3WOGA

Crystal structure plant lectin in complex with ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
238
structure length
238
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phytohemagglutinin from Phaseolus vulgaris (PHA-E) displays a novel glycan recognition mode using a common legume lectin fold
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Erythroagglutinin
total genus 50
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wogA00
1G8WA 2ZHLA 3GNEA 1ONAA 5F9TA 2NM1A 1MS1A 3POSA 1Q8PA 3RMXA 1GV9A 1LODA 2ERFA 2VH9A 3MW2A 4P14A 2A71A 4Y1XA 2R1BA 3WUDA 1YO8A 2EXKA 2JKBA 2E7TA 1IS5A 1CIWA 2EIGA 3PMEA 1SBFA 1Q56A 3T1LA 4YZ5A 3DUIA 1N1VA 5GLWA 5BYNA 5H9PA 2ZMKA 2DVFA 2ZABA 4TYSA 1JUIA 4GWMA 4M3CB 1FNZA 1OFSA 2D6OX 3WDTA 2DV9A 3ZXFA 4FPLA 3AP7A 1AX1A 1SBEA 1LOBA 1HDKA 3C2UA 5E8AA 3B9CA 2WLQA 3IPVB 2D6MA 2R16A 1LJ7A 4YFWA 3ZXLA 1LU1A 2AUYA 2PHRA 1JHNA 4Q8KA 2PHXA 1J1TA 3UJQA 1KITA 1DHKB 3AP5A 1SCSA 4Z8BA 3AXEA 1SLCA 4Q1RA 1AJOA 1N3OA 4JC1A 1A3KA 1DQ1A 1MVQA 4XJWA 3OPZA 1UZZA 1V6OA 5HCFA 3SITA 3SNMA 1JW6A 2SLIA 3ENRA 1QGLA 3AP4A 2UU8A 1OKQA 1DQ5A 1AX2A 1LOEA 3ZSKA 2DUQA 1UX6A 4FP3A 4Y1UA 1MVEA 4YW2A 4UW4A 2ZKNA 3W59A 2PHWA 3USUB 3AYDA 2C5DA 3HMYA 5T5OA 4YM1A 1A78A 2ZGMA 3A0NA 3V0AA 4Y22A 2ZGTA 4WVVA 5HCBA 4LBOA 1Y7BA 2Q5TA 4K21A 2NZ9A 4D69A 1N47A 1SBDA 3GALA 1Q8OA 3M3CA 4Q8LA 2NYYA 2JE7A 2VW1A 3SH4A 1G9DA 1W6MA 4XBNA 1UKGA 1WW6A 5KXCA 3FUOA 3WCRA 1DQ0A 2VU9A 5E88A 2R0HA 1W6NA 3OJBA 1JXNA 4XIOA 4YW5A 5EYYA 4F83A 1DBNA 2ZHMA 2NMNA 1B09A 1DLLA 1QF3A 1QNYA 1ZM1A 1IKPA 1IS4A 1G9FA 1BXHA 2D6PA 2VXRA 3I4IA 3UL2A 4BPZA 2ZMNA 4YLZA 4C1WA 1LULA 1LU2A 4BLJA 2H0BA 3ZSMA 4DPNA 3B00A 5T5LA 1Q8SA 5FRAA 3R4UA 1JYIA 3IPVA 1U0AA 1V6JA 2FHRA 2WT0A 2KM2A 4Q2FA 3MW4A 1AXZA 1V6NA 2NMOA 4FPCA 2GMMA 2DVBA 5H9RA 3AX4A 2JD4A 4YZ3A 3WHTA 5JLVA 3TAYA 3MEPA 2ZBJA 1G9BA 1W6QB 1JN2P 3D6EA 1F5FA 1DQ4A 2ZAAA 2VW0A 4K1ZA 1AVBA 1N1SA 1IOAA 1LHVA 3N7MA 4AVTA 1W6OA 3AZXA 1LOCA 3OBRA 1BQPA 2ZGLA 4XMAA 2GALA 5T5JA 5AVAA 2D6NA 3AK0A 2DWRA 4FVVA 2DYCA 1LOFC 1S0GA 3N7JA 3LCPA 4LBLA 4LBQA 1KJLA 1LEDA 2WT2A 2A3YA 1LOFA 5GALA 1S0IA 5CNAA 2YROA 3IN9A 2SBAA 3M1HA 1MS4A 4FOVA 5IK7A 2JJ6A 2WT1A 4FPHA 3ZPYA 4LBQD 3M3QA 1QU0A 1H9PA 1S0JA 3O0VA 1C1FA 1WLCA 2EALA 2ZGOA 1XQNA 3VKFC 4IQPA 2A6VA 3M3OA 1S0CA 4XDQA 3V0AB 1DGLA 4OZXA 1Z0HA 3UJOA 1D0HA 3KQRA 1G9CA 2P37A 2ZHNA 1W0OA 5GJ6A 4XJZA 1MS0A 3LSDA 4YG3A 1QDCA 1SFYA 2A6XA 4AYUA 4M01A 1PZ9A 2VUAA 5JOYA 5GM0A 3BOPA 4NO4A 4SLIA 3WDUA 1GNZA 3ZYPA 5DUUA 1I1EA 3FLTA 5T5PA 5GLZA 1URXA 4XJAA 2CYFA 2ZGSA 3O0WA 2ZGNA 1G7YA 4UW6A 4DQAA 4XJUA 1HKDA 4AGGA 4Y24A 4AWDA 1FYUA 2A7AA 1KJRA 1GSLA 3D5OA 2GNDA 3OYWA 1S0FA 3KM5A 4YZ2A 4AGVA 1MR5A 4YZ4A 1LHOA 4PBOA 3UK9A 2D3RA 3VKOA 4TZDA 1APNA 2UWBA 3WDVA 1QMJA 1S0BA 2UWCA 2ZGKA 3ATGA 2ZGRA 3FFZA 2W08A 3HN1A 4XZPA 1QOOA 5T54A 3POWA 3WDWA 2CNAA 5EXOA 1Q8VA 2B7YA 3R05A 4GKYA 4FPOB 1FATA 4I30A 5CA6A 4ZXKA 3OGGA 4Y22B 3NWKA 5EWSA 3WV6A 1MS8A 4BM8A 2PHUA 2JDZA 5EYXA 4FPFA 4FPEA 4LBNA 2BQPA 2YV8A 3V65A 2AYHA 1GZ9A 5LK5A 2LTNA 1ULEA 2OW4A 1C4RA 1GICA 2P3JA 1UAIA 4FP2A 1SLLA 2A6YA 2EF6A 3WCSA 2DTWA 1GANA 2EXHA 2GDFA 4P9WA 1GKBA 3PVNA 1I3HA 1MZ6A 2EXJA 2PHFA 5JVVA 3AYAA 2A70A 1W6PB 1IS6A 1LOAA 1SLAA 1D2SA 3FUQA 1CPNA 2E7QA 2I2SA 3AP6A 4JRAA 3VV1A 1UMZA 3AZWA 3WLUA 4LBJA 4L8QA 1FNYA 5DUWA 3VKLA 1DFQA 3BODA 1DQ2A 1DZQA 1FV3A 4PF5A 1N1TA 1AF9A 3NV4A 1BJQA 3ZSJA 1WBFA 4BOWA 3SLIA 4AVVA 4M3CA 3RQ0A 4Q27A 1WD4A 1LENA 1WLWA 4WV8A 2R0FA 3OBTA 3WNXA 1C1LA 3WUCA 5KXBA 4U36A 1V00A 3DGTA 5JOZA 4Y26A 1ULDA 5IK4A 2DVAA 1YXWA 3H0OA 5JMCA 3PVEA 1ULGA 4C1XA 1SLIA 1VAMA 4M3CF 4WZFA 2DUOA 5GZFA 4MYEA 1F31A 3PVOA 2HYKA 4FQZA 3I8TA 3NV2A 1LHUA 5DZFA 4P9YA 5DG2A 2P2KA 2PHTA 1A8DA 2ES3A 4PBPA 2E6VA 5DZEA 5L73A 2R49A 5F5QA 2CY6A 4XBQA 2RHPA 2ARXA 2DURA 1IS3A 1Z78A 3USUA 1CN1A 1G86A 4LBQB 4YGBA 1QNWA 1Q8QA 2GNTA 3OYWB 2OVUA 1WW7A 1BYHA 1VLNA 3AZZA 5GLVA 1FAYA 3N3HA 3ZYRA 5KXDA 2OUJA 1LEMA 3IM0A 1FV2A 3B69A 2W39A 4YM0A 2D6LX 2A3XA 4XYXA 1WW5A 4FPJA 1MS5A 3SISA 3N35A 3AJZA 5T50A 1WLDA 1TEIA 1JOJA 3SH5A 2ZACA 4Y20B 4XTPA 4ISQA 5H9SA 5FREA 3HR9A 4K20A 2D43A 3RS6A 2W68A 1HQLA 1N3QA 2ZZJA 2ARBA 4DRVA 1CONA 2UWAA 4FQ4A 3VUOA 2D7FA 2EXIA 2ZA9A 4GWNA 2GN7A 4Y1YA 4KBBA 3WZ1A 5CAZA 2Z42A 4XHBA 3JU9A 2ZGUA 3N7KA 1FX5A 1QOSA 2GN3A 3ZXEA 5GZEA 1S1AA 3ZSLA 4FOQA 5SV8A 1F9KA 4FOWA 4RL7A 2CWSA 2A75A 3AJYA 4R9CA 3WG1A 3RMYA 2C9AA 3QCWA 1LGBA 4FOYA 4ATEA 1W6MB 2R1DA 3WDYA 4ATFA 1BZWA 4JCKA 2A6ZA 1WCSA 2ZGPA 1GZCA 4R9DA 4U2AA 4CZSA 1H9WA 4PQ9A 3L2YA 1KDKA 1VALA 4RA0A 1UN1A 3AYEA 1OQ1A 1LCLA 1LTEA 4ISRA 3O0XA 2WJSA 1R1ZA 4Q1PA 1CQ9A 1N1YA 1W6QA 4FPGA 3NV3A 3BIWE 4YW4A 4BMEA 4DRRA 3ZVXA 2NP0A 1MZ5A 2D3PA 2WSUA 2YMZA 4XIKA 2GMEA 3ZXJA 4YGDA 4ASMB 2TEPA 3R4SA 5GZDA 3BTAA 1SLTA 5T52A 3WG2A 3AFKA 4GALA 3A0KA 3FLRA 4XXPA 2E51A 2D6KA 4NOTA 1CJPA 2WQZC 1MS3A 4GA9A 1WD3A 1LECA 1UZYA 1UL9A 1DYKA 1ULCA 1AZDA 1EPWA 1CESA 1NLSA 4HANA 3T2TA 4UW3A 5IUQA 1O4YA 1SCRA 2AREA 5HCAA 2NN8A 3N36A 1PZ8A 4YFZA 5JDBA 4YZ1A 4ITCA 4GXLA 4XJ9A 3WOGA 1MS9A 2ZMLA 1KQRA 