3WOGA

Crystal structure plant lectin in complex with ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
238
structure length
238
Chain Sequence
b'ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythroagglutinin
publication title Phytohemagglutinin from Phaseolus vulgaris (PHA-E) displays a novel glycan recognition mode using a common legume lectin fold
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wogA00
4Q8LA 1V6KA 2AREA 1CR7A 4YGEA 2P34A 1C4RA 1LGBA 3WNXA 2OW4A 3WDUA 1WD3A 2CL2A 4Y1YA 1AZDA 3M3CA 2YV8A 1W6NA 1OFSA 3POSA 4XXAA 3OY8B 4GWMA 4XJWA 4Y26A 2Q5TA 3B69A 4DQAA 2W52A 2GNBA 4Q27A 1GZWA 2EAKA 2ZGNA 3AYEA 3I4IA 1D0HA 3MW4A 2ZMLA 1PZ9A 2D43A 2DU0A 4FP3A 2CTVA 4PF5A 4Y1ZA 3WG3A 4YZ4A 1FNYA 2ZGPA 2P37A 1MVEA 3O0WA 1YO8A 4YW2A 5DZGA 1G9CA 2ZACA 2D3SA 1HKDA 5L73A 1AX0A 2KM2A 2PHRA 3V0BA 1LECA 2AR6A 1S0FA 1Y7BA 3SLIA 2ZGOA 1V6NA 1GLHA 2A3WA 1G8WA 3M2MA 1UMZA 2BQPA 4XHXA 4FPLA 2SBAA 3A4UA 1GV9A 1WUVA 1BJQA 4XJZA 4Y1VA 1LEMA 2NM1A 3KM5A 4YZ2A 2A6XA 2D7FA 5JOXA 2CWMA 2JE9A 2PHFA 2DVBA 2EIGA 3N7KA 5H9PA 4BQ1A 1S0DA 5JOZA 2DTWA 4YM3A 2D6MA 1QF3A 1F5FA 2D6NA 3PVNA 1C1LA 2PHUA 5KXBA 4F83A 4C1XA 2YMZA 1W6NB 4IQPA 3OYWA 1XQNA 4PBPA 4Y20A 1B09A 2PHXA 4K20A 4ZXKA 1G9BA 1UAIA 1GZWB 1G86A 3FFZA 5IK4A 1NXD1 1O4ZA 3O0VA 3R05A 4JRAA 4BPZA 3BTAA 2E51A 1LU2A 3O12A 3FUOA 3LSEA 1KITA 1DGLA 3ILNA 3ZXKA 5DZEA 1YI7A 1S1AA 1JW6A 1CIWA 1R1ZA 1SBFA 3RS6A 4YGBA 2DUPA 1LOCA 1WW4A 3LSDA 5BYNA 3AZXA 2FHRA 2NYYA 3M3QA 1RIRA 4ITCA 4LBQD 5GZDA 5KXDA 4LBLA 1OKQA 2D6OX 2JD4A 5GJ6A 1JHNA 1G7YA 1Q8SA 2ARXA 1JYIA 1SLLA 1J1TA 3ENRA 1VLNA 1S0IA 4FVVA 2DVAA 3I8TA 2AGSA 4P14A 3MPPG 2EXHA 4FOVA 5T5LA 1LOFA 1SLBA 4FPEA 1DQ0A 1V6JA 2ZA9A 1LODA 2AH2A 1VAMA 4FP2A 3AJZA 2ARBA 4LBJA 4FPYA 4YGCA 2DU1A 4GXLA 2D3RA 3VUOA 1W0OA 3LCPA 3WDWA 4FPGA 3WVJA 4YZ5A 2WJSA 4U2AA 2VW0A 4XILA 1AF9A 3OYWB 4Y20B 1EPWA 1SLAA 1LJ7A 3L2YA 1KRIA 1C1FA 4M3CF 1PZ8A 2DV9A 2UWAA 3BODA 3N7MA 5GLUA 2C9AA 1DQ6A 3M1HA 1SLTA 1H9PA 5GZEA 4BLJA 5JDBA 1GNZA 4U36A 3SH3A 5EXOA 3AYCA 2A6YA 3ILFA 3PMEA 1BQPA 1SLIA 2DURA 3N7JA 2JJ6A 5F9TA 4GWNA 1WW7A 1N1YA 4XTMA 4Z8BA 4JC1A 3AP6A 3SH4A 5DUVA 5EYXA 1QMJA 2GNDA 1GANA 1AX1A 3A0NA 2DVGA 4GKXA 4P9YA 5H9RA 4GALA 1BKZA 3VKMA 1LESA 3FBYA 2ZHNA 3VKOA 5E89A 3AP4A 1FX5A 1FYUA 1MVQA 2WQZC 1QOSA 3PVEA 3ZXFA 3WDXA 5CBLA 1LGCA 3NWKA 4TYSA 4Y1UA 4ATEA 1Q8VA 3AK0A 1FV3A 2UWCA 3AZYA 2YROA 5GALA 1ULDA 3ZSJA 2GN7A 1QNWA 1UZZA 1YXWA 4M3CA 5CNAA 3M3EA 4FPCA 5GZGA 1S0CA 4W65A 3JU9A 2AUYA 2ZHLA 5JOWA 3BIWE 4XMAA 5JOYA 1LTEA 3V0AA 2YZ4A 4Q1PA 4Q1RA 3ZVXA 1WD4A 5HCBA 2ERFA 1GBGA 1SBEA 3MEPA 4UW5A 3WG2A 1Z0HA 4CRQA 1IS5A 1OQ1A 1X50A 4AVSA 2VY0A 2W08A 4XOGA 4YGDA 4AVTA 2R16A 2P3KA 3KQRA 2ZGUA 2A6WA 2YY1A 1CJPA 1N3OA 1UPSA 1MACA 5DUWA 3SH5A 3RSJA 1ENSA 4M00A 5IK7A 2ZMKA 2R1DA 1ZM1A 4YLZA 1DQ2A 1MS1A 5JVVA 1MS9A 4XIKA 2A71A 4DRRA 1O4YA 3AP7A 5FRAA 4Q8KA 1ENRA 2PELA 4L8QA 3W58A 1QDCA 4LBNA 1AXYA 5HCFA 1JOJA 1CESA 3RMYA 3AJYA 1WBLA 1GZ9A 2DWRA 3D6EA 1WCSA 4MYEA 2VUAA 4BOWA 3O0XA 2P2KA 3WLUA 2E6VA 4XTPA 4PCRA 1LU1A 2E7TA 4XBQA 5KXCA 1A78A 1N47A 1DYPA 1SACA 1WBFA 2UU8A 1CVNA 4M3CB 2GMMA 3DGTA 4YZ3A 4LBQA 4ISQA 1I1EA 3PVOA 4D69A 1MS0A 5DG2A 1FATA 1QGLA 1ULCA 2GALA 3QLQA 3V0AB 1AJKA 2ZGMA 2DTYA 3IKWA 4Y24A 2G4IA 3INAA 3ZSLA 3ZSKA 1CPMA 1SBDA 3V0BB 4BMBA 2ENRA 4ASMB 5GZFA 1ZA4A 1JUIA 4FPOB 3SNMA 4OZXA 2V5YA 1KJRA 3UJQA 1HLCA 2OUJA 4R9BA 3HR9A 5T5PA 4NO4A 2VH9A 1KDKA 4YM2A 1QNYA 2NP0A 3HMYA 1CN1A 5T5JA 3D4KA 3ZXJA 5AVAA 1D2SA 1CPNA 3O5SA 4AGVA 2ZHKA 4R9CA 1N3PA 2H0BA 3RG0A 3W59A 2NMOA 1V6OA 1W0PA 4BMEA 1FV2A 1QDOA 3OGGA 2CY6A 4TZDA 5H9SA 2EXIA 3GNEA 3UK9A 5GZCA 1YIFA 3WUDA 4NOTA 4FPJA 2A75A 4M3CE 4YG0A 2LALA 4WZFA 4PQ9A 5JLVA 1KQRA 2JECA 1LOFC 2XG3A 3MW2A 4LBQB 4R9AA 3DUIA 1ULGA 5T50A 3T1MA 2ZGKA 2ZKNA 2ZBJA 2VXRA 3AZVA 4XDQA 5EYYA 2D3PA 1IKPA 4XZPA 1N1TA 2WLQA 4WVVA 1LOGA 1LENA 1QOOA 2W39A 3IM0A 4CTEA 1V6IA 2GNMA 2ZMNA 3APBA 1LEDA 3WUCA 3TB0A 2NMNA 3C2UA 3NV3A 5HCAA 2A3YA 1Z78A 2WNEA 4FPFA 1AXKA 4Q2FA 2UWBA 3OY8A 2A70A 2GMEA 3H0OA 4Y22A 2EXJA 3FUQA 5IUQA 2RHPA 4K1ZA 1RITA 4CZSA 1RINA 3B00A 5T54A 3V65A 3B9CA 3IPVA 1AXZA 1WLDA 1QU0A 2CWSA 3N3HA 4XXPA 4XMIA 5IT6A 5DZFA 2VW1A 5GLTA 3U4XA 1VALA 1SFYA 3IMNA 3B3QE 1IS6A 3WDVA 3FLRA 1HQLA 3ZXEA 3WDTA 5CAZA 2A7AA 3PJQA 1JYCA 5DG1A 1AX2A 5CA6A 1BZWA 1S0BA 4HL0A 5F5QA 1AJOA 2DVDA 2GDFA 2D44A 2SLIA 2ZGRA 2ZZJA 2DYCA 1LOEA 2ZGSA 1LULA 3MW3A 5E88A 3AZZA 5T55A 1WLCA 1UL9A 4R9DA 1N1SA 5DUUA 4AGGA 4YZ1A 1W6OA 4K1YA 2ZGLA 1KDMA 5CB7A 3ZYRA 3A0KA 3NV1A 2ES3A 1G9FA 1ULFA 1VIWB 3AXDA 3ZXLA 3GALA 4RL7A 3T2TA 2CYFA 1ENQA 1S0EA 4FQ4A 3TAYA 1IKQA 2OVUA 1DIWA 2PHWA 3HN1A 1GNHA 2R0FA 4LBMA 4UW4A 2R49A 2HYKA 1GICA 4Y22B 5GLZA 1G9AA 4UW6A 4JCKA 3VKNA 5IK8A 1GZCA 4AVVA 3RQ0A 2LTNA 3POYA 3T1LA 1G9DA 3NV4A 1DFQA 4RA0A 2PHTA 1N1VA 1MS8A 2D6LX 3IPVB 4K21A 2NZ9A 1UKGA 4SLIA 1Q56A 1W6MA 2D6PA 4KBBA 2JDZA 1LHWA 4UW3A 1JXNA 1LOBA 1GKBA 1GYKA 2XB6C 5GLWA 2UURA 4XJUA 5GLVA 2WKKA 2ZGQA 1FAYA 5GM0A 2AENA 3SISA 1I3HA 4XJ8A 1TEIA 4DFSA 1YRZA 2A3XA 3N36A 3ZYPA 2R1BA 1URXA 