3DKWA

Crystal structure of dnr from pseudomonas aeruginosa.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
227
Chain Sequence
MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLECFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNR protein
publication title A dramatic conformational rearrangement is necessary for the activation of DNR from Pseudomonas aeruginosa. Crystal structure of wild-type DNR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
total genus 46
structure length 227
sequence length 227
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dkwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dkwA01
1XSVA 1ZAOA 2L4MA 1T6SA 3K0LA 4HQMA 3E5XA 4QWQA 1U2WA 3F21A 4I02A 1P2FA 5ILVA 1SEFA 4HX8A 4BIFA 3J80K 4BH9A 4RB3C 2VOOA 1ZZ6A 5HI0A 2MLGA 3WW1A 2QDRA 2STTA 1TNTA 2ET1A 3MDPA 1Q5OA 2DQLA 3KSCA 5DYMA 3S7EA 4HLTA 3GZ6A 3ULQB 1K6OA 1J59A 4DINB 1SFXA 2DBBA 2IXIA 2V1DA 1BI2A 2A6EF 1LKNA 1HW5A 4G7HF 2BYVE 4EGZA 4MEXF 3IWFA 1R1UA 3OTFA 3IRRA 3DQVC 3FM5A 2E1CA 4FHTA 2F5FA 3D0SA 2Z69A 1ZGAA 4EV0A 2W25A 3HYIA 4HVRA 1S8NA 1Z7UA 1VR3A 2O03A 2QYOA 1T98A 5CVUA 1R00A 3K69A 5CVIA 2JSCA 2EFWA 2ZKZA 1LRHA 4EJOA 2QCSB 2A6HF 3KZZA 2ETHA 1U5TC 1ZYRF 3ELNA 3E6DA 3KEQA 3GFIA 1XD7A 2A69F 1J75A 1J7KA 1JUHA 1B1BA 4TV7A 4LG0A 1R7JA 3TO7A 1PP8F 1EPZA 1Z1DA 4EM2A 2ZFWA 3B02A 2D1HA 3T1BA 2H6CA 2A3SA 5CU1A 3ABTA 1HKTA 2ZNZA 1UHWA 4EJVA 2XIGA 2EV6A 4Q0VA 3WW4A 4BYYA 4O9EA 3KP4A 1UW8A 5BPXA 2MH2A 1KYWA 4YARA 2LNBA 2STWA 2V09A 4LG0B 5H6RA 5JSOA 3Q5FA 2HYFA 1NZCA 1U78A 2Q4SA 3FM3A 4A0YA 1E17A 3C18A 4HF0A 1XMKA 2A5YB 1Z91A 3FXRA 2PI0A 2IW5A 3DV8A 2UY8A 2Q1ZB 4ENNA 1EY2A 1FOKA 1HKSA 2K0GA 1V4RA 2GAUA 3KZYA 5E18F 2IA2A 4IEQA 2WWYA 1G3WA 4LD5A 4OFGA 4EJTA 1W7PA 3MEXA 3HSRA 4L0ZB 2XL9A 2R7DA 3ZPLA 1RL3A 1KQ0A 1YS7A 5FFZA 1FY7A 3NL1A 3NRVA 4L9VA 2EV0A 4UUVA 3L00A 1T38A 3JTGA 1KA8A 3RYRA 4MGZE 2CAVA 1OYIA 4LMYA 3V7CA 2XHKA 3MWMA 2IC1A 2PEXA 3UKVA 4P55A 4WZCA 4IETA 2CAUA 1VJ2A 2VC1A 1YUDA 2HGCA 3GZ5A 5F6FA 4FX0A 5DCFA 2FA5A 2K27A 4Q0SA 4MTDA 5D8KB 5ERIA 3TDZC 2CFXA 1XGNA 5HDKA 3JAMZ 2EK5A 3F72A 4IHSA 4ZH4F 1FBUA 5T3NA 2GH2A 4AIJA 4ZU7A 4AIHA 2Y75A 4ESBA 4HZFA 4Y13A 5JSRA 2UZKA 1IXSB 4GXOA 5EEGA 1H1MA 1HXDA 3JTHA 2RGVA 4Q5SF 2IXJA 3M70A 3H1MA 4CICA 1HSTA 3HHHA 5K5RA 3KLOA 3L2CA 1ZZBA 2NAZA 2FOKA 3ZMVA 5CLSA 1EP0A 3BY6A 5LHHA 1ZHFA 5EFUA 2XV4S 1CAUA 3ELKA 5J48A 4XEZA 2MLKA 4AVCA 1B9MA 5FQ0A 3T8TA 3IKVA 3EQEA 1E2XA 1ZARA 2JT1A 5JHUA 1Q3EA 1K79A 3LA3A 1YIOA 4RD7A 1PDNC 1FI2A 1HQCA 5LHIA 3U11A 2R7FA 1OYYA 1WSUA 2K4BA 3P9CA 2GC3A 5FQ0B 2L3DA 3V8KA 1ZLKA 3EUHA 3HOSA 1H9TA 4Q0UA 4LB5A 2NYXA 4MHGA 1FP2A 1Y0UA 1YG2A 1IPJA 1R1VA 1T0FA 2HZTA 4WXHA 4JV4A 3DP7A 2W84A 4XF4A 2XLGA 5D5VB 4BHCA 1QWRA 1WA4A 3OD0A 3NEUA 3RYPA 5HS9A 5JAXA 4S04A 3KETA 4QX5A 3V8JA 3BDDA 2ACJA 3TQNA 1O3QA 1VP6A 2DW4A 1LEBA 1LEAA 2BNMA 4PGHA 4OIRF 4KN4X 1ZNPA 2XUBA 4QGNA 3HRSA 5FD6A 2F5EA 3OOPA 3L2HA 2UYAA 3ZMDA 5FLHA 1DP7P 3KP6A 5L3FA 2PMUA 2MBFA 5CYVA 4Z82A 4F7ZA 1ON2A 2P17A 5BY5A 3CJXA 4I0BA 2C6YA 4AXOA 3TO9A 4KYWA 2ZNYA 4HSLA 1YW8A 2PBIA 4GGGA 4PZJA 4IRGA 2HQRA 1ZZ8A 3PNAA 4WF2A 1KGSA 4YSFA 2XKPA 2BGCA 2K86A 4HN0A 3KGZA 1O5LA 5FLXK 1Z05A 2EA4A 3FX3A 4QM9A 2HEOA 5E8GA 3RTRA 2O8XA 3H92A 1ZRFA 3LQQA 1B59A 1BN5A 4Z2YA 2B0LA 2KIUA 1FLIA 1EH7A 2DO7A 4J1WA 4XLPF 4HMZA 2XAFA 3IRQA 2HJIA 1QNTA 1B4AA 2IPQX 3NSTA 2D5HA 2OQGA 3HRMA 3WODF 4L5IA 1IN7A 2HDCA 2EB7A 4PJYA 4L0YB 4LK0F 5EZWA 2Z33A 3WTWC 3RPUA 2LF8A 5BPDA 1OR7A 3LAGA 4N9IA 5TJJA 3TNPB 4LK1F 2FBHA 4LUMA 3LWFA 2YSRA 2VT2A 2D93A 3TNQA 3GF2A 3WU0A 4B29A 4CDGA 1RUOA 2GC1A 4L5JA 3ACLA 4UV8A 4IVNA 4XETA 4XFBA 3LOIA 3IKTA 4XF3A 5I91A 5HDNA 2ZCWA 5DUKA 3CO6C 4TLFA 1Y9QA 5LHGA 1REPC 4QM8A 3WE2A 3P9KA 3QOPA 1NE4A 1YYVA 3J80Z 2QWWA 3BJOA 3ERED 2KIMA 2COMA 5KHJA 2CGPA 3OCPA 2L02A 3IDBB 1TQ5A 4MNUA 2P6TA 4WBBA 2DAOA 4HQEA 2QJVA 2ZMEB 3P7NA 4MEYF 2IT0A 2V1UA 3CO7C 4RAZA 3BROA 4LLNA 4MQVA 1RGSA 4K2EA 4YIFA 3ABUA 1SMTA 3R0AA 5E1XA 1DGRA 3REOA 1RI7A 2RN7A 2V9VA 2FSWA 1IXRC 2F2EA 4MH0E 2H94A 2LKPA 4OMZA 1ZZ9A 3M3IA 3H8UA 1RZ4A 1U3EM 3SHFA 2QBYB 1C0WA 3S2WA 4HDUA 5F1RA 2FF4A 4LA3A 4HF1A 5ICGA 4MUVA 3D0JA 2IXCA 1O5UA 3EDPA 4A0ZA 3E6CC 1ZVFA 3MPBA 1YFUA 4O5VA 3J81K 4UBHA 2MNGA 1F4KA 3AAFA 4L18B 2OU2A 3HRUA 2AS5F 4A12A 3ISPA 3RZZA 5ILSA 3RJPA 3J7AO 2O6GE 2MPFA 6PAXA 1WGPA 2WFPA 3GYHX 3TKYA 1RNLA 4UV9A 4Q0PA 5BPIA 2QUFA 2FU4A 4K8FA 2BEOA 1NYWA 3BU7A 4XBFA 5LBQA 3WTZA 5KVRA 5ICEA 2VQAA 2HS5A 4A2UA 2J5OA 4HF2A 1J9IA 4Y15A 2N7GA 1PMIA 3DPTA 5E20A 5LEKA 2LDUA 3CUQA 4BAYA 3I53A 1KYZA 4HVOA 5E8IA 1YTYA 2H6BA 4WCGA 1B6AA 1R23A 3L7WA 1G6NA 4EM0B 4JVAA 3KP5A 4JK1X 2DFIA 5H20A 1OFNA 4HA8A 2HKXA 1DGWA 5I0SA 1YLLA 1EV7A 4LFUA 3RNSA 2C0ZA 5D4RA 4AVPA 3CUQB 4MX3A 1KU9A 2R3SA 3V7SA 3LA7A 5ED4A 1RIOH 3IIAA 1S7AA 1GQHA 1LB2A 1TTYA 3BB6A 1ZLJA 2KJBA 3F8NA 4MZUA 2VBYA 2FMYA 2W24A 5KBFA 2ZBKA 1BOAA 4FAGA 2KXLA 3I7DA 1J3RA 1HSJA 2RC4A 1GXPA 3OF1A 2ZJ2A 1QO0D 2PMHA 4G9YA 4WK8F 2BNOA 2FQPA 3S7IA 3WGHA 1O7FA 1GXQA 3FE5A 2JPCA 2FQ3A 2QM3A 3JZVA 4ZU4A 1I5ZA 5ILUA 2YPRA 3ZDSA 4ZYGA 1XMAA 