3ZFEC

Human enterovirus 71 in complex with capsid binding inhibitor win51711
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
242
structure length
242
Chain Sequence
b'GFPTEPKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRDGPWQSTMLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDTSHILQTASIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure of Human Enterovirus 71 in Complex with a Capsid-Binding Inhibitor.
pubmed doi rcsb
molecule tags Virus
total genus 39
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zfeC00
3VBFA 2HWF1 1AR62 1NG0A 1OOPC 1TMF3 1RUE3 2HWE2 3FBMA 2R062 3VBRA 4CEWC 1ND2C 1HXS3 1AYN2 1RUJ3 5DDJ1 4CDUB 5GKAC 3VBHA 1R093 2BFUS 4N53A 2R061 1C8NA 1AR93 1TME2 4Q4X3 4IV1A 4WM8B 1R081 1AYN1 4GB33 4RQPA 2ZTNA 1EAH2 1X36A 2R043 1TME1 4CDUC 1RUH2 3JD71 4GMP3 2WLPA 1RUC3 4CDWB 4GH4B 4JGYA 3HAGA 2HWB3 3VBFB 2RS51 4Q4W3 1RUH1 1PO23 3JBG3 4N43A 3VBRB 1HXS2 1RUJ2 5D8AA 3VBHB 5CFDC 1VBB1 5A32A 5AC91 1R092 1K5MA 1VBD1 4N53B 4CDWC 1NOVA 4GH4C 1DDLA 1POV3 4IV1B 1IHMA 4RQPB 4GB32 3ZFFA 4QPIC 1D4M3 4Y4YA 4CDXA 3VBRC 1B35A 5BNPC 4QPGA 3VBHC 4Y5Z0 1RHI1 1RUC2 4IV1C 4FTBA 4JGYB 2HWD2 1ASJ2 1NA1A 1PVC3 2WS93 4RQPC 1MEC3 5C9AA 1V9U3 1VBE1 1OOPA 1ASJ1 2HWD1 2WFF2 5D8AB 1AYM1 1C8M1 3VBOA 5A32B 1BBT3 4CEWA 1NCQC 1QJU3 1ND2A 1K5MB 5L7OC 4JGYC 3CJIA 2GH8A 2RM23 2WFF1 1RUI3 2PLV3 4CDXB 2WZR3 1B35B 2FZ2A 5D8AC 4QPGB 2RMU3 1K5MC 1PGW1 1Z7S2 1ZBE3 1M06G 4YVWA 3TN93 1NCRC 2WS92 4CDXC 1MEC2 4RHV1 3DPRC 1B35C 1QQP3 5C9AB 1V9U2 5A33A 1Z7S1 4QPGC 2RS31 2RR12 1HRI3 1RUG1 4JGZA 3JB4C 3VBOB 1FMD3 4CEWB 1FPN3 3CJIB 5CFDA 1PO13 2RM22 2MEV3 2RR11 1RUI2 2BBVA 1RUD3 1VRH1 2PLV2 4Z92B 5C9AC 1COV3 1QJX3 2RS13 1RB8G 1RMU2 1PIV2 4QPIA 3VBOC 1ZBA3 5BNPA 1QJY2 3LOBA 1AR61 3CJIC 2HWC2 4YVWB 1RMU1 2HWE1 1PIV1 4FTEA 1AUYA 3VBSC 2TBVA 1QJY1 1QQP2 5A33B 4CDQA 2HWC1 4FTSA 1HRI2 4JGZB 3ZFEB 1FMD2 1FPN2 4YVWC 1EAH1 5CFDB 2ZAHA 1PO12 1NCQA 1FOD3 2MEV2 2XBO3 5JZGC 5L7OA 2VQ0A 2X5IA 1VAKA 2RS12 4WM7A 1TMF2 1RUE2 4JGZC 4QPIB 2R073 3ZFEC 1R1A3 1ZBA2 5BNPB 2GSYA 3VBUB 1RUF3 3IDEA 1TMF1 1RUE1 1CJDA 4GMP0 5CFCA 4LLFA 1AR92 4Q4X2 1HXS1 1ND3C 5ACA3 1RUJ1 1NCRA 5C4WC 4CDQB 1R091 2R042 3S6PA 3DPRA 1AR91 4Q4X1 1WCDJ 3VBUC 4RR3C 1EV13 4GB31 3ZFGA 3J8F3 1CD3G 1NCQB 2R041 5L7OB 1BEV3 1POV0 2HWB2 2X5IB 2QQPA 2BUKA 4Q4W2 4CDQC 1AL23 1AR73 4GMP1 4WM7B 1PO22 2R072 3JBG2 1RUC1 1AR83 5ABJB 2HWB1 4Q4W1 3JB8A 1RUF2 1VBA3 1PO21 3JBG1 4RS5B 5CFCB 2X5IC 1VBC3 1NCRB 4WM7C 1D4M2 3VBSA 1MQTA 1RVF3 3DPRB 5ABJC 1POV1 1PGL2 1HRV3 4Q4V3 4Q4Y3 1EV12 3ZFGB 1D4M1 2XPJA 4RS5C 5CFCC 2HWF3 1BEV2 1PVC2 1AL22 1AR72 5JZGA 3VDDC 2WWSA 5DDJ3 1AR82 1F8VA 1PVC1 2WS91 3ZFGC 3ZFEA 1MEC1 1BBT2 2R063 1QJU2 4YVSA 1V9U1 1R083 4PDWA 1AYN3 5FOJB 1VBC2 5BNOB 1BBT1 3VBSB 1MQTB 1QJU1 1HX6A 1TME3 1RVF2 2WZR2 1ND3A 1AL0G 5C4WA 2RM21 2RMU2 3JD73 4Q4Y2 1RUI1 2PLV1 5C8CA 3VBUA 2WZR1 4RR3A 1ZBE2 4EJRA 2RS53 1RUH3 3TN92 5BNOC 5BNNA 2RMU1 1MQTC 4IV3A 5JZGB 5J98B 1ZBE1 5DDJ2 5FMOL 1VBB3 3TN91 5AC93 4AEDA 1BMV2 1VBD3 4YVSB 1QQP1 5J96B 1R082 4PDWB 3ZXAC 1HRI1 1RUD2 1BMV1 1FMD1 1COV2 1QJX2 1FPN1 1ND3B 5C4WB 1PO11 3NAPA 2MEV1 1HQNA 3JD72 1RHI3 1RUD1 4YVSC 5ABJA 5C8CB 1QJX1 1COV1 2RS11 4PDWC 4RR3B 2RS52 1H8TA 4BCUA 4CEYB 5BNNB 4RS5A 4IV3B 1F2NA 1ZBA1 1OHFA 1VBE3 1QJZA 4WM8C 1VB4A 1ASJ3 2HWD3 1AYM3 1C8M3 1VBB2 5AC92 4AEDB 1VBD2 3VDDA 5C8CC 2BFUL 2DF7A 1A6CA 2FZ1A 3M8LA 2WFF3 4CEYC 5BNNC 1FOD2 4IV3C 2XBO2 1NY72 1SMVA 4NWVA 3VBFC 2Y26A 3NAPB 4AEDC 1FOD1 2XBO1 1R1A2 1NY71 1RHI2 5K0UA 1E57A 1H8TB 4RHV3 2R071 4N53C 1R1A1 1VBE2 1Z7S3 5ACA2 5BNOA 2RS33 3NAPC 1RUG3 1RUF1 1AYM2 1C8M2 2BPA2 4NWWA 1OPOA 1X33A 3VDDB 4N43B 5ACA1 1GFF2 1H8TC 2RR13 3J8F2 5LK7B 1VRH3 2ZZQA 1PGL1 1EV11 3J8F1 3ZFFB 4N43C 5K0UB 1BEV1 1AR63 1PGW2 1RMU3 1W39A 1AL21 1PIV3 1AR71 2HWE3 1VBA2 4RHV2 5FMOS 4FSJA 1QJY3 1AR81 4CDUA 2HWC3 2RS32 1NA1B 1RUG2 3ZFFC 1VBA1 5K0UC 4WM8A 4RFT0 1HRV2 4Q4V2 1EAH3 1VB2A 1VBC1 1OOPB 1VRH2 1RVF1 1ND2B 2HWF2 4SBVA 2IZWA 1HRV1 4Q4V1 1NA1C 4CEYA 4Q4Y1 4CDWA 4GH4A
chains in the Genus database with same CATH superfamily
1GBGA 2BP6A 4YYOA 1BCXA 3VBFA 2HWF1 1AR62 2ZMLA 2MHFA 4IE5A 4BYYA 3GJBA 1UY4A 1TMF3 2HWE2 2VVFA 3FBMA 5A7NA 4MGKE 4M3CA 1PK6C 4EYUA 4FOWA 2OT7A 1HXS3 3VHOA 4JKKA 3VBHA 3V65A 4AK3A 1V70A 1DYOA 3HEIA 1R093 1LB2A 3AKPA 1SLLA 4MXVA 3ZR6A 5A3MA 3L2HA 1W2UA 3RZHA 4OMDA 1WW5A 4BQ1A 4QB2A 2E7QA 1R081 4FO9A 2BYVE 4XF0A 4GB33 2XHNA 4RQPA 1EAH2 4E27A 2DDUA 4XQWA 5I91A 1C3HA 2QQKA 4QAWA 1UKRA 4AW7A 5EYXA 4V1PA 5JXGA 4Q5OA 2XH6A 2YC2A 3JD71 1OKQA 4AFAA 2VOWA 2ZEYA 2EIBA 3AL6A 3T2QA 1JBCA 3WF1A 1RUC3 4CDWB 2XHKA 3FUOA 2DVGA 4JV4A 3HAGA 3VBFB 3WCRA 3NRUA 1RUH1 2JD9A 5FDBA 3MFCA 1UD1A 4P9IA 1W9SA 1H1AA 2QUOA 2ZZJA 2YUEA 3JBG3 4M3CB 5A7PA 3LCPA 4MX3A 4U36A 4D7SA 4XF4A 2EAAA 4HETA 3RZMA 3SNMA 3GGLA 1XYNA 1HB1A 2HLEA 3LSEA 4XAAA 5DPNA 3VBHB 3NSTA 3VHNA 5C33A 1PMHX 1Q3EA 3PVNA 5IVYA 4AGVA 1NOVA 4MZUA 3N3HA 2CDOA 2CAVA 4D7TA 2B9UA 4QKBA 5IHRA 3NV2A 4JC1A 5LA2A 4RQPB 1DYPA 5F6KA 1TE1B 4UFMA 4Y4YA 3JU9A 1I5PA 3N9LA 1QJFA 2ZMNA 3CIHA 4MO3M 5L73A 3HPNA 