3DKWA

Crystal structure of dnr from pseudomonas aeruginosa.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
227
Chain Sequence
MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLECFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A dramatic conformational rearrangement is necessary for the activation of DNR from Pseudomonas aeruginosa. Crystal structure of wild-type DNR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
molecule keywords DNR protein
total genus 46
structure length 227
sequence length 227
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dkwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dkwA01
3ROUA 1EPZA 1ZYRF 1O7FA 4OIPF 4RD7A 3GZ6A 1TQ5A 3MYXA 2PN6A 3HSRA 4Q0PA 3BB6A 4G7OF 3J80Z 3UKTA 1YFWA 4HYEA 2ET7A 3HRUA 3E6CC 4G8XA 1L3LA 4RB2C 4P5OA 4IF4A 1F4KA 1P6RA 1TQMA 2DLLA 5D5VB 1QQIA 2A5YB 5E8GA 2PA7A 2EFWA 5DEQA 2QBYA 3LA2A 2VXZA 2EV0A 1FYLA 1FY7A 2OQGA 3GUDA 4D0PA 2VE9A 3I53A 2GC3A 3GZ5A 3KZYA 4LLNA 4MZUA 2GXBA 2Z99A 5DD4A 4M6XA 3FM5A 2VECA 1I5ZA 4A0XA 1KU3A 4HDVA 5EZWA 1XN7A 4U7DA 1S6LA 2D40A 5F64A 2QM3A 4MTEA 3V7RA 3GX4X 5JAXA 4CXFA 4QGLA 5CADA 3HSEA 2GXGA 5E20A 5E17F 4IETA 3BY6A 3R61A 1H1IA 3BP8A 3IWZA 4Q0UA 2V1XA 3NKTA 3I54A 4ESFA 3MQ0A 3GO5A 1A04A 2HJIA 1O3TA 1ZZBA 5LGNA 2HFHA 2V79A 3IDBB 3M70A 1QY4A 2QQAA 1XB4A 2F5CA 2UXXA 4P55A 2O1QA 2GC2A 4U0WA 4QLCU 3J80K 4U7BA 2CV6A 1ZGJA 1KYWA 3BU7A 4ON0A 5CLSA 4ENKA 1OYWA 1ZRFA 2CGPA 4XF3A 5I93A 3GVAA 3KP4A 2DBBA 3C7JA 2XLAA 1W7PA 2DAOA 2L4AA 1ZHFA 3CUQA 1R1TA 2YX7A 3W6KB 4CDGA 5FLXZ 1O3QA 2CG4A 3FX3A 2PBIA 3I59B 2PHLA 3GF2A 1EH7A 4GGGA 1DDNA 3M8FA 4YFNF 5FGMA 4DNCA 3QPHA 2QQBA 4XLNF 4IHTA 3HYIA 5CVVA 3MDPA 4L9NA 3BJOA 3DF8A 1YFXA 4G6DA 2A07F 1BIBA 1FT9A 2VBXA 2STTA 1I6XA 3RYKA 4MGZE 4AD9A 2O3FA 1F1ZA 4GYIA 1VJ2A 1H1MA 3OCPA 1SD4A 1CAXB 3OOPA 3W6JB 3RNSA 2O6GE 2MA3A 2P5KA 3QU3A 1QGPA 5E1ZB 1YWKA 1HKSA 4LEJA 2HQNA 4I02A 5J3UA 1XSVA 3KSCA 4UUVA 2ISYA 1FX7A 1FOKA 2XUBA 4IRGA 2ZFWA 2Y0MA 3H7YA 2Z9OA 3UKVA 3LZZA 2UY9A 4HLXA 5JVTA 3ERED 1YW9A 4ZYHA 4S05A 3F21A 1C0WA 5KHKA 2DQLA 4EGYA 2HKXA 3LQQA 4LB5A 4HLYA 1U2WA 3RIRA 4GYGA 2W84A 2OQRA 4LFUA 5BXXA 4BHBA 4I3PA 4LLLA 1IXSB 4A12A 4XF4A 3WGIA 1FYKA 4UNOA 5LLQA 4MGKE 1BM9A 4NQWA 3ETQA 3R60A 2BE5F 2ZKLA 4Q0SA 2IXJA 5JFRA 3H1MA 3MWMA 1U5TB 4G6QA 3RI4A 1R1VA 4BAYA 5AIPA 1T39A 4P9UA 3NJZA 2V6CA 3IL2A 4L0ZB 2ETHA 1R58A 1O5LA 1IAWA 1D8KA 3HUGA 3WTSC 4IRIA 2O8XA 3KEOA 4EGZA 5C6CA 5CVIA 5FQ0B 1IN4A 4H7LA 3BPZA 3UKNA 2O8QA 3BALA 3KP7A 4PIYA 3WTXC 3ULQB 1E2XA 1UW8A 2VC0A 3ISPA 2QLZA 1R7JA 4IVNA 4ASNA 4BYYA 3F23A 5LGTA 3OD0A 5LEKA 1XDUA 2QDRA 5DUIA 1MJAA 5IT9K 3HRMA 2DI3A 1EV7A 2OZJA 2PMHA 2HDCA 3PVBB 4CO8A 2QBYB 3ML6A 1S7OA 5A2QZ 3VFZA 5I0UA 3EJKA 4NVPA 2ZCWA 3K0LA 3H1WA 2C6YA 1ZX5A 5CJ9A 4QM9A 2ZNZA 1MJBA 3FMRA 4KL1A 3CTAA 4UXNA 1UHMA 5D5XB 3WTYC 2QQ9A 2IW5A 4IERA 4GO1A 1UHWA 3RKXA 4A6DA 3ABUA 2LNBA 3MCZA 4HF0A 5DYMA 1FWZA 1B1BA 1MJ9A 3VOEA 4XRFA 4L5IA 4GXOA 4AIKA 4HBLA 1FP1D 4G94A 2HYFA 4LK1F 3IC7A 5HI0A 4QMAA 3SFZA 4PDKA 2XAHA 1IUYA 4HVOA 3ZMUA 3L9FA 4HSLA 1IW7F 2LKPA 2A6EF 4PIXA 5D5UB 1P4WA 2HEOA 5TJJA 3S7EA 1BI0A 3ZPLA 2XL9A 1DZRA 3PQJA 2BV6A 1U5TC 2W25A 1W7PB 2XHKA 2DFIA 1V70A 4N9HA 4EM1A 4D7SA 2H6BA 1EY2A 4YIIA 2HWVA 4E2QA 3WU0A 5BPDA 4MUVA 4ENNA 2E9QA 4KNYA 4LUKA 3U1DA 2CYYA 3R6SA 3CJXA 3COAC 5EEHA 1Z1DA 4HDUA 2FBIA 1PDNC 1IRGA 4UHTA 4XF0A 4OU0A 2D1HA 2QNKA 1Z91A 1R5GA 1IPKA 2MHFA 2V9VA 1R5HA 2W57A 5BUVA 3WG9A 6PAXA 1UIJA 2R7FA 2X4HA 4CGZA 4P96A 1P92A 5FDBA 2M45A 4BIFA 1DGWA 4IEZA 3N4MA 5BS6A 4XFFA 2GA1A 2B0LA 1EH8A 1ZH5A 1WSUA 1FSEA 5L3EA 2XAGA 3H50A 3WTZA 1BOAA 3C3WA 4KA4A 3BWGA 3FJSA 3QRFF 1AWCA 4EWEA 2AXLA 4IHSA 3BOQA 1LEBA 3DL3A 4MGRA 3HT2A 1LNWA 3JAMZ 4M9XA 2E1CA 2OA2A 3O3KA 1GQHA 4YYOA 1XGSA 3WE2A 4RB0A 2BYVE 1WA4A 2FQ3A 3R0AA 3F6OA 4Q4ZF 2KIMA 2VC1A 3T0YA 4KN4X 2VBWA 4RS8A 1XMKA 5F6FA 5JSOA 2A69F 3RZZA 2IRFG 4KU8A 4XLPF 2O03A 2KIUA 1FI2A 2Q30A 1ZLJA 4JV4A 1XRUA 4IEPA 3WODF 3U11A 1WKMA 2L4MA 3O2PE 1XD7A 4WCGA 4IEXA 2Y0OA 4JQFA 3S2WA 4XFAA 2X0LA 4BH9A 2DK5A 2I45A 4BNCA 4LG0B 3LSTA 4P9GA 4HLTA 4ZU5A 1DGRA 1YFYA 1ONVA 1S8NA 1B9NA 1K7AA 2QJVA 1O7LA 3GFMA 2RQPA 4MTDA 1KQ9A 3GFIA 3HHHA 4LUMA 2Z3YA 4A0ZA 4HV5A 2RC4A 4RGSA 4MX3A 5I0RA 2ZXJA 3HHGA 1T2KA 2LSOA 1WQ2A 1BBYA 2A68F 2ISZA 2EA2A 2BGCA 1U78A 4FAGA 2Q2EA 1LDKB 1ON1A 4KWLA 2A6HF 2K02A 5FLJA 2MBFA 5BY5A 3FM3A 4R8HA 3I0TA 2EFPA 1ZG1A 4DINB 3IKTA 4JK1X 4ORFA 4PZJA 1KU7A 5D4RA 3E6BA 3OGJA 4EJWA 5JHUA 1G4DA 3ZMVA 4HVRA 2ESNA 4IESA 4LG0A 1OPCA 1MDMB 3Q9VA 3IHUA 3TO6A 2Z69A 4HMZA 2WV0A 1V3FA 3EQEA 2PI0A 2NNYA 4XFCA 2KXLA 1IXCA 2VBYA 4QX5A 4LA3A 4CZZA 5IT3A 4YARA 1S7AA 4IEUA 4LA2A 3LA3A 1TNSA 1BC8C 1SMTA 4LB6B 1J2XA 1XGMA 4MGIE 4IRHA 3CO7C 4L2NA 1Z6TA 1SD7A 2JSCA 5HDGA 1P2FA 1FC3A 2GQQA 2HYGD 2M5WA 2JT1A 1O57A 4KUMA 4O9GA 3NL1A 1B6AA 4MEYF 2XIGA 4L9JA 4WVZA 2IPQX 3LQRA 1LB2A 3R4KA 2GC1A 3CL1A 2D2WA 2XRNA 2FMYA 3SCHA 1MDMA 1Y9QA 2IXCA 2RV8A 4WXCA 3M1EA 5EEGA 2N7GA 2FE3A 3MAJA 2H0VA 4XF1A 2COMA 2UYBA 5I8TA 3ES4A 1UFMA 1O4TA 2JPBA 3F8NA 2B9UA 1R00A 5D4SA 1IN5A 2MNGA 