3H8XA

Structure determination of dna methylation lesions n1-mea and n3-mec in duplex dna using a cross-linked host-guest system
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
204
structure length
204
Chain Sequence
HSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
publication title Structure determination of DNA methylation lesions N1-meA and N3-meC in duplex DNA using a cross-linked protein-DNA system.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 204
sequence length 204
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3h8xA00
4IE6A 3O1OA 3BIEA 4NIDA 3RZLA 3I2OA 4QKFA 4CXYA 4MG2A 3BTXA 4JHTA 4IE5A 4NROA 3O1MA 4ZS2A 4NPLA 3KHBA 3T4VA 2FDIA 3RZMA 4OCTA 2FDHA 4ZS3A 4NRMA 3BU0A 3O1SA 3H8OA 4IE0A 4O7XA 3RZKA 4NRPA 4NRQA 4QKDA 3O1TA 3BKZA 2FDJA 4CXXA 4IDZA 2IUWA 3KHCA 4QKNA 3BUCA 3RZJA 4IE4A 2FDFA 2FDGA 4QHOA 4QKBA 5DABA 3BTYA 3BI3A 3T3YA 3S57A 3O1PA 4NIIA 3O1RA 3O1VA 3I3MA 4NJ4A 3RZGA 4CXWA 2FD8A 3I3QA 4RFRB 3H8RA 4ZHNA 5F8PA 3S5AA 4IE7A 3I49A 3H8XA 3LFMA 3RZHA 4NIHA 3BTZA 4NPMA 2FDKA 3T4HB 4MGTA 3O1UA 4NIGA 4O61A
chains in the Genus database with same CATH superfamily
2VMGA 1RUE2 2ERFA 4KNCA 1KDMA 2BFUS 4CEWB 3SEEA 4K7JA 5A70A 1D2SA 1PHMA 1W9WA 2GU9A 1X8MA 1VBD2 3AP9A 3JCIA 3JQWA 3OCPA 3PTYA 4GWIA 4QDSA 1HV0A 4AI1A 2WZR1 4FAGA 1I3HA 4XZUG 1NOVA 1VB4A 2RMU1 1R082 2ZEZA 1RUG3 1YQ2A 2ZGLA 3B01A 4FT8A 1V6MA 4PDWB 5BNPC 4TLFA 3V0BB 1WA6X 1QJY2 2DYCA 4PLOA 5JIUA 2VQTA 3M3EA 4Y26A 2HYXA 2ZS6B 3NJYA 5CYYA 5F5CA 1PZ9A 1L7QA 2A73B 2W9XA 3KV5A 1BVVA 4QQ2A 1ASJ3 5FXWA 2YPDA 5A3NA 1UW8A 4YFWA 3HMYA 3RSJA 5IVCA 1AJKA 4K8RB 1UPIA 1PVC3 2VZTA 1CJPA 2C0ZA 3AMMA 5C3RA 5GZDA 2CTVA 3AYDA 3KCXA 1MS8A 3MICA 2VTXJ 1XNTA 5FY5A 2WN3A 3PU8A 1PO21 5FZ1A 5LBCA 1N3PA 3KT4A 1IS6A 1QJX3 2VZ3A 2WO3A 3I97A 2PQQA 1ZRRA 1XYOA 3LSDA 3ST7A 3UESA 1S4CA 1O59A 3OB8A 4HXCA 2FZ2A 3KQ4B 1M4WA 2WYFA 5DAPA 2BYVE 4CYDA 1QH6A 2ZHMA 4IV1B 4R52A 1VBB2 1QY4A 5ANNA 1IS3A 2WQZC 5KHHA 1DGWX 1YLLA 2WDBA 3TNPB 2FDJA 4XMAA 5B4NA 1NA1C 1MVEA 2EF6A 1ALYA 5KHJA 4S2HA 3VDDC 4AVSA 1UOBA 1UN1A 1QQP1 3KHCA 2JDNA 4XQ4A 3POIA 4QKNA 2ORZA 4I0BA 1IKPA 5FZOB 5LEJA 1W9YA 2I07B 4W6YA 1SLAA 1JHJA 1W6QA 4YGDA 3H9AA 5CVRA 5IT6A 5A3PA 1HV1A 1WMDA 2PTMA 2QE3A 3VBSA 2CDOA 1LGCA 3A4UA 3VD9A 4E9KA 4AEKA 4CPBD 5LA1A 4MXWB 4A3XA 4YNIA 2IVJA 1TG7A 3FLPA 3WUDA 3QOPA 3E97A 4AEDC 5BNOC 4UW4A 2Q1ZB 1UY4A 1YJKA 4Y4RA 1WW5A 1NY72 3K4AA 5SV5A 3VV1A 1HLCA 3WP6A 4AK3A 1SG3A 2BQPA 4GB32 1MS0A 4PI0A 4OHXA 2VUCA 3I3QA 3PMSA 3OUIA 4OI2A 2JG8A 5FK8A 1KEXA 4LBLA 2H0BA 4BQYA 2H6CA 1PIV1 4P9JA 1SDDB 1I6XA 1OUSA 2ILMA 3AC0A 3EXUA 4B4QA 2I2SA 4XUOA 2VVDA 4XQWA 4BYYA 5BNPA 2R6QA 3B02A 4OUSA 4XUTA 4YVSA 1KD7A 4NPMA 4Q4V2 1MS3A 2ES3A 4XAEA 4IGOA 4AFMA 2XUEA 4MYEA 1YFYA 2W47A 5EYXA 2HWE1 4ATFA 5JSOA 1LNSA 1QF3A 4JRLA 2GC0A 3ON7A 2ADDA 3ZIXA 4A3ZA 2E31A 2G19A 3ROUA 1RXGA 2G9FA 1E5IA 2JG9C 2NM1A 3H3ZA 4TN7A 2N7GA 3D82A 1ASJ2 4K21A 2PHUA 3I2OA 3TN91 1XYNA 3NV2A 3FBYA 3VHOA 4BQ5A 1GQPA 2ZTNA 4DRRA 4Z1VA 1CPMA 4JHTA 5FLHA 4N90A 5DUXA 4DXRA 1SLLA 5D1IA 5A3TA 5FFOC 1GSLA 4GWMA 3I3EA 4KMQA 3MUY1 1BMV2 2B42B 4XJUA 1JZ6A 3O1MA 2VW2A 3BPSA 4HMZA 4QXBA 2PAMA 4YGBA 3RDIA 4TZDA 1ZZBA 3VBHB 2PLV2 4D0QA 2MEV1 1POQA 1TMF2 1OOPB 4NUBA 1REDA 3I2IA 2JD4A 1AYN3 5JZGC 5L7OB 1OA4A 1PM7A 3IZOA 1W0OA 1LTEA 2XKOA 2WFPA 1CZSA 5FZHA 3RGBA 4AQ6A 3VHNA 1H1MA 1RUF3 2ZGOA 4NHMA 2BNMA 3ITQA 3M3CA 4K3UA 3SCFA 4HANA 1N1TA 2PHTA 4WZCA 1YYNA 4CE8A 1YUDA 4AQTA 4DXZA 5A1LA 5FY8A 1UOGA 1QJU1 4CU6A 1LRHA 2HBUA 2WABA 3ZX7A 2CWMA 2FZ1A 3N4MA 4MVTA 4MGKE 4B29A 1G9CA 4IUGA 1DIWA 4Y5TA 1I9RA 3NQHA 1F9KA 4CCMA 4XFHA 1FOD2 2Y6GA 4UFIA 4NOTA 1OMIA 1T2XA 5LB6A 5J09A 2A71A 4FTEA 1LGBA 1YFWA 1YHFA 3KLSA 3WF3A 3MGUA 4CUAA 2RR13 5I0SA 2ADEA 2VOVA 5FWEA 1RHI3 5E89A 3KT7A 4CP9A 4OI4A 3NNMA 3MF6A 2YZ4A 4QHOA 1G9AA 1AZDA 2GH8A 5DMYA 4KQ7A 2GALA 5FPZA 4E8DA 3PHMA 3QH6A 2W1UA 1ONAA 3J8F1 3AMHA 4X8NA 5BXXA 5B2GB 1AR83 4A42A 1QDOA 1UYYA 3OTFA 2ZKLA 4QPYA 2LS6A 3AMQA 1GANA 1PMHX 3NMBA 3MIEA 4B1LA 2AYHA 2E26A 2WNUC 4RR3A 2G1MA 1C4RA 2GN7A 3LA7A 2R30A 2YC2A 2JE8A 3VBOC 2UYBA 3ZFEA 4RS5A 4B3NA 4N9IA 4XXAA 2PAEA 1DYPA 1VBC2 3PTRB 1Y43B 2BTVC 4MHUA 4ASKA 5LA2A 4BM8A 1N1YA 1AHSA 2WNVC 4MH0E 1OC1A 5A3LA 1SBFA 1HDKA 2RE9A 4JTOA 3B69A 2VC9A 3W20A 1XOYA 1YQ5A 1ZBA3 3HWJA 2VMHA 1QU0A 2VM9A 3CKHA 3IIAA 5EZWA 3ZYJB 4BQWA 4LO4B 3ZN6A 1H1AA 4BQ1A 1RUJ3 3VKLA 3NNLA 1YRZA 3DPRA 3J26N 1AYN2 1LAJA 2BBVA 1OPOA 5F9TA 3UGHA 3INAA 3ZSJA 1S0EA 1O5UA 3K46A 4BOWA 3JQXA 1FNYA 4Y20A 2WSUA 4KL1A 3WF2A 3ILFA 4WM8C 2QQUA 1RUF2 3AP7A 4HT1T 3KCYA 5H9RA 4ZZ5A 2EAAA 3LSEA 4LHSA 4JC1A 3OUJA 3OBTA 1NQDA 4XCAA 1JYIA 1W8FA 2YPJA 4FO9A 4QX3A 1XNBA 3SKVA 5IVBA 5LY1A 3OG2A 3S7EA 4LMFA 4AI3A 1W6MA 3T2OA 1IG3A 4URAA 1UZVA 2IFRA 4BQ3A 2XKPA 4Q26A 5F6KA 3G7DA 4YGEA 4IGQA 2VBBA 4OMDA 3EB7A 4Q0PA 4YW3A 4XUQA 1US3A 2O8QA 1W8TA 2HWF1 4KWKA 4XURA 1JZ8A 5FYSA 1GOFA 5C3OA 3RZMA 2GDFA 1XNAA 2A70A 3MFAA 2C26A 2JG8B 4Q4X1 1VRBA 1FPN1 3R05A 1SHWB 3WSOA 4D7SA 3W9AA 2J1SA 2Y0OA 1C8M3 5F39A 2WZR2 4O9EA 5A3UA 4XF9A 1VAVA 1W99A 4ARXA 1V9U1 1RHI2 5D8AB 5FDBA 2JJ6A 2XMLA 4KG0A 3ENRA 1BBT1 1CAUA 2XVLA 4NWVA 3WF4A 5DUWA 4YVSB 1SCRA 4AI2A 3LE0A 1TNRA 1W03A 3Q8AA 3E5QA 4YM0A 3BKZA 1ZRFA 3PIJA 1JZ3A 4D7TA 4CP1A 1NCQC 1W8HA 3LWCA 3DKQA 4MLOA 2VL4A 1GQHA 4UBHA 4W65A 4DPNA 1G9FA 2BDRA 2DTYA 3S0MA 3LEMA 4J25A 1CVNA 3OD4A 5FPUA 4EN9B 2E63A 2RS51 3N7KA 5FYIA 3U4XA 2P4EA 2DVAA 1H2NA 1W6PA 4CUGA 4YSFA 2ZJCA 1PO22 2X10A 3M4FA 4N43A 1WMFA 4C8DA 3MF9A 3UNPA 4NPRA 1CESA 1OLQA 2EIBA 3ES4A 4QKBA 3B9CA 1H9WA 4JGYA 5DABA 2Z69A 3AKPA 4UFLA 2VMEA 5G04L 2D3SA 2WRAA 4BK4A 1Z7S1 2P37A 4ZY9A 4BMEA 2V73A 5L73A 2EICA 1MZ6A 2P3KA 2WIIB 2RDQA 4P14A 4FOYA 2VBPA 3UT0A 3VZMA 2WA4A 1LOFC 1PGW1 4RGKA 1F2NA 1WWYA 4LBOA 1D0GA 2ZZQA 3V0AB 4M3CE 1QOOA 3CJIB 1OD3A 3IDCB 5FMDA 1KFUL 4BPZA 5FRAA 4Q4W1 1HQWA 3VDAA 3HJRA 2WO7A 3RWNA 4QU1A 2E53A 3S5AA 1RUJ2 3DYPA 4FFFA 4UT5A 3D8CA 3KGLA 4XJ8A 2IWGB 3ZVXA 3LDRA 4Z2AA 1D4M3 3JBG3 3WDYA 3RS6A 4IL7A 3U75A 5IVVA 5JXJA 1MS5A 4OHYA 1RVF1 2BV4A 2VW0A 3WP5A 1LOAA 4CEWC 1GZWA 4IE6A 3ZMNA 2JIGA 3C7OA 5FPXA 1VBA3 2QBXA 1S0FA 1KRIA 1XNCA 4LORA 1DG6A 1O3QA 1DGLA 2QJVA 4DO0A 1MS4A 2P34A 4CSWA 2BFUL 1VBD1 2GZWA 1B09A 1BCXA 2YU2A 1CIWA 1N3QA 1BEV3 3MLKA 2W68A 4DXTA 1JZ2A 4W4ZA 2EVXA 1W8NA 4PDWC 1TVGA 1D4VB 1PMJX 2D5FA 3AP6A 2XJSA 4LK6A 2HH9A 3UK9A 3W58A 5DAQA 2YG0A 2W3JA 1JU3A 3U4SA 1F8VA 1IG0A 4AXOA 4S2DA 2ZX1A 1PZ8A 1WA4A 5C33A 4QB1A 3LGRA 3ILNA 1ND2C 1JUHA 1JUIA 3VKMA 1WLTA 2Y26A 3PVOA 4YM1A 2QQIA 4QM9A 1VRH1 3ETPA 2WS91 1VP6A 2B5HA 2FCVA 1AYM1 5T3NA 1W05A 1PK6B 1JYXA 1ZZ8A 5LATA 2FDHA 1WW6A 1LHVA 4Y1ZA 3TN92 2A6YA 2ZGNA 3MYXA 4CCDA 4PLNA 1QHDA 1GV9A 1IPSA 2WZPP 4KU7A 4Y1UA 2XL7A 4XE9A 5L19A 3AMPA 1CONA 4KBBA 3ZFEB 5G05L 1CAVA 4NIAA 2Y6LA 1UD1A 4IV1C 5DG2A 2CYFA 1OH4A 2OUJA 4JKMA 1JN2P 3VKNA 1VBB1 2BW8A 4I02A 4JTNA 2JD9A 4NRQA 5DQ0A 5FZIA 3SEPA 4CDUB 4Y24A 4XETA 2XR4A 3AZWA 1G9DA 3S6PA 4Y5Z0 2HWD1 4LK7A 3VBUB 4AVVA 1B35A 4IGPA 2F6BA 3WNOA 2DBIA 1UZ0A 3I2FA 2W46A 3THTA 3ZN6B 1JODA 5FOJB 2B7YA 1BHGA 1NLRA 2Z42A 3ZSEA 2VG9A 2E33A 1H30A 3ACFA 1LESA 1XB9A 2AR6A 3D3AA 3DPRB 4UF0A 5K0UA 4YW7A 3RZZA 5DDJ3 3ETQA 1ENSA 2XHNA 3H3LA 1HN1A 4BMBA 1C1LA 2VTFA 3UKTA 3Q8CA 4GMP1 2CGPA 3LIGA 4FPHA 3HIFA 2VNRA 3SLIA 4CZSA 3M1HA 4B4RA 4COUA 2BGOA 1D4M2 2ZAAA 4XDPA 2HEVF 3JBG2 2OKXA 1POV0 1US2A 4W6XA 5T5LA 4CEWA 2EA7A 3LA3A 2H0VA 1X36A 2R071 1SFYA 4AI9A 4GKYA 1X8EA 4WVVA 2PHRA 3Q8FA 5M0TA 3LB9A 4BQ2A 1LHUA 1T6BX 1VBA2 2J7MA 1SBDA 1V0AA 1DLLA 2XDVA 4HKOA 2BWAA 3DYOA 1YIPA 3JXSA 2D6KA 4IE7A 4N8MA 1S0BA 1W6OA 5K7PA 3V0BA 1OA2A 2WFF3 4GD4A 3WDWA 4Q4V1 1H0BA 4XHXA 3SCHA 4FFGA 1CAUB 4MGIE 1RUG1 4PBOA 3J8F2 5IK8A 3RFRA 3VB9A 4LO5B 2XG3A 4S2GA 3DF0A 5J7MA 2A6VA 1UY0A 4BA6A 4NVPA 3WQ7A 4EQVA 1YEWA 5A1AA 1DQ1A 2ZOEB 1X9TA 5L36A 3O0VA 5F3IA 1EPWA 5T52A 1OLRA 3A7QA 4OYUA 1ASJ1 1GP6A 4CEYA 3ATGA 1F4HA 1O4YA 3BYWA 4LTAA 3AZZA 5DZFA 5FLJA 1QNYA 2O1QA 5FZ0A 3MLLA 4NHLA 4F8AA 1ZBE3 2GNBA 2QFEA 1PVC1 2JDMA 2XJPA 2WKKA 4DIQA 5GJ6A 2AC1A 1W2NA 1Y3TA 2A6WA 2WBKA 2LW8A 3N7JA 3OGJA 3H1WA 3OEAA 3OY8A 1W6NA 3NL1A 4H2AA 4JGYB 4PIYA 4QHBA 3P6BA 1BMV1 3I3DA 1NUKA 3ZFFA 4COWA 1QJX1 2G4IA 4I0AA 5FWJA 5HCAA 1AXYA 4XYXA 3VBHC 4IV3A 3T1LA 3J7MA 1EV13 1RUD3 2EXIA 1OOPC 2Y60A 5L7OC 1U5XA 1RUH3 3ZN5A 5A3OA 5KR7A 2VZUA 2CAUA 4BQ4A 1KQRA 3BODA 2ZCWA 5FZOA 2JICA 3FL7A 2Q8DA 4Z92B 1RUOA 1JOBA 4MX3A 2XUMA 1Y4WA 3P1IA 5FJKA 3ELNA 1Q8PA 2D6PA 1HW5A 3PURA 4Q4Y3 2W0XA 5LRSA 2XWBB 5LASA 3CBNA 3OOXA 4HSLA 2UU8A 1PX3A 3E5XA 3ZXJA 1LCLA 1K5MB 3CQOA 3ZN4A 4O7XA 1UWWA 2UY9A 4PLMA 3HPNA 5L9VA 3WG1A 