4QB1A

Structure of cbm35 from paenibacillus barcinonensis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
GTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
total genus 29
structure length 128
sequence length 128
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb1A00
4GWJA 2HLEA 2WBKA 2RVAA 5DMYA 1ULPA 3WF4A 4QX1A 4CU7A 2WZEA 4KMQA 1US2A 3C7FA 3THCA 2VC9A 3I97A 3MV11 2E31A 2Y6JA 4MADA 2VZTA 1JZ7A 1JHJA 1HN1A 3VD3A 1NUKA 4DXTA 3LQCA 1W8NA 2WABA 3MBWA 3GGLA 2JKXA 3OGSA 2VMDA 1UYXA 1H6YA 2BBAA 4QDRA 2WN2A 2EIBA 1SG3A 3NJVA 2W94A 1TVGA 1XC6A 2VMFA 3EB7A 2QQIA 5JUVA 2YG0A 1K12A 4QDQA 4ARXA 3HNBM 4D8MA 5LA1A 2B4KA 3WNLA 4E8DA 2J1VA 3AC0A 4QX3A 4W4ZA 4OZOA 2VZ3A 3C7GA 4XUNA 3A21A 2W47A 2V72A 3WEZA 2WUHA 5DN2A 4JKMA 2VL4A 4XURA 5LA2A 2B9VA 1CZTA 4ZZ8A 4QX2A 4OMDA 2DCJA 1GMMA 2VM9A 2VCAA 2DDUA 3VDBA 3GDBA 2VMCA 3OBAA 1TG7A 2BGPA 2YB7A 3JXSA 5JXGA 2QBXA 4CVUA 3K46A 3IB3A 1JZ5A 3WNMA 1LNSA 3C8XA 2CDPA 2BERA 3PUHA 4CU8A 1GOFA 4JHZA 2J22A 5EJZB 4A42A 1JZ2A 3T0DA 1UZ0A 1GU3A 2OKXA 1UMHA 2Y64A 1K3IA 2ORZA 3I2GA 3I2FA 4DEQA 4A41A 2PQSA 2VZ1A 2Y6LA 3HOBA 3WF0A 2ZXQA 2VZQA 3LEIA 2Y8KA 3IAPA 2RV9A 2VQUA 2ZEYA 4XUOA 3LEGA 3IIIA 2KD7A 2WO1A 1W9SA 5IFTA 5DQ0A 3DYMA 4BK4A 3ACGA 2VZPA 2J1RA 1US3A 1JZ3A 2C26A 2E32A 1OD3A 3D3AA 3I3DA 3SEPA 2QQMA 4ZY9A 2BZDA 2VZSA 2W1QA 2W3JA 3K4AA 3T0AA 4DUWA 3HN3A 3T2QA 1CZVA 3I2JA 1DLCA 4CU6A 4JKLA 2EICA 4W50A 2XHNA 3FHAA 2DCKA 2W87A 2WN3A 5CYYA 4P02B 4PQQA 3PUIA 3LPGA 3LE0A 2VO5A 1J83A 4CU9A 2CDOA 3ECQA 4DEVA 3T08A 5IJRA 3VD7A 3VD9A 4FI9A 1GNYA 3NJXA 3IDAA 4W8JA 3ETPA 4ZXEA 4E8CA 4DXRA 5A1AA 5JR2A 5IYYA 3HJRA 2WAOA 3FHQA 5G04L 5C71A 1H6XA 3I3EA 1NX9A 3K4DA 1K45A 3C7OA 4BDVB 5F7UA 4BK5A 2VZVA 3CIHA 2EIDA 3UESA 2QQNA 1W9TA 1NKGA 3MO4A 3MUY1 3DECA 2W5FA 5LA0A 2W92A 3T2OA 2VMEA 3K4ZA 2XONA 1T2XA 3W5MA 1JZ6A 3OEAA 4QB2A 2ID4A 1PX4A 1UMIA 3I2IA 2J1EA 1UYYA 2W1UA 1KEXA 2JD9A 4UOJA 4A4AA 1EUTA 1RYYA 4D0QA 4DXSA 1W0NA 3GM8A 1GQPA 2VZRA 4LPLA 4MOAA 3WF2A 1R64A 2ZEZA 4P5YA 3CQOA 3OEBA 1JYVA 3IAQA 1EUUA 1OT5A 1PMHX 1XPWA 2YFUA 3FN9A 5B4XA 4A6OA 1O8PA 3VDAA 2X09A 3UNPA 2Y6KA 4QPWA 1O8SA 3A22A 2C4XA 4UI9L 3HNMA 2HYXA 3ZM8A 1UY1A 1UY3A 3MV01 4AG4A 4CUBA 3WNPA 1J84A 5HXMA 3WQBA 4XVHA 4QB6A 1GOGA 4HG6B 2J1UA 2VZUA 2QQKA 2XQXA 3BN6A 2WYSA 3ACHA 1JZ8A 2W46A 4TTGA 5CZKA 4L0PA 4MGSA 3U37A 4XUPA 3K75B 1XNTA 2R7EB 3I2KA 4MO3M 3T0BA 4BJ0A 1BHGA 3T2PA 2RJ2A 3VD5A 3THDA 1YQ2A 4CUCA 4GWIA 2VJXA 3SKJE 3DYPA 3NNGA 3MUZ1 2WQ8A 2WO2A 3DYOA 4M4PA 2VCCA 4XUTA 4JX0A 4A3ZA 3FL7A 4LQRA 1OH4A 1WCQA 1UY4A 3ABZA 4AAXA 1W99A 3BGAA 3CMGA 1L7QA 2VQTA 3P6BA 2LS6A 5B4NA 1UWWA 1OF3A 2LW8A 3W5NA 3I2HA 4QX0A 1UX7A 3C7HA 4OMCA 1I5PA 2W91A 3K77A 3LPFA 4UAPA 1UY2A 4ARYA 1MPXA 1PX3A 2ORXA 3GXUA 2W1WA 4JKKA 1NAEA 2J1SA 5C7GA 2WAAA 2W1SA 1UY0A 2QQLA 2ZEWA 3F2ZA 1CX1A 4P00B 2YFZA 1GOHA 3OGVA 4PF1A 4M4RA 1K42A 4RN5A 3OGRA 3WF1A 5IHRA 2E26A 1DP0A 2QQOA 2VTFA 3OB8A 1W8OA 4OUEA 3T09A 5DPNA 4LKSA 1F4AA 1JU4A 1ULOA 3I3BA 5IFPA 4GZ9A 1KGYA 2BGOA 2WDBA 2YC4A 4PT6A 3WNOA 3SKVA 2WO3A 2J1AA 2VCBA 3WNKA 5G05L 1UXZA 5JXJA 3VDCA 2VR4A 2JE8A 3HEIA 4IUGA 4OYUA 2V5DA 1JI6A 3WSOA 4ZZ5A 2L9LA 4KI5M 2X10A 1XNAA 4LHSA 1DYOA 2V4VA 3UETA 2VOTA 5JMOA 1JU3A 2EIEA 3CZUA 1JYWA 2C9KA 2J7MA 3OG2A 4A45A 4YPJA 2ZEXA 4DUXA 4ET7A 3CKHA 3SEEA 3P1IA 3VD4A 4QDSA 2QQJA 3CZJA 1JZ4A 1L7RA 4XUQA 3CDZB 1SHWB 4CUAA 1CIYA 4KWUA 1JYNA 1WKYA 1UXXX 4XZUG 1JYXA 5C70A 2XOMA 3EYPA 3HNYM 1SDDB 1OF4A 3A7QA 2W9XA 4QB1A 2VZOA 5I0DA 4A44A 4MGQA 3WF3A 5LCWL 4QAWA 4RYDA 5J1XA 1CZSA 5FUIA 3NQHA 3ACIA 2YC2A 4Z2AA 3ACFA 5HPOA 1GUIA 3C7EA 1O59A 1IQDC 1P8JA 3HPNA 5JXHA 2X05A 1F4HA 4TXWA 3E1F1 2JDAA 1UYZA 2Y6GA 4BXSV 2WZ8A 4P08A 3LEKA 5EJ1B 2Z4FA 3J7HA 4DUVA 5EIYB 5JXIA 1PMJX 2E33A 2Y6HA 1D7PM 1W9WA 2J1TA 3A23A 2W95A 3NRUA 3WNNA
chains in the Genus database with same CATH superfamily
4GWJA 2WS93 3NKGA 4Q27A 4CPBD 2YBSA 1LOFC 1WMFA 3NNFA 2RVAA 3NAPC 1QHDA 5ISLA 3PDQA 5T50A 2ZGOA 3AP6A 3LSEA 4QX1A 5HCBA 5JOWA 2BOIA 1XXNA 3IKWA 3JBG3 1YFUA 4AVBA 4C0HA 3WDYA 4UW3A 3C7FA 2D6KA 1UOGA 3THCA 5ABJC 4L99A 5FUPA 2JDHA 2OZJA 2E31A 2WO7A 2DVDA 2QJVA 2Y6JA 4MADA 4YW3A 4DPNA 4LXLA 5ACA3 4K1YA 4XQWA 1HN1A 4CCJA 2C6SA 2N7GA 3VBUB 1I9RA 1VBB2 4JCKA 2VW0A 3ZFFA 1JS9A 3LQCA 2EXIA 1QXJA 1W8NA 4DRRA 5AC92 5LY1A 3MBWA 3GGLA 4AEDC 3OGSA 5GZGA 1LOAA 2ARXA 2VMDA 3B93A 3NAPB 1VLNA 4QDRA 2PMWB 5C6CA 5IK8A 2WN2A 4LITA 1SG3A 5L9VA 3KD4A 5FLIA 3KQRA 3EB7A 1TMF3 4UFIA 4RA0A 5DAXA 2IWGB 2QQIA 5ABJB 1BMV2 1DIWA 4B4PA 1M4WA 1G86A 3VHOA 4AQSA 4BQXA 1K12A 4QDQA 2AEZA 5A7PA 4FOWA 3HNBM 4CXWA 1UL9A 4LJHA 1QJU3 4FPJA 4XFAA 4QHBA 1Q8OA 2QKDA 4UYBA 1S0BA 2WNUA 5DDJ3 2FDJA 4ASMB 5KXBA 4FFHA 3K2OA 4D69A 1CAWB 2A71A 2J1VA 4AEDB 4QX3A 1RXFA 4W4ZA 1SLLA 2VZ3A 2Y34A 5FZLA 4LBOA 1N1SA 4HK8A 1MQTC 2R042 3RG0A 1EV12 1GWLA 5DZEA 3MW4A 4XFHA 4COZA 5CFDC 4ITCA 5GZCA 2VQAA 3A21A 1N47A 2ZMKA 3DN7A 3BIEA 3DF0A 1VBD3 3AFGA 3WEZA 4Y24A 3ON7A 1ULGA 2DCTA 3WP3A 1KS4A 2VL4A 2PTMA 1NCRA 3J8F1 4IW3A 4NPLA 1Q8PA 3BOWA 5ANNA 3THTA 4NHYA 2HWF2 4QX7A 1GZWA 3U4SA 1UKRA 3CU7A 1EPZA 1ZZ6A 2JG8C 2DWRA 2B9UA 1XU1A 3BUCA 5FZGA 2ILMA 2QDNA 1LHVA 4URTA 2YB7A 5KHIA 1G9FA 3ZYHA 5A1FA 1RUF2 5FO8B 2FMDA 5JXGA 4PJYA 1WMXA 1DG6A 3IB3A 3VGIA 2KXLA 4OFGA 4YFZA 1LESA 3ZMOA 1LCLA 4FFGA 5HXVA 3C8XA 3H1WA 2BERA 3AKPA 4LO7A 2KR2A 1BKZA 1GZWB 1RITA 5C5UA 1Q5OA 4AYUA 2CGNA 3J9SA 3SCGA 2RJKA 1GOFA 2J22A 5CAZA 4M3CB 5FAXA 1GU3A 2VU9A 2D98A 5FPZA 2JG8B 2Y64A 2OUJA 4CPBA 2JG9C 1K3IA 4AI9A 2AGSA 5FPXA 4UFMA 1HKDA 4UFKA 4I02A 5F3CA 4NMIA 3ZYRA 2TUNA 2Y6LA 3HOBA 4JRLA 1NY71 2VOKA 2WKKA 4HPKB 1HV0A 1PHMA 3ILFA 2RM23 3WG4A 2VQUA 1FOD2 2PHRA 3LIHA 4BIFA 3U11A 1OFSA 2GNMA 4RD7A 4IGOA 3LEGA 1L3JA 3IIIA 2NMOA 1RUD1 1C57A 2YPJA 5IW0A 4XW3A 3UL2A 5IFTA 4P14A 1OMIA 1PO21 1TEIA 4K9SA 3RYKA 1S0IA 4HXCA 2IZWA 4YVSC 2XUMA 1LENA 1H8TC 2HWD1 2NZ9A 4S2FA 3LSDA 3MYXA 4MUVA 1C8M2 3D3AA 3OBZA 2JG9B 2RR11 1QH6A 1VBB3 4HZFA 1T6GC 5DAQA 2WA3A 2D6PA 5FLHA 5AC93 3B94A 5TSWA 1QQP3 2W1QA 2W3JA 1MZ5A 2SBAA 3OGGA 3T0AA 1JBCA 1RUH2 2PHLA 3T2QA 3PURA 1TNRA 3RMYA 1NQJA 1SPPA 2PA7A 3I2JA 5FY0A 4CU6A 4K3UA 1PGL2 4JKLA 3N7MA 1YYNA 4OQ9A 3RS6A 1B09A 2XHNA 3FHAA 3ZR6A 3O1RA 2W87A 1KRIA 5C5TA 1ULCA 4YVSB 3IDBB 4TLGA 1H8TB 2VO5A 1PIV3 4CU9A 2CDOA 1JOBA 3ECQA 4YM0A 5BNPA 3KLSA 2QVSB 4PLMA 3UGFA 1Q43A 4MGKE 3NJXA 3V65A 1UIJA 5FYVA 2BNOA 1ASJ2 1JXNA 5DZGA 4LBQB 4ZXEA 5HCAA 3F95A 4TYSA 5IYYA 1QOTA 1KJRA 2E9QA 4Q4V1 2HWC2 3DXTA 5GLZA 1O91A 2R043 3WW4A 3ZN4A 4CRQA 1EV13 1GANA 4IGQA 1O4ZA 1HB1A 3DKWA 2JXAA 2WFPA 1Z78A 1COV3 3Q8CA 5T52A 2EF6A 4V1PA 1V9U2 3AMHA 4HK9A 4CDXA 1N1YA 1WLTA 2MEV2 1F9KA 4BK5A 2PLV2 2QZ3A 3UESA 3PL0A 3ZFGC 3RZZA 2ZMNA 1CR7A 1W9TA 2A5ZA 1CPMA 2EXJA 1SQ4A 3HMYA 2I2SA 5GLWA 1FNYA 1ENXA 3MO4A 1AYN2 3TYJA 4MGZE 1WCUA 3DECA 4C8DA 1MACA 1W9FA 1JH5A 1YFWA 2K9ZA 4XBNA 4IEUA 4QPIC 2VMEA 4LTAA 4NVPA 2YDEA 4AQ6A 3O0WA 1T2XA 5A6YA 3CNAA 4WVVA 1URXA 1NG0A 4D6QA 3PHMA 4QQOA 3PUQA 2Q1ZB 4WM7A 1GFF2 4AK3A 2BNMA 2JICA 2PHDA 4A4AA 3CBNA 3RWNA 3LWCA 5FPLA 3TOJA 3ZFGB 2A3WA 5FMDA 2Q8OA 5FZ3A 4DRVA 1POV1 2PAMA 2W68A 4FP2A 3IAQA 4CEWA 1IOAA 2WIIB 5F6KA 1Y7BA 4GB33 1ZNPA 1IS5A 2G9FA 3MLJA 4FQZA 4QPIB 2P3JA 5FZ1A 2ZCWA 5GLVA 2WFF3 2VUAA 5LBBA 1V70A 2UY8A 1OH3A 4LBLA 1FOD3 2JIJA 3I2OA 4QPWA 1R1A3 2WQ4A 2JIGA 3ZO0B 1AR72 1WBLA 3R0RA 3A22A 1L7LA 2PAKA 4Q2FA 4UI9L 3HNMA 5FKCA 1WA4A 3ZM8A 1NZIA 1D0GA 4CEWB 1UY3A 4QKBA 1X9PA 5T3NA 3LF7A 3TWIA 2XDVA 4BQ1A 4XBLA 1EAH1 1J84A 1C8M3 4MG2A 1WCSA 3QD6A 1NCQC 2YBKA 3RRDA 2VZUA 3JQXA 1YIPA 5JSPA 2XQXA 4GH4A 1OVPA 1QJY2 4QQLA 5FP4A 4AHWA 5C3QA 3O1MA 3OD4A 2X5IC 5FP9A 3I4IA 3MFAA 2JWPA 2W46A 5CZKA 2VD7A 1BEV2 4L0PA 1SFYA 4MGYE 4XDOA 1S4CA 1ULEA 4U2AA 5L7OB 1XYOA 4MO3M 3T0BA 1VR3A 4PI2A 1CJDA 1SFNA 1ZVFA 4BJ0A 1V6OA 4L92A 2RS31 5EP9A 4BXFA 2RJ2A 5CADA 4DB5A 4LO8A 2K2SA 2UURA 2VJXA 3NNGA 1VMFA 1C8NA 3QCWA 2WLQA 5K0UA 2WO2A 4CCCA 4BM8A 3OUJA 5L36A 2ZGUA 1IS4A 3WP6A 1NCQB 1CAUA 4XUTA 5IVFA 2MPFA 1TZOA 4HKWA 1ASJ3 1I5ZA 2WSVA 5D1IA 4A3ZA 1IKPA 2A6WA 3FL7A 4AEMA 1WZXA 4KH9A 1OH4A 2ZAAA 3ASIA 4R8HA 1C5IA 2HWC3 5ANQA 3WXPA 1PVXA 1HB2A 2D5HA 3E5XA 2YXSA 5A3UA 5KXCA 3ILNA 1W99A 4NRMA 3CMGA 2WT1A 4WM8A 5LY2A 2AACA 2LS6A 2ET7A 1HRI1 1RUNA 4MSVA 2HYKA 2WWJA 3S6PA 1J3RA 3MIFA 4A2UA 3ST7A 3PVBB 2PLV3 2FZ2A 3J7NA 3BIWE 3I59B 1UIKA 3WP5A 4N53C 4OMCA 1ALYA 1I5PA 2W91A 3AK0A 3RPQA 1AYN3 5K4LA 3GZUC 3RMXA 1MPXA 4AVCA 1UU5A 2F4LA 1XYNA 1W6PA 2OUHA 2Q0AA 3FBMA 3H50A 4ZS3A 5BNOB 5DG2A 3ZSEA 2VTXJ 2AZ5A 4O65A 3TNQA 1S0EA 1NLSA 1NAEA 1UD1A 5C7GA 1VALA 2W1SA 2QQLA 1W0PA 4FPOB 1WLCA 4XTMA 1PZ7A 3I3QA 1H9WA 1W2TA 1O3TA 3S57A 1SLBA 5JI9A 2D3SA 2CGOA 4Q1PA 3EBRA 1W9YA 2ZKLA 1S2BA 2WLPA 4HSJA 4XJ8A 4C91A 4E4SA 4RN5A 4HMZA 4XCAA 1DHKB 2KM2A 4N8MA 1BQPA 3BCWA 3BKZA 1IPKA 1WUVA 2JD4A 1UW8A 2R073 4S2DA 3O1SA 1YQ6A 2E26A 1B35A 1DP0A 2Q1FA 2RDNA 1FATA 2ZBJA 4Y1YA 4AOCA 5A6XA 2VTFA 5FBJA 3AM2A 1K5MC 3DPRA 5FP8A 1RMU2 4MGTA 5HV0A 5FP7A 1ULOA 1SCRA 4HONA 4LBJA 1WLWA 2YC4A 1AR73 4XDPA 1F15A 4BH9A 4F8AA 1HX6A 4LULA 4BOWA 4YARA 1U5ZA 2X8KA 1AF9A 1ODMA 2UWAA 3KWVA 1A8MA 5JXJA 4YM1A 1AVBA 1FMD2 3KT7A 4IUGA 3SNMA 2WSUA 2D3RA 3WVJA 4CP9B 1AR82 3ROUA 4KI5M 4ZZ5A 2OS2A 5IVCA 1CX4A 1R083 4FFFA 5KXEA 1PZ8A 4Q29A 5FYYA 1XSQA 1QJY3 2EIEA 3D8CA 1JYWA 5IK7A 3RJ2X 4H7LA 5GZFA 2VXRA 2OT7A 1BEV3 1HW5A 1DLLA 4QPGB 2JB4A 2ZX3A 4CXYA 4IEXA 3JUUA 3HQXA 2CYFA 2JKBA 1H8VA 3HT2A 3P1IA 5FDBA 4OUSA 1X8MA 1VMHA 1JZ4A 1MS5A 4CTEA 3GCXA 4K6BA 5DAPA 1H4GA 1L7RA 2E6VA 2K46A 4LBKA 5J09A 1ZRCA 2RJLA 2A73B 4M00A 1O3RA 4R9DA 4YYOA 5JCTA 1FT9A 4AE2A 5FY7A 5I0UA 2DUOA 2GH2A 3ALQA 3RFRA 3AMQA 1OUXA 4XZUG 4CDQC 1ZX5A 1SDDB 4FTBA 2A1XA 4BWOA 3VBSC 1XE0A 2A6YA 3A7QA 3LD8A 1CAVA 5AVPA 3R4UA 1JYCA 1XE7A 3O1OA 3AB0A 2WZR2 4MGQA 3WF3A 3ZXAC 5FFOC 1UAIA 5JMCA 5JZGC 2NLRA 3HIFA 5C8CA 2Z69A 3NNLA 4CP0A 5FYHA 3NQHA 1NLQA 1AL21 3ACIA 2YC2A 3APBA 3HN1A 3IZOA 1C28A 2XGXA 5LWBA 3ZPOA 3VL8A 1OOPC 5EHDA 3C7EA 3VBRA 3LDRA 1P8JA 1LGCA 1QDOA 1KDKA 2XVGA 1W8ZA 3GZAA 4UFLA 2K0GA 4Z82A 5FZFA 4Z07A 2D3PA 5FWEA 2OVUA 2TEPA 3ILRA 2XLGA 3VBSB 4A6SA 3NV4A 4C1XA 1Q56A 3RNSA 1BVVA 4BXSV 2WZ8A 1HB4A 3H8OA 1W3VA 3RI9A 3G6JB 5H9RA 1PVC1 4Z92B 1PGW2 2OA2A 3J7HA 1UX6A 3MW3A 5JZGB 1LOEA 2ZGLA 3H7YA 4QU1A 4I30A 3ZIXA 4ATEA 3JCIA 4K1ZA 2Z2SB 5E1RA 1PO12 4CDQA 3A23A 2W95A 3MPBA 1RTVA 1OOPB 1OBNA 1RUG2 4D6RA 1UPIA 3B00A 4UWDA 2HLEA 4WVZA 4QX8A 4IL7A 2VNVA 2GALA 4BIOA 2DVAA 1ULPA 3POSA 4LHNA 4CU7A 4FAGA 3UKVA 2GN3A 4L11A 4KMQA 