3H8XA

Structure determination of dna methylation lesions n1-mea and n3-mec in duplex dna using a cross-linked host-guest system
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
204
structure length
204
Chain Sequence
HSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
publication title Structure determination of DNA methylation lesions N1-meA and N3-meC in duplex DNA using a cross-linked protein-DNA system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/dna
total genus 55
structure length 204
sequence length 204
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3h8xA00
4NPLA 3S57A 3BTXA 2FDGA 3RZLA 2FDHA 3H8RA 2FDFA 3BTYA 4NJ4A 4O7XA 3O1TA 3RZJA 4IE5A 4QKNA 2FDJA 4QHOA 3O1VA 3I3QA 3BKZA 4ZS2A 3I3MA 2FD8A 4NIGA 3T3YA 4IE4A 4CXYA 3RZHA 3O1SA 5DABA 3KHCA 3O1MA 4RFRB 3RZKA 4NRQA 5F8PA 2FDKA 4NIIA 4NRPA 2IUWA 4NIDA 4NPMA 3I49A 3I2OA 3BUCA 4IE6A 4IDZA 4NRMA 4QKFA 2FDIA 3BTZA 3S5AA 4NIHA 4OCTA 3RZMA 4CXXA 3BU0A 4CXWA 3RZGA 4NROA 4ZHNA 3T4HB 4ZS3A 3O1UA 3O1RA 3O1PA 4MGTA 3H8XA 3BIEA 3O1OA 3H8OA 4IE0A 3BI3A 4MG2A 4IE7A 4JHTA 4QKBA 4QKDA 3LFMA 3KHBA 4O61A 3T4VA
chains in the Genus database with same CATH superfamily
5A7SA 2Y6FA 3GZUC 4DY5A 2PTMA 2NPIA 3M3CA 4L0PA 3EYPA 5A33B 4J1WA 3JD72 2WSUA 5G05L 3K3NA 1SLTA 3GZTB 2ZCWA 2YY1A 3M1HA 3Q8CA 4J1XA 1YJLA 4XIOA 5A70A 3WY6A 1UY1A 1VP6A 1GP6A 2BQPA 3N7JA 3PUIA 4O7XA 3O1TA 4Y1XA 1NG0A 4IV1A 5HV4A 4GD4A 2JDUA 4AEDB 3UESA 4CU7A 2W91A 3H1YA 5FQ0A 5FXVA 4N43B 1IKPA 4KI5M 1VJ2A 1CZTA 1XB9A 1XNKA 3OPZA 4QM8A 3RI8A 1A8MA 1DGRA 2WS92 3NMBA 3POSA 3PJQA 3AP4A 4IEUA 5BNNB 1BLZA 3RNSA 4CZSA 3VBHC 5ERLA 2BVBA 3ZM8A 1V00A 4PJYA 4AYUA 3ZN4A 1CX1A 1O8SA 1ZRIA 1Y9QA 1C1LA 1F4AA 5FYIA 3SC7X 1NXMA 1T2XA 3GDBA 3PU3A 2B42B 2UY9A 4YLZA 4HPKB 1FV3A 3DKQA 3VBSA 1GP5A 1HB4A 4IE4A 1PK6A 1CAWA 4AEJA 4BQ1A 5ANNA 2Y8KA 3ZFFC 2GH2A 4AW7A 2RS33 1ZBE1 4L11A 3KGLA 1BEV3 4XTMA 1XOYA 2ERFA 2XBO3 3RS6A 1U5XA 4A2UA 1ZBA1 1W9YA 4ARYA 1TZOA 3F2ZA 3T2OA 3MO4A 4K1YA 1DBNA 4J25A 3LFIA 1RUC3 1H8TB 3FC0A 4BH9A 1JZ7A 2A3WA 3E6BA 4F7ZA 4XXPA 1ALYA 3USSA 2GU9A 2JWPA 4EV0A 2W08A 2W92A 3I8TA 3I3BA 4MXWB 2VOVA 5F39A 2PQQA 2VL4A 1R082 4HSLA 1DF0A 4IEPA 4Z2AA 2P6HA 5L19A 4A6SA 1GZWA 3WDVA 2ZHMA 2VVFA 1RUJ3 3MPPG 4KU8A 3LKJA 1MZ6A 2WJSA 4KG8A 3UKVA 1WLCA 2E7AA 3KCCA 4JGYA 4DQAA 4XQ4A 1RXGA 4MHUA 3BU0A 1NXD1 3IAQA 3TN92 2VU9A 4L2NA 5IT6A 1VBA2 5A3TA 3VBUC 3KB5A 4D3WA 4XE9A 4X6QB 1W9TA 4K6BA 3WNNA 1PZ8A 2VZRA 1LNSA 1RUH2 5F3CA 2YPJA 2BYVE 2NM1A 3LE0A 4CDXB 2DWRA 5A1AA 1MQTC 3PTYA 1UCXA 1IS6A 1DG6A 2W39A 2WC2A 1WA6X 4GA9A 5KBFA 2RM21 3VBHB 1XNTA 4QPIC 2ZX4A 3DN7A 1S55A 3LFMA 1HN0A 3ZDVA 1Z7S1 2R071 1MS4A 2GP3A 2ZKLA 1RHI3 4ZONA 1PO12 3FHQA 1W99A 4LBJA 5E1RA 1UL9A 1CVNA 1QOTA 3HEIA 4BXFA 5L7OA 5A3WA 4NPLA 4I01A 2GN7A 1DLLA 4Q4V2 3ZXLA 1UYXA 3ABZA 1R092 3TOJA 1C8M3 4LKSA 2TBVA 2WN2A 3A22A 3TRSB 4AFMA 1B09A 1S2BA 5HI0A 3ZFFB 4AVSA 1R1ZA 2RS11 3T09A 1JU4A 3DXTA 5FYSA 2VCAA 4BIFA 4L97A 4COYA 1PMIA 3OBZA 3USUA 4YG6A 4QHOA 4I2OA 4UW6A 2GSYA 1HB1A 5FRAA 5CFCC 1YCIA 2P6CA 3NJYA 1WCQA 3ACGA 4EQVA 1G9AA 1LTEA 4UFMA 4AQ6A 3U1XA 5AC92 2YROA 3HT1A 1D4VB 4M4RA 4MSVA 5JMOA 1JYXA 4UWDA 2XR4A 3CDZB 1D0HA 3BVCA 3BPSA 4CCDA 4NIAA 3H3UA 5J98B 4LKFA 2QDRA 1CJPA 2XKPA 3ZYFA 3KV6A 1G7YA 1EYBA 4YGBA 4P9XA 4W8JA 5JR7B 3WDWA 4Z07A 4EN6B 1JXNA 3WCSA 3WOGA 2R043 2YMZA 1MS3A 5FY1A 1GSLA 4OULA 5EQUA 3S6PA 4BA6A 2YG0A 2ZEYA 3RMYA 3LEMA 4C8DA 2E63A 3IT8A 1UN1A 3VBUB 1UZZA 2DURA 2GNDA 5IVYA 2MPFA 4K40A 3B69A 5BUVA 2VQUA 4I02A 4M3CA 4Q4W1 1CIYA 4WVWA 2VD7A 2W1UA 4XJUA 3ZSLA 4FFFA 2ADDA 3WW4A 1MQTB 1C3HA 4NRPA 4B29A 3PTRB 3N9NA 1W06A 4GMP1 5FY7A 4YPJA 1ZZ7A 4ASKA 1NCQA 1K3IA 2R063 4FVVA 1JYNA 3U37A 3WLUA 3ZN6B 4LE3A 2LUWA 4LUMA 1ZRCA 5FZ9A 4CEWC 1GQPA 5C3SA 1YI9A 3BN6A 3WP5A 1GOFA 4YARA 2K9ZA 1Q56A 4ZY9A 3SLIA 2E26A 3N9QA 4NRMA 1O3QA 3MF6A 4DS0A 3BTZA 2D6LX 4QQPA 5FLHA 5GLWA 2VO5A 4Q0UA 2XVLA 2A6ZA 4OCTA 3VDBA 1XQNA 3U78A 2JDHA 4HVOA 4CXWA 3CMGA 5A6QA 4DXTA 2HWE2 1R1A1 1ZZ9A 2VBBA 2V5YA 1F5JA 2ZABA 2ZZQA 1POV1 4OVEA 5DDJ1 4ZS3A 1D4M1 5FYZA 3WHUA 5JSRA 3WP4A 5B4XA 2TNFA 3VD5A 3JB8A 2BZDA 2VZUA 3AKSA 3I59A 4P5HA 1AR82 2PAEA 1UYYA 3OF1A 5CFCB 3H8OA 1CIWA 4FOYA 4IE0A 4QB2A 3J8F1 4LLOA 4WVMB 2DUOA 2RS51 2AH2A 5T3NA 3UV9A 4M00A 4LUKA 5FBJA 2XJPA 3HMYA 1W6NA 1IHMA 2VMFA 3AZXA 1RJ8A 1ZX5A 3HD8B 3WXPA 4FO9A 4TN7A 3AP5A 4F3JA 3CEWA 4LA3A 1OQ1A 4HLTA 2W94A 2J1VA 4CPBD 2EIEA 3TEYA 2JIJA 2A1XA 3OSDA 4BQ3A 2P5BA 5GJ6A 5EIYB 1BBT3 3LQCA 3POBA 4XPVA 1QJFA 5A33A 2VVEA 2B46X 5FYUA 3VHRA 4X6RB 1YRZA 2YYOA 3WG2A 1N3OA 4Z2WA 3D0SA 2VTFA 5FKCA 3POFA 1LODA 1MEC3 4Y5Z0 4QX1A 1AL21 3LA3A 3WV6A 3ZSEA 4YZ2A 2BNOA 3W5MA 3BYWA 1LEMA 2ORZA 3POIA 2BNNA 4RGAA 2ARBA 4MYEA 4AEDA 4LK7A 3WF2A 4LBNA 4D94A 2GDFA 2WIIB 4N43A 1W6OB 2G4IA 2BOIA 2BVVA 3OCPA 1F9KA 2W52A 4UW3A 3VD7A 1TQ5A 3HPNA 2BGOA 3A7QA 2Q30A 4RQPC 5FP3A 2DTWA 3K3OA 5BNNA 2YUEA 3VKOA 4XABA 4MGYE 1ONAA 4OHZA 3WP6A 3ZR5A 4QD2A 4CEWB 2ZACA 1I3HA 4XBNA 1LRHA 2VMHA 2XJVA 3POGA 3VL9A 4WV8A 2BFUS 5FY4A 1WLDA 3LPGA 4OZXA 3SH5A 1PVC2 2QCSB 3IB3A 4HPKA 2XJRA 4UXAA 5L9BA 5KHKA 4I0BA 4X8PA 4SLIA 1SBDA 4DEQA 1G86A 4XFHA 4ASLA 2GN3A 1UY3A 1LR5A 1LHUA 4JDOA 1O5LA 2QQVA 4GJZA 3VV1A 4Y4YA 5FBZA 2HH9A 1H2NA 1M4WA 2CNAA 5AVPA 4OHWA 3RJRA 2UU8A 1A3KA 1CZSA 2PHDA 4XMAA 5HCHA 5EXOA 5F5CA 4AI2A 1AYM1 3AYCA 2JE9A 1V70A 1X33A 4XFBA 2AUYA 4RHV1 1G9BA 4UYBA 5I91A 2DU0A 3LZZA 1YYNA 4XJAA 2ZGRA 1MVQA 1GUIA 2VM9A 2WQ8A 4C1WA 4NIIA 2ZX0A 2DYCA 1H8TA 3PUAA 3KSCA 3SNMA 1W3XA 1S0FA 1F5FA 3VBFC 3ZO0B 1RC6A 5LRSA 1LU1A 1AR71 2JEMA 2VZPA 4MXWA 1MS5A 1QHDA 3ZMNA 3B01A 3KCXA 4Q0VA 1OFSA 5CYYA 5IFPA 3SEEA 3AP9A 1H2KA 1O4TA 4C90A 4DNYA 1VBE2 3RPQA 1V9U3 3AZYA 4XEZA 2OXBA 5EV7A 3ACHA 2R30A 1B35C 3WINE 3MEPA 1YFYA 5CFDA 1O5UA 1OPOA 2GH8A 4URAA 1QOOA 1QH7A 2Y33A 3TNQA 5LCWL 1RUOA 2DVFA 4LHLA 3B9IA 4MZUA 1UOBA 3ACIA 4ZHNA 1GQGA 3OBTA 1HXS2 2RG4A 4A7ZA 3VD9A 3W9AA 2AYHA 4AQTA 3CBNA 3N7MA 2BWCA 4Q4X3 3D3AA 4BE3A 2EA7A 1W9SA 2NMOA 1NKGA 1QJX2 2HWF2 2WNUB 3D5OA 3LDRA 3ZYRA 4CDXA 2X05A 1PMJX 3J26N 4MG2A 1LGBA 2P4EA 2BJSA 1RUI2 3S0MA 3VBHA 2CWSA 5SV8A 3C7FA 1NX9A 3RYKA 4FAGA 1OHFA 1KXGA 4R4ZA 3NAPA 3U0ZA 4LO4B 2WZR2 3ES4A 3KCYA 2QUOA 3KHBA 3KS7A 1UPIA 4B1LA 4WM7A 4E2GA 4UF0B 2XOMA 2MNGA 4MGIE 1VMFA 2CL2A 4KWLA 2E9QA 3U07A 3S30A 3WNKA 4CP2A 3AMQA 3V0AB 2NMNA 3T1LA 4XYXA 2L9LA 1T6BX 4R9CA 5FK8A 1AYN3 3HVDA 3VUOA 5GLTA 4TWTA 1AR91 4M3CF 4OI4A 3C7OA 2FBEA 1HB3A 3DCQA 1HJGA 3WQ1A 5KXBA 4LO7A 3C7EA 5LA1A 5IWFA 1CN1A 4RR3A 4OMDA 5C8WA 5T5JA 1FPN1 4BK5A 1YFUA 3O1VA 3OEBA 4META 4MGZE 3VLBB 2RMU1 5J37A 3LPFA 4LOSA 4KBBA 4COUA 2DVGA 2V72A 4W6XA 4E4HA 2BRTA 1HLCA 2Q8EA 2GNBA 5C5UA 4K8RB 1L7QA 2WWSA 5IK7A 1ODNA 1S1AA 2P3JA 1WBLA 1OFNA 2PHWA 2TUNA 1B35B 1J1TA 5IK8A 5IJRA 1S0GA 2QQIA 1VBD3 2ETEA 5EWSA 5FPAA 4CXYA 2YB7A 2WLQA 4YGCA 1XE0A 1JHNA 1UKRA 2XMLA 3NO8A 4YM2A 1DZRA 3VBUA 5A3LA 1H1MA 1K5JA 2DF7A 3FLPA 5LBCA 3MIFA 3M3EA 3PVEA 4FOQA 1QJU3 2VXRA 3ZSKA 2GNMA 1VIWB 1OLQA 2Q1FA 4IGQA 5B2GB 1VB2A 1IPSA 2WLPA 3RZKA 1ODMA 4K21A 5H9PA 4XAEA 3M3OA 4Q0PA 1MQTA 1OUSA 5JSPA 4XOGA 3WW1A 1GNHA 2JE8A 3ZIWA 1U5YA 3RFRA 3A21A 1GU3A 4BMBA 5FPUA 4S2FA 3ATGA 3JD73 3VZJA 2VZ3A 1LESA 2Y60A 3GHNA 3ZN6A 3CO2A 3KLSA 3SITA 5E89A 3GXUA 2WNVC 4QAWA 1GV9A 4Q1RA 5JXIA 4BQ4A 2UYBA 4TTGA 1IKQA 2EF6A 2OPWA 1RMU2 1UXXX 4KWJA 2HWC3 1W03A 1OVSA 1HQNA 1VBC2 3MDPA 5FP4A 4NIHA 1ULFA 4QGLA 1H4GA 3RZMA 5C9AC 1FMD2 1JOBA 2YDEA 4QX8A 5ACA1 5CBLA 5K7PA 4NROA 1AX2A 3J7MA 1GYKA 5F3IA 3IWZA 2CDOA 1PO21 3ZDSA 4P08A 2Z4FA 5CFCA 4ORFA 3N36A 5KWRA 2FCUA 1PZ9A 4X8NA 4O65A 4OHYA 3KV5A 3MW2A 3AMNA 4Q0SA 4WVMA 1OC1A 3ZXEA 3ZYJB 1DGWX 4ZPIA 2J1UA 2ZGQA 3NNFA 3ZYIB 4GQ7A 2NQYA 2RS31 1XYNA 5EHDA 3NRUA 3DPRC 1BEV1 3I2KA 1NE4A 1H9WA 3JQXA 3ZIXA 4QDRA 5FK7A 2XBO1 5FO7B 5T5LA 4CTEA 1VB4A 2PFWA 4FXGB 1OH3A 2ZGMA 2ZX1A 4K9SA 3ZXJA 4XW3A 3N7LA 4YWAA 1OOPC 4QPWA 1RUC1 1V6LA 1UAIA 2QQWA 4NHXA 3QCWA 2VMCA 3AJZA 2XJUA 4MLOA 3MLKA 2W9XA 3CJIC 2DCZA 3UKNA 1Q5OA 2IZWA 5LK5A 5A7PA 1WMXA 2V73A 3BOWA 2VTXJ 4FP3A 4GH4C 4GJYA 4XF4A 1RUJ1 4F8AA 3LSDA 5FP9A 1SZBA 3K4AA 4K1ZA 1KDMA 4MVTA 1W6OA 2LROA 1GWLA 4GWNA 4YZ5A 3IIAA 5FZGA 1DU3D 3I3QA 4FQ4A 2UWBA 5T52A 2O14A 1ZBE2 3K75B 5LA2A 5FZLA 4ISQA 1EUUA 3KMHA 4HANA 3TN93 1RVF2 1ZBA2 1VPHA 4O9GA 4S2HA 3RZZA 4CEWA 5CG8A 4ES9A 3TEWA 4S2DA 4TYSA 1DGRN 2WZ8A 3Q8FA 1HIXA 5FIXA 4KWKA 1J1LA 1F35A 3H7YA 4LBQA 1X82A 4QQHA 1BKZA 3U11A 2DFCA 1OI6A 1LGNA 3NNJA 1W8FA 4MGQA 3T3YA 3WR0A 3KT4A 5EYXA 3CLPA 5LA9A 4K7JA 4BCUA 4QB1A 4YM3A 1OD3A 1FOD3 3O0WA 5C9AB 2Y0IA 2IC1A 3MHZA 3RZHA 4BLJA 5FZFA 3AP7A 3AMMA 5FLJA 3PUSA 4IGOA 1W28A 1PNGA 2V4AA 