2A6YA

Crystal structure of emp47p carbohydrate recognition domain (crd), tetragonal crystal form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
231
Chain Sequence
DASKLSSDYSLPDLINTRKVPNNWQTGEQASLEEGRIVLTSNQNSKGSLWLKQGFDLKDSFTMEWTFRSVGYSGQTDGGISFWFVQDSNIPRDKQLYNGPVNYDGLQLLVDNNGPLGPTLRGQLNDGQKPVDKTKIYDQSFASCLMGYQDSSVPSTIRVTYDLEDDNLLKVQVDNKVCFQTRKVRFPSGSYRIGVTAQNGAVNNNAESFEIFKMQFFNGVIEDSKLITKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Emp47p (form1)
publication title Structures of the carbohydrate recognition domain of Ca2+-independent cargo receptors Emp46p and Emp47p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Sugar binding protein
total genus 60
structure length 231
sequence length 242
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2a6yA00
4Y26A 1LESA 1ENSA 4PCRA 2W39A 2H0BA 5HCAA 2OUHA 1W0OA 3OBRA 2CY6A 2D6KA 1WW7A 2P3IA 2ZZJA 1S0EA 1VAVA 1YO8A 2AR6A 3WUCA 1UL9A 4C1WA 1OFSA 2Q5TA 4C1XA 3IMNA 1JN2P 1SCRA 1WW6A 1YYNA 2A6YA 2WT0A 3C2UA 4LBJA 1GV9A 2GDFA 3IPVB 4R9DA 4GKYA 4M01A 2ZKNA 1I3HA 2ZGRA 4P9YA 1IOAA 1VLNA 1XQNA 1Q8QA 3LSEA 4L8QA 1DZQA 4XHBA 4YW3A 2VU9A 1GZWA 3WG4A 1KJRA 4P14A 3V0AA 1YXWA 1KITA 2LALA 3O0WA 3WOGA 3WCSA 2D43A 3WDUA 1BJQA 3DUIA 3NV2A 1G8WA 3ZXLA 4FOQA 3WCRA 5HCBA 4YW2A 4GKXA 2EXJA 1F31A 1F5FA 2E53A 1MS1A 1MS3A 1MZ5A 1LEDA 3N35A 1DBNA 3VUOA 1KRIA 3CNAA 4Y1UA 1UKGA 2AH2A 4XIKA 4M3CA 2ZGMA 4BPZA 1ULEA 4LBMA 3AZZA 4HANA 2V73A 2DTYA 5IUQA 3USUA 3FUQA 3VKLA 4PF5A 3A0NA 3O5SA 2OUJA 1ULGA 4FPLA 2WSUA 1LHWA 1IS6A 3WVJA 3ZSKA 2ZGNA 1DQ4A 1CPNA 3AP4A 3AXDA 2ZGSA 1MS9A 1CVNA 2GMPA 3AP5A 1FV2A 3APBA 1H9WA 3M3EA 4NOTA 4YM0A 1QDOA 4YW4A 1W6QA 2ZAAA 4R9AA 3ZYRA 4KBBA 4YW5A 3T1LA 1AF9A 1JUIA 1S0GA 4Y20A 4YW1A 2CNAA 4AYUA 2CWMA 3WV6A 5AVAA 1N3QA 4JCKA 2ZA9A 3WDWA 3ILRA 1S0BA 4WV8A 4XJ9A 1GZWB 2E7QA 1LCLA 1ULDA 4DS0A 3V0AB 2ZMLA 2DVFA 2P3KA 3ASIA 1N1TA 5SV8A 3WG2A 3RMXA 1Q56A 2WLQA 4YGDA 3HMYA 1CIWA 3MPPG 2TEPA 2VH9A 3FFZA 5T55A 4AGGA 4YG3A 1FAYA 1IS5A 2CWSA 2DUOA 1RIRA 5DG2A 3NV4A 2E6VA 1SBDA 2A7AA 4TZDA 2VY0A 4XIOA 3OPZA 4GA9A 4XXAA 3R4SA 4XJAA 5FRAA 1N1VA 2PHFA 2UU8A 3FLPA 1MZ6A 4ISQA 1DYPA 1AXYA 2WJSA 5GLZA 3MW3A 2C5DA 3ZSMA 1Q8VA 1F9KA 1MS8A 1CR7A 4M3CB 3VKMA 1JW6A 5JOWA 2R0FA 1H30A 1LGNA 1RINA 4Z8BA 5KXBA 1CESA 1LOCA 1ENRA 4JRAA 2YV8A 4UW4A 1AXZA 1V6JA 2DUPA 2ZHNA 4BLIA 4K20A 3NV1A 1OQ1A 5F5QA 3JUUA 1O4ZA 1QF3A 1GYKA 1JYCA 1G7YA 2KM2A 3WUDA 1FNZA 1W6QB 4ASMB 4DRRA 1G86A 5JLVA 5IK7A 3MW2A 1AZDA 5KXEA 1YIFA 1SFYA 2R1DA 4FOYA 5HCFA 4Y20B 1R1ZA 5H9PA 5GZEA 4ATFA 4F83A 1SCSA 2ES3A 4HL0A 5GLWA 3ZPYA 1WD3A 2P34A 2PELA 3I4IA 2DYCA 4RA0A 4XJZA 2R0HA 4P9XA 3DGTA 2I2SA 2ZGPA 1G9AA 1HDKA 1UZZA 3NWKA 1FV3A 3NV3A 3D6EA 5GLVA 5H9SA 5L73A 4BQ1A 3M3CA 5GJ6A 1AJOA 1ZM1A 4YZ5A 2D6NA 3IN9A 4PBOA 3M2MA 4AGVA 2D6OX 2NYYA 4PQ9A 2FMDA 1JBCA 5DUUA 4BOWA 2WT1A 2WQZC 1N1SA 1U0AA 4FPYA 5DZGA 3UJQA 4GXLA 1HLCA 4GWNA 2AREA 4Y1VA 4DPNA 1VAMA 4YGBA 1LJ7A 2W08A 1W0PA 4P9WA 1X50A 3ZSLA 4I30A 3ZXKA 1LOEA 5T5JA 1ZA4A 2JKBA 1AX0A 1SLTA 2VUAA 1A3KA 4LBNA 1YRZA 4XJWA 3B00A 4AGRA 1G9DA 3OY8A 2V5YA 1N3OA 4ZXKA 3SH4A 1AVBA 2ZMKA 2PHRA 4Y1YA 5GZFA 3U4XA 5DUWA 1C57A 2ZHMA 5GLUA 3AZYA 1SLLA 1JYIA 4FVVA 1UN1A 3BIWE 4Q8KA 1SLAA 1WLDA 3M3OA 1UMZA 1KQRA 3BTAA 4XBQA 4XMAA 1Q8OA 1SBEA 2VXRA 1YI7A 1JHNA 1TEIA 2W68A 1AX1A 2E51A 4XBLA 2ZABA 4WZFA 1LECA 2C9AA 4FQ4A 1QKQA 1DQ5A 5H9QA 2P3JA 1WLCA 3LCPA 3WG1A 1AXKA 1FATA 4M3CE 4XYXA 2R1BA 1WD4A 3WHTA 4BMBA 3N7LA 1LEMA 2YZ4A 1V6KA 4D69A 3M3QA 3HN1A 3T2TA 3UK9A 4YGEA 1OKQA 3KM5A 3ZYPA 3RQ0A 2AGSA 3GALA 3A4UA 4AVTA 3WDYA 5CNAA 3ZXJA 3WDTA 3ZSJA 4YZ2A 2GN7A 5H9RA 2A75A 3AYCA 3OBTA 2VW0A 1ULCA 1DQ1A 4Q27A 1Z78A 2D44A 2JJ6A 4XDQA 2W52A 1GICA 4YM1A 1GZ9A 3OYWB 3N36A 1JXNA 1LOGA 4XTPA 4Q2FA 3N7MA 4R9BA 1BZWA 3UL2A 3OY8B 5JDBA 1QNWA 3SNMA 2A3YA 4IQPA 3D4KA 3PMEA 1FNYA 2DU0A 3V64A 1KJLA 1V6IA 3WDVA 4AWDA 2JE9A 3N7JA 2EXIA 1WLWA 2ZACA 2OW4A 5JOYA 1SLBA 3WHUA 1LHUA 3AXEA 4FPHA 5DZFA 2A71A 3ATGA 3AFKA 3WZ1A 3SLIA 2CTVA 1W6OB 2ZHKA 2A6WA 1LODA 5EYYA 3AZVA 3V65A 4FPKA 4AVVA 1ONAA 1IS4A 2DVGA 3O0XA 2VW1A 1S1AA 1V6NA 4R9CA 4K21A 3PVOA 1WW5A 3ILNA 1KDKA 1UPSA 2ERFA 2D6LX 1QGLA 5IK8A 2BQPA 2A3XA 1PZ8A 5T5PA 1LOFC 1V6MA 2ZGTA 3AP7A 5T50A 1C1FA 1V00A 4UW5A 4ZKTB 2D3PA 2WSVA 4AVSA 3N7KA 2Z42A 4Q26A 3AJYA 4FPCA 1ULFA 3PVEA 4SLIA 4XJ8A 2NMNA 2R49A 4XHXA 4YFWA 3RS6A 1GBGA 1V6OA 4CTEA 2SBAA 4GALA 3V0BB 1Z0HA 1LU2A 2GN3A 3AJZA 4U2AA 4LBQD 2PHTA 2JECA 4XXPA 3OGGA 2EAKA 1RITA 3SH5A 1SLCA 1GSLA 2NZ9A 5JOZA 2A3WA 1SLIA 4GWMA 4FP2A 4XTMA 5KXDA 1J1TA 1BYHA 1WCSA 5EYXA 5T52A 3VKNA 5IK4A 5JMCA 3AZWA 1WW4A 1GNZA 2P2KA 2FHRA 4LBOA 1ENQA 2JDZA 3JU9A 4FPGA 2NM1A 1LHVA 2A70A 4XILA 1LOAA 3VKFC 3WDXA 3SISA 5IT6A 2ZGQA 3I8TA 3INAA 4BMEA 1LULA 3KQRA 1CJPA 1MVEA 1CPMA 1CN1A 1S0CA 5JOXA 1MVQA 5GZDA 4YZ1A 1SBFA 3B01A 3ZXEA 2YROA 4ITCA 5BYNA 1MACA 3TAYA 4FPOB 4PBPA 1HKDA 1W6NA 2D7FA 4YGCA 1S0IA 3OYWA 2DVDA 1S0JA 3W58A 2B7YA 2EXKA 2ZBJA 4ISRA 3SH3A 4XJUA 2R16A 4UW6A 3MEPA 4YM2A 1QMJA 2CYFA 2UWBA 2ZMNA 2A6VA 4YZ3A 3AYAA 2UWAA 4CZSA 1H9PA 1B09A 3B3QE 1D2SA 1O4YA 1G9FA 5EXOA 1N3PA 4RL7A 