1XYOA

Structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE II
publication title Structural comparison of two major endo-1,4-xylanases from Trichoderma reesei.
pubmed doi rcsb
source organism Hypocrea jecorina
total genus 54
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xyoA00
2JENA 2B46X 2F6BA 3AKTA 5EJ3A 4HKOA 1W2UA 4S2HA 1OLRA 3WX5A 3VHPA 1REFA 3MF6A 1H4HA 5HXVA 1OLQA 3AKSA 2BVVA 2D98A 2JICA 1XNDA 3WQ7A 3LB9A 3VHNA 2D97A 3VZNA 1QH6A 1TE1B 2BW8A 4S2FA 3RI8A 3LGRA 1AXKA 1HV0A 3AMQA 3AKRA 1QH7A 3WXPA 2VGDA 3VL8A 4IXLA 3B7MA 4HK9A 2QZ2A 2B45X 2DFCA 1REDA 3WY6A 1XNKA 3VLBB 1BVVA 1XNCA 2DCZA 4HK8A 2BWCA 1XNBA 2Z79A 3VZOA 1XXNA 1OA3A 1XYOA 3VZJA 1T6GC 3O7OA 3WP3A 2JEMA 2VULA 1HV1A 1NLRA 3WQ0A 5K7PA 1IGOA 3WP6A 3RI9A 3AMMA 3HD8B 1M4WA 3WP4A 4S2DA 3ZSEA 1H0BA 3B5LB 4XQ4A 5K9YA 1C5IA 1OA2A 3MFAA 1XYNA 3AKPA 1BK1A 2DFBA 4XQWA 1XYPA 4XPVA 2C1FA 3WT3A 4NPRA 1KS4A 1HIXA 1KS5A 2DCYA 2VUJA 3VZKA 3AMNA 3MF9A 1C5HA 1UU4A 2QZ3A 1UU5A 3EXUA 3WP5A 3MFCA 4HKWA 1F5JA 4HKLA 3AMPA 1H1AA 3WQ1A 1BCXA 3M4FA 2DCJA 2VG9A 1H4GA 1H8VA 3VL9A 3VZMA 1PVXA 3VGIA 4H7MA 3WR0A 3VZLA 3AMHA 2BWAA 1YNAA 1ENXA 1REEA 1UU6A 1OA4A 3AKQA 4XQDA 4S2GA 2B42B 2NLRA 1UKRA 2DCKA 3VHOA 2NQYA
chains in the Genus database with same CATH superfamily
2R042 4K3UA 2YY1A 4AI8A 4NR1A 3OUJA 4KU8A 3PDQA 2GC0A 5FWJA 3ZFGB 4YGEA 4AFBA 1GNYA 2YBPA 3GGLA 3ON7A 4HFSA 2YROA 4A6OA 1AX0A 1R083 2BOIA 4JTNA 3F95A 1GZTA 1GZWB 4URTA 4YVSC 1WKYA 1LJ7A 1FPN2 1NAEA 3WW1A 4YPJA 1F4AA 2AZ5A 2AACA 1O91A 4Q8LA 2JKBA 4YW6A 1G9BA 2JECA 2WNVC 2VNOA 4DUVA 1PK6C 4E4DX 3HNYM 4COYA 2F4PA 1I9RA 2E53A 3OGJA 5IFPA 3NJXA 4U2AA 2WC2A 3CZUA 1X82A 4QXCA 2Y6HA 3WCRA 4LOTA 4NPMA 4CDUA 4OUMA 2R071 2I45A 1NCRA 1MS9A 2D5FA 3NW4A 5H9RA 1OH4A 1NZCA 3B69A 4BQ2A 1AYM1 1ENRA 1LOGA 2XUMA 4Q4X3 4R9BA 2A3WA 1WCSA 1VR3A 3T1MA 2WZEA 1APNA 1F8VA 5HV0A 2JG8A 1DIWA 1RIRA 1EV11 2WN3A 2ZMLA 4QM9A 3WLUA 1YQCA 4KH9A 4CCDA 4RGGA 1H2KA 3I2DA 1JZ4A 1JZ5A 5J98B 4R9DA 1LEDA 5A70A 1XU2A 1KFXL 2HWF3 4R9AA 4N43C 4HBNA 1N3PA 1AX2A 5C5TA 3VBSC 5AVPA 1UAIA 1YIPA 1RUOA 1J84A 2QQOA 3FLPA 3FN9A 4Y1VA 1ZYBA 3B94A 3DF0A 3CIHA 4CDQA 1Z7S3 5K0UB 1MZ6A 5H9SA 1MS0A 3K51A 3EMRA 4G3YC 3KLSA 4L99A 5IWFA 4YW5A 3VD3A 4CCEA 1ND3A 5LW9A 3ZKUA 4RL7A 4AWDA 5BUVA 4D6QA 4ONUA 1YJKA 4HMZA 4XCAA 4AFAA 4OVEA 1ZA7A 3OY8A 3ZYBA 4AQ2A 4N9IA 2YB7A 4N90A 4OLLA 2HWC1 4R8HA 4Y5SA 1CZVA 5A80A 1A78A 4FOYA 1V6JA 1JYNA 2QQJA 1KS4A 5FZAA 3G7DA 4HSJA 5GZCA 4Q29A 1OXCA 4HPKB 5IW0A 1JOJA 2ZGNA 1QQP1 4ARXA 1H9WA 2PQQA 2LM3A 3EXUA 2CGPA 1XPWA 5FYHA 3J4UH 2W46A 4W65A 5IFTA 1D0HA 4B4RA 1BMV1 3WZ1A 2RDSA 1QF3A 1W3XA 2R0FA 5FP7A 1PZ9A 1C28A 4XUQA 4BB3A 2X05A 4ZZ5A 2UWBA 3AB0A 1EP0A 2ZGPA 3MO4A 4EN8B 3OPWA 4Q4W3 1AYM3 2KM2A 3BVCA 3K2OA 5F6LB 1RVF1 5BPXA 1JZ7A 2YYOA 3AMHA 1RJ8A 1W8OA 1UIJA 1B35C 2QVSB 2XH6A 5L36A 4CUBA 2RG4A 4QX2A 5FQ0A 4E27A 4KBBA 5BXXA 1AR63 1CX4A 1DQ1A 3ZXGA 5FZ8A 3UJQA 5EIYB 1VBC3 5JPMB 4XACA 1O3TA 4RQPA 2B46X 2VCBA 4RFT0 5JAXA 3AZVA 5A1FA 2BP6A 4PDWC 2XLGA 4IE4A 1W28A 3IIIA 4Q4V2 3W59A 5ABJA 2BEOA 1H4HA 5FZDA 5C8CA 3BI3A 3HBZA 1DQ4A 5HI0A 4GXLA 5SV5A 4XCBA 1XE8A 2NMOA 3JBG2 3MLKA 5LA0A 2Y6KA 3TEYA 2YBKA 3Q8CA 4X8NA 1IHMA 1LOEA 5L7OA 3IBMA 5T5PA 1Y43B 2A1XA 1JOPA 3D0SA 2K46A 2R041 4XUTA 4ASMB 5EHDA 1XNTA 3ZSMA 3RZLA 1JH5A 5DZEA 5IVCA 3ZN6B 3KV4A 3CEWA 5FOJB 3SEPA 1SHWB 5GLVA 3VBUB 2WZPP 2OX0A 2G4IA 1FPN1 1REDA 4Z07A 2HBTA 3OGSA 4N8MA 5D21A 4AL9A 4CEYA 4P9WA 5E16A 2PMWB 2VTFA 2DVGA 1D0GA 1SCSA 1PO12 1W8WA 4HK8A 4FCAA 2ARCA 3KMHA 4MXVA 2XJTA 5FP9A 3SH5A 5JI9A 2D40A 2YC2A 4GH4C 3H7YA 1PMJX 4BQ1A 3BTXA 1HW5A 4QGMA 3EJKA 4WZCA 4NIHA 4LNVA 5JPNB 3W20A 3RNSA 3Q9OA 3NJZA 5BNPB 2BFUS 4RS5B 5FPXA 3AYAA 5F7UA 5JXHA 2Z42A 2EICA 4S2DA 3ZSEA 4O65A 3WDWA 1SFPA 4BJ0A 4XQ4A 2IUWA 4UFLA 2GC1A 3Q8BA 1VBB3 2CL2A 5DG1A 2Y6FA 3MFAA 1OVSA 2RS32 1UYPA 2VBDA 3RVHA 3NRUA 1HRV2 4ZKTB 5DAVA 3N4MA 2VH9A 3PVEA 5FXXA 2XQXA 2Q1MA 4ARYA 3NSTA 1I3HA 3ZFFB 4QDRA 3AMNA 5LEKA 2VNRA 2ZGLA 1CAWB 1UKGA 4UBGA 2RDQA 2AREA 3NL1A 3P1IA 4QPGA 1KITA 3NMBA 3ZIXA 3N9PA 1KGYA 2E26A 4BHPA 5A3LA 4AGRA 1MS1A 3AX4A 4OUEA 4I3PA 3WQ1A 4DEQA 3B01A 5J96B 1A6CA 1UYYA 2JDMA 2BRTA 1ZX5A 2VTXA 3MYXA 4GA9A 3FJSA 3IKWA 3M3OA 1YQ2A 1VMFA 4PF1A 3HAGA 4QXKA 4XDPA 3VBHB 4GKXA 2VOVA 1ZZ6A 2VMEA 5BNNC 1HQWA 4META 2WLPA 1H6XA 4OULA 4CVUA 5JCTA 1GOHA 3AKQA 3UGFA 2D5HA 2OQ6A 2R30A 4FPKA 5FY0A 5IVYA 3ZX7A 2W3JA 4MLOA 5FLHA 2VQTA 1LB2A 4I09A 2C9KA 2LRPA 2NP0A 5FYTA 5IK7A 5H9PA 4D6RA 2G19A 3NAPC 4QDQA 1UPSA 3H3UA 4GKYA 5FCCA 2VVFA 1WW6A 4L97A 4UBHA 1UOJA 1VAMA 5FY8A 4PJYA 1FI2A 1O6UA 1AR71 3PU3A 5EFUA 4QAWA 5FWEA 2E9QA 5JWPA 1XB9A 1R1A2 3AKSA 1I5PA 1IQAA 2BNMA 3JQWA 3MW4A 5LWBA 2P17A 2JICA 3T09A 3W21A 1MQTC 1WMEA 5F37A 1R092 4NAOA 3SC7X 4CDWC 3BU0A 1WCDJ 2AENA 2R062 3MI8A 1NA1A 4ES9A 3T0AA 2D3PA 2RR11 1L7LA 2DUOA 2FCTA 3MLJA 5G05L 5T5LA 4FO9A 3IPVB 3S6PA 3IDBB 4GB31 1QDOA 4JZRA 4KNCA 1CAXB 4JHZA 1HJGA 2HEVF 2W9XA 2YC0A 1OD5A 2JG8B 2GMPA 2JDKA 1NOVA 4Q4V1 4YG3A 5DUUA 4AI0A 3ZIWA 3LEGA 1G9FA 2ZJCA 4NRPA 4CEWC 