3DKWA

Crystal structure of dnr from pseudomonas aeruginosa.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
227
Chain Sequence
b'MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLECFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNR protein
publication title A dramatic conformational rearrangement is necessary for the activation of DNR from Pseudomonas aeruginosa. Crystal structure of wild-type DNR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
total genus 46
structure length 227
sequence length 227
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dkwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dkwA01
1O57A 2IXCA 5ILSA 2KJCA 3SFZA 2OQGA 4E70A 4IHTA 4U88A 3LSTA 1BI0A 1A04A 3R60A 2G7UA 5ICCA 1EH8A 2GIVA 3ECHA 2NRAC 2Y75A 1RL3A 4LA3A 3UKNA 3T1BA 3I71A 3NRVA 4NHJA 2GAUA 3NKTA 3WTYC 2LF7A 1HKTA 4QMAA 5L3EA 2D1HA 5LGUA 2ZMEB 1OYYA 2MNGA 3TO9A 1ZG1A 4BQAA 1HQCA 5L3CA 3IBMA 2ESHA 2PEXA 3P9IA 1U5TA 2MC3A 1HSJA 3FMQA 4XETA 1R5GA 4P9GA 4Z2YA 1G4DA 2VBYA 5L3DA 3D5LA 3IDBB 2Z69A 2DK8A 3U9GA 1TLHB 4ESBA 3USSA 5DEQA 3GWZA 2Q4SA 3F8MA 1U6GA 3ABUA 5DD4A 4FBFA 1FT9A 2HKOA 3J80K 4M6YA 2Q0AA 3FZVA 5DD8A 1R1TA 2FXAA 5ILUA 1Q1HA 5E1XA 2QJVA 3CLPA 1PUEE 5K5RA 5J3UA 1X8EA 3H3UA 2HOEA 5I0TA 4BAYA 3ZDSA 2D5FA 5FQ0B 3CO6C 4RGSA 1R1UA 3F6VA 2D93A 4JK1X 4M73A 1XDUA 4J1XA 3KP7A 1FP2A 1FI2A 1DGRA 3JTGA 1CAUB 4ENKA 3FMRA 3H3ZA 1I1SA 4UXNA 4R8HA 2MPFA 4UBHA 1J2XA 1XDSA 2XKPA 3CDHA 5EZWA 3V7SA 2H27A 2DCTA 3VEPA 1FBSA 5KHGA 2MD5A 1YLLA 4OLLA 4LUMA 2GXBA 4FT8A 4A6EA 5HLGA 2VC0A 4LG0B 3GBFA 5LRSA 1YTYA 4OMYA 4WXHA 2HYGD 4HSJA 2PYTA 4AVAA 5CVUA 3KEQA 3MCZA 3ES4A 4YYOA 4XSXF 4FX4A 3BJ6A 5FLHA 1PP7U 2KRFA 4PJYA 3I59A 2I45A 1O3RA 5JSPA 3ZN1A 1J59A 2EVXA 3JZVA 3IHUA 3F6OA 1AWCA 4YNIA 3U10A 4GULA 3NEUA 3E6DA 1F4KA 3FHIB 4ONUA 4K8FA 1SAXA 3FX3A 3I64A 3KCCA 2F5FA 2KIUA 1XSXA 5JVTA 1HW1A 3WTUC 2EA7A 1O5LA 3SCGA 1YFHA 2PAKA 2M8EA 5BY5A 4OU0A 1YFWA 3SCHA 1IXRC 1RNLA 2B9UA 2HTSA 2YX7A 1J7KA 2DLLA 4I02A 2VODA 4OFGA 1OFNA 3FXUA 2VE9A 3JAMZ 4F8AA 1X7NA 4CHUA 3H1YA 5BPIA 1FXZA 1SFXA 4A0YA 1S7AA 2CO5A 3C7JA 1BC7C 4R52A 4RB3C 3RI4A 3KSCA 3HRTA 2DW4A 3FMSA 3KMHA 1IN8A 1Z05A 3HT2A 2RVCA 4H7LA 4IVNA 1USSA 5I0UA 2HEOA 1WA4A 1FP1D 5BS6A 5LGNA 3LA2A 1SFUA 3HHGA 1OYWA 2WC2A 5FD6A 1B6AA 3K2ZA 4HAMA 2EFPA 3GXOA 2AXLA 1DGWA 4UV9A 5A2QK 4L9NA 1UCRA 2DFIA 3RKXA 2O6GE 4ENMA 1TTYA 5BQTA 5LHGA 1CF7A 3CTAA 3GEZA 1B4AA 1X82A 1Y3TA 4ZU4A 4Y13A 5KHIA 1SQ4A 3LQQA 2JTVA 2PMHA 2E9QA 3RYRA 1ZGJA 3BOQA 3BPVA 3EETA 2QUFA 3EYIA 1ZLJA 1PDNC 1NXMA 3WTTC 1IXCA 3OV8A 4Q0PA 4Q29A 3ZMSA 1JHFA 4MTEA 2XAGA 4OIOF 2ZCWA 5HVQC 1QZYA 5LLQA 3JSPA 3K1NA 2DK5A 3V7CA 4D7TA 3CUQB 3R61A 2V09A 2XKOA 3HOSA 5BMZA 2Q2EA 1Z9CA 3TDUC 5FLIA 4EWAA 4ASNA 3O6BB 4EGZA 1ZAOA 2DI3A 1D8JA 4B8XA 4LLOA 4KUMA 4CO8A 3FE5A 2ADUA 1SMTA 1IPJA 2EA2A 4ZZDA 3EYYA 1VTNC 4TV7A 4UUVA 1CAWB 2IC1A 1R5HA 3GFMA 2ET7A 2PQ8A 3HSRA 3D82A 5JR3A 5JSRA 3P7NA 2EV0A 1VR3A 1L3LA 3CL1A 2VN2A 3KZYA 4RAYA 3EO6A 1IRFA 3C3WA 2VC1A 4D7SA 5EEHA 1ZREA 2ZXJA 3IKVA 1DDNA 3RZZA 3GX4X 2XRNA 4EJUA 3NQOA 2FA5A 5HOOA 4IEVA 2HQNA 1P4AA 4CZZA 2M1BA 1ZGAA 2HS5A 4HSLA 1R7JA 3IIAA 5D5XB 3NJZA 5CJ9A 2Z99A 2IT0A 3WTZA 1R36A 2RNJA 5I91A 4IRHA 1R22A 1ZX5A 3ELKA 1XGMA 3E6BA 1HKSA 2KKOA 4HQMA 4WXCA 3HHHA 4G7HF 5I8TA 2QLZA 1X8MA 2R7DA 2OZUA 4META 3SMHA 4LFUA 4WBBA 3U11A 1XSVA 2QYOA 5BV6A 1UFMA 3W6KB 3HT1A 2X0LA 2G7HA 4A5NA 2EV6A 4EM2A 1MZBA 3L09A 1H9GA 2CWEA 1B9NA 4UHTA 5DV5A 4A12A 2GXGA 4Q0UA 1U5TC 2C6YA 4ENJA 3QU3A 1Z6RA 2OPKA 2H6BA 1BBYA 2GU9A 1T0FA 4LLLA 3LZZA 5AIQA 4RAZA 5BXXA 2HYFA 1FYLA 1XGNA 4BHCA 5FO5A 1QNTA 1XMKA 1TQPA 4MQVA 1SD7A 4PIZA 2P5VA 2VT3A 2F5CA 4Y15A 3F8FA 2P8TA 4ZZLA 1FWZA 4IHSA 4EJWA 4HYEA 1NZCA 5FPZA 1B1BA 1LDDA 5KBFA 3SHFA 1OPCA 3HSFA 1K78A 1O7FA 4K2EA 1FYKA 2Z9OA 3TNQA 4YSFA 1WLTA 3KGLA 3WW1A 4AIKA 5K8SA 3DV8A 3DPTA 2EK5A 3CJXA 4HV5A 1PP8F 3K9TA 3KP3A 4UBGA 4YIIA 2M45A 4BHBA 3Q9SA 5HDNA 3RPQA 2MH9A 2ZFWA 3OF1A 2FBIA 1KYWA 1KU7A 1B9MA 5ILVA 3FM3A 1HW2A 1RZ4A 2LNBA 4HF0A 1ZHFA 2OAZA 3IL2A 2ETEA 4HBNA 1F9NA 2CGPA 4Q48A 3LAJA 4N9IA 2NYXA 2P17A 2KIFA 4YRDA 1W7PA 4IRGA 2BYVE 1OD5A 1BI1A 4L9VA 1E17A 3D0SA 1B59A 2UWMA 4KWKA 1Q43A 1TNSA 1U2WA 4TLFA 2H6CA 3WW4A 2IA2A 5L3BA 1GQHA 3M1EA 2PFWA 2K02A 4RB0A 2D2WA 5F1RA 5CU1A 3MYXA 2DPDA 2Z2SB 1QWRA 1WKMA 4RGXA 3E6CC 2VQAA 1U3EM 2LKPA 2VOPA 4E2QA 1O4TA 3BJAA 3BY6A 3F72A 3R0JA 1Z91A 2L4AA 3RKYA 3TNPB 4AWXB 4XFFA 4OIRF 4I0BA 2XL9A 4HN0A 1W7PD 2XV4S 2LF8A 3RDIA 1RGSA 2BNMA 5E8GA 2HZTA 1GQGA 3WTSC 3QP5A 5J7MA 3TQNA 2F5DA 1BM9A 3U2RA 4MEYF 4EQQA 4IF4A 5CVJA 4HX4A 3T5XA 3AAFA 3PFIA 2VBWA 3I54A 3M8FA 4FX0A 5JR7B 3SHRA 1P2FA 3GO5A 1STZA 3BP8A 4G7ZF 1ZVFA 4L5IA 2BNNA 2P7VB 4L9JA 3L7WA 3WGIA 4IXAA 3TOBA 1IZ1A 1YS7A 4L18B 1Z7UA 4L11A 3H8UA 3EQEA 4IJAA 2FBHA 2CG4A 4XF1A 2GQQA 5KHJA 4XFHA 1JUHA 4PIYA 3WGHA 2NNYA 4U7BA 1J75A 1H0MA 2QVSB 2XAJA 1UW8A 1HKQA 4KMFA 2O61A 2NAZA 4ETSA 1QXRA 1HBXG 5E1ZB 2XLAA 2D1VA 2JSCA 1ZYRF 3HRUA 5K1YA 4P55A 2W25A 4GO1A 1PMIA 2EV5A 4RB1A 2QBYB 3H50A 5C8WA 3RYPA 1QO0D 3FHZA 1C0WA 4QGMA 4G8XA 