2GNTA 1W6OA 4XOGA 1CONA 2LTNA 5DG1A 5JVVA 5KXCA 1WBLA 4YZ4A 1LHOA 4Y22B 1I1EA 3HR9A 2DVBA 4M3CF 3N3HA 3RSJA 1LGBA 4LBQA 1GLHA 3R4UA 2DUQA 5E88A 1IS3A 3ILFA 4FPEA 5T5LA 5E8AA 3VKOA 3AP9A 2P37A 4XZPA 4YM3A 1Q8SA 2EALA 2D3SA 2DURA 1G9BA 2GNDA 1S0FA 1W6MA 2ZGKA 5DXDA 1JOJA 3QCWA 3AP6A 5GLTA 1DHKB 4OZXA 1KDMA 2G4IA 1QOSA 1Y7BA 4Y1ZA 3H0OA 4Y24A 2PHXA 2ARBA 2DU1A 4YFZA 3POWA 3PJQA 1HQWA 1C1LA 1DGLA 4WVWA 5DUVA 5GZCA 2PHUA 5CBLA 1Q8PA 2HYKA 1AJKA 1W6NB 2D6MA 1APNA 1MR5A 4TYSA 2D3RA 4XMIA 3B9CA 1IKPA 3O0VA 1IKQA 4LBKA 3FUOA 4M00A 4NO4A 5LK5A 4WVVA 1LTEA 4BLJA 3UJOA 2YXSA 1QU0A 2NP0A 4YG6A 3V0BA 1C4RA 3POSA 1AX2A 4Q1RA 2WT2A 5T5OA 3AYDA 4MYEA 3FLRA 3W59A 4ATEA 4FP3A 3FLTA 5IK5A 1LU1A 2ZHLA 2SLIA 2EF6A 3O12A 3D5OA 2UWCA 2ARXA 1FX5A 1N47A 1MS5A 2A5ZA 2DVAA 2EIGA 2DV9A 1SACA 2NMOA 5GM0A 2VW2A 1UZYA 3A0KA 4XBNA 2XG3A 2PHWA 2GNMA 5T54A 1DIWA 3T1MA 1CQ9A 4FOWA 5FREA 1BXHA 4LBQB 5GZGA 3OJBA 1BQPA 1GANA 2GNBA 2JD4A 3Q9OA 4JC1A 3VV1A 1URXA 4CRQA 1W6PA 5F9TA 1DQ6A 3WLUA 2E7TA 3R05A 1W6MB 2GMEA 1A8DA 2CL2A 4LBLA 3B69A 3RMYA 2AYHA 4FPFA 3QLQA 2JE7A 1GZCA 3L2YA 4FOVA 4BM8A 2ENRA 1NXD1 2A6ZA 2DWRA 1LOBA 1WUVA 1GNHA 3AX4A 4FPJA 4YLZA 5DZEA 1LHNA 4Q8LA 1MS4A 3AK0A 1VALA 3SITA 1NLSA 1FYUA 3USUB 3PVNA 3IPVA 1G9CA 2D6PA 5GALA 3RG0A 5CB7A 4DQAA 1VIWB 3ENRA 2XB6C 4W65A 2RHPA 2UURA 2AUYA 1V6LA 1WBFA 2ZGLA 3WG3A 1LGCA 1QNYA 2ZGOA 2NN8A 1MS0A 2WKKA 4FQZA 1DQ2A 2GMMA 4U36A 4Y22A 2A6XA 3MW4A 3AYEA 4K1ZA 4YG0A 2GALA 1DYKA 1S0DA 3BODA 2YY1A 1QOOA 5EWSA 1EPWA 1A78A 2AENA 1DLLA 1LOFA 1LENA 3POYA 3ZVXA 5CAZA 5E89A 4Q1PA 5DUXA 1PZ9A 3LSDA 4Y1XA 2YMZA 2DTWA 2OVUA 2ZGUA 3IM0A 1D0HA 1BKZA 1DQ0A 3BOPA 4XE9A 4DRVA 1PZ7A 1QDCA 1UAIA 3IKWA 2EXHA 4UW3A 2WNEA 1HQLA 4H55A 1QOTA 3WNXA 3FBYA 4DFSA 1GKBA 1N1YA 3AZXA 3TB0A 5CA6A 4K1YA 3ZXFA 3GNEA 3M1HA 1UX6A 1W6PB 3RRDA 1DFQA
chains in the Genus database with same CATH superfamily
3OGSA 4PCRA 1Y4WA 4IW3A 3DPRA 3OF1A 5FYBA 1WW7A 2P3IA 2ZZJA 1UZVA 4KU8A 3VGIA 1MEC2 1TVGA 4PF1A 4C0HA 4C1XA 2PQQA 1OFNA 5DPNA 1SCRA 2WT0A 5EJZB 3K4ZA 5JZGC 2GDFA 2D5HA 4R9DA 5E1RA 1NXMA 1C8M3 2WABA 2G19A 4Q4X3 2BOJA 2VR4A 2ZGRA 3GXUA 4P9YA 4SBVA 3N9NA 1Y9QA 2XUMA 5F37A 4C90A 1DZQA 3ZYGA 1GZWA 2CDOA 3HPNA 3NKTA 3BVCA 4XUTA 1YXWA 3AVRA 1ZZ6A 3WOGA 1QXPA 2JG9C 4LLFA 5JR7B 3WDUA 3DUIA 5DAVA 2WNVC 1K12A 3SMHA 2RS11 4URTA 5HCBA 5FY5A 4GKXA 2EXJA 4P08A 1VMFA 4Q0UA 1S2KA 1MZ5A 3OGJA 3BPSA 2VQTA 4RR3C 3T2OA 4AI3A 4IEPA 1V70A 2VQAA 3K77A 3N35A 4L99A 4XFCA 5FYZA 3VBHA 4COVA 4CP9B 1DGRA 4QDSA 3B9IA 4QT6A 3KHCA 1BMV2 1KRIA 5D1IA 2AH2A 4KGGA 1ALYA 2YGLA 5F32A 3OPWA 1DLCA 1ULEA 4BPZA 2JG8C 3OD4A 4HANA 4JTNA 4OLLA 5SV5A 1X7NA 5BNOA 3RZZA 3SXWA 4B3NA 2X8KA 5C6CA 1LHWA 1VE0A 1VRH2 5FKBA 3RI9A 3WF1A 4QX3A 1MS9A 2GMPA 4LKDA 4A3XA 3O1VA 4NOTA 3PL0A 1QDOA 3QH6A 1ND3C 1ZRCA 3GBGA 3HBKA 3PIGA 4EROA 4KBBA 4YW5A 1AF9A 1JUIA 4GH4B 2BRTA 2H6BA 2CNAA 2W95A 4AYUA 3WV6A 5I8TA 3JZVA 1W8FA 4V1PA 1C8NA 1OA2A 5DAWA 1S0BA 5FZ3A 5CFCC 5LA0A 1UOJA 4MXVA 1GNYA 2E7AA 1QJU3 3V0AB 4RS5A 2PAKA 1A8MA 2P3KA 5SV8A 3WP3A 1F5JA 2XL7A 4WM8C 1E5IA 1CIWA 3HMYA 4FAHA 1POV0 2TEPA 2VH9A 2ZKLA 2ZXQA 3AMQA 4YG3A 1FAYA 1FOD3 2DUOA 3U1XA 1H1IA 2Y0OA 3NV4A 3O14A 1GQGA 4QM8A 4KWJA 2Q8EA 3RWKX 3GZAA 4XIOA 3I2OA 1OXCA 2J1AA 2VVEA 4CDQB 4B4PA 4XXAA 2VMIA 3CZJA 3R4SA 4QDQA 4XJAA 2UU8A 3FLPA 2VZ3A 3ZIXA 3WNNA 4AI1A 1DYPA 2G9GA 1PO22 3LOIA 3ZSMA 4WM7C 5AFBA 1PVC2 2DBNA 5A7PA 3WSOA 1JW6A 2BFUS 5C3QA 2R0FA 1OKOA 1H30A 2J1UA 2WQ4A 4DEQA 3NAPA 4TTGA 2W5FA 2BDRA 5FY9A 4IETA 1H4HA 3CJIC 2O8QA 3NV1A 2J1SA 2VOVA 5FYUA 4PDWB 3X29B 2QQKA 3KT4A 1LAJA 3OUJA 3OG2A 3WUDA 4ASMB 2KM2A 4LK7A 3BALA 1AZDA 2HEWF 5CIRA 2R30A 1YIFA 3L9JT 1TMF2 4FFHA 4FOYA 3KGLA 1DZRA 1UOBA 4QX0A 2HWC3 3TN92 1RB8G 1LNSA 2IUWA 4CCMA 4AHXA 3NNJA 5GLWA 5A3MA 4K8RB 2I2SA 5FBJA 5I0TA 5FMCA 1SMVA 1ULPA 2VPVA 3NRUA 1HDKA 3WF3A 2Y26A 5ACA2 2Z79A 1ZM1A 5HCHA 4IE0A 2O14A 4QB6A 4IV3A 2XJSA 4QQLA 1QXRA 2MEV3 2I07B 1JTZX 4PQ9A 5F2WA 2J1EA 4A4AA 3DEMA 4FPYA 3THDA 4LORA 3VLBB 2WWSA 3UJQA 5APAA 3E1F1 4LA2A 1HLCA 3ZDSA 1YCIA 2CDPA 2WN2A 5KBFA 4Y1VA 4DPNA 1ENXA 2XVLA 2D93A 1KS4A 1LJ7A 1NLQA 2Y38A 4Y3OA 1W0PA 2E32A 2IXJA 4IXLA 1UIJA 4P9WA 4N43C 4BDVB 4JGYC 4K8FA 4FTBA 3ZSLA 4I30A 2BGPA 3ACIA 2FDKA 5J37A 2DCYA 3NQHA 4XDPA 4TN7A 1NX9A 1Y3TA 4IGOA 2JKBA 1AX0A 1AR61 1OOPA 1SLTA 2UY9A 3OD0A 1VBB2 4W4ZA 3ZR5A 5L7OB 3LF7A 4XJWA 2V5YA 1PGW2 4HZFA 4QQOA 4Y1YA 2ARCA 3ZYJB 4OI2A 3O1OA 2ZHMA 2TUNA 1WMFA 1EV12 4FVVA 5A3UA 1WMDA 2XKOA 4KBZA 2G1MA 2XR4A 2PHDA 3DYMA 3ORJA 1QH6A 3H8RA 1KQRA 3BTAA 1TME1 5JZGA 1RHI3 5A3NA 4NHMA 2XL9A 3WD5A 2Q1MA 1YI7A 1JHNA 1J83A 3R0RA 2WL1A 5J3UA 4XBLA 4OHZA 2MPFA 2C9AA 2JDHA 4IV1B 3H7YA 2W9XA 1WLCA 3RFRA 1FATA 2BBAA 3HT1A 4M3CE 2WNUC 1QEXA 1PIV3 3IDBB 3MV01 2JDMA 3IDAA 1POQA 1J3PA 2GU9A 2TBVA 1QJFA 3PDQA 4MH0E 4UAPA 1OH4A 4BQYA 3ELNA 2JX9A 4RR3A 3WDTA 4GULA 2PXJA 1DP0A 4OFGA 5T3NA 4R8HA 3AYCA 4HXCA 2WZEA 2Y6JA 2RM21 1O5LA 1ULCA 1DQ1A 4HMZA 1X8MA 2ADDA 2JJ6A 4UI9L 4E2QA 4OUMA 3N4MA 1GICA 2JG8A 1GZ9A 2FZ2A 1DGWA 4XAAA 4YW7A 4OQ8A 2HEYF 3OY8B 4KI5M 2IZWA 3WP5A 1PVXA 3SNMA 2W3JA 1JYNA 3U78A 4IQPA 3VBUA 