3WOGA

Crystal structure plant lectin in complex with ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
238
structure length
238
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Erythroagglutinin
publication title Phytohemagglutinin from Phaseolus vulgaris (PHA-E) displays a novel glycan recognition mode using a common legume lectin fold
pubmed doi rcsb
total genus 50
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wogA00
2P37A 1JUIA 2R49A 3HR9A 3V0BB 1N1SA 3ZVXA 3W59A 4DPNA 1YO8A 2YROA 3SH5A 1FAYA 4AVSA 1SLBA 4PQ9A 4NO4A 4FPEA 2ERFA 5T5OA 4Y1UA 3FLRA 1LOEA 4YW1A 2E6VA 1QKQA 3LCPA 2ZAAA 4FOQA 2A5ZA 3VKFC 4AVVA 1A3KA 1F9KA 1AF9A 2P3JA 2WJSA 1EPWA 2A6VA 5DZEA 4BLJA 1GSLA 1UZYA 2A7AA 3SH3A 2A6ZA 1WLDA 4YG3A 4YZ2A 2E51A 2VY0A 2YZ4A 4GWNA 1DLLA 1AX2A 1LOFA 2GNTA 4OZXA 5IK5A 1QMJA 1WD4A 2D3RA 1NLSA 4M3CE 3NWKA 2DVBA 5EYXA 3N3HA 3IKWA 2ZGQA 3AFKA 2AR6A 2CL2A 1MVEA 2ZGOA 1UX6A 5HCFA 3FFZA 4FPCA 4Y20B 3WLUA 2I2SA 4XHXA 2ZKNA 4BOWA 4Y1ZA 1DQ4A 4Y1XA 3W58A 1GKBA 1SBDA 1QDOA 3RMYA 4Q2FA 3RSJA 2XB6C 3WUCA 2AYHA 2PHXA 1Z78A 1G86A 4ITCA 2LALA 4ASMB 3DGTA 1ULEA 2D6KA 3FBYA 3DUIA 2ZGNA 2EF6A 5T5JA 3A0NA 3T2TA 5E8AA 4Y26A 1BKZA 1OFSA 1BYHA 2ZMKA 2Q5TA 2VW2A 1MR5A 1MS9A 3ZSMA 5GZCA 1ULDA 2DVFA 2WKKA 3SISA 2NZ9A 1SCRA 2A6XA 1N1VA 2EIGA 4K1ZA 5FRAA 4AGVA 2OW4A 5SV8A 2GN7A 3LSEA 4FPKA 4P14A 4Q27A 5CNAA 1JBCA 5CB7A 3M3EA 2H0BA 2NMOA 2DURA 3VKLA 1AX0A 1DIWA 4ATFA 4UW6A 1N3OA 3AK0A 4Q26A 1IS3A 1GV9A 3WG2A 4KBBA 3WCSA 3RMXA 1SLTA 1MZ6A 3KQRA 4YFZA 4Q1RA 1QDCA 3M3CA 2ARBA 1SLCA 1RIRA 1WD3A 1YI7A 2CTVA 2DTYA 1KJRA 2D3SA 3A4UA 2NP0A 1AVBA 2AGSA 4LBMA 1GNHA 1G9BA 2LTNA 1W6PB 3TB0A 4AWDA 4XYXA 3ZSLA 1O4ZA 1A78A 4H55A 5T5LA 4JCKA 1APNA 2A3WA 3AYAA 4DS0A 3WUDA 2WLQA 1Q56A 2DVAA 2WT2A 3B00A 3FUOA 1F5FA 1MS0A 1MS3A 2A6YA 3MW4A 4Y1VA 1BZWA 1W0OA 3AXDA 5F5QA 4FPFA 4XMAA 5DG2A 5GJ6A 4YM0A 2R0HA 1SACA 1DQ6A 4BQ1A 3AXEA 4YM2A 4CRQA 1S0CA 2D7FA 1ENRA 1DQ1A 5DZGA 3VV1A 2UWAA 4Q8LA 3N7KA 3UJQA 3PVEA 3WG4A 4AYUA 4YZ4A 2ENRA 3SH4A 4HANA 4LBQD 1LTEA 3OJBA 2VXRA 1WW7A 1V6LA 1LENA 2PELA 3B9CA 1U0AA 4C1XA 1RINA 1JXNA 1LU1A 1CPMA 1LOGA 4LBLA 2A3YA 1H9WA 1FNZA 1HDKA 2ZHNA 3N7MA 4WV8A 1G9DA 5GALA 1LEMA 1LULA 1S0IA 4BMEA 1MS8A 3OYWA 1LCLA 2AREA 1N3QA 4XJUA 4U2AA 5DZFA 4W65A 3D6EA 4XTMA 5EXOA 1G9CA 4TYSA 4WZFA 2FHRA 2EXJA 1BXHA 5JOYA 1DYPA 2D44A 3MW3A 5LK5A 1DZQA 2DV9A 3ZSKA 1V00A 1C57A 1G9FA 4JC1A 2GN3A 3OY8B 4IQPA 1GANA 3WHTA 2A6WA 2DUOA 3PJQA 1JOJA 1SFYA 3NV1A 4XMIA 3BOPA 2JDZA 1LHVA 4YZ3A 5KXBA 5KXDA 4FPGA 3APBA 1HKDA 1AZDA 1Q8PA 4Y1YA 1CPNA 1MS4A 1KRIA 1GICA 3ILFA 1CQ9A 4L8QA 3WDYA 1GLHA 1W6MB 2JE7A 2ZACA 3WCRA 4GKXA 4K21A 2WT0A 2ZMNA 3AZWA 1W6OB 2W39A 1BJQA 1JHNA 4BPZA 3N7LA 4FPHA 4UW3A 2GNDA 3BTAA 4LBQB 2AENA 2PHFA 1SLAA 4FPOB 3RQ0A 2GMMA 1H9PA 1URXA 4GKYA 1YRZA 2EAKA 2R0FA 5DUVA 5HCAA 1WCSA 1MVQA 1AXZA 3M3QA 4SLIA 1J1TA 4GXLA 5JOXA 3USUA 2P3IA 2A70A 2DUQA 3AP5A 3FLPA 4YLZA 3WDWA 1V6OA 3AYEA 4M00A 2PHRA 4FOVA 5BYNA 4XOGA 4ATEA 1LOBA 2D6NA 1ZA4A 2DU1A 1Q8SA 4HL0A 3CNAA 3GNEA 1Q8QA 4YGEA 1LHOA 4R9BA 5IK8A 2PHUA 3BIWE 1JN2P 1SCSA 5GZFA 4BM8A 5GLTA 4FP3A 3HMYA 3V64A 2WNEA 2ZGRA 3N36A 1GZWA 2C5DA 2XG3A 1AJOA 2OVUA 3OY8A 4LBKA 3VKNA 1YIFA 5H9QA 4JRAA 3IPVB 2AUYA 2ZGUA 2DYCA 3V0BA 1S0BA 5E89A 3POSA 3UL2A 3V65A 3IM0A 2E7QA 5GZEA 2GALA 2HYKA 3C2UA 5T5PA 4LBNA 1UKGA 3U4XA 1FV3A 2DTWA 2R1BA 1WUVA 4Y24A 2OUHA 3VKMA 3M1HA 2A75A 1FNYA 1HQWA 1W6MA 1UL9A 3ZPYA 1GBGA 2A3XA 2D3PA 4FP2A 1AJKA 3O5SA 5EYYA 1G7YA 4YFWA 1KJLA 1QOOA 1GYKA 4LBQA 3O0WA 5DUXA 1IS4A 2WSUA 1WBFA 5DG1A 4LBOA 3ZXJA 1PZ8A 3B69A 1AXKA 5F9TA 2ZGSA 5JDBA 5AVAA 2ZGKA 3AP7A 2D6PA 1QOTA 5FREA 3O12A 3WV6A 4Y20A 1IKQA 2ZMLA 4AVTA 4PF5A 4YGBA 1IKPA 1MACA 3B3QE 3T1MA 4XDQA 3O0VA 5DUWA 1F31A 3WHUA 3ZSJA 1C1FA 1W6QB 2TEPA 3PVNA 1DBNA 4DRRA 2ZHLA 3ILNA 1HLCA 2W68A 2ZGTA 2ZZJA 3ENRA 4XXAA 1UPSA 3QLQA 1ULFA 5EWSA 1D0HA 2UWBA 5JLVA 1CVNA 1XQNA 1VALA 3UK9A 3NV3A 1SLLA 2YXSA 1DQ5A 2GMEA 2D6OX 3L2YA 3AZVA 3INAA 2PHTA 1QNWA 2EXHA 2E53A 2ZGPA 3IPVA 4XIOA 1WW4A 4YW2A 3QCWA 5KXCA 1DYKA 1SBFA 1G8WA 3ILRA 2D6LX 1GNZA 3OBTA 1KDMA 4P9WA 5H9RA 2W52A 5HCBA 2B7YA 5JVVA 1QOSA 1WW6A 1KITA 1LHNA 1LOCA 1O4YA 3D5OA 1DHKB 4D69A 2C9AA 3ZXEA 1JYCA 1QU0A 2ARXA 1QF3A 1S1AA 3H0OA 3NV2A 2YV8A 4WVVA 2VH9A 4MYEA 3D4KA 4BLIA 3IN9A 4YW3A 3ZXLA 3WOGA 1IS5A 2NN8A 3WDUA 1YYNA 3V0AB 1N47A 1W6PA 4TZDA 1JW6A 4FPJA 4XILA 1I1EA 5GLWA 2JECA 4ISRA 3ZYPA 1FX5A 1WW5A 1LU2A 2VUAA 4GWMA 5CA6A 4F83A 5JMCA 3ASIA 5KXEA 2NMNA 2EXKA 4YM1A 4YG6A 1LOAA 3ZXKA 1ZM1A 3R4UA 4YZ1A 1W6NB 2YY1A 3KM5A 3R05A 2D43A 1Y7BA 5DUUA 1Q8VA 5IT6A 1FV2A 1LOFC 2EXIA 4Q8KA 5IK7A 1QNYA 1CIWA 4YGCA 1JYIA 3MPPG 1GZ9A 1ONAA 1VIWB 1CESA 3UJOA 2P3KA 4XBNA 4DFSA 1UMZA 2DUPA 2OUJA 3HN1A 3RS6A 3Q9OA 1DQ0A 1LHWA 4GALA 4LBJA 4FQ4A 4M01A 3GALA 4Y22B 3WDXA 2VU9A 1W0PA 3I4IA 5JOWA 1I3HA 3AZYA 2GMPA 1ULGA 1S0FA 2ZHKA 4R9AA 3AYDA 5GM0A 1PZ9A 1X50A 4P9XA 1DQ2A 3FLTA 2CYFA 1N3PA 4I30A 2WQZC 4XJ9A 4YM3A 1DGLA 3JU9A 4XBLA 3POWA 3OBRA 3N35A 4XXPA 2DVDA 2UU8A 3WG3A 2CWSA 4AGGA 4P9YA 1MS5A 1S0DA 2SLIA 2V5YA 4NOTA 