1QWRA 3LCPA 4QD2A 5F5AA 5DDJ2 5K9YA 1OXCA 1LENA 3MHZA 4QKDA 4G4FA 3N9PA 5KHKA 1FNZA 5D2AA 1TNFA 4CRQA 4D6SA 1ZNPA 4LHLA 1LKNA 3AYCA 1EY2A 4OI0A 1GZWB 3AKSA 5KC5A 4Q1RA 2OYZA 2HWF2 4QDQA 5HCFA 3UGGA 1XQNA 1IOAA 4XJAA 2CSGA 2HLEA 5E8AA 3C2UA 4M3CF 2NYYA 2DWRA 4J1XA 1C57A 1UXZA 1Y7BA 3ALQA 5LY2A 3VD5A 2ZBJA 2WN2A 1JYNA 1V9U2 1C8NA 2W1QA 3USUA 4HK8A 5FMOS 4OI1A 4BB3A 2E32A 2Q8EA 4C0BA 4E8CA 4YARA 4XBQA 2XVKA 4K1ZA 5KXDA 3S57A 2QVSB 3W21A 1REEA 2WFF2 4JDNA 3JZVA 4JQTA 4DFSA 5A7WB 3O1VA 1HB4A 4GH4A 2WJSA 3NWKA 1WCUA 3BALA 1YCIA 4ZZ8A 4W6WA 2RV9A 2QQOA 4YGCA 2VOWA 1NCRA 4LOSA 1EUTA 2XLFA 4PF1A 4UW3A 4CU8A 2RS52 3VZJA 2MPFA 3JUUA 2RS33 2Q8CA 3POYA 2J1EA 2C5DA 2IZWA 2ZZJA 4LKSA 3WW1A 3TEXA 5F8PA 2AENA 3U78A 4TTGA 1COV3 1IQAA 4X6RB 5FXVA 2WL1A 2E7AA 4YW5A 2D3PA 1ZZCA 1Z7S2 2GNTA 1CAVB 3LOBA 1BLZA 2NMOA 3SKJE 2DUPA 2B45X 4QPIA 2PHDA 2XL9A 5AC93 2UWAA 4EN7B 4M3CB 1ND3B 4AFCA 1OOPA 1UMIA 3UL2A 5A7QA 4MO3M 3POFA 3PMEA 2CNAA 4UYBA 3WQ1A 3IB3A 1V6OA 4LR4A 4QQOA 2BOJA 1RUD2 2ZEWA 2VVFA 1CWPA 3AB0A 3MO4A 1E5RA 5APAA 3IMNA 1AYN1 1UMZA 1VBE3 4DY5A 3P3PA 2TEPA 1H6XA 1POV3 3G6JB 1NQJA 2QQJA 4UF0B 1RUF1 1D2QA 1DGWA 2OA2A 1W8ZA 3D6EA 3VBSC 1DQ6A 3QD6A 3N3HA 4QM8A 4Q4Y2 1Z0HA 2RDNA 4FTBA 2A1XA 1BK0A 1ZRCA 4NPLA 1XXNA 2RG4A 1ULDA 4NHXA 3NAPA 5HCBA 1O8SA 3ES1A 2X8KA 3VBFA 4E2GA 3WOGA 1S0IA 2UY8A 1UYXA 4F7ZA 1RUC2 2ZA9A 4CCOA 1O5LA 2JG8C 4ZS3A 1O7FA 5BY5A 3R6SA 1CQ9A 1W8WA 4FTSA 1XSQA 4K8FA 2P3YA 1BKZA 1D0HA 3SHRA 2JXAA 3E6DA 2QCSB 1LOBA 3ACIA 3AYAA 2GMMA 1Q8QA 2CAVA 2RR11 2Y64A 3ABZA 4W50A 4AQ2A 3PUSA 1RHI1 4IEWA 5I0RA 2BPA2 2ZX3A 2P1BA 1W6OB 4YVSC 4MUVA 4J6GA 5GM0A 2OQ7A 1PO13 3KCCA 3RNSA 1TEIA 3WHUA 4BXSV 1MR5A 4IDZA 4QAWA 4XF4A 5FREA 1F35A 2JWPA 5JXHA 1RUI3 4LIUA 5FTTC 4H7MA 4CDQB 1MQTA 1VRH2 1V6LA 2WS92 3K4ZA 2AACA 3AYEA 1LECA 1K45A 3QBQA 1AYM2 1QDCA 4FQ4A 4P9GA 1UPSA 5FBJA 1AR81 4K40A 5EWSA 4KWJA 4ZU4A 4COYA 4CEYB 3W5MA 2EXJA 4UXAA 1V00A 2VZOA 1ODNA 2HKXA 3M3IA 5EJ3A 2RS32 3DL3A 2C1FA 4PF5A 4G3YC 3J7HA 2YYOA 3HBKA 3C3VA 1SLCA 2W1WA 3OY8B 2R043 1W6NB 2C6SA 2ZGRA 4P9LA 3BVCA 4BIFA 2LALA 3ZFFB 3H1MA 3VBRA 3AL6A 1QIQA 3D4KA 4IV3B 2R16A 1FATA 2HWD2 5EIYB 2DBNA 4DZGA 4RA0A 1GUIA 1CN1A 2Q5TA 4LKEA 2A3XA 2X5IA 4P9YA 3WNMA 3E6CC 1EYBA 3IN9A 4YZ2A 2BERA 5LBBA 1ZBA1 3AZYA 1JZ4A 4PI2A 3AZVA 4E4HA 4HK9A 1FT9A 2DV9A 5JPMB 1RUJ1 3WCSA 3H8XA 3T0BA 5A7SA 3ZFGA 1VBE2 3T30A 3WDTA 5CNAA 5A7OA 3GJBA 1QEXA 4LBNA 2JENA 4DUXA 1QJZA 4I09A 5EYYA 3MPPG 3H3UA 4JKKA 1A8DA 5AVAA 1CZTA 3LPFA 1MEC3 2DU1A 3A22A 3Q8BA 4UFJA 2D5HA 3M3OA 2R072 2AH2A 5FQ0B 1CD3G 4QXKA 5FXXA 4C90A 5FZLA 2UURA 3OEBA 4CUBA 2VCMA 4GKXA 5CZKA 1ULEA 1S1AA 2V5DA 4OULA 3WNPA 3NVCA 4YLZA 4I3PA 1W0NA 5JWPA 5FZ4A 5D8AA 3ZR5A 1K42A 1HRV3 1PM4A 3OGGA 1N47A 5EXOA 1VAKA 3IPVB 1DFQA 3ZSKA 3USUB 1CX1A 1C8M1 1W2TA 3WR0A 2W95A 4HVRA 1OFSA 1KS5A 1QGLA 4FPLA 5LW9A 1RUG2 1RL3A 4LEJA 4YVWB 2PHLA 5A1FA 4I3GA 1YWKA 2VAUA 2VCBA 1OD5A 3LZZA 4GH4B 4AW7A 1ZA7A 2GMPA 3B3QE 2ENRA 1BZWA 4K20A 2VY0A 1NCRB 4IEXA 5IK7A 1RUI2 4KBZA 4AGGA 4LKFA 4AI0A 4FPKA 2OPKA 4RR3C 1AL0G 1NZCA 3A23A 1PVC2 3B7MA 4ES9A 3WNLA 1DQ2A 4QPGA 3ZFEC 4RS5C 2OX0A 2PA7A 4QB2A 3U11A 5I93A 4HVOA 4AAPA 2D43A 1CX4A 2BP6A 3I2JA 2SBAA 4A7YA 2VXRA 1U5YA 1QJX2 4J1WA 5EHDA 3ZO0B 2Y38A 1AR63 4JX0A 4HFSA 1H9PA 4QPIB 2WR9A 2B4KA 2IXIA 2ZHKA 4V2WA 3VL8A 3V0AA 1GR3A 3CJIA 1XNKA 1SEFA 1JOPA 1JZ5A 4HLTA 2J1AA 3ZKYA 3DPRC 3FLRA 3USSA 2Z79A 2WQ4A 2A6ZA 4NR1A 1W2UA 2ZMKA 3APBA 4Y33A 4CCEA 5CA6A 2WQ8A 3T0AA 4AG4A 2IVIB 3OUHA 4IEOA 2LM3A 3D0JA 4ONUA 4LLFA 4NN0A 2BJSA 5L9BA 1DCSA 1OH3A 4NIIA 5A80A 4CUCA 1UX6A 1D4M1 1F5FA 4PQ9A 3GALA 3ECQA 3JBG1 3K2OA 1WKYA 1YFXA 4N7UA 1W2AX 3NAPB 3SITA 2YHJA 1UAIA 5CFDB 2ARXA 3VBFB 2F4PA 1F15A 1SPPA 5LCWL 1PVXA 1MEC2 4R4ZA 5FO7B 3T2TA 3SH3A 4DB5A 1VBA1 3E6BA 4MGQA 5L9RA 2LROA 5DZEA 1GZ9A 4N9HA 1BJQA 4AAXA 4QX7A 3NJXA 4UW6A 3WT3A 3ZPOA 4JGZA 4BWOA 1A8MA 1W9FA 5LK7B 4U36A 4Q29A 3WZ1A 1BEV1 2FDKA 1WMXA 1HIXA 4XHBA 4Z2WA 3KF5A 5FYHA 4OHZA 1WUVA 4YZ1A 3BGAA 5DUVA 2IXCA 4NO4A 4ZU5A 5CG9A 5D21A 1O3RA 1MACA 5C5TA 1CAWB 4QPWA 1JHNA 5CKNA 5BUVA 2VMFA 3POEA 5BYNA 4CVUA 1IKQA 1PK6A 2PHWA 2RMU3 3D5OA 4KH9A 3FMGA 2JDPA 1MQTB 5ABJB 4MXVA 4QGMA 1VALA 4E2QA 5IJRA 2HJIA 3FHQA 4QKFA 4FXGB 4CXYA 3WG3A 2DCJA 3HOBA 4N43C 3R4DB 4Y4YA 5I8YA 1CZVA 3GZUC 4CDWA 3FUQA 4JGYC 4YM3A 2WZEA 2GAUA 4HPKB 4CDUA 3AKTA 1NLSA 3DECA 3I3BA 2FQPA 4D6RA 5LEKA 1WCDJ 1MS9A 4DUWA 2VE1A 1WZXA 1IGOA 3VBUA 3VBRB 2OW4A 1DQ5A 2WLQA 4FSJA 3CMGA 3ZR6A 1RMU3 2VUDA 4LBQD 1LULA 3Q8EA 4AZZA 4EN8B 3ZYBA 1AL23 3VKOA 2ARCA 4OCTA 1LU1A 2HWC3 4EWAA 3OPZA 2X5IB 1OURA 2RS13 2XH6A 2X05A 5FO8B 2BNNA 3BU7A 3O1SA 4N53A 4Q0SA 2DVBA 5KHIA 4DEQA 1K5MC 2D97A 4IEYA 3H8OA 1SLIA 3UYJA 5CB7A 3ZXAC 5J1XA 1AR73 2ZPXA 3ZFGB 5DDJ1 5FY0A 1EUUA 3C7HA 5T54A 4IXLA 1Q8VA 2GP3A 2W91A 2IXKA 3T0DA 1BYHA 1S0GA 3A0NA 2W5FA 3P3NA 1UL9A 3BPZA 5FUIA 2D7FA 3KWVA 2BRTA 3EJKA 1NE4A 1DBNA 2R063 4G9SB 4PIXA 5EFUA 1JXNA 3AM2A 3N36A 4CPBA 3WINE 4N7IA 5GALA 4FPJA 2WWJA 4P00B 4Y5SA 4KWUA 1F5JA 1RXFA 2RR12 1SBEA 5FUPA 1OKQA 3VZNA 2ETEA 4LE4A 1FX5A 4AGVA 1AR93 1BVP1 4OZOA 1VE0A 1S0JA 3TB0A 1SCSA 3DXTA 3HVDA 5FMOL 3O1RA 2WFF1 1F4AA 2CWSA 1AXZA 2VZRA 3FFZA 4LQRA 1W8OA 1HQNA 4YW6A 2PMWB 3AL5A 4JCKA 2XBO3 4OLLA 4MGZE 3GNEA 2ATFA 2FMYA 4LITA 2QKDA 1GZTA 1AR82 4RYDA 4X6QB 4XTPA 4FI9A 1D7PM 4CCNA 5ACA3 4OMCA 4Q1PA 4XJZA 4A6SA 4KGQA 5F7UA 3SCGA 5JVVA 2PAKA 4A41A 4ITCA 4MGYE 3I8TA 1DF0A 4BE3A 4QPGB 3POBA 2Z5WA 1V70A 3BN6A 5KXCA 2PYTA 1LODA 4DINB 1ZBE1 1ZREA 4YM2A 2ZGUA 3CLPA 4I0WB 2A3WA 4DNYA 2BUKA 4NIGA 2DDUA 2E7TA 2P17A 3IKWA 4X8PA 5CFCA 2C9AA 2JB8A 1ULGA 4JZRA 4AF9A 1SFPA 4D8MA 4D3WA 3OGRA 3POGA 1B35C 1RITA 1EV11 4NAMA 2RM23 2NZ9A 1RUD1 1WD4A 2NN8A 3MI8A 1AX0A 1RUH1 1UZYA 2PHFA 1RMU2 1ULCA 5EJ1B 1ZBA2 4IESA 2Y8KA 5K0UC 1K5MA 1R1A3 2RS12 4OFGA 3W5NA 1X9PA 2XB6C 4BJ0A 1GWKA 4IW3A 2CDPA 2CY6A 3X29B 5HXMA 4Q4Y1 1IZ3A 1T6GC 2VZQA 4NMIA 4R4XA 1R64A 3D0SA 1NA1B 4D94A 2J1VA 1AR72 2B9UA 2R1BA 2VU9A 3VDDB 4WBBA 4COZA 5J36A 3GXUA 5C8CB 1GWMA 2XONA 4O9GA 1R1ZA 2W94A 2WT1A 1RUC1 3MIFA 4UAPA 4DY3A 1H8VA 4CCJA 4AVBA 1SPPB 2MNGA 2XXZA 5GZGA 3GBFA 2B39A 2XJVA 3I2HA 2ZGQA 2QDNA 5I8SA 2R062 3VKFC 3WHTA 2OIIA 2DUOA 4EROA 4FP3A 3RG0A 2QQMA 1NLQA 4JGZB 3I54A 4M0HA 1MZFA 1PZ7A 4QT6A 1C8M2 2OZJA 2VCAA 5JAXA 5A7WA 3TEWA 4L8QA 3WXPA 5C8WA 4SBVA 1H4GA 3L9JT 1W9TA 2P3JA 1AF9A 3B00A 4P9IA 2Y6HA 5F6LB 2DURA 3WW4A 3N7LA 4R9CA 5EPAA 1QJEA 4LBMA 2DF7A 3FUOA 4WZFA 5FPBA 3VD3A 2WWSA 3R0RA 5IFTA 1O6UA 2B9VA 1O3TA 1YNAA 2RJ2A 2V72A 1ZRIA 4P02B 4CEYC 1FAYA 4RGAA 1UYPA 2A6XA 1UCXA 4YRDA 5J48A 5FYBA 4QX2A 4MOAA 2RS31 5ACA2 2R0FA 2A7AA 3SNMA 3GZEA 4CDWB 2ARBA 4LE3A 1ZZ6A 3ZFFC 4M3CA 1ND3A 4BQXA 4XJWA 4NJ4A 5FYUA 4IV3C 5A32A 2YB7A 4QX0A 4EWEA 4KGGA 4GULA 5FZMA 2JG9B 2Q1MA 3JD73 4GWNA 2XVGA 2QTWB 5IVYA 3TWIA 4LUKA 5AC91 1PGL2 3SH4A 4A4AA 3SXWA 5J37A 3VHRA 2BNOA 1WMEA 3DYMA 4M01A 3MBWA 4XFBA 2WT2A 1Q8SA 1K5JA 2RM22 1UOFA 1DDLA 5FZFA 3BOPA 3N35A 5FUNA 3ACGA 3LFMA 3K75B 4QU2A 1LOEA 1HN0A 2EIGA 2D44A 4N53B 1I5PA 4OUEA 3PNAA 4DRVA 5GLZA 1VBE1 1HQLA 3CEWA 4PQQA 3GHMA 1E5HA 1HJFA 4H14A 4KWLA 4XBNA 1POV1 1WCSA 4XIKA 4FAHA 2VNGA 2ZX2A 2O14A 5F2WA 4C0HA 3CNAA 4ZXKA 1C28A 5FZGA 2IXHA 2JDAA 1LHWA 4FBFA 4CP0A 5FV3A 3OF1A 4GQ7A 3PUHA 5DZGA 4LJHA 2VZSA 3M8LA 4RD7A 2Q30A 3J9SA 3KD4A 3IAPA 4M4PA 3KVBA 5FYVA 4FCAA 1H1IA 5LA0A 2WYSA 2OPWA 4FPCA 1SMVA 1BEV2 1X33A 4GMP0 4XACA 4QX1A 3DV8A 1GKBA 2K0GA 4RFT0 3H7JA 2FHRA 3L2HA 5JMOA 1YC61 2IXLA 3H0OA 4YW4A 4GH4C 4I30A 5GLUA 4CDQA 1AJOA 4YG0A 2CHHA 1PNGA 2KM2A 3U37A 1PO11 3OBZA 2O0OA 3MIHA 1NCRC 3VZLA 1SLBA 4JDMA 4E4SA 3MV11 1RUI1 2X09A 2D6MA 2KA3A 3PUAA 4UWDA 1OI6A 3POWA 4WVMA 2IC1A 3S7IA 2YBSA 2ID4A 5A6XA 3E5UA 3MW3A 1G9BA 1XE0A 1GMMA 1KFXL 3NO8A 1A34A 3LPGA 5FZAA 1LEMA 3AJZA 3ZXFA 5EV7A 3THPA 3RI8A 5I0DA 2NMNA 5CG8A 2XGXA 4NHYA 2F4LA 1W8UA 1N1SA 2XJQA 3AJYA 1WLWA 2PFWA 3B5LB 5A7NA 3I2DA 4QPIC 3WNNA 5CAZA 3AX4A 4IEQA 1XNDA 3NSTA 3R4SA 3N9OA 3U14A 1SQ4A 2RDRA 5AVPA 5GLWA 4FOQA 5CFCB 2R041 1NYWA 3HD8B 1SACA 1HB1A 1TME3 2OUHA 2VZVA 1PX4A 4AWDA 5KWRA 3O0WA 1HRI3 4FQZA 3T08A 3V64A 4C91A 2WNUB 4XILA 4CCCA 3JD72 4LA3A 2Z2SB 3WD5A 4DEVA 1GWLA 2JIJA 2VW1A 1LB2A 1K12A 3MIBA 2BZDA 1ULFA 4AR2A 5DG1A 1GNHA 1UU4A 1U12A 1J3RA 4XBLA 3UGFA 4LA2A 5FKBA 5F32A 4AHZA 1LOCA 1U0AA 5C9AA 2WNVB 4XCBA 1Y9GA 5ERLA 2A3YA 4AFAA 3I4IA 2JEMA 4DOUA 3BOWA 1FI2A 4TXWA 5FQ0A 3NAPC 3OSDA 5FLIA 1W28A 3GYDA 3VUOA 5JI7A 3ZDSA 5KHGA 3VBFC 4I2OA 1UZZA 1RUNA 3PVBB 3LEIA 4I01A 1MEC1 4XEZA 3C7GA 5DAXA 2VOTA 4A2UA 3WW2A 1OHFA 3VZOA 4CDXA 4L92A 1WW7A 2I45A 3MEPA 4WM8B 3R4UA 4CTEA 2JB4A 2YC4A 3RQ0A 3IPVA 5IUQA 