5I91A

Structure of mouse acirecutone dioxygenase with to ni2+ and 2-keto-4-(methylthio)-butyric acid in the active site
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-Dependent Function of a Mammalian Acireductone Dioxygenase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
total genus 48
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i91A00
2XLFA 2VQAA 4MUVA 3E5XA 1H1IA 2PTMA 4BYYA 2E9QA 4D7SA 4LA2A 4P9GA 3M3IA 2IXLA 3MDPA 2C0ZA 3NJZA 3NL1A 4ONUA 3CO2A 4EV0A 3UKTA 4KU7A 1ZRRA 3HT2A 3EJKA 1ZZ7A 4WBBA 4JTOA 5KHKA 1NXMA 2BEOA 4I09A 4LUMA 4XEZA 3I59B 4Q0UA 3FE5A 2FMYA 4H7LA 1YFWA 3WW2A 4R8HA 4IEXA 4FT8A 3CL1A 3SCFA 1GQHA 3FJSA 4I0AA 1UW8A 3IWZA 2QCSB 3I54A 3CEWA 1NYWA 1O3TA 3KMHA 4R52A 4EROA 1LB2A 4PIXA 5K8SA 3FX3A 4LULA 2UY8A 4PIZA 4Q0PA 1XE7A 3U0ZA 4UBHA 3PNAA 3SMHA 4HVQA 4IEZA 1YFUA 5AVPA 5KHIA 3MYXA 2IXCA 2EVXA 5EZWA 1LR5A 3D0SA 1Q3EA 3E6BA 4QMAA 1O5LA 4HZFA 5FPZA 4XFGA 4AXOA 4BH9A 2P17A 1O5UA 4QGMA 3EHKA 3RYPA 5I0RA 1FT9A 2EA7A 1UIJA 2GC1A 3MPBA 5F1RA 3H3ZA 4MV2A 4JVAA 3WW1A 2QNKA 2ZKLA 4I3PA 1UCXA 2GZWA 1TQ5A 4LEJA 2GC2A 1YHFA 3S0MA 5FDBA 1J3RA 3FHIB 3DV8A 3SHRA 4HVOA 1OFNA 4Z82A 1NE4A 4IEOA 1WGPA 4MZUA 3RYKA 3ST7A 1ZNPA 1NZCA 3TNPB 2XL9A 2BGCA 4UBGA 5CVRA 3TNQA 3LA2A 1VR3A 5JCTA 1SFNA 1Y9QA 3ETQA 3BPZA 3R6SA 3E6DA 3D0JA 1DGRA 3FZ3A 3DN7A 4XETA 4E2SA 4YARA 2V09A 1ZX5A 2IXKA 4LUKA 4E2GA 2XKPA 4N9IA 2QJVA 5LRSA 3JZVA 2H6CA 4Z07A 3RYRA 5FPXA 1OMIA 1RGSA 5FLJA 2VECA 1CAXA 3H3UA 1RTVA 5CADA 1I6XA 2PHDA 1UD1A 3MZHA 5I91A 2MPFA 3UKNA 3S7IA 2H0VA 4HVRA 4MGYE 2MHFA 2PAMA 3RZZA 5JSRA 5JSPA 3D82A 1PM7A 4WZCA 5LEJA 4DINB 5BY5A 1CAWB 4I01A 4HBNA 1UIKA 3KCCA 2XGXA 2GU9A 4AVCA 4QGNA 4IEQA 2IXJA 2EAAA 2Q30A 1EY2A 3KGZA 1IPKA 2ET1A 3OGJA 3NSTA 5KBFA 5KHJA 2OPKA 1V70A 4TLFA 5EFUA 3CLPA 4RD7A 2PQQA 4IEVA 4I2OA 1X82A 1YLLA 3HIFA 4QM8A 4FBFA 4I0BA 1CAWA 2GH2A 5JAXA 1YFXA 2KXLA 4ORFA 4YYOA 2D5FA 2GC0A 1QXJA 4MGIE 5FCCA 4E2QA 4OFGA 1RUNA 3ELNA 3S7EA 3RNSA 4HN1A 1QXRA 3L2HA 3NKTA 4OLLA 3E6CC 3H50A 3H1YA 2D40A 1YUDA 1OD5A 4IETA 4AQ6A 2OZJA 4O9GA 2N7GA 3IDBB 5E1RA 2DCTA 4GULA 1QWRA 1O4TA 2WC2A 1O3SA 2MNGA 1VP6A 3H7JA 4Q0QA 1SEFA 4X6RB 1ZRDA 3CJXA 1ZRFA 1CAUB 5I8TA 1CAUA 1CAXB 4ZU4A 4KWLA 4MGZE 1O7FA 3HT1A 3ROUA 3E5QA 4IESA 1ZZ6A 4MGKE 2VPVA 4AQ2A 3U10A 3NVCA 3EO6A 4PJYA 4LA3A 1FXZA 2Q1ZB 4HMZA 2BNOA 3H1MA 4FAGA 2PFWA 3ES1A 2I45A 4YNIA 1J3PA 1ZZCA 3KSCA 3OD0A 4KL1A 4HSJA 3SXWA 4LLOA 2PHLA 3QACA 3IIAA 4QGLA 5T3NA 1O3RA 2BYVE 4IEUA 1LKNA 1XE8A 2PAKA 5J7MA 2PYTA 3USSA 1UPIA 4XFHA 5KHGA 1WLTA 3BB6A 1ZZ9A 2H6BA 3BCWA 3H8UA 3H1WA 3H9AA 3U11A 2GAUA 1WA4A 1Q5OA 4AVBA 4IEPA 4CYDA 5BXXA 5I93A 2CGPA 3DL3A 4F7ZA 4XF3A 1XRUA 1CGPA 3GBFA 1EP0A 5FQ0A 2HKXA 1DZTA 5FQ0B 2HJIA 4Q29A 4IEYA 2BNNA 4MH0E 1ZRCA 2UYBA 4O9EA 2ET7A 5I0TA 5CU1A 4HLTA 3RPQA 1J59A 4XFBA 4MX3A 2F4PA 5I0UA 3LZZA 1NE6A 4META 4XF0A 2CAVA 3LA3A 4EWDA 4Q0SA 1CAVB 5LEKA 5FLIA 2PAEA 4N9HA 1DGWA 1QY4A 1FI2A 2Q4SA 1O3QA 3I59A 4X6QB 4L11A 3E97A 1J58A 3LOIA 3OF1A 3G7DA 4Q0VA 5I8SA 1RL3A 3RDIA 4HSLA 4UXAA 4B29A 2GC3A 1X8EA 4L2NA 3UKVA 2D93A 2B5HA 3KGLA 4ZU7A 1X7NA 5C6CA 5BV6A 3OCPA 1RC6A 4KWJA 1IPJA 2UY9A 3ES4A 2CV6A 1HW5A 1ZREA 2Y0OA 2UYAA 5HI0A 1JUHA 3HQXA 3N4MA 3ZDSA 3SCGA 4XFFA 1ZZ8A 5J3UA 3NW4A 4PIYA 3LAGA 4HN0A 1ZZBA 2XLGA 2XL7A 2O1QA 3QOPA 4F8AA 2D5HA 4BIFA 4ZU5A 5JSOA 2ETEA 3FWEA 2XHKA 2O8QA 1J1LA 1CAVA 2QDRA 4J1WA 2XLAA 3VHRA 3WW4A 1J3QA 1X8MA 2K9ZA 2BNMA 3E5UA 1RUOA 2B8MA 3ACLA 1DZRA 5BPXA 2PA7A 3LA7A 2Z2SB 5J48A 1Y3TA 2QVSB 1YFYA 4NVPA 3DKWA 4XF1A 5JR7B 3H7YA 5LRRA 3M70A 3OTFA 1LRHA 1SQ4A 1ZVFA 4QX5A 2ZCWA 3B02A 5I0SA 3LWCA 4KWKA 1EYBA 4WVZA 5E16A 3WW3A 3FFQA 5C8WA 2IXHA 2Z69A 4EWAA 3CF6E 3PVBB 2B9UA 2CAUA 2ATFA 1VJ2A 4BHPA 1L3JA 2IXIA 4AVAA 3EBRA 4XF9A 2OA2A 5D1IA 4XFAA 4IEWA 4XF4A 3EQEA 2OZ6A 2XKOA 3IBMA 4FAHA 3PLQA 1Q43A 4IERA 1YWKA 4D7TA 3BALA 3SCHA 2OYZA 2Q0AA 4YRDA 5I8YA 3BU7A 3C3VA 1OI6A 4XFIA 1I5ZA 4K8FA 1CX4A 4LTAA 3O14A 4XFCA 1H1MA 5FLHA 1GQGA 4EWEA 1PMIA 2WFPA 4QXKA 5KHHA 4J1XA 4YSFA 2IC1A 1U12A 4I02A 4JV4A 4JTNA 2FQPA 2K0GA 3GYDA 1EPZA 3IDCB 5BUVA 4QM9A 1G6NA 4A2UA 4KU8A 3I7DA
chains in the Genus database with same CATH superfamily
2OQ6A 1IQDC 3WP3A 1D0HA 2F4LA 2WSVA 4LKDA 2JE7A 1D2QA 2ZHKA 3POBA 2JDMA 2BGOA 5FY7A 2DCYA 3K4AA 2WN3A 4JX0A 4D7SA 2NN8A 2WABA 4RL7A 3MDPA 2RHPA 1BJQA 1MEC3 2D98A 4EV0A 5FYZA 4W6WA 5JR2A 4Y1YA 5FPAA 4RN5A 1OSGA 4JRLA 4IQPA 4M4PA 4WBBA 1ENRA 1PHMA 3FLTA 3GALA 1VBA3 1RUF2 1UL9A 1NXMA 1MS3A 2BEOA 2CDPA 5GM0A 2ZEWA 4LUMA 4GH4C 3AMHA 3FE5A 1IGOA 1OKOA 1POV3 2O0OA 2ZEXA 4CDUA 4L0PA 4D8MA 1R091 2ZHLA 4XJ9A 3THCA 4X8PA 3KHCA 4FT8A 4PF5A 4E8CA 2HWD2 1GQHA 3I3QA 5JPNB 2FCVA 3IWZA 3I2IA 3W5NA 1APNA 4NR1A 2JDYA 2PHXA 3VBHC 1GR3A 4R52A 4EROA 1OLQA 2JDUA 3UGHA 1ND3C 2Y6KA 4W6YA 5DAQA 4JKKA 3FC0A 4YW4A 4LULA 5FP4A 2DFCA 4PIZA 4Q1PA 1GZTA 1A78A 1W2UA 1XE7A 3U0ZA 1DDLA 1YIPA 3BIEA 1JXNA 3SMHA 1CQ9A 1XQNA 2PHFA 4ET7A 4GMP3 2VZUA 4O61A 1C8M1 4V2WA 1AX2A 5DG2A 4CP9B 2EVXA 3I2FA 1AR83 1LR5A 2UWAA 5E88A 3D0SA 4AR2A 5CFDC 4NOTA 5EYYA 4HZFA 2WQZC 4Q4W1 