4QB1A

Structure of cbm35 from paenibacillus barcinonensis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
GTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
molecule keywords Xyn30D
total genus 29
structure length 128
sequence length 128
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb1A00
1H6XA 3T0AA 1JZ8A 2Y6JA 1DP0A 3A21A 4QX1A 4LPLA 2E32A 4KI5M 5CYYA 2HLEA 3SEEA 2ORZA 2J1TA 4P02B 3T0BA 3WF2A 2VJXA 2J1VA 2OKXA 4P5YA 2VL4A 4P08A 3VD9A 3K4ZA 3LEKA 4MGSA 2WQ8A 2WABA 4RYDA 4W50A 5B4NA 4JX0A 4FI9A 2B4KA 4TXWA 3UETA 2VCBA 1UX7A 3OBAA 2WZEA 1CZVA 4GWJA 1GQPA 2QBXA 1GU3A 3EYPA 2J22A 2QQJA 3WF4A 3E1F1 3MV01 3C7GA 1UYZA 5IHRA 1W0NA 1JU3A 3UNPA 3A7QA 4QX2A 2J1AA 1JZ4A 2WN2A 3F2ZA 3FHAA 4W8JA 5HPOA 2ZEYA 4XUOA 3WF1A 4MADA 1MPXA 1UXXX 2VZQA 2XQXA 3NQHA 4QX0A 1JZ2A 2W9XA 3BN6A 3T08A 2WO3A 3T0DA 3THCA 1PX4A 2VMDA 2DDUA 3EB7A 2JKXA 2VZUA 2X10A 3OB8A 3MUZ1 5I0DA 4CUBA 2J1EA 2CDPA 1R64A 2X05A 3C7FA 3IAPA 1RYYA 2VQUA 3LQCA 4OMDA 1O59A 2C9KA 3HNBM 4ARXA 3VDCA 2Y6GA 5JUVA 3MBWA 5JR2A 2W94A 4AG4A 4DXTA 1F4HA 1NUKA 2RJ2A 2VZTA 3P6BA 2J1UA 1UXZA 2LW8A 1BHGA 2WO2A 2VZSA 3WEZA 3DECA 2YG0A 5C7GA 3K4DA 4PT6A 2Y64A 2W1WA 4AAXA 4XUNA 3I2IA 2Y6LA 1W8NA 3WSOA 1OF3A 1XNAA 2W47A 3BGAA 2VZ1A 2VOTA 4BJ0A 3I3BA 3IAQA 2JD9A 2WAOA 4CU6A 1JHJA 2VZ3A 2WAAA 3VD5A 1L7RA 4BK5A 4A44A 2B9VA 5IYYA 1PMJX 4QDQA 5IFTA 2W5FA 2QQKA 3T2PA 3CZJA 2W92A 2ZEZA 5IJRA 1JZ3A 4XUTA 1JZ7A 3CDZB 2YC2A 3WNKA 3W5NA 2WN3A 3HOBA 1GOHA 4A6OA 1YQ2A 1UYYA 5LA0A 3OGRA 5JXIA 2DCJA 2W1SA 3AC0A 3T2OA 4LHSA 4RN5A 3HEIA 1OF4A 3VD3A 5DN2A 4CU9A 2E33A 2XHNA 3C8XA 4XVHA 1CX1A 2WBKA 3I97A 4P00B 2YFUA 4OMCA 3SKVA 1P8JA 1ULOA 3IIIA 3I2GA 1GMMA 4UAPA 3K46A 2KD7A 1UWWA 1T2XA 1JZ5A 1US2A 2QQOA 4A4AA 2ID4A 4JHZA 2ZXQA 3FHQA 1O8PA 4DXRA 4HG6B 3I2FA 3HJRA 1GOFA 3VDAA 3FN9A 5DMYA 2BGOA 1UZ0A 3GGLA 1W9TA 2QQNA 4A45A 4E8DA 3OGVA 4KMQA 1CZTA 2V5DA 1W9WA 1OH4A 2QQIA 2CDOA 2J1SA 3VD7A 3LE0A 2EIBA 4ARYA 3OGSA 3WNMA 1JYWA 1JZ6A 1O8SA 1WKYA 2V4VA 3W5MA 1W8OA 2QQMA 3A23A 4A3ZA 3A22A 3K77A 4D8MA 2JDAA 2XONA 3C7EA 1UYXA 4LKSA 3LPFA 3CIHA 5JXJA 3NNGA 1JYVA 3OEAA 3ACIA 2VMEA 1K3IA 3VD4A 4MGQA 1NX9A 3PUIA 2VR4A 1KGYA 3CKHA 5G05L 4DUVA 3WNLA 5B4XA 5JXHA 1OT5A 4CUAA 4A42A 1UMHA 2E31A 3IB3A 4GWIA 4A41A 3ZM8A 2Y8KA 3FL7A 4OYUA 1TVGA 3MO4A 4KWUA 2HYXA 4BXSV 4TTGA 2PQSA 5DPNA 3WNOA 2EIDA 3I2HA 3GM8A 3LEIA 2BERA 5C70A 1W99A 1SG3A 2YFZA 1W9SA 4Z2AA 2BZDA 2J7MA 3ACGA 3VDBA 3K4AA 3SEPA 2W87A 2VZRA 2Y6HA 1K42A 2W1UA 1F4AA 1SHWB 2ORXA 5JMOA 2C26A 4ZZ5A 4QX3A 3J7HA 1UY3A 4QB1A 1KEXA 4PQQA 3DYOA 5LA1A 3CMGA 4MOAA 1CIYA 3GDBA 1US3A 4ZY9A 2VM9A 1L7QA 1LNSA 4QB6A 1UY0A 2JE8A 3U37A 3UESA 3WNPA 4QPWA 5FUIA 1JYXA 2ZEWA 3DYMA 1CZSA 4XUPA 4CVUA 3T09A 2J1RA 1OD3A 1UY2A 2EICA 1XNTA 3D3AA 2VTFA 4OUEA 1XC6A 5F7UA 4ZZ8A 1IQDC 2W1QA 3MUY1 4IUGA 4M4PA 3I2JA 2WUHA 2XOMA 1JU4A 2WDBA 4YPJA 3HNMA 1J84A 4E8CA 3P1IA 5EJZB 4OZOA 4CU7A 5C71A 3LEGA 2DCKA 1DYOA 5EJ1B 3HPNA 1DLCA 4DUWA 1SDDB 4QDRA 4XUQA 1ULPA 4BDVB 3T2QA 4QAWA 2VMFA 2W46A 3I2KA 2RV9A 3K75B 4W4ZA 4D0QA 1J83A 3C7OA 5HXMA 2QQLA 4DUXA 2X09A 3NJXA 4JKMA 2WZ8A 3HNYM 1NAEA 4ZXEA 3WF0A 4PF1A 1UY4A 2W95A 4CUCA 4LQRA 3LPGA 2L9LA 2VCCA 5EIYB 1H6YA 3JXSA 4XURA 5IFPA 1JYNA 1EUTA 4UI9L 3PUHA 3THDA 3HN3A 3OEBA 4ET7A 5CZKA 5J1XA 2W91A 2VO5A 3MV11 2V72A 3ETPA 3ABZA 3I3EA 4QDSA 3CZUA 3NRUA 2WO1A 4JKLA 2Y6KA 2VZOA 2R7EB 4MO3M 3CQOA 2EIEA 1PMHX 1GOGA 2VZVA 3DYPA 3NJVA 5G04L 1WCQA 1D7PM 4DEVA 3ECQA 3OG2A 3I3DA 3SKJE 3GXUA 4M4RA 2WYSA 2YB7A 5LA2A 2BGPA 2VCAA 3C7HA 4GZ9A 3IDAA 4XZUG 4CU8A 2VC9A 3WQBA 1EUUA 2LS6A 2VQTA 4QB2A 5JXGA 4DXSA 2ZEXA 3ACFA 2C4XA 1XPWA 2VMCA 1PX3A 1JI6A 2Z4FA 4JKKA 3WNNA 5A1AA 3WF3A 1I5PA 1K45A 1UMIA 1UY1A 2RVAA 3ACHA 1TG7A 2W3JA 5LCWL 1GUIA 2BBAA 2E26A 4BK4A 2VZPA 1NKGA 4L0PA 4UOJA 1HN1A 2YC4A 5DQ0A 1GNYA 1K12A 4DEQA
chains in the Genus database with same CATH superfamily
1H6XA 1NYWA 5DZGA 3T0AA 2Y6JA 1GNHA 4QX1A 3VZKA 4FBFA 4YW7A 4HSLA 5FMDA 2JX9A 2J1TA 3ENRA 3KLSA 4QM8A 3T0BA 1POV0 3GZTB 5EQUA 4YW4A 2VJXA 1RVF3 2IXJA 1R1A2 4P5YA 4PDWB 4LBQA 1MS1A 2Z5WA 2DUPA 1ZRRA 3VD9A 4BQ4A 4XJAA 3JB4C 5DDJ2 3VZMA 4CEYC 1SCRA 4RR3A 2MPFA 4UFIA 3DPRB 3M3EA 4HPKB 2CGOA 2HWB2 4K21A 1PO23 2JDPA 2BYVE 3VHRA 2ZZJA 3S7EA 1JYCA 2PELA 5FZOA 3ILNA 3NV3A 3ZPOA 1W39A 2JG8C 4QMAA 3UETA 2VCBA 1AYM3 2R063 3SQOA 3MIBA 4Q4W2 4Y3OA 5CKNA 5FBJA 1W6PB 4Q4V2 2QBXA 3ILFA 5C4WA 1FX5A 1GU3A 5FYCA 3HD8B 2J22A 4MGKE 3E1F1 2FDJA 3C7GA 2X5IA 2Q1ZB 1O3QA 1QJX2 2MNGA 1W0NA 3WG4A 4COVA 3A7QA 1URXA 1W0OA 2A71A 1LOAA 2WRAA 1GQHA 1X50A 4LBJA 4MHRA 4QX2A 4B4QA 1JZ4A 3ZXLA 4OZXA 1BBT2 2AGSA 3DKWA 2YUEA 5KHJA 5CFDB 4QGLA 3ES4A 4WVMB 1YJLA 2Y34A 1QJY2 2GH8A 5LZ6A 1CPMA 2I74A 1XXNA 2Q4SA 2Q8OA 2D6OX 1UXXX 1YWKA 2OZ6A 4QPIA 2VZQA 2X8KA 4COUA 3NQHA 1V9U1 1AUYA 1PM7A 2JD4A 4GMP3 4DY5A 5AFEA 1PO21 1JZ2A 4AEDA 4DXZA 2ZX1A 5FZ8A 3SC7X 1PX4A 4OFGA 3ZXEA 2EVXA 2BOJA 4Y1XA 2ADDA 3BYWA 3EB7A 4Y22A 2JKXA 3ASIA 2BFUL 3HIFA 2R073 1JW6A 4P9WA 1C5IA 3GJAA 2QQPA 2AR6A 1QOTA 5ANQA 3UYJA 4NRMA 3C7FA 4UFHA 1DQ5A 2RMU1 1A34A 1PIV2 5IVJA 5JZGB 1D4M3 5C3QA 1OLRA 2ZX2A 4ZONA 2G9FA 1O59A 3AYEA 1W9YA 1V00A 1DF0A 3Q9OA 4Z07A 4ARXA 5C5UA 2YPDA 4QPGB 1I6XA 4KU8A 4UFJA 4YGEA 2Y6GA 2UYAA 1FXZA 2D3SA 4XAEA 2W94A 1HV0A 5KXDA 1F4HA 1DQ6A 5C3PA 1OUXA 2RJ2A 3VB9A 2VZTA 4F3JA 1QGLA 1UXZA 1E57A 1HV1A 1F31A 2MEV2 4R9CA 3TN93 3DECA 3ROUA 4CP1A 5GALA 5FO9B 3K4DA 3B69A 2ADEA 2E7AA 1H0BA 1GFF2 1CAWA 4MH0E 3MEPA 5FKCA 3WCSA 1VRH3 5JZGA 5D8AB 4XBLA 3I2IA 3H8UA 1HDKA 2R1BA 2W47A 3BGAA 3ORJA 4HVOA 5FBZA 1BYHA 3NW4A 2FMYA 1W03A 2A6VA 2VOXA 4Q4Y1 4Q8LA 3H7JA 4Y24A 2PHFA 5IVYA 1NZCA 4HK8A 4NVPA 1PK6C 5FYZA 2VZ3A 1Q56A 1H1MA 3VD5A 3N9PA 1L7RA 3POJA 4XIKA 1FATA 4ISRA 2OPKA 4QKNA 2YBPA 4OHZA 1H9PA 1NT0A 1RVF2 3BU7A 5CVRA 4BE3A 2ZX4A 4QDQA 5ACA1 2W5FA 4MHUA 3T2PA 1PZ7A 1H1IA 3ZYFA 3SXWA 4Z2WA 1JZ3A 1JZ7A 4EN6B 4JGYC 3CDZB 5B2GB 3WW3A 3W5NA 2XJUA 2UY8A 4KGQA 4YWAA 3ZMNA 5FPBA 2WN3A 1AYM2 2RM23 2H0BA 2LUWA 1GOHA 4ES8A 1XQNA 3TOJA 3WUDA 3UL2A 2CV6A 3NKGA 5BNPB 3OGRA 3UJOA 4F8AA 4H7MA 4NIGA 3AC0A 4BB3A 1M4WA 4M0HA 4P9GA 5CISA 4IE7A 3O1UA 3BKZA 2XWJB 2RDQA 1AJOA 3R6SA 1HLCA 1FMD3 2R041 2QQVA 1N47A 2XVKA 5LBFA 4FPFA 1OMIA 2NLRA 4P00B 4UF0B 3MFAA 2VNOA 2E63A 5C5TA 2G1MA 2HWC3 2NN8A 4OMCA 5L36A 1FYUA 4O65A 5LWBA 4R52A 2FBEA 1QY4A 1ULOA 4LK7A 4UAPA 4JC1A 3K46A 3POWA 4NHKA 4IL7A 3RGBA 3O7OA 4CDXC 3HT1A 1ZZCA 1S0DA 5DZEA 4HT1T 4JHZA 1UF2C 2ZXQA 4GAZA 5HBAA 2EF6A 5A6XA 4WZFA 1O8PA 4CCCA 2YPJA 4H2AA 1RL3A 1UU5A 3O12A 1LOCA 1MVEA 1RUJ2 5D8AA 5FP7A 2PAEA 3AMMA 4HONA 5L73A 3VBRC 3ZSJA 2PHUA 4YW1A 4AZZA 4CZSA 1AJKA 3IIAA 2Z2SB 3FN9A 1PVC3 1UZ0A 1SCSA 4BH9A 3UKTA 4E4HA 3OY8B 1AVBA 3AZZA 1O5UA 1B35B 1CWPA 3W58A 1H8TB 3G7DA 3S0MA 4KL1A 1EYBA 5DAWA 5FYUA 1UKRA 5FZ1A 4XETA 3RNSA 3JQWA 3OY8A 3AP7A 1OH4A 2VE1A 4QPGA 4AQ2A 3TNPB 1YEWA 4HKOA 1RUC1 3SISA 3O0WA 2A73B 2WNUC 4F7ZA 1CJDA 2G19A 5KHKA 2WNUA 3WINE 1MVQA 1F15A 1V6IA 3WNMA 1JYWA 4LE3A 4M3CA 4Q2FA 4NE9A 3P3NA 3RZMA 2D5HA 2VBPA 1YI7A 1RINA 1FV3A 3B94A 3VBOC 1WKYA 2PFWA 2V4VA 4KWJA 3W5MA 1ZRDA 1BMV2 2RR12 4JCKA 2DWRA 3ZKYA 2D6PA 2TNFA 4NIDA 5K9YA 3MF6A 2HWC1 3A22A 1FI2A 4D8MA 2JDAA 1UZWA 4LO8A 1GZWA 4M00A 4UFMA 3SCFA 2XONA 4ZU5A 5T52A 3ZIWA 1RHI1 1N3OA 1CAXB 1CR7A 2DTWA 3GF6A 4KG8A 2A6WA 2VGDA 3LPFA 4K9SA 1LOGA 2JDUA 5JXJA 3NNGA 1ND2C 1JYVA 4YZ3A 1PGSA 3OUIA 4LIVA 4MG2A 1Y43B 4MGZE 2GH2A 4OI4A 4COZA 3T1LA 1IPJA 2HWE3 3CF6E 3OOXA 3PUIA 2PLV2 3VHOA 4DUVA 1CONA 4IESA 5HXVA 1Z7S3 1XSQA 3MIEA 2UU8A 3I8TA 5B4XA 3EHKA 2ZGSA 4MUVA 1VBD2 2E31A 2WFPA 5FTTC 4FPJA 4A41A 1ND2A 2E7TA 4UW6A 2JEMA 2OIIA 2R30A 3T4HB 3ZM8A 1W8FA 3K3OA 5IW0A 1WW4A 3BTXA 1VBD1 2R043 4KWUA 4BM8A 1MQTA 5FR3A 2WA3A 1X9PA 3WW2A 3WNOA 1UPIA 1FNYA 3S57A 1Y9MA 3AFGA 2EIDA 4H7LA 3GM8A 4Q0UA 1EV11 1UX6A 4PIYA 2BERA 5FYBA 2WWJA 3LDRA 4LHLA 2DVFA 5GZDA 4N7IA 4DZGA 1SG3A 2ZA9A 5FZAA 3DPRA 1LECA 1UAIA 3NKTA 3VDBA 4ZS3A 5IK5A 4LO6B 3K4AA 4GB33 1VRH1 2VD7A 5J37A 5FMOS 4NHXA 4FFGA 1BVP1 4P9XA 5LRSA 1YQ8A 1BMV1 2XXZA 1W6QB 5FZ3A 5GLUA 4ZU7A 5JIAA 1OVSA 1D0GA 4NWWA 4G9SB 1QJY3 4YGCA 5EYXA 4LBLA 1QKQA 2XKOA 4JGZC 3USUA 5BNNA 4PQ9A 1VB2A 4AGGA 1UY3A 5CNAA 1HQNA 5LA9A 3N9NA 3PTRB 1KEXA 3E5QA 2PLV3 1PVC1 4NROA 2IXKA 4R9BA 1DZQA 1LESA 4E2QA 1TEIA 2HEWF 1VIWB 3GDBA 5IAVA 4ZY9A 5L9RA 2IVIB 2YHJA 1LNSA 2P3YA 1R092 3O0XA 2GMEA 2P4EA 4I0BA 1UMZA 4QGNA 4QB6A 2HBTA 1UY0A 3RWKX 2JE8A 2XUEA 3G6JB 3MIGA 1AR62 4D6RA 2GSYA 4CXWA 5DAVA 1JYXA 2RS51 1VPHA 1GP6A 4CVUA 4CDWA 2D43A 3KT4A 3E97A 3RYRA 1UU4A 3WP6A 1LGBA 2DYCA 2EICA 1DU3D 4QXKA 3ZXAC 3D3AA 4RQPB 3WOGA 4AFBA 4ZZ8A 4GWNA 4IEVA 2FZ1A 5ABJC 2W1QA 4JDNA 1J3PA 2JKBA 3J8F3 3I2JA 4MYEA 1VBC2 5SV5A 3WD5A 4JGYB 1JU4A 1EY2A 5A3TA 4GJZA 2OA2A 4LTAA 2VXRA 1IKQA 2KR2A 1J84A 2B7YA 4SBVA 1PO12 4YGDA 4CU7A 4YM1A 2A1XA 2P1BA 3LEGA 4X6QB 2PMWB 2FQPA 2DCKA 2QTWB 5FY4A 1KRIA 1ND3A 4XILA 1DLCA 3T3YA 3B01A 3WXPA 3FX3A 3MW3A 1ZZBA 4XUQA 4D6QA 5CFCC 3B3QE 1LOFC 4CEYB 4Y20B 2W46A 1RC6A 3I2KA 4HK9A 1AYM1 3PUQA 4Q0QA 4SLIA 3I49A 5FJKA 1QXPA 3V0BA 1H1AA 1PVC2 2VNGA 3TYJA 3C7OA 1BEV2 5HXMA 2X09A 2VTXA 1VBA1 4M3CB 1HB4A 2B39A 2Q30A 2ENRA 4PF1A 5F3EA 1QDOA 2BDRA 5I0SA 3BI3A 5HCFA 2TUNA 4I3PA 1G9BA 3CL1A 1JN2P 3OGGA 3J8F1 5I8TA 1AX0A 3JB8A 3O14A 1PNFA 2QE3A 2VCCA 4O9EA 4XE9A 1NXD1 4YW6A 4PF5A 4CDUA 3ZFFC 1H8VA 5F5IA 5FY8A 3O1OA 3ZYIB 3VUOA 1OOPA 5GZEA 3V64A 3B9CA 4IETA 1CQ9A 2QKDA 1ODNA 2CNAA 2AREA 3KCCA 3KQ4B 4FSJA 1NLSA 1FV2A 2JENA 4RFT0 1KFUL 4PBOA 3DEMA 5A32A 1DFQA 3S5AA 1EAH2 1TMF2 3HN3A 4HPKA 3Q8AA 4KWKA 3UT0A 5A70A 5CZKA 3H1MA 5FPVA 2BPA2 2ZPXA 1QOOA 4R8HA 1ND2B 4HL0A 2NP0A 3F95A 2WS91 3I3EA 1F5JA 3WW4A 3KM5A 3N4MA 2Y26A 5GM0A 4MO3M 3ZFGC 1W06A 2EAKA 3ZFFA 3A0NA 1SMVA 4JHTA 1WLWA 1PMHX 1GOGA 2EIEA 3NJVA 2HWC2 4LUMA 5E8AA 1ENSA 5G04L 1Q8QA 5FZEA 4AAPA 4BHPA 2XL7A 5I8SA 1O3SA 1N1YA 4LITA 4LULA 3FE5A 2DFCA 3PDQA 2WSUA 4LUKA 3GXUA 4Y5SA 1K42A 2GMMA 2WYSA 5LBCA 3CJIC 1CAVA 4LMFA 4N8MA 4FFFA 4RS5B 5CU1A 5JOYA 3C7HA 1K5MB 3ACLA 2FDHA 4GZ9A 4FFIA 1SEFA 3N9OA 4Y4RA 5T3NA 1PVXA 2VQTA 4AQ6A 4XXAA 5JXGA 3I3MA 1ZA7A 3PHMA 2ZEXA 1PM4A 1D2QA 1DQ1A 4XF9A 5EHDA 3BVCA 2OZJA 5IVBA 1PX3A 4GA9A 4BISA 4JRLA 1GICA 2RS31 1JI6A 4YG3A 2WR9A 2RMU3 2XLFA 4JKKA 2MEV1 2QZ2A 3D6EA 5A1AA 3JD72 3THTA 5FY1A 3AJYA 4BU2A 4EWAA 3WF3A 1HN0A 4Q26A 2D6MA 1UW8A 1HB2A 1I5PA 1K45A 1UY1A 3OPTA 1JH5A 3OUJA 3WT3A 3ZLIA 5FZGA 5LCWL 1GUIA 1MR5A 2E26A 2WNEA 3DL3A 4FOWA 5DXDA 5T50A 5DG1A 1H2LA 4RS5A 3VBHB 1IS4A 4BK4A 2XJPA 2YC4A 2WNVA 