3DKWA

Crystal structure of dnr from pseudomonas aeruginosa.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
227
Chain Sequence
MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLECFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A dramatic conformational rearrangement is necessary for the activation of DNR from Pseudomonas aeruginosa. Crystal structure of wild-type DNR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
molecule keywords DNR protein
total genus 46
structure length 227
sequence length 227
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dkwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dkwA01
2HS5A 3QP6A 4ENNA 4WK8F 4N0BA 3NJZA 2FA5A 3IL2A 2OZJA 2ZNZA 2Y48A 3TQNA 4MGZE 4XFCA 2P17A 4ZU7A 2IA2A 2LDUA 4BHPA 3ES1A 2PAMA 4HQMA 3KEQA 1SD7A 1J58A 3BALA 2XAJA 3IIAA 2XV4S 5HI0A 4Q5SF 1HSJA 2D2WA 1CF7B 3F8MA 2XROA 3FZVA 4R79A 2EWNA 4M6YA 1IXCA 1PP7U 4OIQF 3RDIA 5FD5A 4HMZA 1PM7A 2V1XA 1Z9CA 3P7NA 2FQPA 4IJAA 3RIRA 1SFEA 1NE6A 1GQHA 3Q9SA 3HUGA 2P6SA 3HSFA 3PFIA 4YARA 5CYVA 3CLPA 3WTTC 1S6LA 4QM8A 1USSA 5ICEA 4HX8A 5FPXA 1F5TA 2E9QA 1RUOA 3LA7A 1XSVA 1YYVA 2HYFA 3KMHA 3KLOA 3NL1A 5I8TA 1CF7A 1SAXA 4KWLA 3BPXA 5CLSA 2DPUA 4OMZA 4UV8A 4Q0SA 3RYPA 3TNQA 1IUYA 2VT2A 4RB0A 4EV0A 2IXKA 2Q0AA 5FLJA 4YFNF 3GWZA 4ON0A 1IPKA 1Q5OA 4Y17A 4HX7A 4MHGA 5K8SA 1Z7UA 4MQ9F 1PDNC 1LNWA 3FWEA 2JZYA 1XCBA 4MGRA 3SZTA 3MEXA 2VN2A 2GC2A 4KWJA 4EQQA 2XAHA 4IRHA 3GBFA 1LDDA 4ESFA 3I59B 3KLNA 2K0GA 2BNOA 3T0YA 4HLTA 2A69F 4HN1A 3RKWA 2L4MA 4JTOA 1G3TA 1IRGA 2IXIA 4MTDA 4KU8A 5A2QK 2PI0A 1WGPA 2OA2A 3DXJF 2DFIA 4WZCA 4MGYE 2VPVA 1WRJA 2XLAA 3WU0A 4Z2YA 1YFXA 4IERA 4U88A 4A5MA 4G8XA 5KHHA 4EWEA 3F21A 2IP2A 1I5ZA 2FNPA 1Z91A 3O6BB 4IETA 2EV6A 5T3NA 4Y13A 3PNAA 3LA3A 4LLLA 3EBRA 4MTEA 5JHUA 3CTAA 4WXCA 3S7IA 4ENMA 2XL9A 1ZN2A 3HYIA 3I54A 4XFIA 1U2WA 3EHKA 4WX9A 2FBKA 4P55A 4UVBA 1VR3A 3FE5A 2O0YA 4B29A 2XGXA 5JAXA 2QLZA 1LRHA 1TW2A 3E5XA 3KP3A 5IT9Z 3J80K 3WGGA 5K5RA 4H0EA 1UD1A 2BNNA 1VTNC 3IRQA 3EDPA 2FMYA 2RKHA 1ZREA 1JHHA 2BYVE 3GFMA 3N97A 4YIIA 5LRRA 3OV8A 2O61A 2XKOA 5J6XA 1P6RA 1KU2A 3LAJA 3U9GA 4UXNA 4XF0A 2GC1A 2FBHA 4I09A 2Q2EA 4AVAA 2YX7A 4O9EA 4MQVA 2EA7A 1OYWA 2HZTA 2CFXA 2QWWA 3WU1B 2PEXA 3O2PE 3HHHA 4RGUA 3I59A 5E1WA 2K86A 1MJAA 1R1VA 3HOTA 1XRUA 1XGNA 1T38A 3ISPA 4WF2A 4LMYA 1J75A 3E5QA 1R1TA 2VBXA 2EFQA 3BY6A 1KQ0A 3M8EA 3T5XA 4HOBA 2RV8A 4LG0A 2PYTA 3GZ6A 4AVPA 4WXHA 2IC1A 2NRAC 4KN4X 3FM5A 5D5XB 4XLPF 2A5YB 3IKVA 4EMSA 2HGCA 1U3EM 3OTFA 1XCVA 3LWFA 4G9YA 1Q43A 1TBXA 4KT5C 1R22A 1GXQA 2XVCA 1IW7F 2ISZA 1YG2A 3MAJA 4UUVA 3S0MA 5TJJA 3HTSB 2PHLA 4QM9A 1X8EA 3HSRA 1CAVA 5BPXA 3ZMSA 4TLFA 3HRTA 3K1NA 5E16A 3H3ZA 3EJKA 3EYIA 4QXKA 3M70A 4FHTA 3H7YA 4A2UA 3E6DA 5K5OA 3C1DA 3L9FA 4UXAA 3CLOA 4RAZA 1WA4A 1Y3TA 4LLGF 2FXAA 3FMSA 2FMLA 2VE9A 3RTRA 1ZVFA 3WTXC 2G7HA 4G7ZF 5FLXZ 2OU2A 3NSTA 4ONUA 3JAMZ 1R00A 5FFZA 2KKOA 2QM3A 1E17A 5DCMA 4LEJA 3V7SA 2J5PA 3WTUC 2MPFA 2ZKZA 2DLLA 3KP7A 3SZPA 2O1QA 3NQOA 4L5JA 3MZYA 2RC4A 5J48A 3FHZA 3RNSA 5HOOA 2YPRA 2XLGA 2GIVA 2RNJA 2D40A 3S7EA 2RQPA 1WI9A 2H27A 3WG9A 4RD7A 1UHMA 1WWXA 4IXAA 4A6DA 4HVRA 4PZJA 3RKXA 1FSHA 4OINF 2C6YA 4A5NA 2HEOA 3CO2A 1HBXG 1RI7A 3FHIB 2YX4A 3V8KA 3IC7A 4E2QA 1KYZA 5ILUA 4HSLA 1XSXA 4QX5A 3ZMTA 2FE3A 4ZYHA 5CJ9A 4YSFA 4AQ2A 1CAWB 3WGIA 5JSOA 3COAC 3W6JB 3RZZA 5HS9A 2XKPA 1SMYF 3DPTA 4EROA 3UKTA 3SFZA 3LAPA 2GAUA 2B5HA 1U8RA 2MLGA 3V8JA 1R1UA 3CUQC 4XFAA 3JW4A 3WE2A 1DGWA 3GLXA 4OMYA 1FYLA 4D7SA 3RPQA 4AIJA 2NS0A 3J7AO 2QENA 1USTA 5LBQA 5JI6A 2V6CA 2BBYA 4L9TA 1J3RA 4HF1A 1ZRFA 4EGYA 5I0RA 4NB5A 4OU0A 3WW2A 2VT3A 5HLIA 3WTSC 3F8FA 1XD7A 3ZMZA 2K7LA 4IESA 4CXFA 4G6QA 1WKMA 2QQAA 5LHGA 3R4KA 2DK8A 5BV6A 1FZPB 2W57A 4X6QB 4J1WA 2ZBKA 5L3DA 1B59A 3VHRA 3HIFA 3MQ0A 3NKTA 4KUMA 3E97A 1NXMA 1LB2A 3MDPA 1TQPA 3K2ZA 5H6RA 3F8CA 1ZG3A 3FMRA 4HZFA 1ZG5A 2CAUA 1Q3EA 4HQEA 1ON1A 5E1ZB 3PVBB 4OLLA 4KIBA 1ON2A 3OCPA 2E1NA 2B0LA 1FP2A 3WTVC 2CWEA 4XETA 1BC8C 1CAWA 1DZTA 1BOAA 2V79A 1E2XA 1H9GA 1XSDA 1G6NA 3C3WA 1ZZ6A 3BU7A 3PQJA 1IN5A 1BJAA 3U11A 1J3PA 2LSOA 1FYKA 4F8AA 3KEOA 2M45A 3FXRA 1IN7A 1EP0A 2VXZA 1TNTA 2OAZA 4ETSA 2UZKA 2EJRA 2H6BA 2QBYA 1JUHA 3G3ZA 5LEJA 3GW2A 1YO5C 4RS8A 1BI2A 2JT1A 3LFKA 5DCFA 2ZO4A 4ESBA 2EVXA 3B73A 2MH9A 1HQCA 3IWZA 1X8MA 1JGSA 4BNCA 3I53A 1H1IA 3KGLA 3QRFF 1U5TC 3TOAA 2WV0A 1XE7A 2FOKA 3WE3A 4LA2A 2IT0A 2OZUA 1S7AA 1SD5A 4PGHA 1IXRC 2KXLA 4U0YA 2Y75A 5LGTA 2DQLA 3P9CA 3IKTA 3HSEA 1JHFA 3F72A 5EFUA 2EFWA 4OIRF 1AWCA 1TNSA 5DV5A 1QZZA 2DI3A 2BV6A 3DEUA 3V8LA 3HQXA 3LAGA 5KVRA 4KWKA 4DINB 2GXBA 2WFPA 2ZMEB 2G9WA 1SFUA 2A68F 1XGMA 1MZBA 1IXSB 1OKRA 3NVCA 3DV8A 4XFHA 2EV0A 1FI2A 3KP4A 1RGSA 5DD8A 1FWZA 5FGMA 1W5SA 1ZZ8A 2H6CA 1YTYA 1FYMA 4NQWA 3WW1A 2F5DA 5CADA 4YFKF 3REOA 1XN7A 1LKNA 2IVMA 1X82A 3DL3A 5EZWA 1D8JA 2HR3A 2ATFA 3O14A 3GZ5A 3BJOA 1B9MA 3T8TA 4DQ2A 3OGJA 1HXDA 3I0TA 2PLYA 4HAMA 4QGLA 1GXPA 4R52A 4HV5A 3E6MA 2GH2A 4L5IA 4PDKA 3JSPA 3C7JA 1KQ9A 2Z5UA 4HX4A 4YIFA 2P5VA 1P4AA 2GWRA 1KU3A 2YR2A 3FX3A 1SEFA 1NE4A 4HVQA 3DP7A 1J3QA 2BEOA 1G3YA 