5L7OB

X-ray structure of triatoma virus empty capsid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
179
structure length
179
Chain Sequence
THSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 34
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oB00
5BNOA 1ND3A 1PO11 5DDJ2 4Z92B 2XBO3 2WS91 2R062 5C4WB 4JGZB 4CDUB 1OOPB 2QQPA 1RUE2 1BEV3 1HQNA 4IV1C 2XPJA 3J8F1 2WZR1 2WLPA 1CD3G 1HXS3 1HX6A 1M06G 1QJU2 4Q4X1 3ZFGC 4GMP0 4FSJA 5AC93 4RS5B 1ND2B 1COV2 5A32B 3VBFC 1VBC1 5C9AB 4YVSA 1AR92 4Q4Y2 3JBG1 1K5MA 4Q4V1 4AEDA 4QPGA 1FMD3 1PO23 1HRI3 4RQPB 5LK7B 5K0UA 1R081 1MQTA 2WFF3 4N43B 1FPN1 2HWF3 2R071 1B35C 1RUC1 3JD71 3VBHA 4WM7A 3VBSC 3ZFGB 1RUD2 4GB32 5BNPB 2R061 1RUE1 4SBVA 2HWC1 1QJU1 5CFDC 1COV1 5BNOC 4QPIB 1QJY3 1ND3C 1VRH2 1H8TA 3ZFFB 4JGZA 1OOPA 2FZ1A 1AR91 4Q4Y1 1PGL2 4JGYB 1AR83 5ACA1 1EV12 1SMVA 2RMU2 3VBSB 1RUF3 4CDWC 4GH4A 2ZTNA 1IHMA 5L7OA 2XBO2 5BNNB 5C9AA 1NA1B 4YVSC 5CFCC 1RUH1 1RHI1 1BMV2 4CDXA 1POV3 1RUD1 4GB31 4AEDC 1VB2A 4QPGC 1HXS2 4WM8C 2R043 1RVF3 5K0UC 1MQTC 4N43A 2HWE2 5JZGC 3VDDC 1RUG3 3VBHC 4WM7C 4CDWB 5D8AC 5BNPA 1AR73 1QQP3 2GH8A 1FMD2 1PO22 2RMU1 4CEWB 4CDQC 3JBG2 2WFF2 1RMU3 5CFCB 4FTBA 1VBB2 1NCQA 2RR12 1VBA3 5FMOL 1H8TC 2XBO1 1R082 1FPN2 2R072 3IDEA 1NCRC 4JGYA 3VBOA 2RS13 1BMV1 1RUC2 1RUJ2 5ABJA 1F8VA 3JD72 1C8NA 1ZBE2 1HXS1 1AYN3 3DPRC 4YVWB 4GH4C 5AC91 5FOJB 2MEV2 4RHV2 1QJX3 2HWE1 1X33A 5L7OC 4RR3A 2HWC2 4PDWA 3VBUC 5A33B 5BNNA 4IV3A 1VBD3 1AL22 3VBRB 3ZFEB 5J98B 4CDXC 4Q4W2 4CEYB 3NAPB 1RUF2 2FZ2A 1FMD1 1PO21 3TN92 1HRI1 1V9U3 3CJIB 5ACA2 2WFF1 1VBB1 2RR11 2BFUL 2WS93 2Y26A 5C8CA 1D4M3 1R093 1PIV2 4IV1B 1RUJ1 1HRV3 2X5IA 1ZBE1 1RUH2 2IZWA 1RHI2 2R042 1RVF2 4Q4X3 2MEV1 1RUG2 2RS53 3VBFB 1QJY1 4RHV1 4NWWA 1C8M3 1BBT3 1R1A2 4N53C 2HWD3 3ZXAC 1TMF3 2ZZQA 3VBOC 5ABJC 1TME2 1AL21 1QQP2 2RS33 1NOVA 4Q4W1 1AYM3 1ASJ3 1RUF1 1RMU2 4YVWA 5C4WA 4CDUA 3TN91 2WWSA 1PVC2 2ZAHA 4RR3C 1B35B 1MEC3 2BPA2 4PDWC 5DDJ3 1OPOA 4RS5A 3JB4C 1ND2A 5A32A 5FMOS 2RS12 4IV3C 4RFT0 3VBRA 1POV1 1RUE3 3S6PA 3ZFEA 1FOD3 1PIV1 2BUKA 1AYN2 1AUYA 4N53B 1QJU3 1BEV2 1RVF1 2R041 3CJIA 4NWVA 5CFDB 4Y5Z0 5BNOB 1K5MC 1EAH3 1ND3B 1RUG1 4RQPA 3JB8A 5AC92 1R1A1 1Z7S3 5C8CC 1AR93 4Q4Y3 4FTEA 1TME1 2X5IC 1QQP1 3LOBA 2RM23 1V9U2 1RUI3 3ZFGA 1AR63 2HWB3 1RB8G 1RMU1 1PVC1 1VAKA 1HRI2 4YVSB 1D4M2 2HWF2 1ZBA3 2BFUS 4QPIA 1X36A 2RS11 4GB33 1HRV2 1K5MB 2VQ0A 4AEDB 4QPGB 3ZFFA 1AYN1 4WM8B 5C4WC 4GMP3 4JGZC 1OOPC 4CDUC 5K0UB 1MQTB 1POV0 1BEV1 2RS52 3VDDB 5JZGB 1QJX1 1C8M2 3VBHB 4WM7B 1VRH3 3VBSA 2PLV3 2HWD2 4RS5C 1ND2C 1TMF2 5D8AB 2GSYA 1QJY2 1VBD1 4Y4YA 1AL0G 2RS32 1EV13 1AYM2 1NA1A 5C9AC 1F2NA 4CDQB 1V9U1 3HAGA 1AR82 4FTSA 1MEC2 3FBMA 1H8TB 1VBE3 4RQPC 4LLFA 5GKAC 1GFF2 4N43C 1D4M1 1NCRB 1R091 2HWF1 1FOD2 1PGW2 1PO13 1HRV1 4CDWA 3DPRB 4GH4B 5BNPC 1A6CA 2HWE3 1EAH2 3J8F3 2RS51 5L7OB 2WZR3 3VBUB 1C8M1 1BBT1 4CEWA 1Z7S2 5CFCA 2HWD1 1TMF1 4QPIC 4CDXB 2DF7A 1VB4A 1NCQC 2RS31 1VBC3 2TBVA 2RM22 1RUI2 3ZFFC 4WM8A 1AYM1 1ASJ1 2HWB2 1AR62 1AR72 1NY72 3JBG3 4JGYC 5JZGA 3VDDA 1AR81 4Q4V3 1VBB3 1MEC1 2RR13 5DDJ1 1R083 1ZBA2 5D8AA 1FPN3 2R073 1RUC3 1RUJ3 1FOD1 1VBA2 1PGW1 3JD73 5A33A 1ZBE3 5BNNC 1NA1C 4CDQA 2R063 2MEV3 4CEYA 4RHV3 4BCUA 1EAH1 1NCQB 3NAPA 2HWC3 2PLV2 5J96B 1Z7S1 1WCDJ 1NCRA 1QJX2 1COV3 3VBOB 5ABJB 1AL23 4Q4W3 2RM21 1RUI1 3DPRA 1AR61 1VBD2 2HWB1 3TN93 1AR71 1NY71 4IV1A 5ACA3 2BBVA 4RR3B 3VBUA 4PDWB 1VBE2 4CEWC 3M8LA 1W39A 1ZBA1 4IV3B 3VBFA 1PO12 1PIV3 1E57A 1VBA1 2WS92 1DDLA 1R092 1RUH3 1RHI3 4GMP1 1RUD3 3J8F2 4EJRA 2WZR2 1NG0A 4Q4X2 1VRH1 2PLV1 1R1A3 4YVWC 1QJZA 5C8CB 1PGL1 1B35A 1TME3 1VBC2 1BBT2 1OHFA 2X5IB 1EV11 1CJDA 3VBRC 3ZFEC 4Q4V2 1PVC3 4CEYC 1ASJ2 3NAPC 2RMU3 4N53A 1VBE1 5CFDA 3CJIC
chains in the Genus database with same CATH superfamily
3JZVA 1RIRA 4Y20A 4UAPA 1W6OB 4XJ9A 3WP6A 2FBEA 4UW3A 1DF0A 4EN7B 1WLCA 4LO8A 3HQXA 4ORFA 3E5XA 5FP9A 4AVTA 1REDA 1HLCA 2R062 1CJPA 2JG8C 5A7PA 2C6SA 2PAKA 1QXPA 3CNAA 1ALYA 2GP3A 1UYYA 2WZEA 4QX5A 5FP7A 4A3XA 3AYEA 2XPJA 2WZR1 2C9KA 4LK7A 3HN1A 3GZUC 1ENQA 3WNPA 3QACA 1M06G 1QJU2 2DVFA 1A8DA 1W8UA 3LAGA 5AC93 5A32B 3VD3A 2GAUA 1DGRA 5D21A 1H8VA 4FP2A 4FPFA 3NKGA 3AP6A 2ZGRA 1JXNA 3GCXA 4P9WA 3WW1A 1ZZCA 1WMFA 4GWMA 3HD8B 1VBC1 3WF2A 2W94A 3GZTB 5JMCA 3AJZA 2YY1A 1AR92 4I09A 4AI1A 4DUVA 2VTXA 1E5HA 2BGCA 1QH7A 3E6BA 4H3WA 1RXGA 4WVVA 1DQ0A 5F39A 1BK1A 1AX1A 3AMQA 4CP0A 1PO23 3T1MA 3RZZA 1HRI3 3RZJA 3KZ4C 2YBPA 3KCCA 1G9FA 4XDOA 3K77A 4IEXA 4A41A 2RG4A 1WWYA 3ZPOA 3U75A 1RUC1 1GSLA 2XQRA 5I93A 1OFSA 4IGQA 4GZ9A 2JB4A 5EJZB 2WT1A 3VBSC 4A6OA 3AP9A 1UN1A 3U4SA 1NQDA 3KWVA 1CX1A 3FLRA 1RUD2 2RJLA 3H3LA 5BNPB 2BWCA 3UJQA 3PTRB 4B3NA 3EBRA 1TVGA 4FPLA 2JB8A 4XJWA 4B8EA 2ZEXA 4JTOA 3I2HA 3MLLA 3UGHA 1H30A 1BCXA 2DCJA 2Z69A 4KG8A 1ULDA 5BNOC 3J4UH 2LTNA 1ND3C 4N90A 4DMIA 1VRH2 1VLNA 4IGPA 2H6BA 3RDIA 3AZZA 2QQOA 3PU8A 5HCBA 3I59B 4XPVA 5D1IA 1PK6B 2OYZA 4N9HA 1J3PA 4RGKA 4AEMA 2PHDA 3ZKYA 2Q1ZB 2V4VA 4HONA 4B4RA 3DL3A 2Q8DA 1SMVA 4BISA 1FV2A 4DUWA 3WDYA 1UMZA 4J1XA 2XJUA 