2BTVC 4KGGA 5E1RA 1XJAA 4LIUA 1OLMA 2VW0A 2XJTA 4AFCA 1AX1A 4FXKB 2AEYA 3VBSA 1LHNA 1PGW1 4BLJA 3UGHA 3KV9A 4BXFA 4KI5M 3WX5A 4ISQA 4LKDA 2HLEA 3SEEA 3SLIA 1WUVA 3R4UA 5A7WA 3USUB 4LLFA 2JG8A 1DG6A 1X9TA 5FO7B 1ZX5A 4IQPA 3WDVA 4IXLA 2HJIA 3H3LA 2RDNA 4P14A 3MIDA 2GDFA 2DF7A 5LATA 1ENQA 4HETA 4KH9A 1WW6A 3K4ZA 2NYYA 1K5JA 3NO8A 4COWA 2WQ8A 2WABA 1LGNA 4XFGA 1F5FA 1O4ZA 3AM2A 1FOD2 4RYDA 5B4NA 5FZFA 4Y5TA 3K48A 4JX0A 5FLHA 2Q8DA 3O0VA 2DCTA 1QJZA 3KWVA 5FY5A 1JOJA 2DVDA 3RYKA 1ASJ2 1QEXA 3FZ3A 3VZLA 4BQXA 2VNVA 3ZSMA 3MV01 5IHRA 1UYZA 4OLLA 1W6MA 5AC93 5HCHA 4HLTA 1JU3A 1VBB1 4WM7A 4HN0A 4Y1VA 1UYPA 4N53B 1GKBA 2JE7A 3OD0A 3K3NA 3M2MA 4M3CE 3NV2A 1AYN3 1RMU1 2YGLA 1VBB2 3CNAA 3ZYBA 3MPPG 1A3KA 1WCUA 2VMGA 4DY3A 2UYBA 1AXYA 4UWDA 1EAH3 1C4RA 1W8TA 4I0WB 5A7QA 1VBE2 3F2ZA 4W8JA 2HWF1 5HPOA 3PTYA 4MADA 2RR13 5K7PA 1MPXA 4FPGA 1WBLA 3QH7A 3WG2A 2XQXA 3SHRA 1BVVA 3BN6A 4UW4A 2WO3A 5E88A 4J1WA 5GLZA 2VMDA 5FP3A 3ZR6A 3MYXA 4AQSA 1NY71 2QDNA 2ZGQA 3VBRB 3ZFFB 1LENA 4MXWA 3FLPA 5DUXA 1RUF3 1R64A 1GP5A 2OUJA 1W28A 4JDMA 4X6RB 4H14A 5DDJ1 1MQTC 3KHBA 3OD4A 4OUMA 1MEC2 3IAPA 1SLAA 4AGRA 5FPXA 4NAOA 4LR4A 4NO4A 2BRTA 2C9KA 3W9AA 1RUG1 4YVWC 1SBFA 4UW5A 1LEDA 4YVWA 3W21A 3ZXFA 3Q8FA 1O91A 4W6YA 3MBWA 1Y9QA 4PI0A 3RS6A 4AG4A 3BB6A 5BY5A 4YVSC 1MS8A 1NUKA 4DB5A 2OT7A 1QU0A 1RUD3 1BCXA 3P6BA 3MIFA 2QJVA 2GAUA 4W6WA 1RUH2 4HMZA 1X7NA 2B45X 2LW8A 3ATGA 1BHGA 3OPWA 3WEZA 2OS2A 3WW1A 5EPAA 3RZHA 1Y9GA 3OF1A 1LOBA 1MS4A 4AF9A 4AVVA 2XJQA 1NA1A 1TE1B 2VNRA 4PT6A 5FP4A 5JLVA 3WQ1A 4AAXA 3CLPA 2JDHA 3K51A 4RS5C 4V2WA 3V0BB 2Y6LA 5CBLA 4BZ4A 1XNAA 4G3YC 1DDLA 5FMCA 3I3BA 1VBA2 2JD9A 1G6NA 2ZS6B 4IDZA 2ZGMA 3GALA 4CEYA 5I0UA 1JHJA 1AZDA 3SH5A 3S6PA 3JCIA 4K1YA 3SITA 1E5IA 3B93A 3KB5A 1ZZ8A 3VL8A 4S2GA 1AX2A 3VN4A 4NUBA 2PHTA 4BK5A 2OXBA 1SLBA 2WT0A 4IEOA 4J6GA 4A44A 3LF7A 1Z7S2 2B9VA 3LOIA 4AEKA 1SFPA 3WHUA 1FPN1 5TSWA 3HQUA 2GN3A 5IYYA 4UFLA 1APNA 5DUVA 3H8XA 1S2EA 3VBOB 3GYDA 1REEA 4P5HA 3VBHA 3CZJA 1DYPA 2XWBB 2HWB3 1CAUA 2LROA 5EP9A 4D3WA 1NQJA 1MZFA 3VBSC 3AXEA 2RS53 2YC2A 3SCGA 3LFIA 3VKLA 5FZLA 1Y4WA 5DUWA 5FZ7A 3OBZA 2NZ9A 3WG1A 3DF0A 3LAGA 1UYYA 2JECA 5LA0A 5JSOA 1RUNA 5JXIA 2DCJA 1CESA 2XLAA 1D2SA 3LA7A 3OBRA 4LHSA 2YU2A 4HVQA 1VAKA 4WM8C 2VH9A 5E6HA 3HEIA 1GP4A 2WC2A 3I4IA 3VD3A 2E33A 1RB8G 4FTBA 2ZX3A 2VVFA 5F8PA 5A3OA 3KQRA 3KZ4C 4IERA 3OGJA 1CVNA 1YFUA 1VBC3 4FFHA 1RXFA 2YFUA 4JRAA 1U5YA 4YZ5A 4Z92B 3RI8A 1UOJA 3SKVA 2ARAA 5FREA 2RS12 3PL0A 1OXCA 1P8JA 1U5XA 3I2GA 4N43B 1UZYA 1GMMA 2BJSA 4CA9A 5GKAC 1PIV1 5FPAA 2A7AA 1T2XA 5A7SA 1JBCA 1OQ1A 4YARA 2QQOA 3LEMA 1WD4A 1U12A 4YRDA 2RE9A 1W6NB 2GU9A 5A7OA 2K2SA 1SPPB 4HG6B 2JWPA 4XMAA 4BQ1A 1JS9A 1XBFA 1XB9A 3I2FA 1BK1A 2RJLA 2VBDA 4CSWA 4ES9A 3ZSLA 4QWNA 4Z1VA 3HJRA 4Q4X3 3WP3A 4AHYA 3LB9A 4TN7A 2BGOA 4I0AA 3WP4A 1XNKA 2ZMKA 1BEV3 4PBPA 4XEZA 1F8VA 1W9TA 5H9RA 4JQRA 3JZVA 2ETEA 2HYKA 3JD73 5LASA 3OGVA 2P2KA 3JUUA 4KMQA 1VBD3 3IBMA 3ZYRA 1SFYA 1MZ5A 4LA2A 2QQIA 4LLOA 4U2AA 5FLJA 4B29A 1U5ZA 1FMD2 3JQXA 3VD7A 2RMU2 2VTXJ 3ZFEC 5IAXA 3ZIXA 3OGSA 3RPQA 4A3XA 1LEMA 1C1LA 1JZ6A 1GYKA 2AZ5A 3BODA 3POGA 4Q4Y3 1W8OA 1Y3TA 3KV4A 5EJ3A 2WFF1 4Y26A 3L2HA 2DVAA 1NG0A 4MXWB 5L19A 2NM1A 4XW3A 3U4XA 2GALA 1PHMA 1RXGA 3C7EA 4J1XA 2H6CA 1NZIA 4LO7A 1UYXA 4RGKA 3ZX7A 3WQ0A 1STMA 3KCYA 5K8SA 4GB31 2XBO2 3KV5A 2LM3A 3PVBB 4INDA 1ZREA 4FP3A 4IE4A 1RUF2 2ZGLA 5LRRA 4QD2A 3AKQA 2FCVA 5JOWA 2D98A 5EZWA 2XBO1 4DO0A 1JYTA 3S7IA 1KGYA 4JGYA 5A7PA 3CKHA 5G05L 4QX5A 2WKKA 4EN7B 4Q0PA 1QH7A 4AFMA 1HKDA 1AL0G 3POYA 5JXHA 5BNPA 2V73A 5LY1A 3QACA 1RUG3 4LBOA 1UMHA 3IB3A 2P6HA 3NAPC 3VKOA 3NV4A 4BQ5A 1SLTA 1GSLA 1DQ0A 3AKTA 2Y8KA 1A8MA 3TRSB 1TVGA 4L99A 4NHMA 3VHPA 1BBT1 2MEV3 5DAQA 1S2BA 1BBT3 1W6OA 3ZVXA 2Q8EA 1VBB3 1VMFA 4OHVA 4Q29A 1H2MA 1WMDA 1NCQA 4ITCA 4XF3A 5FXXA 1MS3A 3I2HA 5BNNC 5C3SA 3LEIA 5JDBA 3MZHA 1RUH1 3PU8A 4V1PA 2CL2A 4X8PA 1QOSA 5FY0A 5C70A 1KXGA 4OULA 4XDOA 2YFZA 2W2IA 1W9SA 1FAYA 2UWBA 4FOYA 2A3WA 2W08A 2YROA 3ZFGB 5JR2A 5JOXA 4FTSA 3S30A 1Z0HA 1O6UA 5K0UB 1UZVA 2RR11 1LULA 4LEJA 4CDXA 5A6QA 1PO11 3AVSA 4OVEA 2F17A 1EPWA 2X5IC 4IV3C 4NHLA 3LA3A 3IPVB 4AHZA 5F6LB 3EJKA 4OI0A 3M8LA 5JMOA 1SPPA 2C26A 5JI9A 4UYBA 4NR1A 1ZA4A 4XC9A 2P6CA 5F32A 5K0UA 4QB1A 3PU3A 5BNQA 1AXZA 1W8HA 1W2NA 5FXVA 1ZBE3 2WT1A 1JTZX 4K40A 4RFRB 1H4GA 5CA6A 1XSRA 4Y33A 5C9AA 4IE0A 5FQ0A 1V6NA 2DUOA 3CMGA 4MOAA 1CIYA 3HVDA 4S2DA 4CP9B 1US3A 2VM9A 2VBBA 1HJGA 3KV6A 3NNMA 3JBG3 3ZOIA 3U37A 2D7FA 2CAVA 2RS32 4O7XA 4QPGC 4DRRA 2ZEWA 2CGPA 3O5SA 1UIKA 5FYIA 3T09A 4AEDC 1XE7A 1UY2A 1QH6A 1KQRA 5K4LA 3PMEA 1C28A 2FDKA 1A8DA 2O8QA 4AE2A 1IQDC 1ZRIA 1HRI2 3S5QA 3UKNA 2O1QA 4N43C 2OQ6A 3X29B 4AI9A 5IVCA 3GZEA 5JMCA 3RI9A 2JB4A 1DHKB 2PHWA 1QJX3 2XOMA 1FNZA 4EJRA 1RHI3 4YPJA 5IATA 1CAUB 4CCLA 1IPKA 1AL23 3KVBA 4EZHA 1KDMA 3DXUA 5EJZB 3TN92 2DBIA 1I9RA 4LE4A 3DXTA 5JZGC 5FV3A 5FP9A 1S0GA 2D40A 1TME1 2DBNA 1LTEA 4GXLA 5EXOA 5FZCA 5C3RA 2PAMA 2ZGUA 5KHGA 1JXNA 4V2VA 4QDRA 2SBAA 2ET1A 3AP9A 4J25A 1O3RA 5T5PA 1LGCA 1TNRA 4DRVA 1SZBA 2ZGTA 3FJSA 1IS6A 1J58A 2VMFA 1ZBE1 2Y0OA 1W3VA 1UNBA 1X8EA 3K75B 4P9YA 2AACA 2P3IA 4K8FA 4D0QA 1J83A 4XF0A 2DVGA 1AR92 1DBNA 4DINB 3IM0A 4KQ7A 2NPIA 2R072 2UURA 1NAEA 4L92A 4TLGA 4TWTA 4BQ2A 1KITA 1QWRA 5A6YA 5CEHA 4CXYA 5J3UA 2JDYA 4ZPIA 1F9KA 1CAWB 4GJYA 2CWMA 2ARXA 2W95A 3QCWA 4COYA 5KC6A 3LPGA 3SH4A 5A32B 3PIGA 1AXKA 4XHXA 4XYXA 5FWEA 5EIYB 1QF3A 5BNPC 3JXSA 5E89A 4XURA 3D5OA 4HFSA 3KHCA 2WA4A 4C1XA 1TQ5A 1VMHA 4QX8A 2YDEA 4FOVA 4K20A 2F6BA 2B46X 5IK8A 4UI9L 4XJUA 1SDWA 2QVSB 3AYAA 2ZHNA 3JD71 4KNCA 3U10A 3VBUB 5C8WA 4ET7A 1MACA 3LSDA 4E4ZA 1RUE1 1IKPA 2XUMA 2W0XA 4QDSA 4XCAA 3CJIA 3R05A 3WZ1A 3L9JT 1NCQC 3NRUA 2IUWA 2EA7A 3N9MA 4GD4A 4MX3A 4AHWA 3WV6A 3RJRA 2KXLA 2R7EB 3PVEA 3ME2A 3T1MA 5A7WB 5A1LA 3EQEA 4M01A 1OA4A 1WCQA 1AR61 2C9AA 2RHPA 3HBZA 4IE6A 3QBQA 2NMNA 5A33B 2GP3A 3ETQA 3LIHA 4K1ZA 4D94A 1UD1A 2BNNA 1VRBA 3SKJE 5KHIA 1HQWA 4M4RA 1W2TA 1WLTA 2V5YA 4B1MA 3ES1A 1DIWA 4N53C 5DAXA 3RJ2X 3ZYJB 1R1A1 1BQPA 3FUQA 4OUSA 5LEJA 3DN7A 1RUG2 4JGZB 4D7SA 1J3RA 4JVAA 4CCOA 5DUUA 1RIRA 3LKJA 5FIXA 2VC9A 4CU8A 1W05A 1EUUA 1H8TC 2WL1A 3U4SA 4OHWA 4Q0SA 4QB2A 2ZAHA 1DGLA 3J7NA 4ZU4A 5H9SA 4L11A 2PTMA 2ZZQA 2C4XA 2RS33 4IV1C 1HXS3 1HRV1 4QKBA 4HOOA 2WQ4A 2FDIA 1YQCA 2VMIA 4H3WA 4UW3A 2RM21 1D4M1 2WNUB 1AL21 2IXIA 4N53A 4Y1ZA 5K0UC 2YBKA 3NMBA 4E2GA 3AFKA 1JUHA 2R061 2R32A 2CWSA 1TZOA 3E5UA 2RVAA 5HV4A 3ACHA 2W3JA 3EBRA 4GB32 3VBOA 4NN0A 1BKZA 1CGPA 2LTNA 3HR9A 4AVCA 4L0PA 4EROA 2BFUS 3H3ZA 3NV1A 4HXCA 5DQ0A 3ZXGA 4YW3A 5CFCA 4BPZA 3P5BA 2XHKA 5EV7A 1ACCA 1DQ2A 2CGNA 2VW2A 3RZZA 3NNLA 1DP0A 3A21A 4BA6A 4RR3B 1B35C 4LPLA 2VVEA 3D0SA 1GWMA 1NCRC 1QJY1 1WMXA 2XB6C 4LBQB 1FPN3 5BNNB 3RRDA 4XABA 1N3QA 1QNWA 4P02B 5F3IA 2HWD3 2C6SA 3LZZA 3PLQA 5FRAA 1ND3C 1ZZ6A 2PLV1 4I30A 2XPJA 4FTEA 2VL4A 4P08A 2PAKA 1E5HA 1WW7A 3BU0A 1ZM1A 4NPLA 1WLDA 2XBO3 2ZBJA 4YYOA 1OKOA 3LEKA 4CCDA 2C24A 4MGSA 4QPYA 2A75A 4RSUA 3MLLA 3AYCA 3AKSA 4W50A 5F2SA 3E6CC 4DMIA 5CFCB 5JSRA 2WWSA 1ULCA 4FI9A 1ULGA 4LBKA 4S2FA 4TXWA 1A6CA 3AL5A 4XPVA 4NOTA 1UX7A 4X8NA 4CP0A 2H6BA 2WZEA 4ATFA 4UFKA 4NAMA 4GWJA 1WLCA 4WBBA 4CCMA 3AYDA 3EYPA 4I01A 5CFDC 4PLNA 1RUD1 2Y6FA 4FAGA 4N9HA 3POFA 2HWB1 1CN1A 3AZYA 1BZWA 3BOPA 4CYDA 4C91A 4YZ2A 3TEWA 4CCNA 1QJU2 1QHDA 3HT2A 1N3PA 1YC61 1DGRN 1LHVA 1RUD2 5H9PA 2DURA 2P34A 3VBFA 1HB1A 2Z69A 1S0JA 5FK7A 2RS13 3WR0A 3HQXA 4Y20A 3GBGA 4Y22B 5FY7A 3IWZA 1S0FA 2ZEYA 4QGMA 3ST7A 1CAVB 3AJZA 4FPHA 1G8WA 3N35A 1H30A 5AVPA 4QX0A 1LJ7A 3ZMOA 1CAXA 4CCJA 1AF9A 3T0DA 1ZZ9A 3THCA 1O4YA 3AP5A 3H1YA 4AHXA 4LBMA 2PA7A 2VZUA 3GZAA 3MUZ1 4A7KA 5FYSA 4OI1A 4P9JA 5A33A 2EAAA 3A0KA 1AR63 4CUBA 2DVBA 3H8RA 3EMRA 3NSTA 1ZBE2 3OPZA 3B5LB 5T5LA 5LY2A 5IVVA 1RYYA 3FUOA 3H0OA 4YM0A 2D6KA 5KC5A 4OMDA 4YM2A 3CJIB 3VDCA 3I2OA 4NIAA 3O1SA 2ZTNA 1K5MC 4CP2A 5FPUA 3RVHA 3AKRA 3B00A 3QH6A 1WGPA 4DXTA 1SACA 5CG8A 1PGW2 4WV8A 1NE4A 3QLQA 4XJWA 3EO6A 1GNZA 3L2YA 4XJ9A 4ZXKA 5C8CA 5F9TA 2QDRA 2WLPA 4LOSA 5T54A 4BQWA 3BUCA 2FD8A 2VZSA 2JG9B 2YG0A 5JPMB 3QD6A 1V6KA 5C9AB 1QQP3 2XGXA 2Y64A 3TEZA 1L3JA 2W1WA 2ET7A 4E9KA 1BXHA 1S0CA 4AVAA 4XUNA 4XFFA 4U36A 1W8NA 3A4UA 4JAAA 1OF3A 1BLZA 4PIZA 5C4WC 1S2KA 2VZ1A 1QIQA 3IAQA 4IGOA 4XBNA 3VBHC 2R071 3C2UA 2WFF2 4YW5A 3VBUC 5HI0A 5F2WA 1O7FA 2WAOA 3WDXA 3FLTA 4CCKA 5C8CC 2O0OA 2OPWA 4HSJA 5FFOC 5JVVA 5GZFA 5F3CA 1G86A 3ZXKA 1VR3A 3ZYGA 1VP6A 3RQ0A 1KJLA 3ZFEB 4LT5A 3H7YA 4N90A 1QDCA 3RMYA 1PMJX 4YNIA 4AXOA 1QMJA 3DCQA 5IFTA 5J7MA 1YYNA 2WZR3 5FYVA 1MZEA 3T2TA 3ZO0B 3CHXA 3AX4A 2W92A 5JWPA 4XUTA 2OW4A 3HQRA 2R042 1AR81 4YFZA 5JR7B 3J7MA 4OQ9A 4CDUC 1OQDA 4Y5Z0 5FOJB 2XMLA 5FZDA 4AOCA 4O9GA 3HOBA 1X33A 1O3TA 1YQ2A 4K7JA 4AQTA 2RDRA 3KMHA 3ZPYA 2GNTA 4XQWA 3NVCA 3WLUA 3BTZA 2UWAA 4AVTA 1OF4A 4PHZA 1XYPA 3IMNA 1HRI3 2XHNA 4XAAA 4ASMB 5IUQA 2JDMA 4BWOA 2WBKA 3I97A 1OVPA 3BIEA 3SCHA 4QQ2A 1PZ9A 2BVBA 5LEKA 3RWNA 1RGSA 2JDZA 4QQHA 4UBHA 1T6GC 1S0BA 3IIIA 5HCBA 3AL6A 4PI2A 5T5OA 1UWWA 2VECA 3PMSA 2X53S 4HBNA 4XFCA 4URAA 2IWGB 1US2A 1JZ5A 1RMU2 2DCYA 3POIA 4HZFA 3U78A 4IW3A 4CXXA 1NE6A 1GANA 3J7LA 2ID4A 1ULEA 4LORA 4A4AA 2D93A 1SBDA 2WO7A 4CUGA 4ATEA 1CPNA 4DXRA 4D7YA 2WZR2 2R0FA 3MLKA 5KXCA 1LODA 2YZ4A 5LBEA 3KSCA 4NPMA 4Q1PA 4LO4B 3ZFGA 2ZGKA 4BMEA 1GOFA 4YVSA 2EXIA 3VDAA 3THPA 3VZNA 4TLFA 1Q3EA 4Z8BA 5FZ4A 3N7LA 4O61A 4A45A 4A7ZA 4H55A 4E8DA 2Q1MA 1CZTA 4DNYA 1PZ8A 4YSFA 3N9LA 2XKPA 4MV2A 3VKFC 3RZLA 1MQTB 1W9WA 4NIIA 1RUJ1 2WS93 3IKWA 4S2HA 4FOQA 4ASLA 1W0PA 2ZAAA 2VOKA 2XR4A 2BOIA 1VMJA 1NA1C 1AR72 3D4KA 5A3UA 3INAA 1B09A 2DFBA 2EIBA 1UPSA 3LE0A 2XJRA 3MF9A 2ZGOA 3LIGA 2BWAA 4YVWB 4ARYA 3DPRC 4PLOA 1OHFA 1O8SA 1W2OA 2FZ2A 1SLIA 2QQMA 4XZPA 3FMGA 1C8M2 4A3ZA 4AEJA 5CAZA 3GNEA 4QU1A 1GBGA 3K77A 3OYWA 4C0BA 1UQXA 3KF5A 4JGZA 4AEDB 4BIOA 1YFWA 2ZGNA 4RD7A 4MZUA 1G9AA 4QPIB 1Q8OA 2O8OA 4NMIA 1OH3A 2AENA 5FZ0A 1V6OA 1Y7BA 2BGCA 4A2UA 2FMDA 4Y1UA 2N7GA 5ABJA 5FUPA 1PO22 2VMEA 4A6SA 3AP4A 4B4RA 2IFWA 1UZZA 3VD4A 2A6ZA 3IN9A 1R1A3 2VR4A 4IV3A 3VKNA 2HBUA 2BW8A 4UBGA 4D6SA 4GQ7A 5F3GA 3WNLA 3NWKA 1OA3A 1Q8VA 1OPMA 3U75A 1C5HA 2CY6A 3PNAA 1GLHA 4CDWC 4Q4V3 1OI6A 1OLQA 1OT5A 3VLBB 1ASJ3 2JDKA 4CUAA 4A42A 1UOGA 2QNKA 1R093 3IDCB 4WVVA 1XU1A 2D5FA 3GJBA 3JBG2 4WM7B 1C3HA 2GP5A 2K46A 5EYYA 5T5JA 4N9IA 5C9AC 2VAUA 5CKMA 1DQ4A 1IG3A 4WM8A 3VBUA 4CCEA 3MO4A 2HYXA 4BXSV 1WA6X 1HXS2 3R0RA 1RUE2 2PQSA 2WINB 2W39A 1COV1 5C4WB 1PGL2 2ILMA 3M3IA 3Q8BA 