4F7ZA 2Z5UA 3ABTA 4IETA 2HFHA 2O3FA 2EFWA 3QRFF 4KNYA 1YFXA 2PMUA 4OINF 3VHRA 2A07F 1CF7B 4AQ6A 2XIGA 4M72A 2MH2A 1K7AA 4B29A 3GFIA 2ESNA 4YARA 4N9HA 3CEWA 2VBXA 2P6TA 4XSZF 4M9SA 3RPUA 3ELNA 4PIXA 2FQ3A 1O3QA 4JVAA 4HOBA 3EDPA 2EB7A 2O0YA 2RV8A 1SEFA 3DP7A 4HVOA 2HR3A 3EQLF 2L54A 1YWKA 4BNCA 1Y9QA 3ETQA 4QWQA 1T38A 2PLYA 3VB2A 3M3IA 4Q0VA 2RC4A 1D5VA 4KMUX 3M70A 4QM9A 2NNNA 4N0BA 1IN5A 5LEKA 3C18A 4LGWA 1XB4A 2Z3YA 4KN7X 4M9ZA 1ON1A 5HLHA 3HRMA 1T98A 3EHKA 1GVJA 2MLGA 3NL1A 2QQ9A 2IXLA 3RYKA 2VECA 1ZZ8A 1R58A 2A3SA 2UYBA 1U8RA 3LA7A 1NHAA 2D40A 1LEAA 4BIFA 4MGZE 2K86A 2IJLA 5EEGA 2PJPA 4AVBA 4EJVA 1NE6A 2WV0A 3ZPLA 2CV6A 1UIKA 1J9IA 4NVPA 1ZN2A 3QP6A 2HWVA 2WTEA 4EJOA 1QZZA 2RDPA 4A6DA 2H09A 2STTA 3IWFA 3I4PA 2HKXA 1OMIA 1LJ9A 4EMSA 2ZNYA 3L00A 2QQAA 3NVCA 1IW7F 3K69A 3KLNA 2EAAA 3VFZA 1DPUA 2NS0A 1FLIA 4IPAA 4BYYA 3J81K 1TQMA 4KDPA 2DO7A 2M30A 2X4HA 3DL3A 5IT9K 5DCMB 2ZMEA 1YIOA 4MGYE 3K1PA 3TO6A 4CDGA 3F22A 2L01A 3PNAA 1RUNA 1IN6A 4I09A 2IVMA 4MTDA 4ZH4F 5LGTA 2XHKA 3B73A 2JRTA 5I0SA 5FLXK 4BHPA 2UXXA 4IEPA 4GXOA 3ROUA 4IEYA 3KE2A 3HIFA 5D1IA 1D8KA 1J0RA 4E2GA 1EYBA 2ATFA 3FF5A 3ZMUA 2PA7A 3LAPA 4B09A 3GUDA 2IA1A 1G3WA 4ZYHA 1XE8A 2VT2A 3COAC 2CFXA 5D6FA 1P4WA 4ZYEA 4HN1A 3QPHA 1ODDA 4ESJA 5FQ0A 3I0TA 2FNAA 2XLGA 2EFNA 1DP7P 2J5PA 3JTHA 5DYMA 2M87A 2RKHA 3GZ6A 1CAXB 1YFUA 3DN7A 5L3GA 3SCFA 1CAUA 3IRQA 2XAHA 2V1DA 1ZZBA 4NB5A 4JTOA 3E6MA 3CF6E 3S7IA 4HMZA 3G73A 1RTVA 2PI0A 1UIJA 1H9TA 4P96A 3PQJA 5E8IA 4CICA 1G3SA 3OGJA 3NW4A 4LG0A 4O5VA 2GZWA 5K5QA 4M9XA 1SMYF 4QLCU 4WK8F 2L4MA 1O7LA 2YPRA 2AS5F 1J58A 2XASA 4JBAA 2FSWA 4UNOA 3F8BA 3BDDA 4G6QA 2DPUA 2XAFA 1R00A 2EA4A 3Q9VA 4G94A 1SD6A 2HGCA 1P4XA 3TKYA 3IRRA 5I8YA 4GYGA 4WWCA 3B02A 2STWA 2XUBA 4RD7A 2N7GA 5H6RA 1DZRA 2PHDA 4M71A 2GA2A 3CJNA 1ULYA 3FZ3A 5D8KB 3LOIA 3GF2A 4ORFA 3T8TA 3J80Z 1S3JA 3HSEA 3SZTA 1ZNPA 5E1RA 1BN5A 2G9WA 3R4KA 1SD5A 2B5HA 3O14A 4IESA 2JPBA 4A0XA 1LEBA 4ESFA 1J3QA 3GFJA 1W7PB 2MBFA 5FB2A 2GA1A 5FLJA 1V70A 2K7LA 1Y0UA 1EV7A 3W6JB 4HX7A 1RI7A 5LRRA 3QAHA 2FEZA 2GC0A 4XF0A 1CAVB 5CYVA 2RQPA 2E7XA 2ACJA 4KL1A 3VODA 1P6RA 1TNTA 2A69F 4HQEA 3LAGA 4L9TA 1MJAA 4JV4A 3KGZA 3TO7A 1SFEA 1W5SA 1TQ5A 3V7RA 3F8CA 1MJBA 4GYIA 2P7CB 4AQ2A 4LEJA 3BU7A 5D6EA 2OA4A 1ZZ6A 4AD9A 4ENNA 5HS8A 5DUKA 2LSOA 2UYAA 3TOAA 3S2WA 1QGPA 3MZYA 2PHLA 2D45A 4RB2C 4GGGA 4HDVA 1CX4A 5JFRA 4YFXF 2IXJA 1KQ9A 3FJSA 4KWLA 4EROA 4YG2F 1YUDA 2O8XA 3IC7A 4KIBA 4L2NA 2H94A 2XLFA 4XRFA 3CUOA 2QQBA 4Q5SF 2BNOA 3GVAA 3KZZA 3LWCA 2A61A 1LDJA 5I8SA 2XAQA 3WU0A 1FY7A 2UY8A 4Q0SA 3H7JA 4IEUA 3HUGA 1TQIA 1R1VA 1RUOA 3KP6A 5JHUA 2ELHA 1HXDA 3WGGA 1MKMA 3CUQA 3K1MA 1U5TB 4A0ZA 3BZ6A 4WCGA 1BC8C 2CAVA 4ZU5A 1RC6A 4EM1A 3KLOA 3CLOA 1UCXA 5CVVA 2V79A 1WI9A 3N4MA 3L2CA 2QCSB 1F5TA 3T8RA 4EWDA 1XE7A 4KWJA 2RN7A 3KETA 4G6DA 2Q1ZB 5FCCA 2VE8A 2A6HF 1EY2A 2GH2A 2MLKA 3KFWX 3E3VA 3QPTA 4KT5C 5IT9Z 4YFKF 3JAMK 1CAWA 5I0RA 2A5YB 4QXKA 3SQNA 2E7WA 1KQ0A 4OMZA 1MD0A 2L3DA 2E1NA 2Y0OA 4CYDA 3DXJF 3PLQA 4IEXA 5A2QZ 1YFYA 5T3NA 3ML6A 3P9KA 1LNWA 4LB6B 4AXOA 1BI2A 2PBIA 5CADA 2FQPA 1ONVA 3M7GA 4MGRA 3FM5A 1FNNA 5ICEA 4MHGA 2QM3A 3KP4A 5EFUA 2B8MA 4KFCA 1J3PA 3I53A 2M5WA 2OA2A 1XRUA 3ERED 5F64A 4J1WA 1PM7A 4KIFA 4EM0B 2FNPA 2O03A 1MDMA 2EFOA 2CSOA 3HRSA 5LHHA 3F3XA 3REOA 3BPXA 2P4WA 2L02A 4BH9A 3H92A 3I59B 3KP2A 4CXFA 4RGUA 1Z1DA 4ZYDA 1ZARA 4IRIA 4LULA 5AVPA 4LK1F 2FMYA 5J6XA 1U12A 4PGHA 2BEOA 2PAEA 3E97A 5C6CA 3UKVA 2DAOA 2LDUA 2W57A 3V8JA 4HLYA 3S0MA 3L2HA 1F1ZA 1IN7A 2H0VA 3LA3A 3BB6A 2A6EF 1DPRA 1J5YA 2UY9A 2MHFA 4LD5A 1S29A 5KK1A 1XD7A 1SFNA 1WSUA 3MZHA 5E16A 1KU2A 1IN4A 1EPZA 5H20A 2OZJA 2IXHA 1FYMA 1OYIA 1YS6A 4IEZA 1BIAA 2XL7A 5E20A 2V6CA 2ZKLA 4UVCA 2VXZA 3GLXA 3BALA 4GCVA 2Q0OA 2KIMA 1YW9A 2IXKA 2J5OA 2K0GA 3M8EA 3I7DA 2GC2A 3FWEA 1FBUA 2W24A 3WTVC 4EV0A 3DF8A 4MX3A 1HW5A 4Q0QA 5E1WA 4XFBA 3MQ0A 4Z07A 4XEZA 1JXSA 3C3VA 3FFQA 4P9UA 3O2PE 4KU7A 1T2KA 1EP0A 1YYVA 1FBQA 3DKWA 4LLNA 1VP6A 3CO7C 5DUIA 3K0LA 2IP2A 4IERA 4Q4ZF 2UXNA 3WW2A 2IW5A 4KICA 3WU1B 1V4RA 4MZUA 1OKRA 3IWZA 4UXAA 2BBYA 1D3YA 1O3TA 1YG2A 3U1DA 1OR7A 2DBBA 1DZTA 4QM8A 4XFAA 3U0ZA 3PVBB 1NE4A 5LHIA 2QDRA 3KEOA 4LJZF 2K4BA 4HX8A 1SD4A 2DT5A 4KA4A 5KHHA 3F21A 4FAGA 2GC1A 4OIQF 1AOYA 4X6RB 2F4PA 5E18F 2ZJ2A 4XFIA 3EJKA 5HS9A 4MH0E 1ZH5A 2PN6A 5D4RA 3E5UA 4CGZA 4HV6A 5KVRA 5BOXA 5HDGA 4LLGF 3LWFA 2KXLA 1REPC 4PCQA 5D8LB 2ISYA 3R6SA 5TRDA 3E5QA 4UVAA 4XFGA 4I0AA 4FAHA 2ETHA 3V4GA 3ZQ7A 3IDCB 4HVQA 5FFXA 2BE5F 2COMA 2OBPA 1I5ZA 2P5LC 1ZG5A 3PQKA 3ACLA 5D4SA 3SXYA 5HI0A 1QXJA 2FMLA 4MGKE 5CLSA 2JPCA 4KU8A 3UKTA 5JI6A 2DTRA 3HOTA 3WE2A 4AIJA 5LBQA 3SXWA 4WXDA 3ULQB 4LA2A 3ECOA 1WQ2A 4KYWA 1MJ9A 1LRHA 4L0YB 4O3MA 2QNKA 1TW2A 3WTXC 1IXSB 5DCFA 4M6XA 5KHKA 1FZPB 2O1QA 2HJIA 5BPXA 4L5JA 1KA8A 4UVBA 4LTAA 4HDUA 4MQ9F 3G7DA 4I01A 1BIBA 1KU9A 2Z33A 3WW3A 1XGSA 4DNCA 1Q5OA 4EGYA 4X6QB 4D0PA 4G9YA 4HF2A 2BV6A 1BOAA 4ZYGA 2QENA 3OTFA 2D5HA 3HTUA 4PGGA 2DQRA 3ZMDA 1BJAA 4MV2A 5CVRA 1KU3A 1W5TA 2QVOA 5AONA 1ZRDA 3MEXA 1KGSA 2EFQA 5ICGA 5HS7A 2OYZA 4MEXF 5JAXA 1ZZ9A 2IPQX 5JSOA 