3WOGA

Crystal structure plant lectin in complex with ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
238
structure length
238
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythroagglutinin
publication title Phytohemagglutinin from Phaseolus vulgaris (PHA-E) displays a novel glycan recognition mode using a common legume lectin fold
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wogA00
3D5OA 3BODA 4Y22B 1LOCA 4LBKA 4TYSA 2CL2A 5AVAA 1GZWB 1S0JA 1TEIA 4FOYA 4AGGA 2AUYA 3BIWE 4XIKA 3TB0A 3N7KA 5CB7A 2EXHA 2AH2A 4WZFA 2UURA 5CNAA 2ZGRA 3IKWA 2R1DA 3ZSJA 3D6EA 1WLDA 4XJAA 1WW5A 3ZSKA 5L73A 1LENA 1BJQA 2PHTA 5JMCA 4P9YA 4XHXA 2JDZA 2OW4A 2EXJA 3FFZA 4XXPA 3AJYA 3ZXLA 1GICA 1Q56A 4XJ8A 1WBLA 1V6NA 3AP9A 5JVVA 2NYYA 4Y1ZA 5JDBA 2DUOA 3A0KA 4RA0A 1ZM1A 1MS5A 2VW0A 1ENQA 2JECA 3GALA 1A3KA 1W6OB 3AK0A 5GM0A 1DQ4A 1R1ZA 5JOYA 4RL7A 4D69A 2CYFA 2DURA 1V00A 1LODA 2ZABA 3N36A 4YW2A 3V0AA 4JC1A 3IN9A 4WVVA 2C5DA 2ZACA 2EXIA 4XBQA 1IKPA 1DFQA 2EIGA 4M3CE 1LOFA 4K1YA 2CWMA 4XTMA 1LOFC 1VAVA 3VKMA 5JLVA 3Q9OA 1LEDA 4YLZA 2GN3A 1Q8PA 5DZGA 1MACA 1QMJA 1YIFA 2PHXA 3M3OA 1UN1A 3WHTA 4XJWA 4XE9A 3OYWA 4AWDA 4AYUA 1ULGA 1WW6A 3MW3A 3IPVB 4CZSA 4SLIA 3NV4A 4FP3A 1I1EA 4XTPA 4YG6A 1LHUA 2D43A 1LHNA 4GWMA 4AGVA 2W52A 4YGCA 5GALA 2GALA 4BPZA 2D7FA 4W65A 1GNZA 2SLIA 1HQWA 3RS6A 4XBLA 1N3QA 1SACA 3WDXA 3AXDA 1AVBA 3HN1A 4BQ1A 1Q8VA 3OBRA 3WCSA 1ULCA 1SCRA 1MS3A 3NV3A 1N1TA 1A78A 1SLIA 3WDTA 2LALA 3AYAA 3T1LA 1W6NB 1WW4A 2JKBA 1S0IA 2A6WA 1W6MB 4K20A 3ENRA 4XZPA 5H9QA 3LSEA 4Y24A 1AXKA 4FOVA 3AYCA 3B9CA 1CESA 4PCRA 4XMIA 4YZ4A 3ASIA 4JCKA 3APBA 3RSJA 4BM8A 5IK8A 1GZ9A 3OY8A 2DWRA 4XILA 3IM0A 3WZ1A 3B3QE 1U0AA 3O12A 1F31A 1KQRA 4ASMB 2ZMKA 3NWKA 4DS0A 3AZZA 2NM1A 4XJ9A 1NLSA 2W68A 3UJOA 1DGLA 1DQ5A 3AZWA 1N3OA 2WSVA 1AXYA 1KDMA 1G7YA 2PHUA 4PF5A 1IS6A 1W0PA 1FAYA 5DG1A 1W6QA 2WT0A 4XJZA 4PBPA 4PBOA 3POWA 3W59A 4FPHA 4GKYA 1LOGA 1D2SA 1JUIA 2AREA 1G9FA 3HR9A 4K1ZA 2DTWA 3MPPG 2RHPA 5DXDA 5CBLA 3SH4A 1KDKA 4DPNA 1LHWA 1QOTA 1G86A 5FREA 2A3XA 1RINA 2WNEA 3M1HA 4Y20B 1CONA 1DQ6A 3SNMA 5E88A 4CRQA 2ZGSA 5H9RA 3MW4A 4FPFA 3R05A 4ZXKA 2P3KA 2WQZC 5KXBA 2D6PA 5E8AA 3WDUA 1QOSA 1GBGA 1PZ8A 1AX0A 1DHKB 4GKXA 1ULDA 3AP5A 5CAZA 3ZVXA 2TEPA 4Q1RA 1G9DA 1I3HA 3QCWA 4L8QA 1QF3A 2ZA9A 2AENA 2NMOA 2YV8A 3H0OA 5DUWA 2DUQA 1LU1A 3WOGA 4FPCA 5KXEA 2CTVA 4WV8A 4XIOA 2VH9A 2OVUA 4FOWA 1YRZA 5FRAA 3SLIA 1B09A 2YY1A 1MR5A 1WD4A 2KM2A 3AYEA 1QDCA 3VV1A 3ZXEA 5BYNA 1JOJA 1W6PA 3ZXJA 1CPNA 2ZBJA 4YW4A 1HLCA 2NN8A 3W58A 5GLVA 2BQPA 2GNDA 1N47A 1SLLA 3RQ0A 3C2UA 5T50A 4DFSA 1N1YA 3AX4A 3SH3A 1DQ0A 1QU0A 2ZHLA 1GNHA 1H9WA 4Y1YA 2B7YA 2OUHA 5GZEA 4BMBA 4NO4A 3AZVA 4M3CB 2PHWA 4Q8KA 1CIWA 3R4UA 3N3HA 4OZXA 3SH5A 4YM3A 4YGDA 5DUVA 4YW1A 2EF6A 2ZGKA 3OJBA 2R0FA 2PELA 2DU0A 3LCPA 3VKNA 4FPLA 4FP2A 3WCRA 1DQ1A 3ZPYA 5IUQA 1IS5A 1GYKA 3DGTA 4JRAA 2DVFA 2WJSA 3N7MA 4Y1XA 3BOPA 3WG2A 4DRRA 1RIRA 1LGNA 4FPJA 3IMNA 2WT2A 1SFYA 3AZYA 1GV9A 1VLNA 3AYDA 2A3WA 1LGCA 3OGGA 2ZMNA 2YZ4A 3V65A 4GA9A 4ZKTB 1FNYA 1WW7A 2R1BA 4H55A 4DQAA 3FLTA 4BMEA 2A6VA 2XG3A 2LTNA 5HCFA 1GANA 3I8TA 4K21A 4YG3A 2JE9A 1C1LA 1Z78A 1O4YA 2ZGNA 2DTYA 1JHNA 2E53A 3WG4A 3WUDA 1ONAA 1WLCA 4HL0A 1J1TA 2D6MA 1S0DA 2D3RA 4Q26A 1IOAA 4FPGA 3O5SA 4Q1PA 2ENRA 4Y26A 1KRIA 1UPSA 1S0GA 3QLQA 4XJUA 2DVAA 5IK5A 5DG2A 1FV3A 2YXSA 2GNTA 2A71A 2SBAA 3I4IA 2W08A 2D3PA 2A75A 4CTEA 5GZCA 4FQZA 4LBQA 4LBLA 1LEMA 2A6ZA 1BKZA 2CY6A 1A8DA 3WHUA 1WUVA 1JW6A 1MS0A 2ZGOA 1HDKA 4BOWA 4FPKA 3R4SA 3N7JA 3V0AB 1JN2P 1LULA 1C1FA 1V6LA 4Q2FA 1CVNA 1O4ZA 1Q8OA 3PVEA 2D6NA 2ZGQA 2JJ6A 1V6MA 1G9BA 1CN1A 1XQNA 1ZA4A 3ZSMA 3T2TA 5EYXA 4XMAA 1AF9A 3RMYA 3PMEA 4YM2A 2A6XA 2WSUA 4GXLA 1JBCA 5H9PA 5GJ6A 3ZXFA 2P34A 4FPOB 3MW2A 1LESA 3WV6A 3B01A 2ZGTA 1S0FA 4YZ2A 2Q5TA 3USUA 3OYWB 4R9AA 2GN7A 3INAA 1VAMA 1OQ1A 4YZ1A 1GKBA 2ZGUA 1LOBA 5E89A 3ILFA 3N7LA 4YW3A 2WKKA 4TZDA 1ENSA 1Q8SA 3ZYRA 3POSA 2GMPA 3L2YA 4Y1VA 1S0CA 4M3CF 3WUCA 3M3QA 3POYA 2D3SA 5SV8A 1MZ5A 2D6KA 1QOOA 2ZMLA 3O0VA 3GNEA 1KJLA 2GDFA 3LSDA 4LBJA 2A70A 4R9BA 4ITCA 1YXWA 1IS4A 2HYKA 4Z8BA 1MVEA 1UMZA 1YO8A 2I2SA 3CNAA 4LBNA 2PHFA 4WVWA 3WDYA 3B69A 3MEPA 4Y22A 4LBOA 1GZWA 1RITA 1WCSA 1ENRA 2JD4A 3OY8B 1V6KA 2P3JA 4XOGA 4AVTA 5EYYA 4YZ3A 4DRVA 1UKGA 3OPZA 1QGLA 1ULFA 2GNBA 3AP4A 4HANA 1VALA 1AX1A 2FHRA 3N35A 5JOZA 1LHOA 1G8WA 1UX6A 5GLZA 1MS8A 1LOEA 2NP0A 4YM1A 2AGSA 3ZYPA 3AFKA 2ZHNA 1V6IA 1YI7A 3T1MA 4LBMA 5JOXA 5IK4A 3FBYA 2ZKNA 1MS4A 1JYCA 1W6QB 1SBDA 4UW6A 4FVVA 5EXOA 3AXEA 1N1VA 2VY0A 4FQ4A 2EXKA 4FOQA 1URXA 1WBFA 2GMMA 3PVNA 4GALA 2A3YA 4YGEA 5DUXA 4C1WA 1W6OA 2DV9A 5H9SA 5IT6A 3FUQA 1LECA 3U4XA 1LJ7A 2R0HA 2CNAA 3O0WA 4Q27A 3M3EA 1BZWA 4Y1UA 3BTAA 5GLWA 2DUPA 5GZDA 3AP6A 2YMZA 1DZQA 1G9CA 1DYPA 1S0BA 1X50A 2VW2A 4Q8LA 2EALA 2V73A 4XXAA 5CA6A 1W0OA 1N1SA 4YZ5A 3PJQA 1LTEA 1FX5A 4FPYA 3JUUA 5T52A 1BQPA 2CWSA 5IK7A 1C4RA 1UZYA 2DU1A 1Q8QA 3VKLA 2ZHKA 2ARBA 1V6JA 1CR7A 1OKQA 3IPVA 2P3IA 2DVGA 1IKQA 2W39A 1CPMA 1HKDA 1NXD1 1VIWB 3JU9A 1HQLA 1W6PB 5GLUA 3WNXA 1AJOA 3V64A 2R16A 4XYXA 