1VBD1 5FZGA 2XJSA 3N9OA 1GZCA 2WO1A 2DCTA 3P3PA 2D6MA 2HBUA 5A7WA 4AVBA 4BOWA 2VR4A 1F31A 3JBG1 2ZX0A 2ARBA 4CZSA 5LK5A 2R32A 1LR5A 4P9LA 5C6CA 1BBT2 4LO7A 2C5DA 2O1QA 5C9AA 1O4TA 3WP3A 3O7OA 4XMAA 2GN7A 2OA2A 4NWVA 3RMYA 5J1XA 2WDBA 2Y8KA 2FMDA 4Z82A 4AQ6A 2RJ2A 3H1WA 3AMMA 2FQPA 2H6BA 2MEV1 4HANA 4LIVA 1M4WA 1GSLA 1C3HA 4C91A 1UNBA 2WAOA 3JB4C 4P02B 5D8AA 2P34A 2E33A 3OY8B 1OQEA 3KCYA 3QOPA 3LE0A 3KHBA 1JI6A 2W1UA 2JDAA 3OOXA 3WVJA 3V0BA 1C5IA 4FOQA 3KV9A 4Y26A 4HSLA 3FBMA 2JDNA 2DF7A 3L2YA 1PO11 1XYNA 1MR5A 1AR73 1RUI2 1W8ZA 2RM23 4HT1T 4PIYA 2ETEA 4QMAA 4XQWA 1VALA 1YIFA 3D8CA 1X33A 2EIEA 2C1FA 1PGL2 3PIGA 1FATA 3WT3A 2DCYA 2VO5A 5E88A 2J1EA 1MZFA 2HLEA 2ZHLA 4M4PA 4OI1A 5J48A 1UU5A 4B4QA 4F3JA 5J7MA 3RS6A 3FHIB 2FHRA 2WSVA 4LO4B 4XJAA 3WCSA 3W5NA 2RR13 3GCWA 1O3QA 4XIKA 4L9BA 3OEBA 1BCXA 3O1RA 4B29A 1FOD2 3GXUA 1VRH3 4GB33 4GMP0 4CDXA 2Q1FA 4BLJA 3C7OA 2RJKA 4JX0A 4EV0A 2YFUA 5FYSA 4B1LA 2EXJA 5A6QA 2RS31 5F3EA 1D4M2 2W1SA 3PMEA 1JXNA 2TUNA 4A4AA 1HX6A 1HRV1 1KXGA 1VBD3 2IWGB 2P3YA 5FQ0B 3X29B 3BALA 3V0AA 3LEKA 4FQZA 4RQPB 3QLQA 1OA4A 2QQKA 2NLRA 3OEAA 5EWSA 3C7GA 4FFIA 1Y9QA 5FZOB 1B09A 1RTVA 4E4ZA 5ABJB 2VY0A 3ACFA 5T50A 1DU3D 2VMDA 4MX3A 4QX0A 4S2HA 5A1AA 3FLTA 2VQUA 5F2WA 4EWDA 3MIEA 2JDPA 2TEPA 4UOJA 5DQ0A 3A0KA 2C6SA 1UWWA 2MEV3 2P2KA 5JR7B 3SKVA 1XJAA 3GZEA 2GNDA 4AEMA 4EZ4A 1W99A 1ZA4A 3ACHA 4K1YA 4Y20A 2N7GA 1TQ5A 1UX6A 1WA4A 2CAVA 4IERA 3PL0A 3AP6A 3ZYFA 5FY9A 4DIQA 5HV4A 5EV7A 3J8F2 5L7OB 4FPOB 4MXWA 5A7SA 3O0XA 1WA6X 1AF9A 2A3YA 3M3CA 4N43A 1D2SA 2ZEWA 1FNZA 1WCKA 4I0AA 2VTXJ 3VBSA 1COV2 3BTZA 3VKNA 1HN0A 4HVQA 2RDNA 1LECA 1O59A 1QU0A 5CB7A 3URFA 5KC6A 4YLZA 3ITQA 1Y4WA 3GBFA 5IJRA 4B3NA 2WWJA 4CEYB 2P6HA 4UAPA 1PZ7A 3LIHA 2XDVA 3K3NA 3PTRB 4NO4A 3IAQA 1LOCA 1QNYA 4YZ4A 1W6OA 2JG9C 5FMCA 3ZPOA 5A32A 1CR7A 2Q4SA 1R1A1 1BKZA 3ZN4A 2J1RA 1BEV2 4QHBA 4UW6A 1DYOA 2DCZA 5FZFA 2CNAA 1UYXA 3O12A 4IV3A 1R091 4FXKB 1RINA 3K75B 3KV5A 2GH2A 2JE9A 4QDSA 1RUG2 2Z69A 4E8CA 4QPWA 1XYOA 2R061 1ASJ1 3S7EA 3FUQA 5FZBA 1HV1A 2VQAA 3ENRA 3WP6A 3D0JA 4R52A 2GNMA 2VAUA 1FMD3 1R082 3HD8B 4WBBA 5DUWA 5E1RA 4QB2A 3AZYA 3K77A 4SBVA 4AYUA 5CADA 5IK4A 2DVAA 1SLTA 2CGOA 4IUGA 2YU1A 1AL0G 1OH3A 1U0AA 4J1XA 5FZ6A 3ZXDA 5LK7B 5IAVA 3TEXA 3AP7A 1RITA 1POQA 3VV1A 1LHNA 3RZGA 3PHMA 1V70A 1BBT1 1K5MC 2ZKNA 3BPSA 4XPVA 4AHZA 5IVVA 4NPRA 1X8MA 4QPGB 4UW5A 2QCSB 3POSA 4MGZE 2G1MA 5CEHA 4Y5Z0 5L73A 3WHTA 4WVZA 4NIIA 2ZTNA 4FFGA 1WCQA 2WFF3 4Q4X2 3K46A 4W6YA 1DZTA 1YJLA 1NE4A 3CLPA 3GCXA 4QQHA 3BTAA 4WVMB 2NPIA 4I01A 1AZDA 1H1AA 2AGSA 1BXHA 4YRDA 2EAKA 1DYPA 3A21A 3K3OA 4LKFA 4PI2A 4AI9A 1A8DA 3M8LA 2DURA 3NWKA 4ZPIA 4H7MA 3TWIA 1QJZA 1IS4A 2HWF2 5T5JA 3KHCA 3TAYA 4LBNA 3ZFEA 3U4SA 3KD4A 4DO0A 2UU8A 3WW3A 1ENXA 4BCUA 2RS13 4XVHA 1PGL1 5FPBA 4X6QB 4XBQA 3EYPA 5C4WC 4K8FA 1JUIA 5JXGA 4QXHA 1UY0A 4D3WA 1DFQA 1Z7S2 2DCKA 5I0RA 4AF9A 3CKHA 1CPNA 1NQJA 4NRQA 1QWRA 2PFWA 5D1IA 1ASJ3 5F3CA 4TN7A 3BUCA 3W58A 4GQ7A 1JZ8A 2Q1ZB 1GWKA 3E5QA 4QQPA 1TNRA 4XETA 2W39A 1FOD1 3DPRB 3OD4A 2GALA 1WLWA 3A7QA 3ZSJA 2QQNA 1C57A 5CISA 2EAAA 2JB4A 4Q4Y1 4UF0A 3TN93 2Q8CA 3ZXAC 5IVEA 1CD3G 1D4M1 4IGQA 4QQ2A 1BYHA 1ALYA 5ACA3 2IXCA 3LIGA 4XABA 4XF4A 4TZDA 1QDCA 5JI7A 2JIGA 4D0QA 2XBO3 1XSRA 4M0NA 4FAGA 2VXRA 3RZKA 5HCBA 5FZHA 1HV0A 2VZPA 1LKNA 2VCAA 3WXPA 4INDA 3E6DA 4IXLA 1KQRA 3DYPA 3RYKA 4LUMA 4DUWA 3BU7A 1Z78A 4HL0A 3VD5A 4OI0A 5DZFA 4AGVA 4Q4W2 1AYM2 3OD0A 2ZKLA 3RGBA 5LBEA 1CPMA 3MICA 3JQXA 4LEJA 4XJ9A 4QPIC 5IAXA 3J8F1 3I8TA 4AHWA 1AR62 4YVWA 3UT0A 2PAMA 1DQ5A 2ZXQA 3ROUA 5FXZA 1ODMA 3J7MA 3NNLA 1VBC2 1J1TA 5FZ1A 5JIUA 4MGYE 1QXPA 1COV1 1AHSA 5K7PA 1G6NA 2AUYA 5D8AB 4CCOA 1G86A 2WO7A 3B9CA 4NAMA 4B7EA 3ZYRA 3JZVA 3QH7A 4Y1UA 3KCCA 5KHKA 1HB2A 1W2NA 3B5LB 1VAVA 1W2AX 4COVA 3E5UA 3MDPA 4QKDA 4D8MA 4L11A 4P5HA 2ZABA 1BEV1 1SQ4A 3M3QA 2WAAA 4LBLA 1XC6A 1SLCA 5DPNA 2YC4A 3VKMA 5BNNA 5FPVA 3RPQA 2J1UA 1S0JA 4Q4Y3 2W1WA 1RUG1 5CBLA 1Q43A 3ZR6A 4DRRA 4C1WA 3FHQA 3HT2A 4YGBA 5T55A 1DGRN 1OBNA 5IUQA 5SV8A 3TEZA 1O3SA 5TSWA 3N35A 3NAPA 2PHWA 1R081 3ZMNA 4PF5A 3AZWA 1GANA 5LEJA 1TME3 2ES3A 5F5IA 4YGCA 3AYEA 4CTEA 1J1LA 5FMOS 2E31A 5BNOC 1OOPA 3LA2A 1YO8A 1DYKA 2HEYF 1S2KA 4YZ3A 3V0AB 4AXOA 4Z2AA 1POV3 5JZGA 3MHZA 3ES1A 3FFQA 2BGOA 1HXS3 2X5IB 4JKKA 1MQTA 5IVBA 1H9PA 1NZIA 4CDWA 2BWAA 4P9XA 5FUIA 2EIGA 4AE2A 4UFHA 4XQDA 2B9UA 2RVAA 3PTYA 4YW1A 4FPYA 2WJSA 2WA3A 2J1AA 4Q4X1 1OSGA 4YZ2A 4KMQA 3PJQA 4HKOA 3UJOA 1X50A 2W0XA 5DDJ3 5KWRA 4M3CB 2DBNA 1FX5A 5M0TA 5FK8A 3ZDVA 1E5IA 4XEZA 2ZMNA 2XG3A 2V72A 5DUVA 1AR81 5ERLA 1VBB2 3I3BA 5T3NA 4DUXA 3N7LA 3VBFA 3CHXA 5A3TA 2E32A 2Q0AA 2CYFA 2B7YA 4Q5OA 4ASLA 2DWRA 4LBKA 5JDBA 2WNUA 2HWF1 4OMDA 4Q1PA 4IW3A 1M06G 2D98A 4I3GA 1Q3EA 1L3JA 4NE9A 4Y33A 3WNLA 1YQ5A 4KI5M 1ULDA 2NMNA 3LB9A 3KT7A 1V00A 5DAPA 3RI8A 1EY2A 1Z7S1 2RS51 5DG2A 4WM8C 3RZHA 2UYAA 3I7DA 4BISA 4AQTA 2XHKA 4FBFA 3VBOA 1YI9A 1RGSA 3OF1A 1JYIA 2V5YA 2Y26A 4QQLA 2WS93 1QIQA 5D2AA 2OKXA 3VD7A 1NCQB 3UKTA 1O5LA 5BV6A 1G9DA 1JHNA 1QHDA 3MIHA 4KWUA 2YV8A 4QX8A 3FMGA 