2OIIA

Structure of emilin-1 c1q-like domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
150
structure length
131
Chain Sequence
PVPQVAFSAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNQGVARVDSGGTLGVFSLILPLQAGDTVCVDLVMGQLAHSEEPLTIFSGALLYGDPELEHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the C-terminal domain of EMILIN-1
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords EMILIN-1
total genus 6
structure length 131
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oiiA00
2JG9A 1KXGA 1XU2A 4QPYA 2JG8B 4KGGA 3ME2A 2WNVC 2JG9C 3B9IA 1U5XA 1IQAA 1JH5A 3FC0A 1U5YA 1WCKA 4MXWA 4E4DX 4EN0A 1C3HA 3V56A 3QD6A 2HEVF 2ZJCA 3ALQA 1I9RA 4QQ2A 4KGQA 1KD7A 4TWTA 2HEWF 3WD5A 4OUMA 3LKJA 5TSWA 3K51A 4J6GA 2ZPXA 5L19A 1GR3A 3B94A 4D7YA 1OQDA 2KA3A 1RJ7A 3K48A 3TYJA 5HBAA 4MXVA 4G3YC 1ALYA 3L9JT 1PK6C 5L36A 4F3JA 4E4SA 2OIIA 2WNUA 1PK6B 2WNUB 1PK6A 2JG8C 2HEYF 3AB0A 2WNVA 2Z5WA 2JG8A 4DB5A 2QE3A 3B93A 2R30A 1TNRA 1D0GA 1A8MA 2RJKA 4KG8A 4N90A 4NN0A 1C28A 1DU3D 1OSGA 2RE9A 4MXWB 4RSUA 5BNQA 5KC6A 1D2QA 1S55A 2TNFA 2AZ5A 3MI8A 5KWRA 3QBQA 1U5ZA 4QQOA 1XU1A 2RJLA 4QQLA 2R6QA 2Q8OA 4G4FA 4QQPA 5CIRA 1JTZX 4MSVA 2QDNA 3TWIA 2O0OA 4DOUA 1OQEA 1TNFA 4QQHA 3URFA 4GIQA 4TSVA 2WNUC 4OULA 2Q1MA 3IT8A 4OUSA 4HT1T 2R32A 2TUNA 2E7AA 1D4VB 1RJ8A 1DG6A 1O91A 2X29A 5KC5A 2JG9B 2WNVB
chains in the Genus database with same CATH superfamily
2XHNA 4OI0A 2MEV1 3LIHA 5IJRA 1QJY2 3NJZA 4WM8B 4CXXA 1UN1A 3VZMA 1MZFA 1U5XA 2HWF1 3ZYBA 2WN3A 4IE0A 4Q29A 4GWIA 5HV4A 1POV0 4L97A 1AR71 5FFOC 1AR62 3AKPA 2W68A 1MEC3 2ZAAA 5FP3A 3PIJA 1CQ9A 1PMIA 3GZEA 1QJY3 2JWPA 3MIFA 1B09A 3ZSKA 5LEKA 4RGKA 1EV11 1W3VA 3PUHA 4I3PA 1ZZ9A 4H3WA 5FUNA 1ENSA 4M0HA 4QDRA 5FMBA 1BVP1 1PMHX 3B01A 1XE8A 1Q56A 2Y34A 4M3CE 2VMDA 2PHTA 4S2HA 1LGBA 1PGW2 2MNGA 5BNNA 2OT7A 4MX3A 5FQ0A 2OUJA 2RS13 1ACCA 4XF1A 4DS0A 2L9LA 4EE2A 1PO21 4Q2FA 1FV3A 1RUJ3 5FMOL 3B94A 4Y3OA 1QJX1 2VQTA 3Q8CA 4Y26A 4K1ZA 1VBA1 2KA3A 3ZPOA 3HNMA 1SLAA 2AREA 4AGGA 1VBD1 5SV8A 4AEDC 1RUE2 4WZCA 5A7WA 3OGRA 4W65A 4WM7C 4E4HA 1RUOA 5FZLA 3CBNA 3K75B 5JWPA 1FPN3 4QXBA 4GKXA 3S30A 4YFWA 3WLUA 4AHYA 1LESA 1US3A 2RR11 2EXJA 1VRH3 2IFRA 2MPFA 1DFQA 1UIJA 3NL1A 4XE9A 2P17A 3W20A 4UYBA 5FDBA 3I97A 2ZCWA 3MV01 1LOFA 2BNMA 3VBUA 4BH9A 1CGPA 2D93A 2QE3A 2WZR3 3OBZA 3PUSA 5LBFA 4ZHNA 1HXS2 1HV1A 4XMAA 4EQVA 3IDCB 3PUIA 4FFFA 4CPBA 2HKXA 3GCWA 2NPIA 4XF4A 5K0UA 4NIIA 3I2GA 1RUD1 3KV4A 5EPAA 4LMFA 1OXCA 4M0NA 3CDZB 4RSUA 5BNQA 3F95A 3LSDA 1MS5A 4LK6A 4Q0UA 4WVMA 2C9KA 1LAJA 3PL0A 4OHXA 1S55A 4LKFA 4LHKA 5ERLA 4LOSA 1POV3 4JRLA 5F3EA 3GALA 3WUCA 3VDBA 5F5CA 1V9U1 1KDMA 2FMYA 2XUEA 3PTRB 1L3JA 1POQA 2WT2A 1H8TB 3ZN6A 1RUD2 3ZN6B 1AL21 3M70A 4P14A 3DXUA 1QGLA 1RUG3 2D3RA 2ZGMA 1VBE2 3H9AA 2V4AA 2BZDA 4QB6A 3VZJA 1ND3B 3ZMNA 2H6BA 4XCBA 5FPZA 3ZFFC 2UURA 2QQIA 3BU7A 2BGCA 1R083 1Y9MA 4CZSA 3V64A 1N3OA 1TME1 3OBTA 4AFBA 1OH4A 5FZHA 1W6MB 4YG6A 2R0FA 2W9XA 2B39A 5FMDA 5C70A 5EJ1B 4NIAA 3VBSC 3H3LA 1XXNA 1QJU2 1ZREA 4UF0A 2A3WA 3HAGA 4H2AA 3AP9A 2GC3A 3UGGA 4XBQA 1HQNA 4BK4A 4AEKA 1GWMA 3ZKYA 5T5LA 4N7UA 5FOJB 4F8AA 1W8FA 4Q4W2 1AR83 3D4KA 3J8F2 4KGGA 3I8TA 3SHRA 2A5ZA 3SISA 1GBGA 4DY3A 1JZ2A 2VZUA 1DYPA 4Q5OA 1RXFA 2ZHLA 2ZX1A 3I2JA 1VMHA 3KLSA 4CU9A 1JYIA 3OY8A 5IYYA 4BMEA 3NRUA 1DBNA 1U5YA 4L2NA 2DUPA 5D8AB 5FUIA 3BTZA 4XJ9A 2VCMA 3UESA 1QY4A 5KHGA 1MVEA 4WVMB 1U12A 3SNMA 1QHDA 2ZEWA 4ISQA 1NT0A 2PELA 3AKTA 4UBHA 3WW3A 4DUXA 5ACA1 5L7OB 1R1A3 3T2TA 4NJ4A 3WF3A 2O1QA 1O4TA 1UQXA 1F4HA 2DFCA 2DVBA 2ZGQA 3PMSA 4NMIA 3WZ1A 4BXFA 1O8SA 1KFUL 2QQOA 1V9U2 3PUQA 3IAPA 2WJSA 1U5IA 2XJVA 1PO12 4UW6A 1UKRA 5FPVA 3USUA 1ZYBA 4ES9A 3FN9A 4LR4A 1HQLA 4PQQA 2VOKA 4Q4W1 1K5JA 4XF3A 4I02A 1JZ4A 4CUCA 1J59A 3E5UA 4RGAA 3TRSB 3EO6A 3JUUA 3WY6A 1K3IA 4AFCA 4CXWA 5H9QA 1HRI1 1Q8VA 1VBB1 2CAVA 1COV1 5FIXA 4ZU4A 1QXRA 2HEYF 1NE6A 1C8M3 4RS5B 4KWKA 1ND2B 4QKNA 3T08A 2BBVA 4KL1A 2K0GA 1H8TA 3BALA 2DURA 4XIKA 3BU0A 5CB7A 3MW3A 3FHQA 5DG1A 1CAVA 5JI7A 1O3QA 1Z7S3 3VBUC 5CA6A 2JICA 1T6GC 3PJQA 5LB6A 2X09A 5CBLA 5F39A 3TNQA 2J1TA 2OYZA 3RYKA 3ZSMA 3GXUA 4CA9A 2ORXA 4HXCA 3T1LA 3GZUC 1OVPA 4PF5A 3B69A 4BU2A 2VULA 4PLOA 1PO11 3VDCA 1KJLA 4BQ5A 3I3MA 2VW2A 2BRTA 4OQ9A 5LCWL 5CG8A 1OF4A 1W6PB 1E5IA 1PO22 2Q4SA 2VOTA 2XH6A 2YFUA 4Q8LA 3RI9A 2VMGA 4Z07A 5LRRA 1ZBA1 5DAVA 1WMEA 2Y60A 1XU1A 2RM22 2RJLA 3POBA 4RYDA 1BKZA 1EAH1 1I3HA 1TMF1 1RGSA 4YVWC 3IIIA 4QHZA 2XVKA 1W2OA 3FJSA 5FZ0A 3AL5A 5FZ3A 5IK5A 1OQEA 3MV11 1RUF2 2W0XA 1NA1A 5E8AA 5D8AA 1XSQA 2VG9A 2ZACA 2BOJA 2Q1MA 2VJXA 1ZA4A 2WZEA 2BQPA 5CAZA 2QTWB 3H8UA 1YYNA 1R093 4AF9A 1POV1 3T3YA 2XJSA 3J7NA 2GNTA 1MEC1 2JD4A 1Q8PA 4FVVA 4UWDA 1HJGA 4Y4RA 2A7AA 2A3XA 1CAVB 1XU2A 4HLTA 4FPYA 1XE0A 3DYPA 1R1ZA 4LUKA 4FOWA 5FK8A 5A32B 4XBNA 2CNAA 1EUTA 3HMYA 1ULPA 2XBO2 3SCFA 2CAUA 2ZGLA 1W6MA 4IV3B 1G9BA 1RUH1 1HW5A 3JQWA 3PDQA 4NHMA 1UYXA 1BBT3 1REEA 4MGZE 4UF0B 4AVSA 5KHIA 1H0BA 2VAUA 4W8JA 2RS53 5FZKA 1SCSA 2VMEA 1GYKA 2SLIA 4KBBA 2D40A 1N1SA 3FZ3A 3O1OA 4BK5A 4EWAA 2GNBA 1ZBE1 3WG2A 3ZIWA 3ZXAC 3D8CA 2ZKLA 3GBGA 3NAPC 5FJHA 