2RS13

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus sp.
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs1300
1BBT3 3ZFGA 1EAH2 1RVF1 1NCRC 3ZFFB 3FBMA 4N53B 5JZGA 1RB8G 1TMF1 1PGW2 4Q4W1 4RFT0 1VRH1 5BNPB 1HRV2 1RUF2 1RUH2 4FSJA 2BFUS 2RS52 4CDQB 1HXS2 1RVF2 2X5IB 1AR81 1ZBE2 4RQPB 1QQP2 2R041 4CEYB 4CEWA 4Q4V1 1AR93 1HX6A 1WCDJ 4CDUC 1H8TA 1C8NA 1QJZA 4Y5Z0 1PO21 3VBSC 2HWE1 1RUG1 2R042 1EV13 2R063 4N43A 3CJIC 4CDUA 5L7OB 1OHFA 1POV1 4IV3B 1VBA1 1VB2A 1TME1 1VBC1 1HRV3 1RUF3 2HWE2 1HRI3 1RUH3 2WFF2 3VBSA 2ZTNA 4GB31 1FOD3 4GH4C 1MEC1 2RS53 1HXS3 3M8LA 1RVF3 2R071 4RR3A 1R091 1ZBE3 1QQP3 1AL23 1ND3A 1ASJ3 2TBVA 1HQNA 1BBT1 5BNOB 5C8CB 2HWF2 1VBA2 4GMP0 3VBOB 4IV1A 2Y26A 5D8AC 3DPRB 4YVWC 1B35A 4RS5B 4GH4A 1RUJ1 4CDWC 2RMU2 1R092 4WM7B 3VBHC 1PGL1 2QQPA 1BBT2 1QJU2 3ZFEC 3ZXAC 1K5MC 4YVSB 5BNPA 1AR91 1NCRB 4FTSA 5D8AA 1RMU2 1RUJ2 1BMV1 2HWE3 2WFF3 4JGYB 4CDWA 1VBE3 1PGL2 1QJX2 5CFDA 4WM8A 3ZFEA 1AR92 1EV11 1K5MA 2R061 3ZFGC 4EJRA 5JZGC 2HWF3 1VBA3 2RS12 1BMV2 1MQTB 1FPN2 1ND2A 1HRV1 1RUF1 1HRI1 1RUH1 4CDXC 2RMU3 1EV12 1FOD1 2R062 4GMP3 4QPGB 2RS51 1QJU3 1AR72 1HXS1 1ZBE1 4CEWC 1QQP1 1AL21 1ASJ1 3CJIB 2BFUL 1A6CA 1H8TC 2ZZQA 5A32B 1NCQB 3NAPA 1RMU3 1HRI2 5C4WB 1RUJ3 1RUD2 2WZR3 1E57A 1OOPC 4CDXA 1FOD2 3VBUA 1QJX3 2MEV2 4PDWC 3HAGA 5C8CA 3VBRB 1AL22 1ASJ2 1NOVA 4N43C 3VDDB 2HWC2 1NA1B 1R082 4JGZA 3JB4C 2RS13 1FPN3 4WM7A 1OOPA 5CFCB 1PO12 1AL0G 4YVWB 2WFF1 4PDWA 5C9AA 1VBE1 4YVSA 4Q4Y2 3VBFC 3VBHB 4RR3C 1W39A 1AR73 4Y4YA 1ND3C 5K0UB 1FMD3 2HWF1 4IV1C 1RUD3 5A33B 4RHV3 4NWVA 1B35C 1VBE2 1AYN3 2HWD2 4Q4X1 5ABJA 2GH8A 2MEV3 4QPIB 3VBFA 2RMU1 1CD3G 3ZFFC 4AEDB 5J98B 4GMP1 2HWC3 1QJU1 1R083 3ZFGB 4SBVA 5BNPC 3TN92 5JZGB 1M06G 1POV0 4Q4X2 1PO13 1RMU1 3J8F2 2X5IC 4QPGA 2WZR1 1D4M2 1COV2 4CEYC 5BNNB 3ZFFA 4N53A 5CFDC 1QJX1 2XBO2 4Q4Y3 1IHMA 4WM8C 5ACA1 1VBB2 1NCQA 4FTBA 5C4WA 1F2NA 2RS31 3JBG2 4NWWA 2RS11 2WZR2 4CDQA 1ND2C 2X5IA 1FPN1 1R1A2 4RQPA 4CEYA 2HWD3 5GKAC 3S6PA 1RHI3 5ACA2 1BEV3 5AC93 5J96B 1RUI3 1Z7S2 5L7OC 2RS32 1AR71 2WS91 4N43B 3LOBA 3TN93 4CDUB 1FMD1 5FMOS 1VBD2 1QJY2 1C8M3 3NAPC 4Q4X3 2BUKA 1RUD1 3J8F3 3JB8A 1D4M3 3VBUC 4RHV1 1COV3 3VBSB 1X33A 1AYN1 5K0UA 1AYM3 2XBO3 2MEV1 5L7OA 2WS92 5C8CC 2BBVA 4IV3A 4RR3B 1FMD2 1VBB3 1NG0A 4JGZC 2HWC1 1PIV3 1R081 3DPRC 3JBG3 2PLV1 1ZBA1 4IV1B 4WM7C 1NY71 1PVC1 4RHV2 4QPIA 2HWB3 1AYN2 1R1A3 3JD73 2ZAHA 1PO11 4BCUA 2RR13 1AR62 2XPJA 1RUE1 4GH4B 5ACA3 5BNOA 1V9U2 5C9AC 4YVSC 1Z7S3 3VBOA 4Q4Y1 2RS33 2PLV2 3DPRA 1ZBA2 4RS5A 1NY72 1PVC2 1QJY3 1VBD3 4JGYC 2RM23 5DDJ3 5BNNA 1RUE2 5D8AB 4CDWB 5ABJC 1CJDA 2HWD1 1RHI1 1TMF2 1NCRA 4Q4W2 2WS93 5CFDB 2FZ1A 1BEV1 5AC91 5FOJB 1VRH2 1GFF2 1RUC3 4WM8B 1RUI1 5LK7B 3ZFEB 1MQTC 1K5MB 2DF7A 2VQ0A 4JGYA 3TN91 1C8M1 3IDEA 1AR82 1ND2B 1RHI2 4QPGC 1AR63 4Q4V2 3J8F1 1BEV2 1D4M1 5AC92 1COV1 1V9U3 4N53C 1RUI2 1EAH3 1AYM1 2WLPA 2XBO1 1MQTA 1NCQC 1SMVA 1PO22 2PLV3 5C4WC 1VBB1 1C8M2 1ZBA3 1PIV1 1PVC3 1RUG2 3JBG1 4CDQC 1RUE3 3NAPB 4RQPC 2HWB1 3VBRC 1R1A1 2GSYA 3JD71 1AYM2 4CDXB 3VBUB 3VDDC 1NA1C 2RR11 3CJIA 1TMF3 4Q4W3 1VRH3 5A32A 1Z7S1 1VBC2 1TME2 4CEWB 1PIV2 1VAKA 5CFCC 4JGZB 1H8TB 4GB32 1MEC2 1VBD1 1QJY1 2HWB2 2RM21 1VB4A 3JD72 5DDJ1 2R072 1OPOA 1AR83 3VBRA 2RR12 1OOPB 2R043 3VDDA 1NA1A 4Q4V3 5FMOL 2BPA2 5K0UC 4PDWB 5C9AB 4IV3C 5CFCA 1RUC1 1PO23 4YVWA 2RM22 2IZWA 5DDJ2 4LLFA 1RUG3 1F8VA 4QPIC 3VBHA 4AEDC 2WWSA 1AR61 5BNOC 5ABJB 2FZ2A 1V9U1 3VBFB 1POV3 1RUC2 4FTEA 3VBOC 1EAH1 1X36A 1ND3B 1VBC3 1TME3 5A33A 1PGW1 4RS5C 1DDLA 4GB33 1MEC3 5BNNC 4Z92B 2R073 4AEDA 1R093 1B35B 1AUYA
chains in the Genus database with same CATH superfamily
3A4UA 4ATFA 1DBNA 1EAH2 1I6XA 3I3BA 3WW2A 4N53B 1DIWA 5JZGA 4QX8A 3PMSA 3POBA 3V0AB 1RB8G 1PGW2 4YZ5A 1BVVA 3CHXA 1OKOA 5F7UA 5DZGA 3AKTA 4HZFA 2V09A 3AKQA 1VE0A 1US3A 2RS52 5A7WA 5FAXA 1ODNA 4FQ4A 4CDQB 4COVA 1RVF2 2X5IB 3R4DB 3B7MA 3R4UA 3WUCA 1KFXL 1OH4A 2YGLA 4PIXA 1QQP2 2R041 3ZSLA 4CEYB 5KR7A 3VD4A 4MH0E 4ZHNA 4Q4V1 4BPZA 3FX3A 5FZDA 3T08A 4EYUA 3WW4A 3AFKA 5J7MA 4KBZA 5I0DA 2QQJA 2ENRA 4PQ9A 2JG9B 1W0OA 2QQWA 3O14A 4QB2A 5DUVA 5FO8B 5IK7A 3PJYA 1IOAA 1LGNA 3WINE 4BISA 1UN1A 4N90A 4E9KA 4RD7A 3OTFA 2VXRA 1HDKA 1LENA 3ZYPA 2R063 2EXKA 2IC1A 3RGBA 1Y9QA 5C33A 1QF3A 1UU6A 2DUQA 4AI0A 2Z2SB 1F31A 3BUCA 4BU2A 4M0NA 4P9YA 1SDWA 1YXWA 1OHFA 4OMDA 1JZ4A 5JR2A 4ORFA 1POV1 2VO5A 5LBFA 3WNXA 2YXSA 1VBC1 5DAQA 5FY0A 4DPNA 3FC0A 1ZZ8A 2HWE2 2ZX2A 3MIBA 4BLIA 4W6XA 1GICA 1B09A 2VXJA 1W6MB 5C5UA 2OZJA 4LHLA 4A3ZA 4KWUA 5E16A 2RS53 1DQ0A 3M8LA 1CAUA 1RVF3 4IQPA 2PHWA 3M2MA 5FDBA 3WW3A 3A0KA 1QQP3 1LNSA 4P5YA 4QHBA 4R9BA 1UY0A 4LNVA 1SQ4A 2HWF2 4XXPA 5C8CB 3SCGA 1VBA2 4GALA 5FQ0B 4B8EA 3V0BA 4GMP0 3KQRA 3GZUC 5B2GB 3BTXA 1G86A 1XC6A 3AZWA 3I2GA 5T52A 2KA3A 5D8AC 2VG9A 3ZDSA 5AFEA 4J25A 4RGAA 2P34A 3NL1A 5M0TA 1CAVA 1JZ8A 2Y6KA 3OD0A 4HK8A 2J1AA 2RJ2A 3I3DA 1QKQA 1S0CA 2ETEA 2VTXJ 1KDMA 3AMHA 5EV7A 3ZFEC 4ARYA 5BNPA 1AR91 3AJYA 4YGCA 5CEHA 1RJ7A 4Y1YA 2MNGA 4QQ2A 4AHXA 1Q3EA 1S0JA 3GBFA 4FP3A 