4LITA

Structure of ycfd a ribosomal oxygenase from escherichia coli in complex with cobalt and 2-oxoglutarate.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
372
structure length
361
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 102
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4litA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4litA01
3N9QA 5FYYA 3ZPOA 5FWJA 3KV9A 3LDBA 2YPDA 3N9PA 4HONA 5A7SA 3KV6A 5FZIA 5IVYA 5IVFA 3KVAA 4GJZA 5FWEA 5LWBA 5IWFA 3DXUA 4CUGA 5A7QA 5LW9A 2YU2A 2P5BA 3PU8A 3N9OA 5FUPA 3PUSA 5FYIA 5FZ7A 3OPWA 5FXXA 4LXLA 2GP3A 4Y33A 3KVBA 3PUAA 4V2WA 5FYCA 5F3GA 5FYVA 5FP9A 5FPBA 4NUBA 5FYSA 5A7NA 4CCLA 4HOOA 4QX8A 5FZ3A 4AAPA 2OQ7A 5FY8A 5FBJA 4TN7A 5FZDA 5FP3A 5A3TA 5IVEA 4CCJA 5IVBA 4D6QA 4GD4A 5ISLA 3N9NA 4QX7A 5A3NA 4UF0A 4BXFA 2OQ6A 4QXCA 5FYHA 5FY7A 5K4LA 5FP7A 5CEHA 5FYZA 4URAA 3PURA 3PUQA 5FYUA 4BU2A 4QXBA 5FY9A 3PTRB 4BISA 3PDQA 3PU3A 3KV5A 5F5CA 5FZ6A 5FZKA 3OPTA 5A7WB 5F39A 4LIUA 5E6HA 2YBPA 3AL5A 4V2VA 5FZHA 5FYMA 5A7OA 4CCOA 5A3PA 5IVJA 5FY0A 3ZLIA 5FZMA 5FXZA 5FY1A 5FZOA 4CSWA 2PXJA 5F37A 5F3EA 3N9MA 5FY5A 4D6RA 5FZLA 5A7PA 3UYJA 4C8DA 4EYUA 2XXZA 3K2OA 5FZ9A 5FZCA 2XDVA 5A1LA 5IVVA 2YBSA 4CCKA 4GJYA 5FZ4A 5FZ0A 5F32A 5KR7A 5FP8A 4CCNA 5FPAA 3N9LA 3AL6A 3U4SA 5FXWA 5LY2A 2Q8CA 4XDOA 2XUEA 4XDPA 2OT7A 4LITA 2WWUA 4GAZA 3KV4A 4ASKA 5A3WA 2YBKA 3LD8A 4QXHA 5A80A 5F2WA 3U78A 5IW0A 5FZ1A 1VRBA 3K3OA 3K3NA 2WWJA 4EZHA 4Y3OA 3NJYA 3AVSA 5FUNA 5FV3A 4IGQA 5FZOB 5FYTA 4D6SA 5FP4A 5IVCA 2YU1A 4Y4RA 5FZ8A 5FPVA 2Q8DA 5FPLA 5F5AA 5FY4A 5A7WA 4UF0B 3DXTA 4AI9A 4IGOA 2OX0A 4QU1A 5FYBA 5A1FA 5FZAA 5FZFA 2OS2A 3AVRA 4LIVA 5F3CA 2Q8EA 2VD7A 2GP5A 5FJHA 5LY1A 5F2SA 2XMLA 4CCMA 4QWNA 4IGPA 5FZGA 2W2IA 4DIQA 5FPUA 3RVHA 5FZBA 5F5IA 4DO0A 5FJKA 5FXVA 5FZEA 4EZ4A 4E4HA 5ANQA 5F3IA
chains in the Genus database with same CATH superfamily
3B00A 1R22A 1JGSA 5J1RA 4EWEA 3Q0WA 3HRUA 4JX5A 1G86A 2DVBA 3PMEA 4EJTA 1I6XA 2ESHA 3FLPA 2PA7A 3FLRA 1GSLA 3N4MA 3V7RA 3CMMA 4IHVA 2B63J 1KONA 3TEWA 2WNUB 1ODNA 5F64A 5EJZB 1S0DA 3KPHA 3ZN5A 1FNYA 5JOYA 1X3UA 3ILNA 3PIJA 1OVPA 2DDBA 2XGCA 1RUC1 1YFXA 1MEC3 3K4LA 3ZFEC 1SLLA 1YI9A 2R4GA 5ICGA 1LKNA 3WGHA 1R5GA 5E8GA 1BI1A 2C26A 1H9PA 1JH5A 3WU0A 3HOUJ 3L2UA 2PXJA 2D40A 1VALA 5SV8A 5DCMB 2PFBA 5GP9A 3O8GA 4HLTA 3WG9A 1XGMA 3MQ0A 3RZHA 1OLME 3OYCA 5KR7A 3H1CA 1IV8A 4HBNA 4RS5A 2QQAA 4XIDA 2F5EA 3J26N 1WBLA 2PAKA 1ZRFA 1RC6A 3TKYA 1CVNA 2ZGLA 5C5TA 2WN2A 3U07A 5TGTA 3C1DA 5HNFA 3U37A 2LW8A 1WCSA 4YVWC 4QX5A 4G12A 2E5ZA 4HL0A 4Y1XA 1DGWY 3IHUA 5FZEA 3KEQA 1S2BA 1XU2A 2KDOA 1HB2A 4BKXA 5A32B 4OFGA 3WTZA 4ZDLA 2XF7A 1I1SA 4RB0A 5F0HA 2WT2A 2CDPA 2V73A 2HWB1 4QQPA 1V00A 1U5YA 1FOWA 2XG3A 3Q9SA 5I8TA 3HVDA 1UXXX 1Y6IA 2WT0A 3SISA 2AGSA 4UFLA 4WF2A 2HQAA 1DQ0A 5GTIC 1OF4A 4XLNF 4A3LJ 2VG9A 4CDWB 1MDMA 4BH9A 2FOKA 2WS92 4ENNA 4BU2A 4AF9A 1UIJA 2P6HA 5CLSA 2XJQA 2P5KA 5DDGA 1IUYA 4PHZA 2BY0A 4DRRA 3GTQJ 2WO7A 4MIMA 2O8XA 4ESFA 3CDHA 2WO3A 5HXMA 2L5QA 3V56A 2HDCA 2IZWA 1PMIA 2JA5J 1TMF3 4XF1A 1T98A 2HYKA 2E7WA 1MS9A 4WM7A 5FQ0A 2WS93 2UYBA 3LSKA 1MBKA 3FXRA 1LENA 4LBOA 1U5TA 3RZGA 2E34A 3I9V2 1JUSA 3H9GA 3AVSA 3P7NA 3SH5A 2DOAA 1BVP1 1UU4A 2YU1A 3S30A 1OH3A 2ZAAA 2VVFA 3VBUC 4ITCA 5KAFC 5FO9B 2ZMLA 3ASIA 4PDWB 4GB33 3ZMTA 4XBNA 2BEOA 1VBB2 1IZ1A 4Q4V3 1FX7A 1BYHA 5IVFA 1KFUL 4B4CA 4RQPC 1BR1A 3I56I 5C44J 3AAFA 2P3KA 5GZDA 3CLQA 2ZKLA 2X1DA 2KIFA 1VJ2A 2DVAA 1A8MA 3BROA 1XRUA 2Q5TA 4RA0A 2CV1A 1LU2A 3NWKA 2M4KA 1ODDA 1PUFA 3ZFGB 1ZYRF 5A7WB 1FWZA 1UELB 1FOD1 2EAAA 2F48A 4DPNA 3NRUA 5KHKA 3KGLA 5F3EA 2ZHNA 4N43A 1S0JA 1QDOA 1RUG1 3K48A 3WF4A 1J75A 1CJPA 1ENQA 2Q1MA 3JRHA 3T1MA 3S57A 3ZN1A 5K7FA 4IJAA 1TWFJ 3LSDA 4D7NA 2Q8KA 1HRI2 5EYYA 3ZOIA 3BC8A 3BZCA 2B39A 1VAVA 5A1FA 5DQ0A 3Q0VA 2D5FA 2VNVA 2CWMA 1PNFA 3ACLA 4KNYA 2Y38A 5F1RA 3I3EA 3QOPA 2E2HJ 2HWE2 4XDQA 2RDNA 4C3IJ 3K4ZA 3ILFA 1GNYA 5A7QA 3ZQCA 3L1PA 5J7MA 4XJZA 1K5MA 5M5WJ 1V6MA 3WNMA 3BJ6A 1R4NB 3POYA 3K46A 3SQNA 1GUUA 1R1A2 5IVBA 4XORA 1W6PB 1VQLI 2ILMA 4Q4ZF 1KFXL 1NG6A 2A68F 5CVVA 1RIRA 3FXKA 3BYWA 2XAJA 2MSYA 4U0VA 2JDPA 3J7YJ 4B48A 4QPYA 2VKDA 1HKSA 3HM5A 4V2VA 4NC6A 1YX5A 5J47A 2XBO3 3JCIA 1VBC1 5A33B 3LL7A 3RPUD 4LG0A 4BGDA 4IV1A 3T8RA 2K5CA 1CPNA 4A6SA 2ETHA 4AAXA 2K9LA 4ENJA 2YBKA 3H50A 5F2WA 3TMOA 1ONAA 4ES8A 5I93A 2XPJA 3NJYA 2RGVA 5LEKA 4QM9A 3H8RA 2HEOA 1EH6A 3OS1A 2FDJA 3M7GA 1GP5A 1MGTA 2XKOA 1P4WA 3M4OJ 4BHPA 1HV1A 3VBSC 3MCZA 2L9VA 4PI2A 1ZR2A 5D8KB 4E7IA 3NNFA 5EPAA 3M3OA 1CPMA 1EAH2 2P0WA 3EUKL 3WINE 1EH7A 2X5IB 5C7GA 3MN2A 4YZ2A 3OGJA 2VZVA 4W65A 2VZSA 4FTBA 5GZEA 3CU7A 3F6VA 4AE2A 2NP0A 3DQVC 1K78A 1D0GA 2JWTA 5EV7A 3WP6A 2ES3A 3SMHA 2RM21 2QVSB 2IS2A 4OI4A 1WLWA 1UZYA 5KBFA 5JZGC 1KJRA 1COV3 3HEFA 5FY9A 4XFGA 2BZTA 3PDQA 1EAH3 4PJNA 3JTHA 2AZ5A 4XICA 4IQJA 2VVEA 4HLYA 2KMUA 4K8FA 2QQMA 2XAUA 3G1LA 3FXUA 3I3QA 3JUUA 3U21A 4RGUA 5DAXA 1WCQA 1W6NB 2LG4A 2VMDA 2QSFX 4MGQA 3FK7A 1YQ2A 5JIAA 5BNNC 1MACA 5EZHA 2XUEA 1RMU2 2E53A 3V0AA 1ZHFA 5FDBA 3ZFEA 1ITYA 4LULA 3VZNA 2DJIA 