5I91A

Structure of mouse acirecutone dioxygenase with to ni2+ and 2-keto-4-(methylthio)-butyric acid in the active site
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
publication title Metal-Dependent Function of a Mammalian Acireductone Dioxygenase.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i91A00
5JSOA 2Q1ZB 1EYBA 3B02A 4MGYE 4QM8A 2PAMA 1IPJA 2Y0OA 1ZX5A 2O1QA 1X7NA 4L11A 1SFNA 5I0SA 2XLGA 4EROA 4KWKA 4MGZE 5KHKA 2I45A 3I59B 2UYBA 3OF1A 4ORFA 1J59A 3MYXA 3HT1A 3CEWA 4IEUA 4P9GA 4AQ2A 1X8EA 3LAGA 2OZ6A 3HT2A 2EAAA 1YUDA 4KWJA 4X6RB 3E5UA 3NVCA 5CU1A 4HN0A 3BALA 3MZHA 3RYRA 1L3JA 1O4TA 5JSRA 2XGXA 1I5ZA 4AVAA 4HLTA 4MH0E 5FLJA 4Q0PA 1WA4A 5F1RA 4JVAA 1NE4A 2QDRA 3UKVA 4F7ZA 2K9ZA 5LEJA 1QXJA 3CL1A 4YRDA 3BCWA 2P17A 2Z2SB 1RUOA 3ETQA 2XHKA 1RGSA 3GBFA 5T3NA 4JV4A 2B8MA 1ZZ6A 3TNQA 1ZNPA 4IEYA 5C6CA 1ZZCA 2MNGA 4I0BA 3TNPB 3RYPA 4E2SA 3OD0A 2XLAA 4K8FA 5JSPA 3FE5A 4PIZA 1CAUA 3E6BA 4LUKA 5EFUA 4IEXA 1J3RA 1YFWA 1FI2A 4MGIE 5I0TA 4WZCA 3JZVA 3OTFA 3D82A 1CAVB 5FPZA 4YYOA 1U12A 3SCHA 1X82A 4D7SA 3ACLA 3UKNA 4EWDA 2QCSB 3HQXA 1OD5A 3EO6A 2XLFA 4PIYA 2BNMA 5JR7B 3FFQA 1PM7A 5KHGA 4N9HA 3BPZA 4FBFA 2ET1A 4IESA 5BUVA 1EY2A 2XL7A 2WC2A 4FT8A 4MX3A 4KU8A 4HBNA 1XRUA 1ZZ9A 2CV6A 5I93A 4I2OA 2PYTA 1NYWA 5JCTA 1ZREA 3H7JA 1O5UA 4BH9A 4H7LA 4XFGA 4HN1A 1QXRA 2PAEA 4Q29A 1SEFA 2O8QA 2PFWA 3DV8A 3N4MA 1LKNA 1O5LA 1O3RA 3G7DA 5CVRA 2GC2A 1ZRDA 5J48A 5BY5A 2ATFA 1YWKA 4JTNA 3E5XA 3CF6E 1J3PA 4XFFA 2K0GA 2H0VA 3FX3A 3RYKA 4YARA 2ET7A 1CX4A 3LZZA 3U0ZA 2WFPA 5LRSA 1NXMA 3NSTA 4LUMA 2IC1A 4XFCA 1DZTA 3FHIB 1LR5A 3ELNA 1X8MA 2PAKA 3EJKA 5FQ0B 3NKTA 3OGJA 2GU9A 4XF1A 1H1IA 2CAVA 4IEZA 5E1RA 4XF3A 3H7YA 1JUHA 1OI6A 4Q0SA 1VR3A 4I0AA 4XFAA 3KCCA 4FAGA 2BNOA 2XL9A 2GC0A 4I01A 1CAWB 4PIXA 2N7GA 3QOPA 3CLPA 3ZDSA 2Q0AA 3E97A 2BEOA 4JTOA 4O9EA 4DINB 3H9AA 4GULA 1HW5A 5E16A 3MDPA 1YHFA 2V09A 2GZWA 3H8UA 2FMYA 4N9IA 4Z07A 2BNNA 1ZRFA 3FZ3A 1RTVA 1DZRA 5FLIA 2D93A 4LTAA 1Q5OA 3ST7A 3UKTA 2OZJA 4IEPA 2Z69A 1J1LA 3ES4A 1LRHA 4HVRA 2PQQA 4QM9A 1EP0A 4XF0A 4XF4A 4E2QA 2KXLA 3I59A 1XE8A 2OA2A 2PTMA 2VECA 1UCXA 4OLLA 4HVQA 4O9GA 3S0MA 2H6BA 1DGWA 4HZFA 3RNSA 3BU7A 3WW2A 3M70A 3NL1A 1O3TA 4NVPA 1Y3TA 5I8TA 3KGZA 4QX5A 3GYDA 5KHIA 1UIKA 2EVXA 1LB2A 1I6XA 1J3QA 4QMAA 2PHDA 3M3IA 3LOIA 4IEVA 3SXWA 3WW1A 4EV0A 4IEOA 3D0SA 5KBFA 1RUNA 1NE6A 3IDCB 4ONUA 4X6QB 5I91A 1CAXB 3H1MA 4ZU4A 1ZRCA 3IDBB 3I7DA 1O7FA 3EBRA 4KL1A 2UY9A 5I8SA 3OCPA 4E2GA 4LLOA 1UIJA 3EHKA 2MHFA 5KHHA 4MZUA 3KGLA 5BV6A 4EWEA 3ROUA 4XEZA 4IEWA 3WW4A 3H3UA 2PHLA 4Z82A 4Q0VA 2VPVA 4WBBA 1ZRRA 3FJSA 3BB6A 3IBMA 4I09A 1CAVA 2XKPA 2IXKA 3E5QA 2VQAA 3PNAA 2FQPA 2UYAA 1O3SA 2UY8A 4OFGA 2XKOA 1IPKA 2CGPA 3WW3A 4KWLA 3R6SA 3KSCA 4BYYA 3LWCA 2B5HA 1VJ2A 4J1WA 2CAUA 3LA3A 1YFYA 1UW8A 2IXJA 4B29A 5JAXA 4LA2A 3USSA 2ZCWA 3SHRA 3FWEA 1ZZ8A 1QWRA 2HKXA 1NZCA 2IXCA 4QXKA 2IXHA 4QGLA 4FAHA 4ZU7A 3DN7A 2BYVE 4CYDA 1RL3A 3IIAA 4R52A 2QVSB 1YFUA 2ETEA 2GH2A 2OPKA 5FPXA 2QJVA 4XETA 4Q0UA 5BXXA 3O14A 3S7IA 2DCTA 1YLLA 4XFIA 2H6CA 4UBHA 3DL3A 2ZKLA 3E6DA 4AVBA 3QACA 2BGCA 3KMHA 2B9UA 2C0ZA 1CAUB 5LRRA 2EA7A 5KHJA 4J1XA 1DGRA 5FCCA 3NJZA 2GC1A 3ES1A 1Q43A 3IWZA 4D7TA 4AQ6A 4XFBA 4L2NA 5FQ0A 4LEJA 1EPZA 3SCGA 1V70A 4MV2A 5C8WA 3H50A 4UXAA 4AXOA 1FXZA 1G6NA 1WGPA 4IERA 1GQGA 4KU7A 1CAWA 5LEKA 1SQ4A 4HSLA 4Q0QA 4QGMA 5D1IA 2PA7A 1GQHA 2E9QA 4QGNA 5J7MA 3S7EA 4A2UA 4MGKE 3H1YA 4RD7A 4ZU5A 2F4PA 5EZWA 1UD1A 2IXIA 1YFXA 1J58A 5K8SA 4MUVA 4TLFA 3VHRA 5FDBA 1PMIA 1Q3EA 4IEQA 1OFNA 3RZZA 3SCFA 1UPIA 1QY4A 1ZZBA 4LULA 2MPFA 1FT9A 2D5HA 1ZZ7A 3CJXA 3PVBB 2D5FA 4R8HA 3E6CC 4F8AA 4I02A 2D40A 5HI0A 4YNIA 3H1WA 4HSJA 4XF9A 4AVCA 5I0RA 3RDIA 4LA3A 3H3ZA 5J3UA 1O3QA 4BHPA 5AVPA 5FLHA 2GAUA 2GC3A 1Y9QA 1OMIA 4HVOA 2QNKA 3U10A 2Q4SA 3DKWA 3NW4A 1VP6A 1TQ5A 3CO2A 4XFHA 3D0JA 1XE7A 3RPQA 5I8YA 1ZVFA 4YSFA 5I0UA 3I54A 4I3PA 4EWAA 2Q30A 3EQEA 3HIFA 4META 1H1MA 2OYZA 1CGPA 4UBGA 1CAXA 3MPBA 4PJYA 3SMHA 1WLTA 4WVZA 3U11A 3PLQA 2IXLA 3L2HA 2HJIA 1RC6A 5BPXA 4HMZA 5CADA 4BIFA 3LA7A 3LA2A 3C3VA 4IETA
chains in the Genus database with same CATH superfamily
5JSOA 2Y38A 2Y6LA 1EYBA 2VCMA 3B02A 1TVGA 3W9AA 2EIBA 3WCRA 2RV9A 1KFXL 1X9TA 1O59A 2Y0OA 3HNBM 3ORJA 3T08A 3ON7A 3V65A 1BCXA 4QX1A 4AEDB 4MG2A 1KRIA 1WMXA 4XE9A 5HBAA 2YPDA 4FPYA 3Q8EA 1W2TA 2ZABA 4L11A 1SFNA 4Y24A 2A3YA 2NLRA 5FOJB 1OH3A 2CDOA 5HCFA 4A7YA 2E32A 1STMA 1ND3C 4P9IA 1VAVA 4WV8A 4MGTA 5KHKA 3I59B 1VBD2 3ASIA 2ZGRA 1HXS2 4TN7A 2YC4A 3MYXA 2VZVA 4RSUA 2PMWB 3SC7X 5C8CA 4IEUA 1GNZA 1YIFA 2OUHA 3FUOA 2ZPXA 4CEYA 1X8EA 1JODA 3E5UA 1NKGA 5K0UB 5GKAC 4HN0A 2E26A 1EUTA 1W6MB 2B7YA 3BALA 1ACCA 4Y3OA 3MZHA 4IV3C 4Q1RA 2IWGB 2GNTA 1Z7S2 4AI8A 2ZMKA 4FQ4A 4HLTA 5FPBA 2D6OX 3ACGA 4GH4B 1DLLA 5DZGA 5F1RA 4JVAA 2BJSA 4AL9A 1OLMA 1QKQA 5J96B 3UKVA 2FDFA 2W1UA 2A75A 3U14A 1OSGA 1OHFA 4P5HA 5FBJA 5A1LA 4A44A 2JG8C 2Y33A 4QT6A 4O65A 1QXJA 5IW0A 5A32B 2E6VA 5LK5A 5BNNA 4LMFA 4XUQA 2Z42A 2G1MA 2Z2SB 2XHKA 2Q8OA 2BBVA 1MQTA 4YZ2A 5FYZA 3AYAA 1ZNPA 4CCMA 4IEYA 1ENXA 4XAEA 