4LITA

Structure of ycfd a ribosomal oxygenase from escherichia coli in complex with cobalt and 2-oxoglutarate.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
372
structure length
361
Chain Sequence
EYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S ribosomal protein L16 arginine hydroxylase
total genus 102
structure length 361
sequence length 372
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4litA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4litA01
3N9PA 4C8DA 5FY0A 4XDOA 5A7WA 4XDPA 5F5CA 5FZGA 4ASKA 5A3WA 2OS2A 4EYUA 5LW9A 5LY2A 4LIVA 5A7QA 4IGQA 5F5IA 5FP4A 1VRBA 4GD4A 4CSWA 2YBKA 3K2OA 4AAPA 5FXZA 5FUNA 3DXTA 3PUAA 5FZDA 5FP8A 3KV9A 5FZ0A 5FYHA 5ISLA 3UYJA 5F32A 5FYUA 5FXVA 4CCJA 5IVVA 3N9NA 5E6HA 5FYIA 5FYSA 5FY8A 2OQ7A 4QWNA 3PTRB 2XUEA 2OQ6A 5FPVA 3U4SA 3AVRA 5FZ7A 2YU2A 3ZPOA 5IVCA 5FZLA 4IGPA 5FYBA 4GJZA 4TN7A 4BXFA 4QX8A 2YBPA 4GAZA 5FY4A 5FP7A 3K3OA 5FZKA 4QXCA 4HONA 5F3GA 3N9LA 5FBJA 3PDQA 2GP5A 4HOOA 4QX7A 5FYZA 5FZBA 5FZMA 4EZ4A 2WWUA 3NJYA 4LIUA 3AVSA 5FZFA 5FZOB 5FPUA 5A7OA 4LITA 4LXLA 5FZ3A 3OPWA 2Q8EA 4DO0A 5FZ4A 5FZHA 5F37A 4AI9A 5IVJA 5IW0A 3KV5A 3RVHA 4UF0A 3ZLIA 4D6RA 5LY1A 5FZOA 4URAA 5A3NA 5A1LA 5FZ8A 3PUSA 4CUGA 3AL6A 2PXJA 3N9MA 3KVAA 3PURA 5A7WB 4Y33A 5FJKA 5FUPA 5F3IA 5A3PA 5FV3A 5K4LA 4CCKA 3U78A 4E4HA 5IVEA 3DXUA 5FZCA 3KV4A 5FXWA 5IVBA 5FY1A 4V2VA 4D6QA 5A7SA 4CCOA 4BISA 5FY9A 3LD8A 5LWBA 5A3TA 4EZHA 4NUBA 3OPTA 3N9OA 5FPAA 5FY5A 4QU1A 4CCNA 4D6SA 5FPBA 5F39A 2OT7A 5FZEA 2Q8DA 3PUQA 5FJHA 5FPLA 5FYCA 5FZAA 2W2IA 2XMLA 2WWJA 5ANQA 3AL5A 5FY7A 5A1FA 2YBSA 2VD7A 5KR7A 5F5AA 4QXBA 2YU1A 4CCLA 4BU2A 5FWEA 5F3CA 4IGOA 4V2WA 3K3NA 5FZ1A 3N9QA 5A7NA 4CCMA 2YPDA 3PU8A 3LDBA 5FYMA 2Q8CA 2GP3A 5FXXA 5IVFA 2P5BA 5F3EA 2OX0A 4UF0B 4Y4RA 2XXZA 5F2WA 4DIQA 5IVYA 5A80A 4GJYA 5FYYA 5F2SA 5FP3A 5FZ9A 4QXHA 4Y3OA 5FYVA 5IWFA 5FZIA 2XDVA 5FYTA 5FP9A 3KVBA 3PU3A 5A7PA 5FZ6A 5CEHA 3KV6A 5FWJA
chains in the Genus database with same CATH superfamily
5TJJA 2CDPA 2XKOA 3SNMA 4XJ9A 3L00A 4GMP0 1L7RA 3TP0A 4PUSA 1MS5A 3IBMA 4I2OA 5GZDA 4N0BA 3OYLA 3J7MA 3P3NA 3IHUA 1GV2A 2OQGA 4NC6A 1OCTC 4PFOA 3BG7A 2K02A 4BOWA 5ABJA 2OQ7A 1YJKA 3OUHA 5JXHA 2YU2A 2PAMA 4H14A 5FREA 4ZDOA 1BEV1 1JJ6C 2FE3A 1OLMA 3Q0VA 1ACIA 5FOBB 1MMNA 2Q8EA 1JODA 3AC0A 4DO0A 2FDIA 2RNGA 5FGMA 4LKDA 2VC0A 3GO5A 4IRGA 3E6DA 2YU9J 3RSNA 4BJ6C 3FHNA 2XAHA 1TMF3 3HOSA 5JXGA 4B8XA 4X8NA 4CDQC 3RYRA 1P7IA 1WFXA 4NJ4A 1FP2A 3A22A 1G3SA 2ZX1A 2FDJA 1QNWA 3TP3A 1T95A 3A1YA 4DUVA 5C33A 1TWHJ 5F39A 4A41A 1YXWA 5HLTA 4A6EA 1U9OA 4LHSA 2A6YA 5JIUA 4D7SA 1RUOA 2VBYA 1U5YA 3AK0A 3O1TA 4QLCU 3LSTA 2BNNA 2FQ3A 5F1JA 4B48A 2RM22 4Y4RA 1H8AC 2DVFA 2ZX0A 1X3ZB 4QXHA 2ECBA 2WFPA 1GNYA 3S7IA 1H9TA 2COMA 4A6SA 2GNTA 5FOJB 4IV1B 2QQAA 1JYWA 3T8RA 3A4UA 2HQAA 4LBJA 2R1DA 1UZYA 2P3IA 2JG9B 2XPVA 5FXZA 2EA4A 3LPFA 1I27A 5IFPA 4AEJA 2DI3A 4LQRA 3BPVA 4UFJA 4IW3A 1FJLA 2VJJA 1XMXA 4HKOA 2DVBA 4UUSA 2QM3A 1UY4A 2HH9A 1G9BA 2DK8A 5J1YA 5TRDA 1RZ4A 3O12A 1K3IA 3F8NA 3MD2A 1T2XA 3BOPA 1PMJX 3E6BA 2CUZA 4ANJA 2XJVA 4JTNA 2WNUC 4RYDA 4GALA 1KQ9A 4MGTA 4ZHNA 1GZ9A 3ZYFA 4UUTA 3ZYGA 4FTSA 1JTYA 1DU6A 1OD5A 4CXXA 4L9JA 6PAXA 3AKZA 4NVPA 1LGBA 3CUOA 2E7XA 1RKWA 4OFGA 1QXRA 2OPWA 3WG2A 3TMOA 2HWB1 1ETOA 2CU5A 1O8PA 1WCKA 5HBAA 3SCHA 1ENHA 3MICA 1XU2A 3ZXSA 3KCYA 2HQNA 2DO7A 1PO23 2WWYA 1R7JA 4G9YA 4QQPA 5F3EA 4FQZA 4XQDA 2BDRA 2UURA 3GTOJ 4Y15A 3FUQA 2RS53 5I91A 3N7JA 2R041 1OUXA 3W9AA 2EZLA 2VU9A 5IOZA 4GH4C 1A36A 4AHZA 3CCVI 4PF5A 3CJQB 2C5DA 2CGNA 5FYUA 2ET1A 2DCTA 2LM3A 3HSEA 2OA4A 2CHHA 3VYRB 3H42B 3AFHA 2Q0OA 1CAXA 2HZDA 4CU8A 3D1NI 5AC91 2YSRA 3UL2A 3ZXKA 1G3YA 4RS8A 1ZYBA 1O3QA 5CKNA 2XHKA 2YU3A 2W87A 1Q8QA 2MHFA 4CDXC 4Y33A 5DUWA 3VLBB 3K4DA 3TDZC 1T8IA 1V9U1 4HG6B 4OHXA 1MH4A 4CH7A 3H35A 2XAJA 4P9WA 1PGL2 3O1PA 1V55H 3TOJA 5IPAA 1QJY2 2J5PA 1M06G 3OL3A 4WXDA 3CNAA 3ZFFA 4M3GA 5C6CA 1JZ6A 1QDCA 3R4KA 4D6SA 4KICA 2H27A 1VZ0A 5L9BA 1V5FA 4AVTA 2CUJA 5ICEA 3MLLA 3ISPA 5L7OB 3LMMA 2HWB2 4HKWA 1JZ3A 3GX4X 3WE3A 3JD73 2Y75A 3K9TA 5HCHA 5IT3A 4XLEA 2HBTA 3OYKA 2L2OA 3F0CA 3AJYA 1C3HA 1UXXX 3NJZA 3N9PA 1U0JA 2RVAA 3W5NA 3RYKA 4AI0A 3H0DA 4PI2A 1H89C 3LKJA 1W36D 4I3PA 2A3XA 4XDQA 1MBJA 4XLFA 1U8RA 2VC9A 2OV7A 2WS92 1HCRA 3M1EA 3AZVA 4HF1A 1RVF1 2XGDA 1LU2A 2X1CA 1WD3A 5FBZA 1C5HA 3NNMA 1JZ5A 1ERDA 4FAHA 3DXJF 2IVMA 2SBAA 2M0MA 3I59A 1W06A 4X6QB 1K78B 1VRH1 3JCUC 2ZGSA 2NMNA 3RPQA 4KWLA 3F95A 1VPHA 3V65A 2FBKA 2D3PA 4HNUA 4BXXJ 3CDHA 1LPQA 1YLFA 1B59A 1SVLA 1IDZA 3M70A 4UBGA 2DCEA 3POIA 4YEJA 3WXPA 3LEIA 1FIPA 2ZS6B 1HX6A 4Q0SA 3V0BB 3U21A 2HWVA 2W1OA 4IV1A 3H5RA 4OUEA 4COYA 4K1ZA 3ACHA 5JI9A 2HVSA 1JYTA 2KKOA 3ZMOA 2CW8A 1G2HA 3VBUA 1XDUA 1XE0A 3W6KB 5FLMJ 2JWTA 1LFPA 4DW6A 4KIFA 3E5XA 5CKTA 3FXUA 5ANNA 2GC2A 2EV0A 2XAGA 4XXAA 1NLQA 1E3HA 4HVOA 1EA3A 2CQKA 4R9AA 2QQ9A 3S16J 3T0AA 2FJ1A 1W8UA 5KC6A 3B6CA 3K4NA 4AIJA 1MSEC 5B4NA 2WYSA 5G04L 2HI3A 3RZZA 3QOEA 4CTEA 5EFUA 4RQPC 1ZLJA 3GTJJ 1CONA 1V70A 5DAQA 2FSWA 4B7EA 5BS6A 5E20A 4CDWC 4A6OA 4D3WA 4LXLA 2ETHA 4WCGA 