQH A;  4PT6 A;  4CVU A;  1TG7 A;  2X09 A;  3WF2 A;  1GOH A;  2W1Q A;  3I3B A;  4ARY A;  2QQJ A;  3OEB A;  4ZXE A;  4QDQ A;  1W9S A;  4BK4 A;  3C8X A;  1OD3 A;  1L7Q A;  2W46 A;  3IAQ A;  4XUR A;  1J83 A;  4D8M A;  2BBA A;  3FHA A;  4LPL A;  2VME A;  1OH4 A;  5F7U A;  3SEP A;  3WF1 A;  3T0B A;  4OMC A;  2C4X A;  2Y8K A;  2J1A A;  3P6B A;  3WNK A;  4XVH A;  3LPF A;  4BJ0 A;  4QX2 A;  3HEI A;  3MO4 A;  4P02 B;  3WF0 A;  2ZEZ A;  5HXM A;  2V72 A;  4GWI A;  2W1W A;  2VZS A;  3P1I A;  3ETP A;  3A23 A;  1GNY A;  2WBK A;  3FN9 A;  3DYP A;  4W4Z A;  4CU6 A;  4RYD A;  2YFZ A;  1JZ4 A;  4CUC A;  4CUA A;  3FL7 A;  1D7P M;  3C7F A;  4UI9 L;  2VR4 A;  1XC6 A;  4DUX A;  3VDC A;  2QQM A;  1GU3 A;  1K3I A;  1GOG A;  3III A;  5JXH A;  2ID4 A;  2W1S A;  2WQ8 A;  4UOJ A;  4TTG A;  1OT5 A;  4JKK A;  1US2 A;  2WO2 A;  4TXW A;  2WYS A;  3I2I A;  2J1T A;  2WDB A;  2EIB A;  3F2Z A;  2WAO A;  3I2F A;  4DXR A;  3UET A;  3I2J A;  1WKY A;  4E8C A;  5DN2 A;  3GDB A;  4XZU G;  1XPW A;  3CMG A;  2WZ8 A;  4QDS A;  2J1S A;  1NAE A;  2LW8 A;  3HOB A;  3I2K A;  2J1R A;  3FHQ A;  1OF4 A;  2VZT A;  4A44 A;  3OGV A;  2Z4F A;  5IHR A;  1UMH A;  3NRU A;  2VC9 A;  3EYP A;  2VZV A;  4MOA A;  1SHW B;  3OGS A;  3WQB A;  3WNM A;  1W9T A;  4JHZ A;  1UXX X;  2YB7 A;  5EJZ B;  2YFU A;  3HPN A;  1W8N A;  2RV9 A;  2W95 A;  2W94 A;  4ZZ5 A;  2EIE A;  1K45 A;  3NJX A;  2J1V A;  2JKX A;  2L9L A;  3SKV A;  4QAW A;  5CZK A;  4XUT A;  1UY3 A;  4DXT A;  2YC4 A;  1UY2 A;  5IFP A;  4YPJ A;  1P8J A;  2LS6 A;  3MV1 1;  2EIC A;  4A6O A;  1CX1 A;  1PX3 A;  1GMM A;  5FUI A;  4P5Y A;  3MBW A;  3K46 A;  1JYX A;  4PQQ A;  2PQS A;  5LA2 A;  1DYO A;  3C7H A;  3OB8 A;  1K42 A;  4QB6 A;  3ACG A;  3U37 A;  1I5P A;  1UYZ A;  2CDP A;  1US3 A;  2OKX A;  2BZD A;  5C70 A;  2Y6H A;  2Y6G A;  2VO5 A;  5G05 L;  2WZE A;  1UYX A;  3JXS A;  3HNB M;  4MAD A;  5DQ0 A;  2W91 A;  2X10 A;  3VDA A;  2B9V A;  5JXG A;  2WAB A;  2XQX A;  1R64 A;  3A22 A;  2E33 A;  3LEK A;  3CZU A;  2Y64 A;  2CDO A;  4M4P A;  1BHG A;  3T09 A;  3VD7 A;  4MO3 M;  2J7M A;  4CU9 A;  4CU8 A;  1PMH X;  4ZY9 A;  1O59 A;  3K75 B;  4E8D A;  2WUH A;  3I3D A;  1W9W A;  1W99 A;  2VOT A;  4KWU A;  1CZT A;  3NNG A;  2QQL A;  4LHS A;  2QQN A;  2JDA A;  4BDV B;  3WNP A;  3ACH A;  1JZ5 A;  3I3E A;  3DYM A;  5J1X A;  3WNL A;  3K77 A;  3WF4 A;  3VD5 A;  3WF3 A;  3E1F 1;  4A3Z A;  2ORX A;  2ZEX A;  5LA1 A;  4A4A A;  1JU3 A;  4OZO A;  1F4H A;  4BK5 A;  3OGR A;  5A1A A;  3I2H A;  3CKH A;  1JZ3 A;  4UAP A;  1LNS A;  3LE0 A;  3OG2 A;  3VDB A;  1JZ6 A;  4DUW A;  3LEI A;  3ACF A;  4MGQ A;  2VQU A;  3WNN A;  4CUB A;  3I2G A;  5B4X A;  4DEV A;  4GWJ A;  3T2Q A;  3W5N A;  4JKL A;  5EJ1 B;  2JE8 A;  5LA0 A;  1IQD C;  4ARX A;  5I0D A;  3HNY M;  4XUN A;  3C7E A;  2VL4 A;  2ORZ A;  4QX3 A;  4W50 A;  1KEX A;  1MPX A;  3OBA A;  3NJV A;  3HN3 A;  2Y6L A;  2W47 A;  5LCW L;  1OF3 A;  2V5D A;  3DEC A;  3VD9 A;  3T08 A;  3CZJ A;  1KGY A;  4LQR A;  2YG0 A;  2W3J A;  3MUZ 1;  5JXI A;  3UNP A;  1W8O A;  4QB2 A;  2VZO A;  4QPW A;  3MV0 1;  2QQI A;  1O8P A;  1NUK A;  1XNA A;  3ACI A;  4KMQ A;  3T2P A;  2WN2 A;  3C7G A;  5EIY B;  1JYN A;  2WO3 A;  1YQ2 A;  3LEG A;  1T2X A;  1UWW A;  3K4A A;  1PMJ X;  3T0D A;  1HN1 A;  1CIY A;  2W92 A;  1EUT A;  2VZU A;  3CDZ B;  4FI9 A;  3THD A;  3WSO A;  4AG4 A;  3W5M A;  1WCQ A;  3C7O A;  1F4A A;  3SKJ E;  1DP0 A;  1RYY A;  2B4K A;  3I97 A;  2J1U A;  3VD3 A;  3BGA A;  1ULP A;  2DCK A;  4A45 A;  2JD9 A;  3K4Z A;  2W87 A;  1H6Y A;  1K12 A;  1TVG A;  2XON A;  3CIH A;  2BER A;  3K4D A;  3GM8 A;  1O8S A;  2C9K A;  2XHN A;  3GXU A;  2R7E B;  1CZS A;  4DXS A;  3LQC A;  5JXJ A;  3A21 A;  3J7H A;  1JHJ A;  5C7G A;  2VMD A;  2HLE A;  5B4N A;  2DDU A;  3UES A;  3AC0 A;  3MUY 1;  4GZ9 A;  3T2O A;  5JR2 A;  2X05 A;  2BGO A;  5CYY A;  2HYX A;  3CQO A;  4XUQ A;  4A41 A;  2VMF A;  5HPO A;  3IB3 A;  2RVA A;  5DPN A;  5G04 L;  4Z2A A;  5IJR A;  4M4R A;  4KI5 M;  5IYY A;  3PUH A;  4D0Q A;  1JZ8 A;  1GOF A;  1XNT A;  3HNM A;  1UX7 A;  2VZP A;  3LPG A;  2E32 A;  2W9X A;  1GQP A;  4XUO A;  5DMY A;  4CU7 A;  2VZ3 A;  2QBX A;  3SEE A;  5IFT A;  1UY0 A;  4ET7 A;  1ULO A;  1UMI A;  4XUP A;  3HJR A;  2C26 A;  5JUV A;  2BGP A;  2VCB A;  1UZ0 A;  3WNO A;  2WAA A;  2RJ2 A;  2VTF A;  3BN6 A;  2VCA A;  1H6X A;  2ZEY A;  3VD4 A;  4MGS A;  4LKS A;  4QX1 A;  1NX9 A;  1UY1 A;  1GUI A;  2Y6J A;  1JU4 A;  4OUE A;  3GGL A;  2W1U A;  1DLC A;  1SG3 A;  2Y6K A;  4A42 A;  2DCJ A;  3A7Q A;  4PF1 A;  4DEQ A;  2J1E A;  2J22 A;  3WEZ A;  2WN3 A;  3ECQ A;  4W8J A;  4RN5 A;  4IUG A;  4JX0 A;  3IDA A;  1NKG A;  4DUV A;  4HG6 B;  1L7R A;  2VJX A;  4QDR A;  2E31 A; 
#chains in the Genus database with same CATH topology
 4AVT A;  4YZ4 A;  1ND3 B;  2WO1 A;  4JZR A;  1IHM A;  5IWF A;  3PUI A;  1X9P A;  4NPM A;  1JZ2 A;  4OMD A;  4NO4 A;  4NHM A;  4JKM A;  1UKR A;  4XAC A;  4ZZ8 A;  4NUB A;  3GHM A;  2W2I A;  2QNK A;  4XTM A;  3AZY A;  2RM2 1;  4GXL A;  1AR9 1;  1QOS A;  3MIH A;  4N53 A;  4RR3 B;  4CEW A;  2E53 A;  4L0P A;  2E26 A;  1W0N A;  1RVF 3;  3KVA A;  4Q4Y 1;  4FAG A;  2FCU A;  1S55 A;  1VAL A;  2HJI A;  2ERF A;  2RJK A;  3FWE A;  4RFT 0;  4X8P A;  3WQ1 A;  3DXU A;  5T52 A;  1PGW 2;  2ZZJ A;  5LAS A;  1AR7 1;  1LED A;  4MGI E;  3GYD A;  2V4V A;  5AC9 2;  2FZ1 A;  5C8W A;  4XFI A;  1H2L A;  2EID A;  1LEN A;  3B5L B;  1J84 A;  4KWL A;  5CKM A;  5A7N A;  1F5F A;  2LRP A;  3OOX A;  4Y20 A;  4QX0 A;  2YC2 A;  3T0A A;  5LWB A;  1J3R A;  1R1A 2;  4LHL A;  4RR3 C;  2P3Y A;  2WNE A;  1EUU A;  1A8D A;  2Z69 A;  4CVU A;  1OI6 A;  1Y9G A;  3VLB B;  2I45 A;  3M3O A;  1OQ1 A;  2FDI A;  2UY9 A;  1DQ5 A;  4EQV A;  1X36 A;  3E5U A;  3I3B A;  3D82 A;  4LEJ A;  1IOA A;  3UJQ A;  3WG4 A;  1LU2 A;  3I54 A;  2UWC A;  2VTX A;  3KLS A;  1XSR A;  4NPL A;  5KC6 A;  1QGL A;  1LUL A;  3QCW A;  5L9V A;  1Q5O A;  1UN1 A;  2UU8 A;  4XAA A;  1VBB 1;  2W46 A;  3KS7 A;  1LB2 A;  1HRV 3;  1YQ6 A;  1ZX5 A;  1J83 A;  4YVW A;  3NJZ A;  2JG8 A;  3M8L A;  1X33 A;  5CAD A;  1JOP A;  4UFK A;  2I07 B;  2Q8E A;  5F7U A;  2DVG A;  3N7J A;  2B5H A;  2Y8K