4HZFA 4E2SA 2GC3A 1G3TA 1K6OA 3CO2A 4U0YA 2Y0MA 3M9AA 3BWGA 2QBYA 5K5OA 1ZRFA 3TGNA 4OIPF 1P92A 5ED4A 3DEUA 2FBKA 5FDBA 5J8FA 4S05A 4R1HA 2EJRA 4LUKA 2ZKZA 2OD5A 1YO5C 4IEWA 3CUQC 4O6JA 1KYZA 2Y48A 3D0JA 5F6FA 3RIRA 1XCBA 1O3SA 1IAWA 4HW0A 4I7HA 1QQIA 2PFBA 2W85A 2HQRA 3HTSB 4PZJA 2MA3A 1XSDA 2DU9A 3S7EA 5FD5A 3JSOA 4QX5A 1NYWA 3GYHX 1YW8A 3BJOA 3E5XA 4L0ZB 3N97A 1UPIA 3QU6A 1JE8A 1W4MA 3Q5FA 1G6NA 4P5OA 5JCTA 1IUYA 5FGMA 4MUVA 1IF1A 1ZZCA 2ZBKA 3GZ5A 3KP5A 1LVAA 4U7DA 1X3UA 1K78B 3ZMZA 1LB2A 2VOOA 1L3JA 4MGIE 1ZRRA 3V8KA 2TDXA 2ZO4A 1S6LA 2RGVA 1UD1A 5D5VB 3IKTA 1RIOH 1QY4A 1LKNA 5BPDA 2R7FA 1VJ2A 3RJPA 5ICFA 3WTWC 1K79A 2JT1A 5E17F 2KJBA 4LMYA 5ERIA 3T0YA 2O8QA 2PQQA 4LB5A 2P6SA 4EVIA 2CYYA 3H1WA 4PDKA 2XGXA 2F2EA 3H1MA 5DDGA 1ZG3A 1V3FA 3ES1A 1I1GA 4HVRA 4H0EA 2OU2A 3OCPA 1ZRCA 2B0LA 4BXUA 3FXRA 1IPKA 3VOEA 1E2XA 1ZLKA 5LEJA 3F23A 1T39A 4Z82A 4WX9A 1UB9A 4WVZA 4R79A 2QZ8A 1YLFA 1XN7A 2E1CA 3GW2A 3MPBA 3QOPA 1JGSA 1GXQA 1WWXA 4OOIA 2CAUA 4HLTA 4ON0A 4EWEA 1XGOA 3J7AO 4A5MA 5DCMA 3WODF 2VPVA 2K4JA 1Z6TA 3LFKA 5H6QA 5J48A 3FXQA 1EH7A 2ISZA 4IEQA 2JZYA 1JHHA 1LDKB 4Y17A 4XF9A 4U0VA 2FOKA 1S7OA 1TBXA 1TW3A 1LQ1A 1XMAA 1USTA 1FSHA 1S8NA 3ZN0A 1MDMB 3GFLA 4RGRA 5FPXA 4Q47A 3ST7A 1WGPA 2P5KA 2FU4A 2WFPA 3JW4A 4I98B 1FX7A 1CGPA 4HF1A 2FRHA 2V1XA 3HQXA 2HDCA 2C0ZA 3H9AA 2R3SA 1J3RA 3MDPA 3MWMA 1BI3A 2PG4A 3L9FA 2UZKA 1H1MA 3ZMTA 2YU3A 1ON2A 4NQWA 3H7YA 2YSRA 3I58A 5BUVA 3ZMVA 2HTJA 3F8NA 5HDKA 4UV8A 5TJJA 1CAXA 2OQRA 1YHFA 5L3FA 4RS8A 1WRJA 3OOPA 4JQFA 1FOKA 2YR2A 2ZNZA 3BCWA 4O9GA 5CVIA 2BGCA 4FHTA 1GHCA 4KIGA 4XLPF 2PAMA 2IXIA 2K9ZA 4MNUA 3QACA 3MAJA 4U0WA 4LK0F 3DFGA 2GWRA 3WG9A 2V9VA 4HLXA 4AIHA 4XF3A 3EUHA 1GXPA 2WWYA 2F5EA 4ZU7A 4KN4X 3BROA 3I5UA 3J81Z 1UHWA 4XBFA 3WE3A 4JTNA 4XFCA 4YIFA 2ET1A 3DPLC 1KQ8A 3SZPA 4I2OA 2A68F 3OD0A 3GYDA 4P9FA 5IT3A 1QBJA 1Q3EA 2FF4A 2PTMA 2DQLA 5FLXZ 2XVCA 4G7OF 4HBLA 2K27A 2V1UA 2EWNA 3HYIA 2W84A 3MFKA 4EJTA 4XF4A 1H1IA 2FE3A 3RKWA 3C1DA 1IRGA 4O9EA 1DUXC 3RTRA 4WZCA 3BPZA 1U78A 5J8CA 2OZ6A 1L0OC 4AVPA 1T6SA 2IRFG 3LQRA 1FPQA 2XROA 3EBRA 4YFNF 2QWWA 3R0AA 1O5UA 4QGLA 3O3KA 2CW0F 1CAVA 1YQAA 1UHMA 1OI6A 2IA0A 4AVCA 1I27A 2VONA 1J1LA 3RNSA 4HA8A 5HLIA 6PAXA 1MGTA 4S04A 4IEOA 4DQ2A 5I93A 1QPMA 3NSTA 4QGNA 2CQKA 4XLNF 1FSEA 3ISPA 3DQVC 4A2UA 3TDZC 5D5UB 1R23A 2Q30A 4M74A 1LR5A 2YX4A 3V8LA 1FC3A 1XCVA 5D5WB 1ZZ7A 1HSTA 4DINB 2VBZA 4I3PA 1I6XA 1YW7A 3P9CA 1EH6A 4WF2A 5AIPA 5FFZA 3ZP5A 2Q8KA 3G3ZA 1G3YA
chains in the Genus database with same CATH superfamily
3SFZA 2R063 4E70A 3LSTA 3EPZA 5A7PA 4Q4V2 1OSGA 3NNGA 2WLPA 4RL7A 5C4WB 3ECHA 5T5JA 2NRAC 3OYMA 1ST8A 4LA3A 3UKNA 4PLMA 1QHDA 1C3HA 2VZSA 1YX5A 5IOZA 2LF7A 2W52A 3OYHA 2QQOA 2E32A 5FMCA 3TO9A 4BQAA 1N25A 1OH3A 2ESHA 4Y5Z0 3U07A 1HSJA 1YIFA 2AGSA 3IMMA 1ND3B 4XETA 2E6VA 1H6XA 4EN6B 1R5GA 1G4DA 1DYOA 3IDBB 1H2NA 5DEQA 3GWZA 5DPNA 3F8MA 5DD4A 3CNAA 4AI8A 3J80K 3BOWA 1OLRA 1REFA 2GBYA 1MQTC 3ATGA 1R1TA 3VDDA 2UURA 5ILUA 2EZLA 4YZ5A 1W6PB 1PUEE 3H3UA 2D44A 1RHI2 3CC2I 4RHV3 1UYZA 2D5FA 5FQ0B 4DNYA 3CO6C 5BNGA 2TCTA 3ZXJA 3PTRB 2D93A 4C91A 2XUEA 1RUD1 2HH9A 4J1XA 3LQCA 1MBJA 4PBOA 3DCFA 4E27A 4RAGA 5CQEA 5HCBA 2MPFA 1TME1 4UBHA 5H9RA 1E3HA 4XUTA 3CJIC 3J26N 4IO9F 1FBSA 3OPTA 2G4IA 1JU3A 3AM2A 1ZQ3P 1Z3XA 2ZHNA 5LRSA 2ELKA 2MEV2 4XKCA 1PIV2 2HYGD 4HSJA 2M7AA 2OCEA 3MCZA 1VBA3 1S0JA 4XSXF 4X6AJ 3BTJA 2KRFA 3SLIA 3I59A 2WA3A 2EVXA 1SVOA 3AG4H 1AWCA 4YNIA 3U10A 3BT9A 4GULA 2LOOA 3E6DA 4DGWB 1Y6IA 4BE2A 1WPKA 3THDA 2WS91 2F5FA 1XSXA 3CDLA 2CQXA 1BQPA 3POYA 1G9DA 1HW1A 1Z77A 2EA7A 2CSGA 1KQRA 1C4RA 2HPIA 4TYSA 2KDOA 4OU0A 2JA8J 3SYTA 1R093 4JOMA 3AL5A 1GNYA 1OFNA 4UWDA 4YWAA 3N9OA 4FP3A 1X7NA 5DDJ2 2MD0A 3WP5A 4AFDA 3H1YA 2ME0A 3OOXA 5FUPA 5BPIA 5FWEA 2LUWA 1V6MA 3W2WA 4ES9A 2J7MA 4ZXEA 2H1LA 1BC7C 5A7OA 2ZEWA 5FMOL 1RITA 2CJJA 4LO5B 4L99A 1MBGA 4C3JJ 5TISC 1Z05A 2VCBA 3IKWA 4IVNA 5F3GA 4MHUA 2RVAA 1XNTA 2HEOA 3UYJA 1YJKA 1IQAA 1W39A 1WA4A 4B43A 1LKXA 3LA2A 5LGNA 5KXBA 3AMHA 3ZKYA 2BRTA 1OYWA 4FTEA 4UV9A 1LHUA 4CDQA 3RKXA 2O6GE 1OD3A 2HI3A 1V9U3 5CIRA 1B4AA 3BG6A 1YO8A 3ZFGC 5GLTA 3EYPA 5J1XA 1ZA4A 4AEDA 4E7LA 1GWLA 3EUHC 5ABJA 4NIDA 4IHWA 3K4JA 1WW7A 3BPVA 2JVGA 2QUFA 2BFUS 1ZLJA 2XQXA 3WTTC 1WFXA 5IVFA 4DOUA 4C1XA 1OCOH 4AFMA 3AKSA 4XRSA 2VOWA 5H9QA 5E88A 5IAXA 3D4KA 3HUGB 1WLDA 2IGKA 3VKOA 1QZYA 5LLQA 2CDOA 1W2NA 1RUF1 4FPGA 4FCAA 2JD4A 4QPIB 5FLIA 1BR2A 3PU8A 2PLV3 4EGZA 4AW7A 2FZ2A 4Y24A 3M2MA 5F9TA 1D8JA 4B8XA 4LLOA 3M4OJ 2LW8A 4PJLA 4R9CA 3FE5A 2EA2A 2CV0A 4K3UA 3EYYA 3SDGA 3WG4A 3MUY1 3VYSB 2W48A 4GWIA 5CKTA 2ET7A 2PQ8A 5JR3A 4CE8A 1G8XA 2EV0A 4C1WA 1XNCA 5CZKA 3BQZA 2R043 4L9BA 1E5HA 4RQPA 4V19K 3UETA 2L2OA 4BQQA 2X48A 4FOVA 2JXAA 2RMU1 3EO6A 1IRFA 2RR13 3KM5A 4D7SA 4A7YA 4YM2A 4FPKA 3JD72 2CS3A 3BR3A 2XRNA 4EJUA 2DUOA 3S32A 4GB32 4XLAA 4CXYA 2HQNA 2HS5A 1AYN3 3NJZA 4KGQA 3GCXA 4AQSA 2RDNA 1YHQI 1R36A 1GV9A 4IRHA 2WV1A 2R7QA 3ZN6A 1XGMA 2WQ8A 2DURA 5C7GA 5L73A 2WQ4A 4YZ1A 3I97A 4IQ4A 4Y7NJ 4B7KA 2ID3A 2OZUA 2W0XA 3SMHA 1KXGA 4LFUA 4WBBA 1O59A 5LB6A 4DZJA 1VQ5I 