4AFDA 2QKDA 3IN9A 4CCDA 5BNPC 5CNAA 5A3UA 4OUSA 3AXDA 2NMOA 3ACGA 4AAXA 4FXGB 3C7GA 2D7FA 3ZKUA 4DY5A 2GC2A 4XIKA 2GAUA 3H42B 3EJKA 4FBFA 1GOHA 2JB8A 1L7RA 1L7QA 1KFUL 3IZOA 4IV1C 3ZM8A 2HWD2 2QNKA 2CDPA 2PAMA 5KXEA 4XFBA 3PMSA 3AMMA 4EN9B 5C9AA 2D5HA 4QQHA 4CCJA 2YU2A 1MS9A 3LQCA 4AVCA 1NLSA 5SV8A 3ATGA 5HXVA 4OZXA 3VKLA 5K7PA 3Q8AA 4BXFA 1ND2A 4YM3A 3UNPA 2XJUA 4AHWA 2XLFA 4GWNA 2IUWA 2R32A 2WFF1 4CDXB 1QH6A 2WZR3 4AFCA 4S2FA 3T0DA 2ZGMA 1OC1A 1W3VA 5CKQA 1LOFA 1ZRIA 1SEFA 1O4YA 1DGWX 1LOCA 1GMMA 2CGNA 1ZRFA 5FKCA 4ZU7A 5GALA 2ZGRA 3GYDA 2C26A 1G9FA 3CMGA 4Y1XA 3SQOA 3IPVA 3WUCA 1O4ZA 1VP6A 1GV9A 4I3PA 2W68A 2L9LA 1SLCA 4YVWA 1Z0HA 4D6QA 4IEWA 1U5IA 1MS0A 4XDOA 4O9EA 5J36A 5LB6A 5FO8B 3DPRC 2Y6FA 2DCZA 4UW3A 2W94A 1GNYA 1LGBA 1V9U2 2NYYA 5GLTA 1LTEA 5A33A 1DBNA 3FLRA 3ZSJA 4ASKA 3L2YA 4BQYA 5JR2A 4MG2A 5CBLA 1HRI3 5F3GA 2W2IA 5C7GA 2XWBB 3NJZA 3O14A 4JAAA 1JYCA 4HONA 4JDOA 1OURA 3MPPG 2MEV3 3HVDA 1RUI2 1LHNA 3AZWA 3FFZA 2PLV2 4URAA 2XJTA 1W8NA 4Y20B 2GDFA 2RS13 1SLTA 1APNA 3AFGA 1LOGA 4W8JA 1UF2C 1LESA 2JDMA 1RMU2 4C90A 4QPIA 4TTGA 4MGTA 1HB2A 4CP9A 3FWEA 5FXZA 5T55A 2PHUA 2IFRA 3LOBA 5APAA 2VOKA 1Y3TA 1W6PB 4OUMA 2YMZA 3IPVB 1XE8A 2VNGA 4YVWB 5F6LB 1PIV1 3ZXGA 5GZDA 3W5NA 4LHSA 1JUHA 2GNTA 2PHLA 3WNKA 1KEXA 3SKJE 3I8TA 1UZZA 1QJY1 3V0BB 3D6EA 4B8EA 3WG2A 5A33B 2IXCA 3HNBM 1S0GA 2VW2A 1JZ8A 2VTXA 3ES1A 2WA4A 4XDPA 3GM8A 4IL7A 5FZOA 1FMD2 2ZGLA 1ZA4A 1OLMA 3BYWA 4WBBA 4OMCA 3TAYA 1X9PA 2ZS6B 1C28A 4C0HA 3WF0A 5CG8A 1F9KA 3AL5A 4XF1A 3WG1A 4DMIA 2ZAHA 4LBMA 1PO12 2RDRA 5I0RA 1Y43B 4JQTA 3BIWE 5L7OA 4O7XA 5DUXA 4OHXA 5LA0A 4GALA 4L9BA 1AJOA 2QVSB 2VXRA 1K3IA 2XDVA 4XXPA 4KWLA 4QD2A 4F7ZA 3LB9A 4WM7A 1RUE2 4JGZC 4QPIB 4PI2A 2R073 2A70A 4N7UA 4Z07A 3RDIA 5CEHA 1F5FA 1R1A3 2VC9A 3T08A 4YGBA 1UL9A 4TWTA 2GSYA 4DUXA 3VBUB 2A1XA 4RD7A 1WCQA 4AEJA 1TMF1 3LDKA 3ITQA 1W8FA 4LLFA 3B93A 2E7AA 4YM1A 1HXS1 2W1WA 4LK7A 4YFZA 1H4GA 1R091 2JDPA 3ACLA 3AYDA 1RC6A 1X8MA 3LEKA 3NWKA 4HSJA 4CDXA 2F4LA 1ZA7A 4AI9A 5DAQA 5IVCA 5FZOB 2PYTA 3TB0A 1WCDJ 2YBSA 4RR3C 4FPHA 4GB31 3ZFGA 1X9TA 3N9OA 1CD3G 5FZEA 1GP5A 2PFWA 2YGMA 2ZGPA 1WW7A 4LIVA 3WZ1A 3O12A 5L7OB 1CGPA 5CAZA 1POV0 2QQPA 3I7DA 4Q4W2 2FQPA 2G19A 1VALA 5BNQA 3SEEA 4WM7B 3SITA 1PZ9A 4B4PA 5F3CA 1W0OA 2VTXJ 3KZ4C 1RUC1 5A6ZA 4E4HA 3KF3A 3ELNA 1H0BA 3KCXA 2VUCA 3OYWA 3O1TA 1LGCA 2W95A 3EXUA 1RUF2 3RZLA 5CA6A 4HK9A 3JBG1 3D5OA 4RS5B 4CUCA 5F3EA 4Q26A 1WW6A 2X5IC 2YC0A 3GCXA 2XQRA 1DQ5A 3JCIA 5LATA 1ZYBA 3INAA 3ORJA 3WNLA 4ZKTB 1WCUA 2D98A 3VBSA 5I8SA 3M7AA 1KS4A 4LO6B 4P5HA 3N9QA 1RVF3 1KDKA 1UY2A 3NJVA 4GZ9A 4ITCA 4YRDA 1UAIA 1UMHA 4Q4V3 3H0OA 4HANA 4K1YA 4S2GA 3B02A 5E88A 3ZFGB 2DV9A 3NNLA 3THDA 4P02B 4XUQA 2CYFA 4AHYA 2XVLA 3M3OA 1F5JA 1AL22 2P5BA 1AR72 1CJPA 4LA2A 3LDRA 2JICA 5IWFA 3VDDC 2DYCA 2HEVF 5DDJ3 2KM2A 2NMNA 1F8VA 1DHKB 5T54A 1AZDA 3OYWB 3FFQA 2BEOA 1V6KA 1LHUA 2DVFA 5A7QA 1BBT2 5A7WA 3ZFEA 1QJU2 1WUVA 1O5LA 4YVSA 4YWAA 4CU8A 2W52A 3BU7A 3RMXA 5FZ7A 2DFBA 1SLBA 1UN1A 3OEAA 4AVTA 4EWEA 1W9TA 4N9HA 4ATFA 3M3CA 4CCCA 3K4ZA 3LA2A 1V00A 3O0XA 1XPWA 3VBSB 3H50A 1BXHA 4PIXA 1HX6A 4AGRA 3PDQA 2YPDA 4OHYA 2Y8KA 1LHOA 1F35A 3CNAA 4W6WA 1KGYA 1CVNA 5JPNB 1O5UA 1G86A 4XACA 2JECA 5F39A 3PVBB 5D1IA 1S0FA 2ETEA 5C8CA 4MGQA 2WZR1 1ZBE2 2XL9A 4EJRA 1JZ6A 2ZGOA 1SPPA 2FCUA 5CADA 4EN6B 4FPCA 4YZ5A 3K4AA 1QH7A 2VZVA 3NKGA 2Q0AA 3TN93 5KXCA 2VECA 4TLFA 1H2MA 4LO8A 3B00A 3T3YA 5FMBA 4ES8A 3HJRA 5FYSA 1TVGA 1Q43A 4FQZA 3TOJA 4NMIA 5A7WB 4OHZA 4H7LA 5FBZA 4YVSB 3A22A 4ET7A 1ODMA 2K46A 1JZ4A 5KHKA 2CY6A 4XILA 1XRUA 3I97A 4R8HA 2RVAA 3WW1A 1HRI1 3T2PA 3AYEA 1BMV1 3JZVA 2EXIA 2W08A 5CZKA 1HKDA 1QJX2 3KV9A 3KS7A 4QU1A 2A6VA 1PHMA 3P6BA 3AZXA 1JZ3A 2MEV1 1HQNA 3DV8A 5IK5A 3DEMA 5ABJA 4MH0E 2PAKA 3T30A 5EZWA 5C8CB 2RS11 5M0TA 2V73A 2IXKA 4WZFA 3D0JA 1J59A 4CEYB 4N7IA 5FY4A 2D40A 2GMEA 1BVVA 3I2KA 4C91A 5C3QA 1VB4A 1DZQA 2HWD3 4TLGA 1QXJA 3MICA 3AMNA 3BOWA 1VBB2 4CTEA 2WT1A 3AXEA 4CXYA 1OH4A 1REFA 2ZEXA 1H2KA 2ILMA 1FV3A 2FZ1A 3K75B 3M8LA 4P5YA 4QT6A 3T4VA 2R16A 1ZNPA 3BTZA 3QBQA 3U07A 3VZJA 1UWWA 2XGXA 3ZYHA 1O6UA 3B3QE 5DQ0A 4XZUG 1WD4A 2QZ3A 1OD5A 2HKXA 3WP5A 1LR5A 4R52A 1EYBA 3WLUA 5LEJA 1TNFA 1NY71 1T6GC 1UU5A 2VZRA 1PVXA 4IGPA 2Z4FA 3CQOA 2D6LX 3J26N 4CVUA 5L9VA 4Q29A 5AVAA 4URTA 1JU4A 2R071 3GZAA 3J7LA 1OLQA 1R1A1 1UYYA 1S0JA 4CCNA 2VZUA 3J4UH 3LZZA 2JDKA 3O1SA 2JG8A 4OQ8A 4Y33A 4KGGA 1GWLA 2RJKA 3LAGA 4J1WA 2FDHA 3PLQA 4L92A 5JOYA 4NWWA 2WT2A 2PQQA 5KXBA 2A71A 4CCKA 1SG3A 1XU2A 1NZCA 2ZX3A 4N43B 2IC1A 1ENXA 2WN2A 4JRLA 2DVDA 1UNBA 2C4XA 5A3NA 5LK7B 1XQNA 2ZZQA 1CX1A 2AYHA 3AKRA 5DG1A 2ZPXA 3W58A 5L19A 4NIAA 1I5ZA 5J3UA 4PT6A 5FUIA 3WDYA 3G7DA 5J1XA 1TEIA 4IEPA 1NE4A 1V6JA 2J1TA 3NV1A 3BTYA 3AJYA 2K0GA 4NPLA 1RL3A 3R4SA 2Q8OA 5HCFA 3E5UA 3MF6A 2DCTA 1FAYA 2YB7A 1WBFA 2JE9A 3USUB 1RMU3 2CGPA 1NUKA 1DQ1A 1VBA2 4RHV2 3ZDSA 1O8PA 4EROA 5C3PA 4LT5A 2R1BA 1ZZ9A 1Q8VA 2OQ6A 2ZEWA 3K46A 2JG8B 4KI5M 4UBHA 2VTFA 4AVAA 4CDQC 2Q1FA 2RS32 4Q1PA 1IS6A 1NA1B 3PUHA 1N1TA 4EWDA 5I93A 4ASMB 5EJZB 1CZVA 1LENA 4CPBA 3I2OA 4GXLA 4D8MA 