4LITA

Structure of ycfd a ribosomal oxygenase from escherichia coli in complex with cobalt and 2-oxoglutarate.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
372
structure length
361
Chain Sequence
b'EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 102
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4litA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4litA01
4UF0A 5FWEA 3PURA 5IW0A 5FXWA 5FYZA 5FP3A 2XDVA 5FJKA 5FXVA 5F3IA 5FPAA 4LXLA 2OQ6A 5IWFA 5FZ0A 5FXXA 2OS2A 5FP7A 5FZCA 3KV4A 4QU1A 3N9LA 2Q8DA 4CCKA 5F5IA 5F3EA 2GP5A 5F39A 5FZKA 4E4HA 4TN7A 3N9PA 5FZMA 4EYUA 5ISLA 3KV6A 2OQ7A 5LWBA 3KV9A 5IVEA 2W2IA 4IGPA 4BISA 3AVRA 5FZOB 3LDBA 4BU2A 4QX8A 5FY8A 5FY4A 5IVYA 3AL5A 5A7WB 4C8DA 3OPWA 5A80A 5F5AA 5A3WA 2XUEA 5LY2A 1VRBA 4LIUA 2P5BA 5FUPA 5F3CA 5FZEA 5KR7A 5FP8A 5F37A 5F32A 4LIVA 5F5CA 5FYMA 2Q8CA 2PXJA 3U4SA 4Y4RA 4IGOA 4CUGA 5A3TA 4QXHA 4URAA 5FPVA 5A7PA 4UF0B 4D6SA 5FXZA 3ZPOA 4V2VA 5FZ1A 2GP3A 5IVVA 5LW9A 5FZAA 3K2OA 4CCJA 4GJZA 2YU2A 5FY9A 5FZ6A 5E6HA 3PUQA 3PDQA 2YBPA 2YU1A 4ASKA 4Y3OA 5A7SA 4AI9A 3DXTA 4EZHA 5FZ9A 3AVSA 4D6RA 3K3NA 3N9NA 5FZGA 4CCOA 5FZDA 4GAZA 4IGQA 4DO0A 5IVBA 5A7QA 2XMLA 5FV3A 4V2WA 3OPTA 5FP9A 4CCNA 5FUNA 5FZ7A 5FZLA 3KVBA 4QXBA 3N9QA 5IVCA 5K4LA 3LD8A 5FP4A 5FZ3A 4HOOA 4GD4A 5F2SA 5FYSA 5IVJA 5FZIA 4LITA 3AL6A 5FYYA 5A1FA 4AAPA 4QX7A 5FY5A 5A1LA 5FZ4A 4EZ4A 5CEHA 2OX0A 3N9OA 5FPUA 3KVAA 3PU8A 2YBKA 2VD7A 3RVHA 5A7OA 5FY1A 5FZHA 4BXFA 5FWJA 5FY7A 5FYTA 4Y33A 5FYIA 2OT7A 4DIQA 3PUSA 5FJHA 3ZLIA 5F3GA 3NJYA 2YBSA 5FBJA 4CSWA 5FPBA 5FYUA 3DXUA 3K3OA 5FZOA 5FZBA 3PUAA 2Q8EA 2YPDA 5FY0A 4QXCA 5A3NA 5FYBA 5A7WA 4QWNA 5FYCA 3KV5A 5FZFA 5IVFA 3PU3A 5A3PA 2WWJA 5FYVA 5LY1A 4GJYA 3N9MA 5A7NA 2XXZA 3U78A 5ANQA 5F2WA 5FZ8A 5FPLA 3UYJA 4CCLA 4HONA 4D6QA 2WWUA 4NUBA 4XDPA 4XDOA 5FYHA 4CCMA 3PTRB
chains in the Genus database with same CATH superfamily
1RHI3 3DU5A 1AYN3 1FBUA 5GLTA 2R072 4C30A 2AQEA 3BR6A 5JPNB 5ACA1 4QAWA 4A3MJ 3POYA 3ILRA 2W1QA 2CAUA 4XJWA 3RWKX 5A33B 1WFXA 5C33A 5H6RA 1V5GA 1JYXA 4JX5A 2GXGA 4PFOA 4AQTA 4TZDA 1W2UA 5B1AH 2ZCWA 4AG4A 3LSJA 3K75B 4EE2A 3VPRA 3EXUA 4ZYGA 5C3QA 5FZAA 3MYXA 3BCAA 4CDQA 4QM9A 3ZSEA 1RVF2 5FZ6A 4OHWA 4KI5M 1VZ0A 2BFUS 2M45A 5DN2A 1VQ6I 3BQZA 4M3BA 2VCBA 3OPTA 1GU3A 3KX2A 3REOA 1W4MA 4B09A 3SQOA 2JKBA 2JQ7A 4QXBA 3WTZA 2WAOA 1KU9A 4YFZA 3IM0A 3S0MA 3SMHA 3OUHA 2R7DA 1NG6A 4FCAA 4HNTA 4YW6A 4BLIA 4ISRA 3MGUA 4A6OA 1ST8A 3WNOA 1SBFA 4GA9A 5BNNA 4UY8I 3LMMA 1QPIA 3O1PA 2BVVA 3D5SC 3D4KA 5T5PA 1UYXA 3DEEA 4JGZC 1PJRA 3CDLA 4G6DA 2EZIA 1QJFA 3HOUJ 3OYKA 3AMPA 1N3QA 5F2WA 1LUJB 1GUIA 4XFIA 4D0PA 4IHTA 3N97A 1EAH3 3VB2A 1R092 2L4AA 1GR3A 4S0HB 5GTHC 5JCTA 1B72A 4CDUA 3OYIA 2A6XA 1MMGA 4BACA 2KISA 5K0UC 2WZR3 3CHXA 4ENKA 2IP2A 4A3DJ 3KV6A 4KGQA 1YI2I 2M7AA 4B8XA 5CU1A 2VI6A 3QP6A 4Q4V2 1VQLI 5FY8A 3F9KA 2LFBA 2C26A 2O8XA 3AB0A 5D2AA 2VQTA 3K4MA 2BV4A 2EAKA 3FXOA 1SPPA 5AC92 3CUQC 5H9PA 3ZFFB 2M0MA 4LQRA 2AACA 3IAPA 2GDFA 3X2QH 5A3UA 3IPVB 4N7UA 1YO5C 4A0XA 4H2AA 1Y9GA 4DRVA 4FX4A 5KK1A 4EATA 5IUQA 3MWMA 1MEC3 3LD8A 2OQGA 2PMUA 4GH4B 4FTHA 3TW6A 5B5EC 5F5QA 3CJIA 4IQJA 4AYBN 5IK7A 3J7NA 2J5PA 3LQQA 2OAZA 4PJNA 4A42A 4RGSA 1AYM2 3IKTA 2M30A 2JT1A 3G71I 3NL1A 2NOGA 4QDRA 2FHRA 1UMQA 1FLIA 1H8VA 2YBSA 1OLTA 1QVTA 1BCXA 1ZG1A 2EFNA 2RG4A 4XQ4A 2M3AA 4KG0A 2VULA 2F4OB 1ULYA 3MEPA 4XQFA 4Q1RA 1A8MA 1WLWA 4A93J 3RZDJ 2XRNA 5C3SA 5JAXA 2VW0A 4BK4A 2K9ZA 4Q4W1 2OS2A 4D69A 2DVFA 3M8FA 4PDWB 2COBA 3F21A 2IS2A 1N1TA 1LOEA 1YI7A 3ZKYA 2F4PA 2FDKA 4YELA 1C8M3 3EMRA 1WH7A 4H55A 3E7LA 3I0TA 2CTVA 2R7RA 4WM8B 3RI4A 4MX3A 1TQPA 2HPIA 4LLGF 4QPIB 1GWKA 4KU8A 3VBHB 3K3NA 2G7HA 5FP9A 2RHPA 2CGNA 3TB0A 4MO7A 3CD6I 4Q4Y1 5E3MA 3VYTB 4XOGA 2GIVA 2WZEA 5IFTA 1STMA 2KRHA 1T8IA 5CVUA 3OTFA 4XETA 5CZKA 3W6JB 5CA6A 3WD5A 5AVPA 5CISA 3KLSA 1IRZA 3K0LA 3VBSB 5D5UB 1RUC2 1MACA 2GZWA 1NK3P 2OU2A 5I8YA 3JTHA 4G8XA 3EUKL 2ZEWA 1BC7C 1PP8F 3GLXA 4IHSA 2OBPA 4BDVB 3BZCA 3AP9A 3K70C 5E79C 5FY0A 3IBMA 1DCSA 3MZ8A 2IUWA 3H1MA 3CL1A 1X33A 3WNKA 2PN5A 3NQHA 2IXJA 1N3PA 4Y5TA 1JT0A 5ACA3 4Q26A 2W7NA 3FMQA 1XGMA 5FWEA 4PGHA 1RUF1 5JMCA 1W03A 4CEYA 3IDEA 3LA7A 3LPGA 4PSWA 3AC0A 2JG9C 4NHMA 2JX9A 4D0QA 3JB4C 1AJOA 2QENA 3HPHA 2P5LC 3KV9A 4IO9F 4QX8A 2KDZA 3OPWA 3WTSC 4AYUA 4HDUA 1E3PA 1ZN2A 2W91A 1G8XA 5FO8B 2X05A 3JRGA 1W3VA 1AR92 2IC1A 5J36A 1DF0A 2ELJA 1GWLA 2DWRA 1QEXA 2E5NA 2QKMB 4YW1A 2X8KA 1NYWA 5L3CA 2BGCA 3IIIA 4LBNA 3VD9A 1I3HA 2XAJA 3ZMNA 4WVVA 3I49A 4FPLA 1E3HA 1ODMA 1S1AA 1IS6A 4HN1A 1Z3XA 4UUSB 4YM2A 4E7ZA 3WDXA 4QM8A 2TDXA 2VGDA 2WT1A 3GM8A 2L9RA 3SXWA 1DPRA 3HOBA 2XJUA 4I2OA 5FLXK 3RZHA 5F08A 3ONQA 4D7TA 1QJU1 3IH3A 3MI8A 4MGYE 3NJXA 3TP0A 5JLXA 2HWB1 4RDUA 1VFCA 1J3QA 3P9KA 1S7AA 5LHGA 3KZIC 2ELKA 2AO9A 3AZZA 4U36A 5HODA 1UKGA 5FYHA 4Y20A 1QH7A 4IQPA 1XU2A 2PN6A 4KG8A 4UYBA 1LNWA 1XQNA 4XEZA 4PIZA 1W3XA 3WQ0A 3V0AB 3OIQA 1W6PA 4OIOF 3CDZB 3K4DA 3E3VA 1UQXA 5FBZA 3BT9A 3CCLI 2IXHA 2Z16A 3VZKA 2JDHA 1SBDA 3DWLE 3K9TA 2E7QA 2W08A 4CEWC 1V5EA 4GWMA 4LBQB 4XJUA 3FJSA 