2HWF1

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
283
structure length
283
Chain Sequence
NYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSIPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKLSVVITTHIYHKAKHTKAWCPRPPRAVPYTHSHVTNYMPETGDVTTAIVRRNTITTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
total genus 36
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwf100
5C4WB 4YVWC 3VDDC 2R042 4CDXB 1AR63 1HRI1 1CD3G 5CFCB 2FZ2A 1AR82 2HWE2 3LOBA 1VBD1 4YVSC 1AR91 1QQP3 3DPRC 5L7OA 1R092 4IV3C 1VB4A 1VB2A 1VBA1 4YVWA 3JBG1 1HRI3 3VDDA 1MQTC 2RS32 1BMV2 1RUC2 1VBD3 1AR93 4CDXC 4CDWB 5ABJC 5CFCC 4YVSA 4N43C 4PDWB 5A32A 3VBSB 3DPRA 1HRV2 1VBA3 1VBE1 1PO22 4GMP1 1W39A 3JBG3 4IV3A 3ZFFB 2VQ0A 1QJU1 1FPN2 4FTEA 1MQTA 4RS5B 2PLV2 5D8AB 1BBT1 2BBVA 4CDXA 4WM7B 5ABJA 1QJY2 4N43A 3VBHB 4CDWC 3NAPC 5ACA1 1NCRC 1VBE3 5AC91 4GMP3 2ZTNA 2R073 1POV0 1QJU3 3ZFEC 3VBOB 5K0UB 5CFDB 4AEDC 1RUI1 1Z7S2 1BBT3 1OPOA 4Q4X2 5A33A 1RB8G 5FMOL 1FOD1 1RUF2 3ZFGB 3HAGA 4GH4B 1NY71 4GMP0 1ND2A 5AC93 4QPIB 4WM7C 4CDWA 4RHV1 1V9U1 3NAPA 1NCRA 3VBHC 3VBFB 2RMU2 1E57A 4CDQB 1PGL2 3ZFEA 1H8TB 5BNNC 4Q4Y2 4AEDA 1PGW2 5K0UC 1FOD3 5CFDC 2TBVA 1NG0A 1ND3C 1MEC3 1K5MC 1M06G 4RHV3 1VBB1 1V9U3 1C8M2 3ZFGC 1PIV1 1EAH2 1R081 4WM7A 1OOPC 2RS53 2MEV2 3VBHA 2WZR2 2HWD3 1RUD1 1ASJ1 5BNNA 1AYN1 5DDJ2 3TN93 5K0UA 5CFDA 1VBC1 1RVF1 1VBB3 2RR12 1ND3A 4WM8B 1GFF2 1IHMA 1PIV3 1PVC2 1R083 1AR72 1AYM1 1K5MA 1TMF2 1ZBA2 2HWF2 2HWC2 1NOVA 4RQPB 5GKAC 1AL21 2WFF2 3ZFGA 1D4M2 1OOPA 1RUD3 2R061 4Q4W1 1ASJ3 1AYN3 2BFUL 3J8F2 1VBC3 1RVF3 1RUE1 1ZBE2 1BMV1 3VBRB 1F8VA 1AR83 4Q4V2 1AYM3 4N53B 5BNOB 1AL23 4CEWC 4CEWA 1R1A2 2ZZQA 2R063 4Q4W3 1X33A 4CDUC 1RHI2 3CJIB 1COV1 4GB32 1RUE3 4Z92B 1BEV1 1EV11 1RUG2 3JD71 5C4WC 1AL0G 1A6CA 2RM21 2XBO1 4N53C 1NA1B 1COV3 3M8LA 1AR62 4CDUA 4SBVA 2IZWA 1NCQB 4RR3B 1BEV3 1EV13 3JD73 3VBUB 3ZXAC 1FPN3 1QQP2 2PLV3 2RS11 1RUJ2 2R071 1RMU1 5C4WA 2RM23 4JGYB 2XBO3 1QJY3 1B35B 1HRI2 4N53A 3IDEA 5JZGB 5CFCA 5J98B 1VBD2 1AR92 4CEYB 3FBMA 2RMU1 1VRH2 2RS13 4PDWC 3VBSC 4QPGB 1RMU3 2WWSA 4Y5Z0 2QQPA 1RUF3 3ZFFC 1VBA2 4LLFA 4RS5C 1DDLA 5D8AC 2ZAHA 1B35C 2WS91 2RMU3 1MEC1 5JZGC 1C8NA 2HWB1 1PO11 4PDWA 2BUKA 1TME1 3VBSA 5C9AB 1QJX1 2RS51 5C8CB 4IV1B 5DDJ1 1VBE2 2HWD1 4QPGC 5BNPB 3VBOC 3ZFFA 2WLPA 1QJU2 3TN91 2WS93 4RS5A 5FOJB 1FMD1 1BBT2 5D8AA 2MEV3 1B35A 4EJRA 4FTSA 2HWB3 4GH4C 1PO13 5JZGA 1RUH1 1TME3 4QPIC 1QJX3 5DDJ3 5ACA2 5AC92 3VBFC 4CDQC 4QPGA 3VBOA 4Q4V1 4FTBA 1AR73 1H8TC 1ZBA3 2R041 1RUI2 2XPJA 1FMD3 1R1A1 1AR81 1FOD2 2HWE1 1RUH3 1NY72 4GH4A 3J8F3 4QPIA 4RHV2 1V9U2 2BFUS 1R091 4Q4V3 2Y26A 4YVWB 3VBFA 2R043 3VDDB 4CDQA 2RS31 1R1A3 1H8TA 1RUC1 2HWE3 4NWVA 2DF7A 5J96B 1RHI3 4YVSB 4WM8C 1HXS2 1VBB2 5A32B 4NWWA 4RQPC 1PIV2 1R082 1R093 1HRV1 1PO21 4IV3B 2X5IB 1RUJ1 2RS33 3S6PA 1RUC3 4BCUA 1MQTB 1FPN1 1ASJ2 2PLV1 2BPA2 1AYN2 3VBRC 1VBC2 2GSYA 1RVF2 1AUYA 5ABJB 5LK7B 4N43B 4WM8A 1QJY1 5BNOC 1HQNA 1AYM2 1HRV3 4RQPA 1AL22 1PO23 1X36A 1VRH1 1RUJ3 2R062 4Q4W2 3CJIC 1Z7S1 2X5IC 5A33B 1WCDJ 4Q4X1 1RUE2 1QJZA 3VBRA 1RUF1 1POV1 1ND2B 5BNOA 1VRH3 3NAPB 1NCRB 1NA1C 3ZFEB 1PGL1 1Z7S3 1COV2 1NCQC 3CJIA 4Q4X3 4RR3C 4AEDB 4Q4Y1 1PGW1 2X5IA 3VBUC 1BEV2 1EV12 1POV3 3JD72 5FMOS 3JBG2 1OHFA 1SMVA 4JGYC 1C8M1 2RM22 1EAH1 1ND2C 2XBO2 1NA1A 2MEV1 2WZR1 4Q4Y3 3JB8A 4CEYC 1HX6A 1NCQA 5BNNB 4RR3A 3VBUA 2RS12 2R072 1ND3B 2RR11 1RMU2 1C8M3 1K5MB 1EAH3 1PVC1 2HWF1 1AR71 1ZBA1 4JGYA 1TMF1 2HWC1 4Y4YA 1F2NA 2WFF1 1D4M1 2WZR3 5ACA3 1OOPB 4JGZB 3J8F1 4CEYA 1RUI3 2RR13 1ZBE1 5C9AC 1CJDA 2GH8A 5C8CC 1PVC3 4IV1C 2HWF3 1TMF3 5BNPC 2HWC3 4CEWB 2WFF3 1D4M3 4FSJA 4RFT0 1HXS1 1RHI1 2WS92 1MEC2 4GB31 5L7OB 1ZBE3 2HWB2 4JGZC 1RUG1 1PO12 1TME2 1QJX2 2RS52 5C9AA 3JB4C 5C8CA 4IV1A 2HWD2 5BNPA 1HXS3 2FZ1A 3TN92 4CDUB 1AR61 1FMD2 4GB33 3DPRB 1RUG3 1RUH2 1QQP1 4JGZA 5L7OC 1VAKA 1RUD2
chains in the Genus database with same CATH superfamily
4YVWC 5FYSA 4LO5B 3QD6A 4QWNA 4QXHA 5FBJA 4CDXB 4JTOA 4N90A 1HRI1 2GMPA 4BLJA 3M7AA 5EJ3A 2PHXA 3ZXGA 3ZXKA 4ARYA 5TSWA 1OSGA 3VB9A 3ZSLA 2UU8A 5F6KA 4LTAA 4CTEA 1AR91 2QTWB 3HQUA 4D8MA 1REDA 1U12A 2E7AA 3VV1A 3RYRA 2VZOA 2DUPA 3K4ZA 3ECQA 3FZ3A 3H9AA 1H2MA 4XOGA 4IV3C 1J83A 2GMMA 2X10A 1KRIA 5A3OA 2XUMA 3UL2A 3WG3A 3T09A 4CUAA 1HRI3 4QXBA 2RS32 1SHWB 4UBGA 4X8PA 1XSQA 2WNEA 4L92A 1HQWA 3B69A 3IAPA 2HYXA 4BIFA 1AR93 4CDXC 3OPTA 4KU8A 1DIWA 2WNUA 3DGTA 3ITQA 3NJZA 4YVSA 4AQSA 5A3NA 2YPDA 5FPZA 4B7EA 2XJQA 5C5UA 3FC0A 5A7QA 2A6VA 3DPRA 3AMQA 5GLTA 3TEXA 4YGEA 5FPBA 1HRV2 1DGWX 4GJYA 4HMZA 1W39A 1IKQA 1H2LA 4EZHA 2P37A 3SEPA 3ZFFB 1WKYA 2VQ0A 4AW7A 1OURA 5DABA 4CUBA 1XPWA 3MBWA 1OH3A 2BP6A 4OI2A 4PI0A 5D8AB 1W28A 4UFHA 1BBT1 1PZ7A 3B94A 2PQSA 4UF0B 1XBFA 4WM7B 2VR4A 3RRDA 1QXPA 1AXKA 4X8NA 4EN8B 1QJY2 3D0JA 1TNFA 1W8ZA 1IPKA 2ORZA 1REEA 1V0AA 1AJKA 5E8AA 5IVYA 2R073 4PQ9A 2QDRA 4CUCA 3AKPA 4YW1A 4P9XA 3RG0A 4NRMA 4AEDC 4DEVA 2UWCA 5HI0A 2F4LA 2QNKA 1BBT3 3VD9A 4MADA 3VN4A 1QJFA 5FLIA 5J7MA 3LQCA 3THDA 3N4MA 1FOD1 4GJZA 4AEJA 4Q8LA 3V64A 3WVJA 3ZFGB 