2OIIA

Structure of emilin-1 c1q-like domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
150
structure length
131
Chain Sequence
PVPQVAFSAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNQGVARVDSGGTLGVFSLILPLQAGDTVCVDLVMGQLAHSEEPLTIFSGALLYGDPELEHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EMILIN-1
publication title The solution structure of the C-terminal domain of EMILIN-1
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 6
structure length 131
sequence length 150
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oiiA00
2WNUA 1JTZX 4E4DX 4QQPA 2TNFA 4F3JA 4NN0A 1XU1A 2RJKA 2R6QA 2WNVA 2WNUB 2R32A 1PK6B 5KC5A 2JG9A 4QQOA 4E4SA 5HBAA 2O0OA 1D4VB 2HEVF 3AB0A 3IT8A 1OQEA 2JG8B 1RJ8A 2WNUC 1PK6A 3TYJA 4TSVA 2KA3A 2X29A 4G3YC 4G4FA 1DG6A 2WNVC 3URFA 1TNFA 1JH5A 1ALYA 3ALQA 2JG8A 1IQAA 1A8MA 2JG9C 3V56A 1XU2A 4QPYA 5KWRA 3LKJA 4OUMA 1DU3D 5CIRA 4DOUA 4EN0A 2E7AA 4KG8A 2ZPXA 1RJ7A 3B9IA 4D7YA 1PK6C 4MXWB 1TNRA 1KXGA 4RSUA 5L19A 2OIIA 5KC6A 4OULA 2Z5WA 2HEYF 2HEWF 1KD7A 2RJLA 1I9RA 1O91A 4MSVA 1U5ZA 1OQDA 2AZ5A 2JG8C 3L9JT 4HT1T 4QQLA 4KGGA 1C28A 4MXWA 1D2QA 1D0GA 3ME2A 4QQ2A 4GIQA 3TWIA 3B93A 3WD5A 1GR3A 2R30A 3B94A 2Q1MA 4KGQA 4J6GA 5BNQA 1WCKA 2QDNA 3QD6A 4TWTA 1S55A 2ZJCA 3K48A 2QE3A 5TSWA 3K51A 4MXVA 3FC0A 2Q8OA 1U5XA 1U5YA 5L36A 2RE9A 1OSGA 4DB5A 3MI8A 2WNVB 3QBQA 2TUNA 4N90A 1C3HA 2JG9B 4QQHA 4OUSA
chains in the Genus database with same CATH superfamily
1QJU1 5A3PA 3BODA 5DG1A 4A4AA 3WF4A 1YQ6A 2GH8A 1GZ9A 1S2KA 1H8VA 1V9U3 4MLOA 3Q8FA 3UKNA 5CFDB 4XFAA 1J84A 5DXDA 4YVSA 4YARA 4RHV1 1XNBA 1BXHA 1ZBE1 4AZZA 4OZOA 5CBLA 2OYZA 2P34A 3CKHA 3POWA 2WNOA 3IDEA 4Q1PA 3ZYJB 3T09A 3H8OA 1QNYA 1YIPA 2B9UA 2DF7A 3LSEA 5C4WB 1DP0A 3VKLA 3WDUA 5F3GA 1BEV2 5EYYA 3SEPA 4ZHNA 2IXKA 1H6YA 3KMHA 1FI2A 4HK8A 3W5NA 1W6MA 3I2DA 5DAWA 1NQJA 1GZCA 5ABJB 1H2MA 1RUI2 2XVGA 5FLJA 5JPNB 3KGZA 5FZ8A 4ITCA 3SH4A 1FV3A 4UAPA 1SPPA 2IXCA 2VVFA 1G86A 4IE0A 1HN1A 1TMF2 2WZ8A 5BNPC 3ACHA 3VBOA 2E26A 2IXJA 2VQUA 4ZY9A 2HWE2 4YW2A 1PIV2 1XNCA 3DCQA 5KHHA 5T55A 3JU9A 1I3HA 1SLTA 2XLGA 1PO11 3LPGA 3KWVA 3LFMA 3WP3A 4AQSA 4E8CA 2ZX1A 1OH3A 5FO8B 4XJZA 3WP5A 1SMVA 5FQ0B 4AGRA 3PHMA 3GJBA 3VBFB 1W39A 5L9RA 4AOCA 1MZEA 2W2IA 4NO4A 4W50A 1IG3A 5DDJ3 3VUOA 1IKQA 2VNVA 4AR2A 2DUPA 1VBD1 2VECA 4Y1UA 5A7OA 4ATFA 3J7MA 1DFQA 4CE8A 2R49A 3WNLA 2E7AA 2I07B 3OPZA 4KG8A 1MS3A 1JYIA 2RS33 1VBE3 4QKBA 4CXXA 4PF1A 3WQ1A 4OHVA 4Q4V2 4YM2A 5FYUA 1R081 1SHWB 1UL9A 3KF3A 4IERA 4INDA 4IDZA 3TRSB 1JHJA 1JS9A 2D40A 3AMNA 4RR3A 3EO6A 2QTWB 2YXSA 5CKMA 4YFWA 2DVAA 5DN2A 1J3PA 2EVXA 4CDWC 3PTYA 1LECA 3I54A 5JIUA 2V72A 3GNEA 4NAMA 4AVVA 2EALA 5I0RA 4URAA 3I3MA 1LOEA 3N7LA 4FFIA 4OZXA 5LASA 5BNNA 3ZN6A 1TVGA 4R8HA 1CGPA 5C33A 4DUWA 1GR3A 1JYXA 4I2OA 3IDCB 2VGDA 4FO9A 2D97A 3RJ2X 4CEYC 2ZAHA 4XFHA 5DQ0A 2CL2A 4AVSA 4OI4A 5D8AB 1OC1A 1AX1A 1H8TB 4FPCA 3RSJA 1J1LA 1S55A 5FOJB 3RMYA 3DGTA 1DZTA 1VMJA 4CCDA 2B4KA 4OI1A 4LMFA 5GKAC 4F7ZA 2A73B 4DUXA 1WW6A 2LALA 2QZ3A 2GN3A 4YGCA 1BK0A 4HLTA 1D4M2 1IG0A 1HRV2 4XJWA 5EQUA 3AP5A 4AI1A 1V00A 1X50A 4WVMB 2WL1A 4CRQA 5JXIA 3N4MA 4N7IA 3ZFGA 1OF3A 1GZWA 2W3JA 1N1TA 2PHDA 4N9IA 4OUSA 1ENXA 4PLOA 4BK5A 3HN3A 5GZCA 2DYCA 2RR11 5BV6A 5HPOA 2HWF1 2BUKA 4P14A 2OVUA 4F3JA 4R52A 4QPIA 5IJRA 3AP6A 1Q8SA 2R063 1JN2P 2DCTA 2PQSA 2RMU1 1W6QA 4JZRA 4ET7A 1NQDA 3O1UA 3IIAA 2YC2A 2ZABA 5J09A 3OSDA 4JRLA 3P6BA 1UZWA 2E51A 1YLLA 2VOXA 2MEV1 1W9SA 5CADA 4CXYA 4M3CE 3ZXFA 1HRI1 5A3TA 1K5MA 4Q4Y1 4XUTA 5AC92 1OHFA 3DECA 1J59A 5HBAA 2YYOA 3LEMA 2P17A 1Z7S3 1IKPA 1AYN1 1GBGA 1NE6A 2B45X 1KFXL 2FMYA 3E5UA 4JGYB 3UKVA 4RFT0 2HWD3 4WV8A 3T1LA 5JZGA 2IXLA 5GLUA 4BHPA 5EIYB 4QM8A 4YGBA 1GOFA 3EHKA 1O5LA 4LBKA 2EF6A 2FDJA 1AR73 1SBDA 4A7ZA 1PM7A 1TME2 3QOPA 3HQXA 4Q0SA 4CDQC 3H7JA 5F3EA 1RUJ3 5FZAA 1GICA 1BMV1 1L7RA 4CCJA 5FZ3A 5F37A 3WNOA 1H9WA 2V09A 2Z79A 3NV1A 4XYXA 1S0DA 2MHFA 1XNKA 2AR6A 4LKSA 5A7PA 3WDVA 4LO6B 4JKMA 3UGGA 1RUH3 5HXMA 2JECA 2QQLA 4OUMA 1SLAA 3ZVXA 5CFDC 4AF9A 2IWGB 5JWPA 3VBUA 1PGL1 2WT1A 1XYOA 3AKPA 2J1VA 1UQXA 3L2YA 1PVC2 3KVAA 3A22A 3MHZA 5JXGA 1QJZA 4D7YA 3NNJA 2DUQA 1DYKA 3CNAA 5DPNA 5GLVA 5IATA 1R093 2P2KA 5LA1A 3V0AA 4LIUA 4RS5A 3SC7X 5FZOA 5CA6A 5L19A 4S2GA 3Q8CA 1MQTB 3JB4C 3ZPOA 4B29A 2JB4A 1SFPA 1B09A 1B35B 4OULA 4P9YA 4XE9A 1O3SA 1PNFA 4QB1A 3DPRB 1Q5OA 3LFIA 1NAEA 1U5ZA 2VCMA 2ZEXA 2A6VA 2JDZA 3D5OA 3JBG3 4QM9A 1POV3 2GP5A 4HT1T 5E8AA 3RGBA 5KR7A 3ME2A 1FPN2 1DQ0A 4AQTA 3ZSEA 4HXCA 3WY6A 4L11A 2CWMA 3WUDA 1YJKA 3WP6A 4XCAA 1LTEA 2WA4A 3AL5A 1GMMA 2TBVA 1CAXA 1QQP2 1CPNA 1EAH1 1UPSA 3AP9A 3JCIA 4JDOA 3U10A 1VB2A 1QWRA 3R4DB 1U5YA 2XJPA 4YWAA 5C3SA 1W03A 1EV11 1T6BX 4NRQA 1QOTA 2FMDA 2VBBA 4IV1A 2Q0AA 2WS93 1Q43A 4CCNA 4M3CF 2VJXA 1JODA 2UURA 3IKWA 1H2LA 4N9HA 4QDQA 4BLIA 1G9DA 2JG9B 4PQ9A 