3DN7A

Cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
146
structure length
146
Chain Sequence
b'MHTALINHIRKFIFLTDEDAGTLSAFFQLKKVRKKETLLKTGEICRINYFVVKGCLRLFFIDEKGIEQTTQFAIENWWLSDYMAFQKQQPADFYIQSVENCELLSITYTEQENLFERIPALERYFRLVYQKSFAAAQLRSKFQHMY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide binding regulatory protein
publication title X-ray crystal structure of cyclic nucleotide binding regulatory protein from Cytophaga hutchinsonii.
rcsb
source organism Cytophaga hutchinsonii
molecule tags Structural genomics, unknown function
total genus 44
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dn7A00
3E97A 1GQGA 5CVRA 4FAHA 2UY9A 5KHKA 1ZZ7A 3RPQA 3VHRA 1DZRA 1SFNA 1EYBA 4Z07A 5J48A 5E16A 4HMZA 4AVBA 2PYTA 2B9UA 3ETQA 4XF9A 3TNQA 4ZU7A 4XF1A 4IEQA 5JR7B 4E2GA 3LA2A 1Y3TA 3EBRA 4O9EA 3B02A 2C0ZA 2D93A 2XLGA 3SCFA 3QACA 1WGPA 4N9IA 5JCTA 4P9GA 3LWCA 3JZVA 3PLQA 3RZZA 1UCXA 4MGZE 4HN1A 2PAKA 1UD1A 2DCTA 4EV0A 2OYZA 4A2UA 2CV6A 3CL1A 2IXCA 4I01A 2IXIA 4QX5A 4ONUA 3N4MA 5FLIA 3O14A 4Z82A 3ELNA 3WW3A 3TNPB 1LB2A 1XE7A 3FWEA 5BXXA 1YUDA 4E2QA 4PIZA 1XE8A 1XRUA 3E6DA 4MGIE 1RTVA 1X7NA 2PQQA 4XEZA 5C6CA 4KU7A 3BPZA 3RYRA 4D7SA 3I7DA 2BNOA 4WBBA 5J3UA 3BB6A 1EP0A 3LAGA 1ZREA 3H50A 4ORFA 4QM8A 4XFGA 2WFPA 3UKVA 5I8TA 3H1YA 3GBFA 1UIJA 3H1WA 3H7JA 2OZ6A 2FQPA 5I91A 3MPBA 1RUOA 4MUVA 4KL1A 4XFIA 1GQHA 1OMIA 4WVZA 3SCGA 2PHDA 3OD0A 4XFFA 5HI0A 3FZ3A 4I02A 1CAVB 1DZTA 4X6QB 3USSA 4UBGA 3FE5A 2N7GA 3GYDA 3KMHA 5I0UA 1CX4A 2GC1A 2HJIA 1YFUA 3U11A 3CLPA 4J1WA 4H7LA 2ET7A 1UPIA 1YHFA 3IDCB 4QXKA 3I59A 3MYXA 4LUKA 3E5XA 5CADA 1ZVFA 1SQ4A 1YFWA 2EA7A 1YLLA 1CAXB 3H3UA 4PIXA 4CYDA 2GC2A 3IDBB 2BNNA 2BYVE 3M70A 1Q43A 3ES1A 5KHIA 3EQEA 3NSTA 4YRDA 4OFGA 3E6CC 4XFBA 2O8QA 3CF6E 1ZZ9A 3KGZA 2H6CA 3R6SA 4BYYA 3H9AA 3LA3A 4IEPA 3D0JA 5FDBA 4XFCA 4IEXA 5CU1A 2Q4SA 4AXOA 5F1RA 1I6XA 3LZZA 2PAEA 3KCCA 3HQXA 2UYBA 5J7MA 4X6RB 3KGLA 4JTNA 5I8YA 5FQ0A 4IERA 1QWRA 4PJYA 4N9HA 1YFYA 1NYWA 2IXJA 3M3IA 1ZRFA 2H0VA 1ZZ8A 2MPFA 4BIFA 2PA7A 3PVBB 3BALA 3CEWA 3EJKA 4HVOA 2XGXA 3NVCA 1X8EA 3H8UA 4LA3A 3SHRA 3RNSA 3CJXA 3C3VA 2Q1ZB 2IXHA 2PTMA 4EWEA 1OI6A 4XETA 1X8MA 1O3QA 1EPZA 4IEUA 4NVPA 3MZHA 1I5ZA 4HVRA 4HSLA 1G6NA 3E5QA 1NXMA 1OFNA 3ROUA 1LKNA 3D0SA 1HW5A 4MZUA 1PMIA 1QXJA 5KHHA 3RDIA 2Z69A 1CAWA 1IPKA 4I3PA 1J3RA 4O9GA 3ST7A 3NJZA 1J3PA 3SCHA 2CAVA 2ET1A 2Q0AA 3IIAA 4AVAA 2OA2A 2KXLA 4Q0QA 4RD7A 2CGPA 3HT1A 4LUMA 4AQ2A 5LEKA 2GZWA 4YYOA 4FBFA 4Q0UA 1O3RA 1SEFA 3FJSA 4QMAA 5KHGA 1CGPA 1ZZBA 2XHKA 1UIKA 4MH0E 4XF4A 2CAUA 2H6BA 1EY2A 2BGCA 4HSJA 1ZZ6A 2E9QA 2QDRA 3OCPA 4LTAA 4I09A 4YARA 2O1QA 2XKOA 5K8SA 1Y9QA 2GU9A 3NL1A 1CAUA 2QCSB 4FT8A 1J59A 4AVCA 3WW2A 5I0TA 4IEWA 4KWJA 4AQ6A 3LA7A 2XL9A 2GC3A 4YSFA 1QXRA 4IEZA 2IXKA 3MDPA 3EHKA 4BH9A 4HN0A 1DGRA 4EWAA 3UKNA 5FPZA 4XFHA 3S0MA 3SXWA 4Q29A 1NE6A 4JTOA 1IPJA 4I0AA 5C8WA 2XLAA 2K0GA 4EWDA 2Z2SB 5I0SA 3DL3A 3ZDSA 2F4PA 2ATFA 4HBNA 4WZCA 2PAMA 3S7EA 4TLFA 3NKTA 4LULA 2OPKA 2B8MA 4MV2A 2QNKA 4I0BA 4E2SA 4L11A 4HLTA 1Q3EA 3HT2A 4HZFA 4MGKE 2P17A 1O3SA 1NZCA 1WLTA 1FXZA 1ZRDA 3I54A 2OZJA 1H1IA 2UYAA 1DGWA 2PHLA 2XKPA 5I93A 3H3ZA 5LRRA 2K9ZA 2GH2A 1U12A 3QOPA 2WC2A 3S7IA 5AVPA 2GAUA 5BUVA 1O7FA 1PM7A 2QVSB 1ZNPA 2VECA 3FHIB 1J3QA 3OTFA 4F8AA 3G7DA 2ZCWA 5T3NA 2MNGA 3ES4A 3RYKA 2B5HA 1CAVA 5KHJA 4META 2VPVA 2EVXA 1ZZCA 4R8HA 4UBHA 2D5HA 4YNIA 2XLFA 3I59B 3DV8A 1WA4A 2XL7A 5KBFA 1YFXA 1UW8A 4KU8A 2V09A 3DN7A 3FFQA 4OLLA 3OGJA 5I0RA 1RUNA 5EZWA 3U10A 3IWZA 5LEJA 3UKTA 1NE4A 4JVAA 3SMHA 1JUHA 2VQAA 1O3TA 1CAXA 3CO2A 4GULA 4Q0PA 3D82A 4F7ZA 1L3JA 1X82A 4JV4A 5FCCA 4ZU5A 1LRHA 2D5FA 2BEOA 3L2HA 1ZRRA 3PNAA 1O5LA 2GC0A 4K8FA 4R52A 3WW4A 1O5UA 4HVQA 2IXLA 4IEOA 4B29A 4IESA 2MHFA 2ETEA 4FAGA 4QGMA 1OD5A 5FQ0B 5JAXA 5EFUA 1V70A 2FMYA 1RGSA 4IEVA 4Q0VA 3H7YA 3LOIA 1J58A 5LRSA 3ACLA 4LEJA 3WW1A 5E1RA 3RYPA 3KSCA 2Y0OA 1TQ5A 5I8SA 4DINB 4UXAA 1QY4A 1FT9A 3FX3A 4XF3A 1LR5A 4LLOA 4MGYE 3U0ZA 5FPXA 3BU7A 5D1IA 4PIYA 1YWKA 3HIFA 5FLHA 1ZRCA 4KWKA 3E6BA 2PFWA 5FLJA 2I45A 4IETA 1FI2A 4I2OA 3DKWA 1RL3A 4J1XA 4IEYA 5BY5A 2EAAA 1VP6A 4QM9A 3E5UA 4LA2A 1CAWB 2UY8A 5JSOA 5BPXA 4XF0A 1RC6A 4L2NA 2Q30A 4QGNA 2BNMA 3EO6A 3OF1A 3NW4A 4Q0SA 5JSPA 1H1MA 2ZKLA 4ZU4A 2HKXA 4KWLA 4BHPA 3BCWA 4QGLA 1Q5OA 1VJ2A 1VR3A 4MX3A 2D40A 3IBMA 4XFAA 3H1MA 5BV6A 5JSRA 2QJVA 1J1LA 1ZX5A 2IC1A 4EROA 1O4TA 4D7TA 1CAUB
chains in the Genus database with same CATH superfamily
