5L7OB

X-ray structure of triatoma virus empty capsid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
179
structure length
179
Chain Sequence
THSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 34
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oB00
1DDLA 4RHV3 3VBHB 1V9U1 1VBB3 1FOD1 4YVSA 5JZGB 1RHI2 4IV3A 2MEV1 1D4M3 1ND2B 3VDDA 5BNPB 1R1A1 3FBMA 1NCQC 1EAH3 1C8M2 1RUD3 4RQPB 1BMV2 3ZFEA 1B35A 4WM8A 4WM7A 1NG0A 1HRI1 1Z7S1 4GMP1 1VRH2 1RUE3 1TME1 1MQTB 1HXS3 4CDWA 1K5MC 2HWD3 2R073 2R062 1MEC2 5DDJ3 1OPOA 1AR82 1ND3B 4PDWA 4JGYC 2X5IC 3VBRC 4QPIC 1PO22 1AYM2 1BEV3 4N43B 1RUC2 5C8CC 5C4WC 1BBT2 2PLV3 4RFT0 5C9AB 4RR3B 5CFCA 3HAGA 1RUJ1 5L7OC 2HWC2 5CFDA 2RS52 1AYN1 1OOPA 1QJY1 2HWF1 3J8F2 4N53A 1QQP3 1H8TB 1POV3 3CJIC 1F8VA 1ZBA1 2TBVA 1RMU1 1RUG3 3VBFB 4RHV1 2HWB3 1PGW2 4GH4C 3VBHC 1CJDA 1VBB1 5JZGC 1PGL2 1VBC2 1ND2C 5BNPC 2HWE3 1RUD1 5D8AC 3M8LA 2XPJA 1NA1A 1V9U3 1FOD3 4CDXC 2FZ2A 5AC92 5K0UA 4GMP0 3S6PA 1R1A3 4YVSB 4CDUA 2GSYA 3VBUA 4IV3B 2WZR2 2BPA2 3VDDB 1ASJ3 1HXS1 4JGZA 5BNOC 5A33B 2RR12 2R071 2GH8A 1EV11 3ZFEB 1B35B 1HRI3 1NY71 1Z7S3 1HRV2 4WM7B 1VBD2 4YVWA 4FSJA 1TMF2 1AR93 1BEV1 4Q4X2 5ACA2 3J8F1 4N43C 2PLV1 2BFUS 1RUI2 1FMD1 2WS93 3NAPC 4PDWB 1R091 4GB33 3ZFGC 1R082 1POV1 1QJU2 1AR62 3VBFC 2HWB1 1PVC1 5ABJA 1RUH1 2ZTNA 2HWF3 4Q4Y1 4QPGA 2WFF2 3JD71 1RHI3 1ZBA3 4N53B 3ZXAC 1C8M3 4EJRA 3VBOA 2HWE1 1AL22 5BNNC 2R041 1PIV1 2XBO2 3JB4C 2RR11 2WLPA 4YVSC 2ZAHA 1VRH3 4IV3C 3VDDC 1ASJ1 3TN92 1VAKA 4CEWC 4CEYA 1MEC3 5K0UB 3ZFEC 1AR83 2RS11 5GKAC 1PO23 4CDUB 3VBUB 1AYM3 1RB8G 1IHMA 5FMOS 1AR91 1RUC3 2RS32 3VBSB 1ZBE2 1EV13 1BBT3 2RMU2 4RS5A 3JBG2 2RS53 2WS91 1VB4A 4PDWC 1POV0 4IV1B 1RVF2 1D4M2 2VQ0A 3J8F3 4GB31 2BUKA 1EAH2 1VBE2 5J98B 2BFUL 2RM22 1FMD3 1AL0G 4JGYA 1AUYA 1R093 2X5IA 4QPIA 3VBRA 1RHI1 4CDQB 1VBC3 1RUE2 1FPN2 1C8M1 4AEDB 4N53C 5C4WA 3ZFFA 1AR72 1PVC3 1RUH3 1VBA2 2HWD2 4Q4Y3 5L7OA 1BMV1 1E57A 1QJX2 5AC93 3JD73 4Q4W2 5DDJ2 1PO12 5FOJB 4QPGB 1VB2A 1NCRB 2WZR3 1COV2 2R043 1VRH1 2ZZQA 1PIV3 3CJIA 3VBOB 4Z92B 4RQPC 2RR13 4GH4A 2R061 3VBHA 1MEC1 1AR81 5K0UC 4Q4V2 1PO21 5JZGA 1VBD3 1ND2A 1AYM1 3VBUC 1MQTC 1QQP2 1TMF3 5D8AA 4Q4X3 5ACA3 1RUC1 1RUG2 4CDXA 3VBSC 1BBT1 1X33A 2RS13 4CEYB 4WM8B 1ND3C 2BBVA 2HWC1 2RS51 1RUF2 5FMOL 4LLFA 4CDWB 4IV1C 1R083 5BNOA 1QJU3 5C9AC 4RR3C 1V9U2 4SBVA 4RS5B 1FOD2 4NWVA 1PGW1 4Y4YA 2MEV2 1QJX1 2WFF3 1SMVA 1PO11 3DPRA 1PGL1 1H8TC 1VBC1 4CDQC 1AL23 5CFCB 4AEDC 1HX6A 2FZ1A 1M06G 5CFDB 2XBO3 5AC91 3NAPA 1OOPB 4JGYB 2X5IB 1HRI2 1Z7S2 4QPGC 1TME2 3ZFGA 2WZR1 1NCRC 3ZFFB 3TN93 3VBOC 3VBFA 4FTEA 5L7OB 3JB8A 1HRV1 1HQNA 1VBD1 5BNNA 1TMF1 1NA1B 2R063 2RS33 1ZBE3 4Q4X1 5ACA1 1RUJ2 2RMU3 4GH4B 1AYN2 3JBG3 1B35C 4CEYC 2QQPA 1QJY2 1RUI1 4WM8C 1NCQA 2HWF2 4WM7C 1QJZA 1RVF3 1ZBA2 4JGZB 1RMU2 5A32A 2WWSA 1R081 5D8AB 4CDWC 2IZWA 1VBE3 4RHV2 1QJU1 1AR61 5A33A 4CEWA 4CDXB 2RM23 2HWC3 1VBB2 4RS5C 3IDEA 4YVWB 2WFF1 4Y5Z0 1K5MA 1RUD2 1FPN3 5BNOB 1AL21 1AR73 5CFCC 1VBA3 1QJX3 2XBO1 5CFDC 4Q4W3 1PO13 1OOPC 5C8CA 1HXS2 1COV3 3DPRB 1C8NA 2R072 1EV12 3TN91 3LOBA 5ABJB 3ZFFC 1NY72 3NAPB 1X36A 4Q4V3 1BEV2 3ZFGB 1A6CA 2PLV2 2RS31 1ZBE1 1NA1C 2RMU1 1FMD2 1HRV3 4BCUA 3JBG1 1R092 4CDUC 5BNPA 1RUF3 1RVF1 1D4M1 1EAH1 5BNNB 4JGZC 4RQPA 1VBE1 2HWB2 1PVC2 1RUH2 1GFF2 1RUI3 2RM21 1CD3G 4Q4Y2 3JD72 4FTSA 2MEV3 1NCQB 1OHFA 4YVWC 1MQTA 2HWE2 1AR63 2R042 1PIV2 1RUE1 1FPN1 5A32B 1F2NA 3VBSA 4NWWA 1AR71 4CEWB 1VBA1 2HWD1 1ND3A 1R1A2 4Q4W1 5DDJ1 4GMP3 1TME3 4N43A 1ASJ2 4IV1A 1K5MB 2Y26A 1COV1 3DPRC 5C9AA 4RR3A 2DF7A 3VBRB 4QPIB 2RS12 5ABJC 1NOVA 5J96B 1W39A 4Q4V1 1H8TA 1AR92 5C8CB 4CDQA 5C4WB 4AEDA 1QQP1 4FTBA 1RUJ3 1RUG1 1AYN3 2WS92 1WCDJ 1QJY3 4GB32 3CJIB 1NCRA 1RUF1 5LK7B 1RMU3
chains in the Genus database with same CATH superfamily
1LOFC 1AF9A 3BOWA 4HSJA 1V9U1 1VBB3 4J1XA 3BN6A 4LHKA 5JZGB 5FY9A 3AKRA 2MEV1 4GZ9A 1DLCA 4XZPA 3VDDA 4CXXA 2E63A 3D8CA 3HT1A 3LOIA 1E5SA 1NKGA 4Y1YA 3DF0A 4X6QB 2VBDA 3GBWA 5A7WA 3HT2A 5FO7B 4QKNA 1P8JA 1S0FA 1B35A 2VOXA 4IESA 4Z1VA 4V1PA 4XMAA 1S4CA 2WKKA 1ONAA 3I4IA 1NG0A 2Z4FA 1Z7S1 4QX8A 2EIBA 5FZIA 4LJHA 4OHVA 2Y6KA 5FYIA 4FOWA 4XJWA 4AHYA 3BUCA 2JD9A 2VZVA 3WXPA 1BLZA 4HK9A 1HXS3 4P9JA 3VHPA 3ZYBA 3FHAA 2R073 4XXAA 4C1XA 5ANNA 5CKQA 5J36A 1HQLA 2WRAA 4WVMB 1O7FA 3JXSA 2DV9A 1AZDA 1GZWB 2BOJA 1ND3B 1SCSA 1WCQA 2XB6C 2WO7A 4JGYC 1JZ3A 1DIWA 3ABZA 4NR1A 3I2IA 3NNMA 1WD3A 5E6HA 5FY7A 3RG0A 2Y8KA 5I8YA 1REEA 3A22A 1MS8A 5F5AA 5DAPA 5B4XA 1JUIA 5C4WC 3T2QA 2PLV3 2VG9A 2WR9A 4HKLA 3I2DA 3MPBA 5LBCA 1NE4A 4BXSV 2B42B 3HIFA 3WQBA 5L7OC 2RS52 4AFMA 3AP6A 3MIEA 2ZHKA 4AE2A 1DBNA 4A7YA 3ZYFA 2VNVA 4A41A 2R0FA 3X29B 4IEYA 3AZYA 4KBBA 1LESA 1QQP3 2ENRA 5JI7A 3O1TA 2YY1A 1LODA 5E8AA 3CJIC 3ES1A 1F8VA 1AXZA 1ZBA1 2JDAA 1RUG3 2L9LA 4R8HA 5FZMA 3WP5A 2J1AA 4AFAA 3O7OA 1BYHA 2CDOA 3LSEA 5KXCA 1QU0A 1BK0A 4IXLA 1VBB1 4MGZE 2RJ2A 4A3ZA 3RZMA 4XEZA 2NMOA 3WG4A 5HV0A 1PGL2 4YW1A 3RYKA 1BZWA 2DCKA 4CXYA 2YUEA 4ATEA 5FP3A 5FO9B 5DZGA 4YW2A 1QOSA 1JH5A 2B4KA 2FZ2A 2AACA 3JU9A 1EPZA 