3D4KA 2Y6HA 1F15A 4AWDA 1KJLA 5FZGA 1H6XA 3J8F2 1XNDA 2EXIA 3KLSA 5F5AA 2VZTA 3POGA 4WZCA 4XZUG 4QPYA 2GSYA 5JOYA 1FPN1 1ND3A 5FYCA 4DEVA 3FBMA 4E4HA 2A71A 4DUWA 2VZSA 3RYKA 2CTVA 4NAMA 3VHNA 4FPKA 5C8CB 2E33A 5CFCA 1ONAA 3O1TA 2JE8A 5JI9A 5FP4A 1CAXB 4PIXA 1V9U3 4HLTA 4OHVA 4Z2AA 2BWCA 3KV6A 1ND2B 5KHJA 4WM8A 1UPSA 2XWBB 2ERFA 5HPOA 2VO5A 3ZKYA 1GWMA 4ONUA 4ET7A 1PZ8A 5T5PA 5A32A 1JOPA 1ZBA1 3JQXA 5EFUA 5LATA 2ZGTA 4RHV2 2BYVE 4ZKTB 2WSVA 4AVSA 3PNAA 3BTYA 3RI8A 2Z42A 4HPKA 1PVC3 3ZO0B 1R1A3 4X8NA 5K0UA 4A7YA 4WM7A 4XJ8A 4EQVA 3O1MA 2R49A 4P5HA 4CTEA 5FZAA 4GALA 3NJXA 2GN3A 3H3LA 4XURA 3NL1A 4LBQD 2PHTA 3FHAA 5FZBA 1VBD1 4XXPA 1XNAA 4XF4A 3KVAA 3H7JA 3WX5A 2VC9A 3CJIA 1SLCA 2D97A 5JOZA 2A3WA 4UXAA 5C4WC 5EYXA 1WCSA 2RJKA 5T52A 5JMCA 3ZFFB 1TMF3 2RJ2A 2Y6GA 1WW4A 2RMU1 2K0GA 2FHRA 2XLAA 3AZWA 1YQ2A 4LBOA 3WF2A 2NM1A 2A70A 3WDXA 1GOHA 2NLRA 1QJX1 3SISA 2WFF3 4MGYE 3I8TA 4Y5SA 3B5LB 4XACA 1CJPA 1MVEA 2FCTA 4IERA 3AMNA 3TEXA 1S0CA 2YPJA 3SKVA 1L7QA 1SBFA 1YFXA 3HNMA 3ZXEA 2YROA 1D4M2 3CHXA 3CO2A 1MACA 4ITCA 4FPOB 3TAYA 3VZNA 5IVCA 3VDDB 4BQ4A 1OQEA 3G7DA 1W6NA 5C33A 1PK6A 2D7FA 3IBMA 5LA9A 3VL9A 5IVEA 2ZBJA 1GFF2 4XUNA 1R64A 2HKXA 4AI0A 4NROA 3MEPA 4YM2A 1QMJA 1UD1A 1PNFA 4QD2A 2EIEA 3AYAA 1JS9A 3K51A 4CDQC 2CAUA 2E63A 1XBFA 1YQ5A 3E5UA 4AI8A 1H9PA 4S2GA 3T2QA 4TSVA 3B3QE 1O4YA 3H50A 4HN0A 1W6OA 4XOGA 1CONA 4N43A 4QKFA 4JGYA 5JVVA 5HBAA 5KXCA 4YVSB 3LIHA 1YHFA 4YZ4A 2EAAA 1NG0A 4M3CF 4Q4V2 4X6RB 1VBE2 2WA3A 1SFPA 3RSJA 1LGBA 1XRUA 3R4UA 2DUQA 5B2GB 3VDAA 4PDWC 2WFPA 5LEJA 4BCUA 2R041 3IAPA 1I9RA 4EN0A 3RWNA 2D3SA 4ARYA 2DURA 1DYOA 2GNDA 4CDWB 2BWAA 2I74A 5BY5A 1JOJA 2VOTA 4J25A 1DHKB 2P3YA 3UGHA 2G4IA 3SHRA 4INDA 2PHXA 5FZEA 3T2PA 3VBOB 3MICA 3POWA 3PJQA 4Q4Y1 1DGLA 4F7ZA 2R072 4CPBD 1ZREA 1W39A 1APNA 2D6MA 4TYSA 4ZPIA 1PMHX 3H3UA 2JB8A 3WNOA 1Y43B 1IKPA 3H1WA 2OA2A 1TME3 4M00A 4LNVA 5LK5A 2Y34A 4BLJA 2W92A 2NP0A 1OPOA 2WS93 1J59A 2WNUA 2ZTNA 3RZHA 3KV5A 1BEV1 2XXZA 1F35A 1KFXL 4XF1A 3S6PA 4MYEA 3FLRA 4ATEA 2WBKA 4QX8A 3FLTA 1QIQA 1LU1A 2ZHLA 2EVXA 3E6DA 4NVPA 2H0VA 1RUG2 2EF6A 3SKJE 5IVVA 5KC5A 4Y4YA 2XLFA 4HFSA 2QQNA 1FX5A 2A5ZA 3U11A 5GM0A 3RVHA 1RUC3 2NMOA 1QJZA 5FZ4A 1O5UA 1CAWB 2V09A 2XJUA 2HWB2 1UZYA 3I2HA 1FT9A 4CDUC 3ALQA 4GB32 5BNPB 1DIWA 3T1MA 3PJYA 4FOWA 1BXHA 4BE3A 1IQAA 2B39A 3P3PA 3RJRA 1R081 3DYPA 2JD4A 2YU1A 3K46A 5L7OC 2RM23 3N9QA 5CG9A 4CRQA 1YI9A 3U10A 4LIUA 4XFGA 2OXBA 3R05A 4LBLA 2IXHA 2VAUA 4QHZA 1UXXX 2AYHA 1AL21 3GDBA 3O1SA 4FOVA 1HJFA 4XFBA 2PLV2 2JICA 3ROUA 4AVBA 4FPJA 2IXLA 1SDDB 1LHNA 1MS4A 1W05A 3SITA 4IEVA 2BPA2 1OH3A 2QKDA 4Q4W3 3PVNA 5FY1A 3RG0A 4AEKA 4E27A 5CB7A 3RDIA 5FPLA 5FY7A 1H4GA 4N53C 3THTA 2ZGLA 3WG3A 2BNOA 1LGCA 5J7MA 5FYTA 2ORXA 4Y22A 5J96B 4FQZA 4YG0A 5EJ1B 1X9PA 4IV1C 1RYYA 4JGZB 4N8MA 1RTVA 1QOOA 2PFWA 2XJPA 4OZOA 5FWEA 1LENA 2QQMA 4FFIA 1C8M1 1Z7S2 5E89A 3RJ2X 3O1PA 3LSDA 4RGGA 2DTWA 2VNRA 4NRQA 3U0ZA 3FWEA 4HSJA 4AFAA 4H3WA 1BKZA 4JKLA 4XE9A 4B8EA 4Z07A 5FXWA 5J48A 1PZ7A 4RFT0 1NCRB 1UAIA 4KMQA 3ZIWA 2FCVA 2EXHA 3CU7A 4UW3A 2H6CA 4AVCA 4CP9A 4NRMA 4D7TA 3WQBA 4Z1VA 3BUCA 5FP3A 4OI1A 3C7GA 5CA6A 4K1YA 3M1HA 3OEBA 1UQXA 1W6PB 3MV11 3RRDA 1VBA2 2VVDA 1LESA 1XXNA 1ENSA 3PIJA 5A6ZA 2W39A 2HWD3 5HCAA 1U5IA 5DAPA 4XPVA 3UKTA 3IMMA 2J7MA 1VAVA 2Z2SB 2HWE2 3MLJA 2BV4A 2ZX1A 3WUCA 3P3NA 2Q5TA 3RNSA 3IMNA 3DF0A 4QKNA 4Y4RA 4CEYB 1YYNA 5D2AA 1GV9A 1QQP2 2VNVA 4GH4A 2K9ZA 4MADA 4F83A 5FWJA 1VLNA 4IEXA 5C8CC 1XQNA 2PN5A 3KT1A 4L8QA 3DV8A 4XHBA 2VU9A 2OZ6A 4XVHA 2RS32 4K40A 3AMPA 4P14A 5FYHA 3VBUB 5BNOC 3V0AA 3PMSA 5A6YA 1AR73 4RQPB 4DXTA 1ND2C 1PGL2 1UIKA 1G8WA 1ZZ7A 4DY3A 1H2LA 3WCRA 2O8OA 4LE4A 4MLOA 1RUE2 5A3TA 2E53A 1W90A 1MS1A 2RR12 4BU2A 1HB2A 1MS3A 2ZZQA 4DINB 2Y0IA 3I3BA 3LFMA 4CDQA 3GCWA 1QJU1 4RN5A 1LEDA 2ZX3A 1UF2C 3VD3A 4META 1MPXA 4NAOA 3UYJA 1NA1B 4AQ6A 3D3AA 1RVF2 4BXSV 4YRDA 1FOD1 5HI0A 5FZOA 4QXCA 4HT1T 3AZZA 1D2QA 4IEZA 4Q0SA 2DTYA 4AAPA 4QGMA 3LPFA 1XYPA 2B9VA 1US3A 3A0NA 4PF5A 1O7FA 2CSGA 2RVAA 2OUJA 1ULGA 2B8MA 2WSUA 3LB9A 2BJSA 3CQOA 3QACA 3WVJA 1DQ4A 3AP4A 4PDWA 4XF0A 5EZWA 1CVNA 1H8TB 5IVBA 2VXJA 3M3EA 3N9LA 4I09A 3W20A 3ZFFC 1VBC2 4M0NA 4CEWC 2BEOA 3GJAA 4NWVA 5FMDA 3ZM8A 5A1AA 5LRSA 1GQPA 3GF6A 3SEEA 3ZYRA 3S7IA 3T1LA 1VR3A 4AVAA 1ASJ3 5AVAA 1N3QA 5ANNA 1OLMA 2ZA9A 1HB1A 2E9QA 3JQWA 1JZ8A 2E7QA 3T08A 1ULDA 4EE2A 3VDDC 4FFFA 3ASIA 4XCBA 2ET1A 1Q56A 1HV1A 3A21A 4UFIA 5T55A 1AUYA 2HWC1 4CCOA 4PIZA 5L36A 2CWSA 3NVCA 3GGLA 4QKDA 3WQ7A 3WINE 5FY8A 2NQYA 4GA9A 1H2MA 1TE1B 2WR9A 5EQUA 5FRAA 1JZ5A 2PHFA 4QXKA 2FDJA 1MZ6A 1AR83 1AXYA 1R093 2WJSA 1COV2 3E5XA 3HAGA 1OI6A 2C0ZA 4NHXA 4NJ4A 1BEV3 4M3CB 3PURA 1JMUB 4ZU4A 1RINA 2MEV1 1ZVFA 2I45A 5KXBA 2WQ8A 1Y9GA 2LS6A 1ENRA 2YV8A 1AXZA 1V6JA 4YVSC 3ZXGA 3QBQA 2RS52 4FXGB 4MV2A 5F5QA 4BISA 5C3RA 2ZEWA 5KWRA 3WP6A 3JUUA 5L7OA 2CU5A 1QF3A 1GYKA 1G7YA 4HVRA 1W6QB 2DBIA 2R062 2WO7A 4DRRA 1HRI2 4LHNA 3MW2A 4TLFA 4AQTA 5JLVA 5FZMA 3AVSA 3JBG2 1YNAA 1SPPB 2XQRA 1RUD3 5HCFA 5H9PA 4CDWC 3WW2A 4XUPA 3HT2A 4LTAA 4YVWB 1OQDA 2GC2A 4AI2A 1H6YA 4ATFA 2ES3A 4HL0A 3ZPYA 1C5HA 2P34A 1JZ4A 