2FMDA

Structural basis of carbohydrate recognition by bowringia milbraedii seed agglutinin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
236
structure length
232
Chain Sequence
ANSVCFTFTDFESGQQDLIFQGDASVGSNKALQLTKVDSKGNPQGGSVGRALYTAPIRLWQSSSLVASFETTFTFSISQGSSTPADALTFFIASPDTKIPSGSGGRLLGLFGSSNDNGVVSVEFDTYPNTDIGDPNYRHIGIDVNSIRSKAASKWDWQNGKTATAHISYNSASKRLSVVSSYPNSSPVVVSFDVELNNVXPXWVRVGFSATTGQYTQTNNILAWSFRSSLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title Structural basis of carbohydrate recognition by a Man(alpha1-2)Man-specific lectin from Bowringia milbraedii.
pubmed doi rcsb
total genus 48
structure length 232
sequence length 236
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fmdA00
3SH3A 4ISQA 1W6PA 1QDOA 3FLPA 4OZXA 1WW7A 5JLVA 3I8TA 2DVDA 4YG3A 5JDBA 3AP4A 1S0GA 4BLJA 3IM0A 2VH9A 1LHWA 2ZABA 3POYA 2UWAA 2NMOA 1U0AA 2GMEA 2PHTA 4R9CA 2YY1A 1N1SA 2ZGOA 4GA9A 1CONA 2ZHLA 3OYWA 4Y22B 1DGLA 3D5OA 1FV3A 3OBRA 2C9AA 4LBJA 1GV9A 4XDQA 2I2SA 3SISA 5GALA 1G9CA 1CR7A 2WT2A 4XTMA 3WUCA 1KDKA 3ZSKA 1CN1A 2AREA 1UL9A 3RRDA 2EXKA 5KXEA 1HDKA 1QF3A 5IT6A 2P37A 4GWMA 2P3IA 2UWBA 1JYCA 3ZVXA 3AYDA 1V6OA 5DG2A 1O4ZA 1YYNA 1F9KA 1APNA 3M1HA 4YGBA 1W6QB 4BLIA 3SNMA 3KQRA 5GZDA 1YRZA 1KJLA 5IK8A 4R9BA 1SACA 1AX1A 1RIRA 2VY0A 1ENRA 2P2KA 2RHPA 2VW1A 1N1TA 2JJ6A 4LBNA 3ZXLA 4FPGA 1Q8OA 3ZXKA 1A78A 4BPZA 1MVQA 1QKQA 5JVVA 3NWKA 1FAYA 1KQRA 4M3CE 4TZDA 1MS4A 2GN3A 4H55A 2D6KA 1B09A 3LCPA 3PVNA 2NZ9A 1ZA4A 1LHOA 5GZEA 3NV2A 3AXDA 4YW2A 1C4RA 3FUQA 3IN9A 2WJSA 3MEPA 1SFYA 3ZXJA 2NN8A 2E7QA 1GZWB 4UW5A 3WDVA 2EXJA 4ATEA 2A6VA 1MS8A 4R9AA 1AXZA 2AR6A 2A6ZA 1QOOA 4XIKA 3BTAA 4YM1A 1LOFC 1WUVA 4Y24A 3OPZA 4XHXA 5E89A 1ULFA 1AVBA 5DG1A 2EF6A 2WKKA 3HN1A 3W59A 3ZPYA 4BQ1A 1KDMA 1W6OA 3D6EA 3ZYRA 4P9YA 3TAYA 2OVUA 2EXHA 1AX2A 1H9WA 1QMJA 2P3JA 1MS1A 2V5YA 4FPHA 1LGBA 1RITA 3AK0A 2DVAA 5CNAA 4YM0A 4DQAA 4BMBA 1C57A 2PELA 1DQ5A 3V0BA 2EAKA 2JD4A 5H9SA 4U36A 3N7JA 1W6NB 2WQZC 2EXIA 2ZGLA 1FNZA 1QNWA 5CBLA 2D6OX 2PHFA 1WBFA 3AP6A 4DS0A 2D43A 4YW3A 1MS3A 1FATA 2DU0A 1Q56A 3CNAA 3AFKA 1LGNA 1S0IA 1X50A 1GNHA 2VUAA 5H9PA 2D7FA 4WV8A 4PBOA 2ERFA 3M2MA 1LOBA 2NYYA 5KXBA 2JE7A 4P14A 3WCSA 5DZEA 4XOGA 2FMDA 2XB6C 2ZGSA 1N1YA 2CL2A 4ASMB 4FPYA 4FPFA 1VAVA 1IS3A 4YZ2A 2WNEA 3WDWA 3MW3A 3QLQA 1UKGA 4M00A 4XTPA 2EIGA 4TYSA 1LHUA 2CNAA 2GMPA 1IS5A 1CJPA 4M01A 4YZ1A 2DVBA 1WLCA 3AZXA 4PF5A 4YGEA 5JOYA 1JXNA 4YLZA 3A0NA 1V6JA 2NM1A 3M3QA 1IS6A 2WSVA 1GLHA 1V6NA 4XBLA 1DLLA 3PJQA 3T2TA 4D69A 5GZCA 1W6MA 4YW5A 5CB7A 1O4YA 2AGSA 4U2AA 1OQ1A 1V00A 1LOEA 1MZ6A 2OUHA 5IK7A 4I30A 1LOGA 3HR9A 5CAZA 3ASIA 2DUPA 4XMIA 2D3RA 1GYKA 1LCLA 5GZGA 1AJOA 2EALA 1WW4A 2A6XA 3A0KA 3BIWE 4DFSA 1TEIA 2D6NA 1SBFA 1LESA 1LHVA 1UX6A 3V64A 3WV6A 3FFZA 1A3KA 2YROA 4WZFA 4Y1VA 1WLWA 4XJAA 2YMZA 2ARBA 1CQ9A 1W0OA 3RQ0A 1F5FA 1HQLA 1N1VA 3W58A 2GMMA 2GNBA 1JUIA 1QU0A 2ZZJA 3O12A 3O0VA 4L8QA 2HYKA 4FPJA 5FRAA 5T52A 2NP0A 3N7LA 2UURA 3MW4A 3B9CA 3PVEA 1MS9A 1FYUA 3POSA 4Z8BA 1HQWA 4Y20B 2D6MA 5KXDA 2G4IA 2KM2A 1S0EA 1CESA 3WOGA 1N3OA 3B3QE 1MZ5A 4FPOB 2PHXA 5GZFA 1DZQA 1JN2P 2A3YA 2ZAAA 4XILA 2DVFA 2VW2A 4C1WA 3AJYA 2DURA 1AZDA 5LK5A 2DYCA 3UJQA 3M3EA 4GKYA 2UU8A 4GWNA 1GSLA 2WLQA 3ILNA 4AGGA 2WSUA 4AGVA 5BYNA 1SLCA 2TEPA 4XBQA 5EXOA 1SCRA 4LBQB 3LSDA 1S0JA 2A7AA 3NV1A 3OY8B 4YGCA 3ZYPA 2D44A 3WNXA 3PMEA 5DUUA 1Q8VA 4Y1UA 5L73A 1ENSA 2E51A 2P34A 4XJ8A 1VIWB 1DYKA 1GZCA 4XJWA 4BM8A 3RMYA 4YM3A 1JYIA 1DFQA 5HCAA 2CY6A 1Q8QA 4UW3A 3WDTA 1IKPA 2ZMKA 4XXAA 4LBQD 1N3QA 5T54A 5HCBA 4Q1PA 4AGRA 5T5OA 3R4SA 1QNYA 2ARXA 3FLRA 4GALA 3Q9OA 1S0CA 4JC1A 4UW6A 2R49A 3U4XA 1D0HA 3MW2A 1W6QA 4YGDA 2A3WA 1I1EA 1UZYA 3ZSJA 3AZZA 5AVAA 5GJ6A 1HLCA 4XJ9A 1WW6A 2BQPA 3LSEA 1Q8PA 3RSJA 4P9XA 1PZ7A 4YM2A 1QGLA 1OKQA 1S1AA 1S0FA 3VKMA 5JOWA 1CIWA 3V0BB 4XMAA 2ZGUA 5GLVA 2ZGRA 4XHBA 2LTNA 3AZYA 1ENQA 4DPNA 1JOJA 3WG2A 2Q5TA 3N3HA 4K1YA 4FOQA 5HCFA 4PQ9A 3JUUA 3WDUA 1ULGA 5T5JA 3VKLA 3V0AA 1LULA 1PZ8A 1WBLA 1LOFA 4R9DA 3VKOA 1CPNA 1MS5A 1V6LA 3AZVA 1DBNA 1AJKA 3BOPA 3OBTA 3ZSLA 5JOXA 3AZWA 5EYXA 5EYYA 4XE9A 2XG3A 4FPCA 2ZKNA 4YG0A 3NV3A 3USUA 5GLWA 1H30A 1MACA 4LBOA 1FNYA 1F31A 1LECA 4M3CA 2ZBJA 1LEDA 5JOZA 3FBYA 1SLAA 1W0PA 5GLUA 1JBCA 1XQNA 3O0WA 1Q8SA 2B7YA 5DZFA 2GNDA 2AYHA 2ZMLA 3AYEA 4YZ5A 2WT1A 3AYAA 1LODA 1WD4A 2ZMNA 3RG0A 2R0FA 2W39A 1A8DA 1UPSA 2VXRA 1GKBA 1LU1A 1G86A 4YFZA 3O5SA 1UMZA 1GBGA 3C2UA 2ZGQA 3V65A 2CWMA 1W6MB 1W6NA 1N3PA 1DHKB 1DIWA 4RA0A 1Y7BA 4IQPA 3ENRA 4XXPA 2W08A 3SITA 1SLLA 1BZWA 3KM5A 2W68A 5FREA 1W6PB 4YG6A 3AP9A 3WUDA 2DTWA 4Y1ZA 1MS0A 1AF9A 1GICA 4PBPA 1IOAA 2ES3A 3H0OA 1ULCA 1DQ1A 1URXA 2ZHNA 3DUIA 3HMYA 1I3HA 1D2SA 1JW6A 4P9WA 1FV2A 1SLTA 2AENA 1GANA 3POWA 4NOTA 4XJUA 3OYWB 4BOWA 4PCRA 2SLIA 1MVEA 4GXLA 1WD3A 1ONAA 3DGTA 1LEMA 1LHNA 1UAIA 4JRAA 4K1ZA 4GKXA 1IKQA 2ZGTA 3GALA 1G9FA 1J1TA 1JHNA 4RL7A 2VW0A 3UJOA 5DUVA 2E6VA 5E8AA 4YZ3A 3M3CA 4ATFA 2GNTA 2DU1A 1G9DA 1BKZA 3SH5A 3WCRA 3AP5A 1V6MA 3L2YA 2A3XA 2DWRA 1LENA 2ZGKA 1FX5A 4FQZA 2GALA 1Z78A 2W52A 1KITA 3IPVA 2FHRA 1YI7A 1G8WA 4Y1YA 2ZGPA 3OGGA 2JKBA 4HANA 