3KHBA 2XVKA 1N1TA 3HAGA 2WIIB 1NY71 1J84A 3R4DB 4E4HA 5F37A 4WM7C 3SH4A 4CDWA 4RHV1 4Y22B 5FQ0A 5IK8A 3NAPA 4ATEA 4V2VA 3KLSA 1LESA 1MS5A 2Q4SA 4G4FA 4OUSA 4YW2A 4DUVA 3CU7A 3POFA 2RMU2 1J1LA 2ZX4A 3L2YA 2DBIA 3IDAA 4OMDA 5BNNC 3KCYA 4HVQA 4S2GA 2D6LX 1FOD3 5C71A 1W8HA 4LK7A 4ZZ8A 3UK9A 3KB5A 3AP4A 2VZRA 4Q2FA 3MLJA 3LDRA 4NMIA 3H8OA 4LBOA 1VALA 5LA0A 4QD2A 3IN9A 4RHV3 1DQ6A 4L8QA 2E33A 1GZTA 5FPAA 3ZFGC 5K8SA 1EAH2 2HBTA 4WVZA 4AWDA 2PHWA 3M70A 3RI9A 1PNFA 2RS53 5FY9A 3WQ7A 3V0BA 1KJLA 3EYPA 3SEEA 1TQ5A 1DU3D 1ALYA 2ENRA 1RUD1 2XJVA 4JX0A 1LRHA 4Q0VA 3TAYA 2EAAA 1OT5A 1W6PB 4AHWA 5DDJ2 1OC1A 3ES1A 3TN93 1JOPA 3WZ1A 1SDWA 4I30A 1X7NA 2OXBA 3TEWA 3QLQA 2O14A 1K5JA 1ND3A 3OYWB 1DYPA 1IHMA 1PVC2 3FBYA 1ZBA2 1K5MA 5GKAC 5A7SA 2W08A 2HWC2 2Z79A 3BODA 2VUDA 2WFF2 1D4M2 3LF7A 2R16A 1EPZA 1HV1A 1RUD3 1WUVA 4QX5A 5FWJA 2W87A 2BFUL 1QOOA 4N9HA 2P17A 4LO6B 4XAAA 2NN8A 1ZNPA 1ODMA 4CYDA 1OH4A 2VCBA 2A6YA 2YYOA 1F8VA 4IEUA 1OA4A 5F8PA 1AR83 1ZZBA 1MS8A 1VAVA 3EQEA 5DUUA 1SDDB 3SLIA 4CEWA 4M0NA 1URXA 1KQRA 4J1XA 1V6MA 2YG0A 4CDUC 3IBMA 3GCWA 4Y4RA 1YQ8A 2VNGA 3CJIB 4CCMA 1VAMA 3I3BA 2WT0A 3WDYA 1DGLA 3OPZA 4E8DA 5C6CA 4LOTA 4GB32 1YEWA 3U1XA 3RZKA 2JE7A 1LHVA 1MS1A 3TEYA 4FFIA 5T5PA 2E51A 4CCNA 1CGPA 3JD71 5LB6A 4F7ZA 3K75B 1CAXB 4UFMA 4B4PA 3WDXA 2XMLA 1UXZA 5L36A 4XUNA 2MPFA 3KGLA 1P8JA 1W0OA 3DL3A 3U07A 3ZXLA 3WDWA 1GSLA 2DVGA 2XQRA 3IB3A 3M8LA 4MGYE 5FJKA 1BZWA 1HIXA 2D3PA 4NRQA 3O5SA 3VKFC 4F8AA 1FYUA 4YARA 3D3AA 4ES9A 2LROA 1W8OA 2XKOA 3TWIA 5IK7A 3JD73 2FMYA 2PLV3 3K4AA 3MO4A 3NNFA 5FY1A 1RMU1 2WZPP 1GOHA 5IAXA 1WGPA 3PU3A 4JGYB 4PF1A 1WLTA 1DZQA 4EYUA 4YZ1A 5J37A 2BNNA 2PHRA 2QQUA 4OHZA 5BNQA 5I93A 2BNOA 1KFXL 3T2TA 4P00B 5FZGA 1LU1A 2A73B 4UWDA 1HRI2 5CA6A 4N53A 2W1QA 2FD8A 4AG4A 2WFPA 3UGFA 4LORA 4AAXA 4PLOA 2YU2A 3K51A 4LBQA 1AR92 4XJ8A 2AGSA 5B4XA 2BRTA 1VRH2 3PL0A 4HONA 4PDWC 3THPA 1W0PA 3ILFA 4XJUA 1SLTA 3VBSC 4BM8A 1RMU3 4IGOA 1UMHA 2BJSA 2CDOA 2QE3A 2Z42A 3AMNA 5JXJA 2QQPA 3B5LB 5FWEA 5H9PA 2XJTA 1GZ9A 1SPPA 3ZDVA 1DLCA 4XPVA 4TN7A 2VJXA 4XURA 3LEMA 5B2GB 4RS5C 4LBKA 1XNDA 1O3QA 1DDLA 5C3SA 3WP6A 3WF1A 4H14A 2VQTA 2ZAHA 4LO4B 4E8CA 3IAQA 2CWMA 2X29A 2WQ8A 1K45A 4EE2A 3GZTB 4PBPA 2QZ3A 5CKQA 1UZYA 1UF2C 3N36A 5JPMB 3WY6A 2Y33A 3C7HA 3BOPA 3MF6A 4I02A 2Q1ZB 1NX9A 1PO11 2JEMA 5T5LA 1J59A 2LTNA 5C9AB 4HANA 4I01A 1C3HA 3J7NA 2HWD1 2A3WA 4JRAA 4IERA 3VBOC 5I0TA 2P2KA 3ZFFA 4AYUA 2DURA 4G9SB 1XYOA 5KXDA 5IJRA 1V6OA 4NIAA 4DXZA 5D8AA 1BBT2 1LHNA 3RYPA 5I8YA 5JMCA 1CESA 3GZEA 4DIQA 3H8UA 4FTSA 4UF0A 3MI8A 5FZ6A 3T2QA 4W6YA 4BE3A 1PO13 1CJPA 3O0XA 2DWRA 4GWIA 4XDQA 4XTPA 4BMBA 3VZNA 5IVCA 3CZJA 4XBLA 5HCBA 2R7EB 2PTMA 4QGLA 3MFCA 3IM0A 3VBFC 5KC6A 3X29B 1H8TC 2XPJA 2H0BA 2PELA 3QBQA 4P02B 4XILA 1UZWA 1MS4A 4MX3A 1R1A1 2VBDA 2HWE1 1FOD2 2YC2A 4IEZA 4A7ZA 1ENSA 3OBTA 2BGCA 3B93A 2NLRA 1NY72 5F5CA 1UOGA 1UYXA 3PJYA 3RWKX 1KJRA 4RHV2 4NVPA 4JKMA 4Y22A 4RN5A 2GC2A 5DUXA 2Y38A 2AEYA 3H1WA 3NVCA 3SMHA 3AP6A 2Y26A 4K8FA 2W5FA 1DYKA 2XHNA 3H7YA 2C24A 3OSDA 5FYZA 3RYKA 3VLBB 2ZZJA 4OFGA 4LHSA 3M3CA 3N7JA 1R1A3 5EFUA 5F5IA 1RUC1 1US3A 1BVVA 1YCIA 1YQCA 2HWE3 4WBBA 1U5XA 3SKJE 1O3SA 3BU7A 4GAZA 4IEVA 2ZACA 2DF7A 3I3QA 4AI0A 5EYYA 2VOWA 1SFYA 3NV4A 1MPXA 4AL9A 4QX1A 2J1TA 5LBCA 1DCSA 2VZ1A 1YXWA 5A6XA 5K7PA 4I0AA 4AI3A 4BWOA 3MIGA 3MW2A 5D1IA 1UNBA 2WUHA 3LOIA 1MVQA 3UKNA 3VD7A 1RUC3 2DCKA 2ZX1A 5JSPA 3NSTA 2ZCWA 1MQTB 1FPN1 2OVUA 3I59B 3PTYA 1W6PA 4BB3A 2VMEA 4LUKA 1OD3A 1W8WA 4M01A 1JYXA 4A7KA 3R0RA 1JYNA 1W8FA 3W9AA 5FPUA 3N9NA 2W0XA 3ILNA 4NPRA 1FV2A 3MW4A 4RGAA 4YM2A 1JU3A 5CG8A 1UIKA 3LDKA 4HL0A 5FCCA 1WCQA 4XUPA 4FBFA 4MGZE 4UBHA 4BQ4A 2VQUA 4DOUA 3R6SA 3Q8CA 2IXLA 3NQHA 1Z7S1 3OEBA 4JKLA 4NJ4A 5T50A 4EWAA 3PLQA 3AK0A 4CUGA 4M3CE 4DY3A 1RUF1 3MV01 5BYNA 1GOGA 3NMBA 3WG2A 2RE9A 1BKZA 3HBZA 3FMGA 4Y20B 4JHTA 3WOGA 1NCRB 1WW5A 1HB2A 2WO3A 1X9PA 4LA2A 3RMYA 3ZFEB 1SFNA 4WZFA 1XE8A 1Z7S3 3CJIA 5FY5A 3GM8A 2Q30A 1N3OA 2ZEXA 1HKDA 1CPNA 3MICA 4Q4Y1 4MGKE 3QACA 4TXWA 5FZLA 3VBUC 3H8RA 3AZXA 4N8MA 2AH2A 4XJWA 1AX0A 2D98A 3JD72 1PX3A 1S1AA 1UZ0A 2YU1A 1CAXA 1SMVA 5FK7A 3T1MA 4CXXA 2RVAA 4L9BA 2I45A 2QDNA 4XCAA 3BTZA 3LAGA 2A6ZA 1IS4A 1RC6A 2JKBA 3FUQA 3LA7A 5DAXA 4XE9A 5BV6A 2FCTA 4BQ1A 3VDAA 4ISRA 1UMZA 2C5DA 2MEV1 2XJSA 1JZ7A 5FMDA 3H3LA 5C3QA 2GC1A 2ZGNA 4Q4Y3 3RZMA 4BA6A 5GLWA 4IE7A 4CEYC 2GH2A 2YC0A 4KNCA 2JDYA 1O5UA 2HEVF 1SCRA 4Q1PA 4FOWA 4D94A 2V09A 1GR3A 1RTVA 3B02A 4MV2A 5FYVA 5CBLA 4QXCA 2QKDA 3K3NA 3DV8A 4YGDA 1VP6A 4LLOA 2Q8EA 4QB2A 1RMU2 5IAVA 4ORFA 2HWF1 4ZS3A 4JGYA 4AI9A 1UZVA 2HEYF 3RDIA 1W6MB 4XF4A 5KHJA 3LPGA 2J1RA 5ACA3 3V0AA 4H2AA 5GLZA 2Z4FA 2ARCA 3U10A 1IQDC 2AEZA 1PVXA 2PHDA 1N3PA 3CL1A 2KA3A 5F3GA 3O0WA 4NIDA 3VHPA 4NRPA 3LKJA 3Q8EA 1ZBE1 2GP3A 4LHKA 2FMDA 3K4DA 2N7GA 2K2SA 3DYOA 3POGA 2HWF3 4MXVA 2Y0OA 4R4ZA 4UXAA 5FZIA 2BEOA 3FWEA 5DAPA 2WRAA 4NHKA 5BNPC 3O14A 3WDUA 1LNSA 1R64A 1VRBA 4UAPA 4RFT0 1HXS1 5GZEA 2VPVA 4ZXKA 4XFHA 5F5QA 1K3IA 4LHLA 4XABA 3KT1A 3THCA 2PHUA 1L7RA 1W90A 3D5OA 2Y60A 3H50A 1ZBE3 3H3UA 1WW4A 