4RA0A 1W03A 4XJZA 3VBOC 4P9XA 3DGTA 2UYAA 2ZGPA 2GC3A 5DQ0A 1QJY2 4BB3A 5ISLA 1JYXA 1UZZA 3NWKA 3NV3A 4JQTA 1GZTA 2DF7A 1AYM2 5FZIA 5H9SA 4LMFA 5DAXA 5GJ6A 4HBNA 4N53A 5A1LA 3I3MA 1BVVA 3IIAA 1RUI3 4H2AA 2D6NA 3UKVA 2VZVA 4IV1A 2D6OX 1RHI1 1JBCA 1BLZA 1U0AA 4NIGA 4IEQA 3KCCA 5DZGA 2XJQA 2KD7A 4I01A 3MIEA 4CUAA 1W2OA 1H1AA 4DUXA 1OMIA 1K45A 4BK5A 3J7HA 5LY2A 1OUSA 1F4AA 1F2NA 1PM7A 4O9GA 4G9SB 4LKFA 3ON7A 1D4VB 5FYYA 4QX5A 4AEJA 1FMD3 1HB3A 4W8JA 4LQRA 1LOEA 3O1RA 2XBO2 5L9VA 1PIV1 5C3SA 1RMU2 4CVUA 1UY2A 4FBFA 1KXGA 4LPLA 2OT7A 1ULOA 2W91A 3GYDA 1DZTA 3WY6A 1BMV1 4P9IA 3OY8A 1XSQA 2VMEA 4PT6A 1N3OA 3SH4A 2ZMKA 2PHRA 1UU4A 3LA7A 3ACLA 3FE5A 4QHOA 2WUHA 3QH7A 4OUSA 5BPXA 5DUWA 5I0RA 3AZYA 4FSJA 1L7LA 3BIWE 1H0BA 1WLDA 2VOWA 2KR2A 3M3OA 2CGPA 3LOBA 1M4WA 5FOJB 4A42A 1NCQB 1NZIA 3UETA 1NAEA 4QM9A 4PQQA 4B7KA 1S2BA 4XMAA 2F6BA 1Q8OA 2BOIA 2VXRA 5CKQA 3F2ZA 2PTMA 4W6YA 1MZEA 1KS5A 2OYZA 5AC92 5C8CA 3LDKA 4CCJA 3PTYA 4WZFA 1ZYBA 1YQ6A 1LECA 4FQ4A 1CAXA 1EY2A 1QKQA 4M4PA 4Q0PA 4LO7A 1ZZ8A 2P3JA 4XUQA 5D8AB 4LUKA 1ND2A 3VZKA 4MXWA 4JQRA 1RUE3 1AYN2 2R1BA 5BUVA 5FOBB 4QWNA 1WD4A 3I3QA 4XABA 3NJVA 2P17A 1LEMA 2BUKA 2X53S 1CX4A 1V6KA 4GD4A 3M3QA 4JGZC 5FK8A 3UK9A 4B1LA 3RZGA 3N9PA 3RQ0A 5JMOA 2ZPXA 1CGPA 4NPMA 1V9U1 3A4UA 3ZXJA 5KR7A 2Q30A 5F3EA 2WWUA 3ZYBA 2RS12 3ACHA 3E6CC 1OVPA 2Y33A 4Q27A 1NCRC 3SCHA 5FYIA 4XDQA 1IG0A 2BGOA 4LITA 1OURA 4CCLA 3OYWB 1JU3A 5JXGA 3N7MA 4R9BA 1BZWA 2WNOA 1T6BX 2ZEZA 3A7QA 3KD4A 5IVJA 3NNLA 5E6HA 3U07A 1QNWA 2FZ1A 1RGSA 2A3YA 2JDNA 1WCKA 1QWRA 3PMEA 1FNYA 1PVC1 4K3UA 1R1A1 3WDVA 2XOMA 1NE4A 3OPTA 4BZ4A 5IW0A 4NIAA 1WGPA 2OW4A 4KGQA 3ZFFA 4CEWA 4WVZA 3WHUA 1PNGA 1ACCA 4QPWA 4JX0A 3BPZA 4ZS3A 2VUCA 3VHPA 4CU6A 3AFKA 3WZ1A 2VTXJ 4ES9A 1XC6A 5TSWA 4AR2A 4D7YA 5ERLA 4CEYC 5BV6A 5K0UC 1LODA 2Y60A 4D7SA 4DMIA 4Y5TA 2OZJA 3LEMA 5EYYA 3V65A 5C7GA 1K5MB 4AVVA 1OHFA 2PAEA 5BNQA 3EB7A 2DVGA 3O0XA 4IGQA 2ATFA 3ABZA 4P5YA 1TMF1 1J58A 5K9YA 4R9CA 5J98B 4FT8A 4QQHA 3OBZA 3VDDA 3KS7A 3KCXA 4D8MA 4CDXB 5I0SA 1KDKA 3JD73 5CYYA 3EYPA 2WFF1 3VBUC 1QGLA 4JRLA 4QPIC 4CXYA 5CKMA 4RQPC 1EUTA 4ZU7A 2VUJA 4EZHA 1V6MA 4S2HA 1C1FA 1V00A 2JDYA 5ACA1 3AB0A 4IE5A 1CD3G 3N7KA 3SC7X 2HH9A 3S5QA 3H42B 4N7UA 3R4DB 1REEA 3PVEA 1ZBE3 3HD8B 2NMNA 4XHXA 2PMWB 3RS6A 3QOPA 1CAVB 3J7LA 4I02A 1FI2A 2JIGA 2VGDA 4KH9A 1Z0HA 1LU2A 1GOGA 1NA1C 2L9LA 4LIVA 3CLPA 1E5SA 1RL3A 5LZ6A 4YVSA 2VUDA 3KVBA 1PK6C 3LDBA 3P1IA 4K7JA 4PI0A 1OA3A 1RUF2 3BCWA 3K2OA 2R063 5L9BA 5CADA 2HBUA 3PTRB 3VKNA 5IK4A 3DKQA 4NN0A 4I0BA 5F5CA 3WNMA 4LHKA 1HRV2 5FZFA 4KNCA 3VKFC 2ZAHA 4IL7A 2VZOA 1TZOA 5FLHA 4CDWA 4P9LA 5IT6A 1VBB1 2Y6LA 5AVPA 3KQRA 3WR0A 1CPMA 1W99A 1O3QA 1GP4A 4E2GA 3KQ4B 1PGW1 3VBOA 2GC1A 3RZKA 1YLLA 2P5BA 1DGWX 3HJRA 2WAAA 1CWPA 2Z5WA 1O8PA 4LULA 1HN0A 2B42B 3FHQA 4UYBA 2DVDA 3U14A 3W58A 2X29A 2B7YA 2EXKA 1JZ6A 2ZEYA 4QXHA 2R16A 4UW6A 5JWPA 4XEZA 3IDEA 3KV9A 1DDLA 2K2SA 2UWBA 2ZJCA 4IEOA 3BN6A 3JB8A 1ZZCA 1MEC3 4IE6A 4IE4A 1W04A 5C5TA 2DDUA 4CZSA 3HEIA 1B09A 2X10A 1G9FA 3L2HA 5EXOA 4BHPA 1W28A 1PO12 3J4UH 4NE9A 3VBFB 2XJVA 2XBO3 1HX6A 2WS91 1RUJ2 5IATA 3QD6A 1CAWA 3DKWA 2JDUA 4HKOA 4A3ZA 1I1EA 2DVBA 3N3HA 5FMOL 4V2WA 1OSGA 1OVSA 1P8JA 1XU1A 2GP3A 3MLLA 5FZHA 5BNPA 5L19A 5LEKA 1OLRA 2P1BA 1L3JA 5FK7A 1OA4A 4UFLA 3WP4A 1IS3A 2YBKA 5C9AC 5E8AA 3VKOA 3AP9A 4XZPA 3T30A 3THCA 5A33B 2Z69A 2B5HA 5FDBA 1IPJA 1RUC1 1WMEA 1VMJA 2ZGKA 1S0FA 4GQ7A 1G9BA 3QCWA 1AR62 1NKGA 5A7WA 4HSLA 2BBVA 1KDMA 1XNBA 3THPA 5HXVA 3H0OA 4E2SA 4YFZA 4YVWC 4LHLA 1W2AX 5DUVA 2VM9A 1NE6A 2PHUA 1YEWA 5LBBA 5CBLA 3J8F1 4NHYA 3W5MA 2D40A 2DCZA 3HQUA 4NUBA 4E8CA 5C5UA 2P6HA 2AACA 1M06G 3DL3A 1RC6A 2P6CA 5CU1A 5FY4A 3O1UA 1IKQA 2W1QA 1UY1A 3G6JB 1VRH3 4NO4A 3DPRB 1ZX5A 1LTEA 2GH8A 2C26A 2YXSA 4MSVA 4N9IA 2QE3A 1UOFA 3KSCA 3MHZA 1UYXA 4H14A 3ZFEB 4Q1RA 4HKLA 2WT2A 2AZ5A 4JGZA 5IK5A 3POIA 4Q4W1 5FMBA 1K5JA 4CU7A 2DCTA 1ZRRA 3MFAA 2A73B 4GMP3 5A80A 3I49A 2LUWA 4OVEA 4NIDA 2DVAA 2Y8KA 4QX1A 1SACA 3WT3A 1NCRA 1VMHA 1NY71 2XG3A 5T54A 1AR92 4KG8A 4LBQB 5FYMA 3PUAA 2Q8CA 3OJBA 1BQPA 1GANA 2DCKA 3GHMA 1ZA7A 2VZ1A 3MBWA 5DDJ2 1W6PA 5F9TA 1DQ6A 4NPLA 3WEZA 1W6MB 2OPWA 1A8DA 2CL2A 2QCSB 4UOJA 4ASLA 4IDZA 3RMYA 1JHJA 5M0TA 4FPFA 4DY5A 4AHZA 2JE7A 1GZCA 3L2YA 3NKGA 5JR2A 3WW1A 5CFDB 2ENRA 1NXD1 1UMIA 1PO23 1WUVA 1OD5A 1GWKA 4Q8LA 4CEYA 3AK0A 1VALA 1NCQC 2D98A 2WRAA 1FYUA 4ZY9A 1PMJX 1FPN2 5GALA 2HWD1 1VIWB 2YG0A 2XB6C 2GP5A 2UURA 1ZNPA 2WIIB 5A7NA 1WBFA 5HV4A 2W1WA 4CU9A 3V0BB 2WKKA 4I0WB 1DQ2A 1YQ8A 2GMMA 2JWPA 2A6XA 5I8SA 3AYEA 3O7OA 4K1ZA 4MUVA 1DYKA 4QPIA 1S0DA 3BYWA 4RQPA 5D8AC 4YPJA 3VZJA 2YY1A 4J1XA 1XNTA 4CP1A 2J22A 3EO6A 3TN93 1PZ9A 4Y1XA 5FAXA 5FLJA 2QQPA 1GOFA 2OVUA 1NQJA 3IM0A 5EHDA 4DRVA 3I97A 3VDBA 1QDCA 1UY0A 3IKWA 3HNBM 3ST7A 3BTXA 4GH4C 1AR71 1ZBA2 2WDBA 2VD7A 1TNFA 1NQDA 3OB8A 1HQLA 5ACA3 1U5YA 1NA1A 1WMXA 4H55A 3FBYA 3ZXFA 3GNEA 1RUF3 4LJHA 1NYWA 1HIXA 2GAUA 1UX6A 4QKBA 4EWEA 4URAA 2BW8A 2VULA 1J84A 1XNKA 2H0BA 3UESA 4IUGA 2OUHA 1XYNA 1W0OA 3OBRA 2CY6A 5FFOC 1SG3A 1VBD2 1H8TA 1S0EA 2KA3A 3CKHA 1YO8A 2AR6A 4JDOA 1UL9A 4RGKA 4S2FA 4C1WA 3AKQA 