5EXOA 5A32A 1D2SA 4KNCA 4X6RB 1O5LA 4E4HA 2VC9A 3OPTA 1RMU3 1HDKA 1ZBE2 2XWJB 3FLRA 5F5AA 2VVDA 3R6SA 3MV11 4XPVA 3LAGA 3UKNA 1PGSA 1S2KA 2FCUA 2VZTA 3WDWA 2GNBA 4LLOA 1JZ7A 2WQZC 4J25A 4XF0A 5FZOB 3VD3A 1RUI1 1VRH1 2D6OX 2C0ZA 4KBZA 4DXTA 2ZGNA 2EXHA 5IVYA 3VBFA 4E2SA 2XKPA 3KT4A 4EN9B 4XJZA 4CCMA 2RS11 4Q4W1 4C90A 5FO7B 1YJLA 4FPCA 1E5HA 1ZZBA 4FPFA 3C3VA 1ACCA 1YNAA 1UU6A 3EHKA 3VBOA 4NRQA 3NJVA 3VDDA 4UFJA 3J7LA 2O1QA 3FFZA 4XF4A 1ODNA 5FJHA 1W8TA 3UV9A 3V0AB 3WHUA 3HBZA 1QNWA 5KHKA 3U4XA 2OPWA 4LLFA 4D8MA 5LA1A 4Q5OA 4JTOA 1LTEA 1U5IA 1ZZ9A 2PN5A 4W6YA 4R4ZA 1VBA2 1Q8SA 3E6BA 1QKQA 1W6OA 5F6LB 5DAWA 5JPNB 3MIDA 3AC0A 2RS53 3J4UH 4RS5C 4OZOA 2XQRA 2C24A 4JDMA 4AXOA 1UOBA 5EZWA 3NSTA 1RHI3 4RHV2 1RUE2 3PU3A 3LFIA 4YVWC 4EWEA 4XUNA 2R0FA 2HWB1 3LOIA 2WUHA 3GCWA 1UMZA 1H1IA 4QGNA 4COVA 3KS7A 1E5SA 5LA2A 4S2HA 2DBNA 3Q8AA 1BLZA 2EALA 2B9VA 4LKFA 5FY4A 2IFRA 5K8SA 1GKBA 4ZZ8A 1NE4A 1GMMA 2VM9A 1CJPA 1H9PA 1OQ1A 1QJX2 5FY1A 1ZRIA 3ZSKA 5F9TA 3OBAA 4ASKA 4ES9A 2R062 1W6QA 2BGPA 1VBE1 3JXSA 4MXWB 4RFRB 5FY8A 4DXZA 1VBC3 5IAXA 2C9AA 1ZBA1 1DYKA 2XJVA 4KL1A 5DUVA 4AI1A 1PK6A 5CG9A 2PAEA 2A3YA 3N9LA 2GNDA 3OOXA 1FV3A 3SITA 3ZR5A 1LNSA 3JU9A 4KGQA 2CDPA 1XU2A 2WWSA 5D8AC 1LHOA 4LE3A 3PUHA 4AFMA 4I2OA 4UF0A 3B3QE 2HWE3 5C3SA 1U5XA 2QE3A 2DYCA 1QF3A 4JHZA 4A42A 4Z8BA 3T0DA 2ZGPA 3VL9A 4LBNA 1NA1A 1GP6A 3LA2A 3B9IA 3IPVA 1W8WA 1F8VA 3TEYA 1W6NB 1UMHA 4HVQA 1N3QA 1YRZA 4J6GA 2RG4A 5A3NA 5ACA1 4QHOA 1MVQA 1PO13 1WMDA 4QKFA 2GDFA 1XE8A 4X8PA 1RUG3 2PQSA 3WF0A 1IGOA 2GC3A 3P5BA 2DBIA 2ATFA 4IV1B 2CSGA 3EJKA 4GKYA 4BB3A 1YFYA 2Y8KA 4IEWA 5A3PA 4IEQA 3KHCA 2ZEYA 2IXLA 3SH5A 2BUKA 3AP7A 1HV1A 3TRSB 4LO5B 1OLMA 4NWWA 2VTXA 3AL5A 5BNQA 1ZBE3 5C9AA 2BPA2 1N3OA 1TMF1 2J1RA 4LO4B 2XVKA 2CV6A 4Y22B 1M06G 3ZXEA 4AI8A 4EROA 2WT0A 1K5JA 4BQ2A 2E32A 5I8TA 3R05A 1CQ9A 2LALA 3I3DA 3LZZA 1QJU1 1GZ9A 3JD72 5D21A 2WRAA 1HXS1 2P6HA 4JDNA 3K4AA 1I6XA 3KF3A 1O6UA 2Y26A 2Y60A 3LA3A 1SZBA 1RVF1 4M3CF 2PYTA 1S0JA 1QOOA 4BPZA 4OHXA 2E51A 4BMEA 4Z1VA 1OI6A 3MZHA 2JDPA 1DQ0A 3H42B 1VBD1 4V2WA 4GIQA 3PUIA 4QQHA 3ZFFC 3LPGA 3AMMA 4H2AA 4PQ9A 2IXJA 5JSOA 1J83A 3V56A 5BNNA 4JDOA 5A7SA 2FQPA 4E2QA 1ZZCA 3BODA 1WCKA 1GNYA 1DGLA 4H3WA 2OPKA 4LE4A 4QMAA 4RR3A 5J96B 4E8CA 5CVRA 1OKOA 3WX5A 2EA7A 3GZEA 4TLFA 1VE0A 1G8WA 3HJRA 4RHV3 1NOVA 2IUWA 3AVSA 4N9IA 1J3QA 3PMSA 3FLPA 3H8XA 3KV9A 1OLME 4W6XA 5EYYA 3MIBA 1UKGA 3VKOA 2VULA 1DU3D 2DFCA 3K4DA 3ZXJA 4BDVB 3ZFFB 2ZPXA 5F7UA 3I7DA 3NV3A 3N35A 2DFBA 5A7NA 2VQ0A 4S2GA 1HIXA 2GMMA 2QQNA 5CB7A 1QJX3 1ZRRA 1NKGA 4R9BA 3MUY1 3RZHA 3POEA 4EQVA 4HT1T 1LHWA 2W5FA 4XFCA 1OPOA 5LA0A 3I8TA 4IE4A 1Z7S1 4XCBA 2XONA 3M70A 4JRAA 2ARAA 4FOVA 4J1XA 1SCSA 1NCRC 2UWCA 5BYNA 3S7IA 3OEAA 4QB2A 1JZ6A 5DUWA 2RM21 1YHFA 2WYFA 3I2IA 3QH7A 2J1EA 4BISA 5EWSA 3MPPG 4QXHA 2VUJA 2WNUB 4OUMA 5GJ6A 3ZSLA 4OI1A 2EAKA 3U14A 1UO9A 4DXSA 2R0HA 1HQWA 3WQ0A 5B2GB 5J3UA 1NY72 4OI4A 2VZRA 5FZAA 4XF3A 1R64A 1BBT1 5FP3A 2ZHLA 3CQOA 4K21A 1ZRFA 3AYEA 4TWTA 1REEA 4KWJA 4FPLA 1RUD2 5DG1A 4BQYA 5I8YA 1GZTA 2YFUA 1IHMA 1WA6X 1PO22 3FN9A 5EFUA 1GSLA 3ZYBA 1UZZA 1QQP1 4INDA 1NT0A 1NCRB 1FAYA 2NYYA 5B4XA 2BVVA 4AVAA 2X09A 1MQTA 3UNPA 1GQHA 2HWD2 4K7JA 2UYBA 1DYPA 1ONAA 1UYPA 3AZZA 4IEYA 5CFDA 2VGDA 1S0DA 5DABA 4BCUA 1DZQA 2RR12 4CEYA 4DOUA 5HI0A 4NO4A 5IK4A 1U5YA 2HYXA 2I74A 4BQ4A 4ZKTB 1UY1A 1Y9GA 1LR5A 5FK8A 2WNVA 5FUNA 1BMV1 3CO2A 4LKEA 3M3OA 5L73A 3ZFEA 2V4AA 2Y0IA 5A33A 4LO6B 3RZKA 1PIV1 1J1LA 4MV2A 4ZS2A 4XVHA 4CDWA 4QB6A 4Q4X3 4HG6B 3JD73 5EV7A 2J1UA 4URAA 5J36A 3ZN6A 1OC1A 2WYSA 1KFUL 1OA3A 3MICA 5FY9A 4YZ2A 4KQ7A 2YU1A 4ZXKA 3VBHA 1SMVA 4G9SB 4MGSA 2QDRA 3U37A 5LK7B 1MS4A 2XHKA 4XC9A 3WCRA 2FDGA 4WVMA 3B01A 3I2KA 4CDUA 1G9BA 3LA7A 1COV1 1QGLA 1DF0A 3T2PA 4DY5A 5J48A 2FDHA 4MZUA 3THDA 1Y4WA 3VV1A 3WHTA 5FZEA 4ORFA 4CUCA 2BBVA 4Q4V2 3SKJE 4NIIA 1F35A 4Q0QA 4AEKA 1LJ7A 4HN1A 1GV9A 3ZXDA 1MEC1 1OUSA 4Y20A 1MS9A 4Q0VA 2AH2A 3AFKA 3RDIA 1WCQA 3TN92 3X29B 2OW4A 2P37A 3ABZA 2W52A 5BNPC 2VQTA 3PTYA 4Q4Y1 5F2WA 5LEKA 1QJZA 1UWWA 1J3PA 1A78A 4AR2A 4I3GA 3ZYIB 4ASLA 3K51A 2XUEA 3BYWA 4QPYA 3W5NA 3I2HA 3ZXFA 2JE9A 4N7UA 1OSGA 5I0TA 2NN8A 1UX7A 3BVCA 1BZWA 3K77A 3LPFA 5IUQA 3HQRA 4G4FA 1XQNA 1SPPB 3AL6A 3QH6A 1SLIA 2H0BA 4ARYA 4GQ7A 5EQUA 1YCIA 1Y3TA 2ORXA 4GB31 3WW1A 3GXUA 1AYM1 1D4VB 2W1WA 4JKKA 3PLQA 4UW6A 2WFF1 2ZEWA 5BNPB 1EYBA 2VW2A 4GWNA 4O9GA 2OQ6A 4YRDA 2YFZA 3LDKA 1R1A1 2JB8A 2DVGA 3OGVA 5EJ3A 2JENA 2HWF3 4M4RA 2A7AA 3GBWA 1JW6A 1R091 4B8EA 3NNJA 3UGGA 3SLIA 1ZRDA 4YG6A 4DMIA 1H2NA 1FNZA 1W90A 4NIHA 2QQOA 4EN6B 1RUF3 3RZGA 1PO23 5FLJA 4Y5Z0 3B69A 4OUEA 3T09A 5DPNA 4LKSA 3KCXA 1JU4A 2NMNA 4CDXB 3D82A 3O0XA 5CG8A 4JGZA 2XJSA 3SQOA 3VKFC 2BYVE 2G1MA 4CSWA 3WNOA 1EAH2 1PGL1 2J1AA 2VCBA 3OCPA 3WNKA 3N7LA 3FC0A 3K48A 5G05L 1UXZA 1W8UA 4CEWC 3ATGA 3TBDA 1O3QA 4YGDA 3BPSA 2PHXA 1REFA 4H14A 2JDNA 1E57A 3WSOA 4LUMA 3OY8A 3I49A 2X10A 1XNAA 2IXKA 1DYOA 1JTZX 2DVBA 2EXKA 2GSYA 3SH4A 3UETA 3W58A 4WM7B 5JMOA 2EAAA 4IEZA 2D44A 1CWPA 4NIAA 2RS32 3NKTA 5FYIA 1YIFA 3USUA 3W21A 2XBO1 4PBOA 2JEMA 2ZTNA 2ZEXA 1AR91 4HVRA 3H1MA 4P9WA 1SBFA 5E16A 1LOCA 1MZFA 2BQPA 2DF7A 3CKHA 5L7OC 2ADEA 2ZHKA 4QQPA 4KU8A 2Q5TA 3IBMA 4XJWA 2Z42A 4QDSA 3VD4A 5FXVA 5BXXA 4HETA 3O12A 1ND2A 4H55A 2ENRA 3CDZB 4GH4C 4RQPA 3UGHA 4FXGB 3UJOA 4DZGA 1UZVA 3KCCA 4KWUA 1AX2A 3WQ7A 1JYXA 4YW1A 2XOMA 4TN7A 3EYPA 3T3YA 3S5QA 1HRI2 5L9BA 2BU9A 4QGLA 3N36A 4XE9A 1RUH3 1CVNA 3TN93 3DGTA 3ORJA 1YFXA 3IT8A 5FYSA 3WT3A 4E27A 2VZOA 2XR4A 2PHWA 3UKTA 4NN0A 5I0DA 1PNGA 3KF5A 1Z0HA 3E6DA 3B02A 5LCWL 1YQ5A 4BE3A 2DU0A 2UWBA 5EPAA 4FPEA 1HLCA 5K0UC 5CFCA 3K3NA 4NE9A 5KR7A 3ZSMA 5LB6A 2I07B 3CJXA 4OZXA 1RGSA 4AHZA 2DUQA 1GUIA 2YGLA 4GH4B 5A70A 5AFBA 3RGBA 2ET1A 3H0OA 4FXKB 1X33A 5C4WA 3HPNA 2ZAHA 4UBHA 4W6WA 5BNOC 2R071 5GLUA 3W20A 3H3ZA 4WM8C 1UYZA 4CYDA 1BCXA 5FRAA 5FV3A 1HQNA 2FMYA 4FOQA 1XB9A 2X5IA 5SV8A 3KVBA 2DUPA 2Z4FA 1PZ9A 1RUC2 4Q0UA 4AEJA 4NR1A 4JVAA 2ZGKA 1F2NA 4MH0E 1RJ8A 5K0UB 1POV3 5GKAC 1PMJX 2HEVF 1V9U3 1H1MA 4YW6A 2E33A 1CAUB 1W9WA 2MEV3 2J1TA 1VPHA 2ZX1A 4M0HA 1D4M1 3KMHA 4XJUA 5J1XA 3WNNA 1IPJA 1GNHA 1FX5A 1S55A 2VY0A 2X29A 1WWYA 3CEWA 4Q0PA 4F7ZA 4XFGA 3LIGA 5DUXA 5DMYA 4HN0A 3WF4A 3IM0A 4JTNA 3BI3A 1W6MA 1R081 3ZXLA 4WM8B 3N9OA 1US2A 1LULA 2X53S 3RZMA 1QJY1 3O1UA 2QTWB 2YROA 5HV4A 1OXCA 1OA2A 3OUHA 4UW5A 3WR0A 1I3HA 3LEMA 5FY5A 3NMBA 3BU7A 1BEV1 4E4DX 2P3IA 1NYWA 2OIIA 4YZ4A 5FZ0A 4Y5SA 2PQQA 4CCLA 3IDCB 2VNOA 1NUKA 2HKXA 2WABA 3H3UA 1W6PB 2QQWA 2JKXA 2FBEA 3AZWA 4BMBA 3WUDA 3AKTA 3DPRC 1QU0A 2IVJA 3ITQA 4ONUA 4N53A 4C0BA 2Z5WA 4N7IA 2UY9A 4PLNA 2D7FA 3LFMA 3VZKA 4EE2A 5FZIA 1O3SA 1GR3A 4FCAA 5FXXA 3BU0A 1TVGA 1XC6A 2VMFA 3WW3A 2RS33 2DTWA 4CCDA 5FYZA 2OZ6A 4IV3A 2R49A 4QPGC 1JHNA 4GAZA 5JUVA 1F5JA 4IEPA 4MVTA 1AUYA 2D5FA 3CLPA 4KG0A 1EP0A 3EMRA 2GMPA 1A3KA 3G7DA 3R4SA 3TB0A 1ENSA 5FYCA 3ZYGA 4E4ZA 4JGYA 2O8QA 1ND3A 5A80A 3N7JA 1F5FA 1B35B 2AYHA 2JX9A 2UU8A 5T54A 4COWA 1FPN1 4QKNA 1AXYA 3C7GA 3DPRB 4N9HA 2W08A 4P5HA 5BPXA 4XFBA 2ETEA 3BOPA 1VRBA 5FCCA 5JOYA 1G9AA 1WW7A 4Q8LA 2V72A 1YQ8A 3KHBA 2AENA 4NPMA 4R9CA 1K5MA 4K40A 3DL3A 1JOPA 3M2MA 4BU2A 3PMEA 2XG3A 1AJKA 3QOPA 1WBFA 3GNEA 4DQAA 1XOYA 1W05A 2DCJA 1HRV1 2ADDA 1QJEA 2H6CA 1AR61 2DDUA 2VNRA 2IC1A 5F1RA 1X8EA 3VDBA 2VMCA 2GP3A 3MIHA 3INAA 1CONA 1J1TA 3L2HA 1LB2A 4JQRA 2VUCA 1KITA 1GP5A 3GHNA 4CVUA 1UN1A 5T5OA 1JZ5A 1PVC2 1POQA 1XRUA 3A4UA 3GBFA 4NHLA 3PVNA 2LROA 4EJRA 3D6EA 4YM3A 2XL7A 1DZRA 1JN2P 2BJSA 3D5OA 4WBBA 5APAA 4BHPA 3POGA 1RUJ1 3CHXA 5EYXA 5LBEA 3W59A 3WG3A 1BJQA 3D0JA 1XJAA 3ES4A 5GZEA 1RUC3 3V0BA 1UZ0A 4B1LA 3GYDA 2OKXA 2XXZA 5GM0A 3H1YA 1H2KA 1KDMA 4JQTA 3AP9A 3VBRC 4LK6A 4AQTA 3M4FA 2ORZA 3I2GA 4AHYA 3I2FA 4LKDA 3QLQA 4NJ4A 5CKNA 1SLCA 2ZXQA 1CAVB 2JECA 2VZQA 3LEIA 5IWFA 2GP5A 4ZU7A 3IAPA 5F3EA 4PDWA 5F2SA 2RV9A 4KU7A 2ZZJA 1RUOA 1OPMA 3RZJA 4KBBA 1RL3A 4XUOA 5DZFA 4AWDA 3RYRA 1DQ5A 5C8CB 1TME1 1RUI2 4EN7B 1VRH2 2ARBA 4B29A 1GNZA 1ZZ8A 4BK4A 1YXWA 1GP4A 1YO8A 1V6LA 3ACGA 4RL7A 2GU9A 2RS12 4Q4W2 4YWAA 3VZLA 3FUQA 3VBRB 3ZYFA 2HBUA 2PHTA 3ZYJB 4CE8A 1FXZA 1GZCA 1W28A 3ENRA 1BK1A 2ZHMA 3VN4A 4N90A 1DBNA 4P9IA 2QQMA 4YGEA 3ZKYA 2BZDA 1JUHA 4F83A 1SDWA 5JLVA 4RGKA 2CY6A 2RS51 4XETA 4DFSA 1W2UA 1CZVA 3ZVXA 1DLCA 1RHI1 2EICA 4LIUA 2YBPA 3MGUA 3R4DB 4B3NA 4W50A 1E5RA 4FPHA 2DCKA 2WN3A 5T5PA 5CNAA 2IXHA 2QCSB 2RHPA 2Y33A 4P02B 4XHXA 4PQQA 3VLBB 3AXDA 1DGRA 4AI0A 4CDQB 3EO6A 4NHKA 1ZA7A 3T1LA 3OPZA 3K3OA 4GULA 4QXKA 5FYUA 4SLIA 4DEVA 1Q8QA 5I91A 1WCDJ 4YG0A 4FI9A 3VZNA 3GHMA 2BNNA 3IDAA 4W8JA 2HWB2 1LU2A 3VBOC 3VDDC 1FMD3 4ISQA 3O5SA 5A32B 5A1AA 3OD0A 4QKDA 5JR2A 5F3GA 1SBEA 1AR83 1ZREA 2BEOA 2O0OA 1VBC1 1UU4A 2WAOA 3FHQA 1VB4A 1CGPA 3O1VA 3ETQA 4IE7A 5C71A 5JVVA 1STMA 2PFWA 5FPVA 3N3HA 3I3EA 5KC5A 4E9KA 4ZONA 3KV5A 1NX9A 3BTXA 1CD3G 3C7OA 3VHPA 1V0AA 2HWE1 1C3HA 1VBE2 1YWKA 1Y43B 2P2KA 3VBFB 3H7JA 1JYTA 3GBGA 2VZVA 1ZBA2 5A6QA 3WDXA 5A6ZA 3KCYA 4M01A 3UYJA 2XB6C 2G4IA 3OYWA 3FLTA 4O7XA 2CHHA 5AFEA 3VBOB 3VDDB 3RZLA 2PXJA 4ARXA 2CAVA 1PO11 2GMEA 4MYEA 4D3WA 4LT5A 4FO9A 4HKOA 1DDLA 1LGNA 1PVC3 3O7OA 3W5MA 2RMU1 4DINB 2YHJA 4JHTA 4IEVA 2ID4A 1PX4A 2F17A 5FREA 2OYZA 1XNDA 2JD9A 3A0NA 2R30A 4UOJA 2VBDA 1U12A 2H0VA 3CJIA 2BTVC 1ENRA 4BQ5A 2P3KA 3JQWA 2WZR3 3AX4A 4LA3A 1EUTA 1W6OB 1W39A 1XNCA 3GM8A 1QH7A 1NXMA 3WF2A 4MOAA 2XLFA 3AZXA 5FK7A 1CAXA 1N3PA 3GF6A 1PK6C 2YYOA 5FMBA 4AI2A 3LKJA 5JWPA 4YZ1A 3OEBA 1JYVA 2VOVA 3BTZA 1H2LA 1XNBA 3WP4A 1W04A 1LHNA 4QM9A 4IV1C 3ZIWA 3POBA 5CKQA 3UJQA 3PTRB 4GMP3 4BZ4A 2WS91 2VBPA 2NPIA 5F5CA 5GALA 4HSLA 3RWKX 2QQUA 3FFQA 2Y6KA 3LCPA 4H7MA 1NA1C 4LORA 3TEZA 2B5HA 1C1FA 2BW8A 3VZOA 3FWEA 1O8SA 4LOSA 1QIQA 2QZ2A 3JBG1 1RUI3 1VRH3 1AX1A 5FZHA 4NAMA 4R52A 3D0SA 5IK5A 4RSUA 5ERLA 1HXS2 1W6QB 3MV01 5A3TA 4Q4W3 2VW1A 3T2TA 3WV6A 3GJBA 4CUBA 2NQYA 2CU5A 1DGRN 2R1BA 1G9DA 4XF9A 1DFQA 4CCNA 1PK6B 3WQBA 1RVF2 4CP2A 2OX0A 3N9QA 1H1AA 2VOXA 5A7WA 3KQ4B 4NROA 2QQPA 5FZ9A 3AMPA 1IKQA 3BN6A 3EXUA 2ZGQA 4UF0B 3ACHA 1VBD2 3FBYA 1JZ8A 4FTSA 2JE7A 2DCZA 1V6NA 3OTFA 3AP5A 4LK7A 3MDPA 4GJYA 4AZZA 4BQWA 5CU1A 4IE5A 1NA1B 4XUPA 3SH3A 2LM3A 1WW6A 3K75B 1XNTA 3IPVB 4PBPA 3ZDVA 3ZX7A 5D8AA 2D43A 1JYIA 1APNA 1RXGA 3NJZA 3WD5A 2ZGTA 3I2DA 1BHGA 3U1XA 2ZGMA 1GLHA 3VD5A 1LKNA 1NZCA 3EQEA 3DYPA 4O9EA 3MUZ1 2WQ8A 1W2NA 4YW4A 2CWSA 1IS3A 4UT5A 4CCKA 3PNAA 3L2YA 4N43A 5CA6A 3TAYA 3AXEA 4YGBA 4JX0A 2MHFA 5DDJ1 1UCXA 4XF1A 5LA9A 1LOBA 4Z2WA 4LQRA 5KHJA 2P17A 