3B9IA 3MI8A 3WP5A 4AWDA 2I07B 4Q1RA 2D3PA 5F39A 3FBMA 1W99A 1XE8A 2AUYA 3HN1A 3R4DB 5FWJA 1W9FA 3KD4A 5J98B 4AI1A 3ACGA 3C3VA 4BCUA 2EXKA 2NQYA 2W87A 1VJ2A 1ST8A 2VZRA 1N1SA 1C8NA 2WFF3 2Y6HA 4FPCA 4AVSA 4ONUA 1V6LA 1F4AA 2JXAA 1UCXA 5JOZA 4AI3A 3AP6A 4ZZ5A 3N7MA 2ATFA 4JV4A 4QX3A 3SNMA 1DGWX 2NMOA 4IEUA 4QKFA 4C1WA 1OOPC 2HWE2 4MVTA 4PQQA 1D4VB 1YHFA 1V6MA 1RUF1 1PIV3 5LA1A 4GWMA 1L7QA 1LRHA 5C8CB 3WDYA 4R4ZA 5FLIA 1NCQB 5FUIA 2ZGPA 1UKGA 2ZHKA 3AMHA 5A7NA 3DYMA 1CZSA 2RM22 3U11A 5GZCA 4MGIE 5I93A 4OHXA 4IEWA 1U5IA 3PUAA 1DZRA 1VLNA 1LU2A 1EV13 4DFSA 5D2AA 1AR82 1CJPA 1PK6B 1XNTA 4Q4W3 5BPXA 2VTFA 5L7OC 3BTYA 3IDEA 1BJQA 5F7UA 3E6BA 2PQQA 1E5RA 1G7YA 4ZHNA 3MUY1 4CPBA 3AMPA 1QJX1 4QXHA 5BXXA 1PK6A 5FYMA 1WBFA 1J59A 1LOEA 3LSEA 1RUH3 5KHHA 5ISLA 2BNMA 3P1IA 4HVRA 2XQRA 2RS11 2VOVA 4OZOA 4UT5A 2CAUA 4XDQA 5C71A 3HAGA 4PDWC 4CDQC 1NCRB 4XTMA 5T55A 2XDVA 3U1XA 2IC1A 1I1EA 1UO9A 4DUWA 2GC0A 1SLCA 3H42B 1SDDB 4PIXA 4EWDA 2I45A 1NLQA 1UU6A 1W3XA 1WCSA 4XQDA 4YG0A 2D6LX 1DLLA 3GHMA 4CPBD 4NIHA 4QAWA 2C0ZA 1TNFA 3RDIA 1J1TA 1Q8SA 3GCXA 3ZXJA 3H8OA 3LDBA 4KG0A 4FQ4A 5BNOB 1LU1A 5A3LA 1NY72 2AEZA 4DUXA 3NJXA 4RL7A 4XACA 5JSPA 2WZ8A 2RS52 3HNYM 5I0RA 5CG9A 4ZXEA 1NA1B 3WF0A 1W6MB 1POV3 5FJHA 1ENRA 1AR83 2VQAA 4LNVA 1RUOA 4RR3C 4LQRA 2TEPA 2D6NA 4MXVA 1SFNA 3I59B 4FVVA 4JZRA 4NPRA 3J4UH 1H6YA 4URTA 2E9QA 5GJ6A 1ENXA 1A78A 2XJVA 2WYFA 2QZ3A 1X36A 3MW4A 5FZOB 4B1LA 4TZDA 4YLZA 1DGWA 5J48A 1JHNA 4HANA 2BNOA 1AL22 4C90A 1OC1A 1XU2A 3THDA 3OEBA 1HRI1 1S4CA 2WNVC 1VBE3 3UGGA 1YUDA 4QU2A 2W91A 2C1FA 4QPIC 5KR7A 1UOBA 2ZGRA 3ABZA 4EN9B 5BNOA 1WD3A 3CZUA 2VUCA 1H4HA 2XG3A 4YW2A 1GV9A 1R081 4E27A 2VZOA 3K2OA 1N1TA 2AH2A 3CQOA 2PHRA 3E5XA 1C8M1 2ARBA 1R1ZA 1YO8A 3PUSA 3VBRA 4AL9A 1QXRA 2HEYF 2IXHA 1D7PM 1MZ6A 3ECQA 3OG2A 4EN0A 1IS5A 1T6BX 4B4PA 2Q0AA 4PLMA 4Y1YA 2BVVA 1W8UA 2XL9A 2Z42A 4QHBA 2YB7A 4WM7C 4DIQA 1OQEA 5FUNA 5JIUA 5LA2A 2YC0A 2BGPA 4GH4C 2JIJA 2Q8CA 2VCAA 4YM3A 4FPYA 4XF1A 4Z82A 3N3HA 4Q5OA 1NCRA 1RJ7A 3RZKA 5LB6A 2E53A 2GMPA 1LCLA 4LHKA 4C0HA 4C8DA 5FO8B 5BUVA 2Y38A 1PMIA 4OQ8A 5DABA 2P3KA 3ZKUA 4RHV2 3PVNA 3VDDC 2JDNA 1VE0A 4WVZA 4AFAA 1YCIA 1IOAA 1GZTA 2ZMLA 3ACFA 2VMCA 3POEA 3TN91 3U07A 4B8EA 4E2SA 4W65A 2P3JA 2Z4FA 3MPBA 3WNNA 2B5HA 2E51A 3MDPA 4RA0A 4FPLA 1KJRA 2VUAA 3M1HA 4HKLA 1EP0A 1NOVA 4FO9A 4YG6A 2FDGA 1EV12 1OUSA 4CDWB 4EWEA 3QOPA 1UMIA 1XNCA 1QJFA 1TG7A 4LBNA 2QUOA 3NL1A 2BBAA 2ZX0A 4ZS2A 1L7LA 2VZPA 1S55A 1HIXA 1RUC2 1WW5A 1REDA 4EZ4A 3VDDA 2P5BA 1GNYA 1CZVA 1K12A 3H9AA 1IHMA 5FZ6A 3FC0A 3BPSA 1W8ZA 1JZ8A 3LGRA 3D8CA 1C8M3 1J3QA 2E32A 5CIRA 5CYYA 3MGUA 1WMEA 4NWVA 2ORZA 4PDWA 3MW2A 1V6JA 2PN5A 4XF4A 3WF2A 5I0TA 1JOPA 2FCUA 2J1VA 2OKXA 3POBA 5FK8A 4XJ8A 2GNDA 1YIPA 4WVWA 2HWE1 2B42B 1XYNA 1QJEA 1V9U3 4GMP1 5F1RA 1HXS1 1XRUA 5L7OB 4FPOB 1COV2 1PGL1 1S1AA 2B4KA 3FFZA 4JQTA 4IEPA 2ZOEB 1AR93 1OOPB 3FWEA 4RGGA 4M0NA 3I2DA 3OBAA 4I02A 2QCSB 5KBFA 3OBTA 1RUI3 4IGPA 1GQPA 3HMYA 4GALA 2CTVA 2J42A 2GNBA 1VBE1 4XFAA 3WF4A 2QQJA 4NJ4A 3PIJA 4L2NA 2Y0IA 1D0HA 1VBC1 4CDQB 1X82A 2F4LA 2I2SA 4BQ3A 3UNPA 5DZFA 1FOD1 3MLJA 5A3NA 3N9QA 2J1AA 3O1MA 1XYOA 4OCTA 1LR5A 4TYSA 1ALYA 2WZPP 1VAMA 5EFUA 4KBZA 2VOWA 4GULA 4CEWC 5SV8A 3AZVA 2WN2A 4FP2A 1H2NA 3FHAA 5IWFA 4CE8A 4IV3B 2JIGA 4XUOA 3WF1A 3FFQA 3D82A 4YFWA 5L9BA 2HWD2 5BNOC 4Q8KA 3TB0A 3VHNA 1VRH2 5F5QA 3OSDA 2GC3A 2W9XA 3CBNA 5JI7A 4TSVA 3T08A 2VQ0A 4QKDA 1IPSA 1VB4A 2DDUA 3CU7A 3AVRA 4WZCA 2OQ7A 2X10A 1RVF1 3OB8A 1F35A 1BEV1 4NRPA 4YGBA 5I0DA 4K6BA 5CADA 1WMFA 4IEZA 4FT8A 5A80A 3HWJA 2J1EA 5A3MA 2CDPA 1IS3A 2X05A 1MS9A 4AR2A 1Z78A 3KF3A 1HX6A 2R062 3VBFB 3FBYA 1CIWA 4QHZA 4GH4A 3TBDA 2VQUA 3LQCA 1ONAA 1ASJ1 1GR3A 2A5ZA 1WA4A 3HNBM 3ZDVA 1Q8PA 2R0HA 1G9CA 1UOFA 3O1VA 1OFSA 5JUVA 2X5IB 4P9LA 4XXPA 1W90A 3PURA 1ULDA 2HEVF 2WLQA 3ZXDA 5D1IA 1AR73 2ERFA 3J8F2 4FPKA 5F6KA 3VZOA 3ITQA 1H8TA 1EAH1 1F2NA 1ZZ7A 2WJSA 1AYN2 2J1UA 3BALA 4DOUA 1DZTA 3WDUA 4BMBA 3ZDSA 1AHSA 2WO2A 1B35A 1RUE3 2ZABA 5C7GA 4IV1B 5FQ0B 1IZ3A 1AYN1 5CB7A 3KGZA 5FAXA 4YVSB 1HW5A 4AI2A 3H1WA 3ZYPA 4YZ4A 4GH4B 1JODA 2K9ZA 1QNYA 5I8YA 3WSOA 1I5ZA 1R082 2VOTA 1GWLA 4BJ0A 5JAXA 4PJYA 3IT8A 4Q0VA 4E4DX 4KU7A 4BIFA 4CU6A 2XVGA 3UGFA 4XHBA 1YJKA 3BTAA 2WAAA 2X29A 2LALA 3ZR5A 4E4SA 2VMHA 2CHHA 3LOBA 3MHZA 1LHUA 3VBSB 5IK7A 4G4FA 1ZYBA 2ZHLA 1MEC3 2PHLA 3AMQA 2IFRA 4UF0A 2DU1A 4RHV3 1V70A 5J36A 2CU5A 4UXAA 3SH3A 2QQKA 3GBFA 5DDJ3 1W6OB 2G4IA 3H3UA 3VL9A 1ND3B 2D44A 2G9GA 4AYUA 5FKBA 2ZEZA 5IJRA 4LKFA 4WM8B 1HRV3 3WNKA 3AB0A 1OD5A 4B7EA 4BOWA 3WNXA 2V4AA 2VVDA 3ZN4A 3OTFA 1WCKA 2IXLA 4A6OA 4D69A 1S0IA 5FYHA 3U14A 1YRZA 2P37A 5FDBA 2RG4A 2VUDA 3OUHA 2W1SA 3T2OA 5HCAA 3APBA 4RN5A 1ULFA 5GLVA 4EYUA 5DN2A 4CU9A 3I7DA 3H50A 3RFRA 4B3NA 3C8XA 4XVHA 4AVBA 3BCWA 5I91A 1CX1A 4D7TA 3LCPA 1CD3G 3TEXA 5AC91 1TME2 3ZN6B 2Z79A 1QQP1 1LB2A 4BQYA 1R083 3TAYA 2WSVA 1O4TA 2XH6A 4Q4Y2 3O1PA 2Q1FA 5FXWA 2VW1A 5FYYA 4A7YA 2DTYA 4ORFA 4K8RB 3VZJA 4CP9A 3V0AA 2KD7A 2B9UA 1V0AA 3IZOA 2Y60A 3WY6A 3WQ7A 4RHV1 5DAPA 3FHIB 4ZKTB 2DV9A 4XFHA 2PHXA 4XQ4A 4FCAA 2ZMNA 1REFA 4IEQA 2UWCA 3IPVA 3FHQA 1ZBA1 1KS4A 1OKQA 4QM9A 3CJXA 3AKPA 1IG0A 1ZNPA 2LRPA 2QQWA 4LO5B 1W6QA 2F4PA 1X8MA 2G9ZA 3ALQA 4CTEA 4EN8B 3ZSEA 2YV8A 5IT6A 1ZBA2 3HBKA 5ACA3 5DMYA 1HRV2 3GGLA 4QT6A 2XVLA 2W68A 1WZXA 1Q5OA 5FZ9A 2QQNA 5AFBA 2KA3A 2VXJA 3I59A 4XDPA 2BV4A 4LA3A 2QQUA 5FXZA 4JTNA 1YFXA 4CEWB 1QJU3 2V5DA 3JBG1 3ZSKA 3N36A 1DGRA 1RITA 3ELNA 2CDOA 3GBWA 5KXEA 2J1SA 1R091 2ZACA 2EXJA 1RUC3 3U0ZA 2AYHA 3I54A 1YQ6A 3P3PA 2SLIA 2V09A 5A3WA 1YFYA 2JJ6A 2ZKLA 3WCRA 4JTOA 3W20A 4AEMA 4BLIA 3N7JA 4M3CF 5EWSA 1FT9A 2DU0A 3BOWA 3GCWA 1W2AX 2OVUA 3E6DA 4QXCA 3A23A 4META 1YI9A 1JYIA 2YMZA 4I09A 4QQOA 3NJYA 4FXGB 4AI0A 2RJKA 2R49A 3R4SA 4QXBA 5D8AC 5IVFA 1GZCA 4LXLA 3GHNA 4LKSA 2WQZC 1OSGA 5FZBA 3USSA 3PVOA 2HWD1 3CIHA 1HB3A 5FZMA 1YLLA 3M4FA 4IE5A 4YZ1A 1S0EA 1VBA3 2JB8A 3LFMA 3RZJA 3AMNA 3OEAA 1DYKA 4ASKA 3ACIA 5FY9A 3ZN6A 4P9IA 3NAPB 4WVMA 1K3IA 1GZWB 3VV1A 1I3HA 1NX9A 4MGQA 2BBVA 1LHOA 2AC1A 2XLGA 4L97A 3N7KA 2R16A 2ZKNA 1LOFA 2YYOA 1SLLA 4CEWA 1E5SA 1RUI2 3PJYA 2A6YA 1UL9A 4Q4X1 1XE0A 4JDOA 5M0TA 4GWIA 2EIGA 3NJZA 3MIHA 4XOGA 1KD7A 3FL7A 1RUI1 3T30A 4OYUA 4RQPA 3DV8A 4EQVA 5C3OA 4LK6A 2BP6A 2HKXA 5ERLA 5AVAA 2A6XA 2B8MA 5KWRA 1YQ5A 3BPZA 4TTGA 1TMF3 1UIJA 3AZXA 3DUIA 3URFA 3EXUA 2FHRA 5DPNA 3TNQA 2VPVA 3Q8EA 3WDWA 1ODMA 1W6PA 3ON7A 3OCPA 1O5LA 5ANNA 1ZVFA 4CDUB 3MICA 2GN7A 4F83A 3ZFEA 3J26N 2OYZA 4R9AA 5BYNA 5JPNB 4Z2AA 2BZDA 2J7MA 2P17A 3NNFA 2WNOA 3SEPA 5L7OA 1RHI2 2WWUA 1W8WA 2ZJCA 4XTPA 4DPNA 2W1UA 5C6CA 1C1FA 2D97A 3T4VA 1SHWB 4CRQA 4Y4YA 2ORXA 2HWF2 3WHTA 4I2OA 4Q27A 2PXJA 2WT2A 4NHYA 5FOBB 4FPEA 2IXCA 3J7HA 1W6NA 4K3UA 3MFCA 1YXWA 2JG8B 3DGTA 4L8QA 1VALA 4QHOA 1FPN2 3B7MA 4XIOA 5C33A 3UJQA 4CDXB 2QFEA 3V0AB 1POQA 2FDFA 2DUQA 3KGLA 3DYOA 3CO2A 1ZRFA 2ZCWA 1HQLA 4NRQA 3KT1A 2WNVB 2JG9A 2VY0A 2VUJA 5F37A 3ZN5A 3KS7A 2IVJA 4EV0A 4MLOA 4QQLA 4XCBA 3VDDB 3UESA 1RUJ3 1V9U2 1OLME 2A70A 4QPWA 3VKMA 4Q4V1 3WNPA 2YY1A 1JMUB 1SQ4A 1FOD3 2HH9A 4XUPA 2Y33A 1COV3 2CSGA 2RDSA 4IGQA 1DCSA 4LKEA 2YBSA 2J1RA 2EALA 1OD3A 1RTVA 2WZR1 4XFIA 3ILRA 1W2UA 1PNGA 3OJBA 5GLTA 4OUEA 3RZGA 1XC6A 2BEOA 4BYYA 5JCTA 4XFBA 3KVAA 1TMF1 1KDKA 4IUGA 2JG9C 4M4PA 5F5AA 2C5DA 5J96B 3JU9A 4L9BA 2WUHA 3D0JA 1N1VA 2WDBA 5APAA 4LOTA 5FPLA 1QJU1 3UK9A 3HNMA 3M3OA 4E8CA 3B02A 2Q5TA 4FAHA 4XMIA 1K5MA 1KS5A 3RG0A 5FCCA 5F5CA 4EE2A 2R1DA 3AXDA 3PJQA 5FYTA 5GZGA 2HWF3 1DYOA 3NAPA 1QQP2 4XBQA 2ES3A 3VGIA 5EJ1B 3HPNA 1MS0A 2R6QA 1OURA 4DS0A 3LD8A 2GZWA 3I3QA 3UV9A 1WCDJ 4AK3A 4N7UA 2ARCA 1IQAA 2JE9A 3M70A 1UN1A 4RGAA 1ULPA 2E7QA 4BDVB 4DQAA 5IK4A 1JUIA 1EPZA 3T2QA 3OYWB 4AGVA 3NNJA 1OPOA 2IZWA 2RV9A 5L9VA 3AZWA 4MSVA 4W4ZA 2OUHA 4IEXA 4MGYE 2EXHA 4LBQD 2FCTA 2QQLA 3O1TA 4JKMA 1C57A 2VCMA 3LWCA 5A6ZA 1UY4A 5FP8A 1XNDA 4LJHA 3POSA 4FQZA 4IV1A 1G9DA 4B7KA 1M06G 4CUCA 3WVJA 2BU9A 2L9LA 5AC92 2ZHMA 5D21A 4HN1A 3O1RA 5FMOL 2GNMA 4OI2A 2YGMA 2D3RA 1AR71 5FZHA 4AW7A 1XNBA 5CKQA 5IVEA 1AR91 4GMP0 3FLRA 3RMXA 2VU9A 3ZYHA 3GZUC 4XJZA 5IFPA 5GLWA 1JYNA 1J1LA 2VG9A 1EUTA 1MS5A 5LK7B 3PUHA 1TME3 1PO13 2A3XA 3M3CA 5J1XA 1YNAA 4LHNA 2VO5A 3MV11 2V72A 3ETPA 4GIQA 5DG2A 4W6XA 2CYFA 1BK0A 2XJSA 2KM2A 5LK5A 2WO1A 3J9SA 4JKLA 4AI8A 1CX4A 2Y6KA 4GKYA 5H9QA 1GWKA 2E6VA 3WDTA 5A3PA 1U0AA 5BV6A 1LAJA 2YU1A 1H2KA 1ZRCA 2VZVA 1NXMA 1RMU3 2JICA 3DYPA 5FZIA 3TWIA 1W04A 1RJ8A 1MEC1 3AK0A 2BWCA 3BIWE 1NQDA 3RYPA 4RQPC 4DEVA 1H9WA 2OX0A 5FPZA 5KXBA 1HJFA 4MGTA 2YXSA 3I3DA 5ABJB 4N43A 2BUKA 1G9FA 5FZKA 4QX7A 5LBBA 1ZBA3 5ACA2 2K0GA 3IMMA 1OFNA 1D4M2 1OBNA 3VBFC 1LHWA 1IGOA 4KBBA 1Z7S1 5A1FA 1WWYA 2A3YA 3M7AA 1JOBA 3KCXA 1KFXL 3IDAA 4I3GA 4Q4W1 4XZUG 3V65A 2MHFA 2VULA 4R9DA 1YIFA 2LS6A 3WQBA 5HV0A 4GKXA 2BQPA 3WG3A 1VAVA 1POV1 4DXSA 1XOYA 3Q8CA 3DKQA 4Q4X2 1GZ9A 3LDKA 2WIIB 5CFDA 1XPWA 3RSJA 3W59A 2TBVA 1Q43A 3V56A 2O14A 1GQGA 3KT7A 4AFDA 1NLRA 4R4XA 2GC1A 2DCZA 2W52A 3WUCA 4IEYA 3SMHA 4CDQA 5LW9A 1LKNA 1QXJA 2GC2A 2WS92 5E16A 4KWLA 4QQPA 1OA2A 4HKWA 3TEYA 2PHDA 4OHYA 2PYTA 3M3QA 5J09A 1FMD1 2UY9A 3LA2A 4PCRA 1NKGA 3CEWA 3UKVA 3IDBB 4UOJA 1HN1A 5FMBA 1SBEA 2H0VA 4DEQA
chains in the Genus database with same CATH topology