4CP9B 1UQXA 1EV12 1OA4A 3WG1A 4P9XA 1UZCA 4U0YA 1OT5A 5IYBJ 1YO5C 2VVFA 1VAVA 4FQGA 4P55A 1ND2B 5BXXA 2VT3A 4BIOA 4IXLA 3G71I 1VQ4I 3LGRA 2L02A 5C7GA 2DUQA 1XPWA 4Q0UA 2E1MC 5L3DA 2Z16A 2W91A 3M1HA 2VTFA 2A5ZA 3TDUC 3MW3A 1QHDA 3IM0A 3HKZA 2OA2A 5GAEJ 3EJKA 4A3EJ 1GSLA 2R5YA 2IEKA 4Z1VA 4HSRA 1QJX2 2KIFA 2OUMA 3MKWB 1EJ9A 4DZPA 1IKPA 2OQRA 3I4MJ 1TQ5A 4BM8A 2V1DA 1H0MA 1D4M2 1FLIA 3GFIA 5FZIA 2OUHA 4XDOA 4BJTA 4AXOA 2EV6A 1NA1A 2Y34A 2YX7A 4AAPA 2G7HA 4CCCA 5C4WC 3BTIA 3ZQHA 4M3CB 2BZDA 4CCJA 4XK4A 1OOPA 1BK0A 4BXUA 4RBOA 2DA2A 3ZSKA 1H1AA 2JICA 3RG0A 2A6ZA 2EZKA 2X4HA 5JPMB 2X6OA 2J7MA 4UAPA 1LVAA 1YQ5A 2WAAA 1WWXA 4A2UA 1CPMA 4EJOA 3GALA 2ZPXA 2FD8A 2WZ8A 3MLJA 4XF1A 3IL2A 1ZYRF 5FROA 3TRSB 1XBFA 5E1RA 3IV5A 1RUH3 2L4MA 3OYGA 3S2HJ 2WV1A 1W5SA 1WW4A 3VB2A 4QDSA 3RZDJ 3KM5A 4H4KC 3K70D 1S3JA 5DQ0A 2V09A 4I3GA 4CE8A 1PNFA 4B1RA 2BVVA 5KBFA 4Q1PA 3UKTA 1HSJA 4BY7J 1GT0C 4IEZA 3KLOA 2XJSA 3FUOA 2QUOA 1QQP1 3B69A 1PO13 1RL3A 2IS4A 3OSGA 3NAPC 2AHQA 3KEYA 3WQ7A 4MO3M 4JX0A 1NCQC 5BPIA 2E71A 4OMDA 5CEHA 5JHFA 2XF7A 2P0WA 5FPXA 4II2A 1FSEA 2L9NA 2WO2A 5LA1A 4KMQA 3J9SA 1R71A 3DFGA 1NUKA 3DF0A 2ISZA 3P6BA 3JREA 5ABJB 3NL1A 3P3PA 1V5GA 3OYNA 2D97A 3GFLA 1XSQA 3CO2A 2E5NA 1FBUA 4CCEA 3SLIA 3QWLA 3ZYBA 1OR7C 5HLGA 1Y9QA 2VBPA 2UV1A 1WZ2A 3B5LB 5I93A 1TMF1 3VBRB 4BDVB 4Q4W1 2DVAA 5APAA 2JG9C 3AMNA 3V0AB 1FX7A 3POSA 4CPBD 3F8CA 4Q4X3 3G1OA 1XYOA 2BBYA 2G4IA 4YGDA 1CPNA 2IXSA 1B9NA 3MWMA 4XEZA 2DDUA 3E5UA 4OVEA 5FUPA 1REEA 3M4OJ 1POV1 2VTXA 2ZXJA 3DKXA 3CMYA 2KT0A 4Q0PA 2DFHA 1FV2A 4EZHA 1MW7A 2RS12 5IAVA 1TME2 3J7HA 2VL4A 1I1SA 4A3KJ 4FPEA 4R9DA 1IHMA 1SAUA 1G9DA 4KI5M 1NLRA 4H7LA 2CYFA 1O59A 2V1XA 1NOVA 4BLIA 4JQRA 2GXGA 2W00A 4Y22B 4YELA 3OBRA 3KVBA 3RPUA 4KYWA 2EFQA 3DU6A 1T39A 1DQ2A 4YG6A 3VB9A 2NVQJ 1MNDA 2KR2A 4X6AJ 3Q0UA 1IPJA 4QXKA 3WU1B 4CU9A 3H3LA 4OI0A 2PTMA 5A2QK 5KHDA 1LHVA 2HR3A 5GZFA 1S6LA 4LHLA 1RB8G 3A0KA 1OC1A 4S0HB 4I98B 4RR3A 4DY3A 3RZOJ 1HA8A 4M3EA 5A3OA 3I71A 4UOJA 2CW0F 1I9RA 4PHZA 2AGSA 2K9QA 3RZHA 1QH7A 4LITA 1D1AA 1TWAJ 3ZQIA 3WNOA 4WVMA 4P5OA 2K2SA 3VKLA 5AFBA 3GWZA 1F1ZA 1RUI2 2HVQA 4UUSB 1R4NB 2QDNA 2ZSIB 1EYBA 3JB8A 5FKOA 4CA0A 2P6HA 3HTSB 4OCTA 1LKXA 2PMZN 3PSIA 5CFDC 5H9RA 5GLTA 3ME2A 4XF0A 2CFXA 2WY8Q 2AUYA 2VZOA 5A1FA 3BDDA 1KDMA 1XG1A 5FRMA 3DWLE 4XILA 2E53A 1C5IA 3V64A 5B5EC 3ZQLA 1VFCA 1TME1 1UCRA 5IVFA 4OLLA 3ZP5A 4WBBA 1BC8C 4J6GA 2Y33A 4DEQA 2F4MB 5FYVA 3CUQB 4Y1XA 5FXVA 3I55I 1WJBA 3NARA 3RZJA 3R4UA 1G9AA 1OYYA 4JK1X 4GB31 2E51A 4GD4A 1RXFA 5LATA 1AKHA 1B8IA 1H9PA 3ZXFA 1EH8A 1BBT2 4KMFA 1WLTA 3IB3A 5EF6A 1MNEA 3ULQB 4KNCA 1QJX3 4F91B 1K45A 3M8LA 3U9GA 1NAEA 2FDKA 2X8KA 2ACJA 1IS4A 3ILFA 4AD9A 2E6VA 4RGXA 1XPXA 3M2MA 4IHSA 4BQNA 1SPPB 4NAOA 2ZMEA 1TL8A 3EB7A 1S0FA 5FZ3A 2RS33 4NNJA 1VQMI 2ZZQA 4PF1A 4J01A 1MGTA 4NB5A 4RQPA 4BKXA 4XIDA 2XB0X 1K5JA 3BZKA 3P9KA 3TNQA 1MBEA 4MQ9F 1X50A 1DQUA 2GMEA 2UU8A 3RCOA 3OPTA 5BNNA 1H6YA 4M6YA 4CYDA 3CJIC 5GPCA 4JKKA 1R1A3 1AL0G 3AP9A 3GF6A 3ZO0B 3VEPA 1FBSA 4CRQA 2O8KA 2QTWB 5TISC 1X2NA 4YPJA 4HEA2 5LEKA 4NO4A 2WT1A 3EHKA 2PJRA 2WZR3 4L9BA 2BY2A 1TC3C 2ARBA 3HN1A 3M8FA 5LBBA 3OSDA 1PIV2 4BHPA 5BYNA 5FYTA 1UU6A 4LGWA 1RHI1 4MGSA 2VCCA 2ENRA 3JBG2 1ZZCA 1WCMJ 4XHBA 2FDHA 1FX5A 5GALA 1V9U2 2ZJQF 3WF0A 4LIVA 4RDUA 5EEHA 2L0KA 1GXPA 4YLZA 1MS9A 2D98A 1TTYA 3RI4A 1LULA 2WTEA 3FBNB 4PCQA 1HQLA 2R32A 4QDQA 1AYM1 1GQGA 2ZJ2A 1A35A 3WG9A 2XC7A 1M4WA 2ZEYA 5FO7B 3VZNA 4RAGA 2AACA 1G9FA 2RR13 2CNAA 2NYXA 4BEHB 2YS9A 3RWKX 3VV1A 2B0LA 3L09A 3MZHA 3IN9A 2M4KA 2VXDA 1NE6A 1WMEA 1JU3A 4RHV2 1WBLA 3ZSMA 2WNOA 3IH3A 2MH2A 1TWGJ 1SBEA 5FZOA 3VDBA 4FASD 2PXJA 2A68F 5A7WB 1C1LA 1MQTA 2CDOA 4MIMA 4ZTJA 5IP6A 4TSVA 2EVXA 3ZN6B 3VOEA 4OZXA 4OIOF 3IT8A 4EJVA 2DCJA 3SQOA 3M3CA 4U7DA 3JRDA 2AEZA 2ICWG 2UWAA 1WH7A 1NH3A 3C7JA 4BA6A 2B7EA 4J19A 3FBIB 4A44A 4TYSA 3TEWA 1BLZA 2GNBA 4P5HA 3IWFA 5A6QA 3CCEI 1SCRA 3A0BC 2DCKA 2WSVA 4Y1VA 2B45X 2X09A 2NLRA 2EALA 2JDKA 5B66C 4COVA 4Y1ZA 2ZHKA 1HRI3 3SEZA 4U7BA 3EYPA 1W3VA 5LD2C 1RMU3 3QBQA 1JI8A 5FMOL 5FY0A 3EETA 1OQEA 1W8HA 4HBLA 4N9IA 1HW2A 5CZKA 5T5JA 2WS93 2PHWA 5C71A 3I53A 2NOJB 4M3CF 5EYXA 5T5LA 2B46X 4IE4A 2Y38A 2VE8A 3KHCA 5DN2A 1G8WA 1MMGA 4BXFA 4QX8A 1KS4A 2JE8A 2ZABA 3D8CA 5ERIA 2OJED 1BIBA 2HWC1 4AI8A 3AMMA 2JG8C 2HWE2 1DQ6A 4COWA 3DPUA 4YZ3A 5A6XA 3ZQQA 4MNUA 3J8F1 3L7WA 5IVJA 4TTGA 4NPMA 3V42A 3KD4A 1UHMA 2R6QA 5CQGA 4AQSA 4M73A 2R30A 3SFZA 3BWGA 4PBOA 1HDKA 3H3ZA 2WT0A 3VDDA 5FPAA 1XB9A 3SCGA 5LHHA 2WWJA 5ANQA 2LSOA 2D44A 2R7QA 1ZTRA 3AMQA 3V8KA 3IH4A 3VZJA 1C8M1 4FTHA 2WN2A 2CWMA 1VQPI 4F93B 4E2GA 2R5ZA 2B8MA 1NY71 2NP0A 3AZXA 4HL0A 3JSOA 1WUVA 3WG4A 4YIFA 1ENRA 5ICFA 3SQNA 4CYCA 3PUFA 1T33A 2J1AA 2VOKA 1EF4A 3LOBA 4M9XA 2Y6HA 5I0DA 2KZGA 4B44A 3CZ6A 1VBC1 5FQ0A 1WGPA 1NQJA 1RUG3 3VYTB 3C7FA 1OCRH 2V9PA 1B72B 3POBA 1RVF2 1DP0A 2LS6A 1MKMA 4Q26A 4YARA 2XONA 1YFHA 3IIIA 4NPRA 2DMNA 2WINB 2EICA 2VZQA 5ILSA 5FZOB 4X1EA 5A3MA 2IWGB 3WDXA 2OF7A 2ERFA 5HCAA 1DLCA 2PLV2 2HQRA 1LJ7A 2ZXIA 1DGLA 1W6PA 4GXOA 3PUSA 1LKNA 4UWDA 1USSA 