4AVTA 2IWGB 1G9CA 5D8AA 3HR9A 1GNYA 1CAWA 1H9PA 2HWE3 4Q0PA 1AF9A 3NRUA 2ATFA 4AR2A 2BOIA 4CCCA 4UBHA 1JXNA 1VBE3 1H6YA 5JOWA 1XE0A 3WUDA 4RA0A 4CUBA 1O6UA 3PUSA 4QKDA 5A1FA 1W8UA 3NJXA 4UFHA 3ZFEA 3H7YA 2FMDA 3ES4A 3GZTB 2FDJA 2DUOA 4KU7A 5A7PA 1IKPA 3ON7A 3RI9A 3H1YA 1HW5A 3LIGA 2WSUA 1W0PA 1MS4A 4AAXA 2G9ZA 2HWF3 2D98A 2H0VA 1VBA3 1XNKA 1D7PM 1ZM1A 3O1UA 1LTEA 3H3ZA 5GLZA 1BMV2 2P37A 4CP9A 4OVEA 1ND2A 2E32A 4AXOA 3MIDA 2XKPA 5T5OA 2VAUA 1CPMA 2XWBB 3SITA 5EWSA 2ZXQA 4CDXC 1YI9A 1EV12 3E97A 1AR72 5GJ6A 1HXS1 2JEMA 2WT1A 3ZSKA 1GR3A 2WNVC 1AL21 2ADEA 1ASJ1 4CXWA 1XOYA 1A6CA 2CGNA 1W9SA 3B9IA 3F2ZA 1U5YA 3MZHA 4JCKA 3Q8AA 3U4SA 4ITCA 3ECQA 3WDXA 4AHYA 1G9FA 1HRI2 4ZONA 2BQPA 1RUD2 4K40A 2J7MA 4AFCA 4AG4A 5T55A 4TLGA 3DYOA 4CDXA 1FOD2 4Z8BA 3WP3A 4CP2A 4F83A 1QDCA 1HQWA 1MZEA 3ZOIA 4CUCA 3POEA 2H0BA 1V6OA 5JXGA 4ZU5A 4DFSA 2RG4A 4Y1XA 2WNVA 1D2QA 3I2OA 5EZWA 1TVGA 5A7SA 5KHHA 4XW3A 2K2SA 4EE2A 4BQXA 2VNOA 4LIUA 2AH2A 2PELA 3GZEA 1PGSA 3NO8A 4HONA 3Q8FA 4E8CA 5FREA 3UK9A 4JVAA 4ET7A 3V64A 3ZYHA 5FZOB 3KQ4B 1JODA 1Q8SA 3FMGA 4MO3M 4PHZA 4QX2A 1SFYA 2ARAA 2JD9A 3PL0A 1US2A 4CRQA 2VMIA 4NROA 4EN8B 4R4XA 5F37A 5C9AA 2VOXA 1VALA 2Z79A 2CU5A 4URTA 2IFWA 1W39A 2QJVA 3ILFA 1AR73 2DCYA 4LKEA 1ZA4A 3T1LA 3WVJA 5A3UA 1ND3C 3IWZA 1BXHA 1I1EA 2W95A 3M3QA 3NV4A 1FMD3 2WQZC 3TYJA 4LEJA 3PLQA 4H14A 1VLNA 4IV1C 2Y8KA 5FZIA 1DGRN 1A8DA 4HXCA 4I09A 1RUD3 4CCOA 3WF4A 1GP5A 1NQJA 3BTAA 3USUB 3E5XA 4LK6A 5A1AA 3AL6A 4XDOA 2F17A 5FPBA 4B7EA 2GMPA 4QPIB 4XF0A 2GC0A 2RMU1 2XKOA 1CD3G 2GNMA 4Q0VA 2OYZA 4A41A 3BTYA 4AEDB 5J98B 4XACA 3AB0A 4GMP1 3DYMA 4QM8A 4IGPA 4XMIA 3VKOA 1YUDA 2YGMA 4XUOA 3ZFGB 4SBVA 3ZKYA 2NQYA 2ZEXA 4R52A 4UFLA 4FFGA 2XJUA 4RFRB 1M06G 4O9GA 4GQ7A 1PK6C 1OUSA 3UV9A 4YZ1A 4Q4X2 2K9ZA 4FPGA 2ET7A 3OEBA 4M3CE 3WF0A 4QPGA 5LRRA 3HMYA 1LGBA 3TEWA 1KS5A 2ILMA 5BNNB 4GZ9A 4LBJA 2R16A 5CFDC 5JR7B 1IHMA 1FV2A 4PI2A 3AMQA 4DY5A 4LOTA 2EXIA 2EF6A 1HKDA 1Q8VA 1NCQA 1BJQA 1CX4A 4KU8A 4XUQA 5FJKA 3THCA 3UNPA 1F2NA 3NNJA 3WZ1A 5FYMA 2J1SA 1LULA 5FZCA 1XNTA 2LALA 2RS11 2P3YA 1W6NB 2WZR2 1W2TA 3FN9A 3MIEA 3O12A 4IEQA 4V2WA 4FFHA 2XJRA 3H50A 1YIPA 4RQPA 4CXYA 3S6PA 1RHI3 2AUYA 5JI7A 3SH5A 3KGZA 2LTNA 1LODA 1FAYA 5ACA2 5FYTA 2ET1A 2O8OA 1BEV3 3IKWA 2IXJA 2VMCA 3K4AA 3OB8A 1N1TA 1VP6A 5IFTA 1RUI3 2W68A 1IS3A 1DCSA 2Z69A 1SPPB 2ZX3A 5FR3A 4CE8A 2WS91 4XFFA 5L9VA 2QE3A 4BE3A 3LOBA 1L7RA 3BB6A 5FZKA 4CDUB 4BXSV 3H42B 3KGLA 1LOEA 2XJTA 3I2KA 4FCAA 4XURA 2W1SA 2NMNA 2AENA 4Q4X3 3C7EA 2DVGA 3PDQA 2W3JA 4MVTA 3UETA 3OBRA 4MXWA 5CISA 3KCXA 5FLJA 4MGSA 4OMCA 3VBUC 3BIEA 2F6BA 1DGWX 2WAOA 2JDYA 3H9AA 1J3RA 4IXLA 3U11A 1ENSA 4W6WA 4EROA 1IG3A 1QNWA 2MEV1 3PIGA 2DV9A 1N1VA 4MG2A 1BVP1 3PNAA 2DU1A 3HBZA 4LUKA 5EHDA 1SLAA 4S2GA 4IL7A 1QWRA 2XQXA 1OKQA 1F5JA 4JGZC 4NRPA 4HVQA 2GP3A 2C1FA 3KHCA 1O4TA 4QX7A 5GLVA 5F8PA 3I3MA 4XQ4A 2PLV1 2XB6C 2A75A 1UOFA 2B46X 5IAVA 1FYUA 1HN0A 2ZMLA 3D6EA 5LA9A 3K3OA 4IV1B 4WM7C 1XNDA 3ZLIA 1AYN2 1AXKA 1SBEA 3I59B 3T30A 4UW6A 5FTTC 2WRAA 1RUE1 3MI8A 5ACA3 2XWJB 3EQEA 2AEYA 5FP7A 1OFSA 3FFQA 3N7KA 2P6HA 4JQRA 4Q4Y1 2ZBJA 3KVAA 3T0DA 3OGGA 4L92A 4NIIA 2ZACA 1ZBA2 1ZX5A 3WT3A 4Y24A 1NY72 1PVC2 1JBCA 2ZAAA 2W94A 4AGVA 4JHZA 2BEOA 5A7OA 1PK6B 3ZIWA 1IQDC 4XFCA 5FJHA 4K9SA 1YFUA 5DN2A 2ZX4A 1JYIA 4TLFA 1OSGA 3AP6A 2HWD1 5GLWA 2BVBA 1TNRA 1WLWA 1IPSA 5JXIA 4RSUA 3H3LA 5C71A 1NCRA 5CFDB 1RIRA 2Q4SA 5L73A 4J1WA 3HPNA 4ASMB 5HXMA 5E89A 5LK7B 5FXVA 1H2LA 1K5MB 3GHMA 3Q8EA 4LE4A 5JCTA 2VQ0A 4XCBA 1H0BA 1YC61 5IVYA 4AI3A 2EVXA 2OKXA 4TYSA 3TN91 4COWA 1C8M1 2JIJA 4FXKB 4EZHA 5I0UA 4I3PA 1TZOA 4QHZA 2R30A 2PHTA 4Q4V2 3AXDA 4LORA 1QXJA 1GOFA 3MFCA 1XU1A 4FPCA 4H7LA 4MYEA 2CGPA 3ZYJB 1SLCA 2PAEA 3HN1A 3RDIA 3HD8B 4B4PA 4AZZA 2YY1A 1J84A 2CHHA 2GC3A 2LM3A 1CAXB 3PVNA 4LA3A 4N8MA 4E4ZA 5C4WC 4YWAA 4MGTA 1ZBA3 3DEMA 4XFBA 3TEZA 1PVC3 1Z0HA 4NHKA 4GIQA 1UZVA 3MHZA 2Y64A 4DIQA 3JBG1 5CIRA 3MDPA 3OPWA 4LO4B 5F2WA 4UFMA 2G19A 5IVEA 2DTYA 3KHBA 3WNOA 4F7ZA 3INAA 2GSYA 1AYM2 1W9WA 4JKLA 3WHUA 4BIOA 3VBUB 2XG3A 2XMLA 4Y5SA 5AVPA 1RUNA 2BW8A 2OA2A 2Q1ZB 3O1TA 1UZ0A 3SKJE 4L8QA 3PVBB 4HT1T 4IE7A 5A32A 4CTEA 1VBC2 4CCLA 4CZSA 4JKKA 2HEYF 4GKYA 3WY6A 3Q8CA 4JGZB 4DNYA 4XAEA 2XL7A 5F9TA 1H8TB 2B9VA 2JDMA 4FOQA 4AQ6A 3CO2A 1VBD1 2IXCA 5FYVA 1DQ5A 3JD72 2W87A 5KC5A 2RR12 2R043 3OY8A 3WG1A 4ZS3A 4Q4V3 1D0HA 4M0HA 3KVBA 4QMAA 4DUVA 3LFMA 5K0UC 3GYDA 4PDWB 2PAKA 2WL1A 1GZWA 3IDBB 3IMMA 3MO4A 1WCKA 3NWKA 1G9DA 3KZ4C 3ZIXA 1VJ2A 4XYXA 3MIGA 4IV3C 2UWCA 2YBKA 2D7FA 2CTVA 4UW3A 1CESA 3MLJA 1H2KA 2W0XA 5IFPA 1U5ZA 4UWDA 5DDJ2 2GH2A 3AYCA 1NUKA 2OIIA 2FCTA 4WBBA 5FP8A 5LA2A 3VBHA 2QFEA 2WABA 3QLQA 4GKXA 4KNCA 4XDQA 3OOXA 5F5AA 4A7KA 4DRRA 2E9QA 3I97A 3QH7A 1IZ3A 2WWSA 3AZVA 3NJZA 3WDVA 1GQHA 5BNOC 1WKYA 5EJZB 3N9NA 2P4EA 3L2HA 2B42B 2XXZA 5CG8A 2BV4A 1POV3 1RUC2 2PTMA 5FZ7A 5FYIA 1VBC3 5GLTA 1H9WA 2VCAA 2OS2A 5FZGA 3K2OA 1GNZA 5A3TA 4PQQA 4DXTA 2EIBA 4BHPA 3FHQA 4UYBA 2C9AA 2OVUA 2BWAA 2JDKA 4QB6A 4S2DA 3U07A 2RDNA 3ZO0B 4YZ2A 2PHFA 