5C8CB 2FNPA 3ILFA 4JTOA 1DQ2A 2LF8A 3B73A 5TGTA 1H8AC 4OVEA 3WNPA 4PLNA 2GNDA 1D0HA 2J5OA 1CF7A 3N7LA 1DUXC 2E71A 1LJ9A 1RETA 3VBOC 3GF2A 2L9VA 4CP9A 2W1UA 4A45A 1NLSA 1WLDA 2PQQA 5A7QA 3KIOA 3O12A 1BJQA 2RR12 2DFIA 2QQBA 4JBAA 1YQ5A 3I2GA 2VIXA 2QKLB 2HQNA 4NRPA 1I39A 2XVKA 3KEOA 2ICWG 3GZTB 1XE0A 1U9OA 5KC6A 1LEBA 5A6YA 4DY3A 1M06G 3I3EA 2HYFA 4J25A 1DU0A 1MH3A 3A0HC 3VBRC 1R1A2 3HWJA 3SQNA 5J37A 2D43A 2HTSA 4QB2A 3K3OA 2O8QA 1Z3YA 1IN8A 5A2QK 2HFHA 1SMVA 4PQQA 5FYBA 1Z67A 4Q4W3 1WQ2A 4AFAA 3H36A 1D4VB 4ESJA 3JRHA 4QLCU 4LK0F 1BI3A 5CFDA 2IBDA 4BEHB 4F83A 1RR7A 4LE3A 3JXSA 3T0DA 3OYGA 4JK1X 1Q8VA 4EN7B 2HYGD 2I2SA 4CH7A 2VOWA 1SLLA 3WINE 4XRSA 1X2NA 1D1AA 2PI0A 1W05A 1DZTA 3BJAA 4BH9A 4BNCA 1XBFA 2X51A 3ME2A 5KHJA 4QHZA 3HGYA 5JPMB 2HWC2 2JECA 4Q8KA 3QPLA 5D4SA 1EP0A 2VMDA 2FBIA 1T2KA 3QYBA 3RDIA 4WXCA 5KWRA 4Q4Y3 2QFEA 4UFIA 3ZDVA 2VZ1A 1R22A 3QPTA 4I6ZA 4IUGA 2R5ZA 3WXPA 2CW0F 1T33A 5EYXA 4Z2AA 1H2NA 4AHYA 3BP8A 1OLME 2A61A 2P37A 2DBIA 1D7PM 1S2BA 5FK7A 1IHMA 2WZPP 4CDQB 1NH3A 3ES1A 3GTLJ 3VBUC 1UJ8A 2Y0OA 4ITVA 2PX9A 5DM6F 4BK5A 3CZ6A 3OYAA 3W2WA 1MJ9A 2VMHA 4QQLA 1JOPA 3FHIB 1RUF3 4JGZA 1DQ1A 4HLXA 1ZRCA 2RS12 3UYJA 2WAFA 3J7MA 5EQUA 3ESWB 2A3XA 2Y33A 5FROA 3C1DA 3WG7H 1WHUA 2OVUA 2C0ZA 5FLHA 2LDUA 2K86A 4XCAA 3S1MJ 2B8MA 5FP7A 1SAXA 3N9LA 1SFXA 4B3NA 2STWA 5BNNB 2VOTA 4IEJA 1NXMA 3M3QA 2VNOA 2CAVA 5K0UA 2Y6HA 3RQ4A 2R1BA 2ZS6B 3MDPA 3L2RA 1O4TA 4XE9A 1JYCA 1IRFA 1R7JA 2J1VA 3WGIA 1HQWA 2PAEA 1FJLA 2O7OA 2OXBA 2K02A 3PVBB 3CUQA 2C4XA 2WFPA 1B72B 4CDUB 2W1OA 3AMHA 4OUSA 1ZBE2 1E5SA 3FMGA 4M6VA 3CDIA 1W9SA 2HEOA 1R49A 2FOKA 1HXS2 3OYWA 1DG6A 4FI9A 3MIGA 3K1MA 3MVPA 1Y6IA 4XJZA 4XLNF 1JW6A 1E5IA 1Q5OA 3MW4A 1X2MA 5FZIA 4LITA 1SPPB 5FLJA 5E8GA 1Z7LA 4S2DA 2E2IJ 3IH4A 4RB2C 2GLOA 2HWB3 4BXFA 4B48A 4ZYEA 2JIJA 1CWPA 1XDUA 2D6OX 2RVCA 3EQEA 4P96A 5FMCA 4KITB 2NAZA 3GO5A 3LGRA 3BPZA 3PMSA 4LO6B 1NE6A 4HMZA 5E20A 1YQAA 3CJIB 4NUBA 4E7JA 4XXPA 2DXIA 4OLLA 1K42A 1UCRA 2JVHA 3PM1A 4DFSA 4U0VA 3NRUA 1LPQA 2YX4A 3HVDA 3OUIA 2HWE2 3W6KB 2YG0A 4Q0QA 3GUDA 4D94A 2M9HA 2QYOA 4L99A 3VDAA 3THPA 4IGPA 3UGGA 1Z6RA 5J7MA 2CS3A 2CYYA 2ID3A 2GH2A 3R60A 2P5BA 1T0FA 1Z7S1 2VOOA 3BU7A 1VAKA 4FCYA 2MG4A 2VW2A 1S4CA 2VM9A 2IA1A 4RM3A 1HQLA 1GXPA 1G3TA 3VBFA 5J3UA 1UZVA 5E3LA 3FM3A 1E57A 2VZVA 5LK5A 4QTRA 3W20A 3ZQCA 3A0KA 5FZGA 1U5TB 2G1MA 3CEWA 4NO4A 2JSPA 4AI2A 1OXCA 5I0DA 2QUOA 3R4SA 2NPIA 5HCFA 3BDDA 4KWJA 1AX0A 3Q8EA 5AIPA 1XX5A 2P6HA 3P3NA 1LHWA 1IF1A 3CF5F 4PJJA 3T09A 1VBC2 1RVF1 4P9WA 3CCYA 1AVBA 4V19K 2C24A 2E36A 2OPWA 5EGOA 1UX7A 5KHIA 1ENSA 2ZPXA 4ENMA 3MUY1 2NVQJ 3AP5A 3LQCA 5EYYA 5JXJA 3HBKA 1SBEA 5HS8A 3GTMJ 4AVVA 1QH6A 1MDMA 4BE0A 3F2ZA 4OI2A 3SCFA 4PDKA 4B1RA 1YRNA 1UIKA 3Q0UA 1V5FA 3CTAA 2NZ9A 2GA1A 3SHRA 4A3ZA 3R4DB 3QP5A 2BHYA 2R7XA 1Q1HA 1NQJA 2H1KA 3AKSA 2JG9A 1ACCA 1PVXA 3ZMVA 4EGZA 5CYYA 5DAVA 5K7FA 2X6OA 1KQ9A 1VBD1 4E6KG 4KIBA 3BLYA 4COYA 2L9NA 3APBA 5BXXA 4ZS3A 1R091 4CEYB 2RJ2A 2HS5A 4UXAA 3M7AA 4OZXA 4L9BA 2YU2A 1YX5A 5EZGA 4D9JA 5IT3A 1MSEC 1W8OA 2MBFA 5IATA 1WLCA 4UUVA 5EZHA 4I0WB 1GP6A 5HDGA 3ZXLA 4A7KA 2LG4A 2QQOA 2VQLA 5GM0A 1RR8C 3KETA 1GOGA 2CDOA 5J96B 4EEFG 2JDAA 5AC91 1SVOA 4FE4A 5HLIA 3BU0A 2OPTA 3RZLA 4HVRA 3ENRA 4B4PA 3GTJJ 2V6EA 5FZHA 5ANNA 3AYDA 1KQ8A 4KQ7A 2IPQX 1FPQA 2BEOA 3N3HA 3U9GA 2BHZA 2LROA 3TNQA 4AHZA 4CE8A 4YGCA 3ZX7A 4UW3A 2P81A 2JDNA 3P9IA 1ZM1A 2QQ9A 5KHHA 2RS32 3S1QJ 4IKFA 2Q8CA 3T4HB 1JGGA 3G73A 1AYM1 3RYRA 5FJKA 2B63J 1SEFA 4V1PA 4CU9A 2RQPA 3I53A 4LKEA 2DJIA 1W06A 2B45X 1R36A 2VXRA 5F3CA 2XJQA 1OMIA 4CEWA 2JG8B 4Y20B 1QOOA 4PJLA 3FLRA 1DGWY 2D5FA 3WTYC 5KC5A 1WGXA 2NLRA 1W6PB 2MLGA 2CWEA 5D8KB 4G7OF 3VBOA 1IV6A 1OQ1A 3C2GA 4PGGA 4RA2A 1UPSA 4DXZA 5A6XA 1CVNA 2Y6JA 2HKXA 1AX2A 1GOFA 4AM3A 5ICFA 3J81Z 1F36A 1OLQA 2EXJA 1GYKA 4MGIE 2CFXA 5J8CA 2LALA 3AZYA 3OSDA 5FPUA 1CF7B 3LIGA 4W50A 2O14A 2F2EA 4XVHA 5FYTA 2SLIA 3BG3A 1VQ4I 2HQAA 3HXLA 4CP9B 3VBRA 1JYTA 2A3YA 4CSWA 3T4VA 4OFGA 3GMEA 3HT1A 5A3NA 1MBHA 5JXIA 4IRHA 2ECCA 4E70A 1FI2A 2KL4A 1TWHJ 2NNYA 4AOCA 1VAVA 2WNEA 2KPMA 2XAHA 3GXOA 1YJLA 5FLIA 3WHCA 4L9VA 1GWMA 4LLNA 1DQ5A 1T6BX 1W5TA 3BTLA 1EJ9A 2E7AA 5E8IA 3HGGA 3FC0A 1Z7S3 1ZTRA 4E2SA 2OQ7A 3HOWJ 4BKXA 1ON2A 1OD5A 1PNGA 4YM1A 3ABMH 3FXRA 5EPAA 1I5ZA 3AYEA 3V8JA 3UKVA 1J2XA 2VUDA 4XBQA 1MJAA 4XIKA 5CFDB 4XIOA 3O7OA 2DMUA 3TOJA 3SC7X 4XK4A 1ULEA 2A6YA 3BKZA 3NJVA 1XN7A 2GOXB 4LK6A 3IV5A 3ETQA 4YVWA 3PNYA 1X1CA 4TYSA 3UNGC 3C7EA 4COVA 4B43A 4QPGC 5CAZA 2AR6A 3ZR5A 4S2HA 5FZLA 1CPNA 3QH6A 1RVF3 1LGNA 1S7OA 4FO9A 4M3FA 4FAHA 4GD4A 5IVJA 5EG0A 1KXGA 2DT6A 2EXIA 4QX7A 3B6CA 4HLTA 1YITI 3BB6A 1QOSA 4NJ4A 4F93B 2F48A 2ZA9A 3AKZA 1IZ1A 4GRIA 3RFRA 3I97A 3WDVA 3VBUA 2EZHA 2R5ZB 3MLKA 2L4MA 2H1LA 2O03A 4XC9A 4EQVA 5LA1A 5FYVA 3NKTA 4IVNA 1UL9A 3SCHA 3CMMA 3QWLA 2WNUC 2XGXA 1R9TJ 3W3CA 3B01A 1IKPA 1VBD3 3JCUC 2X1CA 2VUAA 4B29A 4DBQA 2BOJA 2QCOA 5J4YA 5E1RA 4DW6A 4J1XA 2AEZA 1R093 4JGZB 2EALA 2YS9A 4L18B 1N78A 1C8NA 1J9IA 4B7KA 1J0RA 1A34A 4AI0A 2V72A 3JAMK 1D0ZA 2OCEA 3AG1H 1Z77A 