2A6WA 4FVVA 4JCKA 4ISRA 3T1LA 2E7TA 3ATGA 4AVSA 3OJBA 2YV8A 5GM0A 5H9RA 3B00A 4KBBA 4YFWA 2UWCA 5DUWA 1G7YA 1R1ZA 3AP7A 3N35A 3WZ1A 2ZACA 4LBMA 3SH4A 1DQ4A 5T50A 1G9BA 5T5LA 1BXHA 1LTEA 4Y22A 5F9TA 2H0BA 3MPPG 3VKFC 2R1DA 4Y20A 4XIOA 1CVNA 4SLIA 2DVGA 4AVVA 4WVWA 4FPEA 1WW5A 2DUOA 4AYUA 1ULEA 2DTYA 1YXWA 4XYXA 1AXKA 3BODA 2LALA 1GNZA 2GDFA 2DV9A 5DXDA 4ZXKA 4YZ4A 5GLTA 1YIFA 3AX4A 4Q26A 2A70A 2V73A 3SLIA 5IK5A 2D6LX 1NLSA 1LOAA 4FOWA 1W6OB 4BMEA 1UN1A 3D4KA 4LBQA 5GLZA 2SBAA 1KJRA 3OY8A 1Z0HA 1VLNA 1GZ9A 4FPKA 3N7MA 3ZSMA 3V0AB 4FP3A 2R16A 4M3CF 2R0HA 3IKWA 4FOYA 3UL2A 3VUOA 5KXCA 1SCSA 1YO8A 4LBKA 2ZA9A 4W65A 1DQ2A 4K21A 1VALA 4FP2A 3GNEA 3QCWA 1LJ7A 1KRIA 1NXD1 3RMXA 3WVJA 3ILFA 4Q27A 1AXYA 1UZZA 1AX0A 2E53A 4DRRA 1BJQA 3USUB 1GZWA 2ZHMA 2YXSA 4M3CB 2DUQA 4MYEA 1S0BA 1QOTA 4ITCA 3JU9A 4UW4A 2JECA 3AYCA 4C1XA 4ZKTB 2C5DA 4AVTA 3B69A 5T55A 3N7KA 2PHWA 2OUJA 2AUYA 1N47A 1HKDA 1SLIA 3FUOA 4NO4A 1DYPA 1VAMA 5H9QA 3WHTA 1EPWA 1MR5A 1G9AA 4CRQA 3WG1A 1WCSA 4Q1RA 1H9PA 4XBNA 1BQPA 2D3SA 3WDYA 1SBDA 5SV8A 3B01A 1WLDA 2PHUA 1C1LA 5DZGA 2AH2A 3WG4A 3ZXFA 4Q8KA 2A75A 3R4UA 2WT0A 3O0XA 2CWSA 4XZPA 1IS4A 4FPLA 1S0DA 4LBLA 3WLUA 1V6KA 3VKNA 1QOSA 2R1BA 4K20A 4Y1XA 5T5PA 3T1MA 5CA6A 3UK9A 2CYFA 5EWSA 2A6YA 4CZSA 2A71A 1OFSA 2JDZA 2GNMA 2ZGNA 5DUXA 5JMCA 4HL0A 1CPMA 3IMNA 3PVOA 3NV4A 3WG3A 1DQ6A 3M3OA 5F5QA 3TB0A 5E88A 3ILRA 3FLTA 4AWDA 4DRVA 1ULDA 2CTVA 2NMNA 2D3PA 2JE9A 2VU9A 2ZGMA 3VV1A 3A4UA 4CTEA 1QDCA 4YW4A 3N36A 4XJZA 4Q2FA 5IUQA 2P3KA 1V6IA 1BYHA 1SBEA 1LOCA 3AJZA 4Y26A 3RS6A 3WHUA 2ZHKA 3WDXA 3INAA 1DQ0A 2PHRA 2YZ4A 4FOVA 4F83A 1RINA 5IK4A 1SLBA 4Q8LA 1C1FA 4YW1A 3ZXEA 1LGCA 3R05A 1PZ9A 3APBA 3AXEA 4WVVA 3IPVB 1LU2A 2GN7A 4FQ4A 2Z42A 2OW4A 3I4IA 2ENRA 2D6PA 2A5ZA 1ZM1A
chains in the Genus database with same CATH superfamily
2Y6HA 4ISQA 3SMHA 3ES4A 4IERA 2Y64A 1QDOA 3DXUA 1OHFA 4R4ZA 3U37A 5BNOB 3I2DA 1WW7A 4QX2A 5JLVA 4JDNA 2HJIA 1AR93 2E32A 3P5BA 2XDVA 5JDBA 5M0TA 1WCDJ 5FMDA 2RMU1 5K0UC 1T2XA 3POYA 2UWAA 2ILMA 1U0AA 1OPOA 3PDQA 3PTYA 4R9CA 1IG3A 4R8HA 2X5IA 1RB8G 1WA4A 2WYFA 4GA9A 2VL4A 2ZOEB 2ZHLA 4LKDA 4Y22B 1W04A 1O91A 3RZZA 3T0AA 3OBRA 1XNCA 4LBJA 1ZZ9A 3MYXA 5GALA 1G9CA 4QWNA 1JZ6A 5I8SA 1NA1B 2AREA 1O8PA 2QQJA 2Z4FA 1NX9A 2QBXA 2WIIB 3BU0A 1QF3A 4XF0A 4AL9A 5IFPA 2P3IA 5CISA 1D2QA 2W3JA 3ZSEA 1OD3A 2J1AA 4I3PA 3IDEA 3TEXA 2D5FA 1T6GC 3M1HA 1ALYA 2XHKA 5A80A 4NIAA 4BLIA 5BNOA 3THDA 4DXSA 1KJLA 1HJGA 1NA1C 2ZKLA 1AR71 4CU7A 3E5UA 4TTGA 1AX1A 2H6BA 2RHPA 2VW1A 1ZRRA 4QPYA 4MLOA 4RS5B 4IV1A 3ZXLA 2VCBA 3WR0A 2AEYA 3O7OA 5FZMA 4NPRA 3KV9A 4M3CE 3E6BA 1GP6A 3LQCA 4TZDA 4YVSA 4CXWA 2WZ8A 1BEV1 5DDJ1 1JOPA 3GYDA 2VNGA 1ZBA3 4NHKA 1PK6A 4IV3A 3GDBA 4EN8B 4GJYA 3AXDA 4RS5C 4YW2A 1ZX5A 3FUQA 5CFDB 4Z1VA 2F6BA 2WJSA 3A21A 3MEPA 4JHTA 1PM4A 1BHGA 1WA6X 1GZWB 1BK0A 1ULPA 2NN8A 3DV8A 4FFIA 4AEJA 4F7ZA 1AR63 2EXJA 4A7KA 1O5UA 2A6VA 1JYVA 3ZXAC 1AXZA 1HB4A 3EBRA 4W6XA 1QOOA 3AM2A 3B93A 1NQDA 4A45A 5HI0A 3R4DB 1GQHA 2OQ7A 2K9ZA 1HXS2 2WQ8A 4EWEA 1WUVA 5CFDC 2JEMA 4Y24A 5AC92 3OPZA 4I0AA 5E89A 3S7IA 2JDNA 1AVBA 3HN1A 3VD4A 4Q0QA 4CCEA 2J22A 4RR3C 2J1SA 5A3WA 1S2BA 4HN1A 3TYJA 1QXJA 2OVUA 2XONA 2NPIA 1V70A 1E5IA 4N7UA 4RGAA 1CAXA 3U07A 4IEWA 1C57A 5IVCA 2JD4A 4N9HA 4LT5A 3T4HB 5FZCA 2JG9A 1CX4A 3H8UA 1ZZCA 4TXWA 2WLPA 1WBFA 3S5AA 4BCUA 1MS3A 2WFF2 2DU0A 4HFSA 5BY5A 2BFUS 1VRH1 1GNHA 2D7FA 1YHFA 4QKDA 3JBG1 5KHIA 5FY0A 5KXBA 5FYIA 4K8RB 4FCAA 2ZGSA 4CDXA 4IDZA 1PVXA 4OQ8A 5LBBA 4FPYA 5J48A 1VBD3 4BZ4A 1VAVA 3RVHA 5EJ3A 4MX3A 3OUHA 2EIDA 5FZOA 4QD2A 2WZEA 4AG4A 2EIGA 1LHUA 1UY0A 2CNAA 1IS5A 1AR73 1CJPA 3I3QA 1STMA 1RMU2 4PF5A 4YGEA 5F5AA 1KGYA 3K4AA 3VZMA 1KEXA 5A33A 4BQWA 1ULOA 1XNBA 1DLLA 5GZCA 3T2TA 3KB5A 4URTA 5DDJ3 1BEV3 3LE0A 5CB7A 3OF1A 3OUJA 1UMHA 4QX5A 2DCJA 3TEYA 2BOJA 2YBSA 3MUZ1 2OUHA 2VQTA 2XVLA 1LOGA 4LHLA 1JU4A 4ZONA 5A7NA 5J09A 5IK7A 1LCLA 1A8MA 1AJOA 2ARAA 2VD7A 3H9AA 1YFYA 3PLQA 4RHV1 5FO7B 5CKNA 3S7EA 2X5IB 1HRV1 2MNGA 1GNYA 5FFOC 1LAJA 2YMZA 3THTA 1CQ9A 4CCMA 1F5FA 4QB2A 1O5LA 4OI4A 1IQDC 3RWNA 2GNBA 3O12A 3V56A 5CKQA 3POIA 2DBIA 5FRAA 3ORJA 3KF5A 3BVCA 3N7LA 1UX7A 3NAPA 5IHRA 1H6YA 1MS9A 3NSTA 5KXDA 2VE1A 3WP5A 1CWPA 3R6SA 3NJYA 4WM8A 3MUY1 4LO6B 5CKMA 1DZQA 1JN2P 3IMMA 4Q4X3 4Q4Y1 4JDMA 2DVFA 2B42B 3WNOA 4CCKA 2D40A 5FYYA 2DURA 1AZDA 2VTXA 1DGWA 4XQ4A 1QJY1 2JDKA 2VM9A 1QJFA 5CZKA 3T2QA 4AXOA 2WLQA 5BYNA 1PX4A 1OKOA 2Y6FA 1YJKA 1TNFA 4QKFA 5KHKA 1W2OA 1VRH3 1QQP3 1RC6A 2A7AA 4OLLA 4V2VA 1W9WA 1MEC3 2ORXA 3H42B 4G9SB 5C71A 1OLME 4IV3B 5GKAC 1GOGA 2J1TA 5C8WA 5LW9A 4Y1UA 1YC61 1ENSA 2VMCA 4LLFA 5L73A 3HT1A 5LBFA 4QMAA 1XB9A 4XJ8A 1RUD2 4XJWA 3VDCA 2R6QA 2ZX3A 3ACLA 3OGJA 4BYYA 3RJ2X 3ALQA 3DECA 2CY6A 3WDTA 2XLFA 4OMDA 4XFCA 4RN5A 4Z07A 4XXAA 3VBHA 1XSQA 1RUF2 5T54A 3BTXA 1O59A 1W3VA 3QD6A 4IUGA 4E2SA 1R1A3 3R4SA 1QNYA 4UW6A 1S2KA 2C1FA 2R49A 1GWKA 2VOKA 4EJRA 5JSOA 3MW2A 5I93A 3T2OA 1W6QA 1CD3G 1I1EA 3PMSA 1D4VB 1UZYA 1E5SA 3KVBA 3SXWA 3ZSJA 5GJ6A 1HLCA 4UFMA 1KS4A 1Q8PA 1RHI1 1UZWA 4JGYC 4LO5B 3AMMA 1S0FA 3W20A 3IIIA 3VKMA 5CIRA 4HKLA 2VOVA 2HEYF 4N53A 2W2IA 