4LITA

Structure of ycfd a ribosomal oxygenase from escherichia coli in complex with cobalt and 2-oxoglutarate.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
372
structure length
361
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
total genus 102
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4litA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4litA01
3KVBA 5FYIA 4QXBA 5F39A 2GP5A 3PURA 3PDQA 5FXZA 4CUGA 3PUAA 3PUQA 3N9NA 4XDOA 5FZAA 3N9OA 3AVSA 5FZ7A 4GJYA 3AL5A 3U78A 4EZHA 5IVCA 4Y33A 4CCOA 5ANQA 2OT7A 4LXLA 5FZ4A 5FXXA 3LDBA 5F3EA 4CCKA 3KV5A 4EYUA 4AAPA 2P5BA 4CCLA 5FYBA 5FPLA 5A3NA 5FY4A 3PTRB 5FV3A 5A80A 4URAA 2YBPA 5FZ6A 2Q8EA 5F3CA 3LD8A 2VD7A 3AVRA 4BXFA 5FYTA 5IWFA 4AI9A 5FY5A 5FZMA 3KV9A 2YPDA 4IGOA 5A7QA 5F32A 5FZLA 3KVAA 5K4LA 4BISA 2OX0A 5FPUA 5FYSA 3ZLIA 4QX8A 5A7WB 4QU1A 5FY9A 5FP3A 2Q8CA 4CSWA 5FXWA 2YU2A 5FZ0A 5IVYA 2OS2A 5F3IA 5F2WA 5FZ3A 5FZOA 3PU8A 4BU2A 3KV6A 5FZHA 5A7NA 3N9MA 5FZGA 5FZ8A 5F5AA 4V2VA 5FYMA 4CCNA 4NUBA 2YBSA 4GAZA 3PUSA 4IGPA 5FZ1A 5FZDA 4CCMA 5IVFA 3DXTA 5A7WA 4DO0A 2OQ6A 5FP7A 2Q8DA 3K2OA 5FY1A 5LWBA 5FZFA 5FZ9A 4LITA 5LW9A 3KV4A 5FZOB 5FZIA 5FUNA 3OPTA 2YBKA 3NJYA 4LIUA 5FYCA 3PU3A 5F2SA 5F37A 5FP9A 2WWUA 5FY0A 3K3OA 4TN7A 4D6SA 3RVHA 4Y3OA 5F5CA 5FP8A 4QXCA 5FYHA 5FPAA 5F3GA 3UYJA 5IVEA 4D6QA 3N9PA 4IGQA 5CEHA 5ISLA 4C8DA 5FYZA 4HOOA 5FWJA 2W2IA 4UF0B 4GD4A 3DXUA 4QWNA 5FXVA 5FBJA 2GP3A 2XDVA 4Y4RA 5E6HA 5LY2A 4LIVA 2YU1A 5FZBA 5A7PA 5FY7A 5FZCA 2XUEA 3OPWA 5A7SA 5A3TA 3AL6A 2WWJA 4QXHA 4HONA 4V2WA 5IVVA 5LY1A 5FPVA 2XMLA 4UF0A 5FWEA 4EZ4A 2XXZA 1VRBA 3U4SA 5IVJA 5F5IA 5FP4A 5FJKA 5FUPA 3ZPOA 4XDPA 4CCJA 4DIQA 5FZEA 5FY8A 5IW0A 4E4HA 4GJZA 5A3WA 5A3PA 5KR7A 2PXJA 3K3NA 5FYUA 5FPBA 5FYYA 5A7OA 4D6RA 4ASKA 5A1FA 3N9LA 4QX7A 5FYVA 5A1LA 5FJHA 5FZKA 2OQ7A 5IVBA 3N9QA
chains in the Genus database with same CATH superfamily
1QWRA 1G9AA 3UGGA 4J01A 4N7UA 3N7MA 3JBG1 3K10A 4O6JA 1E57A 1Q1HA 4I01A 1OLRA 3F3XA 4Y22A 3LAPA 4BQAA 3B3QE 4PHZA 4EQQA 1W4MA 2J42A 2Z16A 5C9AB 3OYHA 4NPMA 4A44A 1JW6A 1HDPA 5JR3A 1C8NA 5IUQA 4HG2A 3LSIA 1Q43A 3H50A 5FMBA 3S3OA 1IKQA 3CJTB 5FO8B 3I3EA 4M72A 4UXNA 2EXIA 2E36A 4IEXA 1U8RA 2JA7J 1A3KA 1B4AA 2KXLA 1VNDA 2G4IA 1NQDA 3FBIB 1W0OA 2ZA9A 1V9U3 3BP8A 4OULA 2XPWA 3MZYA 4F83A 2ARBA 4XKCA 1FBUA 2E2JJ 3G6JB 3J9SA 2R7UA 2NRAC 1W8FA 3VKMA 3V64A 3DXJF 1ZYBA 5DV5A 1RUH2 2ISZA 3E6DA 1LQ1A 2H27A 2I74A 2VMIA 5HCHA 5T5JA 5A3OA 3IKWA 3W21A 2Y0SA 2YS9A 3BCWA 1N3QA 2WWJA 4RAGA 5D4RA 1G6NA 3I3MA 1PK6A 1QGLA 4QQOA 4CTEA 5HS7A 4A0ZA 1H0MA 2D44A 1JZ4A 2KDOA 5A3PA 2QTWB 4XKVA 5ACA2 3CNAA 3QACA 4IV1A 1IPJA 2ID6A 2DVFA 1S72I 3PSFA 3AG2H 2VL8A 5JPNB 2LTNA 2P7VB 4WXDA 2GXBA 1TL8A 4LUMA 2E9QA 1VRH2 3KP6A 1PYVA 3PIPF 2YBPA 1SMYF 3L2RA 2CQXA 3B69A 4PLOA 1HF0A 4K8RB 5F32A 3N7KA 3VOEA 1QJZA 4CYDA 1W8HA 4FPYA 1OA2A 4XFIA 3IMNA 3P9IA 5F2WA 5EEAA 3POFA 4AL9A 2HQ5A 4M0NA 4CCNA 4QM8A 3ME2A 1X8MA 1V5FA 3PM1A 4NHYA 1F9KA 3ZN1A 1YW9A 1IF1A 3WDVA 4XFAA 4RQPC 3DTEA 1RUG3 2X5IC 3BPVA 5DABA 5IHRA 1I39A 5ICGA 4ZDPA 3LPFA 1BM9A 2EPFA 2BBAA 3K1PA 3VB2A 4XJUA 1FPQA 5CEHA 4RHV2 2C24A 3GCMA 2JUCA 2CQKA 1ULFA 3WTYC 1DLLA 3CMEI 1ZA7A 4ES8A 1BR2A 4ZYAA 5A7SA 2EINH 1S0FA 3WODF 5LY1A 1RL3A 1WGXA 5FP4A 3JRHA 1KGSA 1X1PA 2RC4A 5L3EA 2JK3A 3VPRA 2E5ZA 2YPRA 2ESNA 3AKSA 1FP1D 3PL8A 2DXIA 1WW7A 1CIWA 3LOBA 3ABLH 1TG7A 1LEMA 5F39A 4D69A 2XG3A 4ZXKA 2I10A 2QBXA 2WAQA 2ZHKA 1XE0A 4YFNF 1I50J 5JLXA 4XBFA 5FY4A 5IK4A 3F23A 3RDIA 2OW4A 2Q8EA 1VP6A 1OVPA 1DGRM 4U0VA 2EV6A 2D43A 5EJ3A 4CHUA 4XTMA 4OI2A 5EJZB 2XRLA 3TEDA 2E7WA 2DFCA 4GB32 2GC1A 2Q8CA 3HRSA 4CGZA 1ZBA3 3QLQA 3POWA 2COMA 1FYUA 2YBSA 2JDUA 2Q8OA 3R4KA 4PCQA 1N1SA 1R083 4Y17A 4XZPA 3RZLA 3BG5A 3ZMVA 1UOBA 4MVTA 1DUXC 2WN2A 4HZFA 5DQ0A 4XKWA 1O5UA 3LSEA 1OT5A 3SC7X 4TXWA 1AR81 3KT1A 3MZ8A 1Z05A 1Y4WA 1VBC3 2EV0A 4F55A 3JXSA 1UZCA 2E1OA 4XBQA 2VCMA 1FMVA 3LQQA 5JCTA 1G3WA 1DQ5A 1K6YA 3L9FA 4BS9A 2RJLA 3UNGC 4MX3A 3IHUA 1KQ0A 2KKOA 4UBHA 2V6CA 2DUQA 5ANNA 4Q4X2 1LHVA 4ITCA 1LKNA 1MZEA 1U5TA 5DDGA 1TT5B 4Y22B 5B1BH 2HS5A 1OF3A 2IXHA 1WCSA 5ANQA 4A6EA 1QQP1 4PDWC 5BPIA 1LGNA 4UB8C 2ACJA 2WO3A 4N9IA 4E7ZA 4RGXA 3SISA 2HEVF 2VCCA 2ETHA 4PBOA 1YXWA 2QUFA 4ZZDA 4D7YA 4Y1UA 2WNEA 3I3BA 2E7QA 3MMYB 5FROA 3FZVA 5ILSA 3I97A 3OD0A 1YHQI 3MGUA 1YQ6A 2GAUA 3WTSC 1J3QA 1EV11 4WK8F 3SZPA 1WD4A 3CO6C 2HQRA 5F04A 5FKLA 4AFBA 4KN7X 1SMTA 4A42A 3ORJA 2WNUC 2GBYA 1H1IA 2WWUA 3C7OA 2FJ1A 1I1SA 4FETA 3G1MA 3QYBA 2VL4A 1WLCA 4FTBA 1E3HA 1LOGA 3E6MA 1JI6A 1X1AA 4AQSA 1W04A 3L2CA 2C26A 2LKPA 1FTZA 1AF9A 1SFKA 2E1MC 2PMZN 5EWSA 1YFHA 3SQNA 2LNBA 2WZ8A 1DZRA 3HB9A 1DIWA 1M06G 1WJCA 4Q0VA 4EN9B 3JTGA 2YMZA 3S1QJ 2HPIA 5TRDA 1H9WA 3EJKA 1E3OC 1EPZA 3WNPA 2VNRA 1K12A 1YYVA 5CU1A 3CCJI 1TBXA 1YQ2A 2VC1A 2D6LX 5IPAA 2X09A 3GCXA 3VL8A 1RUI1 5I8YA 4ESBA 2JG9B 3IM0A 3MEXA 1QKQA 1RVF1 2JD9A 3THCA 1MBEA 2JRTA 1ZQ3P 2ILMA 2OV7A 4K1ZA 5IK8A 5BNOC 4D3WA 4GKXA 4YG3A 4IJAA 5C71A 5K9YA 3BOQA 2BVLA 3NNJA 1ZGJA 1WMFA 1AR63 1OI6A 4LJZF 1ETVA 2VW2A 2BVBA 3KSCA 2BHZA 2LH9A 