2HWF1

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
283
structure length
283
Chain Sequence
NYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSIPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKLSVVITTHIYHKAKHTKAWCPRPPRAVPYTHSHVTNYMPETGDVTTAIVRRNTITTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
molecule tags Virus
total genus 36
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwf100
1R093 2RS53 3ZFEA 4YVWA 5CFDA 5ACA3 1PO13 4CDUC 2HWF1 1H8TC 2IZWA 5ABJB 4CDXA 1Z7S1 2HWE2 1M06G 1RUG3 4Q4V1 1FPN3 1AL21 5CFCA 2RS11 1VBE1 4IV1B 1QJX1 4N43C 5BNOB 1QQP1 1QJZA 1B35A 1NCQC 3JB8A 1HRI3 1VBC3 1RUC2 3S6PA 1CD3G 1RVF3 1RUJ1 1AYM3 5DDJ1 4N53A 4RR3A 4RHV3 1VAKA 1RUD1 3JD71 1PIV2 1AR81 5LK7B 1VBA2 1PVC2 4GH4A 1RUE2 1SMVA 1R091 1OPOA 1HXS3 1MEC3 4CEWB 1EV13 2ZAHA 1RUF3 4RS5C 5JZGB 3VBSB 5ABJC 4PDWB 2HWD3 1QJU3 4GB32 1RHI2 2XBO2 1NA1C 1E57A 1OOPB 1RUH1 1BEV2 5BNOC 4YVSB 4CEYC 1FMD1 1K5MA 1AL0G 5C8CB 3VBHA 4FTSA 1VB2A 1HRI1 1RVF1 2WZR2 1AYM1 3VDDB 1MQTC 5BNNC 1NY71 4QPGB 4RHV1 3DPRC 3VBOB 5D8AA 3ZFEC 2BUKA 3IDEA 5C4WA 4YVWC 5K0UB 5CFDC 1ND2B 5A32B 4CDQA 1VBB3 1RMU2 3VBFA 1HQNA 1HXS1 5A33A 5JZGC 1EV11 3VBSC 4CDWA 5CFCC 1PIV3 1AR61 1EAH2 1C8M2 2HWD1 1QJU1 1VBA3 1PVC3 1OOPC 3JB4C 1V9U2 1RUE3 4RFT0 3VBUA 5FOJB 4LLFA 2R062 4CDUB 1AR92 4AEDB 1ZBE1 4GB33 2XBO3 4N53C 4JGZA 2DF7A 4N43B 2RR11 1PGW1 1BEV3 2HWC2 1NCQB 1NCRB 5J98B 3JBG1 1GFF2 3VDDC 3ZFGC 4BCUA 1PGL2 3J8F1 5K0UC 1ND2C 2WZR3 2PLV2 1A6CA 2XPJA 1VBB1 2R072 1BBT2 4QPIA 1AR72 4Y5Z0 1IHMA 4WM8C 1PIV1 1QJY1 1VBA1 1PVC1 4RS5B 1RUE1 1F2NA 1TME2 3VBHC 4AEDC 1NA1B 3CJIC 2RMU1 4GB31 1R1A2 2R063 2WFF2 4CEYB 2R042 1AR93 5FMOL 5D8AC 1NCRC 3TN92 4Q4Y1 3VBRA 1BEV1 4Z92B 1R082 4WM7A 1AYN1 2WS92 1MQTB 5BNNB 2MEV2 4CEWA 1HRV2 2HWC3 2WZR1 2FZ2A 3DPRB 4PDWA 3ZFEB 2HWB2 4YVWB 5CFDB 2RS51 2WWSA 3ZFFC 1ASJ2 4YVSA 5ACA1 1PO11 1BBT3 1D4M2 5CFCB 5C8CA 1PO22 1AR73 1TMF2 1RUG1 1FOD2 1FPN1 4FSJA 4JGYA 4QPGA 1TME3 2R061 3VBOA 2HWE3 2HWF2 4N53B 4RR3B 2BPA2 1VB4A 1VBC1 1Z7S2 5A32A 5BNPA 1NOVA 1R1A3 4IV3A 4RQPC 1AL22 1AUYA 2WFF3 3M8LA 4QPIC 1VBE2 3ZFGB 1QJX2 3NAPA 2X5IC 1R083 1RUC3 2WS93 2MEV3 3HAGA 1H8TA 1HRV3 4CDXC 1MEC1 1X36A 5L7OA 5FMOS 1RUF1 2HWB3 1RUD2 4WM8B 4N43A 1AR82 1B35C 4Q4X2 4FTBA 1ASJ3 1NCQA 3VBHB 3VBRC 1D4M3 1PO23 3CJIB 1RHI3 1ZBA2 4RR3C 1TMF3 2HWE1 1POV3 5C9AA 3FBMA 4NWWA 2GH8A 1RUH2 1BMV2 5D8AB 1ND3A 1VRH2 1W39A 1X33A 2HWF3 4GH4C 1FMD2 1RUC1 1AL23 5A33B 4Y4YA 4RS5A 4CDWB 1VBE3 4EJRA 5ABJA 1QJX3 1RVF2 2MEV1 1HRV1 1NA1A 1RUI2 2BFUL 1NY72 1VBD2 2BBVA 5GKAC 4IV1A 2RS32 3ZFFB 5BNOA 2VQ0A 1RMU3 2GSYA 1K5MC 1ASJ1 1EAH3 1RUD3 1C8M3 1PO21 4NWVA 1RHI1 1V9U3 2XBO1 1AR62 1AR83 1MQTA 5BNNA 4Q4X3 1POV1 3DPRA 1WCDJ 5C4WC 2RM22 4CDQC 1ZBA3 1ZBE2 1POV0 3VBFC 4RQPB 4QPIB 1RUH3 5AC92 5L7OC 5JZGA 2RR12 2X5IB 4CDWC 3VBSA 1VRH3 1PGW2 3JBG2 2WLPA 3VBUC 1OOPA 1FMD3 3J8F2 2PLV3 4CDXB 1F8VA 1DDLA 2R073 1HX6A 1RMU1 1RUI3 1VBB2 4JGZC 1VBD3 1COV2 4Q4W2 5C9AC 1EAH1 1B35B 2RS33 1C8M1 1ND3C 3VBRB 3VDDA 1V9U1 4WM7B 3ZFGA 4Q4X1 1QJY2 1AR91 5K0UA 1ND2A 2BFUS 4Q4V2 1ZBA1 1AR63 2RMU2 2R043 2RS12 2FZ1A 3TN93 1BMV1 2HWC1 3LOBA 2RM23 1QQP2 4GH4B 4IV1C 4WM8A 1VRH1 4Q4Y2 1ZBE3 1PGL1 4CDUA 1AYN2 1RUJ2 5AC93 5DDJ2 4GMP3 4AEDA 2RR13 2PLV1 3CJIA 2R071 3JBG3 3JD72 1BBT1 4JGYB 1RUI1 1AR71 1VBD1 2Y26A 3J8F3 1K5MB 1NCRA 2RS31 1R092 4WM7C 2RS52 5J96B 1RB8G 5BNPB 1TME1 5ACA2 1COV3 4IV3B 4Q4W3 1PO12 1C8NA 2ZZQA 2QQPA 4CEWC 1FOD3 3NAPB 1RUG2 4PDWC 1R1A1 5C4WB 1FPN2 1NG0A 2WFF1 1QJY3 2R041 4CDQB 3TN91 3VBFB 2RM21 1H8TB 1R081 1Z7S3 3ZFFA 4Q4V3 4YVSC 1HRI2 1VBC2 2RMU3 5L7OB 2RS13 3ZXAC 5C8CC 4FTEA 1CJDA 2TBVA 2WS91 2ZTNA 5AC91 1AYM2 4GMP1 1OHFA 1QQP3 3VBUB 4RHV2 4Q4Y3 4JGYC 2HWB1 4QPGC 1AYN3 4CEYA 1RUJ3 4GMP0 5DDJ3 3VBOC 4JGZB 4SBVA 5C9AB 5BNPC 3JD73 1D4M1 1HXS2 1MEC2 4IV3C 1EV12 1ND3B 1RUF2 4RQPA 1COV1 4Q4W1 1TMF1 2HWD2 1QJU2 3NAPC 1FOD1 2X5IA
chains in the Genus database with same CATH superfamily
4F3JA 2LUWA 4LKEA 5FP4A 4XFCA 4AHYA 2ID4A 4E2SA 2HKXA 4IE7A 5SV8A 5ACA3 2QQLA 3CJXA 5JWPA 3MV11 2IZWA 4YG6A 3RMYA 5F3EA 1YUDA 3POSA 3WZ1A 1W9TA 1Z7S1 2HWE2 2X8KA 2VD7A 4Q1PA 5FZFA 1RUG3 2GC1A 2VZSA 4AI0A 4M00A 2IVJA 5EJZB 3ZX7A 3OY8B 2VAUA 1VBE1 3CLPA 4HVQA 3R6SA 4MGYE 4E8CA 4OQ8A 5FO8B 4PI2A 3FLPA 2NQYA 4LITA 1K42A 3D0JA 2BVVA 3B3QE 2XL7A 1B35A 4ORFA 4E8DA 1HLCA 4YRDA 1HRI3 1VBC3 2D5HA 3B9CA 4FPGA 1RUC2 5EHDA 2XUMA 4NIGA 2VMIA 1UXXX 4ZU5A 4HT1T 5BY5A 1UU6A 5CEHA 5DDJ1 1A78A 2C26A 4RHV3 1TNFA 3H3UA 4J25A 5DAWA 3VL9A 1VAKA 3N3HA 4OULA 4HVOA 4AFDA 1PX4A 3C8XA 2SBAA 1QF3A 4OI0A 3IB3A 4GWMA 2NP0A 4D7SA 4FFFA 3DL3A 1SBFA 2XJUA 1R64A 1H6YA 1UY3A 2ZAAA 1FV2A 1UZYA 1QHDA 3WDYA 1W6NB 1HN1A 2QUOA 2ZAHA 3LZZA 4IE5A 4XIKA 3B00A 1LHNA 1HDKA 5L9RA 5ABJC 2RDNA 3J7NA 4LK6A 3ITQA 2ZGSA 4XQ4A 5LA2A 2Q1MA 1UU4A 1NA1C 5M0TA 5DN2A 4BLJA 2GAUA 5IUQA 2H6CA 5T5OA 4DFSA 4P9YA 2QQWA 4EQVA 2VULA 3WR0A 1DQ4A 1I6XA 2VOKA 4HKLA 3VZKA 3GJAA 3BCWA 3WUDA 5JI9A 1BEV2 1UKRA 3POFA 4N7UA 1OBNA 3E1F1 4FPOB 4D7YA 4I3PA 4HANA 4UW5A 1AL0G 1QXJA 2CL2A 4FTSA 4A45A 3ILFA 