A;  2ZGN A;  2GZW A;  1UYP A;  2AUY A;  4O61 A;  4CA9 A;  3WNK A;  3U07 A;  3O1U A;  3NNL A;  3I4I A;  2WNV B;  2VMG A;  2RS3 1;  3DV8 A;  3MO4 A;  5FPZ A;  2ETE A;  2ZEZ A;  1KD7 A;  1ZRE A;  1DQ4 A;  1S2B A;  2GC0 A;  1OPO A;  5HXM A;  4GWI A;  1WGP A;  3AL5 A;  3EHK A;  1NCR A;  4COW A;  1W04 A;  1YFW A;  3ETP A;  1G9D A;  2R32 A;  1GNY A;  2WII B;  4YVS B;  4W4Z A;  2Q1F A;  3BIW E;  5HXV A;  5LRR A;  5IAV A;  4MX3 A;  4U36 A;  3T4H B;  3B69 A;  2BGC A;  1OHF A;  1HIX A;  2XML A;  3MLK A;  1HW5 A;  4CUG A;  2B42 B;  3FL7 A;  5CFD A;  3C7F A;  4CUA A;  3EBR A;  3R05 A;  1W2A X;  4K6B A;  3RG0 A;  4DUX A;  4XJZ A;  3INA A;  4BM8 A;  3VDC A;  2CHH A;  4ZHN A;  1RUI 3;  5FZO B;  1GU3 A;  3III A;  1GOG A;  5JXH A;  1VBE 3;  4H14 A;  3L2Y A;  3RNS A;  2WQ8 A;  3M3I A;  4N53 B;  1OT5 A;  2RS5 3;  1W3X A;  2Q8C A;  1REE A;  3BU0 A;  2PHD A;  1AL0 G;  2Z5W A;  4YVS C;  1D4M 2;  4TXW A;  1WA6 X;  5FP9 A;  4AVA A;  3TN9 3;  2VOW A;  2CAV A;  4FOW A;  1OC1 A;  2D44 A;  1NA1 A;  1GYK A;  1T6B X;  2WZP P;  2HWD 1;  3O7O A;  3V0A A;  5L19 A;  4A7K A;  1VIW B;  2ZBJ A;  4BLI A;  4AL9 A;  2FMY A;  2WAO A;  4H2A A;  2C0Z A;  1D4V B;  2JWP A;  3UET A;  3MID A;  4HON A;  1RUI 1;  3VL9 A;  3ZYB A;  2WT1 A;  5FMB A;  4RS5 A;  1VBE 1;  2LM3 A;  3KGL A;  1QY4 A;  2D98 A;  4XDQ A;  4Y20 B;  2R16 A;  5EZW A;  3PVO A;  2NZ9 A;  3ZKU A;  1EPZ A;  2XB6 C;  4IXL A;  2RS5 1;  4N53 C;  4QDS A;  3FUO A;  5DUX A;  4CEW C;  2WJS A;  2XDV A;  4GA9 A;  2RR1 3;  1MS1 A;  4HK8 A;  2UYB A;  1GLH A;  2W0X A;  3HOB A;  3I2K A;  4HL0 A;  4Y24 A;  5KHH A;  1XB9 A;  2FHR A;  1QJU 3;  3NST A;  5C8C A;  2O8Q A;  4NPR A;  2J1R A;  4E4Z A;  5L7O B;  4E27 A;  4P9Y A;  3OGV A;  1OOP A;  3WDV A;  5IHR A;  1H0B A;  1AL2 3;  1X82 A;  2PXJ A;  2Y33 A;  2EAA A;  4XFF A;  5H9S A;  1SHW B;  1UD1 A;  1BCX A;  2A1X A;  1MR5 A;  3WNM A;  1ZZC A;  5GZC A;  1UXX X;  3ZXK A;  2YFU A;  3HPN A;  1PK6 B;  1PVC 2;  4IV3 A;  2JG8 B;  1APN A;  1N47 A;  2DTW A;  2BNO A;  2VQ0 A;  1VAV A;  1RUD 2;  5FYI A;  5A3O A;  4ZU7 A;  1K45 A;  3NJX A;  2J1V A;  2JKX A;  4AGV A;  1RUJ 3;  2GP5 A;  1QJU 1;  1OQD A;  1DGW A;  4IEQ A;  4IER A;  1UY3 A;  4Z82 A;  1S0G A;  3EQE A;  3JCI A;  4XQ4 A;  4IEP A;  5FZ0 A;  4Q5O A;  4DXT A;  1F9K A;  4MGT A;  1GBG A;  4YG0 A;  3UGH A;  4MSV A;  4Q4V 3;  1AL2 1;  4YPJ A;  3PVN A;  4P9X A;  1P8J A;  3FC0 A;  1UQX A;  4FBF A;  4J1X A;  3MV1 1;  4XJ8 A;  4LUM A;  5EHD A;  3I3M A;  2E7Q A;  1V70 A;  1CX1 A;  4A6O A;  1E5H A;  1PX3 A;  2VOV A;  1AR6 3;  3LGR A;  4LE3 A;  4P5Y A;  4YVW C;  3OBR A;  4P9J A;  2JG8 C;  2DUO A;  4NHY A;  4ONU A;  5FZH A;  5IUQ A;  3VBR B;  5I0S A;  3CEW A;  2XLF A;  3BTY A;  5KHG A;  1NG0 A;  1MS5 A;  2VUC A;  1DYO A;  1K42 A;  5CFD B;  4XTP A;  3GZT B;  2PTM A;  2IXK A;  4FP3 A;  4Q27 A;  1Q8O A;  1RUJ 1;  2P37 A;  4AVB A;  2QFE A;  3ZIW A;  5JPN B;  5FV3 A;  1US3 A;  2OKX A;  1J58 A;  2AR6 A;  4Y26 A;  4QGM A;  1I6X A;  1QH7 A;  3IMM A;  1UYX A;  3E6B A;  4Q4V 1;  5DG1 A;  4BQX A;  5DQ0 A;  4XBN A;  5JOY A;  4DRV A;  2X10 A;  4CSW A;  4IEU A;  1NCR C;  1BLZ A;  4K8R B;  1VBD 3;  1Q3E A;  3ZXE A;  2XLA A;  2A3Y A;  1AR6 1;  4N7U A;  4Q4X 2;  2MHF A;  4TLF A;  1U5Z A;  2P17 A;  1V6K A;  4FPC A;  4M0H A;  3VN4 A;  1O4Z A;  2WR9 A;  3RZJ A;  1NA1 B;  5KBF A;  5FZ9 A;  5DUU A;  4OQ9 A;  3WCR A;  2O0O A;  4GMP 0;  1R64 A;  5CFD C;  3V0A B;  3BTZ A;  2JKB A;  1FAY A;  1UCX A;  3LEK A;  4MUV A;  2QUO A;  2O8O A;  3ROU A;  3VD7 A;  2J7M A;  2X53 S;  3AZV A;  1BVP 1;  4MGK E;  4R4Z A;  4WM8 A;  4AHY A;  4ZY9 A;  4RS5 B;  5C3R A;  1HRI 2;  2WUH A;  2ZAH A;  2D93 A;  2PQQ A;  1H4H A;  1W99 A;  4YZ5 A;  3N4M A;  1VBA 2;  3N9Q A;  4AQS A;  1QDC A;  1W9F A;  2ZOE B;  1ZBA 2;  4LHS A;  1MS8 A;  4BDV B;  5L9B A;  1B35 A;  2D3R A;  2D5H A;  3I3E A;  3WP6 A;  1JZ5 A;  2ZPX A;  3WNL A;  3ZXG A;  1FOD 3;  4N43 A;  3WF4 A;  1C28 A;  2IFR A;  3QAC A;  3VD5 A;  5C8C B;  1NA1 C;  1VMH A;  3S30 A;  2GH8 A;  1OOP B;  3LOI A;  5FPL A;  2E6V A;  1ZZ9 A;  3FBY A;  1AXK A;  2HWC 1;  3FFZ A;  5A1A A;  4BK5 A;  3OGR A;  1RB8 G;  1RMU 3;  3I2H A;  1AXY A;  1GQH A;  2ES3 A;  3M3E A;  4DFS A;  3KM5 A;  4RS5 C;  4CP9 A;  3GJB A;  1LNS A;  3ILN A;  3LE0 A;  5AFB A;  2Y26 A;  3ACF A;  4IV3 B;  4MG2 A;  1WZX A;  3M7A A;  2VQU A;  5FKB A;  3WNN A;  5A33 B;  4M0N A;  2E51 A;  2NMN A;  3ILR A;  3VHR A;  4ES9 A;  1DU3 D;  4GWJ A;  4Y1Y A;  4DEV A;  1RUE 3;  5FMD A;  1ODM A;  1FOD 1;  4PQ9 A;  4WZF A;  5C8C C;  5EJ1 B;  1GSL A;  3W59 A;  3ZXA C;  4PLO A;  2JJ6 A;  5CNA A;  1OOP C;  1BJQ A;  3CNA A;  5F39 A;  1LOG A;  2DU1 A;  1QXP A;  3R4D B;  4XUN A;  1UPS A;  2GME A;  1UW8 A;  1RUH 2;  1J1T A;  4OHV A;  3OBA A;  3S7E A;  3HN3 A;  3POF A;  1IS4 A;  1LHN A;  3UJO A;  1SPP A;  2VXJ A;  5LCW L;  1C57 A;  1UL9 A;  2OVU A;  1OQE A;  2XG3 A;  4IV3 C;  3AJY A;  4CCM A;  2NPI A;  1QDO A;  4FFI A;  2ATF A;  1COV 3;  4J6G A;  1O7F A;  4RD7 A;  4H3W A;  2EXI A;  5DZG A;  3VD9 A;  2CTV A;  3RYP A;  1KGY A;  5FZF A;  2YY1 A;  1RUE 1;  5J09 A;  2BQP A;  3DL3 A;  3AMN A;  3WUC A;  1WA4 A;  4AFD A;  1G9A A;  3M4F A;  2ENR A;  4G4F A;  4C1X A;  4QB2 A;  2VZO A;  3V0B A;  4KL1 A;  4XIO A;  4XE9 A;  4KMQ A;  3T2P A;  4FSJ A;  3WW2 A;  5FZC A;  2BOI A;  1JS9 A;  5K0U A;  2DWR A;  3LWC A;  3ZSL A;  1JYN A;  2WO3 A;  1I3H A;  4UBG A;  4BYY A;  3PIJ A;  3VB9 A;  2A6X A;  1COV 1;  4BOW A;  1C3H A;  1PMJ X;  3AYD A;  1YQC A;  1CIY A;  1FPN 2;  4SLI A;  4JHT A;  5ACA 3;  3L9J T;  1W8Z A;  4WM8 B;  4QT6 A;  5L36 A;  4TYS A;  2DBI A;  1W6O A;  2H0V A;  1BKZ A;  3WSO A;  2DFB A;  4Y33 A;  4Y5S A;  4XF4 A;  4D7Y A;  1DGR N;  4FPY A;  1GZT A;  4RGA A;  1DLL A;  1F4A A;  5A7P A;  3GZE A;  1QH6 A;  1DYP A;  1RYY A;  2XLG A;  4N9H A;  5FY9 A;  1H1I A;  5I0R A;  2J1U A;  1B35 B;  4YM0 A;  5KWR A;  2VMH A;  4ZU5 A;  1A78 A;  2D6L X;  4LK7 A;  1MEC 1;  4ATF A;  5GLZ A;  4N43 B;  4XYX A;  4TWT A;  1OH3 A;  1LCL A;  2A3W A;  1ST8 A;  2W87 A;  3I8T A;  1H6Y A;  1QWR A;  1K12 A;  1NLS A;  1TVG A;  3F95 A;  4Y3O A;  4NIA A;  4QM9 A;  2HWE 2;  