4LITA

Structure of ycfd a ribosomal oxygenase from escherichia coli in complex with cobalt and 2-oxoglutarate.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
372
structure length
361
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 102
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4litA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4litA01
5CEHA 4Y3OA 5A80A 3K2OA 5FYCA 5FYUA 5FPLA 2YU1A 5A7WB 2WWJA 4CCMA 5FZ6A 5A7WA 5F32A 2XDVA 3DXUA 3PUSA 5F5AA 5A7QA 4DIQA 3DXTA 5FUPA 5LWBA 5A7NA 2Q8EA 5FZBA 4XDPA 2Q8CA 2OQ7A 2OQ6A 4GAZA 5FY0A 5F3CA 5FXVA 2XXZA 3AVSA 4QX8A 5F3GA 3N9LA 5ANQA 4LITA 3OPTA 4IGOA 5FZ8A 4BISA 2YBPA 4HONA 5FP7A 3N9OA 2XMLA 3KV9A 4V2WA 4CCKA 5FY7A 4QXCA 4C8DA 4D6SA 2WWUA 5IW0A 5ISLA 2GP5A 5FZCA 4D6RA 2YU2A 4AI9A 5F5CA 3OPWA 5FP4A 3PTRB 4EZHA 5E6HA 5FZ3A 5A1FA 1VRBA 4IGQA 5FWJA 5IVVA 4AAPA 2VD7A 3PDQA 5FPAA 5FYSA 5LY2A 5FYZA 4CCJA 3N9PA 3KV4A 3N9MA 5FYVA 3ZPOA 3LDBA 5FP3A 5FY1A 3KVAA 5FP9A 5FJKA 4BU2A 5LW9A 4LXLA 2OT7A 4CUGA 5IVYA 4CCOA 5FZLA 5FBJA 4LIUA 3PU3A 5FZ0A 4D6QA 4LIVA 4BXFA 5FPVA 5K4LA 5FY9A 5FZOB 4Y4RA 4GJZA 4XDOA 2YBSA 5FZOA 5FZ4A 5FY5A 5A3WA 5FP8A 5FUNA 5FWEA 4CSWA 3KVBA 5KR7A 4V2VA 5FZMA 3PUAA 5FZGA 3AL6A 5FXXA 2Q8DA 5FPBA 4ASKA 5FZ7A 3KV5A 4Y33A 5FZDA 5FV3A 5IVJA 5IVCA 3RVHA 5F39A 3KV6A 3U78A 5IVEA 2OS2A 5FZFA 4QX7A 3U4SA 5FJHA 5FXWA 5F2SA 4URAA 5FYTA 5IVBA 5F37A 5FZ1A 4TN7A 5FYYA 5A7SA 5A7PA 3LD8A 2XUEA 3UYJA 4EYUA 5A1LA 5A3PA 2W2IA 3K3OA 4EZ4A 3K3NA 5IVFA 5FZKA 4DO0A 3NJYA 4QU1A 4HOOA 5FYBA 2GP3A 2OX0A 4IGPA 5F3IA 5FZHA 5F3EA 3AVRA 2P5BA 2YBKA 3N9NA 5F5IA 5FZEA 3PU8A 4UF0B 4UF0A 3ZLIA 5IWFA 5FY8A 5FPUA 3PUQA 4QWNA 3AL5A 5FYIA 5FZIA 5FXZA 4GD4A 5A7OA 4E4HA 4CCLA 5A3NA 5LY1A 5FZ9A 2YPDA 5F2WA 4GJYA 4CCNA 4QXHA 3PURA 5FZAA 4NUBA 4QXBA 5A3TA 5FYHA 3N9QA 5FY4A 5FYMA 2PXJA
chains in the Genus database with same CATH superfamily
3OY8A 4UXAA 1YS6A 3KEQA 1U8BA 1HW2A 4WXHA 4RGXA 4HF1A 4LBQB 4KJZA 3FUOA 4OI2A 2H1KA 1WCKA 2RR11 4Q26A 3S5QA 2STTA 3LWFA 1V70A 1YE9A 3TYJA 5A32B 4C8DA 4XMIA 4Q8KA 2DYRH 2EIMH 3QD6A 3WHCA 5F64A 1C8M2 2ZGPA 2ZKNA 1DP0A 2X29A 2R042 3VUOA 3J80K 1G9DA 3GYHX 2DA1A 2M3AA 4YVSC 2RVAA 1CAUB 1POQA 3J81Z 4Y15A 4CDXC 1TEIA 1VBA1 4J1XA 3IPVA 2ZGRA 5CADA 3IT8A 4LA3A 5BNQA 4UV8A 2L9NA 5LRRA 2DUOA 3VKLA 1LPQA 5EJ1B 3L2UA 4C0BA 5EF6A 3OUHA 4XLEA 1UAAA 2WFF1 2W3JA 1GFF2 3BVCA 3T4VA 4CA9A 4AVBA 1NH3A 4P9XA 1R6RA 4AVCA 4RAGA 3U2RA 2BHYA 3E5XA 2WO3A 1C0WA 3M4OJ 2CQ7A 4XC9A 1KXGA 1UNBA 2BZDA 5CVUA 3BB6A 2ZS6B 5F2WA 1FTTA 2YDEA 1U9NA 1AZDA 5FIXA 2VH9A 1S55A 4CDGA 2VBZA 1TZOA 2EQRA 3GGLA 2J1EA 1D0XA 3CCYA 1O3TA 2JG8B 3L2YA 3VZMA 4O7XA 4QGMA 3V0BA 3POSA 4IEUA 1MZ5A 5FY0A 2D6LX 4HVQA 3ZSEA 3K10A 1UFMA 2UZKA 2O1QA 1GP4A 1GU3A 2ARAA 2DFBA 1TE1B 1TMF2 2GP5A 4RL7A 2E1OA 4GCVA 1W4MA 4QPWA 4BQYA 3ZMUA 4AUXA 3PVBB 4XQWA 3GBFA 2OUJA 4OFGA 5FJKA 1AX0A 5FD6A 3I8TA 2E5ZA 2ZSIB 4JHZA 3FLRA 2D6MA 1CAVB 4XFBA 1UMHA 3JRAA 3AK0A 2DCKA 2D6PA 1JYNA 2HQAA 2EV0A 1RR7A 4LB5A 1ENRA 3PFYA 3VL8A 2XLGA 4XF3A 4D9JA 1F5FA 1ODDA 1AF9A 3JB8A 3A0NA 1JKPC 2WZR1 2XC7A 1W6MA 3LD8A 1NXMA 4MFDA 2HVSA 3L7WA 2ZJCA 2Y6FA 1BMV1 3NV2A 2L9VA 2XJTA 4DNCA 1XNCA 5JIUA 2LTPA 2WSVA 3S32A 1KDKA 4LKDA 1O8SA 1G2HA 1RMU1 2E2JJ 1H1IA 4FPEA 1AYM1 3RZMA 1L7RA 5A7WA 4AYBA 3CCQI 3VZNA 3SZGA 4B47A 3U0ZA 2IBDA 3NNLA 1TW3A 4E8CA 3REOA 4QM9A 1NOVA 2M87A 2RQQA 2UYAA 4C2TA 1BBT1 4XICA 3HEIA 3IM0A 2VBYA 2F4LA 4JAAA 2O03A 5FLJA 3KETA 4A3IJ 5JVTA 4QB1A 4PFPA 1WLDA 3BJOA 1OURA 3LFMA 2VT3A 4IV1C 1B6AA 1FXZA 4LG0B 1FOD3 4AAPA 1ZHFA 3K4MA 4CZZA 1FNZA 2E53A 2BVLA 3BUCA 3VBOC 3WQ1A 3MUY1 1NT0A 1HXDA 1DGRM 1A34A 4D6QA 1I1EA 3EB7A 1GKBA 4PIXA 3NWSA 3U75A 3ZYRA 3EETA 5FUNA 2VC9A 5K9YA 5FXXA 2VZUA 5GKAC 5CA6A 5IT6A 1KU3A 1US3A 2WADA 1YYVA 1BW5A 3ZYJB 2VCBA 4XFGA 2OS2A 4Q0SA 2DU0A 4F7ZA 1QPIA 4PHZA 4UUTA 1L0OC 3AC0A 2M0MA 1JZ2A 2MG4A 2PHLA 4ANJA 5CJ9A 1UHMA 4QLCU 4KYWA 5GLUA 4W8JA 2KT0A 1B59A 1F5TA 2VE8A 2ZCWA 1U0AA 4OYUA 3TN91 3K1MA 5C44J 3PNVA 2HYGD 4BIFA 4W1UA 3ZMNA 3FKIJ 2WZEA 5IT9Z 2AYHA 3O1UA 2RS31 2ZHLA 1YEWA 4QHBA 2KA3A 2KDZA 4QGNA 1VQ8I 4R4ZA 2PI0A 3ZM8A 1WJBA 3VBUA 3MHZA 1ACCA 4D7SA 5J1XA 2FD8A 3A23A 4B7KA 1DCSA 3IB3A 3K4AA 2BTVC 4MADA 2MFZA 2D5FA 4LUKA 3CMEI 3SH4A 1GYKA 1WMXA 4UWDA 5EYRA 4QX0A 2PA7A 1H8AC 1R083 3DEUA 1V5FA 5CISA 2IFWA 3CUOA 5FYSA 2ZXJA 3JRDA 5CFDA 3WEZA 1QQP1 2FNAA 3E7LA 1ETVA 1SFNA 1P4AA 1T6GC 5FYVA 3ZPOA 1K6OA 3BU0A 1YQ6A 3J7AY 1COV1 3OBRA 1HOMA 3K2AA 3OYIA 2E7WA 2ECBA 1VB2A 2IA2A 3G73A 2RC4A 4LKEA 2QZ8A 2Y9ZA 1B35A 4GYGA 1X9TA 2Z3YA 5D1IA 5GP9A 1QU0A 2VMHA 4MO7A 2ZGOA 4KG0A 1JE8A 2IWGB 3LSDA 5JZGA 3HYIA 1BEV3 2EXHA 2P6CA 4JX4A 5HV4A 2RV8A 4TLGA 4L5IA 1BJQA 4CEYC 3Q9VA 1VBC1 2EALA 1XNDA 3HKZN 2VECA 5E79C 1GWMA 4GB31 3K9TA 2V9KA 5IY5H 1FSEA 1JYWA 3V64A 5HCAA 1IW7F 4MNUA 4JQTA 1FATA 5F0FA 2K3FA 1QOSA 1AHDP 3JRGA 5FQ0A 3FBNB 1GNHA 3VN4A 3WU2C 3O7OA 2XF7A 3PUBA 5DYMA 2EF6A 1GVJA 1XGNA 2E31A 3SEQA 1QH6A 4U7BA 5HLTA 2PN5A 2D40A 3ES1A 2ZFUA 4OMYA 3VYRB 4AQTA 5J6XA 2Z9OA 1N25A 2K9QA 4LMFA 5CVIA 3CC4I 5L3GA 1JYVA 