1H6XA 3T0AA 1JZ8A 2Y6JA 1DP0A 3A21A 4QX1A 4LPLA 2E32A 4KI5M 5CYYA 2HLEA 3SEEA 2ORZA 2J1TA 4P02B 3T0BA 3WF2A 2VJXA 2J1VA 2OKXA 4P5YA 2VL4A 4P08A 3VD9A 3K4ZA 3LEKA 4MGSA 2WQ8A 2WABA 4RYDA 4W50A 5B4NA 4JX0A 4FI9A 2B4KA 4TXWA 3UETA 2VCBA 1UX7A 3OBAA 2WZEA 1CZVA 4GWJA 1GQPA 2QBXA 1GU3A 3EYPA 2J22A 2QQJA 3WF4A 3E1F1 3MV01 3C7GA 1UYZA 5IHRA 1W0NA 1JU3A 3UNPA 3A7QA 4QX2A 2J1AA 1JZ4A 2WN2A 3F2ZA 3FHAA 4W8JA 5HPOA 2ZEYA 4XUOA 3WF1A 4MADA 1MPXA 1UXXX 2VZQA 2XQXA 3NQHA 4QX0A 1JZ2A 2W9XA 3BN6A 3T08A 2WO3A 3T0DA 3THCA 1PX4A 2VMDA 2DDUA 3EB7A 2JKXA 2VZUA 2X10A 3OB8A 3MUZ1 5I0DA 4CUBA 2J1EA 2CDPA 1R64A 2X05A 3C7FA 3IAPA 1RYYA 2VQUA 3LQCA 4OMDA 1O59A 2C9KA 3HNBM 4ARXA 3VDCA 2Y6GA 5JUVA 3MBWA 5JR2A 2W94A 4AG4A 4DXTA 1F4HA 1NUKA 2RJ2A 2VZTA 3P6BA 2J1UA 1UXZA 2LW8A 1BHGA 2WO2A 2VZSA 3WEZA 3DECA 2YG0A 5C7GA 3K4DA 4PT6A 2Y64A 2W1WA 4AAXA 4XUNA 3I2IA 2Y6LA 1W8NA 3WSOA 1OF3A 1XNAA 2W47A 3BGAA 2VZ1A 2VOTA 4BJ0A 3I3BA 3IAQA 2JD9A 2WAOA 4CU6A 1JHJA 2VZ3A 2WAAA 3VD5A 1L7RA 4BK5A 4A44A 2B9VA 5IYYA 1PMJX 4QDQA 5IFTA 2W5FA 2QQKA 3T2PA 3CZJA 2W92A 2ZEZA 5IJRA 1JZ3A 4XUTA 1JZ7A 3CDZB 2YC2A 3WNKA 3W5NA 2WN3A 3HOBA 1GOHA 4A6OA 1YQ2A 1UYYA 5LA0A 3OGRA 5JXIA 2DCJA 2W1SA 3AC0A 3T2OA 4LHSA 4RN5A 3HEIA 1OF4A 3VD3A 5DN2A 4CU9A 2E33A 2XHNA 3C8XA 4XVHA 1CX1A 2WBKA 3I97A 4P00B 2YFUA 4OMCA 3SKVA 1P8JA 1ULOA 3IIIA 3I2GA 1GMMA 4UAPA 3K46A 2KD7A 1UWWA 1T2XA 1JZ5A 1US2A 2QQOA 4A4AA 2ID4A 4JHZA 2ZXQA 3FHQA 1O8PA 4DXRA 4HG6B 3I2FA 3HJRA 1GOFA 3VDAA 3FN9A 5DMYA 2BGOA 1UZ0A 3GGLA 1W9TA 2QQNA 4A45A 4E8DA 3OGVA 4KMQA 1CZTA 2V5DA 1W9WA 1OH4A 2QQIA 2CDOA 2J1SA 3VD7A 3LE0A 2EIBA 4ARYA 3OGSA 3WNMA 1JYWA 1JZ6A 1O8SA 1WKYA 2V4VA 3W5MA 1W8OA 2QQMA 3A23A 4A3ZA 3A22A 3K77A 4D8MA 2JDAA 2XONA 3C7EA 1UYXA 4LKSA 3LPFA 3CIHA 5JXJA 3NNGA 1JYVA 3OEAA 3ACIA 2VMEA 1K3IA 3VD4A 4MGQA 1NX9A 3PUIA 2VR4A 1KGYA 3CKHA 5G05L 4DUVA 3WNLA 5B4XA 5JXHA 1OT5A 4CUAA 4A42A 1UMHA 2E31A 3IB3A 4GWIA 4A41A 3ZM8A 2Y8KA 3FL7A 4OYUA 1TVGA 3MO4A 4KWUA 2HYXA 4BXSV 4TTGA 2PQSA 5DPNA 3WNOA 2EIDA 3I2HA 3GM8A 3LEIA 2BERA 5C70A 1W99A 1SG3A 2YFZA 1W9SA 4Z2AA 2BZDA 2J7MA 3ACGA 3VDBA 3K4AA 3SEPA 2W87A 2VZRA 2Y6HA 1K42A 2W1UA 1F4AA 1SHWB 2ORXA 5JMOA 2C26A 4ZZ5A 4QX3A 3J7HA 1UY3A 4QB1A 1KEXA 4PQQA 3DYOA 5LA1A 3CMGA 4MOAA 1CIYA 3GDBA 1US3A 4ZY9A 2VM9A 1L7QA 1LNSA 4QB6A 1UY0A 2JE8A 3U37A 3UESA 3WNPA 4QPWA 5FUIA 1JYXA 2ZEWA 3DYMA 1CZSA 4XUPA 4CVUA 3T09A 2J1RA 1OD3A 1UY2A 2EICA 1XNTA 3D3AA 2VTFA 4OUEA 1XC6A 5F7UA 4ZZ8A 1IQDC 2W1QA 3MUY1 4IUGA 4M4PA 3I2JA 2WUHA 2XOMA 1JU4A 2WDBA 4YPJA 3HNMA 1J84A 4E8CA 3P1IA 5EJZB 4OZOA 4CU7A 5C71A 3LEGA 2DCKA 1DYOA 5EJ1B 3HPNA 1DLCA 4DUWA 1SDDB 4QDRA 4XUQA 1ULPA 4BDVB 3T2QA 4QAWA 2VMFA 2W46A 3I2KA 2RV9A 3K75B 4W4ZA 4D0QA 1J83A 3C7OA 5HXMA 2QQLA 4DUXA 2X09A 3NJXA 4JKMA 2WZ8A 3HNYM 1NAEA 4ZXEA 3WF0A 4PF1A 1UY4A 2W95A 4CUCA 4LQRA 3LPGA 2L9LA 2VCCA 5EIYB 1H6YA 3JXSA 4XURA 5IFPA 1JYNA 1EUTA 4UI9L 3PUHA 3THDA 3HN3A 3OEBA 4ET7A 5CZKA 5J1XA 2W91A 2VO5A 3MV11 2V72A 3ETPA 3ABZA 3I3EA 4QDSA 3CZUA 3NRUA 2WO1A 4JKLA 2Y6KA 2VZOA 2R7EB 4MO3M 3CQOA 2EIEA 1PMHX 1GOGA 2VZVA 3DYPA 3NJVA 5G04L 1WCQA 1D7PM 4DEVA 3ECQA 3OG2A 3I3DA 3SKJE 3GXUA 4M4RA 2WYSA 2YB7A 5LA2A 2BGPA 2VCAA 3C7HA 4GZ9A 3IDAA 4XZUG 4CU8A 2VC9A 3WQBA 1EUUA 2LS6A 2VQTA 4QB2A 5JXGA 4DXSA 2ZEXA 3ACFA 2C4XA 1XPWA 2VMCA 1PX3A 1JI6A 2Z4FA 4JKKA 3WNNA 5A1AA 3WF3A 1I5PA 1K45A 1UMIA 1UY1A 2RVAA 3ACHA 1TG7A 2W3JA 5LCWL 1GUIA 2BBAA 2E26A 4BK4A 2VZPA 1NKGA 4L0PA 4UOJA 1HN1A 2YC4A 5DQ0A 1GNYA 1K12A 4DEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6X A;  3T0A A;  1JZ8 A;  2Y6J A;  1DP0 A;  3A21 A;  4QX1 A;  4LPL A;  2E32 A;  4KI5 M;  5CYY A;  2HLE A;  3SEE A;  2ORZ A;  2J1T A;  4P02 B;  3T0B A;  3WF2 A;  2VJX A;  2J1V A;  2OKX A;  4P5Y A;  2VL4 A;  4P08 A;  3VD9 A;  3K4Z A;  3LEK A;  4MGS A;  2WQ8 A;  2WAB A;  4RYD A;  4W50 A;  5B4N A;  4JX0 A;  4FI9 A;  2B4K A;  4TXW A;  3UET A;  2VCB A;  1UX7 A;  3OBA A;  2WZE A;  1CZV A;  4GWJ A;  1GQP A;  2QBX A;  1GU3 A;  3EYP A;  2J22 A;  2QQJ A;  3WF4 A;  3E1F 1;  3MV0 1;  3C7G A;  1UYZ A;  5IHR A;  1W0N A;  1JU3 A;  3UNP A;  3A7Q A;  4QX2 A;  2J1A A;  1JZ4 A;  2WN2 A;  3F2Z A;  3FHA A;  4W8J A;  5HPO A;  2ZEY A;  4XUO A;  3WF1 A;  4MAD A;  1MPX A;  1UXX X;  2VZQ A;  2XQX A;  3NQH A;  4QX0 A;  1JZ2 A;  2W9X A;  3BN6 A;  3T08 A;  2WO3 A;  3T0D A;  3THC A;  1PX4 A;  2VMD A;  2DDU A;  3EB7 A;  2JKX A;  2VZU A;  2X10 A;  3OB8 A;  3MUZ 1;  5I0D A;  4CUB A;  2J1E A;  2CDP A;  1R64 A;  2X05 A;  3C7F A;  3IAP A;  1RYY A;  2VQU A;  3LQC A;  4OMD A;  1O59 A;  2C9K A;  3HNB M;  4ARX A;  3VDC A;  2Y6G A;  5JUV A;  3MBW A;  5JR2 A;  2W94 A;  4AG4 A;  4DXT A;  1F4H A;  1NUK A;  2RJ2 A;  2VZT A;  3P6B A;  2J1U A;  1UXZ A;  2LW8 A;  1BHG A;  2WO2 A;  2VZS A;  3WEZ A;  3DEC A;  2YG0 A;  5C7G A;  3K4D A;  4PT6 A;  2Y64 A;  2W1W A;  4AAX A;  4XUN A;  3I2I A;  2Y6L A;  1W8N A;  3WSO A;  1OF3 A;  1XNA A;  2W47 A;  3BGA A;  2VZ1 A;  2VOT A;  4BJ0 A;  3I3B A;  3IAQ A;  2JD9 A;  2WAO A;  4CU6 A;  1JHJ A;  2VZ3 A;  2WAA A;  3VD5 A;  1L7R A;  4BK5 A;  4A44 A;  2B9V A;  5IYY A;  1PMJ X;  4QDQ A;  5IFT A;  2W5F A;  2QQK A;  3T2P A;  3CZJ A;  2W92 A;  2ZEZ A;  5IJR A;  1JZ3 A;  4XUT A;  1JZ7 A;  3CDZ B;  2YC2 A;  3WNK A;  3W5N A;  2WN3 A;  3HOB A;  1GOH A;  4A6O A;  1YQ2 A;  1UYY A;  5LA0 A;  3OGR A;  5JXI A;  2DCJ A;  2W1S A;  3AC0 A;  3T2O A;  4LHS A;  4RN5 A;  3HEI A;  1OF4 A;  3VD3 A;  5DN2 A;  4CU9 A;  2E33 A;  2XHN A;  3C8X A;  4XVH A;  1CX1 A;  2WBK A;  3I97 A;  4P00 B;  2YFU A;  4OMC A;  3SKV A;  1P8J A;  1ULO A;  3III A;  3I2G A;  1GMM A;  4UAP A;  3K46 A;  2KD7 A;  1UWW A;  1T2X A;  1JZ5 A;  1US2 A;  2QQO A;  4A4A A;  2ID4 A;  4JHZ A;  2ZXQ A;  3FHQ A;  1O8P A;  4DXR A;  4HG6 B;  3I2F A;  3HJR A;  1GOF A;  3VDA A;  3FN9 A;  5DMY A;  2BGO A;  1UZ0 A;  3GGL A;  1W9T A;  2QQN A;  4A45 A;  4E8D A;  3OGV A;  4KMQ A;  1CZT A;  2V5D A;  1W9W A;  1OH4 A;  2QQI A;  2CDO A;  2J1S A;  3VD7 A;  3LE0 A;  2EIB A;  4ARY A;  3OGS A;  3WNM A;  1JYW A;  1JZ6 A;  1O8S A;  1WKY A;  2V4V A;  3W5M A;  1W8O A;  2QQM A;  3A23 A;  4A3Z A;  3A22 A;  3K77 A;  4D8M A;  2JDA A;  2XON A;  3C7E A;  1UYX A;  4LKS A;  3LPF A;  3CIH A;  5JXJ A;  3NNG A;  1JYV A;  3OEA A;  3ACI A;  2VME A;  1K3I A;  3VD4 A;  4MGQ A;  1NX9 A;  3PUI A;  2VR4 A;  1KGY A;  3CKH A;  5G05 L;  4DUV A;  3WNL A;  5B4X A;  5JXH A;  1OT5 A;  4CUA A;  4A42 A;  1UMH A;  2E31 A;  3IB3 A;  4GWI A;  4A41 A;  3ZM8 A;  2Y8K A;  3FL7 A;  4OYU A;  1TVG A;  3MO4 A;  4KWU A;  2HYX A;  4BXS V;  4TTG A;  2PQS A;  5DPN A;  3WNO A;  2EID A;  3I2H A;  3GM8 A;  3LEI A;  2BER A;  5C70 A;  1W99 A;  1SG3 A;  2YFZ A;  1W9S A;  4Z2A A;  2BZD A;  2J7M A;  3ACG A;  3VDB A;  3K4A A;  3SEP A;  2W87 A;  2VZR A;  2Y6H A;  1K42 A;  2W1U A;  1F4A A;  1SHW B;  2ORX A;  5JMO A;  2C26 A;  4ZZ5 A;  4QX3 A;  3J7H A;  1UY3 A;  4QB1 A;  1KEX A;  4PQQ A;  3DYO A;  5LA1 A;  3CMG A;  4MOA A;  1CIY A;  3GDB A;  1US3 A;  4ZY9 A;  2VM9 A;  1L7Q A;  1LNS A;  4QB6 A;  1UY0 A;  2JE8 A;  3U37 A;  3UES A;  3WNP A;  4QPW A;  5FUI A;  1JYX A;  2ZEW A;  3DYM A;  1CZS A;  4XUP A;  4CVU A;  3T09 A;  2J1R A;  1OD3 A;  1UY2 A;  2EIC A;  1XNT A;  3D3A A;  2VTF A;  4OUE A;  1XC6 A;  5F7U A;  4ZZ8 A;  1IQD C;  2W1Q A;  3MUY 1;  4IUG A;  4M4P A;  3I2J A;  2WUH A;  2XOM A;  1JU4 A;  2WDB A;  4YPJ A;  3HNM A;  1J84 A;  4E8C A;  3P1I A;  5EJZ B;  4OZO A;  4CU7 A;  5C71 A;  3LEG A;  2DCK A;  1DYO A;  5EJ1 B;  3HPN A;  1DLC A;  4DUW A;  1SDD B;  4QDR A;  4XUQ A;  1ULP A;  4BDV B;  3T2Q A;  4QAW A;  2VMF A;  2W46 A;  3I2K A;  2RV9 A;  3K75 B;  4W4Z A;  4D0Q A;  1J83 A;  3C7O A;  5HXM A;  2QQL A;  4DUX A;  2X09 A;  3NJX A;  4JKM A;  2WZ8 A;  3HNY M;  1NAE A;  4ZXE A;  3WF0 A;  4PF1 A;  1UY4 A;  2W95 A;  4CUC A;  4LQR A;  3LPG A;  2L9L A;  2VCC A;  5EIY B;  1H6Y A;  3JXS A;  4XUR A;  5IFP A;  1JYN A;  1EUT A;  4UI9 L;  3PUH A;  3THD A;  3HN3 A;  3OEB A;  4ET7 A;  5CZK A;  5J1X A;  2W91 A;  2VO5 A;  3MV1 1;  2V72 A;  3ETP A;  3ABZ A;  3I3E A;  4QDS A;  3CZU A;  3NRU A;  2WO1 A;  4JKL A;  2Y6K A;  2VZO A;  2R7E B;  4MO3 M;  3CQO A;  2EIE A;  1PMH X;  1GOG A;  2VZV A;  3DYP A;  3NJV A;  5G04 L;  1WCQ A;  1D7P M;  4DEV A;  3ECQ A;  3OG2 A;  3I3D A;  3SKJ E;  3GXU A;  4M4R A;  2WYS A;  2YB7 A;  5LA2 A;  2BGP A;  2VCA A;  3C7H A;  4GZ9 A;  3IDA A;  4XZU G;  4CU8 A;  2VC9 A;  3WQB A;  1EUU A;  2LS6 A;  2VQT A;  4QB2 A;  5JXG A;  4DXS A;  2ZEX A;  3ACF A;  2C4X A;  1XPW A;  2VMC A;  1PX3 A;  1JI6 A;  2Z4F A;  4JKK A;  3WNN A;  5A1A A;  3WF3 A;  1I5P A;  1K45 A;  1UMI A;  1UY1 A;  2RVA A;  3ACH A;  1TG7 A;  2W3J A;  5LCW L;  1GUI A;  2BBA A;  2E26 A;  4BK4 A;  2VZP A;  1NKG A;  4L0P A;  4UOJ A;  1HN1 A;  2YC4 A;  5DQ0 A;  1GNY A;  1K12 A;  4DEQ A; 
#chains in the Genus database with same CATH topology
 1H6X A;  1NYW A;  5DZG A;  3T0A A;  2Y6J A;  1GNH A;  4QX1 A;  3VZK A;  4FBF A;  4YW7 A;  4HSL A;  5FMD A;  2JX9 A;  2J1T A;  3ENR A;  3KLS A;  4QM8 A;  3T0B A;  1POV 0;  3GZT B;  5EQU A;  4YW4 A;  2VJX A;  1RVF 3;  2IXJ A;  1R1A 2;  4P5Y A;  4PDW B;  4LBQ A;  1MS1 A;  2Z5W A;  2DUP A;  1ZRR A;  3VD9 A;  4BQ4 A;  4XJA A;  3JB4 C;  5DDJ 2;  3VZM A;  4CEY C;  1SCR A;  4RR3 A;  2MPF A;  4UFI A;  3DPR B;  3M3E A;  4HPK B;  2CGO A;  2HWB 2;  4K21 A;  1PO2 3;  2JDP A;  2BYV E;  3VHR A;  2ZZJ A;  3S7E A;  1JYC A;  2PEL A;  5FZO A;  3ILN A;  3NV3 A;  3ZPO A;  1W39 A;  2JG8 C;  4QMA A;  3UET A;  2VCB A;  1AYM 3;  2R06 3;  3SQO A;  3MIB A;  4Q4W 2;  4Y3O A;  5CKN A;  5FBJ A;  1W6P B;  4Q4V 2;  2QBX A;  3ILF A;  5C4W A;  1FX5 A;  1GU3 A;  5FYC A;  3HD8 B;  2J22 A;  4MGK E;  3E1F 1;  2FDJ A;  3C7G A;  2X5I A;  2Q1Z B;  1O3Q A;  1QJX 2;  2MNG A;  1W0N A;  3WG4 A;  4COV A;  3A7Q A;  1URX A;  1W0O A;  2A71 A;  1LOA A;  2WRA A;  1GQH A;  1X50 A;  4LBJ A;  4MHR A;  4QX2 A;  4B4Q A;  1JZ4 A;  3ZXL A;  4OZX A;  1BBT 2;  2AGS A;  3DKW A;  2YUE A;  5KHJ A;  5CFD B;  4QGL A;  3ES4 A;  4WVM B;  1YJL A;  2Y34 A;  1QJY 2;  2GH8 A;  5LZ6 A;  1CPM A;  2I74 A;  1XXN A;  2Q4S A;  2Q8O A;  2D6O X;  1UXX X;  1YWK A;  2OZ6 A;  4QPI A;  2VZQ A;  2X8K A;  4COU A;  3NQH A;  1V9U 1;  1AUY A;  1PM7 A;  2JD4 A;  4GMP 3;  4DY5 A;  5AFE A;  1PO2 1;  1JZ2 A;  4AED A;  4DXZ A;  2ZX1 A;  5FZ8 A;  3SC7 X;  1PX4 A;  4OFG A;  3ZXE A;  2EVX A;  2BOJ A;  4Y1X A;  2ADD A;  3BYW A;  3EB7 A;  4Y22 A;  2JKX A;  3ASI A;  2BFU L;  3HIF A;  2R07 3;  1JW6 A;  4P9W A;  1C5I A;  3GJA A;  2QQP A;  2AR6 A;  1QOT A;  5ANQ A;  3UYJ A;  4NRM A;  3C7F A;  4UFH A;  1DQ5 A;  2RMU 1;  1A34 A;  1PIV 2;  5IVJ A;  5JZG B;  1D4M 3;  5C3Q A;  1OLR A;  2ZX2 A;  4ZON A;  2G9F A;  1O59 A;  3AYE A;  1W9Y A;  1V00 A;  1DF0 A;  3Q9O A;  4Z07 A;  4ARX A;  5C5U A;  2YPD A;  4QPG B;  1I6X A;  4KU8 A;  4UFJ A;  4YGE A;  2Y6G A;  2UYA A;  1FXZ A;  2D3S A;  4XAE A;  2W94 A;  1HV0 A;  5KXD A;  1F4H A;  1DQ6 A;  5C3P A;  1OUX A;  2RJ2 A;  3VB9 A;  2VZT A;  4F3J A;  1QGL A;  1UXZ A;  1E57 A;  1HV1 A;  1F31 A;  2MEV 2;  4R9C A;  3TN9 3;  3DEC A;  3ROU A;  4CP1 A;  5GAL A;  5FO9 B;  3K4D A;  3B69 A;  2ADE A;  2E7A A;  1H0B A;  1GFF 2;  1CAW A;  4MH0 E;  3MEP A;  5FKC A;  3WCS A;  1VRH 3;  5JZG A;  5D8A B;  4XBL A;  3I2I A;  3H8U A;  1HDK A;  2R1B A;  2W47 A;  3BGA A;  3ORJ A;  4HVO A;  5FBZ A;  1BYH A;  3NW4 A;  2FMY A;  1W03 A;  2A6V A;  2VOX A;  4Q4Y 1;  4Q8L A;  3H7J A;  4Y24 A;  2PHF A;  5IVY A;  1NZC A;  4HK8 A;  4NVP A;  1PK6 C;  5FYZ A;  2VZ3 A;  1Q56 A;  1H1M A;  3VD5 A;  3N9P A;  1L7R A;  3POJ A;  4XIK A;  1FAT A;  4ISR A;  2OPK A;  4QKN A;  2YBP A;  4OHZ A;  1H9P A;  1NT0 A;  1RVF 2;  3BU7 A;  5CVR