4LITA

Structure of ycfd a ribosomal oxygenase from escherichia coli in complex with cobalt and 2-oxoglutarate.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
372
structure length
361
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
total genus 102
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4litA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4litA01
4QXBA 3NJYA 2YBSA 5FP4A 4CCJA 5FZ9A 5FYYA 5IVJA 4QU1A 5IW0A 3ZPOA 5FXVA 3KV9A 4URAA 5FZOA 4IGPA 3LDBA 4QX7A 4CSWA 2XUEA 5F5IA 5F3EA 5FZ3A 5FYMA 4EYUA 5A7WB 3N9QA 5FZ1A 2P5BA 5FP3A 4GJYA 5FZKA 4GD4A 2GP5A 4UF0A 5FZAA 3PURA 4DO0A 3U4SA 5FY5A 2WWJA 5FYBA 4LIUA 5FZDA 5FZ0A 5FPAA 2PXJA 4Y4RA 3ZLIA 3AVRA 5F3IA 5FJHA 5FPLA 4C8DA 4CUGA 4BU2A 3RVHA 4DIQA 5F3GA 5FV3A 5FUNA 5FZ4A 5A1FA 4GJZA 2GP3A 5FWEA 5FY7A 5A7NA 2YBKA 2Q8CA 5FY9A 4Y33A 3LD8A 2YBPA 3N9MA 4QWNA 1VRBA 4GAZA 4V2WA 3KV6A 2OQ7A 4XDOA 3N9LA 5FBJA 5A80A 2Q8EA 5A3NA 3K3OA 5F37A 4NUBA 3KVAA 4D6RA 5FYSA 2XMLA 2YU2A 5FP9A 3N9NA 3OPTA 5FYVA 5FYUA 5IVBA 5LY1A 4CCNA 5FZFA 2YU1A 3DXUA 4ASKA 3PU3A 5FYHA 5FZEA 5ISLA 5KR7A 2OX0A 3DXTA 3AL5A 5IVEA 3U78A 4BXFA 5A3PA 5FPVA 5FZ8A 5FZHA 5FZIA 5FUPA 5FPUA 3KV5A 5IVYA 4IGQA 5A3WA 5K4LA 5FYIA 4TN7A 5FXXA 4CCKA 5F2SA 3PUQA 4HOOA 5FY8A 5FWJA 5FY4A 5FZCA 5A7QA 5FZMA 5F5CA 5FZGA 3PDQA 3K2OA 3KV4A 3AVSA 2OQ6A 3UYJA 5LWBA 5ANQA 5FZLA 5FZBA 5FZOB 5IVFA 2W2IA 5IWFA 5FXWA 5LW9A 2YPDA 5LY2A 3N9OA 4AAPA 4AI9A 5CEHA 5FY1A 5A7OA 5A3TA 4QXCA 5FP8A 5A7SA 5IVCA 4HONA 3PUAA 3PTRB 3PU8A 2XXZA 5FY0A 5FPBA 5F5AA 2WWUA 4D6SA 4CCLA 3OPWA 5FP7A 4EZ4A 5F3CA 4UF0B 4LIVA 2XDVA 5E6HA 5FXZA 4LXLA 5FYZA 2VD7A 2Q8DA 2OT7A 5IVVA 4V2VA 5A7WA 5F39A 5FJKA 4EZHA 4E4HA 4XDPA 3N9PA 5F2WA 5FZ6A 5F32A 5FZ7A 4CCOA 5A1LA 4LITA 5A7PA 4QX8A 3K3NA 5FYCA 5FYTA 4D6QA 3KVBA 4CCMA 3AL6A 3PUSA 4QXHA 4Y3OA 2OS2A 4IGOA 4BISA
chains in the Genus database with same CATH superfamily
2XPUA 4JQTA 1W5SA 5LGTA 4Y1VA 1D8JA 4RM3A 1VQ8I 2RM22 2B7EA 5CJ9A 1FXZA 3CCQI 1OF4A 4PUSA 4AFDA 4D5CA 5CVIA 3MWMA 3ACLA 3EYIA 1VZ0A 4EJUA 3EO6A 2JJ7A 2J1RA 2WZEA 1WH7A 4CZSA 1RMU1 1LESA 4FPGA 5BV6A 1SAXA 1X1BA 4BY7J 3B3QE 1C8NA 2KFDA 1UJ8A 1Y0UA 3CCEI 3KHBA 4JDOA 4KWJA 4ZDLA 4YRVA 4JQRA 4I7HA 4XKVA 1SBFA 4E7KA 1WJEA 5FUIA 2LY9A 4LKFA 4B29A 4I3PA 1ZZ7A 1YFUA 1W36C 2BJSA 1WI3A 1GOFA 4HLYA 2GMPA 4C0BA 4AVSA 3ESWB 2E5ZA 2GM4A 5JLWA 4XF3A 2ET7A 3ZMVA 4YM2A 3ALQA 3ZIXA 2ZGSA 1U5TC 3MI8A 2LM3A 2R7UA 2XLFA 4IHVA 2WS91 4C91A 1W8FA 1HQNA 4RQPC 2CDPA 1RUJ1 1RUNA 4M3DA 4M3CE 3CLQA 5FZOA 4YW2A 4XLAA 5EEGA 3K46A 1POV1 3PVEA 2L2OA 5J40A 1HLVA 1YRNB 2COMA 3KZIC 1DGLA 5C3SA 5D8KB 2R3SA 1F36A 3I0TA 3CJNA 2K7LA 4YFNF 1LEDA 3WQBA 3DPTA 3I4NJ 1RJ7A 2W84A 4RS5C 3FX3A 1U3EM 4AYUA 2E1NA 2G9WA 4IDZA 1TEIA 2W91A 1W6OB 4K8RB 1BVP1 2FDFA 3B94A 3LSPA 1GMMA 3I3DA 1RB8G 2RS53 4D0PA 1OFCX 3FDYA 3HGGA 2HWC2 3RZKA 3JTGA 1DPRA 4EJOA 1OJLA 3W3CA 4XQFA 4JX6A 4S2GA 4RB3C 3BIWE 1U0AA 1N3OA 3WTZA 2Y9YA 3O0WA 2W2IA 4IESA 1COV1 2E6VA 2W47A 5K0UA 4S0HB 5F6KA 5CFDB 2FD8A 1ZLKA 3PNYA 1Q1VA 5FLXZ 3O14A 4G7OF 3TGNA 1N3QA 1HRV1 2WNOA 2ZHMA 4S04A 5L3FA 3VHPA 1PGL1 4BDVB 5K5QA 2PFWA 3LZZA 3ACFA 1HIXA 1WLWA 2PG4A 4BQWA 1BBT2 2BU9A 3G6JB 3PMSA 4TWTA 3WG3A 2ZBJA 2AC1A 3U21A 1DZQA 4DUWA 2BWAA 4XBQA 4LIUA 2JA8J 5EQUA 2A3SA 5DEQA 2YC2A 3P3NA 3CD6I 3U0ZA 3S93A 2DMPA 4ENMA 4CUGA 3ZFGC 2O3FA 1FLIA 5DUVA 3NWSA 5HOOA 4RS5A 1F5TA 2EXIA 2KM2A 1ZA7A 3C7OA 4F3QA 3LWFA 5I8TA 1IGOA 2JG9A 2M8EA 4QX1A 1K5MB 4Y15A 2G9FA 5FZFA 3DQVC 3VZLA 4L0YB 2LYCA 1LU1A 4E8CA 3O5SA 1MVEA 3F8NA 4L92A 2P6CA 1POV0 3EYYA 3FE5A 3WCRA 1Z9CA 3U07A 3ZMUA 1FIAA 4JDMA 1WMEA 1UMQA 1OPMA 2ZGRA 5F5CA 1AR61 3R60A 3F8BA 5DUIA 1RITA 2ENRA 1FMVA 2ZMEB 5GTHC 4W4ZA 5L7OB 3T4HB 5A7OA 3CZJA 3ZX7A 2MC3A 2ZX3A 3VDDB 2H0BA 4QDQA 2B5HA 4OHYA 4A3IJ 2EIBA 4QX3A 5KC5A 3BOQA 4M0HA 1M1EB 1IDZA 5A6QA 1YO5C 3FXKA 1IW7F 2ZAAA 5KHKA 5KHHA 4BY1J 1DZRA 5L9VA 2QENA 4D6QA 3RJRA 2E9QA 1YWKA 3H1CA 3ENRA 2LTPA 2PQSA 1XN7A 4LE4A 2VBWA 5M5YJ 2ZJQF 4N90A 5I0TA 3CHXA 5A7WB 3N9QA 4BJ5C 4BA6A 1PO22 2VC1A 3V64A 4XHBA 4CXXA 1JHFA 1S29A 1CIYA 2V4JC 1A3KA 2D5FA 4LG3A 4PF5A 1G9AA 2FUG2 1ZRCA 2L9VA 3JRFA 1ENXA 1LOGA 3VWBA 1D4M2 2HH9A 2A75A 5FO5A 3MIBA 3N9MA 6PAXA 4XDOA 2CW0F 3L2RA 3J7MA 5A80A 5FAXA 4HLXA 3OF1A 1PX4A 2HXIA 3WTXC 1XPWA 4FFHA 5E3NA 3HRUA 1NY72 1QVTA 5IUQA 1P9QC 2GSYA 5KR7A 4ZDOA 5CYYA 4JYKA 4KI5M 2VIXA 3SFZA 2UURA 4UI9L 2IWGB 1CD3G 4AE2A 3B00A 2Z4FA 4XFCA 5CBLA 3Q3SA 4E7LA 3V0AA 3SLIA 2C1FA 1I3QJ 3P9KA 2D1HA 1U6GA 2ZXQA 1S2BA 2H6BA 5FY0A 1MS4A 2PJRA 1CX1A 3RKYA 1KA8A 5I0SA 1XSQA 1E0EA 1CQ9A 1ZRFA 5GLZA 3H8XA 1O57A 1N1VA 3C1DA 2VUCA 3VV1A 1RL3A 2LKXA 1OOPC 2L5QA 4GO1A 1V9U1 3O0XA 3IN9A 4QU1A 4XOPA 3OGVA 1UL9A 1UY3A 4Q4V3 1WWXA 2QQWA 5J6XA 4MYEA 2K9LA 4AHWA 5JSPA 3O6BB 1CF7B 2QSGX 4QIWN 2WB1A 1SMTA 1DGRN 5DAXA 5LRSA 4AF9A 3PHMA 4PSXA 3FLRA 4G6TB 1QH6A 3GTKJ 3DU5A 3K9TA 2ZZQA 4MVTA 1ZK8A 1UPSA 2VL8A 4Y5SA 3GX4X 1FMD2 3MMYB 3AXEA 2Z99A 3IWZA 4G7HF 3QPTA 4Q4W1 4UW4A 1IXCA 2R7SA 5JOZA 2BXZA 5AIQA 2LUWA 1AYN3 2HWD1 3WU0A 2GXAA 1K45A 5BOXA 4M72A 4JGYB 3H8UA 