3H8XA

Structure determination of dna methylation lesions n1-mea and n3-mec in duplex dna using a cross-linked host-guest system
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
204
structure length
204
Chain Sequence
b'HSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
molecule tags Oxidoreductase/dna
source organism Homo sapiens
publication title Structure determination of DNA methylation lesions N1-meA and N3-meC in duplex DNA using a cross-linked protein-DNA system.
pubmed doi rcsb
total genus 55
structure length 204
sequence length 204
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3h8xA00
4NIIA 4NROA 4IDZA 4OCTA 3O1PA 3I2OA 3LFMA 4QKBA 3T4HB 3BI3A 5F8PA 3RZLA 4IE5A 3KHCA 3O1MA 3O1RA 2FDGA 4NRQA 2FD8A 4NPLA 2IUWA 4ZS3A 2FDIA 4MG2A 3KHBA 4QKNA 4IE6A 4O7XA 3RZKA 2FDKA 4NJ4A 3I3QA 4NRMA 4QKDA 3O1UA 3BKZA 3H8XA 3BIEA 4NRPA 5DABA 4CXXA 3I49A 2FDFA 4MGTA 3RZJA 4NIGA 3BU0A 2FDJA 4RFRB 3BUCA 3S57A 4NPMA 4IE7A 3O1TA 4ZS2A 2FDHA 3H8RA 4NIHA 3RZHA 4IE0A 3S5AA 3O1SA 3O1OA 4CXYA 4QHOA 3I3MA 3RZGA 3T4VA 3RZMA 4O61A 3H8OA 4IE4A 3BTXA 3O1VA 3BTYA 4ZHNA 4JHTA 3BTZA 4NIDA 3T3YA 4QKFA 4CXWA
chains in the Genus database with same CATH superfamily
1O3SA 4YGBA 1NE4A 4KBBA 2JDMA 3I59B 1GLHA 1DQ0A 4KGGA 5JI7A 5T54A 2XBO1 1TME1 4P9GA 1REFA 1RUC3 1K45A 1ND2C 1KS5A 2EIBA 2XH6A 4Y5SA 1N1YA 4XACA 5LY1A 3O1RA 5GLZA 5IATA 1BCXA 1HXS3 4OUMA 4MGKE 1RL3A 1WLTA 1D4M1 4K8FA 5LBEA 4AE2A 2ZZQA 5FLIA 2YC2A 3IDCB 3FE5A 3RS6A 2A73B 3HOBA 3LIHA 4UW3A 5BNNA 1O6UA 3NV1A 1H4GA 2VXRA 3DXTA 1AR83 4CEYA 1I9RA 2BOJA 2J42A 5FZ4A 4KWLA 2DVAA 3QD6A 4XBNA 5LRSA 5FMOS 4BQ3A 5CVRA 4XAAA 3SKVA 2ET1A 1R092 1QJEA 2JDYA 2W92A 2Q1MA 2WSUA 3OOXA 3EYPA 3VKOA 3IKWA 4LHSA 5FPZA 4YW5A 5CFDB 1PVC1 4QPIC 2ZGUA 5A6ZA 4Q4Y3 4LO4B 3TAYA 4AEDC 2FHRA 3WVJA 5JDBA 2C9AA 5CFCC 2VTXJ 2C5DA 1QQP1 4UFIA 1BBT2 1YWKA 4P5YA 1Y4WA 2BQPA 3FL7A 2BV4A 2VZOA 1LHOA 3UYJA 1OKOA 1OQDA 2VBBA 3ZN4A 5CKNA 1HX6A 5E16A 4JVAA 1ZVFA 1H9WA 3THPA 5C6CA 4BM8A 4ES8A 3VBSB 3N9MA 3OBZA 1H6YA 3U4SA 5ABJA 4Y33A 1GQGA 3IB3A 5DDJ3 4ET7A 1J83A 1PO13 3DEMA 2E26A 5FZ3A 3AYDA 1OI6A 3ZYHA 1QH6A 5DUXA 3JXSA 3LFIA 2BEOA 3BN6A 4QKBA 1AR73 2EAAA 1WCQA 2ID4A 4CU6A 3CMGA 2WAOA 5F32A 4E2SA 4XCAA 2GAUA 1US3A 2VTXA 4DS0A 3NQHA 4H2AA 1KS4A 2WNVA 4PF1A 4Z82A 2P3IA 5FJHA 2YDEA 1SQ4A 5JPMB 1W9FA 4N53A 3WG3A 1BMV1 5EYXA 1FPN3 2TBVA 1C5IA 3LGRA 4QDSA 3S57A 2R32A 1K5JA 1ZRFA 5CFCA 2GALA 1NG0A 1X9PA 3Q8EA 2XL9A 3PHMA 3HMYA 2TEPA 4OQ9A 3RYKA 4AVCA 2C6SA 1UO9A 1UPSA 1V9U2 4JDOA 3WDXA 3ETPA 2P5BA 3JQXA 4XOGA 2GMPA 3BCWA 4L2NA 3M3QA 2QZ3A 2QTWB 3JB4C 4FPHA 5FYCA 2A70A 4AEMA 3LOBA 1Y9GA 4PJYA 4V2WA 1SCSA 3CDZB 4Y26A 2VBPA 2FBEA 4IUGA 1JZ4A 5CISA 1JYVA 3BIWE 3JD71 3U11A 2PAKA 1A34A 3RGBA 4Z1VA 1DP0A 1K12A 3N3HA 1V70A 4JX0A 4K3UA 1SBEA 2R1DA 1RMU1 4QGMA 4A41A 5JZGB 4IE0A 3R05A 4E9KA 1MS4A 3NSTA 3VZJA 4C1WA 4K6BA 5DDJ2 2PHFA 3VGIA 3WNPA 1PGL2 4LE3A 5BNPA 4HONA 2R1BA 4D6SA 4OHYA 1E57A 2RR11 5FK7A 3G7DA 3ZYBA 4NIIA 1QMJA 2XJRA 3SQOA 1R1A2 2HWD1 4UF0A 1IGOA 3HQUA 2YC4A 1ND3A 1SHWB 1YYNA 2D3RA 4E4SA 2ZX3A 3GALA 4KGQA 4Q0SA 5LATA 2X5IA 4HKLA 4BXFA 5BY5A 4OVEA 3FFZA 3V0AB 4WZFA 3RZKA 3AMMA 4Q4Y1 1JYXA 5L19A 1QJX3 4RR3B 2OKXA 1S0EA 5E88A 3ITQA 3MHZA 1GZWA 4X6RB 4C8DA 4XTPA 3GBFA 5LA9A 2WRAA 5F3EA 3H8RA 2JDAA 2ZX2A 4CCEA 2VL4A 4P5HA 4FAGA 3NO8A 1QOOA 1V9U3 3T0BA 5LASA 1W28A 1XE0A 4XPVA 4N9IA 1ALYA 3PUAA 1AXZA 3ZMOA 1DZRA 3D0JA 3N36A 4DNYA 5I0RA 3BVCA 4Y4YA 1ODNA 4QM9A 2WWUA 1W6QA 1ZZ6A 2WNEA 5JZGC 2HJIA 3D5OA 5J36A 2DVDA 4L99A 5FP9A 1L7QA 5DAWA 5FZKA 5FYUA 3FHQA 2DUPA 2PTMA 4Q5OA 4IGOA 3I2FA 4B29A 3HJRA 5CNAA 1W39A 2EA7A 2LM3A 3JBG2 4TSVA 1S1AA 2CDOA 4FPOB 2BNMA 4OUSA 4FTBA 1S2KA 2W5FA 3DYPA 2ZGRA 2JIGA 4GB31 3T2TA 2P17A 1CAUB 2AEZA 3AVSA 1OVPA 3NNGA 4AFAA 2RDQA 3ZFGC 5IVVA 2C26A 5JOYA 1CR7A 2I2SA 1UMHA 3CHXA 3MW4A 1H8TA 2GU9A 5FPVA 2Y0IA 5BNNB 3FMGA 3AJYA 1QDOA 5ACA1 1XE8A 1I1EA 3ZN6B 4DOUA 4QPYA 3C7FA 5C8CA 4FP3A 2PLV1 5LA1A 4QWNA 3OJBA 4HL0A 5F39A 2XMLA 3WF0A 1YHFA 5IW0A 3M2MA 1FV3A 2ZGPA 3ACIA 5FP7A 4HOOA 4QPGC 2TUNA 2WNUC 2K46A 5LRRA 1QXJA 5JSPA 1ND2A 2A7AA 1SCRA 1SFYA 2QQLA 4UFJA 4W6XA 2WNVB 2EIGA 1W6PB 4QX8A 4XTMA 3WF1A 1GSLA 2QNKA 1FT9A 4ASKA 4YARA 5IYYA 4RQPB 1O4YA 4FTEA 1YRZA 3I7DA 4QU1A 4WM8A 4WV8A 5A7NA 2WS92 3W58A 4Q4W1 3OY8B 4JHTA 2ARCA 4NHXA 4AAXA 4AEDB 1TMF3 5BNOA 1RMU3 4GMP1 4YNIA 3J7HA 1WW6A 4RGGA 5I8SA 1TNFA 2VXJA 2Y6KA 3J8F1 4Q0UA 3IPVB 4N43A 1JZ6A 2Y6FA 3WNXA 4U2AA 4TTGA 5FYBA 3LPGA 4CUBA 4LBNA 1VBC2 1URXA 1HQNA 5DZEA 3B7MA 1IS3A 1YCIA 2BGPA 5CEHA 1Y3TA 2WN2A 3Q8BA 5GZGA 5FAXA 1RUI3 3LA2A 4NMIA 3W9AA 4QPIB 2OUJA 4Q0VA 1PVXA 3H7JA 4UI9L 4DPNA 4DXSA 4UFLA 1RUI1 4IEYA 5DG2A 1Z0HA 3MYXA 4FPYA 1VALA 1LEMA 2D44A 4Z8BA 3G6JB 3AZXA 4QPGA 2DURA 3ZFEB 4FVVA 3CBNA 1TNRA 4QGNA 3I54A 1FOD3 4XJ9A 2R30A 1AXYA 1JBCA 5BNPB 1KITA 5HPOA 2IXCA 4CP0A 3IDBB 5FZ7A 1GQHA 3U1XA 1KQRA 3PTRB 4IEQA 3M3IA 1N3QA 5A1FA 3AL6A 5IAXA 4GULA 2W94A 1A3KA 1ND3B 3MICA 3WZ1A 4I02A 2XJTA 1SFPA 2NYYA 3MIBA 5IUQA 2ZBJA 1XNCA 4K21A 5BNOB 2HWF2 1LGNA 2VQUA 4HT1T 4IEWA 4FFGA 3HN3A 4DB5A 3ZIXA 4N90A 2WS93 4Q4X1 4BIOA 5L7OA 3L2HA 4Q27A 4M0HA 2BFUS 4YW7A 1RUOA 1IOAA 1BZWA 5C3QA 4FOWA 1HQWA 5HBAA 3MIDA 2RS31 5J98B 5CB7A 2VMDA 2RR13 1XPWA 2IUWA 1M06G 4Q1PA 2FDKA 1NZCA 2YFZA 1HRV1 1NXMA 5C9AB 4PBPA 4XMAA 4CPBD 1ZA4A 4AI3A 1U5XA 4XC9A 4AAPA 4DEVA 3POYA 5HCAA 4BQ5A 1RUE2 1QJY2 3AP4A 4QX5A 5ERLA 5L9RA 1B35A 2DWRA 2XKOA 3ZVXA 3UJOA 2GC2A 1NY71 3M3OA 2P3JA 4NAMA 1JMUB 2VZ3A 4I0AA 3AP5A 4AK3A 4L8QA 4FPKA 2VCBA 4B8EA 1WCKA 2A6XA 1RVF3 4Y1XA 1H2MA 4AZZA 3I2OA 1W90A 3LB9A 5H9RA 1PK6C 3ES4A 2RS12 1TEIA 4HZFA 4MOAA 4AHYA 3PLQA 1DLCA 3WEZA 1W99A 3AZWA 4UWDA 2B45X 4YW1A 1H2LA 2W87A 2Q30A 1AUYA 2XOMA 3DF0A 5FYVA 3TRSB 1NUKA 1CVNA 1UY2A 3LEIA 3PU8A 4NWVA 1C28A 3VDBA 3B00A 1MQTA 3S5QA 5FZ6A 2J7MA 4MZUA 2P4EA 2W9XA 3ZFGA 4XJ8A 4IV3A 1W8TA 3VBRC 5DAXA 1JZ8A 4LLOA 4R4XA 2CWMA 1Q8QA 1UY1A 1EV11 3I3DA 4EN8B 2E9QA 3T4HB 5A6QA 3EBRA 2B7YA 3EXUA 3RVHA 5C8CC 2GP5A 1AZDA 1J1TA 3T2QA 1S55A 4BQYA 5JSOA 1YQ5A 3OY8A 3ON7A 5IAVA 1NLSA 2E32A 4OI2A 2PQQA 2ZEXA 4YFWA 3DN7A 5DAQA 2DDUA 5FBJA 5HCFA 3WP3A 1W03A 3FFQA 4ONUA 2VW0A 5JZGA 2WFF3 3NRUA 4Q4V1 3VBOB 2PLV3 2HWC3 4C90A 4B7EA 5IVEA 1PNGA 1PMJX 1MACA 3H42B 3NNJA 4BA6A 2YFUA 3IN9A 3ME2A 4UOJA 3O1VA 3LDKA 2B8MA 4AL9A 4CUCA 1J84A 1IKQA 3KLSA 4DRRA 4YVSA 4XF0A 1W8ZA 2F4PA 3SH4A 5KR7A 2XLGA 2Y38A 2VUAA 4TN7A 4RA0A 5D8AB 4CDXA 2ZMLA 3MIFA 2IXLA 2BNNA 5FUNA 4G4FA 4AFMA 4NJ4A 3I3QA 3R4DB 3RRDA 1QNWA 4QQOA 3S7IA 4RGKA 1T2XA 4WM7B 5FZEA 3H3LA 2BP6A 1XU2A 2D6PA 4GKYA 1R1ZA 2JG8B 4XEZA 3POEA 5LEKA 3DUIA 4YM2A 3ZYGA 3GCXA 2XGXA 5EWSA 3VBUA 4BE3A 1H2NA 3J8F3 4CP1A 3I2DA 3KF5A 3RYPA 5FZLA 5J96B 3HT1A 5GZEA 2QQWA 2ILMA 3PVNA 4RN5A 1OFNA 1RUD1 1VIWB 4INDA 5B2GB 5FPUA 2YPJA 5FQ0B 5CBLA 2ZGQA 2ZX4A 3WDUA 3JZVA 5C4WC 5LCWL 4Z07A 1PIV1 3KWVA 3NJXA 4D0QA 1DGRA 2Z5WA 1U5YA 2DUQA 3TEXA 1D7PM 1JTZX 1MZFA 2QQIA 1ZRCA 2JDNA 2RS53 5I8YA 1LCLA 2HYKA 3ACFA 5A1AA 4PF5A 2ADDA 1RUG3 1RUD2 4QDRA 2MEV3 1SEFA 1XYNA 2CGNA 2RS51 3BOPA 5KC5A 4AI2A 1BEV3 1GKBA 3PUSA 4ZONA 4EN0A 1QJU3 1EAH2 1LHVA 1W8HA 5E8AA 2X53S 3USUA 1N3PA 4QX1A 3FX3A 3HVDA 2VMFA 1C8M2 1QOTA 2X29A 1PHMA 3MV11 5FBZA 1C3HA 1T6GC 4COWA 3ZSEA 4BXSV 2JD9A 4LBQB 4OHVA 4A44A 4UBHA 3MFCA 5JOZA 4YZ3A 3AZYA 3PDQA 2JE8A 1QY4A 4OLLA 3UKTA 2F4LA 2G1MA 2XJSA 1W9SA 4CDUC 1FPN2 1B09A 4LLFA 2UU8A 2VMIA 5C33A 1UOFA 2VW1A 2CTVA 4E2GA 2VZ1A 2AZ5A 4RR3A 4BLIA 1F31A 2JDUA 4QXKA 4HVRA 4WM7C 5KHHA 4XAEA 3O0WA 3NAPC 2WSVA 3SCFA 3WW4A 1W05A 3ZIWA 2AH2A 4N53C 4BH9A 3AB0A 2PHWA 4KWJA 2HWB2 1CJDA 3FUOA 4FQ4A 5GLTA 2JXAA 3VKFC 5IFTA 3DYMA 1UOBA 3I3EA 3JCIA 4HN0A 3VDDB 4EJRA 1XOYA 4HKWA 1AXKA 1WCSA 4XFCA 3N4MA 2ZPXA 4L0PA 3V0AA 4MLOA 4Z2WA 2WO2A 2QDRA 4AQ6A 1FMD3 3H9AA 4CVUA 5AC92 1F8VA 2O8OA 3VBSC 2FZ1A 5DAVA 3SHRA 1WLWA 2R041 1YFUA 3ZXKA 4EQVA 5K0UB 2FQPA 3LEMA 3O5SA 4Y4RA 4UFHA 3EMRA 3D82A 1PGL1 2HYXA 2VE1A 1UQXA 4MX3A 2OA2A 5EV7A 3MW2A 4I2OA 2P6HA 4QMAA 4BQ4A 1UU5A 4UW5A 1RUC1 3UGFA 2D6KA 1HRI3 2XHNA 2AEYA 1G9DA 2Q5TA 4CCDA 2DBNA 2NQYA 2FCVA 2XONA 1O91A 4NRQA 5EJZB 2BDRA 3ZR6A 3RZZA 4I01A 4N53B 4A3ZA 4O7XA 1ULEA 1VMFA 1Q8VA 5LB6A 1SLTA 2GMEA 2I07B 1CWPA 3PVOA 3VHOA 5F3CA 1BYHA 2OT7A 2VH9A 4V1PA 2W2IA 2A3YA 3NKGA 3WNMA 4ES9A 3DXUA 3FLTA 5FJKA 4XABA 1R091 3H8OA 3ACGA 3PURA 1JYTA 2L9LA 1RUE1 3WQ0A 2HWC1 2BZDA 3ORJA 2YY1A 5FDBA 2VMGA 1QQP3 1H0BA 3WF2A 4BK4A 3OB8A 1OURA 1AYN1 3DPRC 5CFDA 3J26N 4O65A 1N3OA 3IDEA 5JOWA 1AR82 2DFBA 1VBD3 4Y1ZA 4QAWA 1BVP1 4GWIA 2VUCA 3OGJA 1WCUA 3E5UA 5KXDA 4A6SA 1JU3A 4AI1A 1HW5A 4LHNA 3M3CA 2UWCA 2WO7A 2Z69A 1E5RA 3CZUA 2K9ZA 