A;  4BE3 A;  2ZX4 A;  4QDQ A;  5ACA 1;  2W5F A;  4MHU A;  3T2P A;  1PZ7 A;  1H1I A;  3ZYF A;  3SXW A;  4Z2W A;  1JZ3 A;  1JZ7 A;  4EN6 B;  4JGY C;  3CDZ B;  5B2G B;  3WW3 A;  3W5N A;  2XJU A;  2UY8 A;  4KGQ A;  4YWA A;  3ZMN A;  5FPB A;  2WN3 A;  1AYM 2;  2RM2 3;  2H0B A;  2LUW A;  1GOH A;  4ES8 A;  1XQN A;  3TOJ A;  3WUD A;  3UL2 A;  2CV6 A;  3NKG A;  5BNP B;  3OGR A;  3UJO A;  4F8A A;  4H7M A;  4NIG A;  3AC0 A;  4BB3 A;  1M4W A;  4M0H A;  4P9G A;  5CIS A;  4IE7 A;  3O1U A;  3BKZ A;  2XWJ B;  2RDQ A;  1AJO A;  3R6S A;  1HLC A;  1FMD 3;  2R04 1;  2QQV A;  1N47 A;  2XVK A;  5LBF A;  4FPF A;  1OMI A;  2NLR A;  4P00 B;  4UF0 B;  3MFA A;  2VNO A;  2E63 A;  5C5T A;  2G1M A;  2HWC 3;  2NN8 A;  4OMC A;  5L36 A;  1FYU A;  4O65 A;  5LWB A;  4R52 A;  2FBE A;  1QY4 A;  1ULO A;  4LK7 A;  4UAP A;  4JC1 A;  3K46 A;  3POW A;  4NHK A;  4IL7 A;  3RGB A;  3O7O A;  4CDX C;  3HT1 A;  1ZZC A;  1S0D A;  5DZE A;  4HT1 T;  4JHZ A;  1UF2 C;  2ZXQ A;  4GAZ A;  5HBA A;  2EF6 A;  5A6X A;  4WZF A;  1O8P A;  4CCC A;  2YPJ A;  4H2A A;  1RL3 A;  1UU5 A;  3O12 A;  1LOC A;  1MVE A;  1RUJ 2;  5D8A A;  5FP7 A;  2PAE A;  3AMM A;  4HON A;  5L73 A;  3VBR C;  3ZSJ A;  2PHU A;  4YW1 A;  4AZZ A;  4CZS A;  1AJK A;  3IIA A;  2Z2S B;  3FN9 A;  1PVC 3;  1UZ0 A;  1SCS A;  4BH9 A;  3UKT A;  4E4H A;  3OY8 B;  1AVB A;  3AZZ A;  1O5U A;  1B35 B;  1CWP A;  3W58 A;  1H8T B;  3G7D A;  3S0M A;  4KL1 A;  1EYB A;  5DAW A;  5FYU A;  1UKR A;  5FZ1 A;  4XET A;  3RNS A;  3JQW A;  3OY8 A;  3AP7 A;  1OH4 A;  2VE1 A;  4QPG A;  4AQ2 A;  3TNP B;  1YEW A;  4HKO A;  1RUC 1;  3SIS A;  3O0W A;  2A73 B;  2WNU C;  4F7Z A;  1CJD A;  2G19 A;  5KHK A;  2WNU A;  3WIN E;  1MVQ A;  1F15 A;  1V6I A;  3WNM A;  1JYW A;  4LE3 A;  4M3C A;  4Q2F A;  4NE9 A;  3P3N A;  3RZM A;  2D5H A;  2VBP A;  1YI7 A;  1RIN A;  1FV3 A;  3B94 A;  3VBO C;  1WKY A;  2PFW A;  2V4V A;  4KWJ A;  3W5M A;  1ZRD A;  1BMV 2;  2RR1 2;  4JCK A;  2DWR A;  3ZKY A;  2D6P A;  2TNF A;  4NID A;  5K9Y A;  3MF6 A;  2HWC 1;  3A22 A;  1FI2 A;  4D8M A;  2JDA A;  1UZW A;  4LO8 A;  1GZW A;  4M00 A;  4UFM A;  3SCF A;  2XON A;  4ZU5 A;  5T52 A;  3ZIW A;  1RHI 1;  1N3O A;  1CAX B;  1CR7 A;  2DTW A;  3GF6 A;  4KG8 A;  2A6W A;  2VGD A;  3LPF A;  4K9S A;  1LOG A;  2JDU A;  5JXJ A;  3NNG A;  1ND2 C;  1JYV A;  4YZ3 A;  1PGS A;  3OUI A;  4LIV A;  4MG2 A;  1Y43 B;  4MGZ E;  2GH2 A;  4OI4 A;  4COZ A;  3T1L A;  1IPJ A;  2HWE 3;  3CF6 E;  3OOX A;  3PUI A;  2PLV 2;  3VHO A;  4DUV A;  1CON A;  4IES A;  5HXV A;  1Z7S 3;  1XSQ A;  3MIE A;  2UU8 A;  3I8T A;  5B4X A;  3EHK A;  2ZGS A;  4MUV A;  1VBD 2;  2E31 A;  2WFP A;  5FTT C;  4FPJ A;  4A41 A;  1ND2 A;  2E7T A;  4UW6 A;  2JEM A;  2OII A;  2R30 A;  3T4H B;  3ZM8 A;  1W8F A;  3K3O A;  5IW0 A;  1WW4 A;  3BTX A;  1VBD 1;  2R04 3;  4KWU A;  4BM8 A;  1MQT A;  5FR3 A;  2WA3 A;  1X9P A;  3WW2 A;  3WNO A;  1UPI A;  1FNY A;  3S57 A;  1Y9M A;  3AFG A;  2EID A;  4H7L A;  3GM8 A;  4Q0U A;  1EV1 1;  1UX6 A;  4PIY A;  2BER A;  5FYB A;  2WWJ A;  3LDR A;  4LHL A;  2DVF A;  5GZD A;  4N7I A;  4DZG A;  1SG3 A;  2ZA9 A;  5FZA A;  3DPR A;  1LEC A;  1UAI A;  3NKT A;  3VDB A;  4ZS3 A;  5IK5 A;  4LO6 B;  3K4A A;  4GB3 3;  1VRH 1;  2VD7 A;  5J37 A;  5FMO S;  4NHX A;  4FFG A;  1BVP 1;  4P9X A;  5LRS A;  1YQ8 A;  1BMV 1;  2XXZ A;  1W6Q B;  5FZ3 A;  5GLU A;  4ZU7 A;  5JIA A;  1OVS A;  1D0G A;  4NWW A;  4G9S B;  1QJY 3;  4YGC A;  5EYX A;  4LBL A;  1QKQ A;  2XKO A;  4JGZ C;  3USU A;  5BNN A;  4PQ9 A;  1VB2 A;  4AGG A;  1UY3 A;  5CNA A;  1HQN A;  5LA9 A;  3N9N A;  3PTR B;  1KEX A;  3E5Q A;  2PLV 3;  1PVC 1;  4NRO A;  2IXK A;  4R9B A;  1DZQ A;  1LES A;  4E2Q A;  1TEI A;  2HEW F;  1VIW B;  3GDB A;  5IAV A;  4ZY9 A;  5L9R A;  2IVI B;  2YHJ A;  1LNS A;  2P3Y A;  1R09 2;  3O0X A;  2GME A;  2P4E A;  4I0B A;  1UMZ A;  4QGN A;  4QB6 A;  2HBT A;  1UY0 A;  3RWK X;  2JE8 A;  2XUE A;  3G6J B;  3MIG A;  1AR6 2;  4D6R A;  2GSY A;  4CXW A;  5DAV A;  1JYX A;  2RS5 1;  1VPH A;  1GP6 A;  4CVU A;  4CDW A;  2D43 A;  3KT4 A;  3E97 A;  3RYR A;  1UU4 A;  3WP6 A;  1LGB A;  2DYC A;  2EIC A;  1DU3 D;  4QXK A;  3ZXA C;  3D3A A;  4RQP B;  3WOG A;  4AFB A;  4ZZ8 A;  4GWN A;  4IEV A;  2FZ1 A;  5ABJ C;  2W1Q A;  4JDN A;  1J3P A;  2JKB A;  3J8F 3;  3I2J A;  4MYE A;  1VBC 2;  5SV5 A;  3WD5 A;  4JGY B;  1JU4 A;  1EY2 A;  5A3T A;  4GJZ A;  2OA2 A;  4LTA A;  2VXR A;  1IKQ A;  2KR2 A;  1J84 A;  2B7Y A;  4SBV A;  1PO1 2;  4YGD A;  4CU7 A;  4YM1 A;  2A1X A;  2P1B A;  3LEG A;  4X6Q B;  2PMW B;  2FQP A;  2DCK A;  2QTW B;  5FY4 A;  1KRI A;  1ND3 A;  4XIL A;  1DLC A;  3T3Y A;  3B01 A;  3WXP A;  3FX3 A;  3MW3 A;  1ZZB A;  4XUQ A;  4D6Q A;  5CFC C;  3B3Q E;  1LOF C;  4CEY B;  4Y20 B;  2W46 A;  1RC6 A;  3I2K A;  4HK9 A;  1AYM 1;  3PUQ A;  4Q0Q A;  4SLI A;  3I49 A;  5FJK A;  1QXP A;  3V0B A;  1H1A A;  1PVC 2;  2VNG A;  3TYJ A;  3C7O A;  1BEV 2;  5HXM A;  2X09 A;  2VTX A;  1VBA 1;  4M3C B;  1HB4 A;  2B39 A;  2Q30 A;  2ENR A;  4PF1 A;  5F3E A;  1QDO A;  2BDR A;  5I0S A;  3BI3 A;  5HCF A;  2TUN A;  4I3P A;  1G9B A;  3CL1 A;  1JN2 P;  3OGG A;  3J8F 1;  5I8T A;  1AX0 A;  3JB8 A;  3O14 A;  1PNF A;  2QE3 A;  2VCC A;  4O9E A;  4XE9 A;  1NXD 1;  4YW6 A;  4PF5 A;  4CDU A;  3ZFF C;  1H8V A;  5F5I A;  5FY8 A;  3O1O A;  3ZYI B;  3VUO A;  1OOP A;  5GZE A;  3V64 A;  3B9C A;  4IET A;  1CQ9 A;  2QKD A;  1ODN A;  2CNA A;  2ARE A;  3KCC A;  3KQ4 B;  4FSJ A;  1NLS A;  1FV2 A;  2JEN A;  4RFT 0;  1KFU L;  4PBO A;  3DEM A;  5A32 A;  1DFQ A;  3S5A A;  1EAH 2;  1TMF 2;  3HN3 A;  4HPK A;  3Q8A A;  4KWK A;  3UT0 A;  5A70 A;  5CZK A;  3H1M A;  5FPV A;  2BPA 2;  2ZPX A;  1QOO A;  4R8H A;  1ND2 B;  4HL0 A;  2NP0 A;  3F95 A;  2WS9 1;  3I3E A;  1F5J A;  3WW4 A;  3KM5 A;  3N4M A;  2Y26 A;  5GM0 A;  4MO3 M;  3ZFG C;  1W06 A;  2EAK A;  3ZFF A;  3A0N A;  1SMV A;  4JHT A;  1WLW A;  1PMH X;  1GOG A;  2EIE A;  3NJV A;  2HWC 2;  4LUM A;  5E8A A;  1ENS A;  5G04 L;  1Q8Q A;  5FZE A;  4AAP A;  4BHP A;  2XL7 A;  5I8S A;  1O3S A;  1N1Y A;  4LIT A;  4LUL A;  3FE5 A;  2DFC A;  3PDQ A;  2WSU A;  4LUK A;  3GXU A;  4Y5S A;  1K42 A;  2GMM A;  2WYS A;  5LBC A;  3CJI C;  1CAV A;  4LMF A;  4N8M A;  4FFF A;  4RS5 B;  5CU1 A;  5JOY A;  3C7H A;  1K5M B;  3ACL A;  2FDH A;  4GZ9 A;  4FFI A;  1SEF A;  3N9O A;  4Y4R A;  5T3N A;  1PVX A;  2VQT A;  4AQ6 A;  4XXA A;  5JXG A;  3I3M A;  1ZA7 A;  3PHM A;  2ZEX A;  1PM4 A;  1D2Q A;  1DQ1 A;  4XF9 A;  5EHD A;  3BVC A;  2OZJ A;  5IVB A;  1PX3 A;  4GA9 A;  4BIS A;  4JRL A;  1GIC A;  2RS3 1;  1JI6 A;  4YG3 A;  2WR9 A;  2RMU 3;  2XLF A;  4JKK A;  2MEV 1;  2QZ2 A;  3D6E A;  5A1A A;  3JD7 2;  3THT A;  5FY1 A;  3AJY A;  4BU2 A;  4EWA A;  3WF3 A;  1HN0 A;  4Q26 A;  2D6M A;  1UW8 A;  1HB2 A;  1I5P A;  1K45 A;  1UY1 A;  3OPT A;  1JH5 A;  3OUJ A;  3WT3 A;  3ZLI A;  5FZG A;  5LCW L;  1GUI A;  1MR5 A;  2E26 A;  2WNE A;  3DL3 A;  4FOW A;  5DXD A;  5T50 A;  5DG1 A;  1H2L A;  4RS5 A;  3VBH B;  1IS4 A;  4BK4 A;  2XJP A;  2YC4 A;  2WNV A;  2BTV C;  4KGG A;  5E1R A;  1XJA A;  4LIU A;  1OLM A;  2VW0 A;  2XJT A;  4AFC A;  1AX1 A;  4FXK B;  2AEY A;  3VBS A;  1LHN A;  1PGW 1;  4BLJ A;  3UGH A;  3KV9 A;  4BXF A;  4KI5 M;  3WX5 A;  4ISQ A;  4LKD A;  2HLE A;  3SEE A;  3SLI A;  1WUV A;  3R4U A;  5A7W A;  3USU B;  4LLF A;  2JG8 A;  1DG6 A;  1X9T A;  5FO7 B;  1ZX5 A;  4IQP A;  3WDV A;  4IXL A;  2HJI A;  3H3L A;  2RDN A;  4P14 A;  3MID A;  2GDF A;  2DF7 A;  5LAT A;  1ENQ A;  4HET A;  4KH9 A;  1WW6 A;  3K4Z A;  2NYY A;  1K5J A;  3NO8 A;  4COW A;  2WQ8 A;  2WAB A;  1LGN A;  4XFG A;  1F5F A;  1O4Z A;  3AM2 A;  1FOD 2;  4RYD A;  5B4N A;  5FZF A;  4Y5T A;  3K48 A;  4JX0 A;  5FLH A;  2Q8D A;  3O0V A;  2DCT A;  1QJZ A;  3KWV A;  5FY5 A;  1JOJ A;  2DVD A;  3RYK A;  1ASJ 2;  1QEX A;  3FZ3 A;  3VZL A;  4BQX A;  2VNV A;  3ZSM A;  3MV0 1;  5IHR A;  1UYZ A;  4OLL A;  1W6M A;  5AC9 3;  5HCH A;  4HLT A;  1JU3 A;  1VBB 1;  4WM7 A;  4HN0 A;  4Y1V A;  1UYP A;  4N53 B;  1GKB A;  2JE7 A;  3OD0 A;  3K3N A;  3M2M A;  4M3C E;  3NV2 A;  1AYN 3;  1RMU 1;  2YGL A;  1VBB 2;  3CNA A;  3ZYB A;  3MPP G;  1A3K A;  1WCU A;  2VMG A;  4DY3 A;  2UYB A;  1AXY A;  4UWD A;  1EAH 3;  1C4R A;  1W8T A;  4I0W B;  5A7Q A;  1VBE 2;  3F2Z A;  4W8J A;  2HWF 1;  5HPO A;  3PTY A;  4MAD A;  2RR1 3;  5K7P A;  1MPX A;  4FPG A;  1WBL A;  3QH7 A;  3WG2 A;  2XQX A;  3SHR A;  1BVV A;  3BN6 A;  4UW4 A;  2WO3 A;  5E88 A;  4J1W A;  5GLZ A;  2VMD A;  5FP3 A;  3ZR6 A;  3MYX A;  4AQS A;  1NY7 1;  2QDN A;  2ZGQ A;  3VBR B;  3ZFF B;  1LEN A;  4MXW A;  3FLP A;  5DUX A;  1RUF 3;  1R64 A;  1GP5 A;  2OUJ A;  1W28 A;  4JDM A;  4X6R B;  4H14 A;  5DDJ 1;  1MQT C;  3KHB A;  3OD4 A;  4OUM A;  1MEC 2;  3IAP A;  1SLA A;  4AGR A;  5FPX A;  4NAO A;  4LR4 A;  4NO4 A;  2BRT A;  2C9K A;  3W9A A;  1RUG 1;  4YVW C;  1SBF A;  4UW5 A;  1LED A;  4YVW A;  3W21 A;  3ZXF A;  3Q8F A;  1O91 A;  4W6Y A;  3MBW A;  1Y9Q A;  4PI0 A;  3RS6 A;  4AG4 A;  3BB6 A;  5BY5 A;  4YVS C;  1MS8 A;  1NUK A;  4DB5 A;  2OT7 A;  1QU0 A;  1RUD 3;  1BCX A;  3P6B A;  3MIF A;  2QJV A;  2GAU A;  4W6W A;  1RUH 2;  4HMZ A;  1X7N A;  2B45 X;  2LW8 A;  3ATG A;  1BHG A;  3OPW A;  3WEZ A;  2OS2 A;  3WW1 A;  5EPA A;  3RZH A;  1Y9G A;  3OF1 A;  1LOB A;  1MS4 A;  4AF9 A;  4AVV A;  2XJQ A;  1NA1 A;  1TE1 B;  2VNR A;  4PT6 A;  5FP4 A;  5JLV A;  3WQ1 A;  4AAX A;  3CLP A;  2JDH A;  3K51 A;  4RS5 C;  4V2W A;  3V0B B;  2Y6L A;  5CBL A;  4BZ4 A;  1XNA A;  4G3Y C;  1DDL A;  5FMC A;  3I3B A;  1VBA 2;  2JD9 A;  1G6N A;  2ZS6 B;  4IDZ A;  2ZGM A;  3GAL A;  4CEY A;  5I0U A;  1JHJ A;  1AZD A;  3SH5 A;  3S6P A;  3JCI A;  4K1Y A;  3SIT A;  1E5I A;  3B93 A;  3KB5 A;  1ZZ8 A;  3VL8 A;  4S2G A;  1AX2 A;  3VN4 A;  4NUB A;  2PHT A;  4BK5 A;  2OXB A;  1SLB A;  2WT0 A;  4IEO A;  4J6G A;  4A44 A;  3LF7 A;  1Z7S 2;  2B9V A;  3LOI A;  4AEK A;  1SFP A;  3WHU A;  1FPN 1;  5TSW A;  3HQU A;  2GN3 A;  5IYY A;  4UFL A;  1APN A;  5DUV A;  3H8X A;  1S2E A;  3VBO B;  3GYD A;  1REE A;  4P5H A;  3VBH A;  3CZJ A;  1DYP A;  2XWB B;  2HWB 3;  1CAU A;  2LRO A;  5EP9 A;  4D3W A;  1NQJ A;  1MZF A;  3VBS C;  3AXE A;  2RS5 3;  2YC2 A;  3SCG A;  3LFI A;  3VKL A;  5FZL A;  1Y4W A;  5DUW A;  5FZ7 A;  3OBZ A;  2NZ9 A;  3WG1 A;  3DF0 A;  3LAG A;  1UYY A;  2JEC A;  5LA0 A;  5JSO A;  1RUN A;  5JXI A;  2DCJ A;  1CES A;  2XLA A;  1D2S A;  3LA7 A;  3OBR A;  4LHS A;  2YU2 A;  4HVQ A;  1VAK A;  4WM8 C;  2VH9 