1SCS A;  1X8M A;  1FI2 A;  4I02 A;  4WM8 C;  1IKQ A;  1KS5 A;  2DVF A;  1Z7S 1;  1ULD A;  2P4E A;  4HKL A;  2K9Z A;  2XUE A;  1C5I A;  2YDE A;  3MDP A;  3KV4 A;  4A3X A;  1JW6 A;  2WA3 A;  3APB A;  2ZKN A;  3MLL A;  4DB5 A;  3HD8 B;  2I74 A;  3WLU A;  1WD4 A;  4MGZ E;  4E4S A;  5LBB A;  2VUA A;  1UIK A;  2N7G A;  2A70 A;  4LMF A;  5I0T A;  4L99 A;  1HJG A;  3ZSE A;  2ZML A;  3ATG A;  1B35 C;  4I0A A;  2HYK A;  4LO6 B;  1RUO A;  4LT5 A;  1AF9 A;  5FZI A;  2JG9 B;  4N43 C;  1LOD A;  2PAE A;  1PM7 A;  1N1V A;  5H9P A;  5C7G A;  2Q5T A;  4FOQ A;  5FJK A;  2HWB 2;  3KCY A;  4HOO A;  4LOS A;  5JZG A;  4XEZ A;  1UZZ A;  4GJZ A;  2WS9 3;  2Q1M A;  1TME 2;  2EXH A;  4Z8B A;  5IVY A;  3AC0 A;  5FPV A;  4JDM A;  1SPP B;  3CJI A;  5E16 A;  3T2O A;  2PAM A;  3CF6 E;  5EPA A;  4IEX A;  2VMF A;  3J8F 3;  2FBE A;  2PLV 1;  4L8Q A;  3QLQ A;  3RSJ A;  3THT A;  5DPN A;  5G04 L;  3GZU C;  4LUL A;  3ES4 A;  1Q43 A;  1PMI A;  3NNF A;  3ES1 A;  3O1V A;  3HT1 A;  4RFR B;  4BQ4 A;  5ABJ A;  1G9C A;  1KQR A;  5SV8 A;  3Q8B A;  3RYR A;  1K5M A;  1OFS A;  2KM2 A;  4IDZ A;  3U10 A;  3CO2 A;  1GOF A;  1CR7 A;  4BPZ A;  4PBP A;  2CNA A;  5AVP A;  2E32 A;  2W9X A;  3SCF A;  5DMY A;  2WS9 1;  3V0B B;  2QBX A;  3RDI A;  1NT0 A;  1K5J A;  1ZA4 A;  1NY7 1;  3AFG A;  4LIT A;  5IVF A;  4L92 A;  2ZGO A;  3SEE A;  5K0U B;  1H4G A;  1JXN A;  4ZON A;  2W52 A;  4CDX A;  2XGX A;  3O1S A;  4Y5Z 0;  1ULO A;  3J8F 1;  2IFW A;  4HAN A;  3RZK A;  3FZ3 A;  4YG6 A;  1TZO A;  4QD2 A;  2VCB A;  1WWY A;  3SLI A;  3MYX A;  1OFN A;  2JDH A;  4QWN A;  4YW4 A;  4V1P A;  1W6O B;  5FDB A;  1PGL 1;  2WC2 A;  2ZCW A;  2VCA A;  5F3G A;  2ZEY A;  1WME A;  3Q8A A;  3B3Q E;  3BIE A;  4LBO A;  3PJY A;  1JN2 P;  1AX1 A;  1HKD A;  1GV9 A;  5T54 A;  5K0U C;  1UU5 A;  4XPV A;  5KHJ A;  2Y6J A;  1JU4 A;  1ZBE 3;  2OQ7 A;  3WNX A;  2J42 A;  5DAQ A;  2NLR A;  4M3C E;  4XXP A;  5EYX A;  3L2H A;  2RMU 3;  5FYU A;  4BMB A;  4GWM A;  3POE A;  1GR3 A;  4FP2 A;  5CU1 A;  1C5H A;  4DEQ A;  1EAH 3;  4MET A;  4FCA A;  3VL8 A;  3WG1 A;  5A7W A;  4QGN A;  5C6C A;  4X6R B;  3AKS A;  4K1Y A;  4CCC A;  1ND2 A;  3UGG A;  3ECQ A;  2BW8 A;  3V56 A;  5A3N A;  2HWF 2;  1LOE A;  1O4T A;  2XXZ A;  4DY3 A;  4IUG A;  5J37 A;  3OD0 A;  2FDK A;  2RS1 3;  2ARE A;  4D7S A;  1H2M A;  1NKG A;  1Z78 A;  2ET1 A;  4DUV A;  1ZBE 1;  3ENR A;  1VAM A;  1L7R A;  4IGQ A;  2RMU 1;  1CPN A;  2GND A;  2E31 A;  1S0B A;  1AXZ A;  3N7K A;  5HBA A;  1F15 A;  1S0F A;  1EAH 1;  1JYI A;  1FNZ A;  4A6S A;  5A32 A;  3JBG 2;  4LJH A;  3U14 A;  3KF5 A;  3LA7 A;  4CP0 A;  4EWA A;  5JMO A;  5DAV A;  1JI6 A;  2LUW A;  4YYO A;  2OS2 A;  3CJI B;  4EZ4 A;  4PBO A;  1XXN A;  5KXE A;  5LY1 A;  4HT1 T;  2CYF A;  3ZXL A;  4ZS2 A;  5DZF A;  1Q8Q A;  4CCK A;  1ULF A;  3WW4 A;  2WQZ C;  4HVR A;  5ANN A;  5ABJ B;  2X5I A;  2YU2 A;  1UY4 A;  3VGI A;  1K5M B;  5GLT A;  1BEV 2;  2F6B A;  2VNV A;  2VGD A;  1HDK A;  4EN9 B;  1JZ7 A;  2ZXQ A;  1FNY A;  2R06 2;  4P00 B;  4H55 A;  1JBC A;  1JUH A;  1NZI A;  5JZG C;  1JOD A;  2BUK A;  5EV7 A;  1W90 A;  3UYJ A;  1JYV A;  3ABZ A;  5FOJ B;  4WBB A;  2W5F A;  3E97 A;  4LLO A;  5C3S A;  5APA A;  2GNB A;  1VRH 2;  3SIT A;  4AI9 A;  2E7T A;  2VZR A;  2WIN B;  3ZFG B;  4CDX B;  1QIQ A;  4HK9 A;  3DF0 A;  4BB3 A;  4PLM A;  2KD7 A;  3NQH A;  1QJX 2;  4KBB A;  2IC1 A;  3N36 A;  2HEW F;  2X09 A;  1VBC 3;  3U1X A;  3WF2 A;  4CRQ A;  5FP7 A;  3P3N A;  1CPM A;  3I3Q A;  3M2M A;  2QQJ A;  3OEB A;  1JMU B;  2C6S A;  5ABJ C;  4QDQ A;  1Y9Q A;  4HVQ A;  3PU8 A;  4C1W A;  1K5M C;  3ZIX A;  2R6Q A;  2ZX2 A;  3AJZ A;  1F2N A;  1MVQ A;  2OZ6 A;  2GC3 A;  3MPP G;  3ZPY A;  4LKF A;  3WP4 A;  2GSY A;  3C8X A;  3W58 A;  4EE2 A;  1YUD A;  3UGF A;  1TNR A;  2PHW A;  1GWM A;  2QQV A;  3VKL A;  3T1M A;  4Z07 A;  1DFQ A;  3D5O A;  4OHX A;  2CAU A;  2WYF A;  4XXA A;  1GKB A;  1YCI A;  5GLV A;  1VBC 1;  2MEV 3;  4OMC A;  4Y5T A;  5A7W B;  1IQA A;  5HV4 A;  1OA2 A;  5T3N A;  1E5I A;  1ND2 B;  2WFF 2;  3H3U A;  5T5P A;  2LAL A;  1QJF A;  3THP A;  1FAT A;  2W1W A;  1GWL A;  4QKN A;  2VZS A;  1W8H A;  3ZSM A;  4EZH A;  1YFU A;  3H1M A;  1DDL A;  3DCQ A;  3FN9 A;  4HKW A;  3JD7 1;  1LGC A;  2WKK A;  3B93 A;  3W20 A;  3RRD A;  5CA6 A;  4HBN A;  1GZW A;  1TE1 B;  2QDR A;  2RM2 2;  1AR9 2;  2CGN A;  4B8E A;  3S0M A;  3J7M A;  2DCZ A;  2VBB A;  1NCQ A;  1WCD J;  4UI9 L;  5LB6 A;  4Q4Y 2;  2MEV 1;  3PNA A;  1ASJ 3;  1R1Z A;  3AYA A;  5A32 B;  1C1F A;  1XE0 A;  2QQM A;  2D40 A;  4BHP A;  5FUP A;  2WQ4 A;  1KRI A;  4ITC A;  5FIX A;  5FO9 B;  1AR7 2;  1ND2 C;  2DUP A;  3B02 A;  4N8M A;  4SBV A;  3S6P A;  2HEY F;  2ZHL A;  5A3T A;  4I30 A;  1RED A;  1RUC 3;  2W1S A;  1N3P A;  4PIZ A;  4BE3 A;  2BBV A;  2WO2 A;  4F83 A;  3LCP A;  1U12 A;  5F3E A;  2WYS A;  1OXC A;  2J1T A;  2C9A A;  2WDB A;  4GD4 A;  2C5D A;  2XR4 A;  4Q4W 3;  3KHB A;  1LEC A;  3AP9 A;  2Y6F A;  4NWV A;  3SMH A;  2X5I B;  5JI7 A;  4XF3 A;  4PHZ A;  5FYT A;  2AAC A;  3F2Z A;  2YBK A;  1OA3 A;  2G9F A;  5GZD A;  3I2F A;  2JDU A;  2MPF A;  1AR8 3;  1W6Q A;  2Z42 A;  1WKY A;  2WNV A;  4KGQ A;  4S2D A;  1ZRI A;  4C91 A;  3OYW A;  3POW A;  1LGN A;  2VAU A;  3NKG A;  2PHF A;  4OI1 A;  1QQP 3;  1RUC 1;  2WA4 A;  5A3M A;  4COV A;  4R9A A;  5FMO L;  5DXD A;  5FYB A;  3ZYJ B;  3IBM A;  2J1S A;  4L9B A;  5LA9 A;  3UK9 A;  5LBE A;  1VBB 2;  1A3K A;  3ST7 A;  2MNG A;  4Q4W 1;  3AKP A;  1V00 A;  1OF4 A;  1Q8V A;  2X5I C;  2QZ2 A;  3AP6 A;  1V6J A;  4IE4 A;  2OPW A;  5FMO S;  2Z4F A;  1UMH A;  3ELN A;  3EYP A;  3NRU A;  2VZV A;  1WW7 A;  4HET A;  4MOA A;  3LSD A;  5FZE A;  3U4S A;  1AR8 1;  2VVF A;  2JDY A;  4GQ7 A;  4UFI A;  5FZO A;  3OGS A;  5C3O A;  1S2E A;  3GJA A;  2JDM A;  4JHZ A;  5JSO A;  1OUS A;  4OHW A;  1H1M A;  1W8N A;  2RS3 2;  3QH7 A;  3OUJ A;  5GLU A;  2W94 A;  4JGZ A;  4ZZ5 A;  3TRS B;  4HVO A;  2FDH A;  3LEM A;  5KC5 A;  1WW5 A;  4FFG A;  4YW5 A;  3VKO A;  5DAX A;  3SKV A;  2VOK A;  4FOY A;  5CZK A;  1SFP A;  1X8E A;  4XUT A;  1C8M 3;  1CAU B;  3VBU A;  1ND3 C;  4FQZ A;  3DN7 A;  3U78 A;  1IPS A;  3R0R A;  1CD3 G;  3N7M A;  