1ZRIA 3HNBM 1S0CA 2QDNA 5D21A 4OZOA 3RNSA 3JBG1 4R9AA 4F8AA 1D2QA 2ENRA 5FZBA 3NMBA 3IPVA 1ZA7A 2WZR3 1XSRA 3W59A 4A7KA 3KQRA 3UL2A 5T5LA 1C1LA 3THCA 1QXPA 4A7YA 4XHBA 5FXVA 2WQ8A 3AK0A 5BNPC 1OOPC 1X7NA 5KWRA 2IFWA 4LO8A 1US2A 2P3KA 4NRPA 4NE9A 3WCRA 1NLRA 5FOBB 1AL22 1SMVA 3I97A 5AVAA 3K3OA 3MLJA 3UKVA 4ZZ5A 3O0XA 4FI9A 3E1F1 1OC1A 3KV4A 4N9HA 3TN92 1WA6X 2PYTA 3QCWA 3V0BA 2HWE1 1RMU2 4IETA 1VAVA 4RHV1 2PHDA 1LU2A 2VCAA 4MSVA 1XJAA 1W0PA 1UL9A 1SG3A 5AFEA 4UW4A 4Q4Y2 1U0AA 2V5YA 3WNKA 1GNHA 4CEWB 2XWJB 1R083 2R0HA 3H3ZA 1CAWB 1DF0A 1XRUA 2VGDA 3WCSA 3NVCA 1VBC1 3K4ZA 2WWJA 1E5HA 1YFWA 3MFAA 4I09A 1QKQA 2MEV1 4RSUA 1AR62 2EVXA 4UXAA 4RGAA 4AFDA 1VJ2A 1YQ2A 2FDJA 5C9AA 5C9AC 2BTVC 4HN1A 2QVSB 4FT8A 1R64A 1F2NA 4AGRA 4YG6A 3ZSKA 3UESA 3AKQA 3N9NA 3DGTA 2VZSA 3P3NA 1OF4A 1UXZA 3X29B 1WW7A 2JENA 3WSOA 1LB2A 2PQSA 4H3WA 2ZAHA 4M3CA 1UCXA 3HBKA 1AR61 2XVLA 2JG9B 2Q0AA 2NPIA 3I2GA 2X09A 5FP4A 3IWZA 3ZFFB 4HPKB 1HB2A 4Z2AA 2R7EB 5C5UA 4ASMB 2GN7A 2UURA 1OA4A 2FMYA 5FWEA 2BBVA 3K2OA 4XURA 1A8DA 2DTYA 3UETA 1LGCA 3MO4A 4J1XA 2XUEA 5BPXA 4CEWC 4RHV2 1UU6A 4B4QA 1V9U1 1PGW1 4XXPA 5IK7A 3VKLA 2Q1FA 2C4XA 2YV8A 5DUVA 3MW3A 3O1OA 3MZHA 3E6CC 3VD5A 1DQ4A 4E27A 5LEJA 4BWOA 4Q4X2 1O3TA 5F5CA 3C7GA 4BPZA 4UW6A 3TBDA 3OTFA 2DUOA 3B01A 2RMU2 5L73A 4MUVA 4WM7A 2ZMKA 3VBHC 4BIFA 1GZTA 2EXIA 1H30A 5FO9B 1LULA 5FMBA 1MEC2 1S0BA 4NPLA 2QQJA 3ZX7A 4DEQA 4S2DA 1HRV2 2OVUA 4XIKA 3NL1A 1NA1B 2IXKA 5ABJC 5FR3A 3M1HA 1F9KA 1RGSA 3NV3A 2AUYA 5JMOA 1DIWA 2GSYA 2XKPA 1OUSA 4GB33 5FZHA 4BU2A 5HV4A 4DXRA 2DFCA 5LWBA 3BU0A 2RJKA 4HFSA 5JI9A 1UZVA 1VBA2 4IEPA 5EXOA 3ZFEC 3HR9A 3VD3A 1CZSA 1RVF2 1WZXA 4CDXC 2O0OA 2WDBA 5L9VA 5KHGA 3OGRA 2N7GA 2A71A 1FX5A 4WZCA 5A80A 1Z7S1 2Z4FA 2BFUL 2JB4A 3KD4A 4YWAA 1ULGA 3DKQA 4AEKA 4JQTA 2ARXA 4BYYA 4EN7B 2IVJA 4QKNA 1OH3A 1HLCA 1PVC3 3CLPA 1UPIA 1NCQB 1RUF1 2QQPA 3VBOA 1W8FA 4Q0QA 1LOFC 1REEA 1DZTA 2VUJA 1VBE3 4XFBA 2R061 1RUF3 3RZHA 1H1IA 1S0JA 4XJZA 5IVJA 1W6NA 2UWBA 4PIXA 2W0XA 4PIZA 4IEXA 2BWAA 2NLRA 1QGLA 4XJUA 2GZWA 5T3NA 3ZXDA 4NOTA 1AYN3 1H8TB 1I5ZA 3LWCA 3GJBA 1L7RA 1ZNPA 3HT2A 2OQ7A 1HV1A 5A3TA 3JUUA 5HXVA 2WBKA 2RE9A 4W8JA 5A32A 1UWWA 3HWJA 4CDQC 2ZKLA 1RUJ2 2EAKA 2VOVA 4TLFA 1YQCA 4DY5A 4LNVA 1EPZA 3IAPA 4XFIA 1W2AX 3T0DA 3KSCA 1VRBA 5I0SA 4C0BA 1TMF2 3F95A 5JAXA 2C1FA 1YC61 2WNOA 2ZX1A 1GQPA 5F5AA 2I74A 2YROA 3ZSLA 2ZGMA 3AMHA 4BQXA 2P6CA 5FYTA 4G9SB 1ZBE1 5FUPA 2VZTA 2ZGKA 1K5MB 2HBUA 1DG6A 1M4WA 2QKDA 3AZZA 1VBA3 1U12A 2E63A 2WABA 4LJHA 4PLMA 5FZ1A 2RHPA 2WUHA 5FXXA 4CEYB 5LZ6A 1WLDA 3SEPA 3AX4A 4Q4V2 4D7SA 1VBA1 1HV0A 5FV3A 4X8NA 2V4VA 3LFMA 1OA3A 2XL7A 3N9QA 1XBFA 1AX0A 3USUB 2J1SA 1ULDA 1ZZ7A 2JJ6A 3IIAA 1YNAA 1O5UA 5JIUA 3PUHA 4CYDA 3KHBA 3K46A 4ZU7A 1XNKA 3FHIB 3AMNA 3VN4A 1W3XA 4CXXA 4YZ4A 4CDUB 1DGLA 5EQUA 2O1QA 4CSWA 2EICA 4GXLA 1VRH1 4C1XA 1KJRA 4DY3A 2UY9A 1O4TA 2NM1A 3I3BA 3OUHA 1W0NA 3QBQA 5LK5A 4Q0PA 1JYNA 1ENSA 2D6NA 1SBFA 4MGSA 4LBJA 1ZBA1 2O8QA 4A7ZA 2VUDA 4SLIA 5JXHA 3LF7A 2PFWA 5L7OB 3O1MA 5FYHA 3QH6A 3BB6A 1PIV2 4JGYB 4AVVA 3IT8A 1HJFA 4ARXA 3PMEA 1SZBA 4QQHA 2XXZA 3BTAA 2JB8A 1CPMA 3N7JA 4Q4W3 4AI0A 3CZJA 1U5ZA 2GNMA 4C0HA 4GIQA 1IS6A 1YI7A 3WW2A 1NA1A 1SDWA 4QGLA 2R6QA 1WKYA 4FO9A 3HEIA 1POQA 4XBLA 1QJFA 5FWJA 4UYBA 2GC0A 2D7FA 2P37A 1ODMA 5DDJ1 1YI9A 2C9KA 1QJX2 2JECA 2ARBA 1MZ6A 2VQTA 3E5QA 2QJVA 5C3SA 3BYWA 4CUGA 5D1IA 4BMBA 2B9UA 2DVFA 1PZ7A 4XUQA 4R9DA 1LNSA 3M3EA 3TYJA 3T30A 3VKMA 2OPWA 1TME2 4RYDA 2ZACA 4IL7A 1L7LA 2ORZA 2ORXA 3E5XA 5DZGA 2EXJA 1DGWX 1O8SA 3CF6E 3BIEA 4QX2A 4KH9A 1W9WA 3FWEA 1CAXB 1QJU1 4JGZA 4W6YA 1JUHA 2VOTA 3DPRB 5EIYB 5HI0A 2MPFA 4KWKA 3I3MA 2ET7A 1YUDA 1Q43A 2J1VA 2VZQA 3OEBA 1OH4A 1GWKA 1SLIA 4FQZA 4GH4A 1LEDA 1SLLA 3VZKA 4Y20A 5DQ0A 2B5HA 2PHUA 3H8UA 2J1UA 3H0OA 3KV6A 4QHBA 2AREA 2HWE2 4QKFA 5FZ8A 1X8MA 3T3YA 4AFBA 4AWDA 1K42A 2VJXA 1DBNA 4Z92B 2ZGTA 1BK0A 1S0IA 5DN2A 3PUIA 3FZ3A 2OPKA 1ULCA 1ZM1A 3RZLA 3WUDA 1FMD2 3M70A 3OPWA 1FAYA 4MXVA 1COV3 1EUTA 2WJSA 4Y5TA 3AL5A 1UYPA 4DXZA 4XW3A 4MG2A 4UFKA 4K7JA 3VBUB 1BKZA 4PHZA 4CDWC 1DDLA 2XBO3 4JQRA 2XJPA 5KXCA 2W91A 2RM22 4AEJA 4QX7A 1NOVA 4XBQA 1CD3G 4QU2A 4JKMA 3BPZA 1F15A 4AHZA 1OA2A 1OOPB 1ST8A 4JAAA 1I5PA 3SLIA 1XXNA 4JRLA 4NHLA 5CZKA 1LODA 2JKXA 4JDNA 4YW6A 3UGHA 3KMHA 4WVMA 5FMDA 3D6EA 3N7LA 5IK8A 5FP3A 1XQNA 3DYOA 2ARAA 3RJ2X 5GM0A 5KBFA 4YVSB 1CAXA 1V6IA 3OEAA 4I30A 4MXWA 5G04L 3VBRA 3GHNA 4OUEA 1HB1A 1RXFA 2PXJA 4BB3A 4CDXB 1AR72 1Q8SA 1ASJ1 1EYBA 4RS5B 1DYPA 2WNUA 2UY8A 2BVVA 3USSA 5C8CB 5A7QA 3KGLA 1HIXA 5LA0A 1HRI1 4NR1A 1RUH3 2VY0A 2AR6A 1H1AA 3SC7X 2YPDA 2ZGOA 1CJPA 1LOAA 4M00A 5FZ9A 4OMCA 1IHMA 1LTEA 3T09A 3WNNA 4B1MA 3WG2A 5GLUA 1W2NA 3MIEA 1ZRRA 2E6VA 3THDA 2KR2A 4CDQA 1MZEA 3IBMA 3CJIA 3ZYPA 2R072 1F4AA 2CU5A 4P9JA 1Q5OA 5K0UC 1Y43B 2DV9A 4PCRA 1AX1A 1MZ5A 3GXUA 1NAEA 1OOPA 2MNGA 5CG8A 1GUIA 1SPPB 1LJ7A 4NIGA 5FZOB 1IG0A 4CCCA 1DQ6A 1AX2A 1MPXA 4M3CF 5ISLA 1FOD2 1JU4A 4CA9A 4DINB 3W5NA 2QE3A 5A3UA 4P9LA 2W68A 1UMZA 4P08A 4EZ4A 2WZR2 4MHRA 5A3OA 4ZKTB 1GFF2 5FXZA 4FSJA 3B94A 3PU3A 4EROA 3ZYFA 3FUQA 4UAPA 2JG9C 3ZMNA 1NCQA 5L36A 1RIRA 1PX3A 2MEV2 2D98A 1C8NA 3RJRA 1AYM3 4M0NA 2JKBA 1KXGA 5C3PA 5BNOC 3VHPA 3Q8AA 3GF6A 3NKTA 3VL9A 5C4WB 1WMXA 3NNMA 1RYYA 2ZCWA 3D0SA 3Q9OA 4RFT0 3SCGA 4QXHA 3SNMA 2Y0OA 1ZBE2 1KRIA 1W04A 1NCRB 2RS33 3CQOA 4N8MA 2E31A 2CYFA 4LR4A 3S0MA 2ERFA 4HXCA 1X50A 3ZSMA 1GV9A 1PK6A 1IQDC 1ASJ3 2VW2A 2RJLA 1CAVB 2VC9A 1NLQA 1UMIA 4HVOA 4LBLA 1OHFA 4IGQA 4GMP0 4K40A 3VZMA 4XXAA 4YG0A 4CTEA 1APNA 2NZ9A 5LBBA 2VMHA 2Y26A 5A3NA 2DVBA 3FBYA 2VOKA 4WVVA 1AL0G 1OLMA 2A3XA 2XVGA 3VL8A 3LCPA 4MVTA 1B35C 2D93A 4XHXA 2DF7A 1RUD3 3AKPA 5CFCB 1S0FA 2BOIA 4O61A 5HCBA 4BQWA 1UX6A 1HN1A 4WBBA 1EAH1 4DMIA 1A8MA 2WC2A 1O3QA 3WHTA 4AOCA 1ZYBA 1QJU2 5FPLA 4K1ZA 2JICA 2RG4A 1S0GA 3HNYM 4BCUA 1QDCA 1UAIA 1IKPA 4F7ZA 2R16A 3BI3A 4IV1C 4ISRA 4IV1A 4URTA 4KQ7A 1X9TA 1W8OA 4XZUG 2RDRA 4XFAA 1FPN1 3VHNA 4CDWA 3UNPA 4IESA 1LGBA 4KMQA 1TG7A 3ECQA 3ZXGA 1S2BA 3AMPA 2Y6HA 2CL2A 2DU0A 3NV4A 4YPJA 2QQMA 4LXLA 2OX0A 2Z42A 3ZR5A 3VBRB 3QOPA 3PIGA 3P5BA 1V6JA 4IGPA 2VNOA 3WF3A 1FV2A 1XU1A 3E97A 1X36A 3O7OA 4HMZA 3O0VA 2A6ZA 4M4RA 2KD7A 2GP3A 4AVBA 4IDZA 1IPSA 4QPIA 5FY1A 4LKSA 1BMV2 4A6OA 4ZZ8A 4HKOA 2E7AA 3QLQA 4XDQA 2C24A 1H8TC 4IEZA 2XLAA 4UF0B 5FCCA 1HRV3 2WFF2 2D5HA 3RWKX 2WYFA 1W6MB 2HEVF 2VMEA 3SISA 1TVGA 1VBB1 4NWWA 3UJQA 3VBOC 2DCJA 4I0BA 4M01A 3VZNA 3VBFA 4YZ5A 4OQ8A 3ZPYA 4XUPA 1PM7A 1RXGA 1RINA 2BERA 2XHKA 4YFZA 1MR5A 4YGCA 2P34A 4BISA 2WQ4A 2XB6C 3BTXA 4M3CB 5T5PA 3U4XA 3ZYRA 4BMEA 1X8EA 1UY4A 2D97A 2JE9A 1VRH2 2ZXQA 4QQPA 3CO2A 1HRI2 4YVSC 2QCSB 2VQAA 5F8PA 1QXRA 2Y33A 4FPEA 5K4LA 5A7WB 4YRDA 1POV3 2Y6LA 4CCLA 4JGZB 3A4UA 2HWD2 5DABA 1DQ1A 2XR4A 4IEUA 1UIJA 3WDTA 5AVPA 4M3CE 1XYOA 3K77A 3K3NA 4MGQA 1D0HA 3V65A 1WMEA 3KGZA 4JC1A 1Z7S3 1EV12 1UY3A 3TOJA 3T2OA 2HWB1 1AR91 4AQ2A 2VAUA 3KM5A 4YW4A 3HBZA 3B5LB 5F3IA 5E1RA 4EWAA 2IC1A 1RUJ3 1AR93 3WT3A 2V73A 5LY2A 3OUJA 4GJZA 4I3PA 2ATFA 4HK8A 1VBC3 1Y7BA 3R0RA 4JKLA 2BNOA 1AVBA 1NCRA 1XNTA 2W39A 4I3GA 1RUJ1 4CCMA 3RMYA 4P9XA 4AQTA 1JODA 1JI6A 3HNMA 2SBAA 1FYUA 2XG3A 4NHKA 5DZFA 4LULA 4Q29A 3K4DA 2B9VA 1YXWA 1VE0A 2V4AA 3OCPA 4CUAA 1GYKA 1SLBA 3GDBA 4UFMA 1LRHA 1R082 1OFSA 4Q4V3 3NNFA 5J37A 2PHXA 2R062 2XQXA 4F3JA 2GNTA 4FPJA 3GGLA 3AMQA 1QH7A 5L9BA 4NAOA 3DKWA 1Q8PA 1UF2C 3O12A 5FK8A 3INAA 3KB5A 5CADA 3F2ZA 3ZFFA 1WGPA 4IV3B 4N43B 3FLPA 3ZFEA 1VAMA 4E8DA 3GZUC 4J6GA 1NQDA 1GR3A 2HH9A 1YJKA 2JIJA 1MS8A 3U75A 5IHRA 2R071 1YLLA 1VP6A 4R52A 1ONAA 1EP0A 4FFFA 5C3OA 3OGGA 4TLGA 3MIHA 1NZIA 1X82A 1Z7S2 3EB7A 1UU4A 3EQEA 5I8TA 3ILNA 1JZ5A 4H7MA 4LIUA 3TEYA 2RVAA 1W9TA 4IQPA 4XETA 4LMFA 2G19A 1DYKA 1WUVA 3POBA 3R4UA 5I91A 4HSJA 3C7EA 1JOPA 5IVYA 2DCYA 4CDQB 4GWMA 4QPGB 4AQSA 2VVEA 1D4M3 4I0WB 5F1RA 2WNUB 1VBB2 2PAEA 1QHDA 2OYZA 3NWKA 1F35A 5FZDA 4FCAA 3OGVA 4X6QB 5CU1A 1JOBA 3NAPB 4ZXKA 5I0UA 1ENRA 4NIDA 5BUVA 2RDNA 4S2FA 3ZM8A 2OXBA 4CCJA 3K4AA 3B69A 2F17A 3D3AA 2LS6A 1V6LA 3EO6A 4CU9A 3WDWA 1ENXA 3HQXA 4HK9A 4N43C 1POV1 3PNAA 3GNEA 3AP9A 4QX3A 1MEC3 2HKXA 4LKFA 1W8WA 1QNYA 4UT5A 1OPOA 2QQVA 4L11A 2OZJA 5EJ3A 2GH8A 3NJZA 4KNCA 5H9QA 3ACHA 1G9AA 1UIKA 4WVZA 3WD5A 2KXLA 1PO23 3ACLA 3VDDA 1UKGA 3POIA 5FMOL 2BGCA 2EALA 1PMHX 1P8JA 4BLJA 1K5MC 3PJYA 5LBCA 4M4PA 2FCTA 2ZJCA 3NJVA 3U10A 2VTFA 4XFFA 3ZXAC 1JHNA 1XE7A 4JRAA 2PAMA 2V5DA 5FQ0A 1W0OA 4Q2FA 1R093 4GALA 3POWA 1UZWA 2IXIA 4PQ9A 4RS5A 5A7WA 2VNGA 1QF3A 1R1A1 4QDQA 4DQAA 4WM8C 1U5IA 4XF1A 4CP9A 1CN1A 3UK9A 3PJQA 4D69A 5FXWA 4AVAA 4OCTA 4FOYA 2VZRA 5AC91 2QQNA 2RMU3 5FY5A 2IZWA 2GNBA 1VBB3 2FCUA 4OHWA 5C4WA 3ZKYA 