4QB1A

Structure of cbm35 from paenibacillus barcinonensis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
GTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
total genus 29
structure length 128
sequence length 128
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb1A00
2W1SA 1R64A 3GXUA 2RJ2A 4P02B 1XNTA 2Y64A 4AAXA 3OG2A 3VD7A 1F4HA 1OD3A 2VZSA 3A22A 2J1UA 1OT5A 1SDDB 2X05A 2WO1A 3A7QA 1PX3A 2VZOA 3UESA 4W50A 5A1AA 3WNPA 3DECA 3I3EA 4XUNA 2C26A 4ZZ5A 5JXGA 2Y6LA 4ZXEA 1JZ8A 3CIHA 1OH4A 3CZUA 1JHJA 2DDUA 1L7RA 1KEXA 4GZ9A 2J1AA 3JXSA 3VD5A 1EUUA 1JYNA 3T0DA 1SG3A 3C7EA 2VZRA 1XPWA 4IUGA 4P5YA 1JU4A 1MPXA 5FUIA 1UZ0A 3MO4A 2BBAA 4CU8A 2VTFA 1GOGA 3FN9A 1JZ2A 3ABZA 4ZZ8A 2ZXQA 2WZEA 2BERA 1JYXA 2WAAA 1W9SA 4QX0A 4D8MA 1GOHA 2CDOA 5B4XA 3C7HA 3P6BA 1JZ4A 3ZM8A 2HYXA 2YFZA 4KI5M 3FHQA 4TXWA 3IB3A 1LNSA 1SHWB 2C4XA 2ZEWA 2B4KA 2WYSA 3K4ZA 2WO3A 4BK4A 1J83A 1BHGA 1PMJX 3ECQA 5DPNA 2J1EA 2E31A 2BGOA 4UI9L 4QDRA 2Y6HA 3I2JA 3T2PA 3OGRA 3WQBA 4A42A 2YC4A 3WSOA 4PQQA 2BGPA 3WF2A 1TG7A 4QDQA 1CZSA 2W1WA 3IDAA 3CKHA 1CIYA 5JUVA 2J1SA 3T0AA 3WNOA 3THCA 2J22A 1I5PA 4JKKA 2VZVA 1O8PA 2WO2A 2VZUA 3DYPA 1HN1A 2DCKA 3OEAA 3WNKA 4XVHA 4E8DA 2VR4A 3I2FA 1XC6A 3ETPA 3VDCA 4UAPA 3HPNA 1JZ7A 2QBXA 3W5NA 4MOAA 1US3A 4M4RA 2VZQA 4BDVB 1UY3A 2W46A 5C71A 1JU3A 3OGSA 1K12A 3PUHA 4JKLA 3WF3A 2W1UA 3NQHA 1L7QA 2W9XA 1GU3A 1W99A 3LE0A 5C7GA 3K4AA 4OYUA 3WNNA 3E1F1 1UXZA 2V4VA 2VOTA 1KGYA 1WKYA 3HNYM 3I2GA 1US2A 3WF0A 4ARYA 4A41A 3LPFA 2ZEYA 5DQ0A 1EUTA 2XONA 4CUCA 3MUZ1 1JZ6A 3UNPA 1JZ5A 2PQSA 4JKMA 5DMYA 2JKXA 2RV9A 4PT6A 1GOFA 2VMDA 1UX7A 4KWUA 2ZEZA 2WUHA 1O8SA 3GM8A 1PMHX 2OKXA 2VZ3A 1UY4A 4CUAA 4A3ZA 3WNMA 5G04L 1NUKA 2YFUA 5EJZB 1K42A 4GWJA 3MV11 4MO3M 1GUIA 1YQ2A 3K77A 1H6YA 4W4ZA 5EIYB 4QX3A 2VZ1A 1OF4A 2W94A 4BK5A 2VCBA 2HLEA 2VMEA 3GGLA 2W91A 1O59A 3DYMA 2J1RA 1UMIA 2X09A 4CVUA 3CQOA 5LA2A 2VMFA 3F2ZA 3BGAA 3FL7A 5J1XA 4XURA 3ACGA 1CX1A 3P1IA 1ULPA 4OUEA 4W8JA 1NX9A 3C8XA 2QQOA 3ACHA 2RVAA 4QB6A 4AG4A 5B4NA 3VD9A 4QX1A 5IHRA 3I3BA 4JHZA 3HNMA 2ORZA 5LA0A 3SKVA 1W0NA 2Y6JA 5JR2A 4QPWA 1GQPA 2EIBA 4Z2AA 5HPOA 1J84A 4XZUG 2WZ8A 1UY2A 4XUTA 5IJRA 1GMMA 3C7FA 2JDAA 1NKGA 3BN6A 4UOJA 4MADA 1K3IA 2X10A 1DLCA 1RYYA 1CZTA 4D0QA 3I2HA 3U37A 2WN2A 5JMOA 2JD9A 3W5MA 3IAQA 5JXJA 2VCCA 3HEIA 1D7PM 2W1QA 1W9TA 4P00B 5LA1A 1F4AA 3OEBA 4BXSV 3IAPA 1UY0A 4L0PA 3UETA 1UWWA 4DUVA 1W8OA 2B9VA 3CDZB 5C70A 3SEPA 2KD7A 1DYOA 3I3DA 2WDBA 3C7OA 4DXTA 3LEKA 1T2XA 4JX0A 3DYOA 2E33A 2WAOA 2VZTA 2QQJA 1TVGA 4XUPA 5F7UA 4LQRA 4DUXA 2W92A 1W8NA 3D3AA 4RN5A 3SEEA 4PF1A 1UY1A 2WN3A 3I2IA 2VC9A 2L9LA 3NJXA 4DEQA 3WEZA 2ZEXA 3MUY1 4BJ0A 3EB7A 3C7GA 2Z4FA 3K75B 3VD4A 2R7EB 3VD3A 4RYDA 5IFPA 2WBKA 3EYPA 4A45A 4E8CA 5JXIA 1ULOA 3LEIA 4HG6B 4ARXA 2WQ8A 2LW8A 5HXMA 2EIEA 2W95A 1W9WA 3T09A 4ZY9A 3A23A 4CU7A 1OF3A 2YB7A 2CDPA 3THDA 2QQIA 4OZOA 2JE8A 4A44A 4DXRA 3I97A 3HN3A 3NRUA 3T08A 2QQKA 5CYYA 2E26A 4MGQA 3CZJA 3VDAA 2C9KA 3WNLA 5JXHA 3IIIA 3SKJE 3A21A 2VMCA 1H6XA 1PX4A 4DXSA 1CZVA 1UYXA 2YG0A 2XOMA 2J1TA 1JYWA 2W47A 3OB8A 1NAEA 5I0DA 3MV01 1K45A 2Y6GA 2V5DA 2VJXA 3NNGA 4QB2A 2QQMA 4M4PA 2VZPA 3AC0A 3K46A 3LEGA 3HNBM 2VL4A 4P08A 4YPJA 2VQUA 1UMHA 4ET7A 5IFTA 1UXXX 4DEVA 3K4DA 4LPLA 4QB1A 2XHNA 5G05L 5DN2A 1JI6A 2QQNA 1JZ3A 1P8JA 2QQLA 2BZDA 2Y8KA 4OMDA 3MBWA 4XUOA 4MGSA 3GDBA 3T2QA 3LQCA 4CU9A 2YC2A 1GNYA 5EJ1B 4CUBA 4QDSA 1JYVA 2E32A 3LPGA 3NJVA 4LHSA 4FI9A 2Y6KA 2ORXA 2W3JA 4A6OA 3VDBA 1XNAA 3J7HA 4XUQA 3CMGA 2XQXA 4A4AA 4GWIA 2VCAA 1IQDC 4DUWA 3FHAA 2VQTA 2VM9A 5LCWL 2J1VA 2V72A 3I2KA 2ID4A 2EICA 3WF4A 1UYZA 2VO5A 2J7MA 1WCQA 3PUIA 3HOBA 4OMCA 3OBAA 4TTGA 3T0BA 4QAWA 2W5FA 4KMQA 3ACIA 4LKSA 4CU6A 1UYYA 5CZKA 3HJRA 2DCJA 2LS6A 4QX2A 2WABA 1DP0A 3ACFA 2EIDA 2W87A 3OGVA 3WF1A 5IYYA 3T2OA
chains in the Genus database with same CATH superfamily
1R64A 3SQOA 1KJLA 2RJ2A 1XNTA 5DUVA 5FZAA 4Q8KA 3WY6A 1YI9A 2JENA 3O0XA 3A22A 4CEYA 2DVAA 4OULA 3TEWA 1ZRIA 3B93A 3GCXA 1MS8A 2R6QA 3V0AA 4K8RB 1PX3A 2VZOA 4P5HA 4YM0A 5FMBA 3SC7X 4YW2A 4N43B 1WMFA 3WNPA 4GIQA 1OXCA 3TBDA 1RMU3 1BYHA 4XF3A 3DECA 1GV9A 2C26A 2WA3A 1VPHA 1UIKA 2UURA 4KWLA 3INAA 4C0HA 4A7ZA 2XJVA 1OH4A 1LGNA 2DBIA 3N9QA 3SH3A 3AP6A 2CNAA 3W58A 3O1OA 1LESA 1RUF2 4N43C 1O4ZA 5FZ7A 3WQ7A 3D6EA 1AR72 2ZX4A 2VQAA 3PIGA 4GZ9A 4IE4A 3PTYA 4P9JA 5DXDA 5BV6A 3NW4A 2VZRA 1VRH1 3NNFA 1Q5OA 1JUIA 1OLME 2GNBA 2XVLA 1Z7S3 1MS0A 2P37A 4AF9A 3U78A 4IEXA 3BTZA 2W08A 3WOGA 2ZAHA 5L7OC 2ZX0A 1LGCA 4QU1A 2BOJA 4XOGA 3FN9A 1KQRA 1AYM3 1N1YA 1JZ2A 2Q0AA 2EXHA 4W6XA 4ZZ8A 3OYWA 2ZXQA 4Z92B 1G9AA 2OA2A 2WZEA 2BERA 1JYXA 4CEYB 5J36A 4QHOA 1POV0 3ZPYA 4ES9A 1R082 4D8MA 4HSJA 1GOHA 1D4M2 3SCHA 4XAEA 3V0AB 2DYCA 2E7QA 1Q8OA 1OSGA 3C7HA 3KGLA 4IQPA 1XNDA 5ISLA 1JZ4A 2B7YA 2BDRA 1YO8A 5FZ6A 3U11A 1HRI2 2HWF1 2YFZA 4CEYC 3BU0A 5A3PA 3AZVA 5JOZA 1O3TA 4TXWA 3JQWA 2VNRA 4Y5SA 2GC0A 1SACA 2D3SA 5L9VA 2ZEWA 4Q4Y2 2QVSB 1BMV2 3FMGA 3KVAA 4KGQA 2VVFA 3N9LA 3H8OA 2WO3A 2ZGUA 1M4WA 1PMJX 1E5HA 2J1EA 2BPA2 4Q27A 1R091 4QD2A 1QQP1 4OI4A 1RUJ1 3J9SA 4AFCA 4BM8A 5FZEA 3NAPA 3T1MA 3I2JA 1WMEA 5F37A 3G6JB 3UV9A 3VUOA 4BMEA 1OKQA 3VHPA 3WSOA 1NOVA 1O91A 4PQQA 3EBRA 1LJ7A 4DIQA 3MIBA 2VULA 3FHIB 4QDQA 5A33A 5F9TA 2Y0OA 3ITQA 4RQPA 3POFA 3ENRA 3PHMA 3JB8A 1XJAA 5JUVA 4DXZA 3E97A 4R52A 3KHCA 4K3UA 3O1RA 4FPEA 5F39A 4YSFA 4DPNA 5FO8B 3A4UA 2HWE3 4C1WA 1PIV1 2IXHA 2XLGA 1LHUA 3WNOA 2G1MA 3THCA 4JKKA 1SFYA 4ONUA 4A7YA 4E2QA 1TMF2 1E5RA 4N90A 1TZOA 1LEMA 4BXFA 2HEYF 3A0KA 3ZLIA 1I1EA 1NE4A 2DCKA 1YIPA 5KBFA 4QXKA 4D6RA 3O1SA 5FMDA 2X53S 4P9GA 4YW1A 1I9RA 2OPKA 2VR4A 5FY1A 2ZGPA 4Y1VA 3VBUA 1OI6A 3VDCA 2EF6A 5FYMA 3SCFA 2P6HA 5DZGA 4B4QA 1G8WA 1X36A 3POSA 5DDJ3 4PBOA 1NG0A 3T30A 3ZYIB 1S2KA 5FPXA 2F4PA 4YW6A 5KC6A 4DNYA 2DCTA 2ZS6B 1XU1A 1QJY3 4AI2A 2JIJA 2PMWB 4HOOA 3WDYA 5CBLA 1H8VA 2GNMA 4OLLA 4GH4C 2WZPP 4HVQA 2JJ6A 2YBKA 1JU3A 4LA3A 2FHRA 3HD8B 5B2GB 2JDYA 4OVEA 5EYXA 4LBNA 5CIRA 1L7QA 1JTZX 5EV7A 1OPOA 1GU3A 5A33B 2FDKA 1RXFA 4OYUA 4RQPB 1XSRA 3PL0A 3OCPA 4Q0VA 4WVWA 1GZWA 4FAGA 1JXNA 1ZA7A 1UXZA 1G9DA 1UU5A 2V4VA 1KGYA 3I2DA 1DQ0A 2XKOA 2IXJA 2R49A 4K8FA 3A0NA 3AYAA 3GCWA 1UZWA 3PIJA 3NNMA 5IVEA 3CEWA 1RUI3 3T1LA 3TN91 4A41A 4K1YA 2GN3A 4I09A 4RQPC 2XBO3 1DQ2A 1DZRA 2ZEYA 2ZMNA 1RVF3 4F8AA 1AYN2 4HPKA 1X9PA 1AR91 5FP4A 3VBUB 2RV9A 4PT6A 4L92A 4Q0SA 5CKQA 5KHGA 1C57A 1C8NA 1V6IA 4KWUA 2A3WA 5F6LB 4N53C 4DS0A 1BJQA 4A2UA 2A1XA 4AI8A 5GZEA 3APBA 3MHZA 5DUWA 3AFGA 1W04A 3OF1A 3N35A 1N3PA 3R4UA 4QGLA 1AX2A 4XFFA 5IWFA 3OSDA 3VBUC 2DCYA 4H14A 1W0OA 1UOJA 3WNMA 1K5MA 1NUKA 1WWYA 1K42A 3ZMOA 1ZREA 1BCXA 4ASMB 2VOKA 1U12A 4MO3M 3WP6A 4LUKA 4YM2A 1RJ8A 3RJ2X 3B3QE 2G4IA 2XHKA 3RWNA 1W39A 4UBHA 1SPPA 1LECA 1REFA 1LOCA 4N8MA 4L11A 4OCTA 4RSUA 2W94A 3D8CA 2VCBA 4H7LA 1F35A 3AZWA 3B94A 4WZFA 5F3IA 1ZBE2 1RUF1 1SBDA 2AREA 3Q8AA 1U5ZA 2G9FA 1AR71 1GZWB 3M70A 4K9SA 3RYPA 2HKXA 3DKWA 5T5OA 1UMIA 1ENXA 4XTPA 2CSGA 1RUH3 3AVSA 2QE3A 5A3NA 2SBAA 4CDWA 1ULCA 3FL7A 2D6MA 2GU9A 4HLTA 2CHHA 3GF6A 1PZ9A 1CN1A 3GYDA 1IOAA 4L8QA 5FZOA 3UT0A 1ODNA 1ULDA 4HPKB 1Q8VA 3CBNA 1HLCA 4Y5Z0 1A34A 2ES3A 1IKQA 1CX1A 4OUEA 1ENRA 2ZOEB 5FZ4A 5JOYA 1JODA 1KFUL 2QQOA 3ZXGA 2NMNA 3ACHA 4AEDB 4AVCA 4AQ6A 4Q4X3 4FTBA 4QX1A 1YQ5A 1XNCA 2FDHA 4DRRA 3W59A 1W2NA 2QZ2A 1BBT2 3BALA 1D4M1 1G9CA 2XJUA 5LBFA 2Y6JA 2CV6A 3EJKA 5K4LA 4AEDC 4CSWA 2VUAA 2FMDA 1K5MB 5ABJA 2EIBA 4ZU4A 3HIFA 5HPOA 2KA3A 1OD5A 1GLHA 1HRI1 2WZ8A 3H1WA 1UY2A 3AZYA 1IHMA 1JZ8A 2PHDA 1SPPB 2BGCA 1PM4A 2R073 4Q4Y1 1UYPA 5J3UA 1BMV1 4CCOA 3HBKA 3BN6A 1VBB3 4GMP1 4ORFA 5C3OA 1RYYA 4J1WA 4D0QA 5KXBA 2OX0A 3LFIA 3U14A 1ZRCA 2FD8A 1JN2P 2XB6C 2OQ6A 1YQCA 3KV9A 1JMUB 3OUHA 5HV4A 1UX6A 2ZGOA 3WG3A 1D7PM 1UPIA 2YPDA 2XUMA 1NXMA 5E6HA 3FFQA 4XFGA 4YZ4A 1CPMA 2BWCA 5FZOB 5CFDA 4BXSV 2XR4A 3O1PA 2D6OX 1UY0A 4FXKB 4C8DA 5DUUA 3CNAA 1CAWA 4W6WA 3RI8A 3LAGA 1KS4A 3VDDB 1GWMA 3BKZA 4BQ1A 1PHMA 2ZZJA 3VL9A 4BOWA 3UYJA 1LHWA 5FK8A 2Y34A 3SEPA 3LIHA 4I30A 1Y9MA 3CU7A 5FY9A 1TMF1 2BNNA 4AVBA 5ABJB 2ZABA 1EPZA 1DHKB 4XBLA 4DXTA 3LEKA 1T2XA 3VDDC 3FBYA 1GFF2 5AFBA 1SCSA 2E33A 2HWD3 2QQJA 1TVGA 1Z7S2 2WAOA 2VZTA 4Y1ZA 5FLIA 4IGQA 4LQRA 4XF1A 3AYDA 5H9SA 3THPA 4DUXA 5FZ8A 3OPWA 1IPJA 4XAAA 2QTWB 3ZIWA 2OT7A 5CEHA 4META 3WP3A 3TOJA 3VV1A 3JB4C 4LKFA 3I2IA 1AYM2 2ET1A 2ZTNA 3KGZA 2XUEA 3MEPA 5LBBA 2A3XA 4LBQA 1WBLA 2ZEXA 4DO0A 3M3IA 4Q4V3 3RRDA 1ZZ9A 3ES4A 2JG8A 3VD4A 2R7EB 1LODA 3HQUA 5AFEA 5CFDB 3VD3A 3ATGA 5A7NA 5FZ9A 3J8F3 4NJ4A 3AMHA 5FUPA 5FZGA 3WP5A 1CX4A 3USSA 4NUBA 1OQ1A 2R16A 4MG2A 4KBBA 4AZZA 3EYPA 1CAWB 3FLPA 1GKBA 3LEIA 2ZGQA 4ZU7A 1BEV2 4QQLA 5L73A 4ARXA 3S7IA 2EIEA 1W9WA 2PFWA 3T09A 4FFIA 4HT1T 4S2FA 4CU7A 2EXJA 2CDPA 2JG9A 2R042 5CKMA 5JPMB 3PDQA 4OZOA 2A6VA 4A44A 3TNQA 4YFWA 1AYN1 2A75A 3IDEA 3PMEA 4B3NA 3NRUA 3VBOB 1DGRN 5JSRA 1WCDJ 4BWOA 1WZXA 5IAXA 2W0XA 1U0AA 5F3CA 5KWRA 2E9QA 1CD3G 5DZFA 1POQA 4B1LA 3VBFC 1LGBA 5FXVA 3O5SA 3UGHA 1VAKA 2K2SA 3WNLA 1G9FA 2DTYA 3IIIA 2Y33A 4QXHA 2K46A 1EAH3 2AYHA 2H0VA 1OLMA 4OHYA 3HT2A 4KU8A 3A21A 2VMCA 2XXZA 1PX4A 4IV3A 5CNAA 3VBOC 4LBMA 5CG8A 1AZDA 1WLDA 5GZDA 2YGMA 4S2DA 3WQ1A 1OKOA 2HWE2 2Z2SB 4FPJA 2JG8B 4GB32 1BKZA 2W47A 4LNVA 2JDMA 3ZX7A 4K1ZA 4ES8A 1RHI2 1SBEA 1Z78A 4RHV3 5HI0A 4H7MA 1ZRFA 2W2IA 4NWVA 3DF0A 4XQWA 1QKQA 4UW5A 1K45A 1ZZCA 2TBVA 4UFHA 2WL1A 3NNGA 1ZBE1 2MEV3 3O7OA 4BIOA 2VZPA 1XYNA 1JUHA 4LULA 3W9AA 2GDFA 2OZ6A 2JG8C 2VQUA 4V2WA 4F3JA 1BQPA 5DG2A 4IE0A 4QKFA 5DDJ2 3C3VA 5EFUA 1ZRRA 5IFTA 4OHZA 2JG9B 1COV2 3K4DA 4LPLA 5FZFA 1XNKA 3H3ZA 4AEMA 1RUOA 3HWJA 3R4SA 1LRHA 1QJZA 1JZ3A 5C3QA 2NPIA 1FX5A 2WNVC 5BXXA 1NA1B 4LE4A 3KLSA 2JG9C 4XUOA 4BQYA 2XPJA 3ILNA 2IXKA 4YZ5A 3U75A 5KHIA 4O9EA 4XMAA 4OZXA 1JYVA 4LT5A 3JQXA 1BBT1 1OURA 2Y6KA 4IV3B 3T4HB 3OJBA 1UN1A 3MLKA 4V1PA 5JIUA 5ANNA 4CP2A 2VUDA 4GMP0 2ADDA 1O4YA 3IMMA 3USUB 1GQGA 4YLZA 4ATFA 1PO22 1NA1C 4DUWA 4RGAA 3FHAA 2VM9A 4GALA 2ZX3A 5F5AA 4MHRA 5FDBA 3RZJA 1RUI2 4U36A 2ZKLA 5FYVA 4IV3C 1R1ZA 1RVF2 3Q8CA 3PURA 2JDHA 5C3RA 3WF4A 1OVSA 4XJUA 1PK6A 2VO5A 1TEIA 3LIGA 4ZHNA 1G6NA 3PUIA 4YGEA 1N3QA 4FOYA 3T0BA 4FVVA 4IW3A 3VZLA 4TTGA 1Y4WA 3ACLA 3GBWA 1DYKA 1YQ6A 4CU6A 1FAYA 2ZHKA 2LUWA 5SV5A 1BZWA 1TNFA 1ZM1A 1GYKA 2Z79A 2WABA 1ND3A 1DP0A 2EIDA 1F8VA 1PZ7A 3H1MA 4Z1VA 5E89A 1JYCA 4YFZA 5IYYA 3T2OA 5J7MA 2W1SA 3POEA 5F3EA 1DLLA 2YBSA 4P02B 1X9TA 1W05A 2Y64A 4AAXA 1IS4A 1RJ7A 3GJBA 3JU9A 4QXCA 5FYUA 3ZKUA 1F4HA 1OH3A 2VZSA 4AI3A 5FUNA 3O12A 1SDDB 