1XSQA 4COYA 2DU0A 3AYEA 4IESA 3VHNA 1LOAA 1ULOA 4FPJA 4Y1VA 1PNGA 3PURA 3BPSA 3ACGA 4YG0A 1XJAA 2WN3A 3CZJA 4B1LA 1LEDA 3I2JA 3ZFFB 3FBMA 3KF3A 1W8WA 1TMF1 2C6SA 4JKMA 5FK8A 4Q4W1 2QZ3A 4IEWA 5FY9A 4XJ9A 1UO9A 5IW0A 3ZSJA 3ASIA 1R64A 2YZ4A 2VECA 1AX0A 4FPEA 4XETA 3ZYGA 2QQUA 2E26A 1YIFA 1HXS2 5DAXA 3O1VA 3AVRA 5G05L 2Y6LA 2RDRA 2D6MA 1W6PB 1MZFA 4MGQA 4CEWA 1AR93 2B9UA 2B45X 3WQBA 1CX1A 1J1LA 2OQ7A 1UYYA 1UY3A 4Z1VA 1UY4A 2D43A 4PJYA 4QQLA 4YRDA 3VDCA 1RXGA 3K77A 4AOCA 2ZGLA 4ONUA 1BQPA 2BP6A 2YG0A 4INDA 4HPKB 1JZ2A 3CEWA 3VBSC 2ES3A 1XE7A 2ADDA 2P3IA 2F4LA 1RUG1 4Z07A 2C5DA 1AXZA 3U1XA 1I9RA 3HQXA 4XCAA 4AL9A 1ZREA 1RTVA 4FBFA 3BODA 2QQLA 4LBQB 1WUVA 2AREA 2ARBA 2JECA 3LB9A 4N43A 4XVHA 5DG1A 1K5JA 3CJIC 3PTRB 3ZN4A 1YWKA 2B8MA 1S0BA 3ETPA 1BHGA 5EJ1B 5L7OB 4HMZA 3I2FA 3SH4A 2KR2A 4IV3B 4OCTA 1KDKA 3LPGA 4FPOB 4OZOA 1I5PA 1TME1 5CKMA 2MPFA 2FDGA 3N9LA 3VBSA 2VBBA 4NOTA 2C9KA 5IK8A 4PI0A 5FBZA 2GU9A 2N7GA 4GB31 4GH4C 4QPYA 3JUUA 2SBAA 1OQEA 2VMHA 2ZCWA 2P3KA 1HXS3 4RR3A 1R091 4GD4A 4EQVA 1AL23 2VQAA 1ASJ3 2CWSA 1JYWA 3B69A 4PF1A 4DZGA 1BBT1 5BNOB 4EWDA 1WLTA 3MUZ1 2A73B 3OJBA 2V4AA 1JYVA 1OC1A 2D6OX 4DY3A 2P5BA 4BYYA 1KRIA 2HYXA 2ID4A 2LS6A 1WCSA 2QUOA 4XF1A 4XTPA 4EN6B 1B35A 1C1FA 2J22A 4QT6A 2VMGA 3J26N 1RUJ1 1V6IA 4GH4A 3ZXDA 4CDWC 2J1UA 1W2OA 2RMU2 2CY6A 1QGLA 5C7GA 5HPOA 2CV6A 4M01A 4YGBA 5JSOA 1GWKA 1F4AA 3J4UH 1PGL1 4OQ8A 4L97A 2FD8A 3AZXA 3N7JA 2DBIA 4S2HA 3CQOA 4M4RA 3ZXAC 1MVEA 1J83A 4LO5B 4YVSB 2W92A 4NN0A 4OHXA 3V65A 2NM1A 3E6DA 5FPZA 3HNMA 1P8JA 3RNSA 2YPJA 5A3NA 4FTSA 2O8QA 4BIFA 2W08A 1IKQA 4JGYB 4JRLA 4CDWA 2DFCA 1O3RA 1QDOA 3PUHA 1H8VA 5FY5A 4M00A 3IMNA 1PMIA 3J7HA 1CIYA 1DQ2A 1Q5OA 2JKXA 1I5ZA 3QACA 5I91A 3RMYA 3GF6A 1WA4A 4EJRA 2JE8A 1Y9GA 1H4GA 3OYWA 3ZR5A 2UY8A 4YARA 1UYXA 3E5UA 1WZXA 5JZGC 1RUOA 5A3WA 2RS12 3N9MA 5A70A 1W28A 4Y22B 4BM8A 3DF0A 4QGMA 1F9KA 2WT0A 3FJSA 4C8DA 4CCEA 1H1AA 2CDPA 2ZGMA 1RUH1 4LHSA 4CVUA 4MGIE 1CIWA 2RMU3 5JI9A 3O1OA 3W20A 4YW7A 4E4HA 2AZ5A 1J59A 2R062 3BN6A 1WD3A 4D8MA 4GMP3 5J09A 4NAMA 3KS7A 4ZXKA 1J1TA 4I2OA 4X6RB 3WNLA 5A7QA 4AF9A 2W1QA 3I3QA 1ZBE1 5JXJA 1ACCA 4MV2A 4H3WA 4TWTA 4MLOA 3UJQA 3CJIB 4C0HA 4IETA 2BVVA 2OUJA 2VQUA 1W6MA 2DVDA 5K8SA 1LOFA 3NAPA 4B4RA 3PUQA 1LCLA 4OHWA 5E8AA 4YM1A 1E57A 3N4MA 1ZZBA 4WVMB 1YRZA 4YGDA 1AHSA 1Q8QA 3OD4A 3ZR6A 3AKSA 2UURA 3POIA 2MEV2 4LQRA 5F5CA 1UX6A 3POFA 3HQUA 1D2SA 3HAGA 1V0AA 5C8CA 3VDAA 2VVDA 3IN9A 1UZYA 5FQ0A 2QCSB 3S5QA 3VDDB 1WW6A 4JTOA 5CA6A 5FKBA 4LIVA 5GZEA 2XH6A 3J7LA 3PTYA 3AKRA 3JB4C 4BQWA 2RS13 5J37A 4XFGA 1IG0A 3RZGA 4E2QA 3ZXJA 1ZRCA 4XF9A 1RGSA 5CFCB 2D3PA 3ES1A 1AL0G 1GMMA 3H3UA 2G1MA 4IEZA 4LT5A 3BVCA 4NHYA 3RZJA 1OA2A 1YO8A 2VH9A 2WNEA 1O3SA 1YEWA 2I2SA 1FX5A 1HB2A 1BCXA 3AP7A 4Q4Y2 4W50A 5FUIA 5T54A 3VBFC 1ENRA 5FMCA 4O61A 4JAAA 2WR9A 1WW7A 3EHKA 2YUEA 4Y20A 4A7YA 2X29A 2Q1MA 1G7YA 2E53A 1YFWA 4J6GA 3A7QA 5T5JA 4IGQA 2BJSA 3R4SA 2VBDA 1SHWB 2A6ZA 2OW4A 2XJVA 1GOHA 5KHIA 1DGWA 2Y6FA 2BDRA 1VBE2 2HWD2 3LPFA 4GJZA 1UKRA 1ULFA 5ABJA 1C3HA 1VIWB 2VGDA 2Y6HA 2MEV3 5CG9A 1HLCA 2PFWA 3VBFA 2TNFA 2V5DA 1C5HA 3HJRA 5F6LB 5K7PA 2LUWA 5IYYA 2GAUA 5FZ4A 4OI0A 1QJU1 3ZFGC 3ATGA 5CU1A 1QNYA 1NAEA 4A7ZA 2RVAA 1SCRA 5BNPC 3TN92 2WUHA 5EFUA 5JZGB 5FZ0A 4UAPA 4R8HA 4QU2A 4H2AA 5SV8A 4XFIA 5D1IA 2WBKA 1KITA 3ZYFA 3MEPA 1RMU1 3VD9A 4KG0A 1BKZA 3CL1A 3KT1A 4N7IA 3U14A 5GZGA 3FBYA 1GBGA 2ZGQA 4QX5A 3VB9A 4A45A 3KM5A 4Q4Y3 1OFNA 3ZVXA 1LHVA 5A7WB 1JYXA 3VKFC 1IPJA 3OGSA 2VZ3A 2WWJA 1MR5A 1POQA 5F6KA 4Q0UA 1XQNA 2BNNA 3NSTA 3TBDA 3H8OA 2ZHKA 3EBRA 4P08A 4D94A 4BK4A 3JBG2 3KCCA 1UPSA 4NWWA 1OF4A 2WA4A 3QBQA 3S7EA 2DFBA 4DXSA 1G9BA 1ND2C 2RV9A 2V4VA 1FPN1 3AMPA 1YCIA 4MZUA 3BTZA 2JDZA 1I3HA 2HWD3 3BGAA 4GWNA 1W2NA 5DUUA 4YPJA 3SHRA 2QQMA 4RGKA 4Y26A 4YLZA 3O1MA 3RZLA 1FV3A 1XPWA 3KV4A 3B93A 4QKFA 3VLBB 5J96B 4FPFA 4ARXA 3EB7A 2RS32 3EYPA 3Q9OA 2ORXA 4IEXA 1XYNA 1ZA7A 1LOGA 3M3IA 3OBAA 1UCXA 1UPIA 1QH6A 2VJXA 2UY9A 2WNUC 3MBWA 3TN93 1VBD2 1AX1A 1Y3TA 3MFAA 1C8M3 1KQRA 3IDAA 3IM0A 4XXAA 2G9FA 5HI0A 5IT6A 3PUAA 3EJKA 3I4IA 5LA1A 2QQNA 1NT0A 4Z2WA 1HB3A 5JPNB 2BUKA 1VMFA 2O1QA 1WGPA 4RHV1 1QOTA 1BK0A 1X33A 2VUCA 5GM0A 4JV4A 3MV01 5JOYA 1QIQA 1W2UA 4JDOA 5C5TA 1HQLA 2HH9A 3LA3A 2ZA9A 2XVGA 4FOVA 1FMD2 1A8MA 4C0BA 4D7TA 2WNUA 1JZ5A 1STMA 4W4ZA 2VCMA 1ZZ9A 3WXPA 1R081 1RL3A 3DPRC 3ZMOA 1E5SA 3DUIA 3PVEA 1PX4A 3W5NA 2GN3A 3JBG3 4LBQD 3UGHA 4DB5A 2XVKA 4I30A 3RS6A 3I2HA 3WF3A 4BQ4A 3V0BB 1YNAA 3C2UA 3NVCA 2WN2A 2XJQA 2Q5TA 4QPIA 5LZ6A 5FCCA 2ZAHA 4WZFA 1URXA 1RITA 3RWKX 3WSOA 4P9JA 4BDVB 2YB7A 4IEYA 5C9AC 1SLIA 1OXCA 2QVSB 1CAVB 5F3EA 4TTGA 3KT4A 3VBOA 5FPVA 1GU3A 5FUNA 2QKDA 5B4XA 2DUPA 2RS33 2XJPA 3RG0A 1XBFA 4DUWA 1C57A 1HJGA 3DPRA 5DMYA 4RS5A 3EXUA 3WDYA 1VBD3 3KV5A 5JVVA 3W58A 4BWOA 5IATA 4NIDA 1F4HA 5BNNA 1S2BA 2EAKA 3LEGA 3VZKA 4X8NA 3RWNA 4CCJA 5D8AB 2XUMA 3D8CA 4KH9A 4XJUA 1Q56A 1CJDA 4FOYA 5FYYA 4IDZA 3AVSA 3T0BA 1TMF2 4Q4W2 5JOZA 3B01A 4IEUA 2FZ1A 3UKNA 2YFZA 5AC91 4P14A 3DECA 2WZ8A 4N9HA 3ZFEB 