5L7OB

X-ray structure of triatoma virus empty capsid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
179
structure length
179
Chain Sequence
THSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
total genus 34
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oB00
5CFDB 3ZFFC 5CFCB 5D8AA 4CEWC 1RUI2 5BNOA 1PVC1 4CEYA 1OOPA 4JGYC 1FMD3 3ZXAC 4WM7C 1VRH2 1A6CA 1EV13 1FMD1 3ZFGC 3VDDA 1AR92 1AYM3 1ZBE2 1EV11 4QPIC 1R093 1AYM1 3J8F1 4YVSA 2QQPA 4Q4V2 1R091 1V9U3 1NG0A 2WS92 2WZR2 2R061 1V9U1 5C8CB 5K0UB 4RQPA 2ZAHA 1TMF2 1PGW1 3DPRA 1TME3 5BNNB 1VBB2 2WFF3 3JBG3 1AL22 5ACA3 5A33A 1MEC2 1B35A 1ND3A 4FTEA 1AR83 5LK7B 1TME1 2WFF1 2R042 3JBG1 5ACA1 1AR81 2RS33 1POV0 5L7OA 4JGZB 1PO22 5C4WA 2RS31 2PLV1 1Z7S3 1VAKA 4PDWC 1Z7S1 3VBUC 4FTBA 4CDQC 3ZFEC 1NA1C 4CDUA 1NCRA 3JD72 1RUJ3 1RMU3 3VBRA 1VBE1 1IHMA 1QQP3 3CJIC 4GH4B 1RUJ1 1RMU1 2HWC3 1DDLA 3VBOA 1QQP1 2RS12 2HWE3 1VBD3 4IV1B 2MEV2 2TBVA 1RVF2 1ND2A 2HWC1 4WM8A 4Q4Y2 4N53B 2HWE1 1NY72 1R082 1VBD1 2Y26A 2GH8A 1R1A1 4FSJA 5A32B 1C8NA 1COV3 3VBHA 1AR73 4RHV3 3VBSA 1H8TA 1CD3G 4Q4X2 1COV1 2VQ0A 1AR71 4RHV1 4RS5B 5C9AB 1BEV2 5FMOL 1ASJ2 4IV3B 2X5IB 1PIV3 5FMOS 3VBFA 5JZGC 1NCQC 1BBT2 1FOD3 1PIV1 1QJU2 1FOD1 4CDXA 1EAH3 2FZ2A 1RUE2 2RM23 5JZGB 4QPGC 2BBVA 5AC91 1BMV2 2HWD2 4YVWC 4RR3B 1AR63 1D4M3 5CFDC 5CFCC 3TN92 4N43C 1HRV2 1CJDA 1AL0G 1RUG2 3JB4C 1K5MA 3NAPB 1VRH3 5FOJB 3JB8A 2RR12 1VRH1 1ZBE3 1ZBA2 1AYN2 4N43B 1ZBE1 5ABJA 4AEDA 1MQTA 5D8AB 2FZ1A 4Q4V3 5BNPC 3M8LA 2WWSA 1FPN3 5BNOB 4CEYB 5C8CC 5K0UC 2WS93 1RUF2 2WZR3 4Q4V1 4CDWA 5BNNC 1FPN1 4RFT0 1TMF3 1VBB3 2BFUS 2WS91 2WZR1 1AL23 1MEC3 3VDDB 1HRI2 1TMF1 4LLFA 5BNPB 2R043 3ZFFA 1AL21 1MEC1 4JGZC 2HWB3 4CEWA 1RB8G 2R041 1PO23 4JGYA 1PVC2 2HWB1 1RHI2 2XBO2 4WM7A 1PO21 3ZFGA 2GSYA 4RQPB 3DPRB 4QPIA 1OPOA 2RS52 5A33B 1ND3B 1B35B 1HX6A 3J8F2 3JD73 4GH4C 5L7OB 4Y4YA 1QJZA 5C4WB 3JD71 2R062 1V9U2 1X33A 4IV1C 1PGW2 2RS13 2ZTNA 2MEV3 1RVF3 4N53C 4Q4Y3 2R073 2RS11 2WFF2 1R083 2MEV1 1PO12 1RVF1 3S6PA 1AR82 4Q4Y1 2R071 4CDUB 1NY71 1R081 1NCRB 2RMU3 3FBMA 4Q4X3 3VBRB 2PLV2 2WLPA 4RS5C 5C9AC 2RMU1 1POV3 4PDWA 4Q4X1 5J98B 4IV3C 2X5IC 3VBOB 1BEV3 1QJX2 1VBC2 3VBUA 1HXS2 4CDQA 1ASJ3 1ND2B 1POV1 3ZFEA 1NA1A 4WM8B 1BBT3 1ASJ1 1M06G 5DDJ2 4Q4W3 4GMP0 1C8M2 1BBT1 1QJU3 3VBHB 3CJIA 1VBE2 3VBSB 4Q4W1 1H8TB 1VBA2 5GKAC 1QJU1 1E57A 1RUD2 1PGL1 2HWD3 4RR3C 3VBFB 1BMV1 2HWD1 2XPJA 1R1A2 1EAH1 4GB32 1RUH2 4EJRA 4CDXB 2RM21 3NAPC 1AR72 1HRV3 1RUG3 1AR61 1D4M1 5JZGA 1HRV1 1NCQA 2RR13 1RUI3 2HWF2 1ZBA3 1AYN3 1PIV2 4GMP3 2RR11 5D8AC 1RUI1 1ZBA1 5BNOC 1AYN1 4GMP1 4CEYC 1OOPC 1AR93 1RUF3 4QPGA 1RUC2 4YVWA 1AR91 5AC92 1K5MB 3VDDC 1RUF1 5CFDA 5CFCA 1HRI3 2ZZQA 1OOPB 1HRI1 4YVSC 5ABJB 2BFUL 4N43A 4AEDB 1MQTB 1PVC3 1GFF2 2BPA2 1RHI3 2XBO3 1QJY2 1VBB1 4RQPC 1HQNA 3DPRC 4CDWB 1RHI1 2XBO1 1ND3C 1B35C 2RS53 4YVSB 2RS51 3ZFFB 3HAGA 5L7OC 3J8F3 5J96B 5BNPA 4CEWB 1FMD2 1NOVA 4FTSA 5C4WC 5K0UA 5C8CA 4JGYB 1OHFA 1EV12 5BNNA 4WM7B 2R063 1FPN2 3ZFGB 1AYM2 4NWWA 4QPIB 1AUYA 1R092 4JGZA 1PO13 4CDUC 1NCRC 4BCUA 3VBRC 1PO11 2HWB2 2PLV3 4NWVA 1TME2 3VBOC 3JBG2 5ACA2 1QJX3 1ND2C 1VBC3 1HXS3 3IDEA 4WM8C 2RS32 1QJX1 1VBC1 1HXS1 3VBHC 4GH4A 5DDJ3 1C8M3 4Y5Z0 3VBSC 1H8TC 1VB4A 1VBE3 1Z7S2 5DDJ1 1VBA3 1C8M1 4IV1A 1BEV1 1RUD3 1VBA1 4N53A 2IZWA 4PDWB 1WCDJ 3VBFC 3LOBA 3VBUB 4CDQB 1RUD1 5A32A 1W39A 1RUE3 3ZFEB 1NA1B 1RUJ2 1R1A3 1RMU2 1F2NA 2R072 1QQP2 1RUE1 4GB33 4CDXC 1RUH3 3CJIB 2HWC2 4RS5A 5C9AA 4GB31 4Z92B 1RUH1 2HWE2 1VBD2 4IV3A 2X5IA 2RMU2 3TN93 2HWF3 1X36A 1COV2 1VB2A 4SBVA 1F8VA 2BUKA 4RHV2 2HWF1 3TN91 1RUG1 4Q4W2 1K5MC 1RUC3 1SMVA 4RR3A 1PGL2 5AC93 1RUC1 1FOD2 1NCQB 2DF7A 5ABJC 1EAH2 4AEDC 1MQTC 3NAPA 2RM22 1QJY3 4CDWC 4QPGB 4YVWB 1QJY1 1D4M2 1AR62
chains in the Genus database with same CATH superfamily
3PVNA 5FXXA 5KWRA 3ZFFC 1W2NA 1OF4A 1WCQA 2BU9A 4MHRA 4Y33A 1ULPA 3UV9A 3VKOA 1HIXA 2ZBJA 3KCCA 1DF0A 1N1VA 2WO7A 2WO3A 3S5AA 3HEIA 2PHRA 5DAVA 2QVSB 1CIYA 4HT1T 3MFAA 1YFXA 4ZU5A 2VXJA 1SBFA 4HANA 1FMD1 1QY4A 2ZXQA 1Q56A 3ZYBA 3AMHA 3VD7A 1ZBE2 2QKDA 1EV11 1U12A 1YJLA 2HYKA 1DCSA 4M00A 4S2GA 2YV8A 1ODMA 2JDKA 1R093 1AYM1 2P37A 3EJKA 4MGKE 5CKMA 4A6SA 3J7HA 2OX0A 1ZRFA 4Q4V2 3N9OA 2D6OX 2WBKA 1QOSA 5AFBA 1O4YA 3ZKUA 2GP3A 5HV0A 1NG0A 1SLIA 4QX3A 3ZYRA 5IVJA 1W6MB 5JPMB 4XAEA 3S7EA 2WQZC 2B5HA 1AXYA 2E7TA 1P8JA 2R061 2D3PA 3CQOA 3DEMA 1YLLA 3I3EA 1PGW1 4RQPA 1TME3 1KRIA 3AYCA 3V0AA 1YO8A 1B35A 1KDKA 4ASKA 3UJOA 2QDNA 2JKXA 2WFF1 5ACA1 4QDQA 1Y43B 4NHLA 2V4AA 4YM2A 4ZZ5A 1ODNA 3EHKA 3NL1A 3PVOA 5L7OA 1RXGA 1W9YA 5FY1A 4B29A 3S7IA 2VMFA 4P00B 3B01A 1EYBA 5FV3A 5EJ1B 4ARXA 2CSGA 5FY7A 4F7ZA 1LHVA 3KLSA 2Q8EA 4WVWA 3LSDA 5ISLA 3FLRA 5I91A 2BGPA 2KD7A 3ZYJB 3ZMNA 1WLWA 1H1AA 1QXJA 1Z7S1 3VBUC 1GNZA 3FLTA 3JUUA 3POWA 1MS4A 2VPVA 5C7GA 3DN7A 4HONA 3C7GA 3H1MA 1V6JA 1MS3A 2Q8DA 3A21A 1H2LA 4CDUA 3H3ZA 1OH3A 1NCRA 4QXBA 1RUJ3 3WNLA 1RMU3 4B7KA 3RZHA 4OQ9A 4GH4B 1W03A 1QQP3 3T2PA 2OIIA 2PQSA 4ZONA 2D6LX 2VJXA 2WRAA 1C5HA 3VBOA 2DYCA 1QDCA 3LIHA 4BIFA 4QKBA 4CP2A 4OFGA 