3DV8A 3WGHA 1QZZA 3LWFA 4OMYA 3BZ6A 4EV0A 4ONUA 2XROA 4KICA 1IRFA 2J5OA 1SD5A 1BI2A 1G3WA 3EUHA 3WU1B 5ILSA 3SCGA 5ILVA 4L9TA 2VODA 4WX9A 2DK8A 3SXWA 3ZQ7A 4XF9A 4UBHA 4IXAA 5LRRA 3SZPA 3H7JA 1T0FA 2STWA 2D5FA 4UXAA 4MEXF 3DKWA 4NHJA 1Z9CA 5HDKA 2UXNA 2NRAC 1GXQA 1FNNA 1CGPA 3WW2A 3E6MA 2GA2A 2HOEA 3WTTC 2CFXA 2WTEA 4M74A 3RYPA 1ZZ7A 3CLPA 5LBQA 1UCRA 3SHRA 3J7AO 5FB2A 4L0YB 4U0VA 4CHUA 3FMSA 3WW1A 2P8TA 3P9KA 1J9IA 3NSTA 4LMYA 4LULA 1DP7P 5D5WB 3TGNA 4Q0QA 1PUEE 1Z05A 2Q4SA 3C1DA 1HKQA 1DZTA 2OYZA 1ZG3A 1H9GA 3I5UA 4WXHA 1UIKA 3DXJF 2J5PA 1Q5OA 4X6QB 3FHZA 4AVPA 1YLLA 3E6DA 2EA4A 1EH6A 2FSWA 4LLGF 3VHRA 4PGGA 4XFIA 2XV4S 1UPIA 5D6FA 2VT3A 1JE8A 4BHCA 3HTUA 4HA8A 3TNPB 4HX4A 1KU9A 5JR7B 1F5TA 4ZZDA 2IXIA 2IVMA 1W5TA 1WRJA 1YW7A 3HIFA 3K9TA 3JSPA 2LF7A 4Y13A 4ETSA 1SFEA 4L18B 1QPMA 1Y3TA 4LLOA 2KRFA 2R3SA 1LRHA 1Z6RA 2M1BA 2E7XA 3F72A 2ACJA 1HW1A 2RDPA 2DT5A 4AQ6A 2XL7A 1LDJA 1REPC 3S7IA 2HTSA 4QWQA 5JR3A 2IJLA 2RNJA 3DQVC 4HAMA 1HSJA 4AVCA 2DCTA 3DPLC 3TOAA 2XLGA 2IA2A 1SD6A 4B8XA 4META 3C18A 4HQEA 4ZU7A 5F1RA 5E16A 5LHIA 4HQMA 1NE6A 1TBXA 3ZMDA 3FF5A 1YLFA 4MV2A 4A5MA 2IXLA 3K1NA 1Y0UA 2P5VA 4EROA 1RL3A 2IT0A 4MGYE 1D3YA 1H0MA 4OIRF 4IJAA 4XSXF 2FQPA 2RGVA 4WWCA 3L00A 2VOPA 3KETA 1GQGA 3GBFA 1IN6A 4KMUX 1VTNC 3LOIA 2CW0F 3C3VA 3WGGA 2DTRA 3E5UA 1QXJA 2B5HA 5FLIA 4UBGA 3P7NA 2LDUA 1LVAA 4Z2YA 2WWYA 1UCXA 3E97A 5FO5A 2VOOA 2YSRA 2W85A 3L09A 2G7UA 2KIFA 2YR2A 3V8JA 4YFXF 5CVUA 1B4AA 3EBRA 5AONA 1OD5A 3V8LA 2D93A 1X3UA 4WF2A 3KP5A 2BNMA 4XETA 2HZTA 3KP3A 4WK8F 3V4GA 1ZREA 1L0OC 2H6CA 3G73A 3GYDA 4R79A 1U6GA 1P4XA 3IBMA 3GFLA 3OF1A 4A2UA 1BI1A 3BJ6A 2EAAA 4AWXB 5L3GA 4HV6A 4XFGA 3KLNA 1ZZ6A 2FNAA 4Y15A 3S0MA 5H20A 3MZYA 1ZNPA 2ETEA 3CF6E 2OA4A 1O5UA 1I27A 2Y48A 5KHGA 1YO5C 5ICGA 5HLGA 4K2EA 2IP2A 4KFCA 2FRHA 2HKOA 2K7LA 2OU2A 2XAFA 3ZN1A 3FHIB 2O61A 1I1GA 3FXQA 3IRQA 1BN5A 2ZNYA 3KE2A 4HF1A 2ESHA 2DPDA 2OZ6A 1DPUA 1X82A 1ZZ8A 4KIGA 3I64A 3V8KA 4RAZA 5KK1A 1FBSA 2O0YA 2RKHA 3ACLA 4X6RB 3ELKA 4WBBA 4EVIA 5J8FA 1RUOA 3IIAA 4LGWA 1KA8A 1QZYA 5CYVA 2ZMEA 2EVXA 3VEPA 1ZG5A 3BPXA 3K1MA 3TKYA 5E1RA 3PQKA 4EJOA 1KQ0A 1CAXA 2OZUA 4AQ2A 3RKYA 4B09A 4WZCA 1O3RA 5J7MA 2EWNA 1FXZA 2KKOA 3PFIA 4FX0A 3GEZA 2V09A 2A3SA 4PGHA 3QAHA 4HN1A 5JSRA 2K4BA 1CAUA 4N0BA 1YG2A 3CDHA 4TV7A 4HF2A 2QVOA 4Q5SF 1AOYA 1RZ4A 4A5NA 1G3SA 1ZARA 4JBAA 3F3XA 4HZFA 2VE8A 2YX4A 5L3DA 2QVSB 2K4JA 4I0AA 1YS6A 3TNQA 1Z7UA 2HTJA 4GULA 5L3FA 3VODA 2PAMA 4MH0E 5JI6A 3NVCA 3RPQA 3T8RA 4FAHA 4QXKA 1TW3A 1CAVA 4J1XA 4TLFA 2W24A 2Z5UA 2H27A 3N97A 4KMFA 2MPFA 2ZBKA 5BQTA 3BROA 2HR3A 4HW0A 3V7CA 1DUXC 3CO6C 1KQ8A 2L02A 3TOBA 3B73A 1U5TA 4L9VA 3H8UA 5J48A 2D5HA 4ZZLA 2F4PA 4YNIA 1QO0D 2JRTA 3I4PA 1TW2A 2P6SA 3K1PA 1YIOA 1J5YA 4M71A 5I8SA 4YFKF 1S3JA 1PMIA 1XE7A 2DQRA 1J3QA 2DO7A 1B59A 1RGSA 1S29A 1FPQA 3BDDA 5FFZA 3QU6A 1XDSA 1U8RA 4ENJA 1QNTA 4PJYA 4F8AA 3Q5FA 1K78B 1CAVB 4IPAA 4Q48A 1LR5A 3M7GA 4G7HF 1ZRRA 3TDUC 4RAYA 1Q3EA 1IPJA 4XFBA 4M6YA 2EFNA 3PLQA 1NYWA 2EFOA 2CO5A 1XCVA 4I01A 2M87A 1G3YA 2KJCA 1KU2A 5I8YA 2GZWA 4LD5A 2C0ZA 1MZBA 2HGCA 4G7ZF 1HKTA 4G9YA 3EETA 4BXUA 1HW2A 4HX8A 3LAJA 5KVRA 1U12A 3KGZA 4OIOF 2Y75A 1ULYA 5K5RA 3D0SA 1XSDA 2E7WA 1ZZCA 1R22A 1TLHB 4YSFA 5J6XA 2QYOA 5JSPA 5HS9A 2IA0A 5E18F 2PAEA 2ET1A 2QCSB 3FMQA 4HOBA 4XEZA 3MPBA 2CSOA 3VB2A 4ENMA 2G9WA 1MD0A 1B9MA 1FYMA 1MKMA 3ZMTA 3U0ZA 2GIVA 5KBFA 4KWJA 4N9IA 1D5VA 3QP5A 1STZA 3EYIA 3EHKA 2DU9A 3NW4A 2P6TA 1H9TA 1NHAA 4P9FA 4FX4A 3QOPA 4A0YA 3K69A 2IA1A 4YIFA 3F8MA 1BC7C 3NEUA 3WTVC 1XE8A 4KT5C 3RYRA 3HQXA 1CX4A 1HQCA 3QP6A 4ESBA 3M9AA 1ZAOA 1ZRDA 2E1NA 3L7WA 5H6RA 2JTVA 3RKWA 2R7DA 2VN2A 3KEQA 1J3RA 5E1XA 5C8WA 3FXUA 3MFKA 3J81Z 4O3MA 4L5JA 1ZZ9A 4IEVA 4JVAA 4EQQA 1RIOH 4HSJA 1TTYA 5K8SA 4OLLA 2WFPA 1FP2A 5D6EA 4OFGA 4Q47A 2PAKA 2IXHA 2ZMEB 1JXSA 1TNTA 3O6BB 5JCTA 3BPVA 2L54A 2PHDA 1YUDA 4RB3C 2FNPA 1USSA 1NE4A 3E5XA 4ZU4A 1HXDA 1QBJA 1EYBA 1J7KA 4U88A 5J8CA 3AAFA 1LEAA 1JHFA 4E2SA 2EK5A 1Q43A 3HSFA 1UB9A 4UV8A 1CAUB 3BCWA 1J0RA 3H92A 3E5QA 3FWEA 3CO2A 2MLKA 3KMHA 1BI3A 4I7HA 2PTMA 4Q0VA 2FXAA 3MZHA 5HLHA 2EA7A 2QWWA 3E3VA 5BOXA 2FOKA 3JAMK 1R1UA 5I91A 3F8CA 3ABTA 3GFJA 2PFWA 2Q0OA 2P7CB 2H09A 4EJVA 5BPIA 4PIZA 1FZPB 1XSXA 1WLTA 4I2OA 1MGTA 1GHCA 2F5DA 5HS8A 2ZKZA 1HW5A 5H6QA 5HVQC 5BMZA 1I1SA 2EJRA 2VBZA 2PQQA 1IF1A 1W5SA 4XFHA 2RN7A 1ZGAA 2MH2A 1OFNA 1ZVFA 2FEZA 3ZMSA 1T98A 4O9EA 5BV6A 2BNNA 3EYYA 3JZVA 3U10A 4F7ZA 1IN7A 1K79A 3HTSB 2LF8A 3D5LA 4ZYGA 3CLOA 3WW3A 2QUFA 3SXYA 4BQAA 2HQRA 4BHPA 1YS7A 1X8MA 1EP0A 4K8FA 2G7HA 3Q9SA 2QENA 1ZRCA 5DUKA 1F9NA 2UY8A 1DPRA 2FU4A 1RTVA 1LDDA 2QZ8A 3IDCB 2FMLA 3ELNA 4IEQA 2FBKA 4EJUA 4KDPA 5K5OA 4AVAA 4CICA 3RDIA 4RB1A 1JUHA 3I7DA 4RGUA 5ICFA 1WWXA 2EV5A 3JSOA 1FSHA 3FZ3A 3DP7A 5LHGA 1KYZA 5A2QK 2F5FA 1E17A 1RI7A 4ZYDA 3P9CA 1V4RA 3IWFA 2VQAA 3GYHX 5ERIA 4UV9A 3FZVA 4FHTA 2PMUA 2IC1A 3SZTA 1VP6A 4Q29A 3H3UA 2Q1ZB 3RJPA 4EMSA 4AVBA 3SCFA 2CWEA 3T5XA 4HVQA 1XGNA 2UWMA 4MHGA 1SFUA 1JGSA 1KGSA 4KWKA 1ZLKA 1YYVA 4HN0A 1YQAA 5L3BA 1WGPA 2ZO4A 2Q8KA 3H9AA 1SQ4A 4QGNA 2DPUA 2JZYA 2ADUA 3HRTA 