1HRV2 4KWJA 5FZ1A 4EV0A 2BWAA 1RVF1 4OI0A 3WW4A 1PK6B 1JI6A 3OGJA 5LBCA 5KC5A 4RA0A 4ZU5A 4Q4V1 1EP0A 1GWKA 4HVQA 1KJRA 3BIEA 1DIWA 5A7OA 1SACA 2JB4A 5FCCA 4GAZA 5FWEA 3AB0A 4E9KA 2K2SA 4NAOA 3WHUA 2ERFA 2GALA 1SLIA 4QX7A 4XFAA 1NG0A 2HEWF 5FIXA 4AXOA 2OKXA 1RUE3 3MZHA 5JCTA 2R062 4YSFA 4Y4RA 4CEWC 1JOJA 4AVSA 3RS6A 3HBKA 1R64A 1IPJA 2OX0A 3WQBA 1AYN2 1RUJ3 1ENRA 4NN0A 2R7EB 5DDJ1 4R4XA 5GKAC 4CSWA 1W6QA 2W1UA 1OBNA 1POQA 1F31A 1YI9A 2WO3A 1BZWA 1C8NA 4FFIA 4IGOA 1YO8A 3H7JA 2JG9C 2OZJA 4JQRA 4BJ0A 1EY2A 4IV1A 5EXOA 4AEKA 3KB5A 2VUDA 1LU1A 5KXDA 1WGPA 4IEYA 2WZPP 1YNAA 1X36A 3C7FA 4IW3A 1CONA 1C5IA 1H2NA 2WL1A 3F95A 1UIKA 4QWNA 4LBQA 4CCLA 2DCYA 1HN1A 3J7HA 1W2OA 3DKQA 1C1LA 3KSCA 2WLPA 1Y4WA 1K5JA 2G4IA 2B46X 4LA3A 4DZGA 3E6BA 4FPLA 3A0NA 1BQPA 4Q4W3 4BXSV 1UOJA 2XMLA 4UFKA 5FZ4A 4CU9A 5A1AA 4L0PA 3E97A 4BK4A 3WT3A 3GBGA 5CKMA 2J7MA 4COWA 5CFDC 4J6GA 2Q5TA 1W6QB 2MNGA 1YQCA 3IM0A 4YGEA 3ABZA 3V64A 4EQVA 3WDXA 1W03A 3WNOA 3NNFA 4CXXA 5DAPA 1POV3 1WA4A 4XOGA 4HG6B 4IV1B 2QQVA 1CIYA 3H3UA 5JXJA 2WZ8A 2XKPA 3ZFFA 1HIXA 2B7YA 4ORFA 2WQ8A 2R6QA 2ZKNA 4C0BA 1UYXA 4XUPA 1A34A 1YUDA 1XBFA 3D0SA 1DGRA 4RN5A 1YFXA 4L8QA 1IKQA 4Y5Z0 3GALA 1IQDC 4B3NA 3ZKYA 2LW8A 2CHHA 4DEVA 3HD8B 3QCWA 2WS93 4NVPA 2WUHA 4QX3A 1MVQA 5FPVA 3WY6A 4FOQA 2BQPA 1SDWA 3PJYA 3FE5A 2W87A 1OOPA 2HWD1 3WP3A 3CF6E 3V56A 4Y1ZA 4AEMA 4HLTA 1BBT3 5F9TA 1NCQC 3SC7X 1QJU3 1W9WA 4LBOA 3UK9A 1N3PA 2OVUA 1NXMA 3ZYJB 2GH8A 1PZ8A 4QDQA 2I74A 3BB6A 1UMZA 2CWSA 3IKWA 3K3OA 5T52A 1J1LA 1EUUA 5FV3A 2QDRA 1A78A 2BV4A 3MV11 2V72A 2SLIA 3PURA 3LD8A 5C71A 1ULPA 1H8VA 2WIIB 2FZ2A 5D8AC 3E5QA 3EO6A 5K9YA 4FFFA 2EIDA 3W5MA 2J1RA 1GR3A 3PJQA 3SCGA 2IXLA 3ILNA 1ZBE3 1NT0A 2R49A 3BCWA 4AYUA 4YW5A 2FMYA 3B69A 5JLVA 1RYYA 1UXXX 4FVVA 2V4VA 1HQWA 1MEC2 3BGAA 5I8YA 3ILFA 1IS5A 5FZCA 5LEKA 3ZN6A 4M0HA 3AMPA 3RZKA 5FP3A 4QPGC 5TSWA 3THPA 5JMOA 2EICA 1K42A 3NVCA 1DF0A 1SBFA 4HFSA 1XC6A 3JB4C 1HJFA 4JGZA 4NPMA 5T5OA 2XUMA 3WNPA 3PIGA 3LSDA 4IQPA 1LGNA 1FPN3 3PVEA 5DN2A 3V0AA 1I9RA 2BWCA 1K12A 2DBIA 2RM22 4Q2FA 3TYJA 1ALYA 1EUTA 2EIEA 3D82A 3SISA 1Y7BA 1EPZA 3LIHA 3VKMA 4EN8B 1A8DA 5L9BA 3WUDA 2BBVA 1TG7A 3UESA 4JHTA 3I2DA 1QJX3 1VLNA 1CZTA 2CTVA 3I2FA 4UAPA 4QX2A 2XJRA 4XZPA 4A7YA 1RB8G 2VZ3A 3SH3A 3DECA 3ZPYA 5F8PA 2JKBA 2MPFA 4BWOA 1DP0A 3U0ZA 2AEZA 4FPKA 4QKNA 5FP7A 5LBBA 2DTWA 3OSDA 3VKOA 3WP4A 3SCHA 4QHZA 1YEWA 4NHYA 3CJIC 2BVBA 2Y6KA 3T2OA 1RMU1 2Y33A 2VGDA 3FN9A 3LPFA 1GUIA 1AUYA 4FTEA 4Z8BA 3SEPA 1GZWA 3EHKA 1RJ7A 5D2AA 4E8DA 3GJAA 3ZN6B 1QQP2 3MUZ1 4BDVB 5GLWA 2VO5A 4M0NA 4FFHA 4AI0A 4P9JA 1FI2A 1YRZA 4QGMA 4JGZB 4LO4B 2ZGUA 1US2A 4DB5A 1LOAA 3I54A 3HQUA 3Q8BA 1YC61 2VULA 1SFPA 1S0DA 1YQ2A 3KCYA 5A3WA 3V0AB 2ZGTA 4LUKA 1OD3A 1UIJA 1YFWA 4YW1A 3HWJA 3U1XA 3DF0A 4M01A 3ZN5A 2RG4A 2XVGA 2HEYF 2X5IA 4UWDA 3PHMA 1VAKA 3LFIA 2A5ZA 1PZ7A 3K48A 5FZ9A 4V2VA 2ZGKA 3RZGA 1S1AA 2KXLA 2WNUA 2ZGNA 3ZXJA 5FFOC 1BYHA 3POEA 4O61A 1ZBA2 3WR0A 5GZCA 1O3RA 5E16A 2FCVA 3ZOIA 1JYXA 1D0GA 1N3OA 4HVRA 1LCLA 1RUE1 4GMP0 3N7MA 3GXUA 3WQ0A 1JUIA 3MW4A 3IMMA 3C7OA 1GZWB 1YCIA 2EF6A 3UYJA 5EV7A 4X8PA 5FYTA 3VDCA 5JWPA 1ND3C 1OVPA 1RUJ1 1NCRA 1JHNA 2HBTA 5C4WC 3DYPA 4YARA 1ODNA 3AFKA 3ON7A 5IFPA 3GBFA 1EPWA 1X8EA 3I2JA 3S6PA 3CKHA 1Z78A 5A6YA 1XU1A 2DVAA 2D3PA 2ET1A 2YFZA 5IVBA 3SLIA 4PQQA 4DXSA 1GP4A 2DTYA 4QU2A 3ZN4A 3M2MA 2YXSA 4GWJA 2E7TA 1HV0A 3OG2A 4HOOA 3I49A 1W3XA 1YHFA 2JWPA 2QZ2A 1NLRA 4A7KA 3ROUA 3ZR5A 1CIWA 2EXKA 1SQ4A 2HWB2 2X5IB 3HT2A 2CSGA 3MFAA 2VZPA 4LQRA 5CYYA 1MZ5A 5LK5A 2WNUB 2WO1A 4K20A 1L3JA 3BALA 2ARXA 3POBA 3JQXA 4IE0A 4IUGA 1OUXA 4OI2A 5A1LA 4LKSA 1O7FA 3VL8A 1OA3A 3UJQA 3AKSA 3OCPA 3CU7A 2W0XA 4Q4W1 4CU7A 1G9BA 2VMHA 1VBA3 2AC1A 2C1FA 1NX9A 2DURA 1U5XA 2AH2A 3I3DA 5GLUA 3RVHA 1HB4A 2BERA 2G9FA 2HYKA 2V09A 1KRIA 1NCRB 1ENSA 2JIGA 4LE3A 4P9LA 5C3OA 4PF5A 1ZM1A 4FFGA 5A7SA 5KWRA 2NN8A 1GYKA 2YC4A 4Y20A 2OIIA 4FT8A 4L97A 1AX0A 2BBAA 1POV1 1F4AA 2HJIA 2WR9A 1PGL2 1HRV3 3ACFA 2XOMA 2HH9A 4Q4Y3 3RSJA 1EV12 2DU1A 4O65A 2PHTA 3H8XA 3KQ4B 5FZ3A 1NKGA 1W6PA 5GZFA 4K9SA 3SH4A 5HPOA 1BEV2 4JDNA 1KXGA 2ARBA 3B01A 1Y9GA 2WYFA 1WZXA 4Y1VA 2WT0A 3LFMA 5JZGA 2FDFA 2YGLA 3DN7A 4BK5A 3TNQA 2AR6A 3RJRA 5IK7A 5FY1A 1AR82 1DQ4A 4JVAA 3RMYA 4GJYA 1SLAA 5I0UA 2WS91 2ZA9A 2B5HA 1OA4A 2WNVC 3ENRA 3CO2A 2R063 4S2DA 5IJRA 2CNAA 2RDQA 3KGZA 5C5TA 3U37A 1W8WA 3ME2A 4OUEA 1AYN3 4BE3A 5BYNA 1AXZA 4KGQA 4QXKA 2D3RA 1VBC2 1U5YA 2B4KA 4QKDA 4ATEA 4YLZA 4X8NA 1BBT1 5FAXA 1QJU1 2H0VA 2Z42A 5F3IA 1TZOA 1WCKA 1GQGA 4J1XA 4FAHA 1AL0G 3IIIA 3POGA 1VPHA 5CISA 1UOFA 4A2UA 1QDCA 1UCXA 4TZDA 5DABA 4RYDA 4X6QB 4K6BA 4LO5B 3VBUA 4YW6A 1UZYA 2RS53 5GLVA 1VRBA 5LA1A 5BNOC 4QDSA 1VAMA 5JDBA 4GWMA 2QQWA 2H6BA 1D0HA 1DU3D 2B39A 4YG3A 5JZGB 4P9GA 5FZ8A 1REEA 2DUOA 2GU9A 1KD7A 1W06A 4DXRA 4LOTA 1ZBE1 3RI9A 4HT1T 1OXCA 2QQJA 5KBFA 5AC93 4F3JA 4IE7A 1V6OA 3SXWA 1VBD3 3ZPOA 3U10A 5FKBA 5IATA 4Y5SA 1YJKA 3VD5A 4B4RA 1R082 5LY2A 3RWNA 4CCEA 2WWJA 1RUD2 3U4SA 2ET7A 2DCKA 4B1MA 1COV2 1ST8A 1LECA 1FPN1 3RNSA 3LDBA 1VIWB 2GC0A 4ZY9A 1CN1A 4YZ1A 4AI2A 5FLIA 2YROA 2W39A 