2XWJB 4ITCA 2BQPA 2CWMA 2J1EA 3WDXA 4NOTA 4ONUA 1LOCA 4B7EA 2E7TA 1FI2A 4A44A 3VHPA 4IEYA 3W59A 5C9AA 3MFAA 2VMDA 4A7YA 5KHGA 4IEWA 1RHI1 1S0JA 3ZXFA 2W08A 2RE9A 1UPSA 3ETQA 3GM8A 4YW5A 1U5IA 3VKFC 3WOGA 4QGNA 4AEDC 5CG8A 4QPGC 3W9AA 4X6QB 5AC91 4K8FA 1CQ9A 1WZXA 1US3A 4QQ2A 4LR4A 2ORZA 2UWAA 3H8UA 3RNSA 1MQTC 4ZZ5A 5IVEA 1WUVA 1XC6A 2ZKLA 3MIFA 4FVVA 4XJAA 3TNQA 3L9JT 4ZONA 2D5HA 4AG4A 5A6XA 4LMFA 1W8ZA 1W2AX 2V72A 3AKPA 4OHXA 4AR2A 2G9FA 1E5IA 4E9KA 2Y6KA 1HN0A 2Q5TA 5FQ0B 1W2TA 3KS7A 4UW5A 3SMHA 3OBAA 2JD4A 1U5XA 3R4UA 1GICA 5L19A 2XVLA 5T55A 3OG2A 3KF5A 2WFF2 1RMU3 4FCAA 1DLCA 4UW6A 3AL5A 4Z1VA 1BYHA 1VBB2 5F32A 4LEJA 4NHLA 3BALA 5DQ0A 3EO6A 1VBA3 3HNYM 1HB2A 2O8QA 1YC61 2XBO1 5LY2A 4OMCA 2XG3A 1UOGA 1SLBA 1VJ2A 1FPN2 5JXHA 3ZPYA 3IDEA 1NCRC 4QX8A 3LWCA 3JD72 4LO5B 4BIFA 4IL7A 4Q5OA 4YGDA 1HXS1 1AYN3 1UL9A 1WGPA 3GBWA 3RFRA 4YZ1A 2W9XA 3DPRC 4YVWB 3TYJA 2VZQA 1DQ5A 5KXBA 2MEV2 4FPJA 4RHV2 3V0BB 3LKJA 5FY4A 2P37A 4XBLA 4C1WA 2D6MA 3O1VA 3CDZB 3ZN6B 5A33B 4LA2A 2JKXA 1QF3A 2EAKA 3NNMA 1RINA 5T54A 4AHXA 5JDBA 3BTYA 3LEKA 1IKPA 2XLFA 2VH9A 4XHBA 3GBGA 3N7JA 4IV3A 4QDQA 3VL9A 2QKDA 4CCNA 5J98B 5JI7A 4Q4W2 4W6XA 4CCMA 4CA9A 3ZR5A 5FZ9A 4OQ9A 4JKMA 2DTYA 3NAPB 1RUF2 1NZCA 2FZ2A 2VZ1A 3ILRA 4LIUA 4PLNA 1V9U3 2V5DA 2XHNA 1MZEA 3CJIB 2A5ZA 3GHMA 2VUCA 1YQCA 4M0NA 4BMEA 4HPKA 1NKGA 2JDYA 1W8WA 2RR11 2BFUL 1WD4A 4LHSA 4V2VA 5HCHA 2WL1A 3C7EA 2RDSA 2K46A 2XJRA 4BOWA 1UU5A 4OCTA 4GAZA 4BJ0A 2PQQA 1LU1A 1L3JA 3NWKA 5JPNB 1ZZ8A 3T09A 5K4LA 4D7TA 4AI0A 1RUH2 1LHWA 1ULCA 4Q4X3 2QZ2A 2VECA 3NO8A 5CIRA 5IAVA 4XQDA 2B46X 2VZVA 5IJRA 3ZIXA 1CAXA 3K48A 1RUG2 3VBFB 1QJY1 5IWFA 4NWWA 1TQ5A 5GLZA 1OD5A 4KH9A 3WQ7A 1R1A2 2A6VA 2E53A 4N53C 4R4ZA 4BQ5A 4ASKA 4CCCA 4MADA 2HWD3 2XWBB 3IIAA 3PL0A 1CZVA 3ZXAC 5IT6A 5FBZA 4FFGA 3WF0A 1ZYBA 2HEYF 1NOVA 4LORA 1QMJA 1H9WA 4B1MA 3LSDA 1ASJ3 4TXWA 2CGOA 3OYWA 1DZTA 1UPIA 1SFYA 3OUJA 5C4WA 4CDUA 1ZRFA 4OHVA 5H9RA 3NNJA 2CGPA 5EQUA 1MVEA 3ILNA 5BYNA 4ASMB 2ZX0A 2O0OA 1B35B 1MEC3 4RR3C 4PDWC 1LRHA 2A71A 2OW4A 2VW2A 4OHWA 1FV3A 4LTAA 3M3IA 4QT6A 2X29A 3O1RA 3DYOA 1JYWA 3JQXA 4RFT0 1POV1 1RUE3 1SDDB 3S6PA 2VUJA 1FOD3 1PIV1 2D6LX 1N1VA 2BUKA 2OXBA 3A4UA 1UY2A 1H9PA 2PQSA 3DXUA 5FK8A 5FUIA 1AUYA 3O1TA 1JYTA 3WUDA 4A7KA 2R041 1RVF1 5CFDB 4W6YA 1GWLA 4Y5Z0 3B9IA 5F37A 2FCVA 1DQ6A 3LIHA 4P9JA 5AVPA 1MR5A 1HQLA 1V6NA 3W5NA 4O9EA 4ET7A 3I2KA 3FL7A 2LS6A 2VNRA 2WQZC 2XKPA 5AC92 1UOJA 2WT0A 3VZNA 5C8CC 2D7FA 2XQXA 3DF0A 3S5QA 3SHRA 3QLQA 2FDFA 4Y1YA 3E5QA 3VHOA 5HCAA 5A7WB 3AP5A 4UOJA 2X5IC 1QQP1 4NMIA 2ORXA 5A3WA 1GV9A 3WDVA 3LOBA 3ALQA 1YQ6A 3KHBA 1RUI3 3B02A 1UU4A 2AH2A 1RB8G 1O6UA 1FXZA 4JRAA 4HETA 1DZQA 2HLEA 1OKOA 3AXEA 3Q8CA 4XJ8A 3RI8A 5BV6A 3T4HB 3IDCB 1LULA 2A70A 2B42B 3ATGA 4K6BA 3IM0A 4LBMA 1IQDC 1HRI2 2IUWA 3K2OA 1YEWA 2ARCA 3LA3A 2X8KA 4FPKA 4OUSA 4YVSB 3WQ0A 3ZXEA 1K5JA 2BFUS 4QPIA 4HG6B 1ENSA 4EN8B 4DXZA 1EPWA 3TB0A 1PZ7A 2J1SA 3B69A 4CU9A 1FX5A 4UW4A 2W92A 4OYUA 2ZHNA 1W9WA 4YM0A 3ZFFA 4MHUA 4WM8B 4LIVA 3OCPA 4DZGA 1ONAA 2XONA 3PIGA 2WJSA 1LOGA 3C3VA 3NV1A 5K0UB 3OEBA 1POV0 2FDKA 3I2JA 5JZGB 3VDDB 2A1XA 5C7GA 1QJX1 1XYOA 3AMMA 5LBFA 3WCSA 4HKWA 4GXLA 4W65A 3MW3A 4XFIA 5GLWA 2D5FA 1BVVA 3VBHB 4WM7B 4WVWA 3O14A 3VBSA 4EN0A 1W8NA 1K12A 5A6QA 1OSGA 1W2OA 1U5ZA 3QOPA 4UYBA 5D8AB 5IHRA 2NP0A 4XFCA 3SITA 5FDBA 3JU9A 4R9AA 2YGLA 4U36A 1KD7A 1VALA 3KCXA 1X8MA 4B29A 3J26N 5J48A 1JYVA 2BP6A 2B7YA 2EVXA 1A3KA 3BOWA 4OHYA 1FYUA 4YARA 2BVBA 4OVEA 3RS6A 2ZGTA 4L2NA 3IAPA 3H8RA 2VNVA 3I3BA 4FTSA 5IFPA 4MXWB 3WG3A 1URXA 2VNOA 1WLDA 4F3JA 4CUAA 1H8TB 1SQ4A 5LY1A 4L99A 4LLFA 2EIGA 3GXUA 4UFMA 2OZ6A 1D4M1 3N9LA 3VZKA 3WW3A 1VAMA 2IXLA 3P3NA 5IAXA 2GDFA 4NVPA 2P17A 2ZOEB 5JR7B 2VMCA 5I8SA 1MACA 5FYVA 3WV6A 1DGLA 1JOJA 2LUWA 3OY8B 5ISLA 3GNEA 4GH4B 3O5SA 2G4IA 5BNPC 1A6CA 4KWUA 2HWE3 4XTPA 3IPVB 2RS51 5L7OB 4IXLA 2VMGA 5DAQA 1QJEA 3P5BA 1S0CA 2VJXA 1J59A 4NPLA 1BBT1 5IYYA 4FFFA 4XF4A 1LU2A 1Z7S2 3MIBA 1WCSA 1W6PB 4LO6B 4R9CA 3RYKA 3WNXA 4AFDA 3FZ3A 2W1UA 1TMF1 4YG0A 2PHUA 1T2XA 1YO8A 2SBAA 1W6MB 4GKYA 5A1LA 1VB4A 3H42B 4M4RA 2RS31 1B09A 3DEMA 2TBVA 1QU0A 3CQOA 1OPMA 1TNRA 2QQUA 2HWB2 4LOSA 1PK6C 2VL4A 2ZPXA 2QDNA 2Q8OA 1XU1A 4LJHA 4XUPA 3ENRA 2GNTA 4XF9A 3CU7A 2DCKA 3WW4A 2Y34A 2P3JA 1N1SA 2CDOA 2X53S 4AQ2A 3AVRA 4D7SA 3WVJA 3NKTA 1L7RA 3TBDA 2NMOA 2YGMA 1VBA2 5FRAA 1Q8SA 3NVCA 4QQOA 1LOAA 3DGTA 2A3XA 3R6SA 4Y33A 3WDTA 2BV4A 5FMCA 3S57A 1AZDA 3N7KA 5HBAA 2R063 2VMHA 1GQPA 4YFWA 3K3OA 3LDKA 4M0HA 2C0ZA 3NRUA 3K75B 5G04L 3VZMA 2VNGA 4XURA 1NCQB 4DRRA 4Y5TA 2FMDA 4E2GA 2HWC3 4DB5A 4D69A 5CYYA 3USUB 2JE7A 3JQWA 1RL3A 3EMRA 1NCRA 1I9RA 2CV6A 1MPXA 1XNDA 5CKQA 4AQ6A 4Z07A 4J1WA 1W8HA 3AZXA 4COVA 1W0OA 4E27A 4NO4A 1BHGA 1SACA 3DPRA 1AR61 2ENRA 1W03A 3N7MA 4TLFA 5FP4A 1UZZA 4PLOA 1Q8QA 1AR71 3AKQA 2YBSA 4IV1A 2WN3A 5ACA3 2BVVA 5IW0A 2WINB 1HB1A 4LBJA 2VUAA 4OI2A 4Q26A 2CDPA 2ARXA 4CZSA 4TZDA 4TYSA 1KJRA 1EUUA 4M01A 1GOGA 1KQRA 1W39A 2C26A 1UY3A 4LKFA 1SLTA 1ZBA1 2WABA 5JOWA 2PHXA 1PO12 4UFLA 1LOEA 1YQ8A 4ZY9A 1E57A 