2QZ3A 2F17A 3OGJA 5GM0A 2WC2A 4S2GA 2BW8A 3S6PA 1R1A3 4YVSB 3SXWA 3WP3A 3WNKA 1U5XA 2HEWF 2F4PA 5FRAA 4R4ZA 1ASJ3 2R16A 3O14A 5BPXA 1E5RA 4ZS2A 1HXS1 4FI9A 1YEWA 4IEQA 2R071 2GH8A 3HOBA 5IVYA 5IK4A 4TTGA 1BCXA 4Y26A 2VU9A 1OI6A 3SNMA 1HRI3 2PHDA 5LASA 2P17A 3AYDA 3W58A 3HN3A 4AFBA 4CZSA 4B3NA 1XU1A 3ASIA 4K40A 5F5CA 4FSJA 1UZYA 4MHUA 4MXWA 3MDPA 3LF7A 4Q4X2 4AAXA 3J8F1 4TWTA 5ACA2 2HLEA 1W2TA 2PLV1 3WLUA 2NLRA 4OMDA 3S30A 4NN0A 1JU4A 1W3XA 5J3UA 2R6QA 1RUI2 1G9CA 4D69A 4OHWA 1DGWA 4PDWB 5L9VA 3LAGA 1OUSA 2Y64A 1CAXA 3RSJA 2JDUA 2WYFA 1UZ0A 4IGOA 2ZGPA 2VMGA 1UXXX 2D3PA 4L0PA 1J83A 2RE9A 3AZVA 1G9AA 3AKTA 1IQAA 3P5BA 4PF5A 3GZTB 4FPJA 4PLOA 1ZZCA 4QXKA 2J1SA 5FR3A 1RUH1 3MF6A 2V5DA 3B94A 3IT8A 4ZU5A 1S0GA 4MGKE 5FLHA 2I74A 2JD4A 2WZ8A 4N53B 3ZXAC 3D0SA 3KHBA 4EJRA 2PHFA 2PQSA 3VBOA 2CWMA 1AL22 3BCWA 3U1XA 2ZBJA 3W21A 5BNNC 3EB7A 2WNUC 3EO6A 3GF6A 2ZOEB 3HPNA 2G4IA 2OZJA 5JXJA 4R9BA 1ZZ6A 1NZCA 2UWBA 1DQ2A 3AC0A 3N4MA 4YGCA 2CYFA 2VMCA 1NUKA 2R49A 2ZAHA 1VRH3 3O0WA 4IV3C 1O3SA 1DFQA 1KXGA 1ASJ1 4Y20A 1CAVB 2XQXA 4O65A 3AP5A 4FP2A 4GWNA 2W0XA 3SH3A 5I0DA 5HXVA 2ZGNA 1JODA 3WDTA 3T2PA 3UGGA 2RS11 4O9EA 1YLLA 2GNDA 4NUBA 1I1EA 5FBJA 2V4AA 4BIOA 3ZR5A 2W9XA 4H2AA 3VBUB 1CX1A 1C5HA 4I0WB 1RXFA 5JR7B 1AYM3 1IPKA 1IHMA 2EICA 3I2GA 5FZEA 4QT6A 3ZXDA 3LSDA 1T6GC 4D3WA 3Q8CA 2OXBA 1RUC3 1EV13 4UBHA 2Q8CA 3D4KA 2RMU2 1QJEA 1ZRIA 3JBG2 2Q1MA 5A6QA 3DKQA 4MX3A 3I3EA 4E4SA 1LGCA 4XF3A 1UZZA 3KM5A 5JPNB 2WQ8A 2VBPA 1PNFA 3HQXA 3RDIA 1RVF2 1KJLA 2I07B 2W94A 3ME2A 1E5IA 2BUKA 3JQWA 3OD4A 3RWKX 1POQA 3M4FA 4YWAA 5IVBA 5J1XA 4I09A 1I5PA 3C7OA 2BFUL 2BWAA 3KF3A 3NNGA 4XF4A 2NYYA 1NLSA 5FYBA 3VBRA 1CN1A 3THTA 5T54A 4J25A 4A2UA 2GNTA 4JDMA 2WT1A 1F35A 2DVGA 4CDQB 1H30A 1VBC3 4FFFA 2OUHA 4AEDB 5EYYA 5H9QA 1GICA 3THCA 3VDAA 1AR72 2P1BA 4DXRA 3AZWA 4Q4Y3 4A6OA 4Y24A 5AC93 2Y6FA 3JD73 5GLTA 3L2HA 2VCBA 4OHXA 4Z2WA 5FPAA 4YRDA 4QPGB 4Y33A 2PA7A 3NL1A 4BHPA 2YPDA 2Z2SB 4D7SA 1LENA 1QF3A 1VMJA 2WZR3 3ZYRA 3PUQA 1VRH1 2OUJA 1PIV3 3N7JA 1PMJX 1LOGA 5FY1A 1C57A 2RR13 2VUCA 3NNJA 3OY8B 2A5ZA 2R7EB 3OUHA 3PU3A 1SLLA 2XJQA 2C9KA 4PI0A 4U2AA 5H9PA 1C4RA 3OD0A 5K0UC 4QM9A 2WNOA 1QXPA 4LBNA 4WVWA 4YFWA 5F6LB 3UESA 2Q8DA 3ZYJB 4AI0A 5JZGA 2DBIA 1CGPA 1AYM1 5JIUA 2I2SA 3NVCA 1QQP2 4IW3A 4M4RA 5D8AA 1STMA 2CSGA 1YQ8A 1O3QA 2Y6GA 1RUC1 1O4ZA 2HBUA 4AR2A 1RUG2 5DAVA 5DG1A 1KGYA 5I0SA 1J1LA 3H7JA 1ND3C 2W3JA 3GBFA 3E5QA 1SDDB 3KT1A 3MI8A 3E6BA 4YZ1A 5FMOL 1W8NA 4XHXA 3G7DA 4IV1C 3N36A 3M3EA 5BNOA 4QGNA 4NIGA 2CHHA 5IAVA 4UFKA 2WSVA 2ZGKA 4XPVA 4BQ1A 2E9QA 1X7NA 4CPBD 4CTEA 5I8TA 2CY6A 3WF0A 1YI7A 4NAOA 1GZWA 3VGIA 5CEHA 3MIFA 3RRDA 3SEPA 2WFF3 2CTVA 4CP2A 2W1WA 2PFWA 3KV6A 4Q8LA 1V6LA 4GD4A 3DPRA 3CHXA 5FYVA 1VBC1 4FPOB 1LNSA 1L7RA 4B29A 1UIKA 2D3RA 1W8OA 1KFXL 3WF4A 3IN9A 1ZA7A 3F95A 5AC91 4BE3A 1V0AA 2B46X 3INAA 2WYSA 2X5IB 1HRI2 1OLQA 4NMIA 3DYMA 3V0AB 2A6ZA 5KWRA 2ZGSA 3USSA 4YZ5A 5FYMA 4XBNA 4B4PA 2WZR1 1NCRC 1VR3A 4AQTA 4FAGA 2ZX2A 2FDIA 2PHTA 2QZ2A 4ATFA 4GKYA 5LBEA 3UGHA 3OYWA 3VHRA 1MVEA 4Y1UA 3LEKA 1NQDA 1T6BX 3J7NA 4KI5M 1DQ4A 2VW0A 3OPZA 1O5LA 4YM3A 3MFCA 2D98A 3POGA 3WNLA 3SQOA 5IT6A 5JOWA 2ARAA 4OULA 4XBQA 1K12A 1XYOA 3ES4A 5C70A 3RZZA 5FKBA 2R063 5LK5A 1J3RA 4BQ4A 1ZBE3 3BB6A 5TSWA 4LITA 4XFHA 1RUJ2 4AVCA 1RUOA 4GH4B 3PJQA 1AYN2 2XJUA 5FZ8A 4X8PA 3VZNA 2XWJB 3U14A 4WM8C 1NCQA 1HV0A 2ARBA 5D2AA 1XNDA 2VXJA 5F3EA 1MZEA 5A3OA 3VKOA 4JGZB 1DP0A 3MV01 5GALA 4CDWC 4LHNA 1CZVA 1VBE3 2BVVA 2XUEA 1W0NA 2ADDA 2UWAA 1AR61 3B00A 5FYCA 2RM23 3ACHA 4CDXB 5IWFA 3UJOA 1JW6A 4LIUA 2JIJA 4RS5C 1DG6A 3ACFA 4Q5OA 4BQYA 1JYNA 2WFF1 3O1VA 1N1VA 3DYPA 3W5NA 2JG8B 1YIPA 1K5MA 3KVBA 3I2KA 2C26A 2DDUA 2LS6A 2PHXA 2VO5A 3P6BA 4IE6A 3SLIA 1ULGA 1EPWA 3NW4A 2BRTA 1VBA3 5CFCC 3LCPA 1UY1A 5B2GB 1N3OA 1HB4A 4QXHA 1QJX3 1D2SA 5CFDC 1PO13 3AK0A 4V2VA 4X8NA 4XUQA 4KGGA 4A42A 4Q0VA 1CZSA 5C8CA 1EY2A 3PUAA 1COV3 1ZREA 1Q3EA 1YUDA 3NKGA 2VE1A 2PAKA 2C1FA 2XVGA 5JSPA 4I3GA 5FZ6A 3C7FA 4A3XA 1EV12 4E27A 1CAUB 5CA6A 3QOPA 2BGCA 3ZKYA 4LT5A 4D7TA 2D43A 3NAPB 2K46A 3Q9OA 4LE3A 1C5IA 2Q5TA 5G04L 1O5UA 3T1MA 1TG7A 4ES9A 1BEV2 1H1AA 1H8VA 1LOCA 1EUUA 1SFPA 2YPJA 1Q8SA 2VMEA 3RZHA 3U10A 1CESA 2XL9A 1NQJA 4AF9A 1ZBE1 1V00A 2FMDA 2VGDA 2B9UA 1HRV3 3ACLA 4KWLA 4BCUA 1S0JA 3D0JA 4QKDA 1SPPB 4PLMA 3TNQA 5BNPA 3WDUA 3OOXA 4XJUA 5F37A 2P4EA 4AWDA 4DNYA 1J84A 1YWKA 4FPKA 3LQCA 3LIGA 3LEMA 4N9IA 2FMYA 3U78A 1VBE1 1YJLA 1ZM1A 3JQXA 1VAMA 4BQXA 5LA1A 4K1YA 1GFF2 2RM21 1CD3G 1GWMA 1HN1A 4M00A 4PLNA 4Q4Y2 3T30A 3JD72 1UPIA 3OPWA 3MV11 5KC5A 3I49A 4UFJA 5LWBA 1OHFA 2ARCA 4XJ8A 1LULA 4YVWC 2VZUA 1MQTA 1VMFA 3ZYIB 2AUYA 2O8QA 3H9AA 3UNPA 1KEXA 2Q30A 1PIV2 1Q56A 4JHTA 5A32B 3WG2A 3WNPA 4AHXA 1RUNA 1HDKA 4COVA 1DHKB 4YGBA 4CEWB 1VBA1 2HWD1 2VTXJ 2ZZJA 4LPLA 2VZ1A 4BK5A 4ZY9A 4UAPA 5DDJ1 4C8DA 5J7MA 5F5QA 1U0AA 2AR6A 2ATFA 1V70A 3KQRA 4IE5A 5E16A 5EWSA 1TME3 2QQVA 2Y26A 1COV1 1X9PA 2FDGA 2GMMA 1MS0A 4RR3A 3GJBA 1NYWA 2UYBA 4UBGA 1PM4A 4W4ZA 4DRRA 4XF9A 4E2QA 2DYCA 1QNWA 2DFCA 2O8OA 1KITA 2WDBA 3PLQA 