5EG0A 2K40A 4Q4X2 2FMLA 1DQ1A 4M3CF 1LGCA 1ETXA 3T4VA 2DMPA 4IE5A 5DEQA 1LEDA 1UKRA 2V9PA 4R9CA 1S6LA 1G8XA 3S2HJ 2MD0A 2ZACA 3DPRC 4BQ3A 3DLAA 1W2NA 1VFCA 4YRVA 3J8F2 4GH4C 2IAIA 1PK6C 3QP5A 1QGPA 1T6GC 3AYEA 2HR3A 2QQIA 2V1DA 2M4GA 4K1ZA 3LOBA 4XR6A 5A7NA 1S55A 3DPUA 2V1UA 2OQ7A 4W6YA 4WVMB 1QNYA 1POQA 3MFCA 3WW1A 2H0BA 2OZJA 4YVWA 2DQRA 1GVDA 3TQNA 5K5OA 4CU9A 5FP7A 1PGL1 4XYXA 4KBZA 2COBA 2VO5A 4GWMA 3NMBA 1XYNA 3J8F3 3I3BA 5JR2A 2D5VA 4GYGA 3CQOA 5B2GB 2PHWA 5JDBA 3SFIA 1FMD2 1H88C 1FATA 1JYVA 4W6WA 1BEV2 3WDUA 3DN7A 4AFMA 3K6GA 4DQAA 3Q8CA 4FCYA 2ZPXA 4LD5A 5GPAA 5FPAA 5CFCC 3CESA 1T08B 1JN2P 1G3YA 5DDJ1 2W08A 2QJVA 3U9GA 5K7PA 4E7SA 4NHXA 1GZCA 1SANA 4BQ4A 3VBRB 1IKQA 2QFEA 4LHKA 2O5RA 4XLAA 5EEGA 4ARYA 3KP2A 1V6NA 1J1LA 3AMHA 1X82A 1O5LA 2EXJA 5TRDA 4NHJA 1G7YA 5KAIC 1GANA 3AFKA 1HN1A 1IS6A 3PNYA 2RMU1 1A04A 4L9TA 1A31A 1FEXA 1MKMA 4E4HA 3IDAA 3SKVA 5ILSA 4RHV3 3OYNA 4E6KG 5DUUA 2WBKA 2VY0A 4CCDA 1QJY3 1JZ7A 1UYZA 2AQEA 1OLMA 3ZQFA 1V6JA 2NQYA 3SDGA 1LU1A 5FP9A 3QD6A 4KICA 4AI2A 2DA3A 1AL0G 3KS7A 1ZZCA 4QX0A 3VBUA 1C5IA 3GTMJ 4WK8F 4LKDA 4Y17A 4IL7A 3RYPA 1H9WA 4QKFA 3VZJA 1QZEA 2PMHA 4QSHA 3ACHA 2WV1A 1F5FA 1RUC2 4BM8A 4IEOA 3K4MA 4NB5A 5E16A 3SEPA 1E0EA 4BBRJ 1PM4A 3JW4A 2JDUA 2VBBA 1MMNA 3H3ZA 5E8AA 4C0BA 4BE0A 4BK4A 3RMYA 3S32A 1FV3A 1OA3A 2BGOA 1P92A 1POV1 2XONA 3PHMA 5EGOA 3X29B 1XU1A 3CBNA 2DFFA 2E2IJ 3HN1A 5T5OA 5I0SA 9ANTA 3SXYA 2ZMEB 4XKBA 2JUCA 3O0VA 2PX9A 5JXJA 1IXCA 1NZCA 1KS5A 3ZSLA 4YZ3A 1NQDA 4ET7A 2BTVC 5IP9J 4G7OF 5FKCA 3OG2A 1SBEA 4XN3A 2R7EB 3H35A 5IYCJ 1SFUA 3T0DA 3C7FA 4RR3C 1O6UA 4NJ4A 2J5OA 4KN7X 2Y6FA 2A1XA 4RDUA 3U2RA 1DPUA 1V5GA 1G8WA 1XE7A 4KISA 3B5LB 3W58A 1I6HJ 3PU8A 2QZ3A 2HWB2 2WL1A 1JMUB 2BNMA 3E1SA 3A22A 5FYVA 1W90A 2ELKA 3WNLA 4JGZB 2UZKA 2FQPA 1ND2C 4XF9A 2G9FA 1HJGA 1Y4WA 3G71I 3KETA 1VQ8I 3ZMDA 3CJRB 4MGKE 4A6DA 1ULFA 4D0QA 5GALA 5FFZA 2RS11 2K85A 4CCOA 2LKSA 4GMP1 1UY2A 1F2NA 3GHNA 3MLLA 4MUVA 3VSKA 4J6GA 4MXVA 3HTUA 3HNMA 5FZCA 3Q8BA 2ICWG 1PX4A 2BVLA 3H9JA 3ITQA 2O03A 4L11A 2PBIA 3CZJA 4QX3A 4CDWC 1JTYA 2YGLA 4L5IA 4IF4A 1Z77A 5FRAA 3GFJA 2AQFA 4OLLA 4JAAA 2JXAA 4QDSA 3ABLH 3F6OA 1FMWA 4KA4A 3J7MA 4HRIA 2G7UA 1FBQA 2E1MC 2MC3A 3KP7A 3R4KA 1YG2A 3ZXEA 2W25A 4Y1YA 4J19A 5FGMA 1WI3A 4CDXC 1PJRA 3OCPA 1OYWA 2VGDA 2WSUA 2LDUA 1D8JA 4Q0SA 1SQ4A 2R32A 2VPLA 4DW6A 1OT5A 4AIKA 3JRGA 2DFEA 2LFBA 1J59A 3OF1A 3A0KA 2VC0A 1V3FA 4NUBA 3DBRB 3T2QA 3ZN6B 4CDQB 2Z9OA 3G7DA 1V9U1 1UW8A 1XC6A 3VBSA 2WZEA 4B1RA 2BRTA 4AHYA 2D3RA 1SDDB 1R081 2GA2A 1V5FA 1YX3A 4QMAA 2YZ4A 1BBT3 5EZWA 2EIBA 4YWAA 5C4WB 2FDFA 3VZLA 3UT0A 3OS0A 4WZCA 3KEYA 4CH7A 4ARXA 3WHBA 1M1EB 1RC9A 3NKGA 3QYFA 1FOD2 1GV9A 1SPPA 4XJAA 2OCEA 2ISZA 3HD8B 3TL4X 2E9QA 2Y0MA 1CAVB 3K69A 1RUG2 1VRH3 1DQ4A 1SLBA 3U4SA 1FBSA 3H8XA 3TOAA 1A36A 1KGSA 5JZGA 3D4KA 3G2BA 3SHFA 3VHOA 4FSJA 4ISQA 1QDCA 1RXGA 1X4PA 3ZFGC 2R061 1WI9A 2RQPA 4L0ZB 3TDUC 1YIFA 3H3LA 2QENA 1AXZA 4IXLA 4GKXA 1BC8C 4LKSA 4M00A 1LEBA 4YIFA 3I59B 3SZTA 4CE8A 2A07F 2I2SA 3RZDJ 1G6NA 4U0WA 5FXVA 5CISA 3A01A 3REOA 1P8JA 5BNNA 1Z67A 1X1AA 1MNEA 4A4AA 3S16J 1KA8A 3N9PA 3IPVA 2UXXA 4HNVA 2XAGA 5CKMA 1AYM1 1VBA2 2VT2A 1J3RA 4XL9A 1X1CA 1HDPA 1KZHA 4IRIA 3OMYA 1PO23 2IXIA 3MD2A 5EEAA 1JZ2A 5FZ3A 2IVJA 4Y1VA 1ZNPA 3F21A 1XDSA 2GAUA 4XE9A 2Z69A 4A3DJ 3HHGA 3K10A 5C3EJ 4XPVA 1HQWA 2P7CB 1P9QC 3OYGA 3VEPA 4NIAA 3DPRA 2QQPA 4AEDC 1B35B 2UWBA 4GH4A 4DMIA 1PGW1 2NYXA 1PK6A 1VBA3 4EQVA 2VKEA 5AIPA 1XD7A 2JVGA 1PX3A 2ZSHB 2V7FA 2TCTA 4I09A 1VBC2 2D6OX 2ARXA 2BHYA 2VMGA 2ME6A 3KE2A 2D7FA 4UVBA 2L0KA 3HMYA 4XCAA 3EHKA 1K83J 3NSTA 5J3LA 3AYDA 4MLOA 4EJRA 4A3CJ 2A69F 2WAQA 3I2JA 5IP7J 5J40A 3FE5A 1CAWB 2B4KA 1SC7A 2HQNA 3QLQA 1ZYBA 1Z0HA 2ME0A 2VU9A 1AHSA 2D93A 1GU3A 3VBFC 1YJWI 4I3PA 4PIXA 3ZM8A 4LHSA 3DU6A 2LY9A 2P7VB 2XAQA 2LYCA 3MBWA 3AKZA 3H1MA 4P00B 5F5IA 5CFCA 2HTJA 3K77A 2ZNZA 1YC61 4FISA 5BOXA 3B01A 4PQQA 4QWQA 3CC4I 5DXDA 2QBYA 1B8IB 1ZRDA 2K4JA 4CCMA 4JQTA 1Z7S3 3I2IA 2X51A 1Z7UA 1G3TA 5BPIA 5F1JA 4Y20B 1YE9A 1D5VA 3FISA 4JHZA 3M3CA 2VQGA 4OI2A 2RM22 4H2AA 4GWIA 4RL7A 3BR2A 1ZK8A 1GUIA 3CCLI 4MTDA 2WFPA 5F5CA 4ITVA 4YM3A 4DB5A 2NVYJ 1CQ9A 2XB6C 3EBRA 1GP4A 1Y0NA 3MPPG 2ID4A 2CW8A 1DZRA 3CD6I 1EJ9A 4GJYA 1US3A 2K0GA 4LMYA 1E5IA 5FD5A 1D0XA 2E5NA 4PLOA 2M45A 4QPGB 3CF5F 5IK5A 1HJFA 2J1EA 1JHNA 1ACIA 3N35A 4CGZA 5A2QK 2GMPA 3UKNA 2X4HA 1KDKA 3QCWA 3T5XA 1VQOI 3K4AA 2DXIA 1YXWA 2YS9A 1OFNA 1VAMA 2Y9ZA 2R0HA 4XABA 4LFUA 3CLPA 2VIXA 4LE3A 4NC8A 4A3IJ 2R071 1E3HA 1Z3YA 3LA2A 5JSPA 1AR83 2FZ2A 5F0CA 3IRRA 4Z2WA 4E27A 5AC91 1X2MA 2NM1A 3I2OA 1HQCA 4R4ZA 2VKVA 2ZEYA 2KFDA 1GBGA 3F23A 3N7KA 2V1XA 2VZUA 1WA4A 5ABJC 2BOLA 3AXDA 2DF7A 3VD4A 4RR3A 4LPLA 4PCQA 1IO2A 3F0CA 3PQJA 1CF7B 2LVSA 3OYWA 2ZX3A 4COWA 4NR1A 1V4RA 2VBXA 1R71A 1YJLA 4AFDA 5FZKA 1X3WB 4BJTA 3UK9A 5A3PA 5HCAA 4RS8A 4XVHA 1KYZA 3BTJA 5T5LA 2NS7A 2O3FA 3CIHA 1REFA 2YG0A 5IVVA 2BFUL 1ND2A 1R093 2HU9A 2W00A 1QIQA 5DDJ2 3QODA 5A32A 1QJEA 3G3ZA 2M1BA 1YOVB 1G9BA 3LSGA 3USUB 2WO1A 1WW4A 3Q9OA 3RDIA 3PVBB 5BUVA 2EFWA 