4QB1A

Structure of cbm35 from paenibacillus barcinonensis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
GTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
total genus 29
structure length 128
sequence length 128
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb1A00
3ACHA 3VDCA 3THDA 2JKXA 3C7OA 2QQKA 1KEXA 1W0NA 2QQOA 4DXRA 2Y6LA 1PX4A 2WZ8A 2YB7A 2BGOA 2LW8A 3FHQA 2J1EA 2ZEYA 4CVUA 1JI6A 1K12A 3HNBM 2W92A 3ECQA 2X10A 3LEKA 4LKSA 1K42A 2W1WA 3SKVA 2DCJA 5EJZB 2VCCA 3I2KA 4LQRA 1JZ3A 3K4AA 1W9WA 2VMEA 1JZ5A 4XUQA 3NJVA 5F7UA 4ZY9A 1UY2A 1UY4A 3IAPA 3VD9A 2W5FA 5DN2A 3I2FA 2EIBA 3FHAA 1UXXX 2VMDA 3W5MA 2Y6KA 4A3ZA 3WEZA 3HNYM 2WQ8A 3DYMA 4MGQA 3I2GA 2ZEZA 5DPNA 2X09A 3OGVA 4BK5A 1K45A 1L7RA 4AG4A 4XUOA 5JXGA 1RYYA 4QB6A 2EIEA 3T2QA 2RJ2A 2VO5A 3I97A 3GM8A 3C7FA 1CZSA 1TVGA 4CU6A 5G05L 2VQUA 3OGRA 4DXTA 5I0DA 3J7HA 3SKJE 3THCA 3MUY1 3LEIA 5IYYA 3E1F1 2WZEA 3CZUA 4KWUA 4XVHA 4DEVA 2C4XA 2ORXA 3T2PA 1W8OA 1JZ2A 1JYVA 4ZZ8A 4PT6A 2QBXA 1I5PA 2LS6A 3WF4A 4TTGA 1CIYA 3FN9A 3VD3A 4E8CA 2BZDA 3IAQA 1EUUA 4QX0A 1D7PM 1CZTA 1O8PA 2W1SA 4CUCA 2RV9A 4UAPA 1MPXA 1O8SA 3HN3A 2XHNA 1UXZA 1XNAA 1GOHA 1LNSA 4QDRA 2WUHA 2Y64A 3C7HA 4ZZ5A 2C26A 1JZ7A 2EICA 3ACFA 1UY3A 1XNTA 1H6YA 3OEAA 2WYSA 2YC2A 3PUHA 2VZTA 2L9LA 3I3EA 4JKKA 1DP0A 3CKHA 4A6OA 2VZPA 1YQ2A 4CUAA 2YC4A 4M4PA 1GOFA 4ZXEA 1O59A 5JXHA 3ACGA 1UYXA 3DYPA 4JKMA 1ULPA 3OBAA 5DQ0A 4AAXA 2VZVA 2W3JA 3K46A 1OD3A 2VZOA 1DLCA 4YPJA 2J22A 3ABZA 2ZXQA 4BXSV 3K4ZA 3C8XA 3WNOA 4W8JA 4P02B 2E33A 3OGSA 2XQXA 3CMGA 3I2IA 1NUKA 4A4AA 2W46A 4XUPA 5C7GA 3HJRA 2WBKA 4GWJA 3VD4A 2W87A 3CZJA 4GWIA 1UWWA 4QX2A 1UMHA 2XONA 3CIHA 4A42A 3OEBA 2YG0A 3WF2A 3NRUA 4UOJA 5IHRA 3WF0A 1SHWB 4QDQA 2ID4A 3DYOA 1JZ8A 3MV01 3GGLA 1WCQA 3IDAA 2QQLA 1JYXA 1JYNA 5LA0A 1GNYA 3D3AA 3IIIA 5A1AA 1T2XA 2Y6HA 4JKLA 1UYZA 2V72A 2KD7A 2VZSA 1CX1A 1JZ6A 4OZOA 4XUTA 3VDBA 4MOAA 3FL7A 2J1VA 3T0AA 2HYXA 2R7EB 4CU9A 3WNPA 4DUXA 5B4NA 2JE8A 2W9XA 4P5YA 2DCKA 2VC9A 3OB8A 3VD5A 3A22A 2BGPA 4QX3A 3LQCA 4BK4A 3MV11 4P00B 4PQQA 3VD7A 4XURA 3WQBA 2ZEWA 4A44A 2VMFA 3ETPA 1UY0A 2XOMA 3I2JA 3K77A 2YFZA 4MO3M 4TXWA 2BERA 4MADA 2E26A 3ACIA 1JU3A 4OYUA 1F4HA 1BHGA 4DUVA 3CQOA 4QB1A 4ET7A 1W99A 3A23A 3U37A 1J83A 1SDDB 2QQNA 4MGSA 2VTFA 5IJRA 1JYWA 1ULOA 5JXJA 3NJXA 1WKYA 2E31A 5LA1A 5IFTA 3WF1A 3T09A 3NNGA 3DECA 3UESA 2E32A 2J1AA 3WNKA 3LPFA 4OUEA 2CDPA 4FI9A 1US2A 4GZ9A 1HN1A 1OH4A 3AC0A 4D0QA 2C9KA 2W95A 4BJ0A 4P08A 3HOBA 4CU7A 5LCWL 3UETA 3BGAA 5LA2A 4DXSA 2VZQA 4Z2AA 4QPWA 4XUNA 1UMIA 1UX7A 4CUBA 1DYOA 2W1QA 1OF3A 1H6XA 3I2HA 5CZKA 1GU3A 4PF1A 2PQSA 3BN6A 3LEGA 4W50A 2OKXA 1PMHX 1SG3A 2B4KA 2X05A 5EIYB 3F2ZA 3VDAA 2B9VA 3T0DA 2J1SA 2BBAA 3GDBA 3LPGA 3T0BA 4BDVB 1K3IA 4HG6B 3MO4A 2WO2A 3K75B 2VR4A 5G04L 3I3DA 4KI5M 5J1XA 1UZ0A 2EIDA 2QQIA 4CU8A 1F4AA 1GOGA 1NAEA 1GQPA 1W9SA 2WAAA 4JHZA 4M4RA 4OMCA 1UY1A 2DDUA 1OF4A 2VCBA 3WNLA 3I3BA 5CYYA 2W91A 3C7EA 2V5DA 3EYPA 1IQDC 2CDOA 4QAWA 2JDAA 1NKGA 3MBWA 4LPLA 2VZ1A 1JU4A 3HPNA 2WN2A 2QQMA 2VQTA 2VOTA 1OT5A 3GXUA 1KGYA 3OG2A 5HXMA 3ZM8A 3A7QA 4KMQA 4A45A 2J1UA 3UNPA 1R64A 1TG7A 1JHJA 3HNMA 4DEQA 3P1IA 2VZ3A 4RYDA 1CZVA 2VZUA 2WO1A 3T08A 4ARYA 3IB3A 1EUTA 3EB7A 2HLEA 2V4VA 2VZRA 4QX1A 4RN5A 3JXSA 1PX3A 1XPWA 3P6BA 1W9TA 4QB2A 3T2OA 4OMDA 2JD9A 2Y8KA 1L7QA 5DMYA 2QQJA 2W47A 4A41A 3A21A 2ORZA 1JZ4A 3SEPA 1J84A 3HEIA 5JMOA 2VL4A 1UYYA 2YFUA 2ZEXA 3SEEA 2RVAA 4LHSA 4JX0A 5C71A 5FUIA 3NQHA 2WN3A 1GUIA 4E8DA 4XZUG 2J1RA 5JXIA 3LE0A 3WNMA 5EJ1B 2WABA 2VMCA 3PUIA 4UI9L 3WNNA 2Z4FA 4IUGA 2VM9A 2VJXA 2WDBA 1NX9A 1W8NA 3W5NA 3WF3A 5C70A 5B4XA 3WSOA 4L0PA 1GMMA 1P8JA 5IFPA 2J7MA 5JR2A 2VCAA 4W4ZA 5HPOA 2J1TA 5JUVA 2W1UA 3CDZB 1XC6A 4D8MA 1US3A 4DUWA 3K4DA 2Y6GA 2WO3A 2WAOA 1PMJX 4QDSA 3C7GA 2Y6JA 4ARXA 3MUZ1 2W94A
chains in the Genus database with same CATH superfamily
4Y1UA 5LY2A 2LTNA 3THDA 3C7OA 3NAPA 4PCRA 4E4ZA 5DAQA 1YHFA 2OW4A 4GH4A 1SCRA 3TEWA 2ZX2A 4KG0A 3L2YA 3OY8B 1Z0HA 5DUWA 5FY5A 5FY1A 1QQP1 4NWVA 5GZEA 4DXRA 4AVBA 3KHBA 4N9IA 2JD4A 1DGLA 4YM3A 3PLQA 5E16A 3VBSC 1Y9QA 1QJEA 1WGPA 2LW8A 1COV2 5FYCA 5CISA 3NJYA 2J1EA 1G6NA 4KL1A 3VBFA 4QQHA 3I54A 2Z42A 1CGPA 3LDKA 1VBA2 4EWEA 3RNSA 4COWA 4NIDA 2ES3A 1UQXA 2X10A 3N9MA 3O0WA 5FYHA 4LXLA 2D6PA 4BCUA 3EMRA 4LKSA 2XBO2 1WLTA 5GLZA 2R063 3SKVA 4A6SA 3OY8A 4RR3B 4CDQA 5LRRA 2YBPA 1GANA 4MXWB 1LCLA 1RUI2 3AFKA 3WR0A 1JN2P 3AXEA 3WDVA 1RMU1 2VMEA 1JZ3A 1VRBA 4MXVA 4XFHA 1JZ5A 5E1RA 2P3JA 1GP4A 3E5UA 1U0AA 2MEV3 3WHTA 3NJVA 4F7ZA 4ZY9A 2WO7A 3IZOA 5A7NA 1QJX3 3G7DA 1RXFA 1YJLA 1ZM1A 2XHKA 5HI0A 1DQ6A 4OHWA 2BBVA 4FPKA 2XJTA 4RQPB 3VB9A 1H0BA 4XF0A 2ZMNA 1E5IA 4RR3A 3WQ1A 3JD72 1PHMA 3SH5A 2DTWA 3NV1A 4XJ9A 1ZBA1 3JBG2 1W8UA 2WQ8A 4XCAA 3GHNA 4XPVA 1VB2A 4OQ9A 2B39A 1AR61 2O1QA 5D1IA 5FP7A 4FO9A 3HBKA 2F4LA 3TRSB 1PVC2 4ITCA 1AR72 3UGFA 2XJSA 1RC6A 2Y0IA 3KS7A 4S2GA 4XUOA 5IVCA 5FZIA 1SLAA 1IKPA 1N3PA 1Q8PA 2EIEA 3GHMA 2AEYA 4I01A 3ZKUA 3K3NA 3J4UH 4RQPA 5JSOA 2RJ2A 1RJ7A 4O65A 2H0VA 3N36A 3WHUA 1ONAA 1W2OA 2ZHKA 1VP6A 1NYWA 3UT0A 5A7SA 1VBB2 2Z5WA 4IEWA 4IW3A 3UL2A 1F5FA 4DXTA 4XBLA 1WMEA 1ZBE2 4B4PA 3THCA 5I0DA 1S0GA 1XE7A 5IYYA 5JMCA 1HRV1 4O9GA 3DPRB 5FZ3A 2OX0A 4NMIA 3KHCA 4XVHA 2GC3A 3RJ2X 1AR92 3RI9A 3MYXA 4DIQA 3LA2A 2OZ6A 2OXBA 3POBA 4BQ5A 4L2NA 4NVPA 2LS6A 2JG8C 5F6LB 1QJU2 1CIYA 1OC1A 2VVFA 2KXLA 5LATA 1YYNA 3AMPA 3HQXA 2X5IC 1GP6A 2BZDA 4QPIC 1YUDA 1A34A 5H9PA 3ZR5A 3AXDA 4Q1PA 5FLHA 3H8XA 3DPRA 2QJVA 1XU2A 2MNGA 1RIRA 5FMOS 4NHLA 5T5PA 1LB2A 5DABA 5FKCA 1L3JA 1W2AX 2BQPA 1K5MC 2EXIA 3LA3A 3O1RA 2DWRA 4CUCA 5IW0A 4IDZA 1C8M3 2RV9A 5D8AC 4KU8A 4RS5A 1BK0A 3HN3A 3R4UA 4YWAA 5FIXA 5KXEA 4MX3A 2HWB2 3HWJA 3ST7A 3TYJA 1V6JA 3NO8A 2GP3A 1VBC2 2Y64A 3WX5A 2R32A 5AVPA 2Q8EA 1H8VA 1REEA 2SBAA 4BQ4A 1IPJA 3N4MA 3WCSA 1RUNA 2C26A 3U4SA 1JZ7A 4DS0A 2XBO1 2PELA 4CDUB 2YPJA 1H6YA 4FPGA 3OF1A 1CD3G 4FP3A 4B8EA 5F6KA 2Q0AA 1Y4WA 5T52A 3FX3A 1LRHA 1LHOA 2PHDA 4M3CF 5H9QA 4YG6A 4HVRA 3IDCB 2YU2A 4XFAA 1NXMA 3I3QA 3VBRC 3POEA 4IEPA 1LTEA 3GCWA 1SMVA 4Q0PA 4Y5SA 4OZXA 5LBBA 5FXXA 4QHZA 4ZXEA 2D7FA 4DMIA 1NCRC 4M3CB 1RHI3 3ACGA 1GFF2 2Q1MA 3WT3A 4NAOA 1ULPA 5DQ0A 3EHKA 3JD71 1QMJA 4CDUA 1RUF1 3POJA 3CNAA 3VDDB 1W2UA 5BYNA 5EHDA 5JOZA 1PO13 4MGZE 1XQNA 1UAIA 1OD3A 2WL1A 4QM9A 2VQ0A 1LHUA 4AI1A 1CAXB 4YPJA 2SLIA 5I8SA 5JZGA 4BXSV 1OQ1A 3BOPA 1ZA7A 4W8JA 4LHLA 1IOAA 1MZEA 4BB3A 1DZRA 5FZ0A 1UU5A 5D2AA 4M3CA 4JRLA 5GLWA 5FXZA 4CP9B 3KV4A 3QCWA 4NIIA 2AUYA 4I02A 4YM0A 3JQWA 4PHZA 4R9BA 2NPIA 5F5AA 4W6YA 2ADEA 4LOSA 3KT7A 3VDDA 3NV3A 4IEYA 1VBE3 1GNHA 2DU1A 1NUKA 3Q8BA 5EYXA 1FPN2 2W46A 2RG4A 4XUPA 4AVVA 3DGTA 2QDNA 4FVVA 1CAXA 1TMF2 5C7GA 1X33A 3D4KA 4Q4W2 2RJLA 2F6BA 2HJIA 1FAYA 5BNOB 4GWJA 2W87A 4AEDC 3CZJA 4QX2A 4HVQA 2XONA 1YRZA 5CB7A 5A3NA 1PGL1 1FOD3 2QQVA 2R043 2YG0A 3VN4A 3HT1A 3FLPA 4E27A 3M3OA 2WNVC 4HPKB 1BK1A 1CQ9A 1OPOA 2ZTNA 2VVDA 1XXNA 3RVHA 3HQRA 4E4SA 1SEFA 5C3PA 4RFT0 4ASMB 1DGRA 3DYOA 3R6SA 5JVVA 5GZCA 1JZ8A 4DZGA 2E7TA 2R16A 4ISRA 2WNEA 4LR4A 2YGLA 3LAGA 2MPFA 1S0IA 3ROUA 3SH3A 2BPA2 4AW7A 1IZ3A 5BNOA 5FV3A 1XE8A 5J48A 4UFKA 4KWLA 1VAVA 3AZWA 1QOOA 4Z92B 2P3IA 1JYNA 1D0HA 2VGDA 2XGXA 1DIWA 3MZHA 5A7OA 1T2XA 1NY71 3AK0A 2HWD3 3U10A 2HWB1 1NLSA 1UKRA 4FPJA 4BMEA 1MEC3 3IIAA 1G86A 1AL23 3ORJA 1JZ6A 3VHOA 3FUOA 1VBC1 1DFQA 2DVAA 2WLPA 3FL7A 1PO22 1YWKA 1G9FA 1W6OB 4JHTA 2JDHA 4CU9A 4DUXA 1L7LA 4K7JA 1AX0A 2JKBA 2JE8A 5GJ6A 2W9XA 5J7MA 2DCKA 1ENQA 2VC9A 1LU2A 5B2GB 3ZXGA 1OLME 1CJPA 2E7AA 4CP1A 1DQ4A 5FBZA 3OBTA 1MQTC 2R062 4UW4A 4RGKA 5IK5A 1TNRA 1OOPC 2XJUA 3MV11 2VNVA 3LEMA 1UD1A 3FFQA 4Q0SA 3U0ZA 4UBGA 4WVVA 5CVRA 1WMFA 1HIXA 1W6OA 1VBD1 3NVCA 1UY0A 2RJKA 3I2JA 4TXWA 2YFZA 2DBNA 1UO9A 2WS91 2FHRA 4N43B 3ACIA 5IK4A 1ULCA 2A75A 4FXKB 5I8TA 1AZDA 3JZVA 2IFRA 4OYUA 4HXCA 4UWDA 1ZYBA 3ZYRA 1F4HA 1BHGA 3HIFA 3H1YA 3HQUA 5LWBA 4QB1A 4I30A 1O91A 4YVWB 4A7ZA 3H0OA 3J7NA 4CCKA 1ZZ7A 5BUVA 2LUWA 3KMHA 3RYKA 3ZO0B 3ZFFB 4NHMA 2W39A 2QQNA 3P3PA 4MGSA 5FRAA 3WINE 4AEMA 3NNJA 1HRI3 4U2AA 5FZHA 2GNDA 5CAZA 5ISLA 2WKKA 3M3CA 5C9AC 2E31A 2QTWB 4XF1A 3WP5A 5DZEA 2VMHA 4Y24A 2VQAA 3LGRA 1BEV2 5LBFA 5IFTA 4XFBA 4MUVA 3OUJA 4WV8A 5GKAC 5GZDA 3WF1A 1O7FA 3M2MA 4M0NA 3O1UA 4XDOA 5FYTA 1QQP3 2GN7A 1ZA4A 1TMF1 2QFEA 2VUAA 2WWJA 2CDPA 3H3LA 1NE6A 1PMIA 2LROA 3ZFFA 3T3YA 2WA3A 3M7AA 1WLDA 3SISA 4LNVA 1OFNA 4OULA 4CTEA 4JGZC 5FMBA 3SH4A 1GWMA 4R4ZA 3KVBA 2P1BA 1Z7S3 1OVPA 1RUD3 2ZX4A 3PJYA 4CU7A 1Q5OA 4H7LA 5C33A 5FZLA 5A3TA 3N9PA 5FYMA 4AFCA 5JZGC 3BGAA 5LA2A 4XIOA 2DTYA 5FY9A 2VZQA 4LK7A 4QPWA 4RGGA 1LGBA 3H8UA 2RMU2 4NJ4A 1YXWA 2JIGA 4GH4C 2C1FA 4IEVA 4ATEA 4FPOB 1RMU3 5C8CA 2W1QA 4FCAA 4FPHA 4L97A 5CZKA 3DN7A 5GZGA 1GNZA 4XAAA 2PQSA 2Q4SA 4L92A 2DFCA 1XRUA 2X05A 1FMD3 2NMNA 3IN9A 3F2ZA 3CJXA 3VBFC 4CCNA 3VDAA 1A8MA 4LT5A 3FBMA 2OQ6A 2BBAA 1C8M2 1EV11 3GDBA 1N3QA 1ZBA3 3ZXJA 4HL0A 2K2SA 3LPGA 3UK9A 4LO7A 5BNQA 1ZRDA 4LTAA 5BNPC 5FPZA 4CDQC 1SLBA 4FPFA 2ZZJA 4AI3A 3I3DA 4KI5M 4PQ9A 4XJUA 4GKXA 4BE3A 4AEJA 5FK8A 4CU8A 4V2WA 4C91A 1GQPA 3L2HA 1C4RA 3V0BB 4JHZA 2R061 2WAAA 3N35A 1O4TA 2AR6A 4CCLA 2JDMA 1OF4A 1X8EA 3AB0A 3ZXEA 4IV1B 3H9AA 2WJSA 5CYYA 3VZJA 2V5DA 5FZOB 3TWIA 2MEV1 4RR3C 4UFJA 4CXWA 2CDOA 4EWAA 4QAWA 2HKXA 1QJX1 2JDAA 3BU7A 2ZGUA 1WW4A 3ZYGA 5IUQA 1RHI2 3NJZA 3HPNA 3KD4A 4RD7A 4Y26A 2QQMA 5CFCB 1GKBA 3V0BA 1AVBA 1QXJA 3IBMA 3T4HB 1OT5A 4IV1A 2QZ3A 2GALA 4MVTA 1PO12 5T5OA 3PVOA 3VHPA 4YZ5A 1X36A 5HXMA 1WCSA 3PJQA 4IXLA 1QDCA 2J1UA 4HKWA 4RQPC 1CWPA 1TG7A 5FJKA 3ALQA 5FZOA 4DEQA 5AC91 4RYDA 2GC2A 1W6NB 4ARYA 2AREA 2ET7A 2GNBA 1CR7A 3OSDA 3DKQA 1J3PA 4DFSA 3ZFEB 5CFCA 2VZRA 1REFA 1JBCA 1SDWA 3ZYPA 3WW4A 3T2OA 2R1BA 5T50A 3KCCA 1H9WA 2UWCA 1VBE2 3POFA 3V65A 1W06A 2CYFA 1YIPA 5KR7A 2A6ZA 2IXIA 3UJOA 1V00A 3M3EA 3GZUC 2ORZA 3VKMA 1W6NA 4LO5B 4PDWB 1J84A 4GB31 4O7XA 3K48A 3SEPA 2VNGA 5HCFA 3NV4A 4W6WA 2PXJA 3GJAA 5JMOA 3H8RA 1TEIA 1UPIA 1JS9A 2ZEXA 3LIHA 3SEEA 4LHSA 4C8DA 1AYM2 4JX0A 3HVDA 2HWF3 3ZFEA 1KS5A 1M06G 4E8DA 1FOD2 2XQRA 1F35A 2RHPA 3DF0A 3I4IA 3D8CA 1H4HA 2ARAA 3DPRC 4XZUG 2DUOA 3O14A 3ZN6B 3O1OA 5FZ7A 4K6BA 4LLOA 5EJ1B 3UJQA 4ORFA 4NHYA 3WP3A 1RB8G 3G6JB 2DCZA 4OHVA 4PIYA 4RS5C 1SCSA 2VM9A 2XKPA 4PDWA 4E2GA 2WDBA 4JGYB 3WV6A 1ZZCA 2P6CA 5FPVA 1BCXA 3KV6A 1LENA 2YGMA 5IFPA 1PZ9A 1UKGA 4FOQA 3WDTA 4XJZA 1D4VB 4Q1RA 4IV3A 2VCAA 5LK5A 3ZX7A 1RUF3 1DG6A 1OLQA 3ZN6A 1UIJA 1W8ZA 2HWD2 4D8MA 4AVSA 1QEXA 4CUGA 1MEC2 1V9U2 1AL22 4DUWA 2JDKA 1LHWA 3JB4C 