4AXOA 1ITYA 3OR1C 4IEQA 3POIA 4LBNA 1YUDA 4A93J 3LAJA 5LBQA 1S0BA 4OLLA 3WG4A 1S0GA 2AYHA 2CYFA 4AOCA 5FO7B 1POGA 2ZGQA 5D5UB 1KU3A 4OI1A 3D5SC 2XJRA 4CEYC 1JZ4A 1UY0A 1UPIA 4AI0A 5JZGB 3TOBA 1MBJA 1Y4WA 2RMU1 1WGPA 1N77A 4H0EA 2VNRA 4NPMA 3TBDA 1KONA 2Y60A 1XSDA 3BDDA 3D82A 4NHYA 3WQ7A 4W6WA 1VBE2 4LQRA 5FKOA 3M8EA 2JPBA 3RWNA 1U2WA 2JT1A 1Z67A 1IPKA 1Q8OA 2HGCA 5C71A 1EV11 5ACA1 3Q9SA 4OQ9A 1WPKA 1MBKA 1V0AA 1WJAA 2KZGA 1OUXA 4ZHNA 2Y0SA 2A1XA 2YZ4A 3VSLA 5KNLA 2NVUB 3OL4A 4NVPA 4Q4X1 4XKCA 2IS6A 5CVVA 3KYLA 1V6MA 3FXRA 1LHNA 4I76A 4HSRA 4X8NA 1YI2I 2AXLA 3HOZJ 3JRIA 1MZEA 4ZJZA 2BW3B 4DY3A 5C4JJ 4XJ8A 2VQLA 3H9AA 1ONVA 3T1BA 3IRRA 1FBSA 5IT9K 4QB1A 1OH4A 1BOBA 3PDQA 1JHNA 4CU6A 1OR7C 2NYXA 3LE0A 4XUQA 3K4BA 5L9RA 1FATA 1JJ6C 4O61A 4XONA 1G3TA 1TP4A 4EQQA 4ZZDA 3ACGA 2W46A 3RRDA 4PGGA 1UOJA 3AP5A 4ENJA 1RC6A 5DABA 4M0NA 3HBKA 2NP0A 4Y52J 4CCEA 3J7ZI 1YLFA 4X6QB 3HPNA 2VXRA 2DF7A 1NH3A 2A5WA 1B8IA 2VMGA 2IAIA 5DN2A 3MZYA 2NNNA 1UMHA 4RAFA 5HS8A 1OKQA 1CAWA 1BHGA 3ILRA 5HXMA 1XSVA 1RR8C 5F3IA 5E1XA 1FAYA 3DBLB 5J4YA 4M9XA 2BY3A 4QU2A 4OAZA 2OVUA 5FWEA 4BL0B 1VE0A 2BPA2 4UW6A 4AHYA 1G59A 3H3LA 1RUG1 2JXAA 2IXSA 3QACA 1O4ZA 1W06A 2G7UA 2RVAA 4CXWA 2IBDA 1CONA 2EZLA 4ASKA 4GZ9A 1X8MA 3EHKA 3A23A 4AW7A 2YC4A 4RDUA 2P4WA 1OC1A 2YR2A 3ME2A 5GTIC 2FD5A 2VZPA 2XROA 3WT3A 5FWJA 1QJEA 1WUVA 1ULFA 3POGA 2RS51 1HKQA 5GLWA 3ELKA 3KGZA 2QZ2A 2W1QA 1SVOA 1RUOA 2GQQA 3VZMA 4AM3A 1PMHX 1XSRA 2DAOA 2WNVB 4PFOA 4ZU5A 3Q0UA 1IUYA 3O7OA 1H8TA 3EDPA 3TP0A 3VKFC 5A7WA 1JYVA 5ICCA 1Q1HA 2K3PA 1JGGA 1Z7S2 2XAHA 4FOYA 2Q2EB 1V5FA 2X51A 2IPQX 4GKYA 5FB2A 3A21A 3AL6A 4AVVA 1HRV3 1AR62 4PQ9A 4QPYA 5K0UB 1IN5A 1QHGA 4C1WA 3ES1A 3DF8A 3OWTA 1YQCA 1RVF1 1OYYA 3TN92 1ZREA 1R1A2 3REOA 2DCYA 1QH7A 4YNIA 1NLQA 4W65A 2B9SA 2I8DA 3ZYFA 1Z91A 3ZQCA 1O3SA 1SZBA 4I99C 4BUPA 4GYIA 3ZQLA 1RI7A 3HNYM 4E7IA 4RGXA 3OD0A 1TNSA 4BJ0A 2EFOA 1AR91 3ZQFA 2I45A 3FLPA 5CKQA 1ND3A 4HRIA 3TEZA 2PAKA 4DW6A 1JYXA 4XEZA 3OSGA 2YFUA 1AR72 2QNKA 4P14A 2IEKA 3AKSA 3S15J 1OCOH 1TWGJ 2HWE2 1URXA 2XJUA 2RVCA 3BQYA 2ISYA 2VZRA 4Q4W2 4BBSJ 3X29B 4CU9A 3Q8FA 2R32A 3AFHA 3NWTA 1UZCA 5B2GB 2A5ZA 1MJ9A 4M3FA 4XL9A 4JX5A 3Q8EA 3USSA 4FOVA 4URTA 5DUXA 3T2QA 2VJIA 2TDXA 1Y9MA 2HOEA 2OBPA 3BROA 2OUHA 3FLTA 1F5JA 3THDA 3NRVA 1LR5A 1J83A 3NV4A 4ISRA 3PJRA 4ZONA 4BZ4A 2NS7A 3BG6A 4P9UA 4YZ3A 2VMFA 4N43B 1WD4A 2RREA 4LBQD 1XGMA 1B1BA 3OV8A 1B6AA 4QX7A 4E4DX 1AKHB 2A6TA 3AG4H 1U5XA 5EYYA 1PVC1 2P6TA 4W50A 3C3WA 1FZPB 5GKAC 5FY5A 2GNDA 1R082 3AG3H 2KRHA 2DA4A 4RHV3 2ZHKA 1YFXA 4RL7A 5J1UA 3J8F1 3HSFA 1D2QA 5FUNA 1JZ6A 4M6XA 4A12A 2KJBA 4U2AA 2R7EB 5IOYA 3AKTA 1J1TA 3UKTA 2WZR1 4E2GA 4K8FA 5J8FA 4CZZA 2GC2A 3DFGA 5FKMA 4YW4A 1FY7A 3DXTA 3Q8CA 2BTVC 3S1RJ 1D5YA 2VCMA 3JRAA 1AXYA 1C5IA 4YVWB 5K7HA 1REFA 4I09A 5C8CC 1P4WA 3OYJA 1C4RA 5FMDA 3OUIA 1J3QA 4GA9A 2X5IA 1Y1WJ 3GZ5A 4TLGA 2AO9A 1JZ5A 1GNZA 2E1OA 1G3SA 1QPIA 1GKBA 2XPVA 2R7VA 5J98B 3FK7A 2WAOA 1Z0HA 1N75A 1OD5A 1BC7C 2DFEA 3WY6A 2FZ2A 2Y64A 1YTYA 3AP9A 1FOYA 1KU9A 2IXCA 2LVSA 4CCJA 4Z07A 1ZX5A 4A7KA 3TWIA 2ZX4A 2PLV1 1HCRA 3ZFFC 3LEGA 2KR2A 2E26A 1UZ0A 5FR3A 2CMPA 1H6XA 5FZ3A 4D7NA 3BTLA 4IERA 3RQ0A 1VB4A 2DWRA 5A3UA 1RUF2 2VKEA 4IKFA 5J48A 3T2TA 2DDUA 3SDBA 2DYCA 5DDJ2 2D6NA 5JI9A 4AGRA 4YEJA 2RDSA 4HK8A 2DA1A 2OUMA 3WVJA 3MDPA 3W6KB 3L9FA 3FIWA 4Q0VA 2DK5A 2AUYA 4BQ2A 3OUHA 3G73A 2RS52 4YM1A 3F8MA 2R92J 2Y33A 4DEVA 4LA2A 1D4VB 4QLCU 1O3TA 5E3OA 2XAFA 2JD9A 1U9OA 2R7ZJ 1XNDA 4KU7A 3M8JA 2HKOA 5A3PA 3P3PA 1SFNA 4HN0A 2MLGA 4OHVA 3HOYJ 1PUFA 3MIGA 1I6HJ 1OQ1A 2OQ6A 4XRSA 4Y5TA 3BR2A 3N9OA 2YC0A 4EJWA 3BODA 3AZYA 4WCGA 2R4GA 1X36A 1YQ6A 3VLBB 1WSUA 1V3FA 1MNDA 2M45A 3TEDA 5ABJB 2CW7A 3ZFGB 1JTZX 2DODA 1I39A 4AI1A 3N36A 1ENRA 2PQQA 4EWAA 1U5IA 3BJ6A 3G1LA 4Z1VA 1R1ZA 3C18A 2B9UA 2HEYF 3PL0A 1S0JA 3I71A 2PI0A 2OAZA 5CU1A 3CJIC 1LVAA 4QWQA 1W8WA 4ENNA 1IPJA 3U1DA 1V55H 1NG6A 4YLZA 2X6XA 1VBC1 3JAMZ 2FBEA 4EN9B 4Y33A 3GFIA 2UZKA 4V2WA 4IXLA 1AR82 2D6LX 4QB6A 3J81K 2LD5A 4NC7A 1US3A 2DFFA 3LGRA 2RJKA 4YG2F 2ARAA 1KU2A 3FBYA 2VOOA 1WA4A 1W2UA 1YIPA 4BBRJ 2J7MA 4P55A 2RJ2A 2NS8A 1XYPA 2VNVA 2VASA 5CPRB 1GBGA 5DV5A 1XMAA 2Q1ZB 2JRMA 4HSLA 5IT6A 2VBYA 2BOJA 1OKOA 5T3NA 2ETHA 1ULEA 3OG2A 3WDXA 1T6SA 5IWFA 2YPDA 1G9BA 5EF6A 5CEHA 1J1LA 3BTCA 1P4XA 3POEA 3CMYA 3H5AA 2CWEA 3P6BA 4BXSV 2AEZA 4E4HA 3S2DJ 4IRGA 2P37A 3ZN1A 4TSVA 1QDCA 2JSCA 2V09A 4XW3A 5FP4A 1GT0C 3RZHA 1JKPC 3KP4A 1AL22 4W8JA 3CUQC 2FRHA 1SLAA 3O1RA 1VBD1 3CDIA 3U75A 2ZJPF 1JZ2A 1BC8C 5F3EA 1H2MA 1T0FA 3APBA 3FHAA 5JXJA 2NS0A 3BPSA 1MD0A 5M3MJ 2P8TA 3H5NA 5FRAA 5A7NA 5F8PA 2HQ5A 3CZUA 2VE9A 1MQTC 4SBVA 1CAVA 2WABA 3NW4A 5L3CA 3I59A 1C3HA 5FYUA 2E7AA 3E3VA 4L11A 3BPZA 2PMWB 5FZEA 4QDSA 3ZFEB 3B5LB 1IXSB 3CUQA 2OJED 1IAWA 4TYSA 5ABJC 1G8XA 1UX7A 2QLZA 1H4HA 4MFEA 4CP9B 5FY8A 5IFTA 2ATFA 3O1PA 3FM3A 1HW5A 4CH7A 1ETXA 5LD2C 3VZKA 3ES4A 3I8TA 4PDWC 3NVCA 4XLNF 4Q27A 1VBD2 4XLPF 1WW4A 4UAPA 2WQZC 3TEYA 1IV6A 4P08A 2XXZA 1NG7A 1H0MA 1NYWA 4INDA 3NMBA 4UF0B 4FOQA 3KSCA 2RMU3 2BW8A 2DT7B 