4QB1A

Structure of cbm35 from paenibacillus barcinonensis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
b'GTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
total genus 29
structure length 128
sequence length 128
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb1A00
3SKVA 2CDPA 2VR4A 4DEVA 3PUIA 2JE8A 2BGOA 1O8PA 3GXUA 4CUCA 2ZEZA 1UYZA 3CZUA 3C7OA 3GM8A 4MO3M 3K77A 5JR2A 2E31A 3NQHA 1PMJX 4JKMA 2VCAA 3THCA 2JDAA 3IIIA 1GOHA 1R64A 3CKHA 2EICA 3HN3A 3GDBA 4PF1A 1H6XA 1P8JA 3JXSA 1DLCA 2WO3A 3WSOA 2XQXA 1UMHA 4BDVB 4P02B 4TTGA 3WEZA 3A21A 2W92A 2L9LA 2VJXA 4BJ0A 2J1AA 2J1RA 1JZ4A 2ZEYA 3I2JA 3VD3A 3DYPA 3WNLA 1TG7A 4UAPA 3WNOA 3C7GA 1K42A 1GMMA 4MADA 3K46A 4QDSA 1JU4A 1PX4A 4BK4A 2WAOA 1JYWA 4W8JA 2HLEA 1L7QA 2B4KA 1UY1A 4JKLA 5IYYA 3K4ZA 2VMFA 2JKXA 3A7QA 3E1F1 2VQTA 1JZ2A 2LW8A 2CDOA 3J7HA 2Y6JA 4OUEA 5HXMA 3ACHA 3HEIA 2VZRA 4MGQA 3I3BA 4A42A 5EJ1B 3VDAA 4GWJA 5LCWL 3MV11 1W9WA 2EIEA 3P1IA 4D8MA 4PQQA 2W1UA 1KEXA 2Y6KA 1GQPA 1PX3A 4QDRA 4KWUA 3MBWA 4IUGA 4XVHA 2W95A 1W8OA 4QX1A 3DYMA 3MO4A 1UWWA 4CU8A 1OD3A 1J83A 3WF2A 3I3EA 3ZM8A 1JI6A 1JU3A 3P6BA 4UI9L 4HG6B 2VC9A 2W1QA 1ULOA 5IFPA 3OB8A 1KGYA 2VZSA 2XHNA 2W1WA 1W9SA 3OGSA 2VL4A 1JYXA 3OEAA 1HN1A 4QDQA 3T2OA 5IFTA 4DEQA 2BBAA 3T08A 5G05L 2W9XA 2ZXQA 1EUUA 3DECA 3LEIA 3T0AA 2Y8KA 2VMEA 2ID4A 4BK5A 3C7HA 2WDBA 5DN2A 4A41A 2VTFA 5LA1A 3UESA 2QQLA 2RVAA 1OT5A 1GNYA 2ZEWA 3VD7A 2X05A 1CZTA 5B4XA 4ZY9A 1UY4A 2W1SA 3HNMA 3OBAA 3WF1A 3THDA 4DXRA 4ARYA 1RYYA 1K3IA 2BERA 3WNPA 1UXXX 2YFZA 3CDZB 2VM9A 1W9TA 3K4AA 1K12A 2VQUA 1W0NA 1L7RA 2OKXA 3HPNA 3WF3A 3T2PA 1F4AA 3FHAA 1UMIA 5B4NA 2J7MA 5C7GA 4QPWA 4OYUA 1XPWA 5F7UA 1SG3A 2DCJA 2EIBA 2PQSA 2E32A 5LA2A 2QQNA 2VOTA 3OEBA 2J1UA 3I2HA 4TXWA 3D3AA 3MUZ1 5IJRA 5EIYB 2VO5A 3LPFA 4YPJA 4Z2AA 2WBKA 4XUTA 2Y6LA 4ET7A 2XOMA 3MV01 4ZXEA 5DPNA 3HOBA 1DP0A 2R7EB 1CIYA 3F2ZA 4E8DA 2WAAA 2C26A 1OH4A 4E8CA 1J84A 3FN9A 1T2XA 4OMCA 2ZEXA 1US3A 4A45A 4XUQA 1W8NA 4GWIA 5C70A 4P08A 3ETPA 4M4RA 1PMHX 3I2GA 3UNPA 3T0BA 4DUXA 2WN2A 4QB6A 3VD4A 4LQRA 3I3DA 2W87A 1SDDB 2QBXA 2WN3A 1UY2A 3GGLA 3W5MA 2J22A 2J1VA 2VCBA 2RJ2A 4ARXA 3T2QA 3U37A 3K4DA 5EJZB 2VZTA 4QB2A 3WNNA 2WYSA 4LKSA 2ORXA 5A1AA 1WKYA 3T09A 4CU6A 1CZVA 2W5FA 3UETA 4KI5M 2YC4A 1OF4A 4P00B 2BZDA 4QX0A 3NRUA 2W47A 1GOGA 2Y6GA 2J1SA 1DYOA 3BGAA 3LE0A 3WQBA 2HYXA 1ULPA 1NUKA 3ACGA 2J1TA 2X09A 4CVUA 4XZUG 1EUTA 3HNBM 3C8XA 3MUY1 2LS6A 4OMDA 4ZZ8A 1UZ0A 3OGVA 1SHWB 1JZ8A 3NNGA 3SEPA 1UY0A 2WO1A 3FHQA 2E26A 4DXTA 5JMOA 3IAPA 4DUWA 4JKKA 4XUNA 3CZJA 1H6YA 2W3JA 4UOJA 3VD5A 5CYYA 4JX0A 4PT6A 4QB1A 3I2KA 3C7EA 3HJRA 3LEGA 5CZKA 3NJVA 1F4HA 4MGSA 2VCCA 4JHZA 2WABA 1BHGA 3LQCA 1JZ7A 4P5YA 4LHSA 3VDCA 1JZ6A 3OG2A 2E33A 4CUAA 1O59A 2VZOA 5DQ0A 3I2FA 3VD9A 4QX2A 5I0DA 4RYDA 3EB7A 5HPOA 2ORZA 1XC6A 5DMYA 4L0PA 4XUOA 2WZ8A 1YQ2A 2J1EA 4XUPA 3ECQA 2VZ3A 2EIDA 2VZPA 3PUHA 4CU9A 3I2IA 1O8SA 2W46A 4D0QA 1XNTA 2JD9A 3W5NA 1UYYA 2V72A 3T0DA 2W94A 1JYNA 5JXHA 1GUIA 5JXGA 2C4XA 2YFUA 2QQMA 3LPGA 2XONA 4MOAA 2VZ1A 3SEEA 3CIHA 5JXIA 2VZVA 1US2A 3IAQA 2BGPA 3A22A 3K75B 1JHJA 3NJXA 1OF3A 2QQOA 1IQDC 4M4PA 4A44A 3VDBA 2WUHA 1JZ3A 1LNSA 4RN5A 3WF4A 5JXJA 1UXZA 3HNYM 2DDUA 3LEKA 4AAXA 2V5DA 2WQ8A 1UYXA 1GOFA 3BN6A 4W50A 4DUVA 4DXSA 1TVGA 3AC0A 3IB3A 5J1XA 3C7FA 4CUBA 4ZZ5A 2WO2A 3ABZA 3ACIA 1MPXA 1NKGA 2YB7A 3DYOA 1K45A 2YG0A 3I97A 4LPLA 2WZEA 3WNMA 4XURA 1W99A 4OZOA 3ACFA 2VMCA 4A4AA 4AG4A 4QX3A 3A23A 4GZ9A 1GU3A 1NAEA 4FI9A 2Z4FA 5LA0A 4QAWA 5G04L 3WF0A 5IHRA 5JUVA 4KMQA 1CX1A 1JZ5A 2VMDA 1I5PA 1XNAA 3WNKA 5C71A 3IDAA 4A6OA 4BXSV 2VZUA 2DCKA 2QQKA 4W4ZA 2X10A 1UY3A 1CZSA 5FUIA 2KD7A 2QQJA 2C9KA 2YC2A 3SKJE 3OGRA 1D7PM 1WCQA 2B9VA 2Y64A 3EYPA 1NX9A 4A3ZA 2V4VA 3CQOA 2VZQA 2W91A 1JYVA 3FL7A 2Y6HA 4CU7A 3CMGA 1UX7A 2RV9A 2QQIA
chains in the Genus database with same CATH superfamily
1HB4A 2CDPA 1FPN2 3OBRA 3PUIA 5B2GB 5I8SA 1FYUA 1DGWX 3DGTA 3WDTA 1O3QA 2ZEZA 1UYZA 5FXXA 3U75A 3V0BB 2MPFA 1W0OA 5E89A 5A7SA 1ND3A 5IVCA 3OUJA 1OD5A 3W58A 4I01A 2FDIA 3DPRA 1W8TA 3WZ1A 1VBB2 3X29B 3FUOA 3V64A 4LBOA 3GCXA 5D2AA 2BNNA 2JDAA 1DF0A 3ZN4A 1VBA2 2ZZQA 3V65A 1GOHA 3POJA 2FBEA 2JX9A 3HN3A 1H2LA 3GDBA 4YZ3A 5LK5A 1LGNA 1BXHA 2ATFA 3N7KA 2PHFA 4TSVA 5I93A 3NV1A 2EVXA 5FMOS 3TEZA 2PAEA 5FXWA 2A73B 4CCCA 2WLPA 1WCKA 3ZFEA 5LZ6A 5IVEA 2IFRA 1NXMA 2GC1A 1GZTA 4XFCA 4AXOA 4BDVB 2RS51 5FYYA 1RGSA 3GZTB 1RUE3 3N9LA 3WEZA 2VJXA 1SLBA 4IE5A 5FZDA 5A3PA 1GZ9A 3ZXKA 1VIWB 4CCNA 1ZZCA 2B7YA 3ITQA 5FP7A 5HV0A 1DZRA 1VRH1 2GMPA 2WYFA 4YW4A 3Q8EA 3LDBA 3FBYA 1AHSA 1PM7A 1J3QA 1OOPA 1LCLA 2XG3A 3U78A 2UY8A 1HRI3 1V6OA 4NWVA 2QDRA 1BK0A 2WNEA 4R9AA 5FY7A 2ZGLA 3WNOA 4XHXA 1K42A 3WHTA 4L99A 2B45X 2EALA 2GMEA 3LD8A 4MX3A 4UW6A 1QQP2 4PIXA 4XAAA 5DDJ2 3M7AA 1JU4A 1O5LA 2DFBA 4CDXB 2JDUA 3FBMA 2GP3A 4Q4V1 2HLEA 4WM8C 3RWNA 4HFSA 5L36A 1JOBA 5FO8B 2GH8A 2XJTA 2FMYA 2VMFA 3DEMA 4NIIA 3ZXDA 1F2NA 3PIGA 5ANQA 5FZIA 3E1F1 2QNKA 1ZRFA 3PIJA 4JAAA 4BQ4A 3KQ4B 1WCSA 2A6XA 4HZFA 4IV1A 4ATEA 4C0HA 5C8WA 3I2DA 4DRRA 3IDCB 5AC93 4NUBA 1CWPA 2WQ4A 1ND2C 1Y4WA 2Y6JA 2AC1A 2D5FA 1V0AA 1WD4A 2AH2A 5DUXA 1XNCA 1OVPA 1PVC1 4A42A 1UPIA 4GWJA 5LCWL 2A3XA 4GD4A 5FLJA 1AR63 3H1YA 4Q8KA 2VNGA 3IPVA 1NY72 5T55A 4Q4Y3 1C8NA 1UZWA 2JDNA 1EV12 4PLMA 2Y6KA 4N9IA 4UF0B 3BVCA 1PX3A 3QLQA 4QDRA 1JH5A 3MBWA 3R05A 4IUGA 1FNZA 3NNLA 4F7ZA 3VD7A 5CA6A 1H8TB 1QOOA 2DV9A 2LUWA 3MO4A 3VBUC 1ODNA 5FYHA 5D8AA 3NNMA 1RUF2 4JDMA 1VR3A 2R6QA 1H1MA 1QJX3 2VQ0A 1XB9A 3ZM8A 4XBLA 1JI6A 4FQ4A 3AVRA 1XE7A 1AR91 2P17A 4B4QA 1ZM1A 1QJY1 2BYVE 4B29A 1PO11 1ULEA 1LOEA 3U0ZA 2JE7A 2XHNA 2WNVA 2XBO1 1OA3A 4XTPA 4D7SA 3N7JA 2XH6A 1JYXA 5L9VA 2PLV2 1YIFA 5LB6A 3ZYFA 3ILFA 4DFSA 3VKFC 2TUNA 5HCBA 5KBFA 4KG0A 4S2FA 2BBAA 2CAVA 1GP4A 5H9RA 3T08A 1H4HA 2DCZA 3POBA 3O0XA 4AYUA 3B93A 4K20A 3T0AA 1DGWA 2MEV1 1COV1 2Y8KA 2CL2A 4BK5A 1QJU3 2ID4A 3M3EA 3AZXA 3O1PA 2VTFA 4NAMA 4XIKA 1U5XA 4KGQA 1AR72 2VW2A 2WWUA 1ZRRA 1JYCA 3MW4A 2K0GA 2NMNA 3NL1A 2QTWB 1GNYA 2VUJA 2LROA 2QKDA 4RR3A 1VBC1 2QQUA 4BA6A 3ZSJA 4XYXA 4YYOA 1S2BA 3SHRA 1HQLA 1UY4A 4IEXA 4FAGA 1RUJ1 3HNMA 4NN0A 3WF1A 4JGYA 1NCQB 3JQWA 5H9PA 3ZYIB 2DVGA 3ZIWA 5HCHA 5FY1A 4EE2A 5GZGA 1XNDA 4GULA 2WZR2 3WNPA 1UXXX 3QH6A 2HWB2 4CDQA 1IS5A 4MV2A 3E6BA 5C6CA 3CDZB 2VM9A 3AB0A 2NLRA 2CGPA 4R9BA 3IIAA 5T50A 3VHNA 4LOSA 1IS6A 1STMA 2D6MA 2GC2A 2GH2A 4BZ4A 3HQRA 2PHUA 3E5UA 3DCQA 2OKXA 3O0VA 3ZFFC 4Y3OA 2FHRA 1ZVFA 5C3QA 5CFCB 2OS2A 5B4NA 3RMXA 4UFMA 2WNUB 3POEA 3O1SA 3NNFA 4LBLA 1YYNA 1H9PA 3GYDA 1QXRA 4GWMA 4QXBA 1VBE3 5IVJA 2ADDA 1JOJA 4INDA 4OYUA 4WM8B 1WGPA 4CPBA 2BUKA 4P9YA 5F9TA 4E4ZA 1VRH2 2BVBA 3R4DB 2E32A 1AYM2 1QEXA 1WMFA 2ET7A 4NHKA 4K6BA 3RNSA 1TMF3 3NAPC 3I2HA 1Q3EA 4DXZA 1DCSA 2X5IC 1RUOA 3N9MA 1TNRA 1ASJ3 4XDPA 4RS5B 4XJZA 4FFFA 4IL7A 1A34A 1JN2P 3ENRA 5EXOA 1AJOA 5EIYB 1F5FA 1OKQA 2VO5A 3KLSA 5F2SA 1KDMA 1QGLA 5FQ0B 3RDIA 5ABJB 2WSUA 3TYJA 2G1MA 5I8YA 3A4UA 2VMIA 3KQRA 3WNXA 2E7AA 3AYCA 4QKNA 5BNNB 4LR4A 2ZTNA 4Q4V2 2GNMA 3HOBA 1LHOA 4LO6B 4S2GA 1QJEA 4AVTA 4E8DA 4QKFA 4M01A 2PAKA 1VMJA 1OH4A 5CNAA 2XQRA 4P9IA 3VZMA 3FN9A 1MS9A 5FY4A 4EROA 1W39A 4GJYA 4Z1VA 3ZPOA 1NZCA 5F3CA 1UOJA 4Y20A 3PUAA 4BQ3A 2GU9A 2JDMA 3JD71 1VMFA 4CDXA 2JDKA 2QQPA 4QPYA 2ZBJA 5IAXA 3OUHA 4GWIA 1RUG1 4B7KA 1ACCA 4BMBA 3RZHA 1PZ8A 2WKKA 4M4RA 4Q1PA 2A70A 3JUUA 4RGGA 1KD7A 3FFQA 2PHTA 5FJKA 3VD4A 1PVC2 4X8NA 1GFF2 5C3SA 4LQRA 4HOOA 3KHCA 1VPHA 5A3NA 2W87A 4WVZA 3FX3A 3GGLA 4M3CE 4FPKA 3W5MA 2Q8OA 3FUQA 3GF6A 1CN1A 1M06G 5DAXA 2RJ2A 2NMOA 5J98B 2FCUA 5GALA 4ARXA 2FDHA 3K4DA 2WA3A 1E5SA 5EJZB 3N3HA 3WNNA 1HXS2 5LRRA 3EJKA 4XCAA 3U4SA 2Q8DA 2ORXA 5I0RA 2JIGA 5C33A 2ZZJA 3T09A 3ZFGC 4IETA 1YFYA 1O5UA 1ULCA 3D82A 2VD7A 3N35A 1PO23 4HETA 3HAGA 3UETA 1SBEA 2H6BA 4UF0A 1OSGA 2DVBA 2D6KA 4BHPA 4Y22B 3RZLA 3W20A 1VB4A 1VBD3 3K3OA 1PO12 2UU8A 3WW2A 1MS8A 1H8TA 5FZOA 4MGIE 3OPWA 2Z69A 2C0ZA 3ZOIA 3LKJA 4YW1A 4MGTA 1MEC2 2J1TA 3POIA 4CVUA 2XKOA 1YEWA 3C8XA 5A1LA 1QJFA 4N7IA 3W21A 4OI4A 1L3JA 1RUE1 1WW6A 5FZLA 3U11A 4OMDA 4ZZ8A 2DTYA 1B35B 5FJHA 1V00A 5IVVA 5C3OA 1WW7A 5T5PA 2UURA 3OGVA 5F32A 2MEV2 1COV2 3NNGA 4RHV3 1I5ZA 2TNFA 3K51A 3O12A 1WW4A 2HEYF 3ZDVA 3WVJA 2XWBB 1HRI1 1RUI3 3ASIA 3I3MA 4XJUA 4IGOA 2CNAA 5LY1A 4DY3A 3WDUA 5L19A 3MGUA 2YMZA 3CZJA 4AHZA 3DV8A 4H3WA 3MF6A 1VBC2 3WCSA 3ZFFB 4PT6A 2QZ3A 1UIJA 1ZRIA 4AQ6A 3ROUA 3MLKA 1CAXB 2PHXA 3I2KA 1HB2A 3C7EA 3HJRA 1S2EA 5GKAC 3UGFA 1ND3C 1BJQA 2RHPA 2Q8EA 4MGSA 4M00A 4XFBA 3DPRC 1AXYA 1LENA 2VUCA 4QX7A 5GLTA 3LB9A 1BHGA 2VTXJ 1ST8A 1O7FA 1F31A 1HRV3 4XCBA 1MS5A 1W3VA 5CADA 1IG3A 3S6PA 3NSTA 5AC91 5CB7A 1NCQA 5FMBA 4OHYA 1O59A 3NAPB 3MW2A 1CAWB 5DQ0A 3VV1A 4IERA 3VD9A 5I0DA 4FFHA 2EXHA 1J3PA 4X6QB 1LRHA 2GC3A 2ORZA 3ZFEC 1GWMA 3OOXA 4BQ2A 4XUOA 1MZFA 4OVEA 3E5XA 3U4XA 2GAUA 4XUPA 1RJ7A 2VZ3A 2EIDA 3SH4A 3OD4A 2VZPA 1AR61 3RYKA 4CU9A 4XF0A 3I2IA 1S55A 2P37A 2WT1A 4OI2A 2W46A 4Q4Y1 4S2HA 4CP9B 5FZ4A 5J3UA 1FATA 2Z42A 2JD9A 3RMYA 3W5NA 3LFIA 5CFCA 1XOYA 3J7MA 1OOPC 1NQJA 1WLDA 2WNUA 4QM9A 2OQ7A 1JYNA 1ZZ7A 1EY2A 5T5JA 1QU0A 2C6SA 2I2SA 2WO7A 2QQMA 1BBT2 3JCIA 2XONA 4MOAA 2JB4A 2VZ1A 1QJX1 4M0NA 3CIHA 2W0XA 3VBHB 5I0SA 5JXIA 1O4ZA 3PTRB 3IAQA 4ITCA 5F5IA 3A22A 5FZ9A 4RD7A 5FP4A 1G9AA 4KWKA 1UOGA 2XJPA 1IS4A 1JHJA 3VDBA 2XXZA 4A44A 2P34A 1ENQA 4RS5A 3WUDA 3DUIA 4COUA 1YHFA 4QPGB 1UXZA 4ZONA 1LHVA 4ATFA 3TN93 2RR13 1DQ2A 2V5YA 2ZX1A 3AYAA 1GSLA 3HNYM 3OPTA 3HR9A 5FQ0A 5ABJA 5LA9A 4MGZE 2WC2A 3LSDA 4IV1C 4WVWA 4JV4A 5BNNA 3TEXA 2JIJA 1OVSA 3JD72 4CCOA 4DNYA 2P6CA 4MYEA 5ANNA 5FYZA 4BISA 5BNPB 3RQ0A 3FHIB 3L9JT 4K3UA 1QDOA 2ZHLA 4Y24A 5K0UA 3VZLA 5IVFA 1I6XA 1QJU1 1I3HA 2XDVA 5DG1A 2VPVA 5FZ7A 4E2QA 3C7FA 4XQWA 4CUBA 1FXZA 3KF5A 2VMHA 5FKBA 5FKCA 5EP9A 1ZA7A 4PJYA 3Q8CA 2NQYA 3ACIA 2YB7A 3KV4A 3O14A 1XSRA 3R0RA 1DG6A 1AXKA 4AEDA 2WT0A 2WINB 1PGW2 2VOVA 2YU1A 4WZCA 3M3QA 1NOVA 4QWNA 4AVBA 1LEMA 1LAJA 3AL5A 1YFUA 2OZJA 1QNWA 3MIFA 4QX3A 4ZU4A 4AG4A 2VCMA 5KXBA 2VXRA 5D8AC 3LAGA 4ASMB 5JSOA 4KMQA 3KT4A 5BUVA 2XL7A 3DXUA 4A6OA 4XC9A 2VZUA 2ILMA 4Q2FA 2WNVC 4FFGA 1W6NB 5A3OA 1U12A 2QQKA 4W4ZA 4Y5SA 4Z8BA 2ARXA 3DKWA 1C8M3 5FZFA 4BIOA 2YC2A 3HBKA 3NV2A 2R32A 3LA7A 1W8FA 4HK8A 4Y22A 2D6OX 2Y64A 3EYPA 4JTNA 4X6RB 1RUE2 4WVVA 3CQOA 5JZGB 1VBE1 2IFWA 2EXJA 1AR83 2MNGA 3IT8A 3IKWA 4Y1VA 3SLIA 1U0AA 5EYXA 1JHNA 3B02A 5HCAA 3WG1A 1W2NA 1YNAA 3DPRB 1R1A3 2D43A 1REEA 2XKPA 4N43A 3RZKA 2BV4A 5FYTA 3UL2A 1TMF1 1YFXA 1GICA 3RJRA 3THPA 3VBRB 1W6PA 