5DD4A 1DHKB 3PMEA 4E7KA 4FE7A 3HBLA 4AXOA 2IP2A 4NR1A 4R8HA 2AQFA 3K4DA 3H35A 2XAJA 5CVVA 3B00A 3CD6I 3I59A 1MMSA 2DK5A 2JE8A 2PHFA 4LOCA 3NL1A 5DDJ1 4RR3A 1BEV1 1J09A 4QDQA 4Q5SF 2XL9A 1J83A 2VBPA 5J6XA 1RGSA 2WNVA 2Z1DA 1TZOA 2JN6A 3MQ0A 4YGBA 1HDDC 1ZG5A 4RD7A 4M6XA 4Y1YA 4WM8C 3MFAA 4HONA 2PHUA 4N53A 3A01A 2HOSA 4GMP0 2HYFA 1VZ0A 3ZXFA 5C3SA 1W8TA 2M9HA 4XIDA 2PTMA 1LUJB 4XNFA 1IN4A 1XPXA 3E6BA 4OZOA 1MS5A 5HLTA 1RXFA 4U7DA 2A61A 3BROA 3SJMA 3N9NA 1TP4A 1D4M1 2R7VA 1JXSA 2FDJA 3MKLA 3OWTA 3NO8A 4YYOA 3JRIA 5J8FA 2K27A 4LK0F 2WAOA 2W68A 1GP5A 1AR71 2OAZA 2KIMA 2BV6A 2MNGA 4XORA 2K4JA 4MNUA 2JA5J 5BPXA 3VLBB 3FKIJ 2HYGD 5HLHA 4ISQA 4G6TB 1MNEA 2QQKA 2D93A 2WIIB 4LITA 1IZ3A 1LOAA 2VJ5A 4C30A 2X1CA 2BNNA 4HDUA 5DN2A 3NJYA 2AXLA 2Q4SA 2ZJCA 3B6CA 4IRIA 2CV0A 3OIOA 2NZ9A 5A6QA 2W24A 2VOKA 2I2SA 1UYYA 2RNJA 3RNSA 1W6PA 3RJPA 3QH7A 3LEKA 1TQPA 1BOBA 2JVHA 4K6BA 3ZXDA 1H4GA 3P3PA 4L18B 1OA3A 1VB4A 1UY2A 1LVAA 4BDZA 2TDXA 4HNVA 5FLXZ 4LK6A 1S29A 3IIAA 3S1RJ 1VF9A 4BAYA 2GM4A 4AEDC 3A22A 4UF0A 2RE9A 4QX1A 4AVSA 2P5KA 3MO4A 1BOAA 2ZKLA 1U5TB 5DD8A 3ZX7A 3PNVA 2A71A 2HDDA 3S3MA 3OTFA 4XR6A 3M9AA 5F3CA 3WF4A 3EYIA 2GU9A 2KHMA 1R1A1 2VPRA 3MIBA 4RB1A 4N7IA 4P00B 1G3TA 2M1BA 2O61A 2QLZA 1OOPC 2DA6A 3HNBM 1B6AA 4A3EJ 3EYPA 1C5IA 2XOMA 3GX4X 1QIQA 1AR82 2E6VA 2Y6GA 4LG0A 3ZGKA 1AKHB 2BOIA 5FZ0A 3R61A 2M8EA 1HSTA 1DG6A 1AWCA 5FP7A 3K2AA 5LWBA 4A7ZA 5FBZA 2JEMA 4XACA 1GWMA 5CVUA 2IS1A 3TBIA 4FPOB 3WT3A 4CDQA 5C8CC 3ZMTA 2K85A 1HBXG 3HT1A 1A6CA 3ZVXA 3TO7A 1GVDA 3A2KA 4YEJA 3KLNA 1GWKA 1W6QB 3NW4A 3BPSA 2BW3B 2Z4FA 2DN0A 5IT3A 1QQP2 2FNAA 1ZRRA 2JWTA 4KMFA 1XCVA 1V70A 3RPUA 4NOTA 2CUEA 4AZZA 3AG3H 4AVPA 4X8NA 3ETQA 1CGPA 3U4SA 4D1QA 1IQAA 1HB1A 2RREA 1PX4A 3I64A 1CIYA 2CFXA 4AW7A 4DIQA 1W8ZA 4CU6A 5IW0A 3RFRA 3IAQA 2K3FA 5JR2A 4BE2A 1IG0A 2ZHNA 5BQTA 4XC9A 1EV12 5D4SA 1OCOH 3S15J 2XV4S 1LDJA 1Y8RB 2D5VA 4Q4Y2 2L7ZA 1V4RA 3MIFA 2F5VA 5JPMB 5IFPA 3GLLA 2HWF3 3W58A 1H1AA 5CKTA 3FHZA 4K8FA 2FEZA 1SFPA 4B3AA 1ASJ3 5HDKA 4JX6A 3PJQA 4UVBA 5I91A 3MPBA 2L7KA 1GBGA 2KRCA 2F4LA 2YU2A 4YW3A 5J40A 2JQ7A 2ZX3A 5FZHA 2YX7A 3I59B 3DCFA 5FYMA 3FBNB 4DY5A 3AM2A 3M4OJ 1IXRC 5LASA 4H3WA 4XK4A 1SG3A 3JAMK 3V7CA 4DINB 3SEQA 1FV3A 5LATA 1UIJA 3IAPA 1YIOA 1DP7P 2HWB3 4RR3B 4MO7A 3S93A 3WINE 1QJEA 2VQTA 3KEYA 4RAZA 3H3LA 4C3HJ 1GMMA 1R6RA 3LEMA 1FPN3 2CL2A 1S8NA 3KE2A 1YFYA 2CV6A 4GH4C 1S7AA 1W7PB 4ESFA 4NPLA 3A01B 1R1TA 1P2FA 3DYPA 1VMHA 2OPWA 4ZXEA 5L7OC 3V4GA 2J1VA 4BQWA 3MYXA 3WD5A 5ED4A 4BL0B 4KI5M 4RS5A 1XGSA 4CXFA 2WRAA 2W57A 1OCZH 1ZBE1 2OBPA 1NOVA 1A36A 3AKQA 3A03A 1OLMA 2TNFA 2LR8A 2JUGA 2XJTA 2GH8A 2RR12 4BQ5A 4ABZA 4FPFA 5J47A 4M4RA 5EQUA 1GNZA 1UY4A 1FYMA 4UW4A 2HLEA 1KQRA 2R061 3FMQA 5DDJ2 5FLVA 1J1TA 2D3RA 3UL2A 1MDMA 3DKQA 2PHWA 3DF8A 1QXRA 4CE8A 2XROA 3Q8AA 5BY5A 4HNTA 3V8KA 2KRFA 4GGGA 4G9YA 5GAGJ 3RWKX 1NCQA 1D3YA 1W6OA 1N1YA 4LBJA 4Q0QA 1RHI1 2YSRA 2O14A 4AYBN 2HWC2 2HWD2 5HVQC 4RQPA 4BLIA 2BXZA 2EIGA 3P1IA 1BI2A 2WV0A 3LF7A 5F0CA 5FIXA 4Q48A 2CU7A 1HV1A 3H8UA 5ERLA 4A7YA 1U5XA 1PIV3 4Y24A 2CDOA 2JA8J 3OEAA 3NMBA 2KISA 5H9QA 1PZ9A 2PLV3 2BU9A 3CP2A 1QJFA 4L0PA 1D4M2 5F1JA 4DGWB 5DG2A 4UF0B 2WO7A 4NRMA 2GOXB 5GADJ 3RMXA 5ABJA 2BY1A 2L9RA 1COV1 3MV11 1KITA 3V7RA 4JCKA 4HKLA 1AR72 4CUAA 3QRFF 1FOWA 4L97A 1F4KA 5FZEA 1H2KA 1D0YA 3ABZA 3COAC 4P14A 2XPJA 2A69F 1ZLJA 3AZVA 3IKVA 3N9QA 5A6YA 1C57A 1J75A 2FHRA 4H7MA 1GDTA 1WH7A 3ZR5A 1DQ4A 4GFBA 2D97A 2R041 3KCCA 4LG0B 4Q4W3 3G1LA 1VMJA 1UOJA 1QJY2 5A7QA 4DZPA 3ZFEC 3NJZA 2VASA 4FFGA 2CNAA 1Z91A 2IXIA 3OGJA 2IA2A 3L00A 4NC8A 4YG2F 1EJ9A 4HX8A 4Y13A 4GAZA 2MABA 3DU5A 2J1AA 3TO6A 5IJRA 2W84A 3LSJA 3UGFA 1QJX3 2EFNA 4FPHA 4D6SA 2PAMA 5F3GA 5IVEA 2E26A 2Y30A 4ES9A 1UHMA 5IYYA 3FFQA 4XTPA 3ZYBA 4ENJA 2MLKA 4NC7A 3V42A 3LKJA 3QPHA 2KPMA 5T5LA 2H8WA 3LGRA 4R79A 2W1OA 5FZCA 1RUF3 4E2QA 2ZGMA 3OB8A 2OUJA 1HB3A 5CZKA 3AXDA 5IVJA 3ONQA 1D5YA 5FD5A 3WU2C 1OLTA 1RMU3 2VN2A 3O8HA 5LEKA 5JR7B 3Q0VA 1OC1A 2EZHA 1U12A 1BJZA 5CKMA 3S30A 3N7JA 2Y9ZA 3C8XA 3KYCB 3ZQCA 4PDWA 2ZHLA 2QKLB 5F1RA 4MIMA 2D45A 5CVIA 2QQVA 1GP6A 3F8CA 2LP0A 1UCRA 4QU1A 1RUJ2 3RZMA 3LSKA 2Y48A 4GIQA 3SNMA 1ETWA 2X51A 3OIQA 1IKPA 3R0RA 1IGNA 4DO0A 1B8IA 1HRI3 3NRUA 3JRCA 1WQ2A 5K7PA 3OYEA 3W6VA 1VBD2 2WNUA 4IF4A 5D5UB 1UMQA 4PI2A 4JBAA 4A69C 4L9TA 1XX5A 3LWFA 2HQNA 4AAXA 4A3CJ 1NZCA 1WZ2A 3FIWA 4BWOA 3M1EA 4BK4A 4LFUA 2WWYA 2ZNZA 5BNPA 3WF0A 5CQEA 3HDDA 1X2MA 2WQZC 2C6SA 5IVVA 1ENQA 1N75A 1XCBA 2HTSA 2JXAA 4IEJA 4FCAA 2B5HA 1V6OA 3M70A 3DPLC 1VAMA 4IPAA 4UBGA 2BY2A 1TTYA 5CLSA 5K7HA 1JS9A 3LCPA 1R9TJ 2HI3A 1KJLA 2P5BA 1ODDA 4WCGA 2VE9A 2QQBA 4TLGA 3I8TA 5BNOA 3LA2A 3AFGA 2JICA 4LNVA 3VBSC 2R7QA 2ZZQA 2VZRA 1W5CC 1SLAA 3FUQA 3RGBA 1UZYA 4RM3A 4HVRA 5KVRA 4RQPB 5A7NA 2ZO4A 1YI2I 2X5IB 4JKMA 4N90A 5J4YA 2W1QA 3SLIA 4D7NA 1UZWA 5M3FJ 4ITVA 4KQ7A 3H3ZA 4V2GA 2XF7A 3WNMA 2X05A 4YGDA 3NNLA 2BTVC 2W52A 3AYAA 3BWGA 4QHOA 1NK2P 3THTA 4GWNA 1AU7A 1W6MA 4HOOA 2W1WA 5DAXA 4GD4A 4I0AA 4N9HA 2HPMA 2Q30A 4FOVA 2A6XA 4HSLA 2YU1A 2NS7A 2R062 2JZYA 