3GGLA 2ET1A 5LWBA 3BTZA 4E27A 5B4XA 1GNZA 1RUE3 2BOIA 5FZ9A 1ZYBA 3LA2A 1ENRA 2ARAA 4YVWA 5A6YA 4IEVA 1HRV1 4MGTA 4RQPA 3IBMA 5JIAA 4O61A 3AMNA 1H4HA 5DN2A 4Z07A 4P08A 3WLUA 5FPAA 2AZ5A 5DAWA 3V65A 1MQTC 5ABJC 2YUEA 1R083 4BCUA 5C5UA 3AVRA 2Y34A 2YBKA 5C4WA 3ZMOA 4WM7B 3TAYA 5FYMA 1QJY3 3O12A 1N3OA 4QXCA 3SQOA 5JOYA 3LDKA 1DZTA 4NROA 1RJ7A 4EZ4A 4A6OA 3EBRA 2BWCA 1ZBE2 1JOJA 1P8JA 3WDXA 4Y1XA 1FXZA 2BVBA 3ZSLA 1TE1B 4MV2A 1Q5OA 3KHBA 3A21A 5BPXA 3HEIA 3VBRC 1YIFA 2CV6A 2WAOA 2XQXA 5F5QA 3UJOA 3KV9A 5DAVA 4E4ZA 4FVVA 5FYCA 5A32B 3RJ2X 3HBZA 3CDZB 3WG2A 1AR61 3GF6A 1EV12 1O8PA 2QQWA 2X5IC 1QJFA 2J22A 3PU3A 1RUH2 4L11A 4YG6A 2DCKA 4YWAA 5BNNA 5AFBA 1JMUB 1TME2 3WP4A 4EJRA 4GA9A 1HRI2 1IHMA 1CJDA 2VQ0A 1OT5A 2ZXQA 3WV6A 2YBPA 1C5HA 1OF4A 3ZFGC 1ENXA 3DN7A 3B93A 3RZKA 3TEZA 1SDWA 5F37A 1GYKA 4GJYA 2H6BA 4E2SA 4LBQB 3IT8A 4AHXA 3O5SA 2V5YA 2CGOA 1VMHA 3MW4A 5JCTA 1AVBA 1ENQA 2VGDA 5CFDA 2QQVA 2XLAA 3T2QA 1FV3A 1H8TA 1ODMA 2C9KA 3VHPA 4BU2A 3DKWA 4A7ZA 2J1TA 1NKGA 5CADA 1RC6A 4R9AA 1YFUA 2VQAA 2JKBA 3FFQA 3M2MA 2IFWA 3BIWE 1W2OA 4IE4A 3UKNA 1LU2A 3WNXA 4XXPA 2WT0A 2RVAA 1FYUA 1CAXB 4XAAA 4PJYA 4XDQA 3ZXEA 2DUQA 3KM5A 5D8AC 2P6CA 1U5IA 2OT7A 2HEWF 2J1RA 1VPHA 1WD3A 1ZZ9A 3BTYA 4GB33 2RHPA 1OLME 1I5ZA 3ZM8A 4TSVA 3ZIWA 1VIWB 1DP0A 4ASMB 4AVTA 2BGPA 1CAWA 3FHIB 3GZAA 5IK5A 5F5IA 3WQBA 4P5HA 3RZGA 5C7GA 3MW2A 1GP4A 4JV4A 4CXWA 2R0HA 2Y33A 4XFAA 4HVQA 5ABJA 3AK0A 4OQ9A 4WVZA 4D7YA 1W39A 4UFHA 5CKQA 1HX6A 1H2MA 2R1DA 4META 1OVPA 3N7MA 3N9NA 4Q4V3 2XJRA 4R9BA 5FZKA 1DGRN 4WVMB 4DUVA 3POJA 4BH9A 3RZHA 1O4TA 4QPGC 2JE7A 2YXSA 5LA9A 3UKVA 5DPNA 2YROA 5A6QA 1XRUA 4HPKA 1DGRA 2KR2A 2YFZA 4H7LA 4HSJA 4XC9A 1COV2 1IQDC 4EYUA 4BLIA 3K48A 2NQYA 1QXJA 4V2VA 3AXEA 3WQ0A 3EYPA 1ND2B 3GM8A 1QMJA 3TOJA 2RJKA 1UO9A 2EXHA 2Z4FA 3OBAA 4PBPA 1XU2A 2ZGTA 5AC92 2UWCA 5CU1A 1APNA 4CU9A 4HN0A 2DCTA 3CJIC 1QKQA 3AKQA 4XJ9A 1PMIA 2QZ2A 2ZACA 5FYZA 1L7LA 1HB3A 1RMU1 2DVDA 3SH5A 5JMCA 1CPNA 3ACLA 1HKDA 1UKGA 1AL21 3NV4A 4PCRA 5GLTA 3BTXA 3CL1A 4Q27A 4E4DX 2HWC1 4B8EA 5CISA 2PLV3 2RS11 3EQEA 3FN9A 5FZBA 5C3QA 1A78A 1TMF3 2VNOA 1UQXA 2D93A 3PUIA 5JOZA 5F3GA 2TNFA 5C70A 1GNYA 3RJRA 5C3SA 5A6ZA 2EAKA 1NT0A 5C9AB 1QXRA 3H8UA 3DXUA 5FP3A 1UOJA 3NNFA 1AR71 5EP9A 2IXJA 1XJAA 4S2FA 3CF6E 5C8CC 1ULOA 3HN3A 2VZPA 1TQ5A 1OF3A 2OXBA 2ZAHA 3HT2A 1J59A 2L9LA 1ZA4A 5FXZA 3MLJA 4XTMA 5JOWA 3VDCA 5FPLA 1OLMA 3VDBA 2QNKA 3OGVA 4QQHA 4QQPA 2FCTA 2R061 4CDXB 4DQAA 1R093 2K9ZA 4QGNA 4JGZC 2C24A 3LQCA 4IE0A 5KC6A 1FOD3 2VVEA 4QMAA 3WP3A 2HWB3 2VZ1A 4K9SA 1M06G 1S2BA 2JECA 5SV8A 3RRDA 5HXVA 3A0KA 1G8WA 3AP4A 3KGZA 3N9QA 1DYKA 4WVWA 5IAXA 3PDQA 4IQPA 1GICA 3T1MA 4GXLA 1AR91 1Q3EA 2BBAA 4RQPB 4V1PA 4HBNA 1PO12 1PNFA 4AFDA 4AL9A 1PK6C 4Y22B 3LFIA 1NE6A 1UY1A 2PN5A 3AP5A 1DHKB 3ZKUA 2GMEA 5C4WB 5FZEA 2XBO1 2FDGA 1VLNA 4P9XA 2FBEA 4LHNA 1V6JA 4FPEA 3ZXDA 1XU1A 3OPTA 4JVAA 1ZZ7A 2WSVA 4KG8A 5FMBA 4GJZA 4CDWC 2JX9A 5ACA1 1YQ6A 1VB2A 3GJAA 2VR4A 3GDBA 2J42A 2XJTA 3OJBA 4CDUC 3I3MA 3NNGA 1DZRA 4LKDA 5JI9A 1EAH3 2DU0A 3E1F1 3LF7A 3HNBM 4ZONA 5T50A 1WLDA 3WDUA 5BV6A 1DLCA 2R042 3DGTA 3VBUC 4JDOA 3QCWA 2Y6FA 2FD8A 5I91A 1IS5A 1SFNA 1HB2A 4UOJA 2E7QA 1PGL1 2XPJA 3CU7A 4INDA 2XQRA 4AHYA 3KF3A 3CJXA 1JTZX 1VBC3 1E5SA 2VOXA 3HT1A 5GLVA 3ZXLA 4ZHNA 5BNNB 3GBWA 5FY9A 2ZHLA 2RM21 4N53C 1RJ8A 4BK5A 1QXPA 5LBFA 3VZKA 4NHKA 1FMD3 1VJ2A 3M3QA 5IK4A 1DQ0A 1YI7A 3NRUA 5JUVA 5EJZB 5FPVA 2DCZA 2R7EB 2D6OX 4QDRA 2JE9A 1W04A 1KJRA 4RHV3 5C71A 1R1A1 1E57A 1NA1A 2UWBA 4GWJA 4ZXEA 3VDDA 1IPKA 4BISA 3J7NA 3PJYA 5F2SA 5C8CA 3VLBB 4NIDA 2VXJA 3TRSB 5C3PA 2VBDA 2Q1FA 2W2IA 1H8TB 2ET7A 5FP9A 2K46A 1LOGA 5AFEA 4QHZA 1QOTA 4C1WA 5IVFA 3IDAA 5K8SA 1HXS3 1HJGA 1MVQA 3I7DA 4Q0UA 2NP0A 2VNVA 1DU3D 3W59A 3WVJA 4OVEA 3FC0A 5BNQA 2D98A 4AEDA 5BNOA 1DZQA 1UYZA 2DFCA 1ZM1A 4LULA 1I1EA 1R092 1J1LA 3RYKA 4XUNA 1HRV2 1W3XA 4IETA 4QB6A 2HYKA 3J4UH 2YU1A 2CU5A 3IMMA 3JU9A 1LHOA 4H55A 2HWB2 4QQLA 4C1XA 4OZXA 4TYSA 4NAOA 4HL0A 4YYOA 3QH7A 1S2KA 2GSYA 1LJ7A 4HKWA 3FLTA 2WZR3 5J96B 4LT5A 3FE5A 4XPVA 2A5ZA 4Y3OA 3MIGA 3WG4A 1H2LA 1AXKA 2PQSA 1RTVA 5E6HA 3WY6A 1IS4A 1V6NA 2OQ6A 3BU0A 1RB8G 1JYVA 5T5JA 2CL2A 2QDRA 3WX5A 1G6NA 1O4ZA 1JBCA 3OGSA 5JXIA 1BXHA 2GC1A 1JU4A 3PVEA 2SLIA 4XFCA 3VD7A 4OHVA 4ES8A 1W0PA 4NRPA 4QGLA 5IATA 2W08A 4L0PA 3WDVA 4BXFA 1ZRDA 3H42B 2P6HA 5IFPA 2I74A 1J83A 4YZ4A 5CFCC 1NZIA 1RGSA 2ZHNA 2JG9A 3B9IA 4YW1A 1PO23 1Y9QA 1AR62 3ZDVA 1EAH2 5DXDA 5GZCA 1TZOA 1URXA 3PJQA 3KT1A 1KJLA 5E16A 3JD71 2ZX0A 1N1VA 1O91A 2WO1A 1SZBA 3CZJA 4LO7A 4OHWA 5FZ8A 5IAVA 5HV4A 4A44A 5IVJA 1A3KA 3AFGA 3ZYGA 3FHAA 2ZMNA 1OQ1A 4CA9A 1FV2A 2KD7A 3KB5A 5FO9B 3VN4A 4AQSA 3VD4A 3IDBB 2AREA 4NWWA 4F3JA 1QQP3 4LLOA 3OYWA 4B7KA 4DS0A 1MZEA 4EN6B 5H9QA 3MUZ1 4XFFA 1FMD2 2WWUA 3RVHA 5JZGA 1LHNA 4O65A 3KS7A 4BIOA 1OUXA 5FJHA 3FJSA 2ORXA 2FCUA 4RHV2 2UYAA 3BTAA 5EQUA 2JDKA 3ZYIB 1Y9MA 4Q0VA 4FPOB 2VOKA 2XHKA 2KXLA 2Y0IA 2VTXA 2GNMA 4LUMA 3U10A 1W6QB 3CO2A 1AUYA 3PL0A 4U2AA 1XE7A 2ZMLA 3VGIA 2HBTA 1X82A 1J3QA 4L97A 3VBSB 4YW2A 2OZ6A 4BZ4A 1ZX5A 4GAZA 4F83A 2B46X 4Z82A 2JDUA 4EV0A 1W3VA 3KSCA 2ZEYA 5FZCA 1S0DA 2K2SA 1HXS2 4AVCA 1S0CA 2AEZA 1C3HA 2F17A 3EO6A 4ISRA 2VUAA 4SLIA 3GCXA 3O1UA 1UIJA 2GNDA 1PIV3 3MFCA 4FOWA 4UFMA 1ST8A 4JQRA 3SISA 4LBKA 3WW3A 3KQRA 5LZ6A 2VECA 3MPBA 3O1OA 3BIEA 4ZU7A 1C1FA 3BB6A 3P5BA 4P9WA 5JPNB 4WM7C 1WW4A 3WF0A 5JSPA 1AX1A 4CCKA 1WBFA 2GC2A 3AFKA 2EALA 1J1TA 2RDSA 2RMU2 4OUMA 1JH5A 1VMJA 2HWE3 3C8XA 4LHKA 4M0NA 3WNKA 1GQGA 2ZGMA 3NW4A 2D6NA 3HAGA 4RGGA 4COVA 5BNPB 1KS4A 2P5BA 4ZPIA 3TBDA 1KITA 3C7EA 3RMYA 2YMZA 4GIQA 1OVSA 4ZKTB 1ND3C 2GH2A 5F3EA 3TN93 2VPVA 2FDIA 3FX3A 3ASIA 3O14A 2JDZA 4XDOA 3RMXA 5JLVA 5FMCA 1JW6A 2WUHA 2JDHA 3AXDA 1UU6A 2E9QA 2QQLA 2WNUA 2ZX4A 4AGRA 4EZHA 2OS2A 5IYYA 4QX5A 4YFZA 3OBRA 2VUJA 3VBOA 2Q8OA 1AL22 1TME1 1UX7A 1WBLA 4Q0QA 3V56A 5HI0A 5A33A 3IWZA 1HRI1 2HWC2 4MADA 4KI5M 1QNWA 1WLCA 2MEV3 5K4LA 4MGSA 1UNBA 2X29A 2WNVA 3O1TA 2R32A 5FOBB 4HOOA 2VMDA 4IEUA 3I59A 3H1YA 4FPGA 3K3NA 3WF1A 4CU7A 5FAXA 1QQP2 2LUWA 1VMFA 5I8TA 3ZYFA 4D69A 3O7OA 3Q9OA 4P5YA 5CKMA 1SLTA 3RPQA 1QJU3 2PXJA 1XYPA 4QX8A 4HZFA 3DCQA 1A6CA 4WM8A 3ZLIA 5IHRA 3FZ3A 2W92A 5JSRA 3RI9A 4AEJA 3M7AA 2RJLA 3LIHA 1X7NA 1YJLA 2V4AA 1UXXX 3H50A 2P3IA 2BEOA 3HNYM 1JZ7A 5FZDA 4ATEA 5LBEA 4Q8LA 3LDBA 5KBFA 4FPFA 4AVAA 4AEDB 4FOVA 3ZPYA 5BNOB 4TLGA 3TEYA 3ZYHA 1XPWA 4XFIA 3I49A 1UU5A 2DVFA 2B8MA 1RUE1 2A75A 4MZUA 2HEYF 5GZFA 5F3CA 1AR92 5FZ3A 5HBAA 1G86A 1XC6A 4Q2FA 1Q8OA 2G9GA 4CDQC 4LNVA 3MIDA 1LR5A 3UV9A 2QUOA 1PIV2 2YFUA 5IW0A 1X50A 4WM7A 5FIXA 2PHXA 2VJXA 2WNEA 2YGLA 4FFHA 5T5OA 2ZKNA 1NXD1 3IAQA 4CP9B 2XBO2 4A7KA 2NLRA 1R081 3J8F3 4XF3A 5ANQA 4RSUA 1S55A 1WCKA 2WO2A 3HR9A 1G7YA 2PELA 1U5ZA 3I2GA 1QJY1 5FY4A 5I0UA 1OQEA 5FYYA 5HCHA 2HWE2 2WZ8A 3HN1A 4W8JA 3NKTA 3JB8A 4B7EA 3HQXA 5A3MA 1COV1 1Q56A 2YY1A 1NCQA 2TUNA 5KXEA 2VQUA 3TNQA 5LK5A 4HONA 4PT6A 1CR7A 2OVUA 5KXBA 3U0ZA 3THCA 2W39A 3OD0A 2AGSA 4UW5A 2E51A 1EPZA 3GCWA 3LKJA 4YPJA 3B94A 2DFBA 1L7RA 4AI8A 1CGPA 4RR3B 4ET7A 3T2PA 3CHXA 4IE5A 1OKOA 3ORJA 1J58A 4LXLA 1O3SA 4HN1A 4EWDA 4MHRA 4RS5B 1H6YA 5FBZA 5C6CA 3BCWA 2QQPA 2GN3A 3NJVA 1UY2A 3QACA 4ASLA 3K77A 1NX9A 1YO8A 4B4PA 4M00A 1XBFA 4LBQA 3T09A 4HETA 4ZS2A 5C9AC 1R1A2 2MEV2 3IDEA 1LOFA 4PIZA 3OYWB 1NXMA 4FPYA 4JAAA 4JKLA 5I0TA 3T4VA 1ULPA 3F2ZA 4Q8KA 4Z8BA 4UFKA 4XFGA 5JZGB 4ARYA 3L2YA 3ZYPA 2BU9A 2EIDA 2WA3A 3ZXKA 4NRMA 5FY7A 3THDA 1CAXA 1J3PA 4CDXC 2ZGKA 3ZXGA 4Y20B 3U07A 1QJU2 1UMHA 4KU8A 3DUIA 3URFA 3CIHA 4HKLA 2FMDA 2J1UA 3DEMA 4XZPA 5GKAC 3ZYRA 1UIKA 2Y6JA 4URTA 4Y1YA 2YV8A 3FBMA 2XOMA 3HNMA 2YDEA 2HWF3 4R8HA 1WCQA 4YVWC 1W6MB 2Y6KA 1NY71 4CXXA 2D3RA 1VAMA 2IUWA 5JR7B 5CBLA 4RQPC 4Q4X3 5A3WA 5J3UA 1FPN3 4GB31 2R49A 2YGMA 2XWJB 4XIOA 4AOCA 1VR3A 1XSRA 2V4VA 3IM0A 1V9U3 1J84A 3BUCA 4DMIA 3RZJA 4XQDA 4RL7A 3GBGA 1BBT3 1QH7A 5C4WC 1Q43A 4PDWA 1LGNA 4XF1A 4GALA 4XVHA 1KDKA 2WINB 4A45A 1Z78A 4LBJA 5F1RA 2VULA 3KV6A 4IERA 4AHWA 1S2EA 1GLHA 4FP2A 2VMIA 3BI3A 4K6BA 2YC0A 3T3YA 1DYOA 5FZ6A 3RWKX 2D6LX 1OQDA 2NPIA 1ND2A 3S5QA 1JYWA 4CP2A 1YQCA 2RS53 5FR3A 1L3JA 4CCLA 1GOGA 2JDYA 2WLPA 1OFNA 2C4XA 3JB4C 1YQ8A 2E6VA 1GU3A 5DUUA 4BHPA 3H8RA 1JYTA 3ZOIA 2W1SA 4DXSA 3PVNA 3MV01 4WV8A 4HG6B 1W6PB 4UBGA 5BNNC 5IVEA 1STMA 4XUPA 1Z7S3 4N43B 1RYYA 3VBOB 2DTWA 3RYRA 3AKRA 2QQNA 4IV1A 5A33B 3PLQA 5HV0A 4AFBA 3J7LA 1QOSA 2XLGA 1UF2C 1BQPA 2WC2A 2ZABA 4Y1VA 3QLQA 4GZ9A 5FZ7A 2PLV1 1PGSA 4FFIA 1OBNA 4QXHA 1TMF1 4LIVA 4BDVB 4AYUA 5CIRA 4Q4W3 3WCRA 5FP8A 2QZ3A 3I59B 5CFDC 2G9ZA 2GC3A 4EE2A 5E88A 3RZLA 3AVSA 1REFA 4QWNA 1H8TC 4IEPA 3EHKA 2VMCA 3U1XA 4MG2A 