3B3QE 3ZYIB 2VT3A 4I2OA 4OIRF 1DP0A 1AJOA 2HXIA 1UU5A 4BLJA 1LPQA 2MC4A 2RMU2 3JRAA 4Y7NJ 1RUJ2 2JE9A 5IATA 3FM5A 4M9XA 3ISPA 2WKKA 4CDWA 2HGCA 3V0BB 1EUUA 3MIEA 3VBRC 3JBG1 2TBVA 2YU2A 3LFKA 4FASD 1HB1A 4H0EA 3ABTA 2DURA 3NAPC 3NV3A 4AFCA 1R1TA 1UAAA 2ZX2A 3BWGA 4FPLA 4IPAA 4CDXA 4WM8C 1RUJ3 2VOWA 4A3EJ 1VQNI 4OHXA 2G9ZA 4Y26A 4UW3A 2KZVA 1XTAA 2P34A 4G6DA 5FPXA 1QA6A 1UX7A 4BCUA 4BK5A 3K4DA 4LKEA 2QA4I 4AVTA 1F9KA 4X0GA 4LO8A 2R93J 5HCBA 4MGRA 1AR93 4G4FA 2F4IA 1ZZ6A 2ETEA 4C8DA 1FXZA 4LT5A 1KEXA 1DCSA 4LBLA 5F32A 1JHFA 2HH9A 1XE8A 5H9SA 3ORJA 2KRFA 4ZZDA 2H1KA 2H1LA 1S0BA 2F4OB 5JXHA 4I3GA 2K4BA 3NRVA 1Y8QB 1ENSA 4ZU4A 1LB2A 3H3VK 3S1NJ 3SZPA 5B3SH 4HK8A 1RNLA 4JBAA 4WXCA 1QVUA 4IGPA 2QE3A 4H4KC 4L92A 2G9GA 3NARA 3NW4A 2NYYA 2ZS6B 1A34A 2ZMEC 4OQ9A 3WV6A 2PMZA 4UFHA 2B9UA 1BOBA 4UB8C 1VB2A 3PUIA 3ZFGA 1SDWA 1AJKA 1Q8PA 2WZR1 3WTXC 2CSGA 3KYLA 4PIYA 1FI2A 4Q4Y3 4XUNA 1BIAA 1DBNA 4L0PA 5FYSA 3BY6A 5FBJA 3FBIB 5ICEA 4LBQD 1RUE1 4H55A 3VYRB 4V2GA 3TRSB 2RG4A 2CG4A 1XS9A 3BIWE 2AENA 1QO0D 1BLZA 1TNTA 4FVVA 3HGGA 3M07A 4XFAA 2RS12 2RNGA 2WNOA 1LOBA 2WQZC 3TOJA 1UZ0A 4JGZC 4C3HJ 2M34A 1PGSA 1ERDA 3P9KA 3CCSI 4N8MA 4F93B 3K7AJ 1N78A 4Z92B 3PO3J 3QPHA 1JYNA 4EN7B 5FXWA 5ACA3 2DFIA 2WYSA 1RUF1 3I3LA 2W24A 4AEDA 2YY1A 2UWCA 1CIYA 2JDYA 1K12A 5DUXA 3ZR5A 3N7MA 3SLIA 4UF0B 1W99A 4C91A 3IDCB 3BR6A 2P3IA 1JKQC 2XKPA 2PN6A 4MV2A 3OYEA 3HBKA 4Y5Z0 1YUDA 4X6QB 2GQQA 2D43A 2EV5A 1MS1A 2HZTA 3TEDA 4UW4A 2IA1A 1DZQA 5CG8A 2VBZA 1O4ZA 3VZKA 4L9VA 3TN91 1LDJA 2P6SA 4AVVA 2HWD2 3ZDVA 3OD0A 3VBFA 1VE0A 4IHYA 2DMUA 1V9U2 4BJ5C 3MEXA 4U36A 1U5IA 2BERA 1Y9GA 4CXWA 1SD6A 2CQQA 4UFMA 2ZEZA 1FLIA 1XNAA 2BXYA 4HSRA 1O3RA 1UYYA 4N53C 2LR8A 1ZG3A 1KU2A 2GC0A 4Q4W1 4XBLA 1XSQA 4Q0QA 1UOBA 3L9FA 4CDQC 2HWD3 2GM4A 2XXZA 2XV4S 3DKQA 2B7YA 4IEQA 1RHI1 4JKLA 4LKFA 3K1MA 3HOVJ 1X1PA 1Y9MA 1E3OC 5C4WC 3TW7A 4OINF 3P9IA 1VBD1 2R062 2X5IA 2B8MA 1P6RA 2ARAA 2Q8DA 2OIIA 1GLNA 2CUZA 5F3CA 3LCPA 5FJHA 5DAPA 1QZZA 1J58A 3ZMZA 1F4KA 4JDMA 3QH7A 2W5FA 1GHCA 1VTNC 4Y24A 4XACA 3Q9VA 3IAQA 3LWFA 2ACJA 5H9QA 2R063 4R9BA 4I99C 2K27A 2LMDA 1XYPA 4ZYAA 4UV9A 4HOOA 1NUKA 1WMEA 3SYTA 1I3AA 3KZIC 3WHTA 3RJRA 2HDWA 3LAGA 2EICA 1QH6A 3FZVA 1FYKA 2AREA 3ZMVA 4EJOA 1F4AA 5T52A 2JWPA 3RJPA 4XAAA 5BNPB 2RE9A 1XNBA 2WWSA 3M9AA 2Q2EA 2FMYA 3OJBA 1XDUA 2M0CA 4LR4A 2EFQA 2DT6A 1PGW2 1TL8A 3OEAA 3O0XA 4NPMA 1C4RA 5CVIA 5FK7A 3A03A 1YW9A 4XEZA 1Q8SA 1JYIA 2K86A 3FBYA 4U87A 2BY2A 1SLAA 1A6CA 5ABJA 4XRSG 5DABA 2G7HA 1W2OA 2DTWA 5KHGA 2ZXQA 2E7QA 1Z0XA 1W3VA 5A3OA 3H5AA 1SLTA 1UZWA 1B35C 3BZKA 4K9SA 2DU1A 3RSJA 5KXBA 3C2GA 3KT4A 4QPOA 2DCJA 4XRMA 2F6CA 3AZXA 4YPJA 2EIJH 2VB6A 3SHRA 4K21A 2YDEA 4M0HA 2VMFA 4XJ8A 2R7SA 3WNPA 3S5AA 3L09A 3OGVA 4CVUA 2CJJA 3CJNA 2CYYA 1FPN3 1NTCA 1SFKA 4OOIA 3KM5A 1IRGA 1HIXA 3WGIA 2W39A 3K2ZA 2VLAA 3QP6A 3IAS2 4FAGA 1RUOA 2CAVA 3GZAA 1MS5A 3C7OA 3VHPA 1T56A 1UG2A 3RYKA 3S7IA 2XLAA 2VUMJ 3KZ4C 3D6EA 4W97A 3I58A 2JRMA 4AI8A 1OYIA 4B1LA 2PLV2 4OUEA 1UO9A 3DU5A 3VBRA 4BDZA 3WTUC 2F4MB 5BPXA 4GRIA 3NAPA 2JN6A 3N9MA 3AYAA 4CA0A 3LGRA 4UB6C 1ACCA 1S3JA 1G59A 1YIPA 3MFKA 4IDZA 5HNHA 4HN0A 2BOIA 4WM8A 1BCXA 3QYEA 4RB1A 4ZDPA 3ZXFA 4HX7A 1FAYA 4Y5TA 2PLV3 5F08A 1VR3A 1EA3A 1EY2A 2OUMA 2EH3A 3FZ3A 3RIRA 1TME1 3TB0A 3LFMA 5C3RA 1OH4A 2XGEA 1N3PA 2AO9A 4A3KJ 4FBFA 4XIOA 3AP5A 2R072 2M9HA 4QB6A 1RUI2 4ZU7A 3J7NA 1GZWA 4PF5A 5AC92 5B4XA 4CA9A 1K61A 1ZBE3 2N7GA 1NHAA 4XJWA 3ZKYA 4B7EA 4HKLA 4ONUA 1TNSA 3CMAI 2ZGQA 2OW4A 3PNVA 4LK1F 1TE1B 1ZARA 2Y26A 3E6CC 3FMQA 2ZMEA 3BTXA 3QWLA 4RGRA 5EFUA 1MPXA 1RUI3 2YBPA 2P5LC 1P4AA 1UMHA 4YEJA 4X8NA 1BK0A 5F9TA 3LOCA 4XNFA 1DGWX 2O0YA 5KHIA 4BAYA 5E89A 2K46A 4B7KA 2XVCA 1UHSA 2ZKZA 3VD3A 3L00A 3BJOA 2XJRA 1OOPB 4A3BJ 3VBOC 3JRIA 4FOYA 3LEMA 4XMYA 5HDKA 3I4NJ 3EMRA 3ETQA 1D5YA 1W6OB 3A2KA 1SAUA 1QJZA 1M06G 1S4CA 4CEYC 4XC9A 2KJCA 2L7MP 2MGQA 2DCKA 4GA9A 3DKYA 1APNA 4JGZA 1JUMA 1WZ2A 1AKHB 2WA0A 2XSDC 4DFSA 5LFAA 2R7XA 3MDPA 1QHDA 5JMCA 4KQ7A 4XQWA 5DG1A 3ACFA 2HTSA 1QXRA 1FTTA 5J09A 1JU3A 5M0TA 1BJZA 1KQ8A 1AYN2 1UWWA 1QJX2 1SD4A 1MBGA 5J48A 3H92A 2EXKA 2RNJA 4BOWA 3MKZA 1QQIA 1LJ7A 1DQ5A 2YX4A 1OI6A 2QQ8A 3WTYC 2JDMA 2JIJA 3WHUA 2CQ7A 1N3QA 1ZG1A 4Z82A 4Q5OA 4YFNF 4BE1A 2QQBA 2EBIA 2DCZA 3WDXA 4MGIE 1HKQA 1N1YA 2CHHA 3DECA 5FYMA 1YEWA 1TQIA 1AYN3 2NVXJ 3CNAA 1QJX3 5LK5A 1FY7A 1SMTA 2HWC2 1GNZA 2BU9A 5DD4A 4TWTA 3K2OA 4MGSA 5EWSA 3HOSA 4XBFA 2F6BA 4AL9A 2QSHX 3M3YJ 4N4NB 1YITI 4YW6A 2CY6A 1ENHA 1T33A 4EV0A 4N53A 5IJRA 1UX6A 3AJZA 1WPKA 3LSEA 2YC0A 4PGGA 1OUXA 3VDDB 2HWC3 4UYBA 5JHFA 4ESJA 2WT1A 2QZ8A 3ZN6A 4CDQA 2Q8EA 4M3EA 2LBFB 3IZOA 1UKGA 2HS5A 3ZSKA 2FBIA 1XXNA 1C1FA 1AX1A 3SCGA 2VULA 3TEZA 4IQPA 3I4MJ 4YZ1A 3BALA 3GALA 1IN6A 2W48A 3HKZA 4NE9A 2KIQA 5C4WA 3DXUA 4CYDA 2QNKA 2KZGA 1VMJA 2WZR2 5L3DA 1QQP1 3WTTC 1VBE1 2BQPA 3JREA 1YLFA 3HN3A 1PIV3 3AFGA 4EM0B 1AL21 2WNVB 4FTEA 1XMAA 3ACGA 2PTMA 2L7FP 4PJJA 4AI1A 4AGVA 2OCCH 4ZYHA 4FE7A 3LSTA 3OSGA 1V6LA 4A5NA 1FSHA 1I1GA 1UPIA 2CGPA 1YS6A 4XFFA 4P9WA 1JZ3A 3HBZA 3TBDA 3RPQA 