3AZWA 3B01A 1DBNA 1LGNA 1HDKA 3WCRA 1DLLA 2OUHA 2WT2A 4BLIA 4PBOA 2CNAA 1MS5A 4AGRA 4YG3A 3AXEA 1N3QA 2FMDA 1ONAA 4LBOA 4FOQA 1DHKB 1LHVA 4WVWA 4ZKTB 4GA9A 2ZABA 1UN1A 2V73A 4XHBA 5KXEA 2EALA 1S0JA 1W6OB 1MZ6A 5T5OA 4Y1XA 3WZ1A 3NV2A 5JMCA 1V6LA 1BXHA 2D6KA 5EWSA 1AVBA 1MR5A 3FLTA 3QCWA 4FPKA 4YG6A 3WCSA 1DQ1A 1IS4A 3OPZA 4ISRA 2ZAAA 5H9QA 3RMXA 3WV6A 3ILRA 3ASIA 1JBCA 1HQWA 2Z42A 4AWDA 1DYKA 3R4UA 4C1WA 5IK5A 3D5OA 2I2SA 3OBTA 4XBLA 4XE9A 3V64A 1SCSA 3AP9A 3WDYA 1MS4A 4XJAA 2GNTA 2TEPA 1CONA 4DRVA 3AP5A 1BYHA 4P9XA 4YM1A 1U0AA 1W6MB 2NN8A 1S0GA 1H9WA 4I30A 4WV8A 4XYXA 4YM0A 1F31A 1UZYA 1MS3A 3AYAA 2A5ZA 4FOWA 2WSUA 3M3OA 3CNAA 5LK5A 3ZPYA 2YXSA 1LHOA 1PZ7A 1Q8QA 1NLSA 2A6ZA 2AYHA 2P3JA 4AYUA 1SLCA 2E7QA 1W6PA 1VAVA 1UX6A 1APNA 1QOTA 1LOAA 2EXKA 2W68A 2GN3A 2DUOA 2VW2A 4YW5A 1WLWA 4FQZA 1W6QA 2R0HA 4Q26A 3UL2A 3AFKA 1V00A 3USUA 1WW6A 3AX4A 2JE7A 1A8DA 1DZQA 3VKFC 2VU9A 5T52A 1IOAA 4YW3A 2GMPA 2E53A 4YW1A 4YFWA 3VV1A 4DS0A 5E8AA 3FLPA 3AYDA 3N35A 1MZ5A 4M01A 1YYNA 1IS3A 1A3KA 1JN2P 1WW5A 4HANA 1FNZA 4DPNA 2ZHMA 1V6MA 2P3IA 1Q8OA 4XIOA 5FREA 3WG4A 4XBNA 1H30A 1DQ4A 3WG1A 1LHUA 4ATFA 2JKBA 1KJLA 4P9WA 3BOPA 2C5DA 3POWA 1CQ9A 2DUQA 1DQ5A 4FOYA 1LCLA 1SCRA 3RRDA 3VKLA 1GSLA 3WHTA 5SV8A 3N7LA 2ZGTA 4H55A 4YFZA 3R4SA 2A6VA 2WSVA 1LHNA 3IN9A 3Q9OA 4YW4A 2DVFA 3WHUA 2WT1A 1W6PB 1ULEA 4XJ9A 3OBRA 3ZSMA 2EF6A 5DUXA 2WT0A 5DXDA 2B7YA 1QKQA 1Q8PA 4FPHA 3SITA 1C57A 3JUUA 3UJOA 1W6QB 4LBKA 3WOGA 4GKYA 3USUB 4BM8A 1F9KA 3ATGA 3OJBA
chains in the Genus database with same CATH superfamily
1V6KA 3LQCA 1CR7A 3CZUA 2P34A 1C4RA 1NZCA 1W05A 3ITQA 4UXAA 2OW4A 4AAXA 1JZ7A 4W6XA 4YVWB 3M3IA 2ADEA 2JG8B 1AZDA 4Y1YA 4C91A 1W6NA 4DINB 5HV0A 4XXAA 4BDVB 4FTSA 2WZR3 4UT5A 5C4WC 2FDKA 1OT5A 1I6XA 2WFF2 2GNBA 1E5IA 2Y34A 3NJVA 4Q27A 1MPXA 3MW4A 1LRHA 4V2WA 4Q0SA 3QH7A 1PZ9A 4YWAA 3T2PA 4A3XA 2VNGA 5FP9A 4PF5A 2QQNA 5FPBA 1P8JA 2R072 3ST7A 4E8DA 1MVEA 1ZBA2 1D4M1 2BERA 4IXLA 4YW2A 3K4ZA 5FZOB 3TNQA 2ZACA 4HLTA 1FOD1 4AI8A 4H14A 1UWWA 4IETA 2D3SA 1PK6C 3O1MA 4YVSC 1AR82 1AL21 4QPIA 3V0BA 1OURA 4AEKA 4QPGA 4TWTA 4WM8B 4QGNA 1CX1A 1S0FA 2PLV1 2Y0IA 2ZGOA 4H7MA 1G8WA 5ACA1 1GWMA 3ECQA 4FXKB 4XHXA 1H8TB 2P5BA 1OMIA 2VO5A 3BB6A 4NHXA 2VMCA 4Y1VA 4NIAA 4AQ6A 3KMHA 1VRH3 2PHFA 1EV11 3JCIA 4OLLA 1RXFA 2EIGA 3KGZA 5HCHA 4QGMA 2DTWA 5LEKA 1FMD3 1SHWB 1J3QA 2XJSA 3GHNA 3PVNA 5KXBA 2VMFA 3JD73 2YMZA 3I2GA 4C1XA 4JVAA 1W6NB 1A6CA 2YGLA 1MEC1 3ACHA 4AFDA 4PIZA 3FFZA 5IK4A 3S5AA 3O0VA 3R05A 1QJU3 3JBG1 1W8TA 3I2HA 2XH6A 2BDRA 5CADA 3FUOA 4IDZA 1COV1 5L9BA 2ARAA 2YHJA 4MHRA 3ZXKA 4QAWA 4QPIB 4XFCA 1JW6A 3MIGA 3H8UA 2W46A 1GWLA 4QPGB 5FP7A 3LSDA 3ZPOA 3M3QA 3EHKA 3QACA 2WS92 2RS32 2JIJA 2Y26A 5FYMA 5KC5A 4QX0A 4NPRA 4RN5A 5ERLA 1OKQA 2WINB 3I3BA 4Y4RA 4N43A 1RUG2 2ARXA 3HEIA 3U4SA 4PQQA 1J1TA 1JYIA 3ENRA 3B5LB 1RUJ1 5K0UC 3BUCA 5T5LA 1MZEA 1UNBA 2EXHA 1SLBA 3ZMNA 4AEJA 5C3PA 1BEV2 3E5UA 2ZA9A 1TME1 3E5QA 5BNNC 1GP5A 4S2DA 1CIYA 1R082 2DU1A 3RZHA 1ZREA 2HWD3 3N9PA 4OYUA 4AXOA 4YZ5A 3ZYIB 3IDAA 1HN0A 2VW0A 2DCZA 5LRRA 2WNUC 4QHZA 2B46X 2IXJA 2WFF1 3I3QA 4NHLA 1SLAA 1LJ7A 2HEVF 3SEEA 3ZYJB 1KRIA 1HRV3 1PZ8A 2YC0A 5LY2A 2UYAA 2R071 1W06A 3VD5A 3N7MA 3LFMA 5GLUA 1O3TA 1SLTA 2C1FA 4PIXA 1E5SA 4HETA 1XC6A 5J36A 2YBSA 3NW4A 4FFFA 4GWJA 3ILFA 3AC0A 1AR81 1BQPA 1VJ2A 2DURA 3N7JA 4LKEA 5F3GA 1OXCA 2BGCA 1YHFA 4GWNA 5FV3A 1JUHA 4XVHA 4W50A 2XJVA 4BCUA 2AEZA 3MUZ1 1DGRN 3VHRA 2GNDA 3J7MA 3BIEA 3A0NA 4XFHA 2JKXA 5F37A 3VKMA 4N43B 2JXAA 1H2LA 1O8SA 3WNPA 1OKOA 1PIV2 1QH7A 5A70A 4OVEA 1FYUA 1MVQA 2C26A 2HBTA 2XLAA 3UGGA 1DLCA 4PLOA 1EAH3 4D94A 5CBLA 3E6DA 5LA9A 2Z69A 1LGCA 3VBSA 3NWKA 4ATEA 1Q8VA 3PL0A 1FV3A 5DDJ2 2Z79A 5F7UA 1BBT3 1VBC3 3RZLA 5EIYB 1GP6A 2ORZA 2F4LA 2EAAA 2OIIA 2QKDA 5CNAA 4FPCA 3BU7A 2W95A 2AUYA 2WQ8A 2ZHLA 3FX3A 3H3LA 3JU9A 1K12A 5JOYA 5FLIA 4NN0A 2QJVA 5J48A 4Q1PA 5HCBA 2ERFA 3AMHA 4MGZE 1SBEA 3GHMA 3MEPA 3SCGA 4AFAA 5BY5A 2YC2A 1OQ1A 3C7HA 4K9SA 3WP3A 2E32A 3H50A 4LT5A 3GZAA 5A3TA 1W2OA 4AVTA 5F5AA 2BU9A 2W9XA 4A6SA 4HK8A 3O1RA 2A6WA 2YY1A 1CJPA 2RM22 4QPWA 1HJGA 3K48A 3DXUA 4A3ZA 4Q0QA 4LKDA 2RS31 5C71A 3D82A 3K46A 4LHSA 5L19A 2JDYA 2VC9A 4Z92B 2X8KA 1MS9A 4DRRA 2A71A 1GZTA 3AP7A 5FRAA 2PELA 2PQSA 2PYTA 2QDRA 4UYBA 1Z7S2 1CESA 1BEV1 3RMYA 2VE1A 3ELNA 4BQ3A 3BVCA 3D6EA 3NKGA 3VBSB 1E5RA 1VB4A 4MYEA 1R081 4OHVA 1DGRA 4I2OA 3HAGA 3OSDA 3WLUA 2E6VA 3WQ7A 4PCRA 1LU1A 2WNOA 5FMBA 2C0ZA 1N47A 2IZWA 3B93A 2DFCA 4X8PA 2WNVA 5JCTA 4GWIA 1VB2A 2GMMA 4LBQA 4ISQA 1I1EA 3MPBA 1Y9GA 4BB3A 2XLGA 5C8CC 3PNAA 4N53A 2WZR2 3OOXA 3MGUA 2D40A 4EWDA 2PAKA 2ZGMA 4CU8A 1UOBA 2VQAA 4AFMA 2W2IA 3HT2A 1SG3A 2GC2A 2ZX4A 5FO7B 4QXCA 4AFBA 2QQWA 4QQLA 4XF9A 4NPLA 5C3QA 3C3VA 3CLPA 4Q4X3 1JOPA 5FY8A 2XKOA 1FPN3 3J7HA 1JUIA 4CU9A 1GP4A 5BUVA 5FPLA 4RR3C 4BK4A 2OUJA 4R9BA 3T08A 3K75B 1UOGA 2YFUA 5C3OA 2CDPA 5FPVA 1RUC1 3KVAA 3MI8A 1OOPC 4RFRB 4WZCA 5T5JA 1SQ4A 2VVEA 3D4KA 1XNTA 1OFNA 2QFEA 5IVCA 1NX9A 3M8LA 1PIV1 2ZHKA 4JRLA 4R9CA 2OPKA 5A3PA 1R093 5FO8B 3LOBA 1FV2A 1QDOA 2KA3A 3OGGA 1XSQA 1OHFA 2CY6A 