2XG3A 1AR72 1PVC2 1Z0HA 4FSJA 2P6CA 4IGPA 3Q8BA 4A44A 2JKXA 3LSEA 4FXGB 2JDNA 5FYZA 4CCJA 2WRAA 1JYTA 4GH4A 2R0HA 3RZKA 1REDA 3WHTA 1VBC3 2OW4A 4DINB 5IWFA 3DKQA 4NIGA 2ZGKA 3VZKA 3AZYA 1L7QA 5JR7B 4CP1A 5KXDA 2W95A 4AYUA 4LKEA 1W9YA 5C8CC 1JZ3A 4NRPA 3WHUA 4EROA 1FXZA 4RGGA 5LY2A 1BK1A 3I2OA 5FZDA 2RR12 1QJX3 1UU5A 4LORA 3WNXA 3CF6E 4OFGA 3THDA 3UYJA 1S1AA 5JUVA 2I45A 5L9BA 5JLVA 4AAXA 2YXSA 1PM4A 4J1WA 2JDYA 1WLWA 2ZHMA 3LDRA 2P4EA 4XC9A 1OHFA 2WT0A 4GMP0 4YWAA 3VBOB 1SG3A 3IMMA 1IS5A 4D6SA 3N3HA 5C4WA 2VO5A 1ZVFA 4A2UA 5JPMB 1DGRA 5K0UB 1GZTA 1AL23 1E5SA 2VE1A 4GA9A 5FY1A 4YZ2A 1GZWA 5LBEA 2A73B 4A7YA 1JOBA 2HWD3 3OUHA 1FT9A 1H1AA 5H9PA 4CU6A 1HDKA 2FZ2A 1DGLA 2AZ5A 2VVFA 1TME3 4R52A 2BNNA 1A8DA 3DPRB 4TXWA 3IPVA 2XGXA 3J26N 2VZVA 3EBRA 2RS32 3MW4A 4YFZA 5KXBA 1RTVA 4TTGA 1HXS1 3PVNA 3IDBB 2QQPA 4D94A 4UFKA 2XJTA 5CIRA 3T2PA 4HETA 5DABA 4ET7A 2YC2A 4U36A 4XDPA 1BEV3 3RMYA 3MDPA 2GC2A 3AVRA 3TAYA 1A78A 5FWJA 4XAEA 3R6SA 1S0FA 4XURA 2Z2SB 5IFTA 2RDSA 2BERA 1NCRB 2VNGA 2XB6C 1VAVA 4YW2A 3QLQA 3P6BA 1MZEA 1O3RA 5ANNA 3O12A 4EV0A 1LOAA 4XXPA 4XHXA 2DF7A 1QJEA 5T5PA 4JRAA 3T09A 4GALA 2KM2A 4UFIA 2XLGA 3LB9A 2AEZA 1AZDA 4AL9A 1BBT2 3PVEA 3KF3A 4YG0A 2XWJB 2VXRA 3BCWA 4G9SB 4IUGA 3POGA 3VGIA 5A3TA 4A3ZA 3MEPA 2BWCA 3LD8A 4ZXEA 4LA2A 3EYPA 3HBZA 4MZUA 4N43A 4P9IA 5L9RA 4BQ3A 1OVSA 1RUJ1 3HQRA 3IDAA 4AHZA 1YJKA 1RMU3 4NVPA 5C3RA 2VC9A 5K9YA 4MXWA 5EJ3A 4EN0A 3MIEA 2WL1A 4JX0A 5AFEA 1GOFA 4AAPA 1CPMA 1UL9A 2F6BA 2D98A 4LQRA 2I74A 4ATFA 3PVOA 1CZTA 2RMU1 1R092 4PIZA 4AK3A 4Z82A 4ISRA 3U78A 2LW8A 2K46A 2HEWF 3GYDA 2WO7A 4LBQB 1VRBA 1JZ8A 5A3UA 5L7OC 1LECA 1V0AA 1DQ2A 1TE1B 1DQ1A 2B46X 3HN1A 4P08A 4QX2A 4AEJA 4COVA 5I0SA 5GZDA 1CZVA 2BW8A 2P3IA 5A7OA 3U10A 4FBFA 1QMJA 1D0HA 3K48A 3TYJA 3ZR5A 4HKLA 4QPIB 3ZYRA 1XJAA 1H9PA 4G3YC 4OZOA 2P3JA 2ARBA 4FOYA 1FYUA 1PK6C 3LA7A 3TB0A 3PTYA 3S7EA 5J7MA 3WG1A 1V6NA 5APAA 2WNUA 3IWZA 2WNUB 5F5QA 2VZSA 3E5QA 2BFUL 3OEBA 2PTMA 3FBYA 1V6OA 1GU3A 4AQ6A 1FMD3 1J3RA 1Q5OA 3AL6A 1YFWA 4LLOA 4YZ4A 1YQ6A 3VDDA 3O1RA 4NROA 1C5HA 3POFA 1FI2A 4GB33 1G9DA 1MZ6A 2MEV2 2WS91 4BZ4A 4RN5A 4IERA 3LAGA 2ZGPA 3VDDC 4LBQD 3M3OA 4Q4V1 5JVVA 1GP6A 1OUSA 4LITA 4Q4Y1 1A3KA 3VUOA 2PHLA 1COV3 3LDBA 2JENA 2X5IA 2VOXA 2FDFA 4EN7B 2X5IB 4KU7A 3I4IA 1RUC2 1WD4A 2XL9A 3MFAA 1TVGA 1ULCA 4KMQA 4YZ5A 2V72A 2J1UA 2UYBA 4BB3A 3LOIA 3MIBA 2P37A 1E5HA 5AVAA 4PT6A 5FK7A 1C8M2 1QIQA 3NVCA 3QBQA 3THCA 3VBHB 1LU1A 1S0DA 3J7HA 2R043 1UY4A 3IAQA 2CWMA 4L9BA 4QQLA 4A4AA 2E63A 3G7DA 3JB4C 2ZGOA 3OB8A 5FZMA 2ZTNA 3OGSA 5JIAA 4AI0A 3LA2A 4XJUA 1Y4WA 3RGBA 4Q1RA 1MS9A 3KT4A 3V0AB 1DGWX 1LCLA 4Q4X2 3VBOA 1JTZX 2J42A 5D21A 4MSVA 2W52A 5KXCA 3I49A 2FZ1A 1CR7A 5B2GB 2JDMA 5C4WB 3CLPA 4LO7A 2JDKA 1BCXA 2W1WA 2ZZJA 4QQHA 4TSVA 1VB2A 4BLJA 4GKYA 1BJQA 2FCTA 1MQTC 5HCHA 1UY3A 5JZGB 3ETPA 5DMYA 4P9GA 2VOVA 3GZTB 2Y64A 1PIV2 4DMIA 5F8PA 5FZBA 2X8KA 2Q1FA 1MQTA 1PGL1 1O91A 2QQJA 4JTNA 4AVAA 1ULDA 1QU0A 2QKDA 3TEYA 3K4AA 4XTPA 1GQPA 1R1A2 2R061 3ZYGA 2VECA 2WNVB 2LRPA 1PGL2 1H2LA 4NHYA 3M3EA 1W8ZA 2D6KA 3NWKA 1XYOA 4KWJA 3K46A 4LXLA 1W6OB 2IXHA 2Z4FA 3B9IA 4M01A 5FP9A 3BIEA 4C8DA 3H8RA 4QMAA 1SDDB 5J3UA 1Y9GA 2WINB 5FMOS 4WM7B 1LOEA 3VBRA 4Y5TA 3RPQA 2VW0A 4MO3M 5A3WA 1YHFA 1NZCA 4JGYC 4COZA 3KD4A 3HD8B 4TZDA 1FAYA 1JU3A 4LLFA 4YW3A 3QD6A 1NLQA 2XONA 4JGYA 2Y6GA 3I59A 4KGQA 4C0HA 2YBKA 1J3PA 2ID4A 3H7JA 4LTAA 4P9YA 4RS5A 2RJ2A 4AZZA 4Z2WA 5CISA 1WLDA 3GHMA 3H7YA 1C8M1 5IK4A 4CEWC 1YO8A 1QJU3 1ULEA 5FY5A 1AVBA 2W08A 5KXEA 4LBMA 4LEJA 1XSRA 1B35C 1GNYA 3N7KA 2H6CA 4CVUA 3POSA 4QGLA 3ZR6A 4XOGA 3JD73 3FLTA 2XKOA 4Z1VA 3IIAA 4HK9A 4LE4A 3VD9A 2BV4A 4Y5SA 3JB8A 1AL0G 3WDYA 1VBE3 3NNLA 4BISA 1CIWA 1RUG2 4O9EA 4UFJA 3ON7A 2G1MA 1LHOA 4XUPA 4ZS3A 1KGYA 1W6NB 2B8MA 2Y6KA 2YDEA 3OGVA 3DF0A 4H14A 4IETA 4NAMA 3V65A 4AEDB 1G86A 1LHVA 1Q3EA 3ZLIA 2QQKA 5H9SA 5I0DA 4Q0QA 1F5JA 1OD5A 1VAMA 2VZRA 4EWEA 3BVCA 4IEQA 5FY9A 1AYM3 4XFBA 1J1LA 1MS3A 1ZRIA 1CN1A 3FWEA 4XILA 4CCOA 4J25A 3RS6A 3CKHA 4KG8A 3OCPA 2OX0A 3LPFA 1R64A 4BM8A 2OKXA 2O8QA 1TQ5A 5DPNA 3ZFGA 5GLZA 4KU8A 1OSGA 3ENRA 4CCCA 2IZWA 2NN8A 2AACA 1AR63 2E33A 3NV1A 1ULFA 3RG0A 1FATA 3J4UH 2GN3A 1I1EA 1O6UA 5M0TA 3ZO0B 1VIWB 5FZ8A 2DCYA 1PHMA 1AF9A 1PNFA 4MGSA 1UWWA 4NPMA 3KT7A 2JJ6A 2CYFA 2VUCA 1FPN2 3BTAA 3FL7A 1DZTA 3POWA 1ZX5A 2PXJA 4IV1A 2UWAA 1GSLA 1XYNA 1W8NA 2ES3A 5HI0A 1QKQA 1BEV2 4WV8A 2IC1A 1MR5A 2CWSA 2ZHKA 3H42B 2PLV2 2OA2A 2QDNA 3I2IA 3TWIA 2JDUA 4P5YA 2IXKA 3JQXA 4L99A 5FYUA 1W06A 2GAUA 2Y6FA 4P02B 4I0WB 4IV3A 2QDRA 3W21A 3VDAA 5A3NA 1W0OA 4YVSC 4LIUA 5IFPA 1ZZCA 2WAOA 5A3PA 1K5MA 4XAAA 5CVRA 4IV3C 4KWUA 4RQPB 2J7MA 4M3CF 2PAKA 5FLJA 3L2HA 1NCRC 4IE6A 4Y22A 5EFUA 3U11A 4ASKA 5IHRA 1H4HA 3NV4A 4LPLA 3KGZA 4NPLA 5GALA 3ZXEA 1DGWA 2K2SA 2TBVA 3M3CA 4UFMA 4CSWA 4CUGA 1ASJ1 1Q43A 3FHIB 5T54A 5AVPA 2FQPA 5GM0A 4QM8A 4ZU7A 2ZS6B 3ACGA 2VZOA 1K42A 3FUQA 2KXLA 2E7QA 2ZX3A 1K12A 5IVJA 2DU1A 2EIEA 2PQSA 3A0KA 5BNOC 2UWBA 3EHKA 1QOOA 4BQ1A 1IQDC 3W58A 3AMMA 3Q9OA 4PIYA 1FNYA 1RUC3 2BVVA 3FLPA 3KSCA 1LNSA 3POIA 2ZJCA 2QQLA 3APBA 1JOPA 