3H42B 4XE9A 2X05A 2WO1A 1BK0A 4D6QA 4MUVA 3WUDA 2XWJB 2XDVA 4CZSA 5ACA3 5C6CA 2X5IA 3FLRA 1A3KA 4AI9A 5A1AA 4EWDA 2RR13 4NRQA 1WLTA 4L97A 5JXGA 2PLV3 3U4XA 1RUH2 2Y6LA 3JBG3 4ZXEA 1NQJA 2OS2A 1Z7S1 2FCTA 4OQ9A 3HT1A 3POWA 1PMIA 2OQ7A 3CZUA 1RC6A 1MZ5A 3POYA 2EAKA 2YV8A 3W20A 1E57A 5IAVA 2DDUA 2P3YA 4Q8LA 2ZJCA 1MEC3 4LA2A 3VHOA 3WG4A 2WSUA 3JZVA 3VD5A 2I45A 3T0DA 4PJYA 1AYM1 5ERLA 1DGRA 5BNPA 5JIAA 1YQ8A 1JU4A 2PHTA 5TSWA 4AFAA 3MO4A 3TEZA 2BBAA 1J1TA 3PVNA 1F31A 4PHZA 1ND3B 1X33A 2AUYA 2DU1A 1GOGA 4NIIA 4ZU5A 4EYUA 1FPN2 2DFCA 5FYTA 4FPLA 4IGOA 4YWAA 3NV4A 1VBD3 3ZYGA 3ZYJB 3BVCA 4COYA 5KHKA 3JD73 4EN0A 3AYCA 3FUOA 2WAAA 1BEV1 5J96B 4P9LA 3NVCA 4LUMA 1ND3C 1BXHA 4QX0A 2R072 3BU7A 4BLIA 2CDOA 2JWPA 2O14A 1VBB2 1SLLA 1WMDA 3OD4A 2PQQA 2X5IB 5I0TA 2R041 1IQAA 3P6BA 3UKVA 5CG9A 1A78A 4LHKA 4PLMA 1YUDA 4KG8A 3V0BA 5JI7A 4KI5M 1HQLA 1XB9A 3VZMA 3MYXA 1S4CA 2C4XA 4M3CA 2WYSA 3KVBA 4XC9A 5EJ3A 4Q29A 2WFF2 5FBJA 1K5JA 4LO7A 4BK4A 3JCIA 1VMHA 2B5HA 4FPOB 2HWC2 3AYEA 4KWJA 1OA3A 1SFPA 2E31A 4L9BA 2BGOA 5LRSA 3VBHB 3WW3A 1FMD3 3TEYA 5BNPB 5C33A 3RPQA 5BUVA 5FMCA 3ZDVA 2QQWA 5L36A 3IKWA 2JEMA 2WLQA 3FBMA 3OGRA 4A6SA 1OFSA 4WM8C 4TLGA 1JOPA 5JDBA 4XFHA 4A42A 1EYBA 2HWE1 3AMQA 1Y7BA 2F4LA 2YC4A 4GB31 1ND2A 3WCRA 4Q0UA 1RHI1 4JV4A 3WF2A 2AEZA 3S5QA 3VBHC 1CZSA 5FLHA 4CPBD 5BNPC 2P4EA 3IDAA 1G9BA 2RDRA 2BTVC 2DVBA 4U2AA 2R0FA 3RDIA 5KR7A 4N43A 1LHOA 4YW5A 2HWD2 3PJYA 5FK7A 3T0AA 1HDKA 1QOOA 2GNTA 2Y38A 3ZXAC 1YHFA 2VZVA 4ITCA 4COUA 4NPMA 3BB6A 4CXYA 2WO2A 4PI0A 2CAVA 4IV1B 1COV1 4N9HA 1QJX3 1CPNA 5FZHA 3MLJA 2QCSB 3LOBA 1ZBA3 2BWAA 4K7JA 4R8HA 1XC6A 2AC1A 2D93A 2LROA 1VBA3 1L3JA 3AP9A 3ETPA 4QHBA 3WCSA 1WA6X 4M3CB 2BYVE 1VAMA 3EMRA 4YRDA 1QJEA 1UKRA 1EV12 4NVPA 2D3RA 2FQPA 4IV1C 4OI2A 3KCXA 3J8F2 1C28A 1QNWA 4QPIC 5FYSA 5LEKA 2Z42A 3ZMNA 1YWKA 1OA2A 3O0VA 5DG1A 3RZGA 1HJFA 1UY3A 1C5IA 4IEOA 1KD7A 3POIA 4M3CF 2C5DA 3GZUC 3POBA 5C71A 1RUD2 2HH9A 1VJ2A 2VBBA 1PO21 3PUHA 4JKLA 2NN8A 5JVVA 2GSYA 5A7OA 4RR3C 3WF3A 2ZGTA 1ND2B 2W1UA 3NQHA 2WR9A 2ZPXA 1AHSA 5GLTA 2D44A 4RS5B 4XILA 1RUI1 1V6JA 2C1FA 5F5QA 1RVF1 5J09A 3M3OA 2ZGNA 4AWDA 5FZ3A 4BYYA 3E6BA 3DCQA 5C5UA 5LBEA 2VOTA 1VLNA 4GWMA 1FYUA 2WQZC 3H7JA 1WKYA 1ND2C 3HNYM 1FI2A 2VTXJ 4RS5C 2WA4A 5A3UA 1CQ9A 3ST7A 4EQVA 5DQ0A 4W65A 5KXDA 1EAH2 3MUZ1 5I0SA 2MPFA 4IEPA 4JTOA 1JZ5A 3MF9A 1JZ6A 1DGWX 2JKXA 1ZYBA 4L99A 1RUC3 2DF7A 1JYIA 1WA4A 2RM23 1J3PA 5GM0A 3L2HA 2ZCWA 4YW3A 2ETEA 2WS93 4R4XA 2ZEZA 3RZKA 3EO6A 2WUHA 3GZTB 4AVVA 5GLZA 2YU2A 1O8SA 1WGPA 2PAMA 2VNGA 1J1LA 1QIQA 5IK5A 4IEUA 4N7IA 2OKXA 4HSLA 4CUAA 3BCWA 2Q8DA 3VGIA 5JMCA 3MF6A 1SDWA 4A3ZA 4URAA 1PNGA 2WYFA 3KF5A 3U1XA 3ZN5A 4CCCA 4B4PA 4EN7B 2VVEA 2YFUA 3MIEA 2RS13 4O65A 1CAUA 1RUH1 1V0AA 4LBKA 5I91A 2MNGA 2Q1ZB 3SH5A 3T3YA 3S0MA 4AEJA 4JDMA 3MIFA 1XNBA 2WZR3 4LE3A 1O59A 1WBFA 4YG6A 4MXVA 4MV2A 3NL1A 5KC5A 1GP6A 4XIKA 1RUG2 2ARCA 4BHPA 3I8TA 4F83A 5IVJA 2DCZA 1UOGA 3KZ4C 3VKLA 3C2UA 3U0ZA 4CVUA 3CQOA 4RFT0 2GNDA 1RUNA 2VMFA 3F2ZA 3ZPOA 4CCNA 3LGRA 3ZFGC 3DXUA 2YYOA 3ZXLA 4GH4A 5JOWA 5A1FA 4YVSA 2WQ4A 5FYCA 4XURA 4XJ8A 1NT0A 3LA2A 3ROUA 4EROA 4W8JA 1FPN1 3ILFA 1NX9A 3T4VA 1F5FA 3C8XA 1EP0A 2JKBA 5FZ0A 4I0BA 4AG4A 5I8SA 2IVIB 5IHRA 2BVBA 4UT5A 4XFAA 4H3WA 2HBUA 3HNMA 4C1XA 4CP9B 1XOYA 4E4SA 5IT6A 2ORZA 2R071 4QKBA 5BNNB 1F9KA 1W0NA 2UY8A 3SKVA 1VBB1 3KT7A 4QPWA 1H2KA 3X29B 4IXLA 1O3RA 3BPZA 3UJQA 4LBJA 4X8PA 1YJLA 4QX5A 4SBVA 4DRVA 1J84A 2JIGA 2UWAA 2BNMA 4XZUG 2IXIA 3H8RA 2BVVA 1CAUB 4XZPA 3BOWA 3S7EA 4AVSA 5IJRA 1GMMA 1BVVA 1S2EA 4FPHA 4N9IA 5A80A 5BNNC 3S30A 1NE6A 5L9RA 2P3JA 4FPFA 5HCHA 2QDNA 2WFF1 3NSTA 4XPVA 1CZTA 2XLAA 4N53A 5JZGA 4TLFA 5LRRA 5HCBA 2HWC1 2JD9A 2P34A 1T6BX 2PTMA 4PLOA 3IAQA 2ERFA 1UCXA 3ZSMA 1OHFA 1SBFA 4LTAA 5HCFA 4FAHA 3ZYHA 2W1QA 1C8M3 1B35A 5L9BA 5LA1A 1CJPA 4XCAA 1FNZA 4BMBA 3OEBA 2V09A 4GH4B 3UKTA 4YVSB 1VMJA 2DUPA 2V5YA 1LTEA 3IAPA 5ACA2 3N7LA 5LA9A 3VN4A 1JBCA 2GALA 4YZ2A 5L19A 3ALQA 1O3QA 5C4WA 3ZYRA 2VPVA 4D94A 4DUVA 2VGDA 3JBG2 2HWD1 2CGPA 4YVSC 5FKCA 4CE8A 2B9VA 4LIUA 3OD0A 1CIWA 4X6RB 4M0HA 4YVWA 1V6KA 2KD7A 4ZS3A 1VRBA 1DYOA 3I3DA 4R4ZA 3WHUA 2AEYA 4TSVA 5I8YA 4NAMA 2WNOA 1S2BA 2H0BA 2WDBA 3M7AA 5A32A 2EA7A 3M8LA 4XF0A 3GNEA 1Y9QA 2ARAA 2BEOA 3AMPA 4XBQA 1AL23 1FATA 2DVGA 5F7UA 3UGFA 2JXAA 2D6LX 4M00A 1KS5A 1QWRA 2AACA 3I49A 4MLOA 1DGLA 1EV11 3OY8A 1NQDA 5LY2A 4MYEA 4N53B 3J8F1 5JZGB 4GAZA 4D7TA 2WNUA 2VECA 1NXD1 2L9LA 4Y5TA 2VMGA 3AZXA 4CCDA 3QH6A 4G9SB 3RVHA 3U10A 3LEMA 1C4RA 1RUD1 1B35B 2E63A 4AEDA 4JHTA 5JZGC 1NY72 3H3UA 4XFBA 4HKOA 5FIXA 4E9KA 2J42A 5IFPA 2QUOA 2OIIA 4LO4B 4H55A 5F2SA 3CO2A 2WRAA 4Y24A 5T5JA 1B35C 5C4WB 1CGPA 1CWPA 3VZKA 1GSLA 3AFKA 2VBPA 4XIOA 3HN1A 2LW8A 1URXA 2EVXA 1GBGA 1SLAA 4YVWB 3A23A 4AL9A 3QOPA 3BODA 4XACA 2B46X 4HKWA 2FDIA 1X50A 4WM7B 3IDBB 3ZKYA 4KNCA 5FY7A 5A32B 4DXRA 3B7MA 1EAH1 4ISQA 5C4WC 2LTNA 1H1IA 3I97A 5BYNA 1W2AX 3GZAA 2D6NA 4M3CE 1FMD2 4Q0QA 3T08A 1ULGA 2KXLA 2QQKA 5F2WA 1H9PA 4YVWC 5FO7B 1R1A3 4YW4A 3VDAA 3B02A 2C9KA 1RB8G 5FCCA 4WM7C 5FWJA 2E7AA 4AOCA 3OY8B 4XFIA 4FFHA 2RS32 2ZX2A 5JLVA 4LJHA 2WNUB 2D6PA 4S2HA 1H6XA 4DXSA 3OUIA 2GN7A 1S1AA 3BYWA 3FJSA 3RYKA 4XJAA 4EN8B 3MZHA 2O1QA 1ASJ3 3KWVA 2DV9A 4MXWB 2XOMA 2BV4A 2J1TA 1HQWA 2JB8A 5FREA 1VBE2 2G9ZA 1GZ9A 2DUOA 4RFRB 2C0ZA 2WNUC 3VDDA 4KBZA 2RDNA 1XXNA 3Q8BA 4FPGA 3RQ0A 1R081 1LOGA 4M4PA 2Y6FA 4YM1A 2X29A 3AC0A 4R9BA 4B7KA 3PVEA 1W6NA 2VL4A 3KV4A 5KXEA 3WDXA 1RUG1 1VBA2 4COVA 1TE1B 1DQ5A 4KL1A 5K7PA 5LASA 4LKDA 5EQUA 1YFXA 4R9DA 5K0UB 3UK9A 3ZSKA 4JRAA 2XHNA 1WCKA 5FZIA 1RUE2 2HWF3 4DINB 1JI6A 3BOPA 4D3WA 3H1YA 2E7TA 2QQNA 2BUKA 1PO12 3QH7A 4XFCA 5DAXA 2Y8KA 1UZZA 3PNAA 4QMAA 1N1VA 1IPSA 1X8MA 5H9QA 5K0UC 1DQ6A 4NN0A 4OMDA 3ZR5A 3CJXA 1QXPA 4FPKA 1FXZA 3LFMA 4CU9A 2ET7A 4CUBA 1GNYA 5EJ1B 4QDSA 2E32A 4FOQA 4H2AA 5FXXA 2NYYA 4LHSA 1WD4A 2W3JA 3RS6A 1XNAA 4WVMA 2NMOA 2F17A 1HV1A 2VOVA 4INDA 3H50A 5C5TA 3H0OA 3POGA 5KXCA 3B5LB 1RMU2 5IVYA 4UFMA 1OC1A 4Z2WA 1J3QA 2YDEA 2FZ1A 2ID4A 2PHXA 2EICA 1QDCA 4XDQA 5HBAA 3ILRA 2RG4A 4MHUA 1YC61 3HQRA 4EV0A 4YNIA 1PIV3 1W6NB 1WCQA 2O0OA 5BPXA 3VBFA 4OMCA 1H4HA 1RUC2 2VXJA 2XLFA 3OBAA 4OFGA 3R4DB 4LOTA 4IL7A 4PBPA 3AKSA 2WWUA 1LENA 4LBOA 5AC93 4Y22A 3MPPG 3VBOA 4LKSA 4K21A 4Y26A 1QOTA 4Q5OA 1I3HA 2QJVA 1W0PA 2WWSA 1Q8PA 1S0JA 3ACFA 2AH2A 5FPLA 1S0IA 4MGZE 5JI9A 3D0SA 4IEZA 5ACA1 2ADEA 4P9IA 1F15A 1VE0A 2HEVF 5D21A 4CYDA 4HKLA 1AXYA 4MGIE 3VD7A 5A6QA 3S5AA 2RS12 1U5XA 1OD3A 3KT4A 2J1UA 4AVTA 1GANA 1OT5A 1WLCA 3JBG1 4G3YC 4IEQA 3N9PA 4OUMA 4ZONA 3RWKX 4D7YA 1QOSA 4AHZA 4NHXA 4KWKA 2RMU3 3AL6A 4WVMB 3UESA 4W50A 3VKMA 4UYBA 4AXOA 3I3EA 1W2TA 3OGJA 4XUNA 5D2AA 1MQTA 2C9AA 1GNHA 2D5FA 4JRLA 2XVKA 4GKXA 3ZYFA 5FZKA 5FO9B 3CIHA 1MACA 2XJRA 2VE1A 1JHJA 4PIYA 1IPKA 2B8MA 4EZ4A 1GICA 3VKNA 2Y0IA 1UOBA 1KEXA 2WNVA 1Q8SA 1IKPA 5E1RA 3VBFB 3JXSA 1EUUA 4GQ7A 1JYNA 1SG3A 4I02A 1XPWA 4E2GA 3D5OA 2VQ0A 4Y22B 2IFRA 3J4UH 3POJA 4NPLA 4BZ4A 3RFRA 1UZ0A 3KV6A 4PDWC 5GZGA 1JH5A 2NZ9A 4CU8A 1NA1A 1NY71 1XSQA 3AZZA 1UPSA 5EPAA 5FMOL 4QHZA 1AXKA 2EALA 3AJYA 4LITA 4AHWA 2HYKA 1ENQA 5H9RA 5IW0A 2Q8EA 4NPRA 3MIDA 1ZZBA 1SLTA 2GH2A 2ZBJA 1W9SA 3SISA 3WV6A 4Q1PA 3USUA 2B45X 1GP5A 3I7DA 4Y33A 1NCRC 4BB3A 5B4XA 3N7MA 3GJAA 1VBC3 4MGTA 1UU6A 2FZ2A 4XEZA 4QPGB 3NWKA 2FDGA 2CTVA 4EWEA 4E4DX 2PYTA 1MQTB 3FHQA 1FMD1 1LNSA 2OW4A 2ZGSA 4IGPA 2B4KA 1C8M2 3K4ZA 1RUF3 4WV8A 3WNXA 4BE3A 4XJWA 4WBBA 1SEFA 1J83A 2WNVB 1UIJA 1W8FA 3DUIA 3MIHA 4QPGC 5DPNA 2RS31 4ASLA 4QDRA 1MQTC 2IZWA 4KGGA 2Y6HA 4NHLA 2OPWA 3EXUA 2RJKA 4EZHA 1QJY2 4NRMA 1W03A 3RZHA 4K6BA 3E6CC 3SH4A 3WQBA 4LK6A 3E5QA 2XG3A 4ZPIA 1AR63 1PGSA 1W28A 1VBE1 3DEMA 2JDPA 3MI8A 1TG7A 3VZOA 3M1HA 1XRUA 5FR3A 4YGBA 4BA6A 3O1TA 1UZVA 1APNA 3KCCA 4YW7A 2W1WA 4UW6A 4JQRA 3CKHA 3AMNA 2WT1A 1LEDA 5DUXA 5FFOC 1QJU3 1Q56A 4QPYA 5EHDA 4OI0A 2JDUA 4LIVA 1D4M3 1VBA1 3MW3A 1TME3 1I5PA 1XE8A 2A6YA 3D0JA 1RGSA 3AXDA 2FCVA 3HBZA 3KQRA 1RUE1 2XBO2 3RJRA 3CHXA 3WNKA 3WXPA 4XVHA 4MX3A 1DZQA 2OZJA 2Z5WA 3RG0A 3I2FA 1HXS3 4OUSA 3ZR6A 4Y4YA 5FYHA 1PO11 3F95A 3HPNA 4UAPA 1JZ7A 3UGGA 3I54A 3J26N 4KU7A 1G7YA 4AE2A 4I01A 4UFLA 5IVBA 2JICA 3W21A 4MOAA 3EHKA 1SMVA 4AQ2A 4M4RA 3V65A 4BDVB 4J25A 5DAVA 4XYXA 2Y60A 2ZZQA 3Q8EA 3IIAA 5FY5A 5EZWA 2GP3A 3OGSA 1DBNA 1GR3A 1K12A 1GZCA 1TQ5A 1ULFA 2EIGA 1RMU1 1RITA 4QKNA 3MLLA 1JYTA 1LB2A 4CXWA 2W9XA 3GHNA 4TN7A 4GD4A 3LE0A 1DCSA 3LKJA 3WR0A 3B69A 5C7GA 3K4AA 1LOFC 4FFFA 2ZA9A 4Y1UA 4SLIA 4YG3A 1GZTA 3BPSA 3SHRA 3VBSC 1YLLA 2E51A 2VW2A 3ORJA 5GZCA 5IVFA 5F3GA 1S0EA 1QNYA 1RUC1 5LW9A 1D0GA 1R1A2 2XQRA 1TMF3 2XGXA 1W9YA 1US2A 4QQPA 2ZAAA 5FZLA 3E6DA 3ZO0B 2HWB3 4ARYA 3TRSB 2A6WA 3LPFA 1PGW2 2Q1MA 4Y1YA 3ZYPA 4CDUA 1BLZA 2UYBA 1EUTA 4WM8A 1AJKA 2XONA 2YHJA 3D82A 3UNPA 3N36A 2PQSA 4JKMA 4E2SA 5DMYA 2ENRA 2XKPA 1ASJ2 3RMYA 3ZFEA 5A3LA 2QDRA 1UX7A 3I59B 3KMHA 3VBHA 4DMIA 1A6CA 3CLPA 4Q4X2 4JAAA 2RS11 2V4AA 1J59A 1W8TA 1OMIA 5K8SA 2P6CA 4OHXA 1MS9A 2OUJA 3GM8A 4XW3A 2WC2A 1DDLA 2WIIB 1MVQA 2RE9A 1UY4A 2VZ3A 1PGL2 3GBGA 4FTSA 5G04L 2XJPA 5EYYA 4HBNA 1KRIA 5EJZB 5EXOA 1S0BA 3I3QA 3P5BA 4GWJA 5FP9A 3ZSLA 3MDPA 4PIXA 4LORA 4A7KA 3THTA 1CESA 5A6YA 2JD4A 3K3NA 1YQ2A 3HAGA 4LOSA 1H6YA 5EIYB 2E53A 3U4SA 4K20A 2E6VA 4HK9A 4QX7A 2HLEA 1FV2A 2VMEA 4Q4W3 2LALA 2W91A 3BIEA 3M3CA 5FYYA 1BK1A 1OBNA 1IG0A 1YYNA 1SFNA 3FE5A 4IV1A 3WT3A 2J1RA 4IE7A 4QPIA 5FLJA 4NRPA 2X09A 2LM3A 2CWSA 3FFZA 5BNOB 3AVRA 4CDQB 2ARXA 1I6XA 5FYIA 5J1XA 3LA3A 2HJIA 1AYN3 4CDUB 3PVOA 1WCSA 3MW2A 5FXWA 1REEA 1WW5A 3FC0A 4WM8B 1PVC3 2ZKNA 4D69A 3ACGA 1AR83 4LO8A 3P1IA 4RR3A 1LKNA 1GP4A 3ZFEB 2XJSA 4V2VA 3WD5A 4CDQC 4MVTA 5BNOC 3VD9A 4DY5A 3I3BA 2GAUA 4UBGA 2DFBA 4JGZA 3VL8A 4CDUC 3O1UA 4UFKA 2XH6A 5A1LA 2UWCA 1ZX5A 4L2NA 2GC3A 5LA0A 1MS1A 5LK5A 2QQPA 1H1AA 4NO4A 1QHDA 1N1TA 5GZFA 3ZFEC 2P5BA 4RS5A 1GQPA 2ZMKA 2ZHMA 2OXBA 5SV8A 2AR6A 2VXRA 4Z2AA 4IE6A 3O1VA 1PZ8A 3S57A 5JR7B 1W3XA 2Z69A 3SLIA 2GP5A 1V6NA 4XUTA 5AC92 4XABA 4F7ZA 3AKQA 1C8M1 1VB2A 2YC0A 3C7FA 3I2OA 4UOJA 4GA9A 3KHBA 1YFUA 4WZCA 2BOIA 1DLCA 3DN7A 4XXPA 5DDJ1 4CP1A 3B01A 3U37A 2OYZA 2Q5TA 3LSEA 1AXZA 3W5MA 4QPIB 4QT6A 2ZX1A 4AYUA 2FMYA 1YFYA 2YMZA 2WLPA 4XHBA 2VCCA 1QJY1 3HEIA 2VD7A 3N7JA 1JOBA 4Q4V2 4XHXA 2WFPA 3OUJA 4LK7A 2VNVA 2NM1A 2RMU2 4O7XA 1CJDA 4RR3B 1KXGA 3AM2A 3EQEA 3R0RA 3ZSJA 1UWWA 2GC1A 5GLWA 1Y43B 4UWDA 1QMJA 1QEXA 2PXJA 4Y4RA 5F6KA 1DQ1A 2PHWA 1WW7A 4JGZB 4HONA 2IUWA 3WDVA 1HB4A 1W8OA 1OPMA 3CDZB 1RTVA 5E88A 1STMA 