5I91A

Structure of mouse acirecutone dioxygenase with to ni2+ and 2-keto-4-(methylthio)-butyric acid in the active site
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
publication title Metal-Dependent Function of a Mammalian Acireductone Dioxygenase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 48
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i91A00
5BPXA 1WGPA 3SHRA 1OMIA 2PQQA 4F7ZA 1J3PA 1RGSA 4H7LA 4LLOA 4XF0A 1CAWA 4HN1A 5HI0A 1XE8A 4ZU5A 3LAGA 5AVPA 1Q43A 2XL9A 3I59B 1O4TA 2OA2A 1HW5A 5FQ0B 1ZX5A 2IXIA 3RPQA 4XF3A 2ETEA 3JZVA 3RYPA 1ZRCA 1LKNA 3E6BA 5BUVA 3OCPA 4Q0SA 1O3QA 4PIZA 3HT1A 4HVOA 5LRSA 3FJSA 5D1IA 1GQGA 3DKWA 3EBRA 2VECA 4X6QB 2ET1A 3WW2A 5CADA 3CEWA 5KBFA 2Y0OA 4IEWA 2EAAA 1UIJA 5I8SA 5EZWA 2VQAA 1Q3EA 4XEZA 4R8HA 4BYYA 5KHHA 3SXWA 4HVRA 2WFPA 4XF9A 3GBFA 1DZRA 3E97A 2D93A 4IERA 3L2HA 5KHKA 1RTVA 1LR5A 1EPZA 4KWKA 4E2QA 4E2GA 4F8AA 5C6CA 3SCGA 2GH2A 3OD0A 2BNOA 1IPJA 4FBFA 4BH9A 4KWLA 4N9IA 3CL1A 3RDIA 1NXMA 2OZJA 2QCSB 4EWAA 4HVQA 2Z69A 4MGKE 1UIKA 1O5UA 2BNNA 2HKXA 2GC1A 4OFGA 3LOIA 5C8WA 3N4MA 2GU9A 3FFQA 3QOPA 3B02A 2Q1ZB 3S7IA 2UY8A 5JR7B 3U11A 2ATFA 1O7FA 1GQHA 2PHDA 4LA2A 3NW4A 3PNAA 1J1LA 1RC6A 4IEXA 3UKNA 1CAUA 4FT8A 3MYXA 1CAVB 4YSFA 3HIFA 2EVXA 1ZZ9A 4QGNA 3E5QA 2V09A 1L3JA 2QJVA 3FZ3A 5J48A 4IEQA 1ZZ8A 4JVAA 2EA7A 3H3ZA 1ZRFA 4LA3A 4I01A 5I0UA 3KGZA 1PMIA 4PIXA 2UYAA 4HSJA 3BB6A 4NVPA 2MPFA 5LRRA 1QXJA 3ROUA 2PA7A 3USSA 3VHRA 1J3QA 2BNMA 2Q4SA 5BV6A 3UKTA 1ZZ6A 2GC2A 4HSLA 3H50A 3GYDA 4OLLA 4X6RB 1LB2A 3H8UA 4XF4A 4UBGA 4EROA 4XFBA 3WW1A 2H6CA 2WC2A 2IC1A 4XETA 2PAEA 3LA3A 4Z07A 1QWRA 2PTMA 1O3TA 3UKVA 3SCHA 4CYDA 4A2UA 3CF6E 2F4PA 3S0MA 1CAXB 5FLJA 2GC3A 4R52A 3E6CC 3PVBB 4EWDA 5FLIA 5LEJA 4YYOA 3CJXA 2MNGA 2PAMA 3I59A 1UD1A 1SFNA 1YHFA 4Q0VA 1QXRA 4QMAA 2XLAA 3EO6A 4RD7A 5FQ0A 3NSTA 4QX5A 1EY2A 5FLHA 3U0ZA 2XL7A 2BYVE 3NKTA 3TNPB 1YFUA 4MV2A 1FT9A 5FCCA 3H3UA 3C3VA 1OI6A 1FI2A 3E6DA 3WW4A 2HJIA 2P17A 3FE5A 1ZVFA 3KMHA 3M70A 4XFGA 4D7TA 3FX3A 2IXLA 2D5FA 1ZNPA 3DL3A 5KHGA 4ZU4A 3H1WA 3FHIB 4LEJA 1RUOA 2B9UA 3ACLA 1XE7A 4AVBA 3DN7A 1RUNA 1UW8A 4KU7A 1DGWA 4O9EA 4Z82A 4IEVA 1H1MA 2GAUA 2IXCA 4AVCA 1O5LA 2DCTA 5E1RA 2IXHA 4PJYA 1PM7A 2MHFA 3LWCA 1U12A 4UXAA 4D7SA 2K0GA 2ZCWA 3PLQA 4QGMA 3G7DA 5BXXA 1IPKA 4EWEA 4IEZA 4AQ2A 1YFXA 1YWKA 3ZDSA 1O3RA 4I2OA 4FAGA 5T3NA 5F1RA 1CGPA 4HN0A 4MGIE 3IDBB 3M3IA 1WLTA 3MZHA 1VP6A 3KCCA 5E16A 1UCXA 2PAKA 4KWJA 3H1MA 4AQ6A 3BPZA 1LRHA 4YARA 1DGRA 3BCWA 1CAVA 5FPZA 4XFHA 1EYBA 4I3PA 4LTAA 2PYTA 1I6XA 2ZKLA 3EHKA 3NL1A 4EV0A 1ZZ7A 2PHLA 4QXKA 4LUMA 5FDBA 1DZTA 3H7YA 4HZFA 2B5HA 5JSPA 1X7NA 4IEPA 4XF1A 2K9ZA 1XRUA 1J3RA 3NJZA 4E2SA 3H1YA 3RZZA 2IXKA 1OFNA 1SEFA 5KHIA 3MPBA 1NZCA 3H9AA 4MGYE 1YFYA 3TNQA 3QACA 5I8YA 3S7EA 3CO2A 3OGJA 3H7JA 1VR3A 3D0JA 2CAUA 3U10A 5EFUA 4DINB 4META 3HT2A 5CU1A 1ZREA 5JCTA 4Q0UA 4WZCA 1CAXA 4XFFA 3WW3A 4FAHA 1YUDA 1SQ4A 4O9GA 2O8QA 5JAXA 4QM8A 2FQPA 5I8TA 1G6NA 3BALA 4J1WA 5K8SA 4KL1A 1JUHA 2QVSB 3OF1A 2VPVA 2ET7A 4HBNA 4IEYA 3NVCA 1X8MA 4JTOA 1Y9QA 4L2NA 4XFAA 4I09A 4YNIA 4IESA 4IEUA 4LUKA 4QM9A 3IIAA 4BIFA 4MX3A 4J1XA 3EQEA 4WBBA 2PFWA 2Z2SB 1RL3A 1CAWB 2XHKA 1QY4A 2QNKA 5JSRA 2UYBA 2XLFA 5I91A 4YRDA 4IEOA 2D5HA 3ES4A 2XKPA 5BY5A 1ZZCA 2O1QA 3HQXA 1ZRDA 3BU7A 1NE6A 4UBHA 4MGZE 4TLFA 2BGCA 2XKOA 4PIYA 2QDRA 4ZU7A 5I0RA 1OD5A 1Q5OA 4KU8A 1O3SA 3OTFA 1TQ5A 4P9GA 4K8FA 3E5UA 3KGLA 2Q30A 3ELNA 4Q0QA 5I93A 1J59A 4HLTA 4B29A 4QGLA 4AVAA 3RYKA 3E5XA 1ZRRA 4L11A 3ETQA 5CVRA 1VJ2A 4BHPA 1ZZBA 2GZWA 5LEKA 5J3UA 4MZUA 2B8MA 1WA4A 1H1IA 2FMYA 4HMZA 1Y3TA 3IBMA 3RYRA 1CX4A 4Q0PA 1UPIA 4WVZA 2I45A 3LA7A 1X8EA 2KXLA 5KHJA 2E9QA 1EP0A 1FXZA 3SMHA 4JV4A 3O14A 3IDCB 4JTNA 3I54A 2CV6A 2H6BA 3DV8A 1CAUB 4MUVA 4XFCA 4ONUA 3CLPA 4I0BA 1V70A 3ST7A 1NYWA 1NE4A 4I0AA 2IXJA 5FPXA 4AXOA 4GULA 1X82A 3R6SA 3I7DA 3FWEA 3LA2A 2XLGA 2H0VA 4N9HA 4XFIA 2OYZA 3EJKA 1YFWA 1I5ZA 3MDPA 5I0SA 5JSOA 2UY9A 2Q0AA 4I02A 2GC0A 4MH0E 4IETA 3RNSA 4Q29A 2OZ6A 3D0SA 3D82A 2CGPA 2XGXA 4ORFA 2C0ZA 3LZZA 3SCFA 1YLLA 2CAVA 1J58A 3ES1A 2N7GA 4LULA 3KSCA 3IWZA 2BEOA 5I0TA 2D40A 5J7MA 2OPKA
chains in the Genus database with same CATH superfamily
4WM7A 4YG6A 5BPXA 1EUTA 3SHRA 4IV1A 2PQQA 1Y43B 3VBFC 3ZDVA 1F2NA 1C28A 4TTGA 1CAWA 2X5IA 4HN1A 3I2GA 2ZGMA 5F2WA 4A7ZA 1EV11 4NR1A 2NMOA 1WLWA 3O7OA 4C0BA 2VXJA 4LHLA 3UJQA 1S2KA 2FBEA 4A4AA 1PGL2 4HT1T 4LITA 1RVF1 1GNYA 4INDA 5IVCA 1R093 1Y9MA 2A6WA 1O4TA 1WW6A 2WRAA 4W8JA 4AEDA 5FZFA 4MG2A 2RS52 1VMFA 1LKNA 2RE9A 3B69A 4DUWA 4ZKTB 3T1MA 2WIIB 4GKYA 4ASLA 1KRIA 4Y20B 5LA0A 1N47A 3HT1A 4BM8A 1GKBA 2ZPXA 3FJSA 5D1IA 5LA2A 3DKWA 1POV3 4AHXA 2WA3A 3UESA 3AZXA 4QQLA 3ZSLA 1BBT1 3PVOA 4Q2FA 4CTEA 5CADA 3WW2A 3FUOA 2XJUA 1HN0A 2BERA 4E27A 1SLCA 4J6GA 5FMOS 4NHXA 5I8SA 4NHYA 5FREA 1AZDA 1F9KA 1ZRIA 1PVC1 3P3PA 2OPWA 3KLSA 3WOGA 3N9QA 3D4KA 1BEV2 2CSGA 4XZPA 2PXJA 2EICA 2WFPA 5CKQA 2PQSA 3E97A 5FP4A 2D93A 4QQ2A 1VBA3 3WDVA 3I4IA 5K9YA 2ES3A 2IVJA 5FKBA 5F2SA 3WR0A 2D6NA 3OD0A 4BXSV 1B35C 3J4UH 1UXZA 1Z78A 3WINE 4FBFA 1ULCA 