3DKWA

Crystal structure of dnr from pseudomonas aeruginosa.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
227
Chain Sequence
MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLECFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNR protein
publication title A dramatic conformational rearrangement is necessary for the activation of DNR from Pseudomonas aeruginosa. Crystal structure of wild-type DNR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
total genus 46
structure length 227
sequence length 227
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dkwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dkwA01
1USSA 1Z7UA 1IW7F 4MEYF 4KICA 5DEQA 1RI7A 1TQPA 1UPIA 2JRTA 1WSUA 2GU9A 2DTRA 3L7WA 3GFLA 2Y0OA 2L3DA 2O61A 5HVQC 3ELNA 3TOAA 3WTWC 3FM5A 1R1VA 1TW2A 5L3CA 1LDJA 5AONA 3C7JA 2VE9A 3J80Z 1XN7A 2PA7A 1S7OA 5HOOA 3F6OA 1ZN2A 4Q48A 3UKTA 3BPVA 2XAHA 1I27A 3IRQA 2Z5UA 3K9TA 1XD7A 2FQPA 3PQJA 4BH9A 4KYWA 5CVVA 3FMQA 1JUHA 4A5NA 1J3RA 5AIQA 1AOYA 2Z2SB 4LUKA 4WXDA 4ENKA 4XLPF 4XETA 2IT0A 1MDMB 4EV0A 1FP2A 4KUMA 4RGSA 3PFIA 1DZRA 1XGSA 4Q0VA 4OU0A 2D93A 3L9FA 1YHFA 2L02A 4XFIA 2HWVA 3FZVA 1ZGAA 3GXOA 4MHGA 2XGXA 4ZYEA 4KWLA 4P55A 2MH9A 1P2FA 4K2EA 2CGPA 4U7DA 1GHCA 2A5YB 2J5PA 1SFUA 4Q47A 3KZYA 1HQCA 3BWGA 2OZJA 4HQEA 3M8FA 1XE7A 3TNPB 1JHHA 2ACJA 1L3JA 5L3GA 1U3EM 4UNOA 5K8SA 1BI0A 2OYZA 4XF1A 4XFHA 5E18F 3KE2A 5I0RA 3GYDA 3KP2A 1ON1A 2XL7A 3JZVA 3F8MA 4IEUA 1RC6A 5CJ9A 2PLYA 4N9IA 4A6EA 3IL2A 2WV0A 2XIGA 3TOBA 1G6NA 1HW2A 1YG2A 2VQAA 4EROA 2R7DA 4A0YA 1DDNA 1YLFA 4CXFA 5IT3A 1FY7A 3R4KA 3NW4A 4IHSA 2OZ6A 5HDNA 5E1XA 1PMIA 3K1MA 1XDUA 2ZMEB 1MDMA 5E17F 1UIJA 3G7DA 4D7TA 4YIIA 1FYLA 3H9AA 2EA7A 2VBXA 4HX8A 3L09A 4Y17A 3GX4X 2P6TA 1ZARA 5JI6A 2PAKA 2HKXA 1IXCA 4AVPA 4P9FA 1Q43A 4RB2C 1NXMA 3QU6A 5K5RA 3F72A 4I09A 2XLFA 4L9VA 3AAFA 1EH7A 2FBHA 3GWZA 2VOOA 4ETSA 4S05A 2HS5A 2QZ8A 5JSPA 4IEWA 2ESHA 4E70A 2RGVA 4QM8A 3WTXC 3J80K 2L01A 3KSCA 3ECOA 5I8YA 4LA2A 1J3PA 4Q0QA 4D7SA 1IN4A 1RUNA 2H0VA 2HYFA 6PAXA 4WF2A 4WX9A 2D1HA 3FM3A 1KGSA 2RC4A 1J5YA 2GA1A 4EJTA 2M30A 4YG2F 3NSTA 5D5UB 4UV8A 3KEQA 1X8MA 4CHUA 4YSFA 1OI6A 4JTNA 2MHFA 4YYOA 4LK0F 1T0FA 3FE5A 4OINF 1OKRA 1ZNPA 4HN1A 4IVNA 4NB5A 4YFKF 1B59A 1EP0A 4GO1A 1PDNC 5JVTA 4IERA 2ELHA 3UKVA 2VOPA 2FBIA 5EEHA 3GLXA 4HLTA 5DUKA 2ZMEA 4Y15A 2VBZA 3CUQB 2MH2A 3BY6A 1U5TC 4KT5C 2FE3A 4PDKA 1P4AA 1G3TA 1YLLA 2KJBA 4B29A 3F6VA 4WWCA 2Y75A 4OFGA 4OIRF 2EV0A 5J3UA 4KMFA 2O6GE 1ODDA 2AXLA 2V1XA 4PJYA 3S7IA 1EV7A 4L5IA 1MJBA 4OIOF 3HHHA 2ISZA 1J59A 3P9IA 3BALA 3F8BA 1R5HA 2GZWA 3VODA 3SQNA 5J48A 2PFWA 3BPZA 1UIKA 3T8TA 4NVPA 2JSCA 4MQ9F 1FPQA 4WXCA 4M73A 4O6JA 5K1YA 3KMHA 2O3FA 1O3QA 3CO6C 1LNWA 2Q0OA 2IPQX 3M70A 3VEPA 3LSTA 4A2UA 4KWKA 4BIFA 1U5TB 1ZHFA 1SD7A 2QJVA 4M6XA 2DBBA 3F8CA 4WK8F 1BIBA 1UW8A 1YFWA 1CAXB 2ET7A 3QP5A 1WQ2A 2DT5A 3OV8A 3ACLA 1XMKA 1PP8F 3RIRA 1Q5OA 2MNGA 4Z07A 5CU1A 1O3RA 2PJPA 1IN5A 1O4TA 2EJRA 3IRRA 3E6CC 1XDSA 3ETQA 3DP7A 4B09A 1YWKA 5EFUA 4PCQA 1XSDA 4JBAA 1K6OA 4BYYA 5L3FA 1B9NA 2QLZA 4FX4A 4A12A 4ZYGA 1W7PB 3HSRA 1B6AA 5FDBA 2W85A 2GAUA 3FJSA 4ON0A 5J7MA 1KU2A 2RVCA 4RB3C 4IXAA 2PG4A 4LGWA 1Z9CA 1R22A 4EWAA 3FX3A 1HW1A 2EFQA 2ZKZA 4OMZA 2HQNA 4KDPA 1EH6A 2P5LC 5JCTA 2B9UA 1ZZ6A 1U6GA 2JPCA 3N97A 2M5WA 3DXJF 1KQ0A 2DCTA 5BPXA 4YNIA 3ERED 5BPDA 1LEAA 5AVPA 2GC0A 2K9ZA 2DI3A 2O1QA 1SAXA 3GYHX 1W7PD 1I6XA 2YPRA 2QBYA 4FT8A 1QQIA 5LGNA 4OLLA 1IUYA 3FMSA 3O2PE 2B0LA 2EA4A 2ZJ2A 5D4SA 5TJJA 1Q3EA 2STWA 1KU3A 3MWMA 1HBXG 3QP6A 3VB2A 4NQWA 3TO6A 2D1VA 1F1ZA 2LNBA 4ZU7A 1GXPA 1IXRC 3NQOA 1GQHA 5ILVA 4UXNA 2K4BA 3BDDA 1F9NA 4QLCU 3V8LA 1U5TA 3CLOA 1U8RA 4ZZLA 3F8FA 2F5CA 4L9JA 1YQAA 3G3ZA 4J1WA 4L2NA 3KP3A 3WGIA 3FMRA 1CAXA 3M9AA 4HBLA 1GXQA 4EWEA 4I7HA 4ZU4A 1R36A 2FA5A 2PN6A 3VOEA 4JK1X 4AIHA 2HKOA 4KN7X 4LLGF 5J6XA 1QO0D 2YX4A 4XF0A 3RZZA 1BJAA 1LEBA 5E1WA 4EWDA 2VONA 4RB0A 3DPLC 3SHFA 3WTVC 1T6SA 4G6QA 2NRAC 3MFKA 1J1LA 4WCGA 1LJ9A 4HQMA 1W7PA 5FGMA 4G7OF 5JAXA 1ZG1A 1X82A 5KK1A 2D40A 2PYTA 1MJAA 4CZZA 4QGLA 3ZMVA 4MV2A 1ZZBA 2V09A 5C8WA 3DL3A 3IWZA 3ISPA 1BC7C 2A69F 2RQPA 4MNUA 4KL1A 2QVOA 2VPVA 4YFNF 1NYWA 2QYOA 2ETEA 2CAVA 1QBJA 2PQQA 3I0TA 5F1RA 2OA2A 1QY4A 1QXJA 2DQRA 4LB6B 3MDPA 2WWYA 4RD7A 3LQRA 1WKMA 5BUVA 4RGRA 3NKTA 3U2RA 1J58A 1TQ5A 3S0MA 3GVAA 4IRHA 2DU9A 4O3MA 2QM3A 2P8TA 2IVMA 3LQQA 3I54A 5ICFA 3MPBA 4HAMA 2X0LA 1ZRFA 2M1BA 4Q4ZF 3HT1A 4S04A 5F64A 5CYVA 4ASNA 2CQKA 2F5DA 1LQ1A 4A5MA 2PEXA 5FFZA 3FF5A 3GO5A 4XFGA 1R1TA 2O8XA 2P5VA 3H7YA 4HF2A 4QM9A 4PIYA 1X3UA 2KIMA 4O9EA 5J8FA 4RAYA 1H1MA 3FXRA 3B02A 2EVXA 5FLIA 1RUOA 4DNCA 4L9TA 5A2QZ 1DP7P 2V1UA 4A0XA 4GYGA 4HV5A 5FCCA 4CO8A 1P4XA 4LEJA 2XVCA 4FX0A 4YRDA 5BPIA 3GFIA 1D8KA 5E8GA 1UHMA 2OPKA 2ZKLA 3R0JA 4U0YA 1BN5A 4UBGA 1SMYF 1K79A 2EK5A 3NEUA 2CFXA 5HS7A 4GGGA 4P5OA 1CX4A 3ZP5A 2HEOA 1DPUA 1J9IA 4HN0A 1O5UA 1Z91A 3COAC 3EQLF 3HUGA 2E7WA 5K5OA 1YFHA 4EJVA 2BNMA 4XSZF 1C0WA 2PHLA 1YTYA 5I91A 2PMUA 3TDZC 4A6DA 2ZXJA 4MEXF 2HTSA 2UXXA 1AWCA 2L4AA 4MZUA 1QGPA 3WTYC 1H9TA 2XL9A 5EZWA 3EO6A 2Z99A 