5AFBA 3JD72 3GBWA 3WHTA 1W8ZA 1RHI3 2W5FA 4NHLA 5HBAA 3HNMA 2CAUA 1ULFA 3ZXLA 3S57A 1QJX1 4GJZA 1QNWA 4PDWC 5JUVA 3FX3A 4LJHA 5J09A 4RS5A 4NJ4A 4O9GA 4P9YA 1VJ2A 1F2NA 1VBE3 1AHSA 2VUAA 5T5JA 2WAOA 4QX5A 1D4VB 1Y9QA 4ES9A 1AYM3 1C8M3 3T1LA 2Q30A 3WEZA 1DGWA 1UPIA 4GULA 2BNNA 3U78A 1W28A 2VL4A 3HNYM 2LROA 1A6CA 3BN6A 1ZZ7A 2Y34A 3IBMA 2CV6A 4LLOA 2GC3A 1CR7A 4G4FA 5BNNC 1KS5A 5FP8A 1FOD2 2ZX0A 2UWBA 2VOTA 4CP0A 1WLCA 4I0BA 1O59A 2J1SA 4DFSA 3WQ1A 2C0ZA 2RJ2A 3VBFC 2VVDA 4LORA 2QQUA 3CBNA 4XBQA 3FL7A 2PXJA 5KR7A 2H6CA 4AQTA 1PX4A 1OQEA 2ADEA 4FPGA 4OVEA 2XG3A 1SCSA 1N3QA 3HT1A 4HSLA 3OOXA 5C5UA 4Q1RA 1W99A 1OFNA 4DUVA 3PU8A 1URXA 2FD8A 4BIOA 5DAXA 3E6DA 3C7HA 3FHQA 1MZEA 1RUG3 3RYRA 4DNYA 3BUCA 3RZZA 1KQRA 1OPOA 2ZGSA 1WMFA 1ZZBA 4COUA 1RUOA 4LXLA 3LEIA 5EFUA 1WBLA 1WW4A 3MBWA 4LPLA 3A0KA 1US3A 1H8TC 1CPMA 3WF3A 3J8F2 2VD7A 2C9KA 1VRH3 4GA9A 1IS3A 3RJ2X 2CU5A 2ZX4A 4DRRA 3BTAA 2WQZC 2W92A 1MS4A 2XWJB 5GLZA 2VPVA 4YW2A 4AHZA 4Y5TA 3T0BA 4FCAA 3ZXDA 4IESA 4LBQD 4PBPA 5FBJA 1MR5A 3KVBA 2ZX2A 5FPZA 3APBA 3UT0A 1AR63 2VZOA 1I1EA 1F15A 2QFEA 4LITA 1ULCA 1W39A 2HWE3 3IWZA 4YZ3A 1C5HA 1UZWA 4RGKA 1CZSA 4XJUA 4GIQA 3AKQA 3GNEA 5ERLA 4KNCA 4ISRA 2P34A 4HK8A 4KU8A 5FQ0A 1UY1A 2X53S 1RXFA 4XFHA 1VBA1 5K0UC 5AFEA 4WM8A 4W4ZA 4CUAA 1UW8A 1OA2A 1EAH3 4XVHA 5F32A 3VLBB 5FZBA 5JOXA 4EE2A 1QNYA 1HV1A 5ISLA 3O1RA 2FDKA 1CESA 3OPWA 5KC6A 4AR2A 1XE0A 2F6BA 3MLJA 4I09A 4SBVA 4XTMA 3UGGA 2IZWA 4AI8A 4ASLA 1HRV1 2VMGA 3KWVA 1J58A 3AZYA 3R0RA 4Q4Y1 4CEYA 3KQRA 1DQ0A 2PHWA 4JKMA 2XR4A 4LULA 5FLHA 4H55A 3O1PA 3LWCA 1DG6A 3H3LA 5I0DA 5J98B 3WX5A 4UBGA 2GN7A 2JG9B 1FYUA 2DFCA 3VD3A 2B42B 4C1XA 3ZSKA 5FZ0A 3ZYBA 4DY3A 2YPJA 4ZXEA 4IEOA 5JPMB 1BHGA 3WQ7A 2D93A 1ND2C 4YM2A 5DUVA 3DYMA 2Z2SB 4LHLA 2CWMA 5LRSA 4M3CE 1S4CA 1PM7A 1UMIA 1XYOA 2EVXA 3B5LB 1SBEA 5LW9A 3N7LA 4N53A 1HN0A 2R061 2G9GA 5FQ0B 4IEQA 1TME2 3POSA 4PCRA 2Y0OA 3NQHA 3R05A 2DWRA 4WM8B 4QPYA 2EALA 1AYN1 3AP6A 3HN3A 3FHIB 4NIDA 4IEUA 5DMYA 4A6SA 1LOFC 5FUPA 5IAXA 2I07B 3B7MA 4YGCA 4ZS2A 1IPKA 2B9VA 2VH9A 4XETA 3VKNA 1XNKA 4CDUC 4XAEA 4B7EA 1DFQA 2PMWB 1KJLA 3IT8A 3OF1A 2XL7A 4FI9A 4GMP3 4XPVA 4XUNA 1IZ3A 2D6PA 3LKJA 4G3YC 4IE6A 4AFBA 3MDPA 1AXKA 1UPSA 2HWB3 2QDNA 2PQSA 2GNMA 2RS51 3GZUC 5IVVA 4LBLA 4ZZ5A 3AMQA 4IEZA 5KHHA 3AJZA 1XSRA 4N43A 3THTA 2WO2A 5A3LA 1E5IA 2E6VA 5GZEA 4WVZA 5DZEA 2OPKA 1HXS2 2WFPA 4E4DX 5D8AA 4R9AA 4RFRB 5F5CA 3KT7A 5A32A 5AC91 1H30A 2H0BA 1L7LA 1R092 1QY4A 2BZDA 1VBD1 2OS2A 3F2ZA 4N53B 1H6XA 4GH4C 1N1VA 2JDHA 3BODA 3K51A 3R4DB 5D21A 1OMIA 1DDLA 1W2TA 5EWSA 1Q8QA 1H9WA 5FY0A 4GB32 1YIPA 3UETA 3N35A 4QPIC 4EN7B 1DLCA 3VBRC 3T09A 2XONA 2ZBJA 2E33A 3FJSA 4FPFA 3VDBA 2VMEA 3CLPA 1LJ7A 3USUA 1IPSA 3AKTA 5DAVA 5C9AB 5KHJA 2O0OA 1LODA 3I2IA 5EJ3A 1W6NA 4FP2A 4QPGA 2LM3A 1NYWA 1CPNA 3M3IA 1STMA 5H9SA 1A8MA 5FYVA 1YI7A 1RHI1 1I6XA 1RUC2 2WNOA 3WF2A 1CX4A 1OQDA 3SCFA 1ASJ2 1NA1A 3WF4A 2PHFA 1ULEA 3ETQA 1G9DA 5LCWL 2Q1MA 4NOTA 2VY0A 5JVVA 2W9XA 2JE7A 1HW5A 2A73B 2XLGA 3LPGA 2AGSA 1HDKA 1V9U3 3N7JA 1VBE1 4WVMA 5C70A 4PLMA 4QQ2A 4HN0A 3KHCA 2V5YA 5IYYA 2D6KA 5D8AB 1AYM1 2LUWA 1C8M1 4ISQA 5A32B 1IG3A 1PK6A 2VBPA 2O8QA 1NZIA 3O0WA 4JTOA 4Z2WA 2ZJCA 3AC0A 4JCKA 5L7OC 2FDIA 1UYZA 4JGYC 2K9ZA 3Q9OA 4NRQA 3CJIA 3ECQA 1OVSA 2DCJA 4UW4A 4CCMA 5H9PA 3A23A 4AVVA 1RUI3 3UKVA 1GWMA 4COYA 2PLV3 2R1DA 4PIYA 3RGBA 1W04A 5LA9A 3OGGA 3IMNA 4DPNA 1X82A 4KMQA 5LBFA 3VD9A 4Y1YA 2P3KA 1W6NB 4QPGB 2ZOEB 5BY5A 1FX5A 3A7QA 4KH9A 1VR3A 3FBYA 3HBZA 1K5MC 5FY8A 1QU0A 2J42A 4XDQA 1YIFA 3AYCA 3T1MA 1PGW1 1V6NA 1E5RA 1Z7S2 3WNMA 4XJ8A 5C6CA 4BQ4A 1SHWB 2VR4A 2V5DA 3P5BA 5FZKA 5EQUA 4QPWA 3WG3A 1JYTA 1GOGA 4RL7A 5CG9A 1B35C 1VAVA 5DXDA 4QHOA 2WAAA 1ZVFA 1UO9A 4WVMB 1WLDA 4NR1A 3S30A 2O8OA 4U2AA 2RR12 4XIOA 1IG0A 5G04L 1RUG1 4DINB 5JXIA 1QKQA 1FMD3 2BJSA 3PNAA 5K4LA 4LBKA 3CJIB 5K8SA 1PO13 2I2SA 4QM9A 3EMRA 4I0WB 4F83A 4A45A 1RUD3 1RXGA 1VRH1 3D4KA 4CUBA 4OZOA 1GU3A 3MHZA 4CZSA 1COV3 4G9SB 2Q8CA 4HXCA 2A6ZA 1QJEA 4BLIA 2BNOA 2EXJA 3C8XA 3VBOC 5BNPA 2E26A 1XNCA 2G1MA 3OY8B 4XJWA 5LASA 4RGAA 3T0AA 1G9AA 1AR61 3POWA 1V0AA 3O5SA 4YPJA 3H8RA 2HWC2 3UL2A 2HWE1 1XOYA 2Q4SA 5FZFA 1G9CA 5J48A 2P37A 2VMDA 5B4NA 2D6NA 5DAWA 1S2KA 1WLTA 3VBSC 3TWIA 3VZMA 4INDA 2TBVA 4A41A 4CP1A 2XJSA 4YM0A 1QF3A 5FUNA 1T6BX 3VD4A 4AZZA 3WD5A 4A42A 3MUY1 5F2SA 4MV2A 1Y9MA 4XQDA 4AL9A 4FTSA 1HRI2 1UY3A 1B09A 3LF7A 2E63A 4BA6A 4AGGA 2NP0A 4QXHA 3PIJA 2YHJA 1UYPA 2PA7A 3I2GA 3CEWA 2A7AA 3U11A 1EAH1 1OLME 2MEV2 1FOD3 2X09A 5FP9A 5DG2A 2ZHMA 4LKDA 1CAVA 2ARAA 4CUGA 4XFIA 2FDGA 2RS12 1CAXA 3K3NA 4Q8LA 1SDDB 1RUNA 1SZBA 5FTTC 4NHXA 3GHNA 3ZFEC 4DS0A 3LEMA 3L9JT 2Y6HA 4PF1A 3O1MA 5BNPB 1AX1A 1NXD1 4MVTA 2NLRA 4XMIA 4AAPA 3OEBA 1RUF3 4UW6A 4UFJA 1CJDA 1E5HA 4OQ9A 4FPYA 1WA6X 1BK1A 1AR92 3MGUA 3VN4A 2XJVA 4Q4X2 2JXAA 2C5DA 3WDVA 1JOBA 3ZYFA 4OHVA 4Y3OA 3BKZA 1S2EA 2W1SA 1JYNA 2R042 3WVJA 3DPRA 5GZGA 4I2OA 2JKXA 4JDMA 3ALQA 3O7OA 3E1F1 2VAUA 4LNVA 4Z2AA 4FXKB 4KL1A 2XLAA 1PMIA 3J8F3 2WNVA 1KFXL 2CL2A 3BVCA 3ZVXA 5AVPA 1QMJA 2JDZA 1CAVB 2R30A 4BOWA 3Q8CA 4L99A 3MW3A 2RHPA 