1IKQA 2ZTNA 2GU9A 3I3LA 3VUOA 4FX0A 4XZUG 4Q47A 2VR4A 3I7DA 3OPZA 5AC93 4XF9A 5A1AA 5J1XA 5K0UB 2IRFG 1S0GA 1WD4A 2RMU1 1OKQA 1W9FA 4CUBA 1BI1A 2JPBA 2XKOA 3Q0VA 4N9HA 4XFCA 3ZPYA 3LEMA 4EJOA 1REEA 1SG3A 3BOWA 3DKYA 3NNFA 4BDYA 3CUQB 1DQ4A 3WG3A 2VW1A 3VHPA 5HDNA 1L0OC 4LHSA 4OWRB 1VBE2 2OT7A 1O4YA 3MF9A 4Z8BA 4X6AJ 4ANJA 2XUMA 5JWPA 1KDKA 3GZ5A 1X1AA 1UOBA 2RR11 3OYWB 3ZMZA 2OJED 2CU5A 2ZJ2A 1AYM3 4ITCA 2TCTA 3INAA 4C3IJ 2QSGX 2A7AA 3ZIWA 4OI1A 4ET7A 5IVVA 1ITYA 1BL0A 4XSZF 1RUG2 2Z5UA 1HSJA 1O91A 5CVIA 1CQ9A 4GCVA 2VMCA 2D44A 2CUJA 3KSCA 4LKSA 3C7OA 3OG2A 3F22A 3Q3SA 2A6VA 3B6AA 3FL7A 4DZJA 1IN7A 4A12A 5LY2A 2W25A 4RLFA 3ZQQA 4HKLA 1JUIA 4JGYC 4M0NA 5FKKA 1HN1A 3QYFA 2QSHX 2FDGA 4RL7A 2V6CA 3BJOA 3L2VA 1O6UA 4Y3OA 4IE0A 3FBNB 3MHZA 1K45A 1KZHA 3QODA 4UHTA 2DA4A 4H7LA 1HDPA 3T08A 1QHHD 2F5EA 3T1BA 3GGLA 4ZZ8A 3W59A 1G3YA 3J4UH 3KFWX 1JU3A 2QVOA 4BL0B 4XUQA 1J58A 3AL6A 2HWC1 5LHIA 1POQA 3RZKA 3AM2A 2XBO1 3MIEA 5A7OA 1UN1A 1JKPC 1FNZA 3H9JA 3RS6A 2YXSA 1G9AA 4ZDOA 3T2TA 4MGKE 3DLLF 3NV2A 1UYPA 2LR8A 5A6ZA 4KBBA 2JA2A 1N1VA 3OYFA 4IEVA 5DZFA 2EIMH 1A04A 2W9XA 4UNOA 1W36C 4AEKA 3JSOA 1HB3A 1LU1A 4C91A 2BXZA 3BALA 3OS2A 4QQOA 3ZGKA 2IXKA 4Y26A 5EGOB 3GTQJ 4SLIA 2ETEA 4HBNA 2WN2A 2V4VA 4B4RA 1WMXA 3ABLH 3D5OA 4PHZA 3DKWA 1R00A 2QCSB 4LIVA 4D5FA 1MDMB 3HOTA 4CUCA 4GWJA 4Q4X1 2ADEA 4CVUA 3M3IA 4XOPA 3WVJA 4EGYA 2SBAA 3OYNA 3PDQA 1FIPA 2ZX1A 2JG9B 4KMFA 1AU7A 1QXRA 3EB7A 3DU6A 1O5LA 4XONA 5IP7J 4OIQF 1Z0XA 3RI9A 4BY7J 2VNRA 2K9LA 2B9SA 1T98A 1Y1WJ 2UYAA 1XGNA 2A73B 2HEYF 4IHYA 3JRDA 2IT0A 5J47A 4EN9B 1ZBE1 3DL3A 3ORJA 2EZLA 4AF9A 2EB7A 1YE9A 4F52A 2VKVA 4X0GA 5FPBA 3WZ1A 1QHGA 2Q8EA 2GXBA 3FHNA 2MEV2 1BK0A 2LY1A 1WBFA 1ZZ9A 1Z7UA 3KM5A 2ZFUA 4KWUA 5IOZA 3N7KA 3WR0A 1A6IA 3TN92 1G3SA 3CLOA 5F3IA 2WNOA 4LGWA 5DCFA 4KNCA 2BPA2 3SDGA 1GDTA 4MYEA 4P9YA 1SCRA 2ESNA 4P9XA 1VI0A 4EVIA 4GKXA 1PGW2 4UFJA 3ZXJA 4HZFA 2IS1A 4AXOA 2Y0SA 4QDSA 4BQNA 4E27A 1MZEA 2ZX3A 2E7XA 4KGGA 2HWE1 2RMU3 4NBQA 2Y2ZA 3VOEA 4YIFA 1ZA4A 2EXHA 2PHLA 2VUJA 1JUPA 2PHXA 2XMLA 1LESA 3H1YA 2D93A 3LA2A 1SFUA 4K8FA 1K6YA 4J1WA 4CEWB 1TNRA 2GMMA 3OYCA 5FZ4A 4AVSA 2VMEA 5EHDA 2OA4A 2RR13 1NG0A 2YR2A 4LBJA 5FMDA 4KJZA 1VPHA 1DYPA 4JKLA 1HC8A 3VBOB 4ASNA 1IPKA 1GUUA 4IHXA 1Z91A 3J7YJ 5IK8A 4FQZA 4XN3A 3SISA 5FZOA 3HQUA 2YPRA 3AG4H 5J98B 4GO1A 1XXNA 4ARYA 1I3AA 1RUJ1 5J1YA 2XL9A 2W00A 1P92A 2D6MA 2ARAA 1R58A 3RKXA 4JRLA 5I0UA 4CUAA 5E17F 2M5WA 1OUXA 1VBC1 1FY7A 5GADJ 1DYOA 5E3OA 1KFUL 2L54A 1YFUA 1YS7A 2L7FP 1N77A 1D1BA 1HW2A 3VBRB 3A23A 9ANTA 1HKQA 5HNFA 5L3GA 1TWAJ 5L9RA 5DTDA 2R0QC 3A0BC 1CAVA 1CAUA 2DA7A 3B02A 3WGGA 2KR2A 2O5RA 4TLGA 3BWGA 3ACIA 4U2AA 4URAA 2Y31A 3RNSA 3KYLA 3MKYB 1G3WA 2IGNA 5GLWA 1CN1A 1URXA 1QIQA 4OZOA 4J00A 3AKQA 5CLSA 3JCIA 1OQYA 4ZS2A 5EWSA 1W0TA 2HWC3 4NIDA 4EJUA 4EJVA 4IF4A 2XBO3 4QPGA 1SLAA 1P4WA 2R7SA 4C90A 1AHDP 3J26N 1OT5A 1X19A 1GT0C 3CCQI 1W0NA 1ETOA 2WAQA 1A6QA 4JV4A 4GULA 4DPNA 3MMYB 1OR7C 1IN5A 5CVRA 4MHUA 2EV5A 4XF1A 3KGZA 3J80Z 4HPKA 2RM21 5JDBA 1U6GA 1TEIA 2WIIB 5LCWL 2XLGA 4D1QA 5EG0B 1S0JA 3FMRA 4RHV2 5C3EJ 1COV2 3A4CA 4XLPF 5JOYA 3ROUA 1XOYA 5BPDA 3GWZA 2LLKA 2NQYA 2FQ3A 5J48A 1G86A 4YW4A 1W2AX 2VJIA 2WFF2 4XRMA 1CJDA 4XN0A 4YG6A 4DZPA 3C3WA 1LE8A 1D5YA 2DTWA 3VBUB 2PFBA 1NY72 1HBXG 4Q4X3 4HRIA 2KXLA 2HU9A 1WCKA 4HK9A 5FTTC 3UESA 1W6QB 4CU8A 4BM8A 5F5AA 4RD7A 4BB3A 3KYDB 3Q8AA 3D0JA 3ZM8A 5IPAA 1M4WA 4M74A 5A7PA 5HCAA 4NC7A 3ZSMA 2CQKA 1SQ4A 4NHLA 2VOVA 1MPXA 1A35A 3LKJA 3IDCB 2EJRA 2V7FA 4BIFA 4BOWA 4Q48A 1D1CA 3PUFA 2CY6A 4LO8A 5LEKA 2Y0SN 4A3EJ 3DEMA 3I5UA 2D3PA 4MGZE 2DTRA 2VONA 5KVRA 2IAIA 1V6MA 1E17A 5F6FA 4WVWA 4M3GA 3E6MA 3FXQA 1ZBE3 1ONAA 2VL4A 3WF1A 3ERED 4Y24A 1GNYA 3BR2A 3HIFA 3IP4B 1PDNC 2MLKA 1JMUB 1WA6X 3HJRA 1F9NA 5F9TA 3ZYJB 4C1WA 2YB7A 5JVVA 3W6VA 1RESA 2Y0MA 4Z92B 2FCVA 4LOTA 2CV1A 2FSWA 4ASMB 3WE2A 2EV6A 2QQVA 4JDMA 3IZOA 2ARXA 2FA5A 2B42B 4NN0A 3VD5A 4Q0UA 1SD4A 1TQ5A 4KIFA 1F4HA 4OI0A 4AHXA 4I76A 1TT0A 1YW7A 2D97A 3OD4A 2P17A 4XW3A 3S7EA 4E7KA 1HQNA 5BPXA 4CXWA 4DMIA 1JZ3A 4LO4B 2A6WA 1IOAA 2F4LA 2BOLA 3UR3C 4ZTFA 2HWE3 4XF4A 5BNOC 4Y5Z0 3AYCA 1WMEA 3ZDSA 4F8AA 4INDA 4HVOA 5C5UA 4JGYA 1ND3C 4KT5C 5A70A 1LULA 4OUMA 4PF5A 4E7SA 3H8UA 1R1UA 2JDZA 2G9FA 3D82A 1HDKA 4AVZA 2D6LX 3CESA 3T5XA 4FFFA 2KRFA 1B9NA 2V1DA 4A3LJ 1E0EA 4HFSA 4PIYA 4MHRA 2LVSA 3CP8A 5B3SH 1RUJ3 2ZGQA 2QNKA 2CJJA 4YM0A 3HRTA 4JAAA 3L2QA 1FAYA 3VDXA 1JXNA 1VBC3 4NB5A 2WAQN 3I3MA 1I1SA 1W0UA 2WWJA 3N9MA 1XNAA 1VBA2 1WCMJ 1LOBA 2QQAA 2YPJA 2IEKA 1YJNI 2RV9A 2K85A 4GWIA 3V7CA 2FF4A 4LG0A 5J4VA 3LOIA 4HANA 1MS0A 5K5OA 1HB2A 1R5GA 4PQ9A 1ETXA 3OYHA 2WO7A 2V09A 4QKNA 1GXQA 3CU7A 3L1PA 1RUE2 4UB8C 1O4ZA 1USSA 1J3PA 1MZ6A 3IKVA 1VB4A 1SMTA 3FKJA 1D0YA 3PVOA 5KAIC 2DA3A 2VPVA 2B4KA 2VKEA 3U4XA 1VLNA 3K1PA 1Y8RB 1APNA 2E32A 4LBKA 3PO2J 2YU3A 1P6RA 4YGBA 2QVSB 3R4UA 4ESFA 2R30A 2RM23 4LA2A 5J8FA 1VRH2 1S8NA 1BN5A 2QQWA 4FPGA 4CXYA 4C9YA 5L36A 4LBLA 3NKGA 4QXCA 1FMVA 3JRAA 1R23A 3M8JA 3BG7A 2ZAAA 1TWCJ 3RGBA 4NQWA 3WTUC 1IO2A 5GLVA 2JA7J 