2WO7A 3NJYA 1QJFA 4NHMA 4I3GA 1H8TC 2C24A 2UU8A 3K2OA 3IM0A 2VTXA 2VOXA 3GHMA 3ZFGA 2YXSA 2XBO1 3ETQA 3ZXKA 2PHUA 3NV3A 3E5UA 4JGYA 3M3EA 4JGZC 3VHRA 5CAZA 4JX0A 4JCKA 5GKAC 5FZCA 4I0AA 4HFSA 1J58A 2DWRA 4XUPA 2CGOA 1C1LA 3PUAA 4D6SA 5CFCA 4FXGB 5C9AB 1ZRDA 2KM2A 2BU9A 3HVDA 2VU9A 3QCWA 1W8NA 2ZACA 1SLBA 4P9WA 4QKDA 5C8WA 5FY8A 3D3AA 4CCEA 1OUXA 4RN5A 3BUCA 1OOPA 3SEEA 4PF1A 5H9PA 3ZXJA 4BQ2A 4DY3A 2WN3A 4FT8A 2VC9A 4LKEA 4QWNA 2TNFA 2GH8A 3N9NA 3O1MA 5FPVA 2WNEA 4BJ0A 4UW3A 5C9AC 3EB7A 2AENA 3C7GA 2Z4FA 3K75B 2EAAA 3RNSA 5BY5A 3PU8A 3RYRA 4NIHA 4RYDA 3KSCA 5I0UA 3IN9A 4Q1RA 1VBC2 4Q26A 4RHV2 5F5CA 4CP9A 1YI7A 5IVCA 2IFWA 5BNNA 3VBRA 2WBKA 3ME2A 3OPZA 3RMXA 4E4HA 2MEV2 1ULOA 2CWMA 3KB5A 4HG6B 4XXAA 4YZ3A 5A7QA 4WVVA 2WQ8A 2ZGLA 3KCYA 5HXMA 4OI1A 3AP5A 1R1A1 2G19A 1NLRA 4G4FA 1UQXA 4M01A 4MZUA 5CA6A 2NP0A 1OF3A 5D8AA 4CCMA 2H6CA 3N3HA 1PGW1 4AK3A 1W2OA 4UXAA 1IS3A 2JE8A 1W2UA 2QQUA 1HRV3 1UW8A 3H8UA 3ZFGB 4LLOA 3SNMA 1CR7A 4BQ5A 4JGYB 2UWBA 3HN3A 3PU3A 1C5HA 5CYYA 2E26A 1ASJ1 4FOVA 5BNQA 5CFCB 3SITA 5T5LA 4Q4X1 1H2NA 1AR62 3ZN4A 5DABA 1HJGA 1OOPB 3KT1A 5JXHA 4AGVA 2BQPA 4JGYC 3SKJE 4HN0A 1QH6A 1POV3 1PGL1 4Y20A 4PQ9A 1IS5A 4RA0A 2DTWA 3K48A 5FZDA 1CZVA 3H8XA 1BVP1 3U07A 5CFCC 4DFSA 1QJU2 2BFUL 5LK7B 2P1BA 2YG0A 4B29A 1QGLA 4FQ4A 3TNPB 4LHNA 1H1MA 2GMPA 1TME2 1NAEA 1T6GC 1OOPC 2R32A 3PVBB 5I0DA 3ZXEA 4WVZA 5J37A 3L9JT 5KHJA 1LR5A 1W90A 4NOTA 2V5DA 2YGLA 4FBFA 2VJXA 5J98B 3RZLA 2NLRA 3VBRB 4B4RA 4JZRA 1FOD3 3K46A 1BEV3 1FV3A 1W6QA 2XL9A 3P3NA 4P08A 2YBPA 2VUCA 1HXS2 5FZ1A 3KD4A 2D98A 3WINE 1IG3A 2PAKA 1UXXX 2R043 5IVVA 1V6OA 5D8AB 2WINB 1DG6A 1UD1A 1OUSA 4QB1A 3N4MA 3VBRC 4PI2A 3G7DA 4AGGA 2IWGB 1HKDA 2A6ZA 4RD7A 3NV1A 5FPUA 3FWEA 3OBRA 4LBQD 3CL1A 4JDNA 1P8JA 1Q8QA 5GLVA 3SCGA 3O14A 4KH9A 2IXCA 2BZDA 2VUJA 1SZBA 2DBNA 1RXGA 4MH0E 5FMOS 4W6YA 4YM3A 1W8UA 5D8AC 1H2LA 4BH9A 3WG2A 2RS53 4A3XA 2A3YA 1ONAA 3AP7A 3LQCA 3LCPA 5HXVA 4TZDA 2AZ5A 3OYWB 3UL2A 1GWLA 4COZA 4Y20B 2XJQA 3UJOA 3VDBA 3J7HA 4XUQA 3CMGA 1MR5A 1D2SA 4RL7A 4YG0A 4GB33 2RR12 5AVPA 1RHI3 1VP6A 4A4AA 1FNYA 2VCAA 1IQDC 1RINA 4GWIA 5LBCA 1DGWA 2VQTA 4NWWA 4BQWA 2PLV2 3NV2A 5AC91 5IK7A 2HWB2 4E27A 2V72A 4NR1A 4YYOA 3FLTA 1Y9GA 1XQNA 1W6QB 2J7MA 4HMZA 4WM7A 2XVGA 1CAXA 1MEC2 3HOBA 4QQHA 1OFNA 2Q30A 4HETA 4BQ4A 2ZHLA 3MW4A 4QAWA 2VCMA 5FQ0A 2W5FA 2VW0A 1UO9A 5HCAA 4KMQA 4Q2FA 4AAPA 3AB0A 4QGMA 2R063 5LWBA 1COV3 4URTA 1V9U3 1UYYA 2VMHA 2P17A 3B9IA 1UAIA 3DKQA 3HJRA 3OTFA 5CZKA 2LS6A 3V64A 1ZZ6A 5JPNB 2YPJA 1F2NA 4Q4V1 3NMBA 3WX5A 3NAPB 2W87A 1OA4A 2RMU1 3NNJA 4BISA 3MGUA 4EWAA 2DVFA 3GXUA 1QDOA 3B9CA 3OG2A 4AW7A 1VBD2 3IDCB 5D1IA 5M0TA 5KHHA 3JD72 1O6UA 4IE5A 4NHYA 4QX8A 4MXWA 1QU0A 4CUGA 3NAPC 5C3SA 3A7QA 4Q4W2 5FV3A 1CVNA 4LMFA 3Q9OA 3DV8A 1VIWB 1PO23 3OBZA 2PELA 4FPCA 4CCLA 4CPBA 4ZZ5A 4OHVA 4LO5B 5F32A 1AX1A 2ZGMA 4KQ7A 4GWNA 4QGNA 1VALA 1YIFA 5FY0A 2LRPA 5LY1A 4JTNA 3QBQA 4FTEA 1L7RA 2W52A 1PVC2 4HXCA 2BP6A 1AR82 1YCIA 1XYOA 2J1AA 1KDKA 3NKTA 1CAXB 4XMIA 5K0UA 5EP9A 1ZZ7A 3C7EA 2YROA 5C8CA 5FQ0B 1E5IA 2O8OA 4IUGA 4P5YA 1VB4A 1DU3D 5LATA 3ZSEA 4C90A 1NZCA 1W9FA 1MPXA 1MS3A 5FUIA 4XDOA 3AK0A 2QFEA 5A7SA 5F1RA 1PVXA 3T2TA 1Q3EA 2VTFA 5FAXA 1H9WA 1MZFA 2D5HA 4I2OA 1X8EA 1VBC1 4RHV1 1LHNA 3ABZA 1VRH3 4BQXA 2R1BA 1HV0A 2VW1A 5T54A 4QM8A 5E8AA 2MEV1 4IEVA 2ATFA 5E16A 1W06A 3IPVA 4XF9A 5FKBA 3AXEA 3NKGA 5GJ6A 3KS7A 2FCUA 1KITA 4AR2A 2ILMA 3ZM8A 2HYXA 1QJX2 1ALYA 2GMMA 3ZXDA 5T50A 4Y3OA 5FP7A 4CEWA 1ZBA2 1WMXA 3FZ3A 4FQZA 3IB3A 1SHWB 2NQYA 2VMIA 3AKRA 3LWCA 4IESA 4XJ9A 1HB1A 1YNAA 2BRTA 4AI0A 3PUSA 1W6OA 1AR61 1U5IA 3K51A 1BHGA 3ECQA 4KG0A 2VNOA 3AJZA 1S0DA 3B00A 4Z8BA 4UI9L 3IZOA 4DB5A 5C8CB 1IS6A 3RZMA 3T2PA 3LD8A 4FCAA 2IVJA 4P14A 1QJU1 1HB2A 3MPBA 1NLQA 4NE9A 4ISRA 1FPN3 1TME1 2BGPA 3N9MA 1O3SA 4Z07A 1W8HA 1R093 2ZGKA 5I93A 1EY2A 1QQP3 3WW2A 1RUJ3 2VY0A 4GULA 1YRZA 2CL2A 2P2KA 5C8CC 5FYBA 1H4GA 4BIFA 4AFMA 2OVUA 1CIYA 2J1SA 3VKOA 1NZIA 1HXS1 4HANA 5K9YA 1N47A 2ARBA 2J22A 3IPVB 1K5MC 1XE0A 1IGOA 1O8PA 1ZZ8A 1U5YA 2VZUA 1Q43A 2XJTA 3DYPA 4FSJA 4MGKE 1HN1A 3RSJA 4PDWA 5T55A 3OEAA 4XQ4A 5FTTC 2BBVA 1M06G 1X82A 4CEWB 4CDWB 3VB9A 4E8DA 4AFDA 4EE2A 5FBZA 4HN1A 4CCKA 4AQTA 2WFF3 1TNRA 2RM22 2QBXA 3QLQA 1W6OB 1WCUA 4QXBA 3KQ4B 2JE9A 4P9XA 4OQ8A 4GJYA 2MHFA 2WS92 3IWZA 2HWC3 2WSVA 2PA7A 3HMYA 1V6MA 4LBLA 1LCLA 1YJKA 4RGKA 2ZHNA 4Y1XA 3W5NA 1UNBA 1US3A 1LAJA 2GC2A 2VZQA 2ZGRA 2A5ZA 2YY1A 3PMSA 4UF0A 4CDWC 4P9YA 2W46A 4CEWC 1UKGA 1XYPA 4LEJA 1NCRA 4XQDA 1SCRA 3BIWE 2K9ZA 4HVRA 2RR11 4FP2A 2RHPA 1D0HA 3WDUA 1UMZA 3IMNA 3TB0A 2PLV1 1C3HA 2HWB1 1W99A 1O7FA 2A73B 3WLUA 4IETA 5ANQA 5FRAA 3LA7A 2GMEA 2I74A 2I2SA 3WNNA 5JSOA 1HRV2 3MFCA 3E1F1 2WZR2 3TWIA 1LULA 1UL9A 5IK8A 5FPAA 4LXLA 1MEC1 1JOJA 3RGBA 4CTEA 2RDSA 5CISA 2KR2A 4QPGA 3IT8A 4YGCA 3GBFA 1LU1A 3I2GA 3AL5A 3WF0A 2X8KA 4Z82A 4N7UA 5ABJC 2VH9A 1RL3A 2C6SA 2UY9A 1W6MA 1VAVA 1DZTA 4PDWB 4CUCA 4YARA 4FFGA 3VKFC 3LZZA 2R30A 3WZ1A 1F5JA 2XWBB 3JUUA 2YU1A 4COWA 1GOFA 2VMDA 2D43A 1EV13 3LOIA 1AUYA 3WDTA 5JCTA 2FDFA 2SLIA 1VBD1 2HEWF 3TN93 3SMHA 3E5XA 4AQSA 3JD71 3BTXA 2R1DA 5LB6A 3LF7A 1PMHX 4UF0B 1AR93 4Q4W1 5AVAA 5FPZA 1FOD2 1NCRB 1RUD3 2D97A 3ON7A 4NAOA 4QU2A 5CVRA 1MVEA 5CFDC 3MV11 2JDNA 1UZYA 1ACCA 1LU2A 1GUIA 4GXLA 5T5PA 5JOXA 3K77A 4DZGA 3FUQA 3M4FA 4W4ZA 2TEPA 4QX3A 1L7LA 2FBEA 2VZ1A 5DZEA 1OF4A 4BK5A 3GGLA 3ZIXA 5LEJA 3J7NA 1W6PA 2CYFA 1PVC1 1XU2A 1NCQA 1AR81 4IEYA 5FPBA 4AI1A 4PF5A 3DYMA 2DURA 1ENSA 2Q8CA 2OUHA 3WVJA 1HIXA 2JX9A 4NROA 4XTMA 4XCBA 5LA2A 4D7SA 2VG9A 2UYAA 2FDJA 5JWPA 3DL3A 1ULEA 2D3PA 2EXIA 3BGAA 2RS52 1MZ6A 1S0FA 1OLRA 3J7MA 1H30A 1O5LA 2Q4SA 1OVPA 1W6MB 1WUVA 1AR73 1D2QA 1KJRA 1WW4A 3UKNA 1QY4A 5FY4A 1SLIA 1ULPA 2ZMLA 3O0WA 4LBQB 4JDOA 5A7WA 4AHYA 4X6QB 2XMLA 2RVAA 4QB6A 5B4NA 2F6BA 4AHXA 5JSPA 1LOFA 4JHZA 4FPYA 1UU4A 3Q8FA 1OQDA 3VBSA 3OBTA 4OHWA 2A71A 1JS9A 3DXTA 5IK4A 4BQ3A 1H0BA 5A7PA 2DU0A 5JR2A 1S0GA 5FZBA 1UOFA 4I3PA 4R9CA 2B9UA 2JECA 1C1FA 1KDMA 1ZNPA 2CU5A 1QJX1 3DGTA 2TUNA 3ZN6A 3CJIA 1ZBA1 2A7AA 2R062 1MS5A 1AL22 1V9U2 4R9AA 3AKTA 1R083 3DPRA 4QQOA 3MICA 3N7KA 2JDAA 1NKGA 3V56A 4O61A 5IUQA 4MADA 1K3IA 3TYJA 2X10A 1W6PB 1IZ3A 1NCQB 1RUG3 3VHNA 3I2HA 3ZYBA 2WN2A 5JMOA 4EN6B 2JE7A 1AX0A 1S55A 1YFWA 1QXRA 4IERA 4XJZA 1HRI3 4ZS2A 3VZNA 2WT0A 4XDPA 4BPZA 2A70A 5C3PA 2HBTA 5JXJA 3PJQA 4B1MA 2N7GA 2W68A 1W9TA 4IEWA 4Q4Y3 3PTRB 4P00B 4YGDA 5EWSA 2RJLA 4S2GA 5LZ6A 1F4AA 4GMP3 2G9GA 3I59A 1RIRA 1S0CA 1NCQC 2BFUS 4TWTA 2VVDA 2PHRA 4JQTA 3RI9A 1AVBA 1DIWA 5A70A 4L0PA 3UETA 5A7WB 2PN5A 1HN0A 2B39A 3ZOIA 4I0WB 3K3OA 3P3PA 1O4TA 5DAQA 5I8TA 5A6ZA 1LOEA 4E4ZA 5JAXA 5FP3A 1W8WA 1REDA 4CDXA 5HV0A 3GZEA 3VBSB 3RZZA 2XL7A 5C70A 4TYSA 1JW6A 1XBFA 2P3IA 3M2MA 1V6LA 3MFAA 2YZ4A 3ES1A 3VLBB 2VOWA 5FWEA 2D6KA 2PHLA 3S6PA 1AJOA 2W39A 3C7OA 2V73A 5A3TA 1PNFA 3AX4A 1A8MA 3ZN6B 4C91A 3CJIB 3DYOA 4ZXKA 4ASKA 2P3KA 3DPRB 4QM9A 2RM21 1LOAA 2W92A 3AKPA 2JB4A 5BNOA 4CDQA 2WS91 4PCRA 1UY1A 3AMMA 1NYWA 1VRH2 3IBMA 3CJIC 1NLSA 2IXLA 3NJXA 3WEZA 4DEQA 4NIGA 3HR9A 2JDZA 4NIDA 2DVDA 2DUQA 3MUY1 3DPRC 1CAVA 4YZ1A 1N1SA 4ATEA 2K0GA 3M3QA 4LHLA 1G86A 1N3OA 4MGYE 3WDWA 1SQ4A 4PIZA 2BW8A 3BTYA 4RGGA 3ZXFA 4LO6B 5FJHA 1YXWA 3WW1A 5A6XA 1HRV1 2QNKA 3LDRA 1FT9A 4JVAA 4UFIA 3ZVXA 4A45A 4DOUA 4E8CA 5JXIA 1OQEA 1DF0A 2WZR1 4QQ2A 4UFJA 4XBNA 1A8DA 2VBDA 4LR4A 1MZEA 1V70A 4UW4A 1DQ4A 4CDXB 2W95A 3BTAA 4ZY9A 3PUQA 1JHNA 3ZDSA 2RDQA 2CAUA 5FOJB 4HVOA 1PK6B 2A6XA 4CA9A 3CF6E 2YB7A 1GNZA 3THDA 1ODMA 2QQIA 2R0HA 2CY6A 4XETA 1VMFA 2HWF2 4ZKTB 1POV1 3LSDA 4PLNA 1SLCA 2IC1A 3D4KA 4CDXC 4MGQA 3CZJA 5T3NA 5CADA 1PK6C 3KM5A 2JDKA 4CRQA 1X7NA 3R05A 4AFBA 4AVAA 5J48A 1HW5A 3ZFFA 1B09A 1R092 4CP0A 1OLQA 1QQP2 3H9AA 1RUJ2 3TEXA 5T52A 1H2MA 1GQHA 1YEWA 2Y26A 1Y3TA 4C0BA 1ST8A 4J6GA 3H7YA 3URFA 4HK8A 3AP4A 1FOD1 2Q1FA 1CAVB 1UYXA 1H8TA 5I0RA 3I4IA 1JYWA 4X8NA 3OB8A 5FXZA 2H6BA 2AGSA 2WKKA 4O9GA 4FP3A 3MV01 3WG1A 1J3RA 4AGRA 4AEKA 3MIGA 5F8PA 2O8QA 2Y6GA 3FX3A 2D40A 4DQAA 3OGGA 5GALA 1ZA4A 1UF2C 4QB2A 4BLJA 2QQMA 4B7EA 1V00A 4JC1A 3LEGA 4HL0A 5DAPA 5A3WA 3HNBM 4Q0PA 4YPJA 3LDKA 1PIV2 1UMHA 3N9OA 1Z0HA 4ET7A 5A3MA 5FOBB 1WLWA 3NNLA 2X5IC 1QXJA 3LB9A 2QQVA 4CXXA 4NIAA 1QF3A 1D4VB 4DEVA 2RS51 1I5ZA 1GWKA 1XE7A 4NMIA 2QZ3A 5G05L 5C9AA 1ZBE3 2YUEA 5DN2A 5DAWA 5FYZA 4EN9B 3I3MA 3WUCA 4GJZA 3VZJA 1EPWA 2VAUA 4BU2A 2PHFA 3H3LA 3KV5A 5A3OA 3BI3A 2QQLA 1HB3A 2CGNA 4B8EA 1MS4A 5FP8A 3OOXA 1O5UA 1AL0G 1VR3A 3MBWA 1W3VA 4MGSA 2RS33 3GDBA 2PAEA 4NHKA 1HX6A 3T2QA 3ZFFB 1W8ZA 4HZFA 4FOWA 2YC2A 4EJRA 3NO8A 3WP4A 3QD6A 3LPGA 3NJVA 4CCJA 2BJSA 4FI9A 2WT2A 5CB7A 2ORXA 3GALA 1DYPA 4A6OA 3J7LA 3NJZA 5CU1A 2EXKA 2Q8OA 1ZVFA 1H8TB 3WW4A 1CONA 1VBE3 4LLFA 2I07B 3R6SA 2XQXA 3QACA 1WW6A 3ASIA 2B42B 3ZFFC 2R061 5LCWL 5IATA 1AL21 1V9U1 2J1VA 3KF3A 1BBT3 3I2KA 3V0BB 5APAA 5L7OB 5FZMA 1UYZA 3PLQA 4XF4A 5L7OA 5CKNA 1AF9A 4IDZA 2QKDA 3LDBA 4FO9A 4J1XA 5FJKA 1DFQA 1HQNA 2D7FA 3WQ0A 2WWJA 1LHVA 3ELNA 3ACIA 4M0NA 3TN92 3SXWA 1E5SA 1WD3A 1RUE3 3L2YA 5GLUA 2DCJA 3TAYA 4QX2A 1PM7A 1KFXL 4K40A 3HQXA 4BCUA 2GZWA 2WJSA 3OPTA 3WHTA 3OGVA 4GKYA 3WF1A 1AR92 2BNOA 5F5IA 1QH7A 4MSVA 1PO13 1LOBA
chains in the Genus database with same CATH topology