1ZZ6A 5FMOS 2JG9B 1PO12 3VDAA 2MHFA 4K1YA 2AC1A 4LUMA 4RHV3 1HRI2 2R041 4PQ9A 2WNVA 4MXWA 3WDUA 5DABA 4K40A 1PZ8A 1US3A 3DF0A 4OUMA 3RDIA 2BPA2 1CX1A 1OPMA 3CL1A 2KA3A 3GZUC 3BOPA 4S2FA 5FLHA 2X29A 3NL1A 4CUAA 5JAXA 4NAMA 4J25A 5EYXA 2VMDA 5FO8B 4NVPA 3RZMA 1ZYBA 2JDUA 4FPCA 4N90A 3RWKX 3L2HA 1BBT2 1R083 1GWLA 2OXBA 4M4RA 4FXKB 1MACA 2R071 3USUA 4CDXB 3I49A 2MEV1 5D1IA 5CADA 5CG9A 1KD7A 1LEDA 2VQUA 1SLAA 3ZR5A 2PTMA 2YC0A 1XYNA 5FZOB 1PIV3 1Q8SA 4Q4Y3 2GNDA 2AYHA 3CLPA 4QX1A 5JI7A 3I3MA 3P1IA 1J1LA 1WD4A 3RG0A 2R0FA 3BPZA 3ECQA 4IEXA 2VXRA 2JD9A 4DXTA 4FAHA 4ZZ8A 4NRPA 1GKBA 3J7MA 1H2KA 2DBNA 4QPGA 3FE5A 1G86A 3N9LA 5ISLA 1JZ3A 1PGL1 5A33B 2HKXA 1HQNA 1COV1 1XE8A 2P1BA 2RVAA 5F8PA 1UMZA 3T3YA 4AZZA 4YFZA 4ZU4A 2PXJA 4V1PA 2ZGQA 1F35A 1JZ2A 5A3NA 1W6NA 4XFAA 1DHKB 5CG8A 1PGSA 4CCCA 1QWRA 1AYN2 1LRHA 2JWPA 4IQPA 3ENRA 1W8UA 4GMP1 5A7WA 1J3QA 4KGQA 5A7OA 1SLLA 1SFNA 1POV3 5IVBA 4OZOA 2W68A 5HCHA 2WL1A 2DTWA 2G1MA 3OD4A 3WUDA 1DF0A 3J8F2 5E6HA 2RS33 1W9YA 1VBE2 1DQ1A 1D2SA 1Z7S1 4QXKA 5FK8A 2Q4SA 2XXZA 1H8TA 2CDOA 3VZNA 2XR4A 3H3LA 1W8WA 2HWE2 1OLRA 3W9AA 4BOWA 1YFWA 3NAPB 2FCUA 2VUCA 1RHI3 2ZGTA 1W99A 2TBVA 1J1TA 2BZDA 2ZXQA 4G3YC 3UV9A 4WM8B 3UJOA 3ZFFC 5DUVA 4EN9B 3ZLIA 1NZCA 2PQSA 2WNUC 2IXHA 3D82A 4KG8A 4TLGA 3P3NA 5EFUA 2GNTA 2DU1A 5DPNA 3ZMNA 5C3QA 1BKZA 4EROA 4LO8A 3VD7A 5BPXA 3ZR6A 2R043 5J96B 1X36A 2VZVA 4JKLA 1VBB1 2TUNA 3T4VA 2GALA 1Z78A 5FUPA 1KITA 3IPVA 3VDDA 1CAUA 3O1RA 5FQ0B 4PT6A 1YI7A 2JKBA 5K8SA 1ASJ2 4A42A 4COWA 1PMIA 3FHQA 4ISRA 5BNQA 3C7HA 4Q4V2 4AVSA 1JYXA 2B45X 1Y43B 2JDPA 3CEWA 5H9RA 4HZFA 5JR7B 4HVRA 2CDPA 4IW3A 1R1ZA 3GCXA 4YNIA 5FY4A 5A32A 4DUXA 5J7MA 1NXMA 1FI2A 1LTEA 4GMP0 3VD9A 3TRSB 2H0BA 3LEGA 3S30A 1QH6A 2ORZA 2JG8B 2GC3A 5A3PA 2BRTA 2JDAA 3K75B 2B9VA 2X8KA 1W9SA 4AYUA 1BMV2 3VHOA 5FY7A 1AXKA 1H2NA 2Z5WA 1XRUA 4OMCA 2BGPA 5DXDA 2UYAA 2QQPA 1YIFA 4GWJA 3DKWA 1MQTC 2D6LX 2JG8C 2LS6A 1NLSA 3ZIWA 1LOAA 4FOWA 3VBOA 3AKSA 4N53B 1NY71 3D4KA 4LBQA 4ZS2A 5GLZA 4F8AA 2WO7A 2GC2A 3OY8A 1VLNA 4G4FA 1T6BX 1POQA 2LW8A 2FZ1A 4I02A 2WNVB 1Y9QA 3ZSMA 4AR2A 1B35A 3IKWA 3UL2A 1K3IA 5C3RA 3NKGA 1PO22 1SCSA 4LBKA 5IVFA 1Z7S3 1VALA 1W2TA 4Y4RA 1NXD1 4LKFA 3WVJA 1FT9A 5FMCA 1TNRA 2E53A 1YUDA 4DRRA 4QHZA 3HJRA 3USUB 3VL9A 5FP9A 2XL7A 2YXSA 1YQ2A 1CIYA 1QOTA 3KT1A 4YRDA 5ANQA 3ZDVA 3BB6A 3B5LB 4XFBA 4C1XA 3VBFC 5C7GA 1W3XA 2IVJA 3MLJA 5KC5A 4ZU7A 3SQOA 2OUJA 4P02B 5FZ9A 3OGSA 1O3RA 1AR82 3GBFA 1RUE1 1F8VA 4QPGB 1VBB3 3WHTA 3O1OA 5FPVA 3LA7A 1D7PM 5C8CB 3J7NA 3PIJA 1CZTA 1SBDA 1WZXA 1AHSA 3ZYGA 4YVWC 3DYOA 1WLDA 5L36A 4AF9A 3S6PA 1OC1A 3WG4A 4BH9A 5FXZA 2JB8A 2H6CA 3O0XA 4LHNA 4XEZA 4UYBA 4LBLA 2Y6GA 4PQQA 5FYZA 2QQOA 5FYCA 5KR7A 4K20A 2VQ0A 2VQAA 3OCPA 4O9GA 4Y1XA 5T5PA 3T1MA 1QH7A 5C8CC 4NIHA 4HVOA 3UK9A 3ZFEC 3N9PA 1US2A 2XLGA 2A6YA 4DUVA 4LNVA 1OFSA 2ZGNA 3N9QA 4F3JA 4ZS3A 2HLEA 5JMCA 1V9U3 3PVOA 4UI9L 4Y5Z0 5EHDA 2XBO3 2FBEA 3M3OA 3ILRA 4AWDA 1W8TA 2QDNA 3LDRA 4L0PA 2P5BA 2QQKA 1EV11 4AQSA 1UPIA 3CHXA 4Z82A 4MHUA 3DCQA 1W03A 2JX9A 3M70A 4Q2FA 3WSOA 5K9YA 3AJZA 1V6IA 1BYHA 1SBEA 1LOCA 5JIAA 3I7DA 1I5ZA 4FOVA 3C7OA 5LBEA 5LCWL 1QJU3 1SHWB 4Q8LA 4YW1A 3MFCA 3JD72 1PGW2 1W8ZA 4HMZA 1LGCA 1AYM3 3R05A 4FO9A 3CMGA 1TMF2 3AXEA 3VDDB 2W1QA 3OPTA 3IPVB 3UGHA 4FQ4A 2Z42A 2HWB1 5HXMA 5J1XA 1OMIA 4BQ5A 1YEWA 2A5ZA 1ZM1A 2PAEA 1SFPA 2WC2A 4AGGA 5HPOA 5A1FA 1W6PA 1UOGA 3FLPA 4DMIA 4OZXA 3RZLA 3I8TA 2DVDA 4YG3A 4XFHA 3AP4A 5FMBA 2B39A 5IAXA 1ZZ7A 3MIDA 4HVQA 2CU5A 2PHTA 2VR4A 5A32B 1CONA 1RUC1 3OG2A 5C3SA 3OYWA 3WF1A 1DGLA 4IEYA 2C9AA 3EXUA 4Q5OA 5IVJA 3U10A 2I2SA 3SISA 2FDIA 4IE4A 1CR7A 2ID4A 2P4EA 5JZGA 5FZ7A 3BKZA 3IDBB 1UL9A 4WVZA 5KXEA 5JMOA 3JQXA 2ZX1A 5IT6A 2YU2A 2BU9A 3FN9A 4GWMA 2UWBA 4QM9A 2XJQA 4RQPA 3ZOIA 1PHMA 1V6OA 3BI3A 2IUWA 1D4M1 2ZS6B 4KMQA 4PDWA 4IESA 4Y4YA 5AVPA 3ZN6B 2XVKA 3KQRA 4Z2AA 1YRZA 4NMIA 2Q1ZB 5FZHA 3VBOB 5C9AC 2HWF2 4JRLA 1WWYA 3VBRA 3Q8AA 4B4RA 2P2KA 3KQ4B 1W8OA 1OOPA 5FXXA 1UYYA 4HLTA 4ZZ5A 3C7GA 3PUIA 3POEA 3ETPA 2W47A 3ZKUA 1Q8OA 1UKRA 5FYUA 1A78A 1B35B 1HXS1 4XCAA 1ZNPA 3NWKA 1KQRA 4EN0A 3MIFA 4KWLA 3K3OA 4LIUA 4QX3A 1MS4A 3LZZA 1ND2A 3LCPA 4QPIC 3IIAA 4QX0A 3MF9A 3K46A 1EV13 5FZ3A 4CPBA 5A6QA 1YJLA 1UYPA 3IN9A 3NJXA 4QKNA 4JV4A 1S2EA 3OB8A 3ZIXA 3AVRA 5JSPA 4GB32 5C3PA 4Q0UA 1J58A 2XOMA 3OSDA 4E2QA 1MS8A 3N9OA 2YBPA 2AR6A 2VMEA 2HWC1 1R64A 3B7MA 5F3EA 4E8CA 3WP6A 4XHXA 1VE0A 2WFF1 5CU1A 3W59A 3K77A 2WS93 5A6XA 3D6EA 3AL6A 2HWB3 3TAYA 4NPLA 1RXFA 5JCTA 1ZBE2 5DN2A 2Y0OA 2P3JA 1IG0A 1MS1A 2JENA 5CNAA 2FZ2A 4JDOA 4M4PA 4MVTA 2VGDA 3V0BA 1DQ5A 1XBFA 2ZX2A 3BU7A 4QHBA 2WQZC 2VMFA 2EXIA 4XUNA 4N43A 2ARCA 1FNZA 4QGNA 1REFA 1QNWA 3VLBB 2PHFA 4BWOA 5KWRA 1RMU1 1RUC3 4GQ7A 1FATA 5FIXA 3PU8A 4WBBA 5F3IA 4JGZB 4IEPA 2I74A 1LGNA 1RUNA 3DEMA 3DN7A 4XAAA 5FUIA 4WV8A 4PBOA 2NYYA 2QUOA 1SZBA 2JE7A 3PVBB 5DZEA 4PHZA 2FMDA 1UXZA 2XB6C 1FOD1 1N1YA 2CL2A 2QE3A 4WM7C 5FYVA 3UKTA 1ZZBA 1TME3 1JMUB 1D4M3 2C6SA 1IS3A 3HN3A 1W8NA 4JGZC 4CDWC 2WNEA 4CEYA 5D8AA 1EPZA 4XTPA 5B2GB 2IZWA 1K5JA 2YC2A 2GMPA 4M01A 2WUHA 4IEOA 3AZXA 3NW4A 3TNPB 1UU5A 4YLZA 3LD8A 