3GALA 3PMEA 1JUIA 4WXDA 2Y2ZA 2QTWB 3N9PA 4FCAA 1Y7BA 1YFYA 2C6SA 1MQTA 4IEWA 2RM21 5DCMA 4QXHA 4A3DJ 4CPBA 5LA1A 4EM0B 1BEV1 4UXAA 4X6RB 4XMYA 4GB32 1CZSA 4C2UA 4A45A 3IV5A 4JC1A 4CSWA 1LOCA 3MPPG 3AKZA 5EJCA 2RS32 3CDLA 2BVLA 4I0BA 1AYM3 4MZUA 3LEMA 4QQLA 3Q8AA 3HGYA 4QT6A 4DOUA 1QJY2 3CCMI 4CA9A 1FMD3 2DCZA 1K5MA 4XTPA 4WV8A 4N43C 4NJ4A 4WM8C 5LBBA 1C8M3 2R0FA 5FYVA 4A3KJ 3BTJA 4GMP0 5FLHA 2PQ8A 4ONUA 2HTJA 5D8LB 5CZKA 2HBTA 1QXPA 2R5ZB 2OV7A 3KCXA 3POYA 1QMJA 1V5GA 3VUOA 3THTA 3LOBA 1ULPA 3GFLA 4PLMA 3C2BA 5FFXA 1XNTA 5JR3A 4J6GA 2IP2A 3TEWA 2ADUA 3MKZA 5KWRA 1HB2A 3VBRA 4S2FA 1ZKGA 1Q8VA 5D21A 4P9GA 3M3OA 5A32B 4EN7B 1S4CA 3POSA 3I2FA 4BQ4A 1WA6X 1S1AA 3VBSC 2WLQA 3BT9A 1FEXA 4Z82A 1Z7UA 1JUMA 3K4KA 2JWPA 2NMNA 1B9MA 5DG2A 3A2KA 3RZZA 5FYCA 2L01A 1MZBA 1LTEA 2X0LA 3TO6A 1YFHA 3FKIJ 1P2FA 1TNFA 3S7IA 3SHRA 3NQOA 5JLVA 3AZZA 1DYPA 3WNOA 1DGWY 3O1UA 1WBLA 5BQTA 2CSGA 3VBUC 3WDWA 2BYVE 5FZDA 4WWCA 2JA2A 4UHTA 1G8WA 4CYDA 4HZFA 4EE2A 1T6BX 4DIQA 3WGHA 3H92A 3GW2A 4QPGA 3M1EA 4XFGA 2L9LA 5FY9A 3OYWA 2WNUA 2RC4A 3Q9VA 4OUEA 4II2A 1JTXA 4LBQB 2K5CA 4LLFA 5E89A 4Y24A 1RUJ3 1CAUA 1WW5A 2OZ6A 4A69C 1SAUA 1WJCA 4F52A 1VQ6I 4N9HA 5JZGC 5B1AH 2OX0A 2JK3A 2VZQA 2UYBA 4A41A 1EV12 5HCAA 1OQDA 1JKQC 5E3MA 1W8UA 1RUF1 2X48A 1C8M1 2X8KA 3HL2A 3S2WA 1T33A 5FZOB 2VH9A 4HPKA 2H0VA 5EJZB 1KITA 3UKNA 1EPWA 3ABLH 4B4QA 3I2GA 5D6FA 5B3SH 3QP6A 2QQAA 2CY6A 4Z6YA 2ZX1A 3RZMA 1NLSA 2X6YA 1NUKA 4NIIA 4OMCA 1IPSA 2V6EA 1Q56A 5CADA 4Q2FA 4XVHA 4E2SA 3TBIA 2OA4A 2ZHNA 5IYBJ 2EIJH 5ED4A 4JKMA 4OUSA 3DP7A 1X9TA 4LOTA 4HDVA 5AFBA 1GVDA 3D0SA 4AK3A 3ZSKA 3H3ZA 5KXBA 1I9RA 3ZDVA 4CP0A 4PGHA 2VL4A 2A6XA 3DKQA 2ID3A 2AQFA 4U7DA 3ZDSA 1CAXB 4A3ZA 1OMIA 2Y38A 2D6MA 3SQOA 5JXHA 4KA4A 5FBJA 3KB5A 1Z7S1 4D6RA 1BR1A 3CP8A 3CMMA 1UY2A 1Y56A 2Z2SB 4UVCA 2XWJB 3SJMA 4IE6A 2EJRA 2MG4A 4A0YA 1GV9A 2UV1A 2VKVA 4KDPA 4LBLA 1ZLJA 2V73A 3LMMA 2PN5A 4NIHA 5D8AC 4BOWA 1VBB3 4KT6A 3KV4A 4GWJA 1Y0NA 4AVTA 1DP7P 3MLKA 4FQZA 1I1SA 2QQKA 3PIPF 4Q8KA 1WLDA 1W5TA 1RUI2 1BYHA 2NVXJ 3A4UA 2E60A 3N7KA 4IUGA 1W0UA 4LXLA 1PJRA 3AJYA 3A1YA 2DJNA 3WP5A 2D5VA 3RGBA 4I0AA 3AC0A 2VCCA 5IW0A 1XC6A 1MACA 3H7YA 3OY8A 3S5AA 4AQ2A 4AEDB 3LSHA 2QSFX 2EV0A 2WS92 1P7JA 3T09A 2VE1A 4ZTFA 2X09A 2EH3A 1W99A 2CQXA 4DYRA 2D98A 3HRMA 4IHTA 3VD3A 1SEUA 4O3MA 1E57A 4FO9A 2L3DA 2O5RA 2ESNA 4ZU7A 4C3HJ 2HWE3 4MQVA 5KBFA 3JD71 2JTVA 3VOEA 1EP0A 4PBOA 3PJYA 3DU6A 1U5TB 1WHUA 5ILSA 2BHYA 2DK8A 3IM0A 1W03A 1W3VA 1N3PA 4AVBA 1A6QA 3HOSA 3WF3A 2TUNA 4GCVA 2N7GA 4YZ1A 3D5LA 2BGOA 1YJNI 3VKOA 2CQQA 5FZBA 2PHXA 1FOWA 2P34A 3KQ4B 4AVAA 2M4KA 1VQ4I 1H8TC 5GALA 3H36A 4XFHA 1SD7A 4LMFA 4FCYA 3UETA 4QM9A 2Z1DA 4PIXA 1RZ4A 2V5YA 3JCIA 5EPAA 1BL0A 3DLAA 2VOWA 5IK7A 2JN6A 3GCMA 1CVNA 4XK4A 2TBVA 2JSPA 4FPOB 4G7ZF 4JDNA 2R5ZA 1N25A 3DF0A 2L54A 4BXXJ 2WBMA 2ZJCA 3KZZA 2W9XA 2XG3A 5CAZA 4JV4A 2DOAA 3CCLI 1OCTC 2WJSA 2CU7A 2L9NA 2HKXA 3KV9A 4P9XA 1X1PA 1ZBA2 3RZOJ 2GNBA 4G9YA 5E18F 1VAVA 3NNMA 2O03A 3ECQA 5KXCA 2I10A 1YIJI 2D3RA 1D0XA 3JRBA 2JB8A 2D5HA 4QPOA 1BJZA 3D6EA 4XIDA 1O4TA 3WHBA 3RYKA 4XQWA 2RE9A 1GU3A 2H27A 5CFDC 1S2EA 3AK0A 4JOMA 3W9AA 4C2MJ 3E1F1 2K40A 1S0IA 4BEHA 4E7JA 3KX2A 1P7IA 1LGBA 2Y30A 4NOTA 4KISA 3F95A 5HI0A 4HK9A 1O8PA 3FHIB 4IL7A 4UBHA 1USSA 1BW6A 1KDMA 3MW2A 2ZBKA 3WDVA 3K70C 3IBMA 1KQ8A 1PO13 2WWSA 2DO7A 2JZYA 1REDA 2R041 2JE9A 2XPWA 3T2OA 1E5IA 1Y9QA 3RKQA 3WX5A 1SVLA 4BPZA 2W25A 1UOFA 4CU8A 2KRFA 1OCRH 3LL7A 1J5YA 3V8JA 3CUOA 3AYEA 1FP2A 3PUAA 5ERLA 1H6YA 3AYDA 4AIDA 2DVAA 3USUA 1MQTB 1UHWA 1OYWA 2XDVA 3DYPA 4BJTA 5K8SA 2XVGA 3GMEA 1YG2A 4DXTA 4EGZA 1FMD1 2ZS6B 3QOEA 4HW0A 1CIWA 5EP9A 3V4GA 2OUJA 5E20A 3GNEA 2ZMKA 2QZ8A 5JVTA 3N7LA 3SEEA 3LPGA 4XFAA 3HQXA 2WAQN 1R081 4YFWA 4CO8A 3T5XA 4R9AA 3P5BA 4U0YA 1WLTA 2VKHA 4LG0A 3VD9A 1AJKA 2ZX2A 2WFF2 5EJ3A 1BR4A 2PMZN 4B7EA 1TNTA 3M3YJ 3BG9A 1UZYA 4RM2A 4EN6B 4ZZLA 1ZHFA 3B02A 2QKLB 4C3JJ 4AEMA 2G9ZA 1B72B 5K1YA 3OIPA 2OA2A 1WQ2A 4LO6B 5DPNA 2RV8A 5BNGA 5EG0B 5JIAA 1EF4A 5L3GA 3IH2A 2VQ0A 2VOVA 4EM1A 5TSWA 5CG8A 4XJ9A 3H0DA 3I55I 2E36A 3CC2I 4A3EJ 1IKQA 2WFPA 2ACJA 3WP4A 2G7HA 5DD8A 3VBUB 2XSDC 4FE7A 2GIZA 3EQEA 3UR3C 2BBAA 2VW2A 3ZXSA 1PIV2 1OQYA 4Q1PA 2DPUA 2K9SA 1VBE1 1BIBA 1BKZA 3KCCA 2VO5A 3QQAA 1UAAA 3I2OA 3E6MA 4KWLA 5IFPA 1G4DA 1V6IA 1NK2P 1W6MA 2K9ZA 2QCSB 1RIOH 2WADA 3H7JA 2WZ8A 3ON7A 1V4RA 2L7KA 1H88C 2ZX0A 4AEJA 2VONA 3CCUI 3AP4A 1ENSA 2JE7A 3D5OA 3OB8A 4GWMA 2DMUA 1RGSA 2PN6A 2STTA 1ERDA 4OCTA 5FZ9A 5FDBA 2B63J 1WCQA 2R073 3EUHC 1WZ2A 2KRCA 4B48A 5A70A 3OYDA 1UYXA 5TGTA 3KT7A 4K9SA 5ERIA 1HKTA 4QDRA 4QKBA 1W6NA 2C9AA 2ID4A 4FQGA 3PVBB 5BNNB 4S2DA 3LAPA 1SFPA 2WZR3 3HBLA 1UYYA 2YDEA 4CHUA 2JA7J 1TMF3 3SCFA 4ZYDA 3HT2A 4FP3A 4FAGA 2RS31 3DTKA 2CWMA 1BMV2 3I64A 1RUC2 2R1DA 3BWGA 5IJRA 4COZA 1S72I 2NOJB 1Y8QB 1OHFA 5A3OA 3BR0A 3IH4A 2P4EA 4A3MJ 5BNOC 3O1SA 4E8DA 2VNOA 5D4SA 5CA6A 3OJBA 1O6UA 4AFBA 1XE0A 5E88A 3ZFFA 3M70A 4OYUA 4XJUA 2Y75A 1HW2A 1S7OA 4WX9A 1PO11 3KLSA 1ETVA 4XAAA 3HOXJ 4EJVA 2E2IJ 2W08A 4AI9A 2P5KA 4Y7NJ 2L7ZA 4UB8C 