3OBRA 1CAXB 1AL23 1AR73 4QM8A 4QXBA 5I0TA 1LULA 3A4UA 3WNXA 1XYPA 4GMP1 4QX0A 4ZXKA 2G9ZA 1PO22 2R072 5IVJA 4LR4A 1UOGA 2IXIA 3KD4A 3MIFA 3VHRA 1W2AX 4E2SA 2VCBA 1ZX5A 3PMEA 1N1YA 5G05L 2HWB1 3WDWA 2E53A 2AUYA 2XJQA 3JB8A 4QKFA 1I3HA 4QGLA 5EJ1B 4D0QA 3DCQA 4BPZA 2BTVC 5A6QA 5JOWA 1XNDA 3ES4A 5I0SA 4NROA 3I59B 3JXSA 4XW3A 2BOIA 5HCBA 3SMHA 3WSOA 1DGLA 1D7PM 1D4M2 1C57A 1DGRN 3AM2A 3AZZA 2NM1A 2OUJA 1JOPA 1RJ8A 1YFYA 2QBXA 1NQDA 2ZCWA 2AEYA 3DPRB 3NL1A 4AVBA 5ABJC 3FMGA 3RWKX 2XB6C 3K77A 2YYOA 2VE1A 3PTRB 3PVOA 3VV1A 2WNVB 5FK8A 4LOSA 3RRDA 5CFCC 2XPJA 2WQ4A 4BMBA 4NIGA 2A6WA 3DXTA 4XJZA 4EZHA 3R6SA 1FATA 3N9NA 3TNPB 1PVC2 4PHZA 1W9YA 2IWGB 2QTWB 3KLSA 3USSA 4BISA 5T3NA 2GNBA 3ZDVA 2QCSB 1ULGA 2VVEA 2VW1A 2ZHNA 2DUPA 5IUQA 3MIHA 3THCA 5BUVA 1QOTA 4DIQA 5F5IA 2A3WA 5BPXA 4IXLA 5F5AA 2VCMA 3KT1A 1PGSA 1X50A 3CHXA 4UFHA 1V9U1 1DQ2A 3ZXFA 3OGVA 4H3WA 3LOIA 4PDWA 5H9QA 5FOJB 4WVVA 4Q0QA 5BNOB 2RDNA 1S0IA 1Q8SA 4R9CA 5HV0A 5HCHA 3TBDA 1TME3 1RVF2 1G6NA 4XHXA 2QQLA 5JSRA 4Y24A 2Y64A 4M4PA 1ENQA 4K7JA 3B9CA 2RMU2 1Q56A 2JDYA 1RUI1 2UYBA 3MIGA 3OUHA 2PLV1 5FJKA 1FT9A 5CB7A 4YW3A 1JH5A 1GQHA 2PTMA 4I01A 4RR3A 2VBDA 3MPBA 3A21A 3TN92 2KD7A 2PHXA 5BNNA 1ZRDA 2HBUA 2VZTA 1MQTC 1W6MA 4EZ4A 2ATFA 2Y38A 3PU3A 5FZ6A 5FJHA 4H7MA 3QH6A 4K40A 4F8AA 1K45A 5DDJ2 4MLOA 2CGOA 4BLJA 5FMOL 2ORZA 4C1WA 3N9MA 1JYIA 1O91A 1VBB3 1OSGA 1W8OA 2VZQA 3OB8A 2JEMA 4P9WA 5JSOA 5JR7B 3KF5A 4FOYA 3LIGA 5J96B 1BLZA 2FCTA 3KHBA 4FOVA 1GNZA 3POJA 4PDWB 2HYXA 1GQPA 2YY1A 3LA7A 3ZXAC 3ZX7A 1UX7A 4XUTA 1DCSA 2PELA 3E5XA 1FMD1 4LHKA 4PLOA 2OZ6A 3W20A 3I3MA 2VG9A 4COVA 3ACHA 4DO0A 3E6CC 4HMZA 4J25A 1PO11 2VZSA 2XJPA 2P2KA 3I4IA 3TRSB 4BM8A 4BQWA 5FPXA 1RUD1 2A3YA 4A3XA 2P3YA 1QDOA 2RV9A 1QGLA 3JQWA 5DUUA 5KHGA 1COV1 3OTFA 5FY9A 4RR3B 5JMCA 3OD4A 1VMHA 4HKLA 1H8TA 5HI0A 4UFIA 3AX4A 4BCUA 2D97A 5BNNB 4UYBA 4WZCA 4HN1A 4KU7A 3MYXA 1W6MB 4W65A 1UQXA 1OHFA 4BQ3A 2VW0A 2ZABA 2ZMKA 5FRAA 1ASJ3 5IK4A 3MLKA 2WLQA 1W90A 1WMDA 3HIFA 4AQ2A 1SCRA 1J84A 3VDDA 4YG6A 2J1AA 3PTYA 2GP3A 4E8CA 1JZ5A 2BFUL 2TEPA 4A4AA 1VMJA 4MGSA 3CZJA 1MVEA 3UKNA 1DZTA 4NE9A 5GM0A 3VZOA 4XXAA 1W2NA 1UU6A 2W91A 4IV3C 2XBO2 3VGIA 2YBKA 4NRMA 4MOAA 1JMUB 4XTPA 1JZ2A 1SMVA 3MF9A 4NWVA 4BHPA 1H4HA 1S55A 4W6XA 3Q8FA 2Y26A 4AEDC 5F5QA 1FOD1 3NJXA 4FAGA 5K0UA 4GWIA 4YGDA 1YLLA 1YQ6A 5JIUA 1KDMA 5FMDA 3AP7A 1H8TB 4XE9A 4RHV3 3OGSA 3EYPA 1OH3A 2F4PA 3AYAA 1Z7S3 5ACA2 2RS33 5FYBA 3NAPC 1RUF1 4ZONA 4HZFA 2LALA 2LTNA 3ZSMA 1QHDA 1T2XA 3BTXA 4QQOA 3EQEA 2B45X 2BPA2 3VDDB 4W6YA 3N36A 3VHPA 1O3QA 1J83A 4BIFA 1UY0A 4COZA 3T4HB 3HQRA 4OI4A 1GFF2 2ORXA 4XFFA 3SH5A 2RR13 1W0NA 2WKKA 1JU3A 2FHRA 5FY7A 5LWBA 5F2WA 4AI1A 2J1UA 3IAQA 1NE6A 4RSUA 3DYOA 3WINE 1YJLA 5FYCA 3AMHA 3J8F1 4Q27A 2QJVA 4XABA 3MO4A 5K0UB 1W0PA 4LKFA 3SKVA 2A3XA 2TUNA 5IW0A 3RQ0A 2YBPA 5FZGA 2Z69A 3UGHA 2WN3A 1AL21 4S2HA 1AR71 3WDTA 1HQLA 1OQ1A 3ETPA 2Y0IA 4LO7A 1CAUA 5FMOS 4SLIA 2DVBA 3TEZA 1FNZA 4CDUA 1XNTA 3NKTA 5IAVA 2HWC3 5BV6A 3UGFA 4JTNA 1X7NA 3ZFFC 1JHJA 5FREA 4K1ZA 4D69A 2JJ6A 4XJAA 4KWKA 4E2QA 4RFT0 4AWDA 3ZYRA 4IGQA 1VB2A 3NO8A 5L9RA 1D2QA 2E9QA 3H9AA 2GMMA 3NJYA 4QX8A 4AI3A 3KV4A 3RYPA 4C8DA 2LRPA 2AENA 1ND2B 2HWF2 4PI0A 3WV6A 2X05A 4LMFA 3WXPA 1LNSA 2BGOA 3BU0A 1RTVA 5DZGA 1WMXA 3N9PA 3AP9A 4GH4A 3O1UA 4Q0PA 3SHRA 4NIHA 3DL3A 5L36A 2DBNA 4TN7A 2VQUA 4I02A 1OOPC 4M00A 4M4RA 4XJ9A 3IIAA 2GC1A 3KM5A 3VBRA 2C6SA 4AF9A 2YG0A 1CAUB 1JXNA 3CL1A 2Y6LA 2IVIB 3HOBA 5FO7B 4CDUB 5FZLA 1ACCA 2TNFA 2R0FA 5FPAA 2BFUS 3G6JB 3MI8A 3S0MA 5EYYA 4D7YA 1WCSA 1AR93 5E1RA 3HMYA 4Q4X3 2D5FA 3LA3A 1CQ9A 1LEDA 4UOJA 4CP2A 5DUWA 4LKEA 2ZTNA 2Z5WA 4QB6A 2R043 2UY8A 3M70A 2A75A 1XNAA 2AREA 4HBNA 1TME1 3WCSA 4E2GA 3CZUA 3KV6A 4LBJA 1WKYA 2QQIA 3I3EA 1RUH2 2E51A 2W3JA 5FO9B 2OA2A 4NRPA 2JE8A 2ZHLA 2ZAAA 2D43A 2WDBA 1OF4A 4Y22A 4GH4B 1QEXA 4JGYA 1S0EA 5FZAA 2OXBA 4KQ7A 3OBTA 3OGRA 4I3GA 3UJOA 4AE2A 5FOBB 4E4ZA 2FDJA 2OYZA 1PO23 4M3CF 4YG0A 3VBRB 3MLLA 3ZMOA 4CP9B 5FYYA 3ZYPA 5CIRA 5FXVA 4MHUA 1RUJ2 4CPBD 1ULDA 1VBB1 2UY9A 2J1VA 4IDZA 4EN0A 3EBRA 1K5MA 4A6OA 4CDWC 3J7NA 2VCCA 3ZXEA 2Q8EA 4LEJA 4QB1A 2UU8A 4X6RB 3I3BA 1IHMA 4DOUA 3IDBB 1OUSA 1PNGA 1D4M3 4XUOA 3PUSA 5FYUA 2NQYA 4LHNA 5FPBA 3H8UA 3OPTA 4N90A 5JSPA 1B35A 3V0BA 4YZ2A 2VCAA 3KT4A 3CDZB 3VBHC 5JOZA 3J9SA 4GD4A 3C2UA 3H3ZA 4RGGA 1UKGA 3RPQA 4XYXA 1YFUA 3RFRA 4D6SA 2WO7A 4PBOA 4NHMA 4FTBA 4Y22B 3I3QA 4JGYB 4OYUA 4B29A 2FMDA 3VZNA 1PVC3 4RQPC 4OI1A 5FMCA 1MEC3 4AQSA 1XE7A 2I45A 3NNMA 5FY5A 3H8OA 1YQ8A 1HB3A 2BW8A 4IERA 3ZYGA 4H14A 3S7IA 5C3SA 4IEXA 1ASJ1 4D3WA 2WFF2 2VJXA 1IQAA 2R0HA 4OULA 4ZHNA 1E5SA 1ULOA 3RI8A 3VBOA 4IEVA 4CEWA 2DUQA 1K5MB 2VBBA 1W9FA 5EHDA 3W21A 3DUIA 4HVOA 2JD4A 1JTZX 2Q1ZB 1MACA 4KBBA 4TYSA 2RM23 5HXMA 2WBKA 1GZTA 1YWKA 3QH7A 1XJAA 2UYAA 1GLHA 1QIQA 2JG9A 2WNUC 1CAWA 3AZVA 3ILRA 1B35B 5EP9A 1FXZA 2ZX1A 4K3UA 1AVBA 2JX9A 3OBZA 2RMU3 1PMJX 5FZDA 5JXHA 1P8JA 4QQLA 2O1QA 1DLLA 2D6OX 4IETA 4KG8A 2Q8DA 3RG0A 1C4RA 1M06G 5CVRA 4BB3A 1J3PA 4FPJA 4AG4A 1Q5OA 3IB3A 1NCRC 1SBDA 2WS92 4XHBA 2OQ7A 3CJXA 2YDEA 1U0AA 5BXXA 2ZHKA 