4UUVA 5C5UA 3GHNA 2DA4A 2UV1A 3FXJA 4LHNA 4EN6B 1DCSA 3ACFA 5J1UA 2R5ZB 1ACIA 2K46A 1CAWA 4MGIE 3T1BA 2R1BA 4XJAA 5FYUA 2Y2ZA 2UXXA 1E5RA 2P3KA 4BKXA 2ZJ2A 3TP0A 1UAIA 1GZTA 3EHKA 4CVUA 3I56I 3I49A 2KD7A 2R5YA 3HSEA 2JDYA 4EYUA 3KYLA 5C44J 2ZFUA 5BUVA 3C7GA 1QXJA 4FOWA 2JSPA 4ORFA 3TO9A 4PK4A 2FUG2 3OEBA 1I5PA 1NT0A 5T54A 4EMSA 1FOD3 5C6CA 5EZGA 3R4UA 2ZX2A 5I8TA 2PN6A 3M1CA 5FUIA 1B72A 3HEIA 3DP7A 2DBBA 2ELJA 1COV2 1UQXA 2Z9OA 2NXNB 1T8IA 1ZR2A 1WJAA 1WGPA 1TME1 3WQBA 4AU7A 3EUHC 5LCWL 2ZGSA 4XPVA 4XAEA 2V26A 2JVGA 4KISA 4IZZA 5GLUA 3EO6A 1KEXA 1YIJI 3ZSLA 4RN5A 4C90A 2TBVA 2NVUB 2W7NA 5JXIA 3LA7A 1UX6A 1AX0A 1YUDA 2R042 3A4CA 2VKDA 2VZ3A 2VJIA 4MEXF 4Y20A 4AEDA 5C70A 1SEFA 1P6RA 3TOAA 1UHWA 2X10A 3M8EA 5FKKA 4IEUA 3ZPOA 5GALA 3RQ4A 3GZEA 4MUVA 2VOXA 1W99A 3ZR6A 3K3NA 3FE5A 4PDWB 5GAEJ 1HKDA 3OJBA 2V7FA 1HXDA 1E17A 4PCRA 3KP5A 1ZG3A 4UY8I 4QIWN 4A3LJ 1Y0UA 2V1XA 1V6LA 3J7YJ 2DQLA 5KXCA 4A5MA 1MBJA 1RKWA 3KP2A 4C1WA 3PTRB 3CQZJ 5EIYB 5JI7A 4XUPA 2LVSA 4OLLA 3POIA 5CKNA 2YDEA 2G9FA 4NDLA 1BBT3 3M3OA 1X3WB 3CKHA 3O0XA 2QDNA 3K4LA 4ZS3A 2A6VA 1AL21 4OYUA 2WNUB 2L2OA 1UY1A 1V9U1 4QSHA 3VKLA 4UUSA 2YY1A 2UWAA 4LBLA 4LIUA 3NAUA 3AZXA 1K3IA 4FI9A 2PMUA 3BODA 3SHRA 2DMPA 2UYBA 5BNPB 2VUJA 3HBKA 2XVKA 1ND2C 2E1MB 5HLIA 3K7AJ 4DUVA 4EN7B 1IG7A 2MSYA 2CW8A 2B9UA 3RZKA 3N3HA 1KU9A 1GQHA 3U37A 1AYM1 3WR0A 1C0WA 2V9VA 1ZZ8A 1FI2A 1WFXA 4A3BJ 2CW0F 4FFHA 3GJAA 4AWDA 4KNYA 3DUIA 4M3CA 5K0UC 2A3XA 5IK5A 3ILRA 5IP6A 4QPGC 5DAVA 5FYIA 3GMEA 3BALA 5FZAA 5BNOB 1GNYA 4ZZ8A 3DPRA 2GA2A 3H5RA 4RB2C 2OCEA 4OVEA 1HXS3 1UXXX 3BTCA 3AKRA 5E1WA 1YQ8A 1ZZ6A 3QYEA 2TCTA 2EB7A 1HSJA 4HK8A 4YW5A 2ZXIA 4HBNA 1VBA2 2EH3A 2W92A 4CA9A 4XCBA 3IH3A 1YQ5A 4DMIA 4ZYGA 1MH4A 2JIJA 1FSEA 1ZN2A 3KX2A 3HXLA 4JQRA 1WH5A 3M8JA 1MS9A 4HOBA 3RRDA 1KONA 1U0JA 2XONA 2WT1A 1NTCA 2IXLA 1D2SA 1HC8A 2VC0A 5M0TA 1FWZA 4K9SA 1CX1A 3PU3A 1W6MB 1U9OA 5CBLA 3PQKA 2Z5UA 2ID3A 4GH4A 2EICA 1JHHA 3B93A 1FXZA 4MEYF 2Z2SB 4WM8B 2YYOA 1X4OA 1YRZA 3THDA 2STTA 4BGDA 1LU1A 2GP3A 3WTVC 3D5LA 5FZBA 2FE3A 2J1TA 5L7OA 1CAWB 1IW7F 3NSTA 3K1NA 4B44A 5JZGA 4WVVA 1BMV2 3DLAA 2MHFA 2KIFA 2IA0A 1RB8G 2VUDA 3HQXA 3J80Z 4IV3A 4KN4X 1F5FA 3VBOC 1DGRN 3MCZA 4H2AA 5KBFA 3ABKH 1VMFA 2I07B 1VQ8I 3T0AA 2CS3A 4KWUA 3B73A 4CCOA 3USSA 1POV1 2ARCA 2R7FA 3OG2A 1UELB 4L9JA 4MTDA 2XWBB 3VZMA 3QP5A 4MTEA 4OAZA 2IA1A 4AR2A 2ZSHB 3MI8A 1Z7S1 5D8AA 2KLOA 1RUD1 1VBE1 2ETEA 1PO23 1IRFA 2K4BA 3U1DA 1A6IA 5J98B 1MZBA 4S2FA 1XXNA 4HKWA 3GM8A 2EFWA 3BG7A 1AX2A 5IVYA 3LIHA 1YI9A 4B3NA 5GAHJ 1JTXA 1CJDA 1OQ1A 2NPIA 1UW8A 5LEJA 1XBFA 4QAWA 3RI9A 1H0BA 5FZ9A 1AYN1 3LDKA 4HF2A 2OZJA 2F17A 4CDUC 3ES4A 1AA7A 2DBIA 4CDWA 2KL4A 4F52A 2J1UA 4HX7A 3WG7H 4LMFA 3ZO0B 2ZNYA 2VZPA 4JGZA 4AEDB 4Y20B 5AVAA 4N4OB 4K40A 5FWJA 1ONVA 3O3KA 1CAVA 4ZZ5A 4M71A 1R091 2B7EA 1A8DA 4FPEA 5D1IA 3WOGA 1W03A 1JYVA 1UYXA 3B6AA 4TV7A 3O2PE 1XE7A 3ENRA 1RUC3 3HPNA 4BQ4A 4MFDA 3M2MA 2YX4A 3CCEI 1UO9A 3D0JA 3WNLA 3JD71 3C2HA 3ILNA 2A73B 2V73A 3AP4A 1UY0A 2QUOA 1WA6X 1YIFA 1DDLA 2W46A 1OOPB 2XJQA 3POBA 3WTTC 3TKYA 4PIYA 4AFMA 1GHCA 1UIKA 3TEWA 1JYIA 4KFCA 5FZ6A 1W8NA 3HN1A 4CXYA 3ROUA 1GV5A 1XU1A 4IGOA 2B42B 2GC2A 3ZFEA 2D7FA 3TN93 1HQLA 2UY8A 3DGTA 1I3QJ 4E2SA 4NHKA 4UVCA 5F3IA 4LR4A 3AAFA 5C8CB 1HRV3 2E19A 1N25A 1PUEE 4JQFA 4I0BA 2YHJA 1I3HA 3MIGA 5FZOB 1T39A 2OD5A 3H0DA 4WBBA 2D3PA 2XWJB 2M3AA 3ZYRA 1AJKA 3FUOA 3EB7A 4CEYC 4EM0B 1SEUA 5D2AA 4XF9A 1BQPA 1XB4A 1CJPA 1NA1C 2VQUA 1RXGA 1YHFA 4S2DA 1TWHJ 4Y1XA 2VMGA 1JOJA 4DUXA 2BEOA 3ZXSA 3I7DA 1B9NA 1XMKA 1PVC3 2G19A 3VBHA 4M3CB 2R7XA 5KXEA 2R7WA 5JHUA 4XIOA 1CPNA 2IVIB 3OOUA 5BS6A 5DAWA 2Y64A 3TQNA 1TNFA 2E5NA 4Q47A 4FPLA 3JSOA 5I0SA 1PO11 2YB7A 1R00A 3HGGA 1AL22 4EM2A 4HG6B 2EZLA 4COYA 1HW2A 1CQ9A 2F2EA 4BBRJ 2M5WA 4Y5TA 5BXXA 1KDMA 1V9U2 2B63J 4TZDA 3UKGA 1GV9A 4M3EA 3HQUA 4RFT0 3D1NI 3VDDA 1SFNA 5A3LA 4UV8A 2E51A 4X8PA 2YFUA 4JGYC 2K0GA 3GBFA 4BQQA 3LSRA 1XSVA 3KT4A 4LORA 3L7WA 1UCXA 3U07A 3IDCB 4P9FA 2ZGRA 4YELA 5FZGA 2HYXA 4O7XA 2OQ6A 2Q8DA 2K02A 4GH4B 1MJAA 3HOUJ 2BPA2 4LBKA 3BTXA 2WYFA 2X6XA 3H9GA 5K7ZA 3CCLI 2G9GA 3DKXA 1T6GC 1VFCA 1OH3A 3ML6A 4F91B 3AKPA 3KPHA 4QXCA 2M2EA 2FDKA 2V4JC 1CR7A 2IGOA 3WNNA 2QQOA 3T5XA 5L7OB 1GV2A 2L5QA 1ZREA 1LHWA 4C8DA 3JTHA 1DU6A 2M87A 3GFLA 5E1ZB 3IPVB 2WAFA 4N43A 5HI0A 4XW3A 5E1RA 3QWLA 3T2OA 1FYKA 3KEOA 3T0YA 1JH5A 4ON0A 2DA7A 1A04A 3T30A 5JLVA 4IHTA 4XBLA 3FK6A 4PJMA 4UW3A 2HOTA 5A3WA 3I3QA 2R93J 2O1QA 3B02A 3MBWA 2DCZA 1IGOA 3O1MA 4XLHA 4D5CA 3ACIA 1X3UA 4M3FA 5E3LA 2O8XA 2RS11 2STWA 1MQTA 2ORZA 4TLFA 2K9ZA 4QKBA 3VBSA 4KGGA 2AYHA 4LLGF 4OI1A 3GFMA 3R0AA 3RSNA 3S14J 4DRVA 3VDCA 4Z2YA 1AR93 4MGTA 3T08A 4XAAA 1S0CA 1XDSA 5E3OA 3A23A 1VBB3 1H2LA 5FY1A 4WV8A 4CDWB 2VULA 1MR5A 3W5NA 1ALYA 1W8WA 2FNPA 3OOPA 2IFRA 1TWCJ 2BYVE 3S5QA 1RR8C 2WZR3 3ZFFC 3MHZA 1JYWA 5KXBA 2B7YA 3V8JA 3NNGA 1C8M1 5K5QA 2R4GA 2XHKA 1OPMA 3TB0A 3OBZA 3SHFA 2X9DA 2CQQA 1LTEA 4CH7A 3LA3A 4LLFA 4TWTA 4K21A 2IS4A 2H0BA 4V2WA 2RS53 2RHPA 1Z7S2 1FV2A 1RUD2 1J2XA 1FSHA 4BYYA 1D7PM 3SXWA 