3EYYA 2BBYA 4XF9A 4I09A 4QXKA 2PLYA 5JCTA 2PQ8A 1O57A 2BE5F 4UVAA 3M8FA 3EJKA 3JSOA 3KGLA 3F3XA 4YFKF 4HBLA 1MDMA 5JVTA 2DK8A 4HOBA 3NW4A 2PAEA 4YFNF 2K02A 2K9ZA 2RV8A 1FNNA 3I54A 4CHUA 1L3LA 2O0YA 3ECHA 3CLPA 2OZJA 4ZYHA 1SFEA 1O3TA 3N4MA 3D5LA 2P7CB 5C6CA 3I5UA 3COAC 2XAGA 3ZN1A 4GO1A 1S29A 1MDMB 2RDPA 4D7SA 1WI9A 4UXNA 4LJZF 4HN1A 3HOTA 3F8MA 3MZYA 2OA2A 3TGNA 1R5HA 1F9NA 2FE3A 4RB0A 3FFQA 4HLXA 4M9ZA 2UY9A 4BHPA 1UHMA 1ZG5A 5JFRA 4KN7X 1LDKB 1J0RA 1IN8A 5JSPA 5D6EA 1BM9A 4B09A 2O3FA 4RGRA 4L9JA 5DD4A 4P9FA 5J6XA 1FT9A 3BPZA 5TRDA 2EA7A 2P5KA 2FNPA 5HLHA 2L54A 2VT3A 3DKWA 1I1GA 1UB9A 3NVCA 3RKXA 2PYTA 1P4XA 3UKTA 4EWDA 3HSEA 3WW2A 3U2RA 3I0TA 5D8LB 1IF1A 3GYDA 4G8XA 2YX7A 4ESFA 1T2KA 2XL7A 3DEUA 3JW4A 5BQTA 5I0RA 1FSEA 3IL2A 2K7LA 1S7OA 1SD4A 4QLCU 1YW9A 4IEZA 4CZZA 2VBXA 1YFYA 1W7PB 4XSZF 2O1QA 3WTUC 2P8TA 3C1DA 3QU3A 2XASA 3CUQC 1WKMA 3RDIA 1FWZA 3ECOA 3IDCB 1KQ9A 4IERA 1ZH5A 5AIQA 3LSTA 5HDGA 3SMHA 4IEVA 3F6OA 5EEHA 1IN5A 4YIIA 3O6BB 3GWZA 3R4KA 5HOOA 1EYBA 4KFCA 1L3JA 1CF7A 3DF8A 4O9GA 4XF1A 4QGLA 1TQMA 2PHDA 1O3RA 5DUIA 3I71A 2D1VA 3MAJA 1QPMA 2Y0MA 2O61A 1BI0A 5FLXZ 4KWKA 2H0VA 1TBXA 3MQ0A 4FX4A 1R36A 4U7DA 3KMHA 4OMYA 1SFNA 2PG4A 2QVOA 4IEOA 1CF7B 4WXDA 2GXBA 4META 3WTTC 1YFWA 4KA4A 1R1TA 3EBRA 5J3UA 1F5TA 4KWJA 3USSA 2IRFG 3WGGA 1GVJA 1I6XA 4XFCA 2DCTA 3V4GA 4MGKE 3Q9VA 4A6DA 4QGMA 3SZTA 3C3VA 5BUVA 2A07F 3VB2A 5HLIA 1ZX5A 2FMLA 3F8FA 2VXZA 2V79A 2HWVA 3TDUC 4GYIA 4E2QA 2RVCA 4NQWA 3BPVA 1BC7C 3BWGA 1CAUB 1FSHA 4XFAA 1O4TA 1J3QA 3GLXA 2IJLA 4KIGA 3F6VA 1FX7A 2ELHA 1TW2A 1AOYA 2P7VB 2PFWA 2GC2A 2EV5A 4AVAA 1O7LA 1P4AA 1LQ1A 2FBIA 1CGPA 1QY4A 5JR7B 4WX9A 1SD6A 4LA2A 4E2GA 2Z5UA 2M1BA 2YU3A 3DXJF 4E2SA 1K7AA 2Q8KA 1ZREA 4XRFA 5KHIA 2UXNA 4KMFA 2HTJA 4U0VA 1IRGA 5CVJA 1X8EA 1KU2A 2FXAA 3WGIA 2CQKA 5CVVA 1CX4A 2F4PA 5K1YA 2BNNA 4N0BA 1Y3TA 5E16A 2E7XA 4HBNA 2XRNA 3QRFF 3V8LA 1ZRRA 4ASNA 4Q29A 1HKQA 3SCFA 5K5OA 1ZG3A 5I0TA 4ENKA 2GU9A 3FHZA 3DL3A 2GZWA 1WQ2A 3BCWA 4X6RB 3EHKA 1V70A 3FJSA 3IHUA 1BJAA 1OD5A 2F5CA 3ROUA 4Q0QA 3J81Z 5FLJA 3F8BA 4J1XA 3QU6A 3H3ZA 3K9TA 5IT3A 4ZYEA 3K1PA 1UFMA 2CWEA 2E7WA 4AQ2A 3HUGA 2FRHA 2GA2A 3GFJA 1FYLA 2DLLA 2PQQA 4P96A 3SCHA 5E17F 4ORFA 2EVXA 2Z2SB 4KU7A 3KEOA 3LWCA 3FF5A 4LEJA 4GYGA 4XLNF 1KU3A 1ZGJA 1D8KA 2P6SA 3F8CA 2IXKA 2X0LA 2VBWA 4G94A 4M73A 2ADUA 2IA1A 1Q1HA 2CV6A 3ZQ7A 4OINF 1CAXA 1CAWA 2TDXA 3ZMTA 1SFUA 2B9UA 1BI1A 2P4WA 3LQRA 1I1SA 2QQAA 4DQ2A 4I98B 2EFOA 1STZA 4X6QB 3I4PA 1QZYA 2UYBA 3RPQA 4ZZLA 2DPDA 5HS8A 2VODA 3ZMSA 1ONVA 2OD5A 4LGWA 1CAWB 2RQPA 5L3EA 3N97A 1BBYA 2VC0A 4HX4A 1SQ4A 1QGPA 1K78A 3G3ZA 3NQOA 1XSDA 4KIFA 1ULYA 2XVCA 2MD5A 3VODA 4M6YA 3CUOA 1X7NA 2VN2A 2CSOA 4BHBA 1IN4A 3EYIA 3EETA 3H7YA 2Y48A 1XE7A 4G7OF 4M71A 3ES4A 4D7TA 3IC7A 2HQNA 4I0AA 2H09A 4LUKA 2D5FA 2XAQA 3R61A 2VPVA 2VECA 4AVBA 3LAPA 4Q47A 4PIYA 2G7HA 3VFZA 3R0JA 3FXQA 3U1DA 1W7PD 5AONA 1U5TA 2Q2EA 4G6QA 2GWRA 3RI4A 4CXFA 2DTRA 1XDUA 5L3GA 4RGUA 3O3KA 5FFXA 3GUDA 1P92A 3FMRA 1LNWA 4ENJA 1WLTA 4HDVA 4O6JA 5A2QK 1KU7A 4KL1A 2B5HA 3G7DA 4YFXF 1S6LA 2B8MA 5FPZA 5I8TA 2CO5A 3GFMA 5HLGA 4EM1A 4MGIE 3SZPA 4WXCA 4MV2A 1FXZA 3O14A 3FXUA 4RGSA 2VE8A 5D5UB 4FBFA 3T8RA 2QQ9A 1MD0A 1SD5A 1SD7A 3MYXA 4AQ6A 4RGXA 1HW2A 5JI6A 5D4SA 2FBKA 2JPBA 1OKRA 3KFWX 4UNOA 3GX4X 4OIOF 1MJ9A 5FCCA 4FT8A 3HRTA 2UXXA 5LGTA 4WWCA 1A04A 4A0XA 1YHFA 1B9NA 1XCBA 4EJWA 1G4DA 4M6XA 3CF6E 2ATFA 1IW7F 2OQRA 4JBAA 3W6JB 3G73A 1MJBA 4JTNA 4UVCA 4XF0A 4ESJA 5LGUA 3VOEA 4HVQA 2E1NA 2NNYA 3TOAA 3ZMZA 5I93A 4LLLA 2YX4A 2NRAC 1OI6A 3GO5A 1NHAA 2RKHA 2Q0AA 4U88A 2D45A 3E6BA 1UD1A 1DDNA 1BC8C 4R79A 5E1ZB 2OPKA 3HTSB 2WC2A 4KNYA 4ENMA 3BPXA 3ETQA 1HW1A 4HAMA 1X8MA 1RC6A 2W85A 4CYDA 2PJPA 2M5WA 4OU0A 4XFIA 5AVPA 5K8SA 3KE2A 2Z9OA 3U0ZA 1JXSA 4IEUA 4FAHA 3KP7A 2IVMA 4NHJA 5HS7A 2QVSB 1JE8A 4PIXA 4UHTA 3K2ZA 3VHRA 4NB5A 2F5DA 2G9WA 3LA2A 2HKOA 2OA4A 1SMYF 4IF4A 1YO5C 3ML6A 3FZVA 3GFLA 3HHGA 1QBJA 1YFHA 4LLGF 4MQ9F 2Y0OA 4ZU5A 5D5WB 3I58A 2I45A 2E9QA 5DV5A 2HR3A 2FEZA 2ESNA 3SHRA 3ZP5A 3RKYA 4CO8A 1YFXA 1PP7U 4IRIA 5FO5A 3RIRA 4R1HA 2OBPA 5CVRA 2M8EA 4E70A 4ZZDA 1Z6TA 3F22A 5KHHA 3K1NA 4UXAA 3QPHA 2M87A 1XCVA 4G7ZF 4IEPA 2PTMA 2PFBA 4I7HA 1P4WA 1IRFA 3CDHA 2KJCA 3PLQA 3WE3A 4I2OA 2OZ6A 4PDKA 4XSXF 3HT2A 2ISYA 4HV5A 3VEPA 3SXWA 2D40A 5BS6A 3BZ6A 2FNAA 1ZZ7A 3BALA 2K4JA 2EFPA 2RNJA 2DQRA 1RUNA 2M45A 4JTOA 4HV6A 2EWNA 2XKOA 5IT9Z 2XLFA 2KKOA 2Z99A 4IJAA 4A5NA 2LF7A 3MCZA 1MKMA 3M7GA 1DZTA 3P9IA 1J1LA 2MA3A 3EQLF 4EQQA 2P5VA 1KQ8A 1FZPB 1IPKA 1UCRA 3BJ6A 1D5VA 2ZKLA 1ON1A 2CYYA 1DUXC 1D3YA 2ESHA 1OMIA 1QXJA 1WRJA 5FLIA 3HQXA 4ETSA 3KP2A 4BQAA 3HTUA 2ETEA 1LDDA 1IZ1A 3E6MA 1IAWA 1T39A 2JRTA 4CGZA 2L01A 2M30A 2KIFA 1TQPA 3CO2A 1L0OC 2VONA 4H7LA 3U10A 4HX7A 3CLOA 3GEZA 4LLOA 5ICCA 4Q4ZF 1QQIA 2IXHA 1EH6A 4XFGA 3L9FA 1AWCA 3KLNA 4IEXA 1S3JA 2DU9A 1DPRA 2L4AA 1U8RA 1X82A 2Q30A 5AIPA 4A5MA 1H1IA 4IESA 2DI3A 1J3PA 2G7UA 1U6GA 4S05A 1LVAA 4I3PA 4D0PA 1XSXA 4L11A 4M9XA 3I59A 2OAZA 2VBZA 4HYEA 5KHKA 1XB4A 1OPCA 4UBGA 2Z3YA 3LFKA 1R22A 1J58A 3DN7A 3LAJA 1SAXA 1J5YA 1XGSA 1USSA 4MGRA 