4YG0A 1WLWA 4XBNA 2D6OX 1QNWA 4R9DA 1FV2A 1LGBA 4AVVA 2E7QA 3NV2A 3NV1A 5DZFA 1LHVA 1W6NA 2DYCA 5HCAA 1C57A 1W6MA 3KQRA 2H0BA 4ISRA 1MVQA 1V6OA 3RRDA 1MS9A 2A6YA 2P37A 4XHBA 3RMXA 1SBFA 4IQPA 1MS1A 2WT1A 2ZGMA 1G9AA 1AXZA 5T5JA 4PQ9A 2C9AA 1KJRA 3HMYA 1DLLA 2ERFA 4M00A 1BYHA 3FLPA 3FUOA 2E7TA 4FPEA 3VUOA 3WLUA 2VXRA 2AR6A 2UU8A 4UW4A 4UW3A 2ZZJA 3WDWA 3FLRA 1AX2A 2V5YA 4U2AA 5KXDA 2GMEA 2NZ9A 3D4KA 5GLTA 5T5LA 4F83A 3ILNA 3OBTA 1PZ7A 2E51A 4NOTA 4P9XA 1OFSA 1N3PA 1FNZA 1SLTA 2R49A 5T55A 4P9WA 2UWBA 2GNMA 4LBQD 2ES3A 2ZGLA 5T5PA 1QNYA 2A5ZA 3ZXKA 1DQ2A 3AJZA 1WD3A 1F5FA 1YYNA 2D6LX 2FMDA 3WG3A 1JYIA 1H30A 4I30A 5JOWA 1H9PA 1EPWA 2WLQA 4Y20A 2A7AA 2XB6C 4BLJA 2DVDA 1SBEA 1Y7BA 3VKOA 1LOAA 1SCSA 5T54A 3V0BA 5KXCA 5F5QA 4LBQB 5GZGA 4R9CA 4MYEA 1ULEA 2Z42A 1DBNA 5GZFA 1UL9A 3ATGA 3UL2A 3SITA 4U36A 4YGBA 1BXHA 2JE7A 2NMNA 2ARXA 2UWAA 3PVOA 2YROA 1MZ6A 4P14A 5DUUA 2DVBA 2PHRA 1QKQA 4UW5A 3WVJA 1FYUA 5DZEA 1GZCA 5F9TA 1AJKA 3B00A 2P2KA 2OUJA 2ZGPA 4ATEA 1FATA 2VU9A 4AGRA 1CJPA 2G4IA 1GLHA 1GSLA 5LK5A 3TAYA 5HCBA 2VW1A 5T5OA 1S0EA 2EAKA 3SISA 4YW5A 1CQ9A 1Z0HA 1SLCA 1UAIA 3AZXA 5EWSA 1PZ9A 3WDVA 4AVSA 2ZAAA 1IS3A 1LU2A 3O0XA 4ISQA 3A0NA 4GWNA 3USUB 2D44A 1SLAA 3KM5A 3M2MA 1DYKA 1UZZA 1D0HA 2VUAA 1LCLA 3ILRA 3ZSLA 4M3CA 4KBBA 1QDOA 2ZHMA 4YFZA 4M01A 1AZDA 3V0BB 4ATFA 1F9KA 3WG1A 3RG0A 1SLBA 3AP7A 2UWCA 3M3CA 4YM0A 2E6VA 3UK9A 1APNA 1JXNA 4C1XA 1KITA 3UJQA 2AYHA 1S1AA 3A4UA 1DIWA 3DUIA 3VKFC 4BLIA 4XDQA 4YFWA
chains in the Genus database with same CATH superfamily
4MGIE 4AI1A 2JX9A 3VDDB 2I07B 4AGGA 1S2BA 3ZSEA 1UKRA 2FBEA 2HBTA 2HWF3 4XIKA 3TB0A 2VTXA 2VZVA 2EXHA 2AH2A 1BK1A 2EIBA 3NNMA 1PO11 1JYXA 4K8RB 2R1DA 4QB1A 2WO1A 3H7YA 5JR7B 1K12A 3WNPA 2HWC1 1WLDA 5CFCC 2W87A 2WFF3 1BJQA 5FYCA 5JMCA 1HB3A 2EXJA 3WF4A 3AJYA 5KWRA 1RHI2 1Y9QA 3AL5A 3WQ7A 4F8AA 1HRI3 3ETPA 4AR2A 5K8SA 3MBWA 4EN7B 5JDBA 4NPLA 3GJAA 3I59B 4L0PA 1ZM1A 4M0NA 4AQ2A 3MO4A 1ENQA 2JECA 3GALA 1BK0A 2V4VA 1A3KA 1W6OB 1PM7A 1DQ4A 5K0UC 2HWE3 4J1WA 2ZX3A 2CU5A 2DURA 2ZZQA 2ZABA 1UOBA 2VOWA 4D6SA 3V0AA 2OQ6A 3IN9A 3JD73 4A7KA 4AVCA 5C9AB 2R073 4AOCA 4QGNA 2EIGA 3DL3A 1VRBA 4ZU4A 2X53S 4PIXA 1VAVA 1F4HA 3B02A 3CKHA 4O7XA 4YLZA 1Q8PA 5DAXA 4CCMA 1QMJA 5FXVA 5FQ0A 1R64A 5FO9B 1JHJA 1Z7S3 1XNAA 1O5UA 2IWGB 2JB4A 2VVFA 1ULGA 2PLV3 4AYUA 4CZSA 1QQP2 2OQ7A 1VBE3 4BIOA 4DNYA 4XTPA 5CISA 4QX2A 5FYTA 1I1EA 3RZJA 3T4HB 2BGOA 2GALA 2LS6A 3WINE 4EWAA 4PDWA 4RHV3 4W65A 4IEQA 2BYVE 4PDWC 4XBLA 3DPRC 2QQLA 1AUYA 2DCKA 1SACA 2RS12 4PJYA 3ZFFA 5IJRA 4RQPB 4Q4V1 4FAGA 1Q8VA 2BTVC 3WCSA 1SCRA 3ZIXA 3WNNA 2RJKA 3GBGA 5JSOA 3WDTA 2ILMA 3AYAA 4CEWA 5CG8A 1RUC2 2JKBA 1D4M1 1UIJA 3LWCA 1T2XA 1DGRN 1UY1A 4JGYB 4S2GA 3GYDA 4CEWC 4IE0A 2RR11 5I8SA 3VZKA 2WYFA 3PUSA 5FTTC 4FOVA 3AYCA 4PCRA 4D7SA 3N4MA 4GH4A 3ASIA 3H3UA 3HD8B 3PVBB 4JRLA 4ZY9A 4GH4C 4QXKA 1UPIA 4CDXA 2Y6FA 2BDRA 4HPKA 3QH7A 4CDXC 2DWRA 5K7PA 2YDEA 3CJXA 3IM0A 4ZONA 1OD5A 3HJRA 3MF9A 1U0AA 1JZ3A 1C5HA 1KQRA 1AL21 5EJZB 4ASMB 5F1RA 4HK8A 4LTAA 4QT6A 4Y5TA 3AZZA 1W8ZA 4QQPA 3ZXDA 1OA4A 2PHLA 3NVCA 3WY6A 1NT0A 3I3EA 2W68A 2XOMA 3T09A 4B4QA 1EUUA 1FMD3 2VE1A 5C3QA 3AVSA 1N3OA 2WSVA 1UU6A 4IETA 1AXYA 4QPIB 1G7YA 1RVF3 1OXCA 3HOBA 4GIQA 1W0PA 2CSGA 4LK7A 2QJVA 4Y33A 4BCUA 2VCBA 5A3LA 1NY71 1G9FA 3HR9A 5I0RA 4E2GA 4QM8A 2W1UA 2DDUA 1YFWA 2IFWA 1EUTA 5D8AB 3ZFEC 1ZZ6A 4AK3A 5CBLA 2WNUB 1KDKA 3M3IA 5EZWA 2VMDA 4XQDA 5DAVA 1LHWA 1QOTA 5FREA 3EXUA 3M1HA 2WNEA 3U0ZA 4Y20B 5LWBA 4HONA 5D21A 4OULA 2L9LA 5H9RA 1OPOA 4OI1A 5L7OB 3LEMA 5KHJA 1DLCA 1PK6B 3POIA 1UF2C 5CZKA 1GP5A 3VB9A 4Q4V2 2D93A 3WDUA 1QOSA 4B4PA 4GKXA 1CAUB 2BFUS 3HT2A 1US3A 5FZDA 4Q1RA 1I3HA 2F4LA 1OOPB 3JXSA 5CVRA 5FP7A 1W8FA 1QF3A 1VBA3 1O91A 1SDDB 2B42B 3MLLA 5JAXA 1AR81 3VHRA 3BOWA 4LJHA 2H6BA 5FUIA 3SLIA 5C7GA 5ANQA 1B09A 1QJEA 4Z2AA 1IPSA 1WD4A 3J8F3 3VV1A 1JOJA 3ZXJA 2WRAA 4M4PA 1LRHA 1NCRC 3IB3A 3UESA 4QKFA 4AI0A 4CUBA 1W8TA 1MQTA 1N47A 3VHPA 2QQWA 5DAQA 3RQ0A 4B1LA 1RHI3 4AVAA 3ZN4A 4DFSA 2VZ3A 3AX4A 2Y6HA 2OZJA 4N53A 2HBUA 2XL9A 1W8OA 4IEZA 2OUHA 5GZEA 2C24A 4NO4A 1ODMA 2XL7A 1W8WA 5JXIA 1CIWA 4O9EA 4OZXA 4G4FA 4YM3A 4N43A 1BHGA 1MEC1 5C3OA 4MG2A 4MXVA 4IEWA 1NY72 1COV3 3VKNA 3KS7A 3N9MA 3ZPYA 1BBT3 3DCQA 2UYBA 4S2HA 1VBD3 3N7MA 3KWVA 1UXZA 2LROA 3LF7A 4DRRA 3I97A 4V2WA 3IMNA 3AZYA 2WFPA 4QX3A 2ZTNA 2F4PA 2YBPA 3JB8A 5IFTA 5HXMA 3BTXA 3POEA 3C7EA 1J3PA 1U5IA 3V65A 4GJYA 5A6QA 3AM2A 1WW7A 1KFUL 3J7NA 1CZTA 4BMEA 1OVPA 2A6VA 4Q5OA 4V1PA 3I8TA 2Y60A 4E4HA 1DZRA 1O4YA 3U75A 2DTYA 2GP5A 2B9UA 3T3YA 2E53A 2RS31 3PUHA 1ONAA 2LRPA 2WZ8A 4KWJA 1WLCA 1JH5A 4OFGA 3WXPA 4DXSA 5A80A 1REFA 2PFWA 1PO13 1QIQA 4XF3A 1IQDC 4Q1PA 4JKLA 3RPQA 4LHNA 4J1XA 2FZ1A 4Q4W2 2HWC3 2DVAA 4XF9A 2YXSA 3OF1A 4A7ZA 1AYM3 2A71A 4NIHA 4SBVA 4I01A 5IAVA 4CTEA 3SQOA 5GZCA 4LBQA 4L99A 1QHDA 1QH6A 4AL9A 1BKZA 3WHUA 4C0BA 3U1XA 4BQXA 4LHSA 3N7JA 1JN2P 1C1FA 1O4TA 2FQPA 4QGLA 5JWPA 4ASKA 4COUA 1EPZA 1PX3A 3NMBA 1G9BA 1PIV1 4RGGA 2JE8A 2PAKA 5EYXA 1J3QA 4FFIA 3VBHA 3VBSA 2XJSA 4D7TA 1DF0A 5FY9A 1JBCA 3VBHC 1RUG2 