1PO12 4QQOA 1IS5A 1E5IA 5C9AA 4AR2A 4I0WB 2HWD2 2EIGA 2JDKA 2JECA 1CIYA 1Z0HA 3CQOA 3LSDA 4IEXA 1HXS3 2P3YA 4PIYA 1J58A 3LEKA 4HBNA 3POBA 5FZ9A 4CXYA 2DCJA 3VDCA 4PQQA 3SH3A 1AR61 2VOXA 3OUHA 1ZYBA 3U37A 2ADEA 3DPRB 3AXDA 3BTAA 3ENRA 4CU7A 4GXLA 2LALA 2R0FA 2VQAA 1QXRA 1ZX5A 3BIWE 3NO8A 1QQP1 4XVHA 3I54A 3B3QE 3FLPA 4FFHA 4XDOA 1CZVA 1RXFA 1O7FA 5F1RA 2ZGMA 3RWNA 5C3PA 3BUCA 4UW3A 1OF3A 2AYHA 3U11A 1QHDA 1ZZ6A 1AR63 2V72A 1CD3G 1PX4A 2D6PA 4Y1VA 1UN1A 1KEXA 1L3JA 4KL1A 3ACGA 5JR7B 2ZOEB 1FXZA 2CHHA 2HWE2 2WNUC 2ZGKA 3BPZA 4YVSC 2A3YA 3HNBM 4AHXA 4O65A 1QQP3 4ZPIA 3MZHA 3DPRC 3OPWA 4B7KA 2B42B 1MZEA 3DKQA 4FP3A 1JU4A 1HJFA 2ZGPA 4HN0A 1VPHA 2E32A 2C9KA 1OUSA 2D6NA 1JYVA 1BHGA 3FFQA 2ZABA 1W6OB 1ZZ9A 2NYYA 3I3DA 5FK8A 2EXHA 4BJ0A 1BMV2 3O0VA 1SLBA 5FZCA 1RUC2 5FZ3A 3UV9A 5A6QA 3MV11 3WEZA 3ALQA 2VZSA 2BYVE 5HBAA 3VZKA 3A0NA 4ZONA 5FQ0B 1PMHX 1QU0A 2J1VA 2L9LA 3P5BA 1NXMA 1Y9GA 4IGQA 4S2FA 4COZA 4YFZA 2E9QA 3WP5A 2JDUA 2IXIA 2K0GA 4JZRA 1U5IA 3BPSA 1HN1A 4YSFA 3WQ1A 4I3PA 2O1QA 4DO0A 2VOVA 4CU8A 5IK4A 3I3MA 4B4RA 2A71A 2WAOA 4GMP1 3DCQA 4KMQA 2LS6A 1QOTA 4U2AA 1QJU1 3OTFA 3QH6A 1FPN2 3WUDA 1MQTA 5JI7A 2LW8A 2G9ZA 3I59A 3ZN4A 2BVVA 5F3IA 5H9RA 5I0UA 3B7MA 1NUKA 1ENRA 1NLQA 2FBEA 2ZKLA 4AFBA 5A3WA 4CDWC 2CDPA 2XXZA 4S2HA 2CL2A 2VMHA 3NAPC 2RDNA 1YFUA 4JDOA 2QBXA 1RYYA 1UX7A 4GMP3 3AMPA 1D4VB 1POV0 3ZKYA 4FOYA 1QJU3 5FPXA 3FFZA 2X8KA 1JW6A 4HK8A 1XYNA 1Z7S2 3HD8B 5FZKA 1IPSA 2ZGOA 3CZUA 3IMMA 4EROA 1RB8G 2GDFA 1SCSA 4HETA 5FMOL 5IWFA 3NRUA 2Y0IA 5CU1A 1RUF2 3HEIA 3VDBA 4MXWB 1XQNA 1DFQA 4GMP0 1AJOA 1POQA 4QPIB 4C8DA 2WSVA 2WAAA 2JDHA 3I2HA 4QXKA 4Y20A 5FXZA 4OZOA 4DPNA 1NCRA 1STMA 3GBGA 3V65A 2YY1A 3UYJA 4UT5A 5JAXA 4TLGA 3ZFEA 2ZGTA 4P9LA 1HV0A 1C4RA 1F4AA 3MLLA 4Q4Y2 3FLTA 1O8SA 2E26A 3BU0A 4FPLA 3AVSA 4CU9A 3WDTA 2W92A 4PLMA 1ND3C 1BYHA 2X09A 3K46A 2IC1A 1MEC3 1K5MC 2YPJA 1W3XA 1VBB1 3NJVA 4AZZA 2AENA 4JHZA 1D2QA 2Y6GA 3M1HA 5T3NA 1EPWA 1R081 4WZCA 4XF9A 4MLOA 3WDVA 2VZTA 2MEV2 5CZKA 3VBHA 3RJRA 1WMFA 2G19A 2O8QA 5FZOA 2BU9A 5BXXA 3ZYBA 1WBLA 3RMXA 3IIAA 2ETEA 2JG9B 3D6EA 3OF1A 4URTA 1ASJ1 4EZ4A 1JZ5A 1AYN1 5K0UA 1OVSA 4LULA 5CFDA 3RZGA 1VBC1 4OQ9A 1RVF1 1VBB3 4GWJA 4UYBA 2W1WA 4WM8B 5LATA 4CEWC 3KCCA 1R083 2DCYA 1AYM1 1JMUB 2HWF2 2R6QA 2NZ9A 4RQPB 5FZBA 3IWZA 3TBDA 2P6CA 1W6MA 4XFCA 2UURA 5IVBA 1UWWA 4MGIE 5FOBB 2Q0AA 2D6KA 4K7JA 5ANQA 3FHAA 4D7TA 1BLZA 1JZ8A 4N7IA 4CP9B 1XNKA 4BK4A 2YZ4A 1C28A 1ASJ3 3H7JA 2W1UA 1AYN3 1OPMA 1S0JA 1AVBA 3ZMOA 1VBC3 3F95A 1RVF3 1RUE1 4XW3A 2G9GA 1V6KA 1KXGA 1ZBE2 5EJ1B 3SH5A 3VBRB 3FLRA 3A4UA 4Q4V2 1AYM3 4E2SA 4J6GA 3TNQA 2Z5WA 4N53B 4XZPA 4O9EA 3PUAA 5GJ6A 3VKNA 4R9CA 2JDNA 4OZXA 2ZZQA 4LBQB 3KWVA 1A78A 5G04L 1VMHA 2VNVA 2IVIB 2VXRA 5C5TA 5F5AA 3IIIA 2YHJA 1COV1 5F3EA 2PN5A 4JV4A 1RUE3 1W8UA 1ENQA 3U14A 4XIOA 2TEPA 1RUNA 1BEV1 2R0HA 1SPPB 3I4IA 1YIPA 1UD1A 4LBJA 2EIBA 4UOJA 5JDBA 1DF0A 2BWCA 1DLLA 1A6CA 3LFIA 5FMBA 4XHBA 1MR5A 4XJ9A 1XC6A 3VKOA 4N53C 5LA9A 4B8EA 1COV3 1X8MA 1AR62 2VVFA 2SBAA 2IZWA 2VZ3A 3CO2A 2JWPA 4N7UA 3OBZA 3WT3A 4Z2WA 1BEV3 4A2UA 1BQPA 1I5PA 2CGPA 5DAVA 4WV8A 2JIJA 3ZXAC 1QQP2 1GP4A 3NV2A 4QDSA 5A3UA 2R071 1XJAA 1LENA 2A7AA 1W03A 3NKTA 3WLUA 3O1OA 2I2SA 2GZWA 3C7EA 4XFAA 1FT9A 1GLHA 1OF4A 1X9TA 3ZVXA 4CVUA 3T4HB 3I2KA 3E5UA 3M4FA 4LUMA 3FE5A 1GNYA 4XF0A 5J98B 2PXJA 3J7HA 4DEQA 4HKOA 2G4IA 1HLCA 1WW6A 4D3WA 2ARAA 5FYHA 1UPIA 4Y1UA 1W3VA 3ZYPA 3GBWA 4B29A 1HW5A 2PHFA 4AGGA 4MHRA 3L9JT 3ZFFC 5KXBA 2WR9A 2ATFA 1W6OA 3KQRA 1OMIA 4FFGA 4YRDA 5D8AC 1O8PA 1K42A 4XMAA 1G6NA 1YIFA 3WG4A 1IS3A 2WS91 4FQZA 4JRLA 4N9IA 1LOBA 4YW7A 4P9JA 2VM9A 3T0BA 4FT8A 4QHZA 4ZU7A 4KWJA 3EBRA 4B1MA 3OG2A 4Z1VA 1A3KA 4EN0A 3GALA 3OB8A 4IE4A 2RS51 1SLAA 2WNVB 4IV1B 2G1MA 3VGIA 4ARXA 2VC9A 4S2DA 3I49A 5T5JA 5A3TA 2VOTA 4XF3A 3UJOA 1QJU2 3OGGA 4IE6A 3VZLA 1FX5A 1MZ6A 1JYWA 3TN91 2WS93 4WVWA 1NQJA 2RJKA 3K48A 3ZLIA 2QQKA 3E6BA 5A6YA 2NQYA 3T0AA 2ORXA 3RZJA 1PK6A 1J3RA 2UY8A 4UI9L 1DZTA 4OI1A 1CAVB 2OPKA 3GCXA 1XE7A 1JODA 2WDBA 1HN0A 3MIDA 3S30A 1KS4A 5FZ4A 4C0HA 1IPJA 1XNTA 2ZXQA 5I8TA 1AR73 4M0HA 2R041 2ZBJA 1IOAA 1JHNA 5F6LB 2VD7A 4XCBA 1DQ1A 4AVTA 4AVVA 2Q1FA 5B4NA 1I6XA 3EB7A 1AR81 1YFYA 2BW8A 3OY8B 1BVP1 3I8TA 3ZSKA 1F5FA 3USUB 3T1LA 1KITA 3ZPOA 2VU9A 3J7MA 3N35A 4OUEA 4MXWA 2NPIA 3J8F3 5CVRA 5T52A 3U0ZA 1CR7A 4QPIA 5FP7A 5LY1A 1QOSA 3HVDA 4CZSA 4ZZ5A 5AVPA 2XJPA 1R091 5DAQA 3CIHA 2R043 4OI4A 3VDDB 2J42A 4FAGA 2FDFA 3E6CC 3BIEA 4FPOB 4I09A 3N9MA 3SQOA 3P1IA 3VZMA 2YBPA 4IEOA 2PAKA 5LBBA 4IEQA 1MZFA 3CEWA 4FPFA 5L73A 1RHI3 5FAXA 4QHBA 4M3CF 4YYOA 5H9QA 1AXZA 3D8CA 4Y33A 3DKWA 3I97A 1VBB2 3GNEA 1UIJA 4QKDA 1ZRDA 5JOWA 3MW3A 2OKXA 4NAOA 4Q29A 1R082 1R093 5FPVA 2VVDA 3ZSJA 3S57A 3KCXA 2LRPA 2VNOA 1W6NB 3R4SA 1RUJ1 5SV5A 4QDRA 1BXHA 5A7PA 4RGGA 3ST7A 2ZHLA 4K6BA 1G9FA 5FLJA 1ASJ2 2IXJA 2JG9A 2PLV1 3POIA 1AYN2 5E89A 2BPA2 4GALA 4IQPA 1TNRA 2E53A 1VBC2 2GSYA 4QQPA 1RVF2 1AUYA 5ABJB 1NKGA 5FYTA 5LK7B 4N43B 4WM8A 4WVVA 3UGHA 1AYM2 1YNAA 2H6CA 4XC9A 5FXVA 4E4SA 5CISA 5HV4A 5L19A 4RQPA 2HYKA 4QQHA 5GALA 