2DWRA 2JE9A 3HN1A 1NOVA 3SC7X 3T08A 5JDBA 2JG9C 3OB8A 3B7MA 4FPGA 4AZZA 2E51A 2NZ9A 1N1TA 1IGOA 3I7DA 3USUA 4CDQA 4NROA 4CA9A 5C4WB 5CAZA 1VLNA 4AEDA 1VP6A 4P08A 3OF1A 5CISA 4W50A 2DFBA 5IW0A 4XCAA 3I97A 2VL4A 3H1MA 2JE7A 4NHKA 1OPMA 1C1LA 1W6MB 1WCDJ 2G9GA 4COZA 1QJY3 4P9LA 4N90A 4BZ4A 4P5HA 2B9VA 2DTYA 5T55A 3CJIB 5A3PA 5LK7B 4TN7A 3HNYM 3KB5A 1SQ4A 2V09A 1RMU3 5A7OA 1XSQA 3MUZ1 1GWKA 2Q8EA 4HMZA 3LDRA 3UK9A 1UPSA 2ORZA 5C5UA 1DDLA 2QDNA 4PIXA 4CCOA 4Y22B 4YZ3A 4A4AA 3CEWA 5FXXA 1RHI2 3WUCA 3SCGA 1J1TA 1UD1A 1SDWA 2D6KA 3FLPA 1O8PA 1C8M2 1W8HA 3FUOA 4Q29A 4RSUA 2FDJA 1ODMA 2W52A 1SG3A 4RQPB 1NLRA 1LR5A 4PBPA 1UN1A 3ZFEA 3E5XA 1OFSA 5JSRA 2QQWA 4U36A 3FHQA 4EZHA 1O8SA 2XGXA 4XUNA 4WM7A 4ZXEA 5A3LA 5I93A 3BTYA 1MZ6A 3CNAA 3JCIA 4PCRA 5FQ0B 5T50A 4I01A 1RUE3 5IK7A 1PZ9A 1TME1 2VPVA 4NO4A 4TLGA 5FYYA 5E88A 1GV9A 2VW2A 3T1LA 4AI2A 3ZIWA 2R062 3VL8A 4ORFA 4LMFA 4LNVA 3BU7A 2W87A 3H8XA 4HKWA 1OLMA 1OPOA 2UY9A 2X5IC 1PO22 3HEIA 3K4DA 5F3IA 4A6SA 5DAWA 1RXGA 3N9PA 4DS0A 2TEPA 3IMNA 4LKFA 4XIOA 1W2OA 3TEYA 4URAA 3IAQA 3LEIA 4RFT0 4P5YA 2X29A 5FMCA 1YCIA 3HAGA 4LA2A 3QBQA 4IGQA 5ISLA 4QPWA 1OLME 3GCXA 2ZGTA 5IFPA 3PU8A 2PYTA 1QJY1 1HJFA 2BGOA 2HWF1 4ZS3A 4B7EA 1IQDC 1QGLA 3I54A 3K77A 3V0AA 2VTXA 2Y6JA 1POV3 2W47A 3IBMA 3M1HA 1RMU1 5APAA 4KG8A 4YGEA 1GMMA 2EALA 1W90A 1GNHA 3BALA 4AI9A 3UGFA 3ILRA 1PGW2 4GH4C 2K0GA 3N7LA 4A45A 4K1ZA 2XQRA 4E2SA 3BKZA 3ZYHA 2WT0A 4MVTA 1ZRRA 3NQHA 4COUA 2AGSA 3I2JA 4DXSA 1ND2C 4AHWA 2JDKA 2HWE3 2AH2A 4M3CB 2A71A 2WNUB 5C5TA 3ORJA 1UMZA 1V9U3 2VUJA 2JDMA 5GZGA 4Z82A 4CDXC 3IB3A 1CJPA 1IG3A 1GNYA 1W03A 1D7PM 2XHKA 2SLIA 4CDUA 2AENA 3V65A 2OZ6A 4IV3B 2BPA2 3PVNA 2OS2A 1NXMA 1W6QA 3K51A 3VD7A 4NVPA 1PVXA 2V4VA 4JGZA 2RDRA 2KD7A 5CVRA 3P3PA 1UYYA 3F2ZA 3LZZA 2AZ5A 3CL1A 4YM0A 2HEVF 1Z7S3 1MR5A 1NY71 1HRV2 3TYJA 2J1RA 3GBGA 1VBD2 1MS4A 1QXJA 4PHZA 2DVBA 5FYZA 5FY5A 4YSFA 1LB2A 1TMF2 1AR93 2NPIA 4LKDA 4PQQA 1IPJA 4N43C 1H6XA 2EIDA 2ID4A 1TE1B 3WV6A 3O1PA 4R9DA 1SBFA 3N35A 2NMNA 2WT2A 3BVCA 3CO2A 3ACGA 2Q1ZB 2WAAA 4HVOA 4IQPA 1FMD1 4KNCA 3NAPC 1GR3A 4XILA 1F4HA 1DYKA 4YZ2A 1YC61 4QQ2A 2DCJA 3OJBA 4J6GA 5EV7A 4W6YA 3NV2A 5D1IA 1POV1 1QJU2 4QHZA 1OVPA 2VOKA 1XE0A 4XFAA 3ZDSA 1UYPA 2Y34A 4E8DA 3I3MA 1FNYA 1UX6A 2X53S 4IEPA 3WEZA 1XQNA 1CONA 2A6XA 2DU0A 2JECA 2VOTA 1KDMA 3A23A 3PUIA 4XAAA 5F1RA 5K8SA 4FO9A 2DU1A 5FAXA 1ZBA3 2R30A 1XNTA 5FOBB 1W8TA 5IFTA 2HWE1 1SHWB 5EJZB 4LLOA 1GQPA 2XLGA 1RTVA 1YRZA 4KWUA 3MLLA 4LUKA 3UKVA 2C4XA 3JB4C 5A7PA 3SKVA 2WLPA 3WW1A 1W6PA 2WSUA 5A3NA 3WCSA 1VJ2A 2Z79A 5T5JA 5C3RA 3BTXA 3M70A 3H1WA 5AFEA 4V2WA 1SPPA 3DCQA 1XNCA 1B09A 3J7HA 1MVQA 5FZ0A 1YO8A 2EIGA 3VDDC 4DEVA 4JKLA 4IEUA 4AQ6A 1AXYA 1KDKA 3BI3A 3VD9A 3WG1A 1QY4A 4JX0A 2GC1A 4URTA 4AEJA 4FPEA 4CEYA 4CEWC 1MEC3 4IETA 5K0UB 1SLCA 2W1QA 3J4UH 1AR83 2XHNA 1UZWA 1WW4A 3POWA 1GANA 4YFZA 3ZN5A 1RB8G 2JIGA 2DCTA 1AR91 2AYHA 3AP4A 1ACCA 3WW2A 3L9JT 4K6BA 4QU2A 2YC4A 1BBT3 3B3QE 5FZOB 1WA6X 3KCXA 1GZCA 2P2KA 3W59A 2YMZA 1POV0 4QKFA 4ZXKA 1YJKA 3OPTA 4IV1B 1YQCA 1X50A 2ZMNA 3J8F3 4LUMA 4DEQA 3AKQA 3HNMA 4NHYA 3OUJA 4CUBA 4O9GA 5J98B 3UL2A 4QDQA 2WNVB 3K4AA 3LE0A 3I2OA 3WUDA 1ENXA 1OURA 4JDNA 2EF6A 1OKQA 4JGYA 4EN6B 3IIAA 3CF6E 3K48A 1S0EA 1RUE2 2BWCA 3LB9A 3SISA 3WQ0A 1K45A 1G6NA 3U4SA 2VZQA 5EZWA 5FY0A 5FXWA 5C4WA 2JE8A 3WDWA 2YDEA 3ZFFA 3PHMA 1RUH3 5IATA 4D6SA 2VH9A 4K8FA 5L7OA 4MGTA 1BMV1 2R1BA 2BTVC 4MLOA 4Q4W2 5T5PA 4NJ4A 5JXGA 4HVQA 3PNAA 4W65A 4BH9A 3NRUA 5LBBA 1NCRB 1KRIA 4LIVA 3GHNA 3K46A 2HKXA 2ZZQA 2ZS6B 3CJIA 3POJA 4H7LA 3WDVA 4BLJA 1C28A 3NV1A 4IEOA 2ES3A 4Z2AA 4Z92B 3E6DA 4RQPC 5HCAA 4MGYE 1MEC1 4Y22A 4D6QA 4EN0A 4CUGA 5BNQA 3SH4A 3VD3A 5LCWL 1SFNA 1AR81 5LY1A 3LDBA 4XOGA 3AX4A 2GC2A 2QKDA 4YG0A 3U07A 3PIGA 4L9BA 1O59A 5LATA 5SV5A 4C1WA 1W28A 2E33A 1OSGA 4MHRA 2FQPA 2LM3A 4S2FA 4BPZA 4XAEA 1ULEA 4XETA 4KH9A 3H8RA 3ZDVA 4EWDA 4XABA 1BBT1 1X33A 2RS13 3N7KA 2D6NA 3S5QA 1PK6C 4LEJA 1WCSA 4WM8B 5KR7A 4IERA 4ARXA 2HWC1 3I59B 4FFHA 1V6OA 1QEXA 2YHJA 1OLRA 2HYKA 2ZCWA 4AVVA 1Q8QA 2WA4A 5FBZA 5F2SA 2XLFA 4CDWB 4HN1A 4NAMA 2P6HA 2QBXA 1LHOA 4XE9A 1R083 4YLZA 5I8SA 1LCLA 1SBEA 3SCFA 2OPKA 2P3KA 2AC1A 4FT8A 4ZKTB 4QB6A 3CBNA 1V9U2 4IGPA 4LA3A 4SBVA 4RS5B 3C7HA 3RPQA 4AAPA 1KFUL 4IEZA 1WA4A 4HL0A 4CRQA 3KV4A 2MEV2 2XL7A 2XG3A 4XJ9A 2C0ZA 4FCAA 3DL3A 5EJ1B 3WCRA 4CCMA 1KS5A 5CKMA 3TOJA 2FCTA 2RVAA 4BA6A 1JYIA 5CFCB 2ET7A 3KCYA 1SCRA 2PHUA 1HX6A 1T2XA 2Y6LA 4XQWA 5JIAA 3RI9A 4KBZA 1JHJA 4ISQA 2OQ6A 1SLIA 4D7YA 5CFDB 2XBO3 3QH7A 3V0BB 3IPVB 5K4LA 3H0OA 1Z7S2 2WO2A 5HCBA 3ZXLA 4HFSA 2W68A 1W0OA 2WN2A 4YW4A 4AGRA 2Q8OA 2J1UA 5FKCA 2GMEA 2PTMA 3TN93 4M3CF 4MGSA 3VBOC 4G9SB 3ZSLA 3LD8A 3MUY1 2BP6A 3C2UA 1L7QA 2CU5A 3T4HB 5FPLA 1PZ8A 5FJHA 5IVVA 1DQ1A 3RWNA 1ZZ8A 2D6LX 3AMNA 2JJ6A 4LKSA 4ASMB 1IS6A 3QCWA 4YARA 5BNNA 5EHDA 2RS33 3PDQA 2J1VA 4GXLA 2EXHA 5FY8A 5A7QA 3UYJA 4CCEA 5A1FA 1TNFA 5FK7A 4BOWA 4OZXA 5L9RA 3AL6A 4CCKA 3IM0A 1QJZA 1XU2A 5FXVA 5J09A 2W46A 4NHMA 5BXXA 1ZBA2 2WO3A 1GSLA 5FO8B 3O12A 1JZ2A 2XUMA 1R081 4OHZA 