4XKBA 1QKQA 2WDBA 1S0JA 4HZFA 3GO5A 4IRHA 3LSJA 4XZUG 1DYOA 2J1VA 4Q4Y3 3AKSA 1BI2A 1E2XA 2PHXA 3PL0A 1AL23 1G9CA 2LVSA 3B9IA 5CKTA 4B3AA 4PLMA 3CMYA 3UT0A 3KF5A 1RL3A 2W47A 5FMOL 2JG9A 3F23A 3LFUA 1NCQC 5AC93 3FXLA 5IK5A 3PJYA 2FE3A 5FTTC 4UVAA 2XPJA 1BJAA 3F21A 2CQNA 3G4SI 3ECOA 2ORZA 1YQ5A 3I49A 3HGGA 4LLNA 4Z2WA 1P6RA 5JLXA 3A4CA 3WF3A 2WIIB 4I7HA 3MUZ1 4G7ZF 1G9AA 1D0YA 3MLKA 3FWEA 2XKPA 3MGUA 5LY1A 3S7EA 1EV7A 1DP7P 3R0RA 5K7FA 2NVTJ 4P9LA 4FX0A 1UWWA 4FFIA 2EWNA 4N9HA 4QD2A 1ETQA 2R041 4YW4A 1HKQA 2ME0A 4EQVA 2VQHA 3MEXA 2RKHA 4K21A 2BRTA 3OGVA 1YTYA 1QPMA 4XDPA 4DRRA 4M3BA 3QYBA 4AEJA 1IG0A 1Y56A 2XV4S 2QQUA 1MQTA 1V6JA 2E36A 1ZZ6A 2DUPA 4PSWA 1FNYA 1YI2I 1W36D 4XXPA 5A6YA 3WNMA 5FMCA 4R9CA 2ZHNA 3LDBA 1D4M3 4XUQA 3ZSLA 2CGNA 3VBOB 4GXLA 2L9RA 3RKYA 4RSUA 1D0HA 5FMBA 1H6YA 4YZ5A 2F17A 3BQYA 5J4VA 5CFDB 3WQBA 2XJQA 4A4AA 4YPJA 5E17F 1I50J 3QP5A 3V7CA 2FQ4A 2D93A 5FYYA 4A0XA 2ERFA 2ZKLA 4FP3A 1Z77A 3AYEA 4QB6A 4B44A 5JSOA 2PJPA 2XHKA 2I2SA 1MBJA 3LEMA 1Y6IA 2QTWB 3FM3A 4UB8C 4BQ5A 1OUSA 3AL0C 1TMF1 3V7RA 2EFOA 2RDNA 2WAFA 5FFXA 3ZN0A 5DDJ1 5E8IA 4JRLA 2BZTA 2FOWA 4Y3OA 1GOFA 4PQQA 2Z5WA 2RAEA 5FO8B 4BDZA 3H8OA 2VZ3A 4P9IA 1YHFA 3M1EA 2WO7A 1S2BA 4UFKA 4XONA 3RMYA 2Q0OA 2DAOA 5LBCA 3L9JT 1RHI3 3ZP5A 2X0LA 3OYAA 3JD73 3CJXA 3JREA 1X2MA 1J5YA 3OG2A 1K5MA 4XILA 3HIFA 4Q4V2 4RAFA 3JR9A 2VJ5A 1AXKA 2JN6A 2P7VB 4PLNA 1VMHA 1YX3A 2W7NA 1ASJ3 4DQ2A 5KR7A 2VQLA 5FZMA 2R92J 2A07F 3H5NA 2MHFA 3IL2A 1PNGA 2D2WA 3MW2A 4M73A 1CAXB 1Y39A 1C1LA 5E3OA 1PUFB 2L5QA 4DYQA 4CEYB 3K6GA 5FZHA 5KHGA 1HQNA 2JG9B 2VIXA 5IAVA 4EN6B 4A7ZA 2HYJA 2W08A 4RS5C 4UFHA 4ZZLA 5JXIA 2R7XA 4K6BA 3VKNA 4BUPA 4AVTA 3FXQA 1TNTA 2HFHA 1XC6A 2E1CA 1REPC 1HDPA 1KQ0A 4DZPA 1OR7A 5LBBA 1E5SA 1XU2A 1UMIA 3J7LA 2FOKA 2XBO2 1QXJA 4QPIC 4ABZA 3CCMI 1VQ4I 3BQZA 3I53A 2ID4A 4HMZA 4HF2A 3VB9A 2M45A 3AVSA 3C7EA 2XKOA 1LJ9A 2IGMA 2XMLA 2M30A 3ATGA 2HTJA 4M3FA 3GZAA 3W5NA 1VBB2 2W0XA 4O9GA 3I71A 1NE6A 3E5QA 4NC8A 4YFXF 1Q8SA 2FA5A 4AHXA 4AU7A 3NNJA 4CCOA 2K9LA 4LO5B 4N7UA 2R93J 2FBEA 2LK2A 1ZG5A 1X3ZB 1OH4A 5IOZA 5GLWA 1U0JA 4XJZA 2Z99A 2D3RA 3HJEA 5JSPA 1JJ8C 4NQWB 4RA2A 4ESJA 2J22A 4TLFA 4GH4C 2C1FA 5F39A 1CQTA 1D2QA 3P9KA 1NCQB 2VONA 2KRHA 1GDTA 5T54A 4WK8F 3PL8A 3WG9A 3WW3A 2DU9A 3VBSA 1WMEA 3W58A 1IDZA 4B4RA 4P9JA 1IUYA 2B8MA 2X8KA 2X6WA 4QWQA 3WU1B 4FFHA 3F8BA 3LPGA 3WG3A 4X6QB 3G6JB 4Q1PA 3AMNA 5CVVA 5BUVA 3ZDSA 2GU9A 1FC3A 4P9YA 3ZO0B 3AKPA 1FPN3 3I4MJ 5CB7A 1AA7A 2BVVA 1IDYA 5FPLA 4ZYGA 4PJJA 1LHUA 2PFWA 1OXCA 2B9VA 5A3OA 2HBUA 2MPFA 1ALYA 1YFYA 2V1XA 4Q4X2 1CONA 3AP5A 3J7ZI 2CWEA 4MGQA 4FAGA 1OQEA 1D1CA 3POBA 4IF4A 2DURA 1VRBA 1EF4A 1NUKA 4DUVA 3LSRA 2DK5A 4NIGA 4BJ6C 1W8UA 1VPHA 5LD2C 5FPVA 4L0ZB 1R1A2 2W9XA 1UZYA 4IETA 3KZZA 1WA6X 3O2PE 2LY2A 4CUAA 4F93B 2WT2A 3THPA 1NX9A 1V3FA 1E0EA 3URFA 1R4MB 5LBQA 1C4RA 4AC0A 1QVUA 5IVEA 4COVA 3BTXA 2ZNYA 4UYBA 3KP6A 5IPAA 1LE8A 1QY4A 1NLQA 2P3YA 1PDNC 5A2QZ 1LFBA 4AIDA 2RS52 1OBNA 1W3VA 3ZSMA 4DO0A 4BEHA 1N47A 4BQOA 1MNDA 3DGTA 4UFLA 5I0TA 4YFNF 3IDBB 4LUMA 2JA6J 3AL0B 4UI9L 2W95A 3BG9A 4DXZA 5BNGA 1GLHA 1R5ID 5K7ZA 3KEOA 4L9VA 2R16A 5L9RA 5FLMJ 2AXTC 5CZKA 4F3QA 3U07A 3GFJA 4BE1A 1CWPA 3VZKA 2F5FA 5A33A 3L1PA 1X33A 1W6OB 4B1RA 1X1BA 2XWJB 3WTUC 4BPZA 1URXA 2FHRA 3OPWA 5EG0B 4AIHA 5A1FA 1S3JA 1K61A 5HDKA 3WHTA 3D1NI 4CCJA 5DAQA 2DDAA 2ZGTA 2CW8A 4ZU4A 3P5BA 4CUGA 3S1RJ 3I4IA 1W06A 2B45X 1RETA 3DBLB 3OOUA 4JGZA 3L2WA 1UOFA 5LBFA 2VPVA 2NVUB 4D7YA 2X1DA 3WDWA 3F6OA 1BXHA 3OOXA 2PN6A 2LR8A 3FMSA 2RM21 1KEXA 3DPRC 3R60A 5A1LA 2WWSA 3HRSA 5A3PA 2V6CA 1OVSA 3QQAA 4FOYA 2A5WA 1OHFA 1MS4A 2MC4A 4LKSA 5D5WB 1AXZA 4RS5B 4X1EA 2NVYJ 1WW4A 5D5UB 1CIYA 3D8CA 1XCVA 4FE4A 3IDCB 2HYXA 3T1MA 1VQOI 3TEYA 5DQ0A 3DKYA 2ZXIA 3LKJA 5CEHA 2LBFB 1YO8A 1UHSA 1R71A 2WWJA 5D4RA 5F32A 2AC1A 3G2BA 3BOWA 2OW4A 3ZYIB 2Q8CA 2VUAA 4QPQA 1LHOA 1AYN3 2B63J 4QPIB 1TME3 5B66C 4FE7A 4MTDA 1OOPC 1ZBA2 1ND3A 3T3YA 1RTVA 2QUFA 3Q3SA 3VYUB 2R4GA 5FWJA 4DBQA 2D43A 1JUPA 2CJJA 2Q2EB 4OAYA 1SHWB 3M3OA 2HPIA 1WWYA 2VY0A 4GIQA 1WLWA 2ZO4A 3BROA 4BH9A 2BEOA 3QH7A 1P4WA 2NLRA 5CFCC 3OOPA 1QZZA 3NKTA 3R4DB 3K4LA 1IN7A 5LFAA 2R7UA 2RE9A 5JPMB 3BR1A 3C7GA 1HJFA 4GH4B 2NN8A 5FZFA 2VJJA 2V26A 2P5KA 2D7FA 5LBEA 3CJQB 1PGSA 4PI0A 2CWSA 2MYSA 3HPHA 1ZYRF 1GV9A 1QXPA 1ZZ8A 3BOPA 2VZ1A 4EZ4A 3FX3A 1EV12 2VW1A 4E7KA 4XUPA 3T2TA 2J5OA 3ZFFA 2XPUA 1UZZA 2QKDA 4E4SA 3TEZA 1OFSA 5FKOA 3UNGC 3CHXA 3OB8A 2P5LC 4FPOB 5J48A 1DQ0A 4BBSJ 4ASNA 1YQCA 3I59A 3D0SA 2IGKA 3DEWA 5F7UA 5FZ6A 3MIDA 4H3WA 1HRV3 5FFOC 3V0AA 1H9WA 5CNAA 3JBG3 2Q1FA 3WV6A 1DPUA 4GO1A 4UV9A 3PQKA 5EZWA 2QDRA 2ZB9A 2JT1A 2QZ2A 2E60A 3H8UA 1XG1A 4ENJA 4XBNA 3OGGA 2JDNA 1JYIA 2V7FA 1G3TA 4HAMA 5BPIA 5GLZA 2JSCA 1G4DA 1WUVA 1DIWA 3UNPA 4LHKA 1TQIA 4LXLA 2JDHA 1W8FA 1PGW2 3POFA 3LB9A 2FQ3A 2HDDA 1GZWB 4P9FA 4IOAF 3MQ0A 3MKZA 4HF0A 4WVVA 3OGRA 1WGPA 4E7HA 1JH5A 4BA6A 4YVWA 5JI6A 4XEZA 1LULA 3RVHA 2DJIA 2LW8A 5CG9A 5GADJ 3OS0A 1Z3YA 2QQNA 5BNNC 3WW4A 1T2XA 2KXLA 5FZ1A 3SEZA 1DZTA 4KG8A 3BU7A 4CDXA 1KA8A 3VBFC 