3WT3A 5T3NA 4NWVA 4CUBA 3JSPA 3H0GJ 5JMCA 4I0AA 2B63J 5C4WB 5DAWA 1N47A 4W97A 5LWBA 1JKQC 1W8TA 4B3NA 4YW5A 4KG8A 1JZ7A 2GNDA 2E1OA 4K7JA 3T1MA 1QHGA 2QQNA 4XRFA 2HFHA 5EP9A 3UGFA 3ATGA 1ZH5A 1XCBA 3QH7A 2CQNA 2ME0A 4LNVA 2M4GA 3MCZA 2DLLA 4ZJZA 3ABZA 1OKQA 5T52A 4B4PA 5FO5A 2PQSA 3EUHA 2PJRB 2OU2A 2KP6A 1WLDA 5GZGA 3O6BB 1O7FA 3FXLA 1TW2A 1KGSA 4XC9A 2OS2A 3DPTA 4WXCA 5GP9A 1UU4A 1EPZA 3T0DA 4WX9A 3VDXA 3H9JA 4GKXA 4QPWA 4E4DX 1SACA 1X1PA 1BI3A 1TT0A 1ZBA3 1H0BA 4R4XA 5J98B 4YZ1A 5FYSA 1UCXA 1E5HA 2F5EA 4BQAA 3KZ4C 1J5YA 1SLLA 2GMPA 2FRHA 3VZOA 4QX5A 4AR2A 4BGDA 2VW2A 2VY0A 1S0BA 3HOUJ 3T3YA 1OCOH 2BOLA 1PUFB 1BVVA 1AYN1 1AA7A 4NIIA 3J7NA 2BERA 1WD4A 1CESA 3MN2A 1IAWA 4K1YA 2ZX3A 3OWTA 1O57A 1SC7A 4P9LA 1VBE1 3ML6A 1FY7A 2VMIA 3VD3A 3FZ3A 1DYPA 4ABZA 4JGYA 3WOGA 3U78A 2VCAA 3K4LA 1J3PA 3BPXA 1TP4A 3T1BA 5I0RA 5EJ3A 1WJFA 1ULEA 5C8CB 3BLYA 1Y56A 4I6ZA 2VPRA 5I0SA 5J48A 1VTNC 3GCMA 2V73A 4HX4A 3RSJA 3HB9A 1ZVFA 3CMGA 2GMMA 1AYM2 2EAAA 2X85A 4YFZA 3TYJA 3I2HA 4OMZA 2XXZA 3ZFGC 3ACFA 3MFKA 2IAIA 2JPBA 4JX4A 3LEMA 3KYCB 1TQPA 2PHFA 3WP5A 2XVCA 1DDLA 3MZYA 2YC4A 2W1WA 3R61A 1B35C 5BNGA 3LIGA 4XN3A 2KHMA 4GA9A 1IZ3A 5CVUA 4E7LA 1A78A 1MZ6A 1GDTA 3QYFA 3ZVXA 4I76A 5BNPC 4AG4A 1NXD1 4GKYA 3INAA 3DBHB 1REDA 2KZVA 1JJ8C 2AZ5A 2F48A 1TZOA 1A6IA 2VOOA 5LY1A 4UF0A 5A3LA 4XNFA 3ABKH 1H2KA 1R64A 1Y6IA 4CGZA 3GCWA 2E34A 2UY8A 2JRMA 1F36A 4LB6B 3H92A 2O7OA 2HVRA 3CDLA 3BALA 3FF5A 1Z05A 2P17A 4ET7A 3OYWB 4QPGC 1LNWA 5A3TA 1R4MB 1P4WA 1DCSA 5B2GB 3AG2H 2JB8A 1LR5A 4EV0A 3BGAA 3HM5A 1U5XA 3LA3A 2J1SA 3CEWA 4EJTA 2ZHNA 2YPDA 1W2TA 4LLFA 4GB32 1FEXA 4A4AA 1QVTA 5FFXA 1AF9A 1W6QA 4XZUG 1TNTA 3OGJA 2LP0A 1GWLA 4K6BA 2UYBA 3CP8A 1GOGA 4X0GA 3FN9A 4CDUB 1T6GC 4Y5SA 1LGCA 3IAS2 1QWRA 2WFF2 3S5AA 1RUC1 2MH9A 2E9QA 5GLVA 4Z07A 1RUD1 1N1YA 1Y1WJ 1CF7B 2BRTA 2WRAA 2R0QC 1USTA 3WTTC 4PIXA 2E36A 1YW8A 3O3KA 4CPBA 1LEAA 2EV5A 4FOQA 1AR62 3H9AA 2RGVA 1HIXA 3N9NA 1VNDA 3TWIA 2Q4SA 5CADA 2ZMEC 4MXVA 1GHCA 5FPVA 3PVBB 2ATFA 2PX9A 3OOXA 3MIFA 1Y8RB 1X8EA 1SHWB 4URTA 4MTDA 2FD5A 4O65A 2R7EB 1JHNA 4P96A 4HV6A 2EILH 5DUXA 5T5PA 1OA2A 3NJYA 4DQ2A 4N4OB 2GZWA 1JXSA 3CO7C 1BR4A 2WT2A 4QWQA 4Q8LA 4FO9A 3BVCA 4B47A 4HMZA 2CAVA 4ISRA 4IV3C 5JR3A 1F2NA 2TRTA 3REOA 3VBFA 3W6JB 1A8MA 3OGRA 3GFMA 3B3QE 4RM2A 4AIKA 4HFSA 2X53S 4RA2A 4E7JA 3SJMA 1HSTA 2LK2A 4PDKA 1E0EA 5FJHA 1U0AA 2WY7Q 4B1LA 3F21A 5D5UB 5BNPB 4LO8A 1NK2P 5JXJA 4V2WA 4IOAF 4NHMA 2MEV2 4RA0A 4A3IJ 5CA6A 1ORKA 5HXVA 1BBYA 3SFIA 1R1A1 5LBCA 3LF7A 3CCJI 2Y64A 4I0WB 3KYDB 2Y2ZA 4UY8I 1R23A 3M3EA 3BJAA 4RS5B 2EA7A 4M0NA 2D1HA 1WZXA 1RHI3 2TEPA 1R083 5IVCA 3ZIXA 1GNHA 4IRIA 1VBA1 5FY4A 3KFWX 1HXS1 1ETYA 4UVCA 2XLFA 3USUB 2HOSA 1RTVA 4CEYC 1Q8PA 3MUZ1 4L92A 1LTEA 4L0PA 5JUVA 2LVSA 1D5YA 1AYM3 1YJ9I 5K0UA 4KITB 1IKQA 1F5TA 2R043 4YNIA 3L9FA 1CN1A 3JRAA 1X4PA 1F4AA 1HOMA 3HN3A 3THCA 1XSXA 1ENXA 2VZUA 1K61A 3K6GA 4P9JA 2Y30A 1AR92 3OS1A 4IE0A 2PQ8A 3K75B 3OOPA 3ESWB 1KEXA 4MGZE 4BDYA 1J84A 1Y1VJ 3AP7A 1IN5A 1R1TA 4XJAA 1POGA 3QP6A 1NA1B 2J1VA 1EUTA 1UD1A 3BODA 1GUIA 4A0YA 3BTZA 5BNOA 1X2MA 3ZRGA 1FOD2 1J2XA 2IP2A 2NNYA 2HQ5A 5C44J 5FZ9A 2DPDA 1GXQA 4WM7A 5IJRA 4UXNA 1RINA 3A23A 3GYHX 3MW2A 2FCUA 5H20A 2LTNA 1QO0D 2ORXA 2L54A 4HOBA 3USSA 3N4MA 2YXSA 1AJOA 4K8FA 1BK1A 2VO5A 4A5NA 5E3OA 4P14A 4QHBA 2JIGA 2A75A 1I3HA 4EQVA 5D6EA 4DOZA 2K9NA 1U78A 2BV6A 1AR72 5HCFA 3BPZA 5LB6A 1S29A 4DNYA 1AU7A 3F9KA 4OI2A 2O8OA 2VASA 1PMHX 5FZ4A 1KJRA 2BVMA 3M7AA 1YQAA 2VJIA 4FTBA 4Y24A 4P08A 5A32A 4G6DA 1PIV3 1Y9MA 2ZO4A 4RGSA 2WFF3 1LVKA 1BQPA 2XQXA 3SDGA 2B4KA 1MJ9A 4EQQA 3DCQA 4LBQD 4AFBA 3NEUA 1XCVA 3ZMTA 2JDPA 2GC3A 2FZ2A 2VKEA 4EGZA 2Y31A 4LOTA 3A2KA 2WA0A 3RKWA 1AVBA 3BN6A 2ZB9A 5J3UA 1JHJA 1H9WA 3EXUA 3CCUI 3AYEA 3KEQA 1AX0A 4B29A 4CDGA 5BY5A 1OSGA 1P4XA 2VUDA 1W7PD 2PN6A 1ZA4A 5A7QA 4PJNA 2P6SA 1I50J 2G1MA 2Q5TA 4LEJA 3QU6A 3H0OA 4MXWB 1S72I 1SVMA 1VQ6I 2XLAA 4O7XA 5HI0A 2D3SA 4IETA 4UUVA 3HKZN 5FYIA 2LR8A 3SZGA 2WQ8A 2WDBA 5J40A 3RGBA 1GZWA 2BTVC 3LSKA 3UJQA 1R5ID 4EGYA 4YIRX 1XNDA 3U0ZA 2JJ6A 4HN1A 4K9SA 1JOPA 3M7GA 3HT1A 4IV3A 3ALQA 2RDNA 2UXNA 4XLPF 2Q8KA 1W9SA 1YITI 1YUDA 2QBXA 2YYOA 2V6CA 1XJAA 2KDZA 1BW6A 2Q1ZB 2W24A 3I49A 4FQ4A 4FISA 1RUJ3 1Z3YA 1MEC1 3O0WA 4PK4A 4BISA 1EKEA 1PO11 3ZPLA 4QU1A 4YVSB 5T54A 1Z1DA 2ZJRF 3ZSEA 4EM0B 1MZ5A 1J9IA 2A07F 5J1RA 1JTXA 5J4YA 2ETEA 4N53C 1BKZA 4GRIA 4JHTA 5J3LA 2EINH 4BHCA 1GWKA 2Z33A 4Q27A 4CU6A 2BHYA 5IATA 2JE9A 4HLTA 4ENKA 4JDMA 1KA8A 3WGIA 2CMPA 3PUHA 4RL7A 2D3RA 3U2RA 4FPLA 1SD5A 3KGLA 2NNNA 3VBFB 1LQ1A 1FYUA 4QKBA 2DA6A 3HPHA 5L7OA 5LY2A 2K9MA 1D0ZA 3OCPA 3OL4A 1X7NA 3AYAA 3UGGA 2DXIA 3ZKYA 3ZFFB 1AR93 3FM3A 1TLHB 2Y0IA 1WCUA 2W46A 4LK1F 1OXCA 1PGW1 2ZNZA 3GTGJ 5FP7A 4RB0A 2QSFX 3N9LA 3SC7X 1IV8A 1CAWA 3L2YA 3MMYB 3WTSC 1GP5A 2LRPA 2QKLB 4XM3A 4XSXF 3IRRA 1G6NA 4AVBA 4IEXA 3GGLA 3WX5A 1FOD3 2ECCA 3LSEA 1DGRM 2DJNA 1OH4A 4JRLA 3VBHB 3BQYA 3SDBA 1XN7A 2GXAA 2MW8A 3K4KA 1XDSA 1W6QB 2XRLA 3AKTA 1VBB1 5GM0A 3AFGA 1KGYA 1X1DA 1RIRA 1YIFA 2MLKA 2K5CA 1DLLA 3S2WA 5FPBA 1Q8SA 1UU5A 