4TXWA 4EN0A 2KRHA 1X3ZB 1NY71 3ERMA 1XB9A 3PL8A 2BW8A 2P8TA 2E2JJ 3BN6A 2JMWA 3BR5A 2H0VA 2YMZA 4ASMB 1T6SA 1OA4A 4A3GJ 2HPMA 4RGKA 3L2RA 3VHNA 2Y9YA 2E51A 4C90A 2ZGTA 1RUF2 3OL3A 1ETYA 2VE8A 2MEV3 1AR61 3ILRA 4GWJA 2MH2A 2X6YA 3V64A 1YJ9I 4II2A 1RZ4A 3GEZA 4UNOA 4CZSA 5FLXK 3P6BA 2ELJA 4MYEA 4IV3B 5HOOA 3WT3A 2J22A 2V9KA 5FROA 1HB4A 5DPNA 3ZMNA 2O1QA 3M8LA 2CGNA 1B35A 2YC4A 4ZXKA 2AACA 2SBAA 3H7YA 5KXDA 4NPLA 2ZAHA 1RIOH 4KUMA 4UAPA 4Y33A 3LFUA 1W28A 1WW6A 2OPWA 5HLHA 3MGUA 5B4NA 5I91A 5CQEA 1VLNA 5FOJB 4BNCA 2Q30A 3ABKH 2ZO4A 1S0GA 5B5EC 1AXKA 4XQDA 5FLMJ 2B9SA 2PFWA 3GHMA 2EWNA 2AUYA 4BISA 2B0LA 2XUBA 4Q8LA 2OU2A 5A2QZ 1HKTA 3CJIC 1WGPA 2FDHA 3RQ4A 2ZHLA 3FK6A 1T39A 4Q4W2 3NJVA 1BI3A 3EETA 2M0MA 3D1NI 3ZN4A 3KZYA 5LD2C 2RN7A 5GZGA 1RJ7A 2EIGA 1WJAA 1ZR4A 1AUYA 1RHI2 4CUBA 4COVA 5GPCA 4Q0UA 1BR2A 1ULYA 3P3NA 2ZKNA 2JEMA 2LKPA 4Y3OA 3NO8A 1D4M3 1B8IA 1VBD2 4IGQA 1KU9A 4Y4RA 1RUH1 3QQAA 5JR3A 5GAEJ 5CYYA 2LC2A 5CQGA 2D3PA 3NNLA 1C8M1 5I8SA 3LF7A 1YFHA 3CC2I 2CU7A 3MF6A 1MBJA 1HXS3 4LLOA 4HXCA 1IPSA 3P5BA 1SFOJ 1N1TA 5CVJA 5J1UA 1HOMA 2PG4A 3USSA 1HW5A 3ECQA 3IM0A 2CUFA 5LGUA 2YUSA 1CGPA 4HQMA 3H1YA 2WABA 1TZOA 2XJPA 1D1BA 3U10A 2XLGA 4AI3A 3O6BB 2BHZA 1U8BA 3H0GJ 5L3GA 2C24A 4YW1A 4A12A 4DRVA 1OCZH 5LBEA 3AMNA 1QJU3 4R1HA 3K4NA 4JV4A 2KKOA 1CN1A 2JVHA 3TO9A 5JVVA 1SVLA 1ODMA 3DYOA 3N9LA 2VCMA 4XQFA 2ZGSA 3T0YA 5F0FA 2XASA 1D1CA 2J1TA 4LLNA 2DVDA 4FXKB 1U8RA 5FP4A 1BC7C 5IVCA 1WGXA 3OSDA 1K42A 3D0JA 4ZTJA 2MNGA 1W2TA 4BWOA 2V4AA 2VJJA 2G0EA 4WVZA 4QPIB 2WFF3 1EPWA 4CDUB 4FE4A 1X8EA 1J3PA 2HYFA 3N3HA 3VBOA 4CEWB 1L3LA 2CS3A 2B46X 2EV6A 2WWYA 5IVYA 3BTCA 2UYAA 1WD3A 1K4SA 3VDBA 3B02A 1JKRC 5JSOA 4YVSC 2ZBKA 1RVF3 1OF3A 4IW3A 4PGHA 2CRGA 5FMCA 4RBOA 1WLCA 4CEYA 1XNDA 3POWA 1NOVA 4QQLA 2O7OA 1LFUP 1ND3C 2ZGUA 4E8DA 1KGYA 4GD4A 4JQFA 4KWKA 5K4LA 3MIHA 1W8OA 1RB8G 3NQHA 2HYGD 1VQMI 5KHDA 4NC7A 3WG4A 4M3CB 4QXBA 1X1BA 5LHGA 1KD7A 3NVCA 2CUEA 4NDLA 2IS6A 2HVRA 2XPWA 4HANA 2DTZA 2Z42A 4AC0A 3LDRA 2W82A 4XOPA 1E3PA 1IXSB 3OGGA 1H1MA 1R7JA 3I7DA 4XSZF 3V8JA 3OSFA 1TQ5A 2FD5A 2WZPP 3AFHA 2JK3A 2QQ9A 2Y75A 2OT7A 4BA6A 4F7ZA 3Q5FA 3TNPB 3OGSA 1ZBA2 1APLC 4HDVA 3K70C 1W2AX 2Y33A 3RI4A 2FBHA 3VYTB 1FOXA 1ALYA 2OBPA 1OPOA 3WLUA 1CAXB 4FPEA 3B6AA 2R7WA 2W47A 4KG8A 3ME2A 2HOTA 3RSNA 3KP4A 5FMBA 5ANQA 5FYYA 1X58A 2LK2A 1R36A 4HX4A 3UGHA 4HONA 2LP0A 5FWEA 4P9FA 5LASA 1ZBA3 4F55A 2D1VA 4LO4B 3COAC 3ZXGA 4OIOF 2LY2A 3OY9A 5JWPA 4JKMA 4FI9A 2DV9A 2DAOA 4QT6A 5GKAC 1XGOA 1UZVA 2OVUA 3M8JA 5FY7A 1ZGJA 3ULQB 4R9AA 1QPIA 2A6VA 3OV8A 4KT6A 1YS7A 4CDGA 3HDDA 1DQ6A 1RPWA 4OMYA 1A8DA 5EF6A 4J1WA 1DGRN 3PL0A 3WW2A 1S2KA 4ZXEA 5HV4A 3PFIA 1YYNA 2W92A 2ECCA 4B3AA 3C2BA 3JAMK 3ALQA 5I0TA 4L9NA 3BPXA 4HSLA 5F27A 3K51A 1FMVA 4OUSA 1G9AA 4CP9A 2Y6KA 4A0YA 5E3MA 3HC7A 2E1CA 2WSVA 3R0AA 4KIGA 3T0AA 5C4JJ 3PVEA 1NZIA 1UIKA 3MAJA 5LBFA 4OUMA 5HPOA 3JCUC 4OAZA 5F6KA 2E63A 2OTLI 3WQBA 5I0DA 2E35A 5C8CB 2ZGPA 5GADJ 1LTEA 5FR3A 2RREA 2RR13 2O14A 2LTNA 3HG9A 3HQXA 5CYVA 2ZC2A 1EPZA 3HPGA 1W9YA 2EINH 4H3WA 1JUPA 3WP4A 4IEWA 1A6IA 2OKXA 2WBMA 4Q47A 3DYMA 3ROUA 2YROA 4NQWA 1TW3A 3PUAA 1XYOA 2MABA 1ZG5A 3GFMA 2NVTJ 1JE8A 1QZYA 3UGFA 2GNTA 3DGTA 3JB4C 3EUHC 3GTLJ 4AVCA 1UYXA 2UV1A 2A61A 1LEMA 2DUOA 3JRFA 2RS51 2VASA 5JOZA 5FK8A 2YPJA 3VKMA 1AR71 3IL2A 1XGNA 4YM1A 3O1TA 3DEWA 1MD0A 2AXTC 4LTAA 2RS31 5DZGA 2DCTA 1IRXA 2EK5A 3AG2H 1SFPA 3JSOA 1DP3A 3RQ0A 3DFGA 1H8TC 1YHFA 2M5WA 2Y8KA 1HN0A 1TTYA 2FDGA 1UCRA 1JOPA 1O7LA 4Q29A 3BUCA 4N9HA 4DOZA 1H9GA 2HLEA 3LEKA 2IPQX 3ABMH 5DM6F 2MG4A 4O65A 5JR7B 1HRV3 3WQ1A 5FV3A 1H89C 3V42A 3CJIA 2KD7A 5A1AA 3BPSA 3VWBA 2HZDA 1UMZA 2DCYA 3BOPA 2JIGA 4YZ5A 4AW7A 3U14A 5J8CA 3HRMA 4LK6A 4LO5B 4A3FJ 1UU6A 2BVMA 3ZMOA 4P55A 5JPMB 2VXJA 1YYVA 2PQSA 4YGDA 1DDLA 1QQP2 1VBE2 1RUD3 1QWRA 1UY1A 4TN7A 2AXLA 1I39A 2PMWB 3SNMA 5CFDB 2JD4A 2DUPA 2H27A 3S2WA 3KSCA 4O9EA 3SC7X 5CKQA 3PUBA 5T3NA 3DBLB 5BNGA 4QGLA 3NV1A 2BW3B 1HLCA 2G9WA 4BQWA 1ZKGA 1AWCA 1IHMA 3ZIWA 5DUWA 1USTA 2JTVA 1CONA 4C1XA 4N7UA 5JCTA 3E0JB 2LALA 2DFHA 3VSLA 1FIAA 4A7ZA 4NOTA 2L54A 4LBQB 2IXKA 1W5CC 4A69C 3LNQA 2H94A 1VIWB 3K3NA 1F35A 4P9XA 4HA8A 2IXSA 4LHLA 2JSCA 4G94A 4GCVA 1IGNA 2OC6A 4AGRA 2C4XA 3SCFA 3CF2A 2R043 3OYDA 3WF3A 1JYXA 2XL9A 3H0DA 4UFIA 2PYTA 2E33A 4KDPA 4L18B 3DCQA 4OIPF 5A7SA 1TWCJ 2XJUA 2ZEXA 4B8XA 4MNUA 1R5HA 4F3QA 5T5PA 5LW9A 1V54H 3LSHA 2CAUA 3MIDA 3FF5A 5F3GA 3VKOA 2PN5A 4ZYDA 5T54A 1UJ8A 5IVEA 4HSJA 1W9TA 4D6QA 4FOVA 4FOQA 2VMHA 1Z1DA 4IV3C 3IKWA 1WH7A 3D8CA 5K0UB 3RWNA 3BB6A 3UESA 1UCXA 1YFYA 3KV5A 5CKNA 3THPA 5DN2A 3O2PE 5IAVA 4EGYA 1LOAA 1VP6A 4LOTA 4YVSA 1YTYA 1PYVA 4XKWA 4R52A 5J98B 4RAZA 2XGXA 4SBVA 4D9JA 3UYJA 4R9DA 1ND3A 5A1LA 4K8RB 4LUMA 3BG6A 4C2MJ 5LA2A 3UKTA 4LA3A 3HSEA 2L01A 2K2SA 3Q8FA 3CMYA 4D69A 4I01A 1SCSA 2GDFA 4QXHA 3WDVA 4PK4A 1WMXA 4XQ4A 4FPFA 1U0JA 3U1KA 1BW5A 2AH2A 3HAGA 1PP8F 3HQRA 4D7SA 3THTA 1RUH2 1XNKA 2KP6A 1CX1A 3GTOJ 5FMDA 1LCLA 1C8M2 4FFGA 2ET7A 4RGXA 5CNAA 1GVJA 1YQCA 1U78A 1EV13 3U1XA 5F3IA 2UWMA 5JSRA 3KEOA 1UXZA 