3DKWA

Crystal structure of dnr from pseudomonas aeruginosa.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
227
Chain Sequence
MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLECFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords DNR protein
publication title A dramatic conformational rearrangement is necessary for the activation of DNR from Pseudomonas aeruginosa. Crystal structure of wild-type DNR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 46
structure length 227
sequence length 227
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dkwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dkwA01
2E1NA 4KN7X 2GQQA 3RYKA 2IRFG 2Y0MA 4RD7A 4G6DA 4LTAA 4CZZA 3V8JA 3COAC 5F6FA 1EYBA 2F5EA 3F8MA 1OYYA 5D5WB 3VB2A 4HX7A 1JE8A 3D5LA 2MD5A 3WE2A 1ZH5A 1KA8A 3HRTA 4M9XA 4IVNA 2HOEA 1P92A 3TOAA 1S8NA 2RN7A 2GWRA 3USSA 1YTYA 4Z2YA 1MJ9A 3I5UA 2EV6A 1ZREA 1XGNA 2L54A 4M73A 1J3RA 3KZZA 4YRDA 5K5OA 1MGTA 4HBNA 1RTVA 4ZYGA 4RGXA 2XIGA 4UVBA 1IW7F 1YFUA 1OI6A 4OU0A 4HSLA 5L3DA 2J5OA 2STTA 3EJKA 1BC8C 4MEXF 3KP5A 3WTVC 4MGYE 1BI2A 5KHIA 2CQKA 3I53A 3V7SA 2R7FA 4D0PA 2IW5A 4EWDA 2PAMA 5DV5A 1MZBA 1ZRCA 3MPBA 1NHAA 1GHCA 4EROA 2WV0A 2P5LC 4HLXA 1FOKA 5FPZA 1KYZA 2F5CA 3QU6A 2DQLA 3DXJF 1U8RA 3W6JB 2ISZA 2VBXA 1RC6A 5JCTA 5HS9A 1R58A 2PLYA 4P96A 1YYVA 1F9NA 1ZGJA 1OD5A 3H9AA 1P4AA 2XRNA 3I59B 4HN1A 3FMSA 2GZWA 3RKXA 1V70A 3DL3A 2FBIA 2IA2A 2V1DA 1CAXB 5FGMA 4TV7A 3GFJA 2IXIA 2G7UA 2QQ9A 2IXHA 3KGZA 4WZCA 1I1SA 2E7XA 2EWNA 3I59A 3NW4A 4XSZF 4EWEA 4AIHA 4L9VA 1CAXA 4BHCA 2XHKA 3KP2A 4YIFA 5KHHA 4F8AA 4I02A 2DT5A 3ST7A 4WK8F 1IRGA 3BPVA 5D6EA 2HZTA 5E17F 3FXRA 4U0WA 2GIVA 1J3PA 1NYWA 4O9EA 4UBGA 5I93A 4OMYA 2B9UA 4ZH4F 5FQ0B 3UKNA 4XSXF 5JR3A 5CVIA 5HI0A 4ZU7A 2R7DA 2M5WA 2YX4A 3FFQA 2PMHA 2XVCA 3O6BB 1J59A 5FQ0A 4LEJA 5CVUA 5BXXA 1HBXG 2P6TA 4IEQA 3BJOA 3SXWA 3WTZA 2CFXA 4ZYEA 4X6RB 2DU9A 1R00A 1USSA 2VT3A 4I0AA 4LB5A 3HT2A 1J75A 3BWGA 1HW1A 2KXLA 2ZCWA 4A0ZA 2RVCA 3JAMZ 1H9TA 3NQOA 3EHKA 5J7MA 4EJVA 2LDUA 4KU7A 4BQAA 4EM0B 2LF8A 3RKYA 1BOAA 3MFKA 1D8JA 2QENA 3GX4X 2QQBA 3GUDA 1TW2A 3F8NA 2IXLA 1ZZ9A 1L0OC 4MQVA 5K5RA 3KP6A 1CAVB 2XUBA 4MTEA 4XFCA 4S05A 4OLLA 1ZZCA 4HOBA 1KQ8A 4LFUA 2IJLA 2DPUA 3QU3A 4KL1A 1YW9A 2ESNA 1NZCA 3TDZC 3LAJA 1CAVA 1HXDA 5BMZA 3I58A 5E16A 2MNGA 3J81K 1UHMA 4WF2A 1B4AA 5D5XB 3I71A 3ECOA 1CGPA 4KDPA 1LVAA 1SD4A 1QQIA 3BZ6A 1STZA 1IZ1A 3MQ0A 2PMUA 2ESHA 4DNCA 3QPHA 1SMTA 2FNPA 3GYDA 4YARA 2A3SA 2CV6A 2P6SA 3CUQB 3F8BA 5JAXA 2ZXJA 3E5UA 4XFGA 1DGWA 2OYZA 2FF4A 4R1HA 1Z05A 1V4RA 3DEUA 2BNOA 3LQRA 1XMAA 3EYYA 3CUQA 2PEXA 4N9IA 3LAGA 1J9IA 3ELKA 4NVPA 2VQAA 4YSFA 1U6GA 1BIAA 1IUYA 3LSTA 3VODA 1OYIA 1BI0A 1ON1A 2IP2A 2HKXA 3PFIA 3SQNA 1WLTA 3U10A 1IN8A 4HW0A 3HOSA 4FAHA 2HTSA 2L4MA 2PN6A 1DZRA 4EMSA 3KMHA 4HLTA 2EAAA 1ZNPA 2WFPA 1XE8A 3R6SA 2GC0A 2X4HA 5BV6A 4A0XA 4XF1A 2OQGA 1P4XA 3CDHA 3TO7A 3NJZA 2DQRA 1S29A 3GZ5A 3K69A 4P5OA 2H09A 4LLLA 4M71A 5HLGA 4OINF 2JSCA 3ELNA 4WVZA 1FSEA 2OZUA 2OZ6A 1DGRA 3FX3A 3J80Z 3HTUA 3QOPA 3ZMUA 4AVBA 2P5KA 1WWXA 1UPIA 1LDJA 1XD7A 2DFIA 3IRRA 2PFBA 3EYIA 1LDDA 4H7LA 1PMIA 3CEWA 2M45A 3SXYA 3KSCA 1UB9A 1BN5A 4A6DA 2GC1A 4ENJA 3KZYA 1LKNA 2W25A 3GO5A 4ESFA 4ONUA 3VOEA 4I0BA 1UIKA 4PIYA 3BCWA 3WTWC 4MH0E 1EH6A 3I64A 3FXQA 3P9KA 3FM3A 4RB0A 3TOBA 3DFGA 3HSEA 4Q29A 3K1MA 4Q5SF 1I5ZA 3S2WA 5ICGA 3E6BA 3BP8A 2MPFA 4YFXF 1O5LA 2DAOA 1RUOA 4KIFA 4AWXB 4IETA 4XF0A 5DCMB 3EUHA 4M74A 1YW7A 2Y0OA 2B0LA 1Z1DA 1H1MA 1W7PD 3H1YA 1ZG5A 2V6CA 3U1DA 1QZYA 5DCMA 4I7HA 1GXPA 2IXKA 4ZYHA 2XV4S 2K4JA 2XAJA 3LA7A 4QM9A 5CVJA 2FSWA 1NXMA 2H6CA 4LD5A 3IDBB 4KIGA 2W24A 1EPZA 4WCGA 3N97A 1EH7A 1IN4A 1RNLA 2FQ3A 5CJ9A 5DUKA 1UCXA 2Q1ZB 2J5PA 3IC7A 2R3SA 2BV6A 2JT1A 1E2XA 3H7JA 2OAZA 4KN4X 3R0AA 1TQMA 5KHGA 4L9TA 4G6QA 4HYEA 1SD5A 5D8KB 5H6QA 5KK1A 3WTUC 1QY4A 2IVMA 3FWEA 2L4AA 2FQPA 2A6HF 4MGKE 5E18F 5L3BA 1RUNA 1FBSA 3F3XA 3FE5A 4XF4A 3D0SA 1LJ9A 5EZWA 1ZAOA 5EEHA 4WWCA 2ISYA 5A2QK 5KHKA 2O61A 3J80K 2OA2A 1UW8A 3F23A 3HRMA 1XSXA 2Q2EA 5HLHA 3O2PE 1B1BA 1F5TA 4HBLA 1G6NA 2Y75A 2XROA 2YX7A 4MNUA 5JFRA 4ESBA 3ROUA 1FX7A 4G8XA 2C0ZA 4ZZDA 1TQPA 4E70A 1R22A 2HS5A 4KWLA 4IEVA 5LRSA 5LEJA 4O3MA 2B8MA 1BI3A 3I54A 3FZ3A 3I0TA 5JSRA 3NL1A 4MHGA 2V9VA 4YIIA 4QGLA 1ON2A 4F7ZA 4PZJA 3H7YA 2IPQX 3HSFA 2RV8A 2DCTA 3LA2A 2ACJA 3C7JA 3EO6A 2P17A 4E2GA 2D5HA 2DO7A 1BM9A 3WG9A 1FY7A 2F5DA 4LB6B 3RKWA 4CYDA 3NEUA 4IPAA 3OTFA 5FD6A 1RI7A 2VOPA 2W84A 2HYFA 1S3JA 4IRHA 1G3TA 3E5XA 4B8XA 3GEZA 1P6RA 1SFXA 3ECHA 3M70A 5KHJA 4FBFA 2MLKA 5IT9K 4RGRA 1XB4A 3HUGA 1SFEA 4M6YA 4I01A 2KJCA 1C0WA 3N4MA 2Q0AA 1EP0A 4HVRA 1D5VA 4META 4BAYA 3HIFA 1O7LA 4QMAA 2GXBA 1IN5A 1SFUA 3RPUA 4TLFA 2OBPA 5FO5A 1GQGA 1YQAA 4IEWA 5JSPA 4ZYDA 4Q0UA 5ILVA 5D6FA 3T0YA 4ZZLA 3WW2A 5CADA 1ULYA 4UXNA 3MAJA 4RGUA 4Y17A 4HN0A 4L9JA 1TNSA 5TJJA 2DPDA 1JUHA 1IPKA 5BPXA 3LWFA 4GYIA 2P5VA 3P9IA 1BC7C 2IXCA 2ELHA 3TGNA 2Z69A 1Y9QA 1KQ0A 1HW5A 3MZYA 3ZMTA 1MKMA 4CXFA 1YFHA 4HLYA 2L02A 3RIRA 5D5VB 3KEQA 3QPTA 2RKHA 4P55A 1ZLJA 4QX5A 5BS6A 1IPJA 5AIQA 5CU1A 4M9ZA 