4ZZDA 2TDXA 4PIXA 4XFBA 1JE8A 1ZYRF 3ECHA 3I5UA 4Q0UA 1BI1A 2Q1ZB 3UKVA 3KSCA 2PG4A 2Q30A 1DUXC 1HSTA 4XFGA 3F22A 4ESJA 1UHWA 4BYYA 3FXUA 3ABUA 3ACLA 5L3FA 1S7OA 4HLXA 4XSZF 2QCSB 3USSA 2K9ZA 3ULQB 3D0SA 3CJXA 2ACJA 4L9VA 2W25A 1UB9A 2OZ6A 4ASNA 1DGRA 5CVRA 4LUKA 1QXRA 5LHIA 1FXZA 1AOYA 4KA4A 3FMQA 4IEXA 4Q29A 5DUKA 2MNGA 2FF4A 4EM1A 3ERED 1XDUA 2IXCA 3HT1A 5EEHA 1KQ8A 1K79A 3MWMA 1X3UA 4RGSA 5D1IA 2MA3A 4P9FA 3H1MA 1LEBA 4LGWA 2FEZA 1UPIA 1DDNA 5A2QZ 1I27A 3V4GA 1BI3A 5ILVA 4UBGA 2MC3A 3E3VA 1DZRA 2QQBA 5KHIA 3L7WA 1SD4A 3K0LA 2WWYA 2L4AA 1OI6A 2O8QA 1YW7A 1D8KA 1Y0UA 2LNBA 1XB4A 2FBIA 3BWGA 3H1YA 2GA2A 2YU3A 4MX3A 1ZAOA 5HS7A 3H8UA 1X7NA 1EH8A 1SMTA 2QZ8A 2W84A 1V3FA 3LA2A 4EVIA 5D5UB 4I2OA 5ILSA 2A6HF 2WC2A 3DPLC 2NNNA 2R7FA 2JSCA 5DDGA 2E7XA 3WGHA 2P5KA 3BB6A 4XBFA 1YW9A 1ODDA 5FPZA 2V9VA 3CF6E 1W7PD 3P9IA 1EYBA 3SHFA 5J3UA 4ZYGA 2UWMA 2RVCA 4XFFA 4AD9A 3EO6A 1MGTA 3HOSA 3VOEA 1BBYA 3ZN1A 1FC3A 1Q1HA 1ZGAA 2P7VB 4HF0A 4IF4A 2PA7A 1FY7A 4Y15A 3KP6A 1OR7A 3CO7C 3TGNA 4FX4A 2DAOA 4P9GA 1QQIA 2Z2SB 2GC3A 3M3IA 1TW3A 3GYHX 2ADUA 3T1BA 1O5UA 3BOQA 3GX4X 4M9ZA 4ORFA 4KIGA 1UFMA 1K6OA 4LD5A 2A3SA 5BY5A 2XASA 2GXGA 3MCZA 1O3RA 4U7DA 1XDSA 4R1HA 2LF8A 3I4PA 3L00A 1YFHA 1FP1D 3E6CC 4OIPF 1XMAA 1EV7A 5E8IA 3ELNA 4I7HA 4EWAA 2K4JA 3M7GA 3MYXA 5AONA 3U0ZA 3ZMDA 3IHUA 4CDGA 4D7TA 2HFHA 2KJCA 2XL7A 1PMIA 4L9JA 4KFCA 3F6VA 5ED4A 3KE2A 5J8FA 1RL3A 2BGCA 2JPBA 1I6XA 5D4RA 4LLOA 3GXOA 1ZZ7A 1RIOH 2DK5A 3F6OA 3HT2A 4NVPA 4UVCA 1R5GA 2V1UA 1S29A 1T39A 1IZ1A 2FSWA 3KZYA 1YFYA 2O03A 3FJSA 1FOKA 2XAFA 1BC7C 1EY2A 4GXOA 5L3CA 3H9AA 2DPDA 1UIKA 2GA1A 5H6QA 2ELHA 4IEOA 5AIPA 2MH2A 2CV6A 2O8XA 4IRGA 5JR7B 1UIJA 4UHTA 2EFNA 4O9GA 3KGZA 2KIMA 5AVPA 4XF9A 3H50A 1OMIA 4A0YA 4LJZF 5BPDA 1RNLA 2K02A 1HKSA 3QU3A 2BNMA 3TO7A 4XRFA 4AIKA 4PCQA 1O3TA 5HLGA 3S2WA 3BPVA 1G3WA 5I0SA 4LFUA 2RN7A 3G73A 4LULA 1WSUA 2CW0F 3CUQA 3MPBA 3GYDA 4YFXF 2EA4A 5ICFA 3BCWA 3IDBB 4HDVA 1XMKA 3H3UA 3H1WA 5K5QA 1LDKB 4IRIA 3G7DA 4AVBA 2EFOA 4AVCA 4FT8A 3WW4A 5I93A 1I1GA 4TV7A 3U2RA 2L3DA 4I01A 4HV6A 4Z07A 2PAKA 3NEUA 3VODA 2QNKA 4LK1F 2D45A 4GULA 1FPQA 4WVZA 1B1BA 2H0VA 1B6AA 4MEYF 5D4SA 2HKXA 1FT9A 3L2CA 2I45A 3EQLF 1V4RA 4IHTA 5E18F 1FNNA 1ZZCA 4OOIA 2IXHA 3GUDA 2OD5A 4WWCA 1YS6A 2XIGA 1J7KA 2K27A 2CSOA 1STZA 5ICGA 1ZNPA 5FLXK 5JCTA 4KMFA 4Q48A 4LK0F 4CYDA 2OYZA 2W85A 2M8EA 5DD4A 4HBNA 1J1LA 3CEWA 5F1RA 3HRMA 4MNUA 1YLLA 4UV9A 1O3SA 2HOEA 1IAWA 2HJIA 1WQ2A 2XHKA 3VB2A 2FRHA 4L18B 3KP5A 2ZMEA 1MDMB 1MDMA 2UYBA 5ERIA 2ZXJA 3F3XA 3ABTA 2PJPA 4I02A 1J2XA 6PAXA 3U10A 3WTYC 3QU6A 3KCCA 2ET7A 1H1MA 2CYYA 2EB7A 4HBLA 4PJYA 2OQRA 1ZZ9A 3QP5A 1OPCA 1QPMA 4HLYA 4FX0A 3BZ6A 3GF2A 4J1XA 4RB3C 1TQ5A 3E6BA 2GU9A 2CAVA 2ZJ2A 2IA0A 4IEUA 2QDRA 2GC0A 3OF1A 1B9NA 1XE8A 4D0PA 1UW8A 1LEAA 4MZUA 2HYGD 3J81Z 3TO6A 3E5UA 4E2GA 1A04A 5I8SA 3T8RA 4IVNA 3ZMVA 4Q0VA 1PP8F 4YRDA 4GGGA 5D5VB 5D6FA 1FLIA 2OA4A 4B8XA 4IEQA 4KNYA 4M9SA 5LGUA 3C18A 5L3BA 1RTVA 1TLHB 1Z6TA 4BQAA 2RDPA 2PMHA 2P5LC 3IRRA 3VEPA 5DUIA 2ETEA 3NW4A 1H9TA 2DTRA 3IWFA 1QXJA 3ZPLA 4META 2EFPA 4EWDA 4IEZA 5FDBA 3WODF 3L2HA 4XF1A 1F1ZA 4Q4ZF 1O4TA 3TO9A 2B9UA 2FNAA 1O7FA 1O57A 4P9UA 2A07F 1NZCA 2GZWA 2GQQA 3H7JA 5LEKA 5BS6A 2UXXA 2NYXA 1R5HA 3W6KB 4AWXB 5JSPA 1G3SA 4QMAA 5LHHA 2DW4A 5FD6A 1Y9QA 4CICA 2L54A 3FM3A 1S8NA 2NNYA 1YFUA 1LDJA 5C6CA 3P9KA 3WTZA 1JXSA 2VC0A 3I58A 1YS7A 2ZKLA 2DQRA 1SD6A 2Y0OA 5I0TA 4FAGA 5KHJA 4N9HA 5DCMB 5FCCA 5BMZA 2O6GE 1CAUB 4IPAA 3J81K 2VBZA 3LOIA 2DBBA 1ZX5A 1V70A 3TOBA 5HLHA 3JSOA 4L9NA 1LVAA 4G7OF 3I7DA 4LTAA 3GFIA 1GHCA 3PLQA 1KA8A 3TDUC 4B09A 4BH9A 4L11A 1FBSA 4HF2A 3KP2A 2PFBA 1ZH5A 4XSXF 4AQ6A 2R7DA 4XF4A 2DT5A 4BHCA 4JV4A 4K8FA 4XF3A 4MGKE 2E7WA 3EQEA 4NHJA 4ZU4A 2D1HA 3SCGA 3LSTA 1XGSA 1OYIA 3R61A 4UNOA 2JTVA 2Q4SA 4EM0B 2PQ8A 3F23A 3TDZC 4A0ZA 5IT9K 5KHGA 5KHKA 3BJAA 1QBJA 1U12A 1QWRA 2P8TA 3GO5A 1TQMA 1J0RA 5AIQA 1EH6A 3HRSA 2A6EF 3K1PA 3D0JA 3IDCB 4KMUX 5BUVA 2JPCA 1U6GA 4I0BA 3ECOA 1MJBA 1SQ4A 2UXNA 3I64A 5BQTA 1FSEA 3QOPA 1J9IA 2Z3YA 5HDKA 3ZMUA 2D93A 4JBAA 1Z6RA 1RUNA 1KU9A 2NAZA 4H7LA 1IN8A 3CDHA 4DNCA 5FO5A 2F5FA 5E20A 4CGZA 4XEZA 3F8BA 1D5VA 1IN6A 3BJ6A 2D5HA 1QY4A 2IXJA 3HTUA 2QVSB 2XLFA 4R8HA 2EV5A 1W7PB 1K78B 1G4DA 2X4HA 2ZFWA 3HHGA 4EJVA 1T0FA 1YW8A 4HSJA 3K1MA 2ESHA 3R0JA 3J80Z 5H20A 4RB2C 2MLKA 4MGIE 1OD5A 5I91A 3SCFA 4MH0E 2H94A 4UBHA 3BROA 1CAXA 2MD5A 2HKOA 4EJTA 5DEQA 4LLNA 4M9XA 2P4WA 4IEVA 2RGVA 2P6TA 3EYYA 1T6SA 2OBPA 3LZZA 1T2KA 3ELKA 1MD0A 1EH7A 4JVAA 3MZHA 3IBMA 3KETA 2IRFG 2ESNA 2KIFA 4QGNA 1K7AA 2F5EA 1LJ9A 1P4WA 5KBFA 3N4MA 4GYIA 3ETQA 3B02A 2E1CA 2QBYB 3R60A 2UYAA 3K9TA 3SHRA 2HTSA 3WW3A 1F9NA 2BE5F 5HDNA 4AIHA 4KICA 4ZU5A 2HWVA 3RI4A 4S04A 3JAMK 3FZ3A 5E1XA 3D82A 4GCVA 1R36A 5ICCA 2VECA 5KK1A 2PHDA 1DPUA 5FQ0A 1CAXB 2OQGA 4BHBA 4MV2A 2XUBA 4PIYA 4Q0PA 4YNIA 4PIZA 2D5FA 2CGPA 3JZVA 1IPJA 1P92A 4A12A 3M9AA 4UVAA 2DO7A 2IJLA 5D6EA 1R58A 4KL1A 4IEWA 4KU7A 5E17F 4RB1A 1EPZA 2ISYA 3M1EA 2R3SA 3BP8A 4WXDA 5K1YA 1FBQA 2PTMA 3R0AA 2VBWA 4ZH4F 5J8CA 3DFGA 4PGGA 1DPRA 4E2SA 1L3LA 5FLIA 4Z82A 4QLCU 