1YRNA 3E6BA 5FOBB 1QOTA 4E7LA 3WCSA 3WTWC 3OV8A 2CL2A 3ERED 5CAZA 5H20A 3MMYB 2WS93 1DGWX 3SKVA 1JHNA 3HOYJ 1VBB1 4Y5TA 4CUCA 3KP5A 2WZ8A 1TP4A 2NNYA 4M0NA 1NG7A 1PUEE 3BTLA 4IHWA 4H0EA 3ZMOA 4OI4A 4BE3A 1PZ9A 1RXFA 2VW0A 3ZPYA 5JXHA 1DQ2A 1GVDA 4KIFA 4AEKA 2FMDA 5T5PA 4FFFA 5FRAA 4BHCA 1FMD3 3CCVI 5FZ3A 4ZXEA 1UW8A 3MD2A 4ZKTB 2F5EA 5C3RA 4XBFA 4PJYA 2G4IA 1VAMA 2MW8A 2WT0A 2CQXA 1ZGWA 5K5QA 4IEPA 3ACIA 2LTNA 2A6TA 2Y38A 3DCQA 4BHBA 2AXLA 2R32A 3LA3A 3ZCOA 4A3KJ 2RR13 2NS0A 3PMEA 1NZCA 4CPBA 3DPRB 2LDUA 1SD5A 4CCEA 3T2QA 5HI0A 5F6FA 4BQQA 1K5JA 5F3IA 4NWVA 4A3GJ 3PU8A 1XSDA 4LBKA 1R082 4G7HF 1K12A 2PLV1 5F5QA 3E0JB 2ZXWH 3SC7X 3AP4A 3VKMA 1CZTA 5C9AA 1KITA 1T0FA 2YUEA 1ULDA 4Z2AA 2JIGA 3L9FA 3USUA 3HSEA 1DU6A 2M1BA 2O61A 3VFZA 2NS8A 4JOMA 4NHMA 2WFF3 3KFWX 3HOWJ 1RUE2 4PIZA 3EYPA 2ADEA 1H4GA 4A7KA 1R4NB 2VOTA 4CA0A 1OOPB 1J58A 4YZ4A 3DUIA 3MFAA 2WZPP 3O12A 4LO7A 4QHZA 1YJNI 4AI3A 2KLOA 4MX3A 1LFPA 1OC1A 2H8WA 1WJ5A 2Z79A 2HXOA 3OYKA 3AJYA 1GSLA 3KHBA 2QCSB 1MACA 3QLQA 4LIVA 3CO7C 2ARBA 4XQ4A 2PAEA 2DLLA 3C1DA 3KLOA 2WLQA 5CFCB 4H14A 2VOOA 1W03A 3DKWA 1HQWA 2XAQA 3T5XA 1A3KA 4HG2A 2YU9J 3P5JA 3WP5A 1IRXA 1BR2A 1ZBE3 1H8TA 4M01A 3NAPA 4FCYA 3T0BA 1ORKA 2EA2A 1KJRA 5BV6A 4NDLA 1HDDC 1UKRA 1XE7A 5JR2A 5C70A 5M3FJ 3ZN4A 4SBVA 2PTMA 1VAVA 4GJYA 5FLVA 4AVSA 3BZ6A 5FZAA 3TGNA 3SHRA 2ZSHB 2R7EB 1VQ5I 2LD5A 3SISA 5LCWL 1TWHJ 4U0YA 1OCRH 3UKGA 2MH2A 5JVGF 3IN9A 4EN7B 3ON7A 2A68F 3P9IA 3QPHA 1FOXA 1IAWA 3ZN5A 4XF0A 3M3EA 2R7VA 3CESA 2OYZA 3ZMVA 4D6SA 2QQVA 1S4CA 5IT9K 3D5LA 3F8NA 2VL8A 1W6QB 2BVBA 4ZU7A 3MVPA 5GZGA 4B09A 1KS4A 1IPKA 3KZYA 2Y60A 4HEA2 4DW6A 2Y0SN 1OCZH 2C26A 3K70C 4M3GA 4ENNA 2PJRB 3FHZA 2OTJI 4NIIA 2MEV3 3ABLH 1HV1A 1QH7A 2XONA 4JX6A 1QF3A 5KK1A 4H7LA 3FF5A 1H89C 2C9AA 5BNNB 5A7SA 5A7PA 1ULYA 2JENA 4Y26A 4EATA 1AR73 1W7PD 2W25A 2HEVF 1XYPA 4H2AA 3VBFB 3S17J 3W3CA 4A6DA 3UJOA 2DMUA 3SNMA 1PHMA 4P5OA 4DY3A 3VBHA 4NHKA 1ZBA1 3KLNA 4K40A 1IZ3A 2K9MA 4D5FA 4AI0A 2JDPA 3ENRA 2LUWA 5A70A 2OPTA 4EE2A 1RUG2 2DCZA 5J4YA 5HDNA 1OKRA 5LWBA 4FOQA 1JOJA 1Q8OA 4PQ9A 1D8KA 4IESA 4JHTA 1Q43A 3N9OA 1APNA 2GSYA 1CX4A 2WNUC 4AI9A 1W8TA 1VRH2 1DP3A 1RJ7A 4LBNA 4P00B 2M8EA 1KFXL 5AFEA 3KV4A 1KRIA 2XJPA 4NBQA 3ZYPA 5H9SA 3ZFGA 5L3CA 1H2NA 2VGDA 3J8F3 1U5TC 4A6OA 4BQ2A 2JQ7A 1EV11 2OKXA 1OCPA 1K78A 2CAUA 2GC0A 2CU5A 5JHFA 5TJJA 1WQ2A 3RCOA 3OS2A 1NG0A 5FRNA 3ZSJA 2JDUA 5D6EA 4Y33A 4YLZA 4FI9A 1ST8A 1UZVA 4K1YA 1X50A 4Y1VA 2UWCA 3HM5A 1I3HA 2WAEA 2A05A 3J80Z 3P1IA 2K85A 5DABA 2GP3A 3KQRA 1AR83 4IQJA 2EICA 4ETSA 2HEWF 1TT0A 2IA0A 2VJ4A 1LGNA 1PO12 4BMEA 1R22A 3TEDA 2DYSH 2ZKZA 1QJX3 2G1MA 2CHHA 3PURA 1G9FA 1H8TB 4J25A 1BHGA 2CUZA 4OCTA 3S15J 3TDUC 4AFBA 1USSA 1KU9A 3O8HA 1PGW1 4K9SA 5FZBA 1KQ8A 4RHV2 5EGOB 2YGLA 3G6EI 3A2KA 4MTEA 3PO3J 1VBC3 4JRAA 5ACA2 3S1QJ 2XGXA 3FJSA 4XPVA 1JUMA 1W8HA 1MS0A 2IXJA 2VM9A 2L54A 1Z7S2 2B5HA 2OCCH 4XOPA 1ERDA 1JZ8A 4EN9B 4UW5A 4Z8BA 1G86A 1U5IA 1BK0A 1TWCJ 2GZWA 3VYSB 3RSJA 4I98B 3UETA 3H35A 4G9YA 1SDWA 2LYCA 4BIOA 1FOD1 3ELNA 1RVF2 1NA1C 5IVJA 1PP8F 2OQGA 4XSZF 3LQRA 5CG8A 1IXCA 4WX9A 1R49A 1FP1D 3GZ6A 4NIHA 3PUFA 1O91A 3SMHA 1ZZ7A 3UYJA 3RPUD 3NNGA 2Y31A 3GTMJ 2YR2A 1Q1HA 2OX0A 3AXDA 5KHHA 1XPXA 3ZKYA 1AX1A 2VNOA 2NOJB 3AZWA 4LQRA 3EO6A 4AWXB 2A61A 1F2NA 3H1WA 4CDUA 4NUBA 3CJIA 4IRIA 3RI4A 2JWPA 3ZXDA 1Y43B 4HX8A 2C4XA 1SD6A 3VZOA 1E3HA 3PJRA 2C24A 5D8KB 3KYDB 1JKRC 1UOGA 3VBHB 4OMCA 5L73A 4GAZA 5I91A 4H4KC 1LJ7A 5BPXA 3S3MA 5GPCA 3FZ3A 4L5JA 2P1BA 3BR5A 3DQVC 5GLVA 5ISLA 2J42A 3ZR8X 4P08A 1H4HA 4P9UA 4QPGC 1W8WA 3WUDA 3VLBB 1IJWC 1I1SA 3I4NJ 2KIMA 5FKCA 3WG2A 1C8M3 1NQDA 3ES4A 2X6OA 5HS8A 2YY1A 4KMFA 1R081 2R043 4OZOA 1F1ZA 2WN2A 3A1YA 3J4UH 1FV3A 1DDLA 3WW1A 4HG6B 3CMAI 1MSEC 4Y13A 4KI5M 4AOCA 3ZOBA 4D5CA 1QDCA 3HOZJ 1HSJA 2ME6A 4A0ZA 2ZEZA 3SFZA 1RUE1 3O0WA 4P9WA 5TGTA 2PHDA 2A5ZA 1DGLA 2A3SA 5A3TA 1LKNA 1MS9A 1JOPA 3RKQA 3ZQGA 4GFBA 2EIGA 1E5IA 5ABJA 2M2EA 4OHWA 4N53C 2CW7A 3ILNA 2DFIA 1P7IA 4X0GA 2DTWA 5G05L 5M5XJ 1V00A 1WJAA 2WNUB 4E7SA 2JE9A 4EEFG 3DWLE 5IK8A 4YG2F 4X8PA 2BNNA 1YLLA 1X36A 2JVGA 3RZDJ 1ZVFA 1TMF3 1QOOA 2OV7A 4JYKA 1U5TB 1GICA 2BNMA 2QSGX 1ZGJA 2LSOA 4Y1UA 1LR5A 4XLNF 5ICEA 5CVJA 4FFGA 3IRRA 5D8AC 3D5OA 1DU3D 3VGIA 5FZDA 2BY3A 5FV3A 4DZGA 3VDDA 5TRDA 1X9PA 2EAKA 1WJFA 2DMPA 3VD4A 2BE5F 4GWNA 3T0AA 2FU4A 3HVDA 1CN1A 2UWBA 3NJYA 3RDIA 4FP2A 3T08A 1MGTA 4CP9A 2PYTA 3CLPA 4IEYA 1SFXA 2MH9A 3O0XA 2DFHA 5AC91 1U12A 4YZ1A 1MS3A 3PNTA 2B0LA 4WZCA 1PK6A 3I0TA 2RNGA 1IPJA 2OC6A 3MV11 4QDRA 5CVRA 4HSTA 4M3CB 1EUTA 3AB0A 2VBWA 1RR8C 3BC8A 1FYMA 3OPTA 4IGOA 5I0UA 2VCCA 2V5DA 5DS9A 3BPSA 2ETHA 1AKHB 4RR3A 4W6XA 5CKQA 1U6GA 4IV3A 3ZMZA 2F4IA 3NJVA 5IFPA 3R4KA 2KR2A 3CCJI 3PMSA 2E1MC 1GZ9A 4N8MA 1ZR2A 1IS3A 3RKWA 2RJ2A 3GUDA 3PUAA 4TWTA 4FTEA 3U1DA 3Q5FA 2R3SA 3L00A 1NA1B 1Q8PA 4HSLA 2DT6A 5GZFA 2W4SA 3CIHA 4OUSA 4U0VA 1AYN2 1IV6A 3CZUA 2P17A 5FO7B 2YC0A 4EJUA 1RESA 2VOXA 2P6TA 4AVZA 5L3DA 4ZYAA 2X05A 3QBQA 1IG7A 1HC8A 2VVDA 1N1SA 2A69F 4LOSA 2BERA 3NSTA 3PQJA 4DRVA 4XLFA 1Z7LA 2EIEA 