1QNTA 4R52A 3SHRA 1IRFA 1DDNA 4LA2A 3DF8A 1X3UA 3JTHA 4LG0B 4XFHA 2WC2A 4Z07A 1KU3A 3O3KA 4YFNF 4N9HA 4L5IA 2D1VA 2P7VB 4I98B 4IEOA 3TNPB 5HLIA 3V7RA 1UHWA 2G7HA 1X8EA 2QDRA 1J5YA 4LG0A 3MCZA 1XSVA 5ERIA 2DTRA 1ZG3A 4Q47A 2XKPA 1USTA 5E1XA 2O3FA 2FOKA 1MD0A 2MC3A 3J81Z 3U0ZA 2Z9OA 4QXKA 5J3UA 3GBFA 5DEQA 3FHIB 4YNIA 1FT9A 2BE5F 1R5GA 2EFOA 4IRIA 1E17A 4HV5A 3ISPA 3KGLA 4RAZA 2D1HA 3B73A 3KLOA 5BUVA 3HYIA 4GYGA 2F4PA 1BIBA 5D4RA 3NSTA 3MEXA 2ATFA 5DD8A 1D3YA 2M87A 2DK8A 2QWWA 5E20A 1TBXA 1SQ4A 2UY8A 4IF4A 2UXXA 1SMYF 2EK5A 2VBWA 5FCCA 1L3LA 1BBYA 1LRHA 1W5SA 1YG2A 4IESA 3I4PA 4I09A 5AIPA 3C18A 1U5TB 4G7ZF 2GA2A 4CICA 1YLLA 5LBQA 3H8UA 1F4KA 3IIAA 4IEUA 2JRTA 1EY2A 5EFUA 1I1GA 2XLGA 2RQPA 3OD0A 1K78B 5J6XA 3IDCB 3LA3A 3S7EA 4RS8A 1X8MA 1W7PB 3LZZA 1U5TA 5T3NA 5D8LB 4H0EA 3WTSC 2VN2A 5CVVA 4PGGA 4JVAA 1HQCA 4HA8A 4JQFA 1K78A 3ZPLA 4IEPA 4ENNA 3F6OA 1W7PA 3HRUA 1FZPB 3UKVA 2CG4A 3L7WA 2ZMEB 3C1DA 5I0RA 3SFZA 1H9GA 1Y0UA 5ICCA 2V1UA 3DKWA 6PAXA 3RDIA 4ESJA 2VPVA 4XFIA 4CHUA 4MZUA 3BROA 1DPUA 4KFCA 2JPCA 2ZMEA 3DN7A 5BQTA 1SEFA 4K8FA 3BB6A 2FA5A 3WGHA 4UBHA 4I2OA 4GGGA 2Z3YA 1HSJA 5KBFA 2EFWA 3SZPA 2PAEA 4FAGA 5D1IA 1R1TA 1XGSA 4AQ6A 4HSJA 3QP6A 2MHFA 3ZN0A 3J7AO 1OR7A 1UFMA 3M1EA 3E5QA 1KU2A 2KIFA 2Q0OA 3SCFA 1XE7A 5J8CA 1Q5OA 2WWYA 4HX8A 3IHUA 2XLAA 4ENMA 4EGZA 3F6VA 1WSUA 1A04A 2OA4A 4LGWA 2RNJA 4PDKA 3D82A 3LOIA 4KICA 4HAMA 5LGNA 3WTTC 5FFXA 1G3WA 2A61A 1U12A 2MH9A 2CO5A 5L3GA 2PFWA 1Q43A 1KYWA 3U2RA 4Q0SA 3BOQA 2W85A 2XLFA 1TW3A 3T5XA 3WGIA 3B02A 4WBBA 1JXSA 3O14A 3K1PA 3CJXA 2VBYA 3LWCA 2P8TA 2VONA 1OKRA 1V3FA 5CVRA 4AVPA 5FPXA 1W5TA 4M9SA 4U88A 3T8TA 4G7OF 1GVJA 2EA2A 5JR7B 1T0FA 3SCGA 1O3TA 3F72A 3L09A 5L3FA 1WRJA 1YUDA 4JV4A 4RB2C 1J2XA 4A5NA 1YIOA 2XKOA 3KE2A 1Z9CA 2CGPA 3IWZA 4ON0A 3H92A 3Q9VA 2KRFA 2XGXA 1H1IA 3HT1A 5LGTA 4MV2A 2EVXA 2ZFWA 3FMQA 4BYYA 4XETA 5HDKA 5ILSA 3ACLA 2O6GE 3WW4A 4XFFA 3RTRA 1X82A 5A2QZ 3SMHA 1YWKA 4A12A 2BNNA 3H3UA 4A5MA 5FLHA 3CTAA 3E3VA 1WQ2A 3QP5A 2VT2A 4HVQA 2FNAA 2RGVA 1QO0D 1IF1A 3PQKA 4IEZA 1LR5A 2E7WA 4QWQA 2MA3A 3LQQA 1XMKA 1DP7P 2V79A 5K5QA 2VODA 3NVCA 2LNBA 1XDUA 4HF2A 1R1VA 3UKTA 3CF6E 2A69F 3AAFA 2XAQA 4HF0A 3KP7A 2Z99A 4S04A 2NS0A 2VC0A 4NHJA 3RPQA 1QXJA 2C6YA 4FX4A 2ZBKA 4MGIE 4XF3A 4IERA 1RIOH 2EA4A 1S7AA 3CO6C 1T38A 4WXHA 4N0BA 3TQNA 4AIKA 2O03A 3P9CA 3TDUC 1I6XA 2VBZA 3MWMA 1YS7A 4HX4A 3M8FA 4ENKA 2QLZA 3BPXA 4XFAA 1R36A 1CAUB 2X0LA 5FLJA 1IXRC 4BXUA 2FRHA 1LQ1A 4E2QA 1QWRA 2ZNZA 1WI9A 4HDUA 3H1MA 3BDDA 4HQMA 2QVSB 1WA4A 4CO8A 1OMIA 2GU9A 5J8FA 1CAUA 4UNOA 4QGNA 2BGCA 4U7DA 5IT9Z 1ZG1A 5I91A 1TQIA 2NNNA 2XAFA 4CDGA 1HKSA 3BJ6A 3K0LA 4Q0VA 1GXQA 1ZVFA 4Q0PA 5FB2A 4M72A 4WXDA 4UV9A 5DUIA 2CWEA 1QZZA 2PHDA 1T6SA 4XRFA 3PVBB 2BYVE 4YG2F 4Q48A 1VR3A 1WGPA 5BPIA 5C8WA 1L3JA 3G7DA 4EM2A 5AONA 3EETA 1HSTA 4P9FA 4A6EA 4OIRF 3WGGA 2L01A 1ZZ8A 1X7NA 3C3VA 4LJZF 3EBRA 2NRAC 2PYTA 3HOTA 2DW4A 1AWCA 4LK1F 5FFZA 5LHIA 2KIUA 2Q30A 2XL9A 3CUOA 2QUFA 5I8YA 1QGPA 4KU8A 3VHRA 4UVCA 1XGOA 1MDMB 3WW1A 2JPBA 3JTGA 2M8EA 2OQRA 4Q0QA 1PP7U 4MGZE 1GQHA 4MX3A 5H20A 1MDMA 4O5VA 2QVOA 1FBQA 3KFWX 3ZMZA 5D5UB 2ET1A 1MJBA 2D5FA 4D7SA 2OZJA 4AXOA 1U3EM 2HGCA 4MEYF 3QRFF 2ETEA 2EJRA 2LSOA 2NYXA 4EJOA 3Q9SA 4OOIA 1XDSA 3DPLC 1K7AA 1FPQA 1ONVA 1YW8A 1OYWA 3K1NA 2K7LA 3IL2A 3OF1A 2D2WA 4OIOF 3HHHA 2K0GA 4WX9A 4YYOA 3FJSA 4IEXA 2E9QA 5JSOA 1EH8A 1R1UA 1TNTA 3L00A 4OMZA 2EB7A 2QYOA 4EV0A 5BPDA 2MBFA 3WU0A 1KU9A 1Q1HA 3G3ZA 2HR3A 4JK1X 3HSRA 3RJPA 2UZKA 1LB2A 2CW0F 5HOOA 4Q4ZF 2PG4A 1FXZA 5DD4A 1J3QA 4UUVA 4QGMA 2HKOA 3CLPA 3RNSA 4L2NA 3F8CA 2Z5UA 1Z6TA 5E8GA 3RI4A 2K27A 1VJ2A 1G4DA 4LULA 1ZZ6A 2Q4SA 2EV0A 4LLGF 4XLNF 3RYRA 3ES1A 1K79A 5E1ZB 2IT0A 3BU7A 1IXSB 3V8KA 2AS5F 5FDBA 1BJAA 1K6OA 2MLGA 5IT3A 1ZRRA 1CX4A 2O8XA 2FBKA 2DI3A 2V09A 2VOOA 5E1RA 3C3WA 4IRGA 5DYMA 2Z2SB 4L5JA 3FM5A 4KT5C 3F8FA 2H27A 2HDCA 2K86A 2XAHA 1OPCA 3ERED 5LRRA 5FD5A 2EFQA 4ASNA 3IWFA 3ZMSA 3SCHA 4LLOA 1FSHA 3CUQC 1O3RA 3CO2A 1ZYRF 3LFKA 3TO6A 4G7HF 1Y3TA 3ZMVA 3S0MA 1LNWA 2FMYA 3HRSA 5K1YA 2RC4A 4OIQF 2IA0A 2UWMA 4GXOA 1TQ5A 3ZQ7A 2M30A 2QCSB 4O9GA 5LHHA 2CAUA 2F2EA 1XN7A 2CAVA 2HQRA 1YFXA 2LKPA 2RDPA 3JSOA 3JZVA 3TKYA 4LK0F 1B9NA 4MUVA 3GLXA 4U7BA 4EQQA 3ZDSA 1ZLKA 4XBFA 4HZFA 4J1WA 3R0JA 1SD7A 1QBJA 2GXGA 2G9WA 4ZU5A 3Q5FA 2QQAA 3IRQA 2GH2A 2NNYA 4LMYA 5JHUA 4PIZA 1JHFA 2HFHA 1UIJA 2DLLA 2KJBA 2LF7A 3T1BA 1CF7B 3DP7A 2PTMA 3OCPA 1B59A 5I0UA 1FWZA 4P9UA 2YPRA 2A5YB 1FYKA 3GW2A 3T8RA 1CF7A 3WW3A 3GVAA 1TLHB 1B9MA 2PBIA 4G94A 2EA7A 5TRDA 3DV8A 3KETA 4IHSA 3JSPA 3L2CA 1FC3A 2BBYA 4B09A 2D45A 1ZARA 3GYHX 4KYWA 3L2HA 2KIMA 3PLQA 1SFNA 1QXRA 5H6RA 2A07F 2PHLA 4EJUA 4YFKF 1FNNA 4FHTA 4XFBA 4IJAA 3ABUA 2PI0A 1UCRA 3FMRA 5DDGA 3I7DA 4HF1A 1R23A 3BJAA 1JHHA 3IKVA 1R7JA 1PDNC 2JTVA 4UVAA 5J48A 4J1XA 4DQ2A 4HMZA 3SHFA 2PQQA 2XAGA 1PP8F 5HS8A 3BALA 1P4WA 1O3QA 1S7OA 5K8SA 4Y15A 2ZJ2A 4B29A 4KMFA 1JGSA 3V7CA 1PM7A 3M3IA 1S6LA 2IXJA 1REPC 1O3SA 2XASA 2FBHA 3WODF 3P7NA 1LDKB 3ES4A 3K9TA 3F22A 4O6JA 4M6XA 3ULQB 1RL3A 2QM3A 1Z6RA 4PCQA 3MYXA 4WXCA 4BH9A 4AVAA 1J7KA 