2VW2A 3AZVA 4H55A 2JE9A 2YXSA 3O12A 2DU1A 4YM2A 1QDOA 4YGEA 4XXAA 2XB6C 4PCRA 4FPKA 1QOTA 1BKZA 2W52A 2ZHKA 3OY8B 4XHXA 4YM3A 1LGNA 3AXDA 1MACA 1CPMA 1V6MA 3AP9A 3APBA 3V64A 3MW3A 3SH3A 4CRQA 1ULFA 5DG1A 2P34A 1YI7A 1YYNA 1DIWA 1YIFA 3M3EA 5IK5A 2ZGQA 1GZWB 5DZGA 4Y1VA 1RINA 2UURA 3AYCA 3CNAA 2EAKA 4W65A 1V6IA 3V0BA 1UPSA 2DUPA 1V6KA 1S0EA 2GNBA 1QKQA 4DFSA 5H9QA 4R9AA 5JOWA 1GNHA 4UW5A 1PZ7A 1W6OB 4BMBA 4XILA 2CWMA 2DU0A 1AXKA 4Y1ZA 4AGRA 3IMNA 3M2MA 1NXD1 1W0PA 2YZ4A 2DVGA 4AVSA 1N3PA 5DUVA 3B01A 2AH2A 2D3SA 2YY1A 4P9XA 3V0BB 1O4ZA 4BLIA 3U4XA 1CVNA 1S0DA 4XBLA 2PELA 1GZWA 3RRDA 3WDXA 1RIRA 4YGCA 3WVJA 5DUXA 1G9AA 2JECA 2D44A 5GLUA 1C57A 2P3KA 5IT6A 2AR6A 1LOGA 3WG3A 5CB7A 1GBGA 1GYKA 5GZGA 2AENA 1ENSA 2CL2A 1HQWA 3OY8A 3RG0A 3RSJA 3ILNA 1DQ6A 3TB0A 3INAA 3PJQA 4DS0A 2DVDA 2V5YA 1WUVA 1W6NB 4XTMA 2VY0A 4XE9A 3AZYA 3QLQA 2WNEA 2XG3A 2A5ZA 1JYCA 3W58A 3NV1A 4FPYA 1ENRA 4CTEA 2GMPA 5JOXA 4YW3A 2ENRA 2GNMA 1AJKA 2CTVA 3ASIA 3ILFA 4YG0A 1H30A 4YG6A 2WSVA 1SLBA 1IKQA 2FMDA 2V73A 3ILRA 4LBKA 4Y20A 1VIWB 1JBCA 3FLPA 3T1MA 1KDMA 1WBLA 5GZCA 4R9BA 3Q9OA 3WG4A 1YRZA 4XOGA 4XMIA 3N7LA 4BQ1A 2DTYA 3D4KA 4GKXA 2P3IA 3POYA 3JUUA 1DYPA 5GLTA 1AX0A 3VKMA 4M3CE 1GLHA 4LBMA 1LHWA 3B3QE 3VKNA 4WVWA 5T55A 2OUHA 1AXYA 3O5SA 1SACA 3FBYA 1ZA4A 2A6WA 2WKKA 1X50A 3IKWA 4XJ8A 2LALA 4YW1A 5CBLA 1HLCA 5IK8A 5KXEA 3A4UA 3WHUA 1V6LA 1KRIA 1RITA 2G4IA 4HL0A 1LHNA 1ENQA 3LSEA 3ZXKA 5E89A 4K1YA 4Q26A 4ZKTB 5DXDA 1CR7A 1LGCA 3MPPG 1VAVA 2AGSA 1LESA 1W6PA 4M00A 1WW4A 2A3WA 2E53A
chains in the Genus database with same CATH superfamily
5FJHA 3I3QA 3FN9A 5IAVA 2EIDA 1MQTA 1TNRA 4MGZE 4XFHA 5LK7B 1MS1A 1O8PA 1HB1A 2MEV3 1W2NA 1C8M2 4XFCA 3RMXA 5A33B 1YQ2A 1GV9A 1LODA 2ERFA 3MW2A 4P14A 4A41A 3MIFA 4Z1VA 2R1BA 4GQ7A 1NY72 3WUDA 1RC6A 1YO8A 2E7TA 2RDRA 4N53B 1CAVA 2QQLA 2HWB2 4HPKA 3ZXGA 4Q4W2 1OMIA 3GGLA 1SBFA 1Q56A 5A7WA 4BHPA 4LUKA 1A34A 5H9PA 1PVC2 4TYSA 4GWMA 4H14A 4Q4Y2 1COV2 1FNZA 1OFSA 2BWAA 3OB8A 4QU1A 2WAAA 4GWIA 4RS5C 1PO11 5IWFA 4CCDA 1UU4A 2E63A 3ZXFA 4FPLA 3M3IA 3SC7X 4UWDA 2YFZA 4CEYA 3C8XA 1R082 1RXGA 2XUEA 3C2UA 3ACFA 4OVEA 3VHNA 1JHJA 5IVJA 2D6MA 3BALA 3ZXLA 3POEA 2PHRA 4P9LA 2Y8KA 3DXUA 4Q8KA 2W46A 5FMDA 3UJQA 3I59B 3AP5A 5IHRA 2GAUA 5LBBA 4CA9A 2JG9C 3W5NA 4JC1A 1OHFA 1DQ1A 1MVQA 4NWVA 4YW7A 1RUG3 5E16A 4ASLA 4LULA 5FZ4A 2VXJA 1JW6A 4A7KA 4CSWA 4XPVA 3U78A 4CEWC 5FYCA 2HWE3 3ES4A 1UX6A 2CGOA 2FBEA 1MVEA 2UY8A 3RZKA 1OF3A 3T09A 1V70A 5T5OA 3ZOIA 5I0RA 1A78A 3ON7A 4PT6A 1ZBA1 4QPIC 4RSUA 3U14A 4QKDA 4Y22A 2KXLA 4S2GA 4AEDB 4BCUA 1C8NA 2K2SA 4K21A 1C5HA 1YIPA 3ZIXA 1N47A 1SBDA 3GALA 1Q8OA 3VBSC 1G9DA 3IIAA 1W6MA 4XBNA 4CDXA 5KXCA 1DQ0A 1VMHA 1RUJ2 4ASKA 3IB3A 1VBD2 1D2QA 5EYYA 3WF0A 4F83A 1VRBA 2VQAA 1DLLA 4HMZA 4X6QB 3I49A 4G3YC 1IS4A 1BXHA 1J3PA 3WR0A 1ZBA2 2D6PA 1PO13 2VMEA 4Q0SA 3UL2A 4BPZA 3KB5A 4YLZA 4NMIA 1LU2A 1HRI1 3WEZA 3B00A 4K40A 5JSRA 4K9SA 1WA4A 4CCJA 2WT0A 3ZKUA 5BNOB 2KM2A 3DYPA 3JQXA 1AXZA 3LAGA 5LWBA 2VZQA 5AC91 1VBB2 2RVAA 1W8OA 3OD0A 4D6SA 4FPCA 2GMMA 4YVSC 3NO8A 3I3BA 4IEXA 3LFIA 5JLVA 2ZBJA 1XU1A 3ME2A 2BUKA 3HN3A 1F5FA 1DQ4A 1XU2A 2FDJA 2JKXA 2A1XA 3DPRB 3GXUA 4IV3C 4K1ZA 5FP8A 3OG2A 4A7ZA 4DY5A 4L99A 4QQ2A 2VNVA 1LKNA 4URAA 3OGVA 3S5AA 5JZGA 3AZXA 1LOCA 1R081 1BQPA 4LKEA 5CZKA 4CPBA 4OI0A 1CAWA 4FVVA 2WNOA 2DYCA 1LOFC 3N7JA 1XYOA 5C4WB 3LCPA 4IERA 4LBQA 4CPBD 5FZMA 3VHRA 1COV1 5GALA 1S0IA 1G6NA 3KQ4B 1GU3A 1PNFA 4Q4Y1 2QDNA 5BNNA 3MBWA 2JJ6A 2WT1A 1HIXA 5D2AA 1H9PA 4LLFA 1PX4A 3DECA 1OH3A 4GH4C 4IGQA 4OHZA 1NE4A 3P6BA 2XQXA 3T2QA 1OLRA 2GC0A 3G7DA 5A6XA 1SMVA 5K7PA 4IQPA 2A6VA 4G4FA 5ACA3 2VAUA 3UJOA 5FIXA 5FY5A 2H6BA 1G9CA 3QD6A 2ZHNA 5FZEA 4YVSA 5GJ6A 3VBRB 4XJZA 1MS0A 3LSDA 3LZZA 5LZ6A 1PZ9A 2XJSA 4QB1A 5HV4A 4SLIA 4WVMB 5A1FA 5EJ1B 5T5PA 2VUCA 5BNNC 1URXA 3NNMA 2DCYA 2PAMA 2ZGSA 5L36A 1VE0A 2ZGNA 1G7YA 2XKOA 1R64A 2YU2A 1K5MA 1T6GC 5FO7B 3UT0A 5KHJA 1HKDA 4XFBA 5F5IA 3SMHA 3ZFGC 3AL5A 2IVJA 1HRV2 2RMU2 4AI9A 4M0NA 1BK0A 1S0FA 3OYWA 4AGVA 3GCXA 1MR5A 3WNMA 3KCCA 1FMD3 3UK9A 3ELNA 4LLOA 5FYZA 5FOBB 5A3NA 4B8EA 1H2LA 3H42B 4AI3A 4BQ4A 2VOTA 3J4UH 5L7OC 2ZGKA 1US2A 3FFZA 5F3IA 3BTXA 1ZBE1 3HN1A 2FDFA 2W9XA 5T54A 3POWA 3WDWA 1UMHA 4DY3A 4GKYA 1QWRA 1FATA 1YFUA 3NWKA 5DDJ2 2ATFA 1HJFA 5ACA1 5CKNA 2PLV2 3MHZA 4QQLA 4LK6A 4QGLA 3CJIA 1QJZA 2YV8A 4FPEA 4JV4A 3V65A 3V56A 3VLBB 5FO8B 1ULEA 1XE0A 3NNJA 3K2OA 1ZVFA 1C4RA 1H2KA 4QM8A 3VDCA 1QH7A 3E6BA 2CDOA 3WCSA 5SV5A 2DTWA 1GANA 4FAHA 2QQIA 2VZVA 1PK6A 1I3HA 2EXJA 2PHFA 2WZR3 3I2JA 2A70A 1IS6A 3HWJA 5C9AC 1QJU2 4LIVA 3FUQA 1CPNA 1TNFA 2WWSA 3LDBA 2QQJA 5CIRA 2Q1FA 4Q4V1 1AL23 3VV1A 3S6PA 1W2TA 4BA6A 1W8NA 5DUWA 1DFQA 2XJRA 2BNNA 1DQ2A 2B42B 3BODA 1IQAA 3TEZA 4B1LA 4ZONA 5A6YA 1SPPB 1N1TA 2OIIA 4LO6B 4RYDA 1HV0A 5FZ9A 3SEEA 3SLIA 1AR73 4A42A 2XJQA 1CX1A 1WD4A 5FMOL 3IMMA 2W95A 4EYUA 3VBFA 1KD7A 4U36A 5FCCA 1LRHA 2O8OA 2LW8A 5FYUA 2GC1A 1ULDA 5IK4A 1PIV3 3JB8A 1YXWA 1VMFA 4JGYA 4K8FA 3MIDA 3PVEA 1ULGA 4I0BA 3KCXA 3T30A 1X36A 5I8TA 3PU8A 3RWKX 2XH6A 1H8TA 4M3CF 3WW2A 5GZFA 4MYEA 3IZOA 