4YG0A 3ZYRA 3V0AA 2ZGLA 1V6MA 1UN1A 4YW5A 5CBLA 3PVOA 1FATA 1WLWA 4ISQA 1KQRA 1BQPA 1A8DA 3T1LA 4FPYA 1MZ5A 4RA0A 1IS6A 1W6NA 3AZZA 2GNMA 3RRDA 4XHBA 1V6NA 1AXYA 2E7TA 2UWCA 1MS1A 2ZBJA 4XE9A 3AP9A 3WDTA 1VAVA 4PBOA 1V6IA 1W6OA 3AJYA 4C1WA 5T52A 3POYA 3FUQA 4FVVA 1PZ7A 3NV4A 4DRVA 1N1TA 1C4RA 3R4SA 5CAZA 2DVGA 3M3OA 1UZZA 2BQPA 2ZHMA 4Y22A 1ENQA 2SBAA 2YMZA 1LHUA 4FOYA 4XTPA 1R1ZA 2RHPA 4UW4A 4PBPA 3VKOA 3WG1A 4M3CB 2EALA 4Q1PA 4YW4A 2ZGMA 4M3CF 2VW1A 1Q8OA 3OYWB 3SLIA 4CTEA 1CJPA 2D6MA 1V6KA 2GNBA 2NYYA 4FOWA 1ULCA 1SLIA 4Z8BA 3BODA 1AX1A 1WLCA 1Z0HA 4K20A 4XJ8A 5L73A 3LSDA 3VUOA 1IOAA 3IMNA 3AJZA 2FMDA 4WVWA 3AP6A 2VW0A 5H9PA 1HQLA 1LGBA 1GZCA 2ZA9A 3PMEA 4GA9A 4XBQA 5E88A 5GZGA 4YZ5A 3B01A 2JE9A 1VLNA 2GDFA 4R9DA 1LODA 5T50A 2ES3A 1DFQA 2CNAA 3WZ1A 1LGCA 1S0GA 3WNXA 3MEPA 2CWMA 2A71A 3JUUA 2Z42A 4XJAA 1KDKA 2PHWA 3WDVA 3ZXFA 1H30A 2ZABA 4FPLA 3MW2A 1YXWA 2P34A 1CONA 4U36A 1S0JA 1V6JA 1LESA 2AH2A 3AZXA 2JJ6A 1B09A 3AP4A 5T54A 3N7JA 5IUQA 3A0KA 3RG0A 3O0XA 1S0EA 4XJZA 3OGGA 3I8TA 5GZDA 4BMBA 2W08A 4XJWA 1ENSA 1OKQA 1SBEA 1LGNA 4R9CA 1D2SA 1RITA 2R16A 2R1DA 4UW5A 5DXDA 4AGRA 4RL7A 5GLVA 1VAMA 4M3CA 1NXD1 1LECA 1C1LA 4XZPA 2KM2A 5JOZA 4ZXKA 1G9AA 3M2MA 4ZKTB 1N1YA 3AX4A 4XIKA 3SITA 1W6QA 1FYUA 5T55A 2UURA 2JKBA 4CZSA 3USUB 2WSVA 3AYCA 3TAYA 1OQ1A 1UAIA 2WT1A 1QGLA 3ATGA 1CN1A 2DU0A 5GLZA 2CY6A 3SNMA 4DQAA 1LJ7A 4FQZA 2P2KA 1CR7A 4PCRA 3WVJA 5GLUA 2NM1A 4YGDA 2G4IA 1GZWB 5H9SA 2JD4A 1LEDA 1WBLA 5IK4A 3OPZA 2DWRA 1TEIA 4K1YA 2V73A
chains in the Genus database with same CATH superfamily
3KV5A 4NIIA 3ZXGA 1F5JA 4MG2A 4DPNA 3W59A 1UXXX 4AR2A 1YQ8A 4XDPA 2Y6HA 4GIQA 4NO4A 4FPEA 4W6WA 5KC6A 2ERFA 1HRV3 4BZ4A 2E6VA 1H4GA 2H6CA 4FXKB 5LA2A 4QGNA 2A5ZA 1HQNA 4AVVA 4BLJA 1AF9A 5IHRA 5JSRA 1EPWA 2A6VA 3SKVA 4LO7A 3FMGA 4KI5M 2JXAA 4OZOA 4YG3A 1PMIA 4FTSA 4GWNA 2VECA 1PNFA 1AX2A 1QMJA 4MXWB 1NLSA 3VGIA 3NWKA 4BH9A 2DVBA 3ZYIB 3AFKA 1RUJ1 4E4HA 4OI0A 1DGRN 2AR6A 2CL2A 3THTA 4FAGA 5HCFA 3FFZA 3MI8A 1AL23 4FPCA 2I2SA 3S30A 5FLHA 3OBAA 3VBUB 2ZEYA 4Y1ZA 4JKKA 3ZIWA 5JSPA 3BUCA 1HX6A 1TME3 4M4RA 3WW4A 3JBG1 1QDOA 3I2GA 4OI4A 5BPXA 2XB6C 2WNVB 1CIYA 3T4VA 1Z78A 1AR71 1JI6A 2RR13 1SMVA 2X8KA 3DGTA 3U75A 3FBYA 4META 4QT6A 1I9RA 4N43A 1W2UA 5E8AA 4CDUB 1BKZA 3WW3A 2BFUL 3RZKA 1MR5A 1GQPA 1ULDA 3PLQA 3I54A 4UF0B 5FYUA 2WKKA 1OLQA 5FRAA 1V9U1 2EIGA 4KWKA 5DAPA 2OW4A 3KVAA 5CFDB 4FPKA 5CNAA 4AHYA 4K9SA 5L9RA 2FDFA 3NVCA 1K5JA 2RJKA 3RZJA 2RS52 1QQP1 4ATFA 3AK0A 3TYJA 5ACA3 4OHZA 3POBA 2VZTA 2ZX3A 3CIHA 3H8OA 3AVRA 1ZRCA 2X5IA 3F2ZA 3RMXA 1B35A 1RUF3 1YI9A 1ULOA 3BPSA 2HBTA 2WN2A 2CTVA 1WD3A 2RDRA 5LA1A 2D3SA 3A4UA 2MPFA 1R64A 2XMLA 1ZBA1 3GJBA 5GKAC 2ZX4A 4AFAA 3H3UA 1GNHA 1XC6A 4EQVA 4AWDA 4NRPA 4XYXA 3ZSLA 3F95A 4H55A 5T5LA 3DYOA 3K3NA 1APNA 5FPXA 3AYAA 4L2NA 3WUDA 3BTYA 4Q4V2 2DVAA 2WT2A 3B00A 4BHPA 2QTWB 2VL4A 3VBUA 2HJIA 1UYPA 1F5FA 3FUOA 3GYDA 4ARXA 1H1AA 5A7PA 5CU1A 1BZWA 5LCWL 1BEV3 4R52A 3HPNA 1GOGA 4QQPA 4XMAA 2WNVA 3DL3A 4YM0A 3M4FA 2R0HA 2K46A 4W50A 2JDNA 1CAUB 1XYPA 2BOIA 2G9GA 4CRQA 1K45A 3MHZA 2JG9C 4E8CA 1JOPA 4CDUA 4UI9L 4XUOA 1STMA 5LA0A 2ENRA 1ZYBA 2VOVA 4TTGA 3OJBA 2VXRA 3K48A 4UF0A 3GBGA 1LENA 2OA2A 1U0AA 1VP6A 2VXJA 1QJX1 5CFDA 1VBB2 3KF3A 5BNNB 2CV6A 1P8JA 1RINA 4MSVA 1RHI1 1LU1A 1CPMA 2QCSB 4GJZA 4PHZA 1DZTA 1H9WA 4NAMA 3J7LA 4Y5TA 4EZ4A 1ODMA 2GC1A 1XNDA 5C70A 1N3QA 1O5UA 4WM8B 2BFUS 5EXOA 2ID4A 4TYSA 3PIGA 3ACIA 4A6SA 4F3JA 1BCXA 5CKQA 3VDDC 3MW3A 1ND3A 2XHNA 4GD4A 3VD3A 1VJ2A 2DV9A 2Q1ZB 4PI2A 4LOSA 1R1A3 4CEYC 4EWEA 1DGRA 1W9TA 1ZZBA 3TWIA 3WW1A 2JB4A 4IQPA 4BU2A 5J7MA 2A6WA 3W20A 4CEWC 2BU9A 2YB7A 1HV1A 1VRH1 4LK6A 5G04L 3ZDSA 1MEC1 2Q4SA 1XNCA 4CU8A 5FXZA 5FYCA 1ULPA 4YYOA 3APBA 1Q8PA 2Z69A 2P6HA 2VVFA 1CPNA 3HWJA 3SCGA 2BZDA 3T2QA 4AFBA 3HIFA 4H3WA 4L0PA 4O65A 1CQ9A 4QX5A 4WM7C 1AR83 1ZBE2 2JDPA 1E5RA 2BW8A 3PUIA 1W6MB 2C6SA 2WLPA 2ZACA 3FHAA 3QBQA 4GKXA 2GC2A 4OHWA 4QHBA 3WCRA 5F1RA 1W6OB 3MIBA 2BYVE 2XXZA 4BPZA 5IATA 4LE3A 1JYWA 5LASA 1US2A 4LBQB 3I49A 3SMHA 2AENA 3E5UA 3J7NA 4LKEA 3I2IA 1W2TA 4CCMA 1PMJX 2GMMA 5BNNA 2DCJA 2J42A 2EVXA 2R073 1GP4A 3ETQA 1OQDA 2H0VA 4IE5A 1MVQA 2V5DA 4LMFA 1QWRA 3K46A 3AL6A 1K3IA 1UOGA 1J1TA 2PFWA 2WZR1 1AYN1 4GXLA 2A70A 2O8QA 2XR4A 4WM8A 3TNPB 1PNGA 3AYEA 3VZKA 2WAOA 4O9GA 1LOBA 1Q8SA 3T30A 5KBFA 2GU9A 4R9BA 5GZFA 3ZYGA 4NN0A 4XACA 2YBKA 2ZGRA 3N36A 1RUG3 1CZVA 1PGSA 1J59A 3K51A 1LR5A 1YIFA 2ORXA 1DGWA 2YFUA 5H9QA 4OMDA 4BYYA 4CU6A 1AYM2 4AHXA 2ZGUA 3TEXA 1JUHA 1S0BA 3WXPA 3POSA 2E7QA 4XVHA 2UY8A 3KWVA 4Q4W1 2HYKA 5D2AA 5GZEA 4HFSA 5FYYA 2RS32 4LBNA 2PQSA 2B8MA 1WWYA 1RUH2 4LUKA 4BISA 5HPOA 4Y24A 2OUHA 3M1HA 2A75A 1BMV2 2VMHA 1W6MA 3ZPYA 1COV2 1UL9A 3O7OA 1GBGA 2A3XA 2D3PA 2V09A 4FP2A 3O5SA 1OSGA 5I0SA 5EYYA 4KWLA 3OUIA 5FXXA 2Q1FA 5DUXA 5IVEA 4LBQA 2QQPA 2WSUA 4HVRA 2VZSA 1PZ8A 2HWF1 3I3QA 5AVAA 5FREA 1QOTA 3O12A 2ZMLA 2VULA 5C3SA 5C3RA 5DUWA 5J37A 1F31A 1F15A 2D5FA 3BCWA 3CDZB 3A21A 3ZSJA 4MUVA 2TEPA 4MVTA 2XLGA 3TEWA 3D0JA 4B7EA 4YVWB 1XE8A 3O1RA 5FZOB 4ES9A 4DRRA 2WO1A 5A7NA 1CZSA 