3A0NA 4RSUA 1V6JA 3KVAA 5FCCA 3H8XA 4NN0A 1RUG3 1V6NA 1R093 3PJQA 3VD3A 3O1MA 3ZN5A 2NQYA 4Q0VA 1O4YA 1QXPA 5JIUA 4U2AA 2O14A 1HN0A 4EE2A 3BPSA 4PIXA 3VL8A 3J26N 5B4NA 1H1MA 3WF2A 2R32A 3ASIA 4MV2A 3WW4A 1I5PA 2D3RA 4CDQA 4HK9A 1RTVA 2BNMA 5GZGA 1OH4A 3BIWE 2D6NA 2J1EA 5JXGA 1LHVA 3FFZA 2YROA 2BWCA 2HWC3 3DPRB 2F17A 2YHJA 3ST7A 2ARBA 5CFCB 1RUJ2 1EYBA 2ZX0A 1HQLA 5FXVA 5JZGB 3W58A 3O0VA 3WW3A 2VG9A 1P8JA 2HYKA 4X6RB 1VBA1 1U5IA 1AL22 3PVEA 4GAZA 1NAEA 4Y33A 4RQPB 1HQWA 4Y20B 2D6MA 2BUKA 2GZWA 2KM2A 1K45A 3DPRC 1YLLA 5CFCC 1RUD1 5GZFA 5A7SA 3J4UH 2DFBA 4C1WA 4M0HA 4E27A 4AQTA 5FP7A 2C9KA 1RUF1 5FV3A 4GWNA 1LB2A 1RUI1 2R062 3GBWA 3LDBA 4XVHA 3TOJA 4GJZA 4OI1A 4XBQA 5L9RA 1OFNA 2WO3A 3LSDA 4UT5A 1S0JA 1OUXA 3ZYPA 2FD8A 5FZDA 3TN93 1ND2B 2D44A 3WNXA 4BJ0A 3RYKA 4AEDA 1Q8VA 4X6QB 3I2IA 2J1VA 2P34A 1FMD1 1UZ0A 1X82A 1FOD3 2B46X 3D0SA 1GZCA 4CXXA 1OXCA 1ODMA 2VOXA 1VJ2A 1JYIA 1QJX2 2IFWA 2QQNA 3LFIA 2UYBA 4SBVA 1FPN2 1IZ3A 1PO11 3KV5A 1K42A 2HWD2 2J1UA 1K5MA 1N3QA 1HRI1 3KCCA 2IFRA 3POBA 1DZRA 2G9FA 3FLRA 2C0ZA 3Q9OA 4JC1A 3KV4A 2DCKA 3U4XA 4GD4A 5BNPA 4QU2A 1PVC2 4YGDA 2DDUA 3GGLA 2CGNA 3PUHA 3I2JA 5AVAA 4XACA 3T0BA 2JIGA 5LB6A 1F4HA 3MO4A 5ACA2 5ANNA 1RUH3 2OS2A 3RSJA 5A6YA 1EAH2 2QVSB 4YM2A 1OKQA 2PLV3 1SQ4A 2YGLA 1RVF3 4HPKA 1CIWA 5J98B 3V0BB 1TG7A 4XABA 2BVVA 2ZX4A 2RE9A 5K7PA 4XHBA 3AZYA 2V4VA 4TLFA 1HW5A 2Q5TA 3N3HA 3WG2A 4HG6B 5HCFA 3VBSB 3JUUA 1REEA 4TWTA 1ULGA 5T5JA 3ZYJB 3VKLA 2A73B 2VCAA 5ABJB 1LOFA 4CSWA 4R9DA 3LEMA 4FBFA 2RS12 4MHRA 1CPNA 1MS5A 1V6LA 2RMU3 3AZVA 3OBTA 5FYHA 4A4AA 5JOXA 4QX8A 1QIQA 4CCDA 2XG3A 4ORFA 3VBSC 2ZKNA 1H4GA 1UU6A 1VBA3 5AFBA 3CQOA 3SCGA 3ZDSA 1AYN1 3CJXA 2XGXA 2VOTA 4D0QA 2WBKA 4D6QA 5ABJC 2ZBJA 2OX0A 3RJRA 5JOZA 3MICA 1W0PA 3ELNA 4CEYB 5BNNB 2ZMLA 2GH2A 4QXCA 2ATFA 1CAWB 2ZMNA 4NJ4A 5J36A 3J8F1 4KG0A 1VBE1 4JHZA 1AR92 1UCXA 3ZPOA 4O61A 4I0BA 1RUI3 4W8JA 3OOXA 5BXXA 4ARYA 1UMIA 3RGBA 5BNNC 2W92A 4CEWA 5LBCA 5I0DA 3V65A 2HWE1 1N3PA 1OUSA 2E9QA 5BV6A 2RG4A 3U11A 1O7FA 5FJKA 4XXPA 3WD5A 3MF6A 3SITA 4BB3A 1FMD3 4K9SA 5F5IA 3KM5A 4CDQB 3LAGA 5FREA 2JXAA 3AFGA 3AP9A 4D7TA 3RZHA 3LIHA 4A2UA 1AF9A 2RDQA 4PBPA 1IOAA 5FPBA 5A1LA 3M8LA 4XURA 5FZFA 3D8CA 1URXA 2ZHNA 4AQ6A 3DUIA 3HMYA 4P9WA 1FV2A 1J3PA 4CE8A 2AENA 1GANA 2GP3A 1NT0A 2RR11 1JTZX 3POWA 4JKKA 4DOUA 1GU3A 1ASJ1 3FFQA 4XJUA 3KLSA 3MFAA 1VBC2 3PURA 4NAOA 1ONAA 4AQ2A 1LEMA 1LHNA 4CCJA 2YC4A 4LTAA 4K1ZA 4GKXA 2OPWA 1NQJA 3GALA 3K48A 2QZ2A 4A3ZA 5BNOC 3S0MA 2VW0A 4YPJA 4YZ3A 1HV0A 1ZBA2 2XH6A 4ATFA 2X5IC 4OI0A 1ENXA 3SH5A 1DU3D 1V6MA 3A7QA 1XNKA 3CZUA 1UZVA 1FX5A 5DAPA 2Q8CA 4FQZA 2X05A 2P6HA 3ZMOA 4AW7A 4COVA 2FDFA 1AR62 2QZ3A 1SG3A 1VR3A 1C8M1 1G8WA 3JCIA 4Y1YA 5F7UA 5JSRA 5FOJB 1BMV1 4OCTA 3SC7X 2VOWA 3W5NA 4A6OA 4JCKA 4AEDB 2W87A 4IV1B 3MPBA 3VZKA 4DINB 3OJBA 2YV8A 5GM0A 3EYPA 3QH7A 2WR9A 4KBBA 2QTWB 4YVSB 3RYRA 4BQ3A 4IEZA 3LA3A 1WMXA 1XOYA 4YFWA 5DUWA 3WQ0A 1PK6B 3JBG3 3WZ1A 2EA7A 2ZACA 5C4WA 2IXJA 5B4XA 4D6RA 2BW8A 4NHMA 4IV1C 2RS51 1YQ5A 2GH8A 1VB4A 5F6LB 4B29A 2VUDA 4L11A 2C24A 4B1MA 2V4AA 3BTYA 4AVVA 4WVWA 2VXJA 1UU4A 3UKVA 4XF9A 1PK6C 1ULEA 4IV3C 1GUIA 2VMGA 1IPJA 3ETQA 3H50A 4ES9A 2WN2A 2LALA 2XKPA 4OUEA 2WWJA 4YZ4A 3LWCA 3HAGA 3LOBA 1YFUA 4Q26A 2V73A 4HPKB 4PIZA 5FWJA 5IK5A 2OZ6A 3ZFGA 3VBUA 4BMEA 1JYTA 1TQ5A 5JXIA 1KJRA 3CBNA 3GZAA 4JAAA 2Q8OA 3L9JT 1CAXB 1ZRIA 1AR81 1VBD2 2R16A 3J7HA 3KT7A 3MDPA 4FOYA 4M3CF 4NIIA 4LLOA 2GAUA 4RFT0 4B4QA 3F2ZA 2PQQA 4I0WB 4W65A 1DQ2A 4K21A 3GNEA 4Q4W1 1LJ7A 2RR13 1AR72 2Y6LA 1DLCA 1HRV3 1UZZA 1YQCA 4Q27A 2CHHA 1AX0A 5I0UA 2J7MA 1X33A 2ZAHA 2Z69A 1GWMA 5E16A 4UWDA 2JG9C 3H7YA 2C5DA 5DDJ2 1BEV2 4S2HA 5C5TA 2PHWA 3S57A 1DYOA 1HKDA 1UY2A 4QGLA 1DCSA 4C8DA 3FUOA 3HQRA 1W2NA 2FQPA 5JXJA 4LKSA 1MR5A 1UNBA 1WCSA 2R7EB 2VZPA 2N7GA 3AKPA 5FP4A 4XBNA 3BUCA 4OHYA 4P9GA 2FMYA 3QH6A 1C8M3 4N8MA 4UOJA 5SV8A 3B01A 4A6SA 1QJY3 4CDXC 4CP1A 1PMHX 4IE6A 4CXYA 1C1LA 5DZGA 3ZXFA 3A22A 3CJIA 4C90A 4WVMA 4MZUA 4BXFA 2CWSA 3HIFA 1S0DA 1DGRN 1V6KA 3VKNA 4CU8A 1L7QA 5FYMA 4V2WA 3GCWA 4XW3A 2CAUA 3EHKA 3RZJA 4QM8A 1VB2A 2A71A 1XNTA 3B02A 3PTRB 4BISA 2EIBA 4NIGA 2ADDA 1X8EA 1QEXA 1CPMA 4GH4A 2RS53 1PGW1 3JD71 3KCXA 1H2MA 3HNYM 3NV4A 2HBTA 1TMF1 1QXRA 4IGOA 4PF1A 4Q4X2 4AE2A 5BUVA 3FLTA 5C70A 5LRRA 3BCWA 4I01A 2NMNA 1JU3A 4AFMA 3AMNA 4AHWA 3AC0A 4LUKA 4KWUA 4P9JA 4CTEA 4XJZA 2K2SA 1JS9A 5JPMB 1YWKA 2XHNA 1QQP2 2ZHKA 2Q1MA 3INAA 4JTNA 3WDXA 1MEC2 3RYPA 4DO0A 2BP6A 1RYYA 5IK4A 4L97A 4D3WA 2WZR1 2O0OA 2Y38A 3SCHA 3FL7A 1NOVA 1GP4A 2QQIA 4AI3A 4E9KA 1AR83 3APBA 4KU8A 3RFRA 3KWVA 3WP3A 4DNYA 2GN7A 5A3UA 1GQPA 2O1QA 2RDSA 3I4IA 5I8YA 2ENRA 1W90A 2RDNA 1O4TA 3U1XA 3NAPC 4Q4W3 1L7RA 3H8OA 2BGOA 2Y6KA 4AK3A 5L7OA 1C5HA 1NG0A 1R1A2 2AACA 2BWAA 4WM8C 2QNKA 1S0GA 3LFMA 4QQLA 2D97A 4TN7A 2HWF1 2YY1A 2PAKA 1CZSA 4UFKA 2Y34A 2R073 4LXLA 4DY5A 2MEV3 1FV3A 2XMLA 4XDQA 4J1WA 4ZPIA 4CUGA 3I2FA 1EY2A 2JDYA 2VBDA 3PHMA 4INDA 1ND3A 3WUCA 3UT0A 3ZSKA 4MG2A 1CN1A 2VVDA 4YW6A 3VBHB 1XNDA 4QKBA 3KF3A 1HDKA 3VZOA 2DCTA 5EP9A 1UW8A 1MZFA 3PUAA 3EB7A 3HQXA 3R0RA 3TNQA 5FOBB 3MV11 2ADEA 4WZCA 