2TBVA 5T5PA 1KGYA 4LOTA 2VCCA 4K1YA 1MS1A 1W9SA 1RVF3 4MXWA 5H9PA 5HPOA 2D40A 5E1RA 3K4DA 1CIYA 1RINA 1ZVFA 4XW3A 4JHZA 5FP4A 4M4RA 4AE2A 3UETA 4YZ5A 1R091 1RUC3 2AUYA 1LEDA 3KMHA 3MDPA 5FCCA 3SMHA 4LO6B 1FOD1 1VBD3 3AZXA 2HWB1 2ZEXA 1JI6A 3KV4A 4UI9L 4JRAA 1DQ4A 2LRPA 4R9DA 4YG3A 5H9SA 1GP5A 4BLJA 4Y22A 3PUQA 3O0XA 3S30A 3PIGA 4Q4X2 1FPN2 4OQ8A 1W90A 1F31A 5JXGA 3VL9A 1K3IA 1YXWA 2AEYA 3IIIA 5T55A 2LTNA 3LAGA 3LEKA 4MSVA 5FK7A 1OA3A 1JYCA 4XABA 1GBGA 5JR2A 2EIEA 1BBT2 2VD7A 3N9LA 5JDBA 3SC7X 3LOIA 3GHNA 4L2NA 4TWTA 2DCYA 3CZUA 4LO8A 1VRH3 2VO5A 2WS93 3I2KA 3OPWA 5FY1A 5GZEA 5FKCA 1AYM3 4LPLA 2CGNA 5TSWA 1ACCA 1GOHA 1IPJA 3F95A 1KXGA 1BK1A 1NCQB 3H7YA 1GFF2 4H3WA 1OSGA 1UKRA 1UZWA 3ILRA 3C7FA 2O8OA 1XE8A 5ISLA 3K51A 4XMIA 1EAH1 2V09A 1C5IA 2X53S 3GZTB 3NV3A 2FDFA 4L9BA 2ZGSA 1UY3A 1VBB3 4PHZA 4NE9A 3EMRA 2ZGPA 5J98B 1VBC1 1NG0A 2Q4SA 4XF0A 4AEMA 2Q0AA 2HWD3 2XJUA 3UJQA 5JOXA 2P2KA 3NV1A 3VBHA 1V6IA 4L99A 3O1PA 3NJZA 3KZ4C 1MZ5A 3TYJA 5L7OA 3K3OA 3NKGA 2QQKA 1FMD1 1OPMA 1PGW2 2DVGA 2WNOA 1NAEA 3NNJA 4FXKB 4YZ3A 4B1MA 3FWEA 5FP7A 3N9MA 4RHV1 3HQRA 3LEGA 4ORFA 4RFRB 1B35B 2EXKA 5CEHA 1JS9A 4Q4W2 4IEZA 3WUCA 3POSA 2GP5A 1MPXA 1RIRA 1W06A 2BGCA 4GMP3 1AX2A 1H2KA 1GZCA 5K0UB 2BVVA 2VH9A 1WGPA 2JKXA 2MHFA 3HQUA 3KVAA 4Q5OA 3RYPA 2W52A 3ZSMA 4NIHA 3LD8A 3M70A 4RN5A 1EP0A 4XOGA 5IWFA 3T4HB 1RVF2 1YI9A 2W87A 2R073 4ISQA 3WEZA 3MZHA 5A7PA 5LRRA 1HXS1 3ACHA 3ME2A 1V6KA 4EN0A 4D6QA 2WAAA 5FYTA
chains in the Genus database with same CATH topology
4IE6A 3O1OA 3BIEA 4NIDA 3RZLA 3I2OA 4QKFA 4CXYA 4MG2A 3BTXA 4JHTA 4IE5A 4NROA 3O1MA 4ZS2A 4NPLA 3KHBA 3T4VA 2FDIA 3RZMA 4OCTA 2FDHA 4ZS3A 4NRMA 3BU0A 3O1SA 3H8OA 4IE0A 4O7XA 3RZKA 4NRPA 4NRQA 4QKDA 3O1TA 3BKZA 2FDJA 4CXXA 4IDZA 2IUWA 3KHCA 4QKNA 3BUCA 3RZJA 4IE4A 2FDFA 2FDGA 4QHOA 4QKBA 5DABA 3BTYA 3BI3A 3T3YA 3S57A 3O1PA 4NIIA 3O1RA 3O1VA 3I3MA 4NJ4A 3RZGA 4CXWA 2FD8A 3I3QA 4RFRB 3H8RA 4ZHNA 5F8PA 3S5AA 4IE7A 3I49A 3H8XA 3LFMA 3RZHA 4NIHA 3BTZA 4NPMA 2FDKA 3T4HB 4MGTA 3O1UA 4NIGA 4O61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IE6 A;  3O1O A;  3BIE A;  4NID A;  3RZL A;  3I2O A;  4QKF A;  4CXY A;  4MG2 A;  3BTX A;  4JHT A;  4IE5 A;  4NRO A;  3O1M A;  4ZS2 A;  4NPL A;  3KHB A;  3T4V A;  2FDI A;  3RZM A;  4OCT A;  2FDH A;  4ZS3 A;  4NRM A;  3BU0 A;  3O1S A;  3H8O A;  4IE0 A;  4O7X A;  3RZK A;  4NRP A;  4NRQ A;  4QKD A;  3O1T A;  3BKZ A;  2FDJ A;  4CXX A;  4IDZ A;  2IUW A;  3KHC A;  4QKN A;  3BUC A;  3RZJ A;  4IE4 A;  2FDF A;  2FDG A;  4QHO A;  4QKB A;  5DAB A;  3BTY A;  3BI3 A;  3T3Y A;  3S57 A;  3O1P A;  4NII A;  3O1R A;  3O1V A;  3I3M A;  4NJ4 A;  3RZG A;  4CXW A;  2FD8 A;  3I3Q A;  4RFR B;  3H8R A;  4ZHN A;  5F8P A;  3S5A A;  4IE7 A;  3I49 A;  3H8X A;  3LFM A;  3RZH A;  4NIH A;  3BTZ A;  4NPM A;  2FDK A;  3T4H B;  4MGT A;  3O1U A;  4NIG A;  4O61 A; 
#chains in the Genus database with same CATH topology
 2VMG A;  1RUE 2;  2ERF A;  4KNC A;  1KDM A;  2BFU S;  4CEW B;  3SEE A;  4K7J A;  5A70 A;  1D2S A;  1PHM A;  1W9W A;  2GU9 A;  1X8M A;  1VBD 2;  3AP9 A;  3JCI A;  3JQW A;  3OCP A;  3PTY A;  4GWI A;  4QDS A;  1HV0 A;  4AI1 A;  2WZR 1;  4FAG A;  1I3H A;  4XZU G;  1NOV A;  1VB4 A;  2RMU 1;  1R08 2;  2ZEZ A;  1RUG 3;  1YQ2 A;  2ZGL A;  3B01 A;  4FT8 A;  1V6M A;  4PDW B;  5BNP C;  4TLF A;  3V0B B;  1WA6 X;  1QJY 2;  2DYC A;  4PLO A;  5JIU A;  2VQT A;  3M3E A;  4Y26 A;  2HYX A;  2ZS6 B;  3NJY A;  5CYY A;  5F5C A;  1PZ9 A;  1L7Q A;  2A73 B;  2W9X A;  3KV5 A;  1BVV A;  4QQ2 A;  1ASJ 3;  5FXW A;  2YPD A;  5A3N A;  1UW8 A;  4YFW A;  3HMY A;  3RSJ A;  5IVC A;  1AJK A;  4K8R B;  1UPI A;  1PVC 3;  2VZT A;  1CJP A;  2C0Z A;  3AMM A;  5C3R A;  5GZD A;  2CTV A;  3AYD A;  3KCX A;  1MS8 A;  3MIC A;  2VTX J;  1XNT A;  5FY5 A;  2WN3 A;  3PU8 A;  1PO2 1;  5FZ1 A;  5LBC A;  1N3P A;  3KT4 A;  1IS6 A;  1QJX 3;  2VZ3 A;  2WO3 A;  3I97 A;  2PQQ A;  1ZRR A;  1XYO A;  3LSD A;  3ST7 A;  3UES A;  1S4C A;  1O59 A;  3OB8 A;  4HXC A;  2FZ2 A;  3KQ4 B;  1M4W A;  2WYF A;  5DAP A;  2BYV E;  4CYD A;  1QH6 A;  2ZHM A;  4IV1 B;  4R52 A;  1VBB 2;  1QY4 A;  5ANN A;  1IS3 A;  2WQZ C;  5KHH A;  1DGW X;  1YLL A;  2WDB A;  3TNP B;  2FDJ A;  4XMA A;  5B4N A;  1NA1 C;  1MVE A;  2EF6 A;  1ALY A;  5KHJ A;  4S2H A;  3VDD C;  4AVS A;  1UOB A;  1UN1 A;  1QQP 1;  3KHC A;  2JDN A;  4XQ4 A;  3POI A;  4QKN A;  2ORZ A;  4I0B A;  1IKP A;  5FZO B;  5LEJ A;  1W9Y A;  2I07 B;  4W6Y A;  1SLA A;  1JHJ A;  1W6Q A;  4YGD A;  3H9A A;  5CVR A;  5IT6 A;  5A3P A;  1HV1 A;  1WMD A;  2PTM A;  2QE3 A;  3VBS A;  2CDO A;  1LGC A;  3A4U A;  3VD9 A;  4E9K A;  4AEK A;  4CPB D;  5LA1 A;  4MXW B;  4A3X A;  4YNI A;  2IVJ A;  1TG7 A;  3FLP A;  3WUD A;  3QOP A;  3E97 A;  4AED C;  5BNO C;  4UW4 A;  2Q1Z B;  1UY4 A;  1YJK A;  4Y4R A;  1WW5 A;  1NY7 2;  3K4A A;  5SV5 A;  3VV1 A;  1HLC A;  3WP6 A;  4AK3 A;  1SG3 A;  2BQP A;  4GB3 2;  1MS0 A;  4PI0 A;  4OHX A;  2VUC A;  3I3Q A;  3PMS A;  3OUI A;  4OI2 A;  2JG8 A;  5FK8 A;  1KEX A;  4LBL A;  2H0B A;  4BQY A;  2H6C A;  1PIV 1;  4P9J A;  1SDD B;  1I6X A;  1OUS A;  2ILM A;  3AC0 A;  3EXU A;  4B4Q A;  2I2S A;  4XUO A;  2VVD A;  4XQW A;  4BYY A;  5BNP A;  2R6Q A;  3B02 A;  4OUS A;  4XUT A;  4YVS A;  1KD7 A;  4NPM A;  4Q4V 2;  1MS3 A;  2ES3 A;  4XAE A;  4IGO A;  4AFM A;  2XUE A;  4MYE A;  1YFY A;  2W47 A;  5EYX A;  2HWE 1;  4ATF A;  5JSO A;  1LNS A;  1QF3 A;  4JRL A;  2GC0 A;  3ON7 A;  2ADD A;  3ZIX A;  4A3Z A;  2E31 A;  2G19 A;  3ROU A;  1RXG A;  2G9F A;  1E5I A;  2JG9 C;  2NM1 A;  3H3Z A;  4TN7 A;  2N7G A;  3D82 A;  1ASJ 2;  4K21 A;  2PHU A;  3I2O A;  3TN9 1;  1XYN A;  3NV2 A;  3FBY A;  3VHO A;  4BQ5 A;  1GQP A;  2ZTN A;  4DRR A;  4Z1V A;  1CPM A;  4JHT A;  5FLH A;  4N90 A;  5DUX A;  4DXR A;  1SLL A;  5D1I A;  5A3T A;  5FFO C;  1GSL A;  4GWM A;  3I3E A;  4KMQ A;  3MUY 1;  1BMV 2;  2B42 B;  4XJU A;  1JZ6 A;  3O1M A;  2VW2 A;  3BPS A;  4HMZ A;  4QXB A;  2PAM A;  4YGB A;  3RDI A;  4TZD A;  1ZZB A;  3VBH B;  2PLV 2;  4D0Q A;  2MEV 1;  1POQ A;  1TMF 2;  1OOP B;  4NUB A;  1RED A;  3I2I A;  2JD4 A;  1AYN 3;  5JZG C;  5L7O B;  1OA4 A;  1PM7 A;  3IZO A;  1W0O A;  1LTE A;  2XKO A;  2WFP A;  1CZS A;  5FZH A;  3RGB A;  4AQ6 A;  3VHN A;  1H1M A;  1RUF 3;  2ZGO A;  4NHM A;  2BNM A;  3ITQ A;  3M3C A;  4K3U A;  3SCF A;  4HAN A;  1N1T A;  2PHT A;  4WZC A;  1YYN A;  4CE8 A;  1YUD A;  4AQT A;  4DXZ A;  5A1L A;  5FY8 A;  1UOG A;  1QJU 1;  4CU6 A;  1LRH A;  2HBU A;  2WAB A;  3ZX7 A;  2CWM A;  2FZ1 A;  3N4M A;  4MVT A;  4MGK E;  4B29 A;  1G9C A;  4IUG A;  1DIW A;  4Y5T A;  1I9R A;  3NQH A;  1F9K A;  4CCM A;  4XFH A;  1FOD 2;  2Y6G A;  4UFI A;  4NOT A;  1OMI A;  1T2X A;  5LB6 A;  5J09 A;  2A71 A;  4FTE A;  1LGB A;  1YFW A;  1YHF A;  3KLS A;  3WF3 A;  3MGU A;  4CUA A;  2RR1 3;  5I0S A;  2ADE A;  2VOV A;  5FWE A;  1RHI 3;  5E89 A;  3KT7 A;  4CP9 A;  4OI4 A;  3NNM A;  3MF6 A;  2YZ4 A;  4QHO A;  1G9A A;  1AZD A;  2GH8 A;  5DMY A;  4KQ7 A;  2GAL A;  5FPZ A;  4E8D A;  3PHM A;  3QH6 A;  2W1U A;  1ONA A;  3J8F 1;  3AMH A;  4X8N A;  5BXX A;  5B2G B;  1AR8 3;  4A42 A;  1QDO A;  1UYY A;  3OTF A;  2ZKL A;  4QPY A;  2LS6 A;  3AMQ A;  1GAN A;  1PMH X;  3NMB A;  3MIE A;  4B1L A;  2AYH A;  2E26 A;  2WNU C;  4RR3 A;  2G1M A;  1C4R A;  2GN7 A;  3LA7 A;  2R30 A;  2YC2 A;  2JE8 A;  3VBO C;  2UYB A;  3ZFE A;  4RS5 A;  4B3N A;  4N9I A;  4XXA A;  2PAE A;  1DYP A;  1VBC 2;  3PTR B;  1Y43 B;  2BTV C;  4MHU A;  4ASK A;  5LA2 A;  4BM8 A;  1N1Y A;  1AHS A;  2WNV C;  4MH0 E;  1OC1 A;  5A3L A;  1SBF A;  1HDK A;  2RE9 A;  4JTO A;  3B69 A;  2VC9 A;  3W20 A;  1XOY A;  1YQ5 A;  1ZBA 3;  3HWJ A;  2VMH A;  1QU0 A;  2VM9 A;  3CKH A;  3IIA A;  5EZW A;  3ZYJ B;  4BQW A;  4LO4 B;  3ZN6 A;  1H1A A;  4BQ1 A;  1RUJ 3;  3VKL A;  3NNL A;  1YRZ A;  3DPR A;  3J26 N;  1AYN 2;  1LAJ A;  2BBV A;  1OPO A;  5F9T A;  3UGH A;  3INA A;  3ZSJ A;  1S0E A;  1O5U A;  3K46 A;  4BOW A;  3JQX A;  1FNY A;  4Y20 A;  2WSU A;  4KL1 A;  3WF2 A;  3ILF A;  4WM8 C;  2QQU A;  1RUF 2;  3AP7 A;  4HT1 T;  3KCY A;  5H9R A;  4ZZ5 A;  2EAA A;  3LSE A;  4LHS A;  4JC1 A;  3OUJ A;  3OBT A;  1NQD A;  4XCA A;  1JYI A;  1W8F A;  2YPJ A;  4FO9 A;  4QX3 A;  1XNB A;  3SKV A;  5IVB A;  5LY1 A;  3OG2 A;  3S7E A;  4LMF A;  4AI3 A;  1W6M A;  3T2O A;  1IG3 A;  4URA A;  1UZV A;  2IFR A;  4BQ3 A;  2XKP A;  4Q26 A;  5F6K A;  3G7D A;  4YGE A;  4IGQ A;  2VBB A;  4OMD A;  3EB7 A;  4Q0P A;  4YW3 A;  4XUQ A;  1US3 A;  2O8Q A;  1W8T A;  2HWF 1;  4KWK A;  4XUR A;  1JZ8 A;  5FYS A;  1GOF A;  5C3O A;  3RZM A;  2GDF A;  1XNA A;  2A70 A;  3MFA