3UGFA 2A6YA 1UNBA 1WW6A 2W1SA 3C2UA 1W2NA 3U37A 4A41A 3S57A 2HBTA 4BYYA 4R52A 4CCKA 1KFUL 2ZKNA 1I3HA 1UWWA 3MO4A 2HEVF 3D82A 4A6SA 2N7GA 2VBDA 3LSEA 4MHUA 1VBB3 5JPMB 3FHIB 3N9OA 4MZUA 1KITA 5IYYA 1RUH2 1JUHA 4Q0QA 2PYTA 1K3IA 2D43A 1BJQA 1VB2A 3NV2A 3GJBA 3I3DA 4FOQA 4RYDA 3ZXLA 1CIYA 3K48A 2R071 2ZEXA 1S55A 1ASJ1 2VNGA 4COZA 1EV13 3SCGA 2B4KA 1CZVA 3GZEA 3LD8A 1C28A 2DFBA 3A23A 3CJXA 3WQ0A 3POJA 3PU3A 3BB6A 1PO13 4GZ9A 2DFCA 1DBNA 3FN9A 5IFTA 3RZLA 2CHHA 4XUOA 1RUJ3 3K3NA 5FLIA 1JYWA 3H8OA 4Y1UA 3M4FA 4M3CA 3AC0A 5DABA 4LBMA 3RPQA 1O3TA 2VCBA 4QAWA 4CP2A 2V73A 4EN8B 5A1FA 3USUA 5IVFA 4MG2A 3FUQA 4OCTA 4EN6B 1RUG1 1UW8A 2BZDA 3O5SA 4AOCA 3BIEA 4UFKA 2XJTA 5EV7A 3ZSKA 1IS6A 5C9AA 2ZGNA 1WCDJ 1AR81 3AXDA 2QTWB 1R091 1FV2A 3APBA 1H9WA 1B35B 3Q8FA 4R4XA 4EYUA 5IFPA 3MF6A 1W3VA 1U5ZA 1W6QA 2ZX4A 2ZAAA 2W0XA 3JCIA 4YW4A 1W9FA 1JOBA 5IAXA 4DIQA 1S0GA 1QJEA 2OQ6A 4XF9A 4YW1A 1K42A 4YVWA 2R042 4YWAA 4CUBA 4JCKA 4D3WA 3WDWA 2HYXA 1OLQA 1OOPB 2WA4A 2PAMA 1LCLA 4DS0A 1UO9A 1NZCA 1BBT2 2ZMLA 4FI9A 2DVFA 3ITQA 3LE0A 1GU3A 1N1TA 1SQ4A 1OT5A 2W1UA 1RUD1 2Q8OA 1X9TA 4YGDA 3RMXA 3VZMA 2ZCWA 2BVVA 3MPPG 4Q4Y2 1CZSA 2DCJA 1IS5A 3J8F3 1RIRA 3MFCA 5DG2A 1UU5A 2B9UA 2CGNA 2YGMA 2A7AA 2OPKA 3A22A 2VY0A 4TZDA 4A6OA 2ORZA 1XOYA 3EHKA 3KZ4C 1N1VA 2FQPA 1POV3 4ISQA 4LK6A 2C4XA 5I93A 4FXKB 1IQDC 1UOGA 3MW3A 2C5DA 1CR7A 3K4AA 4BQ2A 4XETA 1RUI1 2QVSB 1AR93 4Q0VA 2YC2A 3BOWA 4Z8BA 4BH9A 4BA6A 3BI3A 1CESA 1LOCA 5EPAA 4UBHA 4XQDA 1ZRFA 2JG9B 3HQXA 2ZHNA 4BLIA 2ZOEB 2WNVB 2QBXA 5DDJ3 5FP7A 5B4NA 5JSRA 4AAXA 3I2JA 2XGXA 1O4ZA 3ACGA 1JYCA 1LR5A 4OI4A 5A6QA 5IK7A 4RHV3 4OI0A 1W9WA 1X36A 5I0DA 1SFYA 3I3EA 5F2SA 4B29A 1FMD1 1S2EA 3CL1A 4Y20B 4BQWA 5F6LB 5GKAC 2YFZA 1R082 2WZR2 4COYA 2X5IB 5J1XA 2Y64A 3VBSB 2IWGB 2XUEA 3M7AA 1WD3A 4CU8A 1OF3A 2PELA 3MLKA 1ODNA 1NCQA 4KWUA 4CCEA 1W0NA 4JKKA 4GJZA 5GLVA 5L73A 4BQ1A 3M3CA 2VBBA 4LOTA 1HXS2 4DOUA 4L11A 2J42A 3PUSA 3ZN4A 4HN1A 4E4DX 4CEWB 1WKYA 4FO9A 4X6QB 5JSPA 5D8AA 3M2MA 1E5HA 3FFQA 4BOWA 2WT1A 2WQZC 1N1SA 3ZN5A 2VMCA 3VBRB 3ZFEC 1IPSA 3NMBA 5A7OA 5FUIA 4D0QA 5LWBA 2XHNA 4LOSA 3SQOA 1PM4A 4XF3A 1I5ZA 1PGL1 1VAMA 4YGBA 1D4M3 1AHSA 2W08A 4AEDB 5F7UA 2R32A 1X50A 5LBFA 1C8M2 4L92A 1RUE1 4Q4X2 5EP9A 3ZX7A 3ZXKA 3KV4A 5T5JA 1W2UA 2IFWA 3J7MA 1A3KA 4LBNA 4PJYA 1TG7A 2B46X 4AGRA 4CSWA 1G9DA 4XQ4A 4A7ZA 4XFHA 1O3SA 1UY4A 3D8CA 4N7IA 1XE7A 5GZFA 4Z82A 1C57A 5GLUA 5B4XA 5FY0A 1SLLA 1JZ7A 1JYIA 1UU6A 1O8SA 1D7PM 3IIIA 5FZ1A 3IZOA 1H2KA 2JIJA 2Q1FA 3LPGA 4WM7B 5LB6A 5CFDC 1FXZA 5K7PA 5I91A 4W6XA 4Y5Z0 4MGIE 4QXBA 1SBEA 3T0DA 4L9BA 1TEIA 2BP6A 3TOJA 5EJ3A 2F17A 4Q4V3 3T0BA 1AX1A 1VBE3 4QX7A 2ZABA 4OHYA 1RUH3 4QB2A 5BNNB 1W8UA 3PUQA 3HNYM 4LKEA 1W3XA 1O4TA 3MIDA 5LA2A 2JDPA 3K3OA 3W9AA 3WG1A 2EIBA 2AC1A 4CDXA 4XYXA 3TNPB 3N7LA 1Q3EA 3I54A 4MGSA 4YW6A 4IESA 4P00B 5FP8A 4B4QA 3HN1A 4PIYA 4D69A 3DYOA 5C3OA 1ZRDA 4JDNA 2RG4A 3DXTA 3KM5A 4BK4A 4QGLA 1MQTB 2AGSA 3GALA 4C0BA 4AVTA 2BGCA 1WA6X 3WDYA 1KD7A 5CNAA 1IGOA 2GN7A 2R073 3BGAA 5H9RA 2A75A 3OBTA 3JD71 2VW0A 5FO7B 5FZKA 3RGBA 1Z78A 4R4ZA 2CAVA 1DF0A 4MGKE 1CAVA 2WO2A 3Q8AA 3FZ3A 3E5QA 3SCFA 1I5PA 1JXNA 1YJKA 1QJU2 2VQUA 3N36A 4AFMA 2JEMA 4Q2FA 4CE8A 4AG4A 3UL2A 1I6XA 1O59A 5F1RA 2Q8DA 1GP6A 2EIDA 5ABJB 5KHGA 2DU0A 5FJHA 3V64A 1V6IA 1FOD2 1US2A 5G04L 5FZ7A 5LRRA 5JAXA 1ZBE1 3GCXA 5A7SA 5I0UA 1XSRA 1SLBA 2ZX0A 2JXAA 1LHUA 3AL6A 3AXEA 1RUG3 5DZFA 4CCCA 3ATGA 3ZMOA 4HONA 1YC61 2RS51 3SLIA 2V4VA 2MHFA 1W6OB 4TXWA 2HWF2 2ZHKA 1UXZA 1XJAA 2A6WA 4LEJA 4B7EA 4UBGA 3AZVA 2HWB3 1LKNA 4QU2A 4E4SA 2FCUA 2R061 3MIFA 1HRI1 1MZFA 4GB33 1BBT3 3POBA 5HV0A 1IS4A 2IXKA 2VW1A 2WAOA 5CISA 2F4PA 1V6NA 1TQ5A 4Z2WA 5FZ6A 1EP0A 2RJLA 2D6LX 3VD5A 1CX1A 5LCWL 2XMLA 5F3GA 1OC1A 2A3XA 2OQ7A 1XU2A 5C70A 2PLV3 3AP7A 2YBSA 1STMA 2XHKA 3LKJA 5IJRA 2D3PA 1OUXA 4LLOA 3Q8BA 4Q26A 4B1MA 3JB4C 2HWC2 3ES4A 4UWDA 4Z92B 5D21A 1OD3A 2YYOA 4YFWA 1O91A 1GBGA 2C24A 1YFWA 2VG9A 4G4FA 3ZFGB 5LW9A 2BERA 3AJZA 3VBFA 3B02A 4O7XA 3NO8A 4ZONA 4RFRB 2EAKA 3VD9A 2G9ZA 1RITA 3SH5A 3LAGA 1MEC1 2NZ9A 1EAH2 3OTFA 1SLIA 4FP2A 3ZKUA 1J1TA 2ID4A 2QFEA 1BYHA 5JUVA 2MEV2 1GNZA 5A3LA 1Z7S3 2JDZA 4OMDA 5A33A 4FPGA 3KGZA 2XBO1 4PLNA 4XILA 1B35C 1W9YA 3U4SA 4ZU5A 2YHJA 5F3CA 2BU9A 4BMEA 2QZ2A 3GZTB 4B4RA 4UF0B 1CN1A 2YC4A 1CAUB 5JOXA 4YZ1A 5FPUA 4MGTA 5BYNA 3HOBA 1RUOA 3S5AA 1VJ2A 4PBPA 1HKDA 2IVIB 1HXS3 5FPXA 3GM8A 2VNOA 2W94A 4IEYA 3UV9A 3PHMA 3HBZA 3LA3A 4NWWA 2Q4SA 4YGCA 5BNPC 1VBA3 1BCXA 4MO3M 3I7DA 1O3RA 4XJUA 1BVP1 1CJDA 1W9SA 4QPGB 4UFJA 5IAVA 2EA7A 4AXOA 3VB9A 4N90A 2ZMNA 1WWYA 2A6VA 2HWE3 3LEIA 5AC91 4YZ3A 3ZFEA 2QDRA 1UX7A 3ZPOA 2ARAA 1S4CA 4MGQA 4AL9A 1Y9MA 1QQP3 5IVYA 1D2SA 1C5IA 2QNKA 1G6NA 1N3PA 1AYN1 1RHI2 1VRH1 2GNTA 3WW4A 1IG3A 2LTNA 3OEAA 5DN2A 4AQSA 2YB7A 2FBEA 4Y22B 2RS33 2W47A 4AFBA 2CGOA 5C8WA 1HV0A 4GAZA 4KWLA 1GLHA 4LBQA 5E88A 2HJIA 2FDIA 4BXFA 4GMP1 4M0HA 3OGVA 3ILFA 4P02B 3ZXDA 4EJRA 1W8TA 4QGNA 4RD7A 2P37A 2VVFA 3CZUA 2RR13 3ZR6A 1PIV2 1W6MA 1J3QA 5DXDA 3AP6A 4E8DA 2YC0A 3FC0A 4EZ4A 1QOSA 1Y7BA 4Y1ZA 5CFDA 2DU1A 1JYTA 2X5IC 3T4HB 3T3YA 2HLEA 1C1LA 3VBSC 1RVF3 