4ES8A 2HYKA 4N43B 1AYN2 4B4PA 3RDIA 3NQHA 5CVRA 4P9YA 1M06G 1NCQB 4XETA 2IXKA 5BNPB 1RL3A 2ES3A 4J1WA 5F3GA 3PLQA 4PBPA 4B1MA 2JX9A 1X9PA 1W9FA 5F2WA 3C7EA 1AYM2 1ZBE2 1CN1A 3DKWA 2WNUB 4YGBA 2WNVC 1Q8QA 1XYNA 2WZR1 1QY4A 4IV1C 1BYHA 1VLNA 1AR93 2QKDA 1VPHA 5FZCA 3VDDB 5BNQA 1YFYA 3EO6A 3T4VA 1PVXA 2I07B 2ZEYA 4X8PA 1TMF2 4NIDA 2R063 5EHDA 2RMU1 4AVAA 1XNTA 2D6LX 5HBAA 2ADEA 4XYXA 4YNIA 5C70A 2TUNA 4EWEA 1AR91 4CP9B 2BNMA 3I2FA 1WLDA 1TEIA 1JOJA 2FCVA 1YWKA 5T50A 4BQWA 2KD7A 2ZACA 1S2KA 4LOSA 3A7QA 4NROA 5APAA 5DPNA 4K20A 2D43A 4FI9A 2W68A 3O1MA 4KGGA 1O5LA 3BTZA 1N3QA 3OOXA 2WRAA 4UFMA 2RS11 1OKOA 2ARBA 5JXJA 2AACA 2YPDA 2VTXA 4DNYA 4FQ4A 2JDPA 4IE5A 3FX3A 1QJX2 2GN7A 1FMD1 1IG3A 3WW3A 5CAZA 5J09A 4IW3A 3RZHA 2WFF1 2ZGUA 3N7KA 2GN3A 1S1AA 4BJ0A 5I91A 3ZSLA 1ND3C 4J1XA 2BJSA 4FOWA 4GB31 4IV1A 4S2DA 3WF2A 1RUF3 3ZFFB 2XBO3 1QH6A 2RG4A 4QQHA 2DCZA 4NN0A 4ATEA 4BZ4A 1UY0A 4KL1A 4DXRA 3DN7A 5HPOA 3WDYA 5CEHA 1X82A 2J1SA 4CZSA 1J83A 3TN92 3K51A 1H9WA 4PQ9A 1EYBA 3GBWA 1HRV1 3KV9A 4R8HA 1W8UA 1LCLA 2EVXA 1IQDC 4H3WA 4HVOA 4I2OA 5IFPA 2ZPXA 3BIWE 3NV3A 4DRRA 4EJRA 2NP0A 3TEYA 1OPOA 2YMZA 5FY0A 3WW1A 3ZXJA 1RXFA 3EQEA 4QX8A 2VZPA 4YGDA 3LIGA 4ASMB 3H8XA 3R4SA 4PIYA 4RHV3 4EE2A 3CU7A 1O3RA 5T52A 4P00B 4GALA 4UF0A 4CCEA 4E4SA 4XXPA 4NOTA 1F15A 2FZ1A 1AR63 2WQZC 4JGZC 1MS3A 4GA9A 5JIUA 2K46A 4OLLA 4QX2A 4I0AA 1QXJA 4META 4COYA 4WM7B 1UZYA 3BCWA 3DKQA 5I0UA 5JUVA 1VJ2A 3IIIA 4IE6A 4V2WA 1CD3G 4UW3A 4DUVA 1O4YA 3OGJA 5J37A 1NKGA 1R083 2NN8A 1RUF1 3LA3A 1UXXX 3N36A 4EV0A 1EY2A 3BN6A 4KWKA 2W87A 4CEYC 1VBA2 1NLRA 5JDBA 4ITCA 2BVVA 4YPJA 3WF1A 4XJ9A 1DGWX 1KQRA 3AZVA 3ZR6A 2XHKA 3D3AA 1QDOA 1DU3D 4A4AA 2XB6C 3MF6A 3ZFEC 3AKTA 3ZDSA 3ORJA 1BKZA 1PIV1 4H2AA 5FMBA 2B46X 5JSPA 1RUOA 4HK8A 3E1F1 1BCXA 1PM4A 1MACA 3AP9A 4ZY9A 5DG1A 3WNKA 4CCCA 1GOGA 2P34A 2VNGA 1CZVA 3E97A 4XCAA 2B8MA 1GZWB 1RINA 1ST8A 3PUAA 2UURA 5ISLA 2EAKA 2ET7A 1V6IA 3V0BA 3NJZA 1S0EA 1UU5A 1CX4A 2Z79A 4UF0B 5H9QA 2WIIB 2B4KA 3C3VA 1RUD2 1ZX5A 1W6OB 4BK5A 1NZIA 4KG0A 3EYPA 4JTNA 3H3UA 4B3NA 3KF5A 1MEC3 3PL0A 4IE7A 3E5UA 4Y1ZA 3EBRA 1NA1C 1W0PA 4JKLA 1OD3A 2YZ4A 3VZLA 1RUC1 1N3PA 2HWC1 4OI1A 2BPA2 3KMHA 3B01A 4P9XA 2DCKA 3V0BB 1FPN1 5EPAA 3KWVA 5FZ1A 4AQ2A 3U4XA 4BXSV 4LKSA 1H1IA 2WN3A 1ZBA3 3ZFEA 1RIRA 1SQ4A 2DF7A 4YGCA 1OC1A 3WVJA 5DUXA 4LTAA 1Y3TA 2JECA 4QMAA 1WZXA 3GZUC 3P3PA 5IT6A 1W8FA 2AR6A 2WNVB 3WG3A 5FO9B 4D94A 5CB7A 1GBGA 2CL2A 3EHKA 1TQ5A 2YYOA 1PVC1 1D7PM 4Q0VA 2PN5A 1DQ6A 5G04L 3PJQA 4DS0A 4AE2A 5FPZA 1OA3A 1W6NB 1WUVA 3RI9A 3ROUA 3QLQA 4ZZ5A 2XDVA 2Y0OA 4AI8A 1PVC3 3H8OA 2WFF3 2WS92 1W8WA 1COV3 2GMPA 4YW3A 2GNMA 4YG6A 2WS91 2W47A 4OUSA 4Z2AA 2Y6HA 5F39A 1IKQA 1SLBA 2V73A 4TN7A 3LEIA 5LBEA 1Y9GA 3VBUC 3FLPA 3T1MA 4PDWA 2PQQA 4QKBA 2OS2A 2X5IC 4CP9A 2QQUA 4OZOA 4XMIA 4XOGA 1OT5A 5L9RA 5DAWA 4BQ1A 1SFNA 2DTYA 3FJSA 1S55A 1BEV3 3JUUA 1DYPA 5F3CA 3MPBA 2R072 5JI7A 2VZRA 5F2SA 4QXKA 3O5SA 4OHVA 1AR83 2LALA 1HLCA 2MPFA 4AFBA 1L7RA 3WHUA 1V6LA 5FPLA 1R1A1 2V5DA 1EAH2 1LHNA 3ZXKA 4JQTA 3W21A 4NPLA 4Q26A 3UGHA 3WXPA 4A3ZA 1CWPA 2P3YA 4FBFA 5M0TA 1YI9A 1LESA 5A6ZA 2ZHLA 2W3JA 1H8TB 3SHRA 4IDZA 2VUDA 2F4PA 3N4MA 2VH9A 2W1WA 1IZ3A 4J6GA 2J1TA 4ORFA 4CU8A 4KWUA 1GMMA 3K75B 3GYDA 2JKBA 2Z4FA 2W1QA 1HRV3 1CIWA 2QQOA 2EIGA 3W20A 2VCMA 2VM9A 4MXWB 3T1LA 4YZ5A 2WNVA 3LE0A 1N1VA 5GLWA 5FP7A 1ULPA 3NAPC 5A3MA 1XXNA 1ACCA 3O1OA 5FZHA 2VO5A 3KT4A 1RJ8A 2VPVA 1C5IA 1V9U1 3CHXA 5TSWA 3TYJA 3UGGA 5JXHA 1JZ3A 4HONA 3TEXA 1AX1A 1SBEA 1LOBA 1W8HA 3VL8A 2QTWB 5FY4A 4AXOA 3RYRA 2OZ6A 2WA4A 3UYJA 3B9CA 4DXZA 3ZDVA 5A3TA 3SCFA 3BYWA 2R16A 5FTTC 4Q4X2 4MOAA 2XONA 3MDPA 5A80A 2AEYA 1KITA 1DHKB 2VZSA 1SCSA 5JIAA 2VVEA 1CGPA 2VMHA 4Q1RA 1AJOA 2JXAA 4QPYA 1A3KA 2FDGA 3OUJA 3OPZA 4CDQA 1EV13 1ND3A 3BPZA 3RZLA 1X7NA 4BE3A 4Y4YA 3HT2A 2JDUA 4CXYA 2UU8A 2QNKA 4QB6A 4F8AA 1DQ5A 2RS13 3ZSKA 3BOWA 3LWCA 2Y6FA 2L9LA 1EV11 4QD2A 3ZPOA 3HQRA 2ZGMA 3A0NA 5F37A 4WVVA 4S2HA 5HCBA 4LBOA 2HBTA 3J8F2 3SEPA 2Q0AA 4ZU7A 2MEV2 4LK7A 4D69A 5FPBA 3M3CA 2B9UA 1TG7A 2NYYA 2VW1A 2YBSA 4PJYA 1AR72 4XAEA 1IPJA 3FUOA 4EROA 3PIJA 4Y5SA 5IW0A 2QCSB 1ULOA 2DBNA 3PHMA 4O61A 4QXBA 1J84A 2NMNA 1B09A 4QX7A 1QF3A 5ANNA 5FYBA 2VVFA 3I7DA 3I4IA 4R52A 1MEC1 5CFDA 2IFRA 1LULA 2Q1ZB 1JYNA 2H0BA 2JDKA 4QDQA 3ZSMA 1BMV2 5T5LA 4CUBA 1O59A 2XVKA 4OFGA 5FLJA 3IPVA 1JYIA 3AFGA 2XJPA 4LUMA 1QJX1 2GP3A 3ZFEB 1KS4A 1VRH3 2R30A 4LHKA 4AEKA 4B29A 2WUHA 1UOFA 5D8AB 1AHSA 2DBIA 4QDSA 2CV6A 3BPSA 5H9RA 4AHYA 5B2GB 4BB3A 1RUH2 4IV3B 3D6EA 1NX9A 2FZ2A 2ZAAA 3RZGA 2FD8A 3GZEA 4RS5B 1IOAA 3PJYA 3CIHA 4E8CA 4AVTA 4MXWA 4EWDA 4ZXEA 1AR92 1W6OA 3OBRA 4Y5TA 2O1QA 2ZGLA 3MLJA 3OPTA 1OQEA 5T5JA 5CFDC 4IEYA 1OUSA 3WINE 2XL9A 1TME3 4ZU4A 4LBLA 1DGRA 3QBQA 4LHLA 1QJY2 2A3YA 2OQ7A 3RZJA 3H7JA 4UFJA 1OBNA 5CNAA 2SBAA 1MS4A 4AVBA 2RV9A 3MIGA 1S0JA 1RUNA 2RS52 3O7OA 5JXIA 1TME1 2EALA 3H50A 5EQUA 1UY1A 4AEJA 3NJXA 4QQPA 5FFOC 3M7AA 3VKFC 5EJZB 1YUDA 1S0CA 3K46A 4XDQA 5FZGA 1V0AA 1E5HA 5K4LA 4OZXA 4CP1A 1PMIA 2X53S 5A3PA 1NA1A 1BEV1 1RYYA 4MO3M 3VHPA 3P5BA 5L7OB 1O3QA 2XJUA 