3DL3A 1V0AA 4YGBA 1W6QB 3SNMA 1COV3 5GZDA 4AHYA 1H1AA 4PI0A 3ZFGB 1L3JA 4GB31 1SACA 1K12A 3VBHC 1RIRA 1UOJA 1NCQA 1ENRA 2VY0A 4IETA 4Q29A 5IVYA 1N1TA 1R082 4LBNA 1REDA 4BE3A 4GMP3 3GZEA 1KS5A 2QFEA 3ZXKA 5FTTC 3AVSA 5JVVA 1NE4A 4GWIA 1PIV2 2GN3A 4LK7A 4Q4Y2 3MHZA 3AB0A 3PVNA 4XF3A 2NZ9A 1FXZA 4MXWB 5FPUA 5JPNB 1Y9GA 4YSFA 4QAWA 1DZTA 1C4RA 1GOFA 4LA3A 1NKGA 4N53C 5FDBA 2B9UA 3WDVA 4ATEA 2IXCA 5JWPA 2ETEA 3WXPA 4R9AA 4ZHNA 2A6ZA 2WNVC 4HBNA 4PLMA 3WF4A 2Q30A 4XIKA 3FWEA 2WZR3 1JODA 4E4SA 3FHAA 1Y9MA 4XC9A 1ULFA 1UYXA 1XE7A 4XAEA 1X9PA 2EF6A 3VB9A 2JE8A 5EZWA 3ABZA 1W6OA 4AVCA 4P9YA 4K7JA 2RS32 4ZXEA 2EXHA 3LDKA 5JR2A 1H9WA 1QMJA 3NNFA 4UFIA 5F6KA 2V5YA 2VZRA 4DQAA 1LGBA 1RITA 3AK0A 2DVAA 2XKOA 1NCRA 3W21A 3THPA 2WAAA 4BMBA 2PELA 3CIHA 4D7SA 2EAKA 5H9SA 4EYUA 4U36A 3N7JA 1W6NB 1OD5A 3AMQA 4OHZA 2ZGLA 3MI8A 3WP4A 2HWF3 4P5HA 1U5XA 4DS0A 5A7WB 1XPWA 4KBZA 3POJA 4QPGC 1RHI2 1QJZA 1SMVA 4GH4B 3ZX7A 5HBAA 5FZ0A 5JUVA 3TEZA 1X50A 2VUAA 2B4KA 4JVAA 4BU2A 2ERFA 1LOBA 4P14A 2RM21 1PMJX 4NROA 4EZ4A 5FK7A 2EIEA 2VZ1A 4CCLA 4CDUA 1RUOA 5F5CA 4ASMB 4XCBA 1GR3A 3AKRA 4QQHA 2XJVA 4UBHA 4NUBA 3LPFA 1GFF2 5IW0A 3NMBA 3CF6E 1H8TB 5G05L 5L9VA 3WDWA 3MW3A 3QLQA 1UKGA 2KD7A 2DCZA 4TYSA 4YZ1A 4NHLA 5LASA 2DVBA 1WLCA 5JOYA 4LK6A 1JXNA 5LA1A 3M3QA 4WM7A 3I2HA 2W95A 1HB3A 1GLHA 1RUJ1 4XBLA 1H8TC 5FY9A 2YPJA 4IEQA 4A41A 4D69A 2YU1A 5FAXA 2PAMA 4QT6A 1HJFA 1OQ1A 1V00A 1LOEA 5L7OB 4JQRA 3ZYFA 1CAUB 4EZHA 2AEZA 1DGRA 2W1WA 2FDGA 1J3RA 1WCQA 4DUWA 3FMGA 4MGIE 4S2GA 1OVSA 3A0KA 3SCFA 2E31A 2VNRA 2KR2A 1XE0A 1SBFA 4CUCA 4XQDA 4BHPA 3V64A 3E1F1 3WV6A 2VAUA 4X8PA 1A3KA 4WZFA 2V5DA 5F37A 4Y1VA 3VDDC 4XJAA 2BERA 3H1YA 4XQWA 5DAWA 2VC9A 2R061 3RQ0A 3MIBA 1O3QA 5KHGA 1HIXA 1JUIA 1QU0A 2ZZJA 3CDZB 2NP0A 2TNFA 1W9FA 3B9CA 2EAAA 1UD1A 4JQTA 1FYUA 4UXAA 1RUE3 2G4IA 3T2PA 1S0EA 1CESA 1RXGA 1S55A 1N3OA 3B3QE 1MZ5A 4FPOB 4NRQA 2ZAAA 1Z7S2 4XILA 4BDVB 4BK5A 2VW2A 2W5FA 5K0UA 2YFUA 1ODNA 3AJYA 1KFUL 4NHXA 5FYSA 5FLIA 5LK5A 1FPN1 1NCQB 3QBQA 4LJHA 2HWD1 3NNGA 3UJQA 2WSUA 1SLCA 2TEPA 2BVBA 4AVBA 3H1MA 5EXOA 1SCRA 2Y8KA 4LBQB 4B3NA 3NKTA 3NV1A 3OY8B 5KBFA 1GZTA 2XQRA 5D21A 3PMEA 3SEEA 4BQ4A 4DEVA 2RM23 4AFCA 3UNPA 5AC91 1OURA 2D93A 4BM8A 3I3EA 1H6XA 1VBB2 3VBOC 4YM3A 3VZLA 2VCMA 2IXIA 3RI8A 5HCAA 1NA1A 1W9TA 1IKPA 2ZMKA 1CZVA 4CVUA 5KC6A 2Q1FA 5HCBA 2W0XA 1B35C 4AGRA 1U12A 2ARXA 5ERLA 1S0CA 3JB8A 2BNOA 2Y26A 1D0HA 2RS11 4H7MA 3P6BA 3MZHA 2RV9A 3MLKA 1WCKA 3AZZA 4L92A 4HSLA 4XJ9A 5FBJA 5DAQA 3RNSA 3LSEA 4P9XA 1V9U2 2C4XA 2WINB 3MIHA 4RS5A 3K3NA 1S1AA 4Q0PA 2JKXA 1NCRB 3IDAA 2XBO2 2X53S 5IWFA 5JOWA 4XMAA 2ZGUA 5GLVA 3ACGA 4I09A 4KQ7A 3WEZA 3SKJE 2LTNA 1ENQA 5FKBA 1RL3A 4FOQA 4HONA 4CU9A 4FFHA 5I8TA 3V0AA 2EVXA 4PI2A 4HT1T 3I2KA 1BVP1 1H0BA 5LY2A 5CFDA 2WWUA 4MGSA 3VKOA 5IAVA 1GQGA 2VZSA 1J59A 1DBNA 1AJKA 2KXLA 3MGUA 3AZWA 2W1SA 4RR3A 1NY72 1IGOA 4B4PA 3CU7A 1QJU2 4CDUB 2W46A 3DYPA 4YG0A 5GLWA 5A7QA 4HETA 4LBOA 1AYM2 1F31A 4M3CA 4OFGA 3UETA 4UFLA 1ZZ8A 1F5JA 2WO2A 1LKNA 3FBYA 1IQAA 3KV6A 4BK4A 4CU6A 1JBCA 2VZTA 4ASKA 5DZFA 1Q43A 1EP0A 1X9TA 2GC1A 4YYOA 1LODA 3K51A 3FHIB 2W39A 1A8DA 1UPSA 1XU1A 1UY1A 1Q3EA 3HEIA 5I91A 4FTSA 1MPXA 1RJ8A 2DFCA 2OT7A 1A34A 3VZJA 4P9IA 2IWGB 2CWMA 2P6CA 2XJTA 1Y7BA 2Y0IA 4E8DA 2VECA 1VBC1 2WFPA 4QXBA 1HXS3 2W1UA 2FCTA 5AC93 1YNAA 5HV4A 1A6CA 5FJHA 5G04L 1BZWA 5LWBA 3VHNA 4EWAA 2PFWA 5FZ8A 1W6PB 2OIIA 2LRPA 3KZ4C 4XUOA 2Q8DA 1ZBA1 1MS0A 3IT8A 4Y1ZA 5C5UA 2VBPA 2VCCA 3SHRA 2Y33A 2YB7A 2WO1A 1GOHA 2VMHA 4LA2A 4O7XA 2VTXJ 3PUQA 1JH5A 5FUNA 3THCA 4L2NA 3MLLA 5FP8A 2QJVA 5FPZA 4NOTA 4W50A 5FZEA 2VZUA 4KGGA 1NUKA 1HB1A 3OYWB 4W6WA 5F3CA 4XFFA 4PCRA 3M3IA 2J1RA 2VVFA 4BXSV 1UAIA 5A3TA 2WFF3 4JRAA 1IKQA 4EN6B 3O14A 1JHNA 4R4XA 5F32A 4OHXA 5A3LA 5K4LA 4GIQA 3J7LA 3M3CA 1CGPA 5K0UB 1G9DA 3IAQA 5FZ1A 4QB6A 1EV12 4XPVA 4PDWB 2A3XA 2ZZQA 4ONUA 2DWRA 5A70A 2VJXA 1ACCA 2GU9A 5JZGC 4IEUA 1OA3A 2ZEZA 4NHYA 2FHRA 3VBRB 4RYDA 2VNOA 2ZGPA 5FY1A 3GZTB 4HANA 1OOPB 2A6WA 2FDJA 2Y6JA 5FZAA 4C0HA 4RQPC 3IAPA 3ATGA 1E5HA 1RMU3 4PDWC 2OYZA 3POGA 1W0NA 5LATA 2UY8A 3B00A 2AZ5A 4LOSA 5FZLA 5LEJA 2UWCA 3UESA 1G7YA 1DP0A 5CYYA 1YIPA 2WS92 3N35A 3VBRC 1UY3A 2XPJA 2HWB2 3B9IA 5EQUA 2WN3A 1DQ4A 1OOPC 4AI0A 2VVEA 1L7LA 5T5LA 5F9TA 2BOIA 3WX5A 3EO6A 3EJKA 3O1UA 3MPPG 3GXUA 1CJDA 3ZYHA 4DEQA 1VBD1 3JXSA 4KI5M 4SLIA 3DXTA 3SKVA 4FPEA 3HPNA 1WW5A 4EWDA 1ND2C 1YQ6A 4XETA 3I2GA 4XYXA 3Q8EA 5FY8A 4AI8A 3VD5A 4URAA 3BODA 1PM7A 3OEAA 1ZRDA 4ZY9A 1GNZA 3ZN4A 4ZXKA 1RUC2 3BOWA 1UYZA 3LPGA 1PNGA 5F2SA 3C7EA 1VBC3 4UBGA 2VPVA 1WCUA 3LF7A 4PIYA 4YW7A 1UN1A 1BLZA 2OZJA 2SBAA 3PU3A 4DB5A 3N4MA 3AMPA 3HNBM 1BBT1 1GZ9A 4FPKA 1O6UA 2CSGA 1NLQA 3V0AB 4FP3A 4BQ2A 1TME2 2R0HA 3USSA 3NNJA 1YCIA 3KD4A 1D4M2 5FR3A 3IWZA 1YO8A 4JTOA 5A3OA 3ZYBA 1W39A 4FP2A 1HN1A 1VP6A 3QCWA 4GZ9A 4N43B 4RR3B 1NE6A 3ILFA 4CYDA 2D98A 2QQVA 1BJQA 3NNLA 4JGYA 1PNFA 1I9RA 2X10A 5KHHA 4M3CB 2BEOA 1DG6A 5FXWA 2XJSA 1RUG2 2XJRA 4MYEA 1R092 1YI9A 4ITCA 4KNCA 2GP5A 3JU9A 2CAVA 4Y3OA 4BIFA 2JECA 2WQ4A 1OLMA 3ZXDA 3O1SA 4AVTA 4N43C 3B69A 3U4SA 2BBAA 3WNPA 3WNMA 3LEIA 1XYOA 