1MIJA 3W6KB 4BY1J 4QX0A 1VMFA 5CFCA 4UHTA 2G9FA 1JOJA 2VD7A 2LLKA 1O6UA 4PLOA 1PGL2 2C6YA 1AR81 2LR8A 3QU3A 1VBB2 4YFWA 4IL6C 1X3WB 4Y4YA 2VOVA 3BZCA 5AIQA 2ELJA 4P08A 2HYFA 5A6QA 5GLVA 1HJFA 2FDHA 2A5WA 4CPBA 5FO5A 3LDBA 3CZUA 1QNTA 3VDDC 1XMKA 3H0GJ 2OF7A 3PVEA 5F5AA 4NIIA 5FYVA 4AGGA 3F8FA 2ZKNA 2HDDA 2AHQA 4EJWA 1LULA 4HYEA 2LMDA 4LIUA 1GZCA 1K78A 4R9BA 1TT0A 1O7FA 2WNUA 5D8AB 4BCUA 5JOWA 4W6YA 2HWC3 1JW6A 3LSPA 2E34A 4CPBD 2X10A 4RA2A 3LE0A 4IXLA 4AF9A 1XNAA 4YIIA 5FZMA 1LCLA 5LY1A 1JXNA 1XXNA 4L5EA 3OF1A 2C9KA 3DLAA 2FBIA 4YRVA 5ILVA 2O8KA 2VTFA 3NAUA 3IM0A 2LNBA 2AYHA 1ETYA 1ZHFA 1QJU2 1UKGA 3IL2A 4GQ7A 2CGPA 3LAJA 5ISLA 3BR6A 1FNYA 3DYOA 3B7MA 1EUTA 1R083 1B59A 4YG6A 1TNSA 4LXLA 3OS1A 1GQHA 5L3BA 3M1EA 5FY1A 3X2QH 2PFWA 3KS7A 2K02A 4RS5A 3VSKA 3ZYFA 3THPA 2FCTA 4RGXA 3E6CC 3WCRA 3FLRA 3IUOA 2Z5WA 3F72A 4F92B 2DMPA 1ZKGA 1Z91A 4F55A 2E36A 2DYSH 1BZWA 4FFIA 3RWNA 4BQXA 4AWXB 3OY9A 4AAXA 3MW4A 4XURA 1WCMJ 1YIPA 3J7HA 3BKZA 1HV0A 4DQAA 3OBZA 1URXA 5E8GA 2HZTA 5AC91 1OA2A 2XGCA 2E33A 3TN92 3CDZB 4IF4A 4EQQA 3H8OA 3ZN4A 1P2FA 5LZ6A 1K5JA 4NHKA 4GRIA 2YPJA 2HVSA 3S2HJ 1T6BX 1FOYA 1D4VB 3JXSA 4XW3A 1GV5A 1IG0A 3K75B 2BNNA 2P7VB 4L9JA 3RWKX 3VKNA 4D6RA 1EJ9A 2VBDA 3L7WA 1HLCA 2P2KA 3LB9A 3H8UA 4CDQC 2Y0SN 2D6PA 3HN1A 2CG4A 4XF1A 4KJZA 3J7AY 2XJUA 4CCCA 1WMDA 4V1PA 1BJZA 1UZYA 3CCRI 4XFHA 1JUHA 4AFCA 4S2HA 2NNYA 1AX0A 4Q5OA 3SJMA 1J75A 3M4FA 1H0MA 1WZXA 2QVSB 1OJLA 4AEDC 1UW8A 1HKQA 1UOJA 5ABJC 1HBXG 2HWB3 3ABZA 4MO7A 2XLAA 1NA1A 1ZYRF 3JRIA 5K1YA 2W25A 2Y31A 1A6IA 5KNLA 4RB1A 4AZZA 2JWTA 1JOBA 4XIOA 3ZX7A 3JCIA 4F7ZA 4RN5A 1DU6A 4NO4A 2HFHA 3UNPA 3QRFF 3LSHA 2BY2A 1W2AX 5CKNA 1ITYA 1EA3A 2PMUA 2DMUA 3ERMA 4OINF 2LS6A 3VHRA 4AQ6A 1WUVA 4UUSA 2HWD1 2MH2A 1GWMA 2DCYA 4YARA 2BWCA 4RM3A 2BZDA 4L8QA 2JUCA 2FQ3A 1O3QA 2DOEA 2EILH 1Y9MA 1LTEA 4IKFA 3OYNA 3F95A 4E9KA 5FKNA 2PHFA 5GPAA 2C9AA 3EQLF 2L54A 5EZGA 4KMUX 1PZ9A 1GUUA 4CTEA 1SFOJ 1IN5A 2A71A 1K12A 4COYA 2BHZA 1UO9A 4M9ZA 4KITB 5M5WJ 2DN0A 2FDGA 4B4PA 2X85A 4CEYB 2VPLA 1JZ5A 2P34A 1RUH3 4URAA 2IXLA 4SLIA 4YLZA 1UJ8A 3HGYA 2VECA 4YM0A 1R58A 3NMBA 4YZ2A 4RQPC 3H42B 5F39A 2ICWG 4Z8BA 1LFBA 3MBWA 3QODA 1NHAA 1V5GA 1ETKA 2D40A 1LEAA 2DMQA 3DF0A 4M4RA 4MGZE 2K86A 4MGSA 1GUIA 1DQ1A 4EJVA 1ZBA3 4HNUA 2M34A 4ITVA 5LK7B 5FREA 2XPVA 3QLQA 1RR7A 2WTEA 1QZZA 1C1FA 4A6DA 3CCUI 3I4PA 1I50J 1VQOI 4CP0A 3IH2A 3L00A 1QF3A 2WABA 1SG3A 4DEQA 3K69A 1MZEA 2R0QC 3WLUA 2WNOA 1FLIA 5FZ3A 4W97A 1IKPA 4XC9A 3IPVA 1NG0A 2DO7A 4LMFA 1PVXA 3NO8A 5IT9K 4HPKB 3FL7A 5CFCC 1D7PM 2K85A 1U9NA 3K1PA 3VD5A 4D3WA 2V4AA 1S7EA 3MIFA 1PJRA 2OCCH 2NZ9A 3O1OA 1PUFA 4TXWA 5FZ8A 1BCXA 3Q0WA 4DB5A 3KYCB 3FF5A 3OYWB 4AIDA 1PMJX 1R5ID 3HQUA 2PA7A 4B09A 4AHZA 2IA1A 1G3WA 5IYDJ 2VT2A 4CUAA 2B4KA 4X8NA 1DP0A 1OQYA 1P4WA 4ZYEA 3OBAA 4HANA 2V7FA 1BMV1 4BBSJ 2LROA 1W6MA 2FNAA 2XLGA 4XLHA 1GZ9A 2EFNA 5B4NA 1F4AA 3JTHA 2M87A 2X1DA 4LO6B 3GZ6A 1YFUA 4MXVA 3NRUA 1CAUA 1CZSA 3PJRA 4GH4A 3ZMNA 3N9MA 4XAEA 2E1MB 3CF6E 4YW5A 2PI0A 1PK6A 1GR3A 4CICA 3HXLA 1HN1A 2L9LA 2IFWA 3K3OA 3NW4A 5C3PA 1PVC1 2BJSA 1U8BA 2GZWA 4EQVA 3ETPA 2B45X 3KVBA 3WCSA 4BK4A 2ZGKA 1FOD1 4QLCU 2K40A 5HCAA 1O7LA 2AS5F 4QPQA 1YE9A 2WAEA 2FSWA 2CTVA 3F8BA 2WBKA 4G6QA 2DPUA 4B8EA 2BOJA 4PQQA 1P7JA 1RKWA 1SD6A 4LKSA 2N8GA 4WWCA 3S17J 4P9IA 3JB4C 4RD7A 4RS5C 2BBAA 5H6RA 4M71A 4AHXA 4HONA 2LP0A 1VBE2 4K1ZA 2E7TA 3LOIA 4ORFA 3TWIA 3VV1A 3J80Z 3O1UA 1S3JA 1DF0A 3VDAA 3VBSA 4BZ4A 4A4AA 1BN5A 2XPUA 4UFMA 2B5HA 3A21A 2LY1A 4IESA 5FYYA 4JGZA 4Y52J 4AVVA 2QE3A 1C8M2 1J3QA 3GFJA 4TWTA 1W7PB 1OT5A 2K7LA 4TN7A 2XGEA 3T2TA 3QAHA 2MEV3 1PIV3 5LD2C 5FUIA 2NS8A 4CH7A 2E7XA 2ACJA 5LASA 1P6RA 1BLZA 3H35A 4HQEA 1MJAA 2I2SA 1GLHA 3X29B 1W5SA 3V7RA 4D5CA 3BU7A 2HWF2 4XZPA 4AD9A 1LHWA 2RM22 5IK4A 2R061 5HBAA 3TOAA 3DPRB 3ZXEA 3UESA 4GGGA 5T52A 4QQHA 4BDVB 1JUPA 1KQ9A 5FJ8J 2ZGRA 4KWLA 2VBBA 1YUDA 3CCLI 1YXWA 4YZ3A 4L2NA 3LOBA 2XF7A 3I2JA 4XRFA 5FO7B 3LDRA 5DDJ3 1NA1C 4XJWA 2A61A 2L5QA 3WU0A 1JYWA 4AUXA 1FY7A 3QYFA 1BL0A 3DKQA 4Q0SA 4W4ZA 4Q8KA 4NHLA 4A3DJ 3DTKA 1TQIA 1RUOA 5K0UA 2OS2A 3I3BA 2ZGQA 2RS51 2BDRA 1U5TB 3BZ6A 3K4CA 2CAVA 4ZU5A 1WW6A 4P14A 4YGBA 4EM1A 3CLOA 4JGYB 4LQRA 2OQ7A 1QJX1 1EAH2 3L2CA 3POGA 4KWJA 3KETA 4XBQA 4OHYA 1LEDA 1RUJ2 2E53A 2MLKA 1WLWA 3I2IA 2GMEA 3BOPA 2VVEA 3LNQA 2Y69H 2E7WA 3VKMA 3W5NA 3PFYA 1KQ0A 2GXAA 3U21A 2CL2A 2B7YA 2PX9A 1MD0A 1JI6A 4G4FA 2L3DA 4OUMA 3DXJF 2A73B 4EN9B 1AL21 2A3WA 1VQ9I 1RUI2 4FO9A 4INDA 2WZR2 2JIGA 3ZYBA 1V54H 1QZEA 4PQ9A 4PDWA 2XJTA 1VBA1 3M7GA 4MGRA 3ZQFA 1FNNA 5ICEA 2VASA 3D5RC 4Y22B 2B8MA 1V6LA 1DIWA 1QJY3 1TL8A 4MGQA 1XRUA 3ERED 3OJBA 2QQJA 4QTRA 1WCUA 4KIFA 1W2UA 2JMWA 4FPJA 2FNPA 2UWAA 2XC7A 3GTJJ 4BJ0A 4M3DA 3WR0A 5LHHA 2P4WA 2L02A 4B48A 4BH9A 4NROA 4BL0B 4QHBA 3KP2A 2W7NA 3PURA 2QZ3A 2AQFA 4CXFA 2WAQA 1R091 2J1UA 4ZS3A 1Z1DA 4PUSA 5JI9A 4NPMA 4Z1VA 4IRIA 5AVPA 4LK1F 4DYCA 1FAYA 5J6XA 3SFIA 3E97A 3UKVA 4XK4A 3LOCA 2LDUA 3S0MA 1FV3A 2H0VA 3ZFEA 3LA3A 1DPRA 1VQKI 2ZGTA 2XVLA 4OZXA 1S29A 4IE4A 3WNXA 5HCFA 1QXPA 3JD73 5FYTA 1IN4A 2OZJA 5KXCA 5DAPA 2Y9ZA 