2W1SA 1R64A 3GXUA 2RJ2A 4P02B 1XNTA 2Y64A 4AAXA 3OG2A 3VD7A 1F4HA 1OD3A 2VZSA 3A22A 2J1UA 1OT5A 1SDDB 2X05A 2WO1A 3A7QA 1PX3A 2VZOA 3UESA 4W50A 5A1AA 3WNPA 3DECA 3I3EA 4XUNA 2C26A 4ZZ5A 5JXGA 2Y6LA 4ZXEA 1JZ8A 3CIHA 1OH4A 3CZUA 1JHJA 2DDUA 1L7RA 1KEXA 4GZ9A 2J1AA 3JXSA 3VD5A 1EUUA 1JYNA 3T0DA 1SG3A 3C7EA 2VZRA 1XPWA 4IUGA 4P5YA 1JU4A 1MPXA 5FUIA 1UZ0A 3MO4A 2BBAA 4CU8A 2VTFA 1GOGA 3FN9A 1JZ2A 3ABZA 4ZZ8A 2ZXQA 2WZEA 2BERA 1JYXA 2WAAA 1W9SA 4QX0A 4D8MA 1GOHA 2CDOA 5B4XA 3C7HA 3P6BA 1JZ4A 3ZM8A 2HYXA 2YFZA 4KI5M 3FHQA 4TXWA 3IB3A 1LNSA 1SHWB 2C4XA 2ZEWA 2B4KA 2WYSA 3K4ZA 2WO3A 4BK4A 1J83A 1BHGA 1PMJX 3ECQA 5DPNA 2J1EA 2E31A 2BGOA 4UI9L 4QDRA 2Y6HA 3I2JA 3T2PA 3OGRA 3WQBA 4A42A 2YC4A 3WSOA 4PQQA 2BGPA 3WF2A 1TG7A 4QDQA 1CZSA 2W1WA 3IDAA 3CKHA 1CIYA 5JUVA 2J1SA 3T0AA 3WNOA 3THCA 2J22A 1I5PA 4JKKA 2VZVA 1O8PA 2WO2A 2VZUA 3DYPA 1HN1A 2DCKA 3OEAA 3WNKA 4XVHA 4E8DA 2VR4A 3I2FA 1XC6A 3ETPA 3VDCA 4UAPA 3HPNA 1JZ7A 2QBXA 3W5NA 4MOAA 1US3A 4M4RA 2VZQA 4BDVB 1UY3A 2W46A 5C71A 1JU3A 3OGSA 1K12A 3PUHA 4JKLA 3WF3A 2W1UA 3NQHA 1L7QA 2W9XA 1GU3A 1W99A 3LE0A 5C7GA 3K4AA 4OYUA 3WNNA 3E1F1 1UXZA 2V4VA 2VOTA 1KGYA 1WKYA 3HNYM 3I2GA 1US2A 3WF0A 4ARYA 4A41A 3LPFA 2ZEYA 5DQ0A 1EUTA 2XONA 4CUCA 3MUZ1 1JZ6A 3UNPA 1JZ5A 2PQSA 4JKMA 5DMYA 2JKXA 2RV9A 4PT6A 1GOFA 2VMDA 1UX7A 4KWUA 2ZEZA 2WUHA 1O8SA 3GM8A 1PMHX 2OKXA 2VZ3A 1UY4A 4CUAA 4A3ZA 3WNMA 5G04L 1NUKA 2YFUA 5EJZB 1K42A 4GWJA 3MV11 4MO3M 1GUIA 1YQ2A 3K77A 1H6YA 4W4ZA 5EIYB 4QX3A 2VZ1A 1OF4A 2W94A 4BK5A 2VCBA 2HLEA 2VMEA 3GGLA 2W91A 1O59A 3DYMA 2J1RA 1UMIA 2X09A 4CVUA 3CQOA 5LA2A 2VMFA 3F2ZA 3BGAA 3FL7A 5J1XA 4XURA 3ACGA 1CX1A 3P1IA 1ULPA 4OUEA 4W8JA 1NX9A 3C8XA 2QQOA 3ACHA 2RVAA 4QB6A 4AG4A 5B4NA 3VD9A 4QX1A 5IHRA 3I3BA 4JHZA 3HNMA 2ORZA 5LA0A 3SKVA 1W0NA 2Y6JA 5JR2A 4QPWA 1GQPA 2EIBA 4Z2AA 5HPOA 1J84A 4XZUG 2WZ8A 1UY2A 4XUTA 5IJRA 1GMMA 3C7FA 2JDAA 1NKGA 3BN6A 4UOJA 4MADA 1K3IA 2X10A 1DLCA 1RYYA 1CZTA 4D0QA 3I2HA 3U37A 2WN2A 5JMOA 2JD9A 3W5MA 3IAQA 5JXJA 2VCCA 3HEIA 1D7PM 2W1QA 1W9TA 4P00B 5LA1A 1F4AA 3OEBA 4BXSV 3IAPA 1UY0A 4L0PA 3UETA 1UWWA 4DUVA 1W8OA 2B9VA 3CDZB 5C70A 3SEPA 2KD7A 1DYOA 3I3DA 2WDBA 3C7OA 4DXTA 3LEKA 1T2XA 4JX0A 3DYOA 2E33A 2WAOA 2VZTA 2QQJA 1TVGA 4XUPA 5F7UA 4LQRA 4DUXA 2W92A 1W8NA 3D3AA 4RN5A 3SEEA 4PF1A 1UY1A 2WN3A 3I2IA 2VC9A 2L9LA 3NJXA 4DEQA 3WEZA 2ZEXA 3MUY1 4BJ0A 3EB7A 3C7GA 2Z4FA 3K75B 3VD4A 2R7EB 3VD3A 4RYDA 5IFPA 2WBKA 3EYPA 4A45A 4E8CA 5JXIA 1ULOA 3LEIA 4HG6B 4ARXA 2WQ8A 2LW8A 5HXMA 2EIEA 2W95A 1W9WA 3T09A 4ZY9A 3A23A 4CU7A 1OF3A 2YB7A 2CDPA 3THDA 2QQIA 4OZOA 2JE8A 4A44A 4DXRA 3I97A 3HN3A 3NRUA 3T08A 2QQKA 5CYYA 2E26A 4MGQA 3CZJA 3VDAA 2C9KA 3WNLA 5JXHA 3IIIA 3SKJE 3A21A 2VMCA 1H6XA 1PX4A 4DXSA 1CZVA 1UYXA 2YG0A 2XOMA 2J1TA 1JYWA 2W47A 3OB8A 1NAEA 5I0DA 3MV01 1K45A 2Y6GA 2V5DA 2VJXA 3NNGA 4QB2A 2QQMA 4M4PA 2VZPA 3AC0A 3K46A 3LEGA 3HNBM 2VL4A 4P08A 4YPJA 2VQUA 1UMHA 4ET7A 5IFTA 1UXXX 4DEVA 3K4DA 4LPLA 4QB1A 2XHNA 5G05L 5DN2A 1JI6A 2QQNA 1JZ3A 1P8JA 2QQLA 2BZDA 2Y8KA 4OMDA 3MBWA 4XUOA 4MGSA 3GDBA 3T2QA 3LQCA 4CU9A 2YC2A 1GNYA 5EJ1B 4CUBA 4QDSA 1JYVA 2E32A 3LPGA 3NJVA 4LHSA 4FI9A 2Y6KA 2ORXA 2W3JA 4A6OA 3VDBA 1XNAA 3J7HA 4XUQA 3CMGA 2XQXA 4A4AA 4GWIA 2VCAA 1IQDC 4DUWA 3FHAA 2VQTA 2VM9A 5LCWL 2J1VA 2V72A 3I2KA 2ID4A 2EICA 3WF4A 1UYZA 2VO5A 2J7MA 1WCQA 3PUIA 3HOBA 4OMCA 3OBAA 4TTGA 3T0BA 4QAWA 2W5FA 4KMQA 3ACIA 4LKSA 4CU6A 1UYYA 5CZKA 3HJRA 2DCJA 2LS6A 4QX2A 2WABA 1DP0A 3ACFA 2EIDA 2W87A 3OGVA 3WF1A 5IYYA 3T2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1S A;  1R64 A;  3GXU A;  2RJ2 A;  4P02 B;  1XNT A;  2Y64 A;  4AAX A;  3OG2 A;  3VD7 A;  1F4H A;  1OD3 A;  2VZS A;  3A22 A;  2J1U A;  1OT5 A;  1SDD B;  2X05 A;  2WO1 A;  3A7Q A;  1PX3 A;  2VZO A;  3UES A;  4W50 A;  5A1A A;  3WNP A;  3DEC A;  3I3E A;  4XUN A;  2C26 A;  4ZZ5 A;  5JXG A;  2Y6L A;  4ZXE A;  1JZ8 A;  3CIH A;  1OH4 A;  3CZU A;  1JHJ A;  2DDU A;  1L7R A;  1KEX A;  4GZ9 A;  2J1A A;  3JXS A;  3VD5 A;  1EUU A;  1JYN A;  3T0D A;  1SG3 A;  3C7E A;  2VZR A;  1XPW A;  4IUG A;  4P5Y A;  1JU4 A;  1MPX A;  5FUI A;  1UZ0 A;  3MO4 A;  2BBA A;  4CU8 A;  2VTF A;  1GOG A;  3FN9 A;  1JZ2 A;  3ABZ A;  4ZZ8 A;  2ZXQ A;  2WZE A;  2BER A;  1JYX A;  2WAA A;  1W9S A;  4QX0 A;  4D8M A;  1GOH A;  2CDO A;  5B4X A;  3C7H A;  3P6B A;  1JZ4 A;  3ZM8 A;  2HYX A;  2YFZ A;  4KI5 M;  3FHQ A;  4TXW A;  3IB3 A;  1LNS A;  1SHW B;  2C4X A;  2ZEW A;  2B4K A;  2WYS A;  3K4Z A;  2WO3 A;  4BK4 A;  1J83 A;  1BHG A;  1PMJ X;  3ECQ A;  5DPN A;  2J1E A;  2E31 A;  2BGO A;  4UI9 L;  4QDR A;  2Y6H A;  3I2J A;  3T2P A;  3OGR A;  3WQB A;  4A42 A;  2YC4 A;  3WSO A;  4PQQ A;  2BGP A;  3WF2 A;  1TG7 A;  4QDQ A;  1CZS A;  2W1W A;  3IDA A;  3CKH A;  1CIY A;  5JUV A;  2J1S A;  3T0A A;  3WNO A;  3THC A;  2J22 A;  1I5P A;  4JKK A;  2VZV A;  1O8P A;  2WO2 A;  2VZU A;  3DYP A;  1HN1 A;  2DCK A;  3OEA A;  3WNK A;  4XVH A;  4E8D A;  2VR4 A;  3I2F A;  1XC6 A;  3ETP A;  3VDC A;  4UAP A;  3HPN A;  1JZ7 A;  2QBX A;  3W5N A;  4MOA A;  1US3 A;  4M4R A;  2VZQ A;  4BDV B;  1UY3 A;  2W46 A;  5C71 A;  1JU3 A;  3OGS A;  1K12 A;  3PUH A;  4JKL A;  3WF3 A;  2W1U A;  3NQH A;  1L7Q A;  2W9X A;  1GU3 A;  1W99 A;  3LE0 A;  5C7G A;  3K4A A;  4OYU A;  3WNN A;  3E1F 1;  1UXZ A;  2V4V A;  2VOT A;  1KGY A;  1WKY A;  3HNY M;  3I2G A;  1US2 A;  3WF0 A;  4ARY A;  4A41 A;  3LPF A;  2ZEY A;  5DQ0 A;  1EUT A;  2XON A;  4CUC A;  3MUZ 1;  1JZ6 A;  3UNP A;  1JZ5 A;  2PQS A;  4JKM A;  5DMY A;  2JKX A;  2RV9 A;  4PT6 A;  1GOF A;  2VMD A;  1UX7 A;  4KWU A;  2ZEZ A;  2WUH A;  1O8S A;  3GM8 A;  1PMH X;  2OKX A;  2VZ3 A;  1UY4 A;  4CUA A;  4A3Z A;  3WNM A;  5G04 L;  1NUK A;  2YFU A;  5EJZ B;  1K42 A;  4GWJ A;  3MV1 1;  4MO3 M;  1GUI A;  1YQ2 A;  3K77 A;  1H6Y A;  4W4Z A;  5EIY B;  4QX3 A;  2VZ1 A;  1OF4 A;  2W94 A;  4BK5 A;  2VCB A;  2HLE A;  2VME A;  3GGL A;  2W91 A;  1O59 A;  3DYM A;  2J1R A;  1UMI A;  2X09 A;  4CVU A;  3CQO A;  5LA2 A;  2VMF A;  3F2Z A;  3BGA A;  3FL7 A;  5J1X A;  4XUR A;  3ACG A;  1CX1 A;  3P1I A;  1ULP A;  4OUE A;  4W8J A;  1NX9 A;  3C8X A;  2QQO A;  3ACH A;  2RVA A;  4QB6 A;  4AG4 A;  5B4N A;  3VD9 A;  4QX1 A;  5IHR A;  3I3B A;  4JHZ A;  3HNM A;  2ORZ A;  5LA0 A;  3SKV A;  1W0N A;  2Y6J A;  5JR2 A;  4QPW A;  1GQP A;  2EIB A;  4Z2A A;  5HPO A;  1J84 A;  4XZU G;  2WZ8 A;  1UY2 A;  4XUT A;  5IJR A;  1GMM A;  3C7F A;  2JDA A;  1NKG A;  3BN6 A;  4UOJ A;  4MAD A;  1K3I A;  2X10 A;  1DLC A;  1RYY A;  1CZT A;  4D0Q A;  3I2H A;  3U37 A;  2WN2 A;  5JMO A;  2JD9 A;  3W5M A;  3IAQ A;  5JXJ A;  2VCC A;  3HEI A;  1D7P M;  2W1Q A;  1W9T A;  4P00 B;  5LA1 A;  1F4A A;  3OEB A;  4BXS V;  3IAP A;  1UY0 A;  4L0P A;  3UET A;  1UWW A;  4DUV A;  1W8O A;  2B9V A;  3CDZ B;  5C70 A;  3SEP A;  2KD7 A;  1DYO A;  3I3D A;  2WDB A;  3C7O A;  4DXT A;  3LEK A;  1T2X A;  4JX0 A;  3DYO A;  2E33 A;  2WAO A;  2VZT A;  2QQJ A;  1TVG A;  4XUP A;  5F7U A;  4LQR A;  4DUX A;  2W92 A;  1W8N A;  3D3A A;  4RN5 A;  3SEE A;  4PF1 A;  1UY1 A;  2WN3 A;  3I2I A;  2VC9 A;  2L9L A;  3NJX A;  4DEQ A;  3WEZ A;  2ZEX A;  3MUY 1;  4BJ0 A;  3EB7 A;  3C7G A;  2Z4F A;  3K75 B;  3VD4 A;  2R7E B;  3VD3 A;  4RYD A;  5IFP A;  2WBK A;  3EYP A;  4A45 A;  4E8C A;  5JXI A;  1ULO A;  3LEI A;  4HG6 B;  4ARX A;  2WQ8 A;  2LW8 A;  5HXM A;  2EIE A;  2W95 A;  1W9W A;  3T09 A;  4ZY9 A;  3A23 A;  4CU7 A;  1OF3 A;  2YB7 A;  2CDP A;  3THD A;  2QQI A;  4OZO A;  2JE8 A;  4A44 A;  4DXR A;  3I97 A;  3HN3 A;  3NRU A;  3T08 A;  2QQK A;  5CYY A;  2E26 A;  4MGQ A;  3CZJ A;  3VDA A;  2C9K A;  3WNL A;  5JXH A;  3III A;  3SKJ E;  3A21 A;  2VMC A;  1H6X A;  1PX4 A;  4DXS A;  1CZV A;  1UYX A;  2YG0 A;  2XOM A;  2J1T A;  1JYW A;  2W47 A;  3OB8 A;  1NAE A;  5I0D A;  3MV0 1;  1K45 A;  2Y6G A;  2V5D A;  2VJX A;  3NNG A;  4QB2 A;  2QQM A;  4M4P A;  2VZP A;  3AC0 A;  3K46 A;  3LEG A;  3HNB M;  2VL4 A;  4P08 A;  4YPJ A;  2VQU A;  1UMH A;  4ET7 A;  5IFT A;  1UXX X;  4DEV A;  3K4D A;  4LPL A;  4QB1 A;  2XHN A;  5G05 L;  5DN2 A;  1JI6 A;  2QQN A;  1JZ3 A;  1P8J A;  2QQL A;  2BZD A;  2Y8K A;  4OMD A;  3MBW A;  4XUO A;  4MGS A;  3GDB A;  3T2Q A;  3LQC A;  4CU9 A;  2YC2 A;  1GNY A;  5EJ1 B;  4CUB A;  4QDS A;  1JYV A;  2E32 A;  3LPG A;  3NJV A;  4LHS A;  4FI9 A;  2Y6K A;  2ORX A;  2W3J A;  4A6O A;  3VDB A;  1XNA A;  3J7H A;  4XUQ A;  3CMG A;  2XQX A;  4A4A A;  4GWI A;  2VCA A;  1IQD C;  4DUW A;  3FHA A;  2VQT A;  2VM9 A;  5LCW L;  2J1V A;  2V72 A;  3I2K A;  2ID4 A;  2EIC A;  3WF4 A;  1UYZ A;  2VO5 A;  2J7M A;  1WCQ A;  3PUI A;  3HOB A;  4OMC A;  3OBA A;  4TTG A;  3T0B A;  4QAW A;  2W5F A;  4KMQ A;  3ACI A;  4LKS A;  4CU6 A;  1UYY A;  5CZK A;  3HJR A;  2DCJ A;  2LS6 A;  4QX2 A;  2WAB A;  1DP0 A;  3ACF A;  2EID A;  2W87 A;  3OGV A;  3WF1 A;  5IYY A;  3T2O A; 
#chains in the Genus database with same CATH topology
 1R64 A;  3SQO A;  1KJL A;  2RJ2 A;  1XNT A;  5DUV A;  5FZA A;  4Q8K A;  3WY6 A;  1YI9 A;  2JEN A;  3O0X A;  3A22 A;  4CEY A;  2DVA A;  4OUL A;  3TEW A;  1ZRI A;  3B93 A;  3GCX A;  1MS8 A;  2R6Q A;  3V0A A;  4K8R B;  1PX3 A;  2VZO A;  4P5H A;  4YM0 A;  5FMB A;  3SC7 X;  4YW2 A;  4N43 B;  1WMF A;  3WNP A;  4GIQ A;  1OXC A;  3TBD A;  1RMU 3;  1BYH A;  4XF3 A;  3DEC A;  1GV9 A;  2C26 A;  2WA3 A;  1VPH A;  1UIK A;  2UUR A;  4KWL A;  3INA A;  4C0H A;  4A7Z A;  2XJV A;  1OH4 A;  1LGN A;  2DBI A;  3N9Q A;  3SH3 A;  3AP6 A;  2CNA A;  3W58 A;  3O1O A;  1LES A;  1RUF 2;  4N43 C;  1O4Z A;  5FZ7 A;  3WQ7 A;  3D6E A;  1AR7 2;  2ZX4 A;  2VQA A;  3PIG A;  4GZ9 A;  4IE4 A;  3PTY A;  4P9J A;  5DXD A;  5BV6 A;  3NW4 A;  2VZR A;  1VRH 1;  3NNF A;  1Q5O A;  1JUI A;  1OLM E;  2GNB A;  2XVL A;  1Z7S 3;  1MS0 A;  2P37 A;  4AF9 A;  3U78 A;  4IEX A;  3BTZ A;  2W08 A;  3WOG A;  2ZAH A;  5L7O C;  2ZX0 A;  1LGC A;  4QU1 A;  2BOJ A;  4XOG A;  3FN9 A;  1KQR A;  1AYM 3;  1N1Y A;  1JZ2 A;  2Q0A A;  2EXH A;  4W6X A;  4ZZ8 A;  3OYW A;  2ZXQ A;  4Z92 B;  1G9A A;  2OA2 A;  2WZE A;  2BER A;  1JYX A;  4CEY B;  5J36 A;  4QHO A;  1POV 0;  3ZPY A;  4ES9 A;  1R08 2;  4D8M A;  4HSJ A;  1GOH A;  1D4M 2;  3SCH A;  4XAE A;  3V0A B;  2DYC A;  2E7Q A;  1Q8O A;  1OSG A;  3C7H A;  3KGL A;  4IQP A;  1XND A;  5ISL A;  1JZ4 A;  2B7Y A;  2BDR A;  1YO8 A;  5FZ6 A;  3U11 A;  1HRI 2;  2HWF 1;  2YFZ A;  4CEY C;  3BU0 A;  5A3P A;  3AZV A;  5JOZ A;  1O3T A;  4TXW A;  3JQW A;  2VNR A;  4Y5S A;  2GC0 A;  1SAC A;  2D3S A;  5L9V A;  2ZEW A;  4Q4Y 2;  2QVS B;  1BMV 2;  3FMG A;  3KVA A;  4KGQ A;  2VVF A;  3N9L A;  3H8O A;  2WO3 A;  2ZGU A;  1M4W A;  1PMJ X;  1E5H A;  2J1E A;  2BPA 2;  4Q27 A;  1R09 1;  4QD2 A;  1QQP 1;  4OI4 A;  1RUJ 1;  3J9S A;  4AFC A;  4BM8 A;  5FZE A;  3NAP A;  3T1M A;  3I2J A;  1WME A;  5F37 A;  3G6J B;  3UV9 A;  3VUO A;  4BME A;  1OKQ A;  3VHP A;  3WSO A;  1NOV A;  1O91 A;  4PQQ A;  3EBR A;  1LJ7 A;  4DIQ A;  3MIB A;  2VUL A;  3FHI B;  4QDQ A;  5A33 A;  5F9T A;  2Y0O A;  3ITQ A;  4RQP A;  3POF A;  3ENR A;  3PHM A;  3JB8 A;  1XJA A;  5JUV A;  4DXZ A;  3E97 A;  4R52 A;  3KHC A;  4K3U A;  3O1R A;  4FPE A;  5F39 A;  4YSF A;  4DPN A;  5FO8 B;  3A4U A;  2HWE 3;  4C1W A;  1PIV 1;  2IXH A;  2XLG A;  1LHU A;  3WNO A;  2G1M A;  3THC A;  4JKK A;  1SFY A;  4ONU A;  4A7Y A;  4E2Q A;  1TMF 2;  1E5R A;  4N90 A;  1TZO A;  1LEM A;  4BXF A;  2HEY F;  3A0K A;  3ZLI A;  1I1E A;  1NE4 A;  2DCK A;  1YIP A;  5KBF A;  4QXK A;  4D6R A;  3O1S A;  5FMD A;  2X53 S;  4P9G A;  4YW1 A;  1I9R A;  2OPK A;  2VR4 A;  5FY1 A;  2ZGP A;  4Y1V A;  3VBU A;  1OI6 A;  3VDC A;  2EF6 A;  5FYM A;  3SCF A;  2P6H A;  5DZG A;  4B4Q A;  1G8W A;  1X36 A;  3POS A;  5DDJ 3;  4PBO A;  1NG0 A;  3T30 A;  3ZYI B;  1S2K A;  5FPX A;  