2WBKA 1OVPA 1Y7BA 1MZ5A 4IV3B 2W87A 4LO5B 2WRAA 1WMDA 3VDDA 5KHIA 5FYYA 1IS3A 3AFGA 3HNBM 3T30A 2HWB3 2XONA 5KHGA 1IPSA 1LAJA 3HN1A 1OKQA 3AVRA 4TTGA 5FUPA 1WZXA 2GC3A 2GC2A 2GSYA 1Z0HA 1XRUA 1LCLA 4KWLA 1W6NB 4BXSV 3QCWA 4ZS2A 4Q4W1 2WUHA 3N9MA 2VW2A 3AYDA 3D3AA 3I2KA 1W9YA 3PUIA 4D7SA 3MIBA 4RR3C 4FQ4A 4RYDA 1RJ7A 5JSPA 1EUUA 2ZPXA 3DUIA 1AR61 1AR83 1W6MA 2OIIA 4K40A 2W68A 5DXDA 3BCWA 4MOAA 4Q1RA 2DBIA 5FZ7A 4NHXA 1A3KA 1PNGA 1VBC1 1YCIA 3U10A 1V6LA 1VBE3 2VUJA 3VZKA 1IG3A 1O8PA 2GNBA 2WYSA 1W3VA 1RHI3 4JGYA 3WINE 3WP5A 3ZMOA 5FZEA 3DL3A 2RS53 2VZTA 2JXAA 4NIGA 3CL1A 5GLZA 3V65A 3WOGA 4IEWA 2G9FA 2GH8A 1UY1A 1TG7A 1X9PA 5EYXA 2ZHMA 3UGHA 1WWYA 3RG0A 1NKGA 5FZ0A 4CP9A 4LKSA 2YG0A 5APAA 1GBGA 1HLCA 1W6PA 4QHZA 4Y1YA 4AVCA 2XXZA 3WDXA 4LBQB 4N9HA 3T4VA 4R4ZA 3RDIA 4OQ8A 1LOFC 1UPIA 5LB6A 3UV9A 4BQWA 1DP0A 2RMU3 1VP6A 4WM7C 5KXDA 4LITA 1AR93 2PHRA 1AL21 2ADDA 4Q0PA 2BBAA 1XE0A 1GKBA 4I0BA 1W2UA 3CF6E 4CUCA 1F4HA 3HT1A 1NCQC 3ZFGC 4DPNA 3OBAA 1N1SA 2BV4A 2VZVA 2O8OA 1AR72 2E7QA 2RM22 4FPFA 4XHXA 3TNPB 1CIWA 1X8EA 5KHJA 4XF9A 3W5MA 2ZGOA 4GZ9A 4LHKA 4PQQA 3K4AA 1XNDA 5F5QA 1W9WA 4COWA 3AP4A 1J59A 4UT5A 3LD8A 1C8NA 4YSFA 3MBWA 4IEZA 5JMOA 4MGTA 1UXZA 2D7FA 3M1HA 2EA7A 4D69A 2RR12 3AMQA 3PVBB 3WUCA 2YXSA 4ISRA 3LEMA 2ARAA 1VMJA 5I0UA 3VL8A 4MSVA 1Q8QA 1T6BX 1CAVA 1VRH2 4GB32 4Q0VA 4BWOA 2HWD3 1IKQA 5KR7A 5AVAA 4IV1A 4AEDA 1VBB1 5KC5A 1LHUA 1JOBA 3HMYA 4DQAA 1LNSA 1FV3A 3R4UA 4YVWB 4XAAA 4FTEA 2FD8A 3FHAA 1DQ2A 3ZPYA 1VBD2 1RMU3 3ETQA 2W1QA 3V64A 3J7LA 3ZXJA 1MVQA 3GNEA 2AEZA 4JGZB 2PAKA 5GM0A 2NYYA 1NQDA 1O5UA 1H1MA 2LUWA 1MPXA 4IE7A 3CJIB 1DDLA 1UMIA 3WW2A 2FBEA 2ET1A 2JEMA 4PQ9A 2GU9A 5I0SA 1GWLA 5AC91 1IGOA 4AZZA 4DZGA 4MG2A 3RI9A 4Y22A 5CNAA 2MEV2 1TZOA 3B00A 3LSDA 1AL23 1D4VB 2XJRA 4W50A 5K0UC 1W90A 4GJYA 4O7XA 4LHSA 2R6QA 3WDYA 5JOXA 4AI3A 2JE8A 3USUB 4E8DA 1RB8G 1LHWA 1RXFA 1VB2A 1NY72 1W04A 1W39A 2R7EB 3N9QA 2OUHA 3AK0A 3DEMA 3I4IA 4HXCA 4HONA 2B4KA 3O1TA 2YPDA 1TNFA 4ASKA 4CU8A 2DDUA 2A70A 4AK3A 3NJYA 2W5FA 2HEWF 1UU4A 4OHYA 5JXIA 3SEEA 4BPZA 4XE9A 3CQOA 1YQ6A 1G9AA 3T08A 1OOPB 3I2OA 4BLIA 3VBRA 3O5SA 2FDIA 5JZGB 4LO6B 1O8SA 2WL1A 2PELA 5DMYA 2ZOEB 1R1ZA 5FRAA 5CFCC 5FUNA 4ZU5A 3J26N 4JC1A 3TEWA 3I2IA 1CWPA 3KVAA 3T1LA 1SPPA 3ACIA 4A44A 1NX9A 3INAA 3LOIA 3I3EA 2CV6A 4LR4A 5C3PA 4RD7A 3NV1A 4WZFA 4YWAA 2J7MA 4IEXA 4Z92B 3L9JT 4HN1A 4FAHA 4R4XA 5LY2A 5A3MA 1K42A 1UKRA 1QXJA 2RE9A 1FMD2 3FBYA 3HN3A 4QU2A 3VHOA 3WF4A 3ZSLA 3WW4A 3I2GA 4EWAA 4YW7A 5F6KA 4OQ9A 1OF3A 3IDEA 3VBFB 1I5ZA 2H0BA 4NIDA 1XSQA 5AC93 2IXKA 2MNGA 2YMZA 5L9RA 3ACLA 2WNUB 1MZEA 1PGW2 4HVOA 2ZGUA 5DN2A 2AC1A 2ET7A 3N9NA 1RUF3 3ECQA 2A6ZA 4XOGA 4QPIA 1TVGA 3CMGA 3WG2A 2Y0OA 2SLIA 4LLFA 2BUKA 1SEFA 1WUVA 2XJVA 4GULA 2QQLA 3ZXFA 5JVVA 3ZN5A 1SMVA 2D97A 4JGZC 2VUCA 2Z2SB 2EXHA 2EIDA 2WFF2 2QJVA 3I3QA 3UESA 2ZZQA 2D6KA 2BFUL 2ID4A 1QH7A 2Y6JA 3AKRA 1HB4A 5C7GA 4J6GA 4BQXA 4Y24A 3KVBA 2BPA2 1SBEA 3VDDB 3KSCA 1OQ1A 1YRZA 1FV2A 1RUJ3 3KGLA 4XJWA 1ZBE3 1JU4A 2WWUA 2RM21 3KWVA 3NNMA 3EO6A 4DXSA 5B4XA 3NKTA 3VBUC 4AEKA 1NXD1 1ZZ9A 4AVVA 1ND2A 1BVVA 2RS12 5FPUA 5KXBA 1XNCA 1YLLA 4LLOA 4QX5A 1EAH3 3H8UA 1IZ3A 2XHNA 2BWCA 4GWIA 4CDUB 1JHJA 3RMXA 3BB6A 3GDBA 5FP3A 3SISA 3OPTA 3SXWA 2HJIA 1K45A 1JODA 3JUUA 1NCRB 4E4HA 2A6YA 1ASJ2 1KDMA 1MS5A 1VAKA 1DF0A 3AJYA 5L9VA 1OHFA 4XDQA 1F2NA 4LBMA 4Y5TA 1VRH1 1H8TA 1CJDA 1NE6A 1CIYA 5FR3A 2ZGSA 1PIV1 1QNWA 4FOVA 3TN92 5BNPC 1W6MB 5EPAA 3HEIA 1ZRDA 1QOTA 4MGQA 4RS5C 3SH4A 5ACA2 3I49A 3HQUA 2BERA 2PQSA 2IVJA 2ORZA 3IM0A 1OC1A 4ZU7A 2AYHA 4MGKE 4IEQA 1RXGA 4A7KA 2DUQA 4JV4A 4OCTA 4CU9A 4N53A 3SITA 2XBO2 5HXMA 4FTBA 1NT0A 1CZSA 5CFDA 4JGYB 1GU3A 2PN5A 3ZDSA 2PA7A 4MUVA 1HIXA 4CDQB 3FWEA 3NNGA 3OSDA 1RUD3 1S55A 4QX3A 5ANQA 5JXJA 4PLMA 1ND3B 5I91A 2CU5A 3PURA 2FCVA 2PHFA 3ZFFC 1JTZX 1W8NA 4FPHA 2P3IA 4PBOA 1VMHA 2P6CA 5J37A 1HQNA 1ODNA 1W6PB 4MGSA 1JYCA 2DTWA 3PIJA 2VG9A 4N7IA 4BH9A 2XVKA 2GP3A 2G9GA 1NG0A 2A6WA 2YGLA 2YBSA 5CYYA 4I2OA 3VDAA 1SBFA 4WV8A 3UK9A 1NY71 2WIIB 3IMMA 4CYDA 2H0VA 5GLTA 1QOOA 3BYWA 4IGPA 2QKDA 4YNIA 3FUOA 4LBJA 2MPFA 2XL9A 3THTA 3VBHC 3E1F1 1JS9A 3ZR5A 4B7KA 4KG8A 3BOPA 2C0ZA 3LFMA 4KU7A 5L9BA 3MZHA 4YM2A 1IPJA 1HRI1 2A6VA 2VC9A 1EYBA 2F6BA 3POYA 4R9CA 5BYNA 4A45A 3ABZA 2ZX4A 4WVVA 2LROA 2CWSA 4YVSA 4UI9L 4LA3A 1XNAA 4ATEA 2BNNA 1OLQA 3ZXKA 1MEC3 1DZQA 1US2A 1UCXA 2DU0A 2CY6A 1MS4A 4XHBA 4Q4Y2 1PIV3 2WNVA 1ENQA 2W52A 2Y34A 1V9U3 1VBA3 1PK6A 2ZX3A 2DVBA 4B4PA 3FC0A 4D7YA 1S4CA 4NVPA 4CCCA 4ET7A 3GF6A 4NROA 2DUPA 2ERFA 4UFKA 1FMD1 1CAVB 2YUEA 2D6OX 1VRBA 2WINB 3SCFA 1OUXA 5LY1A 1RUE3 3UKNA 4IV1B 1TME2 4AEDB 2QBXA 2HH9A 2XR4A 4C0HA 5HCAA 4LTAA 3ZVXA 3MW3A 2TNFA 5A3OA 4HK9A 3WEZA 3PUHA 1S0CA 1XOYA 3POGA 2VMGA 2YFZA 3JCIA 1GP5A 4JCKA 5C8CB 1PGW1 3T2OA 2FDKA 3BPZA 3KB5A 4FFHA 4RFRB 4UFMA 3SQOA 1HXS2 3I3DA 4OYUA 4Z8BA 4RR3A 4YW4A 5A7QA 4OI4A 2JG8C 3UYJA 2ATFA 1O4ZA 1Q8VA 4GMP3 4FVVA 4PIZA 3PMSA 5FLJA 5I93A 1ZZBA 2VZUA 4RN5A 2VJXA 4NHKA 2Z79A 1JZ3A 2X8KA 3D5OA 1OA3A 1W6QA 3H3ZA 4XMIA 3O0WA 1UX7A 