2KIUA 2PQSA 2QENA 5I8SA 1Z7UA 3ZR8X 1X1DA 2LDUA 1QPMA 5FYYA 5LK5A 4F3JA 4BEHA 1SLIA 3POYA 3B01A 2ZPXA 1K4SA 5FLXK 1O4ZA 3WU0A 4XSZF 5EG0A 1AYN2 5C4JJ 1XNBA 2PJRA 3E7LA 2AENA 3HOYJ 3KZ4C 2E60A 3ZFEB 1H89C 3HOZJ 2Z79A 3DYOA 5DZFA 4BPZA 5LRSA 2F5DA 2F4MB 3KHBA 4WVMB 2DBNA 2VCAA 5D5VB 5K4LA 2JKXA 1F5TA 2LM3A 1PGSA 2H0VA 4BHBA 2R073 1QRYA 4OUMA 3JR9A 2MYSA 3E0JB 3POGA 2L9VA 5BNNC 2YBKA 4EE2A 2GZWA 4BCUA 2ADUA 3EUHA 2YV8A 3U9GA 2DJIA 4IKFA 2JDNA 3CQOA 5BMZA 4YZ5A 3QYFA 4NHJA 1FAYA 1A31A 4MO3M 3M4FA 2RDRA 4QPOA 4RAFA 1DU0A 1XMXA 4JTOA 5C3OA 1B9MA 2ET7A 4GWJA 1W2NA 3S57A 2DVAA 1FOKA 4RB3C 1UF2C 4MGZE 4XF3A 4UWDA 1ZG1A 2IC1A 3I9V2 4RS8A 1FIAA 3HOXJ 2A1XA 3PVOA 3VDAA 4U2AA 3WE2A 3FLPA 1QJU3 2OPTA 2W5FA 3WP4A 4IE4A 4PI0A 1LGCA 3PNTA 5LZ6A 2K9LA 3LB9A 2L9NA 3LSDA 2LF8A 3N9OA 2DU1A 1WCMJ 5T3NA 3OYAA 1SD4A 3C7HA 4G7OF 1ASJ1 5FMOS 2E7XA 1FNYA 4CPBD 3VBFC 2CGOA 3P6BA 2M0CA 2BP6A 2VH9A 4OIPF 3ITQA 1W2AX 3FFZA 2UXNA 5KHHA 2OX0A 3IP4B 3PIJA 4EROA 3DF0A 1WCUA 2O8OA 1QZYA 2UU8A 4ZYDA 5FFOC 1JKPC 3CEWA 1SFEA 2LC2A 2QVOA 3AMNA 1FPN1 2RS33 3PQJA 1XYOA 3OPTA 3ISPA 2RGVA 4AGVA 4OQ8A 1LJ7A 1O3RA 3AYEA 4NIAA 2PMWB 5FP9A 2RV9A 2V9PA 1ND2A 1YX3A 2L7FP 4N43B 4Q4V3 1G3SA 1FOYA 5TGTA 1TT0A 1F2NA 3CF2A 5GTHC 1W36D 3BT9A 2HVRA 1N78A 1UG0A 5FMDA 2P37A 4IE6A 3VD7A 4AFCA 4Z6YA 2D98A 4MZUA 3VYTB 5E79C 2Z5WA 3L9JT 4NMIA 2VAUA 4OOIA 3I53A 3MW4A 4DYRA 1SFXA 2BY0A 5JVTA 1HQNA 1H6XA 5K0UA 2PHRA 4KYWA 2F5FA 4JP0A 1OQDA 2AR6A 5FMOL 1S0BA 3GCWA 1QZZA 4JC1A 4QPGA 2ECBA 3NQHA 3FJSA 1BLZA 1MQTB 3BPXA 4QXBA 1ZR4A 5B66C 3DN7A 2HBTA 1QOOA 1YRNA 4AHWA 3ASOH 3VBSB 2P8TA 2CH0A 2GMPA 5FTTC 2EA7A 5GKAC 3ZMSA 1SQ4A 4ZONA 2ZZJA 1A8MA 5ICFA 1O4YA 4P55A 2PJPA 3IV5A 1UOFA 5CISA 1LFPA 1X19A 3VHNA 3UKNA 3FF5A 2XSJC 4R9DA 1UMHA 3H1YA 1H4HA 2YU3A 1M4WA 1S7EA 5JAXA 1GU3A 2F48A 4NAMA 3VL9A 1GZCA 5EYRA 1RUH3 2QSHX 4BDYA 1CAXA 4KDPA 3OR2C 1IRZA 5FZFA 2VZQA 5A3MA 1XNAA 3A21A 4O9EA 3PUHA 2MD5A 3IWZA 4LBQB 2ZKNA 2DLLA 3MN2A 3FBYA 1Q8PA 4JKKA 3HJEA 3Q8FA 1K83J 1KA8A 1YFXA 3CESA 2Y38A 1UFMA 3UKTA 5HXVA 2K40A 3JRFA 3M3EA 2DT7B 1MH3A 2R7DA 1P8JA 1LOFC 1OKQA 5FOJB 5ACA3 1AHDP 1HB4A 2RS12 2DJNA 1S6LA 5GLTA 1N1VA 4KBBA 2ZABA 5FPVA 1ZRFA 5F27A 4RA2A 1D2QA 2E2HJ 5FUPA 1OCPA 4A6OA 2JD4A 1IO2A 2HYKA 5KCMA 2OU2A 5EG0B 4BQ3A 1A34A 2RM21 3M7GA 1Y1WJ 1GZWB 4BQXA 3UJQA 4XRSA 3ZP5A 2XB6C 3ZXGA 3TOBA 2B46X 3VSKA 2YR2A 1NH3A 2VBYA 2W94A 2ZGTA 4QU2A 2ZMKA 3MV01 2DTZA 1ZYRF 2QQMA 4IRHA 3FN9A 3EUKL 1YFUA 3BCBA 4DW6A 1WJFA 4U0WA 3OYKA 4P5YA 4EVIA 2M34A 2ZXWH 2BY3A 1YJLA 4OUSA 4QPIC 2B9SA 1JJ8C 1HLVA 2WQ8A 5L9BA 4DYQA 1T0FC 4COWA 1ULYA 4CZCA 3C18A 1VIWB 5H20A 2DUPA 2NNYA 3F6OA 4PT6A 4YFWA 5AIPA 4CDUA 1Q56A 1S1AA 1XS9A 2C1FA 1TZLA 3VZLA 1UJ8A 3AMHA 2XBO3 3AX4A 3VBRC 4RGRA 4YM1A 2XHNA 4AVZA 3EYYA 3WG9A 3LFIA 2R6QA 4Q2FA 2A75A 1W0NA 4QPQA 1KU2A 1LOCA 1Q5OA 1UU6A 4CEWC 2OQRA 1REPC 3ULQB 2PAEA 4NBQA 3GBWA 4BM8A 2LREA 5A3TA 2G9ZA 1EUUA 3VZJA 2CWEA 4AI0A 1LCLA 3J7NA 1P7IA 3HC7A 1QXPA 1QA6A 1WW4A 4FPKA 4BB3A 3MW2A 4MQ9F 3LAJA 2D6OX 2AHQA 2JWPA 1OSGA 4ARYA 4PFPA 5IVCA 1Y56A 3CMAI 4PLMA 3BQYA 4RGKA 1ENXA 1VQKI 4LB5A 4LK7A 4F93B 2P3YA 3DKYA 2VOTA 2XKOA 3A0KA 4A3ZA 2IS2A 3SCFA 2YPDA 3UGHA 4JDMA 2HXIA 2ZMLA 2KFDA 1K7AA 1ZZBA 1YCIA 2EIDA 5F5AA 4NRQA 4FAHA 2V79A 3RZOJ 5IVFA 1PGW1 2GMMA 2EFQA 2QZ8A 4E4SA 3FDYA 2E32A 4YZ1A 4AVVA 1V6JA 2FF4A 2AH2A 5FZIA 1ND2B 4LKDA 1XMAA 4EGYA 2CGPA 1B09A 2FRHA 4CEYA 1I27A 1MBGA 3SH5A 1Y43B 3WQ0A 2HWE1 3K46A 2E35A 3DLLF 1YJNI 1NA1A 2FQ3A 1W9WA 1L0OC 2HWF2 1QH6A 3FHAA 5KK1A 2LKXA 4HDVA 1ASJ2 3GZ6A 1Y39A 1ZTRA 3GZUC 5K0UB 2VVFA 1DYOA 3AL6A 1EH6A 4QPGB 1SD5A 3WGIA 1F35A 1JHNA 1R1ZA 5DZGA 1DFQA 1B59A 3LSGA 2RN7A 4LPLA 1QU0A 2WAAA 2XJUA 4ZZLA 3J8F3 1OUSA 2CJJA 1MMNA 3FM3A 2HWB2 1ULDA 5FJ8J 3ILFA 1KS5A 2CGNA 5GM0A 1FPN2 1W5TA 3JQWA 3TNPB 1HLCA 2D6NA 3UJOA 4GYGA 1C28A 3SDBA 2V1NA 4URAA 2DVBA 2Q1MA 3KETA 1POGA 1V5EA 2ICWG 2HR3A 4ZH4F 3ZQQA 3VKFC 1ETKA 1VRH1 2AGSA 2P3IA 4IHWA 3GEZA 3C7EA 4BZ4A 1CAXB 3WP3A 4BU2A 3ZQHA 2CHHA 3AYCA 4ZDOA 3VEPA 2QE3A 1TWFJ 3JBG3 1A78A 2A6YA 2EF6A 2YXSA 3WG2A 3CC7I 2DMUA 5L3GA 2Z42A 4AOCA 2C0ZA 3OBAA 2F4IA 1Z7LA 1KYWA 2F4OB 5CVRA 5FRAA 5K7FA 1MBKA 1ACCA 5FKOA 3GBGA 3IH4A 4LA2A 2RNGA 3I2HA 3F72A 2PELA 3VBUA 3VBOB 3HUGA 1JT0A 3GTGJ 3QH6A 1OH4A 3SMHA 5IYDJ 4IRGA 1FX5A 5DM6F 3J7AO 5A1FA 5FRNA 4I3GA 3QOEA 5BV6A 2EAAA 3TEYA 4KG8A 1PIV2 4UFJA 4MGSA 5IK7A 2XPVA 4HYEA 2CTVA 2EA4A 5JSPA 1S0IA 4KUMA 1P4WA 4NPRA 4WX9A 3C3WA 4PBPA 5FV3A 3TDUC 2ZXJA 2PLV2 4YG0A 1TC3C 1FOD1 3I2GA 3QPLA 3H5NA 3GYDA 2E2IJ 4P96A 4FISA 4X6RB 1W2UA 4GA9A 2QQ8A 3KF3A 3BZ6A 4MXWA 3H0GJ 4CDUB 3MWMA 3WQ7A 3SZTA 4GB31 4EJOA 5CG9A 4IEZA 1R4MB 3NQOA 5IYBJ 4C2UA 1VALA 2RMU1 2FA5A 5C3QA 3CP8A 4M9SA 1FEXA 2MC3A 1WA4A 2RM22 4PDKA 3NKGA 4XF0A 4B4CA 1ZVFA 4IE0A 2RQQA 5HNFA 4QXKA 1W36C 2LS6A 5IY5H 5FMCA 5JI6A 3KIOA 5HCFA 4JX4A 1OBNA 3BTIA 5FY7A 2COBA 1UOGA 3VUOA 2VLAA 4NJ4A 5FOBB 2XJPA 3H92A 1T56A 3KMHA 4FPJA 2VB6A 5FB2A 2GALA 5DUVA 1V6KA 4HETA 1SZBA 3D5OA 4C91A 4YFKF 4HN1A 5FJHA 1Y9QA 2Y31A 2ZGNA 3BG9A 2ID4A 5IT6A 