4K20A 3Q8FA 2ZZJA 1JOJA 3VSLA 2DCYA 4JQFA 5FP3A 3BIEA 1PVC2 3WNMA 2R6QA 3ZIXA 2EVXA 4YW7A 1XSQA 2DF7A 2N7GA 2KDOA 3OBAA 1UU5A 5IVEA 4AQSA 5FCCA 4BISA 1SACA 2YZ4A 4MH0E 3CC4I 3KQ4B 3ZMSA 2Y75A 4N53C 4OINF 3GBGA 1KJLA 3BI3A 4YZ2A 1BBT1 3AJZA 3LSKA 2JWPA 4LHKA 4XFAA 3VZJA 1W90A 4DUXA 5GJ6A 3F8MA 4IOCF 2DFBA 3KT1A 4XLHA 4XMIA 2HYKA 4P9JA 1EUTA 3W58A 1CX4A 4M0HA 2J7MA 2VQ0A 2PAKA 4XBLA 4Z2WA 2E51A 2VO5A 2GC3A 3HMYA 4N0BA 1GQHA 4W6YA 5IHRA 4XXAA 4P9GA 3VV1A 5HBAA 1SANA 2YYOA 2BOIA 4DZGA 2RNJA 4M6YA 2I74A 4FTSA 1V6JA 5TSWA 1PZ8A 4LKDA 3VHOA 2R92J 1OURA 2VNGA 1ETWA 1FP1D 2OUMA 2DLLA 4BQ5A 3SDBA 3IAM2 1HW5A 3QOPA 5B66C 1DLLA 1A31A 2Y6GA 3H5AA 3WNNA 4FPKA 5FXWA 3GZNB 4UFHA 1QQIA 5F7UA 4YZ4A 1IQDC 4DJAA 2EXKA 2PFWA 1IXSB 1B35C 2E60A 2WT0A 2H09A 4OI4A 2DPUA 3TO9A 1RUD2 1XB4A 5L3FA 1DU6A 5FZOB 4UW5A 2W24A 1HRI2 4PCRA 2B5HA 3VDCA 1Y56A 2A5ZA 3KF3A 1RC9A 6PAXA 1H9PA 2DOEA 3DPTA 1U0AA 4LORA 4E4SA 3ZFEC 5D8LB 2FCUA 1BR1A 4BJ6C 2XLAA 1P2FA 4QQPA 1T6SA 2GM4A 4KFCA 1QWRA 2A6EF 1LKNA 2FU4A 3KQRA 1R082 4QPYA 2Y6KA 4NIAA 3MQ0A 3AG3H 3K46A 3OIPA 1CAVB 2R3SA 1CAUB 5JR2A 3T2OA 3GNEA 1WCQA 2W3JA 1SFNA 3GJBA 5FY1A 2ZGRA 3BOQA 1AZDA 4QX3A 4Y33A 1UMZA 4AC0A 1TMF2 1RMU2 1OR7A 2G9WA 3UGHA 2Z99A 1BM9A 5F1JA 1B6AA 4L92A 2WBMA 4QPGB 2XF5A 1FOKA 5A7NA 1ZZ8A 3WX5A 4P9UA 1MZ5A 1AOYA 3H50A 1HLCA 1K12A 3ZYFA 1UCXA 2KZVA 2HWVA 1YC61 4AFCA 1MGTA 3M1EA 2JA8J 1R1VA 5IYBJ 5FKCA 5IJRA 2E9QA 4UOJA 4IHVA 4HPKB 4JQRA 2OW4A 3KHBA 4OQ8A 3ZSJA 3B93A 3LDBA 4A4AA 2EIDA 1HKSA 4HPQA 1O5UA 1P4XA 4R79A 2MEV1 2ZMLA 5H9SA 4XLFA 3TN91 4XKWA 1HXDA 3KT4A 2A6TA 3SJMA 5DABA 2R5YA 2WNUB 3GX4X 2HVQA 4BXUA 1KS4A 1LE8B 2YC0A 2A07F 4XZPA 3QPSA 4K7JA 2WC2A 3MPPG 4CCOA 3MCZA 4RYDA 4OOIA 5LBCA 2FCTA 5IYDJ 2WSVA 3D6EA 5L9VA 4LUMA 1XPWA 4SBVA 2VT2A 4DGWB 4JTNA 4QKFA 4AFMA 4HF1A 3MIDA 3S14J 2ZSHB 1CZSA 3FFQA 3BY6A 1FYLA 4WVMA 2JB8A 3FKIJ 4QT6A 2CFOA 3O14A 1U0JA 2VOKA 3KZZA 3FBMA 4QX1A 3PJYA 2Z1DA 2Z69A 5F0CA 4BXXJ 2HH9A 2CWMA 4K6BA 1P8JA 1XCBA 3CC2I 4PZJA 3I9V2 2R0HA 4BQ4A 3BR1A 3OR1C 1ND2C 2PMHA 1JYVA 3B9IA 1X3UA 3CQZJ 1C1LA 3PVNA 5LB6A 2D98A 3A21A 2P6SA 1XG1A 4E7HA 1W8ZA 2RN7A 5FZ1A 2HWF1 3WDTA 3A01A 2OIIA 3PUQA 1ND3A 3DPRC 2P5KA 2ENRA 1WGPA 3WG9A 1C0WA 1T6GC 1SD6A 1NTCA 3WTVC 2JD4A 2L7KA 4U7DA 3VN4A 3F8FA 2EZKA 4AFBA 2KLOA 3HSRA 1IUFA 4EZ4A 4JGYB 1SFPA 3SNMA 2WDBA 1JH5A 3O2PE 4UFKA 1RGSA 2EICA 5BPIA 1FYUA 5C3RA 3UETA 5B4NA 1A3KA 5SV5A 2Q0AA 2VE8A 3O1UA 1UKRA 2QDNA 4QWNA 1YIFA 1BIBA 2NYXA 5A3LA 1BBYA 3HB9A 4A2UA 4FPEA 3K4KA 1AKHA 2HOSA 3D3AA 1F4KA 3OSGA 4ENJA 4KU7A 5FZCA 5CG9A 1ZRRA 2WRAA 1RYYA 1UY3A 2C5DA 1ZZ7A 1W28A 4CCDA 5LGNA 1QQP2 3W5NA 3GYDA 5FP8A 4RHV1 3U4SA 5FKBA 2L2OA 5H2FC 1U3EM 3JD72 1OCOH 4ETSA 4B44A 4CCJA 4S04A 2WFF1 1PZ7A 2NVTJ 5FIXA 2M7BA 3FZVA 3NNJA 1XNCA 4ATFA 4AI9A 4LG0B 5ICCA 3HQRA 4CCEA 5L3BA 4M3DA 1UU6A 3N9NA 2IW5A 2O8KA 1IXCA 1JTXA 1W8HA 4R52A 3RZMA 3SLIA 1NA1C 2ZOEB 3WHTA 1YJ9I 2VUMJ 3DEUA 1O3SA 3H3ZA 1YW9A 4DUVA 1LDDA 1MBKA 1JOBA 1OYYA 1LEAA 1OH4A 4IRGA 3DBRB 4GWNA 1EV7A 3PMEA 1N1SA 1WI3A 2UWCA 1SZBA 3NRVA 4Q0SA 4BE3A 2VNVA 3F23A 2W52A 4JQTA 4XIDA 4RQPC 1Q8SA 1YCIA 1DPUA 1PYVA 2WJSA 4W6XA 4A3KJ 1AUYA 3WY6A 4U7BA 1WCUA 2MEV3 4IHWA 1PMIA 4GMP1 5HS7A 3PNVA 2Y38A 4O9GA 1ZZCA 3ABUA 5FOBB 3HRSA 2LRDA 5JVGF 4OHXA 3TN93 4OMZA 3HOXJ 4NWWA 2KFDA 5M5YJ 2VMIA 3OY8A 4NQWB 4Q0VA 5EEHA 1RC6A 2IFWA 4N53A 3WTWC 3POFA 3HM5A 2Y34A 3KP7A 3C7FA 2BY1A 4OMCA 4M3EA 2YBPA 2VODA 1TG7A 2WYFA 5LEJA 3BJ6A 1QKQA 3HUGA 5K1YA 1JS9A 4AW7A 2E1OA 3AMQA 1NZCA 2Z5WA 2A3SA 1QJY1 2ET7A 1PUEE 1XTAA 1OA3A 2R7FA 5T52A 3RMXA 5GPAA 2Z33A 3J81K 2Q0OA 1FTTA 1NLQA 4HV6A 3ISPA 1LFUP 4AEJA 4YZ3A 1IUYA 3H1WA 4LJZF 2L01A 5DEQA 3IWZA 2YPDA 1IJWC 1GP5A 2KIMA 3MLJA 4A3GJ 1C1FA 4QKBA 2VU9A 2CQXA 4JC1A 4PCQA 4BE2A 2HI3A 2E2HJ 4QKDA 5LA2A 1E2XA 3H7JA 2HTJA 4QU1A 3WW3A 4ZZDA 5LBEA 1K78A 2XPUA 1JHNA 1UAIA 2MNGA 4L5IA 3CLPA 2LNBA 4GIQA 1OVSA 2CH0A 2LF7A 1AXYA 5BQTA 2HWF3 3BCWA 3DECA 3FLPA 2R042 4TTGA 2HOTA 2LY9A 4A3JJ 3CCJI 5FPVA 4AVTA 1JBCA 1UZWA 5E1ZB 4LLFA 3ZFEA 1CIYA 1T38A 2EH3A 2CMPA 3ELNA 3POSA 3AVSA 3RKQA 1L3LA 2EA7A 5FV3A 3P9CA 1H4GA 2X1EA 2EWNA 1FBSA 1J7KA 1YIPA 4W1UA 3OIOA 2M1BA 2D2WA 3A1YA 1ERDA 3R61A 5BOXA 4M01A 5J09A 1YQ2A 4CP1A 2K3PA 5FO9B 1GZCA 5D6EA 3DN7A 3M4FA 1I5PA 3LFIA 2PYTA 1BMV2 3U0ZA 5FLXZ 1YQ8A 3CO6C 1ETVA 2J1AA 3S3OA 4RBOA 2ZMNA 2DCJA 4LLOA 2VOPA 3USUA 5DG1A 1VRH1 4NIHA 4BBSJ 3MF6A 4LOSA 3HN3A 1WZXA 5F3EA 4WX9A 5EJZB 4FPFA 4RHV3 3U75A 4YZ5A 4QQ2A 1MKMA 1YLLA 3HNYM 3D8CA 1UMIA 3SKJE 3NWKA 1VAMA 1QDCA 1FOD2 2WFF3 4GZ9A 4FPCA 1ZRFA 1WW5A 1W39A 1ALYA 1C28A 1JN2P 2MD0A 1Y39A 2CSGA 4II3A 5BNQA 2GNMA 5FKLA 3R05A 5E6HA 1JZ4A 3NVCA 4HA8A 3DCFA 4ZYHA 4GMP0 1OFNA 1G9DA 4JDNA 1V4RA 1GV2A 4FXKB 2XF6A 2VZPA 3U2RA 1F5FA 3S57A 5IT9Z 1WUVA 3T0YA 4DXSA 2DYCA 2NMOA 1Q43A 4E9KA 3IH2A 2V5DA 2R5YB 3L7WA 1S0DA 5DDGA 1ZH5A 5FMOS 2XGCA 3FBYA 2CL2A 2W0XA 3FXMA 4A69C 3S2HJ 4NWVA 4AWDA 1JYNA 2PBIA 3SEZA 4E8CA 2YMZA 2XWJB 1TW3A 2XV4S 1IAWA 2AUYA 4GMP3 2LD5A 3OGGA 3HBLA 4B3XA 3ZN6B 5H20A 4WVMB 1AX1A 3RZGA 4IEPA 4DXRA 