3ZFEC

Human enterovirus 71 in complex with capsid binding inhibitor win51711
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
242
structure length
242
Chain Sequence
GFPTEPKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRDGPWQSTMLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDTSHILQTASIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure of Human Enterovirus 71 in Complex with a Capsid-Binding Inhibitor.
pubmed doi rcsb
total genus 39
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zfeC00
4WM8A 4CEWB 1ND2B 1V9U1 2IZWA 2ZZQA 5C8CC 1D4M2 5J96B 1FMD3 4Q4X1 4PDWC 1RMU2 1E57A 1C8M2 1DDLA 4AEDB 1B35B 1RHI1 4Q4V1 3VBRB 3CJIB 4CDXC 5AC91 1PVC2 1QJX2 2BPA2 1PO23 2R073 4RR3B 3VBUB 2RR11 1HX6A 1NY72 3VBHB 3ZFFB 1VBA2 1AYN3 5J98B 2HWE3 1FMD2 5ABJB 2R062 4RS5B 2RS13 1RUE3 1AYM2 1Z7S3 2PLV3 2RS53 1VBE3 1BEV1 1R081 3IDEA 2HWF1 2X5IB 1HXS3 1PO22 3VBSC 2R072 4Q4W3 4CDWC 1TME3 2HWC3 3DPRA 1NG0A 5K0UB 1RUH2 2MEV2 1AR63 1AYN2 5BNOC 4WM7C 1H8TA 4CEYB 1PIV2 2RS32 1RUE2 3S6PA 1AL22 1Z7S2 2PLV2 4RQPA 1RUG3 1VBE2 1NA1C 4GMP0 5FOJB 4CDWA 4Q4Y3 3VBFB 1RUI2 4YVSC 5BNNC 1QJY3 1K5MC 1W39A 1AR83 3JBG2 4WM7A 3ZFGC 4JGYB 3J8F2 2HWC2 2FZ1A 3ZFEA 1RUJ3 1QJU3 1BBT3 2HWB3 4RHV3 1OHFA 1VBB3 1R1A3 4GB33 4IV1C 2R071 1MQTB 1VAKA 2TBVA 4GH4A 1K5MA 1VRH3 3VBOC 1GFF2 2BUKA 5BNPA 1VBC2 1AYN1 2HWE1 5CFCC 1D4M3 1NCQB 3VDDC 1POV0 1AUYA 2RS11 4IV3C 2QQPA 1RUE1 2PLV1 2RS51 1RMU3 1RB8G 1AR82 1VBE1 1OPOA 1C8M3 4GMP3 4JGZC 4YVWA 1RUJ2 4CDQA 1QJU2 5A33A 1HXS1 4RHV2 1M06G 1VBB2 4AEDC 4CDUA 1PVC3 1QJX3 4GB32 4Q4W1 3VDDA 1TME1 4IV3A 1AR72 4N53C 2HWC1 5C4WA 3CJIC 1NOVA 4QPGC 1NCRA 1ASJ2 2BBVA 1AR61 1VBA3 5D8AA 4Y5Z0 1MEC3 4QPIC 2R063 2VQ0A 1R092 4RR3C 3VBUC 3TN93 5A32B 1AYM3 3VBHC 1RUG1 2WWSA 3ZFFC 5ABJC 4BCUA 4RS5C 4Q4Y1 2R041 1POV3 3NAPA 4QPGA 1QJY1 1RUD3 1FPN2 3ZXAC 5C8CA 1AR81 4QPIA 1ND3C 4WM8B 2X5IC 5D8AB 1TMF3 4PDWA 1RUJ1 1QJU1 1RUH3 1BBT1 4FSJA 2HWB1 2MEV3 1HRI3 1PGW2 1VBB1 2WZR1 1MEC2 1R1A1 1FOD3 4GB31 1PIV3 3TN92 2RS33 5K0UC 1AL23 4CDXA 1VRH1 2RMU3 1PO12 5L7OC 1AR92 1ZBA2 1D4M1 2GH8A 1RUI3 1RUD2 1EV12 4PDWB 1RMU1 2DF7A 2WS93 1RUF2 3VBFC 3HAGA 1C8M1 3JBG3 4GMP1 4N43C 1TMF2 3J8F3 1PGL2 1HRI2 4CDXB 1PVC1 1QJX1 4JGYC 1FOD2 4FTSA 1QQP3 2ZAHA 5CFDC 2RMU2 3VBSA 1NY71 1VB4A 1VBA1 4N43A 1MQTC 1VBC3 5JZGC 2ZTNA 1MEC1 1FMD1 2R061 1COV3 5ACA3 1HQNA 3TN91 1OOPC 1AYM1 2WS92 3DPRB 5BNOA 1RUC2 3JD73 5FMOS 4Y4YA 1WCDJ 5CFDA 1H8TB 1POV1 1SMVA 3JB4C 1NA1A 5DDJ2 1RUD1 4RQPB 1PO21 1QQP2 4YVSA 4CDWB 1AR73 1TMF1 5BNNA 1PGL1 1RUH1 1VBD3 2MEV1 1ASJ3 1IHMA 3ZFGA 5C9AC 1FOD1 1COV2 4WM7B 5ACA2 1A6CA 1R093 1PIV1 2RS31 1AL21 1Z7S1 3ZFEB 2RMU1 4CEWC 1ND2C 3JD72 4IV1A 1F2NA 2GSYA 4Q4X2 1RUI1 1HRV3 3VBOA 4GH4B 5BNNB 1K5MB 2WS91 1FPN3 1B35C 4Z92B 5C9AA 1R083 5CFCA 2HWF3 3JBG1 1RHI2 4Q4V2 5GKAC 5BNPB 2FZ2A 3J8F1 3VBRC 1VBD2 4CEWA 1ND2A 4WM8C 1EAH3 4JGZA 1QQP1 4YVWB 4AEDA 4CDQB 1B35A 5A33B 1PO13 3VBOB 3FBMA 1AR93 4N53A 1VBC1 1ZBA3 4CDUB 2WFF3 3VBRA 1COV1 3CJIA 3VDDB 1HRV2 5ACA1 2RM23 4IV3B 5C4WB 1BEV2 1EV13 1R082 1NCRB 1RUF3 2HWF2 3JD71 4RR3A 3VBUA 1ZBE3 4JGZB 3VBHA 3ZFFA 4RHV1 5ABJA 1EAH2 4RS5A 1AR71 2HWD3 4N53B 1BMV2 1VBD1 3NAPB 5LK7B 4QPGB 1ASJ1 1AL0G 1ND3A 1RVF3 2X5IA 5FMOL 4CEYC 2WFF2 5C8CB 4QPIB 2RM22 1R091 1RUC3 3JB8A 1ZBE2 5K0UA 2BFUS 1HRV1 5DDJ3 3DPRC 5L7OA 1VB2A 1FPN1 2Y26A 4RFT0 4CEYA 1H8TC 1ND3B 2HWD2 2XPJA 4RQPC 3VBFA 1RVF2 1PGW1 1EAH1 4NWVA 3LOBA 2XBO3 1BMV1 4JGYA 1PO11 1V9U3 5L7OB 1NCQC 2HWE2 1CD3G 1AR91 4LLFA 1ZBA1 2RS12 2WFF1 4Q4X3 3ZFEC 2RM21 2RS52 1EV11 1MQTA 5JZGA 1RUF1 3VBSB 1RHI3 4Q4V3 2R043 4N43B 1ZBE1 1HXS2 1OOPA 4GH4C 5AC93 1HRI1 1NCQA 4Q4W2 1TME2 5BNOB 5BNPC 4NWWA 2XBO2 4FTBA 2HWD1 1X36A 1C8NA 2RR13 5CFDB 3M8LA 1V9U2 1AR62 1NA1B 2WZR3 1RVF1 1CJDA 5JZGB 1X33A 4YVWC 4YVSB 1RUG2 4CDQC 1BEV3 1OOPB 1F8VA 4Q4Y2 1RUC1 4CDUC 2R042 4SBVA 3ZFGB 4FTEA 1QJY2 5C4WC 5AC92 5DDJ1 1QJZA 1NCRC 5D8AC 4IV1B 5A32A 2RR12 1BBT2 2HWB2 2WZR2 1R1A2 2WLPA 4EJRA 5C9AB 5CFCB 2BFUL 2XBO1 1VRH2 3NAPC
chains in the Genus database with same CATH superfamily
3FFQA 5FPZA 2QDRA 2IZWA 1NUKA 4R4ZA 1OA4A 2V5YA 4NIAA 2B8MA 3I3DA 1JZ3A 4K21A 3PIGA 3RJRA 5FYBA 2E31A 2BV4A 3U4XA 4XXPA 1P8JA 1RMU2 2B42B 3CDZB 3ZSEA 1E57A 1Q8QA 3SMHA 4CYDA 2DU1A 4LBOA 1B35B 2NQYA 2LTNA 3VDCA 4AE2A 4Q4V1 1W6QB 2ORXA 1MR5A 1QH6A 4MXWA 3VBRB 3IDBB 4CP0A 1VP6A 2YGMA 2ZPXA 3ZN4A 3GZEA 2V4AA 2BPA2 4DNYA 1PO23 2JKBA 3PL0A 1GMMA 3JZVA 1Q8PA 2R073 4QM9A 3ZYGA 2EICA 3BOPA 1MS8A 4FFFA 4ISRA 3OUJA 3WUDA 1CN1A 3UL2A 1MACA 2NN8A 2RR11 4EWDA 5DQ0A 1NY72 3MIGA 2XJUA 4UFHA 2GNMA 2WT1A 3MV11 5ISLA 3ZFFB 1VBA2 2R1BA 1XRUA 2J7MA 1GWLA 2ZMNA 4OMCA 2TEPA 5E88A 2R062 1UY3A 3NV2A 4RS5B 3D82A 4GWNA 5F32A 1JZ6A 2ZGUA 1JYXA 1UIKA 4U36A 2GN3A 2RS53 4JKLA 2WIIB 1BEV1 1UPIA 5LRRA 3VHOA 4B4PA 3WF3A 5A6XA 1C28A 2SLIA 2VQAA 4RA0A 1O3TA 2X5IB 4IUGA 4EWAA 3W5NA 4YM0A 1W99A 5FMCA 4CA9A 3UKNA 3MW2A 3IDCB 1QOSA 2YFZA 3POIA 1MS9A 3ZYIB 4BJ0A 4BIFA 4CDWC 3B02A 1DYPA 4A2UA 1OURA 1UYZA 3NRUA 5K0UB 1RUH2 2FQPA 1VPHA 3N9QA 3NJZA 2VZRA 2MEV2 1KS5A 1SPPA 3WP5A 3AKSA 5JMCA 