3T3YA 5KHIA 1GV9A 1RUJ3 1YQ5A 1O59A 5A80A 3PJQA 3CJIC 4JQTA 2WQZC 2XVGA 4CP9A 1AX1A 5H9SA 4EV0A 3M3OA 4Q4X1 2GAUA 3WW3A 4KQ7A 5KR7A 1RUE2 2Y34A 1WW7A 3AXEA 1GZWB 3UJQA 3VBRA 4OHYA 1CX1A 5JCTA 5A70A 3BTXA 4TTGA 1G8WA 5JLVA 3V0AB 4BIOA 4GKXA 4AVAA 5A1AA 5T54A 2E63A 1ULFA 1QH7A 1LOCA 2YGMA 3KGZA 3L2HA 3ON7A 4M00A 1MS3A 4Q27A 3WNLA 4Y5TA 5FZ1A 3NWKA 5DZEA 1COV2 4ZU4A 4Q4X3 1IQAA 1W0NA 3RZLA 3AKQA 4FPGA 3SXWA 2YFZA 3N9PA 5EHDA 4YZ5A 1PGW1 2DVFA 2X5IA 4NHXA 5FR3A 1BEV2 5FP9A 3S7EA 1ST8A 5FMOS 4P9IA 1PZ8A 3EO6A 1W9FA 5FXWA 4JGYC 4TYSA 2B9VA 2AR6A 1C8M1 3MIEA 4IE0A 4NROA 3AZYA 5CEHA 4D6RA 4CCCA 4HG6B 4GULA 4AK3A 4K9SA 5E6HA 1WMEA 2DFBA 4AHYA 1LOFA 2QQJA 4XFGA 1S2KA 1WLCA 3JB8A 5KXEA 2FCVA 3VD5A 2QUOA 4YG3A 2VCAA 2JDZA 3NNMA 2VBBA 4K21A 2R072 3VD4A 1C8M3 1OUXA 1JYCA 1CWPA 2OZJA 4AF9A 4MH0E 4LITA 4X6RB 1O5LA 5GLUA 1EY2A 1OBNA 1OOPB 4I0BA 4DXTA 3ACIA 2ZJCA 1GOFA 4AFCA 4HK9A 4CCOA 1ZRIA 3IT8A 2HKXA 2XB6C 2WYFA 4NN0A 2C9AA 4EWEA 2RHPA 1XYPA 4ONUA 3LWCA 1RUI3 1QDCA 2W46A 1GQPA 2YUEA 1D0HA 1VIWB 5AFBA 1NZCA 1CJDA 2ERFA 3AYDA 5C9AC 5L9RA 4BH9A 4YPJA 1V6LA 1N1SA 3OEAA 4M4RA 2BZDA 4HOOA 2JDPA 2XWBB 3WNNA 4ISQA 2WS92 4A45A 3WUCA 5JPNB 4Z8BA 2VMIA 2BOJA 3UKTA 2P6HA 1S0BA 3ZYRA 2P34A 3JQWA 1ZZ8A 1YQ2A 2B46X 5DQ0A 1IGOA 2RS52 5F32A 3T0DA 3JB4C 4A3XA 2GNDA 2WNVA 4IV1A 1ULOA 4FPJA 4XUQA 4NIGA 1YQ6A 2ZS6B 2ZX0A 3JQXA 2XLAA 3IDBB 4MYEA 5LA2A 5IVVA 1Q8OA 3ZSMA 5F39A 3ZR5A 1PMJX 3TN92 4LBQD 2XJRA 1NXD1 5J48A 4GIQA 2VGDA 4IEWA 2WWUA 3H1MA 4AI1A 4YM0A 1EUTA 3RJ2X 1U5ZA 2DVDA 3CKHA 4I3GA 3EHKA 3BKZA 3WX5A 5JOXA 5HCFA 1ULDA 2YMZA 1RUOA 3ZYIB 1ODNA 1Y43B 4JGZA 3SCGA 1CAVA 3LB9A 5EYXA 4PHZA 1RUD2 1W6QB 3WF3A 5C4WB 3DXTA 3DN7A 1ZZ7A 5L9VA 4XHXA 5FY7A 2IXCA 4UFLA 2E7QA 2R042 1YI7A 4QX7A 4BXFA 1GANA 1J3PA 3N9LA 3WNXA 1DGRN 1AR82 1SZBA 1TE1B 2XKPA 3OUJA 3OY8A 3PTRB 5LEKA 3USUA 3B9IA 5JVVA 3ZXFA 4A44A 1Y7BA 2ZMLA 2DV9A 2XLFA 2QQMA 2VCMA 1Q8VA 5EXOA 5JI9A 5L7OA 2RJ2A 3OGRA 3LPFA 1R092 3WF0A 3PVEA 1UKGA 4IE5A 3W20A 2EXIA 3RQ0A 3JBG1 3VDDA 1MQTC 3AMHA 2J1AA 1DG6A 2KD7A 1SG3A 4BOWA 3POWA 1CZSA 3LA3A 4QB6A 2NP0A 2VZPA 1SBDA 2B4KA 5BPXA 2PYTA 2XG3A 3LZZA 4DUWA 1DQ2A 1W04A 1Z78A 3N9QA 4DS0A 1JUIA 1VBE1 1W05A 2WKKA 2H0VA 3J4UH 3JBG3 1W6NA 3GYDA 1F31A 2WC2A 3WNKA 5FO8B 3C3VA 4AOCA 1S0DA 4FTEA 2PLV2 4E2QA 1L7QA 2JB8A 2VTXJ 4D7SA 3KHCA 1S0IA 1SLIA 2A75A 1WCUA 5ABJA 4PBOA 1PGSA 4N43A 3VBHB 4J25A 2Y6LA 5FZOB 3VHRA 4XBQA 3Q8FA 5ACA1 1NCRC 1VBE3 4ATFA 2ZTNA 2VW0A 2F17A 5FKCA 2A6XA 3ZSEA 4CP1A 4LXLA 2VECA 1TEIA 2O0OA 4JQRA 3N9OA 5FYYA 3VHNA 3WW1A 3ZFEC 5CFDB 5A7WB 4QX8A 4R52A 5K0UB 5JOYA 5K4LA 1OLMA 4XF1A 4Q4X2 4XEZA 3OD0A 1G9CA 1WMDA 5FZFA 3K3OA 5DZGA 3BVCA 4KGQA 4YFWA 2WN2A 2WWJA 1GZWA 2YFUA 5HCHA 4GH4B 1UYPA 4EN7B 3DEMA 2R1DA 2RV9A 5CYYA 1LOEA 2PAMA 1V70A 3VKMA 2OT7A 4YG0A 3TB0A 3KMHA 4OI0A 4JDMA 2PMWB 3VBHC 2XLGA 5HCAA 5HV0A 4CDQB 2CNAA 2A1XA 3B9CA 1ZVFA 4QM9A 2EVXA 1GNZA 4KG0A 1PGW2 5K0UC 2D6OX 5CFDC 4LKEA 2BGOA 3HBKA 1AZDA 3UT0A 3WW2A 5I0DA 1LULA 3ZKUA 1I9RA 3AVRA 3BN6A 3WHUA 4A6SA 4DUXA 4L99A 5ISLA 4J1WA 5L9BA 2W95A 4D6SA 2RDRA 2QZ2A 1C8M2 1QMJA 1AF9A 1PIV1 3KM5A 5JUVA 4C1WA 2GNMA 2VY0A 2KXLA 3FUOA 2UWBA 5DXDA 2VMDA 3PVNA 2GP5A 3AYAA 3SCHA 4XIKA 1LU2A 1DP0A 1W8NA 2NMOA 3NV3A 4QDQA 2UYAA 3AKSA 3IMNA 3M3QA 3PU8A 4U36A 4MOAA 1SLLA 5CIRA 4AEKA 4LMFA 4KBZA 5LK5A 1H9PA 1W9TA 2JIGA 2WSUA 3KF5A 2JJ6A 1CN1A 3R4UA 4QB1A 3WSOA 4AHZA 1GFF2 1PIV3 4MGSA 1OD5A 2WO7A 3PVBB 4PIXA 1TG7A 2WQ4A 3GJAA 5DG1A 2D3RA 1OOPA 4FVVA 2R061 1UY2A 4Q4W1 2VMFA 4MG2A 3EXUA 3ZIWA 4IDZA 4HXCA 5FUNA 2WA4A 1J1TA 2VZQA 4H3WA 5JSOA 3ZN5A 1A8MA 5HXVA 5IHRA 3LCPA 3VL8A 4DB5A 3BI3A 2DU1A 1RL3A 1CVNA 1OQDA 2VTFA 5BNOB 1BK1A 3AP7A 1R1A2 3T2OA 2R063 4Q4W3 1UY0A 3KV4A 1H30A 4YW5A 5LW9A 2E6VA 5FZ7A 2R32A 2QQOA 3HN1A 3U4SA 4FXGB 2VZVA 4BQ3A 4F83A 2BVBA 1EV11 1QKQA 1W2TA 2ZGUA 4LIUA 4ZXEA 1Y9QA 3LE0A 1FI2A 1Q5OA 2YXSA 4JTNA 5GZGA 1C1LA 4XFIA 5IYYA 3F2ZA 3I2FA 2W9XA 3KSCA 5EQUA 3ETPA 2IXKA 4E4DX 2IVJA 4XFFA 2XBO1 2WO2A 1NA1B 3RVHA 2OUJA 5D2AA 2R1BA 4DINB 5IFPA 5A1LA 1SLCA 1X8EA 3AFGA 5DUWA 1NCQB 1Q8SA 2RJLA 2JB4A 2XQXA 2XJUA 3POSA 4RR3B 5CG9A 1EV13 1KDKA 3U4XA 2FDKA 1E5RA 3H0OA 1J3QA 2RS11 4GA9A 4AGVA 1LGBA 2PHTA 2ZEYA 1IZ3A 3AC0A 4CP0A 5A3PA 1QJEA 5EIYB 1W6QA 1GP6A 5C4WA 1NAEA 2W47A 4Q0UA 2XBO3 2Y8KA 4FCAA 1QJY3 4HVRA 4JCKA 1D0GA 3TNPB 5FY4A 4BPZA 2CAUA 5FYCA 1ZREA 1PK6B 4UFJA 3OBAA 1QEXA 3IDEA 4BZ4A 2VW1A 1CQ9A 4AFMA 4QX0A 1PZ9A 1HB1A 2DU0A 4IESA 3OBRA 5IUQA 5A7OA 4QPWA 2RMU1 3AP5A 3NW4A 2RS13 2FDJA 2YB7A 3GHMA 3PNAA 4Z82A 5AFEA 2GALA 2A3XA 3FL7A 3NJXA 1LGCA 4Y5Z0 4Q5OA 5DMYA 3M3EA 2Z69A 4AE2A 4CPBA 4GZ9A 2WJSA 4XDPA 1LB2A 4AQ6A 2CGNA 1T2XA 2ET1A 2XHKA 2RDQA 4CCJA 1F15A 3NNLA 1PK6C 4KWLA 4DMIA 2PFWA 1NT0A 1MEC1 2D5FA 1NE4A 2RMU3 2J22A 1UU4A 1DBNA 1N1YA 3IPVB 1YYNA 5FXXA 1FNZA 4CCDA 2ARXA 1C8NA 3KVAA 4URAA 5FZ0A 4HSJA 2R30A 3MPPG 1H2NA 2JG8B 2MNGA 2BUKA 2V73A 4KI5M 4LO8A 4PLNA 2C26A 1GICA 3ABZA 5C8CB 5DDJ1 1F4HA 5LASA 1VBE2 2SLIA 4NHMA 3PUHA 3JUUA 1DQ0A 5FZAA 2P3IA 3C2UA 3ROUA 3LFMA 1U5YA 4B1LA 4D7YA 3TRSB 1UZZA 