2A3YA 2D6PA 2HBUA 2VGDA 4GKXA 3N9PA 2DU1A 4Q0SA 4X8PA 3B01A 3FHQA 3HVDA 5T5LA 1DDLA 4K8RB 1NX9A 3VKLA 4GMP1 4IE4A 1RUD3 3R4DB 4XZPA 1UY1A 3J8F2 5IVYA 4HOOA 2B45X 3MGUA 1JHNA 4J6GA 1L7LA 5T3NA 5JSRA 4AAXA 4FAGA 4QDSA 5C3RA 1X9PA 1VRH1 4PIXA 4Q4X2 2FDJA 5C3OA 4YVWC 1EUTA 4TTGA 2JDMA 1O4YA 4L8QA 5FYBA 2Z5WA 1AHSA 3SKVA 4UXAA 2V5YA 4BXSV 1CAUB 3B9CA 4ZU4A 2OKXA 3J9SA 3RWKX 1HV0A 3KV9A 3ZO0B 1UIJA 4Q4V2 4XJZA 4PIZA 1SLIA 4CPBA 2QE3A 1ASJ2 3NAPC 3M4FA 3OBZA 2XMLA 4N53A 1VBE1 4YZ3A 1QNWA 1Y3TA 4ZZ8A 2O1QA 5I8TA 3CJIC 3KQ4B 1WW7A 5F7UA 1SFPA 2W0XA 2EXJA 3NL1A 2WSVA 5FXVA 4Z92B 1UNBA 1PHMA 2F6BA 1LGCA 1YFYA 5IK7A 5GJ6A 4UF0B 4LNVA 2CAVA 2QQPA 1RUE2 3GALA 3ZSKA 1BEV3 1VP6A 4LLOA 1E5SA 1F4HA 2WLPA 1CD3G 2XB6C 4KWJA 3CF6E 2NMNA 4K7JA 4GMP0 2J1TA 4B7KA 1COV2 3MZHA 5KC5A 5CU1A 4OFGA 1W8TA 3GZAA 2A6ZA 3I3DA 3VBFC 2ZGUA 3ZYRA 4ARYA 1LAJA 3WR0A 5K9YA 4QQHA 4XQWA 2GN7A 2OS2A 1MVQA 1VMHA 3V0AA 4LBLA 2RDNA 2VBBA 2VW1A 3M3EA 3GGLA 4H14A 4X8NA 3ZSMA 3LSEA 2RV9A 3BVCA 4HK9A 4EN9B 5B4XA 3VUOA 4D94A 5DZEA 4YZ4A 1NT0A 2XJSA 1S0GA 2JWPA 3HT1A 3MPBA 2Y0IA 4DY3A 3H7JA 1SLAA 3INAA 4FPEA 4RQPB 3BTAA 2WNVC 4U2AA 5DUVA 4DO0A 2TUNA 1YI9A 2WFF3 4XBQA 1FPN1 2HWF3 3OSDA 3PTYA 4UBGA 1B35C 3AFKA 3JD71 5FPVA 2ZCWA 3ZXDA 4C91A 3J7LA 3KGLA 2DCTA 4YRDA 1T6BX 1YLLA 5A7SA 1EPZA 2EIBA 3ZFGB 3ZYFA 3MBWA 1CIWA 2JICA 3RVHA 2P3KA 1OUSA 1BKZA 4LBQA 2GU9A 1H1MA 4BA6A 5A3OA 1WBFA 4N7IA 3O1MA 5FO9B 3O1UA 3I3EA 5DZFA 1PX4A 4FOQA 1XSRA 4SBVA 3D5OA 4D6QA 3O1OA 1ODNA 1DFQA 2ZHLA 1S1AA 4GULA 5CFDC 5FLJA 2YU2A 3HJRA 3MW4A 2QZ3A 2UYBA 1JHJA 1WCKA 3ES1A 4HVRA 1MZ5A 3O1SA 4H7LA 4CCJA 3C7OA 5C3SA 3LIGA 2Z79A 5C3PA 1IQAA 3RMXA 1KDMA 1ZZ9A 1XRUA 4AVAA 2YU1A 5E6HA 3OB8A 4O7XA 4Q4Y1 4DEVA 1PGL2 4JGYB 4E4ZA 1OLMA 2Z2SB 4QGLA 1AR83 4QKFA 2VCMA 4Y4RA 1XYPA 1CONA 4D0QA 2YMZA 1GNYA 4CU6A 4XEZA 1U0AA 4YZ5A 3UL2A 1RUF3 2JECA 3VD5A 4BQXA 1GQGA 3OD0A 5F6LB 5FIXA 1Z78A 4R52A 1XYNA 1KFUL 1W9SA 1WW6A 3KT1A 1IPJA 1OKQA 4N8MA 4K9SA 2JE9A 4NN0A 3TRSB 1NA1B 3FE5A 4IEOA 4YVSC 1RUH1 2F4PA 4XDPA 4CDXA 4QPWA 4GB31 4MXVA 4BK4A 3F95A 3ABZA 4HK8A 4RSUA 5SV8A 1W9YA 4JDNA 5LEJA 3VLBB 4XF3A 4PLMA 4M00A 2Q8CA 4WM8C 4NHMA 2E6VA 4WVMA 1IOAA 5K0UC 2E9QA 1QJFA 2HWE2 3USSA 5JZGC 3RYPA 1QHDA 3VDDC 3VV1A 2YBKA 3MUY1 1RUG3 1ZRRA 2W1QA 4TLGA 1N47A 3QCWA 3VBHC 3SC7X 4WM7C 1G9DA 3UGFA 2D97A 3K51A 4CDWB 2H0BA 2FDIA 4NAMA 5FY5A 5D8AC 5BNPA 1LB2A 5JVVA 5A1FA 3RWNA 3RZMA 3I2FA 5F3IA 4TN7A 2CSGA 3Q8BA 2Y64A 4S2HA 4H55A 1L7QA 1FMD2 2XVKA 1DHKB 1ACCA 3VDBA 2RMU1 1NQJA 4XMIA 4CEWB 1OBNA 1XU2A 3DUIA 5EFUA 5CFCB 2GP5A 4NHYA 1A34A 2B9VA 2D98A 3DYPA 3MF6A 4Y1ZA 1MZ6A 2OQ6A 3OBTA 4ASLA 2ZS6B 4HN1A 4CRQA 1UQXA 3FLTA 4OHZA 1W3VA 1H8TC 4AVVA 4DRVA 1CZSA 3O0WA 4AGRA 2Y33A 3I59A 1PK6A 2VMEA 3VBOA 2VZUA 2KXLA 2WN2A 4KI5M 1O4ZA 1BMV1 5ABJA 1C3HA 2IVJA 2Y60A 4RN5A 4P9IA 4NROA 2DFCA 4IDZA 5A3PA 1VIWB 5A3NA 1GMMA 2QQVA 4ES8A 1C57A 2DDUA 2VXJA 3WY6A 3CO2A 4GH4C 2VULA 1UW8A 2DCZA 3B94A 3LQCA 4LE3A 5FJKA 2LROA 3AMNA 3RGBA 1HB3A 5L7OC 2HWC2 3MEPA 4NHXA 2Y0OA 3WP4A 3UKTA 2VZPA 4D6SA 2VTFA 2VOTA 3WUCA 3RZLA 2D40A 1VBD3 3ZN4A 2UY9A 2MNGA 3ZFEB 3IMMA 5EYYA 4CYDA 2V4AA 2BBAA 2EIDA 5EIYB 2CU5A 4FOYA 1AJKA 4NRMA 2ZJCA 1JYCA 4KGQA 2WLQA 1PO21 3WF4A 4MH0E 1HRI1 1HB4A 2NN8A 5H9QA 1ZREA 2B5HA 3LZZA 3R05A 2JG9B 5ACA2 1AXKA 1NAEA 5DUUA 3H8OA 4PF1A 3THPA 4TWTA 2ZX3A 1CAWB 3UGGA 1ZVFA 2ZGLA 5HXMA 2HJIA 3GHNA 1PGSA 4XUQA 1R093 4M3CA 1XQNA 2W39A 1KDKA 1RUJ1 1V6LA 1ZBE1 4F7ZA 1Q8PA 2K9ZA 3NJVA 4FPCA 5LA9A 4FPHA 1E5RA 5EHDA 2BOJA 4LHLA 4CCOA 1VR3A 4YW1A 1OH4A 5FXZA 4KQ7A 2AR6A 5CAZA 3U0ZA 5FPXA 4FP3A 2JIGA 4OZXA 2BW8A 2R30A 4OMDA 4HKLA 1Q3EA 2OA2A 5BPXA 2W3JA 1GNZA 3NNFA 4YG6A 1SDWA 3ZOIA 2QQKA 1OQ1A 5FPLA 1OD3A 4EROA 1AL21 3NNGA 5FYIA 3B00A 4OUEA 1F4AA 3LCPA 4I30A 4YVWA 2L9LA 3VD7A 4W8JA 1NLQA 3TN91 5DG1A 5LBBA 4I0AA 4AXOA 2ZAHA 3V0BA 2FD8A 2C1FA 1LENA 3ZXKA 1OPOA 2DYCA 1W6QA 2PMWB 4BQYA 3O1PA 4RS5A 1HJGA 1ND2A 2GH2A 2PXJA 2RDRA 4XACA 3TWIA 2NYYA 3V65A 2RS12 3POFA 2J1RA 3ES4A 3I97A 1LTEA 5DAVA 3PUSA 5BXXA 3ZYPA 5LB6A 4QXKA 4DFSA 1ZRDA 1WCQA 2VCCA 3KGZA 2DURA 1KRIA 1BEV2 3CJIA 1DU3D 4NWVA 4IE5A 2ZGPA 2YC4A 1DYKA 5L73A 3WG4A 4Y20B 5AFBA 1K5MC 1YRZA 1SZBA 4JCKA 3I2IA 2TNFA 4UFKA 3OPZA 1ZA4A 2VVDA 3LA7A 5FAXA 3BB6A 4MLOA 2BDRA 2D6KA 1Z7S3 4YWAA 3GZEA 4CPBD 3U07A 3N9OA 1X7NA 4TSVA 3WEZA 2I74A 2R16A 5IUQA 5FOBB 4LK6A 1TME1 5KHHA 1PMIA 4IEZA 4CUGA 3IZOA 5I0DA 1I5ZA 4QU2A 4WV8A 1I6XA 4Q1PA 1DP0A 2HWB3 5FZBA 4DS0A 1NXMA 2JDZA 1RMU1 2X09A 1A8MA 1PVC1 1XSQA 5FV3A 5FZ4A 4BIOA 4D6RA 5B4NA 4E8CA 2EAAA 1VAKA 5BNQA 4CXWA 4CU7A 5C6CA 3H9AA 4EYUA 2QBXA 4R9DA 3SNMA 3FJSA 2GMMA 2HWF2 4BDVB 1OLRA 3PVNA 1HRV2 2UYAA 2VQ0A 2A7AA 4EV0A 1AYN1 5DAWA 4QXBA 2WNVA 1TZOA 1ST8A 1K45A 4EWAA 5FY9A 2XUMA 3SH3A 2WUHA 2CYFA 3BN6A 1C8M2 2JDNA 3N9QA 5A1AA 5FPZA 2XOMA 3X29B 1W9TA 2O8OA 1PZ9A 2GSYA 1C28A 2N7GA 4E4DX 1BZWA 2ILMA 3AC0A 2Q0AA 3QH7A 1EV13 1UKGA 1AYM2 2PHRA 3D4KA 2W46A 1EY2A 3DXTA 4YM1A 1W3XA 2C4XA 1V9U1 5DXDA 2XJVA 3R0RA 4LPLA 1AR82 4BQ2A 1MS9A 2CGNA 3LFMA 3LEMA 4AGGA 1OUXA 4YFZA 