1MQTC 2ZOEB 3FHIB 2A7AA 2IVIB 2W5FA 3T2TA 5C3PA 3FL7A 2LRPA 1MZ5A 5D21A 3IDEA 3BKZA 1NKGA 1ODMA 4XAAA 5F5IA 4CP9B 3LDRA 3THTA 1ND2B 1RHI2 4ASLA 4HL0A 4QPGC 1GYKA 5FUPA 1NE4A 1CR7A 4LXLA 4BMBA 1BEV2 1D4M1 3D82A 1COV1 2JG8A 5JWPA 1RUI2 5IK4A 4ZXEA 1MZ6A 1MQTA 4AE2A 1IS4A 2PA7A 2WZEA 4LHKA 2VVFA 4AQ2A 1NCQC 4CA9A 4OI4A 1VBB1 5I0TA 2QBXA 1ULDA 1H1MA 1PIV1 4RN5A 2DCKA 1LESA 1RUG2 3ZPOA 1SLLA 2X09A 4UF0B 2WSVA 2XL9A 2IXKA 5I8SA 3VGIA 1DQ1A 4RQPC 2HWB1 2D97A 2XDVA 4NR1A 2WINB 1G8WA 1IS6A 1R1A1 1SFNA 3VBRC 4CDXB 4Q2FA 4AGGA 1NA1C 4LBOA 5C3QA 1TMF3 4CU7A 4LOSA 4CP1A 4Q4W3 1HN1A 1YQCA 2V73A 3DV8A 3ZX7A 5FXXA 1UQXA 4HANA 4M4PA 1IQAA 3WR0A 2HEWF 1Z7S1 1TME2 1UIKA 3DYPA 4HK9A 2WNVB 3H0OA 2VC9A 5CB7A 5ISLA 1YLLA 3IAPA 5DXDA 3VZJA 1X8MA 4GB32 3JCIA 3LD8A 2E63A 3I2DA 5FPUA 1N3OA 1KD7A 3O1PA 2RM21 2VULA 5I0SA 4S2FA 3VBRA 3SMHA 1JN2P 5LEJA 1NA1A 4XOGA 5FY1A 5FZEA 1MS8A 4WVWA 1ZVFA 3VD3A 2QTWB 4AQTA 4IE6A 3UKTA 2W39A 5C9AB 1BK1A 3PIJA 1W9TA 1BLZA 1NE6A 3A21A 4XTMA 3AK0A 2OPKA 2P2KA 1EUUA 3SCFA 5FZ1A 4IE5A 2X8KA 4OHVA 4YVWA 2JE7A 3W9AA 5T3NA 5KC6A 1RUG3 4K7JA 2VVEA 1XRUA 4OQ9A 3RYRA 4YW5A 5BYNA 2UU8A 1G6NA 4OUEA 4K20A 4YW2A 1UMHA 1RJ8A 5GZCA 4FT8A 1T2XA 2VZRA 4E2GA 1NYWA 1UMIA 3FZ3A 4KG8A 5EPAA 4HKLA 4ISRA 1UY2A 1EAH1 5FPLA 4R9CA 4ES9A 1ND3B 1QXPA 1TME3 2ARCA 3C7GA 4TSVA 4Q1PA 5KBFA 5A33A 1PGW1 3T3YA 2DCJA 1SLTA 2A3YA 1ZZ7A 2P3JA 3MLLA 4GB33 4CPBD 2V72A 4Z92B 2EXJA 1RINA 1NZIA 2BYVE 1R093 5DZEA 2WIIB 2ZHMA 3ZSMA 4FSJA 5EXOA 1AUYA 2WO1A 2MHFA 5A3MA 5HCBA 4YG3A 1BBT3 3IBMA 4UFJA 3VZOA 3ZYBA 1RVF1 3WG3A 3CF6E 4QKBA 1NCRC 2B4KA 2VOVA 4MX3A 4AI9A 4RFT0 4EN0A 1N1YA 3POWA 2CNAA 2VZTA 5FV3A 2JDAA 4FFFA 1C5IA 1IGOA 1RUH2 1DYOA 3LZZA 4L99A 4COUA 1D0GA 3CNAA 2BERA 4C91A 1JMUB 3UJOA 1N47A 2ZEWA 4P5HA 2RE9A 1SDDB 2A5ZA 1Y9MA 2W1WA 3WP5A 1ZBE2 4K3UA 4RQPB 3O0WA 1ZZ6A 3G7DA 3RJRA 4EN7B 3ME2A 4GA9A 3AYAA 1PM4A 3MF9A 2KXLA 3CMGA 4XDPA 2X10A 2VCCA 1H8TA 2VOWA 3BU7A 1QJZA 4EZ4A 4Y5Z0 4NVPA 1GZTA 4IUGA 3WD5A 1PO21 3IPVB 2JXAA 1Z78A 3AX4A 2YDEA 1NX9A 5IUQA 4NIAA 2HWE1 1X82A 4LULA 2R042 5FYHA 5LK5A 4D7SA 3RZHA 4JZRA 1CGPA 4P9GA 3GJAA 3MW2A 1FNYA 5F3IA 2HLEA 4MXWB 1K42A 2R1DA 1YI7A 2OQ6A 2IXLA 2D6PA 4XE9A 1LRHA 1QMJA 4YG6A 3KV9A 4XHBA 1YJKA 3O7OA 2W9XA 1APNA 4H7MA 3FUQA 5FZ3A 4CU8A 3RPQA 1VBA1 1VB2A 4I0WB 3H8RA 3BPZA 3E1F1 1RUH3 2J1TA 3J9SA 5FLIA 3IIIA 3U78A 2QQKA 4LO7A 2XLFA 3QCWA 3WOGA 3H1MA 3TNPB 2A1XA 4Y33A 3FHAA 4PBPA 1JOJA 3NNGA 1ZBE3 1SACA 1OBNA 3VV1A 1MVQA 2WO3A 3K4DA 2P1BA 1NZCA 1LHWA 2TBVA 2UYAA 1HQNA 3OSDA 5C70A 2R6QA 4XBQA 2L9LA 4I02A 5FZHA 4WVVA 4UFKA 4K1YA 1DF0A 4IE4A 3ZXKA 1U12A 5IVCA 3S7IA 3ZN6B 1TEIA 2Y26A 2A6VA 1PMHX 2GZWA 2JENA 4AFMA 3RZKA 3R6SA 4DEQA 4WM7B 4DEVA 3VBHC 1HV1A 2QQPA 4QQHA 4XABA 1QJU2 1O5UA 3AL5A 3MPBA 1EPZA 2XONA 4L9BA 1CZVA 4URAA 2QDRA 5E1RA 1NCRB 2D6NA 3CKHA 5LW9A 2B39A 3LKJA 3J7NA 1RMU2 3H7JA 3MYXA 4L0PA 3ZXEA 1BMV1 4K21A 5J3UA 1UWWA 3EO6A 1K3IA 5EP9A 5IJRA 3HT1A 1O8PA 3WNNA 4ZPIA 1W6PA 2IXHA 4J1XA 5A3OA 4JRAA 1S2EA 3RFRA 1V6NA 4A6OA 1UOJA 3HBKA 4WM8A 1REDA 4FAHA 2RHPA 1AR92 1EV11 4D6SA 4CU9A 3WNPA 3C3VA 2D40A 3MPPG 5FYBA 4EN9B 5FP9A 4P9WA 4R4ZA 2E7QA 1H4HA 1AJOA 1CWPA 2BTVC 4FP2A 5FFOC 3ZXLA 3WV6A 1W06A 1X9TA 5FZBA 1FPN2 2NYYA 5BY5A 1ENXA 4D6RA 1W6OB 3RYKA 1HRV1 1RUF1 4QXBA 1HRI1 2JWPA 4LBQA 3WF1A 3TB0A 1G9AA 5T5LA 4LO8A 5ERLA 1FOD1 5EQUA 4HVOA 4HETA 5LBBA 5E6HA 5A6XA 1GV9A 2DBNA 1QJU3 3K46A 4O9EA 5KXCA 3WNMA 4HVRA 4CEWC 2ZHLA 4L2NA 1KEXA 4AEKA 3UT0A 3IB3A 2BFUL 2R49A 1CVNA 1LGCA 4JX0A 5K4LA 1AVBA 2F4PA 4PF5A 2ZZQA 4LK7A 5A32B 3N7LA 1RMU3 5C4WB 1ZNPA 4EV0A 1FXZA 4NO4A 3U37A 3O5SA 1OOPC 4OYUA 3ELNA 3HIFA 3GZAA 4PLMA 4YM2A 2VPVA 4QWNA 4KQ7A 3R05A 5FZ8A 2EALA 3K3NA 4QDSA 3ETQA 5T5PA 1AL22 5GALA 1ASJ2 1NOVA 1PNFA 2JE9A 1X50A 3OY8B 4N43C 1FT9A 1NLSA 2Q8EA 1R082 3LEMA 4A42A 1JZ3A 1DZRA 3MW3A 1GOGA 3HOBA 1MS0A 2PHLA 4G3YC 2QNKA 4LKFA 4UBGA 1CN1A 3IDCB 1FPN3 2PQQA 3ABZA 1OOPA 2O0OA 2VD7A 1HJFA 2E7AA 3PJQA 4N7UA 5A3LA 5EJ3A 4ZS2A 5BNQA 1WMDA 5BPXA 1FI2A 2WFF1 4NPLA 4CXXA 2W2IA 4G4FA 1K12A 5FKCA 2WLQA 2XR4A 4A6SA 3BALA 2X53S 3JQXA 3K51A 4YVSA 3VBHB 1AZDA 4RR3C 5F3GA 4QGNA 3TAYA 4OUMA 1YHFA 4FVVA 4UI9L 4CUAA 4YZ3A 5FO9B 5K0UB 1WW5A 3RVHA 2PXJA 5I0RA 1S0IA 1WBLA 4DQAA 3WCRA 2XGXA 3U10A 5APAA 3VHRA 1UX7A 5J48A 4HLTA 1V6MA 1GP6A 2CAVA 4Y4RA 1WBFA 4CUGA 3RZMA 1LB2A 4LBNA 2LW8A 3OUHA 2VZ1A 4RHV3 3O0XA 2ZGUA 1B35C 3AP9A 4LBMA 4NWVA 4D6QA 4JTNA 1OQDA 1F15A 1LEMA 4IGOA 2GNTA 2DCZA 4IEOA 4PT6A 4Q4X1 3I2IA 3K48A 5CNAA 2E51A 4NHLA 5JDBA 3T2QA 4Q29A 4BQYA 5IVVA 2AACA 3E6CC 3AZZA 2IXIA 4OULA 1AJKA 3L2YA 5G04L 2YBPA 1UAIA 5KHGA 3DCQA 4FPYA 1R083 1XXNA 2FQPA 1UW8A 3OUJA 2VY0A 4GWJA 5FYCA 3VKMA 4MSVA 4CCDA 1ZRIA 4JDMA 1XNAA 4E8DA 1POV0 2DURA 1GZCA 2FDKA 2IVJA 3LWCA 2NMOA 4ZZ8A 5JOXA 3I7DA 2X5IC 5FYSA 2G9GA 2WZR1 1D4M2 2Y34A 1ZRFA 3WEZA 1COV2 2VNVA 4CEYC 4AYUA 4ASKA 5HCHA 3DKQA 4N53A 3WG2A 3V0AA 1ALYA 1QJX1 3VKLA 1W6QB 3USSA 1PZ9A 2GC2A 4CCNA 5ACA1 4Y1ZA 4MGKE 4UW4A 3PU3A 4ZU7A 1JYNA 4QXHA 2XHNA 2HBTA 1VBB2 5DQ0A 5JIAA 