2LS6 A;  2V5Y A;  3VUO A;  2AZ5 A;  1CX4 A;  5BYN A;  1DGL A;  3DEM A;  5HCF A;  4R9B A;  3ZXF A;  5IK4 A;  1J1L A;  3SC7 X;  3VZO A;  1UZV A;  5JAX A;  1GMM A;  5FUI A;  2Q30 A;  4CP2 A;  3K46 A;  4UWD A;  3LD8 A;  1RJ8 A;  1UU4 A;  1GZW B;  1RVF 1;  3OPW A;  5LA2 A;  4F3J A;  3H8R A;  4GH4 B;  4UF0 A;  2BOJ A;  2Y38 A;  5F32 A;  4EYU A;  1NCQ B;  2BDR A;  3ACG A;  2W68 A;  5L7O A;  4K20 A;  4GUL A;  5KXC A;  1UYZ A;  4K7J A;  2CDP A;  4QXH A;  4LXL A;  5FRA A;  1V6M A;  1C8M 1;  4YGE A;  4YSF A;  2CV6 A;  2Y6H A;  5FZ7 A;  5I8S A;  3VHO A;  4Y1Z A;  5G05 L;  2HWD 2;  2ZKL A;  3JXS A;  5FP8 A;  4UW4 A;  3MIC A;  2YPJ A;  2W91 A;  4E9K A;  2PHT A;  5LZ6 A;  1YI7 A;  4AED A;  5F2W A;  1UKG A;  4EJR A;  1PK6 A;  5J7M A;  1RUI 2;  3TAY A;  1WLW A;  4WVM A;  3HBZ A;  4P5H A;  4NIG A;  1VBE 2;  1WW6 A;  1ENR A;  2GAL A;  3WD5 A;  1NQJ A;  3KMH A;  1RUF 3;  2B9V A;  1SLA A;  2RS5 2;  3IDE A;  1XYO A;  4GMP 3;  1NCQ C;  5EWS A;  4FXG B;  3IM0 A;  1IPK A;  3T09 A;  1W6Q B;  4B1M A;  1PMH X;  2SBA A;  2WWU A;  1G9F A;  3OYW B;  1SFN A;  4LLF A;  5E8A A;  4E8D A;  2OYZ A;  3BPS A;  2YV8 A;  4GIQ A;  5D1I A;  4YW7 A;  4KWU A;  1CZT A;  4GAL A;  1HQL A;  2VUJ A;  3DPR A;  4HLT A;  5A7O A;  3U11 A;  5AC9 3;  1HRV 1;  2QQN A;  4AFC A;  4YAR A;  4E2Q A;  3ACH A;  1UF2 C;  2C24 A;  4MH0 E;  3VBR A;  2PA7 A;  3M1H A;  1HV1 A;  3VKF C;  2ZX1 A;  2BVB A;  3WF3 A;  2XJQ A;  1RUF 1;  2IVJ A;  3K48 A;  4YFW A;  1N1Y A;  2ILM A;  4AQ2 A;  2WO7 A;  4XF0 A;  1HB3 A;  1OKQ A;  1JU3 A;  4XQD A;  1RUG 3;  5A1L A;  3FLR A;  1OA4 A;  2BEO A;  4QXK A;  1QJU 2;  1POV 0;  2WNV C;  2P6H A;  4Q0U A;  3RJR A;  4AI0 A;  1JZ3 A;  1WLC A;  3OG2 A;  5BNN B;  2YXS A;  4LA3 A;  4AVV A;  3POB A;  4DZG A;  3GBW A;  2JX9 A;  1AL2 2;  3S57 A;  4CEY A;  4JGZ B;  2RJL A;  1Q8P A;  2XJR A;  4CUB A;  1D2Q A;  1URX A;  4HPK B;  5FZ3 A;  4IL7 A;  2B8M A;  3DXT A;  3T2Q A;  2XVL A;  1XE7 A;  3KF3 A;  3OCP A;  3RI8 A;  5AFE A;  3VBU B;  3AMP A;  3S5Q A;  3N9L A;  1RIN A;  5I0D A;  4NRO A;  1MS9 A;  5D8A A;  1RUG 1;  4QX3 A;  3ZKY A;  3AKR A;  1RUJ 2;  1MPX A;  4GKX A;  4BQ2 A;  4R8H A;  5AVA A;  1SLI A;  3RWN A;  2R0F A;  1CVN A;  1MVE A;  3D6E A;  3SXW A;  4QPG A;  3E6C C;  3ITQ A;  4TZD A;  2RDR A;  2H6B A;  4Q4V 2;  1QOT A;  4HZF A;  2B7Y A;  3DEC A;  2YMZ A;  2AH2 A;  4JGZ C;  1LHO A;  3J4U H;  4UF0 B;  3TN9 1;  5BNO A;  1QEX A;  2DUQ A;  1GQG A;  1UIJ A;  1AR6 2;  2G9G A;  3HQX A;  3H7Y A;  1KIT A;  4LO8 A;  1GIC A;  3E6D A;  1VE0 A;  3MF6 A;  3VBU C;  3ZFF B;  2ZGK A;  2XQR A;  3PMS A;  1DF0 A;  2BJS A;  3MV0 1;  3P3P A;  1LRH A;  1O8P A;  4AED B;  4YM3 A;  3C7G A;  3ON7 A;  1OLM E;  3WDU A;  5CBL A;  5C4W B;  4FPG A;  4WVM B;  1YQ2 A;  4DQA A;  5A33 A;  1KFU L;  1VMF A;  2RR1 1;  4IGO A;  5BNP A;  2DBN A;  4FQ4 A;  3MLJ A;  4JRA A;  2BFU S;  2WWS A;  3HVD A;  4W6X A;  2JB4 A;  4CCD A;  2ZGS A;  5L7O C;  2ARX A;  1W05 A;  1SQ4 A;  4XHB A;  1WMF A;  4FPJ A;  4PDW B;  3FLP A;  2ZHM A;  2C1F A;  4UW6 A;  4L97 A;  3THD A;  1PGS A;  1E57 A;  1WBF A;  1WCQ A;  5KR7 A;  2A6V A;  3WG2 A;  3DPR B;  3MFA A;  4AED C;  5IVE A;  2HWC 2;  2DFC A;  3D4K A;  2O1Q A;  1PK6 C;  1H2N A;  3I97 A;  5FZL A;  3MEP A;  5DAB A;  3RMX A;  3LF7 A;  1CES A;  2FD8 A;  3PUS A;  4V2V A;  5C33 A;  3WUD A;  3K4Z A;  4XC9 A;  3TEW A;  2XON A;  1XYN A;  3CIH A;  1XOY A;  2X8K A;  2DVA A;  3BAL A;  4XMA A;  1DQ0 A;  5LAT A;  3IIA A;  1GFF 2;  1FOD 2;  2B9U A;  2ADE A;  3QD6 A;  1C1L A;  1QNW A;  4JCK A;  5I0U A;  2BYV E;  1O8S A;  3LB9 A;  2XHN A;  2R7E B;  3KGZ A;  2CY6 A;  1AYN 3;  4MXV A;  3LQC A;  5JXJ A;  1UZY A;  2DCY A;  2QDN A;  4J25 A;  3DPR C;  5KXD A;  4KQ7 A;  4CEY B;  2PHX A;  3A21 A;  4LBQ A;  1F35 A;  1KFX L;  3WZ1 A;  4MXW A;  1R08 3;  3VBR C;  4HSJ A;  4I0B A;  1O3T A;  2R07 3;  3VBF A;  2BWA A;  4WVW A;  2VUD A;  2A73 B;  5FTT C;  5I93 A;  3Q8C A;  2RE9 A;  2QE3 A;  4CDW A;  1RIT A;  1SDW A;  3GNE A;  3WT3 A;  3MFC A;  2XUM A;  3H3Z A;  3HAG A;  3EJK A;  4IES A;  5D8A B;  2ZGR A;  5T50 A;  1LKN A;  2VNR A;  5JVV A;  1RUE 2;  4XFG A;  1RUD 3;  1GNH A;  2RDN A;  4KU7 A;  4AVC A;  4H7L A;  5FYC A;  5FLI A;  3WHT A;  4QPG B;  1WMD A;  4BQW A;  3MW4 A;  4MV2 A;  1O5L A;  2X05 A;  4RHV 3;  2BGO A;  5CYY A;  4LIV A;  1AYN 1;  1VBD 1;  5SV5 A;  3HR9 A;  4A41 A;  4N90 A;  4AR2 A;  2EIG A;  5HPO A;  4CEY C;  3IB3 A;  3W9A A;  5BNO B;  5F1R A;  4K8F A;  3ZYP A;  4YGD A;  1R08 1;  4Z2A A;  5IJR A;  2YGL A;  2R07 1;  4M4R A;  3OPT A;  2KXL A;  3KV5 A;  4QMA A;  1BBT 3;  2X29 A;  1COV 2;  3LA3 A;  3NNM A;  5J36 A;  4XFC A;  4QX7 A;  5D8A C;  1UX7 A;  3OD4 A;  5C5T A;  1N1S A;  3O0W A;  4XUO A;  1VB2 A;  5LY2 A;  5F6K A;  1W9Y A;  3R6S A;  2LRO A;  4TSV A;  5GZG A;  4COY A;  4B1L A;  5FPX A;  5IFT A;  3NV2 A;  4RHV 1;  2CU5 A;  3VZL A;  5BNP B;  3FUQ A;  1UMI A;  3PU3 A;  2ZTN A;  5BNO C;  4AEK A;  5J48 A;  3NV1 A;  3LDK A;  3HJR A;  3VZN A;  5JUV A;  1W6N B;  2BGP A;  2JG9 A;  2UUR A;  5F3I A;  3D0J A;  4EN6 B;  2QKD A;  3HN1 A;  1AUY A;  1HN0 A;  4G9S B;  3GHN A;  4O9G A;  1MEC 2;  3H1W A;  4AFM A;  4EV0 A;  2GC2 A;  3PDQ A;  2RJ2 A;  3MW2 A;  1BBT 1;  4Q4X 3;  3S5A A;  3POY A;  4FPF A;  3LFM A;  4EN0 A;  1H6X A;  1ZM1 A;  1YXW A;  1RMU 1;  2JDZ A;  2BTV C;  3AYC A;  4X6Q B;  4OFG A;  1DBN A;  3CBN A;  4QX1 A;  1Z7S 2;  4MZU A;  2K0G A;  3T4V A;  1DLC A;  3RMY A;  1REF A;  4YW6 A;  4COZ A;  2XVK A;  5BNP C;  1W28 A;  1KDM A;  1DHK B;  2DCJ A;  3BOD A;  4PF1 A;  1HRI 3;  3NL1 A;  4K3U A;  2J1E A;  1O5U A;  1SZB A;  3BOW A;  4IEY A;  3WEZ A;  2A7A A;  5D21 A;  5FCC A;  1G6N A;  1YYN A;  5LBF A;  5C3Q A;  2WN3 A;  2GH2 A;  1GZ9 A;  1QF3 A;  4ZPI A;  1SCR A;  1RJ7 A;  4B29 A;  5JOZ A;  3B01 A;  5JSP A;  4LBQ B;  3IDA A;  2R1D A;  4MXW B;  3NVC A;  4FT8 A;  2ARA A;  4HG6 B;  1UZW A;  5A6Q A;  3VBF B;  3ZYR A;  1WD3 A;  4QGL A;  2JE9 A;  4CDW B;  1VAK A;  2G9Z A;  4BU2 A;  2PLV 2;  3POJ A;  1UXZ A;  4A2U A;  3A4U A;  4AAX A;  2VPV A;  1HX6 A;  4KWJ A;  4L11 A;  4AGR A;  1S0E A;  5FZ1 A;  3TOJ A;  5FFO C;  4CE8 A;  4FTE A;  1S0C