1D2SA

Crystal structure of the n-terminal laminin g-like domain of shbg in complex with dihydrotestosterone
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
170
structure length
170
Chain Sequence
PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human sex hormone-binding globulin: steroid transport by a laminin G-like domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords SEX HORMONE-BINDING GLOBULIN
total genus 32
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 1999-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1d2sA00
1LOFA 2UWAA 2JKBA 2ZHKA 3PJQA 1ENQA 4RA0A 4YM1A 4Y22A 2WJSA 4R9DA 3N3HA 1W6PB 4XILA 4FPFA 2JECA 2PHFA 1IOAA 1LTEA 4XE9A 1WD3A 2P3KA 3BIWE 2NYYA 2A3WA 2EXKA 4XOGA 4Y26A 2P37A 3WLUA 1LHOA 1N1SA 5AVAA 5DUXA 1GZ9A 1IS5A 1JHNA 1N47A 3LSDA 4Q26A 5SV8A 2WKKA 1LHUA 2UU8A 2ZHLA 4FPCA 1PZ8A 4GWNA 1S0FA 5DZGA 5CB7A 1H9PA 3AZVA 2A6VA 2ERFA 3VV1A 1WUVA 1DQ2A 4PQ9A 4UW6A 4DRRA 2AGSA 3AZWA 2A7AA 3NV3A 3A0NA 4ITCA 2YXSA 1N3PA 4U2AA 3V65A 5HCAA 1GZWB 3AYDA 2OUJA 1AX1A 3OJBA 4C1WA 3BODA 2GNBA 5KXEA 3W58A 2D7FA 5GLZA 5FRAA 3RMXA 1N3OA 3KQRA 2AREA 2CNAA 5H9QA 4Q27A 1X50A 3NWKA 3OYWB 3VKMA 1Q56A 2AH2A 2ZABA 1D2SA 3OY8A 5GZEA 3C2UA 2P3JA 3O0VA 1LEDA 2YROA 2D6NA 3POYA 2ZGNA 2YV8A 4L8QA 3MEPA 4XJAA 1LOGA 3KM5A 2GMPA 2D3SA 3BOPA 4LBQB 3AYEA 4XBQA 2PHWA 2W68A 1B09A 4XJWA 1MS4A 1QDCA 1Q8SA 3WVJA 1UL9A 3WG4A 4YZ5A 1WW7A 2NP0A 3AJZA 5FREA 2WT0A 2GNMA 4YGEA 1SBFA 4XHXA 1W6NB 1Q8PA 5T52A 1FYUA 3OYWA 4Q8KA 2R49A 3WDTA 4AYUA 2FMDA 4Z8BA 1MACA 4P9WA 1UZZA 1LGNA 2DWRA 3RRDA 3ZSLA 1O4ZA 1XQNA 1KDKA 4AVSA 1HDKA 1OFSA 4GKYA 2EF6A 4F83A 1V6KA 2P2KA 5JDBA 3HN1A 2CY6A 5H9RA 1A8DA 5KXCA 1QF3A 1ENSA 4XIKA 1G9DA 4P9XA 5LK5A 2R1DA 3IKWA 3OGGA 4YZ4A 3AP9A 5HCBA 3WCRA 2Z42A 4CTEA 5KXBA 2UURA 4RL7A 1LOBA 4Y22B 5CNAA 4YG0A 1N1TA 3VKOA 3OBRA 1LODA 3ILNA 2CL2A 4LBOA 3ZSKA 1N1VA 1U0AA 2A70A 2P34A 1YIFA 4U36A 1KQRA 1AX0A 1SACA 2YZ4A 2ZMKA 4FQ4A 1BXHA 2LALA 1AXKA 2ZGPA 4MYEA 2SBAA 4FPJA 4GKXA 1AZDA 1APNA 1W6PA 2W08A 4BLIA 1AX2A 2H0BA 3ZSMA 3DUIA 1G8WA 4YW4A 2D43A 2JD4A 2ZHMA 2EXJA 1VLNA 2R1BA 2VW2A 3MPPG 1S0BA 4BOWA 1FNZA 4FPHA 3FLPA 3V0BA 4Y1YA 2OW4A 3JU9A 1CIWA 3AFKA 1W6MA 1ULEA 2DVGA 1IKQA 4YG6A 2ZKNA 3QCWA 5GLTA 3UJOA 1JOJA 3H0OA 1A78A 2WNEA 1SLTA 1SLBA 1G9CA 3NV2A 2RHPA 1CR7A 2PHXA 2VW0A 3AP6A 1QOTA 1IKPA 2EXIA 4LBJA 1Q8OA 3AX4A 5GZDA 1LEMA 4WV8A 4XDQA 4FPEA 1NXD1 2WSUA 4K1ZA 3IN9A 3VUOA 4GXLA 1QNYA 1KITA 1F31A 1MS9A 1AF9A 2AUYA 3B00A 3M3QA 3WDYA 2GN3A 4M3CE 4YW1A 3IM0A 2GNTA 3ZYRA 2ZZJA 4BM8A 2ZAAA 2OVUA 4FOQA 2Q5TA 2R0HA 1LOFC 2XG3A 2EIGA 4XZPA 1GANA 3GNEA 2VXRA 1VAVA 3N7LA 1W6QB 3WZ1A 3SLIA 2D6LX 4M3CA 1SLAA 4YGDA 1HQLA 4XBNA 2BQPA 5JMCA 1N1YA 1C4RA 1DQ0A 2DU1A 3HR9A 1QOSA 2CYFA 3OPZA 2R16A 1A3KA 3A4UA 1QOOA 1YI7A 2GN7A 1WW5A 4WZFA 4R9BA 4DRVA 3AP4A 5DG2A 1G9FA 1YYNA 2ES3A 1YO8A 3LSEA 1BYHA 2JE7A 5EWSA 2CWSA 1W6NA 3AZYA 5JLVA 2ZMLA 1KJLA 2ZGOA 3R4SA 4LBKA 4AGGA 1LHNA 2D6MA 1LGBA 3WNXA 2A75A 1LGCA 1LHWA 2DV9A 1FV3A 1TEIA 3M3EA 4FOVA 4SLIA 4Y20A 3WG1A 4AGVA 1MS0A 1YXWA 4LBNA 2WQZC 2W52A 1QKQA 5IK4A 4Y24A 1MS1A 3ZPYA 1WBLA 4YG3A 5IUQA 1JBCA 1V6JA 1BKZA 4XJ8A 3USUA 1S0DA 4YLZA 2PHTA 1FV2A 3N7JA 3R05A 4YZ1A 4FPOB 1DLLA 4YFWA 1AJKA 5GZGA 1MZ6A 1S0GA 1EPWA 3WUCA 4ISRA 2PELA 5GJ6A 4LBQA 2A6ZA 4XMAA 4DQAA 2ZGMA 1R1ZA 4ATEA 1S0JA 4Y1UA 1LU2A 3APBA 1DFQA 4Y1ZA 3WDVA 1JYCA 1SCRA 2JE9A 1UX6A 4ATFA 3RG0A 2E51A 1JYIA 4W65A 4YZ3A 1PZ7A 5T50A 4JCKA 4WVWA 1OKQA 2VUAA 1Z0HA 5GLWA 1RITA 5JOWA 5EYXA 1V6OA 1CPMA 3SNMA 2V5YA 5DUVA 4UW4A 5CBLA 3POSA 3O12A 3AXEA 4M3CF 1HKDA 1WW6A 2NM1A 3UJQA 1C57A 3ZXKA 1FATA 3N7KA 3AZXA 4K1YA 1CQ9A 1IS3A 5JVVA 2ARBA 4AGRA 2D3PA 2ZA9A 4Q2FA 4BMEA 1RIRA 4BQ1A 2E7TA 3AXDA 1G7YA 1DYKA 4GWMA 4XYXA 1DGLA 1SLCA 1WLWA 5EYYA 1CVNA 4IQPA 3ZXEA 3B9CA 2C5DA 5F9TA 4LBMA 2A6WA 3AYAA 1MS3A 2AYHA 2FHRA 2E53A 3VKFC 3B69A 4BPZA 1GNZA 4TYSA 4ZXKA 4Q8LA 2DURA 1GZWA 4KBBA 3CNAA 3M3OA 2OUHA 3AJYA 1WBFA 1FAYA 3FUQA 3ILRA 5E8AA 1W6OA 2ZGLA 3POWA 1S0EA 5H9PA 1BJQA 5T5OA 5DUWA 3WDXA 2A71A 1DBNA 2DYCA 2WSVA 1LECA 1F5FA 3FBYA 1WW4A 1PZ9A 3ZXFA 2DUOA 2ZACA 5T54A 1VIWB 1LULA 5HCFA 3DGTA 4H55A 4XMIA 3SH4A 1ZM1A 3UL2A 4Y20B 3NV1A 2AR6A 3WHTA 4XJ9A 3N35A 3HMYA 3T1MA 4JRAA 2C9AA 4FOYA 5H9SA 2I2SA 4XJZA 2B7YA 1KDMA 2D6KA 4P14A 2ZHNA 3B01A 3ZYPA 1SBEA 4ASMB 4YFZA 1ZA4A 1JW6A 3BTAA 2PHRA 3WDWA 3WOGA 4YW2A 4XXAA 5GZCA 5JOZA 1HLCA 4C1XA 1GV9A 2E7QA 4AWDA 1JXNA 2SLIA 2YMZA 3I8TA 5JOYA 2ZGQA 2P3IA 3NV4A 1LU1A 3RMYA 2GNDA 2WLQA 2JJ6A 2NZ9A 2UWBA 1JUIA 1F9KA 2HYKA 3IPVA 1MZ5A 1AVBA 4LBQD 1W6QA 1QGLA 5IT6A 1QMJA 2PHUA 1V6LA 1WLDA 3FLTA 1GSLA 4M00A 3IMNA 4YGBA 4R9AA 3SH5A 4FPLA 1AJOA 3VKNA 2GALA 1UKGA 1CJPA 4UW5A 1DYPA 3M1HA 2DUPA 2ZMNA 3SISA 3V0BB 5IK8A 2GDFA 1IS4A 1GLHA 1GYKA 1MVQA 4ISQA 5T55A 4R9CA 5IK7A 2A5ZA 5T5PA 4FQZA 4ZKTB 3ASIA 1DQ5A 1LENA 2ZGSA 4XBLA 1OQ1A 1I1EA 1FX5A 1DQ6A 1DIWA 3RS6A 1CESA 2A3YA 2ZBJA 3OY8B 2ZGKA 4K21A 4JC1A 4Y1VA 3MW2A 5GLUA 1MVEA 3ZVXA 1SCSA 4D69A 1Q8VA 1S0CA 1KRIA 3AYCA 5DUUA 3Q9OA 3FUOA 1UZYA 2VH9A 2EALA 3M3CA 2LTNA 1LOCA 3LCPA 4FVVA 3ZSJA 