4AXOA 2WS93 4XHBA 2P17A 1O5UA 3ZVXA 5FPUA 1V6OA 3J7LA 4OZOA 4YW7A 2FHRA 1FT9A 1DG6A 1UIJA 1US2A 3PTRB 1DGLA 2DCKA 3PVOA 3T1MA 3UGGA 2GALA 3OPTA 4JAAA 3WF1A 4D6SA 2C9KA 4MOAA 2ZKLA 1UCXA 1QH6A 2VZRA 5A33B 4D69A 1AL0G 3F95A 3S0MA 4FFHA 2X09A 1AYM1 3OGVA 1J3RA 3OY8B 1UZYA 1PVC3 4LKSA 1NG0A 3C7FA 3DV8A 3SHRA 2W94A 1QXPA 1FOD1 3NV1A 4GWJA 4XPVA 1D4M1 1GUIA 1LTEA 4ZONA 5FY4A 1WCUA 1AL23 3K4ZA 1ZNPA 4YW1A 3ST7A 1NZCA 3WHUA 5IVJA 1W90A 4P5YA 3ZYGA 2VU9A 3NNJA 4SLIA 5FTTC 4BLIA 1ST8A 1W39A 2QQKA 4RYDA 3LEGA 1DHKB 5K7PA 1NCQA 2CDOA 3ETQA 1PGW2 2TEPA 3ETPA 4K1YA 2DTYA 1RVF3 1W9TA 4AGGA 4K20A 3MHZA 3D0JA 4AEKA 4AAXA 1VLNA 1OQDA 3DN7A 4XETA 3PUHA 2ZGTA 5IVVA 4IE5A 1PNGA 4HKWA 5DZEA 4E2GA 5JZGB 4JDMA 4AVBA 1C3HA 4N9IA 2A3YA 3WDWA 5LRSA 1LGCA 2VECA 1CAXA 2HLEA 1W03A 3AYDA 3H3UA 3T2TA 1I6XA 1JU3A 1O91A 1RIRA 2PHDA 2DVDA 3VDDA 4F3JA 5LY1A 3N7KA 3MZHA 1POV1 1CX1A 2VUAA 2RE9A 5I91A 5A1AA 2XB6C 4HONA 3VLBB 2V4AA 3HJRA 1H8TA 3J8F2 4XE9A 1JOBA 2W0XA 3S7IA 3WNPA 3MV01 2IVJA 4L97A 3IDEA 4OUSA 4HVRA 4MGYE 1H8VA 3HBZA 5ANQA 1LECA 1PGW1 5JSPA 1LOAA 2EAKA 4UFLA 2VZQA 1QGLA 5FYCA 1RMU2 2V5YA 4KNCA 2BTVC 3Q9OA 2ZX3A 2OKXA 4OI0A 1UIKA 3KCCA 2XGXA 1FATA 4AVCA 1WCSA 1TMF2 3NNFA 1F35A 2VZSA 5L7OA 5GLTA 3MF6A 4IV3C 1W28A 2XBO3 1LOFA 1L7LA 1HDKA 2ZGRA 3KGZA 3VZOA 3OPWA 4GWNA 1VRH3 5CYYA 5IFTA 2OPKA 4NAMA 2VCMA 2W1QA 3FBYA 1B09A 4CEWC 5C3SA 4DUVA 5BNPB 4Z2WA 3PHMA 4JGZB 4EJRA 1JN2P 3RZKA 1MS0A 4RD7A 2DU0A 1D4VB 4RR3A 4GMP0 4CXWA 1ND2B 2I74A 3HIFA 4QM8A 2WFF1 4WVMB 3ZLIA 4I0BA 1CZSA 1WW7A 2XJVA 4RSUA 5T52A 3RFRA 1US3A 4LBJA 4P9LA 3T2OA 1IS4A 4FPFA 2KXLA 4CU8A 3P1IA 2ZAAA 2HWB3 1RUD1 3CU7A 1ULCA 2QZ3A 4OI2A 2FDJA 3UYJA 4G9SB 5F3GA 1CIYA 4XW3A 5CNAA 5CB7A 1BVP1 2X05A 1W8HA 4E2QA 4OFGA 1K5MC 3MW2A 5JXGA 3FBMA 1RUNA 3ELNA 1UY2A 3PU8A 2XH6A 4HK8A 3THDA 4COWA 3RZHA 3KCXA 4DEVA 1RVF1 1BXHA 4Y24A 1PNFA 4LIVA 2ZAHA 5C8CB 1QEXA 3NKTA 4XILA 1UZ0A 1UY4A 1C28A 1GFF2 4CE8A 3H50A 1GLHA 2LS6A 2RV9A 4M00A 5JXIA 3HNBM 5IWFA 5KC6A 4BK5A 2D40A 5FXXA 2B7YA 1HV0A 1HB1A 5A3WA 1QHDA 4B1LA 4AQ6A 4W4ZA 1GWKA 3WQ0A 2GNBA 4Y1UA 1HRV1 2A1XA 4E4ZA 1HRI1 3FLRA 1UU4A 4FQ4A 5J36A 5FAXA 5FYBA 4YW3A 1EAH3 1HB2A 2A73B 4LO5B 4MHUA 2JE8A 1O4TA 5FZ3A 1O3SA 5C9AC 5IVCA 2BWAA 1VP6A 1PO12 2ARBA 3MGUA 2FD8A 1HRI2 2W9XA 1ZRFA 2PHWA 5FYMA 1FV2A 2ES3A 1CAUB 4YG3A 1JZ4A 1OA2A 3VB9A 1RUF1 2XJPA 2ZX1A 1CAUA 4XC9A 1SLBA 5CG9A 4KWLA 4TYSA 1S0IA 1V6MA 1V00A 4MGZE 1K45A 2ZOEB 3L9JT 4A42A 1ASJ1 1ZZ6A 4QPGB 3S6PA 4R9BA 2A6YA 3U10A 3NVCA 2NYYA 1DQ5A 1EAH2 4LKEA 2HBTA 2PLV3 3LFMA 1FXZA 1PZ8A 2Q1ZB 2RM23 3NRUA 3ZKYA 2BNOA 4CEYB 3V0AA 5K0UC 2VMDA 4S2FA 4YW2A 1FOD3 1RITA 3J4UH 4LBLA 2I45A 2P37A 1TME2 5C70A 4B4QA 2WNOA 5LW9A 1CJDA 1VBD1 1Y7BA 1J3PA 1ZM1A 5FZ0A 3KSCA 5T5PA 3W9AA 3SXWA 4AEDC 4LLOA 4K40A 2Y0IA 2ORZA 4QGLA 5T3NA 4GXLA 3HD8B 1X9TA 1O3RA 4IEUA 4AFMA 1H2MA 2PAKA 5J7MA 4LXLA 1FOD2 5SV8A 5F5CA 1Z78A 4NRPA 2HWB1 5KHGA 1WLTA 3ZFFA 4XUTA 1KGYA 4Q4W3 4P08A 3JUUA 4CCEA 1W05A 1W2TA 5FZOB 1AZDA 4XABA 1XXNA 3VKOA 1NQJA 2VMGA 2CGPA 2YPDA 2G9ZA 1UOJA 3HNYM 3BTXA 4QKNA 4CCDA 1XRUA 1FNYA 4MO3M 1CGPA 5LBBA 5ISLA 1EP0A 3UJQA 5A3OA 2HKXA 3N9PA 1T6GC 4L9BA 1JZ3A 4Y33A 1GNYA 2Y38A 1S4CA 4ZS3A 5GLZA 2ZX4A 3JB8A 1PZ7A 5I0TA 1WD4A 2RJLA 1SHWB 5FYTA 4HLTA 2I07B 4TXWA 4CCMA 4JCKA 1W6MB 2F4PA 1S0CA 5IT6A 4KMQA 1U5YA 3U14A 4LKFA 5A7WB 4LO8A 2JG8C 3M2MA 4QB1A 5T50A 3RZGA 2VTXA 3WG2A 1DLLA 4N43B 1H9PA 3KF3A 2R32A 3VBOC 5GZGA 4XF0A 2VNRA 2JIJA 4YM3A 3LIHA 3SH4A 4CP9A 2P2KA 2VMFA 5KR7A 5LEKA 1R083 5CFCB 2PAEA 3WR0A 1DGWA 2C24A 3T30A 3WNLA 5CFCC 3VBUA 2Y33A 3KV5A 4WZFA 4XTPA 5GZDA 4AEDB 4BJ0A 2NLRA 2Y6LA 5D8AB 1O3QA 2P1BA 4FOQA 3MLLA 5LATA 3I59A 3KLSA 4L11A 3WNKA 1J58A 2CU5A 4K7JA 1XNDA 1RL3A 5HCFA 1UX6A 3LD8A 3MIEA 3BU0A 1FMD2 3DXUA 3OGSA 1OVPA 4COUA 1GICA 5A3MA 2GC3A 2W2IA 2R0HA 2WZ8A 1TG7A 4LIUA 4PCRA 2YBKA 3TB0A 3UKVA 1AR72 2FDIA 1OH4A 1WLCA 2ZGNA 1SFPA 4D6QA 4QDQA 4OULA 2DV9A 1V6IA 4YFWA 2R1BA 1IKQA 2VZ1A 3LKJA 3HBKA 4BQ4A 5JXJA 1O8PA 3ZSKA 2X8KA 3OCPA 4Q8KA 1NLSA 2OS2A 3KT1A 4N7UA 4AHYA 4N43C 2HWE1 2UY9A 1R081 2RVAA 2Y6JA 4MYEA 4AVTA 2D43A 3RVHA 4K9SA 2YGMA 2UYAA 4Z1VA 1MZ6A 1PZ9A 5FKBA 3LSEA 3OUHA 3WDYA 4DIQA 1Z7S1 5EIYB 4YG6A 1JUHA 1BBT1 4MGTA 1ASJ3 1W0PA 1OT5A 1AR63 4UW4A 1VBC3 3DXTA 1AYN1 2X10A 3I8TA 4J25A 1CVNA 1DYOA 4LBMA 4QX2A 3IPVA 1IHMA 3NQHA 4MLOA 4A44A 5J3UA 4Y26A 3POIA 2VZVA 3I3EA 1NQDA 1W6PA 3DPRA 4HN0A 1ZZBA 2VQ0A 2PMWB 2XLGA 5JUVA 4QQ2A 2O1QA 1W3VA 2WO1A 3VD4A 2D5HA 1LU2A 2DBIA 3IT8A 2XOMA 2RR12 3T4VA 2ETEA 1COV3 1MS9A 2WT0A 2LW8A 3Q8AA 3ACIA 2W95A 1J1LA 1RUJ3 2WNUC 3D3AA 4Q5OA 3AP5A 1QU0A 4J1WA 3WUDA 2XLAA 3LQCA 2W1UA 5FZ6A 4HKOA 3FN9A 4QHOA 3RI9A 4AW7A 3DF0A 4BMEA 3RWNA 4KGGA 4GQ7A 3F2ZA 3SH3A 2GSYA 1KS5A 5C8CC 2KA3A 3TEZA 4Y4RA 5HXMA 1RUOA 3LA7A 4F83A 2WKKA 5F32A 1YFYA 1AXKA 1HXS1 3C8XA 4CP2A 4XF1A 5JR7B 5AVAA 1SDDB 5LRRA 5JPMB 3OUJA 3OTFA 1ZVFA 5FK8A 5FPVA 2ZCWA 1C4RA 3B02A 2XWBB 4G4FA 4LO7A 3CDZB 1RUH2 4M4RA 3LWCA 4KWKA 1RHI3 1W9WA 5ACA2 5BNPA 4Q26A 2WNVB 3FFQA 2IXHA 4EWAA 4NJ4A 1ENQA 5JMCA 2B9UA 4Y20B 