3U78A 2H6BA 5C9AB 1UF2C 1VMJA 4QM8A 2VECA 4D94A 4TSVA 1ZZ7A 4DIQA 3L9JT 4ZPIA 2R32A 2VVEA 5C33A 3NWKA 4AAXA 1FYUA 3BGAA 3J7MA 4YZ5A 4UXAA 4AQ2A 2IFWA 2BGCA 4AFAA 1S0GA 1OF3A 2OQ7A 4RR3C 1IG3A 4N43B 4D7YA 2Y6FA 3PJYA 3E97A 4QX0A 1ZBA3 5T55A 1Z7S2 1GWMA 4OHYA 3VUOA 3AYAA 2FDFA 4CCOA 1SEFA 2QNKA 4UAPA 1VBA3 5FZ7A 3KZ4C 5LASA 1YLLA 3VBUA 2RM22 5FWJA 4Y1VA 4ISRA 1KD7A 3KSCA 2BRTA 4KGGA 3J8F2 1RUE3 2CWMA 4I0WB 5DXDA 1G6NA 1G7YA 3MF9A 1LOFA 4LHKA 1N1VA 3NAPA 1EPWA 1QXRA 4OHVA 2WAAA 4CCEA 3TEWA 1UY0A 3P3NA 3RI8A 1YEWA 1NLRA 3F2ZA 4U36A 3MLKA 1BBT2 5BNNB 1CX1A 5FXWA 4XQ4A 2A6VA 5ABJA 2RDRA 2XJUA 2WNUC 1XNKA 1KFXL 4PF1A 4Q0SA 4RR3B 4DNYA 4G3YC 5K9YA 5A1LA 4XILA 3Q8BA 5DUUA 1MVEA 1QQP2 4GKXA 3RSJA 4EYUA 3H8RA 2XJPA 3KT1A 3WF1A 3ACLA 2R063 5IHRA 1RB8G 2V09A 5J7MA 2ZZQA 1CAWA 2VXJA 4Q4X1 4AEDA 3JD71 3J26N 1W8OA 1QMJA 2ZX4A 2BV4A 1QOSA 3SISA 5IFPA 3PVEA 1KGYA 5I8SA 4HL0A 4LBQD 3AMNA 2AEYA 3DXUA 2JDMA 5JR7B 1PIV2 5LK5A 3I54A 3TEXA 3SKVA 2WO3A 5KXDA 3ZLIA 2YZ4A 4AGRA 4MXVA 3WG2A 2DURA 3JB8A 2G9GA 1MS8A 1HXS3 1POV0 3SXWA 4XEZA 3ZDSA 4XAAA 5LW9A 5KHGA 3VDCA 2JE8A 3HEIA 1GQGA 3VDAA 3OBTA 1RVF3 4OHZA 3N9NA 2EIGA 2D6NA 4PLOA 4M0NA 2V4VA 1VBB1 4A3XA 4QXCA 2VOTA 4AHXA 4GALA 4AVSA 1XYPA 5FZ8A 5AC91 4XACA 4CEYC 1IPSA 1COV2 2J7MA 3MF6A 3FHIB 1Y9MA 2G19A 3PIJA 3OG2A 2BFUL 4IESA 2LRPA 5FZBA 3RQ0A 4A45A 1F31A 1AJOA 2WNVC 2ZGRA 4XOGA 2F6BA 2FCTA 3ZFEC 1G9CA 4ET7A 2ZKNA 1TQ5A 4EN8B 4HFSA 4CDWC 3FJSA 1MEC2 2QQJA 4Q26A 2NP0A 1KQRA 3ZKUA 1UQXA 1DGWA 4XUQA 4MLOA 4M3CA 4AFDA 1O5UA 3WZ1A 1SHWB 3W9AA 4CUAA 1NXD1 1CIYA 4OLLA 5H9QA 2JG8A 4I09A 4B4QA 1HB3A 3VBHC 5LEJA 4D7SA 1MQTB 5FYMA 1JYNA 1UXXX 1H2MA 2O14A 3IN9A 5CBLA 2D6LX 5FYTA 5CFDB 4A7ZA 4Q4Y2 4GJZA 4CDUC 3NW4A 2GAUA 5IVVA 4BLJA 1E5IA 4YW7A 4CEYB 5JI7A 3NO8A 4HPKA 4GWMA 2VUDA 4QB1A 5LBCA 1CN1A 2XL9A 4MHUA 4AGGA 4PI0A 2R041 2WNVB 4I01A 5FZ4A 3KM5A 1EV11 5DAVA 4OVEA 3ZFEB 4QAWA 2BWAA 3BTAA 4XXPA 4NHXA 1CZSA 5A33B 4EWAA 1BYHA 4CDWB 3NVCA 3PVOA 3ZYPA 4Z2AA 2D97A 3ACFA 3O14A 3WDUA 3ZN6B 1LOGA 1Z7S3 4GB32 4UFHA 5FZCA 1AYM2 1O59A 3WG1A 4FSJA 1T6BX 2HWF1 4K8FA 4B7KA 3VHRA 3NNMA 2WJSA 2JG9A 2YPDA 2WFF2 3VBHB 3U75A 4LNVA 3ZN5A 4HKLA 5FJKA 4AF9A 5JXHA 2WINB 3H9AA 3U07A 1F4HA 4TXWA 4WVMB 3E1F1 1GWKA 4CDUB 1R1A2 2CGPA 3QBQA 2JDAA 3J8F3 4P9JA 3LOBA 1V6JA 1Q8VA 4XIKA 1RUF1 5EJ1B 5FMOL 3AKRA 4Y1UA 2AC1A 4IE6A 2E7QA 3UK9A 1R092 1S0CA 4OHWA 4AGVA 3BALA 3NV2A 1BBT3 2FDKA 5EIYB 1YJKA 5E8AA 5FTTC 3O1TA 4M3CE 2BP6A 5F32A 3N7KA 4YVSA 3M3EA 1QDCA 3D4KA 4NIDA 2PHUA 1SLAA 4Y20B 2B46X 1H8TA 3S30A 4NAOA 1EY2A 4FOYA 5IATA 4C1WA 1LECA 2ZACA 4QXBA 5LZ6A 2WBKA 1X7NA 3AZVA 2B42B 5JIAA 2WR9A 4LBQA 5I0SA 5KHHA 2WZEA 1JOJA 4L8QA 5BY5A 4QU2A 4CDXC 3I97A 3BB6A 1HJFA 1W8FA 3TNPB 1DZTA 1WW5A 1FOD1 3KVAA 4COYA 1YI9A 3IDEA 5FYBA 1JHJA 1ULDA 3N9PA 4DS0A 1OHFA 2AREA 3WCSA 2CTVA 3B9CA 4META 3N4MA 2E7TA 4P9XA 2WNEA 5JSRA 4OI2A 1BVP1 2LTNA 3OF1A 2MNGA 2ZOEB 1WW4A 4FFIA 4AI3A 2BVBA 3PJQA 1UYXA 1H6YA 2BBAA 2XBO2 3ZXKA 1C8M1 1DQ1A 3O1PA 1AR92 1RUD3 2EIBA 4JGZC 4WM7C 4IEOA 4HVOA 4XYXA 4A7YA 5KC6A 4IDZA 5JAXA 1S0FA 2HJIA 2W94A 2XLAA 5H9SA 3HBKA 4MHRA 2BDRA 2HWD3 1RUH1 4QD2A 2YG0A 3TN91 1H0BA 1UPSA 1UZYA 2JJ6A 4CXXA 1Y9QA 3VZJA 2RR13 2B4KA 3KGZA 4QHZA 2WL1A 5BUVA 5E89A 1XSRA 3WNLA 3MLLA 1TE1B 1MEC3 1WD3A 4LBMA 4E8DA 4HLTA 3BPZA 1RINA 3E5UA 2GH8A 1ZM1A 4Y33A 5C8WA 3ZFGA 4O61A 2IXIA 2XVLA 3OPWA 3DKQA 1O7FA 5FXZA 4JGZB 1X50A 4WZCA 4DO0A 2NM1A 1ASJ1 2W47A 4Q4Y3 1OD5A 4QPIA 5DN2A 4XJAA 4JKMA 1W2AX 2AR6A 4XURA 3O0VA 1OLRA 2HWC1 2VOWA 5F5IA 2RDQA 4KWKA 1ULFA 1CZTA 1ND2C 4RQPC 4B1MA 3S7EA 2GC0A 4QX2A 4IERA 4OMDA 4XAEA 4NIGA 4EZHA 1LRHA 2D6MA 1O4TA 2VCAA 3MI8A 4XBQA 3OY8B 4KG8A 3GDBA 3HD8B 5C3OA 1W8HA 5AVAA 1LEDA 1V9U1 2R072 3M1HA 1TG7A 3KB5A 4Q4V3 3HVDA 2MEV1 4Y1XA 1AYM3 5C3RA 2PLV1 2QBXA 2SLIA 3K46A 3PU8A 4AVTA 5BV6A 1QXPA 3WNMA 5CEHA 1RJ7A 5A3WA 2DTYA 1AX0A 3POYA 4NOTA 3USUB 1AYN1 1FV2A 1SACA 3FUOA 3URFA 4HOOA 4CU8A 5JPMB 3M3CA 5CFCC 3PUSA 5C3PA 1QWRA 4YW5A 3T4VA 1A8DA 2TBVA 5FIXA 4AFCA 1D4M2 1ZA4A 3OSDA 5EJZB 5HBAA 1OFNA 5FZ6A 1JZ2A 2WWUA 1CESA 1ND2B 2YUEA 4RQPB 1UOJA 1R093 2R1DA 4XXAA 1IG0A 2FZ1A 2FDIA 1Q3EA 5C4WC 5T5LA 3AP4A 4Y4YA 3LDBA 2WC2A 2YC0A 5L7OA 1WGPA 3ZMNA 5FPUA 3GZTB 3KV6A 4OULA 1R082 2WZPP 1D2QA 1RC6A 4A41A 4CP1A 4DEQA 2A70A 4EWDA 2VZ1A 4AAPA 3FMGA 2ZA9A 3HAGA 3MHZA 2IXCA 4HANA 5GZDA 1NCQA 4GXLA 4I0AA 4FT8A 3OJBA 2VMHA 4EN0A 2XWBB 4TZDA 4NUBA 2KD7A 2WO1A 2WT2A 1W9SA 3PUAA 4F3JA 5CFCB 3VKLA 1PNFA 3M8LA 2OXBA 5DQ0A 3DYMA 4RGAA 2VZPA 1SLTA 3N9MA 5L9RA 1US3A 4JAAA 1JZ3A 2C26A 5K7PA 1AR71 3AYDA 2ZX0A 5C4WB 1OD3A 2BOJA 3MFCA 3SEPA 1R1ZA 1J59A 2W39A 1C4RA 2XJQA 4Y26A 4ZY9A 4I3PA 1U0AA 3IIAA 2VZSA 2HH9A 2ZHNA 4P9YA 4XHBA 2Q30A 3I59A 4DUWA 1QEXA 2P4EA 3HN3A 3AJYA 2B8MA 2X5IB 2ERFA 2XBO3 4R4XA 1AR93 2XKOA 1AXZA 1YUDA 4GMP0 1IQAA 5BNOA 5L19A 3H3LA 3OBRA 5CYYA 2BFUS 3WINE 4SBVA 4FTEA 5F5QA 2PHFA 4Y3OA 1X9TA 3LE0A 4FBFA 1FPN2 1EAH3 2P1BA 4FPGA 5T5JA 3T08A 4IGPA 5IJRA 5JOXA 3VD7A 2VBBA 3VD9A 1X82A 3ZXGA 1W0OA 4FVVA 1SBDA 2AUYA 1W06A 1B35C 1OA4A 2LUWA 2V5YA 3SC7X 3ETPA 4COUA 1W6MB 4DXRA 1AXKA 4XQDA 5KWRA 2Y38A 1H30A 3IMMA 4LOTA 3DCQA 4EV0A 3SCHA 2A75A 4PIYA 5JDBA 4IV3C 5FO9B 5G04L 1ST8A 3Q8EA 1H6XA 5IVEA 1HRV2 1VAMA 1JMUB 1AR62 1MZ6A 2HEWF 4RGGA 2WNOA 3FE5A 3KV4A 1K45A 4JGYC 1ND3C 2P3YA 5LBFA 2YGMA 2QFEA 4IE0A 3CIHA 3B7MA 2EIDA 1RUC1 1DGWX 3M3QA 3NJYA 4N53B 2WA4A 3FX3A 1OVSA 5FZKA 4QT6A 1RUJ2 2F4PA 1V6MA 2ZGSA 2EVXA 5FOBB 2W92A 2DVFA 3T2OA 1HN0A 3U0ZA 3HQUA 3K4ZA 5CKMA 5JOZA 4CP9A 4IV3B 4AW7A 4JV4A 1UMIA 3SCFA 1AL22 1HRI3 2E53A 4JZRA 1UYYA 2W1UA 1KEXA 5FMOS 5KBFA 1PM7A 4XDQA 5LRRA 3UT0A 4JGYB 1ND3B 1UOFA 1D4M3 2ARCA 3NL1A 4XTPA 1RYYA 4QPGA 3WDTA 4D0QA 1W0NA 2GC1A 2VPVA 1XBFA 2JDKA 1GQPA 4LPLA 4YLZA 3U10A 2P6CA 3AZYA 2ZEZA 4P5YA 3ZSJA 3GALA 5LRSA 3BTYA 1UZWA 5A7QA 1KXGA 1VJ2A 1EUUA 1OT5A 3DUIA 2KA3A 4YW2A 1I1EA 1PMHX 2RDSA 5FBZA 1XPWA 1TME2 4OQ8A 2I45A 5J98B 2R16A 2JDZA 2Q1MA 4GA9A 4AFBA 1OQDA 1K5MB 4A6OA 5FOJB 1O8PA 3VB9A 3GJAA 2ZABA 4Q8KA 2DV9A 4L97A 3SMHA 5C8CC 3I3MA 3VKNA 1OQEA 4FAHA 1YI7A 3ES1A 2C4XA 2ZJCA 3THPA 1JODA 1X36A 1OKQA 1RMU1 2VH9A 4LIVA 4AG4A 5A3LA 3POIA 3MW2A 3WNXA 5IVBA 2RS52 4PIXA 3ZOIA 1V6IA 3WNPA 5HXMA 2B7YA 1RHI2 1IS6A 4PDWC 1GOGA 4WZFA 2Q8EA 4WVWA 3JB4C 1BXHA 1LHUA 3LB9A 2UYAA 1ZYBA 3HWJA 2QQKA 4PHZA 4K20A 3E6CC 5HCFA 1LAJA 5A7OA 1FMD1 3LGRA 3WQ1A 4TTGA 1CPNA 3AKQA 4QX5A 1AR81 4YFWA 3POFA 5D2AA 3V0BB 4Y5TA 4YSFA 1MS3A 2BWCA 4P9GA 2R7EB 5JIUA 2VMGA 1KS5A 3VBSA 4LA2A 4XMIA 1UNBA 3S0MA 2XMLA 1LODA 4ZU5A 2IVIB 4YGCA 1NE6A 1YQ2A 1FPN3 4BYYA 3DV8A 1H4HA 4GWIA 5JZGA 1VBC2 1QNYA 2YU2A 4NRPA 4UW4A 3MEPA 4E2GA 3JZVA 2VG9A 3DYOA 2FCVA 4M4PA 2VCCA 4PDWB 1DQ2A 3NV1A 4X6QB 4NPRA 2ZMLA 5CISA 2FD8A 1OOPA 2XH6A 3Q8FA 3RYPA 3VKMA 4BQ3A 3H8UA 1KJLA 3POJA 3KGLA 2HWE2 3T1MA 1RIRA 1UY4A 1MR5A 4V2VA 1CIWA 1HRV3 3SHRA 1AR63 5HCHA 4XJ9A 4Q1RA 3P6BA 1L7QA 5B4NA 1W03A 3RJRA 4LEJA 2Y0OA 4BLIA 2XJRA 3VBFC 5E88A 5GLTA 2YY1A 3WDVA 1GYKA 2B39A 2HBTA 2LW8A 2P5BA 2TNFA 2CNAA 2W2IA 4I0BA 2WZR1 3C7HA 2CL2A 1YQCA 2Q4SA 5A3OA 2RMU2 4XMAA 2V73A 4PF5A 5FZOA 2DU1A 1UY2A 4IETA 3VZMA 1MZEA 5FR3A 5IT6A 1A34A 3AKSA 1RUJ3 1W3XA 1PX3A 3MIGA 3USSA 2D40A 4JC1A 1S1AA 2A6XA 2Q8CA 1QJFA 2J1SA 4L9BA 2A3XA 4GMP1 5E6HA 1AHSA 5F3IA 1AL23 2DCYA 1C5HA 4P00B 1MS0A 4HBNA 1NQDA 2YV8A 4A7KA 2ZX2A 1GOHA 4CA9A 4LHLA 1VP6A 3V0AA 3AJZA 4ZU4A 1K42A 3RVHA 2FHRA 3M3IA 1PGW1 2E63A 4LR4A 3OGJA 1O4YA 1V6KA 2WS92 4WV8A 1IZ3A 2XJTA 3OGRA 4NHMA 4OCTA 1WD4A 5J37A 3ME2A 1OLQA 2JDYA 1JUIA 1TME3 4FPYA 3JBG2 5I93A 3CF6E 5F8PA 5H9PA 3PIGA 1RUG1 3OB8A 1VIWB 1GBGA 1LEMA 3CJIC 2GNTA 4FP3A 4FPKA 1F4AA 3POWA 4AL9A 3I3BA 4GZ9A 4YG3A 2BGOA 2WDBA 4PT6A 3AYCA 5FMCA 5FZDA 2YMZA 5ACA2 4IQPA 1DQ4A 2A6ZA 4ZHNA 3V64A 5IAVA 4QQ2A 3OYWB 2C1FA 1FI2A 2E7AA 1ZBE1 3VHNA 4LUKA 4UBGA 2VR4A 2GC2A 5FZMA 4LMFA 4OYUA 4AVVA 2V5DA 1JI6A 1VB2A 2L9LA 4NWVA 3ELNA 4LHSA 5A3MA 4DY3A 4MXWA 2R6QA 1HQLA 1JU3A 4RS5A 5LATA 2P34A 2Z79A 3CZUA 2C9KA 2G9ZA 4IXLA 5F39A 1TMF2 3DEMA 3CJIB 1GICA 4L2NA 1WLDA 1DCSA 4P9LA 2QUOA 4R9AA 5FKBA 4YVWA 5IVJA 3M7AA 4YNIA 3AVRA 4YPJA 4PCRA 1WMEA 4DUXA 3WUCA 2B45X 1QJU2 1CAXB 2GZWA 4Y4RA 3SEEA 5I0RA 4W65A 2QQVA 3OUIA 4ES8A 1J58A 4J1WA 3CZJA 2RS13 5DDJ2 2PELA 3HR9A 4MX3A 4YZ3A 1PM4A 2VAUA 4RS5B 3CL1A 3IWZA 1W6NA 1MS1A 3C2UA 5CIRA 1REDA 4OI0A 4ATFA 1WKYA 4XZPA 4B7EA 1VBA1 4YVWB 3B5LB 5C70A 5F37A 3HNYM 2ES3A 1OF4A 2CAUA 4KWLA 5SV5A 1SFPA 2W9XA 5C9AC 4IV1A 1C1LA 3QACA 4YM2A 4RHV1 1RUE1 4A44A 1D0HA 1V00A 3IMNA 2VVFA 2VCMA 4RYDA 2JDUA 2RE9A 4XIOA 4CZSA 3Q9OA 3WLUA 5FUIA 4X8NA 2Q8DA 1S2EA 4GD4A 3MIEA 4N43C 5FQ0A 1YC61 3WW2A 5A7WB 4QGMA 5FPBA 4Y1ZA 5FPAA 5HPOA 4MGIE 1AL0G 4PIZA 4XFIA 1BK0A 2HEYF 4Y22A 2J42A 3ZPYA 1IQDC 2RMU3 3P3PA 4FQ4A 4BA6A 1ENQA 2O8OA 1W2OA 1QJX1 1DQ6A 2HWB3 2VE1A 4EZ4A 2X05A 4QWNA 1A6CA 1N1TA 4CUGA 1VAKA 1LU1A 2R061 4XABA 4XFFA 2VNGA 5D8AB 2GN7A 3T4HB 4D6SA 2Y6GA 4P08A 3LEKA 1PMIA 1TNFA 5FQ0B 1QY4A 2VMIA 3A0KA 5BNNC 5M0TA 4D7TA 1HJGA 4DUVA 2C5DA 3T30A 3FZ3A 3HT1A 3WY6A 5JXIA 2D93A 4B4RA 3VBUC 1OURA 4K8RB 1VBE3 2Y6HA 1D7PM 2ZS6B 3E5QA 2W0XA 2XPJA 4Q4X2 1VAVA 1AZDA 3S5AA 1LGBA 4RFT0 3NRUA 3WOGA
chains in the Genus database with same CATH topology