5FZ7A 3DQVC 3ABUA 4BQ1A 5FREA 4Q4X1 2XUBA 5FZ4A 4URTA 3BIWE 4MHUA 1PNFA 4DS0A 2DA3A 4G3YC 5T55A 1FOXA 4A0YA 2IWGB 3RMYA 3RKYA 3W2WA 2VW0A 4DEVA 5J3LA 1RUF2 2QF7A 3LL7A 4DZGA 5C3PA 2C9AA 3W2VA 4CEYB 1HQCA 1U78A 1RMU2 2XQRA 1NA1B 2IEKA 3BTJA 4UHTA 5I0TA 3HHGA 3WSOA 3OYMA 2LRDA 3MKYB 3CCMI 3WG1A 5JOYA 3AZWA 4KT5C 2DA1A 5BOXA 1NE4A 2FXAA 2EJRA 5FYZA 1O57A 2FBEA 3OYWA 4GMP1 2M30A 5T5OA 2XGDA 2EQRA 4PIXA 4LK1F 3H8XA 5JMCA 4G12A 5GLVA 4CCCA 2ENRA 4QXHA 2F6CA 4P9WA 3PNYA 2R0HA 4PF1A 1G4DA 3PNAA 5L3DA 2B45X 4KU7A 1EAH1 4E4ZA 1SHWB 5DTDA 1AR83 2OXBA 1HRI2 2X48A 1PGW2 1W3XA 1R7JA 2VE1A 4YW1A 3ABTA 1XYPA 4HA8A 2W0XA 1NCRC 3BG6A 4AVCA 4JGYB 5LBCA 1WRJA 3ERMA 2DFEA 1ZAOA 3GTPJ 2NOGA 2HWE2 3EXUA 4EQVA 2DFBA 1XQNA 1VR3A 3T0DA 2E1CA 5D8LB 2W1SA 2BQPA 3KVAA 2DMTA 1RYYA 4EJRA 5JMOA 4NIIA 3W20A 1RUE1 3ZIWA 2Y26A 3ZOIA 2LBFB 1ETQA 5GZFA 1SVOA 3V0AA 1QQP3 3LFUA 1OVSA 3C7FA 2GIVA 2WFF1 1MNMC 2PHTA 3PMSA 4A5NA 4KWLA 3D82A 1Q1VA 4JKLA 5LBFA 4J6GA 2FSWA 2FZ2A 1Z21A 4MV2A 1Y6IA 3NWKA 3UYJA 1O91A 2LY1A 1PUFA 4LGWA 3LOCA 2GOMA 2KDZA 2O0OA 4ANJA 2JKBA 3O6BB 1QPIA 3VBUB 2R7TA 3R4DB 3HUGB 3IDEA 3TDZC 4IE7A 1EV13 2DDUA 4PJLA 3IN9A 5EV7A 3PIOF 5F0HA 1LJ9A 1NYWA 2XMLA 1VRBA 3G4SI 5FKBA 5AONA 1JGGA 3POEA 1WCDJ 4A12A 4YVWC 3GTMJ 4XLPF 3QQAA 1RRJA 5FKMA 3D4KA 3TMOA 1K6OA 3WHCA 1US3A 3ZYPA 2JG9A 3BZCA 1STMA 3GALA 3E5QA 3BOPA 1SAXA 2NOJB 1OYYA 3FXUA 2DYRH 1ZRCA 2I8DA 4Q29A 3H5AA 1D0HA 3VZOA 2SLIA 2ZGLA 3OBTA 3BR5A 3RYRA 1IC8A 4MXWB 2H6CA 2GNBA 1KS4A 1MD0A 4XICA 3WHUA 4DXSA 3SDGA 5FFZA 2JG8C 4YIIA 3K1MA 3NRVA 3REOA 3WF1A 4B1LA 3ZFFB 2ZGKA 1IN7A 1RUI3 4LLOA 4QB6A 1RVF3 2KQRA 1V00A 4RB0A 3U11A 3OYIA 3J81Z 5FAXA 1ND3A 4AGGA 1QQIA 2QGUA 2ARAA 2AS5F 1Y9GA 2A6HF 1LODA 1W90A 5C4WC 1LOBA 2R7EB 4G6DA 3L2YA 2W4SA 3EQLF 4CICA 3WNKA 1FBSA 2RQPA 3ECHA 3IAS2 5F6LB 1YQCA 2BOJA 3O7OA 1FOD2 1USTA 3F8BA 2VI6A 3JRDA 3LQCA 4PUSA 4XRSG 4OINF 3IIIA 3I2FA 4LHKA 3KCXA 3JCIA 4YZ3A 4JRLA 1BEV3 5J96B 4HVOA 1X9PA 3CZ6A 3BTLA 1K5MC 3BR0A 1CAUA 4HLYA 3BB6A 3LZZA 2V6EA 2K7LA 4OCTA 3JW4A 3HQRA 2RMU2 2VVEA 2PBIA 4YM2A 3SFIA 2EXJA 1LECA 3LEIA 2A6TA 1UYZA 3FLTA 5C8WA 4JQTA 1PZ7A 2Y60A 3NV4A 4BDVB 4W8JA 1V6IA 3GXOA 3GGLA 4HQMA 2L4MA 1GOFA 5BNNB 3OR1C 4QPIA 2GMEA 3W59A 1T0FA 3KZIC 2NVTJ 1FIPA 2Q5TA 5FKCA 4QPWA 1LKXA 5LBQA 4L5EA 3P9CA 3H1CA 3AZZA 1KGYA 1SLTA 4I6ZA 3OYWB 1AR73 4HT1T 3K4AA 1R5GA 4PF5A 4R4ZA 4CXXA 1F1ZA 4CEWA 1NHAA 1WPKA 4BE0A 1O3SA 5LA2A 4HANA 2XDVA 4KG0A 2IJLA 4MSVA 2XUEA 4BXSV 1V3FA 1OURA 4AF9A 5C4XJ 2ZACA 4ZYEA 3NVCA 4H7LA 4Q1RA 1F4AA 4CCJA 3WDYA 4RLFA 1GFF2 5DUKA 1IDZA 2LLKA 4D0PA 3B9IA 3SFZA 5J1XA 2H8RA 2P7CB 3VBFB 1L3LA 4ENNA 4UV9A 1MBHA 1W7PD 1JYNA 3WE3A 2XASA 4LE3A 1XDUA 3SXYA 1AKHA 3KD4A 1CF7B 3WGGA 3UT0A 5HDGA 4OQ9A 1JTZX 4Q4Y1 2VNVA 4KGQA 4EGZA 3I2JA 4BXFA 1UG2A 2CAVA 2JJ7A 2WT2A 3PUIA 4L9BA 5E3MA 4RGUA 1S0JA 3PL0A 2M8GX 1YE9A 2R3SA 1WWXA 4DXRA 4S04A 2VU9A 3V0AB 1UX7A 2WB1N 1Q3EA 4AHZA 4BH9A 3RS6A 3BI3A 5J37A 2CQNA 1R1A3 4KMUX 5E20A 2PEXA 1MJ9A 1AXYA 2AO9A 1ODMA 1D5VA 2LY2A 2MEV1 1PUFB 1W6QA 2BW3A 5LHGA 3HT2A 1WW6A 1EAH2 3I0TA 2BW8A 3DTKA 3FMSA 3OSFA 5FY0A 2LD5A 2QQWA 1HXS2 3T2PA 1ETOA 2VKHA 1F5JA 2FCUA 1IZ1A 4A7KA 3O1UA 4NHMA 4AQ2A 3S2HJ 1ZARA 5FBJA 3ECOA 2DYSH 2L9SA 4OMDA 3OIPA 1MS0A 3WX5A 4QX5A 2RVAA 4DFSA 1PVXA 4BNCA 3NKTA 1B35C 3A7QA 3QPSA 1SDDB 3HKZN 3RG0A 5C3EJ 1RUE2 1AUYA 1LFUP 2EIMH 2CV2A 4MXVA 2HEWF 2Z99A 3I2DA 4D9JA 1H6YA 3K70D 1GICA 1YWKA 1H8VA 1PK6C 3BG3A 1W2TA 2WFF2 4B7KA 2EIJH 1OCTC 2VONA 3WG3A 3FBMA 5B5EC 3BOWA 2ZTNA 3AMPA 4W65A 2JX9A 1OXCA 1O5LA 2XB5A 2RR11 3AP7A 5M3MJ 1TLHB 1X58A 1ZNPA 5FQ0A 4ETSA 1HJGA 3FM5A 2E71A 1WCKA 1OF4A 1FMD1 4IV1C 4LOSA 5AIQA 1W0UA 3DECA 3AL0C 1I9RA 3KQRA 3MIEA 3Q8BA 4XOPA 1IN8A 5J1RA 2ADDA 2LTPA 4Y26A 1ND3B 3UK9A 4C2TA 3I55I 2XH6A 1W7PA 2AZ5A 2QYOA 3AG1H 2JT1A 1GYKA 1Z6RA 5A6XA 4NIDA 3OYDA 2WABA 3GJBA 2FBKA 2HWC1 3WP6A 4B4RA 2HWD1 5A32A 3EDPA 2UZKA 1OFSA 2K9NA 2ZJPF 4J00A 3SKVA 1TMF1 2GWRA 4RM2A 5EGOA 2NYYA 6PAXA 4LIVA 2ZAAA 2LY9A 3OPWA 4EWAA 2P5LC 3BPZA 4OIRF 5FWEA 3J7LA 1U6GA 2JENA 3LWCA 2DA5A 3I71A 5IFTA 3AFKA 1XSRA 4I02A 1ZELA 4YZ4A 3J7HA 1CAUB 1UAAA 3VODA 3N7LA 2BXYA 2WN3A 3T1LA 1VQ4I 3IBMA 2L9LA 3H9QA 3RI4A 1RR7A 1AHSA 5FXZA 4GJYA 3A0BC 3APBA 1E2XA 5CKQA 3D5RC 3RPUD 4HVQA 1V6NA 1KRIA 5L3CA 3L1PA 2WR9A 3OUIA 1IS3A 2UWBA 4XFHA 2V4VA 4LO4B 4IHSA 5FYTA 3TOJA 4QPIB 2DFIA 3WP5A 3E1SA 5LHHA 1ZBE3 2KP6A 1VQ7I 3VYRB 4XOGA 4EJUA 1Z9CA 1QJY1 1R23A 1RUC2 2GSYA 3K51A 1X9TA 1JTYA 3VBRB 1IPSA 1IS5A 1GOHA 4HKOA 1GLNA 1VTNC 4ENKA 1R4NB 4HMZA 4NROA 4Z07A 4CEWB 3OSGA 1Z77A 2LFBA 1MKMA 3G73A 5L19A 1T33A 1DQ6A 1UU4A 1US2A 3CDZB 4IO9F 3BJOA 1QOTA 4HRIA 1U2WA 1LAJA 5IP7J 2IGKA 2I45A 5E8GA 4XF1A 3I3DA 4DQAA 3K48A 2ZEXA 2DCEA 1RHI3 1QEXA 3TN92 3IKTA 4GALA 3OYCA 3KFWX 4LJHA 1PX3A 1QY4A 3RQ0A 2FMDA 3KM5A 2V5YA 4AIKA 4E4HA 2A7AA 4COUA 4TSVA 2WYSA 3OY8A 2RDSA 2Z69A 3LEGA 4P02B 3LQRA 3CO7C 3EMRA 1W3VA 3GXUA 2WADA 5F3EA 1IJWC 3KV5A 2XKPA 1L3JA 5GJ6A 4ZS2A 1LESA 1COV3 4B8EA 3E6CC 1JZ2A 2W82A 4W4ZA 1QVTA 3WZ1A 1LB2A 5E88A 5T5PA 3RWNA 1MPXA 