4YW7A 1JYVA 1JZ2A 4Q2FA 2HWC1 4WM8A 1PM7A 4CUCA 1IQAA 5FY4A 3KCYA 2H0BA 1GICA 1R1A1 2VBBA 3ACIA 5KXDA 3V0BA 4FSJA 3POBA 1X9PA 5A3PA 4WV8A 4RHV3 1H8TA 5FZ1A 1YQ6A 2VQ0A 2I74A 1ALYA 1VPHA 1W6PA 1WW4A 4GJZA 5FBZA 1XU2A 5C9AB 1F4AA 2ZGRA 2W68A 3P3PA 4NPLA 3VBFA 3A7QA 5FK8A 4URTA 2OQ7A 4LO6B 4QWNA 4XEZA 1DIWA 2GN7A 3I2JA 3FUQA 4G4FA 1M4WA 4WVZA 1PIV1 3C2UA 2WYSA 1QJU2 5A3UA 2FZ2A 5FP9A 3O1VA 5T54A 3RJ2X 2CDPA 4OZOA 4D94A 3C7EA 2Y0OA 4SLIA 5FYBA 4KWLA 1V6MA 1W8NA 1WMDA 2RM23 3GGLA 2X29A 3HIFA 2BBVA 1QJFA 3BVCA 4BJ0A 1GKBA 3VHRA 2ZOEB 4A44A 1GMMA 3WP6A 3WF1A 5G04L 4Y26A 4ZKTB 1DQ1A 3LEIA 1LRHA 4K6BA 5DAPA 2MHFA 4HPKA 5CFCC 4GWMA 4H55A 1JHNA 2JG8B 2WA4A 1OBNA 4QX7A 4Y3OA 2NLRA 3HWJA 4K8RB 1K45A 5FZMA 5C33A 2GALA 3WY6A 3OB8A 2W5FA 1W8TA 2A3WA 1O5UA 1O3QA 3TAYA 3KT1A 4QDRA 4IETA 5C5TA 4Y22B 4TTGA 3O1MA 3RYKA 4FT8A 4UFIA 3THCA 1HRV2 1NE6A 1RUG2 2O8OA 2VZQA 2VZ3A 3ZXDA 4DXRA 2BJSA 3BU7A 5LRRA 2BZDA 3JB8A 5F2SA 1ZBE3 4HVOA 5AVAA 1LENA 1DLLA 2PAKA 1LODA 1SHWB 3AKQA 5JSOA 2GZWA 1CQ9A 2XG3A 2ID4A 1UY3A 1UNBA 1H2KA 5FZ7A 4NIGA 5F39A 3HNMA 1MQTA 5GJ6A 1W6OB 3IPVA 4Q4V3 5D8AB 5BNPC 2WWSA 4LPLA 3ES1A 4J1WA 2BBAA 5BNOB 3J7MA 2A6ZA 1UMIA 5DUVA 3M3QA 1IPSA 5C8CC 5K0UC 1UYXA 1VMJA 3KS7A 4K1YA 4XXAA 4HK9A 2ZGQA 3R4SA 4NIAA 4OI1A 2XHNA 3TOJA 4A45A 3U4XA 3I2HA 4OULA 4CZSA 3GHMA 5FP7A 2YC4A 3POJA 3WNMA 1IPJA 1HRI2 4LLFA 1DZTA 1W6QB 2VMGA 4LR4A 1AL21 1UX6A 1W3VA 4XQWA 3TWIA 4DUVA 3DYPA 4AG4A 4NPRA 4LK7A 2R041 2CAVA 5HV4A 3POSA 5T3NA 1J83A 3KD4A 4Y20A 5LBCA 3PMEA 4R9DA 4WM7A 1PO21 4OMCA 3WQ1A 5KR7A 2ZMNA 5LZ6A 1Q3EA 2P3KA 1LU1A 3DPRB 2P1BA 4D8MA 4QPIA 1OPOA 2JG9A 2ARAA 2AEYA 1CPNA 3KT7A 3PL0A 2DVBA 3RDIA 3RGBA 3T2TA 2PN5A 5D2AA 1W9WA 4FFIA 2W1WA 1DQ5A 2A1XA 1SLAA 5A7NA 4ZS3A 4PLMA 4XUOA 2OQ6A 4Y4YA 1QJZA 2QNKA 4ISQA 2LRPA 4ZPIA 4GQ7A 5C4WB 4QQOA 5GZFA 2YY1A 4QX5A 1X33A 2D44A 3VL8A 2JDYA 5LBBA 2XHKA 1VR3A 4XZUG 4CTEA 2XQXA 4XDPA 2WR9A 5FZDA 1R1ZA 4QD2A 1WW5A 4L92A 3E6BA 4GXLA 2RVAA 2MEV1 1PO12 1RVF1 4MXWB 1AR82 1JTZX 4UW3A 4ARYA 1JU4A 5CIRA 4DXZA 3QH6A 3RZKA 1GSLA 2DU1A 3VBRB 5A70A 3SITA 4EWAA 1OH4A 3THDA 4XE9A 2EALA 1KFUL 3WW3A 4AFAA 1POV3 4XFIA 2CGPA 1C57A 4CDQA 3IAQA 2JE9A 3M7AA 4BB3A 5EXOA 5IT6A 1ND2B 1IG0A 1O59A 4MSVA 3ZFEA 1DYOA 4QXHA 4W6WA 3AVRA 4UW6A 4BA6A 1YWKA 5FY5A 5FYCA 3NJVA 1US3A 4Q4W3 5DDJ2 4YW4A 1C8M2 1DLCA 1CAVB 1W8HA 2WNVB 1QJU3 3VBHB 1PK6B 4AZZA 2YYOA 1VBE2 1W9TA 3ZMOA 3VBSB 3P3NA 5FPLA 2ZA9A 3LCPA 3RYPA 1PGL1 1OKOA 4Q26A 2ZKNA 4RR3C 3AKRA 2A6XA 1ZA4A 1VMHA 3NKGA 5DN2A 2LS6A 4Y5TA 5JAXA 2E9QA 1QWRA 4PQQA 1HJGA 1JZ6A 1OD3A 2CY6A 1WBLA 1ZZCA 5A7WB 1GBGA 4XACA 3NAPC 4DY5A 1O3RA 2EIBA 4IESA 5LY2A 3L2HA 3ZM8A 1AR72 1HRV3 1RUG3 4FOYA 1WUVA 2Z2SB 3ZSEA 1WLTA 1D4M1 2B4KA 1QGLA 2ADEA 3MI8A 4OZXA 4FFFA 1RUI3 2CWMA 2HWF2 4K7JA 4HN0A 1D0GA 4JDMA 5T55A 4EQVA 2EA7A 3BUCA 1ZBA1 1YCIA 2QQNA 5DUWA 3UGHA 1AYN1 4UFMA 4ZZ8A 1U0AA 4GMP1 3E6DA 1HKDA 1OUSA 3T0BA 1A3KA 1WA4A 4EN7B 1ULCA 1UZYA 3E1F1 4QPGA 4NIHA 1F5JA 1Z78A 1HJFA 1B09A 2WT0A 1AJKA 1AR91 5KHKA 4JRLA 2DCTA 3VKFC 1JHJA 3IT8A 2V4VA 1VP6A 4HKOA 3VV1A 3H8OA 4I30A 1PNFA 1GNYA 1IZ3A 4JKMA 1HRI3 2AGSA 4JAAA 4BU2A 3MO4A 2ZGNA 2X10A 1W06A 4K21A 1JYXA 1CGPA 1ZX5A 5FO9B 1SPPA 5ABJB 3NVCA 5H9SA 1LOEA 1GFF2 5CAZA 2ENRA 5EHDA 4A6OA 3SKJE 1IKPA 2BPA2 3U07A 3BTZA 2J1UA 1OA4A 2K2SA 4O9EA 5F3CA 4RQPC 1XBFA 1HQNA 2XBO1 1B35C 2VUCA 3PUSA 2EAAA 3C7OA 4CXYA 4FPFA 3VKLA 2BW8A 3NMBA 4N8MA 3BB6A 2RS51 5L7OC 1S0GA 1UKRA 1AZDA 4NHYA 3BOWA 5FZHA 4FTSA 1GQHA 1V6NA 3I2IA 4K8FA 4QB2A 4JGYB 1O8PA 1ZZ9A 1WD4A 4QU2A 4A3ZA 5BNNA 2W46A 1XQNA 2XXZA 1FPN2 4P9GA 3ZFGB 2V5DA 1EPWA 2Q8CA 5LB6A 4FPJA 1DGWA 4K40A 1BVVA 2FDJA 3LPFA 4JGZA 3POFA 3BOPA 3GBGA 3MGUA 1RGSA 2X09A 1PO13 1CX4A 2VUJA 3AYEA 3MW4A 4CDUC 1NCRC 1Z0HA 2UY8A 1YNAA 1IG3A 2VMDA 3QLQA 5J48A 1G9FA 2HWB2 1UN1A 3OF1A 4PF5A 3MICA 1J3RA 2VZVA 4CCKA 1O4TA 3UK9A 3GZEA 1REDA 4XJ9A 4N7UA 3VBOC 3RSJA 4I0BA 3ELNA 4NVPA 4LKSA 2JIGA 4WM8C 3UESA 4C8DA 5I0RA 2V72A 2ADDA 2VMEA 3BKZA 3OBAA 5FUPA 1HXS1 5LA0A 3LWCA 4P5YA 4CCLA 3RZLA 4ISRA 4IQPA 2ES3A 3I2KA 2Y6GA 5DDJ3 1JYNA 1C8M3 2VO5A 4KU8A 4GA9A 1H8TC 1LULA 4KWJA 3ZXKA 2B42B 1VBE3 3QOPA 5I8TA 2NPIA 4IV1A 2D6NA 1BHGA 2V09A 4N53A 4CXWA 3FZ3A 2JD4A 2EIEA 3LPGA 3NO8A 3VBFC 1ZRRA 4GALA 1YYNA 5IYYA 5A32A 5FYIA 4PF1A 1W39A 5CB7A 1RUE3 4FP3A 3PJYA 5CNAA 3W5NA 1TE1B 1I1EA 1G86A 1F2NA 3C7FA 2R072 3LDRA 3CO2A 5FZIA 2W95A 2ZEYA 4K9SA 1BXHA 3ENRA 3VKNA 1OVSA 2WUHA 4PIYA 4I3PA 3W59A 1C4RA 3WCRA 4A7YA 1VBD2 3IDCB 2RMU2 3WOGA 3ZYPA 3FUOA 4JX0A 3HVDA 1ZREA 1UX7A 2WDBA 2WFPA 5KXEA 1H8VA 1MACA 2AYHA 1HB1A 1RTVA 2WQ8A 1YFUA 3OEAA 4OI2A 4PT6A 1LGCA 2HWF3 1VALA 2XMLA 2DU0A 3WQ0A 4SBVA 2C5DA 4W6YA 2EXJA 4I09A 2GC1A 1F8VA 1ZM1A 2BUKA 3TN91 4UFHA 5A6YA 3UETA 4LBQB 4QAWA 2DVFA 2QQUA 5FBJA 5I0SA 3O12A 3AZVA 2XL7A 3LDKA 2ERFA 3P5BA 2XKOA 3ZXLA 1N47A 4IEVA 4AVAA 3HBKA 4M4RA 1A34A 4YARA 4KWUA 1REFA 1FOD2 3MYXA 4XF4A 4MLOA 4DOUA 5C6CA 2DF7A 4XOGA 2OVUA 4TSVA 5FZ4A 1UXZA 2B8MA 1KS4A 2FCTA 4GD4A 2Y33A 5JOYA 1S0FA 3RMYA 1MQTC 1JODA 1XB9A 2WNUA 5C71A 5FLJA 