2A6YA 2DVBA 4PBPA 3ATGA 2DTYA 2VY0A 1QNWA 2NN8A 3D6EA 1V00A 3FFZA 4TZDA 3W59A 3AZZA 5KXDA 4PBOA 2W39A 5E89A 4XXPA 1GKBA 1CPNA 5T5LA 2ZGUA 4CRQA 3TAYA 3INAA 1LHVA 5GALA 1KJRA 5T5JA 1WD4A 2DUQA 5DZFA 2V73A 1LJ7A 5L73A 1QDOA 1G9AA 3PVOA 1ONAA 2VW1A 3PVEA 4P9YA 2D3RA 2DTWA 3AK0A 5DXDA 1AXYA 1Y7BA 4K20A 1V6MA 1GNHA 4YW5A 3T2TA 3V0AB 3ILFA 1GICA 2CWMA 4DFSA 1WLCA 1G9BA 2CTVA 3FLRA 3O0WA 1H30A 1I3HA 2ENRA 3IPVB 3PMEA 5DG1A 1FNYA 1C1LA 1DQ4A 2A3XA 2XB6C 2AENA 3SH3A 2EXHA 5CA6A 2WT2A 3QLQA 3SITA 4FPKA 4WVVA 1LOAA 4XIOA 1AXZA 1SLIA 4NO4A 5F5QA 2DVDA 2VU9A 3GALA 5CAZA 3PVNA 3B3QE 4DS0A 5GZFA 4OZXA 4YM0A 1LOEA 2NMOA 3O0XA 1ENRA 3ZXLA 3ENRA 1G86A 3L2YA 3VKLA 2YY1A 4LBLA 3USUB 2DVAA 5BYNA 2GMEA 3UK9A 1N3QA 5IK5A 1MS8A 3N7MA 4YZ2A 4YW3A 4Y1XA 3M2MA 4FPYA 4UW3A 1URXA 1SFYA 3R4UA 1WCSA 4M01A 5GLVA 1HQWA 1S0IA 1Q8QA 4Q1RA 4YM2A 1LESA 2UWCA 1C1FA 1DQ1A 1J1TA 3WG3A 3WV6A 2D44A 1D0HA 2G4IA 3TB0A 4XJUA 1MR5A 2WT1A 4GA9A 1ULCA 1V6IA 3D4KA 1UN1A 1GZCA 2KM2A 2A6XA 3MW3A 3WDUA 4BMBA 1V6NA 1ULDA 3O5SA 4DPNA 3D5OA 1Z78A 1SLLA 2GMMA 4FOWA 2D6OX 1DZQA 4M3CB 4NOTA 4PCRA 4YM3A 4CZSA 1UAIA 3RSJA 3WHUA 1DHKB 3N36A 3MW4A 2EAKA 1LCLA 1SBDA 1W0OA 2ARXA 2DVFA 2ZGRA 1CN1A 4XTPA 2R0FA 5EXOA 2DU0A 4FPGA 3WG2A 3U4XA 4HANA 4FP2A 5JOXA 1MS5A 4BLJA 5E88A 2JDZA 4HL0A 1RINA 1VAMA 4FP3A 1YRZA 1GBGA 2NMNA 3WUDA 4AVVA 1O4YA 1W0PA 5DZEA 2E6VA 3AP7A 1ULFA 4GALA 4AVTA 2D6PA 1UMZA 1BQPA 3A0KA 1IS6A 1BZWA 1CONA 4PF5A 5GM0A 2ZGTA 1VALA 4XTMA 1QU0A 1JN2P 1NLSA 1ULGA 1W6OB 1H9WA 3I4IA 4I30A 3OBTA 3V64A 3JUUA 1W6MB 4YGCA 4Q1PA 3AP5A 1S1AA 1UPSA 2TEPA 3T1LA 3V0AA 3WCSA 3RQ0A 4XHBA 3ZXJA
chains in the Genus database with same CATH superfamily
3CLPA 3BVCA 3AFGA 1JZ4A 2FDKA 2WFF2 5A7NA 3ZFEB 2RR13 2FDFA 1FPN1 4EQVA 1ZRCA 4XILA 1W2OA 4CPBA 3KMHA 2P3KA 2MNGA 1RVF2 1DGRN 2A3WA 4XOGA 4Y26A 4OHWA 1R1A1 1UW8A 1LHOA 1QQP1 5AVAA 5C4WB 1R081 1O7FA 1JHNA 2L9LA 5LB6A 4X8PA 2VBBA 4FPCA 1LHUA 2ZHLA 4ZS3A 1H8TC 1S0FA 1RHI2 2VM9A 1GOGA 4EN0A 5A3PA 2ERFA 1YIPA 1Y9QA 3U07A 4CUAA 4PQ9A 4UW6A 3VBOC 4UFKA 1FMD2 2CAUA 2W0XA 5F6LB 1D0GA 2YXSA 3BB6A 3GCXA 1AR62 2GC1A 4LKDA 1CZTA 1NZCA 1AYM1 2VMDA 1GFF2 1TME2 2GNBA 3RNSA 1VMHA 4IE0A 5A33A 4AFBA 5A3TA 2DCKA 3KCXA 2D7FA 3RMXA 3S6PA 1KS5A 1N3OA 3S7IA 4N43C 2JIGA 2AREA 1AL23 5CG8A 2CNAA 5FJHA 2WWJA 4WM8B 4MGSA 2XJRA 3DCQA 4Q27A 5ABJB 1X50A 3NWKA 4K6BA 4QWNA 2AH2A 5FWEA 1D2SA 1OLMA 4HKOA 3C2UA 2VMEA 3O0VA 4YVSA 1W8ZA 3H1YA 2K46A 4QPWA 1XNAA 4QQHA 2Q8CA 2VJXA 3I3BA 2VVFA 1WA6X 1RTVA 3GHMA 3NNMA 3JB4C 5FMOL 1NT0A 3K48A 2GMPA 2UYAA 4BK5A 2PHWA 3LE0A 5FP8A 1YHFA 3U0ZA 1VB4A 3ES4A 1UL9A 3OUHA 4O65A 1F8VA 1XU2A 3WP4A 1HX6A 1GQHA 4JZRA 2GNMA 1DDLA 5FZFA 3ACIA 4LKFA 4Q5OA 2NQYA 3P3PA 4IV3C 1W6NB 2JE8A 5EPAA 2HYXA 5FY7A 3RYRA 3U37A 4BXSV 3OYWA 3TEZA 5A7QA 4JX0A 3VZMA 1QJX3 1PO22 2R49A 2V09A 4IE4A 3WDTA 3WW4A 4A3ZA 4Z1VA 5FO9B 4P9WA 2QFEA 2XDVA 2OQ6A 1MQTB 4IEYA 2DWRA 4PDWB 5J98B 4QXCA 4FCAA 4H14A 1XQNA 1KDKA 5IW0A 4AVSA 5A6YA 2ZZQA 5J36A 3VBUA 4GKYA 4F83A 4ZU4A 1PK6B 3AMQA 2HEWF 2XR4A 3SHRA 4RGKA 1ZZ9A 3GBFA 1A8DA 2F6BA 4IESA 4EROA 3VL9A 4P9XA 5F8PA 4BIFA 1DP0A 1BMV2 3OGGA 4ZONA 5HCBA 1W8TA 2AZ5A 3WCRA 3VD5A 2BV4A 5HI0A 4D3WA 2WNOA 1QXJA 1HRI2 4PIYA 4CCLA 2OXBA 1L7RA 1RUI3 2FBEA 1N1VA 5IAXA 1YIFA 1HN0A 1AX0A 1SACA 2ZPXA 3QD6A 3SKJE 4Q4Y1 3LA2A 1AXKA 1JOPA 4XDOA 4FPJA 1CAUB 1CZSA 2HH9A 4GKXA 2W08A 4NWWA 2JDYA 3I2GA 3THTA 1IPKA 4AFMA 2VUCA 1F5JA 3I2JA 1G8WA 4YW4A 2D43A 2JD4A 3B9IA 1AR92 4XFAA 2R1BA 2VW2A 4NMIA 1S0BA 1FNZA 1QJZA 2JENA 2ZX4A 2DFCA 1LKNA 4GJYA 4JGYC 4Y1YA 5FAXA 1UX7A 2WFF3 1OXCA 1CAVB 3AFKA 4QX0A 4YG6A 2B5HA 4L92A 1YFYA 1SLTA 1SLBA 3CZUA 3EXUA 2WNVA 2HWE1 3W20A 3KSCA 4ZZ8A 5BNNC 3NSTA 2ID4A 1RMU3 2VW0A 2PMWB 3KT7A 3ZFGA 1IKPA 4YVWB 4LBJA 3LOIA 1DG6A 1EAH3 1WMFA 3AX4A 1LEMA 3KVBA 3LDKA 5AVPA 3LPGA 5GZDA 1OVSA 1CGPA 4K1ZA 4QGMA 5LZ6A 2W2IA 5JXIA 2HWB3 5JXHA 3O1MA 1KXGA 1HXS2 3M3QA 4Z82A 1HB1A 2ZZJA 1Z7S1 1RUF2 2YG0A 4OMDA 4QXHA 4UF0A 1VBB2 5FZAA 2R7EB 1G6NA 2CDOA 2R0HA 3H8UA 5AFEA 2EIGA 2QQWA 3ZXAC 1O3SA 5C7GA 1PO12 2Y0IA 4ET7A 3WZ1A 3N7LA 1W6QB 3A7QA 5K0UC 2E33A 3SLIA 5C9AA 1SLAA 1HQLA 4H7LA 1GZTA 1YLLA 2BQPA 5FZ9A 4QQPA 5DPNA 1QOSA 3OPZA 2R16A 2YPJA 4LLOA 1QEXA 2GN7A 5LA9A 1Z7S2 4J6GA 4EV0A 1DGRA 5DG2A 3IWZA 4COZA 2R6QA 1W8HA 2OZ6A 2J1RA 4IL7A 3LSEA 5EWSA 1I5PA 1W06A 3N9NA 3AZYA 5JLVA 2ZMLA 2R061 2ZGOA 3R4SA 4LO4B 4SLIA 2QQVA 3M3EA 1J83A 1TEIA 1LNSA 3WG1A 4AGVA 4QU2A 5DAPA 2JD9A 3WQ1A 2RDSA 2WQZC 2W52A 3MIHA 3UGHA 4XF1A 4CP9A 4W50A 5IK4A 1MS1A 3ZPYA 2ET1A 1RHI3 1BKZA 4XJ8A 3USUA 1HIXA 4ZU7A 4HSJA 1DLLA 1VBD3 4C0BA 4LA2A 2PXJA 1MZ6A 3WUCA 2GC2A 4ISRA 3I97A 2PELA 1UZ0A 1US3A 1QY4A 4RR3B 2ZGMA 4MO3M 2BJSA 4Y1UA 5LRSA 4Y1ZA 1O3RA 1JYCA 3I2DA 1ULOA 3RG0A 4YVSB 1QWRA 4XQDA 5JI7A 5FZ8A 2BNOA 3K75B 2QCSB 1PZ7A 5T50A 3ZXDA 5JMOA 1TQ5A 4A42A 4OHVA 4E4ZA 2VUAA 3LF7A 4ARXA 1V6OA 4CUGA 1VBA2 1CPMA 4DXZA 3KGLA 5DUVA 5CBLA 3ZOIA 2HWC1 3H1WA 2C6SA 2VMHA 5EJ3A 2WS93 2NM1A 3UJQA 3WQ0A 1C57A 1FATA 4GQ7A 3ZN4A 3ZFGB 4QXKA 3WW2A 5JVVA 2ARBA 4AI8A 2JDUA 3X29B 3VZOA 2E7TA 4QDRA 4ZS2A 1DYKA 2ETEA 