2PFWA 3WTWC 3GFLA 2K4BA 4G7HF 3R6SA 2Z99A 2DU9A 3Q9VA 1IRFA 3HRUA 1O5LA 4N9IA 2Z9OA 4WCGA 1CGPA 1ZLJA 3DF8A 1REPC 3ROUA 1R23A 2ZCWA 3KFWX 4P96A 3EUHA 3L09A 4O3MA 3DKWA 2VODA 3UKNA 5CVJA 3AAFA 5LLQA 4O6JA 3RPUA 1F4KA 5D5WB 5JSRA 2KIUA 4KYWA 2VOOA 3SMHA 5DYMA 1B4AA 5J7MA 2CQKA 3CUQB 3FFQA 3JTGA 2VBYA 1ZHFA 2B8MA 2M1BA 2ETHA 1WLTA 4EJOA 1ONVA 2Y0MA 3K69A 2STWA 3MFKA 4G94A 2EA2A 3FXQA 3GFJA 2IA1A 2JRTA 3DN7A 1LQ1A 3O3KA 5F6FA 1KYWA 1KGSA 2KRFA 2M87A 1D3YA 1BN5A 1MJ9A 4XLNF 4CZZA 3DQVC 4RAYA 4RGXA 4IEYA 2KJBA 2IXLA 1QZYA 1IN4A 4F7ZA 4GO1A 3RYRA 1NYWA 1U78A 1OYYA 2P7CB 4HVOA 4U0VA 3V7CA 1ZGJA 2YSRA 5D8KB 2CO5A 5BOXA 1BIBA 3BPZA 4LG0B 1J59A 4KN7X 4HYEA 3CL1A 4L0YB 4K2EA 4IEPA 1CX4A 3JTHA 2FQ3A 4YYOA 1VP6A 2MHFA 4M73A 1QGPA 4RGRA 1SFXA 3ML6A 2OPKA 3ES4A 4S05A 2LKPA 3PQKA 2VOPA 1ZRRA 4ZZLA 5HDGA 4IHSA 2HQNA 1L0OC 2V1DA 2VONA 5E8GA 3OD0A 4CHUA 2PN6A 1YHFA 1ULYA 1QNTA 2QQ9A 4M71A 4I3PA 1SFNA 4KDPA 1VJ2A 3GEZA 1O7LA 1ZLKA 2W24A 2QVOA 1L3JA 4LUMA 4L0ZB 1BI0A 5EEGA 1PUEE 2H09A 2CG4A 1BM9A 5CVVA 3LQQA 5JVTA 1YUDA 4E70A 2VC1A 1W5TA 1XGOA 3I71A 3V7RA 1ZG1A 4MEXF 2HTJA 2QJVA 3BDDA 3FF5A 2QYOA 2PQQA 3ZN0A 1TQIA 1R7JA 5CVIA 4P5OA 2Q8KA 2UY9A 4L2NA 3M8FA 1S3JA 1W4MA 4M6XA 4YG2F 5L3EA 2EAAA 3ZDSA 5I0UA 4U7BA 4BIFA 4ENKA 2M5WA 2AS5F 1QO0D 4Q47A 3TKYA 3LQRA 2PAEA 2COMA 3SCHA 3U1DA 4Q0QA 2N7GA 2ZNYA 1U5TB 3SXWA 1J5YA 2HDCA 1DP7P 1ZZBA 4ZYDA 1TTYA 5C8WA 1I1SA 3QAHA 4FBFA 2L02A 1Z1DA 2LF7A 2A61A 1HKQA 5BPIA 2VE8A 3RKYA 2DCTA 4EJUA 4EJWA 4LB5A 2F4PA 5CVUA 5E1RA 2M30A 5HS8A 2V09A 2XRNA 4I98B 4JTNA 5I8YA 2C0ZA 1CAVB 5BXXA 1LR5A 2Q0OA 2D1VA 4G6DA 1YIOA 1IF1A 4BXUA 2XAGA 2IPQX 1H0MA 4A0XA 1T98A 5IT3A 2O3FA 3F8NA 3C3VA 3ZQ7A 5JFRA 3H92A 1FBUA 1HW1A 5L3GA 3QACA 4O5VA 4OIOF 4HN0A 1FX7A 2J5OA 4M72A 3CO6C 3SQNA 1ZRDA 3EETA 3KZZA 2Z69A 3LWCA 2L01A 1CAUA 4QGMA 4U0WA 1NHAA 2STTA 1YWKA 2FU4A 4LB6B 5FLHA 5LGNA 3Q5FA 1UCRA 2VQAA 4MUVA 4CO8A 3QPHA 2MBFA 3ZP5A 2UY8A 3QPTA 2HQRA 3CUOA 3RJPA 4FAHA 2XAQA 5FFXA 5HVQC 4JK1X 1U5TA 1W7PA 1K78A 2F2EA 1RC6A 1BIAA 5TRDA 4WBBA 1P2FA 3TNPB 4HA8A 4GYGA 2AXLA 4JQFA 2EK5A 1MKMA 1ZARA 5FB2A 2PBIA 4HW0A 1KU7A 3D5LA 4ZYEA 1RZ4A 3ST7A 4A6EA 4EM2A 1HW5A 1P4XA 1OFNA 3GVAA 3VFZA 4AXOA 4X6RB 3SXYA 4HDUA 5D8LB 1GVJA 5F64A 1C0WA 2QUFA 1GQGA 1YLFA 1HW2A 5CU1A 4I0AA 5LRSA 1UCXA 4LA3A 3NRVA 1YQAA 4ENJA 1O3QA 1ZRCA 3RYKA 2ET1A 2Z33A 2F5CA 5FQ0B 2IW5A 2X0LA 5JR3A 4KIFA 1Z05A 4QWQA 4BAYA 1YFWA 2G7UA 1HKTA 2WTEA 3OOPA 4OFGA 4EGZA 4M74A 2PMUA 3CJNA
chains in the Genus database with same CATH superfamily
2HS5A 3ACHA 1ULCA 4QXCA 2LKXA 1YE9A 2WY8Q 2A6YA 2EIKH 5E3MA 4N0BA 4QXHA 3IL2A 2OZJA 2VL8A 3THPA 3LEMA 4NOTA 2CV2A 1E57A 2PAMA 3WD5A 3KEQA 1S0FA 1TL8A 1PGW1 2W87A 1YJ9I 5FZ3A 1FPN3 3B9CA 5AVAA 5HBAA 5HI0A 3MKZA 2WR9A 4N4OB 4AVSA 4Q5SF 2IS4A 4CUCA 1CF7B 1PMJX 2XROA 4LHKA 4R79A 2Y0IA 2EWNA 3ENRA 1JGGA 4M6YA 3M3YJ 2FDFA 4HMZA 4BBRJ 1W0PA 4OMDA 2FDJA 2V1XA 2FQPA 3CCMI 4IJAA 2VCCA 3RIRA 4E4DX 1GQHA 3Q9SA 3HUGA 1XG1A 2P6SA 2VZRA 3WTTC 1JU4A 5FY1A 3DEWA 2LS6A 1QHDA 4R9DA 3ZYRA 2OX0A 3NAPC 3HOVJ 4D6SA 1F5TA 2E9QA 2OQ6A 5T5OA 1ND2A 5IYDJ 1UOBA 3KMHA 2JDKA 3V65A 2DPUA 1ULEA 5FREA 1NXD1 4UV8A 3RYPA 1K5MA 3HOUJ 1ENXA 3TBDA 2ADEA 4YFNF 3DKXA 5GP9A 4MHGA 2Y33A 5K8SA 1RESA 4MQ9F 1VBB1 4PJMA 2WL1A 2JZYA 1X1AA 3GMEA 4Q2FA 3IP4B 4XQDA 5GJ6A 4XJUA 5IAVA 2GC2A 4KWJA 5E6HA 4CCOA 4IRHA 4N7UA 3H9JA 3I59B 3KLNA 4HLTA 1BW5A 1N1SA 2BNOA 4Y1VA 4CDQA 4NWVA 4R9AA 3RKWA 3CCSI 2PI0A 2SLIA 3ZYFA 2OA2A 3POSA 4KBZA 1RUH3 3A21A 4COVA 4JYKA 3TEZA 3BIWE 3NQHA 1SACA 2VPVA 3I9V2 4D8MA 2XLAA 3WU0A 1VAMA 4IERA 4A5MA 4G8XA 2R16A 3A23A 1I5ZA 3R0RA 5H9PA 3O6BB 1HLCA 3KF5A 3VYTB 5G05L 2J1TA 3LA3A 3KQ4B 1K42A 2YY1A 3CTAA 4ENMA 2XL9A 3B69A 4XFIA 4QPIB 3H1CA 5J40A 2WNOA 1AR72 2R0FA 2DU1A 4CE8A 3OYLA 4QQLA 3NRUA 4N90A 4Y5SA 3O0VA 1YIJI 3FLRA 4LO6B 1LOEA 1DQ0A 3KP3A 4OI1A 5GADJ 3WGGA 5K5RA 4P9XA 4H0EA 1UD1A 3ZQFA 3IRQA 2B39A 3VHPA 3MPPG 3BIEA 2FMYA 1OUXA 2RKHA 1ZREA 2ARCA 1GOFA 3VBUC 1JHHA 1AL0G 1R4NB 2P0WA 1SBEA 3LDBA 3MMYB 1MVEA 3U9GA 1ENRA 2K46A 2WINB 2NVUB 3O1SA 2ENRA 2DA3A 2CFXA 2JG8C 2PMZA 3WU1B 4P5YA 1C8NA 3DXTA 1CD3G 3VYUB 4AL9A 5E1WA 2DFEA 1ZA7A 3LB9A 3OBZA 2VBXA 3S15J 1XNCA 1KQ0A 3POGA 3T5XA 2DVAA 1PK6C 4AI9A 4TYSA 3GZ6A 4WXHA 3V42A 3PHMA 4RS5B 1PGW2 5IPAA 5HCAA 4FTBA 3HOWJ 3AB0A 1R22A 2UWBA 5FBJA 4IL6C 3O8GA 2XGCA 1UG0A 1L7QA 2WN3A 2ZGTA 3HTSB 2PHLA 1X8EA 1VMJA 1NLSA 5BPXA 1LHNA 1UN1A 3VPRA 3ZMSA 4TLFA 3TP3A 3H3ZA 3RSJA 1COV3 4QXKA 1S0DA 5IVVA 3MEPA 2IFRA 3DLLF 2Y2ZA 1SFOJ 4Q4W2 1COV2 5JPMB 5JZGB 4RAZA 1FX5A 1IS3A 2FMLA 2XJUA 2GBYA 1QA6A 1N3PA 3TWIA 4CU7A 4IUGA 2E7AA 1RMU1 1NKGA 5F2WA 3LSIA 2Q8EA 3JAMZ 3AX4A 4LKDA 2EZHA 3ZXDA 2DLLA 4RS5A 1YJNI 5EGOA 3B6AA 3POWA 2CSGA 1H8TB 3MZYA 5J48A 3RNSA 5HOOA 1QDOA 3BVCA 2E63A 4LHSA 3S7EA 1A36A 1TMF1 3WG9A 2QUOA 3I97A 4A6DA 2WAQN 1XPWA 2DUQA 5A7WA 4XN3A 3CF2A 4LKSA 1MZFA 2HEOA 2D3PA 1HF0A 2XUEA 3DWLE 3G1MA 4AI1A 3FHIB 3V8KA 4XJ9A 4E2QA 5LZ6A 2GM4A 5ILUA 2HWB1 3M07A 1REDA 2R073 4K3UA 5KXEA 4YSFA 1CAWB 4JKLA 4A3FJ 1SMYF 2L9RA 4NHMA 2RR11 3LAPA 2EIBA 4DIQA 2MLGA 