4P9XA 1HIXA 5IVYA 3I97A 1KD7A 2DURA 1AYN2 1FMD1 4Y20A 4CUBA 4P5HA 5FY5A 5FRAA 5BNPC 1UZVA 1WA6X 2JX9A 1KXGA 5LK7B 3T1LA 4ASMB 1QQP1 3S30A 4BLJA 3N9QA 5DZFA 1CPMA 2J1UA 4PLNA 4A7ZA 4CVUA 3EBRA 5H9RA 2HWF2 2VULA 2OA2A 2YYOA 2E32A 1YQ2A 4XF4A 2ZGMA 3VZNA 4NHKA 1VAMA 2ZACA 2P34A 5C33A 3ZSLA 5CG8A 3IBMA 5FXVA 5FWJA 3QBQA 2LUWA 1Q43A 1UMIA 4IERA 5BNQA 3BALA 3SCHA 1N1VA 4CEWA 3ZSMA 2Q0AA 4A45A 2E33A 1UAIA 2K2SA 2W39A 4G3YC 2CGOA 4M0HA 1I5ZA 3ZDVA 5A3LA 3NKGA 4AI0A 1CX4A 3O14A 2NM1A 3WVJA 1UOGA 3TYJA 3BPSA 3UGFA 1PMIA 1PGL1 3M3EA 4CUCA 2D6MA 4J1XA 5EPAA 4YSFA 2VUDA 2EF6A 3QLQA 1F31A 3IMMA 4JV4A 4RGAA 5L9RA 4BK4A 4BM8A 1O8SA 1Z7S2 2DFBA 2WLPA 4RGKA 2LM3A 4QM9A 4CDQB 1XE0A 3UJOA 1VBB3 3S5AA 1G6NA 4KU8A 3I7DA 2WIIB 4ZPIA 2WWSA 2XLFA 4MUVA 4Y3OA 5FV3A 3ZYRA 4IV1B 4IV3B 4P9WA 4UW6A 4DPNA 2ZBJA 1XNCA 4XUPA 1JZ5A 1BHGA 3QD6A 4NO4A 3WP4A 2Y6HA 3USUA 1JU4A 2JG9C 4P9GA 2IXLA 2HWC1 3CZJA 3ZFEC 3WXPA 4XQWA 1WCKA 1UF2C 1F15A 4OUEA 3ZYJB 1W6OA 3ZFEA 1N1TA 2VMEA 1LODA 5CFCA 4NN0A 5G04L 2VOWA 3KT7A 1A3KA 1UMZA 3ZN6B 4JTOA 3ZXGA 5KHKA 4E8DA 1LESA 4QB2A 1WMEA 1OXCA 1OLMA 3AP7A 3A21A 3I59B 3PUIA 1HN1A 2C5DA 3TOJA 1OF4A 4LT5A 2V72A 4R8HA 1JZ6A 3CL1A 4R4XA 3OEAA 4FPYA 2F17A 4I0AA 1UW8A 3K77A 3AMNA 2VMCA 3A7QA 3VGIA 2AREA 4HANA 4OQ8A 1NYWA 5F3CA 2F6BA 3KMHA 1LJ7A 3WV6A 1PGL2 2ILMA 2ZEZA 4DRRA 1SPPA 4N53A 3UT0A 3O1PA 4KBZA 1VBD3 1E5HA 4LK7A 5K8SA 5DUVA 1XYPA 2HYXA 4SBVA 2B4KA 1C1FA 3N9LA 1NUKA 3ITQA 4K8RB 2R49A 3O12A 5FZBA 4FPCA 4LBOA 1KJLA 3RI8A 1AL21 4XAEA 4K21A 1YFUA 5AVPA 3ZKUA 4AQTA 3PUSA 2IXCA 1COV1 5L9BA 3O1TA 1K5JA 3EYPA 5C5TA 1Q3EA 2G19A 3E6BA 3HOBA 5BNNB 5A7OA 3KQ4B 3NWKA 4BE3A 3AZWA 3WOGA 1ULEA 1GOFA 2VUJA 5EJ3A 4XFGA 2JB4A 1AHSA 2J1SA 5T5JA 1ND2A 4WVMA 2GMMA 2VVDA 4COZA 1LHWA 5I0RA 3KV9A 4LOTA 4FOYA 2W68A 4DQAA 3IKWA 5D8AC 2GC1A 2Q8OA 3RS6A 2GH8A 5G05L 5FR3A 3KS7A 5F1RA 3H3ZA 2RM22 4MV2A 4FPGA 3WW1A 4AK3A 5JI9A 5HV4A 2G1MA 1XYNA 3B01A 3LDKA 4I3PA 3AK0A 1TQ5A 3I3DA 4B4RA 4FP2A 2RS13 3NV4A 3B9IA 3CZUA 3O1SA 3KCYA 3WP6A 1JS9A 2ZMKA 1YEWA 2VM9A 2WWJA 1GZWB 1HXS2 1KITA 4RS5C 1F9KA 1W06A 1YCIA 3ZXDA 1GANA 1C8M3 4OHVA 3HWJA 3TN93 4IEOA 1RMU3 2JDAA 4Q27A 1NA1C 2QQJA 1Y9GA 3IM0A 5GZFA 3VBSB 1HV1A 2VMHA 3ACFA 1JTZX 5FZ9A 4BZ4A 2NMNA 2D3PA 2ZHMA 1B35A 4OHXA 1M4WA 3K75B 1S55A 1X9PA 4A7KA 5JCTA 4BCUA 2BPA2 4JZRA 3BPZA 3R6SA 4QU2A 2EXKA 2Y6FA 1HXS3 2V73A 1HRV2 2ID4A 1EUUA 5L19A 2VNOA 1S2BA 5L7OB 1KQRA 5FMDA 4YFZA 4E2SA 4YARA 3SITA 2V09A 1N3PA 2QJVA 2EIBA 4XDQA 3CBNA 5ACA1 1OOPA 1FX5A 1OMIA 1RGSA 1NXD1 4JHTA 1H8TC 4XBQA 5A80A 2XPJA 1ASJ2 3NJVA 4LMFA 5JZGC 5CADA 4IDZA 1NX9A 4BMBA 2H0BA 4JGZA 4QPGA 3LF7A 3VBUC 2QBXA 3AFGA 1HRV3 1SMVA 2C4XA 2WR9A 3BTZA 4XBNA 3KF5A 3W59A 2BJSA 2MPFA 2BGPA 3AMQA 1V9U1 2OX0A 4YZ2A 5C7GA 2MHFA 3RZZA 5FBZA 1WUVA 4JKLA 4RGGA 3VBHA 3JBG2 4WZCA 3VKMA 4AE2A 4DINB 4E27A 5BY5A 1CAWB 1LOFC 1ND3A 4I01A 2O14A 1DU3D 4WM8B 5FMBA 3RRDA 1H4GA 2VXJA 3POGA 2FDGA 4OCTA 2W08A 3VBOB 1K12A 1R082 2D3RA 5CISA 1RJ7A 5FYVA 4LHLA 3PURA 4CXXA 2IXJA 4JGYB 3T09A 1BBT3 4HG6B 1H2LA 2C6SA 1XPWA 2DUPA 1EY2A 2MEV3 4LBKA 4NROA 4RR3C 3ACGA 1MQTA 5TSWA 5KBFA 5CEHA 2RR11 5DUXA 3VN4A 5LASA 1G9FA 2ZPXA 4AWDA 4CCLA 2W52A 1SCRA 4AFCA 3P6BA 1W8FA 1I1EA 4HFSA 1VBA1 4GWIA 2WZPP 1NOVA 1LNSA 2CY6A 2FZ1A 4TLGA 4E4SA 4FBFA 2RMU2 2RS53 5JAXA 1GOHA 1YFXA 2VD7A 4K6BA 3WX5A 1SBFA 1HQNA 2D5FA 5FREA 1BEV1 2GC0A 5L73A 5JMOA 5FZIA 4R9CA 1NT0A 1H1AA 2D3SA 1RUC1 5F2WA 5E8AA 2E26A 1LEMA 4GKYA 2RS52 1UYXA 3LEKA 4PT6A 5F37A 1W9FA 3FHAA 4CCKA 4BQXA 2WT1A 3H1YA 2P5BA 5KC5A 3POSA 5CZKA 1WCDJ 5B4XA 1RUG1 1TNRA 1YUDA 4LO4B 1UY3A 1JOJA 1ONAA 5C9AA 4OHYA 1QDOA 4A41A 2FZ2A 2DBNA 3RJRA 1DIWA 3U37A 2DCTA 3NAPC 2JWPA 2NZ9A 4P9JA 4DXZA 1QWRA 1EPWA 1W8NA 3RWKX 3H7JA 1IOAA 4OQ9A 1SEFA 1OVSA 1X50A 1ZRDA 3CJXA 3OYWA 2YU2A 3NNLA 3M7AA 5I8TA 2QQVA 2RDRA 3VDDC 3LPGA 5IFPA 5IW0A 2A7AA 3OGGA 5IYYA 2YU1A 4NIGA 3KZ4C 1QIQA 5FBJA 2JDHA 4GD4A 4CDXC 5AC93 1RUE1 2IZWA 3ZXEA 2VVEA 3EO6A 1PK6C 4KGQA 3L2YA 2VO5A 4GMP1 3SISA 4AGRA 1UYYA 4XIOA 1CONA 1YQ6A 3KD4A 1DQ4A 2VOXA 1KDKA 4PBPA 4ES9A 3PTYA 1STMA 5GALA 4AFBA 4AHZA 5FZ4A 2WINB 3NV3A 3OD0A 3ASIA 1GP4A 1LOCA 3MIBA 4HT1T 4BDVB 4CXYA 2GMPA 3ILFA 2PHLA 3SC7X 3ZIXA 4A3ZA 2CNAA 2JD4A 1A8DA 4INDA 4OMDA 2DUQA 4IE4A 4AI2A 1ULDA 5FZFA 3CIHA 3IPVB 4JRAA 4GA9A 4AHWA 4M3CA 1NLQA 1OKQA 2EALA 1Q56A 1ZZ9A 3WNNA 4YWAA 3ZFEB 2WNVC 3ZYBA 1EAH1 3SEEA 2VZ3A 3KQRA 1XSRA 2HWD3 1JHJA 2R1DA 3OPZA 4R4ZA 3D4KA 5FZEA 4CPBD 1UXZA 4R9AA 1NCRA 1YI9A 3U4SA 1AR81 4TSVA 1DQ6A 3GBFA 4XJUA 1YQ8A 5A7QA 1LOGA 4ISQA 2V5DA 3TBDA 4YGDA 2W92A 2BDRA 2JD9A 4NRQA 4CU6A 2HJIA 4Q29A 1MZFA 2A70A 1POQA 2BUKA 3NNGA 2MEV1 1ZRCA 1QNYA 4D3WA 3V0BB 2R6QA 1UOBA 2BFUL 2D6KA 5KXEA 1N1YA 5A7SA 2E7TA 2JG9A 3UL2A 1NLRA 2JECA 3NMBA 4QQOA 3AYAA 4YM2A 4CRQA 4DXSA 1AR82 2WAOA 2WJSA 3MO4A 4PBOA 3P3NA 5A3TA 4QT6A 3O0WA 1C5HA 3GHMA 3LFIA 4GH4A 4META 2CAVA 5FJKA 1QNWA 5F3EA 3LA3A 4EWDA 2CTVA 3POJA 1CAVB 3WNOA 5IVFA 1AR62 4XURA 1TE1B 3ZXFA 1SG3A 2FCTA 5FLIA 4QQPA 1YO8A 2R073 3VBHB 1QY4A 1FI2A 5FY0A 3CQOA 4WM8A 2XJQA 3WY6A 