1FYMA 1GYKA 3O8HA 1BIAA 4A7ZA 2DUQA 2XL7A 1SFYA 3U1XA 4GB33 4GCVA 4D0QA 2KIMA 2IXKA 4S2FA 2YBPA 3I7DA 1FBUA 3BTAA 3QCWA 4XFBA 3WQ7A 2DV9A 1H6YA 3T09A 3O2PE 1MZFA 4KU7A 3ZXKA 1IG7A 4YFZA 1VP6A 3CO7C 3SH4A 3K0LA 1UYPA 3JRDA 1H30A 4GH4C 3WU1B 2WL1A 1OKRA 3CF5F 1BBT1 2BGOA 5FZ6A 1PK6C 2DBBA 2CGNA 3ZM8A 4QM8A 4XFAA 1BJQA 4MLOA 4GAZA 3KEOA 2OIIA 4XBNA 2K4BA 4HX8A 1MPXA 1NCQB 4LT5A 1ENHA 1VBB3 2DT5A 4K6BA 3H8XA 5KXDA 4KA4A 2V4JC 3VYRB 5E18F 4QQOA 4AYUA 4R4XA 1ZH5A 2PN6A 1LHOA 2VZVA 2PLV1 5CA6A 3LWFA 3GALA 1REPC 2YXSA 3O8GA 2PJRA 2R7EB 4IV3A 2K5CA 1F5JA 1RKTA 2CHHA 3SZGA 3J7LA 3NARA 5GALA 4ITCA 5LK5A 5F2WA 3PQKA 3VBSC 3VBHA 3O0WA 1NY71 1A6CA 1QXJA 5HI0A 2FMLA 4MGKE 3LL7A 2JPCA 2D6MA 4HEA2 3WP3A 4JGZC 3UKTA 1Y4WA 5A3PA 2JB4A 2R041 2RS12 2M4GA 3HOTA 3AYCA 2VI6A 3INAA 1GNZA 4AIJA 4CXWA 2RR11 3SXWA 5GAHJ 2XPWA 3EMRA 5IHRA 1VAMA 1TWCJ 4ZYAA 2OPWA 2LH9A 1WQ2A 3BODA 1MJ9A 4JDNA 1VI0A 3FXMA 5C3RA 4XJUA 5KHKA 2HQ5A 2O1QA 1C8NA 4MOAA 2RDQA 1KA8A 4M0HA 4HDUA 3G7DA 2CYFA 3AMQA 1MH3A 1OUSA 4CVUA 1XGSA 4PSXA 4DNCA 4X6QB 4EGYA 1AJOA 1DGRN 4G9YA 4HF2A 5FRNA 2BV6A 1BOAA 1VBC2 2DVGA 4D6SA 2F6CA 3POSA 2DQRA 2KZGA 2X51A 3WNPA 1ULPA 1ZYBA 1W5TA 3RZMA 2HEVF 2XMLA 4GMP3 2WYSA 3G6JB 5JAXA 1YI7A 2R7XA 5JSOA 4HZFA 4Y26A 1XYNA 3AYAA 4Q4Y1 3CO2A 2BTVC 3M9AA 5T5OA 2QBYA 1WJ5A 4PHZA 5EYYA 5FPUA 1VAVA 1P92A 4MFEA 3TN93 1RUF2 1H2LA 5K0UC 2L7KA 1PZ8A 1SPPB 2ZKZA 3JREA 4BEHB 2XB0X 1JBCA 5HNFA 3D0JA 5F6FA 1XCBA 4N4OB 3QD6A 4I7HA 1QQIA 4XM3A 1F8VA 3B69A 3SH3A 4PZJA 2MA3A 3OWTA 4F83A 1W36D 2DXIA 2PN5A 4XIKA 4A45A 2CQQA 4L0ZB 2QA4I 3N97A 1UPIA 2F4IA 1W4MA 1W8NA 3DEEA 1KRIA 1DP3A 2XHNA 2HBTA 3GZ5A 3KP5A 1LVAA 4U7DA 4Z2WA 3ZMZA 3V8KA 2ZO4A 5F32A 4NAOA 1FOXA 1RIOH 1X4OA 2RMU2 4HKLA 4CP2A 4CCOA 1VJ2A 4YG0A 3RJPA 1JT6A 5ICFA 3AKTA 3PTYA 2OXBA 1FTZA 5E17F 2KJBA 4LMYA 4XMAA 2O8QA 4PDWC 4C9YA 4EVIA 3CU7A 2J42A 2XGXA 3CCJI 4WVMB 2IFRA 3A0BC 1MNEA 3DTIA 4H0EA 1R081 4XN3A 2OU2A 4A3KJ 2I8DA 2X6YA 5LATA 4Y1UA 4EEFG 1HV1A 1JKQC 4XL9A 4NOTA 3FXRA 5FY7A 3Q8EA 1SCRA 3R05A 1V6OA 4JQTA 5A32A 2WB1A 4ZXKA 4QB6A 4WVZA 4OI0A 4UW3A 3K4LA 1YLFA 2W47A 1A6QA 4X0GA 4LBLA 1FNZA 4XDPA 1VBD2 3NWTA 4JX4A 2W9XA 3QOPA 5FZIA 2DOAA 4NHXA 1ETOA 5DCMA 3WODF 2VPVA 3VYUB 4QHOA 5FRAA 1Y43B 2K4JA 2B9VA 1AR82 1UX6A 5IP7J 1HN0A 3OEAA 1JHHA 3ABKH 4B3XA 3ZFEC 1TBXA 3OYJA 3R0RA 2DTYA 2R073 4OUEA 1MDMB 5A7WA 5B5EC 1QPIA 4N43B 1WGPA 2P5KA 2EAKA 3HOVJ 4HF1A 2Y33A 5CQGA 1SC7A 4XRSG 1WJDA 2R3SA 1J3RA 2E51A 1SVMA 4URTA 1X9TA 4E4DX 2EIJH 2YU3A 1WJCA 1ON2A 2WSUA 3MV11 2A6TA 3ZXLA 3ZMVA 2HTJA 3WDYA 5HDKA 2WZ8A 5FZ1A 2VQCA 1CAXA 1YHFA 3ZFFA 2L0KA 2YR2A 1UF2C 3MO4A 3DLLF 3BCWA 5CVIA 5FKMA 2BGCA 4Y20A 1WKYA 3ORJA 4FHTA 2K9ZA 2B39A 2HWB1 2VNRA 3MAJA 2Q1MA 4LK0F 3WHTA 3USUA 2IGOA 2L7FP 2LG4A 4AIHA 1OVSA 3SQOA 1STMA 4K20A 4IHYA 2RQQA 3S1QJ 2UV1A 2WWYA 3VGIA 5BNNB 4MSVA 1IS6A 4XAAA 1PNFA 2GN7A 2BHYA 1H9PA 4JTNA 4OUSA 2VGDA 3SZPA 1E0EA 3JBG1 1QNYA 4LO4B 2DQLA 4SBVA 3ZOBA 2JVHA 2NYYA 4IV3C 3Q0VA 1W0OA 3L2UA 2D5VA 2W84A 2K3PA 5FYBA 1HJGA 3BTXA 4EJTA 4IGPA 1QOTA 4AOCA 2JE7A 3BPZA 5JLWA 4HXCA 1LOFA 2A6YA 3ZSLA 5JHFA 4IHXA 4LE4A 1XBFA 3KV5A 3VBHC 4AK3A 3ILRA 4R9AA 3N35A 3PDQA 3ACIA 2JECA 1L0OC 4C30A 1HDPA 3FBIB 4LJHA 2X05A 1MMSA 5IP9J 4DS0A 5JXHA 1LJ7A 2JA2A 3MN2A 4YFNF 2ERFA 1O5UA 4QGLA 2EXJA 3O3KA 1RMU1 4F3QA 3DPUA 4ZTFA 4TTGA 2ZXIA 2X1CA 2BERA 1XE0A 1ZBA1 2GN3A 2JDYA 3H36A 1LGBA 4S04A 1AX2A 2NPIA 1QPMA 4QGNA 2WR9A 4ET7A 1ULDA 3AG3H 3ISPA 3GTQJ 4A2UA 1NLRA 1NCRB 1R23A 5FV3A 4M74A 3P6BA 1LR5A 3VBUA 5DM7F 1J83A 1V55H 1FC3A 1K5MA 2W39A 4DINB 2VBZA 1VBE3 5FP4A 1RVF2 5FFZA 5IVEA 2D43A 1S72I 2Q8KA 4LE3A 4YW1A 5IVYA 2EXHA 4AGRA 5C9AB 2B63J 1BI0A 2XPJA 2G7UA 1C8M3 4QXHA 4C90A 5FKKA 1W36C 1MS9A 2Y75A 4DUWA 2OVUA 5DQ0A 2LREA 2CWSA 4CDXB 5L9BA 1POQA 4NHJA 2GAUA 1JOPA 2BXZA 4W8JA 1IS4A 4NPLA 3IN9A 2VQHA 5LGUA 2D6NA 2HWD2 2MNGA 1VQ7I 2UWBA 4V2VA 5AFBA 2KISA 2Y38A 5E3LA 1POV3 2DTZA 3FMQA 3LPGA 1H8VA 4Z2YA 4ASMB 2VBYA 5J4YA 1RUC1 2Z69A 4XQDA 5FRMA 3HJEA 1HDKA 2RM23 3ABUA 5J09A 1BVP1 4RR3B 3BGAA 3PIGA 4AE2A 3FZVA 4Q4V1 3BUCA 2F4LA 1YNAA 2QJVA 5K5RA 5J3UA 3CQZJ 4LIVA 2VXDA 4BAYA 4RGSA 3F6VA 3FBYA 4JK1X 1RRJA 2D3RA 3WINE 4ENKA 3FMRA 1QRYA 1I1SA 4N7UA 4R8HA 3AG1H 4ZDPA 2DCTA 1F2NA 1YYNA 3VEPA 5IATA 3U78A 2GXBA 1H8TB 4FT8A 2ZGMA 2MC4A 4A6EA 2YU2A 2VC0A 4LG0B 4XRMA 3ZMOA 3IT8A 5BNOA 3SISA 1YTYA 1XU2A 4OMYA 1RHI1 5F1JA 4YM1A 2PYTA 4AVAA 3WG1A 1VQLI 1EAH3 4YYOA 4FX4A 3ASIA 2HLEA 5FYMA 5FLHA 1PP7U 1ASJ1 4PJYA 3WVJA 1O3RA 4Z92B 1RUJ3 3ZN1A 1J59A 2P0WA 3JZVA 3BIWE 3CBNA 3M3YJ 3FHIB 4K8FA 1SAXA 3KCCA 5B2GB 2JK3A 2DMNA 5JVTA 2NOGA 1JKPC 3WTUC 4M3CE 3FUQA 4OI1A 1O5LA 1YFHA 3MIDA 3GTLJ 3SCHA 1IXRC 1J09A 2HTSA 1GZTA 1W8TA 3N9LA 4I02A 5IYCJ 2MEV1 1RUI3 1S2KA 2WZR3 5F08A 1Z21A 4BQ4A 3NNJA 1FXZA 3VBOB 1SFXA 4AVSA 4OAYA 1HRI2 5FR3A 2QQ8A 1VF9A 3AFKA 3KSCA 4IV1B 2VKDA 3HRTA 4XUNA 4ES8A 2DW4A 4BLIA 3MF9A 1WJAA 2JDAA 1AHDP 3DCQA 5EZHA 4H7LA 3WHBA 1USSA 5I0UA 4A69C 4BUPA 3ZFFC 2QKLB 2BY3A 1XG1A 1GP4A 3LSGA 1B6AA 3K2ZA 1A3KA 2AXLA 3BN6A 4L97A 1UCRA 4RAFA 1OQ1A 3N7MA 1D1AA 1UY2A 3RMYA 