2F4PA 4FQZA 3KV6A 3WTWC 5JFRA 4CCEA 4QQOA 2P5BA 1G2HA 1V0AA 5GAHJ 2GP3A 2LREA 4TLFA 4BDVB 4YFXF 3DTIA 1SACA 1JXSA 4QX8A 1ASJ1 2FQ4A 4MZUA 3DKWA 4KI5M 3BR1A 1LE8A 1X33A 3MZ8A 3F8CA 3PMSA 2HWVA 2XVKA 5J3UA 2XQRA 1IQDC 3LIGA 4KT5C 3T2TA 2CQKA 2RQQA 5J4YA 4FCAA 2ESNA 4M3CE 4KWJA 3OTFA 3FKJA 1GZ9A 2VJIA 3SDBA 4BMBA 2DCEA 2HWF1 1JGGA 3NNMA 1ST8A 5EJCA 4G7HF 4KGQA 3MEPA 2L9LA 1MZEA 3HQUA 3JD71 1TT0A 3GTPJ 1S0IA 2E60A 3WCRA 3QU6A 3BU0A 1QOSA 2QUFA 4BZ4A 1CAUA 3O12A 2TDXA 3AJYA 2YR2A 5FPLA 2KDZA 2OQGA 1HXDA 4HOBA 3AVRA 2R6QA 1KU3A 2DUQA 3CCVI 4JK1X 4B4PA 2O6GE 1WBFA 2VW0A 4UUSA 1BM9A 1WJDA 3GF2A 3TBIA 5FWJA 4A45A 4AQ6A 3H9QA 4A6OA 2RHPA 4GJZA 3GW2A 4CUGA 2C9KA 5IFTA 3RFRA 4W50A 1WCDJ 5JVTA 4GYIA 1FV2A 2HKOA 1PHMA 2JRTA 3BTYA 1NG0A 2ERFA 2E31A 1PO11 3QH6A 4CDUC 3G1MA 4WM7B 3ZRGA 5F04A 1F5TA 1W9SA 5K7ZA 3IN9A 5JOXA 4CPBA 1YIJI 4CEWC 1XBFA 1BI0A 2RKHA 4I7HA 4L2NA 2JDNA 2NVUB 2QQLA 4UFJA 4CUAA 1WLTA 3HUGA 1W6OA 2KL4A 4GMP0 2A70A 1W6QA 3J7ZI 3JSPA 1FIPA 3I54A 3QYBA 1D0YA 1AKHA 1KITA 1JUHA 4BQ2A 3D5OA 3HJEA 1DP7P 3EUHA 1AZDA 4IEUA 1XJAA 5LY2A 3RYRA 2CFOA 5I8YA 2N8GA 1AHDP 4II3A 2Y64A 1TWGJ 1BQPA 1XC5A 4KL1A 1ULGA 3V7CA 1PNGA 5FO8B 3LSIA 5C3PA 3MICA 4IGOA 4QU1A 3CJQB 3FFQA 5B1BH 3HWJA 2CW0F 1KQRA 3WU1B 5A3UA 2GU9A 3LQRA 1XB4A 2NPIA 2NS0A 3CJTB 2W2IA 1H8TA 4ESBA 4YIIA 1PUFB 3CMEI 4HAMA 1TP4A 3HTSB 1VPHA 2R7QA 2WB1A 5BPDA 3VPRA 2PELA 1LHWA 5D6EA 5IWFA 1VBB3 3GZUC 2RV9A 1SBDA 1Z3XA 5IP6A 1SVOA 3ZYGA 4E7HA 1A6QA 3D3AA 3E7LA 4BEHA 2DLLA 1QXJA 2Q1FA 1QHHD 3LPFA 3HOTA 2ZSIB 5JXGA 2FUG2 4P9JA 2X85A 1X50A 2BY1A 2LM3A 5J6XA 2DWRA 2GNDA 1CESA 4A93J 4DNYA 2B45X 1ZREA 2DW4A 2R7TA 1SCRA 1W6MA 3CUOA 4AUXA 2WA3A 5AFEA 4D6RA 3AC0A 4N7IA 4XFIA 2ADUA 1EYBA 2RJLA 1SD7A 1MS4A 1W9WA 4HNTA 5FLXZ 2GH2A 3AL6A 1LOCA 2VQLA 4AYUA 1U9OA 4GALA 4AI0A 5FRNA 5JUVA 1JU4A 2QUOA 4PBPA 1XSDA 1S8NA 5FAXA 4ZS2A 2R7FA 4FQ4A 1Q5OA 3DTEA 4RFT0 3ERED 5DD8A 4Q27A 5CBLA 4KU8A 3A02A 1HRI3 4KWLA 5KXCA 2ZXWH 2DBIA 3BOWA 5A3LA 2Z5WA 1RUNA 3IDBB 1FC3A 3FFZA 4AOCA 4QD2A 1SFEA 4FOWA 4DXZA 3GJBA 2LH9A 1YQ6A 4ZHNA 4LG0B 2HWE3 1R1ZA 1YRZA 3SZGA 4L97A 4IV1B 3HT2A 3CZUA 4IHWA 1R49A 1TVGA 4FX0A 1F9NA 1U9NA 2DVGA 1R1A3 3VODA 4URAA 1FTZA 2XWJB 4IHSA 1UD1A 3I2DA 3AZWA 2W68A 4EJVA 2RS52 2QBXA 1AR72 1OPCA 1R1VA 3DEUA 3SEEA 1OISA 2WAOA 4WBBA 2V5YA 3AKSA 1OCCH 2DYRH 2JPCA 1SFNA 5KHHA 4E8CA 1RR7A 1PVC1 4IV3A 1FYUA 5I0RA 4CUCA 4JRAA 1KQ9A 2CQXA 2DA5A 1DU0A 2VOTA 3WR0A 1ETVA 1S0EA 4B4RA 3ELNA 2IVMA 4CP2A 2OUJA 5LA9A 2OJED 3WQ0A 5BNOC 3CUQB 5LBCA 1OCOH 3D0SA 4RGAA 5LCWL 3L2WA 1ZX5A 4UT5A 1OR7C 4LIVA 2J1UA 1TNRA 3MKLA 1J83A 2WJSA 3CHXA 4RM3A 4KIFA 4EE2A 3TNQA 2X9DA 3UNGC 4EEFG 1X8MA 1IG0A 3WEZA 2QSGX 3QAHA 1JKPC 2J1RA 4NRPA 4BQAA 2JG9C 4N4OB 1ETQA 1WJ5A 2IA2A 1STZA 2H8RA 1FX5A 4FPOB 2BBYA 3S1MJ 2HBUA 4HF1A 2ATFA 2R5ZA 2WAEA 3WD5A 4S2DA 1NCRC 4AVAA 2EQRA 5GTHC 1GWMA 3MWMA 1MEC1 4CYCA 1GFF2 3ZFEB 2BJSA 3WTSC 5C6CA 5FYZA 3OOPA 1W04A 3PURA 2WAAA 3KLOA 5EG0B 1XNCA 4IEJA 1H4GA 4IXAA 4BLIA 2C5DA 1H6YA 3GLXA 1JHJA 3K2AA 3GX4X 4A6EA 2BYVE 2P37A 4X6AJ 2ZTNA 3FUOA 4IESA 4IEPA 1T38A 2EJRA 1EV7A 2XGDA 2YBSA 2OA2A 4PDKA 4MGZE 4HVQA 1J1TA 1DDNA 2HOEA 4CXXA 3SEZA 5FO7B 4KITB 2CWEA 2Q0OA 3S3NA 3IKVA 1AA7A 4DEQA 1W8NA 3WE3A 1F1ZA 1TBXA 1JZ5A 4MVTA 4DNCA 2VC9A 1RMU3 2W1UA 3K4KA 2JJ6A 4XJUA 2IGKA 2IGOA 2V09A 4NRQA 1YRNA 1NT0A 3CEWA 1JUIA 4AHWA 1ZM1A 4Q4X3 2ZMKA 4NIGA 2PHXA 2NMNA 2ZJQF 3NJXA 4YLZA 3GM8A 2CDOA 5F8PA 5JIUA 2FOWA 2JDAA 2EF6A 1QEXA 4ZTFA 2FJ1A 3OD4A 4CU7A 5TJJA 4QTRA 2D45A 2LKXA 2EA4A 2JUGA 3KIOA 2ID6A 5IAXA 3Q0UA 1LQ1A 5D8AC 5A3MA 2EXIA 2GNMA 3OYAA 1IG7A 3TYJA 3WDTA 4YYOA 5D5VB 1UF2C 1IS4A 3BLYA 3S1QJ 3PNTA 2DN0A 4AAPA 3RZZA 4LORA 3RCOA 3KGZA 1W8TA 4V2FA 3ZP5A 4UY8I 2L4AA 2QEXI 2O8QA 3BPZA 3V7SA 1S7EA 2KPMA 2A73B 2DDUA 1UY0A 4M01A 2NMOA 2V1NA 1HW2A 2YU9J 2AS5F 3WW4A 1IN7A 1EH8A 3ETPA 1SVMA 4UUVA 2NNNA 3FHZA 3SITA 1MJAA 1KRIA 1I5PA 2Y0SA 1TMF1 3LB9A 1LHUA 5A7PA 4BQ5A 2KIMA 2WS91 1FMD3 4CDUA 3DPLC 3FLTA 5FKBA 5EHDA 1BEV3 5D2AA 3S1RJ 1IXRC 2KLOA 4FO9A 4CEWA 1JOBA 4WXDA 1IAWA 1KYWA 3WTVC 1IOAA 1JOJA 2CTVA 5FKLA 3VBUB 3M8EA 2DT5A 3Q3SA 4GB31 1N25A 4WZFA 1BXHA 4PBOA 2CGOA 4OULA 2VZ1A 3DEEA 2GP5A 4I98B 4Q4V1 3H1WA 1WW7A 5F2SA 1J0RA 2Y0SN 2Y60A 1FOKA 5CJ9A 5JAXA 3K9TA 2WO2A 3TEYA 3LKJA 4RQPB 1W3XA 3A4UA 4EMSA 4Y52J 4M3CA 2ZOEB 2VOPA 2STTA 3ZQIA 5DTDA 4NRMA 3POGA 2P3YA 5IT9K 3EYIA 2D44A 3OR1C 2AC1A 2VCBA 1WVRA 2QQOA 1BN5A 1LJ9A 4KIBA 3WP3A 2WNUC 3LEGA 3JAMZ 1ASJ2 4XXAA 3WE2A 1LHNA 4Y22B 2D5HA 3THDA 1OFSA 3P3PA 3NEUA 2MPFA 4IE4A 2DMTA 3KZZA 4DY5A 3DPTA 5IT6A 1RUC3 3DLLF 2HKXA 4FPHA 3AM2A 3X2QH 1K3IA 1LOGA 2D2WA 1VMHA 1OKQA 5FOBB 4MQVA 2HDDA 3RS6A 5FZ4A 2R0FA 2HWF2 2W9XA 2BE5F 3FXOA 1PM7A 5LBBA 4BE3A 3MVPA 4COZA 4YW7A 3WUDA 1PZ9A 1JKOC 3QPTA 1HC8A 5LRSA 3EJKA 3JD72 2AEYA 2VR4A 4NHYA 1C0WA 5FZOB 1XNTA 3DTKA 4M72A 5IYBJ 4J01A 3R61A 2HFHA 1QPMA 3SFZA 3BG7A 4XLEA 3EDPA 3AP6A 2EIDA 1RKTA 1BW6A 2XSJC 3HGYA 3C7JA 1BA5A 3HOWJ 4EJWA 2RVAA 4QQHA 2P4EA 1WCUA 2VZQA 3LDBA 4UFKA 2E7XA 1OQDA 5FFXA 4HVOA 4A44A 3JD73 