3VDDA 1VBA3 4FTEA 1VE0A 4OHYA 3I3MA 4IQPA 4BIOA 4WVMA 3IDEA 1OLQA 5L7OA 4AF9A 5F9TA 4JQTA 1QJX2 5CG9A 4LBMA 5FFOC 3CO2A 5EP9A 2AYHA 4MGYE 5FMDA 2C0ZA 2E53A 2YFZA 3AL5A 2B46X 3EO6A 3DXTA 1EP0A 2Q8OA 4DUVA 1Y4WA 1JU3A 3ZX7A 4CCKA 4CCCA 3ACLA 5ANNA 4L11A 2BU9A 1OLME 4QPIA 4QM9A 2IFWA 4GJZA 2D97A 3M3OA 2YBKA 4HVRA 4NE9A 1H1MA 1W05A 5FBZA 5FKBA 5H9PA 5DUWA 2BOIA 2WSVA 1F5FA 2CDPA 4AEDB 3K77A 2FZ2A 4PF1A 2DUOA 5F39A 1LULA 3HBZA 2Y6KA 5HCFA 2J7MA 3KHBA 5FDBA 2GC3A 5FY9A 2AR6A 4HT1T 1RUF3 1X82A 2WL1A 5FO7B 5BNPA 3HMYA 4JRAA 4FOYA 3HQRA 4F3JA 4Q29A 1W9TA 1K5MB 3B01A 3DEMA 3NW4A 4NHKA 4I0BA 2WZR2 4RQPA 4RS5B 3VZKA 3ZYPA 4ASMB 4HZFA 1JW6A 5A3LA 3BTAA 4KI5M 4YW2A 4XF3A 4XZUG 3MIGA 1HLCA 2XH6A 5LWBA 4AWDA 2E7QA 1US2A 2YMZA 1OQEA 4EJRA 4Q4V3 3RMYA 1UU5A 1GWKA 2H6CA 2I45A 2NZ9A 2WLQA 3GZUC 1JYWA 1VPHA 5A7WB 1EV12 4QMAA 4RFRB 1PMJX 5FR3A 2WO7A 1GSLA 4M00A 3WP5A 3I3DA 1O91A 4YW6A 2LW8A 2VMCA 3I2KA 3IDCB 2Y34A 4G3YC 3SH5A 3SCFA 4RD7A 5DDJ3 1J58A 1TME1 1UOBA 3M3IA 3MV01 5LRRA 1YEWA 3OBAA 1W8WA 5FYMA 1DYOA 2G9FA 3V0BB 5FK8A 4MADA 2VXJA 3H7JA 4Q0QA 3VBRC 1GLHA 3NAPB 5IK7A 4FQZA 1K5MA 3KGZA 4RS5A 1DQ5A 1LENA 4C0HA 1PGW1 2GAUA 5DDJ2 2WAOA 1WKYA 1IG3A 1WCUA 3WINE 1RUD3 3OTFA 1UYYA 5FZ0A 4HK9A 1ZZ7A 3RS6A 4Z92B 2ZBJA 3OY8B 4K21A 5I8YA 1KFXL 4Y1VA 1U5ZA 5GLUA 2FDJA 1MVEA 3AB0A 1UXXX 1NCQA 3ZVXA 1OUXA 3C7GA 1KRIA 1PGL2 3VHOA 4OYUA 5FLJA 3M8LA 3ACGA 5L7OB 2W46A 3ETPA 2QQKA 3VZJA 2EIDA 4E2GA 2QQIA 4GMP0 5KR7A 4LT5A 1AR63 1H1IA 1COV2 1QNWA 4AW7A 2NN8A 3D6EA 1ND3C 2XLAA 4UFJA 3RZLA 4QT6A 3AZZA 2PHDA 3K3NA 5KXDA 3NAPA 2X09A 2XBO1 2RJLA 4PBOA 4KL1A 1GKBA 5A32B 4KMQA 3VBOA 1RUJ2 4LKSA 4YARA 4H7MA 1PM4A 2Z69A 3INAA 3U78A 1LHVA 1WD4A 2DUQA 3GYDA 1Y9GA 4CDWA 1ND2A 2V73A 4IE5A 4HETA 1QDOA 3EJKA 3ON7A 1QH7A 3PVOA 4MX3A 2R071 1CAXB 1ONAA 2VW1A 5CKNA 4HVOA 3ZR5A 1SHWB 4N9IA 2DTWA 4N53C 3LZZA 3AK0A 4OULA 1A34A 1RUG1 1SZBA 4QU1A 1H8TB 1UOGA 1W3VA 3W21A 1G9BA 5KHKA 2J1AA 4DXRA 5I93A 5HV4A 1I3HA 3IPVB 4IUGA 4R8HA 2WYFA 4CA9A 2YUEA 4RGGA 3ZLIA 2C4XA 4JQRA 1FNYA 1REFA 2A3XA 5ERLA 1EYBA 3ZYHA 2RS11 3SITA 3CQOA 3N9PA 4N53B 3CJIC 4EZ4A 3QH6A 1JYVA 4XIOA 2C1FA 1NG0A 1SLIA 2J1TA 4A7YA 3PLQA 4MVTA 4MGKE 4CEYB 1D4M2 1S55A 2E9QA 5GZFA 4E4DX 1CZVA 3OBZA 2G9ZA 2V5DA 3CEWA 5C5UA 4IGQA 1PVC1 2NMOA 3AKSA 1HN1A 1S2BA 4XFFA 3WW3A 3WNLA 2JDHA 2BRTA 3L2YA 4RGAA 3VKLA 3USUB 1ND3B 4A6SA 2BPA2 1IG0A 1VRH1 3ZFFB 4B4QA 2JICA 1N3QA 1PIV1 5FXVA 3O1SA 4KU8A 4YZ2A 5J37A 3VZLA 4Y1XA 2W3JA 3J7HA 2RE9A 4UW3A 3WEZA 4B7KA 2HWF3 1RUF1 1W39A 1S0IA 5L7OC 1UYZA 1LESA 3C7HA 3KZ4C 4OUMA 5JZGA 5LEKA 1C1FA 1DQ1A 1NCRA 3HNMA 5KHHA 1NA1B 4OI1A 4CDWC 3LEKA 3DN7A 3I2IA 5C9AB 1EV13 4O9EA 3TB0A 2WN3A 2WT1A 4GA9A 4GH4A 2VMGA 2KM2A 2VZQA 2BERA 4OI0A 1H8VA 5SV5A 2HWD3 1ULDA 1WWYA 4UYBA 3USSA 4AHWA 3NAPC 5FP3A 3O5SA 3WNMA 1HQNA 1JUHA 2ZEZA 2QJVA 3VDDB 4ES8A 2XJVA 4NN0A 2WWSA 4NOTA 1KFUL 1DHKB 1RUC3 4DXSA 3N36A 4GH4C 4PJYA 1GWMA 4K9SA 5F5CA 4XTPA 2R073 2PTMA 2R0FA 4HANA 4AHXA 4FSJA 5BV6A 3MIFA 3ZFEA 2HWB2 1RINA 3ZFFA 2ZEYA 4D7TA 1CAXA 3OGJA 1YRZA 4AVVA 2BEOA 3IIIA 1C28A 5DZEA 1XSQA 3K4AA 1JZ7A 1HB3A 2XXZA 3VBFC 1V70A 4OLLA 2ZGTA 3BTZA 3LEMA 4XTMA 1QU0A 2Q8DA 5FBJA 2E26A 2XMLA 3V64A 2WNVB 1X7NA 3JUUA 1X9TA 5DAWA 3U4SA 3WCSA 1VBE2 2PQSA 3ZXJA 2FDHA 1LOFA 3CHXA 1UPIA 2ZHKA 1UYPA 5A3MA 4IEOA 4YM1A 4CP0A 5C3QA 3ZN6B 5FYBA 5J1XA 1NCQB 2BDRA 4R9DA 1PM7A 3OCPA 4XE9A 3VD3A 2ZJCA 2VQUA 5JSRA 1C3HA 3FC0A 4EE2A 2BWCA 3PUIA 2JG8C 4ARYA 4LE4A 4P9LA 3DPRC 4D0QA 5I91A 1L7LA 2VZTA 2ZX0A 2F17A 2ZOEB 3CF6E 2QZ2A 1ZZ6A 3LSDA 1TME3 2ZCWA 3T3YA 3WP3A 2GP5A 1WMEA 1H9PA 4UI9L 5IATA 1I5ZA 2VGDA 3VV1A 3PU8A 1DQ2A 3C7OA 2B9VA 2A7AA 2GC0A 2PYTA 4ITCA 5G04L 3VN4A 3LEGA 3V65A 1COV3 1GZWB 4I2OA 3AYDA 2JEMA 2OUJA 1K12A 1RGSA 3BODA 3Q8CA 2K0GA 5ACA3 5L73A 2DF7A 2ZX1A 3MICA 4Q4V1 2C24A 3CBNA 3U1XA 4LTAA 4DQAA 3ZFGC 4FTBA 2Z79A 2YC0A 2HEVF 1TNRA 1OT5A 3OYWB 3EBRA 3VHRA 1QXRA 3OY8A 2K9ZA 3HT1A 4E4HA 5K0UA 2OKXA 4DB5A 3AC0A 2Y38A 2D6NA 2VUDA 1RUG2 2XJSA 2AEZA 4CU7A 3KM5A 1TMF2 1ZBE2 2D3SA 3BOPA 5DN2A 1RUC1 2X8KA 3AYEA 4DUXA 2VNOA 4IERA 4L9BA 4OI2A 5HPOA 1AYM2 3WVJA 1STMA 1QQP3 4YZ5A 5BNPB 5FIXA 1HRV2 2FMYA 4UFMA 1ULPA 3FN9A 3WNOA 5IVCA 4QX7A 1SBFA 4AQ6A 1TMF1 1ZBE1 2QTWB 5E1RA 2DBIA 1O5UA 3GJAA 3ZXGA 4OI4A 1FYUA 4URTA 4Q8KA 4XQWA 1W28A 1CIYA 1T6BX 5FY1A 1EAH2 2F4PA 2FMDA 3L9JT 5E16A 1MACA 4AYUA 5BNNB 3KS7A 4AEKA 5FZ3A 1TE1B 2VR4A 1H2KA 4HFSA 3UGGA 1HDKA 2VD7A 2VQTA 3K4ZA 5FXWA 1YUDA 2EF6A 1V6KA 2WA4A 5JDBA 4HOOA 2OA2A 4ZZ5A 5LBCA 1OD3A 1QF3A 3MF9A 3U75A 3T0AA 3IKWA 4MOAA 4YZ4A 3VD4A 3RZMA 2VZOA 4CTEA 4Q4Y3 2X29A 2XGXA 2UURA 3H42B 1LOBA 1SDDB 1ZZBA 4LIUA 4RL7A 4Y22B 1N1TA 5CNAA 4YG0A 5FUPA 3O1VA 3DECA 3ILNA 2CL2A 2IUWA 3ZSKA 4QB6A 3P1IA 2VULA 4CDXA 4U36A 5FK7A 1BXHA 2LALA 3CIHA 3DYPA 1QJFA 4XFHA 3SEPA 2IC1A 2WQ8A 2BZDA 3AMPA 4IEUA 2RV9A 1AZDA 3B93A 1W6PA 2ZEWA 4I0AA 4QGLA 2QQMA 1IQDC 2H0BA 3B5LB 3VBRA 3ZSMA 3HOBA 4AEDA 1QJY1 3VLBB 4FAGA 4QXBA 1VLNA 3J8F3 4BOWA 3MPPG 4FPHA 1CAWA 3WR0A 1RMU1 2EIBA 5FP4A 2VVEA 2FDGA 4EN6B 4Y5SA 1ULEA 4MHUA 4P9JA 5GLTA 2ZKNA 3QCWA 3UJOA 3BYWA 