2JG9C 3DXUA 4FTBA 3CBNA 3B3QE 5LBEA 4XJ8A 5CKNA 1GUIA 2C0ZA 3ST7A 3P3PA 2G4IA 3NV3A 2GN7A 1XYPA 2HKXA 1VAVA 4DOUA 3FWEA 2AGSA 3AM2A 4CDQA 2D44A 3UYJA 2X5IA 3N35A 1R1A2 4QXKA 4XQWA 5DUXA 4CEYA 5GKAC 4AHWA 3GM8A 2QQIA 1PX3A 1GZ9A 5AC93 4C1XA 2WAAA 1OA4A 1Z7S2 5FPAA 2VZVA 1OUXA 1WA6X 3C7HA 1IS5A 3HT2A 2JG9A 2AEZA 2XHKA 4KWJA 4BXFA 4HKWA 2NLRA 4N43B 5I8YA 2KM2A 4CP0A 1W8HA 2Q0AA 5FY8A 3ZYRA 5H9PA 3MV11 3A23A 2Y33A 2HYKA 1H1IA 1JZ6A 1LOFC 3NAPC 1OF3A 4QX0A 3M3CA 3JXSA 2JKBA 3AKPA 3JB8A 1D4M3 4CPBA 1COV3 3FFZA 3VBSB 1AYN1 1OD3A 5LATA 2CSGA 5JMOA 2BBVA 2WS92 3LE0A 4YFWA 5C8CC 3S0MA 2WNOA 3GALA 1C4RA 1UU5A 4RR3B 1YFXA 3BYWA 4NAOA 1VBB3 1W8ZA 2Q8CA 1NG0A 2ZEYA 4LJHA 1J3PA 2HWC1 1S0EA 1PIV3 2CDOA 3VDBA 3AZYA 1DYPA 4A2UA 2VNRA 3ZXGA 4M3CB 2NP0A 4NRMA 4P9IA 1PMJX 1ZBA1 2ZKLA 2GMMA 4MHUA 2WYFA 1NY71 1PVC1 3VZMA 2HWB3 2JDHA 2RDQA 1X8EA 1R1A3 4E4SA 5GLUA 1PO11 4BCUA 5IK5A 1R1ZA 2VNGA 1LJ7A 2Y6JA 2XPJA 4AVSA 4AVAA 4P9LA 4GH4B 3NV1A 5C8WA 4ISQA 3URFA 1Z7S3 4P9XA 5FIXA 1QOOA 5C6CA 3KB5A 3PVOA 4LITA 5LY2A 4FPHA 4XBLA 4DXZA 2PLV2 5FY7A 2Y38A 4DINB 2YC0A 3SLIA 4FAGA 3SNMA 4F3JA 1LU2A 1WW4A 3LDBA 1MS9A 2RM23 2RJKA 3D4KA 4GWIA 2D93A 3RRDA 1AX2A 2VMDA 1LKNA 1Q8OA 1UOGA 1RUE2 1V70A 1XE8A 1EPWA 4K1ZA 1OVPA 1QXRA 1WWYA 4JQTA 5DZFA 5FLHA 5SV5A 1PZ8A 3LA2A 2Y0IA 1A3KA 4MGZE 4CDWB 5ABJC 5DAPA 1UXZA 4BLJA 5J36A 3U4XA 1UNBA 1UZZA 2QQOA 3FLRA 4KWLA 5L9RA 2WS93 2CGOA 1QJFA 1T6GC 5FPXA 3POYA 2VQTA 1GANA 3WF2A 3OGVA 3QD6A 1W99A 4FQZA 4QU1A 4E27A 2DF7A 2V5YA 2ZHNA 1A34A 4D0QA 5JSRA 4IE0A 3OYWB 4L11A 1DG6A 1W03A 4MHRA 2WWUA 4LBKA 4YW4A 3TEYA 1OPMA 4NIGA 2TEPA 5FZAA 1IPKA 3KMHA 4K6BA 3SXWA 3MGUA 2W46A 3H8UA 3KT7A 5AFBA 2Z5WA 3J8F1 3UESA 3ENRA 4PIYA 4AQSA 2VZQA 4D3WA 3H8XA 4QHOA 4AVCA 2ZGKA 4G9SB 1EAH3 1AYM1 2D6KA 1V6LA 2WLPA 2XBO1 1W8FA 1LOCA 3AYDA 3CIHA 4M3CF 3MLKA 4E4DX 1BZWA 3VKNA 3AP5A 1SMVA 4FFIA 1PO22 2PLV3 5CKQA 4OFGA 1C8M2 5KHJA 5F2SA 3WLUA 3ROUA 1UXXX 4BQ2A 2DYCA 4TN7A 4K8FA 1RUE3 3NAPB 1H30A 1WMXA 1QEXA 4A44A 1S0DA 4XJWA 1JI6A 1NXMA 1EUTA 2W1UA 3JD71 5FRAA 2RR11 2WFPA 3CLPA 1JOBA 3WHTA 1CZTA 4DRVA 1DP0A 2BNOA 2X05A 3NV2A 4FPKA 5TSWA 1JOPA 5EIYB 3SEPA 5FWJA 3O1RA 1CPNA 1KXGA 2EIGA 2QQVA 5J1XA 3RYPA 5CYYA 4MGYE 2XJSA 3HNYM 3I8TA 3NMBA 3NKGA 2JDNA 1QJY1 3LEKA 3O0VA 5FXZA 2EXHA 1UL9A 5A80A 2DVBA 1W0NA 2FCUA 5DDJ1 1SLBA 2VOTA 3LF7A 4LR4A 3FE5A 5B4NA 1W9YA 1NXD1 1DFQA 5FP3A 2E7TA 2BPA2 5FMOL 4HKOA 4A4AA 4XFHA 2FBEA 5JIUA 1REFA 2EA7A 4LE3A 1CONA 2PMWB 3IIAA 2PN5A 2VTXA 4PIZA 4XF3A 5A6YA 4LKSA 3OF1A 1X7NA 3P3NA 2JDUA 3LIHA 5FZOA 1RUC1 1PO23 2ERFA 3TNQA 4NIHA 1E5IA 5DABA 1GQPA 1JU3A 2WA3A 4Y20B 5FY4A 3UGGA 3WQ1A 5FZFA 1V00A 4XILA 5GZFA 1J58A 2ZGRA 4LLFA 5JPMB 3IZOA 4LA2A 2I74A 4Y3OA 2DDUA 4X8PA 4OHZA 2BZDA 2WC2A 2KD7A 2Q1FA 1PVXA 1M4WA 4QPIC 4Y5TA 4D7YA 1Y7BA 4AEDC 2UYBA 2XLGA 4GWMA 4YM0A 3UL2A 4B1MA 2VM9A 4CCKA 1S1AA 2XVLA 1AR61 5A1LA 1WLCA 5ABJB 1OVSA 4HSJA 1OD5A 1V9U1 1CAUB 3VBFB 2ZS6B 3VBOC 4GAZA 2HEVF 2GC1A 4QKNA 1CQ9A 2JICA 2TUNA 4QDRA 2VZPA 1JUHA 1SG3A 4WV8A 3USUA 4RS5C 4RYDA 1DDLA 4DO0A 2J1EA 2ORZA 2Q30A 2VL4A 3GGLA 1SBDA 4DMIA 2GMEA 5DUWA 2DWRA 3ACLA 2Y60A 5BNNC 1GNHA 4B3NA 3RJ2X 2WKKA 4XF4A 4KL1A 4AEDA 4AEJA 4FOWA 3JU9A 1UF2C 3AC0A 4GJYA 4QXCA 5DAVA 5LRSA 2VTFA 3ACHA 3OGRA 1UZWA 2BU9A 3P6BA 4LPLA 3ZFGA 1W3XA 4NPRA 4HFSA 1EP0A 1TNFA 4QM9A 1OMIA 3WW1A 1UD1A 1GWLA 2YFUA 1ULPA 3MICA 3T0AA 2JB8A 1VRH1 3SEEA 2K0GA 3MF6A 1W90A 4TXWA 4UF0A 2A6WA 2DTWA 5D2AA 1PHMA 1HRV2 1RUF2 5BNPB 2YBSA 2OPWA 1UYZA 4XZPA 2W47A 1EYBA 4QD2A 2FCVA 4BA6A 2E33A 2VCBA 2BFUS 1KS4A 4HN1A 1CAWB 2BRTA 1AR81 2ZGNA 3WDUA 4KBBA 1HV0A 5F5QA 3PU8A 1HX6A 2JG8C 1XYOA 3LAGA 1WCDJ 3HQRA 1N3QA 4CDUC 3LGRA 3SISA 5BUVA 4P00B 4BJ0A 1C28A 1S0FA 1W6NA 2EICA 2WO2A 5F3CA 3GBGA 1C8NA 1CJPA 1VAMA 2ZMKA 3T4VA 4CYDA 1XSRA 1UYPA 5FP4A 4XPVA 5FWEA 1YQ5A 3VHPA 1YQ6A 5LBCA 3NJVA 1C1LA 1GKBA 3LFIA 5AVAA 2ZKNA 1AXYA 3ZMNA 5C3RA 5IVJA 1SPPA 1EV13 3GCWA 4V1PA 3B9CA 3N7MA 3LEIA 5E88A 3RQ0A 5FYZA 1SEFA 5C3OA 2XQRA 4CDUA 1V6JA 1ONAA 5H9SA 4I0BA 2J1RA 4H55A 4YW3A 1OLMA 2BGOA 3RMXA 2H6CA 3T09A 3W21A 4RGGA 1JHJA 3CU7A 1HRV3 1RUF3 2WNUB 1HRI3 4XBNA 3ZPYA 2WFF2 1XB9A 2VMFA 2XLAA 2Y0OA 2ZTNA 1LECA 4LKDA 5FZMA 2CAUA 1FOD3 4FXGB 1DQ6A 1MEC1 1W05A 1QJEA 5EYXA 2Z42A 1W3VA 1DHKB 2VUDA 2VUAA 2R071 3MW4A 4AFBA 2P6CA 3DXTA 3POJA 2CYFA 1ND3A 5LY1A 4PLNA 1JZ7A 5DAWA 1RYYA 3POSA 1ZZCA 1MPXA 3PHMA 4B29A 3M4FA 5IVFA 1HIXA 5CAZA 5A6QA 5FZ9A 1K45A 3VBOB 4IV1A 2BNMA 4XEZA 4YW1A 3WP4A 3HN3A 1KJLA 3R0RA 5HCAA 4HBNA 3I59A 3DPRB 4I01A 4YVWC 5IVBA 3RZZA 1WCUA 4RS5B 1QY4A 4XJZA 1FNZA 1A78A 1NLRA 2VZSA 1R092 1S2KA 1UKGA 2BGPA 4D69A 2A71A 5FBJA 3AP4A 1BBT2 1F35A 4BQ5A 1N1SA 3CJXA 2RDSA 3M7AA 4LHNA 1OI6A 1SCSA 4Q0QA 4Z2AA 1K5MC 3ITQA 2E31A 2ZGPA 1B35B 2PHRA 2FDFA 3V56A 1VMHA 1MS3A 4DS0A 1DZTA 1PK6A 1RUJ2 4B4QA 3RI8A 4CU6A 4KWKA 4BOWA 3WCSA 2WFF3 2WO7A 3ILRA 4OI2A 5FO7B 4SLIA 3C7FA 5L36A 2GDFA 4FO9A 4I3GA 4LO6B 4XC9A 1QJX2 3I49A 2FDHA 1PGL2 1H6XA 5CFDA 2YC4A 3E6BA 2YMZA 3HEIA 2JX9A 2WQ8A 4W8JA 2OUHA 3WDWA 