4HVOA 3DPTA 4BHPA 3FHZA 3LAPA 2HQNA 5I8TA 4CGZA 1ZN2A 4JTNA 3ML6A 3ZMDA 1RZ4A 4LUMA 3GFLA 3H50A 3GXOA 3EQEA 2DK5A 2ZO4A 5F1RA 3OOPA 4EVIA 3QACA 4A0YA 1O7FA 5HS7A 1B6AA 3M8EA 4K2EA 4Z82A 4RB3C 1QPMA 1F1ZA 4X6QB 2O1QA 5LLQA 2QJVA 4RGSA 2XL7A 4JTOA 4AD9A 3KEOA 1G3SA 4JBAA 4AVCA 5LGUA 1NE4A 2QBYB 4FX0A 4KMUX 1XGMA 3U11A 2K9ZA 3GWZA 2VE8A 2I45A 1IN6A 1ZZ7A 1HKQA 4NQWA 1O57A 4XF9A 5AVPA 3FXUA 4RAYA 2QBYA 2K4BA 2K02A 2STWA 4IHTA 1D8KA 2PA7A 4MTDA 3PNAA 2L3DA 4I3PA 1T2KA 2NAZA 3E6CC 1KGSA 4BHBA 4EJTA 3ABTA 3KP3A 4MQ9F 3K2ZA 2FMLA 3PQJA 2OPKA 3HQXA 2YU3A 4R8HA 2O8QA 4RB1A 3IBMA 1G3YA 2BEOA 1O5UA 5ED4A 4LUKA 4L0YB 4OFGA 3R60A 4UHTA 1ZZBA 3W6KB 1NE6A 3SZTA 2O0YA 4P9GA 2PAKA 4GULA 4MGRA 2H94A 4UV8A 1LEAA 4FT8A 2EV5A 5FLIA 2ETHA 4HDVA 4L9NA 2W57A 2YR2A 1FP2A 4PIXA 1HKTA 1YFWA 3V4GA 3ZN1A 1U78A 3DQVC 3JAMK 2OU2A 2FXAA 1HW2A 2YSRA 3NRVA 4L0ZB 1O4TA 2HWVA 5FLXZ 3CJNA 4XEZA 5LEKA 5BY5A 2ET7A 3JW4A 1CAWB 1H0MA 3TO9A 3REOA 1ZRDA 1MJAA 3VEPA 2GC3A 2V1XA 2DBBA 1LEBA 2A6EF 2A68F 3H1WA 4OIPF 3GF2A 3MZHA 1CAWA 4L18B 4L11A 4ORFA 5E1WA 2GA1A 1DPRA 4EGYA 2F5FA 1T98A 1ZGAA 3WU1B 1FBUA 4QLCU 4U0YA 1U2WA 2EFNA 2ZKLA 3HHGA 2PJPA 1ZHFA 3U9GA 4HV6A 2FE3A 1J1LA 3M7GA 2N7GA 5L3CA 1VP6A 2KKOA 1ZX5A 5I8SA 2TDXA 3KP4A 3BY6A 1DZTA 3KCCA 4AIJA 2VE9A 1T39A 1YFYA 4D7TA 3OV8A 5JI6A 2D93A 2FU4A 1EV7A 1YHFA 3WTXC 3WTYC 2ADUA 5ICEA 2D40A 4KWJA 1XSDA 4PJYA 5HDGA 2UY9A 3EQLF 3CO7C 3BPZA 1P2FA 5E8IA 3RYPA 4A2UA 1XRUA 3D0JA 3VFZA 4G9YA 3ZP5A 3FF5A 4PGHA 1ZRFA 2HJIA 5HVQC 2QNKA 1W4MA 2P7CB 2BNMA 5KVRA 2FEZA 1BI1A 4QM8A 1Z91A 1IXCA 2H6BA 3MDPA 4GO1A 1J58A 4EJWA 5EEGA 4KUMA 4ZU4A 2Q8KA 4R79A 3FZVA 1ODDA 1FI2A 3GFIA 5ILUA 4HQEA 4BIFA 2M1BA 4KNYA 1XCVA 3F21A 3E6MA 4IEYA 4EM1A 2OD5A 1XCBA 2AXLA 2GAUA 1FP1D 5HDNA 1SD6A 3G73A 4EWAA 2E1CA 2MH2A 1YO5C 3V8LA 4BNCA 5C6CA 4KIBA 4UXAA 3TNQA 3QAHA 5FLXK 1RGSA 5CLSA 2ZKZA 3HTSB 2COMA 3S7IA 1KQ9A 5CYVA 1YLFA 2PQ8A 2Y48A 3GFMA 5BOXA 1R5HA 2HEOA 1AOYA 4XLPF 2VC1A 3CLOA 2P4WA 5DCFA 1KU7A 3CL1A 5I0SA 4E2SA 3R61A 3E6DA 2CSOA 2GC2A 3IKTA 2IA1A 5LHGA 1Q3EA 3RZZA 4AQ2A 2UXNA 1U5TC 1SAXA 2Z33A 4KWKA 3H3ZA 2B5HA 5D4SA 2HTJA 4DINB 2UYAA 2QZ8A 2VECA 2IC1A 5I0TA 3KLNA 1YS6A 1IAWA 3ETQA 2JZYA 5F64A 2H0VA 3R4KA 3OGJA 3WE3A 4KA4A 3E97A 1FYLA 3NKTA 4GCVA 4Y13A 5ICFA 2VXZA 4IXAA 1VTNC 1FLIA 1OFNA 4U0VA 3EDPA 5JVTA 2WTEA 1DUXC 2HYGD 1UD1A 2UYBA 3M9AA 3GZ6A 1PUEE 3L9FA 1Z7UA 1IN7A 2ZNYA 1FYMA 4LA3A 2EFPA 5L3EA 1J0RA 1I27A 4LLNA 1TTYA 4NB5A 2CYYA 4ETSA 1WKMA
chains in the Genus database with same CATH superfamily
1Q8QA 3SEPA 5CKMA 4KN7X 2JWTA 1W39A 3RYKA 3B9IA 4XACA 4CZZA 3V8JA 5FP7A 3PUHA 4Q4W3 3F8MA 5H9SA 1UAAA 2R5YA 1JE8A 1DIWA 2XWJB 2MD5A 3WE2A 3IH4A 5FY0A 3HRTA 1K5MC 3GDBA 1R1A2 4M9XA 1VPHA 3GJBA 2WADA 1YTYA 3MD2A 4BJ0A 3CP8A 4Z6YA 4Z2YA 2KLOA 3ZXLA 2DODA 1F5JA 3SKVA 1G9CA 5J1UA 3W59A 5AC93 1J3RA 5IVJA 2CMPA 2MG4A 1RMU3 2D6MA 3S57A 2HLEA 4FPOB 4UB8C 3RWNA 3ZFGC 2KDZA 4AUXA 4RGXA 5LBBA 1IW7F 4GAZA 5FXWA 1ZBE3 4CDUA 1ASJ2 3EJKA 3KP5A 5IVFA 5KHIA 1F4AA 4XHXA 2CQKA 4D0PA 3M2MA 4AL9A 3BIEA 2PAMA 2VNOA 2CV0A 2XH6A 5J4YA 2DOEA 2WV0A 2P5LC 1KDMA 4XDOA 1RUG1 1U8RA 4D69A 5GADJ 2ISZA 5JCTA 3WUDA 4NIDA 5HS9A 4XURA 2KMUA 3F2ZA 5L9BA 1YX3A 1OCOH 2A1XA 4A6SA 1XS9A 1YYVA 1F9NA 1ZGJA 4CZCA 1IZ3A 1OD5A 2XRNA 4ARXA 3FMSA 1V70A 3MMYB 4LR4A 5FGMA 1V6JA 4CU8A 5F32A 2DVDA 4BJTA 4XBQA 1I1SA 2GSYA 3I59A 2N8GA 4AIHA 3BCAA 3KZIC 1GUIA 4B4CA 1CAXA 2XF6A 3NO8A 2J1EA 3WP6A 1OCPA 4YIFA 2DT5A 4MOAA 3FHAA 3CC2I 2HZTA 2LR8A 4LNVA 2VMHA 5C71A 1VQ8I 5FQ0B 3OPZA 1MQTA 2ZEZA 3FFQA 5A33B 3HZJA 3AMHA 2WO1A 1H89C 2XVCA 3ZQHA 4LIUA 3W2WA 2VBPA 3CJIA 4IEQA 3BJOA 3KHCA 3L1PA 4X6RB 4I0AA 1NCRB 1O91A 1YRZA 3AYDA 2ZEYA 4AEKA 1HW1A 2KXLA 2ZCWA 2NPIA 1XOYA 1OF3A 3VBRA 2RVCA 2BVMA 1D2SA 2VOKA 4Q1RA 4KU7A 3J8F3 4Z1VA 1BOAA 3KLSA 4Y26A 2QENA 3ZFFC 4M3DA 4YW7A 3F8NA 2IXLA 2CDOA 1LFPA 4PFPA 2VR4A 3K4LA 3KP6A 1CAVB 1XSQA 2WZR3 1DLLA 1ZZCA 2VZQA 1KQ8A 4AEDB 2IJLA 3QU3A 2DA4A 3WF4A 2ESNA 4KITB 1NZCA 3TDZC 3LAJA 1HXDA 2AYHA 3ZOIA 3W2VA 5L19A 3J81K 4WF2A 5D5XB 3L2QA 3VDDA 3DEMA 4KDPA 2ZGTA 3AMPA 1ZQ3P 3CESA 2JE9A 1IZ1A 2PMUA 2E33A 2AQEA 4M3FA 1VAVA 5JVGF 2FDHA 3WDYA 1SMTA 1HRV3 2FNPA 2HZDA 4CPBD 4CE8A 3JD73 4CXYA 2X6WA 1V9U3 2RR12 2ZGMA 4CA9A 5HV4A 2ZXJA 3E5UA 5K4LA 4LOCA 2FF4A 3G2BA 2BNOA 3R4SA 4M4PA 4NHMA 3LQRA 2PEXA 3MKLA 4N9IA 5C33A 5ACA2 4NNJA 1VBB1 3C8XA 3WG4A 5L7OC 3JBG2 5DM7F 5FKCA 1K5JA 1X2NA 1OYIA 1WLTA 3U10A 1OXCA 1BEV2 1DGWY 2HTSA 2L4MA 1DZRA 3SLIA 4UF0A 3TWIA 3R4UA 1ZNPA 3POFA 3ZIWA 1XE8A 3HOYJ 1DQ4A 1OLTA 3N9LA 1GV2A 1HLCA 2HOSA 5BV6A 1T6BX 2FOWA 3BZKA 2IGKA 5AFEA 3GZ5A 4P5OA 4UUSB 1DU6A 5HLGA 4H4KC 4LO5B 3AVRA 2B42B 5K7ZA 4WVZA 3OYIA 2COBA 5M5YJ 3FX3A 2W68A 1BBT1 3J80Z 1ZR2A 3HTUA 5T5LA 3QOPA 3JRHA 4HRIA 4GWNA 5JI9A 1MMNA 1UPIA 3ZSKA 2DYCA 2PFBA 4B3NA 3CEWA 1LODA 2ZMKA 3SXYA 4Y52J 4A6DA 4YZ4A 1N1SA 4FSJA 3VBFC 3GO5A 4ATEA 4XBNA 1QNYA 4ONUA 1LNSA 2XXZA 1OOPB 4PIYA 3BCWA 3CDLA 3H8OA 2RMU2 3WTWC 4MH0E 1EH6A 1FOWA 2ORZA 3TOBA 4A3JJ 3TB0A 3HSEA 3ILRA 3K1MA 3AG3H 3ZN4A 2MPFA 1H8TA 3LFUA 2G9ZA 1QOTA 3TEXA 5GPCA 4XAAA 