2YR2A 5L3CA 3DPLC 2OYZA 1FP1D 4KT5C 2HTSA 4R8HA 4RB2C 1EH8A 4U7BA 5BOXA 2PN6A 1G3YA 3CTAA 2DPUA 1PM7A 3I59B 4PGGA 1UIKA 5BV6A 2JZYA 4KU8A 1U12A 1YLFA 3D82A 5DCMA 5JR3A 3GVAA 4HW0A 1IUYA 3WTXC 3L09A 2O8QA 5D1IA 1GQGA 3SFZA 5I8YA 2NNNA 5LLQA 3QAHA 4KIBA 1TQIA 5FD5A 3PQKA 1TLHB 4G6DA 1W4MA 4YNIA 4ONUA 4M9SA 3TOBA 2EFQA 4LTAA 2X4HA 5IT9K 1P6RA 1FPQA 1RTVA 5DCMB 1FBSA 3QP5A 4EROA 4Q48A 3MFKA 1QZZA 4Y17A 3C7JA 1UCXA 2ET7A 3PVBB 3CL1A 2HFHA 2UWMA 3H1YA 4OLLA 5D6FA 3OGJA 1HBXG 1V3FA 3E5QA 4KDPA 2HOEA 4AIKA 2V1XA 4RAYA 4QMAA 4P9UA 3MZHA 3ZN0A 3RKWA 3DFGA 2P5LC 5CJ9A 4XFHA 1JGSA 1IXCA 1JHFA 2AXLA 5LGNA 2XROA 2XAHA 4L9NA 1YS6A 1XGMA 3SQNA 3TO6A 3Q9SA 4IEWA 2H27A 3JSPA 1LR5A 2IXLA 3CEWA 1XGOA 1R58A 1NE6A 3HIFA 1NXMA 1BIAA 5A2QZ 3O2PE 3BOQA 3H3UA 1I27A 3W6KB 1G3TA 3NKTA 4EMSA 3NJZA 5I0UA 2LSOA 3GXOA 3QP6A 3KP3A 2XLAA 3K1MA 4KICA 1FC3A 5J8FA 5LEJA 3ST7A 5I8SA 2V6CA 1MGTA 3FMQA 1ZN2A 4M72A 1CAVA 1Z9CA 3LZZA 1OYWA 3WW3A 1G3SA 2D2WA 4L9TA 1JHHA 1LDJA 1DPUA 3T0YA 1MZBA 4WVZA 2BV6A 4BNCA 1DZRA 5E1RA 3JAMK 4RB1A 2EA2A 5DDGA 1H9GA 4I01A 4EWEA 1D8JA 1UPIA 3E97A 2ISZA 3FHIB 4YYOA 1TW3A 5LRRA 1CAVB 1ZRCA 3R6SA 5L3BA 3WTVC 2DT5A 2NS0A 5ICFA 4M74A 4PIZA 1R5GA 1MJAA 5L3DA 2GQQA 3U9GA 2EJRA 4EVIA 5K5QA 5FDBA 2PHLA 2GIVA 2OZUA 2CW0F 4HLYA 4NVPA 4LB6B 3UKNA 1FBQA 4AD9A 5F64A 2ZO4A 1CAXB 5BXXA 3T5XA 3RYKA 5J7MA 1XDSA 2IP2A 4KUMA 2Q0OA 3M8EA 1VTNC 5BMZA 4GULA 4F8AA 3V7RA 3ES1A 2WTEA 3B73A 5J8CA 1ODDA 4O3MA 4RS8A 1FYKA 3IWZA 3R60A 5FPXA 2VE9A 1W5SA 2PAMA 2W57A 4JQFA 2MH9A 1FYMA 4OIQF 2GA1A 4HSJA 4H0EA 1Q43A 4R52A 2QQBA 3GW2A 4P5OA 2ZMEA 1H0MA 4P9GA 3FMSA 3SCGA 3C3WA 1PUEE 2DK5A 2EFNA 1K78B 3BJAA 4YG2F 4EGYA 1BI3A 3KCCA 3S0MA 3GBFA 1YW7A 3WTYC 2GC0A 3IBMA 3F23A 3CJNA 1ZG1A 2HYGD 5LRSA 4LULA 2QBYA 1XRUA 5FGMA 4YRDA 3FWEA 4EWAA 1X3UA 4IHTA 4DNCA 4MGYE 4EJUA 1XE8A 2PA7A 4KWLA 2QZ8A 1WWXA 3H7JA 1F1ZA 5D5XB 3SXYA 4GCVA 1IN6A 2XAJA 2QENA 1J2XA 1U5TB 3PQJA 4U0YA 3E5UA 4ZYDA 3M9AA 2QLZA 2EAAA 4AWXB 1YQAA 4B8XA 2XGXA 3EO6A 2WV0A 1ZZCA 2IA0A 1USTA 1XN7A 2QNKA 1GHCA 2KRFA 3H1WA 4MTEA 4ON0A 3PFIA 4OOIA 4N9HA 4L2NA 5KHGA 2ZXJA 3WU1B 2CG4A 3HSFA 4Z07A 3WTSC 2J5PA 3QPTA 5C8WA 1QXRA 4KMUX 3M1EA 4XFFA 5KK1A 3H9AA 4A6EA 5E1WA 1BIBA 1YWKA 5CADA 4OIPF 5H6QA 4IPAA 2GXGA 1UIJA 3H50A 3OV8A 3BP8A 5DEQA 2PAKA 3ZMUA 3E3VA 4IXAA 1Z6RA 4IRHA 1W5TA 2A68F 4U0WA 4UVBA 1O3SA 5HVQC 3QACA 4PCQA 2MC3A 5FB2A 2MHFA 1TNSA 3WG9A 4BXUA 2JTVA 3I64A 5DD8A 3HT1A 1ZRDA 1LJ9A 2A61A 3FZ3A 4IEYA 2VOPA
chains in the Genus database with same CATH superfamily
1XSVA 1ZAOA 3A1YA 2O14A 1T6SA 3WDUA 1T2XA 5A3LA 3E5XA 1VAKA 2R073 2ZEWA 3F21A 5FZ3A 1BR2A 3AYAA 1UNBA 5E3MA 4HX8A 4BIFA 2C1FA 1RUF2 2D3PA 2Y33A 4XW3A 4OQ9A 3VYRB 1AL21 2STTA 3MDPA 5EZHA 5DYMA 3LSKA 3ULQB 5IT6A 4UWDA 2R7OA 5IFPA 3AC0A 2ZZJA 2IXIA 3LPGA 1HB2A 1PMHX 3LEIA 4RM3A 1MQTC 1R1UA 3RZHA 1X9TA 3CHXA 1W6MA 1QKQA 4AYBA 4FHTA 4CDQC 4XURA 1OCRH 5FY1A 1DLCA 4HVRA 2O03A 2QYOA 1UU5A 5CVUA 4K6BA 2JSCA 1H8TA 2DVAA 3VHNA 3AKTA 3DYPA 1NG0A 2DFCA 3RJRA 3S8PA 4FPLA 1V5GA 1U5TC 3PDQA 2LY2A 4AFAA 2R7XA 1ZYRF 3GFIA 1WLDA 3GTQJ 3MLJA 4FPCA 1J75A 3JRDA 3ZQCA 2R92J 3H9JA 1HRI3 2NVXJ 1LNSA 4NBQA 3NWSA 4C2MJ 4WM8C 4XQFA 2DUPA 2DFBA 5IK5A 1Z1DA 1XYPA 4BDVB 2DDAA 3WD5A 1O8SA 2HEWF 3ABTA 1CZSA 1K12A 1UHWA 2XIGA 2EV6A 1ZBE1 4Q0VA 3H8OA 4Y1YA 1UW8A 5BPXA 4DRRA 3UESA 5JIAA 4YARA 2LNBA 2STWA 1W9TA 1IDZA 1L7LA 2R7ZJ 1GV9A 2Q4SA 3FM3A 3C18A 4P5YA 4BK4A 2AEYA 4HF0A 2VCCA 2HWF1 4YVWC 3FXRA 2PI0A 3DV8A 2J22A 4FXGB 1W3VA 2Q1ZB 2UY8A 5FTTC 1HKSA 4A3FJ 3DXUA 3ZOIA 2E1MB 5E18F 4IEQA 4OFGA 4EJTA 3CJIC 1IRZA 3HSRA 4L0ZB 1OLQA 1ULEA 5B5EC 3TOJA 3ZSKA 4JGZA 2R7DA 1RL3A 1W0NA 1FY7A 5C4WA 3I2DA 1DBNA 1WJFA 2RDSA 1SLAA 3CJRB 2VNOA 4RGKA 2IC1A 2PEXA 4LKEA 3BCBA 2QE3A 4MHRA 2VC1A 3POSA 2GNTA 2WZR2 4AGGA 4L0PA 4F83A 5ERIA 3OYBA 2DVGA 2EQRA 1LULA 2VUMJ 3B7MA 1F4HA 4PQQA 2X1EA 3H35A 3VL9A 3GTMJ 3VV1A 2EZHA 5KXBA 2BTVC 3RZLA 4N43C 3QODA 3VBRC 3OYFA 2CW7A 2LR8A 1V55H 5JSRA 1YITI 1GOFA 3I4IA 1FTTA 1W8HA 5B1AH 3PUSA 3TP0A 1H1MA 1HXDA 3VUOA 2ICWG 3M70A 1HSTA 5K5RA 3L2CA 2VJXA 2ZKNA 2D5VA 2ZJQF 5CLSA 3BY6A 2HWB3 5EFUA 2XV4S 1COV1 1AHSA 5J48A 4XEZA 4XZUG 4AVCA 4II3A 3IKVA 3UNGC 5JHUA 4A3CJ 2CUFA 2Z5WA 4Q4X1 1F36A 3M8JA 3LA3A 1A5JA 4RD7A 2DJIA 1N1SA 1W8WA 3K3NA 2R7FA 1WSUA 1WW7A 2B42B 3M1HA 5JOZA 2B9SA 4EN8B 2VKDA 2WT0A 3OGSA 3ZO0B 3I56I 3FK6A 3EUHA 5H2FC 3EYPA 4YGBA 5LCWL 1H9TA 3KVBA 1YRNA 5M5YJ 2K40A 1QH6A 4FPYA 4P9JA 1T0FA 4YZ5A 2P1BA 4JV4A 3IV5A 4XF4A 5D5VB 3N9LA 4BHCA 1AYN1 1QWRA 3OD0A 3NNGA 4RL7A 3RYPA 5HS9A 1VBD3 4QX5A 2OCEA 1BMV1 5M0TA 1VP6A 1ODNA 1LEAA 3MLKA 2PLV1 1OFCX 2WO2A 3SH4A 4YEJA 1AR92 1VRH1 4QGNA 3RMYA 3FXOA 1GSLA 1F43A 2UYAA 3ZMDA 3B9CA 3ZXKA 3S1NJ 2I74A 3KP6A 3I2IA 2ILMA 3BIWE 3ILFA 2DMNA 4B3XA 5A6XA 2GM4A 1I9RA 5GLUA 4CUGA 1ND2A 3AG4H 2Y60A 1ON2A 2GNDA 1WI3A 3OUIA 3CJXA 4I0BA 3S15J 4AXOA 1WH7A 4TSVA 4XICA 3TO9A 1RUE2 1Q8PA 4HSLA 2WNEA 2HQRA 1ZZ8A 2Y6LA 2KDZA 5EDNA 2A5WA 5J36A 3N7MA 5GZDA 2CSGA 4CCLA 3A4UA 3G2BA 2HEOA 4M3CB 4FO9A 1ZRFA 3FBYA 3VDDB 4Z2YA 2KIUA 1TC3C 4XLPF 3OEAA 4BM8A 1LOCA 2ZA9A 