3ZXFA 4YZ2A 4QX0A 4UF0A 2Q5TA 4PF1A 1RMU1 3OYWB 2Q8DA 1SHWB 4YZ1A 3AKSA 2HJIA 3AMNA 4WM8C 5BNOB 5FZIA 3HNBM 2ZGUA 1NZIA 2ZX1A 1HJGA 5FIXA 4WM7A 5F32A 3ZYFA 4MHRA 1HN0A 1X36A 3ZDSA 2YG0A 4WM7C 4AI3A 3ZYRA 3W21A 1U5ZA 3L2YA 1S0CA 3M3QA 1O8SA 2ZEWA 4O65A 5SV8A 3JBG3 1WA4A 5JXGA 2ZMLA 4DXTA 2JDNA 4HZFA 1JUHA 1Y43B 2BOJA 4X6RB 4R9BA 2DCJA 4XF4A 3TEXA 5L9VA 3SMHA 3UV9A 3ZXGA 2PHFA 3WDYA 3M70A 4Q4V3 4AEMA 3O1VA 4LBOA 1GZWA 1RITA 1UOJA 3LD8A 1WCSA 1ENRA 2P3JA 1GOGA 2HEYF 2JDMA 3JCIA 2J1SA 1AR72 4URTA 5EYYA 1D4M3 4DRVA 1QGLA 1ULFA 1GQHA 1VALA 1X82A 2O1QA 2RR13 2YB7A 1W2OA 3K46A 4CP1A 4DUXA 2MEV1 5JOZA 5LEKA 4CVUA 2BPA2 5AVPA 1O7FA 1YJLA 4CE8A 5GLZA 4JTNA 1LOEA 5C71A 1ASJ1 1TZOA 2ZHNA 3LIHA 5L36A 1PIV2 3KCXA 1V9U2 1POQA 2QQIA 1STMA 5FZHA 2VVDA 1AL23 1CZSA 2D98A 1W6QB 4YWAA 4FVVA 1ZZ9A 2QE3A 1ZA7A 2VY0A 4Y4RA 5DAPA 4NRMA 4FQ4A 4FOQA 3DF0A 4B7EA 4GALA 5FYMA 2ADEA 1X8MA 2BNOA 4LULA 1RMU2 5L9BA 1QXRA 4C1WA 2DV9A 5IT6A 1ZREA 1PGW2 5JZGB 1LJ7A 2R0HA 2CGNA 4XF1A 1ND3A 4BDVB 4ZU5A 4K7JA 3M3EA 2YFZA 5J1XA 1RUOA 3GHMA 1VJ2A 5FDBA 4ARXA 4AGVA 3ZFGA 1EV12 1U5XA 3MICA 3ZFGC 1SZBA 1YEWA 1RUF2 2A73B 3IDBB 2JDKA 5C8CA 2EALA 1OURA 4XXAA 3VBRC 3TOJA 1W0OA 1N1SA 5DABA 1CJDA 4EZ4A 1C4RA 2DU1A 2R061 3IWZA 4AQTA 1ZBE1 2X5IB 4HK9A 4FT8A 4YYOA 3VD7A 2DVGA 2Y26A 3NNLA 3FL7A 3AB0A 3DN7A 4P5HA 1VIWB 5JPMB 3PL0A 5A7PA 3KV6A 5DQ0A 2RDRA 1W6PB 5F6LB 1US2A 3MV01 1HV1A 1GMMA 2R16A 3RNSA 4AHZA 3ZPOA 4QB6A 1AR83 5C5UA 1T6GC 3AKTA 4LE4A 5JI9A 2B8MA 1H1MA 2A1XA 4HT1T 2B46X 5DZFA 1DGRA 2DYCA 2IXIA 4KGGA 3NAPB 3KQRA 1UW8A 3RRDA 3W9AA 2A6YA 4YPJA 3RMXA 3T2PA 3VLBB 1R091 2ORZA 2V72A 4AFMA 1FT9A 2ZGMA 1IQAA 2G19A 1QJU1 3H7JA 1S2EA 3OCPA 1REDA 3WNLA 3PMSA 2QZ3A 2VMFA 2XUMA 3KMHA 4FI9A 1MEC3 2JDUA 2VXRA 3CIHA 4HKWA 5FY4A 3FLRA 3JZVA 4MO3M 4PLMA 5C3SA 1RUNA 3ILNA 1SG3A 4P9XA 1CX4A 1H8TC 1AR91 2R49A 2FCTA 5I91A 2GNMA 3ITQA 3FHIB 4EZHA 3POGA 1BVP1 5A7WB 1T6BX 3MIFA 1F5FA 1JYIA 1K5MC 3VBUA 5A6ZA 5BNNC 1PGL1 3UKTA 5CU1A 5EJ1B 1GFF2 3VBOC 5FPZA 4BLJA 3MV11 4Q4Y1 4XC9A 5BNPA 4JGZC 2RS33 4D7YA 5KXCA 5BNPC 2V4AA 1LKNA 3V0BA 1UL9A 3OD0A 3A22A 2W5FA 1BXHA 2P17A 2JXAA 2Q4SA 3C8XA 3PU8A 5A3NA 3BUCA 2VGDA 5BXXA 2DVBA 1KGYA 4UW5A 2W94A 3LA7A 2E7AA 3KVAA 5DZEA 1GZCA 1QJFA 1AJKA 4ATEA 4LKDA 4QDQA 2VU9A 4MH0E 1FPN2 4AEDB 5LY2A 2G4IA 3HBZA 5JIAA 5A70A 1R092 4IGOA 2IZWA 3TAYA 5T5OA 1NQDA 4OLLA 1PVC1 1OVSA 1KFXL 4ORFA 3O1TA 2VNVA 2WZPP 1HRI1 5A3OA 3ZYIB 1CAVA 1VE0A 2XLGA 5C6CA 2QTWB 1PIV3 3A7QA 3KM5A 2OKXA 3U10A 4RGKA 2R041 1D0HA 2VUAA 4LLOA 1RC6A 1QJY2 1PO22 4C0HA 3MFCA 5CIRA 1K45A 1F5JA 4KBBA 3BPSA 3BU7A 5FYZA 4M01A 4XCBA 3F2ZA 1RGSA 2EIEA 2LW8A 4MXWB 5FZKA 3TRSB 2Q30A 4ATFA 1W9YA 1RUE2 5BUVA 2QQOA 4HETA 1APNA 3KB5A 4C1XA 4LUKA 3POFA 2VCAA 3VHOA 3RYKA 4L92A 2ZXQA 2JICA 2AYHA 3UJQA 3VKFC 2FZ2A 4YFWA 4YSFA 1XE8A 4S2FA 1M06G 1PGL2 2GAUA 4HKLA 5AC92 3GF6A 2CL2A 1TEIA 2ZKLA 1L7QA 2AUYA 3BIWE 4FSJA 4ES8A 4QM9A 2TBVA 3N7KA 1VBE1 1XOYA 1D4VB 3LDBA 2UURA 4WZFA 5CNAA 1MZEA 4RR3B 3IKWA 5E1RA 4P9JA 2VQUA 2HWF2 2XBO1 3NO8A 1ST8A 3I54A 4B7KA 1UYZA 4BQYA 4R8HA 4EN8B 3ZSKA 3T0DA 5L73A 1JYVA 1LENA 2GU9A 2OX0A 2W92A 4QQOA 3KV9A 3FBMA 2Y8KA 4CCNA 4YW7A 4CXXA 5B2GB 4Z92B 2OW4A 3ZXLA 1L3JA 3D0SA 3UKNA 1GICA 2WFF2 5FLHA 5FZ9A 1NA1A 1A34A 2MEV3 2YGLA 1UWWA 1UU5A 1WBLA 3AP9A 3HPNA 4W4ZA 5JVVA 4UT5A 2DUOA 3W20A 1NCQA 2OYZA 5FYBA 1ASJ3 3RZKA 1MS5A 2VW0A 1ZVFA 1HRI2 2QCSB 4PI2A 1GWKA 3VD5A 2AACA 4AG4A 5JOYA 2CGPA 4D69A 4N7IA 2YU2A 3ZIWA 2ET1A 4Z2WA 3N36A 5FZ0A 4QQLA 4WVVA 4JDOA 4BE3A 5FWJA 2HWE2 4MGSA 4G9SB 1IKPA 3VZNA 1DFQA 1VMHA 1VMJA 4M3CE 4AHWA 3JD72 5FMCA 4P5YA 2R072 1FMD1 4JQTA 4CP2A 3LQCA 1YQ8A 5JLVA 2OS2A 4CDQA 3RJRA 3WQ0A 4CDQC 5CFCB 1YIFA 5KBFA 2PHXA 5KHGA 2EAAA 2WZR1 4XE9A 4AWDA 4F3JA 1JYTA 2JG8C 3MW3A 3IPVB 4FP3A 3URFA 5LEJA 4YG6A 3VBFC 3FZ3A 1TMF1 1Z7S2 4N9HA 5FO7B 2ZAHA 3X29B 2PLV2 3NQHA 4OI0A 3KF3A 2XONA 4N7UA 1I6XA 4OYUA 5FUPA 2SLIA 4JDNA 1HQWA 5G04L 1VBE2 4QX8A 3RS6A 3ZOIA 4A6OA 1BVVA 2R063 3DXUA 2PQQA 1ZBE3 3PUQA 3B93A 3J9SA 4BQ1A 4RHV2 1ULCA 1Y4WA 2ZX2A 1OI6A 3ACGA 5K0UB 3ZR5A 4P00B 4QQ2A 1A78A 2LALA 5LW9A 1W6NB 5FZOB 1S0IA 3J7HA 1W6MB 1G6NA 4NMIA 4BA6A 3B94A 2WINB 3PTYA 5LA2A 4ZZ5A 1EAH1 3LSEA 4Y24A 4OI4A 3B9CA 1CESA 4XMIA 5A3WA 4DOUA 5KR7A 3O1OA 2XVKA 3IIAA 3RSJA 1U5YA 1UZWA 2R32A 1XNCA 3KCYA 2DCTA 4E8DA 1DGWA 2VUJA 3WZ1A 3OOXA 3O12A 1F31A 4M0HA 2ZMKA 3NWKA 1W8HA 4LKFA 1ND2A 1ZYBA 3QOPA 2VNGA 2BNMA 1BEV1 4XF0A 4BB3A 2Z4FA 5LB6A 3O1RA 4I2OA 1VBB1 3H42B 1QJU3 3WEZA 1DQ5A 1XXNA 4UXAA 5HI0A 2FMYA 3PTRB 1DP0A 3DPRB 2X29A 2P5BA 5DG1A 1FMD2 3S30A 2WL1A 4PBPA 4PBOA 2J1VA 4B29A 5FBZA 5FY5A 1RVF2 2AREA 4K1ZA 1GQPA 2PHDA 3HT1A 2WN2A 3I2JA 4IV3A 5F2SA 2QUOA 4P08A 3KGLA 5J09A 1AR93 2A3XA 3I2KA 3SNMA 4JKKA 4CRQA 3OEAA 4JZRA 5FZGA 4HBNA 5I8YA 3BYWA 2DFBA 1GOFA 2BGPA 2RMU1 2XQXA 4ZXKA 5KXBA 1E5HA 2DBIA 5E8AA 1UD1A 2QNKA 4DEVA 1GP4A 1DHKB 1WA6X 3DYPA 5K4LA 4CDWA 5JXJA 3AP5A 5DDJ1 5IVVA 3ZVXA 4NRPA 5A1FA 1G9DA 4Q4Y3 3VHNA 4QDSA 2QQMA 4L8QA 1WWYA 1KS4A 2ZA9A 1L7LA 2AENA 2NMOA 2VQAA 1RTVA 1QJX1 1OFNA 1VPHA 1LU1A 