3S16J 2HWE3 3DKYA 3ZO0B 1LESA 1W7PD 2DA5A 3FBYA 1S0BA 1R4NB 4GH4C 2V6CA 1HQLA 3N7LA 4XUOA 5F3IA 2K4JA 3I3QA 5CVJA 2OC6A 2B9VA 2QCOA 2BERA 2W24A 1EPZA 3N97A 1LGNA 2KR2A 2FQ3A 5CJ9A 5DUKA 1UCXA 3IH3A 3K2OA 2R3SA 4RMNA 4PSWA 1E2XA 1UY4A 3ABLH 3T0AA 3S3NA 2RDSA 2GLOA 1TQMA 1KONA 4HYEA 3Q3SA 3WTUC 2W3JA 4GA9A 5JR2A 5JLXA 1UY0A 1GU3A 2Q2EB 4YZ1A 2ISYA 5A2QK 2YG0A 4SLIA 2O61A 3J80K 2J1VA 3CJQB 2BW3B 4D6SA 1F5TA 1S5LC 3OYWB 2JDUA 1QH6A 3VLBB 4MNUA 3TL4X 2K46A 1WZ2A 1REFA 3ZYGA 4G8XA 3CCYA 4ZZDA 3H0DA 4QQ2A 1OLRA 4NAOA 2HS5A 5D8AA 2ADEA 2D43A 5C70A 5LEJA 3I9V2 2EQRA 1BI3A 4CCMA 1JH5A 2RG4A 3FZ3A 5KAIC 2XJPA 3LSGA 1RUF1 3NL1A 4Y1YA 4YFZA 1UY1A 1ON2A 1JT0A 1W6MB 1VAKA 3HSFA 4E7ZA 3L2UA 4MFEA 5C4WC 2P17A 1HRI2 1PIV2 3ZXGA 2F5DA 2CV2A 4DYQA 2DU0A 4IPAA 2Z5WA 2KZGA 3BKZA 1WD4A 5KNLA 3OIOA 1AX1A 3E5XA 1EV13 1U8BA 3WSOA 1HB4A 1P6RA 3M70A 3G1MA 3LSMA 3J9SA 4FBFA 5IT9K 2WWUA 4RGRA 2B63J 3PJRA 1C0WA 2DJIA 1FAYA 3RS6A 3G1OA 1EP0A 4HONA 1N3PA 2UUZA 3HIFA 1O7LA 3CCEI 2GXBA 5CZKA 2YFUA 4Y20B 5E89A 4IEWA 4X8PA 2H1LA 2VGDA 4IL6C 5F7UA 1HF0A 3IH2A 1W9SA 2X5IB 3EXUA 3I55I 1BR1A 1WGXA 4UXNA 4CDQC 4Y17A 2DPDA 1LENA 2DCEA 2X09A 1V0AA 5BPXA 3P1IA 1UWWA 5EIYB 1FOD2 2IXCA 2ELHA 2A71A 3UGGA 1Y9QA 2HYXA 1HW5A 3MZYA 3ZMTA 3VDAA 1MKMA 3GLLA 1LHWA 1UYZA 1K83J 4BJ5C 4CXFA 3V56A 2RKHA 4P55A 2D6OX 2Y0SA 5BS6A 1PO23 2DFHA 4OWRB 2GNBA 1DDNA 2WAEA 3DF8A 3JTHA 2X1EA 2JRMA 3OYNA 3Q8BA 1TWCJ 4OULA 1BJQA 3CMEI 3HOBA 1SCRA 4QDQA 4ARYA 1UHWA 3ZSMA 2QDRA 4LG0A 2VMCA 3MCZA 3RG0A 2BV4A 4QD2A 5A6YA 4Q47A 2OJED 2XKPA 4P9JA 1USTA 5E1XA 3POWA 1TMF1 3GBFA 4C3JJ 3S1MJ 1R5GA 5K7FA 1V00A 4JP0A 4HV5A 2L9LA 3KGLA 3VSLA 4FCAA 4YW5A 4XC9A 1YI9A 4COZA 4GYGA 1UX6A 1YHQI 1J83A 3NSTA 3MEXA 1D3YA 4Y5TA 1W90A 4JGYA 2VMDA 2YFZA 2BBAA 1NKGA 5E79C 2UY8A 3U21A 3G71I 5JZGB 4PDWA 1NY72 2RS51 2EK5A 5GZGA 3HOZJ 1L3LA 4JYKA 3H9JA 2EIJH 4V19K 1YO8A 4QHBA 1PMJX 4Y3OA 1AJOA 4NPMA 3I4PA 1SLLA 3PIJA 2LW8A 1YNAA 1YLLA 2VCMA 1UX7A 3IIAA 4IEUA 3S2HJ 3LOBA 1I1GA 3ZQLA 2A3WA 3MLLA 3OYGA 2CHHA 4BMEA 5T3NA 4IGOA 4Q4Y2 4UY8I 3WNXA 2W52A 3ZPLA 4ENNA 2QQWA 1W7PA 3BR6A 1W6PB 3GHNA 1FZPB 1ENHA 3UKVA 3DPUA 4XXPA 4CU6A 2GOXB 5ICCA 3IIIA 4A3FJ 2VPVA 1TL8A 3MLJA 4XFIA 2VKVA 2GALA 4KFCA 2VMGA 2C5DA 4I2OA 4HG6B 4V1PA 4LHSA 4XMYA 5FP4A 2WT0A 4FI9A 1QKQA 4F91B 3SZPA 4UW4A 1G7YA 4AQ6A 3QP6A 4N43C 3RGBA 2VPLA 3E1F1 2WV1A 3POBA 3M1EA 3OSFA 2JDPA 4EZ4A 1XE7A 1FMD1 2I2SA 1QJX1 1AXZA 3HB9A 3I97A 1Q5OA 2WWYA 4BKXA 4HX8A 3IHUA 2RS12 2XLAA 1RR8C 1R081 2OA4A 4LGWA 4PDKA 3AX4A 5LGNA 2HQAA 2DF7A 5L3GA 2VNRA 3CCVI 2VZVA 3T2TA 1R093 1AR71 3E1SA 3NAPA 5A7QA 4MHRA 3B02A 4WBBA 3M7AA 3KYCB 2HBTA 2CGNA 5IK8A 5C44J 3RI8A 1TEIA 1IQDC 3S3OA 1JUMA 1ZK8A 1OKRA 4AVPA 2VPRA 2WNVC 5A6QA 3KT4A 3T8TA 4G7OF 1JYIA 2E7QA 2GNMA 3HEIA 4KG8A 1KDKA 2RR13 1T0FA 3SCGA 2VVFA 1WCDJ 1WRJA 1ZYBA 2R0HA 4RB2C 4ZZ5A 3MF6A 4A5NA 4XIOA 2XKOA 2P37A 2G0EA 2Q5TA 3MW2A 1Z9CA 2CGPA 4PSXA 3THTA 2MSYA 4PF1A 1MS8A 3HT1A 2JB8A 5J36A 1QHDA 4AFAA 4AGVA 3WHUA 3RZDJ 3S6PA 1RUJ1 2O6GE 3WW4A 5G04L 4XFFA 3RTRA 1FPN1 3SMHA 2DA2A 4ZC3A 4QXCA 5DDJ1 3H3UA 1RUI2 2EIEA 5FZEA 5FLHA 4XCAA 3CTAA 3E3VA 4AFBA 3UK9A 4RS5A 1UG2A 2ZHKA 2VT2A 2RGVA 3U37A 5HCAA 2ARXA 3JRAA 3D8CA 4QWQA 2DA7A 4YVWA 2MA3A 3LQQA 4W6YA 3QYEA 1MIJA 4CEWB 2VODA 2LNBA 3AG4H 2F6BA 3RI9A 4R9AA 4HF0A 2NS0A 2DDBA 4XVHA 4XLFA 4NHJA 2GIZA 4DS0A 2C6YA 2ZBKA 2OPTA 2YB7A 2XHNA 1S7AA 2GH8A 4UFMA 4A3IJ 4WXHA 2O03A 1WCSA 2XJTA 1KRIA 1STMA 1CONA 4CDUC 1PZ8A 2VBZA 4OAZA 4FOYA 1YS7A 4KMQA 2WN3A 1G9AA 1R36A 4RHV3 3BG5A 5JUVA 1CAUB 3OYMA 4BXUA 2BXYA 2K2SA 5LWBA 2R0QC 4E2QA 3PNTA 1OA2A 3V65A 2IAIA 3V42A 3H1MA 2P3JA 3BDDA 4HQMA 1KJRA 2VTXA 5JMCA 5C3QA 3Q8CA 2GU9A 4DEVA 3AP7A 4UNOA 4QGNA 2BGCA 3BJ6A 3LEKA 4FTBA 1XPXA 4UV9A 2CWEA 1QZZA 2XBO3 4UFIA 1T6SA 2OQ7A 1JKRC 1YOVB 2K3PA 2VW1A 2J1SA 3VZLA 4BXSV 4QQPA 2DYRH 4QX3A 5HODA 1VR3A 4R9DA 1WI3A 2WS91 1DQ1A 4JGZA 5AONA 1HSTA 4OIRF 2QQPA 4CVUA 3ZXSA 2KQRA 2A6XA 1NG7A 2BY1A 2JDZA 4COVA 1GOFA 3ZXEA 4R4ZA 5FFZA 5LHIA 3U07A 2KIUA 5I8YA 1QGPA 4KU8A 3VHRA 2VO5A 1LKXA 1XGOA 1MDMB 3N7JA 2PLV1 2VB6A 1ZBA1 2DVAA 3JTGA 1MQTC 2OQRA 4Q0QA 3F0CA 1XG1A 1X9TA 1GQHA 2P6CA 1GZWB 4GKXA 4ZXEA 4O5VA 4IZZA 3AC0A 2BY2A 1I50J 1W2UA 4Z2WA 3CJIC 2W91A 3VKFC 4HNTA 4D1QA 4IGQA 4FE4A 4UYBA 2WQ8A 2A70A 2DMTA 2LSOA 4EJOA 1U9OA 2QDNA 2HWF2 2VNGA 3VBUA 3GNEA 3VBRC 3BG3A 1V6MA 4B43A 2IEKA 2CRGA 1ZA4A 3IL2A 1GVDA 2D2WA 2W00A 1MBHA 1OD3A 3CMGA 2HH9A 5CBLA 5F27A 1EH8A 4BDVB 3L00A 4Y1ZA 5BPDA 1VQ4I 3WU0A 1ZRIA 3IM0A 2WNUA 4LK7A 1ENXA 4DW6A 4CUCA 3DBHB 2HR3A 4JK1X 3CCLI 2UZKA 1LB2A 3Q0UA 1PVXA 1VBE1 1JBCA 1J3QA 1W2TA 2RS33 1PX3A 5IYCJ 4UUVA 4JKLA 4QGMA 5A3NA 4L2NA 1G86A 2Z5UA 1Z6TA 3RI4A 2JIGA 2K27A 1W9YA 1XXNA 4LLGF 2VQGA 2Z1DA 3VDDC 3ZQFA 1K79A 2CWMA 1ND2A 1NK3P 2VBBA 3VYTB 2PHTA 3WLUA 4X0GA 5IY5H 1ZRRA 3B93A 4NJ4A 3VZJA 2FBKA 4NO4A 2AXTC 4AVSA 5GTIC 2VOOA 1LAJA 4IRGA 4L5JA 1FIPA 1SLCA 4YM1A 1NCQA 2WQ4A 1POV0 2ZGNA 4QPGB 5L36A 3POEA 3MFCA 5LRRA 3ZMSA 2TEPA 1BJZA 3I49A 1IO2A 1ZYRF 1Y3TA 4QB6A 3ZMVA 3S0MA 2DTZA 3T08A 3LFIA 3HRSA 2NQYA 2RC4A 2KHMA 1I5PA 