5FBZA 5GZCA 1V0AA 3DN7A 3RZJA 2HYKA 5LASA 1A6CA 2VCMA 2YDEA 5A3WA 3KF5A 1ST8A 3B9CA 4HKWA 3O0VA 4N9HA 4HVQA 1SEFA 3KB5A 5C4WB 3FUOA 4WVVA 3LGRA 1XNCA 3CF6E 1PO21 2QQUA 5BXXA 3V0BA 2UYBA 1AX2A 3POSA 2XONA 4KQ7A 1VBC3 1RUNA 3MIGA 3AYDA 5T5OA 3W59A 5A3PA 3W5NA 1EPZA 2BFUL 2WLPA 4M4RA 2SLIA 3VBRC 1X8EA 2EICA 3O12A 2VECA 1NOVA 3D5OA 2UWCA 1N47A 2EIGA 4DZGA 4K9SA 3MI8A 2B45X 1QHDA 4FTSA 3I59B 4YARA 3KMHA 3A0KA 3B93A 4IEUA 4AEDC 2W46A 4LUMA 2GNMA 2LM3A 4QDRA 2QZ3A 3B7MA 1RJ8A 1V9U2 2QQWA 5FREA 4MVTA 3TN91 2GNBA 4JC1A 3LWCA 3MDPA 1URXA 3D0JA 3WLUA 1EYBA 2E7TA 2GMEA 3FL7A 2J1RA 3B69A 4V2VA 2XLGA 3H9AA 2RDSA 5FUPA 4BM8A 2XKPA 2HWF3 3H1MA 2A6ZA 2DWRA 1COV3 4D6SA 2OKXA 1GNHA 4YLZA 1UKRA 1RUF1 1R1A2 1ZZ9A 5FZOB 3VDCA 2VMFA 3WXPA 4COUA 4PHZA 1NLSA 4ARXA 1RXFA 1G9CA 3POEA 1IHMA 2BNNA 2D6PA 4DQAA 3ZN6B 1HRV1 2RE9A 3ENRA 4W65A 4CPBA 2YPDA 2RHPA 2Z4FA 2RS53 2AUYA 4A7KA 3J9SA 1Q5OA 2ZGOA 2XVGA 4U36A 5BNNC 3ETPA 2IXIA 2V72A 1HRI3 3AKSA 3WF0A 3BODA 4D94A 3MF9A 2QQJA 4L0PA 1EPWA 2AENA 3ETQA 2RDRA 2WC2A 3JBG3 3POYA 3ZVXA 1JZ3A 2GZWA 2K46A 5CAZA 3ZYFA 4Q1PA 1H8TC 5KC6A 4AHYA 2KXLA 3WNKA 1U5XA 1UY3A 2WFF2 3N9MA 1H2NA 1MQTC 4FCAA 4ZS2A 3KHBA 4QHBA 1QJY3 2YU2A 3ZSEA 4DXZA 1AL0G 1AYM3 3WNXA 3EQEA 1GKBA 1N1YA 3AZXA 3TB0A 5JPNB 1DGRN 1EAH3 1GMMA 1EV11 3VZLA 1BK1A 2PQSA 4AFDA 2WYFA 4Y26A 1VP6A 5KHIA 2BTVC 4XQWA 5ABJC 1PO11 1GP5A 3CDZB 1RUJ1 3JXSA 5FUNA 2D6KA 3KCYA 5LA1A 1W8WA 1B35A 4OHWA 3TBDA 1HB4A 3P5BA 4LKSA 1OFSA 3C7EA 2VZPA 3NJYA 4P9JA 4WVMB 1JN2P 4P9GA 3V56A 4LBJA 5CZKA 3MPBA 4GWIA 5FQ0B 2W87A 5IWFA 4CDUB 3IPVB 3RYRA 3C7OA 4GKYA 4M01A 4JKMA 5A70A 3MZHA 5FZLA 4KG0A 2VQ0A 2GH2A 2C1FA 4CP0A 1IOAA 1UMHA 5FPZA 1RMU3 1Q8QA 1WCUA 3TRSB 4DXSA 1KEXA 4OYUA 2ILMA 1RJ7A 1WCQA 4YW3A 5FV3A 3WG4A 5JIUA 1KJRA 4XFIA 4O9EA 5FJKA 2LALA 3LEKA 3O0WA 3WCSA 4D6QA 3HQRA 1W8ZA 3LA2A 3MIBA 4BIFA 1BHGA 4CYDA 1HN1A 4YW2A 4BQ3A 3T4VA 1F31A 1F5FA 3AKTA 3J7NA 3CBNA 3ME2A 1YFYA 3AMMA 1XE0A 3B94A 4QU1A 4S2DA 4LT5A 3HWJA 3VUOA 3Q8CA 3CNAA 2WN3A 1UKGA 5AC93 4XIKA 3WNPA 5CEHA 4N53B 1J3RA 2ZGMA 3ZFGC 4A44A 1VAKA 3IB3A 5IUQA 1JU4A 1VB4A 2ZS6B 4QB1A 5A7QA 2AEYA 3VKLA 2JG9A 1EUUA 1TME2 3ZOIA 1AYN3 4FPLA 5E16A 2WNVA 1POV1 3KT7A 1CPNA 2G9FA 5F5IA 2ZGSA 4OMCA 3C7FA 2WS92 4D6RA 4DXRA 4ZZ5A 3AP5A 3EXUA 5FMOS 4YM0A 3I2GA 4AE2A 4LR4A 4O65A 1AR91 2R7EB 4R9AA 1F4HA 4E4ZA 3RYPA 2WYSA 4Y20A 1GWLA 2RS13 2CWMA 2X5IA 5DDJ1 2YBPA 5FCCA 3TYJA 2XWJB 3VBSA 4QMAA 1RUC2 2D5FA 1VRBA 2IVJA 3ILRA 4I3PA 4WV8A 4XJ9A 5J36A 3TEYA 1GZWB 1REFA 3FJSA 3IWZA 3UGGA 4JTOA 5FZCA 3HN3A 2O1QA 4RHV1 1GUIA 4AZZA 2WLQA 1T2XA 4DO0A 4GWJA 5I8YA 5JCTA 3FFZA 4AGGA 3H1YA 5AFEA 2RM22 5FPAA 1SDWA 4H7MA 2E6VA 1SBDA 3IAQA 3OPZA 4QPGC 3ZXAC 4ASKA 4HK9A 4ZHNA 3VBHB 3VBRA 4AW7A 5GLZA 2QDNA 2JD9A 1Q8VA 3ZYHA 1F9KA 4F3JA 1MS8A 2IC1A 3VKMA 4LHSA 2VE1A 5JOWA 1LGNA 5FXXA 3VD7A 4AEDA 3VZOA 4Q4W2 5BNOB 4JRAA 4UW4A 2GC0A 4XCAA 5FIXA 5K4LA 2DUPA 4K20A 4MXWB 1XPWA 1OQ1A 3VHRA 4DB5A 3FMGA 3BTZA 4XC9A 3NJZA 5ANQA 1LRHA 4HVOA 5F39A 1JH5A 1FNZA 4QQPA 1G86A 1NY72 3AMHA 3U75A 1D4M1 1W2TA 1W8OA 5KXEA 2R1DA 1YJLA 1R1ZA 5JXIA 5GZEA 2QQOA 3M70A 2WINB 2ETEA 2XH6A 3WF4A 1SCSA 2FD8A 1IZ3A 3I4IA 5FYSA 2DYCA 3C7HA 4NMIA 4XAEA 4ZXEA 2R0HA 3BU0A 4CXXA 4RS5B 1G9AA 1FV3A 3C3VA 3D6EA 1L7RA 1AJOA 4JZRA 1DCSA 5FZ0A 5BNNA 3GZUC 5JIAA 3MGUA 3IN9A 3ZMNA 4YZ5A 4PBOA 4AGVA 2NYYA 2OX0A 3NNMA 2FMDA 3OBAA 5DUUA 3ZDVA 1HRV3 1XB9A 2HWD2 3OGRA 5JI7A 2XDVA 4IEWA 3NNGA 3IDCB 2W2IA 3GBWA 4EN7B 3K75B 4GXLA 4Q4V1 4A45A 4GWNA 1VBE1 4NHKA 1OPMA 5FZDA 2AREA 1MQTA 1RUH1 2ET7A 5FPBA 3F95A 4LO6B 1E57A 5G05L 4ORFA 4F8AA 3NAPB 1HQNA 1DG6A 1CZTA 2RMU2 2J1VA 2VTFA 2PA7A 1K5MC 1ZA4A 2VMGA 4ZZ8A 1QJX2 5K8SA 2VUAA 4GJYA 3AL5A 5DMYA 1YRZA 4IGPA 3B00A 4EN9B 4KL1A 1PGSA 1HW5A 1AR72 3DXUA 3E6BA 3LDRA 2CV6A 4ZXKA 1AVBA 4CDXC 5ABJA 3U4XA 1QY4A 4BQXA 1IPKA 2JKXA 5LY1A 1UN1A 5C3PA 4Q8KA 1SLAA 3AKPA 3C8XA 3MYXA 1HJGA 4J1WA 2E26A 1UMZA 3BKZA 3SEPA 3POFA 2Q0AA 4XBQA 3TNQA 2LROA 2FMYA 3CIHA 2W68A 3AFGA 4KWKA 3Q8EA 5FYVA 4K6BA 3OUIA 4CA9A 2E51A 2VZQA 4IV3B 3DECA 1DQ5A 3UKNA 2Y6FA 5H9QA 5HXMA 2ADEA 3EMRA 3LCPA 4LO4B 1AXKA 1W8NA 4YNIA 3WHTA 4BMBA 4CUCA 2VL4A 5F8PA 2YZ4A 4H7LA 1AR63 2HWB1 3T2TA 4YGEA 1OKQA 2IXCA 4GB31 1BBT1 2VMDA 4AFCA 3ZYPA 4COWA 3NNFA 1KGYA 2X09A 3MUY1 3KF3A 3P6BA 3ZLIA 5F6KA 1SPPA 4LE3A 3ZSJA 4YZ2A 3OCPA 1YIPA 5FXZA 1ASJ2 1JYVA 2D44A 5FO9B 1PX4A 4JAAA 1JODA 2W52A 3ZFGA 4YM1A 5JXHA 1LOGA 4XTPA 2PLV1 5JDBA 1U12A 1UYPA 2NPIA 3EJKA 3I2DA 1OLME 1W8HA 1X82A 1JZ2A 2V4AA 2JE9A 3N7JA 4JDMA 1H8VA 1OBNA 4RSUA 4BWOA 1WLWA 2ZACA 5J09A 3R6SA 3CMGA 5F3IA 4FPHA 2VMHA 5JZGB 3RZMA 2P4EA 4AEMA 1W06A 2VJXA 4BQ5A 1AR82 2JB4A 1C3HA 1R092 1UZ0A 4E9KA 4UF0A 1BEV2 1CAUA 4NPRA 2V5DA 3OOXA 5L9RA 4JHZA 2FDHA 1S1AA 3VBFC 3EBRA 1ZRIA 1Z7S1 1UYZA 1SHWB 4K21A 3TEZA 3PVOA 1WW5A 4NR1A 2WZR1 3ILNA 4OHXA 3AM2A 2C9KA 5IHRA 1UYYA 5DAQA 4OULA 1WZXA 3USSA 5IK8A 2BQPA 2QJVA 1JI6A 4RGAA 2VCCA 4QQ2A 4CUGA 5A7WB 1LOFC 3T09A 4NRPA 4QPGA 5FPVA 5T50A 5CKNA 2VCAA 4UW5A 4I2OA 4RR3B 1RUD2 1HXS1 1D0GA 3AJYA 4FPCA 5FXVA 1ULFA 3E97A 4C91A 1A34A 4FTEA 1VBA1 4SLIA 4HOOA 1FPN3 1PX3A 1V6OA 