1W6NB 4ATFA 4XAEA 3FBMA 4CP1A 1T6GC 3AMPA 4JTNA 2VO5A 4NIIA 4Q0UA 4RQPC 4LBQD 1U5YA 1AXZA 2QVSB 1WLWA 2EXKA 5KHJA 1GNHA 4BPZA 4MYEA 4RD7A 2D3RA 1JZ4A 5A7WA 2BNMA 1PO13 1OQEA 2QQLA 2VMFA 1YIPA 2XVGA 4XTMA 5CVRA 3U11A 4CU8A 5EXOA 1KEXA 3A23A 2V73A 4AFMA 4XIOA 1QY4A 5FPBA 4DIQA 2DBNA 4XMAA 4N7UA 3UJOA 2CNAA 4GWIA 1EAH2 2XH6A 3J8F3 4WVZA 5DAPA 2QDRA 4LO7A 3A22A 1D0GA 1Y4WA 2ATFA 4BU2A 4NPMA 4E4SA 5JWPA 2DU0A 5GZCA 1G9BA 3ZSEA 1ZX5A 3LOIA 3HEIA 2HWD1 1UO9A 5A70A 3LDBA 4AI3A 2MPFA 2DF7A 3AP7A 4IEQA 5DZGA 4CE8A 3QBQA 3IIIA 1QWRA 2RM22 3RJRA 4WM8A 5J1XA 1ASJ1 4NR1A 1H4HA 5A7OA 5BUVA 1RXFA 2EALA 2W1WA 2ZBJA 1GYKA 3JBG3 4JGYC 2BYVE 3RG0A 3VDDA 4BWOA 5JZGA 1W28A 4Q4V3 1OI6A 1NZIA 2DUQA 2FMYA 1MEC1 3K4DA 3RYRA 3ZYIB 4A6SA 2PAEA 4V2WA 2RR13 2HKXA 2R1DA 3KT4A 4I02A 1EP0A 1R083 1XBFA 3H3ZA 2KD7A 5TSWA 3FX3A 4NJ4A 5D8AA 4MGSA 2R073 2WZ8A 1H0BA 3L2HA 4QD2A 3ZYJB 2P4EA 1FOD1 1PGW1 2K2SA 4QMAA 4OZOA 1SBDA 5T50A 1NA1C 2AREA 1YCIA 5FYCA 3SCFA 2DVBA 4XCAA 3T2QA 2AACA 4O61A 2GMPA 3Q8AA 4YW3A 3U78A 2ZEWA 5I0RA 2AENA 3CEWA 3BUCA 4CEYA 4BCUA 2E26A 2W2IA 5D2AA 1JOPA 5F5AA 3PIJA 4COZA 2PLV2 2DWRA 4GJYA 1O8PA 4AHZA 1QIQA 2RVAA 2WYSA 2JD9A 2BNOA 1COV3 4NRPA 3C7GA 3LPFA 3UKVA 4D3WA 3KHCA 4YG3A 4AOCA 2GALA 1AF9A 1LOFC 2CWSA 2VZSA 3BIWE 3I3MA 4S2GA 1RUI1 2E7QA 1UAIA 1VBD2 1N3QA 1LOBA 2JG8A 3POSA 4LBKA 1NY71 5FUNA 4L0PA 3EJKA 4RFRB 3RPQA 2GC0A 5JPMB 2QQWA 2ZXQA 5FZOA 4CEWC 2CAUA 2ZGSA 4AFCA 3PMSA 5FREA 2WO3A 4ZU5A 5FZLA 2P5BA 3WF1A 5KXDA 4IV3B 3AKRA 1PIV3 1JS9A 3K46A 2D44A 2A73B 3KV4A 3RQ0A 1UMIA 3C2UA 4JDMA 4MHRA 1R092 2YG0A 4I0WB 3ACFA 4KBZA 5FYHA 3N36A 1YI7A 4C1XA 4XF1A 2SLIA 2R6QA 2WZR2 3T2PA 1D2QA 4AAPA 3LA2A 4MX3A 4Q27A 4Y22A 4HPKB 3DECA 5L9BA 1R64A 2JDUA 1LGBA 3VDAA 1AVBA 3WX5A 4CVUA 3NJYA 2I07B 4F83A 3QH6A 3M70A 1PGL1 4NAOA 2Z4FA 1NE6A 1CZTA 1VBC2 1OHFA 2VC9A 3UT0A 1CVNA 2WA3A 5JAXA 3HNBM 4NHKA 4J25A 3T0DA 4XETA 3SCGA 3ZFEC 2OT7A 1TNFA 5FZ0A 5J09A 1GZTA 1N3PA 2ZHMA 4M3CF 1WD3A 3ZLIA 5C5TA 2PTMA 4P14A 3Q8FA 2GC2A 3USUA 4LXLA 3ZSJA 1C5IA 1G8WA 1AX0A 3EXUA 4P00B 5DABA 3I3QA 3LEGA 2JG9C 5FLIA 4MGYE 5BNOA 4PJYA 5LW9A 2FCUA 3WCRA 1ND3A 1CAVA 4S2FA 2H0VA 4QDRA 2EICA 1FAYA 4XUNA 3WG2A 2ES3A 2NQYA 2WS91 4N9IA 5C4WB 5JXGA 2H6CA 4JGZB 4CDUB 1OOPB 3ILFA 5A7QA 3MIGA 4C0BA 3KB5A 3LGRA 3THCA 3FBYA 3POWA 4LUMA 4CCEA 4HXCA 1W0PA 4A2UA 1HX6A 2NPIA 5H9PA 4AYUA 4ISRA 3WZ1A 1KFXL 5B2GB 5IFTA 5FZ8A 5LBCA 1UZWA 1YHFA 4Y1UA 5JI9A 3FFZA 4ZHNA 4L11A 4AWDA 4NUBA 4K21A 1DYOA 3SQOA 1DYPA 2QQMA 5IK5A 1BJQA 1PM7A 3WNMA 5FLHA 1JYNA 1SPPB 2Q30A 3OBRA 2X10A 2GC3A 4Q0PA 1O3QA 2WRAA 3FFQA 5A3UA 2LRPA 3H1YA 5LEKA 1Y9MA 1K5MA 2WO7A 3AMHA 3HMYA 4AEDA 4IW3A 2QQIA 4QPGA 4UFHA 5ANQA 3U37A 5L9VA 3TEWA 3WHTA 1H6YA 3ZM8A 1FMD3 2XDVA 4JZRA 4P9LA 4ARXA 5L36A 4YNIA 1MQTA 5LK7B 2OIIA 4N43B 1ZM1A 5IVVA 2QJVA 3CL1A 1V6IA 2UY8A 2VY0A 4Q2FA 1CAUA 1CGPA 4LOTA 4QB2A 1ZRCA 4SLIA 4QHOA 4GJZA 4JVAA 3W20A 3ZMOA 1RGSA 1PVXA 1J1TA 1D2SA 2R061 2VMIA 4Q1RA 1XNTA 5T5OA 3MPPG 2TEPA 4I3PA 4JKLA 4LHKA 2HWC1 2D3SA 5CEHA 3FUQA 3MF9A 1QJU1 3M3OA 5JOZA 4LQRA 4B1LA 3ZIWA 5FYUA 4QPIB 2W91A 4YW2A 2P2KA 1D7PM 2BGOA 4Q0VA 5FR3A 2BOIA 3T30A 2QNKA 4K40A 4Y5SA 1Y43B 4YLZA 3ZFFB 4ES9A 4UF0A 2HH9A 1CESA 1G86A 1VRBA 2FZ1A 1YIFA 1AR91 2KA3A 3I8TA 4MGIE 5APAA 5ACA1 5CISA 1WW5A 1EV12 4I3GA 3ROUA 3LEIA 3OOXA 2ZGKA 1SLCA 3VBSB 4FPOB 1S0DA 1UKRA 3AXDA 1IHMA 1TG7A 4XZUG 1GOFA 5FCCA 2ZGNA 2WNUB 5AVAA 3B3QE 1QEXA 2D93A 2XBO2 2ZGOA 5BNNB 1YQ5A 3AK0A 2D6NA 2W52A 3BCWA 2QFEA 3OGJA 4E8DA 1C5HA 1RC6A 2GN3A 3FC0A 3TEYA 3WD5A 3I49A 2ADEA 1J84A 1RUD1 1G7YA 2NLRA 4XFHA 4A45A 4QHZA 1CX4A 1HXS2 4EE2A 3NV3A 4XF0A 3AVSA 2YC2A 5G05L 4XQ4A 3E97A 1YQ2A 1G9CA 4URAA 2VBPA 1ULGA 3M3QA 3BPZA 5JXIA 2ET7A 3MLKA 2AEYA 1PM4A 3VKOA 3BKZA 4IESA 1QOOA 3VD4A 3H1MA 2B8MA 5CADA 5HCFA 4L9BA 3KSCA 4BQWA 4A4AA 3S5AA 3P3PA 1AR73 3DV8A 5E1RA 3UV9A 2QUOA 2E51A 3ITQA 3G7DA 2DV9A 4QKNA 1MS8A 5IVCA 2A6XA 4YZ2A 1YJKA 3JBG2 4KMQA 3URFA 1K3IA 1GZWA 3ZYBA 2UWCA 1WA4A 2ADDA 3I2GA 3BU7A 3AKSA 4CCDA 1JH5A 1JN2P 2RR12 1JYIA 5F1RA 5JLVA 1R082 3PUHA 1JZ6A 3IDAA 1QDCA 4HVOA 2R072 4JGYA 2RS13 5FWJA 1F8VA 5IVBA 1AXYA 1C8NA 1CPNA 3ACIA 3DN7A 2W87A 1FT9A 2DVGA 2VVFA 3PNAA 4KNCA 4NIAA 2OPKA 4BE3A 2XJPA 1STMA 4Z2WA 3KMHA 5DUWA 1X33A 5KHKA 4RR3A 1JODA 4PDWA 5FZIA 4CP9A 2IXIA 4YM3A 4GD4A 3HT2A 3LD8A 4HSLA 3SEEA 4AI9A 3VBRB 1OA3A 4AZZA 2Q1FA 1ULPA 4CCKA 1SBFA 2WA4A 3WQBA 3H1WA 3APBA 3MLJA 2R32A 4QHBA 3OPWA 5FKBA 2DVDA 2WFF1 2F17A 2VZ3A 3OF1A 4V1PA 5C8WA 5LA0A 5EV7A 4AL9A 1VBB1 3EB7A 1APNA 2QQJA 2IC1A 1C4RA 1FNZA 2DTWA 3EHKA 4BQ1A 5C8CA 5I91A 1RJ7A 1VPHA 4HMZA 4MO3M 5EJ3A 5DUXA 3WNNA 1PIV2 2E7AA 2DUPA 3POEA 4IV1B 3FMGA 3E6CC 1HRV3 2X5IA 3D0SA 4E2SA 5F5IA 1AJOA 4QGMA 1WMEA 1REFA 1RVF2 2R042 3NV4A 4EZ4A 1Y9GA 3KVAA 1F31A 3C8XA 1XNKA 3CZJA 3HBZA 4P9XA 1NYWA 2MEV1 1NUKA 3VZLA 4RHV1 4R9BA 4XC9A 2XL7A 4B4PA 4BMBA 1C8M3 5I0TA 4RGGA 1UX6A 2JDKA 3UETA 3DYMA 5A6YA 1QDOA 5EYXA 1YJLA 2WO2A 2WT2A 4NE9A 3S7EA 1W6OA 2PHTA 1DGRN 2GMEA 1OA2A 1UYXA 2R0HA 5GZGA 1GUIA 1QQP2 5FZHA 1OQDA 4Q4W1 1IG0A 