1K45A 2WLPA 5I8TA 1EPZA 3POEA 5DUWA 5A6QA 2ZX0A 5BUVA 5FY4A 4Y20B 1C8NA 1VE0A 2D43A 3KZ4C 1WLCA 2PLV3 2BP6A 4GB32 4MHUA 3RJRA 3ROUA 2G4IA 5FYMA 1CONA 1QDOA 4PLMA 5FUPA 5IVBA 1KRIA 1RHI2 1MZ5A 1FNZA 3MW2A 1ZBE2 4IEZA 5F5IA 4DO0A 2ADDA 2ZBJA 1AR73 4XDOA 4YVWA 4FFHA 1AXYA 4TYSA 4WZFA 3WVJA 1LHWA 3I3QA 4JQRA 2YBSA 4COYA 1V6MA 3CO2A 3ZFGB 1DZQA 3BKZA 4PF1A 1QOSA 5HBAA 4COUA 3ATGA 3U4SA 3KCYA 2VVDA 1CESA 1NA1C 2YYOA 2ILMA 4PI0A 4XPVA 5FZAA 5EIYB 5L36A 2VNRA 2WWSA 2WA4A 2GC1A 2KR2A 3KMHA 2K9ZA 4IEOA 3WDUA 2F4PA 3MIGA 2FDGA 1GZ9A 3JBG1 4OHZA 1CX4A 4B29A 1FOD3 2EIDA 2A71A 1URXA 4ASMB 4RS5C 4S2DA 1G6NA 5A7PA 3RNSA 3JD71 1BEV1 1HKDA 1LEMA 3RYRA 4Q4X1 3VBRB 3TN93 4NAOA 4EN8B 1UZVA 4JCKA 1ODMA 1F35A 4OCTA 4MUVA 4UI9L 1JZ6A 2P6HA 5FPXA 1JZ7A 4AFDA 5CFDC 4FPEA 4MADA 3ZFGC 4BE3A 2EAAA 3AZWA 4FPFA 5LA0A 3JU9A 3WDXA 2WIIB 2EVXA 3U37A 5C9AB 3WT3A 4DEVA 4YZ1A 1KJRA 1OMIA 2VTXA 3QOPA 4XXAA 3I2HA 2C24A 2FDIA 4LHSA 2OXBA 5FLIA 4CEYA 3ZFFA 5C3SA 3AXDA 3Q8EA 3PJYA 4MYEA 3KF5A 4XF0A 5G05L 3WW2A 1PNGA 1ZRCA 1F31A 2QNKA 4OULA 4AI3A 1ZRDA 4JDMA 1D4M1 1W8WA 2ZMKA 1RYYA 1L7LA 2ZX4A 4OHVA 3WP6A 1UXZA 4GH4C 5IK8A 4A6SA 3R05A 5A7SA 2UYAA 1VB4A 3WQ0A 1LJ7A 5FYCA 2DVFA 4MGYE 1H1IA 1ZM1A 2JG9B 2DFBA 1SDWA 4B7KA 4EN6B 2LALA 2ARCA 2A6YA 4Q0VA 2J22A 3ZSEA 4CTEA 4GULA 1CAWA 1GANA 1WZXA 3KVBA 3VL8A 3FHAA 3ME2A 1IPJA 1RC6A 3VV1A 1JH5A 1TME2 3UT0A 1HN0A 4XZPA 2R063 1GMMA 1PGW1 4E4DX 1C3HA 4KWLA 1BYHA 4YVSB 4TN7A 4JGYB 1AL22 2H0BA 2VQ0A 3C7EA 4MG2A 1W03A 3CHXA 4FXKB 4R9BA 4QKFA 4W4ZA 4NO4A 5FZEA 2B5HA 5LA2A 1VP6A 1H6YA 2ADEA 1YFUA 3SH5A 5J96B 4UT5A 2HYKA 3K51A 4YZ3A 2D3PA 3IM0A 3RDIA 5FXZA 3MUY1 1NAEA 1OFNA 1ZNPA 1BLZA 3LEGA 4YM2A 5FPBA 4INDA 5FZIA 4BCUA 2X53S 2JE9A 1S0EA 1O7FA 3GDBA 3UK9A 3RQ0A 4ARXA 2YGLA 1QNWA 3KM5A 4XJWA 2BYVE 4DRVA 3D82A 4RQPA 3I2FA 2A6XA 4WVWA 4YPJA 4CP0A 1YFYA 1ZZ8A 1ZRRA 4X8NA 2WZPP 2Y6LA 4NHKA 2JDZA 3N9PA 4AI9A 5C9AA 4Y1XA 1COV2 5FZ4A 2XXZA 3K2OA 3T0AA 4F83A 3BOWA 2QQWA 5FZ1A 1SEFA 1SLIA 2X05A 4PHZA 5FO9B 1H6XA 3BYWA 5LA1A 3DYOA 1OC1A 3BPSA 3CU7A 1FPN1 1DQ4A 1DLCA 5F6LB 2R071 4E8CA 1A8MA 3OPZA 4WVZA 1SZBA 5GLUA 1QJZA 4Q4W3 3AP5A 4JHTA 3K4ZA 2DBNA 2RS31 5G04L 2DCZA 2WBKA 1D2SA 3H50A 3FE5A 1C5IA 4E2GA 1SQ4A 2XBO3 3BGAA 4IGOA 1NZIA 4QQOA 1IG3A 4MGQA 4FFIA 2WYFA 4QWNA 1CD3G 1WCDJ 2ZABA 4Q8KA 2XDVA 2Q8OA 4P9WA 5DUUA 3UJOA 4X8PA 3ZXFA 1JHJA 2RHPA 4P9LA 2ZOEB 3MUZ1 5FP7A 3M3IA 2Z42A 2AH2A 4XCAA 4QU2A 4AG4A 5FYBA 2Y38A 4BIFA 1EYBA 4XFIA 3W9AA 2UY8A 5A7WB 3BTXA 1UMIA 1CAUB 1G8WA 1N1TA 2WWJA 2I2SA 3LQCA 3O0VA 4E2SA 4QD2A 1AYN2 4XJZA 1YLLA 4AOCA 1RJ8A 5FLHA 5FXXA 2BWAA 5FZ6A 3OBRA 1XNCA 3AYEA 1C4RA 3MIDA 3NJYA 1U0AA 1LOBA 3MF9A 4IGQA 3RSJA 3WF2A 3FFQA 4GJYA 2YBPA 2Y33A 4LHLA 2EXIA 3ZFFB 4AGVA 3HEIA 2HWE1 1PIV1 5ACA3 2D6NA 3PMEA 4ZS2A 5DQ0A 1OI6A 1QJFA 4IE5A 4E4ZA 5CG9A 3FC0A 1S4CA 3AYDA 4QDSA 5F3GA 2C0ZA 4JDNA 3ACIA 2GP5A 2P1BA 2XHKA 1V6IA 1HB4A 4I3GA 4QXKA 3ZFEB 5KBFA 3HJRA 4JDOA 3WP4A 1VMFA 4LKDA 3WW1A 3LCPA 4PDWC 3WNKA 1HN1A 1LR5A 4W6XA 5ISLA 3FLRA 1W6NA 3ZDSA 2J1SA 4JKKA 2CY6A 1HB2A 3IKWA 4DUWA 1GNZA 3CEWA 2Q8DA 4GJZA 5JDBA 4CDQC 1XPWA 2CGNA 3GHNA 1RVF1 2FMDA 1M4WA 1X82A 4B1LA 2EAKA 4LE3A 2VL4A 2WR9A 4XQDA 1XYPA 1RUJ2 2GN7A 4YARA 4IQPA 5CKNA 3EB7A 2VR4A 2QQUA 2I07B 5EV7A 3VBSA 2ZGSA 5I8YA 3U0ZA 5L19A 2ZMNA 1OQDA 5EYXA 2MHFA 4AFAA 1GOHA 5LK5A 2W1QA 2W94A 3AMPA 4QKDA 4QXCA 3AP7A 1J58A 4NE9A 4Y1YA 4YNIA 5D2AA 1US2A 5I8SA 3OD0A 1S2EA 1J1TA 3WF4A 4U2AA 1NLRA 1UZYA 4Q4X3 2JG8C 3KS7A 5FP4A 1UF2C 1WMXA 3DYMA 4D8MA 3C8XA 4CCEA 2NLRA 4CPBD 2DUQA 1PO13 2HH9A 3ZXDA 1EY2A 4BMBA 4DB5A 2JG8A 2YPJA 4DXSA 2R1BA 1RITA 3MF6A 2R30A 4SBVA 5A7QA 2HYXA 3V0BA 1TNRA 1YI7A 1E5RA 5F3IA 2DVAA 4C91A 1GQHA 3NKGA 1ZRFA 3ZSLA 2RDQA 4DQAA 1CVNA 3IN9A 3ZXLA 1YEWA 4YGCA 2WNEA 3G6JB 4JGZA 3MHZA 1UOFA 5FZOB 4BOWA 5JCTA 1YCIA 3CNAA 3P1IA 1V70A 1JUHA 3O14A 1YWKA 4XABA 3OYWA 1WBFA 3HPNA 1UW8A 1UY0A 1H9WA 3IBMA 3O1SA 4FQ4A 2EIBA 3E6BA 4QX5A 2RG4A 2ZAHA 3WNMA 2BBAA 1GOGA 2D6LX 1OA2A 2QQNA 2E51A 1PVC3 4LT5A 4K8FA 3L2YA 3N9LA 2LROA 3M2MA 4CEWA 2O0OA 4LBOA 2JX9A 1YQ2A 1LHUA 5CZKA 1V6LA 3H0OA 2JKBA 2RDNA 1UOGA 2XQXA 1ENXA 2DWRA 2A1XA 3AFKA 3VZNA 1SLLA 4HVQA 2DVDA 2W47A 3LDKA 3VBFB 2VPVA 3ZVXA 4RR3C 2B42B 1UYPA 2J1VA 1D4VB 2OPWA 3DN7A 5GZCA 3S5AA 5A6ZA 1T6BX 4YLZA 1D7PM 3KCXA 5L7OA 4Y1UA 3P5BA 3GGLA 4N9IA 1AYM2 3DPRA 3I54A 1YQ8A 4YGDA 4IEXA 2OVUA 1SBDA 2PHUA 4OHWA 4AWDA 1CAWB 2VU9A 3T2OA 1JYVA 5BNPB 3HWJA 2YC4A 3ST7A 4DPNA 1UU6A 4NR1A 5CU1A 3MLLA 1XRUA 2XPJA 1R091 1UY1A 2YUEA 4OQ8A 4N53C 1NX9A 4UW4A 4OLLA 1AXKA 1HV0A 2QQMA 3AMQA 5LRSA 3AP4A 2HWB1 4ORFA 1JXNA 5F5AA 2Q0AA 3OTFA 4NHXA 1S0GA 1ULGA 5C3QA 1UOJA 3AXEA 2Y6JA 4CP9B 3OYWB 4FAHA 2XLFA 4UW5A 3AJYA 4QGNA 2B45X 4OMDA 4WBBA 3S5QA 1V00A 1UU4A 1VBC1 2XL7A 3WQ7A 1KITA 4BQ4A 3CJIB 1O5UA 1GZCA 1RUH2 3CJIA 4HONA 4R9CA 2HWE3 5FY7A 1XB9A 4H7LA 4YYOA 4A7KA 4B4QA 4IEUA 2WUHA 3GBFA 5BNNB 1VAKA 2EIGA 3DEMA 4BQXA 4NUBA 4CCNA 5LW9A 1GR3A 2AEYA 2RS51 4BXSV 5BY5A 4HBNA 4OI2A 4LULA 4D7YA 5FY0A 1RJ7A 4A45A 4XJAA 3POJA 3TN91 1W28A 3UJQA 5C8CA 1OBNA 1ZBE3 3AP6A 4JV4A 5C8CB 1RHI3 