2HWF1

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
283
structure length
283
Chain Sequence
NYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSIPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKLSVVITTHIYHKAKHTKAWCPRPPRAVPYTHSHVTNYMPETGDVTTAIVRRNTITTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
molecule tags Virus
total genus 36
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwf100
1C8NA 2X5IB 3ZFFB 1TME1 1AR63 1BEV3 1AL0G 5BNNB 4Q4X2 5ACA3 1V9U1 4WM8B 1ND2B 1MEC3 1R1A2 3VBHA 1FMD2 1QQP2 1RUD2 1RUI3 4RHV1 1QJX3 2HWF3 5BNOC 5AC92 4FSJA 2XBO1 4QPGB 1VBC3 1WCDJ 1F2NA 2VQ0A 1OHFA 4RS5B 2ZTNA 5D8AB 2R041 2X5IC 2DF7A 2RS32 1RHI2 3ZFFC 4GB31 5BNNC 1RUE1 1RUC2 4IV3B 1D4M1 4WM8C 1B35A 1FOD2 4N43B 3VBRB 1W39A 1PGW2 5L7OA 1NA1A 1ASJ1 5A32B 2WS91 1RUF3 2HWB2 4CEWA 2MEV2 4Q4Y1 3ZFGA 3IDEA 4QPGC 1BBT2 2R071 3JBG1 1B35B 2RMU3 1VRH1 1AL21 2HWD1 5A33B 4JGYA 3VBHC 4RS5C 1M06G 3DPRA 1TME2 2RM22 5D8AC 1NCQA 1AR61 4QPIA 2HWC2 5ACA1 2ZAHA 1C8M1 5DDJ3 4IV3C 4Q4V2 1MEC1 1VBA3 4N43C 3VBRC 1GFF2 5FOJB 1COV3 1RUI1 1QJX1 5ABJB 4IV1A 1AR83 1HQNA 4CDUB 2RS12 1ZBA3 1VBC1 1QJZA 5C8CB 4YVSA 1B35C 4GB32 1OPOA 5K0UB 4GMP3 1RUE2 1VBB2 1R083 1AR91 1D4M2 4CEWC 1PO23 4PDWA 2WLPA 1X33A 4GH4A 1AR71 1RVF3 1EV12 1RUF1 3M8LA 4CDUC 4CEYA 4PDWB 3TN93 2RMU1 5BNOA 5C8CC 1EAH3 1VBE2 4Y4YA 3HAGA 1HXS2 4N53B 4GH4B 1RUH2 5ACA2 5GKAC 1C8M2 5DDJ1 2R062 4EJRA 5BNPB 5K0UC 1R091 2X5IA 4CEYB 3ZFFA 1VBA1 1VAKA 4RQPB 1COV1 5BNNA 1QJX2 5JZGB 1Z7S2 1AR81 4WM8A 1ND2A 1VBD3 4FTEA 1ZBA1 2BFUS 1CJDA 1PVC2 1QJU2 4PDWC 5CFCA 1AUYA 1RMU3 4CDWA 4QPGA 2WFF3 4N53C 4GH4C 4GMP1 2WZR2 1AR92 4RS5A 1R081 5BNPC 5D8AA 1PGL1 4CEYC 5CFCB 1BMV1 4CDQB 3LOBA 3CJIB 4RQPC 3JD73 4Z92B 4CDWB 5JZGC 1AR72 1PO12 4IV3A 1RVF1 1RUF2 1RUG3 4N43A 3VBRA 3J8F2 5A32A 1EAH1 1NCRB 4Y5Z0 1FPN3 2RR13 4BCUA 4Q4W3 1HRI3 5DDJ2 1ND2C 1R092 1RUJ2 1PIV3 5A33A 4NWVA 4FTBA 2FZ2A 2PLV3 2HWE3 4AEDB 1HRV2 5CFCC 1DDLA 4CDQC 3CJIC 4CDWC 1VBD1 4Q4X3 4NWWA 5ABJA 1R1A3 1BEV1 1RMU1 4CDUA 1QQP3 1RUD3 1V9U2 3VBFB 2WFF1 5AC93 5C8CA 1A6CA 3VBUA 1NY71 4RHV2 1PGL2 2HWF1 4AEDC 1K5MA 4YVWA 2XBO2 3JD71 5CFDB 5K0UA 2RS33 1RHI3 1RUG1 5FMOS 1VB4A 3VBUB 1F8VA 2R042 1FOD3 1K5MB 4YVWB 5C4WA 1FPN1 2RR11 4Q4W1 3VBFC 4GMP0 1HRI1 2HWB3 1PIV1 2MEV3 1BBT3 2PLV1 2HWE1 4N53A 1ASJ2 5ABJC 2WS92 2IZWA 4Q4Y2 2RM23 5CFDC 2TBVA 5BNPA 5C4WB 2R072 3JBG2 2HWC3 1VRH2 1AL22 4Q4X1 2HWD2 4RQPA 3NAPA 3VBUC 3VDDB 5JZGA 4Q4V3 1R1A1 1BEV2 1AR62 1RUD1 5J98B 1K5MC 4YVWC 5AC91 2RS53 1MEC2 1MQTB 2RS13 1RUI2 3NAPB 2HWF2 2BFUL 1ZBE3 4JGZB 3JD72 1VBC2 2RS31 1RHI1 5C4WC 4GB33 4CDQA 1VBB3 1POV3 3VBOB 3CJIA 3VDDC 1FOD1 1OOPB 1PGW1 1AYN3 4CDXA 1H8TB 2RR12 3JB4C 4Q4W2 3ZFEA 1PO21 1EV13 2HWB1 1ND3B 2MEV1 2BUKA 1MQTC 1BBT1 3NAPC 1NCRA 2FZ1A 4CDXB 1QJY3 1VBE3 4JGZC 2BBVA 2RM21 1HXS3 2HWC1 1RUH3 2RMU2 4RR3A 3TN91 3ZFEB 4AEDA 1C8M3 2R063 1AYM3 1TMF3 3FBMA 2Y26A 4Q4V1 3VBOC 3VBSB 1OOPC 1H8TC 1E57A 1Z7S3 2RS51 1VBA2 4RR3B 2RS11 1COV2 1NOVA 1ND3C 1AR82 3VBHB 3VBFA 1PVC3 1QJU3 1ZBE1 1ZBA2 4CDXC 2GSYA 4RFT0 4FTSA 5LK7B 1IHMA 3ZFEC 2WZR3 1AR93 1VBB1 1POV1 1FMD3 5CFDA 5J96B 5C9AA 1AYN1 1NCRC 3VBSC 4LLFA 1RB8G 1R082 2QQPA 1AR73 1PO22 1PO13 2GH8A 1CD3G 1EV11 5FMOL 1BMV2 4RR3C 3JB8A 3J8F3 2ZZQA 3ZXAC 1RVF2 5C9AB 1NG0A 1QJY1 1VBE1 5L7OB 1NA1B 1HXS1 1RUC3 3TN92 1RUH1 4CEWB 3ZFGB 1EAH2 2R061 1R093 1RUJ3 1AYM1 1TMF1 4SBVA 4JGYB 1HRV3 3DPRB 1NCQB 1SMVA 1HX6A 1Z7S1 2RS52 4QPIB 3VDDA 4WM7A 1TME3 1PVC1 1ZBE2 1QJU1 1VBD2 5C9AC 1V9U3 4IV1B 1MQTA 5L7OC 1NA1C 4WM7B 3S6PA 2WZR1 1RMU2 4JGZA 3ZFGC 1FMD1 1QQP1 4RHV3 1AYN2 2WFF2 4YVSB 1VB2A 4JGYC 2XBO3 1NY72 3DPRC 3VBOA 1PO11 1NCQC 1X36A 4QPIC 1OOPA 1H8TA 3J8F1 2R043 1QJY2 1RUG2 2WWSA 1ND3A 4IV1C 1RUE3 1RUC1 1D4M3 1POV0 4WM7C 1RUJ1 1AYM2 1TMF2 5BNOB 1FPN2 1HRI2 1ASJ3 4YVSC 2BPA2 1HRV1 2WS93 1PIV2 2XPJA 4Q4Y3 2R073 3JBG3 2PLV2 2HWE2 3VBSA 1VRH3 1AL23 2HWD3
chains in the Genus database with same CATH superfamily
3MEPA 2OXBA 1OLMA 4PBPA 4XUOA 1F5FA 3AM2A 4WZFA 3ZSKA 1TME1 4IEPA 2R0FA 3B9CA 1AR63 3RI9A 4PF5A 1OSGA 3T2OA 2OZJA 5HXVA 4N7IA 5HCHA 2AZ5A 4OI1A 4LA2A 2JICA 1R1A2 3VBHA 1ZZ9A 1XNDA 4K8RB 1CAUA 1QQP2 5JWPA 2PAEA 1QJX3 2HWF3 2RG4A 4GKXA 4QDQA 4E4HA 4YZ1A 1D2QA 4UW6A 4AAXA 5AC92 3O0VA 4N9HA 1LOBA 4PIXA 4BJ0A 3BYWA 3O1UA 3RVHA 5EZWA 1WCDJ 3M3OA 1VAVA 5FY8A 1F2NA 1QNWA 1YQ5A 2GN7A 4META 3KM5A 4JV4A 1CAWA 4D3WA 3NNFA 1G9FA 4XFBA 3FLPA 2VU9A 5F5AA 3A0KA 2RS32 3POSA 4KL1A 4E2SA 4EWDA 4NIAA 1V70A 3I3DA 1H8VA 1Q8OA 2WAOA 4CRQA 4UF0B 5A6ZA 1SCRA 3SISA 2VR4A 4N43B 3VBRB 2OVUA 4AFDA 1W39A 3J9SA 4DFSA 1LR5A 3K75B 3L2HA 1JOBA 4KNCA 5AFBA 1QKQA 3AB0A 3ALQA 3BPSA 1LAJA 3KGLA 1UOJA 1GUIA 4DS0A 1ASJ1 4OHZA 1RUF3 4DY5A 4UI9L 4Y1XA 2VOVA 3T1LA 2XHNA 2VOTA 3AX4A 5DUWA 3JBG1 4A6SA 2RMU3 5FPXA 1WGPA 1NQJA 1VRH1 1DQ0A 2HWD1 2A6ZA 3WG3A 4ARXA 5FQ0A 1IPKA 1DP0A 4JRLA 4OHVA 1Y4WA 3OYWB 3ZSJA 1OLRA 5IHRA 3RZLA 2LW8A 3W58A 4QPIA 1X8MA 2CHHA 4URTA 2W52A 4XXAA 1YQ2A 5DXDA 5F9TA 3CMGA 3VKNA 4F7ZA 4OLLA 2ES3A 1XRUA 2ZHLA 4Q4V2 5LA0A 5GZDA 2LTNA 1VBA3 2E26A 2PMWB 