2Y6GA 2Q8DA 3EBRA 1ULEA 4X6RB 5FZGA 4JGYA 4S2FA 4ARXA 2JENA 1HB1A 2QCSB 1CX4A 3AP5A 2UU8A 1YFXA 2ET1A 2IXLA 1C3HA 2BOJA 1HLCA 3ACHA 5FZCA 1CESA 3GF6A 3VDCA 1D0GA 1SBDA 2JKXA 4Y22B 4AI8A 1W8FA 2QQKA 3DV8A 4J1XA 4WM8A 2BNOA 3H1MA 3IPVB 3W20A 3AZXA 2OUHA 4CDUC 1QWRA 2FDHA 2GMPA 3MGUA 1AF9A 1IS3A 2O0OA 2GH2A 2Y6LA 3B01A 4HT1T 1N1VA 1OKOA 3I2OA 3RMYA 2RS52 2WFPA 2JE9A 2I2SA 3RZGA 1NCQA 1PGW2 4QGNA 2CWSA 1VIWB 2BGCA 4FPCA 1AXZA 1B35B 1VMJA 2HBUA 3KQRA 3TEXA 2R0HA 1JI6A 3GZTB 3HNBM 2W92A 4Q29A 4Y22A 1RVF1 1W03A 4NUBA 4YW6A 4JQTA 3IPVA 1K42A 1W28A 3ZXDA 1TQ5A 4FOYA 1AJKA 4AHZA 2DCJA 2B5HA 3B69A 3VDDC 3ZPYA 4LQRA 5BPXA 4FFIA 1WA4A 4K8FA 4XJ8A 4UT5A 4IEZA 3HMYA 1HRI2 3SCHA 5KC5A 4D94A 3O1PA 5F7UA 4XJAA 1B35A 3WG1A 1WZXA 2J42A 1STMA 3KQ4B 3M3IA 1VBE1 3QBQA 5FBJA 4DINB 4YARA 2UY8A 4LUMA 1MS8A 1QQP2 3QH7A 5IVYA 2VMDA 3WG2A 2KA3A 1D4M3 1UW8A 1B09A 4BLJA 4A3ZA 3MDPA 3VV1A 4MGTA 1GZWA 3KF5A 4URTA 1OUXA 2E63A 2RS11 3OBZA 4LK6A 2D6LX 1RUJ3 1MQTB 5DPNA 2X09A 5H9RA 1RUG1 2FCTA 1ZRRA 1POV3 3OGVA 3Q8AA 1Y9MA 2CTVA 1FOD1 1HQWA 1OOPB 1Z7S2 2R041 2A71A 4N53B 5BNOC 4QB6A 1LHNA 4OLLA 2IUWA 3TN93 3WUCA 5HV0A 1KDKA 3AZVA 2TUNA 2QZ2A 2OYZA 2IFWA 2UYAA 4I0AA 5IAXA 1AYN1 2ADDA 1IGOA 1RMU2 1VBD3 2FCUA 1REDA 3KVAA 4ZS3A 3AM2A 2VQUA 2WS93 3OGRA 4FAGA 5HCAA 5ACA1 3MUY1 2WT0A 3AZZA 3ES4A 4D7YA 1FMD2 1JUHA 3FMGA 2ZHLA 2HWD1 5CU1A 4BISA 4CDWB 4KWUA 1NLQA 4GA9A 3MW3A 1AL21 2ORXA 4K1YA 2HEWF 4QXCA 3RYPA 3T2PA 1OXCA 5CKQA 1JZ2A 1RUOA 5T5LA 5C9AB 1ZBA2 1KITA 4K1ZA 4YW2A 3BTXA 2Q8OA 2EF6A 1BXHA 2BDRA 2ZGSA 1WLCA 3BALA 5GZFA 1AR62 4CEWB 2CAVA 4SLIA 4BZ4A 5F2SA 1RGSA 2A70A 2BVVA 1WLWA 3VD3A 3JB8A 1A6CA 3PNAA 1RUH3 1LODA 2XUEA 1OVSA 3O12A 2D6OX 4CDWA 1W6QB 3BU0A 4Y1XA 1Y7BA 1CZTA 4YFZA 1O8PA 2FDKA 3LFIA 4Y1VA 1O3QA 1VRH3 4E9KA 4GMP3 4Z8BA 5CKNA 5A6QA 1R1ZA 2WQZC 1X7NA 5FUPA 5CADA 1UXZA 4CEWA 2V5YA 1GOHA 1LNSA 2B8MA 4QDRA 3NAPB 1DDLA 2P6HA 2ZX1A 1ULDA 3F95A 3MICA 2ZABA 4ZZ5A 3RZMA 3CU7A 1XJAA 1KFUL 4TWTA 1W6QA 2EICA 2VBPA 3GBWA 4R8HA 4IE5A 2DV9A 1UY3A 2IC1A 4Q2FA 3UKVA 3WOGA 4F8AA 5BNNB 5KWRA 2WYSA 2YC2A 2D3SA 3BTAA 3KV5A 3PUHA 4HETA 5EWSA 5JI9A 2VZTA 5GLUA 5FO7B 3J8F3 3DKWA 4QX5A 3VBUB 4JKKA 3W21A 4AVTA 1R1A3 5IVVA 3CKHA 4A6OA 1C28A 1OLMA 3PMEA 3PIGA 2YC4A 3ZFFC 4F3JA 4K40A 1Q8SA 1RITA 4ZU5A 3AMQA 4CDQB 1TE1B 1O6UA 2RE9A 5EV7A 5L19A 1DGRN 2CSGA 5BNNA 2ZBJA 1EV13 1UOGA 5IATA 5A1LA 5F39A 4R9AA 2VZVA 2W3JA 3K46A 2V09A 2YC0A 4Q4V1 3VBUA 3H1WA 2ARCA 2RS33 3AJZA 4BQ1A 3ZYBA 1F9KA 1Z7S1 5C8CC 1RUD1 4BQ3A 3WNOA 1G7YA 3URFA 5BV6A 5DG1A 2HWF2 3RJRA 3LF7A 1BKZA 3LCPA 3ZYHA 5JR7B 4H3WA 3IM0A 3OGSA 3Q8EA 4QQPA 5FYUA 4NPMA 3SMHA 3I2IA 3H3ZA 1K5JA 4O9EA 1VE0A 3MHZA 3AKPA 2BWAA 4A4AA 1FV3A 2R0FA 4GIQA 4D7TA 1W0OA 5T3NA 2R073 2XB6C 4YLZA 2WBKA 5FYIA 2HWE3 2UWBA 2RR13 3UGGA 2FZ2A 2DVDA 1FMD1 2A6VA 3VHNA 3M3QA 3MF9A 2FCVA 3VBHA 4GWIA 1S0JA 3AKSA 1VALA 4N7IA 1G9BA 2IWGB 4A42A 4QHBA 1RUF2 3LD8A 3OEBA 3WLUA 3D0SA 3EQEA 3VZKA 3AX4A 2PLV3 5FPBA 1QU0A 3S30A 5IHRA 1NA1B 3KT1A 2JWPA 5AC93 1BJQA 5KBFA 2ID4A 3GGLA 1C57A 2QQLA 2GH8A 5E89A 1V70A 4EN6B 2XWJB 4B1LA 4ASKA 4EN9B 1JYXA 4LBLA 3SQOA 4CEYA 5FLIA 5A1AA 1LJ7A 2DVFA 2Y6HA 5T5JA 3THPA 1UYZA 1UMZA 2V72A 4L8QA 5I0TA 4YVSB 1NA1A 3A4UA 4IV1C 4OZOA 4TYSA 4H2AA 4GB33 4LEJA 4P5HA 2ZOEB 2NQYA 3WNPA 1MACA 5A1FA 4P5YA 4FTBA 4MHUA 2EAKA 1PGL2 3GZAA 5FY8A 2ZMKA 3VD5A 4RS5B 4BOWA 2WA4A 1QIQA 3FE5A 4AQ2A 4QU2A 4B4RA 3BCWA 4AFMA 5CFCC 3O1TA 4Q8LA 2WRAA 2BGPA 1Y43B 5FLJA 4COVA 1W8TA 3LOBA 3LQCA 4C1WA 2JICA 4YVSA 3JCIA 3OPZA 1UPSA 4XQ4A 3VD7A 2HH9A 4KWJA 2ZEWA 1PM4A 4A44A 1T6GC 1QH6A 3ETPA 1HDKA 2VOWA 2XOMA 4MO3M 4XHXA 4CPBA 4YGEA 2BERA 2ZA9A 1BQPA 1CVNA 2E53A 2A1XA 4UBHA 3SLIA 5APAA 1NY72 3ZFEC 4DUVA 2GDFA 4XW3A 1HV1A 1F5JA 2VECA 4WBBA 5FMDA 1D4M2 2VW0A 3AP7A 2RDQA 3KF3A 1Q56A 1S0CA 5E6HA 3OOXA 2CU5A 1X82A 4Q8KA 2YHJA 4A7KA 2HWF1 2VTFA 3BOWA 5IJRA 3ZLIA 1ZREA 4PDWC 3NJXA 3ME2A 4MSVA 2DVBA 5LA1A 1XNDA 4ASLA 4Z2WA 5FUNA 5CIRA 1W2TA 4JRAA 4YGBA 1HXS1 2VXJA 3DCQA 3DECA 4MGIE 3UESA 2GNMA 2YMZA 3AYDA 4OUEA 3KSCA 5C4WB 4FI9A 1VBD2 1E5SA 2YBKA 2WS92 5A3PA 1N3OA 5EJ3A 1JMUB 2W95A 5A3UA 5J37A 1LGCA 1R083 1APNA 4HSLA 3CHXA 1JHNA 4JGYC 4BJ0A 4P08A 4EV0A 1YO8A 4XJWA 2Q30A 1RVF3 2YXSA 1S2EA 3ATGA 4A2UA 5LCWL 4NIHA 4OI0A 1CIWA 1XYPA 5A3LA 1VMFA 4MGKE 1XBFA 2WC2A 3AP9A 4XZPA 3RI8A 4WM8C 3DL3A 5C4WA 4N90A 4COZA 3RRDA 4CUBA 3B94A 1DYOA 4HLTA 4XILA 4LBJA 3OPWA 1OF3A 4CCJA 1H6XA 4DNYA 3I2HA 3QLQA 1GU3A 1MR5A 4AQSA 2KR2A 5JPMB 5HCHA 1RUH2 3BN6A 3O0XA 2FDJA 4IERA 1NCQC 1PMHX 1WBLA 2B4KA 5EIYB 3MPPG 1IS6A 3TNQA 2F4PA 5FYVA 2B9VA 1QXPA 5FPUA 1LU1A 2J1SA 2Z2SB 2XJVA 2C5DA 3J26N 3O1SA 2EXHA 2D44A 4YZ2A 2FMDA 3GJBA 2RS13 2EA7A 4AE2A 4P9WA 1ASJ3 4I2OA 4ZKTB 4OUSA 3K75B 4HKLA 1RUG3 4IEXA 4YM2A 3ZXAC 2VR4A 5G04L 4OFGA 5FK7A 2JIJA 3DXTA 1XSRA 4UFMA 1F4AA 2JEMA 2C24A 4JAAA 1KXGA 2A3YA 1B35C 1TNFA 4JDMA 2TEPA 2XL7A 4M4RA 4Y5TA 4CCEA 3QH6A 1YFYA 2DDUA 3QOPA 1ZZ9A 4YZ1A 1AYN3 5C3QA 4M01A 4RHV1 1KJRA 3J8F2 5L9VA 3C7EA 2EXKA 2D3PA 3EYPA 1IQDC 3MIGA 2Y33A 2QQUA 3ZSEA 5FY0A 5F9TA 1GV9A 1V6KA 2GAUA 3AL6A 3SC7X 4F83A 5IT6A 4BXFA 5ACA3 4LKDA 4CXXA 1NKGA 3MBWA 3MFCA 1G9CA 3TEZA 5JLVA 4LITA 1NZCA 4OI4A 2VW2A 3PU8A 2AC1A 3CJIA 4LHNA 4E4DX 1D4M1 1W04A 1XNBA 4Z82A 1EV12 1KGYA 4KG8A 1O3TA 1KS4A 1VPHA 5FZAA 2W08A 4KMQA 5FMCA 1R64A 1RUJ1 4CCMA 1H2NA 3HNMA 5FKBA 1POV1 1EAH1 2VMIA 2VZ3A 3VUOA 1DLLA 5LRSA 1JW6A 2H6BA 5KXCA 3T08A 2WO1A 4AI2A 4D69A 5FZ8A 3H42B 3GYDA 5BXXA 3TN91 3BI3A 3MFAA 5C3SA 5CFDB 2Y6FA 2OUJA 3LDRA 3NSTA 4IEOA 1FNYA 1W8WA 2YU1A 1RTVA 2VY0A 3N9OA 2D5HA 3P6BA 4N53C 1DGWA 3VBOB 1W9TA 2Z79A 4BHPA 1N1YA 4OMDA 4LIUA 2O8QA 1F15A 2WZR1 3K2OA 2WT1A 4QQLA 4XMAA 5I93A 3O1MA 1MZ5A 1IS5A 2JD9A 2MEV2 2W68A 3NNFA 1L7QA 3AL5A 3RZZA 2XR4A 2HBTA 3HBZA 1VAKA 1QJX2 2R072 2BYVE 2HWE2 3LA7A 2RR12 2R30A 2ZAHA 1ZRFA 5FZFA 2YFUA 3LZZA 2PAEA 2ZS6B 2AGSA 5CFDA 4AAPA 3AYEA 4FQ4A 2P4EA 2ZMLA 3VGIA 4QM8A 2XMLA 3FLRA 1GUIA 2WSUA 3B00A 4UYBA 1W9YA 2J1RA 3VBOA 3LIGA 2BFUL 2YV8A 3LFMA 1EYBA 4CDWC 3RDIA 1AL0G 3WNMA 4B7EA 1ULFA 3MEPA 5AC92 1URXA 2PA7A 2VMCA 2VOVA 3WNNA 5J98B 1S2KA 1RUH1 4FQZA 3ZDSA 2TBVA 4Q4Y3 1HB4A 1HQNA 5DUVA 4DB5A 2DUPA 3WF3A 5HCBA 5C70A 4CEWC 4DY3A 1RUC3 2B9UA 1GMMA 4L0PA 4GJYA 2CGOA 1ALYA 1V6NA 5GLVA 1VRH1 5FZ9A 4GMP1 5CEHA 2J1TA 5C8CB 3H3UA 4EE2A 2DURA 3N7JA 2W1UA 3CDZB 4UF0B 1U12A 4N8MA 4XABA 1NXD1 2D43A 4LA3A 4Q4V3 3WW2A 5GALA 3ZN5A 3WDYA 4QKBA 4GB32 5CG9A 2DYCA 4XBNA 2PAMA 4AHXA 2ZKNA 2JDZA 3C7GA 3VL8A 1JOBA 2A3XA 2PQQA 2Y60A 4MYEA 1YCIA 2ZGOA 2W94A 2VULA 3ZKYA 3NAPC 3BYWA 3N3HA 1OA2A 5F3CA 4W6XA 4O61A 5KHHA 4FPEA 3J8F1 1UCXA 2FMYA 2QQOA 4UF0A 1QJZA 1R1A1 4CYDA 3MLLA 5BNNC 5JOXA 3PDQA 2E6VA 2N7GA 1N47A 1KD7A 4IQPA 5FY4A 1AXYA 2BTVC 1F8VA 2YB7A 3VBUC 2BGOA 5K9YA 4BMBA 3OGJA 4PI2A 3BPZA 4LORA 2ZEYA 4XDQA 1X50A 5I0SA 4XFFA 2WR9A 1JXNA 4XFIA 4DY5A 1ZX5A 4AZZA 1K12A 4DO0A 1IS4A 2BNMA 3HN1A 3KCXA 3SCFA 1TME1 2PFWA 3VHRA 2XJRA 1AHSA 3IMMA 1DQ1A 4FFFA 3M70A 5CG8A 3LEKA 4BM8A 2RS31 5FP9A 3ZDVA 2F17A 1Y9GA 3EJKA 5K0UA 5EJZB 5A3MA 2VCCA 5F37A 2WWSA 1ZNPA 2BV4A 1YIFA 4XTMA 3K4AA 1W9WA 3AP6A 5IK7A 2FBEA 1UOBA 1W6PB 2HYKA 4XUQA 5LA9A 4ES8A 5FAXA 4UFIA 1UY2A 3J7MA 3WW3A 3S5AA 3IAPA 2VNOA 3VBHC 5DAXA 1BVVA 4L99A 5DN2A 5L9RA 3RQ0A 3U75A 3I2FA 1BVP1 1QF3A 3FHAA 4RFRB 1UXXX 5AFEA 3OD0A 3W5MA 2R071 2Y6KA 3OD4A 2HWE1 1EPWA 2RR11 4G9SB 2XJQA 3ZPOA 3A0NA 4HOOA 3M1HA 4FPYA 3W9AA 5I91A 5JWPA 1G9DA 2DBIA 3V56A 1W6PA 2H0BA 1R082 1SFNA 2HWC3 4KGQA 5FYBA 3AKTA 3PVBB 4BK5A 2D40A 4AEKA 1RVF2 4AG4A 1V6MA 2PLV1 5JXGA 4EROA 3KGLA 1I1EA 5J96B 4JC1A 4HONA 1OQDA 5JIUA 5F3GA 4CEYC 2VO5A 2B45X 3I97A 3AMHA 4HN1A 2PHFA 3TOJA 5FP3A 3S57A 3C7FA 4FFHA 2P5BA 1NA1C 1S0DA 5G05L 1N1TA 4COUA 2XVKA 5HV4A 3J7HA 3ZXKA 4YW5A 3E1F1 1NE4A 4OI1A 1UYPA 1MS0A 4XMIA 4XEZA 4G3YC 1RXGA 3ZSJA 4BWOA 4FAHA 2ZGQA 4QX8A 1PK6B 4DEVA 1H2MA 1W8OA 3WDWA 1WMXA 3NNMA 4META 3UKNA 3HAGA 4PT6A 2YUEA 1AX2A 2CY6A 1QY4A 1N1SA 1R093 1W3VA 2RS12 4XDPA 1ASJ2 2ARBA 5FXWA 5FTTC 2W52A 4QKNA 4XE9A 4YVSC 1RUG2 2NN8A 3E5XA 1EP0A 3FLTA 4IV3B 3WF4A 3FN9A 2R042 3PURA 4XHBA 1U5XA 5DUXA 4E8CA 1M4WA 4P9IA 1S4CA 2BU9A 1G8WA 3HD8B 1A8DA 1HXS3 1BZWA 5C3RA 5DUUA 4X6QB 2P34A 1PK6A 1DYKA 1AYN2 4P9XA 2A6YA 2Y34A 2JDPA 1QNYA 1MS9A 2XLAA 1VBA3 4KQ7A 4UAPA 3E5QA 1O8SA 3NL1A 4QD2A 1PZ7A 2ZGRA 4XBQA 4FPLA 2G9FA 2D6MA 5ACA2 3VLBB 2BEOA 4WM8B 4Y33A 2WYFA 5FOJB 5L36A 5J3UA 3NMBA 2VVEA 4IL7A 2RM21 2VUCA 3R4SA 5I0RA 3JU9A 1XNTA 3OEAA 1DBNA 1H8TB 5FYYA 1IG3A 3RZKA 3ZSLA 2BRTA 4J1WA 2CGPA 1H2KA 1NCQB 1GZCA 1UNBA 1VAMA 3I3EA 1DP0A 2PHTA 1SFPA 2QQPA 2VZPA 1DHKB 2ILMA 4XFGA 1WW7A 3ZR6A 3OYWB 4LBOA 4CUAA 3AKRA 2FQPA 2VD7A 1YQ6A 1JUIA 2VTXA 1H1MA 3INAA 3P3NA 4QXHA 3CLPA 5FQ0B 1S0BA 3DYPA 1J1LA 3ZXFA 4CDXA 1C5HA 2PYTA 4AAXA 4AF9A 2A5ZA 1PVC3 2D5FA 1AR73 1H8TA 2CL2A 4HMZA 4Q4X1 3UYJA 2YPDA 3MW4A 5LBEA 1UIKA 3C3VA 1YQ8A 5FZMA 4LUKA 2WNOA 3N7MA 1ND3B 2CNAA 4QGLA 1DLCA 4JZRA 3N7LA 1POV0 1R081 3ABZA 4NPRA 5C4WC 3WNXA 4CXYA 4BQ2A 3OYWA 1HW5A 2NZ9A 2VUDA 3C2UA 3IDEA 5DAWA 4B7KA 4CCCA 3WUDA 5FPAA 1ENXA 4H7MA 1CAWB 4PF5A 5FQ0A 1GZWB 1VBB3 3ETQA 2PTMA 4RHV3 1HX6A 4A7YA 1ZBE3 1LKNA 5LEKA 1A3KA 4I09A 3B7MA 5IVJA 1JH5A 3GZEA 4NR1A 5A80A 3KV9A 2PHWA 2XXZA 1ND3A 3H50A 3HJRA 4WM7B 4Q4Y2 4NN0A 3J9SA 2BFUS 3PIJA 2ZZQA 2X29A 1G9AA 1GWLA 1CAVA 4V1PA 4GKYA 1QHDA 3CIHA 4AL9A 5FWJA 1CAWA 4H55A 3E6DA 4I0WB 1LGNA 1FX5A 4LOTA 4C1XA 3KM5A 3NRUA 2XVGA 2D98A 1QJY3 1GLHA 1ASJ1 3J7LA 4Q5OA 1YQCA 2EIGA 4X8PA 5KXBA 4Q4V2 4UFHA 1W90A 3WF0A 3OTFA 1EAH3 4QDQA 2GN3A 1Q43A 1RUD2 2YZ4A 4WM7A 1NLRA 3MV01 3B02A 1O3RA 1QGLA 2JG9B 1O5LA 3IDAA 1OSGA 3ZYIB 4BQYA 4OHXA 3OCPA 1HV0A 1YI7A 1SFYA 5LA0A 4GMP0 3D3AA 2WZR3 3EXUA 4JTNA 4I0BA 4A3XA 3BVCA 3RPQA 3I2DA 2PHUA 4Y3OA 4JKLA 2KD7A 2VZSA 2GU9A 3I3MA 5KHGA 1CX1A 3WQ7A 1WW6A 3NKGA 4XUTA 2VBDA 2YROA 3T0AA 3SITA 2XDVA 1NZIA 3BPSA 5ABJB 2JG9A 2IZWA 1ZVFA 4P9YA 1LAJA 1W39A 3ZIWA 3OB8A 4YZ4A 1LULA 4IEUA 4QU1A 1IPSA 4J25A 3KWVA 3RFRA 3UGHA 5CNAA 2FDGA 5DDJ3 1E5HA 2I07B 1ODMA 1NT0A 2OS2A 2VW1A 1MZ6A 4FP2A 3Q8CA 3K51A 3T4VA 1YQ5A 1C8NA 4I3PA 1NG0A 4P00B 3CL1A 3MIEA 3PL0A 4INDA 4PQQA 4XURA 1PIV1 1IG0A 1X8MA 2PHLA 2VMFA 4PI0A 4BU2A 5C5TA 5JOYA 3P5BA 5ABJA 1CPNA 4S2HA 2WLQA 2D93A 2E26A 4LULA 1JU3A 3FWEA 3CF6E 2E9QA 4H14A 2ZCWA 2KM2A 5FREA 3RS6A 4COYA 5CFDC 1HJGA 3WG3A 3KGZA 2XWBB 2WINB 4ZXKA 5HXVA 5FR3A 3POIA 2ZX3A 1W99A 3VBOC 3WZ1A 4LIVA 1FXZA 4HK8A 3W58A 5FPXA 3U37A 4FBFA 4IEQA 3T1LA 5LW9A 2ZPXA 2WIIB 3LB9A 1H9PA 2K0GA 