A;  2C26 A;  2JG8 B;  4Q4X 1;  1VRB A;  1FPN 1;  3R05 A;  1SHW B;  3WSO A;  4D7S A;  3W9A A;  2J1S A;  2Y0O A;  1C8M 3;  5F39 A;  2WZR 2;  4O9E A;  5A3U A;  4XF9 A;  1VAV A;  1W99 A;  4ARX A;  1V9U 1;  1RHI 2;  5D8A B;  5FDB A;  2JJ6 A;  2XML A;  4KG0 A;  3ENR A;  1BBT 1;  1CAU A;  2XVL A;  4NWV A;  3WF4 A;  5DUW A;  4YVS B;  1SCR A;  4AI2 A;  3LE0 A;  1TNR A;  1W03 A;  3Q8A A;  3E5Q A;  4YM0 A;  3BKZ A;  1ZRF A;  3PIJ A;  1JZ3 A;  4D7T A;  4CP1 A;  1NCQ C;  1W8H A;  3LWC A;  3DKQ A;  4MLO A;  2VL4 A;  1GQH A;  4UBH A;  4W65 A;  4DPN A;  1G9F A;  2BDR A;  2DTY A;  3S0M A;  3LEM A;  4J25 A;  1CVN A;  3OD4 A;  5FPU A;  4EN9 B;  2E63 A;  2RS5 1;  3N7K A;  5FYI A;  3U4X A;  2P4E A;  2DVA A;  1H2N A;  1W6P A;  4CUG A;  4YSF A;  2ZJC A;  1PO2 2;  2X10 A;  3M4F A;  4N43 A;  1WMF A;  4C8D A;  3MF9 A;  3UNP A;  4NPR A;  1CES A;  1OLQ A;  2EIB A;  3ES4 A;  4QKB A;  3B9C A;  1H9W A;  4JGY A;  5DAB A;  2Z69 A;  3AKP A;  4UFL A;  2VME A;  5G04 L;  2D3S A;  2WRA A;  4BK4 A;  1Z7S 1;  2P37 A;  4ZY9 A;  4BME A;  2V73 A;  5L73 A;  2EIC A;  1MZ6 A;  2P3K A;  2WII B;  2RDQ A;  4P14 A;  4FOY A;  2VBP A;  3UT0 A;  3VZM A;  2WA4 A;  1LOF C;  1PGW 1;  4RGK A;  1F2N A;  1WWY A;  4LBO A;  1D0G A;  2ZZQ A;  3V0A B;  4M3C E;  1QOO A;  3CJI B;  1OD3 A;  3IDC B;  5FMD A;  1KFU L;  4BPZ A;  5FRA A;  4Q4W 1;  1HQW A;  3VDA A;  3HJR A;  2WO7 A;  3RWN A;  4QU1 A;  2E53 A;  3S5A A;  1RUJ 2;  3DYP A;  4FFF A;  4UT5 A;  3D8C A;  3KGL A;  4XJ8 A;  2IWG B;  3ZVX A;  3LDR A;  4Z2A A;  1D4M 3;  3JBG 3;  3WDY A;  3RS6 A;  4IL7 A;  3U75 A;  5IVV A;  5JXJ A;  1MS5 A;  4OHY A;  1RVF 1;  2BV4 A;  2VW0 A;  3WP5 A;  1LOA A;  4CEW C;  1GZW A;  4IE6 A;  3ZMN A;  2JIG A;  3C7O A;  5FPX A;  1VBA 3;  2QBX A;  1S0F A;  1KRI A;  1XNC A;  4LOR A;  1DG6 A;  1O3Q A;  1DGL A;  2QJV A;  4DO0 A;  1MS4 A;  2P34 A;  4CSW A;  2BFU L;  1VBD 1;  2GZW A;  1B09 A;  1BCX A;  2YU2 A;  1CIW A;  1N3Q A;  1BEV 3;  3MLK A;  2W68 A;  4DXT A;  1JZ2 A;  4W4Z A;  2EVX A;  1W8N A;  4PDW C;  1TVG A;  1D4V B;  1PMJ X;  2D5F A;  3AP6 A;  2XJS A;  4LK6 A;  2HH9 A;  3UK9 A;  3W58 A;  5DAQ A;  2YG0 A;  2W3J A;  1JU3 A;  3U4S A;  1F8V A;  1IG0 A;  4AXO A;  4S2D A;  2ZX1 A;  1PZ8 A;  1WA4 A;  5C33 A;  4QB1 A;  3LGR A;  3ILN A;  1ND2 C;  1JUH A;  1JUI A;  3VKM A;  1WLT A;  2Y26 A;  3PVO A;  4YM1 A;  2QQI A;  4QM9 A;  1VRH 1;  3ETP A;  2WS9 1;  1VP6 A;  2B5H A;  2FCV A;  1AYM 1;  5T3N A;  1W05 A;  1PK6 B;  1JYX A;  1ZZ8 A;  5LAT A;  2FDH A;  1WW6 A;  1LHV A;  4Y1Z A;  3TN9 2;  2A6Y A;  2ZGN A;  3MYX A;  4CCD A;  4PLN A;  1QHD A;  1GV9 A;  1IPS A;  2WZP P;  4KU7 A;  4Y1U A;  2XL7 A;  4XE9 A;  5L19 A;  3AMP A;  1CON A;  4KBB A;  3ZFE B;  5G05 L;  1CAV A;  4NIA A;  2Y6L A;  1UD1 A;  4IV1 C;  5DG2 A;  2CYF A;  1OH4 A;  2OUJ A;  4JKM A;  1JN2 P;  3VKN A;  1VBB 1;  2BW8 A;  4I02 A;  4JTN A;  2JD9 A;  4NRQ A;  5DQ0 A;  5FZI A;  3SEP A;  4CDU B;  4Y24 A;  4XET A;  2XR4 A;  3AZW A;  1G9D A;  3S6P A;  4Y5Z 0;  2HWD 1;  4LK7 A;  3VBU B;  4AVV A;  1B35 A;  4IGP A;  2F6B A;  3WNO A;  2DBI A;  1UZ0 A;  3I2F A;  2W46 A;  3THT A;  3ZN6 B;  1JOD A;  5FOJ B;  2B7Y A;  1BHG A;  1NLR A;  2Z42 A;  3ZSE A;  2VG9 A;  2E33 A;  1H30 A;  3ACF A;  1LES A;  1XB9 A;  2AR6 A;  3D3A A;  3DPR B;  4UF0 A;  5K0U A;  4YW7 A;  3RZZ A;  5DDJ 3;  3ETQ A;  1ENS A;  2XHN A;  3H3L A;  1HN1 A;  4BMB A;  1C1L A;  2VTF A;  3UKT A;  3Q8C A;  4GMP 1;  2CGP A;  3LIG A;  4FPH A;  3HIF A;  2VNR A;  3SLI A;  4CZS A;  3M1H A;  4B4R A;  4COU A;  2BGO A;  1D4M 2;  2ZAA A;  4XDP A;  2HEV F;  3JBG 2;  2OKX A;  1POV 0;  1US2 A;  4W6X A;  5T5L A;  4CEW A;  2EA7 A;  3LA3 A;  2H0V A;  1X36 A;  2R07 1;  1SFY A;  4AI9 A;  4GKY A;  1X8E A;  4WVV A;  2PHR A;  3Q8F A;  5M0T A;  3LB9 A;  4BQ2 A;  1LHU A;  1T6B X;  1VBA 2;  2J7M A;  1SBD A;  1V0A A;  1DLL A;  2XDV A;  4HKO A;  2BWA A;  3DYO A;  1YIP A;  3JXS A;  2D6K A;  4IE7 A;  4N8M A;  1S0B A;  1W6O A;  5K7P A;  3V0B A;  1OA2 A;  2WFF 3;  4GD4 A;  3WDW A;  4Q4V 1;  1H0B A;  4XHX A;  3SCH A;  4FFG A;  1CAU B;  4MGI E;  1RUG 1;  4PBO A;  3J8F 2;  5IK8 A;  3RFR A;  3VB9 A;  4LO5 B;  2XG3 A;  4S2G A;  3DF0 A;  5J7M A;  2A6V A;  1UY0 A;  4BA6 A;  4NVP A;  3WQ7 A;  4EQV A;  1YEW A;  5A1A A;  1DQ1 A;  2ZOE B;  1X9T A;  5L36 A;  3O0V A;  5F3I A;  1EPW A;  5T52 A;  1OLR A;  3A7Q A;  4OYU A;  1ASJ 1;  1GP6 A;  4CEY A;  3ATG A;  1F4H A;  1O4Y A;  3BYW A;  4LTA A;  3AZZ A;  5DZF A;  5FLJ A;  1QNY A;  2O1Q A;  5FZ0 A;  3MLL A;  4NHL A;  4F8A A;  1ZBE 3;  2GNB A;  2QFE A;  1PVC 1;  2JDM A;  2XJP A;  2WKK A;  4DIQ A;  5GJ6 A;  2AC1 A;  1W2N A;  1Y3T A;  2A6W A;  2WBK A;  2LW8 A;  3N7J A;  3OGJ A;  3H1W A;  3OEA A;  3OY8 A;  1W6N A;  3NL1 A;  4H2A A;  4JGY B;  4PIY A;  4QHB A;  3P6B A;  1BMV 1;  3I3D A;  1NUK A;  3ZFF A;  4COW A;  1QJX 1;  2G4I A;  4I0A A;  5FWJ A;  5HCA A;  1AXY A;  4XYX A;  3VBH C;  4IV3 A;  3T1L A;  3J7M A;  1EV1 3;  1RUD 3;  2EXI A;  1OOP C;  2Y60 A;  5L7O C;  1U5X A;  1RUH 3;  3ZN5 A;  5A3O A;  5KR7 A;  2VZU A;  2CAU A;  4BQ4 A;  1KQR A;  3BOD A;  2ZCW A;  5FZO A;  2JIC A;  3FL7 A;  2Q8D A;  4Z92 B;  1RUO A;  1JOB A;  4MX3 A;  2XUM A;  1Y4W A;  3P1I A;  5FJK A;  3ELN A;  1Q8P A;  2D6P A;  1HW5 A;  3PUR A;  4Q4Y 3;  2W0X A;  5LRS A;  2XWB B;  5LAS A;  3CBN A;  3OOX A;  4HSL A;  2UU8 A;  1PX3 A;  3E5X A;  3ZXJ A;  1LCL A;  1K5M B;  3CQO A;  3ZN4 A;  4O7X A;  1UWW A;  2UY9 A;  4PLM A;  3HPN A;  5L9V A;  3WG1 A;  1QWR A;  3LCP A;  4QD2 A;  5F5A A;  5DDJ 2;  5K9Y A;  1OXC A;  1LEN A;  3MHZ A;  4QKD A;  4G4F A;  3N9P A;  5KHK A;  1FNZ A;  5D2A A;  1TNF A;  4CRQ A;  4D6S A;  1ZNP A;  4LHL A;  1LKN A;  3AYC A;  1EY2 A;  4OI0 A;  1GZW B;  3AKS A;  5KC5 A;  4Q1R A;  2OYZ A;  2HWF 2;  4QDQ A;  5HCF A;  3UGG A;  1XQN A;  1IOA A;  4XJA A;  2CSG A;  2HLE A;  5E8A A;  3C2U A;  4M3C F;  2NYY A;  2DWR A;  4J1X A;  1C57 A;  1UXZ A;  1Y7B A;  3ALQ A;  5LY2 A;  3VD5 A;  2ZBJ A;  2WN2 A;  1JYN A;  1V9U 2;  1C8N A;  2W1Q A;  3USU A;  4HK8 A;  5FMO S;  4OI1 A;  4BB3 A;  2E32 A;  2Q8E A;  4C0B A;  4E8C A;  4YAR A;  4XBQ A;  2XVK A;  4K1Z A;  5KXD A;  3S57 A;  2QVS B;  3W21 A;  1REE A;  2WFF 2;  4JDN A;  3JZV A;  4JQT A;  4DFS A;  5A7W B;  3O1V A;  1HB4 A;  4GH4 A;  2WJS A;  3NWK A;  1WCU A;  3BAL A;  1YCI A;  4ZZ8 A;  4W6W A;  2RV9 A;  2QQO A;  4YGC A;  2VOW A;  1NCR A;  4LOS A;  1EUT A;  2XLF A;  4PF1 A;  4UW3 A;  4CU8 A;  2RS5 2;  3VZJ A;  2MPF A;  3JUU A;  2RS3 3;  2Q8C A;  3POY A;  2J1E A;  2C5D A;  2IZW A;  2ZZJ A;  4LKS A;  3WW1 A;  3TEX A;  5F8P A;  2AEN A;  3U78 A;  4TTG A;  1COV 3;  1IQA A;  4X6R B;  5FXV A;  2WL1 A;  2E7A A;  4YW5 A;  2D3P A;  1ZZC A;  1Z7S 2;  2GNT A;  1CAV B;  3LOB A;  1BLZ A;  2NMO A;  3SKJ E;  2DUP A;  2B45 X;  4QPI A;  2PHD A;  2XL9 A;  5AC9 3;  2UWA A;  4EN7 B;  4M3C B;  1ND3 B;  4AFC A;  1OOP A;  1UMI A;  3UL2 A;  5A7Q A;  4MO3 M;  3POF A;  3PME A;  2CNA A;  4UYB A;  3WQ1 A;  3IB3 A;  1V6O A;  4LR4 A;  4QQO A;  2BOJ A;  1RUD 2;  2ZEW A;  2VVF A;  1CWP A;  3AB0 A;  3MO4 A;  1E5R A;  5APA A;  3IMN A;  1AYN 1;  1UMZ A;  1VBE 3;  4DY5 A;  3P3P A;  2TEP A;  1H6X A;  1POV 3;  3G6J B;  1NQJ A;  2QQJ A;  4UF0 B;  1RUF 1;  1D2Q A;  1DGW A;  2OA2 A;  1W8Z A;  3D6E A;  3VBS C;  1DQ6 A;  3QD6 A;  3N3H A;  4QM8 A;  4Q4Y 2;  1Z0H A;  2RDN A;  4FTB A;  2A1X A;  1BK0 A;  1ZRC A;  4NPL A;  1XXN A;  2RG4 A;  1ULD A;  4NHX A;  3NAP A;  5HCB A;  1O8S A;  3ES1 A;  2X8K A;  3VBF A;  4E2G A;  3WOG A;  1S0I A;  2UY8 A;  1UYX A;  4F7Z A;  1RUC 2;  2ZA9 A;  4CCO A;  1O5L A;  2JG8 C;  4ZS3 A;  1O7F A;  5BY5 A;  3R6S A;  1CQ9 A;  1W8W A;  4FTS A;  1XSQ A;  4K8F A;  2P3Y A;  1BKZ A;  1D0H A;  3SHR A;  2JXA A;  3E6D A;  2QCS B;  1LOB A;  3ACI A;  3AYA A;  2GMM A;  1Q8Q A;  2CAV A;  2RR1 1;  2Y64 A;  3ABZ A;  4W50 A;  4AQ2 A;  3PUS A;  1RHI 1;  4IEW A;  5I0R A;  2BPA 2;  2ZX3 A;  2P1B A;  1W6O B;  4YVS C;  4MUV A;  4J6G A;  5GM0 A;  2OQ7 A;  1PO1 3;  3KCC A;  3RNS A;  1TEI A;  3WHU A;  4BXS V;  1MR5 A;  4IDZ A;  4QAW A;  4XF4 A;  5FRE A;  1F35 A;  2JWP A;  5JXH A;  1RUI 3;  4LIU A;  5FTT C;  4H7M A;  4CDQ B;  1MQT A;  1VRH 2;  1V6L A;  2WS9 2;  3K4Z A;  2AAC A;  3AYE A;  1LEC A;  1K45 A;  3QBQ A;  1AYM 2;  1QDC A;  4FQ4 A;  4P9G A;  1UPS A;  5FBJ A;  1AR8 1;  4K40 A;  5EWS A;  4KWJ A;  4ZU4 A;  4COY A;  4CEY B;  3W5M A;  2EXJ A;  4UXA A;  1V00 A;  2VZO A;  1ODN A;  2HKX A;  3M3I A;  5EJ3 A;  2RS3 2;  3DL3 A;  2C1F A;  4PF5 A;  4G3Y C;  3J7H A;  2YYO A;  3HBK A;  3C3V A;  1SLC A;  2W1W A;  3OY8 B;  2R04 3;  1W6N B;  2C6S A;  