2OPWA 4N43C 1GFF2 5B4XA 3VBRC 5FOJB 3AJYA 1QF3A 1RUI1 3CBNA 4OHWA 2NP0A 3EMRA 2I07B 2XJTA 2E31A 4F3JA 4BPZA 3GDBA 1HQNA 3ZM8A 2BNNA 2FDFA 3H1YA 2RS12 2WZ8A 4D0QA 3ACLA 4FPKA 4R9AA 2QQMA 5IAVA 1DYKA 1H30A 3PDQA 3S30A 5FUPA 4GKYA 5C6CA 4C1WA 5I8YA 2ZA9A 1VJ2A 1JHNA 4AHWA 5A3UA 1XC6A 5FRAA 1SQ4A 4MXWB 4PLMA 3ZN6A 2A5ZA 4HSLA 5BV6A 4KWLA 3RG0A 2FBEA 1N3PA 3RJ2X 1SDWA 2JDPA 2VNRA 1AR91 3A7QA 4PDWA 1LOFC 4XAAA 5DN2A 5FYIA 1JUHA 2MPFA 3GZAA 1QMJA 3H3UA 4OFGA 3EHKA 1QEXA 3CKHA 4CP9A 3HEIA 1RVF3 2DCYA 3I3QA 2VUDA 5FYZA 4QHZA 4DPNA 5CEHA 3N3HA 3VN4A 3TN93 3EQEA 5BNOA 2JE9A 3FHAA 5KR7A 3E6BA 1EAH3 3LAGA 3RMYA 4MO3M 1W6QB 1MS1A 1S2BA 2ATFA 4XTPA 3FMGA 3SKJE 1NZCA 1RUH2 4KBZA 1C8M2 1MACA 5EXOA 4YW2A 4YGCA 2BBAA 3PMSA 5BNPB 4QKDA 3SEPA 1MZ6A 3HNBM 4OULA 2IWGB 3C3VA 1YQ6A 3N9MA 4LHNA 1ENRA 4LJHA 5A3LA 2O14A 1COV1 2W1SA 2CSGA 1QJX2 3KB5A 3KCYA 4J1XA 4XQWA 5GLVA 3GCXA 3M3QA 4ONUA 5F3EA 5FP9A 3ZR5A 5BYNA 1AR81 1VR3A 4FPHA 4ISQA 1ND2A 1KITA 1VBD3 1ZRRA 3BGAA 1CX1A 5L9BA 1ZBA1 3RI8A 4GWIA 4GALA 2DU0A 1ONAA 1NLSA 4Q1RA 3HT2A 2CWMA 5CAZA 4CP2A 2Y38A 1MS8A 1YI9A 4XTMA 4QPGA 4YM2A 2J1SA 2WFF3 2XWBB 4K1YA 4B4RA 3HN3A 4GMP1 4BQWA 2YYOA 1JYXA 4RS5A 1R081 2OPKA 3RYRA 5GLUA 3R05A 5BNPC 4Z82A 2ARAA 2Y0OA 4XF3A 4Y20B 3MICA 1H1MA 4W6YA 5A3OA 2YC0A 3Q8CA 3I2JA 2J1TA 3PLQA 3JD73 3J26N 4YM0A 5FYMA 5T50A 3U10A 4CDWB 3TEZA 3BB6A 3W5MA 3D3AA 4IV3A 1RUF2 2IXJA 3K4DA 4Q2FA 4MX3A 4YRDA 3V64A 4QB2A 3VD9A 3VHPA 2Q5TA 2O8OA 3U14A 5A32A 5K9YA 4V2WA 1WBFA 1CIYA 3BVCA 2B7YA 3OBAA 3WNOA 4ARYA 4BCUA 4Q4W3 1ALYA 3Q9OA 1UIKA 2ZGTA 2A6WA 3MBWA 1JTZX 1DQ6A 5A33A 1RIRA 1E5SA 3ZXDA 3SEEA 3MIFA 3I59B 1WD4A 4UBGA 1PM4A 2DVBA 4XDOA 3ZPYA 4RL7A 4WVWA 4FTBA 4AEDB 4AHYA 3H0OA 1HRV2 3VD4A 2DCJA 1LOGA 1ZX5A 3AC0A 3CLPA 4LBJA 4CDWC 1KD7A 1A78A 4M00A 4XHBA 3LA2A 4UFLA 3S5QA 5A7NA 4OVEA 1BEV1 4FPYA 2Q8CA 1W05A 1ACCA 2DVGA 2WO7A 3VL8A 3PVBB 1FAYA 3I2FA 3JU9A 1K45A 1YYNA 2PTMA 1H0BA 3ACHA 2ZGSA 3AZZA 1XBFA 1NY71 1Q43A 1PGL2 2WO3A 2J1RA 3UL2A 1LHUA 5KHGA 1Z0HA 1OUSA 3PNAA 2XMLA 4HK8A 4LBQB 4F8AA 4AEDC 2D6OX 3VZKA 3HQUA 5K0UA 2SBAA 2Z5WA 1QDCA 1TQ5A 3HQXA 1WMFA 1G9DA 2ZCWA 1UU5A 5FMOS 3URFA 4KWKA 3HBZA 3VBUB 2VMHA 1F8VA 1JHJA 4BH9A 1OQ1A 4M4PA 1FOD3 3GYDA 3K48A 3KQRA 3RZZA 3DECA 2K0GA 1UMIA 2VO5A 2YY1A 1JZ7A 3N4MA 4YVWB 1C1LA 3MGUA 3LFMA 1H4GA 5F39A 1FPN1 2RR11 2Q1ZB 5C4WA 4QXCA 4BQ5A 5BNQA 4N9IA 1MS3A 1V0AA 2D3RA 4Z07A 2YU2A 2ZGKA 4UFKA 4TLGA 3HBKA 2HWB3 4ORFA 1ULGA 5CBLA 4QHOA 4GXLA 4LUMA 2PLV1 1QGLA 3H8UA 1BLZA 5ABJC 1ASJ2 1GQGA 2K46A 3EXUA 5A7WB 4ZS3A 3O1PA 2RM23 4XCBA 3UKVA 1S0DA 2ZEZA 3AMMA 3JBG2 1KGYA 4YG6A 2HWC3 1NAEA 4DXTA 1VRH2 2HWD2 3HR9A 4NR1A 3DUIA 1HW5A 3VBUC 2P4EA 3AYDA 3WY6A 3BPZA 1X9PA 2GZWA 2XKOA 5FO7B 4S2GA 1RGSA 4MGQA 4SLIA 4PT6A 3WX5A 4YVWC 5E6HA 1S0CA 5IVYA 1DGLA 4CCKA 1FV3A 1GWMA 2ZBJA 5FXZA 1ST8A 4TXWA 4YG3A 1YC61 3KF5A 3I4IA 1IPSA 1RUI2 3THTA 2OS2A 3A4UA 3KGZA 4BIOA 3GCWA 1WD3A 3I2OA 1WMDA 3JD72 3KZ4C 3BOWA 5LY2A 4X8PA 3WINE 2GP5A 3NNJA 2RDRA 3UYJA 4GB33 3JQXA 4AE2A 5C7GA 2W2IA 4OI4A 1BQPA 3WXPA 1LGNA 3U07A 5KC5A 5FKCA 4QQLA 2C9AA 3CJIA 3MO4A 2XJPA 1C3HA 4KWUA 2R30A 3SNMA 3VKLA 4CDXA 1G8WA 1H8TB 5IFTA 4UFIA 3DGTA 3EBRA 3JB4C 4Q4W2 2I2SA 5FZ6A 5I0UA 2W46A 4O7XA 2GDFA 5FZ0A 1Q5OA 4TN7A 1ND3B 3MLJA 1BBT1 1NCRA 2PHDA 1OQDA 1DGWX 4FPFA 5JVVA 1A8MA 1QJY3 3PUIA 4JVAA 3WNXA 1OF3A 2YHJA 4MSVA 2ZJCA 4G4FA 4LBQD 5FPAA 2G19A 5DMYA 1U5XA 2BRTA 1PK6B 4JKLA 1XYNA 2R063 1GICA 2GC0A 2XG3A 1CPMA 3OGJA 1WA4A 4ITCA 1TMF3 1AZDA 1I5PA 2GMMA 2PN5A 3ES1A 3F2ZA 4LITA 4C1XA 4XBNA 1TEIA 4M01A 1HLCA 2KR2A 5LATA 3N36A 3SCHA 1W2OA 1GNHA 1H8TC 3S0MA 2KD7A 4DINB 5JSPA 1ENQA 3LA3A 1Z7S3 3U75A 5IK5A 2B5HA 2VOXA 1DCSA 4RR3B 2YC2A 2WLQA 3WP6A 2CL2A 1COV2 1NXMA 2OW4A 5I0DA 3N9QA 3RWNA 1ND3C 1IG0A 1GZCA 1UMZA 3DV8A 1AR82 3VBFA 1W0OA 2NMNA 1C5IA 4BXSV 2FDJA 5J3UA 5JXIA 1ZBA2 3RFRA 2ZS6B 4RFT0 5DUVA 5HBAA 1AX2A 4JTOA 3WP4A 1PK6C 3DEMA 3ZN5A 1GANA 1POV1 1Q8SA 1SLCA 4IEYA 2W9XA 5H9SA 1FMD3 2OT7A 5J96B 2Z79A 3VHOA 5C9AA 2CY6A 1PMIA 1UMHA 4P9LA 4QDSA 4QKBA 1GP5A 4FQZA 1R082 4OZOA 1AR73 1PO22 2GH8A 4E2QA 3QD6A 1RTVA 4EE2A 1CD3G 1EV11 1S0JA 2BWAA 5CG9A 1EUUA 4LEJA 4RR3C 3SXWA 4E8DA 1M4WA 1OXCA 3J8F3 4UFMA 3ZXFA 1T2XA 4YFWA 4B4QA 4YARA 1VBE1 1NA1B 3CL1A 1DGRA 5DZEA 1KDKA 1HXS1 4XAEA 2PELA 1FV2A 3W20A 2OKXA 4P5HA 3NQHA 4CEWB 4CCOA 5EWSA 1R093 1RUJ3 3AK0A 2BJSA 4PLOA 3GBFA 3WDYA 1WCUA 3ZN4A 1O3TA 2WO1A 5AVPA 1W6NB 4IEWA 4YW4A 3CU7A 1WKYA 2XLAA 1UZWA 2LM3A 5EP9A 2WSUA 1RUNA 1NCQB 3VDDA 1J3QA 4LIUA 3WVJA 2R0HA 4WM7A 1GMMA 1QJEA 4Q0QA 4CUCA 1MVQA 5FLIA 5LW9A 4OYUA 1UX6A 3WDWA 3ZOIA 3SH5A 3AYEA 2D93A 4BOWA 1T6BX 2GAUA 1QJU1 3OGVA 5EQUA 3VD3A 3WEZA 3FJSA 1V9U3 4AVAA 1HB4A 1NA1C 5L73A 1GQPA 2NQYA 2VCCA 3S6PA 1U5IA 2WZR1 1K3IA 1W6OA 3WD5A 4FFFA 3ATGA 4P02B 1PZ7A 1QQP1 1V6KA 3OY8B 2D43A 4ATFA 3L2YA 5A3WA 4COZA 5JPMB 4JHZA 3TB0A 4EWEA 2BERA 1MS5A 3I2KA 1SEFA 2SLIA 2XBO3 4BLJA 2JDMA 1NY72 4P5YA 4NPMA 1PO11 1NCQC 3PHMA 1X36A 3K46A 3U4XA 5J09A 3HVDA 1JYWA 4JDOA 5IVVA 1WCKA 3LIGA 5JPNB 1BHGA 2BGPA 2IXKA 1YJKA 4W8JA 4DZGA 4ZXKA 