3KV9A 3H1MA 5FBZA 5B4NA 4F3JA 1UXXX 1N3PA 2QJVA 2Q30A 3VBOC 1BMV2 1Y43B 4HVOA 1YUDA 1OA3A 3KB5A 5ABJC 4GWJA 3SH4A 4XUOA 4D0QA 1RVF3 5EXOA 2WN2A 4DXRA 1XQNA 3T4HB 5ABJA 2E26A 2QBXA 3SEEA 3WR0A 5A1FA 5A70A 5ABJB 1L7RA 1SPPB 3DECA 5J36A 4HANA 2VH9A 2EF6A 1WLTA 2C1FA 4E8DA 1W04A 4CYDA 2DDUA 3THPA 4M4PA 2WYSA 4UAPA 5IVCA 3OY8B 5J37A 3VKOA 3N35A 1Y7BA 3VHRA 1ONAA 4YW1A 5A6XA 3SKJE 3S6PA 5EJZB 5FZ7A 1IS4A 4KQ7A 5L9VA 2IXLA 5IUQA 2QVSB 1PZ7A 1RUI2 2ZEZA 1NCQB 3LEKA 4ZZ8A 3HBKA 1RINA 4CXYA 2HWC1 1IS3A 4X6QB 2JB8A 2F17A 2VQUA 1O8PA 3OJBA 5KHHA 2BNOA 2PHFA 3PUAA 3R4DB 5LWBA 4EZ4A 3WOGA 1J83A 1UX6A 2VXJA 1X8MA 3EQEA 3RZMA 1MPXA 3URFA 4B8EA 3N7LA 1W99A 3ORJA 3T30A 2J1EA 2JIJA 3E97A 1W6QA 4ZKTB 4QM9A 4NRMA 5FZOA 1OLME 2A6VA 2R32A 4HN0A 5CKMA 2ZGUA 2GU9A 4N7IA 1DG6A 1WWYA 1LTEA 2QQVA 1NKGA 1OF3A 2WFF3 2PN5A 3NMBA 4J1XA 5T5JA 4AXOA 1GP5A 1B35A 1QH7A 4LNVA 1ST8A 4QDQA 1CAXB 3E6DA 3BPZA 5JI9A 1UPSA 1W8HA 4R8HA 1PVC1 3GJBA 3SLIA 2JG8B 2IXJA 2R7EB 1ENRA 4B3NA 3NKTA 4XUTA 3N9OA 4META 2FD8A 2RS52 1RUI1 3BIWE 3AKRA 3SC7X 3TEXA 3VKMA 2RMU3 2NZ9A 2ORZA 5C71A 4MHRA 3FUOA 4GMP1 1KS5A 4LKSA 4CDXC 3AJZA 4LO8A 1SLBA 3D3AA 3NV3A 2E53A 3R4SA 1AJKA 2BVBA 1UCXA 3D5OA 4UOJA 4XACA 3ILFA 3NNJA 1SLTA 1HRV1 1ZZBA 2HEVF 2DYCA 2W1SA 1ZZ7A 1WW6A 2N7GA 3OSDA 4PIXA 3VD3A 2NMNA 1PX3A 2DU0A 5F2SA 3ACFA 3ZXJA 5CEHA 1AYN3 4YW4A 1EUUA 1C1LA 1W9TA 4JAAA 2EXKA 1W2AX 1RL3A 5C3OA 2W1UA 4PCRA 4ZPIA 3ZYHA 2Q5TA 5HXVA 3WDVA 2P2KA 2YU1A 2YPDA 1LOCA 1NCQC 4TLFA 5EQUA 5KHKA 1A6CA 2GH8A 5JXGA 1E57A 1JYXA 2Z79A 4HSJA 3AMHA 2YU2A 3JD72 4MH0E 3VHNA 3ILNA 1ASJ2 4Z92B 3CMGA 4GQ7A 4I01A 2PFWA 1WA4A 1H8VA 3VBFC 1RUF3 4BHPA 1UZ0A 2VCAA 1OFSA 5T50A 2CDOA 4MV2A 1QH6A 3ZYFA 1F8VA 2NM1A 4PBOA 1ND3C 3CQOA 1ND2A 4V2VA 3VKNA 4K20A 1VLNA 2ZXQA 2FCVA 1HXS3 3B93A 1VPHA 3LIGA 3LF7A 1ND3A 5GZEA 1ND2C 2WNOA 1X50A 1KS4A 3LPGA 1SLCA 1W2TA 3FMGA 5FCCA 2VNOA 2DBIA 2D6MA 4YSFA 5FYSA 4CDQB 2BUKA 3CJIC 2JD9A 4N90A 4KBZA 4K7JA 4AVTA 2VUAA 3AYAA 4HL0A 4EYUA 1C28A 2RE9A 4LOTA 5A3MA 1TZOA 1RUE3 4DEQA 5JOWA 1Z7S2 4YG3A 1GQGA 2VW1A 1LEDA 1B35B 5FP8A 5GZGA 1CIYA 4AR2A 2VBDA 5T55A 2FHRA 2XJPA 2XOMA 2UWCA 5HPOA 5JOZA 4Z2AA 1PIV3 2RS12 1JW6A 2XWBB 3O5SA 3U75A 1YJLA 2YC0A 4AGRA 4IL7A 1BQPA 3MYXA 2WNUC 4AVVA 4R4ZA 2Y26A 1ULOA 3WDTA 3UKNA 3ASIA 4DUVA 3NNMA 3J8F1 3ZFEC 3WCRA 2D6PA 4ATEA 2CU5A 4R9AA 1H2KA 2Y0OA 2V09A 3HOBA 4XQWA 3H1WA 2XJUA 3E6CC 1G7YA 4H55A 4IDZA 1PVXA 4L11A 4FPGA 4NIDA 1EV13 4XYXA 5JAXA 5LZ6A 2WSVA 1YQCA 5BNPA 2R062 3HT1A 3LA3A 3DL3A 5C33A 5EYYA 1BHGA 3LGRA 3FBMA 5A32A 3C7GA 5B4XA 3KVAA 3AX4A 4BPZA 1W6QB 1UIKA 4RD7A 4XF9A 1HRI2 2DVGA 3VBHC 1SBFA 3R0RA 4QXHA 4XFHA 3ECQA 3OF1A 2MEV3 3V56A 1IZ3A 1ZA7A 5CADA 1HB1A 1P8JA 4IXLA 4BIOA 1EAH2 1TMF2 1I9RA 3MPPG 3CL1A 3W59A 4A6OA 1YFXA 5GLTA 1W2NA 4JHZA 1AR82 2BDRA 1UKGA 5JOXA 3P3PA 2B4KA 4FP2A 4AVCA 5JMOA 2BPA2 1RHI1 1V6KA 3LEMA 2PQQA 1IKQA 3VDDB 3M4FA 3WG3A 1F5FA 4GB31 3WXPA 2W5FA 3OUIA 3AKSA 4RL7A 4Q0SA 1WCUA 5E16A 2WFPA 5FTTC 4N43B 5DDJ2 3SKVA 3H8XA 1WUVA 3EJKA 1JHNA 2CGOA 4ZXKA 1KQRA 2R16A 1AYM1 3GF6A 3L9JT 4LBNA 5DAXA 1HRV3 2JXAA 5AC91 4NOTA 3ZPYA 4CDUC 2DTWA 1AR92 1CPNA 1S2KA 2WO3A 2QZ3A 2WNVA 4K40A 4MVTA 2JDPA 1RUD3 5IW0A 3N9QA 1VBB2 4NWWA 2XJRA 1HQWA 4DZGA 2PLV1 1CAXA 4QX1A 3ABZA 4LBQA 1AR61 1HJFA 3H8OA 5DZEA 4D7SA 4NIHA 4HOOA 5FZ9A 4PBPA 4UFLA 2GC0A 2BTVC 3O1VA 2AC1A 3DGTA 5JSOA 1D0GA 2WT1A 3K3NA 1AHSA 1YIFA 4YW7A 3HR9A 3WV6A 3MFCA 2HWC3 5IAXA 2ZHNA 5DZGA 1XNTA 3P3NA 1FOD2 2JDAA 3A21A 1KEXA 1XBFA 2GMEA 4IEWA 2Y0IA 1UPIA 3ZN4A 2NP0A 4MXWB 1WMFA 5CKQA 2EICA 3RYPA 2EALA 5K0UC 1ODNA 3LFMA 1AX2A 4XJ8A 4IW3A 5BPXA 2G9GA 1R081 1OKOA 2DCKA 1UY2A 2OQ6A 3IPVB 1WCQA 5CFCB 1AR93 1QNYA 4LBJA 4XW3A 5HV0A 2JEMA 2FCUA 3O1MA 4X6RB 2ZEYA 1DQ6A 2IVIB 1IPSA 4Q27A 1UO9A 1T2XA 4QHBA 2V5YA 3MPBA 3UNPA 5DDJ3 3QH6A 3ZOIA 3USUB 3J9SA 1DLLA 4CDQA 3O0WA 5A1LA 4GIQA 3AYCA 3RI8A 4UW3A 1UMZA 4FTSA 3MIHA 1AJOA 3IT8A 1NCRA 4AFMA 1J3QA 3W5MA 4HT1T 2IXCA 2WO2A 3HIFA 2F4LA 4UBGA 1HIXA 1RUG1 3ZSJA 5HCAA 5DZFA 1VBD2 1KDKA 2YROA 4S2GA 1VBA2 3ZN5A 4IEPA 1ZZ6A 2ARXA 1EAH3 1TMF3 1DIWA 1QXPA 3I2KA 1KXGA 2GALA 4EWDA 3N9MA 1NG0A 2WQZC 3B02A 4QPYA 5IVVA 1QJU1 2D3SA 2PHDA 1IS6A 3GCXA 1GP4A 1H2MA 4FPLA 4GXLA 4HKOA 4N8MA 5E1RA 4CP2A 3N4MA 1OPOA 5FYHA 3T1MA 2H0VA 1IQAA 2WQ8A 1NA1B 3ES4A 5LK7B 5LASA 1BMV1 1AYN1 1OLQA 1O3TA 3F2ZA 4GH4B 1DQ0A 5J09A 3OG2A 4NWVA 4PI2A 5C9AC 1VBE1 5A3LA 1JOJA 3VD5A 3PURA 1STMA 5BXXA 1W0PA 5BYNA 4N53B 3J7MA 1W6PA 2R072 4FT8A 4B7EA 5A1AA 2RR13 4D6RA 4LO5B 2PHWA 5DG2A 3PLQA 2R1DA 4MGIE 5A6YA 1F15A 3UGHA 2VM9A 2P5BA 3SEPA 2A75A 2IVJA 5F7UA 4C0BA 2C4XA 5FPAA 1VALA 1XNKA 4YM0A 5C8WA 2BGOA 4XDQA 1K5MC 1VBC2 1VJ2A 5JSRA 3PHMA 4PJYA 5EWSA 2PHXA 3JBG3 4K6BA 4RQPC 5I0TA 4QGMA 3OPTA 1LRHA 1NXD1 3JCIA 1GZWB 3NV2A 1SFNA 2P34A 2IUWA 1ENQA 1GNHA 3I59B 4HVRA 2X10A 4MOAA 4I0AA 1LU2A 2W91A 4HG6B 4LBKA 5FMCA 4AI1A 1PZ9A 1W8OA 4DFSA 2HWF2 3C2UA 3QH7A 3ETQA 1OT5A 1UNBA 4K9SA 3PU3A 3AKQA 3N7MA 4Y33A 2W2IA 5FO8B 1RUE1 3DV8A 4FTBA 3DPRC 3NAPB 1ZBA3 5F6KA 4CDWB 1W39A 2B9VA 4URTA 5E89A 1APNA 3OPWA 3B00A 1SACA 5CFDA 2OZJA 