2F4P A;  4YW6 A;  5KC6 A;  4DNY A;  2DCT A;  2ZS6 B;  1XU1 A;  1QJY 3;  4AI2 A;  2JIJ A;  2PMW B;  4HOO A;  3WDY A;  5CBL A;  1H8V A;  2GNM A;  4OLL A;  4GH4 C;  2WZP P;  4HVQ A;  2JJ6 A;  2YBK A;  1JU3 A;  4LA3 A;  2FHR A;  3HD8 B;  5B2G B;  2JDY A;  4OVE A;  5EYX A;  4LBN A;  5CIR A;  1L7Q A;  1JTZ X;  5EV7 A;  1OPO A;  1GU3 A;  5A33 B;  2FDK A;  1RXF A;  4OYU A;  4RQP B;  1XSR A;  3PL0 A;  3OCP A;  4Q0V A;  4WVW A;  1GZW A;  4FAG A;  1JXN A;  1ZA7 A;  1UXZ A;  1G9D A;  1UU5 A;  2V4V A;  1KGY A;  3I2D A;  1DQ0 A;  2XKO A;  2IXJ A;  2R49 A;  4K8F A;  3A0N A;  3AYA A;  3GCW A;  1UZW A;  3PIJ A;  3NNM A;  5IVE A;  3CEW A;  1RUI 3;  3T1L A;  3TN9 1;  4A41 A;  4K1Y A;  2GN3 A;  4I09 A;  4RQP C;  2XBO 3;  1DQ2 A;  1DZR A;  2ZEY A;  2ZMN A;  1RVF 3;  4F8A A;  1AYN 2;  4HPK A;  1X9P A;  1AR9 1;  5FP4 A;  3VBU B;  2RV9 A;  4PT6 A;  4L92 A;  4Q0S A;  5CKQ A;  5KHG A;  1C57 A;  1C8N A;  1V6I A;  4KWU A;  2A3W A;  5F6L B;  4N53 C;  4DS0 A;  1BJQ A;  4A2U A;  2A1X A;  4AI8 A;  5GZE A;  3APB A;  3MHZ A;  5DUW A;  3AFG A;  1W04 A;  3OF1 A;  3N35 A;  1N3P A;  3R4U A;  4QGL A;  1AX2 A;  4XFF A;  5IWF A;  3OSD A;  3VBU C;  2DCY A;  4H14 A;  1W0O A;  1UOJ A;  3WNM A;  1K5M A;  1NUK A;  1WWY A;  1K42 A;  3ZMO A;  1ZRE A;  1BCX A;  4ASM B;  2VOK A;  1U12 A;  4MO3 M;  3WP6 A;  4LUK A;  4YM2 A;  1RJ8 A;  3RJ2 X;  3B3Q E;  2G4I A;  2XHK A;  3RWN A;  1W39 A;  4UBH A;  1SPP A;  1LEC A;  1REF A;  1LOC A;  4N8M A;  4L11 A;  4OCT A;  4RSU A;  2W94 A;  3D8C A;  2VCB A;  4H7L A;  1F35 A;  3AZW A;  3B94 A;  4WZF A;  5F3I A;  1ZBE 2;  1RUF 1;  1SBD A;  2ARE A;  3Q8A A;  1U5Z A;  2G9F A;  1AR7 1;  1GZW B;  3M70 A;  4K9S A;  3RYP A;  2HKX A;  3DKW A;  5T5O A;  1UMI A;  1ENX A;  4XTP A;  2CSG A;  1RUH 3;  3AVS A;  2QE3 A;  5A3N A;  2SBA A;  4CDW A;  1ULC A;  3FL7 A;  2D6M A;  2GU9 A;  4HLT A;  2CHH A;  3GF6 A;  1PZ9 A;  1CN1 A;  3GYD A;  1IOA A;  4L8Q A;  5FZO A;  3UT0 A;  1ODN A;  1ULD A;  4HPK B;  1Q8V A;  3CBN A;  1HLC A;  4Y5Z 0;  1A34 A;  2ES3 A;  1IKQ A;  1CX1 A;  4OUE A;  1ENR A;  2ZOE B;  5FZ4 A;  5JOY A;  1JOD A;  1KFU L;  2QQO A;  3ZXG A;  2NMN A;  3ACH A;  4AED B;  4AVC A;  4AQ6 A;  4Q4X 3;  4FTB A;  4QX1 A;  1YQ5 A;  1XNC A;  2FDH A;  4DRR A;  3W59 A;  1W2N A;  2QZ2 A;  1BBT 2;  3BAL A;  1D4M 1;  1G9C A;  2XJU A;  5LBF A;  2Y6J A;  2CV6 A;  3EJK A;  5K4L A;  4AED C;  4CSW A;  2VUA A;  2FMD A;  1K5M B;  5ABJ A;  2EIB A;  4ZU4 A;  3HIF A;  5HPO A;  2KA3 A;  1OD5 A;  1GLH A;  1HRI 1;  2WZ8 A;  3H1W A;  1UY2 A;  3AZY A;  1IHM A;  1JZ8 A;  2PHD A;  1SPP B;  2BGC A;  1PM4 A;  2R07 3;  4Q4Y 1;  1UYP A;  5J3U A;  1BMV 1;  4CCO A;  3HBK A;  3BN6 A;  1VBB 3;  4GMP 1;  4ORF A;  5C3O A;  1RYY A;  4J1W A;  4D0Q A;  5KXB A;  2OX0 A;  3LFI A;  3U14 A;  1ZRC A;  2FD8 A;  1JN2 P;  2XB6 C;  2OQ6 A;  1YQC A;  3KV9 A;  1JMU B;  3OUH A;  5HV4 A;  1UX6 A;  2ZGO A;  3WG3 A;  1D7P M;  1UPI A;  2YPD A;  2XUM A;  1NXM A;  5E6H A;  3FFQ A;  4XFG A;  4YZ4 A;  1CPM A;  2BWC A;  5FZO B;  5CFD A;  4BXS V;  2XR4 A;  3O1P A;  2D6O X;  1UY0 A;  4FXK B;  4C8D A;  5DUU A;  3CNA A;  1CAW A;  4W6W A;  3RI8 A;  3LAG A;  1KS4 A;  3VDD B;  1GWM A;  3BKZ A;  4BQ1 A;  1PHM A;  2ZZJ A;  3VL9 A;  4BOW A;  3UYJ A;  1LHW A;  5FK8 A;  2Y34 A;  3SEP A;  3LIH A;  4I30 A;  1Y9M A;  3CU7 A;  5FY9 A;  1TMF 1;  2BNN A;  4AVB A;  5ABJ B;  2ZAB A;  1EPZ A;  1DHK B;  4XBL A;  4DXT A;  3LEK A;  1T2X A;  3VDD C;  3FBY A;  1GFF 2;  5AFB A;  1SCS A;  2E33 A;  2HWD 3;  2QQJ A;  1TVG A;  1Z7S 2;  2WAO A;  2VZT A;  4Y1Z A;  5FLI A;  4IGQ A;  4LQR A;  4XF1 A;  3AYD A;  5H9S A;  3THP A;  4DUX A;  5FZ8 A;  3OPW A;  1IPJ A;  4XAA A;  2QTW B;  3ZIW A;  2OT7 A;  5CEH A;  4MET A;  3WP3 A;  3TOJ A;  3VV1 A;  3JB4 C;  4LKF A;  3I2I A;  1AYM 2;  2ET1 A;  2ZTN A;  3KGZ A;  2XUE A;  3MEP A;  5LBB A;  2A3X A;  4LBQ A;  1WBL A;  2ZEX A;  4DO0 A;  3M3I A;  4Q4V 3;  3RRD A;  1ZZ9 A;  3ES4 A;  2JG8 A;  3VD4 A;  2R7E B;  1LOD A;  3HQU A;  5AFE A;  5CFD B;  3VD3 A;  3ATG A;  5A7N A;  5FZ9 A;  3J8F 3;  4NJ4 A;  3AMH A;  5FUP A;  5FZG A;  3WP5 A;  1CX4 A;  3USS A;  4NUB A;  1OQ1 A;  2R16 A;  4MG2 A;  4KBB A;  4AZZ A;  3EYP A;  1CAW B;  3FLP A;  1GKB A;  3LEI A;  2ZGQ A;  4ZU7 A;  1BEV 2;  4QQL A;  5L73 A;  4ARX A;  3S7I A;  2EIE A;  1W9W A;  2PFW A;  3T09 A;  4FFI A;  4HT1 T;  4S2F A;  4CU7 A;  2EXJ A;  2CDP A;  2JG9 A;  2R04 2;  5CKM A;  5JPM B;  3PDQ A;  4OZO A;  2A6V A;  4A44 A;  3TNQ A;  4YFW A;  1AYN 1;  2A75 A;  3IDE A;  3PME A;  4B3N A;  3NRU A;  3VBO B;  1DGR N;  5JSR A;  1WCD J;  4BWO A;  1WZX A;  5IAX A;  2W0X A;  1U0A A;  5F3C A;  5KWR A;  2E9Q A;  1CD3 G;  5DZF A;  1POQ A;  4B1L A;  3VBF C;  1LGB A;  5FXV A;  3O5S A;  3UGH A;  1VAK A;  2K2S A;  3WNL A;  1G9F A;  2DTY A;  3III A;  2Y33 A;  4QXH A;  2K46 A;  1EAH 3;  2AYH A;  2H0V A;  1OLM A;  4OHY A;  3HT2 A;  4KU8 A;  3A21 A;  2VMC A;  2XXZ A;  1PX4 A;  4IV3 A;  5CNA A;  3VBO C;  4LBM A;  5CG8 A;  1AZD A;  1WLD A;  5GZD A;  2YGM A;  4S2D A;  3WQ1 A;  1OKO A;  2HWE 2;  2Z2S B;  4FPJ A;  2JG8 B;  4GB3 2;  1BKZ A;  2W47 A;  4LNV A;  2JDM A;  3ZX7 A;  4K1Z A;  4ES8 A;  1RHI 2;  1SBE A;  1Z78 A;  4RHV 3;  5HI0 A;  4H7M A;  1ZRF A;  2W2I A;  4NWV A;  3DF0 A;  4XQW A;  1QKQ A;  4UW5 A;  1K45 A;  1ZZC A;  2TBV A;  4UFH A;  2WL1 A;  3NNG A;  1ZBE 1;  2MEV 3;  3O7O A;  4BIO A;  2VZP A;  1XYN A;  1JUH A;  4LUL A;  3W9A A;  2GDF A;  2OZ6 A;  2JG8 C;  2VQU A;  4V2W A;  4F3J A;  1BQP A;  5DG2 A;  4IE0 A;  4QKF A;  5DDJ 2;  3C3V A;  5EFU A;  1ZRR A;  5IFT A;  4OHZ A;  2JG9 B;  1COV 2;  3K4D A;  4LPL A;  5FZF A;  1XNK A;  3H3Z A;  4AEM A;  1RUO A;  3HWJ A;  3R4S A;  1LRH A;  1QJZ A;  1JZ3 A;  5C3Q A;  2NPI A;  1FX5 A;  2WNV C;  5BXX A;  1NA1 B;  4LE4 A;  3KLS A;  2JG9 C;  4XUO A;  4BQY A;  2XPJ A;  3ILN A;  2IXK A;  4YZ5 A;  3U75 A;  5KHI A;  4O9E A;  4XMA A;  4OZX A;  1JYV A;  4LT5 A;  3JQX A;  1BBT 1;  1OUR A;  2Y6K A;  4IV3 B;  3T4H B;  3OJB A;  1UN1 A;  3MLK A;  4V1P A;  5JIU A;  5ANN A;  4CP2 A;  2VUD A;  4GMP 0;  2ADD A;  1O4Y A;  3IMM A;  3USU B;  1GQG A;  4YLZ A;  4ATF A;  1PO2 2;  1NA1 C;  4DUW A;  4RGA A;  3FHA A;  2VM9 A;  4GAL A;  2ZX3 A;  5F5A A;  4MHR A;  5FDB A;  3RZJ A;  1RUI 2;  4U36 A;  2ZKL A;  5FYV A;  4IV3 C;  1R1Z A;  1RVF 2;  3Q8C A;  3PUR A;  2JDH A;  5C3R A;  3WF4 A;  1OVS A;  4XJU A;  1PK6 A;  2VO5 A;  1TEI A;  3LIG A;  4ZHN A;  1G6N A;  3PUI A;  4YGE A;  1N3Q A;  4FOY A;  3T0B A;  4FVV A;  4IW3 A;  3VZL A;  4TTG A;  1Y4W A;  3ACL A;  3GBW A;  1DYK A;  1YQ6 A;  4CU6 A;  1FAY A;  2ZHK A;  2LUW A;  5SV5 A;  1BZW A;  1TNF A;  1ZM1 A;  1GYK A;  2Z79 A;  2WAB A;  1ND3 A;  1DP0 A;  2EID A;  1F8V A;  1PZ7 A;  3H1M A;  4Z1V A;  5E89 A;  1JYC A;  4YFZ A;  5IYY A;  3T2O A;  5J7M A;  2W1S A;  3POE A;  5F3E A;  1DLL A;  2YBS A;  4P02 B;  1X9T A;  1W05 A;  2Y64 A;  4AAX A;  1IS4 A;  1RJ7 A;  3GJB A;  3JU9 A;  4QXC A;  5FYU A;  3ZKU A;  1F4H A;  1OH3 A;  2VZS A;  4AI3 A;  5FUN A;  3O12 A;  1SDD B;  3H42 B;  4XE9 A;  2X05 A;  2WO1 A;  1BK0 A;  4D6Q A;  4MUV A;  3WUD A;  2XWJ B;  2XDV A;  4CZS A;  5ACA 3;  5C6C A;  2X5I A;  3FLR A;  1A3K A;  4AI9 A;  5A1A A;  4EWD A;  2RR1 3;  4NRQ A;  1WLT A;  4L97 A;  5JXG A;  2PLV 3;  3U4X A;  1RUH 2;  2Y6L A;  3JBG 3;  4ZXE A;  1NQJ A;  2OS2 A;  1Z7S 1;  2FCT A;  4OQ9 A;  3HT1 A;  3POW A;  1PMI A;  2OQ7 A;  3CZU A;  1RC6 A;  1MZ5 A;  3POY A;  2EAK A;  2YV8 A;  3W20 A;  1E57 A;  5IAV A;  2DDU A;  2P3Y A;  4Q8L A;  2ZJC A;  1MEC 3;  4LA2 A;  3VHO A;  3WG4 A;  2WSU A;  3JZV A;  3VD5 A;  2I45 A;  3T0D A;  4PJY A;  1AYM 1;  5ERL A;  1DGR A;  5BNP A;  5JIA A;  1YQ8 A;  1JU4 A;  2PHT A;  5TSW A;  4AFA A;  3MO4 A;  3TEZ A;  2BBA A;  1J1T A;  3PVN A;  1F31 A;  4PHZ A;  1ND3 B;  1X33 A;  2AUY A;  2DU1 A;  1GOG A;  4NII A;  4ZU5 A;  4EYU A;  1FPN 2;  2DFC A;  5FYT A;  4FPL A;  4IGO A;  4YWA A;  3NV4 A;  1VBD 3;  3ZYG A;  3ZYJ B;  3BVC A;  4COY A;  5KHK A;  3JD7 3;  4EN0 A;  3AYC A;  3FUO A;  2WAA A;  1BEV 1;  5J96 B;  4P9L A;  3NVC A;  4LUM A;  1ND3 C;  1BXH A;  4QX0 A;  2R07 2;  3BU7 A;  4BLI A;  2CDO A;  2JWP A;  2O14 A;  1VBB 2;  1SLL A;  1WMD A;  3OD4 A;  2PQQ A;  2X5I B;  5I0T A;  2R04 1;  1IQA A;  3P6B A;  3UKV A;  5CG9 A;  1A78 A;  4LHK A;  4PLM A;  1YUD A;  4KG8 A;  3V0B A;  5JI7 A;  4KI5 M;  1HQL A;  1XB9 A;  3VZM A;  3MYX A;  1S4C A;  2C4X A;  4M3C A;  2WYS A;  3KVB A;  4XC9 A;  5EJ3 A;  4Q29 A;  2WFF 2;  5FBJ A;  1K5J A;  4LO7 A;  4BK4 A;  3JCI A;  1VMH A;  2B5H A;  4FPO B;  2HWC 2;  3AYE A;  4KWJ A;  1OA3 A;  1SFP A;  2E31 A;  4L9B A;  2BGO A;  5LRS A;  3VBH B;  3WW3 A;  1FMD 3;  3TEY A;  5BNP B;  5C33 A;  3RPQ A;  5BUV A;  5FMC A;  3ZDV A;  2QQW A;  5L36 A;  3IKW A;  2JEM A;  2WLQ A;  3FBM A;  3OGR A;  4A6S A;  1OFS A;  4WM8 C;  4TLG A;  1JOP A;  5JDB A;  4XFH A;  4A42 A;  1EYB A;  2HWE 1;  3AMQ A;  1Y7B A;  2F4L A;  2YC4 A;  4GB3 1;  1ND2 A;  3WCR A;  4Q0U A;  1RHI 1;  4JV4 A;  3WF2 A;  2AEZ A;  3S5Q A;  3VBH C;  1CZS A;  5FLH A;  4CPB D;  5BNP C;  2P4E A;  3IDA A;  1G9B A;  2RDR A;  2BTV C;  2DVB A;  4U2A A;  2R0F A;  3RDI A;  5KR7 A;  4N43 A;  1LHO A;  4YW5 A;  2HWD 2;  3PJY A;  5FK7 A;  3T0A A;  1HDK A;  1QOO A;  2GNT A;  2Y38 A;  3ZXA C;  1YHF A;  2VZV A;  4ITC A;  4COU A;  4NPM A;  3BB6 A;  4CXY A;  2WO2 A;  4PI0 A;  2CAV A;  4IV1 B;  1COV 1;  4N9H A;  1QJX 3;  1CPN A;  5FZH A;  3MLJ A;  2QCS B;  3LOB A;  1ZBA 3;  2BWA A;  4K7J A;  4R8H A;  1XC6 A;  2AC1 A;  2D93 A;  2LRO A;  1VBA 3;  1L3J A;  3AP9 A;  3ETP A;  4QHB A;  3WCS A;  1WA6 X;  4M3C B;  2BYV E;  1VAM A;  3EMR A;  4YRD A;  1QJE A;  1UKR A;  1EV1 2;  4NVP A;  2D3R A;  2FQP A;  4IV1 C;  4OI2 A;  3KCX A;  3J8F 2;  1C28 A;  1QNW A;  4QPI C;  5FYS A;  5LEK A;  2Z42 A;  3ZMN A;  1YWK A;  1OA2 A;  3O0V A;  5DG1 A;  3RZG A;  1HJF A;  1UY3 A;  1C5I A;  4IEO A;  1KD7 A;  3POI A;  4M3C F;  2C5D A;  3GZU C;  3POB A;  5C71 A;  1RUD 2;  2HH9 A;  1VJ2 A;  2VBB A;  1PO2 1;  3PUH A;  4JKL A;  2NN8 A;  5JVV A;  2GSY A;  5A7O A;  4RR3 C;  3WF3 A;  2ZGT A;  1ND2 B;  2W1U A;  3NQH A;  2WR9 A;  2ZPX A;  1AHS A;  5GLT A;  2D44 A;  4RS5 B;  4XIL A;  1RUI 1;  1V6J A;  2C1F A;  5F5Q A;  1RVF 1;  5J09 A;  3M3O A;  2ZGN A;  4AWD A;  5FZ3 A;  4BYY A;  3E6B A;  3DCQ A;  5C5U A;  5LBE A;  2VOT A;  1VLN A;  4GWM A;  1FYU A;  2WQZ C;  3H7J A;  1WKY A;  1ND2 C;  3HNY M;  1FI2 A;  2VTX J;  4RS5 C;  