3N7KA 2XWBB 2AUYA 5A3MA 1TE1B 1JZ5A 2XUEA 1SLIA 2O8QA 2E26A 5H9QA 1RUD3 1EPWA 4UF0A 3AKTA 1ST8A 2PHDA 3IBMA 3MV01 5D8AB 2JB4A 3WG1A 1G9AA 1H9PA 4Q4X1 2D3SA 1E57A 1JHJA 3WDYA 3ZO0B 3T30A 5FYBA 4XFIA 1RUF3 2HWC2 2AH2A 2E63A 3BGAA 2A75A 3R4UA 2WT0A 1G6NA 3WW1A 4A7ZA 4FPLA 3GBGA 4CEYC 1QOSA 2R1BA 5D8AC 1QQP1 5FZ6A 1MEC1 4LORA 5F1RA 1JUHA 2CYFA 4CZSA 4IEVA 4NWWA 4DZGA 3BTZA 3VHPA 3WG3A 4IXLA 4H14A 3N9MA 3HOBA 3TB0A 2J42A 4KL1A 4DRVA 1H4HA 4QU1A 2CTVA 1PO13 2QQMA 3KHCA 3QACA 5JXHA 2YBKA 3Q8BA 1HRI3 4HXCA 3ZKYA 4IL7A 3IZOA 2VU9A 4W6YA 3A4UA 4MGZE 1QDCA 2G9ZA 4NRMA 3Q8CA 1R1A1 4DXRA 3POFA 4AEKA 3UGGA 4CDQC 3F95A 4Y26A 3WHUA 4E2GA 1C3HA 4I2OA 3OTFA 1DQ0A 2PHRA 4IGPA 3ACFA 3TN92 1W28A 4F83A 4XDPA 1W8FA 4Q4V1 2RJKA 3Q8FA 4COZA 1C1FA 1BBT3 3NRUA 4BIOA 1FOD2 4QGMA 1SDDB 3ZXEA 5IVVA 1AUYA 1W06A 2FDHA 4KH9A 3BALA 4P08A 2HYXA 1XU2A 5J37A 2PN5A 2VUJA 4Y5TA 3SH3A 4N7IA 4LO7A 3HWJA 4MGYE 4B8EA 4PLOA 4QPWA 4MO3M 2P17A 4BLJA 3ZM8A 4IE7A 3IM0A 2VH9A 3ZFFA 2P3YA 1LHWA 2ZABA 2NMOA 2GMEA 2WNUA 4QDSA 1N1SA 2ZGOA 2X09A 3C7FA 1Y3TA 1RUH2 3PNAA 5FZGA 2WABA 1AYN3 1H2LA 1R081 2PLV2 1UO9A 3D5OA 3NVCA 1GV9A 1RVF2 3T09A 3HBKA 4AAPA 5CVRA 1W2AX 1WKYA 3PUSA 2WT2A 4XTMA 3U14A 4DIQA 4EV0A 1KDKA 1JI6A 4XF4A 2EXKA 3RRDA 1PIV1 1K5MB 3NJZA 4AEDC 2P37A 2XJUA 1OT5A 3J8F3 1JYCA 1X8MA 2PHLA 3ZVXA 3AYDA 1VBE3 1OI6A 3M4FA 4YARA 1OQEA 5DG2A 4YVSC 1O4ZA 1PO21 1YYNA 1F9KA 4AI9A 1APNA 2RMU2 2XL9A 5BNPB 4A44A 1J84A 4XUTA 2RJLA 4COUA 5IK8A 4R9BA 5FQ0A 2Z79A 1K5MC 2HWE3 1RGSA 4EQVA 1VBA2 2JJ6A 5FP3A 3HD8B 3CO2A 1U5YA 4FPGA 3HVDA 1LR5A 4BPZA 1MVQA 1QKQA 1FAYA 5BNPC 4LQRA 1POV1 3ES1A 2B5HA 4H55A 2D6KA 4P00B 1B09A 2BNNA 4HK8A 4AEMA 1ZA4A 1LHOA 5GZEA 5IFTA 5T3NA 2YUEA 2RS31 4QX7A 3NV2A 3OGRA 3U78A 3HBZA 1SFYA 4XUQA 4JGYB 3ZXJA 4XF1A 2E7QA 4FFGA 4UW5A 1RUI2 4KU7A 1OSGA 1QY4A 2CGOA 3RI9A 5DAVA 1MQTA 2JG8A 2H0VA 1GMMA 3DYMA 3NQHA 1ASJ3 2HBUA 1JYNA 4AFAA 4HN0A 4UFHA 1HX6A 5LA9A 3BTAA 4Q4V3 4YM1A 3WQ7A 2FDKA 1LOFC 2W94A 5I0TA 4I3GA 1FMD2 3B94A 2O8OA 5DG1A 2WKKA 2VZOA 4UF0B 3ZPYA 4BQ1A 3O1VA 1RJ7A 5E1RA 1KDMA 3ZYRA 1E5RA 3O1PA 4MGTA 5HV0A 1AX2A 1OF3A 4JKMA 3S5QA 3JB4C 2BBVA 4JZRA 4FPHA 1VMJA 3DKQA 4YM0A 1UQXA 3K2OA 4Z92B 4QB1A 4OYUA 1NYWA 3H3ZA 1UF2C 3KGZA 4CEWB 4LULA 5LA0A 4NPMA 5TSWA 4BQXA 3VBFA 1KFXL 4QDRA 2QQWA 2JICA 4HKOA 5FPLA 5A6ZA 2D6OX 1XYPA 5CBLA 3AP6A 2D43A 4YW3A 4O9EA 1Q56A 3CNAA 3AFKA 3NO8A 4KWKA 1S0IA 2ET1A 5H9PA 4QHOA 3H8RA 3M2MA 2LROA 4CEWC 2ZEWA 3WCSA 3LIGA 1UIKA 4XOGA 4YVWA 4DY3A 1DGWX 1ZREA 4FPFA 1POV0 3FBMA 4LE3A 3VHRA 5FO9B 2IXLA 4COYA 4AAXA 1PO23 4YZ2A 2PMWB 4M00A 1UY4A 4HSJA 4FI9A 5C8CA 5FZKA 3ZFEA 3WNKA 1JZ7A 3FC0A 2VZQA 1VRH2 4LHKA 5FKCA 2NM1A 5CEHA 3PL0A 1IS6A 1X7NA 2WSVA 2YPDA 1OQDA 1TZOA 3JBG2 3GHMA 2JIJA 4E4HA 1LNSA 3BN6A 3CZJA 1W6MA 4YW5A 2XVGA 4FSJA 4D6SA 2AGSA 2CV6A 4LEJA 4MUVA 1MZ6A 3LA2A 4IE5A 4I30A 3HR9A 1UXXX 2VULA 4CUBA 2DUPA 5CAZA 4XMIA 1GYKA 3I54A 3KSCA 3MBWA 2EALA 4P9LA 1WW4A 2A6XA 3X29B 4OQ9A 2WDBA 1TEIA 2WNUB 3GHNA 4DFSA 4DXZA 1LESA 1UX6A 3K4DA 4N9IA 1OF4A 3FZ3A 3U75A 1WLWA 1W2UA 2QDRA 4ZU5A 1W0OA 2WRAA 3D3AA 2UY9A 2E7AA 1N1VA 2F4LA 2LUWA 5C4WB 2GMMA 4L8QA 5EV7A 5F3GA 1VRBA 5T52A 4GULA 2BGCA 2WZPP 1W8HA 4FPJA 3URFA 2UURA 3MW4A 1UOBA 2OKXA 1MZEA 1WMDA 3POSA 4JX0A 4Z8BA 3LOIA 4QQOA 3UGFA 4NE9A 4A7YA 3H7JA 4MGKE 2QKDA 3WOGA 4ET7A 2PHXA 2VO5A 2ZEXA 2A3YA 4RHV2 3TWIA 3WINE 3WQBA 4E4DX 5C4WC 4FTEA 4QQ2A 5FLJA 2RR12 2C26A 3ON7A 5LZ6A 4AFDA 1HRV2 1UWWA 2RDRA 1C28A 4J1XA 5APAA 2DYCA 4B1LA 4C0BA 4CP9A 3M3EA 2FCVA 4GKYA 2UU8A 1GSLA 3ILNA 5FY5A 4AGVA 4BA6A 4D8MA 4W4ZA 3VBUB 4QXHA 1U5ZA 4ES8A 2DCYA 4MXVA 3OBAA 4YGCA 1WMEA 5DUUA 1C8NA 4CCOA 2ET7A 5L19A 5DAXA 4FT8A 2E51A 2QQLA 4FXGB 4R52A 1UIJA 3JD73 2OQ6A 4XDOA 1V9U1 1VIWB 1DYKA 2K0GA 2BV4A 1TMF3 3RMYA 3ZFGC 4D94A 3VBUC 1I6XA 2XBO1 3U0ZA 1MQTB 4NIDA 1DFQA 5FPAA 5C9AA 2IXKA 2GSYA 1Q8QA 1C8M2 4UW3A 1ZBE1 1BCXA 2ZCWA 4RGGA 1QJY2 3C8XA 1JOBA 4LBQD 1JZ8A 2B8MA 3ACHA 3CKHA 4Q1PA 5C3OA 3FJSA 1YQ8A 5T5OA 4GALA 3ZFFB 4P5YA 1JYWA 3EMRA 4OHWA 3N9NA 1VMFA 4L99A 3ZN6A 3KMHA 2OA2A 2A3WA 1EUTA 5FZBA 3HNMA 4QPIA 4Q0SA 5IJRA 1WW6A 2BQPA 3PJYA 1QJU1 3OUIA 2VTFA 1TVGA 3WF0A 1PZ7A 3M7AA 1QGLA 2IC1A 1IHMA 2RS52 3IB3A 4META 4RGKA 1AYM1 4QQPA 2JDHA 2W9XA 3K4ZA 1CAVA 2ZEYA 4J6GA 4K6BA 3WT3A 1H1IA 2ZGRA 4CCNA 4DPNA 4CA9A 1IPKA 1JOJA 4KWJA 3VBFB 4XFGA 3LGRA 3CJIB 4AOCA 1ZRCA 4WVMB 2ZJCA 3ROUA 1QHDA 1LULA 1Y4WA 1WBLA 1D0GA 3J9SA 5F39A 5EIYB 2BDRA 1XNAA 3ZSLA 2WA3A 4S2DA 3I59A 4K8FA 5EYYA 3I97A 4XE9A 5C6CA 3FX3A 2D5HA 1M4WA 5L9BA 3GJAA 3CJIC 4TSVA 1ZVFA 3NV3A 3E97A 4YVWB 1H30A 4M0NA 3TBDA 1FNYA 1LECA 5DMYA 3KGLA 2BYVE 4LHSA 3OGVA 1XQNA 5GLUA 3O0WA 4A3XA 2B7YA 2CGPA 1XJAA 2R042 3AYEA 2WT1A 3AYAA 4Q4W2 4YZ5A 3E6CC 3ZFEB 4ASLA 1AL0G 4GH4C 1QJEA 1OH3A 3JQWA 3RZGA 2G9GA 3OD0A 1LU1A 2XLAA 4RD7A 2XJPA 5FBZA 4GB33 3O5SA 4LR4A 1GBGA 1F15A 1OVPA 3NJVA 5EJZB 3C2UA 5A7PA 4XUPA 3JZVA 4OUSA 1W6MB 1O3SA 1DIWA 4RA0A 3T0DA 2BFUL 2I07B 2R072 3LKJA 4XZUG 2MEV2 4NR1A 4LIVA 4YWAA 2W08A 3G7DA 3G6JB 3EQEA 5EJ1B 3VDBA 5A1AA 4JGZA 4CDWA 1BK1A 3ACIA 4YG6A 4D7YA 1AL21 3VN4A 1GICA 3GM8A 1ZBE3 2ZTNA 