4BQOA 5DDJ1 2KD7A 5H9PA 2VXRA 2DODA 2YV8A 3OIOA 3VDCA 3GEZA 3A7QA 1R4MB 1Y3TA 2VW0A 3ZCOA 1SQ4A 3AK0A 3PSIA 4NQWB 3QH6A 2PMHA 2E9QA 4UOJA 1ZGJA 2VUDA 2WT1A 4AYBA 4CEWB 3EYIA 3GTKJ 2QSFX 1HLVA 1NXMA 5FZOB 1F5FA 3OV8A 4Q0PA 1IV8A 4CDUB 4G9SB 2E19A 2X5IB 5CNAA 1JHFA 2R6QA 2VJ5A 4CEYA 3POFA 4YEJA 4QKDA 4YW7A 3JSPA 3VD4A 2DK5A 2JIJA 3V7CA 4D7TA 3CUQB 3OBRA 3HOSA 5BMZA 2KR2A 1Z9CA 3TDUC 4EWAA 1HKDA 2PMZA 4ASNA 3O6BB 3W58A 1ZAOA 3GCMA 3K7AJ 1LOFC 2VZ1A 2MYSA 1JYXA 2GOXB 1CWPA 2EZKA 1XMXA 1WI3A 3AL0C 5K9YA 5FZ0A 2W00A 2ADUA 3LSJA 5IY5H 1YQCA 2IZWA 1SMTA 1YJLA 4ZZDA 3POEA 5F3EA 1VTNC 4UUVA 1CAWB 2IC1A 3WDTA 5CYYA 1IHMA 4JZRA 3D82A 4XABA 2R7VA 5DAWA 3V0BB 5KC5A 3THCA 2P1BA 3PL0A 2RS31 1L3LA 4XQWA 4P9YA 3HPHA 2PXJA 1W8OA 1O8PA 2ZTNA 3ZQCA 3GZAA 3DEWA 2ZXJA 3IKVA 2R5ZA 3RSJA 3PMSA 3KB5A 4XZUG 2H8WA 2DUPA 2DBNA 3NQOA 2K9LA 4KMQA 1X1AA 4GA9A 3VBUC 5HOOA 5JI7A 4IEVA 2LD5A 1K5MC 1ZGAA 5B3SH 3DYMA 4HSLA 2R30A 4CZSA 2WNVB 1HX6A 1R7JA 1QVUA 3IIAA 3V64A 1HB2A 3HJRA 4KI5M 3O1PA 5FKBA 3OYFA 2IT0A 4A3ZA 2FCVA 2YROA 2VG9A 4HRIA 5I91A 2XJPA 1R22A 1VE0A 3OYWA 1Y1VJ 1Z7S2 2G9GA 5E3NA 3HHHA 5I8TA 1MS3A 2RS13 2R7DA 4BGDA 1R49A 4META 3K51A 5A6ZA 1XSVA 1AXKA 1QOOA 3GTOJ 2EXIA 4ZDOA 2G7HA 2NVQJ 4EM2A 1MZBA 4JAAA 3IP4B 4XHBA 3JD71 1B9NA 3H0DA 2RS52 3BU0A 5HXMA 4Q0UA 2DYRH 2X8KA 2E7QA 1Z6RA 2OPKA 2H6BA 1BBYA 2GU9A 4LLLA 3LZZA 3I3DA 1QJX2 2EALA 1W28A 5BXXA 4ASLA 3HOZJ 1VBC3 4FOWA 1JI8A 1TQPA 3VHOA 3N9PA 3E1SA 4PIZA 2P5VA 2VT3A 2P8TA 4FCYA 2WB1N 2W08A 1NZIA 3T4HB 4IHSA 2W1QA 1NZCA 5FPZA 4QU1A 5KBFA 1COV1 3HSFA 3VBFA 5J40A 4K2EA 5L7OB 4KG0A 1SBFA 3TNQA 2TRTA 4LO7A 3P3PA 3MKYB 3CDIA 4AIKA 3T4VA 1VBB1 4DO0A 1N47A 4PLNA 3CJXA 4HV5A 1PX4A 1RUF3 4XDQA 1ERDA 4GALA 4UBGA 2VQ0A 5FMBA 4BK5A 2M45A 4BHBA 2DU1A 2P3IA 3RPQA 3H3LA 4YVSB 2A6WA 4XKWA 4HNVA 1ZELA 1DGWX 3L2YA 3IAM2 1K83J 3KV6A 5BNOC 1B9MA 3FM3A 1HW2A 3WNKA 2VMFA 2ETEA 1MEC1 3NJVA 1KJLA 1O8SA 2NVYJ 4YW2A 4N9IA 2KIFA 4YRDA 1W7PA 3IDAA 4K9SA 4UFJA 4IRGA 1BI1A 5C8CA 3D0SA 5FIXA 1U2WA 1B8IB 3WW4A 2IA2A 3GZTB 2NOJB 4RB0A 1UMQA 5F1RA 2W95A 5CU1A 3MYXA 2Z2SB 1LGNA 2BZTA 1QWRA 1SVLA 2HWE2 2VOPA 2JDNA 2KA3A 2GNTA 2RMU3 2VH9A 1O4TA 2QFEA 3BJAA 5FO8B 3MV01 2L4AA 4XFFA 4OIRF 4PJNA 1QJU1 1KFUL 2LM3A 3TYJA 2Y9YA 1W7PD 3M07A 2LF8A 5FZ9A 1ZTRA 1RGSA 1TZOA 1WA6X 1OBNA 5FO9B 1G7YA 2KM2A 4WVVA 1HXS2 4AL9A 2R49A 3QP5A 2Y26A 1JTYA 3TQNA 3RCOA 5J1UA 4MEYF 5CVJA 4UW5A 1UMHA 4PF1A 3GO5A 3WUDA 1W5CC 5HV4A 4GD4A 3M3EA 3POWA 2R32A 4V2FA 4GMP1 4L5IA 2W1WA 1VBD3 4QQPA 3WP4A 3KQRA 4IXAA 3TOBA 5TSWA 1IZ1A 5EIYB 4L18B 4L11A 1QU3A 3EQEA 5A7QA 1FMD2 1D5YA 3B6AA 1AR83 3WGHA 3LFIA 3OUIA 4JGYA 3T2PA 3G2BA 5DAVA 2HYKA 4C0BA 2CQ7A 2NAZA 5C4JJ 3KV4A 2LBFB 1KDMA 1QXRA 1QJEA 1I3AA 2JSCA 4GO1A 3O7OA 1PMIA 3H50A 1RR8C 5C8WA 4TSVA 1QO0D 1C0WA 3ZGKA 1JYVA 3AP6A 2EFWA 4BMBA 4CEYC 2DDBA 5ERLA 1L7RA 1MBFA 2C6SA 1CF7B 4DEVA 1GNHA 3HG9A 1JYIA 2XIGA 2XF6A 2VTXJ 4B29A 2CUEA 3CEWA 4PIXA 4JVAA 5M3FJ 2EB7A 1J1TA 2R5YB 1SEFA 3DP7A 1APLC 2HR3A 1S0EA 1ZM1A 5FUNA 1YWKA 4BNCA 1Y9QA 4QWQA 1T38A 2PLYA 3M70A 5IWFA 2NNNA 2XDVA 1XB4A 1U5ZA 1H2MA 4MHRA 3CJTB 3HRMA 3MIEA 1GVJA 2MLGA 2F17A 2ZGUA 4I76A 3PIJA 3LEIA 2QKMB 3DKXA 2A3SA 3N9QA 2VCMA 2GM4A 4QX7A 3LA7A 1XPXA 2HYXA 4Y5TA 4D94A 3APBA 2IJLA 2Y0IA 5A33A 1K6YA 1W9SA 3CJIB 1NE6A 2ZGOA 4R9DA 1UIKA 1W6NB 1J9IA 4Y1VA 2VNGA 1LODA 1ZN2A 5CAZA 4EJOA 1B09A 3RZHA 1UL9A 4PSWA 4X8PA 2H09A 2STTA 3K48A 2VLAA 4EMSA 3JU9A 4YPJA 2RV9A 3NVCA 3KLNA 2EAAA 3VFZA 1DPUA 5LBEA 2FBEA 1V00A 1M4WA 3IMNA 3L1PA 1Q1VA 1YRNA 4GMP0 2ZMEA 1MMDA 2IVMA 4DPNA 2G19A 3G6EI 2K9SA 5FWJA 3S57A 5I0SA 4D69A 2I74A 1V5FA 3ROUA 3OYCA 2E1MC 3HIFA 1K3IA 1J0RA 1GP5A 3HZJA 3GDBA 2HQAA 5LWBA 3ZIWA 2PHTA 3GUDA 5DG2A 3I2OA 2W91A 1VQ8I 4ANJA 4HN1A 1RVF3 3GZNB 1RB8G 4ZTJA 4ESJA 3A01B 2EF6A 4NAMA 4OI2A 1X4PA 2J5PA 3VBFC 2L9SA 2RKHA 1UHSA 4KWUA 3DN7A 2ZJCA 3SCFA 3IRQA 2XAHA 2GOMA 3KT7A 4RGAA 3PMEA 2L7MP 3E6MA 3S7IA 2W87A 5L36A 2GMMA 3NQHA 1LGCA 5FYIA 2TBVA 4GXLA 3S93A 1UIJA 1H9TA 5C4XJ 3J7NA 3PQJA 1AR62 5C71A 5ANQA 2HWD3 1C5HA 4CYCA 5EGOB 3OGJA 2HOSA 2AR6A 2WAOA 1DDLA 5K5QA 4M9XA 2VMIA 1R1A1 1SMYF 2Y8KA 3OYKA 5LY2A 5F0CA 4PT6A 4ISQA 1AKHB 4WZFA 4IOAF 3FXLA 4Y1YA 2Y6GA 5C8CC 5BNQA 2D7FA 3I2KA 3CCVI 1GKBA 3A23A 1P4XA 2Y34A 2JDUA 3J7YJ 2STWA 3S2DJ 2AEYA 1A8DA 1SDDB 3BC8A 1GZWA 2N7GA 1POGA 4BISA 2GA2A 1IGNA 5T55A 5D8KB 3PJYA 1OLQA 1W8ZA 1S2EA 3SZTA 1ZNPA 3M7AA 5JXJA 1BA5A 1WJEA 2WZEA 2G9WA 2JQ7A 1UZVA 4DY5A 4EE2A 4QDQA 3O14A 2JPBA 2VUJA 2CQNA 2JENA 3T2QA 2GA1A 2ZXWH 4I30A 5FLJA 1V70A 5A6XA 4XN0A 1Y0UA 1EV7A 3W6JB 3VKFC 3LSIA 1CAVB 5CYVA 4A6OA 1QQP2 4KL1A 5E3MA 1TNTA 2VMHA 3LAGA 2JJ6A 5M3MJ 1D4M1 1XPWA 3TO7A 3FBNB 3OL4A 4JKLA 1VBE1 1W8FA 4F91B 1MJBA 4LEJA 1CPMA 2OA4A 4ENNA 5DMYA 5HS8A 1LAJA 2PMZN 1RUE1 3A22A 3MZYA 1SPPA 5CG8A 4WM7A 2D45A 2KT0A 3CQOA 1NAEA 1CX4A 5JFRA 4BEHA 2IXJA 2VJJA 2EQRA 2OUJA 3MPPG 4YG2F 1S0IA 2JA5J 2X6OA 3KHBA 2YC4A 4KIBA 3DYPA 4JGYC 2H94A 3OPWA 2XLFA 3T30A 2BNOA 1RIRA 3GVAA 1TWFJ 3AYDA 2YZ4A 1BOBA 3JBG2 1POV1 3J9SA 2UY8A 1A31A 5J47A 4E8CA 4OWRB 4JP0A 4UF0A 3KZ4C 2HWF1 3KP6A 