2WA4 A;  5A3U A;  1CQ9 A;  3ST7 A;  4EQV A;  5DQ0 A;  4W65 A;  5KXD A;  1EAH 2;  3MUZ 1;  5I0S A;  2MPF A;  4IEP A;  4JTO A;  1JZ5 A;  3MF9 A;  1JZ6 A;  1DGW X;  2JKX A;  1ZYB A;  4L99 A;  1RUC 3;  2DF7 A;  1JYI A;  1WA4 A;  2RM2 3;  1J3P A;  5GM0 A;  3L2H A;  2ZCW A;  4YW3 A;  2ETE A;  2WS9 3;  4R4X A;  2ZEZ A;  3RZK A;  3EO6 A;  2WUH A;  3GZT B;  4AVV A;  5GLZ A;  2YU2 A;  1O8S A;  1WGP A;  2PAM A;  2VNG A;  1J1L A;  1QIQ A;  5IK5 A;  4IEU A;  4N7I A;  2OKX A;  4HSL A;  4CUA A;  3BCW A;  2Q8D A;  3VGI A;  5JMC A;  3MF6 A;  1SDW A;  4A3Z A;  4URA A;  1PNG A;  2WYF A;  3KF5 A;  3U1X A;  3ZN5 A;  4CCC A;  4B4P A;  4EN7 B;  2VVE A;  2YFU A;  3MIE A;  2RS1 3;  4O65 A;  1CAU A;  1RUH 1;  1V0A A;  4LBK A;  5I91 A;  2MNG A;  2Q1Z B;  3SH5 A;  3T3Y A;  3S0M A;  4AEJ A;  4JDM A;  3MIF A;  1XNB A;  2WZR 3;  4LE3 A;  1O59 A;  1WBF A;  4YG6 A;  4MXV A;  4MV2 A;  3NL1 A;  5KC5 A;  1GP6 A;  4XIK A;  1RUG 2;  2ARC A;  4BHP A;  3I8T A;  4F83 A;  5IVJ A;  2DCZ A;  1UOG A;  3KZ4 C;  3VKL A;  3C2U A;  3U0Z A;  4CVU A;  3CQO A;  4RFT 0;  2GND A;  1RUN A;  2VMF A;  3F2Z A;  3ZPO A;  4CCN A;  3LGR A;  3ZFG C;  3DXU A;  2YYO A;  3ZXL A;  4GH4 A;  5JOW A;  5A1F A;  4YVS A;  2WQ4 A;  5FYC A;  4XUR A;  4XJ8 A;  1NT0 A;  3LA2 A;  3ROU A;  4ERO A;  4W8J A;  1FPN 1;  3ILF A;  1NX9 A;  3T4V A;  1F5F A;  3C8X A;  1EP0 A;  2JKB A;  5FZ0 A;  4I0B A;  4AG4 A;  5I8S A;  2IVI B;  5IHR A;  2BVB A;  4UT5 A;  4XFA A;  4H3W A;  2HBU A;  3HNM A;  4C1X A;  4CP9 B;  1XOY A;  4E4S A;  5IT6 A;  2ORZ A;  2R07 1;  4QKB A;  5BNN B;  1F9K A;  1W0N A;  2UY8 A;  3SKV A;  1VBB 1;  3KT7 A;  4QPW A;  1H2K A;  3X29 B;  4IXL A;  1O3R A;  3BPZ A;  3UJQ A;  4LBJ A;  4X8P A;  1YJL A;  4QX5 A;  4SBV A;  4DRV A;  1J84 A;  2JIG A;  2UWA A;  2BNM A;  4XZU G;  2IXI A;  3H8R A;  2BVV A;  1CAU B;  4XZP A;  3BOW A;  3S7E A;  4AVS A;  5IJR A;  1GMM A;  1BVV A;  1S2E A;  4FPH A;  4N9I A;  5A80 A;  5BNN C;  3S30 A;  1NE6 A;  5L9R A;  2P3J A;  4FPF A;  5HCH A;  2QDN A;  2WFF 1;  3NST A;  4XPV A;  1CZT A;  2XLA A;  4N53 A;  5JZG A;  4TLF A;  5LRR A;  5HCB A;  2HWC 1;  2JD9 A;  2P34 A;  1T6B X;  2PTM A;  4PLO A;  3IAQ A;  2ERF A;  1UCX A;  3ZSM A;  1OHF A;  1SBF A;  4LTA A;  5HCF A;  4FAH A;  3ZYH A;  2W1Q A;  1C8M 3;  1B35 A;  5L9B A;  5LA1 A;  1CJP A;  4XCA A;  1FNZ A;  4BMB A;  3OEB A;  2V09 A;  4GH4 B;  3UKT A;  4YVS B;  1VMJ A;  2DUP A;  2V5Y A;  1LTE A;  3IAP A;  5ACA 2;  3N7L A;  5LA9 A;  3VN4 A;  1JBC A;  2GAL A;  4YZ2 A;  5L19 A;  3ALQ A;  1O3Q A;  5C4W A;  3ZYR A;  2VPV A;  4D94 A;  4DUV A;  2VGD A;  3JBG 2;  2HWD 1;  2CGP A;  4YVS C;  5FKC A;  4CE8 A;  2B9V A;  4LIU A;  3OD0 A;  1CIW A;  4X6R B;  4M0H A;  4YVW A;  1V6K A;  2KD7 A;  4ZS3 A;  1VRB A;  1DYO A;  3I3D A;  4R4Z A;  3WHU A;  2AEY A;  4TSV A;  5I8Y A;  4NAM A;  2WNO A;  1S2B A;  2H0B A;  2WDB A;  3M7A A;  5A32 A;  2EA7 A;  3M8L A;  4XF0 A;  3GNE A;  1Y9Q A;  2ARA A;  2BEO A;  3AMP A;  4XBQ A;  1AL2 3;  1FAT A;  2DVG A;  5F7U A;  3UGF A;  2JXA A;  2D6L X;  4M00 A;  1KS5 A;  1QWR A;  2AAC A;  3I49 A;  4MLO A;  1DGL A;  1EV1 1;  3OY8 A;  1NQD A;  5LY2 A;  4MYE A;  4N53 B;  3J8F 1;  5JZG B;  4GAZ A;  4D7T A;  2WNU A;  2VEC A;  1NXD 1;  2L9L A;  4Y5T A;  2VMG A;  3AZX A;  4CCD A;  3QH6 A;  4G9S B;  3RVH A;  3U10 A;  3LEM A;  1C4R A;  1RUD 1;  1B35 B;  2E63 A;  4AED A;  4JHT A;  5JZG C;  1NY7 2;  3H3U A;  4XFB A;  4HKO A;  5FIX A;  4E9K A;  2J42 A;  5IFP A;  2QUO A;  2OII A;  4LO4 B;  4H55 A;  5F2S A;  3CO2 A;  2WRA A;  4Y24 A;  5T5J A;  1B35 C;  5C4W B;  1CGP A;  1CWP A;  3VZK A;  1GSL A;  3AFK A;  2VBP A;  4XIO A;  3HN1 A;  2LW8 A;  1URX A;  2EVX A;  1GBG A;  1SLA A;  4YVW B;  3A23 A;  4AL9 A;  3QOP A;  3BOD A;  4XAC A;  2B46 X;  4HKW A;  2FDI A;  1X50 A;  4WM7 B;  3IDB B;  3ZKY A;  4KNC A;  5FY7 A;  5A32 B;  4DXR A;  3B7M A;  1EAH 1;  4ISQ A;  5C4W C;  2LTN A;  1H1I A;  3I97 A;  5BYN A;  1W2A X;  3GZA A;  2D6N A;  4M3C E;  1FMD 2;  4Q0Q A;  3T08 A;  1ULG A;  2KXL A;  2QQK A;  5F2W A;  1H9P A;  4YVW C;  5FO7 B;  1R1A 3;  4YW4 A;  3VDA A;  3B02 A;  2C9K A;  1RB8 G;  5FCC A;  4WM7 C;  5FWJ A;  2E7A A;  4AOC A;  3OY8 B;  4XFI A;  4FFH A;  2RS3 2;  2ZX2 A;  5JLV A;  4LJH A;  2WNU B;  2D6P A;  4S2H A;  1H6X A;  4DXS A;  3OUI A;  2GN7 A;  1S1A A;  3BYW A;  3FJS A;  3RYK A;  4XJA A;  4EN8 B;  3MZH A;  2O1Q A;  1ASJ 3;  3KWV A;  2DV9 A;  4MXW B;  2XOM A;  2BV4 A;  2J1T A;  1HQW A;  2JB8 A;  5FRE A;  1VBE 2;  2G9Z A;  1GZ9 A;  2DUO A;  4RFR B;  2C0Z A;  2WNU C;  3VDD A;  4KBZ A;  2RDN A;  1XXN A;  3Q8B A;  4FPG A;  3RQ0 A;  1R08 1;  1LOG A;  4M4P A;  2Y6F A;  4YM1 A;  2X29 A;  3AC0 A;  4R9B A;  4B7K A;  3PVE A;  1W6N A;  2VL4 A;  3KV4 A;  5KXE A;  3WDX A;  1RUG 1;  1VBA 2;  4COV A;  1TE1 B;  1DQ5 A;  4KL1 A;  5K7P A;  5LAS A;  4LKD A;  5EQU A;  1YFX A;  4R9D A;  5K0U B;  3UK9 A;  3ZSK A;  4JRA A;  2XHN A;  1WCK A;  5FZI A;  1RUE 2;  2HWF 3;  4DIN B;  1JI6 A;  3BOP A;  4D3W A;  3H1Y A;  2E7T A;  2QQN A;  2BUK A;  1PO1 2;  3QH7 A;  4XFC A;  5DAX A;  2Y8K A;  1UZZ A;  3PNA A;  4QMA A;  1N1V A;  1IPS A;  1X8M A;  5H9Q A;  5K0U C;  1DQ6 A;  4NN0 A;  4OMD A;  3ZR5 A;  3CJX A;  1QXP A;  4FPK A;  1FXZ A;  3LFM A;  4CU9 A;  2ET7 A;  4CUB A;  1GNY A;  5EJ1 B;  4QDS A;  2E32 A;  4FOQ A;  4H2A A;  5FXX A;  2NYY A;  4LHS A;  1WD4 A;  2W3J A;  3RS6 A;  1XNA A;  4WVM A;  2NMO A;  2F17 A;  1HV1 A;  2VOV A;  4IND A;  3H50 A;  5C5T A;  3H0O A;  3POG A;  5KXC A;  3B5L B;  1RMU 2;  5IVY A;  4UFM A;  1OC1 A;  4Z2W A;  1J3Q A;  2YDE A;  2FZ1 A;  2ID4 A;  2PHX A;  2EIC A;  1QDC A;  4XDQ A;  5HBA A;  3ILR A;  2RG4 A;  4MHU A;  1YC6 1;  3HQR A;  4EV0 A;  4YNI A;  1PIV 3;  1W6N B;  1WCQ A;  2O0O A;  5BPX A;  3VBF A;  4OMC A;  1H4H A;  1RUC 2;  2VXJ A;  2XLF A;  3OBA A;  4OFG A;  3R4D B;  4LOT A;  4IL7 A;  4PBP A;  3AKS A;  2WWU A;  1LEN A;  4LBO A;  5AC9 3;  4Y22 A;  3MPP G;  3VBO A;  4LKS A;  4K21 A;  4Y26 A;  1QOT A;  4Q5O A;  1I3H A;  2QJV A;  1W0P A;  2WWS A;  1Q8P A;  1S0J A;  3ACF A;  2AH2 A;  5FPL A;  1S0I A;  4MGZ E;  5JI9 A;  3D0S A;  4IEZ A;  5ACA 1;  2ADE A;  4P9I A;  1F15 A;  1VE0 A;  2HEV F;  5D21 A;  4CYD A;  4HKL A;  1AXY A;  4MGI E;  3VD7 A;  5A6Q A;  3S5A A;  2RS1 2;  1U5X A;  1OD3 A;  3KT4 A;  2J1U A;  4AVT A;  1GAN A;  1OT5 A;  1WLC A;  3JBG 1;  4G3Y C;  4IEQ A;  3N9P A;  4OUM A;  4ZON A;  3RWK X;  4D7Y A;  1QOS A;  4AHZ A;  4NHX A;  4KWK A;  2RMU 3;  3AL6 A;  4WVM B;  3UES A;  4W50 A;  3VKM A;  4UYB A;  4AXO A;  3I3E A;  1W2T A;  3OGJ A;  4XUN A;  5D2A A;  1MQT A;  2C9A A;  1GNH A;  2D5F A;  4JRL A;  2XVK A;  4GKX A;  3ZYF A;  5FZK A;  5FO9 B;  3CIH A;  1MAC A;  2XJR A;  2VE1 A;  1JHJ A;  4PIY A;  1IPK A;  2B8M A;  4EZ4 A;  1GIC A;  3VKN A;  2Y0I A;  1UOB A;  1KEX A;  2WNV A;  1Q8S A;  1IKP A;  5E1R A;  3VBF B;  3JXS A;  1EUU A;  4GQ7 A;  1JYN A;  1SG3 A;  4I02 A;  1XPW A;  4E2G A;  3D5O A;  2VQ0 A;  4Y22 B;  2IFR A;  3J4U H;  3POJ A;  4NPL A;  4BZ4 A;  3RFR A;  1UZ0 A;  3KV6 A;  4PDW C;  5GZG A;  1JH5 A;  2NZ9 A;  4CU8 A;  1NA1 A;  1NY7 1;  1XSQ A;  3AZZ A;  1UPS A;  5EPA A;  5FMO L;  4QHZ A;  1AXK A;  2EAL A;  3AJY A;  4LIT A;  4AHW A;  2HYK A;  1ENQ A;  5H9R A;  5IW0 A;  2Q8E A;  4NPR A;  3MID A;  1ZZB A;  1SLT A;  2GH2 A;  2ZBJ A;  1W9S A;  3SIS A;  3WV6 A;  4Q1P A;  3USU A;  2B45 X;  1GP5 A;  3I7D A;  4Y33 A;  1NCR C;  4BB3 A;  5B4X A;  3N7M A;  3GJA A;  1VBC 3;  4MGT A;  1UU6 A;  2FZ2 A;  4XEZ A;  4QPG B;  3NWK A;  2FDG A;  2CTV A;  4EWE A;  4E4D X;  2PYT A;  1MQT B;  3FHQ A;  1FMD 1;  1LNS A;  2OW4 A;  2ZGS A;  4IGP A;  2B4K A;  1C8M 2;  3K4Z A;  1RUF 3;  4WV8 A;  3WNX A;  4BE3 A;  4XJW A;  4WBB A;  1SEF A;  1J83 A;  2WNV B;  1UIJ A;  1W8F A;  3DUI A;  3MIH A;  4QPG C;  5DPN A;  2RS3 1;  4ASL A;  4QDR A;  1MQT C;  2IZW A;  4KGG A;  2Y6H A;  4NHL A;  2OPW A;  3EXU A;  2RJK A;  4EZH A;  1QJY 2;  4NRM A;  1W03 A;  3RZH A;  4K6B A;  3E6C C;  3SH4 A;  3WQB A;  4LK6 A;  3E5Q A;  2XG3 A;  4ZPI A;  1AR6 3;  1PGS A;  1W28 A;  1VBE 1;  3DEM A;  2JDP A;  3MI8 A;  1TG7 A;  3VZO A;  3M1H A;  1XRU A;  5FR3 A;  4YGB A;  4BA6 A;  3O1T A;  1UZV A;  1APN A;  3KCC A;  4YW7 A;  2W1W A;  4UW6 A;  4JQR A;  3CKH A;  3AMN A;  2WT1 A;  1LED A;  5DUX A;  5FFO C;  1QJU 3;  1Q56 A;  4QPY A;  5EHD A;  4OI0 A;  2JDU A;  4LIV A;  1D4M 3;  1VBA 1;  3MW3 A;  1TME 3;  1I5P A;  1XE8 A;  2A6Y A;  3D0J A;  1RGS A;  3AXD A;  2FCV A;  3HBZ A;  3KQR A;  1RUE 1;  2XBO 2;  3RJR A;  3CHX A;  3WNK A;  3WXP A;  4XVH A;  4MX3 A;  1DZQ A;  2OZJ A;  2Z5W A;  3RG0 A;  3I2F A;  1HXS 3;  4OUS A;  3ZR6 A;  4Y4Y A;  5FYH A;  1PO1 1;  3F95 A;  3HPN A;  4UAP A;  1JZ7 A;  3UGG A;  3I54 A;  3J26 N;  4KU7 A;  1G7Y A;  4AE2 A;  4I01 A;  4UFL A;  5IVB A;  2JIC A;  3W21 A;  4MOA A;  3EHK A;  1SMV A;  4AQ2 A;  4M4R A;  3V65 A;  4BDV B;  4J25 A;  5DAV A;  4XYX A;  2Y60 A;  2ZZQ A;  3Q8E A;  3IIA A;  5FY5 A;  5EZW A;  2GP3 A;  3OGS A;  1DBN A;  1GR3 A;  1K12 A;  1GZC A;  1TQ5 A;  1ULF A;  2EIG A;  1RMU 1;  1RIT A;  4QKN A;  3MLL A;  1JYT A;  1LB2 A;  4CXW A;  2W9X A;  3GHN A;  4TN7 A;  4GD4 A;  3LE0 A;  1DCS A;  3LKJ A;  3WR0 A;  3B69 A;  5C7G A;  3K4A A;  1LOF C;  4FFF A;  2ZA9 A;  4Y1U A;  4SLI A;  4YG3 A;  1GZT A;  3BPS A;  3SHR A;  3VBS C;  1YLL A;  2E51 A;  2VW2 A;  3ORJ A;  5GZC A;  5IVF A;  5F3G A;  1S0E A;  1QNY A;  1RUC 1;  5LW9 A;  1D0G A;  1R1A 2;  2XQR A;  1TMF 3;  2XGX A;  1W9Y A;  1US2 A;  4QQP A;  2ZAA A;  5FZL A;  3E6D A;  3ZO0 B;  2HWB 3;  4ARY A;  3TRS B;  2A6W A;  3LPF A;  1PGW 2;  2Q1M A;  4Y1Y A;  3ZYP A;  4CDU A;  1BLZ A;  2UYB A;  1EUT A;  4WM8 A;  1AJK A;  2XON A;  2YHJ A;  3D82 A;  3UNP A;  3N36 A;  2PQS A;  4JKM A;  4E2S A;  5DMY A;  2ENR A;  2XKP A;  1ASJ 2;  3RMY A;  3ZFE A;  5A3L A;  2QDR A;  1UX7 A;  3I59 B;  3KMH A;  3VBH A;  4DMI A;  1A6C A;  3CLP A;  4Q4X 2;  4JAA A;  2RS1 1;  2V4A A;  1J59 A;  1W8T A;  1OMI A;  5K8S A;  2P6C A;  4OHX A;  1MS9 A;  2OUJ A;  3GM8 A;  4XW3 A;  2WC2 A;  1DDL A;  2WII B;  1MVQ A;  2RE9 A;  1UY4 A;  2VZ3 A;  1PGL 2;  3GBG A;  4FTS A;  5G04 L;  2XJP A;  5EYY A;  4HBN A;  1KRI A;  5EJZ B;  5EXO A;  1S0B A;  3I3Q A;  3P5B A;  4GWJ A;  5FP9 A;  3ZSL A;  3MDP A;  4PIX A;  4LOR A;  4A7K A;  3THT A;  1CES A;  5A6Y A;  2JD4 A;  3K3N A;  1YQ2 A;  3HAG A;  4LOS A;  1H6Y A;  5EIY B;  2E53 A;  3U4S A;  4K20 A;  2E6V A;  4HK9 A;  4QX7 A;  2HLE