4WZCA 4BMBA 2D5FA 1QJY2 3KHCA 4Y1YA 1YCIA 3O5SA 4FP2A 4TTGA 3IN9A 3AP4A 5CKMA 3VDBA 1D4M3 2F4PA 2P3KA 2WWUA 1CZVA 5FBJA 4XACA 4M0HA 1JYTA 3T2TA 1W2UA 1TMF2 3E5XA 3VZMA 1FPN2 3ES4A 4EN6B 4GIQA 1HB1A 3SCGA 3AZXA 2DURA 4Z1VA 4DIQA 2XPJA 4Q4Y3 5BPXA 2R073 1GP4A 2PLV2 5FMBA 1AL23 2VTXJ 3ETQA 2JENA 4MHUA 1ZRIA 1NUKA 1ZVFA 4AI9A 3ZFFB 2VGDA 3MZHA 4XJWA 4AYUA 2JDHA 1YNAA 2QQNA 4CCDA 4E2GA 1O8SA 1OD3A 1C1FA 2R6QA 4RGGA 2HEYF 3UNPA 2JG9B 1S0FA 3TEXA 1X50A 4WM8B 4LHLA 5F37A 2BNOA 5IVEA 4M3CB 1LU1A 1C28A 1MEC3 1J1TA 1DGWA 2WSVA 2YPDA 4L8QA 3V0BA 3LEGA 3V56A 3POBA 1ZA7A 4M3CF 1FMD2 1JYVA 2A7AA 3ITQA 1YI7A 2AR6A 4PI2A 4LOSA 3KWVA 3OF1A 3SITA 3WG4A 4FSJA 2W94A 1OMIA 3B9IA 3T2PA 4H7LA 1V6LA 4YW5A 1BYHA 5E16A 4E8CA 1UPIA 1J1LA 3NRUA 4PLNA 1OHFA 5DAVA 2VXJA 4CPBA 4OQ8A 5DABA 2KXLA 3RZJA 3I2DA 3HMYA 2JKXA 2Q1FA 5D8AB 5BXXA 4DEVA 4XQDA 4W50A 3RQ0A 2YBSA 3ZFFC 2VZ1A 2QDNA 4IESA 4LBNA 3H9AA 4HANA 2JG9C 4GZ9A 3NL1A 4JKKA 4WM8C 3KLSA 4FVVA 3OPZA 2QZ3A 2HEWF 3MI8A 2UYBA 1JI6A 4NPLA 4AI0A 1CZSA 5D2AA 4K21A 2J42A 3CF6E 1PHMA 3Q8EA 4YYOA 3SKVA 2P17A 2AYHA 2XKPA 3ZFGA 1AXYA 3IDEA 5FY1A 1BBT2 2EIDA 5ISLA 4R4XA 4IEUA 3KSCA 4TZDA 4BK5A 3LEKA 4LPLA 2G9ZA 3LEMA 5CNAA 4PI0A 5IVFA 2B46X 2VM9A 3WF1A 3ZXJA 2CDOA 5D8AC 5C3QA 2P3JA 1AR61 4KWJA 4KMQA 5FLJA 3VKMA 4XFCA 5CISA 1C8M1 3MYXA 4IEZA 2YV8A 2BV4A 3AP9A 4MZUA 1CN1A 2JDYA 4HBNA 4RSUA 5JIAA 4NHLA 4A4AA 1GZWB 1PZ8A 2PAKA 1QJX1 2ZMNA 4AQ6A 4LKDA 3WZ1A 3M70A 4KI5M 1N1TA 4QGLA 1SDDB 4Z2AA 2Y33A 5IK7A 1QNYA 4IQPA 5C8CB 3S57A 2CGPA 2Y8KA 4QWNA 2XJVA 4DUWA 4NPRA 2HBTA 3OD0A 3WHUA 4M4RA 4BA6A 2Q8EA 3BTYA 4LR4A 1D4M2 2O1QA 2VVFA 4W6WA 1OT5A 4LE4A 3SC7X 2VUCA 2J1EA 2Y6LA 3GHNA 3KV6A 2RVAA 3POJA 5FZKA 4BE3A 3Q8AA 3OUIA 1VAMA 5FP7A 1N1YA 2VOKA 1QOSA 1HKDA 2VMCA 2V5DA 1LESA 1U12A 4W6XA 3WQ1A 1EV12 4NIDA 1RUF1 4URAA 1FNYA 3Q8BA 5CZKA 4XZPA 5FYTA 4QMAA 4TSVA 5FZEA 4XF4A 2Y6GA 1QDOA 2RMU1 3ILNA 1DZTA 2PQQA 4DXRA 5C8CC 4A45A 3V0AA 1VBE2 3R4SA 1UF2C 2JDKA 4NAMA 4PIZA 4Q5OA 1HXS2 4Y4YA 1V00A 2VECA 1EPWA 2XB6C 4N53B 1UY1A 1YIFA 2VW1A 5G04L 3GJBA 2IXLA 1O8PA 1DQ4A 4AI2A 1BVVA 4H2AA 5KXBA 1WMEA 2BU9A 4QX7A 4GWMA 1GKBA 2X5IA 1VPHA 1H9WA 1VBA1 4OZXA 5KWRA 1IZ3A 2WDBA 2WIIB 3VUOA 3MIGA 4QPWA 2PHTA 2B4KA 3E6CC 1SLTA 3IZOA 4NHKA 4TYSA 4QGNA 1E5RA 1U5ZA 3MIBA 4Q8LA 4BZ4A 2VOWA 3K51A 2QVSB 4QX1A 4XJUA 4IETA 4XUPA 1NYWA 4Y20A 2VZPA 5LRRA 1QJU2 4NUBA 2WNVB 1AUYA 3AXEA 3O1VA 1RMU3 3FLTA 3KCXA 3T30A 4XILA 4IERA 4CDWA 5A3NA 2WJSA 5LY1A 3IPVB 3CHXA 4N53C 2AENA 3SLIA 2D40A 1PGSA 1UX7A 1UYPA 2WZR2 4ZZ8A 4LKSA 2QBXA 5SV8A 3AMQA 1PGL1 3NKGA 5JOYA 5CFCB 4AG4A 3T1MA 4CDQB 3AFGA 4AVCA 5JOXA 5GALA 4N8MA 1PO12 1SLIA 1RVF1 1SCSA 1W6MB 4P9GA 2YDEA 3GALA 3HJRA 5FXVA 4B3NA 4XUNA 4YZ4A 3ZXEA 4I0BA 4JQTA 5FZOB 2ZEWA 4JKMA 5HV0A 2P2KA 3WDXA 1EAH1 3GF6A 2YBKA 2WNVC 3OTFA 1HN1A 2XH6A 4XHXA 3KHBA 3POIA 3UETA 4ZZ5A 2QQVA 2NMOA 4AFBA 3WNLA 1G9AA 4NE9A 4OI0A 1LCLA 4QU1A 5CADA 1HDKA 4BQ2A 2FZ2A 2Y64A 1W6PA 1XYPA 4P9WA 5CFCC 3LDKA 1DDLA 4CDQC 5GLWA 3I49A 4LKEA 3AVSA 1O3SA 1Y7BA 1VMJA 1VBD1 4B29A 4HZFA 4Q4X3 2AGSA 2JG8A 5DG1A 5A3PA 4IE5A 4D7YA 5ABJA 4MGKE 3JCIA 3VD5A 2VBDA 3PL0A 4AHXA 5I8TA 2XONA 4CDUA 1RUD3 3LE0A 2WN2A 3INAA 2WFF1 4ISRA 4X8NA 3VBUA 1S4CA 3MLKA 3T0BA 4FOVA 1RJ8A 2ZXQA 3FHQA 4XUQA 2YROA 2HYKA 4UFHA 2PFWA 4XDPA 4FPEA 3I8TA 3LD8A 2AEZA 4GQ7A 4YVWA 2BOIA 3JD71 4FCAA 5CFDB 1UNBA 2IXHA 2NM1A 1RHI3 3D6EA 1WBLA 2ZGQA 4QXKA 4EN7B 1MVEA 4YW3A 4LE3A 4AI1A 4FAGA 4D6SA 1T6GC 1UZZA 4IW3A 4QX8A 2DWRA 1V6OA 4AI3A 4QGMA 1GNYA 1K5MB 1RC6A 3ASIA 2YB7A 1W8WA 4GAZA 1GWKA 1JZ4A 2PHWA 3ORJA 2WQ8A 1OI6A 1GR3A 4Q4W1 1GU3A 5FTTC 3WG2A 1LHNA 2GNMA 5HCAA 3P5BA 3O1RA 5B4NA 5FPZA 4P9YA 4BB3A 2MEV3 3NV4A 5T52A 3ZVXA 4XW3A 1SLLA 3SQOA 3IT8A 1OA3A 3FL7A 4B7EA 4D69A 3GJAA 1ULPA 4UXAA 2XVLA 3THCA 3K4ZA 4FPCA 2IZWA 4LTAA 4CUBA 1LEDA 1J58A 1QJFA 2JDNA 3EO6A 5CFDC 2BTVC 2D3SA 1W9FA 3MF9A 3NVCA 2V09A 1J3PA 2FCVA 3PVEA 4HFSA 2AH2A 4QQPA 5FUNA 4KU7A 1TNFA 1W99A 3IAQA 5JOZA 1LU2A 2DCKA 4RQPA 5SV5A 3NJZA 2OYZA 5JZGA 2D6MA 2R7EB 2XJRA 1GZTA 1X8EA 4R9CA 3WNMA 1AR62 1UXXX 4CXYA 3LDBA 5J98B 1K5MC 1UKRA 2VMFA 1CZTA 5ERLA 5FZMA 2EIBA 2EALA 4Q8KA 2RS53 1NE6A 1SBDA 3K3NA 1NQDA 1KJRA 1MQTB 5J37A 1MPXA 1WW4A 3NAPB 5FAXA 2HWF2 4OMDA 4J6GA 5KHJA 3DYOA 1LB2A 1AX1A 2NLRA 3T08A 1ZBE3 4JGZB 3ZIXA 2GP3A 5FZ4A 3NO8A 2RE9A 3VKOA 1NLRA 2JD9A 2E53A 1ULOA 1XSQA 3NKTA 3E5UA 2VZTA 3A21A 2ZHMA 3H50A 3H7JA 4IEXA 2XWJB 4HPKA 3E97A 1VBB3 5A6QA 3VBOB 4PJYA 2ERFA 1AJOA 1FOD1 3FC0A 5E1RA 4LT5A 2XUMA 1OOPB 1PGW1 1AYN3 2CGOA 2B39A 5T5OA 4A7ZA 4CP0A 1YO8A 5GZCA 2F6BA 3HNYM 1MZEA 1Q8PA 3ZSLA 5L19A 1GV9A 4FXGB 4KBBA 1H4HA 1PO21 4ZHNA 2HWB1 2X05A 3CJXA 5FK7A 5FWJA 1ULFA 2BUKA 1MQTC 2ZGPA 3NAPC 4D6QA 4ZU7A 4DUXA 3VZNA 4HG6B 5FBZA 1NLQA 2B45X 2OUJA 4YW7A 1CAVA 4JGZC 2B42B 2RM21 4LO5B 2A6XA 4XVHA 5JR7B 3ZKUA 1LGCA 2ET1A 3EB7A 2HWC1 2RMU2 4RR3A 1FI2A 4QX2A 1SBFA 1IS4A 1OLME 2ET7A 4R4ZA 3FBMA 3VBOC 2Y26A 5K7PA 3VBSB 2DV9A 1WW6A 4XURA 2GC3A 1UY0A 1LTEA 3K3OA 2V5YA 1OOPC 4IDZA 3WF3A 5F3CA 5BUVA 2UYAA 1E5IA 4X6RB 2WWJA 2FD8A 3M3EA 