2DUQA 2YV8A 4FCAA 4H7LA 2DCYA 4I3PA 4NWVA 4WBBA 4WV8A 4XIOA 2OVUA 4CXWA 2BERA 3CLPA 4O9GA 1VBA2 5FWEA 2YY1A 3B9IA 5JUVA 4Q0SA 4KBZA 4LKSA 5FKBA 4RYDA 4YW4A 3VZOA 2OT7A 1ZRDA 4ARYA 1TNFA 2BGCA 3NNFA 2J1RA 3J8F2 4QAWA 3WSOA 3ZFEB 1HXS1 1SLLA 1AYM1 2RDSA 5T50A 5CADA 1A8MA 3SH3A 4Z1VA 4AAXA 4HVOA 2E63A 1PVC3 5CKMA 3DKWA 4XVHA 3N9NA 3AZVA 2G9GA 4Q8KA 1RJ8A 2XJVA 4QXBA 1BLZA 3N3HA 2HKXA 3LFIA 4MX3A 4YGDA 5CKQA 3PURA 4BHPA 2PELA 2R043 1KS5A 2DU0A 3J7LA 3LCPA 3RWNA 4FPLA 2GH2A 1W0NA 1IS5A 3DGTA 4FTSA 4YVSA 2DVFA 4CEYA 4CP9B 3H50A 1OLQA 4UFMA 5CFDA 4A2UA 4YVSC 4CEYC 1COV2 3RZMA 2WT2A 1SFYA 2VUCA 2KA3A 1BBT2 3I2GA 4A42A 1VBD2 4RN5A 4JV4A 2WYSA 1SMVA 2YPDA 4GA9A 4META 1FNYA 3THTA 2R1BA 4B1MA 2XPJA 4LR4A 4DQAA 1NCRB 1WCQA 2XJTA 1UU4A 2QZ2A 2XVGA 2XG3A 3AKRA 3RDIA 3BTYA 1XU1A 4J25A 4K21A 4DINB 4COWA 5HXVA 1Z78A 4KNCA 1SPPB 4NIAA 3JBG1 3ME2A 4HL0A 4Q0UA 2D6MA 5J7MA 4QU2A 4Q26A 1XBFA 2W91A 1BMV1 3AC0A 3MIGA 3O5SA 2ENRA 1KRIA 2KR2A 2XBO3 1J3RA 3JB4C 2VZUA 3NRUA 2SBAA 2H6CA 1PO12 2W08A 2D3PA 2A75A 2PA7A 2J1TA 3E97A 3NKTA 1IPJA 4NHKA 4QKNA 4LBLA 3ZFFC 4HSJA 2HWC2 1XB9A 1YQ2A 2CY6A 1AYM2 2BV4A 2WO3A 2CGOA 3L9JT 3RZHA 2ZGOA 1MS0A 2AEZA 3ZYGA 3NJXA 3BTZA 4HN0A 3R4SA 5IHRA 3WQ1A 1V6LA 4Q2FA 1CVNA 2ZX4A 4BQ5A 3MHZA 5LASA 3H8RA 3W5NA 5FLIA 1X9PA 1V6MA 4OVEA 2JD9A 5FZ4A 5ABJA 3T2TA 3H1YA 4IEPA 5ABJC 3NW4A 3VZLA 4LO8A 3RMYA 3A21A 2A6XA 4GXLA 5H9PA 4MGQA 4QXHA 4OHXA 2P34A 3WV6A 3MW2A 2UYAA 4YW6A 1H6YA 3IAPA 3RI9A 3SCFA 3USUA 2GN7A 1SEFA 4GD4A 5C5TA 1OPMA 4KQ7A 3D0JA 3TEZA 2QQJA 2AC1A 4OMDA 1DYOA 3ALQA 1GKBA 1RUJ1 2XHNA 3ILFA 2PQSA 2XLAA 4OI2A 2WKKA 3LEKA 1E57A 2WZR3 5DPNA 1YHFA 1OMIA 5AFEA 2QBXA 3OBAA 5J48A 1CAWB 1QOOA 3GNEA 4Z82A 4P9GA 1TMF3 2GDFA 3NJVA 1HIXA 3U11A 2BBVA 4LBJA 3SHRA 3VDBA 2HWD1 3JBG2 1POV0 4WZCA 2VMIA 1C28A 1YXWA 1O5LA 1IS4A 2PMWB 2VQTA 1YO8A 1UMZA 1YIPA 2TNFA 2VC9A 3CNAA 3FX3A 2VM9A 3VDDA 3QBQA 2VCMA 3B69A 3MEPA 2Y6JA 2ARCA 3VDDC 1RYYA 1VRH1 4PI0A 1UIKA 2WWSA 3OY8B 4XOGA 3CL1A 5A7QA 4XAAA 4K40A 2W95A 4BXSV 2GNBA 4KWUA 3ZYJB 2XJQA 2OXBA 3RZLA 1EAH3 2E26A 5C8WA 1RUI1 2I74A 2VUDA 4WM8B 1D4M2 1UX6A 4R4ZA 2YBSA 1Y9MA 2RR12 1YI7A 3HQUA 1YFUA 4LBMA 2BWCA 1CAXB 3CBNA 2ETEA 4Z07A 4MOAA 4P9LA 3FBYA 5FPUA 5IK4A 1JYCA 3I3DA 3O14A 4CCDA 3FJSA 1SBDA 4UW6A 5EXOA 3AXEA 4JDMA 4QHOA 4DIQA 2Y34A 2O8QA 1BEV3 2EXKA 4NHXA 1URXA 3PNAA 3I59A 1W2TA 1VBB3 1AL22 2MHFA 3FC0A 3PVNA 4LMFA 4YGEA 3RYRA 4AI9A 2QQPA 1C8NA 1MQTC 1W6OA 3DECA 5H9SA 5M0TA 3FUQA 3I3BA 3U4XA 4NUBA 4QPWA 4XUPA 3O0WA 5IWFA 3FN9A 4Q27A 4N53C 3NJYA 3I2IA 5C33A 5C9AA 1BZWA 4Y1UA 5GLWA 2DUPA 2ID4A 1UMIA 2QDNA 1OUXA 4RD7A 4XQWA 5GZDA 3AP6A 3U14A 5BPXA 4AZZA 5ACA1 4N43C 4YARA 3MYXA 1RUH1 5L9RA 2HWB1 3WW3A 2WS91 1F8VA 1ALYA 5EP9A 5IK7A 5T52A 1ZZBA 2CWSA 5C3PA 5EPAA 4CCLA 2RMU3 2ZHKA 2ARBA 1TNRA 2W46A 2P3IA 4B3NA 1IKQA 2W39A 1V0AA 5LA1A 1HKDA 1PNFA 3POJA 3LOBA 5DDJ3 3Q8AA 5GLUA 4QWNA 1AJOA 1CD3G 3V64A 3ZN6B 2CDOA 4Y5Z0 1QJX3 4RQPA 1PVXA 4DY3A 4XBNA 2XQRA 1XSQA 4QHZA 2D6OX 1QNWA 3ZXAC 4R9DA 1IGOA 4I09A 2IUWA 1LHVA 1RUD1 1AR82 1OBNA 2J1UA 2PYTA 4JGYA 2WO2A 3ZFGB 2XWJB 1HXS3 5A33B 2OIIA 3T2OA 3NNGA 2ZX0A 4ZS2A 5FYUA 4A3XA 5J3UA 1B35B 3VBRB 2C9AA 1KJRA 3Q8FA 2P4EA 1XYNA 2QKDA 1S4CA 4NVPA 5FXZA 3FLPA 2RVAA 4CCOA 2E7TA 4FPEA 2WQ8A 3GZTB 1AX2A 5FP4A 4GZ9A 2CDPA 3OD4A 4A7YA 1OA3A 1MEC2 3IMMA 1QH7A 3LGRA 2NZ9A 1VB4A 3D4KA 4QPIA 5E16A 1GP6A 3UGHA 4NIIA 4F83A 4QPIC 3OBTA 1W2AX 2CV6A 3VBSC 1SLTA 5T55A 3SKJE 1H4HA 2RM21 2ZGLA 4LBQD 3Q8EA 1QNYA 3KQ4B 4E9KA 5D8AA 3RZGA 1ODNA 4BU2A 1WD3A 2D6LX 2GP3A 2WNUA 4GMP1 1W05A 4EN6B 5JOWA 4D6QA 3BKZA 3K77A 2WNUC 1NAEA 3IT8A 4Y20A 1M4WA 2A7AA 4CP0A 5JPNB 1WMXA 3IZOA 4CYDA 4HN1A 1X8EA 5L7OA 2VOXA 4XURA 5LRSA 3S5AA 1PK6A 5HV0A 1JYWA 1ZBA1 1PK6C 3TN91 2JE7A 1TME1 2RS32 5DAWA 1CAUA 4HXCA 2CAVA 1OT5A 2BP6A 2PHRA 1QKQA 3BVCA 5IW0A 3WVJA 3THCA 4IEYA 1J1LA 1OOPA 5F9TA 2UY9A 3B00A 3BB6A 4IW3A 4J6GA 1FATA 3LZZA 1W03A 3TYJA 3K4ZA 2IFRA 5LBCA 1F35A 4UFHA 5LK5A 3SEEA 1Y3TA 5HCBA 2RE9A 3LKJA 1H8TB 1ZRRA 4LO5B 3SISA 5JCTA 1XYOA 1Z0HA 4QKBA 1Q5OA 3WF3A 5FZFA 1LU2A 2P6CA 2XH6A 3OUJA 4COZA 3O0XA 3A0NA 3H8UA 4NHLA 3T08A 4V2VA 3VN4A 4AQSA 1K5MB 3TEYA 5BNNB 3ZSLA 5LY1A 2OZ6A 3UETA 3VBOB 2ORXA 1AR61 3ZYHA 3AMPA 1LAJA 4LOSA 5HCHA 4JGZB 5BNPB 3P5BA 5F37A 3V0BB 3WG1A 3LA2A 4URAA 2EIDA 3M3CA 1RUJ3 1UMHA 4IV1B 2GSYA 3UK9A 2VQ0A 2QVSB 2GZWA 1S1AA 4BLIA 1DIWA 1X7NA 2VZTA 4JHZA 4KWLA 3IBMA 1PX4A 1QY4A 3NSTA 2JG9B 1ND3C 2RS51 4N9IA 4Y22B 1LOCA 4LBKA 1ZZ7A 2VR4A 1S0JA 3OGRA 4FOYA 4A45A 3C7HA 2HEWF 2Z69A 2HWD3 1IG3A 1XNBA 1RB8G 1ZZCA 5CB7A 1HB1A 2X05A 5C8CC 2ZGRA 5BNOC 1JMUB 1GOHA 4XUOA 3ZSJA 1ACCA 3CZUA 4HVRA 4KH9A 5C70A 4LIUA 2VZSA 1WW5A 5FZBA 1VRH3 2YYOA 4NHYA 4W6XA 2ZOEB 4P9IA 1Q3EA 1NQJA 2PHTA 5F3CA 4P9YA 4GB33 3WD5A 3FFZA 1W9SA 2IXLA 1HQNA 1Q56A 1YCIA 5FJHA 5FYIA 5FYHA 1RUI3 2XDVA 2X09A 4CCCA 1VB2A 1XNTA 5KHIA 2NYYA 4Y1ZA 4DXZA 3A0KA 3D3AA 4RA0A 4DUWA 2W0XA 3OUIA 2MEV2 3MIEA 4MGTA 1PNGA 4XAEA 3KT4A 1UCXA 3I3MA 2GC3A 5GM0A 1R1ZA 4RL7A 1ASJ2 4OCTA 2CYFA 2Y0OA 5FP8A 1LODA 1WKYA 4NWWA 5FP3A 1SQ4A 