3DPRA 5EWSA 5FZBA 4BZ4A 5A6YA 5FY5A 4PDWC 4QXBA 4Y22A 3N9MA 5FY8A 3OGSA 5IAVA 1V00A 1COV3 1UKGA 5BYNA 3IZOA 1QMJA 3AZWA 2YBKA 4GWJA 3RYPA 4E2SA 2ZGPA 3OD0A 4K8FA 3POWA 1COV1 4GZ9A 1U5ZA 2BZDA 3NJVA 3OPZA 4PIZA 2JG9A 4YVWA 2VTFA 1PVXA 1HRI3 1CVNA 2CL2A 2WT1A 5BNOB 2TEPA 3C7EA 3POEA 2HWE2 2XJSA 4D6QA 5GZGA 1HRI1 5I0TA 1M4WA 4G3YC 3VBRB 4OHVA 2ES3A 3PTRB 4HT1T 2W1QA 2DTYA 5H9RA 3ZLIA 3FC0A 2VG9A 3LDBA 3AYDA 3I97A 5H9SA 5AFBA 1GFF2 4M3CA 2ORXA 1WBFA 1UAIA 2EAKA 1C4RA 2KD7A 4U2AA 4XQ4A 2XLFA 3U1XA 1SDWA 1XNDA 2BNMA 2VZSA 1W2UA 2WFF2 5FY9A 1REFA 3OYWA 5JR7B 2DU0A 3M2MA 2HWD3 2ZGTA 3K46A 3W21A 5ABJA 2HWF2 1Q8OA 1FMD1 2VVEA 4IESA 1YJKA 5BUVA 1HQLA 2HWD1 1RXGA 1RYYA 2XL7A 1LJ7A 2Q5TA 2WC2A 4YW6A 1LNSA 4FFFA 4MX3A 4AYUA 5LA1A 3J7HA 2DVDA 4Y5TA 5L36A 4I2OA 2C6SA 3S5QA 2PYTA 5JCTA 3F2ZA 3SQOA 1ZREA 2P2KA 5JI7A 1L7LA 2LTNA 3MO4A 3NWKA 3I2DA 2P6CA 4Y20A 2ZAAA 3M4FA 3KT7A 3FHAA 1VB4A 2W94A 3R4SA 3WVJA 1AR63 2YU2A 4LBLA 3WF3A 1VALA 2JE7A 2PLV3 5F6KA 3ZXDA 1AR61 3N4MA 2VZQA 1O5LA 4EZHA 2PLV1 3G7DA 3IN9A 1VAKA 2JDYA 2VY0A 4IE0A 4CEWB 1G9DA 2TBVA 1ZRDA 5J48A 2QZ3A 4M3CF 4NPLA 2CTVA 5BY5A 4JTNA 3E5XA 3N9QA 4XFFA 4BQ2A 1H1AA 4NHLA 5SV8A 1YC61 4NJ4A 2AR6A 2CWMA 4YARA 4L99A 1SLAA 3IMNA 1CX4A 3KB5A 3LZZA 2X53S 3GXUA 3NJYA 3PMEA 4CEYB 4QX8A 5IT6A 1Z78A 3ZN5A 1DCSA 2TNFA 4P14A 1NXMA 4NIDA 3ZYBA 4K20A 1GWKA 1ULEA 1VRBA 4B8EA 4CDUC 3MIBA 5LATA 1V6KA 1H8TB 1X50A 3O1MA 2XHNA 3CQOA 4DEVA 3QH7A 1G9FA 3OPWA 4Y33A 4XBNA 1QDCA 4OVEA 2R0HA 4YGCA 2ZACA 2EIGA 2RM22 1MS9A 2BERA 2VUCA 1OXCA 2ZAHA 2I07B 5FYIA 5E1RA 1LHVA 5A70A 4XF3A 1SFYA 1DQ5A 3H7YA 4TLGA 1AYM3 5DABA 4D7YA 2W39A 4XUOA 1APNA 4L8QA 5BNNB 4Q0SA 1AYM1 2VQTA 4FAGA 3AP5A 1V6IA 2JB8A 2RS33 4AQSA 3ZFFC 2ZEWA 2LM3A 1V6LA 4XJUA 2XL9A 1GSLA 1CIYA 3J7LA 4XBQA 5JXHA 4I01A 2OUJA 2RS31 4ISQA 4K7JA 2DCYA 3DPRB 2VZTA 5A3LA 3CLPA 1MVQA 3KV9A 1IOAA 4YZ3A 3ZYPA 2WA3A 2UWAA 4Y22B 4AFDA 1WKYA 1K5MA 3RS6A 2BEOA 1B35C 3S30A 4XQDA 2QKDA 1ONAA 3H9AA 1LHOA 4AWDA 4JCKA 1OC1A 2J1VA 1RUF3 2QE3A 4XMAA 3LPGA 3H8UA 1WMFA 3ZYRA 4YZ4A 4A7ZA 2BBAA 2RDSA 1RUF1 1Q8PA 3GNEA 3IPVB 1QOOA 4QX0A 1DZRA 2J1RA 2WNOA 2D93A 4AW7A 5JXIA 3ZFEB 4SBVA 5GZFA 1FNYA 5DMYA 2OZJA 2CNAA 3K51A 2Z69A 5EHDA 3RWKX 1UU5A 2EXJA 5GJ6A 4ASMB 1NA1A 4CRQA 2NYYA 4Q4V2 4DXZA 2G9ZA 1S0FA 5FY0A 1WW6A 4P00B 4N43B 5C33A 2Z4FA 3A23A 3OSDA 3WUCA 5JVVA 1UCXA 3DKQA 4JRLA 5B4XA 5E6HA 4CCCA 5IFPA 1LOGA 4CDQA 1OFSA 1QOSA 1UOBA 2CU5A 4HZFA 2Q8DA 4AI2A 3WW2A 3MFCA 2RS53 2W5FA 1UPSA 2YB7A 1RUE2 2TUNA 3NL1A 4JKKA 2CGNA 5FRAA 5I8TA 1HDKA 3KGZA 3LPFA 2RS51 5F2SA 1BHGA 1PZ9A 2MEV3 2Y60A 1JHNA 2PHDA 1RMU1 3O1SA 3M3IA 4BMEA 4XTPA 3WDYA 2MEV1 4LO7A 4Y5Z0 3AP7A 1WD3A 3MHZA 4IEOA 5FMOS 5DAPA 1AYN3 1OQDA 4JGYA 3BI3A 5I91A 1D4M2 4JGZA 4EZ4A 4BOWA 4LK6A 5C3RA 1AYN1 1WLDA 3MF9A 3O12A 1SPPB 4LK7A 4KL1A 1GOGA 4OHXA 1OUXA 3OCPA 2XOMA 1BMV2 3OBZA 1U0AA 2HWC2 5LY1A 4B4QA 2MHFA 1TZOA 2YUEA 4MZUA 1OH4A 1HQWA 5BV6A 2J7MA 2RMU3 4FOVA 3ZR6A 2W46A 2VMGA 1UWWA 1YJLA 2PELA 2RMU1 1O6UA 5F39A 1PMHX 4Z82A 2XJRA 1ZBE2 2DTWA 3PIJA 3MIGA 4OI1A 5FP3A 3BUCA 2QQUA 4AEJA 2HLEA 4XVHA 2B4KA 1ASJ3 2RVAA 4MSVA 4CUCA 1W8FA 2BWCA 5JZGC 1ASJ1 1LCLA 1D0HA 3LDKA 4CDXA 4WM8A 4AEKA 4C90A 1SG3A 1GKBA 1US3A 4LO6B 4BCUA 4E8DA 3VHOA 4COYA 2FQPA 5FYHA 3RZLA 4RGAA 1O3SA 3I8TA 3VBSC 4XQWA 1O4YA 1OKOA 4GMP0 2XKOA 5FYUA 1RHI3 5GM0A 3TAYA 3TEXA 3ECQA 2CGPA 1UQXA 3OPTA 1UXXX 3VD9A 2DYCA 4IGPA 4M4RA 2VMIA 3LWCA 4EN0A 2YV8A 4N53C 2R063 3NMBA 1VLNA 1H9PA 5GALA 1GP6A 1K5MB 4ISRA 4XIOA 3POFA 2WWSA 3PMSA 5FKCA 1ZRIA 3NQHA 2VOVA 3SH5A 5E8AA 5L9RA 2IXCA 2DUOA 2DFCA 3VDCA 1RJ8A 1IS5A 1QEXA 2IXHA 2VOKA 2L9LA 1RUG3 4L0PA 1AL22 4LBJA 1H4HA 5FMCA 2P4EA 1K3IA 2XB6C 2BGPA 1RUG1 2BYVE 1PO23 1NOVA 4AGRA 1DYOA 1F5FA 1SCSA 3AXEA 3BOPA 3KHCA 1BKZA 1LOEA 3AM2A 1PO21 2GH2A 2BOIA 3WDWA 2FZ2A 4UFLA 2SBAA 5T54A 4XIKA 1QJX2 1RB8G 4RFT0 1E5SA 1OLRA 3PDQA 4XYXA 2JD9A 1DZQA 1RUD2 1EAH3 2XVKA 3PUIA 2VOWA 4XJ9A 1LTEA 4UYBA 1QJFA 5K0UC 5FO9B 1RHI2 2HYXA 1EAH1 2EXHA 5KHJA 4RQPA 1V6JA 1FOD3 4L92A 3LEKA 3NJZA 2D7FA 4Y1VA 2GC1A 2HWB3 5EP9A 3IWZA 4EE2A 5F2WA 1FOD1 2VCBA 4IGOA 4PI0A 1RUI2 4RA0A 4GH4C 1LGCA 4W4ZA 1JZ4A 5IVYA 1YCIA 4PBPA 1LOFC 3PVNA 5FY1A 4WVWA 3HN1A 1V70A 5C8WA 4RR3B 3ZYJB 3LCPA 3POGA 4JGYB 4UXAA 3UK9A 3KT1A 1YYNA 5IYYA 4JGZB 4E8CA 4ARXA 1IS3A 1G6NA 4HKLA 2VUDA 3ZSJA 3H8RA 3AZVA 4IV1A 5T5JA 5A7PA 4AQTA 4IERA 4B4PA 2F4LA 3I3QA 5JMCA 3GDBA 4LJHA 1BBT3 3AKQA 3G6JB 1H2LA 2VZUA 1POV3 2PA7A 3SLIA 5A3MA 2E9QA 1BYHA 2GMEA 4QGNA 1BBT1 4CCOA 1POV1 4MGKE 4RD7A 1UY3A 2IXIA 1OD3A 5FO7B 3URFA 4IEQA 4QPIA 5FZ4A 2RDNA 5BNOC 4LBQA 1DLCA 5EYXA 5H9QA 4WM7B 2EICA 5GZDA 4EN7B 1OLQA 1QY4A 3HR9A 3ILRA 3OUJA 4PT6A 5C4WA 4C91A 3VBRC 5IK8A 2BU9A 3CJXA 3WDUA 4WM8B 4R8HA 1Q8SA 4XJZA 3BGAA 4QKFA 1WCQA 4HK8A 4HSJA 1UY4A 3JBG3 4O61A 2RE9A 2RR13 4CZSA 2JDMA 4LKFA 1IKQA 4LA3A 5C70A 2YGMA 3JBG1 3OG2A 1K42A 3OGRA 1IZ3A 3U07A 4Q5OA 1N47A 1NG0A 4XUNA 1QIQA 5F3GA 5FLHA 1DHKB 2GAUA 4A6SA 2EALA 4D6SA 4EN8B 2GC3A 4HVOA 3U10A 3ZOIA 3WUDA 4NIHA 3RZMA 4YFWA 1VP6A 2P3KA 2ZJCA 2W95A 