2VULA 3A23A 1CAWB 1FMD1 5FOJB 4RD7A 5IFTA 1B35A 5FO9B 4IXLA 4EJRA 4IUGA 2WABA 5KBFA 4GWMA 3S0MA 5JZGA 1LJ7A 4QPIC 1YI9A 2FQPA 1N47A 4UFIA 5DDJ3 4YW4A 2YGLA 5ACA2 5LCWL 3O1RA 1DYOA 4QGMA 5T55A 4XUOA 4UFKA 5EWSA 5FZHA 2DBNA 4QPGA 4YW6A 2XL7A 1GKBA 3I2IA 1WBFA 1ZBA3 5A7WA 4L2NA 2D6MA 1FMD3 1OA3A 2W2IA 4FPEA 1ULCA 2Y6JA 2WO1A 4Y1YA 2W68A 5LRRA 2JICA 3NJYA 4AVCA 1ONAA 4COUA 4CU6A 4C1XA 3W5NA 5KHGA 1QDOA 2VUCA 1UY3A 1UU5A 3ETQA 4GH4A 4CXWA 3WW4A 2VUAA 1H6XA 1XNBA 3A21A 1UMIA 2QQNA 2DFCA 4I2OA 4OHXA 4OCTA 4FPHA 3ES4A 4YVWB 4R8HA 4V1PA 5G05L 1YC61 4CDQA 1UAIA 3ZO0B 2JG9C 3GGLA 2ZAAA 5EP9A 2X05A 2F6BA 2LM3A 5GM0A 1NYWA 2GNBA 5J09A 4OLLA 4RGKA 4LQRA 3VUOA 4AFAA 3UGGA 1OFNA 5FIXA 4WM8C 1VLNA 4ZKTB 1RGSA 1ULPA 1CONA 1HXS2 1PNGA 2WINB 4NAMA 5FTTC 4F3JA 5A32B 4A4AA 4RQPC 1EYBA 1NLRA 1T6BX 5A6ZA 1PIV2 5A3MA 1L7LA 1SBEA 1OLQA 1T6GC 3VHOA 1ULGA 2NMNA 3QH7A 1PO21 1XSRA 4IV3B 4RFRB 2X5IB 5FY8A 3GF6A 3ZXDA 3S6PA 2G9FA 4CPBD 3O1MA 2D93A 3GXUA 4BCUA 1NLSA 2BDRA 4QX3A 4ASKA 1JTZX 1XU2A 1JXNA 1C5HA 4K8RB 3S5QA 1LODA 1UQXA 4IW3A 2JE9A 5APAA 4CSWA 4YWAA 2I74A 2P5BA 3VBRC 2EICA 2AREA 1NE6A 4COYA 1V6NA 4RYDA 1SFPA 4YZ2A 2DUOA 3NNGA 4LJHA 2ZGRA 2EIEA 3ZYFA 2C4XA 1X36A 1PO23 4QHOA 1H2KA 1VRH1 4JAAA 4R4XA 4CCKA 4A3ZA 1Q56A 2R062 2VW2A 4Q4W2 2CSGA 4Z07A 4DQAA 3CBNA 3BTYA 4RL7A 4TSVA 1UW8A 5C3RA 5D21A 2X5IC 2W94A 5A33B 1WCDJ 2WT1A 1YLLA 1JYIA 2V5DA 2AUYA 2EIDA 1ACCA 1LECA 1YO8A 2JDMA 2YC4A 3AZZA 3Q9OA 3QCWA 1LAJA 1UL9A 4PJYA 2X53S 1ND2B 1A8DA 5BNOA 2WLQA 1VRH3 3RS6A 2ZMKA 3ZN6B 1KGYA 4TZDA 4LIVA 3JZVA 3URFA 4P9GA 1LOFC 4Q0PA 1JYTA 4B3NA 2EXKA 4XJZA 1PGL1 3AM2A 1G7YA 1UX6A 3GBFA 1BCXA 2DDUA 4AEDB 3MF9A 4PCRA 1GQHA 2CGOA 1LOAA 2IFWA 1I1EA 1EV12 4IETA 2CY6A 4ZHNA 3EMRA 1VR3A 2W91A 3PMSA 5IVJA 1OHFA 5JR2A 1JN2P 2JD9A 3NNJA 4DXSA 1ND2C 3CHXA 2XBO2 3SNMA 1NA1A 2D3SA 2JX9A 2WZR1 2ZMNA 3RGBA 4LHNA 2CAVA 1UCXA 2D97A 3RI8A 1LOGA 1HX6A 1NCQA 4CA9A 3PURA 2C1FA 4NE9A 4RR3A 5BNNB 2FDHA 1X82A 5EJZB 2XGXA 3QOPA 3HWJA 1DGRA 2RS12 4H7MA 3DECA 4HPKB 1QH6A 3POYA 2D43A 2OQ6A 2RR11 2Z2SB 3AFKA 1O3RA 3AL6A 4Q0SA 4XQ4A 1OVPA 4Q0QA 1XU1A 5J1XA 1AR71 4WVMA 1TMF1 3PUQA 4Y4YA 3KVBA 1F2NA 4K1ZA 1V00A 2WZR3 2CWSA 1MVEA 4LBLA 2YV8A 1QIQA 2GC3A 4O7XA 3MHZA 1YFXA 4FQ4A 3UKVA 3IZOA 2UY9A 4JGZB 4Y5SA 3DYMA 3VKLA 1LEDA 3J8F1 1SQ4A 2ZX2A 2DYCA 1EP0A 1ZZCA 3TYJA 3WP3A 3WR0A 4BQ5A 4Y24A 2RR13 3PUIA 4XBNA 3ZDSA 2GNTA 2GH8A 2F4PA 2WNVC 4IV1C 1ULEA 4FP2A 4DNYA 1TMF3 1UU6A 4M4PA 4FOQA 3H8XA 1NZIA 1OFSA 4QQ2A 1WMXA 4BQYA 2HBUA 2ILMA 1WLWA 5FFOC 3N7KA 3C8XA 1VE0A 3E6DA 1U0AA 3ZPYA 3WV6A 1RHI1 3LA2A 3SISA 3LIGA 3WINE 1G9DA 2VBPA 1H4GA 4XFBA 1MEC2 1APNA 2ET7A 3RNSA 5L7OB 3IPVA 1CAUB 4JGZC 1GP5A 1RUG1 3HIFA 1W9SA 2JG8A 2GN7A 2XOMA 5FP3A 1CZTA 2OIIA 5C8CA 3LIHA 5F7UA 1HDKA 2BQPA 2PA7A 4HT1T 1GU3A 2EA7A 5IATA 2QVSB 2D7FA 4X6QB 4LR4A 4E4ZA 5J36A 3CJXA 2VMGA 3OOXA 5CADA 4CDUB 1BK0A 1FMD2 1JS9A 4QPYA 2VCCA 1CAWA 1UY4A 4O61A 1SBFA 2ADDA 5J3UA 1KD7A 4L11A 5LY2A 3CDZB 3WQBA 4CCEA 5C8WA 1RUG3 3SITA 2ZKNA 5E16A 2P3JA 4AQ2A 5FZDA 2Q8DA 3OUIA 1LTEA 4NOTA 2EALA 5L7OC 4RA0A 4C90A 4W65A 3MLKA 4LE4A 4YG6A 5CB7A 4FO9A 1W2NA 1WWYA 3HT1A 2BOIA 3VDDC 4NHLA 1PMIA 5DZFA 5F9TA 1AXYA 2HEWF 3O1TA 5M0TA 2NM1A 3E97A 1RJ7A 3O1SA 4P14A 4BLIA 3GJBA 3KV9A 5FO7B 3ZX7A 4EWDA 5CFCB 5FYBA 3ZIXA 4P9YA 2FZ2A 1JBCA 2VG9A 3LOBA 1RXGA 1S4CA 1VBD1 2Q8CA 2E7TA 3CNAA 3W58A 2UYBA 5DAWA 2QCSB 4FI9A 4ITCA 1WCSA 2HH9A 3P3PA 4FPCA 4KH9A 5HXMA 1DQ5A 2OX0A 3MIFA 4AEMA 2V5YA 2ARBA 3J26N 4P9WA 1DZRA 1WLDA 1B09A 3ILRA 1VB4A 1VB2A 1VBA1 3W21A 4YVWA 2Y6HA 2LUWA 3HN3A 5JMOA 4H7LA 1W06A 1JH5A 3O12A 1XE0A 1IG0A 1SEFA 1VBD3 1JHJA 4JKKA 2V4AA 1UOJA 1H0BA 1W2OA 4ZS2A 5ABJC 5CFCC 4LKFA 4N43C 4FAHA 5EZWA 4W8JA 1LHOA 1DHKB 2AC1A 2J7MA 4PDWB 5A32A 3VBSB 3DUIA 2Y64A 2VL4A 1WA6X 3RZHA 1LGNA 1VBA3 2W52A 3E5XA 2Y6FA 1PO22 3KF3A 4IV3A 1AHSA 4DZGA 3P6BA 3SCFA 2HJIA 4XXPA 2BV4A 4HVOA 5IW0A 1CX4A 3J7LA 5A7NA 2OA2A 4RS5B 1VMFA 3O1UA 4YGBA 1FV3A 4YNIA 2BBVA 4CDXA 3NV1A 1RITA 1YUDA 4P5HA 1KFUL 2ZHMA 2UWAA 3LEIA 5FYMA 2DCZA 5FYIA 3I2DA 4BQ2A 4OUMA 5JXHA 5FPLA 2FHRA 3BALA 4HFSA 2W39A 3GZAA 5IT6A 5FDBA 5DN2A 4GD4A 5AC91 4Q1RA 3MFAA 1ZRCA 4QU1A 4UW6A 4BQWA 4HSLA 4FFFA 2B7YA 1ZA7A 3VBOB 2WZ8A 3FJSA 2J1SA 4W6WA 3UETA 3ZXJA 4BXSV 1RUI1 1OPOA 4XTMA 4LEJA 1M4WA 5A33A 1JZ3A 3DF0A 1BJQA 3HR9A 1O6UA 5FZ8A 4P5YA 4OHWA 1DQ4A 3JXSA 2VO5A 3ME2A 4Q26A 1ND2A 3K2OA 5AC93 2XH6A 3HNYM 3N7LA 5KHKA 1V9U1 3IDCB 5FLHA 1FAYA 3WHTA 3ZN6A 3POJA 1OQEA 2B9UA 3VBFB 1VMJA 3ASIA 5ERLA 4L97A 5BY5A 1E57A 1PGL2 2BWAA 3E1F1 2VZUA 1H8TB 1OLME 4XJAA 1K12A 3B01A 3WG1A 4AFDA 4AEDA 3ZM8A 4HKWA 2Y6KA 3POEA 1QWRA 2GC0A 3I7DA 2TBVA 2VMCA 3OGJA 1NG0A 4NR1A 4AVBA 3FN9A 1GQGA 4E2GA 1QNYA 3I2OA 3OCPA 2OW4A 1US2A 1M06G 3UNPA 1KS5A 4MHUA 3WQ0A 3W5MA 1V9U3 1O4TA 1VJ2A 2JD4A 4WM7A 3M2MA 3AL5A 1S0GA 5FZMA 1OOPC 1UYYA 5CNAA 4LT5A 3LGRA 1W2AX 5FRAA 2WZR2 4KGGA 3HJRA 2HWD3 3TOJA 2VAUA 3MEPA 3HQXA 2WN3A 2JENA 4Y1ZA 5BNNA 3Q8AA 3WXPA 1PHMA 2WYSA 3OGSA 4IEYA 1QY4A 4M3CB 3TEZA 5JSRA 2RR12 1IG3A 1PM4A 4HPKA 2ZGSA 2FDIA 2ZEZA 4QKFA 