4XOPA 1ENSA 3KF3A 4OIQF 5A6XA 3ZQ7A 2M30A 3J26N 2CQQA 1XU1A 2HQRA 4YZ3A 4HG2A 9ANTA 4OCTA 1VRH1 3JZVA 2R041 2IS4A 4I99C 1B9NA 3DGTA 4GZ9A 4BUPA 3A03A 3VUOA 2R7WA 4PT6A 4XBFA 1EAH2 3BR3A 3RFRA 5ABJB 3R0JA 2GNTA 3C7HA 2VQCA 1LEDA 2KIQA 1SD7A 4EN8B 1BVP1 1PO11 4XRMA 1XYPA 2GXGA 2NOGA 1PGL2 4LMYA 4J01A 1MNDA 4FVVA 4ZZ8A 5C3PA 3PTRB 1TWHJ 3NWKA 5C3RA 2LF7A 3FBNB 1B59A 3HPHA 2X1CA 1AKHB 1T2XA 2BWCA 3ZMOA 2R7UA 4P9UA 1JYTA 2WABA 4JX5A 2W1UA 2G19A 1B9MA 2PBIA 3AXEA 2EA7A 2H0BA 5FYVA 3DV8A 4IHSA 4RM3A 2VY0A 1FC3A 1RHI3 4K3UA 3O8GA 3CCRI 4KYWA 5L9RA 3L2HA 1DBNA 1WCKA 2JD4A 3UNPA 1X2MA 2AGSA 1Y1WJ 2LBFA 2XJQA 4EJUA 1RUH2 1ZM1A 1H8TC 3TBDA 1QJFA 4IJAA 4LBJA 3I2JA 5C3EJ 3S1NJ 1JHHA 5J48A 4PLOA 2K85A 1GSLA 2PQQA 2XAGA 5JVVA 3BALA 4CCNA 4IE7A 2X8KA 1IDZA 1YQ6A 4FASD 1C8M1 1NQJA 3GCMA 5K0UA 3M3IA 2J1RA 4BQ3A 1MVEA 2XASA 3WNMA 2NS8A 3WODF 2EXJA 5J4VA 1I3QJ 1K61A 2ERFA 2R063 3VL8A 3FUOA 5FWEA 5DABA 4IE6A 3GZAA 4IQ4A 2BOLA 4WXCA 2QQIA 4EYUA 1J7KA 3J4UH 3FHZA 3LAPA 4CGZA 3WDUA 1SACA 5F8PA 2ME0A 2CYFA 4XUNA 2V7FA 3GXOA 1GUUA 2KISA 4OI2A 5F1RA 3LCPA 3KT7A 4XE9A 4MO7A 4N7UA 1QPIA 3HNMA 3JQXA 1Z7S2 1OJLA 4RGSA 3TEWA 1IRZA 4JTOA 1MNEA 5CB7A 2YGMA 1G3SA 3M4OJ 2OCEA 4JBAA 3HD8B 1WUVA 4BLIA 4AVCA 1DYPA 2XVKA 3U11A 5IOZA 2VE8A 1OUSA 1PYVA 2HEVF 1FYUA 4WVMB 3H35A 1B35C 1W6NA 4NQWA 4COWA 4FPJA 3RZJA 2UU8A 2K4BA 4IHTA 4GALA 4YELA 5D8AC 5B4NA 3AKQA 3PNAA 2L3DA 2VMFA 1T2KA 3E6CC 1KGSA 3ABTA 1E0EA 3IMMA 5C8CA 2KDOA 2HVRA 5I0DA 4MQ9F 4YM3A 1IG3A 3THPA 1GWLA 2OPKA 3HQXA 3WR0A 2KP6A 5IUQA 5F39A 1G3YA 1O5UA 5ED4A 4LUKA 4OFGA 1JHNA 2WL1A 4UHTA 2IGMA 5K7HA 4ISRA 1ZZBA 2EH3A 3SZTA 1HJFA 1U5YA 4FP2A 2PAKA 3L2RA 2BGOA 4Y1VA 4UV8A 3OGVA 1VLNA 4FT8A 1ODMA 1NLSA 2ETHA 3VD9A 3TN92 2PHWA 3X29B 5FKLA 2W57A 1JYWA 3POSA 3O0WA 4PQ9A 2WSUA 5B2GB 3V4GA 1C1FA 5F9TA 3GTGJ 1AR61 3JAMK 2Q8OA 2OU2A 1X19A 1W0TA 3QQAA 2YSRA 5DPNA 4L0ZB 2CV1A 1WH5A 5BY5A 4YVWB 2ET7A 2HOAA 4M3CA 4BM8A 4PLMA 1UELB 4LITA 1MJAA 3VEPA 3I4MJ 3W20A 2CQXA 1AX0A 1C5HA 5CKNA 1PGW1 4QAWA 1CAWA 3ASNH 4ORFA 5E1WA 4EGYA 4BQOA 2KRCA 1T98A 4QLCU 1U2WA 2L5QA 2E63A 4HV6A 4JC1A 2BBVA 3UGFA 1DHKB 3M7GA 2OQ6A 3ZLIA 1UMIA 2N7GA 4M3CF 2AHQA 2LD5A 1VP6A 3KV5A 3AP6A 2ECBA 2LYCA 2LY1A 1OISA 3KQ4B 2Y38A 3KP4A 5F5AA 3W9AA 2VZOA 1POGA 2VE9A 2CW7A 5L9VA 2G9FA 1NLRA 3WDXA 4PBPA 1VBC3 5FZCA 2QZ3A 2D40A 4XQFA 5IFTA 1ZA7A 5E8AA 5C9AB 2UY9A 3LSHA 2ZGUA 3PIOF 2OUHA 3JR9A 2A3XA 4QDSA 2YUSA 2JE8A 3D0JA 3C2UA 3ZP5A 3FF5A 2HJIA 2QNKA 3OGGA 5LA1A 2BNMA 3ZXDA 3ATGA 3PVOA 3C7EA 1W99A 2ZXHA 4QM8A 1Z91A 4P00B 4DPNA 4Q4V3 5A7WB 4EJWA 5EEGA 4HKWA 1AYM2 3FZVA 1LOGA 3S32A 1FI2A 5ILUA 4HQEA 2OTJI 4KNYA 4P9WA 2HWC3 5BNPA 3A4UA 3E6MA 4CP0A 5KXBA 4JGYC 4FPCA 3OYJA 1XCBA 3QCWA 1ULOA 2PQSA 1SD6A 2YDEA 4PDWC 4GB31 2XJSA 4BNCA 4KIBA 3QAHA 2OIIA 4RN5A 5LW9A 2PQ8A 1JKPC 4AEJA 1SVMA 3JRGA 2HYKA 1OQYA 2DMQA 2ZJRF 2HWD1 4U2AA 4V2WA 1IS5A 5JXHA 2VC1A 3BU0A 3CLOA 2QQUA 1KU7A 4A3DJ 5I0SA 3OY8B 4Q5OA 4E2SA 4N7IA 1S4CA 1GP5A 1ODNA 1CD3G 1NOVA 2JKBA 2WZEA 5EDNA 3NNLA 5CFCA 5FP8A 1SAXA 5FMOL 2VTXJ 2B5HA 3OBZA 1U0AA 4DINB 2TBVA 2VECA 4MGTA 3UGHA 1YS6A 3ITQA 3VBSB 2JZYA 5FMDA 1J09A 2E31A 3RRDA 2XWBB 3QH7A 1WMDA 3WE3A 3LSDA 1HB2A 3W21A 5JWPA 2NVTJ 1JT6A 1KD7A 5ICFA 4IXAA 3N05A 1OFNA 2W0XA 1QDCA 3I2HA 1OLMA 1ULCA 1QMJA 1UD1A 2YU9J 1WW7A 4RR3B 3HAGA 4NHYA 5FP3A 1FYMA 1ND2B 5BNOA 1JI6A 1J0RA 4LLNA 3S1RJ 3NNFA 2LC2A 1DZQA 1E5HA 5BNQA 2CYYA 1ERDA 4O7XA 1WKMA 4KBZA 2ZBJA 1TC3C 2GQQA 3OYDA 3VYSB 2Y0MA 3SEEA 4A45A 5F6FA 2VXDA 1DP0A 1CQTA 1OYYA 1U5IA 4INDA 3HC7A 1UY2A 3D5LA 4BJ6C 3KT1A 4OYUA 2VC9A 2Y60A 2HOEA 2RREA 1PVC1 1P92A 1AXYA 1W8WA 2CFOA 1S8NA 1TZOA 1GOGA 4YVSA 1NAEA 3NAPC 3LE0A 3CCSI 3OD4A 1GZTA 1XGNA 4QPQA 3AJZA 3AK0A 3KZZA 5DAPA 1RKTA 1MGTA 1O4XA 1LOFA 4IV1B 2CW8A 2XIGA 2R7SA 1YFUA 2LH9A 2LLKA 4OU0A 4HSLA 2IFWA 5L3DA 2STTA 1A36A 3OGSA 1T0FC 3ONQA 4MGYE 3VWBA 1BI2A 3CJRB 3TYJA 3HGYA 4UB6C 3URFA 1RETA 5FKMA 1MVQA 2VKHA 1ZRCA 2WY8Q 5C7GA 4HLXA 3C2BA 5FZ9A 3QU6A 3FL7A 3W6JB 5F2WA 5BNNA 1RC6A 2ORXA 2JDAA 4QKFA 2RM23 1C28A 2PLYA 1HRI1 4P96A 4NWWA 1PIV1 1K12A 1DQ5A 1WJDA 3DL3A 2FBIA 4RS5C 5FZOA 5GTHC 2XVGA 1RUE3 2H8RA 1Q1VA 1AL23 1RMU1 1NG6A 1EAH3 5JIAA 3KGZA 1NT0A 5FZFA 4NC7A 5DG1A 4IOAF 2AACA 4TLGA 2XHKA 3KP2A 4EZHA 3A01B 1SCSA 3ST7A 2DVGA 4WK8F 3BPVA 3O5SA 3KD4A 4O9EA 3SQOA 1U0JA 2B9UA 2WYFA 4ZH4F 2XPJA 4XSXF 4Y7NJ 3BR2A 3ZYIB 1Y9GA 2LROA 5CVIA 5KWRA 5HI0A 3DU5A 2YXSA 4ZU7A 4Y1UA 3KQRA 2PELA 1HCRA 5T52A 3MF9A 3ABZA 3ZVXA 2XGEA 1W03A 1HBXG 2R92J 3WTZA 1FOD1 2CFXA 4ZYEA 3H8RA 2VT3A 3T30A 1QU3A 3HT2A 1J75A 3MZ8A 3HKZA 3TMOA 3OBRA 1H9TA 4RM2A 4BXXJ 5FYSA 4EJVA 2LDUA 2WFF3 4EM0B 1ULPA 3RKYA 3DPRA 3VHOA 2DA3A 1D8JA 1ITYA 1OCRH 3GX4X 2QQBA 3GUDA 1VQNI 3WCRA 5M0TA 2XJVA 1ZZ9A 3RSJA 4MQVA 2XUBA 4H7MA 4XFCA 4S05A 1YJWI 4OLLA 4HOBA 4W97A 1B72A 4LKSA 3H3LA 3JRFA 3QODA 1XMXA 4RGGA 1YW9A 3OYEA 2F6CA 1BBT2 3OB8A 3N9QA 1NH3A 2DFEA 4FPYA 4ZDPA 5DTDA 1Q8OA 3ZM8A 3I71A 2DURA 1SD4A 3BZ6A 1STZA 2Y6GA 2ECCA 1HJGA 3ESWB 3MQ0A 4XJAA 3BTAA 2ESHA 2XPVA 3USUB 2WWSA 4RA0A 1OUXA 4A41A 4YARA 3RJRA 1CIYA 3BTCA 4YGEA 