4QKBA 3ZN6A 1HRI1 2YDEA 2P3KA 3SHRA 1SPPA 2VQUA 4LBKA 4XJAA 5FZ7A 2QKDA 4JTOA 1W8FA 4FFHA 5FFOC 4PBPA 5KXEA 4NAMA 4RHV1 2P6HA 5JPNB 1NAEA 3J7HA 3POIA 1LOBA 2OS2A 5C4WA 4XE9A 4AL9A 3ZSMA 2XQRA 1ND2B 4XURA 1OD3A 1VBB3 3MLLA 4Y1XA 5A80A 1FNYA 2C9AA 2WNEA 4A3ZA 3RZJA 2YY1A 2WWJA 2WZ8A 3OUHA 1VRBA 2F17A 4IESA 2W9XA 3NMBA 4L11A 4QXHA 4OI2A 4YW4A 2VH9A 5JXJA 5JZGC 2VBDA 1LU2A 3V64A 1AR61 1NLQA 3O1SA 1C8M2 3ORJA 5FPAA 1RUE3 3M7AA 5FOJB 3MLJA 4E4ZA 3THPA 2BOJA 4HKOA 5FZ4A 3D0SA 4ES8A 1CZVA 1DCSA 5FZ9A 3I4IA 4G9SB 3ON7A 4Z2AA 1BQPA 4XUQA 4XAEA 4N53C 2BU9A 3MIGA 3OPWA 2B9VA 5LW9A 4O7XA 1GOGA 1PZ8A 1US3A 2BQPA 1GU3A 1GWMA 2QVSB 1W06A 2A6XA 4Y22B 2JICA 5J98B 1YFYA 1GFF2 4IERA 4LR4A 3VDDC 2QQUA 1SBDA 2VCAA 3I59A 3WW4A 4AFBA 4A44A 4BCUA 1TG7A 2VVEA 4LBQB 5ERLA 4RGAA 2XWBB 4HPKA 3HNBM 3AX4A 4C90A 5K0UC 1NYWA 5FKBA 5F6LB 3ACGA 3PVEA 1D7PM 2PLV2 4EWDA 2XPJA 2OPWA 2CDOA 2OUJA 1VBB1 3CZJA 5GZCA 1BBT2 1NXMA 3MIEA 3H42B 2C4XA 4KGGA 1Q43A 4CPBD 4YM3A 1LOFA 3KSCA 4GZ9A 1V6LA 3H1YA 4XTMA 5EYXA 4K20A 5LBEA 2CWMA 1GNYA 1V6MA 1RUE1 3TBDA 1O3SA 2KXLA 1SCSA 4A42A 1GP6A 3PIJA 4AEDC 1OF4A 1NA1B 2BV4A 3PU3A 4JKKA 2YUEA 3N35A 5F8PA 2J1UA 4IXLA 5FY0A 4ZY9A 2X05A 3USSA 3IPVA 2J22A 1WWYA 3WW1A 1LOAA 1JS9A 4YW7A 1AHSA 5FMBA 4G3YC 2JDKA 2JG8A 1WA4A 3IAPA 3WF0A 3EMRA 3BTYA 1IZ3A 2R6QA 2VOVA 4NROA 2ET1A 3VHNA 2VVDA 5F32A 1P8JA 5FYCA 3W59A 4Q0SA 1ODNA 1E5HA 4Z82A 3OUJA 1XQNA 2HWC3 1VPHA 5B4NA 3O1PA 5CKMA 2QE3A 1OQDA 2QZ2A 4WVZA 5HXMA 1N3QA 1OUXA 2Y6LA 4DO0A 2D6MA 2UWBA 4JTNA 3ZDVA 3AP7A 1UZ0A 3ZIXA 1MZEA 2P5BA 2RJKA 3UGGA 2VNRA 1RGSA 3U07A 5C8CA 4BM8A 3NKGA 4LBJA 1AR73 2OW4A 4FI9A 2JD4A 1J58A 2ZGMA 2E63A 2XLAA 3KV9A 1FOD2 1PX3A 3NV3A 4Q29A 5FMCA 2CV6A 1NZIA 1ZYBA 4XVHA 3ETQA 3ME2A 1HB2A 1CESA 2WO1A 4J1XA 4N90A 1TME3 3MUZ1 2PA7A 1UY0A 1GZ9A 4B8EA 2JECA 4JAAA 3T3YA 2HWE3 3K4DA 4C8DA 3MPBA 5HV0A 4N53B 2ZHNA 1LGBA 5LBCA 3SEEA 2ZX1A 3LDBA 4JCKA 1S0JA 1XNAA 2FDHA 3MF9A 4BIOA 3SH5A 4CVUA 1AL22 1AUYA 1DLLA 5H9RA 2VZRA 1LHVA 3I2GA 3NJVA 4QPIC 4R9CA 4FCAA 2V4AA 1QJX2 1JZ6A 1H1MA 1CPNA 3NAPA 4P00B 4R4XA 2A5ZA 1OKOA 1GQGA 4XFAA 4PF5A 3SKJE 1JZ8A 2PTMA 1RUC3 2ZMLA 3FE5A 2EAAA 4AI9A 3WNOA 3VZLA 3LDRA 1EPZA 1YHFA 2ZJCA 5IVYA 1DP0A 3IMMA 3OEBA 3CO2A 4W8JA 4COWA 1F5FA 1IOAA 4CDXC 1MEC1 1X36A 2X09A 5FMOS 4JC1A 4CP9B 1RUD2 4CUAA 3N9MA 2A1XA 1OI6A 1HQWA 4L9BA 4CA9A 1B35C 4LHKA 4RSUA 1NCQA 3M3QA 1KFUL 1SFNA 4B3NA 4GA9A 3NO8A 1PO23 4X6QB 1GQPA 4UYBA 2DVDA 4LT5A 4XC9A 1ZBA2 5HI0A 2GN3A 2WNOA 2DCJA 2A70A 2Y6FA 4LIUA 2HWE1 1TE1B 3AVSA 1POV3 4Q2FA 3AP5A 4NWWA 2VL4A 4XQDA 2ORZA 3MIDA 3VHRA 4MVTA 1DQ6A 1YC61 4DZGA 2OKXA 1E5IA 3SH4A 1X33A 3ZXJA 4N7IA 5A1AA 4WZCA 1JYWA 5HCHA 4AVAA 1ZRFA 4QQ2A 4W65A 2O14A 3NJYA 1RUC1 4NJ4A 1U0AA 1V00A 2PHLA 3K77A 3BVCA 4EN6B 5LRSA 3BU0A 5A33B 2W87A 3U4SA 1URXA 1T6GC 4RS5A 3ZSKA 3OG2A 1ENXA 3SCHA 2GN7A 5KWRA 2KD7A 1H6XA 4A6SA 1L7RA 2D7FA 3GJBA 1KJRA 2W68A 4LOSA 4Q0PA 4Y33A 1DF0A 5FMDA 2CWSA 4OHYA 1EUTA 4GWIA 2VO5A 1ZZBA 1QNWA 2EICA 4XUNA 5FZOB 2GSYA 3SC7X 3ZYPA 2I74A 1YI7A 4JKMA 2VMDA 3AK0A 2RG4A 2IWGB 1UL9A 2OZ6A 3V65A 5A7QA 4ZKTB 3MZHA 2WABA 5DAQA 1C8M3 1PO21 1F35A 1ODMA 2N7GA 2GNBA 3WF3A 5CKNA 1AR83 1MQTA 1Q8VA 5BNNA 4TYSA 1POV1 3LSEA 5A1FA 1FNZA 1XYPA 2Y0IA 3P1IA 1WGPA 2WBKA 2ZMKA 1WCDJ 5C4WC 2XMLA 5EPAA 5KXDA 3TAYA 5A6YA 2XJQA 1HJGA 1JW6A 2Y0OA 4E9KA 3SH3A 3WP4A 5GLVA 1AXYA 4QPIB 3OTFA 4DS0A 1W6NA 5I91A 2OZJA 4X8PA 2DCKA 1BCXA 2WWUA 5A7SA 2VZ1A 4UFKA 4DY3A 1G86A 1F4AA 1PGW2 2WUHA 4UAPA 3ZM8A 3R0RA 2DBIA 2WLPA 2OIIA 1VJ2A 2W46A 3CKHA 1J83A 1LGNA 4ZXKA 2PFWA 1RJ7A 5A6XA 4C0HA 1MZ5A 1W04A 1Y9GA 5FK7A 2ZA9A 3RJ2X 3ZDSA 1XBFA 2PLV3 1G9DA 4CDXB 3VL8A 5IVFA 3W58A 5EFUA 3D6EA 3VV1A 1WLWA 4O9GA 2JIGA 5FUPA 3RYKA 3RZHA 1ZVFA 3HPNA 4W6XA 3O1TA 1OSGA 2OQ6A 1VBD3 1LB2A 1JYXA 2W52A 3BUCA 1UW8A 2V5YA 3GBGA 2GNMA 1B35B 2RS33 3K46A 4IEWA 1C8M1 1C4RA 5BUVA 1Z0HA 1OQ1A 2W5FA 5L73A 1UCXA 4CPBA 4R52A 4QX1A 4YFZA 3KT7A 3APBA 4DMIA 1JI6A 2LW8A 4UFIA 1ND2A 2BFUS 2JWPA 5FUIA 3PU8A 1YI9A 2ZGNA 1YO8A 3BODA 1EY2A 3PVBB 4XFGA 1XPWA 2WYSA 1WBLA 3TNQA 5ISLA 2ZBJA 3FMGA 4CU6A 1LOFC 4CCDA 1BMV1 3MO4A 2D6LX 5I0TA 3C7FA 3I2OA 4WM8A 3RWNA 4AGGA 3O1VA 1SDDB 2W1SA 2FDIA 4JDMA 3PVNA 1J1LA 4COZA 1XJAA 1H4GA 3OCPA 2UYAA 3TNPB 3PUHA 1T2XA 4X6RB 4GMP3 5DDJ2 4GAZA 5HCAA 3PTRB 2PLV1 5KXCA 1UXZA 5A1LA 3KM5A 3JU9A 4DIQA 1BBT1 3KT4A 2HH9A 2P37A 1VBD1 2Y26A 1CX4A 3J8F3 3E6BA 2JG8C 1C5HA 4Y22A 4FPJA 4YW6A 2NM1A 2RS31 3CMGA 1YFXA 1ULFA 1XNTA 3ZN6B 1JU4A 1SPPB 1D0GA 3A4UA 3AJZA 3I3QA 4RFRB 4NHXA 1COV3 5ACA2 2QQPA 1C8NA 2DCYA 1POQA 1W2NA 4O61A 1NX9A 1FOD3 5IHRA 2YPDA 4HZFA 3IIAA 2CGPA 1UOFA 1RUG2 5FYHA 2XJTA 2TNFA 1JYNA 2DFBA 5C4WB 1NG0A 5LCWL 1QJY3 4RYDA 2DVAA 2OPKA 2K9ZA 2J7MA 3O1RA 3S30A 4E4HA 5DABA 2WQ4A 5T5LA 1H8TB 2DVGA 5A3OA 5BPXA 4Q4V3 2C5DA 4QWNA 1HRI2 1VBC2 1QGLA 2IFWA 5FBJA 5C8CC 1CJDA 4OUMA 2TBVA 4AQTA 3POGA 3R4UA 4OQ9A 4GMP1 1OHFA 2JDAA 4XTPA 2XR4A 2ZGQA 2JKXA 1JUIA 4RHV2 1PK6B 4Q4Y3 5FZCA 3ZXKA 4CZSA 4HL0A 3QBQA 2GNTA 5IAVA 4XUOA 1VP6A 5FJKA 3VKLA 1AYN3 2BOIA 2A7AA 3THCA 3NJZA 3I3BA 1JUHA 4ATEA 