1XYOA 2LRPA 1QQP3 2W9XA 1RUC3 3BYWA 5JMOA 2E53A 5BNPB 1G9AA 3VDDB 2ZA9A 5L9VA 1RVF3 5FK7A 3W5MA 1XU2A 1QQP1 1RUC1 4HKWA 3O1RA 2VJXA 1W90A 1F4AA 1V9U2 4BLJA 1RVF1 4K1YA 4PCRA 5LBFA 4I3PA 1QJY2 4EWAA 3C7GA 3DF0A 4A42A 3VBOA 2FZ1A 2Y6HA 2Q30A 3V0AA 1W2AX 2A6WA 5C3SA 4Y4RA 5KWRA 4UBGA 1SCRA 2RJKA 3IMMA 2FDGA 1YIPA 4X8PA 3VBHB 4A4AA 1SLLA 3HPNA 4CEWC 2D3SA 3VD5A 3B5LB 1WLTA 2VZRA 4WVZA 5A7NA 5T55A 5EV7A 3PLQA 4CDWA 5FP9A 2HJIA 2DVFA 1IG3A 1UXZA 3UETA 2C9KA 5ACA3 4Q4W3 4HMZA 3MPPG 1XBFA 2YFZA 2YPJA 3A0KA 2LS6A 3UESA 4UWDA 1BVVA 5FK8A 4CEYC 5ACA1 2JDZA 4Q4W1 4B1LA 3DYMA 4XJWA 3C3VA 1WBLA 1QJU2 2Q1ZB 3MUY1 3RFRA 4FPGA 2RR12 3BOWA 1AXZA 3WDXA 2PAMA 5FZ9A 4H7MA 1KS5A 3K4ZA 3HJRA 4YVSB 3RZHA 3WDVA 1YNAA 3ZFFB 5LA0A 4MLOA 4IE6A 1Y9GA 4DIQA 5DUXA 3ENRA 2BTVC 3WG3A 3ETPA 3OF1A 3JU9A 1HX6A 2W68A 2WIIB 3I3BA 1PIV1 4AFAA 4P9GA 1HRV3 2A6YA 5BNNC 4WZFA 3H3LA 4WVMB 3WCSA 2OZ6A 3HT2A 2EAAA 2Q8EA 3NVCA 3ZO0B 1HRV1 1R092 3M3EA 5CA6A 5KXDA 1OQ1A 1CN1A 3DPRC 1KFUL 1KJLA 2WDBA 4BQYA 2JKXA 2Y6JA 1L3JA 1W9FA 1VE0A 3M1HA 1VBC3 3OJBA 2XGXA 4QPGB 4YZ1A 4JDMA 2B42B 5IVCA 4H3WA 4MH0E 3J9SA 1VBC1 1HJFA 4CP9A 3HNYM 2K9ZA 3Q9OA 3J8F2 4F7ZA 3U4XA 4LIVA 1SMVA 1PNFA 2ERFA 4YW3A 2PHFA 4QPIB 3V56A 3CL1A 1H6YA 5FZAA 1OPOA 3LE0A 2QQJA 3ZFEC 4DPNA 5FZ0A 2ADDA 3ETQA 1FPN2 3SKJE 2YROA 1YEWA 4HXCA 3UGFA 3VHPA 3KF5A 5T3NA 1NY71 4JV4A 2C4XA 2B8MA 3V0BA 1ZZ6A 4KGQA 3TNQA 2YY1A 5FYTA 1TME2 2ZX4A 3PL0A 4N43C 1ULOA 2MNGA 3TN91 2W1WA 4BWOA 4I0BA 3VL8A 2OW4A 4LKSA 2X5IB 4AF9A 4CCDA 4BISA 5AC93 3I3MA 3NNLA 4D8MA 5ABJC 2PN5A 3GF6A 5AC91 3FE5A 5E89A 1CAUA 3NNMA 4LUKA 2Y6FA 2VBBA 4FPLA 2DU1A 2WQZC 5FXXA 1W99A 1J3RA 3VHNA 2AREA 1DG6A 3I2JA 4KG0A 2XJUA 2XONA 5A3TA 4M0NA 4WZCA 4URAA 3JZVA 1VRH2 3OTFA 4HKOA 3SEEA 1CAVB 2XJTA 1QGLA 5DN2A 5FPZA 1F35A 1X82A 4D7SA 3BVCA 1KS4A 3AL5A 1ENQA 2PXJA 3ACLA 5A3OA 5FZKA 3ZYHA 2GALA 3GZAA 5IVEA 3ZSLA 4CPBA 4D3WA 1C8M3 1ALYA 4FP3A 3ZN6B 3VBOB 3H0OA 4AG4A 4BQXA 3V0AB 1Q56A 5ERLA 2XBO2 1AJOA 2R072 4W6WA 1T6BX 1W6PB 2WSUA 5CKMA 5L19A 3SEPA 1V0AA 5A7WA 4N9HA 5KHGA 3AXDA 2ET1A 3NNFA 4ATFA 2JIJA 2VR4A 2WNVB 3AP6A 4FT8A 1TE1B 1VBD3 1XJAA 3KVBA 4KU8A 1ZZ9A 5I93A 1JZ2A 1HXS3 2C24A 4IDZA 4LO4B 1G8WA 1NYWA 4GA9A 1VBD1 1UF2C 4FTEA 4FXKB 1HXS1 2ZEZA 3KV5A 5GLTA 1CJPA 1E57A 4HN1A 3AMNA 2LROA 4NUBA 4Q8LA 4UF0B 3MUZ1 3CZUA 4Z8BA 3HBKA 2D6NA 2F6BA 2O8QA 4YG6A 4CU8A 4DNYA 4K9SA 2IFWA 4XUPA 2W91A 2QQMA 2VBDA 1BEV2 5GLWA 1LKNA 4BU2A 5D8AB 4OHWA 5FYSA 1CWPA 1CZVA 5CVRA 1ULPA 2QQWA 3T2TA 5FZ6A 1MR5A 1VBA2 1Z7S3 1SHWB 4DB5A 2R32A 1CQ9A 1ND2A 1U5XA 1I9RA 1W8ZA 1V6OA 4DO0A 1OBNA 4MHRA 4PLOA 1Z7S1 2K0GA 1AX0A 1N1SA 2J1TA 2H0VA 4KQ7A 5FPLA 3POIA 2V5DA 3CJIA 3RYKA 4C0HA 3T1LA 3NV1A 3O0XA 1GV9A 3SISA 5FPVA 1LEMA 1UU4A 2RS12 1C8M2 3ZXKA 3AMQA 3ZN4A 4QDSA 4AI0A 4Y1XA 2IC1A 4LR4A 1WCSA 2XWBB 5GLUA 1POQA 2GNBA 3LDRA 4MADA 3AP4A 1CZSA 1K5MC 4EN9B 3O0VA 1VIWB 5CB7A 3JB4C 2PAKA 1JYTA 5FQ0B 2A71A 5FZFA 3VD7A 2WN2A 4FPKA 2ZZJA 3OGJA 2GU9A 4RS5A 4UAPA 3WQBA 1S55A 2UWCA 4ATEA 4IEZA 1GZWB 3O1TA 4JHZA 1MS4A 3POYA 2WZPP 2OPWA 4RHV3 1AR82 1DQ1A 2WL1A 1GUIA 2HWE3 3NAPB 4IE4A 3MW3A 4GJYA 5FXZA 3QCWA 5C3PA 1C57A 3K2OA 4GD4A 4L9BA 4M0HA 1JMUB 1JYIA 4ASLA 2HWE1 3ZXJA 3V0BB 2WQ4A 4PIXA 3USUB 3QOPA 5F9TA 2PHTA 3WG4A 1IKPA 4YW7A 1AF9A 4LHSA 1MEC2 3NNGA 2Q0AA 3E97A 2WLQA 4LO5B 4DINB 1RUJ2 2VNGA 1WCUA 2VC9A 3WG1A 2BUKA 2XJQA 4QQOA 2YHJA 1KD7A 2WFF3 5E16A 1W9YA 3A7QA 1WW5A 3MDPA 1G9CA 1MZ6A 4Q4Y2 4LXLA 4N9IA 1L7QA 4PI2A 2HWF3 1XYNA 2WFF1 1ZRFA 3FZ3A 1LESA 4FP2A 1FATA 5FLIA 1OUSA 4A7KA 1W05A 4B7EA 4LTAA 4ZZ5A 1Q5OA 2HWF1 3MLJA 4R9CA 4IL7A 2D44A 3ES4A 4HVRA 4D94A 2PQQA 4QM9A 1SBEA 4YM2A 2X8KA 4OZXA 4AHWA 4XF0A 4QQPA 4JKLA 3OY8A 4E2QA 1NCQB 3BTAA 4P9LA 4QWNA 4RR3C 4ZXKA 2XWJB 3WP6A 4OLLA 4TWTA 1PGL2 3AZXA 4JGYC 3GZTB 1YXWA 4JGZC 1DGWA 1JW6A 5T5LA 4XXPA 4RHV2 1O8SA 3BU7A 3RNSA 4AOCA 2AUYA 4QKBA 5FZ7A 1XNBA 4P9XA 4YWAA 4BA6A 3OUHA 2R1BA 1XB9A 4NVPA 5F3CA 1UZZA 1C8NA 2G19A 3A4UA 3FMGA 3MEPA 3PUHA 2D6MA 5FJHA 2BDRA 5KHIA 5JPMB 1UIKA 1LB2A 1XNCA 5DAWA 1WMEA 3UJOA 1H8VA 3KWVA 4QMAA 2A6VA 4FTBA 5IHRA 1TEIA 2Y6GA 3C7HA 1W6OA 4RYDA 3RZJA 5KC6A 2VW2A 2G9FA 3B69A 4CUGA 5FXVA 3ZSKA 2ZBJA 3W59A 1KJRA 2HEYF 4ONUA 4WM7C 3AKRA 3HAGA 1CAXB 2D3RA 3SKVA 3VZKA 3OEAA 4R4XA 4QX2A 5C5UA 2KA3A 4KG8A 3TRSB 3VBUB 2RM23 1O7FA 1R1ZA 4HPKB 4WM8C 3WR0A 4QAWA 4BIOA 5A7OA 5J09A 2WT2A 3ZMOA 2RM21 4LLOA 1EPWA 1UIJA 3EHKA 1WWYA 4N7UA 4UFHA 2OX0A 1OOPA 5KHHA 3I49A 1W0NA 4EWEA 3WNMA 5F8PA 5G05L 4XEZA 2VAUA 1XOYA 2FHRA 2PHWA 1B09A 1XC6A 3THCA 3WW4A 4CUAA 4NIGA 4NAMA 5DUWA 3LFIA 5CFDA 5JWPA 3KVAA 1QF3A 2DUQA 2C1FA 1KDKA 4BMBA 3O1PA 4GKYA 4E4SA 4QB1A 5JUVA 3RRDA 3ILFA 1PO12 3I2HA 3LD8A 3MI8A 5BNPC 3B01A 4QQ2A 3VDDC 1S2EA 4NHMA 4FCAA 4XXAA 5D2AA 2WKKA 2WBKA 2XKPA 3HQUA 2QQOA 4XPVA 3T0AA 4YM0A 5FZ8A 5C8CB 1ULDA 4DS0A 5AC92 2W2IA 3KM5A 4D69A 1IPKA 3J7NA 1MPXA 4DZGA 2OS2A 2QDNA 3PUAA 4KWLA 3GGLA 3VBHC 3KSCA 4JQRA 3ZFGA 1VBE2 2B5HA 4Q4V3 5F3EA 5F3IA 1VJ2A 2WNUA 1NQDA 2R7EB 4FOWA 3LB9A 1GZTA 3LA3A 3QH6A 2BFUS 4K40A 1PHMA 4MYEA 4Q4V1 2YC2A 