3ZFGA 1W2TA 3VBHB 1QJX2 3BKZA 3E0JB 1IN7A 5GM0A 1YI9A 3VBSA 1OT5A 4L0YB 3LNQA 3JRIA 5BPDA 1XYNA 5TJJA 3TNPB 4PJNA 2ZGLA 3CJQB 2TRTA 3CDIA 3LWFA 2RS32 3GF2A 3WU0A 2GC1A 3ACLA 4QDRA 3RZDJ 5I91A 5FY0A 1DU6A 3RZMA 5HDNA 3CO6C 4GRIA 1REPC 1FMD2 2ZBJA 2PHTA 3CCYA 5HCBA 2EXHA 1SLCA 1NE4A 5FP3A 3OCPA 1TQ5A 1JI8A 1TT5B 5GAEJ 3ENRA 3ZMOA 3P7NA 5F0FA 2V1UA 5A1FA 1AF9A 3CO7C 2JWTA 3M3EA 3ABUA 2WNUC 3REOA 2V9VA 2WWUA 4QX0A 2JRMA 1VBE2 3CZ6A 1GYKA 2W9XA 2LKPA 2ZHNA 4HKLA 5F27A 1RZ4A 1WVRA 2A70A 3S2WA 5ABJA 5ACA2 5ICGA 4MUVA 2IXCA 4OYUA 2MSYA 4RSUA 3EDPA 4A0ZA 3WUDA 1DFQA 1P8JA 3PUFA 5FP7A 3HAGA 1K6YA 4O5VA 4UBHA 2MNGA 2C26A 3EUAA 2R0FA 5BNPB 3V42A 1QNWA 4A12A 3ETPA 1AR73 1LUJB 3RJPA 2RS13 3ZSEA 2ZX2A 2O6GE 2F4MB 1WGPA 1RVF2 4II2A 2HYKA 4MADA 1IRXA 5A6ZA 2VU9A 2QUFA 4NRMA 5J4YA 2FCVA 1R081 1NLRA 1RETA 2Q8EA 2EZIA 1V00A 2HEVF 4XBFA 3WTZA 2A5ZA 4OZOA 5ICEA 1TMF3 2F17A 1B8IB 1HN1A 1PMIA 2N7GA 3H8RA 2EIMH 5IVCA 1OLME 5L9VA 3VPRA 1GP5A 2LDUA 2W1WA 1V9U3 3I53A 4HVOA 3WG3A 3SH3A 4WCGA 1BEV3 2V72A 3L7WA 2VBDA 2ZHKA 3WP5A 5EXOA 4EM0B 5H20A 2IFRA 3NNLA 2WO7A 1DGWA 5I0SA 4HFSA 4ZXEA 4AOCA 4LFUA 1YQCA 4CVUA 1RITA 5F37A 5CFDA 2OQ7A 1RIOH 1ZYBA 1C3HA 3IN9A 3SNMA 2I2SA 4XDOA 1XSQA 4ITVA 2RMU1 3OGGA 4CU8A 3AYEA 4E7SA 2EXJA 2HQ5A 1J3RA 1HSJA 1GXPA 3O1MA 1QO0D 4G9YA 2BNOA 4WK8F 2FQPA 3WGHA 1SZBA 4UUSB 3HR9A 2X6WA 3RZJA 3V65A 4BQ2A 3ZQGA 3RG0A 4ZYGA 4A3BJ 3ZDSA 1UMHA 5GLVA 3OIOA 3IPVB 1W6PA 1QQP2 1NCRB 3M8FA 4KJZA 3JSOA 5DAQA 4U2AA 3VYTB 3VWBA 1MDMA 2R32A 4HOBA 3DGTA 1W9SA 3NW4A 4N90A 3FXLA 3VGIA 3GTKJ 1RKWA 2XR4A 4GWIA 3T0AA 2LVSA 2K02A 2L9RA 3VHOA 4AIDA 1F5JA 4Y5TA 1WA6X 5L7OB 2E7TA 2OZJA 5ERLA 1O3TA 4BA6A 3D5LA 5GPCA 1S29A 3OYJA 3HOXJ 1VBA2 3OL4A 2XF6A 4KGGA 1WI9A 4LJZF 1MBHA 3GGLA 4H4KC 2XHNA 1HDPA 3F8MA 3HC7A 3ABKH 1YJKA 3PUHA 2X8KA 4EJRA 3HPNA 3QLQA 4YW2A 3AKRA 1J1TA 1ONAA 1VNDA 4OHZA 4HLXA 4BUPA 1PX4A 2VXRA 2DVFA 5JSPA 1X33A 1IKPA 4I76A 4LK7A 3BOWA 1N78A 1LODA 1QJFA 1RUE3 3W2AA 5DD4A 4P9FA 5J6XA 5CKNA 1FT9A 1VQ7I 4OHWA 2HXIA 2EA7A 2P5KA 1PGL2 3THPA 5HCAA 2L54A 3DKWA 1I1GA 1UB9A 3NVCA 3WSOA 3WLUA 4Y24A 3TWIA 1X3ZB 2VASA 1TWGJ 2VOXA 1D7PM 5JHFA 5SV8A 1PM4A 3ZFFB 3GYDA 3CCSI 4OCTA 4UW4A 1PGW2 4ESFA 2XL7A 4W65A 1QHHD 1QJX3 3IL2A 2K7LA 1SD4A 3OYLA 1YW9A 2RS33 2PN5A 4CZZA 2VBXA 1LHUA 4XSZF 2O1QA 2P8TA 3C1DA 1BR1A 2LKSA 4IERA 4HEA2 5HDGA 4XVHA 2BDRA 1PJRA 4XQDA 1KDKA 1D1AA 4XF1A 3FHAA 4OUSA 3MAJA 1UY1A 1T6GC 2MEV2 2SLIA 1G7YA 3CP8A 4X0GA 5DUWA 2V4VA 4KWKA 1UYXA 2H0VA 1IC8A 5C3RA 4DO0A 1ZBA2 2RJ2A 1VI0A 2CHHA 4IEOA 2YGLA 3ASNH 4LE3A 4KA4A 2L7KA 3ASIA 3AX4A 3EBRA 5J3UA 1F5TA 4P02B 2WT2A 3USSA 2WL1A 3PL8A 5GZGA 5HCHA 1I6XA 4XFCA 2AEZA 3CF5F 3Q9VA 2AUYA 5BUVA 1NXD1 2FBEA 3VB2A 4C9YA 2O8KA 5ACA3 3IMNA 4QHBA 5HLIA 1ZX5A 5FMOL 2VXZA 1K4TA 2VZOA 4Q4V1 5J96B 3HB9A 1H9PA 1LOAA 2LM3A 2RVCA 4CPBA 1QOSA 2FZ1A 3BWGA 4S0HB 1YC61 1H8TC 3S32A 1TW2A 3LSGA 2P7VB 5L19A 2PFWA 2VMDA 3F0CA 1LQ1A 4WX9A 2JB4A 5D8AB 5C70A 4XMYA 1JZ2A 2LW8A 1VQMI 5FBZA 3CESA 3GHNA 2VJIA 2R16A 4XRFA 1UF2C 1IG3A 2XB0X 5CVJA 4ARYA 2L9NA 3FK7A 3IDAA 2FXAA 1BVP1 3ZXJA 4KWUA 2CQKA 5CVVA 4QAWA 2XOMA 5FYBA 4AI8A 4LO8A 2F4PA 1WLCA 1Y3TA 2WNVA 3ZPYA 2E7XA 4HBNA 1OQEA 3V8LA 1ZRRA 4Q29A 3GCXA 1QMJA 3SCFA 1ALYA 5I0TA 1IGOA 1QDCA 2QCOA 3WNXA 3BCWA 1Z0XA 1UX6A 3EHKA 5DAXA 5CPRB 1NLSA 3IHUA 1KS5A 3JRAA 1POV0 3F8BA 1HQLA 2WJSA 5IT3A 1RHI2 3DBHB 3GBGA 1YJWI 4AQ2A 3HUGA 2FRHA 3Q3SA 1X1AA 1BXHA 2R7TA 2IGMA 1V6IA 2PQQA 1IG7A 3X29B 4QWNA 3T4VA 1RUJ2 2X10A 4JGZC 3LWCA 4YVSA 1LOFA 5C4WC 3FF5A 4CSWA 4BOWA 5FXVA 1D8KA 2P6CA 3TN91 4RA0A 3F8CA 5EPAA 3MIGA 3HEFA 3AJZA 4IE5A 3ZMTA 4W4ZA 2O9LA 3LQRA 1I1SA 4GJZA 4DQ2A 1STZA 2D97A 2YS9A 4MG2A 1QZYA 1H4GA 3HJRA 4B3NA 5HS8A 1JXNA 3L2VA 1ONVA 3LEGA 3O1UA 3TBDA 3U1KA 2RQPA 3N97A 1BBYA 4XN3A 2VC0A 2EICA 2VZSA 1XSDA 5BYNA 1OA4A 1ULYA 5KXDA 5JWPA 3D5OA 4A3ZA 1S7EA 1KFXL 1IN4A 3IC7A 1VBA3 3WNPA 3UL2A 1YO8A 3GLLA 2H09A 5CKTA 4LUKA 3R61A 1YCIA 2ZFUA 2QKLB 2RDNA 2VECA 4BISA 3PUAA 2VZ1A 4CRQA 5FXXA 3VFZA 3R0JA 1F15A 5A1AA 2A05A 3FUOA 1CPMA 1BBT2 2Q2EA 2UWAA 4G6QA 3OSDA 2W3JA 3C8XA 3SISA 4JRLA 3U07A 3GUDA 1LFBA 4JC1A 1P92A 5LFAA 1AR62 1WLTA 4HDVA 2X1CA 4O6JA 3RSNA 2W39A 1R6RA 5KXEA 3EUHC 2ZGPA 5FPZA 5I8TA 2CO5A 1ULFA 5APAA 2XVKA 2XGEA 5HLGA 4EM1A 1T0FC 4MGIE 3BG5A 3UKGA 2HOTA 4QX2A 5A32B 4MV2A 4F3QA 4KI5M 2Q8CA 4KBBA 3G6JB 2Z16A 2F48A 2VE8A 3U14A 4FBFA 2JDUA 2GMEA 1SD7A 2VVEA 3QQAA 5FZ6A 2H1LA 5BNNA 3AJYA 5J09A 2HQAA 1RJ8A 4QPGB 1YHFA 1A04A 1ENHA 1B9NA 1US2A 2R0QC 2FQ4A 2BZDA 3BTYA 5IW0A 4CDUB 2ATFA 1IW7F 2BP6A 2JEMA 3W6JB 1ND2C 3AKQA 1W8ZA 1AYM3 4XF0A 3P1IA 2M7AA 4GQ7A 4ESJA 2E1NA 5A7PA 3MIEA 4NIIA 2YX4A 1S0BA 4DYQA 1NHAA 4U88A 1EV13 5LB6A 3LSIA 1UD1A 3APBA 5JMOA 5FLVA 2LY9A 3OJBA 3JBG3 1GNHA 3I2GA 2WC2A 3J9SA 1OD3A 2VM9A 3PUBA 4ENMA 1X8MA 4M3DA 2E71A 1RPWA 2PMWB 4CYDA 2PJPA 2M5WA 4XFIA 4J01A 5K8SA 4IV3B 1Y0NA 3GZEA 4Q8LA 3U0ZA 4IEUA 4WM7C 1E3OC 3ZFGC 4GB32 3KP7A 4CP2A 5FMDA 2BQPA 4B48A 1JE8A 4GKXA 2WB1N 4UW3A 3VHRA 4TTGA 3FZVA 1MH4A 3BG6A 3ZXAC 2Y0OA 4YPJA 4ZU5A 3FHNA 5C44J 2Q8DA 2I45A 5DV5A 4UT5A 4FQGA 