4D6QA 2YPDA 1AYN2 1DGRN 2PXJA 2FD8A 4WZFA 4WM7C 5IK7A 1H8TA 1DZRA 1U5IA 2J1EA 3CQOA 2JDZA 1OH3A 4AEJA 5FJHA 3S6PA 4E4HA 2N7GA 2GNTA 1YQ6A 2JEMA 2CAUA 3OSDA 1VBE2 4YGBA 5FZEA 4GMP0 4AQTA 4KI5M 1SFNA 1QDOA 4C90A 3I2JA 4DY5A 3VBFB 5C5TA 2G9ZA 3RS6A 4W4ZA 1RUI2 4Y24A 2ZGQA 5C3OA 2OUJA 3HWJA 2W0XA 5BNNC 1MZFA 2ZGSA 5AVAA 5FYHA 2VCCA 5FZDA 4OI0A 3JBG2 2GZWA 2ZEZA 3QH6A 4S2HA 4JGYB 5CU1A 5FY4A 5LA9A 3ST7A 2HWC2 4FFHA 4LITA 3NJXA 4AFDA 3WW2A 1XQNA 3E5XA 1QJU3 1BBT3 2Q0AA 2L9LA 2ZX0A 3AZXA 3KQRA 3UNPA 4LBNA 1R1A3 1E5HA 2WINB 4IV1C 5HXMA 3H8XA 2WC2A 1VAKA 3ACLA 5BUVA 2WNUB 1K5MA 2DBNA 1VRH3 2JE7A 4SLIA 4JX0A 2H6CA 3WQBA 4C0HA 2BUKA 1W2UA 5A7QA 3MUY1 3RYPA 5BNPA 2EIBA 1VBC2 3O5SA 1Z0HA 4H7MA 1US3A 2HWE1 4IEWA 1D4M3 1ZX5A 5FXVA 1POV0 2YV8A 1J1LA 3VDDC 2RS11 5FIXA 4CU6A 1U12A 1K3IA 3NL1A 2YYOA 1RUE1 4GJYA 4V1PA 1NLSA 1UPSA 2ZX4A 4JC1A 2Z69A 1Y9MA 3H1WA 3KCCA 3NKGA 4PQ9A 1CVNA 2AREA 4YVWA 2KD7A 3VKMA 4BM8A 3KS7A 1DU3D 4QB6A 5JCTA 2QQWA 1MZEA 2UY9A 2A75A 3ZYJB 4AVCA 4P9YA 3CL1A 3IAQA 4UBGA 1QJX3 1UYPA 2R7EB 3MFAA 4GB32 4Q27A 4Q4W1 3RZZA 4BYYA 4M3CB 1H30A 5I91A 1AR72 3ZLIA 3OGGA 2QVSB 1ULOA 3RI8A 3OYWA 1WMDA 4LOTA 4QD2A 3WP3A 3GM8A 3CJIC 2YU2A 2ARCA 4QPGC 5JXHA 2ZGNA 2R0FA 1LENA 3JQWA 3WF1A 1ACCA 3ZXFA 5D8AA 3WX5A 4LE3A 4IQPA 1XC6A 1UL9A 3PVOA 4RR3C 1LHVA 1N3PA 2XQXA 3GHNA 5J36A 3VBHC 3E5UA 2B45X 3DV8A 3HBKA 3CHXA 4LE4A 3WF0A 3CZJA 4K3UA 4BCUA 2FZ2A 1UOJA 1SZBA 3BALA 3POJA 5FXXA 3N9LA 4N90A 4MO3M 3V0AA 3NAPA 2R49A 5FDBA 1QGLA 3WF2A 5FPAA 1FPN2 5ANQA 4DXTA 1XNTA 1AR81 1WBLA 4FOYA 4HXCA 4L97A 5A6ZA 2A3XA 1ND3C 3AZYA 4MGYE 2YROA 4QPIA 4XJ8A 2WA4A 5FZ8A 2WZPP 2E53A 1TMF3 3WNLA 3QD6A 2A6YA 4PDWA 2WJSA 3PUAA 1RUJ1 3RJ2X 3U75A 1J3QA 3U0ZA 3T30A 1TQ5A 1O3RA 2HBTA 4A45A 1ULDA 2UU8A 1HRI3 2JD4A 3LDRA 2RDRA 1MEC2 4HSLA 1H6YA 1UNBA 1UX7A 3MZHA 2G1MA 5C3PA 2RS33 5A70A 3I7DA 4QQOA 1TG7A 4YFZA 1CIYA 4DEQA 2KR2A 4AI0A 1NYWA 1ZBA2 4QXHA 2JD9A 3MV01 2P3JA 1IPKA 2HJIA 4A4AA 3WDTA 2D6KA 4NE9A 4XF3A 2R1DA 1F5FA 1RMU1 1URXA 2WS93 3WNMA 4Z8BA 1CGPA 3L2YA 1RUF2 5FWEA 1HJFA 2DYCA 1QH7A 2W9XA 1NQDA 3ITQA 3PNAA 4DS0A 3IBMA 1V0AA 1ZRFA 3FHIB 3WUCA 1S0EA 1J84A 2GP3A 4B4QA 2TUNA 3C7OA 4XBLA 1IPSA 3DXUA 4NN0A 1GQHA 2ZEYA 4NO4A 3ZYPA 4LIUA 1FOD2 4Q2FA 4URAA 1UY4A 2ARAA 3AKTA 3HQXA 2ZAHA 3VD4A 1LKNA 1YJKA 1CESA 3BGAA 3DEMA 3MIBA 5FQ0A 3AL6A 3HD8B 2OZJA 1NY71 2PQQA 3MDPA 2VMIA 1VB4A 1MVQA 3VBSA 5FLIA 4EYUA 1VBA1 2VMFA 2JENA 5JZGC 1PGSA 2ZTNA 3ZR6A 2MHFA 2R061 1COV3 5EZWA 1E5SA 4LO5B 4FBFA 3TN91 3ZDSA 1OKOA 3P6BA 1K5JA 4IGQA 2LALA 3JD73 4Q0VA 4DEVA 1WCDJ 5DN2A 3HR9A 5EYYA 5SV5A 3VDAA 4NIGA 4UF0A 5FV3A 3LE0A 5CFDA 2ZGKA 1YIPA 3T3YA 3ORJA 3QOPA 1CONA 2GN7A 4CCLA 5E8AA 4XF0A 4KG8A 2P17A 3MIDA 1QQP2 3KVBA 4M0HA 1Q8OA 1XE0A 4YVSA 4CDWB 3E97A 3WINE 2DCTA 1L7LA 4PI2A 2QQVA 1MVEA 1RUH1 1VBD3 2YBPA 2MEV1 1ASJ3 3ZFGA 2WQZC 4GQ7A 2RG4A 4D6RA 2BNNA 2V09A 4QKBA 1GU3A 4WM7B 1W8OA 4EZ4A 5ACA2 1IZ3A 1R093 2IVJA 3H1YA 4FP3A 4Q0QA 2BZDA 3ZFEB 4AQ2A 1GBGA 4IGOA 2RE9A 4QQLA 4UWDA 1F2NA 3WQ1A 5CG8A 2VZ3A 1RUI1 3EHKA 5FZKA 2WAOA 3M3IA 1DIWA 3DKQA 4HKWA 5BNNB 2HLEA 4AG4A 2A6VA 1W06A 2HWF3 3JBG1 3ENRA 3O0VA 1RC6A 4QX2A 5FZMA 4AF9A 1V6KA 1W6NA 1CAUA 2VXJA 3B00A 3BODA 2E26A 3Q8BA 3RPQA 3T2TA 1GOGA 1DF0A 2QNKA 1SCRA 4P5HA 5APAA 1YWKA 2C0ZA 1YQCA 2JECA 2WKKA 4WM8C 2G4IA 4MGKE 3ZYRA 4AHYA 1OH4A 2B46X 1PZ7A 1ULFA 1NXD1 2PTMA 2DVGA 4UBHA 2A7AA 2DVFA 4QPWA 1V6NA 4CCMA 3WR0A 3DECA 2IXCA 1KFXL 1B35A 1GV9A 4LULA 3BKZA 4JTOA 1W6QA 4QKNA 1ZZ9A 2VVFA 1VBC1 1WW5A 3KSCA 4PIZA 3VBRA 4XTPA 3VDDB 4A7ZA 1UOGA 2DVAA 2CSGA 2VQUA 4MYEA 1JOJA 3IB3A 3J26N 3LWCA 4AI8A 5F37A 5C4WB 3BTXA 1EV13 2AC1A 1SG3A 1GQPA 2IVIB 2JXAA 3K3NA 3OY8B 3RWNA 1R082 3G7DA 3ES1A 3RZHA 1KDMA 1US2A 5IK8A 1LGNA 2AYHA 2JDYA 3ZFFA 1LODA 1OQEA 2PHFA 3LSDA 4RS5A 5H9SA 2IXJA 2VUCA 3HNYM 4QX7A 2Y38A 2W1SA 3BCWA 5FOBB 2XL7A 1AR71 3NSTA 4UFMA 1YI9A 2BOIA 4XHXA 1HN0A 1GKBA 3QACA 1S2KA 2GNBA 3RFRA 5LK7B 4QPGB 2D5FA 2VZTA 4R9AA 4XEZA 3ZYBA 2X5IA 2PYTA 3D0JA 2WFF2 1WW6A 5C8CB 3T08A 4MHUA 3TEWA 2UYBA 4P02B 5IT6A 2JG8C 2VBBA 1PM7A 5FYUA 1DFQA 1G9FA 1ZZ6A 3I2KA 4QXBA 5IWFA 3UETA 3H0OA 3E6CC 1GP6A 1WCQA 4LNVA 5J3UA 5JPNB 1ZBE2 5K0UA 5FCCA 4X8PA 2QTWB 3FLPA 4BXSV 1A78A 1UZ0A 2D6MA 1Z78A 2IXIA 3Q9OA 2D7FA 4YGCA 1LECA 3I97A 4FAHA 1VB2A 4N8MA 1REEA 1FPN1 2JDHA 1UU5A 4K6BA 1DCSA 1ND3B 2XPJA 2OYZA 4N9IA 4YG6A 3HN3A 3VZMA 4RQPC 3C7GA 3I4IA 3VBFA 5HCFA 2P6CA 1RVF2 4OVEA 3WLUA 3ZN6B 2JX9A 2QZ3A 3CNAA 2D98A 3LF7A 4NWVA 1WLCA 2VZ1A 3D5OA 2XBO3 2PHRA 1SFYA 2DBIA 3TNPB 3O1RA 3USUB 4GKYA 3VLBB 1NE4A 5T3NA 1QHDA 4JGYA 1BMV1 2PHTA 1FYUA 4PLNA 3ZXEA 1A8MA 2XKPA 1CD3G 5DAXA 1QNYA 1UZVA 1ZBA1 4FPEA 3ZIWA 3ZMNA 5T50A 3THDA 2BDRA 4Q4X3 3W5MA 2A6ZA 2RS52 5A6QA 5KXDA 4FPHA 3K77A 4IW3A 3BIWE 3MICA 1RUF1 2WO1A 2WNUA 2Z4FA 2X05A 1YXWA 3USSA 2WZEA 2HYXA 5LASA 2AUYA 2DTYA 4Q1RA 4LHNA 2J1SA 3FHAA 4GH4C 3BI3A 2FDJA 4LBQB 4WV8A 4S2DA 2PAEA 3BPZA 1HQWA 2I07B 2Q8CA 5BNOB 4NUBA 4YZ3A 5KWRA 3GF6A 4LJHA 2ZBJA 4QDSA 4ZHNA 2Q8DA 4QPYA 3AC0A 3I8TA 1UW8A 3O7OA 3VGIA 3RZGA 2OS2A 4BQ4A 4DUWA 2P1BA 1NA1B 3LSEA 5CKQA 