1HV0A 1NAEA 1VRH2 3TN93 3ZOIA 1UMIA 1MZFA 2VZ3A 1YIFA 5DDJ1 5A7PA 2A75A 4M3CE 4NROA 1FMD2 2VNOA 2WNVB 1D0GA 1F4HA 1KQRA 1PMIA 2JECA 4WZFA 5FZLA 4DUVA 1PX3A 5EQUA 2VUJA 4LBQB 4R9AA 3DUIA 1ULGA 4KGGA 3AMQA 3JD72 3MFCA 2IXCA 2ZGKA 4Y5Z0 2BYVE 3AZVA 2VXRA 1RUD1 2YDEA 4N53B 4PHZA 3S7EA 2JB8A 5FJKA 5FK8A 4XZPA 1ZRIA 2XUMA 5FP8A 2JDUA 1N1TA 3Q8EA 5K8SA 2FCUA 4JHZA 4CTEA 1AUYA 1SEFA 3CBNA 3WUCA 1LEDA 2XUEA 3TB0A 1EUTA 3C7OA 3WF2A 1YJLA 4AG4A 5HCAA 1QJZA 1O4TA 3NO8A 2RM21 4NJ4A 4P9GA 4PDWC 4QU1A 5L36A 4AI3A 2GMEA 3GBGA 1QQP3 2VMDA 2VOTA 3RI9A 5JI7A 3MLJA 2RJKA 5CEHA 5IUQA 3WNNA 3RFRA 1RUOA 4CZSA 5GKAC 1XRUA 4IEZA 1CJDA 2V4VA 4NIHA 4BJ0A 4TN7A 3V65A 4CUAA 4LE4A 4E8CA 5AFEA 1AXZA 2R063 3HQRA 2Q8EA 1ACCA 1NQJA 1QU0A 2WZEA 4L9BA 2ET7A 3RWNA 3HNYM 1OLME 5IT6A 2VMEA 5LA0A 4IEUA 5DZFA 2J42A 4DEVA 3CU7A 2QQPA 3B3QE 2VOKA 3WDVA 1GR3A 3ZXEA 4LNVA 4NUBA 3WF3A 1FXZA 1I9RA 1JYCA 5EJZB 5IW0A 4X6RB 5DG1A 4H2AA 3LDRA 2AEYA 3J26N 4BQWA 2HWD2 1DGWX 2SLIA 2D44A 1W3VA 2ZGRA 3B7MA 2ZGSA 4XF4A 3NJXA 4JKKA 5AVPA 3RI8A 2WAAA 2WRAA 2B8MA 4IV3C 4DUWA 2PAMA 2WZR1 3LAGA 5DUUA 1OPOA 4E2QA 4MGKE 4YZ1A 1W6OA 4K1YA 2ZGLA 1KDMA 3CO2A 1HRV2 3ZYRA 1ZZCA 1RUE3 1G9FA 1H2NA 5A7NA 1VIWB 2O14A 3CDZB 4JX0A 4XF0A 3AB0A 3ZXLA 4AHYA 4RL7A 1IHMA 1TNFA 1JHJA 4FAGA 5LWBA 4FQ4A 3TAYA 1IKQA 1GMMA 2GC3A 4UW4A 5FKCA 5GLZA 1GICA 1NE6A 4Q0PA 3VKNA 2EIDA 1GZCA 4UI9L 2RDSA 3ZLIA 4NRQA 3T0DA 5L7OB 4B1MA 2PHTA 3DF0A 4S2HA 5FP3A 1C8M2 1Q5OA 1W8WA 4HKLA 4KBBA 2D6PA 3NKTA 3WF4A 1LOBA 1GKBA 2JWPA 1PGW2 1R1A3 2VZPA 4DXZA 1I5ZA 2VCBA 2WKKA 2ZGQA 4ZU4A 1VRH1 4XFBA 2W92A 4K8FA 1HB1A 1UIJA 1UZ0A 1YRZA 1EAH2 2Z2SB 2JDPA 1DBNA 1LGNA 1FMD1 1HDKA 1ZNPA 4M0NA 3CMGA 4PI0A 4PBOA 3T30A 4GAZA 4LO5B 5FZ3A 4YG3A 5J1XA 5FZFA 3AXEA 1BBT2 3JD71 4ES9A 1DHKB 4XCAA 3PJYA 3GBWA 5C6CA 2EALA 1S0JA 3S30A 2XLFA 4CUCA 1W6OB 4COYA 4DIQA 3SKJE 2P3YA 3HWJA 1MEC3 4OHWA 1QJU1 1OA3A 3E5XA 2BNNA 1WCUA 1AVBA 1MR5A 1NYWA 2LS6A 3H1MA 4FPKA 1DQ1A 4CCEA 3GZTB 1YQ6A 4RGGA 1IPSA 5F5IA 4LPLA 3T4HB 3VDDA 1LB2A 1NCRA 5A1FA 5IVEA 1HQWA 1PMJX 3VZNA 4K7JA 2XVLA 3D5OA 1PM7A 4Q4V3 4UFJA 1SCSA 4XQ4A 4ZONA 3WDYA 4F7ZA 1WCQA 3K3OA 2TEPA 4XJAA 1EYBA 4BWOA 4RHV3 1DP0A 2XOMA 3OUHA 1CZVA 4XEZA 1S0GA 1WMFA 4IEPA 1DDLA 4A7YA 3AYAA 2VOVA 3ME2A 4ZY9A 1EUUA 4ES8A 4FFIA 3M3OA 1VBE1 1PZ7A 2YXSA 1NLSA 3WF1A 4G9SB 4H3WA 4HVOA 1UU5A 5JIUA 4NIGA 2OZ6A 1VAVA 3ORJA 4P02B 1S55A 1LOAA 3A23A 4IUGA 3PTYA 2HWD1 2EXKA 2KR2A 2W68A 5FZGA 5LBFA 5I8TA 3RZZA 1WLWA 5B2GB 4UOJA 3ZN5A 5KHHA 3UL2A 4BA6A 3LB9A 3AFKA 3WINE 1OA2A 2ZTNA 5J37A 3VBHC 1KFXL 1K5MC 1HRV1 2VPVA 3VKFC 1O3SA 5DAWA 1PHMA 4YFWA 3WSOA 5E8AA 5LB6A 3VBFA 3FLPA 3AYDA 3WT3A 2XBO1 3VDDB 3VBRA 1NCRB 3POBA 3IT8A 3MO4A 4LOSA 1IS3A 5FPZA 1KXGA 1BVP1 2HBUA 2RJLA 3G7DA 4QX8A 4OFGA 2D5FA 4Q4X2 1FPN2 1V6MA 2P3IA 2B9VA 1NE4A 4XIOA 5FREA 5CKMA 2VZ1A 1DQ4A 3WG1A 3B94A 5I0TA 4IV1A 2VUCA 1H0BA 4LK7A 4YW7A 4P9WA 5IFTA 4QX5A 2P17A 5I0RA 2C5DA 4FOYA 1PGW1 4AF9A 1LCLA 4HSJA 4LE3A 2AACA 3LZZA 3N7LA 3S6PA 4H55A 3OPWA 3R4SA 1R092 1EAH1 1LHNA 1PGL2 1T2XA 2DVFA 4MGTA 1DG6A 1YWKA 3OBRA 5FXWA 2FDIA 5AFBA 2WT0A 2RR11 1BBT1 1VBC1 2WO2A 1DGWA 4QWNA 2WL1A 2MHFA 3AL6A 3FE5A 2QQJA 1RTVA 2ILMA 1J58A 1F9KA 3ATGA 3RSJA 5M0TA 1U5XA 1AYN1 2AREA 2CSGA 2XWBB 4B4RA 3C8XA 1UY1A 3N9OA 3VBFB 3WDUA 2CL2A 3IMMA 3M3CA 3VBRB 4XFIA 1TG7A 2X53S 4XJWA 1EPZA 2DCTA 4FTEA 4DQAA 2QUOA 2W1QA 2Q1ZB 1VBA3 2JDAA 1HW5A 3I4IA 3THDA 2ZMLA 2DU0A 4FP3A 4Q29A 5F3IA 4XAEA 3URFA 3ZFGC 4AQ2A 4Y1ZA 5IWFA 1YNAA 4YZ4A 2P37A 3O0WA 1QQP2 1PO23 1NXMA 2RS12 2VQUA 3DPRA 4LK6A 3POGA 2HWE3 4IV1B 1G9CA 3NAPC 1W8OA 1ZZ9A 1HB2A 1AX0A 2PHRA 3BU0A 1NCQC 1UY2A 1LECA 2VCAA 2X5IA 2R062 1UMHA 3Q8BA 3SLIA 3O1TA 3RZKA 3WNMA 5DQ0A 4LO4B 2IXKA 1V6NA 2JDHA 3VBUC 4HBNA 2XMLA 3W20A 1UMZA 3DYOA 3A4UA 5FO9B 4JZRA 1LEMA 2NM1A 4D7TA 3KM5A 2X29A 2XJRA 4YZ2A 1UOJA 4BQ2A 3N7KA 5IAXA 4QGLA 4YM3A 5ABJA 1MQTC 3HNBM 2MPFA 5CFCA 5FZBA 5LBEA 4BZ4A 2WFPA 2D6NA 1IZ3A 2PHUA 3Q8AA 4M4RA 4F83A 1OH3A 1W28A 3LKJA 4CP2A 4V1PA 5IAVA 3OYWA 4PBPA 4Y20A 2FDGA 1RUE2 5EV7A 4K20A 4QXKA 4Q4X1 3NNFA 5EHDA 4B3NA 1FPN1 4PIYA 1NXD1 1O4ZA 2BV4A 4EV0A 1XNAA 4QX3A 4XW3A 3DPRB 1C5IA 1QEXA 1LU2A 1OSGA 2E51A 1OC1A 2J1VA 2E63A 3GBFA 3I2DA 5A7WA 4AI9A 3UETA 4AQTA 3EO6A 3RZJA 1YI7A 1CIWA 1R1ZA 2Y0OA 3RS6A 3PLQA 2HLEA 4YGBA 1WW4A 2H0VA 2X5IB 4CCLA 4ZZ5A 4NR1A 1R091 3CJIA 4IERA 4IL7A 5BNQA 1PGL1 1RIRA 2XJPA 4KI5M 5GZDA 4URAA 3TN91 5KXDA 4LBLA 5GJ6A 2D6OX 3LA3A 2LROA 2WN3A 1VLNA 2HEYF 2NPIA 1W8ZA 1KGYA 2DVAA 1ENXA 5BPXA 1V9U3 5B4NA 3IBMA 4OI2A 3LIHA 4PLMA 3B02A 4S2FA 3PUIA 4AEDA 1V6JA 5FZ8A 1B35C 5FIXA 4P9JA 2IVIB 5ABJB 2ARBA 2BP6A 4FPYA 4JGZA 3HVDA 5CFCB 2CAUA 3WVJA 2VBPA 3DKQA 1F15A 1S2KA 3OGJA 3EXUA 1MEC2 3OYWB 3ACFA 4Y20B 2QCSB 3B9IA 2HWC3 1POQA 1XE0A 2CGOA 2FCVA 2ZKLA 2WZPP 3L2YA 3PMSA 3WXPA 5JR7B 4UBGA 5JR2A 1QJX3 1QQP1 5A7WB 1C3HA 1RHI3 2RMU3 5EPAA 5GZEA 3U11A 4BLJA 3DYPA 1COV2 2JG8C 1GNZA 4Q4V2 4YVWC 3AYCA 5FUNA 3PTRB 5LCWL 1L7LA 5C3SA 1N1YA 3LGRA 4OHYA 1J59A 2R061 4Z8BA 1WLTA 3SH4A 3UV9A 1VMFA 4QDSA 3WX5A 3CJIB 3MIFA 1HQNA 1GANA 