2ZGR A;  4P9L A;  3BVC A;  4BIF A;  2LAL A;  3ZFF B;  3H1M A;  3VBR A;  3AL6 A;  1QIQ A;  3D4K A;  4IV3 B;  2R16 A;  1FAT A;  2HWD 2;  5EIY B;  2DBN A;  4DZG A;  4RA0 A;  1GUI A;  1CN1 A;  2Q5T A;  4LKE A;  2A3X A;  2X5I A;  4P9Y A;  3WNM A;  3E6C C;  1EYB A;  3IN9 A;  4YZ2 A;  2BER A;  5LBB A;  1ZBA 1;  3AZY A;  1JZ4 A;  4PI2 A;  3AZV A;  4E4H A;  4HK9 A;  1FT9 A;  2DV9 A;  5JPM B;  1RUJ 1;  3WCS A;  3H8X A;  3T0B A;  5A7S A;  3ZFG A;  1VBE 2;  3T30 A;  3WDT A;  5CNA A;  5A7O A;  3GJB A;  1QEX A;  4LBN A;  2JEN A;  4DUX A;  1QJZ A;  4I09 A;  5EYY A;  3MPP G;  3H3U A;  4JKK A;  1A8D A;  5AVA A;  1CZT A;  3LPF A;  1MEC 3;  2DU1 A;  3A22 A;  3Q8B A;  4UFJ A;  2D5H A;  3M3O A;  2R07 2;  2AH2 A;  5FQ0 B;  1CD3 G;  4QXK A;  5FXX A;  4C90 A;  5FZL A;  2UUR A;  3OEB A;  4CUB A;  2VCM A;  4GKX A;  5CZK A;  1ULE A;  1S1A A;  2V5D A;  4OUL A;  3WNP A;  3NVC A;  4YLZ A;  4I3P A;  1W0N A;  5JWP A;  5FZ4 A;  5D8A A;  3ZR5 A;  1K42 A;  1HRV 3;  1PM4 A;  3OGG A;  1N47 A;  5EXO A;  1VAK A;  3IPV B;  1DFQ A;  3ZSK A;  3USU B;  1CX1 A;  1C8M 1;  1W2T A;  3WR0 A;  2W95 A;  4HVR A;  1OFS A;  1KS5 A;  1QGL A;  4FPL A;  5LW9 A;  1RUG 2;  1RL3 A;  4LEJ A;  4YVW B;  2PHL A;  5A1F A;  4I3G A;  1YWK A;  2VAU A;  2VCB A;  1OD5 A;  3LZZ A;  4GH4 B;  4AW7 A;  1ZA7 A;  2GMP A;  3B3Q E;  2ENR A;  1BZW A;  4K20 A;  2VY0 A;  1NCR B;  4IEX A;  5IK7 A;  1RUI 2;  4KBZ A;  4AGG A;  4LKF A;  4AI0 A;  4FPK A;  2OPK A;  4RR3 C;  1AL0 G;  1NZC A;  3A23 A;  1PVC 2;  3B7M A;  4ES9 A;  3WNL A;  1DQ2 A;  4QPG A;  3ZFE C;  4RS5 C;  2OX0 A;  2PA7 A;  4QB2 A;  3U11 A;  5I93 A;  4HVO A;  4AAP A;  2D43 A;  1CX4 A;  2BP6 A;  3I2J A;  2SBA A;  4A7Y A;  2VXR A;  1U5Y A;  1QJX 2;  4J1W A;  5EHD A;  3ZO0 B;  2Y38 A;  1AR6 3;  4JX0 A;  4HFS A;  1H9P A;  4QPI B;  2WR9 A;  2B4K A;  2IXI A;  2ZHK A;  4V2W A;  3VL8 A;  3V0A A;  1GR3 A;  3CJI A;  1XNK A;  1SEF A;  1JOP A;  1JZ5 A;  4HLT A;  2J1A A;  3ZKY A;  3DPR C;  3FLR A;  3USS A;  2Z79 A;  2WQ4 A;  2A6Z A;  4NR1 A;  1W2U A;  2ZMK A;  3APB A;  4Y33 A;  4CCE A;  5CA6 A;  2WQ8 A;  3T0A A;  4AG4 A;  2IVI B;  3OUH A;  4IEO A;  2LM3 A;  3D0J A;  4ONU A;  4LLF A;  4NN0 A;  2BJS A;  5L9B A;  1DCS A;  1OH3 A;  4NII A;  5A80 A;  4CUC A;  1UX6 A;  1D4M 1;  1F5F A;  4PQ9 A;  3GAL A;  3ECQ A;  3JBG 1;  3K2O A;  1WKY A;  1YFX A;  4N7U A;  1W2A X;  3NAP B;  3SIT A;  2YHJ A;  1UAI A;  5CFD B;  2ARX A;  3VBF B;  2F4P A;  1F15 A;  1SPP A;  5LCW L;  1PVX A;  1MEC 2;  4R4Z A;  5FO7 B;  3T2T A;  3SH3 A;  4DB5 A;  1VBA 1;  3E6B A;  4MGQ A;  5L9R A;  2LRO A;  5DZE A;  1GZ9 A;  4N9H A;  1BJQ A;  4AAX A;  4QX7 A;  3NJX A;  4UW6 A;  3WT3 A;  3ZPO A;  4JGZ A;  4BWO A;  1A8M A;  1W9F A;  5LK7 B;  4U36 A;  4Q29 A;  3WZ1 A;  1BEV 1;  2FDK A;  1WMX A;  1HIX A;  4XHB A;  4Z2W A;  3KF5 A;  5FYH A;  4OHZ A;  1WUV A;  4YZ1 A;  3BGA A;  5DUV A;  2IXC A;  4NO4 A;  4ZU5 A;  5CG9 A;  5D21 A;  1O3R A;  1MAC A;  5C5T A;  1CAW B;  4QPW A;  1JHN A;  5CKN A;  5BUV A;  2VMF A;  3POE A;  5BYN A;  4CVU A;  1IKQ A;  1PK6 A;  2PHW A;  2RMU 3;  3D5O A;  4KH9 A;  3FMG A;  2JDP A;  1MQT B;  5ABJ B;  4MXV A;  4QGM A;  1VAL A;  4E2Q A;  5IJR A;  2HJI A;  3FHQ A;  4QKF A;  4FXG B;  4CXY A;  3WG3 A;  2DCJ A;  3HOB A;  4N43 C;  3R4D B;  4Y4Y A;  5I8Y A;  1CZV A;  3GZU C;  4CDW A;  3FUQ A;  4JGY C;  4YM3 A;  2WZE A;  2GAU A;  4HPK B;  4CDU A;  3AKT A;  1NLS A;  3DEC A;  3I3B A;  2FQP A;  4D6R A;  5LEK A;  1WCD J;  1MS9 A;  4DUW A;  2VE1 A;  1WZX A;  1IGO A;  3VBU A;  3VBR B;  2OW4 A;  1DQ5 A;  2WLQ A;  4FSJ A;  3CMG A;  3ZR6 A;  1RMU 3;  2VUD A;  4LBQ D;  1LUL A;  3Q8E A;  4AZZ A;  4EN8 B;  3ZYB A;  1AL2 3;  3VKO A;  2ARC A;  4OCT A;  1LU1 A;  2HWC 3;  4EWA A;  3OPZ A;  2X5I B;  1OUR A;  2RS1 3;  2XH6 A;  2X05 A;  5FO8 B;  2BNN A;  3BU7 A;  3O1S A;  4N53 A;  4Q0S A;  2DVB A;  5KHI A;  4DEQ A;  1K5M C;  2D97 A;  4IEY A;  3H8O A;  1SLI A;  3UYJ A;  5CB7 A;  3ZXA C;  5J1X A;  1AR7 3;  2ZPX A;  3ZFG B;  5DDJ 1;  5FY0 A;  1EUU A;  3C7H A;  5T54 A;  4IXL A;  1Q8V A;  2GP3 A;  2W91 A;  2IXK A;  3T0D A;  1BYH A;  1S0G A;  3A0N A;  2W5F A;  3P3N A;  1UL9 A;  3BPZ A;  5FUI A;  2D7F A;  3KWV A;  2BRT A;  3EJK A;  1NE4 A;  1DBN A;  2R06 3;  4G9S B;  4PIX A;  5EFU A;  1JXN A;  3AM2 A;  3N36 A;  4CPB A;  3WIN E;  4N7I A;  5GAL A;  4FPJ A;  2WWJ A;  4P00 B;  4Y5S A;  4KWU A;  1F5J A;  1RXF A;  2RR1 2;  1SBE A;  5FUP A;  1OKQ A;  3VZN A;  2ETE A;  4LE4 A;  1FX5 A;  4AGV A;  1AR9 3;  1BVP 1;  4OZO A;  1VE0 A;  1S0J A;  3TB0 A;  1SCS A;  3DXT A;  3HVD A;  5FMO L;  3O1R A;  2WFF 1;  1F4A A;  2CWS A;  1AXZ A;  2VZR A;  3FFZ A;  4LQR A;  1W8O A;  1HQN A;  4YW6 A;  2PMW B;  3AL5 A;  4JCK A;  2XBO 3;  4OLL A;  4MGZ E;  3GNE A;  2ATF A;  2FMY A;  4LIT A;  2QKD A;  1GZT A;  1AR8 2;  4RYD A;  4X6Q B;  4XTP A;  4FI9 A;  1D7P M;  4CCN A;  5ACA 3;  4OMC A;  4Q1P A;  4XJZ A;  4A6S A;  4KGQ A;  5F7U A;  3SCG A;  5JVV A;  2PAK A;  4A41 A;  4ITC A;  4MGY E;  3I8T A;  1DF0 A;  4BE3 A;  4QPG B;  3POB A;  2Z5W A;  1V70 A;  3BN6 A;  5KXC A;  2PYT A;  1LOD A;  4DIN B;  1ZBE 1;  1ZRE A;  4YM2 A;  2ZGU A;  3CLP A;  4I0W B;  2A3W A;  4DNY A;  2BUK A;  4NIG A;  2DDU A;  2E7T A;  2P17 A;  3IKW A;  4X8P A;  5CFC A;  2C9A A;  2JB8 A;  1ULG A;  4JZR A;  4AF9 A;  1SFP A;  4D8M A;  4D3W A;  3OGR A;  3POG A;  1B35 C;  1RIT A;  1EV1 1;  4NAM A;  2RM2 3;  2NZ9 A;  1RUD 1;  1WD4 A;  2NN8 A;  3MI8 A;  1AX0 A;  1RUH 1;  1UZY A;  2PHF A;  1RMU 2;  1ULC A;  5EJ1 B;  1ZBA 2;  4IES A;  2Y8K A;  5K0U C;  1K5M A;  1R1A 3;  2RS1 2;  4OFG A;  3W5N A;  1X9P A;  2XB6 C;  4BJ0 A;  1GWK A;  4IW3 A;  2CDP A;  2CY6 A;  3X29 B;  5HXM A;  4Q4Y 1;  1IZ3 A;  1T6G C;  2VZQ A;  4NMI A;  4R4X A;  1R64 A;  3D0S A;  1NA1 B;  4D94 A;  2J1V A;  1AR7 2;  2B9U A;  2R1B A;  2VU9 A;  3VDD B;  4WBB A;  4COZ A;  5J36 A;  3GXU A;  5C8C B;  1GWM A;  2XON A;  4O9G A;  1R1Z A;  2W94 A;  2WT1 A;  1RUC 1;  3MIF A;  4UAP A;  4DY3 A;  1H8V A;  4CCJ A;  4AVB A;  1SPP B;  2MNG A;  2XXZ A;  5GZG A;  3GBF A;  2B39 A;  2XJV A;  3I2H A;  2ZGQ A;  2QDN A;  5I8S A;  2R06 2;  3VKF C;  3WHT A;  2OII A;  2DUO A;  4ERO A;  4FP3 A;  3RG0 A;  2QQM A;  1NLQ A;  4JGZ B;  3I54 A;  4M0H A;  1MZF A;  1PZ7 A;  4QT6 A;  1C8M 2;  2OZJ A;  2VCA A;  5JAX A;  5A7W A;  3TEW A;  4L8Q A;  3WXP A;  5C8W A;  4SBV A;  1H4G A;  3L9J T;  1W9T A;  2P3J A;  1AF9 A;  3B00 A;  4P9I A;  2Y6H A;  5F6L B;  2DUR A;  3WW4 A;  3N7L A;  4R9C A;  5EPA A;  1QJE A;  4LBM A;  2DF7 A;  3FUO A;  4WZF A;  5FPB A;  3VD3 A;  2WWS A;  3R0R A;  5IFT A;  1O6U A;  2B9V A;  1O3T A;  1YNA A;  2RJ2 A;  2V72 A;  1ZRI A;  4P02 B;  4CEY C;  1FAY A;  4RGA A;  1UYP A;  2A6X A;  1UCX A;  4YRD A;  5J48 A;  5FYB A;  4QX2 A;  4MOA A;  2RS3 1;  5ACA 2;  2R0F A;  2A7A A;  3SNM A;  3GZE A;  4CDW B;  2ARB A;  4LE3 A;  1ZZ6 A;  3ZFF C;  4M3C A;  1ND3 A;  4BQX A;  4XJW A;  4NJ4 A;  5FYU A;  4IV3 C;  5A32 A;  2YB7 A;  4QX0 A;  4EWE A;  4KGG A;  4GUL A;  5FZM A;  2JG9 B;  2Q1M A;  3JD7 3;  4GWN A;  2XVG A;  2QTW B;  5IVY A;  3TWI A;  4LUK A;  5AC9 1;  1PGL 2;  3SH4 A;  4A4A A;  3SXW A;  5J37 A;  3VHR A;  2BNO A;  1WME A;  3DYM A;  4M01 A;  3MBW A;  4XFB A;  2WT2 A;  1Q8S A;  1K5J A;  2RM2 2;  1UOF A;  1DDL A;  5FZF A;  3BOP A;  3N35 A;  5FUN A;  3ACG A;  3LFM A;  3K75 B;  4QU2 A;  1LOE A;  1HN0 A;  2EIG A;  2D44 A;  4N53 B;  1I5P A;  4OUE A;  3PNA A;  4DRV A;  5GLZ A;  1VBE 1;  1HQL A;  3CEW A;  4PQQ A;  3GHM A;  1E5H A;  1HJF A;  4H14 A;  4KWL A;  4XBN A;  1POV 1;  1WCS A;  4XIK A;  4FAH A;  2VNG A;  2ZX2 A;  2O14 A;  5F2W A;  4C0H A;  3CNA A;  4ZXK A;  1C28 A;  5FZG A;  2IXH A;  2JDA A;  1LHW A;  4FBF A;  4CP0 A;  5FV3 A;  3OF1 A;  4GQ7 A;  3PUH A;  5DZG A;  4LJH A;  2VZS A;  3M8L A;  4RD7 A;  2Q30 A;  3J9S A;  3KD4 A;  3IAP A;  4M4P A;  3KVB A;  5FYV A;  4FCA A;  1H1I A;  5LA0 A;  2WYS A;  2OPW A;  4FPC A;  1SMV A;  1BEV 2;  1X33 A;  4GMP 0;  4XAC A;  4QX1 A;  3DV8 A;  1GKB A;  2K0G A;  4RFT 0;  3H7J A;  2FHR A;  3L2H A;  5JMO A;  1YC6 1;  2IXL A;  3H0O A;  4YW4 A;  4GH4 C;  4I30 A;  5GLU A;  4CDQ A;  1AJO A;  4YG0 A;  2CHH A;  1PNG A;  2KM2 A;  3U37 A;  1PO1 1;  3OBZ A;  2O0O A;  3MIH A;  1NCR C;  3VZL A;  1SLB A;  4JDM A;  4E4S A;  3MV1 1;  1RUI 1;  2X09 A;  2D6M A;  2KA3 A;  3PUA A;  4UWD A;  1OI6 A;  3POW A;  4WVM A;  2IC1 A;  3S7I A;  2YBS A;  2ID4 A;  5A6X A;  3E5U A;  3MW3 A;  1G9B A;  1XE0 A;  1GMM A;  1KFX L;  3NO8 A;  1A34 A;  3LPG A;  5FZA A;  1LEM A;  3AJZ A;  3ZXF A;  5EV7 A;  3THP A;  3RI8 A;  5I0D A;  2NMN A;  5CG8 A;  2XGX A;  