A;  2VCC A;  4BWO A;  1JYW A;  1MZ5 A;  3FE5 A;  1R09 3;  3EB7 A;  2YHJ A;  2JEM A;  3PHM A;  5GJ6 A;  2WS9 2;  2ZHN A;  4B4Q A;  5BUV A;  1UNB A;  2F4L A;  4IEZ A;  4QB1 A;  4YRD A;  1NY7 2;  1GWK A;  4BIO A;  2VZQ A;  3J26 N;  3RGB A;  3VBF C;  2OII A;  1XU2 A;  4NWW A;  1IS5 A;  2DU0 A;  4CDW C;  3DUI A;  3DYO A;  4M3C A;  1Z0H A;  3J8F 2;  4OYU A;  4YFZ A;  2QQO A;  5FY0 A;  2A75 A;  4FAH A;  4YM1 A;  5ACA 1;  2GMM A;  4JTO A;  5DAW A;  5C71 A;  1SDD B;  2XJV A;  3T1L A;  4BXS V;  4FPL A;  4XDP A;  4P08 A;  3OGJ A;  3RFR A;  4LBQ D;  1YLL A;  1CZV A;  1SLL A;  2D6N A;  5C5U A;  3MHZ A;  1YWK A;  3IZO A;  1PGL 2;  1R09 1;  3OEA A;  4GB3 3;  3BPZ A;  1N1T A;  3KHC A;  5HCA A;  1EV1 3;  4QPI A;  5GM0 A;  5JDB A;  1TG7 A;  1GOH A;  1SAC A;  2E7A A;  1GP5 A;  2W1Q A;  1UOG A;  4I09 A;  4ZXE A;  1DG6 A;  1LES A;  2DV9 A;  1LHV A;  1GP6 A;  1W9S A;  4BQY A;  2EA7 A;  1GP4 A;  5CFC B;  1O3R A;  2RDS A;  3JB4 C;  5ERL A;  2EVX A;  4CDQ A;  1IG0 A;  1OD3 A;  2OW4 A;  4OI2 A;  5F5Q A;  3URF A;  4DIQ A;  2CSG A;  3FBM A;  3ALQ A;  3IAQ A;  3UL2 A;  3HMY A;  4AI2 A;  4XUR A;  2KR2 A;  1N3Q A;  1FMD 3;  2BBA A;  3FHA A;  4QQH A;  2DTY A;  3Q8F A;  3M70 A;  1NOV A;  4GB3 1;  1AVB A;  4YM2 A;  3PJQ A;  2VME A;  4QPY A;  5JCT A;  1PNF A;  4Q0V A;  3NV4 A;  1EV1 1;  1OH4 A;  3E5X A;  3EXU A;  4K1Z A;  3FHI B;  1G86 A;  4LBN A;  2VE1 A;  1FX5 A;  2A71 A;  3WF1 A;  2JG9 C;  3NV3 A;  1HB1 A;  2ZX3 A;  3T0B A;  3M3Q A;  4YW3 A;  2J1A A;  1STM A;  1YJL A;  1ZBE 2;  3JZV A;  3PVE A;  2BP6 A;  3FX3 A;  4QX2 A;  3O1M A;  2RMU 2;  1RIR A;  2XJT A;  3ZMO A;  4BH9 A;  4CPB D;  3VZJ A;  2V72 A;  4QQP A;  1EAH 2;  2JDP A;  3BVC A;  3RWK X;  3VBS B;  3P1I A;  3AXE A;  4XIK A;  1ZZ6 A;  1CAW A;  2WBK A;  1XE8 A;  2BWC A;  2PMW B;  2WZR 3;  2XVG A;  4UFJ A;  3ZFG A;  2YFZ A;  1FMD 1;  2VEC A;  5JLV A;  2ZGU A;  1JZ4 A;  3G6J B;  3LFI A;  3IMN A;  5IT6 A;  3ILF A;  3LDB A;  1TQ5 A;  4JAA A;  2OT7 A;  3D0S A;  1D7P M;  1AHS A;  1ACC A;  4EN7 B;  2D97 A;  4FOV A;  1LHW A;  1XC6 A;  1S0J A;  1TMF 3;  1ZRF A;  5A70 A;  2GNM A;  1W2U A;  3KSC A;  1LOC A;  4BIF A;  3D8C A;  2B46 X;  5DG2 A;  1NXM A;  2HKX A;  4PF5 A;  4CCJ A;  4PI0 A;  5K8S A;  2NM1 A;  2YPD A;  5T55 A;  4UOJ A;  3ZN5 A;  4TTG A;  4NAO A;  1U5X A;  2VVE A;  4XBQ A;  3SCH A;  5IK5 A;  3VDD B;  3I2I A;  2WZR 1;  3AKT A;  4FPO B;  2GNT A;  2IXJ A;  5FY8 A;  1LTE A;  1W39 A;  1W2T A;  3H3L A;  2EIB A;  2JDK A;  3NJY A;  4K9S A;  2A6Y A;  4OHZ A;  1OVS A;  4M3C B;  3H50 A;  5FP4 A;  3H8O A;  1E5S A;  1TMF 1;  4Y4R A;  1W2N A;  1OLQ A;  3LIH A;  4DXR A;  3TWI A;  4LK6 A;  5FY7 A;  5CAZ A;  4O9E A;  5FRE A;  4UT5 A;  4XZU G;  3U4X A;  3WW1 A;  1MZF A;  4CTE A;  3K3O A;  1QU0 A;  2R0H A;  3OJB A;  4Q29 A;  2HBU A;  3LAG A;  1QXJ A;  5JPM B;  2WZ8 A;  3ASI A;  5HI0 A;  4I3G A;  2Q0A A;  3KZ4 C;  2AEN A;  1V6L A;  1RUN A;  3O1O A;  2LW8 A;  4JRL A;  4QPI B;  3PUR A;  1UOB A;  4HN1 A;  3I2D A;  5TSW A;  3AKQ A;  4XF1 A;  1BK1 A;  3FHQ A;  4U2A A;  3SCG A;  4A44 A;  3H9A A;  4M00 A;  3CJX A;  2FCV A;  4AFB A;  3U0Z A;  1XJA A;  1YIP A;  2VC9 A;  3B9C A;  3N3H A;  4LOT A;  1VBC 2;  4CDQ B;  1RHI 3;  2HH9 A;  2JIC A;  3IKW A;  4FFH A;  4COU A;  1W9T A;  4UXA A;  4XET A;  3PL0 A;  3ZYH A;  5FOB B;  2A3X A;  5EJZ B;  4MYE A;  3WVJ A;  4QXB A;  1W03 A;  1W2O A;  2W95 A;  2RS1 1;  4KNC A;  1AYM 3;  1W8F A;  4Q0P A;  4QPI C;  1UO9 A;  2Z79 A;  4YZ1 A;  4OI0 A;  1CN1 A;  3JD7 2;  3W21 A;  1Y7B A;  3MIF A;  2ZAB A;  4LBM A;  3LOB A;  3VBO B;  3SNM A;  5FBJ A;  1UY2 A;  1T6G C;  4TLG A;  1H30 A;  2CWS A;  4XQW A;  4CDQ C;  1RHI 1;  2MEV 2;  1S4C A;  4OUL A;  1MQT B;  4AOC A;  5C9A A;  1CAW B;  3CJI C;  1YI9 A;  4IEW A;  4W65 A;  3MBW A;  3WCS A;  3ZOI A;  4HFS A;  4OQ8 A;  1L7L A;  4NII A;  3KT4 A;  4H7M A;  1PO1 3;  1AYM 1;  4NOT A;  2JE7 A;  2F4P A;  4YGC A;  1LAJ A;  3V65 A;  3OB8 A;  1DZT A;  5A7S A;  5E1R A;  1YRZ A;  4C90 A;  1I5P A;  4WM7 A;  4OCT A;  5GZE A;  1H8T A;  5DDJ 3;  2BZD A;  2OA2 A;  4LA2 A;  2VO5 A;  4HMZ A;  4CYD A;  3HNB M;  5HV0 A;  1IZ3 A;  4MAD A;  4QHZ A;  3TEZ A;  4LBJ A;  3IPV B;  1UOF A;  5FZG A;  3WP3 A;  3VHP A;  4YG3 A;  1W3V A;  4CZS A;  3ZFG C;  4CDX C;  2WT0 A;  5FYH A;  1HB4 A;  2P6C A;  4B4P A;  3KCX A;  3WG3 A;  3WDY A;  4QX5 A;  1RUC 2;  1PO1 1;  2G19 A;  4LO7 A;  2FDF A;  5JXG A;  3R4S A;  2WAB A;  2XQX A;  2XWB B;  4IE0 A;  3WHU A;  1I5Z A;  4DOU A;  2DYC A;  4P9W A;  3A22 A;  3TNP B;  3O1P A;  4YWA A;  1BXH A;  3FFQ A;  3CZU A;  2Y64 A;  1CAU A;  1XNC A;  1BHG A;  1L3J A;  1F5J A;  3JB8 A;  5DDJ 1;  1PIV 3;  4CU9 A;  4CU8 A;  4Q4W 2;  3AYE A;  4OI4 A;  2WRA A;  2GN7 A;  3K75 B;  4F8A A;  2BV4 A;  5EYY A;  5FYY A;  2IXH A;  1AJK A;  1W9W A;  2WLP A;  1DYK A;  3I3D A;  4FPK A;  2VOT A;  1JOJ A;  1QJE A;  3B94 A;  3O5S A;  2QQL A;  3LZZ A;  1AR8 2;  5CIR A;  2JDA A;  5T5O A;  3MIB A;  4CDU A;  5DZE A;  1G7Y A;  3FJS A;  3K2O A;  3NO8 A;  5J1X A;  3WW3 A;  4GH4 A;  2GP3 A;  2IXL A;  2IZW A;  3E1F 1;  3IT8 A;  4QQL A;  2ORX A;  3RYK A;  3ZFE B;  4A3Z A;  1OPM A;  2JDN A;  5LA1 A;  5J98 B;  3PVB B;  4NR1 A;  1XND A;  3C3V A;  1PHM A;  2ZGT A;  3AP4 A;  4FXK B;  1CJP A;  4LE4 A;  1F4H A;  4HN0 A;  1PIV 1;  4OZO A;  4DPN A;  1POV 3;  2AEY A;  3CKH A;  4LKD A;  4D7T A;  4L2N A;  4UAP A;  4EN8 B;  4DUW A;  2AC1 A;  3AXD A;  1SEF A;  4MGQ A;  4CCO A;  1JH5 A;  2VU9 A;  4UBH A;  1PO2 3;  3I2G A;  2EAL A;  3MI8 A;  4R9C A;  4GAZ A;  2Y34 A;  5FWJ A;  4Q0S A;  2XBO 3;  3BUC A;  4B3N A;  1V9U 3;  4JKL A;  4XIL A;  4KH9 A;  5LEK A;  4FTS A;  3BTX A;  2FZ2 A;  1RVF 2;  5A3L A;  3ORJ A;  1H1A A;  5LA0 A;  1NZC A;  3O1R A;  4AK3 A;  1ASJ 1;  3HNY M;  5FR3 A;  4KU8 A;  3H7J A;  4NIH A;  2VL4 A;  2ORZ A;  4LR4 A;  1KEX A;  1POV 1;  5JSR A;  1JUI A;  5BXX A;  5C9A B;  2Y6L A;  2W47 A;  1C8M 2;  3ZR6 A;  1AX0 A;  2DUR A;  4K40 A;  1HLC A;  3OY8 B;  3USU A;  1OF3 A;  1DGR A;  5L73 A;  2V5D A;  5HCH A;  1YNA A;  1QMJ A;  2OUH A;  3O1T A;  3I49 A;  1PO2 1;  2VNG A;  4QKD A;  4PJY A;  4LQR A;  5DUW A;  2XBO 1;  2PAK A;  