2CNAA 4YW1A 1ULGA 2EXKA 1ZRCA 3V0BB 2BWCA 2PQSA 3AMMA 3JD73 5FYSA 2FCVA 5A7PA 4XAAA 2YBKA 4GALA 4KWUA 2G9ZA 3UETA 3DEMA 4RQPA 1COV1 3KVBA 4HK9A 5FZ1A 3I59B 4CXYA 1HJFA 3LD8A 3N7JA 3NAPC 5KBFA 3SITA 1FOD1 4M0HA 3VD4A 1FT9A 3H3LA 1JZ7A 4PQ9A 2RS53 2ZS6B 3I8TA 4LTAA 5FYTA 1PO13 2QFEA 2VC9A 3JQWA 4ET7A 2RVAA 4B4PA 3SKVA 3LF7A 1SDWA 5FXVA 2GC0A 2WAOA 4R4ZA 3HQRA 3FFQA 1HQLA 2A73B 4Q4V1 4QX3A 3MBWA 2GP5A 1M06G 3N7MA 1AL21 4OZXA 1A3KA 3ZPYA 4BYYA 3LSDA 1QJX1 1DGLA 2W94A 4BISA 5L9VA 5BNOB 2I07B 1QDCA 1X82A 1S2EA 4NVPA 2C0ZA 3LQCA 3KCXA 2VMEA 2OYZA 3WQ0A 1NCQC 4QX8A 3QH6A 3G7DA 2VQAA 4QKFA 5HCFA 3VZNA 5KHGA 2Q1FA 1S0BA 1OF3A 2KM2A 4XXPA 1UF2C 1AYM3 5FAXA 4N53A 1G7YA 1KXGA 5CB7A 3S57A 3CL1A 4LKDA 4WV8A 1DZRA 2YXSA 5FZLA 1OURA 1RUD1 3JD71 2JG8B 3PUSA 4MGTA 2IXHA 4QU1A 5GZDA 1EUUA 4ZS3A 3RYRA 1QEXA 2EIDA 4D6QA 1XNKA 2DURA 3M3OA 5IT6A 3MDPA 2V4VA 4B7EA 2G4IA 4IEQA 1UN1A 1RUE2 1W0PA 3LA7A 3ZXDA 1SMVA 2Z42A 4O9EA 4F83A 4JZRA 4N9IA 3ES4A 1KRIA 4HFSA 4Y5TA 2G9FA 1IQAA 4LJHA 2IXIA 4RS5C 2WKKA 2E7QA 3BOWA 3IT8A 4IEZA 3IM0A 3P5BA 1NKGA 1QJU3 1KITA 1OUSA 4CDXA 3VUOA 3KF3A 4YGBA 1E57A 5CA6A 3GCXA 1OOPB 3WV6A 2OX0A 4META 1IPKA 5LEKA 1V6IA 3NNJA 3UGFA 4CP9A 1DGWX 3UKVA 3VD7A 5L9BA 5CKQA 3INAA 5C7GA 3ECQA 1DLCA 2VZ3A 3MYXA 5DUVA 1K5MA 4N9HA 5C8CB 3R4DB 3TB0A 3AMHA 1VB2A 3LPFA 3NRUA 4MYEA 5JAXA 3N9QA 1C5IA 1JODA 3OOXA 5EIYB 4W6WA 3QOPA 2JE7A 1XNCA 1AYM1 5JIAA 1MQTC 5BNNC 2H0VA 2KR2A 1YQCA 4OLLA 2D98A 2E32A 1Y3TA 4QHOA 2W1UA 3ZFEC 2BBAA 5FPVA 3C3VA 5BXXA 4NUBA 3RGBA 3WUCA 2ZACA 5CFDC 3POWA 3TRSB 5E8AA 4BQ1A 1CR7A 1RMU2 2IFRA 2YFZA 3VBFA 4ASKA 1HQNA 1GNZA 5FQ0B 2ARXA 1JN2P 5A33A 1W8WA 3I3DA 1SLIA 1PIV3 2G9GA 1PMIA 4OUEA 3PUIA 3V56A 4LBLA 3KCYA 3TWIA 4LHSA 1QJU1 3AZZA 3JB4C 3T0DA 2EALA 3N4MA 1V6OA 3AKPA 3KHCA 1JOPA 2DWRA 1DGWA 4LLOA 3HNMA 4BQYA 2XKOA 4BXFA 5EXOA 5SV5A 4ISQA 4QKNA 4FOQA 4GB33 2XBO3 5C3QA 3U4XA 4NRPA 3T1MA 3VHPA 1JOBA 2HYXA 3AYAA 4JGZA 3ZYBA 4BIFA 1JYIA 3WG2A 3J26N 4PLMA 1PGW1 1W90A 2HWC2 1FX5A 1NCQB 3J7LA 1NCRB 4RGKA 2QZ3A 1GV9A 5J36A 2AREA 4WVMA 1O3TA 4A7KA 4C91A 1ND2C 5F5AA 5JMOA 2WZR3 4QDRA 3KS7A 2R072 3WXPA 2VQTA 4ZU4A 4QPIA 1TNRA 4XHXA 4QB1A 2EVXA 2DU1A 4TXWA 3O1OA 1AR72 4CU8A 5LRRA 4BQ4A 4Y5Z0 1IHMA 5FY8A 5T52A 4AG4A 1WLTA 4IEVA 4AE2A 4WM8C 4AW7A 1PIV1 2VNGA 2WINB 3AP4A 4BMEA 2D6PA 5FYZA 4LKSA 1REFA 5FYUA 4RS5B 4AVSA 4LNVA 1WMEA 1TME2 3S7IA 3VBHC 3PNAA 3NSTA 3WVJA 1G9CA 4YW5A 1G6NA 4KU8A 3BPZA 1W99A 2VNVA 3MLKA 2GH2A 4GB31 4URAA 1JOJA 2A6ZA 4IL7A 1EP0A 2YBSA 2QDRA 4Q0UA 2R063 2NMNA 3J4UH 4ASMB 2R042 5D8AC 3OBZA 2Y33A 5F2SA 4TWTA 2C24A 1LJ7A 5JR2A 1OA2A 3ATGA 4DUWA 4LXLA 4OHZA 3ZOIA 1DHKB 3L9JT 3N9LA 3POEA 5C3OA 1QOTA 3GGLA 3AMNA 3LE0A 1MQTB 5BNNB 3N9PA 2JB4A 4CEWA 2G1MA 2CSGA 4P02B 2WZR1 1X8MA 1XXNA 2VTXJ 2VZUA 2QQIA 3ZFEB 2JDMA 3AL6A 5CFDB 1UU5A 2XWJB 4K8RB 1OA4A 1W8NA 1WMXA 2DDUA 3N7KA 2ARCA 2LTNA 4HSLA 4CXWA 2YZ4A 2WWSA 4AFMA 4NPRA 2DU0A 4XIOA 3K3OA 4YVSA 3RMXA 2Y60A 5ACA1 1H2KA 4M3CF 3T09A 1RITA 1PO22 5FZEA 3RRDA 3SISA 1AX1A 1CAWA 2OUHA 1OH4A 5J3UA 1DQ0A 4URTA 4YW3A 1RUG1 3M70A 5C70A 3FL7A 3P3NA 4A7ZA 5IVVA 2DFCA 4LK7A 1B09A 3MW2A 2R49A 3OF1A 2GMEA 4QPGA 4GWNA 2R061 2JE9A 2LM3A 2XVLA 5A7OA 2Q8OA 2FBEA 4A41A 3VBOA 1Q8OA 3BU7A 4QXKA 4RR3B 1X7NA 1CAVB 1TQ5A 1PVXA 1VB4A 1VBC1 3OGJA 4MLOA 1F9KA 2WA4A 2ADEA 1IS4A 3LEGA 2XDVA 1R1A3 2YC4A 4RQPC 4ARXA 2WFF3 2V09A 5FZHA 3UKNA 3UT0A 1Q8PA 3GZEA 1Y9QA 4JHZA 4YWAA 5J09A 2E53A 1VAMA 1QWRA 1R083 3UV9A 1NQJA 4QPYA 2JDZA 3JZVA 1W3XA 4ATFA 5JVVA 4WBBA 2A6YA 5FPUA 4MV2A 2W39A 2WN3A 4HSJA 3N7LA 2WS93 2EIGA 2EXIA 3IDBB 2MEV3 2JDNA 1H8TA 5DG1A 5FYVA 4Z2WA 4NRMA 3LB9A 3FHQA 1E5RA 4QM9A 3KLSA 3AMPA 4A4AA 3WP6A 4I0BA 4K9SA 1VMFA 4MG2A 2ZKLA 4BA6A 4BPZA 4WM8B 4NIHA 3BALA 5FZ8A 4N43A 1AR82 3ZR5A 2VW1A 1JXNA 4X8NA 2WT1A 1PK6A 3B93A 4S2DA 1OVSA 1MZ6A 3VBHB 4FT8A 2HJIA 2A6VA 4BB3A 1D4M3 3W21A 1N47A 3ELNA 3UKTA 4ZONA 1Q56A 2WO7A 2E7AA 5I0RA 4BU2A 1I5PA 4OZOA 3ASIA 4ARYA 5JSOA 5DAXA 3KMHA 4JQTA 2AEYA 3V0BA 4R8HA 4XACA 2GH8A 1BMV2 2DYCA 3WX5A 5D8AB 4DPNA 3HQXA 4XZUG 4QQHA 1UPSA 5GLWA 4S2FA 1W39A 3GXUA 3I2IA 2IXCA 2HWF3 3ILRA 1UYXA 2NPIA 2VZVA 2XB6C 3POYA 4I01A 5FZBA 3LA2A 3WNXA 3D3AA 4H14A 3ZR6A 2QDNA 1ONAA 1DIWA 3FBYA 5C71A 1AXKA 2MEV1 3MFCA 4NRQA 3ZXGA 3KVAA 1S0CA 1ST8A 5FRAA 1VBD2 1C28A 1HN0A 4OYUA 2JIJA 2GC2A 3LEKA 3ZPOA 3MI8A 4P5HA 5A3LA 2RS32 2AGSA 2BVBA 4BOWA 5BNOA 2VQ0A 1RMU3 3GCWA 1PNGA 1UAIA 3O14A 3O1UA 3H9AA 1K5MC 5FZ3A 3VGIA 1S0GA 2OT7A 1BVP1 3AKTA 3KD4A 3MV01 1JYVA 3ZN4A 3OGGA 4CTEA 3Q8FA 4HONA 5JXGA 4I0WB 1UZWA 4IGPA 4Q8LA 2PAEA 3RYPA 4QHZA 1DGRA 4OHWA 2F6BA 3AM2A 5JPMB 3IBMA 3TEZA 2Y6GA 4MGSA 2O1QA 1W8TA 3DPRA 3R4SA 3W20A 4CXXA 3F2ZA 1XE7A 4Q0QA 4QX5A 4AWDA 5KC5A 1CJPA 1HW5A 2UYBA 3OYWB 1POV0 1ZM1A 2HBTA 2ZGRA 3VBFC 4RQPB 1AJKA 2VOWA 1YIFA 3HOBA 4Y3OA 1RUH3 4A3XA 4EE2A 2WA3A 4P9JA 2HBUA 3RZZA 4EWEA 4TN7A 4Q0VA 2P34A 4UBGA 4BQ5A 4V2WA 3T2OA 1O5LA 1OOPA 1LHWA 2JX9A 3U37A 1FMD3 4YZ1A 4PQQA 4GIQA 3J8F2 4QB2A 5DZFA 2AR6A 3I3MA 2R073 2W0XA 4DXTA 2J1AA 1NQDA 3FUOA 1RMU1 1I9RA 2BYVE 3WNNA 3K48A 