2P5LC 2XKOA 2P4WA 5L3CA 1U3EM 3GXOA 4M9SA 3KZZA 1ODDA 5HDNA 2XASA 2VPVA 1XGOA 1FLIA 4KYWA 3IKVA 5DCMB 3KP2A 2XAJA 3EDPA 4J1WA 1O3SA 5HS7A 2L01A 5CVJA 4XBFA 3EO6A 2CAUA 3WW4A 1T38A 4KIFA 3JTGA 1LJ9A 3H3ZA 1XMAA 1R23A 2IXKA 2Q0AA 4I98B 2UZKA 4JTNA 3R0JA 2XLFA 1Q1HA 5HOOA 4M9ZA 2VONA 2EFQA 3GWZA 4O6JA 2RVCA 3LA7A 5LEJA 4UVAA 5HLIA 1JHHA 3QPTA 2K86A 3B02A 3F8FA 1RC6A 3H1YA 1X7NA 3LFKA 1T6SA 1SFNA 5CU1A 3LAPA 1QWRA 3TDZC 1CF7B 3EQLF 2D45A 1G3TA 1D8JA 4HBNA 4EWDA 3WTWC 1GXPA 1HSTA 2BNOA 4LJZF 3HOTA 4QGMA 2A61A 4KN7X 4OMZA 1J75A 2XGXA 3DEUA 3LAGA 4I09A 4XSZF 3ZMZA 5DDGA 2XKPA 5E8IA 4AXOA 1USTA 4Y17A 2UYAA 3JTHA 4MQ9F 4E70A 3KP6A 5DD8A 2PFBA 2PQ8A 4EM0B 4R52A 3GLXA 3WE3A 2F2EA 2GWRA 3TO7A 1YHFA 4RGRA 3T1BA 3M3IA 3I58A 4FBFA 2OBPA 4RGXA 2ZJ2A 4YG2F 4IEYA 1G6NA 2DW4A 3NQOA 3D0JA 2K9ZA 3CEWA 5FLHA 4ESJA 2P17A 5KHIA 4H0EA 3DFGA 1CAWB 4U0YA 3OTFA 5EFUA 4UVBA 2PG4A 5LHHA 1SEFA 1RUNA 5FQ0A 5TRDA 3SMHA 4NB5A 2NS0A 2MD5A 3FXRA 1WI9A 5FD5A 4FT8A 2JPCA 4S04A 3O14A 1BJAA 2VT2A 5I0SA 2KJBA 3V7SA 1K78A 3KGLA 3PNAA 1J58A 4JTOA 3HOSA 4A6EA 2EV6A 2MC3A 3KFWX 4OIQF 2ATFA 3ST7A 4IEWA 4DQ2A 3IRRA 3D82A 1YW8A 1XCBA 4AIHA 1NZCA 1BIAA 3HT1A 1TQPA 1TQIA 2V1UA 3ECOA 1PM7A 3P9IA 1YFUA 2OAZA 4MNUA 3KCCA 5FPXA 1LQ1A 3NRVA 4QM8A 1P4AA 2GU9A 3ES1A 1CAWA 4KU7A 3RTRA 5FPZA 3CUQC 4I0BA 3F6VA 3JW4A 1LKNA 1K6OA 4O5VA 3SHFA 2BEOA 1OYIA 2HS5A 3GW2A 4LK0F 1L3JA 1ZN2A 2NNNA 3REOA 2K27A 2FA5A 4YRDA 3F8BA 3RPUA 3I71A 5FLXK 3CUQB 3MEXA 3CUOA 3BJAA 3I59A 3KLOA 2NYXA 1UD1A 4IEOA 1FBQA 5AIQA 1ON2A 2GH2A 4M73A 1R36A 2M8EA 4EJTA 5T3NA 2ELHA 3DN7A 1PP7U 5DCFA 2BBYA 4Z07A 4CYDA 5D8KB 5ICCA 5E1WA 2MLGA 5IT9Z 5K1YA 1W4MA 2B8MA 1IN8A 1GVJA 3ZN0A 5KHHA 4B29A 3L2CA 5K5QA 4UVCA 2F5EA 2YPRA 1SAXA 3L2HA 2YU3A 3FFQA 4L11A 4D7TA 3LWCA 2Z33A 1X8EA 2FF4A 1VR3A 5KHJA 2XVCA 2EB7A 2FBHA 3T8TA 3DPTA 3U2RA 5LRSA 1OMIA 2XAQA 1OR7A 4ZYEA 3ZP5A 5DV5A 2NAZA 5DCMA 4OINF 3G7DA 3SQNA 3ECHA 3K2ZA 4HX7A 1W7PD 1RNLA 1OI6A 4E2GA 1IZ1A 3G3ZA 2H94A 4LTAA 5D8LB 3U9GA 4R1HA 2Z2SB 3WTUC 3HRSA 1HBXG 5FFXA 1J59A 2K0GA 2PYTA 3TO9A 4GCVA 4EWAA 5D1IA 2V1DA 4Z82A 3CJNA 2M30A 3F22A 4ZH4F 5ILUA 2CAVA 2PLYA 5FD6A 5I0TA 2TDXA 5CVRA 3J81K 2PEXA 2GC0A 1NXMA 4PCQA 4OOIA 1SMYF 4AIJA 4EM2A 3FE5A 1CF7A 3M8EA 1J1LA 2CQKA 3USSA 4MQVA 2MH9A 2AS5F 1QXRA 2WC2A 5ED4A 1YFHA 5BPXA 3OV8A 4WXDA 2OD5A 2L3DA 2D1VA 4M72A 5LGUA 1PP8F 5FCCA 1OKRA 3TQNA 1YTYA 1SFXA 2PJPA 5AVPA 5ICEA 1J3PA 2P7VB 2OPKA 1FBUA 2GAUA 1IXRC 1OYYA 4KIBA 3QACA 3ZDSA
chains in the Genus database with same CATH superfamily
2DA4A 4OIPF 2FQ4A 3WNKA 2PN6A 5A70A 3BB6A 5DABA 5FZMA 4I30A 3F9KA 4KG8A 4JKLA 3RZKA 2EINH 1YFWA 1BJQA 2ET7A 5DUWA 1RHI1 2CGOA 5IVVA 2LKXA 4F52A 3QOEA 5FYIA 4P5OA 1P6RA 2TBVA 3PUHA 4Y52J 5E8GA 3A0NA 2W47A 2WQZC 2QBYA 3DXUA 2EV0A 1FYLA 1FY7A 2ELJA 3PDQA 4D0PA 3OS2A 4GALA 3NWTA 3GZ5A 3KZYA 4MZUA 2DA1A 2WNEA 2WT2A 2GXBA 2Z99A 1RR7A 5DD4A 4WZFA 1IQDC 1U9OA 5FKNA 2WR9A 3ESWB 4U7DA 1L7QA 4MTEA 1RUD1 5FZBA 3GX4X 2WZR1 2Y8KA 4YW1A 2DVAA 2XJPA 5CADA 4IETA 3BP8A 2VW0A 3BG7A 3H1CA 3IWZA 3IDEA 5BNGA 4QQOA 1VPHA 2XJQA 4JGZC 3OYCA 2R4GA 2HYJA 3CCLI 3GO5A 5FJKA 3IDBB 5LFAA 1MW7A 2R0HA 3VUOA 4DOZA 1WJEA 2Y2ZA 2O1QA 2GC2A 1TWAJ 4M3DA 5JUVA 4LO7A 4M4PA 1KYWA 1L7LA 3BU7A 4ON0A 4ZHNA 1VBC3 4W6XA 3WCRA 3CU7A 3GVAA 2M2EA 3GTKJ 3M3CA 1X1DA 5L9BA 5BNNC 3W5NA 3SEPA 1ZHFA 2RS51 5FZAA 1LE8A 5CKMA 3U78A 4INDA 3GZNB 4YM3A 1K3IA 5L7OC 1NA1B 1SFOJ 2QQBA 4IHTA 1Q8SA 2HWC1 4QQHA 4FXGB 4G6DA 4XPVA 3RYKA 4AD9A 4GYIA 3D5OA 4CCEA 5B5EC 1DLCA 3CCQI 1ZRIA 4ZXEA 3LPFA 1CAXB 1WFXA 5KCMA 3ZCOA 1UAIA 1XTAA 3WP5A 1HN1A 2MA3A 3QU3A 1XS9A 4IHWA 1HKSA 4I02A 2NYYA 4Z1VA 5CNAA 3KSCA 1W8NA 4UUVA 4UW4A 1FOKA 1HRI3 1NY72 4CDUA 5KNLA 3H7YA 1A6QA 1ETKA 5F5QA 2Z9OA 4LHNA 1DYPA 3UT0A 3UKVA 2K5CA 2BU9A 4Y1YA 2DJIA 1BW6A 4A7YA 2UY9A 1LHNA 5JVTA 4COUA 4LB5A 1RJ8A 1Q8VA 1FV3A 1W03A 1BEV1 3MLKA 2QQVA 1E3HA 4QDRA 4GYGA 3KV4A 4R9BA 2OQRA 1HB4A 2BERA 4LLLA 1IXSB 4XF4A 4HOOA 2WA0A 1B35A 3I2IA 4QTRA 5LLQA 4MGKE 3KT1A 2A6TA 2BE5F 3LSRA 1ZR4A 2Z79A 3H1MA 1ZBA1 4S0HB 1RVF1 1CIWA 5AIPA 2R0QC 3BR2A 2CYFA 1H8TB 3WDYA 1D8KA 1F9KA 4IRIA 2O8XA 3M07A 2VPLA 5FQ0B 1IN4A 3UKNA 3RMYA 2DVDA 2MC4A 2O8QA 1W9SA 3L2UA 1AX0A 2NLRA 4JRLA 4RFRB 1Y1WJ 1Y43B 3ULQB 1E2XA 3OWTA 4QQ2A 4IVNA 4BYYA 1NX9A 1XC5A 4MLOA 3F23A 2JDZA 5LGTA 3OD0A 5LEKA 1WI3A 3N7LA 1Y9GA 4LK6A 1A6CA 3I3LA 4OI1A 1AR73 4XZUG 2DI3A 1DG6A 3VBUC 1EV7A 3CLQA 2HDCA 1Y7BA 3THPA 1S7OA 1O8PA 2QQMA 3N7MA 3H1WA 3K0LA 4QM9A 1ZX5A 3VGIA 3LSGA 4DBQA 3RS6A 5CFDB 4UXNA 3M4OJ 3J7NA 1VQ7I 5C3QA 2ELKA 1HRV1 5A3LA 5D5XB 3VBHA 3WTYC 2QQ9A 2O14A 4GO1A 3DBHB 1UHWA 2AXTC 1P9QC 1ND3B 2BBVA 1LHUA 5BNNA 1AR61 5DYMA 4JHTA 1XNKA 2Y26A 4Q4Y1 2C9KA 1GVDA 2L9RA 4B3NA 4AIKA 3BI3A 3K7AJ 3VYRB 2LYCA 3IC7A 3HWJA 2BZTA 2D43A 4PDKA 3ZMUA 3L9FA 2ZC2A 4LKEA 1T95A 2A6EF 4PIXA 5FZOA 3WT3A 5D5UB 4JKMA 3SKVA 3S7EA 3MW3A 4YGCA 5FZCA 3KX2A 2WSUA 4G4FA 1BVVA 3BYWA 3HNBM 2IXSA 1AR91 4EQVA 1FOXA 2WLQA 5F0HA 5FPBA 2P81A 3RJ2X 3JQXA 3WNLA 1V70A 4QSHA 4EM1A 1J1TA 2R7UA 2H1LA 1K12A 4AAXA 1G7YA 3JBG2 2V5DA 1V55H 3DBLB 3CJIA 2JDNA 