4IEOA 4BH9A 2WR9A 3CHXA 3T30A 2C5DA 3EBRA 5D1IA 4C90A 1HV0A 4EWEA 4XBQA 4BWOA 1YUDA 1LOFA 5EV7A 1YQ5A 3OBZA 2CWMA 4MGYE 1LOFC 3VKMA 4GWJA 3KLSA 4TLFA 2W1QA 4XFFA 1LEDA 2GN3A 1CGPA 1NX9A 4RFT0 1PGSA 1GWMA 3CDZB 1UZ0A 2B9VA 1OF4A 3M3OA 3WHTA 4OQ8A 4XJWA 3OYWA 5FYYA 4R4XA 3E6DA 5A3MA 5ACA3 2FDGA 1WW6A 1W2NA 4OHVA 2WNVB 5BNOA 1LHUA 1YQCA 3C7OA 3ZMOA 1RUH3 4EROA 2HWB3 3E5XA 2WS93 4YGCA 5GALA 2BVVA 2WLPA 1GNZA 3P3NA 3FHAA 4TWTA 4XW3A 4Y5SA 4E8CA 4BQ3A 3S0MA 3AXDA 4WVMB 2B45X 3J4UH 3GCWA 4GJZA 2R062 1N1TA 1SLIA 1ZBE2 2Y38A 4FFHA 2VECA 1WW4A 3RYPA 4IE6A 5I0UA 2A6WA 5FMDA 5CEHA 1JU4A 1FXZA 1R081 3ENRA 4HG6B 4XZPA 5FAXA 5H9QA 3VBUC 1X9TA 2J42A 2XHKA 2XKPA 4JHTA 3GZAA 4YZ4A 1WMDA 4JCKA 5IK8A 4DMIA 3GJBA 2XLFA 1RUD3 3MPBA 4Q0PA 5CG9A 1S55A 4XILA 3B3QE 2QQUA 5FPBA 5EHDA 1NKGA 3AMHA 5F7UA 3PUIA 1PHMA 2JG8B 3ACIA 4DS0A 1XE0A 4BQ4A 5JMOA 2D97A 2NM1A 3UKVA 3VBFB 3VDAA 3WX5A 1NLSA 5SV5A 2D40A 3UJOA 1DGLA 5IVYA 3AZWA 1KDMA 2PHUA 3WT3A 4TXWA 5C4WB 1W6QA 1QJU2 3Q8BA 3POWA 3W59A 2VZQA 2YUEA 1D2SA 1JUIA 3G6JB 5FZ6A 3WF1A 3RGBA 2IXJA 1JODA 2J1AA 2K46A 4HVQA 2VOVA 2WBKA 1UY3A 3ZO0B 2E9QA 2W47A 1C8M1 3SH4A 3ZMNA 5JZGA 2RDNA 2XJPA 4DPNA 2P3YA 1RINA 1HB2A 2HH9A 1H1AA 5E88A 4EN0A 2ZGSA 1QEXA 5IVEA 2RM23 3MW4A 4FPFA 1OF3A 3HQRA 2FD8A 1AR92 2P3KA 2WQZC 5DMYA 4NE9A 2D6PA 2XUEA 4GMP3 1SFNA 1ZRIA 3UYJA 4LK6A 1GBGA 1PZ8A 4TSVA 1H8VA 4AFAA 4L9BA 3T2QA 4A41A 2TEPA 1UZVA 4D8MA 5BV6A 2X5IA 3B7MA 3H0OA 5DUWA 1DDLA 2JIGA 2X5IC 1ZBA3 4L11A 5KXEA 4H2AA 3TN93 3FHQA 4Q4Y2 5A32B 1ZRFA 1TME3 1YRZA 1E5RA 1MR5A 2KM2A 3AYEA 3U4SA 3ZXEA 1CWPA 3D82A 3OSDA 1WLTA 1W6PA 2ZEXA 4C91A 2ZBJA 2IXHA 3W58A 3BCWA 2GNDA 3U37A 2VCCA 2VVEA 2D5FA 5L19A 3MUZ1 2XMLA 4NROA 3TWIA 1DQ0A 4PHZA 2ZHLA 4DXRA 4W50A 3HVDA 3H1WA 2ET7A 4BMBA 4X8NA 3NAPA 3EYPA 4M3CB 1RXGA 2PHWA 4KGQA 4EV0A 4AQ6A 3AVRA 1NA1C 1PVC2 5DUVA 2ZGKA 1H2MA 4LKEA 3RVHA 4QPGA 1NCQC 3WCRA 4FP2A 3I2FA 5FZMA 4QPGC 3LEGA 5IUQA 1GYKA 3K3OA 1J59A 1AR63 4JRAA 3WP5A 4EJRA 4YVWB 2WJSA 2R042 4Y1XA 1XE7A 3BOPA 5F6KA 3WG2A 1RIRA 1LGNA 2C6SA 1YJKA 3I7DA 5FK8A 1VBC3 2B4KA 1OA2A 2ADDA 1GUIA 2A3WA 4MV2A 3OGGA 3SCGA 2YZ4A 3UNPA 4XFBA 5FY7A 1HRV1 5ISLA 4QXCA 2WUHA 4IE7A 4ZKTB 3VD3A 1IHMA 1O3QA 4H55A 3JQWA 2VPVA 1ZRCA 2XR4A 5IATA 2LTNA 2RS53 3SC7X 4YG3A 3FMGA 3KCCA 2JE9A 1C1LA 2JDYA 3ABZA 3S57A 4DO0A 2BUKA 2DBNA 1HX6A 1JHNA 2RJ2A 3MI8A 2V5DA 5FPAA 4Q4X1 5A7WA 3WUDA 5LRRA 1XNDA 4D6RA 1DGWX 3MUY1 3LB9A 1S0DA 1IOAA 4N8MA 1UPSA 1S0GA 4XJUA 3OGSA 1FV3A 3CJIA 4LO4B 2XGXA 4AE2A 1YFYA 2YFUA 3CJIC 1JZ6A 2Y6KA 2O8OA 5FMBA 3WW1A 1H1IA 1WCDJ 1W3VA 2XBO2 4QD2A 2NLRA 2HEVF 4AI2A 1TVGA 4DB5A 2VAUA 3M8LA 4JTOA 1JW6A 5J36A 3OB8A 3ORJA 1EYBA 3OGJA 1OH3A 1YWKA 2W2IA 3V0AB 1NOVA 4HSLA 3CQOA 5F39A 1Q8OA 3MIHA 1W9FA 2D6NA 3PVEA 2ZGQA 2JJ6A 4AEDA 1JZ8A 4BQ2A 1CN1A 1XQNA 1ZA4A 3ZSMA 1JZ7A 1AF9A 4CDUA 1PM4A 4PLNA 4XFAA 4FAHA 4CDUC 1QXJA 4YM2A 4DUVA 2WA3A 2WSUA 1O8PA 4XABA 4FPOB 1LESA 5FQ0B 2JENA 2F6BA 4R9AA 2VOKA 3INAA 1ND2C 1OQ1A 1KEXA 2WAOA 1DCSA 1YC61 2BU9A 4H14A 1H4GA 4IUGA 5B4NA 3TNPB 4Q29A 4JVAA 3N7LA 4CUCA 1UY4A 4YW3A 4PDWB 5I0TA 2JKXA 4TZDA 1WCKA 3BN6A 3ZFFB 2GMPA 2VZPA 5A1LA 2Y6GA 1C5IA 1XNKA 3KV4A 2D3SA 4MXWA 2RJLA 3K4AA 4GWIA 3O0VA 3CO2A 2WABA 2WZR2 3HNYM 3LSDA 2WWUA 4CEWB 4IV3C 2A70A 3RWKX 1X33A 2G9ZA 5FPXA 4ITCA 4F7ZA 5A6YA 4LPLA 4ASLA 4LO6B 2HYKA 4RSUA 1MVEA 1TMF2 1TQ5A 2I2SA 3MDPA 3I3QA 4LHKA 4WVWA 5J96B 5LZ6A 4GH4B 4YNIA 4CU6A 2XJUA 1IZ3A 2HYXA 3BPZA 4GMP0 3W5MA 4UFLA 2JD4A 4CDXB 4AVTA 1V6KA 4HPKB 4YZ3A 1NG0A 3OPZA 3ES1A 3SXWA 3AP4A 4HANA 1C3HA 1R083 2FHRA 3N35A 5ERLA 2BFUL 4RR3A 1P8JA 1TE1B 4RR3C 4CDWC 1G8WA 2JB8A 2VBPA 1MS8A 2NP0A 4YM1A 2AGSA 3ZYPA 4I0AA 3I2DA 4QHBA 5FK7A 1EAH2 1V6IA 4O61A 1HB4A 3T1MA 5EFUA 2XVLA 2YC0A 4RS5A 4PIZA 3MIDA 3WNKA 5JOXA 5FUNA 2JDAA 4IE5A 2ZKNA 4PT6A 2E32A 4RS5C 4LE3A 4CCKA 3N9OA 3HAGA 4LUMA 4Y3OA 4GQ7A 3FFQA 3NKGA 1WBFA 2GMMA 4FXKB 2A3YA 2B5HA 5DUXA 5JI7A 5F5AA 4G3YC 1XPWA 1LECA 1BEV2 1VBB2 3ZYBA 4CCJA 4CA9A 2VG9A 3IIIA 3D8CA 4X6QB 1QQP1 3VL8A 3BTAA 3T4VA 4MHUA 2E31A 4Q0VA 1RXFA 3J26N 2VMEA 1C8M3 3R4DB 1G9CA 4D0QA 1S0BA 1X50A 1U12A 2H0VA 2V73A 2RS11 2YPJA 4BJ0A 1QWRA 2R6QA 3V56A 1MPXA 4NIDA 5CFCA 3OEBA 1LTEA 4FPYA 3JUUA 1OLMA 3ZM8A 5AFBA 5CFDC 1W8NA 2HLEA 2IXKA 3K48A 1HW5A 3K51A 2K2SA 3SKVA 1XRUA 3KT1A 1RUC1 4H3WA 1OKQA 2ZJCA 3IPVA 4KU8A 2ATFA 4XUTA 1YLLA 4LQRA 2RMU2 4ZPIA 3POBA 2YGMA 3U07A 1HQLA 3WNXA 2Q0AA 4QGMA 4UFKA 3O1PA 2VULA 3DEMA 1MQTB 4XYXA 4YG0A 5DDJ2 4CUGA 4BK4A 5K0UA 1FV2A 1K3IA 1SFPA 1LGBA 4N53B 2WWJA 2E7QA 4CU7A 1QJX2 1W6NA 5FZOA 5HCAA 1C57A 1W6MA 4ZHNA 4EN9B 1MVQA 5FR3A 3BU0A 4KMQA 4N43B 3I2OA 5BY5A 1SBFA 1UY2A 4KI5M 2WQ4A 1RL3A 1G9AA 1AXZA 4NRQA 4PQ9A 1W9WA 3TBDA 5FKCA 1HXS2 1DLLA 2WAAA 4XPVA 1BYHA 1UYXA 3EJKA 4LNVA 3VUOA 3BI3A 3P6BA 3WLUA 2AR6A 2VBBA 4UW3A 3WDWA 2WN3A 3DXTA 4U2AA 4QU1A 2Q8OA 3U78A 4MZUA 3DV8A 4CCEA 2GMEA 3SCHA 4K8FA 5GLTA 3CZJA 5F3EA 5T5LA 2P6HA 3DPRA 4UBHA 4C8DA 4NOTA 1OFSA 4YRDA 3USSA 1CZVA 3HBKA 2UWBA 4XFGA 4L97A 2FDJA 2ES3A 4JKMA 5FOBB 1OLRA 2MPFA 4MVTA 3TNQA 1HRV3 4IEXA 3ZXKA 1DQ2A 5LCWL 