2V4AA 2WFF1 3BOWA 4FI9A 3RZMA 1RUH3 3PUQA 4V2VA 4JHTA 2FCUA 1CAUA 3H8OA 5DDJ2 1BLZA 3EB7A 3S7IA 3ILNA 1DGWA 3RJRA 5AFBA 1FYUA 3OB8A 1OFSA 4B8EA 2ZMKA 3KF5A 5LRSA 3MLLA 3F2ZA 2VECA 2X29A 1AVBA 1H0BA 1HRI3 2JKXA 4F8AA 2OS2A 5E6HA 5FXWA 1J3RA 2BDRA 4QU1A 3AL6A 2RS11 3MIDA 2FZ2A 2WABA 1NUKA 3NKGA 5FPAA 3T2QA 2IFWA 1GV9A 5FPLA 4DXZA 1UD1A 5IK5A 2QQWA 4U36A 3QH6A 4XFAA 3KV6A 2GMMA 3O0VA 3P6BA 4WM7A 3VDCA 3OUHA 1UY3A 1XBFA 2WS92 3VBRB 1JU3A 3I3MA 2XJPA 2VQ0A 2F4LA 4GWNA 2Q8EA 1PX4A 3HQRA 4TSVA 3T0BA 3GBWA 3POJA 3DYMA 5A3WA 4JKMA 3TN91 1SPPB 3ZFGA 1GQHA 4TYSA 1VE0A 1V6OA 2QQUA 2R16A 3D82A 4QPYA 1GNZA 4GALA 4XTPA 3WNKA 5ACA1 2HWB2 1IPKA 1WMFA 1WW4A 1PVXA 2A6XA 2WQ4A 1GZWA 2ZX2A 4CU6A 2ZS6B 2Z4FA 1QJX1 2V4VA 1B35A 2OW4A 2XBO1 4IESA 1HB3A 3RYRA 4URAA 1YNAA 1UU6A 2BGCA 2IFRA 1XU1A 2XVLA 4HLTA 3VUOA 2QNKA 3EQEA 4Y4RA 3BKZA 2B5HA 1LESA 4XF3A 2VUAA 1YC61 3AXDA 1ONAA 4RQPC 5LA9A 4EJRA 2GDFA 1PVC3 1L7RA 2IXJA 4BQ3A 3S30A 4PDWA 4XJ8A 2UWCA 5ABJC 2C4XA 2EIBA 2F17A 3U0ZA 4HETA 1AR82 5IK8A 3ZYJB 5C8CC 3S57A 3T0DA 3UGGA 1LODA 2EVXA 2UYBA 2DU1A 4RSUA 4F83A 3ALQA 1N3OA 2BVVA 3WNXA 2B8MA 1WGPA 1CVNA 1E5HA 3B93A 1IG0A 4OZOA 4P9GA 2K0GA 4YM1A 4K20A 4AHXA 1VBE2 5CKQA 4COZA 1QJFA 2D43A 5FMBA 1GFF2 4DEVA 5FZIA 1AJKA 2P3KA 1S2BA 4TLFA 1RHI2 1HDKA 1UMHA 5L7OC 2A5ZA 3FX3A 3RWKX 5B4NA 2ZGRA 1PGSA 4LIUA 2RS52 3RZZA 3O1MA 1I1EA 5EQUA 2VGDA 5JLVA 3ILRA 4A42A 1UOBA 1GP6A 2VNGA 5B2GB 1ND2B 2DV9A 3GM8A 4A3ZA 1U5YA 3M7AA 4CEYC 3IIAA 3POIA 5GZDA 4CXWA 4YYOA 3VLBB 3WF3A 4A6SA 5J3UA 2IXLA 1QY4A 2Y60A 2RMU2 1NA1B 2BU9A 1Q8SA 1AR92 2E63A 3Q8EA 4GH4A 3E6BA 2ZCWA 1T6GC 1OI6A 1QJX3 3N9LA 1O7FA 4MHUA 1H8TB 3POFA 1QJU3 2J1SA 4UFJA 1TME1 4YG6A 5C3OA 4AVSA 1C1FA 1AYN3 5DAXA 3C2UA 4HPKA 5C3QA 1GYKA 1UZ0A 3AP9A 5A3NA 1KD7A 3PNAA 1POV1 4PLOA 5A7WB 5JOWA 1HXS1 3JD71 1K12A 4N53B 3WDUA 3RQ0A 2VMIA 3BODA 5FY5A 4E9KA 5A33B 4PLNA 5K4LA 4K1ZA 5C9AB 4OI2A 3A23A 2XKPA 3RYPA 3RZJA 5FAXA 4BYYA 1ZM1A 1OLMA 1UN1A 1MS8A 4P08A 2JD9A 1VB4A 3E97A 5DDJ1 1HJFA 1V6NA 4XILA 4ZXKA 4FSJA 4QKNA 3T3YA 2HWD2 4EE2A 1OLME 4G9SB 4HZFA 5GZFA 4QPGC 4QGLA 4HN0A 4Y4YA 3V0BB 2QTWB 1JMUB 1G9CA 1RMU2 4BM8A 1G8WA 1DBNA 3ZLIA 3HJRA 4AGGA 1C8M3 3AM2A 3L2HA 3K48A 2K9ZA 3FZ3A 3VZMA 3QD6A 4XFGA 3APBA 3DXTA 3VKLA 1WCUA 5EP9A 2ZACA 4C8DA 3C3VA 4OHVA 4FXGB 1BJQA 4QQOA 1H2NA 2XVGA 3ME2A 4BZ4A 3AJZA 1KFUL 4IEOA 5I0DA 1N1VA 3S0MA 4Q26A 3E6CC 2WS91 4BQ5A 3NVCA 1O4YA 5F8PA 4L2NA 2JENA 1VIWB 2WZ8A 2RHPA 1ZNPA 2JIJA 4XURA 1Q8OA 3AKTA 4YVSB 1OKOA 1AL22 4UXAA 1QXRA 1U5ZA 4CDXB 1UZVA 3HOBA 2WO3A 5L19A 2HKXA 3POWA 4EROA 1E5RA 1BK0A 3HQXA 1UY2A 4H14A 4IEYA 2WNVB 4Q0QA 3VKFC 3OGVA 3KF3A 1PK6B 2LW8A 2XWBB 1CX1A 2HWB1 4Y3OA 1PX3A 1C1LA 4CRQA 3VBUA 4ZONA 1HN1A 3I2FA 4LKDA 3DPRC 1MACA 3JD73 5GLUA 3BIWE 5F9TA 2IC1A 4GIQA 3AYCA 2ZAAA 3KCXA 2W91A 2ZBJA 5FFOC 2PLV3 3CBNA 1JYTA 1ULEA 1TMF3 3CNAA 3MPBA 5LATA 1N1TA 2FDHA 2JJ6A 4OMCA 4NPLA 3THCA 3SLIA 3NNFA 4L0PA 4YGDA 4JQRA 4KQ7A 3NQHA 3U75A 4UW3A 2VPVA 1X7NA 2WWSA 1ULFA 4Y20B 5LBFA 4CXYA 2TBVA 1BHGA 2X10A 2DVFA 3KGZA 1GOFA 2DFCA 3EHKA 3Q8AA 4CEWA 4K21A 1SDDB 1G7YA 1NXMA 1NLQA 3HR9A 4MXWB 3WY6A 4LHLA 4FTSA 4CCMA 1XNKA 2VBBA 3WDTA 1W6QB 3PU8A 3LA7A 4N43B 2W47A 2X09A 4KGQA 4X6RB 4XZUG 1VBE1 5FYMA 1UZZA 3M70A 3VBSB 3WNNA 5HCFA 5T54A 2P37A 4RGAA 1CAUB 4YZ1A 2XMLA 5EJZB 2Q8OA 1UF2C 1S0FA 1RHI1 4P9YA 1F35A 1S0EA 4I30A 5C8WA 3SKJE 1ZBA3 4PIXA 4QX1A 1NLRA 4M00A 2D6NA 1XE7A 1DZRA 3SH3A 5JOYA 3VDBA 2VOKA 3IAPA 5IYYA 3PVNA 3UETA 5AC92 4BQ4A 3ZFFA 2CHHA 3OTFA 2WZR1 1AJOA 1H30A 5FP4A 1W6OB 5FZ4A 5FMOL 5A32B 1RUF2 1DGWX 2OVUA 4QB1A 5D8AC 4CPBD 4GWMA 4AVTA 1ZRCA 1A8MA 5FY4A 1X36A 1QKQA 1ULGA 3THDA 2MHFA 5A7PA 5I0TA 1NYWA 5HPOA 4FP2A 2RMU1 3ELNA 4OHXA 4QWNA 4XFIA 3E5XA 1AR91 5FYVA 1QJY3 3VBHA 1V0AA 3I97A 1Y9MA 2VW0A 5IHRA 1UXXX 1OMIA 1TEIA 2I2SA 5EJ1B 4XUOA 4BIFA 1WMXA 1W8UA 1ZRRA 3AC0A 3OYWA 1S0DA 5GKAC 5FDBA 1AUYA 2JDYA 3O14A 5J09A 4YZ5A 2Q5TA 3I54A 4XW3A 3WG1A 5FZ3A 1YWKA 1XQNA 3NV4A 3SHRA 2VCCA 4FPJA 2LS6A 1RUJ2 1E57A 2XPJA 3GALA 4RHV3 1GLHA 1ZBE2 3AMPA 5C70A 1EPWA 2ZX1A 3HPNA 4KWKA 4CDXC 3ZXLA 3NV2A 1H4GA 1B35B 1CZTA 2W2IA 3IN9A 2JDUA 1ULPA 3WNOA 1EAH2 4LOSA 3USSA 3VZLA 1PM7A 5JSRA 4JVAA 2XL7A 4FPGA 3U11A 5A3UA 3OPZA 1PO23 1IS6A 4N7UA 1OD3A 3S5QA 3ZSKA 2X5IC 2YHJA 1ZZ8A 1UW8A 4XF1A 5FOBB 1KEXA 1YFXA 1ENSA 2ZEZA 4PDWB 4D94A 2CAUA 2HWD1 3LPGA 4PT6A 2D3SA 3LEIA 2QE3A 2RV9A 1S0BA 4NJ4A 4BK4A 3N3HA 4A41A 1OLRA 4C90A 3IPVA 4QM8A 1LGBA 2JB8A 3DN7A 3KQRA 3VHPA 3WSOA 1RMU1 3WUDA 4YM0A 1DLLA 4XBLA 1CAXA 4LQRA 5HXVA 2WZR3 2VXJA 3ZFEB 4BQYA 4M0HA 2VOWA 4QGNA 1VJ2A 2VL4A 3OG2A 4NHLA 4GJZA 5FY1A 2FDFA 3VHRA 2J22A 2PHXA 2I07B 1LGNA 3KQ4B 4M3CF 4CU7A 2XUEA 3VHNA 2HYKA 1RUD2 4XFBA 3VZNA 4CP1A 5F3IA 1W8FA 2GAUA 1AXKA 2HWE3 4J1WA 2BTVC 1DQ0A 3LDBA 4W8JA 1OUSA 3H1MA 1JZ6A 3A0NA 3ZOIA 5A3PA 1ZZ7A 1QJEA 5FO8B 4CA9A 4FFFA 2VE1A 3SMHA 3DXUA 4DB5A 1RUNA 4NUBA 4UF0B 1L7QA 4LKEA 5LZ6A 2IXIA 1T2XA 4AQSA 2JG9A 2PXJA 2XJUA 2WYFA 3I2HA 4MVTA 2WT0A 1IQDC 4QB6A 4GH4B 4ZS3A 4HOOA 2ZA9A 4H3WA 2ZEYA 3AL5A 1RUC1 3GZUC 2P1BA 