3MW4A 1K45A 3H0OA 4IETA 1XYOA 4JGZC 1COV2 2YGLA 5C9AC 4XDQA 2W1WA 4RA0A 4AI1A 1UQXA 1WCUA 1JHJA 2XL9A 4A7YA 3WNLA 2XQXA 4D8MA 4WM7B 1UYZA 3ZFGA 3IKWA 1QJY2 3H8RA 4Z8BA 4ITCA 1KS4A 2K46A 2VECA 1NLSA 1WW5A 2XH6A 2R7EB 1ZZ8A 2ZGPA 1GZWA 1C1LA 1QNYA 4KMQA 4Q4V2 1OA3A 3K3NA 3WNPA 1KDMA 5FQ0A 5EV7A 1GBGA 2R043 5FK8A 1DGRN 1WCKA 4PCRA 5FZDA 5C3RA 3RFRA 5J1XA 3BN6A 3L2HA 2HWC1 5FLJA 3TEWA 1SLCA 2OVUA 4TLFA 4RN5A 4Q4Y2 1ZBE3 4Y1YA 3WDVA 4XQWA 3LCPA 2ORXA 4YG0A 2ZEZA 4H3WA 4Y1VA 4L97A 1AYN2 3VZJA 2O0OA 2DUOA 3LFMA 2RR13 2VZQA 2JD9A 4K21A 3SLIA 3NL1A 1ENQA 5FZ0A 4M3CE 2PHFA 2R071 3PUAA 3JBG3 3JD72 1KEXA 5DZEA 4JGYB 1W6MA 3LOIA 3AB0A 4AXOA 1AR71 3MHZA 4PT6A 5FZKA 1Y9MA 4Y1UA 4OMCA 1K5MB 1NCRA 1SFPA 2MHFA 2RS52 1RB8G 5BNPB 3ZXFA 2NN8A 1TME1 1LKNA 3B94A 4Q4W3 2NYYA 1OPMA 1PO12 2ZZQA 3JUUA 4IV3B 3ROUA 4GKYA 3RZMA 1UZZA 3ZMNA 1I3HA 4CEWC 2ZABA 2DUPA 5B2GB 2Q30A 1U12A 4JQRA 5T3NA 2OXBA 4HBNA 4XILA 5CNAA 2GC3A 3B69A 5JR7B 1WKYA 3IWZA 3POBA 2LRPA 4QDSA 1X9TA 2R041 4MOAA 3VD3A 4CU7A 2TUNA 2DUQA 4AI2A 1VMHA 2Q8EA 3O0WA 3MIBA 3BYWA 2WAAA 3GBWA 3VBFB 2LROA 3AP6A 4YVSC 5A3PA 5E1RA 2RMU3 2RS13 4FTEA 2J42A 3EXUA 2YV8A 3M1HA 4ISRA 1AYM2 3LPGA 1QQP3 5FIXA 3ILNA 2EXHA 5B4XA 2B8MA 2ZGLA 4YZ2A 3D82A 1KFXL 1UMIA 4CP1A 1DQ2A 4QPGC 1ACCA 4NHYA 1W9WA 1CQ9A 1RUJ3 4GMP0 4E2GA 3DGTA 5I0DA 3EYPA 3GZTB 5ANNA 3VBOC 2ETEA 3G6JB 1R1ZA 1UX7A 3NNGA 5FWEA 4JGZB 1LECA 1JU3A 2VBBA 4PLNA 2RJLA 4XFIA 4D0QA 5C9AB 2CAUA 2QQJA 3GNEA 4Q4W1 3FHIB 4FP2A 2WSUA 3DN7A 1QJU2 2ZGOA 2WZEA 4NPMA 1PMJX 1R093 4KU7A 2E31A 4S2HA 4WVMB 4D94A 3ZFEA 5I0SA 3WP3A 5LWBA 1ZRRA 4CP0A 5CFDA 3MPPG 4IW3A 4Q26A 4COYA 4DEVA 5C33A 1H8TC 2AEZA 5DUUA 1D0HA 5LBBA 1QJEA 1HB3A 3T0AA 3CNAA 4YNIA 1FPN3 3OGVA 1AJOA 1XE0A 5GJ6A 5JOWA 2RS11 5K8SA 1K12A 2G19A 2IXJA 4N43C 1EYBA 4NHLA 2JB8A 3T0BA 3AMQA 1QQP1 3T30A 1PK6C 5IFTA 4CSWA 5DMYA 5CYYA 3VD9A 5CBLA 2DCTA 2K0GA 2PELA 3DECA 4XFHA 3ALQA 2WNUC 1W8UA 3KCCA 3WY6A 3AZYA 4W50A 1RUJ1 3VZMA 4YGCA 3AYDA 4QHBA 4RR3A 4FPKA 1CAVA 2A3XA 4FFIA 1UKGA 4AEJA 4MX3A 1GOFA 2VR4A 2CY6A 4LQRA 1YWKA 2HEYF 1PIV2 1YJLA 2CGOA 2WJSA 3BTZA 1AR81 4AYUA 2VCCA 4KQ7A 1O91A 5IVCA 4Z07A 1SACA 4GH4A 4CCLA 1R091 2BTVC 2CAVA 1OPOA 5A6ZA 5C3PA 5GLZA 4CEWB 1LODA 4UFHA 5H9QA 3T4VA 1RUF3 5FJHA 5FY9A 4CCJA 5CAZA 2V5DA 3O5SA 3VBSB 1OD5A 3QCWA 1SLBA 3EQEA 3LAGA 4GB32 4S2GA 1RHI2 2XBO2 1W8OA 2VMHA 3PLQA 4AQ6A 2CGNA 3PMEA 4XETA 5JLVA 3H8XA 4CUBA 4UXAA 1H2NA 1QKQA 2ZPXA 4DUXA 3IIIA 3K51A 2ARAA 4XJ9A 5F5IA 4CCKA 2ET7A 4C1XA 1OH3A 1IS5A 3MIHA 1UOGA 1IKQA 5EJ3A 3GM8A 4YVSB 4LA2A 4ASLA 5BNOC 3CU7A 4CEYC 5LEJA 3KV6A 4IEPA 3GZUC 1SHWB 3VBHA 2C1FA 4CCNA 3KWVA 5K4LA 1IQDC 2VNOA 1CAWB 2B9UA 4XJZA 5T50A 4YM1A 4EN8B 4AFAA 1DYPA 1H2LA 1D2QA 2WDBA 2X53S 4HOOA 3UJOA 4DRVA 5GZGA 2WZR2 3LIGA 3NNMA 4TTGA 3OBRA 4YGDA 2BEOA 4QPGB 3A0KA 1UZVA 1H2MA 2VM9A 3LIHA 3FLRA 1MACA 3DPRC 1NZCA 4UF0A 5D8AA 3VBOB 4PJYA 2B4KA 3IDEA 5FYMA 4LOTA 4M3CA 4YVWC 5F5CA 1PMHX 4CDQA 5G04L 5IYYA 2JENA 2K2SA 4QX7A 1BKZA 3QLQA 4C0BA 1SQ4A 4QGNA 2O8OA 1DG6A 4CCEA 1Q8SA 1YNAA 4LHNA 5CFCC 3PJQA 2BWAA 3L2YA 3O7OA 4XDOA 4KBZA 1GUIA 2P17A 1VBA3 1LENA 1OOPC 1PVC3 1V9U2 3VBUA 3VBUC 5JCTA 2R062 4Y4RA 4XDPA 2LALA 5FPBA 3WDWA 3CEWA 2YG0A 3WEZA 3PMSA 4P9IA 1SZBA 2BGOA 4R9BA 5E16A 2RDRA 2WYFA 4JRLA 2IC1A 5JIUA 4AGRA 2ZX2A 2DF7A 4Y20B 2ZEWA 4N43B 4NIIA 4DNYA 1JZ5A 3HN3A 3AFKA 4GWJA 1CIYA 5CU1A 3ZLIA 1S0DA 2XJVA 2JJ6A 3I2FA 2VZPA 3WQ1A 4FOWA 1PGSA 5H9PA 3ZFGC 3ZVXA 1MS9A 1APNA 2WNUB 5CG8A 1W6PB 1F31A 3J8F1 4BZ4A 1RL3A 3H8UA 4B4QA 2VVFA 4Y26A 5J48A 5CG9A 4XJUA 4YG3A 1QMJA 2PN5A 3OYWA 3PVOA 4I09A 4TSVA 1WUVA 1AF9A 2ZOEB 1W6OB 3HR9A 5FYYA 3KV4A 2VE1A 3RS6A 4HMZA 4SLIA 2PAMA 4OHVA 4XJWA 1WW6A 2RHPA 4B29A 2QQNA 4XF3A 2Y64A 4IEUA 5C3SA 2HYKA 4WZFA 4H2AA 3IDAA 1X50A 2VU9A 5F2WA 1S2BA 4UFMA 4EN9B 1QJY1 1OLQA 1VBA1 1PVC1 2D6OX 2VZOA 1GWKA 5FY5A 2ZMNA 3I7DA 5DAVA 1GLHA 2AH2A 1CONA 3VDAA 5KHJA 4AEMA 1UY4A 5GM0A 2B42B 3DKWA 4M4RA 2AUYA 4Q1RA 1HV1A 3S5QA 4AQ2A 2EIEA 4AK3A 3UK9A 5FOBB 5FPLA 3BIEA 5LK5A 4TZDA 2QTWB 2UY9A 4Q27A 3KF5A 1R1A2 1SLLA 3M3CA 2XLGA 1JBCA 1QU0A 2BNMA 2WFF2 1H9WA 2RE9A 3MEPA 4CEYB 4N8MA 4EV0A 1F4HA 2WNVB 2QJVA 1AR93 1O8PA 3RWKX 1NCRC 4KWJA 4Q4Y1 1QY4A 1VE0A 1BK1A 1N1VA 1YQ5A 2C6SA 2P1BA 1R082 2ZCWA 4K8FA 4WM7A 2QQVA 5FYIA 4D6RA 5JSPA 2XONA 1U5IA 1AYN1 5GLUA 2PHDA 4B4RA 2CTVA 2E9QA 2WS92 2MEV2 1XU2A 1GNHA 5F3CA 1AX2A 3DPRB 5I8YA 4FVVA 1O4YA 4PDWA 2Q8DA 1ULCA 4UT5A 1H30A 4YVWB 1YLLA 3WNKA 2WZPP 4BH9A 5FZIA 2C9KA 4ZZ8A 3CHXA 3FFZA 1O6UA 4XCBA 3WF1A 1JHNA 2RS51 4JRAA 2VBPA 3FWEA 1N1SA 3BB6A 1PO11 2BNOA 1D4M2 5FP3A 5FYBA 5CFCB 1PM7A 2KA3A 2VPVA 4GD4A 2FMDA 2VG9A 3OD4A 2LS6A 5FLHA 3ZMOA 4DEQA 1TVGA 2YPJA 3MIFA 1DFQA 4IDZA 2F4PA 3Q8BA 4QPWA 4JGYA 5EJ1B 4L99A 5JXHA 4LO7A 4MUVA 1JYCA 5KXBA 3GZAA 5FBZA 2RV9A 4OHXA 1HKDA 4KBBA 4LE3A 3Q8EA 4DXRA 1NE4A 3AKRA 1XNBA 2HWF2 4FPHA 4L0PA 4MH0E 2Q4SA 4R9AA 5EWSA 5LA0A 4OUSA 4OCTA 3S0MA 5A32A 5BNPA 1PNFA 1RXGA 1NOVA 3AZXA 5E88A 4IV3A 4EWAA 4UW3A 3LFIA 1CIWA 3CQOA 3M8LA 3U10A 5LY1A 3C7HA 4EYUA 2W91A 4UW4A 3ZFGB 2ZXQA 3I2JA 