1R1UA 5JOYA 2E5NA 1VBA3 1H8TA 3JRAA 3RPQA 4ZKTB 3JRBA 5FYTA 4A69C 1EUTA 4V2VA 2CW7A 2BBYA 1J3RA 3SEEA 4E8DA 4A3DJ 4EGYA 4EJRA 1Y0NA 4NB5A 5B4XA 4OU0A 2BOIA 1WCDJ 5HLIA 3ZMZA 3IAS2 3BR2A 3QWLA 1NAEA 2K7LA 1Q8VA 4XBNA 3MBWA 2K85A 1FJLA 4IESA 4Q26A 2LM3A 3R4KA 3ORJA 3ASOH 2GXAA 3CBNA 4BJ6C 1WLCA 4XAEA 5A3MA 5FYVA 3VHRA 1WJ5A 3MQ0A 4P9LA 1B72A 3JBG1 4KUMA 5JR2A 3VZLA 5FZFA 1TQPA 3K2ZA 1WLWA 1ZG3A 3POEA 4A3KJ 5H9SA 3I4IA 4HQEA 4CUGA 3PNYA 3PVBB 5GZCA 1C8M3 3VYSB 1YJWI 1H4HA 2A3YA 1DQ6A 2DA4A 3OCPA 4Q4V2 4IHXA 1A5JA 3CC4I 2XMLA 2V79A 2WS93 5DUUA 4CDXC 3A03A 1VBD1 1W6PA 1XSDA 2MEV3 1BJAA 3J8F2 3KEOA 1IN7A 1QJX3 4JDNA 4AAPA 2YMZA 3ZMNA 2EJRA 4DEQA 1I3QJ 5LCWL 3ONQA 3GW2A 1DIWA 1H88C 2VUAA 3LFKA 2EVXA 3B73A 2WO7A 2PHXA 3MF9A 2MH9A 3EUHC 1PVC3 3IWZA 3VL8A 1OCZH 3LSDA 1JGSA 4BNCA 1H1IA 1U5TC 3TOAA 4DB5A 2FMDA 4DMIA 2NVXJ 1XE7A 2FOKA 3BZCA 2IT0A 2OZUA 1IXRC 4YM1A 2Y75A 2X8KA 3LF7A 3P9CA 4RMNA 4ABZA 3HSEA 5EFUA 4UF0A 3ZKYA 4ZONA 1BR2A 3S32A 2HBUA 4E7ZA 3CJTB 3OBAA 2BV6A 3HQXA 2ZGQA 3MV11 1E5IA 4XCAA 4DINB 2JSPA 5FBZA 3NAPA 2M9HA 2ZMEB 2PHRA 2DDUA 4NIAA 1MZBA 3WF3A 1AXKA 1X3WB 3NVCA 2FJ1A 3PIGA 3O1OA 1UZWA 5GLTA 3AG4H 2J1UA 3T2PA 4XFHA 1G9AA 5A1AA 5DTDA 5DD8A 1YI2I 1ZELA 4E8CA 3MIHA 1LE8A 3PMSA 1FWZA 3BI3A 4HXCA 4LT5A 3NJXA 3NARA 4YGCA 2F5DA 4HONA 2JIJA 2AEZA 4E9KA 1L7RA 1D8JA 4AFMA 4YG0A 4XYXA 3BJOA 1AYN3 3T8TA 4L0PA 1D2SA 3K4LA 3J9SA 1HXDA 1N25A 4COZA 4HAMA 1GXPA 1YX3A 2RM23 3E6MA 2GH2A 1CZTA 3JSPA 4JX0A 1Q8PA 1GWMA 1H89C 1P4AA 2ZEZA 4CH7A 1R092 1XB9A 4FPLA 5FXWA 4FFFA 1T0FC 2GNTA 4HVQA 1YRNA 3WF1A 1HRV3 1J3QA 2ARAA 2BEOA 4ZZDA 4PIXA 4LE4A 1OFSA 3I2IA 4CA0A 1YI7A 5FAXA 3UKVA 2QQVA 5F6LB 4IKFA 2ZMLA 2RS13 3HKZN 5FUNA 4BYYA 2XB5A 4NAMA 3HOBA 3FXUA 3ABUA 3AL0B 1IKQA 3WQBA 2VQLA 1S7OA 4HLXA 5FYCA 2Y6KA 1MEC3 3CC7I 3H5AA 3UL2A 3CHXA 3QPLA 5C9AA 4DY5A 2DCJA 2BZDA 2JDMA 1QXRA 1JT0A 1G8XA 3FMQA 4KA4A 1Y1WJ 3G71I 3JRGA 2FF4A 4EM1A 3HT1A 1BMV1 3DXUA 4UFMA 2RS33 4QHBA 3H1MA 1LENA 2ZA9A 1NCQC 1DDNA 2LTNA 4UFIA 4Y5TA 1QJU2 1F31A 3B94A 3E3VA 2ILMA 3MKLA 2VKDA 3BOPA 1KEXA 3HB9A 2WWYA 1ASJ1 2L4AA 3GTQJ 1D8KA 1SANA 2VOWA 2GA2A 4FE7A 3KB5A 4MX3A 1OCPA 1B8IA 1WVRA 2BP6A 1UHSA 2QZ8A 4A41A 3W2AA 1MW7A 1ERDA 1JZ4A 4EVIA 1CZSA 1QGLA 1OVPA 4HG6B 3NNGA 1H1AA 1QJX2 2JSCA 4Z1VA 2R7QA 4IE4A 2P5KA 3WGHA 1AR81 2HLEA 2V9VA 1W7PD 3H5NA 3P9IA 5J3UA 1DP0A 3DKYA 3EO6A 1BBYA 1FC3A 3VOEA 3ZN1A 2ZGOA 4DYRA 4D7NA 3KP6A 5F5QA 3D4KA 1Z0XA 2HXOA 1OR7A 1JODA 3ZR8X 2CWMA 2X1EA 4UFLA 1JUSA 1OVSA 4B3NA 1RKTA 4NMIA 1QQIA 1CIWA 1SBFA 4D5CA 5T5PA 2ADUA 2XPUA 1FOYA 3GX4X 1YYNA 2E7QA 4FOQA 4ORFA 1D7PM 4BM8A 1UFMA 1K6OA 4LD5A 2Y0SA 4NHKA 3KV4A 4B4PA 3HZJA 5BY5A 4CYCB 3MCZA 4Q4X3 1I3HA 2ARBA 4R1HA 3I4PA 4UUSA 1V54H 3ZPOA 3L00A 1YFHA 3BN6A 3E6CC 1EV7A 3ELNA 3IDAA 1UZVA 2CH0A 1NK2P 2ZGNA 4I7HA 4EWAA 2K4JA 5GLUA 3M7GA 3MYXA 1D1BA 5AONA 4D1QA 2GP3A 1TME2 4D7TA 4PF1A 2VJ5A 4QPGA 4QX8A 5FZKA 5F7UA 1I1EA 1PMIA 2BVMA 3DF0A 1JI8A 4L9JA 2V72A 4XTPA 3F6VA 4OUSA 1RL3A 1JT6A 2BGCA 2WFF2 3OOXA 5D4RA 5SV8A 1VNDA 1KONA 3NNLA 4OVEA 3NNJA 1B35A 3HT2A 4NVPA 2V1UA 4YGBA 1VRBA 5JHFA 3OL4A 2DCZA 1IZ1A 2FSWA 2YHJA 1YFYA 2M7AA 4LBNA 4CA9A 2O03A 1UZCA 3TOJA 4BZ4A 4AEKA 1FOKA 1ZK8A 1BC7C 1JZ2A 2VB6A 4RLQA 1YQ6A 2QCOA 1UIKA 3O1RA 1UMQA 2MH2A 2QQMA 1UIJA 2D43A 5DG2A 4UHTA 3ZQIA 4O9GA 3KGZA 2KIMA 5AVPA 2ORXA 3RI8A 1GLNA 3UYJA 4AQTA 4YW1A 5JZGC 3AP6A 1H9WA 3FL7A 3CDLA 3I4NJ 3S2WA 1QDCA 1BW6A 2QFEA 3JUUA 3RJRA 3T0AA 2DUOA 3NV4A 5KAFC 4YFXF 2EA4A 1DGWY 4HDVA 1AXZA 3PUFA 5FY0A 2K9NA 3IMMA 3CZJA 4BMBA 5K5QA 1LDKB 2YGLA 3HD8B 4IRIA 3JREA 3G7DA 3POJA 5I93A 1N3QA 4UOJA 4PJNA 2ZX0A 1DGLA 4XJZA 4Z07A 3NEUA 2Y8KA 4ARYA 3F2ZA 4GULA 4WVZA 4B44A 2XDVA 4JX5A 3GZAA 3LSJA 3KF3A 5L19A 1TWGJ 4XC9A 3ZSMA 1S4CA 3IDEA 1FNNA 2QF7A 2WYFA 2XIGA 5C8CB 1J7KA 3GBWA 1STZA 3IMNA 3W9AA 3JCUC 3SH3A 3SJMA 4Q48A 1P8JA 5DD4A 1GWLA 3CEWA 4IEJA 1W2UA 2H0BA 3CU7A 4KQ7A 2W2IA 4UV9A 1O3SA 2HOEA 1BLZA 1RUF1 2FD8A 5C4XJ 3VB2A 4LNVA 1OPMA 3EPZA 2EIMH 3KP5A 3O7OA 2VTXJ 3BQYA 2HDDA 1MDMB 2WS92 5ERIA 1LTEA 3TEYA 6PAXA 3U10A 2PMWB 1NTCA 1H1MA 4RGAA 1TEIA 2OQRA 1ZZ9A 1NG6A 2XJPA 3WQ0A 4XR6A 3BZ6A 2W00A 4RB3C 3PVEA 2G1MA 4LITA 2V26A 2R7OA 1A34A 4S2HA 1D2QA 1Y43B 3IM0A 4IEUA 1HV0A 2PQSA 3AJZA 2GC0A 1XE8A 2BXZA 1LEAA 4XACA 3HNBM 1O91A 5I8SA 3T8RA 3LDKA 3ZMVA 2C4XA 4Q0VA 2F4IA 4B8XA 3S14J 1SMVA 4M9SA 4KNYA 1UXXX 2D6OX 1G9FA 2BPA2 1TLHB 2G9ZA 2K2SA 2JX9A 2RDPA 2PMHA 2P5LC 2ZXHA 1NK3P 3GTGJ 4QWNA 4BJ0A 5DUIA 3KYLA 5FPBA 1E5HA 2P3YA 1KDKA 2BY1A 2YGMA 2KRCA 2XGDA 4JDMA 3FKIJ 1WJDA 3ZPLA 2EFPA 1WFXA 1OLQA 4EWDA 1AU7A 1UMZA 3QBQA 3UK9A 1ETKA 3DCFA 1F1ZA 2I10A 4LBJA 1MS9A 1VRH2 2B9UA 2FNAA 1O7FA 4HSTA 3KVAA 4DJAA 2JWTA 5FO8B 2CW8A 4N43A 1OLTA 5FZCA 4YM0A 1G3SA 1S2BA 2DW4A 4NHLA 4CICA 2WWJA 2ZHKA 1ORKA 1UAIA 3G4SI 3VBHA 1VQOI 3P9KA 5BYNA 2R7RA 1JXSA 1T08B 1YS7A 2DQRA 2Y0OA 3THTA 1W04A 3JB4C 4N9HA 5DCMB 1CAUB 3VZJA 1Z7LA 1ZX5A 3VBOC 3MKWB 5LD2C 1PZ8A 1LVAA 3WP3A 2JA5J 3TDUC 3Q9OA 5FJ8J 1W5CC 2DCEA 3FISA 1PYVA 2JDAA 1TNFA 3X29B 4L11A 4E6KG 4FCYA 3KP2A 1XU2A 1HIXA 4AQ6A 1DU3D 4XF4A 4BHCA 3NMBA 