2KD7A 1H1IA 2KR2A 3R0RA 4IV3C 5I8TA 1U5IA 4XTMA 1JUHA 1YUDA 1SFYA 2OT7A 1Q5OA 4J25A 5G04L 2V5DA 1UZWA 3HNMA 4MGIE 5LA1A 1OF4A 2VM9A 1JYVA 5HCHA 3B3QE 4CSWA 2OPWA 1UIKA 4PHZA 4AEJA 4Q0UA 4CCLA 4D7TA 3QACA 3WNPA 4PCRA 1OT5A 2X53S 4E2QA 3ATGA 3TBDA 1MEC2 2R073 4OZXA 4Q27A 3N7KA 1OFNA 2VNVA 1PIV2 4NIAA 3U4XA 1V9U2 1VBA2 5CAZA 1UY4A 1KDKA 3VKOA 3DGTA 5LBCA 3D4KA 3O1PA 1N3QA 1RC6A 5DAWA 2UWAA 3WG4A 1WD4A 5FZMA 2AH2A 4XUPA 1K5MA 5FYBA 1EV13 3WF0A 1ACCA 2ZEXA 3GYDA 4KL1A 1RUE2 1KS5A 2A75A 2Y64A 4TXWA 5LRRA 3ST7A 4QHOA 1SACA 1KJRA 1C5HA 1WLCA 2O0OA 3FFZA 2VMFA 4FPEA 4L8QA 1LHVA 4GAZA 4HKWA 4I02A 5FZOA 1RUF1 3POEA 3TYJA 4Z2WA 2RDRA 3MPPG 5CZKA 5I8YA 4AG4A 5CA6A 3DKWA 5F5CA 3BGAA 4LORA 2EALA 4XJZA 3VL9A 4DMIA 5BNNB 2V73A 2G9ZA 4IQPA 5KXCA 3ZFEC 2PHLA 1RUH2 5FBZA 2HWC3 3IT8A 5C4WA 1I6XA 1Y3TA 4IEVA 4JDMA 1FNYA 3NAPB 2YPJA 1RUC3 1SLLA 1SFNA 1GWMA 5T52A 1S0GA 1RL3A 2NM1A 1W0OA 3AVSA 2C24A 5J36A 1HRI2 2VVEA 4UWDA 1RUJ1 2JX9A 1QQP3 2OPKA 2W08A 3WF2A 1ZBE1 5FZLA 4RA0A 3T4HB 3O1SA 4ZU4A 5JOZA 5DABA 2ZGMA 4FOWA 1MQTB 4A7ZA 4KBZA 1EAH1 2QQVA 3AZXA 2AR6A 3ASIA 4LULA 5GJ6A 4CDWB 5CG8A 2O14A 4K9SA 1Y9GA 4A3XA 1A34A 4DS0A 2YGMA 2Y0IA 1RVF3 2A71A 2BGPA 1YFUA 4EN6B 4S2FA 1YEWA 4G4FA 5FYUA 3WNMA 3LGRA 1CGPA 5FZ9A 4LUKA 3CJXA 2PTMA 2ZGKA 3O1VA 2VOXA 1SZBA 2VCMA 2Y6GA 3MW2A 3R4DB 3KZ4C 3EBRA 4LE3A 4CEWB 2GP5A 3O1UA 2VU9A 4CE8A 1N47A 4XXAA 5JMCA 2VZRA 4JQTA 5FIXA 4QKBA 1X9TA 2R1BA 3LDKA 5CKMA 3H9AA 1ST8A 4MHRA 2FMYA 4CPBA 4A2UA 5A7NA 4BIOA 2Q8DA 1GMMA 5DAQA 5FYCA 2KXLA 2PHTA 4YVWC 1JYWA 1IOAA 3H1YA 3ACGA 2OQ7A 3LKJA 2XLAA 4LO8A 1RUD1 4AHYA 1XXNA 5CKNA 3VBOB 4P5YA 1GOGA 2ORXA 2H6CA 2SBAA 3C7EA 1HB1A 1BZWA 1PVC2 1DGLA 5FPZA 3WF1A 3NO8A 3CJIC 4TLGA 5E8AA 5ANNA 4CCKA 3B02A 2R043 3HIFA 3U1XA 2VOTA 2XQRA 1FT9A 4BXFA 1QEXA 2P5BA 2YZ4A 4OUSA 4WVMA 4NHMA 2WT2A 1SG3A 3MUZ1 2E51A 1OA2A 1FPN3 2E7TA 1AXZA 4ORFA 3OYWB 1BK1A 2DFBA 3DV8A 1XYPA 4H7LA 4L92A 5FP8A 2P4EA 4DOUA 3MUY1 1CONA 4PBPA 4EQVA 4K7JA 1U5XA 3H0OA 5FJKA 3MF9A 1US3A 2QZ3A 4H2AA 2IXHA 4DY5A 4MADA 4XF0A 5A1LA 2OZ6A 1YQ8A 5C3RA 3WV6A 2OXBA 2VD7A 1K5JA 4ZHNA 1MEC1 2CTVA 2C26A 3AP5A 4IEPA 4O9GA 5BNOA 3M4FA 3I59A 1OOPC 1V9U1 1VBA1 1W9FA 2GMEA 1SCRA 1ZRIA 1H8VA 2QQMA 3JXSA 4CUGA 5JIAA 5JZGC 1YHFA 2VUDA 2QQIA 3DPRA 2ZZJA 3VGIA 2CWMA 5FKBA 3TOJA 1F15A 2J1TA 3G6JB 5H9QA 3RFRA 4LBQD 4BA6A 1D7PM 5C3SA 5GALA 1PMHX 1UMZA 4DNYA 2QDRA 5KXEA 1QJX2 2WN2A 1PM4A 1QJU2 4W6WA 3LDRA 5CG9A 1EPZA 1RUE1 4IL7A 1F9KA 3BTYA 2UY9A 4YG0A 1AYN2 2WFPA 1K3IA 2NQYA 1NLSA 3IDAA 5F5AA 1SBDA 4JDOA 5FYZA 4NMIA 3NJVA 4UFIA 2EF6A 3LCPA 2J1VA 4NRMA 4FP3A 4CP9B 1ULCA 2K2SA 3C7HA 3WX5A 5LA2A 4BMBA 1W8TA 4Z1VA 2YU2A 1SLIA 4GMP1 4LT5A 2A3XA 3LF7A 3VBFC 3VD4A 1V6MA 1URXA 2E7AA 2JDZA 1ZRFA 5KBFA 5FREA 3ZYGA 2WNUC 1DCSA 1UO9A 2VMCA 3SNMA 3R05A 4JTOA 4YARA 1RUH1 3CU7A 4P14A 1QH6A 1TE1B 2BW8A 3ZO0B 1WLDA 3IMNA 4WM8A 4QD2A 3M3IA 5FMDA 4P9JA 3VBOC 3LAGA 2JG9B 2ZGTA 2Q30A 2Z5WA 1LOBA 1W0PA 2QZ2A 4V2WA 2A7AA 1C8M2 3MIFA 5GZEA 4WVWA 3U14A 1LULA 4LJHA 4EN9B 4XFHA 3MGUA 4OHWA 3VDDC 4BDVB 4C1XA 3SCHA 3DKQA 2PHUA 2BJSA 2BNOA 3U78A 3ZYHA 4CCJA 3T2TA 2OUJA 1KJLA 2EXKA 4OHZA 3OGRA 3ZYPA 4JRLA 1DQ6A 4QXBA 3H8RA 4NWWA 4GWJA 1DG6A 2WKKA 2D6PA 3WQ0A 3UKVA 2UY8A 4MV2A 4CDUC 4X8PA 4P9IA 3RWNA 2RJLA 2ZHKA 5CIRA 3ORJA 5ISLA 1NCRC 4BMEA 1P8JA 2CDOA 2XB6C 3H8XA 3A4UA 3K4DA 4IGOA 5BY5A 2PAEA 5IT6A 2JDHA 5A6YA 1QMJA 2WNOA 5JR2A 1UOGA 3JD72 4Q4V3 1K5MB 2AEYA 1CJPA 1SLBA 1WW7A 2PLV2 2ADEA 2VVDA 5FYIA 2VMHA 3B9IA 2X5IA 1TMF2 2R0HA 1W9SA 3RJ2X 3JBG3 2DTYA 2JD4A 1N1YA 4Y22B 4ATFA 3I2JA 3T2PA 1LRHA 1PVC1 4JDNA 3TNQA 1W0NA 1Q56A 4AFCA 2WT1A 4JGYC 3GZTB 3IZOA 2D93A 5FK7A 4CDQC 4XYXA 4UYBA 1W03A 4ISQA 1F5JA 2XOMA 3FLRA 4OFGA 2XKOA 4AW7A 4DFSA 4CXXA 4F7ZA 5CFCA 1ND3C 2DCJA 1UZYA 1VPHA 3OGGA 4M3CA 3THPA 3LFIA 2OYZA 5CU1A 1YI7A 4QT6A 3U07A 1U12A 4LXLA 3H50A 5JSOA 2CGNA 5C4WB 5F39A 3CZJA 4M3CE 1W06A 3H3LA 1WW5A 1PNFA 3LZZA 4SLIA 3P5BA 1REEA 1ZBA2 3PJYA 3SCGA 3VN4A 1RYYA 4JRAA 2IVIB 1LOFA 4IDZA 2W94A 1PO13 1JBCA 4P00B 2B42B 3R4SA 4LPLA 1WBFA 4EN7B 2DYCA 5F3GA 1AX1A 4LE4A 3WDVA 1V6KA 5EJ3A 1J3QA 4Y1XA 4ZY9A 2VZ1A 4K6BA 4ES8A 1GQPA 1ULOA 2IZWA 2VZ3A 3IDCB 3MF6A 2Y38A 3OBTA 1NCQA 2BOJA 4LMFA 4MZUA 2WA4A 5EZWA 4EWEA 4M01A 3MV01 2C9AA 2D44A 2ZHNA 3GZAA 1PZ8A 3LQCA 1QJY2 2ILMA 3J7HA 3ZYIB 5HBAA 2LALA 1GUIA 5C5UA 1QJU1 1GZ9A 3GBGA 3VB9A 2RS33 4CUAA 1CESA 1HRV3 1AYN1 1S1AA 3PVOA 2HYXA 5F32A 4AAXA 1LEMA 1JZ2A 3OBRA 4LBOA 3UL2A 1LHOA 2CDPA 1LU1A 4AVAA 4RHV2 2B39A 2QQPA 1UOFA 2ZGQA 3B7MA 2CSGA 3J9SA 2B45X 1QGLA 1W6NA 2QUOA 5FBJA 4IV1C 4QPIB 4W6XA 3GHMA 4AEDC 2FDJA 2WNEA 3GJAA 1LGCA 1AXYA 1D2QA 4Y1ZA 5C33A 1C4RA 2WQ8A 5IVJA 4BK5A 1W05A 1PO22 3OUIA 3FE5A 5FLIA 4LK7A 4Q0SA 3AXEA 5BNQA 2GNTA 4AFDA 3AZZA 3UNPA 3WQBA 1BQPA 2NZ9A 3LOBA 4DINB 3LSEA 1KRIA 2E6VA 2VULA 3KT1A 2V09A 1OQDA 4CCNA 1GR3A 2XLFA 5KHHA 4XDOA 3JU9A 2JWPA 2L9LA 3C8XA 4M4RA 1UYZA 4UW4A 3W9AA 1HKDA 1VLNA 4XC9A 1C8M1 4ZXEA 2WZR2 5AFEA 3WP4A 2PYTA 5K0UA 3ZM8A 4HG6B 5K9YA 3AFKA 2GN3A 3HBKA 4D6SA 1W8HA 4DRVA 2DVDA 1DGRA 