1RHI2 1AYN2 2J22A 2ZABA 1XC5A 2DTYA 2CGPA 2XJSA 1YG2A 3DPLC 3TNPB 3GTPJ 2CQNA 4RGXA 2HBUA 5FY4A 5IK4A 1ND2A 2WO3A 3FXJA 2G9ZA 5D21A 2MHFA 5KNLA 1ZGWA 1LECA 1JU4A 4OCTA 3ZPOA 3ZYGA 2BVLA 3RSNA 2JZYA 4META 3HYIA 4MV2A 1SEUA 3ZVXA 4FOVA 1QJY3 4ES9A 1EH6A 3WP6A 5CADA 2P3KA 1VQPI 1PHMA 4AEMA 3DPRA 2WSUA 1HRI1 4M00A 4XSXF 2GN7A 1GOHA 5FZ7A 4FPOB 2GOMA 2VBXA 1ASJ1 3GEZA 2QA4I 2JXAA 4A41A 4FXGB 1OFSA 2Y0IA 4HNUA 5BNOB 2DCZA 3J7AY 2ZXIA 1LHUA 5K5QA 3K4BA 4Z2YA 2ZX4A 3A01B 1SCSA 4ENNA 1BK1A 1OOPC 2VASA 2AC1A 1ND3B 3C7JA 3H7YA 5HLHA 3CZUA 3MBWA 1S72I 3OYDA 1S0CA 2LP0A 3POGA 2DN0A 2LMDA 1OA2A 4JOMA 3S8PA 4HOBA 4XL9A 4F91B 1W9TA 2BBYA 2L9LA 4W6WA 2ZGLA 1ZRIA 5L19A 1WI9A 5E16A 2Q1ZB 2QWWA 2R062 2QF7A 4NRMA 5FXVA 1TNTA 4I3PA 3HTSB 2CUFA 5HPOA 1TE1B 1RMU1 3VHRA 1EAH2 4YZ1A 4TN7A 3LEIA 4XMAA 3MPBA 1PP7U 4YW3A 3BN6A 1FMD2 5EFUA 4O61A 1JHHA 2LK2A 1BEV2 1BW5A 2OUHA 5ERLA 3PSIA 4II2A 5F37A 5ABJA 4UV9A 3I59A 1AKHB 5BYNA 2K9SA 1WVRA 2A05A 3OSFA 1UYZA 2F17A 4CDXC 3WCRA 3VKMA 5DYMA 4ZONA 2NM1A 1OQDA 1WSUA 3WT3A 4X1EA 5DZEA 4IERA 4L5JA 1F8VA 3DQVC 4HAMA 4KH9A 1ZLJA 3C18A 3BTJA 1NA1A 4L8QA 1DZQA 3X29B 4ZXKA 1JUSA 3UNPA 3KHCA 3O6BB 1Y1VJ 2A75A 1F4AA 3USSA 3HZJA 1UNBA 4LFUA 1QJEA 5ILVA 1RUOA 1W2OA 3JU9A 2BERA 2V4AA 3KCCA 1T0FC 3CCVI 1VRH3 5EEGA 1MNEA 3I4IA 1PK6C 3ZMDA 1MS1A 4RQPA 3IKWA 2DYSH 4XF3A 3VBFC 2VT3A 3LEGA 1J1LA 2MA3A 3QOEA 1VMHA 5L73A 2WS92 1VE0A 1F43A 3F8BA 1NE4A 5KBFA 2IGOA 4LIUA 5FUPA 3TL4X 4O65A 3K7AJ 3I8TA 4DRRA 4DOZA 5BS6A 2EIBA 5E8AA 2QQ8A 4M71A 1FEXA 4N8MA 1C8M2 2BY2A 3ZSKA 2E19A 2QEXI 5FRMA 2DU9A 3G4SI 1LRHA 1UHSA 4MEXF 4PLOA 1LAJA 1JHFA 4LK7A 4Z1VA 1F5JA 5FZDA 1HA8A 4IGQA 4L5EA 1VQ8I 2E1CA 2Y60A 1HKDA 3EO6A 2AXLA 5DUXA 3ECQA 3OY8B 1ETQA 3LOCA 5IVCA 2G7UA 3PO3J 5JXHA 1WCDJ 4XFGA 5GZDA 3U37A 2P6CA 4N53B 2P3JA 3LSEA 2YFZA 3IWFA 5CVJA 4L9TA 1T2XA 4DEQA 4C3HJ 1JI6A 1HJGA 1WCSA 4E7IA 3BIWE 2VPRA 1EA3A 3S32A 1DBNA 3HUGB 5T5JA 2ZMEC 1UXZA 1NCQC 4H3WA 3NAPC 5F8PA 4XURA 3T1LA 3LSPA 2KJCA 4H7MA 1AR81 1JZ7A 1N47A 1BOAA 4LHNA 4EJRA 4CRQA 4W65A 4BQQA 3MFAA 3GCWA 2PHWA 3WLUA 4B7EA 1GFF2 1VJ2A 3OD0A 1ENHA 1QO0D 2BZTA 3SH4A 1UOFA 2ZB9A 1ULOA 2O8OA 4RMNA 1EPZA 2VBBA 5CKQA 1XNDA 2ZJPF 1DYKA 1LENA 4UFLA 3ABTA 1GQPA 5BV6A 3COAC 2BNMA 3SHFA 5A3TA 3H35A 3NW4A 1K5MA 4BJ0A 4K40A 2VC9A 1SLBA 1R1ZA 2DU1A 3ZYIB 4OU0A 4EWEA 1HRI3 1S0BA 5FY9A 4UW6A 5DAWA 2ZGTA 1ASJ3 4AVPA 4MXWA 4BJTA 3BPVA 1B35B 4Y7NJ 4IQ4A 2P5VA 1UZZA 3HHGA 5TRDA 3ZQFA 4RFT0 2NXNB 3NQOA 1Y43B 3S7IA 1HIXA 4DXTA 3S3NA 5EDNA 3N7MA 3JD71 3N7JA 3N9OA 3DTEA 4FHTA 1UIJA 2Y48A 3HOSA 2VZ3A 3RVHA 4Y1XA 3ZFEB 1MR5A 3Q9SA 1VMFA 2VL8A 4COWA 3H8OA 2EPFA 4HW0A 1PIV1 1H89C 4JVAA 3TEZA 1VQKI 3K4AA 1C57A 2RDNA 1DGRM 5FYCA 2ZACA 4LO7A 2JJ7A 4BQOA 3IN9A 3FMSA 3GZ6A 1B8IA 1RMU3 3VDDC 2K7LA 5B2GB 2ARCA 2RV8A 3H9GA 1RPWA 5C70A 5C4WC 2BW8A 4XLCA 2K0GA 4FASD 2YROA 3ZSLA 1XGOA 4ZZ5A 1H88C 5G05L 4AFDA 1UY4A 2BE5F 3LFMA 4D7NA 2QQIA 2B39A 2JKXA 2QJVA 1XMXA 5DD8A 2X53S 1PUFA 1W9WA 2JDYA 4GXLA 1SD7A 4D6SA 2P3IA 1WBLA 3USUB 4P14A 3T3YA 5F64A 2VE9A 4N4NB 1KU7A 3I3BA 1E3OC 4FFGA 4OIRF 1LVAA 5J40A 1AHSA 1RUH2 1QF3A 3KLOA 1JHJA 2GWRA 1ZREA 1YEWA 1W8WA 2DCKA 1UHMA 3HSEA 1FV2A 1KS5A 4BCUA 4CYCA 3KVBA 3MKWB 1IQAA 3J7HA 4AIDA 2AQFA 4UV8A 3WQBA 2XAFA 4HN0A 3CNAA 4DNYA 4MSVA 1TP4A 1JZ5A 4CO8A 1DHKB 2PTMA 2P2KA 4L97A 1PGSA 4ON0A 4XKVA 4A5MA 2XLFA 3EHKA 3JRIA 4AVBA 3DXUA 3Q0WA 2FEZA 2W48A 3AYAA 1FSEA 3C7GA 1NQDA 5HXVA 2M87A 1DGLA 1Z78A 3H3VK 3OL4A 3PU3A 2ORZA 5LY1A 3LWFA 3SZTA 3ZOIA 3KP6A 4OIPF 4AU7A 2WQZC 4IE6A 2K4JA 1TC3C 1W1WE 1LDKB 2H6CA 1KJRA 2ZKZA 3TBDA 3BTIA 3OS1A 5LBQA 2EINH 4XM3A 2XJRA 1TLHB 4YVWC 4QHOA 5ED4A 5DS9A 3HEIA 2E53A 3HDDA 4WM7C 2R16A 1LHNA 5JSPA 1VQOI 1OI6A 3DXJF 1CX1A 5D5VB 3AFGA 4FPHA 1REPC 2PMZA 4NHYA 2VCCA 4G7ZF 5CFCC 4DBRA 2D1VA 5FXZA 4OMDA 1W7PA 4NC8A 1ZHFA 2I5UA 1XCVA 2DU0A 5FZ9A 5C9AC 4IE4A 4X6RB 1ND2B 2R041 3F6VA 3OYJA 2LM3A 2JICA 1VALA 3I2JA 2MABA 4HT1T 3CCRI 2PLV2 2LOOA 1UPIA 5HS9A 1O7LA 3LCPA 4RAFA 3NWTA 1I6XA 2Y69H 4P55A 2ZGUA 1OOPA 1AR83 2VXZA 3CJNA 1H8TC 1V54H 3DPRB 3H0DA 1YIOA 2DW4A 3PQJA 3EYYA 4XUTA 2LSOA 3ITQA 3FK6A 3IMNA 4NPLA 4O5VA 1UF2C 3DKXA 3ZCOA 1RUF2 1IPSA 5LGTA 1KFXL 3J7LA 3KB5A 1TBXA 1ULGA 2EBIA 4HEA2 5L9BA 3I56I 5DPNA 2JDPA 3DBHB 3H5RA 5I91A 4N4OB 3WG1A 1E5RA 2DCTA 1YO8A 2CV0A 2EF6A 3I4NJ 1WA4A 2OUJA 2E7WA 1WPKA 1TT5B 3RG0A 1J09A 1X8MA 3M07A 2QQUA 3MZYA 4XICA 2WO1A 1NCRC 2PQ8A 1B4AA 1K61A 3DUIA 4BQXA 3F0CA 2VQGA 4B4CA 2JB4A 4BIOA 1OYWA 4UB6C 4RGKA 3POIA 2O6GE 2W84A 3CIHA 2YHJA 1QNYA 1YQ6A 1OCCH 4KNYA 1JUHA 1V6KA 4YFNF 2CU7A 4MGQA 1LFPA 4G12A 3TDUC 4D7SA 3QBQA 2VQAA 2I07B 4ZTJA 3JD73 4CDXA 1PO12 4BQ1A 3S15J 1FOD1 5A3MA 4NROA 3RSJA 4MLOA 2VZTA 4MVTA 4M9ZA 5JIAA 3HRMA 4LPLA 2CDPA 3MLLA 1EV12 4CZCA 4WWCA 2CGOA 1PIV3 1I6HJ 1X36A 2DK8A 2K9QA 4QPQA 1QJU2 3CKHA 2XUBA 5JI9A 1RUI2 3I2DA 4Q5OA 3H1CA 1W8NA 4GGGA 3KV5A 1Y4WA 3ZRGA 4BAYA 2ADUA 4ZZLA 5AFEA 4LO5B 3KGLA 4HONA 5I0SA 3V64A 1Q8OA 1NA1B 2OV7A 3I2FA 4I3GA 1QJX2 3O1OA 2AEYA 3IC7A 1PK6A 2WA4A 1Y8QB 1TWFJ 2WQ8A 2BZDA 4E4DX 3ZKUA 