2ELHA 1HXDA 2MFZA 3WGGA 1PGW2 4QDSA 1GP6A 1H2KA 3MIBA 5G04L 1BC8C 1RC6A 2X1EA 3KLOA 3OS0A 3U14A 1UCXA 3N4MA 3DU5A 2QCSB 3WG2A 3BTZA 4G6DA 5EJCA 2VAUA 1W04A 3VDDB 5FCCA 1PVEA 5FMDA 1CIYA 2GH2A 2JG9A 3QPTA 3E3VA 4KT5C 3ZXSA 1PVC3 3L2QA 3C7OA 3B6CA 5I0RA 2A5YB 1ACIA 3B9CA 2R7UA 3BCAA 3VZNA 5JIUA 3S1RJ 2E1NA 3BG7A 4CYDA 3PLQA 3K4DA 5LA0A 3RZLA 4LR4A 1JKRC 4BM8A 2A7AA 5CKQA 2Y0SA 1KD7A 2IS6A 4QB2A 3JR9A 2VE1A 2IS1A 1A5JA 1ND2A 4NIAA 2QSHX 2PBIA 5CADA 2HXIA 1AR71 2E35A 3ZPOA 1A78A 3FISA 4FPLA 1IKQA 2OA2A 1G9AA 4J1WA 2TNFA 4L0PA 1U9OA 4XORA 2VQGA 1MDMA 3HRSA 3AG2H 3F3XA 3AP4A 3JQXA 2JUGA 2E71A 3I59B 1MNMC 4PJ0C 3WD5A 2FOWA 4O7XA 2DBIA 3LCPA 2VJXA 1ZARA 1UY4A 1JHJA 2ZS6B 2FMYA 2PAEA 4IOCF 1M1EB 4CA9A 2ZMEC 3V8JA 1DGRM 4XICA 4HLYA 3GGLA 2V6EA 1F1ZA 3FFZA 1RUC2 3BB6A 5B1AH 3GTMJ 1QDCA 2MHFA 2YC2A 2NXNB 2WAFA 1ONAA 3B00A 5E16A 2PHXA 1KU2A 2Z16A 5E20A 1IGOA 2ZKLA 3BALA 3GLXA 2WWSA 2ZX2A 5HPOA 1YW9A 2K0GA 3FWEA 5IYYA 3WTVC 3DF8A 2BY0A 2JDZA 1HW5A 1W6QA 4Q0QA 5E1WA 1DG6A 1G86A 1POV0 1JS9A 1MACA 4Z07A 4XEZA 4P9UA 1UU6A 1FBQA 1LE8A 1Z7S3 2DVBA 5DUIA 3OYBA 3UJOA 2IP2A 3OGSA 4RFT0 3WW2A 2IW5A 3U75A 4NBQA 4LITA 2DVDA 4XUPA 1ENXA 4MZUA 1XTAA 2D97A 3ZO0B 4UXAA 2BBYA 2LC2A 1D3YA 4HKOA 3N7JA 3VHNA 1BR4A 3U0ZA 3PVBB 2RS53 2QDRA 1H4GA 3WDWA 4KBBA 4DRRA 1JZ8A 1SD4A 1DYKA 4AEDB 4Y1ZA 1QJX3 3AFGA 5KHHA 1WCDJ 4FAGA 1VPHA 1AOYA 1ASJ2 4NR1A 4J00A 2EIDA 5LCWL 5JZGA 3AKQA 1W90A 4MH0E 2XRLA 5A3OA 2XG3A 3FIWA 5BOXA 3AC0A 4LLGF 2VZTA 4K8RB 1CZTA 3PUFA 4XPVA 5LBBA 2JA7J 4I0AA 2ETHA 1IRZA 4A3FJ 3HOXJ 3IDCB 1GSLA 5FFXA 2COMA 4FSJA 1AL23 4NNJA 3VBRA 5D4SA 2BVMA 1QU0A 2VZOA 4UW4A 2DA4A 3KQ4B 2CY6A 2I5UA 3A0KA 2DTRA 3I2HA 3GBGA 3LEGA 4WXDA 1NQJA 2GP5A 4D7MA 4KYWA 1ORKA 4AQTA 2BWAA 3G71I 5DCFA 4RQPB 4XQFA 2HJIA 4AFAA 1OQEA 4TLGA 4UVBA 5DXDA 2E2IJ 4CDXA 4JKMA 4I01A 3A02A 3WW3A 3Q8CA 4D0PA 1FEXA 3I2FA 3I8TA 4JHZA 3AB0A 2C26A 1GOFA 2NVXJ 4AWDA 3OTFA 4EZ4A 3NJYA 2K3FA 1WBLA 4WM7C 3HTUA 4PGGA 2RE9A 1VMJA 1BJAA 2HWE3 4MV2A 1KU3A 2RS11 1E5IA 2GNMA 2QVOA 3W21A 4HT1T 1WWYA 2JG8A 3ZKUA 2EFQA 5HS7A 2OYZA 2DCZA 3AJYA 3ZN6B 3AMNA 1GVDA 2GC3A 1G3TA 2VM9A 3GTGJ 2O5RA 1BYHA 1H4HA 5IT6A 3BWGA 3AZZA 4EYUA 2KDZA 4A3IJ 2FX0A 4JDMA 2ARXA 5ED4A 3DEUA 5FDBA 5J8FA 5K4LA 1FYUA 3A4UA 3PUBA 1VBC1 5CFCB 2EJRA 2BUKA 3RZOJ 3BPSA 4QHZA 1IAWA 1VRBA 4HW0A 1A34A 1BBT3 4N53A 2K46A 3OGRA 4BE0A 2LYCA 3HTSB 1S0CA 4UAPA 4HPQA 3MKZA 1NYWA 1FMD3 3ZYGA 4KQ7A 3E5XA 2JG9C 1JE8A 4AAPA 4P5OA 1OKOA 4DMIA 2D3PA 1IUYA 5JCTA 5FGMA 1BW5A 1VRH1 4MUVA 3LSDA 2B42B 2ZBKA 1X3UA 1K78B 4MGIE 3D1NI 1ZRRA 2RS32 2XSDC 3VD9A 1UD1A 1I6HJ 3WHUA 5EDNA 3HGGA 1QY4A 1XB9A 2WNUB 1LKNA 2GSYA 2R7FA 5M5XJ 3WTWC 4KISA 5ERIA 1ND2C 2XOMA 3T0YA 1NUKA 2ZXHA 4LB5A 2P6SA 4QX2A 4NIHA 3RZJA 1X36A 3H1WA 2WA0A 2F2EA 1OOPA 3H1MA 5DDGA 5FZDA 2E2JJ 3VKLA 1WCSA 4OQ9A 4HVRA 5M5YJ 1ZRCA 1SANA 3HNMA 3VOEA 1E2XA 5LEJA 3GM8A 4Q27A 4A93J 1UB9A 1ZR2A 2ZOEB 4IV1A 2E1CA 3I49A 5CB7A 1OF3A 1JGSA 1WWXA 4XMYA 3S6PA 3AP7A 4RS5B 4A5MA 3CCQI 4LBKA 3E0JB 1AR91 1Z6TA 2WT0A 4BKXA 2ISZA 2JZYA 1LFPA 4Y17A 1OCZH 4U0VA 3K46A 2FOKA 2MGQA 2HU9A 1XMAA 1IUFA 5FK7A 2CW7A 3PUHA 5GZCA 3BLYA 1DGWY 3KYDB 3I3EA 1Z0HA 1UWWA 5FPXA 1HF0A 3O1VA 3ST7A 3KWVA 5HV0A 2YUEA 2WFPA 4IE0A 4YIRX 2FRHA 2ECCA 1ETWA 4LBOA 3RI9A 1KS4A 3H9AA 3MWMA 1BI3A 3JB8A 3B93A 3RJRA 2PG4A 3L9FA 2ZJQF 1QOSA 1VBD1 3ZMTA 5A1LA 1COV2 4NQWA 4JC1A 4ARXA 4AC0A 5GTIC 4FQ4A 3F8NA 4Q4Y3 1LHVA 4UV8A 5TJJA 3IAQA 5FZOA 4W65A 1WRJA 4JQFA 3M3QA 4NHMA 3BTCA 4BQWA 4XJ9A 4O65A 3W3CA 5T5PA 3K6GA 1GHCA 2LRDA 4QD2A 2IXIA 4U0WA 2GWRA 4HLXA 1ETVA 5FZHA 3J7MA 1E5RA 4OHZA 2OKXA 4XF3A 4CRQA 5FLMJ 1MEC2 2ADEA 1NA1B 5JZGC 4PJMA 3G1LA 1W3VA 3OD0A 4E4ZA 1LNSA 3W59A 5IOYA 5IT3A 1QBJA 4XOPA 2QQVA 4WM8A 3PNTA 3SDBA 4HETA 2XVCA 1ULCA 3H8RA 4HBLA 5FP7A 2EWNA 3K4MA 1MBEA 1XC6A 1SEUA 3HYIA 4UUSB 4XLEA 4XF4A 3AVRA 2LALA 3FHQA 5GJ6A 2KHMA 4YGEA 3ZYRA 3VDXA 3VBRC 1Q8OA 4Q4X1 1U78A 5J8CA 2OZ6A 3S14J 3C7HA 2CGOA 4XIDA 1MW7A 1NX9A 4AVPA 5EYRA 2IRFG 1AR63 2VL4A 3ZXFA 2M3AA 4I99C 2XROA 2QWWA 3R0AA 2CV2A 1D0YA 3BZKA 5EP9A 4W6WA 1YQAA 1UHMA 5IK7A 4FXKB 1OI6A 2IA0A 3ZYPA 1W0PA 3RNSA 4XCBA 4MXWA 5GLWA 3HOUJ 5FZCA 3S16J 5DABA 2AREA 1M06G 4CDXC 5A80A 2CQKA 3ZXAC 2LFBA 3K4ZA 3NAPB 3DQVC 2A05A 2Q30A 2D6KA 4OCTA 1V9U2 1K4TA 1YI2I 3ILFA 3P9CA 1EH6A 1MNDA 3ZP5A 2JG8C 1G3YA 1O57A 5ILSA 2KJCA 1VALA 2OQGA 1JZ4A 4U88A 1WVRA 1BEV1 4C2TA 4YVWA 3R60A 5ICCA 3UT0A 5A1FA 2XB5A 4J25A 2D3SA 2YMZA 1PO22 3SKVA 1QHGA 3WTYC 3IPVB 3DBRB 3W6VA 5L3EA 2D1HA 2V72A 1UYXA 5CFDA 2VC9A 3CMGA 3GTPJ 3OBTA 2PEXA 3P9IA 4EN0A 4NC7A 3ESWB 4IHVA 1S9HA 2VKHA 1PUFB 1RVF1 5T50A 2DK8A 3U9GA 1KS5A 2GIZA 1TLHB 5FPVA 2VUCA 4N53C 1UOFA 4CU6A 2CUJA 4Q4W2 1ENSA 4FBFA 4BBRJ 1LVKA 2FXAA 1Q8PA 5E1XA 3CLPA 3S5AA 3KIOA 3JCUC 2QQIA 2WAAA 2HOEA 3KCXA 5F2SA 1LUJB 3HDDA 5I0TA 3FDYA 3ZDSA 1W6MB 2C4XA 1R1UA 3VZMA 3BTLA 4XTPA 1XDUA 2A1XA 1DGRA 2M0MA 3JTGA 2YU1A 1CAUB 2J1SA 3JBG3 4GH4B 4PI2A 3H3ZA 3M1CA 1D1BA 3UJQA 3WG7H 1P8JA 1PK6B 2QQMA 5EZWA 3ZN5A 3V7SA 2H27A 2P6HA 5LA2A 5KHGA 2MD5A 1YLLA 4KBZA 1OOPC 4LKEA 4LUMA 1MSEC 5HLGA 1O91A 5GP9A 