2F6BA 3LPFA 4QXBA 3MHZA 2GH8A 3CL1A 5T52A 5IFTA 3LCPA 2AYHA 4LK7A 2R041 2BQPA 4CDQA 1UZVA 1UMZA 2AH2A 2RS31 4Q8LA 1UIKA 2BNNA 4L0PA 1LU2A 1R082 2GC1A 2JD9A 2QQOA 5DZFA 5C8WA 2GU9A 2WLPA 1W9YA 2BVBA 5DPNA 4AL9A 1T2XA 2W91A 3QOPA 3B02A 4DS0A 1PX3A 1BQPA 4ZZ5A 1UYYA 1ZA7A 2ZKNA 1KDKA 1GNZA 5HCFA 4AWDA 1O7FA 5L7OC 1GQHA 2OXBA 1HRI3 3HWJA 2PHDA 1IOAA 3POSA 2BWCA 1AX1A 2EIGA 3PNAA 3HNBM 4IXLA 5EJ1B 4XABA 3ZFFA 2HEWF 2RJ2A 3MYXA 4FT8A 1PGW1 3CDZB 3VBOB 5GLUA 3HIFA 4P00B 4Q5OA 4XZUG 1ZZ9A 1NXD1 2VMDA 3ZFGA 3E5QA 1L3JA 2JE8A 1W0NA 3MIGA 4IL7A 5FAXA 2WN3A 2PHFA 3K4DA 4CDUA 3H3ZA 2XG3A 4LBQD 3OGRA 2XR4A 5I0UA 1FNYA 3AMMA 1PMIA 1J1TA 1LGNA 3NWKA 2JDKA 3TWIA 1PMJX 2BRTA 2MPFA 5FK8A 1LHUA 3MFAA 1W6NA 2PA7A 3LPGA 3KQRA 4LKSA 3T08A 4CP0A 4MOAA 1I5PA 1UPSA 4YVWB 2WO3A 5FOJB 1M06G 2QQJA 2BNMA 1GICA 3AP5A 2J22A 3U4XA 3UKTA 2XJSA 4YZ2A 1LESA 3NV3A 3IPVB 1JYVA 3K48A 3H50A 4X6RB 1W2AX 5DUVA 1LB2A 5A3WA 3X29B 2ZZQA 2AENA 1YIFA 5FO9B 4Y26A 4C1WA 4XF4A 4YG3A 1VRBA 4N53C 4NRMA 1HB3A 4EROA 5IK5A 5FPVA 1YXWA 4LBNA 3UGFA 3MIHA 4XETA 1U5YA 4S2DA 2PAEA 4OI1A 3WDWA 1D0GA 2P3JA 3OUJA 4JZRA 4AEKA 5J37A 3AVSA 3ZYBA 1QWRA 3O12A 3VDAA 3HJRA 1IKPA 5F8PA 2EIDA 3SNMA 4XILA 3VDCA 5ACA1 3HR9A 3S0MA 4QX3A 1IG3A 2HWD2 3INAA 3IKWA 3NNFA 1OKQA 1URXA 4EWDA 5BNOB 4MGTA 2DCZA 1UU4A 1N1VA 3MIFA 3I59A 5FWJA 2VZPA 3VZJA 1SFNA 2CWMA 3L9JT 4Q0VA 1JI6A 2XLAA 4ISQA 3VBHA 4CUAA 5JI9A 2TNFA 1EY2A 2WNEA 2E63A 1MZ6A 4QX5A 4TN7A 3VBUC 4AFMA 3SLIA 1RMU1 4K9SA 3ZXKA 1H2NA 3FBMA 3T0BA 3U0ZA 3R0RA 1QDCA 2ZEWA 3NKTA 4L8QA 5FY7A 1YJKA 2NLRA 1KFXL 3ZSKA 2XVGA 3HMYA 5J98B 1C5HA 1FT9A 1QJU2 1YC61 5FCCA 1S0BA 1JZ6A 2BVVA 2WFF3 3C3VA 1ZBE3 5FV3A 4AGGA 2YFUA 3E6DA 5B4NA 3WW4A 2P17A 4XPVA 5A1AA 1ZVFA 3M70A 2P3KA 1LGBA 3LIGA 4D7TA 3RZGA 1JMUB 2ZTNA 2HEVF 1HIXA 5AFEA 1W6QB 3RZHA 2XXZA 4Y1VA 1RUOA 1MVEA 1JZ3A 3OUHA 3DN7A 3K4AA 1RB8G 1YI9A 1UW8A 3AVRA 5JOXA 3ZIWA 4P9IA 1DGWA 3NV4A 4AEJA 5L9VA 1JHNA 1UX7A 1WKYA 2JG8A 1CZVA 4XW3A 1W3VA 1UOFA 2BGPA 5CFCB 3NV2A 3TEXA 5JMCA 4FI9A 1O5LA 3VBOC 1DQ0A 2JDYA 1AL0G 5E1RA 2IXHA 4PJYA 1LHVA 4QX7A 1VBB3 5FZ3A 4CCMA 1PM7A 1RUH3 2MHFA 1BBT2 1QQP1 2WS91 2X10A 2Y6HA 3AZWA 4LKFA 5FYZA 1RUI2 1NCQA 1N1YA 2K0GA 3FBYA 1FV3A 4O61A 1Q8VA 3BGAA 3K3NA 2W95A 3LB9A 2UWBA 1W8ZA 4AYUA 1AYN1 1IPKA 1N1TA 1V6NA 1WW7A 3UT0A 1PVC2 2JEMA 2YROA 4AQ2A 1GZ9A 1GLHA 2XH6A 1YWKA 4FTEA 4JKMA 4FAGA 4RHV1 3GJBA 1Z7S3 1F5FA 4YVWC 3DPRB 4W50A 5AFBA 4HOOA 1GZWA 1G9CA 1PX4A 3RZLA 1CGPA 4MGIE 2VGDA 5FXXA 1V6MA 2W39A 3N9PA 1WLTA 3MUY1 3MZHA 1V6IA 1JYNA 4FTBA 1I3HA 1R1A2 1FOD3 3S5QA 1AR63 3THPA 1DGRA 5T5JA 3A4UA 5FPZA 4Z1VA 4MADA 5DQ0A 2BP6A 3AKRA 1QJFA 3WEZA 1ND2B 1OT5A 1SG3A 4N43A 4Q4Y3 5A7WA 4HKLA 5IVJA 1XNTA 4ZHNA 4EV0A 4COYA 2RS32 3IDEA 1OQ1A 4LUMA 5HXMA 4M3CA 5FDBA 1DZTA 2BOIA 3N35A 3H7YA 4UW5A 2VZVA 4HZFA 2VL4A 1UY1A 2AEYA 1AR83 3ZXDA 2VNGA 2VZUA 4Y33A 2UURA 2I2SA 4CCEA 2PHRA 5BNOC 3FFZA 1LNSA 5GLZA 3THCA 4LBKA 3ORJA 4WVMB 2O14A 2A73B 1H2KA 3ZM8A 3DGTA 3M3OA 5FBZA 5C3SA 3U14A 5KXBA 3RZZA 3ZYGA 2IXKA 5ERLA 5DG2A 5A3OA 3ZYJB 5JOWA 4K20A 4Z2WA 1JZ5A 2GMPA 1H1AA 3KZ4C 1BK0A 1OOPB 4FOVA 5EYYA 3TNQA 1SACA 1LGCA 1UYPA 1AJOA 1DYOA 2HWF2 2ZX1A 3QACA 1UZZA 2X05A 3ZKUA 4CUGA 1JYTA 2WZR3 1W28A 2DVAA 2QQNA 3D0JA 2DVGA 4JX0A 1HRV1 4NROA 3UGGA 5LATA 3ZN6B 3H8RA 2GDFA 1TNFA 1ZYBA 5DAQA 2WINB 1HB2A 1CAXA 5LA9A 5A6XA 1OURA 2O8QA 5DABA 4AHZA 5JAXA 1VMJA 1U5XA 5L19A 3WQ0A 1AXYA 4P9LA 4NIGA 1T6GC 2VPVA 1FMD1 1H4HA 1NAEA 2VQTA 3FUQA 4HBNA 2EAKA 4XUOA 2XBO3 2R0HA 2VO5A 2BV4A 5CFCC 4JQRA 1SLBA 3VDDB 3JD71 4WM8B 1Y9QA 2E51A 3OY8B 2NYYA 2YGMA 3H42B 2Y6KA 2JKBA 4GH4A 4I09A 3WNNA 5LK5A 4W6XA 4LUKA 4Q4W1 3HD8B 3H0OA 1K3IA 3IIAA 4BE3A 1US3A 5IW0A 4LBOA 4J1XA 3EQEA 4MX3A 1RYYA 1SLAA 3VKLA 2PFWA 3ZSMA 2WT1A 3WDTA 3WY6A 3IB3A 3K46A 5J36A 2D44A 3RSJA 4EN8B 4NRPA 4CDWB 3SC7X 2VM9A 5I91A 2JB4A 3LGRA 1PNGA 3D3AA 1UY3A 5FUIA 3WF2A 2VR4A 1W8TA 3DPRC 1US2A 5L73A 4CZSA 1FAYA 1WA6X 2Y0IA 1C8M1 3BU7A 2RS11 1JYCA 4AI3A 3DF0A 3HN3A 4TLFA 1WD4A 4PIYA 4OUSA 2WWJA 2A6VA 2HH9A 1SFPA 2Z79A 1LAJA 5C9AC 5I0RA 1ND2C 2RM23 5JXIA 4KU8A 2FCVA 3OTFA 5F5QA 1UOGA 1NCRC 3E5UA 1LOCA 1K5MB 4UOJA 4Y3OA 1S0GA 3O1MA 4OI2A 1F5JA 1KD7A 3GF6A 3OD4A 1J59A 2JDMA 4UI9L 1ULDA 5EP9A 1A6CA 1YQ2A 3P3NA 3N9LA 4QGLA 4AVAA 4B29A 2HWE2 3Q8EA 5E6HA 1MZ5A 3UK9A 2V73A 1X33A 3LF7A 1RUJ1 4KGGA 5FOBB 3AYAA 5FYMA 1ZZBA 1JS9A 4UF0A 4Y24A 4COWA 1UX6A 5LEKA 4UAPA 4FPGA 4GKXA 2XWJB 3PUQA 2YU1A 3GZAA 2R071 1QQP2 2WS92 2HLEA 1H1IA 4NIDA 4HMZA 1EAH1 1H9PA 4FO9A 4XUTA 1D4M3 1NZIA 2DYCA 1REEA 2VMEA 2RS53 3QH7A 3AZVA 1ND3A 4DRRA 4JKLA 4LNVA 3IIIA 2VVEA 5ABJA 1AYN2 1WBFA 3MUZ1 3AKTA 4NE9A 4DO0A 1U0AA 2E53A 3VL8A 4CUCA 1W2UA 2D97A 3LA7A 5F3IA 4AQSA 3VHNA 1MR5A 4RHV2 3O0VA 3LDRA 1X8EA 4FVVA 2KXLA 4JRLA 1HQNA 2E9QA 2VW2A 1DBNA 2XJPA 5A6QA 1RJ7A 3I2IA 4DOUA 3VKMA 1TME1 3WP4A 1SPPB 2BFUL 3HOBA 4URTA 3G6JB 4JTNA 4YGCA 3N7KA 1SZBA 2XMLA 2YC0A 2D3RA 1Q8QA 1QHDA 3FC0A 3WHUA 4XMIA 2J42A 2WLQA 1GZCA 2WQ4A 4PBOA 1O4YA 5IVYA 1COV3 4DB5A 3RZKA 1W2OA 1JXNA 2YC4A 4NHMA 3HBKA 4RR3C 3WP5A 1B35A 