5IWFA 4JYKA 4ENNA 2Y34A 4KNYA 1W0NA 2CYYA 1TT0A 4V2WA 4XLAA 5FP8A 3VZJA 1UG2A 3IPVB 4Q4W1 4BKXA 4M3GA 4UHTA 2ZXWH 2BVLA 2D1HA 1VAKA 1UU6A 1R5GA 2BXZA 1IPKA 2W57A 3O1VA 3J7ZI 2X4HA 3VWBA 3HBZA 2R16A 4YZ1A 4A3GJ 2W82A 5BS6A 4Y4RA 4FTBA 2CW7A 4XFFA 3K4NA 4O61A 4Y5Z0 5FREA 2YMZA 1WSUA 5L3EA 3ABKH 4DY5A 5JIAA 3WTZA 1BOAA 3C3WA 2DMPA 4DZJA 4X8PA 4CU7A 3FJSA 1IS6A 3LE0A 4QWNA 4FPGA 2HEVF 4A3ZA 1RUF2 3HT2A 4QPQA 1H6XA 2VNVA 3I3MA 1W3VA 2OA2A 2YROA 3K77A 1XGSA 2FQ3A 5L73A 5IYBJ 1VRH1 2PMZN 3HQUA 5FOJB 1RUE3 2VOKA 1KEXA 1VBA1 1BJZA 2VI6A 3FDYA 4RS8A 3MMYB 5JSOA 3C2BA 3VD7A 3RZZA 1CPNA 4XLPF 4NQWB 2VM9A 2XB6C 4IL7A 4UT5A 3U11A 1OCCH 2RS32 2PHTA 1XD7A 2E35A 2Y0OA 3C8XA 4XFAA 5FV3A 4LG0B 2K46A 4EJRA 4M3FA 4HLTA 4RA2A 1YFYA 1ONVA 1UO9A 4KGGA 1B9NA 2DTZA 4AK3A 3CC4I 2QJVA 4CCMA 3FK6A 2R30A 3VZLA 4MTDA 3G1OA 1ITYA 5CISA 4LUMA 4CCOA 2WB1A 2KP6A 2VZVA 4MX3A 2EIJH 4AIDA 3U4XA 1SVLA 2LSOA 1GR3A 2ISZA 2BGCA 1U78A 1H6YA 4PQ9A 2Q2EA 2YV8A 1LDKB 1LFUP 2YFZA 1ON1A 1MH4A 5FLJA 3FM3A 4M3CF 2F4MB 1X19A 4DINB 3E0JB 2ZGQA 5D4RA 5JVGF 3JRDA 3OGJA 3RZDJ 4N7IA 1D7PM 1TEIA 3HOUJ 4IESA 2JXAA 1LU2A 4I0WB 4BK4A 3Q9VA 4FVVA 4FQ4A 4PDWA 3TO6A 4XICA 2Z69A 1MMGA 2WY7Q 3GALA 3H8OA 5FZ3A 1KS5A 3EQEA 5DUUA 1JHNA 1B8IB 2VBYA 1ETXA 3PFYA 1LE8B 4YARA 1S7AA 2VUJA 4LA2A 5HNFA 3WINE 1SMTA 1J2XA 2F4IA 1N25A 1RUI1 5HDGA 1FC3A 2M5WA 5FZGA 2XQXA 3A2KA 1TME3 3POBA 4CCKA 1WJFA 4M01A 3WCSA 3USUB 5B1AH 2TNFA 4WVZA 1SLCA 3LQRA 3R4KA 2EIGA 1CVNA 2FMYA 3TEWA 3L9JT 1Y9QA 1RMU1 4AM3A 3M1EA 4OUEA 1JYNA 1YJKA 5C8CA 4GMP1 1VALA 1OFCX 3VKLA 4YEJA 2UYBA 3GMEA 2UWCA 2WO1A 2VKHA 5A7SA 3R0RA 5CQGA 3F8NA 4KI5M 2LY9A 5D4SA 2Z5WA 1IKQA 3LWFA 4OMYA 3LSKA 2WINB 4XLCA 3LPGA 3EUAA 4DPNA 1G3WA 2GN7A 2H8WA 4DRRA 3EUHA 1CJDA 1FOWA 2BP6A 4HKOA 3SCGA 4FPKA 4BK5A 4K21A 4BQ2A 4L5EA 2DK8A 4P02B 3OGSA 4BJ6C 4XJZA 2QA4I 2K3FA 3RSNA 5DN2A 2V4JC 2NRAC 3OS1A 5GZCA 2KD7A 2HOEA 4WV8A 1RIRA 2X6WA 3RPUD 1AHSA 1ZZ7A 2BY1A 3PURA 3CLPA 4GRIA 5LBQA 1MNDA 4L0YB 4CHUA 3FMSA 3WW1A 4C3JJ 1VRBA 1HB3A 3ZIXA 1FATA 2P8TA 2VNRA 3NSTA 4M6VA 4BBSJ 2ZACA 3S1RJ 3S3NA 2JSPA 5D5WB 1D5YA 4XRSG 2Q4SA 4XM3A 5K7HA 1H9GA 3UK9A 1MEC1 4N43B 3FHZA 4F3QA 5FMCA 3E6DA 3CJQB 3HXLA 4Y33A 1D4M2 2WKKA 3K3NA 3VBRB 2EA4A 1AA7A 1GOGA 3VHRA 3NJXA 5FYTA 3S93A 1UPIA 1JE8A 2VMEA 4C1WA 4AAPA 4A45A 4EN0A 2YPDA 1V0AA 3OPZA 4D9JA 4B3XA 3SEQA 4XJAA 4ZZDA 3KD4A 2IVMA 1W5TA 2VQCA 1I50J 1YW7A 4C0HA 1NLQA 3JSPA 3W6VA 2PHWA 2XUMA 4DRVA 4D5FA 3TEYA 3Q0UA 3FXLA 2ZJCA 1DQ6A 1OUXA 1RRJA 4L18B 1QPMA 4URAA 3S8PA 4G9SB 1Z6RA 2M1BA 1JYCA 4M0NA 1FOD3 4PDWC 1E5HA 1V6KA 2DMNA 3J26N 4MXWB 1RUH2 2XJRA 4IZZA 1REPC 2HTSA 4DXRA 2K9SA 4FI9A 5JR3A 1HSJA 3EMRA 2P6HA 4IV3B 1WBFA 2IA2A 3CP2A 4OMCA 2Q1FA 4B8XA 4META 2F4LA 2EXKA 5LHIA 1FMD2 1TBXA 4MV2A 1Y0UA 2P5VA 3ZYBA 4MADA 1RL3A 1LULA 3NWSA 5CQEA 4OIRF 3N9MA 3DCFA 4Z2WA 2RGVA 4FOQA 3KETA 3GXUA 2YDEA 1ZTRA 5D2AA 1HCRA 2CW0F 3E5UA 3Q8FA 2AQEA 2WWYA 1UCXA 1H8VA 1JKPC 5E79C 1R1A2 5FO5A 2VOOA 2YSRA 2W85A 4QDSA 3OYDA 3EB7A 4OQ8A 1ACCA 5CVUA 2CNAA 3V8LA 4AHWA 3KP5A 4WK8F 2L5QA 2W1OA 2H6CA 3G73A 3GYDA 3V0AB 1OCPA 1P4XA 1HXS2 3HGGA 3JRCA 4NHYA 4A2UA 4QQLA 1GNYA 1BI1A 2QQKA 4NIDA 1W39A 2R042 1PVEA 2Y69H 3S0MA 5H20A 1MVEA 3LFMA 4DYQA 1RB8G 3VDCA 4D7NA 4PLOA 5ICGA 4EN7B 2IGKA 2PMZA 5HLGA 1PIV2 2OU2A 3FHIB 1A31A 5FXWA 1I1GA 1HB2A 5GZDA 2JDHA 5F9TA 3FXQA 3HG9A 2DCKA 2ZNYA 3ERMA 4HF1A 2KA3A 2DPDA 1DPUA 2X6OA 4OMDA 1X82A 1ZZ8A 3I64A 1XNTA 2VE1A 2O0YA 4UYBA 3DWLE 2WY8Q 3WU2C 2BY3A 4X6RB 4WBBA 4XQ4A 4EVIA 3IIAA 4L9BA 1ZYBA 3LKJA 4Y26A 2X09A 2ZMEA 2EVXA 4CYCB 4YW6A 1NXD1 4OCTA 2AZ5A 1UMQA 3GCMA 3I56I 3K4DA 4EJOA 3OSDA 1HA8A 4LOSA 1C5HA 3BG9A 3DTKA 1NOVA 4UUTA 3PNVA 2ZX3A 4FX0A 4BJ0A 2A6WA 5A32A 3CCSI 4E4HA 5JSRA 3SDBA 5FOBB 2K4BA 1CAUA 1H8TC 1ZM1A 2ARCA 1AR93 2CUFA 3B01A 4CDWB 2XBO1 2VE8A 2BWAA 1RXFA 5FKMA 1WCMJ 2K4JA 4UFKA 4QDQA 3THCA 2B9VA 2XQRA 5EGOB 1Z7UA 2NVXJ 4ARYA 2HTJA 1W6PB 1YI7A 4DW6A 2XAUA 4NO4A 1FNZA 4MH0E 5JI6A 3NVCA 2LG4A 4HNTA 2R073 3VZMA 3T8RA 3A7QA 1A8MA 1G8WA 2JDAA 5T54A 1TW3A 3ZOIA 4TLFA 3U1XA 5IUQA 1W36C 2W24A 3RJRA 5IP9J 3N97A 4XJ9A 1ND2A 2MPFA 3CCRI 5BQTA 1RUE2 4IOCF 5GPAA 1DUXC 3POGA 3CO6C 2L02A 3TOBA 5A3TA 4L9VA 5CG9A 5J48A 5F1JA 4ZZLA 1W6NB 4YNIA 3O1UA 1R4MB 2JRTA 5BYNA 1J5YA 1S3JA 4NWWA 4R9DA 4FPYA 4XLFA 1B59A 1YQ5A 3QODA 3K70C 3BDDA 3CJRB 2I74A 5F3GA 1UOFA 3BR5A 4HNVA 1QNTA 2CU5A 2WZPP 3ZQQA 4MGQA 2YPJA 1CAVB 4FFFA 4HRIA 2VNGA 5IYDJ 4G7HF 2CSGA 4RAYA 2XGCA 1TL8A 3ZQFA 3AG4H 2PLV3 3ZFFC 2EFNA 1QJY3 1POV0 2KJCA 2QGUA 3FXKA 4UFMA 2C0ZA 4PF1A 1JHJA 4N7UA 2CFOA 1RUC2 4H4KC 2JIJA 1HKDA 1ULYA 3PUSA 3OYIA 2Y38A 1N1VA 1PM4A 2E7WA 2VR4A 1RVF3 1HJGA 2DFHA 2QYOA 1KONA 4CU9A 3AYEA 5B66C 1IJWC 2ET1A 2ID6A 4XEZA 4NAMA 4P5HA 3VDDC 3DPRC 4CA9A 2D98A 4ZC3A 1FYMA 3WP4A 3V0AA 5IYCJ 4QXCA 1QHDA 3U0ZA 4N9IA 3BC8A 5FFOC 3WHCA 1ODNA 2XF5A 3EHKA 4BM8A 2V9PA 4GDFA 4YZ3A 5CKNA 2BDRA 1C8NA 3ITQA 3GZTB 4UW3A 4A0YA 1TME2 4YIFA 1BC7C 4K9SA 3WG2A 4AI9A 1XE8A 2A5WA 1S0FA 2W1UA 1HQCA 4ESBA 5ANNA 4Y1UA 1WZ2A 1TWFJ 1ZAOA 2NS7A 4AYUA 2R5ZB 4BQOA 4Q4X3 1IG3A 3RKWA 4IOAF 1ZGWA 5IATA 