2Q4SA 3VZJA 3VKNA 4AYUA 4CCCA 5LA2A 3E97A 4RFRB 3OF1A 5I8SA 1QJFA 4Z92B 1WMXA 4ISRA 2Z4FA 2WZR1 5DDJ2 1EV11 2ZS6B 3Q8BA 1T6BX 4B29A 4PQ9A 2HEWF 4ZXEA 2LALA 1I5PA 1VBB1 4MVTA 5IAVA 4FXGB 3GZTB 2R072 4L2NA 1AVBA 4CDQC 1N1SA 2B5HA 3DCQA 1TEIA 4MSVA 3ZFFB 1WW4A 1RUE2 1OHFA 3AKPA 1MS8A 2IFRA 3HN3A 4LO6B 1RVF2 5C6CA 5FZOA 1XNAA 2OPWA 3TAYA 3V64A 1RC6A 1F8VA 5T5OA 2WSUA 3VBSA 1IPJA 1AX0A 3ES4A 4XMAA 2WAAA 3AYEA 4XQ4A 4CDUB 2RS33 4EYUA 4C91A 1ZREA 2RDQA 4QX8A 3VBSC 3WD5A 5HI0A 1WLWA 1C57A 3AKRA 1GWLA 5JLVA 1KDMA 1DCSA 3GNEA 3HQRA 4UW5A 3N7JA 5FUPA 3VBRB 1X33A 1W8ZA 2G9GA 1GP6A 4ZZ8A 5LA0A 2BP6A 3NW4A 1VMFA 4UFMA 4XDPA 3O1OA 2IVIB 4LBQD 2GDFA 3ZFGA 1AR91 3QOPA 1AYM2 5H9SA 4FI9A 3SKVA 4BIFA 5JSOA 3UNPA 1TMF1 3B00A 1YJKA 3NJYA 4JGYC 4B7EA 1DF0A 5LA9A 2O8QA 2GN7A 4Y5Z0 1DYPA 1DZQA 2QDRA 1XJAA 1V6LA 4CPBA 5LK5A 1DFQA 1WMDA 3MW3A 2CHHA 2VOKA 3ZN6A 2RMU1 3ACHA 5F5AA 5FZ7A 5CFDB 3KM5A 5JIAA 4Z2AA 4UOJA 1VAVA 3OYWB 5A3NA 2BNMA 1LEDA 1E5IA 2QE3A 4YZ1A 4CUAA 4PHZA 4NPMA 4Q1RA 4IGOA 2B8MA 1C8M2 4PDWB 1I9RA 2DF7A 1DZRA 3ACLA 4P14A 5EXOA 5DPNA 3VBOA 3O0XA 4CDXA 2PN5A 2VBDA 2XVLA 1JYIA 1Y3TA 2QVSB 3WDVA 4CEWB 1GU3A 4NVPA 1TZOA 2VTXJ 1LHOA 1S2EA 1WLDA 1W2AX 2D6LX 2XONA 1WD3A 1SQ4A 2E7AA 4C8DA 3RQ0A 1QJX1 1VBE1 1MVEA 1Z7S3 1D2SA 1ALYA 1EYBA 1VBB2 2ADEA 1Q8OA 3MBWA 3OBRA 3ZM8A 5E16A 4GZ9A 4BQWA 1JYWA 4EN0A 4QX7A 3EXUA 3VD7A 3MFCA 1VALA 3CF6E 3PVBB 4YVWA 3UETA 2JEMA 2XUEA 3S5QA 4IUGA 1H9WA 3I49A 2TUNA 2QKDA 2W47A 2RR13 5DAPA 4Y22A 2IXIA 1Q8SA 4IV3A 1W9SA 2YB7A 3ORJA 4AVAA 3B5LB 4IL7A 3BI3A 5D1IA 1EV13 1N3OA 2ZMNA 4XCBA 2PQSA 2CL2A 2D6NA 4L8QA 4WM7B 5LB6A 2VNGA 5IJRA 3D5OA 2FMDA 1IKPA 2XJTA 1QJU1 3A0NA 3KWVA 5FO7B 2AH2A 2BERA 2QQIA 4W8JA 5DABA 5C4WA 2OYZA 1QKQA 2A6VA 4DNYA 4YRDA 3PIGA 2W5FA 5A6YA 5I8YA 3O0VA 5FUIA 3MIGA 4XFIA 2OIIA 2XR4A 4K8FA 4MXWB 3MLKA 1BLZA 3R4UA 1EV12 1N47A 1H1MA 1RJ8A 5C4WC 5CBLA 2R16A 2BBVA 2WFPA 2DYCA 5FOJB 5A3UA 1U12A 4DMIA 4FPOB 1PO23 1QQP2 1VBD2 2FQPA 3HAGA 2JG9B 3PMSA 5J98B 3WQ1A 3NNMA 4AEJA 4B7KA 4NIDA 2AUYA 2E53A 3IDCB 1UPSA 1BMV2 4ASLA 5C71A 3AP6A 3WCRA 3WG3A 2VQAA 1DQ0A 3ZN5A 4O7XA 3E5XA 4BXSV 3HR9A 4AI3A 3POEA 2PTMA 2W1WA 3POFA 4CCJA 4BYYA 3JB4C 1F4AA 1BEV3 3UESA 4H2AA 2D6PA 2VUCA 3WQBA 4LORA 4ONUA 2X29A 3ZSEA 1PO22 1QQP3 4RHV2 2X5IB 1K42A 2LTNA 4QU1A 3EJKA 1VAKA 1FMD3 1JYNA 4TZDA 4DXTA 3MV11 1JMUB 2VE1A 4QPIA 4TWTA 1C5IA 2QQWA 4YZ3A 2HWD1 5F8PA 4FTBA 5ANNA 3N9OA 1OFSA 2FMYA 5FIXA 4ASKA 4H7LA 1MVQA 1YFWA 2CYFA 2QQLA 3I4IA 5IVEA 3RMYA 1BMV1 4KBBA 1G86A 4Z8BA 2XDVA 2GMEA 3RZLA 2GNMA 4HK9A 3R4SA 3SCFA 3FJSA 3AB0A 4AL9A 1V9U2 2QCSB 4IGPA 5HPOA 2QZ2A 5FWEA 2P3KA 3CEWA 3O1RA 3MIDA 4RA0A 3H8XA 3IB3A 3B94A 4C0BA 4PIXA 3OBTA 5FZAA 3VZKA 1XC6A 3QH6A 1LAJA 1W6QB 2W87A 2XVGA 4LR4A 5LZ6A 4GJZA 2UY8A 3R05A 1XNTA 4YM1A 1BCXA 1XYOA 2D97A 1F4HA 2J7MA 4IEZA 4N7IA 4HVQA 5KHIA 2J22A 1SBDA 1V9U3 3MYXA 5EJ1B 1CJPA 5IHRA 1JZ8A 2YDEA 1SLLA 2YC2A 1S2KA 2VVFA 2YBPA 2A6XA 3C2UA 3DUIA 3J7NA 3J7HA 3NAPB 1QOOA 4OVEA 4Q4V2 3UV9A 2WL1A 5F9TA 4FSJA 2TNFA 1UMHA 4IW3A 2YMZA 4BH9A 3VBRA 4YW6A 3RYPA 3DYPA 1QJX3 1VBE3 3VHOA 2AZ5A 3ZFGC 3WT3A 2EA7A 3K48A 4YM0A 3AJYA 3MPBA 1AL22 4CCNA 2R30A 3DKQA 4Y4YA 3D8CA 4JVAA 1RUG2 2YPJA 4IV1A 1OOPB 1LHUA 1HQLA 4HETA 5DAWA 2A6ZA 1QDCA 2GZWA 2BVVA 3WG1A 2RJ2A 2W1SA 4LEJA 4EZ4A 3VDCA 2I2SA 5FDBA 2VXRA 5J09A 2RS31 3GBGA 3AKSA 5B2GB 3FHIB 1LGNA 4GALA 1W6OB 1S0GA 1LOBA 4HVOA 1OFNA 4Z82A 3M1HA 4ZY9A 4MZUA 1RUJ1 1K5MA 3RYKA 2OQ7A 1Z0HA 3AMPA 2NMOA 3ECQA 4GKXA 3DYMA 3TNPB 2XL9A 3ZO0B 3FUOA 2BGCA 4QHZA 4AHXA 3LA2A 3RZJA 2YC4A 4IE0A 1RUE3 4OYUA 5ABJC 4C1WA 5FYIA 1MR5A 5L9VA 2JKBA 1OD3A 1W99A 2YBSA 5EHDA 1QH7A 2GP3A 1ZX5A 2IXKA 1VBC1 2P3IA 2D44A 3AP4A 1O4ZA 2XKPA 2H6CA 3JZVA 3RYRA 4CSWA 5FPLA 3WZ1A 5FPXA 2VTFA 3JQXA 1ZA7A 5FLJA 3WINE 1RTVA 2RMU3 1UY1A 3I2GA 2XQXA 5HV0A 2JJ6A 4QKFA 4BQ5A 5FP8A 4DOUA 2C26A 3R4DB 1JYXA 4WM8C 1MS1A 4NIHA 1S0DA 2DDUA 3N36A 1ZRIA 2HBUA 1W04A 4KH9A 4BXFA 1NCQB 1ZBA2 4RFT0 4NMIA 2YG0A 4XAAA 5FYUA 1VRH2 4MXVA 3D82A 3GBWA 4E4HA 1AXZA 2RDSA 1AJKA 1Q8QA 4N53C 1HKDA 3RSJA 1G9BA 4URTA 2HEYF 2GNTA 1W8TA 1MQTC 4LHKA 4NHXA 4HBNA 4Q4V1 4UT5A 5JDBA 3SH5A 5A7WA 4YLZA 1WBFA 4I0WB 3ZPOA 2DUOA 1NKGA 2AGSA 3GJAA 3J8F3 4QGNA 3ZXJA 4DRVA 2WZR3 5HBAA 1QJY3 4Y1ZA 4NPLA 1R1A2 1NZIA 2ET1A 3B7MA 2WFF3 3NSTA 5DMYA 1YYNA 3FL7A 3CJIB 1AUYA 3VDBA 3ZMNA 4P02B 1GZCA 4HL0A 5EFUA 5SV5A 4YVSA 4Q4X1 2PQQA 4I2OA 4KG8A 2DWRA 1X82A 4AEDA 1YLLA 3I3BA 1PGSA 4FPEA 4CDWA 3QCWA 4L99A 4CDWB 1X36A 1QJY2 3I2KA 4FXKB 3KVAA 3OD4A 1GQPA 2VGDA 2UU8A 3BVCA 3OB8A 4YYOA 3THTA 2JENA 4HPKB 5C3QA 1JODA 1PM4A 2DCJA 2JIGA 2YUEA 5H9PA 2J1EA 2IWGB 5FCCA 3KV6A 4B3NA 5E6HA 1SLIA 3A23A 1XNKA 3RNSA 4H7MA 1QJEA 2YROA 2AC1A 4HN1A 4V1PA 5BNOB 1ZBE3 1OUXA 2A5ZA 2QQNA 3INAA 4OLLA 1F5JA 4FPHA 4RR3B 1NCQC 4GWMA 4JHZA 2Q1FA 4UFIA 1RB8G 1B35C 1O59A 3GXUA 3H8OA 4COVA 4YVWB 5FZKA 1U5XA 3K4DA 1DQ1A 1LENA 4NWVA 2OZJA 4O9GA 1LCLA 3AMMA 2N7GA 1XB9A 1XSQA 3IDBB 5E1RA 5KXCA 3LB9A 3JU9A 2ZGSA 1VE0A 1EUTA 3AX4A 4FP3A 5FXZA 2HWE2 3H8RA 2JG8A 2XQRA 1YJLA 1JUIA 2WC2A 4AI1A 