3MBWA 3RVHA 1I6XA 1WD3A 4LUMA 2RM21 4HKWA 1D2QA 4N53A 4QKBA 5FYTA 2A70A 2CL2A 3T2QA 1X8EA 2GZWA 4I30A 3B5LB 3RZLA 4YRDA 3M1HA 4AEDA 4CEYC 5IT6A 1CJDA 1D4M3 1YQ5A 2D5FA 1OOPC 2W46A 2XMLA 3RWKX 1O3SA 3TOJA 2ZGTA 4R4XA 3HQXA 2JDHA 2YZ4A 2R6QA 2PMWB 1LULA 2YG0A 1AR81 4QU1A 3LZZA 2WWUA 3KWVA 5LBCA 4E9KA 3S7IA 2WC2A 3PU8A 1C1FA 4PDWA 2RV9A 2VMCA 2ZMLA 4ES8A 2R49A 1NOVA 3B3QE 5FPLA 5GKAC 1A34A 4GMP3 2FDJA 1XNAA 2VGDA 4CCKA 4YW6A 4DY5A 2ET7A 3ELNA 4IEVA 5DXDA 2YY1A 2ZX2A 5JIUA 1PX4A 4L92A 1S2BA 3WNOA 4E2QA 2TUNA 3KQ4B 4AHWA 5FO7B 2E7AA 2JE8A 4K1YA 4COWA 3AZXA 5IK7A 4D3WA 3O1PA 4HFSA 1BZWA 4EZHA 1GV9A 1NYWA 4Q4V2 4XTMA 3ZMOA 2QCSB 5FXVA 5DUVA 3O0XA 3T0DA 3USSA 2YHJA 3DKWA 4DXZA 4XVHA 4XBLA 4FOQA 1VRH2 2OS2A 3NQHA 4YVWB 2IXIA 3C7HA 3OD4A 2RMU2 2P3YA 2ZEXA 3Q8FA 4A7ZA 4OI1A 5A3OA 4QPIA 4FPJA 3HVDA 1UYZA 1W3XA 1K5MB 3B7MA 4CU7A 2HLEA 1AUYA 5C5UA 1RUF1 3MO4A 4L0PA 3SQOA 5FZGA 4CU8A 5FYYA 3AFGA 3MLJA 1IHMA 1OKQA 1X7NA 2BFUS 2WFF2 5EP9A 3AK0A 5C6CA 1DYKA 1MS1A 5J1XA 5CFCA 2PHRA 2G9FA 2VBPA 2YV8A 1REFA 1FV2A 2E31A 2XVGA 3VKFC 3WCSA 4CDWC 5I93A 5JXIA 1NUKA 2FDKA 3WD5A 1NY71 1LENA 1JMUB 2VTFA 3NSTA 1BBT1 2LS6A 3T0BA 5CFCC 1Z7S1 4CDWA 4ZU5A 4J6GA 2W3JA 3NAPA 4WVVA 1H30A 4C1WA 1TEIA 4OHYA 5FREA 3OEAA 1IGOA 5A80A 2VY0A 4BYYA 5CFDB 5JZGA 4LO6B 4NPRA 2C9AA 2GH2A 3DUIA 1ALYA 4BJ0A 2O14A 3IDEA 5LEJA 5FZCA 5JZGC 4LO4B 2R073 1UX7A 2OIIA 2R042 4XFAA 4E4SA 1WMDA 2WABA 3KHBA 1YRZA 3KGLA 1OA4A 3SXWA 5I0UA 4BDVB 1X33A 3RFRA 5A33B 4QX8A 1Q8QA 1FX5A 3I3BA 2Z5WA 4YM3A 5T52A 2ZGNA 1H8TC 3ZYPA 2J1RA 1S0IA 5FAXA 4NHLA 1G9CA 1H2NA 2XLAA 5FY8A 5AC93 2QFEA 5F32A 5IATA 3CIHA 1XE7A 2RJKA 4Z8BA 3S57A 1O4YA 4W50A 3VBSB 1N3QA 4AQ2A 1DQ5A 2VUJA 3BTYA 2DTYA 4NN0A 3AM2A 3Q8AA 5SV5A 5KHJA 1FMD2 5C4WC 4CDXA 5K8SA 2GSYA 1RVF2 5DAWA 3J8F3 3AMNA 4XHBA 3VZOA 3RZJA 5I91A 1Z78A 1H1MA 1W9FA 1QEXA 1SCRA 2E32A 4O65A 1UD1A 1SBEA 3ZDVA 1WW4A 3VL9A 1RB8G 1RIRA 3U4XA 5A7NA 4KH9A 3BUCA 1UMHA 3BN6A 1QQP1 2ETEA 3LFIA 4GAZA 4Q4V3 4SLIA 1F4AA 3RZZA 4WM7A 4DOUA 5F37A 2AGSA 5FRAA 2WSUA 4O61A 1JYCA 2CGPA 2JB4A 3A22A 1IOAA 5E88A 4K8RB 4QPGA 5K7PA 4A41A 2ERFA 4OUSA 3NNFA 4JGZB 2HWE2 1DF0A 1YIPA 3X29B 3A4UA 4XFCA 4JVAA 1WCSA 2OUHA 4AQTA 4Y24A 4CRQA 3MGUA 4QX0A 2NYYA 5DDJ1 1CX1A 3SH3A 1RMU1 5AFBA 1H4GA 2O8OA 2B9UA 2CV6A 5BV6A 4FPKA 1Q8SA 3V0AA 4GWNA 4RHV3 1RMU2 3MLKA 2XUMA 4CUAA 4I2OA 4S2FA 4L8QA 1N47A 4FPCA 1D4M2 2VMIA 2Q8CA 3BB6A 1RXGA 2AENA 2PAEA 5DN2A 5GLVA 3WNLA 2ARAA 1LGNA 2WA3A 3N36A 4YW5A 1DCSA 2XQRA 2LM3A 3K77A 3CZUA 4RR3B 4V1PA 4W6WA 4A3XA 4B4RA 4B4PA 3ZYIB 4N43C 3RWNA 5HCBA 3PNAA 4BLIA 2VUDA 1MQTB 1OLMA 3ALQA 1F2NA 5D8AC 1WW7A 1PZ8A 5J48A 4ZY9A 3WNNA 3RRDA 1UYYA 4OMCA 1UOBA 3K3OA 4P00B 1N1VA 2GNMA 3NJXA 3SCHA 3M3QA 1W2UA 3UV9A 4TWTA 1JN2P 2IFWA 2W39A 1W90A 3ES1A 1JBCA 4M00A 4OUMA 4GZ9A 3SMHA 1CWPA 2GP3A 2HWF3 2ENRA 2C6SA 1SHWB 2D7FA 3LWCA 2D5HA 4PDWB 2ZPXA 5HCFA 3UKTA 4XETA 3WP5A 5GLWA 3C3VA 4JC1A 3J7LA 1FMD1 2JECA 3GNEA 4K21A 5F9TA 1MVQA 4CDXB 4N9HA 4K3UA 2RS33 4M3CB 1OQ1A 3AZVA 3U1XA 1YC61 2BJSA 2TEPA 4EN9B 4FP3A 3SITA 3JBG2 3E1F1 4IE7A 1LOGA 2XBO1 1HX6A 4QPIC 1O59A 2W87A 3H3ZA 4PLNA 1AR91 2HWD2 3I7DA 4R9DA 5AC92 2D97A 2RS11 2VZTA 2NMOA 1WW5A 5FQ0B 1NQDA 3IZOA 3LE0A 2PA7A 4AVBA 2VCCA 1F9KA 1W8TA 2JE7A 3VB9A 2GNDA 2ZZQA 2UY9A 3HNBM 1W9SA 2R041 1QQP2 3H1YA 1MEC2 3PVBB 4FFGA 4JGZC 5DAPA 1JYWA 4ZZ5A 3RMXA 5LY1A 4OVEA 3OGGA 3BI3A 4XMIA 2WKKA 5FJKA 5F3CA 4E27A 1LKNA 1CAUA 2B7YA 1QJX2 2VZ1A 2X5IC 4D7TA 4D69A 5KR7A 3HNYM 2CTVA 3D0SA 1GLHA 1VRH1 3MI8A 2OQ7A 3VBHA 1U5ZA 1MS0A 5H9RA 3NO8A 3KV6A 5FWEA 3ACLA 3D6EA 4FQZA 4CEYB 3OOXA 2YFZA 3AC0A 2WZR1 1OH3A 4FO9A 4C90A 2VBBA 2XJQA 4G4FA 5IVYA 5LA9A 4QPGC 3RJ2X 4JKLA 1LB2A 3JZVA 4I09A 1SPPA 1EP0A 4JQTA 4Y1ZA 5FKBA 1GUIA 3OBAA 4ONUA 1QWRA 3K4DA 2WLQA 3WINE 4RR3A 4W6YA 1VMJA 4A42A 3I2DA 2XKPA 2VCBA 2PYTA 1NXMA 1YI9A 1WBLA 1KFXL 4CE8A 4LK7A 2A6ZA 3R4UA 2WAAA 1QXJA 4CCLA 4QAWA 5JR2A 4HMZA 4JKMA 3A0NA 3WQ1A 4HPKA 4BQWA 3C7FA 1NCQA 1Y9QA 4C1XA 5A33A 1QJY1 3THTA 5KC5A 2JG9A 4WM8C 5FV3A 3WEZA 2OZ6A 2VZ3A 2VVEA 4OUEA 1W6OA 3GJAA 2WNVC 2JG9C 3EMRA 4WM8A 2QZ2A 1DZRA 4LHNA 3ZKUA 3TEWA 4D6QA 2WDBA 4MLOA 4OYUA 1XC6A 2VNVA 5EZWA 4BA6A 3I3DA 4RA0A 1JYNA 3A23A 5ACA2 3RZGA 4XFFA 2V5DA 2GDFA 4M4RA 2Q8EA 2FDHA 5L73A 4O9GA 4Q4Y2 1GFF2 3KQRA 4QQ2A 2ET1A 2HWC2 2QUOA 3HQUA 4TLGA 5LATA 3ZXKA 1IG0A 3CJXA 3A7QA 4RHV2 5K4LA 2HWB2 1ASJ3 1S0CA 1DGRN 2LUWA 4CUBA 2Q1ZB 4GWMA 4Q0PA 4DIQA 2HWB3 2FBEA 1UZZA 3DXTA 4O7XA 1XOYA 4QX3A 2WS93 2RDRA 1I5PA 2UU8A 3LKJA 2HBUA 2HBTA 5TSWA 1SMVA 3N7JA 4Q4Y3 4QB2A 1BK0A 3VBFA 3KT1A 5DUXA 1HRV2 2E9QA 1CZSA 4QPGB 3IMNA 1AX0A 1DYOA 1NQJA 1TG7A 2J1AA 5C3PA 5FYVA 2YGMA 4Y1VA 1W9WA 2RM23 2VQAA 4LA3A 1N1YA 1PK6B 4RFRB 2C26A 3WG4A 3EXUA 1PK6A 2EXHA 4IE4A 5C5TA 5C7GA 2WO1A 1XNDA 2V4VA 4HN1A 1PO23 3AB0A 4XIOA 3VHOA 3M7AA 5T3NA 2BEOA 2V73A 1RUNA 3ILRA 4AW7A 3WF0A 3WSOA 4AI8A 1W05A 3RZHA 3FX3A 2RVAA 4P9JA 5CYYA 2ATFA 3C7OA 1X9TA 5T5OA 3WQBA 4MGKE 3VKLA 1M06G 4QX7A 5FOBB 4FI9A 3WF1A 1XNBA 3ZYJB 5GZFA 3MZHA 4IESA 3POYA 4AE2A 3M8LA 3INAA 4AEMA 1HB3A 1UAIA 1WGPA 1JI6A 1DHKB 2VD7A 2GMMA 