2XB0X 2K3PA 2KT0A 4O3MA 1U8BA 5F27A 2XMLA 4CDXC 3A0KA 2LRPA 4JDMA 1TTYA 2BOJA 5L9RA 1AF9A 2WFPA 2EZKA 5D6EA 3KCYA 4OFGA 5HPOA 3TEZA 1O4XA 2PAKA 2VZRA 3CKHA 2IXHA 4AHXA 1Z0HA 2HWC3 4GB32 1NE4A 1RMU3 1NCQA 4D6RA 3E5XA 4B4QA 1HXDA 2IS1A 3CHXA 4Q1PA 4YFWA 1W8ZA 4CUCA 3H0OA 3AP7A 3H35A 1W9YA 1BOBA 1FNYA 4E2SA 2EK5A 3CCMI 2VTXA 3GTJJ 1Q43A 5A32B 2AH2A 4HG6B 3DU5A 1R082 3AL6A 1QKQA 3BCWA 3H92A 1K4TA 5E6HA 3ZR5A 3CO2A 3IUOA 5F5CA 2P3KA 3FISA 5FY7A 5DDJ1 1LVKA 4Q0VA 5HLHA 2Z42A 3I4MJ 2LK2A 1P7JA 3PSFA 4IGPA 1Z21A 3ZQLA 2PFWA 2VC9A 1GOFA 2H09A 2CDPA 2ZX1A 4XJ8A 1NLRA 2F17A 1ONAA 4ZXKA 3UNPA 1GHCA 5CG8A 1V00A 3SH3A 2ZKZA 4B1RA 2ZXHA 1VBD2 2VBZA 5IVYA 1IF1A 2QDNA 3PUFA 1AXYA 2RN7A 4XAEA 1DF0A 1OFNA 4OZXA 1E5SA 5BV6A 2BNNA 5GP9A 3U10A 1W28A 5FUPA 1IN7A 1K79A 3HTSB 3OYMA 4CEYB 4ZYGA 1ENQA 5FLMJ 3CLOA 3OYHA 5C4WA 3WF2A 1OD3A 3LIGA 3CCYA 2RQQA 1F43A 1HV0A 3ZFEA 1LGBA 1VQMI 2PLV1 3Q9SA 2ID3A 4IQ4A 3KQ4B 1F9NA 4XIOA 1DPRA 3P3NA 3TB0A 1XYNA 2QZ8A 4S2HA 3WV6A 4CICA 1MBGA 1AR63 3I7DA 2BZDA 3BR3A 3OJBA 2ZTNA 1FSHA 3LSDA 5IP7J 2VW1A 1BBT1 5LHGA 5GALA 5A2QK 2F5FA 2L9NA 5KXDA 3P9CA 3L2WA 2R7XA 4ASKA 2G9FA 2PHRA 3FHNA 1FMD3 1VP6A 5FYCA 1QQP2 2QE3A 5EEAA 4AVBA 3SCFA 5DAXA 2F6BA 2CWEA 3T5XA 1WZXA 2KR2A 4IE7A 2RDNA 1XGNA 2UWMA 5EYRA 3GF6A 4AQTA 1JGSA 3DLLF 1HRI2 4QPGA 5IYYA 2WT1A 1YYVA 2VUMJ 4TTGA 1BHGA 4HN0A 1DFQA 3ZFEB 1WGPA 2CH0A 3CZUA 1LFPA 2DJNA 2BW3A 4R9CA 4P9JA 3HRTA 4FISA 1GOHA 4LOCA 3T08A 3GXOA 1R1A3 1OF4A 3TN91 2DU0A 3BOWA 1ODDA 2P37A 5HDNA 2BY0A 2WO2A 1FLIA 2NMOA 1Y4WA 3RKQA 1W36D 3AB0A 4WVWA 5J09A 3KP2A 2WV1A 2XAJA 2TRTA 4J1WA 3RG0A 3R4DB 4UB8C 1AUYA 2EXHA 4JKKA 1SFYA 2CAUA 2X29A 1XU1A 2AREA 4KIFA 3JTGA 1JYVA 3WNPA 3ENRA 3IV5A 1XMAA 3ABMH 1R23A 2Q0AA 5GZFA 2UZKA 5K9YA 2XLFA 1Q1HA 2J1AA 1NCQC 5HOOA 5E88A 2FCVA 4FFHA 2L7FP 4YM1A 4QPIB 1UPSA 5EXOA 1WD4A 2RVCA 3LQCA 4UVAA 1JHHA 3MI8A 5C8CB 2VUDA 3ZXLA 2BXYA 1YJNI 5SV5A 1T6SA 4CUGA 1SFNA 3TDZC 1UMHA 5FY8A 5EHDA 4HBNA 1LOGA 2XONA 4Y20B 2QSFX 4PJJA 1AYM1 3WTWC 3ZPYA 1HSTA 2BNOA 4LJZF 2JUGA 2YB7A 1W6PA 4KN7X 1TWGJ 4I09A 2W46A 1I39A 3AMMA 1PO22 4XSZF 2XJUA 5GJ6A 5CFCC 3JTHA 4MQ9F 1YX3A 2AR6A 1IS3A 2D6NA 4Z6YA 2PFBA 4BJ5C 4EM0B 4R52A 4Y22A 1AR72 2F2EA 4AWDA 2R49A 1YHFA 4FPFA 4RGRA 3T1BA 4KBZA 3M3IA 3I58A 4FBFA 3ABZA 2D3RA 3N05A 1OCOH 4IEYA 1G6NA 3NQOA 3I97A 1S1AA 3ZYHA 1B35C 4HEA2 2ZEZA 3DFGA 2OVUA 4U0YA 2ZAHA 3V0BA 5EFUA 5CKQA 5GLVA 4YM0A 2PG4A 2DF7A 5F3IA 1JYXA 5L7OB 1RUNA 5FQ0A 3RZMA 3FXRA 2JPCA 3N9NA 1QEXA 2O9LA 3HOSA 2DN0A 4K1YA 2EV6A 3KFWX 2JDMA 2ATFA 3ST7A 3GHMA 2ZGKA 5ERLA 1PO12 1R6RA 1WCDJ 2J1EA 1XCBA 3SZGA 4AIHA 5FZ6A 4D6QA 4XUTA 1PM7A 1A8DA 3P9IA 1UYPA 5FPXA 2Y6KA 2XVGA 4RAFA 4OZOA 4XKCA 1W2TA 4KU7A 2OJED 3RTRA 2VQ0A 1AX1A 1DZQA 1ST8A 4JHZA 2O0OA 1LKNA 1SEUA 5IY5H 3SHFA 2WJSA 2YU2A 2NNNA 3REOA 2FA5A 1MACA 4AL9A 3CUOA 1DHKB 1V9U1 1HQLA 3LMMA 2ADEA 1UD1A 5FK7A 1FBQA 2BOLA 4M73A 4XIDA 5C5UA 4EJTA 1TME1 1PP7U 2BBYA 1FTZA 2WN2A 4WM8B 4Z07A 3ZIWA 3C2UA 3NKGA 4PT6A 2QFEA 3MKLA 1QJY2 4HNUA 5K1YA 1LPQA 2B8MA 2BHZA 2HPIA 4II2A 1GVJA 3ZN0A 4BS9A 3IH4A 1GNHA 2WFF1 5FMOS 4UVCA 5EV7A 2F5EA 2YPRA 3SEZA 1DQ5A 3L2HA 3B6CA 4Y1VA 1AR83 3VBFB 3T1LA 2Z33A 3I3DA 1RUF3 2X1EA 3OIPA 4BACA 4NPMA 3QYFA 5HLTA 3OY9A 1VR3A 3CJIB 2XVCA 2EB7A 1BR2A 3IZOA 1W04A 5LRSA 3OPWA 1X3ZB 5LBFA 1OR7A 1AL22 1PX4A 2VVFA 4H3WA 3K46A 4XQWA 2RS11 4XHXA 3B7MA 1UJ8A 2VIXA 4OINF 4SBVA 1G8XA 3VLBB 1RNLA 1QJX2 2JE8A 3G3ZA 1EUUA 1YJ9I 1GBGA 3BODA 5D8LB 3U9GA 1B72B 2Z2SB 3VDXA 3WTUC 3HRSA 4DBRA 4CPBD 4A3IJ 4QX3A 4RSUA 4IE6A 5CFCA 4EWAA 2P1BA 4C2UA 3RZOJ 4JQTA 1HDDC 4FPHA 2FBEA 3LF7A 2HXIA 2PEXA 1SMYF 5C3OA 1BBT3 3DKQA 3MPPG 5FZ0A 3FK7A 2JDPA 3M8EA 3USSA 2ECBA 2GM4A 2AS5F 4OHYA 2YXSA 2XF6A 2DT6A 1YFHA 5EQUA 4XBQA 4M72A 5C5TA 1S5LC 1W0OA 5ICEA 1J3PA 3JRBA 1LTEA 3VZKA 3BTZA 3GLLA 5BNPB 3PNYA 4AFAA 2YBPA 4RD7A 3GZ6A 5A3OA 3HSRA 4GB33 5B1BH 3L2YA 1CQTA 3UKTA 3RZLA 5I0DA 3KQRA 4G8XA 3DXTA 2E1MC 4IF4A 2LLKA 2DLLA 1ODMA 2A5YB 5FBZA 2PA7A 3OGVA 4A3XA 4CU8A 2DOEA 4AFCA 2OQGA 4RGAA 4DB5A 5FKKA 2GC3A 5FXVA 4DUWA 1G9AA 4LLNA 2HDWA 3M2MA 2KZVA 1MPXA 4F3JA 2D7FA 4LR4A 3U1KA 2HWD2 4PLNA 1ETOA 3C7HA 5J96B 4XJUA 2VY0A 1OURA 4HDVA 5B4NA 5EZWA 1S6LA 2QM3A 3V7RA 3MLJA 2RDQA 4CDXA 2SLIA 3HSEA 5E17F 2OKXA 3BY6A 3R61A 3SISA 5FZIA 3ZSKA 4Q0UA 3OYLA 2V1XA 4AGRA 2KPMA 3MQ0A 3BKZA 1ZZBA 4RLFA 3JREA 5LGNA 1BR4A 3H0DA 1DQ1A 2HFHA 2V79A 1SHWB 4ZKTB 4AEMA 2QQAA 3BQZA 5EDNA 3S5AA 2NOGA 3R4UA 4QLCU 2QQNA 4U7BA 4RR3B 1ZGJA 4ENKA 1OYWA 1RC9A 3PL8A 1ZRFA 2CGPA 1EJ9A 1RESA 1MBKA 3K2AA 3KP4A 2DBBA 3C7JA 2XLAA 2VH9A 4I99C 3W6KB 4CDGA 1E5RA 1QJZA 2MEV3 2CG4A 2PBIA 4CUAA 3KHBA 3GF2A 1XNCA 4GGGA 3LSJA 1DDNA 3M8FA 2R6QA 5FGMA 4DNCA 1CX1A 1JU4A 1W8OA 1ERDA 4PK4A 1W6MA 1AR62 3DF8A 3LSHA 5CPRB 1A34A 2A07F 2STTA 1BIBA 1FT9A 2VBXA 4WM8A 3VD5A 2FZ1A 1SD4A 1XNDA 2QF7A 4N4NB 2D5VA 3M7AA 3PU8A 3OOPA 5F5IA 2LFBA 3RNSA 1GANA 1E3OC 1EAH3 3Q8AA 2UV1A 4PJLA 1QQP3 2P2KA 5FP3A 1FX5A 3GBGA 4L97A 2HQNA 1IZ3A 1XSVA 3TYJA 4P14A 5JR2A 3PMSA 2ISYA 1SCSA 4P9IA 5D8AB 3WVJA 1FX7A 1HB1A 3VDBA 1LOBA 2XUBA 1HQNA 2Y0MA 1RPWA 