5K4LA 2XLFA 2W68A 2ZGTA 2FDKA 3P1IA 1JZ3A 2JDUA 4KWUA 5FZBA 4IE6A 3ELNA 1CVNA 2VOTA 4RQPC 2W94A 3UK9A 1U5XA 4XPVA 2VM9A 2GMEA 2D6OX 2QQLA 1HXS3 3PUAA 1D7PM 2PHTA 1QJY2 2EXHA 1GMMA 2ZGPA 3MUY1 5FCCA 5C3PA 3H42B 5ANNA 2YGLA 4Y33A 5BV6A 2YBSA 1PO23 3RVHA 1GNZA 1L7RA 2PYTA 4LJHA 1WMFA 3CLPA 4NWVA 5DMYA 5AVPA 3RZMA 4I3GA 2W52A 4NAOA 2B7YA 5JVVA 2R30A 4AEMA 1GUIA 4INDA 5L19A 2IXHA 4OUEA 3N9LA 3U07A 4IGQA 4QQLA 2C9AA 3H0OA 1DCSA 1YQ6A 1S1AA 5FAXA 2YV8A 3QH6A 4WVVA 5C4WA 1U5YA 4MYEA 4YW3A 3MFCA 1W6PA 3BOWA 3LD8A 1W90A 1PIV3 3HBKA 5ANQA 5GLWA 3SHRA 3OCPA 1S2BA 5F3CA 1WW5A 1W99A 3OGVA 2D97A 1JZ7A 2RS51 3I3BA 1XYOA 3CZUA 5LA9A 5FOJB 2B39A 3LPFA 4YG6A 3ZXKA 4XFGA 5KR7A 1PMHX 1W6NB 2YY1A 1NG0A 4Y4RA 3FHIB 3KM5A 4HKLA 4IE0A 3ZFEC 1RUD2 5DUUA 4XETA 5FZOA 1JU4A 2VQTA 3LF7A 1QNYA 1CIWA 5IK7A 1JYIA 2HWB2 1F4AA 4JGYC 1UXZA 3LWCA 5ERLA 1EV12 1NLRA 3HN1A 4MOAA 4Y5SA 5FPUA 3Q9OA 1Y43B 2GC0A 1LHWA 4Q4V1 5CFCB 1VAKA 2WWSA 5EQUA 4OMCA 3IDAA 1W0PA 3AZYA 3UGFA 2GMPA 1ULGA 1S0FA 3OB8A 4LULA 1HRI3 3J4UH 5FP4A 3AYDA 4B7KA 4E8DA 3NMBA 1RJ7A 1OVPA 3ES1A 3FLTA 2CDOA 2CGNA 4Z2WA 4OUSA 3JU9A 1AR61 5E6HA 3N35A 1C28A 1Q43A 2VTXA 5A3PA 1W9FA 2A1XA 2UU8A 1LB2A 5DABA 4RR3B 3FX3A 4CP1A 3VBFA 5FR3A 1VBB1 1V6MA 3NJVA 1UN1A 4QX0A 1RUI3 4COZA 5AC93 4NHMA 2JDKA 5CBLA 1FATA 1UIKA 4XFFA 3RZGA 4DZGA 1VBA3 1BQPA 1EAH2 4GH4A 4WZCA 1AR93 5DAXA 3T1LA 1IPKA 4FPYA 2ZOEB 4EN0A 1VBD3 1WCUA 1W6NA 1ZRRA 5FO9B 4N9IA 3RRDA 3L2HA 1NKGA 3PNAA 5EJZB 4E27A 2VZOA 4MX3A 5FYIA 5I8SA 4MHUA 4NPRA 3IT8A 2ZBJA 3ACGA 3I3DA 2Z5WA 3NAPC 1J3PA 4MO3M 1KEXA 5D8AB 5FY9A 5KC5A 4CCKA 2VBBA 3LFIA 3POYA 5FYZA 5CAZA 2VMIA 3RZZA 4UYBA 5HI0A 2ZZQA 2C4XA 3CL1A 3KB5A 4AF9A 5IFTA 5CFCA 2Y64A 2Y6GA 4XTPA 1WMEA 2Q8OA 5FY8A 1X7NA 2RHPA 2EICA 4PBPA 3BI3A 1XYNA 3KVBA 4Q1PA 3T0DA 2CU5A 1NA1A 2AACA 4D94A 1Q8OA 3OYWB 3SLIA 3WF0A 4K40A 4TXWA 1V6KA 1ZBE1 4D8MA 1SDWA 4LKFA 4FOWA 4XURA 2P17A 1ULCA 1NCRA 5DDJ3 4MADA 1X33A 3B93A 4A7KA 4RR3A 3AMMA 2KD7A 4H2AA 2XVLA 3IMNA 2FMDA 4WVWA 3VBOA 2VJXA 1HQLA 5ABJA 4AAXA 4YZ5A 5A33A 5I0RA 2JE9A 5FTTC 2GDFA 1LODA 3J8F3 3WZ1A 1JYVA 5L7OB 3WNXA 4A3ZA 5A3TA 2Z42A 4LO8A 1KDKA 1M4WA 2XKPA 3WDVA 3DV8A 1ZRIA 3PMSA 4P08A 2YC2A 2WQ8A 5I0TA 5IVJA 3MLKA 2P34A 3OBZA 4QGLA 3ETPA 4U36A 1V6JA 2Y6FA 4WVMB 1RMU3 5K9YA 2RDSA 1HB3A 1B09A 3RG0A 3A0KA 2Q1MA 4BWOA 1XU1A 3OGGA 4BMBA 3VZNA 3MGUA 1EP0A 5L7OC 2W08A 1UNBA 3H7YA 3HEIA 1AYM1 1LGNA 1NQJA 1D2SA 2VOXA 1MZFA 2R16A 2R1DA 4UW5A 5DXDA 2B5HA 4RL7A 3D8CA 2BGOA 2XKOA 3MLLA 1NXD1 1FMD3 2RS31 2XVGA 1C1LA 4XZPA 3DPRB 3M2MA 5FO7B 2WO2A 3LGRA 4YPJA 3J9SA 1N1YA 1OLME 4YW6A 1A34A 1BMV1 1H6XA 2R062 2JKBA 2ZKLA 4NHYA 4N7UA 5T55A 3USUB 1W8OA 2WSVA 3W5NA 1D2QA 1OQ1A 3HNMA 1UOBA 2OT7A 2QQNA 4UXAA 2DU0A 5GLZA 3LFMA 1W0NA 2CY6A 3EJKA 4DQAA 1LJ7A 2BGPA 3CQOA 3I59A 4Y3OA 5FZGA 5FOBB 5BNOB 5GLUA 1YFUA 1TME2 3KHBA 2G4IA 3CO2A 1GOFA 1TMF2 4LA2A 4NRQA 2JD4A 4QX8A 5H9SA 1RGSA 4F7ZA 5ISLA 5LZ6A 4P9IA 1RVF3 1XB9A 2P37A 1JUIA 3HR9A 4QHOA 4QPGC 4CDWB 3V0BB 4ZHNA 2PAKA 3ES4A 2W1WA 2YROA 1YNAA 4AVSA 1SLBA 4PQ9A 2RVAA 4CDQB 1DLCA 5FKCA 3FLRA 4LO5B 1QKQA 5EV7A 4BQ2A 4RHV2 3E97A 2WJSA 4WVMA 4ZONA 5DZEA 1WCQA 4LT5A 1UZYA 2A7AA 3SH3A 3RYPA 5JI9A 1J58A 2E51A 2TBVA 3ACFA 2JIGA 1UU4A 4MXVA 2YDEA 2D3RA 5FZKA 1QJY1 2AC1A 1VBE2 3ON7A 4HVQA 2DCYA 1RUE3 4CDQC 2ZGOA 1PVC3 1NQDA 4Y20B 4BOWA 2O1QA 4XHXA 3DPRA 2VQAA 4E4DX 1O8SA 3ZFGB 2FCTA 4IV1C 1SBDA 5A3LA 1W9SA 5FZCA 1ST8A 4Q2FA 3WUCA 1NE4A 5JAXA 5F7UA 2PHXA 1G86A 3TRSB 4QXKA 4ASMB 1ASJ1 3OGRA 3WNKA 3A0NA 4DEQA 1KS4A 2WINB 5BNOA 3OOXA 4BXFA 1BEV2 5GZCA 2XJRA 4MGQA 5C8CA 5FZ1A 1LKNA 1H8TA 1SCRA 2A6XA 2NZ9A 3C3VA 2HEVF 4MZUA 4CDWA 2O8OA 5LEKA 3KD4A 1K5MC 2EIBA 1W8ZA 4P14A 5CB7A 3WF4A 2JICA 3M3EA 4XUPA 1UX7A 3NNMA 4YZ1A 4K8FA 3VKLA 3GF6A 2XOMA 5FZFA 4RN5A 4NIDA 1OC1A 3IAQA 1J1LA 4UW6A 1N3OA 2R043 1IS3A 4KBBA 5J3UA 2PLV2 3JB8A 4CCEA 4ZY9A 3PTRB 2WS93 2HWB1 1SLTA 3WQ7A 3BU7A 2VVEA 4Q1RA 1EV11 1QDCA 1W28A 1SLCA 3NJZA 1RIRA 4ZZ5A 1YI7A 1KJRA 1GNYA 3HQXA 4NR1A 5FUNA 2OYZA 2AGSA 2X09A 5CZKA 1G9BA 3WP6A 3TB0A 4YW7A 4DMIA 3I2KA 5A6QA 4JCKA 1JH5A 1R092 3ME2A 2A3WA 5FP8A 4AEJA 4DS0A 2VNVA 2VZVA 3WNPA 4X6RB 1D4M2 1TNRA 3ZFGA 3ZR5A 1MS3A 4Y1VA 4ARYA 2ORZA 3CHXA 5F5QA 4FPFA 1SDDB 5C3OA 3W5MA 4XFIA 5GJ6A 3ROUA 3LQCA 3MIFA 5FK7A 1R1A2 1SACA 4KU7A 4QB1A 4XUNA 1JYNA 4EZHA 3S57A 4IEPA 3OPTA 4YM2A 4EN9B 2UWAA 4Q8LA 2NQYA 3N7KA 3TN93 3DYPA 1PM7A 1CAVB 3CJIC 5B4NA 2P5BA 4HANA 1YIPA 4S2HA 4NROA 3Q8FA 5L36A 2XONA 4Z92B 2PELA 4CU7A 2HYXA 3W9AA 1QIQA 4CDXB 4ZZ8A 1EAH1 4LPLA 3OEBA 5JPNB 1JXNA 5FPLA 4M0HA 3VBSA 4DY3A 1X36A 4QD2A 4QB2A 1KFXL 1TNFA 3H9AA 4RS5B 1FNZA 1HDKA 2GAUA 1RJ8A 2QFEA 3GZEA 1POV1 1LEMA 1LULA 1J84A 4WV8A 5GALA 5A3UA 4QPIA 1HV0A 3SC7X 2H6BA 3M8LA 1H0BA 4JRLA 3HBZA 4XJUA 1H2LA 2Z4FA 4U2AA 2UYBA 5DZFA 4MGIE 4K6BA 4XTMA 1G9CA 5E16A 3ZKUA 1WCDJ 1BXHA 3ZKYA 5J48A 4MGYE 4QKFA 3R4DB 1OD3A 1JU3A 1T6BX 4CVUA 3LEIA 3K2OA 4A41A 4LIVA 5B4XA 4JC1A 4RS5C 2BVBA 2JKXA 2GN3A 2XJUA 3O14A 4NPLA 4UFJA 4HK8A 3WHTA 4AG4A 2DF7A 1XJAA 1SFYA 4XF9A 4XMIA 5IVVA 1GWKA 2JDZA 3DECA 5JXJA 