5FYHA 2Y30A 4E7ZA 4C2UA 2HOAA 4D7YA 4WXHA 1FPN2 5J1YA 3KEQA 4Y5SA 2W3JA 3BJ6A 4HK9A 5FZBA 2I45A 2QBXA 2XXZA 4RDUA 1V6JA 4IV1C 2ZMNA 4E7KA 3NEUA 5DUXA 1RMU3 2Q8EA 5L9VA 4ONUA 5FMOS 3FX3A 3I64A 2KIUA 2VMEA 4M00A 3HM5A 1TMF1 2QQKA 1Q8SA 4BXXJ 4AEJA 3OY8A 2M8EA 4LBNA 1YFWA 2B9UA 3BI3A 3IB3A 2ZACA 3VBSB 3PVNA 3ZXDA 2ZEYA 3FXUA 2DFFA 2E2HJ 4F8AA 2ME6A 1HOMA 1B35B 4JGZB 3TL4X 2LKSA 2DFBA 1S7AA 4R52A 1XU1A 4QPYA 3FMSA 3KMHA 1IN8A 1K4SA 4QQLA 1UMZA 1D0GA 3K77A 2DCEA 2EINH 5BS6A 3D5SC 1ODMA 1SFUA 5FXZA 2WC2A 4HAMA 2R7RA 2PHUA 1CX1A 2EFPA 3GXOA 1A8MA 1N1TA 3LSMA 3K10A 2VCCA 4L9NA 1D1CA 1WCQA 2DFIA 1TTYA 1VQ4I 3RSNA 5LHGA 1CF7A 3CTAA 3ZQLA 2KZVA 1HRI1 1WGXA 3O12A 4Y13A 5KHIA 1RUC3 1R1A2 2CUZA 4LLFA 4NDLA 4A42A 2KIQA 2R5YA 3RYRA 3PIOF 2GNBA 4Q4V3 3OPZA 2D6OX 1PDNC 1A35A 1IXCA 1RJ8A 4Q29A 1CD3G 3ZMSA 1NT0A 2ZSIB 4OIOF 1PGSA 4RLQA 2WDBA 3UGFA 4WM8C 5KWRA 5HVQC 4QPWA 4U2AA 4UY8I 1SCSA 5K0UB 1DQ0A 4XJ8A 3R61A 4RGKA 2Q2EA 4HOOA 3CC7I 2BW3B 3ILNA 4QPGA 4KUMA 4CO8A 2KRCA 1LU1A 2UWCA 2QEXI 2P81A 4ATEA 1V6IA 4TV7A 1YQ6A 2DU0A 5JXGA 1RHI3 1U5XA 1R5HA 3GFMA 2B9SA 1RC9A 3HSRA 2M7BA 3T0AA 1I1EA 3ZDVA 1ASJ3 3SITA 3L2WA 1D4M2 1N3QA 4G12A 5EJZB 2VN2A 2RAEA 3KZYA 4RAYA 3QPSA 3C3WA 2LVSA 4CCJA 2XQRA 2VC1A 5JMOA 1Y9GA 2P3YA 1RUE2 3RZZA 3LSEA 1MBHA 3GX4X 2FDIA 2VULA 2FA5A 2FZ1A 1CR7A 4CZZA 1P4AA 4ARYA 3UGHA 2Z99A 2ZABA 3WTZA 1T2XA 2VO5A 4U36A 2RNJA 1ZX5A 3ELKA 3QQAA 3ZR8X 3E6BA 5JOXA 1HKSA 2KKOA 4HQMA 4NHYA 1ZR4A 5IP6A 1JZ3A 4WXCA 1YRZA 4YVWC 3A0HC 2KP6A 2VQTA 1GICA 3EUKL 2QLZA 4M3GA 5FLVA 3VSLA 4XONA 4BE1A 2QYOA 5BV6A 3A01A 2FDFA 5F6LB 3WQBA 4QQ2A 3L09A 3E1F1 4RMNA 4IEJA 2CWEA 3T0BA 3POIA 1OURA 4LK7A 1SFKA 5CFDC 5DV5A 1Y7BA 2DWRA 2CH0A 2H0BA 4ENJA 3ZFEB 4UFKA 1GOGA 1E3OC 4LBQA 2R1BA 4RAZA 1AVBA 1O4XA 5LA1A 2CNAA 3JRFA 1FYLA 4GKYA 4CCEA 4RA0A 3ZSJA 1SBEA 1T56A 2KFDA 3A2KA 1Z7S1 2ID6A 1SD7A 2F4MB 2K9NA 4Y15A 3H3VK 1MS1A 1FWZA 1GOHA 2M0CA 1WW5A 1EV12 1RUH2 2RHPA 3HMYA 3OYEA 2DJNA 4LK6A 1FYKA 3OG2A 1AKHA 1ENRA 3H5NA 2J1RA 3KGLA 3I55I 4LBQD 3WW1A 3W2AA 5IK5A 2EK5A 4U87A 5JLXA 2OTJI 1AR72 2L9NA 3WNNA 4AI9A 4JX0A 2B46X 4ZPIA 5HDNA 5EG0A 3UL2A 2MH9A 3H5RA 1S0FA 3FUOA 3BQYA 4IGOA 5IAVA 5DUWA 2OTLI 5C33A 3VUOA 1S4CA 2P3KA 1YC61 4Z6YA 4HBNA 2Q1FA 1F9NA 2ZGPA 2NYXA 3AL6A 3FN9A 3PJQA 2XBO2 2P17A 2R7TA 3HPGA 5T5LA 5FZGA 1JKOC 1OD5A 1E17A 1Q43A 4CUBA 5D21A 4TLFA 4IW3A 5GPCA 4CDWA 2D2WA 2PJRB 4ASKA 3GMEA 4IV3B 2W82A 2DPDA 2RS33 1P7IA 5F6KA 3PNYA 3S3OA 2QZ2A 4LBMA 5F5IA 1CJDA 1WCKA 5A3WA 3SEQA 5GADJ 2W46A 3TNPB 3ZSKA 3VBHB 2WN3A 2IAIA 2XL9A 3Q8FA 4HN0A 2XV4S 1S55A 2P4EA 1FMVA 3I2GA 2GALA 1CPNA 2H1KA 3OIPA 3K2OA 1GQGA 2HEYF 3WTSC 4BB3A 5IVJA 1GBGA 3NNLA 2F5DA 3B94A 4J19A 3GHNA 4HX4A 3AAFA 3M8FA 3I54A 5F5CA 4FX0A 3FK7A 3OYLA 3O1RA 1RUG2 5C70A 1TEIA 2HWE1 3H9QA 5E89A 1IZ3A 2W1OA 4G7ZF 1ZVFA 4NWWA 2IWGB 1ZRIA 1RXGA 2OQ6A 4LHKA 1YS7A 1Z7UA 2ZMKA 4CCLA 4IE5A 4DXRA 5KHJA 3MLLA 4U7BA 1DZQA 4JDOA 2D6LX 1JMUB 1I39A 1HXS1 4KMFA 2EIMH 4ETSA 2NQYA 1I9RA 2FUG2 1DQ2A 2QDNA 1WH5A 5E1ZB 3ZSEA 2D1VA 1W99A 4A3BJ 2XJVA 2EV5A 2QBYB 3G1OA 1LHNA 3H9GA 3RYPA 2QQNA 4G8XA 1Q8QA 2Z5UA 4IETA 1J84A 4KNYA 3DXUA 2JRMA 2DA5A 3NKGA 1COV3 3TP3A 3FXOA 2KQRA 2ZA9A 2A07F 1HRV1 1FMD1 1K7AA 2X29A 2ESNA 2QQUA 5FROA 1I3QJ 2P6TA 3ELNA 3ONQA 4M9SA 3RPUA 2YHJA 2AUYA 4HOBA 4YELA 3EDPA 3WT3A 4RLFA 4NRPA 4QPGC 3CMEI 2O0YA 4UI9L 4COVA 4HVOA 2Y2ZA 1AL0G 3ETQA 1UG2A 4H7MA 2VB6A 3VB2A 1OA3A 4Q0VA 2RC4A 1D5VA 1S0BA 2A6ZA 2V9KA 3P3NA 5LEKA 3ZYJB 2Z3YA 1ON1A 4E4SA 5IYBJ 5GZGA 1H0BA 4FTHA 1MEC3 5HLHA 3GZEA 1HB1A 1T98A 3EHKA 3K4AA 1X9PA 2UYBA 2QQPA 3RPUD 3ZIXA 4LBJA 1VQPI 4BIFA 1OCTC 1RPWA 5BNPA 3LMMA 4AVBA 5KHDA 1NK2P 2VZUA 5GM0A 2ENRA 2ZBJA 2W94A 2VZQA 4NVPA 3F2ZA 1IDZA 3TEYA 3QP6A 3ME2A 4LG3A 3VYTB 1BR1A 5DZEA 3FK6A 1F36A 1QJU3 2ZNYA 2QQAA 2JB8A 5A32B 5C4WA 2AH2A 5FK8A 4G3YC 1QNWA 3PUSA 3F0CA 4BQ3A 4IPAA 4E7HA 1HA8A 4FPFA 1FX5A 3J81K 5AFEA 1TQMA 4KDPA 2M30A 4AFBA 2X4HA 2WO1A 3DL3A 3ZPYA 5DCMB 1YIOA 4MGYE 3TO6A 4CDGA 3F22A 3AKPA 3PNAA 1IN6A 4I09A 4MTDA 4ZH4F 2XHKA 3B73A 4IL7A 2JRTA 2DFEA 5FLXK 4FQZA 2VJIA 5KAFC 1ND3A 4IEPA 1K42A 3HKZN 1UY1A 3BG5A 1OHFA 4A44A 3KE2A 5D1IA 1D8KA 5A7WB 4E2GA 3AYEA 1EYBA 4CU9A 2BVBA 4D9JA 4C3IJ 3LAPA 1ETQA 3COAC 3L2VA 3RVHA 1W6PA 3ZRGA 4IE7A 2OV7A 2CFXA 1VRH2 5D6FA 1ODDA 1XS9A 1NLSA 5FQ0A 2WNEA 2OC6A 1GDTA 4FETA 2JDPA 1CAXB 2ZSHB 5JOYA 3ZFFB 1S0GA 1GQPA 1REEA 1KONA 5E79C 2O8OA 4Y20B 3LSRA 4OYUA 1ZZBA 4JTOA 1PO23 5FZ7A 5CISA 1RTVA 4LOSA 1BVVA 4OAZA 4EJRA 3CC4I 2ZJPF 2C1FA 4P96A 1T8IA 5E8IA 4M3FA 4DZPA 1G3SA 2QQLA 1QJY2 3USUB 4H55A 2LTPA 1N1SA 2F5VA 4O5VA 4CXXA 4NE9A 1ZA7A 4BQ1A 3HEIA 3SEZA 4WK8F 2L4MA 3MZ8A 1F43A 4P1WA 4Q4W3 1J58A 2LRPA 2VUMJ 2EXKA 4JBAA 3I3MA 3OYIA 3BDDA 1EF4A 1W8UA 3JQWA 1R00A 3O5SA 4XE9A 4G94A 3AX4A 1V0AA 4GYGA 4KT6A 1SACA 4CDWC 5A70A 4AM3A 1AR92 5APAA 4OVEA 1DZRA 1AR61 1HB3A 4GFBA 3FZ3A 2VL8A 1U5YA 3GF2A 1EUUA 3T8TA 5H9SA 1N1YA 3OUHA 1PYVA 2FD5A 5C3SA 1SD5A 3AL0B 1UX7A 3R4UA 2VW1A 4A0XA 1LEBA 2WFF2 1VB2A 3DKYA 5FB2A 5DUVA 3MLKA 4BU2A 3J8F2 5SV5A 4HX7A 5LRRA 3Q9OA 2E5ZA 2FEZA 1FPN3 1VB4A