4A3DJ 1NTCA 3N9QA 4Y4YA 3LZZA 1PGL2 2W5FA 2YC4A 1DGRN 4HLXA 2K9NA 3ERED 1YW9A 4ZYHA 3F21A 5KHKA 3OBAA 2DQLA 4XILA 2HKXA 4B44A 5EPAA 2HOSA 2PHXA 5A1AA 2Y6LA 2FDFA 2E5NA 3O1PA 4LFUA 5BXXA 4BHBA 4I3PA 5DUVA 3HD8B 5SV8A 3NMBA 1OF3A 1FYKA 1FEXA 1BM9A 2HQ5A 1C5IA 2ZKLA 3S1MJ 4OYUA 3ZYPA 4S2GA 1U5TB 3G1LA 2VZ3A 3RI4A 1WW4A 3AXDA 2GMPA 2VB6A 4JZRA 2VJ4A 3S17J 3NJZA 3LSEA 1GU3A 4IHVA 5JOYA 3TP0A 1SANA 1UZWA 1R58A 1PGW2 3LFUA 3V0BB 4LO8A 2VPRA 4OULA 5FP4A 3E1SA 1JYTA 1XU2A 5C6CA 4H7LA 2H8RA 5FY9A 3OG2A 4K40A 4JGZB 2W4SA 3MIBA 4XDPA 4XQDA 2YY1A 2KMUA 1V6LA 1PO23 5DAQA 4LO6B 3WTXC 4MXVA 3VBSC 3ISPA 1NA1C 1R7JA 2QSHX 3WDXA 1C4RA 2B45X 5DUIA 1MJAA 1N3QA 1Q8PA 2E2JJ 3GGLA 4HL0A 3FMGA 1BKZA 1VQ9I 4ISQA 1VQKI 3NJVA 2OZJA 4B1LA 5FBJA 3ZN5A 2E2IJ 5A2QZ 5I0UA 4XVHA 2XDVA 2C6YA 5CJ9A 4DYCA 1MJBA 3ATGA 3CTAA 5C3SA 2JA5J 3MV11 4MVTA 4ZJZA 3HOXJ 1WH5A 1PNGA 2UWBA 1HXS3 4LBJA 3T2PA 2LNBA 1W6QB 4HF0A 3NRUA 4ATEA 5GPCA 4BDVB 1FWZA 1B1BA 3AP5A 2OX0A 1MR5A 4WM7A 4RS5B 4L5IA 3TEXA 4GXOA 1CD3G 2R043 4HBLA 2KDZA 4H2AA 3KB5A 4GJYA 3W21A 5HI0A 4UFHA 3T30A 4QMAA 1W0UA 1IUYA 1K61A 4HVOA 4W6WA 1ENRA 1JKRC 1PIV3 4IW3A 3S2DJ 1SBFA 1PO13 2I8DA 1P4WA 5TJJA 4LBQD 4P5YA 3CCEI 4AE2A 2GOXB 3WEZA 1IRXA 1REEA 4CEWA 4YVSA 2CQ7A 4SLIA 2W25A 4ZS2A 1VQPI 1R092 3DF0A 2XHKA 2DFIA 4N9HA 3GCXA 2KZGA 4PBOA 5EJZB 4BLJA 1NQJA 1EY2A 1FV2A 2W2IA 4MUVA 5FXXA 5L19A 4LUKA 3U1DA 3V56A 3BTAA 3R6SA 3ZYGA 3BZKA 3QD6A 3SITA 5DS9A 1YQCA 1IS5A 1D0ZA 3MIEA 1Z1DA 2CWMA 2W1SA 4ARXA 1IRGA 3VD9A 4XF0A 2MHFA 4HPKB 5BUVA 3WG9A 1UIJA 5CBLA 3H8RA 3KVAA 1P92A 4QKDA 2QZ2A 3CZ6A 1DGWA 5CFCB 3N4MA 1QH7A 1AR92 2B0LA 1AJKA 2Y60A 1ZH5A 3I49A 1FSEA 3NNJA 1VE0A 1JUPA 5D8AA 3AK0A 3BR1A 1HRI1 3QRFF 2AXLA 4IHSA 1F35A 4D5CA 4GQ7A 4M3BA 1AR82 3BOQA 1LEBA 4D7MA 2FDIA 4MGRA 2VBBA 3M3YJ 2J1UA 1X36A 3O3KA 2O7OA 4YYOA 2C1FA 4RB0A 3W2VA 3R0AA 4A3EJ 2DDUA 3F6OA 4Q4ZF 2KIMA 1POV1 1DYKA 4UOJA 3VBRA 4P1WA 2VBWA 5LATA 1MS0A 4XIKA 1ALYA 3P3PA 4LKDA 4M3CA 4AYBN 2A69F 2GP3A 3S2HJ 1QVUA 4KU8A 4YELA 3IT8A 3ZN6B 5FZ8A 2KIUA 1FI2A 2Q30A 1ULDA 3G6JB 4JV4A 2DA7A 1WKMA 3J7AY 2I2SA 4WCGA 4KJZA 3S2WA 3WUDA 4A42A 4BH9A 2I45A 3LSTA 3DTEA 3H42B 1BBT2 2D6MA 5BNOA 1HIXA 1YX5A 1O7LA 2M3AA 4HETA 1KQ9A 5LB6A 3GFIA 2E7AA 2VOVA 2G4IA 4NHXA 4A0ZA 4RGSA 1FTTA 2E7TA 3KT7A 2F6CA 2ZXJA 5I0RA 1W6OB 1WQ2A 3ZR8X 1BBYA 2LTPA 4E7JA 1YI2I 2PLV2 1K5MB 2G0EA 4FAGA 3AZZA 3OUJA 4M3CB 5IP6A 1Z77A 4O65A 4XUPA 1ZG1A 1KRIA 5HV0A 3OBRA 4BQWA 1RXGA 5FKBA 4PZJA 5JOZA 3E6BA 3ZMVA 3S3MA 1RVF2 3DUIA 2BWCA 2FDGA 4GH4C 2ESNA 4LG0A 1BZWA 5FMBA 4QHBA 2OV7A 1V3FA 3H8XA 1VB4A 2NNYA 1WW5A 2BVMA 3WY6A 5L7OA 3UETA 3B9CA 1UKGA 4QX5A 4COVA 2HEWF 1OPOA 4YZ2A 4IEUA 1URXA 5A3UA 3DPUA 2VQLA 3ZFGA 1RUD3 4MGIE 3WNOA 1DGWX 3CO7C 4P08A 1HOMA 3MW2A 1SD7A 2JSCA 4E7IA 1WD3A 3PUIA 1T6BX 5DDJ2 2DYRH 4CP0A 4FETA 1B6AA 3FBMA 4DUXA 4L9JA 5A6YA 2X85A 1KD7A 2YUSA 2D6OX 2GC1A 1NG6A 3F95A 4LIVA 5F37A 3SCHA 4XJWA 2IXCA 4ASLA 4D3WA 4WXCA 2LC2A 2ZJQF 2G9GA 4FP2A 5M5WJ 1N1SA 1BR1A 1HN0A 2N7GA 1LKXA 4OVEA 3BZCA 1MS5A 3A1YA 3KLSA 4CDQC 2ZX0A 5I8TA 3ES4A 1ZA4A 2JPBA 5CEHA 4CUBA 3JU9A 2EALA 1QZZA 1UOBA 2HWC2 5K7FA 2DXIA 1WW7A 4ONUA 2L9LA 4KICA 1VQLI 1RMU2 3HB9A 3CDZB 2J5OA 4TLGA 3T0AA 4K20A 2HU9A 4Y3OA 4M3EA 3FC0A 4YG6A 5ILVA 2PHFA 4L9TA 5DAPA 4EZ4A 4WX9A 4BA6A 2NVUB 2P0WA 4RS5C 4UBHA 5LRRA 3SZPA 3H7JA 3WP6A 5C44J 2D5FA 3IKWA 3BU0A 4MEXF 4KITB 1R083 2UXNA 3H36A 2YBKA 1GXQA 1U5IA 3ZYJB 1I6HJ 4CP9B 3E6MA 3WTTC 1N78A 2I10A 2CFXA 1UAAA 1SC7A 4QB6A 4MFEA 1COV1 1QVTA 2V4VA 1VI0A 3N7KA 5FB2A 2DCYA 1TVGA 1YQ8A 2IFWA 1OR7C 4U0VA 1W1WE 1YIJI 1YRNB 4BMBA 3IH3A 4WVVA 4Q0QA 4Y1ZA 4PFPA 1DZTA 4E7KA 4BWOA 5F32A 2M4KA 4FQZA 4AVPA 1UYXA 4A6SA 1VBD3 3T4HB 3FHQA 2KM2A 3OOXA 3KWVA 4XFIA 4BHCA 3WDUA 1RETA 4HA8A 3ZQCA 1C3HA 4H7MA 4NOTA 3AKQA 2YYOA 3ASIA 2VD7A 3OBZA 3VBFC 2M4GA 2V1NA 5JVVA 2E1OA 2XPVA 1F5TA 4F91B 2IXIA 1G2HA 2EZIA 3HIFA 5FPAA 1LECA 2A3XA 4Y13A 4IDZA 4ETSA 3S1NJ 4PI0A 1SFEA 1A36A 1UU4A 3MZ8A 1Y3TA 1U5ZA 4XABA 4FPCA 2FHRA 2KRFA 2R3SA 1LRHA 2XSDC 2ACJA 1JZ5A 5LBEA 2DUOA 2DT5A 3HJEA 3BTYA 5J1UA 2AACA 2RE9A 2XL7A 3RI9A 3PU3A 1N1TA 4GMP0 3WQ1A 4HAMA 3DQVC 3TOAA 2HOAA 2XLGA 5BNNB 4HQEA 2ZSHB 5F1RA 1AKHA 2GOMA 1YLFA 2GLOA 3TBIA 4A3CJ 3K1NA 1DU3D 1QA6A 4IHXA 4QX7A 1H0MA 2P5BA 2X10A 4Q5OA 4CP1A 4IJAA 4XSXF 4WWCA 1JMUB 4ZZ8A 1GQGA 5IAVA 3A23A 1W2NA 3LOIA 1UF2C 2DTRA 2B5HA 3PMEA 1LVAA 1RUF1 1JJ6C 2FDJA 5A80A 2ZSIB 2KIFA 4K6BA 4YFXF 4ES9A 1B4AA 3EBRA 5AONA 1FJLA 5JHFA 1EAH1 4XRSA 3MO4A 1X3UA 1N77A 3OGRA 4YZ4A 5H9RA 3KP3A 5FIXA 1AYM2 3TL4X 1L0OC 2VASA 4JQRA 1D0YA 3HKZA 3BJ6A 1WLCA 1UZZA 4A69C 4XFGA 3F2ZA 2VKEA 1ZZ6A 5FUIA 3J4UH 2PJRB 3MZYA 1ZNPA 2ETEA 3CF6E 1O5UA 1H4HA 2VQUA 2WNVC 5KHGA 5FJHA 4XTPA 1U5XA 3NARA 4HSRA 2VO5A 3IDAA 3IRQA 3KE2A 1BA5A 3K4LA 2BUKA 3HN1A 4W4ZA 1I3HA 5J1RA 1FBSA 4YIRX 3LFIA 2K40A 5M3MJ 3O0WA 4JGYC 3ACLA 2CDOA 2G1MA 5J8FA 1RUOA 2FD5A 3GCWA 1IDYA 3FXOA 3JB4C 3NO8A 3H0GJ 5CYVA 1K4SA 1JKQC 1ZG5A 3ALQA 3BPXA 4NWVA 5E1RA 3GJAA 3PQKA 1O4ZA 4BXXJ 2A6ZA 3RKYA 1MBEA 5HXVA 4CA0A 4QKFA 1PIV1 2KKOA 3PFIA 4OAYA 3GEZA 3VBOA 5DUXA 