4O61A 1YFWA 1MVEA 1RUI1 4GD4A 4EZHA 4NHYA 3Q8FA 1R1A3 3H42B 2BYVE 4ITCA 5T5OA 2HWE2 2O8QA 1LENA 1YYNA 4EYUA 1DHKB 4E2SA 4FPCA 2PHDA 4LBQA 2Y33A 3O1OA 1R093 3JB8A 5BNOB 4YM3A 2R063 1GNHA 3LA3A 3MFCA 3GHNA 1EUTA 3I59B 3A22A 4V1PA 3VBRC 4XJUA 2FZ1A 4QKFA 4HKLA 1H6YA 3S5AA 4IE6A 4RGKA 1ZZCA 2A73B 4DXRA 1FAYA 3M2MA 5IATA 4IE5A 3RSJA 2ENRA 1J3PA 5FY7A 5LCWL 1E5SA 2OZJA 3WR0A 1CN1A 5CFDB 2WSUA 2PLV1 4AAPA 3P3NA 3V56A 5FO7B 3VD9A 5GLWA 5LBBA 1TMF1 1H2LA 4AR2A 1STMA 4H55A 2XJQA 1GP4A 5FZKA 5DUXA 1W2OA 4MO3M 3POBA 4S2GA 4XXPA 4BE3A 3GJBA 2GZWA 2VW1A 1BBT3 3D6EA 1Q8PA 2R1DA 3OJBA 5A6ZA 1FXZA 3MEPA 3RRDA 4B1MA 1S2EA 4E2GA 3BN6A 2R072 2UURA 5DZGA 2WR9A 4QX7A 4FPLA 4K8RB 4XFCA 1REFA 3DCQA 1SDWA 1WBLA 2WLQA 1GQGA 4YFWA 5E89A 5EXOA 4JAAA 5CVRA 1JW6A 3C7FA 4LHNA 2J42A 5FTTC 2QDNA 1EV12 2VZQA 4KGGA 4WM8B 4AI1A 5A6XA 1ZBA1 3ZKYA 3WQ7A 1IKPA 4JGZA 4XUNA 1SLAA 1RUI3 3HVDA 3KS7A 3CJIA 1J83A 3PLQA 3LPFA 5GZGA 3ES4A 2JE7A 1R64A 2ARXA 3M3EA 1LU2A 3H7JA 3KT4A 5IVFA 3N36A 3NNJA 1WLTA 4AI2A 2WO2A 3FL7A 1POV0 1H2MA 4LK6A 5I8SA 4E4SA 4Q8KA 3U37A 1QOSA 3ZN6A 4ZZ8A 3WHUA 1W9TA 2FDGA 1CQ9A 1FOD3 1BVP1 2VZSA 3WG3A 1QJY1 4XFFA 1ND2C 1PHMA 1PMIA 2HWC2 3USUA 1W2TA 1F5FA 1RUC2 1XNBA 1YFYA 1D4M3 3IB3A 3VZOA 2BBVA 3ILFA 4BU2A 4IETA 1YXWA 3VZJA 1UQXA 1ZVFA 4YFZA 1OPMA 2D3RA 3OBZA 1NA1C 5A7OA 5K8SA 1IS5A 1QQP2 3PUAA 4RHV1 3QBQA 2QFEA 4FT8A 4JKLA 4AOCA 4TWTA 3NV3A 1H8TC 3MIGA 4PI0A 1BMV2 1GICA 4RR3B 5JUVA 2I74A 2BQPA 4DXTA 3K4ZA 4MH0E 5BNPA 4I0WB 5FKCA 2W95A 4RS5A 4IE0A 2EXIA 4XAEA 1LTEA 3N7MA 4CP2A 4AFMA 1PO21 3HWJA 1RVF2 5FV3A 2XGXA 3KM5A 4NN0A 4NOTA 5C71A 1MS3A 2YDEA 3AKPA 1UL9A 3J7NA 2VZOA 4N53C 4XZPA 5FJHA 3WD5A 1LOAA 5CFDC 3J8F3 4Q2FA 4HVRA 3ZXEA 4C0BA 4IEUA 5C9AC 2LTNA 3LWCA 1J58A 3R6SA 4XIOA 2BVBA 1JN2P 1V6IA 3BIEA 1JYXA 5CFCB 1COV3 5LASA 2Y6LA 4DY3A 3CO2A 4W4ZA 5EYYA 4O9EA 5F2SA 1OURA 3TRSB 4A7YA 5F1RA 5FO9B 1CAWA 2VBPA 4COUA 3DECA 3IWZA 2KA3A 4KG0A 2NN8A 4CP0A 2P3JA 4MYEA 2XWJB 3DYOA 1OPOA 3PUSA 2D6LX 2W92A 1S0IA 4WM7B 4KWJA 1ZREA 2R49A 1BEV3 1DLCA 2HWE1 2ZAHA 3MV11 3OCPA 4EN0A 2BZDA 3N7JA 2B9VA 4LA2A 4YW2A 1O3RA 4XBNA 3ETPA 3CDZB 1HQLA 5FXVA 2WQZC 5FZCA 5A33A 3TB0A 1RUG3 4YW3A 1WD3A
chains in the Genus database with same CATH topology
2R042 4K3UA 2YY1A 4AI8A 4NR1A 4KU8A 2GC0A 3ZFGB 4YGEA 4AFBA 4HFSA 2YROA 1AX0A 1R083 4JTNA 4URTA 1GZWB 4YVSC 1LJ7A 1FPN2 3WW1A 2AZ5A 1O91A 4Q8LA 2JKBA 1G9BA 2JECA 2WNVC 2VNOA 1PK6C 4E4DX 4COYA 2F4PA 1I9RA 2E53A 3OGJA 4U2AA 2WC2A 1X82A 3WCRA 4CDUA 4OUMA 2R071 2I45A 1NCRA 1MS9A 2D5FA 3NW4A 5H9RA 1NZCA 3B69A 1AYM1 1ENRA 1LOGA 2XUMA 4Q4X3 4R9BA 2A3WA 1WCSA 1VR3A 3T1MA 1APNA 1F8VA 2JG8A 1DIWA 1RIRA 1EV11 2ZMLA 4QM9A 3WLUA 4KH9A 4RGGA 1H2KA 3I2DA 5J98B 4R9DA 1LEDA 1XU2A 1KFXL 2HWF3 4R9AA 4N43C 4HBNA 1N3PA 1AX2A 3VBSC 5AVPA 1UAIA 1YIPA 1RUOA 4Y1VA 3FLPA 4CDQA 1ZYBA 3B94A 3DF0A 5K0UB 1Z7S3 1MZ6A 5H9SA 1MS0A 3K51A 4G3YC 3KLSA 4L99A 4YW5A 1ND3A 4RL7A 4AWDA 5BUVA 4ONUA 1YJKA 4HMZA 4AFAA 4OVEA 3OY8A 4AQ2A 4N9IA 4N90A 4OLLA 2HWC1 4R8HA 1A78A 4FOYA 1V6JA 1KS4A 3G7DA 4HSJA 5GZCA 4Q29A 4HPKB 1JOJA 2ZGNA 1QQP1 1H9WA 2PQQA 2LM3A 3EXUA 2CGPA 3J4UH 4W65A 1D0HA 4B4RA 1BMV1 3WZ1A 1QF3A 2R0FA 1PZ9A 1C28A 2UWBA 3AB0A 1EP0A 2ZGPA 4EN8B 4Q4W3 1AYM3 2KM2A 5F6LB 1RVF1 5BPXA 2YYOA 3AMHA 1RJ8A 2XH6A 1UIJA 1B35C 2QVSB 5L36A 5FQ0A 4E27A 4KBBA 5BXXA 1AR63 1CX4A 1DQ1A 3ZXGA 3UJQA 1VBC3 5JPMB 1O3TA 4RQPA 2B46X 4RFT0 5JAXA 3AZVA 4PDWC 2XLGA 4Q4V2 3W59A 5ABJA 2BEOA 1H4HA 5C8CA 3HBZA 1DQ4A 5HI0A 4GXLA 5SV5A 1XE8A 2NMOA 3JBG2 3MLKA 4X8NA 1IHMA 1LOEA 5L7OA 3IBMA 5T5PA 1Y43B 3D0SA 2R041 4ASMB 3ZSMA 1JH5A 5DZEA 3ZN6B 5FOJB 3CEWA 3VBUB 5GLVA 2WZPP 2G4IA 1FPN1 1REDA 4Z07A 4CEYA 4P9WA 5E16A 2DVGA 1D0GA 1SCSA 1PO12 4HK8A 4FCAA 4MXVA 3KMHA 2XJTA 3SH5A 5JI9A 2D40A 4GH4C 3H7YA 4BQ1A 1HW5A 4QGMA 3EJKA 4WZCA 4LNVA 5JPNB 3RNSA 3Q9OA 3NJZA 5BNPB 2BFUS 4RS5B 5FPXA 3AYAA 2Z42A 4S2DA 3ZSEA 3WDWA 4XQ4A 2GC1A 1VBB3 2CL2A 5DG1A 3MFAA 2RS32 1HRV2 4ZKTB 3N4MA 2VH9A 3PVEA 2Q1MA 3NSTA 1I3HA 3ZFFB 3AMNA 5LEKA 2VNRA 2ZGLA 1CAWB 1UKGA 4UBGA 2AREA 3NL1A 4QPGA 1KITA 3ZIXA 4BHPA 5A3LA 4AGRA 1MS1A 3AX4A 5J96B 4I3PA 3WQ1A 3B01A 1A6CA 1ZX5A 3MYXA 4GA9A 3FJSA 3IKWA 3M3OA 3HAGA 4QXKA 3VBHB 4GKXA 2VOVA 1ZZ6A 5BNNC 1HQWA 4META 2WLPA 4OULA 5JCTA 3AKQA 2D5HA 2R30A 4FPKA 3ZX7A 4MLOA 5FLHA 1LB2A 4I09A 2NP0A 5IK7A 5H9PA 3NAPC 1UPSA 3H3UA 4GKYA 5FCCA 2VVFA 1WW6A 4L97A 4UBHA 1VAMA 4PJYA 1FI2A 1AR71 5EFUA 2E9QA 5JWPA 1R1A2 3AKSA 1IQAA 2BNMA 3JQWA 3MW4A 2P17A 2JICA 1MQTC 1WMEA 1R092 4CDWC 1WCDJ 2AENA 2R062 3MI8A 1NA1A 4ES9A 2D3PA 2RR11 2DUOA 3MLJA 5T5LA 4FO9A 3IPVB 3S6PA 3IDBB 4GB31 1QDOA 4KNCA 1CAXB 2YC0A 2HEVF 1OD5A 2JG8B 2GMPA 4Q4V1 1NOVA 5DUUA 4YG3A 4AI0A 1G9FA 2ZJCA 4CEWC 1VBD1 2XJSA 1GZCA 2DCTA 3P3PA 2D6MA 4AVBA 4BOWA 3JBG1 1F31A 2ZX0A 2ARBA 4CZSA 5LK5A 2R32A 1LR5A 4P9LA 5C6CA 1BBT2 4LO7A 2C5DA 2O1QA 5C9AA 1O4TA 3WP3A 3O7OA 4XMAA 2GN7A 2OA2A 4NWVA 3RMYA 4AQ6A 2FMDA 4Z82A 3H1WA 3AMMA 2FQPA 2H6BA 2MEV1 4HANA 1M4WA 1GSLA 1C3HA 4C91A 3JB4C 5D8AA 2P34A 3OY8B 1OQEA 3KCYA 3QOPA 3WVJA 3V0BA 