4NE9A 1AX1A 5CVRA 4FFGA 4GKXA 1JOBA 2ZX3A 2D97A 4GALA 5LASA 1BKZA 1F4AA 4D7SA 2J1EA 1LESA 3LA7A 2Y64A 4DY3A 3KGLA 3EJKA 4KMQA 5ANQA 4WM8C 2QZ3A 2WQZC 3PVEA 2OYZA 4GB33 4AEDB 1O59A 2W1UA 4QXBA 3R4DB 5DAQA 1BK1A 5FTTC 4BQYA 4GMP3 4JGZB 4DXTA 4Q4Y3 4Z2WA 4Y1UA 2UWCA 1J84A 1H8TC 3IWZA 1ULDA 5CKQA 3ZSJA 4UFMA 2XDVA 3WW4A 3A21A 1UOFA 5FY0A 1UZZA 5FBJA 3EMRA 1Y9QA 1RUE1 3KF3A 3LEMA 1J1LA 3M3EA 2JX9A 4M3CA 1Y4WA 2VAUA 5JOWA 5I8SA 1YQ2A 2BBVA 3GCWA 2WIIB 2ZEZA 5HPOA 4EE2A 3ZVXA 1WD4A 5C4WA 2UY9A 1IS5A 1JTZX 5FY5A 1OH4A 4AVSA 2FMYA 2VCCA 4YGDA 4XOGA 4DOUA 1WMEA 3KHBA 4AOCA 2IUWA 3KWVA 3MIBA 3OG2A 1N3OA 5DUWA 3KD4A 1PK6A 1HRI3 4IEYA 1R1A1 3DV8A 1IPJA 3BCWA 4M00A 5IK7A 3U0ZA 1ND3A 4RGAA 2YBKA 4YLZA 1DQ2A 5CU1A 5A7SA 2W87A 4KQ7A 5DABA 2BOIA 2ZEXA 5FYZA 5FZAA 4QPIC 4Q8KA 5EFUA 5FWJA 1NUKA 4L8QA 1QDCA 4B4QA 4QPGC 1AXYA 1QH6A 5HCFA 3ZIWA 1JOJA 1OBNA 2D5HA 4NRMA 3J9SA 3J8F3 1WBLA 1JZ3A 1XSRA 4XACA 1OLQA 1OLMA 4BOWA 2Q1MA 3O0XA 5CIRA 2C6SA 5A3LA 5KR7A 4KH9A 4UF0A 3VZJA 3KCYA 2E7TA 1A78A 4HOOA 3WF0A 2GAUA 3KCCA 3LDKA 3PVBB 4M3CB 5D8AA 3DGTA 1UXXX 4N7UA 1CAXA 1W8NA 3I3MA 4L2NA 3PVOA 1MS0A 4KWJA 1FATA 1QGLA 5DG2A 1OA4A 5EJ3A 3AKTA 1AJKA 4WM7A 5C4WB 2PMWB 1NZIA 1OUXA 3IKWA 4IESA 3U75A 2VZUA 1VBA2 3C7GA 4Q4V1 2G4IA 2BBAA 5FMDA 1CPMA 1SBDA 5ANNA 3V0BB 4BMBA 3HJRA 4RHV1 3I59A 2O0OA 1PO22 2Q4SA 2HWE2 1JU3A 4FPOB 2B45X 1X9TA 1HLCA 4BU2A 5T5PA 3IAPA 1ND3B 4PT6A 5A6QA 4NMIA 1US3A 2J1TA 1QNYA 3PIGA 5FZ0A 3NNJA 3U10A 5LW9A 1CN1A 1STMA 1UCXA 4YW6A 3ZXJA 1YLLA 1AR91 3ACIA 1VBE3 4GJZA 4LO7A 2VTXJ 2ZXQA 2BVBA 2NMOA 2R043 2ZX2A 1V6OA 3EBRA 4PF1A 4BMEA 4I02A 4K40A 3GCXA 4TZDA 1WWYA 3GNEA 3OEAA 4UF0B 4N43C 5GZCA 1XBFA 2ZJCA 3D0JA 1AYM3 4FPJA 4DZGA 4QX2A 4J1XA 5BXXA 4CCDA 2OT7A 5JLVA 4UWDA 5D8AB 2XG3A 1RB8G 2Q8CA 3ZO0B 3LE0A 1CAXB 4V2VA 4IEVA 2YUEA 5SV5A 2JG9C 3UGFA 2B42B 3I7DA 4WM7B 1O3RA 2D3PA 1IKPA 3WW1A 1W39A 1XYOA 2WLQA 2WN2A 2XBO3 3P1IA 2W1WA 1LENA 2W39A 5F2WA 3IM0A 3Q8FA 5FZ7A 4CDXA 5IFPA 2HWF1 4QDRA 3I59B 4A45A 3P5BA 4MGQA 4P5YA 5F3EA 4NIDA 5IATA 2A3YA 4EROA 1Z78A 3HPNA 1ND2C 1AL0G 1AXKA 2CHHA 3OY8A 3O7OA 4MHUA 3ROUA 1HJFA 1CWPA 1RUC2 3SCHA 5FY4A 2YU1A 2BVVA 2RHPA 5KWRA 3U37A 2BNOA 3WNLA 4CEWA 1REDA 1CZTA 1GOFA 3KV6A 4D0QA 1VE0A 2VTXA 3B00A 4W4ZA 5T54A 1GQHA 3IPVA 4CCJA 4CPBA 3GM8A 1X36A 4XXPA 4XMIA 4Q0UA 4CP1A 5D1IA 1PM4A 2TUNA 2VW1A 5GLTA 3U4XA 3IMNA 1JH5A 1V9U2 1IS6A 2F4PA 2W5FA 4JQRA 5TSWA 4AI1A 4O9GA 2WUHA 2RR13 2A7AA 4M0HA 3VZMA 1RJ8A 1HB4A 1S0BA 3SQOA 5CA6A 3WNKA 3ZKYA 5F5QA 1AJOA 2QDNA 4W8JA 3MW3A 2VCMA 1LOEA 5K7PA 1AYN3 3O1VA 3HD8B 3QOPA 1RUD2 1CAVA 2EIBA 2FZ1A 4R9DA 2HWC2 3TEXA 3WR0A 3AVSA 1VBA1 3KS7A 4CDXB 5KC6A 3JZVA 3OD0A 3POJA 3A0KA 3NV1A 1NA1A 4QPYA 1QJX2 1PO21 1GUIA 1UU6A 1F8VA 2RMU2 2HWE1 3JB4C 4L97A 3T2TA 1JYXA 4LXLA 2WLPA 1LAJA 4M4PA 4YNIA 1S0EA 3S7IA 4LBMA 2OVUA 1DIWA 4OMDA 1GNHA 2R49A 3VBOC 1BVVA 2LTNA 3POYA 4XFAA 3U07A 3WQ0A 4CEWB 5KBFA 4CP9A 1G9DA 4RA0A 4YYOA 1MS8A 4JV4A 3KCXA 3RVHA 3IPVB 2NZ9A 3J7NA 5C3RA 5FYIA 1PNGA 3V56A 4BH9A 5FYVA 2V5DA 2WR9A 4MZUA 4DY5A 1JXNA 5FY7A 1GYKA 3ZYFA 3BI3A 5GLWA 2UURA 5GLVA 3ZYGA 2BUKA 4JGYA 5GM0A 2AENA 4XJ8A 4DFSA 4XFFA 4GB32 1URXA 4D3WA 1VRBA 1GOHA 4NAOA 4Q4Y2 3RZGA 2J22A 1S2EA 1O5UA 1QWRA 4WBBA 5A7QA 1S4CA 1WCKA 1WKYA 4FOQA 1LHVA 1CAVB 4ZKTB 1OQEA 1YJKA 4Z1VA 1C5HA 1UN1A 2V73A 4XHBA 1W9YA 4C8DA 1BMV1 1JZ2A 3LA2A 4Y1XA 2C24A 3I2FA 4EWEA 4UBHA 5JMCA 2WWUA 3POEA 4GD4A 2WNVC 4GJYA 1NA1B 1UU4A 3FLTA 4KBZA 4LA2A 1IS4A 5ISLA 1U5YA 1AHSA 3RMXA 4QKNA 3ILRA 2WYSA 4DXSA 2XVKA 4AWDA 4L92A 1DYKA 3R4UA 4N53C 2VQTA 4QQPA 4AAPA 2JB4A 4F3JA 3OPTA 2YPDA 2DCYA 2I2SA 3OBTA 3RJRA 3VZKA 4CU6A 3AP9A 1MS4A 4Q4W3 4A6OA 2GNTA 1A34A 2WQ4A 4CP9B 5F3CA 4DRVA 2J1RA 1BYHA 1SMVA 4XDPA 1X82A 4AQSA 1RJ7A 4Y5TA 1U0AA 2KD7A 4LMFA 4OI0A 1YEWA 1G6NA 1TE1B 2P6HA 4XYXA 1OOPA 4GH4A 4YM0A 1DYOA 2E26A 4FBFA 4N90A 1UY0A 1WGPA 4ONUA 5I93A 1V9U1 3CNAA 4JGYB 5FXXA 5LK5A 3UKNA 3UGHA 3VD7A 2A6ZA 4COZA 3MZHA 3R6SA 4AYUA 5JPNB 2XJUA 3J8F2 2JDNA 5FZIA 4B7KA 3OGSA 1H8VA 2CAVA 2GN3A 1J3PA 1VAKA 3S57A 3K77A 1O8PA 4KNCA 1VMJA 3T3YA 1TZOA 3NNLA 4H7LA 4Q26A 2HWC1 2JDKA 3QH6A 5JUVA 1V00A 1XNKA 1JI6A 1W2NA 3AX4A 3KV5A 5FWEA 2RDQA 5JWPA 5F2SA 2CV6A 1QJU2 2IVJA 1AR73 2QQMA 4AEMA 4YW3A 3POFA 2E53A 1QJX1 4LITA 1RHI1 2RMU1 5HV4A 4CUBA 3ACLA 5A6YA 2B39A 4M01A 5AC93 1K45A 2QQLA 1QJY3 4CE8A 2G19A 2JDMA 1WW5A 1FNZA 4IEQA 4DPNA 4PDWA 1T6GC 3E6CC 2XHNA 4XBNA 5FXZA 5BNOA 3JQWA 2J7MA 3KB5A 1ZYBA 2C4XA 1OOPB 1KJLA 4GH4B 3VL9A 3BOPA 4X6QB 5FZMA 4ZPIA 2AZ5A 1DQ5A 1O91A 1UF2C 1VBE2 1WA6X 3ZX7A 4YFZA 4GB31 5JXJA 5IYYA 1L7QA 2R042 3WHUA 5L7OC 3KQ4B 4GMP1 3MIDA 2W3JA 4Q4Y1 3LEIA 5DUXA 4W6WA 1ST8A 4EN8B 1XU2A 1SPPA 3P6BA 1AYM2 2VZVA 4FPHA 1C57A 3WEZA 5LA1A 2FDJA 2JEMA 2GSYA 1XE8A 4LBKA 3GJBA 4GKYA 4MGYE 2DDUA 4PI2A 1JS9A 3WCSA 4BM8A 4QDQA 1XE7A 3J7LA 3WNXA 4EQVA 3SKVA 3ES4A 5J96B 3THPA 4BHPA 1WD3A 2XBO2 3OBZA 1UYYA 2YV8A 1JZ6A 4N7IA 4GWMA 3PU8A 2O8QA 1SFPA 4CDUA 2EAKA 3AM2A 2IXHA 2D43A 3BGAA 3W9AA 2J1UA 5I0SA 3NNMA 4CPBD 1LR5A 1HRI1 2ZGPA 3BTYA 3FBMA 2OX0A 2ZEWA 5BNOB 5IHRA 