4NHY A;  2F4L A;  1W8U A;  1N1S A;  2XJQ A;  3AJY A;  1WLW A;  2PFW A;  3B5L B;  5A7N A;  3I2D A;  4QPI C;  3WNN A;  5CAZ A;  3AX4 A;  4IEQ A;  1XND A;  3NST A;  3R4S A;  3N9O A;  3U14 A;  1SQ4 A;  2RDR A;  5AVP A;  5GLW A;  4FOQ A;  5CFC B;  2R04 1;  1NYW A;  3HD8 B;  1SAC A;  1HB1 A;  1TME 3;  2OUH A;  2VZV A;  1PX4 A;  4AWD A;  5KWR A;  3O0W A;  1HRI 3;  4FQZ A;  3T08 A;  3V64 A;  4C91 A;  2WNU B;  4XIL A;  4CCC A;  3JD7 2;  4LA3 A;  2Z2S B;  3WD5 A;  4DEV A;  1GWL A;  2JIJ A;  2VW1 A;  1LB2 A;  1K12 A;  3MIB A;  2BZD A;  1ULF A;  4AR2 A;  5DG1 A;  1GNH A;  1UU4 A;  1U12 A;  1J3R A;  4XBL A;  3UGF A;  4LA2 A;  5FKB A;  5F32 A;  4AHZ A;  1LOC A;  1U0A A;  5C9A A;  2WNV B;  4XCB A;  1Y9G A;  5ERL A;  2A3Y A;  4AFA A;  3I4I A;  2JEM A;  4DOU A;  3BOW A;  1FI2 A;  4TXW A;  5FQ0 A;  3NAP C;  3OSD A;  5FLI A;  1W28 A;  3GYD A;  3VUO A;  5JI7 A;  3ZDS A;  5KHG A;  3VBF C;  4I2O A;  1UZZ A;  1RUN A;  3PVB B;  3LEI A;  4I01 A;  1MEC 1;  4XEZ A;  3C7G A;  5DAX A;  2VOT A;  4A2U A;  3WW2 A;  1OHF A;  3VZO A;  4CDX A;  4L92 A;  1WW7 A;  2I45 A;  3MEP A;  4WM8 B;  3R4U A;  4CTE A;  2JB4 A;  2YC4 A;  3RQ0 A;  3IPV A;  5IUQ A;  3GGL A;  2ET1 A;  5LWB A;  3BTZ A;  4E27 A;  5B4X A;  1GNZ A;  1RUE 3;  2BOI A;  5FZ9 A;  1ZYB A;  3LA2 A;  1ENR A;  2ARA A;  4YVW A;  5A6Y A;  4IEV A;  1HRV 1;  4MGT A;  4RQP A;  3IBM A;  5JIA A;  4O61 A;  3AMN A;  1H4H A;  5DN2 A;  4Z07 A;  4P08 A;  3WLU A;  5FPA A;  2AZ5 A;  5DAW A;  3V65 A;  1MQT C;  5ABJ C;  2YUE A;  1R08 3;  4BCU A;  5C5U A;  3AVR A;  2Y34 A;  2YBK A;  5C4W A;  3ZMO A;  4WM7 B;  3TAY A;  5FYM A;  1QJY 3;  3O12 A;  1N3O A;  4QXC A;  3SQO A;  5JOY A;  3LDK A;  1DZT A;  4NRO A;  1RJ7 A;  4EZ4 A;  4A6O A;  3EBR A;  2BWC A;  1ZBE 2;  1JOJ A;  1P8J A;  3WDX A;  4Y1X A;  1FXZ A;  2BVB A;  3ZSL A;  1TE1 B;  4MV2 A;  1Q5O A;  3KHB A;  3A21 A;  5BPX A;  3HEI A;  3VBR C;  1YIF A;  2CV6 A;  2WAO A;  2XQX A;  5F5Q A;  3UJO A;  3KV9 A;  5DAV A;  4E4Z A;  4FVV A;  5FYC A;  5A32 B;  3RJ2 X;  3HBZ A;  3CDZ B;  3WG2 A;  1AR6 1;  3GF6 A;  1EV1 2;  1O8P A;  2QQW A;  2X5I C;  1QJF A;  2J22 A;  3PU3 A;  1RUH 2;  4L11 A;  4YG6 A;  2DCK A;  4YWA A;  5BNN A;  5AFB A;  1JMU B;  1TME 2;  3WP4 A;  4EJR A;  4GA9 A;  1HRI 2;  1IHM A;  1CJD A;  2VQ0 A;  1OT5 A;  2ZXQ A;  3WV6 A;  2YBP A;  1C5H A;  1OF4 A;  3ZFG C;  1ENX A;  3DN7 A;  3B93 A;  3RZK A;  3TEZ A;  1SDW A;  5F37 A;  1GYK A;  4GJY A;  2H6B A;  4E2S A;  4LBQ B;  3IT8 A;  4AHX A;  3O5S A;  2V5Y A;  2CGO A;  1VMH A;  3MW4 A;  5JCT A;  1AVB A;  1ENQ A;  2VGD A;  5CFD A;  2QQV A;  2XLA A;  3T2Q A;  1FV3 A;  1H8T A;  1ODM A;  2C9K A;  3VHP A;  4BU2 A;  3DKW A;  4A7Z A;  2J1T A;  1NKG A;  5CAD A;  1RC6 A;  4R9A A;  1YFU A;  2VQA A;  2JKB A;  3FFQ A;  3M2M A;  2IFW A;  3BIW E;  1W2O A;  4IE4 A;  3UKN A;  1LU2 A;  3WNX A;  4XXP A;  2WT0 A;  2RVA A;  1FYU A;  1CAX B;  4XAA A;  4PJY A;  4XDQ A;  3ZXE A;  2DUQ A;  3KM5 A;  5D8A C;  2P6C A;  1U5I A;  2OT7 A;  2HEW F;  2J1R A;  1VPH A;  1WD3 A;  1ZZ9 A;  3BTY A;  4GB3 3;  2RHP A;  1OLM E;  1I5Z A;  3ZM8 A;  4TSV A;  3ZIW A;  1VIW B;  1DP0 A;  4ASM B;  4AVT A;  2BGP A;  1CAW A;  3FHI B;  3GZA A;  5IK5 A;  5F5I A;  3WQB A;  4P5H A;  3RZG A;  5C7G A;  3MW2 A;  1GP4 A;  4JV4 A;  4CXW A;  2R0H A;  2Y33 A;  4XFA A;  4HVQ A;  5ABJ A;  3AK0 A;  4OQ9 A;  4WVZ A;  4D7Y A;  1W39 A;  4UFH A;  5CKQ A;  1HX6 A;  1H2M A;  2R1D A;  4MET A;  1OVP A;  3N7M A;  3N9N A;  4Q4V 3;  2XJR A;  4R9B A;  5FZK A;  1DGR N;  4WVM B;  4DUV A;  3POJ A;  4BH9 A;  3RZH A;  1O4T A;  4QPG C;  2JE7 A;  2YXS A;  5LA9 A;  3UKV A;  5DPN A;  2YRO A;  5A6Q A;  1XRU A;  4HPK A;  1DGR A;  2KR2 A;  2YFZ A;  4H7L A;  4HSJ A;  4XC9 A;  1COV 2;  1IQD C;  4EYU A;  4BLI A;  3K48 A;  2NQY A;  1QXJ A;  4V2V A;  3AXE A;  3WQ0 A;  3EYP A;  1ND2 B;  3GM8 A;  1QMJ A;  3TOJ A;  2RJK A;  1UO9 A;  2EXH A;  2Z4F A;  3OBA A;  4PBP A;  1XU2 A;  2ZGT A;  5AC9 2;  2UWC A;  5CU1 A;  1APN A;  4CU9 A;  4HN0 A;  2DCT A;  3CJI C;  1QKQ A;  3AKQ A;  4XJ9 A;  1PMI A;  2QZ2 A;  2ZAC A;  5FYZ A;  1L7L A;  1HB3 A;  1RMU 1;  2DVD A;  3SH5 A;  5JMC A;  1CPN A;  3ACL A;  1HKD A;  1UKG A;  1AL2 1;  3NV4 A;  4PCR A;  5GLT A;  3BTX A;  3CL1 A;  4Q27 A;  4E4D X;  2HWC 1;  4B8E A;  5CIS A;  2PLV 3;  2RS1 1;  3EQE A;  3FN9 A;  5FZB A;  5C3Q A;  1A78 A;  1TMF 3;  2VNO A;  1UQX A;  2D93 A;  3PUI A;  5JOZ A;  5F3G A;  2TNF A;  5C70 A;  1GNY A;  3RJR A;  5C3S A;  5A6Z A;  2EAK A;  1NT0 A;  5C9A B;  1QXR A;  3H8U A;  3DXU A;  5FP3 A;  1UOJ A;  3NNF A;  1AR7 1;  5EP9 A;  2IXJ A;  1XJA A;  4S2F A;  3CF6 E;  5C8C C;  1ULO A;  3HN3 A;  2VZP A;  1TQ5 A;  1OF3 A;  2OXB A;  2ZAH A;  3HT2 A;  1J59 A;  2L9L A;  1ZA4 A;  5FXZ A;  3MLJ A;  4XTM A;  5JOW A;  3VDC A;  5FPL A;  1OLM A;  3VDB A;  2QNK A;  3OGV A;  4QQH A;  4QQP A;  2FCT A;  2R06 1;  4CDX B;  4DQA A;  1R09 3;  2K9Z A;  4QGN A;  4JGZ C;  2C24 A;  3LQC A;  4IE0 A;  5KC6 A;  1FOD 3;  2VVE A;  4QMA A;  3WP3 A;  2HWB 3;  2VZ1 A;  4K9S A;  1M06 G;  1S2B A;  2JEC A;  5SV8 A;  3RRD A;  5HXV A;  3A0K A;  1G8W A;  3AP4 A;  3KGZ A;  3N9Q A;  1DYK A;  4WVW A;  5IAX A;  3PDQ A;  4IQP A;  1GIC A;  3T1M A;  4GXL A;  1AR9 1;  1Q3E A;  2BBA A;  4RQP B;  4V1P A;  4HBN A;  1PO1 2;  1PNF A;  4AFD A;  4AL9 A;  1PK6 C;  4Y22 B;  3LFI A;  1NE6 A;  1UY1 A;  2PN5 A;  3AP5 A;  1DHK B;  3ZKU A;  2GME A;  5C4W B;  5FZE A;  2XBO 1;  2FDG A;  1VLN A;  4P9X A;  2FBE A;  4LHN A;  1V6J A;  4FPE A;  3ZXD A;  1XU1 A;  3OPT A;  4JVA A;  1ZZ7 A;  2WSV A;  4KG8 A;  5FMB A;  4GJZ A;  4CDW C;  2JX9 A;  5ACA 1;  1YQ6 A;  1VB2 A;  3GJA A;  2VR4 A;  3GDB A;  2J42 A;  2XJT A;  3OJB A;  4CDU C;  3I3M A;  3NNG A;  1DZR A;  4LKD A;  5JI9 A;  1EAH 3;  2DU0 A;  3E1F 1;  3LF7 A;  3HNB M;  4ZON A;  5T50 A;  1WLD A;  3WDU A;  5BV6 A;  1DLC A;  2R04 2;  3DGT A;  3VBU C;  4JDO A;  3QCW A;  2Y6F A;  2FD8 A;  5I91 A;  1IS5 A;  1SFN A;  1HB2 A;  4UOJ A;  2E7Q A;  1PGL 1;  2XPJ A;  3CU7 A;  4IND A;  2XQR A;  4AHY A;  3KF3 A;  3CJX A;  1JTZ X;  1VBC 3;  1E5S A;  2VOX A;  3HT1 A;  5GLV A;  3ZXL A;  4ZHN A;  5BNN B;  3GBW A;  5FY9 A;  2ZHL A;  2RM2 1;  4N53 C;  1RJ8 A;  4BK5 A;  1QXP A;  5LBF A;  3VZK A;  4NHK A;  1FMD 3;  1VJ2 A;  3M3Q A;  5IK4 A;  1DQ0 A;  1YI7 A;  3NRU A;  5JUV A;  5EJZ B;  5FPV A;  2DCZ A;  2R7E B;  2D6O X;  4QDR A;  2JE9 A;  1W04 A;  1KJR A;  4RHV 3;  5C71 A;  1R1A 1;  1E57 A;  1NA1 A;  2UWB A;  4GWJ A;  4ZXE A;  3VDD A;  1IPK A;  4BIS A;  3J7N A;  3PJY A;  5F2S A;  5C8C A;  3VLB B;  4NID A;  2VXJ A;  3TRS B;  5C3P A;  2VBD A;  2Q1F A;  2W2I A;  1H8T B;  2ET7 A;  5FP9 A;  2K46 A;  1LOG A;  5AFE A;  4QHZ A;  1QOT A;  4C1W A;  5IVF A;  3IDA A;  5K8S A;  1HXS 3;  1HJG A;  1MVQ A;  3I7D A;  4Q0U A;  2NP0 A;  2VNV A;  1DU3 D;  3W59 A;  3WVJ A;  4OVE A;  3FC0 A;  5BNQ A;  2D98 A;  4AED A;  5BNO A;  1DZQ A;  1UYZ A;  2DFC A;  1ZM1 A;  4LUL A;  1I1E A;  1R09 2;  1J1L A;  3RYK A;  4XUN A;  1HRV 2;  1W3X A;  4IET A;  4QB6 A;  2HYK A;  3J4U H;  2YU1 A;  2CU5 A;  3IMM A;  3JU9 A;  1LHO A;  4H55 A;  2HWB 2;  4QQL A;  4C1X A;  4OZX A;  4TYS A;  4NAO A;  4HL0 A;  4YYO A;  3QH7 A;  1S2K A;  2GSY A;  1LJ7 A;  4HKW A;  3FLT A;  2WZR 3;  5J96 B;  4LT5 A;  3FE5 A;  4XPV A;  2A5Z A;  4Y3O A;  3MIG A;  3WG4 A;  1H2L A;  1AXK A;  2PQS A;  1RTV A;  5E6H A;  3WY6 A;  1IS4 A;  1V6N A;  2OQ6 A;  3BU0 A;  1RB8 G;  1JYV A;  5T5J A;  2CL2 A;  2QDR A;  3WX5 A;  1G6N A;  1O4Z A;  1JBC A;  3OGS A;  5JXI A;  1BXH A;  2GC1 A;  1JU4 A;  3PVE A;  2SLI A;  4XFC A;  3VD7 A;  4OHV A;  4ES8 A;  1W0P A;  4NRP A;  4QGL A;  5IAT A;  2W08 A;  4L0P A;  3WDV A;  4BXF A;  1ZRD A;  3H42 B;  2P6H A;  5IFP A;  2I74 A;  1J83 A;  4YZ4 A;  5CFC C;  1NZI A;  1RGS A;  2ZHN A;  2JG9 A;  3B9I A;  4YW1 A;  1PO2 3;  1Y9Q A;  1AR6 2;  3ZDV A;  1EAH 2;  5DXD A;  5GZC A;  1TZO A;  1URX A;  3PJQ A;  3KT1 A;  1KJL A;  5E16 A;  3JD7 1;  2ZX0 A;  1N1V A;  1O91 A;  2WO1 A;  1SZB A;  3CZJ A;  4LO7 A;  4OHW A;  5FZ8 A;  5IAV A;  5HV4 A;  4A44 A;  5IVJ A;  1A3K A;  3AFG A;  3ZYG A;  3FHA A;  2ZMN A;  1OQ1 A;  4CA9 A;  1FV2 A;  2KD7 A;  3KB5 A;  5FO9 B;  3VN4 A;  4AQS A;  3VD4 A;  3IDB B;  2ARE A;  4NWW A;  4F3J A;  1QQP 3;  4LLO A;  3OYW A;  4B7K A;  4DS0 A;  1MZE A;  4EN6 B;  5H9Q A;  3MUZ 1;  4XFF A;  1FMD 2;  2WWU A;  3RVH A;  5JZG A;  1LHN A;  4O65 A;  3KS7 A;  4BIO A;  1OUX A;  5FJH A;  3FJS A;  2ORX A;  2FCU A;  4RHV 2;  2UYA A;  3BTA A;  5EQU A;  2JDK A;  3ZYI B;  1Y9M A;  4Q0V A;  4FPO B;  2VOK A;  2XHK A;  2KXL A;  2Y0I A;  2VTX A;  2GNM A;  4LUM A;  