1C5IA 4FOQA 4Y26A 4HSLA 3FBMA 3L2YA 2DF7A 1PO11 1XYNA 1MR5A 1AR73 1RUI2 2RM23 4HT1T 4PIYA 2ETEA 4QMAA 4XQWA 1VALA 1YIFA 3D8CA 1X33A 1PGL2 2C1FA 1FATA 3WT3A 2DCYA 5E88A 1MZFA 2ZHLA 4OI1A 5J48A 1UU5A 4B4QA 4F3JA 5J7MA 3RS6A 3FHIB 2FHRA 2WSVA 4LO4B 4XJAA 3WCSA 2RR13 1O3QA 4XIKA 4L9BA 1BCXA 4B29A 1FOD2 4GB33 1VRH3 4GMP0 4CDXA 4BLJA 2RJKA 4EV0A 2EXJA 2RS31 1D4M2 3PMEA 1JXNA 2TUNA 1KXGA 1HRV1 1HX6A 1VBD3 2IWGB 3V0AA 3X29B 3BALA 4FQZA 4RQPB 3QLQA 1OA4A 2NLRA 5EWSA 1Y9QA 1B09A 1RTVA 4E4ZA 5ABJB 2VY0A 5T50A 1DU3D 4MX3A 4S2HA 3FLTA 4EWDA 3MIEA 2TEPA 3A0KA 2MEV3 2P2KA 4YZ2A 5JR7B 2GNDA 4AEMA 1ZA4A 4K1YA 4Y20A 2N7GA 1TQ5A 1UX6A 1WA4A 2CAVA 4IERA 3AP6A 5L7OB 5EV7A 3J8F2 4FPOB 4MXWA 3O0XA 1AF9A 2A3YA 3M3CA 4N43A 1D2SA 1FNZA 1WCKA 4I0AA 3VBSA 1COV2 3VKNA 4HVQA 1LECA 5CB7A 1QU0A 3URFA 5KC6A 4YLZA 3GBFA 4B3NA 4CEYB 1PZ7A 4NO4A 1LOCA 1QNYA 4YZ4A 1W6OA 2JG9C 5A32A 1CR7A 2Q4SA 1R1A1 1BKZA 3ZN4A 1BEV2 4QHBA 4UW6A 2DCZA 2CNAA 3O12A 4IV3A 1R091 4FXKB 1RINA 2GH2A 2JE9A 1RUG2 2Z69A 1XYOA 2R061 1ASJ1 3S7EA 3FUQA 1HV1A 2VQAA 3ENRA 3WP6A 3D0JA 4R52A 2GNMA 1FMD3 1R082 3HD8B 4WBBA 5DUWA 5E1RA 3AZYA 4SBVA 4AYUA 5CADA 5IK4A 2DVAA 1SLTA 2CGOA 3ZXDA 1AL0G 5LK7B 1U0AA 4J1XA 3AP7A 1RITA 3VV1A 1LHNA 3PHMA 1V70A 1BBT1 1K5MC 2ZKNA 4XPVA 4AHZA 4NPRA 1X8MA 4QPGB 4UW5A 2QCSB 3POSA 4MGZE 4Y5Z0 5L73A 3WHTA 4WVZA 2ZTNA 2WFF3 4Q4X2 4W6YA 1DZTA 1YJLA 1NE4A 3CLPA 4QQHA 3BTAA 4WVMB 2NPIA 4I01A 1AZDA 1H1AA 2AGSA 1BXHA 4YRDA 2EAKA 1DYPA 1A8DA 3M8LA 2DURA 3NWKA 3TWIA 4H7MA 1QJZA 1IS4A 2HWF2 5T5JA 3TAYA 4LBNA 3ZFEA 3KD4A 2UU8A 3WW3A 1ENXA 4BCUA 2RS13 1PGL1 4X6QB 4XBQA 5C4WC 4K8FA 1JUIA 4D3WA 1DFQA 1Z7S2 2DCKA 5I0RA 4AF9A 1CPNA 1NQJA 5D1IA 1QWRA 2PFWA 1ASJ3 3W58A 4GQ7A 2Q1ZB 3E5QA 4QQPA 1TNRA 4XETA 2W39A 1FOD1 3DPRB 3OD4A 2GALA 1WLWA 3ZSJA 1C57A 2EAAA 4Q4Y1 3TN93 3ZXAC 1CD3G 1D4M1 5ACA3 4QQ2A 1BYHA 1ALYA 2IXCA 4XF4A 4TZDA 1QDCA 5JI7A 2XBO3 4M0NA 4FAGA 2VXRA 5HCBA 1HV0A 1LKNA 3WXPA 4INDA 3E6DA 4IXLA 1KQRA 3RYKA 4LUMA 3BU7A 1Z78A 4HL0A 4OI0A 5DZFA 4AGVA 4Q4W2 1AYM2 3OD0A 2ZKLA 1CPMA 3MICA 3JQXA 4LEJA 4XJ9A 4QPIC 3J8F1 3I8TA 4AHWA 1AR62 4YVWA 2PAMA 1DQ5A 3ROUA 1VBC2 1J1TA 5JIUA 4MGYE 1QXPA 1COV1 1AHSA 5K7PA 1G6NA 2AUYA 5D8AB 1G86A 3B9CA 4B7EA 3ZYRA 3JZVA 3QH7A 4Y1UA 3KCCA 5KHKA 3B5LB 1VAVA 4COVA 3E5UA 3MDPA 4L11A 4P5HA 2ZABA 1BEV1 1SQ4A 3M3QA 4LBLA 1SLCA 3VKMA 5BNNA 3RPQA 1S0JA 4Q4Y3 1RUG1 5CBLA 1Q43A 4DRRA 4C1WA 3HT2A 4YGBA 5T55A 1DGRN 5IUQA 5SV8A 1O3SA 5TSWA 3N35A 3NAPA 2PHWA 1R081 3ZMNA 4PF5A 3AZWA 1GANA 5LEJA 1TME3 2ES3A 4CTEA 4YGCA 3AYEA 5BNOC 1J1LA 5FMOS 1OOPA 3LA2A 1YO8A 1DYKA 2HEYF 1S2KA 4YZ3A 3V0AB 4AXOA 5JZGA 1POV3 3ES1A 3FFQA 2X5IB 1HXS3 1MQTA 1H9PA 4CDWA 2BWAA 4P9XA 2EIGA 4AE2A 4XQDA 2B9UA 3PTYA 4YW1A 4FPYA 2WJSA 2WA3A 4Q4X1 1OSGA 3PJQA 4HKOA 3UJOA 1X50A 2W0XA 5DDJ3 5KWRA 4M3CB 1FX5A 4XEZA 2ZMNA 2XG3A 5DUVA 1AR81 1VBB2 5T3NA 3N7LA 3VBFA 2Q0AA 2CYFA 2B7YA 4ASLA 2DWRA 4LBKA 5JDBA 2WNUA 2HWF1 4Q1PA 1M06G 2D98A 4I3GA 1Q3EA 1L3JA 1ULDA 2NMNA 3LB9A 3KT7A 1V00A 3RI8A 1EY2A 1Z7S1 2RS51 5DG2A 4WM8C 2UYAA 3I7DA 4AQTA 2XHKA 4FBFA 3VBOA 1YI9A 1RGSA 3OF1A 1JYIA 2V5YA 2Y26A 4QQLA 2WS93 1NCQB 3UKTA 1O5LA 5BV6A 1G9DA 1JHNA 1QHDA 3MIHA 2YV8A 3FMGA 4IV3B 1Y7BA 1MZ5A 3VDDA 4LO5B 1WMDA 5KHIA 1IS3A 3AFGA 2HWB3 3HN1A 1OKQA 2GC3A 2GC2A 2GSYA 1Z0HA 1XRUA 1LCLA 4KWLA 1W6NB 3QCWA 4Q4W1 2VW2A 3AYDA 4D7SA 3MIBA 4RR3C 4FQ4A 1RJ7A 5JSPA 2ZPXA 3DUIA 1AR61 1AR83 1W6MA 2OIIA 4K40A 2W68A 5DXDA 3BCWA 4Q1RA 1A3KA 1PNGA 1VBC1 1YCIA 3U10A 1V6LA 1VBE3 2VUJA 3VZKA 2GNBA 4JGYA 3WINE 1RHI3 3WP5A 3ZMOA 3DL3A 2RS53 2JXAA 3CL1A 5GLZA 3V65A 3WOGA 4IEWA 2G9FA 2GH8A 5EYXA 5CFCC 2ZHMA 3RG0A 1GBGA 1HLCA 1W6PA 4Y1YA 4AVCA 3WDXA 4LBQB 4N9HA 4R4ZA 3RDIA 1LOFC 1UPIA 3UV9A 2RMU3 1VP6A 4WM7C 5KXDA 1AR93 2PHRA 1AL21 4Q0PA 4I0BA 1GKBA 1W2UA 3CF6E 3HT1A 1NCQC 3ZFGC 4DPNA 1N1SA 4XHXA 2O8OA 1AR72 2E7QA 2RM22 4FPFA 3TNPB 5KHJA 1CIWA 1X8EA 4XF9A 2ZGOA 4LHKA 1XNDA 5F5QA 4COWA 3AP4A 1J59A 1C8NA 4YSFA 4IEZA 2D7FA 3M1HA 2EA7A 4D69A 2RR12 3AMQA 3PVBB 3WUCA 2YXSA 4ISRA 5I0UA 3VL8A 4MSVA 1Q8QA 1VRH2 1CAVA 4GB32 4Q0VA 4BWOA 2HWD3 1IKQA 5AVAA 4IV1A 4AEDA 1VBB1 5KC5A 1LHUA 3HMYA 4DQAA 3R4UA 1FV3A 4YVWB 4FTEA 1DQ2A 3ZPYA 1VBD2 1RMU3 3ETQA 3V64A 3ZXJA 1MVQA 3GNEA 4JGZB 2PAKA 5GM0A 2NYYA 1NQDA 1O5UA 1H1MA 2LUWA 3CJIB 1DDLA 3WW2A 2FBEA 2ET1A 2JEMA 4PQ9A 2GU9A 5I0SA 5AC91 1IGOA 4DZGA 3RI9A 4Y22A 5CNAA 2MEV2 3B00A 3LSDA 1AL23 1D4VB 2XJRA 5K0UC 5JOXA 2R6QA 3WDYA 4AI3A 3USUB 1RB8G 1LHWA 1VB2A 1NY72 1W39A 2OUHA 3AK0A 3I4IA 1TNFA 2A70A 4AK3A 2HEWF 1UU4A 4OHYA 4BPZA 4XE9A 1G9AA 1OOPB 4BLIA 3VBRA 3O5SA 5JZGB 4LO6B 2WL1A 2PELA 2ZOEB 1R1ZA 5FRAA 4ZU5A 3J26N 4JC1A 3T1LA 3INAA 3LOIA 2CV6A 4LR4A 4RD7A 3NV1A 4WZFA 4IEXA 4Z92B 3L9JT 4HN1A 4FAHA 4R4XA 5A3MA 1UKRA 1QXJA 2RE9A 1FMD2 3FBYA 4QU2A 3VHOA 3ZSLA 3WW4A 4EWAA 5F6KA 3IDEA 3VBFB 1I5ZA 2H0BA 5AC93 2IXKA 2MNGA 2YMZA 3ACLA 2WNUB 1MZEA 1PGW2 4HVOA 2ZGUA 2ET7A 1RUF3 3ECQA 2A6ZA 4XOGA 4QPIA 3WG2A 2Y0OA 2SLIA 4LLFA 2BUKA 1SEFA 1WUVA 2XJVA 4GULA 3ZXFA 5A33B 5JVVA 3ZN5A 1SMVA 2D97A 4JGZC 