3ZP5A 4A3IJ 3QPLA 3VSKA 1NCQB 1YFXA 3QH6A 1PP7U 4PI0A 3DKQA 5TSWA 2OBPA 4RAGA 2M8EA 2R7SA 4ZZDA 1Z6TA 5T50A 5FO7B 4UXAA 2M87A 4LOSA 1XCVA 1GZCA 5JZGB 3CC4I 1P4WA 1IRFA 3CDHA 3FC0A 1QRYA 3K4CA 4CDXB 3H1CA 4B4PA 2V73A 2ISYA 4HV5A 4UFJA 3H0GJ 2D40A 2XF7A 1LOGA 3PURA 1ETWA 3AL5A 2K4JA 2HPMA 3MKZA 2IXSA 1PYVA 2M4KA 5B2GB 3WDXA 4HV6A 5A7WA 3KV9A 1S55A 2Z99A 5ABJC 2FCTA 3MCZA 1MKMA 4P9IA 1ENSA 3WDTA 3M7GA 1US3A 2ADEA 1WJCA 4GZ9A 2R042 1RHI3 4EQQA 1PX3A 5CEHA 5JMCA 1UCRA 2ZKLA 1D5VA 3LOBA 1VB2A 2W1QA 5I0DA 3BTZA 1QH7A 1OMIA 3MKWB 1QXJA 1WRJA 3BG9A 1RUJ3 1D1BA 4XRMA 4EZ4A 4ETSA 3BPSA 4MXWA 2EXIA 1ZRIA 3NMBA 1SVOA 2V5DA 5IVBA 1IZ1A 4E4HA 4Y4RA 3RZGA 2K9NA 5DM7F 4BY7J 1IAWA 1R091 2UWBA 3CDZB 3K3OA 2L01A 4QQLA 1I1EA 3CO2A 1A3KA 1L0OC 2VVFA 1OPMA 3CLOA 1J09A 4LBNA 1QQIA 1VBC1 3L9FA 4F91B 2P6HA 5EG0B 1Y9GA 2D3SA 4IQPA 5J37A 3SKJE 4IESA 2ME0A 1TL8A 1U6GA 2CNAA 4P9XA 4I3PA 2ZGQA 4CCDA 5EGOA 1XPXA 3ZKYA 3HBLA 1XB4A 3KHCA 1OPCA 2HOSA 4M3EA 2VL4A 2M4GA 1J58A 1W03A 1J5YA 1USSA 1KZHA 5C3OA 5CFDC 4YM2A 3A2KA 1FP1D 4IE6A 2FOWA 3LFUA 5BOXA 3CTAA 3VSLA 5F6LB 3T2OA 3BCAA 4QQPA 3D82A 1WUVA 4D5CA 5JR3A 1MMDA 4IX7A 3LD8A 3GVAA 1IUYA 4AC0A 3BTJA 5D1IA 5J1RA 3KYDB 4BJ6C 2NNNA 5LLQA 1UMQA 2XJSA 4B4QA 2VPLA 5EJ1B 2HWD2 3PQKA 2DXIA 4KNCA 2B9VA 4G6DA 3ZXDA 4AFCA 1MMAA 2V6EA 1AR63 5F3IA 2AR6A 2WAAA 3AP6A 2RG4A 4NRPA 3RCOA 1FPQA 1JZ4A 1RTVA 1CZTA 2R0HA 4HKOA 1Z7S2 1N1VA 1FBSA 3WCRA 1QOTA 2IEKA 3Q8FA 5FYIA 4GJYA 3RSJA 1RXGA 5H9PA 1YI7A 3WP4A 3LSJA 1HBXG 3D5RC 4XBNA 4AYUA 4RAYA 4QMAA 4Z6YA 3RKWA 1ZELA 4NWWA 3HGYA 1MBGA 3S5AA 1H30A 1QJY1 3PU8A 1OF3A 3U78A 3RS6A 1AZDA 2VNRA 2DCEA 1W2AX 1UY2A 2WWJA 3GBWA 4F93B 1YIFA 2H27A 1NE6A 2ZABA 2CDPA 3H3UA 3W6KB 3NJZA 4HOOA 2K3FA 2LSOA 1MS3A 3AXEA 4ATEA 3USUA 3I2JA 1HKDA 3J8F2 2Y31A 3POWA 4KICA 1FX5A 1GLHA 3H5AA 3S6PA 5A7SA 1S4CA 2HYXA 3FMQA 2JIGA 2RDQA 4AI1A 2NM1A 2V9PA 3WW3A 5M3FJ 5JVGF 1REDA 1G3SA 4L9TA 2D6KA 5IVEA 4KT6A 2BBAA 1APNA 1MSFC 1FTZA 3T0YA 4J6GA 1VQ4I 4BMBA 4BNCA 4GB33 1DZRA 3VBOB 2PMZN 3BG3A 3FHQA 3CMGA 4I01A 4NPMA 4ANJA 4YG0A 5IWFA 3HKZN 2Z79A 1VMFA 3R6SA 5FY4A 4M74A 4L8QA 1HIXA 1MJAA 3U9GA 2GQQA 4BGDA 4EVIA 4KITB 3J7AY 2R7RA 5C8CA 5JPMB 2OZUA 1ND3B 2B39A 3RWKX 1JTXA 2JDNA 3UKNA 2BOLA 4B1MA 2ZO4A 5GTHC 4IO9F 3RYKA 2KLOA 2A73B 1ZA7A 3KT4A 4QX3A 5BMZA 4GULA 2AENA 4F8AA 3GTLJ 4R4XA 2VXDA 3B73A 3BTLA 3KD4A 1DGWX 1ODDA 5AC91 5J3LA 1FYKA 4TN7A 1YNAA 2Y0IA 5FPXA 2PAMA 2W57A 2KHMA 2MH9A 3DPRB 3W9AA 2GA1A 4R52A 2ZMEA 4ZC3A 2RNGA 2EFNA 1LKXA 3BJAA 4BPZA 2WINB 4EGYA 3GCWA 3S0MA 3ACGA 3K7AJ 1MQTB 1UMZA 2RDRA 2YGMA 5CQGA 2XVGA 3CJNA 5FROA 3K70C 5LK7B 1UN1A 5K0UA 5E89A 1MW7A 4LULA 2ID3A 1POQA 2ZEXA 4OMDA 3D4KA 2DA7A 3C7FA 1Y8RB 4DNCA 4MGYE 2PA7A 4KWLA 2J7MA 2JJ6A 2WSUA 2QZ8A 1WWXA 2VOWA 4AI2A 2MG4A 3KX2A 1J2XA 1U5TB 1RUI3 2W68A 3LDBA 4XAAA 3E5UA 4DOUA 1PVC1 2QLZA 3AVRA 1JKRC 3MN2A 3M3YJ 2K9MA 3TEWA 2EAKA 1MS4A 1UHSA 2VMCA 5FY7A 5JOWA 2DVBA 1O59A 3GTJJ 2KRFA 5GPAA 3H1WA 1RB8G 3TEXA 5F04A 1K5MA 4ON0A 1Y7BA 2KA3A 3SDGA 1BK1A 5KHGA 2ZXJA 1YJNI 1S0FA 4Z07A 3WTSC 2J5PA 3OYHA 5C8WA 3A01A 1QXRA 3ZGKA 1C28A 3G1MA 1BIBA 1YWKA 1PO22 4YVWB 4IOCF 3H50A 2HDWA 5CBLA 1MNMC 2XQRA 4RGGA 1EA3A 2DT7B 5A70A 5CISA 4U0WA 3DEMA 4UVBA 5HVQC 4HKWA 1ETQA 3QACA 3TYJA 1W36D 1COV2 2LMDA 3CC7I 4XMAA 3DPUA 4FPGA 5FB2A 2DMQA 3S3OA 1XNAA 4YVSC 1LOFC 4AVZA 1XC5A 3I64A 2LLKA 3M1CA 1KFUL 2G1MA 3DF0A 2VOPA 3OY9A 4HQMA 1T95A 4J25A 4DB5A 3KZIC 3HWJA 5ILVA 4V1PA 4EN6B 1TNTA 1DGRN 2ET1A 4PI2A 4LITA 2DQLA 3KSCA 5CA6A 1WCUA 3S7EA 1D4M2 2VZTA 1K6OA 4N43B 3VBRB 4CP1A 1GFF2 4UF0A 3BU0A 1LKNA 1HW5A 3D8CA 4G7HF 1OF4A 1BK0A 4EGZA 2QSFX 2XSJC 1BMV2 4Q4Y3 3G6EI 4Q4W1 3HZJA 3OTFA 2C9AA 4LG3A 2E1CA 2F5FA 4QKDA 4M6VA 1DP3A 4LKSA 2Z69A 1ZGAA 4EV0A 5LY2A 4CU7A 3IM0A 5CVIA 1O91A 4DPNA 1T56A 3PIOF 2L9SA 1UQXA 2NYYA 4EJOA 3JCIA 3U4XA 3AP7A 3VZKA 1OA3A 2ETHA 4DY5A 3ELNA 3KEQA 3TEDA 1J7KA 1ENXA 2YFUA 1JU4A 2WAFA 1VIWB 3J8F3 1PP8F 1AL23 1EPZA 4EM2A 1AX2A 3B02A 3T1BA 3EUKL 1Q8SA 5CU1A 1HKTA 2HWE2 3RGBA 3JU9A 3IH3A 4O9EA 4OULA 4UFHA 4INDA 2MH2A 3ECQA 2V09A 4LG0B 5JSOA 2ERFA 4WV8A 2B63J 3WG2A 4JGYA 5LW9A 3OYCA 1XMKA 2A5YB 5BNNC 5L73A 4XLFA 4ENNA 1LOBA 3W2VA 3VDCA 1JYNA 4NHYA 4MFEA 2K0GA 1V4RA 3KZYA 1VBB2 4H3WA 1G3WA 4LD5A 3HM5A 5EHDA 3IUOA 2HWC1 1W7PA 2VOTA 3K46A 1VQ8I 4U87A 3KQ4B 4COWA 1LHOA 1LHWA 1W2NA 1U8BA 4XE9A 3ZPLA 1KQ0A 5FFZA 3NL1A 2VCAA 1PNFA 4Y26A 4DEVA 3RWNA 3MMYB 3W5NA 4C0BA 5JXIA 1T38A 1YX3A 3C7EA 1KA8A 2CAVA 1OYIA 4HPKB 1FPN1 2XHKA 2L5QA 5F5AA 3L2UA 3UKVA 4P55A 4WZCA 5FWEA 1VJ2A 3G1LA 4E7LA 2P3YA 4TXWA 3UNPA 5G05L 4FX0A 3I9V2 4LHLA 3WQ7A 1ZBE3 3OYDA 3TDZC 3ME2A 2CFXA 2RR11 3N36A 1XGNA 5HDKA 4IHSA 4C3JJ 3H5RA 4AIJA 2GH2A 2FJ1A 4ZU7A 2IS6A 3V56A 4BQNA 3D1NI 3RFRA 3HBKA 3K51A 3WT3A 1C8M1 2HWF3 1MNEA 1RYYA 2HOAA 4GXOA 5EEGA 3JTHA 3N7LA 4RM2A 3H1MA 4LXLA 2FDGA 3I4NJ 2JE7A 2FOKA 1WD4A 3KVAA 3DXTA 2W1UA 4JZRA 5LHHA 2XF5A 1AA7A 5FZOB 1SFKA 1ZHFA 4YFWA 2ES3A 1GOHA 2ME6A 3RZOJ 4CCKA 2R061 1PIV1 1UKRA 3C7HA 2W48A 3T8TA 1Z3YA 3EQEA 1E2XA 2BZTA 4O7XA 1JI6A 4XDPA 4DGWB 1Q3EA 1R082 1YIOA 1SC7A 5FZLA 