2A3SA 1OCZH 2JA8J 1ETQA 3OEBA 1SPPA 3HBKA 3AZWA 2PELA 1XXNA 1FYUA 1YG2A 4HF2A 3PJRA 4Q5SF 1AOYA 2WQ4A 4EEFG 1AR81 1RZ4A 4QU1A 2JA7J 3F3XA 4HZFA 2SBAA 5L3DA 1CESA 5A7NA 3TNQA 2JRMA 3VSKA 2JJ7A 2CQNA 2CGNA 2KRHA 2JEMA 1ZK8A 4GULA 2R071 3IAM2 1PZ9A 3O7OA 5L3FA 3K2OA 2DOAA 4UF0A 3CMYA 4BXFA 2J7MA 3ZFFA 1COV3 4GA9A 5IVBA 3I3BA 1EPWA 2H27A 1D1AA 2ZMKA 2B46X 4KMFA 3UESA 2HR3A 1JYIA 4HW0A 2QTWB 1KQ8A 3QCWA 3B73A 1U5TA 1Z3YA 3GBWA 2Y6GA 3DECA 4A3KJ 3ZX7A 2RM21 4OHXA 4CU6A 4GIQA 5A3NA 3I4PA 2P6SA 4AR2A 1YEWA 4M71A 4YFKF 3I2HA 1RUC1 1Z3XA 3IH2A 2WN3A 2DO7A 4DY3A 1RGSA 2CJJA 2W48A 1S29A 2ZMEC 4XDOA 2DMQA 2RAEA 3QU6A 1XDSA 5M3FJ 3O0XA 4QX8A 4F8AA 1K78B 3NV1A 3D8CA 3HBLA 1AZDA 4IPAA 5DZEA 4LT5A 4BOWA 1LR5A 2P6CA 1ZRRA 5A7WA 5E3NA 2Y64A 5GAGJ 4XFBA 1OA3A 4M6YA 2LY1A 3PLQA 2ME6A 4I01A 2M87A 2CUJA 4D1QA 4LBLA 2RJLA 4BE0A 5FTTC 3M1CA 1HKTA 2IWGB 1H1AA 3GZAA 3EETA 3BR6A 5C3EJ 1HW2A 4HX8A 2WYFA 1B09A 2Y75A 4BE1A 4UY8I 1XSDA 3LCPA 1X33A 4ZS3A 5A33A 3K75B 2GNBA 1TLHB 4YSFA 2QBXA 5JSPA 4XXAA 1TP4A 1D4M1 4CVUA 2ZGOA 3ZXDA 3EUKL 5FAXA 1AL23 4MIMA 1DDLA 2CSOA 3VB2A 5ANQA 4ENMA 2JX9A 3CC2I 4WM7B 1QJX3 2QZ3A 2COBA 2M7BA 1GWMA 5KBFA 1VQ4I 4ASMB 1D5VA 1S2BA 1Y6IA 2AEYA 3FUOA 3NW4A 4NE9A 1H9TA 3WDWA 4PSXA 4HG2A 4P9FA 3K4ZA 3K69A 2IA1A 2OPTA 3VKOA 2GXAA 3I2OA 2R7ZJ 1AR71 4KT5C 3RYRA 1JKOC 2BJSA 1E3PA 1CX4A 2RREA 4FOYA 5FZ7A 5FKCA 1LGNA 5LD2C 2NVQJ 2BW8A 5H9QA 1R64A 2E1NA 3L7WA 2EIKH 5H6RA 1OCTC 1O91A 2R7DA 3KEQA 4TWTA 4L5JA 1ZZ9A 1RIOH 1TWHJ 4HSJA 3J8F1 1BYHA 3BCBA 2IZWA 1FP2A 2C4XA 2V26A 4ZDLA 2BTVC 2LREA 3F0CA 3O6BB 1N75A 5IHRA 5JCTA 3BPVA 4XR6A 3H9GA 4RB3C 3P1IA 4ZU4A 1ENXA 5J8CA 3RRDA 1LEAA 1JHFA 1XMXA 2MGQA 2IS2A 4UV8A 2QEXI 5F8PA 3URFA 4E4SA 1VQNI 2L7MP 1CAUB 1J0RA 3S15J 3T2OA 1D1CA 1BI3A 2PTMA 2ZB9A 1W2OA 2CQQA 4X1EA 3SYTA 2W9XA 2FXAA 5FYUA 1W9FA 1YJWI 2FOKA 2HWD3 1Z7S1 2W3JA 3JAMK 4X6AJ 1F15A 3ABTA 3KYCB 2P7CB 5APAA 4MXWA 5K4LA 4GKYA 3JB8A 2VLAA 1TMF3 4PIZA 1XSXA 2K9QA 4I2OA 1RUG3 3NAPC 2IVJA 2F5DA 4FOWA 3VV1A 5H6QA 3OYGA 3ZMSA 4O9EA 2Y9ZA 1REDA 3EYYA 1OLME 3JZVA 1SLTA 2RDSA 1JTYA 3MVPA 1OOPB 2LF8A 1Y9MA 2DU1A 3WW3A 2QUFA 2MEV2 4BHPA 1YS7A 1UN1A 1EP0A 2G7HA 3KYDB 2QENA 3LSIA 3HAGA 1RTVA 4XOPA 4HFSA 4QXHA 3IDCB 4W1UA 4IV3C 1T8IA 1JUHA 1WWXA 2EV5A 4CDQB 2XBO2 4R4XA 2XWBB 2LR8A 5F2SA 4BCUA 4JC1A 1XC6A 1XX5A 1RI7A 2XGEA 4ZYDA 3IWFA 4UW5A 2XPUA 1EAH2 3SKJE 1UYYA 1EA3A 1MQTC 3H3UA 3RJPA 2ID4A 1ENSA 1QOOA 4LBOA 3W59A 3C2HA 4DEQA 3M3QA 4LG3A 1KGSA 3DTIA 4KWKA 4O7XA 3GZUC 3WF1A 5L3BA 4L92A 4LE4A 2ZO4A 3H9AA 1SQ4A 2E60A 3N3HA 2WNUC 1V5EA 2R1BA 2DDBA 3UKGA 5JWPA 2JZYA 2ADUA 1RUJ1 5C4WC 4NC6A 4FO9A 1ENHA 4YWAA 1IRZA 3ZFEC 1Y39A 5FRMA 2MEV1 2ZEXA 4P9LA 4M9SA 2ORXA 3GM8A 5E8AA 4CDQA 2DFCA 2VPVA 1NG0A 3CP8A 5DCMB 5LK7B 3EDPA 3K48A 3M4FA 1MEC2 1H8AC 3OMYA 5CVJA 4XBFA 3WF0A 2JD4A 3DGTA 2ZEYA 1T38A 4EATA 3OYWA 1QZEA 3H3ZA 2IXKA 1K83J 4I98B 2IBDA 4B3AA 4JTNA 3R0JA 1SMVA 1K5MC 1ULOA 5LBCA 1OLTA 4BGDA 5LEJA 5HLIA 4L99A 2WWJA 1WJDA 3ETPA 1A3KA 1X7NA 1H2MA 3LFKA 5CU1A 1CZSA 3ZXSA 4FTEA 2C24A 2EXIA 3HQRA 2EIMH 1S72I 1G3TA 2W92A 1N3OA 3MIHA 1GXPA 4AFBA 5EGOA 4LPLA 5B4XA 3HOTA 4OMZA 3ZN4A 1J75A 3DEUA 3LAGA 4P9YA 4XOGA 1LNSA 1JZ7A 3ZMZA 3MIDA 3KP6A 2ZGRA 4NNJA 3A0BC 2VCAA 2JIGA 2PQ8A 3T4VA 3GLXA 3OEAA 4J19A 3WE3A 3EPZA 1C1LA 2GWRA 3B00A 4NMIA 4CP9A 1WJBA 1FIAA 2L7ZA 4J01A 4YG2F 4QKBA 1JU3A 2IS6A 2HBUA 5FLHA 2E63A 1DIWA 3B3QE 3NV4A 1WCKA 5DZFA 1ZR2A 1OLQA 3OYFA 1MS1A 4C3HJ 3PTYA 3HUGB 5A7QA 4UVBA 3C7FA 3PVOA 1SEFA 1B8IA 5TRDA 2NS0A 1WI9A 1FPN2 2QQ8A 4N43A 1GWKA 4S04A 2F48A 2ILMA 1BJAA 1UY2A 5I0SA 3KGLA 5JZGA 3OOUA 2WSVA 3ZXAC 1GZWB 1TG7A 3CBNA 2R7QA 4OQ9A 2DA5A 4UFJA 1SDDB 1COV2 5HXMA 4IEWA 3RZJA 3IRRA 4NHLA 3VB9A 3SQOA 2ZHNA 3VYUB 3HT1A 4HK8A 2V1UA 2QQLA 3FBNB 3ECOA 4H55A 2ME0A 1DQ2A 1X50A 2GIZA 3JR9A 4ABZA 2BVBA 2CRGA 3NRVA 2X6XA 3ES1A 2BHYA 1CAWA 1L7RA 1KFUL 3WSOA 5FPZA 1R093 3S1QJ 3IAQA 4LKFA 2VQHA 1K6OA 5J4YA 2J1TA 4KQ7A 2BEOA 4BE2A 2DVBA 3CJTB 3MUY1 1VMHA 5GZGA 2DVGA 1DBNA 4E27A 3I71A 3CUQB 5GLTA 1TT5B 4OHVA 1OLMA 1VBE3 4FFIA 4QB1A 3MIFA 3N7JA 2CTVA 3PJYA 2YC2A 3C7GA 3AP6A 3MKZA 4CSWA 2VULA 4CZSA 5T3NA 3ECQA 4B47A 1UHSA 1VF9A 4YRVA 5DCFA 3WQ0A 1DLLA 2W39A 3ZKUA 4JCKA 2AUYA 4MHUA 5ICCA 1S0CA 3MD2A 2JG9A 3ZXKA 1AJOA 1US2A 1W4MA 1NCRB 1MSEC 4F92B 2KFDA 4NDLA 5K5QA 1SBDA 1IQAA 4ZTJA 2V9KA 1WHUA 2R5ZA 1IOAA 1LODA 4D7TA 1Q1VA 1NK2P 2FF4A 5F6KA 3K4MA 4ET7A 1T08B 1OA2A 2QKLB 2KL4A 2FBHA 1IUFA 2XAQA 5DV5A 4JGYA 4IE4A 3ECHA 4IHYA 1W7PD 1TZOA 4E2GA 2LY2A 4XMIA 4FASD 1S0JA 3BIWE 1IZ1A 2H94A 3RQIA 2W08A 4EN9B 2E26A 5JXJA 5FFXA 2LVSA 1F8VA 2PYTA 2V5YA 4C2MJ 5D1IA 2V1DA 3K4CA 3F22A 5ILUA 4MFDA 2PLYA 5I0TA 2EPFA 4OOIA 4EM2A 3CQOA 2JG9C 2CQKA 4MQVA 3CQZJ 2MH9A 1QXRA 2HPMA 4KGQA 4U87A 4WXDA 3E7LA 2OD5A 3QLQA 4LLFA 1W3XA 5FCCA 1OKRA 2VCMA 2PJPA 5AVPA 1JS9A 3PM1A 1PGL1 4QAWA 4KIBA 1FPN1 3QACA 2TEPA 3ZDSA 1YO8A 1Y1VJ 2XB5A 1EPZA 2WA3A 1O7FA 2EAKA 2XR4A 5FPUA 1PVXA 3WUCA 5FY4A 2Y9YA 4HYEA 3RVHA 1F5FA 3VD4A 2ZHLA 3HRUA 1SCRA 2VZTA 1L3LA 1T6GC 3L2QA 1JOPA 4WM8C 4YFZA 3AC0A 4G3YC 4AI3A 2EFWA 3DPRA 3GUDA 2VE9A 