3F8BA 5ERLA 2R7SA 2QSGX 2L5QA 1MS1A 3VD5A 3LSIA 2YROA 3IWZA 2RDRA 2FBIA 2HKOA 3I5UA 4PJLA 4UV8A 4LE4A 3WDTA 3KB5A 2VXRA 5F2WA 3OMYA 2EH3A 1IG0A 1MD0A 4LFUA 2YFZA 3DPRC 2JDMA 5L3GA 4HANA 1XE7A 3THTA 5FPZA 2QA4I 1JT0A 2EFPA 1XNCA 2YHJA 4KIBA 1W2NA 4OI4A 4ES9A 3RJ2X 5B4XA 2EXKA 4M72A 4PQ9A 3H1WA 2TDXA 2P7VB 3GZNB 2YX4A 1G59A 1C8M2 1I39A 3MBWA 2O8XA 4ZONA 2Y48A 2NN8A 1WCDJ 3OF1A 4LJZF 4A7YA 2V72A 3CF5F 3OYMA 5KHIA 2IT0A 1X1BA 2O9LA 3GNEA 1ZQ3P 1OVSA 3EUKL 2W5FA 1YI9A 4DPNA 2FDGA 2RMU2 4KMUX 5EV7A 2FMYA 1L3LA 2ZMNA 3R4DB 2EXHA 3C7HA 4OUSA 2HOTA 2JDHA 2KD7A 3HGYA 4I30A 1W8NA 2V4VA 2RM21 3DPRA 1ENSA 5AIQA 4XMYA 3EPZA 3TGNA 2PAEA 4QPGB 2JZYA 4OYUA 2PHRA 3NWSA 1GU3A 5CFCB 1HRI1 2I5UA 1TNSA 2NOGA 4MEXF 2BGPA 4QGNA 2ZXQA 3S3OA 5FY1A 5C9AB 4EWEA 5DG2A 5D4SA 2R7WA 1W8ZA 3J7ZI 1OMIA 3ROUA 2WNUB 1TW3A 4N9HA 1LEDA 1FYLA 3ZMZA 5A3UA 4Z6YA 3PNTA 1V0AA 3G6JB 3LWCA 4ITCA 5KXDA 4R9CA 1UZVA 3BTLA 4QPYA 2MGQA 3HHHA 5D8KB 1VRH2 2D45A 4PJYA 4FFIA 4MGKE 3GEZA 3TL4X 4Q1RA 1K7AA 4Y5TA 3MUY1 3VBHC 3I2GA 4OAYA 1MIJA 2NRAC 3MF6A 3C7OA 4NHLA 2ZEXA 3Q8EA 4DUXA 3JBG3 4YVWB 5AIPA 4XFHA 4S2GA 2RS31 1HBXG 4QIWN 4ESJA 2OQ6A 3KLNA 3WTZA 1KYZA 3IPVB 1N3QA 1GR3A 2E7QA 4KN4X 4FFGA 1D7PM 1FPN3 2LY2A 4UW3A 1ETXA 3MQ0A 5TGTA 2LBFA 4R79A 5DMYA 1QQIA 2VOPA 3ERED 1IOAA 1ZLKA 4NHYA 2DOFA 2R49A 3VBSC 1T0FC 1EPWA 4B4QA 4PBPA 2WLPA 1EV11 3KSCA 5IK8A 1JZ4A 3SITA 3B9IA 1QZZA 2NVUB 5LA0A 4L97A 2P3JA 2XR4A 4KWJA 5D5WB 5SV5A 3L2WA 1AHDP 4LD5A 1UKRA 2D6NA 3RQ4A 2ZEZA 4FXKB 3CMEI 4NPLA 4MYEA 3OJBA 4M3CE 3H9QA 3PMSA 2DCZA 2XH6A 3WW2A 3ZFEC 4DEVA 5EPAA 3DCFA 3KPHA 3JD72 3LSRA 2JE7A 2HYJA 1Q3EA 4B1MA 4XF4A 3LQQA 2KA3A 3J7AY 2EPFA 2PEXA 2GP3A 2ZGUA 1ETKA 1RR8C 1S0CA 2KMUA 5HDNA 4Y3OA 3HNYM 5L7OC 4HK8A 5LASA 4ONUA 4IEJA 4G7ZF 1ITYA 3MGUA 3MKZA 3QP5A 3ENRA 4D1QA 1AXYA 1MZBA 2QYOA 2QQIA 3WW1A 3KZYA 4D7NA 5EXOA 3ZPYA 2R7OA 4H55A 1IN6A 2DWRA 3E1SA 2W1QA 3RPUD 1PO21 2VNGA 1HLVA 3NV2A 3OIPA 1PK6C 2RS32 4DRRA 4XOPA 3FZVA 2GP5A 4YRDA 2YB7A 2P5KA 4XN0A 1UOFA 1W7PB 3O0VA 4CEWA 1B4AA 3OYDA 3M8EA 5LHGA 4AYBA 5LBEA 2IA2A 2FCVA 3HBKA 4D6RA 1EAH1 4IHYA 3CLOA 1IXCA 1D8JA 2R92J 1E5SA 2XL9A 1ODDA 1UW8A 2STTA 3H9GA 1DZRA 3FFZA 4BK5A 5J47A 2EA2A 3V7RA 3S32A 3TAYA 3NO8A 3U75A 1IN4A 3PNAA 4JGZA 3BOQA 3PNYA 1CAVB 3PFYA 4IDZA 1XE8A 1Y7BA 1Z7S3 3EYYA 1IS5A 3CJXA 2GC1A 1Y0NA 2UWBA 1VBA2 1NCRB 2P34A 3G6EI 4IHTA 1HXS2 3PU8A 4FPOB 3FE5A 4Y1YA 5HV4A 3T5XA 5GLZA 1V9U3 3E7LA 1FZPB 4ZPIA 2XQRA 4FPCA 4DJAA 3QQAA 2YMZA 4JDNA 4H0EA 1XU1A 4FE7A 5HVQC 4OU0A 3PUIA 1YTYA 2DA4A 2I07B 4HDUA 2QBYA 2WO1A 1D1BA 1GQPA 3VBSB 1J7KA 1FOD1 4UBHA 2XGEA 4MGRA 1YJWI 1MBKA 1FWZA 3WTWC 5ISLA 3DBLB 2RG4A 3Q9OA 1SFOJ 1W28A 5TSWA 4YVWA 3ZR8X 2ZJPF 3VBOB 3J81K 3K3OA 4MOAA 4XCAA 3LSHA 1OYIA 1WCSA 4BK4A 2WJSA 3CESA 1GOFA 2MLGA 3JAMK 2Z4FA 5IK5A 1A5JA 4XMIA 3AL6A 1IV6A 4LLOA 2FEZA 4QKFA 4DXTA 2Y0SN 3NQHA 1UY3A 5B3SH 3RQ0A 2WABA 1C8M3 3IIAA 4XBLA 2MYSA 2IXIA 2OCEA 2G7UA 1O6UA 4YFWA 1WW7A 3WHCA 3HJRA 2X48A 2BGCA 1KU3A 3A21A 1XGMA 2A71A 3L2QA 1PIV1 2SLIA 3HEIA 2ZEWA 2PJPA 1D1CA 1A04A 3ZOBA 1R082 1YJLA 2YUEA 1BJAA 1RMU2 2VJXA 5K5RA 4IZZA 4E7IA 4QB1A 2W47A 1HKQA 5EHDA 4GWIA 2BWCA 2RM23 4E7ZA 5A7WA 5GKAC 4QT6A 1TNRA 3WU0A 1BC7C 1BI1A 2BW3A 1W9WA 1YQCA 2NM1A 2O03A 3CZJA 1CAUB 4E6KG 4F7ZA 1HB2A 3VPRA 3A02A 4C2MJ 3SXWA 1ULDA 5JFRA 3MV01 4QKDA 2VQGA 5L3EA 4MGQA 1REPC 4LO7A 4N43B 3TOAA 3DL3A 2DFFA 4GH4B 1FNNA 3TOBA 1B6AA 3S5QA 2TUNA 2X5IA 1K12A 3I2OA 4AF9A 1YYVA 1D0YA 3U1KA 1WW6A 1GICA 4YW7A 4CVUA 2K9LA 1SLAA 3KVAA 3I2IA 1SANA 1WPKA 2AEYA 4AQ6A 1A8DA 4A7ZA 5A3PA 3WU2C 3LAJA 3LAGA 2XV4S 3CCSI 2O0OA 1W8WA 3HJEA 2JXAA 1HDPA 3L9JT 3TEZA 1UZZA 1R5GA 4XOGA 1E5RA 1HF0A 2BY1A 2OVUA 3WF3A 2CQXA 4DY5A 1ZAOA 2KQRA 5FY7A 1G8XA 4G12A 3OV8A 2DQLA 4XQFA 4HBNA 3LA2A 3ZFEA 4AQTA 1ON2A 2B39A 5A6YA 3S3MA 2K86A 5K7ZA 2B9UA 2PAKA 3IUOA 2RDQA 1Q5OA 2VCMA 4ZC3A 2EK5A 1OI6A 5HNFA 1HJFA 1YCIA 1ZBA1 3K4AA 4M9SA 2QQVA 3T8TA 4QX3A 2LY1A 4XFIA 3HOYJ 3BTJA 2R7XA 4Z2WA 1GKBA 2WAEA 1PVC1 4QPIA 3P9IA 1RUG2 2VNRA 1UJ8A 1QOOA 1VBE2 5J37A 4HX7A 4FT8A 4DBRA 4XLNF 3WODF 4IEWA 2WN3A 4XXPA 3UJOA 2JDYA 3K4MA 4RFT0 1P9QC 4FETA 4I09A 1CD3G 4NDLA 2JVHA 4GQ7A 5E1WA 3D5SC 3LFKA 1XRUA 3RZGA 2C4XA 3I4IA 4S05A 1Z7S2 1VQ5I 1DYOA 2E60A 2RV9A 3GVAA 3L2UA 4IQ4A 2PN5A 2P3YA 1RESA 1NX9A 1LODA 3WY6A 3OTFA 4KBBA 2YGLA 2LG4A 4CUGA 5K8SA 1KRIA 1DIWA 3DP7A 2XPJA 2GIZA 5FZCA 4V1PA 3TW7A 5DCFA 2P5VA 1YQ2A 3KCCA 1RUI3 4NUBA 5HOOA 2Z9OA 4TV7A 5DUIA 4KWKA 4BYYA 1SFYA 1SD7A 3DUIA 3MPPG 4KT5C 4NC8A 4A3LJ 2MD0A 1V6JA 1XSVA 4PLNA 1PGW2 3K3NA 1BOAA 3J81Z 2RNJA 5JOXA 1A3KA 3BZ6A 4CUAA 3I54A 4RGAA 1JZ2A 5HPOA 2W94A 4A93J 1XSRA 2XHNA 1F9NA 1JYCA 2LROA 4BB3A 3BR1A 3GCXA 3DF8A 2VKDA 4AHYA 2Q2EB 2XBO1 2CWSA 3BR5A 1E57A 3PUAA 1AJKA 1YW7A 2HWD3 1D0GA 4NQWB 2EIBA 1WJCA 3CC2I 1DYKA 1K79A 3IDEA 3S2DJ 4B43A 3AVRA 1VBD1 1WBFA 3NV1A 2YBPA 5FFZA 2UZKA 4LG0A 1RXGA 4YVWC 3ZOIA 2VW0A 3SEQA 2EIGA 1G7YA 2E1MB 1S0JA 5KHHA 1YX3A 1KQ8A 1VP6A 3CQOA 3MVPA 5JI6A 2WO7A 2W85A 4M3BA 2P4WA 2CV6A 4N53A 2JSPA 5A2QZ 1ETWA 5L3CA 3TBDA 4M4PA 1FNYA 4XW3A 