2ZFWA 1W06A 4XUPA 1WZXA 2MW8A 2HVSA 5LZ6A 3KF3A 4BQOA 2QTWB 3KVBA 3VKNA 2Z16A 4MXWB 1JS9A 3MKYB 4ETSA 2GXGA 3CP2A 4D7TA 3NWTA 1BK1A 2VXRA 2HWB3 1BBYA 5DM7F 3KLSA 1PO12 5A3NA 3VD7A 1A78A 4M3DA 3OIOA 4YW3A 4NPRA 4YG3A 2XBO1 4L99A 1ZLJA 1H0BA 4HEA2 3ZKUA 3F8MA 3GMEA 1J84A 2QWWA 4XFCA 4LIUA 5C5UA 4AXOA 1LEAA 2EILH 3ZLIA 3ZXJA 2XC7A 2DU9A 4U0YA 5LB6A 3OL4A 2OUHA 3FMRA 5GJ6A 4B29A 2LLKA 3S17J 4JC1A 5C71A 4A5MA 4DJAA 1T2KA 3LZZA 5IOYA 2Y6HA 1D0ZA 3BCBA 4S05A 2NVQJ 3AMMA 2VUCA 2L9NA 1JBCA 4BXSV 1YI7A 4S2FA 2DYSH 1NCQB 4OZOA 3WSOA 5FY4A 2FX0A 4FP3A 2L7KA 3ZXLA 4CU8A 5IOZA 4XURA 4QWNA 1NH3A 1MMGA 5FREA 1Q8VA 2GC3A 2FNPA 1O8PA 4HMZA 4AZZA 4X8PA 3ZMUA 3L9JT 3HNYM 4PDWC 2R7VA 3MLKA 5KVRA 5M5YJ 4QM8A 1SPPB 4F92B 1ZELA 3FN9A 5BNOA 5FKNA 4PSWA 2DPDA 3PJRA 3BJAA 1IDZA 3VL9A 2VXZA 3H5NA 3G73A 1COV1 3N36A 1OR7A 4XXPA 2XAHA 2W7NA 2C9AA 1EAH1 4WV8A 2V9VA 1S29A 5CEHA 1WMFA 4J25A 2FRHA 2A6EF 3PTRB 4Y1UA 2JG9A 5D5XB 1Y56A 5A7OA 4P1WA 2QQUA 3LQQA 2KRCA 4PJYA 5DAWA 4M4RA 3A01B 1NCRA 2P4WA 1FOD3 4E7JA 4QXKA 1TZLA 3LDKA 5FP8A 3PSIA 4LQRA 5EYRA 3K0LA 2X1CA 3MV11 3JZVA 3R0JA 4MFEA 5HS9A 2YGMA 1RUG3 4K40A 2DT7B 3GYHX 3HPHA 2UY9A 2NAZA 2QQKA 2W1OA 2KHMA 3S3OA 2VQ0A 4K3UA 3RQIA 2PHLA 3DPRB 3MW2A 2VUJA 2F5DA 2UXNA 1GQPA 2Z79A 3T4HB 4BQQA 2NNYA 4EGZA 2GC1A 1PK6B 2ET1A 5LK7B 3N9QA 5L9BA 3BODA 2VONA 3H9AA 1DGLA 2XH6A 2X6WA 4M4PA 4S0HB 1B1BA 5GZCA 2H6CA 3E5UA 3APBA 1IG3A 4QQ2A 2BW3A 2ZJPF 4QIWN 4V2WA 4X1EA 1B9MA 2XHKA 1XQNA 2GZWA 2V4VA 2VMCA 1NE6A 5E1ZB 3T30A 1DGRM 1UQXA 1W2UA 2NLRA 3J8F1 2DA4A 4LNVA 3I0TA 5GAGJ 4E2GA 3D5LA 1JTZX 4FTHA 5D8AA 2GXBA 1DG6A 4CTEA 4A2UA 2DVFA 1LDKB 2WLPA 5CFCB 2LUWA 2YUEA 5LATA 2B5HA 3A0BC 1R64A 4CCKA 1CZSA 5ERLA 1S9HA 4AIDA 1VBC3 2ZHKA 2PQQA 4KBBA 2ZGMA 5EDNA 2QBYB 3B9IA 1PVC2 2LNBA 3O14A 1MJBA 1WFXA 4ISRA 1DQ2A 4XILA 3NWSA 3L2QA 2GN7A 3ZR8X 1HBXG 4XKCA 4NNJA 5BY5A 2WAQN 1HQLA 5FYBA 1O4TA 4QHOA 4M9ZA 4RHV1 2NXNB 2Y6GA 3NJZA 4D7MA 3KQ4B 3V65A 1IPKA 1QJY1 5JI7A 1RINA 4N90A 3JRDA 2WNEA 3BTAA 3IAPA 3FHAA 3HOBA 3W6VA 3RKXA 3URFA 4MG2A 5FXXA 5FUPA 1XCVA 4M9SA 3R05A 3CUQC 2BBAA 2X5IC 1JI8A 1UY3A 3ZOBA 2XRLA 1ZH5A 4I02A 2V26A 3IH4A 1S1AA 4LO7A 4LMFA 1MEC2 2PMUA 3CCMI 2JT1A 1W8WA 3MFAA 4D5FA 1MSFC 2RM23 2EV0A 1E57A 1W7PA 3SH3A 2BV6A 3OB8A 1ONVA 2IFWA 3H42B 3TO6A 3ZYRA 3QOEA 2CO5A 1OQ1A 5JVGF 4LA2A 1F31A 3BP8A 4AVZA 3BDDA 2WNUA 1XSXA 5FLHA 3JXSA 1US2A 3OYMA 1FT9A 1WSUA 5A3WA 3DL3A 3AG3H 3MYXA 1YIOA 2EA7A 2A5WA 2K3FA 4EWDA 3ATGA 3KCCA 1K7AA 2R7DA 1XSVA 2WA4A 4OIQF 2IA0A 2GXAA 2X8KA 4RR3B 3F8NA 2VH9A 3BVCA 4KNCA 3S2DJ 3OYWB 3FX3A 2LS6A 5DCMA 3FBMA 4ZDOA 1VMFA 3VKLA 3J7AO 3WHCA 1LKXA 1OCPA 1PGL2 5JLVA 1DYKA 5A6QA 2XOMA 1ND2B 2D3SA 1BIBA 4EJUA 3MF9A 2PHFA 1MR5A 4PI0A 4XIKA 4HKWA 5BNQA 1MS3A 3DUIA 5K7HA 1POGA 2D98A 1ZZ8A 4XLHA 4NAMA 4I0AA 3PJYA 3TO7A 2TNFA 2W91A 4BDYA 1GV2A 1GDTA 3EYPA 1YFUA 2R5YB 4GWNA 2VL8A 1W5TA 3OPTA 4Y15A 1W4MA 1S0CA 5FY0A 1JTXA 4FETA 2FD8A 3W59A 1IRZA 1OC1A 5H9PA 3ZSMA 3ZFFB 1ETKA 2QCOA 3WGGA 4XW3A 1TMF2 4RSUA 1LRHA 4M74A 4EWAA 2YU3A 4Q0PA 5AONA 2W1WA 4XLPF 3HRTA 2LF7A 5FFOC 5KC6A 4RLFA 4AEKA 5FMOL 3EYYA 1U3EM 1OLQA 4GXOA 2HEWF 2VOKA 5H2FC 1NE4A 1X36A 2VMEA 5DDJ3 2IUWA 4QX1A 2E1MB 1Q3EA 2C0ZA 1ZGAA 4KJZA 2JECA 3W6KB 4CDXB 4GB32 1RETA 1R9TJ 4Q4V2 1F15A 2M30A 1V6OA 1IRFA 3ZYFA 3FMGA 3KV9A 4WVVA 4D3WA 1B72B 2ZCWA 2RMU3 1TQMA 1I3QJ 1JODA 3ECOA 2ZBJA 3GBGA 3J80K 2QM3A 3W6JB 1OCRH 4HN1A 2W94A 3HYIA 2I8DA 2JDKA 2DMQA 2VBWA 1BBT1 4CZZA 2BUKA 4M3BA 5LLQA 2HXOA 1NKGA 3AKRA 3G1OA 2VE9A 3PU3A 4PDWA 1U6GA 4OHYA 1WH5A 3NV4A 1U12A 2ORXA 2YFUA 4QPQA 4ASLA 1VRH1 2EALA 2M3AA 5T55A 3W2AA 3HL2A 5FZLA 2CQNA 2VJ4A 3LAPA 4ENMA 1GNHA 3POSA 1H6XA 2ZNYA 2DI3A 1POV3 2EPFA 2BY3A 2Z5UA 1LVAA 1C1LA 1N77A 4IVNA 2DK5A 5D4RA 3O1MA 4MO7A 3LQCA 5A7WA 4RB2C 3P1IA 2DA1A 1OQEA 4IEZA 2P17A 1QOOA 3RTRA 4JDNA 1URXA 3CQZJ 3TWIA 4L0YB 5H6RA 2VQTA 4DIQA 1SZBA 3AKQA 1IZ3A 3OOXA 3GCWA 1A5JA 4HF2A 2DPUA 1QNTA 2A3YA 5D5UB 2ZGRA 2CNAA 1HDDC 1W36C 2E32A 3ZN0A 2GLOA 1IQAA 5FZIA 3CCUI 4FAHA 1PO21 3OYFA 5B1AH 2IXCA 4KU7A 4U7BA 3PUSA 1Z78A 4LXLA 1UFMA 1MH3A 5L3BA 3MLJA 3ZPLA 4IE0A 5E1RA 1GQGA 2DJNA 1DYOA 1U5XA 2IBDA 2PMZN 1CZVA 5JMOA 3CCRI 3TP3A 1L7LA 2OQ6A 4AEDB 1G9FA 3E6DA 3WF0A 1VBA1 1I9RA 2XBO2 1S5LC 4YFZA 3D5RC 1DPRA 5E1XA 2O9LA 4CP0A 1BI2A 2QQWA 1YQ8A 3CMGA 4AG4A 1BMV1 4ZONA 4XOTA 5FY5A 2RS13 4ZZ8A 3IAM2 4GMP3 4HV5A 3IH2A 1KU7A 1IDYA 5FLVA 5TSWA 3JRBA 5AIQA 3LOIA 2IW5A 4C1WA 2UWAA 4YW4A 3KP5A 2ARBA 1IN8A 3FHNA 1W6PA 3NKTA 3WF1A 3LSMA 3JQXA 2COMA 3O1OA 3VBFB 3WOGA 2VODA 5CADA 4Q1PA 2BVVA 2OX0A 4IETA 2VW1A 3AX4A 2Q0AA 2M8EA 1SBFA 1ZA7A 5A33A 1VZ0A 2DOFA 1O59A 1GQHA 4DO0A 1J7KA 4O6JA 1JZ6A 1PP7U 3VKFC 3A0HC 1Z7S1 2YPDA 2R7RA 5E79C 4JDOA 2CUJA 1HW1A 3VOEA 1R082 2VOVA 2JZYA 3OOUA 3PIOF 2HYXA 2JX9A 2E71A 3N9OA 1R00A 3FHQA 1NCQC 3CKHA 3LE0A 2PHRA 2ZB9A 5GM0A 4HLXA 2WTEA 3I71A 2DFCA 1D1AA 1WJCA 2M2EA 1COV2 3K70D 4P02B 4P9UA 3KCYA 2X1EA 2CFXA 4O7XA 4ZY9A 4WX9A 3UL2A 4CZCA 4Z2YA 1V9U3 2X05A 1B59A 1ETOA 4LBJA 5EJ3A 1W8FA 5F39A 1R083 5CVUA 1QKQA 1LECA 3PVNA 1TLHB 