3BODA 2JKBA 2PA7A 1RHI1 2Z79A 3ASIA 2VZSA 5JI7A 5A7WB 3UGHA 4LEJA 4JV4A 3O5SA 1PO13 1D2SA 3NNMA 2XHNA 4DUXA 1C8M1 3NJZA 1JZ4A 2CWMA 3GZAA 4HMZA 1QNWA 3DGTA 4KBZA 4Q4V3 2FDKA 2EVXA 4BWOA 5BV6A 1R093 2JG9C 5T54A 2XUMA 3M3IA 2JDAA 4IEYA 2ZAHA 4EN8B 4YZ1A 2Q8CA 1PNFA 2IUWA 2J1SA 3GBWA 3DPRB 4G3YC 4AZZA 2KM2A 4U2AA 3M70A 4NIDA 1WW6A 1SFPA 3FUOA 1V6OA 1Z78A 3O12A 4NE9A 3WQ0A 3N3HA 1OOPB 2RM22 5E6HA 2G9GA 5K0UC 1X9PA 3IDCB 3FLRA 1O6UA 1BJQA 1LOFA 1ENRA 1PM4A 1Z7S2 2ZS6B 2CDPA 3GF6A 1JBCA 2R072 4UFLA 1N47A 3CJIB 1LULA 5EP9A 5T5PA 1OQEA 2Y0OA 1VBB3 2JX9A 1WA4A 4ITCA 4GZ9A 5FO9B 4FTSA 1WLWA 2IVIB 1XXNA 3SCGA 4YG0A 1EV11 1OH4A 1GNYA 2DTYA 2FMDA 5JWPA 1L7RA 2WNUA 1P8JA 4N8MA 4GWMA 5JZGA 5CNAA 3O1OA 3LOBA 2IVJA 1OF4A 1OA4A 1QGLA 2RS12 3BTAA 3O0XA 4NVPA 4Q27A 4QB6A 1X7NA 1LGCA 1GICA 2PHRA 2XQRA 4OUSA 1N3QA 3VBRC 5LK7B 1MS9A 2JDYA 2I74A 1NLQA 1T6GC 4CCCA 1LOEA 3VGIA 1MR5A 2RR11 2YC0A 3UJOA 3AFKA 3LF7A 1W8ZA 4MGKE 5J3UA 1KGYA 2ZGTA 2OKXA 3EJKA 1XE7A 1FAYA 2D3PA 3NSTA 4FPOB 4KH9A 4UF0A 4WBBA 3S5QA 5CG9A 1NZCA 2VXJA 2BTVC 4PBOA 4AVTA 3V0AA 4GAZA 1VAMA 4ES8A 5IUQA 5C3OA 1RB8G 3IZOA 3T2QA 2FDHA 3RRDA 2WYFA 1BMV1 3LEIA 5IVJA 3RZJA 3D8CA 2BOJA 4XCBA 4B3NA 1DGLA 3FUQA 4J6GA 5I8TA 5LWBA 4XACA 1PX3A 4G9SB 2QQUA 2VZOA 2XL9A 1RUD3 1W6PB 3EQEA 3HIFA 4NHYA 2VOKA 4AQ2A 5IATA 4IEOA 5B4NA 1PIV3 4BYYA 3E1F1 2R49A 4A44A 4Q4W2 2EIDA 2PELA 4NO4A 3I3MA 3HN1A 2OIIA 2WQ4A 1EPZA 3KV4A 1VLNA 3WEZA 3ZXKA 2FD8A 1ASJ3 2D5FA 3FBMA 4KQ7A 4UOJA 5J36A 5F9TA 2JDKA 3OD0A 5BXXA 4XJZA 1B35A 2MHFA 2Q0AA 5A32A 3ENRA 5FZDA 5FOBB 5K0UB 1C4RA 1AR83 2VUCA 3CIHA 4FOWA 2HWB1 1CAVB 2WABA 2Y6JA 3WZ1A 1DQ5A 1UY2A 1H2MA 1XU2A 3O1SA 4FPYA 1V0AA 1UMZA 3RGBA 2AACA 5FY8A 3WDTA 3APBA 1BBT1 2BP6A 4LO5B 1WW5A 1OLME 1R1A2 2BBAA 4FPCA 5I93A 5IAXA 4JGZC 3U4XA 3I97A 1D4M2 3VBRB 2BPA2 4Y24A 2CGPA 4E4SA 1MEC1 4DINB 1NY71 3AVRA 4D6RA 2Z2SB 4DRVA 1QWRA 4HZFA 4JKKA 5BNPA 2WDBA 4XF0A 1LAJA 3I2JA 1UY0A 1WMEA 1EAH1 2R1BA 3EXUA 4BQWA 2IXLA 2G19A 2WFF1 3ILRA 2RS52 3J8F2 4IDZA 3GBFA 1CPMA 3FFQA 1ULOA 1W8NA 4FFIA 3JU9A 1A78A 1MS8A 5I0TA 2ZMLA 5IVCA 4E8DA 3NJVA 4OHVA 1RUE3 4A45A 2TEPA 5A6YA 1V6KA 1XNDA 2PAMA 3AKTA 4FTBA 1ZA4A 3ETPA 4KWUA 1COV1 2JG8C 3OGSA 1L7LA 1MZEA 4CP0A 3WVJA 5FKBA 5IFTA 3QACA 3URFA 1PGL1 2VGDA 3ZOIA 1J83A 2IXIA 5EFUA 2R0FA 2P34A 2WUHA 4L99A 1PVC3 3GNEA 3IDBB 5FPLA 1OLRA 1HQWA 2XWJB 4IERA 4CU6A 3BI3A 4LO8A 2VZVA 1S0CA 1AL22 1LOBA 1UMIA 4RGGA 4Z1VA 2P2KA 1ZZ8A 5GKAC 5FYHA 4YM0A 4AOCA 3NKGA 1HB2A 4UAPA 3B5LB 2VUJA 1LU2A 3E6DA 4QHZA 1N1VA 4FFGA 4QPYA 2B9UA 5JSOA 2WT1A 4ATFA 5LW9A 1H1IA 2Q1MA 1CGPA 2WA3A 3FJSA 1XYOA 3GCXA 1SCSA 2X5IC 1O8PA 4I0WB 1DHKB 4Q4Y3 4NN0A 4OFGA 2GMPA 2DDUA 2Q8DA 5AFBA 1I5ZA 2RHPA 5A1FA 1F15A 4AF9A 1GANA 4E4ZA 2J1EA 1QMJA 1W39A 4Q26A 3FE5A 4QKNA 2YXSA 1VBE3 1WGPA 2OS2A 4GKXA 4CEYC 2PHXA 1LHVA 4Y33A 1QJY1 4XMIA 4BQ5A 2DVAA 4JGZB 1RITA 2J7MA 5LEJA 1HX6A 4XZPA 4NUBA 1SBEA 4BQXA 4YZ3A 1AYM2 1W0OA 5KHIA 3R0RA 2XGXA 1XJAA 4RHV2 4I0AA 1FI2A 3TEZA 5FJHA 2AGSA 5FMOS 4C0BA 2V09A 4CCNA 1HXS3 4MV2A 4ET7A 2W2IA 5KC5A 4PLMA 4E8CA 1XYPA 3U14A 1AXZA 3P6BA 5FPVA 1QJX3 1JMUB 4HKOA 3WQBA 3FHIB 2X09A 3UT0A 1O59A 4DXRA 4CUGA 3MYXA 1REEA 5IVEA 1QXJA 1YQCA 1GZTA 1WCSA 1S0JA 3OUJA 2ZMNA 3WUCA 4AE2A 5DABA 2JB8A 2LW8A 3RI9A 4N9IA 2PHUA 5A7WA 3EHKA 3KHCA 2VG9A 1A6CA 4DXSA 2RDQA 3S7EA 4XVHA 4XQDA 4EZ4A 4NRQA 5CADA 5EPAA 4PI2A 2ZPXA 2C9AA 2E31A 2D97A 1O3SA 2RJ2A 5C6CA 1AYN1 5HPOA 1W3VA 2VUAA 5CEHA 3OYWB 1XNCA 3ECQA 4F83A 3N4MA 1HW5A 2A6VA 3BOPA 3DPRA 4LOTA 4B7EA 4NAMA 1OQDA 5FDBA 3L2HA 3SISA 3WNOA 1US3A 4XIKA 1QDCA 4Y4RA 2D98A 2J42A 3HQUA 2ZTNA 1PVXA 2BV4A 3GYDA 2P17A 3SQOA 1POQA 4BM8A 1OOPA 2XUEA 2Y6LA 4AAXA 2X5IB 3JCIA 5JOZA 1JU3A 1A8DA 2WNOA 3CJIA 3ZPOA 2J1RA 3PIJA 4IGPA 2VCBA 2VQ0A 3AYEA 2EIGA 1BQPA 4AI0A 4N53C 3WG4A 3KM5A 5JR2A 1K42A 2P1BA 3O1PA 4XURA 4Q2FA 1G9DA 2Y6KA 3RG0A 1CWPA 1WWYA 1VRH1 2D7FA 5EJ3A 5HXVA 5TSWA 1JUHA 4CEYB 1VBD1 4OYUA 5FTTC 4PT6A 4QPIB 4XDPA 2VCMA 2VNRA 3OOXA 2QQPA 1GKBA 1AR92 3HBZA 3EB7A 4DUVA 2SLIA 3DXUA 4GALA 2LRPA 4PLNA 2NP0A 1XNBA 1WCUA 3H9AA 4QX2A 1XSQA 2ZAAA 4DOUA 3SCFA 4EN0A 2A70A 2VULA 3ZFEC 1FPN2 2IFRA 5FMDA 2DU1A 3W5NA 2GALA 2ET1A 1RUF3 2RMU2 1GZCA 1K5MA 4PQ9A 1Q8VA 2ADEA 4ASMB 4BB3A 3M4FA 2PHLA 4P9YA 3A4UA 3NWKA 4QPGC 3A0NA 1CJDA 4R4XA 4AVVA 3IMNA 3LCPA 2B5HA 2KA3A 2RDRA 1QQP3 1IGOA 3G7DA 4IQPA 3BU7A 1S0IA 3T30A 4CRQA 1CZVA 4R52A 3TYJA 2AC1A 3JZVA 1DP0A 5GLZA 4AVBA 2HWC1 1NQDA 4FSJA 1DQ2A 4RN5A 2WO3A 3W20A 4Y5TA 1TME3 2WO1A 2H6CA 1W6PA 4MH0E 4Q5OA 4XBQA 1CPNA 1SLLA 1W04A 4ZZ5A 1W05A 5H9QA 1UZWA 2UY8A 1MACA 4COWA 3Q9OA 5K8SA 2DVDA 1FMD3 2R7EB 4XF9A 1LHOA 3HR9A 2FMYA 3OGJA 5A7QA 3PJYA 1H0BA 5CZKA 5BNOC 5K4LA 3NNLA 3T0BA 1AR61 2ZZJA 3POJA 3WF1A 3KF3A 5D1IA 5FR3A 5IYYA 2OX0A 2LALA 3MBWA 2W3JA 3MICA 1FYUA 3MLLA 2ZGSA 3PIGA 3Q8EA 1OXCA 4LORA 3TBDA 1X50A 2VNVA 2WNEA 4OI0A 3CQOA 1RUG3 3H0OA 3OPTA 4R9DA 2QQLA 1OSGA 4GWIA 4I3GA 3JBG3 3J4UH 4N53B 5LATA 3CZJA 2JE7A 2YPDA 4QWNA 4AGRA 1ZZBA 5C4WC 5KR7A 1XPWA 1JOPA 3ZVXA 4AFBA 3HNMA 3OBAA 4WZFA 4MO3M 3FFZA 1KDKA 5IW0A 2A3YA 2EAAA 2V5DA 2D43A 2ZX3A 3QH7A 3VBRA 5JMCA 3ME2A 3ZMOA 3B00A 1UWWA 4XJ9A 1QY4A 1PO22 3C3VA 3ZFEB 5J96B 1YXWA 1SLBA 1YIPA 4W65A 5FZHA 3MZHA 1SQ4A 5D21A 3AXDA 3INAA 2VPVA 2VBDA 2YBSA 4NHMA 3EBRA 1KITA 3RMXA 4P02B 1UOGA 2RS32 5ABJC 5DAXA 4QPGB 5D8AC 4WM8C 2R1DA 2VMEA 1BEV2 3WDUA 4R9BA 5A7OA 2D40A 4C0HA 4YFWA 1XU1A 2XBO2 5DPNA 4N9HA 1C5HA 1LJ7A 2D6PA 2BFUL 2PLV3 1RVF3 1YNAA 2RVAA 4OLLA 1CAXB 1CD3G 1ZBA3 2ILMA 1HRV2 1RUC2 5JUVA 1OPMA 2WR9A 3THPA 3O1RA 1OKOA 3VBOC 1GWKA 1UIKA 3BIEA 2JDMA 3P1IA 1FOD1 4PCRA 4IEQA 3ETQA 4JRAA 4JHTA 4KU7A 1SCRA 1I9RA 5FYCA 2F4LA 4I30A 2QZ2A 3SH3A 3VB9A 5FREA 4LBKA 3CL1A 1Y43B 5BNOB 3IPVB 1CX4A 2QQMA 4LBOA 1JUIA 4N7UA 1SACA 2MEV1 2B39A 1UU4A 2KD7A 5BPXA 3I3EA 4BK4A 2J22A 3JUUA 4I09A 5L36A 3S57A 1NCRC 2CV6A 2EAKA 4TSVA 4QGMA 3RYPA 5FYMA 4PHZA 4XDOA 1IS4A 1BVVA 4Y22B 1LHNA 1SFNA 4KGGA 4GB32 4DXZA 4AK3A 1PM7A 4DY3A 5FZ8A 5ACA2 5C4WB 4ISRA 1SLCA 3I2DA 3T0AA 4QHBA 3VKFC 4RQPB 3K4DA 3T0DA 1QOSA 3R4UA 5HCBA 4BIOA 4A41A 4JGZA 1IZ3A 1W2AX 3THCA 1G6NA 1NQJA 4FAHA 2OUJA 1JZ5A 1DYOA 1YUDA 5LEKA 1SDWA 1VBB1 4ZKTB 4P9WA 5HV0A 1J59A 5LASA 2HEWF 2PQSA 1G8WA 2JDNA 2WT2A 3AC0A 4IEWA 4AI9A 5J1XA 2BNMA 3VHOA 1UF2C 2D93A 1F8VA 1C8M2 3WW2A 5DAPA 1Z0HA 3POEA 3L9JT 5FZOB 5LB6A 1KFUL 1QIQA 1U0AA 2O1QA 4CCEA 3HQXA 1F31A 1Y7BA 3I2HA 2OQ6A 5ABJB 3KVAA 3HJRA 4YZ4A 5D8AB 4WM8B 2VY0A 2YGMA 5EZWA 1SFYA 1BZWA 3WNXA 3ZFFA 3H3LA 1LEDA 1BK1A 1E5IA 1A34A 3GBGA 2NYYA 1REDA 4TLFA 1YFXA 2UWAA 1ULEA 4P9LA 2OZ6A 4DIQA 3PVOA 4BQ2A 4LKEA 3S7IA 4AFDA 2FZ2A 3VBOB 3AP6A 4YW2A 2WSVA 4XDQA 2E32A 2VMGA 1JZ2A 1PGW1 3DV8A 3O14A 2GC3A 4I3PA 3UK9A 3VBFB 1PHMA 2DFBA 1UNBA 3LIGA 2HWD1 1TNRA 3WX5A 4AEMA 2ZJCA 2JD4A 5GLUA 2ATFA 1XRUA 1DZTA 3OYWA 4UBHA 1EV12 2NN8A 5FZ0A 4QQOA 4URTA 3W21A 1HJFA 3GHMA 1OT5A 3GZEA 5C70A 2PHFA 1EPWA 3W59A 4IEZA 1W6QB 5IK4A 3OTFA 4DRRA 3D4KA 5T55A 2GAUA 3OEAA 3AZVA 1OLMA 3WDXA 2VOWA 4MUVA 2X5IA 1RUD1 2FDIA 3I3DA 4LJHA 1NCRB 4W6WA 5FV3A 5FZKA 2RR12 1PIV1 2BDRA 3PVNA 3POYA 4FCAA 4UI9L 5A80A 4YW7A 4L8QA 4HETA 3IAPA 1RYYA 2SBAA 2XONA 1RGSA 1ASJ1 2EIBA 4CCOA 2D3SA 5DQ0A 1TMF3 2IXHA 5FUIA 4CEYA 2ZHKA 3CKHA 1UZYA 4QPIA 2N7GA 4GMP3 3B93A 2JICA 2K46A 2JXAA 1X8MA 4LHSA 4UBGA 1BMV2 3E5XA 3ZYHA 1UD1A 2ES3A 4JDNA 1LCLA 2UURA 4QKDA 4PLOA 4HK8A 3U4SA 2W68A 4XAAA 3HOBA 2W95A 2HLEA 5LBEA 3IDEA 1DZQA 3NV2A 4QXKA 1G9CA 4QM9A 4CU9A 3I54A 4EN7B 4HK9A 2D5HA 2Y34A 1N1YA 5SV5A 3T4VA 2WS93 1HRI2 5F3GA 3VN4A 4BQYA 3ZR6A 2XL7A 1R1A3 5LRRA 3WDYA 4BJ0A 1NOVA 1POV3 2QZ3A 5FY9A 3V65A 4V2WA 5KC6A 1ZRFA 2VQTA 1E57A 4LIVA 5JI9A 1S0DA 5A3MA 4LPLA 2D6KA 3E5UA 4OQ8A 1FT9A 2HWB2 4AHYA 4G4FA 1DYPA 4H7LA 4CPBA 1RL3A 2A3XA 1QXRA 1AXYA 5DUWA 1GR3A 4AL9A 4M0NA 2V4VA 1RUE1 4EJRA 2X29A 1VMJA 4IESA 3N35A 1H8VA 4QGNA 2CAVA 3PMEA 3VZNA 3AX4A 3LD8A 2NZ9A 1Y4WA 4P5YA 1SLAA 1WLTA 1BBT2 1DYKA 4P14A 3OBRA 2LTNA 3OPWA 5JPMB 5LY2A 4COVA 5JLVA 5GM0A 4TXWA 1SG3A 2QQJA 3ZSJA 1MEC2 2C1FA 1NY72 4BLIA 4YW1A 4A7YA 3MUY1 5FZEA 3FHAA 3P3NA 3WF4A 1YWKA 4BZ4A 2RDNA 1EAH2 1KJRA 5CA6A 3T1MA 1R083 2UYAA 2WFF2 2JDZA 1LOCA 1I1EA 2VOTA 1TE1B 1U5ZA 4N53A 4E2QA 4QMAA 1MPXA 2RV9A 2JENA 4K3UA 4IL7A 1SPPB 1X9TA 1V6IA 2ZBJA 3GM8A 4AHXA 2XH6A 1L3JA 4YRDA 4Q4Y1 1COV2 2K0GA 5F8PA 1VBA3 2XKOA 5E16A 2WNVB 3LA2A 4CU8A 2GP5A 2ZGKA 4V1PA 1SMVA 3ZFEA 3OGRA 4FOVA 4JTOA 1PGL2 2Z42A 2OW4A 1RUH3 3DF0A 3NV3A 5FZ3A 2XPJA 1SLIA 1BK0A 4FPFA 4RS5C 4CA9A 1CONA 2ZEZA 3LDKA 3MI8A 3WNPA 5BYNA 2WKKA 1W90A 4RYDA 4CUCA 4QPGA 3HBKA 1H30A 2QFEA 1V6MA 2ZEWA 3LEKA 4YGDA 3K77A 1YQ6A 3H1WA 3FZ3A 5DAQA 3WNLA 1AYM3 