2DN0A 2LBFB 4EZ4A 4M71A 1D0YA 2V4AA 1ZR4A 3ITQA 2VXJA 3KPHA 1AL23 1HV0A 2WAAA 3T0AA 1JUSA 1XYNA 1HOMA 1G9DA 3BZCA 4QPWA 2Y8KA 4BISA 2XRNA 3KQRA 4A2UA 1R091 5C8CA 1K83J 3VZJA 1GP5A 2JX9A 5GAHJ 4H4KC 1W6PA 3L2YA 1Q3EA 3S5QA 4PDWA 1Z7LA 4NPLA 1GVJA 1AXZA 5D5VB 5T50A 4S05A 4MO3M 5BNPC 2PXJA 3QRFF 3G4SI 3JW4A 1ULCA 4NWVA 2D6OX 2Q2EA 3CEWA 3OR2C 3GF6A 5TRDA 2A5YB 1A36A 1VQMI 1T2KA 1VMFA 4XIKA 1LECA 1ULOA 4ZS2A 1GXQA 4AI8A 4IHXA 2BW3A 1F1ZA 1RIRA 2R0HA 3M3QA 3U1KA 2HEWF 2VLAA 4F91B 5DQ0A 4XF9A 3PU3A 3MKYB 3WNMA 2OZJA 4YGCA 1AX0A 4EJRA 4BK4A 5FPVA 5AC91 2DUOA 3KCYA 1MDMA 1KGSA 1W9YA 4Q4ZF 4HKLA 3ABKH 3RS6A 2BRTA 1ZA4A 2AREA 2OD5A 2WA0A 2Q8KA 3HT1A 1WD3A 4F55A 3ORJA 1OT5A 2CWSA 3WCSA 2L0KA 2HYFA 2VQHA 2V9VA 1QA6A 4EN0A 5FPBA 3JRGA 4B3XA 1X1DA 3JRDA 4IOCF 4UOJA 4GGGA 3SEQA 3DKXA 1CAVB 1J58A 5A7PA 2IW5A 2KIUA 2W0XA 4HEA2 2XHNA 1Q43A 2RDRA 5AIPA 3ABTA 3E1SA 2ZXWH 3AL0C 4DYQA 3WNNA 1PK6A 1HJFA 2CQKA 1QJY3 5A1AA 4KIFA 1QQIA 1DG6A 4F7ZA 1UYPA 5ACA3 2AS5F 1MS5A 2MYSA 4LKSA 2IVMA 1FIPA 2BE5F 4PK4A 1K42A 1NOVA 5FPLA 2JG8A 2VVFA 4G94A 3V42A 1NQJA 1QJX2 2JD4A 1ON1A 1QBJA 2E7WA 1VRBA 2ZEWA 3M3CA 4LGWA 3BTAA 3VKNA 2W85A 2WRAA 4CRQA 1YW9A 2RAEA 2QQJA 5SV8A 4FISA 4H2AA 3R4KA 4FFFA 3ZSJA 3GWZA 4H14A 1RHI2 3CJIB 3BVCA 4XOTA 3UESA 4RR3B 2GN7A 1Q8QA 3I3LA 3JTHA 1ASJ3 1H9WA 5CFCC 3GBFA 1S6LA 1UYZA 4DQAA 3LQRA 4NHLA 2R042 3PFYA 1ENQA 2AH2A 3OS1A 1UY1A 2SBAA 4HONA 4KMQA 3HJRA 1HSTA 1X58A 2QKMB 2K85A 4AQTA 3TL4X 1NAEA 3MCZA 2YX4A 5I0DA 2EIEA 1KJLA 4DNYA 1IN4A 1NA1B 2JIGA 3LSKA 1ONAA 4HBLA 2HS5A 1S0EA 3PO3J 3WDYA 3JZVA 2GN3A 4AI2A 3O0VA 1W0NA 2ORZA 4PSWA 5F08A 5FD5A 1KRIA 4WVVA 4JKLA 2VQAA 5FTTC 1WMFA 1ZZBA 1VQKI 4R9BA 5GM0A 1VAKA 2XAGA 5FYBA 2IS4A 2JDYA 3BTIA 2EIDA 3I2KA 3NNJA 1D7PM 3VBFB 3L1PA 4FI9A 2QJVA 4XLHA 1ZZCA 2IS2A 3HOTA 3DYMA 4YWAA 3A22A 3KFWX 3M1HA 3PSFA 2E33A 2C9KA 4HG2A 1UCRA 5FZ8A 3JXSA 2H8WA 5A3WA 4S2HA 1CPNA 4CDXC 1W2TA 4HPQA 1VP6A 1TME2 1LODA 2PHUA 3FL7A 3OMYA 2D40A 2QSHX 2SLIA 2VI6A 3CCRI 1UELB 3BU7A 1Z78A 1YS6A 5LK5A 4PI2A 3KYDB 2M87A 3WU2C 4RFRB 2BBYA 4XYXA 5F1RA 1IRZA 1TT0A 2ZFWA 4O6JA 1X4PA 3IB3A 1Z05A 1AA7A 4KQ7A 4HG6B 3DBHB 2JVHA 2A3XA 2CFOA 4AAXA 2OU2A 4B7KA 2X5IC 4ON0A 2GBYA 3FXOA 3UNGC 4LE3A 4NE9A 4B8EA 2HNHA 4ZZ8A 2GOXB 3ZXGA 1PIV1 4IL6C 1H1AA 1BBYA 1VTNC 3OBTA 2L02A 3LSRA 1QJU3 2BGPA 2BOIA 1S9HA 5IK4A 4C8DA 3ZIWA 1K4SA 4XUPA 3QP5A 2ZO4A 4PI0A 1IG0A 3I3BA 1OOPB 4FHTA 2XRLA 2ZGLA 3SZPA 2FCTA 2NZ9A 4N53B 1R6RA 2QQUA 1U9NA 1QZYA 4M3EA 3WV6A 3BR5A 3BCWA 2IA1A 1POV3 4PQQA 2O7OA 4U36A 4JGYA 3CP2A 3U1XA 4PJ0C 1I50J 1EUTA 1F43A 5APAA 2IGKA 1OFNA 1U78A 3AB0A 1XE7A 3AMQA 1RNLA 3KD4A 3ECOA 2VMCA 2E7QA 3M7GA 3R05A 5JR2A 2PELA 1LPQA 1IHMA 1XPXA 3J7HA 2XF7A 2GU9A 3CMAI 3NNFA 1R22A 1UKRA 4O9EA 4I0WB 2VMIA 1SFOJ 2P5VA 1PK6C 4ARYA 4NROA 2CG4A 4IVNA 1IF1A 1AVBA 3WOGA 5FYTA 1EA3A 1O91A 5LWBA 4ASNA 2GXGA 4FTHA 3ULQB 2YY1A 1GZCA 3A0NA 1RUD1 1UZWA 4HF1A 2YROA 2E32A 3S30A 1AR71 2F2EA 1TQMA 2WQ8A 3AYCA 3J7AO 3BY6A 1VBC3 3SH4A 3Q9OA 2LBFA 1N1YA 3I54A 4KJZA 2VUJA 4XABA 1TW2A 2JG9C 5FKBA 1XD7A 2BFUL 5AVAA 3J9SA 5EFUA 4XBNA 1DQ5A 5DZGA 4BB3A 5F1JA 3FHZA 3ZPYA 1I5ZA 2ILMA 3ZXKA 4MX3A 3N7JA 1B72A 1HBXG 3B01A 4DJAA 1DQ6A 1T56A 5EZHA 1FSEA 5GZCA 4N4OB 1ZELA 3MV01 1H89C 5A3MA 1N1TA 3M4FA 3LSMA 3MZ8A 3S7EA 5KHIA 1W8HA 1LOEA 1R5HA 5FY4A 1XMKA 2PJPA 3JREA 3HM5A 2HYXA 1BI0A 2A3WA 4GH4C 3GZUC 5LCWL 3URFA 4XE9A 1WWYA 2R30A 2I74A 4CUBA 1P92A 2R0QC 3PTYA 3C2GA 4E2QA 1FI2A 5F04A 4XLCA 4OINF 3P5JA 2ECCA 2K3FA 5KCMA 4LLNA 3WW3A 4B1MA 2PYTA 2DA3A 3ZOBA 2ZKZA 3E5UA 3R0AA 1UU6A 3D8CA 3BOPA 1GV2A 1TLHB 3CF6E 4OHZA 2PHRA 1F15A 3BPVA 3ZFEC 5LFAA 4FASD 2XF5A 3C2UA 4UF0A 2A3YA 4DO0A 3GHNA 2ZXJA 4M00A 1MSEC 4XCBA 2G9GA 3VBSB 2R7XA 1MBGA 2K4BA 5C8CB 2W5FA 3IP4B 2WC2A 1OR7A 4CXFA 3VDDA 1D0ZA 1Y1VJ 5GAGJ 2ZSHB 3OBRA 4D1QA 1PO12 4XLEA 1QGPA 2ZACA 2JDMA 3OGGA 1XCBA 5H9PA 3VPRA 3CUQB 3FM5A 4KMUX 4CDUC 1DFQA 1SLTA 3DPUA 1ZG1A 1UIJA 3I59B 1TWFJ 3I2JA 2CAUA 2FQPA 4LJZF 3LNQA 5FZLA 2W1UA 3PUIA 2OQRA 3N4MA 1QZZA 2A6HF 5M5XJ 2GNMA 1OXCA 4Y22A 1VAMA 2JDUA 3KLOA 2F4OB 1RUH1 1DQ0A 4LHNA 4BEHB 4KBBA 3TN93 1R1A3 3DV8A 4A3LJ 1SANA 4RS5B 4LPLA 5DG1A 4DXZA 1HDDC 3QLQA 3U14A 3OOXA 2OT7A 5F39A 3GLXA 3L2HA 5EXOA 3BN6A 4GXOA 4XSXF 1JKOC 3SEPA 2WQ4A 2OS2A 2WFF3 4OI0A 4BE2A 2V72A 5F64A 5L7OC 1HXS1 2FA5A 3BCBA 1RMU3 2ZZJA 1A31A 2JENA 1JI8A 4QKDA 2IXHA 3LDRA 5T5LA 2O14A 1V6KA 1O59A 2XKPA 1CESA 2JUGA 5C5UA 1DUXC 2J5OA 2H6CA 4H55A 1F4KA 1UXZA 3ABMH 2VOPA 2DW4A 2XLAA 4NHMA 2Z69A 3EMRA 1YQ5A 5J96B 1IN6A 1HXS2 3QWLA 2MH9A 4AC0A 1HXDA 4RAYA 1K7AA 2Y0SN 4XF4A 2ZJRF 1PO23 2IA0A 1WCKA 4B09A 3NJZA 1HKDA 1HRI1 3NO8A 2W1WA 4B43A 4L2NA 1TMF1 3IT8A 4D94A 1OPOA 1TBXA 3SKVA 3NRUA 4WM7A 1E17A 1PP8F 1OLRA 2E1MB 5F27A 5FK8A 3TAYA 4DYCA 2HWB2 3OS2A 5GLTA 5DM7F 3AKPA 4HV5A 4L9VA 4LO7A 3O2PE 1Z1DA 4CCLA 2JEMA 3MZHA 2E1CA 3RQ4A 3AFGA 1VRH2 2Y9ZA 1IJWC 2Q8DA 3Q8BA 4RHV2 3RZJA 2R072 3VBRB 3FF5A 2K4JA 1ZGAA 4LK0F 1OPCA 2KMUA 5F0FA 5IVCA 1YRNA 3IUOA 3OYMA 4AI3A 2MD0A 4B4CA 1ZNPA 4FPKA 1TW3A 2FXAA 1B09A 1FOD3 2R7DA 