4P9JA 5JIUA 3DKQA 1IS3A 2B45X 5GLVA 1L7RA 2D6PA 2ZACA 3KGZA 5JOWA 4YVWB 3R6SA 3IIIA 3LZZA 1ZZ7A 3NWKA 3MIFA 2NP0A 1F31A 3AX4A 4TYSA 2Y6KA 5CFDB 5BPXA 2VOTA 1DGLA 3D6EA 1V70A 1S2EA 3ZKYA 3ZOIA 3ZSKA 4BXFA 4C90A 3HJRA 3I2GA 1F4HA 3FMGA 4OMDA 5BXXA 4NJ4A 1J1LA 4Q1RA 1Q8OA 3IKWA 3A22A 4A2UA 2D6MA 2PHXA 2WT1A 3C7HA 3H42B 4R4ZA 4WM7C 2ZAAA 1A6CA 3VHNA 5C3OA 5JXJA 5L36A 1G6NA 1N1TA 4GULA 3K4AA 2ZGKA 2O1QA 1HQLA 2D40A 1ULEA 3H1WA 3OGVA 5EIYB 4E4HA 2C1FA 2E7AA 4QPIC 4RGGA 2JG9C 3WG2A 4CCEA 3SEEA 4COYA 2VQUA 5LBEA 3SXWA 1DYPA 2O8QA 1VE0A 3IB3A 1LHUA 1R091 4YWAA 1V9U3 4AVBA 1S4CA 1XE0A 1RUOA 3W58A 2BTVC 2VMHA 2WC2A 4KMQA 2WS92 1FAYA 3RG0A 4AF9A 4EZ4A 2WSVA 3BI3A 1SCRA 4YW6A 1TVGA 5JCTA 5FDBA 1TMF2 4IE5A 4IEXA 1POQA 1VBB2 5FPXA 5FPUA 5IAXA 1KGYA 3NV1A 1MEC2 1ND3A 5A33A 1BCXA 4AK3A 3B5LB 4ZHNA 5JUVA 4FFGA 1SQ4A 1TME1 1ENQA 2ZGLA 2ZX2A 2X53S 3WG1A 4CXXA 5I8YA 5IK4A 3CZUA 4AFBA 4AHZA 1KD7A 2JDHA 2VQAA 3USUA 2LW8A 3IMMA 5FZOA 3TNQA 3AYDA 4FI9A 1SEFA 2WLQA 4YM0A 1EUUA 5FYTA 3JQWA 3MIGA 3LQCA 4E8CA 3N7MA 2R49A 1E5RA 3SKVA 3D82A 5J7MA 4ES9A 3EO6A 3X29B 4Z1VA 3WUDA 1D2QA 2YU1A 4CDQC 4DXTA 2W0XA 3HT2A 3ZFEC 1GNHA 4JQRA 5LA9A 5F5CA 3RWNA 1WD3A 2O14A 1DQ6A 1PM4A 5BUVA 3H0OA 1G8WA 1MZFA 4Q29A 2P4EA 2OPKA 1RUJ1 1RMU1 4I2OA 3PU8A 5CU1A 3PDQA 5EFUA 1I5ZA 1QQP1 1UU6A 3BIWE 5FO8B 2RS12 4MGYE 1L7QA 1VBD3 3WDXA 1ZZ6A 2TBVA 3ME2A 1LCLA 4FXKB 3WF4A 4YFZA 5C8WA 1SBEA 4IEYA 4MXVA 3WHTA 4Q4Y2 1N3OA 2YBKA 5IVVA 1R082 4E9KA 4UFJA 4G3YC 1VAMA 4V1PA 4B8EA 1KQRA 4BMBA 5F3GA 1OPMA 3NNMA 2YDEA 1OA3A 1SDWA 1QKQA 2ZKLA 4Q4X2 1IPKA 2XVKA 3UGGA 2QQJA 4LBQD 4QHOA 4LKEA 4X6QB 5LA1A 4RHV1 1PX4A 5B4NA 1GUIA 2D3RA 1UCXA 4RS5B 5GZGA 1CAUB 1BEV2 1GU3A 1UMZA 1GQPA 2VW0A 4FOWA 1ASJ2 3BODA 2X5IB 2AR6A 4IV3B 4O65A 1BBT2 2Y0IA 1NLRA 3WF0A 5CKNA 1FOD3 2A6WA 3OD4A 1MVEA 3ZR6A 5L9VA 3PU3A 5T5OA 3ZYIB 2W94A 1WBFA 1ENXA 3TYJA 3IZOA 4TWTA 5FYUA 2W1SA 1CAWB 1KJLA 4Q5OA 3NV4A 1S55A 3MHZA 5JZGB 1IOAA 5F7UA 4QPGC 1ZRCA 1XNAA 1OFSA 1BMV2 5A80A 3A4UA 1QH7A 4AI2A 2Q4SA 4NAMA 4UFKA 3VB9A 2G9GA 2H0VA 3T1LA 1G9AA 1EP0A 2JKBA 3EYPA 4IW3A 4OHVA 5GZDA 3HMYA 3WXPA 3O1OA 1NXMA 2BVVA 1AXKA 5IVEA 1XNKA 3ZSMA 4AVVA 1E5HA 1LOGA 3LB9A 3I3MA 3M4FA 1W28A 2KXLA 2VNGA 2YHJA 4TXWA 1K5MA 4CYDA 5FOJB 3LA2A 4FPLA 5A1AA 1DQ0A 1E5SA 4UW4A 3T0AA 2GN3A 3WQ7A 2WKKA 1KITA 3MPPG 4BM8A 4CCJA 5LCWL 1ZBE1 3PURA 1UIKA 1OXCA 2LROA 4XABA 2DBIA 5FYHA 1ZA7A 4L99A 1LOBA 2FZ1A 2Z4FA 4BISA 3VZLA 5JLVA 3CMGA 3KT4A 3TRSB 4I3GA 4YW2A 4CEYB 2WS93 1GP4A 1RUF2 2FDFA 4Q4V1 3W5MA 1MR5A 3K4ZA 5BNNC 1XE8A 4RFT0 1TMF3 4P9XA 2P3IA 1VBB3 1JOBA 3MIBA 4LO8A 1UW8A 2BOJA 4CVUA 3DXTA 4XUPA 1KEXA 1MEC3 2ET7A 2IWGB 3VDDB 2DVAA 1UF2C 2HKXA 5FJKA 2R16A 4KH9A 2UURA 4O61A 4JKLA 4CCNA 5FK7A 3LEMA 5FP3A 4JGZC 3U4SA 3OBRA 3OUJA 4CEWA 1QDOA 1UY4A 1LOFA 2D5HA 3FN9A 2D6KA 4I0WB 4PIXA 3H8XA 3DECA 2CWSA 1CWPA 1WMXA 3SH3A 4AI0A 4Z2WA 1K42A 1LNSA 2GSYA 3TBDA 3U75A 3N9NA 2CHHA 3BTYA 1YJKA 4UOJA 4LBKA 4PCRA 1HX6A 4DUWA 1FV3A 1LEDA 2QUOA 1DQ4A 1JBCA 4DZGA 2XJPA 1AVBA 1LHNA 1UU5A 4XVHA 1XU1A 2VNVA 3ABZA 2VD7A 2AEZA 4XHXA 4CUAA 5EJZB 4CU8A 5FUIA 4XDQA 2Q1FA 2WIIB 3ZXGA 3HBZA 2R062 1H6XA 4GJYA 4IV1C 3AP5A 5CKQA 1PGW2 3J9SA 2RS13 4M3CA 3ACLA 4PQ9A 4N53C 3CIHA 3RQ0A 4Q4Y3 4XETA 2BVBA 3MBWA 4BE3A 2WFF2 1R083 4BQ2A 2ETEA 4DQAA 3GM8A 3LGRA 4IXLA 5J3UA 3RMXA 4I02A 2EXIA 4J6GA 1OLME 1UZZA 4Q27A 3APBA 3FBMA 4Q4X3 4AHXA 2CAUA 1SLBA 4YSFA 3ZPOA 4PDWA 1BEV3 3L2YA 1VBC2 4IEWA 4LTAA 3JZVA 4HKWA 2VTFA 1ASJ3 3VHOA 3U0ZA 1POV1 4L2NA 1NA1A 4AL9A 1BBT3 1WZXA 4IE6A 4LO5B 3SNMA 3TB0A 3CZJA 2KR2A 2YFZA 4KBBA 5SV5A 2ZABA 3CJIA 1UOBA 2J7MA 4OUEA 3WP4A 2AACA 3UGFA 3ZN6A 3ITQA 4J25A 1VBA2 4Q4W1 2JDPA 4UBGA 5GKAC 1QJU1 2JX9A 3AP6A 3MDPA 2CGNA 3D0JA 1UYZA 1C3HA 4RYDA 5FTTC 1RUD2 4AOCA 3JU9A 2PXJA 5GLZA 4HFSA 1XXNA 2DWRA 1V6LA 2VBDA 1W6NA 4D7YA 2OKXA 4QM8A 3FHIB 3FJSA 4MZUA 4YGDA 2XPJA 1DYKA 4PI0A 3IAPA 1R1A2 5FPBA 1TNFA 4XCBA 1EAH1 3ZR5A 3JQXA 1BKZA 2XVGA 2JIJA 1RUH2 1JOPA 1MVQA 4EJRA 2TEPA 1X8MA 3J7NA 2WNUC 4XJAA 4CDXB 4PLNA 4W50A 4WVMA 2GNBA 3AJZA 3RI8A 1W8UA 4HOOA 4XW3A 1LTEA 3CHXA 2YFUA 2C26A 2QFEA 4L11A 5IJRA 1AR61 5JZGA 3VD5A 4Q8KA 4META 1HRV1 1NCQA 4YZ2A 4UF0B 4XPVA 4NAOA 5BY5A 5GZCA 1PX3A 1PIV2 4AVCA 1X7NA 4E8DA 3I2DA 1RUI1 5E89A 1UXXX 2D7FA 4XDOA 2JB4A 1UOGA 4LE3A 5FY9A 3S0MA 4QKNA 1YQ5A 4UYBA 4LUKA 3FL7A 3BU0A 1APNA 1NQDA 4WZFA 3RVHA 4EN8B 3GZUC 1RUF3 1O3TA 2C0ZA 1QNWA 3WP5A 4AYUA 4E27A 1DBNA 1CIWA 4YM1A 1CAXB 2VTXA 1PMHX 3MLLA 5JSPA 1UIJA 4OQ8A 3VZNA 1IGOA 3OPTA 3ZO0B 1OOPB 4Z2AA 4XAAA 1HRI1 4JTOA 4EROA 4NRPA 4BMEA 1H1IA 4AEDB 2VZOA 1WW6A 2VMCA 4ATFA 1W0NA 1S0DA 5A1LA 2FDHA 1QJY2 2V5YA 1HV1A 3AMMA 4H7MA 4F3JA 4X8NA 4QX8A 2OUJA 4ZU4A 4CDWB 1ONAA 3W9AA 1JN2P 1X9TA 2XB6C 1ND3C 2WABA 3PIGA 1EPZA 4YVSB 3LOIA 1LECA 1SDDB 1GLHA 3AP4A 1W04A 4Y1XA 4CUGA 4GWNA 3HQXA 3ZFFB 4AXOA 3QCWA 1LEMA 3N4MA 2SBAA 4NIDA 4GKYA 1W6MA 4LNVA 2B39A 3S5QA 4QKDA 1OHFA 3GBWA 4NIIA 2I07B 2XLGA 1YEWA 4N7IA 4XJUA 3T1MA 4COZA 2QQMA 3MUY1 4Y5SA 5FLHA 2R063 3WW2A 1JS9A 4NRMA 2ZHMA 3KZ4C 4V2VA 3NJYA 3T09A 