1BMV1 3SXWA 2JDAA 3UKNA 4ZY9A 2YBSA 2P6CA 4OQ9A 3RVHA 1RUC2 2RHPA 1CR7A 1AUYA 1JYNA 2Q1FA 2P5BA 1RUE1 1BBT3 3AP6A 3OPTA 1RUD1 1RVF3 2EXIA 3SCHA 1ALYA 5AC92 4KWUA 2QQOA 4LR4A 4YVWC 4WV8A 3AMNA 2WSUA 3IN9A 4FAHA 4IDZA 4KWKA 5C9AC 4M3CE 5CU1A 4YW1A 3IM0A 3ZYRA 4CDWB 3HNYM 4BM8A 3IBMA 3BIEA 1E5HA 2Q5TA 4A4AA 1OVPA 2XG3A 4XZPA 2QDRA 1CD3G 1GANA 2IWGB 3GNEA 4LULA 5FZHA 1VAVA 4XFGA 1RUD2 4AFCA 4YGDA 3KQ4B 1ND2C 4XBNA 3ZFFC 4A7ZA 3MBWA 5JMCA 4IEWA 5BPXA 1S2KA 4N43B 1VBE3 1YQ2A 2XQRA 5I0SA 1XPWA 2IVIB 1YI7A 1POV1 4PDWA 4WZFA 3T4VA 3ZYIB 4C91A 4B29A 1YYNA 3J26N 1PMIA 3KF5A 3NNGA 5FZEA 2ES3A 2R32A 1YO8A 4P9IA 5CADA 2CWSA 1W6NA 4E4SA 3OB8A 4HPKA 4LBKA 3RZZA 3KHCA 1LGBA 2IVJA 1LHWA 5C71A 1FV3A 1OD5A 4QB1A 4Y20A 5LBBA 2JG8A 1OBNA 4JV4A 1XU1A 1FOD1 1E5IA 2XL7A 4DMIA 1MS0A 3D0JA 1PK6C 1QKQA 4QX1A 4BHPA 2YC4A 2VZVA 2V72A 1J3PA 3RI8A 5A6XA 1JBCA 3H8XA 4XFIA 2W5FA 2JG9C 4XURA 4CCOA 1AHSA 1XYPA 4BQ3A 2RM23 4OFGA 1JZ6A 4YZ1A 4FPOB 4J1WA 4NWVA 4YFWA 1PIV2 2K2SA 5AFBA 5BUVA 1FXZA 4OUSA 2PQQA 2BVBA 2A6ZA 4LBQA 1O8PA 4XMAA 1R1ZA 1H2MA 2CU5A 3ZFEC 1S0JA 4IV1A 3E97A 4UFIA 4ATEA 1DFQA 1R091 4E8DA 5TSWA 1SCRA 2JE9A 4YYOA 2WS92 1IGOA 1UX6A 4ATFA 4FFHA 2E51A 1QJY3 4OZOA 4YZ3A 5EFUA 2QNKA 1JODA 2QQLA 4CEWA 1OKQA 4RHV1 2D5HA 2W1SA 5FYTA 2HBUA 3VD7A 4CE8A 4Q4Y2 3PVBB 3O1TA 4UW4A 4OQ8A 2VMFA 3POSA 4M3CF 3ACFA 1D4M3 2PLV3 1HKDA 1S4CA 1WW6A 2IXIA 2YPDA 5ABJC 2CGPA 3KT1A 3ZXKA 1TMF3 1ZBE3 2ILMA 2IXLA 3AZXA 4UF0B 1UYXA 4RFT0 1UKRA 2ZA9A 4Q2FA 4BQYA 4BQ1A 3QBQA 3AXDA 3DV8A 1QHDA 1RJ8A 1T6GC 4K40A 1SLCA 5FY0A 1ASJ1 4JKKA 4NAMA 2LROA 2PLV2 2RJKA 1AR81 3N9MA 4NIIA 1AR93 3ZXEA 4KGGA 1ZREA 5A1LA 2VPVA 5FZOB 2F4LA 4Z2AA 3AYAA 2B39A 3W9AA 4IEQA 2W94A 4LE3A 1JTZX 2FHRA 3VKFC 4L2NA 3VBRB 1VBD1 2B45X 5F37A 2WBKA 4BPZA 3R0RA 4TYSA 4Y3OA 1FPN3 2DURA 4D94A 1XOYA 3WT3A 3OUJA 2LS6A 3AJYA 3FUQA 3ILRA 5JR2A 2FCTA 5T5OA 3POWA 1FMD1 2TNFA 4PLOA 3VDBA 2EIEA 1K42A 4HXCA 1COV1 4CXXA 1GQPA 4CXYA 5LW9A 1GOHA 2BGOA 3KCCA 4HSLA 4BQ5A 1OSGA 2B8MA 1XNCA 3TNQA 1PO11 5IVVA 4NRPA 4Y20B 3NV1A 1OA4A 1PVXA 2VE1A 5F2SA 1M06G 5F5AA 3T1MA 3GF6A 4HPKB 5C8CB 5C4WA 5LA2A 2I2SA 4CDQA 5C33A 4NHLA 2D6KA 4P14A 2ZHNA 4CEWC 3MFCA 2BVVA 1ZA4A 3ME2A 1UWWA 1R092 4IETA 5EQUA 2PHRA 3WOGA 4XXAA 2VOTA 2YGMA 1T2XA 1D7PM 4C1XA 5K7PA 3WNNA 4JTOA 2WINB 3OSDA 3UESA 5JOYA 3NV4A 4DXTA 3A23A 2GNDA 1XE0A 2JJ6A 2ZX3A 3JD71 1NQJA 2UWBA 1F4AA 1GU3A 1JUIA 1AR61 2B4KA 3DYMA 4UXAA 1RUNA 1C8M1 2Y6GA 4XAEA 5D8AB 3SC7X 2GH2A 5IYYA 1QMJA 1X36A 4RHV3 5FUNA 1X33A 1RUE2 3B7MA 4OUEA 4XQ4A 4AEDC 4BDVB 3LB9A 1ZA7A 3IMNA 4S2GA 3VD9A 4YGBA 3QOPA 4LITA 2W1UA 1ZZCA 4FPLA 4LOTA 5FZMA 1EPZA 2RMU1 1CJPA 1W8UA 4UW5A 4CYDA 1DYPA 3FMGA 4NAOA 3GM8A 4TXWA 4IV1C 2VO5A 3BU7A 4M4PA 1QJU1 4LEJA 2BYVE 4JKLA 4MV2A 1IS4A 4ISQA 1GYKA 1MVQA 3LAGA 4QHBA 3TEXA 5A80A 2A5ZA 5T5PA 2JDNA 1XYNA 3ASIA 4A6OA 5JZGB 1HV1A 1DQ6A 2LRPA 2W1QA 2VOXA 4G9SB 5FZKA 1Y3TA 3VHPA 5DAQA 1SCSA 4D69A 1HJFA 1Q8VA 3AYCA 3ZPOA 1B35B 4CXWA 3FUOA 3W5MA 3JZVA 2EALA 3OEAA 2LTNA 3BKZA 1LOCA 2XBO3 3VHNA 2WA3A 4L97A 4PIXA 5KBFA 1OPOA 3CMGA 4PBPA 1CJDA 2JG9B 2DTYA 4QQ2A 2VY0A 3J9SA 2BGPA 1W8OA 4HONA 5BXXA 3Q8EA 4F8AA 1CX4A 4DY5A 1UOFA 4YPJA 4XXPA 1CPNA 2HWF2 2BFUL 3KV9A 5T5LA 4HKLA 1DGWA 3H3LA 4AHYA 2JDPA 4CRQA 2Q30A 3M4FA 4DZGA 4LMFA 2WIIB 5GALA 1KJRA 4X8NA 5T5JA 2RDNA 4LA3A 5DZFA 4D6QA 1LJ7A 1G9AA 2HWF1 2HWC3 2FD8A 3PL0A 2PLV1 1AXYA 1OOPA 1V6MA 1GNHA 4K20A 2XONA 4YW5A 1ACCA 3T2TA 1REEA 4IEPA 5FOJB 1OHFA 4PQQA 4B1MA 4P08A 1VRH2 2IFRA 1W9WA 4QX2A 3ZYBA 2JB8A 5C3PA 1RB8G 3PU3A 3FE5A 1ZRFA 2LM3A 1W04A 2E31A 4RQPC 1C1LA 1DQ4A 3I59B 5CFCC 3NL1A 5IVJA 1ZRRA 3E6BA 4DIQA 1YQ6A 3BTXA 3HIFA 3CU7A 3ALQA 3M7AA 3C8XA 4E9KA 1JZ2A 2DVDA 3JBG1 4YSFA 5I8TA 2WZR1 5C3OA 2Y64A 3OGSA 4BXFA 4GB31 4DS0A 3POEA 3NJVA 1U5YA 1OOPC 2UY9A 5FMOS 1LOEA 1ZVFA 3ORJA 4QPIB 4CDUB 4COYA 1ENRA 1Y9MA 4R4XA 3AVRA 5CFDC 1YFXA 1G86A 4AOCA 2YY1A 4LBLA 3U10A 2DVAA 2Y6JA 3MIDA 1J84A 5D1IA 4OHXA 3THPA 4Z2WA 2WNUC 2VCMA 4K8FA 1RL3A 1URXA 2HWD2 1SFYA 3POBA 1WCSA 5FYZA 2BTVC 1F15A 3ITQA 1H4GA 4NJ4A 5GLVA 3ZO0B 4AVAA 3PHMA 4Q1RA 4CDUA 4AI2A 4GULA 2Y26A 3T4HB 1OH3A 2O8OA 2D44A 1D0HA 3WV6A 3SMHA 5BNQA 3VBUB 2EA7A 1POQA 1UU6A 4XDPA 1ULCA 2EICA 3GZTB 4JHZA 4XJUA 1GZCA 4BZ4A 2A6XA 4E2QA 3EMRA 3WDUA 3J8F2 4LHKA 1VMFA 1KEXA 1UU4A 5KHGA 3GZAA 1HRV1 5ACA1 4QPIC 2XUEA 5L19A 2XJUA 4YM3A 3WHUA 2BBVA 2EAKA 2OZJA 5EIYB 1LCLA 3BN6A 1W0OA 2ARXA 2ZGRA 2ZS6B 1CN1A 3KVAA 4FXKB 5EXOA 2DU0A 4FPGA 5DAXA 3WG2A 1QH6A 3VBSB 3U4XA 1MS5A 4BLJA 1FMD3 4HL0A 5CIRA 3HNBM 1HB4A 3AKQA 2NMNA 4PIZA 3K2OA 4UOJA 2ARAA 5ACA2 1RUH2 1O4YA 1K45A 4BISA 4XVHA 3HAGA 4WM7A 3AP7A 1JH5A 1KS4A 1DGWX 4GALA 3RJ2X 4W8JA 3MIBA 4PI2A 3PMSA 2BNMA 2YB7A 5C70A 1AL22 3I7DA 1IS6A 2XBO2 4PF5A 1HXS1 2J1UA 5GM0A 1Y43B 3OPWA 1VALA 4Q4W3 1JN2P 1NLSA 3VBSA 4BH9A 1H9WA 2RMU2 3OBTA 4I30A 4QPYA 2HJIA 1YFWA 4RHV2 4AHZA 1W6MB 1RUE3 5FY5A 4Q1PA 3AP5A 1EV11 4GAZA 1FOD3 4HK8A 2ATFA 3THCA 4LHSA 2UWAA 2VOKA 2WS91 3FJSA 3PJQA 3RZGA 1ENQA 3NNFA 1RUJ3 4BK4A 4IXLA 1SFNA 4AFDA 5K4LA 4Q4W2 4Y22A 1QQP2 2WJSA 1JMUB 3N3HA 3GZEA 4LO7A 