5F39A 2R071 5ICGA 3CC7I 3B94A 2W57A 3LB9A 1FBQA 3TYJA 2VQUA 3L2WA 1LTEA 2DOAA 1H6YA 3POEA 2FJ1A 3FBIB 3NNGA 5APAA 5H9RA 1GP4A 4RQPB 1REFA 2FE3A 5J6XA 4XFFA 4LR4A 4ZDPA 5KHKA 4UVAA 1NK2P 1TWGJ 1SLIA 2PMZN 3GTKJ 4OHZA 3RQIA 2WNVC 3CO2A 1YUDA 4JX0A 4Y52J 3HSFA 4ZPIA 5K4LA 2Y26A 2VXJA 2R32A 2RKHA 3BQYA 5FYSA 4NE9A 2BY3A 2V9VA 3AKPA 3Q9OA 1AJKA 4I01A 3D0SA 3I55I 1LNSA 5JMOA 4QIWN 1Y7BA 3DYPA 2OZ6A 1KITA 1O4XA 3DTKA 3NJYA 1OC1A 2A1XA 1XSDA 3ACHA 2PHDA 1O3RA 4YGEA 5I8SA 1W8TA 2VC0A 4QPOA 2ZMEA 1NCQA 4CA0A 2XR4A 4EQQA 3NAPA 5CIRA 1LR5A 1GZWA 4YVSC 1JYWA 1WJBA 3O1SA 1CONA 4FP3A 5IW0A 2ZX2A 4D7MA 2KRCA 5KHDA 3HPNA 3AL0C 4BS9A 1S5LC 4PFPA 2LW8A 3B5LB 3T1MA 1YNAA 4HX7A 3EUHC 3GW2A 2C6YA 1VF9A 4Q4V1 2ZXQA 1HN0A 4FT8A 3VZOA 3SKVA 1GMMA 4G94A 2IXSA 4NMIA 3FISA 1LJ7A 2V1UA 4G3YC 4XFHA 1XC6A 5JXGA 2QTWB 3ZR8X 2R043 1YJWI 1ZA7A 2UXNA 3PL8A 3UKNA 1UOJA 1JTYA 4HG2A 4IXLA 4NRQA 3EYIA 1EYBA 5FLMJ 4GYGA 1I1GA 4R1HA 5KXBA 1JXSA 4B1MA 5DG2A 1ZKGA 3AAFA 2DCEA 4XHXA 1H1IA 2VZRA 4P9LA 4Y17A 1FPN2 1SFKA 3CO7C 2B9VA 4GYIA 5JUVA 4Y1UA 5FJHA 4MXWB 2ETHA 2L3DA 3AFKA 4Y15A 1H1AA 1WW4A 4C0BA 5F0HA 2VMFA 4M4RA 1FWZA 4WVZA 3OL3A 5FPXA 1KQ0A 2TUNA 5K5RA 3LNQA 3F6OA 1ZBA2 5ANQA 4PK4A 4YARA 4IV1C 4U0WA 4HVQA 2JPCA 2Q30A 2Y6LA 3VDDA 4RM2A 3L2HA 2VCAA 5M5XJ 2BWAA 1ENRA 2BP6A 3CMGA 1YHQI 5C4WA 2JDKA 4EYUA 5BUVA 3CQOA 4A44A 2X6YA 3U1KA 4EM1A 4FTBA 2OPKA 2QQJA 2UWMA 2IXCA 5CB7A 1RJ8A 4EN0A 1ZG5A 3K4JA 1K83J 5FYMA 2PXJA 4F3JA 4UXNA 1B8IB 2HEVF 3ZMUA 2VBPA 3TEYA 4CDGA 2PJRA 1J1TA 3IRRA 1BR2A 1TW2A 2YU9J 4JCKA 2TNFA 2W1SA 4BHPA 1FOD3 1MS4A 5IAXA 4DS0A 4EZHA 5IFPA 4XAAA 2WS91 4NIGA 4M3CA 4E2GA 1QZEA 4NOTA 1VMJA 1PUFB 4H14A 4FOQA 3Q8CA 4AAPA 1VQ7I 4XF0A 3TRSB 1YQCA 2FBHA 2ZNZA 4KA4A 1YFXA 5SV8A 4HG6B 4LMYA 4AVCA 4RS5C 1GLNA 4B47A 1KEXA 1RUC1 3PLQA 1J3RA 4K1ZA 3SXYA 2R93J 4XJ9A 1WZ2A 3NSTA 1SVMA 4XYXA 2BVMA 4CU6A 3CJRB 2XAGA 1W0PA 2CW7A 3R0AA 3BROA 4CYCB 2X5IC 1AF9A 3AKTA 2WLPA 4IEQA 4BEHA 2AHQA 5M0TA 2R073 5HDKA 3PL0A 1FOWA 1FTZA 4YG3A 2MPFA 2VB6A 1KU2A 2KHMA 3O0VA 2HEWF 1GICA 1UG2A 2Q8KA 3K6GA 5EP9A 3NV3A 3WU2C 1W7PD 2W2IA 2JMWA 4HSRA 4YM3A 3KP2A 4JZRA 4E8DA 1RL3A 2VH9A 2FBEA 1Z7S2 4AD9A 1V6LA 2Y9YA 4WM7A 2JRTA 2XJTA 1HKTA 2BGPA 4QXHA 3AZXA 2YV8A 3S1RJ 5CFCA 1AR91 3M3YJ 1GZTA 1OHFA 4LB5A 2QQMA 4DB5A 5JOZA 4B8EA 1HW1A 1WW7A 1S0IA 1F2NA 5DZGA 3AP6A 1HB4A 4GAZA 1PX4A 5C9AA 1XMKA 4HOOA 5A1FA 3OGJA 3GF6A 4BLJA 3GZEA 2PAMA 4FSJA 1O8PA 2YBKA 4AGRA 1BVP1 2JJ6A 1W7PB 2YUSA 3UJQA 5LK7B 3H3LA 1KGYA 2W4SA 1R71A 4XBNA 2GNTA 3DKQA 3FE5A 3HC7A 3JBG2 5FYUA 1A5JA 2MD5A 1IGNA 3I3QA 1MS9A 5FZBA 1H8TA 4QGNA 1HCRA 4AWXB 4KMUX 3LPFA 5IY5H 4XDPA 1RKWA 2YC2A 4A5NA 1DQ0A 2E1NA 1IV8A 2CQQA 5M5WJ 2R7OA 2VCMA 5EV7A 1XE8A 3WUDA 5FZ0A 1JKOC 4Q4V3 1S2KA 1OOPB 4BZ4A 4N90A 2ZGOA 3FN9A 2R063 1VBD2 2ZJRF 2K9NA 1OKOA 4WV8A 2LTNA 2DBBA 2K3FA 3N35A 5B1BH 3B69A 3JRCA 3ZXAC 3FHZA 4EN8B 1OYIA 2V1XA 5E1XA 3PIGA 5HV0A 1NCRA 1LOAA 1FMD3 3R0RA 1BEV3 1W5CC 2XQXA 3IDBB 4FQ4A 2K40A 3HR9A 5IT6A 3AFHA 1H2MA 4KBZA 1XPXA 1FIAA 3QU3A 4DO0A 1MMDA 3RZJA 5IAVA 5C5TA 3ZFGC 3CDHA 1QGPA 5JLWA 1GKBA 3SH5A 1JI8A 4HKWA 4QB6A 1U5IA 3V8LA 3BPXA 4KMQA 2ZBKA 1WMDA 1V3FA 4EWAA 5GZFA 1RUH1 1JJ6C 3AZVA 4OHVA 1R5HA 1OPMA 1R1A1 4D8MA 2ZKNA 4P08A 3WDWA 5I93A 4CDXB 2CV2A 4FPYA 4W8JA 5AFBA 3OR2C 4BMBA 3PHMA 2ZSIB 4M9XA 5EIYB 2WWUA 5E1WA 1NAEA 4ZU4A 2BU9A 2XQRA 5K9YA 3FWEA 2KQRA 2DDBA 1UU4A 1OSGA 4CDWC 3IL2A 2FMLA 3I4MJ 1ZR2A 2E33A 1D4M2 2Z9OA 2A3WA 2JE8A 2GNBA 2HZTA 3S16J 2QZ8A 1UAAA 2DAOA 2DO7A 1V6IA 3I3DA 1L7RA 2XROA 2KD7A 3HPGA 4PJMA 3WP4A 3E0JB 1HF0A 1G8WA 1UZYA 2LYCA 3BCBA 1B1BA 4CXFA 1KQRA 3TEDA 1F31A 2WS93 3I71A 1EF4A 1SDWA 3PFYA 1PK6B 3G7DA 3BZ6A 3VBFB 1I27A 1IS3A 2AH2A 1U5TA 1IXRC 2W87A 1T08B 2I10A 5E88A 4LK1F 2OD5A 1X8EA 5LZ6A 1D8KA 2M34A 1QBJA 1TL8A 1PM7A 2WNVA 2OA2A 1TQMA 2XGEA 3SITA 3O8GA 1RUC3 4JDOA 2L9SA 3L00A 2VAUA 1TME2 1R64A 2NMNA 4QDQA 1OH3A 2VUCA 2DFEA 3BPSA 2X6XA 3DEWA 2XGDA 2UWAA 1FXZA 2ATFA 5DQ0A 1ZR4A 4DYCA 2P1BA 2A5YB 1POGA 3E1SA 4YSFA 3SYTA 2DFFA 4D6QA 2PLV1 1RJ7A 4XKCA 2RS11 1BVVA 4YVSA 1YRNB 2KZGA 2DA5A 1IG0A 2ZJCA 1GSLA 1IZ3A 2WQ4A 3BC8A 1HJFA 4CTEA 2IXLA 1IN4A 3AK0A 4QX0A 3ILNA 5FQ0A 4GKYA 1EH7A 2ZMEB 2Q4SA 1Q8PA 1NCQB 1AR93 3EJKA 5FKMA 1QPMA 5KR7A 4KWKA 3EUHA 3HT2A 3NAPB 2TEPA 1LEMA 1MQTC 2XKPA 3U11A 4WF2A 1GZWB 2BDRA 3A2KA 3KCYA 1MMNA 2VZUA 3BTCA 4M73A 1OKRA 3RPUD 4G6TB 2F6BA 3PNAA 2VJ5A 4BQWA 1HXS1 4L0PA 5E18F 3DTIA 4ZU5A 2KIUA 5HXMA 4P5HA 1ZQ3P 4R9AA 1JKQC 4NPMA 2MW8A 4A3XA 4XRSG 1MNMC 1HSTA 5T50A 1QU3A 1I9RA 1I3QJ 1WWYA 1ETKA 5IYYA 1EUUA 3WNXA 4YG0A 3EUAA 3DGTA 3PUSA 1GNHA 5T5LA 2FMDA 3OOUA 1X3ZB 1ON1A 3FX3A 1RXGA 2HDWA 1PO11 2K9MA 1ODNA 1POV1 1RITA 1TNFA 1XB9A 4LBQD 2GN3A 3FLTA 1K5JA 1FZPB 3IMMA 4CGZA 1EV11 3UV9A 3PURA 5AVAA 3EBRA 4IV1A 1LOFC 2MYSA 4YFKF 4MG2A 3ECHA 2GP5A 3SFZA 3ULQB 3CF6E 1RUI1 2DA6A 1XYNA 1GVDA 3ZP5A 4Y13A 2EFQA 3PUIA 1CAXA 1LGCA 3WUCA 1G7YA 2JG8A 2P4WA 5F32A 4FAGA 1A78A 1YWKA 4XMYA 5DM7F 5FKOA 4RSUA 1N25A 1QJX1 5LW9A 3VDDB 5FFOC 1H0BA 4GJZA 2EIKH 3ZQGA 3CLQA 4K1YA 5C4WB 