1B35A 1ASJ1 4QMAA 3S7EA 2RG4A 5EPAA 4E4SA 3AKSA 4EJRA 4LBQD 1ULFA 1BKZA 4RR3C 3JU9A 1WA6X 4YM0A 2DYCA 1QH6A 3CZUA 5FXZA 3I2OA 4JTOA 1MQTB 2ZAAA 4MO3M 4MXVA 3SITA 2C5DA 4NIHA 3FE5A 1DZTA 3H9AA 1NCRC 3M1HA 5FYUA 4COVA 5I8TA 2ADEA 1MVEA 4IGPA 4JGYC 2YDEA 1QHDA 1Z7S3 5CG9A 4EYUA 3AP7A 4LUMA 4J1WA 3B01A 3SMHA 4V1PA 3W9AA 4CDQC 3IIIA 5ACA2 3GBFA 3AYEA 4BXFA 3BKZA 3MFCA 4XJWA 4XXPA 2EICA 2PFWA 3WQ7A 1CAXA 1TME3 5F3EA 3NO8A 3WHUA 2DVAA 4DMIA 4TN7A 1H6XA 3JXSA 5C8CA 2XMLA 4O7XA 4XDOA 2AZ5A 2JICA 3POWA 2GP5A 4XFGA 1SLAA 1JODA 3PUSA 5FYCA 1LGBA 2VUDA 4ZKTB 3WD5A 2WS93 4P02B 4TTGA 2YPJA 3A21A 2L9LA 3S7IA 2R0HA 5CU1A 2RJKA 4EWDA 2JG9B 1H9WA 4V2WA 3O0WA 2ZHMA 3DF0A 1AR62 2ZA9A 1CAWA 3NKTA 2ZEYA 3MZHA 2JDPA 2PN5A 4FOWA 2X8KA 3DYPA 2O14A 1G9DA 1L7LA 2RE9A 4B1LA 5DAPA 4EQVA 3J8F3 3UJQA 1QXJA 1HV0A 3HQXA 5EWSA 2O0OA 4UT5A 4FOYA 1PO21 3TRSB 2BJSA 2VNOA 4I0BA 4UXAA 1Q8QA 1DYPA 3RSJA 3ZR5A 3K46A 4QDSA 1PX4A 2BW8A 4WV8A 3RZJA 1JYWA 3VUOA 1A6CA 5FUNA 1W05A 1VBD1 2WFF3 4JKLA 1AVBA 4MXWB 5FDBA 4QGLA 1POV3 1VLNA 1S1AA 3IPVB 1IHMA 4Y1UA 4YZ5A 4Q4X3 4K8RB 1SFPA 4CDXC 1IPSA 2LW8A 1OQDA 2DVDA 4P5HA 5DAWA 3MPBA 4OHWA 4AF9A 4QPGA 5HXMA 2P3IA 1BYHA 1EPWA 3ACHA 3HEIA 2VZRA 4GMP0 4MGQA 1GLHA 1QJU2 1FX5A 4PI0A 4RHV1 5D8AB 5EJ1B 4AGVA 4DPNA 1QOSA 1D0HA 1TE1B 2JECA 4DB5A 5E1RA 1RUI1 3WX5A 1LOAA 3MV11 2X53S 2D97A 2BWAA 1N1SA 4I02A 3WUCA 4PLNA 4D94A 5FPAA 1N3QA 2W1UA 4J1XA 1XSQA 1KEXA 2OUHA 4K1YA 4NAOA 5FZHA 5BNPA 3AMQA 1Y9QA 1ZX5A 3ZIXA 2QVSB 2VW1A 2VTXA 2E7QA 2VECA 3VL9A 1O6UA 2ENRA 2HWF3 3GJBA 5F3GA 1W8OA 2VMGA 3HMYA 1F9KA 4YVSB 1UWWA 5CBLA 2K46A 5A80A 3R6SA 3HD8B 1HDKA 2JXAA 2NZ9A 3JBG3 2R0FA 4HG6B 4UI9L 2VC9A 2W1QA 4O9EA 1HRV1 1ULOA 1BCXA 5EFUA 4NVPA 3PL0A 3U14A 4QT6A 4LXLA 1W9SA 1H8TC 2H0BA 4XMAA 1QKQA 3OGSA 4XMIA 3UKTA 3N4MA 3KS7A 1E5RA 5A7OA 1O3SA 1HKDA 1QIQA 2Y0IA 5BXXA 3VZJA 4B1MA 4XF9A 3CJXA 1U5IA 3VLBB 5G05L 3ZDSA 1GWKA 1D2QA 1FNYA 1OUSA 1VBE2 3CL1A 3LEIA 1W6NA 4Y4RA 3KCYA 1ENSA 2RMU3 4PBPA 3AX4A 3W59A 4XF4A 4BM8A 2RDSA 2JEMA 4JGYB 2AEYA 3TAYA 2UWBA 1WBLA 2WDBA 3C7HA 5DN2A 3USUB 5FYVA 3WXPA 1MACA 2OA2A 4CDQB 1AL0G 5LA1A 5A7PA 5JZGA 3PURA 1RUH3 1O4YA 1TMF2 1UW8A 1LTEA 1VALA 2CTVA 2QQLA 2RVAA 2YYOA 1PMIA 3H42B 4JRLA 3VBOB 4N53A 5F1RA 4FPYA 1C57A 1GZCA 3P3NA 4FO9A 3KGZA 1AYN3 2X05A 1CZTA 1XE8A 3CJIB 1WBFA 5FPVA 5B4XA 4EZ4A 4ZY9A 5GLZA 2E7TA 1HJGA 3BIWE 5IT6A 4XFFA 3VBRA 4CUGA 4DXRA 4ARYA 1KITA 3EBRA 5FXVA 1RYYA 2BERA 5I91A 4CYDA 1AX0A 2YFZA 3TN91 2A3WA 2RR11 3O7OA 4R9CA 3K4AA 2WFPA 3IWZA 3VBSB 1CX4A 2JDHA 1MQTA 3D0JA 4IGQA 3ZMOA 4CDWA 2WT2A 1OQEA 4WVMA 1D4VB 2VQUA 3ZSLA 4NPLA 4JDOA 4FTSA 5F39A 4NHXA 1NCQC 3SCHA 3PU3A 1F4AA 1OUXA 4QU2A 3KWVA 3T2PA 1D2SA 3RZGA 5GLUA 2VNVA 2D7FA 5FZAA 1OI6A 3CU7A 2D3RA 3H8OA 5E88A 1YO8A 1CIWA 1KFUL 2J7MA 3LZZA 5C7GA 1POQA 4XDQA 5FAXA 4BQ5A 5GLWA 3VGIA 4H55A 5FZMA 5BNQA 5F7UA 5GZCA 2DCJA 2HWE3 5A6YA 2EIBA 1SFNA 5JSPA 3R4SA 5CFCC 3K3NA 3MICA 4GMP3 2QQNA 2VOTA 3OEBA 2WNUC 3KMHA 4MZUA 5LY2A 5FPUA 4TXWA 2YROA 1MZ5A 4S2DA 2JG9A 4Y20B 4AEMA 1CVNA 1YI7A 1S2KA 5GLVA 4QHBA 1D0GA 4YG6A 1AUYA 5C5TA 1OPMA 1WUVA 3IZOA 3LPFA 4UYBA 3ZX7A 2F4PA 1BMV1 1K5MA 1R093 4LKFA 2RM23 4AOCA 2UYAA 4AI9A 5FK7A 4CDUB 1U5ZA 4ET7A 4JQTA 4ZXEA 3HIFA 3PVNA 1VBD2 5KC6A 1DP0A 1MS0A 2PHRA 1CIYA 1QOTA 4RS5C 4IW3A 5FV3A 3NW4A 5BNOA 2F4LA 4AFCA 4LKEA 4E8CA 4PHZA 4R52A 4Q0VA 2XR4A 1C8M1 1W6MB 1C3HA 2P1BA 1QXPA 1US3A 2YXSA 2ZEXA 5ABJC 4FPHA 3MDPA 4XUQA 1R082 4FVVA 5E8AA 5BNNC 1GP6A 4Q0QA 2F17A 2IXIA 4JZRA 4QGMA 4P08A 1UZZA 1YI9A 5FWEA 3N9QA 1JYIA 1AR81 4O61A 3I2GA 3UNPA 5K0UC 4MXWA 5F5QA 4DUXA 4UWDA 3N9NA 1R1A1 4CXXA 5H9QA 3GHNA 4FFIA 3UKVA 2OZ6A 4OHXA 4XBQA 2WA4A 1F5JA 5A1FA 3LIGA 2QBXA 2DU1A 2XL9A 2KM2A 3WQ0A 3AZZA 1ZBA3 5IVBA 2J1VA 5JPNB 4KU7A 4CCDA 4E2GA 4P9WA 5FZOB 4QPIA 3T2QA 3U37A 4DINB 4AEDC 5HI0A 1H2NA 1W03A 2HYKA 2XPJA 1V6MA 3D8CA 2WYSA 2ZACA 3WCRA 4Q1RA 5CFDB 3M8LA 4R4XA 4IEUA 2PAMA 4CU6A 5KHGA 1Z7S1 4KI5M 5FZGA 2YC4A 3MIEA 3RYPA 1C28A 1OF4A 4LTAA 1UAIA 4P00B 1W28A 1HIXA 4NWWA 2VU9A 2BZDA 4YARA 1HRV2 4YFZA 5DUUA 3T3YA 1I9RA 1TME1 1GOGA 2PHDA 4OQ9A 1FOD2 2ETEA 4YVSA 2KR2A 2YBKA 5DG2A 2WZPP 4YZ1A 1DYOA 1LGCA 4Q8LA 4TLFA 3WQBA 4AE2A 1ULPA 2FDKA 1G8WA 4AFBA 2X09A 2ZGOA 4XZUG 4HVRA 1EUTA 3SXWA 4ES8A 4D69A 3PTYA 2WS91 1FV2A 1RUNA 1UZ0A 1YC61 3VKLA 2GC0A 4HSJA 4LEJA 1PVXA 2TEPA 3N9PA 3LF7A 5JVVA 5J37A 1VMHA 3AZYA 2DBIA 3SEPA 4BYYA 5A3TA 4HLTA 4N43C 1OLRA 5IVYA 3S5QA 2E26A 3J8F1 1B35C 4JKKA 1AZDA 1WMEA 2W3JA 5A7WB 4UOJA 1MZ6A 3V56A 3VD5A 1LOGA 4JX0A 4OHVA 2ZGRA 4QB1A 1QY4A 3USUA 2BU9A 5F8PA 3RWKX 3LEGA 5CZKA 4YZ2A 4KL1A 3NJVA 4H14A 4ONUA 2WFF1 2Y33A 3VBOA 1JW6A 3PUQA 2WABA 4K21A 3LQCA 4AK3A 3CJIA 3ZR6A 3TN92 2RR12 1POV1 4P5YA 4IE4A 4AGRA 2A6ZA 1BEV3 2I07B 3GNEA 4Q4X1 2VVFA 3VKMA 3VDCA 1JZ6A 5IK7A 1V9U3 5FMDA 2IXKA 5A3UA 2QZ2A 2E53A 4IE0A 2VZOA 5C8CC 2RS52 1LOFA 3HT2A 3I2FA 4O65A 1LESA 2ZMLA 2R063 3E6DA 2YY1A 3NJYA 5HPOA 1PK6B 2R16A 1Y7BA 3VBSA 1QDCA 1WA4A 2J1EA 1W8ZA 4FT8A 1JUHA 1N3OA 2DURA 1URXA 3PUHA 1MS3A 4XF3A 1X8EA 2R073 1O8SA 1K5JA 2WQZC 1V6KA 2C9AA 1XNTA 4EN0A 1KS4A 1NLSA 4UW4A 4ZXKA 5FPZA 1DHKB 2OW4A 2P3KA 4YW5A 2ZGKA 3AKTA 2JWPA 3FLRA 5A32B 4A7ZA 3T0DA 1W2AX 4TYSA 5LATA 1GUIA 2A75A 2HWF1 4U36A 2YFUA 1XBFA 5FZ0A 3NMBA 4I09A 1JMUB 1F8VA 2D40A 3AKPA 3D0SA 1ZBE3 5I0TA 4AHWA 1BMV2 5EV7A 3JBG1 2PHLA 3UT0A 2ZHNA 1ALYA 5DABA 5K0UB 3LSEA 3MHZA 3NJXA 3AMPA 1IQDC 5J7MA 2IXHA 1JZ3A 1PZ9A 1LNSA 4RN5A 4BH9A 4MGYE 1X50A 1SPPB 1VBB3 4MHUA 3F95A 5T54A 3VBHC 1VRBA 2YGLA 3IMMA 5T3NA 3VZOA 3ZMNA 4AAXA 4ZS2A 2AACA 2G9GA 4GH4A 4YZ4A 5T5OA 1UYXA 3TBDA 4AEDB 5EYYA 4CDUA 1VBA3 2E63A 3S0MA 5M0TA 4W50A 2C1FA 4HBNA 4K1ZA 1TVGA 2RMU1 1GKBA 1H4GA 4QPGC 3RZZA 4HONA 3OTFA 4QX5A 1B09A 1YLLA 4C1WA 1R1A2 1W6MA 4W6WA 1W8HA 1SCRA 2B9UA 4CCLA 3VZKA 4RA0A 1REFA 2WO2A 1RUH1 1UCXA 5FZCA 4AWDA 2Q5TA 3JB8A 4LA2A 2XLFA 4XBNA 2CGNA 3DYOA 1C1FA 1K45A 5BNPC 4NPMA 1AYN1 2GSYA 3I97A 4YW7A 4E27A 2KA3A 2WZEA 2OPWA 4OZOA 1XYOA 2OQ6A 3LEMA 3ACFA 2VMCA 4A4AA 1HB3A 5FRAA 1AR92 4JQRA 4GZ9A 1NXD1 1QJY2 1Z7S2 2IZWA 5ACA3 1HB1A 1UU5A 3MLLA 4QAWA 1YQ6A 1GQHA 2XBO2 4UFIA 4W6XA 5G04L 3WF0A 4CPBD 1I5PA 1XNAA 3VKNA 2W68A 1HQWA 4D7TA 2D93A 2QFEA 4HKOA 3C2UA 1TME2 4N43B 4Y26A 5CFDA 3ZYHA 1BVVA 2ES3A 3WDWA 2X10A 5JOYA 2Q0AA 1ODMA 1W6PB 1S0IA 1SFYA 2WL1A 2BVVA 4LITA 2IXCA 4LIVA 1DGRN 3HQUA 4RSUA 5EZWA 2AENA 2GNTA 4LLOA 2QQJA 2ZX4A 4WBBA 3SKJE 3OGRA 5JDBA 5KHIA 3WV6A 1H30A 2B9VA 2WS92 3GBWA 1NX9A 2AYHA 1V6LA 5A6QA 2V4VA 1SQ4A 2ZAHA 3VZNA 5FYBA 2DF7A 3CEWA 4XJ9A 4YM1A 4K40A 2V73A 4LORA 2ZGTA 2HWE1 4FQZA 1C4RA 3T4VA 4CU7A 2BNMA 3BTAA 4GMP1 3M70A 4HT1T 4IE6A 2FDGA 1Y9GA 3AFKA 4CP1A 2RV9A 3NVCA 4JC1A 5JZGC 4CTEA 2NYYA 1JS9A 1PZ7A 3SKVA 2VR4A 1RUJ2 3WG4A 5FOJB 1ZREA 2JE8A 2CYFA 5FLIA 2BGOA 5C8CB 1FAYA 2GNBA 3TOJA 1RXFA 3G6JB 1R091 1RXGA 3C7OA 2RM21 1I1EA 1ZRCA 1EV13 1RHI3 2CWMA 3K77A 4FXGB 2Z79A 2BNOA 3EMRA 1W04A 4QQLA 3D5OA 2R49A 3ETQA 5LRSA 4JKMA 3VBRC 1RVF3 2YBPA 2XB6C 2VCAA 4B7EA 4OQ8A 4LK7A 3MPPG 5DAQA 3THCA 4BOWA 5A7WA 4JVAA 2XUMA 4I3PA 4META 4BLJA 3FFZA 4CCEA 4LHKA 3WDVA 1R64A 4QM8A 4KWLA 2BDRA 1MQTC 2QE3A 4CDWC 4QHOA 1RL3A 1CAUB 5EJ3A 1G9CA 1JYTA 4ZS3A 1RUC3 1JBCA 2WO3A 2A6YA 5J09A 2XQXA 2D6PA 3LOIA 2VOXA 1UMHA 3H3UA 1BZWA 4JHTA 2PLV3 3VHRA 1A8DA 4NMIA 4BJ0A 5JPMB 5GJ6A 2J1RA 2VBBA 3WG3A 4B4PA 1KXGA 1ZBA1 4PBOA 2IUWA 4OI0A 5HCFA 3EHKA 3I2JA 3FJSA 2NPIA 1NA1B 1S0DA 4XJ8A 1PK6A 1TG7A 1NG0A 3AP4A 3GCWA 3AKRA 1N1YA 2VBDA 4AVVA 2MHFA 1S0GA 3OPZA 4LBNA 4UAPA 5FMCA 1LKNA 4FPLA 3AP6A 5IUQA 1OLMA 4OUSA 2JG9C 2VY0A 1AR73 5DXDA 3I54A 4PIZA 4EN7B 3KHBA 2RJLA 2XLAA 3UJOA 4F83A 2Y38A 3RI8A 3VKOA 1AX2A 2UYBA 5FWJA 1K5MC 4FPOB 3NV3A 5A32A 3JBG2 2DU0A 4FCAA 1FMD3 1UKGA 2CSGA 3J9SA 1L7QA 1OFNA 2D3PA 1V70A 3MI8A 1UY1A 5IW0A 4E2SA 4YM3A 1QNYA 2YU2A 3PDQA 5D21A 3K4ZA 5KC5A 1V6IA 5BNOC 1Y9MA 2JKXA 2VH9A 4K8FA 3A7QA 4OUMA 4XHBA 3LA2A 3I3QA 5JWPA 1RUG2 4LNVA 3ZSEA 2WZR3 2HWB3 5FZ3A 3Q8FA 2G4IA 2CDOA 4NOTA 3E6CC 3J7HA 3M3OA 4MVTA 3OBZA 4OUEA 1CJPA 2XUEA 5FIXA 4NRQA 4CCMA 4Q27A 2RMU2 1DGRA 2VBPA 4Q29A 4QX8A 2JJ6A 1SPPA 3VDAA 2EIGA 4A3XA 3S57A 2VG9A 3WLUA 3NV4A 5J48A 1QJZA 2B8MA 1BVP1 1SLIA 5KXEA 5F6LB 2EIEA 3P1IA 1CAVA 1RUH2 4M3CA 4D8MA 5F5CA 2R043 4XW3A 1EP0A 2QJVA 2UY9A 5FK8A 4KU8A 2R1BA 5LBEA 1A3KA 1CPNA 3RG0A 1GBGA 1AYN2 3POGA 5I0UA 4QPIC 3RPQA 4JGZB 4KWUA 3O1MA 1POV0 1XQNA 2I74A 4XVHA 2VE1A 2W95A 2AR6A 2ZPXA 3IDBB 1AYM3 2GALA 3JB4C 3DYMA 4QX1A 4A2UA 5C9AA 1OMIA 2R1DA 4KG8A 3WF2A 2GMMA 3J7NA 3MIHA 4FBFA 5KXDA 1HLCA 2RS13 3AM2A 2W52A 4LULA 4GB33 4BE3A 2XJUA 4QQPA 1BEV1 1KGYA 4LOTA 1XXNA 2VZSA 1DLLA 4DQAA 3WINE 4OZXA 2RDRA 3RZMA 1CGPA 4YVSC 4BCUA 1OA4A 4AI3A 3OEAA 4M0HA 4PI2A 1X36A 2R061 4Q4V3 5FY9A 2VW0A 4CEYB 4N53B 3T2OA 4RQPA 3WR0A 4EZHA 1RMU3 3VDDA 2HWD3 1Q8VA 4QXKA 1V6JA 4Q4W3 4XIOA 4AI1A 2ZXQA 1EUUA 3DECA 4HK9A 1XU2A 4XQ4A 1Y3TA 3JQXA 1TQ5A 2Y60A 4BQ1A 4GWNA 1HRI2 2R071 2E51A 5FZKA 2VMEA 1J1TA 2KXLA 2ZGMA 3TNQA 4AQSA 3SH3A 4XTMA 2IWGB 3I7DA 3I59A 4EWAA 4HN1A 3K48A 1DQ0A 1YQ5A 1OT5A 4CDWB 4WVMB 5BPXA 2ZEWA 1RUD3 2BOIA 4LBKA 2RS33 5FZEA 4CE8A 2Y26A 1ZBE1 4IEVA 2BPA2 4QXHA 1ZRDA 2CAUA 2RM22 3MIBA 3BODA 4Q0PA 4ASKA 4LT5A 3OBAA 1Q5OA 2I45A 2Z2SB 3THDA 3J26N 1QMJA 1HXS3 3VBOC 5EHDA 4IEYA 4LLFA 3H7YA 1GV9A 2XJQA 5BY5A 2N7GA 5AC92 2W08A 1PIV3 3CJIC 3O1UA 1LHNA 1VBB1 2XJVA 1VB2A 3U07A 1OKOA 5SV8A 5LASA 1GZWB 1LOCA 1RITA 1VBA1 3SH5A 3HPNA 5LBCA 3WF3A 4A6SA 3LGRA 1LOFC 4IE7A 1JTZX 1UYPA 1IQAA 3FHAA 3Q9OA 1UMIA 5AFBA 1GNHA 3AVSA 5L9BA 1YIPA 4Z2WA 5JR7B 3VBSC 4Q4Y2 1YFWA 3BB6A 4DOUA 1K5MB 1MEC3 3H8RA 4NRMA 1CAUA 1W6QB 3H1MA 3BPZA 3E97A 4G4FA 4KBBA 4YG0A 5A7NA 2OVUA 2VOWA 3ORJA 1ZBA2 2VVDA 3BU7A 3LOBA 2PQSA 3IN9A 3ZN6A 5BNOB 3AL6A 4LKDA 4C90A 4NIDA 2MEV3 1QF3A 1ENRA 2ZKNA 1QJX2 2ARCA 1G9FA 3D3AA 3OD0A 3MUZ1 4TLGA 4PCRA 1AF9A 1M4WA 5IJRA 4CCKA 2PYTA 1UOFA 1SEFA 1O3RA 4A7YA 2X5IA 3ZYGA 4EV0A 4YPJA 3B7MA 2WBKA 1NA1A 1Q43A 1YXWA 5FBZA 5K4LA 5T5LA 5IK4A 2P3JA 2JKBA 3WP3A 1O4TA 2XOMA 5FO7B 5DPNA 2WWJA 2BFUL 4YGDA 2R7EB 1WCDJ 3F2ZA 2XLGA 3OY8B 4MH0E 1T6BX 4RGKA 5F37A 4I3GA 3O1RA 1DYKA 5A33B 3CHXA 4UW3A 4OMCA 1SLLA 5JI7A 2Q1MA 4Y4YA 3ZYJB 4A45A 2EAAA 2QDNA 2J42A 4GH4C 4HANA 4CDUC 1ZZ9A 4FTEA 5JOZA 3AZWA 3Q8AA 5IATA 2RDQA 4IV3B 2IXLA 4LHNA 3ATGA 4KGGA 3H1WA 5C3RA 2HBTA 3AKQA 1NLRA 3T0BA 2WN2A 4NRPA 1W8UA 2QQWA 4RFT0 3I3DA 5FYMA 2WN3A 4IQPA 3NKGA 3ZXEA 4OLLA 4CP0A 4AAPA 3M3CA 2J22A 2O1QA 3KB5A 3A0KA 4M3CF 3WW4A 2XJRA 2ZGSA 1KQRA 4G9SB 5LW9A 1ONAA 2WWSA 