4LA2A 3IM0A 2WWJA 3BTXA 3LIHA 1ZZ8A 4NRPA 3MBWA 5DG1A 2A73B 1NZCA 1SLIA 4QXKA 3VZOA 1Z0HA 1DQ6A 4FAHA 4XW3A 1ULCA 4YVSC 1RUE3 4HG6B 1UL9A 1CX1A 3OB8A 1C1LA 1FMD2 1LHNA 1OQEA 1MQTB 1RUE1 3HD8B 1UY2A 1US2A 2VQUA 2AGSA 1BXHA 1UOFA 2XH6A 2NP0A 2ZZQA 4KI5M 2ENRA 4W50A 4BM8A 3DYPA 5BXXA 2WAAA 4NWVA 2DCTA 1YLLA 3VB9A 3ZPOA 4MHUA 1H2MA 4UBHA 3PHMA 2ZKLA 3E6DA 3QACA 2GP5A 4AE2A 3WF0A 1YRZA 1D4M3 4DXRA 5CFCA 3H8XA 2JG9B 4YVWB 5CKNA 3THPA 2EIDA 1DYPA 1D4M1 2I74A 2C5DA 3ZMNA 3P3PA 4N7IA 5IATA 2EA7A 1OT5A 4YLZA 3I2KA 4J1XA 3JXSA 5FCCA 1H4GA 1PVC2 1Q43A 2HWC3 2QFEA 1MS1A 5HCBA 4QPGC 1YQCA 3KT4A 2GNDA 4YM1A 1UX7A 4CCNA 4MXWA 1BMV1 2HWC1 5K7PA 4M3CB 4CXXA 2ZMLA 1LOBA 3AKTA 2ZX1A 4QPIC 3OYWB 3HWJA 1ZBE3 4P9YA 2B39A 2Y0IA 1H9WA 3JQWA 5ABJB 2J1UA 2BOJA 4QX7A 4S2FA 4KNCA 3WNLA 1FXZA 4FPJA 1MS3A 1ZBE1 2V4AA 4J25A 5C9AB 1LOAA 2WQ8A 2GN7A 1CAWA 4D0QA 1GOHA 4CCEA 1SQ4A 5HXVA 2BWAA 3E1F1 1UMIA 4QGMA 1BLZA 4CUBA 3U4SA 4A6OA 4IV3A 4XJAA 3MFAA 4Y20B 2X5IC 4MGQA 4A2UA 1HB4A 1CZTA 3GZUC 5HXMA 3ZDVA 4LNVA 2DVGA 1GZCA 2HBTA 2HBUA 1J58A 1VMJA 2V73A 5A1AA 4BXFA 1F4HA 1PMIA 1Q3EA 5L73A 1UYPA 4GWNA 1OFNA 4RGGA 1K5JA 5FPUA 2XVLA 4LKDA 1VAMA 5A80A 3ZPYA 4JRAA 4YPJA 2WAOA 1ZZBA 1PM4A 4LULA 4P02B 4EJRA 2YXSA 5FZOA 3ZSMA 5JOZA 2ZKNA 3Q8CA 1ZZ7A 2VW0A 4OYUA 3PVBB 4UFJA 4DXSA 2CYFA 5HCHA 2O0OA 3PIGA 3E6CC 4I02A 3LGRA 2D40A 3SH4A 3WG2A 1NLSA 1F9KA 4PDWA 4Y4YA 3VBOC 2LALA 1JYWA 3T4HB 5I0RA 1W8TA 3RDIA 3M8LA 3DYOA 4XZPA 1AL23 4GB32 5C3QA 4E4HA 5J3UA 1W2OA 2ZGUA 2JE9A 4UI9L 1O3QA 5ANQA 5DAVA 1AL21 1ZA7A 2ORZA 2OVUA 3AC0A 3C8XA 5FMDA 4OUEA 2WNUB 4AGVA 1Y9QA 1OMIA 3TEWA 2WNVC 2Q4SA 2WR9A 3MV11 3RJ2X 3TWIA 3AB0A 3WV6A 4COVA 5FWEA 1R1A3 3PJQA 3WX5A 3CO2A 4IGQA 3D0JA 4PBOA 1GZ9A 1CR7A 2W3JA 4FQZA 1QJX3 4KWUA 1NAEA 4XURA 2XR4A 2DCKA 1ZVFA 3J7MA 4P9WA 4YSFA 3CZJA 1QJX1 3K77A 1RUD3 3WT3A 4QQHA 4CCKA 3W58A 4YZ5A 2VOTA 2ZHKA 2IVJA 1RUD1 3POBA 2OYZA 2HYKA 1D2QA 1ODMA 1T6GC 5D8AC 4N8MA 1RHI1 1WCKA 3IB3A 1UZVA 4PHZA 1W6NA 4BDVB 1RUI3 2P6HA 3N9PA 3U11A 5F32A 3L2HA 3ZXLA 2WLPA 1SDDB 2R061 3VZMA 1RUI1 3OGGA 2G4IA 4OUMA 3ZSEA 4DY3A 3ZYIB 4KBBA 1TNRA 2BVVA 4Q1PA 2XUEA 3D5OA 4RGKA 2BPA2 2UURA 1HN1A 4OI0A 4R9DA 1WLCA 3HNMA 3T2OA 4JQTA 5DG2A 2O1QA 5FBZA 4NAOA 1NA1B 4P08A 4QPYA 5D21A 3K3OA 5I0SA 2E7QA 4GAZA 3TEYA 3CNAA 1CD3G 5GZCA 2YBSA 2A6ZA 2P3JA 4MGZE 3X29B 1MS8A 1R1A2 4ORFA 1HQNA 2QQPA 4NPRA 1QJZA 1LODA 4JC1A 4CXWA 4YM3A 2NN8A 3HT1A 2HH9A 4CDQB 3NAPC 2BRTA 2BW8A 4QB6A 3JQXA 1CESA 3FBMA 4KWJA 1C3HA 5FYVA 3AX4A 4M4PA 5CU1A 4DUWA 5F5QA 2KR2A 3POJA 4HOOA 4UW5A 1A8MA 1POV0 2NZ9A 2GMPA 5JDBA 2ZGLA 1IQAA 3LOBA 4GJZA 2JEMA 5JSRA 1IS6A 5A7QA 2GH8A 5HV0A 1FV2A 1I5ZA 2HWB1 5I0DA 3B94A 3NKGA 5T5PA 3DEMA 3R0RA 1JYVA 2ZS6B 1WA4A 5DUUA 5LEJA 3VDAA 4DY5A 1O91A 1DQ4A 1S4CA 2AH2A 3PUQA 3AP9A 1WLWA 3RQ0A 4XHBA 1UX6A 2JJ6A 3BCWA 5DZFA 3T3YA 2P17A 2OQ6A 1AL0G 4W6YA 2R0FA 5DPNA 1W39A 2C26A 3OOXA 3KQRA 4XHXA 2WABA 2DVBA 1JH5A 1GBGA 1GWMA 1LECA 3OUIA 1JZ5A 1S1AA 4Z2WA 4QHOA 1L7RA 3RG0A 1V9U3 1NCQC 1QJY3 1ZZCA 2VMDA 5L9BA 3FLRA 1V9U1 3BN6A 2VZOA 5CEHA 1W6QA 2AENA 1QJY1 1UU6A 5AVAA 1WW4A 2D98A 3ZXGA 2E7TA 3ZXAC 1UYYA 5FTTC 5JSPA 3LF7A 1JZ3A 3B9IA 5EFUA 1W3VA 3LFMA 1TMF2 1HJGA 2VUJA 3QD6A 3VBFA 3BIWE 4COZA 4OULA 3I2GA 1A3KA 4TYSA 4MGIE 3O1OA 2RJ2A 3RI9A 1JZ7A 2VMFA 3LEMA 1XSRA 4CDXB 4YYOA 3SCHA 1U12A 3A21A 5FZDA 2B45X 4AFCA 4X8NA 2A3XA 3UKNA 3K75B 3ZVXA 4EWDA 1QJU3 1PGW2 4K6BA 1ZBA2 1OD5A 2Q1MA 3DUIA 1W9SA 3EO6A 4Q4X3 5E88A 3KCYA 2VUAA 4NOTA 4BQ1A 5LW9A 1QJU1 1QJEA 2RR11 5FYYA 2VOXA 2ZGNA 4YGDA 1PM7A 1GYKA 4FBFA 3PURA 1R082 1EY2A 3VBUC 4FVVA 1SACA 1UOJA 3DGTA 4AVVA 4AHYA 3S5AA 2PHUA 3CJIC 1AHSA 1BZWA 2NQYA 2DDUA 1GOFA 4IXLA 4OHZA 2PHXA 1NXD1 1O5UA 3H7JA 4BH9A 3AJYA 5IFTA 3AVRA 2PAEA 3VV1A 1QH7A 1JU4A 2BQPA 1R093 2ID4A 2BFUL 4UW4A 3VUOA 1DDLA 1XSQA 1UYXA 1AXYA 1R091 3CBNA 2JDAA 2FMDA 4XC9A 5J98B 3R4UA 1O3RA 4BJ0A 2DUPA 5ANNA 4CE8A 3EYPA 2GC2A 3TB0A 2SLIA 4DXTA 4PLNA 2VBPA 2ATFA 1VBB3 1YWKA 2ILMA 1OF3A 3PJYA 5JR2A 1UMHA 3CF6E 3UV9A 2YFUA 2ADEA 2Q8CA 1CJDA 2WYFA 1AR92 3J8F3 1I3HA 5C8CC 3MLLA 3MIEA 3T4VA 3J8F1 5JPNB 2P3IA 5LRSA 3GM8A 1QHDA 1C1FA 4GALA 4Q4X2 1FPN3 2XDVA 3JB8A 1W06A 4RQPB 2XJPA 2DBIA 3K3NA 3WINE 1FPN1 1SLBA 3WXPA 4AI9A 4LHLA 1TME3 2YYOA 5BNQA 2BGOA 1DP0A 5L7OA 1DYKA 1X8MA 2A70A 1PK6A 3K4AA 1TME1 4YW1A 1FYUA 5LBEA 4JX0A 1N1YA 4XDOA 3NKTA 4JAAA 5JZGA 2ZHNA 1OVPA 1H1IA 1ULFA 2EXIA 3M3OA 1W04A 1WW7A 2WO3A 1F5JA 1JUHA 4LHNA 2JD4A 1NLRA 1OI6A 4NIAA 3UGHA 3VBSA 2HEWF 1VR3A 3DXUA 4I0AA 3KCCA 4QHZA 1H6XA 3GHMA 4GWIA 4K1ZA 5T5OA 2BNOA 1MQTC 4IV1B 5J36A 2GC0A 5FYMA 5LB6A 1VMHA 1VRH3 2EXKA 4QKDA 2X09A 3IAQA 1AVBA 4H2AA 4WVVA 4AAPA 4A45A 1VRH1 5JOXA 4N53A 3NV4A 3AMHA 2F17A 3HBZA 3CHXA 1EV12 1DGLA 3MIHA 1NCRA 1X33A 1GMMA 1RUH2 1VBB2 1F8VA 1HW5A 2XBO3 1UKRA 3O7OA 2R073 1UY0A 5JXJA 4AI1A 1GR3A 3FBYA 1UN1A 1YHFA 2V09A 2GZWA 2JG9C 2FMYA 4LE3A 2XBO1 4XJ8A 3JD72 4YVWC 2R071 2R30A 4LBQB 3THDA 5HV4A 1D0GA 1ZM1A 3N36A 4NIIA 4BQ4A 3AZYA 3UKTA 4AEDA 5C4WB 1H2NA 2J42A 1J1LA 2XUMA 4YW4A 5FMOL 2IFRA 1LRHA 5LA2A 