1NQDA 4NROA 1ULOA 2IXKA 2HWC2 4ZPIA 1JYWA 1WKYA 2PHRA 3ELNA 3D0JA 3ZIXA 1WA6X 4NIGA 3AP4A 4Q4W3 1VLNA 1FATA 2GNTA 3FC0A 3T09A 4AQ6A 4AHYA 1HN0A 1I5ZA 1XYNA 5ERLA 2E7QA 3LPFA 3WQ0A 4LA2A 2G9ZA 4Q4Y1 2P17A 3ZYJB 1BYHA 4IE7A 5A7WA 4GXLA 2RDSA 4LLFA 5FY7A 1OH3A 1RUC1 1OH4A 4GULA 1X9TA 2MHFA 2A3WA 1QOTA 1LOEA 2ZGMA 2NYYA 3BODA 4NRPA 2GSYA 3HOBA 4LJHA 2JX9A 3KZ4C 4UXAA 1TME3 4WVZA 4ZS2A 1UZYA 2VU9A 4Y20B 3DEMA 5FZKA 3T30A 4ONUA 3UETA 4Y1YA 5JOWA 5KXDA 4DXSA 3V0AB 4Z2AA 1LEDA 2K46A 1QNWA 4XUNA 1UMIA 1R092 2UWAA 3KT4A 4L11A 2YY1A 1C1LA 3VBHB 4K21A 2WFF1 4KBBA 5F3IA 1DQ5A 1PGSA 4YW3A 5SV5A 3LDBA 3I8TA 1BMV1 4HK9A 1UL9A 4PF1A 2UY9A 1YC61 3PUAA 1GQHA 4D7SA 4YFWA 1SG3A 2WWUA 5LZ6A 1PO23 2AENA 3GALA 1HXS2 4KU7A 4EWDA 1FNZA 4Y20A 2CAUA 1O5UA 5FP4A 5CA6A 5FZ4A 3V0AA 1LESA 4IESA 2LM3A 2AZ5A 5DXDA 4XQWA 5E88A 2QQWA 1OA4A 4IGQA 4M0HA 1K3IA 2XL9A 3T0BA 4HG6B 2VMGA 3ZVXA 1QOSA 5K0UC 1HQLA 3MF6A 1H4GA 2WO2A 4GWMA 2GC0A 5BNPA 4CEYB 2P3KA 1U5YA 4FOVA 4CE8A 5A7QA 3V64A 2HEYF 1Q8OA 1V6IA 1UZ0A 2EIDA 5J1XA 1ACCA 3B9CA 3X29B 4MV2A 1NAEA 5C8WA 2PN5A 5EXOA 1FI2A 1F2NA 3LOIA 3WP4A 3H7YA 3LWCA 1IHMA 2QNKA 3ON7A 4AGVA 5M0TA 2A6XA 2VCBA 5KHIA 2JE7A 2WNUB 3VL9A 3WNLA 1YEWA 4B29A 3I3BA 3RYRA 1YNAA 2B42B 2W91A 3AMMA 1HB2A 4QPGB 3ILRA 4PLOA 2Y26A 5EFUA 3BUCA 4LO4B 3GBGA 3U07A 3S5QA 3AMNA 5F5CA 1GZTA 4QMAA 1RUE1 2AEZA 4BA6A 2VZ1A 4MXWA 3GBFA 4CP2A 4CCDA 2BW8A 1O4YA 2VBBA 2WN2A 1EPZA 2E51A 2VQTA 1DCSA 4ZHNA 2VOTA 4EQVA 5AVAA 1SLLA 2CHHA 3T1MA 5I0UA 5LASA 2WNUA 4MGYE 1RL3A 3IWZA 1SQ4A 4HN0A 4YRDA 1BEV3 2ZAAA 4Z1VA 3UNPA 4QPGA 1OI6A 2PMWB 5LY1A 3N7KA 1AR81 2HWC1 4TZDA 1JYCA 3E97A 3WY6A 4LBNA 4RSUA 4HKOA 4ZU7A 4DRRA 4NRQA 5FXVA 1LOFA 2IXHA 3EB7A 1W3XA 2HLEA 4OHZA 2V4VA 3M4FA 4YZ3A 4QX1A 1DZTA 2VH9A 3JXSA 1XPWA 4RHV2 3I7DA 3RG0A 4EN0A 3O1VA 5D21A 5FJHA 3S7IA 3NNLA 4OQ8A 2NM1A 2Y8KA 3ITQA 2BWCA 1MS1A 2QQJA 1T6BX 2W47A 3A21A 4XTPA 4CCOA 5KC6A 1KQRA 5C6CA 3E6BA 2OQ7A 3HEIA 4IE6A 4LHKA 5A3WA 2GC1A 2RMU3 3RZHA 2HEVF 3ENRA 1YFWA 3N9QA 2JXAA 2VOKA 4JCKA 4CP0A 4K20A 3BIEA 2RM23 3NQHA 2WN3A 1OURA 5L73A 4FTEA 4IE4A 1MS4A 3I59B 4WZFA 4HANA 4IE0A 4YGCA 1R091 1QJY2 3LE0A 2H6CA 4DXZA 2EAAA 1RUJ2 3FJSA 2QKDA 1PK6C 4FXGB 3QD6A 4XAEA 5IVBA 2FDFA 2RDNA 1EAH2 1KFXL 2GMEA 3S0MA 4UI9L 2G4IA 4IUGA 2D3RA 4DRVA 2VJXA 2LRPA 3AKQA 3TN92 5GLTA 5B4XA 1GBGA 1E57A 2GP5A 1P8JA 1QH7A 2ZGNA 4IV3C 1KDMA 1DGWX 1COV1 2J7MA 1EY2A 1XSQA 5JR2A 2XLGA 4C0HA 2AACA 4K3UA 2WZR2 3I59A 4W4ZA 1VBA1 4Q4X3 1DF0A 5JUVA 3BKZA 5KHJA 1XC6A 1US3A 4FT8A 3WCRA 4CPBD 3K4DA 3PMSA 1I9RA 4TN7A 1XNKA 2UURA 4XYXA 5T55A 4WVMB 3ZFGB 1PMJX 3USUB 3ZN4A 2FDIA 1RUI1 2Y6JA 3IMNA 1W6MB 2ERFA 3MUZ1 2XJPA 4P9GA 3FHIB 3AYCA 5DDJ2 5FYSA 4E2QA 4Y4YA 4D6SA 1KEXA 4MG2A 1W0NA 2DU0A 4CDXC 1GYKA 3VZLA 2AH2A 3TAYA 1H8TC 4NE9A 3AVSA 4C90A 1PX4A 2WZ8A 4WVMA 3ZFGA 4S2DA 3MW2A 5FO9B 4FTSA 3FZ3A 3USUA 1OHFA 1ZZ8A 3JBG1 1W6MA 1ENSA 3FHQA 1IQAA 1V6LA 5A70A 1PNFA 1VRH2 1U5ZA 4AOCA 1MZFA 4EJRA 3U14A 4CVUA 1PVC1 1AR71 1LHVA 2DUQA 4Q0UA 4UFLA 3ASIA 1SLTA 4YW4A 1OFSA 4AGRA 1IPKA 4YYOA 3ECQA 1GSLA 4GALA 4HZFA 1GP5A 4QXBA 5EZWA 4LE3A 2W1WA 1VB4A 2LALA 2Q5TA 5L7OB 3TB0A 5F3EA 3I2KA 3FFZA 4K8RB 2ZHMA 2ZHNA 3ACLA 3CJIB 1LEMA 1ND3C 4AFDA 2W2IA 2IXCA 3B5LB 2XKOA 4HVOA 2Q1FA 4OI2A 1VBB1 2C9AA 1UY4A 4BYYA 1UX6A 1ZBE1 2A6WA 3DXUA 5AFBA 2JB4A 3VD9A 4I3GA 1JYTA 4R4XA 3D5OA 3GCXA 4PBOA 2W5FA 1R1A2 2C0ZA 1KRIA 1SBEA 2EIBA 3ES1A 1AYM3 4KNCA 5EPAA 4CP9A 1LECA 4D6QA 3PHMA 1AR91 5L7OA 2FD8A 2ZACA 3WEZA 1D2QA 2V4AA 4JVAA 4TLGA 1UU6A 3HNYM 4GJZA 3DYMA 4XC9A 1UOJA 4MGQA 3N9NA 3I2GA 4JTOA 2ZEZA 3SCGA 4WM7C 1AUYA 5EYYA 1LOBA 2EALA 5IVFA 1UU4A 4AXOA 1QJU1 4AFBA 1K45A 1DU3D 1L7RA 1ND2B 1V0AA 2B7YA 3FBYA 3KB5A 1TME2 3POGA 1QJY1 1RYYA 3PUQA 4R9DA 5HBAA 4P9JA 2RS32 3T2QA 2BOIA 2VG9A 3ZSKA 5J36A 1ST8A 1QXRA 4XQDA 5DZGA 3WD5A 4QKFA 3SNMA 1W2NA 3GM8A 1PZ8A 1PIV3 1CZSA 3NW4A 1TVGA 5I8YA 1JYIA 4CU6A 2YBSA 1UZWA 2CV6A 1E5RA 4NPLA 1POQA 4HPKA 3S7EA 3ILNA 4MH0E 1NOVA 3SKJE 1V9U3 4MLOA 3WG4A 1WD4A 2GZWA 4AR2A 2R49A 4NO4A 4BPZA 1QKQA 5BY5A 3LEIA 2JG9C 1ND2A 5JDBA 2WZEA 4YSFA 3CZUA 3ZOIA 4NAMA 2OVUA 3ZMOA 2C4XA 1JYVA 1QJFA 2JECA 4ZZ8A 1HKDA 3PTYA 1BBT3 1WWYA 2QBXA 4QPYA 4JDOA 4KBZA 1I5PA 4TTGA 4LBMA 1WD3A 5L9BA 5DDJ1 4URAA 3TEYA 1WCUA 5IK8A 3O7OA 3IAQA 2PLV2 3POSA 5A7PA 4XFCA 4DQAA 1EUUA 4QX0A 1WBFA 4OVEA 5ABJC 1D7PM 2RS53 1VMHA 4AVCA 5C3OA 3R4DB 1GZ9A 1LOGA 2GMMA 4AWDA 1H2LA 2W1SA 1KJLA 2WT2A 1OBNA 1ODNA 4HSJA 4B4QA 1MPXA 4QX7A 2XHNA 1OQEA 1J3QA 4ISQA 1UN1A 1XNAA 3CO2A 2WUHA 4PLMA 1TZOA 2ZGPA 4ATFA 4C0BA 3C7HA 5ANNA 2WQ4A 5FZDA 4AYUA 3R05A 3ACFA 1MVEA 1Z78A 2VE1A 4N43A 5JPNB 5FZ6A 1GWKA 2P3YA 2D97A 5A6ZA 2XG3A 4Q0VA 2O8OA 5FYZA 2IVJA 2L9LA 4PBPA 2WFF3 3UKTA 3VBSB 2RDRA 5KHKA 3KLSA 3S6PA 1FPN1 2CWMA 1YQ2A 1XU1A 4K9SA 4M4PA 4YVWA 4XETA 3BTYA 1GOFA 2XUMA 2Q8CA 5JAXA 4Q4W1 3ZMNA 1WCDJ 1BLZA 3I49A 5C5UA 3W59A 4G4FA 1O59A 2OPWA 5JXHA 4N7UA 2WSVA 1OPMA 5K0UB 1J1TA 1UYXA 1C5IA 4JKMA 3OBAA 5FFOC 4BIFA 2R1DA 4XF3A 1ULGA 3FUQA 4XXPA 1GR3A 3VZNA 3VBSA 2VZOA 2QVSB 1SACA 5FZBA 2J22A 2ZXQA 3JQXA 3USSA 3CBNA 3K4ZA 3AJYA 3C8XA 4TSVA 4Y5Z0 3VKNA 4QKDA 4P02B 2E33A 2TNFA 5FOBB 2QDRA 2RM22 1OLRA 4W65A 3E6CC 1VR3A 5F8PA 5LK7B 5K8SA 4LMFA 2XQXA 4P9LA 3CMGA 2BJSA 1CAUB 4AK3A 4XACA 5IVEA 3VZMA 4L9BA 2DVGA 4AVAA 2C6SA 3MIFA 5FPLA 5FO8B 1RUE3 4OHYA 1XB9A 2BNNA 1PO21 1XNCA 2ARXA 4RA0A 1WMDA 3RGBA 2ZGTA 3VD4A 3VKFC 1J3RA 1AR63 2JB8A 1UWWA 1UMHA 3VKLA 5F5QA 1H1AA 4Q26A 4QWNA 4Q4X2 1Y3TA 3WF2A 3AZYA 1PNGA 2A7AA 1CAUA 4UOJA 4HBNA 1CPMA 3HR9A 3H8OA 1S0FA 1SHWB 5T54A 1AR83 2QE3A 4AGGA 3RWKX 5JIAA 2X8KA 3LSDA 3PUSA 1H1IA 2FZ1A 4GD4A 5FZ1A 5K4LA 1WCQA 2XLFA 4YW7A 4CA9A 3LKJA 4EN7B 3PVEA 4LO8A 1RINA 4XOGA 5LB6A 3UV9A 2VCMA 1GNYA 5IWFA 3IIIA 4NOTA 1HRV3 4XF9A 1JTZX 4NRMA 2ENRA 4UW6A 1WCKA 2OZJA 2WNUC 4TLFA 2Y0OA 2JG8B 1GICA 3MPBA 3VDBA 4MOAA 4PIXA 5ANQA 2J1VA 5LEJA 1MS3A 2HYXA 4QPIB 2R7EB 2X5IB 4QPGC 2EVXA 5JCTA 1PM7A 5B4NA 1DQ0A 3EO6A 5GM0A 3T2TA 3OJBA 1LOAA 1LOFC 3IKWA 2G9GA 3TNPB 3U4XA 2NMOA 1K5MB 1LR5A 1I3HA 5DZFA 3A22A 5D8AB 1BEV1 3DUIA 3N9LA 1S55A 4QX3A 3LSEA 3U78A 3WDXA 2BP6A 2OA2A 4YNIA 3WDUA 4KWKA 4AQTA 5EP9A 4LO6B 4BH9A 4BK4A 5A32B 1SLCA 2JG8A 5A6XA 4EZHA 4Q27A 3WQBA 2VAUA 3MIHA 4HFSA 4QPIA 2X5IA 1C1FA 3K77A 1O3SA 2IXJA 4MADA 1COV3 2DFBA 1SBFA 1YFUA 2VTXJ 4XF4A 4GAZA 3L9JT 1DZQA 1ENRA 4NWWA 5A33B 1LOCA 1K5MA 2BUKA 3O0VA 1DQ2A 4QQOA 2I45A 1V6OA 3CQOA 3H7JA 4YG0A 5D8AA 4ET7A 4M3CE 4BLIA 2XBO3 3A23A 3OPTA 4QXKA 4OCTA 5FZEA 5F5IA 2RMU1 3VBRB 5A32A 5H9SA 1A78A 1J83A 1RUI3 4DOUA 1RJ8A 1ZZ6A 1SDDB 1NCRB 1MVQA 4FSJA 4CDXB 1AX1A 2OT7A 5JXJA 2AYHA 4AI9A 5A33A 2JDYA 1W0PA 3CEWA 4MHRA 4FOWA 1JODA 3NNGA 2XVLA 4J6GA 4U36A 2E32A 2J1AA 3WNKA 1UZZA 3POWA 3D6EA 1C8M1 1PIV2 2ZJCA 3JD73 3MLJA 3VBRA 3PVNA 1H30A 3K3OA 3JBG3 1US2A 1W8HA 4GZ9A 1HN1A 1J59A 3NV2A 1GQGA 1NCRA 1YI9A 3AC0A 3OUHA 4XXAA 4D0QA 5J09A 2C9KA 1AXKA 4QQ2A 3RZLA 1QDOA 4R9CA 3U11A 4CRQA 5F1RA 3ZYFA 2V73A 1W05A 1UF2C 4UW3A 4LKFA 2JDNA 3GNEA 5A3OA 2R6QA 3O5SA 4R52A 3Q8FA 4YM1A 1S2BA 5F2WA 1BBT2 2OIIA 4NHKA 1UX7A 2JJ6A 2VNRA 1CAVB 4YGDA 1O4ZA 1S0EA 3QACA 3RWNA 3R0RA 1ZZBA 5SV8A 1FYUA 1VJ2A 4CSWA 1WW5A 3RMXA 5TSWA 3ZFGC 4AEDB 2YDEA 2NP0A 5K7PA 2VUJA 3LEGA 4N9HA 4QT6A 4Q0QA 4W50A 2OKXA 3JUUA 5IAVA 1OMIA 2VXRA 4EN8B 5BNPB 1RHI1 5E8AA 2WNVB 4RL7A 3D82A 4AFAA 4B1MA 5FDBA 3T0DA 4AI0A 1AR93 1DYPA 3KCYA 5JSPA 4PJYA 1CONA 2D6KA 4LBQB 4E2SA 2G1MA 1PO11 1RUC2 4BDVB 4XIKA 4PIZA 5FMOL 1ZRCA 3MIDA 3MO4A 3POYA 3B9IA 5JI7A 4X8NA 4AEDA 1QJU3 2EXJA 1CN1A 2W0XA 1J58A 2QQIA 4GQ7A 1GOGA 1MS5A 2ATFA 1W9SA 4JQRA 2WNVA 4OMCA 2A73B 1UY1A 3APBA 3IDBB 3OGGA 1SPPB 4EYUA 4SBVA 4XCBA 3A0KA 2DF7A 5CKMA 1XOYA 4LBQA 4GWNA 2K9ZA 4BIOA 2WFF2 3BB6A 5L7OC 1D2SA 2HWB3 2Q1ZB 1BMV2 2D6NA 4NIAA 1JOJA 4LKEA 3WW1A 1WUVA 1VBC3 4LPLA 1CJDA 3CJIC 5DAPA 1JU4A 1PVXA 2NLRA 2IVIB 4KH9A 4BQXA 1AYM1 5LBCA 2UYBA 2PAKA 4IGPA 4WZCA 4WVWA 1HB3A 3GXUA 1Q3EA 1SPPA 3HT2A 3OBRA 3OG2A 2JDUA 1FT9A 3ZM8A 1UZVA 3A7QA 1Q8QA 4A45A 5JSRA 1YJKA 3WP6A 1JHJA 4LE4A 1OA3A 3P1IA 1CZVA 5DG2A 5DAVA 2VZUA 4IETA 3MIBA 3PTRB 3IB3A 1EUTA 2Z69A 2DCYA 4V2VA 3RZJA 4P14A 4Z07A 2X53S 2DCTA 4D6RA 3VKOA 3AVRA 2I74A 3U1XA 4LBKA 3B3QE 5FCCA 1MQTA 4RN5A 4FFGA 1ND2C 5EQUA 1PX3A 3ZSMA 4QB2A 2PHXA 1HJFA 1FV2A 1OKQA 3MLKA 4MZUA 1F31A 4E4HA 1OOPA 4N53A 4PLNA 4CZSA 4LBQD 5DMYA 1SLIA 4A41A 1MEC1 1V9U1 4M00A 2VOXA 1RUE2 2ETEA 3SHRA 3PU3A 1JZ4A 4KGGA 4QHOA 2WZPP 5FWEA 2P2KA 2QUOA 1UYYA 2VL4A 1OD5A 2RVAA 4YW1A 3THTA 5A6YA 5C71A 5FUIA 1AJOA 2ZX0A 4QGMA 4ZU4A 4ZONA 2ZKLA 5CBLA 1BBT1 1W9FA 2CGNA 2VPVA 3AFGA 4Y4RA 5A7WB 4AHWA 5JXIA 4OUMA 1JOPA 3Q9OA 2OPKA 1YLLA 2WABA 4UW5A 1AR82 3PUIA 1FPN3 2Z4FA 3NKTA 4JGZB 1TMF3 1Q8VA 2P37A 2B46X 3IT8A 1U5IA 1SZBA 4IGOA 2Y38A 1NX9A 5C9AA 1W8NA 2G19A 2RS51 4EZ4A 3SXWA 3W5NA 3M8LA 1OUSA 3WSOA 1XE0A 3WVJA 4RGAA 3TBDA 2ZGKA 1PGW1 5JZGB 4DPNA 1S1AA 1UOFA 3BTZA 2O14A 3NWKA 3BIWE 4Y1ZA 5HPOA 1NQJA 3OUIA 1HRV2 4D3WA 1X9PA 2YYOA 3MI8A 1IKQA 4GH4B 4BQWA 2XPJA 3ILFA 5F32A 2XH6A 4N43C 4B3NA 4JV4A 3WXPA 2BVBA 4ES9A 2WO3A 3RSJA 2WAOA 4JGZA 3B93A 3VZOA 3ZXLA 4QDSA 2ZGLA 5FP8A 4NHXA 1XYOA 1I6XA 3AYAA 4JDNA 4YVWC 1ZRIA 1HRI1 3VBFB 4YG3A
chains in the Genus database with same CATH topology