2BOIA 2WT2A 3Q8AA 1NUKA 4QHZA 4MG2A 3NSTA 2MNGA 2Y8KA 2AUYA 2TNFA 4XFAA 5FUNA 4CUBA 2F17A 4IGQA 2ZHLA 5FZGA 4JTNA 4AEKA 2QQVA 4QT6A 1PO11 3ZPYA 2DFCA 3OSDA 4LKDA 1QOTA 4YG3A 5HBAA 4XBQA 4NWVA 4OHXA 1ZZ8A 2IFWA 3JBG2 4XFCA 1ACCA 1K12A 3LA3A 2BV4A 1AX0A 1H0BA 1PZ8A 1CZSA 1VBC3 1CZVA 4Z82A 3VGIA 3KM5A 5LBFA 1AX2A 2CDOA 2UWBA 3ZSLA 2HEVF 2RS32 5F6LB 1SLCA 5FYMA 3HNBM 5E16A 1CONA 2JDNA 5JI7A 4GH4A 1IKQA 1UOJA 4XFBA 4RD7A 1WGPA 1W2UA 1J59A 3PUHA 5DDJ1 1VBA3 1C8M1 3ATGA 4CU7A 2IC1A 2ZEZA 5KC5A 4D6QA 3A23A 1H4GA 1RUD3 2ARCA 3M70A 3K48A 2A6VA 1D7PM 5EZWA 3VBUB 3D3AA 2VAUA 4GIQA 5DAQA 3ZN5A 3GYDA 1JZ4A 1C1LA 1ULOA 1GZWB 4LIUA 5GM0A 2BRTA 1OF3A 1R1A3 2CNAA 2UWAA 1A8DA 4YW1A 5F5AA 1Q43A 1RUE1 4GWIA 4TLFA 1RUH3 1RUNA 2OA2A 5I0TA 4IE4A 5LASA 5C9AA 4HXCA 2XJSA 4Q0SA 5ERLA 2HWE2 2ZX1A 4RA0A 2C6SA 1QMJA 2FMYA 2RJLA 3CDZB 1W8OA 3MIDA 5IVFA 3S57A 2VL4A 3OEBA 4NE9A 1JMUB 3T4VA 2ZX3A 1ULGA 5FXWA 4LHLA 1X36A 1YQCA 1COV2 1VB2A 2Y60A 1D2SA 5HCBA 3P6BA 3WNPA 3DCQA 2WQ4A 4H7LA 4RGKA 5D1IA 3UL2A 1VMFA 2HWF1 1GV9A 2BNMA 2BNNA 2VCMA 4XQDA 3D4KA 5LA2A 5HCHA 3BTAA 4XILA 3GJAA 4DRVA 1BVP1 3I3DA 4HK8A 3U10A 3UKNA 3VZOA 2IVJA 1SACA 1K5MC 1UY1A 4B4QA 3FWEA 3N7KA 1SMVA 4AVTA 4AI3A 1PGL2 2K0GA 3DGTA 4D0QA 5IWFA 3H1YA 1AHSA 2BERA 2JG8A 4PHZA 4QDSA 1LKNA 2XH6A 2XR4A 3B9IA 3WP3A 5J1XA 3VKMA 1QH6A 3R4UA 3F95A 3WZ1A 2PA7A 1S2BA 3CF6E 3OPZA 5DPNA 1NT0A 4Y22A 4RN5A 1S1AA 1RJ7A 2PMWB 3AK0A 3MEPA 3AFGA 3CLPA 4I0AA 1H6YA 1GZCA 3K51A 2QJVA 4BK5A 4C1WA 4AHWA 2DCYA 1QJY3 5FZFA 1O8SA 4CRQA 4YZ5A 3ETQA 1EUTA 4HLTA 3PUAA 3UJQA 4LT5A 2Y6LA 1K5JA 3D8CA 4QHBA 1D4M2 1UD1A 4ATEA 4DPNA 3AP9A 1V6KA 1DZQA 1PHMA 1TNRA 4YW3A 3AL6A 5CFCB 5JDBA 1W6OA 4QQHA 5D8AA 4ZY9A 1WLDA 3E6CC 4CEWC 3AMQA 3LDBA 4BQXA 5BNOA 5C3PA 1PVC1 3MPBA 4BYYA 4LK6A 1LOFC 1OOPA 3AP7A 2WO1A 2W47A 3ZXAC 2NMOA 4Y1YA 4V2WA 5J09A 5FP4A 1VRH2 3VHPA 2EXHA 2FDKA 2G19A 5GZEA 2J1RA 1OLRA 1OT5A 3SCHA 1AR92 2DV9A 5GLWA 2K9ZA 2VNOA 5FRAA 1SBDA 3KWVA 1W6QA 2DCZA 2W91A 4UW5A 4WZCA 4KNCA 4AVSA 4LMFA 3AYAA 4C0BA 4K1ZA 3J8F1 5J37A 1UWWA 5LATA 5A7OA 4YVSA 2QQPA 2WSUA 2FBEA 5CEHA 2YU2A 3EBRA 3KMHA 4IEUA 2XJRA 2WZR2 2IXLA 5DZEA 4ASLA 5K0UB 1V9U1 5C8CB 1VAVA 3DPRA 5E1RA 4D3WA 5F5IA 3JBG3 5FKCA 3IBMA 2XDVA 3U11A 3C3VA 3GZAA 1AR83 5IUQA 5IK8A 3W21A 5JPNB 4AI9A 2IUWA 2VW2A 2UY9A 2RDSA 4M0HA 4NHXA 4Y4RA 1Y3TA 2RS33 2VG9A 4KGGA 3AC0A 4P9WA 4Q0VA 4XF9A 4QX2A 1C1FA 1Y9MA 4S2HA 4XMAA 5KHJA 3DV8A 1WW7A 3OUHA 5C4WA 1DGWX 4YM3A 2PLV1 3GDBA 1ZZBA 4P9LA 3ZYHA 4UBHA 5FY0A 3TEYA 2JE8A 3PHMA 3VN4A 3CEWA 4PDWC 5A3LA 1G9DA 1ULDA 2GC2A 3DF0A 2OW4A 1UAIA 2B9UA 2F6BA 4MXWA 1NA1C 2SLIA 5L9BA 5IW0A 3NNFA 2NN8A 3L9JT 2FDIA 2N7GA 3AB0A 3JD72 1LOAA 1MZ6A 3NW4A 5A7SA 4PLOA 2OS2A 3KVBA 4FBFA 3VBRA 1QXRA 5A6ZA 3CJIC 1ZRDA 2E32A 1XYNA 3BIEA 2VZSA 3GXUA 3O7OA 5JR2A 1US2A 4QQLA 1DHKB 2HWE3 3B9CA 1ND2A 4OHYA 2CU5A 4LO7A 5DZGA 2Y6HA 1NY72 1VBD1 3N9PA 5HXVA 3THTA 3E97A 2RG4A 1IS4A 5T5PA 3FE5A 1HV0A 4KU7A 2WNVA 1C8NA 1CAVA 1COV3 1F5FA 1UY0A 1PK6A 2VH9A 3GF6A 3JXSA 3MLKA 4N9IA 5DG2A 1W8WA 4YPJA 5FMDA 1W3XA 4ET7A 1AR73 3VBSA 3ZDVA 4XQ4A 1CD3G 1OA2A 5BYNA 4PIZA 1OQ1A 3CBNA 1GZ9A 2ZS6B 1HDKA 3OY8B 1CZTA 1FATA 1QIQA 3RNSA 4BWOA 5FMOL 5H9PA 1VIWB 3P1IA 2VZTA 2D97A 5JZGC 1QEXA 1NCQC 4QX1A 1RC6A 3DL3A 4YNIA 3UYJA 3B93A 2IXCA 2VC9A 5JSRA 3ALQA 1MZEA 3V65A 5A7WA 1FOD1 2R1BA 5FMCA 1V00A 2FCUA 2Y64A 4BLIA 3TEWA 4EE2A 1MS1A 1JUIA 2XLAA 4LE4A 4KWKA 1W2OA 5H9RA 5AC91 5ANNA 2HWD2 4O7XA 1O4ZA 3KVAA 4P9IA 3U1XA 3LD8A 1ZNPA 3AMPA 5FIXA 5FZ0A 4RR3B 1F35A 1D4M3 3N3HA 4DRRA 1ZRIA 1PGSA 2NZ9A 2VZRA 4JRAA 3D0SA 4HL0A 4I01A 2BGOA 3NKTA 2G9FA 1CPMA 1JZ8A 3TN92 1JU3A 2PHWA 2LTNA 4AEJA 3GNEA 3NAPB 1AL0G 4LA2A 3JB4C 1C28A 4XJZA 1VRH3 4LXLA 4YGBA 2E51A 2VCAA 2MPFA 4P14A 1G9CA 1TQ5A 1QOOA 4LORA 1BJQA 3IN9A 3M3OA 4LKFA 5IK5A 1KDMA 1U5ZA 2RR12 3WDUA 2AENA 4EYUA 1WCKA 2VOWA 5FZ3A 1SG3A 1XPWA 1OC1A 5IVBA 3MV01 4N43B 2PHFA 2XVLA 2DFBA 5ABJA 5KHIA 2C9KA 4W65A 1YXWA 4K20A 2G9ZA 3M8LA 1UY2A 1FPN3 4FOVA 3WLUA 3UKTA 3KQ4B 1UYPA 2WZR3 4IERA 4JHZA 4XURA 2FDGA 3JCIA 1AF9A 1LOCA 2DTYA 2WS91 3MF6A 2YROA 3OUIA 4LO4B 1GWLA 3WNOA 4HKLA 3B00A 2HBUA 2YUEA 1PNGA 4C91A 2R7EB 1NKGA 1TMF1 1W9SA 1GQGA 1U5XA 4U2AA 1WCSA 4CA9A 1RL3A 4CCCA 4F83A 1MEC1 3NNJA 2HWB3 5FYSA 2W2IA 1RB8G 5ANQA 5L19A 3PUQA 2H6CA 3GALA 3OBTA 4JGYA 3PTRB 3BPSA 2VVFA 2JDUA 1RHI2 4DIQA 2PAMA 1CJPA 2DTWA 2RV9A 3IDAA 4KQ7A 5HCFA 3RYRA 3ZFGA 4AFCA 2HH9A 4LA3A 4RQPB 2WO2A 4MOAA 3V0AB 1B35B 2YGLA 4R4XA 2JICA 5GLTA 5KHHA 2G4IA 3WG3A 2EAKA 1O6UA 2VTXJ 3JD73 2CTVA 1LHWA 2ZGOA 2GC0A 4GH4C 1WWYA 4HBNA 4XF1A 1YFYA 4PBPA 3SCGA 5L7OB 1X82A 4HN1A 2BGCA 2FMDA 2VZ1A 3RS6A 3FX3A 5FMBA 4EN0A 4YZ4A 3SEPA 1HW5A 4Q0UA 5F1RA 5I0UA 1T6BX 3TEXA 2E33A 5FOBB 1GOFA 4NPMA 2ILMA 1KS5A 5CBLA 2X05A 1D4VB 3V56A 4A7KA 3FFQA 2R073 2RS11 2ZEWA 3KGLA 1F15A 1W8FA 4BH9A 3CNAA 5EYXA 1BLZA 2JDAA 3B7MA 2YBPA 2J42A 4Q4Y1 4URAA 5BNQA 4CDUB 1R081 1NCRB 1UPSA 2RMU3 1QXPA 4FPYA 4NMIA 4XF3A 1OFNA 4HZFA 1W2TA 2WLPA 3MW3A 5C9AC 4OI4A 3MV11 1QF3A 4Q4X1 5J98B 3KF5A 3VBOB 1QJX2 2ZMLA 4AI8A 