1AHSA 4EE2A 1VP6A 3AJZA 3VZMA 3WG3A 1YYNA 2W9XA 1R1A1 4I30A 1H9PA 1EPWA 1LNSA 5LK7B 2UY8A 2DVDA 2WC2A 1LOAA 2R30A 2ZS6B 3Q8CA 5T54A 4XFCA 5J37A 5F3GA 2FCUA 4Q4X3 2VMGA 5F5QA 4LBQB 1ULPA 3O7OA 4MYEA 2Z42A 5GZFA 3HEIA 3ATGA 3AMQA 4U36A 4YGBA 2G1MA 4EQVA 2CHHA 2NMNA 1VAKA 2K9ZA 3PVOA 2O14A 5DUUA 3QD6A 1MZ6A 4KU7A 5EIYB 3GZEA 3MLJA 5A3UA 4HFSA 1BMV2 4I3GA 5F3IA 4FTEA 2P2KA 2ZGPA 1J84A 1JZ5A 4CSWA 2X10A 1GSLA 2BWAA 3GXUA 5FLJA 2VTFA 2F17A 2WO7A 5F5CA 3VBHB 1CQ9A 4GB31 1UAIA 3VBSB 3AZXA 4BISA 3C7GA 4AEJA 2ZAAA 1DG6A 4ISQA 4UF0B 1NE4A 4GWNA 4JX0A 1H6XA 3K3NA 3THDA 3ES4A 3ZFEA 3H8XA 1SLAA 3M2MA 1W2UA 4MLOA 4BZ4A 1PMHX 4A6SA 1UZZA 2YBKA 2BNNA 3ACLA 3ILRA 4LITA 4LXLA 4ZS3A 4QMAA 4WVZA 4WM7B 1OQEA 3ETQA 5FZEA 2DFCA 1QDOA 2WIIB 2ZHMA 5FP9A 3GDBA 2G9FA 3PIJA 3RG0A 1SLBA 4B4RA 2UWCA 4NPRA 2EA7A 1NE6A 1JZ4A 3C7FA 5I0SA 3MZHA 4EYUA 5IFPA 3TEWA 1DZTA 4CP9A 3MLKA 3A4UA 3DUIA 4OUMA 1RUJ2 4HOOA 1R1A2 3AFGA 3D5OA 1AL0G 5JR2A 5A6XA 1V70A 3BODA 3L2HA 4TYSA 5AVAA 5A3PA 1GZWB 5C9AC 2Z5WA 4OUSA 3ECQA 3CU7A 5IVJA 1AYN1 4Q4W1 3KHBA 5APAA 2Q8CA 1NCRA 5B4XA 2BJSA 4OMCA 4AFBA 2HWD2 3D6EA 2JWPA 2PAEA 3MFAA 4XJAA 2VZRA 3WNMA 1SPPA 4E2SA 2Q1MA 3CEWA 4XHXA 4Q0QA 4HLTA 2JDZA 2BBAA 2O0OA 4LIVA 4XXPA 5F2WA 1VRH2 5F8PA 5LATA 4D94A 4XJ8A 2ZEYA 1V6NA 3HQXA 4GB32 3AMMA 4H7MA 3PIGA 1W3XA 1XU2A 1ULOA 2X8KA 3QACA 1RUI2 3WP3A 1ZZ8A 3AK0A 4RQPC 1RUG1 4IESA 4W6YA 3QH6A 5CYYA 1W39A 4UAPA 1ND3B 1V00A 3HWJA 1A6CA 4YW2A 3WR0A 4AI8A 2BOIA 4JC1A 4UFJA 4JGYC 3R6SA 4XDOA 2ZACA 1F4AA 2EXIA 4AFCA 2C9KA 3LAGA 3S5QA 5C3RA 4LORA 4IXLA 2J22A 2JIJA 4K1YA 4K6BA 4XTMA 5C8CB 3CF6E 3H8OA 1GR3A 5FCCA 4QPYA 5HBAA 3Q9OA 2YC4A 3H3ZA 4IDZA 3WW2A 5DZGA 1MACA 1QQP3 1OD3A 2P1BA 1UN1A 1JU3A 5FJKA 3IAQA 2J1EA 4E4DX 2KXLA 2BVBA 4SLIA 3NV4A 2GC1A 5K9YA 1WZXA 2D43A 4X8PA 1LHNA 4GWMA 3WF0A 2RS13 1NLRA 2W52A 3LDKA 4LOTA 4M4RA 3OPWA 4AAPA 5T3NA 4BPZA 5A3TA 5ACA2 1AYN2 2D7FA 3FE5A 1D2QA 4IEUA 1N3QA 1RUH2 2HWB2 3WDXA 2WS92 2JDHA 5IAXA 1AR71 1CAWA 1AVBA 1RUC3 3HN1A 4OHZA 3OBRA 5DN2A 4NIGA 2IVJA 1MS3A 3NV3A 4AFDA 2VJXA 4XZUG 4QX5A 3T1LA 5G05L 2YHJA 3ZN5A 5D8AC 3RI8A 3KVBA 4KL1A 5FO8B 4MSVA 3J7MA 4K20A 5EQUA 4ZU7A 3ACFA 1AXKA 4XUQA 1GU3A 5KC5A 4XFHA 2AEYA 3EQEA 3APBA 1V9U1 4BM8A 1GZ9A 3OY8A 4UBGA 4D3WA 3LIGA 3P3PA 5FPVA 5L7OC 1K5JA 1IPKA 2J7MA 4IEVA 3S7IA 2XKOA 4E4SA 2Q1ZB 3VGIA 4COYA 1RUD2 1JOBA 4OUEA 4WM8A 3P1IA 3OGVA 1PGW1 1Q43A 2WA4A 4LA3A 4XCAA 4XJ9A 3WNOA 4AXOA 2MNGA 3HNMA 1OOPC 2GC2A 4K3UA 1CAXA 4LA2A 4OQ9A 3LPFA 4CU9A 1OH4A 4PF5A 1IS6A 4PQQA 1K42A 1FAYA 2WT0A 1EV11 2DF7A 4XJZA 1OUSA 3RJ2X 5JIUA 3PU3A 4FPHA 4GKYA 5JSRA 1LOGA 1RUF1 3E5QA 3T0AA 3G7DA 2DTWA 4W8JA 1JOPA 1UNBA 1WMEA 3MPPG 2RHPA 5DXDA 3VBUB 2C26A 1UO9A 1J58A 3UT0A 1G86A 3ST7A 1OC1A 3VD9A 1O3TA 3JQXA 1CONA 1DQ6A 1I5ZA 5I8TA 2AZ5A 5KHHA 1VBC1 2DCZA 3R05A 3S6PA 4AHXA 3EHKA 4XQ4A 4A44A 2VNOA 2PN5A 2RM22 1RJ7A 4LLFA 1R1A3 4XACA 4IGQA 1H2NA 1O3RA 1AX0A 4CPBA 1ULDA 2W1WA 5CAZA 3AKQA 3PUAA 3QCWA 4NN0A 4E27A 1FOD1 3E6BA 5LBBA 4FPCA 4INDA 1QJZA 1YFXA 2CTVA 3OPTA 5TSWA 2VH9A 4FOWA 5FRAA 3ZKYA 3PHMA 3WF2A 1QDCA 1XC6A 5BYNA 1ZBA2 3TN92 1CPNA 4NJ4A 1HLCA 1TME2 2NN8A 3ZN6A 1UYYA 5GLVA 2BQPA 1CAVB 4JAAA 3C3VA 1W04A 2WDBA 3C2UA 3MIBA 3F95A 4L2NA 1N1YA 4CPBD 1QU0A 4Y1YA 1GNHA 1H9WA 2OA2A 2PAMA 2B7YA 4FFFA 2LUWA 1UY0A 3R4UA 3H9AA 3MGUA 3SH5A 3I2HA 5A33A 4YW1A 2EF6A 5FPLA 3OJBA 1F15A 1SDWA 2R0FA 5FYVA 5E6HA 3PDQA 1DQ1A 1B35A 3IDCB 4KG8A 4QDRA 3VBRA 3WP6A 5A7SA 1B35C 2BZDA 3OG2A 2KD7A 2OPWA 1UOGA 3EO6A 4FPJA 1LB2A 1GV9A 3LE0A 2VO5A 1AR62 1DU3D 1VLNA 3AYDA 2VZOA 4XDPA 1LGCA 5FMOL 2ZMNA 3PLQA 3T0BA 1VBC2 3BIEA 1XSRA 2NQYA 2N7GA 3KV5A 2RDQA 3FLTA 3ON7A 4AEKA 5HCFA 1GWLA 1GANA 4UWDA 1ENXA 3GBFA 5FZ7A 1H0BA 2C1FA 2EVXA 2ZGNA 4QKDA 3WG4A 3E5UA 1AYN3 2RS52 3E1F1 4Q4W3 1FOD2 2D5HA 1J1TA 4MADA 2D3RA 2Y6LA 3LA3A 4FPGA 2YU1A 1NA1B 4Y26A 1YQ6A 3K75B 3QLQA 1FPN1 5IK5A 5DG2A 1I5PA 2GNTA 1NCQB 3I4IA 2I45A 5FZCA 4COVA 4QPGB 5LBFA 1MZFA 2E33A 3O1UA 4FQZA 1W9TA 4K9SA 1O3SA 4E2QA 1LEMA 2A6ZA 1A8DA 3I49A 1WUVA 4TN7A 1S2KA 4MGKE 4AHYA 1HDKA 5FV3A 4BOWA 4FFGA 4FPKA 1BCXA 3OTFA 5IYYA 1JI6A 1LULA 2VL4A 1NUKA 3N9PA 1O4ZA 3KD4A 5HPOA 3ACHA 4JQRA 3E6CC 5CKNA 1QJY1 4QQHA 1RUG3 1WGPA 1XJAA 1PO21 2WNOA 3ZX7A 3KHCA 4XMAA 2V09A 5FY0A 1H8TA 4CDQB 1VR3A 1WMFA 1YNAA 2ZPXA 3PMEA 4CU8A 1ZNPA 4Y4YA 1UXXX 5GJ6A 4FBFA 1POV1 1RUE1 4OHYA 3B01A 2ZGTA 1S0FA 2GC0A 1VAMA 5LBEA 4QB2A 3GCXA 1K5MA 2BEOA 4W6WA 3RFRA 1L7RA 5BNNA 2CAUA 4PIYA 1LOBA 5E89A 1JYNA 3M7AA 3VBOA 4LHLA 5AC91 1D0GA 1ENSA 1Q8SA 1E5IA 3CJIB 3POSA 4JGZA 5A7OA 4GULA 4Y1VA 4M3CF 3WUCA 2C4XA 3POYA 2VD7A 4NAOA 1MZ5A 2D6KA 4IV1A 1KJLA 2VBDA 4A4AA 4UYBA 4IV1C 2GH8A 2HWF1 2BW8A 4MGZE 2FDKA 5JZGC 4TLGA 4Z8BA 4LBNA 3RZZA 2JG9A 1AR73 4XETA 4Y22A 2JG9C 3KF5A 3H1MA 4XUNA 3EB7A 5LA9A 3VDCA 1W28A 1H2LA 1GNYA 1JS9A 1PMIA 1WCUA 2WFF1 4LO7A 5FOJB 4CDUB 4TTGA 2FDIA 3B5LB 3OUHA 1UKGA 5FFOC 2PXJA 2PTMA 3VD4A 1AX1A 5IVBA 4ET7A 3NJZA 1ND2B 3GGLA 1LHOA 5I93A 1V9U3 1R082 3SEPA 3AFKA 2JEMA 3LEIA 3NNJA 5FZ8A 3ROUA 3WQBA 1F2NA 5D2AA 5JSPA 1UOFA 2QQNA 1YI9A 1MS4A 