2AREA 2ET7A 1CAXA 1VRBA 2O0OA 4CUAA 4FFHA 2WZEA 3AVSA 4PIZA 3P3PA 5CKMA 1K12A 4A3ZA 3ZYGA 1H4HA 4DFSA 4EWDA 5IVFA 2BERA 3GCWA 5LBFA 2BUKA 4EROA 2WA4A 1PX4A 3OG2A 3THDA 2YBKA 1UKGA 5T50A 2B8MA 1U5IA 4LBMA 1IQAA 1SEFA 1S2EA 3BB6A 3ITQA 1W6MB 4QKBA 4PIXA 4BISA 4K8FA 1BVP1 1E5SA 3IPVA 5BNOA 1TNFA 1U12A 1QJY2 3R4SA 2CAUA 1JW6A 2EXHA 2VMIA 2E51A 4HN0A 4XFAA 4FTEA 4W50A 3RVHA 2WT0A 5AC93 4YGEA 5GZEA 4GH4B 4QX7A 1V6NA 5ISLA 2FDGA 4Y22A 4XF3A 4A3XA 2R041 4XFGA 5C4WA 1W8TA 4D7SA 5LA0A 3T2TA 4RQPA 1JZ6A 3N9PA 4IE5A 2ZA9A 2RDSA 2W1QA 2VW1A 2RE9A 3Q8BA 2D6MA 5FZ1A 4Y20B 1KRIA 2ORXA 1UOJA 3C8XA 3ZX7A 4FBFA 1IOAA 4M3CB 5I0DA 4ZS2A 5CVRA 4AG4A 1RINA 1WMFA 3N7KA 1IQDC 2BEOA 4RS5B 5FZOA 2D44A 3OGGA 2AENA 4LTAA 3HQRA 5H9RA 2R061 1NUKA 2XVGA 5ABJA 2F6BA 4NIGA 3OD4A 4WM8A 3V56A 1KFXL 3OUIA 4B4QA 3A0KA 1DLCA 2P3IA 3NNGA 4FXKB 2A75A 5HCAA 3KVBA 5JXHA 5FZIA 3B3QE 2XQXA 4NOTA 4CDQC 3B7MA 2Y6GA 4E27A 1EY2A 4ATEA 2AEYA 3I2FA 1YFWA 2O8OA 3LWCA 1RUF1 2K2SA 4HOOA 4XUTA 4COZA 1VR3A 1ZM1A 1YQ2A 2ARCA 2XG3A 4NWWA 4UFJA 3VBOA 1JOJA 1W2TA 2JG9B 4IETA 3O1MA 3K4ZA 3VBFA 2JB4A 1GOHA 3M8LA 2DBNA 2JKXA 4GWJA 3WNMA 4XBLA 4PIYA 4YW3A 4YNIA 1H1AA 2HWE3 3JB4C 5AFEA 3J7NA 1WCKA 2VR4A 4QX5A 5JXGA 1QQP1 3LEGA 2PMWB 1BYHA 1IG3A 1O7FA 1VRH2 5FUNA 5JIUA 2Q1ZB 1VBD2 2WAOA 2PN5A 4Y5SA 3N9MA 1F4HA 3FN9A 1W6QA 1AX1A 4BHPA 2GNTA 3OY8B 3D82A 4LR4A 1VE0A 2DBIA 1LKNA 1TME1 2VECA 5F5AA 1NT0A 4FPKA 1NCRA 1W9WA 4QKFA 2C9KA 1Q3EA 1OA2A 4JX0A 3PHMA 3ZYPA 1ST8A 4LULA 3B02A 2X53S 2B9VA 2DUPA 4A4AA 5C71A 1VALA 5CU1A 4WVVA 1MZ5A 5CB7A 4GIQA 4LO6B 1UO9A 1W2UA 4KMQA 4HL0A 4A7KA 3FLTA 1ZZ6A 2P37A 3OJBA 1FNZA 1UIJA 5FZ7A 5A3PA 5KHGA 3NL1A 4XZUG 4YYOA 5IK5A 5DDJ2 5CFDC 5DXDA 4L92A 4BOWA 2ZGUA 4AR2A 3KZ4C 3ZSMA 1FNYA 3PL0A 2Q5TA 4IV3C 3ILFA 1O91A 4WZCA 1ZRDA 1RUG1 5FZAA 2ZHNA 1D0GA 1GNZA 1DFQA 1REFA 2D3RA 1FV2A 3JBG1 3VD3A 4BPZA 1ULPA 2EXKA 2HWC2 2PAKA 4XCAA 4Q1PA 4C1XA 1C8NA 1SDDB 2BW8A 1JZ8A 4CDXC 4H3WA 5F6LB 4LITA 3A23A 4NR1A 5EJZB 3H3ZA 4OI2A 1ACCA 4XFFA 2Y64A 3MPBA 5FPZA 3ZXAC 1GWMA 1PGSA 2WBKA 4MADA 3NJXA 5JOWA 3AB0A 3R4DB 4DMIA 4Z8BA 3NAPC 4NMIA 2VZTA 1XNAA 3DUIA 3PUQA 1UU6A 4AFAA 3I2IA 5DUXA 4CDQB 1ENQA 1GFF2 3FBYA 3LIHA 4WM7C 4Y1YA 1PO23 2VQAA 1AR62 3F95A 3H8RA 2CYFA 3CHXA 5FYTA 5F32A 2ENRA 4QX3A 3VDDC 2OT7A 2FDJA 2JDPA 5J7MA 1JYCA 1K45A 1Q8OA 2Y6HA 2YHJA 3IMMA 4QXCA 4CDWC 4D8MA 2FDFA 1C5IA 1LOAA 2CGNA 2KXLA 1DDLA 1NLRA 1TEIA 5FZ6A 3BKZA 5FWEA 1ND2C 2PLV1 1DQ4A 3AKQA 4AXOA 1RVF1 4CDUC 1XBFA 2ZEXA 4RR3C 5C7GA 5I8SA 1NAEA 2ZGNA 4QX0A 1HRV3 5ANQA 2A6XA 3L2YA 3MIBA 4AWDA 3CNAA 3T2PA 2XLFA 1WD3A 1W0NA 4YVWC 5I0UA 4CP9B 3WQ7A 2BBVA 3AFGA 5DZEA 1V9U1 1AF9A 3K2OA 2A6YA 1QXPA 4JC1A 2W46A 3OUHA 1EUTA 2VTXA 5JOXA 1OF3A 5C3RA 1SPPA 2CSGA 1CR7A 1WW4A 2F4PA 3DECA 5CFDB 4M4PA 4OQ9A 2FQPA 4W4ZA 4XILA 4XTPA 1AXKA 4IV3B 2PYTA 2WNVA 4Q4X1 1WBFA 2HJIA 4JKMA 1RIRA 2W87A 4RGKA 3WCRA 4E4DX 2YFZA 2BGPA 5FWJA 2P3YA 2VNOA 2HWF3 4GB33 1FOD2 5ACA3 5T5OA 1AR72 1YHFA 3ORJA 5C9AA 5A6XA 1UY4A 1YQ5A 1QU0A 4IE6A 2H6BA 2WWUA 3FL7A 1RUI3 3H50A 3M3QA 2E7QA 4UW4A 3HNYM 4PF5A 3I4IA 2JG8B 2Y38A 3M2MA 3WSOA 3NAPB 3S5AA 1QF3A 2XLAA 4AFCA 1YIFA 3AMHA 5APAA 2HBTA 2WZR3 2VCCA 5FMOL 1XE8A 2FCVA 4WM7B 4PQQA 2MEV2 2JD9A 4A6OA 1MS1A 1H6XA 1SHWB 2XLGA 5FYBA 4E9KA 3QLQA 5CAZA 1CESA 2DCJA 3Q8AA 3CJXA 3VDDB 2VNGA 4QU2A 5F5QA 1NZIA 3LA7A 5JOYA 3UNPA 2VE1A 5CISA 4H2AA 4UFIA 3ALQA 4CDWB 3E97A 3MUZ1 4FQZA 2ZGPA 5GLVA 1UXZA 1ULGA 2HYXA 5C3QA 1Q43A 3TWIA 4CCLA 1W6MA 1ND2B 1OA3A 2HYKA 4HXCA 2D6NA 3VKMA 4CDUB 5DZFA 5IHRA 1DGWA 4RR3B 4XETA 5F2SA 3W58A 1IPKA 3KD4A 2FCTA 3RDIA 4QQ2A 2EALA 4NAOA 5FFOC 2GC0A 2VAUA 4P9IA 1O4ZA 1VBB2 4FPEA 4YVWB 5DAVA 1E5RA 1X36A 5FZMA 3AYDA 1AVBA 3LAGA 2Q8OA 4GH4A 4AI3A 3KGZA 1S4CA 1EV13 4QU1A 1NA1C 3ES1A 1UZ0A 3SEPA 1H2LA 4JTNA 4TLGA 4XJ8A 3PVBB 4AI8A 1W2NA 2C4XA 1M06G 1HKDA 4H14A 5LY1A 1YQ8A 4JQRA 2GC2A 4O9EA 2AEZA 3H8UA 2H0VA 4OZOA 4PBPA 3G6JB 4CSWA 4OMCA 4FPLA 4Y20A 3C2UA 1QJU1 2W1SA 2RR13 5DG2A 1C28A 3AZZA 1YO8A 3POWA 1O4YA 3V0BB 2XJQA 3H7JA 2B45X 3VKLA 4XXAA 1TMF1 1PGW2 2YFUA 4ZU7A 1KS4A 5FYYA 4D6SA 5FMCA 1JZ3A 2GC1A 4RS5A 1J3PA 2HWD2 3JD71 3WHTA 4GMP0 5EYYA 4HVQA 1JYTA 3D6EA 1W2OA 1O3RA 4QDSA 1UU5A 1KQRA 1Y9GA 4YW6A 1AX0A 1ULDA 1Q8QA 2E53A 5FY0A 5HXMA 5DN2A 1ENSA 4HG6B 3VDAA 4AEKA 5M0TA 3VD4A 1OMIA 4R8HA 5EJ1B 3EO6A 4CCMA 1HV1A 1RUD2 5FXWA 1RMU3 4B7KA 1AL0G 3E6CC 3V64A 1PIV2 2CU5A 2JG9A 1VBC3 1UQXA 2WS91 3GGLA 5F3EA 3ZFGC 5C3PA 4KNCA 1QJZA 1HRI3 3EMRA 2WRAA 1POV0 1ASJ2 3SMHA 3VHPA 1UZVA 2WO7A 3KV9A 2XDVA 2I45A 4KL1A 4TZDA 4IUGA 4RD7A 5FPXA 4ARXA 5IVBA 4CUBA 2B7YA 3QOPA 2WO2A 4U36A 2DV9A 5K0UA 2XB6C 3TAYA 4QQLA 3ST7A 1BXHA 2X10A 3OY8A 1CAVA 4NPMA 3ZXGA 2HWB3 3PNAA 1QNYA 1J58A 3I2OA 4M0HA 4P00B 3BUCA 3E5QA 3I2GA 4INDA 1MZFA 4ZXKA 4EWAA 2DUQA 1FATA 2HKXA 3DEMA 3MV01 1WCDJ 3JXSA 1S2KA 2AZ5A 4S2GA 2C6SA 2F17A 1NA1B 3UKTA 4XUQA 3VDCA 3HWJA 3RZGA 2JJ6A 4OUMA 5DMYA 4CCJA 4Q0QA 3KQRA 1JYIA 1AZDA 3X29B 1Y9MA 3MIHA 1ZYBA 2YC2A 1LOFC 4YVSC 4XUOA 4IW3A 1HV0A 4ONUA 4AI1A 4N7IA 4BXSV 1ND3C 5GZDA 4HBNA 4SBVA 4R9AA 3SKJE 1R081 4LMFA 4LKDA 3RWNA 1EAH3 4XF1A 4MGSA 4Y3OA 2IXKA 2WFF3 2WNUC 5FYVA 2O8QA 5JZGC 1Y3TA 3FWEA 1RUE2 5A3NA 5F1RA 2LS6A 1JI6A 4O61A 3TN91 2JIGA 1ZBE3 4JRLA 5FP7A 1XSRA 1VBA1 5FOJB 2QQKA 5GZGA 1COV3 4XUNA 4PDWC 3BPZA 1NLSA 3ZXDA 5JCTA 4CDQA 3U75A 2IWGB 1RUH1 4LBQB 2BU9A 3QD6A 3JQWA 3WP3A 3MV11 3UYJA 3IN9A 2XWBB 1CQ9A 1LHWA 2PHTA 3KT1A 4NJ4A 1ZNPA 1LECA 3ZFGB 1J3RA 4V2VA 4JHZA 4LBQD 5FCCA 1RUJ2 5C8CC 5F37A 1UOFA 3UL2A 4Z92B 1IS3A 1S0EA 1NE6A 4LT5A 1UYPA 1PO11 3SCHA 4IXLA 3J7HA 4FT8A 5BNQA 1UW8A 2VH9A 1GQHA 2A73B 1UYZA 4LK6A 4Q4V1 5CKQA 5LZ6A 4Q4Y2 2Z69A 1R091 2RJLA 3K46A 1UMHA 3OB8A 4RSUA 4AAPA 1C57A 2ZMKA 2D6OX 5JAXA 1D2QA 4P9GA 4CP9A 1IPJA 5C33A 4UFKA 4Z82A 3CF6E 1JODA 3IIIA 2I2SA 5H9SA 3NKTA 2DVBA 4YM1A 2RM23 5J09A 1QJY3 4YVSB 4JDMA 3N9LA 1QJEA 2OUHA 5AC91 1IS5A 1RHI2 3H42B 5HCFA 1Z7S3 4UFHA 1ND3B 5A3OA 2R073 5A7NA 4IV1C 4IV3A 3KT7A 2VOXA 4CYDA 4LQRA 4L9BA 3SKVA 3AL6A 3MLJA 2OVUA 2ARAA 3UGFA 1AUYA 1IG0A 4LIUA 5HBAA 3N9OA 3UJQA 1KD7A 2H0BA 2QDNA 2YV8A 5L73A 5LBBA 3VL8A 2QE3A 1GOGA 5FPBA 2EXJA 4NHKA 4BDVB 5FAXA 1AHSA 4UW5A 5JZGB 4XFIA 3AKRA 5JXJA 3C7HA 1GZ9A 2A71A 2QTWB 1OVPA 3O7OA 3WG1A 1BHGA 5DZGA 5AVAA 2RS13 3BALA 3TB0A 3I49A 3BCWA 3NQHA 2QVSB 2JG8A 2ZGLA 4JAAA 4XHXA 1YC61 5BNPC 4EWEA 2X8KA 4PDWB 5FLIA 1HQLA 2YZ4A 3DYPA 4CVUA 2YU1A 4AGGA 3VBSC 3DYMA 3IKWA 4PI0A 1PK6C 1CAUB 5D2AA 5FZCA 3O1UA 4RFT0 3VDDA 5DG1A 1J3QA 3PUHA 2VBPA 4ZU4A 3PMSA 1KJLA 3NW4A 3RWKX 1EP0A 4CDWA 4BMEA 3D0JA 5K9YA 4AHZA 3C7GA 3DYOA 2IXJA 3ZYBA 3ZXFA 5C8CB 2R042 2EICA 1ND2A 3CU7A 4CCKA 3LB9A 4IE7A 4CDUA 4D6QA 1WUVA 2IXCA 2OQ7A 1TG7A 1O3TA 2CY6A 3P5BA 2B4KA 4MX3A 2KR2A 4DZGA 5CIRA 5I0SA 1WMDA 1FX5A 4W6YA 1G9FA 4YVWA 3ZN5A 2R32A 3KWVA 2W1WA 1OKQA 5L9VA 1SBFA 2HWE1 3WF0A 3I7DA 2VW2A 4Q8LA 4Q4W3 5C5TA 4ZXEA 5FZBA 1GLHA 3AK0A 3PLQA 4HKWA 4XFCA 3TEXA 1YJKA 1DQ6A 2A7AA 4YW5A 3WT3A 4JGYC 2R062 2A6WA 5A32B 1AR81 2WZPP 5JVVA 3RZLA 1VRH3 2WQZC 1AJOA 5F7UA 2QKDA 3BTYA 4QXBA 3IBMA 5A3UA 3K48A 4IV1B 3VKNA 5JIAA 3BGAA 3DL3A 1FXZA 5FQ0B 1ZA7A 1DQ1A 3V0BA 2XJSA 1RUF2 3PDQA 1YEWA 3ZKUA 4MXVA 1QEXA 1YI7A 2XXZA 3MF9A 1HN1A 3QBQA 1RTVA 4FI9A 5KHHA 2G9ZA 1OURA 5G04L 2DCTA 3RYRA 2EXIA 2WINB 3BIWE 5FJKA 5DDJ3 1D4M3 2FZ1A 1QQP2 2P3KA 2ZX2A 1OUXA 1WKYA 2VJXA 1H6YA 4JCKA 3UETA 4AVAA 5BNPB 4AHWA 3RQ0A 4M3CE 4LA2A 5L7OC 3GJAA 3QH6A 2AR6A 2VVDA 3TNPB 3VBSB 2WL1A 1PK6B 3J8F3 4NHLA 4M01A 1CAWB 1TME2 1UPSA 1VAVA 1W8HA 2JECA 2RS53 2Z5WA 1W9FA 4KGQA 2R16A 4NWVA 3KF5A 2QJVA 3CZUA 3AXEA 3ELNA 3J7LA 3WD5A 4CP1A 2ZOEB 4DUWA 5I8YA 4EE2A 1HDKA 1V6JA 4RFRB 1GP4A 3ZPYA 3MIGA 1VMHA 1JS9A 3LOIA 5FUPA 2C0ZA 1YLLA 3AL5A 5L9RA 4WVZA 5KXDA 4JVAA 4AVCA 2G9FA 4AGVA 5F6KA 2UWCA 1LENA 1PVC1 1AR63 2W47A 3PU8A 3VZMA 3HNBM 1F2NA 2J1TA 4B4RA 4IEVA 5GZCA 1ENXA 1PMHX 4OI1A 1RUG2 3WF3A 2VMDA 4Q8KA 1AL23 2ID4A 2VC9A 3JBG2 2QBXA 2W0XA 4HN1A 4DO0A 1GZWB 4D7TA 2PXJA 4C91A 5BY5A 2W5FA 1ZREA 4K20A 4YFZA 4JZRA 4HKLA 4JGYB 1NA1A 2WFPA 1W8OA 4FPHA 4YG3A 3J9SA 1HRV1 1W8UA 1GMMA 3MFAA 1JH5A 3AMPA 4MGTA 3HT2A 2VUDA 1PZ7A 2E7TA 3U10A 2QQNA 4LXLA 5KHJA 3H8XA 2ZKNA 4LBLA 4HONA 4H7MA 3VZOA 4D7YA 5A6ZA 3IDAA 4GKYA 4HSJA 5DUVA 3GJBA 2GMEA 1VBE1 1ZVFA 4LHKA 3AJYA 2NLRA 1VAKA 3ZKYA 3SH4A 2WWJA 3LSEA 4RL7A 1NCQC 2C5DA 4E2SA 4H55A 1QKQA 2QQOA 2IFWA 1JHJA 4XJWA 1J84A 2HEVF 4EYUA 2PLV2 4Q29A 4LNVA 4EN9B 4LE4A 4HFSA 5CKNA 3B9CA 3DKWA 3MFCA 5L7OB 1HXS1 1H9PA 2DCKA 2XVKA 4RHV3 4XQWA 1S0BA 1BCXA 2WN3A 4HT1T 2QNKA 5F5IA 3BTXA 2E33A 2YBPA 3MIEA 3ON7A 2Q4SA 1QJX1 2HWF1 3THTA 4GB31 3AM2A 1K5MC 4B8EA 3MW3A 2CHHA 3FMGA 2ZXQA 3ILNA 