1NY71 2O8QA 3FWEA 4PDWB 4YVWB 1X9PA 4QB2A 1ZZ8A 2DCYA 5FFOC 1OLQA 1EV11 1RHI1 2BTVC 2ZABA 4LKSA 1NE4A 1G6NA 4LE3A 4FPFA 3MEPA 4YGEA 1Q8PA 4LO8A 5JLVA 4XABA 1JOPA 1RVF1 2W5FA 3DXTA 3DN7A 1VAMA 1G9BA 2SBAA 4HKLA 3BU0A 3L2HA 1BBT3 1NYWA 4JGZA 2WNOA 1C5HA 3RS6A 4COYA 3BCWA 3IDEA 4B3NA 1BEV2 2W47A 4HVOA 1LULA 4ISRA 4RGAA 4QKDA 1YUDA 2J1SA 5CFDC 2D3SA 3LE0A 1RUC1 3OYWA 1APNA 4WM7B 1UQXA 4Z82A 4CZSA 5C5UA 3ZKUA 3S5AA 4XAEA 2HYXA 2HJIA 1NUKA 3ACGA 3GHMA 2R062 4FPGA 3WW3A 2XHKA 3BYWA 3HNBM 5JSRA 2PLV1 1H2KA 3HVDA 2LS6A 3MUY1 3U1XA 4CSWA 1U5YA 3H8UA 4XFIA 3ZYBA 1S0CA 4URAA 2IXJA 4P9JA 1SHWB 4C0BA 4JCKA 2R072 1JZ8A 1MS4A 4FPEA 4R9DA 4IEOA 1ASJ2 4CEYA 3KM5A 2BOJA 4ISQA 4CCJA 3FHQA 3PVEA 4NE9A 5JCTA 1YRZA 2P2KA 3N36A 3HT1A 4W65A 5F5AA 3UGHA 2V4AA 2VVEA 4L92A 3IAPA 4Q0SA 1AJKA 2DUPA 3KZ4C 4IDZA 4XILA 5FPLA 3VN4A 1AR71 5A3LA 1UX6A 5FZBA 1JXNA 2AUYA 4DRVA 1F35A 5C4WB 4UFKA 5DZEA 4AQTA 1FMD1 1GP5A 1UL9A 5FPXA 1E5IA 5FREA 3BTZA 2Y6FA 4N90A 5FBJA 5K8SA 2BRTA 4P9XA 3JZVA 2LALA 4NO4A 2F6BA 1JZ7A 2LM3A 2Q1ZB 4LHSA 2WZR1 2HWB1 3OG2A 2E33A 4O9GA 3WY6A 1RINA 4CUAA 2FCVA 3PU8A 3THTA 5JMCA 1MR5A 3RI9A 4AEKA 1XC6A 5DMYA 1YCIA 4L0PA 3T1MA 4FP2A 2WZ8A 3J4UH 4DZGA 1LU2A 1YQ2A 3H3LA 3WG2A 3ECQA 4XZPA 1N3PA 5HXVA 3SCFA 1GZWA 1X9TA 2JB8A 4AEJA 1WWYA 1DQ5A 2R041 3WP4A 4I0AA 3ACLA 4GJZA 2WJSA 4Z92B 4QHZA 1UYYA 2V72A 4AVAA 4EN8B 5A70A 1PK6C 3AMNA 4QQOA 1EPZA 4ES9A 3BIEA 2W94A 2OIIA 1LODA 1PO22 5JXHA 2C4XA 2ZKLA 3S30A 4FSJA 1AYM1 1H8VA 1W6QA 5FYIA 2ET1A 4GH4B 2ARAA 2YUEA 4HVQA 2BBVA 4C8DA 4HKWA 4AHXA 4CRQA 4J6GA 1OA2A 2A6VA 3RGBA 2RS11 1US2A 2VZVA 4GB31 3N9OA 3FZ3A 3T30A 4H7MA 4L9BA 4WZFA 5LBFA 1AL23 1X8MA 3K75B 2OUJA 5A3MA 2BGCA 2WUHA 1LECA 4W6YA 3ZYRA 5LEKA 4GKXA 1E57A 1W6OB 3WP5A 4AVSA 1W2OA 1S4CA 1UU6A 1X33A 1EAH3 2P5BA 4P9LA 1RMU1 5L7OB 2HWD1 2V5DA 4QXCA 3KV6A 4SLIA 1D4M3 4Q4W1 2GDFA 2PTMA 1OH3A 1AX1A 2HKXA 4Y5Z0 2VOKA 2YC0A 1MZEA 4RHV2 4YW6A 4COZA 1GWLA 1PGL1 1N1TA 2CHHA 2OT7A 3OY8A 4NIAA 3KT7A 1IOAA 4UBGA 1RUI2 3IM0A 3AC0A 4LA3A 5A33A 3RRDA 5CKQA 5IK5A 5J1XA 1W3XA 1KFXL 1NQDA 4D6QA 4GAZA 4B4RA 4P14A 3ZXAC 4ZZ5A 4R4ZA 2CWSA 4KWJA 4FXKB 3GZAA 4H2AA 4IV3A 3ABZA 5AVPA 2DVFA 2E9QA 1RUD1 2YG0A 1J58A 1RC6A 2RS31 3WNMA 4LBJA 4XURA 5C3PA 1OPOA 1W99A 1TEIA 3D6EA 1RHI2 4RFRB 1XE0A 3KF3A 4L2NA 4BQXA 1ZA4A 4CEWA 5C9AC 1H1AA 3A23A 1KJRA 1RVF2 1GU3A 1HXS1 3FC0A 5FUPA 4FI9A 2Z4FA 4Z07A 4D3WA 5HV4A 1QWRA 1VAKA 3BOPA 5IHRA 1JZ5A 1GANA 2VMDA 1PIV1 5BYNA 4YVWA 4PDWA 3KV9A 5ISLA 3SCGA 2G9ZA 4LBMA 4ASLA 1GNZA 3GJAA 4HSLA 2VGDA 2DWRA 2CV6A 3AK0A 1RUC2 3QOPA 1ZZ6A 1UY3A 1ULGA 4URTA 5FY8A 3LA3A 4AI8A 1CZSA 1GYKA 1RB8G 4QD2A 2IVIB 4Q5OA 2C9KA 3H0OA 1UPSA 3POFA 2DUQA 4RQPC 3VDDC 4A3ZA 4QU1A 1E5HA 3LDKA 1MEC1 3T2TA 3VBFB 1WLWA 4MLOA 2A5ZA 4B8EA 4L8QA 4XF1A 5H9SA 4WM7A 2ZX3A 1LOBA 1UF2C 2EAKA 1OBNA 2W91A 3LFMA 3SNMA 1JYVA 4HPKB 4CA9A 2Y6HA 3KCCA 3CMGA 1AXZA 1SCSA 1UX7A 1WW5A 1Z0HA 2EXIA 3TB0A 4BLIA 4GA9A 1SLTA 1CJDA 4JRAA 1XYNA 2DTWA 3FLPA 1WD3A 5FY5A 2QQIA 4KNCA 4R8HA 2FDJA 5F3IA 5IAVA 4GIQA 1NE6A 4DEVA 1XRUA 3BTYA 2XWJB 1O8PA 3GZEA 4NROA 3AXEA 3GXUA 4CUCA 2JG8A 3M3IA 4PLOA 4BPZA 4SBVA 3GM8A 4UW5A 2D98A 4EN6B 4ZHNA 1KRIA 2D5HA 2WIIB 3AP5A 1MS1A 3LCPA 5JR2A 1FMD2 1HJFA 4H7LA 2E31A 3NQHA 1A78A 1PMJX 4MGKE 1CPMA 4AFDA 5FZ6A 3HN1A 2FZ2A 5FZ1A 4J25A 1O91A 2Q1FA 2YZ4A 1NCRA 2HEWF 3ZXLA 3BI3A 3WDYA 3P3PA 1S0EA 5C4WA 3CKHA 1DBNA 1CD3G 1XU1A 5LK7B 2GN3A 2BWCA 3O1VA 3QBQA 4EWEA 4PF1A 1DIWA 1P8JA 3ZN5A 1DLCA 5AFEA 3AMHA 4IESA 5A6XA 5DUWA 3WSOA 3V0BA 4FAHA 2HWC3 2XVKA 4NPRA 2BFUS 3G7DA 3HWJA 4X8PA 5FLHA 2W92A 3OGGA 3RVHA 2PMWB 2PELA 2J1AA 1HW5A 1TNFA 1YJKA 3B69A 4C91A 1O3TA 1JZ4A 1VE0A 2RDNA 4MUVA 1T6GC 3KD4A 2E6VA 2R042 3VD3A 1V6NA 3WNLA 2HBUA 1WMXA 3HBZA 4D7YA 2W39A 2PA7A 1DQ6A 1YJLA 3CO2A 4N7UA 2ARBA 3AFGA 4GQ7A 2JD4A 4PF5A 3ZXFA 3C7GA 1FPN3 1SBFA 3H50A 1FI2A 1GMMA 2W2IA 1C1LA 4LO7A 2P6HA 4MADA 2RS12 4HL0A 5FP8A 1NA1C 1CQ9A 1OLME 1BBT1 4GB32 4XFHA 2WAOA 2QUOA 4BK4A 4W8JA 3POYA 1ND2B 1LR5A 1NZIA 2B4KA 3GZUC 4XPVA 4LBQB 5IYYA 1GR3A 1C8M2 2QCSB 5CVRA 4M3CB 1CAVB 5E16A 5HBAA 2VQTA 1JZ2A 4C1XA 4UFJA 1AR82 4NJ4A 5L9RA 2R30A 1RMU2 5IK8A 2HWD2 3ZVXA 4LE4A 4Q4W2 3VHPA 3DL3A 2ZJCA 3FMGA 4OHZA 2VXJA 3ZYPA 4V2VA 4E4DX 4I2OA 4DY5A 1PGL2 3KSCA 1W6OA 5C9AB 5AVAA 1CR7A 4EN9B 3I3BA 2EXKA 3N7MA 1UKRA 3BOWA 3H3ZA 2ZOEB 1LB2A 3PVOA 5L7OA 2IVJA 3VBUB 1G7YA 4XACA 1W9WA 2A3YA 4YRDA 5KWRA 1UD1A 2NP0A 4U2AA 4PQQA 2D44A 3RFRA 4MG2A 2A71A 1RUD2 1GQPA 1W2UA 1EYBA 2RS32 4AFMA 5J96B 5GM0A 4BU2A 3ES1A 4RQPB 2X29A 4LIUA 1Y43B 1PGW1 3VDDB 1JUIA 3EXUA 1H0BA 1OD3A 4XE9A 1J83A 1OC1A 3FLTA 4I30A 2GNDA 2IC1A 1QQP3 3I3EA 1W8WA 1LHWA 5DDJ3 2ZX2A 1SLCA 1JU3A 1YQCA 2YPDA 3B9CA 3EQEA 3MFAA 3P6BA 3WQ1A 5LBBA 1PIV2 3AMMA 3AXDA 3OB8A 1OXCA 4JGZC 3B00A 4YNIA 3NJZA 5IFPA 4ZU5A 1SBDA 1PNGA 3AYDA 2JDYA 2W1WA 3D4KA 3ZPYA 4FTBA 2VL4A 3I59B 2ZGNA 4HN0A 1HN1A 1SACA 4HMZA 4QDQA 1ULDA 5APAA 3VHOA 1UU4A 4YGBA 4DEQA 1PM4A 1H1IA 5IFTA 3ES4A 1UOBA 4LUKA 4OI1A 2DUOA 2W9XA 3CNAA 4QQHA 4YFWA 3BUCA 3IMNA 3KGLA 3UGGA 4A7KA 1R083 5CG8A 1ZNPA 3O1OA 4A41A 3B5LB 3J8F2 2CU5A 4CEYC 4N53C 1X82A 2BEOA 3TEWA 1Q8OA 3UESA 2Q4SA 3ON7A 3AJZA 2FZ1A 2A1XA 3VBFA 5JAXA 2CGOA 2AREA 3OF1A 1W9YA 1DQ1A 4LHLA 5DZGA 2WFF2 1W9FA 4HPKA 4LJHA 4YM2A 2W1SA 3ZSMA 1J1LA 2C24A 3ALQA 3SQOA 4Q26A 1W90A 1AL21 1OQ1A 3O5SA 1RUF3 4GXLA 2P4EA 3B3QE 1K3IA 4Q4X2 2Q8CA 4LO5B 3URFA 3L2YA 2NN8A 3KCXA 3PJQA 4DIQA 1W9TA 5CISA 3V0AB 5FO9B 1MVQA 1UIKA 1ZYBA 1EAH1 4XOGA 5CKNA 1K12A 2ZCWA 2ZMKA 1W0NA 1L7RA 5ACA1 1D4M1 3IBMA 3ZN6B 5CEHA 1SZBA 3H8XA 2QQVA 3EO6A 3O1TA 1TZOA 3PMSA 3ILNA 3WOGA 2FDFA 3SC7X 1CONA 3UYJA 1FOD3 4Y33A 3MW3A 4K9SA 1YQ8A 4IEZA 4NIGA 3QCWA 1Q56A 4JDNA 2X5IB 5E6HA 4TWTA 4NR1A 4QPWA 3POSA 1SDWA 1XPWA 5KHKA 4Y1YA 1SG3A 2OPKA 2SLIA 1BK1A 4FPCA 4P9GA 4YWAA 5JOWA 2HWF2 2Q30A 1WZXA 1UO9A 5LA2A 3AP9A 4OFGA 3A0NA 2J1UA 3WW1A 2XJSA 3TWIA 1NT0A 3ZKYA 2FCTA 5FMOL 4G3YC 1ZZBA 1VP6A 3PNAA 3QH7A 4XUTA 3ZXJA 2Y6LA 4Z2AA 1GQGA 2P3YA 2A6WA 4CXYA 1PNFA 2YGMA 4WM8A 3MV01 3UKNA 2YHJA 5A7QA 2XGXA 3B9IA 4GALA 3CLPA 1DDLA 3ZSKA 2WAAA 4IEQA 2C26A 3ZLIA 2V09A 5KXCA 1A8MA 2ZGPA 1W2TA 1XNKA 1RJ8A 1J84A 5KHJA 1T2XA 2BQPA 1LEDA 4N9HA 4AI0A 5JIUA 1ND2A 2H0VA 1W8NA 4LBQA 5C70A 1RTVA 2D6NA 1SMVA 3ETPA 3M2MA 3J7LA 1PHMA 1PMHX 2BP6A 4BIFA 3WT3A 3UK9A 4QB6A 5ERLA 2RS53 5D1IA 4F3JA 4BMEA 3RYRA 3PJYA 4AFAA 3E5QA 3U10A 1NLQA 1SDDB 1XJAA 3CF6E 1DQ4A 2K2SA 4AGGA 3ZFGB 1UY2A 4K7JA 4AHYA 2FD8A 3OGJA 1VRH3 4IV3C 2VCBA 4QKBA 3ZO0B 3BALA 1UN1A 3B94A 3MYXA 3C3VA 1HN0A 3OYWB 2UWAA 2FMDA 4CU8A 2VZTA 3TNPB 4KQ7A 1F15A 3VBUA 5A1AA 1WKYA 1UZVA 5F6KA 4XFAA 1CZVA 3NWKA 1VJ2A 3R4UA 3WP6A 4CEWC 5FY0A 2Y34A 1V9U1 1S0JA 2FQPA 3KVBA 2ZMNA 1Q8SA 4QX0A 4F8AA 3NRUA 4YVWC 2O8OA 4PDWC 4ZU7A 5FR3A 4KH9A 2Y6GA 4IEPA 2WR9A 4YGCA 2G19A 3BGAA 1IS3A 1BQPA 1LU1A 3I4IA 3ST7A 1UZYA 1VAVA 4L11A 2ZHKA 1C5IA 1KS5A 4UFLA 2XVGA 4YW2A 2HWC1 4IEWA 3UV9A 5K9YA 3KT1A 2HWE2 2A7AA 2B5HA 3AJYA 3OSDA 1KJLA 4MSVA 4YSFA 1DFQA 2DFCA 5FYSA 4E4HA 4COWA 2WSVA 5T52A 2UWCA 5FCCA 1XYPA 3OCPA 4WM7C 5JIAA 1OHFA 1PVC3 3RJ2X 1J59A 1UY0A 2WO1A 3T4HB 1IKPA 5JMOA 5GZEA 3I49A 1LHUA 1ND3B 5FPBA 3M4FA 4XJAA 4DXTA 5JI9A 4DUWA 1R092 1FPN1 4XUNA 4BWOA 2D6LX 4DO0A 1H6YA 4CP2A 4XQDA 5CYYA 4YLZA 5FZ8A 2JG8C 3P5BA 4E9KA 1IG0A 5FTTC 1F4HA 3MIGA 1AL22 4MHRA 3I8TA 2VCCA 4YW3A 4JHZA 1ENXA 2ZGUA 2NM1A 4AVCA 4OCTA 3ZFEB 1AR93 4ORFA 1PGSA 3INAA 3LWCA 1OURA 5GZDA 4AZZA 3DKQA 2JDZA 1QJY3 2WLQA 5C4WC 5JOXA 1WLCA 2DCTA 1EAH2 1DGLA 1PO13 4RL7A 4XXAA 3SISA 2WRAA 2XBO3 4N8MA 5FP3A 2ZX0A 2HEVF 3ZFFA 1D4M2 5KHHA 1UMZA 5DUVA 5BV6A 4PQ9A 4QX2A 4RYDA 3PMEA 3EB7A 3KV5A 1OOPB 5CAZA 4PIYA 3MIDA 1IGOA 2JE9A 4QPIB 5SV5A 1IPJA 3V0AA 3KVAA 3QD6A 5FP9A 4LO4B 3BPSA 2GZWA 4NHLA 4XEZA 1COV3 3GALA 3NNJA 2Z5WA 4D0QA 1IPKA 4AW7A 3MF9A 5DAVA 4D6SA 4Q0UA 1DU3D 2YBSA 3NAPA 4OULA 2OXBA 5TSWA 4AL9A 4BB3A 5JXGA 1WMDA 3OBTA 1VBC3 3LPGA 1KDKA 3SEEA 1QQP1 4FOQA 4Y1XA 5CKMA 5DDJ1 1OFSA 2BGPA 4IV1B 5KR7A 1RUJ3 1W0PA 1YWKA 2OX0A 5FOBB 4TZDA 3TEYA 3Q8BA 5L73A 2JENA 4CP9A 2B39A 1OF3A 2QQOA 4M4PA 1S0FA 2AGSA 4GKYA 3VB9A 3CBNA 3OUIA 5LEJA 2VUAA 3WF4A 5JXJA 1W06A 4Y1ZA 3VL8A 3APBA 2PQQA 4UFHA 5J36A 2EA7A 1HQNA 2ZS6B 3MLJA 3WDXA 2DDUA 2PHWA 3LEKA 3ME2A 1WCUA 3H7JA 2WQ8A 1X7NA 2OYZA 1GOFA 3BN6A 3VBHA 4DUVA 3PVBB 2B42B 3PHMA 4DXSA 4BQYA 1FT9A 1J3RA 4QGNA 1R081 4XETA 4CEWB 3IB3A 2CY6A 3OJBA 3PLQA 2TBVA 1BLZA 5L7OC 2VAUA 5LWBA 4FPJA 3LDRA 3N7LA 4NHMA 4ZPIA 2HH9A 3GBGA 1S0BA 1MPXA 1NKGA 4I0WB 1FV3A 4UBHA 3QACA 4FOVA 2G9FA 2PXJA 4LPLA 1IKQA 1N47A 2H6CA 2LTNA 2ERFA 5F2WA 5A3WA 4L97A 4Y5TA 2WNVB 3AZVA 1RIRA 3ZFGA 4AI2A 2K9ZA 1RUF1 2B46X 1REDA 1NAEA 5LA0A 1UNBA 1CX1A 5EQUA 5JUVA 1V9U2 3BTXA 4BQWA 3WNKA 5C71A 2LRPA 3IDAA 4LMFA 4BXSV 3ZXGA 1HX6A 2XVLA 4D6RA 1H2MA 5CIRA 4FP3A 5K7PA 1WLTA 3T1LA 2VNRA 3USSA 4AQ2A 2ZGQA 2DCKA 1Z78A 2EF6A 1CESA 1LJ7A 4AR2A 2GN7A 5IWFA 1FOD1 5FUIA 2KD7A 1D7PM 1N1VA 1WCQA 2HWC2 3JD73 4IXLA 2VQAA 4LK6A 4QQ2A 1IZ3A 1R1ZA 1HV1A 5GZFA 2JG8B 2Y0OA 4DS0A 1RUG3 2VZQA 3K2OA 4RR3B 2YV8A 1G86A 4HXCA 4NHYA 5DZFA 1QH7A 3ELNA 3FL7A 5A6ZA 2VULA 1DZQA 2AEZA 4CXWA 1NCRB 3ILRA 2DBNA 4KBZA 3LIHA 1XNBA 1ZBE2 4YG3A 3VBFC
chains in the Genus database with same CATH topology