1OLME 4UFHA 4GH4A 3ZPYA 4FAHA 1D2SA 3WNNA 1SCSA 1AYN1 1H9PA 2J1TA 2A71A 1WLCA 1LNSA 1HXS3 5CISA 1PGL1 1ZBA2 1C3HA 3ZXFA 1GFF2 3T2QA 1DYOA 1DZRA 3MFCA 4P5HA 2JDAA 4KG0A 3AVSA 4Z07A 3W59A 3JBG3 5A7NA 4XF9A 4KBZA 2JIGA 5ACA1 1XNKA 2JDPA 5JPNB 4IEQA 2VL4A 1FV2A 5A33A 2YU2A 2R7EB 5A7OA 4E2GA 4CP2A 2YV8A 3ZX7A 4C91A 1VMFA 1Y3TA 2BBVA 3PURA 3ZSEA 1AR61 1COV3 2XLGA 3C7OA 5G05L 3LGRA 1T6GC 2P3YA 3SCFA 2F6BA 2E26A 4JKKA 4HK9A 3LCPA 3LWCA 4P9IA 2JDKA 3ZSMA 3D4KA 2B45X 1XNBA 3ZIWA 3ZYPA 1IOAA 3CQOA 2NQYA 2WZR2 3KM5A 1FOD2 4Z2WA 2DCTA 2OYZA 3GJAA 1BBT1 1NQJA 5A6XA 2W1SA 3RJRA 4LBQA 1SFYA 4M3CF 1WWYA 3OBAA 1FATA 4ONUA 1KXGA 5FLIA 3USUA 3OB8A 1RUG2 4QB1A 1UMHA 1XE7A 3FWEA 3THDA 1YUDA 3I3QA 3WDWA 3E6DA 1LOCA 1AXYA 4YGBA 5J1XA 1YIPA 5A7WA 4BU2A 4W50A 1X7NA 3A22A 4AI3A 1UU4A 4M3CA 4Q4V3 5F3GA 4OZXA 5B4XA 3T3YA 2VQTA 2CYFA 1CIYA 4KU7A 5EV7A 1YQ2A 3G6JB 2DU0A 4HFSA 4DB5A 3GHMA 4D3WA 2WFF2 4MGSA 1VRH3 4KNCA 4RR3C 5J3UA 4CXWA 3BB6A 3MW2A 2HWD1 2OPWA 3GGLA 4RR3B 3LAGA 1RIRA 2RS32 5FO8B 1ZREA 4LQRA 2C6SA 1YQ8A 4XFGA 3UKVA 2DFCA 2HWF1 4W6YA 2DBNA 4SBVA 4YLZA 1C4RA 3GBFA 4JDMA 3UGGA 4YM2A 3H1WA 5T5OA 3U07A 1RVF2 1X33A 3AZWA 3Q8CA 3UJQA 2FQPA 1OQDA 1V0AA 5IWFA 1U5IA 1MEC2 3RG0A 4CCMA 3R4SA 3RSJA 2ES3A 3WUDA 5DG1A 2Y34A 1SBDA 4XFIA 1GQHA 3O1MA 1QKQA 4CZSA 2VVFA 2E33A 2JEMA 4X8NA 1W9SA 3M4FA 3OD0A 5HI0A 3OBZA 3VKMA 4CDWA 1CAVB 5GLVA 2VOXA 2JENA 2WYSA 3OG2A 3USSA 4GWMA 3SH5A 1HB3A 4HKWA 2N7GA 2Y6FA 2QQLA 4QX1A 3KQRA 1H6YA 1HRV3 1V9U2 4FP3A 5I0UA 1CX4A 2GC1A 1UZWA 1QJX3 1WZXA 2WZEA 2Z79A 3MUZ1 1J83A 4YZ2A 4J1WA 2WA3A 1JZ3A 4DFSA 3SC7X 4RSUA 3WG4A 1GWKA 3IDCB 3I2KA 2ZX0A 4QPWA 1C8M3 4W8JA 3E5XA 5GZDA 1SQ4A 1G7YA 5GALA 3DXTA 2B7YA 4IL7A 4NN0A 1VPHA 2EA7A 2ILMA 3O1VA 4CEYA 4PLNA 3RWNA 1VBB2 5A3WA 3H3UA 1RUG3 1HB1A 2W91A 3N9MA 2VOKA 2BV4A 2RJKA 2GC2A 4FPFA 3IDBB 5CG8A 3V64A 4IE4A 2BYVE 1Q8SA 3M70A 4JC1A 2BFUL 2E31A 2ZGNA 5L9VA 3C7HA 1CJPA 3VD9A 5IVFA 1DLCA 1SHWB 5JLVA 2PHWA 1WW7A 2A3XA 2VNGA 3CF6E 2IVIB 3KGZA 2RM23 3ORJA 2BZDA 3RZLA 1SPPB 1IS6A 4GB31 4FXGB 2OQ6A 4OUEA 4XAAA 4AQSA 5CU1A 4AOCA 3LPFA 1I6XA 4JX0A 3VBFB 1CQ9A 2PAEA 4B4RA 3AMQA 2OS2A 5KXEA 3NJVA 4WVWA 4XE9A 4X6RB 5F2SA 2D3SA 4YFWA 5I0DA 4N9HA 2RE9A 3JB4C 3M3IA 3POBA 1X36A 1MQTC 4NAMA 2BGPA 1ZZ8A 4Q4W1 4XXAA 4TYSA 4BPZA 1MQTB 4BIOA 3PU8A 5HXVA 1Z78A 1QJY3 2XXZA 2VMEA 3OEAA 1W9YA 2E7TA 3PUQA 1QJEA 2X29A 3BALA 3PVBB 4CP1A 4XMIA 4JRAA 1W8NA 1O59A 3NNGA 4LE3A 5BYNA 5IVEA 1O4YA 2W39A 2ZX2A 3CIHA 1HIXA 3GM8A 1AR91 3I2IA 2BWAA 1OSGA 3MLLA 1QIQA 4LA3A 5CFDA 4QKFA 1MZEA 2XR4A 2Q1ZB 3OGSA 2PTMA 2R30A 1W6MB 1HJFA 3OUIA 2WS93 4EWEA 3VHOA 1LTEA 1OI6A 2R1BA 3BIWE 4XETA 5DZGA 5ERLA 1VLNA 2GALA 3POGA 1EPZA 4IEUA 5IHRA 1OOPC 1SDWA 3AM2A 2P6HA 2C24A 5JIAA 2HWC2 1OOPB 4INDA 1NQDA 5IVYA 1FPN2 1NXMA 4AGGA 1H8TA 3WEZA 5KHHA 2BVVA 1X9TA 1WUVA 1XB9A 2Z69A 2R0HA 3I2HA 4XDQA 1V6KA 4I3PA 4O9GA 1JZ8A 3ST7A 3NJZA 2W92A 3D8CA 4AFCA 2WQ8A 1XU1A 4V2VA 2BERA 1VBB3 2D43A 3AMPA 1ULOA 4L0PA 2HEWF 4XPVA 2RS11 3IIAA 4K20A 2KXLA 1PMHX 4Q0QA 2JIJA 1NCQC 3HT1A 4RD7A 5GLWA 1RHI2 1RUD1 4AEDC 5FY7A 3AFKA 4BMEA 2GZWA 1NCQB 5LEKA 4AEDB 2W5FA 1RXGA 1PM4A 4N90A 4AGRA 1VAMA 1AR72 3O12A 4D69A 4FPEA 1VAKA 4BQ3A 2W1QA 2XONA 4CCEA 3NV4A 3KCXA 1UIKA 3Q8EA 5H9QA 1H4GA 3FUOA 4QX7A 2WWSA 5JI9A 4W65A 4GA9A 4DNYA 2GP5A 2FDFA 2A6WA 2E9QA 2QDRA 1UXXX 3LOBA 2CU5A 2WT2A 4YARA 2IFRA 4AYUA 3J8F1 2DDUA 2XKOA 3RWKX 5IAXA 4BQ5A 2W94A 1QGLA 1S2BA 2R32A 4FFHA 1IZ3A 4UFIA 5CZKA 4AVCA 1C1FA 1A8DA 2C1FA 1XC6A 2PHRA 4PI2A 2DCJA 2ZOEB 2W68A 5KC6A 1BEV1 1T6BX 3HAGA 3J9SA 1PGW2 2WJSA 4EE2A 1O6UA 2XL9A 3LA7A 3HWJA 3UK9A 4AAPA 1RUE1 5GLZA 4NRQA 4UWDA 3VBOA 1PZ8A 2GMPA 2ZGMA 1M4WA 1R1A1 4IEZA 2IXKA 3MDPA 3FHQA 4LHSA 2G9FA 2ZEXA 1BLZA 1W8WA 3AFGA 3A4UA 2WN2A 4EWAA 3RZGA 1UN1A 2WZ8A 2BU9A 2DWRA 1SZBA 4XFHA 1PO11 3SXWA 1WMDA 3HEIA 2J42A 5GM0A 5ABJC 5DDJ2 3KF3A 2Y0IA 4I0AA 3C8XA 3B93A 5KR7A 5ABJB 1W8FA 4I30A 2Z2SB 2WN3A 1IS3A 3DL3A 3PUAA 2KM2A 3IT8A 2HWC3 4MSVA 3RJ2X 1WW5A 4YVWA 2TUNA 5AFEA 5M0TA 5CA6A 1VMHA 2NYYA 2OPKA 4R4ZA 4AFDA 4COVA 3WQ7A 1OUSA 5IVCA 3N7LA 4GJZA 3M1HA 1TNRA 1UYYA 4HLTA 3HT2A 4TTGA 4BQXA 1VALA 1RHI3 5CIRA 1WLTA 3K4AA 1OLMA 1U5XA 4ES8A 4LO8A 1UMIA 2RHPA 1S0DA 1ZRDA 3AP6A 3LFIA 1OFSA 3LEIA 1ENRA 2BVBA 5E6HA 4CCDA 5I93A 3UNPA 1YIFA 1AJKA 5FYIA 5LRRA 3RMYA 4BXFA 3S7IA 3WNXA 4H55A 3QD6A 5IAVA 2Z42A 1JHJA 3NRUA 4I3GA 4J25A 1LODA 5BUVA 1O7FA 3WQ1A 3NNFA 2HH9A 1F2NA 2A73B 3K2OA 3O5SA 3ZOIA 3AKQA 4QDSA 1AR81 2JG8C 2ZA9A 4LBKA 5FZAA 3UV9A 3MUY1 4LJHA 1OXCA 2JG8B 1BK0A 2VVEA 3OGVA 4F8AA 5AC91 5EWSA 1GV9A 1RMU3 2MNGA 3ES4A 3AKTA 3RYKA 3ZSLA 3MI8A 4BLJA 1GUIA 3HVDA 4META 4EN8B 5F2WA 2EVXA 4Q4X2 3WD5A 1ALYA 4P00B 2JDHA 2OUJA 5FY5A 1J1TA 1LEMA 5IFPA 1KD7A 4XTPA 3WY6A 1OVSA 4NR1A 1MS8A 4ZZ8A 2O0OA 3H3LA 3I59B 2NPIA 4QHZA 2RDNA 5A32A 3EMRA 1YFXA 3Q9OA 1DLLA 3DN7A 3FFQA 4KU8A 2JG9A 3OGJA 4LXLA 1GOHA 4BDVB 2J1SA 4AHXA 4IUGA 5DDJ3 4UAPA 5FBJA 4C1XA 4CDXA 2BRTA 4COYA 4FPLA 3POJA 4FO9A 2D44A 5IW0A 4FFFA 5FY1A 4B8EA 4Y20A 3OY8A 3N9NA 4QX2A 5CAZA 5F9TA 5FZHA 3MGUA 4YG6A 1POV1 2XPJA 1D0GA 1WW4A 2P3JA 1YI9A 4GQ7A 1TMF3 3R0RA 1UZZA 2RJLA 5A7SA 4FVVA 3ZYBA 2Q1MA 1QU0A 3GZAA 1AYN2 3T1LA 3CNAA 1L3JA 4IV1A 4F7ZA 4YZ3A 3U4XA 1PGL2 4OI1A 2CWSA 1QOSA 4JV4A 4GD4A 3L2HA 4OMCA 1ZRRA 4CDUA 4FXKB 3J7LA 4QXHA 4D6RA 1O5LA 1F4AA 3AJZA 3WF1A 4XACA 2E63A 5ACA2 5HV0A 4UF0A 2D7FA 4JGYA 3E1F1 3WW4A 3WVJA 4LK7A 4IEOA 4QPGA 3AMHA 4A45A 4XJ9A 4B29A 2MHFA 4FAGA 1AR62 4CP9A 4BLIA 3H8OA 3HN3A 5FQ0B 5T54A 5JAXA 5EFUA 1GKBA 3GZTB 1VE0A 4IEVA 4S2GA 3VHNA 4AFBA 3TOJA 5FZGA 1JZ2A 3WNKA 4XUOA 3O1PA 4TSVA 4MGTA 1PX4A 4Q27A 2Y33A 1WCQA 1GWMA 1R081 2YBKA 1BBT2 2ZABA 2WR9A 1NAEA 2D6LX 1QY4A 5F5AA 5FZIA 4DINB 4JKMA 5DZEA 4AG4A 4S2FA 3KB5A 1XNDA 