A;  5E6H A;  3HEI A;  1GP4 A;  2WC2 A;  3I4I A;  3VD3 A;  2E33 A;  1RB8 G;  4FTB A;  2ZX3 A;  2VVF A;  5F8P A;  5A3O A;  3KQR A;  3KZ4 C;  4IER A;  3OGJ A;  1CVN A;  1YFU A;  1VBC 3;  4FFH A;  1RXF A;  2YFU A;  4JRA A;  1U5Y A;  4YZ5 A;  4Z92 B;  3RI8 A;  1UOJ A;  3SKV A;  2ARA A;  5FRE A;  2RS1 2;  3PL0 A;  1OXC A;  1P8J A;  1U5X A;  3I2G A;  4N43 B;  1UZY A;  1GMM A;  2BJS A;  4CA9 A;  5GKA C;  1PIV 1;  5FPA A;  2A7A A;  1T2X A;  5A7S A;  1JBC A;  1OQ1 A;  4YAR A;  2QQO A;  3LEM A;  1WD4 A;  1U12 A;  4YRD A;  2RE9 A;  1W6N B;  2GU9 A;  5A7O A;  2K2S A;  1SPP B;  4HG6 B;  2JWP A;  4XMA A;  4BQ1 A;  1JS9 A;  1XBF A;  1XB9 A;  3I2F A;  1BK1 A;  2RJL A;  2VBD A;  4CSW A;  4ES9 A;  3ZSL A;  4QWN A;  4Z1V A;  3HJR A;  4Q4X 3;  3WP3 A;  4AHY A;  3LB9 A;  4TN7 A;  2BGO A;  4I0A A;  3WP4 A;  1XNK A;  2ZMK A;  1BEV 3;  4PBP A;  4XEZ A;  1F8V A;  1W9T A;  5H9R A;  4JQR A;  3JZV A;  2ETE A;  2HYK A;  3JD7 3;  5LAS A;  3OGV A;  2P2K A;  3JUU A;  4KMQ A;  1VBD 3;  3IBM A;  3ZYR A;  1SFY A;  1MZ5 A;  4LA2 A;  2QQI A;  4LLO A;  4U2A A;  5FLJ A;  4B29 A;  1U5Z A;  1FMD 2;  3JQX A;  3VD7 A;  2RMU 2;  2VTX J;  3ZFE C;  5IAX A;  3ZIX A;  3OGS A;  3RPQ A;  4A3X A;  1LEM A;  1C1L A;  1JZ6 A;  1GYK A;  2AZ5 A;  3BOD A;  3POG A;  4Q4Y 3;  1W8O A;  1Y3T A;  3KV4 A;  5EJ3 A;  2WFF 1;  4Y26 A;  3L2H A;  2DVA A;  1NG0 A;  4MXW B;  5L19 A;  2NM1 A;  4XW3 A;  3U4X A;  2GAL A;  1PHM A;  1RXG A;  3C7E A;  4J1X A;  2H6C A;  1NZI A;  4LO7 A;  1UYX A;  4RGK A;  3ZX7 A;  3WQ0 A;  1STM A;  3KCY A;  5K8S A;  4GB3 1;  2XBO 2;  3KV5 A;  2LM3 A;  3PVB B;  4IND A;  1ZRE A;  4FP3 A;  4IE4 A;  1RUF 2;  2ZGL A;  5LRR A;  4QD2 A;  3AKQ A;  2FCV A;  5JOW A;  2D98 A;  5EZW A;  2XBO 1;  4DO0 A;  1JYT A;  3S7I A;  1KGY A;  4JGY A;  5A7P A;  3CKH A;  5G05 L;  4QX5 A;  2WKK A;  4EN7 B;  4Q0P A;  1QH7 A;  4AFM A;  1HKD A;  1AL0 G;  3POY A;  5JXH A;  5BNP A;  2V73 A;  5LY1 A;  3QAC A;  1RUG 3;  4LBO A;  1UMH A;  3IB3 A;  2P6H A;  3NAP C;  3VKO A;  3NV4 A;  4BQ5 A;  1SLT A;  1GSL A;  1DQ0 A;  3AKT A;  2Y8K A;  1A8M A;  3TRS B;  1TVG A;  4L99 A;  4NHM A;  3VHP A;  1BBT 1;  2MEV 3;  5DAQ A;  1S2B A;  1BBT 3;  1W6O A;  3ZVX A;  2Q8E A;  1VBB 3;  1VMF A;  4OHV A;  4Q29 A;  1H2M A;  1WMD A;  1NCQ A;  4ITC A;  4XF3 A;  5FXX A;  1MS3 A;  3I2H A;  5BNN C;  5C3S A;  3LEI A;  5JDB A;  3MZH A;  1RUH 1;  3PU8 A;  4V1P A;  2CL2 A;  4X8P A;  1QOS A;  5FY0 A;  5C70 A;  1KXG A;  4OUL A;  4XDO A;  2YFZ A;  2W2I A;  1W9S A;  1FAY A;  2UWB A;  4FOY A;  2A3W A;  2W08 A;  2YRO A;  3ZFG B;  5JR2 A;  5JOX A;  4FTS A;  3S30 A;  1Z0H A;  1O6U A;  5K0U B;  1UZV A;  2RR1 1;  1LUL A;  4LEJ A;  4CDX A;  5A6Q A;  1PO1 1;  3AVS A;  4OVE A;  2F17 A;  1EPW A;  2X5I C;  4IV3 C;  4NHL A;  3LA3 A;  3IPV B;  4AHZ A;  5F6L B;  3EJK A;  4OI0 A;  3M8L A;  5JMO A;  1SPP A;  2C26 A;  5JI9 A;  4UYB A;  4NR1 A;  1ZA4 A;  4XC9 A;  2P6C A;  5F32 A;  5K0U A;  4QB1 A;  3PU3 A;  5BNQ A;  1AXZ A;  1W8H A;  1W2N A;  5FXV A;  1ZBE 3;  2WT1 A;  1JTZ X;  4K40 A;  4RFR B;  1H4G A;  5CA6 A;  1XSR A;  4Y33 A;  5C9A A;  4IE0 A;  5FQ0 A;  1V6N A;  2DUO A;  3CMG A;  4MOA A;  1CIY A;  3HVD A;  4S2D A;  4CP9 B;  1US3 A;  2VM9 A;  2VBB A;  1HJG A;  3KV6 A;  3NNM A;  3JBG 3;  3ZOI A;  3U37 A;  2D7F A;  2CAV A;  2RS3 2;  4O7X A;  4QPG C;  4DRR A;  2ZEW A;  2CGP A;  3O5S A;  1UIK A;  5FYI A;  3T09 A;  4AED C;  1XE7 A;  1UY2 A;  1QH6 A;  1KQR A;  5K4L A;  3PME A;  1C28 A;  2FDK A;  1A8D A;  2O8Q A;  4AE2 A;  1IQD C;  1ZRI A;  1HRI 2;  3S5Q A;  3UKN A;  2O1Q A;  4N43 C;  2OQ6 A;  3X29 B;  4AI9 A;  5IVC A;  3GZE A;  5JMC A;  3RI9 A;  2JB4 A;  1DHK B;  2PHW A;  1QJX 3;  2XOM A;  1FNZ A;  4EJR A;  1RHI 3;  4YPJ A;  5IAT A;  1CAU B;  4CCL A;  1IPK A;  1AL2 3;  3KVB A;  4EZH A;  1KDM A;  3DXU A;  5EJZ B;  3TN9 2;  2DBI A;  1I9R A;  4LE4 A;  3DXT A;  5JZG C;  5FV3 A;  5FP9 A;  1S0G A;  2D40 A;  1TME 1;  2DBN A;  1LTE A;  4GXL A;  5EXO A;  5FZC A;  5C3R A;  2PAM A;  2ZGU A;  5KHG A;  1JXN A;  4V2V A;  4QDR A;  2SBA A;  2ET1 A;  3AP9 A;  4J25 A;  1O3R A;  5T5P A;  1LGC A;  1TNR A;  4DRV A;  1SZB A;  2ZGT A;  3FJS A;  1IS6 A;  1J58 A;  2VMF A;  1ZBE 1;  2Y0O A;  1W3V A;  1UNB A;  1X8E A;  3K75 B;  4P9Y A;  2AAC A;  2P3I A;  4K8F A;  4D0Q A;  1J83 A;  4XF0 A;  2DVG A;  1AR9 2;  1DBN A;  4DIN B;  3IM0 A;  4KQ7 A;  2NPI A;  2R07 2;  2UUR A;  1NAE A;  4L92 A;  4TLG A;  4TWT A;  4BQ2 A;  1KIT A;  1QWR A;  5A6Y A;  5CEH A;  4CXY A;  5J3U A;  2JDY A;  4ZPI A;  1F9K A;  1CAW B;  4GJY A;  2CWM A;  2ARX A;  2W95 A;  3QCW A;  4COY A;  5KC6 A;  3LPG A;  3SH4 A;  5A32 B;  3PIG A;  1AXK A;  4XHX A;  4XYX A;  5FWE A;  5EIY B;  1QF3 A;  5BNP C;  3JXS A;  5E89 A;  4XUR A;  3D5O A;  4HFS A;  3KHC A;  2WA4 A;  4C1X A;  1TQ5 A;  1VMH A;  4QX8 A;  2YDE A;  4FOV A;  4K20 A;  2F6B A;  2B46 X;  5IK8 A;  4UI9 L;  4XJU A;  1SDW A;  2QVS B;  3AYA A;  2ZHN A;  3JD7 1;  4KNC A;  3U10 A;  3VBU B;  5C8W A;  4ET7 A;  1MAC A;  3LSD A;  4E4Z A;  1RUE 1;  1IKP A;  2XUM A;  2W0X A;  4QDS A;  4XCA A;  3CJI A;  3R05 A;  3WZ1 A;  3L9J T;  1NCQ C;  3NRU A;  2IUW A;  2EA7 A;  3N9M A;  4GD4 A;  4MX3 A;  4AHW A;  3WV6 A;  3RJR A;  2KXL A;  2R7E B;  3PVE A;  3ME2 A;  3T1M A;  5A7W B;  5A1L A;  3EQE A;  4M01 A;  1OA4 A;  1WCQ A;  1AR6 1;  2C9A A;  2RHP A;  3HBZ A;  4IE6 A;  3QBQ A;  2NMN A;  5A33 B;  2GP3 A;  3ETQ A;  3LIH A;  4K1Z A;  4D94 A;  1UD1 A;  2BNN A;  1VRB A;  3SKJ E;  5KHI A;  1HQW A;  4M4R A;  1W2T A;  1WLT A;  2V5Y A;  4B1M A;  3ES1 A;  1DIW A;  4N53 C;  5DAX A;  3RJ2 X;  3ZYJ B;  1R1A 1;  1BQP A;  3FUQ A;  4OUS A;  5LEJ A;  3DN7 A;  1RUG 2;  4JGZ B;  4D7S A;  1J3R A;  4JVA A;  4CCO A;  5DUU A;  1RIR A;  3LKJ A;  5FIX A;  2VC9 A;  4CU8 A;  1W05 A;  1EUU A;  1H8T C;  2WL1 A;  3U4S A;  4OHW A;  4Q0S A;  4QB2 A;  2ZAH A;  1DGL A;  3J7N A;  4ZU4 A;  5H9S A;  4L11 A;  2PTM A;  2ZZQ A;  2C4X A;  2RS3 3;  4IV1 C;  1HXS 3;  1HRV 1;  4QKB A;  4HOO A;  2WQ4 A;  2FDI A;  1YQC A;  2VMI A;  4H3W A;  4UW3 A;  2RM2 1;  1D4M 1;  2WNU B;  1AL2 1;  2IXI A;  4N53 A;  4Y1Z A;  5K0U C;  2YBK A;  3NMB A;  4E2G A;  3AFK A;  1JUH A;  2R06 1;  2R32 A;  2CWS A;  1TZO A;  3E5U A;  2RVA A;  5HV4 A;  3ACH A;  2W3J A;  3EBR A;  4GB3 2;  3VBO A;  4NN0 A;  1BKZ A;  1CGP A;  2LTN A;  3HR9 A;  4AVC A;  4L0P A;  4ERO A;  2BFU S;  3H3Z A;  3NV1 A;  4HXC A;  5DQ0 A;  3ZXG A;  4YW3 A;  5CFC A;  4BPZ A;  3P5B A;  2XHK A;  5EV7 A;  1ACC A;  1DQ2 A;  2CGN A;  2VW2 A;  3RZZ A;  3NNL A;  1DP0 A;  3A21 A;  4BA6 A;  4RR3 B;  1B35 C;  4LPL A;  2VVE A;  3D0S A;  1GWM A;  1NCR C;  1QJY 1;  1WMX A;  2XB6 C;  4LBQ B;  1FPN 3;  5BNN B;  3RRD A;  4XAB A;  1N3Q A;  1QNW A;  4P02 B;  5F3I A;  2HWD 3;  2C6S A;  3LZZ A;  3PLQ A;  5FRA A;  1ND3 C;  1ZZ6 A;  2PLV 1;  4I30 A;  2XPJ A;  4FTE A;  2VL4 A;  4P08 A;  2PAK A;  1E5H A;  1WW7 A;  3BU0 A;  1ZM1 A;  4NPL A;  1WLD A;  2XBO 3;  2ZBJ A;  4YYO A;  1OKO A;  3LEK A;  4CCD A;  2C24 A;  4MGS A;  4QPY A;  2A75 A;  4RSU A;  3MLL A;  3AYC A;  3AKS A;  4W50 A;  5F2S A;  3E6C C;  4DMI A;  5CFC B;  5JSR A;  2WWS A;  1ULC A;  4FI9 A;  1ULG A;  4LBK A;  4S2F A;  4TXW A;  1A6C A;  3AL5 A;  4XPV A;  4NOT A;  1UX7 A;  4X8N A;  4CP0 A;  2H6B A;  2WZE A;  4ATF A;  4UFK A;  4NAM A;  4GWJ A;  1WLC A;  4WBB A;  4CCM A;  3AYD A;  3EYP A;  4I01 A;  5CFD C;  4PLN A;  1RUD 1;  2Y6F A;  4FAG A;  4N9H A;  3POF A;  2HWB 1;  1CN1 A;  3AZY A;  1BZW A;  3BOP A;  4CYD A;  4C91 A;  4YZ2 A;  3TEW A;  4CCN A;  1QJU 2;  1QHD A;  3HT2 A;  1N3P A;  1YC6 1;  1DGR N;  1LHV A;  1RUD 2;  5H9P A;  2DUR A;  2P34 A;  3VBF A;  1HB1 A;  2Z69 A;  1S0J A;  5FK7 A;  2RS1 3;  3WR0 A;  3HQX A;  4Y20 A;  3GBG A;  4Y22 B;  5FY7 A;  3IWZ A;  1S0F A;  2ZEY A;  4QGM A;  3ST7 A;  1CAV B;  3AJZ A;  4FPH A;  1G8W A;  3N35 A;  1H30 A;  5AVP A;  4QX0 A;  1LJ7 A;  3ZMO A;  1CAX A;  4CCJ A;  1AF9 A;  3T0D A;  1ZZ9 A;  3THC A;  1O4Y A;  3AP5 A;  3H1Y A;  4AHX A;  4LBM A;  2PA7 A;  2VZU A;  3GZA A;  3MUZ 1;  4A7K A;  5FYS A;  4OI1 A;  4P9J A;  5A33 A;  2EAA A;  3A0K A;  1AR6 3;  4CUB A;  2DVB A;  3H8R A;  3EMR A;  3NST A;  1ZBE 2;  3OPZ A;  3B5L B;  5T5L A;  5LY2 A;  5IVV A;  1RYY A;  3FUO A;  3H0O A;  4YM0 A;  2D6K A;  5KC5 A;  4OMD A;  4YM2 A;  3CJI B;  3VDC A;  3I2O A;  4NIA A;  3O1S A;  2ZTN A;  1K5M C;  4CP2 A;  5FPU A;  3RVH A;  3AKR A;  3B00 A;  3QH6 A;  1WGP A;  4DXT A;  1SAC A;  5CG8 A;  1PGW 2;  4WV8 A;  1NE4 A;  3QLQ A;  4XJW A;  3EO6 A;  1GNZ A;  3L2Y A;  4XJ9 A;  4ZXK A;  5C8C A;  5F9T A;  2QDR A;  2WLP A;  4LOS A;  5T54 A;  4BQW A;  3BUC A;  2FD8 A;  2VZS A;  2JG9 B;  2YG0 A;  5JPM B;  3QD6 A;  1V6K A;  5C9A B;  1QQP 3;  2XGX A;  2Y64 A;  3TEZ A;  1L3J A;  2W1W A;  2ET7 A;  4E9K A;  1BXH A;  1S0C A;  4AVA A;  4XUN A;  4XFF A;  4U36 A;  1W8N A;  3A4U A;  4JAA A;  1OF3 A;  1BLZ A;  4PIZ A;  5C4W C;  1S2K A;  2VZ1 A;  1QIQ A;  3IAQ A;  4IGO A;  4XBN A;  3VBH C;  2R07 1;  3C2U A;  2WFF 2;  4YW5 A;  3VBU C;  5HI0 A;  5F2W A;  1O7F A;  2WAO A;  3WDX A;  3FLT A;  4CCK A;  5C8C C;  2O0O A;  2OPW A;  4HSJ A;  5FFO C;  5JVV A;  5GZF A;  5F3C A;  1G86 A;  3ZXK A;  1VR3 A;  3ZYG A;  1VP6 A;  3RQ0 A;  1KJL A;  3ZFE B;  4LT5 A;  3H7Y A;  4N90 A;  1QDC A;  3RMY A;  1PMJ X;  4YNI A;  4AXO A;  1QMJ A;  3DCQ A;  5IFT A;  5J7M A;  1YYN A;  2WZR 3;  5FYV A;  1MZE A;  3T2T A;  3ZO0 B;  3CHX A;  3AX4 A;  2W92 A;  5JWP A;  4XUT A;  2OW4 A;  3HQR A;  2R04 2;  1AR8 1;  4YFZ A;  5JR7 B;  3J7M A;  4OQ9 A;  4CDU C;  1OQD A;  4Y5Z 0;  5FOJ B;  2XML A;  5FZD A;  4AOC A;  4O9G A;  3HOB A;  1X33 A;  1O3T A;  1YQ2 A;  4K7J A;  4AQT A;  2RDR A;  3KMH A;  3ZPY A;  2GNT A;  4XQW A;  3NVC A;  3WLU A;  3BTZ A;  2UWA A;  4AVT A;  1OF4 A;  4PHZ A;  1XYP A;  3IMN A;  1HRI 3;  2XHN A;  4XAA A;  4ASM B;  5IUQ A;  2JDM A;  4BWO A;  2WBK A;  3I97 A;  1OVP A;  3BIE A;  3SCH A;  4QQ2 A;  1PZ9 A;  2BVB A;  5LEK A;  3RWN A;  1RGS A;  2JDZ A;  4QQH A;  4UBH A;  1T6G C;  1S0B A;  3III A;  5HCB A;  3AL6 A;  4PI2 A;  5T5O A;  1UWW A;  2VEC A;  3PMS A;  2X53 S;  4HBN A;  4XFC A;  4URA A;  2IWG B;  1US2 A;  1JZ5 A;  1RMU 2;  2DCY A;  3POI A;  4HZF A;  3U78 A;  4IW3 A;  4CXX A;  1NE6 A;  1GAN A;  3J7L A;  2ID4 A;  1ULE A;  4LOR A;  4A4A A;  2D93 A;  1SBD A;  2WO7 A;  4CUG A;  4ATE A;  1CPN A;  4DXR A;  4D7Y A;  2WZR 2;  2R0F A;  3MLK A;  5KXC A;  1LOD A;  2YZ4 A;  5LBE A;  3KSC A;  4NPM