1DLLA 4KG0A 3ZSKA 1CIWA 4B4RA 1W6OB 1FX5A 5FV3A 4YM1A 1VBB2 4PIZA 5FUNA 5A3UA 3NJXA 1A3KA 1UU4A 3O1RA 1EUTA 2WA3A 2W08A 4YVWB 1OD3A 3UKNA 4CPBA 3OG2A 2GNMA 4DOUA 2XKOA 4KGQA 2EIEA 4CXWA 3AL5A 4OYUA 4LO5B 1FPN3 4XUTA 4FXGB 4JTNA 4QDSA 1CIYA 2VMHA 1KD7A 3OBRA 4CSWA 2MNGA 5C71A 2XBO1 1HV1A 2G9ZA 3N3HA 4Y3OA 1OOPC 4O7XA 1LHWA 4WVVA 4J1WA 5FLIA 1GP5A 1R64A 4ASKA 1HXS2 4OUEA 5EQUA 2XR4A 1C8NA 1US3A 5CB7A 1LTEA 2R072 1REDA 4GKXA 4DIQA 3TN91 2CGOA 4YG3A 3NJYA 3R4SA 3WP4A 1QOTA 4BLIA 4PI2A 3S0MA 5A80A 1XC6A 3FBYA 4CUAA 3CQOA 2JG9B 1ZX5A 5FPVA 2WLQA 3V56A 3PTRB 1D2QA 4NHXA 3QD6A 4L99A 4Q4V3 3AP9A 4JDOA 5FPBA 3ZFGB 4IEXA 2VCAA 2XJRA 2PMWB 2BV4A 2PLV2 2XJSA 3MIHA 2RS31 3S57A 1F5JA 1OFNA 1NA1C 5K7PA 1ZRCA 5A6ZA 5CG8A 2YYOA 1LU1A 1GOFA 1MZ5A 3HD8B 3MZHA 2GP5A 3MLJA 2BVBA 2IXIA 4LBQB 4MOAA 1JYTA 3K2OA 3LPFA 4DZGA 1RUF3 3JUUA 4QXCA 1OUXA 4AFDA 1UQXA 1D4M1 4DPNA 1EAH1 2Y33A 5GLUA 3WW3A 2OQ7A 1AX1A 4HANA 1HB3A 1RUH2 4IE0A 5EYXA 1LOBA 2XOMA 4JZRA 4Q1RA 5IVCA 4X6RB 5LA0A 2QJVA 3MGUA 3CIHA 4BQ2A 4C90A 4N7IA 5FY4A 3ZSEA 1Z78A 5KBFA 3PVBB 3P1IA 1AR63 5LRSA 1FPN1 3FL7A 4HK8A 3RS6A 1LHUA 2WNVC 4WVMA 3K3OA 3MHZA 1ND3A 5JUVA 1R1A2 3NSTA 1G7YA 2P3IA 3BIEA 2YBSA 4QQHA 2D93A 1O3RA 2VW1A 4IL7A 2JKXA 1QHDA 1ASJ2 4IV1A 3DUIA 4JV4A 3RJRA 1Y4WA 5GZEA 4ZU4A 1LHVA 3FFQA 4JQRA 4XXPA 3UETA 1N3QA 3DPRC 1W04A 4GAZA 1QH6A 3W20A 2ZEYA 3EYPA 4QX5A 2MHFA 5LZ6A 4KU8A 2DF7A 2YGMA 2RS12 5ABJC 1X8EA 3FMGA 1UMIA 3UJQA 1IPSA 3RYPA 4UXAA 4D0QA 1DGLA 4Q4V1 3KMHA 3LIHA 4XHBA 3TEXA 4UFMA 1V6IA 4W6XA 2A3WA 4QPYA 1JMUB 4FAHA 1W8UA 2Z69A 3RMXA 1F31A 1CR7A 3I3BA 1SLTA 1FATA 2X10A 1W2UA 3H42B 2W1UA 1KS4A 5LA9A 5IHRA 2YFUA 3H50A 2Y6HA 1J58A 2P6CA 2HBTA 4JVAA 3THPA 4EWAA 4NRPA 4QDRA 5FTTC 3TB0A 2YB7A 1XNKA 1NCRA 1RUF1 4D6RA 5C33A 5IK8A 3B69A 1Y43B 4JKKA 3VKMA 4HETA 1H0BA 4RHV3 1JOPA 4HVRA 4B4QA 3RVHA 2VQTA 4UF0B 4L11A 1C3HA 2CGPA 4XJZA 1FOD1 4YVSA 1H9PA 3E5UA 1Q8PA 1SACA 1ULOA 1ND2B 1LU2A 2J1EA 4DUVA 3TBDA 1NCQC 3FJSA 3AZXA 3T3YA 2P3YA 2DVDA 1RUD3 5E89A 1Y9GA 5F7UA 3AVRA 1E5HA 4BM8A 1JZ7A 1VIWB 2WNEA 4IE4A 1GZ9A 4LR4A 4FQZA 4I3PA 5A6XA 1PX4A 2J42A 2WL1A 3ALQA 3WHUA 4WM8A 3BTAA 1X9TA 5L9BA 3N9QA 3RGBA 3WF1A 1BK1A 1VRH2 3NO8A 2CNAA 4XIKA 5AVPA 5FP9A 5GJ6A 1XNBA 4XW3A 3SEEA 4CP9B 5KHGA 4CDWA 5DUWA 4Q2FA 2VUDA 1K5MC 1O6UA 2HWD3 2ZABA 3IWZA 2OX0A 3FWEA 3PVEA 4I02A 5FYHA 3WT3A 3SKJE 5JXHA 3CZJA 4QM8A 1FXZA 2VMDA 4MUVA 4E9KA 5DDJ3 4CU6A 5GZCA 2FD8A 5IAXA 4PDWA 3TEWA 4QPIC 5LY2A 4RA0A 1UNBA 4OMCA 1AYM2 4AQSA 1GNZA 5CZKA 3HNBM 4N43B 1WMXA 1RUC2 1W6NB 5IJRA 5C8CC 3Q8FA 4ZZ8A 1F4AA 1W9TA 2E7AA 2FHRA 2O0OA 3I2HA 3WNMA 4LE4A 5C9AB 5CFCA 1W2AX 1OC1A 3LFMA 1WW7A 5CFDA 3ECQA 4CCDA 3V0BA 1UWWA 2ZKLA 1HB1A 1JOJA 4NRQA 1WBLA 2FDHA 4N53A 3MPPG 3KD4A 1H8TB 3WX5A 4L8QA 3WW4A 2TBVA 5G05L 2D44A 3DN7A 2D5FA 4RHV1 2HWB3 1RYYA 2YU1A 3LGRA 4UWDA 3GYDA 4WBBA 3URFA 3VBHC 5LA2A 4OZOA 2JX9A 2V5YA 2DVFA 4JCKA 4QB2A 5KXEA 3KHCA 3WZ1A 1GQGA 1UOFA 3AB0A 3FZ3A 4YZ4A 4LO4B 4QHBA 4XJAA 1JHNA 1VBC2 2YZ4A 3KZ4C 4HOOA 4PF1A 3WNXA 4AI8A 3AFKA 1CAVA 4YPJA 4AK3A 2E53A 5BNPC 2O14A 1RUD1 2BNNA 4L97A 4AI1A 2RDSA 3M8LA 3IDCB 4F3JA 1Y9QA 2GN7A 4ZZ5A 1KJRA 2A75A 2LW8A 3V64A 5AC92 4CCNA 1K42A 4Q26A 1A78A 2J22A 3VZMA 2XJPA 1J59A 2GSYA 3VBUA 2WZR2 3KVAA 1DZRA 3O5SA 3ST7A 3VDDB 4Z8BA 4QQOA 2DUQA 4H3WA 4HONA 4LBOA 5JPMB 1UW8A 2Q1FA 4R9AA 4E8CA 1A34A 3FC0A 2RR12 4UW6A 2P34A 5A7WB 2PHRA 1OQ1A 4OHYA 2WAOA 2WZEA 1UAIA 3KQ4B 3BYWA 4Y1VA 1B35B 3ZVXA 5LW9A 1ODNA 2HH9A 2YC2A 5ANQA 2VECA 2QDRA 4OVEA 4CCLA 2QE3A 4K21A 2KA3A 1FT9A 3OSDA 3OBZA 4YVWA 4H14A 2OYZA 2ZEXA 5EPAA 3VKLA 4GQ7A 4JAAA 3K75B 1D0HA 1REFA 2BEOA 3POSA 1JBCA 2HEYF 5JXIA 5F3GA 2RJKA 2BFUS 3M7AA 5HV4A 5BUVA 3RMYA 5SV8A 4IEVA 4GALA 2WS93 1WKYA 3WF3A 2OW4A 1R091 3H1YA 4OI2A 4DY5A 4GB33 1OQEA 1XE8A 3BIWE 1WMDA 3W9AA 3ZFGC 5AFBA 1UF2C 1L7LA 2JICA 5T5LA 4HT1T 4COWA 2QFEA 3KGZA 1AR62 5FK8A 2OKXA 3R4DB 5H9RA 3VBFC 1DCSA 2HWB1 5A3WA 4HXCA 1PVC1 2IXCA 2VOWA 3O0XA 2ZTNA 2HWF3 3AMQA 4QPGA 5FP7A 1DQ0A 3VL9A 2JG9A 4BQ5A 5IVEA 2WFF2 1IS4A 1WGPA 4CCCA 5EP9A 1MS9A 1ZZ7A 3D82A 1MACA 2IFWA 3TRSB 2YV8A 3M3OA 2QVSB 1LKNA 1OF3A 2QQJA 2R041 3ZXGA 3OY8A 3POYA 1JXNA 3NMBA 1PZ7A 4MGQA 1YIFA 4PBOA 2VCCA 2YG0A 4UW5A 4LK6A 3NWKA 3AKSA 5FZ4A 4HKOA 5IUQA 4AL9A 5IYYA 3KLSA 4YNIA 3VN4A 2HJIA 2J7MA 2RDNA 3G6JB 3LA7A 5IK5A 2RJLA 5FYSA 3BODA 3ZM8A 4NPRA 3ZFEC 5GKAC 5KHHA 3ZX7A 2ZGMA 2OIIA 2RHPA 4FFIA 1ENRA 1WW5A 2ZGUA 3FHIB 1XYPA 4CVUA 5FMOS 4LO6B 5EXOA 5F2WA 1CPNA 4MYEA 5FUPA 2JDNA 3HMYA 1ZBE2 3FLTA 3POEA 1GU3A 2BQPA 4FOYA 4FPFA 1H1IA 1PK6B 1W9YA 2EXIA 2XONA 2IFRA 1S2KA 2ZEWA 4DQAA 4Q0QA 5JOZA 4XDPA 3PL0A 2ERFA 1H9WA 2RS53 3JZVA 2WS91 1CWPA 1GUIA 1UKGA 1VB4A 4OLLA 2W92A 3HJRA 1W2NA 1GP4A 3KT7A 2BYVE 2VQ0A 4GB31 1BVP1 1CPMA 4XF0A 4MXWB 4RL7A 1VBE2 3UV9A 2P5BA 5FZ3A 2VCMA 2RG4A 1VRBA 3AMPA 2RM22 4TSVA 1FMD3 3SHRA 4ET7A 1PGSA 4CU8A 2QQNA 3OGVA 1ULFA 1AUYA 2X5IA 2XVKA 3IKWA 2ADEA 1DQ5A 4IE7A 3DXUA 5GLVA 4EZ4A 1CAXB 4RYDA 1YYNA 4TYSA 1LEDA 2D40A 4C91A 4DXZA 3AVSA 1BXHA 2DURA 3D3AA 3GNEA 4YGDA 3VKNA 1PMHX 