1NZIA 1W6OB 1RUG2 5IP6A 4KH9A 1HQCA 5LHIA 1QJU1 4K7JA 4HL0A 2K4BA 2GC3A 1GICA 3PL0A 3WCSA 4HNTA 2WNUB 2NVTJ 1RR8C 2OQ6A 2X48A 3ACFA 2XVLA 1FP2A 1WMEA 1IPJA 1R1VA 2W1OA 3NNFA 4B7KA 3M8LA 2E1OA 4AI0A 5JOXA 2VAUA 1YHQI 4G9SB 5IP7J 4P9YA 2P3JA 1AX0A 5JVVA 1WPKA 4YW7A 5IJRA 3TQNA 1UG0A 3G1OA 4OIRF 3BR3A 4KN4X 3BGAA 2XUBA 1SBDA 3L2HA 2ZGRA 1COV3 4JKKA 1DP7P 2RMU2 5L3FA 2CL2A 1CD3G 2PMUA 1DLLA 5FZKA 2KRCA 2QQJA 5C33A 2JDAA 1BVVA 3R05A 3DWLE 3E1F1 2P17A 4M3CA 2C6YA 4IHWA 4COVA 4RFRB 1JYTA 4I30A 4P14A 2X6XA 3K10A 4WF2A 3VBHA 2Q5TA 3H9GA 2XKPA 2WRAA 2BGCA 4HN0A 1ETVA 4FPKA 3AG2H 1O5LA 1JN2P 3MZ8A 2WYSA 4M3BA 2VG9A 1Z05A 2EA4A 1LTEA 5FY9A 3P5JA 3I4MJ 1E5SA 4QM9A 2XQXA 1MVQA 4A69C 1T33A 3DCQA 4ZTFA 1EH7A 4J1WA 5FYMA 2AO9A 2XAFA 1AYN3 1ERDA 3IRQA 1JT0A 1WW6A 3M3CA 1QNTA 3M3OA 2IPQX 2EIDA 4UFLA 3NSTA 2OQGA 3HRMA 3JXSA 2BVLA 4PJYA 4LK0F 2WS91 2Z33A 3RPUA 3IAQA 3LAGA 4RGAA 3ZXSA 2W00A 4LUMA 2YSRA 1VRH3 3KB5A 4CXXA 3TNQA 4FTHA 4HXCA 4B29A 2VI6A 1C8NA 2M34A 4IVNA 1DU3D 3LOIA 3IKTA 1LFPA 4GMP1 5DUKA 3VZNA 4TLFA 1Y9QA 5LHGA 1PVEA 3HXLA 4QM8A 2JUGA 2KMUA 3QOPA 3R4SA 1J83A 2GMMA 5FRAA 1AKHB 1AJKA 1DQ4A 2COMA 2EIGA 1N75A 4ZKTB 4QB6A 3VD3A 5F39A 2KD7A 3MUY1 3GJAA 3L9JT 2DAOA 1H89C 4IW3A 3IAPA 4NAMA 3WEZA 2HWE3 5E1XA 2QDNA 5E79C 4QQOA 1CJPA 3DLLF 2RV9A 3EB7A 1XXNA 5BNPA 2H94A 3FXMA 4PFPA 4YW6A 4OMZA 1ZZ9A 3M3IA 1CN1A 1U3EM 3AKSA 5F8PA 4MO7A 2J1TA 4HDUA 1GZTA 5F1RA 3D0JA 3AFGA 2E7QA 3E6CC 2P4EA 1Z77A 4QXBA 1YFUA 4DYCA 2R071 4A3EJ 1JU3A 4NHXA 4UW6A 1AUYA 3BR6A 1F4KA 5C5UA 2OU2A 2AS5F 3ISPA 1ACIA 5ILSA 1ENRA 2A6XA 2ORZA 1VAVA 2WFPA 2VC9A 4BQOA 5IK8A 4XUTA 2AQEA 3TKYA 3O0XA 1RNLA 5BPIA 2XJUA 1U9OA 2FHRA 1FIPA 1E57A 1SLBA 5FR3A 4DBQA 2VMGA 2K9SA 4IKFA 2VQAA 4A2UA 2PHRA 1U5XA 4NROA 5JLWA 2GN7A 1HOMA 5E20A 3MICA 4AEKA 4Y4YA 1OOPB 4WVVA 3H0OA 4BQYA 1MIJA 5IVVA 3PFYA 2CYFA 4B1RA 1PZ7A 2H6BA 3UGGA 1WCMJ 3CDLA 2WBKA 3CCEI 1A36A 1JYVA 2ZJCA 4JVAA 2NZ9A 2V5YA 1OSGA 1ULPA 4BKXA 2C0ZA 2BHYA 4XKBA 3KIOA 4AVPA 2DBNA 1W2UA 2NVYJ 1SHWB 2GOMA 2YUEA 3V7SA 4XC9A 4PQ9A 3ACIA 3I3BA 5C8CC 5FOJB 3LA7A 3IIAA 1EUTA 4H7MA 1S7AA 3BTXA 3VYUB 2AACA 2JE8A 1TTYA 3BB6A 4MOAA 3JUUA 3B3QE 2A7AA 2B7YA 3IPVA 1ZLJA 2KJBA 5HNFA 4MZUA 4MHUA 2FMYA 4XM3A 1BOAA 2PHXA 4FAGA 4N8MA 3I7DA 5F2WA 5GJ6A 2R49A 2GALA 1R083 3FE5A 1VE0A 3ZXFA 1E0EA 1RUG3 2L0KA 1AR81 1I5ZA 4RLQA 5ILUA 2HDDA 3NWTA 2VW0A 5L7OA 4A3LJ 4I09A 5JCTA 2PQ8A 1JYXA 2ZMEC 1SDWA 3EJKA 4BE3A 4LE4A 1H2LA 2OPTA 4HBLA 3DECA 4NJ4A 2YC0A 2DK8A 4PK4A 2C6SA 1UAAA 5LA1A 3MW2A 2K2SA 4AR2A 2YPJA 2DMPA 4MSVA 1W6MB 3W5MA 5K0UC 2YPDA 2O0YA 3ZXLA 3DYOA 2LP0A 3S17J 3N4MA 3GCMA 1F8VA 3I5UA 4GO1A 4I6ZA 4D7SA 1H8TB 2BXYA 4UXNA 3TP3A 2RJKA 4JRAA 3MZYA 2OA2A 2F6BA 3CCUI 4RB0A 1I5PA 2CQXA 1GNYA 3THTA 2RMU3 5KWRA 4M9ZA 1RJ7A 2AXTC 2WR9A 2UY9A 4BHPA 4NPRA 1ZG5A 5JFRA 4KN7X 4NUBA 4P9LA 1J0RA 1IN8A 3SEPA 4RBOA 2QKDA 1BM9A 4TZDA 1FMWA 4MGTA 1JH5A 1URXA 2L7MP 3ZFFA 1FATA 2CU7A 2VTXJ 2WN3A 2ZAHA 2JDHA 2QQWA 1K5MC 3BPZA 4CP0A 4ZDOA 3LCPA 5FP4A 5IAVA 5TRDA 1WCQA 3VBFB 3UV9A 4D6SA 2PYTA 4FPOB 1RC9A 5D8LB 4LBLA 4G8XA 2YX7A 4ABZA 5J1XA 3JW4A 1WD3A 1SCRA 1EAH1 1JZ7A 1PO11 2Z1DA 1NT0A 5JR2A 1WBLA 4QLCU 3NV3A 2YB7A 1OVSA 4IEZA 3T0BA 5EJ3A 4DZJA 5K7ZA 1YFYA 4E27A 4C90A 3WTUC 3QU3A 3CUQC 1WKMA 3RDIA 1FWZA 3ECOA 2VVDA 3LSTA 4LBOA 3SMHA 3FDYA 5C4WB 2G9GA 1IS4A 2HBUA 1IN5A 2E31A 1Y1VJ 1QU3A 1SACA 3GWZA 1WMXA 3R4KA 1D2QA 4RDUA 4XBQA 4KFCA 1L3JA 3DF8A 3WP3A 1G9FA 4MFDA 2PHDA 1QPMA 2XPVA 3WQBA 1XMXA 5FLMJ 2LFBA 4NHMA 1R36A 3K4AA 1VBD1 4OMYA 1E3PA 4ZDPA 3CZUA 2PG4A 2W7NA 4XTMA 1CF7B 3QBQA 2GXBA 3NKGA 1PUFA 2WKKA 5AFEA 1RUC2 3QH7A 2TBVA 4IL7A 3AMNA 3JD72 5FYTA 2WA4A 2Q1FA 3V4GA 1SPPB 4GH4A 1H6YA 3FLTA 3C3VA 5T5OA 1APLC 3MIHA 2WA3A 3G71I 1EKEA 4XUOA 5IYCJ 3HPGA 1Q8VA 2V79A 3TDUC 4GYIA 3NV2A 3DBRB 4XILA 5FJHA 5IP9J 2GLOA 2KISA 3A0NA 1YE9A 4E7KA 4XFAA 4COUA 2EILH 2QSGX 3GLXA 3F6VA 2ELHA 2GN3A 1RUF1 1AOYA 2GC2A 4PLOA 1QY4A 1SEUA 5IVJA 2LREA 2ZC2A 4Q1RA 2KR2A 4E2GA 4JAAA 2Z5UA 1W9YA 4E2SA 3J7HA 1K7AA 1BQPA 1ZREA 3MD2A 5FWJA 5KHIA 4U0VA 1R9TJ 4QT6A 1X8EA 4D69A 3OYIA 2DWRA 3N9OA 5E16A 5IY5H 2XRNA 4HANA 4BK5A 3PJRA 2CY6A 4A3XA 4RS5B 2P34A 1CQTA 4G12A 2E1MC 4XPVA 4ENKA 2PXJA 2DYRH 2GU9A 2BHZA 4IV1B 4X6RB 3FBIB 3FJSA 3C7GA 1HDDC 1HRI2 4JGYC 3DEWA 2JQ7A 1OD5A 1UL9A 4PFOA 5FMBA 1RMU2 3K6GA 3ROUA 4IZZA 3EXUA 3GTGJ 2MABA 5F0HA 3ALQA 2VQGA 3H3ZA 2K9QA 4Q4V3 3K1PA 1UFMA 2CWEA 1X19A 5DM6F 4TYSA 3BN6A 2CH0A 3POIA 3ZQIA 4RR3A 4P96A 2JB8A 4FETA 3NJVA 1SVLA 2CV1A 2Z2SB 1H6XA 2E60A 2DU0A 1ZGJA 1Y56A 3H42B 2X0LA 2VBWA 2ZMNA 3LPFA 1CAXA 2IS1A 3SH5A 2ZGUA 1G59A 2SBAA 3MIFA 4C1WA 4QPIB 4X6QB 2WAQA 2E2IJ 2OX0A 1WKYA 4BIOA 2VODA 2JDPA 2OD5A 4IE0A 4D6QA 4LGWA 1YQ2A 4WM7B 3ZFGB 2VLAA 1QGPA 1K78A 4KIFA 3AP5A 4EATA 2ZGMA 4LO6B 5IATA 1IOAA 4BEHB 2ZAAA 4IHVA 4K9SA 2HQNA 4AG4A 3KS7A 3O1VA 4E8CA 4OZXA 3OYKA 4YZ2A 5K7PA 4AVBA 3LAPA 3CCVI 4C8DA 1G8WA 4HSRA 2G7HA 1R1ZA 2WZR1 3TN93 5DDJ2 3U1DA 4I0WB 3MO4A 1ZR2A 4LBQD 2WUHA 3RI4A 5FKNA 1XU1A 2DTRA 1XDUA 2DDUA 4CCCA 4RGUA 3O3KA 3SDBA 5A32A 3TEZA 2VW1A 3BR2A 4ZXKA 3P6BA 4XKCA 1Z7LA 