4KH9A 5F3IA 4E2SA 4L9NA 4Y17A 4C0BA 2QZ8A 3HUGA 5K9YA 4JHZA 4IQPA 2PELA 3NMBA 4CEWB 2FA5A 2R93J 1ACCA 4GO1A 3FM5A 5F1RA 3GHNA 1CQTA 2FHRA 5KR7A 2DOEA 2ME6A 5CYYA 5A32B 5KWRA 2V5DA 5FXXA 4XUQA 3V8LA 4AEDB 2RQQA 3ZXJA 1YRZA 4A7KA 4DRVA 2VLAA 5FKBA 3JW4A 3O8HA 1B35A 4GDFA 1R093 4COZA 5FLVA 3J7LA 4Y5Z0 2QQPA 3LA7A 2DK5A 2A05A 5KHJA 1LENA 4BHBA 2N8GA 2FDFA 3TO7A 1QU3A 3DXTA 4ON0A 5JPNB 4PGHA 4LHNA 2HWF2 3WNLA 5CG8A 1OKOA 5IK4A 1MBGA 2EZIA 2HPIA 3VBOA 5F0CA 1BN5A 2ZXWH 4XONA 4MTEA 4Z8BA 2JJ7A 5DCMA 1J75A 2DYRH 1MEC2 4FOWA 2F4OB 4F52A 5D8AA 2W48A 4GYGA 1STZA 4FVVA 1ULGA 3POFA 1UN1A 2FQPA 1W04A 4URAA 4FTEA 2Y26A 3IKWA 4Q4Y2 2VZRA 3TNPB 3VZKA 3HOZJ 2RKHA 2IGNA 3CIHA 2R4GA 4GCVA 3KT4A 4EEFG 5FD5A 3ZKUA 2XJQA 1NQDA 4P1WA 3WTVC 5GZEA 3ZR6A 4NIHA 5FY5A 1F8VA 4C1XA 4BY1J 3CLQA 1JOJA 4H3WA 1H8TA 2EFWA 2WZR2 3W3CA 3J8F2 3GZEA 5F5AA 3VHRA 3BTYA 1M1EB 4ZYEA 3WTUC 2F6CA 2VTXJ 2ZTNA 3WZ1A 1BJZA 4E7SA 3KHBA 2H1LA 1HKTA 3GYDA 4OOIA 2VECA 1UWWA 2BNMA 5F08A 5FAXA 2ZAAA 2Z5WA 4HX8A 3WHBA 3GZ6A 1ENQA 1T08B 4JP0A 2HXOA 2DA1A 5FUNA 4IERA 4TLGA 5GTHC 3AXDA 4GULA 5T50A 4UW4A 2RR12 3GTKJ 3NAPB 4K2EA 2JDZA 1RUJ1 2JDAA 1OD3A 3CTAA 2R7TA 1O4ZA 4OHWA 1IN8A 1V6IA 2H8WA 2CGOA 4IUGA 2W1SA 2XJUA 1SVOA 1AR82 3WVJA 5KC5A 4LK7A 3ZN1A 1FT9A 1ZRFA 5EYYA 2D6KA 5IW0A 5CKMA 4BE0A 4FOYA 2HWE3 1V6MA 2OZ6A 4E4HA 2LREA 3C8XA 3PNVA 1RUE1 4YWAA 1J59A 2HEWF 3K0LA 1D8KA 1YIOA 4BJ5C 3K7AJ 1ZZ8A 1R36A 1OR7A 1TNFA 2DJIA 1JE8A 5F3CA 2CQ7A 3TBIA 2B9SA 4MQVA 1RNLA 4LLLA 1WLWA 1HRV2 5HCBA 1B9MA 1ZGJA 2VODA 4H2AA 3KQ4B 3LPGA 2C1FA 3PJYA 1Z7S1 3BR3A 4XORA 1JOBA 3AJZA 2D6OX 1NZIA 3RRDA 5F5CA 5JZGB 4EYUA 5IK7A 3HOBA 2RMU1 3FHQA 2X9DA 2J1UA 2XB5A 2FZ1A 2P5LC 5HLHA 5EZHA 1S8NA 2J22A 4BS9A 5CVIA 3U4SA 1I1GA 2A6WA 4EJRA 4EATA 1RUI1 5FZLA 1HB1A 2JB4A 1UELB 2L4AA 1VIWB 2VKVA 5FBJA 2EZHA 2MA3A 2VOTA 3O5SA 4JOMA 4IQJA 1NHAA 4WZCA 4XUPA 1G9CA 3H8UA 2NVTJ 4ZTFA 2J1RA 3Q8BA 3TN92 1Z91A 5A6ZA 3NAUA 4C2TA 1GP4A 2EFNA 2XG3A 4DINB 1GOHA 4J25A 4CCKA 2P37A 4QM8A 1WMFA 5FLJA 4OAZA 2Y9YA 4OWRB 1DP3A 3PIOF 2KPMA 2VM9A 2BVBA 3WLUA 1QJU3 3WF1A 3OD4A 4IOCF 2R7DA 1C4RA 2CAUA 4UFHA 4XURA 2VD7A 2P3KA 5DM6F 2FUG2 1S1AA 2C24A 2Q30A 4YGEA 2LOOA 1DGRN 1QF3A 4YM3A 3EBRA 3NW4A 1VBD3 1S0IA 1UF2C 5KXEA 4RAFA 2PMHA 4JTOA 4UF0B 5HNHA 4AVZA 3RIRA 1QIQA 5IWFA 3V4GA 5D5XB 3DPLC 2CTVA 4BDZA 1YS7A 5CG9A 3ZQCA 3RMXA 2V1NA 4DBQA 1GANA 2VQ0A 4BXSV 1QOSA 1K5MA 3E1F1 1W8FA 3RDIA 3UKVA 2R7ZJ 2M1BA 2OTLI 2EIEA 2WQ4A 5JMOA 2V9VA 1VQLI 1SFXA 1QPMA 2BY0A 4RAYA 5IAXA 2E7WA 4M3DA 3ZQFA 5JR2A 1HQCA 5KXBA 4AVPA 3AB0A 4L9TA 1ZGAA 4IHVA 2XSJC 1WA4A 1POV0 4AHWA 4XBNA 1NZCA 2EXIA 3H50A 2QQJA 5M5YJ 2LRDA 5IVEA 1IC8A 5IFTA 2WB1N 1MR5A 3O14A 2GNMA 2BWAA 4IPAA 5BMZA 1J1LA 3ILNA 3RZKA 3CC4I 4JYKA 1NG0A 4YGCA 1OLRA 2QCOA 3PL8A 5JHUA 4LA2A 1BXHA 1R1ZA 1TZLA 4NHJA 2VBDA 4F3QA 1W6MA 1PM7A 5J96B 4MXWA 5C70A 3C2GA 2Y6FA 4I01A 4RGKA 4P9IA 4LK6A 1MVQA 3TEYA 1WI9A 3OGGA 3VZMA 3DYPA 1KS5A 1HW5A 1ZRRA 5FP4A 1ZGWA 2RN7A 5CVRA 1FOWA 3ITQA 5KK1A 3W20A 5FZDA 2GA2A 3V7SA 5EG0B 3IDAA 1OLME 4RGUA 1TG7A 2JK3A 3ABLH 2RAEA 1PM4A 2J42A 4KISA 2Z3YA 3CJIA 1IGNA 5AC92 3RZMA 1AL23 5JXIA 1T38A 2DTYA 1B09A 3LE0A 2QQUA 5L9RA 5C3SA 4ARYA 4XVHA 5LCWL 2VZVA 4WM8A 2K7LA 1W1WE 2VBWA 2VBZA 4BQXA 2OUJA 4OI1A 1KZHA 3KS7A 3N7MA 2ZOEB 4A3CJ 4Q5SF 3CF6E 3BJ6A 1FMVA 3FDYA 4CZZA 2G9WA 1TT5B 4PJJA 5HODA 2QQOA 2VJ5A 3D3AA 4CCOA 2IVIB 2M87A 5CNAA 4RM3A 4FHTA 5LRRA 3AG4H 5IYDJ 1DQ4A 2CS3A 3I64A 4KFCA 1JI6A 4ZZLA 3MV11 1E3OC 2V5YA 1W9TA 4BQQA 1V3FA 1R081 3I0TA 4Q4V3 4ZXKA 4KT6A 4HG2A 3WG7H 4AGGA 2C6YA 1O5LA 2X5IB 4EN6B 3JRCA 3QOPA 2XOMA 4AEDA 5F6KA 1LFBA 2XDVA 3BU7A 1E17A 2LH9A 1I5PA 3O7OA 4LO6B 4YG2F 5JSRA 2ZMLA 5FKLA 3RKXA 4LLNA 4XUNA 4HYEA 1YQ8A 1W39A 3BPSA 4QM9A 4LUMA 1CQ9A 4AI3A 1HQNA 2MG4A 3PDQA 5H9QA 5FZBA 2XBO3 1O5UA 1QXJA 4J1XA 2W68A 3OEAA 1IZ1A 1QKQA 5LHIA 2GSYA 3AAFA 1BR2A 5H6QA 1IN7A 2HXIA 3TB0A 2GU9A 1GP6A 4PLOA 3RVHA 2XGXA 4XCBA 1XTAA 2I8DA 3DKYA 4XBQA 4HLXA 2AREA 3OSFA 4YW4A 4CP1A 2TBVA 1IPSA 2E5ZA 3P9CA 3VHOA 4QPOA 1AR91 5DZGA 2HOEA 1H1IA 3ZCOA 2OBPA 2X10A 1CZTA 4A12A 1W0OA 4XIKA 5FB2A 5D21A 4HXCA 1R00A 1B1BA 3HNBM 3ZMSA 4OZOA 4PDWA 5ABJC 3U10A 1MS0A 1GYKA 4MGIE 1H2LA 1R1VA 2W82A 3BTAA 1DP7P 1TEIA 2MBFA 2R062 2OYZA 2LYCA 3A01A 1BJQA 3FMQA 3IH2A 1OUSA 3VBRC 5EEGA 1HDDC 5D8AC 2PG4A 5LRSA 5FP3A 3C1DA 4KBZA 5ILUA 4UB8C 1COV3 1LE8A 2HTSA 4JX5A 2ZC2A 3WP6A 3RI8A 3H1MA 2EFOA 4XZPA 1SLTA 2DFIA 3CCLI 2RJKA 4FOVA 1VRBA 4XR6A 1KDKA 4XL9A 5ACA3 1NCQA 5K5QA 4XAEA 5JDBA 4QDRA 5LA2A 1VLNA 2JG8B 2CQQA 4TWTA 4YZ2A 4OULA 3FXJA 1QJU1 1WI3A 1H9GA 4COUA 2RJLA 3BKZA 3RFRA 3B01A 4RHV1 2CO5A 4BCUA 4QX7A 3HRMA 1YJNI 3AL0B 3IC7A 1X33A 3BG6A 2BXYA 4R8HA 1UY1A 3KQRA 4JKMA 2V4AA 3BCAA 2C6SA 3MDPA 3CHXA 1UMZA 1SBDA 1NCRA 2G9GA 3RKQA 4MHUA 2W39A 3GXOA 3DXUA 1EY2A 1QEXA 3Q8FA 5F6FA 4RMNA 3BR0A 3LDRA 1TVGA 2ZX4A 2JD4A 2R7FA 1X3WB 3F72A 3J26N 4K20A 4F83A 3E6CC 5DCMB 2IW5A 1XC5A 4G3YC 1NTCA 5FYCA 5T5OA 2EJRA 1HW1A 1W9YA 4YYOA 3C2BA 4QQLA 4GGGA 1O3SA 4MH0E 3AKRA 1UAAA 4HF0A 4O3MA 4CZSA 1FTTA 1QU0A 4U36A 5FYYA 