3O1TA 5IJRA 4YWAA 3OBAA 3AL5A 3HNMA 4E4ZA 4AXOA 1OH4A 1PO12 1JOPA 3BOWA 1WW5A 2P6CA 1JYXA 2DFCA 4UW6A 2OX0A 1JU4A 2JWPA 1GWKA 2OYZA 3V0AB 1C57A 4YZ3A 2XPJA 3KB5A 4NIAA 4GWIA 4TLGA 5A7QA 4ZZ8A 2LROA 4JQTA 5LA1A 1H6YA 4IETA 2GMEA 4BQ4A 1OD3A 2VBBA 4KBBA 5L7OA 3VZNA 1IS3A 1W8UA 1UXXX 5KXEA 4W65A 3J26N 3JXSA 4OYUA 4ORFA 4JGYB 1KS5A 5HV4A 2CAVA 1LENA 5FPBA 2YUEA 4E4DX 1MS1A 3KSCA 4QX8A 5F6KA 5K7PA 4MYEA 3GJAA 4PDWA 1CIYA 3KQ4B 2JE9A 4XIOA 3NJVA 1XU1A 4FP3A 3S5AA 4LKEA 1HRV2 2JDPA 1V6JA 4NPLA 3I2DA 5EIYB 4FPCA 1TVGA 4QDSA 3FLTA 4XJ9A 3AP4A 3CMGA 1JBCA 1UY4A 2ZEYA 2DCKA 2RDQA 1JYWA 4F7ZA 2BBAA 1H9WA 4G4FA 4XF0A 1D2QA 2WSUA 3TEYA 2W92A 4SBVA 4E8CA 1ZBA2 2HWC2 1K5MC 4JDMA 5HI0A 1CWPA 4GAZA 4M0NA 2HBUA 4ASKA 4KI5M 4IW3A 4QPGB 1C8NA 4ZU5A 4QD2A 2R49A 5M0TA 3U07A 5AVPA 2ZEZA 5GZCA 3BIEA 1HV0A 2EALA 5BNQA 2OA2A 1FMD2 3CJIB 3TYJA 1HKDA 3JZVA 4NHKA 2CHHA 3RYPA 1RIRA 1LOGA 1ZRCA 4Q4X3 5J96B 3E6BA 2YU2A 4LPLA 4N53A 1G9AA 5BUVA 3PTRB 4QU2A 4YM2A 5FY4A 4Q0SA 4QWNA 3S57A 4YGDA 4PIZA 4AHWA 4M3CE 2HYXA 4AOCA 5FYIA 3WNKA 2FDKA 1GQGA 1V6OA 3K3OA 3PVNA 3U78A 3W5NA 3EYPA 1O6UA 2RR11 3KV6A 3BTAA 4DRVA 4GMP1 4LE3A 3CEWA 3ZX7A 5KBFA 2DCYA 4IEWA 2MEV1 4LT5A 1W6MA 5GZFA 5A3TA 1UIJA 2UWAA 2Q5TA 3BN6A 4YZ1A 3CNAA 4QHOA 4XTPA 5F5CA 4XEZA 1DGLA 1UOJA 2BGOA 2J7MA 5ANQA 4AFAA 2JDZA 1NLSA 3ZN4A 2IUWA 3SXWA 1NOVA 1YJLA 5A7PA 1R081 1CD3G 1W05A 3VBUA 2CTVA 3V64A 2JB8A 2FDGA 3M4FA 4OZOA 4XF9A 5C4WA 2HWD3 2IFRA 1R1ZA 2WN2A 1MQTB 3B9CA 3OBZA 4LO6B 1LHWA 5A32A 2UU8A 5KHKA 1LR5A 3MIDA 5A33B 5C6CA 4DUXA 4MGSA 1F4HA 4DY3A 1V9U3 2R061 1WLDA 3SCGA 3PVEA 2BNOA 1IPJA 2WT2A 5FY1A 1XYNA 1VBD3 4KWLA 4BH9A 5IWFA 1FNZA 4K7JA 2ZOEB 5CFDC 2VZQA 4HXCA 2KA3A 5IVEA 4MGKE 3ASIA 1O5UA 2HKXA 3N4MA 2E7QA 3LOIA 3LEKA 4IV3C 4RS5C 4D7YA 1RHI2 2ZGKA 5CEHA 3RG0A 1IQDC 1EV13 4TSVA 1V6LA 3PMSA 3A7QA 2WNUA 2AEZA 2UY8A 1RVF3 5JR7B 2D43A 3W9AA 3FHAA 3SKJE 4RSUA 1H8TB 3OBRA 4BA6A 2XUEA 1J1LA 4IEXA 4XUNA 1ACCA 1CAUA 4JGYC 3UKNA 1EAH2 1MEC2 2NZ9A 3NAPC 1RJ8A 2VUJA 1CAVB 4OZXA 2VOKA 4XHXA 3J7NA 3WG4A 4MXWB 4YSFA 2EVXA 4D94A 2DFBA 2V09A 1AXZA 2VCMA 5GALA 3RMXA 4CP9B 1X36A 4LO7A 3PHMA 2R1BA 3PUSA 4DQAA 3CZUA 4R9BA 3C8XA 2GSYA 2VU9A 4JAAA 4YVSA 1BVVA 3KGZA 2UYAA 5FZAA 4QX0A 4NVPA 3VKNA 1BBT3 2ORXA 1UQXA 5FZDA 5FZKA 5JZGA 1J3QA 4V1PA 2OUJA 4P9YA 1F15A 1SLTA 2OVUA 5CIRA 5A1LA 3ZYRA 1POQA 1C4RA 5KC6A 2GC2A 5FZ4A 1X9PA 3K77A 5K0UA 4HSLA 2YG0A 4JCKA 3ZPYA 5CAZA 3OGVA 1F4AA 4NMIA 1SFYA 3WCRA 1L7QA 3MFCA 2ARCA 1OLMA 2BFUS 4Y22A 2JENA 1WWYA 4FXGB 1GBGA 2NM1A 2TBVA 5GKAC 3WW1A 5FY9A 5FPUA 3NO8A 3KHBA 1DQ2A 3OPTA 4QQOA 1S0DA 2X8KA 1W2NA 2IZWA 4A44A 3AKSA 4BK4A 5BNNA 3GCWA 2E32A 4CYDA 4LBJA 4YW2A 4UYBA 1QJU1 2F4PA 2R043 3JBG3 1QGLA 3E6CC 2R32A 1PNFA 1XYPA 5FLIA 5CKNA 5LEJA 2E33A 3JCIA 1PVXA 1UKRA 1QXPA 4QPIA 3CJXA 1FPN1 2JKXA 2QQVA 3PU3A 4AVTA 1UD1A 5FQ0A 2OW4A 4QMAA 3EO6A 1DYKA 1RUG1 3ZXLA 1N3QA 4YGBA 5LBFA 2XL7A 1MQTC 2BYVE 2QQIA 5EHDA 3OJBA 4NPMA 2YYOA 4QU1A 3WUDA 1DHKB 3OYWA 1K12A 2DTWA 3ETPA 1L7LA 1RXGA 5DAWA 5D8AA 4YW5A 1KFUL 4MV2A 1AYM2 1UU5A 1JZ4A 1A8MA 1TE1B 4FFIA 3H3UA 4CXWA 4V2WA 3GZEA 1OA2A 2KM2A 2VNRA 1FI2A 3A0KA 4GD4A 2VUDA 2HJIA 3FE5A 3BTZA 2BPA2 2GP5A 2P4EA 2YV8A 1RUI1 3MO4A 4TWTA 3DL3A 2P5BA 2PLV1 5KHGA 3LE0A 4MHRA 5JMOA 1STMA 1WLCA 4GALA 4LEJA 2X53S 2DU0A 1XE7A 3PJYA 4KWUA 4CP1A 3SH5A 5FYBA 1YYNA 4KU7A 2RDSA 4NN0A 2E31A 5FZ1A 4I3GA 5KWRA 2EF6A 1H8TC 2VZTA 5T5OA 3SEEA 2RVAA 5DAPA 4E4HA 1E5HA 4IEVA 2VXRA 2GAUA 1DFQA 1QF3A 4COUA 5ISLA 2ZGQA 4LR4A 3RFRA 2RR12 3LWCA 1R1A1 3BVCA 1LODA 3BTYA 4D7SA 4DXSA 2MEV2 1W8FA 1S2EA 2Q1MA 4OUEA 4B1MA 4ES9A 2BWAA 4GXLA 5LW9A 1TG7A 3PLQA 1KITA 1QNWA 3OOXA 4QGMA 2BU9A 5FRAA 5JPMB 1WMEA 3GM8A 5FY5A 5C3PA 4CU8A 1HN1A 3CBNA 1MPXA 4IEZA 1AR72 1TZOA 1W6OA 1YFXA 3ZDSA 1O3RA 1BMV1 1V6KA 3PL0A 5ACA3 1S0JA 2Z5WA 5T3NA 5GZEA 1CESA 5F1RA 2J1AA 3RI8A 1CPNA 2W47A 3NNLA 1SLLA 4YW1A 5FZOB 5D2AA 5K4LA 1DGRN 3M3IA 1VP6A 5E16A 3ZVXA 1UCXA 2LS6A 4KWJA 3POWA 1DQ1A 4KG8A 4YARA 2W94A 4GJYA 1DG6A 3TN91 2R062 4LORA 2JIJA 1GUIA 4LO5B 1AJKA 1EYBA 3GGLA 4I3PA 5C9AA 1RMU3 1I6XA 2VNVA 4JGZB 3EHKA 3ZYIB 4P5YA 4N7UA 5FZIA 1NCRA 2PHLA 4QXKA 4XJZA 3BOPA 5FO7B 5T5LA 2C6SA 5F5IA 1JYIA 2BOJA 2HWF1 4CCDA 5DDJ3 5C71A 3M1HA 4MVTA 3QBQA 2SBAA 3D5OA 4CRQA 3ABZA 2DVFA 5IT6A 5FZEA 2JE7A 5T55A 4CPBD 5JSPA 3H8OA 1X7NA 4YM3A 3TOJA 2K9ZA 3DKQA 4XQDA 1OKOA 4JKKA 5E88A 3TRSB 5CA6A 3CQOA 4EN6B 4P14A 1QJEA 1C5IA 1HQWA 4Q27A 4E2SA 3VBRB 3N9OA 1OFNA 3SH4A 5KHIA 3C7EA 1NZCA 4MGYE 1POV1 4BQYA 3BYWA 4FOQA 1GNHA 2YXSA 4CEWB 5FPLA 4CCLA 3M2MA 5BNPB 3ACIA 4XHBA 3GHNA 4UFHA 4ISRA 2WYFA 3RWNA 5I8YA 3CO2A 3OGJA 5KC5A 1YI7A 3ZR5A 1AUYA 2BTVC 1KS4A 1VR3A 3HPNA 4LBMA 4QX1A 2F17A 2CAUA 2E6VA 2WS93 3ACGA 3WT3A 2QQKA 4BQ2A 2PN5A 2CL2A 3AYCA 4XVHA 1JZ7A 4YFZA 1OHFA 2W68A 4META 4Q1RA 1QJX2 3M3EA 5CU1A 2P37A 1ZREA 1AR91 5JCTA 1AYN3 3LEGA 4NOTA 2R6QA 4JC1A 5F6LB 3WW3A 1LOFC 3I2KA 4FAHA 5HPOA 2B4KA 2KD7A 1VAMA 2VMGA 2WL1A 3WP6A 1K42A 4XCBA 5IATA 1EPWA 1VBA1 2VCCA 2WNVA 1G6NA 2VC9A 3BALA 4J1WA 1G7YA 4LHNA 4HPKA 4N8MA 4CEYA 2ZABA 2VOWA 