2K4JA 2VBWA 4GULA 1R58A 2UWMA 3NVCA 1O5LA 5BY5A 4BXUA 4U88A 2OD5A 1P92A 1KQ9A 1FBSA 2NAZA 5E1RA 3SCGA 1EH8A 1HKTA 1UD1A 3ES4A 2P5KA 1T98A 2FXAA 5CVUA 1YW7A 1KU7A 1BI1A 4CGZA 1UFMA 1O3SA 3D0SA 4IESA 3DN7A 2N7GA 4Q0PA 1K78B 1ZX5A 1Z6TA 3RPQA 1I1GA 1TQMA 2JTVA 1DZTA 4E2QA 5BXXA 3U10A 2P17A 5FLXK 2BBYA 2DO7A 5KHHA 3FHIB 1MD0A 4JQFA 2GC1A 2EFNA 1B4AA 3FXQA 3R60A 1BI2A 2W25A 3N4MA 1S6LA 1J7KA 1R00A 4FAHA 1LB2A 2Z9OA 3WU1B 4WVZA 2V6CA 2BNNA 1ZRCA 3CDHA 3PNAA 1YFYA 5L3BA 1F5TA 3RYKA 1FBUA 4QGMA 1S8NA 1KQ8A 1B9MA 1SMTA 2QWWA 4IF4A 1DUXC 4OIPF 2C0ZA 2ZNYA 2Q1ZB 2OBPA 4LLLA 4QMAA 3O6BB 3RJPA 2BNOA 3H3UA 4LJZF 3I7DA 1CAUB 1TNTA 2EAAA 4HVOA 4LA3A 5KBFA 3GF2A 3SXYA 1FXZA 4B8XA 5TRDA 3GW2A 2LF8A 2MA3A 2XHKA 2QENA 4AD9A 4L18B 5FPXA 3ZQ7A 1U12A 3QPHA 3QU3A 3EYIA 5H20A 2JZYA 1IN6A 5CVRA 2A6EF 3REOA 3GZ5A 2Y48A 4QGNA 2PAEA 4L5JA 2WFPA 1NE6A 1NHAA 4EM2A 3CUQC 5A2QK 4Z82A 3WTTC 2VBYA 4XRFA 4HF1A 3KP4A 4Q5SF 3R0AA 3EYYA 3V7RA 3I64A 5LHGA 1K78A 1OYYA 1WLTA 3LAJA 1FZPB 3BCWA 2D2WA 3V8JA 3MYXA 4XFBA 2IXCA 3WW2A 4IEZA 5BOXA 2VODA 3U1DA 4M71A 4DINB 4HMZA 3H3ZA 4WZCA 3WODF 5BV6A 2DQLA 5CVIA 3OGJA 1Y3TA 4KN4X 2K02A 5CVJA 1PM7A 1HSJA 5LLQA 1QPMA 3ELKA 1Z1DA 2DW4A 3C1DA 3KCCA 2FSWA 3DPTA 4UVBA 1FWZA 1D3YA 3E5XA 1YFXA 4MQVA 5ICEA 1R1UA 1FX7A 3DEUA 2OAZA 2K86A 5DD4A 5DCMB 4X6RB 4KIGA 5FLJA 4UVAA 1R5GA 1USTA 1XGOA 5CLSA 1LDDA 1CAUA 1OYIA 4LD5A 1XSXA 2AS5F 1ZGJA 1BM9A 3BZ6A 3HQXA 1TLHB 3E5UA 2K27A 3IHUA 2UYBA 3H1MA 1DGRA 1OR7A 1QWRA 1L0OC 5DCFA 2NYXA 3F21A 3WTUC 3T1BA 1Y0UA 2GQQA 4R1HA 1U2WA 2IXHA 2COMA 1ZZ7A 3CTAA 3O14A 4WXHA 4L0YB 2EFOA 3H1YA 4IJAA 5E8IA 3GUDA 2VC1A 1OMIA 3HRMA 1G3WA 1MJ9A 4IHTA 4IEYA 2OA4A 2ZCWA 3WTZA 1TTYA 5ICCA 5JFRA 1WRJA 3ROUA 3K1NA 2FF4A 2BV6A 2NS0A 3Q5FA 5D1IA 1DPRA 5JR7B 5JSRA 1ZRDA 4EVIA 2O0YA 4HW0A 2EWNA 3BU7A 3H1WA 1XCBA 3RKXA 4EJWA 4O9GA 3V7SA 2QUFA 2FNAA 1Y9QA 3HSEA 3RKWA 3WW4A 2HDCA 2VXZA 2R3SA 5CADA 1YFUA 1WWXA 3ST7A 3I5UA 4OMYA 4IPAA 2ATFA 1IXSB 3RPUA 1RZ4A 1VP6A 5DCMA 3PLQA 2GXGA 4XFAA 3ZDSA 1S3JA 5KHKA 2CSOA 1KA8A 3I4PA 1FSHA 3ZN1A 2ISYA 2CV6A 3CUQA 4QXKA 4Q29A 4ENNA 3JTGA 2P7CB 1Q1HA 3C18A 4MGZE 2YX7A 2EA2A 2JT1A 3F3XA 4HBNA 1IRFA 3BPXA 5LGTA 3KLNA 1EPZA 2XLAA 3KFWX 1R7JA 1B1BA 5I8SA 4PIZA 3DKWA 5FO5A 1HKSA 1TQIA 2W84A 2GA2A 4FBFA 5J8CA 2BE5F 4U0VA 2CAUA 5KHJA 4ENMA 1FSEA 4GYIA 1ZLJA 1HSTA 1ZH5A 1REPC 4MGRA 3CO7C 5K5QA 2QVSB 2E1NA 4PGGA 3CJNA 3CL1A 4IETA 1KYWA 4AVCA 3EBRA 1JXSA 2MD5A 3HT2A 2RKHA 2DFIA 2DK5A 3BROA 4Y13A 2HTJA 2D45A 1J75A 3MZYA 2XUBA 3NL1A 3KETA 4M9XA 3HYIA 3ZMDA 5LGUA 3RDIA 1T38A 3MAJA 4XEZA 5EEGA 2QCSB 3CEWA 1OFNA 4GCVA 4HV6A 3L00A 4BHPA 1ZLKA 2MPFA 2FRHA 1HW5A 2Q0AA 2XV4S 5HS8A 2C6YA 3SZTA 1ZZ8A 4MUVA 3UKNA 2IXLA 3E6BA 4ZH4F 2P7VB 4IEVA 4HA8A 2HQRA 4ZYDA 5HDGA 2XKOA 4MGIE 4IRIA 2L4MA 3I58A 1SD4A 1BC8C 2KXLA 4JV4A 3SXWA 2XROA 2FBKA 3K0LA 2W24A 4OIQF 2LF7A 4U0WA 1LKNA 4ONUA 1LVAA 5I0SA 1V4RA 1CF7B 2FOKA 3HSFA 2EB7A 1FBQA 1G4DA 3ABUA 1XCVA 2W57A 4UXAA 3GZ6A 5FB2A 5FLXZ 1UHWA 2MLGA 3JSPA 3D5LA 3KZZA 3GBFA 3KP7A 5ILSA 1EYBA 1YUDA 3H50A 1FI2A 1LRHA 3T5XA 4YARA 2Q8KA 2CYYA 1XGNA 4HVQA 3RNSA 2QQAA 4HOBA 4K8FA 3VHRA 2XAJA 2XLGA 1QZYA 2PQ8A 1KYZA 1ZZCA 2XASA 4CICA 3P7NA 5F6FA 4I98B 3IDBB 4AWXB 5D6EA 3L2HA 1SD6A 4WBBA 2H6BA 3MCZA 2NNYA 3IIAA 2NNNA 2HZTA 2VE8A 2V1DA 3GFJA 4Z2YA 1I5ZA 2STTA 4I01A 5FQ0B 2GH2A 2YR2A 2EFWA 4L9NA 3ULQB 1WGPA 1JGSA 3E3VA 1K7AA 3M8EA 3FXUA 1QNTA 4BHBA 3SFZA 5LRSA 1QZZA 3ZPLA 3J81Z 5D5WB 2HFHA 2ZBKA 4A0ZA 1O7FA 4M74A 3WTSC 4BNCA 1XSVA 2XAQA 4HX7A 5JR3A 2Q4SA 3RKYA 4KNYA 2PTMA 3C3WA 2EV5A 4IEQA 3TQNA 1IF1A 3PVBB 3D0JA 2FMLA 2RDPA 2LKPA 1SEFA 2GWRA 3KEOA 4O5VA 1CF7A 1XRUA 4N0BA 3I71A 2IXIA 2HR3A 4OOIA 4UV9A 3LZZA 1XGMA 2DK8A 3CLPA 5T3NA 3HRSA 4M6YA 3WE3A 1SD5A 2UZKA 4ESFA 3WE2A 2EFPA 4EM0B 1V3FA 2KRFA 3S2WA 4ZYHA 1JHFA 1OD5A 2PHDA 2VECA 2H94A 1QXRA 3WG9A 5IT9K 4IEXA 2ETHA 4EJOA 3KGZA 3IBMA 2H6CA 4G9YA 4LULA 1TNSA 3HTSB 2I45A 1S29A 3RI4A 2GC3A 2V9VA 5LRRA 3QAHA 1CGPA 3SHRA 4LG0B 3TGNA 2FQ3A 4L0ZB 1WI9A 2FU4A 2PBIA 3FZ3A 3BJAA 5FQ0A 2K7LA 2M87A 2CWEA 4X6QB 1XE8A 5JSOA 2O03A 3QRFF 4MH0E 1X7NA 3LA7A 2MBFA 3L2CA 4XSXF 4HYEA 1EY2A 2QNKA 2DPDA 3W6JB 4I0BA 1UCRA 1T2KA 4BAYA 3PQKA 3HHGA 1PUEE 4MTDA 1W5SA 4R79A 2IRFG 3R61A 4PZJA 4E2GA 5LEJA 2VN2A 2R7FA 3P9KA 4XF4A 2HGCA 3CF6E 3TO7A 4R52A 5LBQA 3U0ZA 5H6QA 4G6DA 1RTVA 4N9HA 3ECHA 4AQ6A 4G7HF 2IA2A 3G73A 3ABTA 1RNLA 5FD6A 2VC0A 5E1ZB 5I93A 3JAMZ 5BS6A 2EV6A 3RYRA 5LHIA 2OQRA 2OQGA 2XAFA 5HS9A 4HSJA 3I53A 5ERIA 2KIFA 2DAOA 2E7XA 3OCPA 2A6HF 4KA4A 4CYDA 4XF3A 1G3YA 3KGLA 2BYVE 2UXNA 4R8HA 3WU0A 2WC2A 3KLOA 2IC1A 5I0TA 1SFXA 3CUOA 3LFKA 2PMHA 2IP2A 3NRVA 1BI3A 4UVCA 1CAVB 1E2XA 3OD0A 1J0RA 4I2OA 2O8QA 1VR3A 1UCXA 4LTAA 3B73A 4LG0A 5I8TA 2E1CA 3DQVC 3KP5A 4AIKA 1GQGA 2IW5A 3F8NA 4H0EA 1LDKB 3V4GA 3FHZA 4QX5A 1YW8A 3J81K 1ZG5A 2MC3A 1D8JA 4LK1F 3ES1A 2KKOA 4ENJA 4HVRA 4KU8A 1UB9A 3CJXA 1ZZ9A 1DGWA 1MZBA 2FNPA 5DDGA 4AQ2A 4HSLA 5FLHA 1FYMA 1XMAA 3BB6A 3T8RA 5D8LB 3ZMZA 4PGHA 2YU3A 1FYKA 4RAZA 1WA4A 3WGHA 1U78A 3EHKA 1BIAA 3R6SA 3LA2A 1YIOA 2UY8A 2VT3A 1ONVA 4ESJA 4KIFA 5DD8A 