4GWJA 2HLEA 2WBKA 2RVAA 5DMYA 1ULPA 3WF4A 4QX1A 4CU7A 2WZEA 4KMQA 1US2A 3C7FA 3THCA 2VC9A 3I97A 3MV11 2E31A 2Y6JA 4MADA 2VZTA 1JZ7A 1JHJA 1HN1A 3VD3A 1NUKA 4DXTA 3LQCA 1W8NA 2WABA 3MBWA 3GGLA 2JKXA 3OGSA 2VMDA 1UYXA 1H6YA 2BBAA 4QDRA 2WN2A 2EIBA 1SG3A 3NJVA 2W94A 1TVGA 1XC6A 2VMFA 3EB7A 2QQIA 5JUVA 2YG0A 1K12A 4QDQA 4ARXA 3HNBM 4D8MA 5LA1A 2B4KA 3WNLA 4E8DA 2J1VA 3AC0A 4QX3A 4W4ZA 4OZOA 2VZ3A 3C7GA 4XUNA 3A21A 2W47A 2V72A 3WEZA 2WUHA 5DN2A 4JKMA 2VL4A 4XURA 5LA2A 2B9VA 1CZTA 4ZZ8A 4QX2A 4OMDA 2DCJA 1GMMA 2VM9A 2VCAA 2DDUA 3VDBA 3GDBA 2VMCA 3OBAA 1TG7A 2BGPA 2YB7A 3JXSA 5JXGA 2QBXA 4CVUA 3K46A 3IB3A 1JZ5A 3WNMA 1LNSA 3C8XA 2CDPA 2BERA 3PUHA 4CU8A 1GOFA 4JHZA 2J22A 5EJZB 4A42A 1JZ2A 3T0DA 1UZ0A 1GU3A 2OKXA 1UMHA 2Y64A 1K3IA 2ORZA 3I2GA 3I2FA 4DEQA 4A41A 2PQSA 2VZ1A 2Y6LA 3HOBA 3WF0A 2ZXQA 2VZQA 3LEIA 2Y8KA 3IAPA 2RV9A 2VQUA 2ZEYA 4XUOA 3LEGA 3IIIA 2KD7A 2WO1A 1W9SA 5IFTA 5DQ0A 3DYMA 4BK4A 3ACGA 2VZPA 2J1RA 1US3A 1JZ3A 2C26A 2E32A 1OD3A 3D3AA 3I3DA 3SEPA 2QQMA 4ZY9A 2BZDA 2VZSA 2W1QA 2W3JA 3K4AA 3T0AA 4DUWA 3HN3A 3T2QA 1CZVA 3I2JA 1DLCA 4CU6A 4JKLA 2EICA 4W50A 2XHNA 3FHAA 2DCKA 2W87A 2WN3A 5CYYA 4P02B 4PQQA 3PUIA 3LPGA 3LE0A 2VO5A 1J83A 4CU9A 2CDOA 3ECQA 4DEVA 3T08A 5IJRA 3VD7A 3VD9A 4FI9A 1GNYA 3NJXA 3IDAA 4W8JA 3ETPA 4ZXEA 4E8CA 4DXRA 5A1AA 5JR2A 5IYYA 3HJRA 2WAOA 3FHQA 5G04L 5C71A 1H6XA 3I3EA 1NX9A 3K4DA 1K45A 3C7OA 4BDVB 5F7UA 4BK5A 2VZVA 3CIHA 2EIDA 3UESA 2QQNA 1W9TA 1NKGA 3MO4A 3MUY1 3DECA 2W5FA 5LA0A 2W92A 3T2OA 2VMEA 3K4ZA 2XONA 1T2XA 3W5MA 1JZ6A 3OEAA 4QB2A 2ID4A 1PX4A 1UMIA 3I2IA 2J1EA 1UYYA 2W1UA 1KEXA 2JD9A 4UOJA 4A4AA 1EUTA 1RYYA 4D0QA 4DXSA 1W0NA 3GM8A 1GQPA 2VZRA 4LPLA 4MOAA 3WF2A 1R64A 2ZEZA 4P5YA 3CQOA 3OEBA 1JYVA 3IAQA 1EUUA 1OT5A 1PMHX 1XPWA 2YFUA 3FN9A 5B4XA 4A6OA 1O8PA 3VDAA 2X09A 3UNPA 2Y6KA 4QPWA 1O8SA 3A22A 2C4XA 4UI9L 3HNMA 2HYXA 3ZM8A 1UY1A 1UY3A 3MV01 4AG4A 4CUBA 3WNPA 1J84A 5HXMA 3WQBA 4XVHA 4QB6A 1GOGA 4HG6B 2J1UA 2VZUA 2QQKA 2XQXA 3BN6A 2WYSA 3ACHA 1JZ8A 2W46A 4TTGA 5CZKA 4L0PA 4MGSA 3U37A 4XUPA 3K75B 1XNTA 2R7EB 3I2KA 4MO3M 3T0BA 4BJ0A 1BHGA 3T2PA 2RJ2A 3VD5A 3THDA 1YQ2A 4CUCA 4GWIA 2VJXA 3SKJE 3DYPA 3NNGA 3MUZ1 2WQ8A 2WO2A 3DYOA 4M4PA 2VCCA 4XUTA 4JX0A 4A3ZA 3FL7A 4LQRA 1OH4A 1WCQA 1UY4A 3ABZA 4AAXA 1W99A 3BGAA 3CMGA 1L7QA 2VQTA 3P6BA 2LS6A 5B4NA 1UWWA 1OF3A 2LW8A 3W5NA 3I2HA 4QX0A 1UX7A 3C7HA 4OMCA 1I5PA 2W91A 3K77A 3LPFA 4UAPA 1UY2A 4ARYA 1MPXA 1PX3A 2ORXA 3GXUA 2W1WA 4JKKA 1NAEA 2J1SA 5C7GA 2WAAA 2W1SA 1UY0A 2QQLA 2ZEWA 3F2ZA 1CX1A 4P00B 2YFZA 1GOHA 3OGVA 4PF1A 4M4RA 1K42A 4RN5A 3OGRA 3WF1A 5IHRA 2E26A 1DP0A 2QQOA 2VTFA 3OB8A 1W8OA 4OUEA 3T09A 5DPNA 4LKSA 1F4AA 1JU4A 1ULOA 3I3BA 5IFPA 4GZ9A 1KGYA 2BGOA 2WDBA 2YC4A 4PT6A 3WNOA 3SKVA 2WO3A 2J1AA 2VCBA 3WNKA 5G05L 1UXZA 5JXJA 3VDCA 2VR4A 2JE8A 3HEIA 4IUGA 4OYUA 2V5DA 1JI6A 3WSOA 4ZZ5A 2L9LA 4KI5M 2X10A 1XNAA 4LHSA 1DYOA 2V4VA 3UETA 2VOTA 5JMOA 1JU3A 2EIEA 3CZUA 1JYWA 2C9KA 2J7MA 3OG2A 4A45A 4YPJA 2ZEXA 4DUXA 4ET7A 3CKHA 3SEEA 3P1IA 3VD4A 4QDSA 2QQJA 3CZJA 1JZ4A 1L7RA 4XUQA 3CDZB 1SHWB 4CUAA 1CIYA 4KWUA 1JYNA 1WKYA 1UXXX 4XZUG 1JYXA 5C70A 2XOMA 3EYPA 3HNYM 1SDDB 1OF4A 3A7QA 2W9XA 4QB1A 2VZOA 5I0DA 4A44A 4MGQA 3WF3A 5LCWL 4QAWA 4RYDA 5J1XA 1CZSA 5FUIA 3NQHA 3ACIA 2YC2A 4Z2AA 3ACFA 5HPOA 1GUIA 3C7EA 1O59A 1IQDC 1P8JA 3HPNA 5JXHA 2X05A 1F4HA 4TXWA 3E1F1 2JDAA 1UYZA 2Y6GA 4BXSV 2WZ8A 4P08A 3LEKA 5EJ1B 2Z4FA 3J7HA 4DUVA 5EIYB 5JXIA 1PMJX 2E33A 2Y6HA 1D7PM 1W9WA 2J1TA 3A23A 2W95A 3NRUA 3WNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWJ A;  2HLE A;  2WBK A;  2RVA A;  5DMY A;  1ULP A;  3WF4 A;  4QX1 A;  4CU7 A;  2WZE A;  4KMQ A;  1US2 A;  3C7F A;  3THC A;  2VC9 A;  3I97 A;  3MV1 1;  2E31 A;  2Y6J A;  4MAD A;  2VZT A;  1JZ7 A;  1JHJ A;  1HN1 A;  3VD3 A;  1NUK A;  4DXT A;  3LQC A;  1W8N A;  2WAB A;  3MBW A;  3GGL A;  2JKX A;  3OGS A;  2VMD A;  1UYX A;  1H6Y A;  2BBA A;  4QDR A;  2WN2 A;  2EIB A;  1SG3 A;  3NJV A;  2W94 A;  1TVG A;  1XC6 A;  2VMF A;  3EB7 A;  2QQI A;  5JUV A;  2YG0 A;  1K12 A;  4QDQ A;  4ARX A;  3HNB M;  4D8M A;  5LA1 A;  2B4K A;  3WNL A;  4E8D A;  2J1V A;  3AC0 A;  4QX3 A;  4W4Z A;  4OZO A;  2VZ3 A;  3C7G A;  4XUN A;  3A21 A;  2W47 A;  2V72 A;  3WEZ A;  2WUH A;  5DN2 A;  4JKM A;  2VL4 A;  4XUR A;  5LA2 A;  2B9V A;  1CZT A;  4ZZ8 A;  4QX2 A;  4OMD A;  2DCJ A;  1GMM A;  2VM9 A;  2VCA A;  2DDU A;  3VDB A;  3GDB A;  2VMC A;  3OBA A;  1TG7 A;  2BGP A;  2YB7 A;  3JXS A;  5JXG A;  2QBX A;  4CVU A;  3K46 A;  3IB3 A;  1JZ5 A;  3WNM A;  1LNS A;  3C8X A;  2CDP A;  2BER A;  3PUH A;  4CU8 A;  1GOF A;  4JHZ A;  2J22 A;  5EJZ B;  4A42 A;  1JZ2 A;  3T0D A;  1UZ0 A;  1GU3 A;  2OKX A;  1UMH A;  2Y64 A;  1K3I A;  2ORZ A;  3I2G A;  3I2F A;  4DEQ A;  4A41 A;  2PQS A;  2VZ1 A;  2Y6L A;  3HOB A;  3WF0 A;  2ZXQ A;  2VZQ A;  3LEI A;  2Y8K A;  3IAP A;  2RV9 A;  2VQU A;  2ZEY A;  4XUO A;  3LEG A;  3III A;  2KD7 A;  2WO1 A;  1W9S A;  5IFT A;  5DQ0 A;  3DYM A;  4BK4 A;  3ACG A;  2VZP A;  2J1R A;  1US3 A;  1JZ3 A;  2C26 A;  2E32 A;  1OD3 A;  3D3A A;  3I3D A;  3SEP A;  2QQM A;  4ZY9 A;  2BZD A;  2VZS A;  2W1Q A;  2W3J A;  3K4A A;  3T0A A;  4DUW A;  3HN3 A;  3T2Q A;  1CZV A;  3I2J A;  1DLC A;  4CU6 A;  4JKL A;  2EIC A;  4W50 A;  2XHN A;  3FHA A;  2DCK A;  2W87 A;  2WN3 A;  5CYY A;  4P02 B;  4PQQ A;  3PUI A;  3LPG A;  3LE0 A;  2VO5 A;  1J83 A;  4CU9 A;  2CDO A;  3ECQ A;  4DEV A;  3T08 A;  5IJR A;  3VD7 A;  3VD9 A;  4FI9 A;  1GNY A;  3NJX A;  3IDA A;  4W8J A;  3ETP A;  4ZXE A;  4E8C A;  4DXR A;  5A1A A;  5JR2 A;  5IYY A;  3HJR A;  2WAO A;  3FHQ A;  5G04 L;  5C71 A;  1H6X A;  3I3E A;  1NX9 A;  3K4D A;  1K45 A;  3C7O A;  4BDV B;  5F7U A;  4BK5 A;  2VZV A;  3CIH A;  2EID A;  3UES A;  2QQN A;  1W9T A;  1NKG A;  3MO4 A;  3MUY 1;  3DEC A;  2W5F A;  5LA0 A;  2W92 A;  3T2O A;  2VME A;  3K4Z A;  2XON A;  1T2X A;  3W5M A;  1JZ6 A;  3OEA A;  4QB2 A;  2ID4 A;  1PX4 A;  1UMI A;  3I2I A;  2J1E A;  1UYY A;  2W1U A;  1KEX A;  2JD9 A;  4UOJ A;  4A4A A;  1EUT A;  1RYY A;  4D0Q A;  4DXS A;  1W0N A;  3GM8 A;  1GQP A;  2VZR A;  4LPL A;  4MOA A;  3WF2 A;  1R64 A;  2ZEZ A;  4P5Y A;  3CQO A;  3OEB A;  1JYV A;  3IAQ A;  1EUU A;  1OT5 A;  1PMH X;  1XPW A;  2YFU A;  3FN9 A;  5B4X A;  4A6O A;  1O8P A;  3VDA A;  2X09 A;  3UNP A;  2Y6K A;  4QPW A;  1O8S A;  3A22 A;  2C4X A;  4UI9 L;  3HNM A;  2HYX A;  3ZM8 A;  1UY1 A;  1UY3 A;  3MV0 1;  4AG4 A;  4CUB A;  3WNP A;  1J84 A;  5HXM A;  3WQB A;  4XVH A;  4QB6 A;  1GOG A;  4HG6 B;  2J1U A;  2VZU A;  2QQK A;  2XQX A;  3BN6 A;  2WYS A;  3ACH A;  1JZ8 A;  2W46 A;  4TTG A;  5CZK A;  4L0P A;  4MGS A;  3U37 A;  4XUP A;  3K75 B;  1XNT A;  2R7E B;  3I2K A;  4MO3 M;  3T0B A;  4BJ0 A;  1BHG A;  3T2P A;  2RJ2 A;  3VD5 A;  3THD A;  1YQ2 A;  4CUC A;  4GWI A;  2VJX A;  3SKJ E;  3DYP A;  3NNG A;  3MUZ 1;  2WQ8 A;  2WO2 A;  3DYO A;  4M4P A;  2VCC A;  4XUT A;  4JX0 A;  4A3Z A;  3FL7 A;  4LQR A;  1OH4 A;  1WCQ A;  1UY4 A;  3ABZ A;  4AAX A;  1W99 A;  3BGA A;  3CMG A;  1L7Q A;  2VQT A;  3P6B A;  2LS6 A;  5B4N A;  1UWW A;  1OF3 A;  2LW8 A;  3W5N A;  3I2H A;  4QX0 A;  1UX7 A;  3C7H A;  4OMC A;  1I5P A;  2W91 A;  3K77 A;  3LPF A;  4UAP A;  1UY2 A;  4ARY A;  1MPX A;  1PX3 A;  2ORX A;  3GXU A;  2W1W A;  4JKK A;  1NAE A;  2J1S A;  5C7G A;  2WAA A;  2W1S A;  1UY0 A;  2QQL A;  2ZEW A;  3F2Z A;  1CX1 A;  4P00 B;  2YFZ A;  1GOH A;  3OGV A;  4PF1 A;  4M4R A;  1K42 A;  4RN5 A;  3OGR A;  3WF1 A;  5IHR A;  2E26 A;  1DP0 A;  2QQO A;  2VTF A;  3OB8 A;  1W8O A;  4OUE A;  3T09 A;  5DPN A;  4LKS A;  1F4A A;  1JU4 A;  1ULO A;  3I3B A;  5IFP A;  4GZ9 A;  1KGY A;  2BGO A;  2WDB A;  2YC4 A;  4PT6 A;  3WNO A;  3SKV A;  2WO3 A;  2J1A A;  2VCB A;  3WNK A;  5G05 L;  1UXZ A;  5JXJ A;  3VDC A;  2VR4 A;  2JE8 A;  3HEI A;  4IUG A;  4OYU A;  2V5D A;  1JI6 A;  3WSO A;  4ZZ5 A;  2L9L A;  4KI5 M;  2X10 A;  1XNA A;  4LHS A;  1DYO A;  2V4V A;  3UET A;  2VOT A;  5JMO A;  1JU3 A;  2EIE A;  3CZU A;  1JYW A;  2C9K A;  2J7M A;  3OG2 A;  4A45 A;  4YPJ A;  2ZEX A;  4DUX A;  4ET7 A;  3CKH A;  3SEE A;  3P1I A;  3VD4 A;  4QDS A;  2QQJ A;  3CZJ A;  1JZ4 A;  1L7R A;  4XUQ A;  3CDZ B;  1SHW B;  4CUA A;  1CIY A;  4KWU A;  1JYN A;  1WKY A;  1UXX X;  4XZU G;  1JYX A;  5C70 A;  2XOM A;  3EYP A;  3HNY M;  1SDD B;  1OF4 A;  3A7Q A;  2W9X A;  4QB1 A;  2VZO A;  5I0D A;  4A44 A;  4MGQ A;  3WF3 A;  5LCW L;  4QAW A;  4RYD A;  5J1X A;  1CZS A;  5FUI A;  3NQH A;  3ACI A;  2YC2 A;  4Z2A A;  3ACF A;  5HPO A;  1GUI A;  3C7E A;  1O59 A;  1IQD C;  1P8J A;  3HPN A;  5JXH A;  2X05 A;  1F4H A;  4TXW A;  3E1F 1;  2JDA A;  1UYZ A;  2Y6G A;  4BXS V;  2WZ8 A;  4P08 A;  3LEK A;  5EJ1 B;  2Z4F A;  3J7H A;  4DUV A;  5EIY B;  5JXI A;  1PMJ X;  2E33 A;  2Y6H A;  1D7P M;  1W9W A;  2J1T A;  3A23 A;  2W95 A;  3NRU A;  3WNN A; 
#chains in the Genus database with same CATH topology
 4GWJ A;  2WS9 3;  3NKG A;  4Q27 A;  4CPB D;  2YBS A;  1LOF C;  1WMF A;  3NNF A;  2RVA A;  3NAP C;  1QHD A;  5ISL A;  3PDQ A;  5T50 A;  2ZGO A;  3AP6 A;  3LSE A;  4QX1 A;  5HCB A;  5JOW A;  2BOI A;  1XXN A;  3IKW A;  3JBG 3;  1YFU A;  4AVB A;  4C0H A;  3WDY A;  4UW3 A;  3C7F A;  2D6K A;  1UOG A;  3THC A;  5ABJ C;  4L99 A;  5FUP A;  2JDH A;  2OZJ A;  2E31 A;  2WO7 A;  2DVD A;  2QJV A;  2Y6J A;  4MAD A;  4YW3 A;  4DPN A;  4LXL A;  5ACA 3;  4K1Y A;  4XQW A;  1HN1 A;  4CCJ A;  2C6S A;  2N7G A;  3VBU B;  1I9R A;  1VBB 2;  4JCK A;  2VW0 A;  3ZFF A;  1JS9 A;  3LQC A;  2EXI A;  1QXJ A;  1W8N A;  4DRR A;  5AC9 2;  5LY1 A;  3MBW A;  3GGL A;  4AED C;  3OGS A;  5GZG A;  1LOA A;  2ARX A;  2VMD A;  3B93 A;  3NAP B;  1VLN A;  4QDR A;  2PMW B;  5C6C A;  5IK8 A;  2WN2 A;  4LIT A;  1SG3 A;  5L9V A;  3KD4 A;  5FLI A;  3KQR A;  3EB7 A;  1TMF 3;  4UFI A;  4RA0 A;  5DAX A;  2IWG B;  2QQI A;  5ABJ B;  1BMV 2;  1DIW A;  4B4P A;  1M4W A;  1G86 A;  3VHO A;  4AQS A;  4BQX A;  1K12 A;  4QDQ A;  2AEZ A;  5A7P A;  4FOW A;  3HNB M;  4CXW A;  1UL9 A;  4LJH A;  1QJU 3;  4FPJ A;  4XFA A;  4QHB A;  1Q8O A;  2QKD A;  4UYB A;  1S0B A;  2WNU A;  5DDJ 3;  2FDJ A;  4ASM B;  5KXB A;  4FFH A;  3K2O A;  4D69 A;  1CAW B;  2A71 A;  2J1V A;  4AED B;  4QX3 A;  1RXF A;  4W4Z A;  1SLL A;  2VZ3 A;  2Y34 A;  5FZL A;  4LBO A;  1N1S A;  4HK8 A;  1MQT C;  2R04 2;  3RG0 A;  1EV1 2;  1GWL A;  5DZE A;  3MW4 A;  4XFH A;  4COZ A;  5CFD C;  4ITC A;  5GZC A;  2VQA A;  3A21 A;  1N47 A;  2ZMK A;  3DN7 A;  3BIE A;  3DF0 A;  1VBD 3;  3AFG A;  3WEZ A;  4Y24 A;  3ON7 A;  1ULG A;  2DCT A;  3WP3 A;  1KS4 A;  2VL4 A;  2PTM A;  1NCR A;  3J8F 1;  4IW3 A;  4NPL A;  1Q8P A;  3BOW A;  5ANN A;  3THT A;  4NHY A;  2HWF 2;  4QX7 A;  1GZW A;  3U4S A;  1UKR A;  3CU7 A;  1EPZ A;  1ZZ6 A;  2JG8 C;  2DWR A;  2B9U A;  1XU1 A;  3BUC A;  5FZG A;  2ILM A;  2QDN A;  1LHV A;  4URT A;  2YB7 A;  5KHI A;  1G9F A;  3ZYH A;  5A1F A;  1RUF 2;  5FO8 B;  2FMD A;  5JXG A;  4PJY A;  1WMX A;  1DG6 A;  3IB3 A;  3VGI A;  2KXL A;  4OFG A;  4YFZ A;  1LES A;  3ZMO A;  1LCL A;  4FFG A;  5HXV A;  3C8X A;  3H1W A;  2BER A;  3AKP A;  4LO7 A;  2KR2 A;  1BKZ A;  1GZW B;  1RIT A;  5C5U A;  1Q5O A;  4AYU A;  2CGN A;  3J9S A;  3SCG A;  2RJK A;  1GOF A;  2J22 A;  5CAZ A;  4M3C B;  5FAX A;  1GU3 A;  2VU9 A;  2D98 A;  5FPZ A;  2JG8 B;  2Y64 A;  2OUJ A;  4CPB A;  2JG9 C;  1K3I A;  4AI9 A;  2AGS A;  5FPX A;  4UFM A;  1HKD A;  4UFK A;  4I02 A;  5F3C A;  4NMI A;  3ZYR A;  2TUN A;  2Y6L A;  3HOB A;  4JRL A;  1NY7 1;  2VOK A;  2WKK A;  4HPK B;  1HV0 A;  1PHM A;  3ILF A;  2RM2 3;  3WG4 A;  2VQU A;  1FOD 2;  2PHR A;  3LIH A;  4BIF A;  3U11 A;  1OFS A;  2GNM A;  4RD7 A;  4IGO A;  3LEG A;  1L3J A;  3III A;  2NMO A;  1RUD 1;  1C57 A;  2YPJ A;  5IW0 A;  4XW3 A;  