1ZYBA 1K5MA 2R061 5FXWA 1DU3D 3M1HA 4AW7A 3OG2A 3TWIA 2ZZJA 1GQGA 1S0GA 5C3SA 2JG8B 3IPVA 1UOBA 1DGLA 3K75B 4UW5A 4Q8KA 2ARXA 3T2PA 1MQTB 2QZ2A 1T6BX 1U5XA 3T2OA 3EMRA 4IW3A 2I45A 1L7QA 2WDBA 3CZUA 2IUWA 4XQDA 3VZNA 4DUXA 3KWVA 5JSPA 5JUVA 1O3QA 3H1WA 1Q43A 2YHJA 1O7FA 4OZXA 4XIKA 3SKVA 1X9PA 4QPGB 3C8XA 1VRBA 2RS51 1LU1A 1CAXA 2CL2A 4PBOA 3D0SA 1QQP1 2ZGSA 4Q27A 4W6YA 3S30A 4C1WA 4F8AA 3AMNA 1H8TC 1W9FA 4Q1RA 2WZPP 4MXVA 1NCQB 2D5FA 3UKVA 1RUJ3 5A6ZA 3HWJA 5BXXA 2WZR3 1LHNA 3VBUA 1E5RA 3DL3A 3M3OA 5KXEA 2A6YA 5IWFA 1QJX3 1ZRDA 4NJ4A 1DGRA 3X29B 4PDWC 1V6KA 1YFYA 5JLVA 3N9QA 3VBRB 3RSJA 4LUMA 5T50A 1QOSA 4MOAA 4XJAA 1GLHA 2HWC2 1NA1B 5DPNA 1W8NA 1ZRRA 3KD4A 3SQOA 3LCPA 4JGZA 3ZN6A 4E2SA 5FK7A 2OXBA 3B5LB 5FMBA 1OURA 3D3AA 3NKTA 4HG6B 2PQSA 4XUTA 5KXDA 4FPLA 2ZGTA 3AJZA 5DG2A 4WM7A 2PYTA 1PO12 3WX5A 2D3SA 1GP4A 3DGTA 1DYKA 4CCMA 4YVWB 2I07B 5HV0A 5CVRA 4PCRA 4PDWA 2FHRA 1VBE1 5L19A 3PUIA 3DN7A 4O7XA 1U0AA 5H9RA 5HBAA 2ZX0A 4Y4YA 4QPWA 3FUOA 2PHXA 2JDPA 1SZBA 2P17A 3C7OA 1U5IA 1JH5A 1TE1B 3N36A 4ATEA 1KGYA 3E5QA 4FI9A 1VR3A 3SC7X 4TZDA 2HWF1 1XU2A 1KFUL 2YYOA 3VN4A 3NQHA 2GP5A 5FOBB 3BOPA 2VE1A 3LOIA 5JMCA 1O3TA 3CDZB 3MIFA 5A33B 3QH6A 3ACFA 1OH3A 1AYN3 2B5HA 4ZU4A 2WT2A 2GH8A 1FATA 1XNBA 3I3EA 5CZKA 3BI3A 1DLCA 1W8TA 1Y4WA 3ZFFC 3GBWA 4QQOA 5LB6A 1TG7A 2Z4FA 5KHKA 3BOWA 2HWC3 4AVVA 4CSWA 4UXAA 1LHUA 3NNLA 5LWBA 1XNCA 1L7LA 3PMEA 5F39A 3ZSEA 3ORJA 3GCXA 1W6OA 2J1VA 4KGGA 1MS5A 2D5HA 2WJSA 2VZUA 2VU9A 3BU0A 2GALA 3KSCA 5EYYA 1PO13 4BMEA 3ACIA 2FDIA 3J8F2 5FMDA 3LSDA 1NLQA 2R0FA 4COZA 2IFRA 1SFPA 3ZFFA 2VW2A 2DCTA 3N3HA 2XBO2 3N9OA 4X6QB 4LMFA 5HXVA 4HSLA 4WM8C 3VZLA 4QGLA 1DQ4A 1TQ5A 2R1BA 2R0HA 2HBUA 1JHNA 2ZEZA 5C4WA 2C26A 3A0NA 2VUJA 2RS31 3J7MA 3VD5A 2E6VA 3GNEA 4UOJA 4N9IA 4GULA 4PLOA 4Z82A 2YU2A 1DZQA 3OCPA 4NHXA 1ULEA 2VZOA 5LA0A 5FZLA 4R9AA 3UGFA 3O1SA 1PZ7A 1OT5A 2OX0A 1RC6A 3BCWA 4Q8LA 3QOPA 2ZGOA 1H2NA 1VMJA 3JZVA 3AFGA 4B7KA 2ZABA 1S55A 2GNBA 3ZDVA 1UY1A 5L7OC 2A6XA 3HNBM 1AR71 3L9JT 2BWCA 3ZKUA 4I0AA 2XOMA 3JQWA 4ZKTB 1FMD1 2EAAA 3LDKA 1QJY2 4HPKA 1PM7A 5FMOS 1UIJA 3WQ0A 4NUBA 4YW6A 1Q8PA 3TEXA 1D4VB 1ULCA 1RUD1 3J8F3 4BQ1A 1O4YA 5H9QA 3APBA 1O91A 1AYM3 2UWBA 5K0UA 2PAMA 4BZ4A 2XBO3 5L7OA 1QH7A 1LR5A 3KCYA 5I8TA 3T1MA 4IV3A 4AEMA 2VW1A 4DXRA 4EWAA 3LA7A 2JJ6A 3FLTA 3HVDA 4BB3A 5LCWL 3POGA 3GXUA 1DLLA 4RL7A 2A3XA 2AC1A 4NRQA 4AK3A 2O14A 2RJLA 1UMZA 2Q8DA 1GSLA 4RHV2 1JW6A 3NNFA 3JD73 3KV6A 1RXFA 2QDNA 2RR13 1AR62 4U2AA 4AI8A 1J3QA 1NQDA 4AI1A 4YSFA 5BNOA 1V9U2 3ILNA 3G6JB 3OUIA 4YVSC 2H6BA 2VBPA 3VHOA 3TRSB 2HJIA 3AXEA 3WG4A 4ZY9A 4AVBA 1SBFA 3AMMA 3NW4A 4KMQA 4AGRA 1BYHA 2ZPXA 3ALQA 3M3EA 1GZWB 2VW0A 1O8SA 2D6LX 4NE9A 2WYSA 1QJY3 4JGYC 5ANQA 3OBTA 1EY2A 5KXBA 1KJRA 4BH9A 4LTAA 5DDJ3 4JC1A 4YM3A 4ES8A 1YQ2A 4XFAA 3D0JA 3THDA 1JYCA 4XUPA 5A3PA 5BV6A 3Q8BA 4GXLA 4LLOA 1W6QA 4JHTA 4Q0SA 3S57A 2YC2A 2YU1A 2UWAA 3A22A 3GJBA 5FZ6A 1OLQA 1RHI1 3NNMA 1O4ZA 4HOOA 2W91A 2PHUA 1YQ8A 1BEV1 5ANNA 2XUEA 5FOJB 1GFF2 1VRH2 4Q26A 2R7EB 1RUC3 2CWMA 1RUI1 2JB4A 1N3PA 4WM8B 4YZ4A 1MS1A 2VR4A 2FMYA 4NHMA 4QX1A 3MIHA 1MACA 4JGYA 4QQPA 5F32A 3OGJA 4NPMA 2NN8A 3KF5A 2NZ9A 2Q8OA 4XMAA 1OLME 1AR82 3ZXFA 1JS9A 4O65A 1QHDA 2EIEA 4W65A 2OT7A 1AR63 1LHOA 3GHNA 4ZZ5A 5AC92 4XZUG 1V9U3 3D5OA 4N53C 4QAWA 3VL9A 5L9BA 2EIDA 4V2VA 1ULGA 2BBAA 4AFDA 4Y22A 3W5MA 1Y43B 4BQ3A 4LBLA 1REEA 3IAQA 2BGCA 1VPHA 2B7YA 3OEAA 3ZYIB 4BK5A 3I54A 5A7NA 5GZDA 1W04A 4OHYA 4YYOA 1W8OA 1GWMA 5KWRA 5IAXA 4Y1UA 1WCQA 3DKWA 4CDQC 4IEVA 3FLPA 4UFIA 2ZMNA 3OBZA 5JAXA 4WZCA 2PHDA 3VDDC 2OZ6A 4XHXA 3CJIA 5JXHA 3K4ZA 1OQ1A 2YV8A 4KGQA 1JUIA 1VRH3 4AAPA 4OLLA 4M3CA 4CEWB 1PIV2 4JDNA 3W59A 3WNKA 1VAKA 5HCFA 4WVMA 1HB4A 4U36A 5CFCC 5IHRA 1W2AX 1WMEA 4P02B 4YFZA 4OUSA 1E5HA 1F5FA 4XUNA 4MUVA 4A3XA 1MEC2 1WMFA 3OPZA 1WLDA 3P1IA 5CADA 1JYTA 3IT8A 2HWB2 2JIGA 2ZJCA 3SCHA 1VB4A 2R072 1OPOA 1AR83 1LOBA 3OPTA 1OOPB 3B00A 4AHZA 3VDDA 1ENQA 2AR6A 5K9YA 2DVFA 2AYHA 3M70A 2LROA 3LQCA 3ZN5A 4MADA 4AWDA 3GDBA 2D3RA 1O59A 2GNDA 2WQ4A 3MUY1 2J42A 1OA3A 2DVAA 4HN0A 4XIOA 3VL8A 5CFCA 2VMEA 3B94A 4K8RB 3THPA 5LEKA 1S4CA 3F95A 3WP6A 2RM22 2IZWA 2C24A 3NJYA 4IEPA 4IERA 4QX3A 4UT5A 4YGEA 2R32A 3WQ7A 1F8VA 5F1RA 3P5BA 3VD7A 1CZSA 2YROA 4WVZA 3T4HB 5HV4A 3B02A 1YJLA 4QDQA 4KI5M 3N9PA 4OI1A 3KLSA 2A70A 1LAJA 2SLIA 1UU4A 3U0ZA 5LASA 1QU0A 4NMIA 4QB1A 2FZ2A 1JU4A 1HB1A 4AFAA 3LSEA 1JTZX 1O5LA 2K46A 2BOJA 2ZX1A 5CBLA 4FTEA 3TOJA 1X36A 4C90A 4EWEA 2NPIA 3VUOA 2W52A 1H2MA 1ST8A 2VOKA 2YPDA 3BIWE 3SH3A 4Q5OA 1L3JA 4YNIA 3ZM8A 4R9DA 2Y6GA 2JD4A 4AI2A 5FYUA 1MEC3 4META 3U75A 3WDTA 1OLRA 2R073 5I93A 2A3WA 1WD4A 2C4XA 1YYNA 3S5AA
chains in the Genus database with same CATH topology