2ES3A 1SPPA 3H0OA 1ULCA 2WYSA 1PGL2 5I0RA 1JZ4A 1COV2 1I3HA 1JW6A 3D0JA 3E6DA 5JI9A 4OULA 1SLTA 4Z2WA 4QDQA 3TEWA 1H8VA 4NWVA 2YDEA 2MPFA 4L9BA 2XWJB 3MIGA 1F4AA 5L7OC 3RZKA 2SLIA 4RFRB 1MVEA 3AKQA 2RJ2A 1WD3A 3DGTA 4GXLA 1OLQA 4CP2A 2GC0A 2R30A 2F4PA 4H7LA 1ND3B 3ZXGA 5IYYA 1G9FA 4RL7A 1DDLA 4Y5SA 2E6VA 5E8AA 4AHXA 2WS91 4FTBA 2PA7A 4H2AA 2VNVA 3WCRA 3AP5A 2ZPXA 5I0SA 3L2YA 2Q8EA 4HOOA 1LENA 1OA4A 2ZGKA 2Z2SB 3KT4A 5IVEA 1EUUA 2W52A 4FFFA 1ND3C 1QJX1 2WA4A 3QOPA 1IPSA 3OGGA 1HB2A 4FVVA 5FZ4A 2W91A 1F2NA 2IVIB 4PJYA 1WLTA 4PLNA 2E7TA 3T1LA 4LO4B 4AFBA 2WZR2 4OI2A 5IATA 3I3DA 3HT2A 4AHZA 3I2OA 3KS7A 3DPRA 1NZIA 1PVC1 5AFEA 5CFCA 4O65A 3ZYIB 3OBZA 3BIEA 5LEKA 1UOFA 1NCQC 1PX3A 4LBMA 3SH4A 5ACA1 5C9AB 5T50A 1G9BA 1BXHA 1EAH1 4Y22A 3WW2A 3VKFC 3LEKA 2R1DA 5LY1A 4Y20A 4XIOA 3LB9A 1CVNA 1TME1 1SEFA 2DVGA 2I45A 4LOTA 3SEPA 2DUOA 2DTYA 1YXWA 3AL5A 4H3WA 4AI1A 4QPIB 2XUMA 4B7EA 2GDFA 2DV9A 1NLRA 3H1WA 1C5IA 1WMFA 5LK7B 2K46A 5GLTA 2DF7A 4CPBD 2YYOA 3AX4A 2A70A 3SLIA 3WNNA 1RUJ3 1XC6A 2A1XA 1CAVB 1W6OB 1RUG1 5FZIA 1GP5A 1R091 3KHBA 4MH0E 4CP0A 1OBNA 2VMIA 2Y60A 4LMFA 4ARXA 1Z0HA 3E5QA 1AL23 3IDCB 3N7MA 4CP9B 3UYJA 2JDMA 2YFZA 4AI2A 4MGQA 4OHVA 3AMHA 3VUOA 5KXCA 2ZA9A 2E33A 1WGPA 2V72A 2PYTA 3I59B 1ZRFA 1M06G 1KRIA 4FAGA 3RMXA 1KXGA 1AXYA 2WWSA 2LM3A 1AR91 1NCRC 2VZ3A 1GZWA 2R063 2ZHMA 5HXVA 2DUQA 1S0BA 3H3UA 3C3VA 3GF6A 4HKWA 4UW4A 3AYCA 4ZKTB 3MIEA 5T55A 1VMHA 3KCYA 1N47A 2EICA 5DQ0A 4UAPA 4K3UA 3W5MA 4BQYA 3OPWA 4NO4A 1DYPA 1VAMA 1O8SA 2HEWF 4B7KA 4IGQA 5FMOL 2WAOA 4EN7B 3ITQA 5J3UA 4MADA 4CRQA 1QJX3 4Q1RA 4UFJA 3I3BA 1S4CA 1BQPA 2BTVC 4C91A 2BJSA 3VGIA 4CDUC 1FPN3 3A23A 3BYWA 1VAKA 2HWD3 2PHUA 5LA2A 3VBSA 1W05A 4E4ZA 4MOAA 4WM7B 1YFXA 4Q8KA 2HEVF 2YGMA 4XZPA 5ABJA 4LPLA 4LITA 1IS4A 5FWEA 3WLUA 1XXNA 2QCSB 2V09A 3ME2A 1PVC3 4CDWB 5CA6A 1ZA7A 3NNMA 4X8NA 3TN91 3WNLA 3E5XA 5EWSA 5ACA3 2JDZA 2GNMA 1RUE2 4LE4A 3OEBA 5DUXA 1EAH3 1SPPB 4HL0A 3IMNA 1DQ6A 3UKNA 5KHJA 5F5QA 2L9LA 5E88A 1ULDA 3WQ1A 5LRSA 2D3PA 2Q0AA 2XQXA 5BNNA 4IE0A 3WY6A 2NLRA 3P3PA 5F2WA 2JE9A 1VPHA 1CAWA 2ZGMA 3VV1A 1J83A 4YW4A 5FPXA 3N36A 2QQUA 3RPQA 1AR61 5IUQA 2P3KA 1O3TA 1SDWA 2HH9A 2YG0A 4LKEA 2RS13 1BVVA 3RS6A 3O1TA 1Q5OA 2YZ4A 3GJBA 1RINA 2WNOA 5D2AA 5SV5A 4OVEA 2RM22 1SLBA 2G19A 5FYTA 5EPAA 3HQUA 1RUH1 1XSRA 4AVAA 4MSVA 1PZ9A 2PLV1 2VBBA 1RVF1 2OPKA 1LU2A 3PIGA 5C33A 3WF3A 2OW4A 3T08A 3AP7A 2D6PA 1HV1A 4WVVA 1OA2A
chains in the Genus database with same CATH topology
4ISQA 3SMHA 3ES4A 4IERA 1QDOA 1OHFA 4R4ZA 3I2DA 1WW7A 5JLVA 4JDNA 2HJIA 1AR93 5JDBA 1WCDJ 2RMU1 5K0UC 3POYA 2UWAA 2ILMA 1U0AA 1OPOA 3PTYA 4R9CA 4R8HA 2X5IA 1RB8G 1WA4A 4GA9A 2ZOEB 2ZHLA 4Y22B 3RZZA 1O91A 3OBRA 1XNCA 4LBJA 1ZZ9A 3MYXA 5GALA 1G9CA 5I8SA 1NA1B 2AREA 2WIIB 1QF3A 4XF0A 2P3IA 1D2QA 3ZSEA 4I3PA 3IDEA 2D5FA 1T6GC 3M1HA 1ALYA 2XHKA 4BLIA 5BNOA 1KJLA 1NA1C 2ZKLA 1AR71 3E5UA 1AX1A 2H6BA 2RHPA 2VW1A 1ZRRA 4QPYA 4MLOA 4RS5B 4IV1A 3ZXLA 3WR0A 3O7OA 4NPRA 4M3CE 3E6BA 4TZDA 4YVSA 5DDJ1 1BEV1 3GYDA 2VNGA 1ZBA3 4NHKA 1PK6A 4IV3A 4EN8B 4RS5C 3AXDA 4YW2A 5CFDB 1ZX5A 3FUQA 4Z1VA 2F6BA 2WJSA 3MEPA 2NN8A 4F7ZA 1GZWB 3DV8A 4AEJA 1AR63 2EXJA 4A7KA 1O5UA 2A6VA 3ZXAC 1AXZA 3EBRA 4W6XA 1QOOA 3AM2A 3B93A 1NQDA 5HI0A 3R4DB 1GQHA 2K9ZA 1HXS2 5CFDC 4EWEA 1WUVA 2JEMA 4Y24A 5AC92 3OPZA 4I0AA 5E89A 3S7IA 1AVBA 3HN1A 4Q0QA 4RR3C 1S2BA 4HN1A 3TYJA 1QXJA 2OVUA 2NPIA 1V70A 4N7UA 4RGAA 1CAXA 3U07A 4IEWA 1C57A 2JD4A 4N9HA 4LT5A 2JG9A 1CX4A 3H8UA 1ZZCA 2WLPA 1WBFA 4BCUA 1MS3A 2WFF2 2DU0A 4HFSA 5BY5A 2BFUS 1VRH1 1GNHA 2D7FA 1YHFA 3JBG1 5KHIA 5KXBA 4FCAA 2ZGSA 4CDXA 1PVXA 5J48A 4FPYA 1VBD3 4BZ4A 1VAVA 5EJ3A 4MX3A 4QD2A 4AG4A 2EIGA 1LHUA 2CNAA 1IS5A 1AR73 1CJPA 4YGEA 1RMU2 4PF5A 3VZMA 5A33A 1XNBA 1DLLA 5GZCA 3T2TA 3KB5A 4URTA 5DDJ3 1BEV3 5CB7A 3OF1A 4QX5A 2DCJA 2OUHA 5J09A 2XVLA 1LOGA 4LHLA 5IK7A 1LCLA 1A8MA 1AJOA 3H9AA 4RHV1 1YFYA 3PLQA 5FO7B 3S7EA 2X5IB 1HRV1 2MNGA 5FFOC 2YMZA 3THTA 1CQ9A 1F5FA 1O5LA 4OI4A 3RWNA 2GNBA 3O12A 3V56A 5FRAA 3N7LA 3NAPA 1MS9A 3NSTA 5KXDA 3WP5A 3R6SA 4WM8A 4LO6B 5BNOB 1DZQA 1JN2P 4Q4Y1 4Q4X3 4JDMA 2DVFA 2B42B 2D40A 2DURA 1AZDA 1DGWA 4XQ4A 1QJY1 4AXOA 2WLQA 5BYNA 1YJKA 1TNFA 5KHKA 1VRH3 1QQP3 1RC6A 2A7AA 4OLLA 1MEC3 4G9SB 4IV3B 5GKAC 5C8WA 4Y1UA 5L73A 1ENSA 4LLFA 3HT1A 4QMAA 4XJ8A 1RUD2 4XJWA 2R6QA 2ZX3A 3ACLA 3OGJA 4BYYA 3RJ2X 3ALQA 2CY6A 3WDTA 2XLFA 4XFCA 4Z07A 4XXAA 3VBHA 1RUF2 5T54A 3QD6A 4E2SA 1R1A3 3R4SA 1QNYA 4UW6A 1S2KA 2C1FA 2R49A 2VOKA 4EJRA 5JSOA 3MW2A 5I93A 1W6QA 1CD3G 1I1EA 3PMSA 1D4VB 1UZYA 3SXWA 3ZSJA 5GJ6A 1HLCA 1KS4A 1Q8PA 1RHI1 4JGYC 4LO5B 3AMMA 1S0FA 3VKMA 5CIRA 4HKLA 2VOVA 2HEYF 4N53A 1ZZ6A 5FMOS 2JG9B 1PO12 2MHFA 4K1YA 4LUMA 4RHV3 1HRI2 2R041 4PQ9A 2WNVA 4MXWA 3WDUA 4K40A 1PZ8A 3DF0A 2BPA2 4OUMA 3RDIA 1OPMA 3CL1A 2KA3A 3GZUC 3BOPA 4S2FA 5FLHA 2X29A 3NL1A 5JAXA 5EYXA 5FO8B 4NVPA 1ZYBA 4FPCA 4N90A 3L2HA 1BBT2 1R083 3USUA 4CDXB 4FXKB 1MACA 2R071 2MEV1 5D1IA 5CADA 5CG9A 1KD7A 1LEDA 1SLAA 2PTMA 2YC0A 1XYNA 1PIV3 1Q8SA 4Q4Y3 2GNDA 2AYHA 3CLPA 5JI7A 1J1LA 1WD4A 3RG0A 2R0FA 3BPZA 3ECQA 4IEXA 2VXRA 4FAHA 1GKBA 4QPGA 1H2KA 3FE5A 