2JG8B 2SBAA 3PU8A 1AL22 4U2AA 2XPJA 5A6XA 2JECA 3OGGA 2Y6KA 2RDNA 2HWE1 3CEWA 1GSLA 4LO5B 4JVAA 1TNRA 4UFMA 3I2FA 4GWMA 4XTMA 5KXDA 2QQLA 4OUEA 1RUI2 1QQP1 3DPRC 4HETA 1ND3B 2P2KA 4Q4X1 4I0AA 1ENQA 3LIGA 3I2KA 2QUOA 3JU9A 4AK3A 1LHVA 1LOAA 2LW8A 4FAGA 3PLQA 2TNFA 2ZGQA 3INAA 5LBEA 4EWDA 1LULA 2RS31 2JENA 1ZBA3 1MVQA 2XQXA 5GZDA 5CFCB 3B01A 3W21A 4O61A 1ZZBA 4W50A 1FMD2 1UPIA 2LRPA 2RR11 1BK0A 4WM8B 3WQ1A 5CG8A 3OUHA 1S0IA 2WZ8A 3VN4A 4EWAA 3OYWA 1S0JA 4Q5OA 5C4WA 4ISRA 5A32B 2JDAA 4UFHA 3SH3A 3HIFA 1F8VA 1NLRA 5JXJA 2VOKA 4LXLA 1VBD3 1XE8A 2CYFA 1RVF1 3LEGA 2C6SA 4AHWA 4HPKB 2E31A 2UWAA 5K0UB 1LB2A 3D0SA 4DUVA 1DU3D 3ES1A 3VBHC 2FDFA 3WG2A 2RMU3 2WWJA 4RL7A 3WNLA 5EIYB 1QXJA 5DG1A 4QX2A 3TEWA 1OF4A 4UT5A 1QJX3 2R6QA 3T0AA 1WBLA 3CJIB 1NT0A 1LHOA 3I59A 3J26N 4GIQA 1K5MA 3GHNA 1VBC1 3HR9A 1GR3A 1RXGA 4QPIB 3OSDA 4IE7A 2VBPA 4KU7A 4YSFA 4FPEA 2WO1A 5T5LA 4YM3A 2PHLA 1Q8SA 2EALA 2UY8A 3H8XA 1XYOA 1T6GC 4NIHA 1GQHA 2O0OA 4NHLA 4Q29A 3ZYIB 5GLTA 4OZXA 4Y24A 2ARBA 3UT0A 1HQWA 1YWKA 4WVWA 4FFGA 1Q8PA 2QQVA 4DNYA 1AJKA 4XFAA 4TWTA 1W6NB 3AKRA 4BIOA 1PK6B 1MR5A 3VL8A 2WO3A 2D3RA 5FP9A 2WZPP 3TWIA 2A1XA 4RS5C 4XMIA 5JSOA 3ZN6A 5FZ9A 1J1LA 4LBKA 3DCQA 3I2IA 5FKCA 4PLOA 1H1MA 4GMP0 3UJOA 1W9TA 1QU0A 2HWF1 2VTXA 3LFIA 1COV1 2Q1ZB 4YG6A 3VHOA 4A2UA 1C4RA 2F4LA 1YFUA 2ZX2A 4J6GA 3KWVA 4MGZE 4FP3A 4MHRA 5FZ8A 4L2NA 2R043 2ARXA 3MIHA 4N43B 1MS5A 4JGYB 2DV9A 4JV4A 2VW2A 1SFNA 4AI9A 4CCNA 4XDOA 4BJ0A 3NAPC 4XBNA 4C8DA 2PHWA 4L97A 4WBBA 3VD4A 1CQ9A 1NUKA 1UZWA 2BVBA 3JBG1 4YYOA 4I3GA 4Q4Y3 3URFA 1X33A 5GZGA 2QQIA 4X8PA 3Q9OA 3S30A 3JD72 5FTTC 3VV1A 2VZUA 1UCXA 4MX3A 3K4DA 5FR3A 1QH7A 2RDQA 1YQCA 1ODMA 3PUHA 5LK7B 2YUEA 2XJRA 3QLQA 1QJY1 3M8LA 3S0MA 2OS2A 3PUIA 2X05A 3S7EA 1AYM1 3WW3A 5KHHA 1Q43A 1REDA 1LOBA 3UNPA 3AX4A 1EAH1 2RV9A 4WVMA 4JHTA 5DZEA 4OQ9A 1WLTA 2IFRA 3NW4A 5FQ0A 1ZBE2 3USUB 4CDUA 1PHMA 3IPVA 2J1TA 4EV0A 2OIIA 2YFUA 3ECQA 4HK8A 4XFFA 4TLGA 3GBFA 4CXWA 1V6LA 2XVKA 4ES8A 5C9AB 2JDKA 4IV3C 1QNYA 2WNUB 2NN8A 1MS0A 4XW3A 3LQCA 4Y33A 1SZBA 4MOAA 1O6UA 3MW4A 4W6WA 1WA4A 2GALA 4CCDA 5A3OA 3NSTA 3IT8A 1VPHA 5EWSA 1A78A 1YUDA 1DLLA 1LOFA 2VZRA 4PLMA 5DUXA 1R083 2WZR3 3ACFA 3H8UA 3M3IA 2AEZA 1RMU1 3HVDA 2YMZA 3PVBB 2ZGUA 4AQ2A 4NIIA 4AF9A 2BNMA 1D0HA 1DQ0A 3BOPA 5C71A 2MNGA 1E5RA 4LA3A 2FDGA 4PI2A 5CVRA 1AL23 2WNEA 4G3YC 1PMIA 3FX3A 1QOTA 3LZZA 4DFSA 5KHKA 4LO8A 3H3ZA 5FO8B 1OOPC 3BU7A 4HG6B 2VOXA 5LBCA 3MUZ1 1DFQA
chains in the Genus database with same CATH topology
4PCRA 3DPRA 3OF1A 1WW7A 2P3IA 2ZZJA 4KU8A 3VGIA 1MEC2 4C0HA 4C1XA 2PQQA 1OFNA 1SCRA 2WT0A 5JZGC 2GDFA 2D5HA 4R9DA 5E1RA 1NXMA 1C8M3 4Q4X3 2ZGRA 4P9YA 4SBVA 1Y9QA 2XUMA 4C90A 1DZQA 3ZYGA 1GZWA 3NKTA 1YXWA 1ZZ6A 3WOGA 1QXPA 2JG9C 4LLFA 5JR7B 3WDUA 3DUIA 2WNVC 3SMHA 2RS11 4URTA 5HCBA 4GKXA 2EXJA 4Q0UA 1S2KA 1MZ5A 3OGJA 4RR3C 4AI3A 4IEPA 1V70A 2VQAA 3N35A 4L99A 4XFCA 3VBHA 4COVA 1BMV2 1KRIA 1DGRA 4QT6A 3B9IA 5D1IA 2AH2A 4KGGA 1ALYA 2YGLA 4BPZA 1ULEA 2JG8C 3OD4A 4HANA 4JTNA 4OLLA 5SV5A 1X7NA 5BNOA 3RZZA 3SXWA 4B3NA 2X8KA 5C6CA 1LHWA 1VRH2 3RI9A 1MS9A 2GMPA 4A3XA 4NOTA 1QDOA 3QH6A 1ND3C 1ZRCA 3GBGA 4EROA 4KBBA 4YW5A 1AF9A 1JUIA 4GH4B 2H6BA 4AYUA 2CNAA 3WV6A 5I8TA 3JZVA 4V1PA 1C8NA 1OA2A 1S0BA 5CFCC 4MXVA 2E7AA 1QJU3 3V0AB 4RS5A 2PAKA 1A8MA 2P3KA 5SV8A 3WP3A 1F5JA 2XL7A 4WM8C 3HMYA 1CIWA 4FAHA 1POV0 2TEPA 2VH9A 2ZKLA 3AMQA 4YG3A 1FAYA 1FOD3 2DUOA 2Y0OA 1H1IA 3NV4A 3O14A 1GQGA 4QM8A 4KWJA 3GZAA 4XIOA 2VVEA 4CDQB 4B4PA 4XXAA 2VMIA 3R4SA 4XJAA 2UU8A 3FLPA 3ZIXA 4AI1A 1DYPA 2G9GA 1PO22 3LOIA 3ZSMA 4WM7C 5AFBA 1PVC2 1JW6A 2BFUS 2R0FA 1H30A 2WQ4A 3NAPA 4IETA 1H4HA 3CJIC 2O8QA 3NV1A 2VOVA 4PDWB 3X29B 3KT4A 3WUDA 4ASMB 2KM2A 3BALA 1AZDA 2HEWF 5CIRA 2R30A 1YIFA 3L9JT 1TMF2 4FOYA 3KGLA 1DZRA 1RB8G 2HWC3 3TN92 4AHXA 5GLWA 5A3MA 2I2SA 5I0TA 1SMVA 2VPVA 1HDKA 2Y26A 5ACA2 2Z79A 1ZM1A 4IV3A 2XJSA 4QQLA 1QXRA 2MEV3 2I07B 1JTZX 4PQ9A 4FPYA 3VLBB 2WWSA 3UJQA 4LA2A 1HLCA 3ZDSA 1YCIA 5KBFA 4Y1VA 4DPNA 1ENXA 2XVLA 2D93A 1KS4A 1LJ7A 2Y38A 1W0PA 2IXJA 4IXLA 1UIJA 4P9WA 4N43C 4FTBA 4JGYC 4K8FA 3ZSLA 4I30A 5J37A 2DCYA 1Y3TA 2JKBA 1AX0A 1AR61 1OOPA 1SLTA 2UY9A 3OD0A 1VBB2 5L7OB 4XJWA 2V5YA 1PGW2 4HZFA 4QQOA 4Y1YA 3ZYJB 4OI2A 2ZHMA 2TUNA 1WMFA 1EV12 4FVVA 1WMDA 2XKOA 2PHDA 1QH6A 1KQRA 3BTAA 1TME1 5JZGA 1RHI3 4NHMA 2XL9A 3WD5A 2Q1MA 1YI7A 1JHNA 3R0RA 2WL1A 5J3UA 4XBLA 4OHZA 2MPFA 2C9AA 4IV1B 3H7YA 1WLCA 1FATA 3HT1A 4M3CE 2WNUC 1PIV3 3IDBB 1J3PA 2GU9A 2TBVA 4MH0E 3ELNA 2JX9A 4RR3A 3WDTA 4GULA 4OFGA 5T3NA 4R8HA 3AYCA 2RM21 1O5LA 1ULCA 1DQ1A 4HMZA 1X8MA 2JJ6A 4E2QA 3N4MA 4OUMA 1GICA 2JG8A 1GZ9A 2FZ2A 1DGWA 2HEYF 3OY8B 2IZWA 3WP5A 1PVXA 3SNMA 4IQPA 3D4KA 4AWDA 1KJLA 3J8F2 3KLSA 1XNDA 2EXIA 4WZCA 4QPYA 2GSYA 5JOYA 1FPN1 1ND3A 3FBMA 2A71A 3RYKA 2CTVA 3VHNA 4FPKA 5C8CB 5CFCA 1ONAA 5JI9A 1CAXB 4PIXA 1V9U3 4HLTA 4OHVA 2BWCA 1ND2B 5KHJA 4WM8A 1UPSA 2XWBB 2ERFA 4ONUA 1PZ8A 5T5PA 5A32A 1ZBA1 3JQXA 5EFUA 2ZGTA 4RHV2 2BYVE 4ZKTB 2WSVA 4AVSA 3PNAA 3RI8A 2Z42A 4HPKA 1PVC3 3ZO0B 1R1A3 4X8NA 5K0UA 4A7YA 4WM7A 4XJ8A 2R49A 4P5HA 4CTEA 4GALA 2GN3A 3NL1A 4LBQD 2PHTA 1VBD1 4XXPA 