3UL2 A;  5IFT A;  4P14 A;  1OMI A;  1PO2 1;  1TEI A;  4K9S A;  3RYK A;  1S0I A;  4HXC A;  2IZW A;  4YVS C;  2XUM A;  1LEN A;  1H8T C;  2HWD 1;  2NZ9 A;  4S2F A;  3LSD A;  3MYX A;  4MUV A;  1C8M 2;  3D3A A;  3OBZ A;  2JG9 B;  2RR1 1;  1QH6 A;  1VBB 3;  4HZF A;  1T6G C;  5DAQ A;  2WA3 A;  2D6P A;  5FLH A;  5AC9 3;  3B94 A;  5TSW A;  1QQP 3;  2W1Q A;  2W3J A;  1MZ5 A;  2SBA A;  3OGG A;  3T0A A;  1JBC A;  1RUH 2;  2PHL A;  3T2Q A;  3PUR A;  1TNR A;  3RMY A;  1NQJ A;  1SPP A;  2PA7 A;  3I2J A;  5FY0 A;  4CU6 A;  4K3U A;  1PGL 2;  4JKL A;  3N7M A;  1YYN A;  4OQ9 A;  3RS6 A;  1B09 A;  2XHN A;  3FHA A;  3ZR6 A;  3O1R A;  2W87 A;  1KRI A;  5C5T A;  1ULC A;  4YVS B;  3IDB B;  4TLG A;  1H8T B;  2VO5 A;  1PIV 3;  4CU9 A;  2CDO A;  1JOB A;  3ECQ A;  4YM0 A;  5BNP A;  3KLS A;  2QVS B;  4PLM A;  3UGF A;  1Q43 A;  4MGK E;  3NJX A;  3V65 A;  1UIJ A;  5FYV A;  2BNO A;  1ASJ 2;  1JXN A;  5DZG A;  4LBQ B;  4ZXE A;  5HCA A;  3F95 A;  4TYS A;  5IYY A;  1QOT A;  1KJR A;  2E9Q A;  4Q4V 1;  2HWC 2;  3DXT A;  5GLZ A;  1O91 A;  2R04 3;  3WW4 A;  3ZN4 A;  4CRQ A;  1EV1 3;  1GAN A;  4IGQ A;  1O4Z A;  1HB1 A;  3DKW A;  2JXA A;  2WFP A;  1Z78 A;  1COV 3;  3Q8C A;  5T52 A;  2EF6 A;  4V1P A;  1V9U 2;  3AMH A;  4HK9 A;  4CDX A;  1N1Y A;  1WLT A;  2MEV 2;  1F9K A;  4BK5 A;  2PLV 2;  2QZ3 A;  3UES A;  3PL0 A;  3ZFG C;  3RZZ A;  2ZMN A;  1CR7 A;  1W9T A;  2A5Z A;  1CPM A;  2EXJ A;  1SQ4 A;  3HMY A;  2I2S A;  5GLW A;  1FNY A;  1ENX A;  3MO4 A;  1AYN 2;  3TYJ A;  4MGZ E;  1WCU A;  3DEC A;  4C8D A;  1MAC A;  1W9F A;  1JH5 A;  1YFW A;  2K9Z A;  4XBN A;  4IEU A;  4QPI C;  2VME A;  4LTA A;  4NVP A;  2YDE A;  4AQ6 A;  3O0W A;  1T2X A;  5A6Y A;  3CNA A;  4WVV A;  1URX A;  1NG0 A;  4D6Q A;  3PHM A;  4QQO A;  3PUQ A;  2Q1Z B;  4WM7 A;  1GFF 2;  4AK3 A;  2BNM A;  2JIC A;  2PHD A;  4A4A A;  3CBN A;  3RWN A;  3LWC A;  5FPL A;  3TOJ A;  3ZFG B;  2A3W A;  5FMD A;  2Q8O A;  5FZ3 A;  4DRV A;  1POV 1;  2PAM A;  2W68 A;  4FP2 A;  3IAQ A;  4CEW A;  1IOA A;  2WII B;  5F6K A;  1Y7B A;  4GB3 3;  1ZNP A;  1IS5 A;  2G9F A;  3MLJ A;  4FQZ A;  4QPI B;  2P3J A;  5FZ1 A;  2ZCW A;  5GLV A;  2WFF 3;  2VUA A;  5LBB A;  1V70 A;  2UY8 A;  1OH3 A;  4LBL A;  1FOD 3;  2JIJ A;  3I2O A;  4QPW A;  1R1A 3;  2WQ4 A;  2JIG A;  3ZO0 B;  1AR7 2;  1WBL A;  3R0R A;  3A22 A;  1L7L A;  2PAK A;  4Q2F A;  4UI9 L;  3HNM A;  5FKC A;  1WA4 A;  3ZM8 A;  1NZI A;  1D0G A;  4CEW B;  1UY3 A;  4QKB A;  1X9P A;  5T3N A;  3LF7 A;  3TWI A;  2XDV A;  4BQ1 A;  4XBL A;  1EAH 1;  1J84 A;  1C8M 3;  4MG2 A;  1WCS A;  3QD6 A;  1NCQ C;  2YBK A;  3RRD A;  2VZU A;  3JQX A;  1YIP A;  5JSP A;  2XQX A;  4GH4 A;  1OVP A;  1QJY 2;  4QQL A;  5FP4 A;  4AHW A;  5C3Q A;  3O1M A;  3OD4 A;  2X5I C;  5FP9 A;  3I4I A;  3MFA A;  2JWP A;  2W46 A;  5CZK A;  2VD7 A;  1BEV 2;  4L0P A;  1SFY A;  4MGY E;  4XDO A;  1S4C A;  1ULE A;  4U2A A;  5L7O B;  1XYO A;  4MO3 M;  3T0B A;  1VR3 A;  4PI2 A;  1CJD A;  1SFN A;  1ZVF A;  4BJ0 A;  1V6O A;  4L92 A;  2RS3 1;  5EP9 A;  4BXF A;  2RJ2 A;  5CAD A;  4DB5 A;  4LO8 A;  2K2S A;  2UUR A;  2VJX A;  3NNG A;  1VMF A;  1C8N A;  3QCW A;  2WLQ A;  5K0U A;  2WO2 A;  4CCC A;  4BM8 A;  3OUJ A;  5L36 A;  2ZGU A;  1IS4 A;  3WP6 A;  1NCQ B;  1CAU A;  4XUT A;  5IVF A;  2MPF A;  1TZO A;  4HKW A;  1ASJ 3;  1I5Z A;  2WSV A;  5D1I A;  4A3Z A;  1IKP A;  2A6W A;  3FL7 A;  4AEM A;  1WZX A;  4KH9 A;  1OH4 A;  2ZAA A;  3ASI A;  4R8H A;  1C5I A;  2HWC 3;  5ANQ A;  3WXP A;  1PVX A;  1HB2 A;  2D5H A;  3E5X A;  2YXS A;  5A3U A;  5KXC A;  3ILN A;  1W99 A;  4NRM A;  3CMG A;  2WT1 A;  4WM8 A;  5LY2 A;  2AAC A;  2LS6 A;  2ET7 A;  1HRI 1;  1RUN A;  4MSV A;  2HYK A;  2WWJ A;  3S6P A;  1J3R A;  3MIF A;  4A2U A;  3ST7 A;  3PVB B;  2PLV 3;  2FZ2 A;  3J7N A;  3BIW E;  3I59 B;  1UIK A;  3WP5 A;  4N53 C;  4OMC A;  1ALY A;  1I5P A;  2W91 A;  3AK0 A;  3RPQ A;  1AYN 3;  5K4L A;  3GZU C;  3RMX A;  1MPX A;  4AVC A;  1UU5 A;  2F4L A;  1XYN A;  1W6P A;  2OUH A;  2Q0A A;  3FBM A;  3H50 A;  4ZS3 A;  5BNO B;  5DG2 A;  3ZSE A;  2VTX J;  2AZ5 A;  4O65 A;  3TNQ A;  1S0E A;  1NLS A;  1NAE A;  1UD1 A;  5C7G A;  1VAL A;  2W1S A;  2QQL A;  1W0P A;  4FPO B;  1WLC A;  4XTM A;  1PZ7 A;  3I3Q A;  1H9W A;  1W2T A;  1O3T A;  3S57 A;  1SLB A;  5JI9 A;  2D3S A;  2CGO A;  4Q1P A;  3EBR A;  1W9Y A;  2ZKL A;  1S2B A;  2WLP A;  4HSJ A;  4XJ8 A;  4C91 A;  4E4S A;  4RN5 A;  4HMZ A;  4XCA A;  1DHK B;  2KM2 A;  4N8M A;  1BQP A;  3BCW A;  3BKZ A;  1IPK A;  1WUV A;  2JD4 A;  1UW8 A;  2R07 3;  4S2D A;  3O1S A;  1YQ6 A;  2E26 A;  1B35 A;  1DP0 A;  2Q1F A;  2RDN A;  1FAT A;  2ZBJ A;  4Y1Y A;  4AOC A;  5A6X A;  2VTF A;  5FBJ A;  3AM2 A;  1K5M C;  3DPR A;  5FP8 A;  1RMU 2;  4MGT A;  5HV0 A;  5FP7 A;  1ULO A;  1SCR A;  4HON A;  4LBJ A;  1WLW A;  2YC4 A;  1AR7 3;  4XDP A;  1F15 A;  4BH9 A;  4F8A A;  1HX6 A;  4LUL A;  4BOW A;  4YAR A;  1U5Z A;  2X8K A;  1AF9 A;  1ODM A;  2UWA A;  3KWV A;  1A8M A;  5JXJ A;  4YM1 A;  1AVB A;  1FMD 2;  3KT7 A;  4IUG A;  3SNM A;  2WSU A;  2D3R A;  3WVJ A;  4CP9 B;  1AR8 2;  3ROU A;  4KI5 M;  4ZZ5 A;  2OS2 A;  5IVC A;  1CX4 A;  1R08 3;  4FFF A;  5KXE A;  1PZ8 A;  4Q29 A;  5FYY A;  1XSQ A;  1QJY 3;  2EIE A;  3D8C A;  1JYW A;  5IK7 A;  3RJ2 X;  4H7L A;  5GZF A;  2VXR A;  2OT7 A;  1BEV 3;  1HW5 A;  1DLL A;  4QPG B;  2JB4 A;  2ZX3 A;  4CXY A;  4IEX A;  3JUU A;  3HQX A;  2CYF A;  2JKB A;  1H8V A;  3HT2 A;  3P1I A;  5FDB A;  4OUS A;  1X8M A;  1VMH A;  1JZ4 A;  1MS5 A;  4CTE A;  3GCX A;  4K6B A;  5DAP A;  1H4G A;  1L7R A;  2E6V A;  2K46 A;  4LBK A;  5J09 A;  1ZRC A;  2RJL A;  2A73 B;  4M00 A;  1O3R A;  4R9D A;  4YYO A;  5JCT A;  1FT9 A;  4AE2 A;  5FY7 A;  5I0U A;  2DUO A;  2GH2 A;  3ALQ A;  3RFR A;  3AMQ A;  1OUX A;  4XZU G;  4CDQ C;  1ZX5 A;  1SDD B;  4FTB A;  2A1X A;  4BWO A;  3VBS C;  1XE0 A;  2A6Y A;  3A7Q A;  3LD8 A;  1CAV A;  5AVP A;  3R4U A;  1JYC A;  1XE7 A;  3O1O A;  3AB0 A;  2WZR 2;  4MGQ A;  3WF3 A;  3ZXA C;  5FFO C;  1UAI A;  5JMC A;  5JZG C;  2NLR A;  3HIF A;  5C8C A;  2Z69 A;  3NNL A;  4CP0 A;  5FYH A;  3NQH A;  1NLQ A;  1AL2 1;  3ACI A;  2YC2 A;  3APB A;  3HN1 A;  3IZO A;  1C28 A;  2XGX A;  5LWB A;  3ZPO A;  3VL8 A;  1OOP C;  5EHD A;  3C7E A;  3VBR A;  3LDR A;  1P8J A;  1LGC A;  1QDO A;  1KDK A;  2XVG A;  1W8Z A;  3GZA A;  4UFL A;  2K0G A;  4Z82 A;  5FZF A;  4Z07 A;  2D3P A;  5FWE A;  2OVU A;  2TEP A;  3ILR A;  2XLG A;  3VBS B;  4A6S A;  3NV4 A;  4C1X A;  1Q56 A;  3RNS A;  1BVV A;  4BXS V;  2WZ8 A;  1HB4 A;  3H8O A;  1W3V A;  3RI9 A;  3G6J B;  5H9R A;  1PVC 1;  4Z92 B;  1PGW 2;  2OA2 A;  3J7H A;  1UX6 A;  3MW3 A;  5JZG B;  1LOE A;  2ZGL A;  3H7Y A;  4QU1 A;  4I30 A;  3ZIX A;  4ATE A;  3JCI A;  4K1Z A;  2Z2S B;  5E1R A;  1PO1 2;  4CDQ A;  3A23 A;  2W95 A;  3MPB A;  1RTV A;  1OOP B;  1OBN A;  1RUG 2;  4D6R A;  1UPI A;  3B00 A;  4UWD A;  2HLE A;  4WVZ A;  4QX8 A;  4IL7 A;  2VNV A;  2GAL A;  4BIO A;  2DVA A;  1ULP A;  3POS A;  4LHN A;  4CU7 A;  4FAG A;  3UKV A;  2GN3 A;  4L11 A;  4KMQ A;  5EXO A;  5A32 A;  1D2S A;  4KNC A;  4X6R B;  1O5L A;  4E4H A;  2VC9 A;  3OPT A;  1RMU 3;  1HDK A;  1ZBE 2;  2XWJ B;  3FLR A;  5F5A A;  2VVD A;  3R6S A;  3MV1 1;  4XPV A;  3LAG A;  3UKN A;  1PGS A;  1S2K A;  2FCU A;  2VZT A;  3WDW A;  2GNB A;  4LLO A;  1JZ7 A;  2WQZ C;  4J25 A;  4XF0 A;  5FZO B;  3VD3 A;  1RUI 1;  1VRH 1;  2D6O X;  2C0Z A;  4KBZ A;  4DXT A;  2ZGN A;  2EXH A;  5IVY A;  3VBF A;  4E2S A;  2XKP A;  3KT4 A;  4EN9 B;  4XJZ A;  4CCM A;  2RS1 1;  4Q4W 1;  4C90 A;  5FO7 B;  1YJL A;  4FPC A;  1E5H A;  1ZZB A;  4FPF A;  3C3V A;  1ACC A;  1YNA A;  1UU6 A;  3EHK A;  3VBO A;  4NRQ A;  3NJV A;  3VDD A;  4UFJ A;  3J7L A;  2O1Q A;  3FFZ A;  4XF4 A;  1ODN A;  5FJH A;  1W8T A;  3UV9 A;  3V0A B;  3WHU A;  3HBZ A;  1QNW A;  5KHK A;  3U4X A;  2OPW A;  4LLF A;  4D8M A;  5LA1 A;  4Q5O A;  4JTO A;  1LTE A;  1U5I A;  1ZZ9 A;  2PN5 A;  4W6Y A;  4R4Z A;  1VBA 2;  1Q8S A;  3E6B A;  1QKQ A;  1W6O A;  5F6L B;  5DAW A;  5JPN B;  3MID A;  3AC0 A;  2RS5 3;  3J4U H;  4RS5 C;  4OZO A;  2XQR A;  2C24 A;  4JDM A;  4AXO A;  1UOB A;  5EZW A;  3NST A;  1RHI 3;  4RHV 2;  1RUE 2;  3PU3 A;  3LFI A;  4YVW C;  4EWE A;  4XUN A;  2R0F A;  2HWB 1;  3LOI A;  2WUH A;  3GCW A;  1UMZ A;  1H1I A;  4QGN A;  4COV A;  3KS7 A;  1E5S A;  5LA2 A;  4S2H A;  2DBN A;  3Q8A A;  1BLZ A;  2EAL A;  2B9V A;  4LKF A;  5FY4 A;  2IFR A;  5K8S A;  1GKB A;  4ZZ8 A;  1NE4 A;  1GMM A;  2VM9 A;  1CJP A;  1H9P A;  1OQ1 A;  1QJX 2;  5FY1 A;  1ZRI A;  3ZSK A;  5F9T A;  3OBA A;  4ASK A;  4ES9 A;  2R06 2;  1W6Q A;  2BGP A;  1VBE 1;  3JXS A;  4MXW B;  4RFR B;  5FY8 A;  4DXZ A;  1VBC 3;  5IAX A;  2C9A A;  1ZBA 1;  1DYK A;  2XJV A;  4KL1 A;  5DUV A;  4AI1 A;  1PK6 A;  5CG9 A;  2PAE A;  2A3Y A;  3N9L A;  2GND A;  3OOX A;  1FV3 A;  3SIT A;  3ZR5 A;  1LNS A;  3JU9 A;  4KGQ A;  2CDP A;  1XU2 A;  2WWS A;  5D8A C;  1LHO A;  4LE3 A;  3PUH A;  4AFM A;  4I2O A;  4UF0 A;  3B3Q E;  2HWE 3;  5C3S A;  1U5X A;  2QE3 A;  2DYC A;  1QF3 A;  4JHZ A;  4A42 A;  4Z8B A;  3T0D A;  2ZGP A;  3VL9 A;  4LBN A;  1NA1 A;  1GP6 A;  3LA2 A;  3B9I A;  3IPV A;  1W8W A;  1F8V A;  3TEY A;  1W6N B;  1UMH A;  4HVQ A;  1N3Q A;  1YRZ A;  4J6G A;  2RG4 A;  5A3N A;  5ACA 1;  4QHO A;  1MVQ A;  1PO1 3;  1WMD A;  4QKF A;  2GDF A;  1XE8 A;  4X8P A;  1RUG 3;  2PQS A;  3WF0 A;  1IGO A;  2GC3 A;  3P5B A;  2DBI A;  2ATF A;  4IV1 B;  2CSG A;  3EJK A;  4GKY A;  4BB3 A;  1YFY A;  2Y8K A;  4IEW A;  5A3P A;  4IEQ A;  3KHC A;  2ZEY A;  2IXL A;  3SH5 A;  2BUK A;  3AP7 A;  1HV1 A;  3TRS B;  4LO5 B;  1OLM A;  4NWW A;  2VTX A;  3AL5 A;  5BNQ A;  1ZBE 3;  5C9A A;  2BPA 2;  1N3O A;  1TMF 1;  2J1R A;  4LO4 B;  2XVK A;  2CV6 A;  4Y22 B;  1M06 G;  3ZXE A;  4AI8 A;  4ERO A;  2WT0 A;  1K5J A;  4BQ2 A;  2E32 A;  5I8T A;  3R05 A;  1CQ9 A;  2LAL A;  3I3D A;  3LZZ A;  1QJU 1;  1GZ9 A;  3JD7 2;  5D21 A;  2WRA A;  1HXS 1;  2P6H A;  4JDN A;  3K4A A;  1I6X A;  3KF3 A;  1O6U A;  2Y26 A;  2Y60 A;  3LA3 A;  1SZB A;  1RVF 1;  4M3C F;  2PYT A;  1S0J A;  1QOO A;  4BPZ A;  4OHX A;  2E51 A;  4BME A;  4Z1V A;  1OI6 A;  3MZH A;  2JDP A;  1DQ0 A;  3H42 B;  1VBD 1;  4V2W A;  4GIQ A;  3PUI A;  4QQH A;  3ZFF C;  3LPG A;  3AMM A;  4H2A A;  4PQ9 A;  2IXJ A;  5JSO A;  1J83 A;  3V56 A;  5BNN A;  4JDO A;  5A7S A;  2FQP A;  4E2Q A;  1ZZC A;  3BOD A;  1WCK A;  1GNY A;  1DGL A;  4H3W A;  2OPK A;  4LE4 A;  4QMA A;  4RR3 A;  5J96 B;  