5K8SA 5EJ3A 4OHWA 3NKGA 4LMFA 2HWB2 3NVCA 4RR3A 4JTOA 4AGVA 2LALA 4XDPA 2ARBA 4XFAA 4YNIA 4WM7B 2VNOA 4UW4A 4IV1B 4QM9A 4LO4B 4B4QA 4BIOA 2IWGB 5FYSA 3JB4C 4WBBA 4PQ9A 1SHWB 3JB8A 1RL3A 5DG1A 5JXJA 1CAWB 2X5IB 2XHKA 2QNKA 3ACFA 3ZN5A 1UWWA 2C4XA 5J09A 5JSRA 1HRI1 1XB9A 2XLFA 4YLZA 1FPN2 4IGPA 2D5HA 1GQPA 4YPJA 1RUG2 5IAXA 2O1QA 4AEDB 4M4PA 1UOBA 5A7NA 3MI8A 1RUC3 5FFOC 1ZRDA 2AACA 3LSEA 4WVWA 2OUHA 2HWE1 4GQ7A 1NE6A 2R0FA 2VZSA 4UBHA 2JD4A 3N36A 4MGZE 3W5MA 2BGCA 2WAOA 5A3NA 3UV9A 2JG9A 5HCAA 2XJTA 3KT4A 2QFEA 3UETA 4A6SA 1A3KA 1BJQA 2ZGNA 4Y5TA 3NV1A 3DCQA 1RXFA 3MW4A 5EWSA 3AK0A 4CUBA 4G9SB 1YIPA 2PLV2 2HBTA 5F7UA 5IVVA 4EZHA 1F8VA 1AX0A 4RGGA 1S0EA 1LOAA 4Q0QA 4B3NA 4NUBA 5I93A 2W3JA 4AFBA 1NLQA 3I97A 3W58A 1W8WA 1GANA 3AXDA 1XE0A 3J7MA 1SDWA 4LBQA 4LE4A 4Q26A 2SLIA 5F5AA 5CVRA 1VBC1 4WV8A 2IVIB 3WQ1A 1TMF1 3J9SA 5JLVA 1A78A 2G19A 4CPBA 1OLME 2GZWA 3AC0A 1RUF3 3VBRC 4IE4A 4XIKA 4K1YA 2QBXA 4MZUA 3KD4A 2BJSA 1HXS1 1WA4A 4RL7A 5FYVA 1ASJ2 1FMD3 4Q4V2 4Y5SA 3LD8A 5BNPC 1UF2C 5H9QA 2RHPA 3JD73 2OQ6A 4A6OA 4ATEA 5LCWL 1BHGA 2B46X 3W21A 2JECA 3GCXA 2I45A 3OUIA 4EYUA 3C2UA 4Q4W3 2RDRA 1FX5A 3DYMA 4CDQB 2DU1A 3LEMA 1SDDB 2RMU2 4B7KA 1KJLA 1UYXA 1PO11 2ZHMA 4UW3A 5LZ6A 2QDNA 3ZLIA 1RUE3 1Q8SA 2JXAA 3E1F1 1ULPA 2DBNA 1PZ9A 5FWEA 3SMHA 3RZMA 5FYHA 4DUVA 4JV4A 3KCXA 2ZGSA 2ARXA 3KVAA 4AAXA 4AFDA 4QDQA 3IZOA 5AC91 3I2JA 3TN92 1XBFA 3VZMA 3WQBA 3ZFFB 4L9BA 4BPZA 4MSVA 4AI9A 3WF0A 4BMEA 4ONUA 1PK6B 3O0WA 3ZFGB 1DLCA 3ITQA 1C8M3 2WZ8A 1W8OA 2RS13 2VJXA 4Q1PA 3CLPA 4I0BA 4ITCA 1NY72 1VRH1 4H55A 2IXJA 3Q9OA 4CDUB 3MEPA 1X82A 5CFDA 3AB0A 4HONA 4XE9A 5DUXA 1R092 3R6SA 3LKJA 3I7DA 5F37A 4KNCA 2R16A 3LA2A 2XLGA 2DVBA 2C24A 4OQ9A 5DZEA 2XVLA 3BODA 4IV3A 1W6NB 2VE1A 2GN7A 4RS5A 1XQNA 5F39A 3WF3A 3PIJA 1I5ZA 1XSQA 4GIQA 3LEIA 1WCUA 2UY9A 1UYZA 2Q8OA 4I02A 2WWUA 4U36A 3RWKX 1Q56A 3WUCA 3I8TA 3RNSA 4DFSA 1IZ3A 1ZBA1 2HWC1 1RUD1 1KDMA 1YQCA 3D82A 1SLIA 2G9GA 5GLWA 2XGXA 3NAPA 3B9IA 5F3CA 3VV1A 3SCFA 4QT6A 3K2OA 1OUXA 1RUJ3 4QXHA 4XBQA 3RJ2X 4CP2A 5J1XA 1W3XA 2A1XA 1NKGA 3B5LB 1E5IA 2FD8A 1HV1A 2Y38A 5I0TA 5FJHA 3AJZA 3UJOA 2ZGUA 1O8SA 2R073 3ZYHA 4CU6A 3O1SA 1EAH3 2WSVA 5FMDA 3VB9A 2LW8A 4PCRA 1OMIA 3AZZA 4FPKA 4CCKA 3B01A 1RGSA 4Y1UA 4KH9A 1OVPA 3C7HA 5APAA 1AR92 2W0XA 3I3EA 1DIWA 2K2SA 4EE2A 3MW2A 1O59A 3ON7A 3J8F3 2R1DA 4J25A 2QZ3A 1VE0A 5CISA 1LJ7A 1VBA2 4DEVA 2ZMLA 1Q43A 4CU9A 2XL9A 1WCSA 3I59B 5C5TA 2VULA 1HW5A 3VBHB 3RPQA 2IXIA 1TME3 1YO8A 3V65A 4XF3A 4DXTA 4GB31 2I74A 4C1XA 2AR6A 2B7YA 3VD7A 4OVEA 3LDBA 4MO3M 3O1PA 3ZOIA 5T5PA 4Z92B 4RGAA 2LUWA 4HVOA 1VPHA 1VMHA 3FN9A 5LRSA 1GWLA 4TYSA 2P3IA 4AF9A 1XC6A 3EBRA 1W8NA 1VAVA 2VECA 5JIUA 2ZEXA 4ZPIA 2A6ZA 3VBFA 1ENSA 2OT7A 2ET1A 4X6QB 3OGSA 1Z0HA 2NN8A 1HRI2 2TEPA 2Y0OA 3RI9A 3DYOA 1OPMA 2VZ3A 1OQEA 1Q3EA 4V2VA 1J84A 1C1LA 2VCBA 4BYYA 1U5IA 3BPSA 1BK1A 2VCAA 4PI2A 4PBPA 2WA4A 5DAXA 2DDUA 4A3XA 4F3JA 3T30A 1RHI1 2JG8B 1MS9A 2AC1A 3ZFFC 4H3WA 1CJPA 2W1WA 4IERA 5A70A 1PK6C 1RTVA 2A70A 2QZ2A 3GDBA 3Q8FA 3A0NA 4MXVA 2WABA 1H2MA 3AX4A 4KWKA 4CCOA 4E2GA 2CY6A 1GMMA 1GV9A 1NCQB 1OOPC 1MEC1 1CIWA 3WP3A 1PZ8A 1NA1B 3RDIA 1NXMA 2QCSB 4L92A 1OVSA 4DEQA 4OUMA 1DCSA 3U75A 2YPJA 3IT8A 1W6PA 4HVQA 1BYHA 1LTEA 2ZX3A 2Z69A 5FZ8A 3ZSEA 1GP5A 2PMWB 4CCCA 4OFGA 2E7AA 4LOTA 4FOWA 3FFQA 3MIEA 2X29A 2P1BA 1VBC2 1GZWB 1OA3A 1TMF2 3NNGA 5DMYA 2XBO1 1H2LA 2ZS6B 5FUPA 3U11A 1GR3A 1K45A 2ATFA 4QKBA 1LOEA 1HXS2 1DP0A 1RC6A 4JHZA 3WNXA 1RITA 3I3QA 4KGQA 4ZXKA 1JTZX 1QJY1 4XDOA 3PJQA 5A3MA 2UWCA 2W46A 4CP9A 3FZ3A 3M8LA 1S0FA 5A7WB 3GZTB 4N43B 2VMIA 5FZHA 1ODNA 1ZZ8A 1FATA 3KF5A 4WM8C 5LBCA 3VDDC 1BEV3 1LHOA 1OA4A 1XNBA 4I01A 1WW4A 4LA3A 4M3CB 2VMHA 5IUQA 5HBAA 4RA0A 4H7MA 4PIXA 5FR3A 2H0BA 2YFZA 3AP7A 4P9XA 1GYKA 3MV01 1DF0A 4HSJA 3RQ0A 1BXHA 2J1TA 3MICA 5F32A 1SCSA 5LRRA 1QXJA 1UY0A 4IE0A 1Y4WA 4CSWA 3ROUA 2EIBA 4GMP3 3BKZA 3USSA 4LKDA 1XNDA 3VHRA 2QTWB 3WXPA 3V0BA 1JOBA 1UZYA 5AC92 3OEAA 4CDWC 3V56A 1VB4A 1ZZ6A 3MF6A 1UO9A 3PDQA 2WFF2 1R083 3GYDA 4OLLA 2VTXA 3Q8BA 1XNAA 5H9RA 1BZWA 2YB7A 2WKKA 1VRH2 3P1IA 5LY2A 1KXGA 1YEWA 1ULGA 4YW4A 1S0CA 4UBGA 1WMXA 2OKXA 1F35A 1Y7BA 2H6CA 2IC1A 5GLTA 3RVHA 3O1OA 5FY8A 3LA3A 4Z07A 4BLJA 2PHTA 2R063 2A3YA 5A3LA 2Y34A 2PHWA 1A34A 2PTMA 1O3TA 3UGHA 3UKVA 2YPDA 3SCHA 2NQYA 1AYM1 4M00A 3CF6E 3IM0A 1REFA 3ILNA 4QKFA 1CAXB 1H8VA 4AI1A 5FLJA 1W8HA 2GC3A 1RUD2 4OMDA 3PVBB 4AI2A 5B4XA 4D6QA 4I0WB 2Q8CA 4QAWA 4YM0A 5FYTA 1RUH2 4EN7B 2MNGA 1H4GA 5D21A 3VD9A 1D0HA 4RD7A 4K3UA 4HK9A 2EXHA 3ZXJA 4OI0A 5FLHA 3FLRA 3SISA 1ST8A 1OSGA 4GH4B 3UYJA 4CDXB 5C8CB 3SITA 2PHUA 5GZGA 2DUOA 3HN1A 3JQWA 4Y20A 3EXUA 3TNPB 4M3CF 3T09A 2GALA 4A41A 5CKMA 2A6XA 2QE3A 1NG0A 2B45X 4P08A 3URFA 2FHRA 1NA1C 2EXJA 4AQTA 2W5FA 4OHVA 2GNDA 2YMZA 3RRDA 3ZSJA 3NNMA 3Q8CA 3FX3A 4AW7A 2D5FA 1OF4A 1FOD2 1LOFA 5FZ6A 2DUPA 4FPEA 4ZU4A 1CN1A 3ZKYA 2E26A 1W0PA 1LOBA 3ECQA 2P2KA 2Y33A 3NNJA 3KF3A 2D3SA 4GB32 1COV1 2B9UA 4D0QA 2TUNA 4AVBA 3MGUA 4NAOA 1SBFA 1DU3D 2GNTA 1N1SA 1AR71 1AXKA 3ILFA 3T3YA 2IFWA 4NAMA 1YQ5A 3UNPA 3OSDA 