4NUBA 3WW3A 4RHV1 4CDXC 2OW4A 3KCCA 5J7MA 5EPAA 2BDRA 1OKOA 1QQP3 1LHWA 1Z7S1 4A3ZA 2RS31 1A3KA 1FNYA 2E31A 3I2HA 4XF3A 4DQAA 5I8TA 1W8TA 3P1IA 3VBOB 4CEWB 3GDBA 1PM4A 4MGYE 4BQXA 2IFWA 2GMPA 1G7YA 2B8MA 1QXRA 2JDNA 5CFDA 1Q8OA 1KITA 2RR11 2VMFA 5FYIA 3URFA 5FXWA 3MV01 4QXCA 2UWCA 3W9AA 1W8HA 4Z92B 5C9AC 3S7EA 5HV4A 1CAWB 1H1MA 3D8CA 5B4XA 2VNOA 1NAEA 1PIV2 2QE3A 4UF0A 1GANA 1LEMA 5FZIA 4B4QA 3HR9A 4BU2A 4Z1VA 4Y26A 4KWUA 1ZBA3 2X8KA 2XQXA 1QJY2 2W46A 2WSVA 4UXAA 4ZPIA 3BOPA 5JI7A 3OPZA 4ONUA 1JZ7A 1GP6A 1QOOA 3VKFC 1V6MA 2GNDA 1Q8PA 4XBNA 2XUEA 1SFYA 2BGPA 1O3SA 3B9IA 4MGIE 1J3RA 4QDRA 2ZGQA 2XKOA 3FUQA 2HWC1 3LEGA 3H1WA 3ZIXA 4CDQA 2Y6GA 1XSQA 5C3RA 4NPRA 3ZFEB 4LE4A 4K21A 2KA3A 2WWUA 3OD0A 1DQ6A 1FPN2 4XFCA 4V2WA 4YVWC 5CFDB 3NV4A 2QQOA 4JHZA 1NCQA 2BNMA 3T2TA 2XBO3 5JZGC 1PNFA 2VQ0A 3J7MA 4AOCA 3K4DA 4I30A 1U12A 3PL0A 1W05A 2ID4A 3MW2A 4MADA 4FQ4A 1TMF2 3MIBA 4UF0B 1UXZA 2NPIA 1QWRA 2W1QA 2WYSA 3GZTB 1NQJA 1LOEA 3POYA 1REDA 3BPSA 4XCAA 3R4UA 1AX2A 3P3PA 1OPMA 3UV9A 3IDEA 3ZO0B 1SPPB 2A6YA 2BU9A 2YFUA 3UKTA 5CFCA 1J3QA 4KBZA 5FPUA 5ACA3 3QD6A 1JYWA 2FBEA 4NAMA 5JAXA 4CDQB 2IXJA 1DZRA 4MHRA 5T50A 3U75A 1MS8A 1O3TA 3W59A 1AR91 3C7EA 4LK6A 3M3EA 3ZYIB 4Q4X1 3PUAA 2ZKLA 3IAPA 4HKOA 3WOGA 4K8RB 4N8MA 3VBUC 3RYKA 2LS6A 1EV13 4R9DA 3ZIWA 2VUJA 1NCQB 2UWAA 2R041 4CDWA 3FLTA 3ZSEA 2F17A 4XC9A 3VDAA 2WRAA 4N9IA 1BEV3 3AP5A 4K8FA 4Y1UA 4L2NA 4QMAA 4MUVA 2BUKA 5FPLA 3O0VA 3VZKA 1MZFA 2EXHA 3GZEA 3JBG2 2VU9A 2ZXQA 1WLWA 4Q0SA 1AR83 5ANQA 5J37A 1JODA 4MXWA 3IDCB 5ABJB 4Q0UA 5A3TA 1O4TA 3VL9A 5F37A 1JS9A 4YFWA 4DUWA 3LE0A 3NMBA 1PO21 1UU4A 4MYEA 4D6RA 5A6XA 5CFCB 1WD3A 3GF6A 3TEWA 2Y60A 5H9RA 4DEQA 1LRHA 1VBC3 4L11A 3N4MA 3BPZA 1MZ6A 3POIA 4WM7C 1MQTA 3M1HA 3KGLA 4LBNA 2VNRA 2VZ1A 3C3VA 3FZ3A 4HPKA 1OFSA 5DZFA 4CXWA 4UI9L 3U14A 4LTAA 4CA9A 2GP5A 2P3JA 3O1VA 1IS4A 1N1SA 2QQNA 4OHWA 1C1FA 3QLQA 2RE9A 3NNGA 1J1TA 1D4M1 3AVSA 3OY8A 4RS5C 2EAKA 3WP6A 4CRQA 1ZRRA 4Q8KA 2X29A 1YQ5A 4HL0A 3OUIA 2J1EA 2HWF3 3POFA 2VNVA 2EIGA 4H2AA 3ST7A 4UW5A 2GH2A 1LAJA 2ARCA 3KVAA 2WSUA 1F4HA 4Z82A 4YW7A 1BVP1 3Q8EA 2XVKA 4YZ4A 4NHKA 2JIJA 5T5LA 4TSVA 1FV2A 1GICA 2WWSA 4JRAA 3WDUA 4LIUA 4MXWB 4CCOA 4ZZ8A 5EIYB 1LHVA 2O14A 2P6CA 1PVC1 5FZMA 3ZFGC 1HLCA 4E4SA 1MEC1 5ANNA 3AP4A 1DYKA 2P17A 1MS1A 3H1YA 5FZHA 1XXNA 4WVWA 5HCAA 1R083 5FXXA 5CU1A 2P4EA 5B2GB 4JZRA 4P08A 5FR3A 1ZZ8A 2GN3A 1MS5A 5JI9A 1GZ9A 4JKLA 4FPEA 2WABA 4BQ2A 1O8SA 1MQTB 5C8WA 1AXYA 3VZLA 4HPKB 3MIEA 2WZR2 1ND3A 2D6MA 5SV5A 2P1BA 1OI6A 3ZMNA 3M4FA 4DXTA 2ES3A 3N7KA 5C4WA 2RM21 3JD73 4Q4Y2 3S5AA 3TEYA 4QQPA 4OCTA 2N7GA 3B94A 1CWPA 4P14A 3X29B 2BRTA 2EA7A 1BK0A 1RUH3 4UT5A 2RMU1 4XBLA 4PJYA 5T5PA 2AACA 1BKZA 1LKNA 4IV3A 1YXWA 2OUHA 4MGZE 1IOAA 2X10A 4YNIA 5A3PA 2VMCA 2VOVA 4UFLA 1M4WA 3NW4A 2YU1A 4GKYA 5E89A 2AZ5A 3EB7A 4BMEA 3NNJA 3OBAA 1GKBA 4R9BA 3TN91 4AEDA 1GOFA 5LBEA 1BMV2 1JYVA 5A80A 3D3AA 1AF9A 1HJGA 4OLLA 4AHXA 1QQP1 4QGNA 2WC2A 2P6HA 1YYNA 4B1LA 1S2BA 4FPOB 2RJLA 1IGOA 5FK7A 3ZXKA 5IVFA 2W47A 2GZWA 1VE0A 3K2OA 1UZ0A 3WG4A 1MPXA 1R1ZA 2JDAA 1ND3B 5C4WB 3NAPA 3NV3A 5LZ6A 2WJSA 3FC0A 4NO4A 1ZRCA 5FP4A 4YVSC 3MIDA 4B7KA 1OLRA 2ADDA 2P3IA 3U4XA 2BGCA 3ZLIA 2RS52 4XURA 4GKXA 4PQ9A 1RINA 2OPWA 1RGSA 4IV3B 5KHIA 3I59A 1ZBA1 5FYMA 4ZS3A 3QOPA 1QJZA 4WM8C 5E6HA 4D94A 1OF3A 4Q0VA 3GHMA 4XCBA 4BH9A 3GCWA 2Z79A 2VOXA 5AC92 4AEDB 5IK8A 5IFTA 1LOBA 1W8UA 4BQ5A 1VBD2 4YW4A 5CKNA 4XMAA 3DKWA 3PUIA 5C8CC 2NZ9A 2PHDA 2DF7A 1SFNA 1OT5A 2XXZA 1V6LA 1G8WA 4CYDA 2WFF3 2KR2A 4CEYC 2ZEZA 4XF9A 1TNRA 1RIRA 4AFMA 5A1FA 1NY72 2D44A 1RITA 2WA3A 3LGRA 3VB9A 4EWAA 3O1OA 1LU2A 3MEPA 2PN5A 3M3QA 4LUMA 4QHBA 3NAPB 5LY1A 4ARYA 1TQ5A 1D2SA 4I0AA 2XBO1 1R1A2 1RHI2 2WZEA 5IT6A 4IE4A 4A44A 4XFGA 1MS3A 4LBQB 4MSVA 1E57A 1GZCA 4CU6A 3OUJA 2IVJA 1H2LA 4N53C 4PLNA 4BZ4A 5FYHA 1VBE2 2ENRA 2QQMA 5JIAA 5BNOA 1S0CA 1JN2P 5LRRA 3H1MA 1AYM2 4PIZA 1C8M2 5A3OA 2BVVA 4CE8A 2C24A 1IKPA 3P3NA 1X33A 1UX6A 2C9AA 2VMIA 2WNEA 4ZU4A 1VMFA 1UOBA 1WMEA 3KMHA 4JX0A 5ACA1 2PHRA 3RZJA 4DXZA 1BJQA 1AJKA 1V6IA 1W6OA 2VXJA 4W50A 5GJ6A 1XB9A 4KG0A 4NIIA 3TEXA 1PGL1 5FWJA 1N47A 1H1IA 1EV11 2JENA 1PX3A 4META 4HKWA 1ZREA 4QX1A 5F7UA 4XEZA 4ARXA 3ZFFB 4XQ4A 1ONAA 2YV8A 2V4AA 2IXHA 4N43C 1BEV1 3WW2A 4P9XA 1PGW2 5FLJA 3DXUA 3H7YA 1PIV3 2BOJA 1XNBA 3AVRA 4TXWA 1WWYA 4DRVA 4FSJA 4P00B 1QJY3 1AR81 3IDAA 4OFGA 3ACIA 4FP3A 3JUUA 2A6XA 2JDUA 1RUG2 3WNNA 1NLQA 1ZZCA 2VQTA 3DGTA 2VM9A 1H6YA 3FHAA 4R4ZA 3VD7A 3VUOA 2PAEA 3FLPA 2WINB 2DU0A 1QOSA 4Q4V2 1ZZ6A 1GNHA 1VBC1 5FYZA 4AQ6A 5IVEA 3BI3A 2SBAA 1OOPB 1QXPA 2E32A 1W6OB 1GSLA 1VRH2 2Y6JA 2YZ4A 3ASIA 3PUQA 3OJBA 5F1RA 3HQXA 2JG8C 2D3SA 3AK0A 2RDSA 4GQ7A 1UZVA 1NA1C 3S5QA 3ZSLA 2J22A 3HN1A 5E8AA 1H9PA 1U5ZA 2UURA 5A70A 3KV5A 1JW6A 2VQAA 1S0BA 3QACA 4A7ZA 2ZACA 4WV8A
chains in the Genus database with same CATH topology