1YW9A 3HTUA 4JTOA 4G7ZF 4AVBA 4P9UA 4UHTA 3V8KA 1Z6RA 3E6MA 5HLHA 3D82A 4IEOA 1IRGA 3H7JA 2FEZA 1XB4A 3M7GA 4HDVA 4AVAA 5C6CA 3USSA 4F7ZA 3EUHA 3Q9VA 4LFUA 4ZZDA 1H9GA 2ET1A 3I59B 1ZAOA 3BOQA 3EQEA 2F5FA 4G94A 4FAGA 1P4WA 1KU9A 1IN8A 1RGSA 4BQAA 1CAVA 1L3LA 4LLOA 5JHUA 4Q0UA 3BP8A 5ILUA 1W5TA 4YIFA 4XF9A 4AXOA 3LOIA 2TDXA 2Y0MA 2Z69A 4KWJA 4MGYE 2GXBA 3C3VA 4KU7A 1BOAA 2F4PA 2P4WA 3WW1A 1MKMA 4GXOA 1FLIA 4LMYA 2KIUA 2B8MA 4MX3A 4XFCA 4EJUA 2ADUA 2PFBA 1O7LA 4M9SA 1OPCA 3OF1A 2G9WA 3O3KA 1RL3A 1OYWA 2M8EA 5DV5A 1FT9A 5BMZA 1NE4A 4BHCA 3IKTA 2K0GA 1BBYA 3BJ6A 3FFQA 2CG4A 1JE8A 4Q0SA 5ICGA 4E2SA 4RS8A 4QWQA 2LDUA 2JPBA 4KFCA 2RN7A 3JAMK 3J7AO 1ZRRA 1S7AA 2QBYB 2D5FA 3M3IA 4XLNF 1IN7A 5E16A 3IKVA 3JW4A 2XKPA 5HLIA 4MTEA 1SFEA 5HDKA 3HRTA 5D6FA 4D0PA 1FC3A 5FD5A 2ZNZA 2QDRA 2UY9A 2BEOA 2Q2EA 2QQBA 3M1EA 3QOPA 4TLFA 3LAPA 4META 1O3TA 2KJCA 3TO9A 3SCFA 3EJKA 3JTHA 3EDPA 3WW3A 3JSOA 2XRNA 3MEXA 4EM1A 5FPZA 4L11A 4MGKE 5L3DA 4I02A 3HIFA 3ML6A 3H8UA 4KIBA 2ESNA 1J2XA 2A3SA 3HOTA 3HRUA 2G7HA 3I59A 1VTNC 3IDCB 5AIPA 2IXKA 3K2ZA 1MGTA 4XBFA 4CDGA 4RGUA 4G8XA 2GC2A 1YYVA 1ULYA 4HZFA 5LHHA 5I0UA 2V79A 2A07F 5DYMA 3S7EA 2DPUA 2PAMA 4UBHA 1ON2A 3BJOA 4FHTA 3Q9SA 3QACA 5ED4A 1HKQA 3DV8A 3H92A 3MZHA 4LLNA 1Z05A 5HI0A 4AIJA 3TNQA 4HLYA 4UUVA 2PI0A 3DF8A 1STZA 1SQ4A 4M9ZA 3LWFA 4RB1A 3W6KB 3NJZA 1A04A 2Z33A 2BGCA 3E5QA 2F5EA 1O57A 4HX4A 5L3EA 5LEKA 2GIVA 5IT9Z 4RGXA 2RNJA 1R23A 2IXJA 1YS6A 1CAWB 4IEPA 1IPKA 4IRGA 1RIOH 3IC7A 4EGYA 2XAGA 1FP1D 1P6RA 2M45A 2OZUA 1YS7A 4J1XA 3ZMSA 2HOEA 3U9GA 1ZYRF 2G7UA 1ZREA 5D5XB 3ZN0A 2RV8A 4HF0A 3QPTA 3VFZA 4I3PA 3V7CA 1LR5A 2Q30A 1I1SA 3EETA 1YO5C 3ZMTA 4JVAA 2OU2A 3LWCA 2HJIA 5KHGA 3RYPA 1D5VA 2WTEA 3WGGA 2F2EA 2A68F 2HYGD 2Z3YA 2FMYA 3LAGA 1SFNA 1ZVFA 4HLXA 3K1PA 4EMSA 3F23A 3CO2A 2A61A 4F8AA 3IWFA 3FWEA 4EQQA 4EGZA 2MLKA 4TV7A 4ORFA 2B5HA 1V70A 1TBXA 3P9CA 2IA0A 1FNNA 1H0MA 2J5OA 4YFXF 2P6SA 1F4KA 1IAWA 1T39A 2D5HA 1IZ1A 1TW3A 1ZG3A 2ZO4A 4LB5A 2YSRA 3OOPA 1W4MA 5FFXA 4DQ2A 5E20A 3SMHA 1G3SA 3T0YA 5DUIA 3RTRA 2LSOA 4P96A 2UYAA 2E9QA 2DLLA 1PP7U 3MQ0A 3ZMUA 2IA1A 4PIXA 2L54A 5D8KB 3HOSA 1VJ2A 5H6RA 4HDUA 4I0AA 2X4HA 4M72A 2H27A 5HLGA 3LA3A 1CAWA 5D4RA 4P9GA 4ZU5A 3E6DA 3F22A 1X8EA 2VT2A 4NHJA 1J3QA 1H1IA 5D5VB 1IPJA 5BQTA 3K69A 3GFMA 4ESBA 3KP6A 4H7LA 1FOKA 1NZCA 2H09A 2QQ9A 2ZFWA 2IJLA 4KMUX 3TKYA 4U7BA 3SCHA 3SZPA 1HXDA 3TDUC 2CW0F 5KVRA 1GVJA 3U11A 1E17A 3E97A 3OTFA 2CO5A 4LUMA 4XFFA 3GEZA 5KHIA 3DFGA
chains in the Genus database with same CATH superfamily
1AR92 1US3A 3TW7A 5F3EA 3ZFEC 1EA3A 1Z7UA 2BZDA 4KICA 4R9DA 2Y9YA 1UPIA 2R5ZB 1WSUA 3AMNA 4UFMA 3JRCA 4XJUA 4F52A 1H4GA 4UAPA 2OXBA 5L3CA 3JUUA 1V5EA 5AONA 3AZVA 1ST8A 3J80Z 2OQ7A 2WA4A 3ZGKA 3BPVA 1LOEA 1EJ9A 1I27A 2Z5UA 3K9TA 3LSGA 3BLYA 4QX2A 5FP4A 4KYWA 2B9SA 2RS13 1ZYBA 4BGDA 3O1SA 1AR72 2OVUA 5EEAA 3WU2C 2M4GA 4XRSA 1WCUA 3HEIA 3WP5A 3CHXA 4ENKA 3JCUC 1LENA 1J83A 5CISA 4JGYC 1OQYA 2F4IA 4KUMA 4Q4W3 1DQ2A 1WVRA 1Y56A 2JQ7A 4OU0A 3QBQA 5LY2A 4Q1RA 4XILA 3ZR5A 2OX0A 1YHFA 2CV1A 5IWFA 2L02A 3IPVB 3PHMA 1SACA 3FZVA 1PO13 1H6XA 4B4PA 4MHGA 4K2EA 1JTYA 1ACCA 3ABZA 1AR82 2CV0A 2DYRH 3CMYA 3TBDA 1GHCA 1T0FC 3J7AY 1HF0A 2J5PA 5EJCA 5DZGA 2DBNA 1JZ5A 1QA6A 5FO7B 3Q8BA 2DA7A 1XE7A 3FMGA 1A8DA 5FZ1A 4N4NB 1LGBA 1MMDA 1X1DA 2PX9A 2K9LA 4UNOA 1NH3A 5K8SA 4U87A 3VBUB 4UFLA 3I4IA 3MBWA 3VZKA 2F5VA 2F4MB 5E18F 1VBD1 3VWBA 3KE2A 4RM2A 5JPNB 3F8MA 1RC6A 1YQ2A 5DUWA 1S0EA 3BG6A 2JDNA 1JZ3A 4JOMA 2JA8J 3KB5A 3THCA 4AAPA 1NG0A 4A0YA 2Y6HA 4CXFA 1D4M2 4IOAF 4LO8A 4Q4V2 3S1QJ 4Z2WA 3C2BA 4IHSA 1LGCA 2OZ6A 2BQPA 5IK4A 3AFGA 1WKYA 1XDUA 2ZMEB 1MVEA 1UIJA 4FXGB 1FYLA 3GTOJ 2O8OA 1WA6X 3ASIA 2OPTA 3N9PA 4AEDC 3GX4X 2P6TA 4OHXA 1JUMA 3J7HA 1LHOA 4XMAA 1AUYA 1LECA 4IV3C 2I8DA 5EYYA 1F4AA 3JU9A 1Y6IA 4QHBA 3AKQA 2GALA 1PK6A 3OS0A 4BK4A 3D5SC 1R1A3 4RB2C 1IG0A 3QU6A 3F72A 3OPZA 2XLFA 3AAFA 2FBHA 2XJTA 3RZKA 1G7YA 1BJQA 1N1VA 4S05A 2HS5A 5EP9A 1QJU3 4RR3C 1RUE1 2ESHA 5IPAA 2XJUA 5J1UA 2HQ5A 4EN8B 3J80K 3ZMNA 4LQRA 4CEWB 3H5RA 4D7SA 1LPQA 1RUNA 3B5LB 4NPMA 4WF2A 3GZUC 4CXYA 4I0WB 2R071 3O0WA 3T4HB 1WJCA 2RC4A 2G9GA 1UO9A 2IEKA 1FOXA 4WV8A 1D2SA 4A3XA 1WD4A 1BW6A 1LTEA 2M8GX 1JKPC 2LK2A 3KT7A 1X8MA 4CHUA 4JX0A 3CU7A 2MHFA 4YYOA 3RG0A 2W1UA 2XWBB 2DJNA 5FKOA 1R9TJ 2WY8Q 1B59A 3D5OA 4GO1A 3GJBA 2WSVA 5JVTA 1FMVA 5J1YA 5C9AB 4TN7A 3ABLH 4AZZA 1GOGA 2WWJA 1JBCA 2VBZA 3CCQI 2QTWB 2LM3A 5HNHA 5F6KA 2E2JJ 2ADEA 1P4AA 1G3TA 1YLLA 3TEZA 2DCJA 4UFJA 4UF0A 4QQLA 1R1ZA 2LBFA 4CU6A 2EV0A 3FUQA 2OT7A 4RBOA 3LSKA 4QDQA 1OURA 2O6GE 1ODDA 4YW1A 4PJYA 3S7IA 1EV7A 2EH3A 4FPKA 1MJBA 3P9IA 1LFPA 9ANTA 3I3QA 3F8BA 1R5HA 2RDNA 4BZ4A 4OI0A 3VYUB 3LSPA 3IT8A 3SQNA 3DGTA 4DZGA 2DCZA 2HWC3 5IK8A 3H3VK 1QJX3 3F2ZA 1UG0A 4BKXA 3T8TA 4WM7B 5A7SA 2VMFA 1O3QA 4NQWB 5D8AA 2WV1A 1AF9A 3K4ZA 2ZZJA 3A01B 3LSTA 3KHCA 4A2UA 1Y9MA 3VD9A 4KWKA 3RQIA 4BIFA 4AEJA 1W0UA 3WXPA 5CPRB 2VCAA 1MBGA 3I55I 1ZGWA 1OLME 3CCUI 5ACA3 5J96B 4M6XA 5DDJ1 4YZ2A 1M06G 1OF3A 1TME3 2ET7A 3ACLA 4JDNA 1XMKA 1Q5OA 2WAEA 3HBLA 1O3RA 5CFCB 2TRTA 3IRRA 3E6CC 