4QAWA 3AMMA 5FYYA 2NMNA 2A3XA 1AL23 1D0HA 3OEAA 1JTZX 1Y9GA 4YZ5A 4PIYA 4FXKB 3KD4A 2TNFA 4CDUB 3HPNA 1XU1A 3NL1A 2W5FA 3IN9A 1CN1A 2EA7A 4GH4B 4J25A 5H9SA 4NIIA 5IK5A 5FZ1A 1ZBA1 1LAJA 2WNVA 3M2MA 4JX0A 5GZFA 1QEXA 1WKYA 1QNWA 3GBWA 4XDQA 3VBSB 3H3UA 3HNBM 3CL1A 2Y60A 3AZVA 5ERLA 3POYA 4NRMA 3ZYBA 2VZ3A 4ZZ8A 3AKRA 3WG1A 1OMIA 3C7OA 3ZFFA 4AHXA 1BBT1 3FBMA 2BFUL 5D8AC 5APAA 1RUE3 4BMBA 1H8TC 3WNPA 1AXZA 3AZZA 3OEBA 5EHDA 1W2AX 2VOWA 1W9WA 2GU9A 1OT5A 3WXPA 1IS3A 4NIHA 5EYXA 4I0WB 2XBO3 3M4FA 4YG6A 3VBFA 1DZRA 2O1QA 4CDXB 3JQWA 3S5AA 1OI6A 1EP0A 1APNA 3HNYM 4OHYA 4QX2A 5E89A 3IBMA 3D8CA 2NM1A 2Q8CA 1UOBA 4HVOA 3NSTA 1NA1C 1HV1A 2A3WA 4MZUA 4TTGA 2H0VA 1J3QA 2BJSA 2ES3A 3B7MA 4R4XA 5KWRA 2VW2A 4ORFA 5FXVA 1GSLA 1KS4A 1QOOA 3VD7A 1W8HA 2VO5A 1ENRA 2VOKA 1G6NA 1QKQA 2JWPA 3KV4A 1HX6A 4CU9A 5FBZA 2WABA 3MLJA 1SBFA 2V73A 4LLFA 1ZZ8A 3KM5A 2ZGTA 3HMYA 1GU3A 3K4ZA 4QB2A 4R9AA 5I8SA 1NCRC 5FP7A 1HDKA 3PL0A 1UY4A 4N8MA 1UY3A 2AGSA 4YW5A 4M01A 4JDMA 1MR5A 3CJIB 3D4KA 4DPNA 3ZXJA 2D6NA 2RM23 2WFF2 3USSA 3ZXAC 1E57A 1C8M2 5FLIA 4Q1RA 3QLQA 3SCHA 1POV0 4K20A 5F2WA 2ZACA 4N43A 4XF3A 1YJLA 5G05L 4GIQA 2G4IA 4Y33A 4XCBA 4AGVA 4KWKA 4XUQA 3ZMNA 4QB6A 1ULFA 5AC91 4E9KA 3MBWA 4UW6A 4NAOA 3C7EA 5IW0A 4DY3A 5BUVA 1YXWA 5DABA 4LBQA 1LHUA 3RI8A 1HB2A 2BTVC 2ZGUA 3J8F3 1WBFA 3T30A 3ON7A 5FPBA 1MZ5A 3O0WA 2J22A 1LRHA 2GC1A 2PLV3 1JOPA 5J7MA 5JR2A 4QT6A 3BCWA 1YCIA 4RQPC 3WF0A 4Y5SA 3ETQA 4FP2A 4U2AA 1CJDA 3KSCA 2WO7A 2YBSA 4HN0A 5KXCA 1UYZA 2JB8A 3LEGA 4IQPA 4LORA 1YFYA 3GF6A 4FAGA 4P9XA 3VDDB 3WG2A 1XPWA 1SBEA 3SMHA 5FKBA 5I91A 2W52A 2BVBA 1PVXA 3WW1A 1GLHA 2VCBA 4E4DX 3T2TA 4YW3A 5FUNA 4BMEA 3TEWA 2WT2A 1GWMA 5EPAA 2DCZA 4I0AA 4MX3A 4BQ3A 1VBC3 2FCTA 2HYXA 2PHLA 2VMDA 3POSA 4QX0A 2Q1ZB 4DRVA 3FMGA 3AMHA 1AYM1 3AJYA 3N35A 3PVEA 4UT5A 1QGLA 1BKZA 2R32A 3J7LA 3ITQA 1PVC1 2ZEYA 1UYXA 4FCAA 2XUMA 1RUF3 2VMHA 4LBQD 3GDBA 1LKNA 4QGNA 1N3QA 1FV2A 1UZZA 2K2SA 4A7KA 1OURA 4ASKA 1QXRA 1AX0A 5DG2A 4DXZA 1SCRA 4LOSA 1UZ0A 3R4SA 2PYTA 1HB1A 1W8OA 4META 1N1SA 2DV9A 3OBRA 4BM8A 2VNGA 2FQPA 3LDRA 4GAZA 1OOPA 4XJUA 3ZYHA 4CEWB 5F5QA 4QKFA 4Y1VA 5A6ZA 2YU2A 2CYFA 4LA3A 3EB7A 4LO4B 4D94A 2ZMKA 3IM0A 2D3RA 4LHNA 3R0RA 4Y22B 5FPVA 4CCOA 3FHAA 4G4FA 5I93A 2BV4A 3VKFC 2XVKA 5E88A 2GC2A 2AREA 5LA2A 4NHXA 4YZ2A 1AR81 3URFA 1DGRN 3VBRC 4WVWA 1DGWA 2A6YA 2CGNA 1STMA 2J1UA 4K1ZA 1ALYA 2JG8A 4PDWA 2B42B 2JG9C 4M4PA 1O5UA 1QQP1 4GQ7A 1CAWA 1LNSA 1RMU3 4SBVA 4B3NA 1RUNA 1RHI1 5LK5A 3WF2A 3SQOA 2GDFA 1NCQB 1C1LA 3I3QA 1AR61 1LU1A 4IEYA 5FAXA 3ZX7A 1ZA4A 4GH4C 3TEXA 1MQTA 1LOFA 1F2NA 2W08A 3T2QA 4E4HA 1HQWA 2JICA 1B35A 1DYOA 1HXS2 1MEC1 4P9GA 4XHXA 3A7QA 4QKNA 2JE8A 2WRAA 4IE6A 2QQWA 2VY0A 2ZGSA 3R6SA 5HCAA 1XRUA 1JYVA 2R16A 1YEWA 2WAOA 2J1RA 1VBA3 2Y26A 1OUSA 1W6NB 4N7UA 4WM7B 1NX9A 2P6CA 3KZ4C 4LXLA 3GBGA 3TBDA 4YG0A 4MSVA 4CCCA 4BQ1A 2WA3A 4XIOA 4AVCA 4IEOA 4LKEA 3MUZ1 1C28A 2UU8A 4MGQA 2RS13 2OQ6A 1NZIA 3E5XA 5FMCA 4NWVA 2WINB 2YUEA 4BISA 2ETEA 1W2UA 2NN8A 2ZCWA 1JMUB 2ZAAA 3JB8A 4LBOA 2ZZJA 4CDXC 3IMMA 5CFCC 2R043 4ASMB 5FV3A 1OA4A 3MLKA 5T52A 1Y4WA 4HPKB 5TSWA 5DMYA 1S0FA 5FO9B 4PI2A 3SHRA 1VRBA 2Y8KA 4K6BA 4CDUA 1VMHA 2R1BA 4W8JA 5E16A 5A32A 1US2A 3ACFA 1PO23 2AEZA 1FNZA 5CISA 5FFOC 3TNPB 1QY4A 1PZ9A 2HWC1 4FPGA 1LOCA 1PMIA 5T5PA 4Q4X3 1DDLA 2GMMA 2B7YA 5FZHA 2PAMA 3WHUA 4ZKTB 4RSUA 3ASIA 1IOAA 2D5FA 2Z2SB 5F2SA 3MICA 2ZA9A 3H3LA 3NO8A 4L97A 2WJSA 5B2GB 4OQ8A 3X29B 5JLVA 4XJ9A 1GQPA 4GKXA 3WHTA 3CJIC 4FXGB 3MW3A 1MS1A 4D6QA 4H55A 3BTZA 4UFIA 2FDKA 3EQEA 5HCFA 2SBAA 1PM4A 3DKWA 4XBQA 5FMOS 2KR2A 1LU2A 4KL1A 3K4DA 2JDYA 2RDRA 3T08A 2O0OA 5I0DA 4OHWA 2HEVF 3WW4A 4NRPA 5C8CC 4Q0PA 1W05A 1CPMA 2FDIA 3PUQA 1PK6A 3I4IA 3IDAA 4GJZA 2JXAA 5DDJ2 3TYJA 3U0ZA 3VDCA 4XJ8A 3THTA 5T5LA 4D0QA 1OKOA 2A7AA 1ND2C 2FBEA 2NLRA 3I97A 3INAA 3MLLA 4G3YC 4MHUA 4QX7A 3VZOA 2XJRA 2WKKA 2Y6LA 2RS32 1VBE2 3GBFA 5FZ9A 5FZ0A 2Q8EA 1VJ2A 2ARBA 3RI9A 3L2HA 2CGOA 1FX5A 3OB8A 4IEVA 5FZMA 3ALQA 2VTXJ 3N9PA 4LO7A 2W39A 5L7OA 1XU2A 2QQNA 4LIVA 4IV3C 4XDPA 4LK7A 2W92A 2IFRA 4AXOA 3ZFEA 1LEDA 1HW5A 1ULOA 3AVSA 1ZA7A 2Z42A 3PVOA 4BJ0A 5A3WA 5CIRA 4EN0A 1QJY3 2OZ6A 2UWAA 4V1PA 5A7NA 3B9IA 2Y34A 4AI2A 1VALA 2WZR3 3NV2A 3FN9A 3T2OA 3GZAA 1RUC3 5IHRA 1TQ5A 4GB31 3BU0A 1EPWA 5CVRA 5FYBA 1XSQA 3H7YA 2BGOA 3NKTA 3RZMA 3GCWA 2IZWA 1J58A 2NMOA 3AKQA 2HEWF 1W0NA 4H14A 1DQ1A 1KD7A 2Q8DA 4NIGA 3VBHB 2G9ZA 2PHFA 4Q4W3 1IPJA 2R0FA 4PBPA 3FLTA 5K4LA 2QQMA 1UX6A 1VRH3 1KS5A 5FYCA 1WCDJ 3ZN5A 2W95A 4MXWA 3OY8A 3FL7A 2W87A 3I2OA 2B8MA 4M3CB 2EXKA 2WSVA 2I45A 2VUDA 2WIIB 4GULA 5C70A 3V56A 1RUG3 1WUVA 3J7NA 2BEOA 4U36A 4DMIA 2BGPA 4JHTA 5IVCA 2YC0A 2DVBA 4HFSA 3VDDA 5F7UA 1V6LA 3K51A 3OPTA 1FMD2 5C6CA 2R062 3BVCA 4YGEA 3LOBA 2ADDA 4B4QA 2XKOA 4QDRA 1WCUA 1OLRA 1VAMA 2V4VA 2PELA 2QCSB 1US3A 2ET7A 