4UWDA 4CYDA 2F4LA 5FO9B 4DB5A 5DPNA 1UY1A 4LKFA 5LB6A 3F95A 3DXUA 1FAYA 1GZWB 3UYJA 2AZ5A 1LTEA 1MS1A 1SLAA 4AVBA 2EXJA 4ZS2A 1HRV3 1WZXA 4UFLA 1LOGA 5CVRA 5E6HA 3EHKA 2GU9A 5CADA 4HXCA 4FO9A 1YEWA 2HWB3 2ZHKA 2W2IA 4XABA 4LO5B 5A3MA 2ZX0A 1QH6A 4ZU7A 1JH5A 1S0EA 1W9SA 4FTBA 2YU1A 1ASJ3 4D69A 3GBFA 3VBRC 3O1MA 2IXLA 4MGZE 5F9TA 1LR5A 5BYNA 1DYOA 1W9FA 1RHI3 3T2TA 3ZYIB 3I2HA 1UD1A 4RR3C 1TMF3 1W6MB 2VUJA 2XHKA 5DUWA 1M4WA 5C9AA 1I5ZA 1H9PA 2WO3A 3FBMA 2BP6A 4LIVA 1RUH2 1UO9A 3KGLA 3R05A 2XLFA 3UESA 3NWKA 3WF2A 3ZO0B 2B46X 3RI9A 4M4PA 5FCCA 4IUGA 3SQOA 2SLIA 5FP7A 3WINE 2WL1A 3IDCB 1O7FA 4GH4C 5E89A 2BNNA 2Q1ZB 3C7OA 1S0IA 1FMD2 5FR3A 4I2OA 4P14A 4QD2A 1XE8A 4Y4YA 3I3EA 3NW4A 4FPYA 1GR3A 4NOTA 2GMMA 4CDWB 1FV3A 1VBE3 1W9YA 1RVF2 3A7QA 4V1PA 2ENRA 1Q8QA 1HRV1 2JEMA 1RUNA 3E97A 1NY72 4Y5SA 3ACLA 1GQHA 2R16A 2VTXA 2JDYA 4P9LA 2YB7A 1K3IA 1GKBA 4QAWA 5GKAC 3I54A 5EZWA 1REDA 1YXWA 2ADDA 2JG9A 2I45A 1C1FA 4FPLA 4P08A 4YM0A 2YROA 3O0VA 4QU2A 2J1VA 1X9PA 4JDNA 5IJRA 1ASJ1 4CRQA 1WCQA 5A3WA 3H3ZA 1ZZ7A 2BERA 2EAKA 2ZGTA 4XFBA 5KR7A 3IZOA 1O3QA 1QOSA 5JOZA 4NWVA 1RHI1 1V9U3 2XBO1 3WSOA 2NLRA 2JDUA 1WD3A 4Q4X3 5A3UA 2DTWA 1DBNA 3T1LA 2V73A 5AFEA 1GICA 3TYJA 4LO6B 2PXJA 4KL1A 4LORA 3EBRA 4M01A 3WW3A 1ULDA 5FZGA 4DINB 5AFBA 4D3WA 3TEYA 4CDQC 1A34A 1S55A 1IKPA 1ZBE2 5IK5A 5KHHA 3WOGA 4PIYA 2YYOA 3AVRA 1QDOA 5IATA 3K2OA 1L7LA 5L7OC 4MO3M 2RR12 3VBSA 1VRH3 1CZSA 2VUAA 3WNMA 2D6KA 1Y43B 3AXEA 3MW3A 3JBG2 2ZHLA 3I2KA 3O0XA 2J1SA 2VXRA 3P6BA 4H55A 1VAVA 2PMWB 4Y1ZA 5C5UA 3BKZA 3BGAA 2DV9A 3B01A 1Q3EA 1LULA 4YZ5A 3UGHA 4AFCA 1WCSA 1KDKA 4NIAA 5JMCA 4NAOA 4EZHA 2ZGUA 3OBTA 5ANQA 1RUI3 4BK4A 1S4CA 2BRTA 4Q4W2 4BXSV 1W28A 3LKJA 4IEXA 2Y6KA 4QQLA 4E27A 4CE8A 1W0OA 2VMCA 3VN4A 2H6BA 3WCRA 1ND3C 1ZREA 1FYUA 1SCRA 5IWFA 3VBRB 1BJQA 1V9U1 4NHKA 3Q8CA 5A6QA 2AACA 2CYFA 3NQHA 1BYHA 4Q4X1 5IK7A 4QX0A 4NHMA 2ZKNA 1ZX5A 1KD7A 3IMNA 3HD8B 4MZUA 2PQQA 5D2AA 1CAXA 2XUEA 5K7PA 2FDGA 3AZVA 5JI7A 5D1IA 1CPMA 3HBKA 1AR63 1J3QA 5LATA 4NIDA 1UOJA 2RMU2 3WP5A 3HQUA 5HV4A 2RS12 4PIXA 2V72A 3ZYRA 1ZZCA 2ZX3A 1GWLA 3MGUA 1BHGA 1AX0A 3TN93 5A70A 2RM23 1QQP2 1US2A 1V0AA 2P2KA 3FX3A 4GH4B 5FREA 4IV1C 5FXZA 2W95A 4YYOA 1VRH1 3HJRA 4IEOA 1W2OA 4OI4A 5HBAA 1SEFA 4FQ4A 4HLTA 1ZRDA 1RUJ2 5AC93 1LESA 3K4ZA 1MS5A 3WW2A 3C7GA 3CJIA 4BK5A 1SG3A 1QXPA 4QGMA 4K3UA 3VKOA 3ACHA 1RUI1 4K7JA 4Y20A 3ZKUA 1DYKA 3PHMA 4FXKB 2J1TA 4JKLA 1I1EA 2FMYA 2Y6JA 4GULA 3K75B 4IEYA 5DAPA 1TZOA 1R092 1Q5OA 4WM7C 5J96B 1WD4A 5FUNA 4DRRA 2WNUA 4HETA 1W6PA 2ZX4A 3H1MA 1X8EA 4LBNA 3SCGA 5FDBA 5A7WA 1E5SA 3AL5A 1XNDA 1AVBA 3ZYHA 5DQ0A 4FAHA 4CUCA 1W6OA 1AXZA 3K4AA 4UF0B 1MPXA 2R0FA 4PDWC 1DZQA 1R1A1 2W47A 4PIZA 1FPN2 2WFF1 4CCCA 3HBZA 4M3CB 5L19A 4CDQB 5CISA 5DXDA 4XW3A 3TN91 1C3HA 1MVQA 3RSJA 1CX1A 4AAXA 2RM21 1R081 2W3JA 3E5UA 5DG2A 3ZFFA 3GDBA 4G4FA 1YQ2A 1KJLA 5L7OB 4P5YA 2WFPA 3WDXA 4J1WA 3A21A 4L8QA 1ZA7A 1S1AA 2WS91 4QQOA 1HIXA 2Q0AA 3M2MA 5AC91 5F3GA 4DOUA 1RC6A 4GJYA 3VBUB 4DXZA 2XHNA 2VCMA 1UWWA 5FPXA 1G9AA 3CZUA 3D8CA 4JGYC 3WG3A 2FD8A 4LHLA 1VMJA 1J1TA 4CEYA 1XU1A 4Q8KA 3GALA 2WNVA 4UOJA 5GZFA 1HB1A 3WDTA 2YGMA 3I97A 4ONUA 4UBHA 4SBVA 4YSFA 3ZYFA 1BXHA 2Q5TA 5BNPC 2X10A 3AXDA 1D4M1 4LUKA 4PHZA 4IV3C 4XZPA 2VZTA 1ND3B 1RUF2 4U36A 3VDCA 1O8SA 4ES9A 4HG6B 1UIJA 4KNCA 2VCBA 2X5IA 3TEXA 2D44A 1U5XA 1JYTA 1QJFA 3H1WA 3E6CC 4YVWA 3QD6A 5A3TA 2BGCA 4QT6A 4E4SA 4YLZA 4CDUC 1J3PA 3VKNA 2HWF1 2H0BA 1YRZA 2VOTA 4IGOA 4IE4A 4XUPA 5ABJB 1V70A 1JZ4A 3V0AB 4A2UA 1OQEA 3NV1A 3GHNA 4Y24A 5CFCA 2A75A 2Y8KA 2PHUA 3HEIA 4IV1B 4P9XA 5CIRA 5JSRA 2ZGKA 4UI9L 1XB9A 2B39A 1N1TA 2EA7A 3KV5A 3QH7A 2YC0A 1QJZA 1YFUA 4XHBA 3RVHA 5F1RA 1PZ7A 4B1LA 3JB8A 5FKCA 5HXVA 1V6JA 3T2QA 5IK4A 3S6PA 4MADA 1VIWB 1VR3A 2YC2A 1CD3G 1RVF3 3EB7A 3JXSA 2R1DA 1YYNA 2VUCA 2Z5WA 3OJBA 1VALA 1ZNPA 4FOYA 2YHJA 1FXZA 2ARBA 1G9BA 2E26A 3AJYA 1QXRA 4QGLA 1O4ZA 2P4EA 4L92A 4AHXA 4AOCA 1GP4A 2CU5A 5LK7B 3CDZB 4I3GA 3USUA 4LBQD 1VBA2 1PVC2 1UY2A 3WQ7A 2E6VA 2VW2A 3WG1A 1LEMA 1STMA 1HXS3 1MEC3 4KG0A 1WW7A 3THTA 3UL2A 1EV13 4QXCA 3ZIWA 5F7UA 5JZGB 2FDJA 1IPJA 2ZEXA 4NO4A 3W5NA 3I49A 2QQOA 2HWD3 4PDWB 3FUQA 2XGXA 1DU3D 3DYPA 4HK8A 4MGKE 4UFJA 4XPVA 5FXWA 3LEMA 4AAPA 3W9AA 1RUH1 4LA3A 3LEIA 1NT0A 4XF9A 5JOYA 2ZZJA 1U5YA 2XXZA 5DZGA 2JG9C 3E5QA 3A23A 3I2DA 3ZSEA 1GMMA 1FMD1 1XOYA 3AP9A 4KI5M 4QB6A 2Q8CA 2UURA 4E2QA 4XUTA 4HN0A 2PYTA 5IVJA 3OGRA 1RVF1 3MF6A 4LE4A 1K5JA 2RDQA 1W6QA 1H4HA 3TOJA 3VDDB 4COUA 1Y4WA 1BZWA 1NY71 3O12A 2PHXA 3SMHA 3TN92 3WF4A 5FZMA 4AGVA 5K9YA 4BE3A 4FPEA 3VDBA 2BUKA 3U11A 3E5XA 5K0UB 3HIFA 5BV6A 5IFPA 5A32B 3RNSA 2R30A 5A3NA 5IVEA 1ULEA 4NN0A 1UYPA 3LGRA 4W4ZA 3PTYA 3VB9A 1N1YA 3U0ZA 3GYDA 1IG3A 1HXS1 2VMFA 3OBAA 4YPJA 4A6OA 1EV11 3VBSC 4CDWA 1W8ZA 3WQBA 1EAH2 4XF4A 3ETPA 2HWD1 3KB5A 5EP9A 4RFT0 4R9DA 4IE6A 4OVEA 4LO8A 4LLFA 4CDUB 2ERFA 3JCIA 3HNYM 4GQ7A 4C1WA 1V6NA 3DXTA 3WLUA 1AR92 4AEDB 1RINA 3B9IA 5F5QA 3AZWA 1LGCA 1ZBE1 1DZTA 1LHOA 3M4FA 2FQPA 3KQ4B 4QDQA 1DQ1A 1JTZX 3KZ4C 3PUQA 2RR11 1OVPA 1ULPA 2GALA 5DUXA 3S7EA 3T2PA 4FP3A 