3D6EA 3ILRA 4LLOA 4MGYE 3ZFEA 4A7KA 5FPXA 4P9JA 3BU7A 4CU9A 4XQDA 3M3EA 1OQEA 5FLHA 3VD3A 1V6OA 3CKHA 5LY2A 3ZFFA 3LB9A 2I45A 3LEMA 5FLJA 4I2OA 2DVFA 4D6SA 2VBBA 3ME2A 3ZYGA 4ZY9A 1CZTA 2XVLA 3DKWA 1RL3A 2FDHA 1N1TA 1W6NA 1HV0A 4J1XA 2ZX4A 4N7IA 1UY1A 1W0PA 2JG9C 5F5IA 4YFZA 5BY5A 5EIYB 5FWJA 3HMYA 3P6BA 2HWD2 1QJU3 3MIBA 4MXWB 3OOXA 1RUH1 5ANNA 4HPKA 5L19A 4H7MA 4AQTA 4K21A 1S0BA 4L9BA 5J36A 5JSOA 3MW4A 3V0BA 3ETPA 3I2OA 1HN1A 5FXWA 2HWF2 5D2AA 2ADEA 1QEXA 1DFQA 1W8TA 3M3CA 2Q30A 2A6XA 3GJBA 2VUDA 4QGNA 2DFBA 3ACHA 3OF1A 4M01A 1W03A 3BOPA 3IZOA 2A7AA 1H2MA 3BN6A 4FOVA 4FTSA 1U5ZA 2VM9A 3Q8FA 1JU3A 1KFUL 2HKXA 3FUQA 1QOTA 2JXAA 4XCBA 3BCWA 5DABA 3RI9A 3SKVA 4RGGA 1MVQA 1VJ2A 2YGLA 4JGYC 3TEXA 4YGDA 4ATFA 4BK4A 2DVDA 4QPGC 5JSRA 1YI7A 5A6QA 1MS1A 2R1DA 2ZS6B 4O7XA 5ACA3 1G9FA 3W21A 2D97A 5T5LA 2BFUS 1FYUA 2WRAA 3E97A 2WNVC 1GQGA 5CVRA 4R9CA 1AR63 3I3EA 3X29B 2VXRA 2WNVB 1S4CA 4ITCA 3UJOA 3VKOA 2HEVF 4W4ZA 2J1UA 4IE6A 3SQOA 2G4IA 1S0FA 2PHFA 2MEV1 3KZ4C 1DYPA 2J1EA 3M2MA 1SFNA 4P14A 4UT5A 4CUCA 1W90A 1SG3A 4HMZA 4AVBA 2PYTA 2B9UA 4PI0A 1QNYA 3VBUC 4K7JA 4XF1A 5JR7B 3VBUB 1JS9A 4A41A 3LA2A 4R9AA 1AX0A 1OVPA 4C90A 4E27A 3POWA 1W99A 3VBSC 4YPJA 3VBSB 3ZFFC 2ZPXA 1DGLA 1W8ZA 2R043 1IPSA 1XYPA 4XVHA 3WNLA 3ZM8A 5DXDA 2W1WA 3CU7A 3PLQA 1UCXA 2Y8KA 4LBLA 3RZZA 3MLKA 4P9LA 2DTWA 4I0WB 1UD1A 3IMNA 5BNOA 1OLRA 5F6KA 5C3PA 3CL1A 4QHBA 3MFAA 3ALQA 3JU9A 5C4WA 3N7MA 2XJRA 3BVCA 4QX5A 3ZN6B 5FOBB 5JZGA 3N4MA 3O14A 3WP6A 2WYFA 3CMGA 5FPBA 3B01A 5C3RA 4GB32 5C5UA 5BXXA 1LB2A 2DURA 4PIZA 1EV11 4EN0A 1XRUA 2EXIA 2FCVA 5IYYA 2EIEA 5FYUA 5DUVA 4AHZA 5FZ6A 2HWE1 4C0HA 4LO6B 4FPOB 5FRAA 1CN1A 2YBPA 4OHWA 3ILFA 4XJUA 3RYRA 1YRZA 4AF9A 2BNOA 2HWB3 1YC61 3T0AA 4Q4W2 2VZOA 1EP0A 1W8OA 2EICA 3MEPA 1YEWA 2VULA 5KWRA 5CKMA 1G86A 2JDZA 4ORFA 3I2GA 4QM8A 3V65A 2J1VA 3IPVA 4F3JA 2ERFA 1UKGA 2D3RA 4MXVA 1JOPA 3VZNA 4Y1ZA 5T55A 4A4AA 2OZ6A 1UY2A 1AR92 2R063 4LPLA 3MF6A 5I91A 3MPBA 1RUOA 4MUVA 4KL1A 2JJ6A 3HJRA 4NRMA 1R091 3VZOA 2YYOA 4P08A 1UY0A 5BNPC 4C8DA 1ND3A 1UX7A 1BZWA 4LHNA 4WVZA 3TRSB 1Y7BA 1IKPA 3ZIXA 5BNPB 2QZ2A 1DGRN 1MZFA 5DAWA 2RVAA 4C0BA 1JU4A 3AKPA 3EB7A 1H2KA 1HN0A 1N3QA 4FPGA 5EP9A 4UBGA 2BJSA 4YW2A 1CZSA 3SNMA 2XUMA 1AL0G 1QDCA 2ZJCA 5HV4A 4HXCA 2BBAA 1W6OA 4JKLA 3WP5A 1US3A 4GKXA 3SEEA 4AVSA 3PJQA 1LAJA 5SV5A 2QQOA 3AYCA 4BCUA 5K0UB 3KMHA 2RS12 4LE4A 3WR0A 1AL21 5FP9A 3U11A 3ZXLA 3L2YA 3W9AA 1FMD3 5CFCA 4A3XA 4WM7A 1XQNA 3FFZA 5HPOA 1RUC3 2Y6GA 5GLTA 3WQ0A 5JZGC 4QXKA 3ZSJA 1UOGA 1QF3A 4LUKA 3RGBA 1ZVFA 5JZGB 1Q8PA 5APAA 2AR6A 5FP4A 5FZ7A 1YFWA 3T08A 1ODNA 2A6VA 2OX0A 3U37A 3PHMA 2CL2A 3DPRA 4LIUA 3DYMA 4QQLA 4Y1YA 1LOFA 4XZPA 3ZYFA 3GALA 4HT1T 4OI2A 4PIXA 3WG2A 5DAQA 1PHMA 2WLQA 3J8F2 2GP3A 2LRPA 2BNNA 3ACGA 1H0BA 1F8VA 3RS6A 2QQIA 4N53C 3EQEA 1KJRA 1UNBA 2AGSA 3HNBM 3NSTA 3A23A 3CJIA 3OBTA 4N53B 4XXPA 4Y1VA 4YRDA 3OPWA 5FMOL 1BEV2 1JYNA 4XIOA 4M00A 4XFBA 1VBE1 1NLSA 1B35C 1W2TA 2KR2A 2JB4A 3MBWA 1RUE2 3BKZA 1W6PA 4H14A 1B35B 3THTA 4FP2A 3H9AA 5E8AA 3LA3A 4Q2FA 3LKJA 2RS51 1R1A2 3KVAA 3D0JA 2ARBA 3PUSA 4FOQA 4IEXA 4JGZC 2Q4SA 4TXWA 4FPCA 3AKRA 4JGZB 4UFKA 1W0NA 4UW4A 2VQUA 4EN7B 3LZZA 1M06G 3WV6A 3PL0A 3HN1A 2JE9A 2RDQA 1Q8QA 1CX1A 1PO12 1JYTA 4JHTA 4LBMA 5I8YA 4LO5B 4PJYA 3WZ1A 1ND3C 3P3PA 1NYWA 5FPUA 1ND3B 2W87A 2VNVA 1OURA 1RJ7A 4KH9A 2VZVA 3L9JT 4YVSA 2DUPA 5C70A 3LD8A 4K1YA 3CEWA 5FYCA 4HVOA 4YGEA 4COWA 5A3TA 2XG3A 3JD73 3VZJA 2Y6KA 2XWJB 4NIHA 2PXJA 2FDJA 2W47A 1UWWA 3ZR6A 4GKYA 5C5TA 5FP3A 1YJKA 3ZLIA 1H6XA 3SHRA 1APNA 2J1RA 5K4LA 3AMNA 2DUOA 3OD4A 2IXHA 5FZDA 4OQ9A 2ZGOA 3HQRA 5CFCC 5C8CA 1UOFA 2ZGPA 1GOFA 1NUKA 2ZXQA 4UOJA 5CFCB 3I2DA 4NVPA 1I5ZA 2ZTNA 4HVRA 1RUD3 1AXZA 1H30A 1TEIA 4O65A 3POEA 3ROUA 1WCSA 3DGTA 4P9WA 4WVMA 4YWAA 1HW5A 1PMIA 1W39A 3TN91 3DPRC 3B3QE 2XBO3 2PLV3 4OMDA 3H42B 2OUHA 2BOIA 3ZXJA 1IPKA 1LGCA 1VBC1 1YQ5A 4IV3A 1J3PA 1STMA 2CAVA 4A44A 2ET1A 4CEWA 4HANA 1LU2A 4Q4Y1 5A3LA 4NJ4A 4AVAA 1NCRC 2E51A 4FPKA 1XSRA 3VDAA 3J8F3 4LUMA 4LBJA 1NCRB 2W9XA 4CXXA 4YYOA 2VUJA 4FBFA 5IK5A 2I74A 2B39A 1AX1A 3I3DA 1O3RA 4OVEA 1PVC1 1AR82 1N1VA 2UURA 5EHDA 5LY1A 5A7QA 3SKJE 4URTA 1OT5A 2HEYF 2XHKA 4FOYA 4GH4C 4JDOA 1S2EA 2DVAA 5AC92 2H6BA 1EY2A 1IG3A 2BGCA 1RUE3 2W2IA 4GH4B 1C28A 4HSJA 4LLFA 4MHRA 3ZXAC 4FSJA 1U0AA 1A6CA 2XMLA 4WV8A 2GU9A 3NL1A 1ZBA3 5ISLA 2WO1A 2QCSB 1J59A 4U36A 1XE0A 1W9TA 2ARAA 5LZ6A 5A33B 2WSUA 4AQ6A 3I49A 1VBD1 2VMCA 2P1BA 4FTBA 1OF4A 2XQRA 2JDYA 1MACA 4ZKTB 4HN0A 4XC9A 4MG2A 2W95A 2YFZA 3HNYM 4LKEA 2P5BA 5F5QA 3UKNA 3UT0A 5A70A 2BP6A 4AW7A 1JZ6A 3IMMA 1L7RA 1IQAA 3MPPG 3VBHA 3LEGA 2WZR3 5DAVA 2ZHNA 4LBQB 3ZXDA 1FOD3 2ZEZA 1JYXA 2P6CA 5FXZA 3LPGA 4JTOA 1W06A 1IPJA 5DUWA 2OVUA 3USUB 2RJ2A 2DV9A 3TWIA 4BQ2A 2XLAA 2ARCA 1JZ5A 4CP0A 1CZVA 1XOYA 2DCZA 4R9BA 2PMWB 5HBAA 2RG4A 4SLIA 3KV6A 3NV1A 3WG1A 4QQPA 5B2GB 4NHLA 3ZDSA 5A7WB 2UWAA 4AI8A 4KI5M 4M3CB 3QBQA 1YNAA 4HBNA 4WZCA 4EN9B 1PIV1 3GCWA 4LOSA 3PUHA 5LBBA 1QDOA 2ZBJA 4IE5A 1POQA 4J6GA 5LW9A 5F3EA 2BDRA 4ARXA 4CEWC 5SV8A 4ASKA 1REFA 1F35A 4I0BA 1Y9GA 1VB2A 4GAZA 3BUCA 1XSQA 5EYYA 