1SFXA 2A70A 2QDRA 2LALA 4A6OA 4WK8F 4SLIA 2KHMA 4JCKA 3TYJA 3JD73 3SZGA 5I93A 5JIUA 1XRUA 1AU7A 1JN2P 2YUEA 1YX5A 1ZVFA 3LA7A 1K6YA 1AYM1 4BE0A 3OYNA 1VALA 2EPFA 5FPAA 4Y22B 2CV6A 4Y4RA 3AP6A 4M4PA 4RMNA 2LS6A 3BR1A 5FY7A 1KYZA 2XGXA 1DQ1A 4V2FA 3KF5A 3RPUD 3ZYIB 2W57A 3HRTA 3OYFA 4Q4V2 1W6MB 1DLLA 3ZN6B 2M1BA 2PBIA 1FT9A 5FLVA 4IV3B 4NIDA 2OTLI 3I49A 2VM9A 2HPMA 3AL5A 5DDGA 1V9U2 1ETYA 4RGUA 3O3KA 3F8FA 1UFMA 2BZTA 1W7PA 1ON2A 5CFDA 2LW8A 2D44A 5CFCA 3RZLA 1YI7A 3KIOA 1Y39A 5IAXA 4KWUA 4E27A 3WW2A 1FX7A 2H09A 2RS12 4GKXA 5EV7A 1XGNA 2WT2A 4KL1A 3JBG1 1H8VA 1FPQA 4N9IA 3WNPA 3OEBA 2X9DA 3INAA 2OC6A 1LGCA 1W6OA 2NXNB 4JGZC 4I02A 1X19A 3M8FA 2TCTA 1C28A 5FRNA 4PCQA 2QQIA 2P3YA 1Z6RA 1A78A 4RGKA 3OBAA 3WTUC 4CVUA 4ASMB 3ZR8X 4YRDA 4OI4A 1BOAA 4IV1C 1NK3P 2X1EA 2LSOA 1PHMA 4FVVA 3NJXA 4LBMA 2EQRA 2YX7A 1O3QA 4CZCA 2LMDA 3OUJA 3AG2H 1HKSA 1LHUA 2A6EF 1QU3A 2DQRA 2Q8EA 5FROA 3K3OA 3NARA 5E8IA 4P9WA 3DPRA 3WD5A 4LO4B 1GLHA 1ACIA 2CW8A 3E6DA 4YVSC 1AWCA 4WM7B 2PJRB 2PMZA 2VZTA 1W0TA 4CXYA 1NHAA 2ZGPA 1SLLA 2HEOA 3G6EI 1RVF3 4XF1A 2WNEA 3I2DA 5GLUA 4JBAA 4B3AA 5A2QK 4OAYA 1USTA 2ZHLA 5EJ1B 2WN2A 5CKTA 4AGGA 1SHWB 2ZEXA 1PVC3 4BMBA 2WY8Q 2BERA 4DNCA 3ERMA 4BYYA 4HVOA 4WZCA 5E1RA 3OS0A 1W5CC 5F9TA 4EV0A 4ENKA 2WYSA 1BR2A 2E5NA 1RC9A 4CYCA 3BUCA 2BNNA 5E1ZB 1SFEA 4M9ZA 3HPHA 5IYYA 5D8AB 3A7QA 2KXLA 4IF4A 1GYKA 3WUDA 4GMP3 3ZGKA 2VMDA 2QKDA 1VQOI 4AWDA 5A3LA 1F4AA 4DY5A 1HV1A 2B9VA 2ZMEA 4FFGA 3SQNA 4DBQA 2X29A 2Q8CA 2BY2A 1X7NA 4Q1RA 2F17A 1CQTA 5H9SA 3CJRB 5GZFA 2CYYA 5JHUA 1RHI1 2RR13 3C8XA 3PNVA 3FUQA 3ZFFB 4G8XA 2QWWA 4KN4X 1NLRA 1GZTA 4KGQA 5FZHA 1AR93 2J1TA 5IVYA 1YJWI 4V19K 1T08B 1BLZA 2EIGA 1SD4A 4HOOA 3WF0A 1X2MA 3KS7A 2O1QA 2IFWA 3ZXJA 3M07A 4QQHA 1OLQA 3WZ1A 1LULA 4WM8B 1FOKA 2DJIA 1PNFA 4E9KA 3BKZA 3GTLJ 2FDKA 2Y6KA 2PMUA 4CDXA 1JKRC 2VW1A 1DGRA 3H50A 3H42B 1FJLA 2JA5J 3AZWA 2BBVA 5IP9J 3VHRA 3ZPOA 4LFUA 1LEBA 4ET7A 3R6SA 1QJU1 4ITCA 2O8OA 4Y20A 9ANTA 1FV3A 1ZRIA 4Q47A 4R52A 4WM7C 2DPDA 2FMLA 4YGEA 3PURA 4HANA 4CP9A 2B42B 3T8RA 4FPYA 2DT6A 1O8SA 1JTYA 5JSOA 2P1BA 2ZNZA 1F2NA 1C1FA 4Q4V1 3FBIB 2DYRH 1JXNA 1TVGA 2FZ1A 1A5JA 3FN9A 1L0OC 1YC61 3R0RA 2AACA 4O9GA 1K79A 4JAAA 2RMU2 5LB6A 4MHGA 3QD6A 3SMHA 4QPIB 4QPIA 3Q5FA 3W20A 3CO7C 4HV6A 4UFJA 1ZZ6A 2F6BA 3WF1A 5T52A 3WQ0A 2QVOA 1TNRA 4B8XA 1KZHA 2UY9A 3HOBA 4UFKA 1Z21A 4G4FA 5GAEJ 2MSYA 2E7TA 5E16A 1CAWB 1O5LA 5L19A 2FNPA 3MEXA 3F8CA 2DCKA 1MEC1 4JTNA 1TG7A 1I6XA 1ASJ1 5KVRA 4XF0A 2DQLA 1SBEA 1Y9GA 4Q0UA 5FK7A 3C7HA 1X1CA 1LKNA 2Q4SA 4QHZA 2HYJA 2HQNA 4L9NA 4YG0A 4N4NB 3GFMA 4XQDA 5FZAA 3VBHC 5LGUA 3CU7A 3VL8A 5AFEA 4K6BA 2FMDA 1L7RA 5IHRA 1QHDA 1RUH3 2YB7A 4L0ZB 3MBWA 3VBRC 4JKKA 2PHLA 1G3WA 5HV0A 5EEHA 3H8OA 1R00A 5FOJB 3F6OA 1FBUA 3ASOH 2W00A 2W24A 4PJNA 4BHBA 1MMSA 2HWC1 3SCGA 1FYLA 3J81Z 4MV2A 2JWTA 3WHUA 1MJAA 4QD2A 3WLUA 5FZIA 1B9NA 4NWWA 2E34A 1NA1C 1NCQC 4BWOA 1HQCA 1UU4A 2NVYJ 1WMDA 3AVSA 5EHDA 5BNPB 2PHWA 4A3FJ 2FDHA 3LEKA 1QOTA 4JTOA 5B66C 3TB0A 3H1YA 2NNYA 4Q0SA 2YPRA 2KLOA 4HMZA 1REPC 4QB2A 3GGLA 3GM8A 4G6DA 3H9JA 2CQNA 2QQLA 4E7HA 5CNAA 4EWDA 3CL1A 1V6JA 1YFWA 2JDZA 2VD7A 2X10A 3OYGA 3OSFA 4Q29A 5GZEA 5KAIC 2Z33A 4C90A 3V65A 1SLCA 4QSHA 3FBMA 3HR9A 1MDMB 5DMYA 1VBC2 4MEXF 4Y4YA 4JHTA 3WTWC 2KIFA 2MFZA 1MSFC 5HLGA 3DL3A 1PYVA 4LBOA 4GH4A 1BI2A 2MA3A 3MIFA 5KHJA 3PUFA 4D9JA 1LFUP 4XZUG 2IXIA 4XORA 5FZ0A 2PHFA 4W1UA 4RYDA 3M7AA 2NYYA 3GFJA 2Z42A 1G3YA 4R4ZA 2DXIA 4OOIA 3S57A 4RLQA 3ZMNA 3UGFA 1IZ1A 1NX9A 4META 4Q4Y2 4FP2A 4XBLA 1L3LA 2Y6JA 1ND2B 1ZGJA 5IVBA 3TW6A 4ZU4A 2DMNA 2A61A 1W4MA 1R23A 1W0PA 3FHQA 3DKWA 3VYSB 2OQGA 4GDFA 2YYOA 2XHKA 5EYRA 2M4GA 3RNSA 4BXFA 1WBFA 2LK2A 3BTXA 3KV5A 4CEWA 5KHGA 1FTTA 1UIKA 5FYIA 1KXGA 4ATEA 3SFIA 2WO1A 2DMTA 4ORFA 5JCTA 4B47A 2Z9OA 2VODA 4D3WA 1YW8A 2X05A 1PX3A 2XJVA 2GA1A 1TL8A 3ZN0A 3OY8B 3BOWA 1IRFA 1ODDA 2WTEA 5IYDJ 5ICGA 2RKHA 2XB6C 2BV6A 1HQLA 3HVDA 5C70A 3M3IA 1OF3A 4XXPA 4CDQA 2VT3A 2IXKA 2LREA 1MH3A 4YM3A 2LF7A 3N35A 5HLIA 2RM23 3VBOC 4YZ2A 3PQJA 1OI6A 1SBDA 3SH3A 5JPNB 2VC0A 4NR1A 3DXJF 1SC7A 1QJZA 1KU7A 4ZYGA 2WV0A 4C2TA 1ENHA 3E97A 3W6JB 1BCXA 5JVGF 3VZNA 3HN3A 4CDUB 3IDAA 2P2KA 2VCAA 3ZQHA 1IQDC 2RQQA 4ZXKA 4Z92B 4KT5C 3FMGA 3JQWA 3ST7A 4Y17A 4GALA 4JGYC 1OCPA 1PVEA 1QQP2 4EMSA 4IEXA 1JOPA 4HKOA 3EUHA 1L7LA 4GFBA 4PLNA 4X1EA 2ZB9A 2QGUA 3H9GA 1BXHA 5D5WB 4BQAA 2X5IB 1RUI3 2EICA 1JMUB 4A0ZA 4PCRA 3NAUA 1MS8A 2FU4A 1W3XA 2RGVA 3GZNB 2P5LC 2M0MA 5FMBA 1W28A 1ZG5A 4D5FA 1YITI 3IPVB 3HHHA 2NRAC 2HDWA 3SNMA 4Z2AA 3J7AY 2ECBA 5D8AA 2COBA 1AR83 1WCMJ 1CJDA 2CU5A 1RUD2 5FRMA 3OYKA 3QAHA 1W6QA 4BQXA 5A7SA 3DEEA 1E3PA 4X6AJ 4LEJA 4CYCB 2WAFA 3B9IA 1MIJA 4O65A 5FXZA 1Z6TA 2JG8B 3RYPA 2RNJA 4YGDA 3LSDA 4HQEA 3LCPA 5LA0A 2UY8A 2WB1N 2HVRA 2P3JA 3ROUA 3KYCB 4NHKA 1J2XA 1OKRA 4QQOA 4URAA 3MLJA 4HPKB 2STWA 3ML6A 4N7IA 1OD3A 3T4VA 3RPUA 3CCJI 4LJHA 1MS3A 1XNCA 2LFBA 5M5WJ 1QKQA 3KT4A 3K0LA 1OLME 2ZNYA 2RN7A 3P1IA 3UJOA 4LBJA 2HWF2 3G2BA 5A1FA 2CS3A 3LSJA 4RFT0 3UT0A 4OFGA 2YPJA 1HW1A 4J01A 2B46X 4L5IA 3IMNA 3UGGA 