1GBGA 4YYOA 1BCXA 3VBFA 2HWF1 1AR62 2ZMLA 2MHFA 4BYYA 1TMF3 2HWE2 2VVFA 3FBMA 4MGKE 4M3CA 1PK6C 4FOWA 1HXS3 3VHOA 3VBHA 3V65A 4AK3A 1V70A 1R093 1LB2A 3AKPA 1SLLA 4MXVA 5A3MA 3L2HA 1W2UA 1WW5A 4BQ1A 2E7QA 1R081 4FO9A 2BYVE 4XF0A 4GB33 4RQPA 1EAH2 4E27A 4XQWA 5I91A 1C3HA 1UKRA 4AW7A 5EYXA 4V1PA 2XH6A 3JD71 1OKQA 4AFAA 2VOWA 1JBCA 1RUC3 4CDWB 2XHKA 3FUOA 2DVGA 4JV4A 3HAGA 3VBFB 3WCRA 1RUH1 5FDBA 3MFCA 1UD1A 4P9IA 3JBG3 1H1AA 2QUOA 2ZZJA 2YUEA 4M3CB 3LCPA 4MX3A 4U36A 4D7SA 4XF4A 2EAAA 4HETA 3SNMA 1XYNA 3LSEA 3VBHB 3NSTA 3VHNA 5C33A 1Q3EA 3PVNA 4AGVA 1NOVA 4MZUA 3N3HA 2CAVA 4D7TA 2B9UA 3NV2A 4JC1A 4RQPB 1DYPA 5F6KA 1TE1B 4Y4YA 5L73A 3JU9A 4CDXA 2ZMNA 4AFDA 2QKDA 3IN9A 5BNPC 5CNAA 4OUSA 3AXDA 2NMOA 4FXGB 2D7FA 4DY5A 2GC2A 4XIKA 2GAUA 3EJKA 4FBFA 1KFUL 4IV1C 2HWD2 2QNKA 2PAMA 5KXEA 4XFBA 3PMSA 3AMMA 4EN9B 5C9AA 2D5HA 4QQHA 1MS9A 4AVCA 1NLSA 5SV8A 3ATGA 5HXVA 4OZXA 3VKLA 5K7PA 1ND2A 4YM3A 2XJUA 4AHWA 2XLFA 4GWNA 2R32A 2WFF1 4CDXB 1QH6A 2WZR3 4AFCA 4S2FA 2ZGMA 1LOFA 1SEFA 1O4YA 1DGWX 1LOCA 2CGNA 1ZRFA 4ZU7A 5GALA 2ZGRA 3GYDA 1G9FA 4Y1XA 3IPVA 3WUCA 1O4ZA 1VP6A 1GV9A 4I3PA 2W68A 4YVWA 1SLCA 1Z0HA 4IEWA 1U5IA 1MS0A 4O9EA 5J36A 5FO8B 3DPRC 2DCZA 4UW3A 5GLTA 5C9AB 1LGBA 1V9U2 2NYYA 5A33A 1LTEA 3V0BA 1DBNA 3FLRA 3ZSJA 3L2YA 5CBLA 1HRI3 2XWBB 3NJZA 3O14A 4JAAA 1JYCA 4JDOA 3MPPG 2MEV3 1RUI2 1LHNA 3AZWA 3FFZA 2PLV2 2XJTA 4Y20B 2GDFA 2RS13 1SLTA 1APNA 3AFGA 1LOGA 1UF2C 1LESA 1RMU2 4C90A 4QPIA 3FWEA 5T55A 2PHUA 2IFRA 3LOBA 2VOKA 1Y3TA 1W6PB 4OUMA 2YMZA 3IPVB 1XE8A 2VNGA 4YVWB 5F6LB 1PIV1 3ZXGA 5GZDA 1JUHA 2GNTA 2PHLA 3I8TA 1UZZA 1QJY1 3V0BB 3D6EA 4B8EA 3WG2A 5A33B 2IXCA 1S0GA 2VW2A 3ES1A 2WA4A 4IL7A 1FMD2 2ZGLA 1ZA4A 3TAYA 5CG8A 4WBBA 2ZS6B 4C0HA 1C28A 1F9KA 4XF1A 3WG1A 4DMIA 2ZAHA 4LBMA 1PO12 5I0RA 1Y43B 3BIWE 5L7OA 5DUXA 4OHXA 4GALA 4L9BA 1AJOA 2QVSB 2VXRA 4XXPA 4KWLA 4QD2A 4F7ZA 3LB9A 4WM7A 1RUE2 4JGZC 4QPIB 4Z07A 2R073 2A70A 4N7UA 3RDIA 1F5FA 1R1A3 4YGBA 1UL9A 4TWTA 2GSYA 3VBUB 4RD7A 4AEJA 1TMF1 4LLFA 3B93A 2E7AA 4YM1A 1HXS1 4YFZA 1H4GA 1R091 3ACLA 3AYDA 3NWKA 1RC6A 1X8MA 4HSJA 2PYTA 3TB0A 1WCDJ 4RR3C 4FPHA 4GB31 3ZFGA 1CD3G 2PFWA 2YGMA 2ZGPA 1WW7A 3WZ1A 5L7OB 3O12A 1CGPA 5CAZA 1POV0 2QQPA 3I7DA 4Q4W2 2FQPA 1VALA 5BNQA 4WM7B 3SITA 1PZ9A 4B4PA 1W0OA 3KZ4C 1RUC1 3ELNA 1H0BA 3KCXA 3OYWA 1LGCA 3EXUA 1RUF2 5CA6A 4HK9A 3JBG1 3D5OA 4RS5B 4Q26A 1WW6A 2X5IC 2YC0A 3JCIA 1DQ5A 1ZYBA 3INAA 4ZKTB 2D98A 3VBSA 5I8SA 3M7AA 1KS4A 4LO6B 4P5HA 1RVF3 1KDKA 4ITCA 4YRDA 1UAIA 4Q4V3 3H0OA 4HANA 4K1YA 4S2GA 3B02A 5E88A 3ZFGB 2DV9A 2CYFA 4AHYA 2XVLA 3M3OA 1F5JA 1AL22 4LA2A 1AR72 1CJPA 2JICA 3VDDC 2DYCA 2HEVF 5DDJ3 2KM2A 2NMNA 1F8VA 1DHKB 5T54A 1AZDA 3OYWB 3FFQA 2BEOA 1V6KA 1LHUA 2DVFA 3ZFEA 1BBT2 1QJU2 1WUVA 1O5LA 4YVSA 2W52A 3BU7A 3RMXA 2DFBA 1SLBA 1UN1A 4AVTA 4EWEA 4N9HA 4ATFA 3M3CA 3LA2A 1V00A 3O0XA 3VBSB 3H50A 1BXHA 4PIXA 1HX6A 4AGRA 4OHYA 1LHOA 3CNAA 4W6WA 1CVNA 5JPNB 1O5UA 1G86A 2JECA 3PVBB 5D1IA 1S0FA 2ETEA 5C8CA 2WZR1 1ZBE2 2XL9A 4EJRA 2ZGOA 5CADA 4EN6B 4FPCA 4YZ5A 5KXCA 1QH7A 3NKGA 2Q0AA 2VECA 4TLFA 1H2MA 4LO8A 3B00A 4ES8A 4FQZA 1Q43A 3TOJA 4OHZA 4H7LA 5FBZA 4YVSB 5KHKA 2CY6A 4XILA 1XRUA 4R8HA 3WW1A 1HRI1 3AYEA 1BMV1 3JZVA 2EXIA 2W08A 1HKDA 1QJX2 3KS7A 2A6VA 1PHMA 3AZXA 2MEV1 1HQNA 3DV8A 5IK5A 5ABJA 4MH0E 2PAKA 5C8CB 5EZWA 2RS11 2V73A 2IXKA 4WZFA 3D0JA 1J59A 4CEYB 4N7IA 2D40A 2GMEA 1BVVA 4C91A 1VB4A 1DZQA 2HWD3 1QXJA 3MICA 3AMNA 3BOWA 1VBB2 4CTEA 2WT1A 3AXEA 1REFA 1H2KA 2ILMA 1FV3A 2FZ1A 3M8LA 4QT6A 2R16A 1ZNPA 3QBQA 3U07A 3VZJA 2XGXA 3B3QE 1WD4A 2QZ3A 1OD5A 2HKXA 3WP5A 1LR5A 4R52A 1EYBA 3WLUA 5LEJA 1TNFA 1NY71 1T6GC 1UU5A 1PVXA 2D6LX 3J26N 4Q29A 5AVAA 4URTA 2R071 3GZAA 1OLQA 1R1A1 1S0JA 3J4UH 3LZZA 2JG8A 4KGGA 2RJKA 3LAGA 4J1WA 3PLQA 4L92A 5JOYA 4NWWA 2WT2A 2PQQA 5KXBA 2A71A 2ZX3A 1XU2A 1NZCA 4N43B 2IC1A 1ENXA 4JRLA 2DVDA 5LK7B 1XQNA 2ZZQA 2AYHA 3AKRA 5DG1A 2ZPXA 3W58A 5L19A 1I5ZA 5J3UA 3WDYA 3G7DA 1TEIA 4IEPA 1NE4A 1V6JA 3NV1A 3AJYA 2K0GA 1RL3A 3R4SA 2Q8OA 5HCFA 3E5UA 3MF6A 2DCTA 1FAYA 1WBFA 2JE9A 3USUB 1RMU3 2CGPA 1DQ1A 1VBA2 4RHV2 3ZDSA 4EROA 4LT5A 2R1BA 1ZZ9A 1Q8VA 2JG8B 4UBHA 4AVAA 2RS32 4Q1PA 1IS6A 1NA1B 4EWDA 1N1TA 5I93A 4ASMB 1LENA 4GXLA 1HRV2 4KWJA 4EV0A 2BWAA 1RVF1 4OI0A 3WW4A 1PK6B 3OGJA 5KC5A 4RA0A 4ZU5A 4Q4V1 1EP0A 4HVQA 1KJRA 1DIWA 1SACA 5FCCA 3AB0A 4E9KA 2K2SA 3WHUA 2ERFA 2GALA 1SLIA 4XFAA 1NG0A 2HEWF 4AXOA 1RUE3 3MZHA 5JCTA 2R062 4YSFA 4CEWC 1JOJA 4AVSA 3RS6A 1IPJA 1AYN2 1RUJ3 1ENRA 4NN0A 5DDJ1 5GKAC 4R4XA 1W6QA 1F31A 1YI9A 1BZWA 1C8NA 1YO8A 3H7JA 2JG9C 2OZJA 4JQRA 1EY2A 4IV1A 5EXOA 4AEKA 3KB5A 1LU1A 5KXDA 1WGPA 4IEYA 2WZPP 1YNAA 1X36A 1CONA 1C5IA 1H2NA 2WL1A 1UIKA 4LBQA 2DCYA 1C1LA 3KSCA 2WLPA 2G4IA 2B46X 4LA3A 4DZGA 3E6BA 4FPLA 3A0NA 1BQPA 4Q4W3 3E97A 3WT3A 3GBGA 4COWA 5CFDC 4J6GA 2Q5TA 1W6QB 2MNGA 3IM0A 4YGEA 3V64A 5L36A 3WDXA 1POV3 1WA4A 4XOGA 4IV1B 3H3UA 2XKPA 3ZFFA 1HIXA 2B7YA 4ORFA 2R6QA 2ZKNA 4C0BA 1YUDA 3D0SA 1DGRA 1YFXA 4L8QA 1IKQA 4Y5Z0 3GALA 4B3NA 3HD8B 3QCWA 2WS93 4NVPA 1MVQA 3WY6A 4FOQA 2BQPA 1SDWA 3PJYA 3FE5A 1OOPA 2HWD1 3WP3A 3CF6E 3V56A 4Y1ZA 4AEMA 4HLTA 1BBT3 5F9TA 1NCQC 1QJU3 4LBOA 3UK9A 1N3PA 2OVUA 1NXMA 3ZYJB 2GH8A 1PZ8A 2I74A 3BB6A 1UMZA 2CWSA 3IKWA 5T52A 1J1LA 2QDRA 1A78A 2SLIA 1H8VA 2WIIB 2FZ2A 5D8AC 3E5QA 3EO6A 5K9YA 1GR3A 3PJQA 3SCGA 2IXLA 