4E8C A;  5CVR A;  1OKO A;  3WX5 A;  2EA7 A;  3GZE A;  4TLF A;  1VE0 A;  1G8W A;  3HJR A;  4RHV 3;  1NOV A;  2IUW A;  3AVS A;  4N9I A;  1J3Q A;  3PMS A;  3FLP A;  3H8X A;  3KV9 A;  1OLM E;  4W6X A;  5EYY A;  3MIB A;  1UKG A;  3VKO A;  2VUL A;  1DU3 D;  2DFC A;  3K4D A;  3ZXJ A;  4BDV B;  3ZFF B;  2ZPX A;  5F7U A;  3I7D A;  3NV3 A;  3N35 A;  2DFB A;  5A7N A;  2VQ0 A;  4S2G A;  1HIX A;  2GMM A;  2QQN A;  5CB7 A;  1QJX 3;  1ZRR A;  1NKG A;  4R9B A;  3MUY 1;  3RZH A;  3POE A;  4EQV A;  4HT1 T;  1LHW A;  2W5F A;  4XFC A;  1OPO A;  5LA0 A;  3I8T A;  4IE4 A;  1Z7S 1;  4XCB A;  2XON A;  3M70 A;  4JRA A;  2ARA A;  4FOV A;  4J1X A;  1SCS A;  1NCR C;  2UWC A;  5BYN A;  3S7I A;  3OEA A;  4QB2 A;  1JZ6 A;  5DUW A;  2RM2 1;  1YHF A;  2WYF A;  3I2I A;  3QH7 A;  2J1E A;  4BIS A;  5EWS A;  3MPP G;  4QXH A;  2VUJ A;  2WNU B;  4OUM A;  5GJ6 A;  3ZSL A;  4OI1 A;  2EAK A;  3U14 A;  1UO9 A;  4DXS A;  2R0H A;  1HQW A;  3WQ0 A;  5B2G B;  5J3U A;  1NY7 2;  4OI4 A;  2VZR A;  5FZA A;  4XF3 A;  1R64 A;  1BBT 1;  5FP3 A;  2ZHL A;  3CQO A;  4K21 A;  1ZRF A;  3AYE A;  4TWT A;  1REE A;  4KWJ A;  4FPL A;  1RUD 2;  5DG1 A;  4BQY A;  5I8Y A;  1GZT A;  2YFU A;  1IHM A;  1WA6 X;  1PO2 2;  3FN9 A;  5EFU A;  1GSL A;  3ZYB A;  1UZZ A;  1QQP 1;  4IND A;  1NT0 A;  1NCR B;  1FAY A;  2NYY A;  5B4X A;  2BVV A;  4AVA A;  2X09 A;  1MQT A;  3UNP A;  1GQH A;  2HWD 2;  4K7J A;  2UYB A;  1DYP A;  1ONA A;  1UYP A;  3AZZ A;  4IEY A;  5CFD A;  2VGD A;  1S0D A;  5DAB A;  4BCU A;  1DZQ A;  2RR1 2;  4CEY A;  4DOU A;  5HI0 A;  4NO4 A;  5IK4 A;  1U5Y A;  2HYX A;  2I74 A;  4BQ4 A;  4ZKT B;  1UY1 A;  1Y9G A;  1LR5 A;  5FK8 A;  2WNV A;  5FUN A;  1BMV 1;  3CO2 A;  4LKE A;  3M3O A;  5L73 A;  3ZFE A;  2V4A A;  2Y0I A;  5A33 A;  4LO6 B;  3RZK A;  1PIV 1;  1J1L A;  4MV2 A;  4ZS2 A;  4XVH A;  4CDW A;  4QB6 A;  4Q4X 3;  4HG6 B;  3JD7 3;  5EV7 A;  2J1U A;  4URA A;  5J36 A;  3ZN6 A;  1OC1 A;  2WYS A;  1KFU L;  1OA3 A;  3MIC A;  5FY9 A;  4YZ2 A;  4KQ7 A;  2YU1 A;  4ZXK A;  3VBH A;  1SMV A;  4G9S B;  4MGS A;  2QDR A;  3U37 A;  5LK7 B;  1MS4 A;  2XHK A;  4XC9 A;  3WCR A;  2FDG A;  4WVM A;  3B01 A;  3I2K A;  4CDU A;  1G9B A;  3LA7 A;  1COV 1;  1QGL A;  1DF0 A;  3T2P A;  4DY5 A;  5J48 A;  2FDH A;  4MZU A;  3THD A;  1Y4W A;  3VV1 A;  3WHT A;  5FZE A;  4ORF A;  4CUC A;  2BBV A;  4Q4V 2;  3SKJ E;  4NII A;  1F35 A;  4Q0Q A;  4AEK A;  1LJ7 A;  4HN1 A;  1GV9 A;  3ZXD A;  1MEC 1;  1OUS A;  4Y20 A;  1MS9 A;  4Q0V A;  2AH2 A;  3AFK A;  3RDI A;  1WCQ A;  3TN9 2;  3X29 B;  2OW4 A;  2P37 A;  3ABZ A;  2W52 A;  5BNP C;  2VQT A;  3PTY A;  4Q4Y 1;  5F2W A;  5LEK A;  1QJZ A;  1UWW A;  1J3P A;  1A78 A;  4AR2 A;  4I3G A;  3ZYI B;  4ASL A;  3K51 A;  2XUE A;  3BYW A;  4QPY A;  3W5N A;  3I2H A;  3ZXF A;  2JE9 A;  4N7U A;  1OSG A;  5I0T A;  2NN8 A;  1UX7 A;  3BVC A;  1BZW A;  3K77 A;  3LPF A;  5IUQ A;  3HQR A;  4G4F A;  1XQN A;  1SPP B;  3AL6 A;  3QH6 A;  1SLI A;  2H0B A;  4ARY A;  4GQ7 A;  5EQU A;  1YCI A;  1Y3T A;  2ORX A;  4GB3 1;  3WW1 A;  3GXU A;  1AYM 1;  1D4V B;  2W1W A;  4JKK A;  3PLQ A;  4UW6 A;  2WFF 1;  2ZEW A;  5BNP B;  1EYB A;  2VW2 A;  4GWN A;  4O9G A;  2OQ6 A;  4YRD A;  2YFZ A;  3LDK A;  1R1A 1;  2JB8 A;  2DVG A;  3OGV A;  5EJ3 A;  2JEN A;  2HWF 3;  4M4R A;  2A7A A;  3GBW A;  1JW6 A;  1R09 1;  4B8E A;  3NNJ A;  3UGG A;  3SLI A;  1ZRD A;  4YG6 A;  4DMI A;  1H2N A;  1FNZ A;  1W90 A;  4NIH A;  2QQO A;  4EN6 B;  1RUF 3;  3RZG A;  1PO2 3;  5FLJ A;  4Y5Z 0;  3B69 A;  4OUE A;  3T09 A;  5DPN A;  4LKS A;  3KCX A;  1JU4 A;  2NMN A;  4CDX B;  3D82 A;  3O0X A;  5CG8 A;  4JGZ A;  2XJS A;  3SQO A;  3VKF C;  2BYV E;  2G1M A;  4CSW A;  3WNO A;  1EAH 2;  1PGL 1;  2J1A A;  2VCB A;  3OCP A;  3WNK A;  3N7L A;  3FC0 A;  3K48 A;  5G05 L;  1UXZ A;  1W8U A;  4CEW C;  3ATG A;  3TBD A;  1O3Q A;  4YGD A;  3BPS A;  2PHX A;  1REF A;  4H14 A;  2JDN A;  1E57 A;  3WSO A;  4LUM A;  3OY8 A;  3I49 A;  2X10 A;  1XNA A;  2IXK A;  1DYO A;  1JTZ X;  2DVB A;  2EXK A;  2GSY A;  3SH4 A;  3UET A;  3W58 A;  4WM7 B;  5JMO A;  2EAA A;  4IEZ A;  2D44 A;  1CWP A;  4NIA A;  2RS3 2;  3NKT A;  5FYI A;  1YIF A;  3USU A;  3W21 A;  2XBO 1;  4PBO A;  2JEM A;  2ZTN A;  2ZEX A;  1AR9 1;  4HVR A;  3H1M A;  4P9W A;  1SBF A;  5E16 A;  1LOC A;  1MZF A;  2BQP A;  2DF7 A;  3CKH A;  5L7O C;  2ADE A;  2ZHK A;  4QQP A;  4KU8 A;  2Q5T A;  3IBM A;  4XJW A;  2Z42 A;  4QDS A;  3VD4 A;  5FXV A;  5BXX A;  4HET A;  3O12 A;  1ND2 A;  4H55 A;  2ENR A;  3CDZ B;  4GH4 C;  4RQP A;  3UGH A;  4FXG B;  3UJO A;  4DZG A;  1UZV A;  3KCC A;  4KWU A;  1AX2 A;  3WQ7 A;  1JYX A;  4YW1 A;  2XOM A;  4TN7 A;  3EYP A;  3T3Y A;  3S5Q A;  1HRI 2;  5L9B A;  2BU9 A;  4QGL A;  3N36 A;  4XE9 A;  1RUH 3;  1CVN A;  3TN9 3;  3DGT A;  3ORJ A;  1YFX A;  3IT8 A;  5FYS A;  3WT3 A;  4E27 A;  2VZO A;  2XR4 A;  2PHW A;  3UKT A;  4NN0 A;  5I0D A;  1PNG A;  3KF5 A;  1Z0H A;  3E6D A;  3B02 A;  5LCW L;  1YQ5 A;  4BE3 A;  2DU0 A;  2UWB A;  5EPA A;  4FPE A;  1HLC A;  5K0U C;  5CFC A;  3K3N A;  4NE9 A;  5KR7 A;  3ZSM A;  5LB6 A;  2I07 B;  3CJX A;  4OZX A;  1RGS A;  4AHZ A;  2DUQ A;  1GUI A;  2YGL A;  4GH4 B;  5A70 A;  5AFB A;  3RGB A;  2ET1 A;  3H0O A;  4FXK B;  1X33 A;  5C4W A;  3HPN A;  2ZAH A;  4UBH A;  4W6W A;  5BNO C;  2R07 1;  5GLU A;  3W20 A;  3H3Z A;  4WM8 C;  1UYZ A;  4CYD A;  1BCX A;  5FRA A;  5FV3 A;  1HQN A;  2FMY A;  4FOQ A;  1XB9 A;  2X5I A;  5SV8 A;  3KVB A;  2DUP A;  2Z4F A;  1PZ9 A;  1RUC 2;  4Q0U A;  4AEJ A;  4NR1 A;  4JVA A;  2ZGK A;  1F2N A;  4MH0 E;  1RJ8 A;  5K0U B;  1POV 3;  5GKA C;  1PMJ X;  2HEV F;  1V9U 3;  1H1M A;  4YW6 A;  2E33 A;  1CAU B;  1W9W A;  2MEV 3;  2J1T A;  1VPH A;  2ZX1 A;  4M0H A;  1D4M 1;  3KMH A;  4XJU A;  5J1X A;  3WNN A;  1IPJ A;  1GNH A;  1FX5 A;  1S55 A;  2VY0 A;  2X29 A;  1WWY A;  3CEW A;  4Q0P A;  4F7Z A;  4XFG A;  3LIG A;  5DUX A;  5DMY A;  4HN0 A;  3WF4 A;  3IM0 A;  4JTN A;  3BI3 A;  1W6M A;  1R08 1;  3ZXL A;  4WM8 B;  3N9O A;  1US2 A;  1LUL A;  2X53 S;  3RZM A;  1QJY 1;  3O1U A;  2QTW B;  2YRO A;  5HV4 A;  1OXC A;  1OA2 A;  3OUH A;  4UW5 A;  3WR0 A;  1I3H A;  3LEM A;  5FY5 A;  3NMB A;  3BU7 A;  1BEV 1;  4E4D X;  2P3I A;  1NYW A;  2OII A;  4YZ4 A;  5FZ0 A;  4Y5S A;  2PQQ A;  4CCL A;  3IDC B;  2VNO A;  1NUK A;  2HKX A;  2WAB A;  3H3U A;  1W6P B;  2QQW A;  2JKX A;  2FBE A;  3AZW A;  4BMB A;  3WUD A;  3AKT A;  3DPR C;  1QU0 A;  2IVJ A;  3ITQ A;  4ONU A;  4N53 A;  4C0B A;  2Z5W A;  4N7I A;  2UY9 A;  4PLN A;  2D7F A;  3LFM A;  3VZK A;  4EE2 A;  5FZI A;  1O3S A;  1GR3 A;  4FCA A;  5FXX A;  3BU0 A;  1TVG A;  1XC6 A;  2VMF A;  3WW3 A;  2RS3 3;  2DTW A;  4CCD A;  5FYZ A;  2OZ6 A;  4IV3 A;  2R49 A;  4QPG C;  1JHN A;  4GAZ A;  5JUV A;  1F5J A;  4IEP A;  4MVT A;  1AUY A;  2D5F A;  3CLP A;  4KG0 A;  1EP0 A;  3EMR A;  2GMP A;  1A3K A;  3G7D A;  3R4S A;  3TB0 A;  1ENS A;  5FYC A;  3ZYG A;  4E4Z A;  4JGY A;  2O8Q A;  1ND3 A;  5A80 A;  3N7J A;  1F5F A;  1B35 B;  2AYH A;  2JX9 A;  2UU8 A;  5T54 A;  4COW A;  1FPN 1;  4QKN A;  1AXY A;  3C7G A;  3DPR B;  4N9H A;  2W08 A;  4P5H A;  5BPX A;  4XFB A;  2ETE A;  3BOP A;  1VRB A;  5FCC A;  5JOY A;  1G9A A;  1WW7 A;  4Q8L A;  2V72 A;  1YQ8 A;  3KHB A;  2AEN A;  4NPM A;  4R9C A;  1K5M A;  4K40 A;  3DL3 A;  1JOP A;  3M2M A;  4BU2 A;  3PME A;  2XG3 A;  1AJK A;  3QOP A;  1WBF A;  3GNE A;  4DQA A;  1XOY A;  1W05 A;  2DCJ A;  1HRV 1;  2ADD A;  1QJE A;  2H6C A;  1AR6 1;  2DDU A;  2VNR A;  2IC1 A;  5F1R A;  1X8E A;  3VDB A;  2VMC A;  2GP3 A;  3MIH A;  3INA A;  1CON A;  1J1T A;  3L2H A;  1LB2 A;  4JQR A;  2VUC A;  1KIT A;  1GP5 A;  3GHN A;  4CVU A;  1UN1 A;  5T5O A;  1JZ5 A;  1PVC 2;  1POQ A;  1XRU A;  3A4U A;  3GBF A;  4NHL A;  3PVN A;  2LRO A;  4EJR A;  3D6E A;  4YM3 A;  2XL7 A;  1DZR A;  1JN2 P;  2BJS A;  3D5O A;  4WBB A;  5APA A;  4BHP A;  3POG A;  1RUJ 1;  3CHX A;  5EYX A;  5LBE A;  3W59 A;  3WG3 A;  1BJQ A;  3D0J A;  1XJA A;  3ES4 A;  5GZE A;  1RUC 3;  3V0B A;  1UZ0 A;  4B1L A;  3GYD A;  2OKX A;  2XXZ A;  5GM0 A;  3H1Y A;  1H2K A;  1KDM A;  4JQT A;  3AP9 A;  3VBR C;  4LK6 A;  4AQT A;  3M4F A;  2ORZ A;  3I2G A;  4AHY A;  3I2F A;  4LKD A;  3QLQ A;  4NJ4 A;  5CKN A;  1SLC A;  2ZXQ A;  1CAV B;  2JEC A;  2VZQ A;  3LEI A;  5IWF A;  2GP5 A;  4ZU7 A;  3IAP A;  5F3E A;  4PDW A;  5F2S A;  2RV9 A;  4KU7 A;  2ZZJ A;  1RUO A;  1OPM A;  3RZJ A;  4KBB A;  1RL3 A;  4XUO A;  5DZF A;  4AWD A;  3RYR A;  1DQ5 A;  5C8C B;  1TME 1;  1RUI 2;  4EN7 B;  1VRH 2;  2ARB A;  4B29 A;  1GNZ A;  1ZZ8 A;  4BK4 A;  1YXW A;  1GP4 A;  1YO8 A;  1V6L A;  3ACG A;  4RL7 A;  2GU9 A;  2RS1 2;  4Q4W 2;  4YWA A;  3VZL A;  3FUQ A;  3VBR B;  3ZYF A;  2HBU A;  2PHT A;  3ZYJ B;  4CE8 A;  1FXZ A;  1GZC A;  1W28 A;  3ENR A;  1BK1 A;  2ZHM A;  3VN4 A;  4N90 A;  1DBN A;  4P9I A;  2QQM A;  4YGE A;  3ZKY A;  2BZD A;  1JUH A;  4F83 A;  1SDW A;  5JLV A;  4RGK A;  2CY6 A;  2RS5 1;  4XET A;  4DFS A;  1W2U A;  1CZV A;  3ZVX A;  1DLC A;  1RHI 1;  2EIC A;  4LIU A;  2YBP A;  3MGU A;  3R4D B;  4B3N A;  4W50 A;  1E5R A;  4FPH A;  2DCK A;  2WN3 A;  5T5P A;  5CNA A;  2IXH A;  2QCS B;  2RHP A;  2Y33 A;  4P02 B;  4XHX A;  4PQQ A;  3VLB B;  3AXD A;  1DGR A;  4AI0 A;  4CDQ B;  3EO6 A;  4NHK A;  1ZA7 A;  3T1L A;  3OPZ A;  3K3O A;  4GUL A;  4QXK A;  5FYU A;  4SLI A;  4DEV A;  1Q8Q A;  5I91 A;  1WCD J;  4YG0 A;  4FI9 A;  3VZN A;  3GHM A;  2BNN A;  3IDA A;  4W8J A;  2HWB 2;  1LU2 A;  3VBO C;  3VDD C;  1FMD 3;  4ISQ A;  3O5S A;  5A32 B;  5A1A A;  3OD0 A;  4QKD A;  5JR2 A;  5F3G A;  1SBE A;  1AR8 3;  1ZRE A;  2BEO A;  2O0O A;  1VBC 1;  1UU4 A;  2WAO A;  3FHQ A;  1VB4 A;  1CGP A;  3O1V A;  3ETQ A;  4IE7 A;  5C71 A;  5JVV A;  1STM A;  2PFW A;  5FPV A;  3N3H A;  3I3E A;  5KC5 A;  4E9K A;  4ZON A;  3KV5 A;  1NX9 A;  3BTX A;  1CD3 G;  3C7O A;  3VHP A;  1V0A A;  2HWE 1;  1C3H A;  1VBE 2;  1YWK A;  1Y43 B;  2P2K A;  3VBF B;  3H7J A;  1JYT A;  3GBG A;  2VZV A;  1ZBA 2;  5A6Q A;  3WDX A;  5A6Z A;  3KCY A;  4M01 A;  3UYJ A;  2XB6 C;  2G4I A;  3OYW A;  3FLT A;  4O7X A;  2CHH A;  5AFE A;  3VBO B;  3VDD B;  3RZL A;  2PXJ A;  4ARX A;  2CAV A;  1PO1 1;  2GME A;  4MYE A;  4D3W A;  4LT5 A;  4FO9 A;  4HKO A;  1DDL A;  1LGN A;  1PVC 3;  3O7O A;  3W5M A;  2RMU 1;  4DIN B;  2YHJ A;  4JHT A;  4IEV A;  2ID4 A;  1PX4 A;  2F17 A;  5FRE A;  2OYZ A;  1XND A;  2JD9 A;  3A0N A;  2R30 A;  4UOJ A;  2VBD A;  1U12 A;  2H0V A;  3CJI A;  2BTV C;  1ENR