4QX8A 3ZYGA 2JECA 4BB3A 1IOAA 1LTEA 1UZVA 1MQTC 1WD3A 1ZNPA 2J1VA 3BIWE 4IGPA 5FZ1A 2NYYA 3UNPA 2EXKA 5CKQA 3E5QA 4FXGB 1N1SA 2Z4FA 4W6XA 2WKKA 4WVMB 2UU8A 4GWNA 1PZ8A 3PUAA 5CB7A 2WABA 2XWJB 3TBDA 3H8RA 2D93A 4MGZE 2ORZA 4GMP3 5IJRA 3TNPB 4A2UA 2AC1A 1CX1A 4XUOA 1WUVA 2JDMA 5JZGC 3Q8BA 4TLGA 3C7EA 3H9AA 1YJKA 2AGSA 5B2GB 3AZWA 5LCWL 2YC2A 3NV3A 2EVXA 4U2AA 3T2QA 5HCAA 1AX1A 3N9QA 2WZPP 4C1WA 3N9OA 1MQTA 2IXKA 4AI3A 5A1AA 4MXWB 3R4DB 2VZ3A 3W58A 5FRAA 4IV1B 4JTNA 5CISA 3MYXA 4QDQA 5I0UA 4MLOA 5FLIA 3RPQA 1VB2A 5H9QA 1AYM3 1OC1A 2TBVA 3ZDSA 2ZABA 2Y6HA 2CHHA 5GZEA 5L9RA 2P3JA 3ABZA 3VZNA 4NPMA 3BUCA 4Q0PA 4NIGA 3A22A 3T2PA 1XXNA 4BQ2A 3POYA 1NCQC 2ZGNA 3PUHA 4L8QA 3MEPA 4XJAA 1LOGA 5FTTC 4H3WA 3WNKA 1UD1A 2OX0A 4XBQA 4XUNA 1BHGA 1B09A 4EZHA 1WLTA 4DEQA 2VOWA 3CJIA 1PO21 2V4AA 2WUHA 3CJXA 4IEXA 3WG4A 1WW7A 3E6CC 2NP0A 1R083 2WT0A 4N53A 4WM7B 4YGEA 1W2UA 2VTFA 3MDPA 4XHXA 1Q8PA 4CDQC 3RZKA 4XCBA 5C4WC 1O3TA 5HXMA 5FOBB 4CCJA 3THDA 3ZSLA 1O4ZA 3LQCA 3GDBA 4Y33A 1HXS3 1H8TA 1OFSA 2P2KA 1XRUA 2QQPA 4QB2A 5GKAC 3HN1A 2CY6A 1YQ5A 5H9RA 4MXVA 5KXCA 5FZ7A 4CDXC 2R072 1RUOA 4OMCA 1G9DA 1GP4A 3GGLA 5FPVA 5KXBA 2QDNA 1L7QA 2QQNA 2IXJA 1LODA 3BALA 2XVKA 2ADEA 5FZDA 2A70A 1OURA 1U0AA 4L0PA 2P34A 4R52A 1KQRA 4LXLA 2ZMKA 2VBDA 4GMP1 4MYEA 1DZRA 3LIHA 3POGA 1XE7A 4BLIA 1APNA 3TEWA 4XHBA 4P02B 3E1F1 4AI1A 1IQAA 3DUIA 2D40A 3POJA 1W8NA 2WRAA 2ZHMA 3GJBA 2EXJA 2XLGA 2J1SA 4Y4YA 1H0BA 1OMIA 3RZJA 5AC93 1NCRC 3FLPA 5FPZA 2WLPA 3WP6A 2OW4A 3JU9A 1CIWA 1SPPB 1XB9A 5FZBA 1W6MA 2DVGA 5FXZA 2Q8EA 4ZPIA 1JZ8A 3LFIA 1JOJA 2WNEA 3MLJA 5CEHA 1G9CA 3JB8A 2W9XA 4N8MA 4A45A 1UY1A 2HBTA 3CL1A 4QPGB 3MLLA 4Q0SA 1OPMA 5HXVA 1YJLA 1KGYA 4XDQA 1NXD1 2NPIA 3VUOA 4GXLA 4B4RA 4HN1A 4C90A 1F31A 1MS9A 2AUYA 2E7AA 3B00A 4MHRA 4CDXB 4W4ZA 1SG3A 2GNTA 3AMMA 4CEYC 3T09A 4DINB 4FOQA 2VQAA 1LOFC 4JGZC 4A3XA 4MGIE 5A7PA 4PI0A 5F2WA 2R062 3TYJA 2D6LX 4XF9A 4LKEA 1Q5OA 1N1YA 1DQ0A 5FYUA 2BBAA 3K4DA 3BPSA 2VVDA 2WR9A 2RDRA 5CKMA 1A3KA 3T08A 4WM7C 2O0OA 1WW5A 1B35A 2VTXA 3AP4A 4HMZA 1G9FA 3MLKA 4KWLA 4NIDA 2VL4A 4CP9B 5FYYA 1BYHA 1MZFA 5FP9A 3H1MA 1FI2A 3VBHA 2Q1ZB 5LBFA 4EN9B 5JCTA 4AGGA 1LHNA 2D6MA 5LEJA 2A75A 1LGCA 3NO8A 2DV9A 1NLQA 4FOVA 4KH9A 1FT9A 5JR7B 5FWJA 3NJZA 3O1RA 4M0HA 1YXWA 4LBNA 2Q1MA 3NJYA 4P5HA 4BYYA 2XL9A 3HN3A 2QQUA 3TRSB 5LA0A 1LAJA 5IUQA 3TN92 3NKTA 4QDSA 2VNGA 3NVCA 4KNCA 2R041 2PHTA 1UZWA 3DL3A 3N7JA 4JDOA 4PLNA 4YLZA 4OVEA 5LK7B 1AJKA 3RZHA 2DCZA 1S0GA 3B02A 4RYDA 4CUBA 1DU3D 4KQ7A 4DOUA 5KHJA 3FBMA 5GJ6A 4MG2A 2GP3A 4IEZA 4HVQA 1LU2A 3APBA 3WSOA 1NX9A 3N9LA 3WDVA 1I6XA 3E5XA 3TWIA 2FCUA 3EB7A 4XACA 5FO8B 4TSVA 5J09A 2Z5WA 5IAVA 4JCKA 1YNAA 4NRMA 5FMBA 5HBAA 1RITA 5JOWA 3WY6A 1GWLA 1YFUA 5FKCA 1YQCA 3SNMA 1OI6A 2VOVA 4AAPA 4XPVA 4EWEA 3AXEA 2FCVA 2WO2A 2V4VA 4YWAA 2Y6LA 4QPGA 1V9U2 3N7KA 1CQ9A 1IS3A 1TG7A 1AR83 2BOJA 2D3PA 4BMEA 1H2NA 4EN7B 1RIRA 2W87A 2XHKA 1G7YA 4GWMA 4LQRA 4XYXA 1NQDA 1YCIA 2P4EA 1WLWA 4N9HA 4XUQA 3VDCA 4AEMA 3LPFA 5JXJA 5C3SA 1VBC3 4HG6B 1Q43A 3B9CA 1RUH1 1UCXA 1XC6A 3PNAA 4UFLA 5LBEA 3VL8A 4CCMA 2E32A 3J7MA 3T0DA 1BVVA 3AVSA 4XC9A 3ZSEA 1HB2A 4ZXKA 3D8CA 1ODMA 1PX3A 1XJAA 5IVEA 4Y4RA 4D8MA 1GZWA 4KBBA 4NR1A 1VBC2 3CNAA 3BI3A 2OUHA 1FAYA 1X8EA 1BBT2 1W6OA 2VMIA 2ZGLA 1S0EA 1H6YA 3AKPA 2J1EA 3FHIB 3MF6A 4NHXA 3S7EA 3VGIA 4XFCA 2DYCA 2QZ3A 3WDXA 5FZOA 1WW4A 1PZ9A 3ZXFA 1ND3A 4LORA 3VBSC 4AEJA 1VIWB 1YWKA 3KV6A 4TTGA 2J42A 4H55A 4V1PA 4XMIA 3SH4A 3UL2A 1WGPA 2WO3A 4M4RA 3WHTA 4XJ9A 3RDIA 1REDA 1XNTA 5H9SA 4XJZA 1RHI1 2RS31 2B7YA 3OD0A 1KDMA 5F32A 1SBEA 1EY2A 3IB3A 1JU4A 3WDWA 4PLMA 5A7WA 1GV9A 1JXNA 1R1A2 3S5AA 2SLIA 3I8TA 4LHNA 3LA3A 4LLFA 2ZGQA 3E6DA 1LU1A 5M0TA 1O4TA 3OUIA 2HYKA 3IPVA 3J7LA 1AVBA 4LBQD 1W6QA 4P9GA 3ETQA 4LJHA 2WN2A 2BFUS 1UIJA 4HBNA 2DCJA 5JIUA 1ODNA 4JDNA 2PHUA 1V6LA 3W5NA 1W90A 2PN5A 3LDBA 3O14A 3PUSA 3WNPA 5IFPA 2RS51 2VZUA 2ADDA 2WNUB 3UKTA 3ZIWA 4RR3A 4Y5Z0 1WA4A 1AJOA 1NE6A 4QKBA 3EYPA 2GALA 3H50A 1C8NA 3Q8FA 5FZ6A 3WF1A 3A21A 3M1HA 3S5QA 2DUPA 2ZMNA 1UOJA 4WBBA 3SISA 4A41A 4CDUC 5ABJA 3NNJA 2P1BA 2GDFA 1E5SA 1BEV1 3WF3A 1HRI1 5T55A 5I0RA 3ACHA 3ES1A 4R9CA 4CDQB 5FZ4A 2FQPA 1D4M1 2RM22 4E8CA 1ZZ8A 2XVLA 1OQ1A 1H4HA 1PIV3 1TZOA 1FX5A 5IVYA 3KD4A 1SMVA 2VZPA 2A3YA 1SPPA 1A6CA 3IIAA 3WF0A 2ZGKA 4JC1A 3MW2A 3PURA 1H6XA 3K3OA 4NRQA 5LA1A 5DUUA 3ELNA 3M3CA 1UZYA 4MUVA 3UETA 2ZKLA 1VR3A 4XETA 1OUSA 4FVVA 3DPRB 4CSWA 2DVBA 4CP1A 2JG8B 3ZKYA 4QHZA 1O8SA 1UNBA 1RXFA 3FWEA 3I2FA 3BTYA 1PGL1 1V00A 2HWD1 3FFZA 4FT8A 4QAWA 3W59A 5JPNB 2YGLA 2Q4SA 3FHQA 3VBHC 1SFPA 2W39A 4BQWA 2QBXA 2OYZA 1GOFA 3CZJA 2W95A 5APAA 5KC6A 1AR82 3TAYA 5BNPC 1PX4A 1VRH3 5K9YA 3ECQA 5F6KA 5KWRA 3POFA 5KHIA 2PFWA 3ROUA 4C8DA 1VMJA 1W03A 4GWIA 1YC61 2WNVC 2EAAA 3MUZ1 5A7SA 3PVEA 1BVP1 2D3RA 2P3YA 2QKDA 5HV0A 5JPMB 5DXDA 1BEV3 4NHYA 3DKQA 4Z07A 1S2EA 2RDQA 1X8MA 4DFSA 1WLCA 2CTVA 3NQHA 3FLRA 1H30A 2BP6A 5DAVA 4LPLA 4Q4X3 2C9KA 3ZN6A 4XEZA 1NYWA 5DG1A 2CAVA 3HQUA 5C8CA 2XB6C 2AENA 4QQOA 3SH3A 2VUJA 2EXHA 5CA6A 5K0UB 2WT2A 3MGUA 3QLQA 1CAVA 2W1WA 5I8SA 1LOAA 3T30A 3VDAA 