4G9SB 4FPGA 3DYOA 2JD9A 4HPKA 1MS8A 4L97A 1BVP1 3IAQA 5C71A 4GMP1 1OD5A 1MMNA 2ADDA 5ILUA 2G9FA 4DYCA 2LM3A 2Y69H 5A2QK 3IMMA 4XUNA 3HRUA 1GNYA 1QGLA 2VCAA 2W00A 2YS9A 3GZ5A 1E3PA 4K8FA 1XNTA 3EUAA 1L3LA 4CCKA 2RS12 1V6NA 4MGZE 1XDSA 4CDWA 3AYAA 4HFSA 2Z16A 1S2EA 3AFGA 4QKDA 1SPPB 4RB0A 1UL9A 1JBCA 4QPGB 1ENSA 1U3EM 4Q0VA 3QPTA 1W7PB 3CL1A 1LU2A 2BOIA 5EZGA 4BLJA 5F1RA 1FYKA 2RG4A 4QM8A 2HQNA 4J6GA 2E19A 1RHI1 3APBA 5FZOB 1BM9A 1UN1A 1HN0A 5FZ4A 3NMBA 5H9PA 2GQQA 3TOBA 3HC7A 1O8PA 5EYYA 4ENMA 2QBYB 3LF7A 2D3SA 2Y75A 3BY6A 4EWEA 1I5PA 4MHGA 1TT5B 3LIGA 4P1WA 1D5VA 5A3MA 2L0KA 4L5EA 3KCYA 4M6YA 2K7LA 1ASJ1 1XB9A 1GR3A 4A6EA 4RHV1 4B7EA 4IHXA 2OZJA 1V9U3 5L7OA 4OULA 4D0QA 3BTCA 3PUHA 2GA2A 5ACA1 2K5CA 5FBZA 3F3XA 5DPNA 5FYCA 4CRQA 2KIFA 3A22A 2AEYA 3OY9A 3BOQA 2VCMA 1WH7A 1YFUA 2WBKA 5HCBA 3BYWA 3NJZA 1REDA 2EJRA 1H88C 3NV1A 4AQ6A 4LLOA 5HOOA 4N53B 1IF1A 4N43C 1IKPA 4LBQD 4I01A 4AEDC 3LDKA 1RVF1 3I2IA 4HBNA 2GIZA 1B72A 1FZPB 4MO3M 3ZQCA 5LY2A 2OU2A 1O4ZA 3IDAA 3HR9A 3ZXEA 1LOFC 4LEJA 1XD7A 3HGYA 2OJED 4II3A 1OLMA 3O0VA 1OA4A 1F5JA 2ESNA 3CO6C 2WRAA 5L36A 4NO4A 1KQ9A 1Z05A 5BY5A 1GV2A 3N3HA 1REFA 5D8AB 4V2VA 4A42A 4UXNA 2VZPA 3ZIWA 1HDKA 3I3MA 2E32A 4MEXF 4IV3B 3JSPA 1PVXA 4B8EA 3O3KA 4KN4X 3I97A 3WDXA 1A04A 5IVBA 4ZS2A 5J98B 2DMTA 5FZKA 1XSXA 3UK9A 1OPCA 3UKNA 2Y64A 2WQZC 2WY7Q 2R30A 4AFMA 2DVAA 1LRHA 3CD6I 4C90A 4XTMA 3L2CA 4OMZA 3SXWA 4RMNA 1EAH2 1RUI2 4IDZA 2HU9A 2VZVA 3A0KA 2FDGA 3F22A 4MLOA 3VD3A 3QPSA 4LMYA 3T2PA 4BQAA 2A6HF 1XRUA 3W2WA 5GALA 3GZUC 3C3VA 3MICA 2R7TA 2M5WA 3ZDVA 2WAQN 1ZLKA 3J7MA 3U1XA 1FBQA 4XAEA 3ZFEA 3A21A 1XBFA 2JD4A 3JB4C 4RGGA 4D69A 1FPN1 1LHWA 2L2OA 2X6XA 5LGNA 3JAMK 1YI7A 4Y1YA 4XFHA 3ACLA 2RJKA 3F9KA 1MEC3 2EV5A 2O9LA 5GPAA 3IKVA 2W24A 2BXZA 3M8LA 4JGYA 1OT5A 5M5WJ 2JJ6A 1TQMA 1RINA 3OYJA 2X5IA 3M3IA 1ENXA 2E1MB 2WA0A 3CF2A 4RB2C 4XN3A 2XUMA 3OYWA 1AJKA 4RGKA 5EWSA 2VO5A 3C2UA 4QB2A 2DI3A 2E7AA 1YW7A 4A12A 1UYYA 2P3JA 4LBMA 5DZFA 2YG0A 5D2AA 4IE5A 1AVBA 1W6NA 2DW4A 1RUNA 4UW6A 1H30A 3C3WA 1Z6RA 4Q5SF 4EN8B 4UF0A 1QJY2 2RQPA 3VD5A 1PM4A 1V54H 4XM3A 5GTHC 4B1LA 1SAUA 1NQJA 3HT2A 2P8TA 1QJFA 3KCCA 4A3CJ 5FYUA 3CUQC 2TBVA 2CGOA 3ZRGA 1FTZA 2BW3A 3H1YA 3FIWA 3LOIA 4R9AA 4XHBA 1UPSA 1PM7A 1QZEA 5FP7A 4AM3A 4RS8A 2XG3A 4Y17A 2DDBA 2OUHA 1YJKA 1MKMA 1ZBE2 3R0AA 2WBMA 4XOGA 4FOVA 3EUHC 2GM4A 1ETOA 2ZAHA 1S0DA 3P7NA 4LE4A 1RUJ2 4ZTJA 2DXIA 3DPLC 4Q4V3 4M6VA 1OCTC 1SEUA 4GRIA 2J1SA 3WUCA 4QKBA 3NQOA 5DZEA 3QCWA 3LSIA 2HEOA 1TNRA 1NK2P 4XZPA 5EJ3A 3VBRA 4MGTA 1Q56A 1R7JA 3R6SA 3H42B 1IN5A 4EJWA 2XWBB 5C8CA 3B73A 3GALA 3K69A 4P9GA 2VKVA 2HOTA 5GAHJ 4XJUA 5KXDA 3TEWA 4Y20A 3HOVJ 1D0ZA 3BDDA 2NQYA 4DXSA 4L11A 2R0HA 1R1ZA 4WBBA 3AG2H 3VB2A 5FK7A 5HCFA 3ITQA 2NZ9A 3BPXA 1R00A 5IFTA 4L2NA 4CEWA 1JXSA 1GANA 3RJRA 3CDIA 4KBBA 4XF4A 2A3WA 4M3CF 1UCXA 2QQJA 1FWZA 3T1BA 2Z4FA 2MEV2 2JVHA 1LOBA 1LFUP 1XNAA 4DNYA 2QCOA 1UU4A 2YFZA 3Q8AA 4YIFA 3FHAA 1J1LA 2NP0A 4N43B 3WHUA 1LKXA 4BQXA 5J1RA 1B8IA 4I99C 2IA1A 4AEDB 1WHUA 2XBO3 3FXKA 2QQIA 5F27A 1AR72 2A6ZA 2I8DA 2P6HA 2BVMA 3BR2A 5F04A 3O1OA 1UY4A 1AYN1 2M4GA 4CU7A 1SVOA 5AIQA 1VBB3 3FBYA 2YC4A 2Y26A 2XROA 3AMMA 4YARA 3MYXA 5A3UA 1R092 1IQDC 3D3AA 1GT0C 2XVGA 1N3PA 5E3NA 1FYUA 3VDAA 3N05A 1IPSA 3I56I 1MDMA 5HCHA 3S7IA 2PFBA 4Q4W2 3ZYGA 1LU1A 4BS9A 4BCUA 5H9QA 2CQQA 2V09A 4XN0A 4PGHA 3S1MJ 4NC7A 3THDA 4F52A 2LKXA 1W6PB 4QU1A 2DCTA 5L9VA 1IV8A 3FXUA 3CMMA 4MXWA 1S7OA 2GOMA 1XC5A 1KS5A 1POV3 1GP6A 3AL5A 1W04A 4QXHA 3FKJA 1XJAA 2ZGSA 4YW2A 2F5DA 5FY4A 3LSEA 1G3YA 1J7KA 2PX9A 2KM2A 5E16A 1AU7A 1YHQI 3H8RA 3HD8B 3H9QA 1H1AA 4XK4A 3CNAA 5C4WC 4IERA 2OQ6A 4GXOA 1ON2A 1R1TA 4PDKA 1UY1A 4V2WA 3SEEA 3RI9A 2IJLA 2RDPA 2C0ZA 1A6IA 2PELA 2VBDA 4AFCA 4IE7A 4Q4X3 2HXIA 4IGQA 2VZOA 1OVPA 5FYZA 3S8PA 3JBG1 1JW6A 3AYDA 1PZ7A 1C3HA 4XFCA 2EH3A 2V1NA 3K7AJ 2ZOEB 4UFJA 2DN0A 1VAKA 1DGRN 4Q0QA 4CYCB 2XLFA 4MUVA 1X19A 4P5YA 1ND2A 2EILH 1BBYA 3WDVA 1MD0A 2CSOA 2FQPA 4A7YA 1R1A3 5FJHA 4CCCA 4CDQA 1AOYA 3DYMA 3BGAA 2DOAA 2ZAAA 3MKYB 2LREA 1D2SA 4FX4A 3ILRA 2WR9A 5FDBA 4PIYA 3OYHA 4PF1A 4JK1X 4S04A 4A6SA 1LHNA 2D98A 2VZQA 1I9RA 2RS53 1WI3A 3D5SC 4QXBA 3AP6A 1OQYA 2LF7A 1A36A 3RYPA 4XCAA 4S2GA 2V4JC 3CUQB 2HR3A 2A6EF 4RQPA 3PUSA 3ZXLA 1E57A 4META 5ICGA 1VNDA 3KMHA 1UY0A 3ASNH 5FXVA 2ILMA 1STMA 4QX8A 3RZZA 4OI0A 3TO9A 3OYLA 3AXEA 1A6QA 1ITYA 5CIRA 2VMIA 4CEWB 4UVCA 1TNFA 2ZMEA 2BUKA 3O1MA 3I3EA 3GZNB 3IWZA 2VKHA 2H0VA 1HLVA 3ZQ7A 4LJHA 1YIJI 2L7FP 2HEYF 1VF9A 1FMD1 3AX4A 4UUSA 4L18B 3C7FA 3AG4H 2L7ZA 2DWRA 4WVZA 4FVVA 4B43A 2WL1A 4R1HA 3A01A 3LCPA 4XABA 1EAH1 1UYPA 1RUI1 4A41A 1IZ1A 2VVFA 2ZGUA 3CQOA 2CUJA 2I07B 4Z2YA 4IKFA 2MABA 4BK4A 2SLIA 4HX7A 1QXRA 1S0FA 3J7HA 1WCUA 2JDYA 4UW3A 2PHUA 2DODA 3LZZA 2R5YB 2IT0A 1ENHA 2QSHX 4GYIA 2BYVE 1J75A 3ZQQA 1O4TA 2P4EA 2IFRA 3GTOJ 1B4AA 3RGBA 3K2OA 1LOGA 3RRDA 1QO0D 2HJIA 2RDRA 1W0UA 1C57A 2HI3A 1NG6A 1KYWA 4MGSA 1A35A 2HWB2 4GZ9A 1UG0A 4BZ4A 1YJWI 2D6OX 3N7LA 2IXKA 2VQCA 4YM2A 2GOXB 2WWUA 4D6RA 1EYBA 2FUG2 2LKSA 3FK7A 4HL0A 3OYEA 1ZBA3 1RUH2 