4W4ZA 5A6ZA 4RL7A 3BTXA 4Y1XA 1AYM3 3OD4A 5I0UA 2VQTA 1RUF1 1LJ7A 1GLHA 3VZOA 1UZ0A 3HBKA 1IS6A 3VHRA 1SBEA 2LW8A 4HBNA 1X9TA 4FXGB 1XNCA 4XCBA 3BIEA 1S0IA 1WLTA 1PMJX 2JE8A 2BPA2 1W9FA 4RYDA 1QOSA 5DDJ3 2VOWA 4MGZE 1MZFA 2V09A 1WW4A 1C1FA 4FT8A 5FZ3A 3ON7A 4D7YA 5A32A 1Q56A 2D3PA 4IV3C 3ZFEA 4HSJA 2XL9A 5T5JA 3WDWA 2VU9A 2ZACA 2HYXA 1FNYA 3FWEA 3IBMA 4P9GA 4N53B 5LBEA 4INDA 1UWWA 3POYA 4IEVA 4AFAA 4I2OA 2JG9A 4WBBA 1J58A 2P1BA 1G6NA 1UU6A 3CLPA 4IGOA 4KG0A 2OX0A 1EAH3 3WSOA 4C0HA 4LITA 1RUG1 5KHIA 5FY7A 1EYBA 2IXJA 1GZCA 4BZ4A 4XFBA 1R1A1 5LA2A 3MW2A 4Q4Y3 3GYDA 4XE9A 1O59A 4FI9A 1O3RA 2ZEZA 1RJ8A 4KU8A 4QB1A 4QQPA 5LZ6A 4YGEA 4BH9A 4KWKA 4XOGA 1WA6X 1O5LA 2RM23 1W2UA 4BQ4A 2WDBA 4QKDA 1Q5OA 1GR3A 4FQ4A 4JRLA 1XE7A 3J7NA 3WNKA 2W5FA 1IZ3A 4MZUA 3RZKA 3SKJE 3ZX7A 5CBLA 4DPNA 1D4M2 3V0AB 1OC1A 2Y6HA 3VKNA 1W8FA 5FKCA 1H1AA 2LALA 1X36A 4GB33 3CBNA 2WZPP 3PJQA 5F3GA 5GLVA 2KM2A 1M4WA 3ACLA 3JUUA 3NV2A 3PDQA 3PVOA 5C4WC 4JGZC 4CDUC 1OOPC 3WT3A 1UOBA 5M0TA 3ZKUA 2HYKA 4YW6A 2RS52 1V6MA 1UCXA 4IE0A 3U14A 1OMIA 3U4XA 5E89A 3DCQA 3F2ZA 2PLV3 5KBFA 3RMYA 1TMF2 4AI2A 1J1LA 4Q8KA 1A78A 5JSOA 3PVEA 1VBD1 4Y4YA 2RS32 1DQ4A 3UKNA 3WDUA 3DKWA 5GLTA 4QM9A 5H9SA 4G3YC 5FZ6A 4K3UA 5FFOC 4JDOA 4NPRA 2GNBA 4E2QA 1F2NA 2BJSA 3VHNA 4CDQB 3AYAA 3B5LB 1SG3A 4E4HA 1H4GA 2B4KA 2AYHA 4NIGA 1N3OA 3IWZA 1WBLA 4FPYA 1ZNPA 1BQPA 5KXEA 4FBFA 1MS3A 1DBNA 3E5UA 5FY0A 3AX4A 1GFF2 5GKAC 2K0GA 2BRTA 2P6HA 4N43C 1R091 4ZKTB 3HQRA 5JSPA 4P02B 1LR5A 3M7AA 3T08A 4CXYA 2P3YA 1HQWA 3K4AA 2I2SA 4MSVA 3IN9A 3VL8A 4FPGA 5ERLA 5KXCA 2C24A 5LRSA 2WWJA 1ENXA 3AJYA 3CMGA 4Y3OA 5FPAA 5FQ0A 3AM2A 4KBBA 4NIDA 2WC2A 1HJFA 3SH4A 2WZR3 1DGWA 3VBUB 3ZMNA 2WWUA 2ZMNA 1X8EA 3BODA 4EQVA 3OGGA 4QXCA 1RTVA 3VN4A 1ZZ7A 4ZS3A 5A3TA 5JOXA 4QPIC 4CDXB 3OGRA 4R8HA 4K1YA 1NCQC 3RJ2X 2A6WA 2YPJA 2OUHA 4MVTA 1VBC3 3AYDA 3ZFFC 1AR62 1ZA7A 3J7HA 4EZHA 1MS0A 1YFXA 1AR72 1OT5A 2OQ7A 1Z0HA 3FHIB 3POGA 4WVMB 1KXGA 4DUXA 1UMHA 1YXWA 2ZGMA 1OF3A 4LHNA 3I7DA 2YPDA 1ZBA2 2OVUA 4WZCA 2JDHA 3HOBA 1CN1A 4JKKA 5DAXA 4AGVA 3IDBB 1RUC3 1RUJ3 2C9AA 2WNUC 4HZFA 5A33A 3WXPA 3ZN6A 1ZBE3 4CXXA 5BNNC 5JXJA 1QOTA 4FAHA 2JEMA 1DG6A 5ANNA 5HPOA 1SCSA 1OURA 4DOUA 1WCUA 2J1AA 2VOXA 2JENA 5K8SA 3WF3A 5JUVA 1W6NA 3GDBA 1H6XA 3NAPA 3MUZ1 3ZR6A 1U12A 3KM5A 5HXVA 1JZ3A 4LBNA 1V6KA 3MFCA 2VM9A 1Z7S1 4M3CE 5J7MA 1WCDJ 1W05A 3PVBB 4P08A 3VBOB 1H2LA 4HVQA 5ABJB 1AL23 3NQHA 1G9AA 1UXZA 1ODMA 2UURA 2DCYA 3A21A 5L9RA 5C3QA 3N9NA 2XKOA 2HWB1 1ULFA 4CTEA 2WAOA 3TN93 4PIYA 4XXPA 2BEOA 2WSUA 5T5PA 2BBVA 4KGGA 1O4TA 4AI8A 1UOFA 4XVHA 1VBE2 1GBGA 3PU3A 3U10A 3UK9A 1V00A 3H7YA 4LE4A 4IUGA 3PLQA 4XXAA 2VCAA 3VBFA 2FDHA 2IXHA 1QNYA 2WKKA 1KS4A 1WMXA 3PUQA 4JQTA 3WNLA 1F9KA 1VBA1 2YC0A 1OH3A 4YM2A 2YB7A 1H1IA 1XOYA 3OPTA 3KQRA 3OUHA 5E8AA 4UWDA 4ZS2A 5EZWA 4FOWA 1RHI3 2Y6FA 2AZ5A 3MDPA 3D0JA 2WAAA 1KGYA 1IS3A 4EJRA 1DQ2A 5FYSA 1UF2C 1NG0A 4F8AA 1BVP1 1PNGA 1QJZA 1S0EA 1CPMA 1S55A 5T52A 3TEZA 3FUOA 2E32A 4M3CB 2D43A 1B35A 1TME3 1EV11 1US2A 1D0HA 2VQUA 1CJDA 5LRRA 2JKBA 1H2MA 1JUIA 3SISA 5KR7A 3G6JB 3VBRC 3A7QA 1XNAA 1Q8VA 1PVC3 2GC1A 5HV4A 1OF4A 1UXXX 2PHLA 1F35A 2YDEA 5F5QA 4BK5A 2QQNA 2JDAA 3D82A 3ZXLA 3AKTA 1QXRA 4DEQA 3E1F1 2PN5A 1DQ1A 1UYPA 4S2DA 3UYJA 5CFDA 2RDQA 1OA4A 2CL2A 2A75A 1GQHA 1LCLA 4YW7A 5JR2A 1O3TA 4CCLA 3I54A 3C7FA 4LKEA 4URTA 1JZ8A 1PO11 1QXJA 5DDJ2 5HI0A 2PHWA 4MGQA 3WP3A 2XBO3 3MIEA 3BI3A 2G9GA 2WNEA 1PMHX 1LHOA 4DQAA 2BERA 3SH5A 1LHVA 4NRQA 1LHUA 4ZU7A 1HQNA 5JIAA 4IV1C 3GJBA 1GU3A 4CUBA 3J8F1 3HNMA 5FZGA 5IK8A 1XNBA 4QX0A 2EA7A 3BPSA 2ARAA 1J83A 1HXS3 2EF6A 3ZSLA 4B4QA 4A7ZA 1W6QB 1VE0A 4Q4X1 3ZFGC 4FSJA 4RS5B 2IFRA 1ND2B 2JXAA 4IETA 1YFUA 2XHKA 1OXCA 3RSJA 4A42A 5KWRA 2Q4SA 2ET1A 4LUKA 1GP5A 1UY4A 5C9AB 4YVSA 2E33A 4Q4Y2 2B39A 3GBFA 2J22A 2VW0A 3N3HA 3H0OA 2HEWF 3JBG1 1KITA 2DVAA 1O8SA 4Q4V1 5LASA 4AVBA 2R0FA 4I0BA 1JW6A 4W6WA 3WNOA 1S0FA 4C90A 4IE7A 4K20A 5C33A 5K0UA 1R081 3T4VA 4H2AA 4Q8LA 3AL6A 2R071 3A0NA 2YXSA 2ZMKA 3NMBA 5JCTA 3VBHA 4WM7A 4AK3A 1DGWX 4AW7A 4PQQA 2ZZJA 4COUA 2ZHKA 1ZZ6A 4CP2A 3EYPA 1PX3A 1YNAA 3AP4A 3B7MA 1LECA 1HDKA 1UY0A 4GB32 4UFIA 4UBHA 3S0MA 1V6OA 2ETEA 3THTA 1RUE1 1O3SA 2W47A 1VMFA 3HIFA 3PJYA 1R1ZA 1S4CA 1N1YA 1BLZA 2BU9A 2BZDA 3MIHA 3MHZA 1RUOA 3W58A 4RGAA 1F5FA 3WW2A 1DZRA 1LEDA 1W90A 2XJTA 4GWNA 4A3ZA 1QKQA 5FO7B 2YYOA 3JCIA 3RI9A 1COV1 4MXWA 2Y8KA 3NJXA 3TAYA 1QJY3 5IVFA 2C5DA 2UWBA 2F4LA 2PA7A 2AUYA 2CTVA 1H8TA 3LDRA 3N4MA 4QX7A 3IT8A 4WZFA 3OJBA 5FBJA 4JGZA 1UZYA 1OOPA 3TNPB 3WLUA 2WNVB 3UNPA 4OI0A 2P3IA 2GZWA 2W1SA 4YYOA 1KS5A 3M3CA 1JMUB 3VD9A 2BWAA 2IXKA 2PELA 4PI2A 4AVCA 2RMU2 3MI8A 4AFBA 3IAQA 4CDWC 3OY8A 3N35A 5FMBA 3LF7A 1DIWA 3CJXA 2ZMLA 4GH4A 4JHZA 2ZTNA 3ORJA 4R4XA 4UT5A 5EP9A 3V64A 3IPVA 2G1MA 3S7IA 5L7OA 1BXHA 3MO4A 3NW4A 2XGXA 4PHZA 4BQ3A 5FYZA 5I0SA 3O0VA 4GALA 1W6PA 5CFCC 1SPPA 4QX1A 1YWKA 1BMV2 3WQ1A 3D6EA 1POV3 1W6MA 2OUJA 1XPWA 3I2OA 2RJ2A 4DXSA 1VB2A 2GNMA 4HANA 4MGKE 2FQPA 1XB9A 3QD6A 4LT5A 3T2TA 5SV5A 5FTTC 5FPUA 2E31A 2R043 1RVF3 5CZKA 4N43A 