3PMEA 1E5SA 1QNYA 4Z82A 5FP7A 2FZ1A 1H1MA 4IGQA 3M3CA 3WZ1A 3EMRA 4AVCA 4WZFA 1AR82 1CVNA 2WJSA 2J1RA 1JHJA 3P6BA 4AVVA 2QUOA 2W1UA 4K1ZA 4UFIA 1W06A 5A3PA 4C90A 3FLPA 4A7KA 4XTMA 2J1EA 4E9KA 2ZX4A 1W39A 2ZCWA 4GWNA 3G7DA 1PO21 2FDIA 4XAAA 2QQWA 4EWEA 4PQQA 3AZYA 2VBDA 5G04L 3VHPA 3ILRA 1O4ZA 1XJAA 1QJU3 3WNOA 5FZ7A 5IK4A 4M01A 4HN0A 4BMBA 3IDBB 2WZR2 2XB6C 2ZACA 4MLOA 4UF0B 3TEWA 3VKOA 2JICA 4QKNA 2FCUA 1PIV1 2PAKA 4AQ6A 4ZS2A 1FPN3 1LRHA 1MS0A 3BPZA 3NRUA 3POGA 4AAPA 4NHLA 4DXZA 3WD5A 5C3OA 2LTNA 3VBOA 5JXGA 3AYEA 4LTAA 4NWWA 2PYTA 3AM2A 1ND3B 1WMFA 5ABJB 1ULOA 3NL1A 5GJ6A 1ZZ7A 2I07B 2VZOA 3P5BA 2A7AA 4ARXA 3ZMOA 4BQXA 1UU6A 3HAGA 1AL21 4QB2A 1GU3A 2J1VA 4W6YA 2V72A 2B5HA 4HKOA 5LB6A 5F3GA 1N3OA 4LXLA 3ME2A 1S1AA 2D6LX 1IHMA 2XBO2 4IEPA 4Y1YA 4XF1A 1O8PA 1GOGA 1RUI3 1WCDJ 1YRZA 2XONA 4YVWA 1XRUA 4Q4X1 4YZ4A 3JU9A 4FFGA 2PLV3 5JVVA 3ZXAC 4ZONA 2WDBA 2WUHA 1MVQA 1QJX1 4K8RB 4QKDA 4QPGC 3LSDA 2NP0A 1U5ZA 1QJY2 1QJZA 4X8NA 1PVC3 3CZJA 3CJIC 3IPVA 3KV9A 1OXCA 4PF1A 3WCSA 3WG3A 5E8AA 1B35B 3H8XA 2EXIA 2YHJA 3C7OA 4GH4C 1Q8PA 3S7EA 4R9DA 4AHYA 1HDKA 2NMNA 1OF3A 3H7JA 2HWB1 4GZ9A 5JOZA 3D6EA 2ILMA 4W4ZA 3O1RA 1DQ4A 1DLLA 3O0XA 4ZXEA 2DVDA 1R1A3 2Q8DA 1MZEA 4FOYA 1UMIA 3WDXA 4DINB 1QDOA 2ERFA 3AFKA 5FBJA 3BI3A 5FUNA 1ENRA 3MBWA 3C7GA 3I3MA 1OLQA 4WZCA 1YUDA 1WCKA 5BNOA 5L7OB 4O9GA 2RS33 1P8JA 1BLZA 4HETA 3T1LA 2FQPA 2RM22 3OEBA 1KGYA 4KL1A 1LCLA 2QVSB 2ZAAA 5LASA 4CCNA 4JRAA 3LIHA 5EV7A 1OH3A 4IEYA 2O0OA 2W52A 2RJKA 2ZGRA 4PDWB 3T2PA 2WR9A 2ADEA 4Y5Z0 2ENRA 2KR2A 1QIQA 4L2NA 5GLVA 1IQAA 3TN93 3DUIA 4BQWA 4IEUA 2ZJCA 5A7OA 1SBDA 2ZHLA 3B7MA 4BIFA 3RZJA 2K46A 4XC9A 4XUPA 2GN3A 2Z2SB 4C0HA 1S0IA 2EIEA 2Z42A 1QY4A 4JDNA 1V0AA 4NWVA 2HWF3 4QXCA 1JZ2A 1VBE1 2UYBA 4KQ7A 1KJRA 1GZTA 1W6QA 3I3DA 4IEOA 4YRDA 5CBLA 4PT6A 1XPWA 4NIIA 2D6PA 2XKPA 1D4M2 4BU2A 1QEXA 5BY5A 1ZZCA 3AKQA 3HQXA 3VKFC 3VN4A 2QQMA 1W9FA 1CR7A 2WNOA 5FZCA 4N53B 4BCUA 3VBSB 1CJDA 1X50A 1XYOA 3POEA 2Y6FA 2ORZA 3WNLA 3KCYA 5CFCA 3BUCA 3K4ZA 2XKOA 4FPJA 4G3YC 2P6HA 4DNYA 3POBA 2Q8EA 2DUQA 1ND3C 2W08A 1Q5OA 3OPZA 5L9BA 5ABJC 5LK7B 2Y8KA 1ASJ1 4Q4V1 1W0OA 4K8FA 1W6MB 2W1SA 3TB0A 4QQHA 3POIA 2C5DA 2Z4FA 4R4XA 4HLTA 1COV2 4CXYA 3GBWA 3RYKA 2DCJA 3E5XA 1XXNA 1ZRRA 4XMAA 4Z2AA 1UY2A 2RMU1 3EB7A 1AR93 2AUYA 4GMP0 1W9WA 3DPRA 3VBUB 4BQ5A 3USUB 2DBIA 4BHPA 1S2BA 1W03A 2C26A 1UN1A 4XJAA 5C4WB 2FDFA 1IGOA 5A32B 5J3UA 2XUMA 4TXWA 3BIWE 3OG2A 1PGSA 5DN2A 1SMVA 3IAQA 1QOOA 3IMMA 3TBDA 1PM4A 1QH6A 1TNRA 3IBMA 3AKPA 1YNAA 2A75A 1CX4A 3CKHA 4Q0PA 1ND2A 1BCXA 2WQZC 4RQPB 1PO22 3BU0A 2JJ6A 2YC2A 3JBG1 2ZGLA 3CHXA 1D2SA 4EZ4A 1MS5A 2WQ8A 4XXAA 1NY71 3ZYPA 2JDAA 2XHNA 5L36A 5DXDA 3THDA 4S2GA 2VUAA 1R091 2W1QA 5KHJA 1CZSA 3N3HA 3I49A 1FXZA 4OHXA 2VW0A 2WNUB 1GOHA 3I2OA 4DZGA 1PIV2 3IDCB 1DYPA 2Y60A 2CV6A 1I9RA 2CDPA 3I54A 2JDNA 1LHNA 4WVMA 5FPAA 3DV8A 1NX9A 1VAKA 4I30A 1CAUB 3B94A 4XQ4A 3POFA 4MUVA 4XFCA 4LK6A 4NPRA 5EJZB 4D3WA 3O1UA 1PK6A 1QU0A 3KHCA 2WZPP 3N7LA 4M0HA 4PDWC 4B1LA 5A1FA 2HWE3 1OOPA 3DECA 1D7PM 3KV5A 3ST7A 1NYWA 4Y4RA 1OQDA 5FPXA 4YVSB 3U4SA 1AL22 2CDOA 2EXKA 3ZFEB 3FWEA 1ENQA 5IK8A 5FJKA 2H0VA 2D6OX 4AZZA 2A3WA 1YQ6A 1QQP3 3ZN6A 3EJKA 1G86A 1YQ8A 5I0SA 4Q4X2 5DZGA 2G9ZA 1UNBA 5JZGB 5IFPA 4MH0E 2GC0A 1PMHX 2A3XA 3MLLA 4A3ZA 5KXDA 2WO1A 1CONA 3ZO0B 2D3PA 5K0UB 3D0SA 1C1FA 3OBTA 1LECA 4ZS3A 2CGPA 5KR7A 5E89A 2C0ZA 3LZZA 1NLRA 4RHV3 1YLLA 3ES1A 1VBC3 1WUVA 3GNEA 1TMF3 3T0DA 4JDOA 4LULA 5FY0A 3VBSC 5C7GA 1LEMA 1XNKA 4Y22B 4RGKA 4NRQA 1UMHA 4LIUA 3M3QA 4RYDA 4WM8A 3VDDA 2VZRA 3OY8A 4HL0A 5IVFA 1HXS3 2A6YA 4BQ3A 3NJXA 1WGPA 4CVUA 1QOSA 4R9CA 1OC1A 3R4DB 5DAVA 5BNNB 1J3PA 4H7LA 4LLOA 4BOWA 3AL6A 3M7AA 5IAVA 2XQRA 4AR2A 1G9DA 3APBA 3MF9A 1XE8A 4BJ0A 3KWVA 2DTYA 4FQZA 4CDWA 3LAGA 1Q8OA 4QPIB 4RFRB 1PO13 1W9TA 1ZA4A 4FFHA 1V9U2 3VGIA 1HB4A 5FQ0B 1W90A 1W9SA 1ZX5A 3PU8A 3F2ZA 4B4PA 4YZ5A 2ETEA 5DUUA 1VBD2 5FZGA 1VALA 4R4ZA 5C4WC 3T2OA 5AC93 3F95A 4XUQA 3IAPA 1UAIA 4BQ1A 1OFSA 3OYWB 5FMCA 3OCPA 1O3QA 1ALYA 3FMGA 5DDJ1 3VZKA 5D8AB 3CU7A 5FP8A 2W2IA 3HBZA 3HEIA 1EV12 4LJHA 2B9VA 1VRH3 4JGZC 3CIHA 4RQPC 1SCRA 1BKZA 1RVF2 1VBE2 3GXUA 4FTSA 3FHQA 4U2AA 2EAAA 1FV2A 4LHSA 3GHMA 5JPNB 1K5MA 3RMYA 5EZWA 4AE2A 4IUGA 1HRV3 1HQLA 2VQAA 4R8HA 3I2HA 1JH5A 5LBBA 4EJRA 2BZDA 4TZDA 4DIQA 5CZKA 2WNUC 5KHHA 3SH3A 2PHXA 2BW8A 2XOMA 5JXHA 4HVRA 1WBLA 2LRPA 3QD6A 2JDUA 4N7IA 4YW3A 5C5UA 1ZBA3 1RUD3 2HWC3 3GBFA 2DWRA 5TSWA 1DZRA 2D6MA 1GFF2 1QH7A 3L2HA 4O65A 3OGGA 1AX2A 4RFT0 2XDVA 1EPZA 1R64A 4E2QA 4F8AA 4HANA 1QKQA 1G8WA 4CEWC 2GH2A 3N9MA 1NA1A 4XDQA 4H14A 4YVSC 1GOFA 4N9IA 1EUUA 3O5SA 2OZJA 5FYYA 3PUHA 4EWAA 4K6BA 5CB7A 3ZFEC 1HB1A 2WAAA 2YZ4A 1APNA 1SBEA 2XQXA 4XCAA 1W6OB 2DURA 3ZR6A 4FPYA 2C1FA 4QB6A 5JZGC 4O7XA 1DGWX 4BLIA 4OULA 1MS3A 2V4AA 2Q1ZB 3S7IA 3R4UA 1SPPA 2VG9A 4GA9A 5FXWA 5C3QA 2LM3A 5LY1A 4SLIA 5K0UC 2E7TA 3HNYM 1UL9A 3KV4A 4LA2A 3NW4A 4XBLA 2ADDA 5FYCA 3VD5A 2B39A 3HQRA 4HK8A 1FYUA 3AFGA 2FZ2A 4GB33 4DY5A 3BTXA 1C3HA 3AMQA 2C9AA 3DXTA 4QGNA 5C9AB 2QJVA 3LDKA 3NMBA 4FXKB 1NQDA 4PF5A 2R042 