1T2XA 5FY8A 1Q3EA 2VTXA 5J37A 2WFF3 1R082 5H9RA 2JICA 1UXZA 1QNWA 3OGRA 2P17A 2RS33 3NV3A 5FJKA 3V56A 2NLRA 5C3SA 1FXZA 4AR2A 1C5HA 3J7MA 1DYKA 1AR83 2C9AA 2Y6HA 2YHJA 4GMP1 2YB7A 1RVF3 2UYAA 1NA1A 4YZ5A 2A6YA 2JDMA 1MEC3 2OW4A 1O8SA 4MADA 2E53A 2EXKA 3QOPA 2WC2A 1F5FA 3QCWA 1TME1 4EZHA 4RA0A 5AVPA 1D4M1 3N9OA 1JZ4A 2GAUA 4CDWC 2ZHMA 1JH5A 1HJGA 3LEKA 2ZAHA 4PHZA 5H9SA 3UL2A 4CDWB 5K7PA 3WDTA 2QVSB 3JQXA 1W04A 2VECA 3FHIB 2RR11 1RUH2 2VO5A 2ZGRA 2ID4A 3ZKUA 4LIVA 1J3QA 3N3HA 3HQUA 3C7GA 4JRLA 4CCOA 2VZPA 4QPIA 3O1UA 3G7DA 4NWWA 2OXBA 3MICA 1RUJ2 1TZOA 1ENQA 2B5HA 5FMBA 3U78A 5FWEA 3VV1A 4TN7A 4AK3A 4KG8A 2CDOA 2OQ7A 2VPVA 3KCYA 1H4HA 1V9U3 2TNFA 2VGDA 3K4ZA 3WHUA 2P3IA 2NM1A 3VBHC 1POV3 2OT7A 3OEBA 4AL9A 1VRBA 3U75A 2D5HA 1GICA 2A1XA 3VGIA 4DUXA 3O1TA 2KA3A 1I9RA 1HXS1 3NNMA 1TNFA 4QT6A 4EYUA 5FZ1A 2V09A 1RUF1 3NV2A 4LO4B 4CEYC 3LDKA 2LROA 1G9DA 4LHLA 4CEYB 1JOJA 5FZ3A 5EZWA 3WP4A 3JBG1 1JYIA 2HLEA 4E4SA 3ZMOA 1XYNA 3NNJA 3LF7A 4RGAA 1JN2P 1GNHA 4CPBD 3PVNA 2FZ1A 1RITA 4XW3A 1COV1 1AF9A 1FNZA 1W2AX 3J26N 4Y22A 1CAXA 5CEHA 5JR2A 3ZYHA 4OI0A 4AI9A 3UETA 4Q0PA 2VH9A 1GNYA 2J1AA 2C5DA 1QOOA 4NRPA 1PX3A 3UESA 2ARXA 1MZ6A 2MEV2 5FCCA 2LTNA 2D5FA 4QPYA 3K77A 3AX4A 4NPRA 3BIEA 2YPDA 2LALA 1GYKA 4K8FA 1P8JA 4MO3M 1LGBA 3U4SA 4HVQA 4KWUA 5FZ4A 1ZM1A 4HETA 3GXUA 4XTMA 5FZOA 5BNNA 5FUNA 4BQYA 5JXIA 3NKGA 5A1FA 5L9RA 4KBBA 1OD5A 1JYVA 2WNOA 2ZGKA 4Q0VA 2DYCA 5FXXA 3RVHA 4XQWA 2YU1A 3ACLA 4RQPA 4LEJA 2WNUA 2TEPA 2WLPA 3BOWA 3U14A 3WW1A 4ZHNA 4NIIA 3VLBB 2Y0OA 1TQ5A 1UX6A 4YG3A 5AFBA 1HQLA 3CZJA 5FMCA 1IKQA 3NJYA 1ST8A 1IHMA 4CCKA 4ATEA 2FDGA 5CFDC 4DXZA 3U0ZA 5FO9B 5CFDB 2XJQA 1OF3A 5D1IA 3TYJA 1EV12 5D8AA 1ZRCA 4BQ1A 2GH8A 3WDUA 5TSWA 3E6BA 2HWE2 2ZGSA 4UFLA 2F4LA 2IZWA 1MS4A 3RZHA 1H8TC 3FMGA 4PDWA 1E5SA 3B94A 4IEYA 1H8TB 1JHNA 2RMU1 2EAAA 1VP6A 1FPN3 2FDIA 2CTVA 3WOGA 3O0VA 4AI1A 3E5UA 1LHWA 5FR3A 3AK0A 2CGOA 4AEKA 5LK5A 5FUPA 1BKZA 1E5IA 4EJRA 3CHXA 3NMBA 1K5MA 3T09A 4PCRA 2LUWA 4QX3A 1G9CA 4QB6A 1W9FA 3LFMA 4OHXA 5CNAA 1PVXA 4AVVA 4LKSA 2BNMA 5A7PA 4XBLA 2DVBA 3AL5A 5EJ3A 4Y1XA 1RXFA 4JZRA 1R092 1HRV1 1QQP1 1H1MA 5FYYA 4CCJA 2ZHLA 1WLWA 2DTYA 1XNAA 1AR73 1S0IA 2CY6A 4RGKA 4KWLA 5A6YA 1LHUA 5BNQA 4CVUA 1R64A 4K6BA 1A8MA 1AJOA 4O61A 2WIIB 4MGQA 1F31A 1SLIA 1VR3A 1W3XA 4MX3A 5LA2A 1C8M1 2LW8A 3IBMA 3MV11 3H1MA 1MPXA 4M0NA 1UY3A 4GWNA 4UFJA 3IN9A 4WM8A 4EROA 1DIWA 2VZSA 3ACIA 1GZWA 1KJLA 4XJZA 4YZ4A 4N7UA 3IAPA 1KS4A 1UZVA 5EJ1B 2R16A 4YG0A 5FK7A 2NZ9A 3NAPA 1AL22 5FMOS 3S6PA 1SLAA 1ZZ7A 4UFMA 3RPQA 3VBOC 3ITQA 3VBOB 2VCCA 4KGGA 4E8CA 1GOGA 5DPNA 1EYBA 1WMFA 3AKSA 2QDNA 5E16A 4FQZA 3AXEA 1LGNA 4FFIA 4ZU7A 2RM21 2ORXA 4Y3OA 4YZ1A 2YFUA 3N7JA 5FREA 2WQ4A 2Q8OA 1YQ6A 5FBZA 1OH4A 2X09A 4O9EA 3OSDA 3BGAA 2D93A 1NKGA 4N9IA 4ASLA 4P9GA 5LBEA 2VMGA 3AP4A 4HN1A 2QQVA 5FYSA 1JMUB 4EN6B 1UPSA 4RFT0 4YVWC 4A2UA 2IXCA 1VBE2 4LORA 4YVWB 5A3NA 1IS4A 2QQJA 3QLQA 5FZCA 2YPJA 4Z82A 4EZ4A 2CHHA 3A7QA 2V72A 2CSGA 1QJY1 2RS52 4LR4A 1K5MC 3SLIA 3LIHA 5FZMA 4X8PA 4LBQD 2WAAA 4CU7A 1H2NA 1JW6A 1RTVA 2E7AA 2PQQA 3K3NA 4M4PA 3CBNA 5FOJB 4QQHA 1F4HA 5A80A 1MS9A 3BPZA 2EIBA 2ZACA 4D7SA 3FLPA 2WS91 3I7DA 1KQRA 4NHXA 4QWNA 4RS5A 1OUXA 2VCBA 1IGOA 2RV9A 2E32A 5FZBA 2ZGLA 1KS5A 4PF1A 2VXJA 5FZ8A 4R9DA 2QFEA 4WM8C 3S30A 3BODA 1SCRA 3GZUC 4UYBA 5I8TA 1JOBA 2Z4FA 3AYDA 3MIEA 2YMZA 5L7OA 1OD3A 4CDQA 1PGSA 2VZUA 3VDDA 2JDUA 4DRVA 2B9VA 4CU6A 4OHYA 3WQBA 1VBA1 2VOWA 5LBFA 3DECA 3H0OA 4DUVA 1ULDA 1YJLA 2IUWA 1HV1A 2W3JA 3SCGA 2PHDA 3GNEA 4ISRA 4XFFA 1V6LA 2VZRA 1TG7A 1SLCA 4MYEA 1DZTA 4QQ2A 5CB7A 3TN92 2QZ3A 4JAAA 4DY3A 3KD4A 3V0AA 1VBC2 1LHNA 2VTXJ 2V5DA 4Q4X3 1SFPA 3T2TA 3FE5A 1QH7A 2KD7A 1ODMA 1K12A 1UF2C 4LBNA 4OUSA 5FY4A 4Q4Y2 3GYDA 5A32B 2JG9B 2NP0A 1YFUA 4CDXC 2X5IA 1OKOA 4H7LA 5FY9A 1DHKB 3MV01 2ET7A 4AFAA 4CDXB 1UPIA 2VMFA 1YHFA 5C9AA 1PVC2 1DBNA 4Z92B 5T5JA 2Y6LA 1N1YA 4Y20B 3OY8B 1RUJ1 1HQNA 1PMJX 3AJYA 3MYXA 5CADA 2PELA 2HYXA 3GHNA 4EQVA 2ZZQA 3RZMA 4AE2A 1YLLA 1A3KA 1GP4A 5GZGA 2XDVA 1JYCA 4IV1C 3VZLA 4C1WA 3DEMA 4IV1B 2RS53 3VUOA 3O1RA 4NIDA 4GALA 1N47A 2P4EA 5EQUA 4CDUC 3W5MA 1AYN3 4XUNA 4CCCA 1JI6A 1Q43A 1WD3A 2GMMA 1HDKA 1OBNA 3AXDA 3ES1A 3LDBA 3POIA 4GXLA 3AL6A 4LOTA 4RS5C 2WDBA 5IT6A 2XJVA 4QD2A 4UF0B 4JGYB 2P3KA 2VMDA 5IFTA 3MW3A 2O8QA 4FPJA 4QPGB 1B09A 1VBD2 1S0CA 5G04L 4CP9B 1DQ2A 4ISQA 4GIQA 3DXUA 3BPSA 2B42B 3W5NA 4XFCA 3OPZA 3NWKA 5F1RA 3APBA 5CBLA 5CYYA 4GJYA 4OI4A 5DN2A 2VTFA 4H3WA 2A75A 2R49A 2VC9A 1WMEA 2XB6C 5FP8A 3WX5A 4CDQC 3VDDC 3PTRB 3PUIA 2VMIA 4HKOA 2WT0A 4CDQB 3VDDB 2E6VA 3KGLA 3ZN4A 2VU9A 1DZQA 4U2AA 4DY5A 1PO22 2UWBA 4IERA 1QWRA 3WLUA 1BBT3 4LNVA 1V6IA 2VW1A 3R05A 3ZFEC 1ZRFA 5D21A 2A6ZA 3LE0A 3ZFEB 1I1EA 4MOAA 2FCUA 2DCYA 3HBZA 4BIFA 2L9LA 5FTTC 3ZFGA 4DMIA 3IKWA 2EALA 4CE8A 3AYEA 2PQSA 2PA7A 5JOYA 5KXBA 4MLOA 4D8MA 5GKAC 3EJKA 4FPHA 4QHOA 5FP7A 1FAYA 3ZFFB 2VUCA 4XDPA 5FMDA 3ECQA 3NVCA 1PIV2 5K9YA 3UYJA 3DYOA 4QDRA 3OGGA 1W6NB 1W28A 2ZGQA 1W6QA 3RNSA 3CJXA 3B5LB 4CSWA 3AP9A 3WINE 4FTEA 4B1MA 2HYKA 2X5IC 2DVGA 3NQHA 4HPKB 1X8MA 4UW3A 1ULGA 5C9AC 2X53S 5KXCA 