A;  4BQ5 A;  2P3K A;  3JQW A;  2WZR 3;  3AX4 A;  4LA3 A;  1EUT A;  1W6O B;  1W39 A;  1XNC A;  3GM8 A;  1QH7 A;  1NXM A;  3WF2 A;  4MOA A;  2XLF A;  3AZX A;  5FK7 A;  1CAX A;  1N3P A;  3GF6 A;  1PK6 C;  2YYO A;  5FMB A;  4AI2 A;  3LKJ A;  5JWP A;  4YZ1 A;  3OEB A;  1JYV A;  2VOV A;  3BTZ A;  1H2L A;  1XNB A;  3WP4 A;  1W04 A;  1LHN A;  4QM9 A;  4IV1 C;  3ZIW A;  3POB A;  5CKQ A;  3UJQ A;  3PTR B;  4GMP 3;  4BZ4 A;  2WS9 1;  2VBP A;  2NPI A;  5F5C A;  5GAL A;  4HSL A;  3RWK X;  2QQU A;  3FFQ A;  2Y6K A;  3LCP A;  4H7M A;  1NA1 C;  4LOR A;  3TEZ A;  2B5H A;  1C1F A;  2BW8 A;  3VZO A;  3FWE A;  1O8S A;  4LOS A;  1QIQ A;  2QZ2 A;  3JBG 1;  1RUI 3;  1VRH 3;  1AX1 A;  5FZH A;  4NAM A;  4R52 A;  3D0S A;  5IK5 A;  4RSU A;  5ERL A;  1HXS 2;  1W6Q B;  3MV0 1;  5A3T A;  4Q4W 3;  2VW1 A;  3T2T A;  3WV6 A;  3GJB A;  4CUB A;  2NQY A;  2CU5 A;  1DGR N;  2R1B A;  1G9D A;  4XF9 A;  1DFQ A;  4CCN A;  1PK6 B;  3WQB A;  1RVF 2;  4CP2 A;  2OX0 A;  3N9Q A;  1H1A A;  2VOX A;  5A7W A;  3KQ4 B;  4NRO A;  2QQP A;  5FZ9 A;  3AMP A;  1IKQ A;  3BN6 A;  3EXU A;  2ZGQ A;  4UF0 B;  3ACH A;  1VBD 2;  3FBY A;  1JZ8 A;  4FTS A;  2JE7 A;  2DCZ A;  1V6N A;  3OTF A;  3AP5 A;  4LK7 A;  3MDP A;  4GJY A;  4AZZ A;  4BQW A;  5CU1 A;  4IE5 A;  1NA1 B;  4XUP A;  3SH3 A;  2LM3 A;  1WW6 A;  3K75 B;  1XNT A;  3IPV B;  4PBP A;  3ZDV A;  3ZX7 A;  5D8A A;  2D43 A;  1JYI A;  1APN A;  1RXG A;  3NJZ A;  3WD5 A;  2ZGT A;  3I2D A;  1BHG A;  3U1X A;  2ZGM A;  1GLH A;  3VD5 A;  1LKN A;  1NZC A;  3EQE A;  3DYP A;  4O9E A;  3MUZ 1;  2WQ8 A;  1W2N A;  4YW4 A;  2CWS A;  1IS3 A;  4UT5 A;  4CCK A;  3PNA A;  3L2Y A;  4N43 A;  5CA6 A;  3TAY A;  3AXE A;  4YGB A;  4JX0 A;  2MHF A;  5DDJ 1;  1UCX A;  4XF1 A;  5LA9 A;  1LOB A;  4Z2W A;  4LQR A;  5KHJ A;  2P17 A;  3U78 A;  2H6B A;  5C9A B;  1UF2 C;  1VMJ A;  4QM8 A;  2VEC A;  4D94 A;  4TSV A;  1ZZ7 A;  4DIQ A;  3L9J T;  4ZPI A;  2R32 A;  2VVE A;  5C33 A;  3NWK A;  4AAX A;  1FYU A;  3BGA A;  3J7M A;  4YZ5 A;  4UXA A;  4AQ2 A;  2IFW A;  2BGC A;  4AFA A;  1S0G A;  1OF3 A;  2OQ7 A;  4RR3 C;  1IG3 A;  4N43 B;  4D7Y A;  2Y6F A;  3PJY A;  3E97 A;  4QX0 A;  1ZBA 3;  5T55 A;  1Z7S 2;  1GWM A;  4OHY A;  3VUO A;  3AYA A;  2FDF A;  4CCO A;  1SEF A;  2QNK A;  4UAP A;  1VBA 3;  5FZ7 A;  3KZ4 C;  5LAS A;  1YLL A;  3VBU A;  2RM2 2;  5FWJ A;  4Y1V A;  4ISR A;  1KD7 A;  3KSC A;  2BRT A;  4KGG A;  3J8F 2;  1RUE 3;  2CWM A;  4I0W B;  5DXD A;  1G6N A;  1G7Y A;  3MF9 A;  1LOF A;  4LHK A;  1N1V A;  3NAP A;  1EPW A;  1QXR A;  4OHV A;  2WAA A;  4CCE A;  3TEW A;  1UY0 A;  3P3N A;  3RI8 A;  1YEW A;  1NLR A;  3F2Z A;  4U36 A;  3MLK A;  1BBT 2;  5BNN B;  1CX1 A;  5FXW A;  4XQ4 A;  2A6V A;  5ABJ A;  2RDR A;  2XJU A;  2WNU C;  1XNK A;  1KFX L;  4PF1 A;  4Q0S A;  4RR3 B;  4DNY A;  4G3Y C;  5K9Y A;  5A1L A;  4XIL A;  3Q8B A;  5DUU A;  1MVE A;  1QQP 2;  4GKX A;  3RSJ A;  4EYU A;  3H8R A;  2XJP A;  3KT1 A;  3WF1 A;  3ACL A;  2R06 3;  5IHR A;  1RB8 G;  2V09 A;  5J7M A;  2ZZQ A;  1CAW A;  2VXJ A;  4Q4X 1;  4AED A;  3JD7 1;  3J26 N;  1W8O A;  1QMJ A;  2ZX4 A;  2BV4 A;  1QOS A;  3SIS A;  5IFP A;  3PVE A;  1KGY A;  5I8S A;  4HL0 A;  4LBQ D;  3AMN A;  2AEY A;  3DXU A;  2JDM A;  5JR7 B;  1PIV 2;  5LK5 A;  3I54 A;  3TEX A;  3SKV A;  2WO3 A;  5KXD A;  3ZLI A;  2YZ4 A;  4AGR A;  4MXV A;  3WG2 A;  2DUR A;  3JB8 A;  2G9G A;  1MS8 A;  1HXS 3;  1POV 0;  3SXW A;  4XEZ A;  3ZDS A;  4XAA A;  5LW9 A;  5KHG A;  3VDC A;  2JE8 A;  3HEI A;  1GQG A;  3VDA A;  3OBT A;  1RVF 3;  4OHZ A;  3N9N A;  2EIG A;  2D6N A;  4PLO A;  4M0N A;  2V4V A;  1VBB 1;  4A3X A;  4QXC A;  2VOT A;  4AHX A;  4GAL A;  4AVS A;  1XYP A;  5FZ8 A;  5AC9 1;  4XAC A;  4CEY C;  1IPS A;  1COV 2;  2J7M A;  3MF6 A;  3FHI B;  1Y9M A;  2G19 A;  3PIJ A;  3OG2 A;  2BFU L;  4IES A;  2LRP A;  5FZB A;  3RQ0 A;  4A45 A;  1F31 A;  1AJO A;  2WNV C;  2ZGR A;  4XOG A;  2F6B A;  2FCT A;  3ZFE C;  1G9C A;  4ET7 A;  2ZKN A;  1TQ5 A;  4EN8 B;  4HFS A;  4CDW C;  3FJS A;  1MEC 2;  2QQJ A;  4Q26 A;  2NP0 A;  1KQR A;  3ZKU A;  1UQX A;  1DGW A;  4XUQ A;  4MLO A;  4M3C A;  4AFD A;  1O5U A;  3WZ1 A;  1SHW B;  3W9A A;  4CUA A;  1NXD 1;  1CIY A;  4OLL A;  5H9Q A;  2JG8 A;  4I09 A;  4B4Q A;  1HB3 A;  3VBH C;  5LEJ A;  4D7S A;  1MQT B;  5FYM A;  1JYN A;  1UXX X;  1H2M A;  2O14 A;  3IN9 A;  5CBL A;  2D6L X;  5FYT A;  5CFD B;  4A7Z A;  4Q4Y 2;  4GJZ A;  4CDU C;  3NW4 A;  2GAU A;  5IVV A;  4BLJ A;  1E5I A;  4YW7 A;  4CEY B;  5JI7 A;  3NO8 A;  4HPK A;  4GWM A;  2VUD A;  4QB1 A;  5LBC A;  1CN1 A;  2XL9 A;  4MHU A;  4AGG A;  4PI0 A;  2R04 1;  2WNV B;  4I01 A;  5FZ4 A;  3KM5 A;  1EV1 1;  5DAV A;  4OVE A;  3ZFE B;  4QAW A;  2BWA A;  3BTA A;  4XXP A;  4NHX A;  1CZS A;  5A33 B;  4EWA A;  1BYH A;  4CDW B;  3NVC A;  3PVO A;  3ZYP A;  4Z2A A;  2D97 A;  3ACF A;  3O14 A;  3WDU A;  3ZN6 B;  1LOG A;  1Z7S 3;  4GB3 2;  4UFH A;  5FZC A;  1AYM 2;  1O59 A;  3WG1 A;  4FSJ A;  1T6B X;  2HWF 1;  4K8F A;  4B7K A;  3VHR A;  3NNM A;  2WJS A;  2JG9 A;  2YPD A;  2WFF 2;  3VBH B;  3U75 A;  4LNV A;  3ZN5 A;  4HKL A;  5FJK A;  4AF9 A;  5JXH A;  2WIN B;  3H9A A;  3U07 A;  1F4H A;  4TXW A;  4WVM B;  3E1F 1;  1GWK A;  4CDU B;  1R1A 2;  2CGP A;  3QBQ A;  2JDA A;  3J8F 3;  4P9J A;  3LOB A;  1V6J A;  1Q8V A;  4XIK A;  1RUF 1;  5EJ1 B;  5FMO L;  3AKR A;  4Y1U A;  2AC1 A;  4IE6 A;  2E7Q A;  3UK9 A;  1R09 2;  1S0C A;  4OHW A;  4AGV A;  3BAL A;  3NV2 A;  1BBT 3;  2FDK A;  5EIY B;  1YJK A;  5E8A A;  5FTT C;  3O1T A;  4M3C E;  2BP6 A;  5F32 A;  3N7K A;  4YVS A;  3M3E A;  1QDC A;  3D4K A;  4NID A;  2PHU A;  1SLA A;  4Y20 B;  2B46 X;  1H8T A;  3S30 A;  4NAO A;  1EY2 A;  4FOY A;  5IAT A;  4C1W A;  1LEC A;  2ZAC A;  4QXB A;  5LZ6 A;  2WBK A;  1X7N A;  3AZV A;  2B42 B;  5JIA A;  2WR9 A;  4LBQ A;  5I0S A;  5KHH A;  2WZE A;  1JOJ A;  4L8Q A;  5BY5 A;  4QU2 A;  4CDX C;  3I97 A;  3BB6 A;  1HJF A;  1W8F A;  3TNP B;  1DZT A;  1WW5 A;  1FOD 1;  3KVA A;  4COY A;  1YI9 A;  3IDE A;  5FYB A;  1JHJ A;  1ULD A;  3N9P A;  4DS0 A;  1OHF A;  2ARE A;  3WCS A;  2CTV A;  3B9C A;  4MET A;  3N4M A;  2E7T A;  4P9X A;  2WNE A;  5JSR A;  4OI2 A;  1BVP 1;  2LTN A;  3OF1 A;  2MNG A;  2ZOE B;  1WW4 A;  4FFI A;  4AI3 A;  2BVB A;  3PJQ A;  1UYX A;  1H6Y A;  2BBA A;  2XBO 2;  3ZXK A;  1C8M 1;  1DQ1 A;  3O1P A;  1AR9 2;  1RUD 3;  2EIB A;  4JGZ C;  4WM7 C;  4IEO A;  4HVO A;  4XYX A;  4A7Y A;  5KC6 A;  4IDZ A;  5JAX A;  1S0F A;  2HJI A;  2W94 A;  2XLA A;  5H9S A;  3HBK A;  4MHR A;  2BDR A;  2HWD 3;  1RUH 1;  4QD2 A;  2YG0 A;  3TN9 1;  1H0B A;  1UPS A;  1UZY A;  2JJ6 A;  4CXX A;  1Y9Q A;  3VZJ A;  2RR1 3;  2B4K A;  3KGZ A;  4QHZ A;  2WL1 A;  5BUV A;  5E89 A;  1XSR A;  3WNL A;  3MLL A;  1TE1 B;  1MEC 3;  1WD3 A;  4LBM A;  4E8D A;  4HLT A;  3BPZ A;  1RIN A;  3E5U A;  2GH8 A;  1ZM1 A;  4Y33 A;  5C8W A;  3ZFG A;  4O61 A;  2IXI A;  2XVL A;  3OPW A;  3DKQ A;  1O7F A;  5FXZ A;  4JGZ B;  1X50 A;  4WZC A;  4DO0 A;  2NM1 A;  1ASJ 1;  2W47 A;  4Q4Y 3;  1OD5 A;  4QPI A;  5DN2 A;  4XJA A;  4JKM A;  1W2A X;  2AR6 A;  4XUR A;  3O0V A;  1OLR A;  2HWC 1;  2VOW A;  5F5I A;  2RDQ A;  4KWK A;  1ULF A;  1CZT A;  1ND2 C;  4RQP C;  4B1M A;  3S7E A;  2GC0 A;  4QX2 A;  4IER A;  4OMD A;  4XAE A;  4NIG A;  4EZH A;  1LRH A;  2D6M A;  1O4T A;  2VCA A;  3MI8 A;  4XBQ A;  3OY8 B;  4KG8 A;  3GDB A;  3HD8 B;  5C3O A;  1W8H A;  5AVA A;  1LED A;  1V9U 1;  2R07 2;  3M1H A;  1TG7 A;  3KB5 A;  4Q4V 3;  3HVD A;  2MEV 1;  4Y1X A;  1AYM 3;  5C3R A;  2PLV 1;  2QBX A;  2SLI A;  3K46 A;  3PU8 A;  4AVT A;  5BV6 A;  1QXP A;  3WNM A;  5CEH A;  1RJ7 A;  5A3W A;  2DTY A;  1AX0 A;  3POY A;  4NOT A;  3USU B;  1AYN 1;  1FV2 A;  1SAC A;  3FUO A;  3URF A;  4HOO A;  4CU8 A;  5JPM B;  3M3C A;  5CFC C;  3PUS A;  5C3P A;  1QWR A;  4YW5 A;  3T4V A;  1A8D A;  2TBV A;  5FIX A;  4AFC A;  1D4M 2;  1ZA4 A;  3OSD A;  5EJZ B;  5HBA A;  1OFN A;  5FZ6 A;  1JZ2 A;  2WWU A;  1CES A;  1ND2 B;  2YUE A;  4RQP B;  1UOJ A;  1R09 3;  2R1D A;  4XXA A;  1IG0 A;  2FZ1 A;  2FDI A;  1Q3E A;  5C4W C;  5T5L A;  3AP4 A;  4Y4Y A;  3LDB A;  2WC2 A;  2YC0 A;  5L7O A;  1WGP A;  3ZMN A;  5FPU A;  3GZT B;  3KV6 A;  4OUL A;  1R08 2;  2WZP P;  1D2Q A;  1RC6 A;  4A41 A;  4CP1 A;  4DEQ A;  2A70 A;  4EWD A;  2VZ1 A;  4AAP A;  3FMG A;  2ZA9 A;  3HAG A;  3MHZ A;  2IXC A;  4HAN A;  5GZD A;  1NCQ A;  4GXL A;  4I0A A;  4FT8 A;  3OJB A;  2VMH A;  4EN0 A;  2XWB B;  4TZD A;  4NUB A;  2KD7 A;  2WO1 A;  2WT2 A;  1W9S A;  3PUA A;  4F3J A;  5CFC B;  3VKL A;  1PNF A;  3M8L A;  2OXB A;  5DQ0 A;  3DYM A;  4RGA A;  2VZP A;  1SLT A;  3N9M A;  5L9R A;  1US3 A;  4JAA A;  1JZ3 A;  2C26 A;  5K7P A;  1AR7 1;  3AYD A;  2ZX0 A;  5C4W B;  1OD3 A;  2BOJ A;  3MFC A;  3SEP A;  1R1Z A;  1J59 A;  2W39 A;  1C4R A;  2XJQ A;  4Y26 A;  4ZY9 A;  4I3P A;  1U0A A;  3IIA A;  2VZS A;  2HH9 A;  2ZHN A;  4P9Y A;  4XHB A;  2Q30 A;  3I59 A;  4DUW A;  1QEX A;  2P4E A;  3HN3 A;  3AJY A;  2B8M A;  2X5I B;  2ERF A;  2XBO 3;  4R4X A;  1AR9 3;  2XKO A;  1AXZ A;  1YUD A;  4GMP 0;  1IQA A;  5BNO A;  5L19 A;  3H3L A;  3OBR A;  5CYY A;  2BFU S;  3WIN E;  4SBV A;  4FTE A;  5F5Q A;  2PHF A;  4Y3O A;  1X9T A;  3LE0 A;  4FBF A;  1FPN 2;  1EAH 3;  2P1B A;  4FPG A;  5T5J A;  3T08 A;  4IGP A;  5IJR A;  5JOX A;  3VD7 A;  2VBB A;  3VD9 A;  1X82 A;  3ZXG A;  1W0O A;  4FVV A;  1SBD A;  2AUY A;  1W06 A;  1B35 C;  1OA4 A;  2LUW A;  2V5Y A;  3SC7 X;  3ETP A;  4COU A;  1W6M B;  4DXR A;  1AXK A;  4XQD A;  5KWR A;  2Y38 A;  1H30 A;  3IMM A;  4LOT A;  3DCQ A;  4EV0 A;  3SCH A;  2A75 A;  4PIY A;  5JDB A;  4IV3 C;  5FO9 B;  5G04 L;  1ST8 A;  3Q8E A;  1H6X A;  5IVE A;  1HRV 2;  1VAM A;  1JMU B;  1AR6 2;  1MZ6 A;  2HEW F;  4RGG A;  2WNO A;  3FE5 A;  3KV4 A;  1K45 A;  4JGY C;  1ND3 C;  2P3Y A;  5LBF A;  2YGM A;  2QFE A;  4IE0 A;  3CIH A;  3B7M A;  2EID A;  1RUC 1;  1DGW X;  3M3Q A;  3NJY A;  4N53 B;  2WA4 A;  3FX3 A;  1OVS A;  5FZK A;  4QT6 A;  1RUJ 2;  2F4P A;  1V6M A;  2ZGS A;  2EVX A;  5FOB B;  2W92 A;  2DVF A;  3T2O A;  1HN0 A;  3U0Z A;  3HQU A;  3K4Z A;  5CKM A;  5JOZ A;  4CP9 A;  4IV3 B;  4AW7 A;  4JV4 A;  1UMI A;  3SCF A;  1AL2 2;  1HRI 3;  2E53 A;  4JZR A;  1UYY A;  2W1U A;  1KEX A;  5FMO S;  5KBF A;  1PM7 A;  4XDQ A;  5LRR A;  3UT0 A;  4JGY B;  1ND3 B;  1UOF A;  1D4M 3;  2ARC A;  3NL1 A;  4XTP A;  1RYY A;  4QPG A;  3WDT A;  4D0Q A;  1W0N A;  2GC1 A;  2VPV A;  1XBF A;  2JDK A;  1GQP A;  4LPL A;  