5FRAA 3NV2A 3RI8A 1WBFA 4NHMA 3IDAA 3WNLA 2XBO2 1F5FA 4LKEA 4LO7A 5T52A 1LAJA 4QKDA 3BKZA 3VBFC 2QQKA 1H9PA 3WP5A 1PO12 3O1UA 2RS11 1BK1A 2Q8OA 4PI0A 4AEDA 1NE6A 1OQ1A 4D6RA 3GHMA 4FPLA 1FXZA 4DZGA 1W8UA 5JMCA 5FZOA 1DQ2A 3TN91 1NKGA 3RPQA 1GNZA 1NCQC 3I2JA 3VDAA 4FXKB 2D40A 5APAA 3HPNA 4CU8A 2X5IB 3AP7A 1KJLA 1RUG2 4L9BA 2R0FA 2GNDA 3WDVA 5F9TA 1WW4A 3CJIC 5FP8A 2HWF3 5DXDA 1UOGA 2JDPA 4DIQA 4FFHA 4FTSA 4Y22B 5A3MA 1WCDJ 5C70A 5FZAA 3PVBB 3WDYA 1WMDA 2CDPA 3ZXJA 4XZPA 3IMMA 3LSDA 1OUXA 5J09A 1UD1A 2ETEA 4IXLA 1POV0 5JOXA 1KFXL 3WNOA 3J4UH 2H6BA 2FZ2A 2VCMA 5FPXA 1PO21 1OLRA 3OBRA 3N7MA 4HANA 3POJA 1A6CA 1ZZ8A 4XFGA 3KF3A 4CRQA 1W9YA 1Q8OA 3V64A 3U37A 3CL1A 2DTWA 3I2HA 1RUE3 1B35B 2D3SA 3DV8A 4FPFA 4JKKA 2VZVA 1D2SA 2WFF1 4H14A 4RL7A 1LHNA 3J9SA 3K48A 3OD4A 5GZFA 5A3PA 1TQ5A 2IVIB 1BBT1 4CDUA 3V56A 2H6CA 2B4KA 2LUWA 1AYM1 5GALA 3ZOIA 3JBG3 3AXDA 4CXYA 1C5HA 1JXNA 4MADA 2BBAA 2RR12 4J1WA 4MH0E 4WVMB 3TNPB 3LEGA 3AVRA 4QM8A 3TEZA 4UBGA 2D6LX 2BVBA 2PA7A 1N1TA 2DCTA 1IZ3A 3AFKA 2WR9A 2WT0A 4GA9A 4W50A 3WW1A 2YBPA 1OLQA 4IEVA 5EPAA 2XQRA 5FY0A 2VBDA 4E8CA 5GLWA 4NIAA 1HB4A 5J48A 2NMNA 1G7YA 3VV1A 2CWSA 2WA4A 2XLFA 1KFUL 3IMNA 1RUC2 3VZOA 2Y34A 4CCOA 3VBSA 2XJQA 1AJOA 3TNQA 2JD4A 3WG4A 1JYWA 1HN0A 5C7GA 5JLVA 2RS13 2BPA2 2E33A 1OD5A 1TME3 3OPZA 2W1QA 1R081 5JR2A 3DECA 4RR3C 1C57A 4D8MA 3OUIA 2YGMA 3UV9A 2VNRA 1PMIA 3URFA 3KV9A 4LEJA 4MGZE 3J7MA 3S6PA 2JG8C 1XSQA 4ZS3A 1G9BA 2ADEA 1V00A 3KQ4B 2VOWA 2B42B 2E7TA 2WINB 1IS4A 5FPAA 1RUG1 2RV9A 2WLQA 5JVVA 2WQZC 5AFBA 2FDFA 1LOBA 3JD73 2JDZA 4FP2A 5DUWA 1KGYA 5F2WA 4AHXA 3RI9A 1ZZ9A 1VBD2 4OYUA 1WMFA 2GN3A 4XFHA 3P3PA 3O1SA 5HXMA 3T4VA 3WV6A 2HEWF 4XCBA 2VR4A 3AM2A 4ZU4A 1GP5A 4PIYA 3IZOA 5C8WA 4QB1A 4XF9A 3UGGA 3OYWB 5CKMA 2RDSA 2YMZA 4LE4A 1J59A 5BV6A 2YG0A 2RM23 2WZPP 5K9YA 1OKQA 4XDPA 4V2VA 4AXOA 3LEKA 3GM8A 4K9SA 3SITA 4Q26A 4FPCA 2AENA 3E6DA 2XUMA 1VBE1 5IFPA 5JPNB 5DUUA 1L3JA 3ZYIB 2FMDA 1H4HA 4QXCA 4YM3A 5FMCA 5KHKA 1VB4A 2BYVE 3MPBA 3IM0A 1NT0A 5FYSA 1XB9A 3DCQA 4LA3A 3WINE 2WWSA 1FOD1 1I6XA 4KL1A 2J1RA 3ABZA 1H6XA 4SBVA 2YGLA 1XNBA 2ZABA 4LA2A 1S0DA 2EIEA 3N7KA 4AVTA 4CCKA 2WT1A 1XNAA 2JDHA 2ZMNA 1OQEA 3TN93 2OIIA 2HBTA 4TWTA 2ZEYA 3H50A 2O14A 3LSEA 4QD2A 2FDGA 1COV2 5T50A 1J58A 1V0AA 5A33A 2YBKA 3HIFA 3ROUA 5I0DA 4E2QA 4N7UA 4B4RA 1CZTA 5A32B 1FI2A 3IIIA 3LZZA 4QB6A 2W1SA 2UYAA 3LD8A 4RFRB 3H1WA 4JTNA 4QQLA 1WW5A 2JE7A 3N9LA 2NN8A 1X33A 3AYEA 4DUXA 5J1XA 1H2KA 3WR0A 3ELNA 1CAVA 3O14A 5FZ0A 4FAHA 1GP6A 2LTNA 4Y5Z0 2WL1A 1QU0A 5ANQA 5JCTA 2YXSA 1HQLA 1G86A 3RQ0A 2A5ZA 5FYMA 5A70A 1NX9A 4BQ1A 1UYXA 2AYHA 2ZHMA 2Q8CA 2YBSA 3H7YA 1EPWA 5F5QA 3B9CA 2G4IA 1F4HA 3S30A 4GJYA 4LIVA 2HWD3 3T2PA 4DO0A 3PL0A 1LR5A 1YEWA 5ACA3 1VMJA 4YZ2A 4RD7A 1RTVA 1GANA 1OD3A 4LPLA 5E89A 4OI1A 1D0GA 1V6OA 4B4PA 4YZ1A 3A23A 3TWIA 4NPMA 1QEXA 1RHI2 3JQWA 4Y1YA 4FOQA 1D4VB 1REDA 4EN9B 5C71A 3RZGA 1UOJA 1CQ9A 2C0ZA 4AI9A 4EYUA 1SBDA 1AR92 1UZZA 1YJLA 2LW8A 3BPSA 4YYOA 5L7OC 2LRPA 1DFQA 1ND3C 4MHUA 1CIYA 4A42A 2PMWB 1LOFA 1RB8G 1VBD1 4PLOA 3DL3A 1SACA 2ZHLA 1IS5A 1W6OA 3AXEA 2VQ0A 4LT5A 1BBT3 4K8RB 4Q1RA 2WYSA 1YIPA 4H7LA 1AR63 2WN3A 3R4SA 2XVKA 4IERA 4PLNA 5LBFA 2HWB3 1KDMA 2R49A 3ZXFA 3FC0A 4ITCA 3AKRA 1MS0A 2W47A 2W46A 4MGYE 3WQ1A 2EXKA 1FNZA 4L97A 4NIHA 3ST7A 2CSGA 3GJAA 4FPGA 1DGWA 1HXS2 3KZ4C 4EV0A 2NP0A 2D3PA 4NVPA 1CPNA 3WQ7A 5T5OA 4Y1UA 4Q8KA 3UKNA 3AKTA 1BQPA 3C3VA 1OF3A 1HKDA 1CESA 1LHWA 1PK6B 5D2AA 5BXXA 3WOGA 5A6YA 1OT5A 4OI0A 1IQAA 2CHHA 5FLJA 2J1EA 3B02A 1WWYA 4P9WA 5CKQA 1YIFA 5FZFA 4CU7A 3NAPA 4ASLA 2FDIA 1GOHA 2CGPA 5ACA2 1VAKA 4ARYA 4NPRA 3C8XA 4S2HA 4AVSA 1HB3A 1GWMA 1QQP2 4W6WA 4AGVA 5DPNA 2D43A 2VMCA 3VD4A 3U14A 3AYCA 2HWE3 1FNYA 3HQRA 4DRVA 2J1TA 2WS91 4Q4X3 1PVC2 3WF4A 1ZRDA 4GWNA 4QHOA 3BALA 3VLBB 5A6XA 3M8LA 1W6OB 4QHZA 2BJSA 2WNVC 5BYNA 3NNLA 3LE0A 3BTYA 1QJZA 1ULPA 2E51A 2VM9A 3GZAA 1RUF2 1LECA 2DBIA 4MV2A 3W21A 1VR3A 1MQTC 1QJY1 2W1UA 1SDDB 5M0TA 4HPKA 2JDKA 3Q8CA 1ZX5A 2PLV2 5KXEA 1RITA 4HSLA 4CDWB 4OMDA 3WY6A 5F6KA 5FY4A 1DU3D 2V09A 2DYCA 4P00B 5FFOC 1NYWA 2WA3A 4Q8LA 1W6MA 1UXXX 3MGUA 3WXPA 4EZHA 3A0NA 3IAQA 5IVCA 5CG9A 4EWEA 5B4XA 2X05A 3QH7A 5FYZA 4IE7A 3VBFB 4URAA 1PZ8A 2BUKA 2ZAAA 1GZ9A 2X10A 4GMP3 4D7TA 2OZ6A 4ZPIA 3OF1A 4CP9B 1ZBA2 2WFPA 3A22A 4LHKA 3ALQA 2DCKA 1H1MA 3POGA 4YGDA 1CONA 2E53A 1PO22 3ASIA 4XIOA 4GZ9A 1UN1A 1R1A3 1XYPA 5D8AC 1EAH3 3ZLIA 1Y9QA 2DCZA 4J25A 4XUOA 2ZEZA 2A6WA 3KHCA 1PZ9A 1BVVA 4LOTA 1W3VA 1W2OA 4FXGB 1AR71 2H0BA 2BW8A 4LORA 2Q8DA 1LHUA 5H9PA 5JSRA 1AHSA 2RMU1 3PIJA 3B93A 4LTAA 5LW9A 1GMMA 5K0UA 2Y8KA 2I45A 4COYA 1G8WA 1G6NA 5EFUA 1LKNA 3RFRA 1JYIA 1I3HA 3AZVA 4Y1VA 4JGYA 4JGYC 3VD9A 1CAWA 2XPJA 4ATFA 1N1SA 3VKNA 5FY9A 3SEEA 2DVGA 2AC1A 2YZ4A 3MI8A 4K1YA 4LQRA 1J3RA 4OFGA 4QPWA 1MVQA 5A7PA 3P6BA 5A7SA 1GZCA 3H1MA 3VBHB 4NROA 4W65A 3ZXLA 2F6BA 2ZA9A 1V6KA 2CAVA 2K2SA 3CJXA 4GKXA 1MS9A 3AYAA 3T1MA 1UYZA 3GZTB 5J3UA 3LAGA 5IWFA 1QOSA 4YM1A 5FKBA 3T1LA 3HAGA 1SFNA 5JWPA 4IE6A 4LHLA 4GAZA 3LOIA 1RC6A 4D94A 3CU7A 4TYSA 4D3WA 1S2EA 1VMHA 1DLLA 2ZEWA 3AC0A 4MO3M 4DFSA 1JOJA 3T0AA 5FOJB 3JU9A 5GZDA 1GZWB 3ZFGB 1C8M3 3L2YA 2A1XA 4PDWB 4W4ZA 1HJGA 4P14A 4ATEA 3H1YA 1BXHA 5FYYA 5B4NA 2H0VA 5DMYA 4Q4W2 3FJSA 5ABJB 4YW2A 1MVEA 2YU2A 2R042 4LO5B 2VPVA 4JV4A 1E5IA 5A3WA 5FIXA 1VRH3 5FO8B 3M7AA 3SH5A 1UX7A 3RYRA 5JUVA 3ZN5A 2P3YA 2G9ZA 4LK7A 5CIRA 2QQUA 3WX5A 1V6NA 2YU1A 1RJ8A 2CGOA 3B3QE 5KXBA 1GU3A 3WQBA 2BU9A 2R063 3ZDSA 2YB7A 4R9BA 3MDPA 2X8KA 4IW3A 1SLCA 5EP9A 2SLIA 4XYXA 5FLHA 1ZREA 3B9IA 1SPPA 1DYOA 2JX9A 1LENA 2JG9A 2RS32 3Q8FA 4FOVA 1BJQA 4JGZC 4L92A 1QJX1 1RVF1 2WIIB 5DAPA 3THTA 1WA4A 1YQ6A 4GD4A 1AJKA 2YHJA 1AF9A 4B1LA 2ZHKA 4B7KA 1DQ5A 1OXCA 3L9JT 1O4ZA 4BJ0A 2VVDA 4GB32 3ES1A 4ZXEA 2BGOA 4RHV3 3I59A 3LDBA 4YVWA 4CCNA 4KI5M 3ZN6A 2W1WA 1UYYA 2Y6JA 4JHZA 1G9FA 4BK5A 3MV01 2HLEA 3ZYJB 1A78A 3H8XA 2QBXA 2Y6GA 1ULOA 2VZPA 2A75A 2QQOA 4ZU5A 5FZMA 5GLVA 2GMMA 3T08A 1BEV1 4HG6B 4BZ4A 4CP2A 2W52A 3OG2A 1JS9A 5FZCA 3MEPA 5H9SA 2X5IC 2PN5A 1GWLA 1PGW2 4RQPA 2E7QA 5CA6A 2ZX0A 4ZHNA 4META 4CZSA 1LOCA 2D5FA 2Q8EA 3RWNA 3K51A 3POFA 1O7FA 1W2UA 2B39A 3MLLA 3N35A 4X8PA 4QX0A 3LA7A 4U36A 1ACCA 3CEWA 1UZ0A 1W6NB 1WLCA 4YG3A 2VD7A 5IVFA 1SLAA 1LOEA 2JG8A 4KWUA 3LPFA 2YUEA 2EIDA 3BGAA 4LUKA 4AI8A 2OUHA 5FY8A 1H8VA 2OQ6A 1KEXA 1W8NA 2GC3A 2Q4SA 3EJKA 1TE1B 2BWCA 4XDOA 3KT4A 4RS5C 2XJUA 5EZWA 3ENRA 1OBNA 3JB8A 4TXWA 4XUTA 4WVWA 4Y22A 1UZYA 3MUZ1 2Y60A 1MS1A 4Y3OA 5EJ1B 4EWDA 1O3RA 2CNAA 4LBMA 1JZ7A 2ZGLA 4LUMA 3CNAA 3MF6A 1D4M2 3SKJE 1VBE2 5GJ6A 3FN9A 3N9OA 4NN0A 4QXBA 2GC1A 2ZHNA 1CAUA 3CKHA 3VD7A 3TEWA 2W95A 2Y64A 5FUIA 2VNVA 3SXWA 4AW7A 1VPHA 1OPMA 3JD72 1JZ2A 5K8SA 5KC6A 1YO8A 2B46X 1RJ7A 3N9PA 4BQ2A 3A7QA 5LA2A 2GH2A 1GOGA 3M4FA 4O9GA 2UYBA 5F2SA 5F7UA 3D4KA 1WBLA 4TZDA 3MPPG 3MUY1 3PVEA 1RHI1 2W3JA 2WZ8A 1DHKB 4LITA 3RSJA 1WD3A 3WLUA 2WKKA 4NUBA 3FHAA 1AL21 4IEOA 1T6BX 3ETQA 2ZTNA 2PHLA 3LQCA 2IXHA 1ZZBA 3TB0A 3UT0A 1JYCA 1LESA 1STMA 4AF9A 2YC0A 4D7YA 3J7LA 1BEV2 1QIQA 4IE5A 2P2KA 1AL23 3KV5A 4LOSA 1MS5A 4PT6A 4WM8B 5C5TA 2QZ2A 1OVSA 2K0GA 4JZRA 4R8HA 1ENQA 4PI2A 5F5IA 1XNDA 1EV13 1GBGA 1NCRC 3I2KA 3WG1A 1CGPA 3MIGA 1MEC1 4EN6B 1BLZA 5ANNA 4B3NA 5IK4A 2VZUA 4ISQA 1RUH2 1KD7A 5F6LB 1CZVA 3I8TA 2DU1A 2IFRA 4XQ4A 2UWAA 2ZZJA 1BHGA 4YVWC 1WD4A 3BTZA 3VUOA 4CXWA 1IPJA 1V6MA 5LK7B 1NXD1 3WUCA 2PHTA 2YYOA 4KG8A 4BHPA 5IJRA 1QWRA 2KA3A 4KU8A 3VBUC 4F83A 3J7NA 4GWJA 4ORFA 2J22A 4AR2A 4CEYC 4LK6A 4A45A 2LROA 4CE8A 2ZGNA 4K20A 2QUOA 3APBA 1C8M1 2XDVA 3GBGA 4DUWA 2VO5A 3RZJA 3AKSA 2JWPA 2HWC2 3CJIB 1PM4A 4IV1B 5E6HA 5J7MA 4XUNA 4DXTA 4P02B 2G9FA 4QT6A 5G05L 1Y9MA 5AC93 1G9CA 5FPBA 1CX1A 3QACA 1LOGA 1J3QA 1O8PA 3BUCA 4D6QA 3KVBA 1JHJA 4P9YA 1ULFA 5KHIA 4HLTA 1FATA 3U78A 1DZQA 5DG1A 5BNNC 4OI4A 3A0KA 1TMF1 3FBMA 4XQDA 1UY0A 2PHRA 1CIWA 3ZDVA 2FD8A 1PGSA 4AG4A 1RUNA 4JCKA 3P1IA 4N7IA 5IVBA 3LA3A 2WZEA 1RHI3 3D8CA 3U0ZA 1MQTB 3I2IA 3KCYA 4BOWA 3ZFFC 3ZKUA 1W2TA 1C4RA 5A7OA 3KT7A 4XMIA 3LIGA 4ZY9A 4C91A 1HDKA 5FZIA 5C3RA 2MHFA 4IV3C 2HWF1 5KHJA 1EY2A 2IWGB 1JW6A 2A6YA 2D6OX 3C7OA 1HXS1 3BU7A 1ASJ2 4LO6B 3RMXA 1JZ3A 4R4ZA 1K3IA 3PTYA 4DUVA 2AGSA 1OSGA 2CAUA 3K75B 1NA1C 3DPRA 4XF3A 5CFDC 4KBZA 1JUIA 3KCXA 3NW4A 1NQJA 5HV0A 2V72A 1K5MA 2ZKNA 2IXJA 2BRTA 3FLRA 3WHUA 5FKCA 5CAZA 5IT6A 2EF6A 2WAAA 5CYYA 4A2UA 3VBHA 1YFXA 4A4AA 2Q1ZB 2XWBB 5F37A 3OSDA 4XJWA 4YSFA 2AACA 3O1TA 1RUI2 1GNYA 4AYUA 3GYDA 2QFEA 4R9CA 1XC6A 5FZGA 1DCSA 1EUUA 3SMHA 4O9EA 5IK5A 5HCHA 1DGRN 2RM21 2RJ2A 4XJAA 5A33B 1W06A 3KT1A 5I93A 2XJVA 4AGGA 4KG0A 1PO11 2GDFA 3ILFA 4KU7A 5D8AA 3W20A 4CEWA 1Z78A 2NMOA 4OHZA 