A;  1FV2 A;  2VME A;  4Q4W 3;  2LAL A;  2W91 A;  3BIE A;  3M3C A;  5FYY A;  1BK1 A;  1OBN A;  1IG0 A;  1YYN A;  1SFN A;  3FE5 A;  4IV1 A;  3WT3 A;  2J1R A;  4IE7 A;  4QPI A;  5FLJ A;  4NRP A;  2X09 A;  2LM3 A;  2CWS A;  3FFZ A;  5BNO B;  3AVR A;  4CDQ B;  2ARX A;  1I6X A;  5FYI A;  5J1X A;  3LA3 A;  2HJI A;  1AYN 3;  4CDU B;  3PVO A;  1WCS A;  3MW2 A;  5FXW A;  1REE A;  1WW5 A;  3FC0 A;  4WM8 B;  1PVC 3;  2ZKN A;  4D69 A;  3ACG A;  1AR8 3;  4LO8 A;  3P1I A;  4RR3 A;  1LKN A;  1GP4 A;  3ZFE B;  2XJS A;  4V2V A;  3WD5 A;  4CDQ C;  4MVT A;  5BNO C;  3VD9 A;  4DY5 A;  3I3B A;  2GAU A;  4UBG A;  2DFB A;  4JGZ A;  3VL8 A;  4CDU C;  3O1U A;  4UFK A;  2XH6 A;  5A1L A;  2UWC A;  1ZX5 A;  4L2N A;  2GC3 A;  5LA0 A;  1MS1 A;  5LK5 A;  2QQP A;  1H1A A;  4NO4 A;  1QHD A;  1N1T A;  5GZF A;  3ZFE C;  2P5B A;  4RS5 A;  1GQP A;  2ZMK A;  2ZHM A;  2OXB A;  5SV8 A;  2AR6 A;  2VXR A;  4Z2A A;  4IE6 A;  3O1V A;  1PZ8 A;  3S57 A;  5JR7 B;  1W3X A;  2Z69 A;  3SLI A;  2GP5 A;  1V6N A;  4XUT A;  5AC9 2;  4XAB A;  4F7Z A;  3AKQ A;  1C8M 1;  1VB2 A;  2YC0 A;  3C7F A;  3I2O A;  4UOJ A;  4GA9 A;  3KHB A;  1YFU A;  4WZC A;  2BOI A;  1DLC A;  3DN7 A;  4XXP A;  5DDJ 1;  4CP1 A;  3B01 A;  3U37 A;  2OYZ A;  2Q5T A;  3LSE A;  1AXZ A;  3W5M A;  4QPI B;  4QT6 A;  2ZX1 A;  4AYU A;  2FMY A;  1YFY A;  2YMZ A;  2WLP A;  4XHB A;  2VCC A;  1QJY 1;  3HEI A;  2VD7 A;  3N7J A;  1JOB A;  4Q4V 2;  4XHX A;  2WFP A;  3OUJ A;  4LK7 A;  2VNV A;  2NM1 A;  2RMU 2;  4O7X A;  1CJD A;  4RR3 B;  1KXG A;  3AM2 A;  3EQE A;  3R0R A;  3ZSJ A;  1UWW A;  2GC1 A;  5GLW A;  1Y43 B;  4UWD A;  1QMJ A;  1QEX A;  2PXJ A;  4Y4R A;  5F6K A;  1DQ1 A;  2PHW A;  1WW7 A;  4JGZ B;  4HON A;  2IUW A;  3WDV A;  1HB4 A;  1W8O A;  1OPM A;  3CDZ B;  1RTV A;  5E88 A;  1STM A;  2WO7 A;  3NJY A;  1QJF A;  4NHM A;  4I3G A;  1H8T C;  2C24 A;  2UU8 A;  3K2O A;  3IM0 A;  2VTX A;  2VOX A;  3GHM A;  3ZFG A;  2YXS A;  2XBO 1;  3ETQ A;  3ZXK A;  2PHU A;  3NV3 A;  3E5U A;  4JGY A;  3M3E A;  4JGZ C;  3VHR A;  5CAZ A;  4JX0 A;  4JCK A;  5GKA C;  5FZC A;  4I0A A;  4HFS A;  1J58 A;  2DWR A;  4XUP A;  2CGO A;  1C1L A;  3PUA A;  4D6S A;  5CFC A;  4FXG B;  5C9A B;  1ZRD A;  2KM2 A;  2BU9 A;  3HVD A;  2VU9 A;  3QCW A;  1W8N A;  2ZAC A;  1SLB A;  4P9W A;  4QKD A;  5C8W A;  5FY8 A;  3D3A A;  4CCE A;  1OUX A;  4RN5 A;  3BUC A;  1OOP A;  3SEE A;  4PF1 A;  5H9P A;  3ZXJ A;  4BQ2 A;  4DY3 A;  2WN3 A;  4FT8 A;  2VC9 A;  4LKE A;  4QWN A;  2TNF A;  2GH8 A;  3N9N A;  3O1M A;  5FPV A;  2WNE A;  4BJ0 A;  4UW3 A;  5C9A C;  3EB7 A;  2AEN A;  3C7G A;  2Z4F A;  3K75 B;  2EAA A;  3RNS A;  5BY5 A;  3PU8 A;  3RYR A;  4NIH A;  4RYD A;  3KSC A;  5I0U A;  3IN9 A;  4Q1R A;  1VBC 2;  4Q26 A;  4RHV 2;  5F5C A;  4CP9 A;  1YI7 A;  5IVC A;  2IFW A;  5BNN A;  3VBR A;  2WBK A;  3ME2 A;  3OPZ A;  3RMX A;  4E4H A;  2MEV 2;  1ULO A;  2CWM A;  3KB5 A;  4HG6 B;  4XXA A;  4YZ3 A;  5A7Q A;  4WVV A;  2WQ8 A;  2ZGL A;  3KCY A;  5HXM A;  4OI1 A;  3AP5 A;  1R1A 1;  2G19 A;  1NLR A;  4G4F A;  1UQX A;  4M01 A;  4MZU A;  5CA6 A;  2NP0 A;  1OF3 A;  5D8A A;  4CCM A;  2H6C A;  3N3H A;  1PGW 1;  4AK3 A;  1W2O A;  4UXA A;  1IS3 A;  2JE8 A;  1W2U A;  2QQU A;  1HRV 3;  1UW8 A;  3H8U A;  3ZFG B;  4LLO A;  3SNM A;  1CR7 A;  4BQ5 A;  4JGY B;  2UWB A;  3HN3 A;  3PU3 A;  1C5H A;  5CYY A;  2E26 A;  1ASJ 1;  4FOV A;  5BNQ A;  5CFC B;  3SIT A;  5T5L A;  4Q4X 1;  1H2N A;  1AR6 2;  3ZN4 A;  5DAB A;  1HJG A;  1OOP B;  3KT1 A;  5JXH A;  4AGV A;  2BQP A;  4JGY C;  3SKJ E;  4HN0 A;  1QH6 A;  1POV 3;  1PGL 1;  4Y20 A;  4PQ9 A;  1IS5 A;  4RA0 A;  2DTW A;  3K48 A;  5FZD A;  1CZV A;  3H8X A;  1BVP 1;  3U07 A;  5CFC C;  4DFS A;  1QJU 2;  2BFU L;  5LK7 B;  2P1B A;  2YG0 A;  4B29 A;  1QGL A;  4FQ4 A;  3TNP B;  4LHN A;  1H1M A;  2GMP A;  1TME 2;  1NAE A;  1T6G C;  1OOP C;  2R32 A;  3PVB B;  5I0D A;  3ZXE A;  4WVZ A;  5J37 A;  3L9J T;  5KHJ A;  1LR5 A;  1W90 A;  4NOT A;  2V5D A;  2YGL A;  4FBF A;  2VJX A;  5J98 B;  3RZL A;  2NLR A;  3VBR B;  4B4R A;  4JZR A;  1FOD 3;  3K46 A;  1BEV 3;  1FV3 A;  1W6Q A;  2XL9 A;  3P3N A;  4P08 A;  2YBP A;  2VUC A;  1HXS 2;  5FZ1 A;  3KD4 A;  2D98 A;  3WIN E;  1IG3 A;  2PAK A;  1UXX X;  2R04 3;  5IVV A;  1V6O A;  5D8A B;  2WIN B;  1DG6 A;  1UD1 A;  1OUS A;  4QB1 A;  3N4M A;  3VBR C;  4PI2 A;  3G7D A;  4AGG A;  2IWG B;  1HKD A;  2A6Z A;  4RD7 A;  3NV1 A;  5FPU A;  3FWE A;  3OBR A;  4LBQ D;  3CL1 A;  4JDN A;  1P8J A;  1Q8Q A;  5GLV A;  3SCG A;  3O14 A;  4KH9 A;  2IXC A;  2BZD A;  2VUJ A;  1SZB A;  2DBN A;  1RXG A;  4MH0 E;  5FMO S;  4W6Y A;  4YM3 A;  1W8U A;  5D8A C;  1H2L A;  4BH9 A;  3WG2 A;  2RS5 3;  4A3X A;  2A3Y A;  1ONA A;  3AP7 A;  3LQC A;  3LCP A;  5HXV A;  4TZD A;  2AZ5 A;  3OYW B;  3UL2 A;  1GWL A;  4COZ A;  4Y20 B;  2XJQ A;  3UJO A;  3VDB A;  3J7H A;  4XUQ A;  3CMG A;  1MR5 A;  1D2S A;  4RL7 A;  4YG0 A;  4GB3 3;  2RR1 2;  5AVP A;  1RHI 3;  1VP6 A;  4A4A A;  1FNY A;  2VCA A;  1IQD C;  1RIN A;  4GWI A;  5LBC A;  1DGW A;  2VQT A;  4NWW A;  4BQW A;  2PLV 2;  3NV2 A;  5AC9 1;  5IK7 A;  2HWB 2;  4E27 A;  2V72 A;  4NR1 A;  4YYO A;  3FLT A;  1Y9G A;  1XQN A;  1W6Q B;  2J7M A;  4HMZ A;  4WM7 A;  2XVG A;  1CAX A;  1MEC 2;  3HOB A;  4QQH A;  1OFN A;  2Q30 A;  4HET A;  4BQ4 A;  2ZHL A;  3MW4 A;  4QAW A;  2VCM A;  5FQ0 A;  2W5F A;  2VW0 A;  1UO9 A;  5HCA A;  4KMQ A;  4Q2F A;  4AAP A;  3AB0 A;  4QGM A;  2R06 3;  5LWB A;  1COV 3;  4URT A;  1V9U 3;  1UYY A;  2VMH A;  2P17 A;  3B9I A;  1UAI A;  3DKQ A;  3HJR A;  3OTF A;  5CZK A;  2LS6 A;  3V64 A;  1ZZ6 A;  5JPN B;  2YPJ A;  1F2N A;  4Q4V 1;  3NMB A;  3WX5 A;  3NAP B;  2W87 A;  1OA4 A;  2RMU 1;  3NNJ A;  4BIS A;  3MGU A;  4EWA A;  2DVF A;  3GXU A;  1QDO A;  3B9C A;  3OG2 A;  4AW7 A;  1VBD 2;  3IDC B;  5D1I A;  5M0T A;  5KHH A;  3JD7 2;  1O6U A;  4IE5 A;  4NHY A;  4QX8 A;  4MXW A;  1QU0 A;  4CUG A;  3NAP C;  5C3S A;  3A7Q A;  4Q4W 2;  5FV3 A;  1CVN A;  4LMF A;  3Q9O A;  3DV8 A;  1VIW B;  1PO2 3;  3OBZ A;  2PEL A;  4FPC A;  4CCL A;  4CPB A;  4ZZ5 A;  4OHV A;  4LO5 B;  5F32 A;  1AX1 A;  2ZGM A;  4KQ7 A;  4GWN A;  4QGN A;  1VAL A;  1YIF A;  5FY0 A;  2LRP A;  5LY1 A;  4JTN A;  3QBQ A;  4FTE A;  1L7R A;  2W52 A;  1PVC 2;  4HXC A;  2BP6 A;  1AR8 2;  1YCI A;  1XYO A;  2J1A A;  1KDK A;  3NKT A;  1CAX B;  4XMI A;  5K0U A;  5EP9 A;  1ZZ7 A;  3C7E A;  2YRO A;  5C8C A;  5FQ0 B;  1E5I A;  2O8O A;  4IUG A;  4P5Y A;  1VB4 A;  1DU3 D;  5LAT A;  3ZSE A;  4C90 A;  1NZC A;  1W9F A;  1MPX A;  1MS3 A;  5FUI A;  4XDO A;  3AK0 A;  2QFE A;  5A7S A;  5F1R A;  1PVX A;  3T2T A;  1Q3E A;  2VTF A;  5FAX A;  1H9W A;  1MZF A;  2D5H A;  4I2O A;  1X8E A;  1VBC 1;  4RHV 1;  1LHN A;  3ABZ A;  1VRH 3;  4BQX A;  2R1B A;  1HV0 A;  2VW1 A;  5T54 A;  4QM8 A;  5E8A A;  2MEV 1;  4IEV A;  2ATF A;  5E16 A;  1W06 A;  3IPV A;  4XF9 A;  5FKB A;  3AXE A;  3NKG A;  5GJ6 A;  3KS7 A;  2FCU A;  1KIT A;  4AR2 A;  2ILM A;  3ZM8 A;  2HYX A;  1QJX 2;  1ALY A;  2GMM A;  3ZXD A;  5T50 A;  4Y3O A;  5FP7 A;  4CEW A;  1ZBA 2;  1WMX A;  3FZ3 A;  4FQZ A;  3IB3 A;  1SHW B;  2NQY A;  2VMI A;  3AKR A;  3LWC A;  4IES A;  4XJ9 A;  1HB1 A;  1YNA A;  2BRT A;  4AI0 A;  3PUS A;  1W6O A;  1AR6 1;  1U5I A;  3K51 A;  1BHG A;  3ECQ A;  4KG0 A;  2VNO A;  3AJZ A;  1S0D A;  3B00 A;  4Z8B A;  4UI9 L;  3IZO A;  4DB5 A;  5C8C B;  1IS6 A;  3RZM A;  3T2P A;  3LD8 A;  4FCA A;  2IVJ A;  4P14 A;  1QJU 1;  1HB2 A;  3MPB A;  1NLQ A;  4NE9 A;  4ISR A;  1FPN 3;  1TME 1;  2BGP A;  3N9M A;  1O3S A;  4Z07 A;  1W8H A;  1R09 3;  2ZGK A;  5I93 A;  1EY2 A;  1QQP 3;  3WW2 A;  1RUJ 3;  2VY0 A;  4GUL A;  1YRZ A;  2CL2 A;  2P2K A;  5C8C C;  5FYB A;  1H4G A;  4BIF A;  4AFM A;  2OVU A;  1CIY A;  2J1S A;  3VKO A;  1NZI A;  1HXS 1;  4HAN A;  5K9Y A;  1N47 A;  2ARB A;  2J22 A;  3IPV B;  1K5M C;  1XE0 A;  1IGO A;  1O8P A;  1ZZ8 A;  1U5Y A;  2VZU A;  1Q43 A;  2XJT A;  3DYP A;  4FSJ A;  4MGK E;  1HN1 A;  3RSJ A;  4PDW A;  5T55 A;  3OEA A;  4XQ4 A;  5FTT C;  2BBV A;  1M06 G;  1X82 A;  4CEW B;  4CDW B;  3VB9 A;  4E8D A;  4AFD A;  4EE2 A;  5FBZ A;  4HN1 A;  4CCK A;  4AQT A;  2WFF 3;  1TNR A;  2RM2 2;  2QBX A;  3QLQ A;  1W6O B;  1WCU A;  4QXB A;  3KQ4 B;  2JE9 A;  4P9X A;  4OQ8 A;  4GJY A;  2MHF A;  2WS9 2;  3IWZ A;  2HWC 3;  2WSV A;  2PA7 A;  3HMY A;  1V6M A;  4LBL A;  1LCL A;  1YJK A;  4RGK A;  2ZHN A;  4Y1X A;  3W5N A;  1UNB A;  1US3 A;  1LAJ A;  2GC2 A;  2VZQ A;  2ZGR A;  2A5Z A;  2YY1 A;  3PMS A;  4UF0 A;  4CDW C;  4P9Y A;  2W46 A;  4CEW C;  1UKG A;  1XYP A;  4LEJ A;  1NCR A;  4XQD A;  1SCR A;  3BIW E;  2K9Z A;  4HVR A;  2RR1 1;  4FP2 A;  2RHP A;  1D0H A;  3WDU A;  1UMZ A;  3IMN A;  3TB0 A;  2PLV 1;  1C3H A;  2HWB 1;  1W99 A;  1O7F A;  2A73 B;  3WLU A;  4IET A;  5ANQ A;  5FRA A;  3LA7 A;  2GME A;  2I74 A;  2I2S A;  3WNN A;  5JSO A;  1HRV 2;  3MFC A;  3E1F 1;  2WZR 2;  3TWI A;  1LUL A;  1UL9 A;  5IK8 A;  5FPA A;  4LXL A;  1MEC 1;  1JOJ A;  3RGB A;  4CTE A;  2RDS A;  5CIS A;  2KR2 A;  4QPG A;  3IT8 A;  4YGC A;  3GBF A;  1LU1 A;  3I2G A;  3AL5 A;  3WF0 A;  2X8K A;  4Z82 A;  4N7U A;  5ABJ C;  2VH9 A;  1RL3 A;  2C6S A;  2UY9 A;  1W6M A;  1VAV A;  1DZT A;  4PDW B;  4CUC A;  4YAR A;  4FFG A;  3VKF C;  3LZZ A;  2R30 A;  3WZ1 A;  1F5J A;  2XWB B;  3JUU A;  2YU1 A;  4COW A;  1GOF A;  2VMD A;  2D43 A;  1EV1 3;  3LOI A;  1AUY A;  3WDT A;  5JCT A;  2FDF A;  2SLI A;  1VBD 1;  2HEW F;  3TN9 3;  3SMH A;  3E5X A;  4AQS A;  3JD7 1;  3BTX A;  2R1D A;  5LB6 A;  3LF7 A;  1PMH X;  4UF0 B;  1AR9 3;  4Q4W 1;  5AVA A;  5FPZ A;  1FOD 2;  1NCR B;  1RUD 3;  2D97 A;  3ON7 A;  4NAO A;  4QU2 A;  5CVR A;  1MVE A;  5CFD C;  3MV1 1;  2JDN A;  1UZY A;  1ACC A;  1LU2 A;  1GUI A;  4GXL A;  5T5P A;  5JOX A;  3K77 A;  4DZG A;  3FUQ A;  3M4F A;  4W4Z A;  2TEP A;  4QX3 A;  1L7L A;  2FBE A;  2VZ1 A;  5DZE A;  1OF4 A;  4BK5 A;  3GGL A;  3ZIX A;  5LEJ A;  3J7N A;  1W6P A;  2CYF A;  1PVC 1;  1XU2 A;  1NCQ A;  1AR8 1;  4IEY A;  5FPB A;  4AI1 A;  4PF5 A;  3DYM A;  2DUR A;  1ENS A;  2Q8C A;  2OUH A;  3WVJ A;  1HIX A;  2JX9 A;  4NRO A;  4XTM A;  4XCB A;  5LA2 A;  4D7S A;  2VG9 A;  2UYA A;  2FDJ A;  5JWP A;  3DL3 A;  1ULE A;  2D3P A;  2EXI A;  3BGA A;  2RS5 2;  1MZ6 A;  1S0F A;  1OLR A;  3J7M A;  1H30 A;  1O5L A;  2Q4S A;  1OVP A;  1W6M B;  1WUV A;  1AR7 3;  1D2Q A;  1KJR A;  1WW4 A;  3UKN A;  1QY4 A;  5FY4 A;  1SLI A;  1ULP A;  2ZML A;  3O0W A;  4LBQ B;  4JDO A;  5A7W A;  