4FPFA 4OHVA 3B02A 2HLEA 2B42B 3W20A 3SHFA 2W1UA 4ZYEA 3E6DA 5FY9A 1JYTA 3OD0A 3RFRA 1QJY1 4RBOA 2QQBA 1WD3A 4ZPIA 1RUD3 5FPZA 1JT0A 3KV5A 1Q8QA 4ZZDA 1NXD1 2AZ5A 5A1AA 1H0MA 3T09A 1Z67A 2R7RA 2O8XA 3SYTA 2QQLA 5EHDA 3OYGA 4XW3A 1LDKB 3WSOA 3IH4A 3SDBA 2HWE2 5JOXA 2W68A 4TZDA 1CPNA 2IXCA 3M9AA 4XR6A 3H5AA 4HDUA 3KQ4B 1BLZA 3GLXA 1W9TA 3WLUA 3DYPA 5J96B 3BJ6A 3WE3A 1ZBE1 1EV13 1XYOA 2VUCA 4K8RB 3M70A 3MEPA 4LG3A 2HPMA 5FK8A 2CY6A 1K6YA 1CGPA 3GFMA 4DOZA 1MZEA 3HPGA 2FBHA 3AZYA 3B5LB 4MVTA 2EA7A 1PX4A 2GAUA 1RC6A 3P3PA 3IHUA 1J3RA 5C4WB 2DT5A 2ZACA 3CJTB 5J37A 1RUJ1 5JOZA 2DTRA 1ONVA 3L2RA 5G04L 5JMCA 3W9AA 2CQKA 3E97A 2EPFA 2DVFA 5CLSA 2G7HA 5DXDA 3LA7A 1N3OA 4E2SA 5FKNA 2CTVA 3GTQJ 4YIRX 5JFRA 4YFWA 1SZBA 1QBJA 4MV2A 3KF3A 5FZ0A 1X7NA 5K0UA 1B1BA 1VR3A 4XSXF 3EYYA 4NC6A 3Q8BA 3POIA 1VQ7I 2ICWG 3ISPA 1CX1A 1VQLI 2VOWA 3OIOA 5HXVA 3SZTA 2HH9A 2XF5A 3MF9A 1F9NA 2LRPA 5H2FC 1X1PA 2F6CA 2EBIA 4I0BA 1GZTA 5BYNA 5BNOA 1N1VA 3RNSA 3TL4X 3HOXJ 4XACA 4NIDA 4FPHA 1MVEA 5BNPA 1VBD2 2MEV1 5FLIA 3ORJA 4MG2A 2R7DA 1A5JA 1FLIA 1FJLA 2ZEXA 2D44A 4YW6A 3WTTC 2VBPA 4CP1A 2OAZA 3BIWE 1XMAA 4ZJZA 3E1F1 4D8MA 4N4NB 3MAJA 1RRJA 2AUYA 4P14A 1NY72 3OY8B 1AR71 5FAXA 5DAVA 3NL1A 3VBUC 4UUVA 1AR62 2GMPA 1POV0 3DTKA 3DBHB 1WCSA 1W99A 3HDDA 1VBE2 3ZQHA 5J47A 3CC2I 4WVWA 4CHUA 2Z5UA 3K4JA 2GXAA 4BISA 1KU2A 3TMOA 1JYCA 4P55A 5J1UA 1R091 2W82A 4ZH4F 2IXHA 3VYTB 4B4QA 3FHIB 2A6VA 1OQDA 3IUOA 3HSFA 3M3CA 4EZHA 3POJA 4Q29A 3LQQA 5CFDC 3KSCA 1GQHA 4OIOF 3JXSA 1X1DA 3B00A 2DT7B 4XMYA 2L7KA 2FD5A 2F48A 2CNAA 2NM1A 3PNAA 4RA0A 2YHJA 2ZJQF 1B35C 3IPVB 2MLGA 1S1AA 5HNFA 1RUC2 1CZSA 5JHUA 2HWF2 5HLHA 3MDPA 1W2NA 2VAUA 1JUIA 5T5LA 5JZGC 1DGWA 1UAIA 3AG1H 3U78A 3J8F1 2VL4A 1PO22 4LULA 4HQMA 3RS6A 4XL9A 1NCRA 2A6XA 2K2SA 2PMZA 5I0RA 4Y24A 2Z69A 3QOPA 2K02A 2EFWA 1BR1A 1N1TA 2XRLA 2QVOA 1RPWA 1YIOA 1SLAA 1SMVA 2XAFA 4GKXA 3I2DA 3CZJA 2ELJA 2NPIA 1WKYA 3OUJA 1O4XA 3NV4A 4M9XA 5BQTA 5GZDA 3H0DA 2WINB 2AEZA 1YXWA 4NPMA 1AR81 2XDVA 3JSOA 3KX2A 3BIEA 4EN0A 3V0BB 2OZUA 1C5IA 1F35A 1QJX1 1WW5A 3BZKA 3W2AA 4L0YB 1ACIA 1S6LA 5CYVA 5DCFA 2Q5TA 1SVLA 2YU2A 2IS6A 1W5TA 2KRFA 3VOEA 2VMEA 1RUE3 2W94A 4EJTA 2SBAA 3SXYA 3JRHA 3SZPA 1UU5A 1D7PM 4PLOA 5FUIA 3OJBA 2QQMA 1V9U2 1A31A 1O7FA 1V6OA 4QU2A 3WZ1A 4Y4YA 3VSLA 2YPJA 3VV1A 2JG9C 3ZN6A 2V1DA 4ORFA 1RUF2 1TG7A 2A6YA 2CG4A 2VXJA 4P02B 2JA5J 1MPXA 3N97A 2FMYA 2BGPA 4LK6A 4BGDA 3Q0UA 4QX7A 4AQSA 2D1HA 4WV8A 1ETKA 1W6MB 1TLHB 1DHKB 4HSJA 3M3YJ 3ILFA 5FMDA 4PDWA 1Z91A 5DDGA 4JCKA 5FGMA 3HBKA 3OR1C 3K3NA 3AMQA 3P3NA 2L4MA 3SITA 1W8ZA 3EQEA 4CU6A 4ZONA 3C2HA 1KGSA 3FISA 2E5NA 4JTOA 2FRHA 4YG6A 5CQGA 4XDQA 3V7SA 5FCCA 5SV5A 3E1SA 3H92A 1DDNA 2BW8A 1UQXA 2NMOA 3I3DA 1ZRDA 4LPLA 4G94A 2B39A 1R36A 1JKOC 4FPKA 2HDWA 5A7WB 1MMGA 3U21A 5BNPB 3OGJA 4P5HA 2D5VA 4W4ZA 1AXYA 2XVKA 1DYKA 2FDKA 2QQWA 2QQAA 3PNYA 1UY2A 2CGPA 1JTYA 2JE8A 1MQTC 2YBPA 2P37A 2WLPA 4QGLA 3CJRB 5IYCJ 1WW6A 3CDHA 5EYXA 2CFXA 3MO4A 4MGKE 2PHFA 2ET7A 4LOTA 2IRFG 3TB0A 3O14A 5FP3A 3KP2A 1G8XA 1KYZA 3JRBA 5T52A 3BG5A 4M3DA 3ACFA 5D5VB 4S2DA 5DCMA 3WE2A 1VTNC 3LOBA 2DMNA 2YBSA 2JECA 4MOAA 4OHZA 2ZA9A 1Y0UA 4ESFA 2MD0A 2PQQA 4G8XA 3MZHA 2VOKA 3QWLA 4GWMA 2BPA2 1C8M1 2OXBA 1JTZX 2DCEA 2KHMA 3GHMA 2ZEWA 4AGRA 3AZZA 3HOUJ 5IVFA 1X1CA 4UT5A 2R7QA 4Y22A 4SLIA 2HWB1 5KXEA 4XQFA 1IQAA 3ZLIA 2M8GX 3F8FA 1GXPA 3DL3A 2CH0A 2DYCA 5FPUA 1UKGA 1MEC2 4E4ZA 2D3PA 5KNLA 1ZZCA 2E63A 3IBMA 4MYEA 3T0DA 2ZPXA 3ONQA 1MJ9A 2XF6A 1WKMA 1G7YA 2V72A 3NVCA 3VBUB 2Y6GA 3BN6A 1RUH1 1XN7A 1O4YA 1IKQA 5FKLA 4NRQA 4U36A 2VUMJ 5F3CA 3ABTA 4NPRA 3H0GJ 1ZZBA 4YNIA 1RUG3 4O3MA 3M8FA 4UW4A 3CTAA 4RM2A 1K5MC 2BBVA 3WNKA 2BGOA 2RJLA 4M3CE 4AZZA 3ZMTA 3T2OA 3B7MA 2OVUA 5J8CA 4AYBN 1HXS2 2XAUA 1VRH3 1YQAA 1YUDA 1HRI2 4EMSA 2LMDA 1MBHA 2IXSA 1B35B 3SQOA 2ZFWA 4B4CA 5LA2A 1L7QA 3RMXA 3WQ0A 4GMP3 3KT1A 3BTIA 1D5YA 1YC61 3ETPA 5JZGB 3FFZA 4AFDA 4GWIA 2YX7A 3N7KA 1ZELA 1GHCA 1TVGA 5IOYA 2MD5A 3WTSC 4JC1A 1YQ8A 2JB4A 3BKZA 3N9NA 2ATFA 2IXLA 2P3IA 5A7OA 2P6SA 3KT4A 5DUVA 4XKWA 2O0YA 2WNVA 4BJ5C 5FQ0B 1OR7C 1BL0A 2ISYA 4L0PA 1YO5C 2JX9A 2JK3A 1VBA2 1T08B 1PO13 5A7QA 3L09A 5LATA 3WCRA 1Z6TA 1HW5A 4A3EJ 1WZ2A 3I3BA 1DQ6A 4IHSA 3ACHA 2H09A 4AF9A 3PSFA 4FBFA 5FP4A 5E6HA 2WB1A 3GX4X 4RHV3 5J40A 3AP9A 2HS5A 2QQ9A 5APAA 3HOBA 1V55H 4WM8A 3ST7A 5EP9A 4XHXA 3EDPA 1G9BA 4B48A 5ACA3 3S93A 1VBD1 2BOJA 2LG4A 3GWZA 4N7IA 2NYYA 4ZTFA 3NNMA 5HXMA 3CZ6A 1HQLA 3OS1A 1Z7S3 3L2QA 1LOEA 4B29A 1U2WA 4M3EA 1H9GA 1AUYA 2HQ5A 4FPYA 3EJKA 3VBSC 4L92A 2LKPA 1XGSA 4WCGA 4XRSG 1CAWA 4D1QA 2E1NA 2XVCA 2VJXA 5J7MA 1UU6A 1RVF3 1UO9A 2MC3A 4WXCA 4R8HA 3GTLJ 3MV01 5F6KA 2VOPA 2UYBA 2XB6C 1U9OA 2BFUS 1WLCA 2CWMA 1HLCA 2CV6A 3OSGA 1L3JA 1NTCA 3WU0A 1EJ9A 2PXJA 4XURA 2DCYA 3SLIA 4Y22B 2VLAA 2JSPA 5EEGA 5C5TA 1XU1A 5DUXA 3KT7A 5FUPA 1WMFA 2GXGA 5DV5A 1ETYA 3BG6A 4OQ8A 2NVXJ 1RUC1 5IATA 2HWF1 1UXXX 1HB2A 1BA5A 1MQTB 1UB9A 5EPAA 1JUHA 3OBAA 2FJ1A 2ZBKA 1I3AA 2FDJA 3OSDA 4KU7A 4U7DA 2BQPA 2IAIA 2ARCA 5CQEA 3PDQA 2DFEA 3HUGA 1QEXA 2ZNZA 1IN6A 3S2WA 