3SLIA 3POBA 1IG3A 4XUOA 4O9GA 3LPGA 4DXRA 2LM3A 2VE1A 2VTXJ 5FXWA 5GLUA 5AFEA 2Q8EA 5A3LA 1N1TA 1RYYA 4QKBA 3WG1A 3FHAA 4XFFA 1W99A 4GIQA 2ZX1A 5J3UA 1GKBA 2Y6JA 3NNLA 3VZJA 5FY8A 1QQP3 2GH8A 2P6CA 4EWEA 2NZ9A 1PO22 5DMYA 2XJQA 3ETPA 5FYYA 4CDQC 5FZDA 4BXFA 4FTBA 2WQ4A 1CAXB 4XBNA 4PQ9A 1NCQA 4FOVA 5FMOL 4IE6A 1ZZBA 3W21A 2G19A 3DKQA 3Q9OA 4GWJA 4ZXEA 2AGSA 1RUC2 1RUJ2 2WFPA 3GF6A 1ZBE2 3IKWA 1HKDA 5CKMA 5FZMA 3GJAA 1LESA 5IATA 4P5YA 1JBCA 2YHJA 5FYTA 4QU1A 2VG9A 5FZFA 5F9TA 1K42A 2HBTA 2E63A 3OYWB 1OVPA 2ERFA 4FFHA 2AC1A 5FOJB 2DBIA 3D8CA 3O0XA 4XAAA 4QPYA 4HLTA 3AZVA 3N7LA 1CR7A 1QJX3 2HWE1 2ZAAA 1REEA 4Y24A 2WNUA 3TEXA 1Q8OA 4XFAA 3VBUC 5BNNA 3T2OA 5F3EA 1JOBA 3ACGA 4L92A 1LGNA 4KL1A 2EXHA 1ENRA 1UX7A 4LULA 1UZVA 1AL22 1SLLA 4CDXC 1W04A 4CSWA 1JYXA 4XJUA 1JI6A 4CEYB 2YFZA 2Q1MA 4HFSA 3S30A 2FCTA 5FZCA 5GM0A 3VB9A 1FMD1 2VR4A 5F2WA 1KJLA 5FP3A 5FK7A 3TN92 2WBKA 3HQUA 3ZXJA 5FZ7A 4ZPIA 3AYCA 5F3CA 2WO1A 1POQA 1I5PA 5CG9A 5FZKA 3WINE 4BLJA 4W50A 5F2SA 1JTZX 3B93A 4H7MA 5IVJA 2J7MA 2WS93 3HN3A 2Y26A 1TEIA 2VOVA 2ZGQA 1D4M3 1WMDA 3POJA 2JG8B 5FZEA 2IFWA 5FWEA 4OI1A 5EWSA 2R7EB 3Q8EA 3O7OA 3AB0A 3K4ZA 5LK5A 5FMDA 5J36A 4Z82A 1IGOA 3RZGA 1ULEA 5FZOB 1AX2A 2IZWA 1MS1A 1RHI2 1JUHA 2CHHA 4NIHA 4OLLA 1GOHA 1LKNA 1JZ5A 3AZWA 4JC1A 1OFNA 5F6KA 2XR4A 4IEPA 1S2BA 2RS53 4META 4Y26A 3KV5A 4HL0A 3BTZA 2YV8A 3PMEA 1BBT3 2VD7A 1NXD1 4PI0A 5CA6A 2VPVA 2HEVF 3C7HA 2DUOA 2Y6LA 1JU3A 1TMF3 2EIEA 1GWMA 2ZZQA 3VBOC 4MOAA 4COYA 4IQPA 2ARBA 5ABJC 1TME2 3A0KA 4XUTA 2RS33 2IXCA 3H3UA 1QGLA 3J7MA 4OULA 4GQ7A 4Y22B 3BU0A 4FXKB 2IWGB 1S2EA 2JIJA 1RMU2 1YYNA 1UYZA 3UESA 2WWSA 1PVC2 1XJAA 1W0NA 2PFWA 1W06A 1LHNA 5I8YA 1SEFA 4Z2AA 3LB9A 4LKSA 2W68A 1IS5A 4AEJA 1OLQA 2JDPA 2Y38A 5EPAA 3KVBA 3KLSA 3JB4C 3K3NA 5FMOS 1O5UA 3VBRA 1Y7BA 4G9SB 4ZXKA 4EN6B 1I3HA 2QCSB 2MHFA 3L2YA 2WR9A 4XHXA 4COWA 1AYN2 1PNFA 2FHRA 3RRDA 5LWBA 1S2KA 1JZ2A 3V56A 1QJU3 4GA9A 3VDCA 1RITA 1PZ8A 3NJZA 3MV11 1BK0A 2ZX4A 3IB3A 4AE2A 5BNOB 3ASIA 3AZYA 1ND3B 1CAVB 3R4SA 3TOJA 5JIUA 2X05A 1HV1A 4ISQA 4RQPA 3JB8A 4LKDA 1SFNA 3ZN5A 3BOPA 4ATEA 1AR93 2R1BA 2WNOA 4CUCA 2O14A 3SEPA 3OGVA 4PBOA 5FO8B 4FTEA 2KR2A 1W8OA 1H2NA 1Y9QA 2CY6A 4I01A 2PAMA 1V9U2 3FLPA 3ZFGA 1AR63 5LA1A 2XLAA 3T1LA 4FQZA 2OPWA 4LA3A 1ULOA 3VKMA 4HN0A 4IEUA 4FFIA 4YSFA 1ZRIA 5F8PA 1D4VB 4G4FA 3ZYHA 1IKQA 5FJHA 4QQLA 1GWKA 1ZBA3 4Y1VA 4QX2A 5GZEA 2RS11 2YZ4A 2ZABA 4PCRA 1K5MB 2ZEYA 4AEDB 4QPGB 3CKHA 5CB7A 4C8DA 5DN2A 1YUDA 4XIKA 4RA0A 4GMP3 2QTWB 4IERA 1MQTB 5FXXA 2XUEA 1BEV1 1F5JA 1RUNA 2WYFA 4YW4A 4YGBA 3I4IA 1XE0A 3JXSA 4AHWA 1JZ7A 1VRH3 3ME2A 4QM8A 5K7PA 2WQ8A 2HWD2 5FY1A 4RS5C 4OI4A 1ND2C 1MS4A 4MUVA 2Z42A 3E6DA 1QJY2 3SXWA 4L97A 2I45A 5E88A 3POIA 1AL0G 3WP5A 3HPNA 3ZDSA 1DCSA 1NA1A 1O7FA 5C9AC 2VZTA 5FUPA 4FO9A 2EXIA 3HAGA 4XFGA 4AEKA 2IVIB 3M2MA 3KF3A 2XLGA 1MEC2 4QAWA 5EJ1B 4LO4B 4DXTA 2A3WA 1VBE3 5LCWL 5JMOA 2YROA 1GZ9A 1NCRB 2HWF1 1FOD2 1PGW2 5GZDA 4PF5A 1LOFA 1HRV1 2BTVC 3ECQA 4XYXA 1S0BA 2BGPA 4CDWA 4XW3A 2J1VA 3ST7A 1IPKA 2R49A 3CHXA 3DPRB 3MICA 1MS5A 1GP6A 4XDQA 1FATA 1YFWA 3M1HA 5JOYA 1HIXA 2J42A 1GANA 1C8M1 3CZUA 4CEWA 1HN1A 5CNAA 4AHYA 2VUDA 3VGIA 5CFCA 1X50A 3LFIA 2VBDA 3KT7A 1I1EA 2Y6GA 3EQEA 4PBPA 5C70A 1LNSA 4BLIA 2ZA9A 3U1XA 2VAUA 1RUI2 2B9UA 1AYM1 1OVSA 5KC6A 1TE1B 3P6BA 3BGAA 4P9YA 1C1LA 1NY72 1W2NA 3T3YA 2DFBA 4DNYA 1AR81 1JU4A 4HKOA 4PT6A 1VBB3 1VAVA 2ID4A 4BB3A 1X82A 3LE0A 4MGTA 3PUAA 1NLSA 5DDJ1 2JJ6A 5A3MA 4Z8BA 5DG2A 1FPN3 4Q29A 2VOKA 4QB6A 3ZXGA 3JD73 3ZVXA 1IPSA 2YFUA 2P34A 4M4PA 1HW5A 3ACHA 3D3AA 1WKYA 4AF9A 4CDQA 2VQAA 4HT1T 3KV6A 2PHFA 4XABA 4OUMA 3RZHA 2MEV3 2OZJA 4JQRA 1GZWB 2G9ZA 4RHV3 4MG2A 2VZRA 3H8XA 1EAH1 4MV2A 2AEZA 2UU8A 3PHMA 4QWNA 3MYXA 5J96B 4EWDA 3MV01 5GALA 1XE8A 3IMNA 1J3RA 1GP4A 1CIYA 1QJX2 4Q0QA 2J1UA 2NM1A 5A7NA 3T0BA 4AQTA 1CAWA 4Q4W3 3MIDA 1Q43A 5IK4A 5FZ1A 3HR9A 2BNNA 1LEMA 2RM21 5A80A 4K1ZA 5CKNA 1QH6A 2YUEA 4LBOA 3OEAA 4P5HA 1NLRA 1F15A 2VZOA 5F5CA 4DY5A 2VXRA 4UFJA 1IS4A 4RR3B 3VBUA 3N9MA 4PDWB 3ELNA 1UD1A 1XXNA 3BYWA 3OTFA 3M8LA 4CP9B 1V6JA 3GCWA 5C5UA 2W95A 4JX0A 3PUIA 1UIKA 1V70A 5C71A 2PYTA 3PURA 4BYYA 2JX9A 3SCHA 3CIHA 2XXZA 2WS92 5E16A 5DPNA 3ZDVA 2ZX2A 1OLME 1RUH3 3NSTA 4DINB 1J3QA 1NE4A 1P8JA 5BY5A 4XILA 4UI9L 4O65A 1SCRA 4YPJA 3HWJA 4AQSA 2RHPA 1SHWB 3AFGA 2VCBA 4JV4A 5GZFA 4OQ8A 4QX3A 2PLV1 5LATA 4KU7A 1R1A3 5FZAA 3THDA 3WHUA 4BM8A 4QXHA 2WIIB 3P1IA 4X6RB 5C8CB 5HV0A 1CWPA 3I2DA 1H2KA 3KCYA 5J37A 3OGSA 1VMJA 1BBT2 2D6OX 2X5IB 2ZKNA 4JHTA 4YGCA 5FP8A 5FYMA 1O91A 4D8MA 3W5MA 1V0AA 3ZYGA 4KWLA 3FN9A 4LBQB 4AVSA 2FDGA 4BHPA 4CEYC 4JAAA 3H50A 2VVEA 3OUIA 1DLLA 2RMU3 3T0AA 3KD4A 3O12A 1LODA 2GNDA 2A6YA 2RJKA
chains in the Genus database with same CATH topology