4AHY A;  4X6Q B;  2XML A;  2RVA A;  4QB6 A;  5B4N A;  2F6B A;  4AHX A;  5JSP A;  1LOF A;  4JHZ A;  4FPY A;  1UU4 A;  3Q8F A;  1OQD A;  3VBS A;  3OBT A;  4OHW A;  2A71 A;  1JS9 A;  3DXT A;  5IK4 A;  4BQ3 A;  1H0B A;  5A7P A;  2DU0 A;  5JR2 A;  1S0G A;  5FZB A;  1UOF A;  4I3P A;  4R9C A;  2B9U A;  2JEC A;  1C1F A;  1KDM A;  1ZNP A;  2CU5 A;  1QJX 1;  3DGT A;  2TUN A;  3ZN6 A;  3CJI A;  1ZBA 1;  2A7A A;  2R06 2;  1MS5 A;  1AL2 2;  1V9U 2;  4R9A A;  3AKT A;  1R08 3;  3DPR A;  4QQO A;  3MIC A;  3N7K A;  2JDA A;  1NKG A;  3V56 A;  4O61 A;  5IUQ A;  4MAD A;  1K3I A;  3TYJ A;  2X10 A;  1W6P B;  1IZ3 A;  1NCQ B;  1RUG 3;  3VHN A;  3I2H A;  3ZYB A;  2WN2 A;  5JMO A;  4EN6 B;  2JE7 A;  1AX0 A;  1S55 A;  1YFW A;  1QXR A;  4IER A;  4XJZ A;  1HRI 3;  4ZS2 A;  3VZN A;  2WT0 A;  4XDP A;  4BPZ A;  2A70 A;  5C3P A;  2HBT A;  5JXJ A;  3PJQ A;  4B1M A;  2N7G A;  2W68 A;  1W9T A;  4IEW A;  4Q4Y 3;  3PTR B;  4P00 B;  4YGD A;  5EWS A;  2RJL A;  4S2G A;  5LZ6 A;  1F4A A;  4GMP 3;  2G9G A;  3I59 A;  1RIR A;  1S0C A;  1NCQ C;  2BFU S;  4TWT A;  2VVD A;  2PHR A;  4JQT A;  3RI9 A;  1AVB A;  1DIW A;  5A70 A;  4L0P A;  3UET A;  5A7W B;  2PN5 A;  1HN0 A;  2B39 A;  3ZOI A;  4I0W B;  3K3O A;  3P3P A;  1O4T A;  5DAQ A;  5I8T A;  5A6Z A;  1LOE A;  4E4Z A;  5JAX A;  5FP3 A;  1W8W A;  1RED A;  4CDX A;  5HV0 A;  3GZE A;  3VBS B;  3RZZ A;  2XL7 A;  5C70 A;  4TYS A;  1JW6 A;  1XBF A;  2P3I A;  3M2M A;  1V6L A;  3MFA A;  2YZ4 A;  3ES1 A;  3VLB B;  2VOW A;  5FWE A;  2D6K A;  2PHL A;  3S6P A;  1AJO A;  2W39 A;  3C7O A;  2V73 A;  5A3T A;  1PNF A;  3AX4 A;  1A8M A;  3ZN6 B;  4C91 A;  3CJI B;  3DYO A;  4ZXK A;  4ASK A;  2P3K A;  3DPR B;  4QM9 A;  2RM2 1;  1LOA A;  2W92 A;  3AKP A;  2JB4 A;  5BNO A;  4CDQ A;  2WS9 1;  4PCR A;  1UY1 A;  3AMM A;  1NYW A;  1VRH 2;  3IBM A;  3CJI C;  1NLS A;  2IXL A;  3NJX A;  3WEZ A;  4DEQ A;  4NIG A;  3HR9 A;  2JDZ A;  4NID A;  2DVD A;  2DUQ A;  3MUY 1;  3DPR C;  1CAV A;  4YZ1 A;  1N1S A;  4ATE A;  2K0G A;  3M3Q A;  4LHL A;  1G86 A;  1N3O A;  4MGY E;  3WDW A;  1SQ4 A;  4PIZ A;  2BW8 A;  3BTY A;  4RGG A;  3ZXF A;  4LO6 B;  5FJH A;  1YXW A;  3WW1 A;  5A6X A;  1HRV 1;  2QNK A;  3LDR A;  1FT9 A;  4JVA A;  4UFI A;  3ZVX A;  4A45 A;  4DOU A;  4E8C A;  5JXI A;  1OQE A;  1DF0 A;  2WZR 1;  4QQ2 A;  4UFJ A;  4XBN A;  1A8D A;  2VBD A;  4LR4 A;  1MZE A;  1V70 A;  4UW4 A;  1DQ4 A;  4CDX B;  2W95 A;  3BTA A;  4ZY9 A;  3PUQ A;  1JHN A;  3ZDS A;  2RDQ A;  2CAU A;  5FOJ B;  4HVO A;  1PK6 B;  2A6X A;  4CA9 A;  3CF6 E;  2YB7 A;  1GNZ A;  3THD A;  1ODM A;  2QQI A;  2R0H A;  2CY6 A;  4XET A;  1VMF A;  2HWF 2;  4ZKT B;  1POV 1;  3LSD A;  4PLN A;  1SLC A;  2IC1 A;  3D4K A;  4CDX C;  4MGQ A;  3CZJ A;  5T3N A;  5CAD A;  1PK6 C;  3KM5 A;  2JDK A;  4CRQ A;  1X7N A;  3R05 A;  4AFB A;  4AVA A;  5J48 A;  1HW5 A;  3ZFF A;  1B09 A;  1R09 2;  4CP0 A;  1OLQ A;  1QQP 2;  3H9A A;  1RUJ 2;  3TEX A;  5T52 A;  1H2M A;  1GQH A;  1YEW A;  2Y26 A;  1Y3T A;  4C0B A;  1ST8 A;  4J6G A;  3H7Y A;  3URF A;  4HK8 A;  3AP4 A;  1FOD 1;  2Q1F A;  1CAV B;  1UYX A;  1H8T A;  5I0R A;  3I4I A;  1JYW A;  4X8N A;  3OB8 A;  5FXZ A;  2H6B A;  2AGS A;  2WKK A;  4O9G A;  4FP3 A;  3MV0 1;  3WG1 A;  1J3R A;  4AGR A;  4AEK A;  3MIG A;  5F8P A;  2O8Q A;  2Y6G A;  3FX3 A;  2D40 A;  4DQA A;  3OGG A;  5GAL A;  1ZA4 A;  1UF2 C;  4QB2 A;  4BLJ A;  2QQM A;  4B7E A;  1V00 A;  4JC1 A;  3LEG A;  4HL0 A;  5DAP A;  5A3W A;  3HNB M;  4Q0P A;  4YPJ A;  3LDK A;  1PIV 2;  1UMH A;  3N9O A;  1Z0H A;  4ET7 A;  5A3M A;  5FOB B;  1WLW A;  3NNL A;  2X5I C;  1QXJ A;  3LB9 A;  2QQV A;  4CXX A;  4NIA A;  1QF3 A;  1D4V B;  4DEV A;  2RS5 1;  1I5Z A;  1GWK A;  1XE7 A;  4NMI A;  2QZ3 A;  5G05 L;  5C9A A;  1ZBE 3;  2YUE A;  5DN2 A;  5DAW A;  5FYZ A;  4EN9 B;  3I3M A;  3WUC A;  4GJZ A;  3VZJ A;  1EPW A;  2VAU A;  4BU2 A;  2PHF A;  3H3L A;  3KV5 A;  5A3O A;  3BI3 A;  2QQL A;  1HB3 A;  2CGN A;  4B8E A;  1MS4 A;  5FP8 A;  3OOX A;  1O5U A;  1AL0 G;  1VR3 A;  3MBW A;  1W3V A;  4MGS A;  2RS3 3;  3GDB A;  2PAE A;  4NHK A;  1HX6 A;  3T2Q A;  3ZFF B;  1W8Z A;  4HZF A;  4FOW A;  2YC2 A;  4EJR A;  3NO8 A;  3WP4 A;  3QD6 A;  3LPG A;  3NJV A;  4CCJ A;  2BJS A;  4FI9 A;  2WT2 A;  5CB7 A;  2ORX A;  3GAL A;  1DYP A;  4A6O A;  3J7L A;  3NJZ A;  5CU1 A;  2EXK A;  2Q8O A;  1ZVF A;  1H8T B;  3WW4 A;  1CON A;  1VBE 3;  4LLF A;  2I07 B;  3R6S A;  2XQX A;  3QAC A;  1WW6 A;  3ASI A;  2B42 B;  3ZFF C;  2R06 1;  5LCW L;  5IAT A;  1AL2 1;  1V9U 1;  2J1V A;  3KF3 A;  1BBT 3;  3I2K A;  3V0B B;  5APA A;  5L7O B;  5FZM A;  1UYZ A;  3PLQ A;  4XF4 A;  5L7O A;  5CKN A;  1AF9 A;  4IDZ A;  2QKD A;  3LDB A;  4FO9 A;  4J1X A;  5FJK A;  1DFQ A;  1HQN A;  2D7F A;  3WQ0 A;  2WWJ A;  1LHV A;  3ELN A;  3ACI A;  4M0N A;  3TN9 2;  3SXW A;  1E5S A;  1WD3 A;  1RUE 3;  3L2Y A;  5GLU A;  2DCJ A;  3TAY A;  4QX2 A;  1PM7 A;  1KFX L;  4K40 A;  3HQX A;  4BCU A;  2GZW A;  2WJS A;  3OPT A;  3WHT A;  3OGV A;  4GKY A;  3WF1 A;  1AR9 2;  2BNO A;  5F5I A;  1QH7 A;  4MSV A;  1PO1 3;  1LOB A; 
#chains in the Genus database with same CATH homology
 2W1S A;  1R64 A;  3GXU A;  2RJ2 A;  4P02 B;  1XNT A;  2Y64 A;  4AAX A;  3OG2 A;  3VD7 A;  1F4H A;  1OD3 A;  2VZS A;  3A22 A;  2J1U A;  1OT5 A;  1SDD B;  2X05 A;  2WO1 A;  3A7Q A;  1PX3 A;  2VZO A;  3UES A;  4W50 A;  5A1A A;  3WNP A;  3DEC A;  3I3E A;  4XUN A;  2C26 A;  4ZZ5 A;  5JXG A;  2Y6L A;  4ZXE A;  1JZ8 A;  3CIH A;  1OH4 A;  3CZU A;  1JHJ A;  2DDU A;  1L7R A;  1KEX A;  4GZ9 A;  2J1A A;  3JXS A;  3VD5 A;  1EUU A;  1JYN A;  3T0D A;  1SG3 A;  3C7E A;  2VZR A;  1XPW A;  4IUG A;  4P5Y A;  1JU4 A;  1MPX A;  5FUI A;  1UZ0 A;  3MO4 A;  2BBA A;  4CU8 A;  2VTF A;  1GOG A;  3FN9 A;  1JZ2 A;  3ABZ A;  4ZZ8 A;  2ZXQ A;  2WZE A;  2BER A;  1JYX A;  2WAA A;  1W9S A;  4QX0 A;  4D8M A;  1GOH A;  2CDO A;  5B4X A;  3C7H A;  3P6B A;  1JZ4 A;  3ZM8 A;  2HYX A;  2YFZ A;  4KI5 M;  3FHQ A;  4TXW A;  3IB3 A;  1LNS A;  1SHW B;  2C4X A;  2ZEW A;  2B4K A;  2WYS A;  3K4Z A;  2WO3 A;  4BK4 A;  1J83 A;  1BHG A;  1PMJ X;  3ECQ A;  5DPN A;  2J1E A;  2E31 A;  2BGO A;  4UI9 L;  4QDR A;  2Y6H A;  3I2J A;  3T2P A;  3OGR A;  3WQB A;  4A42 A;  2YC4 A;  3WSO A;  4PQQ A;  2BGP A;  3WF2 A;  1TG7 A;  4QDQ A;  1CZS A;  2W1W A;  3IDA A;  3CKH A;  1CIY A;  5JUV A;  2J1S A;  3T0A A;  3WNO A;  3THC A;  2J22 A;  1I5P A;  4JKK A;  2VZV A;  1O8P A;  2WO2 A;  2VZU A;  3DYP A;  1HN1 A;  2DCK A;  3OEA A;  3WNK A;  4XVH A;  4E8D A;  2VR4 A;  3I2F A;  1XC6 A;  3ETP A;  3VDC A;  4UAP A;  3HPN A;  1JZ7 A;  2QBX A;  3W5N A;  4MOA A;  1US3 A;  4M4R A;  2VZQ A;  4BDV B;  1UY3 A;  2W46 A;  5C71 A;  1JU3 A;  3OGS A;  1K12 A;  3PUH A;  4JKL A;  3WF3 A;  2W1U A;  3NQH A;  1L7Q A;  2W9X A;  1GU3 A;  1W99 A;  3LE0 A;  5C7G A;  3K4A A;  4OYU A;  3WNN A;  3E1F 1;  1UXZ A;  2V4V A;  2VOT A;  1KGY A;  1WKY A;  3HNY M;  3I2G A;  1US2 A;  3WF0 A;  4ARY A;  4A41 A;  3LPF A;  2ZEY A;  5DQ0 A;  1EUT A;  2XON A;  4CUC A;  3MUZ 1;  1JZ6 A;  3UNP A;  1JZ5 A;  2PQS A;  4JKM A;  5DMY A;  2JKX A;  2RV9 A;  4PT6 A;  1GOF A;  2VMD A;  1UX7 A;  4KWU A;  2ZEZ A;  2WUH A;  1O8S A;  3GM8 A;  1PMH X;  2OKX A;  2VZ3 A;  1UY4 A;  4CUA A;  4A3Z A;  3WNM A;  5G04 L;  1NUK A;  2YFU A;  5EJZ B;  1K42 A;  4GWJ A;  3MV1 1;  4MO3 M;  1GUI A;  1YQ2 A;  3K77 A;  1H6Y A;  4W4Z A;  5EIY B;  4QX3 A;  2VZ1 A;  1OF4 A;  2W94 A;  4BK5 A;  2VCB A;  2HLE A;  2VME A;  3GGL A;  2W91 A;  1O59 A;  3DYM A;  2J1R A;  1UMI A;  2X09 A;  4CVU A;  3CQO A;  5LA2 A;  2VMF A;  3F2Z A;  3BGA A;  3FL7 A;  5J1X A;  4XUR A;  3ACG A;  1CX1 A;  3P1I A;  1ULP A;  4OUE A;  4W8J A;  1NX9 A;  3C8X A;  2QQO A;  3ACH A;  2RVA A;  4QB6 A;  4AG4 A;  5B4N A;  3VD9 A;  4QX1 A;  5IHR A;  3I3B A;  4JHZ A;  3HNM A;  2ORZ A;  5LA0 A;  3SKV A;  1W0N A;  2Y6J A;  5JR2 A;  4QPW A;  1GQP A;  2EIB A;  4Z2A A;  5HPO A;  1J84 A;  4XZU G;  2WZ8 A;  1UY2 A;  4XUT A;  5IJR A;  1GMM A;  3C7F A;  2JDA A;  1NKG A;  3BN6 A;  4UOJ A;  4MAD A;  1K3I A;  2X10 A;  1DLC A;  1RYY A;  1CZT A;  4D0Q A;  3I2H A;  3U37 A;  2WN2 A;  5JMO A;  2JD9 A;  3W5M A;  3IAQ A;  5JXJ A;  2VCC A;  3HEI A;  1D7P M;  2W1Q A;  1W9T A;  4P00 B;  5LA1 A;  1F4A A;  3OEB A;  4BXS V;  3IAP A;  1UY0 A;  4L0P A;  3UET A;  1UWW A;  4DUV A;  1W8O A;  2B9V A;  3CDZ B;  5C70 A;  3SEP A;  2KD7 A;  1DYO A;  3I3D A;  2WDB A;  3C7O A;  4DXT A;  3LEK A;  1T2X A;  4JX0 A;  3DYO A;  2E33 A;  2WAO A;  2VZT A;  2QQJ A;  1TVG A;  4XUP A;  5F7U A;  4LQR A;  4DUX A;  2W92 A;  1W8N A;  3D3A A;  4RN5 A;  3SEE A;  4PF1 A;  1UY1 A;  2WN3 A;  3I2I A;  2VC9 A;  2L9L A;  3NJX A;  4DEQ A;  3WEZ A;  2ZEX A;  3MUY 1;  4BJ0 A;  3EB7 A;  3C7G A;  2Z4F A;  3K75 B;  3VD4 A;  2R7E B;  3VD3 A;  4RYD A;  5IFP A;  2WBK A;  3EYP A;  4A45 A;  4E8C A;  5JXI A;  1ULO A;  3LEI A;  4HG6 B;  4ARX A;  2WQ8 A;  2LW8 A;  5HXM A;  2EIE A;  2W95 A;  1W9W A;  3T09 A;  4ZY9 A;  3A23 A;  4CU7 A;  1OF3 A;  2YB7 A;  2CDP A;  3THD A;  2QQI A;  4OZO A;  2JE8 A;  4A44 A;  4DXR A;  3I97 A;  3HN3 A;  3NRU A;  3T08 A;  2QQK A;  5CYY A;  2E26 A;  4MGQ A;  3CZJ A;  3VDA A;  2C9K A;  3WNL A;  5JXH A;  3III A;  3SKJ E;  3A21 A;  2VMC A;  1H6X A;  1PX4 A;  4DXS A;  1CZV A;  1UYX A;  2YG0 A;  2XOM A;  2J1T A;  1JYW A;  2W47 A;  3OB8 A;  1NAE A;  5I0D A;  3MV0 1;  1K45 A;  2Y6G A;  2V5D A;  2VJX A;  3NNG A;  4QB2 A;  2QQM A;  4M4P A;  2VZP A;  3AC0 A;  3K46 A;  3LEG A;  3HNB M;  2VL4 A;  4P08 A;  4YPJ A;  2VQU A;  1UMH A;  4ET7 A;  5IFT A;  1UXX X;  4DEV A;  3K4D A;  4LPL A;  4QB1 A;  2XHN A;  5G05 L;  5DN2 A;  1JI6 A;  2QQN A;  1JZ3 A;  1P8J A;  2QQL A;  2BZD A;  2Y8K A;  4OMD A;  3MBW A;  4XUO A;  4MGS A;  3GDB A;  3T2Q A;  3LQC A;  4CU9 A;  2YC2 A;  1GNY A;  5EJ1 B;  4CUB A;  4QDS A;  1JYV A;  2E32 A;  3LPG A;  3NJV A;  4LHS A;  4FI9 A;  2Y6K A;  2ORX A;  2W3J A;  4A6O A;  3VDB A;  1XNA A;  3J7H A;  4XUQ A;  3CMG A;  2XQX A;  4A4A A;  4GWI A;  2VCA A;  1IQD C;  4DUW A;  3FHA A;  2VQT A;  2VM9 A;  5LCW L;  2J1V A;  2V72 A;  3I2K A;  2ID4 A;  2EIC A;  3WF4 A;  1UYZ A;  2VO5 A;  2J7M A;  1WCQ A;  3PUI A;  3HOB A;  4OMC A;  3OBA A;  4TTG A;  3T0B A;  4QAW A;  2W5F A;  4KMQ A;  3ACI A;  4LKS A;  4CU6 A;  1UYY A;  5CZK A;  3HJR A;  2DCJ A;  2LS6 A;  4QX2 A;  2WAB A;  1DP0 A;  3ACF A;  2EID A;  2W87 A;  3OGV A;  3WF1 A;  5IYY A;  3T2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...