1I5PA 4P9JA 3B94A 3RSJA 1N1SA 1AR73 1RUI1 4Y1VA 3ZFGA 4D69A 2DCYA 2VZQA 1V9U2 2LM3A 1E5HA 2C24A 4XHBA 3NVCA 4HVRA 3NV4A 4Y26A 3ACFA 3USUB 2BGCA 2WZR1 4MHRA 5KXEA 4GXLA 2HBUA 5DAWA 4EZHA 4MOAA 4AQSA 5JPNB 2VZ1A 1UX6A 2R6QA 3M7AA 1JYVA 4OUEA 3ACLA 4N90A 4BU2A 2MEV3 5A1LA 3MIDA 4CE8A 4YW4A 1JYWA 3IM0A 3LDBA 3WW3A 2BWAA 2CTVA 2OZJA 4Q4X2 1AJKA 4QXHA 3AKPA 5E8AA 3UGGA 4B4PA 4NPRA 3VZKA 1D7PM 5FMBA 2CGOA 1DIWA 3WG3A 3MGUA 1QDOA 4Y1UA 4LHNA 1I6XA 1N1TA 1ZRRA 4FPJA 2GZWA 1WD4A 5FO8B 1OBNA 2VW0A 4KG0A 1UX7A 1LB2A 5E88A 2FHRA 2OYZA 5FXXA 4B1MA 2YC4A 1JTZX 1GBGA 1STMA 2OA2A 4YVSA 4XC9A 3OGVA 2XJTA 4FP2A 4LLFA 2I07B 4Y1ZA 3VHNA 3AZWA 4D0QA 1OD5A 5KXCA 4FPGA 5DUUA 1ND3A 1XC6A 1KS5A 2ARXA 1RXFA 3NV1A 3WUDA 1N3PA 3MW4A 2HEYF 4AEDC 2E6VA 4QT6A 4XUPA 3VZLA 4N43C 5FXZA 3HAGA 4QDQA 1AYN2 1MS0A 1R64A 5J48A 1W0PA 5FP8A 1US2A 3HN3A 2G1MA 3GALA 1NCQB 5BNNC 1WW7A 2GMMA 2YU2A 5D8AA 1MVEA 1JN2P 4RA0A 5GALA 1AR93 1ZZCA 2XHKA 3K51A 3ZLIA 1DQ0A 1KEXA 1ULCA 3SXWA 3H1MA 3T08A 4JKLA 4PDWA 5GZFA 1DCSA 1FPN3 5F2WA 5FY5A 3R6SA 4IEXA 4CXXA 5IVVA 3RJ2X 1K5MB 2Y26A 2RMU3 1CAUA 2WAAA 2WYSA 4UT5A 1QH6A 3R05A 4DPNA 2YGLA 3T4HB 4ZZ8A 2C26A 4GULA 4YSFA 5JDBA 2HWD3 4OHXA 2R0HA 2ZGOA 5FZ4A 5I0RA 5C8CA 1RUNA 3FX3A 2OPKA 1LOGA 1RJ7A 3I59B 4A42A 1WZXA 4JQTA 2ZHLA 1TVGA 2RJKA 3PURA 3AYAA 1APNA 1H8TC 1Q8SA 1RMU1 3SHRA 2J1AA 5IAVA 1Q8PA 1VBC1 1C1FA 1W6NB 3KQ4B 4PF1A 2A5ZA 1QJU2 4ZU5A 3ROUA 4DEVA 3O0VA 3LGRA 1FMD1 1HRI1 4DB5A 1W8WA 1X8EA 1TMF2 1URXA 1NYWA
chains in the Genus database with same CATH topology
4NPLA 3S57A 3BTXA 2FDGA 3RZLA 2FDHA 3H8RA 2FDFA 3BTYA 4NJ4A 4O7XA 3O1TA 3RZJA 4IE5A 4QKNA 2FDJA 4QHOA 3O1VA 3I3QA 3BKZA 4ZS2A 3I3MA 2FD8A 4NIGA 3T3YA 4IE4A 4CXYA 3RZHA 3O1SA 5DABA 3KHCA 3O1MA 4RFRB 3RZKA 4NRQA 5F8PA 2FDKA 4NIIA 4NRPA 2IUWA 4NIDA 4NPMA 3I49A 3I2OA 3BUCA 4IE6A 4IDZA 4NRMA 4QKFA 2FDIA 3BTZA 3S5AA 4NIHA 4OCTA 3RZMA 4CXXA 3BU0A 4CXWA 3RZGA 4NROA 4ZHNA 3T4HB 4ZS3A 3O1UA 3O1RA 3O1PA 4MGTA 3H8XA 3BIEA 3O1OA 3H8OA 4IE0A 3BI3A 4MG2A 4IE7A 4JHTA 4QKBA 4QKDA 3LFMA 3KHBA 4O61A 3T4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPL A;  3S57 A;  3BTX A;  2FDG A;  3RZL A;  2FDH A;  3H8R A;  2FDF A;  3BTY A;  4NJ4 A;  4O7X A;  3O1T A;  3RZJ A;  4IE5 A;  4QKN A;  2FDJ A;  4QHO A;  3O1V A;  3I3Q A;  3BKZ A;  4ZS2 A;  3I3M A;  2FD8 A;  4NIG A;  3T3Y A;  4IE4 A;  4CXY A;  3RZH A;  3O1S A;  5DAB A;  3KHC A;  3O1M A;  4RFR B;  3RZK A;  4NRQ A;  5F8P A;  2FDK A;  4NII A;  4NRP A;  2IUW A;  4NID A;  4NPM A;  3I49 A;  3I2O A;  3BUC A;  4IE6 A;  4IDZ A;  4NRM A;  4QKF A;  2FDI A;  3BTZ A;  3S5A A;  4NIH A;  4OCT A;  3RZM A;  4CXX A;  3BU0 A;  4CXW A;  3RZG A;  4NRO A;  4ZHN A;  3T4H B;  4ZS3 A;  3O1U A;  3O1R A;  3O1P A;  4MGT A;  3H8X A;  3BIE A;  3O1O A;  3H8O A;  4IE0 A;  3BI3 A;  4MG2 A;  4IE7 A;  4JHT A;  4QKB A;  4QKD A;  3LFM A;  3KHB A;  4O61 A;  3T4V A; 
#chains in the Genus database with same CATH topology
 5A7S A;  2Y6F A;  3GZU C;  4DY5 A;  2PTM A;  2NPI A;  3M3C A;  4L0P A;  3EYP A;  5A33 B;  4J1W A;  3JD7 2;  2WSU A;  5G05 L;  3K3N A;  1SLT A;  3GZT B;  2ZCW A;  2YY1 A;  3M1H A;  3Q8C A;  4J1X A;  1YJL A;  4XIO A;  5A70 A;  3WY6 A;  1UY1 A;  1VP6 A;  1GP6 A;  2BQP A;  3N7J A;  3PUI A;  4O7X A;  3O1T A;  4Y1X A;  1NG0 A;  4IV1 A;  5HV4 A;  4GD4 A;  2JDU A;  4AED B;  3UES A;  4CU7 A;  2W91 A;  3H1Y A;  5FQ0 A;  5FXV A;  4N43 B;  1IKP A;  4KI5 M;  1VJ2 A;  1CZT A;  1XB9 A;  1XNK A;  3OPZ A;  4QM8 A;  3RI8 A;  1A8M A;  1DGR A;  2WS9 2;  3NMB A;  3POS A;  3PJQ A;  3AP4 A;  4IEU A;  5BNN B;  1BLZ A;  3RNS A;  4CZS A;  3VBH C;  5ERL A;  2BVB A;  3ZM8 A;  1V00 A;  4PJY A;  4AYU A;  3ZN4 A;  1CX1 A;  1O8S A;  1ZRI A;  1Y9Q A;  1C1L A;  1F4A A;  5FYI A;  3SC7 X;  1NXM A;  1T2X A;  3GDB A;  3PU3 A;  2B42 B;  2UY9 A;  4YLZ A;  4HPK B;  1FV3 A;  3DKQ A;  3VBS A;  1GP5 A;  1HB4 A;  4IE4 A;  1PK6 A;  1CAW A;  4AEJ A;  4BQ1 A;  5ANN A;  2Y8K A;  3ZFF C;  2GH2 A;  4AW7 A;  2RS3 3;  1ZBE 1;  4L11 A;  3KGL A;  1BEV 3;  4XTM A;  1XOY A;  2ERF A;  2XBO 3;  3RS6 A;  1U5X A;  4A2U A;  1ZBA 1;  1W9Y A;  4ARY A;  1TZO A;  3F2Z A;  3T2O A;  3MO4 A;  4K1Y A;  1DBN A;  4J25 A;  3LFI A;  1RUC 3;  1H8T B;  3FC0 A;  4BH9 A;  1JZ7 A;  2A3W A;  3E6B A;  4F7Z A;  4XXP A;  1ALY A;  3USS A;  2GU9 A;  2JWP A;  4EV0 A;  2W08 A;  2W92 A;  3I8T A;  3I3B A;  4MXW B;  2VOV A;  5F39 A;  2PQQ A;  2VL4 A;  1R08 2;  4HSL A;  1DF0 A;  4IEP A;  4Z2A A;  2P6H A;  5L19 A;  4A6S A;  1GZW A;  3WDV A;  2ZHM A;  2VVF A;  1RUJ 3;  3MPP G;  4KU8 A;  3LKJ A;  1MZ6 A;  2WJS A;  4KG8 A;  3UKV A;  1WLC A;  2E7A A;  3KCC A;  4JGY A;  4DQA A;  4XQ4 A;  1RXG A;  4MHU A;  3BU0 A;  1NXD 1;  3IAQ A;  3TN9 2;  2VU9 A;  4L2N A;  5IT6 A;  1VBA 2;  5A3T A;  3VBU C;  3KB5 A;  4D3W A;  4XE9 A;  4X6Q B;  1W9T A;  4K6B A;  3WNN A;  1PZ8 A;  2VZR A;  1LNS A;  1RUH 2;  5F3C A;  2YPJ A;  2BYV E;  2NM1 A;  3LE0 A;  4CDX B;  2DWR A;  5A1A A;  1MQT C;  3PTY A;  1UCX A;  1IS6 A;  1DG6 A;  2W39 A;  2WC2 A;  1WA6 X;  4GA9 A;  5KBF A;  2RM2 1;  3VBH B;  1XNT A;  4QPI C;  2ZX4 A;  3DN7 A;  1S55 A;  3LFM A;  1HN0 A;  3ZDV A;  1Z7S 1;  2R07 1;  1MS4 A;  2GP3 A;  2ZKL A;  1RHI 3;  4ZON A;  1PO1 2;  3FHQ A;  1W99 A;  4LBJ A;  5E1R A;  1UL9 A;  1CVN A;  1QOT A;  3HEI A;  4BXF A;  5L7O A;  5A3W A;  4NPL A;  4I01 A;  2GN7 A;  1DLL A;  4Q4V 2;  3ZXL A;  1UYX A;  3ABZ A;  1R09 2;  3TOJ A;  1C8M 3;  4LKS A;  2TBV A;  2WN2 A;  3A22 A;  3TRS B;  4AFM A;  1B09 A;  1S2B A;  5HI0 A;  3ZFF B;  4AVS A;  1R1Z A;  2RS1 1;  3T09 A;  1JU4 A;  3DXT A;  5FYS A;  2VCA A;  4BIF A;  4L97 A;  4COY A;  1PMI A;  3OBZ A;  3USU A;  4YG6 A;  4QHO A;  4I2O A;  4UW6 A;  2GSY A;  1HB1 A;  5FRA A;  5CFC C;  1YCI A;  2P6C A;  3NJY A;  1WCQ A;  3ACG A;  4EQV A;  1G9A A;  1LTE A;  4UFM A;  4AQ6 A;  3U1X A;  5AC9 2;  2YRO A;  3HT1 A;  1D4V B;  4M4R A;  4MSV A;  5JMO A;  1JYX A;  4UWD A;  2XR4 A;  3CDZ B;  1D0H A;  3BVC A;  3BPS A;  4CCD A;  4NIA A;  3H3U A;  5J98 B;  4LKF A;  2QDR A;  1CJP A;  2XKP A;  3ZYF A;  3KV6 A;  1G7Y A;  1EYB A;  4YGB A;  4P9X A;  4W8J A;  5JR7 B;  3WDW A;  4Z07 A;  4EN6 B;  1JXN A;  3WCS A;  3WOG A;  2R04 3;  2YMZ A;  1MS3 A;  5FY1 A;  1GSL A;  4OUL A;  5EQU A;  3S6P A;  4BA6 A;  2YG0 A;  2ZEY A;  3RMY A;  3LEM A;  4C8D A;  2E63 A;  3IT8 A;  1UN1 A;  3VBU B;  1UZZ A;  2DUR A;  2GND A;  5IVY A;  2MPF A;  4K40 A;  3B69 A;  5BUV A;  2VQU A;  4I02 A;  4M3C A;  4Q4W 1;  1CIY A;  4WVW A;  2VD7 A;  2W1U A;  4XJU A;  3ZSL A;  4FFF A;  2ADD A;  3WW4 A;  1MQT B;  1C3H A;  4NRP A;  4B29 A;  3PTR B;  3N9N A;  1W06 A;  4GMP 1;  5FY7 A;  4YPJ A;  1ZZ7 A;  4ASK A;  1NCQ A;  1K3I A;  2R06 3;  4FVV A;  1JYN A;  3U37 A;  3WLU A;  3ZN6 B;  4LE3 A;  2LUW A;  4LUM A;  1ZRC A;  5FZ9 A;  4CEW C;  1GQP A;  5C3S A;  1YI9 A;  3BN6 A;  3WP5 A;  1GOF A;  4YAR A;  2K9Z A;  1Q56 A;  4ZY9 A;  3SLI A;  2E26 A;  3N9Q A;  4NRM A;  1O3Q A;  3MF6 A;  4DS0 A;  3BTZ A;  2D6L X;  4QQP A;  5FLH A;  5GLW A;  2VO5 A;  4Q0U A;  2XVL A;  2A6Z A;  4OCT A;  3VDB A;  1XQN A;  3U78 A;  2JDH A;  4HVO A;  4CXW A;  3CMG A;  5A6Q A;  4DXT A;  2HWE 2;  1R1A 1;  1ZZ9 A;  2VBB A;  2V5Y A;  1F5J A;  2ZAB A;  2ZZQ A;  1POV 1;  4OVE A;  5DDJ 1;  4ZS3 A;  1D4M 1;  5FYZ A;  3WHU A;  5JSR A;  3WP4 A;  5B4X A;  2TNF A;  3VD5 A;  3JB8 A;  2BZD A;  2VZU A;  3AKS A;  3I59 A;  4P5H A;  1AR8 2;  2PAE A;  1UYY A;  3OF1 A;  5CFC B;  3H8O A;  1CIW A;  4FOY A;  4IE0 A;  4QB2 A;  3J8F 1;  4LLO A;  4WVM B;  2DUO A;  2RS5 1;  2AH2 A;  5T3N A;  3UV9 A;  4M00 A;  4LUK A;  5FBJ A;  2XJP A;  3HMY A;  1W6N A;  1IHM A;  2VMF A;  3AZX A;  1RJ8 A;  1ZX5 A;  3HD8 B;  3WXP A;  4FO9 A;  4TN7 A;  3AP5 A;  4F3J A;  3CEW A;  4LA3 A;  1OQ1 A;  4HLT A;  2W94 A;  2J1V A;  4CPB D;  2EIE A;  3TEY A;  2JIJ A;  2A1X A;  3OSD A;  4BQ3 A;  2P5B A;  5GJ6 A;  5EIY B;  1BBT 3;  3LQC A;  3POB A;  4XPV A;  1QJF A;  5A33 A;  2VVE A;  2B46 X;  5FYU A;  3VHR A;  4X6R B;  1YRZ A;  2YYO A;  3WG2 A;  1N3O A;  4Z2W A;  3D0S A;  2VTF A;  5FKC A;  3POF A;  1LOD A;  1MEC 3;  4Y5Z 0;  4QX1 A;  1AL2 1;  3LA3 A;  3WV6 A;  3ZSE A;  4YZ2 A;  2BNO A;  3W5M A;  3BYW A;  1LEM A;  2ORZ A;  3POI A;  2BNN A;  4RGA A;  2ARB A;  4MYE A;  4AED A;  4LK7 A;  3WF2 A;  4LBN A;  4D94 A;  2GDF A;  2WII B;  4N43 A;  1W6O B;  2G4I A;  2BOI A;  2BVV A;  3OCP A;  1F9K A;  2W52 A;  4UW3 A;  3VD7 A;  1TQ5 A;  3HPN A;  2BGO A;  3A7Q A;  2Q30 A;  4RQP C;  5FP3 A;  2DTW A;  3K3O A;  5BNN A;  2YUE A;  3VKO A;  4XAB A;  4MGY E;  1ONA A;  4OHZ A;  3WP6 A;  3ZR5 A;  4QD2 A;  4CEW B;  2ZAC A;  1I3H