2DMUA 2JECA 3N7KA 2LP0A 4QB6A 3POYA 3BTZA 2MFZA 3TEDA 4ZU4A 1QIQA 1A8DA 4IGQA 3LSTA 3SCGA 1OYIA 4Z2AA 2JTVA 1SCRA 1LECA 1APNA 2YDEA 4EM0B 2PQ8A 3F23A 5EGOB 5IT9K 3WNKA 5KHGA 2QBXA 3BJAA 2EALA 1QBJA 1U12A 3L2UA 2P8TA 2JRMA 5AIQA 3Q8EA 3H8XA 3BC8A 3ZR5A 3VSKA 2A6EF 3D0JA 2JPCA 4XMAA 3E7LA 1A3KA 1ETVA 1FSEA 1UZ0A 2Z3YA 1IKPA 2OVUA 2D93A 3SFIA 5ABJC 5A1LA 4D9JA 5BNOA 4MGTA 4H7LA 3CDHA 1W6OB 1GV2A 3VBHC 2HVRA 2F5FA 5K7ZA 4CGZA 4XEZA 1D5VA 1HRI2 5ANNA 2E35A 2EV5A 4P5HA 1OA2A 1U8BA 4AHZA 1K78B 3HOYJ 4XCBA 3WXPA 1EPWA 1PUFA 2NS7A 1T0FA 4C1XA 2ZEXA 4DZJA 4BPZA 4QPGB 2E26A 3K1MA 2ESHA 4WVWA 4RFRB 4YVWB 2R7UA 4MGIE 1W1WE 5I91A 3SCFA 5FP8A 2HOTA 2H94A 4MIMA 3BROA 2HKOA 5BNQA 1MMAA 1Z7S3 3FXMA 4QB2A 2CTVA 1AL23 1OF4A 2P6TA 3OBRA 4IE7A 2RAEA 1NCQA 1VQMI 1FAYA 1UZZA 3ZFFC 1T2KA 5J98B 1MD0A 1EH7A 3MZHA 1N75A 1HQNA 3M1HA 1HXS3 3S2DJ 2KIFA 1R1A1 1LAJA 4OHYA 4OWRB 1OJLA 3N4MA 3D1NI 1TME1 2QBYB 1GUUA 4AFAA 4AOCA 1S0EA 1F9NA 1WW5A 1LCLA 5HDNA 4KICA 4ZU5A 2HWVA 3AKRA 5C33A 3MD2A 4JKMA 2XF6A 2Z79A 1LU1A 2CQNA 4QQPA 4GCVA 4AHYA 5IVYA 1R36A 4LBQA 1RUH2 2K3FA 1DPUA 1UY1A 3WUDA 4JGZA 1WBFA 1JKPC 3K4MA 1A6CA 3ZCOA 4LHLA 3U37A 1HB3A 1W6NA 3VBFC 4FTHA 4BB3A 4P9IA 3IIIA 2WKKA 3MIFA 4YNIA 1JKOC 4PIZA 3M3EA 2I5UA 5A3NA 1RVF1 2Q8CA 2DTYA 1IPJA 2DMQA 3A0NA 2DO7A 2IJLA 3K4CA 2JQ7A 5AC91 3VV1A 4IEWA 3J7MA 5E17F 2GIZA 3BG6A 4EEFG 5FZGA 1RJ8A 1Y6IA 2R7VA 4WXDA 2XAUA 1RHI2 2PTMA 2VBWA 1OC1A 4E2SA 5HODA 2EBIA 3WINE 2XSJC 4P9YA 4QLCU 2PFWA 2X1CA 3UGFA 4FQ4A 2QQUA 3OGSA 2KT0A 2Z99A 5ABJB 3Q9VA 1IRFA 3ABLH 2CUJA 2ZHMA 1ASJ2 4EYUA 2Q2EB 2Z9OA 2WBKA 3MVPA 3DF8A 1REPC 2F48A 1CONA 4O3MA 2NPIA 3WOGA 1POV0 1DU0A 2Y31A 3RQ0A 4OCTA 2FUG2 1PIV1 2TCTA 1HB4A 5LLQA 4B4RA 5A6QA 2HZDA 5E89A 4TSVA 1TG7A 1XMXA 4A3EJ 4KYWA 5DYMA 1B4AA 2CQKA 2OUMA 2VBYA 4C9YA 1Y7BA 2B8MA 5FMBA 2M1BA 2LYCA 2Y0MA 4Y33A 3KS7A 4GMP0 4E4ZA 1WD3A 1A31A 4G94A 3FXQA 1UY0A 2X05A 2JRTA 2FOWA 2QSHX 2DT7B 1KYWA 1H2KA 3BTIA 2KZGA 3IH2A 2DJIA 1MJ9A 4XLNF 4NIIA 2DCYA 1MACA 2KJBA 3BTJA 5ACA2 2V9PA 3RQ4A 4RGGA 2X6YA 4GO1A 3RYRA 1OYYA 2P7CB 4U0VA 4YGDA 2CQXA 3HOZJ 2CO5A 4E7HA 5LA2A 4RAGA 2R7ZJ 1GFF2 3N7LA 4HYEA 3CL1A 4A93J 2Q8OA 4YZ2A 4GKYA 3WF4A 5L9BA 4NDLA 4DYQA 1GLHA 1QMJA 1CX4A 5F32A 2DV9A 2FQ3A 4M73A 1QGPA 1WLDA 1SFXA 4XORA 4BEHA 3VYRB 4YVSC 4M4PA 1MMDA 2AHQA 2DOAA 4ZZLA 2WQ8A 2JICA 2VKVA 1UYYA 1ULYA 3VBUA 2M3AA 1IHMA 3FK7A 1UQXA 4CEWA 2OXBA 1B35C 1L3JA 2IGMA 4LIVA 1IS6A 1BI0A 4BXFA 4R4XA 3MW4A 5JVTA 1YUDA 2VC1A 1AL22 1XGOA 1ZG1A 1I39A 3ZQCA 3BDDA 4N7IA 4DXZA 2PQQA 3HKZA 1TQIA 4P5OA 3KV6A 4CDUB 1NY71 3THDA 3OY9A 5DDJ3 4XILA 2WNVB 3WG4A 2LD5A 2DXIA 4BCUA 2PAEA 3VLBB 3ZXEA 4IDZA 5F0FA 4OHWA 3SXWA 1POV1 1Y9GA 2FDKA 4XRSG 2LTPA 1IOAA 1J5YA 4FQZA 5FYHA 2E19A 2MD0A 4EATA 2ELJA 1X50A 4LKEA 1OQEA 2QE3A 4XUOA 5FOJB 2WLPA 4Q4V1 2A61A 2VQ0A 3TEXA 2DCTA 2CV0A 2KM2A 3QD6A 5E1RA 3VN4A 4LJHA 4XXAA 2M30A 5HS8A 2V09A 2EZKA 2EQRA 2WAOA 4CEYB 2XRNA 4E4SA 5I8YA 4QKDA 5A7PA 1ZA4A 3UETA 4G6DA 4C30A 3QQAA 1IF1A 2XAGA 2IPQX 2NMNA 1H0MA 1IG7A 3R4SA 3ZQ7A 2J7MA 4HPKB 4JGYC 4OQ8A 4OIOF 2WNEA 2VXRA 5C4WC 3KX2A 4DY3A 3AZXA 3KZZA 3J4UH 4MXWA 1X1PA 2CMPA 1JHJA 2STTA 5JXGA 3WDYA 2OQ7A 1LVKA 5BNOB 3HVDA 2VQAA 1UCRA 4AG4A 4MUVA 1LFUP 4CO8A 2XWBB 4B48A 3V0BA 3ZYIB 3PVNA 2HU9A 2UY8A 4YLZA 2BY0A 2FD5A 2XAQA 5FFXA 2KDZA 5F1JA 1GICA 3KT1A 1K78A 3A4CA 4QU2A 4DZGA 1RC6A 5JI9A 2EPFA 4KT6A 1P2FA 4HA8A 2AXLA 2EK5A 4Y7NJ 4Q4Y3 4M3FA 5FB2A 4K40A 1X3ZB 3ST7A 3HEFA 4Y22A 1P4XA 2RR12 3VFZA 4AXOA 5F5CA 2DF7A 1GVJA 4IGOA 1RUF2 2VY0A 4MFEA 2RR13 2QUFA 2HWC3 2L9SA 3USUA 2IS2A 1YLFA 3OSGA 3LOBA 2VZUA 5LRSA 1RRJA 1BKZA 4LK6A 1HKDA 1UCXA 1YQAA 4ENJA 2VZQA 1O3QA 1NZIA 2DJNA 4ZHNA 2QQJA 5FZ8A 5FQ0B 1KQRA 2BXYA 5LBFA 4AVZA 5JR3A 1Z05A 3BUCA 1R091 3VGIA 3W5NA 3OOPA 1Q56A 4OFGA 4LO4B 4EGZA 4M74A 4QB1A 2AR6A 4ENNA 4MGZE 2ZNZA 2Y48A 3TQNA 3OEBA 3MGUA 3ES1A 1JUPA 4DS0A 4KISA 3G1LA 5EYXA 1U9NA 3WR0A 1X4PA 4JCKA 2C24A 3BALA 1CPNA 2W1UA 2RMU2 4UB6C 1G9DA 2D2WA 1W39A 3F8MA 5JIAA 2VJIA 2KR2A 1Z7S2 3LEGA 4INDA 1IXCA 1PP7U 4OIQF 2X6OA 4W4ZA 1LNSA 4GMP3 1Z9CA 5A3OA 3OIOA 3P7NA 4LBLA 5F08A 3ZFGB 1SFEA 2XF7A 1XQNA 1H8VA 5EJZB 2ARXA 1C3HA 4YARA 3ZDVA 4SBVA 3CLPA 1YO8A 4DOZA 5FYYA 1ONAA 1W0UA 4JAAA 1USSA 5GLVA 2XVKA 4HX8A 5FPXA 5J37A 3LA7A 3VDCA 2HYFA 2I2SA 3KLOA 2Y6LA 4DXRA 5I8TA 4JRAA 1CF7A 4JP0A 1SAXA 4HNVA 3BPXA 5CLSA 3POBA 4PK4A 3UNPA 2OF7A 1IUYA 2Y60A 3T0DA 5HXMA 1H6YA 4EV0A 3KHBA 5IT6A 3CJQB 1GQPA 2Q0AA 3RZOJ 3GWZA 4MSVA 1PM4A 1WD4A 1JH5A 4ON0A 3P5BA 5IK7A 3AMQA 4M3CB 2BGOA 3AMHA 1PDNC 4J19A 3RMYA 3FWEA 1WA6X 2JB4A 3BU0A 1XCBA 4FO9A 3SZTA 3MEXA 2VM9A 2VN2A 4EQQA 5FYZA 4ESFA 2IXSA 4OQ9A 1C5HA 2A69F 4HN1A 4CDWA 2L4MA 2WZR3 2Y6FA 1G3TA 3ZFGA 4KU8A 1WGPA 1QZEA 3RZHA 5IAXA 1DYOA 3H8OA 2DFIA 2WY7Q 2PN5A 2D6NA 4D6QA 2W0XA 2VUDA 1GV9A 1YFXA 3S5AA 4U88A 4EWEA 3N36A 3LIHA 3F21A 2VQUA 5CFCC 1Z91A 5FWJA 1W9YA 4IETA 3HGYA 4LLLA 1E5RA 3EBRA 5JHUA 4WXCA 4NC8A 3I54A 1DU6A 4CDQB 1U2WA 4GA9A 4Q5OA 3EHKA 2FBKA 1SVOA 4UVBA 1ND3A 4B29A 3BZKA 5JAXA 2QLZA 1WCMJ 2Z4FA 4EN9B 3DEMA 5CA6A 1W9FA 1SLTA 1BCXA 3J80K 4RQPA 