2F48A 3CUQB 4XAEA 3F8BA 1VB4A 5JAXA 5J09A 4BOWA 4GFBA 4ITVA 1X3WB 3J8F1 4A3LJ 3GMEA 4AGGA 3EYYA 1VQ9I 3VBUC 2J1AA 3K4AA 2VUDA 3KF5A 4IUGA 3VODA 3UJOA 2WWJA 1BI0A 1ON1A 2EPFA 2IP2A 5FRAA 2OXBA 2HKXA 3K6GA 4Q4Y1 5EQUA 5A32A 4EEFG 3GTJJ 3PL0A 3DKQA 4HW0A 4FAHA 4XOGA 4EMSA 2WNUC 4B4RA 3ZQQA 2ZXWH 5FZAA 2EAAA 3O1VA 2K9NA 2PJRB 4N53B 3Q8AA 2GC0A 2Q8EA 3D1NI 2OQGA 3CDHA 4PCRA 2DQRA 4AAXA 2X53S 2H09A 4LLLA 2XGCA 4AFDA 3AP4A 4AI9A 1TVGA 2LS6A 3JD71 2EIDA 3L2VA 4W8JA 1AR93 1K4SA 1K6YA 3UYJA 1FSEA 1W05A 1DGRA 1BKZA 1JN2P 4B47A 4ZS2A 1LDJA 2ZXIA 1MSFC 5CFDB 2DFIA 4CEYB 2VTFA 3EYIA 5GM0A 3SH4A 1LULA 4CYCB 1NCQC 3KSCA 1UB9A 1EUUA 1NZIA 3JRIA 2RS11 1LKNA 4MXWB 4P5YA 3ETPA 1UIKA 5FZHA 3ILFA 3I64A 3FXQA 3P9KA 3K4ZA 3FM3A 1WCMJ 4LBNA 1D0ZA 3DFGA 2VXJA 1G8XA 4Q29A 5ICGA 4YFXF 3RZHA 2HDWA 5HCHA 4AWXB 3NJVA 2BQPA 5DCMB 2Y0OA 4C30A 4PJNA 1H1MA 4MADA 1X36A 4CXWA 1ZG5A 3U1DA 1QZYA 1Y1VJ 2MEV2 4I7HA 1GXPA 4A3XA 2H8WA 2XMLA 3LA7A 4QM9A 3ZPOA 3P3NA 1DU3D 1D0HA 1ALYA 5FWJA 4MVTA 5B66C 3WP3A 3ZYBA 2DFFA 1KFXL 2E60A 5IP9J 5J3LA 3IPVA 3CJTB 4I6ZA 2ZX1A 2JG9B 2X05A 4UW3A 4P02B 4X1EA 5EHDA 2WIIB 2OAZA 2YBPA 4G9SB 5KHGA 3H0GJ 2D3SA 1OQDA 2AEZA 5H6QA 3ZR5A 3Q0WA 5EG0A 3WHBA 2A6HF 1VZ0A 1FBSA 4XF4A 2CL2A 3D0SA 1WBLA 1LJ9A 1MS3A 4WWCA 5EEHA 3UT0A 1SPPB 1MMSA 2OA2A 2HWE1 3LD8A 1UW8A 3F23A 4BQWA 5A3UA 2EXIA 3AZZA 1XSXA 5HLHA 5IWFA 1W9TA 4HBLA 1G6NA 4FP3A 2Y75A 3DTIA 4BE0A 1RUC1 1B8IA 4UI9L 2R1BA 5EJ3A 2VOVA 3GJAA 3IT8A 3VBOB 4YG0A 4EATA 3K4NA 3ROUA 4MSVA 1TQPA 4E70A 1F35A 1R22A 5FYZA 2P2KA 5LRSA 1ENQA 4O3MA 2L2OA 2XJRA 1ND3A 3I54A 5K0UC 4C1WA 2NVUB 1CWPA 5JSRA 1ORKA 1VBA1 3G1LA 4MHGA 3RZGA 1XBFA 4F7ZA 4PZJA 3H7YA 2IPQX 2LUWA 3AL0C 2ACJA 3C7JA 1YQ5A 2DO7A 1SZBA 4AAPA 1BM9A 4DXSA 4LB6B 4CYDA 3OTFA 4FFHA 2VOPA 2P34A 2W84A 3HUGB 2YV8A 1G3TA 2P3IA 3GEZA 3BTXA 5KHJA 2JG8B 2MLKA 2WO2A 3RZOJ 4HNVA 5IK5A 5A3OA 1XB4A 1SFEA 4M6YA 4I01A 3HM5A 2V26A 2X6XA 4HVRA 1RUG3 3IKWA 4TLFA 4URTA 1GQGA 1YQAA 2RS52 5FZLA 3FDYA 4ZYDA 1Y4WA 2I10A 1IGOA 5ILVA 5D6FA 5IK4A 3A21A 3SEQA 3T0YA 3WW2A 1BMV1 3JREA 5FZIA 1YI7A 4RGUA 4Y22A 2DCYA 4AQTA 1HQNA 4HXCA 4CCJA 2M2EA 3LWFA 1LTEA 3FKIJ 3VD3A 2P5VA 4LMFA 4R4XA 1W2OA 5C8CC 1BC7C 4A7KA 3TGNA 2YU2A 2Z69A 2JECA 1KQ0A 3BLYA 1YRNA 2E7TA 2ZMLA 4RL7A 1W3VA 1I1EA 3RIRA 5D5VB 1O59A 1SLBA 4W65A 4CH7A 5GAHJ 4QX5A 4XDQA 2XQRA 1D0YA 2QTWB 1QNTA 3NV3A 3SHRA 1QOSA 2Y6HA 1I3HA 2HWF1 3VBHB 3BR0A 2WC2A 5HXVA 2M0MA 1GNYA 2P7VB 1VI0A 1FJLA 4IEOA 2M3AA 2AH2A 2G7HA 1W5CC 1J5YA 5ERIA 3PTYA 2DTRA 4DRRA 1UKRA 1UZ0A 3PMEA 1GV5A 1UJ8A 1MD0A 4J6GA 1ETYA 2A05A 1CZSA 4HETA 3FC0A 1FT9A 5FZ4A 2BE5F 2EFOA 1E17A 2WSVA 2X48A 3ISPA 4RAZA 3K4MA 1TME3 3U14A 2JDHA 3KLOA 1QEXA 3OS0A 1SBEA 5BUVA 3HYIA 2ZB9A 1FMD2 2F4PA 1QJX2 2ATFA 3BN6A 5DD8A 3CCQI 2WT2A 4AU7A 3V0AA 1R082 1VAMA 5E20A 4AYBN 2W5FA 4IF4A 5IYDJ 2Q8DA 1T8IA 5EZGA 2VBWA 4LKFA 4HFSA 3I8TA 4A7ZA 2R0FA 2HPIA 1NQDA 1LRHA 1W5SA 3WOGA 4DGWB 1S1AA 2CNAA 2VJJA 1SVLA 4CDWB 3O0VA 4WM7A 5FUIA 1Z0HA 3T4HB 1U5TB 4G7ZF 2VQUA 4CICA 5LBQA 2JRTA 4C3IJ 4AEMA 3OD0A 1K78B 4PI0A 5J6XA 1IHMA 3IDCB 4FFGA 3S7EA 1X8MA 4ZYAA 2XUMA 4H0EA 3VZOA 4ES8A 4JVAA 1W8HA 4JQFA 2VJ4A 3F6OA 3T0BA 2VZ1A 1JW6A 2CG4A 1JS9A 1G9DA 3AKZA 2HU9A 1G9FA 5I0RA 3N9MA 3BR1A 4XJ9A 3DKWA 3RDIA 4ESJA 5A6ZA 4C91A 1HDKA 1VBB3 1HX6A 2ZMEA 1VRBA 4K8FA 4GGGA 1RUJ2 3J7NA 2WAAA 4Q2FA 4ZXKA 5KBFA 5BNPC 1FPN2 3FHNA 2PAEA 4QB1A 5D1IA 2O0OA 5FMCA 3A0NA 3ZGKA 5DDJ2 2VCBA 3SNMA 5FO8B 2A6YA 4B44A 3E5QA 1KU2A 4AFCA 2Q0OA 3IV5A 5FFOC 3HNYM 3HOVJ 1G59A 4CP9B 4XL9A 4O65A 5A3LA 4ENMA 2EIKH 2NZ9A 4EGZA 3F6VA 1V6KA 1HLVA 1K5MB 4KICA 3PJQA 3VN4A 3MBWA 4HAMA 5FFXA 1JU3A 1TWGJ 2MH9A 2PFWA 3MIFA 2BDRA 2VBDA 5CFCC 1AX2A 4LKEA 4Q0SA 3BOQA 5FPLA 4U87A 2XLFA 3ZFGB 3RQ0A 1L7RA 2ZS6B 3O14A 3P3PA 1DU0A 1H9WA 2L0KA 4OI1A 1TE1B 1A6QA 5CVRA 1GZ9A 1UMHA 3UR3C 2BHYA 4F83A 3K2AA 1ETWA 3L09A 3ZXJA 1LPQA 1YYNA 5FK8A 1COV3 4QQHA 3IWZA 4UWDA 2VE1A 3Q9VA 2XGXA 1QHGA 1H1IA 2FCVA 1OFCX 2TNFA 4MV2A 1OH3A 4Z8BA 3ZQCA 2WS92 4BYYA 4CZSA 5HDKA 5ILSA 1OQEA 2C4XA 3AJYA 1X82A 4EN7B 4FQ4A 3SH5A 4A12A 1R091 4A5MA 4LBQA 4XICA 2WNEA 3SDBA 2F5VA 3PQKA 4IEZA 2E7WA 3DLLF 3WQBA 3EPZA 2PLV2 3A22A 4E9KA 1F2NA 1YQ2A 1DP7P 1Q8SA 2V79A 4YVSC 3KYLA 1YCIA 3B6AA 1R1VA 1Z7S1 1D4M3 3CF6E 2Z99A 4S04A 3S5AA 2V5DA 4KWUA 4H3WA 4PLNA 1MEC2 4E7SA 2WYSA 1LOFC 3VKLA 3THDA 2EA4A 1XPWA 3CO6C 3RZMA 1T38A 4AIKA 1C57A 1D1CA 1I6XA 5IOYA 3MWMA 3M8FA 4XNFA 3BYWA 1DLCA 2VUAA 4LOSA 4FOQA 4ZS3A 3WP5A 3GGLA 1IXRC 3RVHA 5KXDA 5GZEA 2FRHA 2A7AA 2ZNZA 1WI9A 4HDUA 5F0HA 3KZ4C 2BU9A 2XDVA 1VQ7I 3LSIA 4CO8A 3LSKA 4AHXA 1GBGA 5BNNC 1ZG1A 2NNNA 3ZFFB 3K0LA 4MYEA 1QJU2 4Q0VA 1S2EA 4Q0PA 5FB2A 3MUY1 5DUIA 5E6HA 2PHDA 4XRFA 4XORA 1VBE2 3PVBB 1M1EB 1IGNA 1HV0A 3SJMA 2QQNA 1W6OB 1RUF3 1UU6A 4YW1A 3O1RA 3U75A 5C8WA 3G7DA 4BQNA 3K3OA 4EM2A 3AG2H 4P9FA 4BU2A 4HPKA 3WGGA 2L01A 3EBRA 4LJZF 1HB1A 3HOTA 2HXIA 4AIDA 4XLHA 2ES3A 2DDAA 1SEUA 4LK1F 1D0GA 2M7BA 3ZX7A 1OQ1A 2LTPA 1X9PA 2Q30A 4RHV1 4AM3A 4UVCA 5FJ8J 2B9SA 4WV8A 2JPBA 2E1MC 3O1TA 3PIGA 4L8QA 1PP7U 1QU0A 3S93A 4MGZE 1XC5A 5M3FJ 2VM9A 3DCFA 3I3EA 