A;  4XBN A;  1LRH A;  2VMH A;  2XJV A;  3POG A;  3VL9 A;  4WV8 A;  2BFU S;  5FY4 A;  1WLD A;  3LPG A;  4OZX A;  3SH5 A;  1PVC 2;  2QCS B;  3IB3 A;  4HPK A;  2XJR A;  4UXA A;  5L9B A;  5KHK A;  4I0B A;  4X8P A;  4SLI A;  1SBD A;  4DEQ A;  1G86 A;  4XFH A;  4ASL A;  2GN3 A;  1UY3 A;  1LR5 A;  1LHU A;  4JDO A;  1O5L A;  2QQV A;  4GJZ A;  3VV1 A;  4Y4Y A;  5FBZ A;  2HH9 A;  1H2N A;  1M4W A;  2CNA A;  5AVP A;  4OHW A;  3RJR A;  2UU8 A;  1A3K A;  1CZS A;  2PHD A;  4XMA A;  5HCH A;  5EXO A;  5F5C A;  4AI2 A;  1AYM 1;  3AYC A;  2JE9 A;  1V70 A;  1X33 A;  4XFB A;  2AUY A;  4RHV 1;  1G9B A;  4UYB A;  5I91 A;  2DU0 A;  3LZZ A;  1YYN A;  4XJA A;  2ZGR A;  1MVQ A;  1GUI A;  2VM9 A;  2WQ8 A;  4C1W A;  4NII A;  2ZX0 A;  2DYC A;  1H8T A;  3PUA A;  3KSC A;  3SNM A;  1W3X A;  1S0F A;  1F5F A;  3VBF C;  3ZO0 B;  1RC6 A;  5LRS A;  1LU1 A;  1AR7 1;  2JEM A;  2VZP A;  4MXW A;  1MS5 A;  1QHD A;  3ZMN A;  3B01 A;  3KCX A;  4Q0V A;  1OFS A;  5CYY A;  5IFP A;  3SEE A;  3AP9 A;  1H2K A;  1O4T A;  4C90 A;  4DNY A;  1VBE 2;  3RPQ A;  1V9U 3;  3AZY A;  4XEZ A;  2OXB A;  5EV7 A;  3ACH A;  2R30 A;  1B35 C;  3WIN E;  3MEP A;  1YFY A;  5CFD A;  1O5U A;  1OPO A;  2GH8 A;  4URA A;  1QOO A;  1QH7 A;  2Y33 A;  3TNQ A;  5LCW L;  1RUO A;  2DVF A;  4LHL A;  3B9I A;  4MZU A;  1UOB A;  3ACI A;  4ZHN A;  1GQG A;  3OBT A;  1HXS 2;  2RG4 A;  4A7Z A;  3VD9 A;  3W9A A;  2AYH A;  4AQT A;  3CBN A;  3N7M A;  2BWC A;  4Q4X 3;  3D3A A;  4BE3 A;  2EA7 A;  1W9S A;  2NMO A;  1NKG A;  1QJX 2;  2HWF 2;  2WNU B;  3D5O A;  3LDR A;  3ZYR A;  4CDX A;  2X05 A;  1PMJ X;  3J26 N;  4MG2 A;  1LGB A;  2P4E A;  2BJS A;  1RUI 2;  3S0M A;  3VBH A;  2CWS A;  5SV8 A;  3C7F A;  1NX9 A;  3RYK A;  4FAG A;  1OHF A;  1KXG A;  4R4Z A;  3NAP A;  3U0Z A;  4LO4 B;  2WZR 2;  3ES4 A;  3KCY A;  2QUO A;  3KHB A;  3KS7 A;  1UPI A;  4B1L A;  4WM7 A;  4E2G A;  4UF0 B;  2XOM A;  2MNG A;  4MGI E;  1VMF A;  2CL2 A;  4KWL A;  2E9Q A;  3U07 A;  3S30 A;  3WNK A;  4CP2 A;  3AMQ A;  3V0A B;  2NMN A;  3T1L A;  4XYX A;  2L9L A;  1T6B X;  4R9C A;  5FK8 A;  1AYN 3;  3HVD A;  3VUO A;  5GLT A;  4TWT A;  1AR9 1;  4M3C F;  4OI4 A;  3C7O A;  2FBE A;  1HB3 A;  3DCQ A;  1HJG A;  3WQ1 A;  5KXB A;  4LO7 A;  3C7E A;  5LA1 A;  5IWF A;  1CN1 A;  4RR3 A;  4OMD A;  5C8W A;  5T5J A;  1FPN 1;  4BK5 A;  1YFU A;  3O1V A;  3OEB A;  4MET A;  4MGZ E;  3VLB B;  2RMU 1;  5J37 A;  3LPF A;  4LOS A;  4KBB A;  4COU A;  2DVG A;  2V72 A;  4W6X A;  4E4H A;  2BRT A;  1HLC A;  2Q8E A;  2GNB A;  5C5U A;  4K8R B;  1L7Q A;  2WWS A;  5IK7 A;  1ODN A;  1S1A A;  2P3J A;  1WBL A;  1OFN A;  2PHW A;  2TUN A;  1B35 B;  1J1T A;  5IK8 A;  5IJR A;  1S0G A;  2QQI A;  1VBD 3;  2ETE A;  5EWS A;  5FPA A;  4CXY A;  2YB7 A;  2WLQ A;  4YGC A;  1XE0 A;  1JHN A;  1UKR A;  2XML A;  3NO8 A;  4YM2 A;  1DZR A;  3VBU A;  5A3L A;  1H1M A;  1K5J A;  2DF7 A;  3FLP A;  5LBC A;  3MIF A;  3M3E A;  3PVE A;  4FOQ A;  1QJU 3;  2VXR A;  3ZSK A;  2GNM A;  1VIW B;  1OLQ A;  2Q1F A;  4IGQ A;  5B2G B;  1VB2 A;  1IPS A;  2WLP A;  3RZK A;  1ODM A;  4K21 A;  5H9P A;  4XAE A;  3M3O A;  4Q0P A;  1MQT A;  1OUS A;  5JSP A;  4XOG A;  3WW1 A;  1GNH A;  2JE8 A;  3ZIW A;  1U5Y A;  3RFR A;  3A21 A;  1GU3 A;  4BMB A;  5FPU A;  4S2F A;  3ATG A;  3JD7 3;  3VZJ A;  2VZ3 A;  1LES A;  2Y60 A;  3GHN A;  3ZN6 A;  3CO2 A;  3KLS A;  3SIT A;  5E89 A;  3GXU A;  2WNV C;  4QAW A;  1GV9 A;  4Q1R A;  5JXI A;  4BQ4 A;  2UYB A;  4TTG A;  1IKQ A;  2EF6 A;  2OPW A;  1RMU 2;  1UXX X;  4KWJ A;  2HWC 3;  1W03 A;  1OVS A;  1HQN A;  1VBC 2;  3MDP A;  5FP4 A;  4NIH A;  1ULF A;  4QGL A;  1H4G A;  3RZM A;  5C9A C;  1FMD 2;  1JOB A;  2YDE A;  4QX8 A;  5ACA 1;  5CBL A;  5K7P A;  4NRO A;  1AX2 A;  3J7M A;  1GYK A;  5F3I A;  3IWZ A;  2CDO A;  1PO2 1;  3ZDS A;  4P08 A;  2Z4F A;  5CFC A;  4ORF A;  3N36 A;  5KWR A;  2FCU A;  1PZ9 A;  4X8N A;  4O65 A;  4OHY A;  3KV5 A;  3MW2 A;  3AMN A;  4Q0S A;  4WVM A;  1OC1 A;  3ZXE A;  3ZYJ B;  1DGW X;  4ZPI A;  2J1U A;  2ZGQ A;  3NNF A;  3ZYI B;  4GQ7 A;  2NQY A;  2RS3 1;  1XYN A;  5EHD A;  3NRU A;  3DPR C;  1BEV 1;  3I2K A;  1NE4 A;  1H9W A;  3JQX A;  3ZIX A;  4QDR A;  5FK7 A;  2XBO 1;  5FO7 B;  5T5L A;  4CTE A;  1VB4 A;  2PFW A;  4FXG B;  1OH3 A;  2ZGM A;  2ZX1 A;  4K9S A;  3ZXJ A;  4XW3 A;  3N7L A;  4YWA A;  1OOP C;  4QPW A;  1RUC 1;  1V6L A;  1UAI A;  2QQW A;  4NHX A;  3QCW A;  2VMC A;  3AJZ A;  2XJU A;  4MLO A;  3MLK A;  2W9X A;  3CJI C;  2DCZ A;  3UKN A;  1Q5O A;  2IZW A;  5LK5 A;  5A7P A;  1WMX A;  2V73 A;  3BOW A;  2VTX J;  4FP3 A;  4GH4 C;  4GJY A;  4XF4 A;  1RUJ 1;  4F8A A;  3LSD A;  5FP9 A;  1SZB A;  3K4A A;  4K1Z A;  1KDM A;  4MVT A;  1W6O A;  2LRO A;  1GWL A;  4GWN A;  4YZ5 A;  3IIA A;  5FZG A;  1DU3 D;  3I3Q A;  4FQ4 A;  2UWB A;  5T52 A;  2O14 A;  1ZBE 2;  3K75 B;  5LA2 A;  5FZL A;  4ISQ A;  1EUU A;  3KMH A;  4HAN A;  3TN9 3;  1RVF 2;  1ZBA 2;  1VPH A;  4O9G A;  4S2H A;  3RZZ A;  4CEW A;  5CG8 A;  4ES9 A;  3TEW A;  4S2D A;  4TYS A;  1DGR N;  2WZ8 A;  3Q8F A;  1HIX A;  5FIX A;  4KWK A;  1J1L A;  1F35 A;  3H7Y A;  4LBQ A;  1X82 A;  4QQH A;  1BKZ A;  3U11 A;  2DFC A;  1OI6 A;  1LGN A;  3NNJ A;  1W8F A;  4MGQ A;  3T3Y A;  3WR0 A;  3KT4 A;  5EYX A;  3CLP A;  5LA9 A;  4K7J A;  4BCU A;  4QB1 A;  4YM3 A;  1OD3 A;  1FOD 3;  3O0W A;  5C9A B;  2Y0I A;  2IC1 A;  3MHZ A;  3RZH A;  4BLJ A;  5FZF A;  3AP7 A;  3AMM A;  5FLJ A;  3PUS A;  4IGO A;  1W28 A;  1PNG A;  2V4A A;  3BOD A;  2JKB A;  2PA7 A;  1RHI 1;  2Z79 A;  3ASI A;  2VZS A;  5JI7 A;  5A7W B;  3UGH A;  4LEJ A;  4JV4 A;  3O5S A;  1PO1 3;  1D2S A;  3NNM A;  2XHN A;  4DUX A;  1C8M 1;  3NJZ A;  1JZ4 A;  2CWM A;  3GZA A;  4HMZ A;  1QNW A;  3DGT A;  4KBZ A;  4Q4V 3;  2FDK A;  2EVX A;  4BWO A;  5BV6 A;  1R09 3;  2JG9 C;  5T54 A;  2XUM A;  3M3I A;  2JDA A;  4IEY A;  2ZAH A;  4EN8 B;  4YZ1 A;  2Q8C A;  1PNF A;  2IUW A;  2J1S A;  3GBW A;  3DPR B;  4G3Y C;  4AZZ A;  2KM2 A;  4U2A A;  3M70 A;  4NID A;  1WW6 A;  1SFP A;  3FUO A;  1V6O A;  1Z78 A;  3O12 A;  4NE9 A;  3WQ0 A;  3N3H A;  1OOP B;  2RM2 2;  5E6H A;  2G9G A;  5K0U C;  1X9P A;  3IDC B;  3FLR A;  1O6U A;  1BJQ A;  1LOF A;  1ENR A;  1PM4 A;  1Z7S 2;  2ZS6 B;  2CDP A;  3GF6 A;  1JBC A;  2R07 2;  4UFL A;  1N47 A;  3CJI B;  1LUL A;  5EP9 A;  5T5P A;  1OQE A;  2Y0O A;  1VBB 3;  2JX9 A;  1WA4 A;  4ITC A;  4GZ9 A;  5FO9 B;  4FTS A;  1WLW A;  2IVI B;  1XXN A;  3SCG A;  4YG0 A;  1EV1 1;  1OH4 A;  1GNY A;  2DTY A;  2FMD A;  5JWP A;  1L7R A;  2WNU A;  1P8J A;  4N8M A;  4GWM A;  5JZG A;  5CNA A;  3O1O A;  3LOB A;  2IVJ A;  1OF4 A;  1OA4 A;  1QGL A;  2RS1 2;  3BTA A;  3O0X A;  4NVP A;  4Q27 A;  4QB6 A;  1X7N A;  1LGC A;  1GIC A;  2PHR A;  2XQR A;  4OUS A;  1N3Q A;  3VBR C;  5LK7 B;  1MS9 A;  2JDY A;  2I74 A;  1NLQ A;  1T6G C;  4CCC A;  1LOE A;  3VGI A;  1MR5 A;  2RR1 1;  2YC0 A;  3UJO A;  3AFK A;  3LF7 A;  1W8Z A;  4MGK E;  5J3U A;  1KGY A;  2ZGT A;  2OKX A;  3EJK A;  1XE7 A;  1FAY A;  2D3P A;  3NST A;  4FPO B;  4KH9 A;  4UF0 A;  4WBB A;  3S5Q A;  5CG9 A;  1NZC A;  2VXJ A;  2BTV C;  4PBO A;  4AVT A;  3V0A A;  4GAZ A;  1VAM A;  4ES8 A;  5IUQ A;  5C3O A;  1RB8 G;  3IZO A;  3T2Q A;  2FDH A;  3RRD A;  2WYF A;  1BMV 1;  3LEI A;  5IVJ A;  3RZJ A;  3D8C A;  2BOJ A;  4XCB A;  4B3N A;  1DGL A;  3FUQ A;  4J6G A;  5I8T A;  5LWB A;  4XAC A;  1PX3 A;  4G9S B;  2QQU A;  2VZO A;  2XL9 A;  1RUD 3;  1W6P B;  3EQE A;  3HIF A;  4NHY A;  2VOK A;  4AQ2 A;  5IAT A;  4IEO A;  5B4N A;  1PIV 3;  4BYY A;  3E1F 1;  2R49 A;  4A44 A;  4Q4W 2;  2EID A;  2PEL A;  4NO4 A;  3I3M A;  3HN1 A;  2OII A;  2WQ4 A;  1EPZ A;  3KV4 A;  1VLN A;  3WEZ A;  3ZXK A;  2FD8 A;  1ASJ 3;  2D5F A;  3FBM A;  4KQ7 A;  4UOJ A;  5J36 A;  5F9T A;  2JDK A;  3OD0 A;  5BXX A;  4XJZ A;  1B35 A;  2MHF A;  2Q0A A;  5A32 A;  3ENR A;  5FZD A;  5FOB B;  5K0U B;  1C4R A;  1AR8 3;  2VUC A;  3CIH A;  4FOW A;  2HWB 1;  1CAV B;  2WAB A;  2Y6J A;  3WZ1 A;  1DQ5 A;  1UY2 A;  1H2M A;  1XU2 A;  3O1S A;  4FPY A;  1V0A A;  1UMZ A;  3RGB A;  2AAC A;  5FY8 A;  3WDT A;  3APB A;  1BBT 1;  2BP6 A;  4LO5 B;  1WW5 A;  1OLM E;  1R1A 2;  2BBA A;  4FPC A;  5I93 A;  5IAX A;  4JGZ C;  3U4X A;  3I97 A;  1D4M 2;  3VBR B;  2BPA 2;  4Y24 A;  2CGP A;  4E4S A;  1MEC 1;  4DIN B;  1NY7 1;  3AVR A;  4D6R A;  2Z2S B;  4DRV A;  1QWR A;  4HZF A;  4JKK A;  5BNP A;  2WDB A;  4XF0 A;  1LAJ A;  3I2J A;  1UY0 A;  1WME A;  1EAH 1;  2R1B A;  3EXU A;  4BQW A;  2IXL A;  2G19 A;  2WFF 1;  3ILR A;  2RS5 2;  3J8F 2;  4IDZ A;  3GBF A;  1CPM A;  3FFQ A;  1ULO A;  1W8N A;  4FFI A;  3JU9 A;  1A78 A;  1MS8 A;  5I0T A;  2ZML A;  