3A4UA 4ATFA 1DBNA 1EAH2 1I6XA 3WW2A 4N53B 1DIWA 5JZGA 3PMSA 3V0AB 1RB8G 1PGW2 4YZ5A 1BVVA 5DZGA 3AKTA 4HZFA 2V09A 3AKQA 2RS52 4CDQB 5FAXA 4COVA 4FQ4A 1RVF2 2X5IB 3R4DB 3B7MA 3R4UA 3WUCA 1KFXL 2YGLA 4PIXA 3ZSLA 1QQP2 2R041 4CEYB 4MH0E 4Q4V1 4BPZA 3FX3A 3WW4A 3AFKA 5J7MA 2ENRA 4PQ9A 2JG9B 1W0OA 3O14A 5DUVA 5IK7A 5FO8B 3PJYA 1IOAA 1LGNA 3WINE 1UN1A 4N90A 4E9KA 4RD7A 3OTFA 2VXRA 1HDKA 1LENA 3ZYPA 2R063 2EXKA 2IC1A 1Y9QA 5C33A 1QF3A 1UU6A 2DUQA 4AI0A 2Z2SB 1F31A 4M0NA 4P9YA 1SDWA 1YXWA 1OHFA 4ORFA 1POV1 3WNXA 2YXSA 1VBC1 4DPNA 3FC0A 1ZZ8A 2HWE2 2ZX2A 3MIBA 4BLIA 4W6XA 1GICA 1B09A 1W6MB 2OZJA 4LHLA 5E16A 2RS53 1DQ0A 3M8LA 1CAUA 1RVF3 4IQPA 2PHWA 3M2MA 5FDBA 3WW3A 3A0KA 1QQP3 4QHBA 4R9BA 4LNVA 1SQ4A 2HWF2 4XXPA 5C8CB 3SCGA 1VBA2 4GALA 5FQ0B 4B8EA 3V0BA 4GMP0 3KQRA 3GZUC 5B2GB 1G86A 3AZWA 5T52A 2KA3A 5D8AC 2VG9A 3ZDSA 5AFEA 4RGAA 2P34A 3NL1A 1CAVA 4HK8A 3OD0A 1QKQA 1S0CA 2ETEA 3AMHA 1KDMA 5EV7A 3ZFEC 5BNPA 1AR91 3AJYA 4YGCA 1RJ7A 4Y1YA 2MNGA 4QQ2A 4AHXA 1Q3EA 1S0JA 3GBFA 4FP3A 4AVTA 2IWGB 1G9CA 5D8AA 3HR9A 1CAWA 1H9PA 2HWE3 4Q0PA 1AF9A 2ATFA 4UBHA 1JXNA 1VBE3 5JOWA 3WUDA 4RA0A 3ZFEA 3H7YA 2FMDA 3ES4A 3GZTB 3ZFGC 2DUOA 4KU7A 1IKPA 3RI9A 3H1YA 1HW5A 2WSUA 1W0PA 1MS4A 2HWF3 2D98A 2H0VA 1VBA3 1XNKA 1ZM1A 1LTEA 3H3ZA 5GLZA 1BMV2 2P37A 4OVEA 1ND2A 4AXOA 3MIDA 2XKPA 5T5OA 1CPMA 2XWBB 3SITA 5EWSA 4CDXC 1YI9A 1EV12 3E97A 1AR72 5GJ6A 1HXS1 2JEMA 2WT1A 3ZSKA 1GR3A 2WNVC 1AL21 1ASJ1 2CGNA 1A6CA 3B9IA 1U5YA 3MZHA 4JCKA 4ITCA 3ECQA 3WDXA 4AHYA 1G9FA 1HRI2 2BQPA 1RUD2 4K40A 4AFCA 4AG4A 5T55A 4CDXA 1FOD2 4Z8BA 3WP3A 4CP2A 4F83A 1QDCA 1HQWA 1MZEA 2H0BA 1V6OA 4ZU5A 4DFSA 4Y1XA 2WNVA 1D2QA 5EZWA 5KHHA 4XW3A 2K2SA 2VNOA 2AH2A 2PELA 1PGSA 3NO8A 5FREA 3UK9A 4JVAA 3V64A 1Q8SA 3FMGA 5GLVA 1SFYA 4CRQA 2VMIA 4EN8B 4R4XA 5C9AA 2VOXA 1VALA 2Z79A 4URTA 2IFWA 1W39A 2QJVA 3ILFA 1AR73 2DCYA 3T1LA 1ZA4A 3WVJA 1ND3C 3IWZA 1BXHA 1I1EA 3M3QA 3NV4A 1FMD3 2WQZC 3TYJA 4LEJA 3PLQA 4H14A 1VLNA 4IV1C 1DGRN 1A8DA 4I09A 1RUD3 1NQJA 3BTAA 3USUB 3E5XA 4B7EA 2GMPA 4QPIB 4XF0A 2GC0A 2RMU1 2XKOA 1CD3G 2GNMA 4Q0VA 2OYZA 4AEDB 5J98B 3AB0A 4GMP1 4QM8A 4XMIA 3VKOA 1YUDA 2YGMA 3ZFGB 4SBVA 2NQYA 4R52A 2XJUA 1M06G 4O9GA 4GQ7A 1PK6C 3UV9A 4YZ1A 4Q4X2 2K9ZA 4FPGA 2ET7A 4M3CE 4QPGA 5LRRA 3HMYA 1LGBA 1KS5A 2ILMA 5BNNB 4LBJA 2R16A 5CFDC 5JR7B 1IHMA 1FV2A 3AMQA 4DY5A 2EXIA 1HKDA 1Q8VA 2EF6A 1NCQA 1BJQA 1CX4A 4KU8A 1F2NA 3WZ1A 1LULA 2LALA 2RS11 1W6NB 2WZR2 3MIEA 3O12A 4IEQA 2XJRA 3H50A 1YIPA 4RQPA 3S6PA 1RHI3 2AUYA 5JI7A 3SH5A 3KGZA 2LTNA 1LODA 1FAYA 5ACA2 2ET1A 2O8OA 1BEV3 3IKWA 2IXJA 1N1TA 1VP6A 1RUI3 2W68A 1IS3A 2Z69A 2ZX3A 2WS91 4XFFA 2QE3A 4BE3A 3LOBA 3BB6A 4CDUB 3KGLA 1LOEA 2XJTA 4FCAA 2NMNA 2AENA 4Q4X3 2DVGA 4MVTA 3OBRA 4MXWA 3KCXA 5FLJA 3VBUC 2F6BA 1DGWX 3H9AA 3U11A 1J3RA 4IXLA 1ENSA 4W6WA 4EROA 1QNWA 2MEV1 2DV9A 1N1VA 1BVP1 3PNAA 2DU1A 3HBZA 4LUKA 1SLAA 4S2GA 4IL7A 1QWRA 1OKQA 1F5JA 4JGZC 4HVQA 2C1FA 1O4TA 4XQ4A 2PLV1 2XB6C 2A75A 2B46X 1FYUA 2ZMLA 3D6EA 4IV1B 4WM7C 1XNDA 1AYN2 1AXKA 1SBEA 3I59B 4UW6A 5FTTC 1RUE1 3MI8A 5ACA3 2XWJB 3EQEA 1OFSA 3FFQA 3N7KA 4JQRA 4Q4Y1 2ZBJA 3OGGA 4L92A 2ZACA 1ZBA2 1ZX5A 3WT3A 4Y24A 1NY72 1PVC2 1JBCA 2ZAAA 4AGVA 2BEOA 1PK6B 3ZIWA 4XFCA 4K9SA 1YFUA 2ZX4A 4TLFA 1OSGA 3AP6A 2HWD1 5GLWA 2BVBA 1TNRA 1WLWA 4RSUA 1NCRA 5CFDB 1RIRA 2Q4SA 5L73A 4J1WA 4ASMB 5E89A 5LK7B 1H2LA 1K5MB 3GHMA 4LE4A 5JCTA 2VQ0A 1H0BA 4AI3A 2EVXA 4TYSA 3TN91 4COWA 1C8M1 4FXKB 5I0UA 4I3PA 2R30A 2PHTA 4Q4V2 3AXDA 1QXJA 3MFCA 1XU1A 4FPCA 4H7LA 4MYEA 2CGPA 3ZYJB 1SLCA 2PAEA 3HN1A 3RDIA 3HD8B 4B4PA 2YY1A 2GC3A 4E4ZA 2LM3A 3PVNA 1CAXB 4LA3A 5C4WC 1ZBA3 4XFBA 1PVC3 1Z0HA 4NHKA 4GIQA 3JBG1 5CIRA 3MDPA 4LO4B 2DTYA 4F7ZA 3INAA 2GSYA 1AYM2 3WHUA 4BIOA 3VBUB 2XG3A 5AVPA 1RUNA 2BW8A 2OA2A 2Q1ZB 4L8QA 3PVBB 4HT1T 5A32A 4CTEA 1VBC2 4CZSA 2HEYF 4GKYA 3WY6A 4JGZB 4DNYA 2XL7A 1H8TB 4FOQA 4AQ6A 3CO2A 1VBD1 2IXCA 1DQ5A 3JD72 5KC5A 2RR12 2R043 3OY8A 3WG1A 4Q4V3 1D0HA 4M0HA 4QMAA 5K0UC 3GYDA 4PDWB 2PAKA 2WL1A 1GZWA 3IDBB 3NWKA 1WCKA 1G9DA 3KZ4C 3ZIXA 1VJ2A 4XYXA 3MIGA 4IV3C 2UWCA 2D7FA 2CTVA 4UW3A 1CESA 3MLJA 1H2KA 2W0XA 1U5ZA 5DDJ2 2GH2A 3AYCA 2OIIA 4WBBA 3VBHA 2QFEA 3QLQA 4GKXA 4KNCA 4XDQA 4A7KA 4DRRA 2E9QA 3QH7A 1IZ3A 2WWSA 3AZVA 3NJZA 3WDVA 1GQHA 5BNOC 3L2HA 2B42B 5CG8A 2PTMA 1POV3 1RUC2 1VBC3 5GLTA 1H9WA 1GNZA 4BHPA 2C9AA 2OVUA 2BWAA 4S2DA 3U07A 3ZO0B 4YZ2A 2PHFA 4COYA 2DU0A 3AYEA 4IESA 3VHNA 1LOAA 4FPJA 4Y1VA 1PNGA 4YG0A 1LEDA 3ZFFB 3FBMA 1TMF1 4Q4W1 2QZ3A 4IEWA 4XJ9A 3ZSJA 3ASIA 2YZ4A 2VECA 1AX0A 4FPEA 4XETA 3ZYGA 1YIFA 1HXS2 2D6MA 1W6PB 1MZFA 4CEWA 1AR93 2B9UA 2B45X 1J1LA 4Z1VA 2D43A 4PJYA 4QQLA 4YRDA 2ZGLA 4ONUA 1BQPA 4INDA 4HPKB 3CEWA 3VBSC 2ES3A 1XE7A 4Z07A 2P3IA 1RUG1 1ZREA 2C5DA 1AXZA 1I9RA 3HQXA 1RTVA 4FBFA 3BODA 4LBQB 1WUVA 2AREA 2ARBA 2JECA 3LB9A 4N43A 5DG1A 3CJIC 3ZN4A 1YWKA 2B8MA 1S0BA 5L7OB 4HMZA 3SH4A 4IV3B 1KDKA 4FPOB 1TME1 2MPFA 3VBSA 4NOTA 5IK8A 5FBZA 2GU9A 2N7GA 4GB31 4GH4C 4QPYA 3JUUA 2SBAA 1OQEA 2VMHA 2ZCWA 2P3KA 1HXS3 4RR3A 1R091 1AL23 2VQAA 1ASJ3 2CWSA 3B69A 4DZGA 1BBT1 5BNOB 4EWDA 1WLTA 2A73B 3OJBA 2D6OX 4DY3A 4BYYA 1KRIA 2QUOA 1WCSA 4XF1A 4XTPA 4EN6B 1B35A 1C1FA 4QT6A 3ZXDA 2VMGA 3J26N 1RUJ1 1V6IA 4GH4A 4CDWC 2RMU2 2CY6A 1QGLA 5JSOA 2CV6A 4M01A 4YGBA 3J4UH 1PGL1 4L97A 3AZXA 3N7JA 4S2HA 3ZXAC 1MVEA 4LO5B 4YVSB 4NN0A 4OHXA 3V65A 2NM1A 