4FXGB 4CUGA 4FBFA 3A0NA 1D2SA 4CCOA 1BEV3 3JBG1 1SFYA 1OT5A 2QQMA 2TEPA 3EO6A 2RJ2A 3JQXA 4FOVA 4QXBA 5JUVA 1ZZ9A 4IE0A 5I8TA 5KHIA 3RZLA 1PGL2 2E51A 1KQRA 2FCTA 2R0HA 2GP3A 2XVKA 3ZXLA 5TSWA 3M3IA 3HT1A 1UIKA 2JDPA 5T5JA 3ZSJA 1A6CA 3WCSA 2W08A 2D93A 1RJ8A 2B7YA 2E33A 1LRHA 3WHTA 3KGZA 3BTXA 1LAJA 1OXCA 4XEZA 1SBEA 1WW4A 5L36A 4FAGA 3OY8A 3D5OA 4QQPA 2ATFA 3M3EA 3VZOA 2DVFA 5D21A 2GDFA 3AYCA 1PHMA 3WD5A 4LBMA 1F2NA 1XC6A 2D97A 3EJKA 3OUIA 5LA1A 2D40A 3D4KA 4AI3A 4B1MA 1JZ3A 4XJ8A 5G05L 5LBFA 1IS6A 3FJSA 2WC2A 1T6BX 3CJIC 3VD5A 4AI8A 3HT2A 2RMU1 1YQ8A 4BQ3A 4IQPA 4ZXEA 1VLNA 2JG9B 3FLTA 5IVBA 2P6CA 3NKTA 1HB4A 4XFFA 5FMOL 4COVA 2YMZA 1GZCA 1F5JA 1BEV1 4HKWA 3VBRA 4Z92B 1UPIA 3NV2A 4CU9A 4XMIA 4W6YA 2OA2A 2R32A 2Z2SB 1ENRA 1WA6X 4LBOA 3BIWE 4OI1A 4LO4B 2XJPA 5KC6A 4K6BA 1J3RA 1GYKA 2VTFA 3FN9A 4MXWB 5FZ6A 2O8QA 1MZFA 1CAUB 1HRV2 2Y38A 3UNPA 3H8OA 3H7JA 3RJRA 3S5AA 2FZ2A 2I2SA 2UY8A 4DY5A 4AVVA 4MGQA 2HWB2 2DBNA 1IS3A 5FY1A 3U78A 1MS3A 2IUWA 2VJXA 2ZHMA 4JX0A 3NV4A 4B7KA 2XJRA 3ZFFC 4UW6A 2Y34A 5JOXA 1ASJ2 1XRUA 5IAXA 3PURA 3RZGA 1L7QA 1OMIA 1BBT3 2R1BA 1O59A 2D3SA 3N36A 5C6CA 4XMAA 1TMF2 3CIHA 5I8SA 2YBPA 3U75A 3BI3A 1FPN1 4WVVA 4FSJA 2J1RA 3NVCA 2IVIB 2P3YA 1ULOA 1JZ2A 3HWJA 1UMZA 2WNVC 1GSLA 3KQRA 4JV4A 1EPWA 1ZRIA 2VW0A 4YM2A 4AZZA 2BPA2 4HVRA 1REEA 4PF1A 5LASA 3RG0A 3RPQA 1Z7S2 4PLOA 4LMFA 1QIQA 2QQKA 4AEKA 2WT0A 1LCLA 1MS8A 1BLZA 4U2AA 4M0NA 1A8DA 1VBE2 2L9LA 4K1ZA 3ZSLA 1PZ9A 3T4HB 3QACA 1W05A 2VOXA 2D6NA 2X5IC 4F7ZA 1LOCA 4XBNA 1GANA 5F6KA 4YW2A 3KHBA 4BMBA 1CAXB 1YQ6A 1YIPA 3IAQA 2BZDA 3H50A 1IG0A 2GNDA 2UU8A 3U1XA 3HAGA 5EQUA 4AVCA 1OKQA 4O65A 3FC0A 1UOBA 4L2NA 4BLIA 2X29A 5L7OA 4EROA 5FTTC 1RUF1 3DYOA 4BQXA 2VGDA 3J7MA 1FATA 4KH9A 2WT2A 2WRAA 3X29B 3DUIA 2IXKA 2MNGA 4IGQA 4NE9A 4P9WA 3WDUA 4Q4X2 3W5MA 4BWOA 3ST7A 4FFGA 1UNBA 1UMHA 2HLEA 4RGGA 1G8WA 1MS0A 3N9OA 3RQ0A 5I93A 2Y6HA 3CJIB 3THDA 4LBQA 2WQZC 4XYXA 1SLTA 2A3WA 1ALYA 1Z78A 1WLDA 5JDBA 1CWPA 1N3OA 5I0UA 1ZZ6A 2VY0A 4QMAA 4JDOA 2FCUA 5T55A 1ND3A 4V2VA 1YCIA 4RD7A 4GJZA 4ZPIA 4ZHNA 1VRH2 2WQ8A 3PL0A 1OLRA 1O3RA 4FQZA 2HEWF 1ENSA 1HV0A 5GALA 5BNQA 1OLME 2JKBA 3FZ3A 4AF9A 5A7WB 1WLCA 3VHOA 1XYNA 3T08A 1U5ZA 3HN1A 4JVAA 1AL23 2BW8A 2PHTA 2Z69A 3MFAA 4F8AA 4EJRA 4EZ4A 2B5HA 5ABJA 4MXVA 1QJX3 4PBOA 2XOMA 2PAKA 2AC1A 2WR9A 3V0AA 1C57A 1H8VA 1NA1A 1RUI2 2BFUL 4EN7B 1YJKA 4MSVA 3OPZA 4YGEA 2BBVA 2AENA 1O4TA 1OC1A 4GKXA 2Z4FA 4IV1A 4NR1A 3ZFFB 3DCQA 5EYYA 3SXWA 2ILMA 3MUY1 1IPSA 1GOHA 4INDA 1S0FA 2WO2A 5AVAA 5FY4A 5FY7A 4YARA 3C2UA 4DUVA 5FWJA 2P3IA 4KWLA 5FO7B 4KWKA 1EAH3 1A8MA 1RUD3 1G9FA 4NPLA 2VMGA 4TLGA 4YZ3A 4BQ2A 1NXD1 2WLQA 1AR62 4DXSA 5T5PA 3ACIA 3ZXEA 2A6WA 4FPFA 1D4VB 2VXJA 5J7MA 2QBXA 1RYYA 5JXIA 1W8HA 3PJYA 3ACFA 4HPKB 1TEIA 2YFUA 5AVPA 1WBFA 3SEPA 2RM22 3PIGA 4AHZA 3AYEA 5C8WA 3E6DA 1ZBA3 3IN9A 1W2AX 3LWCA 4K40A 4FPCA 3VKFC 2EF6A 1MVEA 4PI0A 3KT1A 3ENRA 2JDHA 3ABZA 3NNLA 5IK8A 2ES3A 2D43A 5AC92 1JMUB 3NJXA 2XG3A 5JZGA 2X5IB 1W0NA 4CDWC 3ZYJB 3UJQA 2BJSA 4AQSA 3BTAA 1BVVA 3P3PA 2HEVF 5H9SA 4XBLA 5F3IA 5A7NA 4BQWA 3H7YA 4K1YA 3VKMA 1OFSA 2AYHA 4HN1A 5HCBA 4E4DX 3PDQA 1RIRA 5FPZA 1F8VA 5FP8A 1DDLA 1LHUA 5FXXA 5C5TA 3N9NA 1HX6A 3CBNA 3IPVB 4BJ0A 3OD0A 1VBB2 3DF0A 2YU2A 1PM4A 3J9SA 1ZA4A 2NZ9A 1EAH1 3ZN5A 1MR5A 4KG8A 3VDDA 1CN1A 1LEDA 3URFA 3Q8AA 4QM8A 4MGIE 3OGSA 1AR91 3BOPA 2D3RA 5K0UA 2BGPA 3RI8A 1N3PA 3AKSA 4BDVB 1W2TA 1ZBA1 4QKDA 4XF0A 1KS5A 2EIBA 4CCMA 1Y7BA 1NLRA 5FP9A 4OMDA 2BDRA 2D5FA 2FZ1A 5F37A 2B45X 5CZKA 3USUB 1H0BA 3GF6A 4CP2A 3HVDA 3LOBA 2J1EA 3B02A 2FDFA 4ZZ5A 3SCFA 1PGL1 3LA3A 1AZDA 2DTYA 4RL7A 4D7TA 1W3VA 1H1AA 2MPFA 1XSQA 4CDUA 3AKQA 4XXAA 2E7TA 2XVGA 4AEDA 2QCSB 5F39A 1IGOA 3LDKA 2UWAA 2DVBA 3Q9OA 1XSRA 4LULA 3RDIA 3DKQA 3OPTA 3ZKYA 1RTVA 1UYYA 1W03A 4NMIA 4I0AA 1WMFA 3SNMA 2D3PA 4AHWA 4I02A 4GXLA 4MHRA 4AVTA 1NE6A 4Q5OA 1YFWA 2WSVA 3OSDA 1MS4A 3MICA 5T54A 4MHUA 4XF1A 3VLBB 4D6SA 1QH7A 5APAA 5HPOA 3DYMA 1LNSA 2JXAA 2UWCA 4LUMA 3HMYA 1GP5A 5GLTA 2W1QA 2WN2A 3POJA 2A71A 4EN0A 2FDKA 1W6QB 1FI2A 3OB8A 1LU1A 1LOEA 4QX2A 3C7EA 4OFGA 1J84A 4BHPA 3NAPB 4XCAA 5IW0A 4KGQA 1NUKA 5KHKA 2VUDA 1H1IA 3OEAA 4AR2A 1CVNA 1O5UA 1BK0A 5FLIA 4Z1VA 3WHUA 1Z7S3 3BPSA 4LEJA 2RDSA 4J6GA 4WVWA 1V6KA 4DQAA 1UX6A 1W2UA 1S2KA 5FZOA 1GZTA 3ZXAC 3NNFA 2WIIB 3ZYGA 3AC0A 5FV3A 2ZTNA 3B5LB 2P3JA 2OQ7A 2GZWA 2XKPA 1OLMA 4H7MA 2XJSA 4H7LA 4YZ4A 3AFGA 2NMOA 1KGYA 4JHTA 5LA9A 2HWB1 5LY2A 2PHWA 1QOOA 2A3YA 1CGPA 2ZEYA 3WT3A 3FHAA 5DDJ3 2DCZA 1J59A 3B7MA 2PHRA 3RZKA 1F15A 2QNKA 1CZTA 5J37A 1L3JA 3A22A 4XOGA 3CF6E 5GZEA 4LPLA 1HXS2 1MEC2 1OFNA 1RXFA 2CDPA 2GMPA 1EV12 3DV8A 3GHMA 4YFWA 2CHHA 5FZAA 3ES1A 2JE8A 1WMDA 4MXWA 1TMF1 4P9GA 4XBQA 2HWD2 1CAUA 3U14A 2FHRA 2W92A 4I30A 3WG4A 1RUOA 2Z79A 5LZ6A 1DQ5A
chains in the Genus database with same CATH topology