2R071 1ACCA 1WW4A 3NAPB 4WM8A 2Q5TA 4RFRB 3O14A 4XABA 2GZWA 1ZX5A 2ZHMA 1J83A 1Z7S2 3HT2A 3PIGA 1QHDA 4YLZA 1WA4A 2CY6A 4NN0A 2HWD2 2VMCA 4R9CA 2VG9A 5IFTA 2XLFA 4K3UA 1IPKA 4XQ4A 4UW4A 3O0VA 5FZ4A 4UWDA 4YVWB 2HJIA 2WN2A 4Y5TA 4AI8A 1F15A 1AR72 1HXS1 1AR91 3AMPA 3MO4A 1PX4A 5A3OA 4CDQB 2JIJA 5IVVA 2HWB1 1SZBA 2W47A 3O1MA 3NQHA 1RUJ2 4H2AA 4W65A 5A3LA 1X8EA 4EJRA 5LW9A 4NJ4A 4BCUA 5JSRA 4RGKA 3BPSA 3SISA 1OBNA 5AFEA 5F1RA 3KHCA 4ISRA 5KHJA 3WNXA 5A1FA 1DHKB 1QJX3 2CDOA 5LY1A 4D8MA 3GJAA 2WO2A 1S0JA 2BDRA 2RS53 4B1LA 2HBTA 1RUH2 3VBOC 5JAXA 4LE3A 1EY2A 3ORJA 2W1SA 2BYVE 3HWJA 1WD3A 2GH2A 2QQOA 1QJU3 5F5CA 3ZN4A 1WWYA 3SLIA 4L92A 3PUAA 5A80A 1OA2A 2PAEA 3GHMA 5LRSA 5KHGA 1NCQA 4FOYA 4QD2A 1LHOA 2ZBJA 3RRDA 4RHV3 1ZBE3 1R092 5FY7A 3M3CA 4K40A 4QXHA 1J1TA 3WX5A 3VHNA 3MPBA 3A4UA 4HVRA 1XE0A 1ZZBA 1OFSA 1OA3A 1XNAA 1BLZA 3AP4A 4NPLA 4QKDA 3FHIB 5F39A 3PMSA 4GALA 3RZKA 4C0BA 2YROA 1R1A2 4XBNA 4DUVA 1H1AA 3I2KA 4LEJA 3LWCA 4JVAA 1V6IA 1CJPA 3JBG2 3OOXA 5FZIA 1ENQA 1RJ7A 1W6NA 2OUHA 4NROA 1BYHA 3RYRA 4BQ2A 2A75A 4QXCA 2BGCA 1UO9A 5FWEA 1N47A 1TNRA 1ULGA 4Y4RA 4Y1YA 1VAKA 4Y1XA 3UJOA 4JGZA 4B7EA 3M3IA 4K9SA 5F3CA 4QGMA 5KC6A 2WUHA 1DZQA 3NMBA 2Z5WA 4FOQA 4AVAA 5FY0A 2X5IA 5C71A 2VL4A 3WR0A 2D3PA 2AZ5A 5FYIA 1OPMA 1PO13 3ZXKA 3B5LB 4S2DA 2AENA 2IFWA 3V64A 2UYBA 1ULCA 3ELNA 4QQ2A 5BNNC 4FPHA 3VZNA 4CSWA 5J3UA 4LO8A 4LBJA 4E27A 4XFIA 5J96B 1ND3B 2CDPA 2WS92 3DYMA 5IVJA 2ZHNA 5HXVA 1W0OA 1QMJA 1VBD3 1G9CA 2BQPA 1AL22 2UWCA 3SXWA 2FD8A 1BJQA 3TOJA 5FRAA 3OUIA 5FO7B 1SEFA 3JD71 3S5QA 4YSFA 2CAVA 2JDUA 4MXVA 4CCKA 3DXTA 1RXGA 2O14A 3I7DA 3PLQA 1R083 5FZFA 3WNKA 2ZX0A 3GYDA 3I8TA 3ZYFA 3MI8A 3K3NA 4FFGA 4MYEA 5FUPA 4FFFA 3BTXA 1UU5A 2FZ1A 1RVF2 2Q1FA 4NHKA 1PMHX 2Y0OA 4E2GA 4XEZA 1DBNA 4QPGB 4QXBA 1ODNA 2GSYA 4CUAA 5BNPA 3ZFGC 2XKPA 1JZ3A 3VKMA 1W3VA 5IVBA 1W9FA 1Y9QA 3V0BA 5T3NA 3WV6A 4W4ZA 3SNMA 5LBFA 1S0CA 2VUAA 1O8SA 3E1F1 3CBNA 3WP4A 4XTPA 3LE0A 4Y4YA 1GFF2 1KDKA 3DL3A 3OF1A 3VBHC 5LATA 3OBTA 1X8MA 3WLUA 4MGTA 5IVFA 2XBO2 2ZX2A 4GA9A 1GQHA 4CA9A 2J1EA 4HETA 1HQNA 4QQOA 1LEMA 4BPZA 1NY72 4A2UA 4DXRA 2QKDA 1M06G 2WLPA 2UWBA 3NJVA 3ZM8A 3ZXDA 5JZGC 1NA1B 1RJ8A 1UNBA 1UY0A 3H3ZA 4P08A 5LBCA 4JHZA 3VD4A 3AFGA 2F4PA 4R9BA 2JE7A 5GLWA 3O1RA 1V6OA 4L0PA 2GP3A 2YFUA 2P4EA 2VMGA 3E6BA 1KRIA 2RR13 3B02A 4D69A 4EN9B 1OD5A 1OLQA 2HWF3 2WQ4A 5T54A 3WDTA 4DRRA 4CDWA 3RZZA 2OS2A 4BK4A 4WZCA 2RMU3 3NAPC 4SLIA 2C24A 2GMPA 3K2OA 2JEMA 2VOTA 1NCRB 1HKDA 3TN91 5CB7A 1H4HA 1FMD1 1ASJ2 1W6PB 2MEV3 1YFWA 2P3JA 1PHMA 4IE7A 5C3PA 1HRI3 1CAUB 1RUD1 1GZTA 4Q4Y3 4LA2A 3LIHA 4CEYA 4TZDA 2P3KA 4I01A 1AYN3 1FOD2 4AAPA 4DIQA 3VL8A 2UY9A 4FSJA 4PI0A 1BHGA 1F31A 2C9AA 4YVWC 1U0AA 2B46X 1OH4A 3WQBA 1OKQA 5FMBA 4XUNA 2WN3A 3CZUA 4IE5A 1ZYBA 5FYSA 4D7SA 1PGW1 1COV1 1E5SA 4Q5OA 2ZEWA 3J8F2 1I9RA 4MOAA 2XWBB 3H42B 4Z1VA 5LEKA 4L99A 2PLV2 4IEPA 2BOIA 3D0SA 4NR1A 1GOHA 1JYTA 2ZGKA 2JDMA 1OVPA 3S0MA 1A6CA 4RQPB 1SACA 3W20A 3WDWA 4OI2A 4GMP1 1UMHA 3IDBB 2CTVA 2J1SA 3ZKUA 4D3WA 3OUJA 2PN5A 1RYYA 2VZSA 4O9EA 2ZKNA 1DGLA 2JDNA 3IPVB 2W91A 4DS0A 1GNZA 3A0NA 1YO8A 2DVDA 5BNOB 4TWTA 5LCWL 4XXPA 5FY5A 3HQRA 3FLPA 3I59B 2HYKA 2QQUA 1LGNA 3K48A 1QU0A 1XNDA 3LB9A 3OYWB 5JXJA 2XHNA 1VBC2 4CYDA 4Z92B 1LGBA 5JOWA 3KV5A 2W1QA 4E2SA 3HEIA 4XF1A 5ACA2 3H1WA 2BW8A 4IGOA 1TEIA 2PHRA 3IAQA 5BXXA 3LSDA 5FZ6A 1RUF2 4IV1C 1PMJX 2XONA 5CYYA 3RJRA 3ZSJA 2D93A 4PJYA 1I5PA 1C3HA 4PF5A 1BEV1 4QQLA 2JDKA 1O4TA 1W8FA 4FPYA 1R1A1 3NKGA 3RYPA 1RUI1 2AH2A 1KFUL 1VP6A 3AYAA 4IGPA 4UW3A 3HR9A 1CAVA 1OLMA 2R6QA 1BQPA 3QH7A 3PU8A 3W59A 2VD7A 1TMF1 1LULA 1XXNA 5A6YA 5JOYA 2HWE1 1Q8QA 1EAH3 4KU7A 5F5IA 3MPPG 4MVTA 2WWSA 1PIV1 3ZR5A 1ND3C 1YI9A 3VN4A 3OGSA 5CFDA 3VBRB 3N9OA 5BPXA 2IC1A 3VV1A 2ZS6B 1EV13 4P9WA 1F5FA 1PGSA 4G9SB 3VL9A 1RMU2 5C4WA 5FZEA 3D3AA 4IW3A 3CHXA 3M1HA 5CNAA 4N53B 1O4ZA 2G9FA 2ZX3A 2PHUA 3DV8A 4OHXA 2QQIA 5FIXA 2QFEA 2YPDA 5K0UB 2ZGPA 1X7NA 2ZXQA 4LUMA 1N3PA 1UOJA 1VMFA 3AP7A 4TLGA 5ABJA 4XZUG 2P6HA 3LGRA 1RL3A 2D44A 3NV4A 3E5QA 4Q4V1 5KHKA 1ZBA3 4BOWA 4QPGC 3V65A 1FT9A 1UKGA 3SH3A 3TB0A 1WGPA 4COYA 3B9CA 4MO3M 1MVEA 4Y20B 4A3ZA 3ENRA 4CP1A 3VZJA 4MUVA 5D2AA 4Q0UA 3TAYA 1H1MA 3ZO0B 4FTSA 1UN1A 2XGXA 4IEUA 4OFGA 2WYFA 3BALA 1BBT3 1REEA 3U1XA 4Z8BA 3ABZA 2WZPP 2RS12 1RVF1 2WT0A 3ZYPA 2PMWB 4AE2A 5FQ0A 4NHMA 2C6SA 5SV5A 3U11A 2NPIA 2VCAA 4KMQA 5CFCB 4TLFA 5K8SA 2OIIA 2ZMNA 2ENRA 4XAEA 1UMIA 4ONUA 5FZCA 3K4AA 3UT0A 2CSGA 3O1TA 4ES8A 1AF9A 4HL0A 4MGZE 4NMIA 4YW4A 2VW0A 4FOVA 4LHKA 2VNRA 3A0KA 2ZKLA 3DUIA 1TZOA 5I8TA 1PO22 2W68A 1DCSA 1YYNA 3KLSA 3PU3A 2R30A 2R7EB 4AEDB 3U4XA 1WLDA 1D4M1 3PVBB 1AXKA 1HRV1 2DFCA 1V6MA 4FTBA 3AMQA 5HV4A 3ATGA 1N3OA 2QDNA 4GZ9A 1WLCA 5C9AB 2RJ2A 4ISQA 2OA2A 5JI9A 2GNMA 3M70A 4XBLA 3WDXA 4A45A 3H50A 3R4UA 1GYKA 1SFYA 1VE0A 2PTMA 1V6JA 