2H0VA 4NUBA 4PT6A 2A1XA 5F5QA 2WDBA 2VU9A 3GALA 4GH4B 5CAZA 4NIHA 4Q4X2 5EHDA 3PVNA 2BWAA 3AKTA 4AK3A 3H3ZA 2RS12 2MEV2 1NA1A 1V9U3 2G19A 3KB5A 3PDQA 4DUWA 5B4XA 4YM0A 1HW5A 4GWJA 1OFNA 3FFQA 3O0XA 2DDUA 2XPJA 1YQ8A 2J22A 1JYXA 1PMHX 1QXPA 4Q0UA 3VBHB 3JD72 2W47A 3UK9A 5C6CA 2RMU3 4YW3A 4QGNA 5JSOA 1FOD2 5JWPA 5DQ0A 1QJU3 4S2DA 3I2OA 1AYN3 1Q8QA 4JGYB 5D8AC 3ZR6A 1NAEA 3NKGA 5BNOB 2OIIA 5FZLA 5F3EA 3IAQA 1RVF1 3F2ZA 3D4KA 1V6IA 1UN1A 3MW3A 4BMBA 1IPSA 4S2FA 4Q0VA 3NJXA 3V0AB 4OHZA 3KF3A 5LY1A 5ANQA 1Z78A 1SLLA 4MGQA 2GMMA 4FOWA 2D6OX 4CEWB 1IPJA 1W2AX 2XKOA 4M3CB 4PCRA 5BNOA 5C8CC 1ZRIA 1PGSA 4XUTA 2JXAA 3MW4A 3BGAA 2DVFA 4ZHNA 3GHNA 5D8AA 3CJIB 4FP2A 5JOXA 5E88A 2JDZA 3LEIA 1VAMA 5FYCA 3S57A 4KGQA 4FP3A 3JQXA 4H2AA 2N7GA 4HKWA 1GBGA 3UGFA 3WUDA 4CVUA 5IVBA 4W6YA 1W0PA 4KU7A 4RN5A 2CGOA 4NVPA 1W0NA 4B8EA 4YW7A 2VECA 4COVA 1J3RA 2X10A 1ULFA 2QVSB 2Y8KA 4PDWC 4D6RA 2D6PA 1BQPA 1DZTA 2OPKA 1NOVA 2HWB1 4DO0A 1H1AA 1CONA 5FYVA 4HLTA 3Q8AA 1MEC2 3ZDVA 2R063 1UMIA 1ULGA 1W6OB 3C3VA 3KCYA 2E63A 1RC6A 1JI6A 1K5JA 1OQDA 3PJYA 4YNIA 4YGCA 5CFDB 5JI9A 4DNYA 4D7YA 2WC2A 2TEPA 1NZIA 1UPSA 3OOXA 1OOPB 3T1LA 5JUVA 1O6UA 4GB32 4JHTA 3V0AA 4O61A 3S30A 2JKBA 4WZCA 4KG0A 4MH0E 1W8FA 1V9U1 1XNKA 2DFBA 1WCKA 4RA0A 3SKVA 3D82A 3FL7A 5A6QA 2RG4A 2XUMA 4XF4A 4P5YA 2PAEA 1W6PB 4R4ZA 2R043 1QIQA 4FPFA 4S2HA 3ST7A 2PHFA 3MO4A 5F7UA 3ZN5A 3NMBA 4RQPB 4LNVA 1UY3A 5F3IA 2P37A 3WLUA 1UQXA 3ZIXA 5DUXA 4AZZA 1GZ9A 1IS5A 3RGBA 2RR12 1EUTA 4BU2A 1N47A 4EN8B 1VJ2A 2UYBA 5JAXA 3BCWA 4Q26A 5SV8A 5DZGA 2OPWA 2MPFA 3AZVA 1UIKA 2A6VA 1JYTA 1J59A 1ZBA1 4GIQA 1IZ3A 5L36A 4BQXA 1GR3A 1Q3EA 3RI9A 4DRRA 3MUY1 1NUKA 4QKDA 3MPBA 3A0NA 1N3PA 5HCHA 3FZ3A 4JVAA 4XABA 3OJBA 3ZM8A 3OGVA 5KXEA 1PHMA 1V0AA 1R64A 4TWTA 2XKPA 5GLZA 2MEV3 3HBKA 1POV0 2RS52 4FO9A 3KQRA 3J4UH 1UY4A 4LOSA 4F7ZA 4KBZA 3VKMA 2R30A 1Q56A 2HWE3 3K46A 3E5UA 5A3NA 2ZEXA 1D2QA 1BBT1 1UF2C 1LEDA 3KV5A 2YROA 3AL6A 4V2WA 2YDEA 4YVWA 2YV8A 2Y60A 3LOBA 4LBQB 4KWJA 2W68A 3MFAA 5B4NA 1O5LA 4XJWA 5F3GA 1MS4A 1QDCA 2W91A 1Q8SA 2VCAA 3DXUA 1I9RA 3AJZA 5FREA 3WQ7A 4I3GA 3V56A 3WQBA 3D0SA 3UV9A 4AI9A 1DCSA 3HWJA 1ASJ2 5FJKA 1ZYBA 5T52A 3IAPA 2Q0AA 5J96B 4N90A 1UY0A 1WZXA 3EQEA 4WM8A 4BA6A 1ND2B 4COWA 4D6SA 3SCGA 3U14A 4DY3A 4Z8BA 3QACA 1UZZA 3OD4A 3JCIA 1LGNA 1XNBA 1GNYA 3RRDA 4AXOA 4AFAA 4WVZA 3MI8A 2GH8A 1AR91 2I07B 1LR5A 3OG2A 1NCRB 2GZWA 5L9BA 5F1RA 1JS9A 2PAMA 2JDKA 1LB2A 4ZXEA 1ENSA 2CV6A 1MPXA 4XIKA 4BWOA 4FTSA 3FX3A 5LK5A 2R1DA 4I09A 2YHJA 2VQ0A 3AP9A 2Z42A 3O7OA 4PHZA 4CP2A 1K3IA 2ET7A 4AVBA 1W9FA 3VKOA 3OBRA 1SEFA 1RUH3 3JBG3 3NNLA 4LBOA 1JZ5A 4BE3A 4FQ4A 4LHLA 2YZ4A 2CGNA 1TVGA 2ZGPA 1F4HA 1W9YA 2SBAA 4LK6A 1PNFA 1O3QA 1MEC3 2XJPA 3IZOA 1AX2A 2DBNA 1OF3A 4XW3A 2PA7A 2Y0OA 3IDAA 4AG4A 1RUG3 3JBG2 1U5IA 4CU9A 2IZWA 4JGZB 1DLCA 3V0BA 4META 4TN7A 2P6HA 5FZCA 2KD7A 4CCNA 5CFDA 3PTRB 1IKQA 4LK7A 1J1LA 3LKJA 2O8QA 2XLFA 3H0OA 1A78A 1C8M2 1UXZA 3I59A 3M70A 5FXXA 5C8WA 3NV2A 1WCQA 1AR73 2R042 4NIAA 2P17A 2PHXA 3BPZA 5EJ1B 4ONUA 1QOTA 4CEYA 4N7IA 4IE6A 4D7SA 3IDBB 4JDMA 1Q8OA 4UT5A 3EHKA 1CAUA 3JQWA 4FPEA 1WMXA 2VNVA 4QQLA 1SQ4A 3QH7A 3R6SA 3ZMOA 1NE4A 1QNYA 4YRDA 3CDZB 4YVSC 4LO6B 1KITA 5EV7A 4B1LA 1AF9A 5L9VA 3WDYA 4ORFA 2GN3A 3GCWA 3UYJA 1AR72 5BNOC 1E5RA 1BCXA 5ISLA 2ZAAA 1PVC3 2OVUA 4FBFA 4B4PA 5KC5A 3B94A 1RUI1 4QX3A 3WW1A 1UMHA 4QKNA 5A32A 2X5IA 2VXRA 1NLRA 3K51A 5FZGA 4M3CA 4L99A 2BGCA 4E27A 4KG8A 3I3QA 3I49A 4QKFA 3HR9A 1C4RA 2DU1A 2WZ8A 5JXGA 4P00B 2CYFA 3GBGA 1XNDA 3A4UA 4GB33 1QOOA 4LUMA 1TNFA 4R9BA 1W2TA 3KWVA 4NPLA 4DRVA 1PO13 2X05A 1A8MA 2WFF1 1LRHA 2VNRA 2JE7A 2UY8A 4K3UA 3ZYFA 3TN93 4MGTA 4I01A 1KJLA 5BY5A 3WNXA 4CCDA 3RJRA 1W9SA 2MEV1 1WMDA 3MIEA 2X5IC 1RYYA 4Q4X1 5J48A 1VBA1 2D5FA 5FY8A 4Y24A 1WCDJ 1R082 1UO9A 1WBLA 4YG3A 5C5TA 1RMU2 5FY4A 1JOBA 1V6JA 2JKXA 1OLRA 4XF0A 1S0DA 3UKVA 1FV2A 1OF4A 3R05A 4QHOA 4N43A 1KD7A 1RXGA 1EPWA 2VTXJ 2VZ1A 2XVGA 3AMHA 2PHLA 4UBHA 3WF4A 2OT7A 2VC9A 5A3OA 3P5BA 3IMMA 1VRBA 2FDIA 1JYIA 3ZMNA 2XWBB 4GD4A 4W65A 5I0TA 4RR3C 4Q4W1 3UT0A 4WVWA 5J7MA 5F3CA 2YBPA 1Z0HA 1R093 2YFUA 5GLWA 4CU8A 5EYXA 3RWKX 4FFGA 3SQOA 2V5YA 3LGRA 3O12A 2JB4A 4CU6A 5F5IA 3TN91 3F95A 2B9UA 4K1YA 2RJ2A 1BK1A 5IHRA 3MHZA 4AGRA 3ZKUA 3I3EA 1AL0G 4UAPA 4FFIA 2OS2A 2VZRA 3H7YA 3JXSA 1EAH1 3CKHA 1DGLA 4EWDA 1VAKA 3AM2A 1HJGA 5FPUA 4AE2A 2D98A 1GQGA 5LASA 4AR2A 5EYYA 2B42B 1CVNA 5FQ0B 4A7KA 1YI9A 4J25A 1ZRDA 1D4VB 2C5DA 1QJU2 2A6WA 1AYN2 1MS3A 3B69A 4MXWA 4QX5A 1GNZA 1C5IA 2ORXA 4AQTA 4Q8LA 5A33B 3WF2A 2KXLA 4B7EA 4J1XA 5FYHA 2TUNA 1ZBA3 2OQ7A 1WBFA 2WZEA 5EJZB 4AQSA 5E8AA 3VBFA 1BJQA 1VBD2 4O9GA 3OEBA 2A71A 1DBNA 2FZ1A 1LECA 3VBUC 3FBYA 3OF1A 1O59A 2ZACA 5T54A 5JSPA 5CYYA 3WXPA 2CSGA 3DGTA 3BU0A 5I0DA 1ZM1A 4M0NA 1HRI3 5FQ0A 4XAAA 2W92A 3N35A 1AR71 2YU1A 3H3UA 2JIJA 1QJY2 2C9AA 2JWPA 4I3PA 4NROA 5CZKA 4CPBD 4AL9A 1ST8A 4YFZA 3MZHA 2I74A 2LUWA 5LY2A 1XSRA 5FV3A 3S0MA 5GZCA 3KV4A 5JOZA 3FHAA 3PUQA 2ARCA 1BLZA 4X6QB 2RS33 5BNNA 4MSVA 2GU9A 2VG9A 4LO8A 2P3IA 3KT4A 3RWNA 1NA1C 1NXMA 3PTYA 2WQ4A 1PK6A 1F9KA 2WZR3 4BCUA 