1D2QA 4FPFA 4XIDA 1AR83 1FBQA 3KFWX 3PVEA 5D5UB 1S0CA 4AZZA 1JZ2A 3MPPG 1Z0XA 2HDDA 5ERLA 2QEXI 3LSPA 2HGCA 3QRFF 1Y9MA 3OL3A 5M5XJ 2ETEA 5L7OB 4YPJA 2CSGA 2L7ZA 2DBIA 1R6RA 2VOTA 4OOIA 1VRH2 4YZ5A 4YLZA 4FXGB 4PF5A 4FXKB 2R042 1ONVA 2DXIA 1YW8A 1N47A 3AFKA 1CJDA 3HOXJ 4TZDA 1N1VA 4OIOF 3HHHA 1PZ7A 2K0GA 1JUSA 3NV1A 4XTMA 1ZKGA 3DPRC 4RQPA 4YYOA 1R64A 2E9QA 2WNVA 4PHZA 2QYOA 4EV0A 3J7LA 1GYKA 3O12A 1HQWA 4DY3A 1PO12 1C1LA 1RUD3 4SBVA 5CNAA 3HSRA 3DCQA 1Y8QB 2CW0F 2PG4A 1FXZA 3LDKA 3PUIA 4F55A 3ASIA 3CLPA 1YQ8A 3F8CA 3NNGA 3TAYA 1G4DA 4QX7A 4LULA 5FZ1A 3ZFEA 5LK7B 1W36D 4M0NA 3VDBA 4XLNF 5FY4A 3RYRA 3ES1A 2V6EA 4OHWA 3OG2A 4Q8KA 2IT0A 2AS5F 1TMF3 3ABMH 1U5ZA 4CCEA 2I74A 2MLGA 1CX4A 3KCXA 4IV3A 5IFPA 4E7JA 3VBFB 1N78A 5H9PA 5DYMA 2AENA 2Z2SB 1UL9A 1VIWB 4KT5C 2XAHA 3FXOA 5K7PA 2EFQA 4ASNA 3CU7A 1IKPA 4LLOA 2WAQN 1FSHA 4XQ4A 4HANA 3LFKA 1ZTRA 4G7HF 3H8XA 1RYYA 4V2VA 1FV3A 4YG3A 4C1XA 1C4RA 4P14A 2WA4A 5T5OA 2UWMA 2XQXA 3FIWA 4BBSJ 5HPOA 1A31A 4A3ZA 2CAUA 3PFYA 2WAFA 1J1TA 2OV7A 2C9AA 2AC1A 2RS31 3JSOA 1JJ8C 2LKSA 2FX0A 1C8M2 4BY7J 3TKYA 3HNBM 2CUJA 4GH4B 3HQUA 3V0BB 1QNWA 2R073 1W0PA 4E8DA 1ZLKA 1H2LA 1Y8RB 4J1WA 1IJWC 3WDWA 3HQRA 4M00A 3ZKUA 3CCJI 1V6LA 2ICWG 3O1UA 1DQUA 2QQKA 1WCUA 3PDQA 2Y6FA 4XQDA 2HFHA 1IG0A 2Z4FA 1FEXA 1UIJA 1C5IA 5J47A 1FOXA 1J84A 3T1BA 2PTMA 1YIFA 3OCPA 4D8MA 4NAMA 2FZ1A 1XTAA 2VIXA 1QJEA 4NHKA 1FYKA 3GW2A 1ZELA 1CF7A 1TLHB 3ZOBA 2WUHA 1LGCA 5FUPA 3MKYB 2FBEA 1WVRA 3KETA 3L2CA 1WHUA 1DQ6A 2D45A 2QSHX 1W6QB 2OTLI 3HGGA 4ES9A 2ZA9A 5JXIA 4FTHA 2WAOA 4OMCA 1PVEA 3JUUA 4R9CA 5H6RA 1KEXA 1FNNA 2VZ3A 4FHTA 5FMOS 4IE4A 3ABUA 2PI0A 1UF2C 3FMRA 1TWFJ 2EXKA 5DZGA 4UVAA 4S0HB 5EGOA 3T1LA 1PP8F 5HS8A 1S7OA 1UZZA 4A7YA 3TP3A 1AR73 4QX1A 5C4WB 1IS3A 3POGA 1O3SA 3ZYHA 1WJAA 1CIWA 4E27A 2QF7A 1X58A 3K9TA 2VL8A 4HSRA 1EJ9A 1VBD3 5FMBA 2L7MP 4J19A 2PHUA 2QM3A 2Q8CA 1UZCA 3MYXA 1AR62 4BH9A 5CG9A 5A7OA 1DF0A 4QXHA 4HVOA 1RHI1 3U4SA 5IAXA 3OUHA 2A6WA 5I8TA 2YY1A 2O8OA 3AKSA 4JTNA 3ML6A 1RZ4A 4LUMA 3DTEA 3GFLA 3T09A 5FZKA 3EQEA 2WY7Q 2ZO4A 3OOPA 1PGW2 4B1LA 4FOWA 1B6AA 5IATA 4K2EA 4Z82A 1V6NA 1WLCA 3DECA 2RDRA 4RLFA 4AD9A 4PFOA 4IE5A 2ZEXA 3S3MA 1GZCA 4K9SA 2MD0A 4CDQB 1NE4A 2QBYB 1V5GA 4NC6A 2K9ZA 3JQWA 4XKCA 3HBZA 4ZDLA 5FYMA 3GWZA 2R7EB 1IN6A 1P7JA 1ZZ7A 2VZTA 3AM2A 1WLDA 5FIXA 1JUPA 1A35A 4I30A 3NQHA 3A0KA 1HV1A 3LKJA 4RAYA 1AXKA 3U1KA 2R7XA 1X1BA 3VYRB 1JYNA 2HWB3 2DUOA 2R061 3H0OA 4CDXA 3JRBA 2FDGA 4LBKA 2ID4A 4EJTA 3B69A 3WF3A 2FMLA 1ND3C 1MS1A 3INAA 3PQJA 3SDGA 1HXS3 5ANNA 2YU3A 2O8QA 4K8RB 4KISA 3S17J 3F9KA 2I8DA 1W1WE 4DIQA 4AVTA 2F17A 3CMAI 5LY1A 2UV1A 1AYN3 2HBUA 5B4XA 4MGRA 4Q4X2 3MI8A 5FLVA 1O4YA 1PK6C 3AYAA 1FP2A 3T2PA 4LKDA 5B1AH 1HKTA 4WM8A 3MIGA 4L0PA 3JB8A 3OIQA 2KPMA 4NN0A 4JHTA 3CJNA 1BR2A 5LEKA 4XEZA 1LE8B 1SFOJ 3C2HA 4DMIA 2DBBA 4GB32 2A6EF 4QWNA 3GF2A 3MZHA 1S0FA 4L11A 1SFKA 5IJRA 1DPRA 1EUTA 2ARCA 4GWIA 5FPVA 4QQLA 4II3A 3WU1B 1FBUA 4U0YA 2EFNA 2ZKLA 3MVPA 2HWD2 2PJPA 2WS93 3U9GA 2QZ2A 2KFDA 3K77A 2B45X 3HOUJ 4KG0A 1RKWA 1JTZX 5EJCA 3MW3A 4C2TA 1RXGA 2CUEA 4ASKA 4HK8A 3N7KA 1MPXA 4C90A 5FY8A 3KCCA 2W08A 1YFYA 5JI6A 2BZDA 3D3AA 2FU4A 1ZBA3 4Z2AA 5F1JA 2VQHA 1XSDA 2E36A 4BQXA 2WBKA 2ZGLA 5LB6A 4MGSA 5A70A 2VZSA 3BPZA 1P2FA 2DWRA 5DUXA 4BEHB 3MO4A 3KWVA 1ST8A 3VFZA 4G9YA 2R5ZA 4IQPA 1IS4A 4A4AA 4PGHA 5F0CA 5KVRA 5A7SA 4OZOA 1S72I 4GDFA 5SV5A 3IUOA 1JYXA 1QF3A 1HN0A 2IVIB 3QLQA 3SH3A 4ANJA 5A3TA 4N43B 3WDTA 4KUMA 4ZU4A 4R79A 3FK7A 5IT6A 1OT5A 4PJLA 1IOAA 4A3CJ 1I6HJ 3F21A 5A3MA 1QQP3 2AXLA 5HDNA 1FP1D 1PUFA 3W5MA 4HSTA 1R71A 3VL9A 1YO5C 3C7FA 2VXRA 3TNQA 5CQGA 2JDKA 5CLSA 4KI5M 1KQ9A 5CYVA 1YQCA 3DF0A 4JX0A 1S0EA 3GFMA 4K40A 1CPNA 2ZTNA 5M3MJ 1PVC2 2O8KA 2P1BA 4WM7C 2W1SA 3SYTA 2R30A 3CL1A 1XYOA 3POIA 3NJXA 2FUG2 1WFXA 4ZTFA 1QHHD 1MBEA 4N4OB 3ZYFA 2CSOA 4FQGA 4FFIA 4GMP1 1Q3EA 2ZSIB 2EIGA 3N9OA 1B35A 4YM2A 3M1HA 2ZX4A 2VAUA 1NX9A 2UYAA 5LASA 1YJKA 3AYCA 2FZ2A 2W82A 3MIEA 4MFDA 2JVHA 1UOGA 3FN9A 3K70D 5F64A 3DYPA 4O61A 5FY5A 3R4KA 3O1PA 1VALA 3OGJA 1X33A 3BQYA 2HWC1 1FYLA 4QXBA 4GCVA 3WVJA 5TSWA 1GNHA 4I0WB 3H3VK 3EDPA 4Q4W2 2ZMEC 4QPYA 3HL2A 1QIQA 2UYBA 5GAGJ 1NUKA 3M9AA 2MEV1 2D6LX 1LOBA 4CUGA 4UFKA 1VRH3 1IN7A 4LA3A 4NHXA 1MBFA 1OH4A 1TTYA 4NB5A 5J40A 1UAIA 1RMU2 2E1NA 5DAXA 4HL0A 1VMFA 2R5YB 3TRSB 2QSGX 1NA1C 1US3A 3QBQA 1JZ5A 4GRIA 2R7OA 2M4GA 2BWAA 1ZBE2 1EYBA 1IQAA 2F5EA 3CQOA 3B5LB 3VSKA 3JRCA 2WJSA 1LECA 2JMWA 5J98B 1ZH5A 1KA8A 4E4HA 1S2BA 1RVF3 2Y31A 2WA3A 4Q26A 2RN7A 3BQZA 4FPGA 1GP6A 2FD5A 4CPBA 1MJ9A 2E2JJ 3I5UA 2EV6A 4XOTA 1IKQA 1NLQA 4CDUB 4YRDA 5K5OA 1E5RA 1XNAA 3IN9A 2W48A 4UVBA 1JKQC 4XUQA 1OI6A 1A78A 2J5OA 1PZ9A 1BC8C 4ZTJA 4XJUA 4J00A 3I53A 3V7SA 2OUMA 1R1A3 2R7FA 3KV6A 3AL6A 4NWVA 1IV8A 5F0FA 1GICA 3MPBA 1NHAA 4EROA 2WR9A 1IUFA 1KYZA 3LL7A 4PUSA 2F5CA 5JOXA 2DDUA 5J1XA 4A93J 2VBXA 3A0BC 3OEBA 1HB3A 4YW2A 3T1MA 3EUKL 2W39A 2P81A 4XR6A 4D7NA 3APBA 5T54A 2RHPA 3H9AA 1MS0A 3ORJA 1ASJ3 1IG7A 3GCXA 3I59B 3RKXA 2GZWA 2IS6A 2IA2A 1R4MB 2V1DA 1CAXB 4BQ2A 4M3BA 2YU1A 4C0BA 2G7UA 2JDYA 2QQ9A 2IXHA 3TW6A 