4WBBA 1OXCA 2BEOA 1A6CA 1FOD3 3PVBB 3HN3A 4ZPIA 3RYRA 5BNPC 1W2NA 3LDKA 1RUG2 3RJ2X 2YYOA 3NNLA 5K8SA 2BDRA 3S5AA 1S4CA 4JZRA 1RUJ3 1ZZ6A 1Q3EA 3LA7A 2ZMNA 4B29A 2W39A 3N9MA 3VBRA 1BJQA 1JHNA 3J26N 3D0SA 4OHXA 3N7LA 3P3PA 4LTAA 5FZIA 4FPHA 4UW3A 2GNDA 1CAXB 3JBG3 3PUSA 4CDXA 2PHFA 1SLAA 1PX4A 4QB6A 3RQ0A 4D7SA 1H9PA 1URXA 4KGGA 1AR73 3GBFA 2XUEA 2R0FA 3OUHA 4D0QA 1YFWA 1BBT2 4QPYA 2QZ2A 3GBWA 1W06A 4C0HA 4LO6B 1QY4A 1JZ4A 5F5IA 1YJKA 5FY0A 2PAMA 4E2QA 4N43C 5FBZA 2W3JA 4Z1VA 1OOPB 1NAEA 3AP5A 3FLPA 1JZ8A 1V9U3 5IJRA 4FOVA 4JX0A 4I01A 4XOGA 1YC61 4PDWB 3VHRA 3GNEA 2ZX2A 1LHOA 4NMIA 1JN2P 1QQP3 4RSUA 2BBVA 3RJRA 1GZWA 4JKMA 2RDQA 2XG3A 2OVUA 1OHFA 1OPOA 5FQ0B 3WX5A 4BIFA 4DXZA 3ZOIA 2AUYA 4S2DA 2WA3A 4HOOA 5E89A 2W87A 4AOCA 2X5IC 3KV4A 1IHMA 1UIJA 1OOPC 5FYHA 1B35C 5JXHA 3E6BA 3VD5A 1ZBA3 3U4XA 1FXZA 2R061 5FPZA 4CSWA 2HWE2 4PDWC 5CYYA 2R1BA 1HXS2 4EN7B 1VRBA 3KZ4C 4EWAA 1FNYA 1HN1A 3U10A 3CJXA 4ET7A 1UMHA 2IXIA 1CJDA 4W6XA 1X9TA 1PO22 4YFWA 1PO12 2BWAA 1KJLA 2WAAA 3C7FA 1CAXA 1TMF1 5A6XA 5D1IA 3O1MA 4MXWA 4Y4YA 5DG1A 1YQCA 2GC3A 4LBOA 3ZXJA 1QJFA 2JG9B 2QQWA 3B69A 4CCOA 1X9PA 5F39A 2QQVA 3CU7A 3K4AA 4GULA 3VL8A 4AVTA 2BNMA 4N7IA 4IE7A 3EHKA 4YGBA 1OA4A 3T1MA 3B3QE 5HXMA 3KGZA 2WNUC 1C1FA 3JB4C 5A7WB 3D3AA 4RHV1 2E31A 3RZHA 1QJX3 3T08A 5F5AA 3RDIA 1PIV2 3VN4A 3OTFA 4IL7A 1IQDC 2DBNA 3ILNA 1RHI3 2ZZJA 4PLOA 5EWSA 3BIEA 1X82A 4Q0VA 2UWBA 2UYAA 5FY1A 5LY2A 3NV3A 3R6SA 3DF0A 5EP9A 1SLLA 1VBE1 2VAUA 2FZ2A 2RM22 1WCKA 3L2YA 5FQ0A 2WA4A 3RFRA 2OPWA 5I8TA 3VDDB 1NE6A 3QCWA 4AQ2A 1DYKA 2WFPA 5I8YA 5EFUA 2W92A 4EYUA 4CEYB 3C7OA 4JGZC 2QDNA 3OBTA 1RC6A 2XBO1 4P9WA 5HCBA 3VLBB 5A6ZA 2Y6KA 1ND3C 4CEWB 3EO6A 2W47A 4RD7A 5IVFA 2XJVA 4D69A 1JYCA 1QF3A 1UCXA 1VRH3 1V0AA 1BEV1 1MEC3 1REDA 1J3QA 5KHHA 4WM7B 2Q0AA 3WOGA 2NN8A 1YYNA 4LEJA 2AEZA 4OULA 4TZDA 5I91A 4XILA 2E26A 1Z7S2 3VB9A 3GGLA 1R082 4GWMA 5CA6A 5JMCA 4F83A 3L9JT 4D6SA 5KXEA 3NKGA 3DYMA 3NNJA 3OEAA 2F6BA 1LOAA 2DBIA 1ZM1A 4YM1A 5T3NA 3S5QA 2FBEA 2PLV1 1UY2A 2ZEWA 3JQWA 1W03A 3R05A 4O9EA 4V2WA 5JI7A 1H1MA 2X29A 1Q8VA 1CAUA 1FV2A 1LOFC 2EIEA 2EXIA 4Q8KA 1NLQA 1JYXA 3HQRA 4YGCA 3AM2A 1VBA2 2OZ6A 2VMEA 4P9LA 1W9YA 1GZ9A 2QDRA 2VNOA 1Y3TA 2JIJA 1VIWB 1CESA 3UJOA 2P3KA 2HKXA 2ZPXA 1UMZA 1KXGA 3Q8BA 2DUPA 2OUJA 1AYN3 2WZR3 1O8PA 1R091 1GZTA 1RUC2 3GDBA 4GALA 4IUGA 4LBJA 3VDDA 5JIAA 5IAXA 1D4M1 2VR4A 4CYDA 2MHFA 2WWUA 4QDRA 4EJRA 5JOWA 3IIIA 5A32B 1QJU2 3VHNA 1NUKA 2QVSB 4R9AA 2E7AA 1UZWA 4B1MA 1PZ9A 1R1A1 1X50A 4QX1A 4RYDA 3KF5A 2W2IA 1DQ2A 2YC4A 5FUIA 1DZRA 4CEWA 2CYFA 1N3PA 2WQZC 4XJ9A 4XBLA 2Q8EA 4A3XA 4DXRA 3OBRA 1E5SA 4Q4W3 2CWSA 4WM7A 1MS5A 4XQWA 4NOTA 4TN7A 2V5YA 3ZYRA 3ZFFC 1S2EA 2ZGLA 3KGLA 3WY6A 3PVOA 3VHOA 4AAPA 1OH4A 2WABA 1S2KA 4ISQA 4UFIA 4COWA 1QXPA 5DDJ2 4B3NA 1ZZCA 5LBBA 1J3RA 1MZ5A 4YVSC 1UU5A 2GP3A 4GWIA 3GJAA 4XHBA 1UW8A 1PK6B 3GHMA 2D93A 1W8UA 4YNIA 5FMDA 1W39A 2YPDA 5A7OA 2VCMA 2CGPA 1XNTA 3UT0A 3P6BA 2E7TA 3VDAA 1MS1A 4BDVB 3J8F2 1ZRFA 2HWF3 3AP9A 2XLAA 4XFHA 1VAVA 3WDTA 3WF2A 2GP5A 1C8M2 1V6IA 2WZ8A 1W6OA 4QPWA 5APAA 4DEVA 5KXCA 4NIHA 2CSGA 3FUQA 4FVVA 1PZ7A 3NV4A 1F2NA 3K4DA 3T4HB 1LAJA 3EYPA 4QU1A 5C8WA 3KT7A 3NNFA 1TG7A 3PU8A 4RQPB 3X29B 4CPBD 2YPJA 4HKOA 3V56A 4CU9A 5FDBA 1PK6C 1RMU2 4UW4A 4AFDA 5A32A 2W91A 3FFQA 3VKOA 3WG1A 4M3CB 4Q4X2 1QH6A 3MFAA 5FLIA 4M3CF 2V72A 3HT2A 1JZ2A 5E1RA 4CTEA 4QKBA 1UY0A 3O1SA 5J1XA 3NO8A 2FDHA 1WLCA 2RMU2 4K20A 4KL1A 4RGGA 3EBRA 5L73A 3WSOA 1GP6A 2E33A 1W2OA 3VHPA 3AJZA 1OF4A 2ZA9A 1GZCA 1I5ZA 1NXMA 1TE1B 3PMEA 2WYSA 4A42A 1PX3A 2FCUA 1BBT1 1DFQA 1LGCA 3FE5A 3WP5A 4IV3B 3JD72 1S55A 4IESA 2PHWA 2RS12 3ZXFA 5JR2A 2B42B 3MBWA 2J1VA 3MW2A 3IAPA 5C4WC 2IFWA 4XF4A 1H2KA 5FK8A 3THDA 2YU1A 2HWC2 4LLOA 5C71A 2ETEA 4N53C 2YFZA 3CF6E 5C5UA 2AH2A 2R7EB 2RS53 3AZXA 3ZFEB 3OSDA 5IUQA 1W2AX 3O0XA 3AMNA 1QJEA 1UY3A 1ENSA 4IV3C 3WF3A 5JXGA 3TBDA 2ATFA 4JGYB 4RQPA 3EMRA 3VDCA 3WF1A 4PQQA 4AGRA 3LEMA 5GLVA 1VAMA 4GB32 4M3CA 4AEKA 1WGPA 2KM2A 2HWE1 1G9AA 1CAWB 1HXS1 1ALYA 3EB7A 3ZO0B 4C91A 1QHDA 4R4ZA 2G9FA 2VZ3A 4M0NA 3AYCA 3EXUA 3WNMA 3TAYA 2WT1A 4Q4V3 4YVWA 2XL7A 5IVBA 2ARCA 1QGLA 2V4AA 4C8DA 1CN1A 1PO21 3G7DA 3O1PA 1PO11 3SNMA 5LEJA 4CCNA 5FP3A 4I2OA 2ZEXA 1CR7A 2WN3A 4PCRA 2BVVA 1J83A 1OA3A 2NM1A 3DEMA 4K8RB 3NL1A 1JODA 3H3ZA 3ZMOA 3ZPOA 4RFT0 3FC0A 4AZZA 3UESA 3RGBA 4C0BA 2NP0A 1AR63 2FDIA 2DCKA 1PM4A 1RTVA 4X6QB 1BHGA 1N1SA 4Q4Y2 5HV0A 1YO8A 3MZHA 4GMP1 4NE9A 3SH5A 4AI3A 4CUCA 3ACHA 1FAYA 1O4TA 4XAEA 4Z07A 1G6NA 4CXYA 1VBB3 4Y1UA 1LOEA 4IEXA 5EJ1B 4XCAA 4YW1A 2HEYF 1JHJA 2N7GA 2XQXA 4FOQA 4I02A 1O7FA 4ZS2A 4BA6A 2FQPA 2P3JA 2WWJA 4ES8A 1UMIA 4QMAA 2Y0IA 2A6ZA 1WLDA 4Q0QA 4YZ2A 4JHZA 4JDNA 1CD3G 2Z79A 3N4MA 3LOBA 4OZXA 2RM21 1NCQC 3ZSEA 1WD4A 1YJLA 1E5HA 3NAPB 5FY7A 4JGYA 3SCHA 2EAAA 3IKWA 2VCCA 2WS92 3TEZA 1NZCA 4KBZA 2JDHA 4AK3A 1M06G 2ZKNA 1CAWA 1DQ4A 4Y1XA 5A7QA 3W58A 1GKBA 3S7EA 1UYXA 2Y38A 3C7HA 1IG0A 3RMYA 3RSJA 3U78A 4C90A 4KG0A 3RWKX 2VMDA 5FZ6A 5JMOA 3LDRA 1QJZA 4ITCA 4XZUG 4QM9A 3JXSA 1ULEA 2D6KA 3LEGA 3AC0A 3T2TA 4AHWA 4Y26A 3VBHC 1OFSA 5FYSA 1BYHA 2ZMKA 3UKTA 4DUXA 1VMFA 2Q5TA 5JCTA 1W8FA 1OMIA 1Z7S1 4B8EA 2C1FA 1VBC2 3SISA 3ZN4A 1PGW2 1R081 1ZBE3 1N1VA 2B9VA 2XUMA 4OQ9A 3B5LB 4AGVA 1UY4A 4KWJA 5SV8A 3LSEA 4Q27A 1JS9A 2H0BA 3WQ1A 2WIIB 3URFA 3E5XA 2DURA 1ND2B 2GZWA 2LM3A 3POJA 2E9QA 1DIWA 1RUNA 1NCRC 3GZTB 1KFUL 4XAAA 3WQBA 1ODNA 1GV9A 4HLTA 2BNNA 1NY72 1SHWB 4OCTA 3POIA 3WCSA 4NRMA 1VBA1 4JDOA 3VBOC 4P5HA 3ITQA 3KQRA 4YFZA 3KV9A 2VUDA 5F3GA 3M3CA 3LB9A 5A3WA 2DTYA 4NVPA 1UOJA 4Q0PA 4HN1A 3LPGA 3NAPA 1RUC1 2LTNA 2JE8A 1KD7A 3OGJA 4MV2A 1ND2C 3TNQA 2OXBA 4Y5Z0 1A78A 2WFF2 2WRAA 4CUGA 1MQTB 5LY1A 5BNQA 1QJU1 1Q56A 3SKJE 2AZ5A 3R0RA 3ACLA 3AL5A 1IZ3A 3U1XA 3UNPA 4FTBA 4L92A 1MS0A 2HWD2 1ACCA 1DGWX 2KXLA 2VG9A 3AXDA 2LW8A 3CEWA 4I0AA 4ZS3A 3W21A 4BQ4A 3VD9A 1HN0A 2OX0A 4QXHA 3PJYA 5F2SA 5FMBA 4F8AA 1DU3D 1DQ6A 1AYM3 4AVBA 4BQ1A 3FBMA 4LNVA 1S0CA 1OH3A 2D7FA 5D8AA 3E1F1 3P3NA 1NT0A 2RS33 3UJQA 1MQTC 1HB4A 2K2SA 2YG0A 3FN9A 3WG4A 3WP4A 4AYUA 1FOD2 1WMDA 4G4FA 4KH9A 1V6LA 1OLRA 2VNGA 4C1XA 1HRV2 1Q5OA 2VBPA 4MGKE 1EYBA 4P9GA 5A80A 4E4ZA 5JZGC 4B4RA 3U14A 2JD9A 2YU2A 4LBLA 4QDSA 5FPBA 2A3YA 2ZHNA 3N7MA 1G9DA 1BLZA 3MIEA 3U11A 2QQOA 3VZMA 5IAVA 1RUH1 4DUVA 2PHDA 1FT9A 2P6CA 3OYWA 4NHKA 4QPGB 3NKTA 3J8F1 4E2GA 1COV1 1C8M1 2X05A 4DO0A 3T0BA 4DUWA 4WZFA 2VCBA 3IB3A 2FHRA 3AB0A 3OF1A 5FZ3A 1AL22 1CWPA 3N9OA 5LK5A 2YGMA 2R6QA 4OLLA 2IUWA 3ZSKA 2BWCA 3NJXA 1V00A 4LHKA 3ORJA 2XJSA 2VZRA 4CP9B 3OY8B 4AFMA 1V9U2 5JSOA 3RZLA 4BQ5A 2DUOA 5L7OA 4OQ8A 3PJQA 4Q4X1 3WEZA 2RR12 3BOPA 4YZ3A 2CGOA 4DXSA 2ADEA 1HKDA 4Y1YA 3THCA 4UBGA 1KRIA 5FP9A 2MEV3 2RDNA 1QJY3 3ILFA 2FZ1A 1JMUB 4L8QA 2RMU1 3WDYA 4FTEA 3ZX7A 4QWNA 4IV1B 4K21A 3AZWA 5CG9A 4LK7A 1POV0 5FZEA 3ZYHA 2VVDA 5EJ3A 4FSJA 1MZEA 2JX9A 4MGZE 5F3IA 3UETA 4LO4B 2OZJA 3UKVA 2VQUA 4P5YA 5ACA2 5F32A 3AKTA 2JDAA 3RI8A 4COVA 1CX1A 3KQ4B 4GKYA 3JD71 1V70A 1RUF2 1ASJ3 2QQUA 5DUVA 1UPIA 1BVP1 1WCSA 2G19A 2RS11 3E6DA 5HCAA 1A8MA 4LE4A 4HSJA 2FDGA 2GH8A 5KHKA 3M3QA 1WLTA 1Y9GA 4QPGA 4SLIA 1K5MB 2HWC1 2J7MA 1REFA 1AHSA 4NHLA 3USUA 4QDQA 4NUBA 2JENA 2RV9A 2WQ4A 4M00A 3POGA 4ATEA 1H8TC 2DU1A 3GCXA 1I6XA 3CNAA 4OVEA 4QQHA 1IPJA 4YGEA 1VB4A 5IK8A 1E5IA 1SCSA 3FWEA 4KGQA 4XFAA 2OPKA 2ZJCA 4BM8A 3IBMA 3G6JB 4FP3A 3HMYA 4G9SB 4JDMA 2WNEA 4Q5OA 4CP9A 3OY8A 5FV3A 3I2OA 3BALA 2VE1A 1H1IA 2HWB3 1GR3A 3V0BA 4GB31 2DYCA 3UL2A 3V65A 1FPN3 2WO3A 3C2UA 5T5PA 1XSQA 3PU3A 1UKGA 4H7MA 5A6YA 4J25A 1RUD1 1FV3A 1WZXA 2YBPA 4OHVA 4CDQA 4HG6B 4EE2A 3RI9A 2HEWF 2P1BA 4FFFA 4UAPA 3VKMA 4OI2A 2J1EA 5FZ9A 1ZNPA 3UV9A 4GZ9A 2ARAA 3FHQA 4FXGB 4IV1A 3WQ0A 1W8HA 2D98A 2HLEA 2FD8A 1X8MA 4DB5A 5A3MA 4P00B 1GYKA 3GCWA 4AVAA 3LA2A 2QBXA 4MGSA 1VB2A 3WR0A 2BOJA 2K9ZA 4EN6B 3LDBA 2DDUA 1ZVFA 2VZ1A 4X8PA 5C6CA 4Q4Y1 3CJIB 2ZGSA 5F9TA 4IGOA 4BJ0A 2D6PA 4Y20A 4DNYA 5LATA 1IKQA 5C9AC 4PF5A 1MEC2 1IKPA 1MACA 2WYFA 3O0VA 1W6QB 2VCAA 4YARA 4CCLA 1TQ5A 4BIOA 5HXVA 5LK7B 4XC9A 1EAH3 4XCBA 2XVKA 1GOHA 2VGDA 3OGSA 2I74A 1HLCA 3K75B 2YHJA 4AEDB 2JG8C 3B7MA 4WVZA 4PLMA 1XQNA 4FFGA 2F17A 1POV3 4BQ3A 4UWDA 2G9ZA 4HBNA 1DQ5A 1H4HA 4A4AA 1QNWA 3WNOA 2E53A 2PXJA 1WW4A 4YSFA 3KV6A 1AR82 4AW7A 1SBFA 3CMGA 3KSCA 2Y0OA 4L99A 3B9IA 2VZQA 4O7XA 2QE3A 5FMOL 2VUCA 5K7PA 1KDMA 1KGYA 3OG2A 4QXCA 3KT4A 4AEDC 5AFEA 1O4YA 1OUSA 1DHKB 2UY9A 1T2XA 3ZDVA 4I0BA 3ZXEA 2ARXA 1QU0A 2R072 4GQ7A 3NV2A 3T3YA 1JYTA 5BNPB 1XE7A 3HT1A 3D4KA 4IW3A 2ET1A 3IN9A 3ALQA 1VBC1 3POFA 3Q8EA 1PGW1 3WDUA 5FO8B 4IEUA 2WZEA 1JW6A 2GSYA 3AMPA 1I1EA 5LWBA 3DKQA 4XF1A 3CJIA 3KLSA 1DYOA 4ISRA 1XOYA 5CKMA 5FXWA 1FX5A 3M3IA 2VUAA 3BU0A 3ASIA 3IMMA 2NMNA 5LBCA 2EXKA 4M4PA 5FYVA 1NY71 3R4UA 1WA4A 2YUEA 2QQKA 2EA7A 1POQA 1Y7BA 2D43A 2D5HA 3J7HA 5IFPA 3OD0A 4FFHA 3MPPG 4N43B 2E63A 2I45A 3I3EA 1ONAA 3LA3A 1CAVA 1W8TA 4BCUA 2ZEZA 4XBNA 1VMJA 2WFF1 2J1UA 4LKSA 2Y6LA 3CKHA 3GALA 5FP7A 4AQ6A 3HNYM 4H7LA 3AVSA 4B4PA 1WMXA 4IDZA 2VQ0A 3I4IA 2HWF2 4LHLA 2HWD1 1I3HA 3RPQA 4FI9A 4RS5A 1PVXA 1RXFA 5GM0A 4B4QA 1TZOA 4RFRB 2JB8A 4AQTA 5JXIA 4XF0A 2X5IB 4YM3A 4KG8A 3KT1A 1B35B 2KR2A 4DINB 5FKBA 4XXPA 5BNPA 2VMGA 3C7EA 1FOD1 3H8RA 2P4EA 2WL1A 1QH7A 1S0DA 2SLIA 4YG0A 2R063 4FT8A 1HRV1 3BYWA 5FUPA 3IIAA 2K0GA 2VZPA 2W9XA 3MIDA 4YW5A 5C8CC 1YWKA 3SCFA 3NQHA 1KQRA 5FMOS 1XPWA 1D0GA 1BVVA 1ZZ9A 4QM8A 3MPBA 4XDOA 3IDEA 1F35A 1PGL2 3AZZA 1TMF3 3A7QA 2CAVA 1IQAA 2P3YA 2Y8KA 4NIAA 1X8EA 1XXNA 5FZ0A 2JEMA 4XE9A 4TLGA 1AL21 2WNUB 4L9BA 4NHXA 3AJYA 2IVIB 3M70A 4DRVA 1N1TA 1TME1 3R4SA 4Q29A 2CDPA 1OF3A 3H1WA 3MF9A 2O14A 3MICA 3VBUC 4RHV3 4LQRA 2QQMA 3PURA 4A6OA 2RR11 2WC2A 1R1ZA 1VR3A 2WNVC 4V2VA 4LOTA 4IGPA 4MH0E 1VE0A 4PT6A 3PL0A 2EALA 1XBFA 3I3MA 1Y4WA 2Q8DA 3RNSA 5HBAA 1VBE3 1UD1A 2D6MA 3I97A 4CDUC 1OOPA 4AI8A 2NYYA 5FZ4A 3T2OA 4AE2A 1SLIA 4JGZB 4QKDA 3BODA 4PDWA 1AX1A 4N90A 4XJ8A 4A7YA 3VUOA 3LSDA 5CFDC 5SV5A 1IOAA 2W1SA 1ND3B 4UFKA 3T0AA 1BK1A 4CP0A 4DIQA 5ACA1 1QXJA 5A1LA 2VW0A 2XBO3 2W95A 2IVJA 3HD8B 4XBQA 3H3LA 1HJGA 3ZN5A 1QXRA 1VLNA 1RUF1 1UKRA 4R9DA 5T50A 5F6KA 1YCIA 1OUXA 2CWMA 5FZAA 1DF0A 3JUUA 5DAQA 2IC1A 3OPWA 4XJAA 4GAZA 4RGAA 2LUWA 1H30A 5EIYB 