4E9KA 4KFCA 2L7ZA 4B47A 3CUQA 2FF4A 2K9SA 5TISC 4KG0A 1L7QA 2W52A 2K9QA 4BQXA 5IYYA 5BXXA 2Y34A 1W9FA 1GV5A 3J7HA 2W3JA 3CC7I 1SFXA 4QU2A 2BWAA 2K9MA 3ZPYA 2VKHA 2G19A 2HOAA 3VBHB 1E5RA 4QKNA 4EZHA 5FUNA 2O0OA 2VCAA 1UMQA 4KYWA 3HXLA 3BPVA 4BJ6C 4QAWA 1AYM2 3RRDA 4FX4A 1UMIA 3LEIA 4A0XA 4A7KA 3C3WA 3GZEA 4XUTA 2Q2EB 1XE0A 3HPNA 4ZJZA 1AR81 2MH9A 1W6NA 2LF8A 3ZPOA 4B4QA 3VD9A 3BQYA 3O1RA 1ENRA 3U1DA 2B7EA 4AIHA 1MBFA 4JGYB 2WR9A 1HA8A 4XM3A 3AG1H 3MIGA 2ARCA 5ABJB 2O8KA 2Y6LA 2W46A 1AYM3 2JSPA 4ZZLA 1R6RA 2IJLA 2ZXJA 4J00A 1Q8OA 4QXCA 3QPSA 3AXEA 4OHZA 2E1OA 2J1VA 2RJ2A 4XUQA 2VVDA 3PJQA 4XHBA 1ZTRA 2IXLA 1N47A 5CVRA 2ELHA 4OI1A 5L3FA 3WG3A 1H30A 4CPBD 1MSEC 4DINB 4QHBA 3IWFA 3OY8B 1R091 2CSOA 4N0BA 4E7ZA 4MEXF 2OZUA 2JQ7A 1MMSA 1J2XA 3ST7A 2V4JC 1UPSA 1X19A 5FPZA 3C8XA 1WD4A 4WVMA 3LAJA 5FLIA 4CP1A 1XCBA 3ES1A 4MEYF 3BG3A 1Y8RB 2DYCA 4LE4A 1DQUA 5IT9Z 3OBAA 5DMYA 1S7AA 2QKMB 3RKYA 1Q1HA 5D1IA 4LOSA 3HSRA 4BYYA 1QGLA 5DG2A 4RHV2 2Y31A 2QKLB 2R92J 1F5JA 3R4DB 3HIFA 1QJY2 4WWCA 2VUDA 4HNUA 5F6LB 3VGIA 5GLVA 4GDFA 1UY4A 2XF6A 1G3SA 2XF5A 2WZ8A 3NAPB 4X6RB 1NQJA 1UYPA 2YC2A 2P81A 4DOUA 4E2QA 3TOBA 4G9YA 4Z1VA 2IGMA 5FTTC 4UXAA 4U7DA 2VXDA 1RUJ1 1Y9QA 2KIUA 4ES9A 1GWLA 2NS8A 4WM8B 1ETWA 2GALA 4WXHA 4QX7A 4HPKB 3FBNB 5C33A 3WG1A 2RVCA 1K4TA 5FD6A 5E8IA 2X48A 2A05A 2LRPA 3ABZA 4M3GA 1RESA 2LD5A 2E19A 1AR91 1BZWA 4MGTA 2XPUA 5LBQA 4QHZA 2Y30A 3ASOH 5C3QA 3ZXSA 3BCWA 4FT8A 2HEYF 3ECHA 4E4ZA 1O3TA 2JE7A 5GLUA 3I2FA 4Z07A 3B6CA 4UXNA 4CXFA 4HVRA 5DAQA 3JB8A 2YSRA 5E88A 1Y3TA 5ED4A 1SLCA 2B9VA 3PSFA 3CZ6A 2Q8CA 4XDOA 1ZRRA 4RQPA 4META 4ASKA 3BIEA 2CW7A 1GZWB 3LA3A 4IE7A 2FBKA 5HLGA 4EM1A 3SEQA 5BMZA 3HOZJ 1D0HA 2JJ7A 1DGWA 4QPGC 5LA1A 4DZPA 4IHTA 1UOJA 1H1IA 3LSJA 4XZUG 2I07B 4C0HA 1H8VA 3ZSEA 1Z21A 1Z91A 3GDBA 4LO6B 1H1AA 4Y22A 3T0BA 3R6SA 5KC5A 3CDZB 4Q4Y1 5LRRA 2R073 1FOYA 5DUKA 1FNNA 5JHUA 3H0OA 1NLQA 3KP3A 2I5UA 1BVVA 3S6PA 5FY8A 2IRFG 2VZTA 4RFRB 5AC93 4PSXA 3WP5A 3T1LA 2BPA2 1JJ6C 1P2FA 4DXTA 1UAIA 2J7MA 3L2HA 3LSPA 1GZTA 2IFRA 1A3KA 3RZKA 4FFHA 4H7LA 2X53S 5FZOA 4IRHA 4P96A 1X7NA 3H8UA 4Q2FA 5HBAA 3TGNA 4A3JJ 5ACA1 5C3SA 3MUZ1 1W8ZA 3VD5A 3DXJF 2XPVA 5IK4A 1SG3A 2JB8A 4Q8KA 3ZX7A 3ON7A 3POBA 5EEHA 4G6QA 4LITA 2YHJA 4R79A 1ZA4A 2BGCA 4QDRA 2HI3A 1WMDA 1VRBA 1PZ7A 1TC3C 3VL8A 4EATA 1PZ8A 2CYFA 4YNIA 1OKRA 1W0NA 3GGLA 4RYDA 3ZFFC 3JBG2 4MXWA 2RDSA 4YRDA 4DUVA 4FPYA 5FZGA 4XUOA 5KXEA 1OXCA 3BQZA 1DLCA 1N1VA 1DUXC 3LPGA 2L9RA 1MBEA 3A4CA 4QLCU 5KWRA 1JZ8A 4V19K 1QOTA 4Y1ZA 1HLVA 4JP0A 1FP1D 2XQXA 2ZMNA 4JX6A 5JLXA 4A3XA 1NA1B 4PUSA 3KF5A 2XAFA 4KN4X 2JB4A 3JBG3 5FP3A 1JYCA 3AZZA 1BBT2 4FFIA 4AYBA 4AR2A 2D6KA 4RA2A 5HDGA 3H7JA 3LIHA 1FZPB 2OYZA 1F43A 2OXBA 4N53B 4PT6A 4U88A 1T8IA 2A7AA 1U0AA 4XFHA 2HWD1 1G9DA 4AGGA 5EIYB 3FXQA 2HOSA 1WUVA 3OGRA 1NCQA 1G4DA 5FBZA 3CL1A 5K5QA 2GMMA 5AVPA 1VRH2 1LGBA 2KQRA 2DTYA 3I97A 1JZ4A 3GJAA 4W6XA 2YX7A 1IUFA 1STMA 4A42A 3ES4A 3PVOA 2Z3YA 2RDRA 4UBGA 2HQRA 3WX5A 4AYBN 3GNEA 1NK2P 2RJKA 2LSOA 1H2NA 2EZLA 3H3UA 4FHTA 2DODA 3EUAA 4E7KA 3K3OA 4AEJA 3FXJA 4HPQA 3ZVXA 2PEXA 4QGMA 3O8HA 3OR2C 4DEVA 5FYTA 2MBFA 4PFPA 4QX2A 1PDNC 4RAFA 4XRFA 3EO6A 4O5VA 5CG9A 5ANNA 3KB5A 4HSTA 2KJBA 4I0BA 1X9TA 3RGBA 1RI7A 1CAVA 1VQ7I 1YO5C 2DBBA 1RXFA 1RUE2 4C2TA 4AWDA 1PO22 3GVAA 5EJ1B 1C5HA 5K9YA 1QHGA 1ZRIA 4M0NA 2Z99A 1WKYA 4MFDA 2FNAA 3HKZN 3GZTB 1H2MA 2WZR3 5ISLA 3A23A 4C2UA 1O91A 1OHFA 4QB1A 2ZJRF 1NLSA 2FBEA 1JT6A 4PF1A 2VTXJ 4NHLA 3PO2J 3I59A 2IT0A 4A7YA 1ON1A 4ZC3A 3RZJA 4JTNA 1RUE3 2MFZA 5HDNA 1S72I 2WY8Q 3BTIA 5KK1A 3IMNA 2E1NA 1GYKA 2PQ8A 4HQEA 3ZYJB 4RM2A 3S8PA 3VDXA 4D0PA 1VQPI 3PQKA 4UW5A 1S2EA 1BMV2 2VPRA 1UOFA 4EYUA 4S04A 1JHHA 3IMMA 2VMIA 4D8MA 2RC4A 4CCNA 1B4AA 3U11A 2QDNA 2LOOA 1O3QA 2I74A 1BJQA 1O8SA 4AVPA 5CU1A 1MZFA 4JKKA 4LK0F 3T2PA 3UNPA 3B73A 2AHQA 2MLGA 1NAEA 2X0LA 5HCFA 1RUF3 4BIFA 1FPN1 4BBSJ 1SEUA 4NWVA 3QBQA 4RD7A 2EIMH 1MQTB 3TN92 4QDQA 2IS4A 1NG7A 3R60A 5FKKA 3R4UA 2XLFA 1M4WA 1Z7S2 4YGCA 3RI8A 1RTVA 4EVIA 3G6EI 2YYOA 3JRCA 2R49A 4DY3A 5EYXA 4XF4A 2IXJA 2A6TA 1CAWA 3N97A 2QQNA 4COYA 1Q1VA 4CO8A 3W5MA 1MZ5A 2DA2A 3IP4B 4AWXB 2GIVA 4O9GA 4PQ9A 3ZXKA 2RDPA 1OFCX 2K9ZA 3TN93 3F2ZA 5IT3A 1WJFA 1OA2A 4JQRA 1P7JA 4LBNA 1CIWA 1LOFC 2G4IA 1LOEA 2EIKH 4FXGB 3I2HA 1QRYA 1RGSA 1U2WA 3ZYHA 2GC2A 4V1PA 2OPTA 5DUIA 4M73A 5BS6A 4E4SA 1OVSA 4IEXA 4XK4A 3OYLA 1C3HA 4RB3C 2VAUA 3SCHA 4HG2A 1CZTA 5HV0A 5A70A 3WNNA 2VOXA 4Q4W3 1D2SA 3THCA 1A35A 3KP6A 2HBTA 2OPKA 2PLV1 4Y20A 4F91B 4IHXA 1XPWA 3KV4A 4ATFA 3BZ6A 1Y43B 1RHI3 1PMJX 4XMIA 3VLBB 4P5HA 2XVLA 1N75A 4UHTA 3ESWB 4P5OA 4OHWA 4Q1RA 3CO7C 1VBD3 1GWKA 3V4GA 4OAYA 1JT0A 1HCRA 1GXPA 4AHZA 4P9YA 3GTJJ 5IVJA 4MH0E 1AR82 3GYDA 2BNNA 3T8TA 4S2GA 5EQUA 1J09A 3VBHC 1ZBE1 4NWWA 3FMSA 3BTLA 2PHUA 2AR6A 5APAA 4QPGA 1WW5A 3RKWA 1IS3A 4Y4YA 3POIA 3FM3A 2VZOA 2HQ5A 4C3JJ 4XSXF 1H2KA 2BGPA 2VW2A 1CR7A 4MHRA 3RWKX 3FXMA 1NX9A 3KLNA 3FL7A 3GCMA 3H8OA 3J81K 4MSVA 5KHJA 1RUI1 2A6YA 1VQ9I 4GXLA 5LA0A 1V5EA 4DQ2A 4JX0A 2R1BA 5IK7A 4LB5A 3B9CA 4JVAA 1ZZ7A 2X29A 