3V0BB 2HWD3 3KT1A 3MZHA 5JMOA 1PZ7A 4HSLA 4E9KA 2WABA 5T5PA 1LKNA 2A5ZA 1JUIA 2HWF3 3D0SA 1QXJA 1Z0HA 4RHV1 4CPBA 3RDIA 5FUIA 4YM1A 3ZYJB 3MIFA 1CAWA 1RMU1 4ASMB 2G19A 5F7UA 1TME2 3SCHA 2WSVA 2ZMNA 4XUTA 2Q0AA 1D4M2 2CWMA 3ENRA 2VZTA 4Y24A 2OA2A 2X05A 5DMYA 2CGPA 2GNBA 4LITA 4AQ2A 1MVEA 3WHTA 5JI7A 4BQWA 5GZFA 2Y6JA 4QKNA 4DQAA 3PJYA 3VBRA 2RR12 4QMAA 5JXHA 5KHGA 2Q8CA 1AXKA 2JD4A 3WG3A 1CGPA 1ZZBA 3Q8BA 4G4FA 4MH0E 4N43A 1PK6A 3AB0A 5LB6A 2BW8A 2VBDA 5DAXA 1E57A 2WA4A 3OCPA 4LTAA 3K4DA 4NPMA 3ZMNA 3WSOA 4QU2A 5FKCA 3EXUA 3BTZA 1TMF1 1O4ZA 1Y9QA 1NY72 2JB8A 3RRDA 1CAUA 4FT8A 3DKQA 4R4XA 1CD3G 1X9PA 1HB4A 1HXS2 3WW2A 4XJWA 4B3NA 1I5PA 5I0TA 4ARYA 4IEWA 1RUF2 2VCAA 3HR9A 1AYM1 5EXOA 3ZXKA 2GC3A 3JBG2 2QKDA 5GLUA 4CTEA 1S55A 4AWDA 4CA9A 3H8RA 3LQCA 3ZVXA 1C1LA 3EHKA 2GDFA 3RQ0A 3N9PA 5JVVA 3VKLA 1COV2 1W9WA 1W2NA 3ATGA 1K3IA 4JQTA 4LKFA 3ZYRA 4E4DX 5BNOC 2G9ZA 5FPZA 5BNOB 5JPMB 1QH6A 5C4WC 3O1SA 4Q29A 5C4WB 1HB2A 2XH6A 4JHZA 1CWPA 1MS5A 2ORZA 2ZZJA 3KS7A 5C8WA 2VNRA 1BVVA 2GNTA 4OHVA 2K0GA 3UGHA 1BXHA 2JD9A 3T4HB 2VW0A 3CDZB 5I0SA 3RZKA 4DXRA 4GMP0 1EPWA 4GB33 3S5AA 3LSDA 4Y33A 3WDYA 2F4PA 2ZX3A 3C7FA 2XWBB 4BXSV 2EF6A 4Q8LA 1JBCA 3MLJA 4Q5OA 4TLFA 3NKTA 3PVEA 2VY0A 4GMP3 4ZXEA 2W1UA 1IQDC 4Y5TA 4MVTA 4ZPIA 1GU3A 4YGCA 4AVTA 1OHFA 2XOMA 4E2SA 1TME3 3OUHA 1IS5A 4Q4W3 3VKFC 3WF0A 4HZFA 4MGKE 3VBRC 1O3SA 3IPVB 2FMDA 1VRH2 2P2KA 4YM0A 2YC2A 5JDBA 1OPOA 1QJU1 3OYWA 3FC0A 4WZFA 3ZKYA 3VDBA 3P1IA 1Q8VA 2HBTA 2OZJA 4RR3A 1H1IA 1Q8OA 4LKDA 3INAA 2FBEA 4XUQA 1DGWA 2XKPA 1AR93 4ZXKA 3P3NA 3VD5A 5HCHA 2GH2A 5C3OA 1U12A 5ANQA 3U1XA 3VHPA 3JQWA 1WMXA 1ACCA 1F9KA 2RDSA 2YZ4A 2I07B 4GWJA 1BMV1 2YDEA 1EAH1 4QKBA 1Z7S1 4QKDA 2RMU2 3TAYA 1QMJA 4Y4RA 3AVRA 1GR3A 2ZEWA 1HRI1 1H9WA 1VAVA 3B00A 4XQ4A 3T1MA 1RUF3 3C2UA 4QXBA 1LOGA 1W6OB 1XNCA 4LHKA 2ZCWA 3PVOA 4PLMA 1ZYBA 4Y5SA 2VOVA 1CAVA 3T4VA 1Y4WA 1UU6A 2QQUA 3AZZA 3IIIA 4WM7C 1JTZX 2RS13 3T30A 4WM7B 4UBHA 1HRV2 1QQP2 2V4VA 4BQ4A 1R1ZA 4ES9A 5IUQA 1QJX2 5FV3A 1SBFA 1C8NA 1XYOA 5A3PA 3DV8A 5F3CA 1UW8A 2BWCA 4OLLA 5GJ6A 5I0RA 1RUNA 3PMSA 2EXJA 4XBQA 1LOFC 5A6ZA 3DPRB 2WWJA 4KMQA 1K45A 1YO8A 3HPNA 3IWZA 4FOWA 1C8M2 1GP6A 5LEJA 1CPMA 1AUYA 2PHUA 2WT1A 2VR4A 3GDBA 1NE4A 3MO4A 4MHUA 1DGWX 2QE3A 3K3OA 3SMHA 4QQOA 3W20A 1JUHA 3CJIC 2XHNA 3WP3A 1JODA 3JB8A 3WCSA 1J84A 1NOVA 2WQZC 3B9CA 3CJIB 3SISA 5JXGA 4RFRB 2ZKNA 2R041 3D82A 3WXPA 1RUI1 3I97A 4QDQA 1URXA 1PNFA 2WAOA 2ADDA 1BEV3 4ZU5A 1W6PB 2V4AA 1NLQA 3PTYA 2BEOA 2Y38A 3PNAA 2G1MA 4NHMA 3WF4A 1ENSA 4DEQA 4NOTA 1QJZA 2GC0A 4XUPA 4XOGA 5LBCA 4R52A 1OQ1A 2RM22 3OYWB 1R1A3 5LA9A 1NZIA 1Y43B 2IXLA 4IQPA 5JWPA 4Y26A 4IESA 1CVNA 4D94A 4NAOA 1SPPA 2AACA 3OUJA 3KV9A 5FYMA 5AVAA 1RGSA 1YCIA 1PO13 2JE7A 2VD7A 5LRSA 5IATA 3VBFA 3IDEA 3OPTA 2AUYA 4AZZA 4NIGA 4K8RB 5FPVA 5E1RA 3RYPA 4YVSC 2V5YA 3KSCA 1WCUA 4Z8BA 1KGYA 5I8SA 1AX2A 3KT7A 1ONAA 4YVSB 1FT9A 2HWB1 3N36A 3VL8A 3FLTA 3B7MA 4AEMA 1W2UA 3FX3A 3PIJA 3THCA 1LR5A 2JE8A 4DXSA 2RMU3 1QJY2 2NMOA 3PU3A 3S5QA 1MQTA 2IWGB 2YY1A 4IE7A 2VCMA 3HIFA 4P9XA 4PIYA 5FFOC 1AZDA 2DU1A 3O0WA 5C8CC 1PO21 5CKNA 4KWKA 5FKBA 5C8CB 1QXPA 2JECA 2R061 4W6XA 4XMAA 4DZGA 3LDRA 5HCAA 4XCAA 2Q8DA 2B46X 1UQXA 1NG0A 4LT5A 2HBUA 2WS92 3JUUA 4WVMB 4PF5A 2LM3A 1QQP3 1LESA 1UOJA 1W6MA 3A21A 1A78A 1BJQA 1WD4A 4LA2A 4IV3C 2J22A 2UY8A 1ZBE1 2VE1A 3IM0A 5BPXA 4IV3B 4Q1RA 4RL7A 2K2SA 4JQRA 1OOPA 5HCFA 4L2NA 4CEWB 1D2QA 4S2DA 4CCNA 3A0NA 1HLCA 4HKLA 3SH4A 3EO6A 4YW5A 3WDXA 1ASJ1 2D6MA 3ZR5A 3MIHA 4CU8A 4QAWA 2V73A 5LASA 2ZKLA 1LENA 2A3YA 1VBA2 1FMD1 2BPA2 5F6LB 5FYVA 1RUC1 2RDRA 3TEYA 3TEWA 2JKXA 1NCQA 4AEDA 2D3PA 5IJRA 1H8VA 5AC93 1J1LA 1ZX5A 2IC1A 3C7EA 1F5JA 4BISA 1O4TA 4D7TA 2DCKA 5J09A 4A42A 1N1SA 3BTYA 1CIWA 3VBFC 3O1OA 3M8LA 2UY9A 3IAQA 3N7KA 5KHKA 3AZYA 1RB8G 1NX9A 1NLRA 2AC1A 4XJAA 4NIAA 3VHRA 1TE1B 5FYZA 1LOBA 4PQ9A 2DBIA 4Y4YA 1POV0 3WCRA 5J48A 2SLIA 1S0GA 3ETQA 4N8MA 3TNQA 1V6MA 2R071 2VG9A 4IGOA 4H2AA 2XJSA 1NY71 3EBRA 2IVJA 2W08A 3VBHB 3B02A 2C0ZA 2WL1A 3Q8AA 3QACA 1WGPA 3M3OA 4L8QA 3AMMA 3ZSKA 5JCTA 5EJZB 3JZVA 5L73A 4Y5Z0 2GN7A 5KC5A 2QUOA 4MGZE 1XBFA 3ZO0B 4BE3A 4URAA 2PAKA 5FZLA 4XHXA 2C4XA 3WF3A 2WBKA 3OBRA 4OULA 4EV0A 1EUUA 1WCDJ 2CV6A 3ABZA 2FZ2A 1C5IA 4I01A 5FAXA 4CUGA 2IXIA 2JKBA 2OKXA 2VJXA 4ZS3A 1AHSA 1HX6A 2QQNA 4P02B 2XQXA 3ELNA 5F39A 3TNPB 3WW3A 5ABJA 2CDPA 3TEZA 5IVVA 1CONA 3O7OA 3IB3A 4HL0A 4HK8A 2W52A 4E2QA 2FCTA 1G9AA 1XE8A 3JD71 4Y1UA 2YUEA 4DRRA 4MGIE 4PT6A 3THPA 5C71A 1WCKA 5LCWL 2ZMLA 3ZN5A 4B1LA 4XEZA 3HNMA 3WNPA 1I3HA 3VD7A 5FIXA 5C6CA 4XBNA 5E88A 5C7GA 2YC0A 3SITA 2UU8A 5DQ0A 3VKNA 1R083 3B69A 3GCXA 4AEJA 2PN5A 1DDLA 4K3UA 3URFA 4WBBA 1W05A 3DYPA 5F5CA 1NA1C 1SDDB 4HOOA 1VBA3 2EAKA 1NA1B 4D0QA 3H50A 3ILNA 3WF2A 1V00A 5EPAA 2WFPA 3KHCA 4PQQA 1QHDA 3H1YA 1UIJA 4Q4V1 2XBO1 2PLV1 3H7JA 3QH7A 5IVBA 2XUEA 2Y26A 4DO0A 1A34A 1V6NA 4V1PA 1VRH1 3EYPA 4IE0A 5JMCA 1OMIA 1LULA 3NJXA 1OA3A 3KVBA 2QBXA 3KWVA 4FI9A 4NHYA 4QPIC 3FBMA 1ULFA 4BM8A 1RUH3 2IFWA 4QPIB 1DU3D 1TVGA 3FZ3A 4I02A 2EIGA 2FDKA 4X6QB 5IK7A 4RHV2 1RUJ3 2JG8A 2YC4A 1RMU2 1XJAA 4LK6A 