3ACHA 3VDCA 3THDA 2JKXA 3C7OA 2QQKA 1KEXA 1W0NA 2QQOA 4DXRA 2Y6LA 1PX4A 2WZ8A 2YB7A 2BGOA 2LW8A 3FHQA 2J1EA 2ZEYA 4CVUA 1JI6A 1K12A 3HNBM 2W92A 3ECQA 2X10A 3LEKA 4LKSA 1K42A 2W1WA 3SKVA 2DCJA 5EJZB 2VCCA 3I2KA 4LQRA 1JZ3A 3K4AA 1W9WA 2VMEA 1JZ5A 4XUQA 3NJVA 5F7UA 4ZY9A 1UY2A 1UY4A 3IAPA 3VD9A 2W5FA 5DN2A 3I2FA 2EIBA 3FHAA 1UXXX 2VMDA 3W5MA 2Y6KA 4A3ZA 3WEZA 3HNYM 2WQ8A 3DYMA 4MGQA 3I2GA 2ZEZA 5DPNA 2X09A 3OGVA 4BK5A 1K45A 1L7RA 4AG4A 4XUOA 5JXGA 1RYYA 4QB6A 2EIEA 3T2QA 2RJ2A 2VO5A 3I97A 3GM8A 3C7FA 1CZSA 1TVGA 4CU6A 5G05L 2VQUA 3OGRA 4DXTA 5I0DA 3J7HA 3SKJE 3THCA 3MUY1 3LEIA 5IYYA 3E1F1 2WZEA 3CZUA 4KWUA 4XVHA 4DEVA 2C4XA 2ORXA 3T2PA 1W8OA 1JZ2A 1JYVA 4ZZ8A 4PT6A 2QBXA 1I5PA 2LS6A 3WF4A 4TTGA 1CIYA 3FN9A 3VD3A 4E8CA 2BZDA 3IAQA 1EUUA 4QX0A 1D7PM 1CZTA 1O8PA 2W1SA 4CUCA 2RV9A 4UAPA 1MPXA 1O8SA 3HN3A 2XHNA 1UXZA 1XNAA 1GOHA 1LNSA 4QDRA 2WUHA 2Y64A 3C7HA 4ZZ5A 2C26A 1JZ7A 2EICA 3ACFA 1UY3A 1XNTA 1H6YA 3OEAA 2WYSA 2YC2A 3PUHA 2VZTA 2L9LA 3I3EA 4JKKA 1DP0A 3CKHA 4A6OA 2VZPA 1YQ2A 4CUAA 2YC4A 4M4PA 1GOFA 4ZXEA 1O59A 5JXHA 3ACGA 1UYXA 3DYPA 4JKMA 1ULPA 3OBAA 5DQ0A 4AAXA 2VZVA 2W3JA 3K46A 1OD3A 2VZOA 1DLCA 4YPJA 2J22A 3ABZA 2ZXQA 4BXSV 3K4ZA 3C8XA 3WNOA 4W8JA 4P02B 2E33A 3OGSA 2XQXA 3CMGA 3I2IA 1NUKA 4A4AA 2W46A 4XUPA 5C7GA 3HJRA 2WBKA 4GWJA 3VD4A 2W87A 3CZJA 4GWIA 1UWWA 4QX2A 1UMHA 2XONA 3CIHA 4A42A 3OEBA 2YG0A 3WF2A 3NRUA 4UOJA 5IHRA 3WF0A 1SHWB 4QDQA 2ID4A 3DYOA 1JZ8A 3MV01 3GGLA 1WCQA 3IDAA 2QQLA 1JYXA 1JYNA 5LA0A 1GNYA 3D3AA 3IIIA 5A1AA 1T2XA 2Y6HA 4JKLA 1UYZA 2V72A 2KD7A 2VZSA 1CX1A 1JZ6A 4OZOA 4XUTA 3VDBA 4MOAA 3FL7A 2J1VA 3T0AA 2HYXA 2R7EB 4CU9A 3WNPA 4DUXA 5B4NA 2JE8A 2W9XA 4P5YA 2DCKA 2VC9A 3OB8A 3VD5A 3A22A 2BGPA 4QX3A 3LQCA 4BK4A 3MV11 4P00B 4PQQA 3VD7A 4XURA 3WQBA 2ZEWA 4A44A 2VMFA 3ETPA 1UY0A 2XOMA 3I2JA 3K77A 2YFZA 4MO3M 4TXWA 2BERA 4MADA 2E26A 3ACIA 1JU3A 4OYUA 1F4HA 1BHGA 4DUVA 3CQOA 4QB1A 4ET7A 1W99A 3A23A 3U37A 1J83A 1SDDB 2QQNA 4MGSA 2VTFA 5IJRA 1JYWA 1ULOA 5JXJA 3NJXA 1WKYA 2E31A 5LA1A 5IFTA 3WF1A 3T09A 3NNGA 3DECA 3UESA 2E32A 2J1AA 3WNKA 3LPFA 4OUEA 2CDPA 4FI9A 1US2A 4GZ9A 1HN1A 1OH4A 3AC0A 4D0QA 2C9KA 2W95A 4BJ0A 4P08A 3HOBA 4CU7A 5LCWL 3UETA 3BGAA 5LA2A 4DXSA 2VZQA 4Z2AA 4QPWA 4XUNA 1UMIA 1UX7A 4CUBA 1DYOA 2W1QA 1OF3A 1H6XA 3I2HA 5CZKA 1GU3A 4PF1A 2PQSA 3BN6A 3LEGA 4W50A 2OKXA 1PMHX 1SG3A 2B4KA 2X05A 5EIYB 3F2ZA 3VDAA 2B9VA 3T0DA 2J1SA 2BBAA 3GDBA 3LPGA 3T0BA 4BDVB 1K3IA 4HG6B 3MO4A 2WO2A 3K75B 2VR4A 5G04L 3I3DA 4KI5M 5J1XA 1UZ0A 2EIDA 2QQIA 4CU8A 1F4AA 1GOGA 1NAEA 1GQPA 1W9SA 2WAAA 4JHZA 4M4RA 4OMCA 1UY1A 2DDUA 1OF4A 2VCBA 3WNLA 3I3BA 5CYYA 2W91A 3C7EA 2V5DA 3EYPA 1IQDC 2CDOA 4QAWA 2JDAA 1NKGA 3MBWA 4LPLA 2VZ1A 1JU4A 3HPNA 2WN2A 2QQMA 2VQTA 2VOTA 1OT5A 3GXUA 1KGYA 3OG2A 5HXMA 3ZM8A 3A7QA 4KMQA 4A45A 2J1UA 3UNPA 1R64A 1TG7A 1JHJA 3HNMA 4DEQA 3P1IA 2VZ3A 4RYDA 1CZVA 2VZUA 2WO1A 3T08A 4ARYA 3IB3A 1EUTA 3EB7A 2HLEA 2V4VA 2VZRA 4QX1A 4RN5A 3JXSA 1PX3A 1XPWA 3P6BA 1W9TA 4QB2A 3T2OA 4OMDA 2JD9A 2Y8KA 1L7QA 5DMYA 2QQJA 2W47A 4A41A 3A21A 2ORZA 1JZ4A 3SEPA 1J84A 3HEIA 5JMOA 2VL4A 1UYYA 2YFUA 2ZEXA 3SEEA 2RVAA 4LHSA 4JX0A 5C71A 5FUIA 3NQHA 2WN3A 1GUIA 4E8DA 4XZUG 2J1RA 5JXIA 3LE0A 3WNMA 5EJ1B 2WABA 2VMCA 3PUIA 4UI9L 3WNNA 2Z4FA 4IUGA 2VM9A 2VJXA 2WDBA 1NX9A 1W8NA 3W5NA 3WF3A 5C70A 5B4XA 3WSOA 4L0PA 1GMMA 1P8JA 5IFPA 2J7MA 5JR2A 2VCAA 4W4ZA 5HPOA 2J1TA 5JUVA 2W1UA 3CDZB 1XC6A 4D8MA 1US3A 4DUWA 3K4DA 2Y6GA 2WO3A 2WAOA 1PMJX 4QDSA 3C7GA 2Y6JA 4ARXA 3MUZ1 2W94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ACH A;  3VDC A;  3THD A;  2JKX A;  3C7O A;  2QQK A;  1KEX A;  1W0N A;  2QQO A;  4DXR A;  2Y6L A;  1PX4 A;  2WZ8 A;  2YB7 A;  2BGO A;  2LW8 A;  3FHQ A;  2J1E A;  2ZEY A;  4CVU A;  1JI6 A;  1K12 A;  3HNB M;  2W92 A;  3ECQ A;  2X10 A;  3LEK A;  4LKS A;  1K42 A;  2W1W A;  3SKV A;  2DCJ A;  5EJZ B;  2VCC A;  3I2K A;  4LQR A;  1JZ3 A;  3K4A A;  1W9W A;  2VME A;  1JZ5 A;  4XUQ A;  3NJV A;  5F7U A;  4ZY9 A;  1UY2 A;  1UY4 A;  3IAP A;  3VD9 A;  2W5F A;  5DN2 A;  3I2F A;  2EIB A;  3FHA A;  1UXX X;  2VMD A;  3W5M A;  2Y6K A;  4A3Z A;  3WEZ A;  3HNY M;  2WQ8 A;  3DYM A;  4MGQ A;  3I2G A;  2ZEZ A;  5DPN A;  2X09 A;  3OGV A;  4BK5 A;  1K45 A;  1L7R A;  4AG4 A;  4XUO A;  5JXG A;  1RYY A;  4QB6 A;  2EIE A;  3T2Q A;  2RJ2 A;  2VO5 A;  3I97 A;  3GM8 A;  3C7F A;  1CZS A;  1TVG A;  4CU6 A;  5G05 L;  2VQU A;  3OGR A;  4DXT A;  5I0D A;  3J7H A;  3SKJ E;  3THC A;  3MUY 1;  3LEI A;  5IYY A;  3E1F 1;  2WZE A;  3CZU A;  4KWU A;  4XVH A;  4DEV A;  2C4X A;  2ORX A;  3T2P A;  1W8O A;  1JZ2 A;  1JYV A;  4ZZ8 A;  4PT6 A;  2QBX A;  1I5P A;  2LS6 A;  3WF4 A;  4TTG A;  1CIY A;  3FN9 A;  3VD3 A;  4E8C A;  2BZD A;  3IAQ A;  1EUU A;  4QX0 A;  1D7P M;  1CZT A;  1O8P A;  2W1S A;  4CUC A;  2RV9 A;  4UAP A;  1MPX A;  1O8S A;  3HN3 A;  2XHN A;  1UXZ A;  1XNA A;  1GOH A;  1LNS A;  4QDR A;  2WUH A;  2Y64 A;  3C7H A;  4ZZ5 A;  2C26 A;  1JZ7 A;  2EIC A;  3ACF A;  1UY3 A;  1XNT A;  1H6Y A;  3OEA A;  2WYS A;  2YC2 A;  3PUH A;  2VZT A;  2L9L A;  3I3E A;  4JKK A;  1DP0 A;  3CKH A;  4A6O A;  2VZP A;  1YQ2 A;  4CUA A;  2YC4 A;  4M4P A;  1GOF A;  4ZXE A;  1O59 A;  5JXH A;  3ACG A;  1UYX A;  3DYP A;  4JKM A;  1ULP A;  3OBA A;  5DQ0 A;  4AAX A;  2VZV A;  2W3J A;  3K46 A;  1OD3 A;  2VZO A;  1DLC A;  4YPJ A;  2J22 A;  3ABZ A;  2ZXQ A;  4BXS V;  3K4Z A;  3C8X A;  3WNO A;  4W8J A;  4P02 B;  2E33 A;  3OGS A;  2XQX A;  3CMG A;  3I2I A;  1NUK A;  4A4A A;  2W46 A;  4XUP A;  5C7G A;  3HJR A;  2WBK A;  4GWJ A;  3VD4 A;  2W87 A;  3CZJ A;  4GWI A;  1UWW A;  4QX2 A;  1UMH A;  2XON A;  3CIH A;  4A42 A;  3OEB A;  2YG0 A;  3WF2 A;  3NRU A;  4UOJ A;  5IHR A;  3WF0 A;  1SHW B;  4QDQ A;  2ID4 A;  3DYO A;  1JZ8 A;  3MV0 1;  3GGL A;  1WCQ A;  3IDA A;  2QQL A;  1JYX A;  1JYN A;  5LA0 A;  1GNY A;  3D3A A;  3III A;  5A1A A;  1T2X A;  2Y6H A;  4JKL A;  1UYZ A;  2V72 A;  2KD7 A;  2VZS A;  1CX1 A;  1JZ6 A;  4OZO A;  4XUT A;  3VDB A;  4MOA A;  3FL7 A;  2J1V A;  3T0A A;  2HYX A;  2R7E B;  4CU9 A;  3WNP A;  4DUX A;  5B4N A;  2JE8 A;  2W9X A;  4P5Y A;  2DCK A;  2VC9 A;  3OB8 A;  3VD5 A;  3A22 A;  2BGP A;  4QX3 A;  3LQC A;  4BK4 A;  3MV1 1;  4P00 B;  4PQQ A;  3VD7 A;  4XUR A;  3WQB A;  2ZEW A;  4A44 A;  2VMF A;  3ETP A;  1UY0 A;  2XOM A;  3I2J A;  3K77 A;  2YFZ A;  4MO3 M;  4TXW A;  2BER A;  4MAD A;  2E26 A;  3ACI A;  1JU3 A;  4OYU A;  1F4H A;  1BHG A;  4DUV A;  3CQO A;  4QB1 A;  4ET7 A;  1W99 A;  3A23 A;  3U37 A;  1J83 A;  1SDD B;  2QQN A;  4MGS A;  2VTF A;  5IJR A;  1JYW A;  1ULO A;  5JXJ A;  3NJX A;  1WKY A;  2E31 A;  5LA1 A;  5IFT A;  3WF1 A;  3T09 A;  3NNG A;  3DEC A;  3UES A;  2E32 A;  2J1A A;  3WNK A;  3LPF A;  4OUE A;  2CDP A;  4FI9 A;  1US2 A;  4GZ9 A;  1HN1 A;  1OH4 A;  3AC0 A;  4D0Q A;  2C9K A;  2W95 A;  4BJ0 A;  4P08 A;  3HOB A;  4CU7 A;  5LCW L;  3UET A;  3BGA A;  5LA2 A;  4DXS A;  2VZQ A;  4Z2A A;  4QPW A;  4XUN A;  1UMI A;  1UX7 A;  4CUB A;  1DYO A;  2W1Q A;  1OF3 A;  1H6X A;  3I2H A;  5CZK A;  1GU3 A;  4PF1 A;  2PQS A;  3BN6 A;  3LEG A;  4W50 A;  2OKX A;  1PMH X;  1SG3 A;  2B4K A;  2X05 A;  5EIY B;  3F2Z A;  3VDA A;  2B9V A;  3T0D A;  2J1S A;  2BBA A;  3GDB A;  3LPG A;  3T0B A;  4BDV B;  1K3I A;  4HG6 B;  3MO4 A;  2WO2 A;  3K75 B;  2VR4 A;  5G04 L;  3I3D A;  4KI5 M;  5J1X A;  1UZ0 A;  2EID A;  2QQI A;  4CU8 A;  1F4A A;  1GOG A;  1NAE A;  1GQP A;  1W9S A;  2WAA A;  4JHZ A;  4M4R A;  4OMC A;  1UY1 A;  2DDU A;  1OF4 A;  2VCB A;  3WNL A;  3I3B A;  5CYY A;  2W91 A;  3C7E A;  2V5D A;  3EYP A;  1IQD C;  2CDO A;  4QAW A;  2JDA A;  1NKG A;  3MBW A;  4LPL A;  2VZ1 A;  1JU4 A;  3HPN A;  2WN2 A;  2QQM A;  2VQT A;  2VOT A;  1OT5 A;  3GXU A;  1KGY A;  3OG2 A;  5HXM A;  3ZM8 A;  3A7Q A;  4KMQ A;  4A45 A;  2J1U A;  3UNP A;  1R64 A;  1TG7 A;  1JHJ A;  3HNM A;  4DEQ A;  3P1I A;  2VZ3 A;  4RYD A;  1CZV A;  2VZU A;  2WO1 A;  3T08 A;  4ARY A;  3IB3 A;  1EUT A;  3EB7 A;  2HLE A;  2V4V A;  2VZR A;  4QX1 A;  4RN5 A;  3JXS A;  1PX3 A;  1XPW A;  3P6B A;  1W9T A;  4QB2 A;  3T2O A;  4OMD A;  2JD9 A;  2Y8K A;  1L7Q A;  5DMY A;  2QQJ A;  2W47 A;  4A41 A;  3A21 A;  2ORZ A;  1JZ4 A;  3SEP A;  1J84 A;  3HEI A;  5JMO A;  2VL4 A;  1UYY A;  2YFU A;  2ZEX A;  3SEE A;  2RVA A;  4LHS A;  4JX0 A;  5C71 A;  5FUI A;  3NQH A;  2WN3 A;  1GUI A;  4E8D A;  4XZU G;  2J1R A;  5JXI A;  3LE0 A;  3WNM A;  5EJ1 B;  2WAB A;  2VMC A;  3PUI A;  4UI9 L;  3WNN A;  2Z4F A;  4IUG A;  2VM9 A;  2VJX A;  2WDB A;  1NX9 A;  1W8N A;  3W5N A;  3WF3 A;  5C70 A;  5B4X A;  3WSO A;  4L0P A;  1GMM A;  1P8J A;  5IFP A;  2J7M A;  5JR2 A;  2VCA A;  4W4Z A;  5HPO A;  2J1T A;  5JUV A;  2W1U A;  3CDZ B;  1XC6 A;  4D8M A;  1US3 A;  4DUW A;  3K4D A;  2Y6G A;  2WO3 A;  2WAO A;  1PMJ X;  4QDS A;  3C7G A;  2Y6J A;  4ARX A;  3MUZ 1;  2W94 A; 
#chains in the Genus database with same CATH topology
 4Y1U A;  5LY2 A;  2LTN A;  3THD A;  3C7O A;  3NAP A;  4PCR A;  4E4Z A;  5DAQ A;  1YHF A;  2OW4 A;  4GH4 A;  1SCR A;  3TEW A;  2ZX2 A;  4KG0 A;  3L2Y A;  3OY8 B;  1Z0H A;  5DUW A;  5FY5 A;  5FY1 A;  1QQP 1;  4NWV A;  5GZE A;  4DXR A;  4AVB A;  3KHB A;  4N9I A;  2JD4 A;  1DGL A;  4YM3 A;  3PLQ A;  5E16 A;  3VBS C;  1Y9Q A;  1QJE A;  1WGP A;  2LW8 A;  1COV 2;  5FYC A;  5CIS A;  3NJY A;  2J1E A;  1G6N A;  4KL1 A;  3VBF A;  4QQH A;  3I54 A;  2Z42 A;  1CGP A;  3LDK A;  1VBA 2;  4EWE A;  3RNS A;  4COW A;  4NID A;  2ES3 A;  1UQX A;  2X10 A;  3N9M A;  3O0W A;  5FYH A;  4LXL A;  2D6P A;  4BCU A;  3EMR A;  4LKS A;  2XBO 2;  1WLT A;  5GLZ A;  2R06 3;  3SKV A;  4A6S A;  3OY8 A;  4RR3 B;  4CDQ A;  5LRR A;  2YBP A;  1GAN A;  4MXW B;  1LCL A;  1RUI 2;  3AFK A;  3WR0 A;  1JN2 P;  3AXE A;  3WDV A;  1RMU 1;  2VME A;  1JZ3 A;  1VRB A;  4MXV A;  4XFH A;  1JZ5 A;  5E1R A;  2P3J A;  1GP4 A;  3E5U A;  1U0A A;  2MEV 3;  3WHT A;  3NJV A;  4F7Z A;  4ZY9 A;  2WO7 A;  3IZO A;  5A7N A;  1QJX 3;  3G7D A;  1RXF A;  1YJL A;  1ZM1 A;  2XHK A;  5HI0 A;  1DQ6 A;  4OHW A;  2BBV A;  4FPK A;  2XJT A;  4RQP B;  3VB9 A;  1H0B A;  4XF0 A;  2ZMN A;  1E5I A;  4RR3 A;  3WQ1 A;  3JD7 2;  1PHM A;  3SH5 A;  2DTW A;  3NV1 A;  4XJ9 A;  1ZBA 1;  3JBG 2;  1W8U A;  2WQ8 A;  4XCA A;  3GHN A;  4XPV A;  1VB2 A;  4OQ9 A;  2B39 A;  1AR6 1;  2O1Q A;  5D1I A;  5FP7 A;  4FO9 A;  3HBK A;  2F4L A;  3TRS B;  1PVC 2;  4ITC A;  1AR7 2;  3UGF A;  2XJS A;  1RC6 A;  2Y0I A;  3KS7 A;  4S2G A;  4XUO A;  5IVC A;  5FZI A;  1SLA A;  1IKP A;  1N3P A;  1Q8P A;  2EIE A;  3GHM A;  2AEY A;  4I01 A;  3ZKU A;  3K3N A;  3J4U H;  4RQP A;  5JSO A;  2RJ2 A;  1RJ7 A;  4O65 A;  2H0V A;  3N36 A;  3WHU A;  1ONA A;  1W2O A;  2ZHK A;  1VP6 A;  1NYW A;  3UT0 A;  5A7S A;  1VBB 2;  2Z5W A;  4IEW A;  4IW3 A;  3UL2 A;  1F5F A;  4DXT A;  4XBL A;  1WME A;  1ZBE 2;  4B4P A;  3THC A;  5I0D A;  1S0G A;  1XE7 A;  5IYY A;  5JMC A;  1HRV 1;  4O9G A;  3DPR B;  5FZ3 A;  2OX0 A;  4NMI A;  3KHC A;  4XVH A;  2GC3 A;  3RJ2 X;  1AR9 2;  3RI9 A;  3MYX A;  4DIQ A;  3LA2 A;  2OZ6 A;  2OXB A;  3POB A;  4BQ5 A;  4L2N A;  4NVP A;  2LS6 A;  2JG8 C;  5F6L B;  1QJU 2;  1CIY A;  1OC1 A;  2VVF A;  2KXL A;  5LAT A;  1YYN A;  3AMP A;  3HQX A;  2X5I C;  1GP6 A;  2BZD A;  4QPI C;  1YUD A;  1A34 A;  5H9P A;  3ZR5 A;  3AXD A;  4Q1P A;  5FLH A;  3H8X A;  3DPR A;  2QJV A;  1XU2 A;  2MNG A;  1RIR A;  5FMO S;  4NHL A;  5T5P A;  1LB2 A;  5DAB A;  5FKC A;  1L3J A;  1W2A X;  2BQP A;  1K5M C;  2EXI A;  3LA3 A;  3O1R A;  2DWR A;  4CUC A;  5IW0 A;  4IDZ A;  1C8M 3;  2RV9 A;  5D8A C;  4KU8 A;  4RS5 A;  1BK0 A;  3HN3 A;  3R4U A;  4YWA A;  5FIX A;  5KXE A;  4MX3 A;  2HWB 2;  3HWJ A;  3ST7 A;  3TYJ A;  1V6J A;  3NO8 A;  2GP3 A;  1VBC 2;  2Y64 A;  3WX5 A;  2R32 A;  5AVP A;  