4F3JA 2LUWA 4XFCA 4AHYA 4E2SA 2HKXA 5SV8A 5ACA3 3CJXA 5JWPA 2IZWA 4YG6A 3RMYA 3WZ1A 1YUDA 3POSA 4CDXA 1Z7S1 2HWE2 2X8KA 4Q1PA 4AI0A 1RUG3 2GC1A 4M00A 3ZX7A 3OY8B 1VBE1 3CLPA 4HVQA 3R6SA 4MGYE 5FO8B 3FLPA 2NQYA 3D0JA 2BVVA 3B3QE 2XL7A 1B35A 4ORFA 1HLCA 4YRDA 1HRI3 1VBC3 2D5HA 3B9CA 4FPGA 1RUC2 2XUMA 2VMIA 4ZU5A 5BY5A 4HT1T 1UU6A 5DDJ1 1A78A 4RHV3 1TNFA 3H3UA 3VL9A 4AFDA 1VAKA 3N3HA 4OULA 4HVOA 2SBAA 1QF3A 4OI0A 4GWMA 2NP0A 4D7SA 3DL3A 1SBFA 2XJUA 2ZAAA 1FV2A 1UZYA 1QHDA 3WDYA 1W6NB 2QUOA 3LZZA 2ZAHA 4XIKA 3B00A 1LHNA 1HDKA 5ABJC 4XQ4A 2ZGSA 2Q1MA 1UU4A 1NA1C 4BLJA 2GAUA 5IUQA 2H6CA 5T5OA 4DFSA 4P9YA 2VULA 3WR0A 1DQ4A 1I6XA 2VOKA 4HKLA 3VZKA 3WUDA 3BCWA 5JI9A 1BEV2 1UKRA 4N7UA 4FPOB 4D7YA 4I3PA 4HANA 4UW5A 1AL0G 1QXJA 2CL2A 4FTSA 3ILFA 3ZN6A 1HRI1 2YDEA 2P3KA 3SHRA 4LBKA 4XJAA 2QKDA 4JTOA 5FFOC 4PBPA 5KXEA 4RHV1 5JPNB 1LOBA 5C4WA 4XE9A 3ZSMA 1ND2B 1VBB3 3MLLA 4Y1XA 1FNYA 2C9AA 2WNEA 2YY1A 5LRRA 4IESA 4L11A 5JZGC 4OI2A 4YW4A 2VH9A 1LU2A 3V64A 1AR61 1C8M2 1RUE3 3M7AA 5FOJB 3MLJA 4E4ZA 3THPA 4HKOA 3D0SA 4ES8A 3I4IA 4G9SB 1BQPA 4N53C 3MIGA 1PZ8A 2BQPA 2QVSB 2A6XA 4Y22B 2JICA 5J98B 1YFYA 1GFF2 4IERA 4LR4A 3VDDC 1SBDA 3I59A 4AFBA 3WW4A 4BCUA 2VVEA 4LBQB 4RGAA 2XWBB 4HPKA 4C90A 3AX4A 5K0UC 1NYWA 5F6LB 3PVEA 2PLV2 4EWDA 2XPJA 2OUJA 1VBB1 5GZCA 1BBT2 1NXMA 3MIEA 4KGGA 1Q43A 4YM3A 1LOFA 3KSCA 1V6LA 3H1YA 4XTMA 5EYXA 4K20A 2CWMA 1V6MA 1RUE1 3TBDA 1O3SA 2KXLA 1SCSA 4AEDC 1NA1B 2YUEA 3N35A 4IXLA 3USSA 3IPVA 3WW1A 1LOAA 1AHSA 4G3YC 2JG8A 1WA4A 1IZ3A 2R6QA 2VOVA 2ET1A 3VHNA 2VVDA 3W59A 4Q0SA 4Z82A 1XQNA 2HWC3 2QE3A 1OQDA 2QZ2A 4WVZA 1N3QA 2D6MA 2UWBA 4JTNA 3AP7A 3ZIXA 1MZEA 2RJKA 2VNRA 1RGSA 3U07A 5C8CA 4BM8A 3NKGA 4LBJA 1AR73 2OW4A 2JD4A 1J58A 2ZGMA 2E63A 2XLAA 1FOD2 3NV3A 4Q29A 2CV6A 1ZYBA 3ETQA 3ME2A 1CESA 4J1XA 4N90A 1TME3 2PA7A 4B8EA 1GZ9A 2JECA 4JAAA 2HWE3 3MPBA 4N53B 2ZHNA 1LGBA 2ZX1A 4JCKA 1S0JA 3MF9A 4BIOA 3SH5A 1AL22 1AUYA 1DLLA 5H9RA 1LHVA 4QPIC 4R9CA 4FCAA 1QJX2 1H1MA 1CPNA 3NAPA 4R4XA 4XFAA 2A5ZA 1GQGA 4PF5A 2PTMA 1RUC3 2ZMLA 3FE5A 2EAAA 3VZLA 1EPZA 1YHFA 2ZJCA 3CO2A 4COWA 1F5FA 1IOAA 4CDXC 1MEC1 1X36A 5FMOS 4JC1A 1RUD2 1OI6A 1HQWA 4L9BA 1B35C 4LHKA 4RSUA 1NCQA 3M3QA 1KFUL 1SFNA 4B3NA 4GA9A 3NO8A 1PO23 4X6QB 2DVDA 4LT5A 1ZBA2 5HI0A 2GN3A 2DCJA 2A70A 2HWE1 1TE1B 1POV3 4Q2FA 3AP5A 4NWWA 4XQDA 3MIDA 3VHRA 4MVTA 1DQ6A 4DZGA 3SH4A 1X33A 3ZXJA 4N7IA 4WZCA 4AVAA 1ZRFA 4QQ2A 4W65A 1RUC1 1U0AA 1V00A 2PHLA 4EN6B 5LRSA 5A33B 1URXA 1T6GC 4RS5A 3ZSKA 1ENXA 3SCHA 2GN7A 5KWRA 2D7FA 1KJRA 2W68A 4Q0PA 1DF0A 2CWSA 4OHYA 1ZZBA 1QNWA 2GSYA 3ZYPA 2I74A 1YI7A 3AK0A 2IWGB 1UL9A 2OZ6A 3V65A 4ZKTB 3MZHA 1C8M3 1PO21 2N7GA 2GNBA 1AR83 1MQTA 1Q8VA 5BNNA 4TYSA 1POV1 3LSEA 1FNZA 1XYPA 2Y0IA 1WGPA 2ZMKA 1WCDJ 5C4WC 5KXDA 3TAYA 2XJQA 1JW6A 2Y0OA 4E9KA 3SH3A 3WP4A 5GLVA 1AXYA 4QPIB 3OTFA 4DS0A 1W6NA 5I91A 2OZJA 4X8PA 2DCKA 1BCXA 4DY3A 1G86A 1PGW2 3R0RA 2WLPA 2OIIA 1VJ2A 4ZXKA 1LGNA 2PFWA 1RJ7A 4C0HA 1MZ5A 3ZDSA 3RJ2X 2ZA9A 1G9DA 2PLV3 4CDXB 3VL8A 3W58A 5EFUA 3D6EA 3VV1A 1WLWA 4O9GA 3RYKA 1ZVFA 4W6XA 1OSGA 1VBD3 1LB2A 2W52A 1UW8A 2V5YA 3GBGA 2GNMA 1B35B 2RS33 4IEWA 1C8M1 1C4RA 5BUVA 1Z0HA 1OQ1A 5L73A 1UCXA 4R52A 4YFZA 3KT7A 3APBA 4DMIA 1ND2A 2BFUS 1YI9A 2ZGNA 1YO8A 3BODA 1EY2A 3PVBB 4XFGA 3TNQA 1WBLA 2ZBJA 3FMGA 1LOFC 1BMV1 2D6LX 5I0TA 4WM8A 3RWNA 4AGGA 4JDMA 3PVNA 1J1LA 4COZA 1H4GA 3OCPA 2UYAA 3TNPB 4X6RB 5DDJ2 4GMP3 5HCAA 2PLV1 5KXCA 3KM5A 3JU9A 1BBT1 3KT4A 2P37A 1VBD1 2Y26A 1CX4A 3J8F3 3E6BA 2JG8C 1C5HA 4Y22A 4FPJA 2NM1A 2RS31 1YFXA 1ULFA 3ZN6B 3A4UA 1D0GA 3AJZA 5ACA2 1COV3 2QQPA 1C8NA 2DCYA 1FOD3 4HZFA 3IIAA 2CGPA 1RUG2 2XJTA 2TNFA 2DFBA 5C4WB 1NG0A 1QJY3 2DVAA 2OPKA 2K9ZA 3S30A 2WQ4A 5T5LA 1H8TB 2DVGA 5BPXA 4Q4V3 2C5DA 1HRI2 1VBC2 1QGLA 2IFWA 5C8CC 1CJDA 4OUMA 2TBVA 4AQTA 3R4UA 4GMP1 1OHFA 4XTPA 2ZGQA 1JUIA 4RHV2 1PK6B 4Q4Y3 3ZXKA 4CZSA 4HL0A 3QBQA 2GNTA 1VP6A 3VKLA 1AYN3 2A7AA 3NJZA 1JUHA 4ATEA 2CNAA 4YW1A 1ULGA 2EXKA 1ZRCA 3V0BB 2BWCA 3AMMA 3JD73 4GALA 4RQPA 1COV1 4HK9A 3I59B 3N7JA 3NAPC 5KBFA 3SITA 1FOD1 4M0HA 1FT9A 4PQ9A 2RS53 2ZS6B 3I8TA 4LTAA 1PO13 2QFEA 3JQWA 4B4PA 1SDWA 2GC0A 4R4ZA 1M06G 3FFQA 1HQLA 2A73B 4Q4V1 3N7MA 1AL21 4OZXA 1A3KA 3ZPYA 4BYYA 3LSDA 1QJX1 1DGLA 5BNOB 2I07B 1QDCA 1X82A 4NVPA 2C0ZA 3KCXA 2OYZA 3WQ0A 1NCQC 3QH6A 3G7DA 2VQAA 5HCFA 3VZNA 5KHGA 1S0BA 2KM2A 4XXPA 1UF2C 1AYM3 5FAXA 4N53A 1G7YA 1KXGA 5CB7A 3CL1A 4WV8A 1DZRA 2YXSA 1RUD1 3JD71 2JG8B 2IXHA 5GZDA 3RYRA 1XNKA 2DURA 3M3OA 5IT6A 3MDPA 4B7EA 2G4IA 4IEQA 1UN1A 1RUE2 1W0PA 3LA7A 3ZXDA 1SMVA 2Z42A 4O9EA 4F83A 4N9IA 3ES4A 1KRIA 4HFSA 2G9FA 1IQAA 2IXIA 4RS5C 2WKKA 2E7QA 3BOWA 3IT8A 4IEZA 3IM0A 1QJU3 1KITA 3VUOA 4YGBA 1E57A 5CA6A 1OOPB 3WV6A 4META 1IPKA 5LEKA 1V6IA 1DGWX 3UKVA 3INAA 3ECQA 3MYXA 5DUVA 1K5MA 4N9HA 5C8CB 3R4DB 3TB0A 3AMHA 1VB2A 4MYEA 5JAXA 1C5IA 4W6WA 3QOPA 2JE7A 1XNCA 1AYM1 5JIAA 1MQTC 5BNNC 2H0VA 4OLLA 2D98A 1Y3TA 3ZFEC 3C3VA 5BXXA 5CFDC 3WUCA 2ZACA 3POWA 3TRSB 5E8AA 4BQ1A 1CR7A 1RMU2 2IFRA 3VBFA 1HQNA 1GNZA 5FQ0B 2ARXA 1JN2P 5A33A 1SLIA 1PIV3 2G9GA 1PMIA 3V56A 4LBLA 3KCYA 3TWIA 1QJU1 3AZZA 3JB4C 2EALA 3N4MA 1V6OA 3AKPA 2DWRA 1DGWA 4LLOA 2XKOA 5EXOA 5SV5A 4ISQA 4FOQA 4GB33 2XBO3 3U4XA 3T1MA 3VHPA 3AYAA 4JGZA 4BIFA 1JYIA 3WG2A 3J26N 4PLMA 1PGW1 2HWC2 1FX5A 1NCQB 1NCRB 2QZ3A 1GV9A 5J36A 