3HQRA 3BTXA 4CU9A 1OUXA 4RL7A 2OZ6A 3HOBA 5A3WA 3MFCA 4WM8B 3VZMA 5C3QA 5I0DA 3MF9A 1ASJ1 1JW6A 2VUAA 4Y1UA 4AR2A 3V0BB 2Z79A 1HN0A 1BBT1 4YRDA 5LEKA 4DB5A 1XNTA 1H8TB 5A7QA 1NQJA 1W6PB 2IFRA 3LAGA 3ZIXA 2HWD3 4CCOA 2OPWA 4CPBD 3E5XA 1GZTA 2Q0AA 4IL7A 5K7PA 2CGOA 3VBFB 5FZBA 3SHRA 1BMV1 1ENSA 2JG8C 3WHUA 3WF2A 5IVYA 1SFYA 4QMAA 3SH4A 4JDOA 2A73B 2XUMA 2IXKA 3AVSA 4LBQA 4C1XA 4GB32 2AZ5A 3POYA 5FY8A 2JWPA 2RM21 2J22A 2Y38A 4QQ2A 4IEOA 4FPEA 4JQTA 2JD9A 1CR7A 1Y4WA 5FYVA 5DUUA 4XBLA 3N9LA 2KA3A 1W05A 2RR13 4M0NA 1JYWA 1S0EA 3J7LA 1MS8A 5E8AA 5DQ0A 4EN6B 2ZPXA 4HPKB 5EYYA 3UNPA 2QQKA 1OKQA 5D8AC 3LFMA 5BNOC 4UXAA 1Y9QA 1OOPC 2OZJA 3I54A 5F32A 1WA6X 3ASIA 3VD4A 4J1XA 3ACGA 3MUZ1 4NR1A 5DUXA 1RUC2 4YVWA 2WJSA 1S2KA 1REEA 4JC1A 2GP5A 3H3LA 1OMIA 4NROA 1RUF1 2XLFA 4D7SA 5CFDA 3H7YA 4IDZA 1A8MA 2ZGPA 5IHRA 4NUBA 2E26A 1CX1A 3AXEA 5DG1A 2VULA 4YVSC 1JYCA 1YI9A 4QKFA 4N43A 1MQTB 3EB7A 3W20A 2JENA 3IPVB 1HN1A 2VM9A 3LSEA 3KV4A 1RHI3 3Q8FA 1UZWA 4BQWA 2ZGMA 3PVEA 1XNDA 2J1AA 2E7QA 3DPRC 3FHAA 5DZFA 2ZCWA 3O1PA 1K3IA 2GMEA 5DAWA 3LFIA 1NX9A 4DEVA 4AAPA 2YZ4A 3CU7A 1Q8VA 3WDVA 3Q8CA 4MX3A 1G7YA 4FO9A 1LESA 2VVDA 3Q9OA 4MGZE 5FXVA 3DYMA 5J96B 4JHTA 3R0RA 4R9BA 2CV6A 1FMD2 5EP9A 5C4WC 4XMIA 4LQRA 5FXZA 1YQ8A 2XWBB 1FYUA 2OXBA 1EV12 2P5BA 3LEKA 4QU1A 4XFFA 4Y20B 4WM7B 3I4IA 3AKSA 2ZGUA 2EIGA 1IQDC 4LULA 5FWEA 2ARXA 1AYM2 1H2NA 2ZHKA 3AKTA 4N9HA 5JWPA 2QBXA 3RZJA 3AKPA 3AZZA 4RGAA 3MIHA 4XTPA 2O0OA 4QPIB 2JG9B 2Y34A 4LBNA 4IUGA 5SV8A 4EV0A 5KHGA 3HT1A 3RZMA 2HBTA 1O7FA 5GLUA 4LBMA 1YIFA 3KSCA 3K3OA 4W8JA 4LBLA 4EWDA 4BCUA 3VL9A 2BYVE 2DUPA 1RINA 2YPDA 1GYKA 1OD5A 2JDZA 2PELA 3NV3A 4JVAA 3VBRC 2R0HA 3PUIA 3OJBA 5F3IA 4H2AA 2EIDA 1JZ7A 2A6YA 3AM2A 3WQBA 1U5YA 5ACA2 2HEYF 2FCVA 4YLZA 5HI0A 1QJX3 1ND2C 3V64A 2WNEA 3IDEA 5EPAA 3N7LA 5KXBA 4QGMA 4TN7A 3HD8B 4Y1VA 4R8HA 1VBC1 5IFPA 1XOYA 2WNVC 2WZ8A 4R52A 4DNYA 3DUIA 4Q8LA 3VBHC 1PK6C 4BQYA 1LGBA 3UKVA 3VBSC 3N36A 3HN1A 4U36A 1Z7S2 1DU3D 3B94A 4WBBA 2VZPA 3WD5A 1RITA 4ZS2A 2D3SA 3LA7A 4BLJA 3BN6A 1UO9A 1VBA1 3LOBA 2IZWA 1WCDJ 4XC9A 5JXIA 2VECA 4CDQB 3ST7A 1RUD1 1H2MA 4XF0A 3UT0A 2A70A 3KV5A 2W1UA 1J3PA 1J58A 1Y9GA 1BK0A 3ZFEB 5K9YA 4AGVA 3U78A 2JE7A 4DO0A 3CKHA 3VD3A 4GB33 3R4DB 1R64A 2B46X 3HR9A 1DGRN 3WNKA 1XE7A 2HWC2 4RS5A 1CAUA 5H9QA 5A3NA 1RUH1 1OSGA 2X5IA 4IV3A 5A3OA 4FCAA 4LHKA 1Y7BA 3KV6A 4L9BA 2VGDA 4EZHA 2UU8A 1DQ2A 1G9BA 1YRZA 2AREA 4DFSA 1MZ5A 2GH2A 1VLNA 4B4RA 4Z8BA 5HXMA 2J1TA 3U37A 2E53A 2QQLA 2VCBA 2AH2A 1CAWA 2KM2A 2UYBA 3VDAA 1PMIA 3FFZA 3QD6A 1RUG1 4Q4W2 3WV6A 2LUWA 3WNXA 4ZU7A 5BV6A 4LJHA 1RUC3 1L3JA 4QGNA 4UFLA 1I6XA 5F6KA 5FREA 2Y6FA 4BIOA 3AJYA 3ZN4A 2IXIA 3AFKA 1A78A 3IIAA 5FZEA 3GZTB 2HJIA 2VOVA 2VQTA 3T4HB 1GR3A 1WCUA 5T5JA 1EAH2 4JZRA 4COWA 5ABJC 1BQPA 3O1SA 3BGAA 3U14A 2RDQA 3ZSJA 1HB4A 2E63A 2Q1MA 4FPHA 4LHNA 2OT7A 4QXCA 2BEOA 5JIAA 1QJEA 3HPNA 3QH7A 4A42A 2YBSA 3GCXA 3OGRA 4QXKA 4A41A 1WKYA 4QPGB 3VDCA 4HVQA 2QDRA 1QJY1 4XCAA 1AR62 3ZXFA 4ZXKA 3ON7A 3OCPA 1W9FA 3NNLA 4JV4A 1JYIA 4XBNA 2Z5WA 1S0CA 3Q8EA 4AFDA 1HB3A 4LOSA 2YPJA 2ORZA 3MW2A 4NHMA 1WMEA 2ORXA 3BCWA 1XSQA 4HETA 4IEZA 4L8QA 1RUI2 3SQOA 2DUOA 2R32A 4CEYA 5C3SA 4JGYC 1FMD3 3ZIWA 3ZXJA 1SPPB 4DINB 5JOZA 3AMNA 1JZ3A 4INDA 3FHQA 2IVIB 3ILRA 4KGQA 1EV13 3G7DA 4KG0A 3E5UA 3H9AA 3ZFGC 2DVGA 3QACA 1SZBA 2F4LA 2IXJA 3VDDA 2NQYA 1AYM3 4YGCA 1CVNA 4OVEA 4B4PA 4GZ9A 3K3NA 4D7TA 4TZDA 3IMNA 4ITCA 2QZ2A 3LE0A 2H6BA 3ILFA 1VJ2A 2DDUA 2VNRA 2YC0A 3OGJA 5DMYA 1O5LA 2WINB 4XFHA 3WW1A 1TG7A 2DUQA 4KL1A 2D98A 1GWMA 5C70A 5GALA 5JI9A 5LWBA 3OYWB 2P3JA 2ZAHA 2NM1A 4LIVA 5BNNB 2WFF3 1YI7A 3EMRA 3POGA 1AL22 5ACA3 4FTEA 3ROUA 1LB2A 3ACFA 1L7LA 2C24A 2DCJA 2WZPP 3RWKX 4B7EA 1SLTA 5JMCA 5LK7B 5IFTA 2R042 3GBFA 3ECQA 3JBG1 3AXDA 2QTWB 2R0FA 2VMIA 2GNTA 4MADA 4UI9L 4FAGA 1AR81 1V6OA 1UQXA 1POV0 3O5SA 5FQ0B 1SFPA 4JGZB 4LOTA 5FPAA 4QX0A 1DG6A 2R1DA 1T2XA 1PO22 3N9QA 4OUMA 3B02A 1UZ0A 2RS31 1EY2A 4S2FA 2GC3A 3MLJA 1AXZA 3K2OA 4AQSA 4CE8A 5LRSA 2GNMA 3J4UH 1Z7S3 2VOKA 4ONUA 3O1TA 3RZGA 1VAKA 2GDFA 1S0IA 2V73A 4NN0A 5D21A 3T2QA 4E4DX 4MGQA 4FTBA 2VZUA 3O0WA 4XHBA 4HSJA 3WW4A 2WWJA 2XJQA 1WLCA 4MGIE 2LALA 2NYYA 3KF3A 4XJ8A 3NV2A 2ARBA 2ATFA 5FZ9A 1VBE1 1IHMA 5A3TA 1XNCA 2C4XA 1NZCA 2XJVA 2XJTA 1LHOA 2WNOA 2GMPA 2EXKA 2XONA 3RPQA 2HWC3 4YGEA 1DDLA 3N35A 4P02B 1MS0A 1RIRA 3NNGA 1UKGA 2MEV2 4IV1B 1RVF2 1YUDA 4MYEA 4P5HA 4YZ1A 4YG0A 4N53B 2HWE1 1HB2A 2W08A 1JI6A 3M3EA 2Y26A 2GH8A 3LKJA 5FLIA 3VBHA 5A32B 1I9RA 2UYAA 3R05A 4UT5A 1ULFA 2ZZJA 5CG9A 4IE0A 4BPZA 1DZRA 3OOXA 1COV1 4D6SA 2X8KA 3WNNA 3I2FA 1J3QA 1OLQA 2W1QA 1AR71 3ZDSA 5FZLA 1V0AA 1NE4A 3PLQA 3POEA 3N9MA 4R9CA 2J1SA 1VRBA 2CL2A 2ZHNA 1N1SA 3RJRA 3A0KA 5FMOS 1PIV3 1JZ5A 3NJZA 5T5LA 5LY1A 2Q5TA 4PBOA 1X8EA 4HMZA 2E31A 4RSUA 1RXFA 4S2DA 1H9WA 5EWSA 5L9RA 5A6XA 4BXSV 4CDXA 1EAH3 3E5QA 2OUHA 1RUE2 4LITA 4AEMA 5K8SA 5JXGA 1V6IA 2WN2A 3KV9A 2PTMA 2PHLA 3D5OA 1RYYA 2XOMA 2IXHA 2RJKA 4YVWC 3T2OA 4BQ3A 4UF0A 1UYYA 4YG6A 2AC1A 4X6RB 1AR63 2FD8A 5CFDC 1STMA 3FLPA 4FP2A 2F4PA 3ETPA 