2Q8E A;  1H8V A;  1REE A;  2SBA A;  4BQ4 A;  1IPJ A;  3N4M A;  3WCS A;  1RUN A;  2C26 A;  3U4S A;  1JZ7 A;  4DS0 A;  2XBO 1;  2PEL A;  4CDU B;  2YPJ A;  1H6Y A;  4FPG A;  3OF1 A;  1CD3 G;  4FP3 A;  4B8E A;  5F6K A;  2Q0A A;  1Y4W A;  5T52 A;  3FX3 A;  1LRH A;  1LHO A;  2PHD A;  4M3C F;  5H9Q A;  4YG6 A;  4HVR A;  3IDC B;  2YU2 A;  4XFA A;  1NXM A;  3I3Q A;  3VBR C;  3POE A;  4IEP A;  1LTE A;  3GCW A;  1SMV A;  4Q0P A;  4Y5S A;  4OZX A;  5LBB A;  5FXX A;  4QHZ A;  4ZXE A;  2D7F A;  4DMI A;  1NCR C;  4M3C B;  1RHI 3;  3ACG A;  1GFF 2;  2Q1M A;  3WT3 A;  4NAO A;  1ULP A;  5DQ0 A;  3EHK A;  3JD7 1;  1QMJ A;  4CDU A;  1RUF 1;  3POJ A;  3CNA A;  3VDD B;  1W2U A;  5BYN A;  5EHD A;  5JOZ A;  1PO1 3;  4MGZ E;  1XQN A;  1UAI A;  1OD3 A;  2WL1 A;  4QM9 A;  2VQ0 A;  1LHU A;  4AI1 A;  1CAX B;  4YPJ A;  2SLI A;  5I8S A;  5JZG A;  4BXS V;  1OQ1 A;  3BOP A;  1ZA7 A;  4W8J A;  4LHL A;  1IOA A;  1MZE A;  4BB3 A;  1DZR A;  5FZ0 A;  1UU5 A;  5D2A A;  4M3C A;  4JRL A;  5GLW A;  5FXZ A;  4CP9 B;  3KV4 A;  3QCW A;  4NII A;  2AUY A;  4I02 A;  4YM0 A;  3JQW A;  4PHZ A;  4R9B A;  2NPI A;  5F5A A;  4W6Y A;  2ADE A;  4LOS A;  3KT7 A;  3VDD A;  3NV3 A;  4IEY A;  1VBE 3;  1GNH A;  2DU1 A;  1NUK A;  3Q8B A;  5EYX A;  1FPN 2;  2W46 A;  2RG4 A;  4XUP A;  4AVV A;  3DGT A;  2QDN A;  4FVV A;  1CAX A;  1TMF 2;  5C7G A;  1X33 A;  3D4K A;  4Q4W 2;  2RJL A;  2F6B A;  2HJI A;  1FAY A;  5BNO B;  4GWJ A;  2W87 A;  4AED C;  3CZJ A;  4QX2 A;  4HVQ A;  2XON A;  1YRZ A;  5CB7 A;  5A3N A;  1PGL 1;  1FOD 3;  2QQV A;  2R04 3;  2YG0 A;  3VN4 A;  3HT1 A;  3FLP A;  4E27 A;  3M3O A;  2WNV C;  4HPK B;  1BK1 A;  1CQ9 A;  1OPO A;  2ZTN A;  2VVD A;  1XXN A;  3RVH A;  3HQR A;  4E4S A;  1SEF A;  5C3P A;  4RFT 0;  4ASM B;  1DGR A;  3DYO A;  3R6S A;  5JVV A;  5GZC A;  1JZ8 A;  4DZG A;  2E7T A;  2R16 A;  4ISR A;  2WNE A;  4LR4 A;  2YGL A;  3LAG A;  2MPF A;  1S0I A;  3ROU A;  3SH3 A;  2BPA 2;  4AW7 A;  1IZ3 A;  5BNO A;  5FV3 A;  1XE8 A;  5J48 A;  4UFK A;  4KWL A;  1VAV A;  3AZW A;  1QOO A;  4Z92 B;  2P3I A;  1JYN A;  1D0H A;  2VGD A;  2XGX A;  1DIW A;  3MZH A;  5A7O A;  1T2X A;  1NY7 1;  3AK0 A;  2HWD 3;  3U10 A;  2HWB 1;  1NLS A;  1UKR A;  4FPJ A;  4BME A;  1MEC 3;  3IIA A;  1G86 A;  1AL2 3;  3ORJ A;  1JZ6 A;  3VHO A;  3FUO A;  1VBC 1;  1DFQ A;  2DVA A;  2WLP A;  3FL7 A;  1PO2 2;  1YWK A;  1G9F A;  1W6O B;  4JHT A;  2JDH A;  4CU9 A;  4DUX A;  1L7L A;  4K7J A;  1AX0 A;  2JKB A;  2JE8 A;  5GJ6 A;  2W9X A;  5J7M A;  2DCK A;  1ENQ A;  2VC9 A;  1LU2 A;  5B2G B;  3ZXG A;  1OLM E;  1CJP A;  2E7A A;  4CP1 A;  1DQ4 A;  5FBZ A;  3OBT A;  1MQT C;  2R06 2;  4UW4 A;  4RGK A;  5IK5 A;  1TNR A;  1OOP C;  2XJU A;  3MV1 1;  2VNV A;  3LEM A;  1UD1 A;  3FFQ A;  4Q0S A;  3U0Z A;  4UBG A;  4WVV A;  5CVR A;  1WMF A;  1HIX A;  1W6O A;  1VBD 1;  3NVC A;  1UY0 A;  2RJK A;  3I2J A;  4TXW A;  2YFZ A;  2DBN A;  1UO9 A;  2WS9 1;  2FHR A;  4N43 B;  3ACI A;  5IK4 A;  1ULC A;  2A75 A;  4FXK B;  5I8T A;  1AZD A;  3JZV A;  2IFR A;  4OYU A;  4HXC A;  4UWD A;  1ZYB A;  3ZYR A;  1F4H A;  1BHG A;  3HIF A;  3H1Y A;  3HQU A;  5LWB A;  4QB1 A;  4I30 A;  1O91 A;  4YVW B;  4A7Z A;  3H0O A;  3J7N A;  4CCK A;  1ZZ7 A;  5BUV A;  2LUW A;  3KMH A;  3RYK A;  3ZO0 B;  3ZFF B;  4NHM A;  2W39 A;  2QQN A;  3P3P A;  4MGS A;  5FRA A;  3WIN E;  4AEM A;  3NNJ A;  1HRI 3;  4U2A A;  5FZH A;  2GND A;  5CAZ A;  5ISL A;  2WKK A;  3M3C A;  5C9A C;  2E31 A;  2QTW B;  4XF1 A;  3WP5 A;  5DZE A;  2VMH A;  4Y24 A;  2VQA A;  3LGR A;  1BEV 2;  5LBF A;  5IFT A;  4XFB A;  4MUV A;  3OUJ A;  4WV8 A;  5GKA C;  5GZD A;  3WF1 A;  1O7F A;  3M2M A;  4M0N A;  3O1U A;  4XDO A;  5FYT A;  1QQP 3;  2GN7 A;  1ZA4 A;  1TMF 1;  2QFE A;  2VUA A;  2WWJ A;  2CDP A;  3H3L A;  1NE6 A;  1PMI A;  2LRO A;  3ZFF A;  3T3Y A;  2WA3 A;  3M7A A;  1WLD A;  3SIS A;  4LNV A;  1OFN A;  4OUL A;  4CTE A;  4JGZ C;  5FMB A;  3SH4 A;  1GWM A;  4R4Z A;  3KVB A;  2P1B A;  1Z7S 3;  1OVP A;  1RUD 3;  2ZX4 A;  3PJY A;  4CU7 A;  1Q5O A;  4H7L A;  5C33 A;  5FZL A;  5A3T A;  3N9P A;  5FYM A;  4AFC A;  5JZG C;  3BGA A;  5LA2 A;  4XIO A;  2DTY A;  5FY9 A;  2VZQ A;  4LK7 A;  4QPW A;  4RGG A;  1LGB A;  3H8U A;  2RMU 2;  4NJ4 A;  1YXW A;  2JIG A;  4GH4 C;  2C1F A;  4IEV A;  4ATE A;  4FPO B;  1RMU 3;  5C8C A;  2W1Q A;  4FCA A;  4FPH A;  4L97 A;  5CZK A;  3DN7 A;  5GZG A;  1GNZ A;  4XAA A;  2PQS A;  2Q4S A;  4L92 A;  2DFC A;  1XRU A;  2X05 A;  1FMD 3;  2NMN A;  3IN9 A;  3F2Z A;  3CJX A;  3VBF C;  4CCN A;  3VDA A;  1A8M A;  4LT5 A;  3FBM A;  2OQ6 A;  2BBA A;  1C8M 2;  1EV1 1;  3GDB A;  1N3Q A;  1ZBA 3;  3ZXJ A;  4HL0 A;  2K2S A;  3LPG A;  3UK9 A;  4LO7 A;  5BNQ A;  1ZRD A;  4LTA A;  5BNP C;  5FPZ A;  4CDQ C;  1SLB A;  4FPF A;  2ZZJ A;  4AI3 A;  3I3D A;  4KI5 M;  4PQ9 A;  4XJU A;  4GKX A;  4BE3 A;  4AEJ A;  5FK8 A;  4CU8 A;  4V2W A;  4C91 A;  1GQP A;  3L2H A;  1C4R A;  3V0B B;  4JHZ A;  2R06 1;  2WAA A;  3N35 A;  1O4T A;  2AR6 A;  4CCL A;  2JDM A;  1OF4 A;  1X8E A;  3AB0 A;  3ZXE A;  4IV1 B;  3H9A A;  2WJS A;  5CYY A;  3VZJ A;  2V5D A;  5FZO B;  3TWI A;  2MEV 1;  4RR3 C;  4UFJ A;  4CXW A;  2CDO A;  4EWA A;  4QAW A;  2HKX A;  1QJX 1;  2JDA A;  3BU7 A;  2ZGU A;  1WW4 A;  3ZYG A;  5IUQ A;  1RHI 2;  3NJZ A;  3HPN A;  3KD4 A;  4RD7 A;  4Y26 A;  2QQM A;  5CFC B;  1GKB A;  3V0B A;  1AVB A;  1QXJ A;  3IBM A;  3T4H B;  1OT5 A;  4IV1 A;  2QZ3 A;  2GAL A;  4MVT A;  1PO1 2;  5T5O A;  3PVO A;  3VHP A;  4YZ5 A;  1X36 A;  5HXM A;  1WCS A;  3PJQ A;  4IXL A;  1QDC A;  2J1U A;  4HKW A;  4RQP C;  1CWP A;  1TG7 A;  5FJK A;  3ALQ A;  5FZO A;  4DEQ A;  5AC9 1;  4RYD A;  2GC2 A;  1W6N B;  4ARY A;  2ARE A;  2ET7 A;  2GNB A;  1CR7 A;  3OSD A;  3DKQ A;  1J3P A;  4DFS A;  3ZFE B;  5CFC A;  2VZR A;  1REF A;  1JBC A;  1SDW A;  3ZYP A;  3WW4 A;  3T2O A;  2R1B A;  5T50 A;  3KCC A;  1H9W A;  2UWC A;  1VBE 2;  3POF A;  3V65 A;  1W06 A;  2CYF A;  1YIP A;  5KR7 A;  2A6Z A;  2IXI A;  3UJO A;  1V00 A;  3M3E A;  3GZU C;  2ORZ A;  3VKM A;  1W6N A;  4LO5 B;  4PDW B;  1J84 A;  4GB3 1;  4O7X A;  3K48 A;  3SEP A;  2VNG A;  5HCF A;  3NV4 A;  4W6W A;  2PXJ A;  3GJA A;  5JMO A;  3H8R A;  1TEI A;  1UPI A;  1JS9 A;  2ZEX A;  3LIH A;  3SEE A;  4LHS A;  4C8D A;  1AYM 2;  4JX0 A;  3HVD A;  2HWF 3;  3ZFE A;  1KS5 A;  1M06 G;  4E8D A;  1FOD 2;  2XQR A;  1F35 A;  2RHP A;  3DF0 A;  3I4I A;  3D8C A;  1H4H A;  2ARA A;  3DPR C;  4XZU G;  2DUO A;  3O14 A;  3ZN6 B;  3O1O A;  5FZ7 A;  4K6B A;  4LLO A;  5EJ1 B;  3UJQ A;  4ORF A;  4NHY A;  3WP3 A;  1RB8 G;  3G6J B;  2DCZ A;  4OHV A;  4PIY A;  4RS5 C;  1SCS A;  2VM9 A;  2XKP A;  4PDW A;  4E2G A;  2WDB A;  4JGY B;  3WV6 A;  1ZZC A;  2P6C A;  5FPV A;  1BCX A;  3KV6 A;  1LEN A;  2YGM A;  5IFP A;  1PZ9 A;  1UKG A;  4FOQ A;  3WDT A;  4XJZ A;  1D4V B;  4Q1R A;  4IV3 A;  2VCA A;  5LK5 A;  3ZX7 A;  1RUF 3;  1DG6 A;  1OLQ A;  3ZN6 A;  1UIJ A;  1W8Z A;  2HWD 2;  4D8M A;  4AVS A;  1QEX A;  4CUG A;  1MEC 2;  1V9U 2;  1AL2 2;  4DUW A;  2JDK A;  1LHW A;  3JB4 C;  2Y6G A;  2Q8D A;  3EBR A;  1ULE A;  4X6R B;  5FZG A;  4JGY A;  4S2F A;  4ARX A;  2JEN A;  1HB1 A;  2QCS B;  1CX4 A;  3AP5 A;  2UU8 A;  1YFX A;  2ET1 A;  2IXL A;  1C3H A;  2BOJ A;  1HLC A;  3ACH A;  5FZC A;  1CES A;  3GF6 A;  3VDC A;  1D0G A;  1SBD A;  2JKX A;  4Y22 B;  4AI8 A;  1W8F A;  2QQK A;  3DV8 A;  4J1X A;  4WM8 A;  2BNO A;  3H1M A;  3IPV B;  3W20 A;  3AZX A;  2OUH A;  4CDU C;  1QWR A;  2FDH A;  2GMP A;  3MGU A;  1AF9 A;  1IS3 A;  2O0O A;  2GH2 A;  2Y6L A;  3B01 A;  4HT1 T;  1N1V A;  1OKO A;  3I2O A;  3RMY A;  2RS5 2;  2WFP A;  2JE9 A;  2I2S A;  3RZG A;  1NCQ A;  1PGW 2;  4QGN A;  2CWS A;  1VIW B;  2BGC A;  4FPC A;  1AXZ A;  1B35 B;  1VMJ A;  2HBU A;  3KQR A;  3TEX A;  2R0H A;  1JI6 A;  3GZT B;  3HNB M;  2W92 A;  4Q29 A;  4Y22 A;  1RVF 1;  1W03 A;  4NUB A;  4YW6 A;  4JQT A;  3IPV A;  1K42 A;  1W28 A;  3ZXD A;  1TQ5 A;  4FOY A;  1AJK A;  4AHZ A;  2DCJ A;  2B5H A;  3B69 A;  3VDD C;  3ZPY A;  4LQR A;  5BPX A;  4FFI A;  1WA4 A;  4K8F A;  4XJ8 A;  4UT5 A;  4IEZ A;  3HMY A;  1HRI 2;  3SCH A;  5KC5 A;  4D94 A;  3O1P A;  5F7U A;  4XJA A;  1B35 A;  3WG1 A;  1WZX A;  2J42 A;  1STM A;  3KQ4 B;  3M3I A;  1VBE 1;  3QBQ A;  5FBJ A;  4DIN B;  4YAR A;  2UY8 A;  4LUM A;  1MS8 A;  1QQP 2;  3QH7 A;  5IVY A;  2VMD A;  3WG2 A;  2KA3 A;  1D4M 3;  1UW8 A;  1B09 A;  4BLJ A;  4A3Z A;  3MDP A;  3VV1 A;  4MGT A;  1GZW A;  3KF5 A;  4URT A;  1OUX A;  2E63 A;  2RS1 1;  3OBZ A;  4LK6 A;  2D6L X;  1RUJ 3;  1MQT B;  5DPN A;  2X09 A;  5H9R A;  1RUG 1;  2FCT A;  1ZRR A;  1POV 3;  3OGV A;  3Q8A A;  1Y9M A;  2CTV A;  1FOD 1;  1HQW A;  1OOP B;  1Z7S 2;  2R04 1;  2A71 A;  4N53 B;  5BNO C;  4QB6 A;  1LHN A;  4OLL A;  2IUW A;  3TN9 3;  3WUC A;  5HV0 A;  1KDK A;  3AZV A;  2TUN A;  2QZ2 A;  2OYZ A;  2IFW A;  2UYA A;  4I0A A;  5IAX A;  1AYN 1;  2ADD A;  1IGO A;  1RMU 2;  1VBD 3;  2FCU A;  1RED A;  3KVA A;  4ZS3 A;  3AM2 A;  2VQU A;  2WS9 3;  3OGR A;  4FAG A;  5HCA A;  5ACA 1;  3MUY 1;  2WT0 A;  3AZZ A;  3ES4 A;  4D7Y A;  1FMD 2;  1JUH A;  3FMG A;  2ZHL A;  2HWD 1;  5CU1 A;  4BIS A;  4CDW B;  4KWU A;  1NLQ A;  4GA9 A;  3MW3 A;  1AL2 1;  2ORX A;  4K1Y A;  2HEW F;  4QXC A;  3RYP A;  3T2P A;  1OXC A;  5CKQ A;  1JZ2 A;  1RUO A;  5T5L A;  5C9A B;  1ZBA 2;  1KIT A;  4K1Z A;  4YW2 A;  3BTX A;  2Q8O A;  2EF6 A;  1BXH A;  2BDR A;  2ZGS A;  1WLC A;  3BAL A;  5GZF A;  1AR6 2;  4CEW B;  2CAV A;  4SLI A;  4BZ4 A;  5F2S A;  1RGS A;  2A70 A;  2BVV A;  1WLW A;  3VD3 A;  3JB8 A;  1A6C A;  3PNA A;  1RUH 3;  1LOD A;  2XUE A;  1OVS A;  3O12 A;  2D6O X;  4CDW A;  1W6Q B;  3BU0 A;  4Y1X A;  1Y7B A;  1CZT A;  4YFZ A;  1O8P A;  2FDK A;  3LFI A;  4Y1V A;  1O3Q A;  1VRH 3;  4E9K A;  4GMP 3;  4Z8B A;  5CKN A;  5A6Q A;  1R1Z A;  2WQZ C;  1X7N A;  5FUP A;  5CAD A;  1UXZ A;  4CEW A;  2V5Y A;  1GOH A;  1LNS A;  2B8M A;  4QDR A;  3NAP B;  1DDL A;  2P6H A;  2ZX1 A;  1ULD A;  3F95 A;  3MIC A;  2ZAB A;  4ZZ5 A;  3RZM A;  3CU7 A;  1XJA A;  1KFU L;  4TWT A;  1W6Q A;  2EIC A;  2VBP A;  3GBW A;  4R8H A;  4IE5 A;  2DV9 A;  1UY3 A;  2IC1 A;  4Q2F A;  3UKV A;  3WOG A;  4F8A A;  5BNN B;  5KWR A;  2WYS A;  2YC2 A;  2D3S A;  3BTA A;  3KV5 A;  3PUH A;  4HET A;  5EWS A;  5JI9 A;  2VZT A;  5GLU A;  5FO7 B;  3J8F 3;  3DKW A;  4QX5 A;  3VBU B;  4JKK A;  3W21 A;  4AVT A;  1R1A 3;  5IVV A;  3CKH A;  4A6O A;  1C28 A;  1OLM A;  3PME A;  3PIG A;  2YC4 A;  3ZFF