3SKVA 2CDPA 2VR4A 4DEVA 3PUIA 2JE8A 2BGOA 1O8PA 3GXUA 4CUCA 2ZEZA 1UYZA 3CZUA 3C7OA 3GM8A 4MO3M 3K77A 5JR2A 2E31A 3NQHA 1PMJX 4JKMA 2VCAA 3THCA 2JDAA 3IIIA 1GOHA 1R64A 3CKHA 2EICA 3HN3A 3GDBA 4PF1A 1H6XA 1P8JA 3JXSA 1DLCA 2WO3A 3WSOA 2XQXA 1UMHA 4BDVB 4P02B 4TTGA 3WEZA 3A21A 2W92A 2L9LA 2VJXA 4BJ0A 2J1AA 2J1RA 1JZ4A 2ZEYA 3I2JA 3VD3A 3DYPA 3WNLA 1TG7A 4UAPA 3WNOA 3C7GA 1K42A 1GMMA 4MADA 3K46A 4QDSA 1JU4A 1PX4A 4BK4A 2WAOA 1JYWA 4W8JA 2HLEA 1L7QA 2B4KA 1UY1A 4JKLA 5IYYA 3K4ZA 2VMFA 2JKXA 3A7QA 3E1F1 2VQTA 1JZ2A 2LW8A 2CDOA 3J7HA 2Y6JA 4OUEA 5HXMA 3ACHA 3HEIA 2VZRA 4MGQA 3I3BA 4A42A 5EJ1B 3VDAA 4GWJA 5LCWL 3MV11 1W9WA 2EIEA 3P1IA 4D8MA 4PQQA 2W1UA 1KEXA 2Y6KA 1GQPA 1PX3A 4QDRA 4KWUA 3MBWA 4IUGA 4XVHA 2W95A 1W8OA 4QX1A 3DYMA 3MO4A 1UWWA 4CU8A 1OD3A 1J83A 3WF2A 3I3EA 3ZM8A 1JI6A 1JU3A 3P6BA 4UI9L 4HG6B 2VC9A 2W1QA 1ULOA 5IFPA 3OB8A 1KGYA 2VZSA 2XHNA 2W1WA 1W9SA 3OGSA 2VL4A 1JYXA 3OEAA 1HN1A 4QDQA 3T2OA 5IFTA 4DEQA 2BBAA 3T08A 5G05L 2W9XA 2ZXQA 1EUUA 3DECA 3LEIA 3T0AA 2Y8KA 2VMEA 2ID4A 4BK5A 3C7HA 2WDBA 5DN2A 4A41A 2VTFA 5LA1A 3UESA 2QQLA 2RVAA 1OT5A 1GNYA 2ZEWA 3VD7A 2X05A 1CZTA 5B4XA 4ZY9A 1UY4A 2W1SA 3HNMA 3OBAA 3WF1A 3THDA 4DXRA 4ARYA 1RYYA 1K3IA 2BERA 3WNPA 1UXXX 2YFZA 3CDZB 2VM9A 1W9TA 3K4AA 1K12A 2VQUA 1W0NA 1L7RA 2OKXA 3HPNA 3WF3A 3T2PA 1F4AA 3FHAA 1UMIA 5B4NA 2J7MA 5C7GA 4QPWA 4OYUA 1XPWA 5F7UA 1SG3A 2DCJA 2EIBA 2PQSA 2E32A 5LA2A 2QQNA 2VOTA 3OEBA 2J1UA 3I2HA 4TXWA 3D3AA 3MUZ1 5IJRA 5EIYB 2VO5A 3LPFA 4YPJA 4Z2AA 2WBKA 4XUTA 2Y6LA 4ET7A 2XOMA 3MV01 4ZXEA 5DPNA 3HOBA 1DP0A 2R7EB 1CIYA 3F2ZA 4E8DA 2WAAA 2C26A 1OH4A 4E8CA 1J84A 3FN9A 1T2XA 4OMCA 2ZEXA 1US3A 4A45A 4XUQA 1W8NA 4GWIA 5C70A 4P08A 3ETPA 4M4RA 1PMHX 3I2GA 3UNPA 3T0BA 4DUXA 2WN2A 4QB6A 3VD4A 4LQRA 3I3DA 2W87A 1SDDB 2QBXA 2WN3A 1UY2A 3GGLA 3W5MA 2J22A 2J1VA 2VCBA 2RJ2A 4ARXA 3T2QA 3U37A 3K4DA 5EJZB 2VZTA 4QB2A 3WNNA 2WYSA 4LKSA 2ORXA 5A1AA 1WKYA 3T09A 4CU6A 1CZVA 2W5FA 3UETA 4KI5M 2YC4A 1OF4A 4P00B 2BZDA 4QX0A 3NRUA 2W47A 1GOGA 2Y6GA 2J1SA 1DYOA 3BGAA 3LE0A 3WQBA 2HYXA 1ULPA 1NUKA 3ACGA 2J1TA 2X09A 4CVUA 4XZUG 1EUTA 3HNBM 3C8XA 3MUY1 2LS6A 4OMDA 4ZZ8A 1UZ0A 3OGVA 1SHWB 1JZ8A 3NNGA 3SEPA 1UY0A 2WO1A 3FHQA 2E26A 4DXTA 5JMOA 3IAPA 4DUWA 4JKKA 4XUNA 3CZJA 1H6YA 2W3JA 4UOJA 3VD5A 5CYYA 4JX0A 4PT6A 4QB1A 3I2KA 3C7EA 3HJRA 3LEGA 5CZKA 3NJVA 1F4HA 4MGSA 2VCCA 4JHZA 2WABA 1BHGA 3LQCA 1JZ7A 4P5YA 4LHSA 3VDCA 1JZ6A 3OG2A 2E33A 4CUAA 1O59A 2VZOA 5DQ0A 3I2FA 3VD9A 4QX2A 5I0DA 4RYDA 3EB7A 5HPOA 2ORZA 1XC6A 5DMYA 4L0PA 4XUOA 2WZ8A 1YQ2A 2J1EA 4XUPA 3ECQA 2VZ3A 2EIDA 2VZPA 3PUHA 4CU9A 3I2IA 1O8SA 2W46A 4D0QA 1XNTA 2JD9A 3W5NA 1UYYA 2V72A 3T0DA 2W94A 1JYNA 5JXHA 1GUIA 5JXGA 2C4XA 2YFUA 2QQMA 3LPGA 2XONA 4MOAA 2VZ1A 3SEEA 3CIHA 5JXIA 2VZVA 1US2A 3IAQA 2BGPA 3A22A 3K75B 1JHJA 3NJXA 1OF3A 2QQOA 1IQDC 4M4PA 4A44A 3VDBA 2WUHA 1JZ3A 1LNSA 4RN5A 3WF4A 5JXJA 1UXZA 3HNYM 2DDUA 3LEKA 4AAXA 2V5DA 2WQ8A 1UYXA 1GOFA 3BN6A 4W50A 4DUVA 4DXSA 1TVGA 3AC0A 3IB3A 5J1XA 3C7FA 4CUBA 4ZZ5A 2WO2A 3ABZA 3ACIA 1MPXA 1NKGA 2YB7A 3DYOA 1K45A 2YG0A 3I97A 4LPLA 2WZEA 3WNMA 4XURA 1W99A 4OZOA 3ACFA 2VMCA 4A4AA 4AG4A 4QX3A 3A23A 4GZ9A 1GU3A 1NAEA 4FI9A 2Z4FA 5LA0A 4QAWA 5G04L 3WF0A 5IHRA 5JUVA 4KMQA 1CX1A 1JZ5A 2VMDA 1I5PA 1XNAA 3WNKA 5C71A 3IDAA 4A6OA 4BXSV 2VZUA 2DCKA 2QQKA 4W4ZA 2X10A 1UY3A 1CZSA 5FUIA 2KD7A 2QQJA 2C9KA 2YC2A 3SKJE 3OGRA 1D7PM 1WCQA 2B9VA 2Y64A 3EYPA 1NX9A 4A3ZA 2V4VA 3CQOA 2VZQA 2W91A 1JYVA 3FL7A 2Y6HA 4CU7A 3CMGA 1UX7A 2RV9A 2QQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SKV A;  2CDP A;  2VR4 A;  4DEV A;  3PUI A;  2JE8 A;  2BGO A;  1O8P A;  3GXU A;  4CUC A;  2ZEZ A;  1UYZ A;  3CZU A;  3C7O A;  3GM8 A;  4MO3 M;  3K77 A;  5JR2 A;  2E31 A;  3NQH A;  1PMJ X;  4JKM A;  2VCA A;  3THC A;  2JDA A;  3III A;  1GOH A;  1R64 A;  3CKH A;  2EIC A;  3HN3 A;  3GDB A;  4PF1 A;  1H6X A;  1P8J A;  3JXS A;  1DLC A;  2WO3 A;  3WSO A;  2XQX A;  1UMH A;  4BDV B;  4P02 B;  4TTG A;  3WEZ A;  3A21 A;  2W92 A;  2L9L A;  2VJX A;  4BJ0 A;  2J1A A;  2J1R A;  1JZ4 A;  2ZEY A;  3I2J A;  3VD3 A;  3DYP A;  3WNL A;  1TG7 A;  4UAP A;  3WNO A;  3C7G A;  1K42 A;  1GMM A;  4MAD A;  3K46 A;  4QDS A;  1JU4 A;  1PX4 A;  4BK4 A;  2WAO A;  1JYW A;  4W8J A;  2HLE A;  1L7Q A;  2B4K A;  1UY1 A;  4JKL A;  5IYY A;  3K4Z A;  2VMF A;  2JKX A;  3A7Q A;  3E1F 1;  2VQT A;  1JZ2 A;  2LW8 A;  2CDO A;  3J7H A;  2Y6J A;  4OUE A;  5HXM A;  3ACH A;  3HEI A;  2VZR A;  4MGQ A;  3I3B A;  4A42 A;  5EJ1 B;  3VDA A;  4GWJ A;  5LCW L;  3MV1 1;  1W9W A;  2EIE A;  3P1I A;  4D8M A;  4PQQ A;  2W1U A;  1KEX A;  2Y6K A;  1GQP A;  1PX3 A;  4QDR A;  4KWU A;  3MBW A;  4IUG A;  4XVH A;  2W95 A;  1W8O A;  4QX1 A;  3DYM A;  3MO4 A;  1UWW A;  4CU8 A;  1OD3 A;  1J83 A;  3WF2 A;  3I3E A;  3ZM8 A;  1JI6 A;  1JU3 A;  3P6B A;  4UI9 L;  4HG6 B;  2VC9 A;  2W1Q A;  1ULO A;  5IFP A;  3OB8 A;  1KGY A;  2VZS A;  2XHN A;  2W1W A;  1W9S A;  3OGS A;  2VL4 A;  1JYX A;  3OEA A;  1HN1 A;  4QDQ A;  3T2O A;  5IFT A;  4DEQ A;  2BBA A;  3T08 A;  5G05 L;  2W9X A;  2ZXQ A;  1EUU A;  3DEC A;  3LEI A;  3T0A A;  2Y8K A;  2VME A;  2ID4 A;  4BK5 A;  3C7H A;  2WDB A;  5DN2 A;  4A41 A;  2VTF A;  5LA1 A;  3UES A;  2QQL A;  2RVA A;  1OT5 A;  1GNY A;  2ZEW A;  3VD7 A;  2X05 A;  1CZT A;  5B4X A;  4ZY9 A;  1UY4 A;  2W1S A;  3HNM A;  3OBA A;  3WF1 A;  3THD A;  4DXR A;  4ARY A;  1RYY A;  1K3I A;  2BER A;  3WNP A;  1UXX X;  2YFZ A;  3CDZ B;  2VM9 A;  1W9T A;  3K4A A;  1K12 A;  2VQU A;  1W0N A;  1L7R A;  2OKX A;  3HPN A;  3WF3 A;  3T2P A;  1F4A A;  3FHA A;  1UMI A;  5B4N A;  2J7M A;  5C7G A;  4QPW A;  4OYU A;  1XPW A;  5F7U A;  1SG3 A;  2DCJ A;  2EIB A;  2PQS A;  2E32 A;  5LA2 A;  2QQN A;  2VOT A;  3OEB A;  2J1U A;  3I2H A;  4TXW A;  3D3A A;  3MUZ 1;  5IJR A;  5EIY B;  2VO5 A;  3LPF A;  4YPJ A;  4Z2A A;  2WBK A;  4XUT A;  2Y6L A;  4ET7 A;  2XOM A;  3MV0 1;  4ZXE A;  5DPN A;  3HOB A;  1DP0 A;  2R7E B;  1CIY A;  3F2Z A;  4E8D A;  2WAA A;  2C26 A;  1OH4 A;  4E8C A;  1J84 A;  3FN9 A;  1T2X A;  4OMC A;  2ZEX A;  1US3 A;  4A45 A;  4XUQ A;  1W8N A;  4GWI A;  5C70 A;  4P08 A;  3ETP A;  4M4R A;  1PMH X;  3I2G A;  3UNP A;  3T0B A;  4DUX A;  2WN2 A;  4QB6 A;  3VD4 A;  4LQR A;  3I3D A;  2W87 A;  1SDD B;  2QBX A;  2WN3 A;  1UY2 A;  3GGL A;  3W5M A;  2J22 A;  2J1V A;  2VCB A;  2RJ2 A;  4ARX A;  3T2Q A;  3U37 A;  3K4D A;  5EJZ B;  2VZT A;  4QB2 A;  3WNN A;  2WYS A;  4LKS A;  2ORX A;  5A1A A;  1WKY A;  3T09 A;  4CU6 A;  1CZV A;  2W5F A;  3UET A;  4KI5 M;  2YC4 A;  1OF4 A;  4P00 B;  2BZD A;  4QX0 A;  3NRU A;  2W47 A;  1GOG A;  2Y6G A;  2J1S A;  1DYO A;  3BGA A;  3LE0 A;  3WQB A;  2HYX A;  1ULP A;  1NUK A;  3ACG A;  2J1T A;  2X09 A;  4CVU A;  4XZU G;  1EUT A;  3HNB M;  3C8X A;  3MUY 1;  2LS6 A;  4OMD A;  4ZZ8 A;  1UZ0 A;  3OGV A;  1SHW B;  1JZ8 A;  3NNG A;  3SEP A;  1UY0 A;  2WO1 A;  3FHQ A;  2E26 A;  4DXT A;  5JMO A;  3IAP A;  4DUW A;  4JKK A;  4XUN A;  3CZJ A;  1H6Y A;  2W3J A;  4UOJ A;  3VD5 A;  5CYY A;  4JX0 A;  4PT6 A;  4QB1 A;  3I2K A;  3C7E A;  3HJR A;  3LEG A;  5CZK A;  3NJV A;  1F4H A;  4MGS A;  2VCC A;  4JHZ A;  2WAB A;  1BHG A;  3LQC A;  1JZ7 A;  4P5Y A;  4LHS A;  3VDC A;  1JZ6 A;  3OG2 A;  2E33 A;  4CUA A;  1O59 A;  2VZO A;  5DQ0 A;  3I2F A;  3VD9 A;  4QX2 A;  5I0D A;  4RYD A;  3EB7 A;  5HPO A;  2ORZ A;  1XC6 A;  5DMY A;  4L0P A;  4XUO A;  2WZ8 A;  1YQ2 A;  2J1E A;  4XUP A;  3ECQ A;  2VZ3 A;  2EID A;  2VZP A;  3PUH A;  4CU9 A;  3I2I A;  1O8S A;  2W46 A;  4D0Q A;  1XNT A;  2JD9 A;  3W5N A;  1UYY A;  2V72 A;  3T0D A;  2W94 A;  1JYN A;  5JXH A;  1GUI A;  5JXG A;  2C4X A;  2YFU A;  2QQM A;  3LPG A;  2XON A;  4MOA A;  2VZ1 A;  3SEE A;  3CIH A;  5JXI A;  2VZV A;  1US2 A;  3IAQ A;  2BGP A;  3A22 A;  3K75 B;  1JHJ A;  3NJX A;  1OF3 A;  2QQO A;  1IQD C;  4M4P A;  4A44 A;  3VDB A;  2WUH A;  1JZ3 A;  1LNS A;  4RN5 A;  3WF4 A;  5JXJ A;  1UXZ A;  3HNY M;  2DDU A;  3LEK A;  4AAX A;  2V5D A;  2WQ8 A;  1UYX A;  1GOF A;  3BN6 A;  4W50 A;  4DUV A;  4DXS A;  1TVG A;  3AC0 A;  3IB3 A;  5J1X A;  3C7F A;  4CUB A;  4ZZ5 A;  2WO2 A;  3ABZ A;  3ACI A;  1MPX A;  1NKG A;  2YB7 A;  3DYO A;  1K45 A;  2YG0 A;  3I97 A;  4LPL A;  2WZE A;  3WNM A;  4XUR A;  1W99 A;  4OZO A;  3ACF A;  2VMC A;  4A4A A;  4AG4 A;  4QX3 A;  3A23 A;  4GZ9 A;  1GU3 A;  1NAE A;  4FI9 A;  2Z4F A;  5LA0 A;  4QAW A;  5G04 L;  3WF0 A;  5IHR A;  5JUV A;  4KMQ A;  1CX1 A;  1JZ5 A;  2VMD A;  1I5P A;  1XNA A;  3WNK A;  5C71 A;  3IDA A;  4A6O A;  4BXS V;  2VZU A;  2DCK A;  2QQK A;  4W4Z A;  2X10 A;  1UY3 A;  1CZS A;  5FUI A;  2KD7 A;  2QQJ A;  2C9K A;  2YC2 A;  3SKJ E;  3OGR A;  1D7P M;  1WCQ A;  2B9V A;  2Y64 A;  3EYP A;  1NX9 A;  4A3Z A;  2V4V A;  3CQO A;  2VZQ A;  2W91 A;  1JYV A;  3FL7 A;  2Y6H A;  4CU7 A;  3CMG A;  1UX7 A;  2RV9 A;  2QQI A; 
#chains in the Genus database with same CATH topology
 1HB4 A;  2CDP A;  1FPN 2;  3OBR A;  3PUI A;  5B2G B;  5I8S A;  1FYU A;  1DGW X;  3DGT A;  3WDT A;  1O3Q A;  2ZEZ A;  1UYZ A;  5FXX A;  3U75 A;  3V0B B;  2MPF A;  1W0O A;  5E89 A;  5A7S A;  1ND3 A;  5IVC A;  3OUJ A;  1OD5 A;  3W58 A;  4I01 A;  2FDI A;  3DPR A;  1W8T A;  3WZ1 A;  1VBB 2;  3X29 B;  3FUO A;  3V64 A;  4LBO A;  3GCX A;  5D2A A;  2BNN A;  2JDA A;  1DF0 A;  3ZN4 A;  1VBA 2;  2ZZQ A;  3V65 A;  1GOH A;  3POJ A;  2FBE A;  2JX9 A;  3HN3 A;  1H2L A;  3GDB A;  4YZ3 A;  5LK5 A;  1LGN A;  1BXH A;  2ATF A;  3N7K A;  2PHF A;  4TSV A;  5I93 A;  3NV1 A;  2EVX A;  5FMO S;  3TEZ A;  2PAE A;  5FXW A;  2A73 B;  4CCC A;  2WLP A;  1WCK A;  3ZFE A;  5LZ6 A;  5IVE A;  2IFR A;  1NXM A;  2GC1 A;  1GZT A;  4XFC A;  4AXO A;  4BDV B;  2RS5 1;  5FYY A;  1RGS A;  3GZT B;  1RUE 3;  3N9L A;  3WEZ A;  2VJX A;  1SLB A;  4IE5 A;  5FZD A;  5A3P A;  1GZ9 A;  3ZXK A;  1VIW B;  4CCN A;  1ZZC A;  2B7Y A;  3ITQ A;  5FP7 A;  5HV0 A;  1DZR A;  1VRH 1;  2GMP A;  2WYF A;  4YW4 A;  3Q8E A;  3LDB A;  3FBY A;  1AHS A;  1PM7 A;  1J3Q A;  1OOP A;  1LCL A;  2XG3 A;  3U78 A;  2UY8 A;  1HRI 3;  1V6O A;  4NWV A;  2QDR A;  1BK0 A;  2WNE A;  4R9A A;  5FY7 A;  2ZGL A;  3WNO A;  4XHX A;  1K42 A;  3WHT A;  4L99 A;  2B45 X;  2EAL A;  2GME A;  3LD8 A;  4MX3 A;  4UW6 A;  1QQP 2;  4PIX A;  4XAA A;  5DDJ 2;  3M7A A;  1JU4 A;  1O5L A;  2DFB A;  4CDX B;  2JDU A;  3FBM A;  2GP3 A;  4Q4V 1;  2HLE A;  4WM8 C;  3RWN A;  4HFS A;  5L36 A;  1JOB A;  5FO8 B;  2GH8 A;  2XJT A;  2FMY A;  2VMF A;  3DEM A;  4NII A;  3ZXD A;  1F2N A;  3PIG A;  5ANQ A;  5FZI A;  3E1F 1;  2QNK A;  1ZRF A;  3PIJ A;  4JAA A;  4BQ4 A;  3KQ4 B;  1WCS A;  2A6X A;  4HZF A;  4IV1 A;  4ATE A;  4C0H A;  5C8W A;  3I2D A;  4DRR A;  3IDC B;  5AC9 3;  4NUB A;  1CWP A;  2WQ4 A;  1ND2 C;  1Y4W A;  2Y6J A;  2AC1 A;  2D5F A;  1V0A A;  1WD4 A;  2AH2 A;  5DUX A;  1XNC A;  1OVP A;  1PVC 1;  4A42 A;  1UPI A;  4GWJ A;  5LCW L;  2A3X A;  4GD4 A;  5FLJ A;  1AR6 3;  3H1Y A;  4Q8K A;  2VNG A;  3IPV A;  1NY7 2;  5T55 A;  4Q4Y 3;  1C8N A;  1UZW A;  2JDN A;  1EV1 2;  4PLM A;  2Y6K A;  4N9I A;  4UF0 B;  3BVC A;  1PX3 A;  3QLQ A;  4QDR A;  1JH5 A;  3MBW A;  3R05 A;  4IUG A;  1FNZ A;  3NNL A;  4F7Z A;  3VD7 A;  5CA6 A;  1H8T B;  1QOO A;  2DV9 A;  2LUW A;  3MO4 A;  3VBU C;  1ODN A;  5FYH A;  5D8A A;  3NNM A;  1RUF 2;  4JDM A;  1VR3 A;  2R6Q A;  1H1M A;  1QJX 3;  2VQ0 A;  1XB9 A;  3ZM8 A;  4XBL A;  1JI6 A;  4FQ4 A;  3AVR A;  1XE7 A;  1AR9 1;  2P17 A;  4B4Q A;  1ZM1 A;  1QJY 1;  2BYV E;  4B29 A;  1PO1 1;  1ULE A;  1LOE A;  3U0Z A;  2JE7 A;  2XHN A;  2WNV A;  2XBO 1;  1OA3 A;  4XTP A;  4D7S A;  3N7J A;  2XH6 A;  1JYX A;  5L9V A;  2PLV 2;  1YIF A;  5LB6 A;  3ZYF A;  3ILF A;  4DFS A;  3VKF C;  2TUN A;  5HCB A;  5KBF A;  4KG0 A;  4S2F A;  2BBA A;  2CAV A;  