4XTPA 1VBA2 2HWD2 1FV3A 5KHIA 1E57A 1QJX2 5EIYB 1W0PA 3B9IA 5DDJ2 1BJQA 1PO12 5FPXA 4UFLA 1W8WA 1IS5A 5CG9A 1W9WA 1YFWA 4RGGA 1QXRA 3DGTA 1COV2 5C3QA 1TZOA 2C9AA 3ELNA 1DGWX 3VBOB 4LBQD 1ULDA 2CGNA 2DUPA 2BERA 2D97A 2CL2A 3WOGA 4Y5SA 4GH4A 1JZ8A 3FN9A 4XFIA 5LEKA 1AJOA 1HW5A 1SFYA 1OT5A 3VHOA 3NJZA 2VULA 3BPZA 4KQ7A 3RZGA 4Q27A 1LEMA 3GGLA 3O1SA 1JU3A 2B39A 4FVVA 1ND2A 3ZKUA 4JRAA 3EBRA 4XYXA 1DZQA 3PMSA 1DGRA 4Q4X3 5ACA3 4QX1A 4CDXA 3BGAA 3RJ2X 3VBSC 4BISA 2A6YA 4AVBA 4DY3A 4C0BA 5A3MA 2A3XA 2EXKA 4COYA 2H6CA 1DU3D 2RS51 5FZFA 4UT5A 2TNFA 2VQAA 4G4FA 1AX0A 3AXDA 3Q8EA 2JG8A 1UY4A 4JRLA 4N7UA 4LLFA 4A7KA 2XJVA 3UKTA 3GDBA 4CP9A 5FCCA 4P9WA 2PELA 5C9AC 1N3PA 4SLIA 3SCHA 3KSCA 1FYUA 1G86A 2B45X 4XFCA 3VLBB 1IZ3A 4BMEA 4NWVA 5BNPB 2ZX4A 1XBFA 1OVSA 3O0VA 4HBNA 2QCSB 4W8JA 4BQ3A 1VMHA 1WLTA 4UW4A 5JI9A 1OMIA 3POBA 1H8TC 5FP4A 5C3PA 1PGL1 3M3CA 2G9FA 3E97A 2LALA 1AL23 2YBKA 3A21A 5F8PA 3LWCA 1CAUA 2ZX0A 2FZ1A 4GA9A 4D8MA 1M06G 2ZJCA 4FFGA 5F32A 5H9SA 2W5FA 4CUCA 3NAPA 1OOPB 5CBLA 5FMDA 2GZWA 5IVJA 3OBAA 4P9YA 3A0KA 5FIXA 3AJYA 1TME2 1V6KA 3VKFC 4Q8KA 1US2A 1GBGA 4Y4RA 3APBA 2GALA 1F9KA 1MZFA 4Q1PA 2FCUA 5HBAA 4FTEA 4AVTA 3FLRA 2FBEA 3WG3A 4N8MA 4GJZA 1N1SA 3GHMA 3JB8A 1UCXA 4XFFA 4BK4A 3OGRA 4XZUG 2GH2A 3T0DA 2VQUA 1HQNA 3OEBA 2F4LA 3DV8A 4YW5A 3ILFA 4QB1A 1BVVA 1UO9A 5A7NA 1LOFA 1OD5A 1W8ZA 5FZKA 1NA1B 4Q4X1 5DG2A 5ACA1 5CNAA 5A70A 2RMU3 3VHNA 3MIDA 3N9NA 1O3TA 1RJ8A 2QQMA 3GZUC 3JBG3 4HLTA 1B35C 2YBPA 3ZIXA 4CEYC 5IVFA 1QJY2 1RUI1 2QQPA 2HWF2 4NIHA 2H0BA 4MH0E 4Q0PA 3K3NA 1HQWA 4UYBA 4GIQA 1RVF3 1LGNA 1RMU2 1HJGA 1UXZA 4FPYA 4AHZA 5D8AB 5A32A 4I2OA 4MG2A 2Z5WA 3ETPA 4JKMA 4CEWA 1I6XA 4YW3A 2HWC3 4ZU7A 1OA4A 1IOAA 3LKJA 1H2LA 3T2OA 1XSRA 4LXLA 3KV5A 1UZVA 3VB9A 3WINE 3VZKA 3IDEA 3LA3A 4LOTA 4Y5Z0 2BGPA 3EQEA 5A6YA 2RDQA 2PN5A 2PXJA 1QIQA 3HR9A 3MEPA 4OCTA 1IKPA 2Y0IA 5BNOB 1AL21 1LJ7A 4AVSA 2OT7A 1AR73 2UURA 4Q0SA 1YFXA 3NNFA 4FQ4A 1JI6A 3AFGA 2SBAA 3EJKA 4MV2A 2BOIA 2LUWA 2XVLA 2VY0A 1MPXA 3THDA 4GWIA 3ENRA 2ZHNA 4ISRA 5GZFA 3ZPOA 4NPLA 3DPRB 4AW7A 2Y0OA 4QXBA 4AXOA 5C8WA 2P3JA 3PIJA 2JDPA 1WMEA 5ABJB 3ZFFC 4QX0A 5JVVA 1NY72 5M0TA 1W6MA 1W99A 1ZNPA 3FUQA 4NIAA 3ATGA 4FXKB 1X36A 3O1UA 2E26A 5FZ1A 1JUHA 1OH4A 4QX3A 1VE0A 2WABA 1A6CA 2VZPA 3MO4A 3R6SA 1O91A 3M3IA 4RGKA 3OYWB 3VDBA 4B1MA 1JS9A 2RMU1 1H1MA 4C0HA 1FMD2 5JCTA 3JBG1 3TEZA 1IKQA 1UMHA 5FLJA 4HPKB 2X8KA 4ES8A 4DO0A 5FZDA 5FWJA 1AXKA 4BXFA 1RVF1 2IC1A 4META 2ZMLA 4F8AA 4RQPA 1QNYA 2E31A 4FBFA 2KR2A 3S7EA 1QMJA 1ZYBA 5CADA 2WFPA 4OUMA 2JB8A 1ZZBA 2D6OX 2V73A 1PNGA 3AMHA 3J26N 1NCQB 4A44A 5FQ0A 4LO7A 2QNKA 4BIFA 4DUXA 2OA2A 2ZMKA 4TXWA 2W39A 2A3YA 2HWE2 4JTOA 5DZFA 4YW6A 5L19A 4YYOA 4P9GA 4NWWA 1L3JA 1AR71 1RITA 1ULPA 1PK6A 1XJAA 2NP0A 2V72A 1WMFA 1UOGA 2D3SA 5FFOC 4LK7A 2YFZA 3ZN6B 3N9MA 1H4GA 3B5LB 4GMP3 4M0NA 5C6CA 3MIGA 4P9XA 2VNRA 1K5MB 2Q4SA 2E7TA 3RZLA 3IMMA 2ZEZA 2VTFA 4YG6A 1Z0HA 3WP6A 4AFCA 3MW3A 2PAMA 1PHMA 4QPIB 4OI1A 2BU9A 5B4NA 4FPCA 1A8MA 3E1F1 5J96B 5HCHA 1WCUA 3BTZA 4XFBA 1W39A 2W2IA 3WF2A 1FV2A 2VAUA 4K3UA 3PTYA 1AR92 4JQTA 2VZTA 1UOBA 2UY8A 3AP7A 3AXEA 2VUAA 5F5IA 5FPZA 4ASLA 5K9YA 3GCWA 1QQP1 1NT0A 2IXHA 3CMGA 4FTBA 4NHLA 3WDYA 1RUJ3 1RUG1 2AEYA 5DAXA 1AYN3 2WZPP 1OA3A 4Z07A 5LBFA 2HYXA 3GZAA 4AG4A 4WVZA 1WCKA 4XF1A 1APNA 2UU8A 1YFUA 3A7QA 1J3PA 1G9FA 2EAKA 2VNGA 1YQ5A 4M3CA 2WNUA 5J48A 5DN2A 1K3IA 5A3TA 1WW6A 3ZPYA 3I8TA 2ZHMA 2RV9A 3C3VA 3VBHB 1S0IA 1LECA 3DEMA 2BJSA 4QAWA 5E1RA 4CCJA 3FX3A 4IV3A 3WSOA 2GC0A 3ZSJA 1D4M3 1WWYA 1R1A1 3DKWA 3FBMA 2R1DA 1EAH3 3N9LA 4GULA 4BWOA 3P3NA 3J9SA 3KT4A 4IDZA 2VVEA 4MXVA 4CU9A 5EJ3A 4CP0A 2Y60A 4M3CE 4EN8B 1F5FA 3OEAA 1GZTA 2VXRA 3I3DA 2BZDA 1BMV2 4L92A 2ZXQA 3VD4A 1VPHA 1FAYA 2XKPA 4GJYA 2VD7A 4FPHA 4PT6A 5FZAA 4F7ZA 5BV6A 5F9TA 5HPOA 1LAJA 1I5ZA 1S2EA 1IS3A 1HRI1 1UY3A 4GMP1 1G8WA 2A73B 3RZJA 4LBMA 3CLPA 5DPNA 5JMCA 1MQTB 2D6MA 4MO3M 1UU5A 2JDZA 5GZDA 5JMOA 2YGLA 1ENSA 1UY2A 4LHSA 4XQDA 3RI8A 1CZTA 3U37A 2W91A 1MEC2 3VZJA 2GP3A 4AI3A 1WBFA 1AR82 3LA2A 4DMIA 3VBRC 1QWRA 4LTAA 3WHTA 3ETQA 1RIRA 3KCCA 1J3QA 4LULA 4NIDA 5JLVA 2B5HA 1BEV3 5D21A 3MICA 2A6WA 1CAWB 1CQ9A 4ZHNA 3J7LA 2ZX1A 1BBT2 1R1ZA 2VZ3A 4RR3B 2GMPA 1LGBA 4EE2A 3WDXA 1RUJ1 5HI0A 4QX7A 3WNNA 1WUVA 2HWC2 4OI0A 4RN5A 1AYN1 3Q8BA 1UKRA 2K2SA 1OOPA 1ENQA 2BBAA 1GYKA 2DTWA 2ZGLA 1V6NA 4AGVA 1NLQA 2D7FA 2H6BA 1M4WA 3J8F2 3KS7A 5FWEA 3U4XA 3CKHA 3USUB 2VR4A 4R9CA 1I3HA 4BDVB 3VBFB 4LHLA 3O1OA 4AVAA 2OVUA 2EAAA 2BNMA 5A1LA 5LRRA 1Y9MA 1AVBA 1CJDA 2VC9A 4NPMA 5DQ0A 2C5DA 1EYBA 4BYYA 1UX7A 2WQ4A 5JZGC 2B8MA 3PVOA 3LFIA 3OGSA 2XWBB 5F39A 2FDKA 3AKPA 2BNOA 3R4UA 3U11A 2MPFA 5D8AC 2ZGRA 2XPJA 1GOGA 1NAEA 1NA1A 5KXBA 1F15A 1FOD3 4Y5TA 3VDCA 4I30A 5K0UA 1N47A 2QUOA 3ACIA 4GMP0 3ZMNA 2VZRA 4WZFA 3B02A 4P02B 2WWJA 4LBJA 3TNPB 2VNOA 5BYNA 2C6SA 2D5HA 1XYNA 1QDCA 3ROUA 3U75A 1JYCA 3KWVA 4RFRB 5BNOC 1GWLA 2G19A 2UYAA 3OTFA 5A33B 2XLAA 2XXZA 4AQ2A 3CJXA 1GOHA 2IUWA 4TZDA 3TAYA 1EV11 3ZFEB 5FZOA 3HWJA 4DUWA 4LOSA 1XPWA 4XDQA 1C1FA 4FPLA 3A0NA 5L73A 4WM7B 