C;  4F3J A;  4K40 A;  1Q8S A;  1RIT A;  4ZU5 A;  3AMQ A;  4CDQ B;  1TE1 B;  1O6U A;  2RE9 A;  5EV7 A;  5L19 A;  1DGR N;  2CSG A;  5BNN A;  2ZBJ A;  1EV1 3;  1UOG A;  5IAT A;  5A1L A;  5F39 A;  4R9A A;  2VZV A;  2W3J A;  3K46 A;  2V09 A;  2YC0 A;  4Q4V 1;  3VBU A;  3H1W A;  2ARC A;  2RS3 3;  3AJZ A;  4BQ1 A;  3ZYB A;  1F9K A;  1Z7S 1;  5C8C C;  1RUD 1;  4BQ3 A;  3WNO A;  1G7Y A;  3URF A;  5BV6 A;  5DG1 A;  2HWF 2;  3RJR A;  3LF7 A;  1BKZ A;  3LCP A;  3ZYH A;  5JR7 B;  4H3W A;  3IM0 A;  3OGS A;  3Q8E A;  4QQP A;  5FYU A;  4NPM A;  3SMH A;  3I2I A;  3H3Z A;  1K5J A;  4O9E A;  1VE0 A;  3MHZ A;  3AKP A;  2BWA A;  4A4A A;  1FV3 A;  2R0F A;  4GIQ A;  4D7T A;  1W0O A;  5T3N A;  2R07 3;  2XB6 C;  4YLZ A;  2WBK A;  5FYI A;  2HWE 3;  2UWB A;  2RR1 3;  3UGG A;  2FZ2 A;  2DVD A;  1FMD 1;  2A6V A;  3VHN A;  3M3Q A;  3MF9 A;  2FCV A;  3VBH A;  4GWI A;  1S0J A;  3AKS A;  1VAL A;  4N7I A;  1G9B A;  2IWG B;  4A42 A;  4QHB A;  1RUF 2;  3LD8 A;  3OEB A;  3WLU A;  3D0S A;  3EQE A;  3VZK A;  3AX4 A;  2PLV 3;  5FPB A;  1QU0 A;  3S30 A;  5IHR A;  1NA1 B;  3KT1 A;  2JWP A;  5AC9 3;  1BJQ A;  5KBF A;  2ID4 A;  3GGL A;  1C57 A;  2QQL A;  2GH8 A;  5E89 A;  1V70 A;  4EN6 B;  2XWJ B;  4B1L A;  4ASK A;  4EN9 B;  1JYX A;  4LBL A;  3SQO A;  4CEY A;  5FLI A;  5A1A A;  1LJ7 A;  2DVF A;  2Y6H A;  5T5J A;  3THP A;  1UYZ A;  1UMZ A;  2V72 A;  4L8Q A;  5I0T A;  4YVS B;  1NA1 A;  3A4U A;  4IV1 C;  4OZO A;  4TYS A;  4H2A A;  4GB3 3;  4LEJ A;  4P5H A;  2ZOE B;  2NQY A;  3WNP A;  1MAC A;  5A1F A;  4P5Y A;  4FTB A;  4MHU A;  2EAK A;  1PGL 2;  3GZA A;  5FY8 A;  2ZMK A;  3VD5 A;  4RS5 B;  4BOW A;  2WA4 A;  1QIQ A;  3FE5 A;  4AQ2 A;  4QU2 A;  4B4R A;  3BCW A;  4AFM A;  5CFC C;  3O1T A;  4Q8L A;  2WRA A;  2BGP A;  1Y43 B;  5FLJ A;  4COV A;  1W8T A;  3LOB A;  3LQC A;  4C1W A;  2JIC A;  4YVS A;  3JCI A;  3OPZ A;  1UPS A;  4XQ4 A;  3VD7 A;  2HH9 A;  4KWJ A;  2ZEW A;  1PM4 A;  4A44 A;  1T6G C;  1QH6 A;  3ETP A;  1HDK A;  2VOW A;  2XOM A;  4MO3 M;  4XHX A;  4CPB A;  4YGE A;  2BER A;  2ZA9 A;  1BQP A;  1CVN A;  2E53 A;  2A1X A;  4UBH A;  3SLI A;  5APA A;  1NY7 2;  3ZFE C;  4DUV A;  2GDF A;  4XW3 A;  1HV1 A;  1F5J A;  2VEC A;  4WBB A;  5FMD A;  1D4M 2;  2VW0 A;  3AP7 A;  2RDQ A;  3KF3 A;  1Q56 A;  1S0C A;  5E6H A;  3OOX A;  2CU5 A;  1X82 A;  4Q8K A;  2YHJ A;  4A7K A;  2HWF 1;  2VTF A;  3BOW A;  5IJR A;  3ZLI A;  1ZRE A;  4PDW C;  3NJX A;  3ME2 A;  4MSV A;  2DVB A;  5LA1 A;  1XND A;  4ASL A;  4Z2W A;  5FUN A;  5CIR A;  1W2T A;  4JRA A;  4YGB A;  1HXS 1;  2VXJ A;  3DCQ A;  3DEC A;  4MGI E;  3UES A;  2GNM A;  2YMZ A;  3AYD A;  4OUE A;  3KSC A;  5C4W B;  4FI9 A;  1VBD 2;  1E5S A;  2YBK A;  2WS9 2;  5A3P A;  1N3O A;  5EJ3 A;  1JMU B;  2W95 A;  5A3U A;  5J37 A;  1LGC A;  1R08 3;  1APN A;  4HSL A;  3CHX A;  1JHN A;  4JGY C;  4BJ0 A;  4P08 A;  4EV0 A;  1YO8 A;  4XJW A;  2Q30 A;  1RVF 3;  2YXS A;  1S2E A;  3ATG A;  4A2U A;  5LCW L;  4NIH A;  4OI0 A;  1CIW A;  1XYP A;  5A3L A;  1VMF A;  4MGK E;  1XBF A;  2WC2 A;  3AP9 A;  4XZP A;  3RI8 A;  4WM8 C;  3DL3 A;  5C4W A;  4N90 A;  4COZ A;  3RRD A;  4CUB A;  3B94 A;  1DYO A;  4HLT A;  4XIL A;  4LBJ A;  3OPW A;  1OF3 A;  4CCJ A;  1H6X A;  4DNY A;  3I2H A;  3QLQ A;  1GU3 A;  1MR5 A;  4AQS A;  2KR2 A;  5JPM B;  5HCH A;  1RUH 2;  3BN6 A;  3O0X A;  2FDJ A;  4IER A;  1NCQ C;  1PMH X;  1WBL A;  2B4K A;  5EIY B;  3MPP G;  1IS6 A;  3TNQ A;  2F4P A;  5FYV A;  2B9V A;  1QXP A;  5FPU A;  1LU1 A;  2J1S A;  2Z2S B;  2XJV A;  2C5D A;  3J26 N;  3O1S A;  2EXH A;  2D44 A;  4YZ2 A;  2FMD A;  3GJB A;  2RS1 3;  2EA7 A;  4AE2 A;  4P9W A;  1ASJ 3;  4I2O A;  4ZKT B;  4OUS A;  3K75 B;  4HKL A;  1RUG 3;  4IEX A;  4YM2 A;  3ZXA C;  2VR4 A;  5G04 L;  4OFG A;  5FK7 A;  2JIJ A;  3DXT A;  1XSR A;  4UFM A;  1F4A A;  2JEM A;  2C24 A;  4JAA A;  1KXG A;  2A3Y A;  1B35 C;  1TNF A;  4JDM A;  2TEP A;  2XL7 A;  4M4R A;  4Y5T A;  4CCE A;  3QH6 A;  1YFY A;  2DDU A;  3QOP A;  1ZZ9 A;  4YZ1 A;  1AYN 3;  5C3Q A;  4M01 A;  4RHV 1;  1KJR A;  3J8F 2;  5L9V A;  3C7E A;  2EXK A;  2D3P A;  3EYP A;  1IQD C;  3MIG A;  2Y33 A;  2QQU A;  3ZSE A;  5FY0 A;  5F9T A;  1GV9 A;  1V6K A;  2GAU A;  3AL6 A;  3SC7 X;  4F83 A;  5IT6 A;  4BXF A;  5ACA 3;  4LKD A;  4CXX A;  1NKG A;  3MBW A;  3MFC A;  1G9C A;  3TEZ A;  5JLV A;  4LIT A;  1NZC A;  4OI4 A;  2VW2 A;  3PU8 A;  2AC1 A;  3CJI A;  4LHN A;  4E4D X;  1D4M 1;  1W04 A;  1XNB A;  4Z82 A;  1EV1 2;  1KGY A;  4KG8 A;  1O3T A;  1KS4 A;  1VPH A;  5FZA A;  2W08 A;  4KMQ A;  5FMC A;  1R64 A;  1RUJ 1;  4CCM A;  1H2N A;  3HNM A;  5FKB A;  1POV 1;  1EAH 1;  2VMI A;  2VZ3 A;  3VUO A;  1DLL A;  5LRS A;  1JW6 A;  2H6B A;  5KXC A;  3T08 A;  2WO1 A;  4AI2 A;  4D69 A;  5FZ8 A;  3H42 B;  3GYD A;  5BXX A;  3TN9 1;  3BI3 A;  3MFA A;  5C3S A;  5CFD B;  2Y6F A;  2OUJ A;  3LDR A;  3NST A;  4IEO A;  1FNY A;  1W8W A;  2YU1 A;  1RTV A;  2VY0 A;  3N9O A;  2D5H A;  3P6B A;  4N53 C;  1DGW A;  3VBO B;  1W9T A;  2Z79 A;  4BHP A;  1N1Y A;  4OMD A;  4LIU A;  2O8Q A;  1F15 A;  2WZR 1;  3K2O A;  2WT1 A;  4QQL A;  4XMA A;  5I93 A;  3O1M A;  1MZ5 A;  1IS5 A;  2JD9 A;  2MEV 2;  2W68 A;  3NNF A;  1L7Q A;  3AL5 A;  3RZZ A;  2XR4 A;  2HBT A;  3HBZ A;  1VAK A;  1QJX 2;  2R07 2;  2BYV E;  2HWE 2;  3LA7 A;  2RR1 2;  2R30 A;  2ZAH A;  1ZRF A;  5FZF A;  2YFU A;  3LZZ A;  2PAE A;  2ZS6 B;  2AGS A;  5CFD A;  4AAP A;  3AYE A;  4FQ4 A;  2P4E A;  2ZML A;  3VGI A;  4QM8 A;  2XML A;  3FLR A;  1GUI A;  2WSU A;  3B00 A;  4UYB A;  1W9Y A;  2J1R A;  3VBO A;  3LIG A;  2BFU L;  2YV8 A;  3LFM A;  1EYB A;  4CDW C;  3RDI A;  1AL0 G;  3WNM A;  4B7E A;  1ULF A;  3MEP A;  5AC9 2;  1URX A;  2PA7 A;  2VMC A;  2VOV A;  3WNN A;  5J98 B;  1S2K A;  1RUH 1;  4FQZ A;  3ZDS A;  2TBV A;  4Q4Y 3;  1HB4 A;  1HQN A;  5DUV A;  4DB5 A;  2DUP A;  3WF3 A;  5HCB A;  5C70 A;  4CEW C;  4DY3 A;  1RUC 3;  2B9U A;  1GMM A;  4L0P A;  4GJY A;  2CGO A;  1ALY A;  1V6N A;  5GLV A;  1VRH 1;  5FZ9 A;  4GMP 1;  5CEH A;  2J1T A;  5C8C B;  3H3U A;  4EE2 A;  2DUR A;  3N7J A;  2W1U A;  3CDZ B;  4UF0 B;  1U12 A;  4N8M A;  4XAB A;  1NXD 1;  2D43 A;  4LA3 A;  4Q4V 3;  3WW2 A;  5GAL A;  3ZN5 A;  3WDY A;  4QKB A;  4GB3 2;  5CG9 A;  2DYC A;  4XBN A;  2PAM A;  4AHX A;  2ZKN A;  2JDZ A;  3C7G A;  3VL8 A;  1JOB A;  2A3X A;  2PQQ A;  2Y60 A;  4MYE A;  1YCI A;  2ZGO A;  2W94 A;  2VUL A;  3ZKY A;  3NAP C;  3BYW A;  3N3H A;  1OA2 A;  5F3C A;  4W6X A;  4O61 A;  5KHH A;  4FPE A;  3J8F 1;  1UCX A;  2FMY A;  2QQO A;  4UF0 A;  1QJZ A;  1R1A 1;  4CYD A;  3MLL A;  5BNN C;  5JOX A;  3PDQ A;  2E6V A;  2N7G A;  1N47 A;  1KD7 A;  4IQP A;  5FY4 A;  1AXY A;  2BTV C;  1F8V A;  2YB7 A;  3VBU C;  2BGO A;  5K9Y A;  4BMB A;  3OGJ A;  4PI2 A;  3BPZ A;  4LOR A;  2ZEY A;  4XDQ A;  1X50 A;  5I0S A;  4XFF A;  2WR9 A;  1JXN A;  4XFI A;  4DY5 A;  1ZX5 A;  4AZZ A;  1K12 A;  4DO0 A;  1IS4 A;  2BNM A;  3HN1 A;  3KCX A;  3SCF A;  1TME 1;  2PFW A;  3VHR A;  2XJR A;  1AHS A;  3IMM A;  1DQ1 A;  4FFF A;  3M70 A;  5CG8 A;  3LEK A;  4BM8 A;  2RS3 1;  5FP9 A;  3ZDV A;  2F17 A;  1Y9G A;  3EJK A;  5K0U A;  5EJZ B;  5A3M A;  2VCC A;  5F37 A;  2WWS A;  1ZNP A;  2BV4 A;  1YIF A;  4XTM A;  3K4A A;  1W9W A;  3AP6 A;  5IK7 A;  2FBE A;  1UOB A;  1W6P B;  2HYK A;  4XUQ A;  5LA9 A;  4ES8 A;  5FAX A;  4UFI A;  1UY2 A;  3J7M A;  3WW3 A;  3S5A A;  3IAP A;  2VNO A;  3VBH C;  5DAX A;  1BVV A;  4L99 A;  5DN2 A;  5L9R A;  3RQ0 A;  3U75 A;  3I2F A;  1BVP 1;  1QF3 A;  3FHA A;  4RFR B;  1UXX X;  5AFE A;  3OD0 A;  3W5M A;  2R07 1;  2Y6K A;  3OD4 A;  2HWE 1;  1EPW A;  2RR1 1;  4G9S B;  2XJQ A;  3ZPO A;  3A0N A;  4HOO A;  3M1H A;  4FPY A;  3W9A A;  5I91 A;  5JWP A;  1G9D A;  2DBI A;  3V56 A;  1W6P A;  2H0B A;  1R08 2;  1SFN A;  2HWC 3;  4KGQ A;  5FYB A;  3AKT A;  3PVB B;  4BK5 A;  2D40 A;  4AEK A;  1RVF 2;  4AG4 A;  1V6M A;  2PLV 1;  5JXG A;  4ERO A;  3KGL A;  1I1E A;  5J96 B;  4JC1 A;  4HON A;  1OQD A;  5JIU A;  5F3G A;  4CEY C;  2VO5 A;  2B45 X;  3I97 A;  3AMH A;  4HN1 A;  2PHF A;  3TOJ A;  5FP3 A;  3S57 A;  3C7F A;  4FFH A;  2P5B A;  1NA1 C;  1S0D A;  5G05 L;  1N1T A;  4COU A;  2XVK A;  5HV4 A;  3J7H A;  3ZXK A;  4YW5 A;  3E1F 1;  1NE4 A;  4OI1 A;  1UYP A;  1MS0 A;  4XMI A;  4XEZ A;  4G3Y C;  1RXG A;  3ZSJ A;  4BWO A;  4FAH A;  2ZGQ A;  4QX8 A;  1PK6 B;  4DEV A;  1H2M A;  1W8O A;  3WDW A;  1WMX A;  3NNM A;  4MET A;  3UKN A;  3HAG A;  4PT6 A;  2YUE A;  1AX2 A;  2CY6 A;  1QY4 A;  1N1S A;  1R09 3;  1W3V A;  2RS1 2;  4XDP A;  1ASJ 2;  2ARB A;  5FXW A;  5FTT C;  2W52 A;  4QKN A;  4XE9 A;  4YVS C;  1RUG 2;  2NN8 A;  3E5X A;  1EP0 A;  3FLT A;  4IV3 B;  3WF4 A;  3FN9 A;  2R04 2;  3PUR A;  4XHB A;  1U5X A;  5DUX A;  4E8C A;  1M4W A;  4P9I A;  1S4C A;  2BU9 A;  1G8W A;  3HD8 B;  1A8D A;  1HXS 3;  1BZW A;  5C3R A;  5DUU A;  4X6Q B;  2P34 A;  1PK6 A;  1DYK A;  1AYN 2;  4P9X A;  2A6Y A;  2Y34 A;  2JDP A;  1QNY A;  1MS9 A;  2XLA A;  1VBA 3;  4KQ7 A;  4UAP A;  3E5Q A;  1O8S A;  3NL1 A;  4QD2 A;  1PZ7 A;  2ZGR A;  4XBQ A;  4FPL A;  2G9F A;  2D6M A;  5ACA 2;  3VLB B;  2BEO A;  4WM8 B;  4Y33 A;  2WYF A;  5FOJ B;  5L36 A;  5J3U A;  3NMB A;  2VVE A;  4IL7 A;  2RM2 1;  2VUC A;  3R4S A;  5I0R A;  3JU9 A;  1XNT A;  3OEA A;  1DBN A;  1H8T B;  5FYY A;  1IG3 A;  3RZK A;  3ZSL A;  2BRT A;  4J1W A;  2CGP A;  1H2K A;  1NCQ B;  1GZC A;  1UNB A;  1VAM A;  3I3E A;  1DP0 A;  2PHT A;  1SFP A;  2QQP A;  2VZP A;  1DHK B;  2ILM A;  4XFG A;  1WW7 A;  3ZR6 A;  3OYW B;  4LBO A;  4CUA A;  3AKR A;  2FQP A;  2VD7 A;  1YQ6 A;  1JUI A;  2VTX A;  1H1M A;  3INA A;  3P3N A;  4QXH A;  3CLP A;  5FQ0 B;  1S0B A;  3DYP A;  1J1L A;  3ZXF A;  4CDX A;  1C5H A;  2PYT A;  4AAX A;  4AF9 A;  2A5Z A;  1PVC 3;  2D5F A;  1AR7 3;  1H8T A;  2CL2 A;  4HMZ A;  4Q4X 1;  3UYJ A;  2YPD A;  3MW4 A;  5LBE A;  1UIK A;  3C3V A;  1YQ8 A;  5FZM A;  4LUK A;  2WNO A;  3N7M A;  1ND3 B;  2CNA A;  4QGL A;  1DLC A;  4JZR A;  3N7L A;  1POV 0;  1R08 1;  3ABZ A;  4NPR A;  5C4W C;  3WNX A;  4CXY A;  4BQ2 A;  3OYW A;  1HW5 A;  2NZ9 A;  2VUD A;  3C2U A;  3IDE A;  5DAW A;  4B7K A;  4CCC A;  3WUD A;  5FPA A;  1ENX A;  4H7M A;  1CAW B;  4PF5 A;  5FQ0 A;  1GZW B;  1VBB 3;  3ETQ A;  2PTM A;  4RHV 3;  1HX6 A;  4A7Y A;  1ZBE 3;  1LKN A;  5LEK A;  1A3K A;  4I09 A;  3B7M A;  5IVJ A;  1JH5 A;  3GZE A;  4NR1 A;  5A80 A;  3KV9 A;  2PHW A;  2XXZ A;  1ND3 A;  3H50 A;  3HJR A;  4WM7 B;  4Q4Y 2;  4NN0 A;  3J9S A;  2BFU