3K4ZA 2DFFA 4CUBA 3HBZA 1BMV2 4BE2A 1EH6A 1YJ9I 3LFIA 5K8SA 1FI2A 2XJSA 3KP4A 4A3FJ 5FKBA 3M1HA 3MKWB 1X4PA 2KP6A 3COAC 2NS7A 4O61A 4F8AA 1S5LC 1ENQA 3OL4A 1LCLA 1RMU2 4XMAA 1HKTA 1WBLA 5DG1A 1DZRA 2XQXA 1AYM2 1X3UA 1DQ5A 4AHZA 3GJBA 3WODF 2JA7J 3S3OA 1CVNA 2BY1A 4G6DA 1W5SA 5FYTA 4CH7A 3QACA 2A71A 1BBT2 1WJEA 1T8IA 4LHSA 2TNFA 4XIDA 4OMDA 2GWRA 2BHZA 4ZZ8A 4BXSV 3AVRA 3WTZA 2HVRA 3WF4A 3ZQLA 3W6VA 3I58A 4XIKA 5FZIA 4FSJA 4UNOA 4WM7A 4HV5A 2ZXHA 4XIOA 3WP6A 4NHYA 3H3LA 2EXIA 5KAIC 1XDUA 2VPRA 1DFQA 4UOJA 4ZHNA 4IHVA 3OBTA 1OMIA 4RD7A 2DOEA 3PUIA 1V9U1 4LBQA 1S9HA 1Z1DA 1DQ1A 2JUGA 2FMLA 3FXRA 2FEZA 1RUF1 4QAWA 5A32A 4XJ8A 3M8EA 3LFKA 2RDQA 3WR0A 5JSRA 4JP0A 2JMWA 1K5MB 3CP8A 2ISZA 2HBTA 5KHJA 1O59A 1CAUA 3FHNA 3TN92 3I3QA 1Q3EA 3KB5A 2R7OA 1HV0A 4BE0A 5JCTA 1UD1A 3H9GA 1LECA 4JGZC 3T1LA 3ZQIA 2WN3A 3ETQA 4FCAA 1RKWA 4I3GA 3KV6A 3FUQA 1V5EA 4H7MA 4U88A 4DXTA 3ZQFA 5BOXA 1DYPA 3K4DA 3S2DJ 2A73B 2XR4A 3LPFA 3NV3A 2E7TA 2VJIA 5M0TA 3TAYA 2XUBA 3LQCA 4DEVA 4D0PA 3DBRB 1HKDA 4B3XA 5IP6A 1O6UA 3WP3A 4L99A 1BK1A 3G1LA 2B46X 3HOTA 2YPDA 3CCLI 4HETA 1QQP2 2K4BA 3WNOA 3C2BA 3ABMH 1V6KA 2JKBA 4AL9A 3BTYA 4NRPA 1X2NA 3FHQA 4BYYA 3LSMA 1COV2 5L3BA 2AREA 3H3ZA 1LB2A 1PMIA 4CPBD 3PHMA 3VZLA 4IZZA 2EINH 1UY3A 1P2FA 2YX4A 2JG8A 1ZTRA 2VQTA 4HYEA 3K1PA 3I5UA 3HSRA 1RUOA 3SCHA 1Y9GA 2ID3A 1ND3C 3ULQB 4PT6A 4J19A 3RZJA 3GTPJ 4XRFA 2E6VA 5FZCA 3JRFA 3SKJE 1YCIA 2V6EA 3Q8EA 4XRSA 3HNBM 3ME2A 5EZHA 2O7OA 2JICA 1XNKA 2ZEYA 5F6LB 5LW9A 3M7AA 4A3XA 4HKWA 4BDVB 2K3PA 2WV1A 5J8FA 4GB32 3CMGA 4HBLA 2GC3A 4KBZA 4K2EA 5KCMA 4BL0B 1CAVA 5GM0A 3M2MA 2FXAA 3RI8A 2DVGA 5FZGA 1X8MA 3JZVA 3SJMA 1NK3P 4KWUA 3BP8A 3ZXAC 5HVQC 1MEC1 4JKMA 1BC8C 2CDOA 1RB8G 1LDJA 1Z0XA 4YW3A 4OUEA 4E8DA 2KQRA 4M74A 2ES3A 3I2OA 4YM0A 1VQMI 3VBSB 3CO2A 1OISA 2I10A 4IEXA 1ULFA 3E6CC 2FCUA 1VJ2A 4GMP0 2W85A 3DTIA 2A7AA 4YSFA 3ZFFC 4S2FA 4BK5A 1I1GA 4I0WB 4EROA 2XAGA 4A3LJ 1UZCA 4R4XA 5HNHA 1W0TA 3OPZA 2WA4A 1IRFA 1H2MA 1U5ZA 5E1XA 2CV2A 2BXYA 2L9SA 4HNVA 3S16J 1BKZA 3LSGA 4AI2A 1VQKI 4RB3C 2G9GA 2O5RA 5JLVA 2CRGA 3KHCA 3VSKA 2D5HA 5B2GB 1XQNA 3GHNA 4JKKA 4DY5A 4IVNA 1HXS1 1RUD2 3WHBA 2OZ6A 3VD7A 5IYBJ 3NJXA 2BGCA 2AHQA 4IE0A 1F8VA 3GEZA 4OUMA 1OSGA 1BC7C 5BXXA 2QNKA 1R23A 3QU6A 4CTEA 4LG0A 1O57A 3BCBA 3CF5F 4OQ9A 1AWCA 4TYSA 5K5OA 2JDKA 3KVAA 2RS13 3MWMA 3HKZA 4OIQF 2Q0AA 3GTGJ 1N78A 2W39A 3M1CA 4BBRJ 5IK7A 3HEFA 4RGRA 2BV4A 1YITI 3OIQA 2Q8KA 4YW7A 1EKEA 4DYRA 4E7IA 1U78A 4YVWC 4KIGA 4QQ2A 2QKMB 1J59A 3NRVA 1LDDA 4FPLA 4NPLA 5EQUA 3JAMZ 4PF5A 3B01A 1JS9A 4MHRA 2OTLI 2K27A 1LE8B 4D94A 1NAEA 4G3YC 1IXRC 2JA2A 1S0GA 2EIBA 1QHGA 1HA8A 2W2IA 3BT9A 1B09A 3K4KA 4BEHB 4OAZA 3OUIA 4Q4V1 1UMZA 4COYA 4TSVA 2P5BA 1SFKA 2Y0MA 2CUFA 3B9CA 1DPRA 3VHRA 2K9ZA 4RLQA 4IOCF 4QPOA 5CKMA 2IW5A 1QWRA 3WDTA 5FO5A 1PX3A 3IIIA 1QNWA 5B4XA 3RZOJ 2J1UA 5D21A 1OUXA 3T30A 3MZ8A 2FZ1A 2PMHA 2XGEA 1KJLA 4RGUA 4ZY9A 1G59A 4YG3A 3ZXGA 2M9HA 3K4CA 4KFCA 4H55A 4A93J 4CP2A 1S7EA 3GFLA 1QJU2 5KBFA 1JU3A 4C3JJ 5A33B 3OL3A 1PVC2 4QKNA 5J1YA 3LAPA 1JZ3A 3IH2A 4DJAA 2JE7A 4JX5A 4IPAA 2IVJA 4Q4ZF 1QRYA 3ZR6A 1W05A 4LR4A 4NR1A 5LA1A 4KISA 2R7WA 5FKKA 2Y33A 5K1YA 2OT7A 2TCTA 1W2TA 2TDXA 2IS2A 5IHRA 4YVSA 1GV5A 5C7GA 3OGSA 3SEPA 4Y4RA 4XLHA 1W2OA 4LA2A 4IEZA 1BOAA 3DXJF 5KAFC 4EV0A 2XBO1 4E4DX 4JGZB 5DDJ2 1S0CA 5FZ7A 4LNVA 2CV0A 3MLLA 1UF2C 1ZAOA 5IVCA 3K70D 2DPDA 1X82A 4AIKA 2WAOA 2AENA 4DPNA 2YC2A 2E7QA 3MBWA 3D4KA 3HPNA 3N35A 2W84A 3KM5A 1T6BX 2XHNA 2JZYA 1OF4A 2BU9A 3KZ4C 3MIFA 1LOCA 4X8NA 1OA3A 1T95A 2VTXA 3BI3A 3AFHA 2W92A 4CCNA 1SANA 5C9AC 5FFZA 1T0FC 5HS9A 2D6KA 1OI6A 3QAHA 4LTAA 4NHXA 1H2KA 4NJ4A 1YW8A 2RGVA 4QDQA 4QX1A 4Z1VA 4OOIA 1SDDB 4G4FA 4A5NA 4ZDOA 1NKGA 3DXTA 5ICFA 4ESBA 1POV1 4R9BA 1JHFA 1EAH3 1RUI3 1H9TA 1W8NA 3TKYA 3U37A 4KUMA 4AI8A 1ND3B 4Z6YA 1BIBA 4UB6C 3ABZA 3WQ7A 5A6XA 1SMYF 5M3MJ 1ZA4A 2JA8J 2H6BA 1BW6A 5I93A 4HV6A 4HXCA 5E1WA 5ERIA 4QTRA 2C5DA 3AZXA 3T8TA 2E33A 4ZC3A 4AQ2A 3QU3A 3Q0WA 3R05A 1W0PA 4BY1J 3K0LA 2LH9A 2VZTA 4BY7J 4NMIA 4Q4X1 1VALA 2JUCA 1TWFJ 1BCXA 1JN2P 2J5PA 2KMUA 2H8RA 1H8TC 3NAPC 3AMPA 3JTGA 3E5UA 4HA8A 2YXSA 2OD5A 1MNEA 3V56A 4TXWA 5C5UA 5I0SA 3ZFFB 4YGBA 2YUSA 3TW7A 4LBJA 2HZTA 2CO5A 1RXGA 1R1A1 4KU8A 3O1TA 4XNFA 2Z42A 1VMFA 4AR2A 3I59B 5FYMA 3IV5A 5KXBA 2XLAA 4BQNA 2W1WA 3M07A 1W9WA 1HW1A 1QJY3 3EQLF 3FBIB 4EJOA 3R4UA 2HYKA 3POEA 3V0AB 3OEBA 4WWCA 1D4VB 2OPWA 4NROA 1O3QA 2WC2A 4A3DJ 4C1WA 3MIEA 4RGSA 1B9NA 2RS51 1LUJB 1W8OA 4HANA 3WTVC 3RZGA 4HONA 3L2HA 1XYNA 3IMNA 4QXCA 2L4AA 1JHHA 4YFKF 4WVMA 5JAXA 3ERMA 3UESA 3E3VA 2RV9A 3DP7A 5BPDA 4DXRA 2XASA 4IV1A 1V4RA 4NHLA 3GCXA 4FXGB 1OPOA 2WO2A 3VBOA 5LZ6A 5TSWA 4B4PA 1PIV2 1CZVA 3SH5A 2C6YA 4XLAA 3OTFA 3GMEA 2EZKA 4YVWB 4A44A 2KD7A 1S8NA 4LLGF 5FXWA 2ZABA 1RUJ3 1X4OA 4DFSA 2ZJRF 4YVSB 2XGDA 3C7JA 4EYUA 4L9JA 3LMMA 3DEEA 4CDXB 1J1TA 3X2QH 1YRNB 1SCSA 1BIAA 4DGWB 2J7MA 3VBHC 3IP4B 4XJ9A 2HWD2 1JU4A 3TWIA 2R072 1E5RA 4IEJA 2XJUA 4HW0A 1P7JA 4BMBA 3DU5A 3UR3C 2VI6A 1WMDA 5E8AA 3NWKA 4C3IJ 1HQCA 5FKMA 2YU1A 1D8JA 4CCMA 2YSRA 