5I0TA 3AM2A 1NCRA 5C33A 3CKHA 4B4RA 1QDCA 5DQ0A 5JOYA 3B7MA 5CFCA 3BOPA 2G9ZA 1EPZA 4QHOA 1VBE3 1GP6A 3SQOA 1ZRIA 3P1IA 3Q8CA 4NAMA 4AG4A 1W90A 2VZ1A 1QIQA 3AMHA 4P5HA 2PFWA 4UW6A 5FZAA 4FFFA 4WM7A 4HLTA 2BU9A 4IEQA 4WVMA 5FXXA 1FYUA 1OOPB 1RUC3 4PDWB 2FDKA 1KJRA 3H8RA 1GSLA 3UV9A 3D5OA 2GNDA 3H1WA 4KI5M 3KM5A 4Q4W3 4CDWC 4QPWA 4YZ4A 1LHOA 4RHV1 1XC6A 5ABJC 1H4GA 2W91A 2FCUA 2UWBA 2VE1A 1K12A 2WWJA 3T3YA 5IAXA 3TNQA 4Q4Y3 2J7MA 3AKPA 2VMDA 3Q8AA 3VD9A 3ATGA 5LY2A 2FDHA 2W08A 4INDA 4JDOA 4FCAA 5B4XA 1WMEA 2JG8C 3VZOA 5DMYA 5EXOA 3R05A 1JYXA 1J3RA 4EN8B 3ACIA 3OGGA 4Y22B 1MS8A 1AYN3 4CCKA 1U5ZA 2JDZA 4MADA 5EYXA 5CADA 2FMYA 4FPFA 4DUXA 1LAJA 5CISA 1XRUA 1GZ9A 5FYSA 2VBDA 5K8SA 5LK5A 1X9TA 2VCAA 4UFKA 2K9ZA 5KC6A 2P3JA 1W9TA 1UAIA 1UMIA 2XLGA 2ZX4A 2A6YA 5FDBA 1QQP3 4LMFA 2JDNA 5JWPA 2YBPA 4LITA 1XB9A 3I97A 2I2SA 2PLV1 2AC1A 1UMZA 2IXIA 2R062 4XDOA 3AVSA 4XUNA 1CIYA 5C3QA 2WBKA 1F4AA 3FHAA 1XE8A 2CGPA 2VOXA 2FQPA 4GJYA 4I0WB 3M8LA 3U1XA 5J36A 4MG2A 2ZX1A 3EJKA 4AR2A 4Q27A 1J58A 1LENA 1ZZCA 1W06A 4WV8A 4RD7A 2R0FA 3WNXA 1C1LA 2W92A 2XXZA 5FLIA 5EIYB 1IPSA 3KS7A 4HOOA 2W94A 1UOBA 4Y26A 3AMQA 3ALQA 5E6HA 5JMCA 1H6YA 4UFLA 1PK6C 4ZU5A 2JB8A 5A7OA 2VTXJ 3CJIB 3MI8A 1O3SA 3PVOA 2GH8A 2HJIA 1LHUA 1HB3A 5DG2A 2P2KA 2ZXQA 1POV0 3HBKA 1VBB3 1JYVA 1JMUB 3CZJA 4UBHA 1UPIA 5DZEA 2R49A 1W9WA 2CY6A 2PHDA 2ZTNA 1WLTA 4GULA 4XBQA 2R042 4YWAA 3N9PA 5D1IA 4I02A 1IS3A 5JAXA 2VZOA 2JDYA 1CJDA 2CSGA 3D8CA 3OYWB 4PLOA 1YFWA 2J1RA 1FAYA 3N3HA 1K5MC 2VJXA 4Q4V3 4QT6A 1OVPA 5KXDA 1VAKA 1ND3B 5CG8A 3IM0A 3VBHC 4Z92B 3B69A 3BU7A 5A3LA 1JUHA 4NRMA 3POBA 3VHOA 1WW5A 4FPJA 4FO9A 4NHKA 3PUQA 1R092 2JENA 5FZ8A 3PNAA 1RUI3 4XTPA 5H9SA 5FREA 4UXAA 4BQXA 1RUG1 4NPRA 3RS6A 2AEZA 1JYTA 2QQVA 5BY5A 4C90A 5ACA2 1YJKA 1F2NA 4K8RB 2W2IA 3H7YA 2DFCA 3HT1A 2UWAA 1VBA3 1RHI2 1DZRA 3V0AB 2D7FA 3ETQA 3FBMA 2JICA 2QFEA 2PMWB 4Y1YA 3JU9A 3ZMOA 3ZXEA 3PTYA 4O65A 5JPNB 3ES1A 5LCWL 2E9QA 4B7EA 2Y60A 4FOQA 4PQQA 4UYBA 4LKFA 1EUUA 4RL7A 4FT8A 3NJVA 3WP5A 2A75A 3AJYA 3PURA 5C4WA 1LGBA 2VECA 2YG0A 3OBZA 2JB4A 3H3ZA 3HEIA 4ATFA 1PGW1 1VBE1 2A6ZA 3SKJE 3T0AA 5JZGB 2YGLA 1REFA 3Q8BA 2E32A 4Q5OA 3L2YA 5JR7B 1UN1A 3OGRA 1AYM3 2WJSA 1R1ZA 4GMP1 1CQ9A 1MZEA 4I3PA 1RTVA 1YFXA 4WZCA 4YW4A 4RQPA 1H0BA 3N9NA 5E1RA 4LO5B 2WSUA 3GZTB 4XIKA 2GH2A 5EZWA 2TEPA 5GZDA 1RMU1 2VZUA 3LPFA 3BTAA 4O7XA 1ZRFA 5FZFA 5IYYA 3WG2A 3AFKA 4QB2A 3OUHA 3AKQA 2PLV3 1PX3A 2D6KA 4H7LA 5GKAC 5DAQA 1JZ6A 2XLFA 3T2PA 3U75A 1XYPA 2AZ5A 1K5MB 5IJRA 1H8TC 1UL9A 5F1RA 1SDDB 1ULCA 3E5QA 3J7LA 2P1BA 4FFGA 1NLSA 1F5JA 2HWD1 4NVPA 3RVHA 5BNPA 5IUQA 4AHXA 4CCOA 1SCRA 1PHMA 4GB33 2AREA 5HCAA 4J25A 1JOBA 3VBOB 2Q8CA 1Q5OA 4YFZA 3VZMA 5JSOA 1QJU3 5LA1A 2ARCA 3MIHA 4YZ1A 3F2ZA 4Q0PA 4GXLA 5IVEA 1MS9A 3GM8A 1OSGA 2VW2A 4KU8A 2ZAHA 4JAAA 4P9IA 2YXSA 4RGGA 4AEMA 3WNPA 1NA1B 1PGSA 3WP6A 3J8F1 3O1RA 1UNBA 4RGKA 4FPKA 1QOTA 4MXVA 4QGMA 4PDWC 2ZCWA 3K3OA 1W04A 2Q1MA 1EV12 3D82A 2G9FA 4XFFA 5FLHA 3FWEA 4JGZB 4XF9A 3M70A 4HT1T 1GQGA 3MW3A 5FXZA 5LBCA 3SH3A 4CCMA 4CRQA 5KBFA 3KHBA 5BNNB 1OLMA 1XSRA 5IK5A 4HKOA 2ZGQA 3LEMA 5DZGA 4N53C 3CNAA 3PVBB 2XWJB 5I93A 3Q8FA 2GNBA 4DFSA 1QKQA 3K48A 1W99A 3MV01 1AR61 3PMSA 1OLME 5FZDA 4BQ5A 1RMU2 5BXXA 1H2MA 1LNSA 2XHNA 5HCHA 3M2MA 1E5SA 4NHMA 4LE3A 1YQCA 3ZYGA 5FZIA 2DVGA 2KR2A 5LW9A 2JIGA 4OUEA 1OUXA 2XVLA 2ADDA 4GH4B 1HQNA 4CEYB 1POV3 5A32A 2RM21 3LPGA 1SDWA 2F17A 2O8QA 4XBLA 4DIQA 1K42A 1V9U2 2PELA 1BVVA 1GZWA 3RRDA 4IE4A 4D8MA 1U12A 1G9AA 2VCBA 4WBBA 2VGDA 4NIGA 5GLUA 5FWJA 2PXJA 1C57A 1OOPC 2HEYF 2P3KA 3D0JA 3MIBA 1W0NA 2VC9A 2RR11 4HXCA 2D5HA 5GZGA 1ENSA 1RHI1 1AUYA 3JZVA 4LIUA 3SCHA 4COUA 4EN7B 4FFIA 1HB4A 4HN0A 4OHXA 3RSJA 3ILNA 3THTA 4BIFA 1ZRCA 2R6QA 3INAA 4JVAA 2V5YA 3ACLA 4XTMA 1RUE3 3RPQA 2VY0A 2P4EA 3AMPA 2VQTA 2XG3A 3WP3A 4AFMA 3UKTA 1K45A 2R32A 4CUCA 3HJRA 4CTEA 5JOXA 5FZKA 1AJKA 2CTVA 5IVYA 2BZDA 4JDMA 2WWUA 3ILRA 2Z69A 4LBKA 1JBCA 1KDMA 4JZRA 1KFUL 3I2OA 1Y9MA 1YRZA 3ZSEA 4ET7A 5FY9A 3D4KA 1POV1 3CLPA 2K0GA 2P3IA 2RDQA 1NAEA 1FPN3 4IXLA 4RGAA 1DLCA 5GLTA 3RNSA 2BERA 3HAGA 3ZYHA 3U11A 4BK4A 2W0XA 3RI8A 2HEVF 2G9GA 3B3QE 4WVZA 5T55A 4HSLA 1ENXA 4FAGA 5L9VA 1RUF2 2A6WA 1X50A 3CO2A 3IKWA 3NSTA 2JE8A 4MX3A 5I8SA 2PQSA 1UQXA 5IK8A 1ODMA 3A4UA 1UY4A 2RJLA 2Y33A 3I3DA 4L0PA 4OHWA 2DDUA 3DPRC 2G4IA 2YPJA 3H3LA 1ZZBA 2ZX0A 4ZKTB 3MPPG 3TN93 1VAVA 2PYTA 4EN0A 1W6PA 1CZSA 4M00A 5FPXA 2A3WA 1GWMA 1RUE1 2E53A 4EWAA 1H4HA 1ONAA 1NXMA 1RJ7A 1NT0A 4XABA 4AFAA 1R1A3 1SZBA 4IEWA 1Q8PA 4XZUG 3SXWA 5F5CA 2MHFA 2ET1A 4LHNA 4GMP0 4Y1XA 1Z7S3 4JGYB 2X8KA 2EXKA 4KG8A 4UOJA 2HWF1 2WN2A 3QH7A 2BGCA 1J59A 4IV1B 2VMGA 3PMEA 2BDRA 4N90A 3KLSA 2WL1A 2YHJA 5BYNA 3I2IA 2DVFA 2ZABA 2HLEA 1JUIA 3GCWA 2WS93 1UOGA 2D6OX 5AVPA 3WDTA 2DV9A 1UO9A 3MFAA 4XFGA 2JDMA 3KV5A 4AVCA 1UKRA 3VBHA 1OFNA 3AP7A 3POFA 4N9IA 5D8AA 1IG0A 2CAVA 3B02A 1CAXA 1HDKA 2GSYA 2Q8DA 1JOPA 3L2HA 1VRH2 3VGIA 3WF3A 3IPVB 4YFWA 4HFSA 1LJ7A 4XVHA 1ZZ7A 4E8DA 1LU1A 2AUYA 3BIEA 2R061 5FBZA 2QZ2A 1JHNA 4IESA 2ETEA 2PHXA 1J1TA 3JBG2 1RUH3 4X8NA 1UY2A 3VDDA 