1MZ5A 1J3QA 2RM21 1QGLA 4UWDA 3LD8A 5J3UA 4AQ2A 2WWUA 5IT6A 4W6WA 2WAAA 2DCTA 1C5HA 2VAUA 3FLTA 1UY2A 1WLDA 4HN0A 3O1PA 4IW3A 2RS32 2QQJA 2HWC2 3G6JB 3G7DA 4FFFA 4R9AA 3GBWA 4Q4V2 4JRLA 5CVRA 1IHMA 3VKNA 3DKWA 3P3NA 1U5XA 1UKGA 4LIVA 5A3WA 1DF0A 5IFTA 4ASKA 2YYOA 3DPRA 2XJQA 1FPN2 5EZWA 4N7UA 5IK8A 4Y5TA 2KR2A 5FYIA 1PVC2 2MHFA 4ES9A 2HLEA 4FI9A 1VBC1 4ZKTB 3URFA 3HQXA 3O1UA 2ZGSA 4I0WB 4XBLA 3T2OA 4COUA 3HEIA 5A70A 1POV3 1I1EA 4JGYA 1DIWA 1CESA 2BUKA 5FZIA 1CAWB 2IXCA 3MV11 1QJEA 5A1FA 1S0CA 2RS13 1NY72 3H8OA 3Q9OA 5G05L 5A6ZA 2IXHA 4AVCA 4SBVA 1GMMA 1XE8A 2VH9A 3D3AA 1Z7S3 4XFBA 3VB9A 4ASLA 4IE7A 1X9PA 3LCPA 5A7OA 4BQ4A 4UFHA 1P8JA 3I2HA 2XJTA 2A6YA 1OKOA 2C26A 3ZSJA 1JZ3A 3HVDA 3ATGA 2JX9A 1GUIA 2BW8A 1F35A 1EUUA 2H6BA 1E57A 2WO1A 5D2AA 4DEVA 4TZDA 1OH4A 4IV3B 3C7FA 2WNUA 1OA2A 4NPRA 5E89A 1BEV2 2QUOA 2ZGUA 2X5IB 5K8SA 3I54A 5FPLA 1PGW2 5DDJ1 2BNNA 2HWE2 3ZYJB 4QM8A 2QE3A 3LIGA 5LATA 4P9YA 1Y7BA 1CWPA 3PIJA 4V2VA 4TLFA 3AKRA 3ILFA 3P6BA 1PNGA 5E6HA 4AAXA 1GICA 2CWMA 2ZXQA 5CFCB 4XUPA 2AACA 2G9GA 3O0WA 4JKMA 2NLRA 4WM8C 5FLHA 2ENRA 3PMEA 2O14A 2ZAHA 3L2HA 5A3UA 1VBB1 3DYOA 4IEVA 4IV3A 1XYOA 5FMCA 1ENXA 2G1MA 1ASJ3 2JG9A 1PO23 1RJ7A 4FPKA 3LA7A 4WVVA 5IVFA 2WYSA 4EYUA 3N4MA 3VBOB 1AXZA 3JD73 1F2NA 2O1QA 4NO4A 3HPNA 3LWCA 1GP5A 2HEYF 4X6RB 3RYPA 3LFMA 4ZU5A 3B3QE 1VBE1 2VBPA 4IGOA 4QD2A 4OZXA 3HT2A 4I02A 5CFCA 1SDWA 2XHNA 5FYSA 4BJ0A 3ZXLA 1ZX5A 3ENRA 3U11A 2VCBA 2RVAA 3PIGA 5JIAA 5T3NA 4CCEA 1AYN1 5BYNA 2GMEA 3IT8A 5IK5A 1MS8A 1NKGA 2VZSA 3N7MA 5D21A 5FPAA 5DMYA 3VBFB 1R1A3 1U12A 2X53S 3M2MA 4FPYA 5FPBA 4UBGA 3RYKA 3R4UA 4M01A 3SEEA 1HQWA 2Y33A 1B35C 4K8RB 4YM2A 2ZX2A 2UWCA 5DABA 2HKXA 3KLSA 1J1TA 1H2LA 1HRV3 3WG3A 1HV0A 2G4IA 4JAAA 4K7JA 2ZTNA 2XQXA 1MR5A 3BOWA 1OA3A 1ZBA2 4NHMA 3POIA 1VP6A 2Y6FA 1V6NA 1W99A 4O7XA 4B3NA 4URAA 4QPGC 4DPNA 1MEC1 2DCYA 1XBFA 2WFPA 3D5OA 4AI0A 4E2SA 2VCCA 1K5MC 2GSYA 1DZQA 3HJRA 4RS5C 5FP7A 1C8M3 3VDDC 3J7NA 3LDRA 5C3RA 4CZSA 1UAIA 2Z2SB 3J8F1 3OGRA 4RSUA 1AL21 5AC91 4EWAA 4LUKA 1SBDA 4INDA 2A73B 3RSJA 5GZGA 4XCAA 3WD5A 4CUCA 3T0BA 2PAKA 3O1OA 4LO5B 3RFRA 5IWFA 1M4WA 3TOJA 2KA3A 1L3JA 2XOMA 3DF0A 4G4FA 1W3XA 1BK0A 1RUI2 5FPXA 2E6VA 2YU2A 1VBB3 4JGZA 4AVTA 1NY71 5FCCA 2RS53 4A44A 1UMZA 3NRUA 4OCTA 4GZ9A 3A0KA 3GXUA 1BZWA 3WX5A 1W2NA 2AEYA 3I4IA 3TEYA 1RUJ1 4MZUA 2RR11 1GP6A 1QJX1 1S1AA 3HD8B 5FUIA 1JHJA 3RQ0A 1MZEA
chains in the Genus database with same CATH topology
3CLPA 3AFGA 2WFF2 3ZFEB 2RR13 1FPN1 1ZRCA 4XILA 3KMHA 2P3KA 2MNGA 1RVF2 1DGRN 2A3WA 4XOGA 4Y26A 4OHWA 1R1A1 1UW8A 1LHOA 1QQP1 5AVAA 5C4WB 1R081 1O7FA 1JHNA 4X8PA 4FPCA 1LHUA 2ZHLA 1H8TC 1S0FA 1RHI2 4EN0A 2ERFA 1YIPA 1Y9QA 4PQ9A 4UW6A 3VBOC 1FMD2 2CAUA 2W0XA 5F6LB 1D0GA 2YXSA 3BB6A 1AR62 2GC1A 1NZCA 1AYM1 1GFF2 1TME2 2GNBA 3RNSA 5A33A 4AFBA 2DCKA 3KCXA 2D7FA 3RMXA 3S6PA 1KS5A 1N3OA 3S7IA 4N43C 2AREA 1AL23 5CG8A 2CNAA 4WM8B 2XJRA 4Q27A 5ABJB 1X50A 3NWKA 4K6BA 2AH2A 1D2SA 4HKOA 3C2UA 3O0VA 4YVSA 3H1YA 4QQHA 2VVFA 3GHMA 1RTVA 5FMOL 3JB4C 3K48A 2GMPA 2UYAA 2PHWA 1YHFA 3U0ZA 1VB4A 3ES4A 1UL9A 1F8VA 1XU2A 3WP4A 1HX6A 1GQHA 1DDLA 2GNMA 2NQYA 3P3PA 4IV3C 1W6NB 3RYRA 3OYWA 3VZMA 1QJX3 1PO22 2R49A 2V09A 3WDTA 3WW4A 4Z1VA 5FO9B 4P9WA 2QFEA 4IEYA 1MQTB 5J98B 2DWRA 4PDWB 4FCAA 4H14A 1XQNA 1KDKA 4AVSA 2ZZQA 5J36A 3VBUA 4GKYA 4F83A 4ZU4A 1PK6B 3AMQA 2HEWF 3SHRA 1ZZ9A 3GBFA 1A8DA 2F6BA 4IESA 4EROA 3VL9A 4P9XA 4BIFA 1BMV2 3OGGA 5HCBA 2AZ5A 3WCRA 5HI0A 4D3WA 1QXJA 1HRI2 4PIYA 1RUI3 2FBEA 1N1VA 1YIFA 1AX0A 1SACA 2ZPXA 3QD6A 4Q4Y1 3LA2A 1AXKA 4FPJA 1CAUB 4GKXA 2W08A 4NWWA 3THTA 1IPKA 4AFMA 1F5JA 1G8WA 4YW4A 2D43A 2JD4A 3B9IA 1AR92 4XFAA 2R1BA 2VW2A 1S0BA 1FNZA 1QJZA 2JENA 2ZX4A 2DFCA 1LKNA 4JGYC 4Y1YA 5FAXA 2WFF3 3AFKA 1CAVB 4YG6A 2B5HA 4L92A 1YFYA 1SLTA 1SLBA 3EXUA 2WNVA 2HWE1 3KSCA 5BNNC 3NSTA 1RMU3 2VW0A 3KT7A 3ZFGA 1IKPA 4YVWB 4LBJA 3LOIA 1DG6A 1EAH3 1WMFA 3AX4A 1LEMA 5AVPA 5GZDA 1CGPA 4K1ZA 4QGMA 2HWB3 1KXGA 1HXS2 3M3QA 4Z82A 2ZZJA 1Z7S1 1RUF2 1VBB2 1G6NA 2R0HA 3H8UA 5AFEA 2EIGA 1O3SA 3ZXAC 1PO12 2Y0IA 3WZ1A 3N7LA 1W6QB 5K0UC 5C9AA 3SLIA 1SLAA 1HQLA 4H7LA 2BQPA 1YLLA 4QQPA 1QOSA 3OPZA 2R16A 2YPJA 4LLOA 2GN7A 1Z7S2 4J6GA 4EV0A 1DGRA 5DG2A 3IWZA 4COZA 2R6QA 2OZ6A 4IL7A 3LSEA 5EWSA 3AZYA 5JLVA 2ZMLA 2R061 2ZGOA 3R4SA 4LO4B 4SLIA 4AGVA 3M3EA 1TEIA 3WG1A 4QU2A 3WQ1A 2WQZC 2W52A 3MIHA 5IK4A 4XF1A 1MS1A 3ZPYA 2ET1A 1RHI3 1BKZA 4XJ8A 3USUA 1HIXA 4ZU7A 4HSJA 1DLLA 1VBD3 4C0BA 4LA2A 1MZ6A 3WUCA 2GC2A 4ISRA 2PELA 1QY4A 4RR3B 2ZGMA 4Y1UA 5LRSA 4Y1ZA 1O3RA 1JYCA 3I2DA 3RG0A 4YVSB 1QWRA 4XQDA 5JI7A 2BNOA 2QCSB 1PZ7A 5T50A 3ZXDA 1TQ5A 4OHVA 4E4ZA 2VUAA 1V6OA 4DXZA 1VBA2 1CPMA 3KGLA 5DUVA 5CBLA 2HWC1 3H1WA 2VMHA 5EJ3A 2WS93 2NM1A 3UJQA 3WQ0A 1C57A 1FATA 4GQ7A 3ZN4A 3ZFGB 4QXKA 3WW2A 5JVVA 2ARBA 4AI8A 3X29B 3VZOA 2E7TA 1DYKA 2ETEA 3VDDA 1VBA3 4FTEA 4OHYA 4IQPA 4BIOA 4WVMA 3IDEA 1OLQA 5L7OA 4AF9A 5F9TA 5CG9A 1QJX2 4LBMA 5FFOC 3CO2A 2AYHA 4MGYE 2C0ZA 2E53A 2B46X 3EO6A 1EP0A 2Q8OA 3ZX7A 3ACLA 4L11A 4QPIA 4QM9A 2IFWA 2D97A 3M3OA 4HVRA 1H1MA 5FBZA 5H9PA 5DUWA 2WSVA 1F5FA 2FZ2A 4AEDB 