3LEKA 1QXJA 4LKDA 2Q8OA 1IS6A 1C4RA 1H2NA 1U5XA 4HOOA 4OCTA 2EIDA 4GWMA 1I1EA 2AYHA 4IE4A 4UW5A 3PNAA 3QBQA 4CU8A 5D8AA 3M3OA 5EZWA 1H8TA 2ZGMA 4MGIE 4N90A 1IS5A 1A3KA 4F83A 3HD8B 2VXRA 4YW1A 1UF2C 1WZXA 2D6MA 4YZ3A 2E7TA 2VZUA 4BLJA 4D6SA 4C8DA 4QX5A 5JUVA 4O7XA 4C91A 3IWZA 5K9YA 1ASJ1 2I2SA 3CEWA 4Y24A 2VXJA 1HQLA 5C8CB 5AC93 1LR5A 3MW4A 4KU8A 3S6PA 2Y6JA 3WZ1A 5GZEA 2GNDA 1FOD1 3R05A 4WVMA 2R1DA 1QIQA 1WW7A 4YG3A 3BI3A 2FHRA 1ND2B 5FKCA 4BH9A 1L7LA 5FYVA 1RC6A 4IEWA 3K46A 1QH7A 1TME1 5FZ7A 5A7WB 2ZGRA 2YC4A 1UZVA 5T50A 3PUIA 1WMFA 2WSUA 5BNOC 2Y6GA 2W1WA 3LOIA 1V6KA 1W9YA 1SG3A 2JDAA 4V2VA 5C8WA 3D82A 1F9KA 2WNUC 4IV3B 1O59A 4K1YA 3H1YA 4HSLA 1UAIA 2E6VA 2IUWA 1G7YA 1I5ZA 1NOVA 1QJY2 2MNGA 3KT7A 1HB3A 1CVNA 5IVYA 5IYYA 1DG6A 4JGYA 4JC1A 5FY9A 1U5IA 1Q3EA 2VW1A 2VE1A 1OF4A 3G7DA 5FK7A 1AYM3 2Y38A 1IQAA 4X6QB 4Y26A 2VUCA 1SLLA 1PVC3 2E33A 4AFAA 2VR4A 3LKJA 3N9MA 3OPWA 2YMZA 1DU3D 4UXAA 2H6CA 4LPLA 1L3JA 4XURA 3TNQA 5IK8A 2ID4A 1HLCA 1REFA 3WSOA 3FLRA 4DINB 1JYCA 1VRH2 2JDPA 1E5RA 1LOFC 3VD5A 3WT3A 3UETA 4GWJA 1L7QA 1JZ4A 1GV9A 4QX1A 1GKBA 2BFUS 3FX3A 3AXDA 4UOJA 5JSOA 1FPN1 3VB9A 4OI0A 3W58A 4CU6A 2Y0IA 3WNNA 1RUG2 3ZDSA 4YNIA 2YU1A 4X8PA 2OXBA 1CQ9A 2HEYF 2TEPA 1G9AA 1O91A 3E6DA 3CLPA 4XFBA 4OHZA 2ZMLA 2PFWA 4JCKA 5FPLA 1AR83 3NJZA 3ZMOA 4XUPA 3MIDA 3LPFA 5FK8A 4L8QA 3KT1A 3S57A 3WCSA 3I59A 4N53C 1VBB2 1QQP3 3AL6A 2A1XA 5K0UC 4B4RA 1RHI3 3KGLA 4XUOA 3M8LA 4FPOB 3S30A 2OX0A 2VZVA 1JU3A 1YFXA 3VKOA 1AR63 5CKNA 1URXA 1LJ7A 4QDSA 3DPRA 4XJAA 3WG4A 3QH6A 2WC2A 2IXHA 1DGWX 3DYOA 4P00B 4LULA 5AVPA 2XWJB 2W0XA 1XE8A 4AQ6A 1MEC3 3FC0A 3HOBA 1MACA 2J42A 4YVSB 4CDUC 1SCSA 1VR3A 3VZLA 1MS9A 4IEZA 2QNKA 2KD7A 3I2GA 3N7JA 2RDQA 4CVUA 2XJQA 3LDKA 2WQZC 3EJKA 3OG2A 4YGDA 3VDAA 1RUOA 2XG3A 2VNOA 2VMIA 3ZDVA 4GWIA 1XC6A 2C26A 2Y33A 1CX4A 4O9GA 3WEZA 5F9TA 2RJKA 1QJX2 4Y3OA 2VTFA 2V5DA 5FYTA 1VLNA 1SPPB 2OPWA 4E4ZA 2IVIB 1JZ2A 2RS52 3I2HA 4YW6A 1V0AA 2I74A 3VBOB 1V9U2 2OQ7A 3UGFA 5DUWA 3T4HB 5AFBA 4FP3A 1QJU2 1UXXX 2C5DA 2JG9A 1W06A 4P5YA 5CG8A 1YQ8A 3PURA 4QMAA 3AKSA 5FTTC 2B39A 1XE7A 2ZTNA 5FZLA 4AEDC 1Y43B 2ZHLA 4ES9A 4RHV2 2NP0A 1CESA 3VD3A 4GH4A 2EXHA 4HSJA 4AHWA 1ZRFA 2WZEA 3MIEA 5C9AC 1Z78A 1I6XA 3WINE 1JOBA 2HWC3 4XOGA 1W8NA 2RDNA 1NLQA 3VBSA 3BOPA 1LOGA 3UL2A 2XJVA 3VD9A 1GWLA 3THDA 4WBBA 3ZXGA 1X82A 1WLWA 1XB9A 3POBA 4A42A 2UYAA 1LHNA 4AI0A 4EWDA 1W28A 1DF0A 2YBKA 2EAKA 3BTYA 4BQWA 2BPA2 1WBLA 1FYUA 3LF7A 4RD7A 3P3NA 4L9BA 4RR3B 4MHRA 5FXXA 1NG0A 5L7OC 3D0JA 5T5OA 2ARXA 4ARXA 3OBAA 1CZTA 2WWJA 3MIFA 4CDXA 1EUUA 1PO12 2WQ8A 2BNNA 4XQWA 2WFF1 1W8ZA 3GZEA 5EJ3A 2QVSB 2DCYA 5FY8A 4ARYA 3QCWA 3W9AA 1GUIA 1C8M1 3KVBA 3POIA 5BNNB 1WA6X 3ZN6B 4J1WA 3DYPA 4CCEA 3LEIA 4DFSA 3T0BA 2ZOEB 1C8NA 4A44A 1YFUA 2AUYA 3AM2A 3BOWA 4AL9A 4PBOA 3CO2A 1TG7A 5E6HA 3OGVA 4H7LA 4Z2AA 2WBKA 3RZGA 1QJEA 2GNBA 5GLTA 3N9LA 5FBJA 5HCBA 1XSRA 1LGCA 3CZJA 4NHLA 1R082 5GM0A 4BXFA 4DO0A 5LB6A 1VPHA 2DTYA 3BPZA 2BBAA 3GXUA 1CZVA 2Y6KA 4CP2A 2VPVA 4PLNA 2VH9A 1XJAA 3OGJA 4UF0B 2W94A 5EXOA 1WLTA 2YDEA 4WZFA 4EYUA 3OJBA 5HCHA 3CJIA 4AEMA 3NJYA 2WLQA 3VHOA 3CF6E 2OPKA 3ZFGB 1GZWB 2A5ZA 3RMXA 5CG9A 4RGGA 5CKQA 4COZA 1PX3A 1D2SA 1Y7BA 2LM3A 5FZDA 4QU1A 4UFKA 2ZHKA 4B4PA 2BU9A 1IQDC 4XETA 5IWFA 4QPIB 5FDBA 3WG3A 2OT7A 4AI3A 2VZTA 4LR4A 1NE4A 1ST8A 1W6QB 2VQAA 4GB33 5C3RA 1TE1B 1MS8A 5FP3A 1DQ4A 4UBHA 1DLCA 4JAAA 5BY5A 4TN7A 2JJ6A 1MVQA 4XQDA 4BE3A 3UNPA 1OVSA 1UZYA 5FOBB 2BZDA 1S0GA 1K5MB 1F5JA 1CX1A 1T2XA 3OD4A 1N1VA 3NWKA 3POEA 4QQPA 1KITA 4A6OA 5C5TA 2JKXA 4MG2A 2WO1A 2EIGA 3KT4A 3H8UA 2PAKA 5A1LA 1A78A 1IGOA 2XXZA 3VLBB 4BU2A 4Q29A 5JZGB 5KHIA 4W6WA 1X36A 4PQQA 4JQTA 4IEXA 3I3BA 4Z82A 3WNMA 4EE2A 5C7GA 2LW8A 3OD0A 1OFNA 5DAXA 1DGRA 1G9BA 4DQAA 3O7OA 2RR12 4D7TA 2HWF2 4IV3A 1SQ4A 3ZYRA 3LA7A 2VZPA 5LK7B 4NE9A 2FCVA 3AK0A 3C3VA 1UCXA 4YM0A 2WNEA 4WVZA 2VM9A 1YC61 2ORZA 3U14A 4BB3A 2GALA 4CU7A 1QOSA 2R073 5FYZA 4CPBA 2MEV2 3PIJA 1HRI2 4Q4Y2 3ZLIA 3VGIA 3U07A 4YVSC 3B00A 1HV0A 4FT8A 3WW2A 2XPJA 1AYN2 1KDMA 3BTAA 3Q8AA 4DEQA 2QQJA 2F4LA 3PDQA 3NNFA 3MUY1 5LRRA 4K7JA 3HQUA 2J7MA 1RB8G 3Q8EA 3HVDA 4CEWA 1QF3A 1UD1A 4UFLA 4KBBA 2JIGA 3NNGA 3V0AB 4FPFA 4RS5B 3SKVA 5FZOB 1IZ3A 2DCKA 4YPJA 3S7EA 2J1TA 1PNGA 1HXS3 1AR93 1ZM1A 2RDSA 4LITA 4AFCA 4Y22A 2HWB3 2RHPA 4XACA 4DOUA 3UKTA 3ZR6A 1U12A 3USUB 5FMDA 3KQ4B 1UU4A 4XVHA 1CZSA 1S2BA 1BVP1 3ZKYA 4ATEA 1H9PA 1W90A 1X9TA 2E32A 1E5HA 4NOTA 2O8QA 5IAXA 4OMCA 4CPBD 5K7PA 1ZRCA 2WFPA 1MZFA 3RWNA 5BYNA 3T2PA 4YM1A 1PGL2 1DYPA 1ZVFA 3ZIWA 5FUIA 2X5IC 4EROA 1CAXB 3FUOA 2KM2A 2RG4A 4ZS2A 3L9JT 4CZSA 4LE4A 1V9U1 3GM8A 4DZGA 1GP5A 1AVBA 2XJSA 4IXLA 1CIWA 4FPEA 3KV6A 1KGYA 1EPZA 4IV1B 5FLHA 4WM7A 4LO5B 1WMEA 4JQRA 4HVQA 3SEEA 2DCJA 4LBMA 2DU1A 2C4XA 5IT6A 4K21A 1HJGA 2H6BA 3RYKA 5F5AA 3O12A 1BCXA 4IUGA 2QE3A 4COUA 