3AXEA 4Z8BA 1SLCA 4PF1A 5FZ0A 4ARYA 4K7JA 4RR3B 1N3OA 2J1EA 1OD5A 2VQ0A 2VZ3A 1LR5A 1UZZA 2ILMA 5HCFA 3UGFA 3FFQA 3SNMA 2SLIA 3ENRA 3OGSA 2VOWA 1QGLA 5CFCB 1BVP1 5JI9A 2BW8A 3IDAA 1LOEA 1AX2A 4C0BA 4CDXB 2DUQA 4FP3A 4X6RB 4Y1UA 4MLOA 2GC2A 4UW4A 4YW2A 1NCRC 3O1UA 4PLMA 5FKBA 3HMYA 3OF1A 3AB0A 1OQDA 1UYXA 2WYFA 3HD8B 2ZGTA 1XNBA 3POJA 1JZ5A 1UYYA 4UFIA 5BV6A 1FT9A 2RS53 3PTRB 5D8AC 4Q8LA 3RJRA 3I54A 2Y34A 1MEC2 4BDVB 2G1MA 2ZEXA 1UKGA 3WCRA 3K4DA 3VBOC 2VU9A 1W6NA 4YW5A 3LIHA 5A7QA 4YVWA 4O9GA 4E9KA 3FZ3A 1QNYA 4KBZA 2D97A 1G9FA 5A1LA 4CYDA 4HG6B 1YQ8A 2ZMNA 2XKPA 4MGSA 4C1WA 2LM3A 4BLJA 5FZ6A 1PM7A 3T08A 1DCSA 4IEPA 3MFCA 3SKVA 5IFTA 2EA7A 1U0AA 5F6KA 2FHRA 4PHZA 4XF0A 4IV3A 5KC5A 4Q2FA 3THDA 1S4CA 4A6OA 3B93A 4HZFA 2NMOA 2X5IB 3KF3A 3MV11 3RGBA 5AC92 2DVBA 4NIIA 1YHFA 4XW3A 3AX4A 3VBRA 4FXGB 2V09A 4JRLA 3TAYA 2IXJA 4DB5A 5HV0A 1W6QB 2R043 2EIEA 5DDJ1 2VW0A 3UKVA 1AVBA 1N1SA 1LHVA 1UYZA 3N7MA 3WNOA 2FCTA 2OYZA 5J96B 5CFDB 1CAVB 2RS51 3K4AA 2GALA 5DAPA 5AVAA 1UWWA 2D6NA 3AK0A 1PK6B 2PA7A 1HJGA 3NNGA 4A2UA 2OPKA 1WCQA 1WA6X 2WNUA 2XOMA 3VDAA 4D7YA 2GP5A 5A33A 2ZX3A 1LOFA 1RUJ1 2RM22 4QPIA 3J8F3 1CAWB 4XQWA 1VB4A 2R073 4D7TA 2KA3A 3HQUA 4AFDA 4CE8A 4XQDA 2BOIA 3O0VA 1WLCA 1M4WA 1XQNA 2HWF2 3LOIA 4K6BA 3ABZA 3M3OA 5IVBA 1DGLA 3VD5A 1Z0HA 2QE3A 5BPXA 5FZLA 2RE9A 2I45A 2P37A 1W0OA 4DINB 1IPKA 4YG3A 4AYUA 5FOJB 4M01A 2CAUA 3LB9A 2VUAA 4JDNA 4NJ4A 3EMRA 3LEKA 4CDUA 2XJTA 4CUAA 2BBAA 4NO4A 3E6DA 3WDUA 5DUUA 3T2OA 3FLTA 3GDBA 5GLZA 1UW8A 3FC0A 5BUVA 4MV2A 1H8VA 3J7HA 5DAVA 3O0WA 1OOPA 1BMV1 4DQAA 4EZ4A 4XJUA 2BP6A 2WZPP 4W4ZA 4AGGA 4AWDA 2LRPA 2A7AA 3UESA 4Q0UA 5FAXA 1JS9A 4OI2A 1AR71 4OUMA 4P9GA 4PBOA 4TZDA 3J7MA 4UFHA 1APNA 3CEWA 4A7YA 3ZKYA 1FXZA 4BQ2A 1ZRDA 1S0BA 5C71A 2UWCA 1NCRB 2ZGRA 4LOTA 4EQVA 3HPNA 3GJBA 3G6JB 4YVSB 5FYHA 3C7FA 3O14A 5L7OA 4FTEA 2RDNA 4YW6A 1DDLA 2CNAA 1Q8VA 1OA2A 2VTFA 2JG8B 4FPOB 1GQPA 1JTZX 4I30A 5FUNA 2D40A 4E2GA 1UD1A 5EWSA 3WV6A 4CXXA 3O1SA 2PHUA 2QQKA 1ZREA 1GP4A 1XOYA 2OX0A 4LBNA 1GQHA 2BQPA 4Y33A 5F5AA 2N7GA 2VBPA 1OF4A 2Q30A 2VBBA 1ZYBA 2OW4A 3WY6A 1NY71 5CU1A 3LFMA 4L97A 1VBB1 1XJAA 2OA2A 1YQ6A 3DYMA 2NLRA 2QJVA 3ZYIB 4FP2A 1VBC1 4XDPA 2EXHA 2GDFA 4P9WA 3IAQA 1SG3A 1RVF1 3PVNA 2BOJA 1W8TA 1YNAA 1MZ6A 2ZZQA 5JVVA 2VVDA 3HQXA 1W6PB 1LOAA 1SLAA 1W05A 2OZJA 2RR12 4FFHA 3I59A 3U0ZA 2C0ZA 4JRAA 4QX3A 4XC9A 5C6CA 3AZWA 4YYOA 3WLUA 5FZ3A 3DPRA 1YLLA 1PGW2 1RVF3 4IGOA 3N9LA 5IVFA 3VL9A 3ZYBA 5C8CB 3UKNA 1R093 4PF5A 1AF9A 1GWLA 3K3NA 1BJQA 2MNGA 1WBFA 3NV4A 3TWIA 3ZSJA 4BOWA 2RS33 4D0QA 1XPWA 2P6HA 5F3EA 4AVVA 1U5IA 1QJU1 4QX5A 4CEWA 3IDBB 3LGRA 3OBTA 3WUCA 3I2KA 4CDQC 1UXZA 3AMMA 4GZ9A 5FP3A 3VZKA 4RN5A 1DP0A 2BV4A 2CHHA 2IXHA 1PMHX 3H0OA 4HK9A 3E6CC 2VNRA 3N9QA 1SLIA 2C9KA 2BGPA 5ERLA 4Z2WA 4P08A 3BGAA 2A73B 2DUOA 2X29A 4FQZA 5IATA 5CKMA 3VBRC 1EUTA 2PHTA 2UY9A 1WCDJ 2WZ8A 1BLZA 3ZR5A 1EAH1 2E6VA 5L73A 4CU7A 5F5QA 5BNOC 2WQ8A 2IC1A 3H8UA 2ARXA 1UX7A 2YUEA 1QQP2 4CDXC 2JWPA 2R071 3W5MA 1Z78A 4LBQB 2WABA 5FUPA 1HXS3 1QNWA 2GNTA 1S2BA 3IDCB 4GMP3 1WW7A 5A70A 4LA3A 5GLVA 3U4SA 4JKKA 1H1AA 2YBKA 4OCTA 4WM7C 1CZTA 3RYPA 1H2NA 2WO3A 3ZYRA 5C3RA 3S0MA 1LEMA 4L2NA 1J1LA 1I5PA 1I5ZA 4XACA 4YM0A 1Y43B 4AI0A 1QJY3 1HXS1 1OA4A 5KHGA 4Y3OA 4CXWA 2F4LA 2XLAA 1MS5A 3WQ1A 1X8MA 3SISA 3AJZA 5I0SA 5LATA 5C8CC 1O3TA 3S7EA 4CDUB 4Y20B 5FQ0B 1FOD3 2Y6GA 4PLNA 5EFUA 3WT3A 2P5BA 3HR9A 5FPVA 4DZGA 1C28A 3S5QA 4HN1A 3THPA 1HQLA 2JG9A 4QWNA 5LY1A 1VBC2 4IUGA 3TOJA 2ZZJA 2QVSB 1CAUA 2YDEA 1KGYA 1CONA 1VP6A 3ZFFA 4YSFA 3VUOA 4GWNA 4KBBA 2G19A 5C3OA 1XE7A 2Z42A 5C3SA 1ASJ1 1FX5A 1QOSA 5FXVA 5LEKA 3O1VA 1ZA7A 3DEMA 1D4M1 1VBE2 2QZ3A 2IVIB 2ZJCA 2CWSA 5KHKA 4B4QA 2EAAA 4R9CA 1GP5A 3OEAA 2C9AA 2RDSA 3RMYA 4FOYA 3BUCA 3H1YA 3AKRA 4BH9A 1ASJ3 2WO7A 1RUC2 5C5UA 5FY7A 2B5HA 3OPWA 4AK3A 1BZWA 4DEQA 1QQP1 2ZGPA 3NKGA 1GZCA 2HWD2 4AEDA 4OQ9A 1KDKA 1VALA 3HBZA 4RA0A 4ISRA 4V2VA 1LTEA 4QKFA 5LASA 5CBLA 2HWC2 1YC61 4Q1PA 1N1YA 1OPMA 2VMIA 4E2SA 3URFA 4QDRA 2BGOA 1MZ5A 2D3PA 1ND2C 2VOKA 4N8MA 2WINB 1AL21 2X5IA 2GMEA 4LQRA 4AQSA 2C24A 4NUBA 3LA7A 1JU4A 2J22A 1L3JA 4CDQB 1HN1A 3A0KA 3ETPA 3FLRA 4QPGA 1CJPA 3WD5A 2BNOA 2X10A 2QQPA 1JODA 2XJVA 1FOD1 5FZOA 3S7IA 1DYKA 1RUI2 1EPWA 2NPIA 3KGZA 1BBT3 2D5FA 4S2FA 4UT5A 1UYPA 4HANA 5A3WA 4JGYC 3T2TA 4EN6B 5A7NA 1E5IA 2XVGA 5CYYA 2XGXA 4FXKB 3ZFGA 4COZA 2QUOA 1VBA1 3R6SA 3C7GA 1B35C 1W3XA 1RHI3 3R0RA 3WOGA 4A44A 2ZMLA 2WO1A 1YEWA 2JE9A 4HKLA 2DU1A 1PMJX 2YB7A 3KT7A 4YM2A 4YGEA 4TLFA 4AAXA 5HI0A 2PTMA 5F7UA 2W52A 2ZHKA 1JU3A 1IGOA 3ACGA 3OY8B 4XHXA 2EIBA 1AYM1 1LGNA 1UCXA 5L9BA 4CP2A 5B4NA 3VBFB 4HPKB 1V6MA 5FK7A 3DV8A 2BRTA 3APBA 1ULFA 3TRSB 1YI7A 3HIFA 1QXRA 1DIWA 1YIFA 3M3EA 4KGQA 2PAKA 4W6XA 5FP4A 4Y1VA 3WQ0A 3U37A 3AYCA 4LEJA 4XCBA 5K0UC 1MQTB 3T0DA 2LROA 4OHYA 2DUPA 4R9AA 4UW5A 2R7EB 2RS31 4BMBA 4UI9L 3U10A 5AFBA 2HYXA 2CWMA 2DU0A 4AF9A 1UU6A 4E4ZA 5I0DA 4AGRA 1STMA 3KV6A 1Y4WA 1PO23 4CU9A 1NXD1 4EN9B 4N43C 1OH4A 5DUVA 5HXVA 2YY1A 1OURA 3H9AA 3BI3A 3DXTA 4Q29A 1RGSA 5JZGC 4DEVA 3VBHB 2OKXA 1QJY1 1PO12 1T2XA 