3JZVA 1RIRA 4Y20A 4XJ9A 1W6OB 3WP6A 2FBEA 4UW3A 1DF0A 4EN7B 1WLCA 4LO8A 3HQXA 4ORFA 3E5XA 4AVTA 1REDA 1HLCA 2R062 1CJPA 2JG8C 2PAKA 1QXPA 3CNAA 1ALYA 2XPJA 4QX5A 4A3XA 3AYEA 2WZR1 3HN1A 3GZUC 1ENQA 1M06G 3QACA 1QJU2 2DVFA 1A8DA 3LAGA 5AC93 5A32B 2GAUA 1DGRA 1H8VA 4FP2A 4FPFA 3NKGA 3AP6A 2ZGRA 1JXNA 4P9WA 3WW1A 1ZZCA 1WMFA 4GWMA 3HD8B 1VBC1 3GZTB 5JMCA 3AJZA 2YY1A 1AR92 4I09A 4AI1A 2BGCA 1QH7A 3E6BA 4H3WA 4WVVA 1DQ0A 1BK1A 1AX1A 3AMQA 4CP0A 1PO23 3T1MA 3RZZA 1HRI3 3KZ4C 3KCCA 1G9FA 4IEXA 1RUC1 1GSLA 5I93A 1OFSA 2WT1A 3VBSC 3AP9A 1UN1A 1NQDA 3FLRA 1RUD2 2RJLA 5BNPB 2BWCA 3UJQA 4B3NA 3EBRA 4FPLA 4XJWA 4B8EA 4JTOA 3MLLA 1H30A 1BCXA 2DCJA 2Z69A 4KG8A 1ULDA 5BNOC 3J4UH 2LTNA 1ND3C 4N90A 4DMIA 1VRH2 1VLNA 2H6BA 3RDIA 3AZZA 5HCBA 3I59B 4XPVA 5D1IA 1PK6B 2OYZA 4N9HA 1J3PA 4AEMA 2PHDA 2Q1ZB 4B4RA 3DL3A 1SMVA 1FV2A 3WDYA 1UMZA 4J1XA 2XJUA 2XWJB 4ITCA 2BQPA 2CWMA 3WDXA 4NOTA 4ONUA 1LOCA 4B7EA 2E7TA 1FI2A 3VHPA 4IEYA 3W59A 5C9AA 3MFAA 4A7YA 5KHGA 4IEWA 1RHI1 1S0JA 3ZXFA 2W08A 2RE9A 1UPSA 3ETQA 3WOGA 4YW5A 1U5IA 3VKFC 5CG8A 4QGNA 4AEDC 4QPGC 3W9AA 4X6QB 4K8FA 1CQ9A 4QQ2A 4LR4A 2UWAA 3RNSA 3H8UA 1MQTC 1WUVA 2ZKLA 3MIFA 4FVVA 4XJAA 3TNQA 3L9JT 4AG4A 2D5HA 3AKPA 4OHXA 2G9FA 4E9KA 2Q5TA 5FQ0B 3KS7A 3SMHA 4UW5A 2JD4A 1U5XA 3R4UA 1GICA 5L19A 2XVLA 5T55A 2WFF2 1RMU3 4FCAA 4UW6A 4Z1VA 1BYHA 1VBB2 4LEJA 4NHLA 3BALA 3EO6A 1VBA3 2O8QA 2XBO1 2XG3A 1SLBA 1VJ2A 1FPN2 3ZPYA 3IDEA 1NCRC 3LWCA 3JD72 4LO5B 4BIFA 4IL7A 4YGDA 1HXS1 1AYN3 1UL9A 1WGPA 3GBWA 4YZ1A 3DPRC 4YVWB 3TYJA 1DQ5A 5KXBA 2MEV2 4FPJA 4RHV2 3V0BB 3LKJA 2P37A 4XBLA 4C1WA 2D6MA 3ZN6B 5A33B 4LA2A 1QF3A 2EAKA 4AHXA 1RINA 5T54A 5JDBA 1IKPA 2XLFA 2VH9A 4XHBA 3GBGA 3N7JA 4IV3A 3VL9A 2QKDA 5J98B 5JI7A 4Q4W2 4W6XA 2DTYA 3NAPB 1RUF2 1NZCA 2FZ2A 3ILRA 4PLNA 1V9U3 1MZEA 3CJIB 2A5ZA 3GHMA 4M0NA 4BMEA 4HPKA 2RR11 2BFUL 1WD4A 2WL1A 2XJRA 4BOWA 1UU5A 2PQQA 1LU1A 1L3JA 3NWKA 5JPNB 1ZZ8A 4D7TA 1RUH2 1LHWA 1ULCA 4Q4X3 2QZ2A 2VECA 3NO8A 5CIRA 4XQDA 2B46X 3ZIXA 1CAXA 3K48A 1RUG2 3VBFB 1QJY1 4NWWA 1TQ5A 5GLZA 1OD5A 4KH9A 3WQ7A 1R1A2 2A6VA 2E53A 4N53C 4R4ZA 2HWD3 2XWBB 3IIAA 3ZXAC 5IT6A 5FBZA 1ZYBA 2HEYF 1NOVA 1QMJA 1H9WA 3LSDA 1ASJ3 2CGOA 3OYWA 1DZTA 1UPIA 1SFYA 5C4WA 4CDUA 1ZRFA 4OHVA 5H9RA 2CGPA 1MVEA 3ILNA 5BYNA 4ASMB 2ZX0A 2O0OA 1B35B 1MEC3 4RR3C 4PDWC 1LRHA 2A71A 2VW2A 2OW4A 4OHWA 1FV3A 4LTAA 3M3IA 4QT6A 2X29A 3JQXA 4RFT0 1POV1 1RUE3 3S6PA 2VUJA 1FOD3 1PIV1 2D6LX 1N1VA 2BUKA 5GM0A 3A4UA 1H9PA 1AUYA 3WUDA 4A7KA 2R041 1RVF1 5CFDB 4W6YA 4Y5Z0 3B9IA 4P9JA 1DQ6A 5AVPA 1MR5A 1HQLA 1V6NA 4O9EA 2VNRA 2WQZC 2XKPA 5AC92 2WT0A 3VZNA 5C8CC 2D7FA 3DF0A 3SHRA 3QLQA 4Y1YA 3E5QA 3VHOA 5HCAA 3AP5A 2X5IC 1QQP1 3WDVA 1GV9A 3LOBA 3ALQA 1RUI3 3B02A 1UU4A 2AH2A 1RB8G 1FXZA 4JRAA 4HETA 1DZQA 3AXEA 5BV6A 4XJ8A 3RI8A 3IDCB 1LULA 2A70A 2B42B 3ATGA 4K6BA 3IM0A 4LBMA 1HRI2 3LA3A 4FPKA 2X8KA 4OUSA 4YVSB 3WQ0A 3ZXEA 2BFUS 4QPIA 1ENSA 4EN8B 4DXZA 1EPWA 3TB0A 1PZ7A 3B69A 1FX5A 4UW4A 2ZHNA 4YM0A 3ZFFA 4WM8B 3OCPA 4DZGA 1ONAA 2WJSA 1LOGA 3C3VA 3NV1A 5K0UB 1POV0 5JZGB 3VDDB 1QJX1 1XYOA 3AMMA 3WCSA 4HKWA 4GXLA 4W65A 3MW3A 4XFIA 5GLWA 2D5FA 1BVVA 3VBHB 4WM7B 4WVWA 3O14A 3VBSA 4EN0A 1OSGA 1U5ZA 3QOPA 5D8AB 2NP0A 4XFCA 3SITA 5FDBA 3JU9A 4R9AA 2YGLA 4U36A 1KD7A 1VALA 3KCXA 1X8MA 4B29A 3J26N 5J48A 2B7YA 2EVXA 1A3KA 3BOWA 4OHYA 1FYUA 4YARA 2BVBA 4OVEA 3RS6A 2ZGTA 4L2NA 4FTSA 4MXWB 3WG3A 1URXA 2VNOA 1WLDA 4F3JA 1H8TB 1SQ4A 4L99A 4LLFA 2EIGA 2OZ6A 1D4M1 3VZKA 3WW3A 1VAMA 2IXLA 3P3NA 2GDFA 4NVPA 2P17A 2ZOEB 5JR7B 5I8SA 1MACA 3WV6A 1DGLA 1JOJA 2LUWA 3OY8B 3GNEA 4GH4B 3O5SA 2G4IA 5BNPC 1A6CA 4XTPA 2HWE3 3IPVB 2RS51 5L7OB 4IXLA 2VMGA 1J59A 1S0CA 1BBT1 4XF4A 1LU2A 1Z7S2 3MIBA 1WCSA 1W6PB 4LO6B 4R9CA 3RYKA 3WNXA 4AFDA 3FZ3A 1TMF1 4YG0A 2PHUA 1YO8A 2SBAA 1W6MB 4GKYA 1VB4A 2RS31 1B09A 2TBVA 1QU0A 1OPMA 1TNRA 2HWB2 1PK6C 2ZPXA 2QDNA 2Q8OA 1XU1A 3ENRA 2GNTA 4XF9A 3CU7A 2DCKA 3WW4A 2P3JA 1N1SA 2X53S 4AQ2A 4D7SA 3WVJA 3NKTA 3TBDA 2NMOA 2YGMA 1VBA2 5FRAA 1Q8SA 3NVCA 4QQOA 1LOAA 3DGTA 2A3XA 3R6SA 3WDTA 1AZDA 3N7KA 5HBAA 2R063 2VMHA 4YFWA 4M0HA 2C0ZA 3VZMA 2VNGA 4E2GA 1NCQB 4DRRA 2FMDA 2HWC3 4DB5A 4D69A 3USUB 2JE7A 3JQWA 1RL3A 1NCRA 1I9RA 2CV6A 1XNDA 4AQ6A 4Z07A 4J1WA 3AZXA 4COVA 1W0OA 4E27A 4NO4A 3N7MA 1SACA 3DPRA 1AR61 2ENRA 4TLFA 1UZZA 4PLOA 1Q8QA 1AR71 3AKQA 4IV1A 5ACA3 2BVVA 2WINB 4LBJA 4OI2A 2VUAA 4Q26A 2ARXA 4CZSA 4TZDA 4TYSA 1KJRA 4M01A 1KQRA 1W39A 1SLTA 1ZBA1 5JOWA 2PHXA 1PO12 1LOEA 1E57A 2A3YA 2D6PA 2VGDA 4GKXA 4X8PA 2DU1A 4Q0SA 3B01A 5T5LA 1DDLA 3VKLA 4GMP1 1RUD3 3R4DB 4XZPA 3J8F2 2B45X 3MGUA 1JHNA 4J6GA 5T3NA 5JSRA 4FAGA 4Q4X2 1VRH1 4PIXA 4YVWC 4L8QA 1O4YA 2Z5WA 1AHSA 4UXAA 2V5YA 1CAUB 3B9CA 4ZU4A 3J9SA 1HV0A 3ZO0B 1UIJA 4Q4V2 4XJZA 4PIZA 1SLIA 2QE3A 1ASJ2 3NAPC 3M4FA 4N53A 1VBE1 4YZ3A 1QNWA 1Y3TA 2O1QA 5I8TA 3CJIC 1WW7A 2W0XA 2EXJA 3NL1A 2WSVA 4Z92B 1PHMA 2F6BA 1LGCA 1YFYA 5IK7A 5GJ6A 4LNVA 2CAVA 2QQPA 1RUE2 3GALA 3ZSKA 1BEV3 1VP6A 4LLOA 2WLPA 1CD3G 2XB6C 4KWJA 3CF6E 2NMNA 4K7JA 4GMP0 4B7KA 1COV2 3MZHA 5KC5A 5CU1A 4OFGA 3ZYRA 3GZAA 2A6ZA 3VBFC 2ZGUA 3WR0A 5K9YA 4QQHA 4XQWA 2GN7A 1MVQA 3V0AA 4LBLA 2VW1A 3M3EA 4X8NA 4H14A 3ZSMA 3LSEA 4EN9B 4HK9A 3VUOA 4D94A 5DZEA 4YZ4A 2XJSA 1S0GA 3HT1A 3MPBA 2Y0IA 4DY3A 3H7JA 1SLAA 3INAA 4FPEA 4RQPB 3BTAA 2WNVC 4U2AA 5DUVA 2TUNA 1YI9A 2WFF3 4XBQA 1FPN1 2HWF3 3PTYA 4UBGA 1B35C 3AFKA 