4WVMA 2WINB 1VBA2 4FQ4A 4UFJA 3J7LA 3N9OA 5FYYA 3H8RA 1V6IA 2C9KA 1WLWA 4EYUA 3NV1A 2BP6A 4NIGA 1RYYA 3O1OA 3VBHB 1PVC3 3BTXA 1CAUB 3QH6A 3BIWE 4NO4A 1VE0A 2AACA 3BU7A 5FYCA 4ZU5A 3TNPB 4FTSA 1IHMA 5FMCA 1DZRA 5I0SA 4O65A 1N3QA 2IVJA 1AR93 1RXFA 3HWJA 4L2NA 1R64A 3WT3A 1HB2A 3HPNA 4PIYA 2OX0A 1KQRA 3VZOA 5JIUA 4NHXA 1CAWB 3MLLA 3VBSC 2TNFA 4W4ZA 1J3RA 4IEOA 4LLFA 3OGGA 1I6XA 2A73B 2VNOA 1YFUA 3T09A 2X10A 1SBEA 3KQ4B 3S7EA 2W1QA 5FUIA 4DQAA 1EP0A 4QD2A 3DXUA 4TWTA 4YNIA 5FK8A 1WA6X 4ASLA 4RYDA 3G7DA 3ZXAC 4EN9B 1W6NA 1RVF2 5A7PA 3KT1A 4CZSA 1ZRFA 1QJY1 2BVBA 2ZKLA 1FX5A 3B69A 3RSJA 4B7KA 5EIYB 2C6SA 5C70A 5F32A 1RUC3 3TN92 4OHYA 5AFEA 5J48A 2WNEA 3B94A 1EAH2 2R061 1AXZA 4S2DA 5GM0A 1KFUL 3HN1A 1TMF1 1KRIA 1IOAA 1BVP1 2AUYA 1J83A 1UL9A 4QQHA 2XL7A 5FQ0B 1OC1A 3KMHA 2ILMA 2VVDA 3OG2A 3I2GA 1Y9QA 4HKWA 1Z7S1 2RS52 3H1MA 2IFWA 3CO2A 2QUOA 4QPIB 5F5CA 3WDUA 3VZLA 2Y6JA 3PIJA 1EUTA 5FYVA 4A41A 1XNKA 5IVJA 4JDNA 1US2A 2WL1A 2DVAA 4CU6A 1JUIA 3LGRA 5A3TA 1JU3A 3WF2A 1ZBE2 3T2QA 1G9BA 1VBD2 2P6CA 2W1UA 4MLOA 5FPVA 1W3VA 1VALA 3VHNA 2C4XA 5A3MA 5FZFA 1HJGA 3ZSEA 4R9BA 5FMDA 3AP5A 1MS0A 4B4PA 1FMD1 4RHV3 5FPLA 1AYN2 3ZXLA 2WFF2 5F6LB 3POWA 5B2GB 4NJ4A 3RWKX 4O61A 1O91A 4OQ9A 3D0JA 3ZN6B 2EXKA 1UPSA 4DUVA 2RJLA 4QPIC 2VMDA 1GSLA 4NAOA 4DEQA 5F2SA 5JMCA 3J8F1 4CVUA 2VQAA 2LRPA 2R043 4YW6A 3FZ3A 2DFCA 2E6VA 2JDZA 3C7OA 5J1XA 5FXXA 2WWSA 3PU8A 5CYYA 4CP9B 2YXSA 1W9SA 1TNRA 1RUE3 2CYFA 4HN0A 2XQRA 1UCXA 3CNAA 3VL9A 4YSFA 4Q27A 5JOWA 1RUJ1 1RITA 1UY4A 2BNMA 5T5LA 5TSWA 4AQ2A 5HCBA 1YHFA 2XUEA 3ELNA 4GULA 1APNA 4CP1A 5BNOB 2W08A 3SH3A 1BZWA 4MGYE 4XIKA 2WS93 2JG9A 5C3PA 3AKSA 4D8MA 1PVXA 2IFRA 4M3CA 5ANQA 5T54A 1GLHA 1FATA 3KD4A 2RHPA 4R8HA 4JHTA 2P6HA 1C8NA 2DVDA 1OFSA 5FY4A 3PJQA 4HMZA 4MH0E 4HXCA 3IIAA 3IAPA 3ST7A 1W2TA 2QNKA 4BQ1A 1BEV3 3ENRA 1AL0G 5BNNB 5ACA3 1V9U1 3ZYFA 2IXCA 1O59A 1JZ5A 1ULCA 4CUAA 1UU4A 1VP6A 2WZEA 1ND2B 1O5LA 2ZPXA 3OOXA 2DCTA 5CKQA 3WUDA 2JIGA 2FDIA 1JMUB 2ARCA 1CONA 1SPPA 1VLNA 3LSDA 4CU7A 4V2VA 3O14A 3J7NA 2G4IA 1AXKA 5FXWA 5BNOC 2QQUA 3A0NA 3IIIA 3N9NA 5C3RA 4QQ2A 4BQYA 4CYDA 2GN3A 2XBO1 4QPGB 5EJ1B 1DBNA 1VBC3 2CGNA 2ZX0A 1XE0A 3WUCA 4ET7A 4BYYA 5C5UA 2N7GA 2WT1A 4RS5B 1D7PM 1OURA 4AFAA 3AJZA 2ZTNA 4RD7A 2VTFA 2DF7A 1O4YA 2QQOA 3MPBA 4LQRA 2EXHA 3E5QA 2ORZA 3N7KA 1RINA 5BNNC 1RUOA 4FXKB 3ABZA 3TBDA 1RUC2 3HT1A 4IV3B 1H2LA 1D4M1 3WDTA 1FOD2 4BDVB 3N35A 1PGW2 3PURA 4Y24A 2Z42A 3GZUC 4QX5A 5DZGA 1CAXA 3USUB 5L7OA 4QM8A 4U2AA 5LEJA 1BCXA 3VKFC 3ZLIA 5A32B 3LIHA 2ZMLA 2HWB2 1W06A 3D4KA 4Q4Y1 4BMEA 2C24A 4JAAA 4QPGC 5JMOA 2R071 1B35B 1WW7A 3WHTA 3ZKYA 4CCEA 5F6KA 5FJHA 1AL21 5A33B 4DRRA 4JGYA 1U5YA 4U36A 4K8FA 4RS5C 4FAHA 1M06G 1FXZA 3BOPA 3DPRA 2RM22 4M0NA 1HV0A 3KVBA 2XJQA 4FPOB 2HWC2 3POGA 5LBCA 1XNAA 2O8QA 4MGSA 5DDJ3 3O12A 4A3XA 2VPVA 2ZACA 3AYCA 4IV3C 4V1PA 2WNUA 1MEC1 2HBUA 3D5OA 4XMIA 3N9PA 3CEWA 4LO6B 4Y4RA 3WW2A 5CVRA 1L7RA 3MIDA 4IV1A 1K5JA 4I3PA 1F4AA 2DUQA 4QAWA 1LJ7A 1W8FA 3C7EA 4Q0UA 2VZRA 4Q29A 3ZYBA 3V65A 1EYBA 1UYZA 2OUHA 5F3GA 4LHKA 3IB3A 3ZDSA 3P3NA 4EQVA 4INDA 1Z78A 1B35C 4YVSA 1OVPA 4C0HA 4IE6A 3OSDA 2OQ6A 1OFNA 4Q1PA 4QX0A 4UWDA 4A6OA 4NMIA 4D94A 5FZAA 1Q56A 1WCQA 1JZ2A 4AGGA 2KA3A 3MFAA 4GB32 3ZDVA 5CG8A 5EJZB 3MUY1 4I09A 3WQ0A 5M0TA 2ADDA 5K0UB 1RUE2 5IUQA 5GZFA 3O0XA 4CEWC 1UN1A 5FY0A 4FFIA 2JB8A 3DF0A 4XFFA 5IAXA 4JZRA 3CDZB 4IGQA 1S55A 1X33A 3I7DA 2VCBA 3M8LA 1XNBA 4LLOA 4Q0VA 1GZ9A 2IUWA 3RNSA 3WP5A 5LZ6A 4XEZA 1US3A 5FOBB 5EYXA 1QH6A 2XJSA 3IKWA 4XUTA 5FZLA 2PA7A 3ETPA 1W8TA 2WYFA 3UJOA 4ASKA 4HKLA 3ZO0B 4GH4B 1CESA 5IW0A 3T3YA 5ACA2 5GKAC 2H0BA 1N3OA 3ILRA 3KCCA 1GYKA 1YEWA 3MV01 2R062 4EJRA 1PMHX 5LA9A 5K0UC 4Y5SA 5FY7A 3S5AA 4CEYB 2JECA 3LFIA 4WV8A 3ROUA 4QXBA 3NWKA 1ZRDA 3FX3A 3IDBB 1UOGA 4CCNA 1QY4A 2UWAA 4LXLA 3USSA 1WLDA 3NJXA 5K4LA 2DDUA 1QIQA 1Z7S2 5F5IA 3RZKA 4IEQA 1W04A 2A3XA 2HEVF 4AOCA 4BQ3A 3OUHA 3OGRA 4C0BA 1GOFA 2W68A 1LHWA 3LWCA 2YU1A 3AMNA 4OUSA 1VIWB 2J1AA 2OIIA 1ZNPA 1CJDA 2XXZA 1KDMA 4XXPA 2VNGA 1YFWA 5CFCA 5JXJA 5EHDA 5FJKA 2AEYA 1PX3A 3IMMA 1FYUA 3SCFA 1YQ8A 4EZHA 1SLAA 3NW4A 4GH4C 1IS5A 4AFCA 1AHSA 2ARBA 1F15A 2VE1A 3NV2A 4XJ9A 3AKPA 5FZOA 4CEYC 3PJYA 3KF3A 3H8OA 1BMV1 1W9WA 3TWIA 4MG2A 3LOBA 4DXZA 3CJIB 2V4VA 5GJ6A 1AR72 4UF0A 5FZIA 4A44A 2QTWB 1RUG3 1PNGA 2F17A 4N43A 3VBRA 5I91A 2ZX2A 3C8XA 3B3QE 4IGPA 3RGBA 3J8F2 1V6NA 2ZAAA 1W0PA 2K2SA 2ZHNA 3TOJA 5GZEA 3QACA 1F35A 1Y43B 3IDAA 4MVTA 1NCRB 4HVOA 5FZ9A 3MIEA 3AMPA 1K12A 4B1MA 2W1WA 4FFHA 2VCAA 3HOBA 1HRI3 2X29A 3BI3A 5DDJ2 1R092 1RUJ2 1PIV3 2RV9A 5DAXA 1N1VA 3E1F1 3DYPA 4NWVA 5D1IA 4CE8A 2QCSB 3OYWA 4KGGA 5LRSA 2HWE3 3OB8A 2QQKA 4XMAA 1BXHA 2W87A 1H1AA 2WUHA 4UAPA 3CJIC 5LBBA 1LOFA 2D6LX 2BGOA 2PAMA 4QKFA 3M3CA 1KS5A 4YZ2A 3QOPA 1IG3A 1O7FA 4I30A 3UV9A 2DUPA 1R1A3 5HXMA 2XDVA 1RMU1 1HN0A 1W8HA 1QQP3 1V9U2 2JE8A 1F31A 5FYSA 4E27A 2DCZA 3AYAA 4YW1A 2ZZJA 3VBFB 3ZXKA 2CNAA 2XLGA 1GOGA 4YGEA 3UGHA 4EZ4A 5AC93 1A6CA 4MOAA 3ACFA 1SACA 4EN8B 3BN6A 1YQCA 2BGCA 2QQWA 2W92A 5KHHA 2HWF1 5CB7A 2PHFA 3KV5A 4MXWA 3OBZA 