1OI6A 1R1ZA 2KM2A 2RDSA 1AR72 4LBMA 5C70A 1TMF2 2VE1A 2JE8A 1NOVA 3AP9A 1AL21 2IUWA 1EUUA 4K1YA 4R9AA 3ZFGA 1H1IA 4HLTA 1MS0A 1A34A 2QQWA 4AI8A 2XR4A 1LEMA 1WCKA 1F5JA 3KD4A 5EV7A 5C7GA 3WP4A 4A42A 5IVFA 1V6IA 3J8F2 3ELNA 1Q43A 2XUEA 3HT2A 3MIHA 3MUZ1 3VZOA 3WF4A 4LPLA 2ZEWA 4CP2A 3PHMA 5DUVA 5AVAA 4LK6A 4JC1A 4CRQA 3HPNA 1BMV1 2OS2A 2VVEA 4CCLA 4V2WA 3RFRA 1O4YA 2QFEA 1HQLA 4IL7A 4PT6A 3A0KA 1AL23 2QJVA 1JZ4A 3PDQA 4DXRA 1S0EA 4QQLA 2IWGB 1X33A 3FHQA 4FPYA 4HN1A 2VNRA 3DYPA 4HZFA 1RHI2 2ZPXA 5LWBA 3WNPA 3JCIA 1OXCA 5FJHA 1JZ2A 4K20A 1KDMA 1WD4A 2CV6A 2WL1A 4Z92B 4QKBA 2EF6A 4FPKA 1CAUA 1RUG2 4PF5A 4D69A 5FP4A 2PQQA 3LD8A 1UKRA 2ID4A 5C4WC 4TLFA 1LR5A 4META 4JVAA 1AL0G 3ZXEA 4BDVB 2GN3A 3U75A 4D6QA 1H8VA 2RM21 4CE8A 3OYWA 2TNFA 3WNMA 1WD3A 4DRRA 2EXJA 4CDUA 4SBVA 3NKGA 3ACFA 3G7DA 4ES8A 3ORJA 1MS9A 4XACA 1TZOA 1REFA 2P1BA 5A3LA 3VBUB 1FPN3 3AJZA 3W59A 1G9BA 3C7OA 1RUJ2 3ZOIA 1WZXA 4PI2A 4MGQA 2D44A 2RM23 5A1FA 1H6YA 1XB9A 1F35A 2PAEA 5KC5A 4OQ8A 4OULA 1UYZA 1B35B 2A70A 4ASLA 1HB3A 5CKMA 1UO9A 3K77A 4KG8A 4LA3A 5I8SA 2JKXA 5CFCA 5JZGB 1GWLA 1GUIA 5FP8A 1C5IA 4B4QA 5KXCA 1IS6A 1VBD2 5I91A 4CEYB 3I3EA 3O1PA 4O9GA 3FBMA 3G6JB 1RINA 1UOBA 1O4ZA 2V4VA 3A22A 4QPGB 4A6OA 2ZA9A 4H55A 2WWSA 4OYUA 3AKRA 5DPNA 5FREA 3E5QA 3GDBA 1S55A 1RUF3 3KZ4C 1S2EA 1VBA2 4LLFA 3S5AA 4AXOA 1XRUA 1H1AA 1LCLA 3BGAA 1LHWA 2Q8OA 2RG4A 4BU2A 1UY1A 1MACA 4BHPA 1B35C 4NPMA 5GZCA 3USSA 4YW3A 2VH9A 5FMCA 3KQ4B 5JZGC 2DVAA 5LA1A 3PIGA 2HWB1 3IKWA 4PDWA 1GBGA 3D0SA 1H1MA 1TME1 1OQ1A 2B8MA 4IEPA 1OLRA 1QJX1 4NO4A 3VBSA 3V56A 1XNCA 1W9WA 1IKPA 4QPGC 4EQVA 5BNPB 1C57A 4KU7A 5BUVA 4L0PA 2WLPA 3CF6E 4QM8A 2BNMA 5KWRA 3JU9A 4RS5A 4BISA 4BYYA 4CDWB 4LBNA 4COVA 2MEV3 2B45X 4AVSA 1UPSA 1N3QA 2J1EA 2HWB3 2E31A 4GH4C 4GQ7A 4AAPA 2FCUA 1RUH1 1TME3 3CLPA 4YM1A 1QJX3 1ZRFA 1QNWA 3OGVA 3NL1A 2BERA 3BYWA 4YM3A 5AC92 1SACA 1UOFA 4KWKA 4JDNA 2ZHKA 2ZGLA 1GNHA 3VL9A 4CDQC 2YBSA 4E27A 3VBOA 4Q4V1 4FTBA 1RIRA 2IXHA 2O8OA 1RUI2 2MHFA 4GWNA 1RJ8A 2DTWA 4XYXA 2OPWA 3PVOA 4Y1XA 3BOWA 1V6JA 5CAZA 2CU5A 3SKVA 1GWMA 3DXUA 1QGLA 3AB0A 3O1VA 1RUH3 4QKNA 3BCWA 3C7GA 2OZ6A 5E88A 3ZR6A 4Y3OA 1TVGA 4AGRA 3J9SA 5FBZA 4MVTA 5FUPA 1JI6A 5FZEA 5FKBA 2OQ7A 1V9U2 3T2PA 2R49A 1O91A 2BFUS 2BGPA 2WZEA 3N3HA 4DRVA 3RZZA 4Q4V3 3KV5A 3VBFA 5LBFA 1XXNA 4P08A 4LKDA 3WCSA 3FHIB 1YRZA 5IVEA 5IK5A 3AYEA 4QU2A 2RS31 1H8TA 1JUHA 1CPMA 1G86A 3WD5A 1UXXX 4NWVA 1G9AA 1Y3TA 4OHVA 2WNUB 4C91A 5J96B 3AX4A 3AZWA 1HB4A 4OVEA 4YVSB 3VD3A 5LZ6A 2HLEA 5FV3A 1S0CA 2B5HA 2AZ5A 3MUY1 4NWWA 3AKTA 1ZRRA 4QAWA 5FYUA 2VTXA 2H6BA 2FDGA 3GZUC 1HRV1 4ZY9A 1W9YA 2WA3A 4LO7A 2C0ZA 4YLZA 2RS33 3INAA 5FY0A 2XWJB 3Q8BA 1JOJA 2BBAA 3OD4A 4XXAA 5JOZA 3GHNA 1JOBA 3H3ZA 4NPLA 2DCTA 2P4EA 4KBBA 4G3YC 4Q8KA 3KS7A 2ZHNA 1YJLA 2D5HA 3C7FA 1H9WA 4DFSA 2K46A 1AX2A 4MO3M 2DTYA 4M3CA 4XQDA 3MYXA 4XUTA 4BMEA 4DY5A 5BNOC 1QJY1 2ZGQA 1HQNA 1E5HA 2WNOA 1HRV3 1AL22 3OJBA 4QMAA 5KHHA 2A5ZA 3MDPA 1XNAA 1ZM1A 3RSJA 2WT2A 4XETA 3WCRA 4XAEA 5C3OA 3S7IA 4R9DA 5JIUA 1QF3A 3WNOA 5DG2A 3ZYHA 3CMGA 4PIZA 3HNMA 5GZDA 1YHFA 3KT7A 3APBA 1S2BA 1NQDA 4WVMB 5T5OA 1GYKA 1QJZA 1GWKA 3KT4A 5LEJA 1POV1 4A7YA 1OKOA 3PUSA 4QGNA 4E9KA 4XQWA 2ES3A 2D40A 3FX3A 3NAPB 3ZYGA 4EN6B 4K3UA 1NA1C 1QXJA 2QQLA 1YJKA 1C1FA 2DUQA 2GMEA 1JZ6A 2YBKA 3HQRA 3H42B 4INDA 4Y26A 4MGTA 5JXIA 1NCQC 1W99A 3A7QA 1S0FA 4RR3C 4Z2AA 3KV6A 5JIAA 1YFWA 5LRSA 1X50A 2VXJA 1POV3 5GLVA 1I5ZA 5F2SA 4GKYA 5ANNA 5HPOA 3JBG2 4K40A 4MZUA 1FNYA 3N7MA 2VUJA 3SC7X 2RM22 1EAH1 1GMMA 3R05A 1HJGA 4MSVA 4ZU5A 4LE3A 1W2UA 1YWKA 2Q5TA 3M3IA 1E5SA 4YZ3A 4D0QA 1PM7A 1I3HA 2EAKA 2YDEA 4MUVA 3V0BB 5SV8A 3B00A 3T08A 5EPAA 1OKQA 4KWUA 3ZMNA 1MZ5A 4NUBA 3VBUA 4COWA 1FATA 2W1SA 1N1VA 1OA2A 3PIJA 2J1UA 4IGPA 1ND3B 1GZCA 4UW4A 3P3NA 4SLIA 3ACHA 1K5MB 1EAH3 1PVC1 2OUHA 1ZBA1 3D4KA 3LEGA 3O7OA 4YGCA 2OYZA 2HWC1 4NHYA 2CTVA 3EJKA 3HMYA 2WFF1 4HKLA 1D4M1 4XZUG 4FOVA 1H4HA 3T4VA 1Q3EA 2W3JA 4C0BA 5I0RA 3LSEA 3ACLA 4ASMB 4BK5A 1O3TA 5K9YA 1ENXA 3UESA 4QX2A 2K9ZA 4CEYA 5JXGA 4FXKB 3MGUA 4LOSA 2I07B 2BTVC 2JG8C 3I2JA 2QQVA 5LBEA 2P3KA 2Q1MA 3ZYJB 5C8CC 1PVC3 3MPBA 4NIIA 1D7PM 1F9KA 5F3CA 2JXAA 2HWC3 3THTA 2QQIA 4CEWB 2WFF3 4OMCA 1D4M3 4YZ4A 4ET7A 1ZA4A 2JDAA 1LKNA 4FSJA 2XVLA 2ZX3A 3LDBA 4BQXA 5FUIA 1Y9MA 4LNVA 4XMIA 4TWTA 5GZFA 3AMMA 1XOYA 3H1YA 5JWPA 2VOKA 3BB6A 3AYCA 4NIHA 3D82A 3U78A 4W6XA 4EN9B 2C6SA 4GB31 2XDVA 4A41A 2YROA 2PHLA 2GU9A 2HWB2 3MIBA 3HOBA 3VZJA 3WF2A 4AI2A 4AQTA 5F2WA 1D2SA 1TME2 3SHRA 1QJX2 2WBKA 2XONA 2DVBA 3AJYA 1LHUA 3PMEA 3I2GA 5BNPA 4W4ZA 2FZ1A 1Q8PA 2AACA 5CKNA 2XL9A 5E1RA 3T30A 2TUNA 3ATGA 3RPQA 2KR2A 4W50A 4UW5A 1Q8QA 1DGWA 5I0SA 1CIWA 4GB33 2IFRA 4QT6A 1Y4WA 4RSUA 1WA4A 2A6WA 4LKSA 1RUH2 3AZVA 2CYFA 5C33A 1W8TA 2B39A 1VAKA 4R9BA
chains in the Genus database with same CATH topology