3W3CA 2RE9A 1C5IA 3MZ8A 3T2TA 4CU8A 1BK1A 3VBRC 4BKXA 1W03A 4XNFA 1P7JA 1O4XA 3JRCA 5A3PA 1TZLA 3PFYA 5J6XA 3L2VA 1BA5A 2GMMA 4DO0A 4XF0A 5H2FC 4V19K 2V7FA 2YX7A 1BVVA 3C7HA 2GSYA 3OYHA 3VBRA 1VQ5I 1OYWA 2XH6A 3O2PE 2WABA 1WGXA 3AP4A 3HOTA 3T1MA 2DT6A 3UT0A 4OZXA 4WM8C 2KP6A 4I6ZA 4IV3B 2HWE2 5J4VA 1N78A 1B09A 2DTWA 2NRAC 3NKGA 4B8EA 1QJU1 5D5XB 2WYSA 2A5YB 3IKVA 4RFT0 3AG1H 3OTFA 4FOYA 1NQJA 3SZGA 3SEQA 1TBXA 2ISZA 2XVCA 1YG2A 3WY6A 1FPN1 4QM9A 1AJKA 1UWWA 1CAVA 1GKBA 4MG2A 2OV7A 3VBSA 3HRTA 3K1NA 5CFDB 4P9WA 4FHTA 2RS31 2DA6A 2EILH 2VO5A 3SDGA 3CLOA 3BPSA 4V2GA 1YITI 3DBHB 4LLGF 3FMSA 4XLAA 4TXWA 1MR5A 3K4BA 3WTXC 3PJRA 2WZEA 5DZGA 4G7ZF 2V73A 3AYAA 5FLXZ 1DCSA 1R00A 5FFZA 2QM3A 4MO7A 3FUOA 1OFCX 3V7SA 2J5PA 2BBVA 1S5LC 2ZKZA 1SDWA 3WF2A 4FTSA 3VZMA 2O1QA 3NQOA 3AKQA 3CCVI 2RC4A 1OISA 2UUZA 4BK4A 2YBKA 2RNJA 4RL7A 5FZLA 5GAGJ 2C9AA 1RVF2 1WCSA 2RQPA 1WI9A 3LGRA 2H27A 2Y9YA 3VUOA 5B1BH 1QVUA 2ZGRA 2IS1A 2ME6A 3R4UA 4LBQB 2WSVA 3IKWA 4HVRA 3HOXJ 1FSHA 2R49A 4OINF 3VKLA 3IZOA 4QPYA 3IC7A 1BEV1 4GIQA 3U4SA 2K3PA 1XSXA 4LO8A 4QX5A 4A3ZA 3WHTA 2XHNA 5CJ9A 1G86A 1OBNA 5J1YA 5JSOA 1XYOA 5FYSA 3COAC 3W6JB 3BTXA 2XKPA 2Y69H 3DPTA 5JOXA 3UKTA 1MQTC 2IBDA 3CUQC 3C7GA 2XSDC 4XLHA 5EYRA 4XFAA 3GLXA 4OMYA 1NG0A 1SVLA 3J7AO 5LBQA 1ND2B 2V6CA 1S7EA 3OB8A 4L9TA 1ZR2A 5APAA 4LBMA 3K4JA 1OOPA 3I2KA 4L99A 5TGTA 3WTSC 5GALA 2L9VA 1Z0HA 1XD7A 4AEMA 3CCJI 5LASA 3LFIA 1F15A 4G6QA 1PVEA 4YW7A 4FCAA 4ZY9A 2W57A 1VF9A 4X6QB 4P1WA 4J1WA 5A1FA 5L3DA 2AYHA 3HIFA 5DQ0A 1VE0A 3R05A 1SHWB 4CCCA 3OPTA 3E97A 4PLOA 1XNTA 3RJ2X 3MFCA 2L7ZA 2RDRA 3FMRA 3FMGA 4HZFA 3OYGA 1UG2A 4B1MA 5F39A 1JJ6C 1Q3EA 4BQ3A 4BOWA 1OLRA 2NYYA 1Q8OA 1GZCA 3MLKA 1LHOA 1ON2A 3M3OA 1WKYA 2VKHA 4RM2A 3L1PA 2HWC2 1DZTA 2RV9A 3ZOIA 3ZX7A 2G19A 2MG4A 3POIA 1ZZ6A 3BU7A 3PQJA 1IN5A 2VMHA 3WG2A 1J3PA 3Q3SA 2VCAA 2ZB9A 4XIDA 4W6XA 1VQ6I 2H6BA 1Z78A 4EQVA 3OMYA 1YO5C 1O8PA 2VQCA 2QZ3A 1IGNA 3H42B 2MYSA 2BW3B 3QRFF 1RKWA 3I2OA 2WV0A 3ZQLA 4XOGA 4YZ1A 1Y39A 4NHXA 1RYYA 3I4MJ 1MZ6A 4PBPA 3WHCA 4PGHA 1KITA 4GWJA 1QU3A 4U0YA 4D5FA 3IKTA 1JHFA 1RUJ2 1AWCA 1TNSA 1QZZA 3FXOA 5FY7A 1VBC2 5KVRA 4KWKA 3A02A 1V9U3 2GXBA 1V6IA 2WFPA 1YQ8A 1SFUA 4UB8C 2A68F 1XGMA 1DP3A 4Q4W3 3EUAA 3W2WA 3AFGA 5EXOA 2J22A 2QQPA 1OKOA 1WWYA 1HDKA 5FKCA 4YELA 5CB7A 1V6LA 2O14A 3M4FA 4ZPIA 5FGMA 1GZTA 4AFBA 1WZ2A 1H0BA 5DS9A 1ZZ8A 2H6CA 4FFIA 1YTYA 1QJX1 4KG0A 5CADA 3ZSEA 2BY2A 2CWSA 3KZIC 2V4VA 1XN7A 3DL3A 2ATFA 3O14A 3CF5F 3DECA 1B9MA 3FXKA 4DQ2A 1TC3C 2JMWA 4C2TA 1Z67A 4R52A 2NLRA 1RMU2 4HV5A 4L5IA 1RR8C 2KHMA 2PXJA 2OW4A 3KT7A 4XIOA 5FZDA 5KXDA 2P5VA 4E4HA 4P00B 2HI3A 2GWRA 3FX3A 2ZSHB 1I5PA 3BG9A 3MIGA 4CEYA 3DP7A 1YIFA 4EE2A 3K46A 3P1IA 1MSEC 4B3AA 2LW8A 3ECHA 2JA7J 4YVSA 2R072 1ZBE1 4FFHA 3K4ZA 2ID4A 1HSTA 3OS0A 4XFGA 3F22A 3I56I 4CDUC 5C4JJ 4ASLA 5L3FA 3W20A 1T56A 3FKJA 3OUIA 1ZYBA 5A33A 5JXJA 4FXGB 2K9ZA 5FXZA 2PX9A 3ULQB 3CJXA 3PNTA 2JEMA 4ASMB 3I3MA 4DRVA 1BR4A 3BLYA 5LHIA 1FXZA 1JU3A 2RHPA 3JBG3 3PTRB 3S3MA 4IQPA 4HK9A 4RHV3 1XDUA 3ILFA 1KQ8A 3MWMA 4RGSA 1OCCH 2BUKA 2COBA 2R061 4Y1XA 1GP4A 4P9FA 5DAVA 1KFXL 2RM21 1NA1B 2Q1MA 4RHV2 4HL0A 1X9PA 4W97A 3V4GA 1BI3A 3PU8A 3Q8FA 3HPNA 2RS32 4YG6A 5B4NA 1C8M1 3QODA 3K0LA 4UYBA 1OI6A 1YW7A 2PLV3 4XXPA 1HRV1 5JUVA 3H1YA 3QCWA 3CCQI 3WDTA 4IHYA 1ZAOA 1FPN2 3JD73 1VBD3 1XJAA 1SG3A 1SMTA 2RMU3 3MW2A 4AI8A 1JTXA 3LA2A 5CZKA 3T30A 4I2OA 2WC2A 3DPLC 4EZHA 4PDWA 2IGKA 2X51A 3ERMA 4XBFA 4B47A 1YW9A 1ODDA 2HOAA 4ZYGA 2UWMA 3AK0A 2RVCA 1VPHA 3P3NA 3HOSA 1JHNA 2P7VB 1ZGAA 2PA7A 3H0DA 3RZDJ 3CO7C 3JQWA 2DAOA 4XL9A 4BWOA 5C3EJ 1DF0A 9ANTA 2GC3A 1TW3A 2JUGA 4EN7B 4A3LJ 1HJFA 3T1BA 1O5UA 5HXVA 2A3SA 3FIWA 2UV1A 3PURA 1PVC2 3ABMH 4ITCA 2VVFA 1FNZA 3DPRA 1O3RA 4U7DA 3FLPA 4NAOA 5HPOA 1XDSA 2LF8A 1D5YA 1JJ8C 4M01A 3K6GA 1FP1D 2OPTA 1ODNA 2ZZJA 1VBC3 4DEVA 1QU0A 1WMFA 2PELA 1H2MA 5JPNB 3L2RA 4C3HJ 1K5JA 4CDGA 4AC0A 2NXNB 4BQ4A 5F2SA 4E7LA 2KJCA 3WZ1A 1MS3A 1NT0A 2DMNA 5ED4A 3KE2A 2XRLA 1I6XA 5T50A 3GXOA 1ZZ7A 1RIOH 2Y6JA 4DW6A 4XHXA 1B35B 4H55A 4YFZA 4UVCA 1R5GA 4CVUA 5M5YJ 3V64A 1VBB3 2BHZA 2BW8A 1T39A 1IDZA 4A3MJ 2B9SA 2HYKA 1KGYA 5F8PA 1BBT2 3FXJA 1EY2A 4GXOA 1SPPB 3LNQA 2DPDA 3A2KA 5H6QA 4AM3A 2ELHA 2CYFA 1LOAA 4GKXA 4A6OA 2WNUB 3ZFFA 2JDPA 3BGAA 5KNLA 2VGDA 3DTIA 4S2GA 5FV3A 2EFNA 2Y26A 1N3OA 1RUH1 4AQSA 4UFKA 1RNLA 4DUWA 4OHZA 1W3XA 2BNMA 4RR3B 1YJLA 3H3VK 1AKHB 4PCQA 3UNGC 1ND3C 1G3WA 4LFUA 3G73A 5DUWA 2CW0F 3CUQA 2QTWB 4QKBA 2MABA 5IFTA 3MPBA 3PO3J 5KXCA 2BWCA 5ICFA 3BCWA 1GANA 1OCOH 1XMKA 3S57A 4PJJA 3A0KA 2A6TA 4FQGA 3WW4A 3HMYA 1YNAA 1PX4A 1I1GA 4HSRA 4A3XA 1H6XA 4XMIA 3U2RA 2J1EA 4PLNA 3OG2A 1DDLA 3VODA 3Q8BA 3HDDA 2QNKA 4LK1F 2DFFA 1DZQA 3P5JA 1B1BA 3JBG2 5D4SA 1LOCA 1FT9A 4ZTJA 1HJGA 2I45A 4M0HA 1V4RA 3AL5A 4COWA 1G59A 5E18F 4A3IJ 2GOMA 4OOIA 3MFAA 4CP9A 3GUDA 3AJYA 1YS6A 1JW6A 4GXLA 1WJAA 4UW6A 3OYKA 1ULPA 5ICGA 1IG0A 1W6QA 4KMFA 1GOGA 2HQ5A 4LK0F 5BNPA 4IV1A 2NM1A 5B3SH 2RS51 5FMOS 4HOOA 2W92A 3JD72 5A7QA 2X9DA 2XHKA 3OYCA 5L7OA 2Y6GA 3VDDC 4BLJA 1FYUA 3F3XA 2MEV2 1XNBA 3L2QA 4FP3A 3WG7H 