2Q8OA 5BNOA 3JD72 3MGUA 3OTFA 4EZHA 2C1FA 2D44A 3ZN4A 4CVUA 4KWLA 5DAXA 5EP9A 1W28A 1LOGA 4QAWA 2X05A 1GYKA 4GB32 4WM8A 4DMIA 1ZRRA 3OY8A 2BYVE 5LRRA 3HNBM 1Z7S2 3TB0A 3IAPA 4Q4V2 4Z82A 2Y6JA 2DFBA 2DVDA 4MGYE 2JDAA 4RQPC 4ZS3A 2WNEA 2XBO1 2RJ2A 4HVQA 5JCTA 3NV1A 1ENRA 3CQOA 1BK1A 3FHIB 3ZO0B 4W50A 1D4M3 3ASIA 4YG0A 5FBJA 1H30A 2Q4SA 3CZUA 2FMDA 4MGIE 3H1MA 1VIWB 4NHLA 5CFCC 1WBLA 4LNVA 4R9BA 3Q9OA 4CUGA 2QQWA 3JB4C 4AL9A 4D6RA 3N7LA 4M4RA 1W2OA 4UBGA 2E31A 1W8ZA 4GKXA 4E27A 2RM23 3OD4A 2B39A 1VRH1 5HXMA 4HSJA 3VKMA 1RMU3 2XWBB 3AVRA 4LBMA 1O7FA 3VBUB 5ANQA 1LHWA 4BYYA 4CCLA 1OLQA 2HBUA 2WLPA 4LKDA 1KS5A 4NPMA 4ZZ8A 5ABJA 5BNPC 3ZN6B 1JZ4A 1QJFA 1AXYA 4N7UA 4ZHNA 3FBYA 4XUTA 1REEA 1ZA4A 2WKKA 4XJ8A 3PUSA 4YW1A 3NNLA 3ZMNA 4QX1A 2Y26A 5KXEA 1GOFA 4GWJA 1RITA 1KRIA 3I3EA 3U07A 1ENQA 2PHLA 3OSDA 1DF0A 3RZMA 5E89A 1CR7A 1LGCA 2AGSA 4XILA 2C4XA 4E4DX 1G8WA 3GNEA 1XSQA 2VQUA 1VR3A 3AMNA 1W03A 4IGPA 5FP9A 4CDUC 2NM1A 5F9TA 3CJIC 1KFXL 2VOVA 4TWTA 3POSA 3NAPB 4YRDA 1BBT1 4KNCA 2A71A 4IEOA 4IEVA 3VB9A 4KH9A 1IS5A 3MUY1 5DN2A 1O6UA 3S30A 3VBFC 5KHHA 1FI2A 4QU2A 3DUIA 3O1TA 3IDEA 1PGL1 4LORA 2ZMKA 5JPMB 5LA2A 4M3CB 5FUIA 3NAPA 2VUJA 5FMCA 1PNGA 2IFWA 4QXHA 2W5FA 5FMOS 1HRI3 4IE0A 4SBVA 5E8AA 1K5JA 2WLQA 1TZOA 3ZYFA 4CP0A 5AFEA 2VZTA 3CMGA 3Q8EA 4B7KA 1W2AX 5AC93 3RJ2X 3ZFFC 1X33A 1UIKA 4NR1A 2B45X 4BU2A 4FSJA 4RR3C 3HOBA 4A45A 4I3GA 4XJWA 1RUI1 3P3NA 4L9BA 1V6OA 2CDPA 5FWEA 3SITA 2C6SA 2CU5A 4GAZA 5J7MA 3DCQA 3MLLA 3MO4A 4MGTA 4I09A 4W8JA 4R4XA 3AP4A 2WO2A 3T4HB 1OKQA 4NIAA 4HETA 1Z7S1 1OI6A 2Y0IA 1SHWB 3W59A 3W9AA 2ZKNA 5FR3A 2PHWA 5K0UA 2P17A 3AYDA 4QHZA 3USUB 5JXGA 2C5DA 4YM1A 3EB7A 1TE1B 3JBG1 1XNDA 2EICA 3V0AA 5FYYA 1JZ7A 3ZX7A 4OYUA 3ZN6A 2JG8A 1Y7BA 1SFPA 2Q5TA 1NZCA 2NZ9A 1C8M3 3VBSB 2VMFA 3FMGA 1L7QA 3KT1A 2ORZA 3SH4A 2JE7A 2PAEA 3J7NA 1NQDA 3POIA 1F4HA 2HWF3 1GFF2 5D21A 1WW6A 3JXSA 5E88A 2R0HA 4GD4A 4XF4A 3NRUA 3ZFGB 2IWGB 3OJBA 1JXNA 4XIOA 1JZ2A 2XQRA 1DBNA 2ZHMA 3GJAA 3I2HA 1ZM1A 1IKPA 1Q43A 3NVCA 4O9EA 1JYWA 1V9U3 3KHCA 2VXRA 3UNPA 4I01A 4CEWB 2ORXA 1O91A 1W9YA 5A3UA 1F8VA 5LA9A 3MF9A 1RUH1 2LS6A 2HKXA 4LO7A 4DPNA 1Q8SA 4NRPA 4RS5A 5FRAA 3R4UA 4COWA 1V6JA 3J26N 4BXFA 5L19A 3B5LB 5FZ7A 3MW4A 1F35A 3GHNA 1V6NA 2OXBA 3PU3A 4JHTA 4W6YA 3LEGA 2WDBA 2W1UA 3LDRA 4WM8C 3ZN5A 1ODNA 3OEBA 2JD4A 1RUE2 4RQPB 4YZ3A 3WHTA 3MEPA 1G9BA 4DXSA 1JN2P 5EV7A 3LQCA 4UAPA 4RFT0 5CG9A 4YVWC 5FPAA 3WP4A 5J48A 4CCNA 1E5RA 5LRSA 2JIJA 1GWKA 4XFIA 1UZVA 4XMAA 1W9SA 2QQMA 2HWE2 4D7SA 2YC4A 2DWRA 4NE9A 3ZXAC 2YFUA 5C4WC 1S0GA 5I8YA 5DDJ3 4NHXA 4Q0QA 1KJLA 1LEDA 1D0GA 1UOJA 2WT2A 5T3NA 3WSOA 4C0HA 5IVVA 2OPWA 2E26A 2YROA 3CBNA 3IN9A 3LKJA 1FPN2 3M1HA 4FOVA 3UETA 5IK7A 4FPHA 3ZPYA 4JQRA 2QBXA 1T6BX 1J3QA 1GZTA 1QU0A 3M3QA 4LBQD 1FOD2 1XBFA 4LO4B 2UYAA 3AL6A 1C1FA 2ZGOA 1NCQA 1B35B 1CAUB 1VBC3 2IXLA 1RUJ3 3L9JT 3NW4A 5FZBA 3I3MA 3R4DB 1D0HA 3KQRA 4AQ6A 1RUD1 1VBD3 1REDA 3K77A 2X09A 1P8JA 1SFYA 2A6XA 1AL22 2CGNA 4JHZA 4JKMA 5J3UA 3VDDC 1MQTC 5GM0A 5FXWA 3RZZA 5DABA 1QXPA 1GNZA 2Z2SB 3ZYPA 1GNYA 2ID4A 5FYMA 4BISA 1I1EA 1WMDA 1TVGA 4RFRB 4V1PA 3WNLA 4XJAA 1R1A2 4CU6A 2CYFA 1WCKA 3ZYJB 1R091 3B9IA 1GOHA 1YQ5A 4Y24A 2WQ4A 4KWJA 4PIXA 2YU1A 1SPPA 4MZUA 2HWB3 4YZ2A 2ZEZA 4AI1A 2XPJA 3GBGA 4F3JA 1UIJA 2D3RA 3CL1A 3CJXA 2LUWA 1K3IA 3KD4A 4QKNA 1QMJA 3WDVA 1MZFA 3KVBA 3USSA 1POQA 4F7ZA 2JD9A 2XMLA 4XZPA 5J98B 1QOOA 2BBVA 3VZNA 2B7YA 5CA6A 1NG0A 1XNAA 4ZXKA 1PGL2 4QPIB 4IEZA 4BM8A 3QOPA 3ST7A 4NWWA 1EP0A 1LB2A 1X8EA 1U5YA 1KEXA 2AYHA 4L92A 2BEOA 5F8PA 1AR62 4N53A 3O1PA 2DCTA 2DCJA 2LTNA 4NIHA 3JBG3 1GICA 4M4PA 1SLLA 2EF6A 3BU0A 1RUG2 1GKBA 1HX6A 2YC2A 1HXS2 3GHMA 3HNMA 4XEZA 3WX5A 4RR3A 4ONUA 1SEFA 2O0OA 2HEWF 3AYAA 3JQWA 4QX0A 1D2SA 4E2QA 5FKCA 2E7QA 3I2GA 3AP6A 4XF1A 5F6LB 4LBJA 4L8QA 2BTVC 5G05L 4QGNA 1FNYA 3VKLA 1S2EA 4G9SB 4BWOA 1CAXB 3KZ4C 1DZQA 4XAAA 1FV3A 2XL7A 3WQ7A 2HWE1 3EXUA 4KMQA 4ZPIA 4Q4W1 4E4HA 2GZWA 2V4AA 4M3CA 2HWB1 1WMXA 2R041 1ZNPA 2RMU3 3RQ0A 3BB6A 4JTOA 1WLWA 4ZS2A 1FMD2 3MZHA 3ACHA 5KXBA 4TLGA 1ZZ8A 1E57A 1V00A 3DGTA 1C8M1 3IWZA 5A7SA 1XNKA 2D93A 4A3XA 5JOZA 3QH6A 2V72A 3J9SA 2DVAA 3ECQA 3C7HA 2Y64A 4C1XA 1ND2A 1KXGA 1VAMA 4NRQA 4WZFA 1DGRN 1F31A 2QQNA 2VCCA 2C26A 2XBO2 3FHQA 3I8TA 3NV2A 3OUIA 1Q3EA 3GBFA 1DYOA 3MIEA 5DZFA 4GIQA 1O4TA 5LBFA 1A8DA 1WMFA 4LT5A 5FK8A 2V4VA 4YARA 2HH9A 4MHRA 4Y4RA 4COVA 4DUWA 5C5TA 5A3OA 2RHPA 2DURA 4URTA 3QACA 4AZZA 4IEUA 3X29B 1A6CA 3USUA 5K0UB 1G86A 1O5UA 1NUKA 1PO21 3TNPB 1YCIA 4KU7A 2OVUA 2WZR2 3LF7A 3RFRA 3AZZA 2B9VA 1US3A 3M4FA 4RHV2 2OUJA 3OCPA 1FV2A 3RYKA 2W39A 4LHSA 1DG6A 1QEXA 5FV3A 1QJEA 1RVF2 2A3XA 4LA2A 4AHWA 3MICA 4AW7A 5C9AA 3RWNA 5JR2A 3N35A 2TBVA 4Y5Z0 1GR3A 4D6QA 2VULA 3SCGA 3SH5A 4MSVA 4AHZA 3BTYA 4ISQA 3WNNA 1YJLA 4KQ7A 4MH0E 5LB6A 2RS32 1BBT2 3A21A 4LE4A 1HB2A 1I9RA 1JI6A 5C8CA 2WC2A 2VR4A 2GU9A 4XF3A 5C8WA 3KV4A 4BQYA 1NCQC 4DRVA 4AI2A 2EXIA 1BEV2 2ZA9A 4XQ4A 4JX0A 3WZ1A 2UYBA 2VNOA 3VD4A 1UZWA 1PIV2 2F6BA 2BFUS 3A23A 4H7MA 4L11A 4XHBA 1HN0A 5GZEA 3CF6E 3HVDA 1JH5A 3MYXA 5A7WB 5SV8A 1F9KA 2VMCA 