1XDSA 1NT0A 1U5ZA 1RUF2 3MLJA 4CVUA 3FHAA 2OJED 4JBAA 5L3FA 2IZWA 1OH3A 1B9NA 2E1MC 1X1AA 2VQCA 3RJRA 1W7PB 4BOWA 2XOMA 3CP8A 3LDKA 5HNFA 1W8OA 1KU2A 2JXAA 1VQ9I 2PG4A 1V6NA 5FZIA 1NAEA 3W59A 1Z9CA 2XSDC 4C9YA 3K70C 4BJ5C 2AC1A 2EFQA 4OMZA 1EH6A 3HGYA 2LROA 2BFUL 3I3LA 4WM8C 1JUIA 5BPXA 3THTA 4DW6A 2O1QA 1KS4A 2DFBA 3GYHX 2YPRA 2LMDA 4YRVA 5LGNA 4ZPIA 2KD7A 2V4VA 3T0DA 3O2PE 2B0LA 2ZJ2A 4YPJA 3C7EA 1KU3A 3MWMA 4ZTFA 3VB2A 3TO6A 1HXS3 5HPOA 3ZSKA 4CH7A 1LOCA 4CDWB 2NVYJ 2OV7A 3VBRC 1F9NA 3PDQA 4ITVA 1NY71 2M0CA 1U5TA 3CLOA 5FXWA 3WHBA 3F8FA 4M3CB 1PMJX 3AYEA 1CAXA 3TB0A 4EWEA 4I7HA 3HOYJ 2FA5A 2PQSA 2EIEA 4JK1X 2XGCA 1NCQB 1JT6A 1U0JA 4HG2A 1C5IA 3RZZA 1LEBA 2J1TA 5E1WA 2NZ9A 2VONA 1B09A 1QU0A 4XUTA 3SHFA 5L73A 4NIDA 2NRAC 2JDHA 2Y60A 3VBHB 5EJ3A 4EATA 5FY5A 3K70D 5DM7F 1R64A 2NYYA 4MV2A 1WUVA 5CKTA 4LITA 1ZZBA 4BQNA 4ZXKA 4Q1PA 3OBRA 2RQPA 4MNUA 3MKWB 1UZCA 1E3HA 2VPVA 2WA0A 3HUGB 2RDSA 3IZOA 1NYWA 3KYDB 2ETEA 4AK3A 4KG8A 3DEMA 1K6YA 2M34A 2VMCA 2OA2A 4PI0A 2HYJA 3G4SI 4RFT0 4LO6B 2R043 3LQRA 1VBE1 3U2RA 4AL9A 2W95A 4DIQA 5AC92 2W0XA 5ICFA 3JRAA 4XMIA 2VTXA 1ZRFA 4A3DJ 4Q4ZF 2XVKA 4COVA 2W94A 1ETQA 2D6NA 3B7MA 1K61A 3AZZA 2V4JC 3FFZA 1QDOA 2IGNA 1ZR4A 4XJWA 1HDDC 4XN3A 5EWSA 3JD72 3GO5A 1R1TA 1S0IA 2VJIA 3TEDA 4QM9A 4PIYA 4FPHA 2E2HJ 2KIMA 2VM9A 2QQLA 3THPA 2GM4A 3FXRA 2EVXA 5FLIA 1RUOA 1XS9A 3T0BA 1LOFC 4PFOA 4CO8A 2BVVA 1W9YA 1P4XA 2XVCA 1SC7A 4YRDA 5BPIA 3AJZA 4XJ8A 5J09A 2JG8C 4U0YA 3PL8A 2CV2A 1DPUA 4Y1YA 5K0UC 3VD7A 3J8F3 1Z91A 1SZBA 1QH6A 2WWUA 5BYNA 1HIXA 1AX0A 4EJVA 2BNMA 4XSZF 3IP4B 1PGSA 1W2OA 3I2HA 2PHLA 3ETPA 2EIDA 1B35A 2XPJA 3SYTA 2Y6GA 4C8DA 1SANA 1IDZA 2JDZA 3WG4A 3K4CA 4AI1A 2UXXA 4OI4A 1S9HA 4MGSA 2VQGA 2WO2A 4MZUA 4G6TB 2XL9A 3O7OA 5EZWA 4GULA 2VJXA 2UWMA 3NVCA 1O5LA 4IV1A 4A3ZA 2PLV1 2A6TA 4Q4Y2 3UGGA 1KQ9A 5BNOC 4K3UA 2X48A 1PO23 3CC4I 5FZKA 1QQP1 1UD1A 3SEEA 3FXKA 3SH4A 1MPXA 1DYPA 4FO9A 4CGZA 2ZA9A 3D0SA 1MZEA 1ZBE2 4XXPA 1NLRA 2N7GA 4AI9A 1ZX5A 3CZUA 2PHTA 5FYTA 3RPQA 2QZ2A 1OR7C 4E2QA 4JHTA 4W50A 1DGWY 5BXXA 2VH9A 3U10A 2G4IA 2BBYA 2ZEZA 4CEYA 4YG0A 1VQPI 2EFNA 3L2UA 3FXQA 3N4MA 2R93J 2DA4A 1ZQ3P 4JHZA 5FKKA 1N47A 5FWEA 2RS51 3VKNA 4WVZA 2XPWA 3TEXA 3INAA 3DBLB 1JTXA 1ZRCA 3PNAA 2VQ0A 2CUJA 4XN0A 5L3BA 5F32A 5J3LA 1QIQA 4GH4B 1KQ8A 4A3FJ 2Y6JA 1B9MA 2QWWA 2DTZA 4IF4A 1DUXC 2QKMB 1RUG3 1ZA7A 4N43A 3DKXA 2ES3A 2HWD1 2EXKA 3TMOA 1IQAA 4QMAA 3O6BB 3RJPA 2BNOA 3H3UA 2QSHX 5GLVA 5FYYA 1O8SA 1PX3A 5KBFA 2R4GA 1FXZA 3WHTA 3M8LA 4B8XA 4XW3A 3ZXJA 2W00A 2HWE2 3ZSLA 4EE2A 1OBNA 3VZLA 1J84A 3NAUA 2R7QA 1Z7S1 4X1EA 1C4RA 4L18B 5FPXA 3ZQ7A 2RREA 4Z2AA 1N1SA 3ZN6A 1XNKA 4Y5SA 1R71A 4GRIA 4Y7NJ 3VBSA 4LE4A 2Y48A 2PAEA 1OPOA 2BY3A 1NHAA 1W03A 4EM2A 3KP4A 5F27A 3O8HA 3R0AA 1JHNA 3I64A 4BQWA 1OYYA 1XNTA 5H9PA 3RWKX 3BCWA 1QJZA 3V8JA 3N05A 4C2MJ 3WW2A 4IEZA 4BM8A 2VODA 1GQPA 4QHOA 3U1DA 3H3ZA 1W6NB 1ZBE1 2R063 1RR7A 4AWDA 2K02A 5CVJA 1PM7A 4WZFA 4S2HA 1MMGA 4XOTA 2A6XA 2DW4A 3UR3C 5EQUA 4DJAA 3OYWA 1AA7A 3HMYA 2XVGA 2Z5WA 2GMEA 3K4NA 2OAZA 1JOJA 1YCIA 5DD4A 1RB8G 1OOPB 5FLJA 1RRJA 3RI9A 2IGKA 2EZLA 2NOGA 2JSPA 4NRMA 2IWGB 3E5UA 3CZJA 4LHLA 4AC0A 2K9NA 1X9PA 1SFOJ 4LT5A 5J47A 1QWRA 3ZN4A 5IVEA 2FDIA 3F21A 4PQQA 4XHXA 1Y0UA 2XJSA 5BNNB 3G6EI 1MS4A 4NHYA 4C91A 2CQNA 4IJAA 1PVC3 5E8IA 4LNVA 1K83J 3GUDA 5DMYA 2VIXA 2ZMKA 2DFFA 1G3WA 3JRHA 4IEYA 1FPN3 3I3DA 4UW3A 1WRJA 1UYXA 5G05L 2UURA 2DUOA 4LOSA 3UT0A 2BV6A 2CQXA 1NA1C 3MVPA 3OR1C 3PVEA 3Q5FA 5M5WJ 3GJAA 2GNMA 4A7YA 2DXIA 1DPRA 3J7LA 2F48A 1S0BA 4CZSA 2W91A 4QU2A 1YI2I 2O0YA 1WH7A 1XCBA 3RKXA 4ASMB 2QQMA 3KD4A 1POV3 3D8CA 3AG2H 3PUFA 4YVSC 3M07A 1RUJ1 3IIIA 1GMMA 3MIBA 1YFUA 3I5UA 2K5CA 4IPAA 3WG7H 4XXAA 5CA6A 3AJYA 3RPUA 2A3YA 5DCMA 1T56A 1S3JA 2ARCA 3I4PA 3ZFGA 3GDBA 4ENNA 2P7CB 1Q1HA 3POJA 2A75A 1T95A 2WAQA 1HKDA 3POSA 3PJQA 5GPAA 2JT1A 4NWWA 1SCRA 3OGRA 5ABJB 4HBNA 1V9U3 3I8TA 1IRFA 3QPLA 3EMRA 3KV5A 4NO4A 3BPXA 5LGTA 2FCTA 1HB3A 1OQEA 5I8SA 3DKWA 5FO5A 1PGL1 1NCQC 2GA2A 2BE5F 4ENMA 1RINA 3TOJA 1ZH5A 2BOIA 2QVSB 1MEC2 4O7XA 5FRAA 2ZTNA 1KYWA 3HR9A 3PIJA 5HXMA 3VBHC 3P5BA 3VD4A 2IGMA 2MD5A 2BP6A 3HT2A 2RKHA 2DK5A 3IAPA 4Y13A 3O1MA 3MZYA 3KETA 1RHI1 1T38A 1V6IA 2QCSB 1TWGJ 4DPNA 3CEWA 3H8OA 1VRH2 3L00A 2NS7A 1OLQA 1RUC3 2C4XA 4IXLA 3L2YA 2HQRA 4ZYDA 3CJQB 3VV1A 2XKOA 1YEWA 2G0EA 2CS3A 2JE9A 1YRNB 3K0LA 4OIQF 2LF7A 2R7SA 4U0WA 2DJIA 3AKSA 1LKNA 4ONUA 4GQ7A 2ZHNA 3N9MA 1CF7B 3HSFA 3PO3J 2PHFA 2RMU2 5LBCA 4PLMA 1VBC3 5FB2A 1TNFA 2RS11 1UHWA 3S3NA 4XKBA 3OYMA 2LTPA 2Y69H 3D5LA 3KP7A 5ILSA 2YC0A 2IFRA 5FOJB 2W52A 2R7VA 3T5XA 3DPRC 1VMHA 4Q4W1 3A0HC 3K6GA 4CXWA 4C3JJ 5E89A 2IFWA 4HK8A 2BY1A 3DWLE 4A93J 1ZZCA 2XASA 1L7RA 5L9RA 4A7KA 3IDBB 4AWXB 1PO11 2J1EA 2H6BA 2A5ZA 1QJU2 1H6YA 2BDRA 5FYBA 2H1KA 1POQA 2NNYA 3IIAA 2NNNA 2HEVF 5LCWL 3M3YJ 3N7KA 4FI9A 1QZEA 4M3EA 1AR63 4A3KJ 1UOJA 1WCDJ 2DWRA 4BHBA 3ACGA 5FY4A 3ZPLA 3J81Z 5D5WB 2HFHA 4LBOA 2L9SA 2GOXB 2Y64A 1XSVA 2VZSA 2Q4SA 2HU9A 3C3WA 3USUB 3TQNA 5LK7B 1IF1A 3I2FA 3CCVI 3D0JA 2RDPA 1A8MA 1QHDA 5FMCA 2XBO2 3MGUA 2W08A 2HR3A 5FZHA 2DK8A 