4UYBA 5FPUA 4RR3C 3ACGA 5E1RA 2YG0A 2ILMA 2VZRA 5F6KA 2D98A 2FDFA 2D6OX 1UOFA 1UPIA 4H7MA 2BOJA 2WNVB 5A70A 3HJRA 4LK6A 2ZGQA 4MH0E 3SH5A 1NXMA 4AWDA 1H1IA 1SLIA 2DURA 1GANA 4M0NA 3C7HA 1EAH2 1C1FA 1W8TA 1XBFA 2DFBA 4X6RB 2NYYA 4HPKA 4YW7A 2P5BA 5JOXA 4LHLA 4QHBA 3ZFFB 2HH9A 4Q8KA 1OPOA 5L9BA 4XC9A 2E7QA 1YWKA 1EV12 2K9ZA 4BA6A 4HZFA 5GALA 4NPRA 1NLRA 2D6PA 2C1FA 1JBCA 5GLZA 3UK9A 3WF1A 1FNYA 3TEZA 5EJZB 2VU9A 4XTMA 2GC3A 5FYHA 3SITA 3ZOIA 2X10A 1DIWA 1UU6A 2XJTA 3E97A 5DDJ1 2ZX4A 4XF0A 4NIAA 1YRZA 3H8XA 4FTEA 4OYUA 4CUCA 1OQ1A 2N7GA 4MGKE 3JD73 1JOJA 4BDVB 3HNMA 2RS31 1VBE1 1RITA 4NVPA 3GALA 2XJUA 3MW2A 1ZBA2 1O3TA 3LIGA 3U4SA 2RV9A 3FE5A 1XNTA 4Y5Z0 1W2NA 5J98B 4AW7A 1Z0HA 4QGLA 4ZU7A 1HB4A 1Q8PA 3LDBA 1ZRIA 3N3HA 4MGYE 4I3GA 3CJXA 2D43A 1RUE2 2VZ1A 2WR9A 3BU7A 4QPIC 4UFJA 5DZGA 3I49A 2GMEA 1ZZ7A 4A41A 4BIFA 1BBT2 1N1YA 2D3SA 4R4ZA 3RDIA 3NNLA 3AFKA 3H0OA 3RZLA 3FBYA 5FZKA 4AYUA 1LENA 2EAAA 3FJSA 4M0HA 2LRPA 2VBDA 4NPMA 3PMEA 1DQ2A 1K5MC 4HMZA 1SLBA 1AZDA 1NYWA 1ZRRA 3NW4A 4E8DA 4ZXKA 4BZ4A 1PZ8A 2JX9A 1W6OB 5IK4A 1XOYA 2YZ4A 1JUIA 2ZPXA 5LBBA 1KQRA 1W8WA 3MV11 5EV7A 2QDRA 1JHNA 4N43B 4PIXA 5DUXA 1JXNA 5EP9A 2CU5A 1KXGA 2AC1A 3RWKX 3N9NA 3UESA 4UI9L 4AFDA 3ZXLA 4AGGA 1UIJA 2P1BA 4KI5M 2EIBA 3DN7A 4LBQB 5FP8A 5LY2A 1S2EA 4RN5A 3ACIA 2XMLA 5I0SA 5IVEA 4QWNA 4UF0A 2WDBA 5I0UA 3DXUA 1CR7A 4P9LA 5ANQA 1ZZ6A 2XH6A 1BK1A 1H4GA 1WW5A 2ET1A 2R061 3HAGA 2FZ2A 4EWAA 2Y6HA 2XHKA 3BYWA 1MS5A 2RM22 3JXSA 1S4CA 4XHBA 3UV9A 2BNMA 2PHTA 4KG0A 4KGQA 3TN93 3VBUC 1FMD3 2HLEA 3O0XA 5A3MA 2JDHA 2D7FA 2QQKA 4EN8B 5CAZA 5H9QA 1RUD3 1SDDB 2P3YA 2Z4FA 4CTEA 4A7YA 2QBXA 2E63A 3VBHA 3O1VA 2W1UA 3M3QA 3PUHA 1AUYA 2E9QA 1V70A 3DEMA 3NJXA 4COWA 1X33A 3HIFA 3HBZA 4K8FA 1Z7S1 2YB7A 4RS5C 3EXUA 3JZVA 1OSGA 2HWD1 4M3CA 3WQ7A 2Y6FA 2ZZQA 5EFUA 3T1MA 1C57A 3ROUA 5A33B 3ZIXA 2E31A 2OKXA 3MF6A 1CWPA 1COV3 2DBNA 4LUKA 3RS6A 4ZS3A 4JKLA 4QQHA 4I0BA 2DUOA 1AR71 3LQCA 4LOTA 2RVAA 3FWEA 4DXTA 2G1MA 1RUJ1 3MYXA 2LS6A 5F8PA 5B4XA 3ACLA 3IZOA 4GMP3 5DAQA 3C2UA 3ILRA 4PCRA 4AHZA 1EUTA 4UBGA 1OOPB 2WNUB 3JQXA 4Q0VA 1ULPA 1UIKA 2XQRA 2ARCA 2A70A 3PJQA 3NAPA 2P3IA 3CU7A 2EICA 2G19A 3IIIA 3KCCA 1RUH1 4QU2A 5A1AA 3H8RA 3MGUA 3T3YA 1XQNA 1AL0G 2QZ2A 1LODA 2CHHA 4HONA 4HBNA 4EN7B 4A6SA 3SKJE 1CONA 1D4VB 1F4HA 2VZOA 4FPKA 4AHYA 1UYPA 3JUUA 3ILFA 1AYM2 5D21A 2XOMA 3I3EA 1MPXA 4JTNA 1R091 1LHWA 1NKGA 2JG8B 4PDWB 4OQ9A 3IB3A 2YBPA 5C3QA 1GOGA 4Q8LA 1CAWB 4YVWA 5C4WC 1XYPA 1YNAA 3O1PA 1YI7A 3UJQA 1BEV3 4JDNA 4CDQA 1OLME 2F17A 1S0BA 2BRTA 3AZXA 1V6NA 2V4AA 4A3XA 3KV9A 1E5IA 2B5HA 3JBG1 2WNVC 1R1A3 5ABJC 5IUQA 1POV1 1RUI3 3I2FA 2FDHA 4EZ4A 1YUDA 3USUA 5J48A 2EXJA 3DF0A 4X8NA 2ATFA 3MV01 5A6QA 4TXWA 1TMF3 4XXAA 3P5BA 4ZPIA 4KWJA 5JXHA 3ZFFC 3WQ0A 1O3QA 2BWCA 2HWE3 4XFCA 3WDYA 3WUCA 1AR82 4FPLA 1PIV3 2YY1A 4P5HA 3T0AA 1GQGA 2VULA 1W3XA 2GNTA 1RXFA 2R0HA 3C8XA 4XW3A 2OW4A 2V5YA 4NUBA 4AEJA 2XVLA 5FPAA 3SCGA 5FWJA 1AHSA 2JD9A 1H6XA 3I3DA 1RHI2 1QDOA 2WWUA 3VBFC 3U37A 1ZRDA 3POJA 2WS91 1S0EA 5KXEA 5F6LB 1AR62 2YPJA 4FVVA 5M0TA 4EN6B 1MS4A 3MZHA 3G6JB 3M3EA 1AL21 4PIZA 3KCYA 1VBA2 3OCPA 1MEC2 1K12A 1G8WA 3OGGA 4Q4V3 1D2QA 2K46A 1X9PA 2VOVA 5A32B 3GZTB 3B93A 4KBZA 3WD5A 2D6LX 1D7PM 3B3QE 1H0BA 4OLLA 4AG4A 2EIEA 2Q1MA 3A23A 1NZCA 2VC9A 5FCCA 4YYOA 1ZNPA 4AVBA 3QD6A 1NXD1 1JZ8A 1UY1A 4J1XA 3LA2A 2IXIA 4BQ5A 1GNYA 3LD8A 3VZKA 3MEPA 4ZZ5A 4LNVA 1RVF3 2R042 2XR4A 3BB6A 4B7KA 2KXLA 1RUE1 2ZEZA 3AXEA 5IK7A 5EWSA 3LA3A 1ND3A 4CP9B 5A3UA 4XILA 3W21A 5J37A 4LT5A 4XMIA 2CV6A 1UWWA 1F35A 3OUHA 4GWNA 4N43C 2XBO1 3CIHA 4HKOA 3Q9OA 5F32A 2VAUA 2YV8A 4I3PA 4EWEA 5LA0A 3K75B 3S7IA 1AJKA 4Q4X2 2QQPA 1NY71 2C9KA 3ILNA 4XFGA 4CCMA 5FJKA 4E2QA 4GJYA 2UY8A 5L9VA 4GMP0 1W9TA 5CU1A 1Y9MA 2HWC2 2O8OA 1D4M3 1FAYA 1HRV3 2VCCA 4KNCA 3IMNA 3WOGA 1H2KA 5GZDA 3U75A 1PK6B 4PT6A 4QPGA 4R9DA 3KQRA 1Y3TA 3RVHA 1YHFA 3RNSA 4E4SA 4CCLA 1IHMA 1Q8OA 5B4NA 1IS4A 4QX8A 2ORXA 3AZWA 2A71A 2PHXA 3IT8A 3RQ0A 1F8VA 1W2OA 3ZSLA 5FY4A 5L7OB 4IESA 1ODMA 4MADA 3AVRA 3UYJA 1O7FA 2Q4SA 3OTFA 4UFHA 4RGAA 3WF3A 4BQXA 3ZFEB 1JUHA 3P1IA 1T6GC 2H0BA 1ONAA 2RM21 5D1IA 3T0DA 1W8UA 1JYNA 1JZ6A 4XPVA 1TNFA 2VUJA 1ASJ3 4JGYC 1C5HA 1S1AA 1UXZA 1W6OA 3LAGA 3NRUA 4JRAA 5LBEA 4JKKA 2L9LA 1IPSA 1KJLA 4LHSA 1NT0A 3WCRA 1A8MA 1NA1A 2X53S 3HT1A 3Q8BA 2Z69A 1FOD3 2XQXA 4BQ4A 1SLCA 1OD3A 1H30A 4HK9A 3POFA 5CZKA 4ASLA 1K42A 5FYMA 3LCPA 5FPZA 4M00A 3H9AA 1TME3 4P9JA 3J8F1 1LCLA 1OOPC 4IL7A 4BXSV 2PLV1 4OUEA 5I0TA 2PXJA 2JKBA 4MXWB 3OY8B 1REDA 5DZFA 4YZ1A 4M4RA 1O6UA 2D5HA 1NCRA 5KXDA 1VAVA 3ETPA 3HN1A 5A7QA 4RL7A 4CXWA 3VHPA 1W6PA 4ZU4A 1AXYA 3FHQA 1CAUA 2WZR2 1JU4A 1ULDA 1RUC2 3VZMA 3O1SA 1QH6A 1W04A 1LOAA 4TYSA 2DU0A 2E53A 4P02B 5IAVA 4S2FA 5LEJA 2JG8C 4I09A 2BP6A 4JV4A 3N36A 4PDWC 4Z07A 5DAVA 2YGMA 4JTOA 1R64A 2GAUA 4GB32 