5IVC A;  4E8D A;  3NJV A;  4OHV A;  1RUE 3;  4A45 A;  2TEP A;  5A6Y A;  1V6K A;  1XND A;  2PAM A;  3AKT A;  4FTB A;  1ZA4 A;  3ETP A;  4KWU A;  1COV 1;  2JG8 C;  3OGS A;  1L7L A;  1MZE A;  4CP0 A;  3WVJ A;  5FKB A;  5IFT A;  3QAC A;  3URF A;  1PGL 1;  2VGD A;  3ZOI A;  1J83 A;  2IXI A;  5EFU A;  2R0F A;  2P34 A;  2WUH A;  4L99 A;  1PVC 3;  3GNE A;  3IDB B;  5FPL A;  1OLR A;  1HQW A;  2XWJ B;  4IER A;  4CU6 A;  3BI3 A;  4LO8 A;  2VZV A;  1S0C A;  1AL2 2;  1LOB A;  1UMI A;  4RGG A;  4Z1V A;  2P2K A;  1ZZ8 A;  5GKA C;  5FYH A;  4YM0 A;  4AOC A;  3NKG A;  1HB2 A;  4UAP A;  3B5L B;  2VUJ A;  1LU2 A;  3E6D A;  4QHZ A;  1N1V A;  4FFG A;  4QPY A;  2B9U A;  5JSO A;  2WT1 A;  4ATF A;  5LW9 A;  1H1I A;  2Q1M A;  1CGP A;  2WA3 A;  3FJS A;  1XYO A;  3GCX A;  1SCS A;  2X5I C;  1O8P A;  4I0W B;  1DHK B;  4Q4Y 3;  4NN0 A;  4OFG A;  2GMP A;  2DDU A;  2Q8D A;  5AFB A;  1I5Z A;  2RHP A;  5A1F A;  1F15 A;  4AF9 A;  1GAN A;  4E4Z A;  2J1E A;  1QMJ A;  1W39 A;  4Q26 A;  3FE5 A;  4QKN A;  2YXS A;  1VBE 3;  1WGP A;  2OS2 A;  4GKX A;  4CEY C;  2PHX A;  1LHV A;  4Y33 A;  1QJY 1;  4XMI A;  4BQ5 A;  2DVA A;  4JGZ B;  1RIT A;  2J7M A;  5LEJ A;  1HX6 A;  4XZP A;  4NUB A;  1SBE A;  4BQX A;  4YZ3 A;  1AYM 2;  1W0O A;  5KHI A;  3R0R A;  2XGX A;  1XJA A;  4RHV 2;  4I0A A;  1FI2 A;  3TEZ A;  5FJH A;  2AGS A;  5FMO S;  4C0B A;  2V09 A;  4CCN A;  1HXS 3;  4MV2 A;  4ET7 A;  2W2I A;  5KC5 A;  4PLM A;  4E8C A;  1XYP A;  3U14 A;  1AXZ A;  3P6B A;  5FPV A;  1QJX 3;  1JMU B;  4HKO A;  3WQB A;  3FHI B;  2X09 A;  3UT0 A;  1O59 A;  4DXR A;  4CUG A;  3MYX A;  1REE A;  5IVE A;  1QXJ A;  1YQC A;  1GZT A;  1WCS A;  1S0J A;  3OUJ A;  2ZMN A;  3WUC A;  4AE2 A;  5DAB A;  2JB8 A;  2LW8 A;  3RI9 A;  4N9I A;  2PHU A;  5A7W A;  3EHK A;  3KHC A;  2VG9 A;  1A6C A;  4DXS A;  2RDQ A;  3S7E A;  4XVH A;  4XQD A;  4EZ4 A;  4NRQ A;  5CAD A;  5EPA A;  4PI2 A;  2ZPX A;  2C9A A;  2E31 A;  2D97 A;  1O3S A;  2RJ2 A;  5C6C A;  1AYN 1;  5HPO A;  1W3V A;  2VUA A;  5CEH A;  3OYW B;  1XNC A;  3ECQ A;  4F83 A;  3N4M A;  1HW5 A;  2A6V A;  3BOP A;  3DPR A;  4LOT A;  4B7E A;  4NAM A;  1OQD A;  5FDB A;  3L2H A;  3SIS A;  3WNO A;  1US3 A;  4XIK A;  1QDC A;  4Y4R A;  2D98 A;  2J42 A;  3HQU A;  2ZTN A;  1PVX A;  2BV4 A;  3GYD A;  2P17 A;  3SQO A;  1POQ A;  4BM8 A;  1OOP A;  2XUE A;  2Y6L A;  4AAX A;  2X5I B;  3JCI A;  5JOZ A;  1JU3 A;  1A8D A;  2WNO A;  3CJI A;  3ZPO A;  2J1R A;  3PIJ A;  4IGP A;  2VCB A;  2VQ0 A;  3AYE A;  2EIG A;  1BQP A;  4AI0 A;  4N53 C;  3WG4 A;  3KM5 A;  5JR2 A;  1K42 A;  2P1B A;  3O1P A;  4XUR A;  4Q2F A;  1G9D A;  2Y6K A;  3RG0 A;  1CWP A;  1WWY A;  1VRH 1;  2D7F A;  5EJ3 A;  5HXV A;  5TSW A;  1JUH A;  4CEY B;  1VBD 1;  4OYU A;  5FTT C;  4PT6 A;  4QPI B;  4XDP A;  2VCM A;  2VNR A;  3OOX A;  2QQP A;  1GKB A;  1AR9 2;  3HBZ A;  3EB7 A;  4DUV A;  2SLI A;  3DXU A;  4GAL A;  2LRP A;  4PLN A;  2NP0 A;  1XNB A;  1WCU A;  3H9A A;  4QX2 A;  1XSQ A;  2ZAA A;  4DOU A;  3SCF A;  4EN0 A;  2A70 A;  2VUL A;  3ZFE C;  1FPN 2;  2IFR A;  5FMD A;  2DU1 A;  3W5N A;  2GAL A;  2ET1 A;  1RUF 3;  2RMU 2;  1GZC A;  1K5M A;  4PQ9 A;  1Q8V A;  2ADE A;  4ASM B;  4BB3 A;  3M4F A;  2PHL A;  4P9Y A;  3A4U A;  3NWK A;  4QPG C;  3A0N A;  1CJD A;  4R4X A;  4AVV A;  3IMN A;  3LCP A;  2B5H A;  2KA3 A;  2RDR A;  1QQP 3;  1IGO A;  3G7D A;  4IQP A;  3BU7 A;  1S0I A;  3T30 A;  4CRQ A;  1CZV A;  4R52 A;  3TYJ A;  2AC1 A;  3JZV A;  1DP0 A;  5GLZ A;  4AVB A;  2HWC 1;  1NQD A;  4FSJ A;  1DQ2 A;  4RN5 A;  2WO3 A;  3W20 A;  4Y5T A;  1TME 3;  2WO1 A;  2H6C A;  1W6P A;  4MH0 E;  4Q5O A;  4XBQ A;  1CPN A;  1SLL A;  1W04 A;  4ZZ5 A;  1W05 A;  5H9Q A;  1UZW A;  2UY8 A;  1MAC A;  4COW A;  3Q9O A;  5K8S A;  2DVD A;  1FMD 3;  2R7E B;  4XF9 A;  1LHO A;  3HR9 A;  2FMY A;  3OGJ A;  5A7Q A;  3PJY A;  1H0B A;  5CZK A;  5BNO C;  5K4L A;  3NNL A;  3T0B A;  1AR6 1;  2ZZJ A;  3POJ A;  3WF1 A;  3KF3 A;  5D1I A;  5FR3 A;  5IYY A;  2OX0 A;  2LAL A;  3MBW A;  2W3J A;  3MIC A;  1FYU A;  3MLL A;  2ZGS A;  3PIG A;  3Q8E A;  1OXC A;  4LOR A;  3TBD A;  1X50 A;  2VNV A;  2WNE A;  4OI0 A;  3CQO A;  1RUG 3;  3H0O A;  3OPT A;  4R9D A;  2QQL A;  1OSG A;  4GWI A;  4I3G A;  3JBG 3;  3J4U H;  4N53 B;  5LAT A;  3CZJ A;  2JE7 A;  2YPD A;  4QWN A;  4AGR A;  1ZZB A;  5C4W C;  5KR7 A;  1XPW A;  1JOP A;  3ZVX A;  4AFB A;  3HNM A;  3OBA A;  4WZF A;  4MO3 M;  3FFZ A;  1KDK A;  5IW0 A;  2A3Y A;  2EAA A;  2V5D A;  2D43 A;  2ZX3 A;  3QH7 A;  3VBR A;  5JMC A;  3ME2 A;  3ZMO A;  3B00 A;  1UWW A;  4XJ9 A;  1QY4 A;  1PO2 2;  3C3V A;  3ZFE B;  5J96 B;  1YXW A;  1SLB A;  1YIP A;  4W65 A;  5FZH A;  3MZH A;  1SQ4 A;  5D21 A;  3AXD A;  3INA A;  2VPV A;  2VBD A;  2YBS A;  4NHM A;  3EBR A;  1KIT A;  3RMX A;  4P02 B;  1UOG A;  2RS3 2;  5ABJ C;  5DAX A;  4QPG B;  5D8A C;  4WM8 C;  2R1D A;  2VME A;  1BEV 2;  3WDU A;  4R9B A;  5A7O A;  2D40 A;  4C0H A;  4YFW A;  1XU1 A;  2XBO 2;  5DPN A;  4N9H A;  1C5H A;  1LJ7 A;  2D6P A;  2BFU L;  2PLV 3;  1RVF 3;  1YNA A;  2RVA A;  4OLL A;  1CAX B;  1CD3 G;  1ZBA 3;  2ILM A;  1HRV 2;  1RUC 2;  5JUV A;  1OPM A;  2WR9 A;  3THP A;  3O1R A;  1OKO A;  3VBO C;  1GWK A;  1UIK A;  3BIE A;  2JDM A;  3P1I A;  1FOD 1;  4PCR A;  4IEQ A;  3ETQ A;  4JRA A;  4JHT A;  4KU7 A;  1SCR A;  1I9R A;  5FYC A;  2F4L A;  4I30 A;  2QZ2 A;  3SH3 A;  3VB9 A;  5FRE A;  4LBK A;  3CL1 A;  1Y43 B;  5BNO B;  3IPV B;  1CX4 A;  2QQM A;  4LBO A;  1JUI A;  4N7U A;  1SAC A;  2MEV 1;  2B39 A;  1UU4 A;  2KD7 A;  5BPX A;  3I3E A;  4BK4 A;  2J22 A;  3JUU A;  4I09 A;  5L36 A;  3S57 A;  1NCR C;  2CV6 A;  2EAK A;  4TSV A;  4QGM A;  3RYP A;  5FYM A;  4PHZ A;  4XDO A;  1IS4 A;  1BVV A;  4Y22 B;  1LHN A;  1SFN A;  4KGG A;  4GB3 2;  4DXZ A;  4AK3 A;  1PM7 A;  4DY3 A;  5FZ8 A;  5ACA 2;  5C4W B;  4ISR A;  1SLC A;  3I2D A;  3T0A A;  4QHB A;  3VKF C;  4RQP B;  3K4D A;  3T0D A;  1QOS A;  3R4U A;  5HCB A;  4BIO A;  4A41 A;  4JGZ A;  1IZ3 A;  1W2A X;  3THC A;  1G6N A;  1NQJ A;  4FAH A;  2OUJ A;  1JZ5 A;  1DYO A;  1YUD A;  5LEK A;  1SDW A;  1VBB 1;  4ZKT B;  4P9W A;  5HV0 A;  1J59 A;  5LAS A;  2HEW F;  2PQS A;  1G8W A;  2JDN A;  2WT2 A;  3AC0 A;  4IEW A;  4AI9 A;  5J1X A;  2BNM A;  3VHO A;  1UF2 C;  2D93 A;  1F8V A;  1C8M 2;  3WW2 A;  5DAP A;  1Z0H A;  3POE A;  3L9J T;  5FZO B;  5LB6 A;  1KFU L;  1QIQ A;  1U0A A;  2O1Q A;  4CCE A;  3HQX A;  1F31 A;  1Y7B A;  3I2H A;  2OQ6 A;  5ABJ B;  3KVA A;  3HJR A;  4YZ4 A;  5D8A B;  4WM8 B;  2VY0 A;  2YGM A;  5EZW A;  1SFY A;  1BZW A;  3WNX A;  3ZFF A;  3H3L A;  1LED A;  1BK1 A;  1E5I A;  1A34 A;  3GBG A;  2NYY A;  1RED A;  4TLF A;  1YFX A;  2UWA A;  1ULE A;  4P9L A;  2OZ6 A;  4DIQ A;  3PVO A;  4BQ2 A;  4LKE A;  3S7I A;  4AFD A;  2FZ2 A;  3VBO B;  3AP6 A;  4YW2 A;  2WSV A;  4XDQ A;  2E32 A;  2VMG A;  1JZ2 A;  1PGW 1;  3DV8 A;  3O14 A;  2GC3 A;  4I3P A;  3UK9 A;  3VBF B;  1PHM A;  2DFB A;  1UNB A;  3LIG A;  2HWD 1;  1TNR A;  3WX5 A;  4AEM A;  2ZJC A;  2JD4 A;  5GLU A;  2ATF A;  1XRU A;  1DZT A;  3OYW A;  4UBH A;  1EV1 2;  2NN8 A;  5FZ0 A;  4QQO A;  4URT A;  3W21 A;  1HJF A;  3GHM A;  1OT5 A;  3GZE A;  5C70 A;  2PHF A;  1EPW A;  3W59 A;  4IEZ A;  1W6Q B;  5IK4 A;  3OTF A;  4DRR A;  3D4K A;  5T55 A;  2GAU A;  3OEA A;  3AZV A;  1OLM A;  3WDX A;  2VOW A;  4MUV A;  2X5I A;  1RUD 1;  2FDI A;  3I3D A;  4LJH A;  1NCR B;  4W6W A;  5FV3 A;  5FZK A;  2RR1 2;  1PIV 1;  2BDR A;  3PVN A;  3POY A;  4FCA A;  4UI9 L;  5A80 A;  4YW7 A;  4L8Q A;  4HET A;  3IAP A;  1RYY A;  2SBA A;  2XON A;  1RGS A;  1ASJ 1;  2EIB A;  4CCO A;  2D3S A;  5DQ0 A;  1TMF 3;  2IXH A;  5FUI A;  4CEY A;  2ZHK A;  3CKH A;  1UZY A;  4QPI A;  2N7G A;  4GMP 3;  3B93 A;  2JIC A;  2K46 A;  2JXA A;  1X8M A;  4LHS A;  4UBG A;  1BMV 2;  3E5X A;  3ZYH A;  1UD1 A;  2ES3 A;  4JDN A;  1LCL A;  2UUR A;  4QKD A;  4PLO A;  4HK8 A;  3U4S A;  2W68 A;  4XAA A;  3HOB A;  2W95 A;  2HLE A;  5LBE A;  3IDE A;  1DZQ A;  3NV2 A;  4QXK A;  1G9C A;  4QM9 A;  4CU9 A;  3I54 A;  4EN7 B;  4HK9 A;  2D5H A;  2Y34 A;  1N1Y A;  5SV5 A;  3T4V A;  2WS9 3;  1HRI 2;  5F3G A;  3VN4 A;  4BQY A;  3ZR6 A;  2XL7 A;  1R1A 3;  5LRR A;  3WDY A;  4BJ0 A;  1NOV A;  1POV 3;  2QZ3 A;  5FY9 A;  3V65 A;  4V2W A;  5KC6 A;  1ZRF A;  2VQT A;  1E57 A;  4LIV A;  5JI9 A;  1S0D A;  5A3M A;  4LPL A;  2D6K A;  3E5U A;  4OQ8 A;  1FT9 A;  2HWB 2;  4AHY A;  4G4F A;  1DYP A;  4H7L A;  4CPB A;  1RL3 A;  2A3X A;  1QXR A;  1AXY A;  5DUW A;  1GR3 A;  4AL9 A;  4M0N A;  2V4V A;  1RUE 1;  4EJR A;  2X29 A;  1VMJ A;  4IES A;  3N35 A;  1H8V A;  4QGN A;  2CAV A;  3PME A;  3VZN A;  