1GP4 A;  5H9R A;  3T08 A;  1H4H A;  2DCZ A;  3POB A;  3O0X A;  4AYU A;  3B93 A;  4K20 A;  3T0A A;  1DGW A;  2MEV 1;  1COV 1;  2Y8K A;  2CL2 A;  4BK5 A;  1QJU 3;  2ID4 A;  3M3E A;  3AZX A;  3O1P A;  2VTF A;  4NAM A;  4XIK A;  1U5X A;  4KGQ A;  1AR7 2;  2VW2 A;  2WWU A;  1ZRR A;  1JYC A;  3MW4 A;  2K0G A;  2NMN A;  3NL1 A;  2QTW B;  1GNY A;  2VUJ A;  2LRO A;  2QKD A;  4RR3 A;  1VBC 1;  2QQU A;  4BA6 A;  3ZSJ A;  4XYX A;  4YYO A;  1S2B A;  3SHR A;  1HQL A;  1UY4 A;  4IEX A;  4FAG A;  1RUJ 1;  3HNM A;  4NN0 A;  3WF1 A;  4JGY A;  1NCQ B;  3JQW A;  5H9P A;  3ZYI B;  2DVG A;  3ZIW A;  5HCH A;  5FY1 A;  4EE2 A;  5GZG A;  1XND A;  4GUL A;  2WZR 2;  3WNP A;  1UXX X;  3QH6 A;  2HWB 2;  4CDQ A;  1IS5 A;  4MV2 A;  3E6B A;  5C6C A;  3CDZ B;  2VM9 A;  3AB0 A;  2NLR A;  2CGP A;  4R9B A;  3IIA A;  5T50 A;  3VHN A;  4LOS A;  1IS6 A;  1STM A;  2D6M A;  2GC2 A;  2GH2 A;  4BZ4 A;  3HQR A;  2PHU A;  3E5U A;  3DCQ A;  2OKX A;  3O0V A;  3ZFF C;  4Y3O A;  2FHR A;  1ZVF A;  5C3Q A;  5CFC B;  2OS2 A;  5B4N A;  3RMX A;  4UFM A;  2WNU B;  3POE A;  3O1S A;  3NNF A;  4LBL A;  1YYN A;  1H9P A;  3GYD A;  1QXR A;  4GWM A;  4QXB A;  1VBE 3;  5IVJ A;  2ADD A;  1JOJ A;  4IND A;  4OYU A;  4WM8 B;  1WGP A;  4CPB A;  2BUK A;  4P9Y A;  5F9T A;  4E4Z A;  1VRH 2;  2BVB A;  3R4D B;  2E32 A;  1AYM 2;  1QEX A;  1WMF A;  2ET7 A;  4NHK A;  4K6B A;  3RNS A;  1TMF 3;  3NAP C;  3I2H A;  1Q3E A;  4DXZ A;  1DCS A;  2X5I C;  1RUO A;  3N9M A;  1TNR A;  1ASJ 3;  4XDP A;  4RS5 B;  4XJZ A;  4FFF A;  4IL7 A;  1A34 A;  1JN2 P;  3ENR A;  5EXO A;  1AJO A;  5EIY B;  1F5F A;  1OKQ A;  2VO5 A;  3KLS A;  5F2S A;  1KDM A;  1QGL A;  5FQ0 B;  3RDI A;  5ABJ B;  2WSU A;  3TYJ A;  2G1M A;  5I8Y A;  3A4U A;  2VMI A;  3KQR A;  3WNX A;  2E7A A;  3AYC A;  4QKN A;  5BNN B;  4LR4 A;  2ZTN A;  4Q4V 2;  2GNM A;  3HOB A;  1LHO A;  4LO6 B;  4S2G A;  1QJE A;  4AVT A;  4E8D A;  4QKF A;  4M01 A;  2PAK A;  1VMJ A;  1OH4 A;  5CNA A;  2XQR A;  4P9I A;  3VZM A;  3FN9 A;  1MS9 A;  5FY4 A;  4ERO A;  1W39 A;  4GJY A;  4Z1V A;  3ZPO A;  1NZC A;  5F3C A;  1UOJ A;  4Y20 A;  3PUA A;  4BQ3 A;  2GU9 A;  2JDM A;  3JD7 1;  1VMF A;  4CDX A;  2JDK A;  2QQP A;  4QPY A;  2ZBJ A;  5IAX A;  3OUH A;  4GWI A;  1RUG 1;  4B7K A;  1ACC A;  4BMB A;  3RZH A;  1PZ8 A;  2WKK A;  4M4R A;  4Q1P A;  2A70 A;  3JUU A;  4RGG A;  1KD7 A;  3FFQ A;  2PHT A;  5FJK A;  3VD4 A;  1PVC 2;  4X8N A;  1GFF 2;  5C3S A;  4LQR A;  4HOO A;  3KHC A;  1VPH A;  5A3N A;  2W87 A;  4WVZ A;  3FX3 A;  3GGL A;  4M3C E;  4FPK A;  3W5M A;  2Q8O A;  3FUQ A;  3GF6 A;  1CN1 A;  1M06 G;  5DAX A;  2RJ2 A;  2NMO A;  5J98 B;  2FCU A;  5GAL A;  4ARX A;  2FDH A;  3K4D A;  2WA3 A;  1E5S A;  5EJZ B;  3N3H A;  3WNN A;  1HXS 2;  5LRR A;  3EJK A;  4XCA A;  3U4S A;  2Q8D A;  2ORX A;  5I0R A;  2JIG A;  5C33 A;  2ZZJ A;  3T09 A;  3ZFG C;  4IET A;  1YFY A;  1O5U A;  1ULC A;  3D82 A;  2VD7 A;  3N35 A;  1PO2 3;  4HET A;  3HAG A;  3UET A;  1SBE A;  2H6B A;  4UF0 A;  1OSG A;  2DVB A;  2D6K A;  4BHP A;  4Y22 B;  3RZL A;  3W20 A;  1VB4 A;  1VBD 3;  3K3O A;  1PO1 2;  2UU8 A;  3WW2 A;  1MS8 A;  1H8T A;  5FZO A;  4MGI E;  3OPW A;  2Z69 A;  2C0Z A;  3ZOI A;  3LKJ A;  4YW1 A;  4MGT A;  1MEC 2;  2J1T A;  3POI A;  4CVU A;  2XKO A;  1YEW A;  3C8X A;  5A1L A;  1QJF A;  4N7I A;  3W21 A;  4OI4 A;  1L3J A;  1RUE 1;  1WW6 A;  5FZL A;  3U11 A;  4OMD A;  4ZZ8 A;  2DTY A;  1B35 B;  5FJH A;  1V00 A;  5IVV A;  5C3O A;  1WW7 A;  5T5P A;  2UUR A;  3OGV A;  5F32 A;  2MEV 2;  1COV 2;  3NNG A;  4RHV 3;  1I5Z A;  2TNF A;  3K51 A;  3O12 A;  1WW4 A;  2HEY F;  3ZDV A;  3WVJ A;  2XWB B;  1HRI 1;  1RUI 3;  3ASI A;  3I3M A;  4XJU A;  4IGO A;  2CNA A;  5LY1 A;  4DY3 A;  3WDU A;  5L19 A;  3MGU A;  2YMZ A;  3CZJ A;  4AHZ A;  3DV8 A;  4H3W A;  3MF6 A;  1VBC 2;  3WCS A;  3ZFF B;  4PT6 A;  2QZ3 A;  1UIJ A;  1ZRI A;  4AQ6 A;  3ROU A;  3MLK A;  1CAX B;  2PHX A;  3I2K A;  1HB2 A;  3C7E A;  3HJR A;  1S2E A;  5GKA C;  3UGF A;  1ND3 C;  1BJQ A;  2RHP A;  2Q8E A;  4MGS A;  4M00 A;  4XFB A;  3DPR C;  1AXY A;  1LEN A;  2VUC A;  4QX7 A;  5GLT A;  3LB9 A;  1BHG A;  2VTX J;  1ST8 A;  1O7F A;  1F31 A;  1HRV 3;  4XCB A;  1MS5 A;  1W3V A;  5CAD A;  1IG3 A;  3S6P A;  3NST A;  5AC9 1;  5CB7 A;  1NCQ A;  5FMB A;  4OHY A;  1O59 A;  3NAP B;  3MW2 A;  1CAW B;  5DQ0 A;  3VV1 A;  4IER A;  3VD9 A;  5I0D A;  4FFH A;  2EXH A;  1J3P A;  4X6Q B;  1LRH A;  2GC3 A;  2ORZ A;  3ZFE C;  1GWM A;  3OOX A;  4BQ2 A;  4XUO A;  1MZF A;  4OVE A;  3E5X A;  3U4X A;  2GAU A;  4XUP A;  1RJ7 A;  2VZ3 A;  2EID A;  3SH4 A;  3OD4 A;  2VZP A;  1AR6 1;  3RYK A;  4CU9 A;  4XF0 A;  3I2I A;  1S55 A;  2P37 A;  2WT1 A;  4OI2 A;  2W46 A;  4Q4Y 1;  4S2H A;  4CP9 B;  5FZ4 A;  5J3U A;  1FAT A;  2Z42 A;  2JD9 A;  3RMY A;  3W5N A;  3LFI A;  5CFC A;  1XOY A;  3J7M A;  1OOP C;  1NQJ A;  1WLD A;  2WNU A;  4QM9 A;  2OQ7 A;  1JYN A;  1ZZ7 A;  1EY2 A;  5T5J A;  1QU0 A;  2C6S A;  2I2S A;  2WO7 A;  2QQM A;  1BBT 2;  3JCI A;  2XON A;  4MOA A;  2JB4 A;  2VZ1 A;  1QJX 1;  4M0N A;  3CIH A;  2W0X A;  3VBH B;  5I0S A;  5JXI A;  1O4Z A;  3PTR B;  3IAQ A;  4ITC A;  5F5I A;  3A22 A;  5FZ9 A;  4RD7 A;  5FP4 A;  1G9A A;  4KWK A;  1UOG A;  2XJP A;  1IS4 A;  1JHJ A;  3VDB A;  2XXZ A;  4A44 A;  2P34 A;  1ENQ A;  4RS5 A;  3WUD A;  3DUI A;  4COU A;  1YHF A;  4QPG B;  1UXZ A;  4ZON A;  1LHV A;  4ATF A;  3TN9 3;  2RR1 3;  1DQ2 A;  2V5Y A;  2ZX1 A;  3AYA A;  1GSL A;  3HNY M;  3OPT A;  3HR9 A;  5FQ0 A;  5ABJ A;  5LA9 A;  4MGZ E;  2WC2 A;  3LSD A;  4IV1 C;  4WVW A;  4JV4 A;  5BNN A;  3TEX A;  2JIJ A;  1OVS A;  3JD7 2;  4CCO A;  4DNY A;  2P6C A;  4MYE A;  5ANN A;  5FYZ A;  4BIS A;  5BNP B;  3RQ0 A;  3FHI B;  3L9J T;  4K3U A;  1QDO A;  2ZHL A;  4Y24 A;  5K0U A;  3VZL A;  5IVF A;  1I6X A;  1QJU 1;  1I3H A;  2XDV A;  5DG1 A;  2VPV A;  5FZ7 A;  4E2Q A;  3C7F A;  4XQW A;  4CUB A;  1FXZ A;  3KF5 A;  2VMH A;  5FKB A;  5FKC A;  5EP9 A;  1ZA7 A;  4PJY A;  3Q8C A;  2NQY A;  3ACI A;  2YB7 A;  3KV4 A;  3O14 A;  1XSR A;  3R0R A;  1DG6 A;  1AXK A;  4AED A;  2WT0 A;  2WIN B;  1PGW 2;  2VOV A;  2YU1 A;  4WZC A;  3M3Q A;  1NOV A;  4QWN A;  4AVB A;  1LEM A;  1LAJ A;  3AL5 A;  1YFU A;  2OZJ A;  1QNW A;  3MIF A;  4QX3 A;  4ZU4 A;  4AG4 A;  2VCM A;  5KXB A;  2VXR A;  5D8A C;  3LAG A;  4ASM B;  5JSO A;  4KMQ A;  3KT4 A;  5BUV A;  2XL7 A;  3DXU A;  4A6O A;  4XC9 A;  2VZU A;  2ILM A;  4Q2F A;  2WNV C;  4FFG A;  1W6N B;  5A3O A;  1U12 A;  2QQK A;  4W4Z A;  4Y5S A;  4Z8B A;  2ARX A;  3DKW A;  1C8M 3;  5FZF A;  4BIO A;  2YC2 A;  3HBK A;  3NV2 A;  2R32 A;  3LA7 A;  1W8F A;  4HK8 A;  4Y22 A;  2D6O X;  2Y64 A;  3EYP A;  4JTN A;  4X6R B;  1RUE 2;  4WVV A;  3CQO A;  5JZG B;  1VBE 1;  2IFW A;  2EXJ A;  1AR8 3;  2MNG A;  3IT8 A;  3IKW A;  4Y1V A;  3SLI A;  1U0A A;  5EYX A;  1JHN A;  3B02 A;  5HCA A;  3WG1 A;  1W2N A;  1YNA A;  3DPR B;  1R1A 3;  2D43 A;  1REE A;  2XKP A;  4N43 A;  3RZK A;  2BV4 A;  5FYT A;  3UL2 A;  1TMF 1;  1YFX A;  1GIC A;  3RJR A;  3THP A;  3VBR B;  1W6P A;  1B35 A;  1ASJ 1;  4QMA A;  3S7E A;  2RG4 A;  5EPA A;  4E4S A;  3AKS A;  4EJR A;  4LBQ D;  1ULF A;  1BKZ A;  4RR3 C;  3JU9 A;  1WA6 X;  4YM0 A;  2DYC A;  1QH6 A;  3CZU A;  5FXZ A;  3I2O A;  4JTO A;  1MQT B;  2ZAA A;  4MO3 M;  4MXV A;  3SIT A;  2C5D A;  4NIH A;  3FE5 A;  1DZT A;  3H9A A;  1NCR C;  3M1H A;  5FYU A;  4COV A;  5I8T A;  2ADE A;  1MVE A;  4IGP A;  4JGY C;  2YDE A;  1QHD A;  1Z7S 3;  5CG9 A;  4EYU A;  3AP7 A;  4LUM A;  4J1W A;  3B01 A;  3SMH A;  4V1P A;  3W9A A;  4CDQ C;  3III A;  5ACA 2;  3GBF A;  3AYE A;  4BXF A;  3BKZ A;  3MFC A;  4XJW A;  4XXP A;  2EIC A;  2PFW A;  3WQ7 A;  1CAX A;  1TME 3;  5F3E A;  3NO8 A;  3WHU A;  2DVA A;  4DMI A;  4TN7 A;  1H6X A;  3JXS A;  5C8C A;  2XML A;  4O7X A;  4XDO A;  2AZ5 A;  2JIC A;  3POW A;  2GP5 A;  4XFG A;  1SLA A;  1JOD A;  3PUS A;  5FYC A;  1LGB A;  2VUD A;  4ZKT B;  3WD5 A;  2WS9 3;  4P02 B;  4TTG A;  2YPJ A;  3A21 A;  2L9L A;  3S7I A;  2R0H A;  5CU1 A;  2RJK A;  4EWD A;  2JG9 B;  1H9W A;  4V2W A;  3O0W A;  2ZHM A;  3DF0 A;  1AR6 2;  2ZA9 A;  1CAW A;  3NKT A;  2ZEY A;  3MZH A;  2JDP A;  2PN5 A;  4FOW A;  2X8K A;  3DYP A;  2O14 A;  1G9D A;  1L7L A;  2RE9 A;  4B1L A;  5DAP A;  4EQV A;  3J8F 3;  3UJQ A;  1QXJ A;  1HV0 A;  3HQX A;  5EWS A;  2O0O A;  4UT5 A;  4FOY A;  1PO2 1;  3TRS B;  2BJS A;  2VNO A;  4I0B A;  4UXA A;  1Q8Q A;  1DYP A;  3RSJ A;  3ZR5 A;  3K46 A;  4QDS A;  1PX4 A;  2BW8 A;  4WV8 A;  3RZJ A;  1JYW A;  3VUO A;  1A6C A;  5FUN A;  1W05 A;  1VBD 1;  2WFF 3;  4JKL A;  1AVB A;  4MXW B;  5FDB A;  4QGL A;  1POV 3;  1VLN A;  1S1A A;  3IPV B;  1IHM A;  4Y1U A;  4YZ5 A;  4Q4X 3;  4K8R B;  1SFP A;  4CDX C;  1IPS A;  2LW8 A;  1OQD A;  2DVD A;  4P5H A;  5DAW A;  3MPB A;  4OHW A;  4AF9 A;  4QPG A;  5HXM A;  2P3I A;  1BYH A;  1EPW A;  3ACH A;  3HEI A;  2VZR A;  4GMP 0;  4MGQ A;  1GLH A;  1QJU 2;  1FX5 A;  4PI0 A;  4RHV 1;  5D8A B;  5EJ1 B;  4AGV A;  4DPN A;  1QOS A;  1D0H A;  1TE1 B;  2JEC A;  4DB5 A;  5E1R A;  1RUI 1;  3WX5 A;  1LOA A;  3MV1 1;  2X53 S;  2D97 A;  2BWA A;  1N1S A;  4I02 A;  3WUC A;  4PLN A;  4D94 A;  5FPA A;  1N3Q A;  2W1U A;  4J1X A;  1XSQ A;  1KEX A;  2OUH A;  4K1Y A;  4NAO A;  5FZH A;  5BNP A;  3AMQ A;  1Y9Q A;  1ZX5 A;  3ZIX A;  2QVS B;  2VW1 A;  2VTX A;  2E7Q A;  2VEC A;  3VL9 A;  1O6U A;  2ENR A;  2HWF 3;  3GJB A;  5F3G A;  1W8O A;  2VMG A;  3HMY A;  1F9K A;  4YVS B;  1UWW A;  5CBL A;  2K46 A;  5A80 A;  3R6S A;  3HD8 B;  1HDK A;  2JXA A;  2NZ9 A;  3JBG 3;  2R0F A;  4HG6 B;  4UI9 L;  2VC9 A;  2W1Q A;  4O9E A;  1HRV 1;  1ULO A;  1BCX A;  5EFU A;  4NVP A;  3PL0 A;  3U14 A;  4QT6 A;  4LXL A;  1W9S A;  1H8T C;  2H0B A;  4XMA A;  1QKQ A;  3OGS A;  4XMI A;  3UKT A;  3N4M A;  3KS7 A;  1E5R A;  5A7O A;  1O3S A;  1HKD A;  1QIQ A;  2Y0I A;  5BXX A;  3VZJ A;  4B1M A;  4XF9 A;  3CJX A;  1U5I A;  3VLB B;  5G05 L;  3ZDS A;  1GWK A;  1D2Q A;  1FNY A;  1OUS A;  1VBE 2;  3CL1 A;  3LEI A;  1W6N A;  4Y4R A;  3KCY A;  1ENS A;  2RMU 3;  4PBP A;  3AX4 A;  3W59 A;  4XF4 A;  4BM8 A;  2RDS A;  2JEM A;  4JGY B;  2AEY A;  3TAY A;  2UWB A;  1WBL A;  2WDB A;  3C7H A;  5DN2 A;  3USU B;  5FYV A;  3WXP A;  1MAC A;  2OA2 A;  4CDQ B;  1AL0 G;  5LA1 A;  5A7P A;  5JZG A;  3PUR A;  1RUH 3;  1O4Y A;  1TMF 2;  1UW8 A;  1LTE A;  1VAL A;  2CTV A;  2QQL A;  2RVA A;  2YYO A;  1PMI A;  3H42 B;  4JRL A;  3VBO B;  4N53 A;  5F1R A;  4FPY A;  1C57 