5JLWA 1RRJA 4HNTA 4IXAA 2X1EA 4LTAA 1CX4A 4BEHA 1CJDA 4CDQA 4PSWA 1HXDA 1SCSA 1S9HA 1K6OA 2YFUA 4WV8A 4EN8B 1LESA 5K0UC 2XWBB 5FCCA 2JENA 1SLIA 4XLAA 1S7EA 5HS9A 4NHKA 1S2EA 3LOCA 1FPN2 4N90A 3TEXA 4EVIA 4RD7A 1PNGA 3U1XA 4YW3A 3OYFA 1GQHA 4M4RA 4CO8A 1W2OA 3ZMDA 5JZGC 5D4RA 3Q0WA 1C1FA 4EZ4A 4WVWA 4MGYE 3F2ZA 3CCQI 1JUPA 3S17J 3GJAA 5F37A 3RI9A 2FQ4A 1VB2A 2AC1A 4Q2FA 3LSPA 2GOXB 5JVVA 5L36A 4KU7A 2Q1MA 2WA4A 3KT7A 4M71A 1O8SA 2FBEA 3AYCA 1D4VB 4B4CA 2VQAA 3VKOA 4NR1A 1CAUA 5BNNB 2ELHA 4WM7C 1P4AA 5C4JJ 4XUTA 4LBOA 5I8SA 3THDA 1NG6A 1AXKA 3CMAI 2A70A 1WCQA 4RLFA 1JMUB 2QF7A 1AOYA 1E2XA 1AR81 1IS6A 2E2JJ 4DIQA 2AXLA 1QGPA 3ZQ7A 3B02A 4NE9A 3S1NJ 1ZRDA 1MS3A 2DBBA 2DFCA 3LOIA 4BQ1A 4XFGA 3GBGA 3HBZA 2DMPA 5E8IA 2L9VA 1SMTA 4IEQA 3FK7A 4M9ZA 2XF6A 2A73B 3DTIA 1OFSA 2E7TA 3T2OA 1NK3P 1IRFA 1WSUA 4LO5B 1MS4A 1QJY3 4QPIB 4WVVA 2AS5F 4XAAA 3HT2A 1IF1A 2D6MA 3HEFA 3KP2A 2IJLA 4XACA 2GH8A 1ND3B 1ND3A 2EAKA 1UMQA 4LORA 1R9TJ 2VQTA 4AIDA 2YC0A 2ID6A 2CH0A 3M3QA 2ES3A 5GAHJ 5JOWA 5J1XA 4DUWA 1JKRC 3GJBA 1ALYA 3KX2A 1WKYA 1XMAA 1HN0A 2WUHA 1IXRC 2A6TA 5HDKA 4LT5A 5J09A 2W3JA 3K48A 3S7EA 1VBA3 4AIHA 4D0QA 2OT7A 1ZKGA 2F4LA 3SKJE 3ECQA 2HWD1 1N3OA 4D69A 5FWEA 4B8EA 2DA3A 1DGWY 2BBAA 2VXZA 1JBCA 5JSPA 4R1HA 3OYBA 1C57A 4RB2C 2TNFA 2KJBA 3ZN6A 2H94A 2RC4A 5JZGA 5D8LB 5EQUA 2NZ9A 3VFZA 2ELKA 4NIDA 3DTEA 3U4XA 1YHQI 1BEV3 4Q4W3 3T0YA 4CSWA 2E26A 4DQAA 3U07A 5GPAA 5BNNC 5B1BH 1FBQA 3WUCA 3KF5A 5BQTA 4MFDA 5JOZA 1VBE3 5EIYB 2G19A 3BT9A 1H4HA 1UXZA 2LDUA 1W90A 1U5IA 4DOUA 3N05A 5FZHA 1NE4A 3MIGA 4XE9A 1PP8F 2QQLA 1C28A 2UY9A 3DEEA 2L7MP 1W7PA 5ACA2 3R4SA 1ETQA 5FMOS 1POQA 1BVP1 5LBFA 3QACA 1UFMA 5CFDA 1QJU2 4ES8A 3D6EA 3ZSJA 2L9SA 1JGSA 3M3IA 5IT9Z 2Z1DA 1NYWA 4OIRF 1APLC 4ZS2A 5L3FA 3BR6A 1ULYA 1BMV1 4Y26A 2Z5UA 1MVEA 3PVNA 1UMHA 5A7NA 1S0GA 2D5VA 3UNGC 1LOBA 1JUSA 4QQOA 2Q8CA 2ZFWA 1DZTA 3BTXA 1WJAA 3FIWA 2X6YA 4WM8C 5LGTA 4AYUA 4QMAA 2G0EA 3JRHA 3V0AA 2JUGA 3WTXC 4RQPB 3FXOA 1EV13 1P8JA 1JYVA 1WMDA 1S55A 1WMXA 2L01A 3VD7A 1AL21 3R05A 2FXAA 3H8RA 2A5YB 4OQ9A 4KU8A 4H7MA 3O1VA 1LJ9A 3TEDA 3SEPA 2VZ3A 3EMRA 3ASNH 1OA3A 3AMHA 5C3PA 1QY4A 1VMJA 2WQZC 4BQ5A 4PI0A 3ZYRA 3KCXA 4X8PA 1NXMA 2NQYA 2GLOA 4HQMA 2UUZA 5DEQA 3LNQA 4Q0QA 5DDJ1 1X9TA 4PQQA 2VMDA 2LBFB 3CUQA 4HDVA 2VKHA 3IPVA 1W36C 4HT1T 2L9LA 1J3QA 5K7HA 3N9OA 1CAVA 4JGZB 1VB4A 3MPBA 1FMD2 1OVPA 3VBOC 4OQ8A 4LOSA 2VBBA 1LB2A 1VQ9I 2Q8OA 3SMHA 4FPJA 4YM2A 1N75A 1RUD3 4Q5OA 4BQ4A 1XNBA 4IV3B 3PO3J 3AFKA 4JAAA 1X58A 2VOXA 3O0XA 4KNYA 5LZ6A 4AK3A 1VBC2 3J80K 1FNZA 4MZUA 1FATA 4ASLA 4AFCA 4PDWB 3BJOA 2ZGRA 3PVOA 1SD6A 3D5LA 1RJ7A 3NSTA 4ASMB 1SFPA 4YG3A 5I8TA 2VPVA 1QJZA 3OPZA 4GH4A 1VI0A 2M7AA 1VAKA 2R3SA 1LEBA 4U0WA 2AXTC 1W4MA 2L9RA 3ZN0A 5CFCA 4W6WA 2KIUA 3KETA 4Y52J 2BY3A 4QPGA 2Y8KA 2R072 4XHXA 1LGNA 2IXHA 1OH3A 3WV6A 2MSYA 1L7QA 2WADA 3X29B 1DZQA 3IAM2 2ZACA 1JUIA 3HUGB 4RAZA 4XLCA 2IC1A 4HVQA 3NKTA 3SHFA 4O9EA 4DFSA 2IA0A 5BV6A 4UT5A 3BCBA 3HRSA 3S6PA 3LCPA 2BP6A 4ZH4F 5CLSA 2Z69A 1QDOA 1XS9A 4HVRA 4F3JA 3FXRA 1HLCA 1P92A 1YWKA 1X82A 5FZEA 1RUC2 2QDRA 2VNOA 2EBIA 4XSZF 3Q8AA 1KQ0A 4J00A 3AZWA 2ZJCA 3I2DA 1J3RA 2EXJA 2ESNA 2CYYA 3LB9A 1OQ1A 3HAGA 5CQEA 5C5UA 4QGMA 1X1AA 2CUFA 4YZ5A 2K4BA 4OHZA 2HPMA 4QQ2A 3OGVA 5ILVA 2HGCA 3F22A 1YS6A 3I4NJ 2JG8A 2P81A 2VMGA 5FKCA 1FOKA 1H6XA 3OD0A 5LK7B 3ZXEA 1NCQB 3PTRB 3BC8A 2JKBA 4C9YA 4XJUA 4ZYDA 4FE4A 3O8GA 2H09A 3HOTA 2LKPA 3FBYA 4HW0A 3EO6A 1UPIA 1QJEA 4LK0F 1MH3A 2XAQA 1U5TB 1BIAA 2VUJA 3ZN5A 3HSFA 4QGLA 4QU2A 3SKVA 2IBDA 1ZZ7A 4C91A 4XKBA 2HEOA 1DHKB 2JWPA 3CJRB 3HYIA 4XYXA 3IZOA 2ZGNA 2DODA 1WHUA 1OCZH 4QX1A 1Y3TA 4S2DA 4RR3C 3KE2A 4BU2A 2ARCA 4OMCA 3ZR5A 2LC2A 3ZFFC 1HRV1 3ZSLA 3HBLA 3K4ZA 1ZBE2 1O4YA 4L99A 2JA5J 1FI2A 4ZYGA 2XLGA 3THPA 1H2NA 1IG3A 2M8GX 3NV4A 4DMIA 3RQIA 3K70C 3MFAA 1HRV3 2VXJA 4CEYA 1TE1B 2R1BA 2RS13 3LQCA 2EIMH 3DECA 5F5IA 1MACA 2RREA 3FXMA 2PHTA 1ZARA 3LAPA 1W0UA 4EE2A 1OF4A 5E79C 5LK5A 2KM2A 1OYWA 1IJWC 4ARXA 5EZGA 1Q56A 1RMU1 4RLQA 1LCLA 1I5ZA 4JBAA 4AEKA 5LLQA 3WNPA 1QPIA 1HN1A 2JVGA 2YY1A 3ZMUA 4XETA 2WNUA 5JCTA 3AVSA 2JUCA 4A3FJ 4ISQA 4E27A 4DYQA 3GTPJ 1YG2A 1P6RA 1SDDB 3ZYPA 3ZLIA 3T30A 2LUWA 5E18F 4LG3A 4CDUC 1Z6RA 5J8CA 3AG1H 3I2FA 5FJKA 3MIHA 5FV3A 1QMJA 2WBMA 1ZX5A 3JBG1 1IW7F 3FXQA 1GZWB 4UVAA 2ILMA 4X6RB 1D2QA 2WNVC 1LDKB 2WWSA 1HB3A 2E31A 4I0BA 2D1VA 4C1WA 3QPTA 3POEA 4RFRB 3WG3A 5M5XJ 3BU0A 4IKFA 4Y7NJ 4NOTA 1N77A 2LNBA 1K5MB 4L5JA 2EQRA 2VQHA 1S4CA 3JUUA 3I3QA 1R6RA 1PX3A 2UWCA 1IQDC 3S8PA 3HWJA 3IKVA 1DBNA 3K10A 2V1UA 2IS2A 3S3NA 2WFF1 1Z0XA 2R7RA 4LBKA 3IMNA 5LEJA 1AYN2 2BJSA 1ND2A 3W59A 2BV4A 5DAXA 4M0HA 2YBKA 3PQJA 1PVC2 4FCYA 3QYBA 3OY9A 5M0TA 5A70A 3T1LA 2AR6A 4GFBA 2GOMA 4M01A 3BTCA 2E1NA 4YVSC 5FY8A 2BXZA 2DQRA 5DUUA 4FAGA 4YRVA 4L11A 1TQIA 4IL7A 2YR2A 2YUSA 3NRVA 1ONAA 1ZBA2 3MF9A 2VBXA 1W8OA 5DABA 1XSDA 4BNCA 3N7LA 2EF6A 4JVAA 4LKEA 1VBC3 4GWNA 1YI7A 2CY6A 1J58A 4Q4V1 3CQZJ 4XKCA 3UGHA 1T6SA 1RUG1 1JYNA 2L7KA 1QJY1 3N3HA 2CU7A 2V79A 4EJUA 3POWA 3E5QA 1RUF1 2COBA 3RJPA 1DU3D 2F5VA 3ZXAC 4NROA 