3AJZA 1MPXA 2A71A 4X6RB 1DBNA 1HB3A 1Q8PA 2B46X 4QX1A 2B9VA 1RUI1 1W6PB 1U5IA 4ZU4A 3OOXA 4JGZC 4IXLA 5CKNA 2Z5WA 4GJYA 3OY8A 1PX3A 3QH7A 3I3MA 1RUI2 5JVVA 2DCZA 1H4HA 3GGLA 1CPNA 4H3WA 4Q8LA 4LA3A 4MXWA 5IK5A 1AR71 4FCAA 4HMZA 2WYFA 5E89A 5IAXA 4BQYA 2E63A 4FAGA 3BODA 2XJSA 1VIWB 4XJZA 1A8MA 1RMU1 3ES1A 3LEMA 3MW4A 2NPIA 2CWMA 4HOOA 4NHLA 3K51A 1MEC2 1CESA 4YNIA 4LK6A 5GKAC 1UKGA 5CKQA 3PVEA 4HSJA 5LCWL 3AFKA 4XZPA 3AZZA 4U36A 1UU6A 3WDTA 2UURA 3CNAA 2LROA 3LSDA 4XDOA 2PLV2 5F6KA 1SLCA 3FLPA 2BYVE 5FZHA 3TEYA 1UQXA 2QFEA 4DY3A 1OLRA 2JE9A 1F5FA 2V4VA 4OI4A 2PYTA 4QHBA 3USSA 2Q8EA 2YY1A 4XFHA 4CP0A 1NCRC 4QWNA 3VKFC 3SQOA 1GMMA 3BB6A 2X5IA 3AXEA 3RMXA 2VBPA 3U78A 4AVSA 1RXFA 4AGVA 3JD72 4J6GA 4ARXA 1WA4A 1VRBA 1JBCA 1KFUL 4IEPA 4DB5A 5I93A 1W2OA 4COYA 4XHXA 4ZHNA 4UAPA 1BQPA 1Y4WA 3MFAA 4QPWA 1UZZA 4XCAA 1REDA 4F7ZA 1QF3A 2BRTA 2B42B 2Z42A 2IFWA 4PI2A 3I2JA 4LITA 5BNOC 1ZBE1 1WWYA 1QOTA 3VL9A 4WV8A 4IEYA 5D2AA 2HWC3 4YG0A 1IS3A 1ZBA1 3VBUB 1RYYA 2UYBA 2ET7A 3DPRC 2PELA 2W91A 3RPQA 5D21A 1V6KA 1WZXA 3AM2A 1DQ2A 3JD73 1KFXL 1PMHX 3SNMA 1DLCA 5CA6A 3LZZA 4Q4V3 4LHSA 2BFUS 4PDWA 5A32A 1UWWA 3VHNA 4CDXB 2RS32 4LHNA 1GBGA 1C8NA 1YNAA 3JBG3 1QJX2 1VBE2 1ULGA 2FCUA 2KM2A 4FPJA 1PVXA 1QMJA 1O4YA 1SACA 2WO2A 4Y5SA 2ORXA 1GKBA 1RUG3 4IE7A 2VZOA 5LWBA 3E1F1 2Y6GA 2ZZQA 3MF9A 4AI8A 2BQPA 4N9HA 2WN2A 4ATFA 3S57A 1REFA 1ULPA 3HEIA 3LIGA 4B1MA 2ZTNA 1JH5A 4P9YA 1W8OA 4QXCA 5DDJ1 5FJHA 2ZGUA 5HCHA 1H2KA 1W6MA 3LOIA 4GAZA 4KQ7A 3G7DA 5FP7A 1LULA 2CGNA 4XXPA 2ZA9A 3X29B 5DAXA 2BOJA 1PX4A 1PIV3 2YFZA 2ZGOA 4GB33 4UFKA 2GP5A 4UXAA 5CIRA 2ZXQA 3TN92 4P9IA 3UK9A 3VD3A 3M3QA 5FOBB 3C7OA 5I0DA 4Q4Y3 5T54A 2P6HA 4WM7A 1UU5A 1YXWA 3MI8A 5F5QA 5FMOS 4CP1A 3DPRB 2FDKA 5M0TA 3ZN4A 1ENXA 1H2NA 1CN1A 2GN3A 3ZOIA 2FDFA 2YFUA 2QQOA 1X7NA 2BV4A 5A7PA 3WUCA 4EE2A 4KWJA 3ZFFC 2DU1A 4M3CE 4JDNA 3MPPG 1NY72 4LE4A 5D8AA 5FPBA 3WF2A 2VY0A 2CV6A 4CEYC 2J1RA 3THPA 1TME1 1DGWX 4FOWA 3N3HA 2RS11 3OUIA 1UYZA 1GSLA 3U4XA 4YGBA 3LEIA 1QJU3 3HQXA 4M3CF 3N4MA 3ZDSA 1RUJ2 3HNMA 4XFFA 2WUHA 1F2NA 3FFZA 2VH9A 5IUQA 2WDBA 3TRSB 4XMIA 4QDRA 1AR61 1JYCA 4AEMA 2XUMA 2ZEYA 3ATGA 2JKXA 5AFBA 2SBAA 3FWEA 1MACA 2YV8A 3VZMA 1QJU2 1FNZA 5FK7A 4AG4A 5DQ0A 1MS5A 5FMCA 1CAVA 1A34A 3T2QA 1W0NA 2ARAA 5FZLA 2WA4A 5EP9A 1BKZA 2QQMA 3AKQA 5JI7A 4KI5M 5ABJA 2UWCA 4QPIB 2WT2A 2JG8B 1PO11 1R1A3 1BBT2 3T0BA 4LBNA 4BB3A 4D0QA 1UOFA 2MEV2 4W6XA 3AZXA 3GF6A 1OOPC 5EJZB 5GLWA 3WCSA 3E5UA 3ZIWA 2YHJA 3O5SA 2RDNA 4AI9A 4XQDA 4C1XA 5BPXA 4BIOA 2PA7A 2EICA 2Z2SB 3PUAA 5J48A 1KEXA 1RUH1 5JOWA 3DKWA 3TEWA 3ZX7A 3VBFB 3M70A 3ZXAC 5F39A 3VBFA 4MG2A 1LRHA 4QX5A 3HQUA 1KRIA 2YXSA 2BU9A 4WVZA 2DVFA 1D7PM 3BOPA 2A3WA 4BA6A 2Z69A 1YRZA 2VCCA 2ZABA 1GWMA 1WW6A 2ATFA 3T4HB 3LDBA 4BHPA 4YZ5A 1KS4A 1POV0 2JDZA 4XJWA 1GV9A 2E31A 1W0OA 2VBBA 2WQ4A 2J1TA 2Q8DA 2FDHA 3GZEA 3ME2A 4RQPC 2X5IC 4IEWA 4CDQA 4CTEA 4H14A 3EQEA 4Q4X2 3JXSA 4K3UA 4U2AA 3W20A 1RUF3 2OZ6A 3DYOA 2XKOA 3H3LA 1WKYA 2WYSA 3OJBA 5A1FA 1GZ9A 4AZZA 4D7TA 4N43A 1AYN3 1R093 3P5BA 1ACCA 4QAWA 5EYXA 4BQ3A 5C5UA 1R1A1 2ZGQA 4NAOA 1W8UA 5EWSA 3BU7A 2AENA 3VZLA 2RS51 5J1XA 3C3VA 1XNBA 2R0FA 2XJUA 5FFOC 1OF3A 2Y60A 3M8LA 5IK4A 4QKDA 3WDUA 4FTEA 1J84A 5FLHA 1GQGA 1HX6A 1W6NA 4UFHA 2R043 5KHHA 1LOEA 1WBLA 4DXRA 4I02A 3RJ2X 2RJKA 1L7QA 2K0GA 2WNUA 2OW4A 5FP9A 2WLQA 2Y34A 5AC92 4A2UA 1IPSA 5K0UB 5A3PA 1NA1A 3AC0A 2L9LA 1H1IA 1NA1B 2WBKA 1WCQA 1IS6A 2VMIA 2VZTA 1S0FA 1W9YA 2E9QA 3AXDA 4K1ZA 1PIV1 4GB31 4LA2A 3M3IA 4NHYA 2LRPA 5FZGA 4D94A 2C0ZA 3NJZA 3NL1A 3PVNA 3CO2A 1SPPB 1V0AA 2BWCA 4FPLA 2ZX0A 2BVBA 1JOPA 4N53B 4YGEA 3UKTA 1V6JA 1ZRRA 4KU7A 2R071 3HT2A 4MADA 5C3RA 3D6EA 1RUC2 4D7YA 1ZZ7A 3NAPA 4I09A 2OUJA 4OHWA 5DAVA 4XEZA 4A7YA 2ZGLA 3AVRA 3APBA 4Q0UA 5IATA 2ENRA 2EXHA 1OA3A 1G8WA 3BTYA 3BKZA 4Q4W2 3WW2A 4CU7A 1PMJX 3IAQA 2B45X 4IEXA 4DO0A 3IAPA 4ZZ5A 2A6WA 1AXYA 5HCAA 3JBG1 3VD9A 2IUWA 4Q4Y1 4WM7C 3Q8CA 2P3JA 1D4M2 3I54A 4JC1A 3USUB 1PK6B 3WNMA 4CDUC 2DVAA 5GLVA 1H0BA 5JZGA 1O3TA 1PK6A 2E7QA 1SFYA 2ZJCA 5DXDA 2C9AA 5J96B 1LB2A 3U75A 4FFFA 3JD71 5DG1A 3FX3A 2ZKNA 3RZMA 1SLAA 2KD7A 4Q0PA 2R7EB 3VDDB 1QOSA 3KV4A 4NUBA 4QX3A 4UBHA 1GNZA 3PNAA 4FQZA 4YGCA 3DGTA 1HJFA 4AOCA 1FYUA 3C7HA 4NHMA 1GZWA 1D4M3 3ABZA 4PF1A 5EZWA 2NQYA 2JDPA 1HN0A 2VAUA 4MGQA 4QMAA 3SLIA 3GCWA 4PI0A 4BQ2A 1O5LA 5FPZA 3ZXKA 5FZDA 4RHV3 4B8EA 4QGMA 3EHKA 4ES8A 1JW6A 3IDAA 3A4UA 2ERFA 1H30A 1VMJA 4QKBA 5T5LA 1RUI3 4QQHA 1B35B 1VBA2 3Q8EA 1OBNA 1AX1A 2HH9A 2QNKA 5F5IA 1I3HA 5A6XA 4HPKA 3SKJE 3U1XA 4N8MA 4IGQA 2GC2A 1YHFA 1AR92 4I30A 1J83A 1TME3 4XJAA 1W3XA 1AJOA 2Q8CA 3WQ7A 2ARCA 1BK0A 1ODMA 1U5ZA 3IZOA 4UF0A 4V2VA 5BNOA 1NE4A 1WGPA 2Y64A 5LA1A 3BYWA 5F2SA 1UZWA 1SCSA 3WNXA 4JQTA 2AYHA 3VHPA 3H42B 5HXVA 1FPN1 2JXAA 4UBGA 1OUSA 3M4FA 2AEZA 2PXJA 5CVRA 1MS4A 3TNQA 1G9DA 2RS12 2G9FA 2WZR2 1LGBA 1VR3A 3BN6A 1AR93 3KVBA 5A6ZA 5FO9B 2P6CA 1SFNA 1Y9QA 5FY8A 2D6OX 3E6DA 4XJ8A 4DZGA 5A1LA 4H55A 5FZ8A 2WFF2 1DGRA 3FZ3A 3J9SA 3MIHA 3RGBA 3JCIA 2PHRA 4LNVA 3URFA 3CJIC 3PL0A 3VD5A 4OZXA 3M3OA 4LUKA 4YW5A 