2WINB 2HYGD 4LA3A 3F3XA 1AHSA 3LIGA 4OU0A 3DWLE 2ICWG 4NC6A 5EWSA 2FMYA 1KD7A 1S3JA 3T2PA 2G4IA 3PFIA 1JT6A 5LGNA 3K2OA 4UV9A 3Q0VA 3S14J 2CGOA 1DGRM 5EGOB 1YJKA 4YIFA 2I5UA 2J1UA 3USUB 5CG9A 4RAGA 2F4PA 2R071 4D6SA 2JRTA 3B7MA 2MBFA 2Y6FA 3WTSC 1D2SA 2J1EA 1O7LA 1P6RA 1SDDB 3CDHA 1BM9A 2O6GE 3GO5A 1RUC1 5IK8A 3HQUA 3OYBA 3BLYA 3PUSA 2L4AA 3ZQIA 3O12A 3I9V2 3GHMA 4QPGC 4OMYA 2EV5A 4M3CF 1YHFA 1IGNA 2XUEA 3RG0A 4CDXB 3IL2A 1QIQA 4LORA 4Y1UA 1NQDA 2IXJA 4RA0A 4A6DA 4NDLA 1ZM1A 2CAVA 4WVZA 1UHMA 4L9BA 1UZZA 2XR4A 3H3UA 2W39A 2NMOA 1WMXA 5FKKA 5HLHA 1DQUA 3PIGA 4GAZA 5GJ6A 3ZR5A 1UXXX 5LASA 1V9U3 5JMOA 2CJJA 4NHJA 2Q0OA 5C9AB 3K6GA 5D1IA 5B1BH 2Y6LA 3DEMA 3FUOA 5DDJ1 2B7YA 3MFAA 1J9IA 4IRHA 1YIOA 5KC6A 3K4CA 4J19A 2JKXA 5L73A 2MPFA 3QOPA 2BY0A 3HTUA 4XIOA 3HXLA 4BE3A 4BQ3A 1GDTA 2LKSA 4YARA 4F8AA 3ASIA 5HS7A 3PUHA 3VBFC 2DA5A 4EVIA 3VB2A 3FISA 1MBEA 4JK1X 1X9PA 2DFIA 5J1YA 4IQPA 5LEKA 2LDUA 3IDEA 2VJ4A 2W68A 1N47A 3RZDJ 4XKBA 3DBRB 2IUWA 2QYOA 4OULA 2JVGA 4BACA 1APLC 2LOOA 4AIKA 2CV0A 4DXSA 1K5MC 3BZ6A 2XUMA 1B35B 1WZXA 2VJXA 4PF1A 3GTOJ 1R5ID 1OISA 4YFKF 3MFCA 4IE5A 3M8LA 1D4M3 5FYMA 4IZZA 5I91A 2F4IA 1QPMA 3HG9A 3OOUA 1H8TB 3LA2A 5SV5A 2EXJA 4BIOA 5F0HA 3N05A 2CV1A 3GXUA 2VUAA 1VBA3 4L99A 4JZRA 4NRPA 1WCSA 1ALYA 3WODF 1SQ4A 2IGOA 2OF7A 2MGQA 3CZ6A 1Q8SA 2VBDA 4MEYF 3S8PA 4AEKA 1PGW2 1PNGA 1XBFA 4HDUA 2ZGUA 4BLJA 4AUXA 5K9YA 1AL21 2V5DA 1SD6A 3VDXA 3U2RA 4XRSG 1V6OA 5FMCA 2NQYA 5FPUA 2IXLA 1OFSA 3GVAA 1TE1B 1PVC2 3NJVA 3UL2A 5A7QA 1HF0A 2CL2A 4QAWA 4FTEA 4COUA 1AHDP 5H20A 1NT0A 4IW3A 1Q8PA 3RI4A 5FKNA 4E7SA 3MN2A 2OTJI 1F31A 1ZYBA 3K77A 2VECA 1XCVA 2BVBA 1S0DA 2VZ3A 4UFMA 2XJPA 1J3PA 1H2LA 3P9CA 4EEFG 4Z2YA 3ZKYA 2EXKA 2P7CB 5HV4A 4ZTJA 4HBNA 4MGZE 2WA3A 2VKDA 2XBO1 3JBG3 2GP5A 4AWXB 5AONA 2XONA 2KPMA 2E35A 4NIAA 1BW5A 5JLXA 3JU9A 1YJLA 4XNFA 1RUG3 1EH7A 2MNGA 2X4HA 3BG3A 1V5EA 4YGBA 1CGPA 2WNUC 1S7AA 1NCQA 3S32A 4JX4A 3M9AA 5IPAA 2XGCA 5HVQC 1AR92 3ETPA 4RB1A 4HF0A 1LDKB 1WCDJ 1WH5A 1MKMA 2F4MB 4KN7X 5HDKA 3OYHA 1QZEA 4Q5OA 2Z3YA 2O0OA 5FXXA 2ADEA 2VZOA 2VC9A 3T8TA 3PNAA 4IEUA 4A3XA 3V7RA 3ZQQA 1XYOA 1AYN2 3OSDA 4A4AA 2CH0A 1R092 1LJ7A 2MABA 5K7ZA 1AZDA 1SD5A 3OYCA 2PHTA 1I3HA 2WKKA 4XM3A 5LZ6A 1GUIA 3CCVI 3GZ6A 3I3EA 5FJKA 3BR6A 4CU7A 2CO5A 1UW8A 1X3UA 1B59A 2Y0MA 3C7GA 2J42A 2FSWA 4Y1XA 1D0HA 1OH3A 5IVJA 1RXGA 2MC4A 4XAEA 3IAM2 2DOEA 1G9CA 4F83A 1JYCA 3V0AB 1XGSA 1PM7A 1QNYA 3K4NA 3VD7A 1LOBA 5F5QA 1GHCA 2DU0A 4P5YA 1J84A 4CUCA 4DUVA 4QGMA 4BU2A 5EYXA 1N1SA 5D6EA 1FMWA 1DU3D 3ZYJB 4MIMA 1VBE3 5C3QA 2Y6GA 1SFKA 3ACHA 1TQIA 2GMEA 2E19A 1QNTA 4HX7A 2MEV1 3N9LA 4X0GA 5F37A 4PJLA 2QQNA 2K02A 3CNAA 3OEAA 1BVVA 1DLCA 1W6PB 2O8KA 2W3JA 2DTRA 3W2AA 1LE8A 2FE3A 2UWCA 2AHQA 4KGGA 4OMZA 2X6WA 1K3IA 3NQHA 4YG3A 1HA8A 5LBFA 4QPGB 4KUMA 4A5NA 1RJ8A 4QX2A 2JE8A 5FY1A 1BQPA 4OQ8A 1H2KA 1DDLA 2ZGOA 3FFQA 1JYNA 3FMRA 1AJOA 4P5HA 2YGMA 1JBCA 5ACA2 4BDZA 4IO9F 3MKLA 4NPRA 1X3WB 4R9DA 1XGOA 4CDWA 3HKZA 4KG0A 3H5RA 2LH9A 3EQLF 1JYWA 1UWWA 5TJJA 1MS9A 1UX6A 4B4RA 1YHQI 2YBSA 4NO4A 5IT9Z 1LCLA 4NNJA 4CDUA 2FNAA 3T30A 4UW5A 1HN0A 4IGPA 3CF5F 2KISA 1OVSA 3D4KA 4A42A 2OCEA 1B35A 2BDRA 5FZ1A 3L2QA 4W6YA 3RSJA 5FZKA 4M3CA 4M9SA 1GV5A 1RHI3 1YQ8A 4OMDA 1GSLA 4LMYA 2W87A 1SACA 1XE8A 4QX0A 4FTBA 4ESFA 2Y31A 3VKMA 3J80Z 3OYAA 1ASJ2 2QQBA 3UJQA 3WINE 1V6LA 2R043 1EAH3 1LAJA 1W8OA 3S0MA 2XL7A 4AVCA 5FP9A 4L9TA 4RAZA 2J22A 3M3EA 2W52A 2C24A 3F2ZA 5FYHA 3VDCA 3QPLA 1VBB1 3F72A 4GYGA 4UWDA 5FMOS 5K4LA 3JAMK 1YEWA 2EXHA 3CIHA 1IS4A 4LD5A 4M74A 2WY7Q 1VF9A 2DI3A 2WFF1 3L7WA 2CQ7A 3C7JA 1KQRA 5AC92 5BPIA 1M4WA 1NE6A 2PX9A 2QFEA 5B5EC 4MGKE 3LPFA 4II3A 1F35A 4UB6C 2IVJA 4QGNA 1Z7S3 4XUOA 4A7YA 5BS6A 2F5FA 1KQ9A 2AXTC 3EYPA 1CAXA 5KK1A 3V0BA 1W8ZA 2GWRA 4FE4A 1W90A 1MR5A 1DHKB 2DU1A 5DCMB 2LP0A 3VHNA 2X53S 2F48A 1LNWA 4N8MA 3GTPJ 3KE2A 1QRYA 2R7TA 2P5BA 2LY1A 1UCXA 4GD4A 3VDAA 2D93A 3AVRA 4Q4Y3 1TME3 1BEV3 2E1MC 1KS4A 1TWCJ 2CGPA 3BTYA 2XH6A 5TISC 2JDNA 3MPBA 4L97A 1CZTA 3J7NA 4Z8BA 1HRI2 3EETA 1MJBA 1I5PA 1NG0A 5HCHA 2NAZA 1JH5A 5L9BA 3LA3A 3MEPA 1C5HA 2EAAA 1YIFA 2XQXA 4RQPB 4C0HA 5JPMB 5F2SA 2YMZA 3N3HA 2X1CA 3BJAA 4NB5A 3ZYPA 5FOBB 1NKGA 2A7AA 2VAUA 5LW9A 1W36D 4BHCA 4AAPA 3R0JA 4NMIA 5A3TA 3WTTC 3BQZA 1HB4A 2ZGTA 1T98A 4QX5A 2Y0IA 4Y20B 1J09A 3FHNA 3VBHA 3A0HC 1XMXA 4KYWA 4UFHA 3ABZA 3S3OA 2M0CA 3U4XA 3OOPA 5F32A 4OIOF 2ERFA 4IV3C 4E4SA 3K3NA 4FPCA 2FQ3A 1IN7A 1PO21 3IDBB 1UO9A 1DU6A 4RR3C 4AL9A 3OYLA 2LRPA 2ZGNA 5C4WB 2HZTA 1GP4A 3RWKX 3DN7A 4RBOA 2KQRA 4EYUA 2VCBA 1O5UA 1QQP3 3S3MA 4MHRA 1W9SA 3CJIA 2R7OA 4MO7A 3OCPA 4XRFA 4MGRA 3DPRC 3IHUA 5FV3A 4A6EA 3DECA 2B0LA 4DMIA 5C4WA 2XB5A 1U5ZA 2JDHA 4F93B 2CUFA 1R4MB 3O1VA 1WFXA 2XVCA 3N9NA 4L0PA 3KGLA 3H3VK 1IRGA 4O5VA 1YE9A 1O4XA 3G71I 1G6NA 1YRZA 3VBHB 4HL0A 3IAPA 1YYVA 1RUD3 3TO7A 1STMA 4Q48A 1S7EA 4J1XA 4CCKA 2PAEA 1FPN3 3PUQA 1W7PD 4COYA 2KJCA 1U0JA 2ZKNA 3AG1H 2VMHA 3ZFGA 3OBZA 4FETA 4R8HA 2P3KA 2EAKA 3ILFA 5DTDA 1LOFC 3LSIA 1RUC3 4XMIA 5D2AA 4AU7A 4OI2A 2JQ7A 1ULGA 1MMAA 1MEC2 5J36A 5T5OA 