S;  3PIJ A;  2ZZQ A;  2X29 A;  1G9A A;  1GWL A;  1CAV A;  4V1P A;  4GKY A;  1QHD A;  3CIH A;  4AL9 A;  5FWJ A;  1CAW A;  4H55 A;  3E6D A;  4I0W B;  1LGN A;  1FX5 A;  4LOT A;  4C1X A;  3KM5 A;  3NRU A;  2XVG A;  2D98 A;  1QJY 3;  1GLH A;  1ASJ 1;  3J7L A;  4Q5O A;  1YQC A;  2EIG A;  4X8P A;  5KXB A;  4Q4V 2;  4UFH A;  1W90 A;  3WF0 A;  3OTF A;  1EAH 3;  4QDQ A;  2GN3 A;  1Q43 A;  1RUD 2;  2YZ4 A;  4WM7 A;  1NLR A;  3MV0 1;  3B02 A;  1O3R A;  1QGL A;  2JG9 B;  1O5L A;  3IDA A;  1OSG A;  3ZYI B;  4BQY A;  4OHX A;  3OCP A;  1HV0 A;  1YI7 A;  1SFY A;  5LA0 A;  4GMP 0;  3D3A A;  2WZR 3;  3EXU A;  4JTN A;  4I0B A;  4A3X A;  3BVC A;  3RPQ A;  3I2D A;  2PHU A;  4Y3O A;  4JKL A;  2KD7 A;  2VZS A;  2GU9 A;  3I3M A;  5KHG A;  1CX1 A;  3WQ7 A;  1WW6 A;  3NKG A;  4XUT A;  2VBD A;  2YRO A;  3T0A A;  3SIT A;  2XDV A;  1NZI A;  3BPS A;  5ABJ B;  2JG9 A;  2IZW A;  1ZVF A;  4P9Y A;  1LAJ A;  1W39 A;  3ZIW A;  3OB8 A;  4YZ4 A;  1LUL A;  4IEU A;  4QU1 A;  1IPS A;  4J25 A;  3KWV A;  3RFR A;  3UGH A;  5CNA A;  2FDG A;  5DDJ 3;  1E5H A;  2I07 B;  1ODM A;  1NT0 A;  2OS2 A;  2VW1 A;  1MZ6 A;  4FP2 A;  3Q8C A;  3K51 A;  3T4V A;  1YQ5 A;  1C8N A;  4I3P A;  1NG0 A;  4P00 B;  3CL1 A;  3MIE A;  3PL0 A;  4IND A;  4PQQ A;  4XUR A;  1PIV 1;  1IG0 A;  1X8M A;  2PHL A;  2VMF A;  4PI0 A;  4BU2 A;  5C5T A;  5JOY A;  3P5B A;  5ABJ A;  1CPN A;  4S2H A;  2WLQ A;  2D93 A;  2E26 A;  4LUL A;  1JU3 A;  3FWE A;  3CF6 E;  2E9Q A;  4H14 A;  2ZCW A;  2KM2 A;  5FRE A;  3RS6 A;  4COY A;  5CFD C;  1HJG A;  3WG3 A;  3KGZ A;  2XWB B;  2WIN B;  4ZXK A;  5HXV A;  5FR3 A;  3POI A;  2ZX3 A;  1W99 A;  3VBO C;  3WZ1 A;  4LIV A;  1FXZ A;  4HK8 A;  3W58 A;  5FPX A;  3U37 A;  4FBF A;  4IEQ A;  3T1L A;  5LW9 A;  2ZPX A;  2WII B;  3LB9 A;  1H9P A;  2K0G A;  1NQD A;  4NRO A;  1ULO A;  2IXK A;  2HWC 2;  4ZPI A;  1JYW A;  1WKY A;  2PHR A;  3ELN A;  3D0J A;  3ZIX A;  1WA6 X;  4NIG A;  3AP4 A;  4Q4W 3;  1VLN A;  1FAT A;  2GNT A;  3FC0 A;  3T09 A;  4AQ6 A;  4AHY A;  1HN0 A;  1I5Z A;  1XYN A;  5ERL A;  2E7Q A;  3LPF A;  3WQ0 A;  4LA2 A;  2G9Z A;  4Q4Y 1;  2P17 A;  3ZYJ B;  1BYH A;  4IE7 A;  5A7W A;  4GXL A;  2RDS A;  4LLF A;  5FY7 A;  1OH3 A;  1RUC 1;  1OH4 A;  4GUL A;  1X9T A;  2MHF A;  2A3W A;  1QOT A;  1LOE A;  2ZGM A;  2NYY A;  3BOD A;  4NRP A;  2GSY A;  3HOB A;  4LJH A;  2JX9 A;  3KZ4 C;  4UXA A;  1TME 3;  4WVZ A;  4ZS2 A;  1UZY A;  2VU9 A;  4Y20 B;  3DEM A;  5FZK A;  3T30 A;  4ONU A;  3UET A;  4Y1Y A;  5JOW A;  5KXD A;  4DXS A;  3V0A B;  4Z2A A;  1LED A;  2K46 A;  1QNW A;  4XUN A;  1UMI A;  1R09 2;  2UWA A;  3KT4 A;  4L11 A;  2YY1 A;  1C1L A;  3VBH B;  4K21 A;  2WFF 1;  4KBB A;  5F3I A;  1DQ5 A;  1PGS A;  4YW3 A;  5SV5 A;  3LDB A;  3I8T A;  1BMV 1;  4HK9 A;  1UL9 A;  4PF1 A;  2UY9 A;  1YC6 1;  3PUA A;  1GQH A;  4D7S A;  4YFW A;  1SG3 A;  2WWU A;  5LZ6 A;  1PO2 3;  2AEN A;  3GAL A;  1HXS 2;  4KU7 A;  4EWD A;  1FNZ A;  4Y20 A;  2CAU A;  1O5U A;  5FP4 A;  5CA6 A;  5FZ4 A;  3V0A A;  1LES A;  4IES A;  2LM3 A;  2AZ5 A;  5DXD A;  4XQW A;  5E88 A;  2QQW A;  1OA4 A;  4IGQ A;  4M0H A;  1K3I A;  2XL9 A;  3T0B A;  4HG6 B;  2VMG A;  3ZVX A;  1QOS A;  5K0U C;  1HQL A;  3MF6 A;  1H4G A;  2WO2 A;  4GWM A;  2GC0 A;  5BNP A;  4CEY B;  2P3K A;  1U5Y A;  4FOV A;  4CE8 A;  5A7Q A;  3V64 A;  2HEY F;  1Q8O A;  1V6I A;  1UZ0 A;  2EID A;  5J1X A;  1ACC A;  3B9C A;  3X29 B;  4MV2 A;  1NAE A;  5C8W A;  2PN5 A;  5EXO A;  1FI2 A;  1F2N A;  3LOI A;  3WP4 A;  3H7Y A;  3LWC A;  1IHM A;  2QNK A;  3ON7 A;  4AGV A;  5M0T A;  2A6X A;  2VCB A;  5KHI A;  2JE7 A;  2WNU B;  3VL9 A;  3WNL A;  1YEW A;  4B29 A;  3I3B A;  3RYR A;  1YNA A;  2B42 B;  2W91 A;  3AMM A;  1HB2 A;  4QPG B;  3ILR A;  4PLO A;  2Y26 A;  5EFU A;  3BUC A;  4LO4 B;  3GBG A;  3U07 A;  3S5Q A;  3AMN A;  5F5C A;  1GZT A;  4QMA A;  1RUE 1;  2AEZ A;  4BA6 A;  2VZ1 A;  4MXW A;  3GBF A;  4CP2 A;  4CCD A;  2BW8 A;  1O4Y A;  2VBB A;  2WN2 A;  1EPZ A;  2E51 A;  2VQT A;  1DCS A;  4ZHN A;  2VOT A;  4EQV A;  5AVA A;  1SLL A;  2CHH A;  3T1M A;  5I0U A;  5LAS A;  2WNU A;  4MGY E;  1RL3 A;  3IWZ A;  1SQ4 A;  4HN0 A;  4YRD A;  1BEV 3;  2ZAA A;  4Z1V A;  3UNP A;  4QPG A;  1OI6 A;  2PMW B;  5LY1 A;  3N7K A;  1AR8 1;  2HWC 1;  4TZD A;  1JYC A;  3E97 A;  3WY6 A;  4LBN A;  4RSU A;  4HKO A;  4ZU7 A;  4DRR A;  4NRQ A;  5FXV A;  1LOF A;  2IXH A;  3EB7 A;  1W3X A;  2HLE A;  4OHZ A;  2V4V A;  3M4F A;  4YZ3 A;  4QX1 A;  1DZT A;  2VH9 A;  3JXS A;  1XPW A;  4RHV 2;  3I7D A;  3RG0 A;  4EN0 A;  3O1V A;  5D21 A;  5FJH A;  3S7I A;  3NNL A;  4OQ8 A;  2NM1 A;  2Y8K A;  3ITQ A;  2BWC A;  1MS1 A;  2QQJ A;  1T6B X;  2W47 A;  3A21 A;  4XTP A;  4CCO A;  5KC6 A;  1KQR A;  5C6C A;  3E6B A;  2OQ7 A;  3HEI A;  4IE6 A;  4LHK A;  5A3W A;  2GC1 A;  2RMU 3;  3RZH A;  2HEV F;  3ENR A;  1YFW A;  3N9Q A;  2JXA A;  2VOK A;  4JCK A;  4CP0 A;  4K20 A;  3BIE A;  2RM2 3;  3NQH A;  2WN3 A;  1OUR A;  5L73 A;  4FTE A;  4IE4 A;  1MS4 A;  3I59 B;  4WZF A;  4HAN A;  4IE0 A;  4YGC A;  1R09 1;  1QJY 2;  3LE0 A;  2H6C A;  4DXZ A;  2EAA A;  1RUJ 2;  3FJS A;  2QKD A;  1PK6 C;  4FXG B;  3QD6 A;  4XAE A;  5IVB A;  2FDF A;  2RDN A;  1EAH 2;  1KFX L;  2GME A;  3S0M A;  4UI9 L;  2G4I A;  4IUG A;  2D3R A;  4DRV A;  2VJX A;  2LRP A;  3AKQ A;  3TN9 2;  5GLT A;  5B4X A;  1GBG A;  1E57 A;  2GP5 A;  1P8J A;  1QH7 A;  2ZGN A;  4IV3 C;  1KDM A;  1DGW X;  1COV 1;  2J7M A;  1EY2 A;  1XSQ A;  5JR2 A;  2XLG A;  4C0H A;  2AAC A;  4K3U A;  2WZR 2;  3I59 A;  4W4Z A;  1VBA 1;  4Q4X 3;  1DF0 A;  5JUV A;  3BKZ A;  5KHJ A;  1XC6 A;  1US3 A;  4FT8 A;  3WCR A;  4CPB D;  3K4D A;  3PMS A;  1I9R A;  4TN7 A;  1XNK A;  2UUR A;  4XYX A;  5T55 A;  4WVM B;  3ZFG B;  1PMJ X;  3USU B;  3ZN4 A;  2FDI A;  1RUI 1;  2Y6J A;  3IMN A;  1W6M B;  2ERF A;  3MUZ 1;  2XJP A;  4P9G A;  3FHI B;  3AYC A;  5DDJ 2;  5FYS A;  4E2Q A;  4Y4Y A;  4D6S A;  1KEX A;  4MG2 A;  1W0N A;  2DU0 A;  4CDX C;  1GYK A;  3VZL A;  2AH2 A;  3TAY A;  1H8T C;  4NE9 A;  3AVS A;  4C90 A;  1PX4 A;  2WZ8 A;  4WVM A;  3ZFG A;  4S2D A;  3MW2 A;  5FO9 B;  4FTS A;  3FZ3 A;  3USU A;  1OHF A;  1ZZ8 A;  3JBG 1;  1W6M A;  1ENS A;  3FHQ A;  1IQA A;  1V6L A;  5A70 A;  1PNF A;  1VRH 2;  1U5Z A;  4AOC A;  1MZF A;  4EJR A;  3U14 A;  4CVU A;  1PVC 1;  1AR7 1;  1LHV A;  2DUQ A;  4Q0U A;  4UFL A;  3ASI A;  1SLT A;  4YW4 A;  1OFS A;  4AGR A;  1IPK A;  4YYO A;  3ECQ A;  1GSL A;  4GAL A;  4HZF A;  1GP5 A;  4QXB A;  5EZW A;  4LE3 A;  2W1W A;  1VB4 A;  2LAL A;  2Q5T A;  5L7O B;  3TB0 A;  5F3E A;  3I2K A;  3FFZ A;  4K8R B;  2ZHM A;  2ZHN A;  3ACL A;  3CJI B;  1LEM A;  1ND3 C;  4AFD A;  2W2I A;  2IXC A;  3B5L B;  2XKO A;  4HVO A;  2Q1F A;  4OI2 A;  1VBB 1;  2C9A A;  1UY4 A;  4BYY A;  1UX6 A;  1ZBE 1;  2A6W A;  3DXU A;  5AFB A;  2JB4 A;  3VD9 A;  4I3G A;  1JYT A;  4R4X A;  3D5O A;  3GCX A;  4PBO A;  2W5F A;  1R1A 2;  2C0Z A;  1KRI A;  1SBE A;  2EIB A;  3ES1 A;  1AYM 3;  4KNC A;  5EPA A;  4CP9 A;  1LEC A;  4D6Q A;  3PHM A;  1AR9 1;  5L7O A;  2FD8 A;  2ZAC A;  3WEZ A;  1D2Q A;  2V4A A;  4JVA A;  4TLG A;  1UU6 A;  3HNY M;  4GJZ A;  3DYM A;  4XC9 A;  1UOJ A;  4MGQ A;  3N9N A;  3I2G A;  4JTO A;  2ZEZ A;  3SCG A;  4WM7 C;  1AUY A;  5EYY A;  1LOB A;  2EAL A;  5IVF A;  1UU4 A;  4AXO A;  1QJU 1;  4AFB A;  1K45 A;  1DU3 D;  1L7R A;  1ND2 B;  1V0A A;  2B7Y A;  3FBY A;  3KB5 A;  1TME 2;  3POG A;  1QJY 1;  1RYY A;  3PUQ A;  4R9D A;  5HBA A;  4P9J A;  2RS3 2;  3T2Q A;  2BOI A;  2VG9 A;  3ZSK A;  5J36 A;  1ST8 A;  1QXR A;  4XQD A;  5DZG A;  3WD5 A;  4QKF A;  3SNM A;  1W2N A;  3GM8 A;  1PZ8 A;  1PIV 3;  1CZS A;  3NW4 A;  1TVG A;  5I8Y A;  1JYI A;  4CU6 A;  2YBS A;  1UZW A;  2CV6 A;  1E5R A;  4NPL A;  1POQ A;  4HPK A;  3S7E A;  3ILN A;  4MH0 E;  1NOV A;  3SKJ E;  1V9U 3;  4MLO A;  3WG4 A;  1WD4 A;  2GZW A;  4AR2 A;  2R49 A;  4NO4 A;  4BPZ A;  1QKQ A;  5BY5 A;  3LEI A;  2JG9 C;  1ND2 A;  5JDB A;  2WZE A;  4YSF A;  3CZU A;  3ZOI A;  4NAM A;  2OVU A;  3ZMO A;  2C4X A;  1JYV A;  1QJF A;  2JEC A;  4ZZ8 A;  1HKD A;  3PTY A;  1BBT 3;  1WWY A;  2QBX A;  4QPY A;  4JDO A;  4KBZ A;  1I5P A;  4TTG A;  4LBM A;  1WD3 A;  5L9B A;  5DDJ 1;  4URA A;  3TEY A;  1WCU A;  5IK8 A;  3O7O A;  3IAQ A;  2PLV 2;  3POS A;  5A7P A;  4XFC A;  4DQA A;  1EUU A;  4QX0 A;  1WBF A;  4OVE A;  5ABJ C;  1D7P M;  2RS5 3;  1VMH A;  4AVC A;  5C3O A;  3R4D B;  1GZ9 A;  1LOG A;  2GMM A;  4AWD A;  1H2L A;  2W1S A;  1KJL A;  2WT2 A;  1OBN A;  1ODN A;  4HSJ A;  4B4Q A;  1MPX A;  4QX7 A;  2XHN A;  1OQE A;  1J3Q A;  4ISQ A;  1UN1 A;  1XNA A;  3CO2 A;  2WUH A;  4PLM A;  1TZO A;  2ZGP A;  4ATF A;  4C0B A;  3C7H A;  5ANN A;  2WQ4 A;  5FZD A;  4AYU A;  3R05 A;  3ACF A;  1MVE A;  1Z78 A;  2VE1 A;  4N43 A;  5JPN B;  5FZ6 A;  1GWK A;  2P3Y A;  2D97 A;  5A6Z A;  2XG3 A;  4Q0V A;  2O8O A;  5FYZ A;  2IVJ A;  2L9L A;  4PBP A;  2WFF 3;  3UKT A;  3VBS B;  2RDR A;  5KHK A;  3KLS A;  3S6P A;  1FPN 1;  2CWM A;  1YQ2 A;  1XU1 A;  4K9S A;  4M4P A;  4YVW A;  4XET A;  3BTY A;  1GOF A;  2XUM A;  2Q8C A;  5JAX A;  4Q4W 1;  3ZMN A;  1WCD J;  1BLZ A;  3I49 A;  5C5U A;  3W59 A;  4G4F A;  1O59 A;  2OPW A;  5JXH A;  4N7U A;  2WSV A;  1OPM A;  5K0U B;  1J1T A;  1UYX A;  1C5I A;  4JKM A;  3OBA A;  5FFO C;  4BIF A;  2R1D A;  4XF3 A;  1ULG A;  3FUQ A;  4XXP A;  1GR3 A;  3VZN A;  3VBS A;  2VZO A;  2QVS B;  1SAC A;  5FZB A;  2J22 A;  2ZXQ A;  3JQX A;  3USS A;  3CBN A;  3K4Z A;  3AJY A;  3C8X A;  4TSV A;  4Y5Z 0;  3VKN A;  4QKD A;  4P02 B;  2E33 A;  2TNF A;  5FOB B;  2QDR A;  2RM2 2;  1OLR A;  4W65 A;  3E6C C;  1VR3 A;  5F8P A;  5LK7 B;  5K8S A;  4LMF A;  2XQX A;  4P9L A;  3CMG A;  2BJS A;  1CAU B;  4AK3 A;  4XAC A;  5IVE A;  3VZM A;  4L9B A;  2DVG A;  4AVA A;  2C6S A;  3MIF A;  5FPL A;  5FO8 B;  1RUE 3;  4OHY A;  1XB9 A;  2BNN A;  1PO2 1;  1XNC A;  2ARX A;  4RA0 A;  1WMD A;  3RGB A;  2ZGT A;  3VD4 A;  3VKF C;  1J3R A;  1AR6 3;  2JB8 A;  1UWW A;  1UMH A;  3VKL A;  5F5Q A;  1H1A A;  4Q26 A;  4QWN A;  4Q4X 2;  1Y3T A;  3WF2 A;  3AZY A;  1PNG A;  2A7A A;  1CAU A;  4UOJ A;  4HBN A;  1CPM A;  3HR9 A;  3H8O A;  1S0F A;  1SHW B;  5T54 A;  1AR8 3;  2QE3 A;  4AGG A;  3RWK X;  5JIA A;  2X8K A;  3LSD A;  3PUS A;  1H1I A;  2FZ1 A;  4GD4 A;  5FZ1 A;  5K4L A;  1WCQ A;  2XLF A;  4YW7 A;  4CA9 A;  3LKJ A;  4EN7 B;  3PVE A;  4LO8 A;  1RIN A;  4XOG A;  5LB6 A;  3UV9 A;  2VCM A;  1GNY A;  5IWF A;  3III A;  4NOT A;  1HRV 3;  4XF9 A;  