A;  4Q1P A;  4LO4 B;  3ZFG A;  2ZGK A;  4BME A;  1GOF A;  4YVS A;  2EXI A;  3VDA A;  3THP A;  3VZN A;  4TLF A;  1Q3E A;  4Z8B A;  5FZ4 A;  3N7L A;  4O61 A;  4A45 A;  4A7Z A;  4H55 A;  4E8D A;  2Q1M A;  1CZT A;  4DNY A;  1PZ8 A;  4YSF A;  3N9L A;  2XKP A;  4MV2 A;  3VKF C;  3RZL A;  1MQT B;  1W9W A;  4NII A;  1RUJ 1;  2WS9 3;  3IKW A;  4S2H A;  4FOQ A;  4ASL A;  1W0P A;  2ZAA A;  2VOK A;  2XR4 A;  2BOI A;  1VMJ A;  1NA1 C;  1AR7 2;  3D4K A;  5A3U A;  3INA A;  1B09 A;  2DFB A;  2EIB A;  1UPS A;  3LE0 A;  2XJR A;  3MF9 A;  2ZGO A;  3LIG A;  2BWA A;  4YVW B;  4ARY A;  3DPR C;  4PLO A;  1OHF A;  1O8S A;  1W2O A;  2FZ2 A;  1SLI A;  2QQM A;  4XZP A;  3FMG A;  1C8M 2;  4A3Z A;  4AEJ A;  5CAZ A;  3GNE A;  4QU1 A;  1GBG A;  3K77 A;  3OYW A;  4C0B A;  1UQX A;  3KF5 A;  4JGZ A;  4AED B;  4BIO A;  1YFW A;  2ZGN A;  4RD7 A;  4MZU A;  1G9A A;  4QPI B;  1Q8O A;  2O8O A;  4NMI A;  1OH3 A;  2AEN A;  5FZ0 A;  1V6O A;  1Y7B A;  2BGC A;  4A2U A;  2FMD A;  4Y1U A;  2N7G A;  5ABJ A;  5FUP A;  1PO2 2;  2VME A;  4A6S A;  3AP4 A;  4B4R A;  2IFW A;  1UZZ A;  3VD4 A;  2A6Z A;  3IN9 A;  1R1A 3;  2VR4 A;  4IV3 A;  3VKN A;  2HBU A;  2BW8 A;  4UBG A;  4D6S A;  4GQ7 A;  5F3G A;  3WNL A;  3NWK A;  1OA3 A;  1Q8V A;  1OPM A;  3U75 A;  1C5H A;  2CY6 A;  3PNA A;  1GLH A;  4CDW C;  4Q4V 3;  1OI6 A;  1OLQ A;  1OT5 A;  3VLB B;  1ASJ 3;  2JDK A;  4CUA A;  4A42 A;  1UOG A;  2QNK A;  1R09 3;  3IDC B;  4WVV A;  1XU1 A;  2D5F A;  3GJB A;  3JBG 2;  4WM7 B;  1C3H A;  2GP5 A;  2K46 A;  5EYY A;  5T5J A;  4N9I A;  5C9A C;  2VAU A;  5CKM A;  1DQ4 A;  1IG3 A;  4WM8 A;  3VBU A;  4CCE A;  3MO4 A;  2HYX A;  4BXS V;  1WA6 X;  1HXS 2;  3R0R A;  1RUE 2;  2PQS A;  2WIN B;  2W39 A;  1COV 1;  5C4W B;  1PGL 2;  2ILM A;  3M3I A;  3Q8B A;  3B9I A;  3MI8 A;  3WP5 A;  4AWD A;  2I07 B;  4Q1R A;  2D3P A;  5F39 A;  3FBM A;  1W99 A;  1XE8 A;  2AUY A;  3HN1 A;  3R4D B;  5FWJ A;  1W9F A;  3KD4 A;  5J98 B;  4AI1 A;  3ACG A;  3C3V A;  4BCU A;  2EXK A;  2NQY A;  2W87 A;  1VJ2 A;  1ST8 A;  2VZR A;  1N1S A;  1C8N A;  2WFF 3;  2Y6H A;  4FPC A;  4AVS A;  4ONU A;  1V6L A;  1F4A A;  2JXA A;  1UCX A;  5JOZ A;  4AI3 A;  3AP6 A;  4ZZ5 A;  3N7M A;  2ATF A;  4JV4 A;  4QX3 A;  3SNM A;  1DGW X;  2NMO A;  4IEU A;  4QKF A;  4C1W A;  1OOP C;  2HWE 2;  4MVT A;  4PQQ A;  1D4V B;  1YHF A;  1V6M A;  1RUF 1;  1PIV 3;  5LA1 A;  4GWM A;  1L7Q A;  1LRH A;  5C8C B;  3WDY A;  4R4Z A;  5FLI A;  1NCQ B;  5FUI A;  2ZGP A;  1UKG A;  2ZHK A;  3AMH A;  5A7N A;  3DYM A;  1CZS A;  2RM2 2;  3U11 A;  5GZC A;  4MGI E;  5I93 A;  4OHX A;  4IEW A;  1U5I A;  3PUA A;  1DZR A;  1VLN A;  1LU2 A;  1EV1 3;  4DFS A;  5D2A A;  1AR8 2;  1CJP A;  1PK6 B;  1XNT A;  4Q4W 3;  5BPX A;  2VTF A;  5L7O C;  3BTY A;  3IDE A;  1BJQ A;  5F7U A;  3E6B A;  2PQQ A;  1E5R A;  1G7Y A;  4ZHN A;  3MUY 1;  4CPB A;  3AMP A;  1QJX 1;  4QXH A;  5BXX A;  1PK6 A;  5FYM A;  1WBF A;  1J59 A;  1LOE A;  3LSE A;  1RUH 3;  5KHH A;  5ISL A;  2BNM A;  3P1I A;  4HVR A;  2XQR A;  2RS1 1;  2VOV A;  4OZO A;  4UT5 A;  2CAU A;  4XDQ A;  5C71 A;  3HAG A;  4PDW C;  4CDQ C;  1NCR B;  4XTM A;  5T55 A;  2XDV A;  3U1X A;  2IC1 A;  1I1E A;  1UO9 A;  4DUW A;  2GC0 A;  1SLC A;  3H42 B;  1SDD B;  4PIX A;  4EWD A;  2I45 A;  1NLQ A;  1UU6 A;  1W3X A;  1WCS A;  4XQD A;  4YG0 A;  2D6L X;  1DLL A;  3GHM A;  4CPB D;  4NIH A;  4QAW A;  2C0Z A;  1TNF A;  3RDI A;  1J1T A;  1Q8S A;  3GCX A;  3ZXJ A;  3H8O A;  3LDB A;  4KG0 A;  4FQ4 A;  5BNO B;  1LU1 A;  5A3L A;  1NY7 2;  2AEZ A;  4DUX A;  3NJX A;  4RL7 A;  4XAC A;  5JSP A;  2WZ8 A;  2RS5 2;  3HNY M;  5I0R A;  5CG9 A;  4ZXE A;  1NA1 B;  3WF0 A;  1W6M B;  1POV 3;  5FJH A;  1ENR A;  1AR8 3;  2VQA A;  4LNV A;  1RUO A;  4RR3 C;  4LQR A;  2TEP A;  2D6N A;  4MXV A;  1SFN A;  3I59 B;  4FVV A;  4JZR A;  4NPR A;  3J4U H;  1H6Y A;  4URT A;  2E9Q A;  5GJ6 A;  1ENX A;  1A78 A;  2XJV A;  2WYF A;  2QZ3 A;  1X36 A;  3MW4 A;  5FZO B;  4B1L A;  4TZD A;  4YLZ A;  1DGW A;  5J48 A;  1JHN A;  4HAN A;  2BNO A;  1AL2 2;  4C90 A;  1OC1 A;  1XU2 A;  3THD A;  3OEB A;  1HRI 1;  1S4C A;  2WNV C;  1VBE 3;  3UGG A;  1YUD A;  4QU2 A;  2W91 A;  2C1F A;  4QPI C;  5KR7 A;  1UOB A;  2ZGR A;  3ABZ A;  4EN9 B;  5BNO A;  1WD3 A;  3CZU A;  2VUC A;  1H4H A;  2XG3 A;  4YW2 A;  1GV9 A;  1R08 1;  4E27 A;  2VZO A;  3K2O A;  1N1T A;  2AH2 A;  3CQO A;  2PHR A;  3E5X A;  1C8M 1;  2ARB A;  1R1Z A;  1YO8 A;  3PUS A;  3VBR A;  4AL9 A;  1QXR A;  2HEY F;  2IXH A;  1D7P M;  1MZ6 A;  3ECQ A;  3OG2 A;  4EN0 A;  1IS5 A;  1T6B X;  4B4P A;  2Q0A A;  4PLM A;  4Y1Y A;  2BVV A;  1W8U A;  2XL9 A;  2Z42 A;  4QHB A;  2YB7 A;  4WM7 C;  4DIQ A;  1OQE A;  5FUN A;  5JIU A;  5LA2 A;  2YC0 A;  2BGP A;  4GH4 C;  2JIJ A;  2Q8C A;  2VCA A;  4YM3 A;  4FPY A;  4XF1 A;  4Z82 A;  3N3H A;  4Q5O A;  1NCR A;  1RJ7 A;  3RZK A;  5LB6 A;  2E53 A;  2GMP A;  1LCL A;  4LHK A;  4C0H A;  4C8D A;  5FO8 B;  5BUV A;  2Y38 A;  1PMI A;  4OQ8 A;  5DAB A;  2P3K A;  3ZKU A;  4RHV 2;  3PVN A;  3VDD C;  2JDN A;  1VE0 A;  4WVZ A;  4AFA A;  1YCI A;  1IOA A;  1GZT A;  2ZML A;  3ACF A;  2VMC A;  3POE A;  3TN9 1;  3U07 A;  4B8E A;  4E2S A;  4W65 A;  2P3J A;  2Z4F A;  3MPB A;  3WNN A;  2B5H A;  2E51 A;  3MDP A;  4RA0 A;  4FPL A;  1KJR A;  2VUA A;  3M1H A;  4HKL A;  1EP0 A;  1NOV A;  4FO9 A;  4YG6 A;  2FDG A;  1EV1 2;  1OUS A;  4CDW B;  4EWE A;  3QOP A;  1UMI A;  1XNC A;  1QJF A;  1TG7 A;  4LBN A;  2QUO A;  3NL1 A;  2BBA A;  2ZX0 A;  4ZS2 A;  1L7L A;  2VZP A;  1S55 A;  1HIX A;  1RUC 2;  1WW5 A;  1RED A;  4EZ4 A;  3VDD A;  2P5B A;  1GNY A;  1CZV A;  1K12 A;  3H9A A;  1IHM A;  5FZ6 A;  3FC0 A;  3BPS A;  1W8Z A;  1JZ8 A;  3LGR A;  3D8C A;  1C8M 3;  1J3Q A;  2E32 A;  5CIR A;  5CYY A;  3MGU A;  1WME A;  4NWV A;  2ORZ A;  4PDW A;  3MW2 A;  1V6J A;  2PN5 A;  4XF4 A;  3WF2 A;  5I0T A;  1JOP A;  2FCU A;  2J1V A;  2OKX A;  3POB A;  5FK8 A;  4XJ8 A;  2GND A;  1YIP A;  4WVW A;  2HWE 1;  2B42 B;  1XYN A;  1QJE A;  1V9U 3;  4GMP 1;  5F1R A;  1HXS 1;  1XRU A;  5L7O B;  4FPO B;  1COV 2;  1PGL 1;  1S1A A;  2B4K A;  3FFZ A;  4JQT A;  4IEP A;  2ZOE B;  1AR9 3;  1OOP B;  3FWE A;  4RGG A;  4M0N A;  3I2D A;  3OBA A;  4I02 A;  2QCS B;  5KBF A;  3OBT A;  1RUI 3;  4IGP A;  1GQP A;  3HMY A;  4GAL A;  2CTV A;  2J42 A;  2GNB A;  1VBE 1;  4XFA A;  3WF4 A;  2QQJ A;  4NJ4 A;  3PIJ A;  4L2N A;  2Y0I A;  1D0H A;  1VBC 1;  4CDQ B;  1X82 A;  2F4L A;  2I2S A;  4BQ3 A;  3UNP A;  5DZF A;  1FOD 1;  3MLJ A;  5A3N A;  3N9Q A;  2J1A A;  3O1M A;  1XYO A;  4OCT A;  1LR5 A;  4TYS A;  1ALY A;  2WZP P;  1VAM A;  5EFU A;  4KBZ A;  2VOW A;  4GUL A;  4CEW C;  5SV8 A;  3AZV A;  2WN2 A;  4FP2 A;  1H2N A;  3FHA A;  5IWF A;  4CE8 A;  4IV3 B;  2JIG A;  4XUO A;  3WF1 A;  3FFQ A;  3D82 A;  4YFW A;  5L9B A;  2HWD 2;  5BNO C;  4Q8K A;  3TB0 A;  3VHN A;  1VRH 2;  5F5Q A;  3OSD A;  2GC3 A;  2W9X A;  3CBN A;  5JI7 A;  4TSV A;  3T08 A;  2VQ0 A;  4QKD A;  1IPS A;  1VB4 A;  2DDU A;  3CU7 A;  3AVR A;  4WZC A;  2OQ7 A;  2X10 A;  1RVF 1;  3OB8 A;  1F35 A;  1BEV 1;  4NRP A;  4YGB A;  5I0D A;  4K6B A;  5CAD A;  1WMF A;  4IEZ A;  4FT8 A;  5A80 A;  3HWJ A;  2J1E A;  5A3M A;  2CDP A;  1IS3 A;  2X05 A;  1MS9 A;  4AR2 A;  1Z78 A;  3KF3 A;  1HX6 A;  2R06 2;  3VBF B;  3FBY A;  1CIW A;  4QHZ A;  4GH4 A;  3TBD A;  2VQU A;  3LQC A;  1ONA A;  1ASJ 1;  1GR3 A;  2A5Z A;  1WA4 A;  3HNB M;  3ZDV A;  1Q8P A;  2R0H A;  1G9C A;  1UOF A;  3O1V A;  1OFS A;  5JUV A;  2X5I B;  4P9L A;  4XXP A;  1W90 A;  3PUR A;  1ULD A;  2HEV F;  2WLQ A;  3ZXD A;  5D1I A;  1AR7 3;  2ERF A;  3J8F 2;  4FPK A;  5F6K A;  3VZO A;  3ITQ A;  1H8T A;  1EAH 1;  1F2N A;  1ZZ7 A;  2WJS A;  1AYN 2;  2J1U A;  3BAL A;  4DOU A;  1DZT A;  3WDU A;  4BMB A;  3ZDS A;  1AHS A;  2WO2 A;  1B35 A;  1RUE 3;  2ZAB A;  5C7G A;  4IV1 B;  5FQ0 B;  1IZ3 A;  1AYN 1;  5CB7 A;  3KGZ A;  5FAX A;  4YVS B;  1HW5 A;  4AI2 A;  3H1W A;  3ZYP A;  4YZ4 A;  4GH4 B;  1JOD A;  2K9Z A;  1QNY A;  5I8Y A;  3WSO A;  1I5Z A;  1R08 2;  2VOT A;  1GWL A;  4BJ0 A;  5JAX A;  4PJY A;  3IT8 A;  4Q0V A;  4E4D X;  4KU7 A;  4BIF A;  4CU6 A;  2XVG A;  3UGF A;  4XHB A;  1YJK A;  3BTA A;  2WAA A;  2X29 A;  2LAL A;  3ZR5 A;  4E4S A;  2VMH A;  2CHH A;  3LOB A;  3MHZ A;  1LHU A;  3VBS B;  5IK7 A;  4G4F A;  1ZYB A;  2ZHL A;  1MEC 3;  2PHL A;  3AMQ A;  2IFR A;  4UF0 A;  2DU1 A;  4RHV 3;  1V70 A;  5J36 A;  2CU5 A;  4UXA A;  3SH3 A;  2QQK A;  3GBF A;  5DDJ 3;  1W6O B;  2G4I A;  3H3U A;  3VL9 A;  1ND3 B;  2D44 A;  2G9G A;  4AYU A;  5FKB A;  2ZEZ A;  5IJR A;  4LKF A;  4WM8 B;  1HRV 3;  3WNK A;  3AB0 A;  1OD5 A;  4B7E A;  4BOW A;  3WNX A;  2V4A A;  2VVD A;  3ZN4 A;  3OTF A;  1WCK A;  2IXL A;  4A6O A;  4D69 A;  1S0I A;  5FYH A;  3U14 A;  1YRZ A;  2P37 A;  5FDB A;  2RG4 A;  2VUD A;  3OUH A;  2W1S A;  3T2O A;  5HCA A;  3APB A;  4RN5 A;  1ULF A;  5GLV A;  4EYU A;  5DN2 A;  4CU9 A;  3I7D A;  3H50 A;  3RFR A;  4B3N A;  3C8X A;  4XVH A;  4AVB A;  3BCW A;  5I91 A;  1CX1 A;  4D7T A;  3LCP A;  1CD3 G;  3TEX A;  5AC9 1;  1TME 2;  3ZN6 B;  2Z79 A;  1QQP 1;  1LB2 A;  4BQY A;  1R08 3;  3TAY A;  2WSV A;  1O4T A;  2XH6 A;  4Q4Y 2;  3O1P A;  2Q1F A;  5FXW A;  2VW1 A;  5FYY A;  4A7Y A;  2DTY A;  4ORF A;  4K8R B;  3VZJ A;  4CP9 A;  3V0A A;  2KD7 A;  2B9U A;  1V0A A;  3IZO A;  2Y60 A;  3WY6 A;  3WQ7 A;  4RHV 1;  5DAP A;  3FHI B;  4ZKT B;  2DV9 A;  4XFH A;  2PHX A;  4XQ4 A;  4FCA A;  2ZMN A;  1REF A;  4IEQ A;  2UWC A;  3IPV A;  3FHQ A;  1ZBA 1;  1KS4 A;  1OKQ A;  4QM9 A;  3CJX A;  3AKP A;  1IG0 A;  1ZNP A;  2LRP A;  2QQW A;  4LO5 B;  1W6Q A;  2F4P A;  1X8M A;  2G9Z A;  3ALQ A;  4CTE A;  4EN8 B;  3ZSE A;  2YV8 A;  5IT6 A;  1ZBA 2;  3HBK A;  5ACA 3;  5DMY A;  1HRV 2;  3GGL A;  4QT6 A;  2XVL A;  2W68 A;  1WZX A;  1Q5O A;  5FZ9 A;  2QQN A;  5AFB A;  2KA3 A;  2VXJ A;  3I59 A;  4XDP A;  2BV4 A;  4LA3 A;  2QQU A;  5FXZ A;  4JTN A;  1YFX A;  4CEW B;  1QJU 3;  2V5D A;  3JBG 1;  3ZSK A;  3N36 A;  1DGR A;  1RIT A;  3ELN A;  2CDO A;  3GBW A;  5KXE A;  2J1S A;  1R09 1;  2ZAC A;  2EXJ A;  1RUC 3;  3U0Z A;  2AYH A;  3I54 A;  1YQ6 A;  3P3P A;  2SLI A;  2V09 A;  5A3W A;  1YFY A;  2JJ6 A;  2ZKL A;  3WCR A;  4JTO A;  3W20 A;  4AEM A;  4BLI A;  3N7J A;  4M3C F;  5EWS A;  1FT9 A;  2DU0 A;  3BOW A;  3GCW A;  1W2A X;  2OVU A;  3E6D A;  4QXC A;  3A23 A;  4MET A;  1YI9 A;  1JYI A;  2YMZ A;  4I09 A;  4QQO A;  3NJY A;  4FXG B;  4AI0 A;  2RJK A;  2R49 A;  3R4S A;  4QXB A;  5D8A