A;  1GZC A;  3P3N A;  4FO9 A;  3KGZ A;  1AYN 3;  2X05 A;  1CZT A;  1XE8 A;  3CJI B;  1WBF A;  5FPV A;  5B4X A;  4EZ4 A;  4ZY9 A;  5GLZ A;  2E7T A;  1HJG A;  3BIW E;  5IT6 A;  4XFF A;  3VBR A;  4CUG A;  4DXR A;  4ARY A;  1KIT A;  3EBR A;  5FXV A;  1RYY A;  2BER A;  5I91 A;  4CYD A;  1AX0 A;  2YFZ A;  3TN9 1;  2A3W A;  2RR1 1;  3O7O A;  4R9C A;  3K4A A;  2WFP A;  3IWZ A;  3VBS B;  1CX4 A;  2JDH A;  1MQT A;  3D0J A;  4IGQ A;  3ZMO A;  4CDW A;  2WT2 A;  1OQE A;  4WVM A;  1D4V B;  2VQU A;  3ZSL A;  4NPL A;  4JDO A;  4FTS A;  5F39 A;  4NHX A;  1NCQ C;  3SCH A;  3PU3 A;  1F4A A;  1OUX A;  4QU2 A;  3KWV A;  3T2P A;  1D2S A;  3RZG A;  5GLU A;  2VNV A;  2D7F A;  5FZA A;  1OI6 A;  3CU7 A;  2D3R A;  3H8O A;  5E88 A;  1YO8 A;  1CIW A;  1KFU L;  2J7M A;  3LZZ A;  5C7G A;  1POQ A;  4XDQ A;  5FAX A;  4BQ5 A;  5GLW A;  3VGI A;  4H55 A;  5FZM A;  5BNQ A;  5F7U A;  5GZC A;  2DCJ A;  2HWE 3;  5A6Y A;  2EIB A;  1SFN A;  5JSP A;  3R4S A;  5CFC C;  3K3N A;  3MIC A;  4GMP 3;  2QQN A;  2VOT A;  3OEB A;  2WNU C;  3KMH A;  4MZU A;  5LY2 A;  5FPU A;  4TXW A;  2YRO A;  1MZ5 A;  4S2D A;  2JG9 A;  4Y20 B;  4AEM A;  1CVN A;  1YI7 A;  1S2K A;  5GLV A;  4QHB A;  1D0G A;  4YG6 A;  1AUY A;  5C5T A;  1OPM A;  1WUV A;  3IZO A;  3LPF A;  4UYB A;  3ZX7 A;  2F4P A;  1BMV 1;  1K5M A;  1R09 3;  4LKF A;  2RM2 3;  4AOC A;  2UYA A;  4AI9 A;  5FK7 A;  4CDU B;  1U5Z A;  4ET7 A;  4JQT A;  4ZXE A;  3HIF A;  3PVN A;  1VBD 2;  5KC6 A;  1DP0 A;  1MS0 A;  2PHR A;  1CIY A;  1QOT A;  4RS5 C;  4IW3 A;  5FV3 A;  3NW4 A;  5BNO A;  2F4L A;  4AFC A;  4LKE A;  4E8C A;  4PHZ A;  4R52 A;  4Q0V A;  2XR4 A;  1C8M 1;  1W6M B;  1C3H A;  2P1B A;  1QXP A;  1US3 A;  2YXS A;  2ZEX A;  5ABJ C;  4FPH A;  3MDP A;  4XUQ A;  1R08 2;  4FVV A;  5E8A A;  5BNN C;  1GP6 A;  4Q0Q A;  2F17 A;  2IXI A;  4JZR A;  4QGM A;  4P08 A;  1UZZ A;  1YI9 A;  5FWE A;  3N9Q A;  1JYI A;  1AR8 1;  4O61 A;  3I2G A;  3UNP A;  5K0U C;  4MXW A;  5F5Q A;  4DUX A;  4UWD A;  3N9N A;  1R1A 1;  4CXX A;  5H9Q A;  3GHN A;  4FFI A;  3UKV A;  2OZ6 A;  4OHX A;  4XBQ A;  2WA4 A;  1F5J A;  5A1F A;  3LIG A;  2QBX A;  2DU1 A;  2XL9 A;  2KM2 A;  3WQ0 A;  3AZZ A;  1ZBA 3;  5IVB A;  2J1V A;  5JPN B;  4KU7 A;  4CCD A;  4E2G A;  4P9W A;  5FZO B;  4QPI A;  3T2Q A;  3U37 A;  4DIN B;  4AED C;  5HI0 A;  1H2N A;  1W03 A;  2HYK A;  2XPJ A;  1V6M A;  3D8C A;  2WYS A;  2ZAC A;  3WCR A;  4Q1R A;  5CFD B;  3M8L A;  4R4X A;  4IEU A;  2PAM A;  4CU6 A;  5KHG A;  1Z7S 1;  4KI5 M;  5FZG A;  2YC4 A;  3MIE A;  3RYP A;  1C28 A;  1OF4 A;  4LTA A;  1UAI A;  4P00 B;  1W28 A;  1HIX A;  4NWW A;  2VU9 A;  2BZD A;  4YAR A;  1HRV 2;  4YFZ A;  5DUU A;  3T3Y A;  1I9R A;  1TME 1;  1GOG A;  2PHD A;  4OQ9 A;  1FOD 2;  2ETE A;  4YVS A;  2KR2 A;  2YBK A;  5DG2 A;  2WZP P;  4YZ1 A;  1DYO A;  1LGC A;  4Q8L A;  4TLF A;  3WQB A;  4AE2 A;  1ULP A;  2FDK A;  1G8W A;  4AFB A;  2X09 A;  2ZGO A;  4XZU G;  4HVR A;  1EUT A;  3SXW A;  4ES8 A;  4D69 A;  3PTY A;  2WS9 1;  1FV2 A;  1RUN A;  1UZ0 A;  1YC6 1;  3VKL A;  2GC0 A;  4HSJ A;  4LEJ A;  1PVX A;  2TEP A;  3N9P A;  3LF7 A;  5JVV A;  5J37 A;  1VMH A;  3AZY A;  2DBI A;  3SEP A;  4BYY A;  5A3T A;  4HLT A;  4N43 C;  1OLR A;  5IVY A;  3S5Q A;  2E26 A;  3J8F 1;  1B35 C;  4JKK A;  1AZD A;  1WME A;  2W3J A;  5A7W B;  4UOJ A;  1MZ6 A;  3V56 A;  3VD5 A;  1LOG A;  4JX0 A;  4OHV A;  2ZGR A;  4QB1 A;  1QY4 A;  3USU A;  2BU9 A;  5F8P A;  3RWK X;  3LEG A;  5CZK A;  4YZ2 A;  4KL1 A;  3NJV A;  4H14 A;  4ONU A;  2WFF 1;  2Y33 A;  3VBO A;  1JW6 A;  3PUQ A;  2WAB A;  4K21 A;  3LQC A;  4AK3 A;  3CJI A;  3ZR6 A;  3TN9 2;  2RR1 2;  1POV 1;  4P5Y A;  4IE4 A;  4AGR A;  2A6Z A;  1BEV 3;  2I07 B;  3GNE A;  4Q4X 1;  2VVF A;  3VKM A;  3VDC A;  1JZ6 A;  5IK7 A;  1V9U 3;  5FMD A;  2IXK A;  5A3U A;  2QZ2 A;  2E53 A;  4IE0 A;  2VZO A;  5C8C C;  2RS5 2;  1LOF A;  3HT2 A;  3I2F A;  4O65 A;  1LES A;  2ZML A;  2R06 3;  3E6D A;  2YY1 A;  3NJY A;  5HPO A;  1PK6 B;  2R16 A;  1Y7B A;  3VBS A;  1QDC A;  1WA4 A;  2J1E A;  1W8Z A;  4FT8 A;  1JUH A;  1N3O A;  2DUR A;  1URX A;  3PUH A;  1MS3 A;  4XF3 A;  1X8E A;  2R07 3;  1O8S A;  1K5J A;  2WQZ C;  1V6K A;  2C9A A;  1XNT A;  4EN0 A;  1KS4 A;  1NLS A;  4UW4 A;  4ZXK A;  5FPZ A;  1DHK B;  2OW4 A;  2P3K A;  4YW5 A;  2ZGK A;  3AKT A;  2JWP A;  3FLR A;  5A32 B;  4A7Z A;  3T0D A;  1W2A X;  4TYS A;  5LAT A;  1GUI A;  2A75 A;  2HWF 1;  4U36 A;  2YFU A;  1XBF A;  5FZ0 A;  3NMB A;  4I09 A;  1JMU B;  1F8V A;  2D40 A;  3AKP A;  3D0S A;  1ZBE 3;  5I0T A;  4AHW A;  1BMV 2;  5EV7 A;  3JBG 1;  2PHL A;  3UT0 A;  2ZHN A;  1ALY A;  5DAB A;  5K0U B;  3LSE A;  3MHZ A;  3NJX A;  3AMP A;  1IQD C;  5J7M A;  2IXH A;  1JZ3 A;  1PZ9 A;  1LNS A;  4RN5 A;  4BH9 A;  4MGY E;  1X50 A;  1SPP B;  1VBB 3;  4MHU A;  3F95 A;  5T54 A;  3VBH C;  1VRB A;  2YGL A;  3IMM A;  5T3N A;  3VZO A;  3ZMN A;  4AAX A;  4ZS2 A;  2AAC A;  2G9G A;  4GH4 A;  4YZ4 A;  5T5O A;  1UYX A;  3TBD A;  4AED B;  5EYY A;  4CDU A;  1VBA 3;  2E63 A;  3S0M A;  5M0T A;  4W50 A;  2C1F A;  4HBN A;  4K1Z A;  1TVG A;  2RMU 1;  1GKB A;  1H4G A;  4QPG C;  3RZZ A;  4HON A;  3OTF A;  4QX5 A;  1B09 A;  1YLL A;  4C1W A;  1R1A 2;  1W6M A;  4W6W A;  1W8H A;  1SCR A;  2B9U A;  4CCL A;  3VZK A;  4RA0 A;  1REF A;  2WO2 A;  1RUH 1;  1UCX A;  5FZC A;  4AWD A;  2Q5T A;  3JB8 A;  4LA2 A;  2XLF A;  4XBN A;  2CGN A;  3DYO A;  1C1F A;  1K45 A;  5BNP C;  4NPM A;  1AYN 1;  2GSY A;  3I97 A;  4YW7 A;  4E27 A;  2KA3 A;  2WZE A;  2OPW A;  4OZO A;  1XYO A;  2OQ6 A;  3LEM A;  3ACF A;  2VMC A;  4A4A A;  1HB3 A;  5FRA A;  1AR9 2;  4JQR A;  4GZ9 A;  1NXD 1;  1QJY 2;  1Z7S 2;  2IZW A;  5ACA 3;  1HB1 A;  1UU5 A;  3MLL A;  4QAW A;  1YQ6 A;  1GQH A;  2XBO 2;  4UFI A;  4W6X A;  5G04 L;  3WF0 A;  4CPB D;  1I5P A;  1XNA A;  3VKN A;  2W68 A;  1HQW A;  4D7T A;  2D93 A;  2QFE A;  4HKO A;  3C2U A;  1TME 2;  4N43 B;  4Y26 A;  5CFD A;  3ZYH A;  1BVV A;  2ES3 A;  3WDW A;  2X10 A;  5JOY A;  2Q0A A;  1ODM A;  1W6P B;  1S0I A;  1SFY A;  2WL1 A;  2BVV A;  4LIT A;  2IXC A;  4LIV A;  1DGR N;  3HQU A;  4RSU A;  5EZW A;  2AEN A;  2GNT A;  4LLO A;  2QQJ A;  2ZX4 A;  4WBB A;  3SKJ E;  3OGR A;  5JDB A;  5KHI A;  3WV6 A;  1H30 A;  2B9V A;  2WS9 2;  3GBW A;  1NX9 A;  2AYH A;  1V6L A;  5A6Q A;  2V4V A;  1SQ4 A;  2ZAH A;  3VZN A;  5FYB A;  2DF7 A;  3CEW A;  4XJ9 A;  4YM1 A;  4K40 A;  2V73 A;  4LOR A;  2ZGT A;  2HWE 1;  4FQZ A;  1C4R A;  3T4V A;  4CU7 A;  2BNM A;  3BTA A;  4GMP 1;  3M70 A;  4HT1 T;  4IE6 A;  2FDG A;  1Y9G A;  3AFK A;  4CP1 A;  2RV9 A;  3NVC A;  4JC1 A;  5JZG C;  4CTE A;  2NYY A;  1JS9 A;  1PZ7 A;  3SKV A;  2VR4 A;  1RUJ 2;  3WG4 A;  5FOJ B;  1ZRE A;  2JE8 A;  2CYF A;  5FLI A;  2BGO A;  5C8C B;  1FAY A;  2GNB A;  3TOJ A;  1RXF A;  3G6J B;  1R09 1;  1RXG A;  3C7O A;  2RM2 1;  1I1E A;  1ZRC A;  1EV1 3;  1RHI 3;  2CWM A;  3K77 A;  4FXG B;  2Z79 A;  2BNO A;  3EMR A;  1W04 A;  4QQL A;  3D5O A;  2R49 A;  3ETQ A;  5LRS A;  4JKM A;  3VBR C;  1RVF 3;  2YBP A;  2XB6 C;  2VCA A;  4B7E A;  4OQ8 A;  4LK7 A;  3MPP G;  5DAQ A;  3THC A;  4BOW A;  5A7W A;  4JVA A;  2XUM A;  4I3P A;  4MET A;  4BLJ A;  3FFZ A;  4CCE A;  4LHK A;  3WDV A;  1R64 A;  4QM8 A;  4KWL A;  2BDR A;  1MQT C;  2QE3 A;  4CDW C;  4QHO A;  1RL3 A;  1CAU B;  5EJ3 A;  1G9C A;  1JYT A;  4ZS3 A;  1RUC 3;  1JBC A;  2WO3 A;  2A6Y A;  5J09 A;  2XQX A;  2D6P A;  3LOI A;  2VOX A;  1UMH A;  3H3U A;  1BZW A;  4JHT A;  2PLV 3;  3VHR A;  1A8D A;  4NMI A;  4BJ0 A;  5JPM B;  5GJ6 A;  2J1R A;  2VBB A;  3WG3 A;  4B4P A;  1KXG A;  1ZBA 1;  4PBO A;  2IUW A;  4OI0 A;  5HCF A;  3EHK A;  3I2J A;  3FJS A;  2NPI A;  1NA1 B;  1S0D A;  4XJ8 A;  1PK6 A;  1TG7 A;  1NG0 A;  3AP4 A;  3GCW A;  3AKR A;  1N1Y A;  2VBD A;  4AVV A;  2MHF A;  1S0G A;  3OPZ A;  4LBN A;  4UAP A;  5FMC A;  1LKN A;  4FPL A;  3AP6 A;  5IUQ A;  1OLM A;  4OUS A;  2JG9 C;  2VY0 A;  1AR7 3;  5DXD A;  3I54 A;  4PIZ A;  4EN7 B;  3KHB A;  2RJL A;  2XLA A;  3UJO A;  4F83 A;  2Y38 A;  3RI8 A;  3VKO A;  1AX2 A;  2UYB A;  5FWJ A;  1K5M C;  4FPO B;  3NV3 A;  5A32 A;  3JBG 2;  2DU0 A;  4FCA A;  1FMD 3;  1UKG A;  2CSG A;  3J9S A;  1L7Q A;  1OFN A;  2D3P A;  1V70 A;  3MI8 A;  1UY1 A;  5IW0 A;  4E2S A;  4YM3 A;  1QNY A;  2YU2 A;  3PDQ A;  5D21 A;  3K4Z A;  5KC5 A;  1V6I A;  5BNO C;  1Y9M A;  2JKX A;  2VH9 A;  4K8F A;  3A7Q A;  4OUM A;  4XHB A;  3LA2 A;  3I3Q A;  5JWP A;  1RUG 2;  4LNV A;  3ZSE A;  2WZR 3;  2HWB 3;  5FZ3 A;  3Q8F A;  2G4I A;  2CDO A;  4NOT A;  3E6C C;  3J7H A;  3M3O A;  4MVT A;  3OBZ A;  4OUE A;  1CJP A;  2XUE A;  5FIX A;  4NRQ A;  4CCM A;  4Q27 A;  2RMU 2;  1DGR A;  2VBP A;  4Q29 A;  4QX8 A;  2JJ6 A;  1SPP A;  3VDA A;  2EIG A;  4A3X A;  3S57 A;  2VG9 A;  3WLU A;  3NV4 A;  5J48 A;  1QJZ A;  2B8M A;  1BVP 1;  1SLI A;  5KXE A;  5F6L B;  2EIE A;  3P1I A;  1CAV A;  1RUH 2;  4M3C A;  4D8M A;  5F5C A;  2R04 3;  4XW3 A;  1EP0 A;  2QJV A;  2UY9 A;  5FK8 A;  4KU8 A;  2R1B A;  5LBE A;  1A3K A;  1CPN A;  3RG0 A;  1GBG A;  1AYN 2;  3POG A;  5I0U A;  4QPI C;  3RPQ A;  4JGZ B;  4KWU A;  3O1M A;  1POV 0;  1XQN A;  2I74 A;  4XVH A;  2VE1 A;  2W95 A;  2AR6 A;  2ZPX A;  3IDB B;  1AYM 3;  2GAL A;  3JB4 C;  3DYM A;  4QX1 A;  4A2U A;  5C9A A;  1OMI A;  2R1D A;  4KG8 A;  3WF2 A;  2GMM A;  3J7N A;  3MIH A;  4FBF A;  5KXD A;  1HLC A;  2RS1 3;  3AM2 A;  2W52 A;  4LUL A;  4GB3 3;  4BE3 A;  2XJU A;  4QQP A;  1BEV 1;  1KGY A;  4LOT A;  1XXN A;  2VZS A;  1DLL A;  4DQA A;  3WIN E;  4OZX A;  2RDR A;  3RZM A;  1CGP A;  4YVS C;  4BCU A;  1OA4 A;  4AI3 A;  3OEA A;  4M0H A;  4PI2 A;  1X36 A;  2R06 1;  4Q4V 3;  5FY9 A;  2VW0 A;  4CEY B;  4N53 B;  3T2O A;  4RQP A;  3WR0 A;  4EZH A;  1RMU 3;  3VDD A;  2HWD 3;  1Q8V A;  4QXK A;  1V6J A;  4Q4W 3;  4XIO A;  4AI1 A;  2ZXQ A;  1EUU A;  3DEC A;  4HK9 A;  1XU2 A;  4XQ4 A;  1Y3T A;  3JQX A;  1TQ5 A;  2Y60 A;  4BQ1 A;  4GWN A;  1HRI 2;  2R07 1;  2E51 A;  5FZK A;  2VME A;  1J1T A;  2KXL A;  2ZGM A;  3TNQ A;  4AQS A;  3SH3 A;  4XTM A;  2IWG B;  3I7D A;  3I59 A;  4EWA A;  4HN1 A;  3K48 A;  1DQ0 A;  1YQ5 A;  1OT5 A;  4CDW B;  4WVM B;  5BPX A;  2ZEW A;  1RUD 3;  2BOI A;  4LBK A;  2RS3 3;  5FZE A;  4CE8 A;  2Y26 A;  1ZBE 1;  4IEV A;  2BPA 2;  4QXH A;  1ZRD A;  2CAU A;  2RM2 2;  3MIB A;  3BOD A;  4Q0P A;  4ASK A;  4LT5 A;  3OBA A;  1Q5O A;  2I45 A;  2Z2S B;  3THD A;  3J26 N;  1QMJ A;  1HXS 3;  3VBO C;  5EHD A;  4IEY A;  4LLF A;  3H7Y A;  1GV9 A;  2XJQ A;  5BY5 A;  2N7G A;  5AC9 2;  2W08 A;  1PIV 3;  3CJI C;  3O1U A;  1LHN A;  1VBB 1;  2XJV A;  1VB2 A;  3U07 A;  1OKO A;  5SV8 A;  5LAS A;  1GZW B;  1LOC A;  1RIT A;  1VBA 1;  3SH5 A;  3HPN A;  5LBC A;  3WF3 A;  4A6S A;  3LGR A;  1LOF C;  4IE7 A;  1JTZ X;  1UYP A;  1IQA A;  3FHA A;  3Q9O A;  1UMI A;  5AFB A;  1GNH A;  3AVS A;  5L9B A;  1YIP A;  4Z2W A;  5JR7 B;  3VBS C;  4Q4Y 2;  1YFW A;  3BB6 A;  4DOU A;  1K5M B;  1MEC 3;  3H8R A;  4NRM A;  1CAU A;  1W6Q B;  3H1M A;  3BPZ A;  3E97 A;  4G4F A;  4KBB A;  4YG0 A;  5A7N A;  2OVU A;  2VOW A;  3ORJ A;  1ZBA 2;  2VVD A;  3BU7 A;  3LOB A;  2PQS A;  3IN9 A;  3ZN6 A;  5BNO B;  3AL6 A;  4LKD A;  4C90 A;  4NID A;  2MEV 3;  1QF3 A;  1ENR A;  2ZKN A;  1QJX 2;  2ARC A;  1G9F A;  3D3A A;  3OD0 A;  3MUZ 1;  4TLG A;  4PCR A;  1AF9 A;  1M4W A;  5IJR A;  4CCK A;  2PYT A;  1UOF A;  1SEF A;  1O3R A;  4A7Y A;  2X5I A;  3ZYG A;  4EV0 A;  4YPJ A;  3B7M A;  2WBK A;  1NA1 A;  1Q43 A;  1YXW A;  5FBZ A;  5K4L A;  5T5L A;  5IK4 A;  2P3J A;  2JKB A;  3WP3 A;  1O4T A;  2XOM A;  5FO7 B;  5DPN A;  2WWJ A;  2BFU L;  4YGD A;  2R7E B;  1WCD J;  3F2Z A;  2XLG A;  3OY8 B;  4MH0 E;  1T6B X;  4RGK A;  5F37 A;  4I3G A;  3O1R A;  1DYK A;  5A33 B;  3CHX A;  4UW3 A;  4OMC A;  1SLL A;  5JI7 A;  2Q1M A;  4Y4Y A;  3ZYJ B;  4A45 A;  2EAA A;  2QDN A;  2J42 A;  4GH4 C;  4HAN A;  4CDU C;  1ZZ9 A;  4FTE A;  5JOZ A;  3AZW A;  3Q8A A;  5IAT A;  2RDQ A;  4IV3 B;  2IXL A;  4LHN A;  3ATG A;  4KGG A;  3H1W A;  5C3R A;  2HBT A;  3AKQ A;  1NLR A;  3T0B A;  2WN2 A;  4NRP A;  1W8U A;  2QQW A;  4RFT 0;  3I3D A;  5FYM A;  2WN3 A;  4IQP A;  3NKG A;  3ZXE A;  4OLL A;  4CP0 A;  4AAP A;  3M3C A;  2J22 A;  2O1Q A;  3KB5 A;  3A0K A;  4M3C F;  3WW4 A;  2XJR A;  2ZGS A;  1KQR A;  4G9S B;  5LW9 A;  1ONA A;  2WWS A;  1NY7 1;  2O8Q A;  3FWE A;  4PDW B;  4YVW B;  1X9P A;  4QB2 A;  1ZZ8 A;  2DCY A;  5FFO C;  1OLQ A;  1EV1 1;  1RHI 1;  2BTV C;  2ZAB A;  4LKS A;  1NE4 A;  1G6N A;  4LE3 A;  4FPF A;  3MEP A;  4YGE A;  1Q8P A;  4LO8 A;  5JLV A;  4XAB A;  1JOP A;  1RVF 1;  2W5F A;  3DXT A;  3DN7 A;  1VAM A;  1G9B A;  2SBA A;  4HKL A;  3BU0 A;  3L2H A;  1BBT 3;  1NYW A;  4JGZ A;  2WNO A;  1C5H A;  3RS6 A;  4COY A;  3BCW A;  3IDE A;  4B3N A;  1BEV 2;  2W47 A;  4HVO A;  1LUL A;  4ISR A;  4RGA A;  4QKD A;  1YUD A;  2J1S A;  5CFD C;  2D3S A;  3LE0 A;  1RUC 1;  3OYW A;  1APN A;  4WM7 B;  1UQX A;  4Z82 A;  4CZS A;  5C5U A;  3ZKU A;  3S5A A;  4XAE A;  2HYX A;  2HJI A;  1NUK A;  3ACG A;  3GHM A;  2R06 2;  4FPG A;  3WW3 A;  2XHK A;  3BYW A;  3HNB M;  5JSR A;  2PLV 1;  1H2K A;  3HVD A;  2LS6 A;  3MUY 1;  3U1X A;  4CSW A;  1U5Y A;  3H8U A;  4XFI A;  3ZYB A;  1S0C A;  4URA A;  2IXJ A;  4P9J A;  1SHW B;  4C0B A;  4JCK A;  2R07 2;  1JZ8 A;  1MS4 A;  4FPE A;  4R9D A;  4IEO A;  1ASJ 2;  4CEY A;  3KM5 A;  2BOJ A;  4ISQ A;  4CCJ A;  3FHQ A;  3PVE A;  4NE9 A;  5JCT A;  1YRZ A;  2P2K A;  3N36 A;  3HT1 A;  4W65 A;  5F5A A;  3UGH A;  2V4A A;  2VVE A;  4L92 A;  3IAP A;  4Q0S A;  1AJK A;  2DUP A;  3KZ4 C;  4IDZ A;  4XIL A;  5FPL A;  3VN4 A;  1AR7 1;  5A3L A;  1UX6 A;  5FZB A;  1JXN A;  2AUY A;  4DRV A;  1F35 A;  5C4W B;  4UFK A;  5DZE A;  4AQT A;  1FMD 1;  1GP5 A;  1UL9 A;  5FPX A;  1E5I A;  5FRE A;  3BTZ A;  2Y6F A;  4N90 A;  5FBJ A;  5K8S A;  2BRT A;  4P9X A;  3JZV A;  2LAL A;  4NO4 A;  2F6B A;  1JZ7 A;  2LM3 A;  2Q1Z B;  4LHS A;  2WZR 1;  2HWB 1;  3OG2 A;  2E33 A;  4O9G A;  3WY6 A;  1RIN A;  4CUA A;  2FCV A;  3PU8 A;  3THT A;  5JMC A;  1MR5 A;  3RI9 A;  4AEK A;  1XC6 A;  5DMY A;  1YCI A;  4L0P A;  3T1M A;  4FP2 A;  2WZ8 A;  3J4U H;  4DZG A;  1LU2 A;  1YQ2 A;  3H3L A;  3WG2 A;  3ECQ A;  4XZP A;  1N3P A;  5HXV A;  3SCF A;  1GZW A;  1X9T A;  2JB8 A;  4AEJ A;  1WWY A;  1DQ5 A;  2R04 1;  3WP4 A;  4I0A A;  3ACL A;  4GJZ A;  2WJS A;  4Z92 B;  4QHZ A;  1UYY A;  2V72 A;  4AVA A;  4EN8 B;  5A70 A;  1PK6 C;  3AMN A;  4QQO A;  1EPZ A;  4ES9 A;  3BIE A;  2W94 A;  2OII A;  1LOD A;  1PO2 2;  5JXH A;  2C4X A;  2ZKL A;  3S30 A;  4FSJ A;  1AYM 1;  1H8V A;  1W6Q A;  5FYI A;  2ET1 A;  4GH4 B;  2ARA A;  2YUE A;  4HVQ A;  2BBV A;  4C8D A;  4HKW A;  4AHX A;  4CRQ A;  4J6G A;  1OA2 A;  2A6V A;  3RGB A;  2RS1 1;  1US2 A;  2VZV A;  4GB3 1;  3N9O A;  3FZ3 A;  3T30 A;  4H7M A;  4L9B A;  4WZF A;  5LBF A;  1AL2 3;  1X8M A;  3K75 B;  2OUJ A;  5A3M A;  2BGC A;  2WUH A;  1LEC A;  4W6Y A;  3ZYR A;  5LEK A;  4GKX A;  1E57 A;  1W6O B;  3WP5 A;  4AVS A;  1W2O A;  1S4C A;  1UU6 A;  1X33 A;  1EAH 3;  2P5B A;  4P9L A;  1RMU 1;  5L7O B;  2HWD 1;  2V5D A;  4QXC A;  3KV6 A;  4SLI A;  1D4M 3;  4Q4W 1;  2GDF A;  2PTM A;  1OH3 A;  1AX1 A;  2HKX A;  4Y5Z 0;  2VOK A;  2YC0 A;  1MZE A;  4RHV 2;  4YW6 A;  4COZ A;  1GWL A;  1PGL 1;  1N1T A;  2CHH A;  2OT7 A;  3OY8 A;  4NIA A;  3KT7 A;  1IOA A;  4UBG A;  1RUI 2;  3IM0 A;  3AC0 A;  4LA3 A;  5A33 A;  3RRD A;  5CKQ A;  5IK5 A;  5J1X A;  1W3X A;  1KFX L;  1NQD A;  4D6Q A;  4GAZ A;  4B4R A;  4P14 A;  3ZXA C;  4ZZ5 A;  4R4Z A;  2CWS A;  4KWJ A;  4FXK B;  3GZA A;  4H2A A;  4IV3 A;  3ABZ A;  5AVP A;  2DVF A;  2E9Q A;  1RUD 1;  2YG0 A;  1J58 A;  1RC6 A;  2RS3 1;  3WNM A;  4LBJ A;  4XUR A;  5C3P A;  1OPO A;  1W99 A;  1TEI A;  3D6E A;  1RHI 2;  4RFR B;  1XE0 A;  3KF3 A;  4L2N A;  4BQX A;  1ZA4 A;  4CEW A;  5C9A C;  1H1A A;  3A23 A;  1KJR A;  1RVF 2;  1GU3 A;  1HXS 1;  3FC0 A;  5FUP A;  4FI9 A;  2Z4F A;  4Z07 A;  4D3W A;  5HV4 A;  1QWR A;  1VAK A;  3BOP A;  5IHR A;  1JZ5 A;  1GAN A;  2VMD A;  1PIV 1;  5BYN A;  4YVW A;  4PDW A;  3KV9 A;  5ISL A;  3SCG A;  2G9Z A;  4LBM A;  4ASL A;  1GNZ A;  3GJA A;  4HSL A;  2VGD A;  2DWR A;  2CV6 A;  3AK0 A;  1RUC 2;  3QOP A;  1ZZ6 A;  1UY3 A;  1ULG A;  4URT A;  5FY8 A;  3LA3 A;  4AI8 A;  1CZS A;  1GYK A;  1RB8 G;  4QD2 A;  2IVI B;  4Q5O A;  2C9K A;  3H0O A;  1UPS A;  3POF A;  2DUQ A;  4RQP C;  3VDD C;  4A3Z A;  4QU1 A;  1E5H A;  3LDK A;  1MEC 1;  3T2T A;  3VBF B;  1WLW A;  4MLO A;  2A5Z A;  4B8E A;  4L8Q A;  4XF1 A;  5H9S A;  4WM7 A;  2ZX3 A;  1LOB A;  1UF2 C;  2EAK A;  1OBN A;  2W91 A;  3LFM A;  3SNM A;  1JYV A;  4HPK B;  4CA9 A;  2Y6H A;  3KCC A;  3CMG A;  1AXZ A;  1SCS A;  1UX7 A;  1WW5 A;  1Z0H A;  2EXI A;  3TB0 A;  4BLI A;  4GA9 A;  1SLT A;  1CJD A;  4JRA A;  1XYN A;  2DTW A;  3FLP A;  1WD3 A;  5FY5 A;  2QQI A;  4KNC A;  4R8H A;  2FDJ A;  5F3I A;  5IAV A;  4GIQ A;  1NE6 A;  4DEV A;  1XRU A;  3BTY A;  2XWJ B;  1O8P A;  3GZE A;  4NRO A;  3AXE A;  3GXU A;  4CUC A;  2JG8 A;  3M3I A;  4PLO A;  4BPZ A;  4SBV A;  3GM8 A;  4UW5 A;  2D98 A;  4EN6 B;  4ZHN A;  1KRI A;  2D5H A;  2WII B;  3AP5 A;  1MS1 A;  3LCP A;  5JR2 A;  1FMD 2;  1HJF A;  4H7L A;  2E31 A;  3NQH A;  1A78 A;  1PMJ X;  4MGK E;  1CPM A;  4AFD A;  5FZ6 A;  3HN1 A;  2FZ2 A;  5FZ1 A;  4J25 A;  1O91 A;  2Q1F A;  2YZ4 A;  1NCR A;  2HEW F;  3ZXL A;  3BI3 A;  3WDY A;  3P3P A;  1S0E A;  5C4W A;  3CKH A;  1DBN A;  1CD3 G;  1XU1 A;  5LK7 B;  2GN3 A;  2BWC A;  3O1V A;  3QBQ A;  4EWE A;  4PF1 A;  1DIW A;  1P8J A;  3ZN5 A;  1DLC A;  5AFE A;  3AMH A;  4IES A;  5A6X A;  5DUW A;  3WSO A;  3V0B A;  4FAH A;  2HWC 3;  2XVK A;  4NPR A;  2BFU S;  3G7D A;  3HWJ A;  4X8P A;  5FLH A;  2W92 A;  3OGG A;  3RVH A;  2PMW B;  2PEL A;  2J1A A;  1HW5 A;  1TNF A;  1YJK A;  3B69 A;  4C91 A;  1O3T A;  1JZ4 A;  1VE0 A;  2RDN A;  4MUV A;  1T6G C;  3KD4 A;  2E6V A;  2R04 2;  3VD3 A;  1V6N A;  3WNL A;  2HBU A;  1WMX A;  3HBZ A;  4D7Y A;  2W39 A;  2PA7 A;  1DQ6 A;  1YJL A;  3CO2 A;  4N7U A;  2ARB A;  3AFG A;  4GQ7 A;  2JD4 A;  4PF5 A;  3ZXF A;  3C7G A;  1FPN 3;  1SBF A;  3H50 A;  1FI2 A;  1GMM A;  2W2I A;  1C1L A;  4LO7 A;  2P6H A;  4MAD A;  2RS1 2;  4HL0 A;  5FP8 A;  1NA1 C;  1CQ9 A;  1OLM E;  1BBT 1;  4GB3 2;  4XFH A;  2WAO A;  2QUO A;  4BK4 A;  4W8J A;  3POY A;  1ND2 B;  1LR5 A;  1NZI A;  2B4K A;  3GZU C;  4XPV A;  4LBQ B;  5IYY A;  1GR3 A;  1C8M 2;  2QCS B;  5CVR A;  4M3C B;  1CAV B;  5E16 A;  5HBA A;  2VQT A;  1JZ2 A;  4C1X A;  4UFJ A;  1AR8 2;  4NJ4 A;  5L9R A;  2R30 A;  1RMU 2;  5IK8 A;  2HWD 2;  3ZVX A;  4LE4 A;  4Q4W 2;  3VHP A;  3DL3 A;  2ZJC A;  3FMG A;  4OHZ A;  2VXJ A;  3ZYP A;  4V2V A;  4E4D X;  4I2O A;  4DY5 A;  1PGL 2;  3KSC A;  1W6O A;  5C9A B;  5AVA A;  1CR7 A;  4EN9 B;  3I3B A;  2EXK A;  3N7M A;  1UKR A;  3BOW A;  3H3Z A;  2ZOE B;  1LB2 A;  3PVO A;  5L7O A;  2IVJ A;  3VBU B;  1G7Y A;  4XAC A;  1W9W A;  2A3Y A;  4YRD A;  5KWR A;  1UD1 A;  2NP0 A;  4U2A A;  4PQQ A;  2D44 A;  3RFR A;  4MG2 A;  2A71 A;  1RUD 2;  1GQP A;  1W2U A;  1EYB A;  2RS3 2;  4AFM A;  5J96 B;  5GM0 A;  4BU2 A;  3ES1 A;  4RQP B;  2X29 A;  4LIU A;  1Y43 B;  1PGW 1;  3VDD B;  1JUI A;  3EXU A;  1H0B A;  1OD3 A;  4XE9 A;  1J83 A;  1OC1 A;  3FLT A;  4I30 A;  2GND A;  2IC1 A;  1QQP 3;  3I3E A;  1W8W A;  1LHW A;  5DDJ 3;  2ZX2 A;  1SLC A;  1JU3 A;  1YQC A;  2YPD A;  3B9C A;  3EQE A;  3MFA A;  3P6B A;  3WQ1 A;  5LBB A;  1PIV 2;  3AMM A;  3AXD A;  3OB8 A;  1OXC A;  4JGZ C;  3B00 A;  4YNI A;  3NJZ A;  5IFP A;  4ZU5 A;  1SBD A;  1PNG A;  3AYD A;  2JDY A;  2W1W A;  3D4K A;  3ZPY A;  4FTB A;  2VL4 A;  3I59 B;  2ZGN A;  4HN0 A;  1HN1 A;  1SAC A;  4HMZ A;  4QDQ A;  1ULD A;  5APA A;  3VHO A;  1UU4 A;  4YGB A;  4DEQ A;  1PM4 A;  1H1I A;  5IFT A;  3ES4 A;  1UOB A;  4LUK A;  4OI1 A;  2DUO A;  2W9X A;  3CNA A;  4QQH A;  4YFW A;  3BUC A;  3IMN A;  3KGL A;  3UGG A;  4A7K A;  1R08 3;  5CG8 A;  1ZNP A;  3O1O A;  4A41 A;  3B5L B;  3J8F 2;  2CU5 A;  4CEY C;  4N53 C;  1X82 A;  2BEO A;  3TEW A;  1Q8O A;  3UES A;  2Q4S A;  3ON7 A;  3AJZ A;  2FZ1 A;  2A1X A;  3VBF A;  5JAX A;  2CGO A;  2ARE A;  3OF1 A;  1W9Y A;  1DQ1 A;  4LHL A;  5DZG A;  2WFF 2;  1W9F A;  4HPK A;  4LJH A;  4YM2 A;  2W1S A;  3ZSM A;  1J1L A;  2C24 A;  3ALQ A;  3SQO A;  4Q26 A;  1W90 A;  1AL2 1;  1OQ1 A;  3O5S A;  1RUF 3;  4GXL A;  2P4E A;  3B3Q E;  1K3I A;  4Q4X 2;  2Q8C A;  4LO5 B;  3URF A;  3L2Y A;  2NN8 A;  3KCX A;  3PJQ A;  4DIQ A;  1W9T A;  5CIS A;  3V0A B;  5FO9 B;  1MVQ A;  1UIK A;  1ZYB A;  1EAH 1;  4XOG A;  5CKN A;  1K12 A;  2ZCW A;  2ZMK A;  1W0N A;  1L7R A;  5ACA 1;  1D4M 1;  3IBM A;  3ZN6 B;  5CEH A;  1SZB A;  3H8X A;  2QQV A;  3EO6 A;  3O1T A;  1TZO A;  3PMS A;  3ILN A;  3WOG A;  2FDF A;  3SC7 X;  1CON A;  3UYJ A;  1FOD 3;  4Y33 A;  3MW3 A;  4K9S A;  1YQ8 A;  4IEZ A;  4NIG A;  3QCW A;  1Q56 A;  4JDN A;  2X5I B;  5E6H A;  4TWT A;  4NR1 A;  4QPW A;  3POS A;  1SDW A;  1XPW A;  5KHK A;  4Y1Y A;  