4GWMA 2QZ2A 1WWYA 3IRRA 5D5WB 1WI3A 2X85A 1SACA 3OGVA 1BL0A 4JDNA 5DG1A 1K61A 1AOYA 5DAPA 2WUHA 3WCRA 2Y6LA 5FZDA 4XQDA 1T6BX 2EIKH 1OD3A 2VIXA 1MS3A 4R4XA 4XFGA 1RUJ1 1Q8SA 1NZIA 4CCDA 4JV4A 2R0QC 1X7NA 2A6WA 1XB9A 3WEZA 5FLJA 2R043 2PHXA 4XQFA 3BR2A 4XSXF 4UW6A 4IW3A 4Q8LA 2IXCA 1SFYA 4LQRA 2MLGA 1VBD1 1BCXA 2XAQA 4E7SA 5J36A 2W87A 3ZKYA 1W05A 4Y4RA 1KZHA 2PMZA 3B9CA 3O8GA 1WKYA 4II2A 2IFWA 1XG1A 2WA3A 1HJFA 3QCWA 2MG4A 2QCOA 4H14A 4MADA 2VE8A 3O14A 2XPUA 3HVDA 3S7IA 2OQ7A 3KVBA 5CG8A 3UKVA 1H2NA 3E5XA 2L0KA 3FHIB 4EN8B 3WCSA 1GOGA 2O8QA 5FQ0B 2HZDA 2MEV2 3H7YA 2ZHMA 1YS7A 1V5GA 4LO8A 1LGBA 2ZC2A 1E5HA 4AE2A 2CV1A 3TW7A 2J7MA 3AP5A 3KZZA 3KV9A 1J0RA 1ZZCA 2DWRA 3KLSA 3U1KA 3AFHA 4FFIA 3IWFA 1QHGA 3CLOA 2VT3A 3VN4A 1W1WE 5KNLA 1R5ID 2VQLA 2BDRA 1CZSA 1F31A 4G6QA 3ZDSA 5IAVA 1N3OA 3LE0A 2Q8KA 5HPOA 4DRRA 5A32B 2Y75A 4DZJA 4OMYA 4IX7A 4YGCA 3ZSEA 2WC2A 2KM2A 2CW7A 4P9JA 3F8MA 4LBOA 2H1LA 3MPPG 5EGOB 4OIOF 1W9TA 1QVUA 5FLMJ 3SKJE 1QNWA 1WJ5A 1I1GA 2GN7A 3VHPA 3IAM2 2XR4A 5FGMA 4DNCA 4C0BA 1H8TC 4YG6A 4E27A 2Y0SN 2JA2A 1F43A 1UY3A 2X6WA 1SC7A 4O5VA 1BI0A 1JYCA 1GP4A 3INAA 3WTZA 2JMWA 1FMD2 2WS91 2VXZA 4ZHNA 3GNEA 5EHDA 4XETA 3BN6A 2WNVC 1DGWX 1YNAA 3JRGA 3RTRA 1IRXA 5FKNA 1PZ8A 1GANA 3GUDA 1J5YA 3MD2A 1DGWY 5IT9K 2P1BA 4M01A 4N53C 2X1DA 1PGL2 3KYDB 4NNJA 5APAA 1OCRH 2QKMB 2FOKA 5EYXA 3K4BA 4NC6A 2AUYA 2X5IA 3FX3A 2AXTC 1ZGWA 1RINA 2HH9A 4YNIA 3OBRA 1TMF2 4XRFA 2W95A 2K3PA 5K1YA 3WTXC 4XDQA 3ZSJA 3BTZA 5D8KB 3OYGA 3DXTA 2X1EA 4IXAA 2QKDA 1VQOI 1RJ8A 3TRSB 5HBAA 1W8UA 2ISYA 3T0BA 4LT5A 3GYHX 3MUZ1 3SEZA 1D1BA 2DO7A 3CJIC 4AQ6A 1TNSA 3K3OA 4OU0A 4DBQA 3R05A 4IERA 1SFOJ 3LSHA 1MGTA 4O9GA 1X3ZB 5FK8A 3AYDA 1O7FA 1J3RA 3ELKA 4Q5OA 3CDHA 2R5ZA 4LO6B 4CZSA 5F64A 4YRVA 3BJ6A 2DT6A 4OIQF 4QB1A 5D5XB 3OY8B 1GWLA 2VZVA 1UZVA 1Z6TA 3NJXA 1HV0A 1YW8A 2R072 5H6QA 5IVBA 1K5MA 4X1EA 3ZMUA 4L0YB 2JA6J 4LHLA 3K70C 3ZN6A 2ET1A 4QMAA 4P9YA 3CU7A 4OZXA 2WFPA 3IMMA 2AACA 5FFXA 1M1EB 3HIFA 2OVUA 4YPJA 4KIBA 2Q2EB 2PA7A 1QDOA 2DCKA 4D5FA 1QNTA 2Q1ZB 4E7LA 2GNTA 4A3JJ 4FXKB 2ME0A 4QX8A 3FXRA 4BQNA 1CN1A 5JDBA 2WO1A 2VJJA 5E8AA 3BIEA 1JYXA 2OTLI 1G9BA 1K78A 2CO5A 3RZZA 1F15A 2B4KA 2VMCA 4JRAA 3OGRA 3CCVI 2ZOEB 2D3SA 1S55A 1Y9MA 2VZTA 2EZKA 5KC6A 4WF2A 2FD8A 2XJVA 3IB3A 3WHBA 1F36A 3C1DA 1OQEA 4XBNA 1XGOA 1SVMA 3HN3A 2ARXA 2P81A 4I09A 3LMMA 1OISA 5DUWA 2BE5F 1F4HA 4ZU4A 4CDQC 5HODA 2LALA 4C9YA 1BZWA 2IAIA 2K9MA 3FL7A 1BI3A 4CP1A 2PLYA 2M45A 4HLTA 3ESWB 1TME3 4DOUA 1YITI 3M7AA 4IEPA 1O8SA 3CC2I 3FC0A 4QT6A 1NCRB 3QU6A 4D6RA 4B4QA 2A3SA 4P9XA 4XDOA 2GXGA 4KMQA 2WY7Q 2HTJA 4K2EA 3T8RA 2JB8A 1OYWA 4A2UA 4O61A 1UD1A 4M00A 3PTYA 1IV6A 2O6GE 1H30A 3TEZA 1UPIA 1GNHA 2UY9A 4E9KA 3RI8A 3X29B 4U87A 1VQMI 2IRFG 1CONA 2ZXHA 4XVHA 5FPZA 1VBA1 1Y0NA 2BBYA 4YIFA 2E7AA 2OC6A 3BJAA 5EEGA 4BIFA 4IGPA 3WW2A 5C3RA 4CP0A 2MH9A 1MSEC 3P5JA 4BMBA 1K45A 1RUOA 5IP9J 1HKSA 3PVNA 3GFJA 2MD0A 4J1WA 2FMYA 4R9BA 4WZCA 1FC3A 5DMYA 4QQHA 4HPKA 3PHMA 4EM1A 4ZC3A 5FPAA 3ELNA 3CCYA 2DYCA 5CA6A 5JWPA 3ZYFA 1G8WA 3R60A 5HV4A 5DUXA 1DZTA 1AL23 2C5DA 3HOVJ 3ST7A 3U10A 4BQ2A 4NHLA 4YVWB 3EQEA 1GLHA 2RG4A 2OYZA 4JDOA 4Y4YA 4IE5A 2N7GA 4XMAA 1B35A 1R22A 4BJ6C 2NMOA 2PAKA 2ELKA 1G9FA 3FLRA 4C3JJ 2EIBA 1BMV1 1DGLA 2OCCH 4XE9A 5JXJA 2HVSA 2ZKZA 4KWJA 4ZU5A 1AYM3 2BBVA 3CHXA 1T95A 2PG4A 2VM9A 5GZDA 1IHMA 2C9KA 2VECA 4RS5C 1PM7A 1VI0A 2LF7A 2NS0A 2JG8B 4HK9A 3OGGA 2WZPP 2OQGA 3IT8A 4SLIA 3GWZA 2P6HA 3CUQC 1E5SA 5ILVA 1ZZ9A 2OS2A 5HCBA 2QM3A 3N9MA 1ORKA 3KS7A 1I6HJ 3K0LA 1XU2A 1EUTA 4O65A 4AYBA 3K2OA 1QH7A 2CDPA 5H2FC 2X8KA 1KD7A 2VBWA 5GLZA 2WS92 3DPTA 4P9IA 4WM8A 3JQXA 4QDSA 3ZPLA 5C4WB 2UYAA 2BJSA 2EAKA 2VJXA 3Q5FA 2ZBKA 3ZXLA 3T4VA 1O8PA 1KU7A 3RCOA 5HOOA 1NCQC 2KA3A 1RC9A 1MEC1 2YG0A 4NO4A 1K79A 3U2RA 1X50A 5A7PA 3DBRB 3TP3A 4UOJA 5F5IA 4J19A 2R16A 1K5MB 3VGIA 4FHTA 4XDPA 2LKSA 3ZN6B 5KHJA 3HGYA 3EUAA 4Q0PA 2J22A 1GKBA 4FCYA 4HF1A 2VVDA 2A5WA 5ABJC 4HX4A 4OHWA 1MIJA 2OA4A 1QO0D 3MFKA 4Y33A 3ACLA 4A3DJ 2XBO2 2RV8A 4UT5A 2G7UA 3VFZA 3WLUA 3PSIA 3VKOA 2QQUA 4MGYE 4OMZA 2CAUA 4U88A 4IL7A 2VQGA 2D40A 1NK3P 5M5YJ 3CL1A 1K78B 4UXAA 3WW3A 5K8SA 2BFUS 1WI9A 2GNMA 5FZ8A 5JSOA 3M3YJ 1XSXA 1NLSA 5JIAA 1T08B 4GCVA 4Q26A 2EFPA 4E2GA 1POV3 1RIOH 1W8OA 3F2ZA 3BTAA 4AI8A 4A3GJ 2LROA 3U0ZA 1UYPA 4NVPA 5M5XJ 2CFOA 1SD7A 1H8AC 2A3YA 1L7RA 1Z7S3 2NYXA 5AC93 1RUD3 1VBE3 5F5QA 3ZDVA 3SEEA 3OS0A 2TEPA 4A45A 1IRGA 1V54H 4G7HF 1W39A 3CDLA 1XNKA 3OMYA 4FE4A 3B5LB 3DV8A 3WUDA 5JOXA 3KHCA 1OFCX 2OZUA 5HDNA 4QM9A 3PUFA 2Y0MA 1AYN3 1JXNA 2VCBA 4M9ZA 1OOPA 4KT6A 5DCFA 4UVAA 2VQHA 2YPJA 4PIZA 2GC0A 4Q1PA 1R1VA 1C3HA 4BUPA 4D94A 3V65A 3AMMA 3MVPA 2Q0OA 4RGSA 1QMJA 1R093 2X29A 4B4PA 1Q8OA 3JREA 4OWRB 3CCUI 4H0EA 3J7ZI 2BFUL 5H9SA 4FAGA 3K77A 1PDNC 2CMPA 2XLAA 3LD8A 3MICA 5C8CA 4AI9A 2HOAA 1LHNA 1MZFA 1SDWA 3D6EA 3GTQJ 4LD5A 3U1XA 2JJ6A 3JD73 5FXWA 2IS6A 1L7LA 5FZOA 2FDFA 4L8QA 3VYSB 4X6AJ 2QBYA 1F9NA 4QQPA 3RIRA 4SBVA 4QPYA 1N47A 1OFNA 4NAOA 5H9PA 4HPKB 1JHFA 3SH3A 2A68F 4P9LA 1KDKA 3KV4A 4QKNA 3J8F2 2E7TA 5KHIA 