5A1LA 1KDKA 2ZS6B 5FY7A 2EXHA 5BNQA 4GH4C 3BODA 3AJZA 3J8F2 4COUA 4CPBA 2WO3A 2VCCA 1E5SA 5SV5A 1CX4A 3POSA 3S7EA 4E4HA 3V0BB 3I49A 1W6PA 4PQQA 4YLZA 3U07A 3ZXEA 4GQ7A 5GZCA 1AYN2 3WW3A 3MF9A 5SV8A 2FDHA 5F3GA 2CY6A 2ZGSA 1YQ8A 3AFGA 2R073 4FBFA 3OBTA 5TSWA 4E4ZA 2WZR1 4G3YC 4IE4A 1JH5A 1PX4A 2OS2A 3KCCA 1PNFA 4OULA 1O5LA 2HEYF 5JIAA 4EE2A 4MXWB 3ZO0B 3OYWA 2PELA 2G9GA 3GZEA 2RS52 1UKRA 5EYYA 3O1PA 1Q56A 3LKJA 4PBOA 2WT2A 3HN1A 3ZPOA 1OMIA 3A21A 3AP6A 4COZA 1Q3EA 4LBQA 5JXJA 3WP6A 2VOXA 1W6QB 4RQPC 3C2UA 1N47A 4NRMA 3OGSA 1PIV3 1AR81 3PMSA 5I0TA 1COV1 3VHRA 3VDCA 4MGTA 2W08A 4LBOA 1TZOA 1UNBA 3MBWA 4FFIA 1ZBA3 1LU1A 2Z79A 4ZS2A 3VDDC 1GICA 2VVFA 1F5JA 1NY72 4Y20B 1QJY3 1AYM2 1OLME 4LKDA 4NHYA 2ZOEB 5JXGA 4PDWA 4BDVB 4PDWC 1IPKA 4XE9A 3SCHA 2P1BA 4YGEA 4XF4A 1O59A 5JXIA 1S4CA 1ND2B 1IG3A 3GCWA 3C7HA 2TNFA 3KVAA 3RZMA 4AFCA 1GP4A 1ZZCA 4S2GA 3OPTA 3BOWA 1VLNA 4LBQD 1YFYA 2WO1A 3E6BA 4P9IA 4GH4B 2VULA 2JEMA 1UW8A 3KS7A 4QB2A 2J1AA 1MS3A 3NJYA 4LBKA 3SH3A 1J3PA 5FO7B 2LALA 5GKAC 3RG0A 3WP4A 2A3WA 3S5AA 3OD0A 2A6VA 3OBAA 4HETA 3H3UA 4H55A 5FTTC 4QQ2A 3VZLA 3ATGA 1J1LA 1RUH1 4XILA 3VB9A 1C1FA 2VG9A 4HVQA 5T5JA 4JTOA 2D6MA 4XQWA 3PUQA 2KM2A 3MLKA 4XVHA 3CIHA 2CV6A 5T55A 3GBWA 1GOFA 5A3LA 5K7PA 1N1VA 4YM0A 4HBNA 5FYIA 3EHKA 5EHDA 3R6SA 1ZBE3 4YVWB 4MYEA 4NO4A 5JR7B 2ES3A 1JN2P 3ILRA 4OZXA 4Y24A 1FMD1 3RDIA 3I4IA 2OW4A 5FREA 3W5MA 4YW3A 2VECA 3HD8B 4OHXA 4JDMA 1VB2A 4A3XA 3LDRA 2R043 2WLPA 4E4DX 2VU9A 3ZSJA 4MGIE 4AHWA 2Z2SB 4COVA
chains in the Genus database with same CATH topology
4NIIA 4NROA 4IDZA 4OCTA 3O1PA 3I2OA 3LFMA 4QKBA 3T4HB 3BI3A 5F8PA 3RZLA 4IE5A 3KHCA 3O1MA 3O1RA 2FDGA 4NRQA 2FD8A 4NPLA 2IUWA 4ZS3A 2FDIA 4MG2A 3KHBA 4QKNA 4IE6A 4O7XA 3RZKA 2FDKA 4NJ4A 3I3QA 4NRMA 4QKDA 3O1UA 3BKZA 3H8XA 3BIEA 4NRPA 5DABA 4CXXA 3I49A 2FDFA 4MGTA 3RZJA 4NIGA 3BU0A 2FDJA 4RFRB 3BUCA 3S57A 4NPMA 4IE7A 3O1TA 4ZS2A 2FDHA 3H8RA 4NIHA 3RZHA 4IE0A 3S5AA 3O1SA 3O1OA 4CXYA 4QHOA 3I3MA 3RZGA 3T4VA 3RZMA 4O61A 3H8OA 4IE4A 3BTXA 3O1VA 3BTYA 4ZHNA 4JHTA 3BTZA 4NIDA 3T3YA 4QKFA 4CXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NII A;  4NRO A;  4IDZ A;  4OCT A;  3O1P A;  3I2O A;  3LFM A;  4QKB A;  3T4H B;  3BI3 A;  5F8P A;  3RZL A;  4IE5 A;  3KHC A;  3O1M A;  3O1R A;  2FDG A;  4NRQ A;  2FD8 A;  4NPL A;  2IUW A;  4ZS3 A;  2FDI A;  4MG2 A;  3KHB A;  4QKN A;  4IE6 A;  4O7X A;  3RZK A;  2FDK A;  4NJ4 A;  3I3Q A;  4NRM A;  4QKD A;  3O1U A;  3BKZ A;  3H8X A;  3BIE A;  4NRP A;  5DAB A;  4CXX A;  3I49 A;  2FDF A;  4MGT A;  3RZJ A;  4NIG A;  3BU0 A;  2FDJ A;  4RFR B;  3BUC A;  3S57 A;  4NPM A;  4IE7 A;  3O1T A;  4ZS2 A;  2FDH A;  3H8R A;  4NIH A;  3RZH A;  4IE0 A;  3S5A A;  3O1S A;  3O1O A;  4CXY A;  4QHO A;  3I3M A;  3RZG A;  3T4V A;  3RZM A;  4O61 A;  3H8O A;  4IE4 A;  3BTX A;  3O1V A;  3BTY A;  4ZHN A;  4JHT A;  3BTZ A;  4NID A;  3T3Y A;  4QKF A;  4CXW A; 
#chains in the Genus database with same CATH topology
 1O3S A;  4YGB A;  1NE4 A;  4KBB A;  2JDM A;  3I59 B;  1GLH A;  1DQ0 A;  4KGG A;  5JI7 A;  5T54 A;  2XBO 1;  1TME 1;  4P9G A;  1REF A;  1RUC 3;  1K45 A;  1ND2 C;  1KS5 A;  2EIB A;  2XH6 A;  4Y5S A;  1N1Y A;  4XAC A;  5LY1 A;  3O1R A;  5GLZ A;  5IAT A;  1BCX A;  1HXS 3;  4OUM A;  4MGK E;  1RL3 A;  1WLT A;  1D4M 1;  4K8F A;  5LBE A;  4AE2 A;  2ZZQ A;  5FLI A;  2YC2 A;  3IDC B;  3FE5 A;  3RS6 A;  2A73 B;  3HOB A;  3LIH A;  4UW3 A;  5BNN A;  1O6U A;  3NV1 A;  1H4G A;  2VXR A;  3DXT A;  1AR8 3;  4CEY A;  1I9R A;  2BOJ A;  2J42 A;  5FZ4 A;  4KWL A;  2DVA A;  3QD6 A;  4XBN A;  5LRS A;  5FMO S;  4BQ3 A;  5CVR A;  4XAA A;  3SKV A;  2ET1 A;  1R09 2;  1QJE A;  2JDY A;  2W92 A;  2Q1M A;  2WSU A;  3OOX A;  3EYP A;  3VKO A;  3IKW A;  4LHS A;  5FPZ A;  4YW5 A;  5CFD B;  1PVC 1;  4QPI C;  2ZGU A;  5A6Z A;  4Q4Y 3;  4LO4 B;  3TAY A;  4AED C;  2FHR A;  3WVJ A;  5JDB A;  2C9A A;  5CFC C;  2VTX J;  2C5D A;  1QQP 1;  4UFI A;  1BBT 2;  1YWK A;  4P5Y A;  1Y4W A;  2BQP A;  3FL7 A;  2BV4 A;  2VZO A;  1LHO A;  3UYJ A;  1OKO A;  1OQD A;  2VBB A;  3ZN4 A;  5CKN A;  1HX6 A;  5E16 A;  4JVA A;  1ZVF A;  1H9W A;  3THP A;  5C6C A;  4BM8 A;  4ES8 A;  3VBS B;  3N9M A;  3OBZ A;  1H6Y A;  3U4S A;  5ABJ A;  4Y33 A;  1GQG A;  3IB3 A;  5DDJ 3;  4ET7 A;  1J83 A;  1PO1 3;  3DEM A;  2E26 A;  5FZ3 A;  3AYD A;  1OI6 A;  3ZYH A;  1QH6 A;  5DUX A;  3JXS A;  3LFI A;  2BEO A;  3BN6 A;  4QKB A;  1AR7 3;  2EAA A;  1WCQ A;  2ID4 A;  4CU6 A;  3CMG A;  2WAO A;  5F32 A;  4E2S A;  4XCA A;  2GAU A;  1US3 A;  2VTX A;  4DS0 A;  3NQH A;  4H2A A;  1KS4 A;  2WNV A;  4PF1 A;  4Z82 A;  2P3I A;  5FJH A;  2YDE A;  1SQ4 A;  5JPM B;  1W9F A;  4N53 A;  3WG3 A;  1BMV 1;  5EYX A;  1FPN 3;  2TBV A;  1C5I A;  3LGR A;  4QDS A;  3S57 A;  2R32 A;  1K5J A;  1ZRF A;  5CFC A;  2GAL A;  1NG0 A;  1X9P A;  3Q8E A;  2XL9 A;  3PHM A;  3HMY A;  2TEP A;  4OQ9 A;  3RYK A;  4AVC A;  2C6S A;  1UO9 A;  1UPS A;  1V9U 2;  4JDO A;  3WDX A;  3ETP A;  2P5B A;  3JQX A;  4XOG A;  2GMP A;  3BCW A;  4L2N A;  3M3Q A;  2QZ3 A;  2QTW B;  3JB4 C;  4FPH A;  5FYC A;  2A70 A;  4AEM A;  3LOB A;  1Y9G A;  4PJY A;  4V2W A;  1SCS A;  3CDZ B;  4Y26 A;  2VBP A;  2FBE A;  4IUG A;  1JZ4 A;  5CIS A;  1JYV A;  3BIW E;  3JD7 1;  3U11 A;  2PAK A;  1A34 A;  3RGB A;  4Z1V A;  1DP0 A;  1K12 A;  3N3H A;  1V70 A;  4JX0 A;  4K3U A;  1SBE A;  2R1D A;  1RMU 1;  4QGM A;  4A41 A;  5JZG B;  4IE0 A;  3R05 A;  4E9K A;  1MS4 A;  3NST A;  3VZJ A;  4C1W A;  4K6B A;  5DDJ 2;  2PHF A;  3VGI A;  3WNP A;  1PGL 2;  4LE3 A;  5BNP A;  4HON A;  2R1B A;  4D6S A;  4OHY A;  1E57 A;  2RR1 1;  5FK7 A;  3G7D A;  3ZYB A;  4NII A;  1QMJ A;  2XJR A;  3SQO A;  1R1A 2;  2HWD 1;  4UF0 A;  1IGO A;  3HQU A;  2YC4 A;  1ND3 A;  1SHW B;  1YYN A;  2D3R A;  4E4S A;  2ZX3 A;  3GAL A;  4KGQ A;  4Q0S A;  5LAT A;  2X5I A;  4HKL A;  4BXF A;  5BY5 A;  4OVE A;  3FFZ A;  3V0A B;  4WZF A;  3RZK A;  3AMM A;  4Q4Y 1;  1JYX A;  5L19 A;  1QJX 3;  4RR3 B;  2OKX A;  1S0E A;  5E88 A;  3ITQ A;  3MHZ A;  1GZW A;  4X6R B;  4C8D A;  4XTP A;  3GBF A;  5LA9 A;  2WRA A;  5F3E A;  3H8R A;  2JDA A;  2ZX2 A;  4CCE A;  2VL4 A;  4P5H A;  4FAG A;  3NO8 A;  1QOO A;  1V9U 3;  3T0B A;  5LAS A;  1W28 A;  1XE0 A;  4XPV A;  4N9I A;  1ALY A;  3PUA A;  1AXZ A;  3ZMO A;  1DZR A;  3D0J A;  3N36 A;  4DNY A;  5I0R A;  3BVC A;  4Y4Y A;  1ODN A;  4QM9 A;  2WWU A;  1W6Q A;  1ZZ6 A;  2WNE A;  5JZG C;  2HJI A;  3D5O A;  5J36 A;  2DVD A;  4L99 A;  5FP9 A;  1L7Q A;  5DAW A;  5FZK A;  5FYU A;  3FHQ A;  2DUP A;  2PTM A;  4Q5O A;  4IGO A;  3I2F A;  4B29 A;  3HJR A;  5CNA A;  1W39 A;  2EA7 A;  2LM3 A;  3JBG 2;  4TSV A;  1S1A A;  2CDO A;  4FPO B;  2BNM A;  4OUS A;  4FTB A;  1S2K A;  2W5F A;  3DYP A;  2ZGR A;  2JIG A;  4GB3 1;  3T2T A;  2P17 A;  1CAU B;  2AEZ A;  3AVS A;  1OVP A;  3NNG A;  4AFA A;  2RDQ A;  3ZFG C;  5IVV A;  2C26 A;  5JOY A;  1CR7 A;  2I2S A;  1UMH A;  3CHX A;  3MW4 A;  1H8T A;  2GU9 A;  5FPV A;  2Y0I A;  5BNN B;  3FMG A;  3AJY A;  1QDO A;  5ACA 1;  1XE8 A;  1I1E A;  3ZN6 B;  4DOU A;  4QPY A;  3C7F A;  5C8C A;  4FP3 A;  2PLV 1;  5LA1 A;  4QWN A;  3OJB A;  4HL0 A;  5F39 A;  2XML A;  3WF0 A;  1YHF A;  5IW0 A;  3M2M A;  1FV3 A;  2ZGP A;  3ACI A;  5FP7 A;  4HOO A;  4QPG C;  2TUN A;  2WNU C;  2K46 A;  5LRR A;  1QXJ A;  5JSP A;  1ND2 A;  2A7A A;  1SCR A;  1SFY A;  2QQL A;  4UFJ A;  4W6X A;  2WNV B;  2EIG A;  1W6P B;  4QX8 A;  4XTM A;  3WF1 A;  1GSL A;  2QNK A;  1FT9 A;  4ASK A;  4YAR A;  5IYY A;  4RQP B;  1O4Y A;  4FTE A;  1YRZ A;  3I7D A;  4QU1 A;  4WM8 A;  4WV8 A;  5A7N A;  2WS9 2;  3W58 A;  4Q4W 1;  3OY8 B;  4JHT A;  2ARC A;  4NHX A;  4AAX A;  4AED B;  1TMF 3;  5BNO A;  1RMU 3;  4GMP 1;  4YNI A;  3J7H A;  1WW6 A;  4RGG A;  5I8S A;  1TNF A;  2VXJ A;  2Y6K A;  3J8F 1;  4Q0U A;  3IPV B;  4N43 A;  1JZ6 A;  2Y6F A;  3WNX A;  4U2A A;  4TTG A;  5FYB A;  3LPG A;  4CUB A;  4LBN A;  1VBC 2;  1URX A;  1HQN A;  5DZE A;  3B7M A;  1IS3 A;  1YCI A;  2BGP A;  5CEH A;  1Y3T A;  2WN2 A;  3Q8B A;  5GZG A;  5FAX A;  1RUI 3;  3LA2 A;  4NMI A;  3W9A A;  4QPI B;  2OUJ A;  4Q0V A;  1PVX A;  3H7J A;  4UI9 L;  4DPN A;  4DXS A;  4UFL A;  1RUI 1;  4IEY A;  5DG2 A;  1Z0H A;  3MYX A;  4FPY A;  1VAL A;  1LEM A;  2D44 A;  4Z8B A;  3G6J B;  3AZX A;  4QPG A;  2DUR A;  3ZFE B;  4FVV A;  3CBN A;  1TNR A;  4QGN A;  3I54 A;  1FOD 3;  4XJ9 A;  2R30 A;  1AXY A;  1JBC A;  5BNP B;  1KIT A;  5HPO A;  2IXC A;  4CP0 A;  3IDB B;  5FZ7 A;  1GQH A;  3U1X A;  1KQR A;  3PTR B;  4IEQ A;  3M3I A;  1N3Q A;  5A1F A;  3AL6 A;  5IAX A;  4GUL A;  2W94 A;  1A3K A;  1ND3 B;  3MIC A;  3WZ1 A;  4I02 A;  