3CLPA 3HRSA 1ETXA 2H8RA 4YGDA 5JVVA 4MOAA 2LY1A 3T08A 2YU1A 5JMCA 2DTYA 2KRFA 3S2WA 1AJOA 3ZQHA 5FZLA 2PHDA 2VECA 1XJAA 3LSHA 2BXYA 3LKJA 4IEXA 2DUPA 3C8XA 2ETHA 4EJOA 2RMU1 4LULA 3B94A 2L9RA 1CGPA 3SHRA 1MNMC 2I74A 3R05A 2JD9A 2FU4A 5FREA 4GWMA 3EPZA 3FZ3A 1R1A1 2ZJRF 4CE8A 2B7EA 1O91A 1HB2A 5C8CB 2HWB3 1B8IA 4EJRA 5A33B 4UFIA 2JDAA 1L7QA 2WT1A 3AXEA 4GH4C 3S5QA 5DTDA 1BJZA 1RUD2 5F37A 2O03A 4B47A 3AP4A 5FPLA 2QDNA 5A3TA 5FO9B 2W48A 4XSXF 4O65A 4HYEA 1QJU1 1I5PA 2XF6A 4MHUA 3SISA 1LNSA 1ITYA 5E8AA 4IE4A 1Y39A 1UCRA 2UUZA 4RHV3 3FLPA 2K9SA 4PZJA 4QKNA 5K7PA 5FKLA 4IZZA 3D3AA 2HGCA 1MBHA 4R52A 3ME2A 3CJRB 5LBQA 1RVF3 3KT4A 4CA0A 1D1CA 1Z7LA 4G6DA 4N9HA 2RS32 4G7HF 2CUFA 1SFKA 4Q8LA 2X6WA 3CJIB 2VC0A 5I93A 2YDEA 2Z16A 2BW3A 2VR4A 5HBAA 2OQRA 2OQGA 2XAFA 2OKXA 2KIFA 1S72I 5FROA 1A6CA 1KGYA 2A6HF 2XXZA 2W92A 5KCMA 2EPFA 2BYVE 2UXNA 4R8HA 1LAJA 3KLOA 1POGA 3O1UA 3CUOA 1BOBA 3JBG3 2PMHA 2XJVA 5EG0B 2VQTA 3OD0A 1US2A 4NHKA 1FMD2 2M3AA 3L2VA 2ZBJA 2O8QA 3LDRA 1UZZA 4X0GA 2L9VA 3B73A 3D1NI 5EV7A 1LHVA 4FTSA 2E1CA 1MQTA 4JKMA 2MABA 3KP5A 5GM0A 2X6OA 2J1UA 3HXLA 3F8NA 1AYN2 1TL8A 3SKVA 5CYYA 2MEV3 3J81K 4TLGA 2O5RA 3GALA 2HOAA 5K4LA 1HJGA 2HWC1 1OOPC 1QJX1 4CDQA 3U14A 3CJXA 2GDFA 1MZBA 4OUMA 3D5RC 1RXGA 1FYMA 1XMAA 3BB6A 2JJ6A 3T8RA 1NCRB 1VQ5I 3ZMZA 4PGHA 4CUAA 2YU3A 5L9VA 3I9V2 1OLTA 5IUQA 1WJDA 4C1XA 4XUOA 4F3QA 3WGHA 3VDXA 2VMDA 4XOGA 4B4RA 5GZFA 5ACA1 2UY8A 5BNNC 5E3OA 2YPJA 4XRSG 4G7ZF 1TME1 2C6SA 3HN3A 4P9UA 3AYCA 3V8KA 3E6MA 3CP2A 5HLHA 2C5DA 4RQPB 3I2IA 3TN93 4G3YC 3M7GA 4HDVA 5DAPA 3ILRA 3LDBA 1L7LA 3J7ZI 1YNAA 3I59B 1UJ8A 2ZJCA 4A3EJ 4FAGA 5GLZA 2R7EB 4WVMB 2JDKA 5I0DA 4Q2FA 4N53B 2IAIA 4MGYE 5DS9A 2GXBA 1UU5A 2VMHA 4XKWA 1FLIA 1HB4A 4DMIA 3FXOA 5BNPA 3OSDA 4F92B 4M9SA 4YVWA 1RITA 1XYOA 1OPCA 1RL3A 1OYWA 1FT9A 1WJBA 3BJ6A 4QPIA 4QX7A 1CZVA 4QWQA 1HXS1 1WJ5A 2BHZA 1FOWA 1SMVA 2RN7A 3I97A 4XPVA 1Y0NA 2VY0A 1ZK8A 2E51A 4SBVA 3JW4A 4XNFA 5HLIA 4MTEA 1G8XA 5D6FA 3EYPA 2VL8A 5FD5A 4LG3A 4D8MA 2BEOA 3M1EA 2DA6A 3LAPA 1O3TA 3TO9A 4HNTA 3SCFA 1MS9A 5F6LB 3EJKA 1OSGA 1GANA 2WWSA 2XRNA 3BGAA 4XJZA 3MEXA 3VDCA 2J22A 4L11A 1Y8RB 1OFSA 2QQ8A 3AVSA 2WQ8A 1OH4A 1CVNA 3RMXA 3K2ZA 1MGTA 4CDGA 2WZR2 3SH3A 4J6GA 1HRI3 4BXSV 1QJY3 1ULYA 5IATA 3H3LA 3POBA 4CDUA 5LD2C 5LHHA 4AGVA 2A07F 5J1XA 4UBHA 1XYPA 2F4OB 3ZXGA 3WCSA 4FHTA 2DDUA 4NIIA 5HI0A 4XQWA 2P34A 4HLYA 5CZKA 2P1BA 2PI0A 3DF8A 4QSHA 2P4EA 1STZA 4TYSA 3K4KA 4XLFA 3W6KB 3ZVXA 4PK4A 4GMP0 2Z33A 3CJTB 2BGCA 2R041 1GU3A 5IT9Z 1HRV2 5C5TA 5GALA 4J00A 2FDGA 2IXJA 1YS6A 1CAWB 4CCCA 1IPSA 2V26A 1OD3A 5EIYB 3GF6A 3F0CA 1JN2P 3IC7A 1G86A 3WOGA 4QQOA 1AXKA 4C0BA 1YS7A 2GNTA 2Y0SN 1F2NA 4Y26A 4PJ0C 1ZYRF 1F43A 1XYNA 3VKOA 5D5XB 3VN4A 4EEFG 3QPTA 1RC9A 1YO5C 3ZMTA 4JVAA 1G9AA 2OU2A 1D0ZA 5KHGA 2WTEA 3HQRA 1K4SA 1YX5A 2YC2A 2Z3YA 4AI2A 1ZVFA 4FPGA 1VRBA 2O9LA 5KC6A 3F23A 3V0AA 5FY1A 2WN3A 4INDA 3CO2A 4BE2A 1W39A 3BR2A 4EQQA 5DG1A 3POWA 2MLKA 1R092 3MIDA 2DMNA 3KV6A 4D3WA 3P9CA 4LOCA 4CCEA 3NO8A 4Y5TA 2P6SA 2IGOA 1F4KA 4GXLA 1T39A 1IZ1A 1ZG3A 3J8F1 4MFEA 4M0NA 5CIRA 4P14A 1BKZA 3B9CA 5E20A 1YX3A 1ZTRA 4KH9A 4FPEA 3SMHA 1D4VB 4FCAA 5JXGA 1G3SA 4GAZA 3BR0A 2ZACA 2UYAA 2DLLA 3MQ0A 2IA1A 4C30A 5IYBJ 4UI9L 2L54A 2W1SA 4LO5B 2ZSIB 2RM22 1MR5A 4YW7A 1RMU3 4MGTA 5HLGA 1G2HA 1WMFA 5JLWA 5D4RA 4P9GA 3WNPA 3E6DA 3F22A 2YBSA 3O1PA 4ISRA 1H1IA 2I10A 3K69A 2YGMA 3GFMA 1PO21 2X5IC 3GZNB 3ZR6A 2WB1N 3LB9A 1FOKA 1H2KA 4I99C 2SLIA 4L97A 1ZA4A 2IVIB 3AYAA 3N9NA 1EV13 4E7HA 4AGRA 4AU7A 3GEZA 2VPLA 1I50J 1PNGA 2VQLA 3DFGA 2L9NA 2WNUC 4PQ9A 1OCZH 4MEYF 2IS6A 1RI7A 1TQPA 1TNRA 5C44J 2BV4A 5C8CC 1UOBA 1S5LC 2P81A 3WF0A 1K3IA 2Y0OA 1KQRA 2O61A 5HVQC 2YU9J 1TMF3 3KCYA 3CCLI 4LBMA 3WTWC 3VHOA 3FM5A 2ZHMA 4HANA 2O14A 1TW2A 5LA2A 5DQ0A 2IBDA 3CC2I 2DU0A 2VE9A 2VVFA 3BOWA 4PLNA 2VTXJ 4ZONA 5ANNA 1RUG1 3IV5A 1URXA 3WDXA 4YW6A 4JDMA 3SKJE 5CKMA 4LXLA 1XD7A 2FQPA 4BH9A 5CVVA 2HXIA 2LD5A 1AOYA 1KDKA 4XLPF 4EN9B 3K7AJ 3VHNA 2NN8A 3T2PA 1FP2A 1OCPA 4E7KA 2HZDA 3PFIA 4RLFA 3OYHA 1TG7A 4EZHA 5CG8A 2D93A 1D5YA 1I6HJ 5JPMB 4UFHA 4XFIA 3LEKA 5C5UA 2DMQA 1ZGAA 3GXOA 1E5HA 4KWLA 4L0PA 2W3JA 2CGPA 5JZGA 2W87A 1MMNA 2JVGA 1PK6B 5DUXA 3WV6A 5A3MA 1GWLA 4Y1XA 1SFUA 3IDEA 2QEXI 2JE7A 3CDLA 1HQCA 3ZYHA 3CBNA 3AG4H 4AYBA 4HQEA 3M8FA 1UY2A 2D3RA 3TNPB 2ACJA 1BL0A 1WJEA 3DXTA 5L3GA 1NX9A 1GZCA 4UB8C 4DUXA 2R061 3GHMA 1U3EM 3IMMA 4XAAA 3OB8A 1R5ID 3RFRA 2JIGA 2OYZA 4XF1A 4XFHA 4MLOA 4OMDA 4XIDA 3GYDA 1XE0A 1ON1A 2WINB 2PLYA 2R49A 4N9IA 2XIGA 4GZ9A 1G6NA 1HW2A 5IJRA 1S55A 1XBFA 3LFIA 3WQ1A 2OTJI 5FJHA 2XSJC 4XLCA 5IT3A 2VXDA 2K9QA 4L8QA 3R4KA 3VBOA 1PMIA 4CUBA 3VKFC 2RG4A 1MDMA 4QX0A 3G7DA 3ZFEA 1NK3P 4RQPC 1E5IA 4PJJA 2EA7A 4B1MA 4DOUA 4HX8A 4UF0B 2ZFUA 1PVC1 2LBFB 1DFQA 2P37A 1C8M2 1ZARA 3I4NJ 4RDUA 1DU6A 4HKLA 3EXUA 1IXCA 3HOVJ 1FPN1 4AVPA 4FVVA 4C2TA 3AFKA 5M3FJ 1NXMA 5A1FA 3TEYA 3PJYA 5FXZA 1VQ8I 1EH7A 4LR4A 1WW5A 1VMFA 2VOOA 4ETSA 1PJRA 2DMPA 1ZBA3 2VJ4A 2D6PA 4PBOA 3FK7A 4E70A 1QDCA 3WTXC 4HPQA 3OYAA 5D8AB 1POV1 4ZDOA 5I8YA 4DFSA 3I2GA 4JGYA 3W6VA 2VPRA 3VZNA 