1IG3 A;  2YG0 A;  4WM7 B;  5BPX A;  1H8T B;  1V9U 1;  5BV6 A;  3MUZ 1;  4CCE A;  4DRR A;  3DGT A;  5DAP A;  5JXI A;  2EF6 A;  3VHN A;  3OF1 A;  2JXA A;  4QPW A;  3WX5 A;  1WCK A;  1EY2 A;  4CXW A;  3ACI A;  1NUK A;  1ULC A;  1W06 A;  2WN2 A;  5BNN A;  5EIY B;  1QQP 1;  1QJY 3;  1UAI A;  2XKO A;  1BMV 1;  3LEG A;  4AF9 A;  3I7D A;  1ZRC A;  3VV1 A;  4HPK A;  4S2F A;  1UWW A;  3K4A A;  3T0D A;  1HRV 2;  2OZJ A;  1CAV A;  1NE6 A;  4OLL A;  3S7I A;  2HEV F;  3AK0 A;  4WM7 C;  4O65 A;  1H8T C;  1HXS 3;  5IAT A;  3IN9 A;  1RUF 2;  2VZU A;  3CDZ B;  5FYS A;  3RPQ A;  4HSL A;  4AG4 A;  1NYW A;  2R04 3;  3GBF A;  5GLW A;  3GCX A;  3MZH A;  1JHN A;  1DP0 A;  4CDU B;  2V09 A;  5FQ0 A;  3A0K A;  1QJY 1;  3U75 A;  3VD3 A;  3BGA A;  4AI8 A;  1ULP A;  2DCK A;  2Z2S B;  2VCM A;  2ZGP A;  3HWJ A;  4W6Y A;  5FZ4 A;  1NLR A;  4A45 A;  2OX0 A;  1GAN A;  2XJP A;  4P9I A;  2XPJ A;  2AYH A;  2LTN A;  2G1M A;  5JIU A;  3OGG A;  2W39 A;  2BER A;  5FWE A;  4AZZ A;  3ZFF A;  1SLB A;  3BB6 A;  4WZC A;  1HXS 1;  2NQY A;  1MS4 A;  2WL1 A;  3POG A;  4Y4Y A;  2IWG B;  3GM8 A;  2FDG A;  1WCS A;  1ULG A;  1VBB 3;  4FFF A;  3PIG A;  4I0W B;  4IE6 A;  4OVE A;  4Q1P A;  2VW1 A;  1NQD A;  2D6P A;  1CZS A;  2R04 1;  3BCW A;  3WQ7 A;  4JDO A;  4DXS A;  5F5C A;  1RUG 2;  5C4W A;  4QQ2 A;  4CDU C;  1Q8S A;  4NRP A;  4C0B A;  5JMC A;  3MIE A;  3AP7 A;  4QKF A;  3KV6 A;  1OLM A;  1KS4 A;  1W6M A;  2VOX A;  3J7H A;  1JHJ A;  4GH4 C;  3SQO A;  2YYO A;  2ARC A;  2RG4 A;  2W08 A;  2QQW A;  4B7K A;  5FYV A;  3V64 A;  5FZM A;  4JV4 A;  3TN9 2;  2RS3 3;  3NWK A;  4JC1 A;  2TBV A;  2V73 A;  2KA3 A;  2VUL A;  2YBS A;  4PDW A;  4S2H A;  2QCS B;  5B4N A;  4JDN A;  1PNG A;  1XRU A;  5F3C A;  4Y22 B;  3WP5 A;  3MUY 1;  3HBK A;  4GZ9 A;  1OLR A;  1H9W A;  1KDK A;  2B45 X;  3H8U A;  3NAP A;  3UKT A;  3USU B;  2Y60 A;  4AFA A;  5FPU A;  4XUQ A;  3K3N A;  4RA0 A;  1ZRR A;  4J1W A;  5EJ3 A;  1IKP A;  3KD4 A;  2ZS6 B;  2ZA9 A;  1MS0 A;  3WDX A;  3ETQ A;  1I9R A;  4P14 A;  4LHK A;  4DY5 A;  4Y1X A;  1DQ6 A;  3PUH A;  4GMP 1;  3PLQ A;  1WMX A;  4UFH A;  2RR1 2;  1D0H A;  1JZ8 A;  1R1A 3;  3WIN E;  4S2G A;  5JOW A;  1WW4 A;  3LPG A;  2RDQ A;  1GQP A;  4YZ3 A;  3POS A;  1J3Q A;  3Q9O A;  3EO6 A;  4YGB A;  5IK7 A;  2YU1 A;  1OSG A;  1PGW 1;  3DKQ A;  5AC9 1;  4XJ9 A;  4XCB A;  2I2S A;  2VY0 A;  3QH6 A;  4KWK A;  2HWD 3;  2D5F A;  3C2U A;  4D3W A;  4D94 A;  1CAV B;  1DZR A;  3AVR A;  3WR0 A;  3WNO A;  3RZM A;  1EYB A;  2WAA A;  4TN7 A;  5IK8 A;  5FY5 A;  3RZZ A;  5CG9 A;  3ZO0 B;  1R1A 1;  2VTF A;  4AGG A;  3LA2 A;  4ZXK A;  1ZRD A;  1VPH A;  4QM8 A;  4XMI A;  4B4R A;  4KG0 A;  4CEW B;  1FV2 A;  1C4R A;  3M3C A;  4MGS A;  5FQ0 B;  2ET7 A;  1VJ2 A;  4OUS A;  5BNN C;  2BPA 2;  1UY1 A;  1FYU A;  1GUI A;  4QKB A;  3I59 A;  5E89 A;  2W1U A;  3OPZ A;  4E4D X;  5ANQ A;  5F9T A;  1OUR A;  4OZX A;  3A7Q A;  3RJ2 X;  4NRQ A;  4QQO A;  1GZC A;  2J22 A;  3USS A;  1YQ5 A;  3WXP A;  5FKC A;  3MW3 A;  2NN8 A;  1DZQ A;  1QOO A;  4XJU A;  1HQN A;  2SLI A;  3ZXD A;  1ZVF A;  3NNJ A;  1X50 A;  3QBQ A;  4RN5 A;  2O14 A;  4Y1V A;  4HKO A;  4LO5 B;  4JX0 A;  1X7N A;  1SFY A;  1XQN A;  1Q56 A;  4AQT A;  2ARB A;  4EWD A;  1W6M B;  2IVI B;  4B7E A;  1QJZ A;  5CIS A;  1S1A A;  2VJX A;  4QDR A;  1VBD 2;  1AYN 2;  1YHF A;  1W6N A;  5CVR A;  4FPE A;  4Q0Q A;  3LKJ A;  4YW1 A;  3BU7 A;  2VM9 A;  1ONA A;  2VZ1 A;  1R08 2;  1POQ A;  2ZX0 A;  4OUM A;  3ZFF C;  5A3U A;  1D4M 3;  2R07 2;  2BU9 A;  3KT7 A;  3LSE A;  3WV6 A;  5IAX A;  4FPH A;  3VKN A;  4Q26 A;  5LK7 B;  5LBC A;  2XKP A;  1LOF A;  3NAP B;  4YVW B;  4A7Z A;  5FK8 A;  5M0T A;  4NRM A;  2ZEW A;  2VD7 A;  5C4W C;  1H8V A;  2QQK A;  2VQA A;  2VQT A;  1PX4 A;  3IAP A;  4ASM B;  4Q1R A;  2TEP A;  3VBH A;  1OUX A;  2ADD A;  3OUH A;  2VMC A;  2UYA A;  1VR3 A;  4RHV 2;  2IXI A;  2EAK A;  3D3A A;  2JD4 A;  3FLT A;  3O0V A;  4XDO A;  2GU9 A;  3ZM8 A;  4MHU A;  4I01 A;  1DQ2 A;  2WNU A;  2D43 A;  2VH9 A;  1O3S A;  4NE9 A;  1J3P A;  4PDW C;  5IVJ A;  1D4M 1;  4Q2F A;  1NCR B;  5FLH A;  1KJL A;  1BBT 2;  1JYT A;  1EPW A;  1VLN A;  1UYY A;  2UY8 A;  2R30 A;  3NAP C;  3THC A;  2XOM A;  3ZYI B;  1RMU 2;  5FMC A;  4PT6 A;  4BZ4 A;  4YW2 A;  2H6C A;  3N9O A;  3SHR A;  2VW0 A;  1UPI A;  4RSU A;  2VBD A;  4XW3 A;  4ARY A;  4URA A;  2WWJ A;  2CWM A;  3SH4 A;  1PVC 3;  1YC6 1;  3AX4 A;  3AMM A;  4M01 A;  4IW3 A;  1ALY A;  4AHZ A;  4BK4 A;  4D6Q A;  1J59 A;  1WBL A;  3J7N A;  3J7L A;  1DCS A;  3AP5 A;  4HXC A;  1L7Q A;  2EXJ A;  3CLP A;  1PZ7 A;  4I3P A;  4P9G A;  4QU2 A;  4Q8K A;  1YFY A;  4D8M A;  3DKW A;  2BVV A;  3I59 B;  5A1F A;  2CGP A;  2D6K A;  2P1B A;  3KQ4 B;  4LPL A;  4ZS3 A;  5FAX A;  1ENQ A;  3TEY A;  1X9T A;  3MPB A;  5FPA A;  1CON A;  1TNF A;  1ZZ8 A;  2PHL A;  3TBD A;  1IGO A;  3SEP A;  4AHX A;  1I1E A;  2C4X A;  1BQP A;  4RGG A;  5E6H A;  4IV1 A;  1DGW X;  1CIW A;  3J9S A;  5FZK A;  3P6B A;  4XVH A;  2HWC 3;  3KCC A;  3LPF A;  4PIX A;  4BJ0 A;  1PVC 1;  3HEI A;  4V2W A;  1MS3 A;  1MZ6 A;  4P02 B;  4QX8 A;  3WF0 A;  3RZL A;  2Q1Z B;  5FY4 A;  3RQ0 A;  4AEJ A;  1RUD 1;  1A8M A;  2A5Z A;  1WCU A;  2RHP A;  3BYW A;  5LW9 A;  4CPB A;  3A23 A;  5FXV A;  4QPG C;  2R1B A;  3DYP A;  1RXG A;  4N9I A;  4CU6 A;  4RYD A;  1ULE A;  3E5Q A;  5J3U A;  2P3J A;  2BNN A;  2BNM A;  4UFL A;  3B7M A;  4ISR A;  3WQ0 A;  4CUC A;  2ZX4 A;  3AMH A;  1SBD A;  5CKQ A;  1XNB A;  1S2K A;  2VR4 A;  4JGY A;  2GN3 A;  4ORF A;  1W6P A;  1IS3 A;  3BKZ A;  5K4L A;  2P34 A;  3H1Y A;  4CCN A;  3GZA A;  4XF9 A;  4E2G A;  1K3I A;  5CEH A;  3ZR5 A;  4AEM A;  5CFC A;  2GMP A;  2ID4 A;  4ATE A;  3TB0 A;  2NYY A;  1M06 G;  1KXG A;  5C3P A;  3ZPO A;  1G9B A;  2QJV A;  4JKK A;  1OVP A;  1US2 A;  4FO9 A;  4RQP A;  5FPB A;  1ENX A;  3ZN4 A;  5ACA 2;  5I8Y A;  5H9R A;  5J96 B;  5JWP A;  3VBH B;  3CL1 A;  4LHN A;  3ZDS A;  1AJO A;  1R09 2;  3PME A;  3RZH A;  2XL7 A;  1FXZ A;  3OSD A;  5I91 A;  4PI2 A;  4XAB A;  1W8W A;  1VBA 3;  5GKA C;  2WNU B;  2YBP A;  4Z92 B;  4O7X A;  1OD5 A;  2ZGQ A;  1ZBA 3;  3I2J A;  4Q4X 1;  4FVV A;  4E8C A;  1H2K