1JT6A 3MBWA 3GTPJ 1HDPA 4M6XA 1M06G 2VECA 2WZR2 4LO5B 4J6GA 4A0XA 1GP4A 1KU3A 3I3EA 1RUD2 2ZZJA 3KV9A 4CZCA 1RHI2 3UL2A 5F64A 5EJ3A 5FWEA 5JAXA 4CXFA 4QGLA 4Q26A 1W6QA 2XXZA 5DDJ3 1K6YA 3VDDB 1YE9A 3OBTA 1CWPA 4B48A 2GALA 4ESFA 1O3TA 2JK3A 1E57A 1JI6A 1IGOA 2R1DA 1XYPA 3IMMA 2WO3A 4P55A 2DTWA 4U0WA 3J80K 2CV6A 1VBA2 2BGOA 2B7YA 2HVQA 5CLSA 1SFKA 5C4XJ 4XF3A 5I93A 3PJQA 1C8M3 3WG7H 1ORKA 1BLZA 2DAOA 3CUQA 3UGHA 1O3QA 1NAEA 1W0PA 3I59B 2PHLA 4YW2A 1EH7A 3H9JA 2JMWA 2AGSA 5L9VA 3QPHA 1XNAA 3THDA 2IGOA 2VJ5A 1YFXA 4C90A 1VQ5I 1D0GA 1I6XA 4MGZE 2XBO3 1JZ6A 4I3GA 1F1ZA 3TEDA 2CV1A 3T2QA 1H1MA 1JZ4A 1OQEA 2JG9B 4DFSA 2O6GE 2ZZQA 5ABJB 1WCSA 1QF3A 4XUNA 5AFBA 3THTA 3HZJA 1QGPA 5E1ZB 4DXSA 2UUZA 1YWKA 3AMPA 3OL4A 4LEJA 5KXCA 2Y31A 1RUG1 1Z7LA 3MKWB 4KMQA 5LW9A 2ZFWA 1DQUA 3P5BA 4DS0A 4AW7A 1R081 4AZZA 1E5IA 5T5OA 4S05A 1C0WA 4EGYA 3LQQA 4HLYA 3RIRA 4Q27A 1WLDA 2GH8A 2W84A 1K42A 3VHNA 5DAWA 3Q0VA 4A12A 1RJ7A 4GWNA 2E33A 4GH4B 2WYSA 3ETQA 3R60A 1CR7A 1TZLA 1IC8A 3VHOA 2Q8EA 5JFRA 3MWMA 3N9LA 2NQYA 4RGKA 4AYBA 2VNOA 1R1VA 3FLTA 4P9UA 1NZIA 2XOMA 2DODA 2V6CA 4L0ZB 4QHZA 2ETHA 4AUXA 4CRQA 5K7ZA 4UFIA 5BNOB 3WTSC 4EGZA 1P8JA 2E71A 1D2SA 1ULCA 4G12A 3BALA 4Q2FA 4C30A 1S7EA 4BE3A 2GNTA 1UW8A 2VC0A 3E1F1 2QLZA 4ASNA 4GWJA 5JDBA 4MO3M 2ES3A 4ZONA 1UG0A 1DU0A 4LQRA 2QDRA 1G9CA 2XJTA 3CMEI 3HKZN 5IT9K 2VMFA 5IAXA 1GKBA 5M0TA 1XQNA 4YVSC 1OOPC 3LEMA 3PVBB 4CO8A 2QBYB 4JRAA 3ML6A 1Q8OA 3VFZA 4NVPA 1W5CC 4RGGA 2ZCWA 3PTRB 2ZNZA 2WAAA 3GHNA 3ACHA 3HGYA 2LM3A 1UU5A 1AYM3 2FCTA 4A3LJ 1UHMA 2WS91 2A71A 2IW5A 4DOUA 4A6DA 3ABUA 3B9IA 3MCZA 3AYDA 3ZMNA 4NAOA 1MJ9A 1FPN3 5LASA 5BNQA 4XRFA 5KAIC 5EJCA 1MVQA 4QHOA 1FP1D 2GBYA 5A6QA 4G94A 2HYFA 3Q3SA 2XAHA 3AM2A 1OQ1A 4NRQA 4HSLA 4YLZA 2LKPA 2BGPA 1F4AA 2VQTA 2X5IA 4YVWC 2HEOA 2B42B 2E5ZA 2BY2A 1WGXA 2DVFA 4LMFA 1DZRA 1U5TC 2HLEA 4OWRB 3QYEA 4D7SA 2HWVA 4E2QA 3AVRA 3FXMA 3WU0A 5C8CC 4TN7A 3H5AA 4C3IJ 1PYVA 4D69A 2OUMA 4AVZA 1Y56A 5J98B 3JD71 5DMYA 2VCCA 4CE8A 1VBE2 1QIQA 4AHYA 4HDUA 1PDNC 5CZKA 5G04L 2JG8B 2LUWA 3PIGA 4XN0A 1NCQB 2V9VA 2HEYF 5HCFA 6PAXA 1YC61 3U07A 3VBSB 9ANTA 2M45A 1MSFC 3WHBA 2ORZA 2GA1A 1JTXA 2VG9A 1G9DA 1FIPA 2XAGA 3H50A 3JRAA 4KA4A 2E31A 3SFIA 1ETYA 2E32A 2KISA 1GZ9A 2MG4A 1AWCA 2WBMA 3HN3A 2DA3A 4CDWC 2W7NA 4FXKB 4M9XA 1W8TA 2H0BA 4HONA 3ON7A 5GLZA 3UGGA 1UZVA 2BYVE 4F55A 1W6OA 4OI2A 4MGSA 5J1YA 3MV01 3OYWB 2L9SA 4KN4X 1QOSA 1DQ4A 5JXHA 1XMKA 2JA2A 2LBFA 2F5VA 5F6FA 1KGYA 1HLVA 1QU3A 3KIOA 1JZ8A 2X1CA 1DP0A 3WODF 2E7QA 3P6BA 1SPPB 3ILNA 2WNUB 1W8WA 3O2PE 1MZEA 1RKTA 4IEXA 3IN9A 5ABJC 5M5XJ 4Q4W2 5FZEA 5FMDA 2DK5A 1LENA 1MQTB 3JD72 4ZU5A 2D97A 1DGRA 1SVMA 3K4KA 5JLWA 3LDBA 2A5ZA 2YU1A 3MKYB 3ZLIA 3GFMA 2RQPA 2Q5TA 4UF0B 2B4KA 3HHHA 2Z3YA 2RJKA 1OBNA 1YYNA 3HHGA 1T2KA 3OR1C 5E89A 2WDBA 2EA2A 3QH6A 4BISA 1DCSA 2C6SA 3DU6A 3POSA 3AP4A 2E19A 2WNOA 5AC93 2Y0SA 4KWLA 2A6HF 2K02A 2MBFA 5BY5A 4R8HA 3I0TA 2E1MB 5FWJA 4V2GA 1JUMA 5FXZA 3L2RA 3O1TA 4EJWA 4E8CA 2ARXA 1VQ8I 1OPCA 1MDMB 1CZVA 1SG3A 4RR3A 2WLPA 2WFF2 3IHUA 3PVEA 5FR3A 4HMZA 4LHKA 2FDHA 2WV0A 3DEEA 1ZBE3 2JICA 2JENA 1T2XA 2KXLA 1VZ0A 2CWSA 5F0FA 3VBHB 5BNOC 3VBRC 2WZR3 4IE5A 1XGMA 2AO9A 2ZXIA 5A7PA 4IRHA 3IIIA 1OQDA 3MHZA 4AI8A 3VYTB 2FD8A 1POQA 4CXXA 4CPBA 5IK8A 3VZOA 1P2FA 2HYGD 3AZYA 2W1WA 2G19A 2JT1A 2X5IC 4XN3A 4KUMA 3OUIA 3NL1A 4PJ0C 2XIGA 4NHKA 2IPQX 4DXTA 4HXCA 3ACFA 2ADDA 4XYXA 3V64A 1F5JA 5FZOB 4D0QA 1XPXA 3VL9A 3CL1A 5AVAA 2D2WA 1V6NA 5F39A 1MDMA 3KHCA 4UW6A 1IS4A 2RV8A 2KLOA 1XBFA 4YVSB 5EEGA 2JQ7A 4Q8KA 5JOXA 2VJJA 3CJIC 3Q8BA 3HM5A 2BPA2 1VBA3 2H0VA 1PUFB 4QX1A 3HNMA 2CL2A 1AU7A 1UFMA 1O4TA 4C2TA 1R00A 5EG0A 3DYMA 2QCOA 5LA0A 2MNGA 5C4JJ 3DV8A 3WGHA 4FE4A 3A03A 2WZEA 4C8DA 5LBBA 1BI2A 1UQXA 2JA6J 4LBQB 3S14J 3WU1B 4FPEA 4LHLA 2ZHMA 1T0FA 4LITA 2STWA 4UXAA 1YCIA 2ZXQA 4IUGA 1LU1A 4QQPA 3S32A 3V65A 2X51A 5E3MA 2O8OA 1FNNA 1CGPA 2W87A 3K3OA 2GA2A 3ILRA 2WTEA 2OS2A 2R5YA 4M74A 2FZ2A 4IL6C 3RYPA 4LK7A 2J1RA 4W8JA 5HV4A 3OIOA 3SHRA 1S4CA 3UJQA 1YHQI 2VW2A 2X6YA 3AFHA 4LMYA 4IO9F 1DP7P 2HWE2 2IEKA 1PUEE 1Z05A 1TMF2 2B9SA 3C1DA 1HKQA 1LFBA 1V5FA 1ZG3A 1EV11 4A3MJ 4Q4V2 3I5UA 4NC8A 4OHWA 4WXHA 1RUG2 3OSGA 3DXJF 2J5PA 3WOGA 2RVAA 2HYKA 2DUPA 1ZELA 4LIUA 1QDOA 2XV4S 4YW5A 2VT3A 3DKXA 1PZ8A 4PFOA 4RN5A 3BLYA 1UX6A 4KG0A 1AKHB 3AMHA 2HOTA 3IM0A 1WMEA 1KU9A 2MW8A 3ZM8A 5JMOA 5JR7B 1KFXL 1MNMC 1OA4A 2JDYA 1WRJA 2OPWA 4PJNA 2E36A 2XGDA 4HPQA 1F4HA 3I2KA 4QPOA 4R9AA 3FUQA 1VBB1 4BL0B 4XTMA 5GM0A 1O8SA 4IQJA 2ZS6B 3A01B 2ZJRF 3AKTA 3F72A 2E7XA 2ZMLA 2A7AA 2ZBJA 2AQFA 1X4PA 2RDPA 2LS6A 5CKTA 4LJHA 2MFZA 3S7IA 5LZ6A 4XQFA 5J3LA 2IJLA 2RNJA 4QXBA 4XDQA 5FKOA 4AVCA 4CTEA 3DPLC 3POIA 4IGOA 4M4RA 3C18A 1H9WA 3ZPOA 4HQMA 1NE6A 4A5MA 2A6VA 2K85A 2K9LA 4EROA 2IT0A 4MGYE 2PJRA 1V54H 5A3PA 3LOCA 2R7TA 3Q0WA 2WAQA 4FSJA 2FQPA 4B43A 3L00A 3JRFA 2TCTA 1I5PA 1MBHA 3GBFA 4CEYA 1IN6A 4KMUX 3HR9A 3C3VA 3WGGA 5FLIA 3HPGA 3E97A 2EZHA 3S57A 2M8GX 1Z7S3 3L09A 1MBJA 3WDVA 3V8JA 3HOYJ 1EUTA 4JX0A 2D93A 4WF2A 2HZTA 1AYN1 3J7MA 1K45A 4IGQA 4D94A 3V4GA 3ZFGB 2BQPA 4A6OA 1ZREA