3TWIA 1VBC1 3ES4A 2XL9A 3PVNA 1G9FA 1UMZA 2XL7A 5JR7B 5ACA1 3N7KA 2A6ZA 4Q27A 1K5JA 3J4UH 4Q4W2 1LHVA 5FMOL 4J6GA 1LOBA 5BNQA 1MQTC 2CGPA 3KHBA 1RUF1 4FQ4A 2A6XA 4WM8B 5JOZA 4PLMA 1B35C 5ACA3 5KBFA 2VVEA 5A33A 2X05A 2WYSA 4LKFA 2J1AA 3DPRC 1PZ7A 3J9SA 4RQPA 2AEYA 3KB5A 5L36A 4EZHA 3VKNA 1DQ6A 2EXIA 4BQYA 1FPN3 5DZEA 1RIRA 2DVFA 4IETA 3IPVA 2GN7A 1O3RA 2TUNA 4RYDA 1NLSA 4YRDA 1OXCA 2ZGLA 4O65A 5BNOA 3VDBA 1LB2A 2QQVA 1AX2A 2NQYA 4DXSA 3ECQA 4I02A 4BYYA 2WNUA 5KC5A 3EYPA 3F95A 3OYWA 2VQ0A 5HI0A 3FFQA 3H1MA 3UGHA 2QUOA 3P3PA 3ZSMA 4FAHA 1ZZ9A 5HV0A 2FDGA 1CIYA 3IAPA 4C1WA 5C3OA 1JYWA 4NIDA 4AVTA 3APBA 3ZYGA 4NHYA 2R072 4XF4A 4WVVA 4YFZA 4XDOA 3ZYIB 1RMU1 5J36A 1GWKA 1CD3G 2DBIA 1JI6A 5CEHA 1J3RA 2BERA 2VQTA 3OGRA 1DQ5A 5A3NA 3FZ3A 5JVVA 2GC0A 3U78A 4GD4A 1P8JA 2DVGA 1RINA 4QHOA 3BUCA 4YZ4A 4LTAA 3C7FA 3NVCA 1O8PA 2VVDA 1JZ5A 4KWUA 4GXLA 1Q56A 5SV8A 1OQEA 4PHZA 2VTXA 4XMAA 2ERFA 4AEKA 1NUKA 5FZGA 3OBZA 2A3YA 1W6MB 2OUJA 1VBA1 4HANA 1AR92 1MS0A 1YQ5A 3VBSC 3RFRA 2HWB2 4RA0A 5H9PA 4ZU5A 5A6XA 3MF9A 3I2IA 3MFAA 3SCFA 4Q26A 2ZGNA 4BIOA 3ZXEA 4YM3A 3C7GA 2YGLA 4V2WA 3VBRA 3WW3A 1WCSA 3AYCA 5FJHA 2X09A 1O4YA 2RS11 2IVJA 3B01A 5EJ1B 1QXPA 2QJVA 2SLIA 5L73A 4JGZB 4QPYA 4C1XA 2LROA 1GNHA 4LLOA 2R041 4N53A 1ZBE2 4AFMA 5K0UA 1R1ZA 3W5MA 2X5IB 1OUXA 2XDVA 2VMEA 3QACA 4LBLA 1UOGA 4AK3A 4FOWA 5FY1A 3T4VA 2DDUA 1QJFA 1PK6C 5IFPA 3KCXA 4K8RB 1JW6A 5JI7A 2ADEA 1PO21 2K0GA 1BZWA 2G9GA 2HBUA 3DKQA 3HBKA 4Y20A 4I30A 1LESA 2LUWA 1FATA 4Q4X1 3THCA 3AYEA 4LJHA 3M7AA 2RJLA 5JMCA 4COVA 1GP4A 1OQDA 4MGSA 2VBPA 4KGGA 2NZ9A 3THPA 3RG0A 1ULEA 3D6EA 3ZSKA 1D0GA 3GZUC 3ZFEC 1SDWA 4Y1ZA 1S0IA 2W46A 3B94A 4OMDA 3RZHA 5FR3A 5CFCA 4XIKA 4F8AA 1WCKA 4IGQA 1ENSA 5ISLA 5JCTA 2ZJCA 2A6WA 3ST7A 4CP9A 4DY5A 3KF5A 5BNPB 2WFF3 3AC0A 2CAUA 4OVEA 1VIWB 3V0BB 3BGAA 1C8M3 3K3OA 4XZPA 1VBD2 2MPFA 2RE9A 2AACA 2JD4A 1A34A 4AEDA 4CUBA 4XF9A 3PUSA 5C9AA 3MFCA 5T5JA 3E6CC 1A8DA 1XYNA 5C5UA 5I8YA 3CDZB 3MIHA 3JD72 5LZ6A 1UKRA 2Q30A 5JMOA 5DUUA 1UX7A 5DAPA 1RGSA 4CUGA 1K3IA 4ZXEA 3TEYA 4HKLA 4DEVA 5LA9A 1YQ2A 5A7SA 3GCXA 1VB4A 4P9IA 3EMRA 3VDDC 5H9RA 2DWRA 3LZZA 5G04L 4QX3A 2C0ZA 5GZGA 3O5SA 1K45A 4FI9A 4HN1A 3J7HA 1UY2A 3PJYA 1QDCA 1QJY1 3CMGA 4GKYA 2WO3A 4CDWB 2OZJA 5C8CA 3AB0A 5F3IA 2WZR1 4WM8C 3GHNA 3N9QA 1RUC1 3AZYA 4W6YA 3B69A 4B1MA 1WD4A 3FFZA 4HKWA 4CP0A 4KQ7A 4Z2WA 4NWWA 1YIFA 4XFFA 4TSVA 5GJ6A 4EQVA 3PTRB 1ND2A 4FFHA 4D6RA 1KJRA 1Q8VA 2KA3A 2X29A 3MDPA 5JSPA 4H3WA 1YQCA 1M4WA 4CEYB 4EV0A 4MV2A 1UYYA 5A7WA 4Q4W1 4FPJA 1WMDA 1C5IA 2LTNA 1VRH1 1W99A 4DNYA 4BWOA 1JH5A 1JZ7A 1POQA 5FZBA 3AX4A 3AYDA 4CEWC 4AI9A 4QXKA 3I2JA 3POGA 1HJFA 1EYBA 4FQZA 2BVVA 4QHZA 1RUG1 2RMU2 2Y64A 4AFBA 1GP6A 2D6KA 3ES1A 4QPWA 3CQOA 4S2HA 4AQ2A 5LWBA 2HKXA 3K77A 2W9XA 1KEXA 2FCUA 2CWSA 1W0PA 3AJZA 2PHWA 3AKTA 3BIEA 3BIWE 3MIBA 1MZ6A 3TN92 3J26N 4HG6B 3VBUB 1VBB1 2VMFA 3F2ZA 2P37A 4KH9A 5AVAA 2JENA 1HN0A 1RTVA 1RUD2 2PQQA 3NV3A 4Q0QA 5FP9A 1NCQC 2F6BA 5FPXA 1DLLA 5DUVA 5FXZA 3MIGA 1VBB3 2XLAA 2YFZA 4C90A 4B8EA 2WAAA 3VHRA 1BVVA 5JPMB 2CNAA 3BKZA 3O1OA 1WMXA 5FREA 5KXBA 2B9VA 5FXWA 4LQRA 2BBVA 2BWAA 2VZQA 4UFMA 4FBFA 5FP4A 5JDBA 5J1XA 1BMV2 1PGW2 1COV2 1ZZCA 3ZPYA 5JIAA 4WM7C 1F4AA 2XUEA 4URTA 3RPQA 2BNOA 2PA7A 2ARAA 2YHJA 4KWLA 3A21A 3NNMA 4C0HA 1AJOA 4IEQA 3EBRA 1HIXA 4XAAA 1FXZA 4JGZC 4Q2FA 3BN6A 2X8KA 4O61A 5ANNA 3FUQA 2ZGOA 4DB5A 1QJX1 4AAXA 3N7MA 1CAVB 3WVJA 4ZONA 3RZJA 1UW8A 2JE9A 3GGLA 3KS7A 1ZREA 1SFNA 2RS51 4L2NA 4LBNA 2XB6C 2DTWA 1WCQA 4W6XA 1W2TA
chains in the Genus database with same CATH topology
1QJU1 3BODA 5DG1A 2GH8A 1GZ9A 1S2KA 1H8VA 1V9U3 4MLOA 3UKNA 5CFDB 4XFAA 4YVSA 5DXDA 4YARA 4RHV1 1XNBA 1BXHA 1ZBE1 5CBLA 2OYZA 2P34A 3POWA 3IDEA 3ZYJB 4Q1PA 1QNYA 1YIPA 2B9UA 2DF7A 3LSEA 5C4WB 3VKLA 3WDUA 1BEV2 5EYYA 2IXKA 3KMHA 1FI2A 4HK8A 1W6MA 3I2DA 1NQJA 1GZCA 5ABJB 1H2MA 1RUI2 2XVGA 5FLJA 5JPNB 3KGZA 4ITCA 3SH4A 1FV3A 2IXCA 2VVFA 1G86A 1TMF2 5BNPC 3VBOA 2IXJA 2HWE2 4YW2A 1PIV2 1XNCA 5T55A 5KHHA 3JU9A 1I3HA 1SLTA 2XLGA 1PO11 3WP3A 4AQSA 2ZX1A 5FO8B 4XJZA 3WP5A 1SMVA 5FQ0B 4AGRA 3PHMA 3VBFB 1W39A 1MZEA 4NO4A 5DDJ3 3VUOA 1IKQA 2DUPA 1VBD1 2VECA 4Y1UA 4ATFA 1DFQA 2R49A 2E7AA 2I07B 3OPZA 4KG8A 1MS3A 1JYIA 2RS33 1VBE3 3WQ1A 4OHVA 4Q4V2 4YM2A 1R081 1UL9A 4IERA 4INDA 3TRSB 4RR3A 2D40A 3AMNA 3EO6A 2YXSA 4YFWA 2DVAA 1J3PA 2EVXA 4CDWC 3PTYA 1LECA 3I54A 5JIUA 3GNEA 4AVVA 2EALA 5I0RA 1LOEA 3N7LA 4OZXA 5BNNA 3ZN6A 4R8HA 1CGPA 1GR3A 4I2OA 3IDCB 2VGDA 4FO9A 2D97A 3RJ2X 4CEYC 2ZAHA 4XFHA 2CL2A 4AVSA 4OI4A 5D8AB 1AX1A 1H8TB 4FPCA 3RSJA 1J1LA 1S55A 5FOJB 3RMYA 3DGTA 1DZTA 4OI1A 5GKAC 4F7ZA 2A73B 1WW6A 2LALA 2QZ3A 2GN3A 4YGCA 4HLTA 1D4M2 4XJWA 1HRV2 3AP5A 4AI1A 1V00A 1X50A 4WVMB 2WL1A 4CRQA 3N4MA 4N7IA 3ZFGA 1GZWA 4OUSA 1N1TA 2PHDA 4N9IA 5C33A 1ENXA 4PLOA 5GZCA 2DYCA 2RR11 5BV6A 