2OKXA 3IPVB 4O7XA 4A42A 1W9TA 1GICA 2QE3A 3B7MA 4AFMA 5JZGB 2BYVE 3A7QA 4FQ4A 1W8TA 3FC0A 5FUNA 3K46A 4CDQC 2HBUA 2XG3A 5I0TA 1AX1A 2W91A 2BVBA 3LQCA 1FV3A 5I0DA 2RV9A 3BU7A 1NLQA 3K3OA 4M3CA 4E27A 4CDUC 1LOGA 1G7YA 3AP9A 2D6NA 2R042 2VY0A 2W3JA 3W59A 2YGLA 3B3QE 2FDIA 4OZOA 1LOFA 1ZZBA 1LGCA 2YC2A 1MPXA 4XDOA 1UCXA 3HNBM 3EBRA 3GXUA 2DFCA 2ZXQA 4AHWA 2VMDA 4HETA 1OVSA 4RSUA 1K45A 2ZX3A 1E5RA 2WSVA 2W5FA 1SLCA 1HKDA 2JE8A 3WW4A 2RR12 3RYRA 2WABA 4I30A 1CQ9A 1BBT2 3GZUC 1GNHA 4NPLA 5FY1A 2WZR2 1R1A2 2WLPA 4DOUA 4GZ9A 1KXGA 3NNGA 3OJBA 3RMXA 1JYIA 3FUOA 4BPZA 3MO4A 4M0NA 3LFIA 1I1EA 4ATFA 1VRH2 3RDIA 3SITA 2QUOA 3DCQA 3ZSLA 2YMZA 4COUA 3FFZA 4XTMA 5HI0A 4OYUA 4CCDA 2XLFA 1DQ4A 3NNJA 5CKNA 4MSVA 1D4M2 3K4ZA 3VUOA 1FMD3 3IIIA 2EA7A 4XILA 3S0MA 2JDKA 1KJRA 4AHXA 3PUSA 4DY3A 1XYOA 3H3LA 1UMIA 1DDLA 3LOIA 2VL4A 2CDPA 3IT8A 5EHDA 5GZFA 1LNSA 1A8DA 3DYOA 3T1LA 2AEZA 4XE9A 1OFSA 4AVAA 4CDXC 4IEXA 5AC91 5FKBA 1QJX2 3H7YA 2Y6HA 1UD1A 4Y1VA 4XABA 1W8ZA 5GZEA 1WLDA 4LXLA 4ZY9A 3V0BB 4JZRA 2H6BA 2VCMA 3TEXA 3HT1A 3GCWA 1PMIA 1WUVA 4Y20B 4KBBA 4ASLA 3PTRB 5I0RA 1OT5A 5IVJA 2Y6GA 3PUIA 2OUHA 3OBTA 3OEBA 2D44A 2ZMLA 1WA4A 4CCKA 2EXKA 1N1YA 2P5BA 1Z7S3 2PLV3 5B4XA 4AQ6A 4YFWA 5T5JA 5LWBA 1WW4A 2XB6C 1R081 5LY1A 1LESA 3MI8A 4Y33A 3KT1A 4DXZA 3K75B 2YHJA 4BISA 4XACA 1HXS3 3LZZA 1BZWA 1DGRA 1MS0A 1KD7A 3D3AA 3I49A 3MGUA 1O4TA 2JJ6A 1S0GA 2ZEWA 3KCYA 2H0BA 3MPPG 2D6OX 2ENRA 1HLCA 2Y0IA 1DGWX 4ZU4A 4AL9A 5A3WA 3OB8A 3IN9A 4NHXA 2BWCA 3MW4A 3NJYA 4NROA 3KQ4B 3CZUA 1XBFA 2ZABA 1AR63 3N9MA 4XF1A 4A6SA 2WRAA 1A34A 4QQHA 4YGEA 1VMFA 4C8DA 4CUCA 1YUDA 2RS32 1RUE2 5A6YA 5KC6A 4FQZA 2VCAA 1RUG3 4R9BA 3AL5A 1SFPA 3O14A 5FTTC 3SH4A 2VTXA 5FYVA 3WY6A 1LEMA 3WW1A 2JG8B 2ZKNA 4XYXA 4QX5A 3T2PA 4CDWA 5EV7A 1C5IA 4D8MA 5FOJB 3AZWA 1O6UA 1JU3A 3K4AA 3AKQA 3LEKA 5JPMB 2D97A 5CNAA 4FOWA 2ATFA 2W39A 3S5AA 3R05A 2WNVC 3GJBA 1OUSA 4WM7A 2ARBA 2PHXA 1BJQA 1GQGA 1H1IA 4X6QB 3ZFEA 3H9AA 3TEZA 2P3KA 3RQ0A 2W46A 4RHV3 1GNYA 3P3NA 2ZKLA 4M4RA 1VBB3 4KMQA 4HONA 4UXAA 3O1OA 5DUUA 1MS4A 2R071 3B01A 4XPVA 5CAZA 2XGXA 4AVBA 1I3HA 3D8CA 3ZN5A 1X7NA 4FXKB 4QU2A 2WT0A 4A7YA 1EUUA 4ZS3A 3VBOC 5FP4A 1YCIA 5IVVA 1O59A 1O8PA 4AEKA 3N35A 1ZRIA 2ZGOA 4IV3C 4Y4RA 5FK8A 4IEVA 2A3YA 2VUJA 2RS51 3OG2A 4FPJA 1AR82 4EN9B 2VBDA 3U78A 4O9GA 2XXZA 4HPKB 1JHNA 1RUJ2 4I2OA 4AQSA 4AZZA 2JIJA 1DQ0A 1H6XA 4LHKA 5BXXA 4AEDC 4D0QA 1JOBA 2B39A 3UJQA 2A70A 1VLNA 1IQDC 1CAWB 2VGDA 2VXRA 5ANNA 4HKLA 4N53C 4OQ9A 3VDDA 3M3OA 4BQXA 2EIDA 2JIGA 4MHRA 4GA9A 4PCRA 5C4WA 4F8AA 1QF3A 3D0SA 3OY8A 1ASJ2 3N4MA 2VTFA 2QQLA 2AENA 4GWJA 4Y5Z0 1NX9A 1OPMA 4B4RA 3AYEA 4MGTA 1ENXA 1R092 2DCYA 2GP5A 5A7WB 3VBUC 3PU3A 3MIEA 1AYM3 5KXCA 5FPUA 3HN1A 3GZTB 3VKNA 2VOXA 5LBFA 4JRLA 2E9QA 5ABJC 1G9AA 2P6HA 2DDUA 4LORA 2R041 3FZ3A 4JQRA 4LO7A 4OULA 1PX4A 2BP6A 4QPGA 2VBPA 1RUD3 4AFBA 3ZXAC 2ZX1A 5C8CA 2EF6A 1XPWA 1PNFA 2JWPA 1PX3A 2F4LA 4TWTA 3K51A 4E8CA 4Z2WA 1M4WA 4R9DA 4S2FA 3B93A 3WF4A 1QJU1 1BBT1 4NPRA 3RRDA 2TNFA 5F5AA 1FI2A 1GR3A 3OGSA 3RMYA 3VKOA 2WZR1 2JE9A 2ZAAA 1R1A1 5F7UA 4DQAA 5C70A 3OEAA 5FMDA 5L9RA 3TN92 3ILFA 2GALA 4IEPA 4XIKA 2EAAA 1VRH1 2RMU3 3JU9A 5EFUA 1KEXA 2QBXA 5L7OC 3IMMA 2F6BA 3DN7A 4JDMA 1D4M1 4MGQA 1XU2A 3PVEA 2GH8A 5H9QA 2G9GA 5F3CA 1AJKA 1GYKA 1EV12 5I0UA 4D6SA 2DF7A 2YY1A 3ZN6A 4Y22B 4Z82A 5C3RA 1XSQA 3HAGA 1TNRA 3ASIA 4N43C 2AH2A 2ZX2A 3J8F3 5I8TA 3F2ZA 3USUA 4LBQD 3VL8A 4AGRA 3H50A 4AFCA 4NOTA 4OQ8A 1AF9A 2LRPA 4JHTA 4HLTA 4CDXB 4I09A 1QJX1 1Q5OA 2YDEA 2PHWA 2J1RA 5CBLA 1JH5A 4BE3A 4G3YC 5CKMA 1OD3A 4LBKA 1H4HA 4NJ4A 2XLGA 5A3MA 4GWMA 2PAMA 1XSRA 3ES4A 1I6XA 5D21A 2R16A 2W52A 1RJ7A 4A3XA 3GYDA 1MQTC 4GULA 3SLIA 2VCBA 4XF4A 4LBQA 5EJZB 4P9LA 5FWJA 3VL9A 2DFBA 2X53S 4O61A 2K2SA 1L3JA 2UWCA 3DPRB 3SCGA 4PLOA 2ADEA 2H0VA 5BNOA 3TNQA 5HCHA 5FMOS 4Y4YA 5G04L 4YW1A 1SBFA 3NV1A 1L7RA 1CAVB 3U37A 4E4DX 1SMVA 3T0BA 3VHNA 1NA1A 3WG1A 2WLQA 2PHDA 1L7QA 3IPVA 4O9EA 4L0PA 2BNMA 1NE6A 3WNNA 1SLIA 1TMF1 4LTAA 3TYJA 4AGVA 1OLME 5J09A 2YXSA 2E7AA 3U07A 5FO7B 2W1UA 4N7IA 3LCPA 1LRHA 1XYPA 3PTYA 5L9VA 5FMBA 5DZGA 2R6QA 5C9AC 2JDMA 5CISA 1I9RA 1WCSA 1A6CA 4YM1A 2RS31 3EJKA 5KHJA 2FDGA 4QGNA 5A3TA 5F3IA 4KU8A 1ND2C 1K12A 5D2AA 1UZWA 1JUHA 1YRZA 4M4PA 1SDWA 4L2NA 3IDAA 4CXYA 1UY1A 3B94A 4KWLA 1JXNA 2GSYA 4Q4X2 2E33A 3KV5A 3BN6A 3POWA 4XFIA 1HRV3 1WKYA 1LHWA 1KS4A 2IFWA 4IXLA 1OVPA 2WS91 2WNVB 5FZ6A 1W0NA 5BY5A 1W2TA 4EN6B 4MGSA 4YLZA 1DGWA 1XXNA 5CEHA 3UT0A 2ES3A 2VH9A 1UO9A 3E6DA 2GC2A 1W6MB 1EAH3 1ENQA 3PVNA 4UYBA 3VD5A 4JGZA 4DUVA 1W6OA 3ZX7A 2RDQA 4EWEA 1NAEA 4LA2A 3AP5A 2QCSB 2Q1ZB 1Q8SA 1W8HA 1ULPA 2JDAA 5DAVA 4G9SB 3A0NA 4OHZA 2OIIA 3ETPA 1YFXA 4Q29A 2WDBA 3MF9A 4IERA 4RYDA 3VBOB 1AR93 4XFFA 2XL9A 3HEIA 1GWMA 5DAPA 1COV1 3C7EA 3OGVA 4NRPA 2B4KA 4OI2A 4AOCA 1HB4A 5FBZA 2RM23 4IV3B 4XQWA 4FP2A 1EPZA 2EIGA 4ORFA 3UGFA 3ZYFA 3FJSA 3MIFA 3R4DB 4GKXA 4OHXA 1NCRB 3JD71 4HN1A 4W50A 4CCOA 3V0BA 5FZCA 4Y20A 5LZ6A 1JHJA 4BK4A 4C0BA 1JZ8A 1FNZA 3I2GA 4HK8A 2DV9A 5SV8A 4P00B 5KHHA 3OUIA 3V56A 2BU9A 3LPGA 1WBFA 3SH5A 5A3UA 5DPNA 3O1SA 4COZA 