4YFXF 2B8MA 1X1DA 4XONA 2CTVA 1FJLA 3MLLA 1REFA 3CP2A 1MS8A 1V6MA 3VBUB 2CUJA 5ABJB 4CDUA 4UFMA 2QFEA 3T8RA 1MD0A 2JDMA 1SD5A 4AQ6A 4RGXA 3FXKA 3K2OA 4V19K 3HNYM 2FBKA 1KITA 3GX4X 4OIOF 3ZYRA 3THCA 3PVOA 2UXXA 3MUZ1 1XCBA 4EJWA 3HN1A 1BZWA 3S2DJ 1N3OA 4AQSA 1UKGA 4LK6A 2DOFA 1FV3A 4JBAA 3D6EA 3G73A 1XU2A 4BXFA 5CKQA 3HNBM 1JTZX 4UVCA 4COZA 2EF6A 4MXVA 3VOEA 4CEYC 1XX5A 2F5VA 3ZFEA 3A23A 2RKHA 1S0EA 2D45A 2JA8J 3NV1A 2LYCA 1VMHA 4FE4A 1BC8C 4R79A 3HOBA 1W28A 3JRHA 4FPFA 3ORJA 3ETQA 3CCLI 1AR91 1HW1A 4HAMA 2Y0SA 1U0AA 2W85A 1DU0A 1DGRM 3SQOA 3WNKA 2Z9OA 2XJTA 3JD73 1JXSA 4X8NA 4NHJA 2KPMA 5HS7A 5T5LA 5A7OA 1OUSA 3FMGA 3NO8A 2WV1A 1NCQA 3LA2A 1D4VB 2OA4A 1SMYF 3ML6A 3AFKA 3GFLA 1QBJA 1RUE1 3AG1H 1R1A1 1DHKB 1OQYA 3I58A 2HR3A 2FEZA 2WBMA 5E3NA 4N4OB 4L92A 4CO8A 1FV2A 5FO5A 4R1HA 2WQZC 4Y1VA 4AQTA 3CNAA 1GU3A 3EMRA 2Q8OA 4IEPA 4I7HA 2E26A 2F4LA 1W6PB 4A3GJ 2R7VA 3PLQA 3PNTA 1IV6A 1XSRA 3V0BB 3SXWA 3VEPA 5BS6A 3BZ6A 5LD2C 2FNAA 1ZZ7A 3BALA 3S2HJ 1QHDA 1N3PA 5BNPC 4H55A 1G9DA 1RUNA 4JTOA 2EWNA 5IT9Z 5FIXA 3GJBA 2VQ0A 4YZ4A 3B9IA 4ZZ8A 1RMU3 1FMD1 1ASJ1 3P9IA 1MBEA 4K20A 4PSXA 1FZPB 1G9CA 1WJBA 3ZYPA 1ON1A 2HI3A 4LIVA 1DUXC 1LENA 1AL0G 2ESHA 3ZPOA 5F3CA 2E6VA 3CIHA 3AK0A 1LCLA 5FKLA 2VKHA 2ETEA 1LDDA 5JLVA 5H9QA 5EG0A 1CVNA 3AYCA 3I3QA 3E6MA 2WT1A 2JRTA 2WFF1 1VBE1 2KIFA 1TQPA 1X1CA 2IVIB 5FO8B 2Y30A 2VONA 4H7LA 3U10A 2QTWB 3I3MA 3LEKA 4RQPA 5ICCA 4Q4ZF 2IXHA 5F7UA 3EPZA 1AR72 2NPIA 2KDOA 2RS12 3KLNA 2A6TA 3LDKA 4BL0B 2DU9A 1DPRA 2JA2A 2L4AA 2Q30A 1W39A 2L9LA 5J98B 1HX6A 2DI3A 1MS1A 1SVMA 2G7UA 3UJOA 3MFAA 1XSXA 4XCBA 4L11A 4M9XA 5FKBA 4EQVA 1RVF1 4IUGA 4HYEA 4AYBN 1TMF2 2ZACA 1OXCA 2Z3YA 3LFKA 2WZ8A 3LAJA 1SAXA 5LK5A 1XGSA 5L3CA 5IOYA 3VL8A 3W59A 3R4UA 3Q0UA 1V9U2 3OIPA 3WF2A 1KJRA 4U7BA 4NHLA 4MGQA 2PN6A 1G3YA 3B94A 1BEV2 4PGGA 3VDXA 2RS51 4A7KA 2DOEA 3L2RA 1JHJA 4FFFA 5DDJ3 1U12A 3HJEA 1U9NA 4KG8A 1R093 2O8QA 4HW0A 5JDBA 3D5SC 3R4DB 4DJAA 3QAHA 3CJTB 2VMFA 1GV5A 3RMXA 2JECA 3MKLA 1UO9A 3A0BC 4AFMA 3NAPA 5L7OC 2ZHMA 4XOTA 1C4RA 3J7MA 4JYKA 3RKQA 3V0AB 3VZOA 2VQLA 4Q48A 3C7JA 3VYSB 2XGCA 1BA5A 2HFHA 3RI8A 2DN0A 3VD4A 4AEMA 3J7NA 1DGLA 5D6FA 3OGJA 4BXXJ 2O8OA 3HEIA 2E32A 1ULCA 1V3FA 5EZGA 4KDPA 2UURA 4XCAA 1LGBA 2LH9A 2VB6A 1ACCA 2ZGNA 4O65A 1K45A 1DYPA 5FP9A 2XDVA 3QOEA 3LE0A 4FI9A 2AGSA 5F0CA 1TNFA 2AXLA 1MBKA 2XAHA 4YIRX 2NXNB 3U4SA 5FZ8A 2LTNA 1QQP1 5IK4A 2KM2A 3BZCA 4A93J 2CW8A 2OIIA 1LR5A 4E8DA 1XGOA 3U1XA 1AJOA 3HIFA 1NXMA 1BIAA 4CEWB 2VCBA 1R4NB 3BOQA 4OHXA 2A71A 3NKTA 5I0UA 5CYYA 2GH8A 2JG8B 3GXOA 3QP6A 1W8NA 2XLAA 2A3WA 4XHXA 3K1MA 1FC3A 5DXDA 4FISA 3ST7A 3O1RA 1MGTA 1X1PA 2QZ2A 5GAGJ 3ABZA 4M72A 2KFDA 2IS4A 2DCYA 1Z9CA 3LZZA 1OYWA 4H14A 1GP6A 2D2WA 1LDJA 3M07A 1N77A 2E7AA 1ULOA 3T1LA 3IKWA 1ND3A 5C9AB 4AVSA 4Q4W2 5E1RA 3JAMK 4RB1A 3WF0A 3H5NA 3HUGB 2L2OA 3ZYGA 3HOYJ 1CAVB 1JGGA 2LALA 5L3BA 3WTVC 2DURA 3PIJA 2EJRA 4PJMA 4CDWA 4Z2AA 2PHLA 4BQ1A 4CZCA 1SG3A 4FPHA 3LGRA 2TUNA 2WLPA 3DPRA 1IZ3A 1D0GA 3ABLH 1IQAA 5GADJ 3X2QH 4AHXA 5J7MA 2IP2A 1Q56A 4FE7A 2EPFA 2WTEA 3HOUJ 1GNZA 2WLQA 1PGW1 3I3DA 4FTBA 4OUMA 4O3MA 4RS8A 2CUEA 1W5SA 1STMA 3ZSLA 4JQFA 1D0YA 2IBDA 3DTKA 4OIQF 2BW8A 1D2SA 4H0EA 3T3YA 4P5OA 1H0MA 3SZGA 5D21A 1UZCA 3IH4A 5FYUA 2DK5A 1GOGA 1Z3XA 4ZONA 2R7QA 4M0NA 4GH4C 1BI3A 1FYUA 3IBMA 3UR3C 4P08A 1WJDA 2G0EA 5LRSA 2ZS6B 3AMPA 4R9AA 1POV1 5AFBA 2QBYA 1JOJA 1XRUA 4KGQA 2MEV1 3FWEA 4EWAA 4IHTA 3WNOA 1BL0A 4ISRA 4N53A 1CJDA 1M1EB 1ZBA1 5LATA 4GCVA 4M3CF 2XAJA 1JOBA 1NTCA 2QENA 3CCJI 4HK9A 2VTXA 3PQJA 4U0YA 5F32A 1P9QC 5F5QA 1N1YA 3OPZA 1R4MB 3PTYA 4Y22B 3CQZJ 5DABA 4AWXB 3BUCA 4B8XA 2ZGTA 2XGXA 1D5YA 1H9WA 4LKDA 2EIBA 1XE0A 2JE9A 3ZYIB 5AC93 5HCFA 1ZZCA 4QD2A 4YVWA 1ULDA 4MTEA 2YMZA 3PFIA 4OOIA 1RUH1 3PUQA 4PJ0C 2OCCH 3WU1B 3HSFA 4XLHA 4DMIA 4ITCA 1GWKA 5CZKA 3M3QA 3QPTA 2NN8A 3GZNB 3MGUA 3M1EA 4XFFA 3HOZJ 2DODA 5HODA 3R0RA 4FASD 4A6EA 5E1WA 3SLIA 1RINA 4OIPF 5H6QA 4IPAA 1TP4A 3QYFA 5BNNB 1OLMA 1UIJA 3A7QA 3OV8A 2OPWA 2QKMB 5DEQA 2PAKA 3LEMA 3ZMUA 3E3VA 5GTIC 4IXAA 5F08A 1QXPA 3OGVA 4FP3A 3BOPA 5DS9A 1O3SA 4RR3C 4XLEA 4PCQA 2MC3A 2R062 1MMGA 1IO2A 1PIV2 1WGXA 4M3GA 1KGYA 2W82A 2W92A 4RHV2 4XYXA 2XG3A 1PVC3 4ES9A 5DD8A 4IEYA 2QQOA 4AUXA 5CFCA 2XB6C 2LY1A 1XNBA 4FVVA 3K0LA 4QWQA 2C4XA 3FISA 4I02A 5DUUA 1P2FA 4NWVA 3AMMA 1CR7A 2DVDA 4FXKB 1SEFA 4JHTA 2BY0A 4C3IJ 4RB3C 4DNYA 4XKWA 1ZZ6A 3WG1A 2BVVA 4IOAF 2MLGA 2VUCA 2QDRA 1RHI1 4DIQA 2WABA 2HNHA 3GZ6A 4BBSJ 1O4XA 1GZWA 4AEJA 1OURA 4EN0A 2DYSH 2ZMLA 1KXGA 4XJWA 4B8EA 2V1DA 1BI2A 4PSWA 1ETYA 4DYRA 4E7ZA 2Q1MA 2LKXA 3IWFA 3TEYA 2OC6A 3IRRA 3DQVC 3FM5A 2VZVA 1YQ5A 4AK3A 4XXAA 3E1SA 1Z7UA 3RRDA 1T98A 2EFWA 2J1RA 2VL8A 1LRHA 4AI9A 1RRJA 3N9PA 3HBZA 2QCSB 2E51A 2X5IA 3E6DA 4FPJA 2XC7A 3AZXA 1XD7A 2A69F 1V6JA 2D44A 2J1SA 4XUQA 4XQWA 1JUHA 2VNVA 1OFSA 4TV7A 4LG0A 1R7JA 5DAPA 3BTIA 1JKPC 2NOJB 5DUXA 1M4WA 4ZPIA 2D1HA 5GLWA 3OY8B 2ZNZA 3VKNA 1IS6A 4JDNA 4EJVA 5B4NA 4YGEA 4BB3A 3WW4A 4QXHA 4BYYA 5E3LA 2ZX3A 4W6WA 4E9KA 4QPQA 4XNFA 4CDUC 5H6RA 4ARXA 4YG3A 3Q5FA 2HYFA 1U78A 3P3PA 1B72B 4Q4W3 4A0YA 2VW2A 