2K27A 5A1LA 1PDNC 1XX5A 2OIIA 1JU4A 4Y3OA 2BFUS 2DCEA 2GMMA 5DCFA 4HF2A 2ZAHA 5FD6A 3VFZA 3POJA 4E7ZA 1NCRB 1IS3A 1H9GA 1QVUA 2XIGA 3KP2A 1UOBA 1Y43B 4QQPA 4BHPA 2CFXA 2YSRA 4IHYA 1H8AC 4GJYA 1C1LA 4UFLA 5FJHA 4CEYB 3K10A 4KFCA 4MLOA 1BMV1 1W8TA 2OPKA 4LK7A 4MHUA 2LNBA 1JYIA 1ULDA 4HYEA 2D97A 1HJGA 3ZN5A 5DDJ3 2VPVA 1UOGA 2MLKA 2VJJA 3WE3A 1GQGA 4AFAA 3W5MA 4H3WA 4Y5Z0 4U7BA 3K4DA 1J7KA 4FPEA 4P5OA 1YI9A 5F6LB 1GNHA 2MEV3 3SEZA 1DPUA 3L2UA 4MGSA 2EIMH 2GLOA 3ECHA 5T5PA 5HNFA 1DQ4A 3FWEA 2P81A 3OGRA 4NHXA 1FNZA 1GP6A 4CE8A 1SEFA 2XAJA 4ZS3A 2O8XA 3FKJA 5J8CA 3GBGA 4IQJA 1CPMA 4BIFA 2WSVA 2QCOA 4CTEA 1UB9A 4QPQA 1LU2A 2M9HA 3LOIA 3VDBA 3GTJJ 4XMAA 2K0GA 3ZMSA 3AXDA 3RI9A 3HKZN 4R4XA 4IE4A 2HWD2 5C3RA 5J1RA 4YW5A 2P0WA 1YLLA 1UG2A 4YVSB 1ODMA 2DFBA 5IYCJ 1YW7A 2DVBA 2FQ4A 1PZ9A 2ID6A 1PGW1 1YYNA 3THPA 3EJKA 1BK1A 3MKWB 1CZVA 1COV3 1VFCA 1P4AA 1UZVA 4KNYA 1DDNA 2MH2A 2XC7A 4MQ9F 2MHFA 1B8IB 4NIGA 4FPLA 1BI1A 1LHVA 1O3RA 1UKGA 1W7PB 1RINA 2HDDA 2HVSA 1NXMA 4FTSA 1JT0A 3M1CA 1MH4A 1GXPA 2DBIA 3MVPA 1DBNA 4MSVA 5FYSA 1UQXA 2YU2A 4GRIA 5D5XB 2A07F 3ZRGA 2YGLA 2AGSA 2HOSA 3RKWA 1H9TA 3NNLA 2A71A 1LNSA 2AR6A 1W6NB 2QQVA 1DU0A 2DVGA 2M8GX 1ZTRA 3WG9A 3MUY1 1UNBA 5ANQA 4NQWA 3AX4A 1AOYA 2UWAA 3TKYA 4HN1A 2ZGMA 4PLOA 4XJWA 4QKNA 4FAHA 1R64A 1U8RA 2XF6A 3PTRB 3PU8A 2HLEA 3HQRA 4YFXF 2W94A 1HX6A 5HDGA 3K75B 3NNGA 4ISQA 4V2VA 4BMEA 3LKJA 4HNUA 2OW4A 1IOAA 4EATA 2GAUA 5FYYA 5E79C 4FQ4A 3K2AA 4K21A 1XDUA 1LRHA 4KWKA 4IXAA 2EZKA 2K9QA 5HS9A 4BQ1A 4IQ4A 1QO0D 1T8IA 2BVMA 3GZEA 3M2MA 3KHCA 1BK0A 2V4VA 3IWFA 5GP9A 2Q30A 5T5JA 1T2XA 5DZFA 2TEPA 3CJTB 3LF7A 3JUUA 5F3GA 5FZ4A 5JOXA 2D7FA 1ETQA 4P1WA 1GUUA 3NV3A 4NQWB 5LA2A 4QWNA 3VDDC 5C5TA 4K40A 1MVQA 3IAQA 3PLQA 4QXKA 2WAQA 3RKXA 5DAQA 3HMYA 1FWZA 2VVDA 5L36A 1MMGA 5DXDA 1T95A 1NTCA 1VRH3 2F6CA 3RJ2X 4YW1A 5E8GA 1KYWA 3WTVC 1K6OA 2UWMA 1QXJA 1ZBE2 3IKVA 3SITA 1A04A 2GA2A 3K7AJ 1TC3C 1CX4A 3CC7I 4ESBA 5B4XA 3VD4A 3GZTB 1HSJA 2W48A 3SH5A 1LVKA 4DFSA 3TP3A 2E71A 1G86A 2Y0OA 4Q0QA 4Q8LA 1T6GC 2R7FA 2MW8A 1WJ5A 4UUSB 2QQPA 1RESA 2VTXA 4DS0A 3G1MA 1FV2A 4RGAA 4ATFA 1NCQB 5F6FA 2R5YA 3ZXLA 1JZ8A 2V9PA 1RUG2 1RETA 2BXYA 1IS6A 4WBBA 4RN5A 1EH6A 3WGIA 2OXBA 4GH4B 2IA2A 2YFZA 2WWYA 2FF4A 3QBQA 2KT0A 3ZKUA 1K4TA 4QTRA 3ASNH 1X82A 5FQ0A 4UFIA 1XG1A 5J3UA 4BLIA 1V70A 1LFPA 2Y48A 1JZ7A 5FJ8J 3BP8A 3KEYA 2WO2A 1K12A 1QJU2 4C30A 2VXDA 1C8M2 2RV9A 3C7EA 2BNOA 3WU1B 2CRGA 2W4SA 1OYIA 1OLTA 3V8KA 4N0BA 4DOZA 2L9SA 2EVXA 1ZZ8A 4LULA 4PIZA 5HPOA 2TNFA 1WRJA 4BCUA 2E31A 2Z16A 2EA7A 4LHSA 2BWCA 1AXKA 4IEYA 5CIRA 3IC7A 1S8NA 4BM8A 4YIRX 3HNMA 2J1VA 2XAUA 4ASLA 3E7LA 2W1SA 3MV11 3VYRB 3KZ4C 2V1UA 1UAIA 2ZEYA 5IP6A 3LFIA 3I5UA 4XURA 4U0WA 4LB5A 1CJPA 3AMPA 4HETA 1GANA 3LDKA 1Z3XA 5M3FJ 2DTZA 5FBZA 1IO2A 3GTMJ 4M6YA 5BNNA 3FXUA 4XUNA 4ZH4F 4CCDA 2DVDA 3PO2J 3GJAA 1VPHA 5LHHA 1P8JA 1PZ8A 2Y34A 2ET1A 4PT6A 2V9KA 5FLMJ 5HDNA 3QH7A 1X4OA 3FXQA 4ZPIA 2R6QA 1TME1 3RVHA 4HA8A 5T54A 2EB7A 2JMWA 1FTZA 4A3CJ 1EV13 4QHOA 2O0YA 4J25A 1KEXA 2FCUA 3AM2A 3I2HA 3I58A 5LLQA 1MS0A 4PDKA 1JODA 3J26N 3HUGB 5IVEA 1RUJ2 3LWCA 2ESHA 1W04A 1XNKA 5K0UC 5EZWA 4EWEA 1VQNI 1ZR2A 5FPZA 1WJBA 5FZCA 2XVKA 3P9IA 1OOPA 3MF6A 1SMYF 4A6SA 3GUDA 3WP6A 2IVIB 2HOAA 3OPWA 5L3DA 2FCVA 5GPAA 4LNVA 1MS1A 4IOAF 3BJOA 5G05L 2Y6HA 2NPIA 1S5LC 3K1MA 1J75A 1TWHJ 1AKHA 2IJLA 3QU6A 3DEWA 1FC3A 4XBFA 3PUBA 5DUUA 4DBRA 3IIIA 4Y1ZA 2XB0X 1S0FA 1HDPA 1XB9A 1LQ1A 2JPCA 2DURA 2FJ1A 2VBPA 2ME0A 3SDGA 1DQ2A 1VI0A 3T1MA 1EAH2 4WXCA 3H35A 1T39A 1HB1A 3RI8A 4FPJA 1TQ5A 1JOBA 4G3YC 1YS7A 3X2QH 3HOVJ 4C1XA 1E2XA 2H1LA 3TMOA 1O7FA 2CGNA 4Q4X3 4AIHA 3WDUA 5EZGA 3FJSA 2WA4A 1XOYA 4OZXA 3P7NA 3SCHA 2W82A 1GICA 1S2KA 3EXUA 5L3EA 2UYAA 3K4MA 2ZOEB 3VD5A 5HCFA 5FFZA 2QA4I 2XL9A 4UXNA 4L5EA 2AZ5A 4XZPA 2WT0A 2YV8A 1LDJA 5H6RA 2XBO2 2Q1MA 2PMHA 1OUSA 3DLLF 3U37A 4IEPA 3HJEA 2VTFA 4U0VA 3IZOA 4JRLA 3IH3A 1VBB2 1LOAA 2RR11 4IETA 3POBA 4MG2A 5BNOB 3Q0WA 4XDPA 4YVSA 3ZP5A 1NZCA 4LITA 2NVQJ 5FKLA 2DA7A 3ZQGA 1TQPA 4IGOA 3COAC 5FXVA 4BDYA 3BTZA 2B8MA 2D43A 3DYOA 2QBYA 4FX0A 1BEV2 5LRRA 1K78A 1K5JA 4K20A 2KP6A 4IV1A 2ZGKA 2A73B 4CDQB 2LG4A 1OA3A 2VOKA 3ZXAC 1HRI3 3KETA 5EDNA 3K1NA 1G9FA 3BC8A 4IEVA 1H1IA 3SC7X 3KLNA 2ZEZA 3ZM8A 2JG8C 3I7DA 1R7JA 2DYSH 1KGYA 3HOWJ 1JW6A 2RDQA 5G04L 4JVAA 4CEWB 4YW6A 2Z5WA 3TOJA 2WNVA 1MBHA 2DMQA 4P9IA 1DGWX 1XXNA 2B4KA 2P6HA 2XUBA 3LSTA 1E5HA 1HXS3 3OPZA 4XN3A 4YZ5A 1VMJA 4UW3A 4XFIA 2CUJA 1VRH1 4QXCA 1IRXA 4FX4A 4IHSA 5J3LA 4E4ZA 1PMIA 4FT8A 2GOMA 4L9JA 2DVFA 2VZSA 5IVVA 1RUE3 4LT5A 1W39A 3BZKA 1JYTA 3WSOA 5FZ6A 5J4VA 3ZMDA 4JQFA 2EA2A 5JOWA 4P00B 4QXBA 1REEA 3RTRA 1BIAA 4COWA 1AUYA 1TZLA 3OY9A 3CC4I 4OHXA 5J1XA 4RB2C 4ZXEA 5ILUA 4AVZA 2E53A 3VYTB 5JFRA 2ARXA 4BNCA 3U4SA 2WWJA 4LBKA 1ZBA3 3JB4C 3VB9A 3BG7A 1YX3A 5I8SA 2RNGA 3DCFA 5JI6A 3L9JT 4YSFA 4E6KG 3BALA 4LO5B 2XSJC 1FOD2 1FP1D 2FOKA 1BBT3 3RZGA 1UG0A 4LHKA 4UUVA 1FNYA 1JJ8C 2VPRA 5IY5H 5LEJA 1ZBE1 3DXUA 5BNPA 2Z5UA 3AZXA 3KP7A 1XS9A 3GTGJ 1FBQA 1CN1A 2LF8A 3ACIA 5LATA 1US2A 1WKYA 2PLV2 4HVQA 