3JBG2 3MW3A 4WVVA 4AK3A 5J48A 2WFF1 4IEQA 1NCRB 1ZBE1 4JVAA 5C33A 2EA7A 1CPMA 4DPNA 3S6PA 1ZRFA 3R4SA 4WM7C 2GMMA 1D4VB 3K75B 4IV1C 4PLMA 4F83A 5BNNC 3BB6A 2VZ1A 4QQPA 3KT7A 3V0AA 1PZ7A 3VD3A 2X5IC 2XJRA 4HFSA 2VAUA 1H6XA 1RUC1 1ZM1A 5SV5A 5T54A 2YGLA 4FPLA 4EN0A 2CNAA 1VB2A 5FMBA 2Q4SA 2VVFA 5BV6A 1PGW2 4QPIC 3LFIA 4H2AA 2AGSA 4XAEA 2X09A 1DDLA 2ZMKA 2VOVA 2CGOA 3U37A 4JGYA 4AEDC 4GJZA 3SEPA 4A42A 1GP4A 4AVSA 1VBB1 1RHI3 1RUH1 2ZX2A 3H8UA 5JWPA 1DQ6A 3WVJA 1HJGA 2B42B 3RS6A 4GWJA 4NO4A 4CE8A 4XFBA 3WQ7A 1JN2P 2WBKA 2WC2A 5D8AC 2Y6JA 4JHTA 3AYDA 3ENRA 4K40A 2P34A 2VY0A 3Q8AA 2ID4A 1POV0 1MEC3 1MS4A 2BBVA 2ARAA 5G05L 3VL9A 2VMFA 1QMJA 4LLFA 3N9NA 3VHOA 3AP6A 2CWSA 1Z7S1 4A2UA 4BK5A 4FPFA 4R52A 4COVA 1ULEA 4QPGA 1RUF1 4RN5A 1AHSA 2L9LA 2WNVB 4YYOA 3ZPOA 3U1XA 5FZLA 4L99A 4HPKB 2PAMA 4KBZA 4PLNA 4CEYB 1FOD1 2Y64A 1NT0A 1AR61 1T6BX 1YHFA 1QXRA 3CJIA 4S2FA 4UFJA 3MLJA 5FZ9A 3ZXFA 3NSTA 1ONAA 4UWDA 4RR3B 4D6RA 3DEMA 4Q4Y1 4L97A 2Y6LA 3OPWA 1WMDA 1L7RA 4FQ4A 4R9AA 2XWBB 1YFUA 1J83A 1REDA 5FP9A 1QJY3 2D7FA 5ACA2 2G1MA 1AR81 1RUE1 1OI6A 2YBPA 3AJYA 4YW6A 5JIAA 4ES8A 3GALA 1WD3A 2ZHKA 3KMHA 3KM5A 4XFGA 2ZMNA 3L2YA 5HV0A 2CGNA 2IXLA 4LIVA 1JW6A 1ZNPA 4CDQC 5I0DA 4FSJA 3OB8A 4UT5A 3H1WA 4URAA 2ZA9A 3FHIB 3WNMA 2ZX0A 4Z8BA 4PLOA 4XURA 1OBNA 1RMU2 3ACLA 4KG0A 2DV9A 3T4VA 1RUNA 3KVBA 3LFMA 3T2QA 4Q8KA 1VIWB 2GNMA 4XJUA 2ZGTA 4XJ8A 4O9EA 3W59A 4YFWA 5DDJ2 4ZY9A 3WNPA 5C8CA 1MQTA 1G9FA 1UZ0A 2IXCA 2YBSA 4GWMA 3ZXEA 2VQ0A 2W9XA 2C9KA 2WZR1 3AMNA 3THTA 2DCTA 2JG9B 5A33A 1B09A 3ZFGC 1U12A 1LU1A 4UXAA 1V00A 4UFMA 4XBNA 4B4RA 5BYNA 1XU2A 3VD4A 1PHMA 3B3QE 3D8CA 2GNBA 2D98A 4CDUC 1RINA 3VUOA 4HG6B 4QHZA 1NUKA 5BXXA 1HX6A 3QLQA 1VLNA 3NJYA 5JOYA 1JZ8A 1LULA 5FIXA 4YM1A 4YG0A 4P02B 5CNAA 5H9SA 3ZXGA 4I2OA 2CYFA 3PURA 1W2TA 1AYM3 4HKWA 2BDRA 4LBQB 5FKCA 5HCBA 5LBEA 5EPAA 4CXXA 5AVAA 3DXUA 3DYPA 1ULFA 4ARYA 3POJA 5CG9A 3AMPA 3KCCA 5FXVA 1H8TA 3H1MA 1OUSA 2RJLA 3BCWA 4QDRA 1WCQA 3FL7A 1CAVA 2AREA 3LQCA 4XXPA 4MXWA 4XFHA 4FPOB 2ZKLA 1HJFA 4AI8A 5F9TA 4BXFA 2O8OA 3J8F1 1MS8A 3RGBA 1HLCA 2AZ5A 3WG2A 4M4RA 4IQPA 2XVKA 5FYUA 4MGQA 2VOXA 2G9FA 2ZZJA 5FZ0A 2RR13 2QKDA 2ZGOA 2V4VA 5GZDA 3K51A 4LHKA 5A6YA 4YW7A 2MEV3 1CZTA 2G4IA 1X9TA 4OMCA 3C7FA 2WNVC 3PIGA 2Y26A 4COZA 4E4SA 4Y1ZA 4CEYC 3HVDA 1J3RA 3NJZA 5EYXA 3GZUC 1CQ9A 1KQRA 2A71A 3H1YA 3UL2A 1NQJA 1SEFA 2JX9A 4BDVB 3VBHC 1AR73 3MPBA 4A7YA 5B2GB 3H9AA 3MIBA 2WWSA 1IG0A 1YFYA 2P3YA 2QQLA 4IE5A 4UFKA 1ZBE2 3A22A 4K21A 2RM21 2VQUA 5JR2A 1BVP1 5A7SA 4BZ4A 1W04A 3WF4A 5CFDB 2VH9A 4KMQA 1GWMA 4FPHA 5JI7A 2CU5A 3JQXA 1G9BA 5FZMA 4UFLA 3U10A 5EFUA 1XSRA 4IV3B 4RS5B 3W20A 1RUC2 1XOYA 2OQ7A 3LOBA 3S30A 3AP9A 2V5YA 3HT2A 3WHTA 4D69A 3AXEA 1PO23 4C8DA 4IE7A 4LQRA 4Q0UA 1A8DA 2R30A 5A6ZA 4XFFA 1SQ4A 2VMCA 4QM8A 3T4HB 3VDBA 5FO8B 1PGL1 3NAPB 4Y4YA 5I8TA 5FP3A 5A80A 1AF9A 1N3PA 1VBB2 1JUHA 3OF1A 3WX5A 5A3UA 4BB3A 2ET7A 1OPOA 4OQ8A 1D4M1 1X8MA 1H0BA 3H3LA 1PIV3 2JG8C 2RS51 4IE6A 5FMOL 2J1SA 4IESA 5EXOA 4CDXA 2FCTA 2JG9C 2VTXJ 1XNCA 4P9WA 2XJVA 2VBPA 2ZGPA 3MV11 2JDHA 3ZIXA 4BWOA 5IHRA 5LWBA 3HQUA 1NCQC 1Z7S2 4PI0A 4ASMB 4P5HA 1O91A 1RUF2 4NJ4A 4QHBA 5EQUA 2Q1FA 3J7HA 5HXVA 2WZEA 1S4CA 1AL23 3WSOA 1WZXA 1BMV2 3IN9A 3A21A 4PHZA 1IKQA 1TEIA 3ES4A 1AR62 3ALQA 1GSLA 3O1VA 2WO2A 4CU7A 3VLBB 3N7MA 3JD72 5L9RA 5FZBA 1CX1A 4AG4A 4Q4Y2 5DUWA 1QJX3 2F4LA 3VBSA 4Q4W2 4NIHA 1BEV1 3WDYA 5JDBA 3VZOA 4EN9B 2A5ZA 2R7EB 2QDRA 3GBGA 1ODMA 4ZU7A 3JUUA 1KEXA 1RUE2 1OD5A 3MPPG 5C3RA 4S2HA 3TEZA 2VVDA 3VBFB 4QB1A 4W6WA 4D6SA 4N43C 2ZBJA 1O3SA 1TQ5A 4P9GA 3WF1A 2HWB3 3RJRA 4B8EA 3KGLA 3WLUA 3IDAA 3R05A 2Q30A 3ELNA 3POYA 2JIGA 2VOTA 1E57A 1OLRA 3ZMNA 1C8M2 2V5DA 1Y9GA 2RS12 2WT0A 3ACHA 2FDJA 3TAYA 3WDUA 3J7LA 4L11A 3USUA 3WV6A 5JUVA 5IK7A 5FTTC 3ETQA 5F3EA 2PELA 3QCWA 2RV9A 3I3BA 1VJ2A 4MHUA 5FK7A 4AFCA 4CA9A 4FP2A 4IGOA 2NPIA 5J7MA 1UKGA 2OIIA 5FZOA 4DMIA 1DZQA 4XQWA 3NQHA 3PTYA 1JOJA 2DF7A 3MLKA 2B8MA 2W87A 4LO8A 1IS6A 2FMYA 1Y3TA 4XACA 2RDNA 1RUG3 3B93A 5KXCA 3RYRA 3I2FA 4LOSA 4QX2A 4JGZA 4RQPA 3VZLA 1DQ5A 1H30A 3KT1A 4XOGA 1UPIA 2Y6GA 4WVZA 4IDZA 1I1EA 1W6PB 1ENXA 4AEMA 4B7EA 2YDEA 1GP6A 2ZHNA 3ZYFA 4E8DA 2QQPA 5T50A 1RUJ2 5CYYA 2YY1A 4AI0A 1JU3A 5ANNA 1K5JA 1JUIA 1EP0A 3KS7A 3N7JA 1VBE3 3O14A 2VTFA 5SV8A 2R072 3SKVA 2YBKA 1AVBA 4LBLA 4N90A 2H6BA 2VUCA 4QPWA 5H9PA 4OHZA 3QH6A 3IMNA 3VBRA 2ZXQA 4OI4A 1W99A 4D8MA 1IPSA 1JODA 3PUIA 2VD7A 4CEWA 1V70A 2BUKA 2VW1A 3J8F2 5BNPA 4ET7A 4EQVA 1NE4A 4I0AA 3ATGA 4CDXC 5C8CC 4YGEA 2WYSA 4GULA 3PUAA 1MACA 4A45A 4DXRA 3ZFEA 3SQOA 1UZWA 4C91A 2FMDA 2HEYF 1YCIA 2D6KA 4N9HA 4XFIA 1TME2 2OS2A 3AMHA 4AGRA 5CG8A 1ASJ3 4Q4V3 1IS5A 2RG4A 2ZAHA 3B00A 1YFWA 2WO7A 3MDPA 4X8PA 4XYXA 3T0AA 5C70A 5JSOA 2Q0AA 3V0BB 2HYKA 3A23A 1MZFA 1LEDA 2J1UA 1M4WA 4Q29A 1S55A 3T2TA 4BISA 1IS4A 5HCHA 2OZ6A 2HWD1 3WG1A 2RMU3 4FCAA 1E5RA 4P9JA 2FDHA 4Y1XA 4OHYA 1J58A 1QOTA 2N7GA 4CCJA 4FFFA 2GP3A 1V9U1 5IYYA 3IWZA 5GM0A 2BEOA 2QQUA 4QPYA 4ATFA 1F31A 5IVBA 4OCTA 2D40A 1VBD1 5FXZA 4XJWA 2OPKA 2XJQA
chains in the Genus database with same CATH topology