3BIWE 4E8DA 4GXLA 3KEOA 4D6QA 2ORZA 4XKVA 4UFLA 3OBAA 3OYIA 4YVSA 5KXCA 3LFMA 3H7YA 4CUCA 2HLEA 2W2IA 3PJQA 3AYDA 1UY0A 2ZA9A 3VDCA 1U9NA 1SBFA 1ZRCA 2HWE1 3B93A 4RSUA 4KJZA 5C9AA 2CG4A 3T09A 1S5LC 5SV8A 4Z2AA 2MC4A 3DLAA 2VONA 4AW7A 5L19A 5BNOB 2V7FA 1XX5A 1ULFA 4IE7A 1QGLA 5E89A 5IUQA 1SZBA 3APBA 1Z7UA 1MPXA 3ETPA 3FHAA 1XOYA 4XJZA 1IRGA 3MKLA 3LFIA 5AFEA 2Y6KA 2BHZA 5FTTC 3HQRA 1VQOI 5FUIA 5FZ0A 2JEMA 4CICA 4U0VA 3WQ0A 3ZX7A 3C7EA 5IVVA 4MUVA 2QQWA 1GNZA 1DU0A 4BQOA 4L18B 3ZQGA 4K8RB 2ARAA 1Z3XA 1W0TA 2QEXI 3GF2A 1G3TA 1TWCJ 2DUOA 3JRGA 3V7CA 1PP7U 3E6MA 3CDZB 1RUH2 2RMU3 5FZ8A 1SMYF 2GDFA 4JQFA 3M9AA 5EYRA 2LMDA 2NMOA 1NLSA 1JGGA 5IYYA 2I2SA 2K46A 4YM1A 1XQNA 4BQ3A 1F4HA 2PMWB 3JQWA 2X6WA 1LDJA 1JS9A 4D94A 3ZXGA 2BQPA 2BGOA 1IDYA 2JMWA 2A7AA 5LA9A 5M3MJ 1SEUA 3WW4A 4DZJA 4OMYA 1DPRA 2E1CA 2NAZA 3HRTA 2A5WA 5DG1A 2JPCA 2XKPA 2RQPA 3OR1C 3VSKA 1F31A 4A3GJ 4GJYA 2XGCA 2C9KA 2AENA 2VB6A 4LJHA 2RDSA 4IF4A 3K46A 4A3JJ 2VZSA 4CDQB 3Q3SA 1LHWA 5GADJ 1QA6A 3URFA 1FV3A 3DYOA 2QSHX 2Y60A 2WV0A 1KD7A 1US2A 3UR3C 2GN3A 5KAFC 3J7AO 4UI9L 3I3LA 4JV4A 2QFEA 3VKFC 1AUYA 4QX2A 3HD8B 2V4JC 3HQUA 2XF5A 1SEFA 2WC2A 3CKHA 1I3AA 1LHOA 2JDNA 2DVDA 4WM8B 3AG3H 2HZTA 2VMEA 3HOWJ 2AQEA 1JZ8A 4V19K 5LGNA 2DN0A 1I1EA 2M45A 2YGMA 1H30A 5BNQA 4I7HA 1XNTA 3NKGA 2O1QA 2BNOA 3DBRB 4R52A 1FP1D 2RS11 3OG2A 4E8CA 4CCNA 5K7PA 3QYEA 2K0GA 2K9SA 3PUQA 4Q4W2 4YFNF 3H3VK 2Z79A 5FZAA 3HPGA 5FIXA 1O3RA 4OINF 3JRBA 5EEAA 1T6BX 5E3MA 4IGOA 4CXWA 4JGYC 3WNKA 3LDBA 2RVCA 3GFJA 3E3VA 1UAIA 2A6EF 3P7NA 2K4JA 3D5OA 2NYYA 4XBFA 3LEGA 3KV6A 2IUWA 3USUA 4MLOA 1P7JA 4MHRA 4Q4X2 1Z6TA 4A45A 3MEPA 1ND2C 1KQRA 3L2CA 2VCBA 3SXYA 3VSLA 3H36A 5IT9K 1QVUA 3Q9VA 3KMHA 2JTVA 2DMUA 1LECA 3WHTA 3KZIC 2RJ2A 3FLPA 4A3XA 2M0CA 4YSFA 3QPLA 3WP3A 1QBJA 3BB6A 2A6XA 2ADEA 5BPXA 1UYYA 4HF2A 2LKXA 4PT6A 1NG7A 1PMIA 4AVCA 2M5WA 4A6DA 4FPYA 1PVC3 1W6NA 2P7CB 3B00A 4YZ4A 5CPRB 3ZDVA 3HIFA 4R9BA 1K78A 2X5IC 4BAYA 1PDNC 1AZDA 1HV1A 2JT1A 1JKPC 2QENA 4NQWA 3G2BA 2ELJA 2ZGTA 2L7ZA 3JTHA 5KHGA 1U8BA 3VD9A 2YV8A 2R063 3OYCA 3ON7A 4W50A 3AL5A 1R49A 2CRGA 1X4OA 4UFIA 3VODA 3SH5A 3ACLA 2DCYA 3LIHA 3GM8A 4UB6C 5KNLA 3M1CA 4IRHA 2D43A 3B94A 2W84A 4RS5A 4FSJA 2NS7A 3VYUB 3M07A 4CXFA 5JSOA 1H8VA 4ZYHA 3GW2A 5CVVA 4LBMA 5ED4A 2PLYA 1LOGA 2LALA 2H1KA 1MJAA 5BOXA 4I99C 5FJ8J 1Q43A 3JRFA 1ULPA 3K4CA 3R0JA 4B3AA 2P6TA 3WGHA 4ATFA 1AHSA 4QB6A 1H2MA 2M34A 5FP8A 2OZUA 4P9GA 2FNAA 4II3A 5C8CA 4AWXB 3UKNA 5FZ7A 4AI1A 1DUXC 5F6LB 1SLBA 1I6XA 2DDAA 2XVKA 4QAWA 3PUBA 1JN2P 3L2HA 2ZXHA 3M8JA 5CBLA 2QE3A 3P1IA 5FZFA 5L3BA 1NY72 4AZZA 2RS51 2ZSHB 3F8FA 1K4SA 4C30A 4TLFA 1MNMC 2HEYF 1PZ9A 4Q4V2 2YC2A 1ZK8A 3WDYA 3FLTA 4WM7B 2ZMKA 2L7FP 2VR4A 4HPQA 4XRSG 1WW5A 1YO8A 1UOBA 1D5VA 4HPKA 3VBUB 4HKLA 2BBVA 3LSJA 3GTQJ 1UY2A 1X8MA 4A3ZA 4KDPA 1OISA 3JR9A 3CCRI 2Y0MA 2AYHA 1T0FA 3V0BA 2KISA 2UXXA 1HC8A 2HTJA 5JLXA 4IEPA 2ESHA 4QSHA 2K3PA 2H6CA 1MBHA 4M6VA 2EWNA 1PUEE 3IP4B 4NIAA 1JW6A 2W08A 4XPVA 4YW6A 1YW9A 3PU3A 3PQKA 4JDOA 2KXLA 1YLLA 3OGSA 2BPA2 1E3PA 3S1RJ 2IFRA 3UV9A 1C0WA 4GMP3 3NWTA 5AONA 4XRSA 2DYCA 5FFOC 4BE2A 4PCRA 1W6MB 3HXLA 2C9AA 2WB1A 3AP4A 3H5AA 3FMGA 2LF7A 3VDAA 2MNGA 4ZY9A 4D8MA 2Q2EA 3CD6I 1SD4A 4QXCA 5F3GA 1VE0A 2H8RA 3T4HB 3BROA 1ULOA 1AX1A 1OQYA 1YFXA 3CC7I 4AI9A 2WO3A 4YW1A 1UZ0A 1RKTA 3UESA 3VWBA 4C3IJ 3FJSA 3QD6A 3HVDA 4BQ2A 3JTGA 4GYIA 2VGDA 4AVVA 4D7TA 4E70A 2YG0A 3N36A 3ZGKA 2JQ7A 4MFEA 2ZGMA 2OW4A 3DN7A 1YNAA 5FY9A 1HB4A 3NAPA 4K21A 3FMRA 3WNXA 1JYXA 5H2FC 3OB8A 2J1TA 4J1WA 3KP5A 2BVLA 3HGGA 1D3YA 3AZZA 3ZYHA 2B42B 5BNPA 3W5MA 1JUHA 2A69F 1AR63 3C2HA 4BE1A 2PFWA 4CA9A 1WKMA 1SFUA 2VAUA 4G8XA 3K1PA 2JA6J 2KIQA 4BBSJ 3QPHA 4WVZA 1S2KA 3HG9A 3I8TA 2F5DA 1YIJI 5J8FA 3C2UA 2VC1A 1SPPA 2WIIB 5IT6A 1UHWA 3A7QA 1BHGA 2JA8J 3I3BA 3DEUA 2WAOA 2W95A 3TO6A 2MPFA 1Z7LA 2XASA 3OR2C 4A69C 4CZCA 1CWPA 4DXSA 4YG0A 2D6LX 5B1AH 1BI2A 3QH6A 1R58A 4HSLA 2HNHA 2O8QA 5FYBA 1OCPA 1WH5A 1L0OC 1YOVB 3VN4A 2DW4A 4O5VA 2XVGA 3N97A 4IE6A 2HYKA 4XKWA 4CDXA 4IX7A 3R60A 4DS0A 3CCYA 1FAYA 3B6AA 3K69A 2UWMA 1O3TA 4S04A 1OPCA 1U5TA 3BZCA 4TXWA 2ISYA 1MMSA 3AKSA 5D8AB 2X29A 2ZKLA 4P9FA 2EIKH 4QHOA 4WF2A 1L3JA 3VL8A 4D5CA 3CCMI 4NRPA 4N8MA 1QZEA 2DV9A 4XFBA 3H5NA 3G1MA 2M30A 1W3XA 3TN91 1BMV2 1YYNA 3MIEA 4HN0A 3DKWA 1UO9A 2HDCA 3F6OA 1W03A 2ZGQA 5JOYA 2G9FA 3NQOA 2C0ZA 1OLQA 1RHI2 1YC61 3GXUA 2XIGA 1W6PB 3ZN4A 4BQWA 2XB6C 3KP3A 4XUOA 3OOUA 4ZZ8A 2PBIA 3W58A 1IO2A 4G6QA 2V26A 1YIPA 1PGSA 4WWCA 2M7BA 2FX0A 1DG6A 3WNNA 1HQWA 2FNPA 2IPQX 2PLV1 3D82A 2ZZJA 4P00B 4BLJA 2VUCA 3W21A 2M2EA 2XJTA 5E6HA 3CBNA 3FX3A 1REFA 4AM3A 1V5EA 4HSTA 4AGVA 2BW3B 4TN7A 5GLWA 2E33A 3AP6A 2VNVA 2VMFA 1CIYA 3CJTB 1GWMA 2NPIA 1WJEA 2XVLA 3FLRA 1TMF2 3I58A 1YEWA 3IAPA 1UX6A 5F9TA 2LFBA 4LHKA 3FBMA 1MZFA 3I2KA 4IEYA 2FCTA 4CEWC 3ONQA 1NA1C 4NN0A 2ADUA 4BPZA 3SZTA 1D4M3 1COV1 3BG5A 1UIKA 1AYN3 5JR7B 3W6VA 3LL7A 3GBFA 4U88A 3WE2A 5K0UB 2BUKA 3EQEA 4P02B 3OY8A 4AFMA 1BOBA 4W4ZA 4PIZA 4O6JA 2LTPA 1OFCX 1LOFA 3J80Z 5L73A 2R0HA 1FYMA 2P4EA 4NRMA 4HA8A 2A3WA 3QCWA 5EJZB 2WAFA 