3AX4 A;  3LD8 A;  2NZ9 A;  1Y4W A;  4P5Y A;  1SLA A;  1WLT A;  1BBT 2;  1DYK A;  4P14 A;  3OBR A;  2LTN A;  3OPW A;  5JPM B;  5LY2 A;  4COV A;  5JLV A;  5GM0 A;  4TXW A;  1SG3 A;  2QQJ A;  3ZSJ A;  1MEC 2;  2C1F A;  1NY7 2;  4BLI A;  4YW1 A;  4A7Y A;  3MUY 1;  5FZE A;  3FHA A;  3P3N A;  3WF4 A;  1YWK A;  4BZ4 A;  2RDN A;  1EAH 2;  1KJR A;  5CA6 A;  3T1M A;  1R08 3;  2UYA A;  2WFF 2;  2JDZ A;  1LOC A;  1I1E A;  2VOT A;  1TE1 B;  1U5Z A;  4N53 A;  4E2Q A;  4QMA A;  1MPX A;  2RV9 A;  2JEN A;  4K3U A;  4IL7 A;  1SPP B;  1X9T A;  1V6I A;  2ZBJ A;  3GM8 A;  4AHX A;  2XH6 A;  1L3J A;  4YRD A;  4Q4Y 1;  1COV 2;  2K0G A;  5F8P A;  1VBA 3;  2XKO A;  5E16 A;  2WNV B;  3LA2 A;  4CU8 A;  2GP5 A;  2ZGK A;  4V1P A;  1SMV A;  3ZFE A;  3OGR A;  4FOV A;  4JTO A;  1PGL 2;  2Z42 A;  2OW4 A;  1RUH 3;  3DF0 A;  3NV3 A;  5FZ3 A;  2XPJ A;  1SLI A;  1BK0 A;  4FPF A;  4RS5 C;  4CA9 A;  1CON A;  2ZEZ A;  3LDK A;  3MI8 A;  3WNP A;  5BYN A;  2WKK A;  1W90 A;  4RYD A;  4CUC A;  4QPG A;  3HBK A;  1H30 A;  2QFE A;  1V6M A;  2ZEW A;  3LEK A;  4YGD A;  3K77 A;  1YQ6 A;  3H1W A;  3FZ3 A;  5DAQ A;  3WNL A;  1AYM 3;  2ARE A;  2ET7 A;  1CAX A;  1VRB A;  2O0O A;  4CUA A;  4FFH A;  2WZE A;  3AVS A;  4PIZ A;  3P3P A;  5CKM A;  1K12 A;  4A3Z A;  3ZYG A;  1H4H A;  4DFS A;  4EWD A;  5IVF A;  2BER A;  3GCW A;  5LBF A;  2BUK A;  4ERO A;  2WA4 A;  1PX4 A;  3OG2 A;  3THD A;  2YBK A;  1UKG A;  5T50 A;  2B8M A;  1U5I A;  4LBM A;  1IQA A;  1SEF A;  1S2E A;  3BB6 A;  3ITQ A;  1W6M B;  4QKB A;  4PIX A;  4BIS A;  4K8F A;  1BVP 1;  1E5S A;  3IPV A;  5BNO A;  1TNF A;  1U12 A;  1QJY 2;  3R4S A;  2CAU A;  1JW6 A;  2EXH A;  2VMI A;  2E51 A;  4HN0 A;  4XFA A;  4FTE A;  4W50 A;  3RVH A;  2WT0 A;  5AC9 3;  4YGE A;  5GZE A;  4GH4 B;  4QX7 A;  1V6N A;  5ISL A;  2FDG A;  4Y22 A;  4XF3 A;  4A3X A;  2R04 1;  4XFG A;  5C4W A;  1W8T A;  4D7S A;  5LA0 A;  3T2T A;  4RQP A;  1JZ6 A;  3N9P A;  4IE5 A;  2ZA9 A;  2RDS A;  2W1Q A;  2VW1 A;  2RE9 A;  3Q8B A;  2D6M A;  5FZ1 A;  4Y20 B;  1KRI A;  2ORX A;  1UOJ A;  3C8X A;  3ZX7 A;  4FBF A;  1IOA A;  4M3C B;  5I0D A;  4ZS2 A;  5CVR A;  4AG4 A;  1RIN A;  1WMF A;  3N7K A;  1IQD C;  2BEO A;  4RS5 B;  5FZO A;  2D44 A;  3OGG A;  2AEN A;  4LTA A;  3HQR A;  5H9R A;  2R06 1;  1NUK A;  2XVG A;  5ABJ A;  2F6B A;  4NIG A;  3OD4 A;  4WM8 A;  3V56 A;  1KFX L;  3OUI A;  4B4Q A;  3A0K A;  1DLC A;  2P3I A;  3NNG A;  4FXK B;  2A75 A;  5HCA A;  3KVB A;  5JXH A;  5FZI A;  3B3Q E;  2XQX A;  4NOT A;  4CDQ C;  3B7M A;  2Y6G A;  4E27 A;  1EY2 A;  4ATE A;  2AEY A;  3I2F A;  1YFW A;  2O8O A;  3LWC A;  1RUF 1;  2K2S A;  4HOO A;  4XUT A;  4COZ A;  1VR3 A;  1ZM1 A;  1YQ2 A;  2ARC A;  2XG3 A;  4NWW A;  4UFJ A;  3VBO A;  1JOJ A;  1W2T A;  2JG9 B;  4IET A;  3O1M A;  3K4Z A;  3VBF A;  2JB4 A;  1GOH A;  3M8L A;  2DBN A;  2JKX A;  4GWJ A;  3WNM A;  4XBL A;  4PIY A;  4YW3 A;  4YNI A;  1H1A A;  2HWE 3;  3JB4 C;  5AFE A;  3J7N A;  1WCK A;  2VR4 A;  4QX5 A;  5JXG A;  1QQP 1;  3LEG A;  2PMW B;  1BYH A;  1IG3 A;  1O7F A;  1VRH 2;  5FUN A;  5JIU A;  2Q1Z B;  1VBD 2;  2WAO A;  2PN5 A;  4Y5S A;  3N9M A;  1F4H A;  3FN9 A;  1W6Q A;  1AX1 A;  4BHP A;  2GNT A;  3OY8 B;  3D82 A;  4LR4 A;  1VE0 A;  2DBI A;  1LKN A;  1TME 1;  2VEC A;  5F5A A;  1NT0 A;  4FPK A;  1NCR A;  1W9W A;  4QKF A;  2C9K A;  1Q3E A;  1OA2 A;  4JX0 A;  3PHM A;  3ZYP A;  1ST8 A;  4LUL A;  3B02 A;  2X53 S;  2B9V A;  2DUP A;  4A4A A;  5C71 A;  1VAL A;  5CU1 A;  4WVV A;  1MZ5 A;  5CB7 A;  4GIQ A;  4LO6 B;  1UO9 A;  1W2U A;  4KMQ A;  4HL0 A;  4A7K A;  3FLT A;  1ZZ6 A;  2P37 A;  3OJB A;  1FNZ A;  1UIJ A;  5FZ7 A;  5A3P A;  5KHG A;  3NL1 A;  4XZU G;  4YYO A;  5IK5 A;  5DDJ 2;  5CFD C;  5DXD A;  4L92 A;  4BOW A;  2ZGU A;  4AR2 A;  3KZ4 C;  3ZSM A;  1FNY A;  3PL0 A;  2Q5T A;  4IV3 C;  3ILF A;  1O91 A;  4WZC A;  1ZRD A;  1RUG 1;  5FZA A;  2ZHN A;  1D0G A;  1GNZ A;  1DFQ A;  1REF A;  2D3R A;  1FV2 A;  3JBG 1;  3VD3 A;  4BPZ A;  1ULP A;  2EXK A;  2HWC 2;  2PAK A;  4XCA A;  4Q1P A;  4C1X A;  1C8N A;  1SDD B;  2BW8 A;  1JZ8 A;  4CDX C;  4H3W A;  5F6L B;  4LIT A;  3A23 A;  4NR1 A;  5EJZ B;  3H3Z A;  4OI2 A;  1ACC A;  4XFF A;  2Y64 A;  3MPB A;  5FPZ A;  3ZXA C;  1GWM A;  1PGS A;  2WBK A;  4MAD A;  3NJX A;  5JOW A;  3AB0 A;  3R4D B;  4DMI A;  4Z8B A;  3NAP C;  4NMI A;  2VZT A;  1XNA A;  3DUI A;  3PUQ A;  1UU6 A;  4AFA A;  3I2I A;  5DUX A;  4CDQ B;  1ENQ A;  1GFF 2;  3FBY A;  3LIH A;  4WM7 C;  4Y1Y A;  1PO2 3;  2VQA A;  1AR6 2;  3F95 A;  3H8R A;  2CYF A;  3CHX A;  5FYT A;  5F32 A;  2ENR A;  4QX3 A;  3VDD C;  2OT7 A;  2FDJ A;  2JDP A;  5J7M A;  1JYC A;  1K45 A;  1Q8O A;  2Y6H A;  2YHJ A;  3IMM A;  4QXC A;  4CDW C;  4D8M A;  2FDF A;  1C5I A;  1LOA A;  2CGN A;  2KXL A;  1DDL A;  1NLR A;  1TEI A;  5FZ6 A;  3BKZ A;  5FWE A;  1ND2 C;  2PLV 1;  1DQ4 A;  3AKQ A;  4AXO A;  1RVF 1;  4CDU C;  1XBF A;  2ZEX A;  4RR3 C;  5C7G A;  5I8S A;  1NAE A;  2ZGN A;  4QX0 A;  1HRV 3;  5ANQ A;  2A6X A;  3L2Y A;  3MIB A;  4AWD A;  3CNA A;  3T2P A;  2XLF A;  1WD3 A;  1W0N A;  4YVW C;  5I0U A;  4CP9 B;  3WQ7 A;  2BBV A;  3AFG A;  5DZE A;  1V9U 1;  1AF9 A;  3K2O A;  2A6Y A;  1QXP A;  4JC1 A;  2W46 A;  3OUH A;  1EUT A;  2VTX A;  5JOX A;  1OF3 A;  5C3R A;  1SPP A;  2CSG A;  1CR7 A;  1WW4 A;  2F4P A;  3DEC A;  5CFD B;  4M4P A;  4OQ9 A;  2FQP A;  4W4Z A;  4XIL A;  4XTP A;  1AXK A;  4IV3 B;  2PYT A;  2WNV A;  4Q4X 1;  1WBF A;  2HJI A;  4JKM A;  1RIR A;  2W87 A;  4RGK A;  3WCR A;  4E4D X;  2YFZ A;  2BGP A;  5FWJ A;  2P3Y A;  2VNO A;  2HWF 3;  4GB3 3;  1FOD 2;  5ACA 3;  5T5O A;  1AR7 2;  1YHF A;  3ORJ A;  5C9A A;  5A6X A;  1UY4 A;  1YQ5 A;  1QU0 A;  4IE6 A;  2H6B A;  2WWU A;  3FL7 A;  1RUI 3;  3H50 A;  3M3Q A;  2E7Q A;  4UW4 A;  3HNY M;  4PF5 A;  3I4I A;  2JG8 B;  2Y38 A;  3M2M A;  3WSO A;  3NAP B;  3S5A A;  1QF3 A;  2XLA A;  4AFC A;  1YIF A;  3AMH A;  5APA A;  2HBT A;  2WZR 3;  2VCC A;  5FMO L;  1XE8 A;  2FCV A;  4WM7 B;  4PQQ A;  2MEV 2;  2JD9 A;  4A6O A;  1MS1 A;  1H6X A;  1SHW B;  2XLG A;  5FYB A;  4E9K A;  3QLQ A;  5CAZ A;  1CES A;  2DCJ A;  3Q8A A;  3CJX A;  3VDD B;  2VNG A;  4QU2 A;  5F5Q A;  1NZI A;  3LA7 A;  5JOY A;  3UNP A;  2VE1 A;  5CIS A;  4H2A A;  4UFI A;  3ALQ A;  4CDW B;  3E97 A;  3MUZ 1;  4FQZ A;  2ZGP A;  5GLV A;  1UXZ A;  1ULG A;  2HYX A;  5C3Q A;  1Q43 A;  3TWI A;  4CCL A;  1W6M A;  1ND2 B;  1OA3 A;  2HYK A;  4HXC A;  2D6N A;  3VKM A;  4CDU B;  5DZF A;  5IHR A;  1DGW A;  4RR3 B;  4XET A;  5F2S A;  3W58 A;  1IPK A;  3KD4 A;  2FCT A;  3RDI A;  4QQ2 A;  2EAL A;  4NAO A;  5FFO C;  2GC0 A;  2VAU A;  4P9I A;  1O4Z A;  1VBB 2;  4FPE A;  4YVW B;  5DAV A;  1E5R A;  1X36 A;  5FZM A;  3AYD A;  1AVB A;  3LAG A;  2Q8O A;  4GH4 A;  4AI3 A;  3KGZ A;  1S4C A;  1EV1 3;  4QU1 A;  1NA1 C;  3ES1 A;  1UZ0 A;  3SEP A;  1H2L A;  4JTN A;  4TLG A;  4XJ8 A;  3PVB B;  4AI8 A;  1W2N A;  2C4X A;  1M06 G;  1HKD A;  4H14 A;  5LY1 A;  1YQ8 A;  4JQR A;  2GC2 A;  4O9E A;  2AEZ A;  3H8U A;  2H0V A;  4OZO A;  4PBP A;  3G6J B;  4CSW A;  4OMC A;  4FPL A;  4Y20 A;  3C2U A;  1QJU 1;  2W1S A;  2RR1 3;  5DG2 A;  1C28 A;  3AZZ A;  1YO8 A;  3POW A;  1O4Y A;  3V0B B;  2XJQ A;  3H7J A;  2B45 X;  3VKL A;  4XXA A;  1TMF 1;  1PGW 2;  2YFU A;  4ZU7 A;  1KS4 A;  5FYY A;  4D6S A;  5FMC A;  1JZ3 A;  2GC1 A;  4RS5 A;  1J3P A;  2HWD 2;  3JD7 1;  3WHT A;  4GMP 0;  5EYY A;  4HVQ A;  1JYT A;  3D6E A;  1W2O A;  1O3R A;  4QDS A;  1UU5 A;  1KQR A;  1Y9G A;  4YW6 A;  1AX0 A;  1ULD A;  1Q8Q A;  2E53 A;  5FY0 A;  5HXM A;  5DN2 A;  1ENS A;  4HG6 B;  3VDA A;  4AEK A;  5M0T A;  3VD4 A;  1OMI A;  4R8H A;  5EJ1 B;  3EO6 A;  4CCM A;  1HV1 A;  1RUD 2;  5FXW A;  1RMU 3;  4B7K A;  1AL0 G;  3E6C C;  3V64 A;  1PIV 2;  2CU5 A;  2JG9 A;  1VBC 3;  1UQX A;  2WS9 1;  3GGL A;  5F3E A;  3ZFG C;  5C3P A;  4KNC A;  1QJZ A;  1HRI 3;  3EMR A;  2WRA A;  1POV 0;  1ASJ 2;  3SMH A;  3VHP A;  1UZV A;  2WO7 A;  3KV9 A;  2XDV A;  2I45 A;  4KL1 A;  4TZD A;  4IUG A;  4RD7 A;  5FPX A;  4ARX A;  5IVB A;  4CUB A;  2B7Y A;  3QOP A;  2WO2 A;  4U36 A;  2DV9 A;  5K0U A;  2XB6 C;  3TAY A;  4QQL A;  3ST7 A;  1BXH A;  2X10 A;  3OY8 A;  1CAV A;  4NPM A;  3ZXG A;  2HWB 3;  3PNA A;  1QNY A;  1J58 A;  3I2O A;  4M0H A;  4P00 B;  3BUC A;  3E5Q A;  3I2G A;  4IND A;  1MZF A;  4ZXK A;  4EWA A;  2DUQ A;  1FAT A;  2HKX A;  3DEM A;  3MV0 1;  1WCD J;  3JXS A;  1S2K A;  2AZ5 A;  4S2G A;  2C6S A;  2F17 A;  1NA1 B;  3UKT A;  4XUQ A;  3VDC A;  3HWJ A;  3RZG A;  2JJ6 A;  4OUM A;  5DMY A;  4CCJ A;  4Q0Q A;  3KQR A;  1JYI A;  1AZD A;  3X29 B;  1Y9M A;  3MIH A;  1ZYB A;  2YC2 A;  1LOF