2QYOA 5BNPC 4E70A 4JGYC 4JHTA 2FZ1A 1RITA 2VQAA 4A0ZA 3GFIA 3T09A 2ZXIA 1KJLA 2ZGOA 4FPJA 3OYKA 3OPZA 3ZSJA 1R092 3T1BA 4PCRA 3VBOB 4COUA 2M7BA 4B44A 2A5YB 5DZEA 5D5WB 1XMXA 1IW7F 1RL3A 2ADDA 3B94A 3ASNH 1CQTA 1DF0A 2ZX1A 2HPIA 3I3MA 5H6QA 4ABZA 2VJXA 5M3MJ 4CEYB 3FJSA 1OMIA 1VI0A 1CF7A 1YCIA 3J80Z 1QNWA 1J5YA 4D6SA 4G8XA 1AF9A 2XJVA 3DCFA 2R16A 1MNMC 2A6WA 4P5YA 1SMVA 3HOYJ 4JTOA 3C2HA 2QLZA 4MQ9F 3POFA 4NMIA 2NOJB 3MIBA 4EN8B 1F4HA 5ERIA 4BL0B 4IO9F 2R5YA 4G9SB 3DV8A 1SLIA 3LA7A 2E36A 5AVAA 2EFOA 4LJZF 4ZYGA 2PJRB 4PJ0C 5KCMA 2PI0A 3USUA 1W1WE 2LRDA 3FC0A 3ZFFA 2OA4A 1C28A 3J7AY 1B6AA 1IKPA 3GXOA 3M1HA 3NQOA 1I5ZA 1AYN1 4NIDA 1QJX1 3EPZA 1E17A 4OMDA 3M1EA 5JI9A 1MIJA 4E2SA 2QKDA 2K9NA 1AR92 4BY7J 5HLTA 2GNBA 4LGWA 1MW7A 4HG6B 3NAUA 3S5QA 3I8TA 3T08A 3V0BA 2J42A 4BY1J 3VUOA 2W4SA 5H20A 3ZCOA 2ECBA 3KQRA 4BQ1A 1Z6RA 3E6BA 2Z2SB 1IC8A 1JXNA 5DCFA 1OURA 1C57A 2CMPA 3GF6A 2Y2ZA 1TME2 1LULA 1HB3A 4XF3A 5L36A 4GAZA 3M7AA 3I2GA 5E18F 1D4VB 1B72A 1Z9CA 3L2YA 2VJ5A 2HWC1 2LROA 3A0NA 2EZHA 2V5DA 2R7OA 3AL0B 1V70A 4OMCA 4E4DX 4I76A 3OYHA 3CF6E 1LAJA 3W2VA 4UVAA 3RNSA 3WDYA 3A21A 1WWYA 3SKJE 2CU5A 3W20A 3VB2A 3IKTA 1TME3 2AYHA 3M3IA 1W5SA 3V8LA 3VYUB 1UNBA 4PZJA 2E26A 4Q4Y2 4UUTA 2W1QA 2H09A 2BOJA 1PIV1 1TNFA 4UOJA 2VNGA 2XJSA 3BR0A 5FYCA 4L5JA 5C9AB 3M4FA 4YM0A 1IN5A 1H2LA 2DTRA 3O3KA 3IWZA 3FIWA 2Q1ZB 2VOOA 3UJOA 3N9NA 4CP9B 3GO5A 2JKXA 2RAEA 4ZKTB 2R1DA 2ZGKA 3INAA 4LLGF 1IJWC 2Y0IA 5FB2A 2G1MA 2VBYA 4R8HA 1D2QA 2JE8A 1Y39A 3BG5A 4P9GA 5E6HA 2KISA 3HHHA 1HKDA 3CJXA 1R1UA 4HW0A 4URTA 1V6IA 2VI6A 4L8QA 2QVOA 4K2EA 5ACA2 1PVEA 5FZ9A 1WWXA 2WN3A 3C7GA 3KWVA 1OCTC 5FLJA 5FZ0A 2UUZA 4UVCA 2VE1A 2IEKA 1MNDA 1VNDA 2MEV1 2WWUA 3FXLA 1ON2A 3J9SA 4NQWB 1OOPC 3PTYA 2JD9A 4YG6A 4PIZA 2VZPA 2X6OA 1S0FA 4FFFA 4AI9A 3N05A 3L2CA 4MGYE 4YELA 1G3WA 3BGAA 5E17F 5K8SA 3O1UA 3S14J 3E5XA 2BBVA 1P4XA 1BKZA 2WQ4A 2W85A 2F2EA 1ZZBA 3P9CA 2VQHA 5LWBA 2QCSB 5KNLA 1BL0A 3VZOA 1WA6X 1W0PA 3BI3A 1VF9A 2F5VA 2NOGA 1W8HA 1WRJA 1SHWB 3IBMA 2XB0X 1E2XA 3RG0A 1B09A 1XN7A 3J7LA 4BXFA 4UF0A 2Z1DA 4C30A 3FUQA 2Y0OA 2UU8A 3A7QA 2BVBA 5DZFA 1I1EA 3CJIB 3N7JA 4OYUA 2XWBB 2OZ6A 5FRMA 1VQ4I 4FPGA 3WQ7A 3PIGA 3ZQLA 4RLQA 4YG0A 5F37A 3FDYA 4JZRA 1NA1C 2VQCA 1W7PD 3PUFA 3W21A 3K4JA 2B42B 3AZVA 3J4UH 4IL6C 1BHGA 3ZQ7A 5D4SA 1H8AC 1D4M1 4R4XA 4YW2A 1OJLA 2EFPA 1LOFA 2MYSA 4ATEA 5BYNA 4IEYA 3BG9A 3WODF 1O7FA 4Z2AA 2R30A 4YZ4A 2BV4A 1ORKA 2BP6A 2DDAA 4YM2A 2A6HF 1OKOA 3VZMA 1HXS1 3TDZC 2JG8B 4KMFA 1QVTA 1AVBA 2IVIB 3Q8EA 2FA5A 2VNOA 3UKGA 1J9IA 4EN9B 2XMLA 1PVXA 3VDDC 2W0XA 5I0UA 1Y1VJ 5HXVA 3MI8A 4B8EA 1AL22 1GOFA 5JI6A 1I3HA 3T2OA 2JDHA 3IT8A 3F8BA 4XOGA 5DAVA 3I64A 5ICFA 1R5ID 1WCKA 1OLTA 1DIWA 3VN4A 1Y0UA 1D3YA 4XLFA 3GBFA 5A3TA 2IGNA 3RKQA 4FP2A 1LNWA 1QQP3 1F36A 3S3MA 1VBE3 1RKWA 1NY72 2KR2A 3KT1A 5T5JA 2FDIA 2WNVC 3AK0A 1AL23 3A1YA 3GUDA 1QJU1 2P6TA 5LHIA 5B66C 3VBHA 4BXXJ 2F4LA 3D82A 4QB2A 1TWAJ 3K75B 3OYJA 3EB7A 5DV5A 2DA6A 1REDA 1ULPA 3CCYA 1FBUA 4Z6YA 2JA2A 1AXYA 1AR62 3P5JA 4XTPA 1MMAA 2D6PA 3WG2A 1YQ5A 1Q56A 4G7ZF 4XDPA 3F72A 3OUHA 2NN8A 1FP2A 1T2XA 4DUWA 3OUIA 3UETA 2A75A 2WFF1 5BNPA 4JGYA 2KT0A 3BCAA 2MLKA 2GWRA 3DWLE 2PJPA 1FPN2 2GSYA 5FZFA 3K4CA 5E1WA 1QH7A 1AR63 2ENRA 3UR3C 4W1UA 2QDRA 2V6EA 1H0MA 4F3JA 1RVF1 3GXUA 3RMXA 5GLZA 1LHOA 4YVSB 5HCHA 3KD4A 4TV7A 5L7OB 1ND3B 2DO7A 4GKYA 2I45A 3RZOJ 3OY8A 3KMHA 5FPBA 3HB9A 4CCJA 4BS9A 1MQTC 3CP8A 2IWGB 5FYHA 4RN5A 4AU7A 3F95A 4OVEA 3MZYA 1AX2A 1SFYA 3RPUA 5L9VA 3JR9A 3ZIXA 4ASNA 4A41A 2L9SA 5FZMA 2VPVA 1GP6A 2E7TA 4TYSA 2JENA 2XROA 2L02A 3HJRA 1EUTA 3F22A 4PJLA 1X1DA 4NN0A 5C8WA 2EIEA 4OZXA 2WQ8A 4H7MA 3ZXDA 2FDKA 2ID3A 4Q5SF 2R7UA 1XGSA 1MVEA 4Q26A 4Q0VA 2ORZA 2W95A 4MX3A 5J37A 4DXRA 2PLYA 1YI2I 1S7OA 2P1BA 3IRQA 4MOAA 5L9RA 2BXZA 4OU0A 3DXTA 3R4SA 1D8KA 2TRTA 1LE8B 5LGTA 4K6BA 3CLOA 1GLHA 4RS5B 4LK7A 2DOEA 1RUH3 4LBMA 3E3VA 1ZBA1 1QBJA 4HPKA 1C8M3 4QKBA 3BT9A 5L3EA 2A6ZA 3ONQA 2C6YA 4ORFA 4OHVA 3K1NA 1ZBE2 5FYIA 3ZO0B 2VUAA 3DF0A 5H9RA 2IXHA 4B43A 2WDBA 1Z6TA 2VQUA 3OWTA 4IUGA 2EAKA 3O1VA 3VB9A 1Z7LA 3IV5A 4LBKA 4A3ZA 4LEJA 3S0MA 4TTGA 1GR3A 1CAUB 4HF0A 1POV0 5IUQA 1NLRA 2A3SA 4NAOA 1NYWA 2DFBA 2IP2A 1FYMA 4DYCA 1GT0C 1NXMA 3M8FA 2ZA9A 4RGGA 2FMDA 2YXSA 4UUSB 2F17A 4YW5A 5G05L 2OD5A 2Y6JA 1F8VA 2DMNA 1MDMB 1EF4A 4XZPA 1ZAOA 1QJFA 5CB7A 1I27A 1HSJA 5E3LA 5K1YA 2XR4A 3AP4A 2JKBA 3U78A 4PLNA 1JI6A 5IPAA 2UY8A 1XMKA 2YPRA 2HEVF 2VBPA 3WDWA 2RR11 2H8WA 3B93A 2WADA 1UL9A 2M7AA 2IS1A 3IC7A 5EXOA 1W39A 1LVKA 4QPIC 3R0RA 1ULOA 5FQ0B 1KDMA 3HUGB 1W03A 1U5TB 2M87A 1QU3A 4QPWA 4IEVA 2VTFA 2MHFA 1OOPA 1WCMJ 2WAFA 2CV6A 4NBQA 1W6QB 1U5ZA 3EQLF 3UGGA 2EZIA 3MW4A 3K4BA 3NNGA 4M6YA 2ZJCA 2XB5A 2GA1A 1YNAA 2FCTA 3GCXA 3ACIA 3N7LA 4HK9A 1IN4A 4HDUA 3ZR6A 3DEMA 1UHWA 3O1PA 2VBDA 2WC2A 2LTPA 2K7LA 3POJA 5FZ6A 4ZYEA 1JJ8C 3MPBA 1SAXA 3CO6C 2ZZJA 3ZYBA 1UHMA 1DHKB 4CSWA 2A71A 4YFKF 3OYBA 1H8TB 1YJKA 3BTZA 2A3WA 4OMZA 1O5UA 4N9IA 5JOWA 1K6YA 2X09A 1D7PM 1ULDA 3BU7A 4AK3A 2EA2A 1HRV1 5K5RA 3L2VA 4GO1A 3BKZA 4KH9A 2A6XA 2X10A