5EDNA 2ET7A 1PIV3 1X36A 4HBLA 3S93A 2VNRA 3K4AA 2CUZA 3QP5A 1OPCA 1QPMA 4OULA 4D69A 1TQ5A 5FP3A 2V4AA 3CCRI 4BEHB 2GU9A 3TN93 4Y1ZA 2IA0A 2VMIA 1DYKA 3ZXAC 2QDRA 5A6YA 3OF1A 3B5LB 1RR7A 2ZGKA 4F55A 1ND3B 4MZUA 2HYGD 3U75A 1YC61 3OY8A 2X5IB 1NCRB 5BNNB 4Y20B 3E5UA 4E2GA 2BY3A 2LFBA 2CRGA 3TMOA 4Y52J 3AZZA 4RLFA 3CCUI 3HBLA 5D5VB 1FLIA 2OA4A 3K3NA 4D6RA 3N9LA 3K75B 3KYDB 3MUY1 5LGUA 4BQAA 3ZN6B 4CCDA 2W48A 4XOTA 4BE2A 4B7EA 2WAEA 2BRTA 3NW4A 3VBRB 2YBSA 3HWJA 3IWFA 1QXJA 4META 1R71A 2E31A 2J1AA 5FDBA 4Y5Z0 2DA1A 2WJSA 4M4RA 5A80A 3VDAA 4W8JA 4P9UA 3D5SC 1NA1C 2A07F 1AUYA 1NZCA 2QEXI 1TE1B 1A6IA 2GZWA 3H7JA 5LEKA 2NVTJ 3W6KB 2MW8A 1D4VB 5LHHA 1Y9QA 5LY1A 3OYFA 2NNYA 5CFCA 4FVVA 4PDWC 2E36A 4AGRA 3BODA 1IGOA 5FCCA 5BMZA 4XPVA 2WV1A 1Z3XA 3J81K 3LOIA 3S1QJ 1V70A 2VZTA 1R9TJ 3DYOA 3TOBA 5A7WB 4CEWB 3I7DA 1SFPA 3PLQA 3GFIA 1GHCA 3FBIB 1JUMA 1FBSA 4HF2A 1K4SA 1ZH5A 4XSXF 1HDPA 2VZPA 2VW0A 4Q4V3 1UXZA 2OUHA 2E7WA 1HB1A 1ZQ3P 2DFHA 1XGSA 2W1WA 2Y6HA 3GCWA 3W6VA 4UNOA 1HQLA 2PJRA 3IUOA 3AMMA 4BQ5A 2B9VA 3AZYA 2GMPA 2R92J 2X1DA 3POFA 4FTEA 2CY6A 3GTPJ 1J0RA 2M7BA 4KH9A 3WG3A 4A6SA 2HPMA 1ENSA 2KD7A 2X5IC 5BNNC 4UUTA 2L7KA 4KMUX 2DCKA 2E5ZA 1W0OA 2PHUA 4RA2A 3ECOA 1ULFA 2W5FA 1RUC2 1SQ4A 2UXNA 1G9CA 5BQTA 1W8OA 1XE0A 1J84A 4M3EA 1SEUA 3P3PA 4ZDLA 1EUUA 2WS91 2KZVA 2R93J 2VD7A 1Z6RA 3WX5A 4YZ4A 4PHZA 1IN8A 1UKGA 3IB3A 4DNCA 4NBQA 1RUD1 5FO5A 4CU6A 2O5RA 3HTUA 3FC0A 4BU2A 1W7PB 4XICA 5M5WJ 3Q0VA 3HHGA 1JZ7A 1YW8A 2D97A 3EXUA 5JI7A 2IVIB 4U87A 4YRVA 5IVBA 5C5UA 3R0JA 2VMDA 3J80Z 4QKNA 3SISA 4BJTA 2MLKA 2EINH 3OD4A 1HA8A 3RZMA 5FP4A 1WW4A 4CUBA 2MD5A 1D0YA 4M9XA 5EJ3A 4CXYA 2RGVA 2X10A 2XPVA 4PUSA 1HRI1 3TN92 1T6SA 4M3CE 4Q1PA 3PUAA 4QHOA 1LHWA 4JX6A 1D4M3 5EJ1B 4DZPA 3IBMA 1FOD2 4OI0A 4QGNA 3B00A 2F5EA 4QPOA 1LJ9A 5EJCA 3THCA 1XTAA 1QHGA 2IZWA 4XLEA 4GYIA 3ETQA 3B02A 2DU0A 3AZVA 4HKOA 1PK6A 2J1RA 2E1CA 3R60A 2D3RA 3K9TA 2QQLA 4E7JA 3VBOB 2HTSA 1MPXA 2BE5F 5EQUA 1EAH2 2TNFA 1R093 5FZOB 5GAEJ 1TP4A 3U21A 3D82A 2KRHA 5CG9A 2XVGA 2YG0A 2QQOA 2ES3A 1UY3A 1A78A 2D6LX 3KD4A 1IDYA 4Y22B 1E3PA 2ZZQA 3CCLI 3MUZ1 2ZAHA 2OQGA 4V2WA 4LHNA 4Q0PA 4UF0B 1LEDA 4BMEA 3O12A 4N8MA 3WNXA 3M9AA 4XKBA 4CDWB 2EH3A 3M3QA 1VRH3 1R58A 3VDDA 3KEYA 3OYIA 3PUHA 4KU7A 1PK6B 4KJZA 1EPZA 2A73B 2DOEA 2AH2A 2ZTNA 3D5RC 3G6JB 3QH7A 1KXGA 3VD3A 5K1YA 3S6PA 1W8WA 1HXS1 1Y8QB 3R0AA 4GMP1 5DUXA 1OD3A 3DFGA 1LEMA 2GNMA 3AP5A 5FLIA 2GMEA 5BNPC 3GFLA 2K4BA 2C9KA 5CKNA 5T54A 4ISQA 3LSRA 5A70A 2JG9A 1QEXA 3IAPA 1X1CA 1PO22 1O5LA 4N9IA 1WJCA 3GNEA 1AXYA 1YOVB 1MEC1 1ZLJA 1WH5A 2LY1A 2EIGA 2ZCWA 3ZXGA 4P96A 1PO13 4GH4B 2GP5A 1T6BX 4RDUA 3DKWA 3HR9A 5HNHA 3UKNA 5FYMA 5J09A 5T55A 2R5ZB 4K7JA 3IH4A 1JZ3A 3KV9A 5JSRA 1D0HA 4OHVA 5F37A 4ZYAA 3BKZA 3SMHA 2M0MA 3JTGA 4JZRA 4AHXA 1WLTA 1DGWX 3O5SA 4A45A 5FZ0A 2VBBA 2XQXA 2DODA 3K69A 1RUG1 5CPRB 2VMFA 2EIJH 3GFJA 2GOXB 5FZEA 3DN7A 1LQ1A 3O3KA 1VZ0A 5F6FA 3DTEA 3PL8A 1KGSA 2FCUA 1BN5A 4AYBA 4ZS2A 3BR0A 1W8NA 2A6WA 3H9GA 4IEYA 5GKAC 2XJSA 2IXLA 1IN4A 4F7ZA 3SNMA 4CCKA 1NYWA 1U78A 3AG2H 3I2DA 5DAPA 1BIBA 4HANA 1UU5A 1QRYA 1LU2A 4KN7X 4AI2A 4U36A 1O8SA 2MC4A 3BG5A 2AREA 4YYOA 1VP6A 1UAAA 1MBEA 2L9LA 3ZSLA 5A3TA 5FZ1A 2LKPA 1VB4A 2VOPA 1ZRRA 4IHSA 2V1DA 2VONA 4CHUA 3PL0A 2PN6A 3G6EI 4OUEA 1SFNA 2XJRA 1QNWA 4UY8I 2W24A 2QVOA 3IAQA 4L0ZB 1PUEE 1ITYA 1BM9A 2W1OA 4LBOA 3LQQA 1G8WA 3KM5A 4D3WA 1QXPA 2QKDA 2ME0A 5A7SA 3WQ7A 3I71A 3V7RA 2QJVA 2HTJA 5DM6F 3K3OA 1LGNA 4QPIC 5CVIA 4YPJA 2UY9A 1S3JA 4M6XA 5LFAA 2BVVA 3WNPA 4GWMA 5I0UA 4U7BA 4ENKA 2M5WA 3UGHA 2AS5F 2XC7A 1BJZA 1GT0C 4Z92B 3TKYA 3SCHA 4YZ3A 5LA1A 2K40A 2R7WA 2ZNYA 1U5TB 1GNHA 2P3JA 3DTKA 1WMXA 2WUHA 1TTYA 1KZHA 5C8WA 3BYWA 1Y56A 3QAHA 5JIUA 5L9VA 1W9WA 2M0CA 3WVJA 5BPIA 4BJ5C 1C4RA 3KZ4C 5HV0A 5IP9J 4EJWA 1TZOA 2F4PA 2Y64A 5EZGA 1TWFJ 2M4KA 4U2AA 3CMEI 5FMCA 2VOTA 2VNGA 2LMDA 3VKNA 4O61A 2Z5WA 1UL9A 2OCEA 1URXA 5IVEA 5BXXA 1LR5A 2VZSA 3FHQA 2H1KA 4BXUA 2ZAAA 4JC1A 3GZTB 4ZXKA 3OYJA 4A0XA 5IT3A 3C3VA 5JFRA 3K10A 1HW1A 1X9TA 4G3YC 3F9KA 3PVOA 3QACA 4O5VA 3NWSA 2NQYA 4HN0A 2Y0SN 1VFCA 4M72A 1KDMA 4Y3OA 5L7OC 4NUBA 4K21A 2CGOA 4H14A 2L01A 1OQYA 4K1ZA 4U0WA 4XONA 1JN2P 1KD7A 5DG1A 3AM2A 2FU4A 3TW6A 4LB6B 5FY5A 2BQPA 4P14A 3CMAI 4HG2A 1WH7A 1GUIA 5HLTA 1EF4A 5FLHA 3DPRB 1F9KA 3LSKA 4QPWA 2L0KA 1LUJB 1JI6A 1W7PA 2F2EA 3OIPA 2X6WA 2CHHA 2WN2A 4WBBA 3RPUD 3CQZJ 2PHTA 1NOVA 1MKMA 5CKTA 5K7FA 2LUWA 4HW0A 1KU7A 3HUGB 3RRDA 1LKXA 3N05A 1DBNA 4A6EA 4EM2A 1JUIA 5E79C 1OFNA 3GVAA 3VWBA 4W50A 2Z42A 3T4VA 1AR82 5D8LB 2ZX4A 1C0WA 3N7MA 3USUB 1WI3A 5HNFA 4S0HB 3CCEI 3PIPF 2ZFUA 3MIBA 2BFUL 4LA3A 4IE6A 3NRVA 1WBLA 3OSFA 4XM3A 3GDBA 1OHFA 1LESA 4PSWA 3GTOJ 1YQ2A 4BY1J 2LY9A 3OYDA 4QX3A 5I0DA 2LROA 3K2OA 2D6MA 3RVHA 3QP6A 3AP9A 3J7AY 3NJZA 2FA5A 3C8XA 4XFCA 4ES8A 3HEIA 2LDUA 4V2FA 1LFBA 1XYPA 3NWTA 1K45A 1JZ6A 2GN7A 2W47A 5C8CA 1GYKA 5K0UB 4HRIA 2XV4S 2B46X 4MADA 3HGGA 1HSJA 1ST8A 4HKWA 1YXWA 2M34A 4A3CJ 2W3JA 2LVSA 2D5VA 2IAIA 2LRDA 3RDIA 5L36A 5FD5A 1PM7A 1IRXA 3CLQA 2XPJA 1F4AA 2L7FP 4A7YA 3PFIA 3HSFA 2E1MC 4PF5A 1QF3A 1R081 3OEAA 