3EXUA 4XUNA 2QE3A 3DYOA 2XWJB 5A1FA 3ZXEA 4M3CE 4LEJA 1IS5A 3CJXA 4N43C 3N7JA 4Q1PA 2XJUA 4F8AA 1XRUA 1I3HA 3HNYM 3KHCA 5IK7A 2WNUB 1FV2A 2R6QA 1MS5A 3H8UA 4MV2A 1CJDA 4DS0A 2P17A 5EV7A 3LEGA 2A3YA 1LGNA 3ACHA 1CAXA 5AFEA 5FR3A 1RJ8A 1MS9A 1OQDA 1VRH1 3B3QE 4OI0A 5FKBA 3WUCA 1ZBA2 2XUEA 4XJWA 2W52A 3RZZA 1AYN2 1GP6A 5JR7B 2WA3A 4ZXEA 1ENRA 2C9AA 1F9KA 2VVEA 3AZYA 4AQTA 4C0HA 2GNDA 4AEDA 2JDMA 2A75A 3GJBA 4LBJA 5JXHA 3PVBB 4AFMA 3GHNA 1BK1A 4XIOA 3POIA 4CDWA 1H9PA 1FPN1 2WN3A 5I8SA 4FFHA 2PYTA 2ZGSA 3O14A 2BFUS 3DKWA 1S0BA 2WZR1 5F3EA 1AL23 3HN3A 5C3RA 5DAXA 4AE2A 4YFWA 5BNPB 2R043 2PHTA 3ZFFA 5JVVA 3ZYGA 2A3XA 3NJXA 3T0DA 4CSWA 1QU0A 4H14A 1HQWA 2GU9A 4G9SB 5FWJA 1PO23 3INAA 3H3UA 1PVC2 1SCSA 2HWB1 2XBO2 1PMJX 3H50A 3I8TA 4MUVA 2Z42A 4OHWA 5FAXA 2JXAA 4CU6A 3J26N 4HVRA 3T3YA 4AWDA 2DURA 1DFQA 3BPZA 3WCSA 3OYWA 3PNAA 3G6JB 1GP5A 2RS52 4IE7A 1YC61 1ND3B 1KFXL 1ZVFA 3PIJA 3SC7X 1SLLA 5A33B 2W39A 1QHDA 2K46A 5FZ8A 4IGOA 2ZJCA 1FXZA 3URFA 3J8F2 4CP1A 4LHSA 3VLBB 3TEZA 5LW9A 5IATA 4EN9B 3O0XA 3WG4A 3USUB 5FO7B 1BYHA 3O0VA 5FQ0A 5FZOB 1NXD1 1T6GC 1Q8PA 4AGGA 3JD71 5B4XA 2JEMA 1E5IA 1GOGA 4XYXA 1BZWA 1V9U2 4E2GA 3WT3A 3WDYA 1YHFA 2ZTNA 4E2QA 3I59B 2MEV3 1RVF3 3KCXA 4FPKA 5CADA 4MGSA 1FNZA 3PJQA 3H7JA 1GOHA 4GWJA 1O3SA 1WMFA 1H30A 4FPGA 3VZKA 1NYWA 3S6PA 1UMHA 2FHRA 5IAVA 2R071 4FPCA 1NY71 2L9LA 3F2ZA 3TNPB 3K4DA 4YZ3A 2PLV2 5FZKA 2RHPA 5A3MA 1LAJA 2P6HA 4RS5C 3DXUA 4BOWA 3C8XA 2RMU1 2WYFA 4Q0QA 4AAXA 1M06G 3A0NA 2X5IC 4IV3C 3VBUA 4R9AA 5CVRA 4E4SA 1HXS2 5F5QA 4ASMB 3MZHA 2XQRA 1XJAA 1XC6A 3M2MA 3OD0A 4M4PA 1GZWA 3OBZA 5FPVA 3IM0A 4B1MA 2W87A 4FQ4A 3ZLIA 2D43A 3H8RA 2YB7A 2YMZA 3IDBB 4GMP0 2HEWF 3KHBA 4AQ6A 4HSLA 3Q8BA 5FFOC 4A4AA 4DXSA 3SMHA 3WX5A 5M0TA 4XTMA 2JECA 4FVVA 4M01A 4M3CF 2JB8A 2GAUA 4D69A 2VW1A 2LM3A 1W99A 1JYTA 5KBFA 4FOQA 3WR0A 1E57A 2I45A 3OTFA 1I5PA 2VXRA 2OYZA 3T08A 1PVXA 4P08A 4A7ZA 1Q5OA 1JH5A 1HLCA 1OQEA 2HWD1 1U5IA 2CYFA 3M3CA 2QQOA 4BZ4A 4LBOA 4JKKA 4NHKA 2VR4A 4KG8A 1H4HA 3WDTA 1UZVA 4W4ZA 4XZPA 2A7AA 3WF3A 3BALA 2D5FA 3I7DA 2P34A 2Q8OA 1H1MA 5LK5A 2PHDA 4DUXA 5F8PA 2P6CA 1YIPA 2WZEA 2RE9A 4NRQA 2R30A 2YXSA 4UWDA 1W2AX 2JJ6A 2VU9A 3ES4A 4PJYA 5E6HA 1ZBA3 2XGXA 4A3XA 2VBPA 1DP0A 4DY3A 1AYN3 4L97A 3GCWA 4RFRB 4GMP3 4CCDA 2RR11 2GMMA 4H3WA 4IGPA 5I93A 4NOTA 4WVVA 4K3UA 5G05L 1CN1A 3SISA 2Q1ZB 4CP9B 4CEYC 5L73A 1FX5A 1AR93 5T50A 4MO3M 4QGLA 1XSRA 4IEQA 5J36A 2ZGTA 1NAEA 4Y1ZA 1GANA 5B2GB 5HPOA 5F37A 2EVXA 5AC92 1K5MB 1OLMA 2E6VA 3ORJA 2EICA 3VDDC 3VUOA 2BP6A 3WINE 5CFCA 2ZZQA 4QPYA 1LR5A 1KJRA 2Q30A 2VY0A 2VCCA 1FT9A 2VOXA 3CL1A 5DXDA 2G1MA 1NZIA 2BFUL 3T30A 3ZVXA 3I97A 3VD9A 1S0JA 1PVC3 1W0OA 5FPZA 2XBO3 4N90A 3SH5A 5FP8A 3WSOA 1VBB1 1XNBA 5E88A 1N3QA 2DCKA 4CP0A 1RHI1 2W9XA 4FQZA 1TEIA 2EF6A 3I2OA 3VDBA 3I49A 2RS53 5F2WA 2VE1A 5T52A 1AX1A 3WDWA 1PZ9A 4QPWA 5LEJA 3HAGA 3J8F3 5HCAA 1ST8A 5BNPA 4CEWB 1NOVA 3FBYA 5K0UA 2XL9A 3AL5A 5C8CA 2WAAA 3K46A 2J1EA 4D6RA 1SFNA 1W0PA 4E2SA 5CZKA 5KXCA 2BWAA 4COUA 3K77A 2P2KA 2Y6JA 2HYXA 3RI9A 3I3QA 5FZAA 3M3IA 5TSWA 1JXNA 4OHZA 3SCFA 5F9TA 3PTYA 2ZMKA 4QM9A 2WL1A 4NWWA 2ZX0A 1AUYA 3RRDA 1R092 2XKPA 3PMSA 4O9GA 4KI5M 5APAA 3IWZA 5A6QA 4XUTA 1UL9A 2A71A 4GAZA 3O1RA 5K4LA 3SLIA 4MVTA 3I3BA 2I2SA 4X8PA 2VUDA 2QQWA 1NLQA 2PQQA 1C5IA 4XFGA 2PLV3 3KQRA 5DABA 1TME2 5IVCA 2NMNA 5A7PA 3WEZA 3ILNA 4BHPA 5KC6A 4M3CB 1HXS3 2DVDA 3THPA 3ZX7A 4DMIA 3ZYFA 1OURA 1XYOA 4YW5A 3I59A 4AGRA 1TZOA 1QJX1 1N1YA 3LIGA 4LUMA 1AJOA 3RFRA 3NQHA 4EWEA 2YGMA 1URXA 1D0HA 2BQPA 4ORFA 4AQ2A 4Y5Z0 2YG0A 5EQUA 3OGGA 5FYYA 4BQ4A 1VB4A 4JDNA 2W92A 4B3NA 5JOXA 5EJ3A 1OVPA 2B9VA 1BEV1 3M1HA 4Z07A 3EQEA 1UOFA 1O91A 4PDWB 1UPIA 2P3YA 3O1UA 1JOJA 3QBQA 1Q8QA 4MH0E 2A5ZA 1UU4A 1JUHA 4Y24A 1N3PA 5FYZA 3VZJA 1NA1B 1X50A 1Q8SA 1RUJ2 1RMU2 4QB6A 1PZ7A 1QNYA 1QQP2 4YYOA 4CDXC 4NO4A 5AVPA 3WVJA 4FAHA 3CJIB 3OY8A 5FZCA 3S30A 4GB31 3ZN6B 4Z92B 2TUNA 2HLEA 2WAOA 4HG6B 3OGSA 4AHYA 2PFWA 3K75B 2D93A 1ZYBA 3AZWA 1J84A 2RDRA 5CISA 2PHUA 3MIEA 4DEQA 1FNYA 4KBZA 1W6NB 3TN93 2QZ3A 4BQ1A 4IEPA 4E4ZA 4OUSA 2B7YA 2UWCA 4QB1A 4W6XA 3B69A 4RHV2 5FCCA 4TLGA 4MGTA 3LF7A 3AZXA 4P9YA 5CG8A 2PAEA 3BYWA 4LLOA 3NRUA 4FXGB 1LJ7A 2ZX4A 4CPBA 1YFWA 5FJHA 4FPOB 1J1TA 2QQIA 2DBNA 4WVMB 4BQ5A 5CA6A 4BDVB 3USSA 4OCTA 4UAPA 1XYPA 3OPWA 1YQ2A 4QQPA 4RR3A 2W3JA 3OG2A 4OLLA 4L0PA 5CYYA 5AC93 4ES8A 5FZ6A 4AI1A 1RUC1 2BWCA 1CESA 1NCQB 3FC0A 2YC2A 1OI6A 1W90A 3KB5A 2BDRA 1IS6A 2WWUA 1GWKA 4AEDC 4B1LA 3HQUA 4BK4A 1KXGA 4OYUA 2ZEXA 3NAPA 1FI2A 4GKXA 2RM22 4JCKA 1DGRA 2FQPA 2RJ2A 4PI2A 1LU2A 4Q0PA 4COVA 4MHUA 4CDWC 4CP9A 4XXPA 2BNOA 5JMOA 4XUQA 2Z69A 5C5UA 1NLSA 2RDNA 4XIKA 1MPXA 4AW7A 2J1VA 2QCSB 4CCMA 1W8ZA 2ET1A
chains in the Genus database with same CATH topology