2KXLA 1LHNA 3W5MA 3T0AA 4R52A 1YHFA 2ORXA 1BQPA 3NV4A 2R32A 2GAUA 1BEV1 4M01A 5I91A 2WNVA 3MFAA 5DUXA 1OA2A 4HN0A 3WQ7A 1BKZA 4MSVA 5A1AA 5DAQA 1QH7A 1HB2A 1TVGA 3WQ1A 1V6JA 4EWEA 5T3NA 1R082 2QQOA 4AGGA 4P9IA 4XACA 1Q43A 2ILMA 3VZLA 5J37A 5F3CA 2J1TA 4B1LA 3BU0A 3BPSA 1Q8OA 3N9OA 4XMIA 5LB6A 5ABJA 5KHJA 5C3SA 2LROA 4Q4Y1 1H6YA 4QD2A 3JD71 3SH5A 1YQ6A 1RHI3 1XE7A 4GWMA 2YXSA 3IZOA 1QDOA 3PUSA 3O1MA 5CKNA 5FUIA 1C8M3 1WLCA 4QU1A 3H7YA 4FOQA 1S0CA 2XJTA 3ZO0B 4OI4A 5FZCA 1PIV1 3KGLA 1AX2A 1JOBA 1OQDA 4DRVA 5FDBA 2I45A 2XBO2 3PJYA 5T52A 3T09A 3CU7A 2RR11 5KXDA 3ZN4A 1D4VB 4KMQA 3ZXEA 3FFZA 3DYOA 4UFHA 1ULCA 2ZHLA 4ZONA 5HXMA 3M2MA 4YVSC 1U5YA 4HPKA 4XC9A 4RGAA 5DUUA 4B8EA 2DCZA 4DB5A 5HCFA 1HIXA 5JOYA 4XBLA 1KQRA 4FP3A 2H0VA 3TN92 4M4PA 2ZACA 5JOXA 4UI9L 2JDYA 2XDVA 2YU2A 1VAKA 1NE6A 3C7GA 4K20A 1NZIA 2QQLA 4UFIA 4K8RB 1HLCA 2EVXA 4DFSA 3ZSMA 3RZKA 3I59A 4RD7A 1N1YA 1PO23 2NQYA 4CDUB 2QQKA 3C7EA 4OQ8A 5DMYA 2DCYA 2JEMA 2A70A 1W6QB 1U5ZA 2RS32 3NNLA 5FYTA 3VBSB 4AOCA 2QQUA 3T2TA 1UU6A 4HZFA 2N7GA 4RS5A 4BMBA 2VMIA 1YI9A 2CWSA 2IWGB 3GJAA 4S2HA 4EN9B 3ZN6A 4PDWC 2CV6A 4R4XA 4MZUA 1D4M2 1MS1A 2XH6A 5FZLA 3VD5A 3KF5A 1EAH2 1DQ6A 4UOJA 2ZX3A 5A7SA 3ZYPA 5F6KA 4JC1A 3CZUA 5FREA 4NRMA 2P37A 3Q8AA 1O4TA 1GLHA 1JTZX 4MGIE 3R05A 2PHLA 3PMEA 4TLFA 1AL0G 3IDAA 3IPVA 2ETEA 1R093 4QPIA 1OH3A 3B9CA 2GDFA 5ERLA 4DXTA 4NE9A 1RHI1 2CDPA 3KV9A 1OKOA 3POIA 4AYUA 2W95A 4QQPA 1S55A 1TEIA 4CP1A 3S5AA 1FPN2 1C8M1 3MYXA 2E32A 2ZAAA 1U12A 4N53C 5JAXA 1ZRDA 1PVC3 1ZA4A 3GZEA 1XOYA 4P14A 3POFA 4FOVA 4E4DX 4XVHA 2LRPA 4XFGA 1ZVFA 1W06A 5FOJB 3WD5A 2FDFA 4OQ9A 4P00B 5FYUA 4EV0A 1VB2A 4WV8A 3HQUA 1DZTA 2C24A 2R043 3AJZA 3CDZB 4H7MA 4HSLA 3ZOIA 2DUOA 3QH6A 3SITA 2E6VA 1ST8A 3B93A 2GC3A 1O4YA 2GU9A 2R061 2YC0A 3MW4A 3VBHA 4MADA 2X05A 1W6PB 1IG0A 2ZGQA 4Q4V2 1PO21 2O1QA 1AJKA 1VBD3 3H8UA 4S2DA 2VZOA 3NV3A 3VBUC 4G3YC 3WR0A 1MQTC 1TMF3 2KM2A 3FE5A 2LTNA 4E4ZA 1H2NA 1DYPA 3LEGA 4ONUA 4D94A 1W6OA 5BY5A 1RINA 2JENA 5I0RA 3K4ZA 1DF0A 1TQ5A 2F6BA 4CEYB 5DXDA 2BBVA 2EXJA 2NN8A 4Y1XA 1UOJA 1EP0A 1GP6A 1RUF2 4XTMA 2TUNA 4ZPIA 1VALA 2VM9A 4JHZA 1RJ7A 3NJVA 4Q0UA 4QQLA 3MLKA 1UYXA 1WD4A 1QJU3 3AZZA 3OBTA 1Y3TA 4GWJA 4RR3C 5KC6A 4PIYA 1XB9A 1FOD2 1YFYA 2JWPA 4KU7A 1PGW1 4BB3A 4H55A 2ARXA 4Y4YA 1H2MA 3QACA 2GNBA 1QJX1 3J7MA 1SMVA 2WUHA 1PO11 2IVIB 2PAEA 3IIIA 4M0HA 5JSOA 2AEZA 2JKBA 3H3UA 2BDRA 4CDQC 4LORA 4AEDC 1CAWA 1GKBA 4Y1ZA 3T0BA 3I3QA 1HN0A 1SBDA 1JYWA 4JGYB 2FCVA 4YM2A 5C8CB 4OUSA 3ITQA 1FNZA 1NX9A 2VZSA 4YW7A 3EMRA 1SEFA 1S0BA 3DECA 4BJ0A 4K7JA 2VOVA 4QPGC 1Y7BA 2WO1A 4XURA 1MS5A 2ZPXA 5FP8A 3UT0A 3ZFGA 1S0DA 1WLWA 1RC6A 3AYCA 3IAPA 4I0BA 4INDA 4ITCA 5DABA 4A7ZA 1SZBA 2DBNA 3ZFFB 1Q8VA 1W05A 2JDHA 3VBFA 5C7GA 1DYOA 4AEKA 3MW2A 1PX3A 3OCPA 4F83A 5L7OB 3AYEA 3PUHA 3H3ZA 4LBQA 5LEJA 1YXWA 3AYAA 2VBBA 1HRV1 3QLQA 2VJXA 4CU7A 1G9DA 5FZGA 2ET1A 2WQZC 3NKTA 1VBD1 3H3LA 1S1AA 5GLZA 2VVFA 1TMF1 2JXAA 5I0UA 5DUVA 1UY0A 4XQ4A 1JZ4A 4KWKA 4DINB 2E7QA 4EQVA 3U0ZA 4L2NA 1JYVA 2A1XA 2IXKA 3DXTA 4AEMA 4WM7C 1ZRFA 1QOOA 1U5IA 3OUIA 1W9SA 2XMLA 4BU2A 2CAUA 4IEWA 2PHWA 5FZ9A 3HBKA 1MS3A 3RNSA 3BOPA 5FMBA 5FZHA 4BQWA 2WWSA 2IXJA 3HQRA 2IZWA 3VV1A 4RHV2 3WNOA 1QJU1 5A33A 2IVJA 4NIIA 3GXUA 3A4UA 1WLDA 1CVNA 4K9SA 1FI2A 2UWCA 4N9HA 3ZXKA 2WBKA 3D5OA 2OPWA 3ZR6A 1YNAA 1RUD2 2NM1A 1VAVA 2WIIB 2A6VA 1JN2P 3E6CC 1X8MA 2WINB 4QX2A 1W3VA 1ALYA 2ZA9A 5CYYA 3M3QA 4Q4W3 4EROA 3AMMA 3HVDA 1URXA 2ZGOA 4CYDA 1LOEA 1W9FA 1D0GA 3RFRA 1JZ6A 3EHKA 3IDBB 2WN3A 4NOTA 4XUPA 5FZBA 5JR2A 2B7YA 3TWIA 1PM7A 4XCBA 3ZXJA 3LDKA 2DVAA 2JB4A 1LRHA 3LOBA 2Q0AA 5JWPA 3WY6A 4WZCA 5L36A 4IUGA 4LQRA 4E4HA 4QGMA 2A7AA 2CAVA 2PQQA 3AM2A 3H8OA 1W8FA 4QWNA 1X82A 1AHSA 3RQ0A 1I9RA 5I0TA 3ZXFA 4UF0A 5EFUA 1YQ2A 1H4HA 2QTWB 2YROA 5CIRA 2Y38A 3ZYGA 1SLBA 5KHKA 1R092 4B7KA 4CDUC 4E2GA 1HKDA 4Y20B 1JYXA 3N7MA 2AREA 4QMAA 5GLWA 2W1SA 5BNNB 4JGZC 4EYUA 1G9BA 2HWB2 1PVC2 5C3OA 3R0RA 1RUI3 1CX4A 3ILNA 3WVJA 3B01A 4FTSA 1RGSA 3MBWA 2MEV3 2R0HA 1V6MA 1UYZA 3ON7A 1SLAA 3ZMOA 3I2FA 1K5JA 1UIJA 2JG8C 2R042 5FZ7A 1RUE1 1UL9A 4HG6B 1F2NA 5FPUA 2WWUA 3VBSA 3GM8A 1BHGA 5AVAA 3ZLIA 4CE8A 1GQHA 3L2YA 2G1MA 5T5OA 2GN3A 1A8DA 1OXCA 2IXLA 4QHOA 2D6PA 3HBZA 4KL1A 2VMFA 1WZXA 4LBLA 2ZKNA 2VVDA 4Q4W1 4XDOA 5FJKA 1PMIA 4LO8A 3GALA 4W6WA 4N43A 2X09A 4XUOA 1TNRA 2EA7A 1S2BA 3OGGA 1W6NA 1ZZ9A 3VZOA 5DZEA 4I0AA 5C9AA 3C8XA 2K9ZA 5CU1A 4PJYA 1RL3A 1NXD1 2Z42A 3VBRB 3VUOA 4UW3A 1OBNA 3SMHA 1XRUA 4O61A 4OFGA 2WJSA 4EN7B 2QQIA 4QKBA 1H8TA 4KWJA 1H2KA 5FXZA 3LPGA 3PURA 3T4VA 3RYRA 3EXUA 3MF9A 1DGRN 1QJFA 2WS92 3S7IA 1Q5OA 4ARYA 4PQ9A 1OF4A 3D6EA 4GB32 1QKQA 4LKEA 1XNAA 4LBKA 1JZ5A 1XXNA 3MIBA 1LOAA 4QGLA
chains in the Genus database with same CATH topology