5DAPA 2GNMA 3MIGA 4BOWA 3W58A 2BUKA 2WKKA 3KQ4B 4OYUA 2HJIA 2J7MA 2G9GA 3CLPA 5GZCA 1ZBA1 3VD4A 4XHBA 2XVGA 4AI2A 5A3MA 5HCBA 4CDUB 4IGQA 5C3QA 5IVJA 1PNGA 4TWTA 3I59A 2YXSA 1BYHA 5FJHA 1JYWA 5A3OA 1BQPA 4Y22B 1CAXB 5DUUA 5B4NA 5FK8A 3KV5A 5DUXA 1WW6A 5F37A 1QJX1 3QH6A 2ENRA 4CYDA 5LK7B 1LECA 1F15A 1TMF2 4S2HA 3D5OA 1KDMA 3RZJA 2B4KA 1BVP1 2EXHA 3HOBA 4KGQA 1XPWA 2MEV3 2WZR1 4OUMA 5KHIA 1FOD1 4OFGA 4G3YC 3R4UA 4YW7A 3ZYIB 3E6CC 3ON7A 1AYM2 1WBFA 4D6QA 1DQ1A 5BNNC 1WA6X 5FZOB 2O14A 1N3OA 1ZZ9A 5BNNB 2XJUA 3ZDVA 3FHAA 2WNEA 2H6CA 3AP7A 3R6SA 2WO2A 4BYYA 3FL7A 1GMMA 1RUG1 4IEPA 3WNOA 1C57A 3DCQA 4QU1A 5FDBA 4OZOA 3ASIA 4AXOA 4RQPC 2WNUC 1ULPA 2NMNA 1AVBA 4RQPB 2WNUB 3VB9A 3KCCA 4DXTA 3HQXA 4XURA 1ENXA 1Q56A 1MZ5A 3D3AA 1E5HA 2UYBA 3ZPOA 4BB3A 4DOUA 5J7MA 4JTNA 3PDQA 1NT0A 1UL9A 1D7PM 5FQ0A 1ZA7A 2LS6A 1YFYA 2IXJA 1FV3A 1W8HA 2WFF1 2X10A 4B7KA 4YM3A 2H0VA 5LWBA 5D8AC 2ZMKA 2MPFA 5C33A 2RS31 2I2SA 5D8AB 5FY0A 2BOJA 4QX0A 1MS3A 3ACFA 4YW6A 5J96B 1EV13 2GMEA 1X50A 4NE9A 4QB2A 2XGXA 3HBKA 3IDAA 1L7QA 1DQ4A 1GSLA 1RVF1 1X8EA 1YYNA 3H8UA 4PDWC 4RHV3 4ZONA 2HWE3 1UAIA 3LIGA 1MEC1 4FQ4A 1BK1A 4PDWB 4A6OA 3NO8A 4YW1A 3F2ZA 3C3VA 4NMIA 4BZ4A 3T0DA 3K75B 3MF9A 1U5YA 1OA2A 2JDNA 4LBOA 1O3QA 2VVDA 2O8OA 4ZZ5A 4LMFA 1K5MB 2QQMA 2XJPA 4BA6A 3H8XA 1G6NA 1QJU2 3E5QA 1OFNA 4CCLA 4YW4A 5F32A 1G9BA 1GQPA 3VZMA 4MZUA 4YW3A 4MXWA 4COZA 1YQCA 5JOWA 4XAEA 1J3RA 2P37A 4G9SB 2VNOA 5JUVA 3J7NA 1SMVA 3KLSA 4GZ9A 4PBPA 1R093 3OJBA 1V9U1 4Z1VA 1UMZA 2YGMA 1SLLA 3VL9A 1BMV2 2VW2A 3I8TA 5F3IA 5A1AA 3I2JA 1EAH2 4Q0UA 1ULCA 2ZGUA 1Z7S2 5LATA 1SEFA 1S0JA 3P5BA 3FJSA 1HRI2 4M3CE 4QXCA 4WM8B 1GZCA 1UYPA 1GZWB 3K51A 1AYM3 1CR7A 1E5RA 2CNAA 4OCTA 4UI9L 4XF4A 4CXYA 5FYTA 2CAUA 3NAPC 1VBB1 3K48A 1MS0A 5L9BA 1L7LA 1ZZ6A 2JX9A 1LU1A 2Y64A 3NAPB 2E7QA 4I09A 4NUBA 3TBDA 3M3QA 2Q8EA 1UKRA 4NWVA 2O1QA 1AL23 2GSYA 3BTAA 4JDNA 4CUAA 5HXMA 5K8SA 4K40A 4WVVA 4P9YA 4AAXA 3PMEA 4L97A 1GZTA 2QQPA 1CESA 4KWJA 2WNVA 1UY4A 2OIIA 3ZXEA 3R4DB 5IK4A 5JIUA 4B4PA 4XDOA 2P34A 4YSFA 1DQ5A 3SH3A 1DG6A 2AZ5A 1QXRA 1WBLA 2VUAA 3N9QA 3DF0A 1H1AA 1UOBA 1HKDA 2ZGTA 1VB4A 4BH9A 1JZ7A 1DGRA 5DG2A 1CJDA 4TZDA 3VBUA 2Q1FA 1LEDA 1GP5A 1ND2A 2PHXA 1WLDA 3WUCA 4A7YA 4ZS2A 3S0MA 2Q5TA 2R042 1RUI2 1US2A 4PBOA 1NE6A 4XABA 1DF0A 3VBSA 1LOEA 1DQ6A 1SLTA 1UZYA 4NO4A 4K9SA 3T0BA 4IW3A 4HG6B 2Z5WA 1VBE3 1CPNA 1W2OA 4EWDA 3KV4A 2QTWB 3KHBA 2K46A 1RINA 3TB0A 4CRQA 2F17A 2X8KA 5FZ9A 3VN4A 2AENA 2D6OX 5FZFA 2H0BA 2ATFA 1DCSA 3FBYA 3ZN6A 4GWIA 2BTVC 3JXSA 1D0HA 1XU2A 2PAMA 3S7EA 2EIDA 1RYYA 3AZXA 4L99A 4LULA 1JXNA 2B8MA 2W46A 4RS5B 1W8UA 4MV2A 3I3MA 5FO7B 2QNKA 2WWUA 1MR5A 4ET7A 5FPAA 2VBPA 4L11A 4AFMA 2VZ1A 1VMJA 3B9IA 1OA4A 3POSA 2ZAAA 4D7YA 5DZFA 3T2PA 2WZPP 1S2KA 3KF5A 4TLGA 3F95A 3FN9A 2HWB2 4BK5A 1NZCA 2HWC1 3PIGA 4Q1PA 1EAH3 3J7HA 1FPN1 5L7OC 1Z7S3 4IDZA 2YG0A 1ZA4A 3UGFA 4B7EA 3I54A 5L7OB 4BWOA 1HRI3 4E8DA 1GANA 2PHLA 4IXLA 5FPLA 4NROA 4AHYA 3H3ZA 1YXWA 1IG0A 2K9ZA 4L92A 4XZUG 5F8PA 5FZ0A 4OHZA 1FNYA 1W0OA 2R062 3M7AA 1GWLA 3KT4A 3AC0A 4Q8KA 2W0XA 4UW6A 3ZXGA 1PM7A 1BCXA 1RHI1 5GZEA 3RFRA 4A3ZA 3MHZA 4Z2AA 1OLQA 5LA1A 1ZNPA 1AR71 4A7ZA 4NPLA 4F83A 4FPYA 1W3VA 5L36A 3BI3A 4E4ZA 1BHGA 3V0AB 3TN93 1ULEA 1LCLA 1ZBE2 5CG9A 5BNPA 3AP5A 1OPMA 3OTFA 3WDVA 4W6WA 1XNTA 1SLBA 4A6SA 5T3NA 3AYAA 1VBC3 3J4UH 3GZEA 2AH2A 1LOAA 1ND2C 3A0KA 5KHJA 4QX8A 5JOXA 2X5IB 2WINB 4Q4Y3 1GNZA 1ND2B 1ZZCA 1ASJ2 5T50A 2AYHA 4R8HA 3LSEA 4CUBA 1S0EA 5C9AB 5A3UA 1VIWB 2YROA 4RYDA 4YNIA 2XLFA 1KITA 1WA4A 2XL7A 1FMD2 1PVC3 5K0UA 5KBFA 1GZ9A 1KDKA 2JWPA 1RUI3 2YBSA 4B4QA 1PGW1 4DPNA 1RUC2 3U10A 1N3PA 1UZ0A 1UU5A 2FD8A 3RMXA 3HD8B 3MIDA 3UKTA 2VMHA 3N9LA 2R6QA 1OC1A 4JVAA 3SEPA 3I4IA 4BJ0A 4XJ8A 4COUA 4XYXA 2VOTA 1S1AA 2VQAA 4P5YA 1O3TA 2VZ3A 3CO2A 4GULA 4DIQA 3GBGA 1X82A 2FHRA 5FXVA 1UYZA 3AZVA 3WT3A 1GLHA 2D98A 3FLRA 1K5JA 2UWCA 5DDJ1 2XVKA 1LRHA 2R0FA 4FFGA 1VBD3 5EYXA 3VDCA 2ZHKA 4BMBA 1LJ7A 4N53A 2PHTA 4DS0A 1O5UA 2R072 5FYHA 4DEVA 2C26A 3S57A 3DUIA 4K1ZA 1KRIA 5KXDA 1V6JA 2ETEA 1B35A 1O91A 2XJTA 4QGMA 1LHVA 3BU0A 1V70A 2FMYA 3BTXA 3H7YA 4FCAA 3WNMA 3LOIA 1J58A 3NNLA 4JGZA 1PO23 1UYXA 3ZFGC 1QJFA 1NXD1 2ZX1A 2D6PA 3POFA 5FYBA 2D6KA 2VQ0A 4LO7A 3ZFGB 1DP0A 4UXAA 1SBEA 1G8WA 2A3WA 1EUTA 3GF6A 4UW5A 1ZRIA 5LA0A 4XF3A 4IGPA 2D6NA 2Y60A 4E4HA 1W6QB 1PIV3 1UO9A 2AEYA 1KEXA 1YWKA 1ZBE3 3RI8A 1WKYA 3JD72 5H9PA 4DUWA 3GBWA 2WUHA 2PFWA 2AEZA 1DQ0A 2CGNA 3POYA 1Y9MA 1O8PA 2VZQA 4IETA 4V2WA 1FI2A 4RN5A 1K42A 1REDA 4PLOA 1D4VB 5K0UC 3N35A 1ASJ3 2WO3A 1RJ8A 4OQ8A 4KQ7A 5J98B 1HQWA 4QM9A 1RUD2 1XXNA 1PZ9A 1CAWB 2BGOA 5JOZA 2C9KA 3JCIA 4M4RA 5FZEA 4AHWA 4XIKA 4XF0A 1RC6A 1LHOA 4M0HA 2BQPA 4Q4V2 1SACA 2PLV2 2XBO2 2ZEYA 2DF7A 2GNDA 2A70A 4NHKA 5JXJA 2WO7A 4HONA 2GN3A 4Q4X1 4XILA 1D4M3 3VZKA 3NW4A 4Q0SA 2QQKA 3I3BA 5JSPA 3VBRB 2SBAA 4AGVA 1REEA 1OKQA 3BYWA 4ZU4A 2AREA 1KFXL 4N43C 1FX5A 2NN8A 4Q26A 4BHPA 1PK6C 2RR13 5IK8A 4QGLA 4N43B 2TBVA 5FZKA 1PK6B 3O0XA 1Q5OA 1NCRA 2D40A 1H2LA 4JCKA 4XFAA 2VAUA 5T52A 5BV6A 5E89A 2QJVA 1GBGA 3CZUA 2QQWA 4AI0A 2DUQA 1OH3A 5CKQA 3I2FA 3K46A 2R073 1CAUB 3T2OA 5A1LA