1SG3 A;  2OPK A;  2SLI A;  1BK1 A;  4FPC A;  4P9G A;  4YWA A;  5JOW A;  2HWF 2;  2Q30 A;  1WZX A;  1UO9 A;  5LA2 A;  3AP9 A;  4OFG A;  3A0N A;  2J1U A;  3WW1 A;  2XJS A;  3TWI A;  1NT0 A;  3ZKY A;  2FCT A;  5FMO L;  4G3Y C;  1ZZB A;  1VP6 A;  3PNA A;  3QH7 A;  4XUT A;  3ZXJ A;  2Y6L A;  4Z2A A;  1GQG A;  2P3Y A;  2A6W A;  4CXY A;  1PNF A;  2YGM A;  4WM8 A;  3MV0 1;  3UKN A;  2YHJ A;  5A7Q A;  2XGX A;  3B9I A;  4GAL A;  3CLP A;  1DDL A;  3ZSK A;  2WAA A;  4IEQ A;  2C26 A;  3ZLI A;  2V09 A;  5KXC A;  1A8M A;  2ZGP A;  1W2T A;  1XNK A;  1RJ8 A;  1J84 A;  5KHJ A;  1T2X A;  2BQP A;  1LED A;  4N9H A;  4AI0 A;  5JIU A;  1ND2 A;  2H0V A;  1W8N A;  4LBQ A;  5C70 A;  1RTV A;  2D6N A;  1SMV A;  3ETP A;  3M2M A;  3J7L A;  1PHM A;  1PMH X;  2BP6 A;  4BIF A;  3WT3 A;  3UK9 A;  4QB6 A;  5ERL A;  2RS5 3;  5D1I A;  4F3J A;  4BME A;  3RYR A;  3PJY A;  4AFA A;  3E5Q A;  3U10 A;  1NLQ A;  1SDD B;  1XJA A;  3CF6 E;  1DQ4 A;  2K2S A;  4AGG A;  3ZFG B;  1UY2 A;  4K7J A;  4AHY A;  2FD8 A;  3OGJ A;  1VRH 3;  4IV3 C;  2VCB A;  4QKB A;  3ZO0 B;  3BAL A;  1UN1 A;  3B94 A;  3MYX A;  3C3V A;  1HN0 A;  3OYW B;  2UWA A;  2FMD A;  4CU8 A;  2VZT A;  3TNP B;  4KQ7 A;  1F15 A;  3VBU A;  5A1A A;  1WKY A;  1UZV A;  5F6K A;  4XFA A;  1CZV A;  3NWK A;  1VJ2 A;  3R4U A;  3WP6 A;  4CEW C;  5FY0 A;  2Y34 A;  1V9U 1;  1S0J A;  2FQP A;  3KVB A;  2ZMN A;  1Q8S A;  4QX0 A;  4F8A A;  3NRU A;  4YVW C;  2O8O A;  4PDW C;  4ZU7 A;  5FR3 A;  4KH9 A;  2Y6G A;  4IEP A;  2WR9 A;  4YGC A;  2G19 A;  3BGA A;  1IS3 A;  1BQP A;  1LU1 A;  3I4I A;  3ST7 A;  1UZY A;  1VAV A;  4L11 A;  2ZHK A;  1C5I A;  1KS5 A;  4UFL A;  2XVG A;  4YW2 A;  2HWC 1;  4IEW A;  3UV9 A;  5K9Y A;  3KT1 A;  2HWE 2;  2A7A A;  2B5H A;  3AJY A;  3OSD A;  1KJL A;  4MSV A;  4YSF A;  1DFQ A;  2DFC A;  5FYS A;  4E4H A;  4COW A;  2WSV A;  5T52 A;  2UWC A;  5FCC A;  1XYP A;  3OCP A;  4WM7 C;  5JIA A;  1OHF A;  1PVC 3;  3RJ2 X;  1J59 A;  1UY0 A;  2WO1 A;  3T4H B;  1IKP A;  5JMO A;  5GZE A;  3I49 A;  1LHU A;  1ND3 B;  5FPB A;  3M4F A;  4XJA A;  4DXT A;  5JI9 A;  4DUW A;  1R09 2;  1FPN 1;  4XUN A;  4BWO A;  2D6L X;  4DO0 A;  1H6Y A;  4CP2 A;  4XQD A;  5CYY A;  4YLZ A;  5FZ8 A;  2JG8 C;  3P5B A;  4E9K A;  1IG0 A;  5FTT C;  1F4H A;  3MIG A;  1AL2 2;  4MHR A;  3I8T A;  2VCC A;  4YW3 A;  4JHZ A;  1ENX A;  2ZGU A;  2NM1 A;  4AVC A;  4OCT A;  3ZFE B;  1AR9 3;  4ORF A;  1PGS A;  3INA A;  3LWC A;  1OUR A;  5GZD A;  4AZZ A;  3DKQ A;  2JDZ A;  1QJY 3;  2WLQ A;  5C4W C;  5JOX A;  1WLC A;  2DCT A;  1EAH 2;  1DGL A;  1PO1 3;  4RL7 A;  4XXA A;  3SIS A;  2WRA A;  2XBO 3;  4N8M A;  5FP3 A;  2ZX0 A;  2HEV F;  3ZFF A;  1D4M 2;  5KHH A;  1UMZ A;  5DUV A;  5BV6 A;  4PQ9 A;  4QX2 A;  4RYD A;  3PME A;  3EB7 A;  3KV5 A;  1OOP B;  5CAZ A;  4PIY A;  3MID A;  1IGO A;  2JE9 A;  4QPI B;  5SV5 A;  1IPJ A;  3V0A A;  3KVA A;  3QD6 A;  5FP9 A;  4LO4 B;  3BPS A;  2GZW A;  4NHL A;  4XEZ A;  1COV 3;  3GAL A;  3NNJ A;  2Z5W A;  4D0Q A;  1IPK A;  4AW7 A;  3MF9 A;  5DAV A;  4D6S A;  4Q0U A;  1DU3 D;  2YBS A;  3NAP A;  4OUL A;  2OXB A;  5TSW A;  4AL9 A;  4BB3 A;  5JXG A;  1WMD A;  3OBT A;  1VBC 3;  3LPG A;  1KDK A;  3SEE A;  1QQP 1;  4FOQ A;  4Y1X A;  5CKM A;  5DDJ 1;  1OFS A;  2BGP A;  4IV1 B;  5KR7 A;  1RUJ 3;  1W0P A;  1YWK A;  2OX0 A;  5FOB B;  4TZD A;  3TEY A;  3Q8B A;  5L73 A;  2JEN A;  4CP9 A;  2B39 A;  1OF3 A;  2QQO A;  4M4P A;  1S0F A;  2AGS A;  4GKY A;  3VB9 A;  3CBN A;  3OUI A;  5LEJ A;  2VUA A;  3WF4 A;  5JXJ A;  1W06 A;  4Y1Z A;  3VL8 A;  3APB A;  2PQQ A;  4UFH A;  5J36 A;  2EA7 A;  1HQN A;  2ZS6 B;  3MLJ A;  3WDX A;  2DDU A;  2PHW A;  3LEK A;  3ME2 A;  1WCU A;  3H7J A;  2WQ8 A;  1X7N A;  2OYZ A;  1GOF A;  3BN6 A;  3VBH A;  4DUV A;  3PVB B;  2B42 B;  3PHM A;  4DXS A;  4BQY A;  1FT9 A;  1J3R A;  4QGN A;  1R08 1;  4XET A;  4CEW B;  3IB3 A;  2CY6 A;  3OJB A;  3PLQ A;  2TBV A;  1BLZ A;  5L7O C;  2VAU A;  5LWB A;  4FPJ A;  3LDR A;  3N7L A;  4NHM A;  4ZPI A;  2HH9 A;  3GBG A;  1S0B A;  1MPX A;  1NKG A;  4I0W B;  1FV3 A;  4UBH A;  3QAC A;  4FOV A;  2G9F A;  2PXJ A;  4LPL A;  1IKQ A;  1N47 A;  2H6C A;  2LTN A;  2ERF A;  5F2W A;  5A3W A;  4L97 A;  4Y5T A;  2WNV B;  3AZV A;  1RIR A;  3ZFG A;  4AI2 A;  2K9Z A;  1RUF 1;  2B46 X;  1RED A;  1NAE A;  5LA0 A;  1UNB A;  1CX1 A;  5EQU A;  5JUV A;  1V9U 2;  3BTX A;  4BQW A;  3WNK A;  5C71 A;  2LRP A;  3IDA A;  4LMF A;  4BXS V;  3ZXG A;  1HX6 A;  2XVL A;  4D6R A;  1H2M A;  5CIR A;  4FP3 A;  5K7P A;  1WLT A;  3T1L A;  2VNR A;  3USS A;  4AQ2 A;  2ZGQ A;  2DCK A;  1Z78 A;  2EF6 A;  1CES A;  1LJ7 A;  4AR2 A;  2GN7 A;  5IWF A;  1FOD 1;  5FUI A;  2KD7 A;  1D7P M;  1N1V A;  1WCQ A;  2HWC 2;  3JD7 3;  4IXL A;  2VQA A;  4LK6 A;  4QQ2 A;  1IZ3 A;  1R1Z A;  1HV1 A;  5GZF A;  2JG8 B;  2Y0O A;  4DS0 A;  1RUG 3;  2VZQ A;  3K2O A;  4RR3 B;  2YV8 A;  1G86 A;  4HXC A;  4NHY A;  5DZF A;  1QH7 A;  3ELN A;  3FL7 A;  5A6Z A;  2VUL A;  1DZQ A;  2AEZ A;  4CXW A;  1NCR B;  3ILR A;  2DBN A;  4KBZ A;  3LIH A;  1XNB A;  1ZBE 2;  4YG3 A;  3VBF C; 
#chains in the Genus database with same CATH homology
 3SKV A;  2CDP A;  2VR4 A;  4DEV A;  3PUI A;  2JE8 A;  2BGO A;  1O8P A;  3GXU A;  4CUC A;  2ZEZ A;  1UYZ A;  3CZU A;  3C7O A;  3GM8 A;  4MO3 M;  3K77 A;  5JR2 A;  2E31 A;  3NQH A;  1PMJ X;  4JKM A;  2VCA A;  3THC A;  2JDA A;  3III A;  1GOH A;  1R64 A;  3CKH A;  2EIC A;  3HN3 A;  3GDB A;  4PF1 A;  1H6X A;  1P8J A;  3JXS A;  1DLC A;  2WO3 A;  3WSO A;  2XQX A;  1UMH A;  4BDV B;  4P02 B;  4TTG A;  3WEZ A;  3A21 A;  2W92 A;  2L9L A;  2VJX A;  4BJ0 A;  2J1A A;  2J1R A;  1JZ4 A;  2ZEY A;  3I2J A;  3VD3 A;  3DYP A;  3WNL A;  1TG7 A;  4UAP A;  3WNO A;  3C7G A;  1K42 A;  1GMM A;  4MAD A;  3K46 A;  4QDS A;  1JU4 A;  1PX4 A;  4BK4 A;  2WAO A;  1JYW A;  4W8J A;  2HLE A;  1L7Q A;  2B4K A;  1UY1 A;  4JKL A;  5IYY A;  3K4Z A;  2VMF A;  2JKX A;  3A7Q A;  3E1F 1;  2VQT A;  1JZ2 A;  2LW8 A;  2CDO A;  3J7H A;  2Y6J A;  4OUE A;  5HXM A;  3ACH A;  3HEI A;  2VZR A;  4MGQ A;  3I3B A;  4A42 A;  5EJ1 B;  3VDA A;  4GWJ A;  5LCW L;  3MV1 1;  1W9W A;  2EIE A;  3P1I A;  4D8M A;  4PQQ A;  2W1U A;  1KEX A;  2Y6K A;  1GQP A;  1PX3 A;  4QDR A;  4KWU A;  3MBW A;  4IUG A;  4XVH A;  2W95 A;  1W8O A;  4QX1 A;  3DYM A;  3MO4 A;  1UWW A;  4CU8 A;  1OD3 A;  1J83 A;  3WF2 A;  3I3E A;  3ZM8 A;  1JI6 A;  1JU3 A;  3P6B A;  4UI9 L;  4HG6 B;  2VC9 A;  2W1Q A;  1ULO A;  5IFP A;  3OB8 A;  1KGY A;  2VZS A;  2XHN A;  2W1W A;  1W9S A;  3OGS A;  2VL4 A;  1JYX A;  3OEA A;  1HN1 A;  4QDQ A;  3T2O A;  5IFT A;  4DEQ A;  2BBA A;  3T08 A;  5G05 L;  2W9X A;  2ZXQ A;  1EUU A;  3DEC A;  3LEI A;  3T0A A;  2Y8K A;  2VME A;  2ID4 A;  4BK5 A;  3C7H A;  2WDB A;  5DN2 A;  4A41 A;  2VTF A;  5LA1 A;  3UES A;  2QQL A;  2RVA A;  1OT5 A;  1GNY A;  2ZEW A;  3VD7 A;  2X05 A;  1CZT A;  5B4X A;  4ZY9 A;  1UY4 A;  2W1S A;  3HNM A;  3OBA A;  3WF1 A;  3THD A;  4DXR A;  4ARY A;  1RYY A;  1K3I A;  2BER A;  3WNP A;  1UXX X;  2YFZ A;  3CDZ B;  2VM9 A;  1W9T A;  3K4A A;  1K12 A;  2VQU A;  1W0N A;  1L7R A;  2OKX A;  3HPN A;  3WF3 A;  3T2P A;  1F4A A;  3FHA A;  1UMI A;  5B4N A;  2J7M A;  5C7G A;  4QPW A;  4OYU A;  1XPW A;  5F7U A;  1SG3 A;  2DCJ A;  2EIB A;  2PQS A;  2E32 A;  5LA2 A;  2QQN A;  2VOT A;  3OEB A;  2J1U A;  3I2H A;  4TXW A;  3D3A A;  3MUZ 1;  5IJR A;  5EIY B;  2VO5 A;  3LPF A;  4YPJ A;  4Z2A A;  2WBK A;  4XUT A;  2Y6L A;  4ET7 A;  2XOM A;  3MV0 1;  4ZXE A;  5DPN A;  3HOB A;  1DP0 A;  2R7E B;  1CIY A;  3F2Z A;  4E8D A;  2WAA A;  2C26 A;  1OH4 A;  4E8C A;  1J84 A;  3FN9 A;  1T2X A;  4OMC A;  2ZEX A;  1US3 A;  4A45 A;  4XUQ A;  1W8N A;  4GWI A;  5C70 A;  4P08 A;  3ETP A;  4M4R A;  1PMH X;  3I2G A;  3UNP A;  3T0B A;  4DUX A;  2WN2 A;  4QB6 A;  3VD4 A;  4LQR A;  3I3D A;  2W87 A;  1SDD B;  2QBX A;  2WN3 A;  1UY2 A;  3GGL A;  3W5M A;  2J22 A;  2J1V A;  2VCB A;  2RJ2 A;  4ARX A;  3T2Q A;  3U37 A;  3K4D A;  5EJZ B;  2VZT A;  4QB2 A;  3WNN A;  2WYS A;  4LKS A;  2ORX A;  5A1A A;  1WKY A;  3T09 A;  4CU6 A;  1CZV A;  2W5F A;  3UET A;  4KI5 M;  2YC4 A;  1OF4 A;  4P00 B;  2BZD A;  4QX0 A;  3NRU A;  2W47 A;  1GOG A;  2Y6G A;  2J1S A;  1DYO A;  3BGA A;  3LE0 A;  3WQB A;  2HYX A;  1ULP A;  1NUK A;  3ACG A;  2J1T A;  2X09 A;  4CVU A;  4XZU G;  1EUT A;  3HNB M;  3C8X A;  3MUY 1;  2LS6 A;  4OMD A;  4ZZ8 A;  1UZ0 A;  3OGV A;  1SHW B;  1JZ8 A;  3NNG A;  3SEP A;  1UY0 A;  2WO1 A;  3FHQ A;  2E26 A;  4DXT A;  5JMO A;  3IAP A;  4DUW A;  4JKK A;  4XUN A;  3CZJ A;  1H6Y A;  2W3J A;  4UOJ A;  3VD5 A;  5CYY A;  4JX0 A;  4PT6 A;  4QB1 A;  3I2K A;  3C7E A;  3HJR A;  3LEG A;  5CZK A;  3NJV A;  1F4H A;  4MGS A;  2VCC A;  4JHZ A;  2WAB A;  1BHG A;  3LQC A;  1JZ7 A;  4P5Y A;  4LHS A;  3VDC A;  1JZ6 A;  3OG2 A;  2E33 A;  4CUA A;  1O59 A;  2VZO A;  5DQ0 A;  3I2F A;  3VD9 A;  4QX2 A;  5I0D A;  4RYD A;  3EB7 A;  5HPO A;  2ORZ A;  1XC6 A;  5DMY A;  4L0P A;  4XUO A;  2WZ8 A;  1YQ2 A;  2J1E A;  4XUP A;  3ECQ A;  2VZ3 A;  2EID A;  2VZP A;  3PUH A;  4CU9 A;  3I2I A;  1O8S A;  2W46 A;  4D0Q A;  1XNT A;  2JD9 A;  3W5N A;  1UYY A;  2V72 A;  3T0D A;  2W94 A;  1JYN A;  5JXH A;  1GUI A;  5JXG A;  2C4X A;  2YFU A;  2QQM A;  3LPG A;  2XON A;  4MOA A;  2VZ1 A;  3SEE A;  3CIH A;  5JXI A;  2VZV A;  1US2 A;  3IAQ A;  2BGP A;  3A22 A;  3K75 B;  1JHJ A;  3NJX A;  1OF3 A;  2QQO A;  1IQD C;  4M4P A;  4A44 A;  3VDB A;  2WUH A;  1JZ3 A;  1LNS A;  4RN5 A;  3WF4 A;  5JXJ A;  1UXZ A;  3HNY M;  2DDU A;  3LEK A;  4AAX A;  2V5D A;  2WQ8 A;  1UYX A;  1GOF A;  3BN6 A;  4W50 A;  4DUV A;  4DXS A;  1TVG A;  3AC0 A;  3IB3 A;  5J1X A;  3C7F A;  4CUB A;  4ZZ5 A;  2WO2 A;  3ABZ A;  3ACI A;  1MPX A;  1NKG A;  2YB7 A;  3DYO A;  1K45 A;  2YG0 A;  3I97 A;  4LPL A;  2WZE A;  3WNM A;  4XUR A;  1W99 A;  4OZO A;  3ACF A;  2VMC A;  4A4A A;  4AG4 A;  4QX3 A;  3A23 A;  4GZ9 A;  1GU3 A;  1NAE A;  4FI9 A;  2Z4F A;  5LA0 A;  4QAW A;  5G04 L;  3WF0 A;  5IHR A;  5JUV A;  4KMQ A;  1CX1 A;  1JZ5 A;  2VMD A;  1I5P A;  1XNA A;  3WNK A;  5C71 A;  3IDA A;  4A6O A;  4BXS V;  2VZU A;  2DCK A;  2QQK A;  4W4Z A;  2X10 A;  1UY3 A;  1CZS A;  5FUI A;  2KD7 A;  2QQJ A;  2C9K A;  2YC2 A;  3SKJ E;  3OGR A;  1D7P M;  1WCQ A;  2B9V A;  2Y64 A;  3EYP A;  1NX9 A;  4A3Z A;  2V4V A;  3CQO A;  2VZQ A;  2W91 A;  1JYV A;  3FL7 A;  2Y6H A;  4CU7 A;  3CMG A;  1UX7 A;  2RV9 A;  2QQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...