3E6DA 5FPZA 3RNSA 2YPJA 4FTSA 2O8QA 4BIFA 2W08A 1IKQA 4JGYB 4JRLA 4CDWA 2DFCA 1O3RA 1QDOA 1H8VA 4M00A 3IMNA 1PMIA 1DQ2A 1Q5OA 5I91A 1I5ZA 3QACA 3RMYA 3GF6A 1WA4A 4EJRA 1H4GA 3OYWA 4YARA 2UY8A 5JZGC 3E5UA 1RUOA 2RS12 4Y22B 4BM8A 3DF0A 4QGMA 1F9KA 2WT0A 3FJSA 1H1AA 2ZGMA 1RUH1 4MGIE 1CIWA 2RMU3 5JI9A 2AZ5A 1J59A 2R062 1WD3A 5J09A 4GMP3 4ZXKA 3KS7A 4I2OA 1J1TA 4X6RB 4AF9A 1ZBE1 4MV2A 4H3WA 4TWTA 4MLOA 3UJQA 3CJIB 4C0HA 4IETA 2BVVA 2OUJA 1W6MA 2DVDA 5K8SA 1LOFA 3NAPA 4B4RA 1LCLA 4OHWA 5E8AA 4YM1A 1E57A 3N4MA 1ZZBA 4WVMB 1YRZA 4YGDA 1AHSA 1Q8QA 3OD4A 3AKSA 2UURA 2MEV2 1UX6A 1D2SA 3HAGA 5C8CA 2VVDA 3IN9A 1UZYA 5FQ0A 2QCSB 3VDDB 1WW6A 4JTOA 5CA6A 5GZEA 2XH6A 3PTYA 3AKRA 3JB4C 2RS13 5J37A 4XFGA 4E2QA 3ZXJA 1ZRCA 4XF9A 1RGSA 5CFCB 2D3PA 3ES1A 1AL0G 3H3UA 4LT5A 4IEZA 1OA2A 1YO8A 2VH9A 2WNEA 1O3SA 2I2SA 1FX5A 3AP7A 1BCXA 4Q4Y2 5T54A 3VBFC 1ENRA 4JAAA 1WW7A 3EHKA 2YUEA 4Y20A 4A7YA 2X29A 2Q1MA 1G7YA 2E53A 1YFWA 4J6GA 5T5JA 3R4SA 2A6ZA 2OW4A 2XJVA 5KHIA 1DGWA 1VBE2 2HWD2 1UKRA 1ULFA 5ABJA 1C3HA 1VIWB 2VGDA 2MEV3 5CG9A 1HLCA 2PFWA 3VBFA 2TNFA 1C5HA 5K7PA 5F6LB 2LUWA 2GAUA 4OI0A 1QJU1 3ATGA 5CU1A 1QNYA 5BNPC 4A7ZA 1SCRA 3TN92 5EFUA 5JZGB 4R8HA 4QU2A 5SV8A 4XFIA 5D1IA 1KITA 3MEPA 1RMU1 4KG0A 1BKZA 3CL1A 3KT1A 4N7IA 5GZGA 3FBYA 1GBGA 2ZGQA 4QX5A 3KM5A 4Q4Y3 1OFNA 3ZVXA 1LHVA 3VKFC 1IPJA 1MR5A 5F6KA 4Q0UA 1XQNA 2BNNA 3NSTA 3TBDA 2ZHKA 3EBRA 4D94A 3JBG2 3KCCA 1UPSA 4NWWA 3QBQA 2WA4A 3S7EA 2DFBA 1G9BA 1ND2C 1FPN1 3AMPA 1YCIA 4MZUA 2JDZA 1I3HA 2HWD3 4GWNA 5DUUA 3SHRA 4Y26A 4YLZA 1FV3A 3B93A 5J96B 3VLBB 4FPFA 2RS32 3Q9OA 4IEXA 1XYNA 1LOGA 3M3IA 1UCXA 1UPIA 1QH6A 2WNUC 2UY9A 3TN93 5JPMB 1VBD2 1AX1A 1Y3TA 3MFAA 1C8M3 1KQRA 3IM0A 4XXAA 2G9FA 5HI0A 5IT6A 3EJKA 3I4IA 4Z2WA 5JPNB 2BUKA 2O1QA 1WGPA 4RHV1 1QOTA 1X33A 5GM0A 4JV4A 5JOYA 1W2UA 4JDOA 1HQLA 3LA3A 2ZA9A 2XVGA 4FOVA 1FMD2 1A8MA 4C0BA 4D7TA 2WNUA 1ZZ9A 3WXPA 1R081 1RL3A 3DPRC 3ZMOA 3DUIA 3PVEA 2GN3A 3JBG3 4LBQD 3V0BB 4DB5A 2XVKA 4I30A 3RS6A 1YNAA 3C2UA 3NVCA 4QPIA 2XJQA 2Q5TA 5FCCA 2ZAHA 4WZFA 1URXA 1RITA 4P9JA 4IEYA 5C9AC 1SLIA 2QVSB 1CAVB 3KT4A 3VBOA 2QKDA 2DUPA 2RS33 2XJPA 3RG0A 1C57A 3DPRA 4RS5A 3EXUA 3WDYA 1VBD3 5JVVA 4BWOA 3W58A 5BNNA 1S2BA 2EAKA 3VZKA 4X8NA 3RWNA 5D8AB 2XUMA 3D8CA 4KH9A 4XJUA 1Q56A 1CJDA 4FOYA 1TMF2 4Q4W2 5JOZA 3B01A 4IEUA 2FZ1A 3UKNA 5AC91 4P14A 4N9HA 3ZFEB 1MQTC 2ZOEB 3FHIB 2A7AA 3T2TA 1MZ5A 3IDEA 3THTA 1ND2B 1RHI2 4ASLA 4HL0A 4QPGC 1GYKA 4BMBA 1NE4A 1CR7A 1BEV2 1D4M1 3D82A 1COV1 2JG8A 5JWPA 1RUI2 5IK4A 1MZ6A 1MQTA 4AE2A 1IS4A 2PA7A 4AQ2A 4LHKA 2VVFA 1NCQC 4OI4A 1VBB1 5I0TA 1ULDA 1H1MA 1PIV1 2DCKA 1LESA 1RUG2 1SLLA 2WSVA 2XL9A 2IXKA 5I8SA 3VGIA 1DQ1A 4RQPC 2HWB1 2D97A 4NR1A 3VBRC 2WINB 1G8WA 1IS6A 1R1A1 1SFNA 4CDXB 4Q2FA 4AGGA 1NA1C 4LBOA 1TMF3 4CP1A 4Q4W3 3DV8A 2V73A 3ZX7A 4HANA 1IQAA 3WR0A 2HEWF 1Z7S1 1TME2 1UIKA 5CB7A 4HK9A 2WNVB 3H0OA 1YLLA 5DXDA 3VZJA 1X8MA 4GB32 3JCIA 2E63A 3I2DA 1N3OA 1KD7A 2RM21 2VULA 5I0SA 4S2FA 3VBRA 3SMHA 1JN2P 5LEJA 1NA1A 4XOGA 1MS8A 4WVWA 1ZVFA 4AQTA 3UKTA 2W39A 5C9AB 1BK1A 1NE6A 4XTMA 3AK0A 2OPKA 2P2KA 3SCFA 2X8KA 4OHVA 4YVWA 2JE7A 3W9AA 5T3NA 5KC6A 1RUG3 4K7JA 2VVEA 1XRUA 3RYRA 4YW5A 5BYNA 2UU8A 1G6NA 4K20A 4YW2A 1RJ8A 5GZCA 4FT8A 4E2GA 1NYWA 3FZ3A 4KG8A 4HKLA 4ISRA 1EAH1 4R9CA 4ES9A 1ND3B 1QXPA 1TME3 4TSVA 5KBFA 4Q1PA 5A33A 1PGW1 2DCJA 1SLTA 2A3YA 1ZZ7A 2P3JA 3MLLA 4GB33 4Z92B 2EXJA 1RINA 2BYVE 1R093 5DZEA 2WIIB 2ZHMA 3ZSMA 4FSJA 5EXOA 1AUYA 2MHFA 5A3MA 5HCBA 4YG3A 1BBT3 3IBMA 3VZOA 1RVF1 3WG3A 3CF6E 1NCRC 2VOVA 4MX3A 4RFT0 4EN0A 1N1YA 3POWA 2CNAA 1C5IA 1IGOA 1RUH2 4L99A 3LZZA 4COUA 1D0GA 3CNAA 4C91A 3UJOA 1N47A 4P5HA 2RE9A 2A5ZA 3WP5A 1ZBE2 4K3UA 4RQPB 3O0WA 1ZZ6A 3G7DA 3RJRA 4EN7B 3ME2A 4GA9A 3AYAA 3MF9A 2KXLA 1H8TA 2VOWA 3BU7A 1QJZA 4Y5Z0 4NVPA 3WD5A 1PO21 3IPVB 2JXAA 1Z78A 3AX4A 2YDEA 5IUQA 2HWE1 1X82A 4LULA 2R042 5LK5A 4D7SA 1CGPA 4P9GA 3MW2A 1FNYA 4MXWB 2R1DA 1YI7A 2IXLA 2D6PA 4XE9A 1LRHA 1QMJA 4YG6A 4XHBA 1YJKA 3O7OA 1APNA 4H7MA 3FUQA 3RPQA 1VBA1 1VB2A 4I0WB 3BPZA 1RUH3 3J9SA 5FLIA 4LO7A 2XLFA 3QCWA 3WOGA 3H1MA 3TNPB 4PBPA 1JOJA 1ZBE3 1SACA 3VV1A 1MVQA 1NZCA 1LHWA 2TBVA 2UYAA 1HQNA 2R6QA 4XBQA 4I02A 4WVVA 4K1YA 1DF0A 3ZXKA 1U12A 3S7IA 3ZN6B 1TEIA 2Y26A 2A6VA 2GZWA 2JENA 4AFMA 3R6SA 4WM7B 3VBHC 1HV1A 2QQPA 4QQHA 1QJU2 1O5UA 3MPBA 1EPZA 4L9BA 2QDRA 5E1RA 1NCRB 2D6NA 2B39A 3LKJA 1RMU2 3H7JA 3MYXA 3ZXEA 1BMV1 4K21A 5J3UA 3EO6A 3HT1A 1W6PA 2IXHA 4J1XA 4JRAA 1V6NA 4FAHA 4WM8A 1REDA 2RHPA 1AR92 1EV11 3C3VA 2D40A 3MPPG 4EN9B 4P9WA 4R4ZA 2E7QA 1H4HA 1AJOA 2BTVC 4FP2A 5FFOC 3ZXLA 3WV6A 1FPN2 2NYYA 5BY5A 1ENXA 1W6OB 3RYKA 1HRV1 1RUF1 1HRI1 4LBQA 1G9AA 3TB0A 5T5LA 4LO8A 1FOD1 4HVOA 4HETA 1GV9A 1QJU3 4O9EA 5KXCA 4HVRA 4CEWC 2ZHLA 4L2NA 4AEKA 2BFUL 2R49A 1CVNA 1LGCA 1AVBA 2F4PA 4PF5A 2ZZQA 5A32B 3N7LA 1RMU3 5C4WB 1ZNPA 4EV0A 1FXZA 4NO4A 3O5SA 1OOPC 4PLMA 3ELNA 3HIFA 3GZAA 4YM2A 2VPVA 4KQ7A 3R05A 2EALA 3ETQA 5T5PA 1AL22 5GALA 1ASJ2 1NOVA 1PNFA 2JE9A 1X50A 3OY8B 4N43C 1FT9A 1NLSA 1R082 1DZRA 3MW3A 4G3YC