chains in the Genus database with same CATH topology
4GH4A 3ZPYA 4FAHA 1D2SA 1SCSA 1AYN1 1H9PA 2A71A 1WLCA 1HXS3 1PGL1 1ZBA2 1C3HA 3ZXFA 1GFF2 1DZRA 3MFCA 4P5HA 4KG0A 4Z07A 3W59A 3JBG3 4XF9A 5ACA1 1XNKA 5JPNB 4IEQA 1FV2A 5A33A 4E2GA 4CP2A 2YV8A 3ZX7A 4C91A 1Y3TA 2BBVA 3ZSEA 1AR61 1COV3 2XLGA 3SCFA 3LGRA 1T6GC 2F6BA 4HK9A 3LCPA 3LWCA 4P9IA 3ZSMA 3D4KA 2B45X 1XNBA 3ZIWA 3ZYPA 1IOAA 2NQYA 2WZR2 3KM5A 1FOD2 4Z2WA 2DCTA 2OYZA 1BBT1 1NQJA 3RJRA 4LBQA 1SFYA 4M3CF 1FATA 4ONUA 1KXGA 5FLIA 3USUA 1RUG2 1XE7A 3FWEA 1YUDA 3WDWA 3E6DA 1LOCA 1AXYA 4YGBA 1YIPA 1X7NA 4AI3A 1UU4A 4M3CA 4Q4V3 4OZXA 2CYFA 4KU7A 5EV7A 3G6JB 2DU0A 4HFSA 4DB5A 3GHMA 4D3WA 2WFF2 1VRH3 4KNCA 4RR3C 5J3UA 3BB6A 3MW2A 2HWD1 5FO8B 4RR3B 3LAGA 1RIRA 2RS32 1ZREA 4XFGA 3UKVA 2DFCA 2HWF1 4W6YA 4SBVA 4YLZA 1C4RA 3GBFA 4JDMA 4YM2A 3H1WA 5T5OA 3U07A 1RVF2 1X33A 3AZWA 3UJQA 2FQPA 1OQDA 1U5IA 1MEC2 3RG0A 3R4SA 3RSJA 2ES3A 3WUDA 5DG1A 1SBDA 4XFIA 1GQHA 1QKQA 4CZSA 2VVFA 2JEMA 4X8NA 3M4FA 3OD0A 5HI0A 3VKMA 4CDWA 1CAVB 5GLVA 2VOXA 2JENA 3USSA 4GWMA 3SH5A 4HKWA 2N7GA 3KQRA 3ZYGA 1HRV3 1V9U2 4FP3A 5I0UA 1CX4A 2GC1A 1QJX3 2Z79A 4YZ2A 4J1WA 2WA3A 4DFSA 4RSUA 3WG4A 3IDCB 2ZX0A 1C8M3 5GZDA 3E5XA 1SQ4A 1G7YA 5GALA 2B7YA 4IL7A 4NN0A 2EA7A 2ILMA 4CEYA 4PLNA 3RWNA 1VBB2 3H3UA 1RUG3 2VOKA 2RJKA 2GC2A 4FPFA 3IDBB 5CG8A 3V64A 2BYVE 1Q8SA 3M70A 4JC1A 2BFUL 2ZGNA 1CJPA 5JLVA 2PHWA 1WW7A 2A3XA 2VNGA 3CF6E 3KGZA 2RM23 1IS6A 4GB31 4FXGB 4AQSA 5CU1A 1I6XA 3VBFB 1CQ9A 2PAEA 4B4RA 3AMQA 5KXEA 4WVWA 4XE9A 4X6RB 2D3SA 4YFWA 4N9HA 2RE9A 3JB4C 3M3IA 1X36A 1MQTC 4Q4W1 1ZZ8A 4XXAA 4TYSA 4BPZA 1MQTB 4BIOA 5HXVA 1Z78A 1QJY3 2E7TA 3PVBB 2X29A 3BALA 4CP1A 4XMIA 4JRAA 4LE3A 5BYNA 1O4YA 2W39A 2ZX2A 1HIXA 1AR91 2BWAA 1OSGA 3MLLA 4LA3A 5CFDA 1MZEA 2Q1ZB 2PTMA 2R30A 1W6MB 4EWEA 2WS93 3VHOA 1LTEA 1OI6A 2R1BA 3BIWE 4XETA 5DZGA 1VLNA 2GALA 1EPZA 4IEUA 1OOPC 1SDWA 3AM2A 5JIAA 2HWC2 1OOPB 4INDA 1NQDA 1FPN2 1NXMA 4AGGA 1H8TA 5KHHA 2BVVA 1WUVA 2Z69A 2R0HA 4XDQA 1V6KA 4I3PA 4O9GA 3ST7A 3NJZA 4AFCA 3D8CA 1XU1A 2D43A 1VBB3 3AMPA 2HEWF 4XPVA 2RS11 3IIAA 4K20A 2KXLA 4Q0QA 4RD7A 5GLWA 1NCQC 3HT1A 1RHI2 1RUD1 4AEDC 3AFKA 4BMEA 2GZWA 1NCQB 5LEKA 4AEDB 4N90A 4AGRA 1VAMA 1AR72 3O12A 4D69A 4FPEA 1VAKA 3NV4A 3KCXA 1UIKA 5JI9A 5H9QA 1H4GA 3FUOA 2WWSA 4W65A 4GA9A 4DNYA 2A6WA 2E9QA 2QDRA 3LOBA 2WT2A 4YARA 2IFRA 4AYUA 3J8F1 2XKOA 1QGLA 1S2BA 2R32A 1IZ3A 4AVCA 1C1FA 1A8DA 2C1FA 2PHRA 2DCJA 2ZOEB 2W68A 5KC6A 1BEV1 3HAGA 3J9SA 1PGW2 2WJSA 3LA7A 2XL9A 3UK9A 3HWJA 1RUE1 5GLZA 3VBOA 1PZ8A 2GMPA 2ZGMA 1M4WA 1R1A1 4IEZA 2IXKA 3MDPA 2G9FA 3AFGA 3A4UA 4EWAA 1UN1A 2DWRA 4XFHA 1PO11 3SXWA 1WMDA 5GM0A 5ABJC 5DDJ2 2Y0IA 4I0AA 3B93A 5ABJB 4I30A 2Z2SB 1IS3A 3DL3A 2KM2A 3IT8A 2HWC3 4MSVA 3RJ2X 1WW5A 4YVWA 2TUNA 5AFEA 5CA6A 2NYYA 4R4ZA 2OPKA 4AFDA 3WQ7A 3N7LA 3M1HA 1TNRA 4HLTA 3HT2A 1VALA 1RHI3 5CIRA 1WLTA 1U5XA 4ES8A 4LO8A 2RHPA 1S0DA 1ZRDA 3AP6A 1OFSA 1ENRA 2BVBA 5I93A 1YIFA 1AJKA 5LRRA 3RMYA 3S7IA 3WNXA 4H55A 3QD6A 2Z42A 4I3GA 1LODA 5BUVA 1O7FA 3WQ1A 1F2NA 2A73B 3O5SA 3AKQA 1AR81 2JG8C 2ZA9A 4LBKA 3UV9A 2JG8B 2VVEA 4F8AA 5AC91 5EWSA 1GV9A 1RMU3 2MNGA 3ES4A 3AKTA 3RYKA 3ZSLA 3MI8A 4BLJA 4META 4EN8B 2EVXA 4Q4X2 3WD5A 1ALYA 2OUJA 1LEMA 1J1TA 1KD7A 4XTPA 3WY6A 4NR1A 1MS8A 2O0OA 3I59B 2NPIA 5A32A 1YFXA 3Q9OA 1DLLA 3DN7A 3FFQA 4KU8A 2JG9A 3OGJA 4AHXA 5DDJ3 4C1XA 4CDXA 4COYA 4FPLA 4FO9A 2D44A 4B8EA 4Y20A 3OY8A 5CAZA 5F9TA 3MGUA 4YG6A 1POV1 2XPJA 1D0GA 1WW4A 2P3JA 1YI9A 4GQ7A 1TMF3 3R0RA 1UZZA 2RJLA 4FVVA 2Q1MA 1QU0A 3GZAA 1AYN2 3T1LA 3CNAA 1L3JA 4IV1A 4F7ZA 4YZ3A 3U4XA 1PGL2 4OI1A 2CWSA 1QOSA 4JV4A 3L2HA 4CDUA 1ZRRA 4FXKB 1O5LA 3AJZA 2E63A 5ACA2 2D7FA 4JGYA 3WW4A 3WVJA 4IEOA 4QPGA 3AMHA 4B29A 4XJ9A 2MHFA 4FAGA 1AR62 4BLIA 5T54A 5FQ0B 5JAXA 5EFUA 1GKBA 3GZTB 4S2GA 4IEVA 3VHNA 4AFBA 3TOJA 4TSVA 4Q27A 2ZABA 1R081 4DINB 1BBT2 2D6LX 1QY4A 5DZEA 4AG4A 4S2FA 3KB5A 1XNDA 3D6EA 3ILRA 4LLOA 4MGYE 3ZFEA 4A7KA 5FPXA 4P9JA 3BU7A 4XQDA 3M3EA 1OQEA 5FLHA 1V6OA 3ZFFA 3LB9A 2I45A 5FLJA 4I2OA 2DVFA 3ME2A 2XVLA 3DKWA 1RL3A 1N1TA 1W6NA 1HV0A 4J1XA 2ZX4A 4N7IA 1W0PA 2JG9C 4YFZA 5BY5A 3HMYA 2HWD2 1QJU3 3MIBA 4MXWB 1RUH1 4HPKA 5L19A 4H7MA 4AQTA 4K21A 1S0BA 4L9BA 5J36A 5JSOA 3MW4A 3V0BA 2HWF2 1DFQA 3M3CA 2Q30A 2A6XA 4QGNA 2DFBA 3OF1A 4M01A 3BOPA 2A7AA 1H2MA 4FOVA 4FTSA 1U5ZA 4YM3A 1KFUL 2HKXA 3FUQA 1QOTA 2JXAA 3BCWA 3RI9A 4RGGA 2YGLA 1MVQA 1VJ2A 4JGYC 4YGDA 4ATFA 2DVDA 4QPGC 5JSRA 1YI7A 1MS1A 2R1DA 2ZS6B 5ACA3 1G9FA 2D97A 5T5LA 2BFUS 1FYUA 3E97A 2WNVC 1GQGA 5CVRA 4R9CA 1AR63 3X29B 5KC5A 2VXRA 2WNVB 4ITCA 3UJOA 3VKOA 2HEVF 2G4IA 1S0FA 2PHFA 2MEV1 3KZ4C 1DYPA 3M2MA 4P14A 1SFNA 4HMZA 4AVBA 2PYTA 2B9UA 1QNYA 3VBUC 4K7JA 4XF1A 5JR7B 3VBUB 3LA2A 4R9AA 1AX0A 4C90A 4E27A 3POWA 3VBSC 3VBSB 3ZFFC 2ZPXA 1DGLA 2R043 1XYPA 5DXDA 3CU7A 3PLQA 1UCXA 4LBLA 3RZZA 3MLKA 4P9LA 2DTWA 4I0WB 1UD1A 3IMNA 5BNOA 1OLRA 5F6KA 3CL1A 4QHBA 3MFAA 3ALQA 3JU9A 5C4WA 3N7MA 2XJRA 4QX5A 3ZN6B 5FOBB 5JZGA 3N4MA 3O14A 3WP6A 1LB2A 3B01A 4GB32 5BXXA 2DURA 4PIZA 1EV11 4EN0A 1XRUA 2EXIA 5DUVA 4AHZA 2HWE1 4C0HA 4LO6B 4FPOB 5FRAA 