4YLZ A;  3U10 A;  2P6C A;  3AZY A;  2ZEZ A;  4P5Y A;  3ZSJ A;  3GAL A;  5LRS A;  3BTY A;  1UZW A;  5A7Q A;  1KXG A;  1VJ2 A;  1EUU A;  1OT5 A;  3DUI A;  2KA3 A;  4YW2 A;  1I1E A;  1PMH X;  2RDS A;  5FBZ A;  1XPW A;  1TME 2;  4OQ8 A;  2I45 A;  5J98 B;  2R16 A;  2JDZ A;  2Q1M A;  4GA9 A;  4AFB A;  1OQD A;  1K5M B;  4A6O A;  5FOJ B;  1O8P A;  3VB9 A;  3GJA A;  2ZAB A;  4Q8K A;  2DV9 A;  4L97 A;  3SMH A;  5C8C C;  3I3M A;  3VKN A;  1OQE A;  4FAH A;  1YI7 A;  3ES1 A;  2C4X A;  2ZJC A;  3THP A;  1JOD A;  1X36 A;  1OKQ A;  1RMU 1;  2VH9 A;  4LIV A;  4AG4 A;  5A3L A;  3POI A;  3MW2 A;  3WNX A;  5IVB A;  2RS5 2;  4PIX A;  3ZOI A;  1V6I A;  3WNP A;  5HXM A;  2B7Y A;  1RHI 2;  1IS6 A;  4PDW C;  1GOG A;  4WZF A;  2Q8E A;  4WVW A;  3JB4 C;  1BXH A;  1LHU A;  3LB9 A;  2UYA A;  1ZYB A;  3HWJ A;  2QQK A;  4PHZ A;  4K20 A;  3E6C C;  5HCF A;  1LAJ A;  5A7O A;  1FMD 1;  3LGR A;  3WQ1 A;  4TTG A;  1CPN A;  3AKQ A;  4QX5 A;  1AR8 1;  4YFW A;  3POF A;  5D2A A;  3V0B B;  4Y5T A;  4YSF A;  1MS3 A;  2BWC A;  4P9G A;  2R7E B;  5JIU A;  2VMG A;  1KS5 A;  3VBS A;  4LA2 A;  4XMI A;  1UNB A;  3S0M A;  2XML A;  1LOD A;  4ZU5 A;  2IVI B;  4YGC A;  1NE6 A;  1YQ2 A;  1FPN 3;  4BYY A;  3DV8 A;  1H4H A;  4GWI A;  5JZG A;  1VBC 2;  1QNY A;  2YU2 A;  4NRP A;  4UW4 A;  3MEP A;  4E2G A;  3JZV A;  2VG9 A;  3DYO A;  2FCV A;  4M4P A;  2VCC A;  4PDW B;  1DQ2 A;  3NV1 A;  4X6Q B;  4NPR A;  2ZML A;  5CIS A;  2FD8 A;  1OOP A;  2XH6 A;  3Q8F A;  3RYP A;  3VKM A;  4BQ3 A;  3H8U A;  1KJL A;  3POJ A;  3KGL A;  2HWE 2;  3T1M A;  1RIR A;  1UY4 A;  1MR5 A;  4V2V A;  1CIW A;  1HRV 3;  3SHR A;  1AR6 3;  5HCH A;  4XJ9 A;  4Q1R A;  3P6B A;  1L7Q A;  5B4N A;  1W03 A;  3RJR A;  4LEJ A;  2Y0O A;  4BLI A;  2XJR A;  3VBF C;  5E88 A;  5GLT A;  2YY1 A;  3WDV A;  1GYK A;  2B39 A;  2HBT A;  2LW8 A;  2P5B A;  2TNF A;  2CNA A;  2W2I A;  4I0B A;  2WZR 1;  3C7H A;  2CL2 A;  1YQC A;  2Q4S A;  5A3O A;  2RMU 2;  4XMA A;  2V73 A;  4PF5 A;  5FZO A;  2DU1 A;  1UY2 A;  4IET A;  3VZM A;  1MZE A;  5FR3 A;  5IT6 A;  1A34 A;  3AKS A;  1RUJ 3;  1W3X A;  1PX3 A;  3MIG A;  3USS A;  2D40 A;  4JC1 A;  1S1A A;  2A6X A;  2Q8C A;  1QJF A;  2J1S A;  4L9B A;  2A3X A;  4GMP 1;  5E6H A;  1AHS A;  5F3I A;  1AL2 3;  2DCY A;  1C5H A;  4P00 B;  1MS0 A;  4HBN A;  1NQD A;  2YV8 A;  4A7K A;  2ZX2 A;  1GOH A;  4CA9 A;  4LHL A;  1VP6 A;  3V0A A;  3AJZ A;  4ZU4 A;  1K42 A;  3RVH A;  2FHR A;  3M3I A;  1PGW 1;  2E63 A;  4LR4 A;  3OGJ A;  1O4Y A;  1V6K A;  2WS9 2;  4WV8 A;  1IZ3 A;  2XJT A;  3OGR A;  4NHM A;  4OCT A;  1WD4 A;  5J37 A;  3ME2 A;  1OLQ A;  2JDY A;  1JUI A;  1TME 3;  4FPY A;  3JBG 2;  5I93 A;  3CF6 E;  5F8P A;  5H9P A;  3PIG A;  1RUG 1;  3OB8 A;  1VIW B;  1GBG A;  1LEM A;  3CJI C;  2GNT A;  4FP3 A;  4FPK A;  1F4A A;  3POW A;  4AL9 A;  3I3B A;  4GZ9 A;  4YG3 A;  2BGO A;  2WDB A;  4PT6 A;  3AYC A;  5FMC A;  5FZD A;  2YMZ A;  5ACA 2;  4IQP A;  1DQ4 A;  2A6Z A;  4ZHN A;  3V64 A;  5IAV A;  4QQ2 A;  3OYW B;  2C1F A;  1FI2 A;  2E7A A;  1ZBE 1;  3VHN A;  4LUK A;  4UBG A;  2VR4 A;  2GC2 A;  5FZM A;  4LMF A;  4OYU A;  4AVV A;  2V5D A;  1JI6 A;  1VB2 A;  2L9L A;  4NWV A;  3ELN A;  4LHS A;  5A3M A;  4DY3 A;  4MXW A;  2R6Q A;  1HQL A;  1JU3 A;  4RS5 A;  5LAT A;  2P34 A;  2Z79 A;  3CZU A;  2C9K A;  2G9Z A;  4IXL A;  5F39 A;  1TMF 2;  3DEM A;  3CJI B;  1GIC A;  4L2N A;  1WLD A;  1DCS A;  4P9L A;  2QUO A;  4R9A A;  5FKB A;  4YVW A;  5IVJ A;  3M7A A;  4YNI A;  3AVR A;  4YPJ A;  4PCR A;  1WME A;  4DUX A;  3WUC A;  2B45 X;  1QJU 2;  1CAX B;  2GZW A;  4Y4R A;  3SEE A;  5I0R A;  4W65 A;  2QQV A;  3OUI A;  4ES8 A;  1J58 A;  4J1W A;  3CZJ A;  2RS1 3;  5DDJ 2;  2PEL A;  3HR9 A;  4MX3 A;  4YZ3 A;  1PM4 A;  2VAU A;  4RS5 B;  3CL1 A;  3IWZ A;  1W6N A;  1MS1 A;  3C2U A;  5CIR A;  1RED A;  4OI0 A;  4ATF A;  1WKY A;  4XZP A;  4B7E A;  1VBA 1;  4YVW B;  3B5L B;  5C70 A;  5F37 A;  3HNY M;  2ES3 A;  1OF4 A;  2CAU A;  4KWL A;  5SV5 A;  1SFP A;  2W9X A;  5C9A C;  4IV1 A;  1C1L A;  3QAC A;  4YM2 A;  4RHV 1;  1RUE 1;  4A44 A;  1D0H A;  1V00 A;  3IMN A;  2VVF A;  2VCM A;  4RYD A;  2JDU A;  2RE9 A;  4XIO A;  4CZS A;  3Q9O A;  3WLU A;  5FUI A;  4X8N A;  2Q8D A;  1S2E A;  4GD4 A;  3MIE A;  4N43 C;  5FQ0 A;  1YC6 1;  3WW2 A;  5A7W B;  4QGM A;  5FPB A;  4Y1Z A;  5FPA A;  5HPO A;  4MGI E;  1AL0 G;  4PIZ A;  4XFI A;  1BK0 A;  2HEY F;  4Y22 A;  2J42 A;  3ZPY A;  1IQD C;  2RMU 3;  3P3P A;  4FQ4 A;  4BA6 A;  1ENQ A;  2O8O A;  1W2O A;  1QJX 1;  1DQ6 A;  2HWB 3;  2VE1 A;  4EZ4 A;  2X05 A;  4QWN A;  1A6C A;  1N1T A;  4CUG A;  1VAK A;  1LU1 A;  2R06 1;  4XAB A;  4XFF A;  2VNG A;  5D8A B;  2GN7 A;  3T4H B;  4D6S A;  2Y6G A;  4P08 A;  3LEK A;  1PMI A;  1TNF A;  5FQ0 B;  1QY4 A;  2VMI A;  3A0K A;  5BNN C;  5M0T A;  4D7T A;  1HJG A;  4DUV A;  2C5D A;  3T30 A;  3FZ3 A;  3HT1 A;  3WY6 A;  5JXI A;  2D93 A;  4B4R A;  3VBU C;  1OUR A;  4K8R B;  1VBE 3;  2Y6H A;  1D7P M;  2ZS6 B;  3E5Q A;  2W0X A;  2XPJ A;  4Q4X 2;  1VAV A;  1AZD A;  3S5A A;  1LGB A;  4RFT 0;  3NRU A;  3WOG A; 
#chains in the Genus database with same CATH homology
 4GWJ A;  2HLE A;  2WBK A;  2RVA A;  5DMY A;  1ULP A;  3WF4 A;  4QX1 A;  4CU7 A;  2WZE A;  4KMQ A;  1US2 A;  3C7F A;  3THC A;  2VC9 A;  3I97 A;  3MV1 1;  2E31 A;  2Y6J A;  4MAD A;  2VZT A;  1JZ7 A;  1JHJ A;  1HN1 A;  3VD3 A;  1NUK A;  4DXT A;  3LQC A;  1W8N A;  2WAB A;  3MBW A;  3GGL A;  2JKX A;  3OGS A;  2VMD A;  1UYX A;  1H6Y A;  2BBA A;  4QDR A;  2WN2 A;  2EIB A;  1SG3 A;  3NJV A;  2W94 A;  1TVG A;  1XC6 A;  2VMF A;  3EB7 A;  2QQI A;  5JUV A;  2YG0 A;  1K12 A;  4QDQ A;  4ARX A;  3HNB M;  4D8M A;  5LA1 A;  2B4K A;  3WNL A;  4E8D A;  2J1V A;  3AC0 A;  4QX3 A;  4W4Z A;  4OZO A;  2VZ3 A;  3C7G A;  4XUN A;  3A21 A;  2W47 A;  2V72 A;  3WEZ A;  2WUH A;  5DN2 A;  4JKM A;  2VL4 A;  4XUR A;  5LA2 A;  2B9V A;  1CZT A;  4ZZ8 A;  4QX2 A;  4OMD A;  2DCJ A;  1GMM A;  2VM9 A;  2VCA A;  2DDU A;  3VDB A;  3GDB A;  2VMC A;  3OBA A;  1TG7 A;  2BGP A;  2YB7 A;  3JXS A;  5JXG A;  2QBX A;  4CVU A;  3K46 A;  3IB3 A;  1JZ5 A;  3WNM A;  1LNS A;  3C8X A;  2CDP A;  2BER A;  3PUH A;  4CU8 A;  1GOF A;  4JHZ A;  2J22 A;  5EJZ B;  4A42 A;  1JZ2 A;  3T0D A;  1UZ0 A;  1GU3 A;  2OKX A;  1UMH A;  2Y64 A;  1K3I A;  2ORZ A;  3I2G A;  3I2F A;  4DEQ A;  4A41 A;  2PQS A;  2VZ1 A;  2Y6L A;  3HOB A;  3WF0 A;  2ZXQ A;  2VZQ A;  3LEI A;  2Y8K A;  3IAP A;  2RV9 A;  2VQU A;  2ZEY A;  4XUO A;  3LEG A;  3III A;  2KD7 A;  2WO1 A;  1W9S A;  5IFT A;  5DQ0 A;  3DYM A;  4BK4 A;  3ACG A;  2VZP A;  2J1R A;  1US3 A;  1JZ3 A;  2C26 A;  2E32 A;  1OD3 A;  3D3A A;  3I3D A;  3SEP A;  2QQM A;  4ZY9 A;  2BZD A;  2VZS A;  2W1Q A;  2W3J A;  3K4A A;  3T0A A;  4DUW A;  3HN3 A;  3T2Q A;  1CZV A;  3I2J A;  1DLC A;  4CU6 A;  4JKL A;  2EIC A;  4W50 A;  2XHN A;  3FHA A;  2DCK A;  2W87 A;  2WN3 A;  5CYY A;  4P02 B;  4PQQ A;  3PUI A;  3LPG A;  3LE0 A;  2VO5 A;  1J83 A;  4CU9 A;  2CDO A;  3ECQ A;  4DEV A;  3T08 A;  5IJR A;  3VD7 A;  3VD9 A;  4FI9 A;  1GNY A;  3NJX A;  3IDA A;  4W8J A;  3ETP A;  4ZXE A;  4E8C A;  4DXR A;  5A1A A;  5JR2 A;  5IYY A;  3HJR A;  2WAO A;  3FHQ A;  5G04 L;  5C71 A;  1H6X A;  3I3E A;  1NX9 A;  3K4D A;  1K45 A;  3C7O A;  4BDV B;  5F7U A;  4BK5 A;  2VZV A;  3CIH A;  2EID A;  3UES A;  2QQN A;  1W9T A;  1NKG A;  3MO4 A;  3MUY 1;  3DEC A;  2W5F A;  5LA0 A;  2W92 A;  3T2O A;  2VME A;  3K4Z A;  2XON A;  1T2X A;  3W5M A;  1JZ6 A;  3OEA A;  4QB2 A;  2ID4 A;  1PX4 A;  1UMI A;  3I2I A;  2J1E A;  1UYY A;  2W1U A;  1KEX A;  2JD9 A;  4UOJ A;  4A4A A;  1EUT A;  1RYY A;  4D0Q A;  4DXS A;  1W0N A;  3GM8 A;  1GQP A;  2VZR A;  4LPL A;  4MOA A;  3WF2 A;  1R64 A;  2ZEZ A;  4P5Y A;  3CQO A;  3OEB A;  1JYV A;  3IAQ A;  1EUU A;  1OT5 A;  1PMH X;  1XPW A;  2YFU A;  3FN9 A;  5B4X A;  4A6O A;  1O8P A;  3VDA A;  2X09 A;  3UNP A;  2Y6K A;  4QPW A;  1O8S A;  3A22 A;  2C4X A;  4UI9 L;  3HNM A;  2HYX A;  3ZM8 A;  1UY1 A;  1UY3 A;  3MV0 1;  4AG4 A;  4CUB A;  3WNP A;  1J84 A;  5HXM A;  3WQB A;  4XVH A;  4QB6 A;  1GOG A;  4HG6 B;  2J1U A;  2VZU A;  2QQK A;  2XQX A;  3BN6 A;  2WYS A;  3ACH A;  1JZ8 A;  2W46 A;  4TTG A;  5CZK A;  4L0P A;  4MGS A;  3U37 A;  4XUP A;  3K75 B;  1XNT A;  2R7E B;  3I2K A;  4MO3 M;  3T0B A;  4BJ0 A;  1BHG A;  3T2P A;  2RJ2 A;  3VD5 A;  3THD A;  1YQ2 A;  4CUC A;  4GWI A;  2VJX A;  3SKJ E;  3DYP A;  3NNG A;  3MUZ 1;  2WQ8 A;  2WO2 A;  3DYO A;  4M4P A;  2VCC A;  4XUT A;  4JX0 A;  4A3Z A;  3FL7 A;  4LQR A;  1OH4 A;  1WCQ A;  1UY4 A;  3ABZ A;  4AAX A;  1W99 A;  3BGA A;  3CMG A;  1L7Q A;  2VQT A;  3P6B A;  2LS6 A;  5B4N A;  1UWW A;  1OF3 A;  2LW8 A;  3W5N A;  3I2H A;  4QX0 A;  1UX7 A;  3C7H A;  4OMC A;  1I5P A;  2W91 A;  3K77 A;  3LPF A;  4UAP A;  1UY2 A;  4ARY A;  1MPX A;  1PX3 A;  2ORX A;  3GXU A;  2W1W A;  4JKK A;  1NAE A;  2J1S A;  5C7G A;  2WAA A;  2W1S A;  1UY0 A;  2QQL A;  2ZEW A;  3F2Z A;  1CX1 A;  4P00 B;  2YFZ A;  1GOH A;  3OGV A;  4PF1 A;  4M4R A;  1K42 A;  4RN5 A;  3OGR A;  3WF1 A;  5IHR A;  2E26 A;  1DP0 A;  2QQO A;  2VTF A;  3OB8 A;  1W8O A;  4OUE A;  3T09 A;  5DPN A;  4LKS A;  1F4A A;  1JU4 A;  1ULO A;  3I3B A;  5IFP A;  4GZ9 A;  1KGY A;  2BGO A;  2WDB A;  2YC4 A;  4PT6 A;  3WNO A;  3SKV A;  2WO3 A;  2J1A A;  2VCB A;  3WNK A;  5G05 L;  1UXZ A;  5JXJ A;  3VDC A;  2VR4 A;  2JE8 A;  3HEI A;  4IUG A;  4OYU A;  2V5D A;  1JI6 A;  3WSO A;  4ZZ5 A;  2L9L A;  4KI5 M;  2X10 A;  1XNA A;  4LHS A;  1DYO A;  2V4V A;  3UET A;  2VOT A;  5JMO A;  1JU3 A;  2EIE A;  3CZU A;  1JYW A;  2C9K A;  2J7M A;  3OG2 A;  4A45 A;  4YPJ A;  2ZEX A;  4DUX A;  4ET7 A;  3CKH A;  3SEE A;  3P1I A;  3VD4 A;  4QDS A;  2QQJ A;  3CZJ A;  1JZ4 A;  1L7R A;  4XUQ A;  3CDZ B;  1SHW B;  4CUA A;  1CIY A;  4KWU A;  1JYN A;  1WKY A;  1UXX X;  4XZU G;  1JYX A;  5C70 A;  2XOM A;  3EYP A;  3HNY M;  1SDD B;  1OF4 A;  3A7Q A;  2W9X A;  4QB1 A;  2VZO A;  5I0D A;  4A44 A;  4MGQ A;  3WF3 A;  5LCW L;  4QAW A;  4RYD A;  5J1X A;  1CZS A;  5FUI A;  3NQH A;  3ACI A;  2YC2 A;  4Z2A A;  3ACF A;  5HPO A;  1GUI A;  3C7E A;  1O59 A;  1IQD C;  1P8J A;  3HPN A;  5JXH A;  2X05 A;  1F4H A;  4TXW A;  3E1F 1;  2JDA A;  1UYZ A;  2Y6G A;  4BXS V;  2WZ8 A;  4P08 A;  3LEK A;  5EJ1 B;  2Z4F A;  3J7H A;  4DUV A;  5EIY B;  5JXI A;  1PMJ X;  2E33 A;  2Y6H A;  1D7P M;  1W9W A;  2J1T A;  3A23 A;  2W95 A;  3NRU A;  3WNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...