1Y3TA 5JMCA 1NE4A 1HRI3 4KNCA 2PAMA 2WZ8A 5BNOA 5I0RA 1X9PA 4P5HA 4FCAA 2CHHA 5FR3A 4I0BA 1OLRA 3UGFA 1BVVA 4Y20A 3VD7A 3S0MA 4JZRA 2Y6HA 1FOD1 4FOVA 1DDLA 2D6OX 5JPNB 1EV12 2JIGA 5HXMA 1OPMA 3V0BB 3U07A 1PM7A 4IV1C 4GD4A 5IAVA 2AR6A 4QPWA 4QT6A 5JOYA 1MACA 1V6JA 1TNFA 3QCWA 5IVFA 1OUXA 2D44A 3B9CA 3OGJA 1GWLA 1V9U3 1WKYA 4FPOB 1S0JA 1JS9A 4BQYA 1LGCA 1RUI3 3GM8A 4YVSA 1J84A 1IKPA 4Y22B 2X29A 1QQP3 3LEIA 3GZAA 3PIGA 4OI4A 4XQ4A 4FTEA 2VMHA 3WNPA 4LBLA 5BNPC 3CZJA 2VTXJ 4ZONA 3BODA 5FPUA 1YNAA 3QACA 3W5NA 2VOWA 1CJPA 4CEWB 1IPKA 4P9XA 3ACHA 4XUNA 4F7ZA 2E6VA 5D1IA 2WFF1 2HJIA 4CDUA 4DNYA 3MICA 1VBA3 1WCKA 4XUQA 4AQSA 1W0NA 1VBD3 4XZUG 1AX1A 1JU4A 3ZXGA 1LODA 2ZKNA 5FXWA 4QB1A 4B1MA 2A6WA 4NRQA 4HPKB 5CNAA 3ITQA 5BNNC 5DAQA 2W92A 2WQ4A 2DCTA 3HT2A 1W8UA 3OUJA 3VD4A 4RFT0 1GWKA 1I5ZA 1KD7A 1Q8OA 3TEZA 4FPHA 4HK8A 5JXJA 3BOPA 3VBUB 3ZM8A 4IEYA 3UETA 1OOPB 3GBWA 3NW4A 2Y8KA 1R082 5JSPA 1OOPA 3VHPA 4V2WA 3WW4A 4LIVA 3FFZA 3UKVA 1SFYA 4KI5M 1YXWA 3WDWA 1R1A1 4UFHA 1RUH3 2E7TA 4ASLA 1JUIA 3NNGA 1DP0A 4MXVA 5F2WA 4ARYA 2OPKA 1S0BA 2WS92 4ITCA 4M3CA 1OD3A 3E5XA 1C57A 3WUDA 2SBAA 3VBRC 2BGPA 2C5DA 3KCCA 4LJHA 1SFPA 2G9ZA 1QF3A 2VZPA 3AVSA 1EPWA 4HSLA 4PQ9A 1LOFC 1GKBA 2VMFA 4BQ2A 4CCMA 4IV1B 1VR3A 3U14A 3VLBB 2GMPA 2IWGB 2VZQA 3VZLA 2YB7A 2YMZA 4BWOA 3D0JA 4OZXA 4YGBA 3TBDA 5FZFA 4AI2A 2EA7A 1MS4A 4DXTA 4H7MA 2CSGA 5FKCA 3SCGA 1X36A 3IB3A 3TN92 4DRRA 4XFGA 3I3EA 3WP3A 3O1UA 1VBB3 4JTOA 2XVLA 5GJ6A 3O1TA 1BXHA 3NJVA 3VN4A 2LTNA 1QOTA 2WZR2 2ZA9A 3JXSA 2Z69A 1LHNA 1DU3D 1NY72 2XR4A 4YGEA 5KC6A 2AUYA 5ANQA 1ZBA2 3LOBA 4CP9A 1GICA 4Y5Z0 2TNFA 1O4ZA 4Q1PA 5KWRA 3KHCA 2ZGRA 3HN3A 3KV5A 4QHOA 4Y4YA 5J98B 4CCDA 2BOIA 4UXAA 3O7OA 1G9FA 5EHDA 2DUOA 1JZ5A 2A3YA 1MS8A 3TNPB 1OURA 1JODA 4RHV1 4QQPA 4Q26A 2P3KA 3WX5A 4FAGA 4YM1A 1HLCA 3DCQA 1QDCA 1AXZA 5FYIA 1NLSA 3ZIXA 2AYHA 2KD7A 3UL2A 4XEZA 1G9AA 3ZFEA 4CDUB 4KG0A 2NQYA 1PMJX 4HZFA 3T4VA 5FBJA 2HWD1 2DV9A 4URAA 5JXHA 1O5LA 1RUC1 3H3UA 5BNOB 3N9NA 5LBBA 5IVEA 2G19A 4MGTA 5F1RA 3ZX7A 4AHXA 2BU9A 3AZZA 4EJRA 2DCJA 1WA6X 1PGSA 5E6HA 2CDPA 1UZWA
chains in the Genus database with same CATH topology
4OI0A 2MEV1 1QJY2 3NJZA 4WM8B 1UN1A 3VZMA 1MZFA 1U5XA 2HWF1 4Q29A 1POV0 4L97A 1AR71 5FFOC 3AKPA 2W68A 1MEC3 2ZAAA 1CQ9A 1PMIA 1QJY3 3MIFA 3ZSKA 1B09A 5LEKA 1EV11 4I3PA 1ZZ9A 4H3WA 1ENSA 4M0HA 1BVP1 3B01A 1XE8A 1Q56A 4M3CE 4S2HA 2PHTA 1LGBA 1PGW2 2MNGA 5BNNA 4MX3A 5FQ0A 2OUJA 2RS13 4XF1A 4DS0A 1PO21 4Q2FA 1FV3A 1RUJ3 5FMOL 3B94A 1QJX1 4Y26A 4K1ZA 1VBA1 2KA3A 1SLAA 2AREA 4AGGA 1VBD1 5SV8A 4AEDC 1RUE2 4WZCA 4W65A 4WM7C 1RUOA 5JWPA 1FPN3 3S30A 4GKXA 4YFWA 3WLUA 4AHYA 1LESA 2RR11 4QPGC 2EXJA 1VRH3 2IFRA 2MPFA 1DFQA 1UIJA 3NL1A 4XE9A 2P17A 5FDBA 2ZCWA 1CGPA 1LOFA 2BNMA 3VBUA 4BH9A 2D93A 2QE3A 2WZR3 1HXS2 1HV1A 4XMAA 3IDCB 2HKXA 2NPIA 4XF4A 5K0UA 1RUD1 4M0NA 4RSUA 5BNQA 3LSDA 1MS5A 4Q0UA 4WVMA 4OHXA 1S55A 4LHKA 1POV3 4JRLA 3GALA 3WUCA 1V9U1 1KDMA 2FMYA 1L3JA 2WT2A 1H8TB 3ZN6A 1RUD2 3ZN6B 1AL21 3M70A 4P14A 1QGLA 1RUG3 2D3RA 2ZGMA 1VBE2 3H9AA 3VZJA 1ND3B 3ZMNA 2H6BA 5FPZA 3ZFFC 2UURA 3BU7A 2BGCA 1R083 4CZSA 3V64A 1N3OA 1TME1 3OBTA 4AFBA 1W6MB 4YG6A 2R0FA 2B39A 3VBSC 1ZREA 1XXNA 1QJU2 2A3WA 3HAGA 3AP9A 2GC3A 4XBQA 1HQNA 4AEKA 5T5LA 4N7UA 5FOJB 4F8AA 4Q4W2 1AR83 3D4KA 3J8F2 4KGGA 3I8TA 3SHRA 2A5ZA 3SISA 1GBGA 4DY3A 1DYPA 2ZHLA 2ZX1A 3KLSA 1JYIA 3OY8A 4BMEA 4L2NA 1DBNA 1U5YA 5D8AB 2DUPA 4XJ9A 1QY4A 5KHGA 1MVEA 4WVMB 1U12A 3SNMA 1QHDA 4ISQA 2PELA 3AKTA 4UBHA 3WW3A 5ACA1 5L7OB 1R1A3 3T2TA 2O1QA 1O4TA 2DVBA 2DFCA 2ZGQA 3PMSA 3WZ1A 1KFUL 1V9U2 2WJSA 1U5IA 2XJVA 1PO12 4UW6A 1UKRA 3USUA 1ZYBA 4ES9A 4LR4A 1HQLA 2VOKA 4Q4W1 4XF3A 4I02A 1J59A 3E5UA 4RGAA 3TRSB 3EO6A 3JUUA 3WY6A 4AFCA 5H9QA 1HRI1 1Q8VA 1VBB1 1COV1 4ZU4A 1QXRA 2HEYF 1NE6A 1C8M3 4RS5B 4KWKA 1ND2B 2BBVA 4KL1A 2K0GA 1H8TA 3BALA 2DURA 4XIKA 5CB7A 3MW3A 5DG1A 1CAVA 5JI7A 1O3QA 1Z7S3 3VBUC 5CA6A 2JICA 1T6GC 3PJQA 5CBLA 3TNQA 2OYZA 3ZSMA 3RYKA 3T1LA 3GZUC 4PF5A 3B69A 2VULA 4PLOA 1PO11 1KJLA 2VW2A 5CG8A 1W6PB 2Q4SA 1PO22 2XH6A 4Q8LA 3RI9A 2VMGA 4Z07A 5LRRA 1ZBA1 1WMEA 1XU1A 2RM22 2RJLA 1BKZA 1EAH1 1I3HA 1TMF1 1RGSA 4YVWC 2XVKA 3FJSA 5IK5A 1OQEA 1RUF2 2W0XA 1NA1A 5E8AA 5D8AA 2VG9A 2ZACA 2Q1MA 1ZA4A 2BQPA 5CAZA 3H8UA 1YYNA 1R093 4AF9A 1POV1 2XJSA 2GNTA 1MEC1 2JD4A 1Q8PA 4FVVA 2A7AA 2A3XA 1CAVB 1XU2A 4HLTA 4FPYA 1R1ZA 4LUKA 4FOWA 5A32B 4XBNA 2CNAA 3HMYA 3SCFA 2XBO2 2CAUA 2ZGLA 1W6MA 4IV3B 1G9BA 1RUH1 1HW5A 3JQWA 4NHMA 1BBT3 1REEA 4MGZE 4AVSA 5KHIA 1H0BA 2RS53 1SCSA 1GYKA 2SLIA 4KBBA 2D40A 1N1SA 3FZ3A 4EWAA 2GNBA 1ZBE1 3WG2A 3ZIWA 3ZXAC 3D8CA 2ZKLA 3GBGA 3NAPC 2XG3A 1AR72 1PVC2 1Z0HA 4FSJA 3LSEA 4FXGB 4GH4A 2R0HA 1REDA 3WHTA 1VBC3 2OW4A 4DINB 2ZGKA 3VZKA 3AZYA 5JR7B 4CP1A 5KXDA 4AYUA 5C8CC 3WHUA 4EROA 1FXZA 4RGGA 1BK1A 2RR12 1QJX3 1UU5A 3WNXA 3CF6E 4OFGA 1S1AA 2I45A 5JLVA 2YXSA 4J1WA 1WLWA 2ZHMA 3VBOB 1OHFA 2WT0A 4GMP0 1IS5A 3N3HA 5C4WA 1ZVFA 4A2UA 5JPMB 1DGRA 5K0UB 1AL23 4GA9A 4YZ2A 1GZWA 4A7YA 2A73B 2HWD3 1FT9A 1H1AA 5H9PA 2FZ2A 1HDKA 1DGLA 2AZ5A 2VVFA 1TME3 4R52A 2BNNA 1A8DA 3DPRB 3IPVA 