3PVNA 5KWRA 3ZFFC 3UV9A 3VKOA 1HIXA 2ZBJA 3KCCA 1DF0A 1N1VA 2PHRA 2QVSB 4HT1T 3MFAA 1YFXA 4ZU5A 1SBFA 4HANA 1FMD1 1QY4A 1Q56A 3AMHA 1ZBE2 2QKDA 1EV11 1U12A 1YJLA 2HYKA 4M00A 4S2GA 2YV8A 2P37A 3EJKA 1R093 1AYM1 4MGKE 1ZRFA 4Q4V2 2D6OX 1QOSA 5AFBA 1O4YA 1NG0A 1SLIA 3ZYRA 5JPMB 1W6MB 3S7EA 2WQZC 2B5HA 1AXYA 2E7TA 2R061 2D3PA 4RQPA 1YLLA 1PGW1 1TME3 1KRIA 3AYCA 3V0AA 1YO8A 1B35A 1KDKA 3UJOA 2QDNA 2WFF1 5ACA1 1Y43B 4NHLA 4YM2A 3EHKA 3NL1A 3PVOA 5L7OA 4B29A 3S7IA 3B01A 1EYBA 4F7ZA 1LHVA 3KLSA 4WVWA 3LSDA 3FLRA 5I91A 3ZYJB 3ZMNA 1WLWA 1H1AA 1QXJA 1Z7S1 3VBUC 1GNZA 3FLTA 3JUUA 3POWA 1MS4A 2VPVA 3DN7A 3H1MA 1V6JA 1MS3A 1H2LA 4CDUA 3H3ZA 1NCRA 1RUJ3 1RMU3 4B7KA 4GH4B 1QQP3 2OIIA 2D6LX 1C5HA 3VBOA 2DYCA 1QDCA 4BIFA 4CP2A 4OFGA 4Q2FA 2HWC1 4WM8A 1PM7A 1IQAA 3KCYA 2H0BA 1GICA 1R1A1 5KXDA 3V0BA 4FSJA 4WV8A 4RHV3 1H8TA 2VQ0A 2I74A 1ALYA 1W6PA 1WW4A 5FBZA 1XU2A 5C9AB 2ZGRA 3P3PA 2W68A 3VBFA 4URTA 4LO6B 4XEZA 1DIWA 2GN7A 4WVZA 3FUQA 4G4FA 1M4WA 1PIV1 3C2UA 1QJU2 2FZ2A 5T54A 3RJ2X 4D94A 2Y0OA 4SLIA 4KWLA 1V6MA 2RM23 1WMDA 3HIFA 2X29A 2BBVA 1GKBA 3VHRA 2ZOEB 3WP6A 4Y26A 4ZKTB 1DQ1A 1LRHA 4K6BA 5CFCC 2MHFA 4HPKA 4GWMA 4H55A 1JHNA 2JG8B 2WA4A 5IUQA 2NLRA 3HWJA 5C33A 2GALA 3WY6A 2A3WA 1O5UA 3TAYA 3KT1A 4IETA 4Y22B 3RYKA 4FT8A 1HRV2 1NE6A 1RUG2 2O8OA 3ZXDA 3BU7A 5LRRA 3JB8A 1ZBE3 4HVOA 5AVAA 1LENA 1DLLA 2PAKA 1LODA 3AKQA 5JSOA 2GZWA 1CQ9A 2XG3A 1H2KA 1MQTA 5GJ6A 1W6OB 3IPVA 4Q4V3 5D8AB 5BNPC 2WWSA 3ES1A 4J1WA 5BNOB 5DUVA 2A6ZA 3M3QA 5K0UC 5C8CC 4OI1A 3KS7A 4K1YA 4XXAA 4HK9A 2ZGQA 3R4SA 3TOJA 3U4XA 4OULA 4CZSA 3GHMA 1IPJA 1HRI2 4LLFA 2VMGA 1DZTA 1W6QB 4LR4A 1AL21 1UX6A 4XQWA 3TWIA 4AG4A 4NPRA 2R041 2CAVA 3POSA 5T3NA 3KD4A 4Y20A 3PMEA 4R9DA 4WM7A 1PO21 3WQ1A 2ZMNA 1Q3EA 2P3KA 1LU1A 3DPRB 4QPIA 1OPOA 2JG9A 1CPNA 3KT7A 3RDIA 2DVBA 3T2TA 2PN5A 1DQ5A 1SLAA 4PLMA 4Y4YA 1QJZA 2QNKA 4ISQA 5C4WB 4GQ7A 4QQOA 5GZFA 2YY1A 4QX5A 1X33A 2D44A 3VL8A 2XHKA 1VR3A 4CTEA 1R1ZA 4QD2A 1WW5A 4L92A 3E6BA 4GXLA 2MEV1 1PO12 1RVF1 4MXWB 1AR82 1JTZX 4UW3A 5CIRA 4DXZA 3QH6A 1GSLA 2DU1A 3VBRB 3SITA 4EWAA 4XE9A 2EALA 1KFUL 3WW3A 4AFAA 1POV3 4XFIA 1C57A 4CDQA 2JE9A 3M7AA 5EXOA 5IT6A 1ND2B 4MSVA 3ZFEA 4W6WA 4UW6A 4BA6A 1YWKA 5DDJ2 4YW4A 4Q4W3 1C8M2 2WNVB 1CAVB 1QJU3 3VBHB 1PK6B 2YYOA 1VBE2 3ZMOA 3VBSB 3P3NA 2ZA9A 3LCPA 3RYPA 1PGL1 4Q26A 2ZKNA 4RR3C 3AKRA 2A6XA 1ZA4A 3NKGA 5JAXA 2E9QA 1QWRA 2CY6A 1WBLA 1ZZCA 1GBGA 3NAPC 4DY5A 1O3RA 4IESA 3L2HA 1AR72 1HRV3 1RUG3 4FOYA 1WUVA 2Z2SB 3ZSEA 1WLTA 1D4M1 1QGLA 3MI8A 4OZXA 1RUI3 2CWMA 2HWF2 4K7JA 4HN0A 1D0GA 4JDMA 5T55A 2EA7A 1ZBA1 1YCIA 5DUWA 1AYN1 1U0AA 4GMP1 3E6DA 1HKDA 1A3KA 1WA4A 4EN7B 1ULCA 1UZYA 4QPGA 1F5JA 2WT0A 1Z78A 1B09A 1AJKA 1AR91 5KHKA 4JRLA 2DCTA 3VKFC 3IT8A 4HKOA 1VP6A 3VV1A 4I30A 1PNFA 1IZ3A 1HRI3 2AGSA 4JAAA 2ZGNA 4K21A 1CGPA 1ZX5A 5FO9B 5ABJB 3NVCA 5H9SA 1LOEA 1GFF2 5CAZA 2ENRA 2BPA2 1IKPA 3U07A 1OA4A 2K2SA 4O9EA 4RQPC 1HQNA 2XBO1 1B35C 2EAAA 4FPFA 3VKLA 2BW8A 3BB6A 2RS51 5L7OC 1S0GA 1UKRA 1AZDA 3BOWA 4FTSA 1GQHA 1V6NA 4K8FA 4JGYB 1ZZ9A 1WD4A 4QU2A 5BNNA 1XQNA 1FPN2 4P9GA 3ZFGB 1EPWA 4FPJA 1DGWA 4K40A 1BVVA 4JGZA 3BOPA 3GBGA 3MGUA 1RGSA 1PO13 1CX4A 2VUJA 3AYEA 3MW4A 4CDUC 1NCRC 1Z0HA 2UY8A 1YNAA 5J48A 3QLQA 1G9FA 2HWB2 1UN1A 3OF1A 4PF5A 3MICA 1J3RA 1O4TA 3UK9A 4XJ9A 1REDA 3VBOC 4N7UA 3RSJA 4I0BA 3ELNA 4NVPA 4WM8C 5I0RA 1HXS1 3LWCA 4ISRA 4IQPA 2ES3A 5DDJ3 1C8M3 4KU8A 4GA9A 1H8TC 1LULA 4KWJA 3ZXKA 2B42B 1VBE3 3QOPA 5I8TA 2NPIA 4IV1A 2D6NA 2V09A 4N53A 3FZ3A 2JD4A 3NO8A 3VBFC 1ZRRA 4GALA 1YYNA 5A32A 5CB7A 1W39A 1RUE3 4FP3A 3PJYA 5CNAA 1TE1B 1I1EA 1G86A 1F2NA 2R072 3CO2A 4K9SA 1BXHA 3ENRA 3VKNA 4PIYA 4I3PA 3W59A 1C4RA 3WCRA 4A7YA 1VBD2 3IDCB 2RMU2 3WOGA 3ZYPA 3FUOA 1ZREA 5KXEA 2WFPA 1H8VA 1MACA 2AYHA 1RTVA 4OI2A 1YFUA 1LGCA 2HWF3 1VALA 2DU0A 3WQ0A 4SBVA 2C5DA 4W6YA 2EXJA 4I09A 2GC1A 1F8VA 1ZM1A 2BUKA 3TN91 4LBQB 2DVFA 5I0SA 3O12A 3AZVA 2XL7A 2ERFA 2XKOA 3ZXLA 1N47A 4IEVA 4AVAA 4YARA 1REFA 1FOD2 3MYXA 4XF4A 4MLOA 4DOUA 5C6CA 2DF7A 4XOGA 2OVUA 4TSVA 2B8MA 1KS4A 5JOYA 1S0FA 3RMYA 1MQTC 2WNUA 5FLJA 4P9JA 5JIUA 1IS3A 2B45X 5GLVA 2D6PA 2ZACA 3KGZA 5JOWA 4YVWB 3R6SA 3NWKA 3LZZA 1ZZ7A 3MIFA 2NP0A 1F31A 3AX4A 4TYSA 5CFDB 5BPXA 3D6EA 1DGLA 1V70A 4C90A 3ZSKA 3FMGA 5BXXA 1J1LA 4Q1RA 1Q8OA 3IKWA 4A2UA 2D6MA 2PHXA 2WT1A 4R4ZA 4WM7C 3VHNA 2ZAAA 1A6CA 5L36A 1G6NA 1N1TA 4GULA 2ZGKA 2O1QA 1HQLA 2D40A 1ULEA 3H1WA 2C1FA 2E7AA 4QPIC 4RGGA 2JG9C 3WG2A 4COYA 3SXWA 1DYPA 2O8QA 1LHUA 1R091 1V9U3 4AVBA 1RUOA 3W58A 2BTVC 2VMHA 2WC2A 4AF9A 2WS92 1FAYA 2WSVA 1SCRA 5JCTA 5FDBA 1TMF2 4IEXA 5FPXA 1VBB2 3NV1A 1MEC2 1ND3A 5A33A 1BCXA 4AK3A 3B5LB 1SQ4A 1TME1 1ENQA 2ZGLA 2ZX2A 2X53S 3WG1A 5I8YA 5IK4A 4AFBA 4AHZA 1KD7A 2VQAA 3USUA 3TNQA 3AYDA 1SEFA 2WLQA 4YM0A 3JQWA 3MIGA 3N7MA 2R49A 5J7MA 3D82A 4ES9A 3EO6A 3X29B 4Z1VA 3WUDA 1D2QA 4CDQC 2W0XA 3HT2A 3ZFEC 1GNHA 4JQRA 3RWNA 1WD3A 1DQ6A 5BUVA 3H0OA 1G8WA 1MZFA 4Q29A 2OPKA 1RUJ1 1RMU1 4I2OA 5CU1A 5EFUA 1I5ZA 1QQP1 1UU6A 3BIWE 5FO8B 2RS12 4MGYE 1VBD3 3WDXA 1ZZ6A 2TBVA 3ME2A 1LCLA 4FXKB 4YFZA 5C8WA 1SBEA 4IEYA 4MXVA 3WHTA 4Q4Y2 1N3OA 1R082 4E9KA 4G3YC 1VAMA 4V1PA 4B8EA 1KQRA 4BMBA 1OPMA 2YDEA 1OA3A 1SDWA 1QKQA 2ZKLA 4Q4X2 1IPKA 2XVKA 4LBQD 4X6QB 4RHV1 2D3RA 1UCXA 4RS5B 5GZGA 1CAUB 1BEV2 2VW0A 1UMZA 4FOWA 1ASJ2 3BODA 2X5IB 2AR6A 4IV3B 1BBT2 2Y0IA 1NLRA 1FOD3 2A6WA 3OD4A 1MVEA 5T5OA 