4YG3A 2HWD3 4N53B 2ZS6B 1S0BA 2FMDA 1C57A 2AACA 4FCAA 4HVQA 1BMV2 3RGBA 1VBD1 5A1LA 4H2AA 1YNAA 1ASJ1 1W6PB 3KF3A 3ON7A 4LBLA 5C6CA 2C26A 2W68A 3AMMA 3KCXA 5T5PA 1WD4A 2Z42A 3VD3A 3DYPA 5JWPA 5F5IA 1R091 4IEUA 3LPFA 2PFWA 4J25A 2OZ6A 4LPLA 4BWOA 4CVUA 1RUC3 3GGLA 3UJOA 2R0HA 3C7HA 4H3WA 3WSOA 4YW2A 1GWKA 5EYXA 1O8SA 2BJSA 2JDUA 4P9IA 4BDVB 3I3BA 4ZONA 4F83A 2Q4SA 4YARA 2FDFA 3THCA 4ET7A 3AXDA 1PK6C 4YM2A 4YW5A 4YYOA 4CCJA 1H8TC 2D3PA 4BQYA 3MW3A 2QQOA 4DXRA 1S2EA 3W21A 4ES8A 3W58A 4P5YA 2X29A 1N1TA 3C2UA 2QZ2A 4CCNA 5FRAA 3EYPA 5H9PA 3WQ7A 3UGHA 2VD7A 1YLLA 2JG9A 2UWAA 3WD5A 2VAUA 1F9KA 4KGQA 3LD8A 3A22A 4DO0A 2LS6A 4LKDA 4DINB 1V9U3 2DUPA 1NT0A 1QXRA 1NCQC 5LB6A 3WCSA 5L7OB 1J3PA 1CAXB 1Y3TA 2PA7A 3D4KA 4QHBA 2VMEA 4H14A 1IS5A 2YPJA 2QJVA 1JYVA 1NQJA 1EV11 1WMXA 1YJLA 5FPLA 4CCCA 1JZ2A 1U5YA 1TVGA 1RHI3 1KRIA 3NQHA 1CZVA 4XJAA 1UZYA 4N43B 5LA2A 5C8WA 1HXS2 1OOPA 3K48A 5IATA 4AAPA 5LK5A 3GCXA 2BGOA 5A1AA 4ZU5A 3WDUA 3SC7X 3PMSA 2J42A 5DAWA 5BNPC 3DXTA 2FDHA 4TSVA 4A3ZA 2VUAA 4BMEA 1GZWA 5FY8A 4FTBA 4LR4A 4TZDA 3H3UA 1C8NA 2O8OA 2VZVA 3I2IA 2W87A 2DUQA 5A80A 2YC0A 3M8LA 2Q8EA 2BW8A 1AR62 4QHZA 5F1RA 3AP6A 4HPKA 2VJXA 4AVTA 3I59B 1RXFA 2P37A 4RL7A 4TYSA 4CU8A 3N7MA 5JOYA 4J1XA 1GOHA 4YVWC 4COWA 1U5XA 1IPJA 1RUG2 2DCJA 1YFYA 2IWGB 2XVLA 2WFPA 5CADA 2GAUA 3NNMA 1F31A 4EV0A 2XJVA 1PMJX 1H8VA 4SBVA 1UQXA 2XUEA 4DIQA 1FNYA 1UXZA 4ZXEA 3OF1A 3UESA 2VNRA 3UKVA 2YG0A 1DQ6A 5FPXA 1UAIA 3WVJA 5FYSA 4TXWA 4ISQA 1QJZA 1W8NA 5F3GA 5AC92 4QQPA 4UW3A 4NPMA 1Q8VA 4BIOA 5FUPA 3BB6A 5A7WA 2WR9A 4W8JA 5D8AC 4IV1B 1JZ5A 3O1VA 4KWUA 4URTA 3KWVA 5FPBA 3KVAA 1W9SA 1J58A 4Q8KA 1NZIA 2X8KA 4P9WA 4UW4A 1X9PA 4MX3A 4ARYA 2JDPA 2ZOEB 1ONAA 5C9AB 4S2GA 5CFCB 1W90A 4ATEA 3ETQA 3E1F1 4XFBA 2XBO1 1Q43A 2R32A 4AR2A 4RGGA 1REDA 2BOJA 3NAPC 4ARXA 1R64A 4ZZ5A 5FYIA 3AYDA 4YW3A 1ND2B 3NJVA 4NRQA 3T0DA 4LUMA 5J96B 3LA3A 2K9ZA 3RSJA 3WG2A 4Q4X1 4PDWC 3KV6A 1DGLA 3FE5A 3SCHA 1O5UA 4PBOA 1OUXA 3SKJE 5HXVA 1F15A 3AYCA 3ZXLA 1RJ8A 2D3SA 4QGMA 4OMDA 3KHCA 2WNEA 3U14A 4BQWA 4CP1A 4IETA 4JRAA 5TSWA 1JZ4A 3CJIB 5LY2A 4B1LA 2GMMA 1ZZ8A 1JYNA 3LA7A 1H9WA 3KF5A 5HV0A 5A7NA 3PUHA 3T0AA 4RR3B 3AZZA 5J37A 2PELA 2OQ7A 4Y22A 1XYNA 3VBHB 4JDNA 1AYN3 1DP0A 4NRMA 1CX1A 1UZZA 1IKQA 3H8OA 1ZZ7A 5JI9A 1Y9QA 2SBAA 3MLKA 3CO2A 1DYOA 1DLCA 1AYM2 1PZ9A 3JQXA 1VBE3 4MXWB 1BKZA 4CXWA 1SHWB 3FBYA 5FZ4A 1SLTA 3O1PA 3VD7A 1GOFA 1J3RA 2I45A 4QT6A 2VNGA 4AI9A 3UK9A 1I5ZA 4E2SA 4HVOA 3UYJA 5C3SA 3N7LA 4PIYA 1PO22 1LOBA 1WGPA 4K1YA 2PQSA 2V72A 2R072 3VBSC 1ULGA 2J1UA 2VZPA 4CXXA 1TME3 3LA2A 3VB9A 2PHLA 4CP2A 5DUVA 5E89A 2D3RA 2HWC3 2VZSA 5IK4A 1W3XA 3DPRA 1NG0A 3QCWA 2C24A 3SHRA 1W04A 3N7JA 4A7KA 1C1FA 4IEOA 1O4YA 4E2QA 1BHGA 1CAVA 1V6OA 2Y6FA 1W9FA 3I3EA 4JDOA 2PN5A 3CBNA 3EMRA 4BU2A 1QXPA 3GZAA 4YSFA 1LAJA 2GDFA 2VULA 1ENRA 2ZGLA 2VR4A 3PIJA 1WMFA 5LCWL 4JKKA 3ZKYA 4Q4Y3 3RZJA 4KWJA 2ZEXA 1QNWA 4YZ5A 2WQ8A 4XDQA 3RZLA 4YVSC 1DYKA 1KQRA 1UMHA 3HPNA 3FHQA 1WW7A 1QJY3 5M0TA 1W39A 5CVRA 3MIHA 1R1ZA 2WN3A 1YI7A 3ZFGC 1OA3A 3J8F2 2IXKA 1WD3A 5FFOC 1OLQA 1PK6B 5JSOA 2ORZA 5LEKA 5FP9A 1KITA 2KA3A 1LU2A 3GBFA 4B1MA 4D3WA 1W28A 2HWB3 3HMYA 3WV6A 5FZBA 5JIUA 1OHFA 4ASMB 2QFEA 3IAPA 2AR6A 4H7LA 4LA3A 4GB33 1VRBA 3ILNA 1UWWA 2TBVA 5CZKA 1YHFA 4H55A 4U2AA 2RHPA 2WO2A 2WNVA 4I0AA 4XQDA 2XQRA 1GFF2 1QMJA 1X8EA 4Y26A 1NCQB 4K9SA 4F7ZA 3R6SA 3ZSMA 5C3QA 5JAXA 1W6MA 1C4RA 2DWRA 2F4PA 2PLV1 4XBQA 2LM3A 3POBA 3DKWA 4TLFA 5FY0A 2ZACA 3LAGA 1OPOA 1C8M3 4GMP3 3Q8CA 1W2OA 2VOWA 2CHHA 1QJU2 3WNPA 2OPWA 1HXS1 2A6WA 3OGJA 3I54A 4K40A 5JXJA 1M06G 1VALA 2WYFA 4K7JA 2Q1MA 1H0BA 1PVC3 1CWPA 1EPWA 4LLOA 5KC5A 2Z5WA 4MUVA 4YW7A 4IV3A 1VMHA 4XCBA 2RJKA 5FZHA 3RZKA 1B09A 2DTWA 5FZ0A 4DRRA 1NOVA 1HN1A 1D7PM 5F6KA 5IVBA 1NCRA 4K20A 2DURA 5GLZA 5FO9B 3N7KA 1AR61 3TWIA 4EE2A 5HV4A 3J9SA 1HV0A 5JI7A 2VOKA 1MEC3 2VQ0A 4NHYA 2ZGRA 2J1AA 4FPOB 2Y60A 5A32B 2ZA9A 4QHOA 4P9JA 2CGNA 1RUG1 2OA2A 2WWSA 2Z79A 3J7NA 4JTNA 3ZFFC 3L9JT 5A1FA 4RS5C 1J1TA 5JR7B 3MPBA 3AVRA 1G9DA 2VOVA 5FLJA 3C7FA 1POV3 4OCTA 4Q0SA 4EN0A 3WHUA 4DUXA 1W6PA 1JUIA 2ETEA 1GP4A 2VPVA 2CYFA 4XC9A 2VNOA 2FCTA 4WM8B 5EP9A 2X5IC 2MPFA 5D8AB 4A44A 1WLTA 3OGRA 4HG6B 4Z07A 1HB3A 3O12A 3ILRA 1BK1A 2O14A 5T52A 4FSJA 1CIWA 1PGW2 3SISA 1VBB1 1UIJA 2E51A 1FOD3 1V6IA 2AZ5A 4OUMA 2GC0A 2ZGTA 4BOWA 1RTVA 3AX4A 4YG0A 5B2GB 3IMNA 3VKLA 1PIV3 3NNLA 4XF9A 1SQ4A 5K0UC 2E7QA 5IUQA 1AL23 5IK5A 2XWBB 3J7HA 1YFUA 2EXJA 3W20A 1AR92 2V5DA 3J4UH 4KNCA 2Q8OA 3VN4A 2YFUA 2YU1A 2BTVC 5IW0A 1ZREA 1G6NA 2ZZJA 1JS9A 5EJ3A 1WCKA 4PDWB 3U11A 3H1MA 4K8FA 1XJAA 3VBFC 4PT6A 5I93A 4EN8B 5A7SA 4XMAA 1TMF2 2ZMKA 1W0PA 3KT4A 3QLQA 4IE6A 4OHYA 5FZIA 5J48A 2A3WA 1WMEA 4YW4A 3KM5A 4JCKA 1HRI2 3AKRA 2QQIA 4Q1PA 3T2QA 4BH9A 1CAXA 2IXHA 1FXZA 1SBEA 3OOXA 4JGYC 4XUQA 1HDKA 2CAVA 1QQP3 2WWUA 3WW3A 2OXBA 2HH9A 4YW6A 4QX0A 1SLAA 1QXJA 1RUNA 1SLLA 1F4HA 4W6XA 4IDZA 3E5QA 4N43A 2LROA 4PIXA 5DABA 4TTGA 2VC9A 2P34A 5C7GA 2VZOA 4QX3A 5ACA3 3WHTA 1ZM1A 2CU5A 5LBBA 3B69A 3RWKX 4L99A 4E2GA 1AVBA 1AYM1 2WS92 5DMYA 5FYMA 4FPYA 3CF6E 1RUC2 5EWSA 1HV1A 