2JX9A 3FM3A 3KYLA 3WNKA 1UXXX 3Q0UA 1LEMA 1COV2 3NSTA 3NKGA 1OLRA 4NJ4A 3KEQA 1VBA3 3Q8AA 4JTNA 3WCRA 3AG1H 1SVMA 4LK0F 1T0FA 4OINF 1ZNPA 4HN1A 1AR93 4NB5A 3ERMA 3IAS2 4H14A 1H1AA 2P3IA 1PDNC 5JOZA 1V9U1 4IERA 2VO5A 1ETVA 3UKVA 2ELKA 2VOPA 5EEHA 3GLXA 4HLTA 5FP8A 4Y15A 2A70A 1UOGA 2MH2A 1U5IA 3KF5A 4JKLA 4D6SA 4KT5C 3EB7A 1T8IA 1E5SA 4B29A 4F3JA 2KJBA 3KVBA 3N3HA 2XPUA 1MSFC 3K3NA 5J3UA 1RR8C 4AVVA 3FDYA 2RE9A 1Y4WA 3G1MA 2KFDA 2DUQA 2V1XA 4JKKA 2KP6A 3TWIA 4L5IA 1BVVA 3HHHA 1AR73 2VD7A 5DG2A 4KBBA 2GZWA 1XXNA 4OI2A 2PFWA 5A80A 2JSCA 2KT0A 4MQ9F 1LEDA 2JA5J 4WXCA 5K1YA 3MI8A 3HPGA 5IVBA 3HNBM 4YM1A 2IPQX 1UMHA 1DDLA 3VEPA 1RUC1 1TWHJ 2JB4A 4FPCA 1UL9A 2W82A 3OYCA 1U5TB 1ZHFA 5IYDJ 1AR83 3GHNA 5C4JJ 3WF3A 4AEDA 1B72A 4GWNA 2JB8A 5FPUA 3A4UA 1BXHA 1CAXB 1OT5A 3QP5A 4IV3A 2DT5A 1PP8F 4NR1A 2OF7A 1IN5A 4XORA 3DP7A 4B09A 5EFUA 4IE0A 1VBC1 4YZ3A 1K6OA 3R4DB 4QDRA 3ASNH 1DQ0A 3TP3A 2K46A 3LFUA 4FQZA 3HOXJ 1QVTA 4A12A 1LOAA 2DCKA 3WNLA 3CMEI 3V42A 1CPMA 3OYBA 2GAUA 4ON0A 4DGWB 1KJLA 2WT2A 3SH5A 4NROA 4RB3C 4IXAA 1CQTA 3EUAA 2WY7Q 2P0WA 5GAEJ 5C71A 3FX3A 2F4LA 4XURA 1W0PA 2XB5A 1G9CA 4LBQA 2Q1MA 5JCTA 4OWRB 1D4M3 2VOWA 2YMZA 4Q4V3 3Q0VA 3N97A 2M5WA 1Y1WJ 3B01A 4YNIA 5BPDA 1SAXA 2QBYA 1QQIA 1MBFA 1Q3EA 2RDRA 3FK6A 3QP6A 1JYCA 4M3CF 1F4HA 2QKDA 1CESA 1WGXA 2OTLI 2K9MA 5AFEA 1GXPA 4QLCU 3V56A 4A3IJ 3V8LA 1HQNA 4ZZLA 2YFUA 1AKHA 2YPDA 2VW2A 3AMHA 4L9JA 4J1WA 3A4CA 3OIQA 1XB9A 3NJVA 3M9AA 3CMAI 1GXQA 3NWTA 2A6VA 3AXDA 4BQYA 3NV4A 4AIHA 4PHZA 5J6XA 4LPLA 1QO0D 1BJAA 3K48A 4HG6B 4EWDA 4RB0A 3WTVC 1H2LA 3OUIA 1T6SA 4G6QA 1N3OA 2P3YA 2QFEA 4DB5A 1LJ9A 4PUSA 4P5HA 3OMYA 4UT5A 4G7OF 4AHWA 3HL2A 2JVHA 4CZZA 4QGLA 2V09A 4JQTA 1ENRA 2VI6A 4Q4X2 4HNUA 3FXMA 2K85A 1DG6A 4KL1A 5CNAA 2VKVA 5FO8B 3ZYPA 3PNYA 3ESWB 4OHZA 2CAVA 2E26A 2ID6A 3BZKA 2GMPA 2GBYA 2HWB1 1B35B 1UMIA 4E4SA 2DQRA 2FDKA 2WWYA 5FYZA 2GLOA 5BUVA 4XIKA 4NPRA 3MLKA 4RGRA 2HYKA 2QQUA 1J58A 3S0MA 2DU9A 2QM3A 3LQQA 4IV1B 3I54A 3MPBA 5FZBA 4HAMA 2R7OA 5A3NA 5K9YA 2X0LA 4RHV1 2M1BA 3DYPA 3K77A 1P7JA 2L7MP 2J1AA 3O0VA 5F64A 5CYVA 3WY6A 5FKMA 4ASNA 1RVF1 4K9SA 4BL0B 1GOFA 1LQ1A 5H9RA 4A5MA 3VL8A 3FF5A 1UQXA 1OKQA 2O8XA 4CDXC 3H7YA 2ZGTA 4WM8A 2EZHA 1O4YA 4CEYB 2P3JA 1PK6C 4URTA 3AKTA 5A2QZ 1DP7P 1BA5A 2V1UA 4GYGA 4HV5A 5FCCA 2BBVA 2K2SA 2J42A 1D8KA 1NG6A 3JBG1 4UBGA 1HJFA 3QH7A 1IKPA 1CX4A 3ZMOA 4JQRA 2HEOA 2DMTA 3CZ6A 1YJWI 4N43B 4D7YA 3COAC 3EQLF 2CH0A 2E7WA 3TP0A 1YFHA 1H88C 1RUF3 1EUTA 1RUH2 3HBZA 4SLIA 1OA4A 3KM5A 5I91A 2MEV1 3DU5A 4MEXF 3OR2C 3DKYA 4Y33A 1QKQA 3I2KA 5FYMA 1QGPA 1H9TA 1NOVA 1UY4A 3ZN6B 3EO6A 2K4JA 5IP9J 3K4BA 2WN2A 5BY5A 4AI3A 4U88A 4CTEA 3SEZA 4YELA 4CU7A 1YJLA 3VBSB 2OCCH 3H35A 3N9OA 5FZ7A 2ZAAA 1HKTA 4UYBA 2DFHA 2XDVA 2WRAA 1BI1A 4B1LA 2E31A 1O3SA 1GV2A 3NNGA 4Q0PA 1KITA 4H55A 4CPBD 1I1GA 2Q8DA 4QPQA 3PTYA 3TN91 1IC8A 3WF2A 2Z4FA 4JQFA 3MIFA 1B4AA 1BI2A 2DYSH 4P08A 3NQHA 1J7KA 4GKXA 4FAHA 2WS92 1X9TA 2V6CA 1M4WA 3OYWB 5FPVA 3RYKA 1FBUA 3LIGA 1UWWA 2A1XA 4HNVA 3ZQIA 4P02B 3TW6A 2ZGOA 5M5XJ 1WLDA 1UX6A 2ERFA 3ZSEA 2OBPA 1FTZA 3OWTA 1UZ0A 4LJZF 3CQZJ 4E7JA 2NVUB 3T4VA 4HVOA 1MBKA 4LA3A 1CIYA 1W99A 4BE1A 4P1WA 3LMMA 4XQDA 2ORXA 2MA3A 1I3AA 3HAGA 4C0HA 3LSIA 1HA8A 2BHYA 4AD9A 3U07A 1WD3A 4QPGC 1X1BA 3QPHA 5JMOA 1LOFA 3PUAA 2JZYA 5CVRA 2D97A 3GZ5A 5JR2A 3DTKA 2JG8A 3WDWA 1NE6A 3P1IA 5A2QK 5F0CA 4A3JJ 3BVCA 2VBYA 2VBPA 2Y38A 4ZDPA 5K0UA 1OLMA 4Q5SF 3ALQA 4HRIA 4RS5C 1K78A 3L2RA 1WLTA 3LAJA 1FZPB 5A7WA 4AVZA 2ECCA 3T2OA 4BJ6C 3KV4A 2GNBA 5ERLA 4M71A 3A0NA 4WZCA 5AC93 2DQLA 1FJLA 1Y3TA 4KN4X 2Q2EB 1CZTA 5LLQA 3VBFC 1TT0A 3ELKA 3C1DA 3KCCA 3DPTA 4UVBA 2R1BA 4C2UA 3AKRA 1YFXA 4MQVA 1HRI1 5ICEA 1R1UA 1QJY1 2DFEA 1GR3A 3MV01 3ZXSA 3JD73 2K86A 5BNOA 5DCMB 4CUCA 4KIGA 3AMPA 4M3FA 4E8DA 3ZFGB 1R5GA 5KWRA 2BW8A 1USTA 4JX4A 5CLSA 5FBJA 4CA9A 4BY7J 1VQ6I 4LD5A 2JA7J 1XSXA 1YI7A 2DT7B 3IHUA 2K27A 3O1OA 1WHUA 1X58A 2ARXA 4QAWA 1DGRA 4DY3A 1OR7A 2L0KA 2DCEA 5FV3A 5DCFA 3B6CA 3WTUC 2GQQA 2P5BA 3CTAA 2KDZA 1DBNA 2ZHLA 3DCQA 2HWF2 4HT1T 3H1YA 4QX3A 5F2SA 2CW8A 2VC1A 1OMIA 2QQJA 1MJ9A 2ZCWA 3WTZA 5ICCA 1BK1A 2W1QA 4GDFA 2R5YA 1YITI 3K4MA 3ROUA 1FTTA 2Y9ZA 2FF4A 5FFOC 2NS0A 4MG2A 5D1IA 4LMFA 4M01A 4XBNA 1ZRDA 4MIMA 2L7FP 4HW0A 3MO4A 2EWNA 4PI2A 3VSLA 3OD4A 4Q4Y3 4XTMA 1SVLA 4S0HB 1RPWA 3RKWA 3WW4A 5T5LA 4BMBA 1KRIA 4OMYA 2ZKNA 2QQWA 3F9KA 1VAVA 2ATFA 1ZBE3 4EN0A 2JG9C 1RZ4A 2Y26A 4E6KG 3ZDSA 5FMBA 1R082 2BGOA 2YG0A 1FSHA 2Y0SA 4FXKB 1BW5A 5ISLA 4DXTA 3AYDA 3VZJA 3C18A 2YX7A 4XABA 2BWAA 4A3CJ 3E0JB 2MG4A 2PXJA 2HEYF 1WCKA 3PFYA 1U5YA 3RZHA 1EPZA 5FZ3A 3CF2A 3WNOA 1R7JA 4YFZA 4PIZA 1GWKA 3Q9OA 4AHXA 1RMU1 3BODA 2E60A 4NC7A 4U0VA 3I49A 3OBAA 1FSEA 4MGRA 3T1LA 3UL2A 5CG9A 2YBPA 1QH7A 1KFUL 3I3EA 4GWIA 5J37A 2GSYA 3BROA 2DFIA 2HWF1 2JDUA 4XBLA 5HCAA 2HTJA 2HWE3 5E79C 1IRXA 1X3ZB 2XUBA 4PDWC 3HYIA 5F5CA 3S1NJ 3RDIA 4P9LA 5FLVA 1EV11 3NJXA 4XEZA 3GNEA 3BTAA 4YM3A 3HGGA 2BY0A 4HV6A 2WAQN 3LSRA 1ZLKA 4ATEA 2Q0AA 2XV4S 1ETOA 4HSTA 1GP5A 2IXLA 1AHDP 5FZ0A 2P7VB 2V4AA 5J98B 3NNLA 3VKLA 1VB2A 4B44A 2UU8A 2GP3A 1HQWA 