2AACA 4DS0A 2K46A 3G6JB 4WVWA 4Z07A 5FYYA 2EIGA 4PLMA 3CJIA 3M3CA 5C8CA 1W6QA 4QPIC 5LBFA 4RHV1 5JOXA 4XXAA 5F7UA 4FFIA 1OPMA 2XMLA 4MHRA 5FY9A 3GCXA 1UD1A 3P3PA 4EZHA 5JOYA 4O65A 1JZ7A 2AR6A 3AL5A 1BZWA 2E6VA 2YZ4A 4LJHA 3GHNA 2CWSA 3OBZA 3LOBA 3UKNA 3T0AA 2H0VA 4QPYA 2VL4A 1PVC2 1CD3G 1H6YA 2PAMA 2WO7A 2OUHA 3N35A 5FMOL 5JSRA 1XBFA 1P8JA 1PM7A 4XZUG 5LEJA 1COV2 4ITCA 4S2HA 3HPNA 2GU9A 4UI9L 1ULOA 3WHTA 5IK7A 1UYPA 2EXIA 5GLUA 3PIJA 1HQWA 4IEQA 2EAAA 3J7MA 3TEXA 1G7YA 2B39A 2Q30A 3AL6A 4FFGA 4A6SA 3WLUA 1IPKA 3OGJA 5LBEA 3AYCA 4CDWC 2PHUA 3FUQA 5KHJA 1ND2C 1OPOA 4UYBA 2FBEA 5GZEA 4CEYA 3V0AB 2TBVA 1V70A 4TLFA 2VQUA 1E57A 5K4LA 1K5MB 3HVDA 3CLPA 3VBRC 2VR4A 1ENSA 1RUD2 4BOWA 4RS5A 5FZCA 4Q4Y2 1ZA4A 1CAWA 3MLJA 2NP0A 4NIIA 2GH2A 1S1AA 4LLFA 1SLTA 5C9AB 2WA3A 5BNNC 1OQEA 4IV1C 5JXHA 1NY71 5IK8A 3ALQA 3BGAA 4ORFA 2VW1A 1C1LA 5ACA3 1WMFA 4FPKA 1SZBA 1UXXX 5A33A 3B9CA 1QXJA 3LE0A 4JGYA 4MGIE 3LCPA 1E5RA 3AVSA 1RUD3 2QQUA 2J1VA 3S7EA 3WDXA 3PUQA 4HKLA 2YGLA 3T08A 3VL8A 4AF9A 2EIDA 3N7MA 4UFJA 1QXRA 2ZGKA 3L2HA 5CAZA 2C1FA 4M01A 3O7OA 3E6CC 5A32B 1IZ3A 5BYNA 1E5SA 2UWBA 3BOWA 3RG0A 4BPZA 1DGRN 1REEA 4XUNA 1R1ZA 4OI1A 4Q4X3 3H0OA 4QD2A 1IQAA 4YZ4A 3WF3A 2PLV1 1DP0A 1UX7A 3EMRA 4AFAA 5AFEA 1YC61 1OD5A 4IETA 2VC9A 3WG4A 3K3NA 1LHNA 4FVVA 1DYKA 3KT4A 2W46A 4E9KA 3LDRA 1H6XA 1IS5A 4GULA 5GJ6A 2XWJB 5FUNA 5ERLA 4DEQA 3GM8A 3J8F1 3K2OA 2A75A 2MNGA 4Q0QA 3CKHA 3VBFC 1TNFA 2KR2A 3B93A 5A6QA 4QPGC 3MIFA 2DTWA 2QTWB 2VOVA 2O8OA 1CAXB 1QJZA 3GDBA 5A70A 5J37A 3MUY1 3LPFA 4ZKTB 3O1MA 2AEYA 3BUCA 1O7FA 3HT1A 4L92A 5C3PA 1OA4A 3AKTA 4OHZA 4HXCA 3E5QA 2PHTA 4IESA 4MGKE 3ROUA 2VPVA 3POYA 4AQ2A 3MICA 2VZPA 1OH3A 4M3CB 1H8TB 5FY1A 1HLCA 4PJYA 2Z79A 4LQRA 3WEZA 1W6NB 3H1MA 3BTAA 2PFWA 4YVSB 5AC91 1KJRA 4FOVA 3KB5A 3W5MA 1BEV2 3PJYA 2WWUA 3GZAA 1YQCA 4RQPA 3SEPA 5B4NA 2ARXA 3VUOA 1ZZCA 3KHBA 4RQPB 4KL1A 5K0UA 1RUC3 1RUH3 1UY0A 3J26N 1GNHA 1RHI2 2OT7A 2DVGA 1GYKA 3IIAA 3QACA 4S2GA 4XVHA 3ZMOA 1JI6A 3NJXA 1CIWA 3W21A 1CZVA 1XU2A 1U0AA 4DUXA 1LKNA 1XE8A 1Y9MA 5JWPA 2XXZA 1ODNA 3PU3A 4JDOA 5H9QA 3V0BA 4LBQA 1UPIA 3LGRA 4Y1VA 4LBQB 4QDSA 2H6BA 3BCWA 1RINA 3H8UA 1PO21 3WF0A 3H1WA 3H9AA 1RXGA 2WS91 3HMYA 3U11A 2GAUA 1YIFA 1HRI3 1Q5OA 3BIWE 1BVVA 4GH4B 1K3IA 4XACA 5BXXA 3W58A 4PLOA 1O6UA 4CYDA 3I2DA 3DL3A 2JB8A 3JQWA 2QUOA 1S0EA 2R061 2RM21 2ZMLA 2EIEA 2XG3A 4XF3A 3IMNA 5FQ0A 1MEC1 3ON7A 1DZTA 2HWF1 5FQ0B 1QJY1 3TWIA 5A7NA 4JQRA 1R092 1V6NA 2BNNA 3O1VA 4MH0E 2EXJA 2W3JA 1N3QA 4PDWC 3ZYIB 4LPLA 4O9EA 4CCOA 5CU1A 4XUQA 4LOSA 5FKCA 1ND3B 3O1UA 1J59A 1YQ5A 4XFBA 1ZYBA 4MX3A 2WO3A 2VJXA 4DY5A 4E4DX 3K46A 5I0UA 2HEVF 1LU1A 4FTSA 4AFDA 2WQ8A 3DECA 4PQQA 2R042 1NE6A 2J1AA 3K3OA 3NO8A 3PJQA 3I2OA 2OVUA 2Y8KA 2WS92 2BZDA 4A4AA 1MQTB 2Q1MA 3N9MA 4ZS2A 4EQVA 2HYKA 1ULFA 5DDJ3 3B3QE 1UN1A 4Q0SA 2ZGPA 2R041 4C90A 2R063 3ENRA 3ZYFA 4S2DA 1OURA 4B4PA 1URXA 4Y1XA 3WP5A 2J42A 5DUWA 3ILRA 4EN7B 2G4IA 4DUWA 1NAEA 3GZUC 5CKMA 5KWRA 1UO9A 4NE9A 4QXHA 4X6QB 5FO8B 1W8WA 4Q0VA 4FO9A 1FPN2 2VW0A 1G9CA 4XTMA 3T0DA 3A0KA 5FYHA 4ZXKA 3RDIA 1BYHA 1CZTA 1UKRA 3Q8FA 1Q8VA 4HSLA 4YVWC 3ZSJA 3EB7A 3POWA 2R062 4BU2A 4P00B 1VB4A 1HB4A 1X8EA 4NIAA 1WW5A 4MGSA 4AQSA 2D93A 2SLIA 1AF9A 2RG4A 4AAPA 3AZYA 3KGLA 3N7LA 3OGRA 4JKMA 4ZU7A 2Y26A 5KXDA 1GOGA 5L7OC 1FV3A 2VNVA 4LE3A 1A6CA 4UF0B 3OSDA 3C7EA 3FMGA 1S0JA 4KG0A 4GIQA 1FPN3 4BISA 4CUGA 5BV6A 3VKLA 1SDWA 5ABJB 2ZZJA 1D0GA 2OXBA 5DZGA 4QQLA 2VW2A 3R0RA 2VCBA 2P4EA 2BBAA 1FAYA 4XUOA 2WZEA 1XU1A 4IE6A 1XOYA 1JHNA 2YC0A 1HW5A 5EQUA 2XJRA 1RHI1 1AYM3 1IG0A 3A22A 1VRH1 2Y0OA 4D6RA 2WRAA 1VMHA 2XBO1 2P3YA 4XIKA 4CU9A 1HJGA 5CFDA 3SCGA 2WNUB 3CHXA 3OBAA 4R9DA 3ZXLA 1ZZ8A 2GNDA 1MZ5A 5FZ1A 4QB6A 4QXBA 1J1TA 5FYSA 1G9AA 3T2PA 3DEMA 5LY2A 3VV1A 4PIYA 3LAGA 2QDNA 3FHQA 1L7RA 1VPHA 1ZBA3 4CA9A 2XL7A 4UW3A 4F8AA 4W65A 4A3XA 4ZU5A 4NPRA 5KXBA 5IVBA 3OG2A 4TN7A 3I2HA 3IN9A 1OC1A 1PO13 4TTGA 1PIV2 2VQTA 2XHKA 3OEBA 1MZEA 2HWF3 4GB32 2ADDA 3ZR5A 4EN6B 4OUMA 5EV7A 3TN91 5LBCA 4ATEA 1JYTA 3NV2A 5GZCA 1AR73 1TMF3 3VHRA 2VOTA 4XYXA 3AZVA 3HN1A 3WW4A 2BW8A 3ILNA 4ARYA 2VG9A 2XBO2 3WF4A 4A6OA 4AVVA 1J3QA 4CZSA 3V56A 1JZ2A 1X8MA 2K9ZA 5T55A 1YI7A 4M0NA 4Y22B 3VDAA 4NWWA 1S0BA 3ZFGB 2A3XA 1TVGA 5HCBA 3B69A 1LHVA 5FXWA 1CR7A 5JIUA 3H7YA 4BWOA 4URAA 2JDNA 4UWDA 5F6LB 5APAA 4W50A 4XBLA 5I0SA 1VBC2 4EN8B 2JICA 5L36A 2HWB2 3CMGA 5C4WB 5C3OA 2JDKA 5FP3A 3WW3A 1W2NA 5C8WA 4RS5B 1NCRB 2X53S 2CAUA 3T3YA 1VJ2A 1PVC1 1T2XA 3ZYPA 1L3JA 2VCAA 3PDQA 3IIIA 1JYVA 2QQPA 1ZBE2 3GJBA 4KWUA 1M06G 4XF9A 4NRMA 4N90A 4WVVA 2XHNA 2CSGA 4XFAA 2E51A 2ZHNA 3N9NA 4EN9B 4X8NA 1SBEA 4FAHA 3PLQA 4Y5TA 1R64A 3MUZ1 1YWKA 4YVSC 4BQ1A 2HWC2 3AP9A 3WSOA 2WNEA 2BOIA 5F3IA 4YPJA 4C0HA 1Y43B 3V65A 3ZYHA 2HWE3 1OI6A 4OMCA 3MEPA 1CWPA 4XOGA 1GP5A 1UNBA 2ZX2A 4LTAA 4Q2FA 2XVKA 3PMEA 4I3GA 4XFCA 2DVBA 5FZMA 4DFSA 4EWEA 1OQ1A 5BNNA 3C7GA 4QX0A 4QXKA 1BK1A 2Q5TA 2WNVA 3ZR6A 2IC1A 3ZPYA 3U07A 4JTNA 3GYDA 1IG3A 1EPZA 5DUUA 5JOZA 5BUVA 5DN2A 1VB2A 5K9YA 4IEVA 1OLME 2D7FA
chains in the Genus database with same CATH topology