4XF4A 3WX5A 3H7JA 3CJIA 1SLCA 2D97A 5JOZA 2A3WA 4UXAA 5C4WC 5EYXA 1WCSA 2RJKA 5T52A 5JMCA 3ZFFB 1TMF3 3AZWA 4CEWB 1WW4A 2RMU1 2K0GA 2FHRA 2XLAA 4LBOA 2NM1A 2A70A 3WDXA 2NLRA 1QJX1 3SISA 2WFF3 4MGYE 3I8TA 3B5LB 1CJPA 1MVEA 4IERA 3AMNA 1S0CA 2YPJA 1SBFA 1YFXA 3ZXEA 2YROA 1D4M2 4ITCA 3CO2A 1MACA 3TAYA 4FPOB 3VZNA 3VDDB 1OQEA 3G7DA 1W6NA 5C33A 1PK6A 2D7FA 3IBMA 3VL9A 2ZBJA 1GFF2 2HKXA 4AI0A 3MEPA 4YM2A 1QMJA 1UD1A 1PNFA 4QD2A 3AYAA 3K51A 4CDQC 2CAUA 2E63A 3E5UA 4AI8A 1H9PA 4S2GA 4TSVA 3B3QE 1O4YA 3H50A 4HN0A 1W6OA 4XOGA 1CONA 4N43A 5HBAA 4JGYA 5JVVA 5KXCA 4YVSB 1YHFA 4YZ4A 2EAAA 1NG0A 4M3CF 4Q4V2 4X6RB 1VBE2 2WA3A 3RSJA 1LGBA 1XRUA 3R4UA 2DUQA 5B2GB 4PDWC 2WFPA 5LEJA 4BCUA 2R041 4EN0A 1I9RA 3RWNA 2D3SA 2DURA 2GNDA 4CDWB 2BWAA 2I74A 5BY5A 1JOJA 1DHKB 2G4IA 3SHRA 4INDA 2PHXA 3VBOB 3MICA 3POWA 3PJQA 4Q4Y1 1DGLA 4F7ZA 2R072 1ZREA 1W39A 1APNA 2D6MA 4TYSA 3H3UA 1Y43B 1IKPA 3H1WA 2OA2A 1TME3 4M00A 4LNVA 5LK5A 4BLJA 2NP0A 1OPOA 2WS93 1J59A 2WNUA 2ZTNA 1BEV1 1KFXL 4XF1A 3S6PA 4MYEA 3FLRA 4ATEA 3FLTA 1LU1A 2ZHLA 2EVXA 3E6DA 4NVPA 2H0VA 1RUG2 2EF6A 5KC5A 4Y4YA 2XLFA 4HFSA 1FX5A 2A5ZA 3U11A 5GM0A 1RUC3 2NMOA 1QJZA 1O5UA 1CAWB 2V09A 2XJUA 2HWB2 1UZYA 4CDUC 1FT9A 3ALQA 4GB32 5BNPB 1DIWA 3T1MA 3PJYA 4FOWA 1BXHA 4BE3A 1IQAA 2B39A 3P3PA 3RJRA 1R081 2JD4A 5L7OC 5CG9A 2RM23 4CRQA 1YI9A 3U10A 4XFGA 3R05A 4LBLA 2IXHA 2AYHA 1AL21 4FOVA 4XFBA 2PLV2 2JICA 3ROUA 4AVBA 4FPJA 2IXLA 1LHNA 1MS4A 3SITA 4IEVA 2BPA2 2QKDA 4Q4W3 3PVNA 3RG0A 4AEKA 4E27A 5CB7A 3RDIA 1H4GA 4N53C 3THTA 2ZGLA 3WG3A 2BNOA 1LGCA 5J7MA 5J96B 4Y22A 4FQZA 4YG0A 4IV1C 4JGZB 1RTVA 1QOOA 2PFWA 2XJPA 1LENA 1C8M1 1Z7S2 5E89A 3RJ2X 3LSDA 4RGGA 2DTWA 2VNRA 3U0ZA 3FWEA 4HSJA 4AFAA 4H3WA 1BKZA 4XE9A 4B8EA 5J48A 4Z07A 1PZ7A 4RFT0 1NCRB 1UAIA 3ZIWA 3CU7A 2EXHA 4UW3A 4AVCA 2H6CA 4D7TA 4Z1VA 4OI1A 5CA6A 4K1YA 3M1HA 1W6PB 3RRDA 1VBA2 2VVDA 1LESA 1XXNA 1ENSA 2W39A 2HWD3 5HCAA 1U5IA 4XPVA 3UKTA 1VAVA 2Z2SB 2HWE2 3MLJA 2ZX1A 3WUCA 3P3NA 2Q5TA 3RNSA 3IMNA 3DF0A 4CEYB 1YYNA 1GV9A 1QQP2 4GH4A 2K9ZA 1VLNA 4IEXA 5C8CC 1XQNA 2PN5A 3KT1A 4L8QA 3DV8A 4XHBA 2VU9A 2OZ6A 2RS32 4K40A 3AMPA 4P14A 3VBUB 3V0AA 5BNOC 3PMSA 1AR73 4RQPB 1PGL2 1ND2C 1UIKA 1G8WA 1ZZ7A 4DY3A 1H2LA 3WCRA 2O8OA 4LE4A 4MLOA 1RUE2 2E53A 1MS1A 2RR12 1MS3A 2ZZQA 4DINB 2Y0IA 4CDQA 1QJU1 1LEDA 2ZX3A 1UF2C 4META 1NA1B 4AQ6A 1RVF2 4YRDA 1FOD1 5HI0A 4HT1T 3AZZA 1D2QA 4IEZA 4Q0SA 2DTYA 4QGMA 1XYPA 3A0NA 4PF5A 1O7FA 2OUJA 1ULGA 2B8MA 2WSUA 3LB9A 3QACA 3WVJA 1DQ4A 3AP4A 4PDWA 4XF0A 5EZWA 1CVNA 1H8TB 3M3EA 4I09A 3ZFFC 1VBC2 4M0NA 4CEWC 2BEOA 4NWVA 5LRSA 3GF6A 3ZYRA 3S7IA 3T1LA 1VR3A 4AVAA 1ASJ3 5AVAA 1N3QA 2ZA9A 2E9QA 3JQWA 2E7QA 1ULDA 3VDDC 3ASIA 2ET1A 1Q56A 1HV1A 5T55A 1AUYA 2HWC1 5L36A 4PIZA 2CWSA 3NVCA 3WQ7A 3WINE 2NQYA 4GA9A 1H2MA 1TE1B 5FRAA 2PHFA 4QXKA 1MZ6A 1AR83 1AXYA 1R093 2WJSA 1COV2 3E5XA 3HAGA 1OI6A 2C0ZA 1BEV3 4M3CB 4ZU4A 1RINA 2MEV1 1ZVFA 2I45A 5KXBA 1ENRA 2YV8A 1AXZA 1V6JA 4YVSC 3QBQA 2RS52 4FXGB 4MV2A 5F5QA 5KWRA 3WP6A 3JUUA 5L7OA 1QF3A 1GYKA 1G7YA 4HVRA 1W6QB 4DRRA 2R062 1HRI2 4LHNA 3MW2A 4TLFA 4AQTA 5JLVA 3JBG2 1YNAA 1RUD3 5HCFA 5H9PA 4CDWC 3WW2A 4ATFA 3HT2A 4LTAA 4YVWB 1OQDA 2GC2A 4AI2A 4F83A 2ES3A 4HL0A 3ZPYA 1C5HA 2P34A 4RA0A 4XJZA 3VBOC 4P9XA 3DGTA 2UYAA 2ZGPA 2GC3A 1QJY2 1UZZA 3NWKA 3NV3A 2DF7A 5H9SA 1AYM2 5GJ6A 4HBNA 4N53A 1BVVA 3IIAA 1RUI3 2D6NA 3UKVA 4IV1A 2D6OX 1RHI1 1JBCA 1U0AA 4IEQA 3KCCA 5DZGA 2XJQA 4I01A 3MIEA 1H1AA 1OMIA 4O9GA 1F2NA 1PM7A 4G9SB 1D4VB 4AEJA 4QX5A 1FMD3 1LOEA 2XBO2 1PIV1 1RMU2 4FBFA 1KXGA 3GYDA 1DZTA 3WY6A 1BMV1 4P9IA 3OY8A 1N3OA 3SH4A 2ZMKA 2PHRA 1UU4A 3LA7A 3ACLA 3FE5A 3QH7A 4OUSA 5BPXA 5I0RA 5DUWA 3AZYA 4FSJA 3BIWE 1H0BA 1WLDA 2VOWA 3M3OA 3LOBA 1M4WA 5FOJB 1NCQB 4QM9A 4B7KA 1S2BA 4XMAA 2F6BA 1Q8OA 2VXRA 2PTMA 4W6YA 1MZEA 1KS5A 2OYZA 5AC92 5C8CA 3PTYA 4WZFA 1ZYBA 1LECA 4FQ4A 1CAXA 1EY2A 1QKQA 4Q0PA 4LO7A 1ZZ8A 2P3JA 5D8AB 4LUKA 1ND2A 3VZKA 4MXWA 4JQRA 1RUE3 1AYN2 2R1BA 5BUVA 5FOBB 1WD4A 2P17A 1LEMA 2BUKA 2X53S 1CX4A 1V6KA 4JGZC 3M3QA 3UK9A 3RQ0A 2ZPXA 1CGPA 1V9U1 3A4UA 3ZXJA 2Q30A 2RS12 3E6CC 4Q27A 1NCRC 3SCHA 4XDQA 3OYWB 3N7MA 4R9BA 1BZWA 3KD4A 3U07A 1QNWA 2FZ1A 1RGSA 2A3YA 5JIUA 1WCKA 1QWRA 3PMEA 1FNYA 1PVC1 4K3UA 1R1A1 3WDVA 1NE4A 4BZ4A 1WGPA 2OW4A 4KGQA 3ZFFA 4CEWA 4WVZA 3WHUA 1PNGA 3BPZA 3VHPA 4ES9A 3AFKA 3WZ1A 5TSWA 4D7YA 5BV6A 4CEYC 5K0UC 1LODA 4D7SA 4DMIA 2OZJA 5EYYA 3V65A 1K5MB 4AVVA 1OHFA 2PAEA 5BNQA 2DVGA 3O0XA 2ATFA 1TMF1 1J58A 5K9YA 4R9CA 5J98B 4FT8A 4QQHA 3VDDA 5I0SA 3KS7A 3KCXA 4CDXB 1KDKA 3JD73 2WFF1 3VBUC 1QGLA 4JRLA 4QPIC 4RQPC 4ZU7A 2VUJA 1V6MA 4S2HA 1C1FA 1V00A 5ACA1 3AB0A 1CD3G 3N7KA 4N7UA 3R4DB 1REEA 3PVEA 1ZBE3 3HD8B 2NMNA 4XHXA 3RS6A 3QOPA 1CAVB 4I02A 1FI2A 2VGDA 4KH9A 1Z0HA 1LU2A 1NA1C 3CLPA 1RL3A 4YVSA 1PK6C 4K7JA 1OA3A 1RUF2 3BCWA 2R063 5CADA 3VKNA 5IK4A 4NN0A 4I0BA 4LHKA 1HRV2 4KNCA 3VKFC 2ZAHA 4IL7A 5FLHA 4CDWA 5IT6A 4P9LA 1VBB1 5AVPA 3KQRA 3WR0A 1CPMA 1O3QA 4E2GA 1PGW1 3VBOA 2GC1A 1YLLA 1DGWX 2Z5WA 4LULA 2B42B 2DVDA 3W58A 2X29A 2B7YA 2EXKA 2R16A 4UW6A 5JWPA 4XEZA 3IDEA 1DDLA 2K2SA 2UWBA 2ZJCA 4IEOA 3JB8A 1ZZCA 1MEC3<