4GD4A 2KM2A 1O5LA 3H7JA 4E8DA 3POFA 3ZDVA 1H2MA 3JB4C 5LW9A 3U1XA 3CU7A 4LO8A 1TNFA 1RUD1 5IHRA 1BK0A 1S2BA 4RQPB 5CYYA 5FY7A 1PO21 5EJ1B 3AVSA 3EQEA 4UW5A 1H2LA 5K4LA 1CJPA 4J1WA 5EXOA 5BNNA 4ZU7A 5DAQA 5A7PA 2DVBA 4FPFA 4LO6B 1PGL1 3BIEA 1CPMA 1JW6A 1T6BX 5FY9A 1LU1A 2DU0A 3POSA 4LK6A 2MNGA 3SCFA 4DZGA 5I8SA 1CZSA 1UU6A 5IFPA 1COV2 1RYYA 4Q26A 3HQRA 2Y8KA 2CY6A 1BLZA 1YQ8A 1W2AX 1N3OA 3MEPA 5GJ6A 1QJEA 1DZQA 1LOFC 1OD5A 1UY0A 3J7MA 5I8YA 3HOBA 2RMU1 4CEWC 4HANA 3JD72 1LHOA 4WVVA 4IV1A 5JOZA 4KL1A 4A6OA 2C9AA 1CZTA 3DYMA 2CGOA 3X29B 5KBFA 3QH7A 3WP6A 4E9KA 1KGYA 4QKFA 4UFKA 2XVKA 2XKOA 5C5UA 1S0IA 3OCPA 4P14A 4MZUA 4GH4B 3ZPYA 2I2SA 2NLRA 1OF4A 1V00A 1C3HA 3ACHA 5C9AA 1R083 5CFCA 1RUOA 2GH2A 1RHI2 1BQPA 3NV3A 4GWIA 5GKAC 3J8F1 2A73B 4M3CF 4DB5A 5A3LA 1VBD2 3QBQA 3I2HA 5F2SA 1ND2A 4AAXA 4E4ZA 3JCIA 3VZOA 2XR4A 4XZUG 3WZ1A 3PVBB 5FZFA 4XFGA 4MH0E 4QGLA 3KGLA 3BOWA 4QXCA 5FUIA 1S0DA 2W2IA 4ONUA 3S5QA 4PJYA 1W8UA 3O0WA 4CDQB 4JQTA 4EROA 3LFMA 5A33B 1PO13 1W9YA 4BQ2A 1U5ZA 1XNBA 3J7LA 3LIHA 4LQRA 4XQ4A 2Q5TA 3TAYA 4CUAA 3ZSKA 2BWAA 3R4SA 4CDUB 5EIYB 2WFF3 4W65A 1QDCA 2VG9A 3CJIA 5JOWA 3FL7A 3A4UA 3AJYA 4HSJA 1OMIA 2NYYA 4I02A 4P9XA 5CIRA 1ODNA 3P1IA 1CAUB 1HW5A 4LK7A 3RG0A 4IESA 2OQ6A 5FYTA 1S55A 2HWF2 2JDNA 5GZCA 2IC1A 4PF5A 4RR3A 1PZ8A 1JOPA 3EO6A 1ZBE3 3ELNA 3VBHA 3VZLA 5FPVA 5BNQA 2EAKA 4FAGA 2OX0A 4MXVA 4K8RB 2CWSA 4UFIA 5GLUA 3H8UA 3ZVXA 1RL3A 2BERA 5FR3A 3OTFA 1JN2P 3T4VA 1GP5A 1F35A 2W47A 2BNOA 5CB7A 5IVEA 3RZMA 1ND3A 1RVF3 3MF6A 4GXLA 1OXCA 1Y7BA 4KGGA 5FMOL 3SH3A 4CEYC 5LATA 1SLBA 5B4NA 1N1VA 5GLWA 4BLJA 2A5ZA 3AFKA 2EALA 3AMPA 4QWNA 5L36A 4YGDA 2XJPA 1IGOA 3NO8A 5DZEA 2ZHNA 1V6JA 2GMPA 1YIFA 3WDYA 2KXLA 2DVDA 3JB8A 2GMEA 4MVTA 1AJOA 4G4FA 3I2OA 3WDWA 5LEJA 5T5OA 2BFUS 4PHZA 3T1MA 4XUTA 4CUGA 1C5HA 1J83A 1HJGA 1HRV1 3DGTA 2D93A 2P3IA 4GJZA 4PLMA 1ZA4A 5DDJ3 5LBCA 4B7KA 2VW0A 5JUVA 2OT7A 4TLGA 4V2WA 2Y26A 4LHLA 3KV9A 1I5PA 4Y5SA 2D5HA 2HEVF 4L11A 3JUUA 1VIWB 2VQTA 3IZOA 5BPXA 1BYHA 5T5LA 2VU9A 3LKJA 2WA3A 1RGSA 2B7YA 2WYSA 3KD4A 4UFJA 1PGW1 1UF2C 1EAH1 4QDQA 1SACA 2CGPA 2C4XA 1WLWA 2VOTA 3ZXKA 3PURA 4R9CA 1JYWA 1YQ5A 2Y64A 1K42A 2A1XA 5KHGA 3WG3A 1PK6A 1AR91 1VMJA 4LLFA 3SXWA 2VECA 4OZXA 3TB0A 3OPWA 2Y0OA 3ZFEC 3EB7A 2RM21 4ITCA 1N1SA 4Y1YA 1W3VA 3Q8EA 3ZM8A 2VO5A 2WWJA 3MLJA 4CU9A 4LBMA 5JZGA 5GLTA 4Q4V3 2QKDA 2R043 2Y34A 1JBCA 4ZS2A 3ZR5A 3SKVA 4YRDA 2W1QA 2P2KA 1HRI1 1NCQA 5FKCA 1AZDA 3D6EA 1RINA 1TME2 4YWAA 2CNAA 4COVA 1BVVA 2D43A 2XBO2 2BQPA 2HWD1 2XJTA 1X36A 2BGPA 2RR13 3ZO0B 5IVFA 3WOGA 1H2NA 2F17A 5HPOA 4OI1A 3NKTA 2CV6A 4CCEA 4AHZA 1H2KA 3IIAA 1UX6A 2WZR3 1E5IA 1LTEA 5EQUA 4AYUA 5GALA 4AW7A 3WXPA 1X33A 2XDVA 5IAVA 5FXZA 2WZ8A 3POEA 1BEV3 2VW1A 2IXLA 1W2NA 1AXZA 3ME2A 1RUC1 2C6SA 3APBA 4Q4Y2 4XFHA 3WNXA 4Z2AA 4FTEA 3ZXJA 3O1MA 4FXGB 1TZOA 5FAXA 4BK5A 2FMYA 1AXYA 4Y1XA 1LCLA 1V70A 5L73A 1QJY2 3GNEA 5C4WC 5FZGA 1GLHA 1VR3A 5GZGA 2D6PA 4QU1A 4NAOA 2FBEA 2R30A 3BU0A 2ZJCA 5KHIA 2VNVA 1W0OA 2Q1FA 3LEGA 4KWKA 3M3EA 4Q5OA 4X8NA 4DMIA 5A32A 1LR5A 1YQ2A 2V4VA 2FDKA 2E6VA 3WT3A 1JYTA 1TEIA 2VMGA 2YC4A 1AHSA 1U0AA 3AB0A 2HWB2 1MZ6A 4WVMB 4OLLA 4FPKA 4ZKTB 1W03A 3NNFA 3U4SA 1ALYA 1EP0A 1ST8A 2VZUA 4YZ4A 5JDBA 4J6GA 4A41A 2P4EA 4EJRA 1LGBA 2X09A 4B8EA 4HVRA 4I3PA 3MLLA 4LOSA 1CPNA 2NPIA 2QQUA 2CL2A 3K4DA 1V6LA 4WM8A 1BCXA 2G9FA 4CEWB 1JZ7A 1V9U1 5C8CC 2ZZQA 3GHMA 3I2FA 4IEZA 2JKXA 2G19A 3F95A 5HCBA 3FX3A 4XBNA 3OBRA 1EUTA 4QX1A 4XFCA 5JSRA 1HQLA 2C9KA 1UY2A 4XCAA 2WAAA 2Y6LA 3ACFA 4LIVA 1C8M2 1H9PA 3KGZA 4AEDB 1YFWA 5G05L 2QQJA 3PMEA 1RHI1 2PHUA 1QIQA 2PMWB 5DUWA 4I0WB 3VZNA 3ROUA 2C1FA 2O0OA 1PVC2 1ZRDA 1WZXA 4IE7A 3OPTA 1LEDA 1UXXX 4MADA 5JXIA 2V73A 4YZ1A 4Q0PA 4D69A 1XNDA 4M01A 3VV1A 1SEFA 3VBUB 2E32A 4LUKA 1G9BA 1HX6A 3BPSA 3T4HB 3ZKUA 3RYKA 1VJ2A 4ASKA 5J98B 2HWE3 3WQ0A 1FMD2 5ABJB 4I3GA 2RS13 2RDNA 5F6LB 4YM3A 3M1HA 4Y1ZA 4FOQA 1OLMA 2A6XA 1RUE3 2XONA 1OFNA 4MV2A 4MOAA 5T55A 1D4VB 1X9TA 4CU7A 2BRTA 4CRQA 2CWMA 1V6MA 1RITA 4HN0A 4EQVA 4QM8A 1W9WA 3IDEA 4MGZE 2HWF1 2XHNA 2VW2A 2WO7A 2J22A 1T2XA 1NKGA 3SNMA 4LBJA 4C1XA 2JG8A 2XUMA 1CR7A 1PNGA 1DQ2A 2ARXA 4Q4W3 3W9AA 3WEZA 3IKWA 4RD7A 4IE4A 4KBZA 1QOOA 2J1VA 3S7IA 3AMNA 4BB3A 1ODMA 2B9VA 3HBZA 1OQ1A 1IG0A 4FI9A 4MGIE 4JHZA 4OUEA 4XJZA 5BNOC 5CFCC 5J1XA 5KXEA 3FUQA 3HNMA 4CEYB 3VZJA 1PIV2 4B29A 5LRSA 1RXGA 1AL22 2JICA 1Z7S2 1LHNA 2PLV2 4RQPA 1APNA 3LEIA 4OHWA 5F5QA 3BTAA 5FZ1A 1NA1C 3S30A 1NXMA 4XUOA 3A21A 4CP9B 5LA0A 1FX5A 1T6GC 2DUOA 3LDKA 5F2WA 4YNIA 4QXKA 5D1IA 5IVCA 2BBAA 4FT8A 1W8FA 2HYKA 2W08A 4RGAA 3SQOA 5JMOA 5FY5A 4B3NA 1K5MC 2ERFA 4QQ2A 1H1AA 3LDBA 4XMIA 1AR83 3ALQA 2X10A 5FLHA 5GLVA 4BLIA 5LBEA 2K46A 2CTVA 2GU9A 4HT1T 3V64A 4FPGA 3LIGA 3TOJA 2GC3A 2Y6KA 2NP0A 2FZ1A 4NHMA 1RUJ3 3FN9A 1DQ5A 3BUCA 4XJUA 3NW4A 1YEWA 5LA1A 3GALA 3PU8A 2WO3A 3T2OA 4BMBA 5K9YA 3URFA 4XAAA 1J59A 2YBSA 5KR7A 5JVVA 1MQTB 3Q8FA 4NIDA 1D2QA 3N3HA 3KLSA 2O1QA 4GH4A 4L9BA 1GSLA 4IGPA 4C91A 5FZOB 1CAWA 4AEMA 4FPCA 4F3JA 2Q30A 4UOJA 4BXFA 4WVZA 1AYN1 3ACIA 3THTA 2WSUA 3N9OA 1AUYA 2QQPA 5FZLA 5FXWA 3O0XA 