4WM7A 4YG6A 5BPXA 3SHRA 4IV1A 2PQQA 1Y43B 3VBFC 1F2NA 1C28A 1CAWA 2X5IA 4HN1A 2ZGMA 4A7ZA 1EV11 4NR1A 2NMOA 1WLWA 3O7OA 4C0BA 4LHLA 3UJQA 1S2KA 2FBEA 1PGL2 4HT1T 1RVF1 4INDA 1R093 2A6WA 1O4TA 1WW6A 4AEDA 2RS52 1LKNA 2RE9A 3B69A 4ZKTB 3T1MA 2WIIB 4GKYA 4ASLA 1KRIA 4Y20B 1N47A 3HT1A 4BM8A 1GKBA 2ZPXA 3FJSA 5D1IA 3DKWA 1POV3 4AHXA 2WA3A 3AZXA 4QQLA 3ZSLA 1BBT1 3PVOA 4Q2FA 4CTEA 5CADA 3WW2A 3FUOA 2XJUA 4E27A 1SLCA 4J6GA 5FMOS 5I8SA 5FREA 1AZDA 1F9KA 1PVC1 3P3PA 3KLSA 3WOGA 3D4KA 1BEV2 4XZPA 2WFPA 3E97A 2D93A 4QQ2A 1VBA3 3WDVA 3I4IA 5K9YA 2ES3A 3WR0A 2D6NA 3OD0A 1B35C 3J4UH 3WINE 1Z78A 4FBFA 1ULCA 2F6BA 2GH8A 3CL1A 5T52A 3LCPA 2AYHA 2R041 2BQPA 4CDQA 1UMZA 2AH2A 2RS31 4Q8LA 1UIKA 2BNNA 5DZFA 1LU2A 1R082 2GC1A 5C8WA 2GU9A 2WLPA 2BVBA 3QOPA 3B02A 4DS0A 1BQPA 2ZKNA 1KDKA 1GNZA 5HCFA 4AWDA 1O7FA 5L7OC 1GQHA 3HWJA 1HRI3 3POSA 2PHDA 1IOAA 4IXLA 2BWCA 1AX1A 2EIGA 3PNAA 3ZFFA 2HEWF 4FT8A 3MYXA 1PGW1 3VBOB 5GLUA 3HIFA 1ZZ9A 1NXD1 3ZFGA 3E5QA 1L3JA 3MIGA 4IL7A 5FAXA 2PHFA 4CDUA 3H3ZA 2XG3A 4LBQD 5I0UA 1FNYA 3AMMA 1PMIA 1J1TA 1LGNA 3NWKA 3TWIA 2MPFA 1LHUA 3MFAA 1W6NA 2PA7A 3KQRA 1UPSA 4YVWB 1M06G 5FOJB 2BNMA 1GICA 3AP5A 3U4XA 3UKTA 2XJSA 4YZ2A 1LESA 3NV3A 3IPVB 3K48A 3H50A 4X6RB 5DUVA 1LB2A 3X29B 2ZZQA 2AENA 1YIFA 5FO9B 4Y26A 4C1WA 4XF4A 4YG3A 4N53C 4EROA 5IK5A 1YXWA 4LBNA 3MIHA 4XETA 1U5YA 4S2DA 2PAEA 4OI1A 3WDWA 1D0GA 2P3JA 5J37A 4AEKA 1QWRA 3O12A 1IKPA 3SNMA 4XILA 5ACA1 3HR9A 3S0MA 5BNOB 2HWD2 3INAA 3IKWA 1OKQA 1URXA 4EWDA 2DCZA 1UU4A 1N1VA 3MIFA 3I59A 3VZJA 1SFNA 2CWMA 3L9JT 4Q0VA 3VBHA 2XLAA 4ISQA 5JI9A 2TNFA 1EY2A 2WNEA 2E63A 1MZ6A 4QX5A 3VBUC 4AFMA 3SLIA 1RMU1 4K9SA 3ZXKA 1H2NA 3FBMA 3U0ZA 3R0RA 1QDCA 3NKTA 4L8QA 1YJKA 2NLRA 1KFXL 3ZSKA 2XVGA 3HMYA 5J98B 1C5HA 1FT9A 1QJU2 5FCCA 1S0BA 2BVVA 2WFF3 3C3VA 1ZBE3 4AGGA 3E6DA 3WW4A 2P17A 4XPVA 1ZVFA 3M70A 2P3KA 1LGBA 4D7TA 2ZTNA 2HEVF 1HIXA 5AFEA 1W6QB 4Y1VA 1RUOA 1MVEA 3DN7A 1RB8G 1YI9A 1UW8A 5JOXA 3ZIWA 4P9IA 1DGWA 3NV4A 4AEJA 1JHNA 4XW3A 2JG8A 5CFCB 5JMCA 3NV2A 1O5LA 3VBOC 1DQ0A 1AL0G 5E1RA 2IXHA 4PJYA 1LHVA 1VBB3 1PM7A 1RUH3 2MHFA 1BBT2 1QQP1 2WS91 3AZWA 1RUI2 1NCQA 1N1YA 2K0GA 3FBYA 1FV3A 1Q8VA 3LB9A 2UWBA 4AYUA 1AYN1 1IPKA 1N1TA 1V6NA 1WW7A 1PVC2 2JEMA 2YROA 4AQ2A 1GZ9A 1GLHA 2XH6A 1YWKA 4FTEA 4FAGA 4RHV1 1Z7S3 1F5FA 4YVWC 3DPRB 5AFBA 1G9CA 1CGPA 1GZWA 4MGIE 2VGDA 1V6MA 2W39A 1WLTA 3MZHA 1V6IA 4FTBA 1I3HA 1R1A2 1FOD3 1AR63 3THPA 1DGRA 5T5JA 3A4UA 5FPZA 4Z1VA 3AKRA 1ND2B 4Q4Y3 4N43A 4HKLA 4EV0A 4COYA 2RS32 3IDEA 1OQ1A 4LUMA 4M3CA 5FDBA 1DZTA 3N35A 3H7YA 4UW5A 4HZFA 1AR83 3ZXDA 2VNGA 2UURA 2I2SA 2PHRA 5BNOC 3FFZA 4LBKA 4WVMB 2A73B 1H2KA 3DGTA 3M3OA 5FBZA 5KXBA 3RZZA 3ZYGA 2IXKA 5DG2A 3ZYJB 5JOWA 4K20A 4Z2WA 2GMPA 1H1AA 3KZ4C 1OOPB 4FOVA 5EYYA 3TNQA 1SACA 1LGCA 2HWF2 1AJOA 2ZX1A 3QACA 1UZZA 2WZR3 2DVAA 3D0JA 2DVGA 1HRV1 3ZN6B 2GDFA 1TNFA 1ZYBA 2WINB 1CAXA 2O8QA 5JAXA 4AHZA 1U5XA 5L19A 3WQ0A 1AXYA 4P9LA 1T6GC 2VPVA 1FMD1 1H4HA 3FUQA 4HBNA 2EAKA 2XBO3 2R0HA 5CFCC 4JQRA 1SLBA 3VDDB 3JD71 4WM8B 1Y9QA 2E51A 3OY8B 2NYYA 2YGMA 4GH4A 4CDXA 2JKBA 4I09A 5C8CA 5LK5A 4W6XA 4LUKA 4Q4W1 3HD8B 3H0OA 3IIAA 4BE3A 4LBOA 4J1XA 3EQEA 4MX3A 1SLAA 3VKLA 2PFWA 3ZSMA 2WT1A 3WDTA 3WY6A 5J36A 2D44A 3RSJA 4EN8B 4CDWB 5I91A 3LGRA 1PNGA 3DPRC 5L73A 4CZSA 1FAYA 2Y0IA 1C8M1 3BU7A 2RS11 1JYCA 4AI3A 3DF0A 4TLFA 1WD4A 4PIYA 4OUSA 2A6VA 2Z79A 5C9AC 5I0RA 1ND2C 2RM23 4KU8A 3OTFA 5F5QA 1NCRC 3E5UA 1LOCA 1K5MB 1S0GA 4OI2A 1F5JA 1KD7A 3GF6A 3OD4A 1J59A 1ULDA 1A6CA 4B29A 3P3NA 4QGLA 4AVAA 2HWE2 3UK9A 1MZ5A 2V73A 1X33A 1RUJ1 4KGGA 5FOBB 3AYAA 1ZZBA 4Y24A 4COWA 1UX6A 5LEKA 4FPGA 4GKXA 2XWJB 3GZAA 2R071 1QQP2 2WS92 1H1IA 4HMZA 1EAH1 1H9PA 4FO9A 1D4M3 2DYCA 1REEA 2RS53 3QH7A 3AZVA 1ND3A 4DRRA 4LNVA 5ABJA 2VVEA 1AYN2 1WBFA 3AKTA 1U0AA 2E53A 3VL8A 1W2UA 2D97A 3LA7A 4AQSA 3VHNA 1MR5A 4RHV2 3O0VA 4FVVA 1X8EA 4JRLA 2KXLA 1HQNA 2E9QA 2VW2A 1DBNA 2XJPA 1RJ7A 4DOUA 3VKMA 1TME1 3WP4A 2BFUL 4URTA 3G6JB 4JTNA 4YGCA 3N7KA 2YC0A 3FC0A 3WHUA 2D3RA 1Q8QA 1QHDA 4XMIA 2WLQA 1GZCA 2WQ4A 4PBOA 1O4YA 1COV3 4DB5A 1JXNA 4NHMA 4RR3C 3WP5A 1B35A 4E4ZA 4AXOA 1PO12 3BOWA 1WW5A 2DFCA 4UW6A 2OYZA 3V0AB 1C57A 4YZ3A 2XPJA 3KB5A 4IETA 2GMEA 4KBBA 5L7OA 3VZNA 1IS3A 5KXEA 4W65A 3J26N 4ORFA 4JGYB 1KS5A 2CAVA 1LENA 2YUEA 4E4DX 1MS1A 3KSCA 5F6KA 5K7PA 4MYEA 4PDWA 2JE9A 4XIOA 4FP3A 1XU1A 1HRV2 1V6JA 3I2DA 4FPCA 4XJ9A 3FLTA 3AP4A 1JBCA 2DCKA 4F7ZA 1H9WA 4G4FA 4XF0A 1D2QA 2WSUA 4SBVA 1ZBA2 2HWC2 1K5MC 4JDMA 5HI0A 4M0NA 4QPGB 1C8NA 4ZU5A 4QD2A 2R49A 3U07A 5AVPA 5GZCA 1HV0A 2EALA 5BNQA 2OA2A 1FMD2 3CJIB 3TYJA 1HKDA 3JZVA 4NHKA 3RYPA 1RIRA 1LOGA 1ZRCA 4Q4X3 5J96B 3E6BA 1G9AA 4N53A 5BUVA 4QU2A 4YM2A 4Q0SA 4YGDA 4PIZA 4AHWA 4M3CE 1GQGA 1V6OA 3PVNA 2RR11 3BTAA 4DRVA 4GMP1 4LE3A 3CEWA 3ZX7A 5KBFA 2DCYA 4IEWA 2MEV1 4LT5A 1W6MA 5GZFA 1UIJA 2UWAA 2Q5TA 4YZ1A 3CNAA 4XTPA 4XEZA 1DGLA 4AFAA 2JDZA 1NLSA 3ZN4A 3SXWA 1NOVA 1YJLA 1R081 1CD3G 3VBUA 2CTVA 3V64A 3M4FA 4XF9A 5C4WA 2HWD3 2IFRA 1R1ZA 4LO6B 1MQTB 3B9CA 1LHWA 5A32A 2UU8A 5KHKA 1LR5A 3MIDA 5A33B 