1FMD3 4C3HJ 2R042 2FOWA 3D0SA 1VBB3 4R4ZA 4ENJA 3B9CA 5FQ0B 2D5HA 3EUAA 1WVRA 5C3RA 4SBVA 5FDBA 3CJNA 1F5FA 1VR3A 3D4KA 1GV5A 1SDWA 1BEV2 4CYCB 1WA6X 4M3FA 1JYIA 2QQBA 4JGYB 4ITVA 1MMAA 4C90A 2VQCA 3WDWA 4DB5A 2ZFUA 5DDGA 2HYXA 4LBQA 3HOVJ 5JIAA 4ZDPA 4B7KA 4YIIA 4BL0B 3NNLA 4HK9A 1LUJB 4EWDA 1OF3A 1V6LA 4O9GA 4Q4ZF 4W6XA 1N1TA 4E9KA 4QWNA 3FK6A 1LOCA 1RETA 2XPWA 1IG7A 1QQP3 1ZG5A 1ASJ3 3EQLF 2R071 2QBYB 3VBSA 2KDOA 2OTJI 1H8TB 3POJA 4HONA 4LO4B 4L2NA 4YFKF 4D7YA 3C3WA 4AAXA 2K9ZA 2WLQA 4OHYA 4LKFA 4XABA 3ES1A 5HLIA 1H1MA 3KV5A 5G05L 4HAMA 4EMSA 4YM0A 4BH9A 2MFZA 2JDUA 1HJGA 3HSRA 3MFCA 4ENNA 3WW3A 1GVDA 1ZA7A 1JHFA 5E3NA 3WD5A 1TME3 2QWWA 1S0EA 1X19A 4NC7A 4AE2A 1X3UA 1ETVA 4GMP1 1MJBA 3I7DA 4XJWA 2K27A 3G4SI 5FPLA 2WS91 1R091 1FOYA 1IQAA 3POGA 2GN7A 3AM2A 2OZJA 1ZR2A 3DGTA 1GZTA 2JECA 2NVXJ 3K2ZA 2M9HA 2JX9A 4Q4X1 5FZ1A 4N4NB 2JA7J 4BMEA 3OY8B 2E19A 3PM1A 3JCIA 4LKSA 4AL9A 4FBFA 5F2SA 1CF7A 1XXNA 1POV3 5EGOB 4CP0A 3I3EA 3UETA 1JT6A 5E8AA 4ASKA 1EAH2 2Y69H 2P2KA 5IP7J 4L5EA 3NNGA 5CIRA 1OOPB 3V56A 4L0YB 1RGSA 2A3SA 2VVEA 3MO4A 1F43A 3MAJA 4LUKA 3L2VA 4IEUA 4ETSA 3KYLA 2GM4A 3HDDA 3WHUA 1BBT1 2VZPA 4OUMA 2XAUA 3WCSA 4JRAA 3LFUA 5CFDB 4KWUA 1LHNA 4Y4YA 2F5FA 2W9XA 1URXA 4M6XA 3MYXA 3I2JA 1QXPA 4QQHA 3K4JA 3CUQC 1ZZ9A 3NVCA 3RNSA 1AR83 1YHFA 4ZU4A 1F35A 2R5YB 4N43A 3WQ1A 1DDNA 5EJ1B 1JHHA 2XUBA 4F55A 4RGRA 4NHXA 2UYAA 3BIEA 3O1MA 1UOGA 2IGKA 2LF8A 4XIOA 4LG0B 2ID3A 3HHGA 2G9ZA 2HU9A 4FPHA 5BUVA 4Z2YA 2BFUS 4G94A 3GBWA 2ZBJA 1Q8OA 1W05A 2QJVA 5KVRA 1Q1HA 4ESFA 4AQ2A 3JQXA 1UB9A 3WDVA 3WR0A 5DDJ3 4G6TB 2HS5A 3VDDB 2W7NA 3BOWA 1U2WA 1ZBE3 3N9MA 5A7PA 5H9SA 2VOVA 3D0JA 2X6XA 4WXHA 2RR11 1LDDA 4ASNA 1RYYA 2VN2A 1RUH1 3T08A 5F32A 2DU1A 1SFEA 5CISA 5LGUA 3N35A 1PK6A 1EP0A 1G86A 1EH6A 4IGPA 4GJZA 1XYPA 2A6VA 2DURA 4KG0A 1MMDA 3CL1A 1W0NA 3VBHA 2DA7A 1LEMA 3RKYA 5FYZA 1IRXA 3BQZA 4NIGA 3KP6A 2GH2A 1V6OA 1LHUA 2PA7A 3CP2A 4DGWB 4E2QA 2DTRA 2QVSB 4UHTA 5K5OA 1GLNA 2JD9A 4IESA 1RUD2 2D2WA 2D93A 4KGQA 4B4RA 1Z0HA 1LOEA 1RUE2 1CAWB 1UNBA 1KU2A 2VVDA 4M00A 1SQ4A 1DF0A 3MHZA 3O1RA 2B7YA 4V2VA 1R1A2 2X0LA 2Y6JA 3VD4A 2QZ2A 2X1DA 3ERMA 5FK7A 2FBHA 2M3AA 2HYFA 3GZ5A 1DQ5A 5IY5H 2VW1A 3M4FA 2FF4A 2KLOA 2MABA 3NJXA 3OS2A 4FI9A 1DPUA 2CSOA 3H1CA 1LAJA 1AKHB 4AUXA 4IVNA 2DBIA 3ABTA 1CX1A 1RR7A 1H8TC 1ZG3A 1ULCA 4IEVA 2A1XA 4ZKTB 3TO9A 4OIQF 2OC6A 1Y43B 2I45A 3UKGA 4JC1A 1D4M1 2BOIA 3UYJA 1IXSB 1C8NA 2WYFA 2BOJA 1EUUA 3ZFEB 1W2AX 4BACA 2VG9A 1R1UA 1Z67A 3R6SA 5DUVA 4LOCA 1X36A 1IUYA 4L9VA 4GAZA 5FLHA 4C2UA 4IEOA 5LBQA 1IRZA 5C9AC 4AEMA 5A7OA 1QNYA 3ECHA 1W9FA 1RUF2 5DV5A 5C4WA 1J1TA 5FO9B 2XROA 1BI0A 3H7JA 3P5BA 4CXYA 4Q0VA 5FD6A 2PHXA 1VAMA 1D2SA 4NMIA 3ZXLA 1O4TA 3WQBA 2IXKA 4N7UA 4WVMB 2YPRA 3M3YJ 1QQP2 4CP2A 4OIPF 1TQMA 1UYXA 2RV8A 1AL22 1FPN1 2ID4A 2QNKA 3ZM8A 4MO7A 5JVTA 3S0MA 5ICCA 3ZMNA 3CLPA 1IUFA 1GUUA 1SFNA 3BCWA 3FMSA 2E63A 4NAMA 4BQYA 4CDWA 4HPKB 3LSDA 1GZCA 1W5TA 2ZNYA 1XNAA 1AR61 4XDPA 4Q48A 3VBRA 2CJJA 4XMAA 3S57A 3I9V2 2WZEA 2KJCA 1UKGA 4DZGA 4W8JA 2QQKA 1AR73 5C3QA 4V2GA 2H0BA 4EWAA 2OPTA 4MADA 3J7YJ 4KGGA 2F6BA 3S93A 1ODNA 3QODA 4AU7A 3FHZA 2XRNA 2VOWA 2BFUL 1LNSA 3DQVC 5E88A 1R092 3MI8A 3VBUC 2ZHLA 2R7UA 2RS52 5E8GA 2IGOA 2ZGOA 5FLXK 4B3XA 2X51A 2VMCA 5DDJ2 3K51A 3OUJA 4DXRA 2HWD2 4G4FA 5A33B 2DTWA 3O2PE 2DFEA 5JWPA 4CHUA 2OCCH 2RDPA 5GTIC 3ST7A 3LD8A 1JTZX 4XF3A 4Q4Y1 3HPNA 1HKSA 1UOJA 3VHNA 1ZELA 1T56A 5IHRA 3G73A 1ZG1A 3PHMA 1VMFA 4QXBA 4BJ0A 2F5CA 3PMEA 4G9SB 1BR1A 1I3QJ 4SLIA 1QJX1 1TWFJ 1MDMA 1LE8B 1RITA 1GBGA 3FXKA 1IGOA 1DGWX 4L5IA 3B7MA 3A01B 1RC6A 2Z99A 3GHMA 4CU7A 1N3PA 4XJ8A 1ZM1A 3GTLJ 1W0PA 1XGSA 5JLVA 3QPSA 1UG0A 3C18A 5M5WJ 5FYHA 5LFAA 3PIJA 2R0FA 1D0XA 5DXDA 1PZ7A 4NWWA 5JVGF 2DYSH 1XGOA 2VE1A 5CYVA 4RR3B 4D5FA 2R16A 2PLV3 1OURA 2VQLA 3G3ZA 3JXSA 2ZKZA 2VUAA 4XLHA 4XFAA 3OIOA 2CV2A 4FPGA 3EDPA 5CVJA 1ODMA 2D5FA 4M74A 3H8OA 1PZ8A 4DXZA 3W2VA 2XBO2 3FWEA 3R0AA 1Y0UA 4FX4A 2DA5A 1PGL1 1UHSA 1K4TA 4NRQA 3ZMVA 1Z77A 4EN0A 4L0ZB 4AVSA 4LULA 5FMCA 2HDWA 4Q47A 2VZ1A 3KIOA 1UYZA 3L2RA 2FOKA 2IS1A 3DEMA 3MIBA 5H6RA 3OIQA 5ACA1 3WUDA 1F9KA 3SEEA 4AC0A 3IRQA 3ZDSA 4MG2A 1K42A 3HMYA 5CJ9A 1MS8A 2DVGA 1KFUL 2VT2A 5AVPA 3RTRA 1RVF3 1AXZA 4ZZ5A 5KAIC 4UYBA 5J7MA 1U3EM 2NS8A 2HWB3 1W6OA 2CUEA 4QKNA 1V00A 2IS6A 2XWJB 4V2FA 1N1SA 3VZLA 3ASOH 3I3MA 2ET7A 1OQDA 3W2WA 2EIJH 4QTRA 4ATEA 5J4VA 1G3WA 2O61A 2CFOA 1CR7A 1KJLA 1KU9A 3WF4A 4IO9F 1VQKI 1IS3A 2B5HA 3T4VA 1FXZA 4YW2A 2HWF1 3S14J 1KFXL 4MX3A 4KA4A 5J1UA 5EWSA 3UK9A 2QKMB 2WNEA 3HRUA 4BE3A 2W52A 1VQ8I 2VIXA 3EUHC 2VI6A 3LEKA 3DV8A 3POYA 5F8PA 5DTDA 4EN7B 1R5HA 4HZFA 4S2HA 3OBZA 2OD5A 4PJ0C 2R073 2BW8A 4PSXA 1IPKA 5K4LA 3OUIA 2CWEA 2FMDA 4UNOA 4UXAA 3A0NA 3ACIA 3CJIB 3DYMA 4U2AA 2IA1A 4AHXA 3I97A 2BE5F 3PSFA 3RMYA 3I3DA 5EG0A 1PO22 1I6HJ 1NT0A 1X9PA 2ZGPA 5CKQA 2YBSA 1BW5A 3BY6A 3GZTB 3ASIA 4FP2A 2GIVA 4PGGA 1PHMA 1RUC3 2GXBA 3N9QA 5FYMA 2Q0AA 4CCDA 3AL0C 2E2IJ 4B09A 4GWJA 4LLGF 2HWC3 2WZPP 3Q5FA 2ZX2A 4L8QA 1NKGA 4JKLA 1FOXA 1UYPA 4N43C 4XFCA 3LZZA 3ETQA 1RUNA 2KRHA 1A34A