3O1TA 2OQ7A 2ZMKA 3DYMA 4HVRA 1K5MA 2D7FA 2XBO2 3U11A 5AVAA 3O1MA 2ZX4A 2RS33 2LALA 3NJYA 4COUA 1VB4A 1NE4A 2QQLA 2BEOA 2R1DA 2WQZC 2BVVA 1NKGA 3MIHA 4IL7A 4C91A 4HK9A 3VGIA 3P1IA 1UZYA 4LA3A 4NRMA 5EFUA 5IATA 4FOWA 3TEYA 2CTVA 4HETA 4JC1A 3AZVA 4L99A 3AKTA 1LHVA 1UYYA 3AFKA 4RFRB 3VBFC 3UGFA 2J22A 4GMP0 3VZJA 4R52A 1L7LA 5EPAA 2RDSA 1W6QA 1L3JA 1IKPA 3J7MA 4L11A 2D3PA 2PXJA 2W0XA 4P9JA 4DOUA 1YJLA 1DHKB 2VZUA 4E4SA 5JDBA 3MW4A 3DCQA 4Q4Y2 3PTRB 2VZ3A 5BNPA 1OUXA 2R072 5JSRA 1W8OA 1ZM1A 1AL22 4Q4X1 2A3YA 3QBQA 1PZ9A 3VDDB 3NAPA 2VBBA 4H55A 4QQOA 5FREA 4CXWA 4P14A 4Q4V3 1NXD1 4P00B 5FYUA 5HPOA 3M3IA 5FKBA 1CQ9A 5JXGA 1RUD1 1HJFA 4AEKA 2OZ6A 4B1LA 1QHDA 2YMZA 4D7TA 3SMHA 1MEC2 1JZ8A 2E32A 2RS13 3UESA 1WUVA 2VL4A 3OJBA 3VDAA 2BFUL 1YUDA 1BKZA 3ACIA 1VMFA 3BKZA 4XZUG 2GALA 4S2HA 4HVQA 2VZVA 1YLLA 2PHXA 5C5TA 2WABA 1JW6A 1AX0A 1RHI1 2PQSA 3HIFA 4FOQA 2PHUA 4Y22B 5FIXA 5KHKA 4I3GA 2F4LA 1OQEA 3RZGA 3VDDC 4AK3A 4K40A 1UY2A 2G9GA 5T5JA 4HT1T 3EJKA 3WNPA 2P5BA 3KVAA 1A8DA 2VCMA 3B7MA 2YUEA 1G6NA 5FY5A 2WT2A 5IT6A 3AKQA 2Q8DA 4CCLA 5FCCA 5T3NA 3K77A 5APAA 4XOGA 2RJKA 3BUCA 2FCTA 2MEV1 5A7OA 3R6SA 4FBFA 4L9BA 3E6DA 3GNEA 2A75A 4K6BA 2D98A 1S0BA 4XF1A 2BBVA 4HN1A 1JOPA 1ULEA 2E7TA 1DLLA 3I59A 1IS3A 5KXDA 4JDMA 1RUH3 4XJZA 3TN91 3DN7A 3ZFEB 3ECQA 1C8M3 3TYJA 4AEDA 2VMEA 4C8DA 1D4VB 4PQ9A 3RZHA 1AYM3 1BJQA 1IGOA 4XQ4A 2QZ2A 2UWBA 2FDKA 2HKXA 3MUZ1 2JJ6A 2VG9A 2VTXA 3RJRA 5I93A 5EJ3A 2Z69A 1CJPA 3LPFA 3BIEA 1S2KA 1SLBA 4LNVA 1UQXA 4MGZE 4NIIA 2EXIA 2RS51 4YZ3A 5F2WA 1UZVA 4HLTA 5JAXA 1WCSA 3AP7A 4IUGA 4MGIE 1NOVA 1J59A 3I54A 3ZIWA 5F3IA 1I3HA 2UU8A 1XYOA 3V0BB 1JYIA 4ASMB 1ZBE1 5D21A 4LHSA 3ZPOA 4BQ4A 4CU8A 2LS6A 1K42A 1REDA 2E7QA 4QXHA 1QOTA 4OHXA 3ZR6A 4ATEA 2JDUA 4BIFA 4WBBA 2WT0A 4LBQA 2Q1MA 1I5ZA 3ZFEC 1VBB1 4E4ZA 2VY0A 1W9YA 1Q3EA 5DAWA 3R4UA 3RMXA 2YFUA 1CX4A 2TEPA 5JI9A 1AYN1 3OUJA 2E63A 2V73A 5LB6A 1SHWB 4A42A 2DUOA 1RB8G 1DQ1A 1E5HA 2ZGLA 3H3LA 4LBOA 5EV7A 5FY9A 1W9TA 1BMV2 1H2MA 2V4AA 2X09A 2TUNA 3C2UA 4AVTA 5H9QA 1ZZCA 5LA1A 4LO4B 2DFBA 5DPNA 1LOAA 4K20A 2ARXA 4CA9A 3AZYA 2WA4A 1ZZ8A 2R1BA 4I0WB 4DO0A 4EV0A 1J84A 2JD4A 3MHZA 2AC1A 2VQTA 3WF4A 1U0AA 1AJKA 1LECA 1SZBA 3ZFGB 1UWWA 1YWKA 1CVNA 3N9LA 5A7WA 4UW4A 5K8SA 3N7LA 1YXWA 2EIGA 4JCKA 2BDRA 2YZ4A 1GOHA 1UIJA 1DF0A 1UOFA 1O4TA 2QFEA 2QE3A 1HRV3 2K9ZA 1G86A 1V6MA 2DU1A 4LBKA 3WP3A 1ZRCA 1OKQA 1SMVA 1XQNA 2YGLA 3GBWA 3T4HB 4UT5A 5J36A 2QQIA 1GWLA 3PTYA 1UOBA 1QOOA 5E89A 3LSEA 1F4HA 1W3XA 3A22A 3MW2A 4FT8A 1R1ZA 2VMGA 2FDHA 5LBFA 3SH4A 4BU2A 4BWOA 4N7UA 5FDBA 1TME3 1PVC1 2Y0IA 1POQA 2A3WA 2D44A 3I3BA 5JI7A 4AEJA 1GNZA 3BODA 1ENXA 3FN9A 4XFAA 2GU9A 5LCWL 4NRQA 2LROA 2VJXA 3P6BA 3WQ7A 5L9VA 4HONA 2UY8A 3GHMA 2VAUA 3OPWA 2HYXA 1RMU2 3ZFGC 3TAYA 3LPGA 1CIWA 3H7YA 4NRPA 1B09A 3VB9A 5LWBA 2HH9A 1VB2A 4XIOA 2GNDA 1DZQA 2BOJA 2GMPA 5IYYA 1AVBA 1QH7A 3IM0A 4YWAA 3WDVA 1VRBA 3WV6A 3NSTA 4AQSA 4AW7A 4CU9A 1ZA4A 4RN5A 1MS9A 3OEBA 1MS4A 1I1EA 4K9SA 3JQWA 1H8TA 3IWZA 2L9LA 5A1LA 2D6KA 3VD7A 1O5UA 2B9UA 4LKFA 3RYPA 2GNBA 3AVRA 1SFYA 4I01A 2ZX3A 1DYOA 1ND3A 3PUQA 1RUC1 2E51A 5FYBA 3O7OA 1MR5A 5LASA 1POV0 5DUXA 4BM8A 4ZY9A 1AYM2 4G3YC 2Y6KA 1N47A 1W90A 4P9XA 2WNOA 3V0AB 4CCCA 1ASJ3 3PUHA 4OI2A 2VVEA 1KJLA 5LA2A 2Q0AA 1PK6A 5FZBA 4CPBD 2RDQA 2DYCA 4Y33A 4CCMA 3JBG3 2G9FA 5GLZA 4CXXA 1O4ZA 1VRH3 2HWD3 3W9AA 4MV2A 2X5IB 3W59A 2HJIA 5FZ1A 2RJ2A 1BK1A 3MDPA 1XE7A 3KS7A 4KH9A 5L9RA 4ZKTB 4XDQA 3ZSMA 4I0AA 1XNCA 3AL5A 4IEVA 3OBRA 4Q4X2 4AAPA 4DXSA 1OVSA 2IC1A 2WO2A 1OF4A 4IGOA 4YPJA 2O0OA 1OH3A 4HOOA 3ZYGA 5A7SA 4COYA 4LUKA 1RUD2 3MW3A 1RUI3 3PMEA 3DKQA 4RA0A 4RHV1 5FP8A 5E8AA 3JXSA 4CCJA 1UU6A 3M7AA 1OPMA 3TNQA 3FWEA 2I74A 2DTWA 4YGBA 1L7QA 2VH9A 2VQ0A 2P1BA 3M2MA 1A3KA 4OUEA 1CGPA 1HQWA 1RJ7A 2ZHKA 1WLCA 3QCWA 5FYHA 2YFZA 3USUA 2R041 2X5IC 1OA2A 1RHI2 1W2AX 4BHPA 3LZZA 4GB31 3NJVA 2WR9A 1DG6A 5I0TA 3LB9A 2VNVA 3U37A 1RUE1 3N7JA 2XVGA 2WQ4A 3LEIA 1B35A 2FMYA 5IFPA 4W65A 2IVIB 2JIJA 2VUAA 3I2IA 2WRAA 3L9JT 3RYKA 1NA1A 3WW4A 3C7GA 3B01A 2CDPA 2JE7A 5LEKA 2GNTA 2R32A 2H0VA 2WS91 4P08A 4R9DA 4AL9A 1W03A 2EAAA 2MEV2 4CEWA 3WG1A 3A23A 1HQLA 4HL0A 5A1FA 2Z2SB 2NYYA 3S7IA 1D0GA 1H1IA 4GA9A 2NN8A 3VBHC 1TME2 5JUVA 2EA7A 4HSJA 1NCQA 3BU0A 1W6PB 4XABA 1O3QA 2NZ9A 3W5NA 5ACA1 2ZAHA 2J1VA 4XFHA 4XF9A 4Y1UA 2GC2A 1IQDC 2CWSA 4A2UA 2ZGRA 3Q8FA 1DQ2A 5HCFA 1WWYA 2JG8B 1COV3 3QLQA 1XOYA 3UKTA 2C26A 3AMHA 5ABJB 3D0SA 4JRAA 1AR83 1X9TA 4DNYA 5A1AA 2RDNA 4CDUB 5H9RA 1ZBA3 2A6YA 1VBC1 3VV1A 2BWCA 5KHIA 2WAAA 1QJZA 1XPWA 1YRZA 3FFQA 3OY8A 4YGDA 3FFZA 3UKNA 3I97A 1DU3D 2B8MA 3ZYJB 3HNMA 3FE5A 4PHZA 1P8JA 2E7AA 5IK4A 3NNLA 4XJ8A 4KG0A 3ZMOA 5GZGA 2UWCA 1OPOA 2GH2A 2VD7A 3KV9A 4GMP3 2QDRA 1KS4A 1VBB2 1YFXA 1R083 2FHRA 5G05L 2Y34A 2YBPA 4EROA 1PO23 2FDGA 4NHYA 4NN0A 3I2HA 1ZYBA 2D6PA 1ODNA 3OD4A 3PU3A 5FZ3A 1LOCA 1QWRA 1UO9A 2JG8C 2VQUA 2WLPA 2ZGMA 2XLFA 2P34A 2ZX1A 3FHIB 3J4UH 4GH4A 1AR71 3SHRA 4C90A 3WNNA 4CDUC 4XYXA 1G7YA 1OA4A 3PVOA 4CEYA 4IE0A 1DIWA 4PDWB 4TLFA 4AGVA 3WF0A 3H1WA 2ETEA 4QKNA 3OCPA 5I0RA 2A1XA 3HAGA 1GP6A 