2XGXA 3J26N 3EBRA 4YFZA 2RS32 3MW4A 5KXBA 1RTVA 1HXS1 3PVNA 3IDBB 2QQPA 4D94A 2XJTA 5CIRA 4HETA 4U36A 1BEV3 3RMYA 3MDPA 2GC2A 3TAYA 1A78A 3R6SA 1S0FA 2Z2SB 2VNGA 1NCRB 2XB6C 1VAVA 3QLQA 1MZEA 1O3RA 3O12A 4EV0A 1LOAA 4XXPA 4XHXA 2DF7A 5T5PA 4JRAA 4GALA 2KM2A 2XLGA 3LB9A 1AZDA 1BBT2 3PVEA 4YG0A 2XWJB 2VXRA 3BCWA 4G9SB 3VGIA 3MEPA 2BWCA 4LA2A 3HBZA 4MZUA 4N43A 4P9IA 1RUJ1 4AHZA 1YJKA 1RMU3 4NVPA 5K9YA 4MXWA 5EJ3A 4EN0A 3MIEA 2WL1A 5AFEA 1CPMA 1UL9A 2F6BA 2D98A 2I74A 4ATFA 3PVOA 2RMU1 1R092 4PIZA 4AK3A 4Z82A 4ISRA 2HEWF 3GYDA 4LBQB 5L7OC 1LECA 4AEJA 1DQ2A 1TE1B 1DQ1A 2B46X 3HN1A 4COVA 5I0SA 5GZDA 2BW8A 3U10A 2P3IA 4FBFA 1QMJA 1D0HA 3K48A 3TYJA 4HKLA 4QPIB 3ZYRA 1H9PA 4G3YC 2P3JA 2ARBA 4FOYA 1FYUA 1PK6C 3LA7A 3TB0A 3PTYA 3S7EA 5J7MA 3WG1A 1V6NA 2WNUA 3IWZA 2WNUB 5F5QA 3E5QA 2BFUL 2PTMA 3FBYA 1V6OA 4AQ6A 1FMD3 1J3RA 1Q5OA 3VDDA 1YFWA 4LLOA 4YZ4A 1C5HA 1FI2A 4GB33 1G9DA 1MZ6A 2MEV2 2WS91 4BZ4A 4IERA 3LAGA 2ZGPA 3VDDC 4LBQD 3M3OA 4Q4V1 5JVVA 3VUOA 4Q4Y1 1A3KA 2PHLA 1COV3 2JENA 2X5IA 2VOXA 4EN7B 2X5IB 4KU7A 3I4IA 1RUC2 1WD4A 2XL9A 3MFAA 1ULCA 4YZ5A 2UYBA 3LOIA 3MIBA 2P37A 5AVAA 1C8M2 3NVCA 3QBQA 3VBHB 1LU1A 1S0DA 2R043 2CWMA 4L9BA 4QQLA 2E63A 3G7DA 3JB4C 2ZGOA 4AI0A 5JIAA 2ZTNA 3LA2A 4XJUA 3V0AB 4Q1RA 1MS9A 3KT4A 1DGWX 1LCLA 4Q4X2 3VBOA 1JTZX 4MSVA 2W52A 5KXCA 2FZ1A 1CR7A 5B2GB 5C4WB 3CLPA 4LO7A 4QQHA 1BCXA 2ZZJA 4BLJA 4TSVA 1VB2A 4GKYA 1BJQA 1MQTC 5JZGB 4P9GA 2VOVA 3GZTB 1PIV2 4DMIA 2X8KA 1MQTA 1PGL1 1O91A 4AVAA 4JTNA 1ULDA 1QU0A 2QKDA 4XTPA 3ZYGA 1R1A2 2R061 2VECA 2WNVB 1PGL2 1H2LA 3M3EA 2D6KA 3NWKA 1XYOA 4KWJA 1W6OB 2IXHA 3B9IA 4M01A 4QMAA 5J3UA 2WINB 5FMOS 4WM7B 1LOEA 3VBRA 3RPQA 2VW0A 1YHFA 1NZCA 4JGYC 4COZA 3KD4A 3HD8B 4TZDA 1FAYA 4LLFA 4YW3A 3QD6A 4JGYA 3I59A 4KGQA 4C0HA 1J3PA 3H7JA 4P9YA 4LTAA 4Z2WA 4RS5A 1WLDA 3GHMA 3H7YA 1C8M1 5IK4A 4CEWC 1YO8A 1QJU3 1ULEA 1AVBA 2W08A 5KXEA 4LBMA 4LEJA 1B35C 3N7KA 2H6CA 3POSA 4QGLA 4XOGA 3JD73 3FLTA 2XKOA 4Z1VA 3IIAA 4HK9A 4LE4A 3JB8A 1AL0G 3WDYA 1VBE3 1CIWA 1RUG2 4O9EA 1LHOA 1W6NB 2B8MA 2YDEA 4H14A 4IETA 3DF0A 3V65A 4AEDB 1G86A 1LHVA 1Q3EA 5H9SA 4Q0QA 1F5JA 1OD5A 1VAMA 4EWEA 4IEQA 1AYM3 4XFBA 1J1LA 1MS3A 1CN1A 3FWEA 4XILA 3RS6A 4KG8A 3OCPA 4BM8A 2O8QA 1TQ5A 3ZFGA 5GLZA 4KU8A 1OSGA 3ENRA 2IZWA 2NN8A 1AR63 3NV1A 1ULFA 3RG0A 1FATA 3J4UH 2GN3A 1I1EA 3ZO0B 1VIWB 2DCYA 1PHMA 1AF9A 1PNFA 3KT7A 2JJ6A 2CYFA 3BTAA 1FPN2 4IV1A 3POWA 1DZTA 4YW2A 1ZX5A 2UWAA 1GSLA 1XYNA 2ES3A 5HI0A 1QKQA 1BEV2 4WV8A 2IC1A 1MR5A 2CWSA 2ZHKA 2PLV2 2OA2A 2QDNA 3TWIA 2IXKA 3JQXA 4L99A 2GAUA 4I0WB 4IV3A 2QDRA 1W0OA 4YVSC 1ZZCA 1K5MA 5CVRA 4IV3C 4RQPB 4M3CF 2PAKA 5FLJA 3L2HA 1NCRC 4Y22A 3U11A 5EFUA 1H4HA 3NV4A 3KGZA 3ZXEA 5GALA 1DGWA 2K2SA 2TBVA 3M3CA 1ASJ1 1Q43A 3FHIB 5T54A 5AVPA 2FQPA 5GM0A 4QM8A 4ZU7A 2ZS6B 3FUQA 2KXLA 2E7QA 2ZX3A 2DU1A 3A0KA 5BNOC 2UWBA 3EHKA 1QOOA 4BQ1A 3W58A 3AMMA 3Q9OA 4PIYA 1FNYA 1RUC3 2BVVA 3FLPA 3KSCA 2ZJCA 3APBA 2WLPA 5I8TA 1EPZA 5DUWA 2ZX0A 5BUVA 4Y20B 1C8NA 2D43A 3KZ4C 1WLCA 2PLV3 4GB32 3RJRA 3ROUA 2G4IA 1CONA 1QDOA 4PLMA 1KRIA 1RHI2 1MZ5A 1FNZA 3MW2A 1ZBE2 4IEZA 2ZBJA 1AR73 4YVWA 3WVJA 1AXYA 4TYSA 4WZFA 4COYA 1LHWA 4JQRA 1V6MA 3CO2A 3ZFGB 1DZQA 1QOSA 5HBAA 4COUA 3ATGA 3KCYA 2VVDA 1CESA 1NA1C 2YYOA 2ILMA 4XPVA 5L36A 2VNRA 2WWSA 2WA4A 2GC1A 3KMHA 2K9ZA 4IEOA 3WDUA 2F4PA 3MIGA 1GZ9A 3JBG1 4OHZA 1CX4A 4B29A 1FOD3 2A71A 1URXA 4ASMB 4RS5C 4S2DA 1G6NA 3RNSA 3JD71 1BEV1 1HKDA 1LEMA 3RYRA 4Q4X1 3VBRB 3TN93 4EN8B 4JCKA 4MUVA 5FPXA 4AFDA 5CFDC 4FPEA 3ZFGC 4BE3A 2EAAA 3AZWA 4FPFA 3JU9A 3WDXA 2WIIB 2EVXA 5C9AB 3WT3A 4YZ1A 1KJRA 1OMIA 3QOPA 4XXAA 4CEYA 5FLIA 3ZFFA 3AXDA 3PJYA 4MYEA 4XF0A 3WW2A 1PNGA 1ZRCA 1F31A 2QNKA 4OULA 4AI3A 1ZRDA 4JDMA 1D4M1 2ZMKA 4OHVA 2ZX4A 3WP6A 4GH4C 5IK8A 3R05A 2UYAA 1VB4A 3WQ0A 1LJ7A 2DVFA 4MGYE 1H1IA 1ZM1A 2JG9B 2DFBA 1SDWA 4B7KA 4EN6B 2LALA 2A6YA 4Q0VA 3ZSEA 4CTEA 4GULA 1CAWA 1GANA 3VL8A 3ME2A 1IPJA 1RC6A 3VV1A 1JH5A 1TME2 4XZPA 2R063 1PGW1 4E4DX 1C3HA 4KWLA 1BYHA 4YVSB 4JGYB 1AL22 2H0BA 2VQ0A 4FXKB 4R9BA 4NO4A 2B5HA 1VP6A 1YFUA 3SH5A 5J96B 2HYKA 3K51A 4YZ3A 2D3PA 3IM0A 3RDIA 3ZXDA 4YM3A 4BCUA 1OFNA 1ZNPA 4YM2A 4INDA 2X53S 2JE9A 1S0EA 1O7FA 3UK9A 3RQ0A 2YGLA 1QNWA 3KM5A 4XJWA 2BYVE 4DRVA 3D82A 4RQPA 4CP0A 2A6XA 4WVWA 1YFYA 1ZZ8A 1ZRRA 4X8NA 2WZPP 4NHKA 2JDZA 5C9AA 4Y1XA 1COV2 4F83A 3BOWA 1SEFA 1SLIA 5FO9B 3CU7A 1FPN1 1DQ4A 5F6LB 2R071 1A8MA 3OPZA 4WVZA 5GLUA 1QJZA 4Q4W3 3AP5A 2RS31 2DCZA 1D2SA 3H50A 3FE5A 1C5IA 4E2GA 1SQ4A 2XBO3 4QQOA 1CD3G 1WCDJ 2ZABA 4Q8KA 2Q8OA 4P9WA 5DUUA 3UJOA 4X8PA 3ZXFA 2RHPA 4P9LA 2ZOEB 3M3IA 2Z42A 2AH2A 4QU2A 4AG4A 2Y38A 4BIFA 1EYBA 4XFIA 3W9AA 2UY8A 1CAUB 1G8WA 1N1TA 3O0VA 2I2SA 4E2SA 4QD2A 1AYN2 4XJZA 1YLLA 1RJ8A 5FLHA 2BWAA 3OBRA 1XNCA 3AYEA 1C4RA 3MIDA 1U0AA 1LOBA 3MF9A 3RSJA 3FFQA 4LHLA 2EXIA 3ZFFB 4AGVA 2HWE1 1PIV1 5ACA3 2D6NA 3PMEA 1OI6A 5CG9A 4E4ZA 3FC0A 3AYDA 2C0ZA 4JDNA 2XHKA 4I3GA 1V6IA 3ZFEB 4QXKA 5KBFA 4JDOA 3WP4A 3WW1A 3LCPA 4PDWC 4W6XA 1LR5A 3FLRA 1W6NA 3ZDSA 2CY6A 3IKWA 1GNZA 3CEWA 5JDBA 4CDQC 2CGNA 3GHNA 1RVF1 2FMDA 1M4WA 1X82A 4DNYA 2EAKA 4LE3A 4XQDA 4YARA 