4OI4A 4RN5A 1HKDA 4KBZA 2ZXQA 5ISLA 3GJAA 1SBFA 3AMPA 3I59A 4R9AA 1XE8A 3D4KA 4F83A 2PTMA 4Y1UA 2VECA 4HVQA 4O9GA 4QXCA 1BEV3 2Z5WA 4JHTA 4AEMA 1AR72 4LHKA 3ZIXA 1QU0A 5A33A 5J1XA 3AKPA 5FZEA 3LEIA 1BEV1 4ES8A 5C9AC 1OURA 1VBA3 3M70A 1QXPA 4XABA 5KXCA 2Y64A 4AGGA 1O3TA 1WZXA 1H0BA 4HK9A 3RGBA 4LBQD 4QX5A 1NUKA 3GYDA 1VBA1 1W6MA 3WNXA 1W8NA 1XXNA 2Y26A 4LE4A 2K2SA 1I6XA 4DFSA 4KGGA 3FLTA 2RS13 3LOIA 4GH4A 1PIV2 2OXBA 4IEVA 3VN4A 4NPMA 4EV0A 1QDOA 3D0SA 4LBOA 1RUNA 1LOFA 4YFZA 5B4NA 5CFDC 2RS11 1C8M1 4ZXEA 1IS4A 5A32A 4XILA 4X6QB 2DV9A 3GCWA 2FDKA 4LPLA 2JDNA 4B3NA 1LULA 3H1MA 4ZU4A 4MO3M 1ZRCA 3IDBB 4XDQA 5IJRA 5GZEA 3AMMA 4CDWB 2VE1A 1HN0A 3I7DA 3TYJA 4CU6A 4FOYA 4XUTA 4QDRA 1DU3D 2UY9A 5I8SA 3BODA 3O5SA 2BVBA 4G9SB 4E2GA 4LO8A 3PU8A 2BV4A 5FV3A 1PNGA 5A1FA 3JCIA 1AR83 5JOYA 3KGLA 4Q2FA 5LBCA 2Y34A 1MZFA 1RJ7A 3CMGA 1REEA 2R042 3ROUA 5CISA 3WF2A 1AR81 3ZYFA 4IEWA 1RIRA 1GLHA 4FTSA 2PHLA 2D6KA 3LSDA 3WZ1A 5F37A 5DQ0A 1ENRA 3AVSA 1PZ7A 2WNUC 2ZGKA 1ZRRA 3AFGA 3MGUA 4GQ7A 4WBBA 3RI8A 5BNOA 1FV3A 4XOGA 1KEXA 1MEC3 1PK6B 5A6ZA 4JKMA 1W0PA 5DZEA 1RUJ3 3BB6A 2JXAA 1W9WA 2V5YA 2X10A 2YZ4A 1MEC1 4I09A 3VBRA 2VXJA 1E5IA 4Q27A 1S0GA 3E5QA 2ARAA 1RUJ1 4FFGA 4A3ZA 2VQAA 4Q4Y3 3PNAA 1Q8VA 3WD5A 1HV0A 3N9OA 4FI9A 4YG0A 5IVVA 3IDAA 4PQQA 4XDPA 5CBLA 2WSVA 4XZUG 5DAXA 1IHMA 2XXZA 2C9AA 1IPSA 1C5HA 3WW3A 4DUXA 4L97A 2VD7A 2WNEA 5FUPA 1LU1A 5FUIA 3QBQA 5KXBA 4ZY9A 5F5AA 4GWMA 1JZ8A 1DQ0A 1WD4A 1YFYA 4RFRB 3VDBA 2IXJA 3OBAA 5EYYA 4B29A 5JIAA 5JAXA 1NCRB 1JI6A 3T0BA 3USSA 5A6XA 1UNBA 1YI9A 4CP9B 3CIHA 5CFCC 2AZ5A 3CKHA 2HKXA 1PGL1 5A6QA 2P5BA 5F5CA 3ACHA 1URXA 5TSWA 4QGLA 3CDZB 1TG7A 2ARCA 4FPCA 3SNMA 2WS92 4RHV1 5IK5A 4EN6B 4H55A 1R64A 1SFPA 3BU0A 1NA1C 2ZX3A 4CYDA 1RL3A 1W8UA 3IIAA 1BVP1 2XQXA 4CEWA 2ZX2A 2QVSB 5DDJ2 4CP1A 3POSA 5IWFA 2GN3A 1LHUA 2QJVA 2JDHA 4XETA 4Q0UA 1LEDA 3O14A 3ITQA 3MIDA 1N3OA 3DL3A 4AVBA 3P1IA 2VVFA 2WZR2 2CSGA 1E5RA 3P5BA 2B9UA 3VKNA 1VPHA 2CGOA 3KCXA 1CAUB 4AZZA 4E9KA 5A33B 5FIXA 4AI3A 5LRRA 3PTYA 1GWLA 1UMZA 2VGDA 4DQAA 3LKJA 2DURA 5KR7A 1S0JA 4IE5A 1H8TA 1N1TA 2O14A 2W08A 4I0WB 2VMEA 1D7PM 4LEJA 3U75A 4FPOB 3I2OA 1EPZA 4C1WA 3ZXFA 2E63A 5C9AA 4OZOA 5EXOA 5C7GA 2JIGA 3H50A 1Y9MA 5CZKA 3ZXEA 3WNNA 3RMYA 5A7WB 2YC0A 1SLCA 3RVHA 4OI2A 1D2SA 1RINA 1PO13 3OBTA 5FZGA 3MV01 2D6LX 1WGPA 4KU7A 1PO11 2P1BA 4H14A 4HSLA 4DRVA 4Q0QA 5D1IA 3I3DA 1I5PA 1GQHA 3RMXA 1JYCA 5FJKA 4COWA 4QXHA 4ZU5A 1YI7A 5EZWA 5IVBA 3N7JA 5K8SA 1YFXA 3S57A 3U78A 5EJ1B 4CPBD 5FOBB 4TLFA 1UOGA 2A6XA 3VHRA 2EIEA 2R6QA 1OA4A 1VBE3 2W0XA 5FY7A 3IPVA 1W8WA 3RZZA 3NO8A 4LITA 3SCFA 4ES9A 3MLKA 1UPIA 3PVEA 1VBE1 1JYNA 3CU7A 2XPJA 1Y7BA 3ZFEA 1FT9A 3WDTA 4R4ZA 3R4DB 1ND2B 1O4ZA 1C5IA 4CDXC 2AEZA 3ILNA 5CNAA 2D5FA 5EJ3A 3BTZA 4F8AA 3CJIB 3FFZA 4LOTA 3H1WA 4N43A 5FR3A 1J83A 3BPSA 5LASA 3AYCA 1JN2P 3H3ZA 3KQ4B 5F6LB 5FYCA 3H42B 4KMQA 5FO8B 1IQDC 2JDPA 1FMD3 3KD4A 5JIUA 4LBMA 4BHPA 1GICA 2VNOA 1OVSA 5LY2A 3KHBA 3HQRA 2P37A 4HL0A 4R9BA 3NW4A 2AC1A 3Q8FA 3I2IA 4FO9A 5FZCA 4Z92B 2WO1A 4XFHA 1X36A 1XE7A 4RS5B 2DWRA 2ZHLA 4DMIA 1DQ2A 1AZDA 2VW1A 5I0UA 1G86A 3I54A 1HB1A 3RZGA 1COV2 4J6GA 1Y43B 4S2GA 4OQ9A 1AX2A 2ZHMA 3K4DA 2R1DA 1PVC3 2JWPA 1GNYA 3I2FA 4CXYA 3UNPA 3B00A 3J4UH 4TXWA 4XBLA 1WMDA 1JOJA 1GNHA 1YQ2A 1HRI2 2JB4A 1PVC1 2OIIA 3MPBA 4LKEA 5APAA 3SMHA 4P9JA 5A3NA 1SPPA 2NMOA 4ZZ8A 3UGGA 1HIXA 4XTMA 5FYBA 1NX9A 2XG3A 4P5YA 4CSWA 5CADA 1TNFA 3NV2A 4BIFA 3LA7A 1NZIA 3LA2A 4NHKA 5CIRA 4W65A 2V4VA 4IETA 4MGYE 3WP5A 3T09A 4C1XA 4QM8A 3UT0A 3WF1A 1IPJA 1F31A 1QH6A 1ZX5A 4RQPC 5IVFA 1HB2A 1N3PA 3N7MA 1J1TA 1X7NA 2HWD2 1IGOA 1GP4A 4UW6A 4D6RA 2DFBA 2XLGA 3N7LA 4EROA 3OY8B 2OKXA 4KWKA 1DBNA 3UYJA 4E4ZA 1XQNA 2I45A 3EXUA 1LAJA 2UYBA 1DGRN 2QQLA 2VXRA 4UW3A 1XU1A 1W8HA 2J1SA 1J59A 3F95A 3ZKUA 4AFMA 5HPOA 5LZ6A 3AJZA 1JYXA 3CEWA 1O8PA 4AQ2A 4DOUA 2LUWA 4G4FA 2CDPA 1PX3A 3LAGA 4ET7A 3H8OA 1YUDA 4TTGA 4X6RB 5LWBA 1W2NA 2FCTA 2WN3A 4IV1C 3S6PA 3VKMA 5HCAA 1AR62 2E33A 3BIEA 1XNAA 1OA2A 2PLV2 4AK3A 3T2PA 3M3QA 4S2HA 4NN0A 2WA4A 3RYRA 3AKSA 1O4TA 4HANA 4B7KA 4E4DX 1A8DA 4TZDA 4FFHA 4AVAA 5LBBA 1CPMA 1G7YA 1K12A 1W6OB 5FZMA 4GB33 4V2WA 5FLJA 1ND3A 4Q0PA 4ZS2A 2QQVA 2YU1A 1NE4A 2QDRA 3AZZA 3WLUA 1S0IA 3THTA 3QLQA 1Y4WA 3AFKA 2J1EA 2FDJA 4GB31 2VMCA 4CP2A 3WNOA 1ENSA 2B46X 4JDOA 3VBFC 4YRDA 3IKWA 3RZKA 5CG8A 5FY4A 2ARBA 2OQ7A 3WP4A 1RUOA 5C4WC 1XNKA 3GBFA 1RGSA 1GANA 2NPIA 3GALA 3O0WA 2RHPA 3J26N 4GIQA 4OCTA 2VM9A 4Q26A 5EPAA 4AVSA 2ZX0A 1KQRA 3HEIA 3NRUA 4XCAA 5C6CA 1F15A 2P34A 5FKBA 4PLMA 3NNJA 3PUSA 1OOPB 2QQNA 3AK0A 3VGIA 3C7FA 4FOQA 4FPFA 1JXNA 3TNPB 2VO5A 1DGWX 2XLAA 5CFDB 2QZ2A 1JHJA 1AYM2 1LGBA 3HOBA 3LSEA 4CCJA 3E6BA 5F5IA 2JG8A 5H9PA 5F7UA 4IEXA 4AAXA 1YFWA 2DVAA 3ZR5A 3B7MA 1FI2A 3WNKA 3M7AA 4AFBA 4C0BA 2RS32 2AACA 2VH9A 3L9JT 2DBNA 1RMU3 2NM1A 3D82A 2VU9A 1OA3A 2QCSB 4F3JA 4V2VA 1RITA 3HQXA 1YQ6A 4LLFA 3T1MA 5FZIA 2GDFA 1JTZX 3KLSA 3OBRA 4K21A 4RR3A 4PIYA 1RUF2 5T52A 1A34A 2E31A 2D97A 3FFQA 1H30A 3ZFGB 3BPZA 1DFQA 3PU3A 3INAA 2WUHA 2H0BA 3Q8BA 4CDWC 5T50A 2O8OA 