3RKYA 4LBOA 2GIZA 3WU1B 1QXPA 1FC3A 3Q5FA 2JSCA 2RMU2 3WQ1A 3OB8A 1UD1A 3O1TA 2WTEA 5C3OA 3ZN0A 2X4HA 2JK3A 3HKZA 5FP4A 3PFIA 1RUH3 4YFXF 3OGSA 3V7RA 1R1A3 2PJRB 3R4KA 1CIWA 3PU8A 1BXHA 1FT9A 5I8TA 2DMNA 2Z42A 5LGUA 2ZO4A 2QSFX 3F8CA 4UUTA 5IT9K 2TRTA 5JZGC 4L9JA 2ZXJA 1H0MA 3KT7A 3ACLA 3IIAA 4IV3C 2DTZA 3M3CA 4M3CB 4RS5A 1PNFA 1QVUA 1DQUA 2KA3A 4HNVA 2F6CA 2NS0A 2X85A 1NLRA 4A3IJ 3E1F1 1X1DA 2X5IA 5T5OA 3LDKA 4K8RB 3PTRB 4G6QA 3P7NA 2XH6A 3WF3A 5FLVA 2EFOA 2ZNYA 3GCMA 4TSVA 1RB8G 2LBFA 5J1UA 1CGPA 3SEPA 1LKXA 3C2BA 4XPVA 2VQHA 3AVRA 3C2UA 4BU2A 4PSXA 3ZXFA 2EK5A 2A6ZA 2XG3A 3TQNA 4LBMA 4RAZA 3ETPA 3BG9A 1W6MA 3ZXKA 1P7JA 2EIJH 4JHZA 1UZ0A 2XB0X 1VQMI 4S2FA 3HAGA 1V6NA 4AGVA 5G04L 4YVWB 4MIMA 4JP0A 1H6XA 3K4NA 4WM7B 1OUSA 4HQMA 4DYQA 1DIWA 2ILMA 4KIGA 2XBO2 2W82A 4COUA 2VQCA 3KVAA 5CFCB 1IDYA 2D5VA 4DNCA 3R6SA 2NNNA 1FATA 3VYSB 1U2WA 1TNSA 1IG3A 2WA0A 3IDAA 3UK9A 4QMAA 2WZ8A 2PLV3 5KXDA 5E89A 2RS13 5C9AB 1MVQA 1YIJI 2CUZA 2O61A 4CZSA 3G6JB 4F7ZA 1UZCA 1R6RA 1VP6A 3ZMTA 3TO7A 3WU0A 4M3CF 1FPN1 2RS31 5FYZA 1FNNA 1D0XA 2QBYA 2DI3A 1N75A 2XVGA 1JGSA 3GTGJ 3N9PA 1MW7A 4BY1J 3RZOJ 3G2BA 3Q8BA 3EDPA 3O8HA 4PJ0C 1H8TB 2MH2A 2QKDA 5DXDA 4EM0B 1QHDA 2DVDA 2ME0A 1POV0 3KPHA 1ZBA1 2DVGA 4Q4X2 2XSJC 2EFWA 5TISC 1U5YA 1LHOA 3BG5A 3UT0A 3GFJA 5GPCA 4S2GA 1HXS3 1YHFA 2BUKA 1OCRH 1XNKA 5FJ8J 5FFZA 5HLGA 3S30A 2CHHA 3F8NA 2CRGA 3C8XA 4Q5SF 4M6XA 3BYWA 4EJWA 3ZFGA 2VTXA 3KCXA 5KHGA 2EQRA 3LA3A 1NCRB 2RQQA 2MC3A 2K27A 2CSOA 2VZSA 3LFUA 2E35A 1PO13 2RDRA 5FY7A 1VQNI 4BGDA 2WUHA 1POV3 3PJQA 4OYUA 2PEXA 1EPWA 1KGSA 1NUKA 2QUFA 3HKZN 1Q56A 2BWCA 4A7YA 3KEYA 2NYYA 2GH8A 1EV13 1GNZA 1V9U2 1J75A 3ZXEA 4NAMA 1QJU3 1X58A 2FBKA 2HYJA 4KL1A 2ZHLA 2KP6A 3T8TA 1RUI3 5L3EA 4JYKA 4YGDA 3NARA 3WW1A 4CDWA 2JUCA 2MC4A 2AENA 3L2CA 4KISA 1S55A 2QLZA 4IE5A 3D1NI 2AZ5A 4ORFA 2FQ4A 2K5CA 2UU8A 1SC7A 1QJX3 4P5OA 5FD6A 1VRBA 1NHAA 4XNFA 2H27A 1DGRA 1WJCA 1JTZX 5AONA 1L7LA 2F5FA 2KIFA 4Y22A 3LIHA 1WLTA 3FUQA 4KT6A 3OF1A 3CMEI 1D8JA 3K2OA 4FP2A 4R8HA 4HSJA 4BE1A 4KUMA 2HZDA 2JENA 2UY9A 2ZJQF 4LKFA 1WJDA 5BNPC 1GANA 4BBRJ 2BTVC 2WB1A 3PVEA 1DP0A 3AKRA 1FV3A 1PGL2 4BPZA 3UGFA 1PM4A 4EV0A 1E5HA 5IOYA 2RE9A 4QSHA 3MIFA 2P7VB 1WH5A 5JIUA 3WGHA 2BRTA 1XNTA 2J1SA 3DF0A 3TP3A 3PJRA 1MMSA 4FQGA 1ENXA 1AR72 4N9IA 2X09A 1Y9QA 4ZXEA 3OEBA 1H9WA 3VKNA 1QRYA 4R9DA 1MIJA 3VL8A 2YC4A 5JR3A 3MN2A 2UUZA 1RUJ2 3S2WA 3WDYA 4YFWA 5HV4A 2WNVB 4MZUA 4HDVA 1LFBA 3KP3A 3WHUA 2TBVA 4I99C 3AMMA 2C9AA 1AR62 2JWTA 2CW8A 1OCPA 4FISA 2H8RA 1SFEA 3H42B 5D5XB 3KYCB 5DDJ2 4G9SB 3W5MA 4AI3A 1AL22 4ZH4F 2M2EA 2BBAA 1G9CA 5HVQC 3BODA 4G9YA 3KF5A 3O5SA 3ABZA 5JLVA 1QMJA 3JBG1 1O3QA 5LWBA 4HK8A 3K10A 2YUEA 4LLLA 1RZ4A 4B1LA 1US3A 3LSRA 4BDZA 1RUNA 4M9SA 2ZGPA 1MS3A 2BNOA 1GQGA 1MD0A 4K2EA 3OBZA 1MQTA 2IWGB 1VQ5I 5A6QA 4YVSB 4KN7X 5F6LB 2I45A 4C2MJ 4N7IA 2HQ5A 4DEVA 3RIRA 4D7YA 3M8EA 3AL0B 4IE7A 4WK8F 3GTOJ 5FQ0B 3A7QA 2XASA 3URFA 1BI0A 5FO5A 4RR3C 1D5VA 2NS8A 3POJA 3SEEA 3FIWA 5FY5A 3JW4A 3A03A 2OC6A 3ST7A 3K48A 3GLLA 4XACA 1BKZA 1CPMA 2IZWA 4DY5A 1VBE1 2RM22 3UKTA 3WF2A 3NJZA 4OQ9A 1LU2A 2L5QA 4XLAA 3RJRA 2WBKA 4EMSA 3A22A 1RI7A 1FPN3 1F15A 2RS33 1J84A 3VD7A 3DLAA 2BV6A 1K4SA 1HB1A 3SFIA 1GV5A 3I2OA 1G59A 2XC7A 1JJ8C 1W8UA 5DAQA 2D1HA 2D6PA 3KEQA 3ZOBA 5D5WB 1ORKA 3MAJA 1HLVA 4CU7A 2VJJA 4IL6C 1RUG1 1JUMA 1LOFA 1HV0A 1ZBA3 3OEAA 1WJAA 3T0AA 3MW3A 3PSFA 3K77A 3I2HA 5DD4A 3VD3A 4NR1A 1Z6TA 1WKYA 3GHNA 1T56A 4Q1PA 2H94A 5K7ZA 3WG4A 4V2FA 4A6SA 5T54A 2VKHA 1Y3TA 3UKGA 4X8NA 5I0TA 1UW8A 1YFYA 4XUOA 1JZ6A 4IV1B 4AVAA 1D4M1 2XPJA 5BMZA 4LHLA 4L2NA 1DFQA 4Q4ZF 2D5HA 2DODA 3P3PA 3O1MA 1DGRN 3DXTA 4D6RA 3H9QA 3KE2A 2EV0A 3VZNA 1CAXB 3LSGA 1MMAA 5DUUA 2VVDA 1AWCA 2XAUA 2DURA 1XJAA 4QGMA 5GZCA 5F2SA 5DV5A 5K8SA 2HXOA 1GZ9A 1CQTA 3GFIA 1NT0A 2WB1N 5L3DA 3A02A 3OS0A 4HBLA 4J19A 2DUPA 4NC6A 1KDMA 2WT2A 4PI0A 1OLRA 1FX7A 5L7OC 5JZGA 4D3WA 4IV3A 3B9CA 3G6EI 3WQ7A 4IEOA 4GJYA 5CKTA 3EYPA 2VMGA 2NVUB 1P7IA 1Q3EA 3S5QA 2R7EB 4MXVA 4CCMA 2JIGA 4IPAA 1V0AA 1TME1 3ELKA 1S3JA 2OQ6A 1F1ZA 3LFKA 3HEFA 2A6HF 2IS6A 3J8F2 3KZ4C 3DF8A 2E7TA 2DOFA 1JKRC 5FZKA 3NV4A 2R4GA 1X9TA 5B4XA 2HBTA 4RS5B 4JX6A 4HLYA 5FK8A 5HLTA 2FX0A 2DDAA 1LGBA 5A80A 4FBFA 4IRIA 1NXD1 5LA9A 3LE0A 2D6NA 3ZR6A 2X5IB 3ALQA 4ZU7A 4Y4RA 1DGWA 2B7YA 3VEPA 4XILA 3WNLA 4ES8A 2DA1A 4A3BJ 2CQ7A 1MS5A 2XOMA 2VZOA 4XR6A 4NAOA 2AYHA 3CZJA 3WP3A 2DQRA 2LBFB 2X29A 2FDJA 2DK5A 3E6BA 2P3YA 3S3MA 1NG7A 4U87A 3OUJA 3O3KA 2UXXA 3TWIA 1BIAA 1L3JA 4HSLA 3NWSA 2RDSA 4GB32 3CBNA 1W6MB 4A6DA 2F4IA 1SDDB 4P9IA 2PA7A 4QWQA 3VYUB 3VGIA 1XU1A 4XQDA 2VJ4A 1OISA 5I0RA 4CA9A 4QU2A 4LMFA 1NKGA 1OF3A 5FZFA 5GLZA 1XRUA 2DMQA 1K6OA 2ESHA 2P8TA 2WYSA 4XDOA 1S29A 4DOUA 5LASA 3JBG3 3RPQA 4W4ZA 2XDVA 1ZARA 5GZEA 1RRJA 2Q8DA 3VYRB 2RS52 1W6QA 4YPJA 4Z07A 4TV7A 4F3QA 1XD7A 1U78A 4M4PA 5CNAA 1GLHA 4XDQA 1PGW1 2W46A 2JA6J 4MTDA 2JE7A 5HI0A 2KKOA 3NAUA 2EAAA 2OZUA 2QBYB 2IS4A 3PIOF 3HOVJ 1K3IA 3G1OA 3WODF 3MEXA 3TKYA 1YYNA 5LLQA 3CMAI 3HOYJ 3HL2A 2Y9ZA 1ZVFA 4X8PA 3NV1A 1PMJX 1D0GA 3ACGA 2G0EA 