4WZCA 4P9YA 2E7XA 3NW4A 2XB0X 4A42A 4XSZF 1A5JA 1WD3A 1Y43B 1A34A 4XILA 4L9VA 2Y9ZA 5KHHA 4F8AA 4I02A 1MQTB 3CD6I 4YGBA 1IRGA 5E17F 2GIVA 4H2AA 4UBGA 2GN3A 5I93A 4OMYA 1SBDA 4XDPA 3CJIB 1A6CA 3WHCA 3J8F2 2M5WA 4FTSA 3Q8FA 1J59A 4LJHA 4QX8A 5FQ0A 2LTNA 2ZABA 3EUHC 5BXXA 2P6TA 2YYOA 2IGOA 2WZR2 2RM21 5A33A 3VBRB 2PX9A 4DOZA 1OCCH 1USSA 1K42A 1GANA 3BWGA 3LNQA 2A5WA 2JKXA 2XSDC 4A0ZA 4DFSA 1RUE1 1QJY1 1IDYA 1NCRA 3EHKA 2ZJPF 4BQAA 2LF8A 5FRNA 4Y5SA 3MFKA 4DXZA 3ZSJA 1QA6A 3IZOA 3LIHA 4ET7A 3WCSA 4IHWA 4Y4YA 1HRV2 4MTEA 1EKEA 3JD72 1MH4A 4M6VA 4LFUA 2DPUA 1LHUA 4IGPA 3VDDB 3ZN5A 1CAVA 5FYHA 4XJZA 1MZEA 4XUTA 5JDBA 2RE9A 3U78A 5E16A 4AEDA 4YIRX 3NRUA 5H9RA 1UHMA 1B4AA 4B4QA 3RPUD 3ECOA 1LVAA 1QQIA 1AL0G 3CF5F 1AR63 4DNCA 3M3QA 5DAQA 3WUCA 4F52A 3QPHA 5DG2A 2ZGQA 2A3SA 2CV6A 3ASOH 2D3PA 2OVUA 5D2AA 1VE0A 4XFGA 1DGWA 5FREA 3QPSA 2ZZJA 3KV9A 4QTRA 3HPNA 2QQ8A 3VYUB 2VZRA 3DEUA 3M3EA 4XXAA 2G4IA 3ACHA 3NV4A 5KXEA 5IYYA 1DGRN 2CQ7A 2MC4A 4KGGA 4XM3A 4NVPA 2VQAA 4UF0B 1U6GA 1BIAA 4RQPC 2GBYA 3PFIA 3SQNA 3RWKX 5FYUA 3HOSA 1TNFA 3I4IA 2ZZQA 4HLTA 3OOUA 3A7QA 2WFPA 2YMZA 1QOOA 1RB8G 4CCCA 2R49A 4AQSA 1FTZA 5C5UA 2X4HA 4XF1A 1QZEA 3GBGA 3TO7A 3NJZA 3MIDA 2JICA 4B1MA 3OYBA 5ACA3 3K69A 3M07A 1GOHA 1PMHX 2OX0A 2YROA 3ILNA 1LCLA 5SV8A 2ZEWA 4OINF 1DDLA 3JBG3 3ZFEC 2JX9A 5FROA 4RAFA 3CKHA 2JA2A 2RQQA 3VZMA 1BEV3 2FCTA 4UUSA 1POV3 4QPIC 3I3BA 5A80A 2JE7A 2X6OA 4IV3C 4GKYA 3FXLA 1XD7A 2VQTA 3IAPA 2IXSA 3IRRA 1LDDA 2E34A 3KM5A 3PU3A 2BY0A 4H7LA 4ASMB 4HKOA 5L73A 5JXGA 2M45A 2HWE2 4DUVA 1BN5A 3W6VA 4NBQA 2GC1A 3I2FA 2SBAA 2W25A 1H8VA 2ZJCA 3WF0A 1RUC2 2YC2A 1WA6X 1XQNA 4CCDA 2QA4I 3F95A 2W2IA 1WCQA 1H8TB 4RB0A 3VGIA 3WQ7A 1W8OA 1GQPA 3WNNA 3OUJA 3CF2A 3IB3A 4Q5SF 1OOPA 3B00A 3MGUA 1YEWA 3BP8A 3HBLA 3AFGA 2BVBA 3RQ4A 2DAOA 4KIFA 2V72A 2D44A 1VBA2 3I2KA 2CY6A 4IXLA 1AR91 3H1YA 2VOXA 4CRQA 2JA7J 3S5QA 1JOPA 4L9BA 4ZYHA 2RMU3 2XV4S 1T6GC 4E4ZA 2ARAA 4ASLA 2FSWA 3L2WA 3LFMA 2H6CA 4DBRA 2BHZA 5FZ0A 4E8CA 4K7JA 2Y6KA 1IN4A 5LBEA 2Q1ZB 2WT1A 4GD4A 2J5PA 1BW5A 1L7LA 4NIHA 3IC7A 2VD7A 2BV6A 1I39A 4DEQA 4DUWA 1LU2A 3EB7A 3R0AA 4OZXA 4C8DA 4L9TA 4G6QA 2EF6A 2ZXQA 4ITCA 5CEHA 2HVQA 3WP4A 2D6KA 1SD5A 2YC4A 5KK1A 2DBNA 5T55A 2IVMA 5FRMA 2L4AA 2X6YA 1LOCA 2GXAA 4MGKE 2HPMA 1SDWA 5E18F 4RA2A 5FZ8A 3BCBA 3CQZJ 1IRXA 1BMV2 1ZAOA 5KHKA 3LSRA 1B35B 1HIXA 4OHXA 3OL4A 5BNGA 2Q2EA 3H36A 4K21A 3WDVA 1FIAA 1S0IA 5D8AB 2EICA 2WDBA 2ZC2A 4NE9A 2YX7A 3IDEA 1XX5A 2M0CA 1E3PA 2BW3A 1MEC1 1ETVA 3KB5A 3OYWA 3HN1A 4IEVA 3PUBA 3WV6A 2BOIA 4YW4A 2O14A 1F31A 1LHNA 2V9VA 4DNYA 2R7QA 5FY7A 2RV8A 1LOAA 5HNFA 3EO6A 1F43A 1X50A 2D5HA 2LRDA 1I9RA 3WG9A 3RKWA 3NEUA 3KS7A 1G2HA 1W6MA 5FD6A 1RI7A 1QJU1 1S3JA 4IRHA 4A3MJ 4B8XA 3S8PA 2UWAA 2WB1N 5EZHA 2VVEA 3LQCA 3KYDB 4XCBA 5FYBA 1KFUL 2VI6A 2X9DA 4BB3A 2XJUA 3GCWA 3KPHA 4NR1A 2LREA 2VCCA 1D5VA 4META 3BTLA 3JU9A 1R49A 3RPUA 1LJ7A 3GTOJ 1W3XA 1PO22 5FO5A 1B09A 4WZFA 5JSPA 1HRI3 4OAYA 1PIV3 2PHXA 3ZMNA 5E3MA 3WEZA 1N1TA 4Q0UA 4LK6A 5CADA 2UWBA 4D9JA 3MAJA 4Y20A 4L9JA 1TNSA 1OBNA 1XC6A 1H1AA 3BODA 1JUHA 1IPKA 4CDXC 3P9IA 4L5EA 2X5IA 5HNHA 3ZSLA 1GMMA 3P5JA 5JOZA 1YFHA 3WNLA 3KEQA 5IK7A 3QPTA 1UHSA 3WQ1A 4BS9A 4M9ZA 4CA0A 2J1TA 4R52A 2XOMA 4C0HA 5CIRA 4LG0B 4D3WA 2LM3A 5JXJA 4JOMA 1KU3A 1Z21A 3O3KA 4N9HA 4L5IA 2D1VA 4OHVA 4I98B 3KVBA 3TNPB 5HLIA 2EINH 5IAVA 3V7RA 4XONA 3WXPA 2QFEA 1XSVA 1FOD3 4WM8C 1S2KA 2WLPA 1ZG3A 1UXXX 5JPMB 2JA6J 2O3FA 2FOKA 4QU1A 4XJ8A 2MC3A 3J81Z 2QUOA 3WNKA 2Z9OA 3U0ZA 5DEQA 4FPHA 4KBBA 3GALA 2W1QA 3TEYA 1W0UA 1W36C 5GKAC 4D5CA 2E71A 5EP9A 2DCKA 2D1HA 4JGYB 4P9LA 3V64A 3B73A 2P6HA 3H42B 1BIBA 4PDWB 5EYXA 3JXSA 2M87A 3CBNA 4QB2A 1W8ZA 4ISQA 2SLIA 4F92B 1MNMC 4OQ9A 2LP0A 2PXJA 1BBYA 2CU5A 1YG2A 5JZGA 3S2DJ 2K5CA 4I09A 2QQOA 3C18A 2CQNA 3ZXKA 4LIVA 3H8UA 1F4KA 3MV11 2XR4A 1EY2A 1UOFA 2XLGA 2RQPA 3ZYPA 4RS8A 5F3GA 1W7PB 1UY3A 5E3OA 1O8SA 3ZIXA 1JOBA 1V5EA 1LOEA 5D8LB 3WTSC 2VN2A 5CPRB 4PGGA 3LEIA 1HQCA 1FTTA 4HEA2 4IEPA 3ZXAC 1TME1 3HRUA 4F3QA 2B7YA 3C1DA 1DQ0A 1W0OA 1H9GA 1Y0UA 2V1UA 5DZFA 2LKXA 1Q8PA 1W6PA 4LO7A 3NV2A 3BROA 3DKXA 2E6VA 1FMWA 3DN7A 1SEFA 1HDDC 1N1YA 1SLAA 4V2GA 2WN2A 1ACIA 3WGHA 4KQ7A 2WKKA 3ON7A 5FBJA 2Z3YA 4AE2A 4Q4Y3 1T33A 2EFWA 2VG9A 5IVVA 5FXVA 4FAGA 1KZHA 2XPWA 3DBLB 4K20A 1XGSA 1R092 3GZUC 2LK2A 2MHFA 3ZN0A 4D7YA 4XYXA 1OR7A 2J1UA 2NXNB 2I07B 1IS6A 2ADDA 3VB9A 2ARBA 2LG4A 4ZDOA 2YUEA 5C3OA 2Y26A 1AZDA 1E57A 4QU2A 1DGRM 1WSUA 4BK4A 1WMXA 4M01A 4G12A 2VQLA 3T4VA 1G3WA 3NAPB 2R6QA 4ZONA 3O1MA 2A61A 1U12A 2CO5A 1Q43A 2JXAA 4CCOA 5JMOA 2VW0A 3WF1A 3KV4A 1KYWA 3U2RA 2Y2ZA 2P0WA 3LEMA 4W1UA 3T5XA 2GDFA 5FO9B 1OKOA 3U1XA 2XVLA 1JXSA 1LHOA 3K1PA 3WD5A 1SG3A 3S14J 3LWCA 3OPTA 1S7EA 2P8TA 3M1CA 4N4NB 4RFRB 1VMJA 2RS13 1V3FA 5FPXA 1W5TA 1WJFA 4U88A 1C8NA 5KHDA 3D4KA 3ZKYA 1E3OC 4I76A 1H88C 1WJBA 1QDOA 2R16A 5APAA 2EA2A 5JR7B 2DOAA 3F72A 1FOYA 2ELJA 2PMZA 1J2XA 1XNBA 3AG1H 1WPKA 2E7AA 5FYIA 1FATA 3N36A 1DQ2A 2BP6A 5LGTA 4GJYA 2VKDA 4IL7A 2ELKA 4LG3A 1UZWA 2ZFWA 3FK6A 5CAZA 3ZQIA 2EILH 5IHRA 4RS5B 1JYCA 3ACLA 3CP2A 2VH9A 1BK1A