4BQWA 1PMJX 2HWE1 1NXMA 3S7EA 1RMU3 2QFEA 3A23A 3ZLIA 1N1VA 2FDFA 3JD71 2R071 1E5SA 4AF9A 2B39A 4IV3B 3WW4A 2QQVA 1NZCA 3LOIA 5FZ1A 2VTXJ 2CNAA 3AL6A 2YC2A 1EV13 3THPA 1W06A 1RUF3 3M4FA 1EP0A 4OHWA 1QXPA 2C0ZA 3NAPC 4ZXEA 2VNRA 2Y64A 1H2KA 5A1AA 1Z7S1 1GQGA 2QDRA 4RGAA 4HKOA 2YMZA 1DZQA 1EY2A 2PLV1 4PLOA 4CXYA 3O1MA 5KHKA 1UYPA 1DYPA 2VW2A 4Q8LA 3LDRA 2IXCA 4CDWB 5CA6A 4DEQA 4YZ5A 3PJQA 1C8M2 3DYOA 1FX5A 4RHV1 2Z79A 1BQPA 1OHFA 4QX1A 1UZYA 1Q8QA 2ZEZA 4IGPA 3VKLA 4A3ZA 4AW7A 4BIFA 1OKOA 3EMRA 3N9LA 1V6JA 1CR7A 4I02A 3ZDVA 2WNVA 4RS5B 4GAZA 3WP4A 3AKPA 5FBJA 5FYSA 1HN1A 2WNVC 1CPMA 3PJYA 3GZUC 1NXD1 4IL7A 5IVFA 3JU9A 5ANNA 3K4DA 2XJRA 5A7NA 4BK5A 2NPIA 2VZ1A 1OQDA 1FOD3 3UGFA 1WLWA 3FWEA 1REEA 4WVMA 3VL9A 3HIFA 4I0BA 5LA0A 2VXJA 4AVVA 3NV2A 5HV4A 3NV1A 3N9QA 4OZOA 4DY5A 4XEZA 2JDPA 4FXGB 4ISRA 2H0BA 4ONUA 1KD7A 2FCVA 2QQKA 5FZLA 1CIYA 1V6OA 3UGGA 3ZR6A 5FMOS 1MS9A 1UQXA 2P37A 3GM8A 4XHBA 3KZ4C 4CUAA 3WOGA 4KWKA 5F5IA 4IQPA 3GBWA 1JZ2A 1MS1A 2WT1A 5KC6A 2OPKA 5T5JA 1HJFA 4UOJA 4EWDA 4HMZA 3HMYA 4YVSB 4CEYB 2ERFA 2R7EB 1RVF1 4QX7A 5CFDB 4M00A 3FUOA 3HN3A 3NL1A 4NAMA 5FXXA 2Q8EA 2JG8A 2Z2SB 2UU8A 3H3LA 4UW4A 2ZZJA 4E4ZA 4FTBA 3VBFA 4I0WB 2EICA 2V5YA 5FY8A 1UX7A 5KXDA 1O59A 4NR1A 4BYYA 4AEDC 4R52A 5BNQA 4KG0A 1PZ7A 2E51A 4UI9L 5C4WA 3KGZA 3ZKUA 1N3PA 1FNZA 1NYWA 2ZCWA 5C4WC 4P9WA 2RG4A 1W8UA 5EJ3A 1W99A 2ARAA 2VOTA 2XWBB 5T5PA 1O6UA 1Y9GA 2A5ZA 2IC1A 5J98B 1GZTA 4FO9A 1OLME 3KT7A 4BXFA 2Y33A 2FMDA 1H30A 5GKAC 4NHMA 1HRV2 2WLQA 3IDEA 1I9RA 1ZX5A 2XB6C 1SBEA 1Y7BA 2TUNA 3VKOA 1SCSA 2FDHA 4IE4A 1IG0A 1TG7A 1VBA1 2Y0IA 3ELNA 5GZGA 3CMGA 4R9CA 1ULEA 1JTZX 1DBNA 3UL2A 3SITA 3KSCA 5JXHA 4Q4X2 2ARXA 2UWAA 3J8F1 1FPN3 2YROA 4P14A 4XFIA 3VZJA 3K2OA 4NPMA 3O1SA 2W1SA 3LFMA 1R093 1FYUA 1D7PM 5FZAA 1VMFA 2Q1FA 2OUJA 3BGAA 4AVBA 4AGRA 1CJPA 2K0GA 1GLHA 4ES9A 2XXZA 1RHI1 5FY1A 5ABJB 5A32A 1OSGA 2IVIB 3DKQA 2VW1A 1S0EA 2EAKA 2RV9A 4YW5A 5FZ3A 3WDVA 1SLCA 5EWSA 1PZ9A 2VMCA 4AVSA 1IS3A 4UFIA 1NLQA 2LM3A 3USUB 1W90A 2D44A 1QJY3 1DYKA 5IVCA 1PO23 1LR5A 1LCLA 4N90A 1COV1 3BALA 5I0DA 1FI2A 3DYMA 1BBT1 5FXWA 3MF6A 1VBD1 1POV3 4DZGA 1RUE3 4M3CA 1CX1A 4S2DA 4YFZA 1AZDA 2W3JA 2VMHA 3LPGA 1F9KA 4MUVA 1KXGA 1J83A 4B8EA 4IERA 2BRTA 1XYPA 3AP7A 4RFRB 4YM0A 3IDAA 3R0RA 2E6VA 4P02B 1JXNA 4LEJA 1KITA 4YVWA 5AC93 4ZZ8A 3GHNA 4LT5A 4YVWC 4XDQA 2WZEA
chains in the Genus database with same CATH topology
4MGIE 4AI1A 2JX9A 3VDDB 2I07B 4AGGA 1S2BA 3ZSEA 1UKRA 2FBEA 2HWF3 4XIKA 3TB0A 2EXHA 2AH2A 1BK1A 1PO11 2R1DA 3H7YA 5JR7B 2HWC1 1WLDA 5CFCC 2WFF3 1BJQA 5JMCA 2EXJA 3AJYA 5KWRA 1RHI2 1Y9QA 3WQ7A 4F8AA 1HRI3 5K8SA 4EN7B 5JDBA 3I59B 1ZM1A 4M0NA 4AQ2A 1ENQA 2JECA 3GALA 1A3KA 1W6OB 1PM7A 1DQ4A 5K0UC 2HWE3 4J1WA 2ZX3A 2DURA 2ZZQA 2ZABA 2VOWA 3V0AA 3IN9A 3JD73 4A7KA 5C9AB 4AVCA 2R073 4QGNA 2EIGA 3DL3A 4ZU4A 2X53S 4PIXA 1VAVA 3B02A 4YLZA 1Q8PA 1QMJA 5FQ0A 5FO9B 1Z7S3 2VVFA 1O5UA 2IWGB 4AYUA 1ULGA 2PLV3 4CZSA 1QQP2 4DNYA 1VBE3 4BIOA 1I1EA 4XTPA 2GALA 4EWAA 3WINE 4PDWA 4RHV3 4W65A 4IEQA 2BYVE 4PDWC 4XBLA 3DPRC 3ZFFA 1AUYA 2DCKA 1SACA 2RS12 4PJYA 4RQPB 4Q4V1 4FAGA 1Q8VA 2BTVC 3WCSA 1SCRA 3ZIXA 2RJKA 3GBGA 5JSOA 3WDTA 2ILMA 3AYAA 4CEWA 5CG8A 1RUC2 2JKBA 1D4M1 1UIJA 3LWCA 4JGYB 1DGRN 4S2GA 4CEWC 3GYDA 2RR11 5I8SA 3VZKA 5FTTC 4FOVA 3AYCA 4PCRA 4D7SA 3N4MA 4GH4A 3ASIA 3H3UA 3HD8B 3PVBB 4JRLA 4GH4C 4QXKA 1UPIA 4CDXA 4HPKA 3QH7A 4CDXC 2DWRA 5K7PA 2YDEA 3CJXA 3IM0A 1OD5A 3MF9A 1U0AA 1C5HA 1KQRA 1AL21 4ASMB 5F1RA 4HK8A 4LTAA 4QT6A 3AZZA 4QQPA 3ZXDA 1OA4A 2PHLA 3NVCA 3WY6A 2W68A 4B4QA 1FMD3 1N3OA 2WSVA 1UU6A 4IETA 1AXYA 4QPIB 1G7YA 1RVF3 4GIQA 1W0PA 2QJVA 4BCUA 5A3LA 1NY71 1G9FA 3HR9A 5I0RA 4E2GA 4QM8A 1YFWA 2IFWA 5D8AB 3ZFEC 1ZZ6A 4AK3A 5CBLA 2WNUB 1KDKA 3M3IA 5EZWA 4XQDA 1LHWA 1QOTA 5FREA 3EXUA 3M1HA 2WNEA 3U0ZA 4Y20B 4OULA 5H9RA 1OPOA 4OI1A 5L7OB 5KHJA 1PK6B 1UF2C 4Q4V2 2D93A 3WDUA 1QOSA 4B4PA 4GKXA 1CAUB 2BFUS 3HT2A 4Q1RA 1I3HA 1OOPB 5CVRA 1QF3A 1VBA3 1O91A 3MLLA 2B42B 5JAXA 1AR81 3VHRA 3BOWA 2H6BA 3SLIA 1B09A 1WD4A 3J8F3 3VV1A 1JOJA 3ZXJA 1LRHA 1NCRC 4AI0A 1MQTA 1N47A 3VHPA 3RQ0A 1RHI3 4AVAA 3ZN4A 4DFSA 3AX4A 2OZJA 4N53A 2XL9A 4IEZA 2OUHA 5GZEA 4NO4A 2XL7A 1CIWA 4O9EA 4OZXA 4G4FA 4YM3A 4N43A 1MEC1 4MXVA 4IEWA 1NY72 1COV3 3VKNA 3KS7A 3ZPYA 1BBT3 2UYBA 4S2HA 1VBD3 3N7MA 4DRRA 3IMNA 3AZYA 2WFPA 2ZTNA 2F4PA 3JB8A 1J3PA 1U5IA 3V65A 3AM2A 1WW7A 1KFUL 4BMEA 2A6VA 4V1PA 3I8TA 1DZRA 1O4YA 2DTYA 2B9UA 2E53A 2RS31 1ONAA 4KWJA 1WLCA 1JH5A 4OFGA 3WXPA 1REFA 2PFWA 1PO13 4XF3A 4Q1PA 3RPQA 4LHNA 4J1XA 2FZ1A 4Q4W2 2HWC3 2DVAA 4XF9A 2YXSA 3OF1A 4A7ZA 1AYM3 2A71A 4SBVA 4I01A 4CTEA 5GZCA 4LBQA 4L99A 1QHDA 1QH6A 1BKZA 3WHUA 4C0BA 3N7JA 1JN2P 1C1FA 1O4TA 2FQPA 4QGLA 5JWPA 4COUA 1EPZA 1G9BA 1PIV1 4RGGA 2PAKA 5EYXA 1J3QA 3VBHA 3VBSA 2XJSA 4D7TA 1DF0A 3VBHC 1JBCA 1RUG2 3ZXFA 4YZ2A 2Q5TA 1RMU1 3OYWB 4YZ1A 3AKSA 2HJIA 3AMNA 4WM8C 5BNOB 2ZGUA 2ZX1A 4WM7A 1X36A 3ZDSA 4WM7C 4AI3A 3ZYRA 1U5ZA 3L2YA 1S0CA 3M3QA 5SV8A 3JBG3 1WA4A 2ZMLA 4HZFA 1JUHA 1Y43B 4X6RB 4R9BA 2DCJA 4XF4A 3SMHA 3UV9A 3ZXGA 2PHFA 3WDYA 