3CCQI 3Q0UA 1S7OA 1SCSA 2HDCA 5KAIC 2DFHA 4IGQA 3J26N 3BCAA 3RPQA 2VXJA 4XZUG 3OF1A 1JZ6A 4NIGA 3S16J 3AKZA 1BI1A 2LYCA 1PMHX 1B35B 2OUHA 3T4HB 2RKHA 1POQA 2WT0A 3RQIA 3WDTA 4HV5A 5FJKA 4XHBA 3K4JA 4XJWA 1BBYA 2IT0A 4E4DX 2DW4A 5A6ZA 4AVAA 1O7LA 1PK6B 1NE6A 1JKQC 1WJDA 5L36A 5BNPC 3JBG2 4RSUA 4KNCA 5CPRB 3HEFA 3AVSA 3HJRA 3OYNA 3HG9A 4XIKA 3ZXKA 2DDAA 3ZQLA 1YX5A 4IV1B 5HV0A 1RUG1 3L09A 4GZ9A 3GDBA 3AL0B 2VNOA 2DDBA 3UR3C 2VTXJ 3BYWA 4LB6B 4KITB 1PO13 1G3YA 4ASMB 3RYPA 3KP7A 4N4NB 1W0TA 1RUNA 3PFIA 5DAQA 4ESJA 4YM3A 3FXOA 2NAZA 3PU8A 5DCMA 2WJSA 1AJOA 4ET7A 1XNDA 4XFFA 4AGRA 2E1NA 3QU3A 5A7WA 1TW2A 5DS9A 2PN5A 2ZB9A 5JUVA 2KT0A 3VYUB 4R52A 5FYCA 1R58A 1EF4A 1U3EM 1I3AA 1OPOA 4YRDA 4IHYA 3IPVA 3RKQA 3H8OA 3KP3A 3H7JA 1WBLA 2L54A 1X8EA 5FPXA 4KIFA 4L9NA 4G4FA 2HEYF 1MMDA 1FZPB 2JDZA 2FDHA 1H8TA 4ATFA 4Y5SA 2GIZA 2P3JA 1R64A 3ZXAC 3J81K 3Q8CA 2XAUA 1JZ3A 1EYBA 1WD3A 3OYLA 5LGTA 1WBFA 2NP0A 4XOTA 1JI8A 1ULGA 4XFBA 1YIPA 1HW5A 1LEDA 1ZBA1 4LO7A 2XVCA 2JDAA 3C7JA 4FFFA 1IXSB 2FQ4A 1GT0C 1MNDA 4RL7A 4Q27A 1S0EA 5JOWA 1R081 3B7MA 4C0HA 1AVBA 2DCTA 4PSWA 2VQCA 2NNNA 4S0HB 5E1XA 3O1TA 5HXMA 4AI2A 3CZUA 4YM0A 1RKTA 4X0GA 5L3FA 4NB5A 2IBDA 5IWFA 1JKOC 2A6EF 2DTRA 1VBC1 3KGZA 3ZMDA 4LMYA 1MEC2 3P7NA 1I1EA 4PZJA 4IL6C 2QFEA 4TTGA 1IG3A 4CCMA 4S2GA 4M9XA 4RFRB 2YUEA 4ZKTB 3MLKA 4L0ZB 2RS13 2OPKA 4BQYA 1OYIA 2VKEA 3CJIA 4QWQA 5F37A 5GLWA 1BJQA 2CSGA 2JECA 3V7SA 1C1FA 1SBDA 4Y5Z0 4KJZA 4U0YA 3IDBB 4ZJZA 3N9PA 1Q8VA 2AC1A 1BIBA 3I54A 4DEQA 3OS2A 3F6VA 4PQ9A 1YTYA 2Z3YA 1Q8QA 4KU8A 2JPBA 3JCUC 4BY7J 3ZKUA 4UFMA 3AK0A 3CJNA 1BKZA 2VXRA 4PFOA 4QQ2A 1APNA 1ON1A 1LE8A 3WDXA 3S0MA 4GJZA 3OUJA 1C8M3 2VT2A 3HRTA 5FZKA 2EILH 1ENRA 3L2HA 2HGCA 4ZU7A 1KQ9A 4LLNA 4WVMA 2UWCA 1STZA 2DV9A 1XPWA 2QNKA 1FX7A 2PFBA 3WDUA 1JBCA 3GZ5A 3CLPA 5D6EA 2QBYB 5FLHA 3NNMA 2X4HA 5LGUA 4C2MJ 1QU3A 3BDDA 4CRQA 5FPUA 1JUHA 4RAYA 2QEXI 2DUOA 4AC0A 2UUZA 3L2QA 2Y8KA 2DMNA 2M7BA 2NMNA 1DDNA 3MKZA 1CQTA 1ZKGA 5T50A 1LNWA 3VD3A 4XUQA 5E18F 4B43A 1GUIA 4AHYA 1VLNA 1X2NA 2PHDA 1ODNA 2KZGA 5LLQA 4HNUA 5FUNA 2KR2A 5GPAA 3WG4A 2HXOA 4Y7NJ 1BW6A 3A4UA 1YW7A 4QDRA 4A4AA 2BGOA 2OF7A 3RKWA 2P4WA 3BY6A 1U5ZA 2IXKA 1BK1A 1K5JA 4P1WA 2XXZA 4HEA2 2XQXA 5CFDC 1VQPI 1N1TA 4DBRA 1AR61 1NLRA 2XF5A 2HDWA 5ICEA 4GQ7A 5F6FA 4LBQD 2IGMA 3RZDJ 4CP2A 1PVEA 3N9LA 3KF5A 4UFIA 3AXEA 4LEJA 4M6YA 1BC7C 4CUGA 2YU9J 4QD2A 3U78A 4LKSA 1I6XA 4V1PA 1WMXA 3WXPA 3DBHB 3KLOA 1MSFC 4XLCA 4ONUA 3HTUA 1H9GA 4FPGA 2R1DA 4AG4A 5DCMB 4N8MA 4D7MA 2O9LA 2ME6A 4BISA 4ISRA 3F22A 5A7WB 1UHSA 1WLDA 1RETA 3DPRC 1BXHA 1PP8F 4MGKE 3CJRB 4AUXA 3FHQA 3OOXA 4FASD 2LRPA 2VG9A 1YLLA 3BQZA 3D3AA 1ZA4A 4INDA 1H8TB 4A3KJ 2P17A 5J8CA 2DF7A 3BTYA 4Z8BA 1IS4A 3CCRI 4QKFA 2NQYA 3H0OA 1W5SA 3MZHA 3M3CA 1IDYA 4AVBA 1OR7C 1NQJA 1JOPA 5EYYA 1RUG2 2PMHA 5KWRA 3SYTA 3H9JA 4LA3A 2WNVB 2ZMEC 1W0PA 2VGDA 3A02A 1D0GA 1R71A 4BY1J 2JDPA 3N97A 2VO5A 1XTAA 2PFWA 2FQPA 1X4PA 1Y7BA 4N53B 1PJRA 3PLQA 2Y0OA 1RUI2 3IC7A 1DGRA 2DFFA 1RVF2 5LK7B 3N36A 5J7MA 2CQ7A 2GP5A 3ZQ7A 3QODA 3DCQA 5FD6A 3LDBA 1BYHA 2XAHA 1USSA 4XMYA 3ZMOA 1REDA 5JZGC 1JU4A 4W6WA 2YFZA 4PGGA 1C1LA 1FLIA 1Y3TA 5J1YA 3CCSI 1Z67A 4IV3C 3AB0A 3I4NJ 2EALA 1EKEA 2JE7A 2BGCA 4QTRA 2OZ6A 3CUQA 1WKMA 4LBQA 3WUCA 2GA1A 4W1UA 4PJ0C 3CJIB 5CVJA 1P92A 5LA1A 2FDGA 3BU0A 1BEV2 5D8AC 2N8GA 1BW5A 5ICCA 2Y6FA 2IXSA 5JHFA 1B1BA 4EATA 3ZN0A 3PJRA 4GWIA 1ZBA2 2WSUA 3VB9A 3POSA 4QGLA 5JSRA 2R92J 2QQLA 4MFEA 4XF4A 1SBEA 4XEZA 1D8JA 1R082 5A2QZ 4CYCA 4RBOA 1GSLA 4B7EA 3LSPA 2CWMA 1LE8B 1W6PB 3LIGA 5FO9B 5GZEA 2DQRA 1GZWA 4CDWC 2GH2A 3JRBA 2MGQA 3U14A 1A35A 1VBC2 1JUSA 5FO5A 4A3FJ 5A70A 4JGZC 3OL3A 1RNLA 2W47A 1FT9A 3UETA 2QZ3A 1W28A 1O6UA 2E34A 3W9AA 3S8PA 2XGXA 3JUUA 3I4PA 5CAZA 3HSRA 2K9SA 3ZRGA 4HSTA 3FZ3A 3ABMH 1KXGA 2W3JA 2RAEA 4YVSC 5BNGA 2ZXQA 1UZ0A 1UMZA 3H42B 1WCQA 4Y15A 4JTNA 2EZIA 4DXTA 3S5AA 3ZXEA 2HWVA 5FY5A 3UV9A 1DQUA 4LLLA 3IH2A 5FY9A 1Z3YA 4PJJA 5F6KA 2RM23 1WJBA 2YC4A 3QOPA 3ETPA 3NV1A 3ZXJA 4BJ5C 4XLAA 4R1HA 1C4RA 2D5HA 3DL3A 4XHXA 2DPUA 4DOZA 1CPMA 4CP9A 3WTUC 4IVNA 2WA4A 3I4MJ 2VNGA 1LPQA 1X36A 5B2GB 2Q1FA 1U0AA 2W48A 4BOWA 2FBHA 3WHTA 2XC7A 2DTWA 5FP8A 4GYIA 2UURA 4JZRA 4OI4A 4CDQB 1U5IA 1BR4A 2M4GA 2JDKA 4KWKA 4XL9A 1XSDA 2P6CA 2TUNA 2GXAA 4QWNA 1JHJA 4XN0A 3CUOA 3NNFA 2HWF1 1C5HA 4I30A 4WXHA 4N0BA 1G9CA 1SD6A 3H3UA 3BR1A 4BLJA 1BR1A 2DOAA 3TEXA 2PYTA 5DYMA 1Z3XA 4I2OA 1R1A2 1PHMA 4XABA 4AEKA 3MEPA 3KB5A 3K4KA 2XVLA 4CA0A 2HZTA 2O7OA 4O3MA 3W2AA 2PQ8A 2CY6A 1T38A 4AIJA 3VBHC 2VMDA 1OPCA 2OA2A 4XLFA 3ZFGC 4FQZA 2HWB1 1V0AA 2QA4I 1S2EA 2ERFA 2V72A 3T2TA 1VJ2A 4XQWA 3PUBA 3WF3A 3FXQA 4G9SB 5AVPA 4M3DA 3DTIA 1CWPA 2R0FA 4RA0A 1JUIA 5HS8A 1Z0XA 3LOIA 4NE9A 2VMFA 1FYLA 4XM3A 2WNOA 1S3JA 1WW5A 2CUZA 1IAWA 2J5PA 3AMQA 4HSJA 2C4XA 5LD2C 4QB2A 1P4AA 3VDDC 1Y8QB 4FP3A 1HIXA 4FOYA 4LHSA 3ZSKA 3CMMA 5I93A 1AR62 2JIGA 2WLQA 4XJ9A 2IVJA 1OLME 2FX0A 4CCEA 3F21A 4HL0A 2EFOA 1WSUA 2L02A 3PVEA 1LENA 4RMNA 4F8AA 4YSFA 1REFA 3MLJA 3HWJA 2CYYA 3R0JA 3BUCA 3LSTA 3G7DA 1DZQA 3WDWA 4ZPIA 2W00A 