1JTZ X;  4NRM A;  2ENR A;  4UW6 A;  1WCK A;  2OZJ A;  2WNU C;  4TLF A;  2Y0O A;  2JG8 B;  1GIC A;  3MPB A;  3VDB A;  4MOA A;  4PIX A;  5ANQ A;  2J1V A;  5LEJ A;  1MS3 A;  2HYX A;  4QPI B;  2R7E B;  2X5I B;  4QPG C;  2EVX A;  5JCT A;  1PM7 A;  5B4N A;  1DQ0 A;  3EO6 A;  5GM0 A;  3T2T A;  3OJB A;  1LOA A;  1LOF C;  3IKW A;  2G9G A;  3TNP B;  3U4X A;  2NMO A;  1K5M B;  1LR5 A;  1I3H A;  5DZF A;  3A22 A;  5D8A B;  1BEV 1;  3DUI A;  3N9L A;  1S55 A;  4QX3 A;  3LSE A;  3U78 A;  3WDX A;  2BP6 A;  2OA2 A;  4YNI A;  3WDU A;  4KWK A;  4AQT A;  5EP9 A;  4LO6 B;  4BH9 A;  4BK4 A;  5A32 B;  1SLC A;  2JG8 A;  5A6X A;  4EZH A;  4Q27 A;  3WQB A;  2VAU A;  3MIH A;  4HFS A;  4QPI A;  2X5I A;  1C1F A;  3K77 A;  1O3S A;  2IXJ A;  4MAD A;  1COV 3;  2DFB A;  1SBF A;  1YFU A;  2VTX J;  4XF4 A;  4GAZ A;  3L9J T;  1DZQ A;  1ENR A;  4NWW A;  5A33 B;  1LOC A;  1K5M A;  2BUK A;  3O0V A;  1DQ2 A;  4QQO A;  2I45 A;  1V6O A;  3CQO A;  3H7J A;  4YG0 A;  5D8A A;  4ET7 A;  4M3C E;  4BLI A;  2XBO 3;  3A23 A;  3OPT A;  4QXK A;  4OCT A;  5FZE A;  5F5I A;  2RMU 1;  3VBR B;  5A32 A;  5H9S A;  1A78 A;  1J83 A;  1RUI 3;  4DOU A;  1RJ8 A;  1ZZ6 A;  1SDD B;  1NCR B;  1MVQ A;  4FSJ A;  4CDX B;  1AX1 A;  2OT7 A;  5JXJ A;  2AYH A;  4AI9 A;  5A33 A;  2JDY A;  1W0P A;  3CEW A;  4MHR A;  4FOW A;  1JOD A;  3NNG A;  2XVL A;  4J6G A;  4U36 A;  2E32 A;  2J1A A;  3WNK A;  1UZZ A;  3POW A;  3D6E A;  1C8M 1;  1PIV 2;  2ZJC A;  3JD7 3;  3MLJ A;  3VBR A;  3PVN A;  1H30 A;  3K3O A;  3JBG 3;  1US2 A;  1W8H A;  4GZ9 A;  1HN1 A;  1J59 A;  3NV2 A;  1GQG A;  1NCR A;  1YI9 A;  3AC0 A;  3OUH A;  4XXA A;  4D0Q A;  5J09 A;  2C9K A;  1AXK A;  4QQ2 A;  3RZL A;  1QDO A;  4R9C A;  3U11 A;  4CRQ A;  5F1R A;  3ZYF A;  2V73 A;  1W05 A;  1UF2 C;  4UW3 A;  4LKF A;  2JDN A;  3GNE A;  5A3O A;  2R6Q A;  3O5S A;  4R52 A;  3Q8F A;  4YM1 A;  1S2B A;  5F2W A;  1BBT 2;  2OII A;  4NHK A;  1UX7 A;  2JJ6 A;  2VNR A;  1CAV B;  4YGD A;  1O4Z A;  1S0E A;  3QAC A;  3RWN A;  3R0R A;  1ZZB A;  5SV8 A;  1FYU A;  1VJ2 A;  4CSW A;  1WW5 A;  3RMX A;  5TSW A;  3ZFG C;  4AED B;  2YDE A;  2NP0 A;  5K7P A;  2VUJ A;  3LEG A;  4N9H A;  4QT6 A;  4Q0Q A;  4W50 A;  2OKX A;  3JUU A;  5IAV A;  1OMI A;  2VXR A;  4EN8 B;  5BNP B;  1RHI 1;  5E8A A;  2WNV B;  4RL7 A;  3D82 A;  4AFA A;  4B1M A;  5FDB A;  3T0D A;  4AI0 A;  1AR9 3;  1DYP A;  3KCY A;  5JSP A;  4PJY A;  1CON A;  2D6K A;  4LBQ B;  4E2S A;  2G1M A;  1PO1 1;  1RUC 2;  4BDV B;  4XIK A;  4PIZ A;  5FMO L;  1ZRC A;  3MID A;  3MO4 A;  3POY A;  3B9I A;  5JI7 A;  4X8N A;  4AED A;  1QJU 3;  2EXJ A;  1CN1 A;  2W0X A;  1J58 A;  2QQI A;  4GQ7 A;  1GOG A;  1MS5 A;  2ATF A;  1W9S A;  4JQR A;  2WNV A;  4OMC A;  2A73 B;  1UY1 A;  3APB A;  3IDB B;  3OGG A;  1SPP B;  4EYU A;  4SBV A;  4XCB A;  3A0K A;  2DF7 A;  5CKM A;  1XOY A;  4LBQ A;  4GWN A;  2K9Z A;  4BIO A;  2WFF 2;  3BB6 A;  5L7O C;  1D2S A;  2HWB 3;  2Q1Z B;  1BMV 2;  2D6N A;  4NIA A;  1JOJ A;  4LKE A;  3WW1 A;  1WUV A;  1VBC 3;  4LPL A;  1CJD A;  3CJI C;  5DAP A;  1JU4 A;  1PVX A;  2NLR A;  2IVI B;  4KH9 A;  4BQX A;  1AYM 1;  5LBC A;  2UYB A;  2PAK A;  4IGP A;  4WZC A;  4WVW A;  1HB3 A;  3GXU A;  1Q3E A;  1SPP A;  3HT2 A;  3OBR A;  3OG2 A;  2JDU A;  1FT9 A;  3ZM8 A;  1UZV A;  3A7Q A;  1Q8Q A;  4A45 A;  5JSR A;  1YJK A;  3WP6 A;  1JHJ A;  4LE4 A;  1OA3 A;  3P1I A;  1CZV A;  5DG2 A;  5DAV A;  2VZU A;  4IET A;  3MIB A;  3PTR B;  3IB3 A;  1EUT A;  2Z69 A;  2DCY A;  4V2V A;  3RZJ A;  4P14 A;  4Z07 A;  2X53 S;  2DCT A;  4D6R A;  3VKO A;  3AVR A;  2I74 A;  3U1X A;  4LBK A;  3B3Q E;  5FCC A;  1MQT A;  4RN5 A;  4FFG A;  1ND2 C;  5EQU A;  1PX3 A;  3ZSM A;  4QB2 A;  2PHX A;  1HJF A;  1FV2 A;  1OKQ A;  3MLK A;  4MZU A;  1F31 A;  4E4H A;  1OOP A;  4N53 A;  4PLN A;  4CZS A;  4LBQ D;  5DMY A;  1SLI A;  4A41 A;  1MEC 1;  1V9U 1;  4M00 A;  2VOX A;  1RUE 2;  2ETE A;  3SHR A;  3PU3 A;  1JZ4 A;  4KGG A;  4QHO A;  2WZP P;  5FWE A;  2P2K A;  2QUO A;  1UYY A;  2VL4 A;  1OD5 A;  2RVA A;  4YW1 A;  3THT A;  5A6Y A;  5C71 A;  5FUI A;  1AJO A;  2ZX0 A;  4QGM A;  4ZU4 A;  4ZON A;  2ZKL A;  5CBL A;  1BBT 1;  1W9F A;  2CGN A;  2VPV A;  3AFG A;  4Y4R A;  5A7W B;  4AHW A;  5JXI A;  4OUM A;  1JOP A;  3Q9O A;  2OPK A;  1YLL A;  2WAB A;  4UW5 A;  1AR8 2;  3PUI A;  1FPN 3;  2Z4F A;  3NKT A;  4JGZ B;  1TMF 3;  1Q8V A;  2P37 A;  2B46 X;  3IT8 A;  1U5I A;  1SZB A;  4IGO A;  2Y38 A;  1NX9 A;  5C9A A;  1W8N A;  2G19 A;  2RS5 1;  4EZ4 A;  3SXW A;  3W5N A;  3M8L A;  1OUS A;  3WSO A;  1XE0 A;  3WVJ A;  4RGA A;  3TBD A;  2ZGK A;  1PGW 1;  5JZG B;  4DPN A;  1S1A A;  1UOF A;  3BTZ A;  2O14 A;  3NWK A;  3BIW E;  4Y1Z A;  5HPO A;  1NQJ A;  3OUI A;  1HRV 2;  4D3W A;  1X9P A;  2YYO A;  3MI8 A;  1IKQ A;  4GH4 B;  4BQW A;  2XPJ A;  3ILF A;  5F32 A;  2XH6 A;  4N43 C;  4B3N A;  4JV4 A;  3WXP A;  2BVB A;  4ES9 A;  2WO3 A;  3RSJ A;  2WAO A;  4JGZ A;  3B93 A;  3VZO A;  3ZXL A;  4QDS A;  2ZGL A;  5FP8 A;  4NHX A;  1XYO A;  1I6X A;  3AYA A;  4JDN A;  4YVW C;  1ZRI A;  1HRI 1;  3VBF B;  4YG3 A; 
#chains in the Genus database with same CATH homology
 3ACH A;  3VDC A;  3THD A;  2JKX A;  3C7O A;  2QQK A;  1KEX A;  1W0N A;  2QQO A;  4DXR A;  2Y6L A;  1PX4 A;  2WZ8 A;  2YB7 A;  2BGO A;  2LW8 A;  3FHQ A;  2J1E A;  2ZEY A;  4CVU A;  1JI6 A;  1K12 A;  3HNB M;  2W92 A;  3ECQ A;  2X10 A;  3LEK A;  4LKS A;  1K42 A;  2W1W A;  3SKV A;  2DCJ A;  5EJZ B;  2VCC A;  3I2K A;  4LQR A;  1JZ3 A;  3K4A A;  1W9W A;  2VME A;  1JZ5 A;  4XUQ A;  3NJV A;  5F7U A;  4ZY9 A;  1UY2 A;  1UY4 A;  3IAP A;  3VD9 A;  2W5F A;  5DN2 A;  3I2F A;  2EIB A;  3FHA A;  1UXX X;  2VMD A;  3W5M A;  2Y6K A;  4A3Z A;  3WEZ A;  3HNY M;  2WQ8 A;  3DYM A;  4MGQ A;  3I2G A;  2ZEZ A;  5DPN A;  2X09 A;  3OGV A;  4BK5 A;  1K45 A;  1L7R A;  4AG4 A;  4XUO A;  5JXG A;  1RYY A;  4QB6 A;  2EIE A;  3T2Q A;  2RJ2 A;  2VO5 A;  3I97 A;  3GM8 A;  3C7F A;  1CZS A;  1TVG A;  4CU6 A;  5G05 L;  2VQU A;  3OGR A;  4DXT A;  5I0D A;  3J7H A;  3SKJ E;  3THC A;  3MUY 1;  3LEI A;  5IYY A;  3E1F 1;  2WZE A;  3CZU A;  4KWU A;  4XVH A;  4DEV A;  2C4X A;  2ORX A;  3T2P A;  1W8O A;  1JZ2 A;  1JYV A;  4ZZ8 A;  4PT6 A;  2QBX A;  1I5P A;  2LS6 A;  3WF4 A;  4TTG A;  1CIY A;  3FN9 A;  3VD3 A;  4E8C A;  2BZD A;  3IAQ A;  1EUU A;  4QX0 A;  1D7P M;  1CZT A;  1O8P A;  2W1S A;  4CUC A;  2RV9 A;  4UAP A;  1MPX A;  1O8S A;  3HN3 A;  2XHN A;  1UXZ A;  1XNA A;  1GOH A;  1LNS A;  4QDR A;  2WUH A;  2Y64 A;  3C7H A;  4ZZ5 A;  2C26 A;  1JZ7 A;  2EIC A;  3ACF A;  1UY3 A;  1XNT A;  1H6Y A;  3OEA A;  2WYS A;  2YC2 A;  3PUH A;  2VZT A;  2L9L A;  3I3E A;  4JKK A;  1DP0 A;  3CKH A;  4A6O A;  2VZP A;  1YQ2 A;  4CUA A;  2YC4 A;  4M4P A;  1GOF A;  4ZXE A;  1O59 A;  5JXH A;  3ACG A;  1UYX A;  3DYP A;  4JKM A;  1ULP A;  3OBA A;  5DQ0 A;  4AAX A;  2VZV A;  2W3J A;  3K46 A;  1OD3 A;  2VZO A;  1DLC A;  4YPJ A;  2J22 A;  3ABZ A;  2ZXQ A;  4BXS V;  3K4Z A;  3C8X A;  3WNO A;  4W8J A;  4P02 B;  2E33 A;  3OGS A;  2XQX A;  3CMG A;  3I2I A;  1NUK A;  4A4A A;  2W46 A;  4XUP A;  5C7G A;  3HJR A;  2WBK A;  4GWJ A;  3VD4 A;  2W87 A;  3CZJ A;  4GWI A;  1UWW A;  4QX2 A;  1UMH A;  2XON A;  3CIH A;  4A42 A;  3OEB A;  2YG0 A;  3WF2 A;  3NRU A;  4UOJ A;  5IHR A;  3WF0 A;  1SHW B;  4QDQ A;  2ID4 A;  3DYO A;  1JZ8 A;  3MV0 1;  3GGL A;  1WCQ A;  3IDA A;  2QQL A;  1JYX A;  1JYN A;  5LA0 A;  1GNY A;  3D3A A;  3III A;  5A1A A;  1T2X A;  2Y6H A;  4JKL A;  1UYZ A;  2V72 A;  2KD7 A;  2VZS A;  1CX1 A;  1JZ6 A;  4OZO A;  4XUT A;  3VDB A;  4MOA A;  3FL7 A;  2J1V A;  3T0A A;  2HYX A;  2R7E B;  4CU9 A;  3WNP A;  4DUX A;  5B4N A;  2JE8 A;  2W9X A;  4P5Y A;  2DCK A;  2VC9 A;  3OB8 A;  3VD5 A;  3A22 A;  2BGP A;  4QX3 A;  3LQC A;  4BK4 A;  3MV1 1;  4P00 B;  4PQQ A;  3VD7 A;  4XUR A;  3WQB A;  2ZEW A;  4A44 A;  2VMF A;  3ETP A;  1UY0 A;  2XOM A;  3I2J A;  3K77 A;  2YFZ A;  4MO3 M;  4TXW A;  2BER A;  4MAD A;  2E26 A;  3ACI A;  1JU3 A;  4OYU A;  1F4H A;  1BHG A;  4DUV A;  3CQO A;  4QB1 A;  4ET7 A;  1W99 A;  3A23 A;  3U37 A;  1J83 A;  1SDD B;  2QQN A;  4MGS A;  2VTF A;  5IJR A;  1JYW A;  1ULO A;  5JXJ A;  3NJX A;  1WKY A;  2E31 A;  5LA1 A;  5IFT A;  3WF1 A;  3T09 A;  3NNG A;  3DEC A;  3UES A;  2E32 A;  2J1A A;  3WNK A;  3LPF A;  4OUE A;  2CDP A;  4FI9 A;  1US2 A;  4GZ9 A;  1HN1 A;  1OH4 A;  3AC0 A;  4D0Q A;  2C9K A;  2W95 A;  4BJ0 A;  4P08 A;  3HOB A;  4CU7 A;  5LCW L;  3UET A;  3BGA A;  5LA2 A;  4DXS A;  2VZQ A;  4Z2A A;  4QPW A;  4XUN A;  1UMI A;  1UX7 A;  4CUB A;  1DYO A;  2W1Q A;  1OF3 A;  1H6X A;  3I2H A;  5CZK A;  1GU3 A;  4PF1 A;  2PQS A;  3BN6 A;  3LEG A;  4W50 A;  2OKX A;  1PMH X;  1SG3 A;  2B4K A;  2X05 A;  5EIY B;  3F2Z A;  3VDA A;  2B9V A;  3T0D A;  2J1S A;  2BBA A;  3GDB A;  3LPG A;  3T0B A;  4BDV B;  1K3I A;  4HG6 B;  3MO4 A;  2WO2 A;  3K75 B;  2VR4 A;  5G04 L;  3I3D A;  4KI5 M;  5J1X A;  1UZ0 A;  2EID A;  2QQI A;  4CU8 A;  1F4A A;  1GOG A;  1NAE A;  1GQP A;  1W9S A;  2WAA A;  4JHZ A;  4M4R A;  4OMC A;  1UY1 A;  2DDU A;  1OF4 A;  2VCB A;  3WNL A;  3I3B A;  5CYY A;  2W91 A;  3C7E A;  2V5D A;  3EYP A;  1IQD C;  2CDO A;  4QAW A;  2JDA A;  1NKG A;  3MBW A;  4LPL A;  2VZ1 A;  1JU4 A;  3HPN A;  2WN2 A;  2QQM A;  2VQT A;  2VOT A;  1OT5 A;  3GXU A;  1KGY A;  3OG2 A;  5HXM A;  3ZM8 A;  3A7Q A;  4KMQ A;  4A45 A;  2J1U A;  3UNP A;  1R64 A;  1TG7 A;  1JHJ A;  3HNM A;  4DEQ A;  3P1I A;  2VZ3 A;  4RYD A;  1CZV A;  2VZU A;  2WO1 A;  3T08 A;  4ARY A;  3IB3 A;  1EUT A;  3EB7 A;  2HLE A;  2V4V A;  2VZR A;  4QX1 A;  4RN5 A;  3JXS A;  1PX3 A;  1XPW A;  3P6B A;  1W9T A;  4QB2 A;  3T2O A;  4OMD A;  2JD9 A;  2Y8K A;  1L7Q A;  5DMY A;  2QQJ A;  2W47 A;  4A41 A;  3A21 A;  2ORZ A;  1JZ4 A;  3SEP A;  1J84 A;  3HEI A;  5JMO A;  2VL4 A;  1UYY A;  2YFU A;  2ZEX A;  3SEE A;  2RVA A;  4LHS A;  4JX0 A;  5C71 A;  5FUI A;  3NQH A;  2WN3 A;  1GUI A;  4E8D A;  4XZU G;  2J1R A;  5JXI A;  3LE0 A;  3WNM A;  5EJ1 B;  2WAB A;  2VMC A;  3PUI A;  4UI9 L;  3WNN A;  2Z4F A;  4IUG A;  2VM9 A;  2VJX A;  2WDB A;  1NX9 A;  1W8N A;  3W5N A;  3WF3 A;  5C70 A;  5B4X A;  3WSO A;  4L0P A;  1GMM A;  1P8J A;  5IFP A;  2J7M A;  5JR2 A;  2VCA A;  4W4Z A;  5HPO A;  2J1T A;  5JUV A;  2W1U A;  3CDZ B;  1XC6 A;  4D8M A;  1US3 A;  4DUW A;  3K4D A;  2Y6G A;  2WO3 A;  2WAO A;  1PMJ X;  4QDS A;  3C7G A;  2Y6J A;  4ARX A;  3MUZ 1;  2W94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...