3WP3A 1D0HA 2WSVA 2JE7A 1D2QA 2ZHKA 2DCYA 4D7SA 2NN8A 4RL7A 3MDPA 2RHPA 1BJQA 1MEC3 2D98A 4EV0A 4W6WA 4Y1YA 1OSGA 4JRLA 4IQPA 4WBBA 1ENRA 1PHMA 3FLTA 3GALA 1VBA3 1RUF2 1UL9A 1NXMA 1MS3A 2BEOA 5GM0A 4LUMA 4GH4C 3AMHA 3FE5A 1IGOA 1POV3 2O0OA 4CDUA 1R091 2ZHLA 4XJ9A 4X8PA 4FT8A 4PF5A 2HWD2 1GQHA 5JPNB 3IWZA 1APNA 4NR1A 2PHXA 3VBHC 1GR3A 4R52A 4EROA 1OLQA 1ND3C 4W6YA 3FC0A 4YW4A 4LULA 2DFCA 4PIZA 4Q1PA 1DDLA 1A78A 1W2UA 1XE7A 3U0ZA 1YIPA 1JXNA 3SMHA 1CQ9A 1XQNA 2PHFA 4GMP3 1C8M1 5DG2A 1AX2A 2EVXA 1AR83 1LR5A 2UWAA 5E88A 3D0SA 5CFDC 4NOTA 5EYYA 4HZFA 2WQZC 4Q4W1 4AXOA 2WS93 4XHBA 2P17A 1O5UA 3ZVXA 1V6OA 2FHRA 1FT9A 1DG6A 1UIJA 1DGLA 2DCKA 3PVOA 3T1MA 2GALA 4JAAA 2ZKLA 1UCXA 1QH6A 5A33B 4D69A 1AL0G 3S0MA 1AYM1 1J3RA 3OY8B 1UZYA 1PVC3 1NG0A 3DV8A 3SHRA 1QXPA 1FOD1 3NV1A 4XPVA 1D4M1 1LTEA 3ST7A 1AL23 4YW1A 1ZNPA 1NZCA 3WHUA 3ZYGA 2VU9A 4SLIA 5FTTC 4BLIA 1W39A 1DHKB 5K7PA 1NCQA 3ETQA 1PGW2 2TEPA 4K1YA 2DTYA 1RVF3 4AGGA 4K20A 3D0JA 4AEKA 1VLNA 1OQDA 3DN7A 4XETA 2ZGTA 1PNGA 4HKWA 5DZEA 4E2GA 5JZGB 4JDMA 1C3HA 4N9IA 2A3YA 3WDWA 5LRSA 1LGCA 2VECA 1CAXA 3H3UA 3T2TA 3AYDA 1I6XA 1O91A 1RIRA 2PHDA 3VDDA 2DVDA 4F3JA 3N7KA 3MZHA 1POV1 2VUAA 2RE9A 5I91A 2XB6C 3VLBB 4XE9A 3J8F2 1H8TA 2W0XA 3S7IA 4L97A 3IDEA 4OUSA 4HVRA 4MGYE 1H8VA 3HBZA 1LECA 1PGW1 5JSPA 1LOAA 2EAKA 1QGLA 1RMU2 2V5YA 4KNCA 2BTVC 3Q9OA 2ZX3A 4OI0A 1UIKA 3KCCA 2XGXA 1FATA 4AVCA 1WCSA 1TMF2 5L7OA 5GLTA 3MF6A 4IV3C 2XBO3 1LOFA 1HDKA 2ZGRA 3KGZA 3VZOA 4GWNA 1VRH3 2OPKA 3FBYA 1B09A 4CEWC 5BNPB 4Z2WA 3PHMA 4JGZB 4EJRA 1JN2P 1MS0A 4RD7A 2DU0A 1D4VB 4RR3A 4GMP0 1ND2B 2I74A 3HIFA 4QM8A 2WFF1 4WVMB 4I0BA 1WW7A 2XJVA 4RSUA 5T52A 4LBJA 4P9LA 1IS4A 4FPFA 2KXLA 2ZAAA 2HWB3 1RUD1 3CU7A 1ULCA 2QZ3A 4OI2A 4G9SB 4XW3A 5CNAA 5CB7A 1BVP1 4E2QA 4OFGA 1K5MC 3MW2A 3FBMA 1RUNA 3ELNA 2XH6A 4HK8A 4COWA 3KCXA 1RVF1 1BXHA 4Y24A 1PNFA 5C8CB 2ZAHA 3NKTA 4XILA 1C28A 1GFF2 3H50A 1GLHA 4M00A 5KC6A 2D40A 1HV0A 2B7YA 1QHDA 4AQ6A 3WQ0A 2GNBA 4Y1UA 1HRV1 4E4ZA 1HRI1 3FLRA 1UU4A 4FQ4A 5J36A 5FAXA 4YW3A 1EAH3 2A73B 4LO5B 1O4TA 1O3SA 5C9AC 2BWAA 1VP6A 1PO12 2ARBA 3MGUA 1HRI2 1ZRFA 2PHWA 1FV2A 2ES3A 1CAUB 4YG3A 1OA2A 1RUF1 2XJPA 2ZX1A 1CAUA 1SLBA 5CG9A 4KWLA 4TYSA 1S0IA 1V6MA 1V00A 4MGZE 2ZOEB 3L9JT 1ASJ1 1ZZ6A 4QPGB 3S6PA 4R9BA 2A6YA 3U10A 3NVCA 2NYYA 1DQ5A 1EAH2 2PLV3 1FXZA 1PZ8A 2Q1ZB 2RM23 2BNOA 4CEYB 3V0AA 5K0UC 4S2FA 4YW2A 1FOD3 1RITA 3J4UH 4LBLA 2I45A 2P37A 1TME2 4B4QA 1CJDA 1VBD1 1Y7BA 1J3PA 1ZM1A 5T5PA 3KSCA 3W9AA 3SXWA 4AEDC 4LLOA 4K40A 2Y0IA 4QGLA 5T3NA 4GXLA 3HD8B 1O3RA 4IEUA 4AFMA 1H2MA 2PAKA 5J7MA 1FOD2 5SV8A 1Z78A 5KHGA 2HWB1 1WLTA 3ZFFA 4Q4W3 3JUUA 1AZDA 1XXNA 3VKOA 1NQJA 2VMGA 2CGPA 1CGPA 1XRUA 1FNYA 1EP0A 3UJQA 2HKXA 1T6GC 4L9BA 2Y38A 5GLZA 2ZX4A 3JB8A 1PZ7A 5I0TA 1WD4A 2RJLA 4HLTA 2I07B 4JCKA 1W6MB 2F4PA 1S0CA 5IT6A 1U5YA 4LO8A 2JG8C 3M2MA 5T50A 3WG2A 1DLLA 4N43B 1H9PA 2R32A 3VBOC 5GZGA 4XF0A 2VNRA 4YM3A 3SH4A 2P2KA 5LEKA 1R083 5CFCB 2PAEA 3WR0A 1DGWA 5CFCC 3VBUA 4AEDB 4WZFA 4XTPA 5GZDA 2NLRA 5D8AB 1O3QA 4FOQA 3MLLA 3I59A 3KLSA 4L11A 1J58A 4K7JA 1XNDA 1RL3A 5HCFA 1UX6A 3MIEA 1FMD2 4COUA 1GICA 5A3MA 2GC3A 2R0HA 4PCRA 3TB0A 3UKVA 1AR72 1WLCA 2ZGNA 4OULA 2DV9A 1V6IA 4YFWA 2R1BA 1IKQA 3LKJA 3ZSKA 2X8KA 3OCPA 4Q8KA 1NLSA 3KT1A 4N7UA 4AHYA 4N43C 2HWE1 2UY9A 1R081 4MYEA 4AVTA 2D43A 4K9SA 2YGMA 2UYAA 4Z1VA 1MZ6A 1PZ9A 3LSEA 3WDYA 1Z7S1 4YG6A 1JUHA 1BBT1 1ASJ3 1W0PA 1AR63 4UW4A 1VBC3 1AYN1 3I8TA 1CVNA 4LBMA 3IPVA 1IHMA 4MLOA 5J3UA 4Y26A 1NQDA 1W6PA 3DPRA 4HN0A 1ZZBA 2VQ0A 2XLGA 4QQ2A 2O1QA 2D5HA 1LU2A 3IT8A 2RR12 2ETEA 1COV3 1MS9A 2WT0A 1J1LA 1RUJ3 2WNUC 3AP5A 1QU0A 4J1WA 3WUDA 2XLAA 4HKOA 4AW7A 3RI9A 3DF0A 4BMEA 3RWNA 4KGGA 4GQ7A 3SH3A 2GSYA 1KS5A 5C8CC 2KA3A 1RUOA 3LA7A 4F83A 2WKKA 1YFYA 1AXKA 1HXS1 4CP2A 4XF1A 5JR7B 5LRRA 5JPMB 3OTFA 1ZVFA 2ZCWA 1C4RA 3B02A 2XWBB 4G4FA 4LO7A 1RUH2 3LWCA 4KWKA 1RHI3 5ACA2 5BNPA 4Q26A 2WNVB 3FFQA 2IXHA 4EWAA 1ENQA 5JMCA 2B9UA 4Y20B 4P9XA 1HIXA 1KD7A 2DURA 1AYN2 1FMD1 4Y20A 5BNPC 4P5HA 5LK7B 5FRAA 2JX9A 1KXGA 3T1LA 4ASMB 1QQP1 3S30A 4BLJA 5DZFA 1CPMA 4PLNA 4A7ZA 3EBRA 5H9RA 2HWF2 2VULA 2OA2A 2YYOA 4XF4A 3VZNA 2ZGMA 4NHKA 1VAMA 2ZACA 2P34A 5C33A 3ZSLA 5CG8A 3IBMA 3QBQA 1Q43A 2LUWA 4IERA 5BNQA 3BALA 3SCHA 1N1VA 4CEWA 3ZSMA 2Q0AA 1UAIA 2K2SA 2W39A 4G3YC 2CGOA 4M0HA 1I5ZA 5A3LA 3NKGA 4AI0A 1CX4A 3O14A 2NM1A 3WVJA 3TYJA 1PMIA 1PGL1 3M3EA 2D6MA 4J1XA 4YSFA 2EF6A 3QLQA 1F31A 4JV4A 4RGAA 4BM8A 1Z7S2 2WLPA 2DFBA 2LM3A 4QM9A 4CDQB 3UJOA 1VBB3 1G6NA 4KU8A 3I7DA 2WIIB 2WWSA 2XLFA 4MUVA 3ZYRA 4IV1B 4IV3B 4P9WA 4UW6A 4DPNA 2ZBJA 1XNCA 3QD6A 4NO4A 3WP4A 3USUA 3ZFEC 2JG9C 4P9GA 2IXLA 2HWC1 3WXPA 4XQWA 1WCKA 1UF2C 3ZYJB 1W6OA 3ZFEA 1N1TA 1LODA 5CFCA 4NN0A 2VOWA 3KT7A 1A3KA 1UMZA 3ZN6B 4JTOA 3ZXGA 5KHKA 1LESA 1WMEA 3I59B 3AP7A 2C5DA 3TOJA 4LT5A 4R8HA 3CL1A 4R4XA 4FPYA 4I0AA 1UW8A 3AMNA 3VGIA 2AREA 4HANA 1NYWA 2F6BA 3KMHA 1LJ7A 3WV6A 1PGL2 2ILMA 4DRRA 4N53A 1VBD3 5K8SA 5DUVA 1XYPA 4SBVA 1C1FA 2R49A 3O12A 4FPCA 4LBOA 1KJLA 3RI8A 1AL21 4AQTA 4K21A 1YFUA 5AVPA 2IXCA 1COV1 