4IRIA 3I4MJ 3I58A 4JV4A 4NIGA 4CP9A 3OGGA 1R6RA 3C7OA 3LEGA 1RXFA 3BZCA 4IV1C 4M4RA 5IP6A 5LASA 1IV8A 5FRNA 2WB1A 2EB7A 3LE0A 1DYOA 1XCVA 2D98A 4W6XA 2W57A 4OHWA 1NA1A 2X8KA 5FLXZ 5E88A 2MLGA 2HI3A 1A3KA 1K5JA 1ORKA 3VDDC 4YZ5A 1EYBA 1YUDA 3H50A 2CYFA 2E5ZA 3MW2A 1FI2A 1LRHA 1DGRM 4HVQA 1SFPA 3I2DA 4XCAA 4N90A 3ZLIA 4YVSA 1JODA 5FXXA 3VHRA 2XAJA 4DS0A 3PNVA 4K1ZA 2PQ8A 2AUYA 1KYZA 1WFXA 3U4SA 4I98B 3CCEI 3WLUA 1U0AA 3GZAA 3WSOA 3A1YA 2LY9A 2E7TA 3W58A 2HZTA 2STTA 1B8IB 2WT0A 4FOQA 1D1AA 2YR2A 4NAMA 2ELJA 4L9NA 3ULQB 1WGPA 2BUKA 2DURA 4YM0A 1JGSA 4N43C 3I2OA 2LC2A 4Z1VA 4OAYA 4AVTA 5FKNA 1ERDA 1DLCA 2YROA 1GNYA 2D43A 3HZJA 5LRSA 5GJ6A 2ZBKA 2XWJB 1W28A 4FP2A 3W5MA 4EYUA 1WLWA 2QSFX 1SLBA 1DQUA 5EZGA 2XAQA 4HX7A 3RKYA 4KNYA 1ULFA 2BVBA 2XUMA 3WDVA 2EV5A 4BBRJ 1IS6A 4IEQA 3Q8FA 3PVBB 4B48A 3QWLA 2PJRA 1A5JA 2GWRA 4O5VA 1RESA 4N0BA 2VZ1A 2ZEXA 4BJ0A 4L5EA 2BW3B 2YZ4A 1W8HA 4W97A 3LZZA 4M6YA 2EFPA 3ZYRA 1OD5A 3WG9A 2AGSA 2ZGMA 4C1WA 4MHRA 2JKBA 3KGZA 5AFBA 1ULGA 4D69A 2Y6LA 4LIVA 3IBMA 4MVTA 2H6CA 4G9YA 2CJJA 2Y30A 3HTSB 2EICA 4B7KA 4FOVA 3CMGA 3HOBA 4JDOA 1MS5A 3DEWA 1HN0A 3TGNA 2VZTA 3M4OJ 1WI9A 1MQTB 1EAH3 1QXPA 2VCCA 1SFYA 3U21A 2D44A 2PBIA 4AFBA 2RNGA 4YFWA 5FQ0A 3OSGA 2M87A 4XBQA 1XE8A 1GP6A 3QRFF 4LK6A 4MH0E 2MBFA 3L2CA 3QCWA 4CDQB 1ZBA1 5FMOS 1DQ1A 1EY2A 3A7QA 2R0HA 2DPDA 1T2KA 4OYUA 3N35A 1PUEE 4LHNA 3R61A 5CFDA 1YO8A 5LEJA 3DPRA 1MEC3 1WI3A 3GXUA 1RTVA 3LQCA 3RSNA 4AQ6A 2V6EA 1UELB 1VBA1 2IA2A 4J01A 5GKAC 1VZ0A 1WCQA 2EV6A 1ENHA 1H8TC 1O4XA 5LHIA 4HSJA 4AYUA 4FE4A 1AR91 4IHXA 1VRH3 2E7XA 1BEV2 1GUIA 3OCPA 3B69A 1N25A 5I0TA 1A6IA 3FL7A 5FZEA 5BNGA 2IP2A 1BI3A 2QF7A 4UVCA 4BJTA 3LSDA 1E2XA 4IOCF 4PBPA 3VGIA 2JJ7A 4H4KC 5GTHC 2QQOA 4FTEA 3VHPA 4JX6A 1VE0A 2ZOEB 2RMU3 4G12A 4I3GA 4YW3A 5A3WA 1LDKB 3V4GA 4JGZC 4QX5A 3FXJA 5BNPB 1J09A 1AR71 3JQWA 1D8JA 1OUSA 4ABZA 4YVWB 4KU8A 4QPIB 4HSLA 3WNXA 1QRYA 1MVQA 3DPUA 4Y1ZA 2XJPA 2NQYA 3AL0B 5GZEA 1AR81 1Z77A 1U78A 4NHMA 5M5YJ 4OQ9A 2ZPXA 2ZGQA 3ZSMA 1SLAA 1YIOA 4LO4B 4ESJA 5FKBA 3S6PA 5FZ8A 1W2NA 1T6GC 3HTUA 2NP0A 1W9SA 3AP5A 4UHTA 3D82A 4UFKA 1IRGA 1XB4A 2RJLA 3C2GA 3GBGA 3USSA 2VL4A 2ZXWH 4ZZDA 4LBKA 2Y6FA 5F2WA 3WG1A 1GDTA 2ZGPA 2FOWA 1MH3A 3WQBA 5A1AA 1RGSA 1J1TA 1CAVA 1L3LA 4D1QA 2KPMA 5IFTA 4CDUB 4Q0UA 3BP8A 5ILUA 3K51A 1DYKA 4AXOA 1QOSA 1W3XA 1X2MA 3GTQJ 2BY2A 2DTWA 2VBBA 2XBO3 3C3VA 3FBMA 3WP6A 2F4PA 2P4WA 1C8NA 3WW1A 1MKMA 2HH9A 1XOYA 1D4M1 4LMYA 2KIUA 4Q4V1 2WR9A 2HBTA 3ZYIB 2QKLB 2AENA 4XC9A 3D6EA 2G9WA 2M8EA 4KJZA 4BHCA 3FFQA 2DF7A 2WNVC 3BR6A 2CG4A 3ZM8A 4LO7A 4E2SA 3CD6I 1X3WB 3W20A 2XGDA 4KFCA 3J7AO 2EXJA 3M3IA 2XH6A 1IN7A 3IB3A 2XKPA 2TCTA 4CUGA 5FXVA 3BKZA 2QDRA 2QQBA 3QOPA 2VKDA 4HPKA 4LBQD 1RUD3 4TLFA 4DY5A 2DT6A 4AHZA 1FYUA 3JTHA 3EDPA 3C2UA 4BCUA 4FP3A 1NTCA 4XACA 1BZWA 4MGKE 5L3DA 1BMV2 2ESNA 5A70A 1DGWX 2G7HA 3V0AB 3CCMI 2B46X 4XTPA 2GC2A 1GV9A 3WZ1A 3H0GJ 2WNEA 3AKPA 2RS33 1NQDA 1PIV2 4QXCA 3BUCA 5J40A 3PIPF 5E3NA 2JK3A 3WHCA 1IO2A 5ED4A 1HKQA 4BQ2A 4D94A 4LLNA 3TNQA 3MV11 4UW6A 2DVAA 2DA5A 4M9ZA 3LWFA 3OYNA 3I3BA 1LCLA 4GB32 3NJZA 1A04A 4XOPA 3A0BC 5FR3A 1MBJA 2X1EA 5LA9A 1W90A 2XG3A 5LEKA 2GIVA 4XE9A 2EILH 4RGXA 4L92A 2J1VA 1FMD3 4B3AA 4A42A 2Q1FA 4ITCA 3DLLF 2LR8A 4IRGA 5F0FA 1PGW2 3VDBA 1RIOH 3ZN5A 1FP1D 2OZUA 3W3CA 3ZDVA 3DKQA 1D1BA 2LP0A 4A45A 1AYN3 5TSWA 3ZMSA 2VJ5A 4K40A 2C24A 4XK4A 3HDDA 4UB6C 3AZWA 2VKHA 3ZN0A 3FKIJ 1X2NA 4HF0A 5B3SH 4XRMA 3V7CA 5JOXA 4AW7A 4GJYA 1C5HA 2Q30A 3EETA 1YIFA 4R9CA 4XYXA 2HJIA 4BE3A 3RYPA 3ZQFA 1SBEA 2A68F 4QWNA 1YYNA 5GZGA 3LAGA 1SFNA 4HLXA 2Q5TA 4DXSA 1N3PA 3K1PA 5FZDA 1SLTA 3S8PA 1K5MA 2A5WA 5IYCJ 4F8AA 3IWFA 1JHJA 1NUKA 3FWEA 5GADJ 3KF3A 1ASJ2 2W7NA 1W8ZA 3DTIA 1TZLA 4EGZA 4TV7A 2D3PA 4TXWA 5C3PA 2B5HA 1TBXA 2X6YA 1H89C 1VQLI 2CTVA 4DUVA 4OHYA 1IAWA 2D5HA 1CWPA 4ZS3A 1VBB2 2ILMA 3KZIC 3GCXA 5C4WC 4DQ2A 1DQ4A 4NNJA 1RUF1 1ULEA 2WFF2 3NV1A 5A7OA 4KMQA 5FZAA 1SLIA 4E7IA 2E9QA 1PP7U 4ZXEA 3ZMUA 1XPXA 1JKRC 4PIXA 1PUFA 1E3OC 3HOSA 2W46A 2D6LX 1WPKA 3OUHA 5H6RA 4HDUA 3KIOA 2NPIA 5J36A 1IKQA 4LHSA 1X8EA 2VTFA 2VT2A 3S2DJ 5D5VB 4COUA 1GZTA 1JYXA 2JMWA 3BYWA 1WMDA 1X33A 3NNJA 5JZGB 3QOEA 3KPHA 1GLHA 4H7LA 3TBIA 1YJNI 1NZCA 4TWTA 1E0EA 4Y20A 4KMUX 3TKYA 4U7BA 5FZFA 5IK7A 3SCHA 2Y34A 3TDUC 1IJWC 2CW0F 3U11A 4KI5M 4LUMA 1H9PA 2BPA2 3UKGA 1LKXA 2DOAA 1USSA 1XSQA 5FJ8J 2WAFA 2NXNB 5DEQA 4GA9A 5TISC 2KRCA 2VW0A 1OCRH 2JRTA 2GU9A 2CUZA 2DTRA 3L7WA 3GFLA 4D9JA 2L3DA 2ID4A 2WKKA 3ELNA 3TOAA 4Y22A 4P9XA 1R1VA 4CDQC 1LDJA 3C7JA 4E27A 3NAPA 1XN7A 2PA7A 4OMCA 3UKTA 1ZN2A 4ZYAA 3PUBA 5FZCA 5EPAA 5FP3A 4XDPA 2JECA 1SHWB 2HBUA 3PQJA 2LRDA 1GYKA 1UNBA 1F35A 3FMQA 3H1CA 4AHYA 4A5NA 5AIQA 2Z2SB 1LE8A 4LUKA 3VBOB 4WXDA 5E6HA 2V9PA 2QBXA 4XETA 2WZR3 3VBUC 3NNFA 1MDMB 4EV0A 3ZKYA 3ZFEB 4RGSA 4CYCA 1ULPA 4NMIA 1HN1A 2XONA 3G71I 1LVKA 1BR4A 1DZRA 1XGSA 1C3HA 5HODA 2VUAA 4GMP3 2R30A 4HONA 4QX8A 1BYHA 2LW8A 4ZYEA 2MH9A 1P2FA 4U7DA 1V5FA 4TSVA 2H0BA 1C28A 2A5YB 3RZOJ 1JUSA 4Q47A 1W6PA 3KZYA 4FPYA 5IHRA 2OZJA 1ONAA 4B4QA 5LBEA 1HRV3 4N7UA 2ZMEC 2KHMA 3NNMA 5AC91 1W2UA 