5DZGA 2C9KA 3LWCA 4ORFA 1W0NA 2OS2A 3MF9A 1VR3A 4X8NA 5L73A 3FHAA 2KM2A 4J1WA 5LBCA 3RJ2X 2QQVA 1ZZ8A 2WO3A 4AZZA 5FPXA 3NQHA 3BTXA 1Y7BA 3ZN6A 1GWKA 3J8F1 3VHPA 1GLHA 1H2KA 2A3WA 4QQ2A 2BQPA 2PTMA 3RYRA 4FPLA 4I3PA 5E6HA 4MH0E 1ZVFA 1VBC2 1SPPB 2RR12 4XJZA 4CSWA 1X8MA 4EN0A 5KHKA 3K4AA 5JOXA 4BQ4A 2JE9A 3VDBA 2DVBA 3MV01 1CAUA 1NLQA 1S0DA 2QBXA 4RS5A 4KG0A 3JB8A 5H9PA 3W5NA 1AYN2 3MF6A 3S5QA 1AR61 3H7YA 5E16A 5BNPA 1F5FA 3I2JA 5HXVA 5FYBA 2RS53 2X05A 4GZ9A 1B09A 4ZXKA 4CDUB 1G86A 1H4GA 3ZKUA 5FZDA 2WYFA 2VXJA 5JZGA 4BPZA 2Y6LA 3E6BA 1OUSA 2UY8A 1J3RA 3O12A 2NLRA 2VVFA 5DAVA 3ZDVA 1KITA 5G05L 4IW3A 1NCRC 5FZ6A 4BK5A 1DGLA 3ILNA 4DNYA 2WZ8A 5DZEA 3GXUA 4E4DX 1S1AA 1SBFA 2DUPA 3ON7A 3PHMA 1VBD3 3ZN6B 5BYNA 2FHRA 2NYYA 1RMU3 3AMNA 5EJ1B 2R041 1AR93 4JDOA 4OQ9A 4LBQD 3ZFFA 5JSRA 4BQXA 3O1SA 1C28A 3X29B 1Q8SA 3LOIA 1SLLA 1OF3A 2MNGA 1AYM1 1S0IA 4R52A 3ZFEA 2VGDA 3ZN4A 4DUXA 2AGSA 4P14A 1F5JA 3MPPG 4FOVA 4XUQA 1LOFA 2HEWF 4EWAA 1DQ0A 1CAUB 4CDQA 4RQPC 4RS5B 4FP2A 3HQUA 3AJZA 2XWJB 4YGCA 4MLOA 4GXLA 4I0AA 2E7AA 4KU7A 5BNPB 4ZS2A 3N9MA 2A73B 3MIEA 2WJSA 4K6BA 4XILA 3VBHA 4GULA 1JYVA 5C9AA 1K5MA 2XJQA 1EPWA 2OA2A 4AI0A 2Y6FA 3AKSA 1FI2A 4XFGA 1YIPA 1C1FA 2HWF3 2DV9A 4UFKA 5JZGB 2VBDA 4LJHA 4P5HA 2YB7A 4IEOA 1UXZA 2VMGA 4HKOA 5JDBA 1JYTA 4Q5OA 2OQ6A 4Y3OA 3VBRC 3SH3A 5EXOA 4CDWC 1W90A 1GNYA 3PMEA 4Q4W2 1SLIA 5JXIA 2JJ6A 2HJIA 1BLZA 3MHZA 5HBAA 4ZZ8A 4XTMA 2LRPA 1JZ5A 3AP6A 5DUVA 5EYXA 1QMJA 3RYKA 3ZFFB 1ZBA3 3OF1A 5FYHA 2DVGA 4P9YA 3TN92 4IV1C 5H9RA 3POIA 1KS5A 2ZHNA 4FT8A 3RNSA 3VKOA 3ZFEB 2WDBA 3ZMOA 1GU3A 1RVF3 3AP4A 4KWUA 1FX5A 5HXMA 4CDQB 3LD8A 3WDXA 2R30A 3GYDA 5LEJA 4DB5A 3HQXA 3OUIA 1X33A 1H2MA 1ZZ7A 2YGMA 4ASKA 5IVVA 2YROA 3IDBB 5GALA 5A1AA 1YQ8A 5I8YA 3VBHB 2Y6GA 3VDCA 5C9AB 1AR72 1XXNA 1YXWA 5CKNA 4RFT0 3ACGA 4W65A 3VN4A 2VTFA 3BIWE 4D6QA 1LTEA 1RUF3 2BWCA 2YZ4A 5AC92 3ZXAC 3DXTA 4N9HA 1W8UA 1EY2A 1QJY2 3DEMA 4CRQA 2VL4A 4UFIA 1QJEA 4NVPA 4EN9B 2GU9A 2VY0A 2ETEA 2W08A 1PO13 2P3KA 3KQRA 3OCPA 4N9IA 5D21A 1ULPA 1PVXA 2ZEYA 3SH5A 1UPSA 3HBZA 1O6UA 4NHKA 3MFAA 3JXSA 5A3NA 4JKMA 3BPZA 2XHKA 3DPRC 2ZMKA 4YSFA 3TNPB 5A80A 1MS1A 1DZTA 1VMHA 2VOXA 5JVVA 4XIKA 3OGVA 3N4MA 4MOAA 1O4YA 2VR4A 1CGPA 1QXJA 2Y38A 4META 4MUVA 3W58A 4O65A 2X5IC 1U12A 3AJYA 3VZOA 4AHXA 1QXPA 2DWRA 5CFDA 1WCSA 2VUAA 4QQOA 3WW3A 1WCDJ 2P2KA 5FY1A 3OB8A 4XTPA 4C0HA 1W8FA 1OD5A 1DYPA 2I07B 1CZSA 2QZ2A 4LO6B 4XF3A 3I3DA 4IE5A 5EZWA 1WBFA 5J3UA 3KHCA 2N7GA 5JXGA 3FFQA 3LFIA 4HFSA 5L9RA 2PHLA 3ZM8A 3QLQA 4CEYA 2VZOA 3GF6A 4E4SA 5FUIA 5CFCC 1UX7A 5LY1A 5FAXA 2DTYA 4YPJA 3MIHA 3GGLA 4NPMA 3T0AA 4Y24A 1TMF3 3ZSLA 1VPHA 2WC2A 4Q4W1 3ZSKA 4QB6A 2WO1A 3ZR5A 5T3NA 2ENRA 2VULA 3Q8CA 1V70A 4ASMB 1ZA4A 2VOWA 4OZXA 5FMOS 2V5YA 3PDQA 2B9UA 1VBB3 3ZYBA 1R1A2 3HR9A 2YG0A 1PX4A 5FBZA 1ZBE3 3VD3A 4CVUA 3ZSEA 4IE7A 2NP0A 1K5JA 3PIJA 3KV4A 4BXSV 4COWA 5LZ6A 1D2SA 3DN7A 4A41A 3O5SA 4A7ZA 4AK3A 1RUNA 1T6BX 4UAPA 3E1F1 2H0BA 3RG0A 3W59A 2EVXA 3VB9A 1H1IA 3NMBA 5CFDB 1UYZA 4XDOA 2I74A 1UKRA 5FYSA 2IWGB 2EXIA 3UK9A 4XQDA 4NOTA 4IE6A 2DBNA 1RUI1 3H9AA 4PQ9A 1AR71 1OVSA 1UZWA 2E33A 1W2UA 3MW2A 2XQXA 2F17A 2BWAA 2RS52 3T1MA 4CUGA 4CEYB 4EN6B 4YRDA 4JGZC 5AC91 5EYYA 3D0SA 1QJY1 4QQHA 1IPKA 2EICA 2IFWA 2XGXA 4IEXA 5FQ0A 1LOGA 5JSPA 2I45A 4P9LA 2ZMNA 2RE9A 1UY4A 4RHV2 5FYTA 4CYDA 2NMNA 4IGOA 4D8MA 5IVJA 3C2UA 1JYNA 5FZCA 1R64A 3MICA 2ORXA 1ULOA 4OI4A 2UWBA 1GOGA 2BFUS 2A70A 1GQGA 3CHXA 4TLGA 4HVQA 3ABZA 2EXJA 2QNKA 3FUQA 4XURA 3P3NA 4K1ZA 4JQTA 3LIGA 1RMU2 2KXLA 4I3GA 1AR92 5HI0A 3B9CA 1DZRA 5C8WA 1WLDA 1QJFA 3H8OA 2CWSA 4XUNA 4LHKA 4TSVA 3ETPA 1HXS3 1VALA 1SFYA 1W9FA 3FLRA 4FFHA 2J1SA 5CAZA 1ZRDA 3K2OA 3LF7A 5C5UA 3PJQA 4DEQA 1IGOA 2YFZA 1AX2A 1BZWA 4LHLA 1Z7S3 4OULA 5F6LB 3M70A 2DVDA 2GDFA 3BALA 1LULA 4OMCA 1WLCA 1UL9A 2QQIA 3OD4A 1N1SA 3DECA 4UFLA 3RYPA 4F8AA 4L99A 4R4XA 2K0GA 5LATA 5FQ0B 4B7EA 4E27A 4ET7A 4MG2A 2LM3A 2HWF2 4LIUA 2ES3A 2QE3A 1RUH3 2VVDA 4OUEA 2BGOA 2Y6KA 3I54A 4PLNA 2CYFA 1ENQA 4YVSA 1S2BA 4XCBA 3T0BA 2PHWA 5FFOC 4EZ4A 5KHJA 1G9AA 3VDAA 2OQ7A 2D98A 5EP9A 1BK0A 2W0XA 5IK8A 3RQ0A 2VUDA 3H8XA 4LTAA 1YUDA 5IVBA 1M4WA 4SLIA 4AW7A 1W6MA 4CXYA 4NHYA 1LHWA 2XKPA 4UW3A 3FMGA 2XB6C 1YQ5A 3K4DA 1ND3C 1RVF2 2Y8KA 3H42B 4QXHA 4COUA 3H1YA 1K42A 1YFXA 3HN3A 1YQCA 4LUKA 1HV1A 3ZYPA 4D6SA 3B01A 1H4HA 3MV11 3WCRA 2WT2A 4BLIA 3I49A 2OXBA 1MS5A 3H3ZA 4AGRA 2CGNA 4LKSA 1ZRFA 3N9QA 2RS51 2FMDA 4LBOA 1ONAA 4MX3A 3MUY1 1AR63 5DPNA 4GA9A 4JDMA 4HZFA 2ZABA 5KXEA 4Z82A 3RDIA 3ZDSA 4Z2AA 5T5OA 1UO9A 3WZ1A 3NV2A 4E4ZA 5FMOL 3SHRA 3KSCA 1RUF2 5A33A 2Y6JA 3AMMA 3QCWA 4YG6A 5D8AC 3THCA 4C1WA 2ZX0A 4NAMA 2GC0A 3U78A 4ISRA 2WWSA 2ZAAA 5H9QA 3WV6A 4BYYA 1W03A 3ASIA 1JBCA 4Z07A 4A7KA 4CU7A 1PK6B 4YVSB 2VZQA 4WM7C 5IK5A 1CX4A 5C33A 1PO12 2PN5A 5LA2A 1L3JA 4XBLA 4I01A 4XE9A 1F2NA 4NWWA 1VBD1 1W9WA 2VZSA 4C0BA 2LW8A 1DF0A 1CONA 1RMU1 3A7QA 3FWEA 3AP5A 2RDRA 3PUSA 4P9XA 2DCJA 1W6MB 3A22A 4WV8A 1H9WA 2E31A 1F31A 1PVC3 1UZYA 3GDBA 1MS3A 2MEV3 3IDEA 1OD3A 2A5ZA 4FOWA 4NHMA 5K0UA 3R0RA 3ZPYA 2R7EB 1LHOA 3KLSA 4QMAA 