2LUWA 3RZMA 4FI9A 1V6JA 1H2NA 2BQPA 2XHKA 1PMJX 3LA7A 3TRSB 3ILFA 3B02A 5DDJ1 2EF6A 1YFYA 1R091 3G6JB 5CIRA 5C3OA 3DKWA 1O3RA 2PYTA 3ZFFA 1VAKA 2VXRA 2R16A 4XFIA 3ZYHA 5FZGA 3WSOA 2P3IA 4RQPB 3O1SA 1WZXA 5IVBA 5JZGB 2VZQA 1S2EA 2JB4A 4WM8A 1KFXL 3U78A 4YM1A 4FTEA 4OUMA 3RS6A 4YM3A 3GZEA 4XBLA 1IKQA 4LMFA 1NX9A 2BFUS 3NNGA 1PVC2 1XNTA 4PDWC 1STMA 4PCRA 4BISA 5CKNA 4DY3A 1QXRA 2E9QA 4YZ5A 1UW8A 1AR92 1Y9GA 2D5HA 1ENSA 2W5FA 5A7QA 4A7KA 1TZOA 3PIGA 4H7MA 5D8AA 3LKJA 3LCPA 3NMBA 5FV3A 3WQBA 2W39A 4HPKB 2YGMA 4BXFA 4Y26A 5DAQA 4RQPC 4Z92B 2VZSA 5JZGC 1H6YA 4GD4A 2MHFA 2YC4A 4LOTA 3K2OA 2VZOA 4Y1VA 2Q8OA 5JCTA 1G9CA 4AHZA 1JXNA 3NV3A 1LULA 4IE4A 3ZX7A 4EWAA 5C3SA 1Q8VA 2VMIA 1LODA 3ZXGA 4Y5Z0 1XXNA 1XE8A 4L92A 1FPN3 2RR13 3POFA 3PUSA 3T4VA 3OEAA 5FZ7A 2HLEA 1F9KA 1FT9A 1A34A 1CAVB 4J25A 1ND2C 2BYVE 5KXCA 1CR7A 1BK0A 3RRDA 2W95A 3RPQA 1D2SA 3AP6A 2PLV3 4DMIA 4K7JA 4AEMA 1PX4A 5FPBA 5A70A 5BY5A 1LNSA 3D8CA 1GBGA 2Q4SA 3HD8B 1KEXA 2UY9A 2XVKA 1DYPA 4LIVA 2DVFA 2G1MA 4LBLA 1GZWA 5CA6A 1RL3A 4NWWA 2X53S 3MF6A 4WVMB 4ZXEA 3VDCA 1RXGA 3PUAA 4QB6A 2D97A 3WNKA 2EICA 4OCTA 2BZDA 2JDAA 1X82A 4DB5A 2ORXA 4JQRA 2EIEA 4NOTA 5FP3A 1ODMA 5F5QA 3CQOA 4RGAA 3GXUA 5C8CA 4FP3A 4D7SA 3BCWA 2NPIA 4RHV2 4FPLA 4G9SB 5IJRA 3M1HA 2C5DA 2EAKA 2ZEYA 5JR2A 4XE9A 2ADEA 1Y9MA 3MV11 4LO7A 5ANNA 1YIPA 2FQPA 3BALA 3T0DA 3GM8A 3KT7A 3D82A 4LK6A 3UJQA 2A6VA 3IDCB 3B00A 1RUG1 1S0GA 2CU5A 1DGRN 3C7FA 3WR0A 2ZABA 5DZFA 4E4DX 3RDIA 4L0PA 3FUQA 3ON7A 2R042 5CU1A 4I02A 3EYPA 2DBIA 5C71A 1NZIA 2CV6A 1LENA 1UXZA 3IBMA 2MNGA 4QM9A 3TEWA 2PHLA 1QXJA 3ACGA 4LBMA 4Q0PA 3X29B 4Y5TA 4COWA 1JZ3A 1HRI1 1WW5A 5T5PA 3VHRA 4O9GA 1PIV1 4X6QB 4AR2A 4CSWA 2ENRA 2R49A 1BBT3 1ZREA 5C33A 5LBEA 2HWE1 2Y6HA 4N53A 3UT0A 1REFA 4KU8A 2CAVA 2WS92 2XJUA 3I3EA 4QB1A 3DL3A 2CAUA 1W2NA 3R0RA 2TBVA 3WCRA 4E9KA 5C4WB 4PF1A 1I9RA 1UD1A 4CTEA 4JTNA 4Z8BA 1MZ5A 4YFZA 3FUOA 5DG2A 3MPPG 1JBCA 4AF9A 1C57A 1R1A1 1W0NA 1BEV2 3B5LB 2W47A 2YG0A 1CPNA 2ID4A 2VW2A 3WW3A 3KT4A 2Z4FA 5FZCA 4L97A 4XPVA 3MFCA 5AC91 4Y22A 4UW5A 2UURA 5FO9B 2WFPA 4NVPA 2I45A 3BTZA 2WNVA 5H9PA 4DRVA 3U4SA 2P3YA 1EY2A 4H14A 5BNNA 4GWJA 4FFGA 3JUUA 3IPVA 3B93A 5IVCA 4OMCA 1S0EA 1LRHA 1VMHA 4K3UA 4BQXA 4UOJA 1VBC2 1HV1A 5FLHA 2RS31 4AWDA 5C4WC 2D6NA 2VC9A 2ZGNA 2VUJA 4WVZA 3THDA 4MGTA 4CDQA 2ZGUA 1POV3 4RGKA 5L36A 1XJAA 1IQAA 2WC2A 2EXJA 1W6MA 2BW8A 2YPJA 4GJYA 4K1ZA 4QHBA 1S0IA 2JXAA 4XBQA 5EYYA 3CIHA 2RR12 1H6XA 4Y3OA 3ZYRA 1S1AA 3ZFEA 4AFMA 4IXLA 1EV13 3OPTA 2A71A 2EVXA 3K4AA 5C8WA 1JN2P 4A7YA 3CZJA 1OLQA 1UAIA 4A3ZA 3T0AA 4CUGA 2Y60A 2FZ1A 4EN0A 4CDXB 1N1SA 2DTYA 3OBTA 4COVA 1VBE3 5FPUA 2WKKA 1MZFA 1XU1A 3ZYPA 1C5HA 1HXS3 4M3CE 4FPGA 5JSOA 1LEMA 3OGSA 4Z2WA 2P37A 4FO9A 4KGQA 4MHRA 4NHMA 4XETA 4LULA 4Q4V1 3AZWA 4FPJA 2J7MA 1XU2A 1LHOA 5E88A 3JZVA 1SFNA 5FZ8A 1E57A 1HB3A 4MYEA 4KQ7A 1ZZ7A 3AL6A 1PNFA 1UZ0A 2W91A 2PHRA 1H9PA 5F8PA 4D6RA 2RS11 4BK4A 3C7HA 3H3ZA 4WVVA 5I8SA 1PM7A 4Q26A 1W8ZA 1D0HA 1WLTA 4LORA 1JZ6A 3LDRA 1LKNA 1SPPB 3HQRA 4XF0A 1QJU3 5LK5A 1QXPA 4CDXC 3U1XA 1C4RA 2GSYA 4Q0SA 5LK7B 3CZUA 5A6YA 2WZR3 2IXIA 4XFGA 1JH5A 1DLCA 5CFDA 1URXA 5HV4A 1IPJA 1LGBA 1SFPA 1NCRC 1JS9A 5FP4A 4NIHA 2QJVA 5KC6A 2FMDA 2QQPA 1DFQA 3VLBB 1XB9A 1W8NA 3F95A 1PO13 2X8KA 4AXOA 5FR3A 1W28A 5FMOL 2VBPA 2B9VA 1FNZA 3JB8A 4JX0A 1UKGA 3W21A 1EPZA 4QU2A 4F83A 2ZZQA 3POYA 4XJAA 2XQXA 5FZHA 5FO8B 5FZDA 5DAPA 5C9AB 4I2OA 5FFOC 1NG0A 1JYCA 2AREA 2QQJA 1CAXB 2WA3A 3KV4A 4P9IA 2Q30A 5L7OB 2C1FA 4ZPIA 3AKRA 3N7MA 2JEMA 1GQHA 2WN3A 1OKOA 2ZKNA 2DBNA 3FBYA 1RUH1 3POEA 4MADA 3UGGA 1JU4A 2QKDA 4ZU4A 4AVVA 3ZYIB 2H6CA 2JKBA 3R4DB 1AYM1 1W8UA 1Y3TA 5J7MA 3P3PA 5DQ0A 4SBVA 3LQCA 4GWNA 5GLTA 2GC1A 1DQ5A 2XL9A 2ZEXA 1OBNA 2KM2A 4JGYB 4YLZA 4B8EA 5F7UA 3DPRB 4FOYA 2Y6FA 4KG8A 4MXVA 2XR4A 4LK7A 1HX6A 4QPYA 1AF9A 4PQQA 4J1WA 4MUVA 4ZS2A 3ME2A 4AZZA 2WNUB 2JWPA 5KBFA 1TE1B 1JOJA 2VW0A 5A6XA 5C9AC 5IWFA 3LOIA 4NROA 4UW3A 4IV1B 5DUUA 1MQTA 3GGLA 4S2FA 4AVBA 5L7OC 1TVGA 1KXGA 3NNMA 4WM7B 1ULDA 2OA2A 2JX9A 3LF7A 5A80A 3GBGA 2XOMA 1H2KA 3PVNA 1Q8QA 1UY3A 1QU0A 4JGZA 4YG0A 3H42B 4AI8A 2W3JA 3AXDA 4H3WA 4YVSB 2FCUA 5T55A 2A70A 5FWEA 5F1RA 4JGYC 4Y1ZA 2WYSA 2ZGOA 2E33A 3QH7A 4QT6A 3DPRC 4UYBA 3THPA 4IE7A 2J1UA 3VBOA 2WBKA 2V72A 4AVSA 1IS6A 4AGRA 1OOPA 4PBOA 4ZONA 1CWPA 2GMEA 5KXEA 1W6OB 1NT0A 3WOGA 3IMNA 4ES9A 4O9EA 4GJZA 3WW1A 2WNUC 1OH4A 2XGXA 4ES8A 1ZZ6A 1RUG2 1ZZBA 4XCAA 4BLIA 3M4FA 2WZPP 4IV1C 3I3MA 4QX3A 3GZTB 1REEA 5IK8A 3H8XA 4AQTA 1UYXA 1WMXA 4WM7C 1SG3A 5HI0A 3J7HA 3U0ZA 1JYNA 1JODA 2VULA 3FLRA 1LOEA 4LO8A 3O0WA 1HRI2 1X7NA 4YVSC 2BPA2 1HRV1 4XC9A 4HKOA 1XSRA 3DXTA 4UBHA 1OD5A 1PIV2 1O6UA 1TG7A 2ZOEB 3ZMNA 2C0ZA 3APBA 3BTAA 3UK9A 1HIXA 2H6BA 4N90A 4QDRA 2HWE2 1F5JA 3VBSA 5JLVA 3WCSA 3WLUA 5JXHA
chains in the Genus database with same CATH topology