1G86A 1PGL1 5A33B 2HKXA 1HQNA 1COV1 1XE8A 4YFZA 1UMZA 4ZU4A 4V1PA 2ZGQA 1W6NA 4XFAA 1DHKB 5CG8A 1PGSA 1QWRA 1AYN2 1LRHA 4IQPA 3ENRA 4GMP1 1J3QA 4KGQA 1SLLA 1SFNA 1POV3 2W68A 2WL1A 2DTWA 3WUDA 3OD4A 1DF0A 3J8F2 2RS33 1VBE2 1DQ1A 1D2SA 1Z7S1 4QXKA 2Q4SA 1H8TA 3VZNA 2HWE2 1OLRA 3W9AA 4BOWA 1YFWA 3NAPB 1RHI3 2ZGTA 2TBVA 1J1TA 4G3YC 3UV9A 4WM8B 3UJOA 3ZFFC 5DUVA 4EN9B 1NZCA 2WNUC 5I8TA 2IXHA 3D82A 4KG8A 5EFUA 3P3NA 2GNTA 2DU1A 3ZMNA 1BKZA 4EROA 4LO8A 5BPXA 2R043 5J96B 1X36A 1VBB1 2TUNA 2GALA 1Z78A 3VDDA 1KITA 3IPVA 1CAUA 5FQ0B 1YI7A 2JKBA 5K8SA 1ASJ2 4COWA 1PMIA 4ISRA 5BNQA 4Q4V2 4AVSA 2B45X 1Y43B 3CEWA 5H9RA 4HZFA 5JR7B 4HVRA 1R1ZA 4YNIA 5A32A 5J7MA 1NXMA 1FI2A 1LTEA 4GMP0 3TRSB 2H0BA 3S30A 1QH6A 2JG8B 2GC3A 2X8KA 4AYUA 1BMV2 3VHOA 1AXKA 1H2NA 2Z5WA 1XRUA 5DXDA 2UYAA 2QQPA 1YIFA 3DKWA 1MQTC 2D6LX 2JG8C 3ZIWA 1NLSA 1LOAA 4FOWA 3VBOA 3AKSA 4N53B 1NY71 3D4KA 4LBQA 5GLZA 4F8AA 2GC2A 3OY8A 1VLNA 4G4FA 2FZ1A 4I02A 2WNVB 1Y9QA 3ZSMA 1B35A 3IKWA 3UL2A 3NKGA 1PO22 1SCSA 4LBKA 1Z7S3 1VALA 1NXD1 3WVJA 1FT9A 1TNRA 2E53A 1YUDA 4DRRA 3USUB 3VL9A 2XL7A 2YXSA 3KT1A 1QOTA 4YRDA 3BB6A 3B5LB 4XFBA 4C1XA 3VBFC 5KC5A 3MLJA 4ZU7A 2OUJA 1O3RA 1AR82 3GBFA 1RUE1 1F8VA 4QPGB 1VBB3 3WHTA 3LA7A 5C8CB 3ZYGA 1SBDA 1AHSA 4YVWC 5L36A 1WLDA 4AF9A 3S6PA 3WG4A 4BH9A 2H6CA 3O0XA 4LHNA 4XEZA 4LBLA 4K20A 2VQ0A 2VQAA 3OCPA 4O9GA 4Y1XA 5T5PA 3T1MA 1QH7A 5C8CC 4HVOA 3UK9A 3ZFEC 2XLGA 2A6YA 4LNVA 1OFSA 2ZGNA 4F3JA 5JMCA 1V9U3 3PVOA 4Y5Z0 2XBO3 2FBEA 3M3OA 3ILRA 4AWDA 2QDNA 1EV11 4AQSA 1UPIA 4Z82A 2JX9A 3M70A 4Q2FA 5K9YA 3AJZA 1V6IA 1BYHA 1SBEA 1LOCA 5JIAA 3I7DA 1I5ZA 4FOVA 1QJU3 4Q8LA 4YW1A 3MFCA 3JD72 1PGW2 4HMZA 1LGCA 1AYM3 3R05A 4FO9A 1TMF2 3AXEA 3VDDB 3IPVB 4FQ4A 2Z42A 2HWB1 1OMIA 2A5ZA 2PAEA 1ZM1A 2WC2A 4AGGA 1W6PA 3FLPA 4DMIA 4OZXA 3I8TA 2DVDA 4YG3A 4XFHA 3AP4A 2B39A 1ZZ7A 3MIDA 4HVQA 2PHTA 5A32B 1CONA 1RUC1 3OYWA 1DGLA 4IEYA 2C9AA 3EXUA 3U10A 2I2SA 3SISA 1CR7A 5JZGA 3IDBB 1UL9A 4WVZA 5KXEA 3JQXA 2ZX1A 5IT6A 4GWMA 2UWBA 4QM9A 2XJQA 4RQPA 1PHMA 1V6OA 1D4M1 2ZS6B 4PDWA 4Y4YA 4IESA 5AVPA 3ZN6B 2XVKA 3KQRA 1YRZA 5C9AC 2Q1ZB 3VBOB 2HWF2 4JRLA 3VBRA 4B4RA 2P2KA 1OOPA 4HLTA 1Q8OA 1UKRA 1A78A 1B35B 1HXS1 1ZNPA 3NWKA 1KQRA 4EN0A 3MIFA 4KWLA 1MS4A 3LZZA 1ND2A 3LCPA 4QPIC 3IIAA 3MF9A 1EV13 1YJLA 3IN9A 4JV4A 3ZIXA 5JSPA 4GB32 4Q0UA 1J58A 4E2QA 1MS8A 2AR6A 2HWC1 3B7MA 3WP6A 4XHXA 2WFF1 5CU1A 3W59A 2WS93 3D6EA 2HWB3 3TAYA 5JCTA 1ZBE2 2Y0OA 2P3JA 1MS1A 2JENA 5CNAA 2FZ2A 4JDOA 4MVTA 2VGDA 3V0BA 1DQ5A 2ZX2A 3BU7A 4QHBA 2WQZC 2EXIA 4N43A 4QGNA 1FNZA 1REFA 1QNWA 3VLBB 2PHFA 4BWOA 5KWRA 1RMU1 1RUC3 4GQ7A 1FATA 4WBBA 4JGZB 4IEPA 2I74A 1LGNA 1RUNA 3DN7A 4WV8A 4PBOA 2NYYA 2QUOA 2JE7A 3PVBB 5DZEA 2FMDA 2XB6C 4WM7C 1FOD1 1N1YA 2CL2A 2QE3A 3UKTA 1ZZBA 1TME3 1D4M3 1IS3A 4JGZC 4CDWC 2WNEA 4CEYA 5D8AA 1EPZA 4XTPA 5B2GB 2IZWA 2GMPA 4M01A 4IEOA 3AZXA 3NW4A 3TNPB 1UU5A 4YLZA 3A0NA 4RSUA 1V6JA 5FCCA 4NN0A 1RUG3 1V6NA 1R093 3PJQA 3ZN5A 2NQYA 4Q0VA 1O4YA 1QXPA 5JIUA 4U2AA 3VL8A 4PIXA 3J26N 1H1MA 2R32A 3ASIA 4MV2A 3WW4A 2D3RA 4CDQA 4HK9A 1RTVA 2BNMA 5GZGA 3BIWE 2D6NA 1LHVA 3FFZA 2YROA 2BWCA 2HWC3 3DPRB 2YHJA 3ST7A 2ARBA 5CFCB 1RUJ2 1EYBA 2ZX0A 1HQLA 5JZGB 3W58A 3O0VA 3WW3A 2VG9A 2HYKA 4X6RB 1VBA1 1U5IA 1AL22 3PVEA 4RQPB 1HQWA 4Y20B 2D6MA 2BUKA 2GZWA 2KM2A 3DPRC 1YLLA 5CFCC 1RUD1 5GZFA 3J4UH 2DFBA 4C1WA 4M0HA 4E27A 4AQTA 1RUF1 4GWNA 1LB2A 1RUI1 2R062 3GBWA 3TOJA 4OI1A 4XBQA 1OFNA 3LSDA 1S0JA 3ZYPA 3TN93 1ND2B 2D44A 3WNXA 3RYKA 4AEDA 1Q8VA 4X6QB 2P34A 1FMD1 1X82A 1FOD3 2B46X 3D0SA 1GZCA 2VOXA 1VJ2A 1JYIA 1QJX2 2IFWA 2UYBA 4SBVA 1FPN2 1IZ3A 1PO11 2HWD2 1K5MA 1N3QA 1HRI1 3KCCA 2IFRA 1DZRA 2G9FA 3FLRA 2C0ZA 3Q9OA 4JC1A 2DCKA 3U4XA 5BNPA 4QU2A 1PVC2 4YGDA 2CGNA 5AVAA 5ACA2 1RUH3 3RSJA 1EAH2 2QVSB 4YM2A 1OKQA 2PLV3 2YGLA 1SQ4A 1RVF3 4HPKA 1CIWA 5J98B 3V0BB 2BVVA 2ZX4A 2RE9A 5K7PA 4XHBA 3AZYA 4TLFA 3WG2A 1HW5A 2Q5TA 3N3HA 5HCFA 3VBSB 3JUUA 1REEA 4TWTA 1ULGA 5T5JA 3ZYJB 3VKLA 2A73B 5ABJB 1LOFA 4R9DA 4FBFA 2RS12 1CPNA 1MS5A 1V6LA 2RMU3 3AZVA 3OBTA 5JOXA 2XG3A 4ORFA 3VBSC 2ZKNA 1H4GA 1UU6A 1VBA3 5AFBA 3SCGA 3ZDSA 1AYN1 3CJXA 2XGXA 5ABJC 2ZBJA 3RJRA 5JOZA 3MICA 1W0PA 3ELNA 4CEYB 5BNNB 2ZMLA 2GH2A 2ATFA 1CAWB 2ZMNA 5J36A 3J8F1 4KG0A 1VBE1 1AR92 1UCXA 4I0BA 1RUI3 5BXXA 5BNNC 4CEWA 3V65A 2HWE1 1N3PA 2E9QA 5BV6A 3U11A 1O7FA 3WD5A 4XXPA 3MF6A 3SITA 1FMD3 4K9SA 3KM5A 4CDQB 3LAGA 5FREA 2JXAA 3AFGA 3AP9A 4D7TA 4A2UA 1AF9A 4PBPA 1IOAA 3M8LA 3D8CA 1URXA 2ZHNA 4AQ6A 3DUIA 3HMYA 4P9WA 1FV2A 1J3PA 2AENA 1GANA 2RR11 1JTZX 3POWA 4DOUA 1ASJ1 3FFQA 4XJUA 3KLSA 3MFAA 1VBC2 1ONAA 4AQ2A 1LEMA 1LHNA 4LTAA 4K1ZA 4GKXA 3S0MA 1NQJA 3GALA 3K48A 2QZ2A 2VW0A 4YZ3A 1HV0A 1ZBA2 2XH6A 4ATFA 2X5IC 4OI0A 1ENXA 3SH5A 1DU3D 1V6MA 1XNKA 3ZMOA 1FX5A 4AW7A 4FQZA 4COVA 1AR62 2QZ3A 1VR3A 1C8M1 1G8WA 3JCIA 4Y1YA 5JSRA 5FOJB 1BMV1 2VOWA 4JCKA 4AEDB 4IV1B 3MPBA 3VZKA 4DINB 3OJBA 2YV8A 5GM0A 3QH7A 4KBBA 5BNOC 4YVSB 3RYRA 4IEZA 3LA3A 4YFWA 5DUWA 3WQ0A 1PK6B 3JBG3 3WZ1A 2EA7A 2ZACA 5C4WA 2IXJA 2BW8A 4NHMA 4IV1C 2RS51 2GH8A 5F6LB 1VB4A 4B29A 4L11A 4AVVA 4WVWA 1UU4A 3UKVA 4XF9A 1PK6C 1ULEA