3U10 A;  1W6Q B;  3CO2 A;  1AUY A;  3PL0 A;  4U2A A;  1XE7 A;  2ZML A;  3VGI A;  2HBT A;  1X82 A;  1J3Q A;  4L97 A;  3VBS B;  4YW2 A;  2OZ6 A;  4BZ4 A;  1ZX5 A;  4GAZ A;  4F83 A;  2B46 X;  4Z82 A;  2JDU A;  4EV0 A;  1W3V A;  3KSC A;  2ZEY A;  5FZC A;  1S0D A;  2K2S A;  1HXS 2;  4AVC A;  1S0C A;  2AEZ A;  1C3H A;  2F17 A;  3EO6 A;  4ISR A;  2VUA A;  4SLI A;  3GCX A;  3O1U A;  1UIJ A;  2GND A;  1PIV 3;  3MFC A;  4FOW A;  4UFM A;  1ST8 A;  4JQR A;  3SIS A;  4LBK A;  3WW3 A;  3KQR A;  5LZ6 A;  2VEC A;  3MPB A;  3O1O A;  3BIE A;  4ZU7 A;  1C1F A;  3BB6 A;  3P5B A;  4P9W A;  5JPN B;  4WM7 C;  1WW4 A;  3WF0 A;  5JSP A;  1AX1 A;  4CCK A;  1WBF A;  2GC2 A;  3AFK A;  2EAL A;  1J1T A;  2RDS A;  2RMU 2;  4OUM A;  1JH5 A;  1VMJ A;  2HWE 3;  3C8X A;  4LHK A;  4M0N A;  3WNK A;  1GQG A;  2ZGM A;  3NW4 A;  2D6N A;  3HAG A;  4RGG A;  4COV A;  5BNP B;  1KS4 A;  2P5B A;  4ZPI A;  3TBD A;  1KIT A;  3C7E A;  3RMY A;  2YMZ A;  4GIQ A;  1OVS A;  4ZKT B;  1ND3 C;  2GH2 A;  5F3E A;  3TN9 3;  2VPV A;  2FDI A;  3FX3 A;  3ASI A;  3O14 A;  2JDZ A;  4XDO A;  3RMX A;  5JLV A;  5FMC A;  1JW6 A;  2WUH A;  2JDH A;  3AXD A;  1UU6 A;  2E9Q A;  2QQL A;  2WNU A;  2ZX4 A;  4AGR A;  4EZH A;  2OS2 A;  5IYY A;  4QX5 A;  4YFZ A;  3OBR A;  2VUJ A;  3VBO A;  2Q8O A;  1AL2 2;  1TME 1;  1UX7 A;  1WBL A;  4Q0Q A;  3V56 A;  5HI0 A;  5A33 A;  3IWZ A;  1HRI 1;  2HWC 2;  4MAD A;  4KI5 M;  1QNW A;  1WLC A;  2MEV 3;  5K4L A;  4MGS A;  1UNB A;  2X29 A;  2WNV A;  3O1T A;  2R32 A;  5FOB B;  4HOO A;  2VMD A;  4IEU A;  3I59 A;  3H1Y A;  4FPG A;  3K3N A;  3WF1 A;  4CU7 A;  5FAX A;  1QQP 2;  2LUW A;  1VMF A;  5I8T A;  3ZYF A;  4D69 A;  3O7O A;  3Q9O A;  4P5Y A;  5CKM A;  1SLT A;  3RPQ A;  1QJU 3;  2PXJ A;  1XYP A;  4QX8 A;  4HZF A;  3DCQ A;  1A6C A;  4WM8 A;  3ZLI A;  5IHR A;  3FZ3 A;  2W92 A;  5JSR A;  3RI9 A;  4AEJ A;  3M7A A;  2RJL A;  3LIH A;  1X7N A;  1YJL A;  2V4A A;  1UXX X;  3H50 A;  2P3I A;  2BEO A;  3HNY M;  1JZ7 A;  5FZD A;  4ATE A;  5LBE A;  4Q8L A;  3LDB A;  5KBF A;  4FPF A;  4AVA A;  4AED B;  4FOV A;  3ZPY A;  5BNO B;  4TLG A;  3TEY A;  3ZYH A;  1XPW A;  4XFI A;  3I49 A;  1UU5 A;  2DVF A;  2B8M A;  1RUE 1;  2A75 A;  4MZU A;  2HEY F;  5GZF A;  5F3C A;  1AR9 2;  5FZ3 A;  5HBA A;  1G86 A;  1XC6 A;  4Q2F A;  1Q8O A;  2G9G A;  4CDQ C;  4LNV A;  3MID A;  1LR5 A;  3UV9 A;  2QUO A;  1PIV 2;  2YFU A;  5IW0 A;  1X50 A;  4WM7 A;  5FIX A;  2PHX A;  2VJX A;  2WNE A;  2YGL A;  4FFH A;  5T5O A;  2ZKN A;  1NXD 1;  3IAQ A;  4CP9 B;  2XBO 2;  4A7K A;  2NLR A;  1R08 1;  3J8F 3;  4XF3 A;  5ANQ A;  4RSU A;  1S55 A;  1WCK A;  2WO2 A;  3HR9 A;  1G7Y A;  2PEL A;  1U5Z A;  3I2G A;  1QJY 1;  5FY4 A;  5I0U A;  1OQE A;  5FYY A;  5HCH A;  2HWE 2;  2WZ8 A;  3HN1 A;  4W8J A;  3NKT A;  3JB8 A;  4B7E A;  3HQX A;  5A3M A;  1COV 1;  1Q56 A;  2YY1 A;  1NCQ A;  2TUN A;  5KXE A;  2VQU A;  3TNQ A;  5LK5 A;  4HON A;  4PT6 A;  1CR7 A;  2OVU A;  5KXB A;  3U0Z A;  3THC A;  2W39 A;  3OD0 A;  2AGS A;  4UW5 A;  2E51 A;  1EPZ A;  3GCW A;  3LKJ A;  4YPJ A;  3B94 A;  2DFB A;  1L7R A;  4AI8 A;  1CGP A;  4RR3 B;  4ET7 A;  3T2P A;  3CHX A;  4IE5 A;  1OKO A;  3ORJ A;  1J58 A;  4LXL A;  1O3S A;  4HN1 A;  4EWD A;  4MHR A;  4RS5 B;  1H6Y A;  5FBZ A;  5C6C A;  3BCW A;  2QQP A;  2GN3 A;  3NJV A;  1UY2 A;  3QAC A;  4ASL A;  3K77 A;  1NX9 A;  1YO8 A;  4B4P A;  4M00 A;  1XBF A;  4LBQ A;  3T09 A;  4HET A;  4ZS2 A;  5C9A C;  1R1A 2;  2MEV 2;  3IDE A;  1LOF A;  4PIZ A;  3OYW B;  1NXM A;  4FPY A;  4JAA A;  4JKL A;  5I0T A;  3T4V A;  1ULP A;  3F2Z A;  4Q8K A;  4Z8B A;  4UFK A;  4XFG A;  5JZG B;  4ARY A;  3L2Y A;  3ZYP A;  2BU9 A;  2EID A;  2WA3 A;  3ZXK A;  4NRM A;  5FY7 A;  3THD A;  1CAX A;  1J3P A;  4CDX C;  2ZGK A;  3ZXG A;  4Y20 B;  3U07 A;  1QJU 2;  1UMH A;  4KU8 A;  3DUI A;  3URF A;  3CIH A;  4HKL A;  2FMD A;  2J1U A;  3DEM A;  4XZP A;  5GKA C;  3ZYR A;  1UIK A;  2Y6J A;  4URT A;  4Y1Y A;  2YV8 A;  3FBM A;  2XOM A;  3HNM A;  2YDE A;  2HWF 3;  4R8H A;  1WCQ A;  4YVW C;  1W6M B;  2Y6K A;  1NY7 1;  4CXX A;  2D3R A;  1VAM A;  2IUW A;  5JR7 B;  5CBL A;  4RQP C;  4Q4X 3;  5A3W A;  5J3U A;  1FPN 3;  4GB3 1;  2R49 A;  2YGM A;  2XWJ B;  4XIO A;  4AOC A;  1VR3 A;  1XSR A;  2V4V A;  3IM0 A;  1V9U 3;  1J84 A;  3BUC A;  4DMI A;  3RZJ A;  4XQD A;  4RL7 A;  3GBG A;  1BBT 3;  1QH7 A;  5C4W C;  1Q43 A;  4PDW A;  1LGN A;  4XF1 A;  4GAL A;  4XVH A;  1KDK A;  2WIN B;  4A45 A;  1Z78 A;  4LBJ A;  5F1R A;  2VUL A;  3KV6 A;  4IER A;  4AHW A;  1S2E A;  1GLH A;  4FP2 A;  2VMI A;  3BI3 A;  4K6B A;  2YC0 A;  3T3Y A;  1DYO A;  5FZ6 A;  3RWK X;  2D6L X;  1OQD A;  2NPI A;  1ND2 A;  3S5Q A;  1JYW A;  4CP2 A;  1YQC A;  2RS5 3;  5FR3 A;  1L3J A;  4CCL A;  1GOG A;  2JDY A;  2WLP A;  1OFN A;  2C4X A;  3JB4 C;  1YQ8 A;  2E6V A;  1GU3 A;  5DUU A;  4BHP A;  3H8R A;  1JYT A;  3ZOI A;  2W1S A;  4DXS A;  3PVN A;  3MV0 1;  4WV8 A;  4HG6 B;  1W6P B;  4UBG A;  5BNN C;  5IVE A;  1STM A;  4XUP A;  1Z7S 3;  4N43 B;  1RYY A;  3VBO B;  2DTW A;  3RYR A;  3AKR A;  2QQN A;  4IV1 A;  5A33 B;  3PLQ A;  5HV0 A;  4AFB A;  3J7L A;  1QOS A;  2XLG A;  1UF2 C;  1BQP A;  2WC2 A;  2ZAB A;  4Y1V A;  3QLQ A;  4GZ9 A;  5FZ7 A;  2PLV 1;  1PGS A;  4FFI A;  1OBN A;  4QXH A;  1TMF 1;  4LIV A;  4BDV B;  4AYU A;  5CIR A;  4Q4W 3;  3WCR A;  5FP8 A;  2QZ3 A;  3I59 B;  5CFD C;  2G9Z A;  2GC3 A;  4EE2 A;  5E88 A;  3RZL A;  3AVS A;  1REF A;  4QWN A;  1H8T C;  4IEP A;  3EHK A;  2VMC A;  3U1X A;  4MG2 A;  2TBV A;  5T5P A;  1KGY A;  4LOT A;  2VCC A;  4K1Y A;  1MS1 A;  1W9S A;  1RVF 3;  4MXW A;  5H9P A;  5HPO A;  2D40 A;  5E1R A;  3K4D A;  1CIY A;  1RIN A;  1ZVF A;  4XW3 A;  4JHZ A;  5FP4 A;  4M4R A;  4AE2 A;  3UET A;  4YZ5 A;  1R09 1;  1RUC 3;  2AUY A;  1LED A;  3KMH A;  3MDP A;  5FCC A;  3SMH A;  4LO6 B;  1FOD 1;  1VBD 3;  3AZX A;  2HWB 1;  2ZEX A;  1JI6 A;  3KV4 A;  4UI9 L;  4JRA A;  1DQ4 A;  2LRP A;  4R9D A;  4YG3 A;  5H9S A;  1GP5 A;  4BLJ A;  4Y22 A;  3PUQ A;  3O0X A;  3S30 A;  3PIG A;  4Q4X 2;  1FPN 2;  4OQ8 A;  1W90 A;  1F31 A;  5JXG A;  3VL9 A;  1K3I A;  1YXW A;  2AEY A;  3III A;  5T55 A;  2LTN A;  3LAG A;  3LEK A;  4MSV A;  5FK7 A;  1OA3 A;  1JYC A;  4XAB A;  1GBG A;  5JR2 A;  2EIE A;  1BBT 2;  2VD7 A;  3N9L A;  5JDB A;  3SC7 X;  3LOI A;  3GHN A;  4L2N A;  4TWT A;  2DCY A;  3CZU A;  4LO8 A;  1VRH 3;  2VO5 A;  2WS9 3;  3I2K A;  3OPW A;  5FY1 A;  5GZE A;  5FKC A;  1AYM 3;  4LPL A;  2CGN A;  5TSW A;  1ACC A;  1GOH A;  1IPJ A;  3F95 A;  1KXG A;  1BK1 A;  1NCQ B;  3H7Y A;  1GFF 2;  4H3W A;  1OSG A;  1UKR A;  1UZW A;  3ILR A;  3C7F A;  2O8O A;  1XE8 A;  5ISL A;  3K51 A;  4XMI A;  1EAH 1;  2V09 A;  1C5I A;  2X53 S;  3GZT B;  3NV3 A;  2FDF A;  4L9B A;  2ZGS A;  1UY3 A;  1VBB 3;  4PHZ A;  4NE9 A;  3EMR A;  2ZGP A;  5J98 B;  1VBC 1;  1NG0 A;  2Q4S A;  4XF0 A;  4AEM A;  2Q0A A;  2HWD 3;  2XJU A;  3UJQ A;  5JOX A;  2P2K A;  3NV1 A;  3VBH A;  1V6I A;  4L99 A;  3O1P A;  3NJZ A;  3KZ4 C;  1MZ5 A;  3TYJ A;  5L7O A;  3K3O A;  3NKG A;  2QQK A;  1FMD 1;  1OPM A;  1PGW 2;  2DVG A;  2WNO A;  1NAE A;  3NNJ A;  4FXK B;  4YZ3 A;  4B1M A;  3FWE A;  5FP7 A;  3N9M A;  4RHV 1;  3HQR A;  3LEG A;  4ORF A;  4RFR B;  1B35 B;  2EXK A;  5CEH A;  1JS9 A;  4Q4W 2;  4IEZ A;  3WUC A;  3POS A;  2GP5 A;  1MPX A;  1RIR A;  1W06 A;  2BGC A;  4GMP 3;  1AX2 A;  1H2K A;  1GZC A;  5K0U B;  2BVV A;  2VH9 A;  1WGP A;  2JKX A;  2MHF A;  3HQU A;  3KVA A;  4Q5O A;  3RYP A;  2W52 A;  3ZSM A;  4NIH A;  3LD8 A;  3M70 A;  4RN5 A;  1EP0 A;  4XOG A;  5IWF A;  3T4H B;  1RVF 2;  1YI9 A;  2W87 A;  2R07 3;  4ISQ A;  3WEZ A;  3MZH A;  5A7P A;  5LRR A;  1HXS 1;  3ACH A;  3ME2 A;  1V6K A;  4EN0 A;  4D6Q A;  2WAA A;  5FYT A; 
#chains in the Genus database with same CATH homology
 4IE6 A;  3O1O A;  3BIE A;  4NID A;  3RZL A;  3I2O A;  4QKF A;  4CXY A;  4MG2 A;  3BTX A;  4JHT A;  4IE5 A;  4NRO A;  3O1M A;  4ZS2 A;  4NPL A;  3KHB A;  3T4V A;  2FDI A;  3RZM A;  4OCT A;  2FDH A;  4ZS3 A;  4NRM A;  3BU0 A;  3O1S A;  3H8O A;  4IE0 A;  4O7X A;  3RZK A;  4NRP A;  4NRQ A;  4QKD A;  3O1T A;  3BKZ A;  2FDJ A;  4CXX A;  4IDZ A;  2IUW A;  3KHC A;  4QKN A;  3BUC A;  3RZJ A;  4IE4 A;  2FDF A;  2FDG A;  4QHO A;  4QKB A;  5DAB A;  3BTY A;  3BI3 A;  3T3Y A;  3S57 A;  3O1P A;  4NII A;  3O1R A;  3O1V A;  3I3M A;  4NJ4 A;  3RZG A;  4CXW A;  2FD8 A;  3I3Q A;  4RFR B;  3H8R A;  4ZHN A;  5F8P A;  3S5A A;  4IE7 A;  3I49 A;  3H8X A;  3LFM A;  3RZH A;  4NIH A;  3BTZ A;  4NPM A;  2FDK A;  3T4H B;  4MGT A;  3O1U A;  4NIG A;  4O61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...