3P3NA 2A6YA 2WYFA 3KEYA 1GICA 4JGYB 2CQ7A 4C90A 3AB0A 2BJSA 3PMEA 1DP3A 4UY8I 4M3CE 2NVXJ 3JZVA 1XU2A 4IEUA 1ZR2A 5CJ9A 3M3EA 4QPIC 3JD71 1DU0A 4FFGA 4A6EA 3V65A 2ZGRA 4FTHA 1W04A 3TOBA 2WL1A 2X5IA 1A35A 5F7UA 1PMHX 2MC4A 1V0AA 5FK7A 1IS3A 1PM4A 3PSIA 1S4CA 2AREA 1KFXL 5DZEA 3NW4A 2YB7A 3PIOF 2RR12 2VU9A 5FUNA 4CEWC 1JKQC 3GTMJ 3MW4A 2WNUA 4BQ5A 4AYBN 3ZOBA 3BR5A 1ULCA 1R093 2ZSHB 5L19A 4YW4A 2MFZA 2EF6A 2XJQA 4XLAA 1XMXA 2CU5A 2NM1A 3FISA 5JI6A 5FZ6A 4JCKA 4FFIA 5FUPA 2NMNA 4P9FA 5JIUA 4GJZA 3PMSA 1SBFA 3BR1A 4I09A 3ZO0B 5A6QA 4L9VA 4NE9A 4NRQA 1BK0A 1LFBA 2KMUA 3FHNA 5C9AC 2RM23 5JSPA 4ASKA 1VQKI 2XF5A 2RGVA 4QM8A 4ZZ5A 4Q27A 2L01A 3KSCA 3ECOA 4CP0A 1TVGA 4LA2A 2KL4A 1J3PA 1QNYA 4Q0QA 4Q4Y1 1IN4A 5JHFA 2H0VA 2HYFA 5FLMJ 5L7OA 4WX9A 1A34A 4MSVA 4KG0A 1KGSA 1VFCA 3OS1A 2GA1A 3BTYA 4AEDB 2P3KA 1B72B 4YG2F 4IV3B 3K4DA 4YSFA 1OI6A 5JLVA 3ENRA 1OHFA 3FE5A 1IOAA 4IVNA 3MFCA 4YFKF 3BTJA 4M00A 4WM7C 2ZJPF 4D6QA 3S16J 3AMQA 4P00B 5DUKA 5FPBA 3CUQB 1BHGA 3BY6A 2WQ4A 4PDKA 2LG4A 3Q8CA 2DA2A 3F6VA 2RQQA 1ZM1A 3UESA 2Y75A 4OFGA 4OIRF 2LY2A 4Y4RA 2ARBA 2V72A 2P6CA 2AH2A 4KMFA 3MEPA 2Z1DA 5CFCC 1ZELA 4MFDA 4OIOF 4LKSA 1WW4A 1J59A 5CAZA 3HKZA 5EDNA 3BALA 4XJ9A 2HWE1 4XUNA 1TT5B 1TE1B 2YHJA 3NARA 4NVPA 4AGGA 3ORJA 1FPQA 4M73A 4O6JA 3KMHA 3M8JA 3ACHA 3CO6C 1LNWA 1X4OA 2Q0OA 4B43A 1G9BA 4QPOA 1YQ5A 3M70A 3ACFA 2B45X 3QPSA 1PZ9A 1SD7A 4A6OA 3BTIA 1DIWA 1AKHB 4BS9A 2ZAHA 2XF7A 1UY3A 2K40A 4WK8F 1BIBA 5E3MA 1UW8A 1YFWA 1FOD2 1REEA 3OV8A 3JXSA 3RIRA 1UG2A 1WH5A 1O4TA 2ZGKA 2EJRA 2HQAA 4WVMA 3BTXA 4DXZA 4PCQA 1XSDA 1JW6A 2VXRA 4QHZA 1VF9A 3VB9A 4CDWC 5A6XA 5IFPA 4LKEA 1FV2A 1ETWA 4FX4A 5EGOA 1EAH2 1RUI2 3HSRA 1B6AA 4XCBA 5FDBA 1JJ6C 1JZ2A 3WD5A 1W6QA 3S15J 1BBT2 4EWAA 2WLPA 3KV9A 2KISA 4OHVA 4QB2A 2BVMA 4KDPA 3QH6A 2HVSA 1AL22 1WWYA 1ZZ6A 1U6GA 1KQ0A 2DCTA 4A3BJ 3ERED 1LEAA 2GC0A 3V0BA 1LESA 2DI3A 1W7PD 4FT8A 4OLLA 3FMSA 2HOTA 2VMEA 5D4SA 5TJJA 3W2VA 3J26N 2STWA 2YBKA 1HBXG 1BR2A 2MGQA 3K4AA 1HV0A 3WUCA 2D1VA 2FX0A 1ACIA 4ZU7A 2ECBA 3UYJA 2E1MB 4QB6A 4FTBA 1RKWA 1ND3A 4PSXA 1GQHA 1F31A 4FFFA 5A7PA 2L7ZA 4UXNA 1C8M3 2K4BA 2RVAA 2JWTA 4S2DA 2VC9A 1KEXA 2LKXA 2E71A 1APLC 2F5CA 1YQAA 4L2NA 3KP3A 3WGIA 3BI3A 2HVQA 3SC7X 1R36A 4MXVA 2PN6A 5HXVA 1WLCA 3VOEA 1QNWA 2DYCA 2QA4I 4WM8B 1XTAA 4LLGF 3BG3A 1ODMA 5FY8A 4XF0A 4YW5A 1Z0HA 2FD5A 2MYSA 3DPLC 3TYJA 3OY9A 2FQ4A 1E57A 1J1LA 1XNCA 4HQMA 3MF9A 5FGMA 2DMUA 1H8AC 2JA6J 1XG1A 5C3SA 5KK1A 4WVVA 2NVTJ 2PYTA 2A6WA 1COV3 3ZMVA 1FOYA 5FMDA 3WP4A 3IWZA 1A6QA 3J7YJ 5J1RA 1AZDA 2QVOA 1EAH1 1TC3C 2QYOA 1AHSA 1ENQA 1QBJA 2HLEA 2PQQA 1ENXA 3I0TA 5F1RA 3SJMA 3HNMA 1QY4A 1QXJA 2XQXA 4LB6B 2J1RA 1WKMA 2YC4A 2OUHA 1TQ5A 3GVAA 4IRHA 4O3MA 3DCFA 3MPPG 4YGEA 2R7RA 3LL7A 4D5CA 1PNFA 5ANQA 2W9XA 1W0TA 3HT1A 3H5NA 1MEC1 1VBD2 1YI9A 3ZXLA 1ZRIA 3QLQA 1UHSA 2L7KA 1F5JA 1W9WA 2CQKA 3HC7A 2F5DA 2X05A 2HPIA 3ZPOA 1JYWA 3HQUA 2GN3A 3PL0A 4LKDA 1RIRA 1S2KA 2XRLA 4PCRA 2YXSA 2P5VA 4BXFA 1JYNA 4P5YA 3VZMA 2B4KA 4O9EA 5J8FA 4RAYA 1H1MA 4BACA 3B02A 3KCXA 1UYYA 1VRH1 2TUNA 1Q1VA 2V5YA 4BA6A 4FPFA 4ZTJA 4CCJA 3AKZA 5E8GA 2E6VA 2OPKA 2ZKLA 3R0JA 2GOMA 2EIKH 3O1VA 4PSWA 1K79A 4PFPA 2EK5A 3W9AA 3NEUA 4P5OA 2WADA 2OUMA 4HN0A 4Y4YA 3ITQA 5K5OA 4FOYA 4PJLA 1VQ7I 4BE0A 1TWCJ 2W39A 1YTYA 3TDZC 4A6DA 2V73A 5IAXA 1X1CA 5T55A 2BOLA 3PTRB 2VOXA 5H9SA 2HTSA 2L4AA 1RUE2 3WTYC 1RYYA 3GBWA 4IUGA 4EN6B 4ANJA 3OUJA 2ZGSA 1R58A 4W65A 4COYA 3HWJA 1GBGA 2XVLA 2W4SA 4BXUA 2OCEA 4E4HA 2YFZA 3JB4C 3VLBB 3GMEA 3I56I 1GZWA 1U9NA 1TZOA 5GZCA 3IAQA 2R072 3SEPA 2JG8B 4YWAA 3ES4A 1T98A 2FXAA 5JXHA 1KU7A 4PT6A 2P6HA 3OYJA 2OS2A 1LHWA 5K0UB 2GXAA 2EAKA 1K78B 4XJAA 1Z6TA 5A7WB 1I3QJ 2JEMA 3C7HA 4KWUA 4Z92B 2DO7A 3FHIB 3OJBA 1MD0A 2G9FA 3AP7A 3IDAA 3GTKJ 2GC1A 4DO0A 1OVSA 1GKBA 3R60A 1S6LA 2IS2A 5M0TA 4X8NA 2Z9OA 3WU1B 4Y3OA 3MUY1 3X2QH 2BNNA 2X85A 3WNMA 1YFYA 3JREA 5FZOA 1H2MA 1JI6A 2WAAA 1F5TA 1S8NA 4AAXA 5IY5H 4ISQA 3PM1A 3AFHA 1SMTA 5BNOB 1IV6A 1VPHA 2ZNYA 2Q1ZB 2XBO1 4HSRA 3I7DA 5C7GA 1GZ9A 4MYEA 1TNTA 1MACA 4BU2A 2EAAA 2E63A 2NS8A 2PMZN 3FN9A 1QJFA 3RWNA 3GF2A 1LOGA 5GPCA 3ZYGA 5TRDA 2LF8A 1XNAA 4CDXA 3AZYA 2QENA 4DYCA 4X8PA 4CPBA 2LFBA 3JQXA 5H20A 2RDQA 2A6EF 2Y2ZA 4Q4X3 5F5AA 2Y6KA 1W8TA 2Q8EA 2CRGA 1Y1VJ 2R1DA 5IK5A 1YOVB 1TWAJ 5F9TA 1Q8PA 3CUQC 2R5YB 1D0XA 4HF1A 5DDJ2 2X1DA 3RSJA 4AQSA 3V7RA 3A23A 5LHGA 1RUD1 3O1TA 3FUOA 4XFBA 2IXCA 2DDBA 5BOXA 4DOZA 4HMZA 5FYCA 2D6KA 3B93A 3FBIB 3OYFA 1W2AX 5FOBB 3OGJA 1AX1A 3VD5A 1HSJA 2XB6C 3GTJJ 1UZWA 2IVJA 3N7JA 5FWJA 4XDQA 4QKBA 1D0YA 3AMMA 2FSWA 1JKOC 1AJKA 1FWZA 3IH2A 5FRMA 3SLIA 3VDAA 4BBSJ 2NLRA 4G9SB 4W6YA 5FJKA 3IAM2 3QD6A 4AQTA 3S1RJ 2RS31 1W5CC 4CSWA 4X6RB 2VQUA 1P8JA 2C9AA 3D4KA 3KS7A 2VUDA 1G9FA 3UJQA 3GTGJ 4LORA 1CAUA 3VYSB 3PUQA 3WHUA 3CCYA 1ZGJA 1BM9A 3H1MA 2N8GA 2DA1A 2UYBA 2OC6A 1QOTA 3J7NA 1IS5A 2K3PA 3RKQA 3ABKH 1L0OC 4QXBA 4A4AA 4F91B 1PHMA 2M0MA 3OYLA 1HQLA 4R1HA 1U2WA 1ZZ7A 3O14A 4XZPA 1FMD1 2BOJA 4E8CA 4L0YB 5HV4A 2GNDA 1H8VA 3ZXAC 1K42A 1V6KA 2HOSA 2E2IJ 2DA3A 1NY72 1QEXA 3RQ0A 2OA4A 1TTYA 1RUH3 5JFRA 1AYN1 3K1NA