2HWF1 2BUKA 4P14A 2OVUA 4F3JA 4R52A 4QPIA 3AP6A 1Q8SA 2R063 1JN2P 2DCTA 2RMU1 1W6QA 1NQDA 3IIAA 2ZABA 5J09A 4JRLA 2E51A 1YLLA 2VOXA 2MEV1 5CADA 4M3CE 3ZXFA 1HRI1 1K5MA 4Q4Y1 5AC92 1OHFA 1J59A 5HBAA 2YYOA 2P17A 1Z7S3 1IKPA 1AYN1 1GBGA 1NE6A 2B45X 1KFXL 2FMYA 3E5UA 4JGYB 3UKVA 4RFT0 2HWD3 4WV8A 3T1LA 5JZGA 2IXLA 5GLUA 4BHPA 4QM8A 4YGBA 3EHKA 1O5LA 4LBKA 2EF6A 1AR73 1SBDA 4A7ZA 1PM7A 1TME2 3QOPA 3HQXA 4Q0SA 4CDQC 3H7JA 1RUJ3 1GICA 1BMV1 1H9WA 2V09A 2Z79A 3NV1A 4XYXA 1S0DA 2MHFA 1XNKA 2AR6A 3WDVA 4LO6B 1RUH3 2JECA 4OUMA 1SLAA 3ZVXA 5CFDC 4AF9A 2IWGB 5JWPA 3VBUA 1PGL1 2WT1A 1XYOA 3AKPA 3L2YA 1PVC2 1QJZA 4D7YA 2DUQA 1DYKA 3CNAA 5GLVA 1R093 2P2KA 3V0AA 4RS5A 5CA6A 5L19A 4S2GA 1MQTB 3JB4C 4B29A 1B09A 1B35B 4OULA 4P9YA 4XE9A 1O3SA 1PNFA 3DPRB 1Q5OA 1U5ZA 3JBG3 2A6VA 2JDZA 3D5OA 4QM9A 5E8AA 1POV3 4HT1T 3ME2A 1FPN2 1DQ0A 4AQTA 3ZSEA 3WY6A 4L11A 2CWMA 3WUDA 1YJKA 3WP6A 1LTEA 2WA4A 2TBVA 1CAXA 1QQP2 1CPNA 1EAH1 1UPSA 3AP9A 3JCIA 4JDOA 3U10A 1VB2A 1QWRA 3R4DB 1U5YA 2XJPA 1EV11 1QOTA 2FMDA 4IV1A 2Q0AA 2WS93 1Q43A 4M3CF 2UURA 3IKWA 4N9HA 1H2LA 4BLIA 1G9DA 2JG9B 4PQ9A 3AMMA 2NMNA 2A3XA 1AL23 1D0HA 1JTZX 4YZ5A 4PIYA 4FXKB 3KD4A 2TNFA 1XU1A 3NL1A 3IN9A 5H9SA 1CN1A 2EA7A 4GH4B 5IK5A 1ZBA1 2WNVA 3M2MA 5GZFA 1QNWA 3GBWA 4XDQA 3VBSB 3H3UA 3CL1A 3AZVA 3POYA 3AKRA 3WG1A 1OMIA 3ZFFA 4AHXA 1BBT1 3FBMA 2BFUL 5D8AC 1RUE3 4BMBA 1H8TC 1AXZA 3AZZA 2VOWA 2GU9A 3WXPA 1IS3A 5EYXA 4I0WB 2XBO3 3M4FA 4YG6A 3VBFA 1DZRA 2O1QA 4CDXB 3JQWA 1OI6A 1EP0A 1APNA 4OHYA 5E89A 3IBMA 3D8CA 2NM1A 4HVOA 3NSTA 1NA1C 1HV1A 2A3WA 4MZUA 2H0VA 1J3QA 5KWRA 2ES3A 3B7MA 4R4XA 2VW2A 4ORFA 1GSLA 1KS4A 1QOOA 1ENRA 2VOKA 1G6NA 1QKQA 1HX6A 5FBZA 3MLJA 1SBFA 2V73A 4LLFA 1ZZ8A 3KM5A 2ZGTA 3HMYA 5I8SA 4R9AA 1NCRC 1HDKA 2AGSA 4YW5A 4M01A 4JDMA 1MR5A 3CJIB 3D4KA 4DPNA 3ZXJA 2D6NA 2RM23 2WFF2 3USSA 3ZXAC 1E57A 1C8M2 5FLIA 4Q1RA 3QLQA 3SCHA 1POV0 4K20A 2ZACA 4N43A 4XF3A 1YJLA 4GIQA 2G4IA 4AGVA 4KWKA 3ZMNA 1ULFA 5AC91 4E9KA 4UW6A 4DY3A 5BUVA 1YXWA 4LBQA 1LHUA 3RI8A 2BTVC 2ZGUA 3J8F3 1WBFA 1MZ5A 3O0WA 1LRHA 2GC1A 2PLV3 5J7MA 4QT6A 3BCWA 1YCIA 4RQPC 3ETQA 4FP2A 4U2AA 1CJDA 3KSCA 4HN0A 5KXCA 4FAGA 4IQPA 1YFYA 3GF6A 4P9XA 3VDDB 3WG2A 3SMHA 1SBEA 5I91A 2W52A 2BVBA 1PVXA 3WW1A 1GLHA 4E4DX 3T2TA 4YW3A 4BMEA 2WT2A 2DCZA 4I0AA 4MX3A 1VBC3 2PHLA 3POSA 4DRVA 2Q1ZB 3FMGA 3AMHA 1AYM1 3AJYA 3N35A 3PVEA 1QGLA 1BKZA 2R32A 4FCAA 4LBQD 1PVC1 4QGNA 3RNSA 2XUMA 1RUF3 2VMHA 1LKNA 1N3QA 1FV2A 1UZZA 2K2SA 4A7KA 1QXRA 1AX0A 5DG2A 4DXZA 1SCRA 3R4SA 2PYTA 4META 1N1SA 2DV9A 3OBRA 4BM8A 2VNGA 2FQPA 4CEWB 1KRIA 1OOPA 4XJUA 5F5QA 4Y1VA 2CYFA 4LA3A 4LO4B 4D94A 2ZMKA 3IM0A 2D3RA 4LHNA 3R0RA 4Y22B 5I93A 4G4FA 3VKFC 2XVKA 5E88A 2GC2A 2AREA 4YZ2A 1AR81 3URFA 1DGRN 3VBRC 4WVWA 1DGWA 2A6YA 2CGNA 4K1ZA 1ALYA 2JG8A 4PDWA 2B42B 2JG9C 1O5UA 1QQP1 4GQ7A 1CAWA 1RMU3 4SBVA 4B3NA 1RUNA 1RHI1 5LK5A 2GDFA 1NCQB 1C1LA 1AR61 1LU1A 4IEYA 5FAXA 3ZX7A 1ZA4A 4GH4C 1MQTA 1LOFA 1F2NA 2W08A 1HQWA 2JICA 1B35A 1HXS2 1MEC1 4P9GA 4XHXA 2VY0A 2ZGSA 3R6SA 5HCAA 1XRUA 2R16A 1VBA3 2Y26A 1W6NB 4N7UA 4WM7B 3KZ4C 3GBGA 3TBDA 4YG0A 4MSVA 4BQ1A 2WA3A 4XIOA 4AVCA 4IEOA 1C28A 2UU8A 2RS13 3E5XA 4NWVA 2WINB 2YUEA 2ETEA 1W2UA 2NN8A 2ZCWA 2ZAAA 3JB8A 4LBOA 4CDXC 2ZZJA 5CFCC 2R043 4ASMB 1OA4A 3MLKA 5T52A 4HPKB 5TSWA 1S0FA 5FO9B 3SHRA 4K6BA 4CDUA 2R1BA 5E16A 5A32A 1PO23 1FNZA 5FFOC 3TNPB 1QY4A 1PZ9A 2HWC1 4FPGA 1LOCA 1PMIA 5T5PA 4Q4X3 1DDLA 2GMMA 2B7YA 3WHUA 2PAMA 4ZKTB 4RSUA 3ASIA 1IOAA 2D5FA 2Z2SB 3MICA 2ZA9A 3NO8A 4L97A 2WJSA 5B2GB 3X29B 5JLVA 4XJ9A 4GKXA 3WHTA 3CJIC 4FXGB 3MW3A 1MS1A 4H55A 3EQEA 5HCFA 2SBAA 3DKWA 4XBQA 5FMOS 1LU2A 4KL1A 2O0OA 4OHWA 2HEVF 3WW4A 5C8CC 4Q0PA 1CPMA 1PK6A 3I4IA 3TYJA 2JXAA 5DDJ2 3U0ZA 4XJ8A 3THTA 5T5LA 2A7AA 2NLRA 1ND2C 2FBEA 3INAA 4G3YC 3MLLA 3VZOA 2XJRA 2WKKA 2RS32 1VBE2 3GBFA 1VJ2A 2ARBA 3RI9A 3L2HA 2CGOA 1FX5A 4IEVA 3ALQA 4LO7A 2W39A 5L7OA 1XU2A 4IV3C 2IFRA 4AXOA 3ZFEA 1LEDA 1HW5A 3PVOA 2Z42A 5CIRA 4EN0A 1QJY3 2OZ6A 2UWAA 4V1PA 3B9IA 4AI2A 1VALA 2WZR3 3NV2A 3GZAA 1RUC3 1TQ5A 4GB31 1EPWA 5CVRA 3H7YA 3NKTA 2IZWA 1J58A 2NMOA 3AKQA 2HEWF 4H14A 1DQ1A 1KD7A 3VBHB 2PHFA 4Q4W3 1IPJA 2R0FA 4PBPA 3FLTA 1UX6A 1VRH3 1KS5A 1WCDJ 3ZN5A 4MXWA 3OY8A 2B8MA 4M3CB 2EXKA 2WSVA 2I45A 2WIIB 4GULA 1RUG3 1WUVA 2BEOA 4U36A 4DMIA 2YC0A 2DVBA 4HFSA 3VDDA 1V6LA 3K51A 5C6CA 1FMD2 2R062 4YGEA 4B4QA 2XKOA 1OLRA 1VAMA 2PELA 2QCSB 2ET7A 2R071 1WW4A 3NAPB 4WM8A 2Q5TA 3O14A 2GZWA 1ZX5A 2ZHMA 3HT2A 1Z7S2 1QHDA 4YLZA 1WA4A 2CY6A 4NN0A 2HWD2 4R9CA 2VG9A 2XLFA 4K3UA 1IPKA 4XQ4A 4UW4A 3O0VA 4YVWB 2HJIA 4AI8A 1AR72 1HXS1 1AR91 3AMPA 4CDQB 2HWB1 1RUJ2 4W65A 5A3LA 1X8EA 4EJRA 4BCUA 5JSRA 3SISA 5AFEA 5F1RA 4ISRA 5KHJA 3WNXA 1DHKB 1QJX3 1S0JA 2RS53 1RUH2 3VBOC 5JAXA 4LE3A 1EY2A 2BYVE 3HWJA 1WD3A 2GH2A 1QJU3 3ZN4A 3SLIA 4L92A 1OA2A 2PAEA 3GHMA 