2XJT A;  1SFP A;  2NYY A;  3MIB A;  5IUQ A;  2ZBJ A;  1XNC A;  4K21 A;  5BNO B;  2HWF 2;  1LGN A;  2VQU A;  4HT1 T;  4IEW A;  4FFG A;  3HN3 A;  4DB5 A;  3ZIX A;  4N90 A;  2WS9 3;  4Q4X 1;  4BIO A;  5L7O A;  3L2H A;  4Q27 A;  4M0H A;  2BFU S;  4YW7 A;  1RUO A;  1IOA A;  1BZW A;  5C3Q A;  4FOW A;  1HQW A;  5HBA A;  3MID A;  2RS3 1;  5J98 B;  5CB7 A;  2VMD A;  2RR1 3;  1XPW A;  2IUW A;  1M06 G;  4Q1P A;  2FDK A;  1NZC A;  2YFZ A;  1HRV 1;  1NXM A;  5C9A B;  4PBP A;  4XMA A;  4CPB D;  1ZA4 A;  4AI3 A;  1U5X A;  4XC9 A;  4AAP A;  4DEV A;  3POY A;  5HCA A;  4BQ5 A;  1RUE 2;  1QJY 2;  3AP4 A;  4QX5 A;  5ERL A;  5L9R A;  1B35 A;  2DWR A;  2XKO A;  3ZVX A;  3UJO A;  2GC2 A;  1NY7 1;  3M3O A;  2P3J A;  4NAM A;  1JMU B;  2VZ3 A;  4I0A A;  3AP5 A;  4AK3 A;  4L8Q A;  4FPK A;  2VCB A;  4B8E A;  1WCK A;  2A6X A;  1RVF 3;  4Y1X A;  1H2M A;  4AZZ A;  3I2O A;  1W90 A;  3LB9 A;  5H9R A;  1PK6 C;  3ES4 A;  2RS1 2;  1TEI A;  4HZF A;  4MOA A;  4AHY A;  3PLQ A;  1DLC A;  3WEZ A;  1W99 A;  3AZW A;  4UWD A;  2B45 X;  4YW1 A;  1H2L A;  2W87 A;  2Q30 A;  1AUY A;  2XOM A;  3DF0 A;  5FYV A;  3TRS B;  1NUK A;  1CVN A;  1UY2 A;  3LEI A;  3PU8 A;  4NWV A;  1C28 A;  3VDB A;  3B00 A;  1MQT A;  3S5Q A;  5FZ6 A;  2J7M A;  4MZU A;  2P4E A;  2W9X A;  3ZFG A;  4XJ8 A;  4IV3 A;  1W8T A;  3VBR C;  5DAX A;  1JZ8 A;  4LLO A;  4R4X A;  2CWM A;  1Q8Q A;  1UY1 A;  1EV1 1;  3I3D A;  4EN8 B;  2E9Q A;  3T4H B;  5A6Q A;  3EBR A;  2B7Y A;  3EXU A;  3RVH A;  5C8C C;  2GP5 A;  1AZD A;  1J1T A;  3T2Q A;  1S55 A;  4BQY A;  5JSO A;  1YQ5 A;  3OY8 A;  3ON7 A;  5IAV A;  1NLS A;  2E32 A;  4OI2 A;  2PQQ A;  2ZEX A;  4YFW A;  3DN7 A;  5DAQ A;  2DDU A;  5FBJ A;  5HCF A;  3WP3 A;  1W03 A;  3FFQ A;  4ONU A;  2VW0 A;  5JZG A;  2WFF 3;  3NRU A;  4Q4V 1;  3VBO B;  2PLV 3;  2HWC 3;  4C90 A;  4B7E A;  5IVE A;  1PNG A;  1PMJ X;  1MAC A;  3H42 B;  3NNJ A;  4BA6 A;  2YFU A;  3IN9 A;  3ME2 A;  4UOJ A;  3O1V A;  3LDK A;  2B8M A;  4AL9 A;  4CUC A;  1J84 A;  1IKQ A;  3KLS A;  4DRR A;  4YVS A;  4XF0 A;  1W8Z A;  2F4P A;  3SH4 A;  5KR7 A;  2XLG A;  2Y38 A;  2VUA A;  4TN7 A;  4RA0 A;  5D8A B;  4CDX A;  2ZML A;  3MIF A;  2IXL A;  2BNN A;  5FUN A;  4G4F A;  4AFM A;  4NJ4 A;  3I3Q A;  3R4D B;  3RRD A;  1QNW A;  4QQO A;  3S7I A;  4RGK A;  1T2X A;  4WM7 B;  5FZE A;  3H3L A;  2BP6 A;  1XU2 A;  2D6P A;  4GKY A;  1R1Z A;  2JG8 B;  4XEZ A;  3POE A;  5LEK A;  3DUI A;  4YM2 A;  3ZYG A;  3GCX A;  2XGX A;  5EWS A;  3VBU A;  4BE3 A;  1H2N A;  3J8F 3;  4CP1 A;  3I2D A;  3KF5 A;  3RYP A;  5FZL A;  5J96 B;  3HT1 A;  5GZE A;  2QQW A;  2ILM A;  3PVN A;  4RN5 A;  1OFN A;  1RUD 1;  1VIW B;  4IND A;  5B2G B;  5FPU A;  2YPJ A;  5FQ0 B;  5CBL A;  2ZGQ A;  2ZX4 A;  3WDU A;  3JZV A;  5C4W C;  5LCW L;  4Z07 A;  1PIV 1;  3KWV A;  3NJX A;  4D0Q A;  1DGR A;  2Z5W A;  1U5Y A;  2DUQ A;  3TEX A;  1D7P M;  1JTZ X;  1MZF A;  2QQI A;  1ZRC A;  2JDN A;  2RS5 3;  5I8Y A;  1LCL A;  2HYK A;  3ACF A;  5A1A A;  4PF5 A;  2ADD A;  1RUG 3;  1RUD 2;  4QDR A;  2MEV 3;  1SEF A;  1XYN A;  2CGN A;  2RS5 1;  3BOP A;  5KC5 A;  4AI2 A;  1BEV 3;  1GKB A;  3PUS A;  4ZON A;  4EN0 A;  1QJU 3;  1EAH 2;  1LHV A;  1W8H A;  5E8A A;  2X53 S;  3USU A;  1N3P A;  4QX1 A;  3FX3 A;  3HVD A;  2VMF A;  1C8M 2;  1QOT A;  2X29 A;  1PHM A;  3MV1 1;  5FBZ A;  1C3H A;  1T6G C;  4COW A;  3ZSE A;  4BXS V;  2JD9 A;  4LBQ B;  4OHV A;  4A44 A;  4UBH A;  3MFC A;  5JOZ A;  4YZ3 A;  3AZY A;  3PDQ A;  2JE8 A;  1QY4 A;  4OLL A;  3UKT A;  2F4L A;  2G1M A;  2XJS A;  1W9S A;  4CDU C;  1FPN 2;  1B09 A;  4LLF A;  2UU8 A;  2VMI A;  5C33 A;  1UOF A;  2VW1 A;  2CTV A;  4E2G A;  2VZ1 A;  2AZ5 A;  4RR3 A;  4BLI A;  1F31 A;  2JDU A;  4QXK A;  4HVR A;  4WM7 C;  5KHH A;  4XAE A;  3O0W A;  3NAP C;  2WSV A;  3SCF A;  3WW4 A;  1W05 A;  3ZIW A;  2AH2 A;  4N53 C;  4BH9 A;  3AB0 A;  2PHW A;  4KWJ A;  2HWB 2;  1CJD A;  3FUO A;  4FQ4 A;  5GLT A;  2JXA A;  3VKF C;  5IFT A;  3DYM A;  1UOB A;  3I3E A;  3JCI A;  4HN0 A;  3VDD B;  4EJR A;  1XOY A;  4HKW A;  1AXK A;  1WCS A;  4XFC A;  3N4M A;  2ZPX A;  4L0P A;  3V0A A;  4MLO A;  4Z2W A;  2WO2 A;  2QDR A;  4AQ6 A;  1FMD 3;  3H9A A;  4CVU A;  5AC9 2;  1F8V A;  2O8O A;  3VBS C;  2FZ1 A;  5DAV A;  3SHR A;  1WLW A;  2R04 1;  1YFU A;  3ZXK A;  4EQV A;  5K0U B;  2FQP A;  3LEM A;  3O5S A;  4Y4R A;  4UFH A;  3EMR A;  3D82 A;  1PGL 1;  2HYX A;  2VE1 A;  1UQX A;  4MX3 A;  2OA2 A;  5EV7 A;  3MW2 A;  4I2O A;  2P6H A;  4QMA A;  4BQ4 A;  1UU5 A;  4UW5 A;  1RUC 1;  3UGF A;  2D6K A;  1HRI 3;  2XHN A;  2AEY A;  1G9D A;  2Q5T A;  4CCD A;  2DBN A;  2NQY A;  2FCV A;  2XON A;  1O91 A;  4NRQ A;  5EJZ B;  2BDR A;  3ZR6 A;  3RZZ A;  4I01 A;  4N53 B;  4A3Z A;  4O7X A;  1ULE A;  1VMF A;  1Q8V A;  5LB6 A;  1SLT A;  2GME A;  2I07 B;  1CWP A;  3PVO A;  3VHO A;  5F3C A;  1BYH A;  2OT7 A;  2VH9 A;  4V1P A;  2W2I A;  2A3Y A;  3NKG A;  3WNM A;  4ES9 A;  3DXU A;  3FLT A;  5FJK A;  4XAB A;  1R09 1;  3H8O A;  3ACG A;  3PUR A;  1JYT A;  2L9L A;  1RUE 1;  3WQ0 A;  2HWC 1;  2BZD A;  3ORJ A;  2YY1 A;  5FDB A;  2VMG A;  1QQP 3;  1H0B A;  3WF2 A;  4BK4 A;  3OB8 A;  1OUR A;  1AYN 1;  3DPR C;  5CFD A;  3J26 N;  4O65 A;  1N3O A;  3IDE A;  5JOW A;  1AR8 2;  2DFB A;  1VBD 3;  4Y1Z A;  4QAW A;  1BVP 1;  4GWI A;  2VUC A;  3OGJ A;  1WCU A;  3E5U A;  5KXD A;  4A6S A;  1JU3 A;  4AI1 A;  1HW5 A;  4LHN A;  3M3C A;  2UWC A;  2WO7 A;  2Z69 A;  1E5R A;  3CZU A;  2K9Z A;  1ZRI A;  3HNB M;  1S0C A;  2QDN A;  5D21 A;  4OZO A;  3RNS A;  3JBG 1;  4R9A A;  4F8A A;  1D2Q A;  2ENR A;  5FZB A;  3NMB A;  3IPV A;  1ZA7 A;  2WZR 3;  1XSR A;  3W59 A;  4A7K A;  3KQR A;  3UL2 A;  5T5L A;  1C1L A;  3THC A;  1QXP A;  4A7Y A;  4XHB A;  5FXV A;  2WQ8 A;  3AK0 A;  5BNP C;  1OOP C;  1X7N A;  5KWR A;  2IFW A;  4LO8 A;  1US2 A;  2P3K A;  4NRP A;  4NE9 A;  3WCR A;  1NLR A;  5FOB B;  1AL2 2;  1SMV A;  3I97 A;  5AVA A;  3K3O A;  3MLJ A;  3UKV A;  4ZZ5 A;  3O0X A;  4FI9 A;  3E1F 1;  1OC1 A;  3KV4 A;  4N9H A;  3TN9 2;  1WA6 X;  2PYT A;  3QCW A;  3V0B A;  2HWE 1;  1RMU 2;  4IET A;  1VAV A;  4RHV 1;  2PHD A;  1LU2 A;  2VCA A;  4MSV A;  1XJA A;  1W0P A;  1UL9 A;  1SG3 A;  5AFE A;  4UW4 A;  4Q4Y 2;  1U0A A;  2V5Y A;  3WNK A;  1GNH A;  4CEW B;  2XWJ B;  1R08 3;  2R0H A;  3H3Z A;  1CAW B;  1DF0 A;  1XRU A;  2VGD A;  3WCS A;  3NVC A;  1VBC 1;  3K4Z A;  2WWJ A;  1E5H A;  1YFW A;  3MFA A;  4I09 A;  1QKQ A;  2MEV 1;  4RSU A;  1AR6 2;  2EVX A;  4UXA A;  4RGA A;  4AFD A;  1VJ2 A;  1YQ2 A;  2FDJ A;  5C9A A;  5C9A C;  2BTV C;  4HN1 A;  2QVS B;  4FT8 A;  1R64 A;  1F2N A;  4AGR A;  4YG6 A;  3ZSK A;  3UES A;  3AKQ A;  3N9N A;  3DGT A;  2VZS A;  3P3N A;  1OF4 A;  1UXZ A;  3X29 B;  1WW7 A;  2JEN A;  3WSO A;  1LB2 A;  2PQS A;  4H3W A;  2ZAH A;  4M3C A;  1UCX A;  3HBK A;  1AR6 1;  2XVL A;  2JG9 B;  2Q0A A;  2NPI A;  3I2G A;  2X09 A;  5FP4 A;  3IWZ A;  3ZFF B;  4HPK B;  1HB2 A;  4Z2A A;  2R7E B;  5C5U A;  4ASM B;  2GN7 A;  2UUR A;  1OA4 A;  2FMY A;  5FWE A;  2BBV A;  3K2O A;  4XUR A;  1A8D A;  2DTY A;  3UET A;  1LGC A;  3MO4 A;  4J1X A;  2XUE A;  5BPX A;  4CEW C;  4RHV 2;  1UU6 A;  4B4Q A;  1V9U 1;  1PGW 1;  4XXP A;  5IK7 A;  3VKL A;  2Q1F A;  2C4X A;  2YV8 A;  5DUV A;  3MW3 A;  3O1O A;  3MZH A;  3E6C C;  3VD5 A;  1DQ4 A;  4E27 A;  5LEJ A;  4BWO A;  4Q4X 2;  1O3T A;  5F5C A;  3C7G A;  4BPZ A;  4UW6 A;  3TBD A;  3OTF A;  2DUO A;  3B01 A;  2RMU 2;  5L73 A;  4MUV A;  4WM7 A;  2ZMK A;  3VBH C;  4BIF A;  1GZT A;  2EXI A;  1H30 A;  5FO9 B;  1LUL A;  5FMB A;  1MEC 2;  1S0B A;  4NPL A;  2QQJ A;  3ZX7 A;  4DEQ A;  4S2D A;  1HRV 2;  2OVU A;  4XIK A;  3NL1 A;  1NA1 B;  2IXK A;  5ABJ C;  5FR3 A;  3M1H A;  1F9K A;  1RGS A;  3NV3 A;  2AUY A;  5JMO A;  1DIW A;  2GSY A;  2XKP A;  1OUS A;  4GB3 3;  5FZH A;  4BU2 A;  5HV4 A;  4DXR A;  2DFC A;  5LWB A;  3BU0 A;  2RJK A;  4HFS A;  5JI9 A;  1UZV A;  1VBA 2;  4IEP A;  5EXO A;  3ZFE C;  3HR9 A;  3VD3 A;  1CZS A;  1RVF 2;  1WZX A;  4CDX C;  2O0O A;  2WDB A;  5L9V A;  5KHG A;  3OGR A;  2N7G A;  2A71 A;  1FX5 A;  4WZC A;  5A80 A;  1Z7S 1;  2Z4F A;  2BFU L;  2JB4 A;  3KD4 A;  4YWA A;  1ULG A;  3DKQ A;  4AEK A;  4JQT A;  2ARX A;  4BYY A;  4EN7 B;  2IVJ A;  4QKN A;  1OH3 A;  1HLC A;  1PVC 3;  3CLP A;  1UPI A;  1NCQ B;  1RUF 1;  2QQP A;  3VBO A;  1W8F A;  4Q0Q A;  1LOF C;  1REE A;  1DZT A;  2VUJ A;  1VBE 3;  4XFB A;  2R06 1;  1RUF 3;  3RZH A;  1H1I A;  1S0J A;  4XJZ A;  5IVJ A;  1W6N A;  2UWB A;  4PIX A;  2W0X A;  4PIZ A;  4IEX A;  2BWA A;  2NLR A;  1QGL A;  4XJU A;  2GZW A;  5T3N A;  3ZXD A;  4NOT A;  1AYN 3;  1H8T B;  1I5Z A;  3LWC A;  3GJB A;  