2Z2SB 2EXHA 2WFF2 2QJVA 2ZZQA 2D6KA 2BFUL 3AKRA 1QH7A 4J6GA 4Y24A 2BPA2 1SBEA 3VDDB 3KSCA 1OQ1A 1YRZA 1FV2A 1RUJ3 3KGLA 4XJWA 1ZBE3 2RM21 3EO6A 3NKTA 3VBUC 4AEKA 1NXD1 1ZZ9A 4AVVA 1ND2A 1BVVA 2RS12 5KXBA 1XNCA 1YLLA 4LLOA 4QX5A 1EAH3 3H8UA 1IZ3A 2BWCA 4CDUB 3RMXA 3BB6A 3SISA 3SXWA 2HJIA 3JUUA 1NCRB 1ASJ2 1KDMA 2A6YA 1MS5A 1VAKA 1DF0A 3AJYA 1OHFA 4XDQA 1F2NA 4LBMA 1VRH1 1H8TA 1CJDA 1NE6A 2ZGSA 1PIV1 1QNWA 4FOVA 3TN92 5BNPC 1W6MB 1ZRDA 1QOTA 4RS5C 5ACA2 3SH4A 3IM0A 4ZU7A 2AYHA 4MGKE 4IEQA 4A7KA 2DUQA 4JV4A 4N53A 3SITA 2XBO2 4FTBA 5CFDA 4JGYB 2PN5A 3ZDSA 2PA7A 4MUVA 1HIXA 4CDQB 3FWEA 1RUD3 1S55A 4PLMA 1ND3B 5I91A 3ZFFC 2PHFA 1JTZX 4FPHA 2P3IA 4PBOA 5J37A 1HQNA 1W6PB 1JYCA 2DTWA 2VG9A 4N7IA 4BH9A 2XVKA 2G9GA 1NG0A 2A6WA 2YGLA 4I2OA 1SBFA 4WV8A 3UK9A 1NY71 2WIIB 4CYDA 2H0VA 5GLTA 1QOOA 2QKDA 4YNIA 3FUOA 4LBJA 2MPFA 2XL9A 3THTA 3VBHC 4B7KA 4KG8A 3BOPA 2C0ZA 4KU7A 3MZHA 4YM2A 1IPJA 1HRI1 2A6VA 5BYNA 1EYBA 2F6BA 3POYA 4R9CA 2ZX4A 4WVVA 2CWSA 4YVSA 4ATEA 4LA3A 2BNNA 1OLQA 3ZXKA 1MEC3 1DZQA 1UCXA 2DU0A 2CY6A 1MS4A 4XHBA 4Q4Y2 1PIV3 2WNVA 1ENQA 2W52A 5FQ0B 1V9U3 1VBA3 1PK6A 2ZX3A 2DVBA 4B4PA 3FC0A 4D7YA 4NVPA 3GF6A 2DUPA 2ERFA 1FMD1 1CAVB 2YUEA 2D6OX 2WINB 3SCFA 1RUE3 3UKNA 4IV1B 1TME2 4AEDB 5HCAA 4C0HA 4LTAA 3ZVXA 3MW3A 2TNFA 4HK9A 1S0CA 4JCKA 2VMGA 3JCIA 5C8CB 1PGW1 3BPZA 3KB5A 1HXS2 4Z8BA 4RR3A 4YW4A 4OI4A 2JG8C 2ATFA 1O4ZA 1Q8VA 4GMP3 4FVVA 4PIZA 3PMSA 5FLJA 5I93A 1ZZBA 4NHKA 2Z79A 2X8KA 3D5OA 1OA3A 1W6QA 3H3ZA 4XMIA 3O0WA 3BOWA 2WFF1 1RUH3 1CAUA 5DDJ2 3S7IA 3ILNA 1DGWA 3RJRA 5AFBA 1FYUA 1OFSA 4B8EA 2ZMKA 5LRSA 3MLLA 2VECA 2X29A 1AVBA 1H0BA 1HRI3 4F8AA 1J3RA 2RS11 3MIDA 2FZ2A 3NKGA 2IFWA 1GV9A 4DXZA 5IK5A 1UD1A 4U36A 3QH6A 4XFAA 3O0VA 2GMMA 4WM7A 2WS92 3VBRB 2XJPA 2VQ0A 4GWNA 4TSVA 3GBWA 3TN91 3ZFGA 1GQHA 4TYSA 1V6OA 2R16A 3D82A 4QPYA 4XTPA 1GNZA 4GALA 5ACA1 1KRIA 2HWB2 1IPKA 1WMFA 1WW4A 1PVXA 2A6XA 2WQ4A 1GZWA 2ZX2A 2ZS6B 1QJX1 1B35A 2OW4A 2XBO1 4IESA 3RYRA 1YNAA 1UU6A 2BGCA 2IFRA 1XU1A 2XVLA 4HLTA 3VUOA 2QNKA 3EQEA 2B5HA 1LESA 4XF3A 2VUAA 3AXDA 1ONAA 4RQPC 4EJRA 2GDFA 1PVC3 2IXJA 3S30A 4PDWA 4XJ8A 2UWCA 5ABJC 3U0ZA 4HETA 1AR82 5IK8A 3ZYJB 5C8CC 1LODA 2EVXA 2UYBA 2DU1A 4RSUA 4F83A 3ALQA 1N3OA 2BVVA 3WNXA 2B8MA 1WGPA 1CVNA 3B93A 4YM1A 4AHXA 4P9GA 2K0GA 4K20A 1VBE2 4COZA 2D43A 1GFF2 1AJKA 2P3KA 1S2BA 4TLFA 1RHI2 1HDKA 5L7OC 2A5ZA 3FX3A 2ZGRA 1PGSA 2RS52 3RZZA 1I1EA 2VGDA 5JLVA 3ILRA 2VNGA 5B2GB 1ND2B 2DV9A 1U5YA 3M7AA 4CEYC 3IIAA 5GZDA 4YYOA 3VLBB 5J3UA 2IXLA 1QY4A 2RMU2 1NA1B 1Q8SA 1AR92 2E63A 4GH4A 3E6BA 2ZCWA 1T6GC 1OI6A 1QJX3 1O7FA 1H8TB 1QJU3 1TME1 4YG6A 4AVSA 1C1FA 1AYN3 5KHGA 3C2UA 4HPKA 1GYKA 3AP9A 1KD7A 3PNAA 1POV1 4PLOA 5JOWA 1HXS1 3JD71 3WDUA 4N53B 3RQ0A 2VMIA 3BODA 4E9KA 4PLNA 4K1ZA 5C9AB 4OI2A 2XKPA 3RYPA 5FAXA 4BYYA 1ZM1A 1UN1A 1MS8A 1VB4A 3E97A 5DDJ1 1V6NA 4XILA 4ZXKA 4FSJA 2HWD2 4G9SB 4HZFA 5GZFA 4QPGC 4QGLA 4HN0A 4Y4YA 3V0BB 1G9CA 1RMU2 4BM8A 1G8WA 1DBNA 4AGGA 1C8M3 3AM2A 3L2HA 3K48A 2K9ZA 3FZ3A 3VZMA 3QD6A 4XFGA 3APBA 3VKLA 2ZACA 3C3VA 4OHVA 4FXGB 1BJQA 4QQOA 1H2NA 2XVGA 3ME2A 4BZ4A 3AJZA 1KFUL 4IEOA 3S0MA 1N1VA 4Q26A 3E6CC 2WS91 3NVCA 1O4YA 4L2NA 2JENA 1VIWB 2RHPA 1ZNPA 1Q8OA 3AKTA 4YVSB 4UXAA 1AL22 1QXRA 1U5ZA 4CDXB 5L19A 2HKXA 3POWA 4EROA 4Q0QA 3HQXA 4IEYA 3VKFC 4H14A 2WNVB 1PK6B 2XWBB 2HWB1 4CRQA 1C1LA 3VBUA 3DPRC 1MACA 3JD73 5GLUA 3BIWE 5F9TA 2IC1A 4GIQA 3AYCA 2ZAAA 3KCXA 2ZBJA 5FFOC 2PLV3 1ULEA 1TMF3 3CNAA 3MPBA 1N1TA 2JJ6A 3SLIA 4YGDA 4JQRA 4KQ7A 4UW3A 2VPVA 1X7NA 2WWSA 1ULFA 4Y20B 2TBVA 2DVFA 3KGZA 2DFCA 3EHKA 4CEWA 4K21A 1G7YA 1NXMA 3HR9A 4MXWB 3WY6A 4FTSA 4LHLA 1XNKA 3WDTA 1W6QB 4N43B 3LA7A 4X6RB 4KGQA 3ZIWA 1VBE1 1UZZA 3M70A 3VBSB 5HCFA 5T54A 2P37A 4RGAA 1CAUB 4YZ1A 2Q8OA 1UF2C 1S0FA 1RHI1 4P9YA 1S0EA 4I30A 5C8WA 1ZBA3 4PIXA 1NLRA 4M00A 2D6NA 1XE7A 1DZRA 3SH3A 5JOYA 2VOKA 3PVNA 5AC92 3ZFFA 3OTFA 2WZR1 1AJOA 1H30A 5A32B 1W6OB 5FMOL 1RUF2 1DGWX 2OVUA 5D8AC 4GWMA 4AVTA 1ZRCA 1A8MA 1X36A 1QKQA 1ULGA 2MHFA 5I0TA 1NYWA 4FP2A 2RMU1 3ELNA 4OHXA 4XFIA 3E5XA 1AR91 1QJY3 3VBHA 2VW0A 4BIFA 1OMIA 1TEIA 2I2SA 3OYWA 1ZRRA 1S0DA 5GKAC 5FDBA 1AUYA 3O14A 5J09A 4YZ5A 2Q5TA 3I54A 4XW3A 3WG1A 1YWKA 1XQNA 3NV4A 3SHRA 4FPJA 1RUJ2 1E57A 2XPJA 3GALA 4RHV3 1GLHA 1ZBE2 3AMPA 1EPWA 2ZX1A 4KWKA 4CDXC 3ZXLA 3NV2A 1H4GA 1B35B 3IN9A 1EAH2 3USSA 3VZLA 1PM7A 5JSRA 4JVAA 2XL7A 4FPGA 3U11A 3OPZA 1PO23 1IS6A 4N7UA 3ZSKA 2X5IC 2YHJA 1ZZ8A 1UW8A 4XF1A 5FOBB 1YFXA 1ENSA 4PDWB 4D94A 2CAUA 2HWD1 2D3SA 2QE3A 1S0BA 3N3HA 1OLRA 4C90A 3IPVA 4QM8A 1LGBA 3DN7A 3KQRA 3VHPA 1RMU1 3WUDA 4YM0A 1DLLA 4XBLA 1CAXA 5HXVA 2WZR3 3ZFEB 4M0HA 2VOWA 4QGNA 1VJ2A 4NHLA 3VHRA 2PHXA 2I07B 1LGNA 4M3CF 3VHNA 2HYKA 1RUD2 4XFBA 3VZNA 4CP1A 2GAUA 1AXKA 2HWE3 4J1WA 2BTVC 1DQ0A 3H1MA 3A0NA 1ZZ7A 5FO8B 4DB5A 1RUNA 2IXIA 4AQSA 2JG9A 2XJUA 4MVTA 2WT0A 4GH4B 2ZA9A 4H3WA 1RUC1 3GZUC 4IV3C 3R0RA 1H1IA 5I8TA 1U5IA 4XTMA 1JUHA 1YUDA 1SFYA 1Q5OA 4MGIE 3B3QE 1UIKA 4AEJA 4Q0UA 4D7TA 3QACA 4PCRA 2X53S 4E2QA 3ATGA 3TBDA 1MEC2 2R073 4OZXA 4Q27A 3N7KA 1OFNA 1PIV2 3U4XA