2XH6A 4XXAA 2YROA 3SQNA 4KITB 3ELKA 1ZGAA 2VNRA 4QIWN 3VEPA 4U87A 1E5HA 4HPQA 4PJLA 3IAM2 1QMJA 3H3UA 3ZOIA 3WGGA 2O8KA 1UX6A 3OF1A 3PVEA 1F4AA 3ZFGC 1RYYA 2E9QA 3ZYHA 4W6WA 4BLIA 3FN9A 4Y5SA 2R0QC 4D7TA 2BWAA 3LE0A 2GALA 1QJZA 3O5SA 2OCEA 2DCJA 3UKVA 3D5RC 3J7YJ 2X10A 4JZRA 2CW0F 1ULEA 4CXXA 4AG4A 3OMYA 1R9TJ 2NRAC 3BCWA 2Z2SB 2CYFA 1RITA 4OLLA 2KKOA 3LSPA 2Y30A 3A4UA 1D1AA 2AQEA 2G0EA 1NYWA 1BOBA 1DLCA 1R093 1CAXA 1KONA 4BQ3A 4R79A 1GMMA 2FDFA 3LNQA 1PUFA 1QA6A 4J01A 1DQ4A 4OHYA 5JVVA 4ASLA 1OLTA 1RUD1 2Y8KA 4CEYA 4M6XA 2VNGA 4Q4W3 2VZSA 3PUQA 4JV4A 2W5FA 3HNYM 4XORA 5C9AB 1K83J 4AK3A 3USUB 1JGSA 1J2XA 1ZRIA 3WNNA 4LE3A 2QVSB 2UURA 4MSVA 3IDEA 2W91A 3AM2A 3GNEA 5LGTA 4CCDA 1O3RA 2Q1MA 4BXUA 4Z82A 2E7XA 2LOOA 3F0CA 1DQUA 3W5MA 2QYOA 2E34A 2RM22 3WY6A 3FFQA 4OVEA 2Q8OA 4CXFA 5FPAA 3Q0VA 3ZMDA 2HVQA 4M00A 2ZMKA 5KC5A 4HQEA 4AIJA 5LHGA 5E89A 2L02A 1PGL2 4WVMB 4E9KA 3MIGA 1XE0A 4DS0A 2QBXA 3FXOA 1N77A 1FPQA 1N1YA 2Q8DA 3BTZA 2YB7A 4IV1B 4KQ7A 5LK5A 4NQWA 4YFZA 3DN7A 1VE0A 3U4SA 2AS5F 1NCQA 2EIKH 4K7JA 3UJQA 3TNQA 2PBIA 3NAPB 3NW4A 2M7BA 2V5YA 1FT9A 4XRMA 1FIAA 2FZ2A 1QJU1 2QA4I 5F0CA 2VN2A 1PVC1 5FZEA 4AVPA 1BN5A 3NAUA 3WG7H 4QWNA 1ETXA 3GZEA 4CDUC 4E4HA 1TW2A 4CCLA 3CJIC 4KIBA 2XJRA 1PZ8A 1F31A 2AQFA 3EHKA 4D7NA 4PJMA 3POYA 4QMAA 1NHAA 5IJRA 1PMJX 5GJ6A 1I27A 1SMTA 5LLQA 1IG3A 5LEJA 2FNPA 2ETEA 1PNFA 1UOBA 5FZ8A 2Y6KA 3KCXA 4JTNA 2JJ7A 1K4TA 2MSYA 4HK8A 2V4AA 1SFEA 4G6QA 4Q2FA 3WT3A 5A3LA 3FLTA 2P2KA 4F3JA 1SVMA 1H8VA 5E1ZB 1ULOA 2HYFA 1HB3A 2LRDA 4QSHA 1GLNA 3CLOA 2PHWA 3HN1A 4GA9A 4X6AJ 4M4RA 4IL6C 4F55A 1TWGJ 4G6TB 1KFUL 4DZJA 3FL7A 5H6QA 4LO8A 4NRMA 3S0MA 3ZXKA 1LEDA 4NAMA 3HRTA 1EUUA 1MBFA 4UFIA 2UXNA 4C9YA 1BVVA 3HOSA 3O1SA 3DKQA 3GCMA 4KGQA 4LLFA 1FEXA 2O0OA 3MF6A 4Q0UA 3LSKA 3RQ0A 3V8KA 4L9NA 3GTJJ 1OKOA 3B69A 1ZNPA 4UBHA 3WNPA 4CGZA 3CF6E 2FSWA 5A3NA 1AR93 4ZYDA 3S2HJ 5ANNA 4FQ4A 4N0BA 2Q4SA 4RN5A 3EBRA 4UVBA 5ABJC 1WRJA 1OKQA 2VG9A 4Q8LA 1GZCA 1QDOA 2FDHA 2RMU2 3DF8A 1ULPA 2F6BA 3HTSB 1O3SA 1H1MA 1W6OA 2UV1A 2HZDA 4V2GA 1IS5A 5EG0A 3KD4A 5C3OA 3I2KA 1JJ6C 2HWB3 5T55A 4ONUA 5A6QA 1W2UA 2BY2A 3ZFGB 4XQDA 3V65A 1FNNA 3I9V2 1BI1A 4O65A 4F83A 4AI1A 4CVUA 1EPWA 2R062 5FR3A 3MIBA 1K78B 4XDOA 2YPRA 2R7SA 3HB9A 5LASA 3CC7I 2XB0X 3GZTB 2JPBA 3VDDC 2IUWA 1RUH3 2VQ0A 2O8OA 2VE9A 2DA2A 3FZVA 2UWAA 4YIIA 3QRFF 1GOGA 4ISRA 4AE2A 5T5JA 4URAA 4Y7NJ 2W1QA 3M3QA 1K4SA 3ZXSA 4CO8A 4BACA 3ECQA 3MFKA 1BI3A 4LHNA 4C2MJ 4LD5A 1AHSA 3K75B 2Y2ZA 1IHMA 4UBGA 3VDCA 4NOTA 3MW3A 4B3NA 2V79A 4A3MJ 2GNBA 1PK6C 4RS5A 1YJLA 1RKTA 2QUOA 2QGUA 4Y1XA 2WV0A 1Y9MA 5FMOS 3CEWA 4IXAA 1S2KA 2HWE3 2QQPA 4M9ZA 3IWFA 2RNJA 2LBFA 1WJCA 2WKKA 3B6CA 3ROUA 4IRGA 1XS9A 1Z0HA 3KS7A 4HRIA 1P9QC 3HWJA 3TBIA 4O6JA 2DF7A 1PIV1 2EVXA 3IKTA 3AP7A 2PAMA 1W36C 1XX5A 4QPIA 5IUQA 4RR3C 3WX5A 1W0OA 1WFXA 2VKEA 5JMOA 1ODNA 4GQ7A 4LB6B 4IV3C 1W28A 4Y5Z0 2P4WA 1OFNA 1WD4A 3H50A 2Q2EA 2DK8A 1IRGA 1MMSA 2MA3A 1XTAA 1SFOJ 2QSFX 4UHTA 3QYFA 5C4JJ 3KPHA 1BR4A 2ZX4A 2PLV2 1Z78A 4GJZA 3CU7A 2HWD1 4LK7A 2R071 3AL6A 4L9BA 3TEXA 3VDXA 5DN2A 2IZWA 2Z1DA 4GH4A 4M0HA 1QNTA 5GZCA 4JKLA 5K7PA 4BAYA 5FPXA 4J1WA 2JRMA 2LROA 2ZJPF 6PAXA 1CJPA 1O5LA 3MFCA 2J1AA 3NKGA 4CDUB 4Z07A 1SACA 2EIDA 3CJIB 1UG2A 1VBD3 4FT8A 1GOHA 2G9WA 1ZREA 3RZKA 5FP9A 3GFIA 3OD4A 2LS6A 2EB7A 2VU9A 4B1MA 4Y52J 2VOVA 5IYDJ 4PUSA 4LLLA 1OYWA 1LNSA 2ARXA 5T5OA 3SCFA 4NN0A 4CE8A 4HLXA 1HB4A 3MIHA 1MZ6A 1LEBA 2P81A 2QQOA 4BB3A 2V9PA 3K51A 2HWC2 3DECA 2QJVA 3CJNA 1GBGA 2AGSA 1QU3A 1AR63 4CDWC 3UV9A 1JI8A 1UYXA 2KJCA 4A69C 1VBE3 3QP6A 4XETA 2KZVA 3S30A 1ZK8A 1ON1A 1ZA7A 2CDPA 4M72A 3CCUI 4KWKA 2ZTNA 4F91B 2GLOA 2BJSA 3UGHA 1N3QA 5FZLA 5FLXZ 3K4NA 3LEIA 1RUG1 1JKQC 3KLSA 3DV8A 1GZWA 3HHGA 5A3WA 3VHNA 2WNEA 3KGLA 4CXWA 3BALA 1C1FA 3HJRA 2R7ZJ 3LWCA 2HWVA 2K4JA 4LK0F 1QQIA 3CLQA 3BPVA 3RIRA 2ZX0A 5HS7A 1W1WE 2FCTA 1DBNA 4QQHA 2YZ4A 1RUC3 2HWF3 3LEGA 4QQOA 3WINE 1L7LA 1VQ6I 2DUQA 4PSXA 1VRH1 9ANTA 3LIHA 2NVQJ 3HQUA 1J83A 5B1AH 5FYBA 2DJNA 1PO23 1SLCA 3V8JA 5EJZB 4KL1A 5ERLA 1ZM1A 5L7OC 3FXJA 3OYCA 2EFQA 4PK4A 3ESWB 3CKHA 1SQ4A 4U0WA 3GW2A 3MZYA 2QE3A 2K9NA 5A80A 5AFBA 4BWOA 1ZR4A 3MCZA 1CF7A 3VKOA 2BDRA 4CP0A 3K77A 5ABJB 4QQPA 2EZHA 4JDMA 3Q9OA 3HQXA 1PGL1 1HJGA 1Y3TA 2XL7A 3FLPA 2ZC2A 2VT2A 2HOAA 4HK9A 3WF1A 4YEJA 4I02A 4TV7A 1PO11 3FC0A 2X4HA 5LGUA 4DMIA 3O8GA 5I8SA 1SCRA 4CICA 1FYLA 1K3IA 3LA2A 1H0BA 3WG1A 4E6KG 4C2UA 3W6JB 2PQ8A 1W9SA 5LRSA 3CP2A 2W46A 2CSGA 1UXZA 5K4LA 4FPCA 1ZRCA 4Y1ZA 3VDDB 3F95A 4V1PA 1XCBA 4PJ0C 4RAYA 2TRTA 4LGWA 3POWA 5F2SA 5JI7A 4C0HA 5F37A 3VL9A 1T39A 3DPRA 3CCSI 1RUF3 4WZFA 2PHTA 1K7AA 5GTIC 3ZR5A 2ENRA 1IN8A 2GXBA 1X1AA 4FASD 1Z7S1 4HKLA 4CP9B 3AKZA 1FSHA 4QT6A 2ZMLA 2H94A 2HQRA 2DTZA 5JDBA 2R6QA 4ARYA 1PK6B 3M8JA 4QHOA 1A8MA 3TP0A 1OCOH 3WTYC 2VXRA 4ZDLA 1WGXA 3O6BB 1DF0A 2Y0SA 1JI6A 4DIQA 3LAGA 4E70A 1IGOA 1T98A 1R58A 3S5AA 5ED4A 3ZFEC 4YW5A 2E71A 1W5CC 1ZRFA 2LALA 4KGGA 1OJLA 2MNGA 5ILSA 1OOPA 1YFWA 4RR3B 4HOBA 2HGCA 2RREA 4OHXA 4GALA 1MJAA 4PBPA 4L9TA 2DBIA 2FF4A 4JGYC 4ES9A 4BNCA 