1QOTA 4AL9A 2GMPA 5CBLA 4R9CA 3WW2A 1R5ID 2HGCA 3RWNA 1FMWA 1VBE3 3RTRA 2XSDC 4HSTA 3WV6A 4LOCA 3DCQA 1PO22 2XVCA 3U07A 4GALA 1C3HA 2CV6A 3VFZA 1YYVA 3WE3A 1VR3A 3H8XA 3C3VA 2GXAA 3PUAA 3SZGA 2ZAHA 2BW3A 2N8GA 2ZMKA 1M1EB 3ZFGB 3HD8B 1RUG3 4CCLA 1X4OA 3LSIA 3JR9A 5M3MJ 3M9AA 4ABZA 2UURA 1JT6A 1AXZA 5FPAA 2FZ2A 1Z1DA 5KXCA 4CCKA 4Z6YA 3U1XA 3VB9A 4WBBA 2IXIA 4G7HF 3HNMA 2XB5A 4HX8A 3DPUA 5KCMA 2GALA 1S7EA 5FKNA 1Z0HA 5FPZA 1D4M3 2V9KA 4ZYDA 5F5CA 5GTIC 4HETA 5CQEA 3AG2H 2O0OA 5FRAA 2KJBA 4X6QB 4AE2A 3THDA 4IOAF 1BBT2 4MNUA 3FXLA 4V2VA 1T39A 5ICEA 5T55A 2CWSA 2HLEA 4CDWB 3D5LA 2BJSA 4XKBA 3F3XA 3N05A 3GBWA 1UMHA 5BNPA 3O0XA 1PVEA 2AGSA 2XJVA 1DLCA 3V0BA 1LODA 1L7QA 4PT6A 1IPJA 4QQHA 3AMNA 4Y22B 2A71A 5FRNA 4GFBA 4Y1YA 2H0BA 3QH7A 1HQCA 5FWJA 2VBWA 2L7MP 2Z2SB 3JSPA 4I02A 4LEJA 2YFUA 2ZEXA 2V5YA 2FQPA 1SAUA 4XTMA 1H1MA 1WD3A 1YW8A 2G9GA 3FFZA 2W85A 3FXKA 4M72A 4RA0A 1TME3 2YX7A 5FR3A 3K70D 4JKKA 5FDBA 2GMEA 5ABJC 4MFEA 3V65A 5EJ3A 3QD6A 5HCBA 2DQLA 2Y64A 3LAJA 4NPRA 1CZVA 1COV1 2XL7A 2J1EA 3PQKA 3ZQIA 3MKLA 3OGRA 5CYVA 5IWFA 2GBYA 5M3FJ 5FXXA 2X1DA 4IX7A 4Y4YA 1VBB2 3ZO0B 5LA0A 4NNJA 4QX5A 1XYPA 4MO3M 3ASIA 2DBNA 1MSFC 2JA5J 1NY71 3H5NA 2RC4A 1H30A 1QXJA 1FNYA 1QJZA 5JHFA 1S2EA 1IS4A 1G9FA 2K2SA 5K7HA 2R7ZJ 2V79A 2FDIA 2QQNA 1DGWX 2RGVA 1UWWA 1C4RA 2ZX0A 2A68F 2RJKA 1WW6A 2BNNA 1FYKA 4O9EA 3TW7A 2UYBA 4XORA 4IEXA 2VE1A 3GHMA 5A7SA 3GFMA 5FREA 3N36A 2X9DA 3U10A 2LS6A 4RB3C 3JQWA 3FXUA 3TEWA 4DYRA 3WF4A 3V4GA 3O1VA 1ZYBA 1S0FA 4FVVA 4XFBA 4U88A 5FYYA 4H0EA 4C3JJ 3ASNH 3IUOA 1MQTB 4RR3A 2PLYA 4UW4A 5DCMA 2E2JJ 2O3FA 3ERMA 4YEJA 1ONVA 3OV8A 1H2LA 2RDQA 3UJOA 2Z4FA 4JKMA 2D6KA 2HVSA 1LCLA 4EWDA 3Q9VA 2GC1A 2FDHA 1W6OA 1WJFA 2ZGNA 2DFCA 2GA2A 3GZAA 3MUZ1 4FOWA 2BY0A 1ACIA 5D1IA 1CAWA 3N4MA 3QU6A 2OZJA 2HDDA 1N1YA 1OLMA 1ZNPA 3VSKA 3DFGA 4LB6B 1UY1A 3TGNA 2YY1A 2L7ZA 5GP9A 1XDSA 3IT8A 4RAYA 1O57A 5FZMA 3S17J 1HDDC 1V9U1 3VKFC 4UBGA 3H3UA 3DBLB 3RJPA 1LOGA 2JDUA 3CMYA 2XAQA 1AXKA 3E5XA 3EQLF 2O0YA 1WMFA 3LDRA 1ZZBA 2R7TA 5EF6A 3CCUI 2FD5A 2R49A 2JTVA 2YSRA 3HJEA 1FSHA 3LAGA 3HRUA 4I0BA 3ZQLA 4O3MA 2W47A 2Q1FA 5FUNA 5LRSA 4R4XA 1DP3A 5C6CA 2ZGSA 3OBTA 2JD9A 4AQ6A 4BWOA 3H0GJ 1F35A 3S6PA 3AP4A 1OCTC 1OF4A 5A32A 3ZQHA 1MBFA 1Y0NA 4DIQA 4IEWA 1X1BA 1ULCA 1TQIA 4N43C 2PHUA 1O3TA 3MO4A 3PIJA 3VZLA 2VY0A 5GAHJ 3CCSI 1PGL1 3WOGA 2E31A 3TDZC 1JE8A 5L7OA 3MV01 2ME6A 5A3PA 4GQ7A 4YW2A 1V55H 3KMHA 1AR71 2JVGA 3I58A 3OYMA 2Q2EA 1K5MC 1VBA1 2LUWA 1KD7A 4CPBA 4PF1A 5T3NA 3MV11 4ZKTB 3A4UA 2WWYA 5D6FA 2VBYA 3M4OJ 4Y1VA 1OBNA 3GALA 1UYYA 5JZGB 4UWDA 3ON7A 2W92A 2VKDA 5EEAA 5ILSA 3OYLA 3RCOA 4IV3B 2XIGA 4A7ZA 2VVEA 3C2HA 1GBGA 2EIGA 1ZZ6A 3CCMI 3RMYA 3T8RA 1AR61 2RDPA 2HWF2 5A3OA 2OTLI 1BI2A 4PBOA 2JN6A 4LJHA 1VIWB 4XJAA 5DDJ1 2Q1MA 1AL21 3JREA 1RUE1 1F9KA 2J1UA 4I0AA 2VXDA 5C7GA 3CJQB 1REDA 3LSDA 3M1HA 3JZVA 2ID6A 4YYOA 2HWD2 3LL7A 1FOYA 4S05A 2ACJA 3MW2A 1SLTA 3TAYA 2H8WA 1P9QC 5CJ9A 2E1MC 3SEQA 3KP4A 3KP5A 5FZ3A 4YWAA 4E4ZA 3M3EA 3MD2A 3ZN4A 1U12A 3TEXA 5GLUA 2RVAA 2GQQA 5J1RA 1Z21A 4ASLA 2FOWA 5FYIA 2D45A 4Q2FA 2RREA 3SCGA 3GDBA 2IA2A 2O9LA 4RGRA 1A36A 2UV1A 3CJXA 3KWVA 3LWCA 4C1XA 1LVKA 1COV3 1SHWB 4AI1A 1BJAA 1IDZA 2XXZA 1LQ1A 2F5DA 1Q8QA 1EY2A 2ARBA 4BXSV 2J42A 1V70A 5GZGA 1PVC1 5C3PA 3G1MA 2X0LA 3I4PA 4F55A 5HOOA 2D3RA 2E34A 1ZGAA 2IVMA 4WZFA 1PMHX 3MKZA 2V73A 1DDNA 2KMUA 1VQ9I 5H9QA 3BR3A 4P9FA 1NZIA 5D8AC 2MFZA 1G6NA 4AEDC 1US2A 1IGOA 1UELB 5JI7A 2L02A 3K1NA 3LEKA 4BJ5C 4GXOA 5IK5A 5DAPA 1HRV2 2WR9A 2WNUA 2VTXJ 1YJKA 3B7MA 2O1QA 4Q29A 2A70A 3K2ZA 4BMEA 3WG2A 2PMWB 5IP6A 2HKOA 4AI8A 4MQVA 2IFRA 3AX4A 4TLFA 1I50J 3NO8A 2HNHA 4QGLA 4J01A 3N9QA 4LUKA 4UBHA 4COZA 3ES4A 1YLFA 3LF7A 4UI9L 2VC1A 1ZAOA 1UX6A 4MGSA 4ARXA 3WDUA 1UY0A 2J1RA 1W6NA 3G1LA 4V2GA 2Y30A 2NS7A 4KICA 5A2QZ 1X82A 4FFIA 4MGTA 4Z82A 3ASOH 2QZ2A 2JUGA 4EN6B 4RAGA 1IW7F 1CZTA 2Y8KA 3S5AA 3K4CA 2GC0A 3PNTA 2NP0A 1D3YA 4PIXA 3AJYA 2QQLA 3BTXA 2DA2A 3WCSA 5JOXA 3ML6A 4HX4A 3LOBA 2XPVA 3QPHA 1QNWA 3VWBA 2WLQA 3RKWA 3V8KA 5DUKA 1JZ2A 1V9U3 4ZYAA 1BLZA 1SMYF 1HV1A 2B46X 4XRFA 2L0KA 2XF7A 5KXEA 3BTAA 3L2YA 3OYBA 3K4ZA 1KONA 5LD2C 2ORXA 3AL5A 2C9KA 4G4FA 2BW3B 4FOYA 1RUD1 4K9SA 3AXEA 3P6BA 2ID4A 2HOEA 3CP2A 2NN8A 5FUIA 4IXAA 4XABA 2H0VA 4A0YA 5AIQA 4AUXA 3J8F1 2XONA 3BTZA 2V1NA 4AIKA 2WINB 2X48A 4B4QA 1P4AA 3U21A 4RN5A 1EH8A 1USTA 3KLNA 4RGUA 1CD3G 5FD5A 4OHYA 2VTFA 3WW4A 2JRMA 2DDUA 2DVAA 1QJY2 3J7AO 4NVPA 3LSHA 2ZGMA 1R081 1YOVB 1LOCA 1TTYA 4MGRA 4IEZA 1RXFA 3IHUA 1IG7A 3M7GA 2HQRA 1U8BA 3G3ZA 1XGSA 1OVPA 5CQGA 2NVXJ 2P0WA 3CUOA 1H2KA 2VBZA 2PELA 2P4EA 3TMOA 2V4JC 1TMF1 2IA0A 3BUCA 1CR7A 2AREA 5BNPB 1AR73 3P5JA 1VBA3 3GYHX 3V0BB 3RYKA 2R0FA 4KWLA 2XRLA 5BY5A 4FPJA 2WZR2 5EJ1B 5CVVA 4GB31 1AA7A 3ZFFC 4UF0A 5DUIA 4HKOA 3TO6A 2W39A 3J9SA 2ISYA 4P00B 4UT5A 4UFMA 3ACFA 2W1WA 4M3CE 1AR63 3JQXA 1MVEA 2Q5TA 4GH4C 1U5XA 3ZYPA 3PUHA 3RRDA 5DDJ3 1TVGA 2OKXA 1AL23 1RUE3 1A8DA 3S93A 3IB3A 2E63A 1T95A 1MEC2 4Q0PA 1IN6A 3ZYBA 2K46A 2RS51 4A6EA 3ZXDA 1X7NA 4AR2A 4CYDA 4AK3A 5F1RA 2VLAA