2JDHA 1CESA 2HWE3 2X6YA 1A5JA 2J1SA 3ZM8A 3K4ZA 4N43C 4RS5B 3O0WA 1NG7A 1JJ6C 2VOVA 1DPRA 2DOFA 5CJ9A 3LFKA 1W9FA 2EWNA 2ATFA 3JU9A 2IVMA 5A80A 3CUQB 1G86A 1PIV1 2DTYA 5SV8A 2Y9YA 1SLBA 2G1MA 2PLV1 1LHUA 1IPKA 1GQPA 5LHIA 1FNZA 3KWVA 2FMLA 1QOSA 3HR9A 1MDMB 3AG4H 4FOQA 2FCTA 3TNQA 3CJXA 1MQTC 2EXHA 2D1VA 1HKTA 2CG4A 2WSVA 2HKOA 5M5WJ 4FT8A 3HPHA 2CU5A 1IXCA 4LKFA 1NCQB 4RDUA 1QNYA 1W6OB 2ADEA 4CYCB 3HM5A 1CVNA 2BZTA 3PO3J 1VRH3 5ISLA 2ES3A 2EXKA 3K75B 3VBOA 1XOYA 4UAPA 3AP9A 1S0GA 2DU0A 2ZJQF 2FCVA 1URXA 4Q4W1 2BNOA 1D4VB 1FJLA 2HVQA 1HOMA 3O1OA 1ZBE2 2X53S 1V6MA 4LKEA 2P2KA 5ABJB 3AJZA 3TGNA 2AREA 4FX0A 4E70A 4ARXA 5LRRA 3KCYA 2BWAA 5E8IA 2M4KA 1GXQA 1REEA 5L9VA 3HRMA 1S0DA 1TE1B 3FISA 4RHV3 5KAFC 5G04L 4COVA 2L4AA 5A3NA 1QJX1 4AFAA 4CO8A 1TQMA 3VZNA 3DBLB 3HD8B 2H94A 2RDQA 1WMEA 3USUA 1OD5A 1XE8A 3WF2A 3GLXA 2VC9A 1RHI2 3L2UA 5FP3A 1XJAA 4CDXC 2QQPA 2HJIA 4ZY9A 4MOAA 1NKGA 4CP9B 1TWAJ 3B94A 1RUF1 4IEYA 2IGNA 4W6YA 3DU6A 2QVSB 4ATEA 2RDNA 1YI7A 4UB6C 3C2UA 4BE3A 2ZSIB 1VQLI 1S5LC 5L3BA 1RMU1 3WNXA 3O12A 4TN7A 5SV5A 5F5CA 3BGAA 5LA9A 2XJRA 2WAEA 2TRTA 1JZ7A 2O5RA 3DXUA 3ERED 4DYCA 2Y6JA 4GXLA 5DUUA 2IXJA 5LY2A 4EV0A 4FQ4A 1ZX5A 2KJBA 4WWCA 4GB33 3ZN4A 1TVGA 1DP3A 2MH2A 3CIHA 1Y1VJ 2VXDA 2F6BA 2RMU3 1TQIA 2LG4A 2J1EA 2O3FA 3P5BA 4QX3A 3WY6A 4IQJA 2BWCA 2R7OA 2ZAHA 1LVKA 1YG2A 4LE4A 1DQ0A 4AEJA 1U8BA 3CO2A 2ZX4A 4H55A 3HMYA 3GTLJ 1R5HA 1UL9A 2J1RA 3JZVA 2MA3A 1VB2A 2FZ1A 1HRI1 4K1YA 2JSCA 1OMIA 4FVVA 3MLLA 2L01A 3IRQA 3ZQFA 2R7RA 3ZSMA 4DUWA 1OCCH 4ZTFA 4BBSJ 3HOWJ 5E16A 1IOAA 2VJ4A 5KXDA 1DU3D 3I2KA 3E3VA 4PJNA 4Q4ZF 5FO7B 4BK5A 3SCHA 2GN3A 1JODA 5D21A 1MS8A 3G6EI 4D7TA 5IATA 3C2BA 2DMQA 3CLQA 4Q4X3 2A5ZA 2BNMA 3HL2A 1BN5A 1IUYA 4BQOA 5K5OA 3VD9A 2OKXA 4NRPA 4FTSA 4EJTA 4YARA 1JZ8A 3NV3A 3MIHA 1B8IB 2Y6HA 3LDRA 4KL1A 1RJ7A 1IV8A 1X33A 3J7MA 2O8KA 1EPWA 3WGHA 4L5IA 1VQ5I 3BKZA 3O1SA 4NWWA 1TNRA 1V55H 5LFAA 5FRMA 2B0LA 4LULA 1WVRA 4BIOA 4HPQA 1LDKB 2P34A 3T2QA 4XXPA 3CBNA 2A5YB 3PFYA 1O3QA 5CFDA 4C3IJ 1UU5A 2CRGA 2VTXA 4ZTJA 1IUFA 3F8FA 2RVCA 4JGYA 1LHOA 1YS6A 2ZGPA 4IQ4A 3RJ2X 2FBIA 4GMP3 1J58A 4GULA 3QBQA 3WVJA 1JE8A 4CCKA 1WLWA 3ZYJB 3KP4A 3N05A 1YC61 2BOLA 1W9SA 4FTEA 1NLQA 3QAHA 3IL2A 5L9RA 2ZEYA 2R30A 2WDBA 4NN0A 3ZMNA 4GKYA 4C1XA 2LBFA 1VQ9I 3ASNH 1EAH3 3MUY1 3TBDA 3KT7A 5JVGF 4DJAA 5FZ3A 2ZX0A 2HKXA 3BU7A 4I0WB 4MHGA 4V2VA 2MPFA 3TL4X 5FZ1A 1HDKA 4XRMA 5K5RA 5E17F 1BIAA 1SFUA 5CYVA 1LU2A 2LMDA 1PM4A 4HQEA 4EN0A 1P7JA 2VBDA 3A0HC 2GLOA 2V1DA 1VPHA 3RVHA 4Y3OA 3S17J 2XAGA 1NG0A 1ULCA 4B48A 1RUE3 1OR7A 3W3CA 1VAVA 5FXVA 5I0RA 1S2KA 3DPUA 3I5UA 4W50A 3PVBB 4L2NA 4QGMA 5DXDA 3AKTA 2ZMEA 4L9VA 2XRNA 1NG6A 2WFF3 1J84A 4KA4A 1H2MA 3SQOA 1HCRA 4AIHA 2JRMA 3O0VA 5EPAA 2W39A 5KR7A 4AFDA 4AK3A 3HOSA 1ETXA 2BUKA 3GVAA 4B47A 4YGEA 3NV2A 4WM7C 3PUQA 2Y0IA 4PGHA 3AL5A 4LXLA 2ECCA 3DWLE 3USUB 3OPZA 2FDIA 5FYBA 3PIGA 4XFCA 1N3PA 5T52A 4HV6A 2R5YB 5BNQA 2HQAA 4G8XA 4UFKA 5CFCC 5HS9A 3ZFFA 3VDXA 2X0LA 5GPCA 3F95A 5FCCA 4XLNF 4YFXF 3M1HA 2CUJA 1DF0A 1T2XA 1FP2A 3PUSA 2D5FA 4Q4W2 4XKBA 3Q9OA 5FDBA 5F8PA 2D6PA 3NAPC 1G59A 4LBMA 2IW5A 1UKGA 2P6TA 3D8CA 5AC91 1B72B 5CNAA 4XCAA 1D0ZA 2XLFA 5E3NA 4E7JA 4EEFG 1CX4A 2V4AA 3AZYA 1DQ2A 4XUNA 5LBEA 2VUCA 4K7JA 3A1YA 4D0QA 5E89A 4QHZA 4LTAA 3HTSB 2W25A 2I5UA 2R32A 4JYKA 3SZGA 1QJX2 3BZKA 3MKWB 4ASLA 2A3WA 3G71I 1OA4A 1BBT1 4DB5A 1DGWA 1DP0A 2RJKA 3P3NA 1SCRA 1IQDC 3E1F1 3F0CA 4UYBA 1HKQA 2Z33A 3BLYA 5LA0A 4ENMA 3TWIA 1DPUA 1L7QA 4V19K 2QQJA 3Q8EA 4YVSA 3ZPYA 3K4MA 9ANTA 1D1AA 2NS8A 3O5SA 2QQIA 1RC6A 5BNNA 1QZEA 3FXKA 3LNQA 1GXPA 1DBNA 1MJBA 2DU9A 1YLFA 2LSOA 3ATGA 1BC8C 2QSGX 2VZ1A 3ES1A 4EJVA 1ZHFA 2KMUA 5JVVA 2R7ZJ 3TW6A 2XL7A 1TME2 1X1BA 4GDFA 4QX0A 1SLCA 1XNCA 2DA2A 3VZKA 4M3CE 2OUMA 1ETYA 3P9KA 4U7BA 1QBJA 5F2SA 4W97A 4BXUA 4UUSB 5EZHA 2XVGA 1OKRA 1CZTA 1P9QC 5J09A 1IN6A 4OMCA 3H36A 1ZGAA 3E5UA 5CFDB 1HXS1 3S1MJ 3FKJA 1ULEA 1LFBA 2HU9A 5ERIA 1X82A 5KC5A 1FTTA 4M3GA 3VBFA 2H6BA 1FATA 4CUCA 4OHYA 3DEEA 1BVVA 1YEWA 2WLPA 4MGQA 4EWDA 5A3UA 3F9KA 5A33A 4KIGA 3G1OA 2XF6A 1CF7A 3PURA 1YQAA 5FR3A 4OUEA 3ZFGA 2GDFA 2BVMA 4BHPA 4DY3A 1XRUA 2CSOA 4M74A 5ILUA 2XLGA 3O1PA 2VOWA 4ZYHA 3BR6A 4R9CA 2JTVA 4TYSA 3DPRB 4QKDA 3M07A 1LULA 4E7HA 3OCPA 3JB8A 2VZOA 1XGNA 2D6KA 4AD9A 5C9AC 5H9RA 4G7ZF 1N77A 2W08A 1T6SA 2VMEA 4AIDA 3GW2A 5JFRA 1RIRA 4FSJA 3ZYIB 3VSLA 3URFA 5LW9A 3D0SA 2H1KA 5JI9A 2V09A 4UFHA 3DEWA 5BYNA 3ALQA 2K86A 3K2ZA 3MW3A 4Q4Y3 2ZEZA 4JOMA 1QGPA 1APLC 4LG3A 3HOBA 3VKNA 1AYM2 1YJWI 5CADA 2B9VA 1LR5A 3WTWC 4MG2A 3ACGA 2ZMEB 1HN0A 4M4PA 4IDZA 4BACA 2HBUA 3OL4A 4Y1ZA 1MBFA 2D1HA 4XUOA 4B1RA 1OUXA 3ZCOA 1MW7A 2YZ4A 4MQVA 2MEV3 3H9AA 1OKOA 4DNYA 3V0BA 3I2IA 2ZX1A 3G3ZA 1PO21 3RJRA 4Q0UA 2JE9A 3S2WA 3J80K 2VMHA 2PXJA 3ZYHA 3S3NA 4YWAA 2K9QA 5JZGB 2OIIA 3VD5A 4RYDA 1JMUB 4OHXA 5EXOA 4Z92B 1UB9A 1RTVA 4IV3B 3N35A 2KIQA 5DEQA 2VOPA 4A6SA 4B8XA 1JKRC 3VBUC 2PHLA 4MHRA 2X6OA 1XN7A 3WW1A 4L99A 3OUHA 5FZMA 3ECQA 3EBRA 5GZCA 3FMRA 5DUIA 1LEBA 5D8AB 3GTKJ 1XC5A 4NUBA 4A3XA 5F0FA 1CZVA 1S4CA 1SPPA