1YC61 3HT2A 1S0FA 4CE8A 2FCUA 1S0JA 1RMU3 2VVEA 1UOFA 2ZCWA 1RB8G 4LKSA 1VBE1 3JXSA 4QX8A 1DLLA 2ILMA 4WZCA 4NIHA 4JGZC 5DG1A 2ZHKA 3ZXGA 1WWYA 4CDQA 3M70A 3N36A 4N9HA 3M3CA 5A33A 2XJRA 4QMAA 3WNOA 1QU0A 4FO9A 4RHV2 3AYAA 4AVVA 1IS4A 3GJAA 1VBB2 3RVHA 4CDUA 5FZ3A 5GZDA 5E16A 4EZHA 1AX2A 3BYWA 3GDBA 4XUNA 5AFBA 3VD9A 1TME1 2BVVA 2W94A 1C1LA 2HWC1 5F9TA 1SCSA 2ET7A 5I0SA 3KHBA 2Y33A 4XHBA 5AFEA 2J1TA 2BBVA 3WG4A 1VBA3 1ZRRA 4IEQA 1N47A 4P9GA 4XIOA 1D2SA 1S4CA 1WCUA 1Y4WA 4QPIC 2R063 4PQQA 4R4XA 3TRSB 1O3SA 3TN93 1G86A 1OI6A 4ZPIA 3ZOIA 4IEYA 1GNZA 3WDVA 4R52A 1IG3A 1ULEA 4CZSA 4Q4Y1 1XNCA 4AGGA 4BQ3A 1N3QA 4OFGA 4LEJA 2VVDA 3A0KA 1OF3A 2XMLA 3AP7A 1QJY1 1IKPA 4CPBD 5BV6A 1KDKA 1NZCA 4WVWA 1IS3A 1IOAA 4BA6A 4HMZA 4KH9A 1W05A 3BTZA 1RUH3 2HWB1 2MEV3 2XWJB 2JB8A 1OQDA 4M3CE 4XJ9A 4Q8LA 1JYCA 2WNOA 4GB31 4CSWA 1UYXA 3WDXA 4AVSA 1XE7A 2YBKA 5F39A 1UMZA 1OC1A 2WL1A 4AXOA 1SBDA 3AP4A 2QQNA 4CDXA 1QY4A 1XU1A 1PO12 5FYYA 4CPBA 3BVCA 3P5BA 1Y43B 1DBNA 3ZXDA 2OVUA 4C1WA 4K1ZA 5JSPA 4BQ1A 3RNSA 2BGCA 1RUI3 4UAPA 3OUHA 4UW6A 2P3YA 5FBJA 3MFCA 1UKRA 1IQAA 1RUD2 1XB9A 2ZGMA 3AFGA 1OA2A 2WQ4A 2ET1A 1UU4A 3TEYA 1LULA 1C8M1 1FAYA 3CJXA 3JBG3 4GMP1 1GZTA 2RVAA 4HFSA 4IE5A 4LMFA 1DQ1A 2HKXA 2XLAA 2ZHLA 4L8QA 4Z1VA 3CLPA 1PGL2 5BYNA 1X82A 1MS5A 3CEWA 2JG9C 3NVCA 4D94A 3NV4A 4PI0A 1ENSA 1QEXA 4MG2A 4LKEA 1PVC1 3C3VA 1AX0A 3FLRA 2NM1A 1UKGA 4FTSA 3VHPA 1XNKA 3Q8AA 4OUSA 2VM9A 3B9IA 1JTZX 1MS1A 3MYXA 3HIFA 1NLRA 1ZYBA 3POGA 2RMU2 4XAEA 5CFDC 1W8WA 3AKPA 3FWEA 2B9UA 2IUWA 1BVP1 4META 1XOYA 3VKFC 4Y5TA 3B5LB 2LUWA 2W1WA 1LB2A 1VBC3 2VE1A 3VZKA 2UWBA 1MEC1 1FMD1 3A23A 1LHUA 2ZHMA 2HEYF 3H42B 4XDPA 5F8PA 4NHKA 2VZQA 4NR1A 1HQNA 5FZAA 1OOPC 3KV4A 1A3KA 5A3PA 1S0CA 1SPPB 1STMA 4BQ5A 3UV9A 3M4FA 3OBAA 5HBAA 1H8TB 4UI9L 4LT5A 4ZXKA 1POV1 3S57A 2WT2A 2E63A 3ATGA 5DDJ2 5IVYA 5KHKA 1TE1B 2BEOA 3DUIA 5IFTA 4HL0A 4UT5A 3S7EA 1HB1A 1AR73 4Y1UA 2PAKA 4M00A 4NIIA 4IL7A 2WUHA 1X50A 5H9RA 1IHMA 1ZNPA 4I01A 1FOD1 4UFLA 2B5HA 5E1RA 2JB4A 4DXSA 2ZGPA 1PIV1 5EPAA 3SEPA 5J7MA 1AL21 3AJZA 1Z7S1 5JR2A 5FP8A 5CG9A 1X8MA 4XETA 4NVPA 4DPNA 3IWZA 2O8QA 1RIRA 1QKQA 1YO8A 4PF1A 1QOTA 5IYYA 2D40A 4L92A 3I2DA 3C8XA 2AGSA 1EYBA 1G8WA 2UYAA 4KG0A 4QDRA 4WVMA 4QB2A 3L2HA 3VBOA 3KT7A 1K5MB 3AXEA 1FPN3 1B35C 4Z92B 5FJKA 1Q3EA 2C5DA 2CDOA 2XVGA 4Q4V2 4AI3A 1FT9A 1GZCA 3K2OA 4ZZ8A 5BNPB 4RGKA 3VBRC 1Q56A 4RFRB 4HBNA 4B7EA 5A3NA 4R8HA 2EIEA 2EXIA 2W92A 3ABZA 4CEWA 5E6HA 1O7FA 4WBBA 3THPA 1KFUL 3FMGA 3M2MA 3I3QA 3R4UA 2UURA 5DG2A 4PBPA 3ZIXA 1OBNA 1REFA 2YB7A 1QQP1 2HEWF 3OPZA 1FATA 1JMUB 2Z2SB 1XE8A 3B9CA 4NMIA 4XJWA 3ZSJA 5FZ7A 2FCVA 4YVWB 1H1MA 3ECQA 4AEDA 4GAZA 5FYZA 4RN5A 3FBMA 1HB2A 4N53A 1ZBA3 4XURA 4BZ4A 3PLQA 4INDA 4XFAA 3AZVA 1HRV2 5ACA1 3I3MA 3WCRA 4XUPA 3AMHA 3OYWB 1BEV2 2DCKA 1PHMA 3HQUA 1O4ZA 1RUF3 1S1AA 3PHMA 2NMNA 5GM0A 4O65A 4D7YA 3PJQA 5JOXA 5L19A 5F5CA 3VBUA 4BHPA 4D7TA 3EXUA 4JGZB 4NAMA 1W6OB 2EVXA 3DL3A 3LGRA 1O3QA 5A7OA 1OSGA 4GIQA 4RHV1 3M3QA 3H3ZA 5ABJA 1EAH2 1O91A 3OD0A 3OBZA 1ZA7A 2K0GA 2YUEA 2Y6JA 3V0AB 2IFRA 5ERLA 3NAPB 5FYCA 5IJRA 3KB5A 4LO4B 5T54A 1AL0G 4MLOA 3LB9A 1WA6X 4V2VA 2D6LX 2LW8A 4XVHA 1D0GA 3GBWA 3OD4A 4QPIB 2RM22 2RDSA 2YZ4A 4OHVA 3ZPOA 4XZPA 1QWRA 4XXAA 4KU7A 3VHRA 1YYNA 2NMOA 2VMHA 3ACGA 3HVDA 3KZ4C 3M7AA 1ZVFA 1HIXA 5FZ9A 4JAAA 3ZMOA 5JLVA 3U10A 1VAVA 2RJLA 3CIHA 1G9CA 3FLTA 3AK0A 3NMBA 2XH6A 4I0BA 1DZTA 1PVXA 4E4SA 3DPRC 5L7OA 4N7UA 3TBDA 2ADDA 5HCAA 3UGGA 2XOMA 3T09A 4RFT0 4CEYA 3NWKA 4W6YA 4CTEA 2HWD2 4Y3OA 3PJYA 5FREA 2GC1A 3HJRA 3ZYHA 4CP9A 1DHKB 3N9PA 4YPJA 4FFIA 2AEYA 4FPLA 2QQKA 4AFAA 3SEEA 2EXHA 3AM2A 1Y9GA 3N9NA 4DFSA 4HOOA 1GUIA 2DCZA 2WNUC 4HZFA 3LOBA 1OKQA 3WP4A 1UOBA 4P08A 3INAA 1POQA 1SDDB 3DF0A 4Q0UA 5KXBA 1PO11 5A3OA 4YZ2A 2HWE2 4AK3A 1IS6A 1XNAA 2RS12 2WFF1 1VE0A 1F4AA 4FVVA 1VAMA 2ID4A 2VTXJ 3BTYA 5F3EA 3AMQA 5DUXA 1KJLA 5C71A 3CMGA 3I59A 1EY2A 1CX4A 4QKDA 4FOVA 5FQ0B 2RJ2A 1MQTA 3MUZ1 1LJ7A 3VBSB 3E6BA 5FP3A 3G6JB 4JV4A 5K7PA 5FO8B 1LOEA 1FV2A 4LHSA 1ZBE1 5FZOA 5JXGA 3RI9A 1ZZCA 2FHRA 2QDNA 3UKTA 3CKHA 3KMHA 5AC93 2JG9B 2XHKA 4JVAA 3H8RA 4Q4W2 5IAXA 4HK9A 1LOCA 1JODA 3LEMA 2VUDA 4NWWA 2I74A 4FFGA 4GALA 5FP7A 3V65A 1ULCA 2VMCA 4TN7A 2XJSA 4UF0B 5CFDB 2QQMA 4QB1A 4OI4A 3P3PA 1DG6A 1BXHA 1V9U2 2A71A 2OW4A 4QAWA 5CA6A 1OLRA 1UYYA 1RVF1 5K8SA 1CJDA 2OPKA 3R0RA 4DRVA 1ZRCA 4KQ7A 2UY8A 2WN2A 4YVSB 3PUQA 4CUBA 1QJFA 5JIAA 3O1TA 4AWDA 1OOPB 5FK7A 4COYA 1F8VA 2WBKA 4XOGA 4W6WA 4AI2A 2GNDA 4XW3A 1MS3A 3ZFGB 3VDBA 1GZ9A 3MHZA 1AXKA 4IE0A 1GZWB 2XJQA 4JKMA 4HKOA 2E7TA 5DDJ1 4EN7B 3O1UA 1UN1A 1NCRC 3POYA 2NZ9A 1GANA 2W95A 3WNKA 3PDQA 4D7SA 4LKFA 4X6RB 1PM4A 5L9BA 1F5JA 4NHLA 3GBGA 1JI6A 1PMHX 1LOAA 1MZ5A 5DXDA 3IM0A 4ES9A 1D0HA 4AI1A 3MBWA 1H4GA 2BFUL 5AVPA 1JU4A 5DZFA 5C33A 1W6NB
chains in the Genus database with same CATH topology