5C6CA 4DY3A 1V9U3 2R061 1WLDA 3SCGA 3PVEA 2BNOA 1IPJA 2WT2A 1XYNA 1VBD3 4KWLA 4BH9A 1FNZA 4K7JA 2ZOEB 5CFDC 2KA3A 4MGKE 3ASIA 1O5UA 2HKXA 3N4MA 2E7QA 3LOIA 4IV3C 4RS5C 4D7YA 1RHI2 2ZGKA 3RG0A 1EV13 4TSVA 1V6LA 3PMSA 2WNUA 2UY8A 1RVF3 5JR7B 2D43A 3W9AA 4RSUA 1H8TB 3OBRA 4BA6A 1J1LA 4IEXA 3UKNA 1CAUA 4JGYC 1EAH2 1MEC2 2NZ9A 3NAPC 1RJ8A 2VUJA 1CAVB 4OZXA 2VOKA 4XHXA 3WG4A 4YSFA 4MXWB 2EVXA 4D94A 2DFBA 2V09A 1AXZA 5GALA 3RMXA 1X36A 4LO7A 3PHMA 2R1BA 4DQAA 4R9BA 2GSYA 2VU9A 4JAAA 4YVSA 1BVVA 3KGZA 2UYAA 4NVPA 3VKNA 1BBT3 5JZGA 1J3QA 4V1PA 2OUJA 4P9YA 1SLTA 2OVUA 5CIRA 3ZYRA 1C4RA 5KC6A 2GC2A 5K0UA 4HSLA 4JCKA 3ZPYA 5CAZA 3WCRA 1SFYA 3MFCA 2BFUS 4Y22A 2JENA 4FXGB 1GBGA 2NM1A 2TBVA 5GKAC 3WW1A 3NO8A 1DQ2A 4QQOA 1S0DA 2X8KA 2IZWA 3AKSA 5BNNA 4CYDA 4LBJA 4YW2A 1QJU1 2F4PA 2R043 3JBG3 1QGLA 3E6CC 2R32A 1PNFA 1XYPA 5FLIA 5LEJA 3JCIA 1PVXA 1UKRA 1QXPA 4QPIA 3CJXA 1FPN1 4AVTA 1UD1A 5FQ0A 2OW4A 4QMAA 3EO6A 1DYKA 1RUG1 3ZXLA 1N3QA 4YGBA 2XL7A 1MQTC 2BYVE 3OJBA 2YYOA 3WUDA 1DHKB 3OYWA 2DTWA 5D8AA 4YW5A 1KFUL 4MV2A 1AYM2 1UU5A 1A8MA 1TE1B 3H3UA 1OA2A 2KM2A 2VNRA 1FI2A 3A0KA 2HJIA 3FE5A 2BPA2 2YV8A 1RUI1 4TWTA 3DL3A 2PLV1 5KHGA 1WLCA 4GALA 4LEJA 2X53S 2DU0A 1XE7A 3PJYA 4CP1A 3SH5A 1YYNA 4KU7A 4NN0A 5KWRA 4I3GA 2EF6A 1H8TC 5T5OA 4IEVA 2VXRA 2GAUA 1DFQA 1QF3A 4COUA 2ZGQA 4LR4A 2RR12 3LWCA 1R1A1 1LODA 4D7SA 2MEV2 2Q1MA 4ES9A 2BWAA 4GXLA 3PLQA 1KITA 1QNWA 4QGMA 5FRAA 5JPMB 1WMEA 4IEZA 1AR72 1W6OA 1YFXA 3ZDSA 1O3RA 1V6KA 5ACA3 1S0JA 2Z5WA 5T3NA 5GZEA 1CESA 5F1RA 3RI8A 1CPNA 1SLLA 4YW1A 1DGRN 3M3IA 1VP6A 5E16A 3ZVXA 1UCXA 4KWJA 3POWA 1DQ1A 4KG8A 4YARA 3TN91 1DG6A 2R062 4LO5B 1AJKA 1EYBA 4I3PA 5C9AA 1RMU3 1I6XA 4JGZB 3EHKA 3ZYIB 4N7UA 1NCRA 2PHLA 4QXKA 4XJZA 3BOPA 5FO7B 5T5LA 1JYIA 2HWF1 5DDJ3 3M1HA 4MVTA 3QBQA 2SBAA 3D5OA 4CRQA 5IT6A 2DVFA 5T55A 2JE7A 5JSPA 1X7NA 4YM3A 3TOJA 2K9ZA 4XQDA 5E88A 3TRSB 5CA6A 4EN6B 4P14A 1C5IA 1HQWA 4Q27A 4E2SA 3VBRB 3SH4A 1OFNA 5KHIA 1NZCA 4MGYE 1POV1 4FOQA 1GNHA 2YXSA 4CEWB 5BNPB 3M2MA 4XHBA 3RWNA 3GHNA 5I8YA 4ISRA 3CO2A 3OGJA 5KC5A 1YI7A 1AUYA 2BTVC 1KS4A 1VR3A 4LBMA 2CAUA 2E6VA 2WS93 3WT3A 2PN5A 2CL2A 3AYCA 4YFZA 1OHFA 2W68A 4META 4Q1RA 1QJX2 3M3EA 5CU1A 2P37A 1ZREA 1AR91 5JCTA 1AYN3 4NOTA 2R6QA 4JC1A 5F6LB 3WW3A 1LOFC 4FAHA 2VMGA 1VAMA 2WL1A 3WP6A 1EPWA 1VBA1 2WNVA 1G6NA 3BALA 4J1WA 4LHNA 1G7YA 4CEYA 4HPKA 5K8SA 2ZABA 2VOWA 5EJ3A 4OHWA 3NKGA 2HWB2 3NVCA 4RR3A 4JTOA 4AGVA 2LALA 2ARBA 4XFAA 4YNIA 4WM7B 2VNOA 4UW4A 4IV1B 4QM9A 4LO4B 4B4QA 4BIOA 2IWGB 3JB4C 4WBBA 4PQ9A 3JB8A 1RL3A 5DG1A 1CAWB 2X5IB 2XHKA 2QNKA 3ZN5A 5J09A 5JSRA 1HRI1 2XLFA 4YLZA 1FPN2 2D5HA 1RUG2 2O1QA 4AEDB 3MI8A 1RUC3 5FFOC 1ZRDA 3LSEA 4WVWA 2OUHA 2HWE1 4GQ7A 1NE6A 2R0FA 4UBHA 2JD4A 3N36A 4MGZE 2BGCA 3UV9A 2JG9A 5HCAA 2XJTA 3KT4A 2QFEA 1A3KA 1BJQA 2ZGNA 3NV1A 3MW4A 5EWSA 3AK0A 4G9SB 1YIPA 2PLV2 1F8VA 1AX0A 4RGGA 1S0EA 1LOAA 4Q0QA 4B3NA 5I93A 4AFBA 3W58A 1GANA 3AXDA 4LBQA 1SDWA 4LE4A 4Q26A 2SLIA 5CVRA 1VBC1 4WV8A 3WQ1A 5JLVA 1TMF1 3J9SA 1A78A 2GZWA 1RUF3 3VBRC 4XIKA 4K1YA 4MZUA 3KD4A 4RL7A 1HXS1 1WA4A 1ASJ2 1FMD3 4Q4V2 5BNPC 1UF2C 5H9QA 2RHPA 3JD73 4ATEA 2B46X 2JECA 2I45A 3C2UA 4Q4W3 1FX5A 4CDQB 2DU1A 2RMU2 4B7KA 1KJLA 1PO11 2ZHMA 4UW3A 2QDNA 1RUE3 1Q8SA 2JXAA 1PZ9A 3SMHA 4JV4A 3KCXA 2ZGSA 2ARXA 4AFDA 5AC91 3TN92 3VZMA 3ZFFB 4L9BA 4BPZA 4MSVA 4BMEA 4ONUA 1PK6B 3O0WA 3ZFGB 1C8M3 2RS13 4Q1PA 3CLPA 4I0BA 4ITCA 1NY72 1VRH1 4H55A 2IXJA 3Q9OA 4CDUB 3MEPA 1X82A 5CFDA 3AB0A 4XE9A 5DUXA 1R092 3R6SA 3LKJA 3I7DA 4KNCA 2R16A 3LA2A 2XLGA 2DVBA 5DZEA 2XVLA 3BODA 4IV3A 1W6NB 4RS5A 2GN7A 1XQNA 1I5ZA 4GIQA 2UY9A 2Q8OA 4I02A 4U36A 1Q56A 3WUCA 3I8TA 3RNSA 4DFSA 1IZ3A 1ZBA1 1RUD1 2HWC1 1KDMA 3D82A 5GLWA 1SLIA 2G9GA 2XGXA 3NAPA 3B9IA 3VV1A 3SCFA 4QT6A 1RUJ3 4XBQA 4CP2A 3RJ2X 3B5LB 1HV1A 2Y38A 5I0TA 3AJZA 3UJOA 2ZGUA 2R073 1EAH3 2WSVA 4PCRA 1OMIA 3AZZA 4FPKA 3B01A 1RGSA 4Y1UA 4KH9A 1AR92 2W0XA 1DIWA 2K2SA 3MW2A 3J8F3 2R1DA 2QZ3A 1LJ7A 1VBA2 2ZMLA 1Q43A 2XL9A 1WCSA 3I59B 2VULA 1HW5A 3VBHB 3RPQA 2IXIA 1TME3 1YO8A 3V65A 4XF3A 4GB31 2I74A 4C1XA 2AR6A 2B7YA 4OVEA 5T5PA 4Z92B 4RGAA 2LUWA 4HVOA 5LRSA 4TYSA 2P3IA 4AF9A 3EBRA 2VECA 1VAVA 5JIUA 2A6ZA 3VBFA 1ENSA 4X6QB 2ET1A 1Z0HA 2NN8A 1HRI2 2TEPA 2Y0OA 3RI9A 1OPMA 1OQEA 1Q3EA 1C1LA 4BYYA 1U5IA 1BK1A 4PBPA 2WA4A 4A3XA 4F3JA 1RHI1 2JG8B 1MS9A 3ZFFC 4H3WA 1CJPA 4IERA 1PK6C 1RTVA 2A70A 2QZ2A 3A0NA 4MXVA 4KWKA 1H2MA 3AX4A 4E2GA 2CY6A 1GV9A 1NCQB 1OOPC 1MEC1 1CIWA 3WP3A 1PZ8A 1NA1B 3RDIA 1NXMA 2QCSB 4L92A 4OUMA 4HVQA 2YPJA 3IT8A 1W6PA 1BYHA 1LTEA 2ZX3A 2Z69A 3ZSEA 4OFGA 2E7AA 4FOWA 3FFQA 3MIEA 2X29A 1VBC2 1GZWB 1OA3A 1TMF2 2XBO1 1H2LA 2ZS6B 3U11A 1GR3A 2ATFA 1LOEA 1HXS2 1RC6A 3WNXA 1RITA 4KGQA 4ZXKA 1JTZX 1QJY1 5A3MA 3PJQA 2UWCA 3FZ3A 3M8LA 1S0FA 3GZTB 4N43B 2VMIA 1ZZ8A 1FATA 4WM8C 3VDDC 1BEV3 1LHOA 1OA4A 1XNBA 4I01A 1WW4A 4LA3A 4M3CB 2VMHA 5IUQA 5HBAA 4RA0A 4H7MA 4PIXA 2H0BA 3AP7A 3RQ0A 4P9XA 1GYKA 4HSJA 1DF0A 1BXHA 3MICA 1SCSA 5LRRA 1QXJA 3ROUA 4GMP3 3USSA 3WXPA 1XNDA 3VHRA 3V0BA 5AC92 1UZYA 4CDWC 3V56A 1VB4A 1ZZ6A 3MF6A 2WFF2