3ILNA 1ZBE3 4AYUA 2R49A 3BCWA 4YW5A 2FMYA 3B69A 5JLVA 4FVVA 1HQWA 1MEC2 5I8YA 3ILFA 1IS5A 5LEKA 3ZN6A 4M0HA 3AMPA 4QPGC 5TSWA 3THPA 3NVCA 1DF0A 1SBFA 4HFSA 4JGZA 3JB4C 5T5OA 2XUMA 3LSDA 4IQPA 1LGNA 1FPN3 3PVEA 3V0AA 1I9RA 2BWCA 2RM22 4Q2FA 3TYJA 1ALYA 3D82A 3SISA 1Y7BA 1EPZA 3VKMA 4EN8B 2BBVA 1A8DA 3WUDA 3I2DA 1QJX3 1VLNA 2CTVA 4XZPA 2XJRA 1RB8G 4A7YA 3SH3A 3ZPYA 2JKBA 2MPFA 4BWOA 3U0ZA 4FPKA 3VKOA 2DTWA 3WP4A 3SCHA 3CJIC 2BVBA 1RMU1 2VGDA 4FTEA 1AUYA 4Z8BA 1GZWA 3EHKA 1RJ7A 3ZN6B 1QQP2 5GLWA 4M0NA 4AI0A 4P9JA 1FI2A 1YRZA 4QGMA 4JGZB 4LO4B 2ZGUA 4DB5A 1LOAA 3I54A 2VULA 1S0DA 3KCYA 3V0AB 2ZGTA 4LUKA 1UIJA 1YFWA 4YW1A 3HWJA 3DF0A 4M01A 3ZN5A 2XVGA 2HEYF 2X5IA 3PHMA 1VAKA 2A5ZA 1PZ7A 3K48A 2ZGKA 1S1AA 2KXLA 2WNUA 2ZGNA 3ZXJA 5FFOC 1BYHA 3WR0A 1ZBA2 5GZCA 1O3RA 5E16A 1D0GA 1N3OA 4HVRA 1LCLA 1RUE1 4GMP0 3N7MA 3WQ0A 1JUIA 3MW4A 1GZWB 1YCIA 2EF6A 5EV7A 4X8PA 5JWPA 1ND3C 1RUJ1 1NCRA 1JHNA 5C4WC 4YARA 3AFKA 3GBFA 1EPWA 1X8EA 3S6PA 1Z78A 1XU1A 2DVAA 2D3PA 2ET1A 3SLIA 2DTYA 4QU2A 3ZN4A 3M2MA 2YXSA 2E7TA 1HV0A 1YHFA 2QZ2A 1NLRA 4A7KA 3ROUA 1CIWA 2EXKA 1SQ4A 2HWB2 2X5IB 3HT2A 3MFAA 1MZ5A 5LK5A 2WNUB 4K20A 1L3JA 3BALA 2ARXA 3JQXA 4OI2A 1O7FA 3VL8A 1OA3A 3UJQA 3AKSA 3OCPA 3CU7A 2W0XA 4Q4W1 1G9BA 2VMHA 1VBA3 2C1FA 2DURA 1U5XA 2AH2A 5GLUA 2G9FA 2HYKA 2V09A 1KRIA 1NCRB 1ENSA 4LE3A 4P9LA 4PF5A 1ZM1A 5KWRA 2NN8A 1GYKA 4Y20A 2OIIA 4FT8A 4L97A 1AX0A 1POV1 1PGL2 2HJIA 1HRV3 3RSJA 4Q4Y3 1EV12 2DU1A 2PHTA 3SH4A 1W6PA 5GZFA 4K9SA 1BEV2 4JDNA 1KXGA 2ARBA 3B01A 4Y1VA 2WT0A 5JZGA 2YGLA 3DN7A 3TNQA 2AR6A 3RJRA 5IK7A 1AR82 1DQ4A 4JVAA 3RMYA 1SLAA 5I0UA 2WS91 2ZA9A 2B5HA 1OA4A 2WNVC 3ENRA 3CO2A 2R063 4S2DA 2CNAA 3KGZA 3ME2A 1AYN3 4BE3A 5BYNA 1AXZA 4KGQA 4QXKA 2D3RA 1VBC2 1U5YA 4ATEA 4YLZA 4X8NA 1BBT1 5FAXA 1QJU1 2H0VA 2Z42A 1WCKA 1GQGA 4J1XA 4FAHA 1AL0G 4A2UA 1QDCA 1UCXA 4TZDA 4X6QB 4K6BA 4LO5B 3VBUA 1UZYA 2RS53 5GLVA 5BNOC 1VAMA 5JDBA 4GWMA 2H6BA 1D0HA 1DU3D 2B39A 4YG3A 5JZGB 4P9GA 1REEA 2DUOA 2GU9A 1KD7A 1ZBE1 3RI9A 4HT1T 5KBFA 5AC93 4F3JA 1V6OA 3SXWA 1VBD3 3U10A 1YJKA 4B4RA 1R082 3RWNA 1RUD2 2ET7A 2DCKA 1COV2 1LECA 1FPN1 3RNSA 1VIWB 2GC0A 1CN1A 4YZ1A 4AI2A 5FLIA 2YROA 2W39A 5AFBA 3JD72 3GBWA 3WHTA 1RHI3 5HBAA 4NHLA 3ZXLA 2CAUA 1ULFA 1QJX1 1QNWA 4PDWC 3FX3A 5J09A 4RS5A 4O9GA 4P9YA 1VJ2A 1F2NA 1VBE3 1AHSA 2VUAA 5T5JA 4QX5A 1D4VB 1Y9QA 4ES9A 1AYM3 1C8M3 3T1LA 2Q30A 1DGWA 1UPIA 4GULA 2BNNA 1A6CA 1ZZ7A 3IBMA 2CV6A 4LLOA 2GC3A 1CR7A 4G4FA 5BNNC 1KS5A 1FOD2 2ZX0A 2UWBA 4CP0A 1WLCA 4I0BA 4DFSA 3WQ1A 2C0ZA 3VBFC 2VVDA 4XBQA 2H6CA 4AQTA 1OQEA 4FPGA 4OVEA 2XG3A 1SCSA 1N3QA 3HT1A 4HSLA 4Q1RA 1OFNA 1URXA 4BIOA 3E6DA 3RYRA 1MZEA 1RUG3 4DNYA 3RZZA 1KQRA 1OPOA 2ZGSA 1WMFA 1ZZBA 4COUA 1RUOA 5EFUA 1WBLA 1WW4A 3A0KA 1H8TC 1CPMA 3J8F2 1VRH3 4GA9A 1IS3A 3RJ2X 2ZX4A 4DRRA 3BTAA 2WQZC 1MS4A 2XWJB 5GLZA 2VPVA 4YW2A 4AHZA 4FCAA 3ZXDA 4IESA 4LBQD 4PBPA 1MR5A 2ZX2A 5FPZA 3APBA 1I1EA 1AR63 2QFEA 1ULCA 1W39A 2HWE3 3IWZA 4YZ3A 1C5HA 4XJUA 4GIQA 3AKQA 3GNEA 4KNCA 4ISRA 2P34A 4HK8A 4KU8A 5FQ0A 2X53S 4XFHA 1VBA1 5K0UC 5AFEA 4WM8A 1UW8A 1OA2A 1EAH3 3VLBB 5JOXA 1QNYA 1HV1A 1CESA 5KC6A 2F6BA 3MLJA 4I09A 4ASLA 4SBVA 4XTMA 4AI8A 2IZWA 1HRV1 2VMGA 4CEYA 1J58A 3AZYA 3R0RA 4Q4Y1 3KQRA 1DQ0A 2PHWA 5FLHA 4LULA 4H55A 3LWCA 1DG6A 5J98B 3WX5A 4UBGA 2GN7A 2JG9B 1FYUA 2DFCA 2B42B 4C1XA 3ZSKA 4DY3A 2YPJA 4IEOA 5JPMB 3WQ7A 2D93A 1ND2C 4YM2A 5DUVA 2Z2SB 4LHLA 2CWMA 5LRSA 4M3CE 1PM7A 1XYOA 2EVXA 3B5LB 1SBEA 3N7LA 4N53A 2R061 2G9GA 5FQ0B 4IEQA 1TME2 3POSA 4PCRA 2Y0OA 3R05A 4WM8B 2DWRA 4QPYA 2EALA 1AYN1 3AP6A 3FHIB 4IEUA 1LOFC 2I07B 3B7MA 4YGCA 1IPKA 2VH9A 4XETA 3VKNA 1XNKA 4CDUC 4B7EA 1DFQA 1KJLA 3IT8A 3OF1A 2XL7A 4GMP3 4XPVA 4AFBA 1IZ3A 2D6PA 3LKJA 4G3YC 3MDPA 1AXKA 1UPSA 2HWB3 2QDNA 2GNMA 2RS51 3GZUC 4LBLA 3AMQA 4IEZA 5KHHA 3AJZA 4N43A 3THTA 5A3LA 5GZEA 2E6VA 4WVZA 5DZEA 2OPKA 1HXS2 2WFPA 4E4DX 5D8AA 4R9AA 3KT7A 5A32A 5AC91 1H30A 1R092 2H0BA 1QY4A 1VBD1 4N53B 4GH4C 1N1VA 3BODA 3R4DB 3K51A 1DDLA 1OMIA 5EWSA 1Q8QA 1H9WA 4GB32 1YIPA 4EN7B 3N35A 4QPIC 3VBRC 2ZBJA 3FJSA 4FPFA 3CLPA 1LJ7A 3USUA 3AKTA 5KHJA 2O0OA 1LODA 5EJ3A 1W6NA 4FP2A 4QPGA 2LM3A 1NYWA 1CPNA 3M3IA 5H9SA 1A8MA 1YI7A 1RHI1 1I6XA 1RUC2 1CX4A 1OQDA 3SCFA 1ASJ2 1NA1A 2PHFA 1ULEA 3ETQA 1G9DA 2Q1MA 4NOTA 2VY0A 5JVVA 2JE7A 1HW5A 2A73B 2XLGA 2AGSA 1HDKA 1V9U3 3N7JA 1VBE1 4WVMA 4PLMA 4QQ2A 4HN0A 2V5YA 2D6KA 5D8AB 1AYM1 2LUWA 1C8M1 4ISQA 5A32B 1PK6A 2O8QA 3O0WA 4JTOA 4Z2WA 2ZJCA 4JCKA 5L7OC 4JGYC 2K9ZA 3Q9OA 3CJIA 3ECQA 4UW4A 2DCJA 5H9PA 4AVVA 4COYA 1RUI3 3UKVA 2PLV3 2R1DA 4PIYA 3OGGA 3IMNA 4DPNA 1X82A 4Y1YA 2P3KA 1W6NB 4QPGB 2ZOEB 5BY5A 1FX5A 4KH9A 1VR3A 3FBYA 3HBZA 1K5MC 1QU0A 4XDQA 1YIFA 3AYCA 3T1MA 1PGW1 1V6NA 1Z7S2 4XJ8A 5C6CA 3WG3A 4RL7A 5CG9A 1B35C 1VAVA 5DXDA 1ZVFA 4WVMB 1WLDA 4NR1A 3S30A 2O8OA 4U2AA 2RR12 4XIOA 1RUG1 4DINB 1QKQA 1FMD3 3PNAA 4LBKA 3CJIB 5K8SA 1PO13 2I2SA 4QM9A 4I0WB 4F83A 1RUD3 1VRH1 3D4KA 4CZSA 1COV3 4G9SB 2A6ZA 4BLIA 2BNOA 2EXJA 3VBOC 5BNPA 1XNCA 3OY8B 4XJWA 4RGAA 1G9AA 1AR61 3POWA 3O5SA 2HWC2 3UL2A 2HWE1 2Q4SA 1G9CA 5J48A 2P37A 2D6NA 3VBSC