1LOFC 1AF9A 3BOWA 4HSJA 1V9U1 1VBB3 4J1XA 4LHKA 5JZGB 3AKRA 2MEV1 4XZPA 3VDDA 2E63A 3D8CA 3HT1A 3LOIA 4Y1YA 3DF0A 4X6QB 3GBWA 3HT2A 5FO7B 1S0FA 1B35A 2VOXA 4IESA 4Z1VA 4V1PA 4XMAA 2WKKA 1ONAA 3I4IA 1NG0A 1Z7S1 4OHVA 4FOWA 4XJWA 4AHYA 3WXPA 4HK9A 1HXS3 4P9JA 3VHPA 2R073 4XXAA 4C1XA 5J36A 1HQLA 4WVMB 1O7FA 2DV9A 1AZDA 1GZWB 1ND3B 1SCSA 2XB6C 4JGYC 1DIWA 4NR1A 1WD3A 3RG0A 5I8YA 1REEA 1MS8A 1JUIA 5C4WC 2PLV3 2VG9A 4HKLA 3I2DA 3MPBA 1NE4A 2B42B 3HIFA 5L7OC 2RS52 4AFMA 3AP6A 3MIEA 2ZHKA 4AE2A 1DBNA 4A7YA 2R0FA 3X29B 4IEYA 3AZYA 4KBBA 1LESA 1QQP3 2ENRA 5JI7A 2YY1A 1LODA 5E8AA 3CJIC 3ES1A 1F8VA 1AXZA 1ZBA1 4AFAA 1RUG3 4R8HA 3WP5A 3O7OA 1BYHA 3LSEA 5KXCA 1QU0A 4IXLA 1VBB1 4MGZE 4XEZA 2NMOA 3WG4A 1PGL2 4YW1A 3RYKA 1BZWA 2DCKA 2YUEA 4ATEA 5FO9B 5DZGA 4YW2A 1QOSA 1JH5A 2FZ2A 3JU9A 1EPZA 2QZ3A 3OGJA 5GM0A 2WC2A 4S2GA 2BW8A 3S6PA 1R1A3 4YVSB 3SXWA 3WP3A 1U5XA 2HEWF 2F4PA 5FRAA 4R4ZA 1ASJ3 2R16A 3O14A 5BPXA 1HXS1 4IEQA 2R071 2GH8A 5IK4A 1BCXA 4Y26A 2VU9A 1OI6A 3SNMA 1HRI3 2PHDA 2P17A 3AYDA 3W58A 4AFBA 4CZSA 4B3NA 1XU1A 3ASIA 4K40A 4FSJA 1UZYA 4MXWA 3MDPA 4Q4X2 5ACA2 3J8F1 4TWTA 2PLV1 3WLUA 2NLRA 3S30A 4NN0A 5J3UA 2R6QA 1RUI2 1G9CA 4D69A 4OHWA 1DGWA 4PDWB 3LAGA 1CAXA 3RSJA 2ZGPA 2VMGA 2D3PA 2RE9A 3AZVA 1G9AA 3AKTA 1IQAA 4PF5A 3GZTB 4FPJA 4PLOA 1ZZCA 4QXKA 1RUH1 3MF6A 3B94A 3IT8A 4ZU5A 1S0GA 4MGKE 5FLHA 2I74A 2JD4A 4N53B 3ZXAC 3D0SA 4EJRA 2PHFA 3VBOA 2CWMA 1AL22 3BCWA 5BNNC 2ZBJA 2WNUC 3EO6A 3GF6A 2ZOEB 2G4IA 2OZJA 4R9BA 1ZZ6A 1NZCA 2UWBA 1DQ2A 3N4MA 4YGCA 2CYFA 2R49A 2ZAHA 1VRH3 3O0WA 4IV3C 1O3SA 1DFQA 1KXGA 1ASJ1 4Y20A 1CAVB 3AP5A 4FP2A 4GWNA 2W0XA 3SH3A 5HXVA 2ZGNA 3WDTA 2RS11 4O9EA 1YLLA 2GNDA 1I1EA 4BIOA 3VBUB 1C5HA 4I0WB 5JR7B 1AYM3 1IPKA 1IHMA 3ZXDA 4QT6A 3LSDA 1T6GC 4D3WA 1RUC3 1EV13 4UBHA 3D4KA 2RMU2 3JBG2 2Q1MA 4MX3A 4E4SA 1LGCA 4XF3A 1UZZA 3KM5A 5JPNB 1PNFA 3HQXA 3RDIA 1RVF2 1KJLA 2I07B 3ME2A 5FPXA 2BUKA 3JQWA 3OD4A 3M4FA 4I09A 2BFUL 2BWAA 4XF4A 2NYYA 1NLSA 3VBRA 1CN1A 3THTA 5T54A 4A2UA 2GNTA 4JDMA 2WT1A 2DVGA 4CDQB 1H30A 1VBC3 2OUHA 4AEDB 5EYYA 5H9QA 1GICA 1AR72 3AZWA 4Q4Y3 4Y24A 5AC93 3JD73 5GLTA 3L2HA 4OHXA 4Z2WA 4YRDA 4QPGB 2PA7A 3NL1A 4BHPA 4D7SA 2Z2SB 1LENA 1QF3A 2WZR3 3ZYRA 1VRH1 2OUJA 1PIV3 3N7JA 1LOGA 1C57A 2RR13 3OY8B 2A5ZA 1SLLA 2XJQA 5H9PA 4U2AA 1C4RA 3OD0A 5K0UC 4QM9A 1QXPA 4LBNA 4WVWA 4YFWA 5F6LB 3ZYJB 5JZGA 4AI0A 1CGPA 1AYM1 5JIUA 2I2SA 3NVCA 1QQP2 5D8AA 1O3QA 1RUC1 1O4ZA 1RUG2 5DG1A 5I0SA 1J1LA 3H7JA 1ND3C 3GBFA 3E5QA 3KT1A 3MI8A 3E6BA 4YZ1A 5FMOL 4XHXA 3G7DA 4IV1C 3N36A 3M3EA 5BNOA 4QGNA 2WSVA 2ZGKA 4XPVA 4BQ1A 2E9QA 1X7NA 5I8TA 4CTEA 2CY6A 1YI7A 3VGIA 1GZWA 3MIFA 3RRDA 2WFF3 2CTVA 4CP2A 2PFWA 4Q8LA 1V6LA 3DPRA 1VBC1 4FPOB 4B29A 1UIKA 2D3RA 1KFXL 3IN9A 5AC91 4BE3A 2B46X 3INAA 2X5IB 1HRI2 1OLQA 3V0AB 2A6ZA 5KWRA 2ZGSA 3USSA 4YZ5A 4XBNA 4B4PA 2WZR1 1NCRC 1VR3A 4AQTA 4FAGA 2ZX2A 2PHTA 2QZ2A 4ATFA 4GKYA 3OYWA 3VHRA 1MVEA 4Y1UA 1NQDA 1DQ4A 2VW0A 3OPZA 1O5LA 4YM3A 3MFCA 2D98A 5IT6A 5JOWA 4XBQA 4OULA 1XYOA 3ES4A 3RZZA 2R063 5LK5A 1J3RA 1ZBE3 3BB6A 5TSWA 4XFHA 1RUJ2 4AVCA 1RUOA 4GH4B 3PJQA 1AYN2 2XJUA 3VZNA 4X8PA 2XWJB 4WM8C 1NCQA 1HV0A 2ARBA 1XNDA 1MZEA 3VKOA 4JGZB 5GALA 4CDWC 4LHNA 1VBE3 2BVVA 2UWAA 1AR61 3B00A 4CDXB 2RM23 3UJOA 1JW6A 4RS5C 1DG6A 2WFF1 1N1VA 2JG8B 1YIPA 1K5MA 2PHXA 3SLIA 1ULGA 1EPWA 3NW4A 5CFCC 1VBA3 3LCPA 5B2GB 1N3OA 1QJX3 1D2SA 5CFDC 1PO13 3AK0A 4X8NA 4KGGA 4Q0VA 5C8CA 1EY2A 1COV3 1ZREA 1Q3EA 1YUDA 3NKGA 2PAKA 2C1FA 2XVGA 5JSPA 4I3GA 4A3XA 1EV12 4E27A 1CAUB 5CA6A 3QOPA 2BGCA 4LT5A 4D7TA 2D43A 3NAPB 3Q9OA 4LE3A 1C5IA 2Q5TA 3T1MA 1O5UA 4ES9A 1BEV2 1H1AA 1H8VA 1LOCA 2YPJA 1Q8SA 3U10A 1CESA 2XL9A 1NQJA 4AF9A 1ZBE1 1V00A 2FMDA 2VGDA 2B9UA 1HRV3 3ACLA 4KWLA 4BCUA 1S0JA 3D0JA 4PLMA 3TNQA 5BNPA 3WDUA 4XJUA 4AWDA 4DNYA 1YWKA 4FPKA 4N9IA 2FMYA 1VBE1 1YJLA 1ZM1A 3JQXA 1VAMA 4K1YA 1GFF2 2RM21 1CD3G 4M00A 4PLNA 4Q4Y2 3JD72 1UPIA 5KC5A 1OHFA 4XJ8A 1LULA 4YVWC 1MQTA 3ZYIB 2AUYA 2O8QA 3H9AA 2Q30A 1PIV2 1Q56A 3WG2A 5A32B 4AHXA 1RUNA 1HDKA 4COVA 1DHKB 4YGBA 4CEWB 1VBA1 2HWD1 2ZZJA 5DDJ1 5J7MA 5F5QA 1U0AA 2AR6A 2ATFA 1V70A 3KQRA 5E16A 5EWSA 1TME3 2Y26A 1COV1 2GMMA 1MS0A 4RR3A 4UBGA 1NYWA 2UYBA 4DRRA 4XF9A 4E2QA 2DYCA 1QNWA 2DFCA 2O8OA 1KITA 3PLQA 2DWRA 2JE9A 3HN1A 1NOVA 5JDBA 2JG9C 4FPGA 3B7MA 2E51A 2NZ9A 1N1TA 1IGOA 3I7DA 3USUA 4CDQA 5CAZA 5C4WB 1VLNA 4AEDA 1VP6A 3OF1A 2DFBA 3H1MA 2JE7A 4NHKA 1OPMA 1C1LA 1W6MB 1WCDJ 2G9GA 4COZA 1QJY3 4P9LA 4N90A 4BZ4A 4P5HA 2DTYA 5T55A 3CJIB 5LK7B 3KB5A 1SQ4A 2V09A 1RMU3 3UK9A 1DDLA 4HMZA 1UPSA 2QDNA 4PIXA 4Y22B 4YZ3A 3CEWA 1RHI2 3WUCA 3SCGA 1J1TA 1UD1A 1SDWA 2D6KA 3FLPA 4RSUA 1C8M2 4Q29A 3FUOA 2W52A 4RQPB 1NLRA 1LR5A 4PBPA 1UN1A 3ZFEA 3E5XA 1OFSA 5JSRA 4U36A 2XGXA 5I93A 4WM7A 5A3LA 1MZ6A 3CNAA 3JCIA 4PCRA 5FQ0B 5T50A 4I01A 1RUE3 5IK7A 1PZ9A 1TME1 2VPVA 4NO4A 5E88A 1GV9A 2VW2A 3T1LA 4AI2A 3ZIWA 2R062 3VL8A 4ORFA 4LNVA 3BU7A 4HKWA 1OPOA 2UY9A 2X5IC 1PO22 4DS0A 2TEPA 3IMNA 4XIOA 4RFT0 2X29A 1YCIA 3HAGA 4LA2A 3QBQA 2ZGTA 2PYTA 1QJY1 4B7EA 2HWF1 3V0AA 1QGLA 3I54A 1POV3 3IBMA 3M1HA 1RMU1 4KG8A 4YGEA 2EALA 1GNHA 3BALA 3ILRA 1PGW2 4GH4C 2K0GA 3N7LA 4E2SA 4K1ZA 2WT0A 4MVTA 1ZRRA 4COUA 2AGSA 1ND2C 4AHWA 2HWE3 2AH2A 4M3CB 2A71A 2WNUB 1UMZA 1V9U3 2VUJA 5GZGA 4Z82A 4CDXC 1CJPA 2XHKA 2SLIA 4CDUA 2AENA 3V65A 2OZ6A 4IV3B 2BPA2 3PVNA 1NXMA 1W6QA 3K51A 4NVPA 1PVXA 