3FFQA 5FPZA 2QDRA 2IZWA 4R4ZA 1OA4A 2V5YA 2B8MA 4K21A 3RJRA 3U4XA 4XXPA 1RMU2 2B42B 3ZSEA 1E57A 1Q8QA 3SMHA 4CYDA 2DU1A 4LBOA 1B35B 2NQYA 2LTNA 4AE2A 4Q4V1 1W6QB 1MR5A 1QH6A 4MXWA 3VBRB 3IDBB 4CP0A 1VP6A 2YGMA 2ZPXA 3ZN4A 2BPA2 4DNYA 1PO23 2JKBA 3JZVA 1Q8PA 2R073 4QM9A 3ZYGA 3BOPA 1MS8A 3WUDA 4ISRA 1CN1A 3UL2A 1MACA 2NN8A 2RR11 4EWDA 1NY72 3MIGA 2XJUA 2GNMA 2WT1A 3ZFFB 1VBA2 2R1BA 1XRUA 2ZMNA 5E88A 2TEPA 2R062 3NV2A 4RS5B 3D82A 4GWNA 2ZGUA 1UIKA 4U36A 2GN3A 2RS53 2WIIB 1BEV1 1UPIA 5LRRA 3VHOA 4B4PA 1C28A 2SLIA 2VQAA 4RA0A 1O3TA 2X5IB 4EWAA 4YM0A 3UKNA 3MW2A 3IDCB 1QOSA 1MS9A 3ZYIB 4BIFA 4CDWC 3B02A 1DYPA 4A2UA 5K0UB 1RUH2 2FQPA 3NJZA 3WP5A 5JMCA 2MEV2 1KS5A 3AKSA 1AYN2 1DGRN 4WZFA 4WM7C 5IK7A 1H8TA 1DZRA 1U5IA 2JDZA 4AEJA 3S6PA 2N7GA 2GNTA 2JEMA 2CAUA 4YGBA 1VBE2 4GMP0 4AQTA 1SFNA 1QDOA 4C90A 4DY5A 3VBFB 3RS6A 1RUI2 4Y24A 2ZGQA 2OUJA 3HWJA 2W0XA 5BNNC 1MZFA 2ZGSA 5AVAA 4OI0A 3JBG2 2GZWA 3QH6A 4S2HA 4JGYB 5CU1A 3ST7A 2HWC2 4AFDA 1XQNA 3E5XA 1QJU3 1BBT3 2Q0AA 2ZX0A 3KQRA 3AZXA 4LBNA 1R1A3 2WINB 4IV1C 2WC2A 1VAKA 3ACLA 5BUVA 2WNUB 1K5MA 1VRH3 2JE7A 4SLIA 2H6CA 4C0HA 2BUKA 1W2UA 3RYPA 5BNPA 4IEWA 1VBC2 3O5SA 1Z0HA 4H7MA 2HWE1 5CFCC 1D4M3 1ZX5A 3VDDC 1POV0 2YV8A 1J1LA 2RS11 1U12A 3NL1A 2YYOA 1RUE1 4V1PA 1NLSA 1UPSA 2ZX4A 4JC1A 2Z69A 3H1WA 3KCCA 3NKGA 4PQ9A 1CVNA 2AREA 4YVWA 3VKMA 4BM8A 3KS7A 1DU3D 5JCTA 1MZEA 2UY9A 2A75A 3ZYJB 4AVCA 4P9YA 3CL1A 4UBGA 1QJX3 3MFAA 4GB32 4Q27A 3RZZA 4Q4W1 4BYYA 4M3CB 1H30A 5I91A 1AR72 3OGGA 2QVSB 3RI8A 3WP3A 3OYWA 1WMDA 4QD2A 3CJIC 4QPGC 2ZGNA 2R0FA 1LENA 3JQWA 3ZXFA 5D8AA 3WX5A 4LE3A 4IQPA 1UL9A 3PVOA 4RR3C 1LHVA 1N3PA 3GHNA 5J36A 3VBHC 3E5UA 2B45X 3DV8A 4LE4A 4K3UA 4BCUA 3BALA 4N90A 3V0AA 3NAPA 2R49A 5FDBA 1QGLA 1FPN2 1AR81 1WBLA 4FOYA 4L97A 2A3XA 1ND3C 3AZYA 4MGYE 2YROA 4QPIA 4XJ8A 2WA4A 2WZPP 2E53A 1TMF3 3QD6A 2A6YA 4PDWA 2WJSA 3RJ2X 1RUJ1 1J3QA 3U0ZA 1TQ5A 1ULDA 2UU8A 1HRI3 2JD4A 1MEC2 4HSLA 3MZHA 2RS33 3I7DA 4QQOA 4YFZA 4AI0A 1NYWA 1ZBA2 2P3JA 1IPKA 2HJIA 3WDTA 2D6KA 4XF3A 2R1DA 1F5FA 1RMU1 1URXA 2WS93 4Z8BA 1CGPA 3L2YA 1RUF2 2DYCA 1QH7A 1NQDA 3PNAA 4DS0A 3IBMA 1ZRFA 3FHIB 3WUCA 1S0EA 4B4QA 2TUNA 4XBLA 4NN0A 1GQHA 4NO4A 3ZYPA 1FOD2 4Q2FA 3HQXA 2ZAHA 1LKNA 1YJKA 1CESA 3MIBA 5FQ0A 1O3QA 3HD8B 2OZJA 1NY71 2PQQA 3MDPA 2VMIA 1VB4A 1MVQA 3VBSA 5FLIA 1VBA1 2JENA 5JZGC 1PGSA 2ZTNA 2MHFA 2R061 1COV3 5EZWA 4LO5B 4FBFA 3TN91 3ZDSA 2LALA 3JD73 4Q0VA 1WCDJ 5EYYA 3HR9A 5SV5A 5CFDA 2ZGKA 1YIPA 3QOPA 1CONA 2GN7A 5E8AA 4XF0A 4KG8A 2P17A 3MIDA 1QQP2 4M0HA 1Q8OA 4YVSA 4CDWB 3E97A 3WINE 2DCTA 1MVEA 1RUH1 1VBD3 2MEV1 1ASJ3 3ZFGA 2WQZC 4GQ7A 2BNNA 2V09A 4WM7B 5ACA2 1IZ3A 1R093 3H1YA 4FP3A 4Q0QA 3ZFEB 4AQ2A 1GBGA 2RE9A 4QQLA 1F2NA 3WQ1A 5CG8A 1RUI1 3EHKA 3M3IA 1DIWA 4HKWA 5BNNB 4AG4A 2A6VA 2HWF3 3JBG1 3ENRA 3O0VA 1RC6A 4AF9A 1V6KA 1W6NA 1CAUA 3B00A 3BODA 3RPQA 3T2TA 1DF0A 2QNKA 1SCRA 4P5HA 1YWKA 2C0ZA 2JECA 4WM8C 2WKKA 4AHYA 2G4IA 4MGKE 3ZYRA 2B46X 1PZ7A 1ULFA 1NXD1 2PTMA 2DVGA 4UBHA 2A7AA 2DVFA 1V6NA 3WR0A 2IXCA 1KFXL 1B35A 1GV9A 4LULA 4JTOA 1W6QA 1ZZ9A 2VVFA 1VBC1 1WW5A 3KSCA 4PIZA 3VBRA 4XTPA 3VDDB 4A7ZA 2DVAA 4MYEA 1JOJA 4AI8A 3J26N 3LWCA 5C4WB 1EV13 3RWNA 2JXAA 3OY8B 1R082 3G7DA 3ES1A 1KDMA 5IK8A 1LGNA 2AYHA 3ZFFA 1LODA 1OQEA 2PHFA 3LSDA 4RS5A 5H9SA 2IXJA 2Y38A 3BCWA 5FOBB 2XL7A 1AR71 3NSTA 1YI9A 4XHXA 1GKBA 3QACA 1S2KA 2GNBA 5LK7B 4QPGB 2D5FA 4R9AA 4XEZA 2X5IA 2PYTA 3D0JA 2WFF2 1WW6A 5C8CB 2UYBA 5IT6A 2JG8C 1PM7A 1DFQA 1G9FA 1ZZ6A 3E6CC 3H0OA 4LNVA 5J3UA 1ZBE2 5K0UA 5FCCA 4X8PA 3FLPA 2IXIA 1A78A 1Z78A 2D6MA 3Q9OA 4YGCA 2D7FA 4FAHA 1LECA 1VB2A 1REEA 1FPN1 1UU5A 4K6BA 1ND3B 2XPJA 2OYZA 4N9IA 4YG6A 3VZMA 4RQPC 3I4IA 3VBFA 5HCFA 1RVF2 4OVEA 3WLUA 3ZN6B 2JX9A 2QZ3A 3CNAA 2D98A 4NWVA 1WLCA 3D5OA 2XBO3 2PHRA 1SFYA 3TNPB 3USUB 4GKYA 3VLBB 1NE4A 5T3NA 1QHDA 4JGYA 1BMV1 2PHTA 1FYUA 4PLNA 3ZXEA 1A8MA 2XKPA 1CD3G 1QNYA 1ZBA1 4FPEA 3ZIWA 3ZMNA 5T50A 4Q4X3 2A6ZA 2RS52 5KXDA 4FPHA 3BIWE 3MICA 1RUF1 2WNUA 1YXWA 3USSA 2AUYA 2DTYA 4Q1RA 4LHNA 4GH4C 4LBQB 4WV8A 4S2DA 2PAEA 3BPZA 1HQWA 2I07B 5BNOB 4YZ3A 5KWRA 3GF6A 2ZBJA 4QPYA 3I8TA 1UW8A 3O7OA 3VGIA 1NA1B 3LSEA 3IPVB 1GICA 2QE3A 3B7MA 4AFMA 5JZGB 2BYVE 4FQ4A 3FC0A 4CDQC 2XG3A 5I0TA 1AX1A 2BVBA 1FV3A 3BU7A 4M3CA 4E27A 4CDUC 1LOGA 1G7YA 3AP9A 2D6NA 2R042 2VY0A 3W59A 2YGLA 3B3QE 1LOFA 1ZZBA 1LGCA 1UCXA 3EBRA 4AHWA 2DFCA 4HETA 4RSUA 2ZX3A 2WSVA 1SLCA 1HKDA 3WW4A 2RR12 3RYRA 4I30A 1CQ9A 1BBT2 3GZUC 1GNHA 2WZR2 1R1A2 2WLPA 4DOUA 1KXGA 3OJBA 3RMXA 1JYIA 3FUOA 4BPZA 4M0NA 1I1EA 4ATFA 1VRH2 3RDIA 3SITA 2QUOA 3ZSLA 2YMZA 4COUA 3FFZA 4XTMA 5HI0A 2XLFA 1DQ4A 4MSVA 1D4M2 3VUOA 1FMD3 2EA7A 4XILA 3S0MA 1KJRA 4AHXA 4DY3A 1XYOA 1DDLA 3LOIA 3IT8A 5GZFA 1A8DA 3T1LA 4XE9A 1OFSA 4AVAA 4CDXC 4IEXA 5AC91 1QJX2 3H7YA 4Y1VA 1UD1A 5GZEA 1WLDA 3V0BB 2H6BA 3HT1A 1PMIA 1WUVA 4Y20B 4KBBA 4ASLA 5I0RA 2OUHA 3OBTA 2D44A 2ZMLA 1WA4A 2EXKA 1N1YA 1Z7S3 2PLV3 4AQ6A 4YFWA 5T5JA 1WW4A 2XB6C 1R081 1LESA 3MI8A 3KT1A 4DXZA 2YHJA 1HXS3 3LZZA 1BZWA 1DGRA 1MS0A 1KD7A 3MGUA 1O4TA 2JJ6A 1S0GA 3KCYA 3MPPG 2H0BA 2D6OX 2ENRA 1HLCA 2Y0IA 1DGWX 4ZU4A 3IN9A 2BWCA 3MW4A 2ZABA 1AR63 4XF1A 4QQHA 4YGEA 1YUDA 2RS32 1RUE2 5KC6A 4FQZA 1RUG3 4R9BA 3O14A 5FTTC 3SH4A 3WY6A 1LEMA 3WW1A 2JG8B 2ZKNA 4XYXA 4QX5A 4CDWA 5FOJB 5EV7A 1C5IA 3AZWA 3AKQA 5JPMB 2D97A 5CNAA 4FOWA 