3MEPA 4PBPA 1F5FA 3AM2A 4WZFA 3ZSKA 1TME1 4IEPA 2R0FA 3B9CA 1AR63 3RI9A 4PF5A 1OSGA 2OZJA 5HXVA 4N7IA 2AZ5A 4OI1A 4LA2A 2JICA 1R1A2 3VBHA 1ZZ9A 1XNDA 1CAUA 1QQP2 5JWPA 2PAEA 1QJX3 2HWF3 4GKXA 4YZ1A 1D2QA 4UW6A 5AC92 3O0VA 4N9HA 1LOBA 4PIXA 5EZWA 1WCDJ 3M3OA 1VAVA 1F2NA 1QNWA 2GN7A 4META 3KM5A 4JV4A 1CAWA 4D3WA 4XFBA 1G9FA 3FLPA 2VU9A 3A0KA 2RS32 3POSA 4KL1A 4E2SA 4EWDA 1V70A 1H8VA 1Q8OA 4CRQA 1SCRA 3SISA 4N43B 3VBRB 2OVUA 4AFDA 1W39A 3J9SA 4DFSA 1LR5A 3L2HA 4KNCA 5AFBA 1QKQA 3AB0A 3ALQA 3KGLA 4DS0A 1ASJ1 4OHZA 1RUF3 4DY5A 4Y1XA 2VOVA 3T1LA 5DUWA 3AX4A 3JBG1 2RMU3 5FPXA 1WGPA 1NQJA 1VRH1 1DQ0A 2HWD1 2A6ZA 3WG3A 5FQ0A 1IPKA 4JRLA 4OHVA 3OYWB 3ZSJA 1OLRA 3W58A 4QPIA 1X8MA 4XXAA 4URTA 2W52A 5F9TA 3VKNA 4F7ZA 4OLLA 2ES3A 1XRUA 2ZHLA 4Q4V2 5GZDA 2LTNA 1VBA3 4N43C 3VBRC 1GFF2 5FOJB 3AJYA 1QF3A 1RUI1 4OHWA 2NP0A 2I07B 2XJTA 4F3JA 4BPZA 1HQNA 2BNNA 3H1YA 2RS12 3ACLA 4FPKA 4R9AA 1DYKA 1H30A 3S30A 4GKYA 5C6CA 4C1WA 5I8YA 2ZA9A 1VJ2A 1JHNA 4AHWA 5FRAA 1SQ4A 4MXWB 4PLMA 3ZN6A 2A5ZA 4HSLA 5BV6A 4KWLA 3RG0A 2FBEA 1N3PA 3RJ2X 1SDWA 2VNRA 1AR91 4PDWA 1LOFC 1JUHA 2MPFA 3GZAA 1QMJA 3H3UA 4OFGA 3EHKA 1RVF3 2DCYA 4DPNA 3N3HA 3VN4A 3TN93 3EQEA 5BNOA 2JE9A 3E6BA 1EAH3 3LAGA 3RMYA 1W6QB 1MS1A 1S2BA 2ATFA 4XTPA 3FMGA 1NZCA 1RUH2 1C8M2 1MACA 5EXOA 4YW2A 4YGCA 3PMSA 5BNPB 1MZ6A 4OULA 2IWGB 3C3VA 4LHNA 1ENRA 3KB5A 1COV1 3KCYA 1QJX2 5BNNA 4J1XA 5GLVA 4XQWA 5BYNA 3M3QA 4ONUA 1AR81 1VR3A 4FPHA 4ISQA 1ND2A 1KITA 1VBD3 1ZRRA 1ZBA1 3RI8A 4GALA 2DU0A 1ONAA 1NLSA 4Q1RA 3HT2A 2CWMA 4CP2A 2Y38A 1MS8A 1YI9A 4XTMA 4QPGA 4YM2A 2WFF3 2XWBB 4K1YA 4B4RA 4GMP1 2YYOA 4RS5A 1R081 2OPKA 3RYRA 5GLUA 3R05A 5BNPC 4Z82A 2Y0OA 4XF3A 4Y20B 3MICA 1H1MA 4W6YA 2YC0A 3PLQA 3JD73 3J26N 4YM0A 5T50A 4CDWB 3U10A 3BB6A 4IV3A 1RUF2 2IXJA 4Q2FA 4MX3A 4YRDA 3V64A 3VHPA 2Q5TA 2O8OA 5A32A 5K9YA 1WBFA 2B7YA 4BCUA 4Q4W3 1ALYA 3Q9OA 1UIKA 2ZGTA 2A6WA 1JTZX 1DQ6A 5A33A 1RIRA 3ZXDA 3MIFA 3I59B 1WD4A 4UBGA 2DVBA 3ZPYA 4FTBA 4RL7A 4WVWA 4AEDB 4AHYA 3H0OA 1HRV2 2DCJA 1LOGA 1ZX5A 3CLPA 4LBJA 4CDWC 1KD7A 1A78A 4M00A 4XHBA 3LA2A 4OVEA 1BEV1 4FPYA 2DVGA 3VL8A 3PVBB 1FAYA 3JU9A 1YYNA 2PTMA 3AZZA 1H0BA 2ZGSA 1NY71 1Q43A 1PGL2 3UL2A 1LHUA 5KHGA 1Z0HA 3PNAA 4LBQB 4HK8A 5CAZA 4F8AA 4AEDC 2D6OX 3VZKA 5K0UA 2SBAA 2Z5WA 1QDCA 1TQ5A 3HQXA 1WMFA 1G9DA 2ZCWA 1UU5A 5FMOS 3URFA 4KWKA 3HBZA 3VBUB 2VMHA 1F8VA 4BH9A 1OQ1A 1FOD3 3GYDA 3K48A 3KQRA 3RZZA 2K0GA 2YY1A 3N4MA 4YVWB 1C1LA 3MGUA 1H4GA 5C4WA 1FPN1 2RR11 2Q1ZB 5BNQA 4N9IA 1MS3A 2D3RA 4Z07A 2ZGKA 2HWB3 4ORFA 1ULGA 5CBLA 4GXLA 4LUMA 2PLV1 1QGLA 3H8UA 5ABJC 1ASJ2 1GQGA 3EXUA 2RM23 3UKVA 1S0DA 3AMMA 3JBG2 4YG6A 2HWC3 1VRH2 2HWD2 3HR9A 4NR1A 3DUIA 1HW5A 3VBUC 3AYDA 3WY6A 3BPZA 2XKOA 2GZWA 5FO7B 4S2GA 1RGSA 4SLIA 3WX5A 4YVWC 1S0CA 1DGLA 1FV3A 2ZBJA 4YG3A 3I4IA 1RUI2 3THTA 3A4UA 3KGZA 4BIOA 1WD3A 1WMDA 3JD72 3KZ4C 3BOWA 3WINE 4X8PA 4AE2A 4GB33 3JQXA 4OI4A 1BQPA 3WXPA 1LGNA 3U07A 5KC5A 4QQLA 2C9AA 3CJIA 2XJPA 1C3HA 2R30A 3SNMA 3VKLA 4CDXA 1G8WA 1H8TB 3DGTA 3EBRA 3JB4C 4Q4W2 2I2SA 5I0UA 2GDFA 1Q5OA 1ND3B 3MLJA 1BBT1 1NCRA 2PHDA 1OQDA 1DGWX 4FPFA 5JVVA 1A8MA 1QJY3 4JVAA 3WNXA 2YHJA 4MSVA 2ZJCA 4G4FA 4LBQD 1U5XA 1PK6B 1XYNA 2R063 1GICA 2XG3A 2GC0A 1CPMA 3OGJA 1WA4A 4ITCA 1TMF3 1AZDA 3ES1A 2GMMA 2PN5A 4C1XA 4XBNA 1TEIA 4M01A 1HLCA 3SCHA 3N36A 1GNHA 1H8TC 3S0MA 4DINB 5JSPA 1ENQA 3LA3A 1Z7S3 5IK5A 2B5HA 2VOXA 4RR3B 2WLQA 3WP6A 2CL2A 1COV2 1NXMA 2OW4A 3RWNA 1ND3C 1GZCA 1UMZA 3DV8A 1AR82 3VBFA 1W0OA 2NMNA 1C5IA 5J3UA 1ZBA2 2ZS6B 4RFT0 5DUVA 5HBAA 1AX2A 4JTOA 3WP4A 1PK6C 3ZN5A 1GANA 1POV1 1Q8SA 1SLCA 4IEYA 5H9SA 1FMD3 5J96B 2Z79A 3VHOA 5C9AA 2CY6A 1PMIA 4P9LA 4FQZA 1R082 1AR73 1PO22 2GH8A 4E2QA 3QD6A 1RTVA 1CD3G 1EV11 1S0JA 2BWAA 5CG9A 4LEJA 4RR3C 3SXWA 1M4WA 3J8F3 3ZXFA 4YFWA 4B4QA 4YARA 1VBE1 1NA1B 3CL1A 1DGRA 5DZEA 1KDKA 1HXS1 2PELA 1FV2A 4P5HA 4CEWB 5EWSA 1R093 1RUJ3 3AK0A 4PLOA 3GBFA 3WDYA 3ZN4A 1O3TA 5AVPA 1W6NB 4IEWA 4YW4A 3CU7A 2XLAA 2LM3A 2WSUA 1RUNA 1NCQB 3VDDA 1J3QA 3WVJA 2R0HA 4WM7A 4Q0QA 1MVQA 5FLIA 1UX6A 3WDWA 3SH5A 3AYEA 2D93A 4BOWA 2GAUA 1QJU1 3FJSA 1V9U3 4AVAA 1NA1C 5L73A 2NQYA 3S6PA 1U5IA 2WZR1 1W6OA 3WD5A 3ATGA 1PZ7A 1QQP1 1V6KA 3OY8B 2D43A 4ATFA 3L2YA 4COZA 5JPMB 3TB0A 4EWEA 1MS5A 1SEFA 2SLIA 2XBO3 4BLJA 1NY72 1PO11 1NCQC 3PHMA 1X36A 3U4XA 5J09A 4JDOA 1WCKA 5JPNB 2IXKA 4DZGA 1YJKA 4ZXKA 4WZCA 4BMBA 2D5FA 1QJY2 4Y1YA 1YCIA 3O5SA 4FP2A 3IN9A 3AP4A 1D4M3 2F4PA 2P3KA 4M0HA 3T2TA 1W2UA 1TMF2 3E5XA 3VZMA 1FPN2 3ES4A 4EN6B 4GIQA 3SCGA 3AZXA 2DURA 4Z1VA 2XPJA 4Q4Y3 5BPXA 2R073 2PLV2 1AL23 3ETQA 2JENA 1ZVFA 3ZFFB 2VGDA 3MZHA 4XJWA 4AYUA 1YNAA 4E2GA 2R6QA 1C1FA 4RGGA 2HEYF 2JG9B 1S0FA 1X50A 4WM8B 4LHLA 2BNOA 4M3CB 1LU1A 1C28A 1MEC3 1J1TA 1DGWA 2WSVA 4L8QA 3V0BA 3V56A 4M3CF 1FMD2 2A7AA 1YI7A 2AR6A 3OF1A 3SITA 3WG4A 4FSJA 1OMIA 3B9IA 4H7LA 1V6LA 4YW5A 1BYHA 5E16A 1UPIA 1J1LA 4PLNA 1OHFA 2KXLA 3I2DA 3HMYA 5D8AB 5BXXA 4XQDA 3RQ0A 3ZFFC 2QDNA 4IESA 4LBNA 3H9AA 4HANA 2JG9C 3NL1A 4WM8C 3KLSA 4FVVA 3OPZA 2QZ3A 2HEWF 3MI8A 2UYBA 4AI0A 4K21A 3CF6E 1PHMA 4YYOA 2P17A 2AYHA 2XKPA 3ZFGA 1AXYA 3IDEA 1BBT2 4R4XA 4IEUA 3KSCA 4TZDA 5CNAA 2B46X 3ZXJA 5D8AC 2P3JA 1AR61 4KWJA 5FLJA 3VKMA 4XFCA 1C8M1 3MYXA 4IEZA 2YV8A 3AP9A 4MZUA 1CN1A 4HBNA 4RSUA 5JIAA 4NHLA 1GZWB 1PZ8A 2PAKA 1QJX1 2ZMNA 4AQ6A 3WZ1A 3M70A 