4N9HA 1YXWA 4QXBA 1JTZX 2BPA2 4BXSV 1CONA 2YC0A 3ZN6B 1S0JA 2ZCWA 4Q0SA 5C8CB 1AR62 5CG8A 2WNUA 2ADDA 3DKWA 2XQRA 2EIDA 4J1XA 3ECQA 1OA2A 2JJ6A 3AP4A 1GFF2 5T54A 1ZRDA 2OQ6A 5DQ0A 5FFOC 4XJZA 4BK5A 1SEFA 1HRI2 4JAAA 5GZDA 3ZLIA 2PLV3 5JUVA 4CUAA 1SBEA 2DCZA 4PJYA 2JG9A 1RITA 4GJYA 5FZ8A 4HKWA 4CA9A 1EY2A 3H8UA 1LECA 3MV11 5JOZA 2TNFA 2QQIA 5FY4A 5FLJA 4LLFA 3K3OA 4XIKA 5CVRA 1FYUA 3SITA 5A7WA 2UURA 3T09A 3BTZA 1R093 3MLJA 1REEA 1OKOA 1RUI2 2PMWB 5AC92 2RE9A 4JGZA 5G05L 5CISA 1D4M3 3ATGA 1GP5A 1W3XA 3BGAA 5BNNC 1AR92 2Y26A 1W8NA 2P2KA 4FFIA 1LNSA 2FCVA 4IE4A 4J6GA 5FIXA 4YGDA 1VBD2 1ZX5A 2JWPA 3DN7A 5IK4A 1WBLA 3OPZA 3S0MA 1WKYA 1TEIA 1UZVA 2V73A 4K1YA 2R49A 3PTYA 5EPAA 4PIXA 3K77A 4URTA 1HJFA 1LRHA 3ZVXA 3ZFFB 1O3RA 4I3PA 4WM8C 5JWPA 4EV0A 3KCXA 4CEYA 5T5OA 1O3QA 1JOBA 2WNOA 2CHHA 1W04A 3LCPA 2ZAAA 3ZN6A 3LEKA 3VKFC 1A3KA 1F9KA 3FZ3A 4Z82A 4XABA 4YVSB 2ZTNA 3MDPA 1GSLA 1UOFA 4IEWA 5CIRA 1YUDA 1Y9MA 3NNGA 2PHLA 5J98B 2VY0A 2YZ4A 1DLLA 1LOFA 2GNTA 3MIHA 4QX7A 5IK5A 3NRUA 1GWMA 2A73B 4M3CE 3S7IA 5EYXA 5F6LB 3N3HA 4IEYA 5A3OA 2C0ZA 1AR81 5C33A 2IXKA 4L97A 2ZGQA 3QACA 2QQJA 3GZUC 3O1TA 2VNRA 1MVEA 4JVAA 1UX6A 3IDBB 1VMHA 2Z2SB 3WLUA 4R4XA 2ZX1A 1EPZA 1L3JA 1PHMA 3MO4A 1NYWA 4JV4A 1MPXA 2XWBB 5BY5A 5J09A 4R8HA 3HAGA 4BQWA 1F8VA 2AYHA 1ZZ8A 2R071 1SFNA 2LALA 1DP0A 4GMP0 4I0WB 4X8NA 4HK9A 3DUIA 2ZGNA 2EF6A 5T5JA 1GQGA 4CP2A 2VW2A 1MS9A 3ZSMA 3H1MA 1KS5A 2DVFA 4SBVA 5A7SA 4K1ZA 3POEA 2PQQA 5CEHA 2GN7A 2V4VA 3Q8AA 3U0ZA 3VZOA 1JBCA 3ZFFA 4CXXA 2NMOA 1W05A 4AVCA 1AX0A 3M7AA 3H7JA 4FCAA 3NW4A 4Q26A 5IW0A 3VDBA 1F4HA 3WG2A 1RUG1 4HXCA 3EQEA 5LW9A 5I93A 1RB8G 4JKLA 4YVSA 4XW3A 1MZ6A 1BBT3 3AKPA 3CZJA 4NPMA 3DXTA 2XHKA 2ARBA 4LIUA 2VOWA 5IVYA 1OFNA 1ZZ7A 5C4WB 5F37A 1FMD2 3KMHA 1AVBA 4NIGA 4LBMA 4N53B 1OURA 3P5BA 1W6PB 2PTMA 2J1RA 1O4ZA 5LBEA 4AL9A 3LKJA 1YQ5A 4W6YA 3A22A 2WLQA 3H50A 5FYTA 4FAHA 1EUUA 4XF3A 5FYMA 5I0DA 1IGOA 4KQ7A 2A6YA 3MW4A 5FMCA 1W0OA 1HB1A 5AFBA 4MGTA 2QKDA 4LHNA 3UKNA 5DG2A 4P02B 1PK6A 3BVCA 4KNCA 4UOJA 4FBFA 3AXEA 3IWZA 4A2UA 4Q0UA 2QNKA 1FI2A 2BUKA 1ENRA 1DQ1A 1RVF2 1YFYA 2VMFA 5DZGA 3VV1A 1O6UA 3NSTA 3O1VA 1HW5A 4HSLA 3PVEA 2HWE3 4YZ4A 3A23A 3SH4A 1AL0G 4LBQD 1LTEA 5FPAA 1WW7A 2W46A 3B94A 3B9CA 5C3QA 2MEV2 1UO9A 2E32A 5CKNA 4UFHA 3K4ZA 4ONUA 5JPMB 3U4SA 1UYZA 2DFBA 3SEPA 2W5FA 1LOGA 2C24A 1UY1A 1PGL1 1PO13 4YVWC 4ZU7A 3BTXA 3I2FA 5FZDA 4S2FA 3GHNA 2FDJA 2QZ3A 5BXXA 1S0IA 3JZVA 4BMEA 4BB3A 3TOJA 1DG6A 1MS8A 3N9PA 1LCLA 2AREA 4CPBA 2VC9A 5JR7B 3VD4A 1YLLA 4K3UA 1GU3A 2Y34A 4V1PA 3ZYBA 4W65A 3D6EA 4K7JA 4CXWA 1ASJ2 1UU6A 2EXJA 2LRPA 1RUE2 4GMP3 5JOYA 1DYPA 1YHFA 2D44A 3FJSA 1PVC2 3S6PA 5FWJA 4N53A 5IYYA 4PI0A 1H2NA 1DZQA 3VBFB 1W3VA 4URAA 4QX3A 4QQ2A 1C57A 1G9FA 3GZAA 3ZYJB 1GANA 4QQOA 4BE3A 1T6GC 3AKSA 2G1MA 4GH4B 1JOJA 1NCQB 3NV1A 2IXCA 2IFRA 4IV3A 1LHVA 4PLNA 5KXBA 5KXDA 3I2DA 1RL3A 2XGXA 4PIZA 4FPGA 5KHJA 1SZBA 2RM23 1AZDA 1MS4A 5A1AA 1NX9A 5CADA 1GICA 3MUZ1 4RGKA 1PIV1 4IERA 1Y9QA 5LRSA 2TUNA 4AHZA 4HONA 2ZAHA 3BB6A 1GLHA 4EWDA 3VBFC 2XL9A 2JE7A 2WT0A 3ZFEA 1FPN2 4UBHA 1O59A 3MIGA 3TEYA 2Y33A 4NWWA 3UYJA 4XEZA 2WR9A 3BTAA 3LAGA 4GH4C 2R042 4J1WA 5FWEA 4FPOB 3B02A 4XFBA 4LXLA 4HMZA 3LIHA 3VBHB 4LA3A 1YRZA 2EAKA 4D3WA 3I7DA 4W8JA 1UWWA 2BNOA 1L7QA 1TVGA 5J36A 1AXZA 4JQRA 4H14A 1NA1B 4LHSA 2VO5A 2LS6A 2VTFA 3PDQA 5JOXA 1Z7S3 2BTVC 4MHRA 2P3IA 4OUMA 1R083 1OI6A 2DUQA 4YLZA 3WDWA 3WT3A 1V6OA 2BV4A 2VMCA 5BYNA 1YQ2A 2PHRA 1NCRB 2F4PA 3AFGA 3KCYA 2XH6A 4JTNA 2D6NA 1ZA4A 4HL0A 5FZHA 5CFCC 1OPMA 1HRI1 1Q8QA 3MF6A 3WNNA 2PHUA 1OT5A 2C26A 3BIWE 3HNBM 3MV01 4HETA 5FZ7A 5FY5A 5GLTA 3VBOB 2WZPP 3NJYA 3RWNA 3V64A 5ABJB 4HT1T 2C5DA 4ZU5A 1AJOA 3N9NA 4LBKA 3VKNA 5A33B 5DAVA 3AKRA 4JRAA 1NA1C 3IPVB 1NCQA 1SFPA 3IM0A 2GALA 3HQUA 3Q8CA 2RJ2A 3WINE 4D7YA 3TN92 4XQDA 3UGHA 2DTWA 1RUC3 5AC91 1RUI1 4DOUA 3O1OA 1SPPB 1WUVA 4RR3C 1CGPA 4BK4A 4G3YC 1HQWA 4AQSA 1O3SA 4B1LA 5ABJC 1AR91 1QJU3 4N8MA 1AJKA 5F5CA 1QEXA 2HH9A 3JCIA 1G7YA 3C7GA 4XUQA 1VBD1 1QOOA 1C5HA 2MNGA 3O0WA 4OHYA 3AKQA 1IS4A 2JDMA 2NLRA 4W4ZA 1WBFA 4KU8A 5FXVA 5DPNA 5BUVA 1U5ZA 3DXUA 4FO9A 2B45X 3SEEA 2VZUA 1AXKA 3QD6A 3VBHA 2WO7A 5JDBA 3LZZA 2ZGKA 3AP7A 3WV6A 1ZREA 4CCJA 3OUJA 4IETA 2J1TA 4AXOA 3AMQA 5D8AC 3WHUA 4XDQA 3E6CC 5EZWA 1CX4A 1W9WA 4IEQA 5JZGB 5FZLA 5FBJA 3KHCA 4XUTA 1H8VA 2HBUA 4KMQA 4OYUA 3PVNA 3MYXA 4LKDA 1DBNA 1EUTA 2Q8CA 2ZHLA 3ENRA 4XXAA 1UPSA 3HVDA 1ULFA 2ZX0A 1D0HA 2VOKA 3QLQA 4TSVA 5HV4A 3I59B 5JLVA 3PUHA 1VALA 3LOIA 5DN2A 2BGCA 2YXSA 4LUMA 1RUH3 2RJLA 4BQXA 3AZVA 3INAA 4LITA 1IPSA 1COV3 2IWGB 3IPVA 2B4KA 2XWJB 4HVOA 4XIOA 5DDJ1 1C8M3 1OVSA 3H1YA 4NJ4A 2VUJA 3THPA 1RUJ2 1G8WA 1ND2A 3ILRA 3SQOA 2D6LX 3LE0A 4CCCA 5B2GB 3OD4A 2X53S 5H9RA 5FPVA 1E57A 1SPPA 1QOSA 3GM8A 1WW6A 1OQEA 1KITA 1LHNA 1LOCA 2OIIA 3JBG2 3D5OA 4HPKB 4ZXEA 4IEVA 2PAEA 4GWJA 1W8WA 4QU2A 1AR72 4Q4X3 3CBNA 2OKXA 4QX2A 5A70A 2VH9A 3FL7A 2BRTA 1C3HA 3I2HA 3PHMA 3PUQA 4YWAA 4BLIA 3ZXLA 1IS5A 3VZLA 5A3NA 3ZYFA 1N47A 4MLOA 4EROA 3V0AB 4FPJA 3SXWA 4D6RA 2VTXJ 1MQTA 2JECA 4JHTA 2RMU3 3E5QA 3ZYPA 