2J1UA 2WNUC 2VG9A 5K9YA 3FL7A 1AR82 3WG1A 1OXCA 3QCWA 1HW5A 1NOVA 1H1MA 2OQ6A 4TXWA 5C3PA 1W6MB 2R1DA 2ARAA 2JG9B 5A1AA 1EAH3 4MUVA 4FTSA 4P02B 3VBSA 4JCKA 4R9DA 1WCSA 3DYOA 4U2AA 5A6QA 4PI2A 5FQ0A 3THCA 4MVTA 3AYEA 1OQ1A 3MLKA 4AQTA 5A7PA 2WA3A 3O0XA 4BQ3A 3WF4A 4AAPA 1W6QA 1WKYA 4FPGA 2H0VA 2YC0A 3CDZB 3PDQA 1A8MA 4PIZA 4QHBA 3ZVXA 4BMEA 5C9AB 5LA0A 5FYTA 2VL4A 5ABJB 1AL0G 2RJKA 4OQ8A 2WYSA 1NQJA 2IZWA 3POGA 4P9JA 3S57A 4FTBA 4LR4A 3VBUA 1MPXA 1SLTA 5FYVA 3T0BA 4W6WA 1TMF3 5EJ3A 2YGMA 3PUIA 2H6CA 2E51A 2O14A 4A6SA 3HNYM 1WD3A 1LECA 2ZOEB 2J1VA 3JD73 4N9HA 1AZDA 3VDBA 1UY3A 4DOUA 2XUMA 3TBDA 1CESA 2XR4A 3PIGA 3TN91 3FE5A 4YVWB 3KVAA 1Y9QA 5JMOA 2ZS6B 1H6XA 3NMBA 1RB8G 4ES9A 1W2UA 1PZ8A 1ZZ6A 3AKSA 2IXCA 2RR13 3ZIWA 4D3WA 4DO0A 4QQOA 1ND2B 2P6CA 4H55A 3O12A 1JZ8A 3VD3A 1W3VA 4LJHA 4OMCA 4XXAA 2E7AA 4PCRA 3WW4A 3VBOA 2WFF2 2WFPA 3LD8A 4YM3A 4LO8A 3VN4A 1D4M2 3PUHA 4OI4A 4CDWB 3AXDA 4GJZA 1CPMA 3NJYA 4IL7A 3TEWA 4QM9A 3V64A 4PI0A 1O8SA 4MHUA 1WWYA 2OT7A 4P5YA 2RS12 1YYNA 3BVCA 5FZOB 1C3HA 4OULA 4QPGC 4K3UA 5CKQA 1UZ0A 4W65A 2GC3A 5A32B 1UPSA 2WAOA 1V6KA 5FYIA 5FY1A 4GH4A 2HWC3 3IBMA 5JOWA 1GNHA 2VD7A 2W1SA 1PZ7A 2ZKLA 5KWRA 4XFAA 4N7IA 3E5XA 3VD7A 4TTGA 1GUIA 1AXKA 3MUZ1 3ITQA 3IMNA 4TSVA 4C91A 3D0SA 1TMF1 1UF2C 2BWCA 2ZEWA 1OVSA 4AVSA 1DGWA 4DXTA 5J1XA 4HVRA 2AH2A 2BVBA 1D4VB 2D3SA 4Q4X1 3C7OA 5F32A 1O4ZA 4BLIA 4LPLA 2FDIA 3B94A 1CVNA 1S0DA 3JD71 3NNFA 3N9MA 3ZM8A 3WDXA 3LDKA 1VB2A 2NQYA 3I2DA 4R4ZA 4BIOA 3BKZA 3IT8A 2ZX2A 1IHMA 1QHDA 2QDRA 5FPUA 1ZBE3 4JGZA 1AR81 4OMDA 2Y38A 2Z5WA 5KR7A 3ZLIA 3KSCA 4ARXA 2AENA 1HQWA 1DZTA 2MEV1 3GZAA 2WZEA 3RG0A 1AYN1 2TNFA 5LEJA 3F95A 4XUQA 3OBAA 4CDWA 4NHYA 4AOCA 2I74A 3AC0A 3DF0A 4XE9A 3AZYA 4MGKE 1NE6A 4N43A 1WGPA 2A5ZA 2BFUL 3A22A 1JYCA 1VMJA 4QXCA 3W58A 4FPYA 2Q8EA 4Z07A 5KHIA 2ENRA 3ILFA 4AEDC 3GF6A 1L7LA 1U5XA 2WSVA 3WQBA 3JCIA 1NLQA 4HKWA 2D98A 4C8DA 4Y20A 1HRI2 4IETA 2Y6KA 5GZCA 3WG4A 4WM8B 1ZZ9A 4HBNA 1TME2 4XUPA 4XUOA 3ZXDA 1ALYA 2IUWA 4AFCA 1BHGA 2WR9A 4Q4X3 3POYA 4MGQA 1QJX3 3K4ZA 1RUD3 1VBD1 1AX0A 4NAOA 3LOBA 3KCYA 4M3CE 1GLHA 1NYWA 3NKTA 4QPGB 5FJKA 3VKNA 4WVWA 2JEMA 2OUHA 1PO22 1SACA 4M0HA 1WCUA 5FY8A 5IVCA 1I6XA 4LXLA 3VZJA 3NL1A 1ASJ2 2JDHA 1W39A 2E33A 4HL0A 1XNCA 2Y6LA 1B35A 2J1AA 3KGLA 3LSEA 3DL3A 3N9OA 4K1YA 3LA2A 4XURA 2HWD3 1HV1A 5DXDA 2J42A 3VKOA 1WW4A 5C7GA
chains in the Genus database with same CATH topology
1MQTA 1TNRA 4MGZE 4XFHA 5LK7B 1MS1A 2MEV3 1C8M2 4XFCA 3RMXA 5A33B 1GV9A 1LODA 2ERFA 3MW2A 4P14A 4Z1VA 3MIFA 2R1BA 4GQ7A 1NY72 3WUDA 1RC6A 1YO8A 2E7TA 4N53B 1CAVA 4HPKA 2HWB2 3ZXGA 4Q4W2 1OMIA 1SBFA 1Q56A 4BHPA 4LUKA 5H9PA 1PVC2 4TYSA 4GWMA 4H14A 4Q4Y2 1COV2 1FNZA 1OFSA 2BWAA 4RS5C 1PO11 1UU4A 2E63A 3ZXFA 4FPLA 3M3IA 4CEYA 1R082 3C2UA 4OVEA 3VHNA 2D6MA 3BALA 3ZXLA 2PHRA 4P9LA 4Q8KA 3UJQA 3I59B 3AP5A 2GAUA 2JG9C 4JC1A 1OHFA 1DQ1A 1MVQA 4NWVA 4ASLA 1RUG3 5E16A 4LULA 1JW6A 4A7KA 4XPVA 4CEWC 2HWE3 3ES4A 1UX6A 2CGOA 2FBEA 1MVEA 2UY8A 1V70A 5T5OA 5I0RA 1A78A 1ZBA1 4QPIC 4RSUA 4Y22A 2KXLA 4S2GA 4AEDB 4BCUA 1C8NA 2K2SA 4K21A 1C5HA 1YIPA 3ZIXA 1N47A 1SBDA 3GALA 1Q8OA 3VBSC 1G9DA 3IIAA 1W6MA 4XBNA 4CDXA 5KXCA 1DQ0A 1RUJ2 1VBD2 1D2QA 5EYYA 4F83A 2VQAA 1DLLA 4HMZA 4X6QB 4G3YC 1IS4A 1BXHA 1J3PA 3WR0A 1ZBA2 2D6PA 1PO13 3UL2A 4Q0SA 4BPZA 3KB5A 4YLZA 1LU2A 1HRI1 3B00A 4K40A 5JSRA 4K9SA 1WA4A 2WT0A 5BNOB 2KM2A 3JQXA 1AXZA 3LAGA 5AC91 1VBB2 3OD0A 4FPCA 2GMMA 4YVSC 3NO8A 4IEXA 5JLVA 2ZBJA 1XU1A 3ME2A 2BUKA 1F5FA 1DQ4A 1XU2A 3DPRB 4IV3C 4A7ZA 4K1ZA 4DY5A 4L99A 4QQ2A 1LKNA 5JZGA 3AZXA 1LOCA 1R081 1BQPA 4OI0A 1CAWA 4FVVA 2DYCA 1LOFC 3N7JA 1XYOA 5C4WB 3LCPA 4IERA 4LBQA 3VHRA 1COV1 5GALA 1S0IA 1G6NA 4Q4Y1 1PNFA 5BNNA 2QDNA 2JJ6A 2WT1A 1HIXA 1H9PA 4LLFA 4GH4C 4OHZA 1NE4A 1OLRA 2GC0A 3G7DA 5K7PA 1SMVA 4IQPA 2A6VA 4G4FA 5ACA3 3UJOA 2H6BA 1G9CA 3QD6A 2ZHNA 4YVSA 5GJ6A 3VBRB 4XJZA 1MS0A 3LSDA 3LZZA 1PZ9A 2XJSA 4SLIA 4WVMB 5T5PA 5BNNC 1URXA 2DCYA 2PAMA 2ZGSA 5L36A 2ZGNA 1G7YA 2XKOA 5FO7B 5KHJA 1K5MA 1T6GC 1HKDA 4XFBA 3SMHA 3ZFGC 2RMU2 1HRV2 4M0NA 3OYWA 1S0FA 4AGVA 1MR5A 3KCCA 1FMD3 3UK9A 3ELNA 4LLOA 5FOBB 4B8EA 1H2LA 4AI3A 3J4UH 5L7OC 2ZGKA 3FFZA 1ZBE1 3HN1A 5T54A 3POWA 3WDWA 4DY3A 4GKYA 1QWRA 1FATA 1YFUA 3NWKA 5DDJ2 2ATFA 5ACA1 2PLV2 4QQLA 4QGLA 3CJIA 1QJZA 2YV8A 4FPEA 4JV4A 3V65A 3V56A 3VLBB 5FO8B 1ULEA 1ZVFA 1C4RA 1H2KA 4QM8A 1QH7A 3E6BA 3WCSA 5SV5A 2DTWA 1GANA 4FAHA 1PK6A 1I3HA 2EXJA 2PHFA 2WZR3 2A70A 1IS6A 3HWJA 5C9AC 1QJU2 3FUQA 1CPNA 1TNFA 2WWSA 5CIRA 4Q4V1 1AL23 3VV1A 3S6PA 4BA6A 5DUWA 1DFQA 2XJRA 2BNNA 1DQ2A 2B42B 3BODA 1IQAA 2OIIA 1N1TA 4LO6B 1HV0A 3SLIA 1AR73 2XJQA 1WD4A 5FMOL 3VBFA 1KD7A 4U36A 5FCCA 1LRHA 2O8OA 2GC1A 1ULDA 5IK4A 1PIV3 3JB8A 1YXWA 4K8FA 4JGYA 3MIDA 3PVEA 1ULGA 4I0BA 3KCXA 1X36A 2XH6A 1H8TA 4M3CF 3WW2A 5GZFA 4MYEA 4ES8A 2HYKA 4N43B 1AYN2 4B4PA 3RDIA 5CVRA 4P9YA 1M06G 1NCQB 4XETA 2IXKA 5BNPB 1RL3A 2ES3A 4J1WA 3PLQA 4PBPA 2JX9A 1AYM2 1ZBE2 1CN1A 3DKWA 2WNUB 4YGBA 2WNVC 1Q8QA 1XYNA 2WZR1 1QY4A 4IV1C 1BYHA 1VLNA 1AR93 2QKDA 3VDDB 5BNQA 1YFYA 3EO6A 1PVXA 2I07B 4X8PA 