1N1TA 4QGLA 5IK7A 1QNYA 4IQPA 5C8CB 2CGPA 2XJVA 4NPRA 3OD0A 3WHUA 4BA6A 4LR4A 1D4M2 2O1QA 2VVFA 4W6WA 4LE4A 3GHNA 4BE3A 1VAMA 1N1YA 2VOKA 1QOSA 1HKDA 1LESA 1U12A 4W6XA 3WQ1A 1EV12 1RUF1 1FNYA 4XZPA 4QMAA 4TSVA 4XF4A 1QDOA 2RMU1 3ILNA 1DZTA 2PQQA 5C8CC 3V0AA 1VBE2 3R4SA 1UF2C 4PIZA 4Y4YA 1HXS2 1V00A 2VECA 1EPWA 2XB6C 4N53B 2VW1A 1YIFA 4AI2A 2IXLA 1DQ4A 1BVVA 5KXBA 1WMEA 4GWMA 1GKBA 2X5IA 1H9WA 1VBA1 4OZXA 5KWRA 1IZ3A 2WIIB 3VUOA 3MIGA 2PHTA 3E6CC 1SLTA 4TYSA 4NHKA 4QGNA 1U5ZA 3MIBA 4Q8LA 4BZ4A 2VOWA 3K51A 2QVSB 4XJUA 4IETA 1NYWA 4Y20A 5LRRA 1QJU2 2WNVB 1AUYA 3AXEA 1RMU3 3FLTA 3KCXA 4CDWA 4XILA 4IERA 2WJSA 3IPVB 4N53C 2AENA 3SLIA 2D40A 1PGSA 2WZR2 5SV8A 3AMQA 1PGL1 3NKGA 5JOYA 5CFCB 4AG4A 3T1MA 4CDQB 3AFGA 4AVCA 5JOXA 5GALA 1PO12 1SLIA 1RVF1 1SCSA 1W6MB 4P9GA 2YDEA 3GALA 4B3NA 4YZ4A 3ZXEA 4I0BA 2P2KA 3WDXA 1EAH1 3GF6A 2WNVC 3OTFA 2XH6A 4XHXA 2NMOA 4AFBA 1G9AA 4OI0A 1LCLA 5CADA 1HDKA 2FZ2A 1W6PA 1XYPA 4P9WA 5CFCC 1DDLA 4CDQC 5GLWA 1O3SA 1Y7BA 1VBD1 4B29A 4HZFA 4Q4X3 2AGSA 2JG8A 5DG1A 4D7YA 5ABJA 4MGKE 3JCIA 4AHXA 5I8TA 4CDUA 1RUD3 3INAA 2WFF1 4ISRA 4X8NA 3VBUA 3MLKA 4FOVA 1RJ8A 2YROA 2HYKA 2PFWA 4FPEA 3I8TA 4GQ7A 4YVWA 3JD71 4FCAA 5CFDB 2IXHA 2NM1A 1RHI3 3D6EA 1WBLA 2ZGQA 4QXKA 4EN7B 1MVEA 4YW3A 4LE3A 4AI1A 4FAGA 1T6GC 1UZZA 2DWRA 1V6OA 4AI3A 4QGMA 1K5MB 1RC6A 3ASIA 2PHWA 4Q4W1 1OI6A 1GR3A 5FTTC 3WG2A 5HCAA 1LHNA 2GNMA 5FPZA 4P9YA 2MEV3 3NV4A 5T52A 3ZVXA 4XW3A 1SLLA 3IT8A 1OA3A 4B7EA 4D69A 4UXAA 2XVLA 4FPCA 2IZWA 4LTAA 1LEDA 1J58A 3EO6A 5CFDC 2BTVC 2D3SA 3MF9A 3NVCA 2V09A 1J3PA 4HFSA 3PVEA 2AH2A 4QQPA 4KU7A 1TNFA 5JOZA 1LU2A 2DCKA 4RQPA 5SV5A 3NJZA 2OYZA 5JZGA 2D6MA 2XJRA 1X8EA 4R9CA 1AR62 5J98B 1K5MC 1UKRA 2EALA 4Q8KA 2RS53 1NE6A 1SBDA 1NQDA 1KJRA 1MQTB 5J37A 1WW4A 3NAPB 5FAXA 5KHJA 2HWF2 4J6GA 1LB2A 1AX1A 2NLRA 1ZBE3 4JGZB 3ZIXA 3NO8A 2RE9A 3VKOA 1NLRA 2E53A 3NKTA 3E5UA 3H50A 3H7JA 2ZHMA 4IEXA 2XWJB 4HPKA 3E97A 1VBB3 3VBOB 4PJYA 2ERFA 1AJOA 1FOD1 3FC0A 5E1RA 4LT5A 2XUMA 1OOPB 1PGW1 1AYN3 2CGOA 2B39A 5T5OA 4A7ZA 4CP0A 1YO8A 5GZCA 2F6BA 1MZEA 1Q8PA 3ZSLA 5L19A 1GV9A 4FXGB 4KBBA 1H4HA 1PO21 2HWB1 3CJXA 1ULFA 2BUKA 1MQTC 2ZGPA 3NAPC 4ZU7A 3VZNA 5FBZA 2B45X 2OUJA 1CAVA 4JGZC 2B42B 2RM21 4LO5B 2A6XA 5JR7B 1LGCA 2ET1A 2HWC1 2RMU2 4RR3A 1FI2A 1SBFA 1IS4A 2ET7A 4R4ZA 3FBMA 3VBOC 2Y26A 5K7PA 3VBSB 2DV9A 1WW6A 2GC3A 1LTEA 2V5YA 1OOPC 5BUVA 2UYAA 4X6RB 3M3EA 4WVMA 2WINB 1VBA2 4FQ4A 1V6IA 1WLWA 3NV1A 3VBHB 1PVC3 1CAUB 3QH6A 3BIWE 4NO4A 3BU7A 4ZU5A 3TNPB 4FTSA 1IHMA 1DZRA 5I0SA 1N3QA 1AR93 3HWJA 4L2NA 3WT3A 4PIYA 1KQRA 3VZOA 5JIUA 1CAWB 3MLLA 3VBSC 2TNFA 1J3RA 4IEOA 4LLFA 3OGGA 1I6XA 2A73B 2VNOA 1YFUA 1SBEA 3S7EA 4DQAA 1EP0A 4QD2A 4TWTA 4YNIA 4ASLA 3G7DA 3ZXAC 4EN9B 1W6NA 1RVF2 1ZRFA 3KT1A 4CZSA 1QJY1 2BVBA 2ZKLA 1FX5A 3B69A 3RSJA 4B7KA 1RUC3 3TN92 4OHYA 5AFEA 5J48A 2WNEA 3B94A 1EAH2 2R061 1AXZA 4S2DA 5GM0A 1KFUL 3HN1A 1TMF1 1KRIA 1IOAA 1BVP1 2AUYA 1UL9A 4QQHA 5FQ0B 2XL7A 3KMHA 2ILMA 2VVDA 1Y9QA 4HKWA 2RS52 1Z7S1 3H1MA 2IFWA 3CO2A 2QUOA 4QPIB 3WDUA 3VZLA 1XNKA 4JDNA 2WL1A 2DVAA 1JUIA 3LGRA 1ZBE2 1G9BA 1VBD2 4MLOA 1VALA 3VHNA 5A3MA 3ZSEA 4R9BA 4B4PA 3AP5A 1MS0A 1FMD1 4RHV3 1AYN2 3ZXLA 2WFF2 5F6LB 3POWA 5B2GB 1O91A 3D0JA 3ZN6B 2EXKA 1UPSA 2RJLA 4QPIC 1GSLA 5JMCA 3J8F1 2VQAA 2R043 3FZ3A 2DFCA 2E6VA 2JDZA 2WWSA 2YXSA 1TNRA 1RUE3 2CYFA 4HN0A 3CNAA 1UCXA 3VL9A 4YSFA 4Q27A 5JOWA 1RUJ1 1RITA 5T5LA 2BNMA 5TSWA 4CP1A 4AQ2A 5HCBA 1YHFA 3ELNA 5A3LA 4GULA 1APNA 5BNOB 2W08A 3SH3A 1BZWA 4MGYE 4XIKA 2WS93 2JG9A 3AKSA 1PVXA 2IFRA 4M3CA 5T54A 1GLHA 1FATA 3KD4A 2RHPA 4R8HA 1C8NA 2DVDA 1OFSA 3PJQA 4HMZA 4MH0E 3ST7A 3IIAA 2QNKA 4BQ1A 1BEV3 3ENRA 1AL0G 5BNNB 5ACA3 1V9U1 2IXCA 1ULCA 1UU4A 1VP6A 3WUDA 1ND2B 1O5LA 2ZPXA 4AW7A 2DCTA 1CONA 1VLNA 3LSDA 3O14A 2G4IA 1AXKA 5BNOC 3A0NA 4QQ2A 4CYDA 2GN3A 2XBO1 4QPGB 1DBNA 1VBC3 2CGNA 2ZX0A 3WUCA 4BYYA 2N7GA 2WT1A 4RS5B 4AFAA 3AJZA 2ZTNA 4RD7A 2DF7A 1O4YA 3MPBA 2EXHA 3E5QA 3N7KA 1RINA 5BNNC 1RUOA 4FXKB 3TBDA 1RUC2 3HT1A 4IV3B 1H2LA 1D4M1 3WDTA 1FOD2 3N35A 1PGW2 4Y24A 2Z42A 3GZUC 4QX5A 5DZGA 1CAXA 3USUB 5L7OA 4QM8A 4U2AA 5LEJA 1BCXA 3VKFC 5A32B 2ZMLA 2HWB2 3D4KA 4BMEA 4Q4Y1 4JAAA 4QPGC 2R071 1B35B 1WW7A 3WHTA 5F6KA 1AL21 5A33B 4DRRA 4JGYA 1U5YA 4U36A 4K8FA 4RS5C 4FAHA 1M06G 1FXZA 3BOPA 3DPRA 2RM22 4M0NA 1HV0A 2XJQA 4FPOB 2HWC2 2O8QA 5DDJ3 3O12A 4A3XA 2VPVA 2ZACA 3AYCA 4IV3C 4V1PA 2WNUA 1MEC1 4XMIA 3D5OA 3CEWA 4LO6B 3WW2A 5CVRA 4IV1A 3MIDA 4I3PA 2DUQA 1LJ7A 4Q0UA 4Q29A 3V65A 1EYBA 2OUHA 4LHKA 3ZDSA 3P3NA 4INDA 1Z78A 1B35C 4YVSA 4C0HA 1OFNA 4Q1PA 4D94A 1Q56A 4AGGA 2KA3A 3MFAA 4GB32 5CG8A 3WQ0A 4I09A 5K0UB 1RUE2 5IUQA 5GZFA 3O0XA 4CEWC 1UN1A 3DF0A 4XFFA 1S55A 1X33A 3I7DA 4LLOA 3M8LA 1XNBA 3RNSA 4Q0VA 1GZ9A 3WP5A 4XEZA 5FOBB 5EYXA 1QH6A 2XJSA 3IKWA 2PA7A 3UJOA 4HKLA 3ZO0B 4GH4B 1CESA 5ACA2 5GKAC 2H0BA 1N3OA 3ILRA 3KCCA 1GYKA 2R062 4EJRA 5K0UC 4CEYB 2JECA 3ROUA 4WV8A 3NWKA 1ZRDA 3FX3A 3IDBB 1QY4A 2UWAA 3USSA 1WLDA 1Z7S2 4IEQA 2A3XA 2HEVF 4C0BA 3LWCA 2W68A 1LHWA 4OUSA 3AMNA 1VIWB 2OIIA 1ZNPA 1CJDA 4XXPA 1KDMA 2VNGA 1YFWA