1CN1A 4OHWA 3ILFA 4XJUA 3RYRA 1YRZA 4AF9A 2BNOA 2HWB3 4Q4W2 1EP0A 3MEPA 2VULA 5KWRA 1G86A 2JDZA 4ORFA 4QM8A 3V65A 4F3JA 3IPVA 2ERFA 1UKGA 2D3RA 4MXVA 3VZNA 4Y1ZA 5T55A 2OZ6A 1AR92 2R063 3MF6A 5I91A 3MPBA 1RUOA 4MUVA 4KL1A 2JJ6A 3VZOA 1R091 2YYOA 5BNPC 1ND3A 4WVZA 1BZWA 4LHNA 3TRSB 1Y7BA 1IKPA 3ZIXA 5BNPB 2QZ2A 1DGRN 1MZFA 4C0BA 3AKPA 1H2KA 1N3QA 4FPGA 4UBGA 3SNMA 4YW2A 2XUMA 1AL0G 1QDCA 2ZJCA 3WP5A 1W6OA 4GKXA 4AVSA 3PJQA 5SV5A 5K0UB 3AYCA 4BCUA 3KMHA 2RS12 4LE4A 3WR0A 1AL21 3U11A 3ZXLA 3L2YA 3W9AA 1FMD3 5CFCA 4A3XA 4WM7A 1XQNA 3FFZA 1RUC3 5GLTA 3WQ0A 5JZGC 4QXKA 3ZSJA 1QF3A 4LUKA 1ZVFA 5JZGB 1Q8PA 2AR6A 1YFWA 2A6VA 3PHMA 2CL2A 3DPRA 4QQLA 4Y1YA 1LOFA 4XZPA 3GALA 4HT1T 4OI2A 4PIXA 3WG2A 1PHMA 2WLQA 3J8F2 2BNNA 1H0BA 1F8VA 3RS6A 4N53C 3EQEA 1KJRA 2AGSA 3OBTA 3NSTA 3CJIA 4Y1VA 4XXPA 4N53B 4YRDA 5FMOL 1BEV2 4XIOA 4M00A 4XFBA 1VBE1 1NLSA 1B35C 1RUE2 1W6PA 4H14A 1B35B 3THTA 4FP2A 3H9AA 5E8AA 3LA3A 4Q2FA 3LKJA 2RS51 1R1A2 4FOQA 3D0JA 2ARBA 4JGZC 4IEXA 2Q4SA 4FPCA 3AKRA 4JGZB 4UW4A 4EN7B 3LZZA 1M06G 3WV6A 3HN1A 2JE9A 1Q8QA 1PO12 4LBMA 5I8YA 4LO5B 4PJYA 3WZ1A 1ND3C 3P3PA 1NYWA 1ND3B 1RJ7A 4KH9A 3L9JT 4YVSA 2DUPA 4COWA 4K1YA 3CEWA 4HVOA 4YGEA 2XG3A 3JD73 3VZJA 2XWJB 4GKYA 1YJKA 3SHRA 1APNA 3AMNA 2DUOA 3OD4A 2IXHA 2ZGOA 5CFCC 5C8CA 2ZGPA 5CFCB 3I2DA 4NVPA 1I5ZA 2ZTNA 4HVRA 1RUD3 1AXZA 1H30A 1TEIA 3ROUA 1WCSA 3DGTA 4P9WA 4WVMA 1HW5A 1PMIA 1W39A 3TN91 3DPRC 3B3QE 2XBO3 2PLV3 2OUHA 3ZXJA 1IPKA 1LGCA 1VBC1 4IV3A 1J3PA 2CAVA 2ET1A 4CEWA 4HANA 1LU2A 4Q4Y1 5A3LA 4AVAA 1NCRC 2E51A 4FPKA 3J8F3 4LUMA 4LBJA 1NCRB 4YYOA 2VUJA 4FBFA 5IK5A 2I74A 2B39A 1AX1A 1O3RA 4OVEA 1PVC1 1AR82 1N1VA 2UURA 4URTA 2XHKA 2HEYF 4FOYA 4GH4C 4JDOA 2DVAA 5AC92 2H6BA 1EY2A 4GH4B 2BGCA 1RUE3 1C28A 4HSJA 4LLFA 3ZXAC 4FSJA 1U0AA 1A6CA 4WV8A 2GU9A 3NL1A 1ZBA3 2QCSB 1J59A 4U36A 5A33B 2WSUA 4AQ6A 1VBD1 4FTBA 1MACA 4ZKTB 4HN0A 3UKNA 5F5QA 4AW7A 1IQAA 3MPPG 3VBHA 2WZR3 2ZHNA 4LBQB 3ZXDA 1FOD3 4JTOA 1IPJA 5DUWA 2OVUA 3USUB 2DV9A 3TWIA 2XLAA 4CP0A 2DCZA 4R9BA 5HBAA 4SLIA 3NV1A 3WG1A 4QQPA 5B2GB 4NHLA 3ZDSA 2UWAA 4AI8A 4M3CB 3QBQA 1YNAA 4HBNA 4WZCA 4EN9B 1PIV1 1QDOA 2ZBJA 4J6GA 4CEWC 5SV8A 1REFA 4I0BA 1VB2A 5EYYA 1Q3EA 5J37A 2WFF3 1R082 5H9RA 2JICA 1QNWA 2RS33 2P17A 3NV3A 3V56A 2NLRA 1FXZA 1C5HA 1DYKA 1AR83 2C9AA 4GMP1 2YHJA 1RVF3 2UYAA 1NA1A 4YZ5A 2A6YA 1MEC3 2OW4A 4COVA 2E53A 2EXKA 3QOPA 2WC2A 1F5FA 3QCWA 1TME1 4RA0A 5AVPA 1D4M1 2GAUA 4CDWC 2ZHMA 1JH5A 5K7PA 2ZAHA 5H9SA 3UL2A 4CDWB 3WDTA 2QVSB 3JQXA 2VECA 3FHIB 2RR11 1RUH2 2ZGRA 1J3QA 3N3HA 4JRLA 4QPIA 3G7DA 4NWWA 3MICA 1RUJ2 2B5HA 1ENQA 4AK3A 3VV1A 4KG8A 2VPVA 3KCYA 2VGDA 1H4HA 1V9U3 2TNFA 3WHUA 2P3IA 2NM1A 3VBHC 1POV3 3VGIA 2D5HA 1GICA 2KA3A 1I9RA 1HXS1 1TNFA 4QT6A 2V09A 1RUF1 3NV2A 4LO4B 4CEYC 1G9DA 4LHLA 4CEYB 1JOJA 5EZWA 3WP4A 3JBG1 1JYIA 4E4SA 3ZMOA 1XYNA 4RGAA 1JN2P 1GNHA 3PVNA 2FZ1A 1RITA 4XW3A 1COV1 1AF9A 1FNZA 3J26N 4Y22A 1CAXA 4OI0A 4Q0PA 2VH9A 2C5DA 1QOOA 2ARXA 1MZ6A 2MEV2 5FCCA 2LTNA 2D5FA 4QPYA 3AX4A 4NPRA 2LALA 1GYKA 4K8FA 1LGBA 4HVQA 1ZM1A 4HETA 4XTMA 5BNNA 3NKGA 4KBBA 1OD5A 2ZGKA 4Q0VA 2DYCA 4XQWA 3ACLA 4RQPA 4LEJA 2WNUA 2TEPA 2WLPA 3BOWA 3WW1A 3VLBB 2Y0OA 1TQ5A 1UX6A 4YG3A 5AFBA 1HQLA 1IKQA 1IHMA 4ATEA 5CFDC 4DXZA 3U0ZA 5FO9B 5CFDB 2XJQA 5D1IA 3TYJA 1EV12 5D8AA 1ZRCA 4BQ1A 2GH8A 3WDUA 5TSWA 3E6BA 2HWE2 2ZGSA 2IZWA 1MS4A 1H8TC 3FMGA 4PDWA 3B94A 4IEYA 1H8TB 1JHNA 2RMU1 2EAAA 1VP6A 1FPN3 2CTVA 3WOGA 3O0VA 4AI1A 3E5UA 1LHWA 3AK0A 2CGOA 4AEKA 5LK5A 1BKZA 4EJRA 1K5MA 4PCRA 2LUWA 1G9CA 4OHXA 5CNAA 1PVXA 4AVVA 2BNMA 4XBLA 2DVBA 5EJ3A 4Y1XA 1R092 1HRV1 1QQP1 1H1MA 2ZHLA 1WLWA 2DTYA 1AR73 1S0IA 2CY6A 4KWLA 1LHUA 5BNQA 4K6BA 1A8MA 1AJOA 2WIIB 1F31A 1SLIA 1VR3A 4MX3A 1C8M1 3IBMA 3H1MA 4M0NA 4GWNA 4EROA 3IN9A 4WM8A 1DIWA 1GZWA 1KJLA 4XJZA 4YZ4A 4N7UA 1KS4A 2R16A 4YG0A 2NZ9A 3NAPA 1AL22 5FMOS 3S6PA 1SLAA 1ZZ7A 3RPQA 3VBOC 3VBOB 4KGGA 1EYBA 1WMFA 3AKSA 2QDNA 5E16A 4FQZA 3AXEA 1LGNA 4ZU7A 2RM21 4YZ1A 3N7JA 5FREA 2WQ4A 2Q8OA 5FBZA 4O9EA 2D93A 4N9IA 4ASLA 4P9GA 2VMGA 3AP4A 4HN1A 4EN6B 1UPSA 4RFT0 4YVWC 4A2UA 2IXCA 1VBE2 4YVWB 1IS4A 3QLQA 2YPJA 4Z82A 4LR4A 1QJY1 2RS52 3SLIA 1K5MC 4X8PA 4LBQD 1H2NA 1JW6A 1RTVA 2E7AA 2PQQA 5FOJB 4QQHA 1MS9A 3BPZA 2ZACA 4D7SA 3FLPA 2WS91 3I7DA 1KQRA 4RS5A 1IGOA 2ZGLA 1KS5A 4R9DA 2QFEA 4WM8C 3S30A 3BODA 1SCRA 3GZUC 5I8TA 3AYDA 3MIEA 2YMZA 5L7OA 4CDQA 1PGSA 3VDDA 4DRVA 4OHYA 1VBA1 2VOWA 3H0OA 1ULDA 1YJLA 1HV1A 3SCGA 2PHDA 3GNEA 4ISRA 4XFFA 1V6LA 1SLCA 4MYEA 1DZTA 4QQ2A 5CB7A 3TN92 2QZ3A 4JAAA 4DY3A 3KD4A 3V0AA 1VBC2 1LHNA 3T2TA 4Q4X3 3FE5A 1QH7A 1UF2C 4LBNA 5A32B 4OUSA 4Q4Y2 3GYDA 2JG9B 2NP0A 1YFUA 4CDXC 2X5IA 4H7LA 1DHKB 4CDXB 2ET7A 4AFAA 1UPIA 1YHFA 5C9AA 1PVC2 1DBNA 4Z92B 5T5JA 1N1YA 4Y20B 3OY8B 1RUJ1 1HQNA 3AJYA 3MYXA 5CADA 2PELA 3GHNA 2ZZQA 4AE2A 1YLLA 1A3KA 5GZGA 1JYCA 4IV1C 3VZLA 4C1WA 4IV1B 2RS53 3VUOA 4GALA 1N47A 4CDUC 1AYN3 4CDUB 1Q43A 1WD3A 2GMMA 1HDKA 3AXDA 3ES1A 4GXLA 5IT6A 4RS5C 2XJVA 4QD2A 4JGYB 2P3KA 3MW3A 2O8QA 4FPJA 4QPGB 1B09A 1VBD2 1S0CA 1DQ2A 4ISQA 4GIQA 2B42B 4XFCA 3OPZA 3NWKA 5F1RA 3APBA 5CBLA 4OI4A