5IWFA 3VD7A 1RMU1 2Y60A 1LU2A 3ZR6A 4A45A 1XNAA 5IVCA 5JZGA 5F2WA 4ASLA 3LIGA 1QQP2 4A7ZA 2QJVA 1CZTA 1YFXA 4IEOA 1XRUA 4TLFA 4IEZA 2KA3A 5IT6A 2D40A 2OQ7A 3IDCB 3JD73 2DCTA 5DAWA 4UT5A 1O91A 2RS13 3ZXDA 1FMD1 2IXJA 1H6YA 5F3EA 3WP3A 4UFLA 4AI9A 2CAUA 4CE8A 3N9QA 1HB2A 4DFSA 3KCCA 3WNLA 4COUA 1ZBA2 2HWC3 1GQHA 3RS6A 5KWRA 1H8TB 1DQ0A 3DPRC 4BQYA 4AI1A 4FQ4A 4M01A 4Y22B 3WDXA 2C9KA 1XSRA 3RYKA 5JIUA 2VU9A 2FMYA 4Z2AA 1H2MA 2ZHKA 2DFCA 2LROA 1SG3A 2PA7A 1I5PA 4P9XA 4HPKA 2JDYA 4LORA 3ZM8A 1RUOA 1XE0A 4I30A 1DGLA 5BNOC 3WW2A 1RVF1 3D82A 1UQXA 3POWA 4GB33 2W1UA 5TSWA 4OI1A 2DVDA 4HZFA 5KHIA 1K42A 1GWLA 2PN5A 5LRRA 3WG3A 4ASKA 1JZ5A 3ZXAC 2XJTA 4AGGA 4P9YA 2VBDA 4CDWC 5FJKA 5C7GA 4D7TA 2MEV1 3V0AA 5K0UB 2ZXQA 5L9VA 1HIXA 1RUD3 3ABZA 4DXTA 4E2SA 3ST7A 5KHGA 4LR4A 2W1QA 1WLWA 2J22A 1IG3A 1QJX2 4P9JA 1AUYA 1XNKA 1US3A 1NZIA 1A8DA 1BK0A 4TWTA 1EV13 1UZ0A 1RHI2 4JTOA 3DCQA 3C8XA 4JQTA 1IS6A 4RA0A 2ZS6B 2GNMA 1OBNA 1U12A 1YEWA 1UYYA 2IXLA 2XBO2 1V6NA 1AXYA 5C9AB 3WD5A 4Q4Y3 2UWCA 4XFCA 1RUE1 4YRDA 4PBOA 1PVC1 3JQXA 3BKZA 2Q30A 4C1WA 5M0TA 3O1UA 5T52A 5K0UC 4QAWA 4DY5A 1C4RA 4HN0A 4AI0A 5L9BA 4CCDA 2BERA 2DVGA 3M3OA 1UZZA 1VPHA 2BQPA 2ZHMA 1NOVA 4A44A 4Y22A 3ZIXA 1ENQA 3ZFGC 2SBAA 2XDVA 4UFMA 2YMZA 3QH7A 2JG8B 1O5LA 4AFCA 1LHUA 4FOYA 2B9UA 2RG4A 3VBSB 5A1FA 3HOBA 1RXGA 5FYBA 2WBKA 2XJPA 4YW4A 3QOPA 1VRH2 2ZGMA 2VW1A 4QPIB 2OS2A 5HCHA 1K5MA 4COYA 1K12A 5FZMA 4E9KA 1CJPA 2GNBA 1ENXA 3KS7A 5FJHA 1FPN1 4Z8BA 4QGMA 1OLMA 1Z0HA 4OFGA 4CUBA 4D6QA 3U37A 5I0UA 2VPVA 5K0UA 2BBAA 3VL9A 2R041 2R32A 3AP6A 5H9PA 3VBSC 1LGBA 4GA9A 2WUHA 5E88A 4E4SA 5GZGA 3VZJA 2Y6JA 3B01A 1ZA7A 2WS91 3HJRA 2BP6A 2ES3A 3GXUA 2CNAA 1S0GA 1C8NA 4QPIC 3MEPA 2A71A 1SQ4A 4XQ4A 3J7MA 4IXLA 2ZABA 3AMHA 2AEYA 4FPLA 1VBC3 4PIYA 3BPZA 5C9AA 2XJQA 2WZR2 2L9LA 1AYN2 1UF2C 2J1AA 5C5TA 2O0OA 5LB6A 1LESA 2J1SA 4YW2A 1L7LA 2ET7A 2B46X 1OD5A 3N7JA 2WDBA 4S2GA 3I2JA 5EHDA 1U5IA 1S0EA 2IZWA 3VBRB 3I8TA 2F4LA 4XJWA 2GH2A 2VD7A 1OKQA 1JZ6A 1O3TA 2JG8A 4ZU4A 4R9CA 2XPJA 2ILMA 2W0XA 3TN91 5J96B 4ORFA 4QHZA 4PF1A 4AI2A 4ZXKA 4Q4W2 4ZKTB 3UGGA 3AX4A 4QKNA 4I09A 4CZSA 1W6QA 2WFF3 2X10A 2BJSA 3VBRC 3H8XA 1DDLA 1UAIA 3PIJA 3USSA 1WA6X 2NPIA 2QUOA 2HWD3 4CDXC 4AEDA 4FQZA 1C5IA 3T2PA 5D21A 3IZOA 1D4VB 4L11A 1XU2A 5F8PA 3WVJA 2I07B 4O61A 3ZMNA 4EN8B 1GZWB 1XNBA 3BN6A 1LEDA 5LBFA 2DWRA 1RYYA
chains in the Genus database with same CATH topology
3ZXGA 1F5JA 4DPNA 3W59A 4W6WA 4GIQA 4NO4A 4FPEA 5KC6A 2ERFA 1HRV3 4BZ4A 2E6VA 1H4GA 2H6CA 4FXKB 4QGNA 2A5ZA 1HQNA 4AVVA 4BLJA 1AF9A 5JSRA 1EPWA 2A6VA 4LO7A 3FMGA 2JXAA 4YG3A 1PMIA 4FTSA 4GWNA 2VECA 1PNFA 1AX2A 1QMJA 4MXWB 1NLSA 3VGIA 3NWKA 4BH9A 2DVBA 3ZYIB 3AFKA 1RUJ1 4OI0A 1DGRN 2AR6A 2CL2A 3THTA 4FAGA 5HCFA 3FFZA 3MI8A 1AL23 4FPCA 2I2SA 3S30A 5FLHA 3VBUB 4Y1ZA 3ZIWA 5JSPA 1HX6A 1TME3 3WW4A 3JBG1 1QDOA 4OI4A 5BPXA 2XB6C 2WNVB 1Z78A 1AR71 2RR13 1SMVA 2X8KA 3DGTA 3FBYA 4META 4QT6A 1I9RA 4N43A 1W2UA 5E8AA 4CDUB 1BKZA 3WW3A 2BFUL 1MR5A 1ULDA 3PLQA 3I54A 2WKKA 1OLQA 5FRAA 1V9U1 2EIGA 4KWKA 5CFDB 2OW4A 4FPKA 5CNAA 4AHYA 4K9SA 3NVCA 2RJKA 2RS52 1QQP1 4ATFA 3AK0A 3TYJA 5ACA3 4OHZA 2ZX3A 1ZRCA 2X5IA 3RMXA 1B35A 1RUF3 1YI9A 2CTVA 1WD3A 2D3SA 3A4UA 2MPFA 1ZBA1 5GKAC 2ZX4A 4AFAA 3H3UA 1GNHA 4AWDA 4XYXA 3ZSLA 4H55A 5T5LA 1APNA 5FPXA 3AYAA 4L2NA 3WUDA 4Q4V2 2DVAA 2WT2A 3B00A 4BHPA 3VBUA 2HJIA 3FUOA 1F5FA 3GYDA 1H1AA 5CU1A 1BZWA 1BEV3 4R52A 4QQPA 4XMAA 2WNVA 3DL3A 4YM0A 3M4FA 2R0HA 1CAUB 1XYPA 2G9GA 4CRQA 2JG9C 4CDUA 2ENRA 1ZYBA 2VOVA 3OJBA 2VXRA 3K48A 3GBGA 1LENA 2OA2A 1U0AA 1VP6A 1QJX1 5CFDA 1VBB2 5BNNB 2CV6A 1RINA 4MSVA 1RHI1 1LU1A 1CPMA 2QCSB 1DZTA 1H9WA 2GC1A 1XNDA 1N3QA 1O5UA 4WM8B 2BFUS 5EXOA 4TYSA 4F3JA 1BCXA 3VDDC 3MW3A 1ND3A 1VJ2A 2DV9A 2Q1ZB 1R1A3 4CEYC 4EWEA 1DGRA 1ZZBA 3TWIA 3WW1A 4IQPA 5J7MA 2A6WA 4CEWC 1HV1A 1VRH1 3ZDSA 1MEC1 2Q4SA 1XNCA 4YYOA 3APBA 1Q8PA 2Z69A 2VVFA 1CPNA 3HWJA 3SCGA 4AFBA 3HIFA 4H3WA 1CQ9A 4QX5A 4WM7C 1AR83 1ZBE2 2BW8A 3QBQA 5C8CA 1W6MB 2WLPA 2ZACA 4QHBA 3WCRA 4GKXA 4OHWA 2GC2A 5F1RA 1W6OB 3MIBA 2BYVE 4BPZA 4LE3A 4LBQB 3SMHA 2AENA 3E5UA 5BNNA 2GMMA 2DCJA 2EVXA 2R073 3ETQA 1OQDA 2H0VA 1MVQA 1QWRA 2PFWA 1J1TA 2WZR1 4GXLA 1AYN1 2A70A 2O8QA 4WM8A 3TNPB 1PNGA 3AYEA 3VZKA 4O9GA 1LOBA 1Q8SA 5KBFA 2GU9A 4R9BA 5GZFA 3ZYGA 4NN0A 2ZGRA 3N36A 1RUG3 1J59A 1PGSA 3K51A 1LR5A 1YIFA 5H9QA 1DGWA 4BYYA 1AYM2 4AHXA 2ZGUA 1JUHA 1S0BA 3WXPA 3POSA 2E7QA 5GZEA 2UY8A 4Q4W1 2HYKA 4HFSA 2RS32 4LBNA 2B8MA 1RUH2 4LUKA 4Y24A 2OUHA 3M1HA 2A75A 1BMV2 2VMHA 1W6MA 3ZPYA 1COV2 1UL9A 3O7OA 1GBGA 2A3XA 2D3PA 2V09A 4FP2A 3O5SA 1OSGA 5I0SA 5EYYA 4KWLA 5DUXA 4LBQA 2QQPA 2WSUA 4HVRA 1PZ8A 2HWF1 5AVAA 5FREA 1QOTA 3O12A 2ZMLA 2VULA 5DUWA 1F31A 2D5FA 3BCWA 3ZSJA 4MUVA 2TEPA 4MVTA 2XLGA 3D0JA 4B7EA 4YVWB 1XE8A 4ES9A 4DRRA 2XLFA 2W68A 2ZGTA 3ELNA 1CVNA 4RQPC 3UK9A 1U5XA 4XPVA 2GMEA 2D6OX 1HXS3 2PHTA 1QJY2 2EXHA 5FCCA 2ZGPA 2YGLA 5BV6A 1PO23 1GNZA 2PYTA 4NWVA 1WMFA 3CLPA 5AVPA 4I3GA 2W52A 5JVVA 2B7YA 2R30A 4AEMA 5L19A 4INDA 2IXHA 3U07A 4QQLA 2C9AA 3H0OA 5FAXA 1S1AA 2YV8A 3QH6A 4WVVA 