A;  2VG9 A;  3GDB A;  5DN2 A;  2QZ3 A;  1XPW A;  4LKE A;  1G8W A;  4URT A;  5FO7 B;  5KXB A;  3VBS A;  3PUQ A;  1WLD A;  3CMG A;  2YZ4 A;  3O14 A;  1EP0 A;  2P2K A;  1LOF C;  2XWJ B;  3AVS A;  1LEM A;  1NXD 1;  1XU1 A;  3PUA A;  2XHK A;  1NAE A;  2JB8 A;  3SH3 A;  3OBT A;  3PTY A;  5FBZ A;  3VBH C;  4R9D A;  3H0O A;  1QNY A;  4IND A;  2VZT A;  1HRI 1;  2ZGM A;  4GB3 2;  4XFH A;  4UYB A;  1HJF A;  2ZZQ A;  5K7P A;  1EV1 2;  4XCA A;  1VBA 1;  2WNU C;  3T2T A;  3KVB A;  1ZBA 1;  4DMI A;  1O91 A;  2E9Q A;  2OUJ A;  3KWV A;  3WQB A;  4UFM A;  2PHU A;  2YB7 A;  3O0X A;  4BQ3 A;  2RV9 A;  2NP0 A;  1JOB A;  2ZAC A;  1MEC 3;  2OPK A;  2EIE A;  3VDD A;  5CG8 A;  2VW2 A;  3ACL A;  4XJW A;  3X29 B;  2L9L A;  2WNO A;  3TEX A;  1RUH 3;  4BXF A;  2VXR A;  4IV1 B;  4QAW A;  2FCT A;  3JU9 A;  3VZK A;  1FMD 2;  4DS0 A;  1F8V A;  5A6Y A;  2B39 A;  3WDW A;  1AX2 A;  1ZNP A;  1PZ9 A;  2YC4 A;  4IEO A;  5BNQ A;  1Z7S 3;  1E5R A;  4DIN B;  5IFP A;  2PFW A;  3N9M A;  2TNF A;  1LJ7 A;  2EIC A;  3GF6 A;  4BCU A;  4UW3 A;  2XJS A;  2FDJ A;  1OBN A;  1JYX A;  2XH6 A;  4PQQ A;  4YNI A;  2PQS A;  1CWP A;  4DXZ A;  1XNK A;  1NLQ A;  3WOG A;  3QOP A;  2Y0I A;  4XJA A;  5FYM A;  1CQ9 A;  4WVV A;  2D3S A;  2FQP A;  1LU1 A;  2PHR A;  3C7H A;  4LUK A;  1JYC A;  1U5Y A;  4M3C F;  4QB6 A;  4JGY B;  1GNZ A;  3OTF A;  3U37 A;  1RUH 1;  5A6X A;  4AI3 A;  2WZR 2;  1W6P B;  4IV1 C;  4QHB A;  4UW5 A;  2ZAA A;  5C70 A;  4RGK A;  2D6M A;  4WVZ A;  1FV3 A;  2Y6G A;  2WZE A;  1PZ8 A;  4IQP A;  1XSQ A;  4AYU A;  4CP9 B;  3BTA A;  3VKM A;  3ME2 A;  1TMF 2;  4RQP B;  4PLN A;  4DO0 A;  1YO8 A;  3KT1 A;  1IS6 A;  1FPN 3;  2PLV 3;  3I2O A;  3VDA A;  3P5B A;  4XOG A;  5EP9 A;  2WSV A;  5JR7 B;  5EQU A;  5FUN A;  2D7F A;  2YGM A;  4BA6 A;  1OKO A;  4NVP A;  5EXO A;  2AGS A;  2JEN A;  5FP3 A;  1ZYB A;  2PEL A;  4JGY C;  4LBK A;  2E33 A;  1U5I A;  4D69 A;  3MF9 A;  2CDO A;  4M4P A;  3VBO A;  4EWE A;  1YJK A;  4MO3 M;  4IE5 A;  1Y43 B;  4NJ4 A;  4KG8 A;  1O59 A;  1B09 A;  4CP1 A;  5FJH A;  5CFC C;  5DUV A;  3ZXJ A;  3UV9 A;  2GC1 A;  5CB7 A;  3PTR B;  3NMB A;  4AVS A;  3BI3 A;  1VRB A;  1MQT A;  1MAC A;  4F7Z A;  2IUW A;  3JUU A;  3NNG A;  4RQP C;  4JVA A;  1LHU A;  2WT2 A;  1FPN 1;  3LIG A;  3WNP A;  3DYM A;  1U0A A;  1ZA7 A;  2HWE 3;  3K77 A;  1A6C A;  5KHK A;  3IDB B;  2VMI A;  2WLQ A;  3RI9 A;  2FMD A;  2DVD A;  1V6I A;  2RS1 2;  2ZEX A;  3HQR A;  1VMJ A;  1WUV A;  3GBG A;  4NHK A;  4P9L A;  4A4A A;  1W8U A;  1V6N A;  3AZX A;  3RZG A;  1XBF A;  4N7I A;  3CHX A;  1CGP A;  4GKY A;  1A34 A;  5LEJ A;  3IPV A;  3VDB A;  4XFA A;  1JZ6 A;  3LEI A;  3VBS C;  3SH5 A;  3N7L A;  1SLT A;  2UWA A;  2V4A A;  1F31 A;  2VNO A;  5FZ6 A;  3HIF A;  2PYT A;  5FXW A;  1RHI 2;  4Z1V A;  2HWB 3;  1LR5 A;  5FYZ A;  5B4X A;  2HWE 1;  5JOX A;  3FMG A;  1TME 3;  3AB0 A;  3W5N A;  4XZP A;  1DIW A;  1LGB A;  4ZKT B;  5F5A A;  2JE8 A;  1AYM 2;  1IQD C;  3O12 A;  1UOJ A;  3ZSJ A;  4ARX A;  4IEV A;  1HQW A;  3KQR A;  1CJD A;  3N9N A;  3C7E A;  1SMV A;  3AM2 A;  3POI A;  4W50 A;  4QHO A;  3GAL A;  1DQ1 A;  5JIA A;  3NJV A;  2JIG A;  4NID A;  1PVX A;  2Q4S A;  1YEW A;  3MGU A;  4GJY A;  4AXO A;  2XJU A;  3T3Y A;  4KBZ A;  5L9R A;  4NAM A;  5FZD A;  5FZB A;  5FK7 A;  3T08 A;  3VDD C;  4ASK A;  3NKT A;  1O6U A;  1ENS A;  3CZJ A;  2WSU A;  2HWB 1;  1M4W A;  5FZA A;  1CAX A;  1O4Y A;  3T30 A;  3ZN6 A;  4DNY A;  1VP6 A;  2WFP A;  5GAL A;  1TME 1;  3ZFE A;  1VB4 A;  5F6L B;  2W3J A;  1YQ8 A;  2YRO A;  2R49 A;  1PO1 2;  5D2A A;  3UNP A;  3WDT A;  4LO4 B;  1W8O A;  1Y9M A;  5LK5 A;  5ISL A;  2DCT A;  3JQW A;  1QHD A;  3G7D A;  1UX6 A;  1BYH A;  1LOB A;  2QQI A;  3R4U A;  4XAE A;  1XNA A;  5T5J A;  3VZM A;  5DDJ 2;  2H0B A;  5F37 A;  5BY5 A;  1RXF A;  1HV0 A;  3BOP A;  1C8N A;  1T2X A;  4D6R A;  5F2S A;  4LOR A;  2P3I A;  4CXX A;  4RL7 A;  1FT9 A;  2E63 A;  1HN1 A;  2W92 A;  5IVB A;  1Y4W A;  3HQU A;  2BRT A;  4LIU A;  5JZG B;  1EUT A;  3ZYG A;  4JTN A;  4ISQ A;  4FI9 A;  5LRS A;  4BQ1 A;  3W5M A;  4PCR A;  1UU6 A;  2JIJ A;  3C7O A;  5IVV A;  3H42 B;  5GZF A;  3SKJ E;  5H9Q A;  4BIS A;  1BK0 A;  4YZ2 A;  1PIV 2;  3OY8 A;  2B4K A;  4R52 A;  4D6S A;  4PIY A;  3TYJ A;  3AFK A;  4ERO A;  2G4I A;  4NHX A;  2VBP A;  1H9P A;  2JD9 A;  2P3K A;  1KJR A;  2HWF 3;  3B00 A;  5T5L A;  5FXX A;  2F17 A;  3RVH A;  2YUE A;  4QXC A;  1MZE A;  4NMI A;  2GAU A;  5FY1 A;  5FXZ A;  3VBO C;  4QU1 A;  5A3W A;  2HBT A;  3K4D A;  3UKV A;  3UT0 A;  1LOA A;  2NMO A;  3IDC B;  4GWN A;  1RL3 A;  2C9K A;  3GXU A;  4W6W A;  5A6Z A;  1ASJ 2;  2OXB A;  1ODN A;  1MQT C;  2BFU L;  4LTA A;  4Z2W A;  4KGG A;  5IW0 A;  1S0I A;  2XL9 A;  4C0H A;  1BZW A;  4MVT A;  1PM4 A;  1IPJ A;  3JBG 3;  5A80 A;  3IWZ A;  1N3O A;  3MIG A;  4AE2 A;  5EFU A;  1ZZ7 A;  5KHI A;  3ZVX A;  2IXC A;  5F8P A;  3NW4 A;  2HWF 1;  1ND3 A;  3OUI A;  4X8N A;  2VMD A;  3N35 A;  4AWD A;  2VTX J;  2HLE A;  1UMZ A;  1PO2 2;  4LNV A;  1RTV A;  2ZMN A;  5HCB A;  2DDU A;  4I2O A;  2XBO 2;  4IET A;  3UES A;  4AI1 A;  4AW7 A;  1V9U 2;  1O3Q A;  1Y3T A;  5JR2 A;  1BVV A;  3JD7 3;  1D2S A;  3H8X A;  2QTW B;  2A6W A;  2HYX A;  3CQO A;  4RR3 A;  4XFB A;  5E88 A;  1BEV 3;  1S0D A;  4E2S A;  2RVA A;  4CXY A;  2R06 3;  1D0G A;  2EXK A;  3LDR A;  1CAX B;  4CCL A;  3JBG 1;  1QQP 2;  2Q8D A;  5A3P A;  3ZN6 B;  4ES8 A;  4KI5 M;  1RGS A;  2D3P A;  4WV8 A;  1BMV 2;  4NN0 A;  5IYY A;  1QXR A;  3AZZ A;  3Q8E A;  5IVC A;  1VRH 3;  4D0Q A;  4BME A;  2TUN A;  5F5I A;  2OQ6 A;  1XNT A;  3ZX7 A;  3HNM A;  2VZP A;  3N9P A;  4Y1U A;  2QQU A;  2YC0 A;  4AHW A;  4AAP A;  4JQT A;  3ZYF A;  1QJX 3;  2K46 A;  2QVS B;  2VZ3 A;  4CU7 A;  4JQR A;  1V0A A;  4OHY A;  2GDF A;  1YFX A;  2ZGL A;  4YLZ A;  4AQ6 A;  2UWB A;  4XBL A;  1UY0 A;  2PN5 A;  3EMR A;  4ET7 A;  3ZMN A;  1WLT A;  1BEV 1;  3KV9 A;  3AL6 A;  1AZD A;  4XUP A;  2R06 1;  2C26 A;  3RS6 A;  2Y0O A;  1NE4 A;  2D6O X;  1QJY 2;  5CKN A;  1UZ0 A;  3CU7 A;  3ZFE C;  1RC6 A;  2Q8O A;  3HT2 A;  3UKN A;  3ZSK A;  2DVB A;  1VRH 1;  2VVD A;  4G3Y C;  5K9Y A;  4MGY E;  5FO8 B;  2AEZ A;  4IGP A;  3BN6 A;  1SBE A;  3OBZ A;  2A6Z A;  3AZW A;  1QJX 1;  4Y22 A;  2CGO A;  3VD4 A;  1HXS 2;  2ZJC A;  1W0P A;  4LKS A;  1NX9 A;  4R4X A;  4OUE A;  4MLO A;  1W8T A;  1XYP A;  2ZMK A;  2CL2 A;  1JTZ X;  1SBF A;  3GGL A;  4BLJ A;  5I8T A;  1SG3 A;  1TEI A;  2WFF 3;  2Y6K A;  1SLC A;  1YIF A;  2R04 2;  1QKQ A;  4A42 A;  3A0N A;  4Q8L A;  4ZU4 A;  5JI9 A;  5A7Q A;  1ZZB A;  3B9I A;  4IE7 A;  4MHR A;  1V6O A;  3ZLI A;  2ZHK A;  3SIS A;  4ASL A;  5FLJ A;  1OMI A;  4E4H A;  4FTB A;  3TNQ A;  3KB5 A;  3GCW A;  4W8J A;  3WY6 A;  4C8D A;  1W0O A;  3ZDV A;  2RM2 3;  4NHL A;  2K2S A;  4BQ5 A;  1AR9 3;  5B2G B;  4XHX A;  5C9A C;  4LBL A;  4YVS A;  1HB2 A;  4Q4Y 3;  2JEC A;  2QQP A;  3JQX A;  2DF7 A;  2P5B A;  3AMQ A;  4K21 A;  2WFF 1;  1AR7 3;  3K51 A;  5FZ8 A;  4A7Y A; 