1S6LA 2AO9A 3WCRA 3VD4A 4QM8A 1H30A 1AR61 1ETQA 5ICEA 5DDJ2 4C1WA 1R4MB 2VOXA 1RUOA 1XSVA 1YYVA 3HPHA 1YQCA 3NL1A 4KWLA 2DYSH 3AVSA 4Q0SA 2A70A 5FPLA 3OR2C 2OPWA 3BTAA 1IPKA 1Q5OA 4Y17A 4HX7A 2F6CA 3DPRC 1LNWA 1PHMA 5C70A 5B2GB 5LA0A 5JLWA 4Y26A 2K5CA 2R043 3S17J 2KFDA 2FDHA 3CMGA 5GZGA 3CESA 1VBA2 3ZFGC 3GBFA 5JXIA 1LDDA 3M1CA 2K0GA 2ID3A 4QHZA 1NX9A 4KG8A 1AYM1 4RSUA 4WZCA 4MGYE 4V1PA 3ILNA 4Z2YA 2ZXQA 4NROA 3J7YJ 1V9U1 3AKSA 1AX1A 1XX5A 1VMFA 2BW3A 5J1RA 2EV6A 2ZJCA 3LSEA 5T3NA 4Y13A 4MTEA 2NVYJ 2ZSIB 3HYIA 5FXVA 3EMRA 1RUC3 1PNFA 4P55A 3PNVA 2O0YA 4N53B 1LRHA 3KYCB 3HN3A 1UMIA 5JZGA 2EZLA 5IT9Z 4KGGA 4AYBN 1QNYA 1LE8B 5F5AA 3RZKA 1VTNC 1GZ9A 2RQQA 3CJIB 5A33B 3EDPA 1IQAA 3OUJA 2IS6A 3WT3A 1X2MA 2BYVE 5LRRA 4LQRA 3OV8A 2O61A 3MKYB 2XKOA 3LAJA 1UZYA 2GC1A 2FBHA 2Q2EA 4AVAA 4O9EA 1TWHJ 1OKQA 4MQVA 2EA7A 3LFMA 3C2UA 3J8F3 2QWWA 4IOCF 1FIPA 3LSMA 2D3SA 1W2NA 3I59A 2WO1A 3K48A 2K86A 1R1VA 1ZBE3 1T38A 2AZ5A 3ISPA 4WF2A 1J75A 3ETPA 3RSNA 2ELKA 3E5QA 3RI9A 4L9BA 4L92A 4B1RA 4AEDB 3GZUC 4LG0A 4WZFA 2NN8A 4AVPA 3HG9A 1W0TA 4XE9A 5IYBJ 1BHGA 2IC1A 4EN8B 3FM5A 5F04A 2CU5A 4EMSA 2HGCA 3CP2A 3FK6A 3OJBA 3WEZA 4BXXJ 4G9YA 1Q43A 1IW7F 2BGPA 2XQRA 1ACIA 4BLIA 2L9NA 3S0MA 3EB7A 4CP2A 4M0NA 2D98A 1EAH3 3HSRA 1X33A 1K5MC 2WNUC 4Q1RA 2DDAA 1OQ1A 5E16A 3DBRB 3EJKA 3EYIA 4IXLA 1Z7S1 4G12A 3M70A 4AGVA 2G9FA 3O1MA 4NWWA 1RUE2 3HQRA 5K5OA 2VUMJ 4UXAA 1WA4A 2FXAA 4GWNA 2VE9A 5A7NA 4Y1YA 3APBA 5IWFA 4FOVA 3U4XA 2ZXIA 2WQZC 2RNGA 2G7HA 3NSTA 4J01A 4ONUA 5SV5A 5DPNA 5IFPA 4RS5C 3TYJA 1E17A 4BQYA 1FIAA 3WTUC 2YU1A 2ZJRF 3VBUB 2A3XA 1T2XA 3KP7A 2HEVF 4OHXA 2B4KA 2WT1A 4TWTA 1UO9A 3C2HA 1T33A 2YPRA 1NA1A 2XLGA 3KCXA 4GB32 1NG7A 2I07B 3GF6A 3HNYM 2CQQA 5FZOA 4RD7A 1UHMA 1WWXA 1ULGA 1E0EA 3MLJA 3CC2I 3RKXA 1SPPA 2C6YA 4A5NA 4CRQA 3CO2A 2YBPA 2AC1A 1LHVA 4GALA 1RI7A 1AYM2 2YX4A 5A32A 5DXDA 1S0JA 4HSLA 1W36C 3ZMTA 2FE3A 3LL7A 4ZYHA 3W21A 3GALA 4K20A 5A6XA 1W2AX 5HS9A 1MVQA 3V56A 4EROA 1UYZA 4L5EA 1DGRM 5IJRA 4X1EA 2B5HA 3V8JA 4PJLA 1AA7A 4IV3C 1WHUA 3JW4A 3WE2A 1DGWA 1VBC1 4ISRA 5F9TA 5JLVA 3TB0A 4D7SA 4AIJA 1XBFA 2VQGA 2QZ2A 5JVVA 3MN2A 2QENA 5FROA 5JI6A 3WNMA 4XURA 4UUSB 1LOGA 5K7HA 4DQAA 4JOMA 2JG8A 2QDNA 1X1BA 3WW2A 2PHFA 3VSLA 3F8FA 5F3EA 1S72I 4Q27A 5FZIA 2FDIA 2NZ9A 4A4AA 2KDOA 2QQAA 4FSJA 2DK8A 1IV6A 1JOPA 2VR4A 1W05A 4RM3A 2ZBKA 2E53A 4RQPC 2A5WA 2EAKA 1FNYA 4N4NB 1RUI2 1LB2A 3MDPA 2BTVC 3OS1A 4ATFA 1GZWB 2V4JC 1ON1A 1F35A 5E1ZB 2P6HA 4OLLA 3VD9A 5E8AA 2O8OA 2CV1A 2E1NA 5IK8A 2B0LA 2VAUA 1FP2A 3WTVC 2CWEA 4XETA 3PM1A 1CAWA 4RBOA 3NNMA 1BOAA 3S16J 2B63J 1JYCA 5ABJA 3RZLA 4XMYA 1E2XA 3TL4X 1HDDC 3GJAA 5HCFA 1G6NA 3U11A 1GSLA 4F8AA 5LB6A 5BNPB 3FXRA 4BUPA 1EP0A 2VXZA 1TNTA 2OAZA 2UZKA 3INAA 3MI8A 1FATA 4IZZA 3G3ZA 3H36A 2LY2A 4RS8A 3WQ1A 3UKGA 2JT1A 4ESBA 1K6YA 1QOOA 5L73A 2E7TA 4WVMA 3K51A 3I53A 2WAQA 3I3QA 1BR1A 5FMOL 1MZEA 1GZWA 3WE3A 1S7AA 2DTZA 4FPHA 5FZMA 2KXLA 1R64A 4YW6A 1MMSA 3HPGA 3BG7A 5FY8A 2PMZN 2XF5A 4JGZC 1ZTRA 1OURA 3DEUA 2DI3A 3DBLB 3V8LA 2VBPA 3LAGA 4X8PA 5FRAA 5FZ4A 3OPZA 3T2QA 4NRPA 4LXLA 1IXSB 2RS53 1OKRA 1QJY3 3DV8A 1V9U2 3Q8CA 4C2UA 4GH4C 2EV0A 2XPWA 1POV3 4SLIA 2AQEA 4IV1C 3KP4A 4GRIA 1DQ1A 3K4NA 1YJKA 1W5SA 4DNYA 4WVMB 3WW1A 5M3FJ 1DQ5A 4YFKF 1X82A 2IVMA 5EZWA 2HR3A 2JD4A 5FMDA 3PUBA 4PCRA 5M3MJ 4QPIA 3TW7A 3LD8A 3CJIC 4QX7A 2YYOA 1W6QB 4D94A 5CFDA 3GXUA 2VW1A 3O0WA 1B8IB 3WHUA 4HX4A 2JE8A 3VBSC 4QIWN 2ZJQF 2L5QA 1QH6A 4P02B 1XS9A 1EV13 1G3YA 4DGWB 3LOCA 1ZYRF 2WZR2 3I5UA 2JN6A 3OYNA 4WVVA 4GAZA 4HEA2 3KSCA 3WP5A 2Q30A 1BL0A 2X53S 4YGEA 4UT5A 2B7YA 1WW7A 2E1MB 1E3HA 2YPJA 1UOFA 3ACLA 1FOD1 2JENA 2A1XA 3USSA 2ACJA 4L9VA 2W25A 2OZ6A 1XNAA 2DMPA 4ASNA 3ZQHA 2ZHNA 2WSUA 2EIDA 5CKQA 3A0HC 5CVRA 5DZFA 2OCCH 4JGYB 3WV6A 3DU5A 4IEXA 3ME2A 4XJAA 5ACA1 4IW3A 2F4OB 4Q4Y1 5FKBA 1LJ7A 1X3UA 5D1IA 2MA3A 1LPQA 4FE4A 1CN1A 1UPIA 1ZBA1 1IG3A 3ACIA 5ILVA 2ERFA 3ZN6A 3PSIA 2WA0A 2QQBA 5KHIA 3L7WA 1VI0A 2HWC1 3KLSA 1SD4A 3RWKX 2O8QA 4BXSV 2UWAA 2FBIA 2WO3A 3BWGA 1F5FA 2YU3A 5KAIC 4K8RB 5G04L 4N43B 5JOWA 1UYPA 1X7NA 1EH8A 2DFBA 2PLV2 4A3JJ 1PMHX 2ZHLA 2WT0A 2WFF1 2W84A 3UR3C 1V3FA 2Q8DA 4FETA 2CNAA 3E1F1 5ILSA 2A6HF 3BTCA 2R7FA 1LOFA 5DDGA 1ZBE2 2E7XA 1MQTB 2DVBA 5LATA 1HOMA 2YPDA 2KLOA 5D21A 5FPZA 2BDRA 2DFCA 1QJFA 1MS4A 1W9TA 2R5YA 5DUVA 3OGVA 4XFFA 4AD9A 4G6TB 1MIJA 1ULOA 4IF4A 1JTYA 1P7IA 2DYCA 5IY5H 3PU3A 1UKRA 4XQWA 2I8DA 3W58A 3TGNA 2EXHA 5CNAA 2C1FA 3AL6A 4FX4A 2ZGLA 4P9GA 1CESA 2Z2SB 3BR1A 2UWCA 3M3IA 4J00A 5J4YA 3RS6A 3GYHX 2BERA 3BOQA 2GNBA 4M9ZA 4BK5A 4AZZA 3J7HA 1NCRC 2XOMA 4XHBA 3QLQA 3ZXLA 2FCTA 1R1A2 2ZX2A 1RUJ3 4XQ4A 5CBLA 2VNOA 1XMAA 3OUHA 2V5DA 5E8IA 2TRTA 1RXGA 4XUQA 5JLXA 2VU9A 3JD71 4XRMA 1QQP3 3U0ZA 5J36A 3ZMDA 3Q0WA 2RMU1 1O6UA 4II2A 2CQ7A 4GJZA 2VC9A 2XL7A 2ZMNA 4OI4A 5K0UC 4KFCA 4I0WB 5J8FA 4AI3A 1MBFA 5KHDA 2VPRA 2ZABA 3VBOA 4QXBA 1PJRA 4XTMA 3SYTA 1RIRA 2VUCA 5FLMJ 4GFBA 2KMUA 1S29A 3B6CA 2JWPA 1R1ZA 3KZYA 4GB33 2DURA 3GGLA 2VVDA 3LSPA 4JHTA 2XAFA 3MIDA 5L3CA 3PDQA 3H9AA 1JYTA 2A3WA 4IEOA 3VZOA 4Z6YA 1PO23 4H7MA 2CV6A 4FOWA 3GHMA