1N1VA 2WRAA 3M3CA 2RDQA 3V64A 4ZKTB 4HBNA 1XRUA 2CV6A 4NMIA 3WOGA 1JZ6A 4PF5A 1N3QA 1R1A1 2JENA 4H7LA 4LORA 4XFGA 3WEZA 1WA6X 2FDIA 1QXRA 4BE3A 2YBPA 4Q29A 1SEFA 3O1UA 1UZYA 3WHUA 2VTXA 3LIGA 2PFWA 4XMIA 4AR2A 3DV8A 4KH9A 4ZPIA 3P6BA 5L7OC 3JUUA 4WM7A 1PK6C 3O1VA 5FFOC 2RS52 2X29A 1MVEA 1YQ8A 2I2SA 2ZOEB 4IE7A 2CWSA 4ITCA 1J3PA 1RMU2 3FX3A 4GKXA 4O7XA 2MEV2 5FZHA 3NJXA 2ET7A 5CFCB 3GHNA 3U0ZA 3VD3A 3RWNA 5FMBA 1YO8A 1UZWA 2WFPA 1W0OA 3UJQA 2ZEYA 3MW4A 3NSTA 4LUMA 4XFCA 1WCDJ 4BPZA 1DZTA 1RXFA 1AYN2 3FHIB 3LEGA 5FP8A 2UU8A 5A3WA 1LR5A 5A7SA 3N35A 3ELNA 1BK0A 2QQKA 1NCRC 3TEZA 3EJKA 4MXWB 3ATGA 2W47A 2E7AA 2G9GA 2XJVA 1ND3B 4AHZA 3VDDA 3OD4A 5BNPA 5FZLA 5KC5A 4XF1A 5CG9A 1BJQA 2CAVA 4OHYA 1MS5A 4M00A 5DUVA 3ZX7A 1S2KA 5FUNA 1TMF3 1MZEA 1VB2A 2RMU2 3Q8AA 3D8CA 4MVTA 4XFAA 4GMP3 1M06G 4AEDC 1A6CA 4QU1A 2EF6A 5DAQA 1TMF1 3HN3A 1C28A 1HLCA 4QU2A 3VBHA 4GMP1 1CAWB 3IIIA 2N7GA 4LQRA 4MGSA 4CDUA 2QBXA 4AVTA 3ZDSA 2J1AA 2VNRA 4MXVA 1ASJ2 1W3XA 4IV3B 5M0TA 1ZBA3 3A22A 3MICA 4JTOA 1K45A 4O9EA 1V6NA 4GULA 3D6EA 3N9LA 1AJKA 1PGW1 2VCAA 1OKQA 1ZBA1 2FD8A 4UFIA 2DCJA 2JDUA 3BKZA 1LENA 4Z07A 4AHXA 2BNNA 4YGEA 2JG8B 2WO2A 3GCXA 2WT0A 1RTVA 1R083 5C71A 5FWJA 4YVSA 4BK4A 3NV3A 4GXLA 4XCBA 5FZOB 3ST7A 1R081 1QOTA 2D43A 3MW2A 4IEPA 4UFKA 2WJSA 2W92A 3ZFFA 2HEVF 2AEYA 4BLIA 5IUQA 2Z79A 1JUIA 1EP0A 2R062 4NRQA 4Y1YA 5AFEA 4XF4A 4CU7A 4PDWB 4W6XA 2ZGSA 3KV6A 2KXLA 1HV1A 1S0EA 2IUWA 1EUUA 2OA2A 3ACFA 1B35A 1MS0A 2A5ZA 4NR1A 2R16A 3N7KA 2H6BA 4RL7A 3S0MA 4ARYA 3OGVA 3RJRA 1W8OA 4QB2A 4CTEA 4WVMA 4UT5A 1GP5A 4EYUA 3MF6A 1RUG2 5EJZB 1JS9A 1Y3TA 2VTXJ 1S2BA 2FBEA 1CONA 1VMFA 1BQPA 1GU3A 1NT0A 4UFMA 1PO22 1AR93 2A3WA 2EVXA 4M01A 2YG0A 5FP7A 5C5TA 1J3QA 3C2UA 3WNPA 5EIYB 4QPGA 5KXEA 2A1XA 2WWUA 1AR91 4HONA 4NROA 2LW8A 3C7OA 3SXWA 3T2QA 3WW1A 4K3UA 5KBFA 1S0CA 2JDKA 5B2GB 1P8JA 4C8DA 3VLBB 1NE6A 4Q4X1 2QTWB 5GLVA 3IDCB 3APBA 4U36A 3ZKYA 2W87A 1W9TA 4NHXA 1W03A 2VCCA 4IW3A 1EAH2 1AX1A 4URTA 1W6NB 2VL4A 2VVDA 1ND2C 2FDHA 3KV4A 4HFSA 1CPNA 1T2XA 3D3AA 1UO9A 3DCQA 4ZS3A 4YW5A 3EBRA 5IK4A 4XAAA 1FOD2 2HWB2 4JDNA 1LOCA 1KXGA 3KZ4C 5FAXA 3GZEA 4QPWA 5A3UA 3L2YA 1HB3A 2X5IA 3VKOA 1U5YA 1U5IA 3UL2A 4FPHA 2JKBA 3H3UA 3KS7A 1JOBA 3ACIA 4Q0VA 2VPVA 2JICA 4NRMA 4XACA 2RDRA 5JI9A 1F2NA 1W28A 3T30A 1OF4A 3WQ7A 1EV13 3EB7A 3FJSA 1RUH3 1SZBA 3OEBA 4RS5C 3IBMA 3PVOA 5JXGA 4NE9A 5G04L 1CAVA 1EV11 1RUH1 1BBT2 2IXKA 1VBB1 2XQRA 3GBGA 3MIFA 2K46A 3VZJA 1QNYA 2AYHA 3I3EA 3T0DA 3JD73 2UYAA 4PF1A 1E5HA 1XPWA 2UY8A 4FFIA 4OFGA 3TBDA 3ZN6A 2VQ0A 3JD71 3VZLA 4NHYA 1V6MA 1CIWA 1XYPA 2VZ3A 1ZA4A 4N90A 1IG0A 1AUYA 3AL6A 3R6SA 1W6PA 3VL9A 3ME2A 5FP4A 1NQJA 4BYYA 4LOSA 4QX3A 4CDUB 4Q8KA 5CAZA 4J1WA 2CAUA 2FCVA 2WZ8A 1UW8A 3SITA 2WNVA 4B1MA 1XNTA 2OT7A 3WP3A 1ODNA 4CP0A 3WSOA 2JECA 2ZCWA 3SHRA 3N3HA 3FWEA 2D6PA 3KF3A 4ZONA 1QWRA 1AR73 1H2KA 3U37A 4B4RA 3WQ0A 4Y5SA 2GSYA 4UF0A 3JBG2 4LBNA 4S2DA 4Y26A 4BQ5A 1AR71 2PHRA 1KGYA 5DXDA 1FNZA 5JOWA 3AYEA 2WZEA 2ZGMA 4ZU7A 1JU3A 1FAYA 1JBCA 1WUVA 1GQPA 1H8TC 1SBDA 4ASKA 3DN7A 1KDMA 2X05A 3W5NA 1ZYBA 2WO7A 5D8AA 4NO4A 3ALQA 5C3OA 2B9VA 4R52A 4K8RB 1YFUA 2ETEA 2OPKA 4V1PA 2YMZA 4IUGA 4OMCA 5FPXA 1PIV3 2VULA 1DF0A 1J84A 1QQP2 1RUC2 4I30A 1B35B 4NWWA 4XFIA 2H6CA 5SV5A 1W6QB 2UWBA 3S7IA 4Z1VA 1RVF2 4LBKA 3ABZA 4QQLA 2BGCA 3KMHA 4OQ8A 2QQIA 2C0ZA 1AXKA 1PX4A 2RJLA 2RG4A 4MOAA 1JOPA 1ULGA 4A3XA 2J22A 5FZ1A 4CDQC 3VBFB 5K4LA 4LT5A 2DCZA 3VD4A 3B93A 5FPAA 1QNWA 1A78A 4QHBA 1DGRA 2ZGOA 3ZIWA 1UYZA 2YDEA 4BK5A 3I4IA 3GJBA 3ES1A 5EQUA 3EMRA 3B3QE 4COUA 3P3NA 4D7TA 1MACA 3B9CA 4AQ6A 1SLTA 2XVGA 3IDEA 1PMJX 4XFBA 3HVDA 4L2NA 3VKFC 3IT8A 5FQ0A 3TOJA 2CY6A 2R043 3RSJA 5LCWL 4UOJA 5ACA2 4Q4W2 3SCGA 2ZMNA 4YGBA 1GZWA 1OLME 2E51A 2VZ1A 4HETA 4MV2A 2R041 4ZHNA 1OPMA 4CA9A 4AXOA 4YW2A 3NAPA 2BP6A 5A3PA 3A0NA 1G9BA 1X9PA 5K0UA 3WY6A 1GQGA 4CCLA 4I3GA 5LEKA 4FPEA 2Q1FA 3USUA 3TN93 3ZYGA 1S0BA 1OOPC 1XE0A 2JE8A 3DECA 4QKNA 2NMNA 4IQPA 5J7MA 4QDQA 4LIUA 3S7EA 4DUVA 3H1YA 2GP3A 3FN9A 2V72A 2F4PA 4Y1ZA 1ST8A 1UD1A 2ARXA 5IK7A 3FHQA 2XMLA 4MUVA 2VMHA 5K9YA 5J37A 5FDBA 4FXGB 1HRV2 4OMDA 2W1SA 3W20A 4W8JA 2CHHA 1UY1A 2MPFA 1PZ8A 2D5HA 3HMYA 2Y6KA 2FCUA 3GBWA 2JX9A 2WINB 4DRRA 2A7AA 2VNVA 4INDA 1BK1A 5HI0A 4YNIA 4XF9A 1VBC2 4BB3A 3WF4A 1PGSA 1NCQA 4AVCA 1FX5A 5LA9A 2WS93 4M3CE 1S0DA 3SH3A 1I1EA 4QD2A 4FSJA 2WS91 3ZFGC 2DF7A 5AVPA 4Z2AA 2ZTNA 5IAXA 1LU2A 4EQVA 2Y8KA 5L7OB 3IAPA 2QNKA 5DDJ3 1NY72 1LHWA 3DKWA 5FZ3A 1TQ5A 3FL7A 1YQ5A 4BQWA 5DDJ1 1Q8QA 1KITA 1MZ5A 4JZRA 3RPQA 5JZGB 3FLPA 4SLIA 2W52A 2WZR3 3K48A 3TN92 3VZNA 4CVUA 5I8YA 1NLQA 2ZGQA 2P3YA 5FREA 3ZM8A 4E27A 2WZR1 2GNMA 4Q4Y1 2R49A 5GLZA 3VBSB 4A41A 3DXTA 3EQEA 3HIFA 4META 1H1MA 2GMMA 2WYSA 4OUSA 3FUQA 4TSVA 4YG3A 1CGPA 1D4VB 1REDA 2VZPA 4BXSV 2ZEXA 2QUOA 3LQCA 4CU9A 1CAXA 5JLVA 4PJYA 4DEQA 1DIWA 4N53B 2IXLA 2KM2A 5CYYA 2D3PA 3N9NA 1RC6A 3VBUA 2PQSA 5BPXA 4HPKA 4PQ9A 1UZ0A 3BTYA 5LK7B 2IVIB 2IZWA 3VKLA 5CKQA 3WHTA 1LGNA 4BQ3A 3R05A 5IVJA 5FXWA 3WQ1A 2YGLA
chains in the Genus database with same CATH topology