1TMF2 2R063 2RMU1 4AVAA 2D6LX 5HBAA 4XYXA 4YNIA 2TUNA 4EWEA 1AR91 2BNMA 5T50A 1WLDA 1TEIA 1JOJA 1YWKA 2ZACA 1S2KA 4K20A 2D43A 2W68A 4KGGA 1O5LA 1N3QA 2RS11 2ARBA 4DNYA 4FQ4A 3FX3A 1QJX2 2GN7A 1FMD1 3WW3A 5CAZA 5J09A 2WFF1 2ZGUA 3N7KA 2GN3A 1S1AA 5I91A 3ZSLA 1ND3C 4J1XA 4FOWA 4GB31 4IV1A 4S2DA 1RUF3 3ZFFB 2XBO3 1QH6A 4QQHA 2DCZA 4NN0A 4ATEA 4BZ4A 4KL1A 3DN7A 3WDYA 1X82A 4CZSA 3TN92 3K51A 1H9WA 4PQ9A 1EYBA 3GBWA 1HRV1 4R8HA 2EVXA 1LCLA 4H3WA 4HVOA 4I2OA 2ZPXA 3BIWE 3NV3A 4DRRA 4EJRA 2NP0A 1OPOA 2YMZA 3WW1A 4EN7B 3ZXJA 3EQEA 4YGDA 4ASMB 3R4SA 4PIYA 4RHV3 3CU7A 1O3RA 5T52A 4GALA 4E4SA 4XXPA 4NOTA 2FZ1A 1AR63 2WQZC 4JGZC 1MS3A 4GA9A 5JIUA 4OLLA 4I0AA 1QXJA 4META 4COYA 4WM7B 1UZYA 3BCWA 5I0UA 1VJ2A 1CD3G 4UW3A 1O4YA 3OGJA 5J37A 1R083 2NN8A 1RUF1 3LA3A 3N36A 4EV0A 1EY2A 4KWKA 5JDBA 4CEYC 1VBA2 1NLRA 4ITCA 2BVVA 4XJ9A 1DGWX 1KQRA 3AZVA 2XHKA 1QDOA 1DU3D 2XB6C 3MF6A 3ZFEC 3AKTA 3ZDSA 1BKZA 1PIV1 2B46X 5JSPA 1RUOA 4HK8A 1BCXA 1MACA 3AP9A 5DG1A 2P34A 2VNGA 3E97A 2B8MA 1GZWB 1RINA 2UURA 2EAKA 2ET7A 1V6IA 3V0BA 3NJZA 1S0EA 1UU5A 1CX4A 2Z79A 5H9QA 2WIIB 3C3VA 1RUD2 1ZX5A 1W6OB 4KG0A 4JTNA 3H3UA 4B3NA 1MEC3 4Y1ZA 3E5UA 3EBRA 1NA1C 1W0PA 2YZ4A 3VZLA 1RUC1 1N3PA 2HWC1 4OI1A 2BPA2 3KMHA 3B01A 4P9XA 2DCKA 3V0BB 1FPN1 4AQ2A 3U4XA 1H1IA 1ZBA3 3ZFEA 1RIRA 1SQ4A 2DF7A 4YGCA 3WVJA 5DUXA 4LTAA 1Y3TA 2JECA 4QMAA 3GZUC 3P3PA 5IT6A 2AR6A 2WNVB 3WG3A 5FO9B 4D94A 5CB7A 1GBGA 2CL2A 3EHKA 1TQ5A 2YYOA 1PVC1 4Q0VA 2PN5A 1DQ6A 3PJQA 4DS0A 4AE2A 5FPZA 1OA3A 1W6NB 1WUVA 3RI9A 3ROUA 3QLQA 2Y0OA 4AI8A 1PVC3 2WFF3 2WS92 1COV3 2GMPA 4YW3A 2GNMA 4YG6A 2WS91 4OUSA 1IKQA 1SLBA 2V73A 3VBUC 3FLPA 3T1MA 4PDWA 2PQQA 2X5IC 4XOGA 4XMIA 4BQ1A 1SFNA 2DTYA 3FJSA 1S55A 1BEV3 3JUUA 1DYPA 3MPBA 2R072 5JI7A 4QXKA 3O5SA 4OHVA 1AR83 2LALA 1HLCA 2MPFA 4AFBA 3WHUA 1V6LA 1R1A1 1EAH2 1LHNA 3ZXKA 3WXPA 4Q26A 4FBFA 1YI9A 1LESA 2ZHLA 1H8TB 3SHRA 2F4PA 3N4MA 2VH9A 1IZ3A 4J6GA 4ORFA 3GYDA 2JKBA 1HRV3 1CIWA 2EIGA 4MXWB 3T1LA 4YZ5A 2WNVA 1N1VA 5GLWA 5A3MA 3NAPC 1XXNA 3KT4A 1RJ8A 2VPVA 1C5IA 1V9U1 5TSWA 3TYJA 1AX1A 1SBEA 1LOBA 3VL8A 4AXOA 3RYRA 2OZ6A 2WA4A 3B9CA 4DXZA 3SCFA 2R16A 5FTTC 4Q4X2 3MDPA 1KITA 1DHKB 1SCSA 5JIAA 2VVEA 2VMHA 4Q1RA 1AJOA 2JXAA 4QPYA 1A3KA 3OPZA 4CDQA 1EV13 1ND3A 3BPZA 1X7NA 4BE3A 4Y4YA 3HT2A 2UU8A 2QNKA 4F8AA 1DQ5A 2RS13 3ZSKA 3BOWA 3LWCA 1EV11 4QD2A 2ZGMA 3A0NA 4WVVA 4S2HA 5HCBA 4LBOA 3J8F2 2Q0AA 4ZU7A 2MEV2 4D69A 3M3CA 2B9UA 2NYYA 2VW1A 4PJYA 1AR72 1IPJA 3FUOA 4EROA 2QCSB 3PHMA 2NMNA 1B09A 1QF3A 2VVFA 3I7DA 3I4IA 4R52A 1MEC1 5CFDA 2IFRA 1LULA 2Q1ZB 2H0BA 3ZSMA 1BMV2 5T5LA 2XVKA 4OFGA 5FLJA 3IPVA 1JYIA 3AFGA 2XJPA 4LUMA 1QJX1 3ZFEB 1KS4A 1VRH3 2R30A 4LHKA 4AEKA 4B29A 5D8AB 1AHSA 4AHYA 5B2GB 2CV6A 5H9RA 1RUH2 4IV3B 3D6EA 2FZ2A 2ZAAA 4RS5B 1IOAA 3PJYA 4AVTA 4MXWA 4EWDA 1AR92 1W6OA 3OBRA 2O1QA 2ZGLA 3MLJA 1OQEA 5T5JA 5CFDC 4IEYA 3WINE 2XL9A 1TME3 4ZU4A 4LBLA 1DGRA 3QBQA 4LHLA 1QJY2 2A3YA 3H7JA 5CNAA 2SBAA 1MS4A 4AVBA 3MIGA 1S0JA 1RUNA 2RS52 3O7OA 1TME1 2EALA 3H50A 4AEJA 4QQPA 5FFOC 3VKFC 3M7AA 1YUDA 1S0CA 4XDQA 4CP1A 3V0AB 5I8TA 4OZXA 1PMIA 2X53S 1NA1A 1BEV1 3VHPA 1O3QA 5L7OB 2XJUA 5I0TA 3AM2A 1NCRA 5C33A 4B4RA 1QDCA 5JOYA 3B7MA 5CFCA 3BOPA 1EPZA 1VBE3 4AG4A 3AMHA 4P5HA 2PFWA 4UW6A 4WM7A 4HLTA 4IEQA 4WVMA 1FYUA 1OOPB 1RUC3 4PDWB 1KJRA 1GSLA 3UV9A 3D5OA 2GNDA 3H1WA 3KM5A 4Q4W3 4CDWC 4YZ4A 1LHOA 4RHV1 5ABJC 1H4GA 2UWBA 3TNQA 4Q4Y3 3AKPA 3ATGA 2W08A 4INDA 4JDOA 4FCAA 1WMEA 2JG8C 3VZOA 5EXOA 3R05A 1J3RA 4EN8B 3OGGA 4Y22B 1MS8A 1AYN3 1U5ZA 2JDZA 5CADA 5EYXA 2FMYA 4FPFA 1XRUA 1GZ9A 5K8SA 5LK5A 5KC6A 2K9ZA 2P3JA 1UAIA 2XLGA 2ZX4A 2A6YA 5FDBA 1QQP3 5JWPA 2I2SA 2PLV1 1UMZA 2IXIA 2R062 2CGPA 1XE8A 2VOXA 2FQPA 4I0WB 3M8LA 5J36A 2ZX1A 3EJKA 4Q27A 1J58A 1LENA 1ZZCA 4WV8A 4RD7A 2R0FA 3WNXA 1C1LA 5FLIA 3KS7A 4Y26A 3AMQA 3ALQA 5JMCA 1PK6C 4ZU5A 3CJIB 3MI8A 1O3SA 3PVOA 2GH8A 2HJIA 1LHUA 5DG2A 2P2KA 1POV0 1VBB3 4UBHA 1UPIA 5DZEA 2R49A 2CY6A 2PHDA 2ZTNA 1WLTA 4GULA 4XBQA 2R042 5D1IA 4I02A 1IS3A 5JAXA 1CJDA 3D8CA 3OYWB 4PLOA 1YFWA 1FAYA 3N3HA 1K5MC 4QT6A 4Q4V3 5KXDA 1VAKA 1ND3B 5CG8A 3IM0A 3VBHC 4Z92B 3B69A 3BU7A 5A3LA 1JUHA 3VHOA 1WW5A 4FPJA 4FO9A 4NHKA 1R092 2JENA 3PNAA 1RUI3 4XTPA 5H9SA 5FREA 4UXAA 1RUG1 4NPRA 3RS6A 5BY5A 4C90A 5ACA2 1YJKA 1F2NA 3H7YA 2DFCA 3HT1A 2UWAA 1VBA3 1RHI2 1DZRA 2D7FA 3ETQA 3FBMA 2JICA 2QFEA 4Y1YA 3JU9A 3ZMOA 3ZXEA 3PTYA 5JPNB 3ES1A 2E9QA 4B7EA 4FOQA 4RL7A 4FT8A 3WP5A 2A75A 3AJYA 5C4WA 1LGBA 2VECA 3H3ZA 4ATFA 1PGW1 1VBE1 2A6ZA 5JZGB 2YGLA 1REFA 3L2YA 5JR7B 1UN1A 1AYM3 2WJSA 1R1ZA 4GMP1 1CQ9A 1MZEA 4I3PA 1RTVA 1YFXA 4WZCA 4YW4A 4RQPA 1H0BA 5E1RA 4LO5B 2WSUA 3GZTB 4XIKA 2GH2A 5EZWA 2TEPA 5GZDA 1RMU1 3BTAA 1ZRFA 3WG2A 3AFKA 3AKQA 2PLV3 2D6KA 4H7LA 5GKAC 2XLFA 1XYPA 2AZ5A 1K5MB 1H8TC 1UL9A 5F1RA 1ULCA 3E5QA 1NLSA 1F5JA 2HWD1 4NVPA 5BNPA 5IUQA 4AHXA 1SCRA 1PHMA 4GB33 2AREA 5HCAA 3VBOB 1Q5OA 4YFZA 3VZMA 5JSOA 1QJU3 3MIHA 4YZ1A 4Q0PA 4GXLA 1MS9A 4KU8A 1OSGA 2VW2A 4RGGA 2ZAHA 4JAAA 4P9IA 2YXSA 4AEMA 1NA1B 1PGSA 3WP6A 3J8F1 4FPKA 1QOTA 4MXVA 4QGMA 4PDWC 2ZCWA 2Q1MA 1EV12 3D82A