4YVWC 4LO5B 3QD6A 4CDXB 4JTOA 4N90A 1HRI1 2GMPA 4BLJA 3M7AA 5EJ3A 2PHXA 3ZXGA 3ZXKA 5TSWA 1OSGA 3ZSLA 2UU8A 5F6KA 4LTAA 4CTEA 1AR91 1REDA 1U12A 2E7AA 3VV1A 3RYRA 2DUPA 3ECQA 3FZ3A 3H9AA 1H2MA 4XOGA 4IV3C 2GMMA 1KRIA 2XUMA 3UL2A 3WG3A 1HRI3 2RS32 4UBGA 4X8PA 2WNEA 4L92A 1HQWA 3B69A 4BIFA 1AR93 4CDXC 4KU8A 1DIWA 2WNUA 3DGTA 3NJZA 4YVSA 4AQSA 5FPZA 4B7EA 2XJQA 3FC0A 2A6VA 3DPRA 3AMQA 5GLTA 4YGEA 1HRV2 1DGWX 4HMZA 1W39A 1IKQA 1H2LA 2P37A 3ZFFB 2VQ0A 4AW7A 4OI2A 5D8AB 1BBT1 1PZ7A 3B94A 4WM7B 3RRDA 1QXPA 1AXKA 4X8NA 4EN8B 1QJY2 3D0JA 1TNFA 1IPKA 1REEA 1AJKA 5E8AA 2R073 4PQ9A 2QDRA 3AKPA 4YW1A 4P9XA 3RG0A 4AEDC 2UWCA 5HI0A 2QNKA 1BBT3 3VN4A 5J7MA 5FLIA 3N4MA 1FOD1 4AEJA 4Q8LA 3V64A 3WVJA 3ZFGB 2XVKA 1N1TA 3HAGA 2WIIB 1NY71 3R4DB 4WM7C 3SH4A 4CDWA 4RHV1 4Y22B 5FQ0A 5IK8A 3NAPA 4ATEA 3KLSA 1LESA 1MS5A 2Q4SA 4G4FA 4OUSA 4YW2A 3CU7A 2RMU2 1J1LA 2ZX4A 3L2YA 5BNNC 3KCYA 4HVQA 4S2GA 2D6LX 1FOD3 3UK9A 3KB5A 3AP4A 4Q2FA 3MLJA 4LBOA 1VALA 4QD2A 3IN9A 4RHV3 1DQ6A 4L8QA 3ZFGC 5K8SA 1EAH2 4WVZA 4AWDA 2PHWA 3M70A 3RI9A 1PNFA 2RS53 3WQ7A 3V0BA 1KJLA 1TQ5A 1DU3D 1ALYA 2ENRA 1RUD1 2XJVA 1LRHA 4Q0VA 3TAYA 2EAAA 1W6PB 4AHWA 5DDJ2 3ES1A 3TN93 3WZ1A 1SDWA 4I30A 1X7NA 3QLQA 1ND3A 3OYWB 1DYPA 1IHMA 1PVC2 3FBYA 1ZBA2 1K5MA 5GKAC 2W08A 2HWC2 2Z79A 3BODA 2WFF2 1D4M2 2R16A 1EPZA 1HV1A 1RUD3 1WUVA 4QX5A 2BFUL 1QOOA 4N9HA 2P17A 4LO6B 2NN8A 1ZNPA 4CYDA 2YYOA 2A6YA 1F8VA 4IEUA 1OA4A 1AR83 1ZZBA 1MS8A 1VAVA 3EQEA 5DUUA 3SLIA 4CEWA 4M0NA 1URXA 1KQRA 4J1XA 1V6MA 4CDUC 3IBMA 2VNGA 3CJIB 5C6CA 1VAMA 2WT0A 3WDYA 1DGLA 3OPZA 4GB32 2JE7A 1LHVA 1MS1A 5T5PA 2E51A 1CGPA 3JD71 4F7ZA 1CAXB 4B4PA 3WDXA 5L36A 2MPFA 3KGLA 1W0OA 3DL3A 3U07A 3ZXLA 3WDWA 1GSLA 2DVGA 3M8LA 4MGYE 1BZWA 1HIXA 2D3PA 3VKFC 3O5SA 4F8AA 1FYUA 4YARA 4ES9A 2XKOA 3TWIA 5IK7A 3JD73 2FMYA 2PLV3 2WZPP 1RMU1 1WGPA 4JGYB 1WLTA 1DZQA 4YZ1A 5J37A 2BNNA 2PHRA 4OHZA 5I93A 5BNQA 2BNOA 1KFXL 3T2TA 1LU1A 2A73B 1HRI2 5CA6A 4N53A 4AG4A 2WFPA 4PLOA 3K51A 4LBQA 1AR92 4XJ8A 2AGSA 1VRH2 3THPA 4PDWC 1W0PA 3ILFA 4XJUA 1SLTA 3VBSC 4BM8A 1RMU3 2QE3A 2Z42A 3AMNA 2QQPA 3B5LB 5H9PA 2XJTA 1GZ9A 4XPVA 5B2GB 4RS5C 4LBKA 1XNDA 1O3QA 1DDLA 3WP6A 4H14A 2ZAHA 4LO4B 2CWMA 2X29A 3GZTB 4PBPA 2QZ3A 1UZYA 1UF2C 3N36A 5JPMB 3WY6A 3BOPA 3MF6A 4I02A 2Q1ZB 1J59A 1PO11 2JEMA 5T5LA 2LTNA 5C9AB 4HANA 4I01A 1C3HA 4JRAA 2HWD1 2A3WA 4IERA 3VBOC 5I0TA 2P2KA 3ZFFA 4AYUA 2DURA 4G9SB 1XYOA 5KXDA 1V6OA 4DXZA 5D8AA 1BBT2 1LHNA 3RYPA 5I8YA 5JMCA 1CESA 3H8UA 4FTSA 4BE3A 3MI8A 4W6YA 1PO13 1CJPA 3O0XA 2DWRA 4XDQA 4XTPA 4BMBA 3VZNA 4XBLA 5HCBA 2PTMA 4QGLA 3MFCA 3IM0A 3VBFC 5KC6A 3X29B 1H8TC 2XPJA 2H0BA 2PELA 3QBQA 4XILA 1MS4A 4MX3A 1R1A1 2HWE1 1FOD2 4IEZA 4A7ZA 1ENSA 3OBTA 2BGCA 3B93A 2NLRA 1NY72 3PJYA 1KJRA 4RHV2 4NVPA 4Y22A 2GC2A 5DUXA 2Y38A 3H1WA 3NVCA 3SMHA 3AP6A 2Y26A 4K8FA 3H7YA 1DYKA 3RYKA 3VLBB 2ZZJA 4OFGA 3M3CA 3N7JA 1R1A3 5EFUA 1RUC1 1YCIA 1BVVA 4WBBA 2HWE3 1U5XA 1O3SA 3BU7A 4IEVA 2ZACA 2DF7A 4AI0A 5EYYA 2VOWA 1SFYA 3NV4A 1YXWA 5K7PA 4I0AA 4AI3A 4BWOA 3MIGA 3MW2A 5D1IA 3LOIA 1MVQA 3UKNA 1RUC3 2DCKA 2ZX1A 5JSPA 3NSTA 2ZCWA 1MQTB 1FPN1 2OVUA 3I59B 3PTYA 1W6PA 4LUKA 4M01A 4A7KA 3R0RA 3W9AA 2W0XA 3ILNA 4NPRA 1FV2A 3MW4A 4RGAA 4YM2A 5CG8A 1UIKA 4HL0A 5FCCA 4FBFA 4MGZE 4UBHA 4DOUA 3R6SA 2IXLA 1Z7S1 5T50A 4EWAA 3PLQA 3AK0A 4M3CE 4DY3A 1RUF1 5BYNA 3WG2A 2RE9A 1BKZA 3HBZA 3FMGA 4Y20B 3WOGA 1NCRB 1WW5A 4LA2A 3RMYA 3ZFEB 1SFNA 4WZFA 1XE8A 1Z7S3 3CJIA 2Q30A 1N3OA 1HKDA 1CPNA 3MICA 4Q4Y1 4MGKE 3QACA 3VBUC 3AZXA 2AH2A 4XJWA 1AX0A 2D98A 3JD72 1S1AA 1CAXA 1SMVA 3T1MA 4L9BA 2I45A 2QDNA 3LAGA 2A6ZA 1IS4A 1RC6A 2JKBA 3FUQA 3LA7A 4XE9A 5BV6A 4BQ1A 4ISRA 1UMZA 2C5DA 2MEV1 2XJSA 2GC1A 2ZGNA 4Q4Y3 4BA6A 5GLWA 4CEYC 2GH2A 2YC0A 4KNCA 1O5UA 2HEVF 1SCRA 4Q1PA 4FOWA 4D94A 2V09A 1GR3A 1RTVA 3B02A 4MV2A 5CBLA 2QKDA 3DV8A 4YGDA 1VP6A 4LLOA 1RMU2 4ORFA 2HWF1 4JGYA 2HEYF 3RDIA 1W6MB 4XF4A 5KHJA 5ACA3 3V0AA 5GLZA 3U10A 1PVXA 2PHDA 1N3PA 3CL1A 2KA3A 3O0WA 3VHPA 3LKJA 4LHKA 1ZBE1 2FMDA 2N7GA 2K2SA 4R4ZA 4MXVA 2HWF3 4UXAA 2Y0OA 2BEOA 3FWEA 5BNPC 4NHKA 3O14A 3WDUA 5GZEA 4RFT0 1HXS1 2VPVA 4ZXKA 4XFHA 5F5QA 4LHLA 3KT1A 2PHUA 3D5OA 3H50A 1ZBE3 3H3UA 1WW4A 1PO12 4QQOA 1IS5A 5C9AA 4I0WB 2HWD2 2EIGA 2JECA 1Z0HA 3LSDA 4IEXA 1HXS3 4PIYA 1J58A 4HBNA 2DCJA 3SH3A 1AR61 2VOXA 1ZYBA 3DPRB 3AXDA 3BTAA 3ENRA 4GXLA 2LALA 2R0FA 2VQAA 1QXRA 1ZX5A 3BIWE 3NO8A 1QQP1 3I54A 3B3QE 3FLPA 1O7FA 5F1RA 2ZGMA 3RWNA 4UW3A 2AYHA 3U11A 1QHDA 1ZZ6A 1AR63 1CD3G 2D6PA 4Y1VA 1UN1A 1L3JA 4KL1A 5JR7B 2ZOEB 1FXZA 2HWE2 2WNUC 3BPZA 2ZGKA 4YVSC 2A3YA 4AHXA 1QQP3 3MZHA 3DPRC 4B7KA 2B42B 1MZEA 4FP3A 2ZGPA 4HN0A 2D6NA 3FFQA 2ZABA 1W6OB 1ZZ9A 2NYYA 2EXHA 1BMV2 3O0VA 1SLBA 3UV9A 1RUC2 3ALQA 2BYVE 5HBAA 3VZKA 3A0NA 5FQ0B 4CDWB 1QU0A 4S2FA 1NXMA 4COZA 4YFZA 2E9QA 3WP5A 2IXIA 2K0GA 1U5IA 4YSFA 3WQ1A 4I3PA 2O1QA 2VOVA 5IK4A 4B4RA 2A71A 4GMP1 1QOTA 4U2AA 1QJU1 3OTFA 3QH6A 1FPN2 3WUDA 1MQTA 5JI7A 3I59A 3ZN4A 2BVVA 5H9RA 5I0UA 3B7MA 1ENRA 2FBEA 2ZKLA 4AFBA 4CDWC 4S2HA 2CL2A 2VMHA 3NAPC 1YFUA 4JDOA 4GMP3 3AMPA 1D4VB 1POV0 5FPXA 4FOYA 1QJU3 3FFZA 2X8KA 1JW6A 4HK8A 1XYNA 1Z7S2 3HD8B 2ZGOA 4EROA 1RB8G 2GDFA 1SCSA 4HETA 5FMOL 2Y0IA 5CU1A 1RUF2 4MXWB 1XQNA 1DFQA 4GMP0 1AJOA 4QPIB 2WSVA 4Y20A 4QXKA 4DPNA 1NCRA 3GBGA 3V65A 2YY1A 5JAXA 3ZFEA 2ZGTA 4P9LA 1HV0A 1C4RA 