5JSOA 2Y38A 1EYBA 3B02A 3W9AA 3WCRA 2Y0OA 1KFXL 3V65A 4AEDB 1BCXA 1KRIA 4XE9A 5HBAA 4FPYA 2ZABA 4L11A 1SFNA 4Y24A 2A3YA 2NLRA 5FOJB 5HCFA 4A7YA 1ND3C 4P9IA 1VAVA 4WV8A 5KHKA 3I59B 1VBD2 3ASIA 2ZGRA 1HXS2 3MYXA 4RSUA 5C8CA 4IEUA 1GNZA 1YIFA 2OUHA 3FUOA 2ZPXA 4CEYA 1X8EA 3E5UA 5K0UB 5GKAC 4HN0A 1W6MB 2B7YA 3BALA 3MZHA 4IV3C 4Q1RA 2IWGB 2GNTA 1Z7S2 4AI8A 2ZMKA 4FQ4A 4HLTA 2D6OX 4GH4B 1DLLA 5DZGA 5F1RA 4JVAA 1QKQA 5J96B 3UKVA 2A75A 1OSGA 1OHFA 4P5HA 2JG8C 4QT6A 5A32B 1QXJA 2E6VA 5LK5A 5BNNA 2Z42A 2Z2SB 2XHKA 2Q8OA 2BBVA 1MQTA 4YZ2A 3AYAA 1ZNPA 4IEYA 1ENXA 5EWSA 3DPRA 4BZ4A 4PDWC 4Y22A 1V00A 1COV3 1UKGA 5BYNA 1QMJA 3AZWA 3RYPA 4E2SA 2ZGPA 3OD0A 4K8FA 3POWA 1COV1 1U5ZA 3OPZA 4PIZA 2JG9A 4YVWA 1PVXA 1HRI3 1CVNA 2CL2A 2WT1A 5BNOB 2TEPA 2HWE2 2XJSA 5GZGA 1HRI1 5I0TA 1M4WA 4G3YC 3VBRB 4OHVA 2ES3A 4HT1T 2DTYA 5H9RA 3FC0A 2VG9A 3AYDA 5H9SA 5AFBA 1GFF2 4M3CA 1WBFA 1UAIA 2EAKA 1C4RA 4U2AA 4XQ4A 2XLFA 1SDWA 1XNDA 2BNMA 5JR7B 1W2UA 2WFF2 1REFA 3OYWA 2DU0A 3M2MA 2HWD3 2ZGTA 5ABJA 2HWF2 1Q8OA 1FMD1 2VVEA 4IESA 1YJKA 5BUVA 1HQLA 2HWD1 2XL7A 5C9AA 1LJ7A 2Q5TA 2WC2A 4MX3A 4AYUA 2DVDA 5L36A 4I2OA 2PYTA 5JCTA 1ZREA 2P2KA 5JI7A 2LTNA 3NWKA 3I2DA 4Y20A 2ZAAA 3M4FA 3KT7A 1VB4A 3R4SA 3WVJA 1AR63 4LBLA 1VALA 2JE7A 2PLV3 5F6KA 3ZXDA 1AR61 3N4MA 1O5LA 2PLV1 3G7DA 3IN9A 1VAKA 2VY0A 4CEWB 1G9DA 1ZRDA 2TBVA 5J48A 2QZ3A 4M3CF 2CTVA 5BY5A 4JTNA 3E5XA 4XFFA 1H1AA 4NHLA 5SV8A 2AR6A 2CWMA 4YARA 4L99A 1SLAA 3IMNA 1CX4A 3KB5A 3LZZA 2X53S 3PMEA 4CEYB 5IT6A 1Z78A 3ZN5A 4P14A 2TNFA 1NXMA 4K20A 1ULEA 4B8EA 4CDUC 3MIBA 1V6KA 1H8TB 1X50A 3QH7A 1G9FA 4XBNA 1QDCA 4OVEA 2R0HA 4YGCA 2ZACA 2EIGA 2RM22 1MS9A 2ZAHA 2I07B 5E1RA 1LHVA 4XF3A 1SFYA 1DQ5A 3H7YA 1AYM3 4D7YA 2W39A 1APNA 4L8QA 5BNNB 4Q0SA 1AYM1 4FAGA 3AP5A 1V6IA 2RS33 4AQSA 3ZFFC 2LM3A 1V6LA 4XJUA 2XL9A 1GSLA 4XBQA 4I01A 2OUJA 2RS31 4ISQA 4K7JA 2DCYA 3DPRB 5A3LA 3CLPA 1MVQA 1IOAA 4YZ3A 3ZYPA 2WA3A 2UWAA 4Y22B 4AFDA 1K5MA 3RS6A 2BEOA 1B35C 3S30A 4XQDA 2QKDA 1ONAA 3H9AA 1LHOA 4AWDA 4JCKA 1RUF3 2QE3A 4XMAA 3H8UA 1WMFA 3ZYRA 4YZ4A 4A7ZA 1RUF1 1Q8PA 3GNEA 3IPVB 1QOOA 1DZRA 2D93A 4AW7A 3ZFEB 4SBVA 5GZFA 1FNYA 2OZJA 2CNAA 3K51A 2Z69A 1UU5A 2EXJA 5GJ6A 4ASMB 1NA1A 4CRQA 2NYYA 4Q4V2 4DXZA 1S0FA 1WW6A 4N43B 5C33A 3WUCA 5JVVA 1UCXA 4JRLA 1LOGA 4CDQA 1OFSA 1QOSA 4AI2A 4HZFA 3WW2A 3MFCA 2RS53 1UPSA 1RUE2 2TUNA 3NL1A 2CGNA 5FRAA 5I8TA 1HDKA 3KGZA 2RS51 1PZ9A 2MEV3 1JHNA 2PHDA 1RMU1 3M3IA 4BMEA 4XTPA 3WDYA 2MEV1 4LO7A 4Y5Z0 3AP7A 1WD3A 4IEOA 5FMOS 1AYN3 1OQDA 4JGYA 5I91A 1D4M2 4JGZA 4BOWA 1AYN1 1WLDA 3MF9A 3O12A 4KL1A 4OHXA 3OCPA 1BMV2 1U0AA 2HWC2 4B4QA 2MHFA 2YUEA 4MZUA 5BV6A 1HQWA 2RMU3 4FOVA 2VMGA 1YJLA 2PELA 2RMU1 4Z82A 2XJRA 1ZBE2 2DTWA 3MIGA 4OI1A 4AEJA 1ASJ3 4MSVA 2BWCA 5JZGC 1ASJ1 1LCLA 1D0HA 4CDXA 4WM8A 4AEKA 4C90A 1GKBA 4LO6B 4BCUA 3VHOA 4COYA 2FQPA 4RGAA 1O3SA 3I8TA 3VBSC 4XQWA 1O4YA 4GMP0 2XKOA 1RHI3 5GM0A 3TAYA 2CGPA 3ECQA 2DYCA 4EN0A 2VMIA 3LWCA 2YV8A 4N53C 2R063 1VLNA 1H9PA 5GALA 1K5MB 4ISRA 4XIOA 2WWSA 3PMSA 2VOVA 3SH5A 5E8AA 2IXCA 2DUOA 2DFCA 1RJ8A 1IS5A 2IXHA 2VOKA 1RUG3 1AL22 4LBJA 1H4HA 2XB6C 1RUG1 2BYVE 1PO23 1NOVA 4AGRA 1F5FA 1SCSA 3AXEA 3BOPA 1BKZA 1LOEA 3AM2A 1PO21 2GH2A 2FZ2A 3WDWA 2SBAA 5T54A 4XIKA 1QJX2 1RB8G 4RFT0 1OLRA 4XYXA 1DZQA 1RUD2 1EAH3 2XVKA 2VOWA 4XJ9A 1LTEA 5K0UC 5FO9B 1RHI2 1EAH1 2EXHA 5KHJA 4RQPA 1V6JA 1FOD3 4L92A 3NJZA 2D7FA 4Y1VA 2GC1A 2HWB3 3IWZA 1FOD1 1RUI2 4RA0A 4GH4C 1LGCA 1YCIA 4PBPA 1LOFC 3PVNA 4WVWA 3HN1A 1V70A 5C8WA 4RR3B 3ZYJB 3LCPA 4JGYB 4UXAA 3UK9A 3KT1A 1YYNA 4JGZB 1IS3A 1G6NA 4HKLA 3ZSJA 3AZVA 4IV1A 5T5JA 4AQTA 4B4PA 4IERA 5JMCA 1BBT3 3AKQA 3G6JB 1H2LA 1POV3 2PA7A 3SLIA 5A3MA 2E9QA 1BYHA 2GMEA 4QGNA 1BBT1 1POV1 4MGKE 4RD7A 2IXIA 5FO7B 3URFA 4IEQA 4QPIA 5BNOC 4LBQA 5EYXA 5H9QA 4WM7B 5GZDA 4EN7B 1OLQA 1QY4A 3HR9A 3ILRA 5C4WA 4C91A 3VBRC 5IK8A 3CJXA 3WDUA 4WM8B 4R8HA 1Q8SA 4XJZA 4HK8A 4HSJA 3JBG3 2RE9A 2RR13 4CZSA 1IKQA 4LA3A 2YGMA 3JBG1 1IZ3A 3U07A 1N47A 1NG0A 5FLHA 1DHKB 2GAUA 4EN8B 2EALA 2GC3A 4HVOA 3U10A 3WUDA 4YFWA 1VP6A 2P3KA 2ZJCA 1XYOA 1QQP3 1RUC3 2E53A 5BNPB 1G9AA 3VDDB 2ZA9A 1RVF3 1XU2A 1QQP1 1RUC1 4HKWA 4BLJA 1V9U2 1RVF1 4K1YA 4PCRA 4I3PA 1QJY2 4EWAA 3DF0A 3VBOA 2FZ1A 2Q30A 3V0AA 2A6WA 5KWRA 4UBGA 1SCRA 2RJKA 1YIPA 4X8PA 3VBHB 1SLLA 4CEWC 2D3SA 3B5LB 1WLTA 4WVZA 5T55A 5EV7A 3PLQA 4CDWA 2HJIA 2DVFA 5ACA3 4Q4W3 4HMZA 3MPPG 3A0KA 2YPJA 1BVVA 4CEYC 5ACA1 2JDZA 4Q4W1 4XJWA 3C3VA 1WBLA 1QJU2 2Q1ZB 4FPGA 2RR12 3BOWA 1AXZA 3WDXA 2PAMA 4H7MA 1KS5A 4YVSB 3WDVA 1YNAA 3ZFFB 4MLOA 5DUXA 3ENRA 2BTVC 3WG3A 3OF1A 3JU9A 1HX6A 2W68A 2WIIB 1PIV1 4AFAA 4P9GA 1HRV3 2A6YA 5BNNC 4WZFA 4WVMB 3WCSA 2OZ6A 3HT2A 2EAAA 3NVCA 3ZO0B 1HRV1 1R092 3M3EA 5CA6A 5KXDA 1OQ1A 1CN1A 3DPRC 1KFUL 1KJLA 1L3JA 3OJBA 3M1HA 1VBC3 4YZ1A 2XGXA 4QPGB 4JDMA 2B42B 4H3WA 4MH0E 3J9SA 1VBC1 4F7ZA 2K9ZA 3Q9OA 3J8F2 3U4XA 1SMVA 1PNFA 2ERFA 4YW3A 2PHFA 4QPIB 3V56A 3CL1A 1OPOA 3ZFEC 4DPNA 3ETQA 1FPN2 2YROA 3VHPA 5T3NA 1NY71 4JV4A 3V0BA 2B8MA 1ZZ6A 4KGQA 3TNQA 2YY1A 1TME2 2ZX4A 4N43C 2MNGA 3TN91 4BWOA 