2X5IC 2A5YB 4LIUA 4HNUA 1JTXA 2GMMA 1LQ1A 1YYNA 1UIKA 2IGOA 5FB2A 5EIYB 5AVAA 4IX7A 1VFCA 5CFCA 5B3SH 2DPUA 5FPBA 1HCRA 4N9IA 3RYRA 5F8PA 4RB1A 3U1KA 2QM3A 3PFIA 2P34A 4FPJA 2KIUA 4WXDA 4L8QA 1GP5A 1RJ8A 3DEMA 3WF0A 1Q8VA 5F08A 1WH5A 3I64A 2HOEA 4ON0A 4KNCA 2D45A 5EDNA 4XE9A 2UY9A 2YBKA 4U2AA 1W9FA 4QQLA 1PP7U 1Y8QB 2RMU1 4PCQA 3G71I 5DD8A 4V19K 3LSHA 4QX2A 2BWCA 2DTYA 4CU8A 1MMDA 3IAPA 3WP4A 5EEAA 2B7YA 1U8RA 4HPKB 4FO9A 5J09A 5K7HA 3SH3A 2CUEA 4FXKB 3TQNA 1C28A 1S0IA 1UIJA 3VZJA 1YIPA 4K20A 3N4MA 4JQRA 1UMQA 1ZLJA 2MGQA 3SFIA 3J81K 3GF6A 3GBWA 4QDSA 1FOKA 1MJBA 3F8CA 5EJCA 2R061 1FOD2 1US2A 2VBBA 3FM5A 4Q5OA 4AGGA 1DZQA 1RGSA 4XKCA 3RTRA 4ES8A 2JDMA 4ATEA 4CDWB 1OA2A 1Y4WA 2B7EA 2GNDA 1G8WA 1CF7B 1J84A 4RFRB 1FBUA 3WOGA 5HLIA 3MI8A 1T56A 2EA4A 3C8XA 5LEKA 4HVOA 1W39A 1W6QA 4PBOA 5C3QA 4COZA 4G7OF 1LESA 3L2VA 1YOVB 1JT6A 4IEOA 2YMZA 3X29B 2CFOA 4KWJA 1UCRA 2QENA 2G19A 2XPVA 1JYXA 5F0HA 4XF1A 1YFHA 5F1JA 2QQ8A 2X1EA 3ZYBA 4CSWA 2PJRA 3ZGKA 4GWJA 3R61A 1TQPA 3KYLA 3GF2A 1HXS3 1BJZA 3VBRC 3T8RA 1HRI3 1ZX5A 2F4PA 2VQAA 2X6YA 1Y0NA 5BNNA 2ZXQA 5C8WA 2P0WA 5C8CC 5C3SA 1OH3A 5GAEJ 1XOYA 4IQ4A 4I3PA 1ZN2A 4KICA 2GNMA 2ELKA 4UY8I 3VBFA 4I2OA 1JZ4A 2BBAA 4WF2A 5L7OB 3NNFA 3DCFA 1R1UA 1V6MA 3C18A 3GDBA 1WCDJ 1ZG1A 4CEWC 3CDLA 4E7JA 2VMGA 4FOWA 1MBEA 1NE4A 3S14J 3IZOA 2DO7A 3HQRA 1K42A 1VBA3 3SDGA 1DG6A 2OA2A 5IW0A 1ZRRA 2WYFA 2M7AA 2MBFA 2YU3A 1B72B 1O7LA 5IT3A 5JR3A 3N7JA 5D4SA 1PJRA 1BYHA 1HKSA 4TTGA 1R1VA 2XSDC 3NRUA 2CYYA 1IUFA 3HN3A 5I8TA 5GLTA 1D0GA 1CJDA 4Z92B 1CQ9A 4O5VA 1BEV2 3K48A 3B94A 1Z7UA 2KL4A 5DAPA 3OEAA 1OYYA 4BKXA 2STWA 1AX2A 2R1BA 3RJ2X 4AVAA 5E3LA 2KFDA 4PCRA 3KE2A 2BNOA 2W52A 4Q27A 4Q47A 2VE1A 1QGPA 4EQQA 1YFXA 3ZX7A 5KHIA 3TOAA 2VPLA 3WNLA 1ONAA 1XSRA 3RWKX 4XF9A 1LHVA 5D8LB 3S3NA 2HWC1 4DEQA 1JZ5A 3R0JA 1OFCX 1WW7A 1MNMC 4UAPA 3P9CA 4BHPA 1MH3A 1E3OC 1GUIA 2VKDA 3C7OA 2NOGA 3BG7A 2PG4A 3AJZA 2UU8A 3QH6A 4C91A 2WYSA 5TISC 4W50A 2EFPA 4Q48A 2VC1A 1ETWA 5E20A 2IGNA 2KJBA 1F43A 4EM2A 1UX7A 3I2JA 5EGOA 4IXLA 3ZFEB 4A2UA 4Q4Y2 2GN7A 2QKLB 5JXGA 2DBBA 1AL22 2ZX1A 2H27A 3VWBA 5JOWA 1SLBA 4LT5A 4ZS3A 5IP7J 1S0EA 3KYCB 2LY9A 2ZGNA 4LO4B 5DZGA 4EGYA 5EEHA 1HX6A 4JGYB 3F8MA 4URTA 1SFYA 1LOAA 2ZMNA 2WZR3 2ZGQA 4KNYA 4ARXA 5AC92 2X5IB 4ET7A 3TOJA 2ADUA 5J36A 1ND2C 3OYWB 3FE5A 3MPPG 1OLQA 2ZHMA 4FQGA 2ZGKA 3HMYA 1HIXA 1MW7A 2C9KA 4RGAA 3RSNA 3ASOH 4KT5C 3HL2A 1HN1A 3VODA 1T6SA 5M5YJ 4CDQC 1LGBA 3BR3A 2RS11 1JXNA 3AKTA 4A0YA 3RG0A 1JHJA 1GUUA 1RMU3 2ZX2A 1W6NB 3PVOA 3WDYA 3WGHA 5JXJA 2DA3A 4HNTA 5A6ZA 4OZXA 3USSA 1AYM3 2V9VA 3LOCA 5GAGJ 5CU1A 2P7CB 2ID6A 1MS5A 2VTFA 4UF0B 2GBYA 2OUMA 1N75A 3V42A 1BBT3 2NMNA 3KGZA 3BG3A 1S0BA 3H0OA 3K1NA 2JEMA 3N36A 2VODA 5DMYA 3I2GA 4RQPC 5JPNB 3K2ZA 2BW3B 2ZX3A 3S57A 5C3PA 1TNSA 5ICCA 4NWWA 2W48A 4IQPA 4YGCA 3IAS2 3R4SA 2XAHA 1J0RA 4AHYA 5JIAA 1D4M2 2X09A 3HZJA 4LFUA 3ASIA 3U11A 2GH2A 1OQ1A 5F5CA 2ZMEC 4D7MA 5JLWA 1TTYA 4OIPF 3UL2A 2I45A 2Z33A 1C8NA 1GXQA 1FOWA 1J9IA 2QZ3A 2VMFA 1SFUA 4AW7A 4RAZA 2NNNA 5DM7F 1D3YA 1I39A 3MLJA 4QX5A 2K9SA 2F5CA 2K40A 2IXIA 3HNMA 1OD3A 3TN93 3QYEA 1MBGA 2ECCA 2IEKA 3HG9A 1V5GA 2DDUA 2ORXA 3VBRB 3PTYA 4RM3A 1JGGA 5J3LA 3Q8CA 1R64A 2RS33 3RZLA 3U10A 1AL0G 2XUEA 3W21A 5DTDA 5JWPA 5C8CB 3ZN1A 3H5RA 2X9DA 1SAXA 1LAJA 3OYBA 2VUDA 4W65A 4EWDA 3WF2A 3WVJA 2IS4A 1B9MA 2XAJA 4Y20B 1OYIA 1MIJA 4MH0E 3TBDA 1G6NA 3A7QA 2WQ8A 4V2FA 1LNWA 3PIOF 4XOTA 3E6MA 4ZZ5A 2L7MP 1RHI2 5F5AA 2VC0A 3O1PA 1QQP3 1UYZA 3JD72 3DLAA 2QLZA 1VB4A 1FY7A 2YGMA 2N8GA 1COV3 2DVDA 3N9LA 1XB4A 4BXXJ 1B8IB 3AZVA 5JI9A 2NXNB 4COWA 2HKOA 2WNUA 3J9SA 1UHWA 3DKXA 5B1BH 2JRTA 3H3VK 1YQ2A 2JXAA 5CKNA 1SLTA 3A02A 4I30A 3N9PA 1ASJ2 5DUUA 1ZYBA 3VHPA 4KA4A 5FY1A 2HKXA 3S1NJ 1KU7A 2VASA 3WNXA 5IVYA 3ZMSA 1YIFA 3RQ4A 4FTSA 2JTVA 1U5TA 4AD9A 4OI1A 3LL7A 3GTKJ 2WA3A 1W0NA 1JUSA 3T0YA 4JX0A 2DA4A 1AR92 1KGYA 3GXOA 1MZFA 2YFUA 4ASKA 1IC8A 3TP3A 1YX5A 4BDYA 4GB33 2WNOA 1V0AA 4YGEA 2HDCA 1MDMB 2L3DA 4GDFA 5FREA 1VMJA 4ZXKA 1KQRA 2HNHA 4ITCA 1XSQA 3JQWA 4I0AA 5KHKA 4R9DA 4II2A 1MSFC 2ZBJA 5FROA 5F3EA 4MXWB 2UWMA 1MH4A 4KMUX 4E7ZA 1MBKA 4YW1A 1YW9A 3BPZA 1J3QA 4RYDA 2K46A 1GWKA 5H6RA 1V6LA 1SBDA 1IS6A 1M1EB 4W97A 1M4WA 2BP6A 5C4XJ 3G1OA 1Z3XA 4XLPF 1LODA 4M3CA 1A8DA 4IE4A 1WCQA 4OU0A 1XGMA 3VPRA 2VB6A 5J3UA 3TRSB 4DUXA 1FP2A 5FRMA 4P96A 2UY8A 4ENKA 2K0GA 1S29A 5HODA 2EAAA 3KP3A 2KIQA 1AKHA 1Q1VA 4CZSA 2W57A 1I6HJ 4BOWA 2GH8A 3ZKUA 1XMKA 5KHDA 2AACA 3KWVA 4E27A 4JDNA 4ISQA 3Q9SA 4BXFA 5K0UC 2M34A 5BS6A 1BQPA 1EH8A 3SCGA 3KP7A 1ND2B 2A70A 3GVAA 2XPWA 2W1SA 4IHYA 1IRZA 4XBLA 4DQAA 1NA1A 2Y34A 3MKLA 4CDQB 3AKRA 5BNOC 1HF0A 2FX0A 4MQVA 3VD9A 5BNPC 3GBGA 5L3FA 4IGPA 2PAKA 2A3YA 3OCPA 2ELHA 1FPN2 1SBEA 2JKXA 1TL8A 4S05A 2WABA 5JR7B 1C5HA 1TZLA 4INDA 2R5ZA 2OBPA 3HRMA 1WPKA 3DLLF 2L9LA 2IPQX 3FXMA 4IUGA 2M0CA 5LB6A 4BJTA 3NQHA 4RQPB 2GIVA 2IVIB 3DXUA 4BJ0A 1LEAA 5A7NA 3ECHA 3TO7A 2D6NA 4HKOA 1BEV1 2PEXA 2XXZA 4LITA 3EXUA 3C7HA 2D1VA 4AGVA 3OR2C 1QJU3 3EMRA 4I6ZA 2ZMEB 1A78A 1PVC3 4IEVA 4LJZF 1SC7A 2VD7A 5LA0A