2DUOA 1LULA 3HBZA 5HCFA 5FDBA 2GC3A 2AR6A 4HT1T 1RUF3 1X82A 2WL1A 5FO7B 5BNPA 3HMYA 4JRAA 4FOYA 4F3JA 4Q29A 4NHKA 1K5MB 3B01A 3NW4A 4RQPA 4RS5B 4I0BA 2WZR2 3U07A 3VZKA 3ZYPA 4ASMB 5A3LA 4HZFA 1JW6A 3BTAA 4YW2A 4XF3A 3MIGA 1HLCA 2XH6A 4AWDA 2E7QA 2YMZA 1OQEA 4EJRA 4Q4V3 3RMYA 1UU5A 2H6CA 2WLQA 2I45A 2NZ9A 3GZUC 1EV12 4QMAA 1GSLA 4M00A 3WP5A 1O91A 4G3YC 3SH5A 3IDCB 3SCFA 4RD7A 5DDJ3 1J58A 1TME1 3M3IA 5LRRA 2G9FA 3V0BB 3H7JA 4Q0QA 3VBRC 1GLHA 3NAPB 5IK7A 4FQZA 1K5MA 3KGZA 4RS5A 1DQ5A 1LENA 4C0HA 1PGW1 2GAUA 5DDJ2 5JAXA 3V0AB 3WINE 1RUD3 3OTFA 3RS6A 4Z92B 4HK9A 1ZZ7A 2ZBJA 3OY8B 4K21A 5I8YA 1KFXL 4Y1VA 1U5ZA 5GLUA 1MVEA 3AB0A 3ZVXA 1NCQA 1KRIA 1PGL2 3VHOA 5FLJA 3M8LA 5L7OB 4E2GA 3VZJA 4GMP0 4LT5A 1AR63 1H1IA 1COV2 1QNWA 4AW7A 2NN8A 3D6EA 1ND3C 2XLAA 4QT6A 3AZZA 2PHDA 5KXDA 3NAPA 2XBO1 2RJLA 4PBOA 4KL1A 1GKBA 5A32B 3VBOA 1RUJ2 4YARA 4H7MA 2Z69A 3INAA 1LHVA 1WD4A 2DUQA 3GYDA 4CDWA 1ND2A 2V73A 4W6YA 4HETA 1QDOA 3EJKA 4MX3A 1QH7A 3PVOA 5L73A 2R071 1CAXB 1ONAA 2VW1A 4HVOA 4N9IA 2DTWA 4N53C 3LZZA 3AK0A 4OULA 1RUG1 1H8TB 1G9BA 5KHKA 5I93A 1I3HA 3IPVB 4R8HA 2YUEA 4RGGA 4JQRA 1FNYA 1REFA 2A3XA 1EYBA 2RS11 3SITA 4N53B 3CJIC 3QH6A 4XIOA 2C1FA 1NG0A 1SLIA 4A7YA 3PLQA 4MVTA 4MGKE 4CEYB 1D4M2 1S55A 2E9QA 5GZFA 4E4DX 3CEWA 1PVC1 2NMOA 3AKSA 1S2BA 4XFFA 3WW3A 3L2YA 4RGAA 3VKLA 3USUB 1ND3B 2BPA2 1VRH1 3ZFFB 4B4QA 2JICA 1N3QA 1PIV1 4KU8A 4YZ2A 5J37A 3VZLA 4Y1XA 4B7KA 2RE9A 4UW3A 2HWF3 1RUF1 1W39A 1S0IA 5L7OC 1LESA 3KZ4C 4OUMA 5JZGA 5LEKA 1C1FA 1DQ1A 1NCRA 5KHHA 4OI1A 1NA1B 4CDWC 3DN7A 5C9AB 1EV13 4O9EA 3TB0A 2WT1A 4GA9A 4GH4A 2VMGA 2KM2A 4OI0A 1H8VA 5SV5A 2HWD3 1ULDA 3USSA 4AHWA 3NAPC 3O5SA 1HQNA 1JUHA 3VDDB 2QJVA 4ES8A 2XJVA 4NN0A 2WWSA 4NOTA 1KFUL 1DHKB 1RUC3 3N36A 4GH4C 4PJYA 4K9SA 4XTPA 2R073 2PTMA 2R0FA 4HANA 4AHXA 4FSJA 5BV6A 3MIFA 3ZFEA 2HWB2 1RINA 3ZFFA 4D7TA 1CAXA 3OGJA 1YRZA 4AVVA 2BEOA 1C28A 5DZEA 3VBFC 1V70A 4OLLA 2ZGTA 4XTMA 1QU0A 3V64A 2WNVB 1X7NA 3JUUA 3WCSA 1VBE2 3ZXJA 1LOFA 1UPIA 2ZHKA 5A3MA 4IEOA 4YM1A 4CP0A 3ZN6B 1NCQB 4R9DA 1PM7A 3OCPA 4XE9A 2ZJCA 5JSRA 1C3HA 3FC0A 2BWCA 2JG8C 4LE4A 4P9LA 3DPRC 5I91A 2ZX0A 2ZOEB 3CF6E 2QZ2A 1ZZ6A 3LSDA 1TME3 2ZCWA 3WP3A 1WMEA 1H9PA 1I5ZA 2VGDA 3VV1A 1DQ2A 2A7AA 2GC0A 2PYTA 4ITCA 3VN4A 3V65A 1COV3 1GZWB 3AYDA 2JEMA 2OUJA 5ACA3 1RGSA 3BODA 2K0GA 2DF7A 2ZX1A 3MICA 4Q4V1 4LTAA 3ZFGC 4FTBA 2Z79A 2YC0A 2HEVF 1TNRA 3OYWB 3EBRA 3VHRA 1QXRA 3OY8A 2K9ZA 3HT1A 5K0UA 4DB5A 2Y38A 2D6NA 1RUG2 2XJSA 3KM5A 1TMF2 1ZBE2 2D3SA 3BOPA 1RUC1 2X8KA 3AYEA 2VNOA 4IERA 4L9BA 4OI2A 1AYM2 3WVJA 1QQP3 4YZ5A 5BNPB 1HRV2 2FMYA 1SBFA 4AQ6A 1TMF1 1ZBE1 5E1RA 3ZXGA 1O5UA 4OI4A 1FYUA 4URTA 4Q8KA 4XQWA 1EAH2 2F4PA 2FMDA 3L9JT 5E16A 1MACA 4AYUA 5BNNB 3KS7A 4AEKA 1TE1B 1H2KA 4HFSA 1HDKA 1YUDA 2EF6A 1V6KA 2WA4A 5JDBA 2OA2A 1QF3A 3MF9A 3IKWA 4YZ4A 4CTEA 4Q4Y3 2X29A 2XGXA 2UURA 4RL7A 1LOBA 1ZZBA 4Y22B 5CNAA 4YG0A 1N1TA 3ILNA 2CL2A 3ZSKA 2VULA 4CDXA 4U36A 1BXHA 2LALA 4XFHA 2IC1A 3AMPA 4IEUA 1AZDA 3B93A 1W6PA 4I0AA 4QGLA 2H0BA 3B5LB 3VBRA 3ZSMA 4AEDA 1QJY1 3VLBB 4FAGA 1VLNA 3J8F3 4BOWA 3MPPG 4FPHA 1CAWA 1RMU1 2VVEA 4EN6B 1ULEA 5GLTA 4P9JA 3UJOA 2ZKNA 3QCWA 1BMV1 3SXWA 3UKNA 1RUC2 2RHPA 1CR7A 1AUYA 3AP6A 1RUE1 1BBT3 1RUD1 1RVF3 2EXIA 3SCHA 1ALYA 5AC92 4LR4A 4YVWC 4WV8A 3AMNA 2WSUA 3IN9A 4FAHA 4KWKA 5C9AC 4M3CE 5CU1A 4YW1A 3IM0A 3ZYRA 4CDWB 4BM8A 3IBMA 2Q5TA 2XG3A 4XZPA 2QDRA 1CD3G 1GANA 2IWGB 3GNEA 4LULA 1VAVA 4XFGA 1RUD2 4AFCA 4YGDA 1ND2C 4XBNA 3ZFFC 4A7ZA 5JMCA 4IEWA 5BPXA 1S2KA 4N43B 1VBE3 5I0SA 1YI7A 1POV1 4PDWA 4WZFA 3ZYIB 4C91A 4B29A 1YYNA 3J26N 1PMIA 5CADA 2ES3A 2R32A 1YO8A 4P9IA 2CWSA 1W6NA 4E4SA 4LBKA 4HPKA 3RZZA 1LGBA 1LHWA 1FV3A 1OD5A 4Y20A 2JG8A 4JV4A 1XU1A 1FOD1 4DMIA 2XL7A 1MS0A 3D0JA 1PK6C 1QKQA 4BHPA 1J3PA 3RI8A 1JBCA 4XFIA 2JG9C 1AHSA 1XYPA 2RM23 4OFGA 4YZ1A 4FPOB 4J1WA 4NWVA 4YFWA 1PIV2 2K2SA 5AFBA 5BUVA 1FXZA 4OUSA 2PQQA 2BVBA 2A6ZA 4LBQA 4XMAA 4DQAA 1R1ZA 1H2MA 3ZFEC 4ATEA 1S0JA 4IV1A 3E97A 1DFQA 1R091 5TSWA 1SCRA 2JE9A 4YYOA 2WS92 1IGOA 1UX6A 4ATFA 2E51A 1QJY3 4YZ3A 5EFUA 2QNKA 4CEWA 1OKQA 4RHV1 2D5HA 4Q4Y2 3PVBB 4UW4A 3POSA 4M3CF 1D4M3 2PLV3 1HKDA 5ABJC 1WW6A 2IXIA 2CGPA 3KT1A 3ZXKA 1TMF3 1ZBE3 2ILMA 2IXLA 3AZXA 4RFT0 1UKRA 2ZA9A 4Q2FA 4BQ1A 3QBQA 3AXDA 3DV8A 1QHDA 1RJ8A 1T6GC 4K40A 1SLCA 1ASJ1 2PLV2 2RJKA 1AR81 3ZXEA 1AR93 1ZREA 4KGGA 2VPVA 3AYAA 2B39A 3W9AA 4IEQA 4LE3A 1JTZX 2FHRA 3VKFC 4L2NA 3VBRB 1VBD1 2B45X 4BPZA 3R0RA 4TYSA 1FPN3 2DURA 4D94A 3WT3A 3AJYA 3FUQA 3ILRA 5T5OA 3POWA 1FMD1 2TNFA 4PLOA 1COV1 4HSLA 3KCCA 1OSGA 2B8MA 1XNCA 3TNQA 1PO11 4Y20B 3NV1A 1OA4A 1PVXA 1M06G 3T1MA 3GF6A 4HPKB 5C8CB 5C4WA 2I2SA 4CDQA 5C33A 4NHLA 2D6KA 4P14A 2ZHNA 4CEWC 3MFCA 2BVVA 1ZA4A 3ME2A 1R092 4IETA 2PHRA 3WOGA 4XXAA 2YGMA 5K7PA 4C1XA 4JTOA 2WINB 5JOYA 3NV4A 2GNDA 2ZX3A 2JJ6A 3JD71 3WR0A 1NQJA 2UWBA 1RUNA 4UXAA 1JUIA 1AR61 1C8M1 5D8AB 2GH2A 1QMJA 1X36A 4RHV3 1X33A 1RUE2 3B7MA 4XQ4A 4AEDC 3LB9A 3IMNA 4S2GA 4YGBA 3QOPA 1ZZCA 4FPLA 1EPZA 2RMU1 1CJPA 4UW5A 4CYDA 1DYPA 3FMGA 4IV1C 3BU7A 1QJU1 4LEJA 2BYVE 4MV2A 1IS4A 4ISQA 1GYKA 1MVQA 3LAGA 4QHBA