4P96A 1SPPB 3TW7A 2R49A 2LKPA 1AR63 1R1A1 3TN91 2VT2A 4OZOA 2LRDA 2FX0A 4CDWC 3HRSA 4KMFA 3ZYBA 4OUMA 5I0RA 1XC5A 1A6IA 3SXWA 1H4GA 1JU3A 2OPTA 3HOUJ 2IZWA 2ES3A 2WT1A 1WVRA 4ANJA 4UUSA 4HVRA 2DLLA 1SLBA 2MD5A 3HNBM 3CMGA 4WVMA 5FYZA 2R063 3CTAA 5FREA 4LTAA 2EIKH 4KNCA 5FFOC 1R5GA 2BNMA 4MADA 3VODA 3MLLA 1JHHA 4ABZA 3W2WA 4M4RA 4Z2WA 1K78B 4LLGF 5DAVA 2IT0A 1FX5A 2P6SA 2M3AA 1AR73 4U88A 4YVWC 1ZYRF 2XJQA 1H0BA 2X6OA 3POFA 4XACA 2WL1A 1ZQ3P 3WXPA 3O1MA 4EGYA 4Q4W3 1BI3A 3KEQA 3GDBA 4NAMA 1MBFA 3KT1A 1FYUA 1E3HA 3CO2A 2VULA 3PL8A 2G0EA 2W95A 3ATGA 2EFWA 3K70D 3K4LA 1SCRA 4K1ZA 1GZ9A 4RQPA 2VBBA 2MEV2 3E5QA 4UBGA 4I3GA 4HXCA 4BH9A 2GC1A 2J5PA 2K9NA 3LFUA 4JP0A 1TZOA 4WVMB 3U78A 4ZKTB 3TOAA 3G3ZA 1R58A 4AZZA 1ACCA 3FZ3A 4ES8A 3I4PA 3FFZA 3MF9A 3I56I 4UV8A 1UD1A 4XXAA 1IUFA 2YU3A 3CLOA 3W59A 2F4LA 5BNNC 2CSOA 1X2NA 2L7MP 4LK1F 4L18B 3IKWA 3NV2A 2LTNA 3VBSA 4XLFA 3MD2A 1IXRC 3I3QA 1W9FA 5IATA 3GTQJ 1GOGA 4DB5A 3ZYRA 1OURA 5E6HA 4DINB 5C4XJ 4CEYA 1QOSA 3J8F2 3ETQA 5HBAA 2KL4A 1QGLA 2KKOA 3ZQ7A 3GCXA 3OGJA 2A6WA 1GWMA 2EWNA 3SHFA 4LUKA 4YW7A 4LB6B 3H0OA 3ZVXA 2DTYA 2QEXI 1RTVA 3BYWA 4RLFA 3GBWA 3I2IA 4N43A 3JRHA 4OIQF 4TV7A 5L3BA 4CPBD 3D0JA 1OLMA 2LY2A 4R1HA 1D1CA 2ADDA 3LD8A 3UKGA 3KV6A 3CO6C 3QCWA 3JCUC 2GC0A 2A68F 2WLPA 3PM1A 2XGDA 1ZARA 1GZWB 2ZXHA 5K5RA 1TMF2 5IAVA 3W5NA 5LA9A 4XRMA 2HQRA 3MW4A 5ANNA 1SFUA 2ZMLA 5H2FC 4QQ2A 1DP0A 1YOVB 1VMHA 4BQYA 1MMNA 4MGQA 4C3IJ 2ORXA 4B4PA 5I8YA 4AEDC 2BVVA 2XV4S 1QF3A 4M3BA 5JI7A 1VB2A 5CKNA 3V7SA 3CCSI 1GWLA 2LROA 5FP8A 3L00A 5A6XA 3BCAA 3EB7A 1W9WA 2M7AA 4TXWA 3K69A 1BZWA 2YHJA 2WNUB 5DM6F 2PAMA 2QUFA 3WG2A 1KFXL 2A6VA 5FQ0B 3H8RA 3LQCA 5FKCA 3OYEA 1W2AX 2ZSIB 2R061 4N7UA 2D45A 3NL1A 3WP3A 2VBXA 3LSGA 2HYKA 2DA2A 3HD8B 3OGSA 1W05A 2HTSA 4I30A 2VY0A 4YFZA 4XKWA 3SISA 4UNOA 2V1NA 1JUHA 4ZDPA 4DPNA 3O1TA 3VKLA 1UF2C 2XWBB 4D8MA 3KP5A 2A05A 2DFCA 2GP3A 1OA2A 2P7VB 3CESA 2WN3A 1W2OA 4IHWA 4XC9A 2ZCWA 1TT5B 2BV4A 1ZBE3 2V26A 1C0WA 4F3JA 5JAXA 3G7DA 5BNOA 5KXDA 4XQ4A 5J37A 5EG0A 4FFIA 5BYNA 3GJBA 2B39A 1BN5A 3V7CA 5GPCA 1GWKA 2E63A 4N53A 3BI3A 1QJFA 4AGVA 4LO8A 3A4CA 3O8HA 4MFDA 5F0CA 2WYFA 4YYOA 2Q8OA 2VTXJ 1JOJA 2LR8A 4K1YA 3SXYA 5F5AA 4HNVA 5FP7A 2IS1A 3J7YJ 3FMQA 2ZA9A 2E51A 2BHZA 3GEZA 4IRIA 1F9NA 4XUTA 2M30A 1F4HA 4PJMA 3WF4A 5GADJ 2VQGA 3MICA 4M3CB 2YU9J 1KFUL 3ZMOA 1I1EA 2BGCA 2VQUA 2EFQA 1RUI1 3R4SA 1QJX3 2DT5A 2O8QA 1E5SA 2RDNA 3AZVA 2DFHA 3B6AA 3S1NJ 3HYIA 3NEUA 3LSEA 1JS9A 3K4JA 5GLVA 1H1MA 4DQ2A 4KG8A 5J7MA 1WJDA 3QPHA 2DU9A 4MNUA 1R1VA 3RJPA 1OCZH 2EFPA 1JE8A 2J1AA 1VQPI 4HLTA 2WAEA 1JXSA 5FO8B 2YU1A 3JR9A 3A03A 3IAS2 2YUSA 1SDWA 2AQEA 2ARCA 2VJ5A 4UVAA 5GZGA 3TRSB 1MW7A 5CB7A 1GQPA 1SFYA 5DAWA 3U11A 1J0RA 1IG7A 1HC8A 4YW3A 2D6PA 3WGGA 1TTYA 4ZY9A 2DCTA 4B1RA 2V6CA 3CQZJ 4M3GA 4MTEA 2RDPA 1QEXA 5AVPA 2CUZA 2NN8A 4AHZA 2F5DA 2WZPP 1IV8A 4NBQA 3I4MJ 4GWNA 1V54H 4D7YA 3DPLC 4XOGA 2VN2A 4DGWB 1QHHD 4JRAA 1ZH5A 3PIJA 1FOD1 1LGNA 4KBZA 2QBYB 4AYBN 5LBCA 4F92B 1VR3A 5ICFA 3DUIA 4BAYA 1DZTA 3DTEA 5BUVA 2KDOA 4BGDA 3TO9A 3GYHX 4A7ZA 1Y8RB 2CHHA 3DKYA 3I97A 4I98B 5DD4A 4LLOA 1LOFA 2W7NA 3I3MA 2XASA 1ZN2A 1VQ7I 2RS11 1POQA 3RPQA 3E0JB 2PHDA 5DUWA 4MXWB 2GZWA 1QJX1 1DCSA 4PZJA 5DYMA 4XILA 2DDBA 4YELA 2WUHA 5ILVA 1RYYA 2EF6A 1O4YA 5ISLA 4B44A 3V56A 4K7JA 2FBKA 4IGQA 5M0TA 1LE8B 1BA5A 1ETOA 1IQAA 2Y26A 2KA3A 5H9RA 2QDNA 3VBOB 1DYKA 3HB9A 1MZ5A 4I6ZA 3IMMA 2O61A 4OIPF 3WNXA 4CDGA 3U10A 1V6NA 5ICEA 2HFHA 3S2HJ 5FXWA 5C4WC 5BMZA 3I4IA 3HBZA 4IV1B 3HEIA 1QU0A 4MH0E 2RS33 1WKMA 3QU3A 3W6VA 2W1OA 1PGL2 2AENA 5F3CA 4KICA 1AYM2 1EY2A 1E5RA 3AMHA 3ZYHA 5K5OA 1U5TA 3ZSLA 4WVWA 5FGMA 2ELJA 4A3GJ 2JKBA 4QX8A 1NXD1 3D3AA 4MXWA 4P9LA 2FDGA 3OYIA 3WNKA 2EV6A 3L2VA 2BY1A 2PLYA 5BY5A 3PIOF 1I1GA 2GXBA 1F9KA 3NAPC 3W2VA 4D7MA 5FP3A 4MOAA 3KEOA 3WG7H 5JZGA 4FXKB 2NVTJ 3WG1A 1CR7A 4U87A 2VGDA 2HJIA 3ZXFA 4Q4X2 3WHTA 2N8GA 4GJZA 3F23A 3HIFA 5H6QA 2UUZA 2ETEA 1D4M1 4XICA 1N78A 3TEXA 2YG0A 3WW1A 1R093 3KVAA 1I27A 3K4ZA 1C57A 2C6YA 3SZTA 2E2JJ 3ONQA 4FPHA 3A01B 3ZO0B 2FHRA 4GMP1 2ARBA 4AYBA 2XBO3 1R9TJ 1R083 3NWKA 5CVUA 1ND2A 4LKEA 2ELKA 2B45X 4ESJA 2L9RA 1R1TA 4XHXA 3EUKL 1X1AA 3IIAA 2GH8A 5E17F 5CLSA 2EINH 5EEAA 1NCRC 4YM0A 3GCWA 5FMOL 4BK5A 4RR3A 4NRQA 5DZEA 3F0CA 2GALA 1EUUA 1W0OA 3UV9A 4EQVA 4CP1A 3WE2A 4IV3A 4NC8A 1XB4A 2XKOA 5A33B 1VQ9I 1Z3YA 1X33A 5JOYA 5LK7B 4DZJA 3KVBA 2QVSB 5KHDA 3LQQA 1CF7A 2ZFUA 1IG3A 3FBNB 5A2QZ 1D8KA 2TRTA 1MMDA 2R7WA 2VUMJ 4I2OA 3BG5A 2HQAA 4UY8I 3MW3A 4P02B 5F5IA 1ZGWA 5D4RA 3C7FA 4LR4A 2QZ3A 4Y13A 3F22A 1W1WE 1ND3C 3OIQA 3L09A 1YXWA 5C3PA 4FBFA 4UYBA 1CWPA 1MNEA 4ARXA 2P3IA 2ME6A 4JX0A 4KU8A 1AX2A 2X1DA 3DGTA 1MZFA 2BQPA 1UMIA 5HCBA 4KITB 4OWRB 2FOWA 2I2SA 2CUEA 3W21A 2E7XA 1A34A 3NV1A 1JGSA 2K9MA 4HKWA 1RUF3 1AX1A 2EA4A 2DOFA 1SMVA 1CAUB 4AFMA 4CICA 3WEZA 4TN7A 4BQQA 2HWF3 2C4XA 2C5DA 2I07B 3AL0B 4Q0PA 2Q0AA 1VNDA 2VXZA 2OYZA 2K86A 1RUE2 2KZVA 2ZKLA 3QYFA 1KQ0A 2GDFA 3FZVA 4GWIA 3ZMZA 1LHOA 2RHPA 1KS5A 2HU9A 1W6QB 2JECA 3OL3A 3IDCB 3TDZC 1Y3TA 1OBNA 4Y1YA 4ITVA