3M70A 4Q4V3 4AEMA 4LBOA 1GZWA 1RITA 1WCSA 1ENRA 2P3JA 2HEYF 3JCIA 4URTA 5EYYA 1AR72 4DRVA 1D4M3 1QGLA 1ULFA 1GQHA 1VALA 2RR13 1X82A 2O1QA 4CP1A 2BPA2 5LEKA 2MEV1 5JOZA 5AVPA 1O7FA 1YJLA 5GLZA 4JTNA 1LOEA 1ASJ1 2ZHNA 5L36A 1PIV2 3KCXA 1V9U2 2VVDA 1AL23 2D98A 1W6QB 4FVVA 1ZZ9A 2QE3A 2VY0A 4FQ4A 4FOQA 3DF0A 4B7EA 4GALA 1X8MA 2BNOA 4LULA 1RMU2 1ZREA 1QXRA 4C1WA 2DV9A 5IT6A 1PGW2 5JZGB 1LJ7A 2R0HA 2CGNA 4XF1A 1ND3A 4ZU5A 4K7JA 3M3EA 1RUOA 3GHMA 1VJ2A 5FDBA 3ZFGA 1EV12 1U5XA 3MICA 3ZFGC 1RUF2 2A73B 3IDBB 5C8CA 2EALA 4XXAA 3VBRC 3TOJA 1W0OA 1N1SA 1CJDA 1C4RA 2DU1A 2R061 3IWZA 4AQTA 1ZBE1 2X5IB 4HK9A 4FT8A 4YYOA 2DVGA 2Y26A 5JPMB 3AB0A 3DN7A 4P5HA 1VIWB 1W6PB 5F6LB 1HV1A 2R16A 3RNSA 4AHZA 1AR83 1T6GC 3AKTA 4LE4A 5JI9A 2B8MA 1H1MA 4HT1T 2B46X 5DZFA 1DGRA 2DYCA 2IXIA 4KGGA 3NAPB 3KQRA 1UW8A 3RRDA 3W9AA 2A6YA 3RMXA 3VLBB 1R091 4AFMA 1FT9A 2ZGMA 1IQAA 1QJU1 3H7JA 3OCPA 1REDA 3PMSA 2QZ3A 2XUMA 3KMHA 1MEC3 2VXRA 4HKWA 3FLRA 3JZVA 4PLMA 3ILNA 4P9XA 1CX4A 1H8TC 1AR91 2R49A 5I91A 2GNMA 3FHIB 1BVP1 3MIFA 1F5FA 1JYIA 1K5MC 3VBUA 5BNNC 1PGL1 3UKTA 5CU1A 1GFF2 3VBOC 5FPZA 4BLJA 4Q4Y1 5BNPA 4JGZC 2RS33 4D7YA 5KXCA 5BNPC 3V0BA 1LKNA 1UL9A 3OD0A 1BXHA 2P17A 2JXAA 2Q4SA 2VGDA 5BXXA 2DVBA 4UW5A 3LA7A 2E7AA 5DZEA 1GZCA 1AJKA 4ATEA 2VU9A 4MH0E 1FPN2 4AEDB 2G4IA 3HBZA 5JIAA 1R092 2IZWA 3TAYA 5T5OA 1NQDA 4OLLA 1PVC1 1KFXL 4ORFA 2WZPP 1HRI1 3ZYIB 1CAVA 2XLGA 5C6CA 1PIV3 3KM5A 3U10A 2R041 1D0HA 2VUAA 4LLOA 1RC6A 1QJY2 1PO22 4C0HA 3MFCA 5CIRA 4KBBA 1F5JA 3BU7A 4M01A 4MXWB 1RGSA 4ATFA 3TRSB 2Q30A 1RUE2 5BUVA 4HETA 1APNA 3KB5A 4C1XA 4LUKA 3VHOA 3RYKA 4L92A 3UJQA 2JICA 2AYHA 3VKFC 2FZ2A 4YFWA 4YSFA 1XE8A 4S2FA 1M06G 1PGL2 2GAUA 4HKLA 5AC92 3GF6A 2CL2A 1TEIA 2ZKLA 2AUYA 3BIWE 4FSJA 4ES8A 4QM9A 2TBVA 3N7KA 1VBE1 1D4VB 4WZFA 2UURA 5CNAA 1MZEA 4RR3B 3IKWA 5E1RA 4P9JA 2HWF2 2XBO1 3NO8A 3I54A 4B7KA 4R8HA 4EN8B 3ZSKA 5L73A 1LENA 2GU9A 4QQOA 5B2GB 3FBMA 4Z92B 2OW4A 3ZXLA 1L3JA 3D0SA 3UKNA 1GICA 2WFF2 5FLHA 1NA1A 2MEV3 2YGLA 1UU5A 1WBLA 3AP9A 5JVVA 2DUOA 1NCQA 2OYZA 1ASJ3 1MS5A 2VW0A 1ZVFA 1HRI2 2QCSB 4AG4A 5JOYA 2CGPA 4D69A 4N7IA 3ZIWA 2ET1A 4Z2WA 3N36A 4QQLA 4WVVA 4JDOA 4BE3A 2HWE2 4G9SB 1IKPA 3VZNA 1DFQA 4M3CE 4AHWA 3JD72 2R072 1FMD1 4CP2A 5JLVA 4CDQA 3RJRA 3WQ0A 4CDQC 5CFCB 1YIFA 5KBFA 2PHXA 5KHGA 2EAAA 2WZR1 4XE9A 4AWDA 4F3JA 2JG8C 3MW3A 3IPVB 4FP3A 3URFA 5LEJA 4YG6A 3VBFC 3FZ3A 1TMF1 1Z7S2 4N9HA 5FO7B 2ZAHA 3X29B 2PLV2 4N7UA 1I6XA 2SLIA 4JDNA 1HQWA 3RS6A 1VBE2 1BVVA 2R063 2PQQA 1ZBE3 3B93A 3J9SA 4BQ1A 4RHV2 1ULCA 5K0UB 2ZX2A 1OI6A 4QQ2A 1A78A 2LALA 1W6NB 1S0IA 1W6MB 1G6NA 4BA6A 3B94A 2WINB 3PTYA 1EAH1 3LSEA 4Y24A 4OI4A 3B9CA 1CESA 4XMIA 4DOUA 2XVKA 3IIAA 3RSJA 1U5YA 2R32A 1XNCA 3KCYA 2DCTA 1DGWA 2VUJA 3WZ1A 3O12A 1F31A 4M0HA 2ZMKA 3NWKA 1ND2A 1ZYBA 3QOPA 2VNGA 2BNMA 1BEV1 4XF0A 4I2OA 1VBB1 1QJU3 1DQ5A 1XXNA 4UXAA 5HI0A 2FMYA 3DPRB 2X29A 5DG1A 1FMD2 3S30A 2WL1A 4PBPA 4PBOA 4B29A 5FBZA 1RVF2 2AREA 4K1ZA 2PHDA 3HT1A 4IV3A 2QUOA 5J09A 3KGLA 1AR93 2A3XA 3SNMA 4CRQA 4HBNA 5I8YA 2DFBA 2RMU1 4ZXKA 5KXBA 5E8AA 1UD1A 2QNKA 1DHKB 4CDWA 3AP5A 5DDJ1 3ZVXA 1G9DA 4Q4Y3 3VHNA 4L8QA 2ZA9A 1KS4A 4JQRA 2AENA 2NMOA 2VQAA 2YV8A 1RTVA 1QJX1 1OFNA 2DUQA 1LU1A 4FCAA 4H7LA 4I3PA 4NWVA 2DCYA 4WBBA 4WV8A 4XIOA 3WOGA 2OVUA 3CLPA 4O9GA 1VBA2 2YY1A 3B9IA 4Q0SA 3VZOA 4YW4A 1ZRDA 1TNFA 2BGCA 3J8F2 3ZFEB 1HXS1 1SLLA 1AYM1 5T50A 5CADA 1A8MA 3SH3A 4Z1VA 4HVOA 2E63A 1PVC3 3DKWA 3AZVA 2G9GA 4Q8KA 1RJ8A 2XJVA 3N3HA 2HKXA 4MX3A 4YGDA 4BHPA 2PELA 2R043 1KS5A 2DU0A 3LCPA 3RWNA 4FPLA 2GH2A 1IS5A 3DGTA 4FTSA 4YVSA 2DVFA 4CEYA 3H50A 1OLQA 5CFDA 4A2UA 4YVSC 4CEYC 1COV2 2WT2A 1SFYA 2KA3A 1BBT2 1VBD2 4JV4A 1SMVA 4GA9A 4META 1FNYA 3THTA 2R1BA 2XPJA 4LR4A 4DQAA 1NCRB 2XVGA 2XJTA 1UU4A 2QZ2A 3RDIA 2XG3A 3AKRA 1XU1A 4K21A 4DINB 4COWA 5HXVA 1Z78A 4KNCA 3JBG1 3ME2A 4HL0A 4Q0UA 2D6MA 5J7MA 4QU2A 4Q26A 1BMV1 3MIGA 3O5SA 2ENRA 1KRIA 2XBO3 1J3RA 3JB4C 2SBAA 2H6CA 1PO12 2W08A 2D3PA 2A75A 2PA7A 3E97A 3NKTA 3ZFFC 1IPJA 4NHKA 4LBLA 4HSJA 2HWC2 2CY6A 1AYM2 3L9JT 2CGOA 2ZGOA 1MS0A 3ZYGA 4HN0A 3R4SA 3WQ1A 1V6LA 4Q2FA 1CVNA 2ZX4A 5FLIA 1V6MA 4OVEA 5ABJA 3T2TA 3H1YA 4IEPA 5ABJC 3NW4A 3VZLA 4LO8A 3RMYA 2A6XA 4GXLA 5H9PA 4OHXA 2P34A 3WV6A 3MW2A 2UYAA 3RI9A 3USUA 3SCFA 2GN7A 1SEFA 1OPMA 4KQ7A 3D0JA 3ALQA 1GKBA 1RUJ1 3ILFA 4OI2A 2XLAA 2WKKA 1E57A 2WZR3 1YHFA 1OMIA 5AFEA 5J48A 1CAWB 1QOOA 3GNEA 4Z82A 4P9GA 1TMF3 2GDFA 1HIXA 3U11A 2BBVA 4LBJA 3SHRA 2HWD1 3JBG2 1POV0 4WZCA 2VMIA 1C28A 1YXWA 1O5LA 1IS4A 1YO8A 1UMZA 1YIPA 2TNFA 3CNAA 3FX3A 3VDDA 3QBQA 3B69A 3MEPA 3VDDC 1VRH1 1UIKA 2WWSA 3OY8B 4XOGA 3CL1A 4K40A 2GNBA 3ZYJB 2XJQA 1EAH3 5C8WA 1RUI1 2I74A 4WM8B 1D4M2 1UX6A 4R4ZA 2RR12 1YI7A 1YFUA 4LBMA 2BWCA 1CAXB 2ETEA 4Z07A 4P9LA 5IK4A 3FBYA 1JYCA 3O14A 3FJSA 1SBDA 4UW6A 5EXOA 3AXEA 4JDMA 2O8QA 1BEV3 2EXKA 1URXA 3PNAA 3I59A 2MHFA 1VBB3 1AL22 3PVNA 3FC0A 3RYRA 4YGEA 2QQPA 1C8NA 1MQTC 1W6OA 5H9SA 3FUQA 3U4XA 3O0WA 4Q27A 4N53C 5C33A 5C9AA 1BZWA 4Y1UA 5GLWA 2DUPA 2QDNA 4RD7A 5GZDA 4OI0A 4XQWA 3AP6A 5BPXA 5ACA1 4N43C 4YARA 3MYXA 1RUH1 2HWB1