1L7R A;  1ZNP A;  3HT2 A;  2OQ7 A;  1HV1 A;  5A3T A;  3JUU A;  5HXV A;  2WBK A;  2RE9 A;  4W8J A;  5A32 A;  1UWW A;  3HWJ A;  4CDQ C;  2ZKL A;  1RUJ 2;  2EAK A;  2VOV A;  4TLF A;  1YQC A;  4DY5 A;  4LNV A;  1EPZ A;  3IAP A;  4XFI A;  1W2A X;  3T0D A;  3KSC A;  1VRB A;  5I0S A;  4C0B A;  1TMF 2;  3F95 A;  5JAX A;  2C1F A;  1YC6 1;  2WNO A;  2ZX1 A;  1GQP A;  5F5A A;  2I74 A;  2YRO A;  3ZSL A;  2ZGM A;  3AMH A;  4BQX A;  2P6C A;  5FYT A;  4G9S B;  1ZBE 1;  5FUP A;  2VZT A;  2ZGK A;  1K5M B;  2HBU A;  1DG6 A;  1M4W A;  2QKD A;  3AZZ A;  1VBA 3;  1U12 A;  2E63 A;  2WAB A;  4LJH A;  4PLM A;  5FZ1 A;  2RHP A;  2WUH A;  5FXX A;  4CEY B;  5LZ6 A;  1WLD A;  3SEP A;  3AX4 A;  4Q4V 2;  4D7S A;  1VBA 1;  1HV0 A;  5FV3 A;  4X8N A;  2V4V A;  3LFM A;  1OA3 A;  2XL7 A;  3N9Q A;  1XBF A;  1AX0 A;  3USU B;  2J1S A;  1ULD A;  1ZZ7 A;  2JJ6 A;  3IIA A;  1YNA A;  1O5U A;  5JIU A;  3PUH A;  4CYD A;  3KHB A;  3K46 A;  4ZU7 A;  1XNK A;  3FHI B;  3AMN A;  3VN4 A;  1W3X A;  4CXX A;  4YZ4 A;  4CDU B;  1DGL A;  5EQU A;  2O1Q A;  4CSW A;  2EIC A;  4GXL A;  1VRH 1;  4C1X A;  1KJR A;  4DY3 A;  2UY9 A;  1O4T A;  2NM1 A;  3I3B A;  3OUH A;  1W0N A;  3QBQ A;  5LK5 A;  4Q0P A;  1JYN A;  1ENS A;  2D6N A;  1SBF A;  4MGS A;  4LBJ A;  1ZBA 1;  2O8Q A;  4A7Z A;  2VUD A;  4SLI A;  5JXH A;  3LF7 A;  2PFW A;  5L7O B;  3O1M A;  5FYH A;  3QH6 A;  3BB6 A;  1PIV 2;  4JGY B;  4AVV A;  3IT8 A;  1HJF A;  4ARX A;  3PME A;  1SZB A;  4QQH A;  2XXZ A;  3BTA A;  2JB8 A;  1CPM A;  3N7J A;  4Q4W 3;  4AI0 A;  3CZJ A;  1U5Z A;  2GNM A;  4C0H A;  4GIQ A;  1IS6 A;  1YI7 A;  3WW2 A;  1NA1 A;  1SDW A;  4QGL A;  2R6Q A;  1WKY A;  4FO9 A;  3HEI A;  1POQ A;  4XBL A;  1QJF A;  5FWJ A;  4UYB A;  2GC0 A;  2D7F A;  2P37 A;  1ODM A;  5DDJ 1;  1YI9 A;  2C9K A;  1QJX 2;  2JEC A;  2ARB A;  1MZ6 A;  2VQT A;  3E5Q A;  2QJV A;  5C3S A;  3BYW A;  4CUG A;  5D1I A;  4BMB A;  2B9U A;  2DVF A;  1PZ7 A;  4XUQ A;  4R9D A;  1LNS A;  3M3E A;  3TYJ A;  3T30 A;  3VKM A;  2OPW A;  1TME 2;  4RYD A;  2ZAC A;  4IL7 A;  1L7L A;  2ORZ A;  2ORX A;  3E5X A;  5DZG A;  2EXJ A;  1DGW X;  1O8S A;  3CF6 E;  3BIE A;  4QX2 A;  4KH9 A;  1W9W A;  3FWE A;  1CAX B;  1QJU 1;  4JGZ A;  4W6Y A;  1JUH A;  2VOT A;  3DPR B;  5EIY B;  5HI0 A;  2MPF A;  4KWK A;  3I3M A;  2ET7 A;  1YUD A;  1Q43 A;  2J1V A;  2VZQ A;  3OEB A;  1OH4 A;  1GWK A;  1SLI A;  4FQZ A;  4GH4 A;  1LED A;  1SLL A;  3VZK A;  4Y20 A;  5DQ0 A;  2B5H A;  2PHU A;  3H8U A;  2J1U A;  3H0O A;  3KV6 A;  4QHB A;  2ARE A;  2HWE 2;  4QKF A;  5FZ8 A;  1X8M A;  3T3Y A;  4AFB A;  4AWD A;  1K42 A;  2VJX A;  1DBN A;  4Z92 B;  2ZGT A;  1BK0 A;  1S0I A;  5DN2 A;  3PUI A;  3FZ3 A;  2OPK A;  1ULC A;  1ZM1 A;  3RZL A;  3WUD A;  1FMD 2;  3M70 A;  3OPW A;  1FAY A;  4MXV A;  1COV 3;  1EUT A;  2WJS A;  4Y5T A;  3AL5 A;  1UYP A;  4DXZ A;  4XW3 A;  4MG2 A;  4UFK A;  4K7J A;  3VBU B;  1BKZ A;  4PHZ A;  4CDW C;  1DDL A;  2XBO 3;  4JQR A;  2XJP A;  5KXC A;  2W91 A;  2RM2 2;  4AEJ A;  4QX7 A;  1NOV A;  4XBQ A;  1CD3 G;  4QU2 A;  4JKM A;  3BPZ A;  1F15 A;  4AHZ A;  1OA2 A;  1OOP B;  1ST8 A;  4JAA A;  1I5P A;  3SLI A;  1XXN A;  4JRL A;  4NHL A;  5CZK A;  1LOD A;  2JKX A;  4JDN A;  4YW6 A;  3UGH A;  3KMH A;  4WVM A;  5FMD A;  3D6E A;  3N7L A;  5IK8 A;  5FP3 A;  1XQN A;  3DYO A;  2ARA A;  3RJ2 X;  5GM0 A;  5KBF A;  4YVS B;  1CAX A;  1V6I A;  3OEA A;  4I30 A;  4MXW A;  5G04 L;  3VBR A;  3GHN A;  4OUE A;  1HB1 A;  1RXF A;  2PXJ A;  4BB3 A;  4CDX B;  1AR7 2;  1Q8S A;  1ASJ 1;  1EYB A;  4RS5 B;  1DYP A;  2WNU A;  2UY8 A;  2BVV A;  3USS A;  5C8C B;  5A7Q A;  3KGL A;  1HIX A;  5LA0 A;  1HRI 1;  4NR1 A;  1RUH 3;  2VY0 A;  2AR6 A;  1H1A A;  3SC7 X;  2YPD A;  2ZGO A;  1CJP A;  1LOA A;  4M00 A;  5FZ9 A;  4OMC A;  1IHM A;  1LTE A;  3T09 A;  3WNN A;  4B1M A;  3WG2 A;  5GLU A;  1W2N A;  3MIE A;  1ZRR A;  2E6V A;  3THD A;  2KR2 A;  4CDQ A;  1MZE A;  3IBM A;  3CJI A;  3ZYP A;  2R07 2;  1F4A A;  2CU5 A;  4P9J A;  1Q5O A;  5K0U C;  1Y43 B;  2DV9 A;  4PCR A;  1AX1 A;  1MZ5 A;  3GXU A;  1NAE A;  1OOP A;  2MNG A;  5CG8 A;  1GUI A;  1SPP B;  1LJ7 A;  4NIG A;  5FZO B;  1IG0 A;  4CCC A;  1DQ6 A;  1AX2 A;  1MPX A;  4M3C F;  5ISL A;  1FOD 2;  1JU4 A;  4CA9 A;  4DIN B;  3W5N A;  2QE3 A;  5A3U A;  4P9L A;  2W68 A;  1UMZ A;  4P08 A;  4EZ4 A;  2WZR 2;  4MHR A;  5A3O A;  4ZKT B;  1GFF 2;  5FXZ A;  4FSJ A;  3B94 A;  3PU3 A;  4ERO A;  3ZYF A;  3FUQ A;  4UAP A;  2JG9 C;  3ZMN A;  1NCQ A;  5L36 A;  1RIR A;  1PX3 A;  2MEV 2;  2D98 A;  1C8N A;  3RJR A;  1AYM 3;  4M0N A;  2JKB A;  1KXG A;  5C3P A;  5BNO C;  3VHP A;  3Q8A A;  3GF6 A;  3NKT A;  3VL9 A;  5C4W B;  1WMX A;  3NNM A;  1RYY A;  2ZCW A;  3D0S A;  3Q9O A;  4RFT 0;  3SCG A;  4QXH A;  3SNM A;  2Y0O A;  1ZBE 2;  1KRI A;  1W04 A;  1NCR B;  2RS3 3;  3CQO A;  4N8M A;  2E31 A;  2CYF A;  4LR4 A;  3S0M A;  2ERF A;  4HXC A;  1X50 A;  3ZSM A;  1GV9 A;  1PK6 A;  1IQD C;  1ASJ 3;  2VW2 A;  2RJL A;  1CAV B;  2VC9 A;  1NLQ A;  1UMI A;  4HVO A;  4LBL A;  1OHF A;  4IGQ A;  4GMP 0;  4K40 A;  3VZM A;  4XXA A;  4YG0 A;  4CTE A;  1APN A;  2NZ9 A;  5LBB A;  2VMH A;  2Y26 A;  5A3N A;  2DVB A;  3FBY A;  2VOK A;  4WVV A;  1AL0 G;  1OLM A;  2A3X A;  2XVG A;  3VL8 A;  3LCP A;  4MVT A;  1B35 C;  2D93 A;  4XHX A;  2DF7 A;  1RUD 3;  3AKP A;  5CFC B;  1S0F A;  2BOI A;  4O61 A;  5HCB A;  4BQW A;  1UX6 A;  1HN1 A;  4WBB A;  1EAH 1;  4DMI A;  1A8M A;  2WC2 A;  1O3Q A;  3WHT A;  4AOC A;  1ZYB A;  1QJU 2;  5FPL A;  4K1Z A;  2JIC A;  2RG4 A;  1S0G A;  3HNY M;  4BCU A;  1QDC A;  1UAI A;  1IKP A;  4F7Z A;  2R16 A;  3BI3 A;  4IV1 C;  4ISR A;  4IV1 A;  4URT A;  4KQ7 A;  1X9T A;  1W8O A;  4XZU G;  2RDR A;  4XFA A;  1FPN 1;  3VHN A;  4CDW A;  3UNP A;  4IES A;  1LGB A;  4KMQ A;  1TG7 A;  3ECQ A;  3ZXG A;  1S2B A;  3AMP A;  2Y6H A;  2CL2 A;  2DU0 A;  3NV4 A;  4YPJ A;  2QQM A;  4LXL A;  2OX0 A;  2Z42 A;  3ZR5 A;  3VBR B;  3QOP A;  3PIG A;  3P5B A;  1V6J A;  4IGP A;  2VNO A;  3WF3 A;  1FV2 A;  1XU1 A;  3E97 A;  1X36 A;  3O7O A;  4HMZ A;  3O0V A;  2A6Z A;  4M4R A;  2KD7 A;  2GP3 A;  4AVB A;  4IDZ A;  1IPS A;  4QPI A;  5FY1 A;  4LKS A;  1BMV 2;  4A6O A;  4ZZ8 A;  4HKO A;  2E7A A;  3QLQ A;  4XDQ A;  2C24 A;  1H8T C;  4IEZ A;  2XLA A;  4UF0 B;  5FCC A;  1HRV 3;  2WFF 2;  2D5H A;  3RWK X;  2WYF A;  1W6M B;  2HEV F;  2VME A;  3SIS A;  1TVG A;  1VBB 1;  4NWW A;  3UJQ A;  3VBO C;  2DCJ A;  4I0B A;  4M01 A;  3VZN A;  3VBF A;  4YZ5 A;  4OQ8 A;  3ZPY A;  4XUP A;  1PM7 A;  1RXG A;  1RIN A;  2BER A;  2XHK A;  4YFZ A;  1MR5 A;  4YGC A;  2P34 A;  4BIS A;  2WQ4 A;  2XB6 C;  3BTX A;  4M3C B;  5T5P A;  3U4X A;  3ZYR A;  4BME A;  1X8E A;  1UY4 A;  2D97 A;  2JE9 A;  1VRH 2;  2ZXQ A;  4QQP A;  3CO2 A;  1HRI 2;  4YVS C;  2QCS B;  2VQA A;  5F8P A;  1QXR A;  2Y33 A;  4FPE A;  5K4L A;  5A7W B;  4YRD A;  1POV 3;  2Y6L A;  4CCL A;  4JGZ B;  3A4U A;  2HWD 2;  5DAB A;  1DQ1 A;  2XR4 A;  4IEU A;  1UIJ A;  3WDT A;  5AVP A;  4M3C E;  1XYO A;  3K77 A;  3K3N A;  4MGQ A;  1D0H A;  3V65 A;  1WME A;  3KGZ A;  4JC1 A;  1Z7S 3;  1EV1 2;  1UY3 A;  3TOJ A;  3T2O A;  2HWB 1;  1AR9 1;  4AQ2 A;  2VAU A;  3KM5 A;  4YW4 A;  3HBZ A;  3B5L B;  5F3I A;  5E1R A;  4EWA A;  2IC1 A;  1RUJ 3;  1AR9 3;  3WT3 A;  2V73 A;  5LY2 A;  3OUJ A;  4GJZ A;  4I3P A;  2ATF A;  4HK8 A;  1VBC 3;  1Y7B A;  3R0R A;  4JKL A;  2BNO A;  1AVB A;  1NCR A;  1XNT A;  2W39 A;  4I3G A;  1RUJ 1;  4CCM A;  3RMY A;  4P9X A;  4AQT A;  1JOD A;  1JI6 A;  3HNM A;  2SBA A;  1FYU A;  2XG3 A;  4NHK A;  5DZF A;  4LUL A;  4Q29 A;  3K4D A;  2B9V A;  1YXW A;  1VE0 A;  2V4A A;  3OCP A;  4CUA A;  1GYK A;  1SLB A;  3GDB A;  4UFM A;  1LRH A;  1R08 2;  1OFS A;  4Q4V 3;  3NNF A;  5J37 A;  2PHX A;  2R06 2;  2XQX A;  4F3J A;  2GNT A;  4FPJ A;  3GGL A;  3AMQ A;  1QH7 A;  5L9B A;  4NAO A;  3DKW A;  1Q8P A;  1UF2 C;  3O12 A;  5FK8 A;  3INA A;  3KB5 A;  5CAD A;  3F2Z A;  3ZFF A;  1WGP A;  4IV3 B;  4N43 B;  3FLP A;  3ZFE A;  1VAM A;  4E8D A;  3GZU C;  4J6G A;  1NQD A;  1GR3 A;  2HH9 A;  1YJK A;  2JIJ A;  1MS8 A;  3U75 A;  5IHR A;  2R07 1;  1YLL A;  1VP6 A;  4R52 A;  1ONA A;  1EP0 A;  4FFF A;  5C3O A;  3OGG A;  4TLG A;  3MIH A;  1NZI A;  1X82 A;  1Z7S 2;  3EB7 A;  1UU4 A;  3EQE A;  5I8T A;  3ILN A;  1JZ5 A;  4H7M A;  4LIU A;  3TEY A;  2RVA A;  1W9T A;  4IQP A;  4XET A;  4LMF A;  2G19 A;  1DYK A;  1WUV A;  3POB A;  3R4U A;  5I91 A;  4HSJ A;  3C7E A;  1JOP A;  5IVY A;  2DCY A;  4CDQ B;  4GWM A;  4QPG B;  4AQS A;  2VVE A;  1D4M 3;  4I0W B;  5F1R A;  2WNU B;  1VBB 2;  2PAE A;  1QHD A;  2OYZ A;  3NWK A;  1F35 A;  5FZD A;  4FCA A;  3OGV