3JD71 3ZXDA 2ZCWA 4C91A 3KGLA 2DCTA 4YRDA 1YLLA 1EPZA 3ZFGB 1CIWA 2JICA 2P3KA 1BKZA 4LBQA 2GU9A 1H1MA 4BA6A 1WBFA 4N7IA 5FO9B 5DZFA 4FOQA 4SBVA 3D5OA 1DFQA 2ZHLA 1S1AA 4GULA 5CFDC 5FLJA 3MW4A 2QZ3A 2UYBA 1WCKA 3ES1A 4HVRA 1MZ5A 4H7LA 2Z79A 1IQAA 3RMXA 1KDMA 1ZZ9A 1XRUA 4AVAA 4Q4Y1 1PGL2 4JGYB 4E4ZA 2Z2SB 4QGLA 1AR83 1XYPA 1CONA 2YMZA 4XEZA 1U0AA 4YZ5A 3UL2A 1RUF3 2JECA 1GQGA 3OD0A 5F6LB 1Z78A 4R52A 1XYNA 1KFUL 1WW6A 3KT1A 1IPJA 1OKQA 4K9SA 2JE9A 4NN0A 3TRSB 1NA1B 3FE5A 4IEOA 4YVSC 1RUH1 2F4PA 4CDXA 4GB31 4MXVA 5LEJA 4HK8A 4RSUA 5SV8A 4JDNA 3VLBB 4XF3A 4PLMA 4M00A 4WM8C 4NHMA 2E6VA 4WVMA 1IOAA 5K0UC 2E9QA 2HWE2 3USSA 5JZGC 3RYPA 1QHDA 3VDDC 3VV1A 1RUG3 1ZRRA 1N47A 3QCWA 3VBHC 4WM7C 1G9DA 2D97A 3K51A 4CDWB 2H0BA 5D8AC 5BNPA 1LB2A 5JVVA 3RWNA 4S2HA 4H55A 1FMD2 2XVKA 1DHKB 2RMU1 1NQJA 4XMIA 4CEWB 3DUIA 1XU2A 5EFUA 5CFCB 2D98A 3MF6A 4Y1ZA 1MZ6A 3OBTA 4ASLA 2ZS6B 4HN1A 4CRQA 3FLTA 4OHZA 4AVVA 4DRVA 1H8TC 3O0WA 4AGRA 3I59A 1PK6A 3VBOA 2KXLA 1O4ZA 1BMV1 5ABJA 1C3HA 4P9IA 2DFCA 1VIWB 4ES8A 1C57A 3WY6A 3CO2A 4GH4C 2VULA 1UW8A 2DCZA 3B94A 4LE3A 5AC91 3AMNA 5L7OC 2HWC2 3MEPA 3WP4A 2Y0OA 3UKTA 3WUCA 2D40A 1VBD3 3ZN4A 2UY9A 2MNGA 3ZFEB 5EYYA 4CYDA 4FOYA 1AJKA 2ZJCA 1JYCA 4KGQA 2WLQA 1PO21 4MH0E 1HRI1 2NN8A 5H9QA 1ZREA 2B5HA 3LZZA 3R05A 2JG9B 5ACA2 1AXKA 5DUUA 3THPA 4TWTA 2ZX3A 1CAWB 1ZVFA 2ZGLA 2HJIA 3GHNA 1PGSA 1R093 4M3CA 2W39A 1XQNA 1KDKA 1RUJ1 1V6LA 1ZBE1 4F7ZA 1Q8PA 2K9ZA 4FPCA 4FPHA 4LHLA 1VR3A 4YW1A 4KQ7A 2AR6A 5CAZA 3U0ZA 5FPXA 4FP3A 4OZXA 2BW8A 2R30A 4HKLA 1Q3EA 2OA2A 5BPXA 1GNZA 4YG6A 1SDWA 1OQ1A 4EROA 1AL21 3B00A 3LCPA 4I30A 4YVWA 3TN91 4AXOA 5DG1A 4I0AA 2ZAHA 3V0BA 2C1FA 1LENA 3ZXKA 1OPOA 2DYCA 1W6QA 4RS5A 3TWIA 1ND2A 2GH2A 3V65A 2NYYA 2RS12 3ES4A 1LTEA 3ZYPA 5BXXA 4QXKA 4DFSA 1ZRDA 3KGZA 2DURA 1KRIA 1BEV2 3CJIA 1DU3D 4NWVA 2ZGPA 1DYKA 5L73A 3WG4A 4Y20B 5AFBA 1K5MC 1YRZA 4JCKA 2TNFA 3OPZA 1ZA4A 2VVDA 3LA7A 5FAXA 3BB6A 4MLOA 2D6KA 1Z7S3 3U07A 1X7NA 4TSVA 2I74A 2R16A 5IUQA 5FOBB 1TME1 5KHHA 1PMIA 4IEZA 1I5ZA 4QU2A 4WV8A 1I6XA 4Q1PA 2HWB3 4DS0A 1NXMA 2JDZA 1RMU1 1A8MA 1PVC1 4BIOA 5BNQA 2EAAA 1VAKA 5C6CA 3H9AA 4R9DA 3SNMA 3FJSA 2GMMA 2HWF2 1OLRA 3PVNA 1HRV2 2UYAA 2VQ0A 2A7AA 4EV0A 1AYN1 2WNVA 4EWAA 2XUMA 3SH3A 2CYFA 1C8M2 5FPZA 3X29B 2O8OA 1PZ9A 2GSYA 1C28A 2N7GA 4E4DX 1BZWA 2ILMA 2Q0AA 3QH7A 1EV13 1UKGA 1AYM2 2PHRA 3D4KA 4YM1A 1EY2A 1V9U1 5DXDA 2XJVA 3R0RA 1AR82 1MS9A 2CGNA 4AGGA 4YFZA 1W6NB 4ATFA 3FBMA 4CP1A 1T6GC 3AMPA 4JTNA 4Q0UA 4RQPC 4LBQD 1U5YA 1AXZA 2QVSB 1WLWA 2EXKA 5KHJA 1GNHA 4BPZA 4MYEA 4RD7A 2D3RA 2BNMA 1PO13 1OQEA 1YIPA 2XVGA 4XTMA 5CVRA 3U11A 5EXOA 4AFMA 2V73A 4XIOA 1QY4A 4XMAA 4N7UA 3UJOA 2CNAA 1EAH2 2XH6A 3J8F3 4WVZA 2QDRA 4LO7A 1D0GA 2ATFA 4E4SA 5JWPA 1G9BA 2DU0A 5GZCA 3ZSEA 1ZX5A 3LOIA 2HWD1 4AI3A 2MPFA 2DF7A 3AP7A 4IEQA 5DZGA 3QBQA 1QWRA 2RM22 3RJRA 4WM8A 1ASJ1 4NR1A 1H4HA 5BUVA 2EALA 2ZBJA 3JBG3 1GYKA 4JGYC 3RG0A 2BYVE 3VDDA 5JZGA 4BWOA 4Q4V3 1OI6A 2DUQA 2FMYA 1MEC1 3RYRA 3ZYIB 2PAEA 2RR13 2HKXA 2R1DA 3KT4A 4I02A 1EP0A 1R083 3H3ZA 3FX3A 5D8AA 2R073 3L2HA 1H0BA 3ZYJB 4QD2A 1FOD1 1PGW1 2K2SA 4QMAA 1SBDA 5T50A 1NA1C 2AREA 1YCIA 3SCFA 2DVBA 2GMPA 4YW3A 5I0RA 2AENA 3CEWA 4CEYA 4BCUA 4COZA 2PLV2 2DWRA 4AHZA 2BNOA 1COV3 3UKVA 4D3WA 4YG3A 2GALA 1AF9A 1LOFC 2CWSA 3BIWE 4S2GA 1RUI1 1UAIA 2E7QA 1VBD2 1N3QA 1LOBA 2JG8A 3POSA 4LBKA 1NY71 3EJKA 3RPQA 2GC0A 5JPMB 4CEWC 2CAUA 2ZGSA 4AFCA 3PMSA 5FREA 4ZU5A 5KXDA 4IV3B 3AKRA 1PIV3 2D44A 2A73B 3RQ0A 3C2UA 4JDMA 1R092 4I0WB 3N36A 1YI7A 4C1XA 4XF1A 2SLIA 2R6QA 2WZR2 1D2QA 3LA2A 4MX3A 4Q27A 4Y22A 4HPKB 1LGBA 3WX5A 1AVBA 2I07B 4F83A 3QH6A 3M70A 1PGL1 1NE6A 1VBC2 1OHFA 1CVNA 2WA3A 5JAXA 4NHKA 4XETA 3SCGA 3ZFEC 1TNFA 5J09A 2ZHMA 1N3PA 4M3CF 1WD3A 2PTMA 4P14A 2GC2A 3USUA 3ZSJA 1C5IA 1G8WA 1AX0A 3EXUA 5FLIA 2JG9C 5BNOA 4MGYE 4PJYA 3WCRA 1ND3A 1CAVA 4S2FA 2H0VA 1FAYA 3WG2A 2ES3A 2NQYA 2WS91 4N9IA 5C4WB 2H6CA 4JGZB 4CDUB 1OOPB 3ILFA 3MIGA 4C0BA 3KB5A 3LGRA 3FBYA 3POWA 4LUMA 4A2UA 1W0PA 1HX6A 2NPIA 5H9PA 4AYUA 4ISRA 3WZ1A 1KFXL 5B2GB 5JI9A 1YHFA 4Y1UA 3FFZA 4L11A 4AWDA 4K21A 1DYPA 5IK5A 1BJQA 1PM7A 5FLHA 2Q30A 3OBRA 2GC3A 4Q0PA 1O3QA 3FFQA 5LEKA 3H1YA 3AMHA 1K5MA 3HMYA 4AEDA 4QPGA 1CGPA 3WHTA 1FMD3 4P9LA 5LK7B 5L36A 4YNIA 1MQTA 2OIIA 4N43B 1ZM1A 2QJVA 3CL1A 1V6IA 2UY8A 2VY0A 4Q2FA 1CAUA 1ZRCA 4SLIA 4JVAA 3ZMOA 1RGSA 1PVXA 1J1TA 1D2SA 2R061 2VMIA 4Q1RA 5T5OA 3MPPG 2TEPA 4I3PA 4LHKA 2HWC1 2D3SA 3FUQA 3MF9A 1QJU1 3M3OA 5JOZA 3ZIWA 4QPIB 4YW2A 2P2KA 4Q0VA 2QNKA 4K40A 1Y43B 4YLZA 3ZFFB 4ES9A 1CESA 1G86A 2FZ1A 1YIFA 1AR91 2KA3A 3I8TA 4MGIE 5ACA1 1WW5A 1EV12 4I3GA 3ROUA 2ZGKA 1SLCA 3VBSB 4FPOB 1S0DA 1UKRA 3AXDA 1IHMA 5FCCA 2ZGNA 2WNUB 5AVAA 3B3QE 2D93A 2XBO2 2ZGOA 5BNNB 3AK0A 2D6NA 2W52A 3BCWA 2QFEA 3OGJA 1C5HA 1RC6A 2GN3A 3FC0A 3WD5A 1RUD1 1G7YA 2NLRA 4XFHA 1CX4A 1HXS2 3NV3A 4XF0A 4XQ4A 3E97A 1G9CA 1ULGA 3M3QA 3BPZA 2ET7A 3MLKA 3VKOA 4IESA 1QOOA 3H1MA 2B8MA 5CADA 5HCFA 4L9BA 3KSCA 3P3PA 1AR73 3DV8A 5E1RA 3UV9A 2QUOA 2E51A 3G7DA 2DV9A 1MS8A 2A6XA 4YZ2A 1YJKA 3JBG2 3URFA 1GZWA