3MLLA 4Q4Y2 3FLTA 4FPLA 3WDTA 4PLMA 1ND3C 1BYHA 2IC1A 1MEC3 1K5MC 2YPJA 1VBB1 2AENA 1D2QA 3M1HA 5T3NA 1EPWA 1R081 4WZCA 4XF9A 4MLOA 3WDVA 2MEV2 3VBHA 3RJRA 1WMFA 2O8QA 5BXXA 1WBLA 3RMXA 3IIAA 2ETEA 2JG9B 3D6EA 3OF1A 4URTA 1ASJ1 1AYN1 5K0UA 4LULA 5CFDA 1VBC1 1RVF1 1VBB3 4WM8B 4CEWC 3KCCA 1R083 2DCYA 1AYM1 2R6QA 2NZ9A 2HWF2 4RQPB 3IWZA 3TBDA 1W6MA 4XFCA 2UURA 4MGIE 5FOBB 2Q0AA 2D6KA 4K7JA 4D7TA 4N7IA 1XNKA 2YZ4A 1C28A 1ASJ3 3H7JA 1AYN3 1OPMA 1S0JA 1AVBA 3ZMOA 1VBC3 1RVF3 1RUE1 4XW3A 2G9GA 1V6KA 1KXGA 1ZBE2 3VBRB 3SH5A 3FLRA 3A4UA 4Q4V2 1AYM3 4E2SA 4J6GA 3TNQA 2Z5WA 4N53B 4XZPA 4O9EA 5GJ6A 3VKNA 4R9CA 4OZXA 2ZZQA 4LBQB 1A78A 2VXRA 2YHJA 1COV1 2PN5A 4JV4A 1RUE3 1ENQA 4XIOA 2TEPA 1RUNA 1BEV1 2R0HA 3I4IA 1YIPA 1UD1A 4LBJA 5JDBA 1DF0A 2BWCA 1DLLA 1A6CA 4XHBA 1MR5A 4XJ9A 3VKOA 4N53C 4B8EA 1COV3 1X8MA 1AR62 2VVFA 2SBAA 2IZWA 3CO2A 4N7UA 3WT3A 4Z2WA 1BEV3 4A2UA 1BQPA 2CGPA 4WV8A 3ZXAC 1QQP2 3NV2A 2R071 1LENA 2A7AA 3NKTA 3WLUA 2I2SA 2GZWA 4XFAA 1FT9A 1GLHA 3ZVXA 3E5UA 3M4FA 4LUMA 3FE5A 4XF0A 5J98B 4HKOA 2G4IA 1HLCA 1WW6A 4D3WA 1UPIA 4Y1UA 3ZYPA 3GBWA 4B29A 1HW5A 2PHFA 4AGGA 3L9JT 3ZFFC 5KXBA 2ATFA 1W6OA 3KQRA 1OMIA 4YRDA 5D8AC 4XMAA 1G6NA 1YIFA 3WG4A 1IS3A 2WS91 4FQZA 4JRLA 4N9IA 1LOBA 4P9JA 4FT8A 4ZU7A 4KWJA 3EBRA 4Z1VA 1A3KA 4EN0A 3GALA 2RS51 1SLAA 2WNVB 4IV1B 3VGIA 4S2DA 5T5JA 4XF3A 3UJOA 1QJU2 3OGGA 3VZLA 1FX5A 1MZ6A 3TN91 2WS93 4WVWA 1NQJA 2RJKA 3K48A 3E6BA 2NQYA 1PK6A 1J3RA 2UY8A 1DZTA 4OI1A 1CAVB 2OPKA 1XE7A 3MIDA 3S30A 1KS4A 4C0HA 1IPJA 5I8TA 1AR73 4M0HA 2R041 2ZBJA 1IOAA 1JHNA 5F6LB 4AVTA 1DQ1A 4AVVA 1I6XA 1AR81 1YFYA 2BW8A 3OY8B 1BVP1 3I8TA 3ZSKA 1F5FA 3USUB 3T1LA 1KITA 2VU9A 3N35A 5CVRA 4MXWA 2NPIA 3J8F3 5T52A 3U0ZA 1CR7A 4QPIA 1QOSA 4CZSA 5AVPA 2XJPA 1R091 2R043 4OI4A 3VDDB 4FAGA 3E6CC 4FPOB 4I09A 3VZMA 4IEOA 2PAKA 4IEQA 1MZFA 3CEWA 4FPFA 5L73A 1RHI3 5FAXA 4QHBA 4M3CF 4YYOA 5H9QA 1AXZA 3D8CA 3DKWA 1VBB2 3GNEA 1UIJA 1ZRDA 5JOWA 3MW3A 4Q29A 1R082 1R093 2VVDA 3ZSJA 3KCXA 2VNOA 1W6NB 3R4SA 1RUJ1 5SV5A 1BXHA 4RGGA 3ST7A 2ZHLA 4K6BA 1G9FA 5FLJA 1ASJ2 2IXJA 2JG9A 2PLV1 2BPA2 1AYN2 5E89A 4GALA 4IQPA 1TNRA 2E53A 1VBC2 2GSYA 4QQPA 1RVF2 1AUYA 5ABJB 5LK7B 4N43B 4WM8A 4WVVA 1AYM2 1YNAA 2H6CA 4E4SA 5L19A 4RQPA 2HYKA 4QQHA 5GALA 5KHIA 1GV9A 1RUJ3 3PJQA 3CJIC 2WQZC 2XVGA 1AX1A 5H9SA 4EV0A 3M3OA 4Q4X1 2GAUA 3WW3A 4KQ7A 1RUE2 1WW7A 3AXEA 1GZWB 3UJQA 3VBRA 4OHYA 5JCTA 1G8WA 5JLVA 3V0AB 4BIOA 4GKXA 4AVAA 5T54A 2E63A 1ULFA 1QH7A 1LOCA 2YGMA 3KGZA 3L2HA 4M00A 1MS3A 4Q27A 3NWKA 5DZEA 1COV2 4ZU4A 4Q4X3 1IQAA 3AKQA 4FPGA 3SXWA 4YZ5A 1PGW1 2DVFA 2X5IA 1BEV2 3S7EA 5FMOS 4P9IA 1PZ8A 3EO6A 4JGYC 4TYSA 2AR6A 1C8M1 3MIEA 3AZYA 4GULA 4AK3A 4K9SA 4AHYA 1WMEA 2DFBA 1LOFA 4XFGA 1S2KA 1WLCA 3JB8A 5KXEA 2QUOA 4YG3A 2JDZA 4K21A 2R072 1C8M3 1JYCA 2OZJA 4AF9A 4MH0E 4X6RB 1O5LA 5GLUA 1EY2A 1OOPB 4I0BA 2ZJCA 4AFCA 4HK9A 3IT8A 2HKXA 2XB6C 4NN0A 2C9AA 4EWEA 2RHPA 1XYPA 4ONUA 3LWCA 1RUI3 1QDCA 2YUEA 1D0HA 1VIWB 5AFBA 1NZCA 1CJDA 2ERFA 3AYDA 5C9AC 4BH9A 1V6LA 1N1SA 2XWBB 4ISQA 2WS92 3WUCA 5JPNB 4Z8BA 2VMIA 3UKTA 1S0BA 3ZYRA 2P34A 3JQWA 1ZZ8A 2B46X 1IGOA 2RS52 3JB4C 4A3XA 2GNDA 2WNVA 4IV1A 4FPJA 2ZS6B 3JQXA 2ZX0A 2XLAA 3IDBB 4MYEA 1Q8OA 3ZSMA 3TN92 4LBQD 2XJRA 1NXD1 5J48A 4GIQA 2VGDA 4IEWA 3H1MA 4AI1A 4YM0A 3RJ2X 1U5ZA 2DVDA 4I3GA 3EHKA 3WX5A 5JOXA 5HCFA 1ULDA 2YMZA 1RUOA 3ZYIB 4JGZA 1Y43B 3SCGA 1CAVA 3LB9A 5EYXA 1RUD2 1W6QB 5C4WB 3DN7A 1ZZ7A 4XHXA 2IXCA 2E7QA 2R042 1YI7A 1GANA 1J3PA 3WNXA 1DGRN 1AR82 1TE1B 2XKPA 3OY8A 5LEKA 3USUA 3B9IA 5JVVA 3ZXFA 1Y7BA 2ZMLA 2DV9A 2XLFA 5JI9A 1Q8VA 5EXOA 5L7OA 1R092 3PVEA 1UKGA 2EXIA 3RQ0A 3JBG1 3VDDA 1MQTC 3AMHA 1DG6A 4BOWA 3POWA 3LA3A 2NP0A 1SBDA 5BPXA 2PYTA 2XG3A 3LZZA 1DQ2A 1Z78A 4DS0A 1JUIA 1VBE1 2WKKA 2H0VA 3J4UH 3JBG3 1W6NA 3GYDA 1F31A 2WC2A 5FO8B 3C3VA 1S0DA 4FTEA 2PLV2 4E2QA 4D7SA 1S0IA 1SLIA 2A75A 5ABJA 4PBOA 1PGSA 4N43A 3VBHB 3VHRA 4XBQA 5ACA1 1NCRC 1VBE3 4ATFA 2ZTNA 2VW0A 2A6XA 3ZSEA 4CP1A 3ZFEC 2VECA 1TEIA 2O0OA 4JQRA 3WW1A 5K0UB 3VHNA 5CFDB 4R52A 5JOYA 4XF1A 4Q4X2 4XEZA 3OD0A 1G9CA 1WMDA 5DZGA 4KGQA 4YFWA 1GZWA 4GH4B 4EN7B 2R1DA 1LOEA 2PAMA 1V70A 3VKMA 4YG0A 3TB0A 3KMHA 4OI0A 4JDMA 3VBHC 2XLGA 5HCAA 4CDQB 2CNAA 3B9CA 1ZVFA 4QM9A 2EVXA 1GNZA 4KG0A 1PGW2 5K0UC 2D6OX 5CFDC 1AZDA 3WW2A 1LULA 1I9RA 3WHUA 4L99A 4J1WA 2QZ2A 1C8M2 1QMJA 1AF9A 1PIV1 3KM5A 4C1WA 2GNMA 2VY0A 2KXLA 3FUOA 2UWBA 5DXDA 3SCHA 3PVNA 3AYAA 4XIKA 1LU2A 2NMOA 3NV3A 2UYAA 3AKSA 3IMNA 3M3QA 4U36A 1SLLA 5CIRA 4AEKA 5LK5A 1H9PA 2WSUA 2JJ6A 1CN1A 3R4UA 4AHZA 1GFF2 1PIV3 1OD5A 3PVBB 4PIXA 2WQ4A 5DG1A 2D3RA 1OOPA 4FVVA 2R061 4Q4W1 3EXUA 3ZIWA 2WA4A 1J1TA 4H3WA 5JSOA 3ZN5A 1A8MA 5HXVA 3LCPA 3VL8A 4DB5A 2DU1A 1RL3A 1CVNA 1OQDA 5BNOB 1BK1A 3AP7A 1R1A2 2R063 4Q4W3 4YW5A 1H30A 2E6VA 2R32A 3HN1A 4FXGB 4F83A 2BVBA 1EV11 1QKQA 2ZGUA 1Y9QA 1FI2A 1Q5OA 2YXSA 4JTNA 5GZGA 1C1LA 4XFIA 3KSCA 2IXKA 4E4DX 4XFFA 2XBO1 1NA1B 2OUJA 2R1BA 4DINB 1SLCA 1X8EA 3AFGA 5DUWA 1NCQB 1Q8SA 2RJLA 2XJUA 3POSA 4RR3B 5CG9A 1EV13 1KDKA 3H0OA 1J3QA 2RS11 4GA9A 4AGVA 1LGBA 2PHTA 1IZ3A 4CP0A