#chains in the Genus database with same CATH homology
 2WO1 A;  1UXZ A;  2VM9 A;  2VZ1 A;  4AAX A;  3PUI A;  1JZ2 A;  4OMD A;  5JMO A;  4JKM A;  4ZZ8 A;  1JI6 A;  2VCC A;  1JYW A;  3EB7 A;  4L0P A;  2E26 A;  1W0N A;  2ZEW A;  2QQK A;  2VQT A;  1PX4 A;  3IAP A;  4QB1 A;  2VZQ A;  2VMC A;  2V4V A;  3D3A A;  3DYO A;  1UY4 A;  4OYU A;  1JZ7 A;  3ZM8 A;  2EID A;  2QQO A;  2ZXQ A;  4P00 B;  5C71 A;  1J84 A;  1SDD B;  4BXS V;  1JYV A;  3ABZ A;  4P08 A;  2W5F A;  1CZV A;  4QX0 A;  2YC2 A;  3T0A A;  2VZR A;  1UYY A;  3OEA A;  3THC A;  2XOM A;  1EUU A;  2KD7 A;  3NQH A;  4PT6 A;  4CVU A;  1TG7 A;  2X09 A;  3WF2 A;  1GOH A;  2W1Q A;  3I3B A;  4ARY A;  2QQJ A;  3OEB A;  4ZXE A;  4QDQ A;  1W9S A;  4BK4 A;  3C8X A;  1OD3 A;  1L7Q A;  2W46 A;  3IAQ A;  4XUR A;  1J83 A;  4D8M A;  2BBA A;  3FHA A;  4LPL A;  2VME A;  1OH4 A;  5F7U A;  3SEP A;  3WF1 A;  3T0B A;  4OMC A;  2C4X A;  2Y8K A;  2J1A A;  3P6B A;  3WNK A;  4XVH A;  3LPF A;  4BJ0 A;  4QX2 A;  3HEI A;  3MO4 A;  4P02 B;  3WF0 A;  2ZEZ A;  5HXM A;  2V72 A;  4GWI A;  2W1W A;  2VZS A;  3P1I A;  3ETP A;  3A23 A;  1GNY A;  2WBK A;  3FN9 A;  3DYP A;  4W4Z A;  4CU6 A;  4RYD A;  2YFZ A;  1JZ4 A;  4CUC A;  4CUA A;  3FL7 A;  1D7P M;  3C7F A;  4UI9 L;  2VR4 A;  1XC6 A;  4DUX A;  3VDC A;  2QQM A;  1GU3 A;  1K3I A;  1GOG A;  3III A;  5JXH A;  2ID4 A;  2W1S A;  2WQ8 A;  4UOJ A;  4TTG A;  1OT5 A;  4JKK A;  1US2 A;  2WO2 A;  4TXW A;  2WYS A;  3I2I A;  2J1T A;  2WDB A;  2EIB A;  3F2Z A;  2WAO A;  3I2F A;  4DXR A;  3UET A;  3I2J A;  1WKY A;  4E8C A;  5DN2 A;  3GDB A;  4XZU G;  1XPW A;  3CMG A;  2WZ8 A;  4QDS A;  2J1S A;  1NAE A;  2LW8 A;  3HOB A;  3I2K A;  2J1R A;  3FHQ A;  1OF4 A;  2VZT A;  4A44 A;  3OGV A;  2Z4F A;  5IHR A;  1UMH A;  3NRU A;  2VC9 A;  3EYP A;  2VZV A;  4MOA A;  1SHW B;  3OGS A;  3WQB A;  3WNM A;  1W9T A;  4JHZ A;  1UXX X;  2YB7 A;  5EJZ B;  2YFU A;  3HPN A;  1W8N A;  2RV9 A;  2W95 A;  2W94 A;  4ZZ5 A;  2EIE A;  1K45 A;  3NJX A;  2J1V A;  2JKX A;  2L9L A;  3SKV A;  4QAW A;  5CZK A;  4XUT A;  1UY3 A;  4DXT A;  2YC4 A;  1UY2 A;  5IFP A;  4YPJ A;  1P8J A;  2LS6 A;  3MV1 1;  2EIC A;  4A6O A;  1CX1 A;  1PX3 A;  1GMM A;  5FUI A;  4P5Y A;  3MBW A;  3K46 A;  1JYX A;  4PQQ A;  2PQS A;  5LA2 A;  1DYO A;  3C7H A;  3OB8 A;  1K42 A;  4QB6 A;  3ACG A;  3U37 A;  1I5P A;  1UYZ A;  2CDP A;  1US3 A;  2OKX A;  2BZD A;  5C70 A;  2Y6H A;  2Y6G A;  2VO5 A;  5G05 L;  2WZE A;  1UYX A;  3JXS A;  3HNB M;  4MAD A;  5DQ0 A;  2W91 A;  2X10 A;  3VDA A;  2B9V A;  5JXG A;  2WAB A;  2XQX A;  1R64 A;  3A22 A;  2E33 A;  3LEK A;  3CZU A;  2Y64 A;  2CDO A;  4M4P A;  1BHG A;  3T09 A;  3VD7 A;  4MO3 M;  2J7M A;  4CU9 A;  4CU8 A;  1PMH X;  4ZY9 A;  1O59 A;  3K75 B;  4E8D A;  2WUH A;  3I3D A;  1W9W A;  1W99 A;  2VOT A;  4KWU A;  1CZT A;  3NNG A;  2QQL A;  4LHS A;  2QQN A;  2JDA A;  4BDV B;  3WNP A;  3ACH A;  1JZ5 A;  3I3E A;  3DYM A;  5J1X A;  3WNL A;  3K77 A;  3WF4 A;  3VD5 A;  3WF3 A;  3E1F 1;  4A3Z A;  2ORX A;  2ZEX A;  5LA1 A;  4A4A A;  1JU3 A;  4OZO A;  1F4H A;  4BK5 A;  3OGR A;  5A1A A;  3I2H A;  3CKH A;  1JZ3 A;  4UAP A;  1LNS A;  3LE0 A;  3OG2 A;  3VDB A;  1JZ6 A;  4DUW A;  3LEI A;  3ACF A;  4MGQ A;  2VQU A;  3WNN A;  4CUB A;  3I2G A;  5B4X A;  4DEV A;  4GWJ A;  3T2Q A;  3W5N A;  4JKL A;  5EJ1 B;  2JE8 A;  5LA0 A;  1IQD C;  4ARX A;  5I0D A;  3HNY M;  4XUN A;  3C7E A;  2VL4 A;  2ORZ A;  4QX3 A;  4W50 A;  1KEX A;  1MPX A;  3OBA A;  3NJV A;  3HN3 A;  2Y6L A;  2W47 A;  5LCW L;  1OF3 A;  2V5D A;  3DEC A;  3VD9 A;  3T08 A;  3CZJ A;  1KGY A;  4LQR A;  2YG0 A;  2W3J A;  3MUZ 1;  5JXI A;  3UNP A;  1W8O A;  4QB2 A;  2VZO A;  4QPW A;  3MV0 1;  2QQI A;  1O8P A;  1NUK A;  1XNA A;  3ACI A;  4KMQ A;  3T2P A;  2WN2 A;  3C7G A;  5EIY B;  1JYN A;  2WO3 A;  1YQ2 A;  3LEG A;  1T2X A;  1UWW A;  3K4A A;  1PMJ X;  3T0D A;  1HN1 A;  1CIY A;  2W92 A;  1EUT A;  2VZU A;  3CDZ B;  4FI9 A;  3THD A;  3WSO A;  4AG4 A;  3W5M A;  1WCQ A;  3C7O A;  1F4A A;  3SKJ E;  1DP0 A;  1RYY A;  2B4K A;  3I97 A;  2J1U A;  3VD3 A;  3BGA A;  1ULP A;  2DCK A;  4A45 A;  2JD9 A;  3K4Z A;  2W87 A;  1H6Y A;  1K12 A;  1TVG A;  2XON A;  3CIH A;  2BER A;  3K4D A;  3GM8 A;  1O8S A;  2C9K A;  2XHN A;  3GXU A;  2R7E B;  1CZS A;  4DXS A;  3LQC A;  5JXJ A;  3A21 A;  3J7H A;  1JHJ A;  5C7G A;  2VMD A;  2HLE A;  5B4N A;  2DDU A;  3UES A;  3AC0 A;  3MUY 1;  4GZ9 A;  3T2O A;  5JR2 A;  2X05 A;  2BGO A;  5CYY A;  2HYX A;  3CQO A;  4XUQ A;  4A41 A;  2VMF A;  5HPO A;  3IB3 A;  2RVA A;  5DPN A;  5G04 L;  4Z2A A;  5IJR A;  4M4R A;  4KI5 M;  5IYY A;  3PUH A;  4D0Q A;  1JZ8 A;  1GOF A;  1XNT A;  3HNM A;  1UX7 A;  2VZP A;  3LPG A;  2E32 A;  2W9X A;  1GQP A;  4XUO A;  5DMY A;  4CU7 A;  2VZ3 A;  2QBX A;  3SEE A;  5IFT A;  1UY0 A;  4ET7 A;  1ULO A;  1UMI A;  4XUP A;  3HJR A;  2C26 A;  5JUV A;  2BGP A;  2VCB A;  1UZ0 A;  3WNO A;  2WAA A;  2RJ2 A;  2VTF A;  3BN6 A;  2VCA A;  1H6X A;  2ZEY A;  3VD4 A;  4MGS A;  4LKS A;  4QX1 A;  1NX9 A;  1UY1 A;  1GUI A;  2Y6J A;  1JU4 A;  4OUE A;  3GGL A;  2W1U A;  1DLC A;  1SG3 A;  2Y6K A;  4A42 A;  2DCJ A;  3A7Q A;  4PF1 A;  4DEQ A;  2J1E A;  2J22 A;  3WEZ A;  2WN3 A;  3ECQ A;  4W8J A;  4RN5 A;  4IUG A;  4JX0 A;  3IDA A;  1NKG A;  4DUV A;  4HG6 B;  1L7R A;  2VJX A;  4QDR A;  2E31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...