A;  4X6Q B;  5CU1 A;  1JOB A;  3NAP B;  4ZXK A;  5I0U A;  1ENR A;  4NID A;  5BUV A;  2RDN A;  4S2F A;  3ZM8 A;  2OXB A;  4CCJ A;  3K4A A;  3B69 A;  2F17 A;  3D3A A;  2LS6 A;  1V6L A;  3EO6 A;  4CU9 A;  3WDW A;  1ENX A;  3HQX A;  4HK9 A;  4N43 C;  1POV 1;  3PNA A;  3GNE A;  3AP9 A;  4QX3 A;  1MEC 3;  2HKX A;  4LKF A;  1W8W A;  1QNY A;  4UT5 A;  1OPO A;  2QQV A;  4L11 A;  2OZJ A;  5EJ3 A;  2GH8 A;  3NJZ A;  4KNC A;  5H9Q A;  3ACH A;  1G9A A;  1UIK A;  4WVZ A;  3WD5 A;  2KXL A;  1PO2 3;  3ACL A;  3VDD A;  1UKG A;  3POI A;  5FMO L;  2BGC A;  2EAL A;  1PMH X;  1P8J A;  4BLJ A;  1K5M C;  3PJY A;  5LBC A;  4M4P A;  2FCT A;  2ZJC A;  3NJV A;  3U10 A;  2VTF A;  4XFF A;  3ZXA C;  1JHN A;  1XE7 A;  4JRA A;  2PAM A;  2V5D A;  5FQ0 A;  1W0O A;  4Q2F A;  1R09 3;  4GAL A;  3POW A;  1UZW A;  2IXI A;  4PQ9 A;  4RS5 A;  5A7W A;  2VNG A;  1QF3 A;  1R1A 1;  4QDQ A;  4DQA A;  4WM8 C;  1U5I A;  4XF1 A;  4CP9 A;  1CN1 A;  3UK9 A;  3PJQ A;  4D69 A;  5FXW A;  4AVA A;  4OCT A;  4FOY A;  2VZR A;  5AC9 1;  2QQN A;  2RMU 3;  5FY5 A;  2IZW A;  2GNB A;  1VBB 3;  2FCU A;  4OHW A;  5C4W A;  3ZKY A;  5FRA A;  3NV2 A;  3RI8 A;  1WBF A;  4NHM A;  3IDA A;  3WNL A;  2XBO 2;  1F5F A;  4LKE A;  4LO7 A;  5T52 A;  1LAJ A;  4QKD A;  3BKZ A;  3VBF C;  2QQK A;  1H9P A;  3WP5 A;  1PO1 2;  3O1U A;  2RS1 1;  1BK1 A;  2Q8O A;  4PI0 A;  4AED A;  1NE6 A;  1OQ1 A;  4D6R A;  3GHM A;  4FPL A;  1FXZ A;  4DZG A;  1W8U A;  5JMC A;  5FZO A;  1DQ2 A;  3TN9 1;  1NKG A;  3RPQ A;  1GNZ A;  1NCQ C;  3I2J A;  3VDA A;  4FXK B;  2D40 A;  5APA A;  3HPN A;  4CU8 A;  2X5I B;  3AP7 A;  1KJL A;  1RUG 2;  4L9B A;  2R0F A;  2GND A;  3WDV A;  5F9T A;  1WW4 A;  3CJI C;  5FP8 A;  2HWF 3;  5DXD A;  1UOG A;  2JDP A;  4DIQ A;  4FFH A;  4FTS A;  4Y22 B;  5A3M A;  1WCD J;  5C70 A;  5FZA A;  3PVB B;  3WDY A;  1WMD A;  2CDP A;  3ZXJ A;  4XZP A;  3IMM A;  3LSD A;  1OUX A;  5J09 A;  1UD1 A;  2ETE A;  4IXL A;  1POV 0;  5JOX A;  1KFX L;  3WNO A;  3J4U H;  2H6B A;  2FZ2 A;  2VCM A;  5FPX A;  1PO2 1;  1OLR A;  3OBR A;  3N7M A;  4HAN A;  3POJ A;  1A6C A;  1ZZ8 A;  4XFG A;  3KF3 A;  4CRQ A;  1W9Y A;  1Q8O A;  3V64 A;  3U37 A;  3CL1 A;  2DTW A;  3I2H A;  1RUE 3;  1B35 B;  2D3S A;  3DV8 A;  4FPF A;  4JKK A;  2VZV A;  1D2S A;  2WFF 1;  4H14 A;  4RL7 A;  1LHN A;  3J9S A;  3K48 A;  3OD4 A;  5GZF A;  5A3P A;  1TQ5 A;  2IVI B;  1BBT 1;  4CDU A;  3V56 A;  2H6C A;  2B4K A;  2LUW A;  1AYM 1;  5GAL A;  3ZOI A;  3JBG 3;  3AXD A;  4CXY A;  1C5H A;  1JXN A;  4MAD A;  2BBA A;  2RR1 2;  4J1W A;  4MH0 E;  4WVM B;  3TNP B;  3LEG A;  3AVR A;  4QM8 A;  3TEZ A;  4UBG A;  2D6L X;  2BVB A;  2PA7 A;  1N1T A;  2DCT A;  1IZ3 A;  3AFK A;  2WR9 A;  2WT0 A;  4GA9 A;  4W50 A;  3WW1 A;  2YBP A;  1OLQ A;  4IEV A;  5EPA A;  2XQR A;  5FY0 A;  2VBD A;  4E8C A;  5GLW A;  4NIA A;  1HB4 A;  5J48 A;  2NMN A;  1G7Y A;  3VV1 A;  2CWS A;  2WA4 A;  2XLF A;  1KFU L;  3IMN A;  1RUC 2;  3VZO A;  2Y34 A;  4CCO A;  3VBS A;  2XJQ A;  1AJO A;  3TNQ A;  2JD4 A;  3WG4 A;  1JYW A;  1HN0 A;  5C7G A;  5JLV A;  2RS1 3;  2BPA 2;  2E33 A;  1OD5 A;  1TME 3;  3OPZ A;  2W1Q A;  1R08 1;  5JR2 A;  3DEC A;  4RR3 C;  1C57 A;  4D8M A;  3OUI A;  2YGM A;  3UV9 A;  2VNR A;  1PMI A;  3URF A;  3KV9 A;  4LEJ A;  4MGZ E;  3J7M A;  3S6P A;  2JG8 C;  1XSQ A;  4ZS3 A;  1G9B A;  2ADE A;  1V00 A;  3KQ4 B;  2VOW A;  2B42 B;  2E7T A;  2WIN B;  1IS4 A;  5FPA A;  1RUG 1;  2RV9 A;  2WLQ A;  5JVV A;  2WQZ C;  5AFB A;  2FDF A;  1LOB A;  3JD7 3;  2JDZ A;  4FP2 A;  5DUW A;  1KGY A;  5F2W A;  4AHX A;  3RI9 A;  1ZZ9 A;  1VBD 2;  4OYU A;  1WMF A;  2GN3 A;  4XFH A;  3P3P A;  3O1S A;  5HXM A;  3T4V A;  3WV6 A;  2HEW F;  4XCB A;  2VR4 A;  3AM2 A;  4ZU4 A;  1GP5 A;  4PIY A;  3IZO A;  5C8W A;  4QB1 A;  4XF9 A;  3UGG A;  3OYW B;  5CKM A;  2RDS A;  2YMZ A;  4LE4 A;  1J59 A;  5BV6 A;  2YG0 A;  2RM2 3;  2WZP P;  5K9Y A;  1OKQ A;  4XDP A;  4V2V A;  4AXO A;  3LEK A;  3GM8 A;  4K9S A;  3SIT A;  4Q26 A;  4FPC A;  2AEN A;  3E6D A;  2XUM A;  1VBE 1;  5IFP A;  5JPN B;  5DUU A;  1L3J A;  3ZYI B;  2FMD A;  1H4H A;  4QXC A;  4YM3 A;  5FMC A;  5KHK A;  1VB4 A;  2BYV E;  3MPB A;  3IM0 A;  1NT0 A;  5FYS A;  1XB9 A;  3DCQ A;  4LA3 A;  3WIN E;  2WWS A;  1FOD 1;  1I6X A;  4KL1 A;  2J1R A;  3ABZ A;  1H6X A;  4SBV A;  2YGL A;  1XNB A;  2ZAB A;  4LA2 A;  1S0D A;  2EIE A;  3N7K A;  4AVT A;  4CCK A;  2WT1 A;  1XNA A;  2JDH A;  2ZMN A;  1OQE A;  3TN9 3;  2OII A;  2HBT A;  4TWT A;  2ZEY A;  3H50 A;  2O14 A;  3LSE A;  4QD2 A;  2FDG A;  1COV 2;  5T50 A;  1J58 A;  1V0A A;  5A33 A;  2YBK A;  3HIF A;  3ROU A;  5I0D A;  4E2Q A;  4N7U A;  4B4R A;  1CZT A;  5A32 B;  1FI2 A;  3III A;  3LZZ A;  4QB6 A;  2W1S A;  2UYA A;  3LD8 A;  4RFR B;  3H1W A;  4JTN A;  4QQL A;  1WW5 A;  2JE7 A;  3N9L A;  2NN8 A;  1X33 A;  3AYE A;  4DUX A;  5J1X A;  1H2K A;  3WR0 A;  3ELN A;  1CAV A;  3O14 A;  5FZ0 A;  4FAH A;  1GP6 A;  2LTN A;  4Y5Z 0;  2WL1 A;  1QU0 A;  5ANQ A;  5JCT A;  2YXS A;  1HQL A;  1G86 A;  3RQ0 A;  2A5Z A;  5FYM A;  5A70 A;  1NX9 A;  4BQ1 A;  1UYX A;  2AYH A;  2ZHM A;  2Q8C A;  2YBS A;  3H7Y A;  1EPW A;  5F5Q A;  3B9C A;  2G4I A;  1F4H A;  3S30 A;  4GJY A;  4LIV A;  2HWD 3;  3T2P A;  4DO0 A;  3PL0 A;  1LR5 A;  1YEW A;  5ACA 3;  1VMJ A;  4YZ2 A;  4RD7 A;  1RTV A;  1GAN A;  1OD3 A;  4LPL A;  5E89 A;  4OI1 A;  1D0G A;  1V6O A;  4B4P A;  4YZ1 A;  3A23 A;  3TWI A;  4NPM A;  1QEX A;  1RHI 2;  3JQW A;  4Y1Y A;  4FOQ A;  1D4V B;  1RED A;  4EN9 B;  5C71 A;  3RZG A;  1UOJ A;  1CQ9 A;  2C0Z A;  4AI9 A;  4EYU A;  1SBD A;  1AR9 2;  1UZZ A;  1YJL A;  2LW8 A;  3BPS A;  4YYO A;  5L7O C;  2LRP A;  1DFQ A;  1ND3 C;  4MHU A;  1CIY A;  4A42 A;  2PMW B;  1LOF A;  1RB8 G;  1VBD 1;  4PLO A;  3DL3 A;  1SAC A;  2ZHL A;  1IS5 A;  1W6O A;  3AXE A;  2VQ0 A;  4LT5 A;  1BBT 3;  4K8R B;  4Q1R A;  2WYS A;  1YIP A;  4H7L A;  1AR6 3;  2WN3 A;  3R4S A;  2XVK A;  4IER A;  4PLN A;  5LBF A;  2HWB 3;  1KDM A;  2R49 A;  3ZXF A;  3FC0 A;  4ITC A;  3AKR A;  1MS0 A;  2W47 A;  2W46 A;  4MGY E;  3WQ1 A;  2EXK A;  1FNZ A;  4L97 A;  4NIH A;  3ST7 A;  2CSG A;  3GJA A;  4FPG A;  1DGW A;  1HXS 2;  3KZ4 C;  4EV0 A;  2NP0 A;  2D3P A;  4NVP A;  1CPN A;  3WQ7 A;  5T5O A;  4Y1U A;  4Q8K A;  3UKN A;  3AKT A;  1BQP A;  3C3V A;  1OF3 A;  1HKD A;  1CES A;  1LHW A;  1PK6 B;  5D2A A;  5BXX A;  3WOG A;  5A6Y A;  1OT5 A;  4OI0 A;  1IQA A;  2CHH A;  5FLJ A;  2J1E A;  3B02 A;  1WWY A;  4P9W A;  5CKQ A;  1YIF A;  5FZF A;  4CU7 A;  3NAP A;  4ASL A;  2FDI A;  1GOH A;  2CGP A;  5ACA 2;  1VAK A;  4ARY A;  4NPR A;  3C8X A;  4S2H A;  4AVS A;  1HB3 A;  1GWM A;  1QQP 2;  4W6W A;  4AGV A;  5DPN A;  2D43 A;  2VMC A;  3VD4 A;  3U14 A;  3AYC A;  2HWE 3;  1FNY A;  3HQR A;  4DRV A;  2J1T A;  2WS9 1;  4Q4X 3;  1PVC 2;  3WF4 A;  1ZRD A;  4GWN A;  4QHO A;  3BAL A;  3VLB B;  5A6X A;  3M8L A;  1W6O B;  4QHZ A;  2BJS A;  2WNV C;  5BYN A;  3NNL A;  3LE0 A;  3BTY A;  1QJZ A;  1ULP A;  2E51 A;  2VM9 A;  3GZA A;  1RUF 2;  1LEC A;  2DBI A;  4MV2 A;  3W21 A;  1VR3 A;  1MQT C;  1QJY 1;  2W1U A;  1SDD B;  5M0T A;  4HPK A;  2JDK A;  3Q8C A;  1ZX5 A;  2PLV 2;  5KXE A;  1RIT A;  4HSL A;  4CDW B;  4OMD A;  3WY6 A;  5F6K A;  5FY4 A;  1DU3 D;  2V09 A;  2DYC A;  4P00 B;  5FFO C;  1NYW A;  2WA3 A;  4Q8L A;  1W6M A;  1UXX X;  3MGU A;  3WXP A;  4EZH A;  3A0N A;  3IAQ A;  5IVC A;  5CG9 A;  4EWE A;  5B4X A;  2X05 A;  3QH7 A;  5FYZ A;  4IE7 A;  3VBF B;  4URA A;  1PZ8 A;  2BUK A;  2ZAA A;  1GZ9 A;  2X10 A;  4GMP 3;  4D7T A;  2OZ6 A;  4ZPI A;  3OF1 A;  4CP9 B;  1ZBA 2;  2WFP A;  3A22 A;  4LHK A;  3ALQ A;  2DCK A;  1H1M A;  3POG A;  4YGD A;  1CON A;  2E53 A;  1PO2 2;  3ASI A;  4XIO A;  4GZ9 A;  1UN1 A;  1R1A 3;  1XYP A;  5D8A C;  1EAH 3;  3ZLI A;  1Y9Q A;  2DCZ A;  4J25 A;  4XUO A;  2ZEZ A;  2A6W A;  3KHC A;  1PZ9 A;  1BVV A;  4LOT A;  1W3V A;  1W2O A;  4FXG B;  1AR7 1;  2H0B A;  2BW8 A;  4LOR A;  2Q8D A;  1LHU A;  5H9P A;  5JSR A;  1AHS A;  2RMU 1;  3PIJ A;  3B93 A;  4LTA A;  5LW9 A;  1GMM A;  5K0U A;  2Y8K A;  2I45 A;  4COY A;  1G8W A;  1G6N A;  5EFU A;  1LKN A;  3RFR A;  1JYI A;  1I3H A;  3AZV A;  4Y1V A;  4JGY A;  4JGY C;  3VD9 A;  1CAW A;  2XPJ A;  4ATF A;  1N1S A;  3VKN A;  5FY9 A;  3SEE A;  2DVG A;  2AC1 A;  2YZ4 A;  3MI8 A;  4K1Y A;  4LQR A;  1J3R A;  4OFG A;  4QPW A;  1MVQ A;  5A7P A;  3P6B A;  5A7S A;  1GZC A;  3H1M A;  3VBH B;  4NRO A;  4W65 A;  3ZXL A;  2F6B A;  2ZA9 A;  1V6K A;  2CAV A;  2K2S A;  3CJX A;  4GKX A;  1MS9 A;  3AYA A;  3T1M A;  1UYZ A;  3GZT B;  5J3U A;  3LAG A;  5IWF A;  1QOS A;  4YM1 A;  5FKB A;  3T1L A;  3HAG A;  1SFN A;  