5C4WA 1U5YA 4MYEA 4YW3A 3MFCA 1W6PA 3BOWA 1PIV3 5GLWA 3SHRA 3OCPA 1S2BA 1WW5A 2D97A 2RS51 5FOJB 1XYOA 2B39A 4YG6A 3ZXKA 4XFGA 1W6NB 2YY1A 1NG0A 3ZFEC 3FHIB 3KM5A 4HKLA 1RUD2 5DUUA 4XETA 5IK7A 1QNYA 1CIWA 1JYIA 2HWB2 4JGYC 3LWCA 1EV12 1NLRA 3HN1A 3Q9OA 1Y43B 2GC0A 1LHWA 4Q4V1 5CFCB 1VAKA 2WWSA 1W0PA 3AZYA 2GMPA 1ULGA 1S0FA 4LULA 1HRI3 3J4UH 3AYDA 4B7KA 1RJ7A 3ES1A 3FLTA 2CGNA 4Z2WA 4OUSA 3JU9A 1AR61 3N35A 1C28A 1Q43A 2UU8A 1LB2A 4RR3B 3FX3A 4CP1A 3VBFA 1VBB1 1V6MA 1UN1A 5AC93 1RUI3 4COZA 5CBLA 4NHMA 1FATA 1UIKA 4XFFA 4DZGA 1VBA3 1BQPA 1EAH2 4GH4A 4WZCA 1AR93 3T1LA 1IPKA 4FPYA 2ZOEB 4EN0A 1VBD3 1ZRRA 1W6NA 5FO9B 4N9IA 3RRDA 3L2HA 3PNAA 4E27A 4MX3A 5I8SA 4NPRA 3IT8A 2ZBJA 3NAPC 2Z5WA 5D8AB 1J3PA 5KC5A 3POYA 5CAZA 2VMIA 3RZZA 5HI0A 2ZZQA 3CL1A 3KB5A 4AF9A 5CFCA 4XTPA 1WMEA 2Q8OA 1X7NA 2RHPA 4PBPA 1XYNA 4Q1PA 1NA1A 4D94A 1Q8OA 3OYWB 3SLIA 4K40A 1V6KA 1ZBE1 1SDWA 4FOWA 2P17A 1ULCA 1NCRA 5DDJ3 1X33A 3B93A 4A7KA 4RR3A 3AMMA 2XVLA 3IMNA 2FMDA 4WVWA 3VBOA 1HQLA 5ABJA 4YZ5A 5A33A 5I0RA 2JE9A 5FTTC 2GDFA 1LODA 3J8F3 3WZ1A 5L7OB 3WNXA 2Z42A 4LO8A 1KDKA 1M4WA 2XKPA 3WDVA 3DV8A 3PMSA 5I0TA 3MLKA 2P34A 4QGLA 4U36A 1V6JA 4WVMB 1RMU3 5K9YA 1B09A 3RG0A 3A0KA 2Q1MA 4BWOA 1XU1A 3OGGA 4BMBA 3VZNA 3MGUA 1EP0A 5L7OC 2W08A 3H7YA 1AYM1 1LGNA 1NQJA 1D2SA 2VOXA 1MZFA 2R16A 2R1DA 4UW5A 5DXDA 2B5HA 4RL7A 3D8CA 2XKOA 3MLLA 1NXD1 1FMD3 2RS31 2XVGA 1C1LA 4XZPA 3DPRB 3M2MA 5FO7B 3LGRA 3J9SA 1N1YA 1BMV1 5T55A 2R062 2JKBA 2ZKLA 4CZSA 4N7UA 3USUB 2WSVA 1D2QA 1OQ1A 4UXAA 2DU0A 5GLZA 2CY6A 3EJKA 4DQAA 1LJ7A 3I59A 5FOBB 5BNOB 5GLUA 1YFUA 1TME2 2G4IA 3CO2A 1TMF2 4LA2A 5H9SA 2JD4A 1RGSA 4F7ZA 4P9IA 1RVF3 2P37A 1JUIA 3HR9A 4CDWB 4QPGC 3V0BB 2PAKA 3ES4A 2YROA 1YNAA 4AVSA 1SLBA 4PQ9A 4CDQB 3FLRA 4LO5B 1QKQA 5EV7A 4RHV2 3E97A 2WJSA 4WVMA 5DZEA 4LT5A 1UZYA 2A7AA 3SH3A 3RYPA 5JI9A 1J58A 2E51A 2TBVA 1UU4A 4MXVA 2YDEA 2D3RA 1QJY1 1VBE2 4HVQA 2DCYA 1RUE3 4CDQC 2ZGOA 1PVC3 1NQDA 4Y20B 4BOWA 2O1QA 4XHXA 3DPRA 2VQAA 4E4DX 3ZFGB 4IV1C 1SBDA 5A3LA 4Q2FA 3WUCA 1NE4A 5JAXA 2PHXA 1G86A 3TRSB 4QXKA 4ASMB 1ASJ1 3A0NA 1KS4A 2WINB 5BNOA 1BEV2 5GZCA 2XJRA 1LKNA 1H8TA 1SCRA 2A6XA 2NZ9A 3C3VA 2HEVF 4MZUA 4CDWA 2O8OA 5LEKA 3KD4A 1K5MC 4P14A 5CB7A 2JICA 3M3EA 4K8FA 3VKLA 3GF6A 1J1LA 4UW6A 1N3OA 2R043 1IS3A 4KBBA 5J3UA 2PLV2 3JB8A 2WS93 2HWB1 1SLTA 3WQ7A 3BU7A 2VVEA 4Q1RA 1EV11 1QDCA 1SLCA 3NJZA 1RIRA 1YI7A 1KJRA 3HQXA 4NR1A 2OYZA 2AGSA 1G9BA 3WP6A 3TB0A 4DMIA 4JCKA 1JH5A 1R092 3ME2A 2A3WA 4AEJA 4DS0A 4X6RB 1D4M2 1TNRA 3ZFGA 1MS3A 4Y1VA 5F5QA 4FPFA 4XFIA 5GJ6A 3ROUA 3MIFA 1R1A2 1SACA 4KU7A 4IEPA 4YM2A 4EN9B 2UWAA 4Q8LA 2NQYA 3N7KA 3TN93 1PM7A 1CAVB 3CJIC 4HANA 1YIPA 4S2HA 5L36A 4Z92B 2PELA 3W9AA 4CDXB 1EAH1 5JPNB 1JXNA 3VBSA 4M0HA 4DY3A 1X36A 4QD2A 1KFXL 1TNFA 3H9AA 4RS5B 1FNZA 1HDKA 2GAUA 1RJ8A 2QFEA 4WV8A 1POV1 1LEMA 1LULA 5GALA 4QPIA 1HV0A 2H6BA 3M8LA 1H0BA 4JRLA 3HBZA 4XJUA 1H2LA 4U2AA 2UYBA 5DZFA 4MGIE 4K6BA 4XTMA 1G9CA 5E16A 1WCDJ 1BXHA 5J48A 4MGYE 3R4DB 4JC1A 4RS5C 2BVBA 2XJUA 2GN3A 3O14A 4HK8A 3WHTA 4AG4A 2DF7A 1SFYA 4XF9A 4XMIA 2JDZA 4WBBA 2BEOA 1A6CA 1FOD3 3PVBB 3RYRA 5BNPC 1RUG2 3RJ2X 2YYOA 5K8SA 1RUJ3 1ZZ6A 1Q3EA 3LA7A 2ZMNA 4B29A 2W39A 3VBRA 1BJQA 1JHNA 3J26N 3D0SA 4OHXA 3N7LA 3P3PA 4LTAA 4FPHA 4UW3A 2GNDA 1CAXB 3JBG3 4CDXA 2PHFA 1SLAA 3RQ0A 4D7SA 1H9PA 1URXA 4KGGA 1AR73 3GBFA 2R0FA 1YFWA 1BBT2 4QPYA 2QZ2A 3GBWA 4C0HA 4LO6B 1QY4A 4E2QA 1YJKA 2PAMA 4N43C 5FBZA 4Z1VA 1OOPB 3AP5A 3FLPA 1V9U3 4FOVA 4I01A 4XOGA 4PDWB 3VHRA 3GNEA 2ZX2A 1LHOA 1JN2P 1QQP3 4RSUA 2BBVA 3RJRA 1GZWA 2XG3A 2OVUA 1OHFA 1OPOA 5FQ0B 3WX5A 4BIFA 4DXZA 2AUYA 4S2DA 2WA3A 5E89A 5J37A 2X5IC 1IHMA 1UIJA 1OOPC 1B35C 3E6BA 1ZBA3 3U4XA 1FXZA 2R061 5FPZA 2HWE2 4PDWC 2R1BA 1HXS2 4EN7B 3KZ4C 4EWAA 1FNYA 3U10A 3CJXA 2IXIA 1CJDA 4W6XA 1PO22 4YFWA 1PO12 2BWAA 1KJLA 1CAXA 1TMF1 5D1IA 4MXWA 4Y4YA 5DG1A 2GC3A 4LBOA 3ZXJA 2JG9B 3B69A 3CU7A 4GULA 3VL8A 4AVTA 2BNMA 4N7IA 3EHKA 4YGBA 1OA4A 3T1MA 3B3QE 3KGZA 2WNUC 1C1FA 3JB4C 4RHV1 1QJX3 3RDIA 3VN4A 1PIV2 3OTFA 4IL7A 3ILNA 1RHI3 2ZZJA 4PLOA 5EWSA 1X82A 4Q0VA 2UWBA 2UYAA 3NV3A 3R6SA 3DF0A 1SLLA 1VBE1 2FZ2A 2RM22 1WCKA 3L2YA 5FQ0A 2WA4A 5I8TA 3VDDB 1NE6A 3QCWA 4AQ2A 1DYKA 2WFPA 5I8YA 5EFUA 4CEYB 4JGZC 2QDNA 3OBTA 1RC6A 2XBO1 4P9WA 5HCBA 3VLBB 1ND3C 4CEWB 3EO6A 4RD7A 2XJVA 4D69A 1JYCA 1QF3A 1UCXA 1VRH3 1BEV1 1MEC3 1REDA 1J3QA 5KHHA 4WM7B 2Q0AA 3WOGA 2NN8A 1YYNA 4LEJA 4OULA 4TZDA 5I91A 4XILA 1Z7S2 1R082 4GWMA 5CA6A 5JMCA 4F83A 3L9JT 5KXEA 3NKGA 4YM1A 3ZN5A 5C8CC 2F6BA 1LOAA 5T3NA 1ZM1A 4B3NA 4YZ1A 2FBEA 2PLV1 3JQWA 3R05A 4O9EA 5JI7A 1H1MA 2X29A 1Q8VA 1CAUA 1FV2A 1LOFC 2EXIA 4Q8KA 4YGCA 3AM2A 1VBA2 2OZ6A 4P9LA 1GZ9A 2QDRA 2VNOA 1Y3TA 1VIWB 1CESA 3UJOA 2P3KA 2HKXA 2ZPXA 1UMZA 1KXGA 2WZR3 2DUPA 1AYN3 2OUJA 1R091 1RUC2 3VDDA 4GALA 4LBJA 5JIAA 1D4M1 4CYDA 2MHFA 4EJRA 5JOWA 5A32B 1QJU2 3VHNA 2QVSB 4R9AA 2E7AA 1PZ9A 1R1A1 1X50A 1DQ2A 4CEWA 1DZRA 2CYFA 1N3PA 2WQZC 4XJ9A 4XBLA 4A3XA 3OBRA 4Q4W3 2CWSA 4WM7A 1MS5A 4XQWA 4NOTA 2V5YA 3ZYRA 3ZFFC 2ZGLA 3KGLA 3WY6A 3PVOA 3VHOA 1S2KA 4ISQA 4COWA 1QXPA