C;  4YVS C;  4XUO A;  4IW3 A;  1HV0 A;  4ONU A;  4AI1 A;  4N7I A;  4BXS V;  1ND3 C;  5GZD A;  4HBN A;  4SBV A;  4R9A A;  3SKJ E;  1R08 1;  4LMF A;  4LKD A;  3RWN A;  1EAH 3;  4XF1 A;  4MGS A;  4Y3O A;  2IXK A;  2WFF 3;  2WNU C;  5FYV A;  2O8Q A;  5JZG C;  1Y3T A;  3FWE A;  1RUE 2;  5A3N A;  5F1R A;  2LS6 A;  1JI6 A;  4O61 A;  3TN9 1;  2JIG A;  1ZBE 3;  4JRL A;  5FP7 A;  1XSR A;  1VBA 1;  5FOJ B;  2QQK A;  5GZG A;  1COV 3;  4XUN A;  4PDW C;  3BPZ A;  1NLS A;  3ZXD A;  5JCT A;  4CDQ A;  3U75 A;  2IWG B;  1RUH 1;  4LBQ B;  2BU9 A;  3QD6 A;  3JQW A;  3WP3 A;  3MV1 1;  3UYJ A;  3IN9 A;  2XWB B;  1CQ9 A;  1LHW A;  2PHT A;  3KT1 A;  4NJ4 A;  1ZNP A;  1LEC A;  3ZFG B;  1J3R A;  4V2V A;  4JHZ A;  4LBQ D;  5FCC A;  1RUJ 2;  5C8C C;  5F37 A;  1UOF A;  3UL2 A;  4Z92 B;  1IS3 A;  1S0E A;  1NE6 A;  4LT5 A;  1UYP A;  1PO1 1;  3SCH A;  4IXL A;  3J7H A;  4FT8 A;  5BNQ A;  1UW8 A;  2VH9 A;  1GQH A;  2A73 B;  1UYZ A;  4LK6 A;  4Q4V 1;  5CKQ A;  5LZ6 A;  4Q4Y 2;  2Z69 A;  1R09 1;  2RJL A;  3K46 A;  1UMH A;  3OB8 A;  4RSU A;  4AAP A;  1C57 A;  2ZMK A;  2D6O X;  5JAX A;  1D2Q A;  4P9G A;  4CP9 A;  1IPJ A;  5C33 A;  4UFK A;  4Z82 A;  3CF6 E;  1JOD A;  3III A;  2I2S A;  5H9S A;  3NKT A;  2DVB A;  4YM1 A;  2RM2 3;  5J09 A;  1QJY 3;  4YVS B;  4JDM A;  3N9L A;  1QJE A;  2OUH A;  5AC9 1;  1IS5 A;  1RHI 2;  3H42 B;  5HCF A;  1Z7S 3;  4UFH A;  1ND3 B;  5A3O A;  2R07 3;  5A7N A;  4IV1 C;  4IV3 A;  3KT7 A;  2VOX A;  4CYD A;  4LQR A;  4L9B A;  3SKV A;  3AL6 A;  3MLJ A;  2OVU A;  2ARA A;  3UGF A;  1AUY A;  1IG0 A;  4LIU A;  5HBA A;  3N9O A;  3UJQ A;  1KD7 A;  2H0B A;  2QDN A;  2YV8 A;  5L73 A;  5LBB A;  3VL8 A;  2QE3 A;  1GOG A;  5FPB A;  2EXJ A;  4NHK A;  4BDV B;  5FAX A;  1AHS A;  4UW5 A;  5JZG B;  4XFI A;  3AKR A;  5JXJ A;  3C7H A;  1GZ9 A;  2A71 A;  2QTW B;  1OVP A;  3O7O A;  3WG1 A;  1BHG A;  5DZG A;  5AVA A;  2RS1 3;  3BAL A;  3TB0 A;  3I49 A;  3BCW A;  3NQH A;  2QVS B;  2JG8 A;  2ZGL A;  4JAA A;  4XHX A;  1YC6 1;  5BNP C;  4EWE A;  2X8K A;  4PDW B;  5FLI A;  1HQL A;  2YZ4 A;  3DYP A;  4CVU A;  2YU1 A;  4AGG A;  3VBS C;  3DYM A;  3IKW A;  4PI0 A;  1PK6 C;  1CAU B;  5D2A A;  5FZC A;  3O1U A;  4RFT 0;  3VDD A;  5DG1 A;  1J3Q A;  3PUH A;  2VBP A;  4ZU4 A;  3PMS A;  1KJL A;  3NW4 A;  3RWK X;  1EP0 A;  4CDW A;  4BME A;  3D0J A;  5K9Y A;  4AHZ A;  3C7G A;  3DYO A;  2IXJ A;  3ZYB A;  3ZXF A;  5C8C B;  2R04 2;  2EIC A;  1ND2 A;  3CU7 A;  4CCK A;  3LB9 A;  4IE7 A;  4CDU A;  4D6Q A;  1WUV A;  2IXC A;  2OQ7 A;  1TG7 A;  1O3T A;  2CY6 A;  3P5B A;  2B4K A;  4MX3 A;  2KR2 A;  4DZG A;  5CIR A;  5I0S A;  1WMD A;  1FX5 A;  4W6Y A;  1G9F A;  4YVW A;  3ZN5 A;  2R32 A;  3KWV A;  2W1W A;  1OKQ A;  5L9V A;  1SBF A;  2HWE 1;  3WF0 A;  3I7D A;  2VW2 A;  4Q8L A;  4Q4W 3;  5C5T A;  4ZXE A;  5FZB A;  1GLH A;  3AK0 A;  3PLQ A;  4HKW A;  4XFC A;  3TEX A;  1YJK A;  1DQ6 A;  2A7A A;  4YW5 A;  3WT3 A;  4JGY C;  2R06 2;  2A6W A;  5A32 B;  1AR8 1;  2WZP P;  5JVV A;  3RZL A;  1VRH 3;  2WQZ C;  1AJO A;  5F7U A;  2QKD A;  3BTY A;  4QXB A;  3IBM A;  5A3U A;  3K48 A;  4IV1 B;  3VKN A;  5JIA A;  3BGA A;  3DL3 A;  1FXZ A;  5FQ0 B;  1ZA7 A;  1DQ1 A;  3V0B A;  2XJS A;  1RUF 2;  3PDQ A;  1YEW A;  3ZKU A;  4MXV A;  1QEX A;  1YI7 A;  2XXZ A;  3MF9 A;  1HN1 A;  3QBQ A;  1RTV A;  4FI9 A;  5KHH A;  2G9Z A;  1OUR A;  5G04 L;  2DCT A;  3RYR A;  2EXI A;  2WIN B;  3BIW E;  5FJK A;  5DDJ 3;  1D4M 3;  2FZ1 A;  1QQP 2;  2P3K A;  2ZX2 A;  1OUX A;  1WKY A;  2VJX A;  1H6Y A;  4JCK A;  3UET A;  4AVA A;  5BNP B;  4AHW A;  3RQ0 A;  4M3C E;  4LA2 A;  5L7O C;  3GJA A;  3QH6 A;  2AR6 A;  2VVD A;  3TNP B;  3VBS B;  2WL1 A;  1PK6 B;  3J8F 3;  4NHL A;  4M01 A;  1CAW B;  1TME 2;  1UPS A;  1VAV A;  1W8H A;  2JEC A;  2RS5 3;  2Z5W A;  1W9F A;  4KGQ A;  2R16 A;  4NWV A;  3KF5 A;  2QJV A;  3CZU A;  3AXE A;  3ELN A;  3J7L A;  3WD5 A;  4CP1 A;  2ZOE B;  4DUW A;  5I8Y A;  4EE2 A;  1HDK A;  1V6J A;  4RFR B;  1GP4 A;  3ZPY A;  3MIG A;  1VMH A;  1JS9 A;  3LOI A;  5FUP A;  2C0Z A;  1YLL A;  3AL5 A;  5L9R A;  4WVZ A;  5KXD A;  4JVA A;  4AVC A;  2G9F A;  4AGV A;  5F6K A;  2UWC A;  1LEN A;  1PVC 1;  1AR6 3;  2W47 A;  3PU8 A;  3VZM A;  3HNB M;  1F2N A;  2J1T A;  4B4R A;  4IEV A;  5GZC A;  1ENX A;  1PMH X;  4OI1 A;  1RUG 2;  3WF3 A;  2VMD A;  4Q8K A;  1AL2 3;  2ID4 A;  2VC9 A;  3JBG 2;  2QBX A;  2W0X A;  4HN1 A;  4DO0 A;  1GZW B;  4D7T A;  2PXJ A;  4C91 A;  5BY5 A;  2W5F A;  1ZRE A;  4K20 A;  4YFZ A;  4JZR A;  4HKL A;  4JGY B;  1NA1 A;  2WFP A;  1W8O A;  4FPH A;  4YG3 A;  3J9S A;  1HRV 1;  1W8U A;  1GMM A;  3MFA A;  1JH5 A;  3AMP A;  4MGT A;  3HT2 A;  2VUD A;  1PZ7 A;  2E7T A;  3U10 A;  2QQN A;  4LXL A;  5KHJ A;  3H8X A;  2ZKN A;  4LBL A;  4HON A;  4H7M A;  3VZO A;  4D7Y A;  5A6Z A;  3IDA A;  4GKY A;  4HSJ A;  5DUV A;  3GJB A;  2GME A;  1VBE 1;  1ZVF A;  4LHK A;  3AJY A;  2NLR A;  1VAK A;  3ZKY A;  3SH4 A;  2WWJ A;  3LSE A;  4RL7 A;  1NCQ C;  2C5D A;  4E2S A;  4H55 A;  1QKQ A;  2QQO A;  2IFW A;  1JHJ A;  4XJW A;  1J84 A;  2HEV F;  4EYU A;  2PLV 2;  4Q29 A;  4LNV A;  4EN9 B;  4LE4 A;  4HFS A;  5CKN A;  3B9C A;  3DKW A;  3MFC A;  5L7O B;  1HXS 1;  1H9P A;  2DCK A;  2XVK A;  4RHV 3;  4XQW A;  1S0B A;  1BCX A;  2WN3 A;  4HT1 T;  2QNK A;  5F5I A;  3BTX A;  2E33 A;  2YBP A;  3MIE A;  3ON7 A;  2Q4S A;  1QJX 1;  2HWF 1;  3THT A;  4GB3 1;  3AM2 A;  1K5M C;  4B8E A;  3MW3 A;  2CHH A;  3FMG A;  2ZXQ A;  3ILN A;  1I5P A;  4P9J A;  3B94 A;  3RSJ A;  1N1S A;  1AR7 3;  1RUI 1;  4Y1V A;  3ZFG A;  4D69 A;  2DCY A;  2VZQ A;  1V9U 2;  2LM3 A;  1E5H A;  2C24 A;  4XHB A;  3NVC A;  4HVR A;  3NV4 A;  4Y26 A;  3ACF A;  3USU B;  2BGC A;  2WZR 1;  4MHR A;  5KXE A;  4GXL A;  2HBU A;  5DAW A;  4EZH A;  4MOA A;  4AQS A;  5JPN B;  2VZ1 A;  1UX6 A;  2R6Q A;  3M7A A;  1JYV A;  4OUE A;  3ACL A;  4N90 A;  4BU2 A;  2MEV 3;  5A1L A;  3MID A;  4CE8 A;  4YW4 A;  1JYW A;  3IM0 A;  3LDB A;  3WW3 A;  2BWA A;  2CTV A;  2OZJ A;  4Q4X 2;  1AJK A;  4QXH A;  3AKP A;  5E8A A;  3UGG A;  4B4P A;  4NPR A;  3VZK A;  1D7P M;  5FMB A;  2CGO A;  1DIW A;  3WG3 A;  3MGU A;  1QDO A;  4Y1U A;  4LHN A;  1I6X A;  1N1T A;  1ZRR A;  4FPJ A;  2GZW A;  1WD4 A;  5FO8 B;  1OBN A;  2VW0 A;  4KG0 A;  1UX7 A;  1LB2 A;  5E88 A;  2FHR A;  2OYZ A;  5FXX A;  4B1M A;  2YC4 A;  1JTZ X;  1GBG A;  1STM A;  2OA2 A;  4YVS A;  4XC9 A;  3OGV A;  2XJT A;  4FP2 A;  4LLF A;  2I07 B;  4Y1Z A;  3VHN A;  3AZW A;  4D0Q A;  1OD5 A;  5KXC A;  4FPG A;  5DUU A;  1ND3 A;  1XC6 A;  1KS5 A;  2ARX A;  1RXF A;  3NV1 A;  3WUD A;  1N3P A;  3MW4 A;  2HEY F;  4AED C;  2E6V A;  4QT6 A;  4XUP A;  3VZL A;  4N43 C;  5FXZ A;  3HAG A;  4QDQ A;  1AYN 2;  1MS0 A;  1R64 A;  5J48 A;  1W0P A;  5FP8 A;  1US2 A;  3HN3 A;  2G1M A;  3GAL A;  1NCQ B;  5BNN C;  1WW7 A;  2GMM A;  2YU2 A;  5D8A A;  1MVE A;  1JN2 P;  4RA0 A;  5GAL A;  1AR9 3;  1ZZC A;  2XHK A;  3K51 A;  3ZLI A;  1DQ0 A;  1KEX A;  1ULC A;  3SXW A;  3H1M A;  3T08 A;  4JKL A;  4PDW A;  5GZF A;  1DCS A;  1FPN 3;  5F2W A;  5FY5 A;  3R6S A;  4IEX A;  4CXX A;  5IVV A;  3RJ2 X;  1K5M B;  2Y26 A;  2RMU 3;  1CAU A;  2WAA A;  2WYS A;  4UT5 A;  1QH6 A;  3R05 A;  4DPN A;  2YGL A;  3T4H B;  4ZZ8 A;  2C26 A;  4GUL A;  4YSF A;  5JDB A;  2HWD 3;  4OHX A;  2R0H A;  2ZGO A;  5FZ4 A;  5I0R A;  5C8C A;  1RUN A;  3FX3 A;  2OPK A;  1LOG A;  1RJ7 A;  3I59 B;  4A42 A;  1WZX A;  4JQT A;  2ZHL A;  1TVG A;  2RJK A;  3PUR A;  3AYA A;  1APN A;  1H8T C;  1Q8S A;  1RMU 1;  3SHR A;  2J1A A;  5IAV A;  1Q8P A;  1VBC 1;  1C1F A;  1W6N B;  3KQ4 B;  4PF1 A;  2A5Z A;  1QJU 2;  4ZU5 A;  3ROU A;  4DEV A;  3O0V A;  3LGR A;  1FMD 1;  1HRI 1;  4DB5 A;  1W8W A;  1X8E A;  1TMF 2;  1URX A;  1NYW A; 
#chains in the Genus database with same CATH homology
 4NPL A;  3S57 A;  3BTX A;  2FDG A;  3RZL A;  2FDH A;  3H8R A;  2FDF A;  3BTY A;  4NJ4 A;  4O7X A;  3O1T A;  3RZJ A;  4IE5 A;  4QKN A;  2FDJ A;  4QHO A;  3O1V A;  3I3Q A;  3BKZ A;  4ZS2 A;  3I3M A;  2FD8 A;  4NIG A;  3T3Y A;  4IE4 A;  4CXY A;  3RZH A;  3O1S A;  5DAB A;  3KHC A;  3O1M A;  4RFR B;  3RZK A;  4NRQ A;  5F8P A;  2FDK A;  4NII A;  4NRP A;  2IUW A;  4NID A;  4NPM A;  3I49 A;  3I2O A;  3BUC A;  4IE6 A;  4IDZ A;  4NRM A;  4QKF A;  2FDI A;  3BTZ A;  3S5A A;  4NIH A;  4OCT A;  3RZM A;  4CXX A;  3BU0 A;  4CXW A;  3RZG A;  4NRO A;  4ZHN A;  3T4H B;  4ZS3 A;  3O1U A;  3O1R A;  3O1P A;  4MGT A;  3H8X A;  3BIE A;  3O1O A;  3H8O A;  4IE0 A;  3BI3 A;  4MG2 A;  4IE7 A;  4JHT A;  4QKB A;  4QKD A;  3LFM A;  3KHB A;  4O61 A;  3T4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...