3ZYIB 1WBFA 1ENXA 3TYJA 4TWTA 1CAWB 1KJLA 3NV4A 1S55A 5JZGB 1IOAA 4QPGC 1ZRCA 1OFSA 1BMV2 3A4UA 1QH7A 4AI2A 2Q4SA 2G9GA 2H0VA 3T1LA 1G9AA 1EP0A 2JKBA 5GZDA 4OHVA 3HMYA 3WXPA 1NXMA 2BVVA 1AXKA 1XNKA 3ZSMA 4AVVA 1LOGA 3LB9A 3M4FA 2KXLA 2VNGA 2YHJA 1K5MA 4CYDA 5FOJB 3LA2A 4FPLA 1DQ0A 4UW4A 2GN3A 3WQ7A 2WKKA 1KITA 3MPPG 4BM8A 1ZBE1 1UIKA 4L99A 1LOBA 2FZ1A 5JLVA 3VZLA 3KT4A 3TRSB 4I3GA 4YW2A 4CEYB 2WS93 1RUF2 4Q4V1 1MR5A 5BNNC 1XE8A 4RFT0 1TMF3 4P9XA 2P3IA 1VBB3 3MIBA 4LO8A 1UW8A 1MEC3 2ET7A 2IWGB 3VDDB 2DVAA 1UF2C 2HKXA 2R16A 4KH9A 2UURA 4JGZC 3OBRA 4CEWA 1QDOA 1LOFA 2D5HA 2D6KA 4I0WB 4PIXA 2CWSA 3SH3A 4AI0A 4Z2WA 2GSYA 3TBDA 1YJKA 4LBKA 4PCRA 1HX6A 1FV3A 1LEDA 2QUOA 1DQ4A 1JBCA 4DZGA 2XJPA 1AVBA 1LHNA 1UU5A 1XU1A 4XHXA 4XDQA 2WIIB 3ZXGA 3HBZA 2R062 4IV1C 3AP5A 1PGW2 3J9SA 2RS13 4M3CA 3ACLA 4PQ9A 4N53C 3RQ0A 4Q4Y3 4XETA 2BVBA 4BE3A 2WFF2 1R083 2ETEA 4DQAA 3LGRA 4IXLA 5J3UA 3RMXA 4I02A 2EXIA 4J6GA 1UZZA 4Q27A 3APBA 3FBMA 4Q4X3 4AHXA 2CAUA 1SLBA 4YSFA 4PDWA 1BEV3 3L2YA 1VBC2 4IEWA 4LTAA 3JZVA 4HKWA 1ASJ3 3VHOA 3U0ZA 1POV1 4L2NA 1NA1A 1BBT3 4LO5B 3TB0A 3SNMA 4KBBA 5SV5A 2ZABA 3CJIA 3WP4A 3ZN6A 4Q4W1 1VBA2 4UBGA 5GKAC 1QJU1 2JX9A 3AP6A 3MDPA 2CGNA 3D0JA 1C3HA 5FTTC 1RUD2 3JU9A 5GLZA 4HFSA 1XXNA 2DWRA 1V6LA 1W6NA 4D7YA 4QM8A 3FHIB 3FJSA 4MZUA 4YGDA 2XPJA 1DYKA 1R1A2 1TNFA 1EAH1 3JQXA 1BKZA 2XVGA 1RUH2 1MVQA 4EJRA 2TEPA 1X8MA 4CDXB 2WNUC 4XJAA 4PLNA 4WVMA 2GNBA 3AJZA 3RI8A 4XW3A 1LTEA 2QFEA 4L11A 1AR61 5JZGA 4Q8KA 4META 1HRV1 1NCQA 4YZ2A 4XPVA 5BY5A 5GZCA 4AVCA 1PIV2 1X7NA 3I2DA 1RUI1 5E89A 3S0MA 2D7FA 4LE3A 4LUKA 1APNA 1NQDA 4WZFA 4EN8B 3GZUC 1RUF3 1O3TA 2C0ZA 1QNWA 3WP5A 4AYUA 4E27A 1DBNA 1CIWA 4YM1A 1CAXB 3MLLA 5JSPA 1UIJA 3VZNA 1IGOA 3ZO0B 1OOPB 1HRI1 4JTOA 4EROA 4BMEA 1H1IA 4AEDB 1WW6A 4ATFA 1S0DA 1QJY2 2V5YA 1HV1A 3AMMA 4H7MA 4F3JA 4X8NA 4ZU4A 2OUJA 4CDWB 1ONAA 3W9AA 1JN2P 2XB6C 1ND3C 1EPZA 4YVSB 3LOIA 1LECA 1GLHA 3AP4A 4Y1XA 4GWNA 3HQXA 3ZFFB 4AXOA 3QCWA 1LEMA 3N4MA 2SBAA 4GKYA 1W6MA 4LNVA 2B39A 1OHFA 3GBWA 2I07B 2XLGA 4N7IA 4XJUA 3T1MA 4COZA 5FLHA 2R063 3WW2A 2ZHMA 3KZ4C 2WT2A 3NSTA 2MNGA 2AUYA 2TNFA 4XFAA 2ZHLA 4JTNA 4AEKA 4QT6A 1PO11 3ZPYA 2DFCA 1QOTA 4YG3A 5HBAA 4XBQA 4NWVA 4OHXA 1ZZ8A 2IFWA 3JBG2 4XFCA 3LA3A 1AX0A 1H0BA 1PZ8A 1VBC3 3VGIA 4Z82A 3KM5A 1AX2A 2UWBA 3ZSLA 2HEVF 2RS32 5F6LB 1SLCA 5E16A 1CONA 5JI7A 4GH4A 1IKQA 4XFBA 4RD7A 1WGPA 1W2UA 1J59A 5DDJ1 1VBA3 1C8M1 3ATGA 2IC1A 5KC5A 1H4GA 1RUD3 3M70A 3K48A 2A6VA 5EZWA 3VBUB 4GIQA 3ZN5A 3GYDA 1C1LA 1GZWB 5GM0A 2UWAA 1R1A3 2CNAA 1A8DA 4YW1A 1Q43A 1RUE1 4TLFA 1RUH3 1RUNA 2OA2A 5I0TA 5C9AA 4Q0SA 2XJSA 2HWE2 2ZX1A 4RA0A 2RJLA 1QMJA 2FMYA 3MIDA 2ZX3A 1ULGA 4LHLA 1X36A 1COV2 1VB2A 5HCBA 1D2SA 2WQ4A 4H7LA 5D1IA 3UL2A 2HWF1 1GV9A 2BNMA 2BNNA 4XQDA 3D4KA 3BTAA 4XILA 4DRVA 1BVP1 3UKNA 4HK8A 3U10A 3VZOA 1SACA 1K5MC 4B4QA 3FWEA 3N7KA 1SMVA 4AVTA 4AI3A 1PGL2 2K0GA 3DGTA 3H1YA 1AHSA 2JG8A 3WP3A 1LKNA 2XH6A 3B9IA 3VKMA 1QH6A 3R4UA 3WZ1A 2PA7A 1S2BA 3CF6E 3OPZA 4Y22A 1S1AA 1RJ7A 3MEPA 3AK0A 4I0AA 3AFGA 3CLPA 1O3QA 3K51A 1GZCA 2QJVA 4C1WA 4AHWA 2DCYA 1QJY3 4CRQA 4YZ5A 3ETQA 4HLTA 3UJQA 4LT5A 3D8CA 4ATEA 4QHBA 1D4M2 1UD1A 4DPNA 3AP9A 1V6KA 1DZQA 1PHMA 1TNRA 4YW3A 5CFCB 5JDBA 1W6OA 4QQHA 5D8AA 1WLDA 3E6CC 4CEWC 3AMQA 5BNOA 1PVC1 3MPBA 4BYYA 1LOFC 1OOPA 3AP7A 3ZXAC 2NMOA 4Y1YA 5J09A 1VRH2 3VHPA 2EXHA 5GZEA 1OLRA 3SCHA 1AR92 2DV9A 5GLWA 2K9ZA 2VNOA 5FRAA 1SBDA 4AVSA 1W6QA 2DCZA 4WZCA 4UW5A 4KNCA 3AYAA 4C0BA 4K1ZA 3J8F1 5J37A 4YVSA 2QQPA 2WSUA 2FBEA 3EBRA 3KMHA 4IEUA 2XJRA 2WZR2 2IXLA 5DZEA 4ASLA 5K0UB 1V9U1 5C8CB 1VAVA 3DPRA 5E1RA 4D3WA 3JBG3 3IBMA 3U11A 3C3VA 3GZAA 1AR83 5IK8A 5JPNB 2VW2A 2UY9A 4M0HA 1Y3TA 2RS33 2VG9A 4KGGA 4XF9A 4P9WA 4Q0VA 1C1FA 4S2HA 4XMAA 5KHJA 3DV8A 1WW7A 5C4WA 1DGWX 4YM3A 2PLV1 1ZZBA 4P9LA 4UBHA 3PHMA 3VN4A 3CEWA 4PDWC 5A3LA 1G9DA 1ULDA 2GC2A 3DF0A 2OW4A 1UAIA 2B9UA 2F6BA 4MXWA 1NA1C 2SLIA 2NN8A 3L9JT 2N7GA 3AB0A 3JD72 1LOAA 1MZ6A 3NW4A 4PLOA 4FBFA 3VBRA 1QXRA 1ZRDA 3CJIC 1XYNA 3O7OA 4QQLA 1DHKB 2HWE3 3B9CA 1ND2A 4OHYA 4LO7A 5DZGA 1NY72 1VBD1 3THTA 5HXVA 3E97A 1IS4A 5T5PA 3FE5A 1HV0A 4KU7A 2WNVA 1C8NA 1CAVA 1COV3 1F5FA 2VH9A 1PK6A 3GF6A 3MLKA 5DG2A 4N9IA 3VBHA 1AR73 3VBSA 4XQ4A 1CD3G 1OA2A 5BYNA 4PIZA 1OQ1A 1GZ9A 2ZS6B 1HDKA 3OY8B 1FATA 3RNSA 4BWOA 5FMOL 5H9PA 1VIWB 5JZGC 2D97A 1NCQC 1RC6A 3DL3A 4YNIA 3B93A 2IXCA 5JSRA 3ALQA 1MZEA 3V65A 1FOD1 2R1BA 1V00A 4BLIA 1MS1A 1JUIA 2XLAA 4LE4A 4KWKA 5H9RA 5AC91 2HWD2 4P9IA 1O4ZA 1ZNPA 3AMPA 4RR3B 1D4M3 3N3HA 4DRRA 2NZ9A 1PGSA 4JRAA 3D0SA 4HL0A 4I01A 3NKTA 2G9FA 1CPMA 3TN92 2PHWA 2LTNA 4AEJA 3GNEA 3NAPB 1AL0G 4LA2A 3JB4C 1C28A 4XJZA 1VRH3 4YGBA 2E51A 2MPFA 4P14A 1G9CA 1TQ5A 1QOOA 1BJQA 3IN9A 3M3OA 5IK5A 2RR12 1KDMA 1U5ZA 3WDUA 2AENA 1WCKA 2VOWA 4N43B 2PHFA 2XVLA 2DFBA 5ABJA 5KHIA 4W65A 1YXWA 4K20A 3M8LA 1FPN3 4FOVA 3WLUA 3UKTA 2WZR3 4IERA 3JCIA 1AF9A 1LOCA 2DTYA 2WS91 3MF6A 2YROA 4LO4B 4HKLA 3B00A 2YUEA 1PNGA 4C91A 1TMF1 1GQGA 1U5XA 4U2AA 1WCSA 1RL3A 4F83A 1MEC1 2HWB3 1RB8G 5L19A 2H6CA 3GALA 3OBTA 4JGYA 2VVFA