2ATFA 2W39A 3R05A 2WNVC 4WM7A 2ARBA 2PHXA 1BJQA 1GQGA 1H1IA 4X6QB 3ZFEA 3H9AA 2P3KA 3RQ0A 4RHV3 3P3NA 2ZKLA 1VBB3 4UXAA 5DUUA 1MS4A 2R071 3B01A 4XPVA 5CAZA 2XGXA 4AVBA 1I3HA 3D8CA 3ZN5A 1X7NA 4FXKB 4QU2A 2WT0A 4A7YA 3VBOC 1YCIA 4AEKA 3N35A 4IV3C 2ZGOA 4IEVA 2A3YA 2VUJA 2RS51 4FPJA 4EN9B 1AR82 4O9GA 4HPKB 1JHNA 1RUJ2 4I2OA 4AQSA 1DQ0A 4LHKA 5BXXA 4AEDC 2B39A 3UJQA 2A70A 1VLNA 1CAWB 2VGDA 3VDDA 2VXRA 4HKLA 4N53C 4F8AA 3M3OA 4PCRA 4GA9A 5C4WA 1QF3A 3D0SA 3OY8A 1ASJ2 3N4MA 2AENA 4Y5Z0 1OPMA 4B4RA 3AYEA 1ENXA 1R092 2DCYA 3VBUC 3MIEA 1AYM3 5KXCA 3HN1A 3GZTB 3VKNA 2VOXA 5ABJC 4JRLA 2E9QA 1G9AA 2R041 3FZ3A 4JQRA 4LO7A 4OULA 4QPGA 1RUD3 4AFBA 3ZXAC 2ZX1A 5C8CA 2EF6A 1PNFA 4TWTA 3K51A 4Z2WA 1M4WA 4R9DA 4S2FA 3B93A 1QJU1 1BBT1 4NPRA 3RRDA 2TNFA 1FI2A 1GR3A 3RMYA 3VKOA 2WZR1 2JE9A 2ZAAA 1R1A1 4DQAA 3TN92 3ILFA 2GALA 4IEPA 4XIKA 2EAAA 1VRH1 2RMU3 3JU9A 5EFUA 5L7OC 2F6BA 3DN7A 4JDMA 1D4M1 1XU2A 3PVEA 2GH8A 5H9QA 2G9GA 1AJKA 1GYKA 1EV12 5I0UA 2DF7A 2YY1A 3ZN6A 4Y22B 4Z82A 3HAGA 1TNRA 3ASIA 4N43C 2AH2A 2ZX2A 3J8F3 5I8TA 3USUA 3VL8A 4LBQD 4AGRA 3H50A 4AFCA 4NOTA 1AF9A 4HLTA 4CDXB 4I09A 1QJX1 1Q5OA 2YDEA 2PHWA 5CBLA 1JH5A 4BE3A 4G3YC 4LBKA 1H4HA 2XLGA 5A3MA 4GWMA 2PAMA 3ES4A 1I6XA 2R16A 2W52A 1RJ7A 4A3XA 3GYDA 1MQTC 4GULA 3SLIA 4XF4A 4LBQA 4P9LA 3VL9A 2DFBA 2X53S 2K2SA 1L3JA 2UWCA 3DPRB 3SCGA 4PLOA 5BNOA 2H0VA 3TNQA 5FMOS 4Y4YA 4YW1A 1SBFA 3NV1A 1CAVB 4E4DX 1SMVA 3VHNA 1NA1A 3WG1A 2WLQA 2PHDA 3IPVA 4O9EA 2BNMA 1NE6A 4AGVA 1SLIA 1TMF1 4LTAA 3TYJA 5J09A 2YXSA 2E7AA 3U07A 5FO7B 4N7IA 3LCPA 1LRHA 1XYPA 3PTYA 5DZGA 2R6QA 5C9AC 1I9RA 1WCSA 1A6CA 4YM1A 2RS31 3EJKA 5KHJA 4QGNA 4KU8A 1ND2C 1JUHA 1YRZA 1SDWA 4L2NA 3B94A 4KWLA 1JXNA 2GSYA 4Q4X2 3POWA 4XFIA 1HRV3 1LHWA 1KS4A 2IFWA 4IXLA 2WS91 2WNVB 5BY5A 4EN6B 4YLZA 1DGWA 1XXNA 2ES3A 2VH9A 3E6DA 2GC2A 1W6MB 1EAH3 1ENQA 3PVNA 4JGZA 1W6OA 3ZX7A 4EWEA 4LA2A 3AP5A 2QCSB 2Q1ZB 1Q8SA 4G9SB 3A0NA 4OHZA 2OIIA 1YFXA 4Q29A 3MF9A 4IERA 3VBOB 1AR93 4XFFA 2XL9A 1COV1 4OI2A 5FBZA 2RM23 4IV3B 4XQWA 4FP2A 1EPZA 2EIGA 4ORFA 3FJSA 3MIFA 3R4DB 4GKXA 4OHXA 1NCRB 3JD71 4HN1A 3V0BA 4Y20A 4C0BA 1FNZA 4HK8A 2DV9A 5SV8A 5KHHA 1WBFA 3SH5A 4COZA 4YG3A 2HWD3 4N53B 2ZS6B 1S0BA 2FMDA 1C57A 4FCAA 4HVQA 1BMV2 1VBD1 1YNAA 1ASJ1 1W6PB 4LBLA 5C6CA 2W68A 3AMMA 3KCXA 5T5PA 1WD4A 2Z42A 5JWPA 1R091 4IEUA 2PFWA 2OZ6A 4BWOA 1RUC3 3UJOA 2R0HA 4H3WA 4YW2A 5EYXA 4P9IA 4F83A 2Q4SA 4YARA 3AXDA 1PK6C 4YM2A 4YW5A 4YYOA 1H8TC 2D3PA 3MW3A 4ES8A 3W58A 2X29A 1N1TA 3C2UA 2QZ2A 5FRAA 5H9PA 3WQ7A 1YLLA 2JG9A 2UWAA 3WD5A 1F9KA 4KGQA 4DINB 1V9U3 2DUPA 1QXRA 3WCSA 1NCQC 5L7OB 1J3PA 1CAXB 1Y3TA 2PA7A 3D4KA 4QHBA 4H14A 1IS5A 2YPJA 2QJVA 1NQJA 1EV11 1YJLA 1U5YA 1RHI3 1KRIA 4XJAA 1UZYA 4N43B 5C8WA 1HXS2 1OOPA 3K48A 5LK5A 4ZU5A 3WDUA 3PMSA 5BNPC 4TSVA 2VUAA 4BMEA 1GZWA 4FTBA 4LR4A 4TZDA 3H3UA 1C8NA 2O8OA 2DUQA 2YC0A 3M8LA 2BW8A 1AR62 5F1RA 3AP6A 4HPKA 4AVTA 3I59B 2P37A 4RL7A 4TYSA 3N7MA 5JOYA 4J1XA 4YVWC 4COWA 1U5XA 1IPJA 1RUG2 2DCJA 1YFYA 2IWGB 2XVLA 2WFPA 5CADA 2GAUA 1F31A 4EV0A 2XJVA 1H8VA 4SBVA 1FNYA 3OF1A 2VNRA 3UKVA 1DQ6A 5FPXA 1UAIA 3WVJA 5AC92 4ISQA 1QJZA 4QQPA 4UW3A 4BIOA 1Q8VA 3BB6A 5D8AC 4IV1B 4URTA 1J58A 4Q8KA 2X8KA 4P9WA 4UW4A 4MX3A 2ZOEB 1ONAA 5C9AB 4S2GA 5CFCB 4ATEA 1O3RA 3ETQA 4XFBA 2XBO1 1Q43A 2R32A 4RGGA 1REDA 3NAPC 3AYDA 4YW3A 1ND2B 4LUMA 5J96B 3LA3A 2K9ZA 3RSJA 3WG2A 4Q4X1 4PDWC 1DGLA 3FE5A 3SCHA 1O5UA 4PBOA 5HXVA 3AYCA 1RJ8A 2D3SA 4QGMA 2WNEA 4CP1A 4IETA 4JRAA 5TSWA 3CJIB 2GMMA 1ZZ8A 3LA7A 1H9WA 4RR3B 3AZZA 5J37A 2PELA 4Y22A 1XYNA 3VBHB 4JDNA 1AYN3 1UZZA 1IKQA 1ZZ7A 5JI9A 1Y9QA 2SBAA 3MLKA 3CO2A 1AYM2 1PZ9A 3JQXA 1VBE3 4MXWB 1BKZA 3FBYA 1SLTA 1J3RA 2I45A 4QT6A 2VNGA 3UK9A 1I5ZA 4E2SA 4HVOA 3N7LA 4PIYA 1PO22 1LOBA 1WGPA 4K1YA 3VBSC 2R072 1ULGA 1TME3 3LA2A 2PHLA 4CP2A 5DUVA 5E89A 2D3RA 2HWC3 5IK4A 3DPRA 1NG0A 3QCWA 3SHRA 3N7JA 4A7KA 1C1FA 4IEOA 1O4YA 4E2QA 1CAVA 1V6OA 4JDOA 2PN5A 1QXPA 3GZAA 4YSFA 2GDFA 2VULA 1ENRA 2ZGLA 1WMFA 4Q4Y3 4KWJA 1QNWA 4YZ5A 4XDQA 4YVSC 1DYKA 1KQRA 1WW7A 1QJY3 1W39A 5CVRA 3MIHA 1R1ZA 1YI7A 3ZFGC 1OA3A 3J8F2 2IXKA 1WD3A 5FFOC 1OLQA 1PK6B 5JSOA 5LEKA 4D3WA 1KITA 2KA3A 1LU2A 3GBFA 2HWB3 3HMYA 3WV6A 5JIUA 1OHFA 4ASMB 2QFEA 4H7LA 2AR6A 4LA3A 4GB33 3ILNA 2TBVA 1YHFA 4H55A 4U2AA 2RHPA 2WNVA 4I0AA 4XQDA 1GFF2 1QMJA 1X8EA 4Y26A 1NCQB 4K9SA 4F7ZA 3R6SA 3ZSMA 5JAXA 1W6MA 1C4RA 2DWRA 2F4PA 2PLV1 4XBQA 2LM3A 3DKWA 4TLFA 2ZACA 3LAGA 1OPOA 1C8M3 4GMP3 2VOWA 1QJU2 1HXS1 2A6WA 3OGJA 3I54A 4K40A 1M06G 1VALA 4K7JA 2Q1MA 1H0BA 1PVC3 1EPWA 4LLOA 5KC5A 2Z5WA 4MUVA 4IV3A 2RJKA 1B09A 2DTWA 4DRRA 1NOVA 5F6KA 1NCRA 4K20A 2DURA 5GLZA 5FO9B 3N7KA 1AR61 3TWIA 3J9SA 1HV0A 5JI7A 2VOKA 1MEC3 2VQ0A 2ZGRA 4FPOB 5A32B 2ZA9A 4P9JA 2CGNA 1RUG1 2OA2A 2WWSA 2Z79A 4JTNA 3ZFFC 3L9JT 4RS5C 1J1TA 5JR7B 3MPBA 1G9DA 2VOVA 5FLJA 1POV3 4Q0SA 4EN0A 3WHUA 1W6PA 1JUIA 2ETEA 2VPVA 2CYFA 2VNOA 4WM8B 2X5IC 2MPFA 5D8AB 1WLTA 4Z07A 3O12A 3ILRA 1BK1A 4FSJA 5T52A 1CIWA 1PGW2 3SISA 1VBB1 1UIJA 2E51A 1FOD3 1V6IA 2AZ5A 4OUMA 2GC0A 2ZGTA 4BOWA 1RTVA 3AX4A 4YG0A 5B2GB 3IMNA 3VKLA 1PIV3 4XF9A 1SQ4