5JWP A;  4IE6 A;  4LHL A;  4GAZ A;  3LOI A;  1RC6 A;  4D94 A;  3CU7 A;  4TYS A;  4D3W A;  1S2E A;  1VMH A;  1DLL A;  2ZEW A;  3AC0 A;  4MO3 M;  4DFS A;  1JOJ A;  3T0A A;  5FOJ B;  3JU9 A;  5GZD A;  1GZW B;  3ZFG B;  1C8M 3;  3L2Y A;  2A1X A;  4PDW B;  4W4Z A;  1HJG A;  4P14 A;  4ATE A;  3H1Y A;  1BXH A;  5FYY A;  5B4N A;  2H0V A;  5DMY A;  4Q4W 2;  3FJS A;  5ABJ B;  4YW2 A;  1MVE A;  2YU2 A;  2R04 2;  4LO5 B;  2VPV A;  4JV4 A;  1E5I A;  5A3W A;  5FIX A;  1VRH 3;  5FO8 B;  3M7A A;  3SH5 A;  1UX7 A;  3RYR A;  5JUV A;  3ZN5 A;  2P3Y A;  2G9Z A;  4LK7 A;  5CIR A;  2QQU A;  3WX5 A;  1V6N A;  2YU1 A;  1RJ8 A;  2CGO A;  3B3Q E;  5KXB A;  1GU3 A;  3WQB A;  2BU9 A;  2R06 3;  3ZDS A;  2YB7 A;  4R9B A;  3MDP A;  2X8K A;  4IW3 A;  1SLC A;  5EP9 A;  2SLI A;  4XYX A;  5FLH A;  1ZRE A;  3B9I A;  1SPP A;  1DYO A;  2JX9 A;  1LEN A;  2JG9 A;  2RS3 2;  3Q8F A;  4FOV A;  1BJQ A;  4JGZ C;  4L92 A;  1QJX 1;  1RVF 1;  2WII B;  5DAP A;  3THT A;  1WA4 A;  1YQ6 A;  4GD4 A;  1AJK A;  2YHJ A;  1AF9 A;  4B1L A;  2ZHK A;  4B7K A;  1DQ5 A;  1OXC A;  3L9J T;  1O4Z A;  4BJ0 A;  2VVD A;  4GB3 2;  3ES1 A;  4ZXE A;  2BGO A;  4RHV 3;  3I59 A;  3LDB A;  4YVW A;  4CCN A;  4KI5 M;  3ZN6 A;  2W1W A;  1UYY A;  2Y6J A;  4JHZ A;  1G9F A;  4BK5 A;  3MV0 1;  2HLE A;  3ZYJ B;  1A78 A;  3H8X A;  2QBX A;  2Y6G A;  1ULO A;  2VZP A;  2A75 A;  2QQO A;  4ZU5 A;  5FZM A;  5GLV A;  2GMM A;  3T08 A;  1BEV 1;  4HG6 B;  4BZ4 A;  4CP2 A;  2W52 A;  3OG2 A;  1JS9 A;  5FZC A;  3MEP A;  5H9S A;  2X5I C;  2PN5 A;  1GWL A;  1PGW 2;  4RQP A;  2E7Q A;  5CA6 A;  2ZX0 A;  4ZHN A;  4MET A;  4CZS A;  1LOC A;  2D5F A;  2Q8E A;  3RWN A;  3K51 A;  3POF A;  1O7F A;  1W2U A;  2B39 A;  3MLL A;  3N35 A;  4X8P A;  4QX0 A;  3LA7 A;  4U36 A;  1ACC A;  3CEW A;  1UZ0 A;  1W6N B;  1WLC A;  4YG3 A;  2VD7 A;  5IVF A;  1SLA A;  1LOE A;  2JG8 A;  4KWU A;  3LPF A;  2YUE A;  2EID A;  3BGA A;  4LUK A;  4AI8 A;  2OUH A;  5FY8 A;  1H8V A;  2OQ6 A;  1KEX A;  1W8N A;  2GC3 A;  2Q4S A;  3EJK A;  1TE1 B;  2BWC A;  4XDO A;  3KT4 A;  4RS5 C;  2XJU A;  5EZW A;  3ENR A;  1OBN A;  3JB8 A;  4TXW A;  4XUT A;  4WVW A;  4Y22 A;  1UZY A;  3MUZ 1;  2Y60 A;  1MS1 A;  4Y3O A;  5EJ1 B;  4EWD A;  1O3R A;  2CNA A;  4LBM A;  1JZ7 A;  2ZGL A;  4LUM A;  3CNA A;  3MF6 A;  1D4M 2;  3SKJ E;  1VBE 2;  5GJ6 A;  3FN9 A;  3N9O A;  4NN0 A;  4QXB A;  2GC1 A;  2ZHN A;  1CAU A;  3CKH A;  3VD7 A;  3TEW A;  2W95 A;  2Y64 A;  5FUI A;  2VNV A;  3SXW A;  4AW7 A;  1VPH A;  1OPM A;  3JD7 2;  1JZ2 A;  5K8S A;  5KC6 A;  1YO8 A;  2B46 X;  1RJ7 A;  3N9P A;  4BQ2 A;  3A7Q A;  5LA2 A;  2GH2 A;  1GOG A;  3M4F A;  4O9G A;  2UYB A;  5F2S A;  5F7U A;  3D4K A;  1WBL A;  4TZD A;  3MPP G;  3MUY 1;  3PVE A;  1RHI 1;  2W3J A;  2WZ8 A;  1DHK B;  4LIT A;  3RSJ A;  1WD3 A;  3WLU A;  2WKK A;  4NUB A;  3FHA A;  1AL2 1;  4IEO A;  1T6B X;  3ETQ A;  2ZTN A;  2PHL A;  3LQC A;  2IXH A;  1ZZB A;  3TB0 A;  3UT0 A;  1JYC A;  1LES A;  1STM A;  4AF9 A;  2YC0 A;  4D7Y A;  3J7L A;  1BEV 2;  1QIQ A;  4IE5 A;  2P2K A;  1AL2 3;  3KV5 A;  4LOS A;  1MS5 A;  4PT6 A;  4WM8 B;  5C5T A;  2QZ2 A;  1OVS A;  2K0G A;  4JZR A;  4R8H A;  1ENQ A;  4PI2 A;  5F5I A;  1XND A;  1EV1 3;  1GBG A;  1NCR C;  3I2K A;  3WG1 A;  1CGP A;  3MIG A;  1MEC 1;  4EN6 B;  1BLZ A;  5ANN A;  4B3N A;  5IK4 A;  2VZU A;  4ISQ A;  1RUH 2;  1KD7 A;  5F6L B;  1CZV A;  3I8T A;  2DU1 A;  2IFR A;  4XQ4 A;  2UWA A;  2ZZJ A;  1BHG A;  4YVW C;  1WD4 A;  3BTZ A;  3VUO A;  4CXW A;  1IPJ A;  1V6M A;  5LK7 B;  1NXD 1;  3WUC A;  2PHT A;  2YYO A;  4KG8 A;  4BHP A;  5IJR A;  1QWR A;  2KA3 A;  4KU8 A;  3VBU C;  4F83 A;  3J7N A;  4GWJ A;  4ORF A;  2J22 A;  4AR2 A;  4CEY C;  4LK6 A;  4A45 A;  2LRO A;  4CE8 A;  2ZGN A;  4K20 A;  2QUO A;  3APB A;  1C8M 1;  2XDV A;  3GBG A;  4DUW A;  2VO5 A;  3RZJ A;  3AKS A;  2JWP A;  2HWC 2;  3CJI B;  1PM4 A;  4IV1 B;  5E6H A;  5J7M A;  4XUN A;  4DXT A;  4P02 B;  2G9F A;  4QT6 A;  5G05 L;  1Y9M A;  5AC9 3;  1G9C A;  5FPB A;  1CX1 A;  3QAC A;  1LOG A;  1J3Q A;  1O8P A;  3BUC A;  4D6Q A;  3KVB A;  1JHJ A;  4P9Y A;  1ULF A;  5KHI A;  4HLT A;  1FAT A;  3U78 A;  1DZQ A;  5DG1 A;  5BNN C;  4OI4 A;  3A0K A;  1TMF 1;  3FBM A;  4XQD A;  1UY0 A;  2PHR A;  1CIW A;  3ZDV A;  2FD8 A;  1PGS A;  4AG4 A;  1RUN A;  4JCK A;  3P1I A;  4N7I A;  5IVB A;  3LA3 A;  2WZE A;  1RHI 3;  3D8C A;  3U0Z A;  1MQT B;  3I2I A;  3KCY A;  4BOW A;  3ZFF C;  3ZKU A;  1W2T A;  1C4R A;  5A7O A;  3KT7 A;  4XMI A;  3LIG A;  4ZY9 A;  4C91 A;  1HDK A;  5FZI A;  5C3R A;  2MHF A;  4IV3 C;  2HWF 1;  5KHJ A;  1EY2 A;  2IWG B;  1JW6 A;  2A6Y A;  2D6O X;  3C7O A;  1HXS 1;  3BU7 A;  1ASJ 2;  4LO6 B;  3RMX A;  1JZ3 A;  4R4Z A;  1K3I A;  3PTY A;  4DUV A;  2AGS A;  1OSG A;  2CAU A;  3K75 B;  1NA1 C;  3DPR A;  4XF3 A;  5CFD C;  4KBZ A;  1JUI A;  3KCX A;  3NW4 A;  1NQJ A;  5HV0 A;  2V72 A;  1K5M A;  2ZKN A;  2IXJ A;  2BRT A;  3FLR A;  3WHU A;  5FKC A;  5CAZ A;  5IT6 A;  2EF6 A;  2WAA A;  5CYY A;  4A2U A;  3VBH A;  1YFX A;  4A4A A;  2Q1Z B;  2XWB B;  5F37 A;  3OSD A;  4XJW A;  4YSF A;  2AAC A;  3O1T A;  1RUI 2;  1GNY A;  4AYU A;  3GYD A;  2QFE A;  4R9C A;  1XC6 A;  5FZG A;  1DCS A;  1EUU A;  3SMH A;  4O9E A;  5IK5 A;  5HCH A;  1DGR N;  2RM2 1;  2RJ2 A;  4XJA A;  5A33 B;  1W06 A;  3KT1 A;  5I93 A;  2XJV A;  4AGG A;  4KG0 A;  1PO1 1;  2GDF A;  3ILF A;  4KU7 A;  5D8A A;  3W20 A;  4CEW A;  1Z78 A;  2NMO A;  4OHZ A;  5A1L A;  1KDK A;  2ZS6 B;  5FY7 A;  2EXH A;  5BNQ A;  4GH4 C;  3BOD A;  3AJZ A;  3J8F 2;  4COU A;  4CPB A;  2WO3 A;  2VCC A;  1E5S A;  5SV5 A;  1CX4 A;  3POS A;  3S7E A;  4E4H A;  3V0B B;  3I49 A;  1W6P A;  4PQQ A;  4YLZ A;  3U07 A;  3ZXE A;  4GQ7 A;  5GZC A;  1AYN 2;  3WW3 A;  3MF9 A;  5SV8 A;  2FDH A;  5F3G A;  2CY6 A;  2ZGS A;  1YQ8 A;  3AFG A;  2R07 3;  4FBF A;  3OBT A;  5TSW A;  4E4Z A;  2WZR 1;  4G3Y C;  4IE4 A;  1JH5 A;  1PX4 A;  2OS2 A;  3KCC A;  1PNF A;  4OUL A;  1O5L A;  2HEY F;  5JIA A;  4EE2 A;  4MXW B;  3ZO0 B;  3OYW A;  2PEL A;  2G9G A;  3GZE A;  2RS5 2;  1UKR A;  5EYY A;  3O1P A;  1Q56 A;  3LKJ A;  4PBO A;  2WT2 A;  3HN1 A;  3ZPO A;  1OMI A;  3A21 A;  3AP6 A;  4COZ A;  1Q3E A;  4LBQ A;  5JXJ A;  3WP6 A;  2VOX A;  1W6Q B;  4RQP C;  3C2U A;  1N47 A;  4NRM A;  3OGS A;  1PIV 3;  1AR8 1;  3PMS A;  5I0T A;  1COV 1;  3VHR A;  3VDC A;  4MGT A;  2W08 A;  4LBO A;  1TZO A;  1UNB A;  3MBW A;  4FFI A;  1ZBA 3;  1LU1 A;  2Z79 A;  4ZS2 A;  3VDD C;  1GIC A;  2VVF A;  1F5J A;  1NY7 2;  4Y20 B;  1QJY 3;  1AYM 2;  1OLM E;  4LKD A;  4NHY A;  2ZOE B;  5JXG A;  4PDW A;  4BDV B;  4PDW C;  1IPK A;  4XE9 A;  3SCH A;  2P1B A;  4YGE A;  4XF4 A;  1O59 A;  5JXI A;  1S4C A;  1ND2 B;  1IG3 A;  3GCW A;  3C7H A;  2TNF A;  3KVA A;  3RZM A;  4AFC A;  1GP4 A;  1ZZC A;  4S2G A;  3OPT A;  3BOW A;  1VLN A;  4LBQ D;  1YFY A;  2WO1 A;  3E6B A;  4P9I A;  4GH4 B;  2VUL A;  2JEM A;  1UW8 A;  3KS7 A;  4QB2 A;  2J1A A;  1MS3 A;  3NJY A;  4LBK A;  3SH3 A;  1J3P A;  5FO7 B;  2LAL A;  5GKA C;  3RG0 A;  3WP4 A;  2A3W A;  3S5A A;  3OD0 A;  2A6V A;  3OBA A;  4HET A;  3H3U A;  4H55 A;  5FTT C;  4QQ2 A;  3VZL A;  3ATG A;  1J1L A;  1RUH 1;  4XIL A;  3VB9 A;  1C1F A;  2VG9 A;  4HVQ A;  5T5J A;  4JTO A;  2D6M A;  4XQW A;  3PUQ A;  2KM2 A;  3MLK A;  4XVH A;  3CIH A;  2CV6 A;  5T55 A;  3GBW A;  1GOF A;  5A3L A;  5K7P A;  1N1V A;  4YM0 A;  4HBN A;  5FYI A;  3EHK A;  5EHD A;  3R6S A;  1ZBE 3;  4YVW B;  4MYE A;  4NO4 A;  5JR7 B;  2ES3 A;  1JN2 P;  3ILR A;  4OZX A;  4Y24 A;  1FMD 1;  3RDI A;  3I4I A;  2OW4 A;  5FRE A;  3W5M A;  4YW3 A;  2VEC A;  3HD8 B;  4OHX A;  4JDM A;  1VB2 A;  4A3X A;  3LDR A;  2R04 3;  2WLP A;  4E4D X;  2VU9 A;  3ZSJ A;  4MGI E;  4AHW A;  2Z2S B;  4COV A; 
#chains in the Genus database with same CATH homology
 4NII A;  4NRO A;  4IDZ A;  4OCT A;  3O1P A;  3I2O A;  3LFM A;  4QKB A;  3T4H B;  3BI3 A;  5F8P A;  3RZL A;  4IE5 A;  3KHC A;  3O1M A;  3O1R A;  2FDG A;  4NRQ A;  2FD8 A;  4NPL A;  2IUW A;  4ZS3 A;  2FDI A;  4MG2 A;  3KHB A;  4QKN A;  4IE6 A;  4O7X A;  3RZK A;  2FDK A;  4NJ4 A;  3I3Q A;  4NRM A;  4QKD A;  3O1U A;  3BKZ A;  3H8X A;  3BIE A;  4NRP A;  5DAB A;  4CXX A;  3I49 A;  2FDF A;  4MGT A;  3RZJ A;  4NIG A;  3BU0 A;  2FDJ A;  4RFR B;  3BUC A;  3S57 A;  4NPM A;  4IE7 A;  3O1T A;  4ZS2 A;  2FDH A;  3H8R A;  4NIH A;  3RZH A;  4IE0 A;  3S5A A;  3O1S A;  3O1O A;  4CXY A;  4QHO A;  3I3M A;  3RZG A;  3T4V A;  3RZM A;  4O61 A;  3H8O A;  4IE4 A;  3BTX A;  3O1V A;  3BTY A;  4ZHN A;  4JHT A;  3BTZ A;  4NID A;  3T3Y A;  4QKF A;  4CXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...