C;  5IVF A;  1GZC A;  4LXL A;  3GHN A;  4LKS A;  2WQZ C;  1OSG A;  5FZB A;  3USS A;  3PVO A;  2HWD 1;  3CIH A;  1HB3 A;  5FZM A;  1YLL A;  3M4F A;  4IE5 A;  4YZ1 A;  1S0E A;  1VBA 3;  2JB8 A;  3LFM A;  3RZJ A;  3AMN A;  3OEA A;  1DYK A;  4ASK A;  3ACI A;  5FY9 A;  3ZN6 A;  4P9I A;  3NAP B;  4WVM A;  1K3I A;  1GZW B;  3VV1 A;  1I3H A;  1NX9 A;  4MGQ A;  2BBV A;  1LHO A;  2AC1 A;  2XLG A;  4L97 A;  3N7K A;  2R16 A;  2ZKN A;  1LOF A;  2YYO A;  1SLL A;  4CEW A;  1E5S A;  1RUI 2;  3PJY A;  2A6Y A;  1UL9 A;  4Q4X 1;  1XE0 A;  4JDO A;  5M0T A;  4GWI A;  2EIG A;  3NJZ A;  3MIH A;  4XOG A;  1KD7 A;  3FL7 A;  1RUI 1;  3T30 A;  4OYU A;  4RQP A;  3DV8 A;  4EQV A;  5C3O A;  4LK6 A;  2BP6 A;  2HKX A;  5ERL A;  5AVA A;  2A6X A;  2B8M A;  5KWR A;  1YQ5 A;  3BPZ A;  4TTG A;  1TMF 3;  1UIJ A;  3AZX A;  3DUI A;  3URF A;  3EXU A;  2FHR A;  5DPN A;  3TNQ A;  2VPV A;  3Q8E A;  3WDW A;  1ODM A;  1W6P A;  3ON7 A;  3OCP A;  1O5L A;  5ANN A;  1ZVF A;  4CDU B;  3MIC A;  2GN7 A;  4F83 A;  3ZFE A;  3J26 N;  2OYZ A;  4R9A A;  5BYN A;  5JPN B;  4Z2A A;  2BZD A;  2J7M A;  2P17 A;  3NNF A;  2WNO A;  3SEP A;  5L7O A;  1RHI 2;  2WWU A;  1W8W A;  2ZJC A;  4XTP A;  4DPN A;  2W1U A;  5C6C A;  1C1F A;  2D97 A;  3T4V A;  1SHW B;  4CRQ A;  4Y4Y A;  2ORX A;  2HWF 2;  3WHT A;  4I2O A;  4Q27 A;  2PXJ A;  2WT2 A;  4NHY A;  5FOB B;  4FPE A;  2IXC A;  3J7H A;  1W6N A;  4K3U A;  3MFC A;  1YXW A;  2JG8 B;  3DGT A;  4L8Q A;  1VAL A;  4QHO A;  1FPN 2;  3B7M A;  4XIO A;  5C33 A;  3UJQ A;  4CDX B;  2QFE A;  3V0A B;  1POQ A;  2FDF A;  2DUQ A;  3KGL A;  3DYO A;  3CO2 A;  1ZRF A;  2ZCW A;  1HQL A;  4NRQ A;  3KT1 A;  2WNV B;  2JG9 A;  2VY0 A;  2VUJ A;  5F37 A;  3ZN5 A;  3KS7 A;  2IVJ A;  4EV0 A;  4MLO A;  4QQL A;  4XCB A;  3VDD B;  3UES A;  1RUJ 3;  1V9U 2;  1OLM E;  2A70 A;  4QPW A;  3VKM A;  4Q4V 1;  3WNP A;  2YY1 A;  1JMU B;  1SQ4 A;  1FOD 3;  2HH9 A;  4XUP A;  2Y33 A;  1COV 3;  2CSG A;  2RDS A;  4IGQ A;  1DCS A;  4LKE A;  2YBS A;  2J1R A;  2EAL A;  1OD3 A;  1RTV A;  2WZR 1;  4XFI A;  3ILR A;  1W2U A;  1PNG A;  3OJB A;  5GLT A;  4OUE A;  3RZG A;  1XC6 A;  2BEO A;  4BYY A;  5JCT A;  4XFB A;  3KVA A;  1TMF 1;  1KDK A;  4IUG A;  2JG9 C;  4M4P A;  5F5A A;  2C5D A;  5J96 B;  3JU9 A;  4L9B A;  2WUH A;  3D0J A;  1N1V A;  2WDB A;  5APA A;  4LOT A;  5FPL A;  1QJU 1;  3UK9 A;  3HNM A;  3M3O A;  4E8C A;  3B02 A;  2Q5T A;  4FAH A;  4XMI A;  1K5M A;  1KS5 A;  3RG0 A;  5FCC A;  5F5C A;  4EE2 A;  2R1D A;  3AXD A;  3PJQ A;  5FYT A;  5GZG A;  2HWF 3;  1DYO A;  3NAP A;  1QQP 2;  4XBQ A;  2ES3 A;  3VGI A;  5EJ1 B;  3HPN A;  1MS0 A;  2R6Q A;  1OUR A;  4DS0 A;  3LD8 A;  2GZW A;  3I3Q A;  3UV9 A;  1WCD J;  4AK3 A;  4N7U A;  2ARC A;  1IQA A;  2JE9 A;  3M70 A;  1UN1 A;  4RGA A;  1ULP A;  2E7Q A;  4BDV B;  4DQA A;  5IK4 A;  1JUI A;  1EPZ A;  3T2Q A;  3OYW B;  4AGV A;  3NNJ A;  1OPO A;  2IZW A;  2RV9 A;  5L9V A;  3AZW A;  4MSV A;  4W4Z A;  2OUH A;  4IEX A;  4MGY E;  2EXH A;  4LBQ D;  2FCT A;  2QQL A;  3O1T A;  4JKM A;  1C57 A;  2VCM A;  3LWC A;  5A6Z A;  1UY4 A;  5FP8 A;  1XND A;  4LJH A;  3POS A;  4FQZ A;  4IV1 A;  1G9D A;  4B7K A;  1M06 G;  4CUC A;  3WVJ A;  2BU9 A;  2L9L A;  5AC9 2;  2ZHM A;  5D21 A;  4HN1 A;  3O1R A;  5FMO L;  2GNM A;  4OI2 A;  2YGM A;  2D3R A;  1AR7 1;  5FZH A;  4AW7 A;  1XNB A;  5CKQ A;  5IVE A;  1AR9 1;  4GMP 0;  3FLR A;  3RMX A;  2VU9 A;  3ZYH A;  3GZU C;  4XJZ A;  5IFP A;  5GLW A;  1JYN A;  1J1L A;  2VG9 A;  1EUT A;  1MS5 A;  5LK7 B;  3PUH A;  1TME 3;  1PO1 3;  2A3X A;  3M3C A;  5J1X A;  1YNA A;  4LHN A;  2VO5 A;  3MV1 1;  2V72 A;  3ETP A;  4GIQ A;  5DG2 A;  4W6X A;  2CYF A;  1BK0 A;  2XJS A;  2KM2 A;  5LK5 A;  2WO1 A;  3J9S A;  4JKL A;  4AI8 A;  1CX4 A;  2Y6K A;  4GKY A;  5H9Q A;  1GWK A;  2E6V A;  3WDT A;  5A3P A;  1U0A A;  5BV6 A;  1LAJ A;  2YU1 A;  1H2K A;  1ZRC A;  2VZV A;  1NXM A;  1RMU 3;  2JIC A;  3DYP A;  5FZI A;  3TWI A;  1W04 A;  1RJ8 A;  1MEC 1;  3AK0 A;  2BWC A;  3BIW E;  1NQD A;  3RYP A;  4RQP C;  4DEV A;  1H9W A;  2OX0 A;  5FPZ A;  5KXB A;  1HJF A;  4MGT A;  2YXS A;  3I3D A;  5ABJ B;  4N43 A;  2BUK A;  1G9F A;  5FZK A;  4QX7 A;  5LBB A;  1ZBA 3;  5ACA 2;  2K0G A;  3IMM A;  1OFN A;  1D4M 2;  1OBN A;  3VBF C;  1LHW A;  1IGO A;  4KBB A;  1Z7S 1;  5A1F A;  1WWY A;  2A3Y A;  3M7A A;  1JOB A;  3KCX A;  1KFX L;  3IDA A;  4I3G A;  4Q4W 1;  4XZU G;  3V65 A;  2MHF A;  2VUL A;  4R9D A;  1YIF A;  2LS6 A;  3WQB A;  5HV0 A;  4GKX A;  2BQP A;  3WG3 A;  1VAV A;  1POV 1;  4DXS A;  1XOY A;  3Q8C A;  3DKQ A;  4Q4X 2;  1GZ9 A;  3LDK A;  2WII B;  5CFD A;  1XPW A;  3RSJ A;  3W59 A;  2TBV A;  1Q43 A;  3V56 A;  2O14 A;  1GQG A;  3KT7 A;  4AFD A;  1NLR A;  4R4X A;  2GC1 A;  2DCZ A;  2W52 A;  3WUC A;  4IEY A;  3SMH A;  4CDQ A;  5LW9 A;  1LKN A;  1QXJ A;  2GC2 A;  2WS9 2;  5E16 A;  4KWL A;  4QQP A;  1OA2 A;  4HKW A;  3TEY A;  2PHD A;  4OHY A;  2PYT A;  3M3Q A;  5J09 A;  1FMD 1;  2UY9 A;  3LA2 A;  4PCR A;  1NKG A;  3CEW A;  3UKV A;  3IDB B;  4UOJ A;  1HN1 A;  5FMB A;  1SBE A;  2H0V A;  4DEQ A; 
#chains in the Genus database with same CATH homology
 1H6X A;  3T0A A;  1JZ8 A;  2Y6J A;  1DP0 A;  3A21 A;  4QX1 A;  4LPL A;  2E32 A;  4KI5 M;  5CYY A;  2HLE A;  3SEE A;  2ORZ A;  2J1T A;  4P02 B;  3T0B A;  3WF2 A;  2VJX A;  2J1V A;  2OKX A;  4P5Y A;  2VL4 A;  4P08 A;  3VD9 A;  3K4Z A;  3LEK A;  4MGS A;  2WQ8 A;  2WAB A;  4RYD A;  4W50 A;  5B4N A;  4JX0 A;  4FI9 A;  2B4K A;  4TXW A;  3UET A;  2VCB A;  1UX7 A;  3OBA A;  2WZE A;  1CZV A;  4GWJ A;  1GQP A;  2QBX A;  1GU3 A;  3EYP A;  2J22 A;  2QQJ A;  3WF4 A;  3E1F 1;  3MV0 1;  3C7G A;  1UYZ A;  5IHR A;  1W0N A;  1JU3 A;  3UNP A;  3A7Q A;  4QX2 A;  2J1A A;  1JZ4 A;  2WN2 A;  3F2Z A;  3FHA A;  4W8J A;  5HPO A;  2ZEY A;  4XUO A;  3WF1 A;  4MAD A;  1MPX A;  1UXX X;  2VZQ A;  2XQX A;  3NQH A;  4QX0 A;  1JZ2 A;  2W9X A;  3BN6 A;  3T08 A;  2WO3 A;  3T0D A;  3THC A;  1PX4 A;  2VMD A;  2DDU A;  3EB7 A;  2JKX A;  2VZU A;  2X10 A;  3OB8 A;  3MUZ 1;  5I0D A;  4CUB A;  2J1E A;  2CDP A;  1R64 A;  2X05 A;  3C7F A;  3IAP A;  1RYY A;  2VQU A;  3LQC A;  4OMD A;  1O59 A;  2C9K A;  3HNB M;  4ARX A;  3VDC A;  2Y6G A;  5JUV A;  3MBW A;  5JR2 A;  2W94 A;  4AG4 A;  4DXT A;  1F4H A;  1NUK A;  2RJ2 A;  2VZT A;  3P6B A;  2J1U A;  1UXZ A;  2LW8 A;  1BHG A;  2WO2 A;  2VZS A;  3WEZ A;  3DEC A;  2YG0 A;  5C7G A;  3K4D A;  4PT6 A;  2Y64 A;  2W1W A;  4AAX A;  4XUN A;  3I2I A;  2Y6L A;  1W8N A;  3WSO A;  1OF3 A;  1XNA A;  2W47 A;  3BGA A;  2VZ1 A;  2VOT A;  4BJ0 A;  3I3B A;  3IAQ A;  2JD9 A;  2WAO A;  4CU6 A;  1JHJ A;  2VZ3 A;  2WAA A;  3VD5 A;  1L7R A;  4BK5 A;  4A44 A;  2B9V A;  5IYY A;  1PMJ X;  4QDQ A;  5IFT A;  2W5F A;  2QQK A;  3T2P A;  3CZJ A;  2W92 A;  2ZEZ A;  5IJR A;  1JZ3 A;  4XUT A;  1JZ7 A;  3CDZ B;  2YC2 A;  3WNK A;  3W5N A;  2WN3 A;  3HOB A;  1GOH A;  4A6O A;  1YQ2 A;  1UYY A;  5LA0 A;  3OGR A;  5JXI A;  2DCJ A;  2W1S A;  3AC0 A;  3T2O A;  4LHS A;  4RN5 A;  3HEI A;  1OF4 A;  3VD3 A;  5DN2 A;  4CU9 A;  2E33 A;  2XHN A;  3C8X A;  4XVH A;  1CX1 A;  2WBK A;  3I97 A;  4P00 B;  2YFU A;  4OMC A;  3SKV A;  1P8J A;  1ULO A;  3III A;  3I2G A;  1GMM A;  4UAP A;  3K46 A;  2KD7 A;  1UWW A;  1T2X A;  1JZ5 A;  1US2 A;  2QQO A;  4A4A A;  2ID4 A;  4JHZ A;  2ZXQ A;  3FHQ A;  1O8P A;  4DXR A;  4HG6 B;  3I2F A;  3HJR A;  1GOF A;  3VDA A;  3FN9 A;  5DMY A;  2BGO A;  1UZ0 A;  3GGL A;  1W9T A;  2QQN A;  4A45 A;  4E8D A;  3OGV A;  4KMQ A;  1CZT A;  2V5D A;  1W9W A;  1OH4 A;  2QQI A;  2CDO A;  2J1S A;  3VD7 A;  3LE0 A;  2EIB A;  4ARY A;  3OGS A;  3WNM A;  1JYW A;  1JZ6 A;  1O8S A;  1WKY A;  2V4V A;  3W5M A;  1W8O A;  2QQM A;  3A23 A;  4A3Z A;  3A22 A;  3K77 A;  4D8M A;  2JDA A;  2XON A;  3C7E A;  1UYX A;  4LKS A;  3LPF A;  3CIH A;  5JXJ A;  3NNG A;  1JYV A;  3OEA A;  3ACI A;  2VME A;  1K3I A;  3VD4 A;  4MGQ A;  1NX9 A;  3PUI A;  2VR4 A;  1KGY A;  3CKH A;  5G05 L;  4DUV A;  3WNL A;  5B4X A;  5JXH A;  1OT5 A;  4CUA A;  4A42 A;  1UMH A;  2E31 A;  3IB3 A;  4GWI A;  4A41 A;  3ZM8 A;  2Y8K A;  3FL7 A;  4OYU A;  1TVG A;  3MO4 A;  4KWU A;  2HYX A;  4BXS V;  4TTG A;  2PQS A;  5DPN A;  3WNO A;  2EID A;  3I2H A;  3GM8 A;  3LEI A;  2BER A;  5C70 A;  1W99 A;  1SG3 A;  2YFZ A;  1W9S A;  4Z2A A;  2BZD A;  2J7M A;  3ACG A;  3VDB A;  3K4A A;  3SEP A;  2W87 A;  2VZR A;  2Y6H A;  1K42 A;  2W1U A;  1F4A A;  1SHW B;  2ORX A;  5JMO A;  2C26 A;  4ZZ5 A;  4QX3 A;  3J7H A;  1UY3 A;  4QB1 A;  1KEX A;  4PQQ A;  3DYO A;  5LA1 A;  3CMG A;  4MOA A;  1CIY A;  3GDB A;  1US3 A;  4ZY9 A;  2VM9 A;  1L7Q A;  1LNS A;  4QB6 A;  1UY0 A;  2JE8 A;  3U37 A;  3UES A;  3WNP A;  4QPW A;  5FUI A;  1JYX A;  2ZEW A;  3DYM A;  1CZS A;  4XUP A;  4CVU A;  3T09 A;  2J1R A;  1OD3 A;  1UY2 A;  2EIC A;  1XNT A;  3D3A A;  2VTF A;  4OUE A;  1XC6 A;  5F7U A;  4ZZ8 A;  1IQD C;  2W1Q A;  3MUY 1;  4IUG A;  4M4P A;  3I2J A;  2WUH A;  2XOM A;  1JU4 A;  2WDB A;  4YPJ A;  3HNM A;  1J84 A;  4E8C A;  3P1I A;  5EJZ B;  4OZO A;  4CU7 A;  5C71 A;  3LEG A;  2DCK A;  1DYO A;  5EJ1 B;  3HPN A;  1DLC A;  4DUW A;  1SDD B;  4QDR A;  4XUQ A;  1ULP A;  4BDV B;  3T2Q A;  4QAW A;  2VMF A;  2W46 A;  3I2K A;  2RV9 A;  3K75 B;  4W4Z A;  4D0Q A;  1J83 A;  3C7O A;  5HXM A;  2QQL A;  4DUX A;  2X09 A;  3NJX A;  4JKM A;  2WZ8 A;  3HNY M;  1NAE A;  4ZXE A;  3WF0 A;  4PF1 A;  1UY4 A;  2W95 A;  4CUC A;  4LQR A;  3LPG A;  2L9L A;  2VCC A;  5EIY B;  1H6Y A;  3JXS A;  4XUR A;  5IFP A;  1JYN A;  1EUT A;  4UI9 L;  3PUH A;  3THD A;  3HN3 A;  3OEB A;  4ET7 A;  5CZK A;  5J1X A;  2W91 A;  2VO5 A;  3MV1 1;  2V72 A;  3ETP A;  3ABZ A;  3I3E A;  4QDS A;  3CZU A;  3NRU A;  2WO1 A;  4JKL A;  2Y6K A;  2VZO A;  2R7E B;  4MO3 M;  3CQO A;  2EIE A;  1PMH X;  1GOG A;  2VZV A;  3DYP A;  3NJV A;  5G04 L;  1WCQ A;  1D7P M;  4DEV A;  3ECQ A;  3OG2 A;  3I3D A;  3SKJ E;  3GXU A;  4M4R A;  2WYS A;  2YB7 A;  5LA2 A;  2BGP A;  2VCA A;  3C7H A;  4GZ9 A;  3IDA A;  4XZU G;  4CU8 A;  2VC9 A;  3WQB A;  1EUU A;  2LS6 A;  2VQT A;  4QB2 A;  5JXG A;  4DXS A;  2ZEX A;  3ACF A;  2C4X A;  1XPW A;  2VMC A;  1PX3 A;  1JI6 A;  2Z4F A;  4JKK A;  3WNN A;  5A1A A;  3WF3 A;  1I5P A;  1K45 A;  1UMI A;  1UY1 A;  2RVA A;  3ACH A;  1TG7 A;  2W3J A;  5LCW L;  1GUI A;  2BBA A;  2E26 A;  4BK4 A;  2VZP A;  1NKG A;  4L0P A;  4UOJ A;  1HN1 A;  2YC4 A;  5DQ0 A;  1GNY A;  1K12 A;  4DEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...