3TWIA 4OHZA 3UT0A 1SLCA 2A1XA 3KV9A 2BRTA 5BNNA 3AMPA 4LIVA 4IE0A 2G9GA 1APNA 1QOTA 1TQ5A 1W99A 2VBBA 1W2AX 1ZZ6A 2DUOA 4YW5A 4MXVA 1VP6A 2WNUA 3OEBA 4FQZA 4RSUA 1W6QA 3I2OA 4I09A 1JODA 1BMV2 3USUA 5L9VA 1WW6A 5I0DA 2JE7A 2XL7A 1A8DA 1JU4A 1DZQA 1H1AA 1NT0A 1IOAA 2BFUL 3EB7A 2JG9A 4I0BA 4BE3A 2GMPA 2GP3A 5A33B 5IVYA 4YW1A 4DS0A 1XJAA 4PJYA 2Z5WA 1IG0A 5FJHA 2VMIA 1TMF2 2GZWA 1XYNA 3U14A 1YYNA 4S2GA 5FKBA 4LUMA 2B4KA 1A3KA 2YC4A 4CDXC 1ND2A 2IXLA 4BISA 5A7OA 1Q8OA 1VBB2 1JZ4A 1YC61 1ZBA1 2XXZA 1H30A 3O14A 1ZBE2 4O9EA 1F35A 2JKBA 2VZRA 1GFF2 4Q0VA 3H3UA 3POWA 1CQ9A 2DUQA 2JD9A 4CCMA 5K0UB 3CL1A 1RVF1 1SCRA 3RRDA 3VKLA 4FXGB 3H8RA 5SV8A 5F39A 4A42A 2NQYA 4MO3M 5FLJA 2A6VA 2WSVA 4CEWC 2WBKA 4YW4A 5BNNB 2WT1A 3T2OA 1RC6A 3FN9A 4XJ9A 1C8M3 1LKNA 3AL5A 3ZSMA 2EF6A 2YPJA 4GMP0 5DXDA 2VJXA 1U5ZA 3TOJA 2VM9A 1QKQA 2BGPA 5J09A 1DU3D 1Q8PA 3SITA 2WNUB 3RGBA 3JUUA 3VBSC 3UJOA 1W6QB 1RXGA 2HWB3 1D7PM 4A2UA 4QU2A 4K3UA 4LORA 3USUB 5FR3A 2ZS6B 2WABA 5GZGA 1KD7A 4Q8LA 2ID4A 3MDPA 2Q0AA 5JIAA 1RUF1 5FPUA 2JG9B 4YGEA 3F2ZA 1LGBA 2HYXA 4WVMA 1RHI2 4CCOA 1FT9A 1XNBA 2IC1A 1BHGA 4G4FA 1OFSA 3POSA 2P1BA 3OY8B 4P9IA 2Q5TA 4Y26A 5FYYA 1PO11 3B69A 2W52A 5IJRA 1GZWA 2ZGNA 1OVPA 3AYEA 2O8OA 1D0HA 3U1XA 4AHZA 5K9YA 1ASJ3 1ND2B 1NLRA 5FZ1A 2CTVA 3VD9A 3DKWA 3LEGA 3WG3A 4ZXEA 1FNYA 1NA1C 5A3MA 1UY3A 3P3PA 1YO8A 4IE4A 2PAEA 4TTGA 3VBOA 2ADDA 1HKDA 5FOJB 3WQ1A 4HT1T 3I2IA 1ODNA 2AR6A 2BNMA 2WO7A 2JENA 4OUMA 2XQRA 2WS91 5C7GA 3M2MA 5JMOA 3SXWA 3BKZA 1HXS2 4WVZA 5FLHA 3TEZA 1YI9A 2ZX1A 2G9FA 1RUG1 2SBAA 4AHWA 1GV9A 2QQKA 1WUVA 1BJQA 3BYWA 4KG8A 5A6ZA 4HK9A 2JE8A 5CYYA 2A6XA 1ZRRA 2D7FA 4JGYC 1A8MA 2CWMA 3HBKA 1W9SA 2CGPA 1ZA7A 2XVGA 4BQ1A 1C8NA 3C7EA 2ZCWA 5JOZA 5F6KA 4AVAA 4DXRA 4HVRA 5C8CA 1Y43B 2D6MA 1QF3A 3WW2A 4WVMB 1HB3A 4BIFA 1C1LA 4I0WB 2BW8A 1TMF1 4IQPA 2RG4A 3UNPA 3RZMA 3I2KA 1XQNA 4HG6B 2PHXA 1ZX5A 3HOBA 4ARYA 1NY72 1UAIA 1GZWB 1RUH2 2DBIA 4OI1A 1G9BA 2FZ2A 4QB2A 2W91A 5FCCA 4RR3A 4E4HA 1HRI2 3DCQA 1VBB1 3BTAA 4JRAA 5B4XA 2LUWA 2WAOA 3LSEA 1ZBE1 4CP0A 3NRUA 3PUAA 1PGSA 3VBOB 4EN7B 3MBWA 2JIGA 4RD7A 4EZHA 1KEXA 2VD7A 1LOCA 4LLOA 1GQPA 5KHIA 3WD5A 1WA4A 3AZXA 3O1OA 2CDOA 4ITCA 2V09A 2X10A 2ZZQA 3GZEA 4QKBA 2JD4A 3USSA 3IIIA 4AFCA 5BV6A 1JHNA 1G7YA 1KFUL 4GH4C 1HIXA 2W94A 4LEJA 3W21A 4FVVA 1E5HA 3I8TA 3M7AA 5APAA 1UW8A 5F8PA 5JAXA 4FPEA 2EIEA 1LODA 2AH2A 1Y3TA 1VAMA 1RUI3 4XAAA 3NJZA 5FYCA 2OPWA 2QQOA 4LBJA 5C8CB 1AR62 2BTVC 3VUOA 2D3RA 2P4EA 1W0OA 3LCPA 3FC0A 4FPGA 5FY9A 4IGQA 3DL3A 3WDWA 4OQ8A 4U2AA 3ZR6A 1AF9A 4DO0A 2IXIA 3CIHA 2QQUA 2QVSB 4HSLA 3CEWA 4QKFA 2QTWB 3ZXDA 3O1UA 4OUSA 3KT1A 1UIKA 4M3CF 2UWAA 1H1MA 4RR3B 3BODA 4O61A 2C9AA 1DQ6A 3M1HA 1H9PA 2PQQA 3EQEA 3TRSB 1PMHX 2TNFA 1REFA 4U36A 1SZBA 1XNDA 2A6YA 3VD4A 1XOYA 3GZUC 5DAXA 5F9TA 1WW7A 1TVGA 1U5IA 4JC1A 1D4VB 5F32A 1PVC2 1O3QA 4XETA 2MEV2 1K3IA 1BCXA 2RS13 1HXS1 3LEKA 4C90A 5BNOC 4OCTA 3ES1A 2BPA2 3FBYA 1IQAA 5L7OA 1XB9A 5E89A 1QY4A 3KT4A 2ZAHA 2VZTA 1YCIA 1QOSA 1Z7S1 4LOTA 3ZXFA 3T2QA 1ZZBA 3UESA 1ODMA 5FP4A 4IV3A 3AKRA 4LLFA 4TYSA 1ZRCA 3WP6A 3AK0A 1POV3 1O5LA 3AZYA 3FHQA 5FOBB 2GN7A 1QNWA 2P6CA 1ALYA 2Y60A 3NL1A 3KZ4C 1S0CA 1NY71 1O7FA 1RUH1 4ZHNA 4OZOA 4PDWB 4AVBA 4XMAA 3V0AA 3NJYA 4KWLA 4Q1RA 5FZHA 1OF4A 1NQDA 4CCNA 1GBGA 3WG2A 4FCAA 4UW5A 1Z0HA 3AKQA 2E9QA 1X50A 5J98B 1D2QA 5FZ4A 2R16A 3ZIXA 5D2AA 5DN2A 1SDDB 2ZGUA 5G04L 2PXJA 4CDUC 4AI2A 1M06G 1MACA 3HIFA 4SBVA 3H7JA 1D4M3 1ENSA 4IEWA 2R1DA 4W6YA 1ZM1A 4JHTA 1FOD3 4KL1A 3TBDA 1AL23 1RGSA 4L11A 1ENRA 3PURA 3I3EA 4LBNA 2PLV3 4KU8A 2W47A 3VHOA 5A3WA 3WNOA 3IDCB 4BXFA 5ACA3 1GZ9A 4XZUG 3SC7X 5FZKA 1X8EA 2PFWA 4IV3B 4MV2A 3QBQA 4URTA 3UYJA 1SDWA 2HWB2 2HH9A 4DMIA 5KXCA 4XBQA 2K9ZA 2VNVA 3ZXGA 5FPAA 2ARCA 2XONA 3PU3A 2CU5A 1SACA 3ETQA 3JQXA 3LDBA 1EV13 2UU8A 1CVNA 4YZ3A 3IAQA 3I97A 1UYPA 4RS5C 4D69A 3V0AB 1ULCA 2GALA 2RV9A 4MGSA 1KS4A 2FQPA 5BNPC 4LA3A 1H6XA 1W3XA 3VHNA 1UQXA 3UKVA 3CZJA 3QD6A 3T09A 3VDDC 1HN1A 1YFYA 3INAA 3LPFA 1ASJ2 2PHDA 2TBVA 4R8HA 4B4PA 5GZFA 4G3YC 4JTOA 5CG8A 4EJRA 5JSOA 3SNMA 1IQDC 3JBG3 4HKWA 1PVC1 5JZGC 1KJRA 3UJQA 1WZXA 2MEV1 5C5TA 4E2GA 2OKXA 3O1PA 4NO4A 2VH9A 1KDKA 5LK7B 4YM2A 4UFHA 4LKFA 1COV3 4Y5SA 4FO9A 3HMYA 3BTZA 5AVAA 3FZ3A 3NVCA 1CPNA 4AGVA 2RDNA 1N3PA 1OQDA 1PNFA 3BPSA 4JKLA 4NIIA 1V0AA 1XPWA 1W0PA 2BJSA 3ZFFC 1CAWA 4LR4A 4O7XA 5H9SA 2HKXA 3AFGA 4TXWA 3WUDA 4B1LA 3THTA 3VZLA 3NNGA 1RUJ3 4RQPA 4YG0A 3ZFEC 2GC1A 2LALA 4HPKA 4QHOA 2XR4A 1LOFC 4XUPA 4LULA 2GH8A 4CDQC 1TME3 5T50A 4QM9A 2ZKNA 2ZBJA 4XDQA 4XUOA 4HONA 4QB1A 1QHDA 5CISA 2ZPXA 1Q43A 3VBFC 2W1SA 3SCFA 4JAAA 4WVVA 5FYUA 3VLBB 1QOOA 3AKPA 4NRPA 3NSTA 1V6IA 2GNMA 4ASLA 1WMDA 1W9TA 1LNSA 3APBA 5C9AC 2WFF3 4AVCA 2DFBA 3NV3A 4GQ7A 2WNEA 2Z4FA 2D93A 4FPFA 3M4FA 2ZOEB 4P08A 4CDWA 4Q2FA 3TEWA 2R073 4XC9A 2OZJA 3H0OA 3L9JT 1QXRA 4QM8A 4Y22A 3H1WA 4R4ZA 4AL9A 5A32A 2VNRA 4BQ5A 1RITA 1AR83 3E97A 3OBAA 2ET1A 1RINA 1RL3A 1SFNA 4CCCA 1QIQA 4FTBA 1C8M1 1OI6A 2WA4A 3PUHA 1US2A 3N3HA 1JYWA 5LRSA 3VL8A 4COVA 3N9NA 1CAWB 5A6XA 4INDA 2ATFA 4GIQA 1HQLA 2RVAA 