3BTAA 4TLGA 4HG6B 3VKOA 3PVNA 2VUDA 2IW5A 2LD5A 1BBT1 5CAZA 4OAYA 1EY2A 1FOKA 5GLTA 2EALA 2HVRA 4EE2A 1F2NA 2XUEA 4HPKA 3BZKA 4CZSA 3B5LB 5LZ6A 2VBBA 2VQHA 3ZN6B 3S57A 1FIAA 5AVAA 5CIRA 4L9VA 2EV0A 3JQWA 4UUVA 3UGFA 4MGZE 4QDSA 5F5CA 1LE8B 2BV4A 3MWMA 3ZFEC 3RQ0A 3LSDA 1NK2P 2YC2A 2GP5A 1EPWA 3SYTA 2FZ2A 3MI8A 2P0WA 1TEIA 4LBQB 1PK6B 3GZ5A 5F6FA 5DCFA 2FA5A 3POFA 2DA3A 4Q0SA 4MTDA 1VAMA 5D8KB 5BNOA 1AYM2 3PJYA 4S2FA 1S1AA 3TBIA 3JAMZ 1S0GA 3TL4X 5FZOA 4QTRA 4AIHA 1SBEA 4XJAA 2Y75A 3O7OA 4ESBA 3WVJA 2JSPA 4Y13A 1IHMA 3JB4C 3T09A 3WP6A 1EV12 2COBA 2UZKA 1IXSB 2LOOA 2W94A 5GZEA 2FDHA 3ZSMA 2RAEA 4D0QA 2IXJA 1DQ2A 4CICA 3JBG2 3C2UA 1A31A 4AVTA 4L9BA 3FKJA 4Y52J 1EP0A 2I8DA 1W6OA 2HWC3 2ADDA 3ZXEA 1CAUA 2BOJA 3ELKA 1NG7A 5FV3A 4CU6A 3K4KA 1LEMA 1DF0A 3BODA 3C7OA 3VB9A 4YGCA 5TGTA 5FYHA 5FKKA 3CBNA 2P3IA 1K79A 1FPN3 2GMPA 3NNMA 1CQ9A 1FOYA 1PDNC 1FI2A 3SJMA 4QQ2A 2DFFA 4GA9A 3AXDA 1HV0A 1H1AA 4AHYA 5FQ0B 2L3DA 4QHZA 2K85A 1ZLKA 4NIDA 3HOSA 2O7OA 2R5ZA 4JX5A 4LB5A 1YG2A 2Y6JA 3ZX7A 2HZTA 1QGLA 4ISQA 2W95A 3DP7A 2W84A 4A44A 2XLGA 1WA4A 3NEUA 4S04A 4QX8A 3BC8A 3ZYFA 3BDDA 2DCJA 4QQHA 2ACJA 1O3QA 1NAEA 4CP9A 4XXPA 2BNMA 2EIEA 4PGHA 5GALA 1JHNA 4AFBA 2VZQA 4BXSV 1ZNPA 4Y1UA 3HRSA 2F5EA 3KT1A 2ZJRF 5FLHA 3I2FA 1SFPA 2R063 1PIV3 4NC8A 3CMYA 1OCZH 1HA8A 3HL2A 2MBFA 1TT0A 4RHV3 2CRGA 2JMWA 1VFCA 4Z82A 3U21A 2YXSA 2A1XA 4PDWB 4WVMB 3OUJA 2VKEA 5BY5A 3O8HA 5FZGA 4AZZA 3AL0B 2HH9A 4KYWA 3M4OJ 1QJU3 2HZDA 1TE1B 4LHSA 4UB8C 4XRSA 4PZJA 4RQPC 3PNAA 3UJQA 2JJ7A 3HOVJ 1KGSA 4YSFA 1G8XA 2K86A 3PM1A 3D3AA 3J26N 2R041 3MIDA 3FX3A 2JVGA 3C2BA 4UY8I 2PJRA 5E8GA 3H92A 3I3LA 5DZFA 3LQQA 3S16J 1B59A 2B0LA 4XORA 2DO7A 2MC4A 2E53A 1S2EA 2TNFA 2HJIA 4YZ1A 1B4AA 2YROA 2YBSA 2HDCA 4OWRB 3O5SA 1W8UA 1YQ8A 2E34A 2LF8A 2DT6A 1OR7A 4N9IA 3OYMA 2XXZA 1EJ9A 4DUWA 1WCDJ 5LY1A 2VT2A 1AKHA 5C8CB 2WSVA 1RUOA 3POJA 4L5JA 3KM5A 1POGA 1WW4A 4AL9A 3B00A 2ZCWA 5FKOA 1WCSA 5FZMA 4AAPA 4D7NA 1KQRA 3T2PA 2QWWA 3MHZA 2XJPA 3ERED 2OVUA 2EZKA 2CGPA 4NIGA 5LA2A 4QXCA 2L02A 2DUOA 4C3HJ 1KS4A 3NAPC 2P6TA 2ZMEB 2CJJA 4MEYF 2IT0A 2DA1A 1H2KA 1XC6A 4LLNA 1RGSA 4K1YA 4YIFA 1WFXA 3O8GA 3R0AA 2W1SA 2YBPA 2ZX1A 3DTEA 1RI7A 3N7KA 2H0BA 1IXRC 2F2EA 3WF3A 3S1MJ 2WO3A 4MH0E 5GLZA 1HRV2 5C4XJ 1EAH2 1UPSA 3H8UA 2YYOA 1I3QJ 1C0WA 2WS93 5A3PA 5DN2A 2FF4A 4HF1A 4HT1T 1FAYA 1DQUA 5EYRA 4R9DA 3ILNA 2ELJA 3OYGA 2V7FA 3NARA 3OS0A 3N9NA 3AAFA 2HWD1 3HRUA 1WCKA 4GMP3 4X1EA 5FJ8J 4W50A 2JIJA 4A3KJ 3J7AO 2ID4A 3POYA 1BW5A 3GYHX 3WF4A 4QKBA 1Z7S1 4UV9A 1OOPA 5IAXA 4Q0PA 4K8FA 2BEOA 3PUIA 1LHNA 3ZDVA 1OLRA 2OW4A 1K5MB 4E7HA 3WUCA 3BU7A 2XPJA 5LBQA 5KVRA 2HYJA 3F9KA 3WDWA 2HS5A 2OS2A 3W6VA 4HF2A 4Y15A 3N9QA 2ARAA 2ZSHB 1LECA 2QGUA 4D9JA 4FFGA 4N4NB 4Y3OA 1KYZA 1YTYA 4A6SA 5K9YA 1QA6A 3LSHA 1ND3C 3ATGA 4JOMA 5DZEA 1CPNA 4NE9A 4Z92B 3CMMA 3KP5A 2XBO2 2HKXA 1GBGA 4XJUA 1XB9A 2BUKA 4XRSG 2W08A 2X09A 5D4RA 4J19A 3JB8A 3IT8A 3CUQB 2JVHA 2VJJA 1AXZA 4MX3A 4Y5Z0 4QX1A 1KU9A 4GFBA 3CMAI 2L7ZA 2QQKA 3FFZA 4CU9A 5JXJA 4CDWC 1OCCH 3J8F1 5GKAC 2Y26A 2JKBA 1LB2A 2ZTNA 2D6PA 3DPRC 2ZX4A 4R9CA 4MIMA 3Q8BA 3F8NA 3VBSC 1VQPI 2W24A 2ZBKA 1S9HA 5FRMA 2KXLA 3KEYA 4RAFA 2RC4A 1OKQA 2PMHA 2NLRA 1GXQA 1YOVB 2YV8A 2FQ3A 2JA6J 2QM3A 4YZ3A 2NMNA 2YPRA 3MIBA 1GWMA 4EN7B 1NY72 3EYYA 1QNYA 2WY7Q 4R4ZA 3VD5A 2JXAA 2PLYA 5FY8A 2BE5F 5J40A 4UVAA 3GZAA 4S2DA 3F3XA 2VD7A 4YFKF 2RREA 1VQLI 1HB4A 4LT5A 5JVTA 1OC1A 4BQ5A 4BQXA 4FCYA 4UF0B 1R71A 4G6TB 2PAEA 4LNVA 1SBFA 3Q9OA 1ETKA 2K9ZA 5JOYA 2RV8A 4JCKA 4CHUA 3LF7A 1A8DA 1L3LA 3N05A 3CLPA 1MPXA 1SFEA 4S2GA 2HEYF 3Q8EA 5C6CA 3CCQI 3COAC 3ZR8X 1OJLA 2XAGA 4YW4A 2RDPA 1L7QA 1GANA 3TMOA 1S0JA 4HN1A 2YC4A 4N53C 3AZYA 1UY4A 3TGNA 1RKTA 1R5HA 2RM21 3CC2I 1WJAA 2FE3A 3HDDA 4LBKA 2RVAA 3BIEA 4PHZA 1R5ID 1CESA 3FFQA 1BOBA 4ES8A 1BR4A 4BCUA 5J1UA 4M4PA 3VBFA 1UHMA 1LPQA 2ZXIA 1NQJA 1JUPA 4ZY9A 3L1PA 5D6EA 2EIJH 5FK7A 3KZ4C 4B09A 1JYCA 2O3FA 4RGRA 4NAOA 4XAEA 1V54H 4Q27A 4L9JA 1AR83 4Y5SA 4XIDA 1DQ0A 1ZM1A 2R7EB 5FOBB 4NC6A 2WADA 5FXWA 4XL9A 4OI1A 3HN3A 2MW8A 1RUI2 3HD8B 2NS8A 2DU1A 2E2HJ 4BJTA 4JGYB 1IF1A 3FN9A 4ATFA 3DEUA 2VOVA 1GMMA 1UZVA 2IUWA 2IAIA 1S7OA 2LRPA 1MS9A 2D6MA 2R1BA 5GZFA 3NJYA 4LKFA 1W7PB 4AI3A 4OMCA 4C1XA 2Y6KA 1Q1VA 3ZSJA 2ELKA 4YFZA 1GUUA 3F6OA 5EF6A 4YIIA 5A6YA 1NH3A 3O6BB 5HOOA 1EYBA 1OPOA 2JD4A 1PGSA 2ZGOA 1CF7A 1DIWA 1Y39A 1JYIA 1TQMA 5CFCC 1O3RA 1DQ6A 3I71A 1PHMA 3WQ1A 2Y0MA 2O61A 4IHYA 1BI0A 3GXUA 3RQ4A 2GP3A 3DLAA 1SCSA 1TBXA 1PO21 4IXLA 1N3QA 5DG2A 5E8AA 1SPPA 1BW6A 3KMHA 5JXGA 1SFNA 5EIYB 5CQEA 4PJJA 3GTPJ 4NIHA 1UY0A 4UUTA 2B4KA 1ITYA 1NG6A 5FPVA 2JG9B 1W3XA 1MSEC 4C2UA 5CG8A 3SEZA 2C5DA 1R1TA 1CIWA 2ZEZA 2OUHA 3SFIA 4KWJA 2J1AA 3WGGA 3ON7A 1GVJA 3CKHA 1RUD2 4A6DA 1V6OA 4QGMA 1HRV3 1EAH3 2P37A 4PF1A 3SZTA 1JUIA 1PO13 4CCJA 3S93A 1E5HA 4CA9A 2EZLA 3WNMA 2FMLA 3F8FA 2HWVA 1U0JA 2DFHA 4E2QA 4XIOA 4JQTA 1BC7C 5G04L 4A3MJ 1ULGA 5JI7A 1FX7A 1OLTA 3IZOA 5L9RA 2JDKA 1W6NA 4QSHA 1SFYA 1O7LA 1P4AA 1CGPA 2X5IC 4Q4Y2 4NIAA 2P2KA 2DA5A 1D4M1 4RS5A 2M1BA 2YU3A 1PZ9A 4LBMA 3DXJF 3OR2C 4IHXA 4NQWB 2BBVA