4I0BA 3VL8A 2OW4A 4AF9A 2X5IB 5AC93 5ABJC 2PN5A 3GF6A 5AC91 3FE5A 5E89A 1CAUA 4LUKA 4FPLA 2DU1A 2WQZC 1J3RA 3VHNA 2AREA 1DG6A 4KG0A 2XJUA 4M0NA 4WZCA 3JZVA 1VRH2 3OTFA 4HKOA 1CAVB 2XJTA 1QGLA 5FPZA 1X82A 4D7SA 1KS4A 1ENQA 3ACLA 2GALA 3GZAA 3ZSLA 4D3WA 1C8M3 1ALYA 4FP3A 3ZN6B 3VBOB 3H0OA 4AG4A 3V0AB 1Q56A 2XBO2 1AJOA 2R072 4W6WA 1W6PB 2WSUA 5L19A 5KHGA 4N9HA 3AXDA 2ET1A 4ATFA 2WNVB 3AP6A 4FT8A 1TE1B 1VBD3 4KU8A 1ZZ9A 5I93A 1HXS3 4LO4B 1G8WA 1NYWA 4GA9A 1VBD1 1UF2C 4FTEA 4FXKB 1HXS1 5GLTA 1CJPA 1E57A 4HN1A 3AMNA 4Q8LA 4Z8BA 2D6NA 2F6BA 2O8QA 4YG6A 4DNYA 4K9SA 2IFWA 1BEV2 5GLWA 1LKNA 5D8AB 4OHWA 5CVRA 3T2TA 1MR5A 1VBA2 1Z7S3 4DB5A 2R32A 1CQ9A 1ND2A 1U5XA 1I9RA 1V6OA 4PLOA 1Z7S1 2K0GA 1AX0A 1N1SA 4KQ7A 2H0VA 3CJIA 3RYKA 4C0HA 3T1LA 3NV1A 3O0XA 1GV9A 3SISA 1LEMA 1UU4A 2RS12 1C8M2 3ZXKA 3AMQA 3ZN4A 4AI0A 4Y1XA 2IC1A 4LR4A 1WCSA 2XWBB 5GLUA 2GNBA 3AP4A 1K5MC 4EN9B 3O0VA 1VIWB 5CB7A 3JB4C 2PAKA 5FQ0B 2A71A 4FPKA 2ZZJA 3OGJA 2GU9A 4RS5A 1S55A 2UWCA 4ATEA 4IEZA 1GZWB 1MS4A 3POYA 2WZPP 4RHV3 1AR82 2WL1A 1DQ1A 2HWE3 3NAPB 3MW3A 3QCWA 1C57A 4L9BA 4M0HA 1JYIA 4ASLA 2HWE1 3ZXJA 3V0BB 2WQ4A 4PIXA 3USUB 3QOPA 5F9TA 2PHTA 3WG4A 1IKPA 1AF9A 1MEC2 2Q0AA 3E97A 2WLQA 4LO5B 4DINB 1RUJ2 2VNGA 3WG1A 2BUKA 2XJQA 4QQOA 2YHJA 1KD7A 2WFF3 5E16A 3MDPA 1G9CA 1WW5A 1MZ6A 4Q4Y2 4N9IA 2HWF3 1XYNA 2WFF1 1ZRFA 3FZ3A 1LESA 4FP2A 1FATA 5FLIA 4B7EA 4A7KA 4LTAA 1Q5OA 2HWF1 3MLJA 4R9CA 4IL7A 2D44A 3ES4A 4HVRA 4D94A 2PQQA 4QM9A 1SBEA 4YM2A 2X8KA 4OZXA 4AHWA 4XF0A 4QQPA 3OY8A 4E2QA 1NCQB 3BTAA 4P9LA 4RR3C 4ZXKA 2XWJB 3WP6A 4OLLA 4TWTA 1PGL2 3AZXA 4JGYC 3GZTB 1YXWA 4JGZC 1DGWA 1JW6A 5T5LA 4XXPA 4RHV2 3RNSA 3BU7A 2AUYA 1XNBA 4P9XA 4BA6A 2R1BA 4NVPA 1UZZA 1C8NA 3A4UA 3MEPA 3FMGA 2D6MA 5KHIA 5JPMB 1UIKA 1LB2A 1XNCA 1WMEA 3UJOA 1H8VA 4QMAA 2A6VA 4FTBA 1TEIA 1W6OA 5KC6A 2VW2A 2G9FA 3B69A 3ZSKA 2ZBJA 3W59A 1KJRA 2HEYF 4ONUA 4WM7C 3AKRA 3HAGA 1CAXB 2D3RA 3VZKA 4R4XA 2KA3A 4KG8A 3TRSB 3VBUB 2RM23 1O7FA 1R1ZA 4HPKB 4WM8C 3WR0A 4BIOA 5J09A 2WT2A 3ZMOA 2RM21 4LLOA 1EPWA 1UIJA 3EHKA 4N7UA 1OOPA 5KHHA 4EWEA 4XEZA 2FHRA 2PHWA 1B09A 3WW4A 5DUWA 5CFDA 1QF3A 2DUQA 2C1FA 1KDKA 4BMBA 4GKYA 4E4SA 3RRDA 3ILFA 1PO12 3MI8A 5BNPC 3B01A 4QQ2A 3VDDC 4NHMA 4FCAA 4XXAA 2WKKA 2XKPA 4XPVA 4YM0A 5C8CB 1ULDA 5AC92 3KM5A 4D69A 1IPKA 4DZGA 2QDNA 4KWLA 3VBHC 3KSCA 4JQRA 3ZFGA 1VBE2 2B5HA 4Q4V3 1VJ2A 2WNUA 1NQDA 4FOWA 3LB9A 3LA3A 3QH6A 2BFUS 4K40A 1PHMA 4MYEA 4Q4V1 4LA2A 3IM0A 1ZZ8A 5DG1A 2A73B 1NZCA 1SLIA 4QXKA 3VZOA 1Z0HA 1DQ6A 4FAHA 4XW3A 1ULCA 4YVSC 1RUE3 1UL9A 1C1LA 1FMD2 1LHNA 1OQEA 1MQTB 1RUE1 3HD8B 2AGSA 1BXHA 2XH6A 2NP0A 2ZZQA 2ENRA 4BM8A 5BXXA 4NWVA 2DCTA 1YLLA 1H2MA 4UBHA 3PHMA 2ZKLA 3E6DA 3QACA 4AE2A 1YRZA 1D4M3 5CFCA 2JG9B 4YVWB 3THPA 1DYPA 1D4M1 2I74A 2C5DA 3ZMNA 3P3PA 4N7IA 2EA7A 4YLZA 4J1XA 5FCCA 1H4GA 1PVC2 1Q43A 2HWC3 2QFEA 1MS1A 5HCBA 4QPGC 3KT4A 2GNDA 4YM1A 4MXWA 1BMV1 2HWC1 5K7PA 4M3CB 2ZMLA 1LOBA 3AKTA 2ZX1A 4QPIC 3OYWB 3HWJA 1ZBE3 4P9YA 2B39A 2Y0IA 1H9WA 3JQWA 5ABJB 4S2FA 4KNCA 1FXZA 4FPJA 1MS3A 1ZBE1 5C9AB 1LOAA 2GN7A 1CAWA 1SQ4A 5HXVA 2BWAA 4QGMA 4IV3A 4XJAA 3MFAA 4Y20B 2X5IC 4A2UA 3GZUC 4LNVA 2DVGA 1GZCA 1J58A 2V73A 5L73A 1PMIA 1Q3EA 4GWNA 4RGGA 1OFNA 2XVLA 1VAMA 3ZPYA 4JRAA 1ZZBA 4LULA 4EJRA 2YXSA 3ZSMA 5JOZA 2ZKNA 1ZZ7A 2VW0A 3PVBB 2CYFA 2O0OA 3E6CC 4I02A 3LGRA 2D40A 3SH4A 3WG2A 1NLSA 1F9KA 4PDWA 4Y4YA 3VBOC 2LALA 5I0RA 3RDIA 3M8LA 4XZPA 1AL23 4GB32 5J3UA 2ZGUA 2JE9A 1O3QA 1AL21 2OVUA 2WNUB 4AGVA 1Y9QA 1OMIA 2WNVC 2Q4SA 3TWIA 3RJ2X 3AB0A 3WV6A 4COVA 1R1A3 3PJQA 3WX5A 3CO2A 3D0JA 4PBOA 1GZ9A 1CR7A 4FQZA 1QJX3 2DCKA 1ZVFA 4P9WA 4YSFA 1QJX1 3WT3A 1RUD3 4QQHA 3W58A 4YZ5A 2ZHKA 1RUD1 2OYZA 2HYKA 1D2QA 1T6GC 5D8AC 1RHI1 1WCKA 1W6NA 1RUI3 3U11A 3ZXLA 3L2HA 2WLPA 2R061 3VZMA 1RUI1 3OGGA 2G4IA 4OUMA 3ZSEA 4DY3A 3ZYIB 4KBBA 1TNRA 2BVVA 4Q1PA 3D5OA 2BPA2 2UURA 4OI0A 4R9DA 1WLCA 5DG2A 2O1QA 5FBZA 1NA1B 4QPYA 5I0SA 2E7QA 3CNAA 1CD3G 5GZCA 2A6ZA 2P3JA 4MGZE 3X29B 1MS8A 1R1A2 4ORFA 1HQNA 2QQPA 4NPRA 1QJZA 1LODA 4JC1A 4YM3A 2NN8A 3HT1A 4CDQB 3NAPC 2BW8A 3JQXA 1CESA 3FBMA 4KWJA 1C3HA 3AX4A 5CU1A 5F5QA 4UW5A 1A8MA 1POV0 2NZ9A 2GMPA 5JDBA 2ZGLA 1IQAA 3LOBA 2JEMA 5JSRA 1IS6A 2GH8A 1FV2A 1I5ZA 2HWB1 3B94A 3NKGA 5T5PA 3R0RA 2ZS6B 1WA4A 5DUUA 5LEJA 4DY5A 1O91A 1DQ4A 2AH2A 3AP9A 1WLWA 3RQ0A 4XHBA 1UX6A 2JJ6A 3BCWA 5DZFA 2P17A 1AL0G 4W6YA 2R0FA 1W39A 3KQRA 4XHXA 2DVBA 1JH5A 1GBGA 1LECA 1S1AA 4Z2WA 3RG0A 1V9U3 1NCQC 1QJY3 1ZZCA 3FLRA 1V9U1 1W6QA 2AENA 1QJY1 1UU6A 5AVAA 1WW4A 2D98A 3ZXGA 2E7TA 3ZXAC 5FTTC 5JSPA 3B9IA 5EFUA 1TMF2 2VUJA 3QD6A 3VBFA 4COZA 3BIWE 4OULA 4TYSA 1A3KA 4MGIE 3RI9A 4CDXB 4YYOA 3SCHA 1U12A 4AFCA 2B45X 4X8NA 2A3XA 3UKNA 3ZVXA 4EWDA 1QJU3 1PGW2 4K6BA 1ZBA2 1OD5A 2Q1MA 3DUIA 3EO6A 4Q4X3 4BQ1A 5E88A 3KCYA 2VUAA 4NOTA 5JWPA 1QJU1 2RR11 2VOXA 2ZGNA 4YGDA 1PM7A 1GYKA 4FBFA 1R082 1EY2A 3VBUC 4FVVA 1SACA 3DGTA 4AVVA 4AHYA 2PHUA 3CJIC 1AHSA 1BZWA 2NQYA 4IXLA 4OHZA 2PHXA 1NXD1 1O5UA 3H7JA 4BH9A 3AJYA 2PAEA 3VV1A 1QH7A 2BQPA 1R093 4UW4A 2BFUL 3VUOA 1DDLA 1AXYA 1R091 2FMDA 5J98B