2HWB1 3WDTA 1HX6A 1X7NA 4B29A 4CXWA 3W5MA 4RQPB 3KVBA 4HPKB 1RUI2 3F95A 1K5MB 1UPIA 4QKDA 4XABA 4HL0A 2B5HA 2ZZJA 2DYCA 5E88A 1POV0 1XU1A 2XJTA 1NOVA 3AZZA 5T55A 3CQOA 2EA7A 1CD3G 3CKHA 4FSJA 4XF1A 1I5PA 4AGGA 2YYOA 2GH2A 2X09A 3TYJA 3ZFGA 1ASJ1 3HNMA 5CB7A 2Q8DA 4TLFA 3FHIB 4QT6A 2J1AA 3PUQA 1ULFA 2PA7A 4E9KA 3AXDA 1JZ8A 4XPVA 3GALA 4CDWB 3NAPA 4FI9A 3WQBA 4OHXA 3WY6A 1Y9MA 3HN1A 4LHNA 1NCQA 2R0FA 3IZOA 2HYKA 4Y22B 4EYUA 3OUJA 4UW6A 4JCKA 4MXWA 4N8MA 5A32B 2Q30A 4AVVA 3T1LA 2XL9A 3CJXA 3GJAA 3NV4A 3VBUA 1DFQA 5A1LA 5JXHA 1UD1A 1N1VA 2D6LX 4MVTA 2G9ZA 1X9PA 2V4AA 4K21A 1UKGA 1Q56A 2UYBA 2JDZA 2G1MA 3VGIA 5C70A 2WS93 1TNRA 2RS33 3SEPA 4XJUA 4FAHA 3D8CA 1FAYA 3SISA 1I3HA 2DF7A 1RUG3 1TEIA 3J4UH 2A3XA 3N36A 4LO8A 2R1BA 2V72A 2RJ2A 3AZWA 4Y33A 2FDFA 4JTNA 1MQTA 2DCKA 1H6YA 1DLLA 2OUHA 4KGQA 5JI9A 2CNAA 1BEV3 4IGPA 5A3OA 4B8EA 4ZS3A 2FBEA 4L0PA 1L7RA 1N3QA 3RPQA 5ABJC 1XYPA 3IIAA 5CFDC 2XPJA 4BIOA 4J25A 5CG9A 4WVWA 1R083 2YU2A 3BN6A 4XUTA 5FZEA 1MZ6A 5FMCA 3ZFGB 1W8HA 3FL7A 4JDNA 4CCKA 1V6LA 1BXHA 2D6KA 2AC1A 4QX7A 5EWSA 2VG9A 4QHBA 3OPZA 3WP5A 3G6JB 4CEYC 3NAPB 4KWKA 5IVFA 2Z42A 1NCQB 3K51A 3DYMA 3MLLA 4HN1A 2K46A 4MXWB 4NWVA 2WWJA 3SMHA 1NKGA 3V64A 4CA9A 1OLRA 5F5CA 2Y33A 3VBUB 5FUPA 3AVRA 1JMUB 1WMXA 1D4M2 2VECA 3L2HA 4ZU5A 3BOWA 4YM1A 4E2SA 4HMZA 2L9LA 2NN8A 4I30A 1FOD2 5FK7A 3CJIC 5K4LA 1AL22 4LQRA 4A44A 2BOJA 2WSUA 1RUC3 1Q8QA 2AYHA 2P3JA 2PLV2 2GP5A 4HN0A 1B35A 2E7QA 3EYPA 3OGRA 5ACA2 1MQTB 1W6PA 4HXCA 4AR2A 1PIV3 4MGIE 2K2SA 1UX6A 3ALQA 4MSVA 5LBBA 3WP4A 4AEDC 4YARA 3TEYA 1UZVA 2VW2A 2Q1FA 1NG0A 3D3AA 4QX1A 5FXVA 4P00B 1EP0A 3KF5A 1EV12 2R0HA 5DDJ3 1DCSA 2BEOA 4J6GA 1YFUA 4MADA 3K3NA 2VU9A 5T52A 4XQWA 3S0MA 2O1QA 3CF6E 3VV1A 2FCTA 2R32A 3UKTA 2JICA 4YVWA 5I91A 2JG8A 3N35A 1RUD3 3MYXA 1MZ5A 2WA3A 5CZKA 1YFWA 3OTFA 4A4AA 4D6RA 4AE2A 5DMYA 5J7MA 1JN2P 4D7YA 4HANA 1OPMA 1REEA 1VBD2 2ZHMA 3HT1A 1Q3EA 5FZ9A 3JBG2 1IG3A 1RYYA 3LPGA 3WG4A 2H6CA 2RS11 1LHUA 2F6BA 5FZOA 4ATFA 2RM23 3ZYHA 1W2TA 1W04A 1J83A 5I0UA 5E1RA 2Q8OA 3FJSA 5JPMB 2YBPA 2FD8A 4QD2A 3WHTA 1GSLA 2IFRA 3MLKA 4WM8A 2ZGTA 4ZU7A 2FDHA 3RWKX 1B35B 3IN9A 3Q9OA 3T4VA 1E57A 1W6PB 1ULEA 5KHGA 3N9LA 4CXXA 2VQ0A 5FDBA 3KT7A 1POV1 4ARXA 1H8TA 1XNCA 4RGKA 5F1RA 2B7YA 5DAPA 1RUJ2 5A3UA 1UYXA 4K8RB 2H6BA 3C7FA 4Y4YA 4RYDA 2BZDA 3WOGA 2Y6HA 3IB3A 2VMHA 2R6QA 1TME2 3OJBA
chains in the Genus database with same CATH topology
1V6KA 1CR7A 2P34A 1C4RA 1NZCA 4UXAA 2OW4A 4W6XA 4YVWB 3M3IA 2JG8B 4Y1YA 1AZDA 4C91A 4FTSA 1W6NA 4DINB 4XXAA 2WZR3 5C4WC 1I6XA 2WFF2 2GNBA 4Q27A 3MW4A 1LRHA 4Q0SA 3QH7A 1PZ9A 4A3XA 2VNGA 4PF5A 2R072 3ST7A 1MVEA 1ZBA2 1D4M1 4IXLA 4YW2A 3TNQA 2ZACA 4HLTA 1FOD1 4AI8A 4H14A 4IETA 2D3SA 1PK6C 4YVSC 1AR82 1AL21 4QPIA 3V0BA 4AEKA 4QPGA 4TWTA 4WM8B 4QGNA 1S0FA 2PLV1 2Y0IA 2ZGOA 4H7MA 1G8WA 5ACA1 3ECQA 4FXKB 4XHXA 1H8TB 1OMIA 3BB6A 4AQ6A 4Y1VA 3KMHA 1VRH3 2PHFA 1EV11 3JCIA 4OLLA 2EIGA 3KGZA 4QGMA 2DTWA 5LEKA 1FMD3 1J3QA 2XJSA 3GHNA 3PVNA 5KXBA 4C1XA 3JD73 2YMZA 4JVAA 1W6NB 1A6CA 2YGLA 1MEC1 4AFDA 4PIZA 3FFZA 5IK4A 3O0VA 3R05A 1QJU3 3JBG1 2XH6A 5CADA 3FUOA 1COV1 2YHJA 3ZXKA 4QPIB 4XFCA 1JW6A 3MIGA 3H8UA 4QPGB 3LSDA 3M3QA 3EHKA 3QACA 2WS92 2RS32 2Y26A 5KC5A 4NPRA 1OKQA 2WINB 4N43A 1RUG2 2ARXA 1JYIA 1J1TA 3ENRA 3B5LB 1RUJ1 5K0UC 5T5LA 1MZEA 2EXHA 1SLBA 3ZMNA 4AEJA 1BEV2 3E5UA 2ZA9A 1TME1 3E5QA 5BNNC 4S2DA 2DU1A 1R082 1ZREA 2HWD3 4AXOA 4YZ5A 3ZYIB 2VW0A 2DCZA 5LRRA 2WNUC 2B46X 2IXJA 2WFF1 4NHLA 1SLAA 1LJ7A 2HEVF 3ZYJB 1KRIA 1HRV3 1PZ8A 2YC0A 2UYAA 2R071 1O3TA 3N7MA 5GLUA 1SLTA 2C1FA 4PIXA 4HETA 5J36A 3NW4A 3ILFA 1AR81 1BQPA 1VJ2A 2DURA 3N7JA 2BGCA 1YHFA 4GWNA 1JUHA 2XJVA 4BCUA 1DGRN 3VHRA 2GNDA 3A0NA 4XFHA 3VKMA 4N43B 2JXAA 1H2LA 1PIV2 1QH7A 4OVEA 1FYUA 1MVQA 2XLAA 4PLOA 1EAH3 4D94A 5CBLA 3E6DA 2Z69A 1LGCA 3VBSA 3NWKA 4ATEA 1Q8VA 1FV3A 5DDJ2 2Z79A 1BBT3 1VBC3 2EAAA 2OIIA 2QKDA 5CNAA 4FPCA 3BU7A 3FX3A 2AUYA 2ZHLA 3JU9A 5JOYA 5FLIA 4NN0A 2QJVA 5J48A 4Q1PA 5HCBA 2ERFA 3AMHA 4MGZE 1SBEA 3GHMA 3MEPA 3SCGA 4AFAA 5BY5A 1OQ1A 4K9SA 3WP3A 4LT5A 3H50A 3GZAA 4AVTA 4HK8A 2A6WA 2YY1A 1CJPA 2RM22 3K48A 4Q0QA 2RS31 3D82A 5L19A 4Z92B 2X8KA 1MS9A 4DRRA 2A71A 3AP7A 5FRAA 2PELA 2PYTA 2QDRA 1Z7S2 1CESA 1BEV1 3RMYA 3ELNA 3D6EA 3NKGA 3VBSB 4MYEA 1VB4A 1R081 4OHVA 1DGRA 4I2OA 3HAGA 3WLUA 2E6VA 3WQ7A 4PCRA 1LU1A 2C0ZA 1N47A 2IZWA 3B93A 2DFCA 4X8PA 2WNVA 5JCTA 1VB2A 2GMMA 4LBQA 4ISQA 1I1EA 3MPBA 2XLGA 5C8CC 3PNAA 4N53A 2WZR2 3MGUA 2D40A 4EWDA 2PAKA 2ZGMA 2VQAA 4AFMA 3HT2A 2GC2A 2ZX4A 5FO7B 4AFBA 4QQLA 4XF9A 3C3VA 3CLPA 4Q4X3 2XKOA 1FPN3 1JUIA 5BUVA 4RR3C 2OUJA 4R9BA 1RUC1 3MI8A 1OOPC 4WZCA 5T5JA 1SQ4A 2VVEA 3D4KA 1OFNA 2QFEA 3M8LA 1PIV1 2ZHKA 4JRLA 4R9CA 2OPKA 1R093 5FO8B 3LOBA 1FV2A 1QDOA 2KA3A 3OGGA 2CY6A 1OHFA 3TN93 1HV0A 1VRH2 5DDJ1 1MZFA 1YIFA 2A75A 4M3CE 4WZFA 1FMD2 2VNOA 2WNVB 1D0GA 1PMIA 1KQRA 2JECA 2VUJA 4LBQB 4R9AA 3DUIA 1ULGA 4KGGA 3AMQA 3JD72 3MFCA 2IXCA 2ZGKA 4Y5Z0 2BYVE 3AZVA 2VXRA 1RUD1 2YDEA 4N53B 3S7EA 4XZPA 2XUMA 1N1TA 5K8SA 4CTEA 1AUYA 1SEFA 3WUCA 1LEDA 3TB0A 1YJLA 4AG4A 5HCAA 