4JGZA 5CVRA 3P3PA 3LZZA 2AZ5A 3CL1A 4YM0A 2HEVF 1Z7S3 1MR5A 1NY71 1HRV2 3TYJA 3GBGA 1VBD2 1MS4A 1QXJA 4YSFA 2DVBA 1LB2A 1TMF2 1AR93 2NPIA 1IPJA 4N43C 3WV6A 1TE1B 4R9DA 1SBFA 3N35A 2NMNA 2WT2A 3CO2A 2Q1ZB 4HVOA 4IQPA 3WDYA 1FMD1 4KNCA 3NAPC 1GR3A 4XILA 1DYKA 4YZ2A 4QQ2A 2DCJA 3OJBA 4J6GA 5EV7A 4W6YA 3NV2A 5D1IA 1POV1 1QJU2 2VOKA 4XFAA 3ZDSA 1FNYA 1UX6A 2X53S 4IEPA 1XQNA 1CONA 2A6XA 2DU0A 2JECA 5F1RA 1KDMA 5K8SA 4FO9A 2DU1A 5FAXA 1ZBA3 2R30A 5FOBB 2HWE1 4LLOA 2XLGA 1RTVA 1YRZA 3MLLA 4LUKA 3UKVA 3JB4C 2WLPA 3WW1A 1W6PA 2WSUA 3WCSA 1VJ2A 2Z79A 5T5JA 3M70A 3H1WA 5AFEA 1XNCA 1B09A 1MVQA 3VDDC 1YO8A 2EIGA 4IEUA 4AQ6A 1AXYA 1KDKA 3WG1A 1QY4A 2GC1A 4URTA 4AEJA 4FPEA 4CEYA 4CEWC 1MEC3 4IETA 5K0UB 1SLCA 3J4UH 1AR83 1WW4A 3POWA 1GANA 4YFZA 3ZN5A 1RB8G 2DCTA 1AR91 2AYHA 3AP4A 3WW2A 3L9JT 4K6BA 4QU2A 1BBT3 3B3QE 3KCXA 1GZCA 2P2KA 3W59A 2YMZA 1POV0 4ZXKA 1YJKA 4IV1B 4LUMA 1X50A 2ZMNA 3J8F3 3AKQA 4O9GA 5J98B 3UL2A 2WNVB 3WUDA 1ENXA 4JDNA 2EF6A 1OKQA 4JGYA 4EN6B 3IIAA 3CF6E 3K48A 1S0EA 1RUE2 2BWCA 3LB9A 3SISA 3WQ0A 1G6NA 5EZWA 5C4WA 3WDWA 3ZFFA 2YDEA 3PHMA 1RUH3 2VH9A 4K8FA 5L7OA 1BMV1 2R1BA 2BTVC 4MLOA 4Q4W2 5T5PA 4HVQA 3PNAA 4W65A 4BH9A 1NCRB 1KRIA 3GHNA 2HKXA 2ZZQA 2ZS6B 3CJIA 4H7LA 3WDVA 4BLJA 1C28A 3NV1A 4IEOA 2ES3A 4Z92B 3E6DA 4RQPC 5HCAA 4MGYE 1MEC1 4Y22A 4EN0A 5BNQA 3SH4A 1SFNA 1AR81 4XOGA 3AX4A 2GC2A 2QKDA 4YG0A 3U07A 4L9BA 5SV5A 4C1WA 1OSGA 2FQPA 2LM3A 4S2FA 4BPZA 1ULEA 4XETA 4KH9A 4EWDA 1BBT1 1X33A 2RS13 3N7KA 2D6NA 1PK6C 4LEJA 1WCSA 4WM8B 4IERA 2HWC1 3I59B 1V6OA 2ZCWA 2YHJA 1OLRA 2HYKA 4AVVA 1Q8QA 2WA4A 5FBZA 2XLFA 4CDWB 4HN1A 4XE9A 4YLZA 5I8SA 1LHOA 1R083 1LCLA 1SBEA 3SCFA 2OPKA 2P3KA 4FT8A 4ZKTB 1V9U2 4LA3A 4SBVA 4RS5B 3RPQA 1KFUL 4IEZA 1WA4A 4HL0A 4CRQA 2MEV2 2XL7A 2XG3A 4XJ9A 2C0ZA 4FCAA 3DL3A 3WCRA 1KS5A 3TOJA 4BA6A 1JYIA 5CFCB 2ET7A 3KCYA 1SCRA 2PHUA 1HX6A 4XQWA 5JIAA 3RI9A 4ISQA 4D7YA 5CFDB 1SLIA 2XBO3 3QH7A 3V0BB 3IPVB 3H0OA 1Z7S2 5HCBA 3ZXLA 4HFSA 2W68A 1W0OA 4YW4A 4AGRA 2Q8OA 2GMEA 2PTMA 3TN93 4M3CF 3VBOC 4G9SB 3ZSLA 3C2UA 1PZ8A 1DQ1A 3RWNA 1ZZ8A 2D6LX 3AMNA 2JJ6A 4ASMB 1IS6A 3QCWA 4YARA 5BNNA 2RS33 4GXLA 2EXHA 1TNFA 4BOWA 4OZXA 3IM0A 1QJZA 1XU2A 5J09A 4NHMA 5BXXA 1ZBA2 1GSLA 5FO8B 3O12A 2XUMA 1R081 4OHZA 1DLLA 4KG0A 3ZSKA 1CIWA 4B4RA 1W6OB 1FX5A 4YM1A 1VBB2 4PIZA 1A3KA 1UU4A 2WA3A 2W08A 4YVWB 3UKNA 2GNMA 4DOUA 2XKOA 4KGQA 4LO5B 1FPN3 4FXGB 4JTNA 2VMHA 1KD7A 3OBRA 2MNGA 2XBO1 1HV1A 3N3HA 1OOPC 1LHWA 4WVVA 4J1WA 5FLIA 1HXS2 1C8NA 5CB7A 1LTEA 2R072 1REDA 4GKXA 3TN91 2CGOA 4YG3A 3R4SA 3WP4A 4BLIA 1QOTA 3S0MA 3FBYA 2JG9B 1ZX5A 2WLQA 3V56A 1D2QA 3QD6A 4L99A 4Q4V3 3AP9A 4JDOA 3ZFGB 4IEXA 2XJRA 2PLV2 2XJSA 3MIHA 2RS31 1F5JA 1OFNA 1NA1C 5K7PA 1ZRCA 5CG8A 2YYOA 1LU1A 1MZ5A 3HD8B 3MZHA 3MLJA 2BVBA 2IXIA 4LBQB 4DZGA 1RUF3 3JUUA 4AFDA 1D4M1 4DPNA 1EAH1 5GLUA 3WW3A 1AX1A 4HANA 1RUH2 5EYXA 1LOBA 4Q1RA 4X6RB 2QJVA 3MGUA 4C90A 4N7IA 3ZSEA 1Z78A 5KBFA 3PVBB 1AR63 5LRSA 1FPN1 4HK8A 3RS6A 1LHUA 2WNVC 4WVMA 1ND3A 1R1A2 3NSTA 1G7YA 2P3IA 4QQHA 2D93A 1O3RA 2VW1A 4IL7A 1QHDA 1ASJ2 4IV1A 3DUIA 4JV4A 3RJRA 5GZEA 4ZU4A 1LHVA 3FFQA 4JQRA 4XXPA 1N3QA 3DPRC 1QH6A 4QX5A 2MHFA 4KU8A 2DF7A 2YGMA 2RS12 5ABJC 1X8EA 3FMGA 3UJQA 3RYPA 4UXAA 1DGLA 4Q4V1 3KMHA 4XHBA 4W6XA 1V6IA 2A3WA 4QPYA 4FAHA 2Z69A 3RMXA 1F31A 1CR7A 1SLTA 1FATA 1W2UA 1KS4A 3H50A 1J58A 4JVAA 3THPA 4EWAA 5FTTC 3TB0A 1XNKA 1NCRA 1RUF1 5IK8A 3B69A 1Y43B 3VKMA 4HETA 1H0BA 4RHV3 4HVRA 4B4QA 4L11A 1C3HA 2CGPA 4XJZA 1FOD1 4YVSA 1H9PA 3E5UA 1Q8PA 1SACA 1ND2B 1LU2A 3TBDA 1NCQC 3FJSA 3AZXA 2DVDA 1RUD3 5E89A 4BM8A 1VIWB 2WNEA 1GZ9A 4LR4A 4FQZA 4I3PA 3ALQA 2WL1A 3WHUA 4WM8A 3BTAA 1BK1A 1VRH2 3NO8A 2CNAA 4XIKA 5AVPA 5GJ6A 1XNBA 4XW3A 5KHGA 4CDWA 5DUWA 4Q2FA 2ZABA 1K5MC 2HWD3 4I02A 3IWZA 3WT3A 3FWEA 3PVEA 4QM8A 1FXZA 4MUVA 5GZCA 4E9KA 5DDJ3 4PDWA 4QPIC 4RA0A 1AYM2 4AQSA 1GNZA 4N43B 1RUC2 1W6NB 5C8CC 2FHRA 2O0OA 2E7AA 5C9AB 5CFCA 4LE4A 1WW7A 5CFDA 3ECQA 3V0BA 2ZKLA 1JOJA 1WBLA 4N53A 3MPPG 3KD4A 1H8TB 3WX5A 4L8QA 3WW4A 2TBVA 2D44A 3DN7A 2D5FA 4RHV1 2HWB3 3LGRA 3GYDA 4WBBA 3URFA 3VBHC 2JX9A 2V5YA 2DVFA 4JCKA 5KXEA 3WZ1A 1GQGA 4YZ4A 3AB0A 3FZ3A 4LO4B 4QHBA 4XJAA 1JHNA 1VBC2 2YZ4A 3KZ4C 3WNXA 4AI8A 3AFKA 1CAVA 4AK3A 5BNPC 2E53A 1RUD1 2BNNA 4L97A 4AI1A 4F3JA 3M8LA 3IDCB 1Y9QA 2GN7A 1KJRA 2A75A 3V64A 5AC92 4Q26A 1A78A 3VZMA 2XJPA 1J59A 2GSYA 3VBUA 2WZR2 1DZRA 3O5SA 3ST7A 3VDDB 4Z8BA 4QQOA 2DUQA 4H3WA 4LBOA 5JPMB 1UW8A 4R9AA 3FC0A 2RR12 4UW6A 2P34A 2PHRA 1OQ1A 4OHYA 1UAIA 4Y1VA 1B35B 3ZVXA 2VECA 2QDRA 4OVEA 2QE3A 4K21A 2KA3A 1FT9A 4YVWA 4H14A 2OYZA 3VKLA 4GQ7A 4JAAA 1D0HA 1REFA 2BEOA 3POSA 1JBCA 2HEYF 2RJKA 2BFUS 3M7AA 5BUVA 3RMYA 5SV8A 4IEVA 4GALA 2WS93 2OW4A 1R091 3H1YA 4OI2A 4DY5A 4GB33 1OQEA 1XE8A 3BIWE 1WMDA 3W9AA 3ZFGC 5AFBA 1UF2C 5T5LA 2JICA 4HT1T 4COWA 2QFEA 3KGZA 1AR62 3R4DB 5H9RA 3VBFC 2HWB1 1PVC1 2IXCA 2VOWA 3O0XA 2ZTNA 2HWF3 3AMQA 4QPGA 3VL9A 1DQ0A 2JG9A 2WFF2 1IS4A 1WGPA 1MS9A 1ZZ7A 3D82A 1MACA 2IFWA 3TRSB 2YV8A 3M3OA 2QVSB 1LKNA 2R041 3ZXGA 3OY8A 3POYA 1JXNA 1PZ7A 1YIFA 4PBOA