1XYPA 1RUJ2 2GN7A 4IQPA 2I07B 5EV7A 3VBSA 2ZGSA 5I8YA 5L19A 2ZMNA 1OQDA 5EYXA 2MHFA 4AFAA 5LK5A 3AMPA 3AP7A 1J58A 4Y1YA 4YNIA 5I8SA 3OD0A 1J1TA 4U2AA 1NLRA 1UZYA 4Q4X3 2JG8C 3KS7A 1UF2C 2NLRA 2DUQA 1PO13 1EY2A 4BMBA 4DB5A 2JG8A 2YPJA 2R1BA 1RITA 3MF6A 2R30A 4SBVA 3V0BA 1TNRA 1YI7A 2DVAA 4C91A 1GQHA 3NKGA 1ZRFA 3ZSLA 4DQAA 1CVNA 3IN9A 3ZXLA 4YGCA 2WNEA 3G6JB 4JGZA 4BOWA 5JCTA 1YCIA 3CNAA 1V70A 1JUHA 3O14A 1YWKA 3OYWA 1WBFA 1UW8A 3IBMA 1H9WA 4FQ4A 3E6BA 4QX5A 2ZAHA 2D6LX 1OA2A 2E51A 1PVC3 4LT5A 4K8FA 3L2YA 3M2MA 4CEWA 2O0OA 4LBOA 2JX9A 1LHUA 1V6LA 3H0OA 2JKBA 1AR62 1ENXA 2DWRA 3AFKA 3VZNA 1SLLA 4HVQA 2DVDA 3VBFB 2VPVA 3ZVXA 4RR3C 2B42B 3DN7A 5GZCA 1D4VB 4YLZA 3KCXA 5L7OA 4Y1UA 4N9IA 1AYM2 3DPRA 3I54A 4YGDA 4IEXA 2OVUA 1SBDA 2PHUA 4OHWA 4AWDA 1CAWB 2VU9A 5BNPB 3HWJA 3ST7A 4DPNA 1UU6A 4NR1A 5CU1A 3MLLA 1XRUA 2XPJA 1R091 2YUEA 4N53C 4UW4A 4OLLA 1AXKA 1HV0A 3AMQA 5LRSA 3AP4A 2HWB1 4ORFA 1JXNA 2Q0AA 3OTFA 1S0GA 1ULGA 3AXEA 3OYWB 4FAHA 2XLFA 4UW5A 3AJYA 4QGNA 2B45X 4WBBA 1V00A 1UU4A 1VBC1 2XL7A 3WQ7A 1KITA 3CJIB 1O5UA 1GZCA 1RUH2 3CJIA 4R9CA 4A7KA 2HWE3 4B4QA 4H7LA 4YYOA 5BNNB 4IEUA 3GBFA 1VAKA 2EIGA 1GR3A 2RS51 5BY5A 4HBNA 4OI2A 4LULA 4D7YA 1RJ7A 4XJAA 3TN91 3UJQA 5C8CA 1ZBE3 3AP6A 4JV4A 5C8CB 1RHI3 5FBZA 3H1MA 4F3JA 1N3PA 2QJVA 2Q30A 3VBOC 1BMV2 1Y43B 4HVOA 1YUDA 1OA3A 3KB5A 5ABJC 3SH4A 1RVF3 5EXOA 1XQNA 5ABJA 3WR0A 5ABJB 5J36A 4HANA 2VH9A 2EF6A 1WLTA 2C1FA 4CYDA 3THPA 5J37A 3OY8B 3VKOA 3N35A 1Y7BA 3VHRA 1ONAA 4YW1A 3S6PA 1IS4A 4KQ7A 2IXLA 5IUQA 2QVSB 1PZ7A 1RUI2 1NCQB 1RINA 2HWC1 1IS3A 4X6QB 5KHHA 3OJBA 2BNOA 2PHFA 3R4DB 3WOGA 1UX6A 1X8MA 3EQEA 4B8EA 3URFA 3N7LA 3E97A 1W6QA 4ZKTB 4QM9A 2A6VA 2R32A 4HN0A 2ZGUA 2GU9A 4N7IA 1DG6A 1LTEA 5T5JA 4J1XA 4AXOA 2WFF3 2PN5A 1B35A 1QH7A 4LNVA 1CAXB 3E6DA 3BPZA 5JI9A 1UPSA 4R8HA 3SLIA 1PVC1 2JG8B 2IXJA 1ENRA 4B3NA 3NKTA 4META 2RS52 1RUI1 3BIWE 3AKRA 3VKMA 2RMU3 2NZ9A 3FUOA 4GMP1 1KS5A 4CDXC 3AJZA 4LO8A 1SLBA 3NV3A 2E53A 3R4SA 1AJKA 2BVBA 1UCXA 3D5OA 3ILFA 1SLTA 1HRV1 1ZZBA 2HEVF 2DYCA 1ZZ7A 1WW6A 2N7GA 4PIXA 2NMNA 2DU0A 3ZXJA 1AYN3 4YW4A 1C1LA 4JAAA 2EXKA 1RL3A 4PCRA 2Q5TA 5HXVA 3WDVA 2P2KA 1LOCA 1NCQC 4TLFA 5KHKA 1A6CA 2GH8A 1E57A 2Z79A 4HSJA 3AMHA 3JD72 4MH0E 3VHNA 3ILNA 1ASJ2 4Z92B 4GQ7A 4I01A 2PFWA 1WA4A 1H8VA 3VBFC 1RUF3 4BHPA 5T50A 1OFSA 4MV2A 1QH6A 1F8VA 2NM1A 4PBOA 1ND3C 1ND2A 3VKNA 4K20A 1VLNA 1HXS3 3B93A 1ND3A 5GZEA 1ND2C 1X50A 1KS4A 1SLCA 5FCCA 3FMGA 2VNOA 2D6MA 4YSFA 4CDQB 2BUKA 3CJIC 4N90A 4K7JA 4AVTA 2VUAA 3AYAA 4HL0A 1C28A 2RE9A 5A3MA 1RUE3 5JOWA 1Z7S2 4YG3A 1GQGA 2VW1A 1LEDA 1B35B 5GZGA 5T55A 2FHRA 2XJPA 2UWCA 5JOZA 1PIV3 2RS12 1JW6A 2XWBB 3O5SA 1YJLA 2YC0A 4AGRA 4IL7A 1BQPA 3MYXA 2WNUC 4AVVA 4R4ZA 2Y26A 3WDTA 3UKNA 3ASIA 3J8F1 3ZFEC 3WCRA 2D6PA 4ATEA 4R9AA 1H2KA 2Y0OA 2V09A 4XQWA 3H1WA 2XJUA 3E6CC 1G7YA 4H55A 1PVXA 4L11A 4FPGA 1EV13 4XYXA 5JAXA 2WSVA 5BNPA 2R062 3HT1A 3LA3A 3DL3A 5C33A 5EYYA 3LGRA 3FBMA 5A32A 3AX4A 4BPZA 1W6QB 1UIKA 4RD7A 4XF9A 1HRI2 2DVGA 3VBHC 1SBFA 3R0RA 4XFHA 3ECQA 3OF1A 2MEV3 3V56A 1IZ3A 5CADA 4IXLA 4BIOA 1EAH2 1TMF2 1I9RA 3MPPG 3CL1A 3W59A 1YFXA 5GLTA 1AR82 1UKGA 5JOXA 3P3PA 4FP2A 4AVCA 2BPA2 1RHI1 1V6KA 2PQQA 1IKQA 3VDDB 3M4FA 3WG3A 1F5FA 4GB31 3WXPA 4RL7A 3AKSA 4Q0SA 5E16A 2WFPA 5FTTC 4N43B 5DDJ2 1WUVA 3EJKA 1JHNA 2CGOA 4ZXKA 1KQRA 2R16A 1AYM1 3GF6A 3L9JT 4LBNA 1HRV3 2JXAA 5AC91 4NOTA 3ZPYA 4CDUC 1AR92 1CPNA 2DTWA 1S2KA 2QZ3A 2WNVA 4K40A 4MVTA 1RUD3 4NWWA 1VBB2 4DZGA 2XJRA 1HQWA 2PLV1 1CAXA 4LBQA 1AR61 5DZEA 4D7SA 4PBPA 2GC0A 2BTVC 3DGTA 5JSOA 1D0GA 2WT1A 1AHSA 1YIFA 3HR9A 3WV6A 3MFCA 2HWC3 2ZHNA 5DZGA 3P3NA 1FOD2 4IEWA 3ZN4A 2GMEA 2Y0IA 1UPIA 2NP0A 4MXWB 1WMFA 3RYPA 2EALA 5K0UC 1AX2A 4XJ8A 5BPXA 2G9GA 1R081 2DCKA 3IPVB 5CFCB 1AR93 1QNYA 4LBJA 4XW3A 2JEMA 4X6RB 1DQ6A 4Q27A 4QHBA 2V5YA 3MPBA 5DDJ3 3QH6A 4CDQA 3USUB 3J9SA 1DLLA 3O0WA 4GIQA 3AYCA 3RI8A 4UW3A 1UMZA 4FTSA 3MIHA 1AJOA 3IT8A 1NCRA 4AFMA 1J3QA 4HT1T 2IXCA 3HIFA 4UBGA 3ZSJA 1HIXA 1RUG1 5HCAA 5DZFA 1VBD2 1KDKA 2YROA 4S2GA 1VBA2 3ZN5A 4IEPA 1ZZ6A 2ARXA 1EAH3 1TMF3 1DIWA 1QXPA 1KXGA 2GALA 4EWDA 1NG0A 2WQZC 3B02A 4QPYA 1QJU1 2D3SA 2PHDA 1IS6A 4FPLA 1H2MA 4OZXA 4HKOA 4GXLA 5E1RA 4CP2A 3N4MA 1OPOA 3T1MA 2H0VA 1IQAA 3ES4A 1NA1B 5LK7B 1BMV1 1AYN1 1OLQA 1O3TA 4GH4B 1DQ0A 5J09A 4NWVA 5C9AC 1VBE1 5A3LA 1JOJA 5BXXA 1W0PA 5BYNA 4N53B 1W6PA 2R072 4FT8A 4B7EA 2RR13 4LO5B 2PHWA 5DG2A 3PLQA 2R1DA 4MGIE 2A75A 4C0BA 1VALA 1XNKA 4YM0A 5C8WA 4XDQA 1K5MC 1VBC2 1VJ2A 5JSRA 3PHMA 4PJYA 5EWSA 2PHXA 3JBG3 4K6BA 4RQPC 5I0TA 4QGMA 1LRHA 1NXD1 3JCIA 1GZWB 3NV2A 1SFNA 2P34A 1ENQA 1GNHA 3I59B 4HVRA 4I0AA 1LU2A 4LBKA 4AI1A 1PZ9A 4DFSA 3C2UA 2HWF2 3QH7A 3ETQA 4K9SA 3AKQA 3N7MA 5FO8B 1RUE1 3DV8A 4FTBA 3DPRC 3NAPB 1ZBA3 5F6KA 4CDWB 1W39A 4URTA 5E89A 1APNA 3B00A 1SACA 5CFDA 2OZJA 1I6XA 1WD3A 4LUMA 2RM21 4HKWA 1D2QA 4N53A 2A70A 2CL2A 1X8EA 2GZWA 4I30A 3B5LB 4YRDA 3M1HA 4AEDA 4CEYC 5IT6A 1CJDA 1D4M3 2D5FA 1OOPC 1O3SA 3TOJA 2ZGTA 4R4XA 3HQXA 2YZ4A 2R6QA 1LULA 1AR81 3LZZA 4E9KA 3S7IA 2WC2A 1C1FA 4PDWA 4ES8A 2ZMLA 2R49A 1NOVA 3B3QE 5GKAC 4GMP3 2VGDA