1QJZA 1O4TA 3NO8A 2RM21 4P9GA 4PDWC 5L36A 4AI3A 2GMEA 3GBGA 1QQP3 3RI9A 5JI7A 3MLJA 2RJKA 5IUQA 1RUOA 4CZSA 5GKAC 1XRUA 4IEZA 1CJDA 3V65A 4LE4A 5AFEA 1AXZA 2R063 3RWNA 1NQJA 1QU0A 4L9BA 2ET7A 5IT6A 4IEUA 5DZFA 3CU7A 2QQPA 3B3QE 2VOKA 3WDVA 1GR3A 3ZXEA 4LNVA 1FXZA 1I9RA 1JYCA 4X6RB 5DG1A 3J26N 2HWD2 1DGWX 2SLIA 2D44A 2ZGRA 3B7MA 2ZGSA 4XF4A 5AVPA 3RI8A 4IV3C 2B8MA 2PAMA 2WZR1 3LAGA 5DUUA 1OPOA 4E2QA 4MGKE 4YZ1A 1W6OA 4K1YA 2ZGLA 1KDMA 3CO2A 1HRV2 3ZYRA 1ZZCA 1RUE3 1G9FA 1H2NA 1VIWB 3ZXLA 4XF0A 3AB0A 4AHYA 4RL7A 1IHMA 1TNFA 4FAGA 4FQ4A 3TAYA 1IKQA 2GC3A 4UW4A 5GLZA 1GICA 1NE6A 4Q0PA 3VKNA 1GZCA 5L7OB 2PHTA 3DF0A 4S2HA 1C8M2 1Q5OA 4HKLA 4KBBA 2D6PA 3NKTA 1LOBA 1GKBA 4DXZA 1PGW2 1R1A3 1I5ZA 2WKKA 2ZGQA 4ZU4A 1VRH1 4XFBA 4K8FA 1YRZA 1UIJA 1EAH2 2Z2SB 1DBNA 1LGNA 1FMD1 1HDKA 1ZNPA 4M0NA 4PBOA 4LO5B 4YG3A 3AXEA 1BBT2 3JD71 4ES9A 1DHKB 3PJYA 3GBWA 5C6CA 2EALA 1S0JA 3S30A 2XLFA 1W6OB 4COYA 3HWJA 1MEC3 4OHWA 1QJU1 1OA3A 3E5XA 2BNNA 1AVBA 1MR5A 3H1MA 1NYWA 4FPKA 1DQ1A 3GZTB 4RGGA 1LB2A 3VDDA 1NCRA 1HQWA 3VZNA 4K7JA 2XVLA 3D5OA 1PM7A 4Q4V3 4XQ4A 1SCSA 3WDYA 4F7ZA 4XJAA 4BWOA 2TEPA 1EYBA 4RHV3 4XEZA 1S0GA 1WMFA 4IEPA 1DDLA 4A7YA 3AYAA 2VOVA 3ME2A 4ES8A 3M3OA 2YXSA 1VBE1 1PZ7A 1NLSA 4G9SB 4H3WA 4HVOA 1UU5A 5JIUA 2OZ6A 1VAVA 1S55A 1LOAA 3PTYA 2HWD1 2EXKA 2W68A 5I8TA 3RZZA 1WLWA 5B2GB 3ZN5A 5KHHA 3UL2A 4BA6A 3LB9A 3AFKA 3WINE 1OA2A 2ZTNA 5J37A 3VBHC 1KFXL 1K5MC 1HRV1 2VPVA 3VKFC 1O3SA 1PHMA 4YFWA 5E8AA 3VBFA 3FLPA 3AYDA 3WT3A 2XBO1 3VDDB 3VBRA 1NCRB 3IT8A 1IS3A 5FPZA 1KXGA 1BVP1 3G7DA 2RJLA 4OFGA 2D5FA 4Q4X2 1FPN2 1V6MA 2P3IA 1NE4A 4XIOA 5FREA 1DQ4A 3WG1A 3B94A 5I0TA 4IV1A 1H0BA 4P9WA 4QX5A 2P17A 5I0RA 2C5DA 4FOYA 1PGW1 4AF9A 1LCLA 4HSJA 4LE3A 3LZZA 3N7LA 3S6PA 4H55A 3R4SA 1R092 1EAH1 1LHNA 1PGL2 2DVFA 1DG6A 1YWKA 3OBRA 5AFBA 2WT0A 2RR11 1BBT1 1VBC1 1DGWA 2WL1A 2MHFA 3FE5A 1RTVA 2ILMA 1J58A 1F9KA 3ATGA 3RSJA 1U5XA 1AYN1 2AREA 2XWBB 4B4RA 3VBFB 3WDUA 2CL2A 3M3CA 3VBRB 4XFIA 2X53S 4XJWA 1EPZA 2DCTA 4FTEA 4DQAA 2QUOA 5JSRA 2Q1ZB 1VBA3 3I4IA 1HW5A 2ZMLA 2DU0A 4FP3A 4Q29A 3URFA 3ZFGC 4AQ2A 4Y1ZA 1YNAA 4YZ4A 2P37A 3O0WA 1QQP2 1PO23 1NXMA 2RS12 3DPRA 2HWE3 4IV1B 1G9CA 3NAPC 1ZZ9A 1AX0A 2PHRA 1NCQC 1LECA 2X5IA 2R062 3SLIA 4LO4B 2IXKA 1V6NA 3VBUC 4HBNA 1UMZA 3A4UA 5FO9B 1LEMA 2NM1A 4D7TA 3KM5A 2X29A 2XJRA 4YZ2A 3N7KA 4QGLA 4YM3A 5ABJA 1MQTC 2MPFA 5CFCA 4BZ4A 2WFPA 2D6NA 1IZ3A 2PHUA 4F83A 3LKJA 4CP2A 4V1PA 3OYWA 4PBPA 4Y20A 1RUE2 5EV7A 4K20A 4QXKA 4Q4X1 4B3NA 1FPN1 4PIYA 1NXD1 1O4ZA 4EV0A 4XW3A 3DPRB 1C5IA 2E51A 1LU2A 1OSGA 3I2DA 3GBFA 2E63A 4AQTA 3EO6A 1YI7A 1CIWA 1R1ZA 2Y0OA 3RS6A 3PLQA 4YGBA 1WW4A 2H0VA 2X5IB 4NR1A 1R091 3CJIA 4IERA 4IL7A 5BNQA 1PGL1 1RIRA 2XJPA 5GZDA 3TN91 5KXDA 4LBLA 5GJ6A 2D6OX 3LA3A 1VLNA 2HEYF 2NPIA 2DVAA 1ENXA 5BPXA 1V9U3 3IBMA 4OI2A 4PLMA 3B02A 4S2FA 4AEDA 1V6JA 1B35C 4P9JA 5ABJB 2ARBA 4JGZA 4FPYA 5CFCB 2CAUA 3WVJA 1S2KA 3OGJA 3EXUA 1MEC2 3OYWB 4Y20B 2QCSB 3B9IA 2HWC3 2WZPP 2CGOA 2ZKLA 3L2YA 3PMSA 3WXPA 5JR7B 4UBGA 1QJX3 1QQP1 1C3HA 1RHI3 2RMU3 5GZEA 4BLJA 3U11A 4YVWC 1COV2 2JG8C 1GNZA 4Q4V2 3AYCA 1N1YA 3LGRA 4OHYA 1J59A 2R061 4Z8BA 1WLTA 3SH4A 3UV9A 3WX5A 3CJIB 3MIFA 1HQNA 1GANA 1AX1A 5CVRA 4GKXA 2ZX3A 2D97A 4GALA 1BKZA 4D7SA 1LESA 3LA7A 4DY3A 3KGLA 3EJKA 4WM8C 2QZ3A 2WQZC 3PVEA 2OYZA 4GB33 4AEDB 3R4DB 1BK1A 5FTTC 4GMP3 4JGZB 4Q4Y3 4Z2WA 4Y1UA 2UWCA 1H8TC 3IWZA 1ULDA 3ZSJA 3WW4A 1UZZA 1Y9QA 1RUE1 4M3CA 1J1LA 3M3EA 2JX9A 5JOWA 5I8SA 2BBVA 2WIIB 3ZVXA 1WD4A 5C4WA 2UY9A 1IS5A 1JTZX 4AVSA 2FMYA 4YGDA 4XOGA 4DOUA 1WMEA 3MIBA 1N3OA 5DUWA 3KD4A 1PK6A 1HRI3 4IEYA 1R1A1 3DV8A 1IPJA 3BCWA 4M00A 5IK7A 3U0ZA 1ND3A 4RGAA 4YLZA 1DQ2A 5CU1A 4KQ7A 4QPIC 4Q8KA 5EFUA 4L8QA 4B4QA 1QDCA 4QPGC 1AXYA 1QH6A 5HCFA 3ZIWA 1JOJA 2D5HA 3J9SA 3J8F3 1WBLA 4BOWA 1OLQA 2Q1MA 3O0XA 5CIRA 5A3LA 4KH9A 3VZJA 3KCYA 2E7TA 1A78A 2GAUA 3KCCA 3PVBB 4M3CB 5D8AA 3DGTA 4N7UA 1CAXA 4L2NA 3PVOA 1MS0A 4KWJA 1FATA 1QGLA 5DG2A 1OA4A 5EJ3A 3AKTA 1AJKA 4WM7A 5C4WB 3IKWA 4IESA 1VBA2 4Q4V1 2G4IA 1CPMA 1SBDA 3V0BB 4BMBA 4RHV1 3I59A 2O0OA 1PO22 2Q4SA 2HWE2 4FPOB 2B45X 1HLCA 5T5PA 1ND3B 1QNYA 3U10A 1CN1A 1UCXA 3ZXJA 1YLLA 1AR91 1VBE3 4LO7A 2BVBA 2NMOA 2R043 2ZX2A 1V6OA 3EBRA 4BMEA 4I02A 4K40A 4TZDA 3GNEA 4N43C 5GZCA 2ZJCA 3D0JA 1AYM3 4FPJA 4DZGA 4J1XA 5BXXA 5JLVA 5D8AB 2XG3A 1RB8G 3ZO0B 1CAXB 4IEVA 2YUEA 5SV5A 2JG9C 2B42B 3I7DA 4WM7B 1O3RA 2D3PA 1IKPA 3WW1A 1W39A 1XYOA 2WLQA 2XBO3 4CDXA 1LENA 2W39A 3IM0A 2HWF1 3I59B 2A3YA 4EROA 1Z78A 1ND2C 1AL0G 1AXKA 3OY8A 3O7OA 3ROUA 1RUC2 3SCHA 2BVVA 2RHPA 5KWRA 2BNOA 4CEWA 1REDA 3B00A 5T54A 1GQHA 3IPVA 1X36A 4XXPA 4XMIA 4Q0UA 4CP1A 5D1IA 2TUNA 2VW1A 5GLTA 3U4XA 3IMNA 1JH5A 1V9U2 1IS6A 2F4PA 4JQRA 5TSWA 4AI1A 4O9GA 2RR13 2A7AA 4M0HA 3VZMA 1RJ8A 5CA6A 1S0BA 5F5QA 1AJOA 2QDNA 3MW3A 1LOEA 5K7PA 1AYN3 3HD8B 3QOPA 1RUD2 1CAVA 2FZ1A 4R9DA 2HWC2 3WR0A 1VBA1 3KS7A 4CDXB 5KC6A 3JZVA 3OD0A 3A0KA 3NV1A 1NA1A 4QPYA 1QJX2 1PO21 1UU6A 1F8VA 2RMU2 2HWE1 3JB4C 4L97A 3T2TA 2WLPA 4YNIA 1S0EA 3S7IA 4LBMA 2OVUA 1DIWA 1GNHA 2R49A 3VBOC 1BVVA 2LTNA 3POYA 4XFAA