1Q3EA 3E6BA 5BNNB 3NWKA 4BE3A 3AZWA 3WOGA 1ULEA 2VUJA 5EJ3A 4XFGA 1AHSA 5T5JA 1ND2A 4WVMA 2GMMA 2VVDA 4COZA 1LHWA 5I0RA 4FOYA 2W68A 4DQAA 3IKWA 5D8AC 2GC1A 2Q8OA 3RS6A 2GH8A 3KS7A 5F1RA 3H3ZA 2RM22 4MV2A 4FPGA 3WW1A 4AK3A 5JI9A 4I3PA 1XYNA 3B01A 3AK0A 1TQ5A 4B4RA 4FP2A 2RS13 3NV4A 3B9IA 3KCYA 3WP6A 2ZMKA 1GZWB 1HXS2 1KITA 4RS5C 1F9KA 1YCIA 3ZXDA 1GANA 1C8M3 4OHVA 3HWJA 3TN93 4IEOA 1RMU3 4Q27A 1NA1C 3IM0A 5GZFA 3VBSB 1HV1A 2VMHA 1JTZX 4BZ4A 2NMNA 2D3PA 2ZHMA 1B35A 4OHXA 1M4WA 4A7KA 1S55A 5JCTA 4BCUA 2BPA2 3BPZA 3R6SA 4QU2A 2EXKA 1HXS3 2V73A 1HRV2 5L19A 2VNOA 1S2BA 5L7OB 1KQRA 4YFZA 4E2SA 4YARA 3SITA 2V09A 1N3PA 2QJVA 4XDQA 5ACA1 1OOPA 1FX5A 1OMIA 1RGSA 1NXD1 4XBQA 1H8TC 2XPJA 1ASJ2 5JZGC 5CADA 4BMBA 2H0BA 4JGZA 4QPGA 3VBUC 3AFGA 1HRV3 1SMVA 4XBNA 3W59A 2MPFA 3AMQA 1V9U1 4YZ2A 2MHFA 3RZZA 5FBZA 1WUVA 4RGGA 3VBHA 3JBG2 4WZCA 3VKMA 4AE2A 4DINB 4E27A 5BY5A 1CAWB 1LOFC 1ND3A 4I01A 4WM8B 1DU3D 3RRDA 1H4GA 2W08A 3VBOB 1R082 2D3RA 1RJ7A 4LHLA 2IXJA 4JGYB 1BBT3 1H2LA 2DUPA 4RR3C 1EY2A 2MEV3 4LBKA 5TSWA 1MQTA 5KBFA 2RR11 5DUXA 3VN4A 1G9FA 2ZPXA 4AWDA 2W52A 1SCRA 4AFCA 1I1EA 4HFSA 1VBA1 2WZPP 4E4SA 1NOVA 2CY6A 2FZ1A 4FBFA 2RMU2 2RS53 5JAXA 1YFXA 4K6BA 3WX5A 1SBFA 1HQNA 2D5FA 5FREA 1BEV1 2GC0A 5L73A 4R9CA 1H1AA 2D3SA 1RUC1 5E8AA 1LEMA 4GKYA 2RS52 2WT1A 3H1YA 5KC5A 3POSA 1WCDJ 1RUG1 1TNRA 1YUDA 4LO4B 1JOJA 1ONAA 5C9AA 4OHYA 1QDOA 2FZ2A 3RJRA 1DIWA 2DCTA 3NAPC 4DXZA 2NZ9A 4P9JA 1QWRA 1EPWA 3H7JA 1IOAA 1SEFA 1X50A 1ZRDA 3CJXA 3OYWA 3M7AA 5I8TA 3VDDC 2A7AA 3OGGA 3KZ4C 5AC93 4CDXC 1RUE1 2IZWA 3ZXEA 2VVEA 3EO6A 1PK6C 4KGQA 3L2YA 3SISA 4GMP1 4AGRA 4XIOA 1CONA 3KD4A 1DQ4A 2VOXA 1KDKA 4PBPA 4ES9A 3PTYA 5GALA 4AFBA 4AHZA 2WINB 3NV3A 3OD0A 3ASIA 1LOCA 3MIBA 4HT1T 2GMPA 3ILFA 2PHLA 3ZIXA 2CNAA 2JD4A 1A8DA 4INDA 2DUQA 4AI2A 1ULDA 3IPVB 4JRAA 4GA9A 4AHWA 4M3CA 1OKQA 2EALA 1Q56A 1ZZ9A 3ZFEB 2WNVC 1EAH1 3KQRA 2HWD3 2R1DA 3OPZA 4R4ZA 3D4KA 4R9AA 1NCRA 1YI9A 1AR81 4TSVA 1DQ6A 3GBFA 4XJUA 1LOGA 4ISQA 3TBDA 4YGDA 2HJIA 4Q29A 1MZFA 2A70A 2BUKA 2MEV1 1ZRCA 1QNYA 4D3WA 2R6QA 2BFUL 2D6KA 5KXEA 1N1YA 2E7TA 2JG9A 3UL2A 1NLRA 2JECA 4QQOA 3AYAA 4YM2A 4CRQA 1AR82 2WJSA 4PBOA 3P3NA 4QT6A 3O0WA 1C5HA 3GHMA 4GH4A 4META 2CAVA 1QNWA 3LA3A 4EWDA 2CTVA 1CAVB 1AR62 1TE1B 3ZXFA 5FLIA 4QQPA 1YO8A 2R073 3VBHB 1QY4A 1FI2A 4WM8A 2XJQA 3WY6A 2Q4SA 3VZJA 3VKNA 4AYUA 3E97A 3OF1A 5I8SA 4Z92B 4ISRA 2WZR1 5DDJ2 1EV11 2ZS6B 4B29A 4PQ9A 2HEWF 2LALA 4MVTA 1VBB1 4FXGB 3GZTB 2R072 4L2NA 1AVBA 4CDQC 1N1SA 2B5HA 4MSVA 1TEIA 3ZFFB 1WW4A 1RUE2 1OHFA 3AKPA 1MS8A 2IFRA 4LO6B 1RVF2 5C6CA 3TAYA 3V64A 1RC6A 1F8VA 5T5OA 2WSUA 3VBSA 1IPJA 1AX0A 3ES4A 4XMAA 3AYEA 4XQ4A 4CDUB 1ZREA 2RS33 4C91A 3VBSC 3WD5A 5HI0A 1WLWA 1C57A 3AKRA 5JLVA 1KDMA 3GNEA 4UW5A 3N7JA 3VBRB 1X33A 2G9GA 3NW4A 4LBQD 2GDFA 3ZFGA 1AR91 3QOPA 1AYM2 5H9SA 4BIFA 5JSOA 1TMF1 3B00A 1YJKA 4JGYC 4B7EA 1DF0A 2GN7A 2O8QA 4Y5Z0 1DYPA 1DZQA 2QDRA 1V6LA 5LK5A 1DFQA 1WMDA 3MW3A 2VOKA 3ZN6A 2RMU1 5CFDB 3KM5A 5JIAA 1VAVA 3OYWB 2BNMA 1LEDA 4YZ1A 2QE3A 4Q1RA 2B8MA 1C8M2 4PDWB 1I9RA 2DF7A 1DZRA 3ACLA 4P14A 5EXOA 3VBOA 4CDXA 3O0XA 1JYIA 2PN5A 2XVLA 1Y3TA 2QVSB 3WDVA 4CEWB 4NVPA 1LHOA 1WLDA 2D6LX 1WD3A 1SQ4A 2E7AA 3RQ0A 1QJX1 1VBE1 1MVEA 1Z7S3 1D2SA 1ALYA 1EYBA 1VBB2 3OBRA 1Q8OA 5E16A 4EN0A 3EXUA 3MFCA 1VALA 3CF6E 3PVBB 4YVWA 2JEMA 1H9WA 2TUNA 2QKDA 2RR13 4Y22A 2IXIA 1Q8SA 4IV3A 4AVAA 3B5LB 4IL7A 5D1IA 1EV13 1N3OA 2ZMNA 2CL2A 2D6NA 4L8QA 4WM7B 2VNGA 3D5OA 2FMDA 1IKPA 2XJTA 1QJU1 3A0NA 5FO7B 2AH2A 5C4WA 2OYZA 1QKQA 2A6VA 4DNYA 4YRDA 5I8YA 3O0VA 3MIGA 4XFIA 2OIIA 4K8FA 4MXWB 3MLKA 3R4UA 1EV12 1N47A 1H1MA 1RJ8A 5CBLA 2R16A 2BBVA 2WFPA 2DYCA 5FOJB 1U12A 4DMIA 4FPOB 1PO23 1QQP2 1VBD2 2FQPA 3HAGA 2JG9B 3PMSA 5J98B 3WQ1A 4AEJA 4B7KA 1BMV2 2AUYA 2E53A 3IDCB 1UPSA 4ASLA 3AP6A 3WCRA 3WG3A 2VQAA 1DQ0A 3ZN5A 3E5XA 3HR9A 4AI3A 2PTMA 4BYYA 3JB4C 1BEV3 2D6PA 4ONUA 2X29A 3ZSEA 1PO22 1QQP3 4RHV2 2X5IB 2LTNA 3EJKA 1VAKA 1FMD3 4TZDA 4QPIA 4TWTA 1C5IA 4YZ3A 2HWD1 4FTBA 1OFSA 2FMYA 4H7LA 1MVQA 1YFWA 2CYFA 3I4IA 1BMV1 3RMYA 4KBBA 1G86A 4Z8BA 2GMEA 2GNMA 4HK9A 3R4SA 3SCFA 3FJSA 3AB0A 1V9U2 2QCSB 2QZ2A 2P3KA 3CEWA 3MIDA 4RA0A 3B94A 4C0BA 4PIXA 3OBTA 3VZKA 3QH6A 1W6QB 2XVGA 4LR4A 2UY8A 3R05A 4YM1A 1BCXA 1XYOA 2D97A 4N7IA 4IEZA 4HVQA 5KHIA 1SBDA 1V9U3 3MYXA 1CJPA 2YDEA 1SLLA 1S2KA 2VVFA 3C2UA 2A6XA 3DUIA 3NAPB 1QOOA 4OVEA 4Q4V2 3UV9A 2WL1A 5F9TA 4FSJA 2TNFA 4BH9A 2YMZA 3VBRA 3RYPA 1QJX3 1VBE3 3VHOA 2AZ5A 3ZFGC 3WT3A 2EA7A 3K48A 4YM0A 3AJYA 3MPBA 1AL22 2R30A 4Y4YA 3D8CA 4JVAA 1RUG2 2YPJA 4IV1A 1OOPB 1LHUA 1HQLA 4HETA 2A6ZA 1QDCA 2GZWA 2BVVA 3WG1A 4LEJA 2I2SA 5FDBA 2VXRA 5J09A 2RS31 3GBGA 3AKSA 5B2GB 3FHIB 1LGNA 4GALA 1W6OB 1S0GA 1LOBA 4HVOA 1OFNA 4Z82A 3M1HA 4MZUA 1RUJ1 1K5MA 3RYKA 1Z0HA 3AMPA 2NMOA 3ECQA 4GKXA 3TNPB 2XL9A 3ZO0B 3FUOA 2BGCA 4AHXA 3LA2A 1RUE3 5ABJC 4C1WA 1MR5A 2JKBA 1QH7A 1ZX5A 2IXKA 1VBC1 2P3IA 2D44A 3AP4A 1O4ZA 2XKPA 2H6CA 3JZVA 3RYRA 3WZ1A 5FPXA 3JQXA 5FLJA 3WINE 1RTVA 2RMU3 2JJ6A 4DOUA 3R4DB 4WM8C 1MS1A 1S0DA 3N36A 4KH9A 1NCQB 1ZBA2 4RFT0 1VRH2