2AREA 4WVMA 1O3TA 4A7KA 4C91A 1ND2C 2WZR3 3KS7A 2R072 3WXPA 4ZU4A 4QPIA 1TNRA 4XHXA 2EVXA 2DU1A 1AR72 4Y5Z0 1IHMA 5T52A 4AG4A 1WLTA 4IEVA 4AE2A 4WM8C 4AW7A 1PIV1 2VNGA 2WINB 3AP4A 4BMEA 2D6PA 1REFA 4RS5B 4AVSA 4LNVA 1WMEA 1TME2 3S7IA 3VBHC 3PNAA 3NSTA 3WVJA 1G9CA 4YW5A 1G6NA 4KU8A 3BPZA 3MLKA 4GB31 2GH2A 1JOJA 2A6ZA 4IL7A 1EP0A 2QDRA 4Q0UA 2R063 2NMNA 3J4UH 4ASMB 2R042 5D8AC 4TWTA 1LJ7A 1OA2A 3ATGA 4OHZA 1DHKB 3L9JT 1QOTA 3AMNA 1MQTB 5BNNB 4CEWA 2WZR1 1X8MA 1XXNA 3ZFEB 5CFDB 1UU5A 2XWJB 1OA4A 3N7KA 2LTNA 4HSLA 2YZ4A 2WWSA 4AFMA 4NPRA 2DU0A 4XIOA 4YVSA 3RMXA 5ACA1 1H2KA 4M3CF 1RITA 1PO22 3RRDA 3SISA 1AX1A 1CAWA 2OUHA 5J3UA 1DQ0A 4URTA 4YW3A 1RUG1 3M70A 3P3NA 4A7ZA 2DFCA 1B09A 3MW2A 2R49A 3OF1A 2GMEA 4QPGA 4GWNA 2R061 2JE9A 2LM3A 2XVLA 2Q8OA 2FBEA 3VBOA 1Q8OA 3BU7A 4QXKA 4RR3B 1X7NA 1CAVB 1TQ5A 1PVXA 1VB4A 1VBC1 3OGJA 4MLOA 1F9KA 2WA4A 1IS4A 1R1A3 4RQPC 2WFF3 2V09A 3UKNA 1Q8PA 1Y9QA 5J09A 2E53A 1VAMA 1QWRA 1R083 3UV9A 1NQJA 4QPYA 2JDZA 3JZVA 4ATFA 5JVVA 4WBBA 2A6YA 4MV2A 2W39A 4HSJA 3N7LA 2WS93 2EIGA 2EXIA 3IDBB 2MEV3 1H8TA 5DG1A 4Z2WA 3LB9A 4QM9A 3KLSA 3AMPA 3WP6A 4I0BA 4K9SA 2ZKLA 4BA6A 4BPZA 4WM8B 3BALA 4N43A 1AR82 2VW1A 1JXNA 4X8NA 2WT1A 1PK6A 3B93A 4S2DA 1MZ6A 3VBHB 4FT8A 2HJIA 2A6VA 1D4M3 1N47A 3ELNA 3UKTA 1Q56A 5I0RA 2E7AA 3ASIA 5JSOA 3KMHA 3V0BA 4R8HA 2GH8A 1BMV2 2DYCA 3WX5A 5D8AB 4DPNA 3HQXA 4QQHA 1UPSA 5GLWA 4S2FA 1W39A 2IXCA 2HWF3 3ILRA 4I01A 2NPIA 3POYA 2XB6C 3LA2A 3WNXA 4H14A 2QDNA 1ONAA 1DIWA 3FBYA 2MEV1 1AXKA 3MFCA 3ZXGA 1S0CA 5FRAA 1VBD2 1C28A 2GC2A 3MI8A 4P5HA 5A3LA 2RS32 2AGSA 2BVBA 4BOWA 5BNOA 2VQ0A 1RMU3 1PNGA 1UAIA 3O14A 3H9AA 1K5MC 3VGIA 1S0GA 3AKTA 1BVP1 3KD4A 3ZN4A 3OGGA 4CTEA 4I0WB 4Q8LA 2PAEA 3RYPA 1DGRA 4OHWA 2F6BA 3AM2A 5JPMB 3IBMA 2O1QA 3DPRA 3R4SA 4Q0QA 1XE7A 4QX5A 4AWDA 5KC5A 1CJPA 1HW5A 2UYBA 3OYWB 1POV0 1ZM1A 2ZGRA 3VBFC 4RQPB 1AJKA 2VOWA 1YIFA 1RUH3 4A3XA 2WA3A 4P9JA 3RZZA 4EWEA 4Q0VA 2P34A 4UBGA 1O5LA 1OOPA 1LHWA 2JX9A 1FMD3 4YZ1A 4GIQA 3J8F2 5DZFA 2AR6A 2R073 2W0XA 1NQDA 3FUOA 1RMU1 1I9RA 2BYVE 3K48A 3MW4A 3H0OA 4IETA 1XYOA 4JGZC 1COV2 2YGLA 5C9AC 4XDQA 4RA0A 4AI1A 2XL9A 4A7YA 4WM7B 3ZFGA 3IKWA 1QJY2 4Z8BA 4ITCA 1KS4A 2VECA 1NLSA 1WW5A 2XH6A 1ZZ8A 2ZGPA 1GZWA 1C1LA 1QNYA 4Q4V2 1OA3A 1KDMA 5FQ0A 5EV7A 1GBGA 2R043 1DGRN 1WCKA 4PCRA 3L2HA 2HWC1 5FLJA 1SLCA 2OVUA 4TLFA 4Q4Y2 1ZBE3 4Y1YA 3WDVA 4XQWA 3LCPA 4YG0A 4H3WA 4Y1VA 4L97A 1AYN2 3VZJA 2O0OA 2DUOA 2RR13 4K21A 3SLIA 3NL1A 1ENQA 4M3CE 2PHFA 2R071 3JBG3 3JD72 5DZEA 4JGYB 1W6MA 3LOIA 3AB0A 4AXOA 1AR71 4Y1UA 1K5MB 1NCRA 2MHFA 2RS52 1RB8G 5BNPB 3ZXFA 2NN8A 1TME1 1LKNA 3B94A 4Q4W3 2NYYA 1OPMA 1PO12 2ZZQA 3JUUA 4IV3B 3ROUA 4GKYA 1UZZA 3ZMNA 1I3HA 4CEWC 2ZABA 2DUPA 5B2GB 2Q30A 1U12A 4JQRA 5T3NA 4HBNA 4XILA 5CNAA 2GC3A 3B69A 5JR7B 3IWZA 2R041 2TUNA 2DUQA 4AI2A 3O0WA 3MIBA 3GBWA 3VBFB 3AP6A 4YVSC 5E1RA 2RMU3 2RS13 4FTEA 3EXUA 2YV8A 3M1HA 4ISRA 1AYM2 1QQP3 3ILNA 2EXHA 2B8MA 2ZGLA 4YZ2A 3D82A 1KFXL 4CP1A 1DQ2A 4QPGC 4E2GA 1CQ9A 1RUJ3 4GMP0 3DGTA 3GZTB 3VBOC 2ETEA 3G6JB 1R1ZA 4JGZB 1LECA 4PLNA 2RJLA 4XFIA 5C9AB 2CAUA 3GNEA 4Q4W1 3FHIB 4FP2A 2WSUA 3DN7A 1QJU2 2ZGOA 4D94A 1R093 4KU7A 4S2HA 4WVMB 3ZFEA 5I0SA 3WP3A 1ZRRA 4CP0A 5CFDA 3MPPG 4Q26A 4COYA 5C33A 1H8TC 5DUUA 1D0HA 3CNAA 4YNIA 1FPN3 1AJOA 5GJ6A 5JOWA 2RS11 5K8SA 2IXJA 4N43C 1EYBA 4NHLA 3AMQA 1QQP1 1PK6C 5CBLA 2DCTA 2K0GA 2PELA 4XFHA 3ALQA 2WNUC 3KCCA 3WY6A 3AZYA 3VZMA 1RUJ1 4YGCA 3AYDA 4QHBA 4RR3A 4FPKA 1CAVA 2A3XA 1UKGA 4AEJA 4MX3A 2CY6A 1YWKA 2HEYF 1PIV2 1YJLA 2CGOA 2WJSA 1AR81 4AYUA 4KQ7A 1O91A 4Z07A 1SACA 4GH4A 1R091 2BTVC 2CAVA 1OPOA 5GLZA 4CEWB 1LODA 5H9QA 1RUF3 5CAZA 3O5SA 3VBSB 1OD5A 3QCWA 1SLBA 3EQEA 3LAGA 4GB32 4S2GA 1RHI2 2XBO2 4AQ6A 2VMHA 3PLQA 2CGNA 3PMEA 4XETA 5JLVA 4UXAA 1H2NA 1QKQA 2ZPXA 3K51A 4XJ9A 2ET7A 4C1XA 1IS5A 3MIHA 1IKQA 5EJ3A 5BNOC 4YVSB 4LA2A 4ASLA 5LEJA 3CU7A 4CEYC 4IEPA 3GZUC 3VBHA 2C1FA 2VNOA 5T50A 1CAWB 2B9UA 4XJZA 4YM1A 4EN8B 4AFAA 1DYPA 1H2LA 1D2QA 2X53S 4DRVA 5GZGA 3UJOA 2WZR2 3OBRA 4YGDA 2BEOA 4QPGB 3A0KA 1H2MA 3FLRA 1MACA 3DPRC 1NZCA 3VBOB 5D8AA 4PJYA 3IDEA 4YVWC 4M3CA 4CDQA 2JENA 2K2SA 1BKZA 3QLQA 4C0BA 1SQ4A 4QGNA 2O8OA 1DG6A 1Q8SA 1YNAA 4LHNA 5CFCC 3PJQA 2BWAA 3L2YA 3O7OA 2P17A 1VBA3 1LENA 1OOPC 1PVC3 1V9U2 3VBUA 5JCTA 2R062 2LALA 3WDWA 3CEWA 3PMSA 4P9IA 4R9BA 5E16A 4JRLA 2IC1A 5JIUA 4AGRA 2ZX2A 2DF7A 4Y20B 4DNYA 4N43B 3AFKA 5CU1A 1S0DA 2XJVA 2JJ6A 3WQ1A 3ZVXA 3ZFGC 4FOWA 1PGSA 5H9PA 5CG8A 1MS9A 1APNA 2WNUB 1W6PB 1F31A 3J8F1 4BZ4A 1RL3A 3H8UA 4B4QA 2VVFA 4Y26A 5J48A 5CG9A 4XJUA 4YG3A 1QMJA 2PN5A 3OYWA 3PVOA 4I09A 4TSVA 1WUVA 1AF9A 2ZOEB 1W6OB 3HR9A 3RS6A 4HMZA 4SLIA 2PAMA 4OHVA 4XJWA 1WW6A 2RHPA 4B29A 4XF3A 4IEUA 2HYKA 4WZFA 1X50A 2VU9A 1S2BA 4EN9B 1QJY1 1OLQA 1VBA1 1PVC1 2D6OX 5KHJA 2ZMNA 3I7DA 1GLHA 2AH2A 1CONA 4AEMA 5GM0A 2B42B 3DKWA 2AUYA 4Q1RA 1HV1A 4AQ2A 5FOBB 4AK3A 3UK9A 5LK5A 4TZDA 2UY9A 4Q27A 1R1A2 1SLLA 3M3CA 2XLGA 1JBCA 1QU0A 2BNMA 2WFF2 1H9WA 2RE9A 3MEPA 4CEYB 4EV0A 2WNVB 2QJVA 1AR93 1NCRC 4KWJA 4Q4Y1 1QY4A 2ZCWA 1BK1A 1N1VA 3TN92 5L36A 1R082