5LRSA 5KHGA 1NCQA 4FOYA 4QD2A 1LHOA 2ZBJA 3RRDA 4RHV3 1ZBE3 1R092 3M3CA 4K40A 3WX5A 1J1TA 3VHNA 3MPBA 3A4UA 4HVRA 1ZZBA 1OFSA 1OA3A 3AP4A 3V56A 3FHIB 3PMSA 4GALA 4C0BA 2YROA 1R1A2 4XBNA 1H1AA 4LEJA 3LWCA 4JVAA 1V6IA 1CJPA 3JBG2 1ENQA 1RJ7A 1W6NA 2OUHA 3RYRA 1BYHA 2A75A 2BGCA 1N47A 1TNRA 1ULGA 4Y1YA 1VAKA 4Y1XA 3UJOA 4JGZA 4B7EA 3M3IA 4K9SA 4QGMA 5KC6A 4FOQA 1DZQA 2Z5WA 4AVAA 2X5IA 3WR0A 2D3PA 2AZ5A 1OPMA 1PO13 3ZXKA 3B5LB 4S2DA 2AENA 2IFWA 3V64A 2UYBA 1ULCA 3ELNA 4QQ2A 5BNNC 4FPHA 3VZNA 5J3UA 4LO8A 4LBJA 4E27A 4XFIA 5J96B 1ND3B 2WS92 2ZHNA 5HXVA 1W0OA 1QMJA 1VBD3 1G9CA 2BQPA 1AL22 2UWCA 3SXWA 1BJQA 3TOJA 5FRAA 5FO7B 1SEFA 3JD71 4YSFA 2CAVA 4MXVA 3I7DA 3PLQA 1R083 2ZX0A 3GYDA 3I8TA 3MI8A 4MYEA 1UU5A 2FZ1A 1RVF2 4NHKA 4E2GA 2Y0OA 4XEZA 1DBNA 4QPGB 2GSYA 5BNPA 3ZFGC 2XKPA 3VKMA 1Y9QA 3V0BA 5T3NA 3WV6A 3SNMA 1S0CA 2VUAA 3WP4A 4XTPA 4Y4YA 1GFF2 1KDKA 3DL3A 3OF1A 3VBHC 3OBTA 1X8MA 3WLUA 2XBO2 2ZX2A 4GA9A 1GQHA 4HETA 4QQOA 1HQNA 1LEMA 4BPZA 1NY72 4A2UA 1M06G 2QKDA 2WLPA 2UWBA 3ZXDA 5JZGC 1NA1B 1RJ8A 3H3ZA 3AFGA 2F4PA 4R9BA 2JE7A 5GLWA 1V6OA 3E6BA 2VMGA 2RR13 3B02A 4D69A 4EN9B 1OD5A 1OLQA 2HWF3 2WQ4A 5T54A 3WDTA 4DRRA 4CDWA 3RZZA 4WZCA 2RMU3 3NAPC 4SLIA 2GMPA 2JEMA 1NCRB 1HKDA 3TN91 5CB7A 1H4HA 1FMD1 1ASJ2 1W6PB 2MEV3 1YFWA 2P3JA 1PHMA 1HRI3 1CAUB 1RUD1 4Q4Y3 4LA2A 4CEYA 4TZDA 2P3KA 4I01A 1AYN3 1FOD2 3VL8A 2UY9A 4FSJA 4YVWC 1F31A 2C9AA 1U0AA 2B46X 1OKQA 1ZYBA 4D7SA 1PGW1 1COV1 4Z1VA 3J8F2 1I9RA 5LEKA 2XWBB 4L99A 2PLV2 4IEPA 3D0SA 4NR1A 2ZGKA 3S0MA 1A6CA 4RQPB 1SACA 3WDWA 4OI2A 4GMP1 3IDBB 2CTVA 4D3WA 2PN5A 4O9EA 2ZKNA 1DGLA 3IPVB 4DS0A 1GNZA 3A0NA 1YO8A 2DVDA 5BNOB 4TWTA 4XXPA 3FLPA 3I59B 2HYKA 3K48A 1LGNA 1QU0A 1XNDA 3LB9A 3OYWB 1VBC2 4CYDA 4Z92B 1LGBA 5JOWA 4XF1A 5ACA2 3H1WA 2BW8A 1TEIA 2PHRA 5BXXA 3LSDA 1RUF2 4IV1C 3RJRA 3ZSJA 2D93A 4PJYA 1C3HA 4PF5A 1BEV1 4QQLA 1O4TA 4FPYA 1R1A1 3NKGA 3RYPA 1RUI1 2AH2A 1KFUL 1VP6A 3AYAA 4UW3A 3HR9A 1CAVA 2R6QA 1BQPA 3QH7A 3W59A 1TMF1 1LULA 1XXNA 5JOYA 2HWE1 1Q8QA 1EAH3 4KU7A 3MPPG 4MVTA 2WWSA 1PIV1 1ND3C 1YI9A 3VN4A 5CFDA 3VBRB 5BPXA 2IC1A 3VV1A 2ZS6B 1EV13 4P9WA 1F5FA 1PGSA 4G9SB 3VL9A 1RMU2 5C4WA 3M1HA 5CNAA 4N53B 1O4ZA 2G9FA 2ZX3A 2PHUA 3DV8A 4OHXA 5K0UB 2QFEA 2ZGPA 1X7NA 4LUMA 1N3PA 3AP7A 5ABJA 3LGRA 1RL3A 2D44A 3NV4A 3E5QA 4Q4V1 5KHKA 1ZBA3 4BOWA 4QPGC 3V65A 1FT9A 1UKGA 3SH3A 3TB0A 1WGPA 4COYA 3B9CA 1MVEA 4Y20B 4CP1A 3ENRA 3VZJA 4MUVA 4Q0UA 3TAYA 1H1MA 3ZO0B 4FTSA 1UN1A 2XGXA 4IEUA 4OFGA 3BALA 1BBT3 1REEA 4Z8BA 2WZPP 2RS12 1RVF1 2WT0A 3ZYPA 4AE2A 5FQ0A 4NHMA 5SV5A 3U11A 2NPIA 5CFCB 4TLFA 5K8SA 2OIIA 2ZMNA 2ENRA 4ONUA 4ES8A 1AF9A 4HL0A 4MGZE 4YW4A 2VW0A 4FOVA 4LHKA 2VNRA 3A0KA 2ZKLA 3DUIA 5I8TA 1PO22 2W68A 1YYNA 3KLSA 2R30A 4AEDB 3U4XA 1WLDA 1D4M1 3PVBB 1AXKA 1HRV1 2DFCA 1V6MA 4FTBA 3AMQA 3ATGA 1N3OA 2QDNA 1WLCA 5C9AB 4ISQA 2OA2A 5JI9A 2GNMA 3M70A 4XBLA 3WDXA 3H50A 3R4UA 1GYKA 1SFYA 2PTMA 1V6JA 1QXJA 2Q8OA 1IS6A 1C4RA 1H2NA 1U5XA 4GWMA 1I1EA 2AYHA 4UW5A 3PNAA 3QBQA 5D8AA 3M3OA 5EZWA 1H8TA 2ZGMA 4MGIE 4N90A 1IS5A 1A3KA 4F83A 3HD8B 2VXRA 4YW1A 1UF2C 2D6MA 4BLJA 4YZ3A 2E7TA 4QX5A 4C91A 3IWZA 5K9YA 1ASJ1 2I2SA 3CEWA 4Y24A 5C8CB 1HQLA 5AC93 1LR5A 3MW4A 4KU8A 3S6PA 3WZ1A 5GZEA 2GNDA 1FOD1 3R05A 4WVMA 2R1DA 1WW7A 4YG3A 2FHRA 1ND2B 4BH9A 1RC6A 4IEWA 1QH7A 1TME1 2ZGRA 5T50A 1WMFA 2WSUA 5BNOC 3LOIA 1V6KA 5C8WA 3D82A 1F9KA 2WNUC 4IV3B 4K1YA 3H1YA 4HSLA 1UAIA 2E6VA 1G7YA 1I5ZA 1NOVA 1QJY2 2MNGA 3KT7A 1CVNA 1DG6A 4JGYA 4JC1A 1U5IA 1Q3EA 2VW1A 3G7DA 1AYM3 2Y38A 1IQAA 4X6QB 4Y26A 1SLLA 1PVC3 4AFAA 3LKJA 2YMZA 1DU3D 4UXAA 2H6CA 3TNQA 1L3JA 5IK8A 1HLCA 1REFA 4DINB 3FLRA 1JYCA 1VRH2 1LOFC 3WT3A 1GV9A 1GKBA 2BFUS 3FX3A 3AXDA 5JSOA 1FPN1 4OI0A 3W58A 2Y0IA 1RUG2 3ZDSA 4YNIA 4X8PA 1CQ9A 2HEYF 2TEPA 1G9AA 1O91A 3E6DA 3CLPA 4XFBA 4OHZA 2ZMLA 2PFWA 4JCKA 1AR83 3NJZA 3ZMOA 3MIDA 4L8QA 3KT1A 3WCSA 3I59A 4N53C 1VBB2 1QQP3 5K0UC 4B4RA 1RHI3 3KGLA 3S30A 3M8LA 4FPOB 1YFXA 3VKOA 1AR63 1URXA 1LJ7A 3DPRA 4XJAA 3WG4A 3QH6A 2WC2A 2IXHA 1DGWX 4LULA 5AVPA 2XWJB 2W0XA 1XE8A 4AQ6A 1MEC3 3FC0A 1MACA 4YVSB 4CDUC 1SCSA 1VR3A 3VZLA 1MS9A 4IEZA 2QNKA 3N7JA 2XJQA 2WQZC 3EJKA 4YGDA 1RUOA 2XG3A 2VNOA 2VMIA 1CX4A 4O9GA 5F9TA 2RJKA 1QJX2 1VLNA 4E4ZA 2RS52 2I74A 3VBOB 1V9U2 5DUWA 5AFBA 4FP3A 1QJU2 2C5DA 2JG9A 5CG8A 4QMAA 3AKSA 5FTTC 2B39A 1XE7A 2ZTNA 4AEDC 1Y43B 2ZHLA 4ES9A 4RHV2 2NP0A 1CESA 4GH4A 2EXHA 4HSJA 4AHWA 1ZRFA 5C9AC 3MIEA 1Z78A 1I6XA 3WINE 2HWC3 4XOGA 3VBSA 3BOPA 1LOGA 3UL2A 2XJVA 4WBBA 3ZXGA 1X82A 1WLWA 2UYAA 1LHNA 4AI0A 4EWDA 1DF0A 2EAKA 1WBLA 1FYUA 4RD7A 3P3NA 4L9BA 4RR3B 5L7OC 1NG0A 3D0JA 5T5OA 2ARXA 3MIFA 4CDXA 1PO12 4XQWA 2BNNA 5EJ3A 2WFF1 4E2SA 2QVSB 2DCYA 3QCWA 3W9AA 1C8M1 5BNNB 3ZN6B 4J1WA 4DFSA 2ZOEB 1C8NA 1YFUA 2AUYA 3AM2A 3BOWA 4PBOA 3CO2A 4H7LA 2GNBA 5GLTA 5HCBA 1LGCA 4NHLA 1R082 5GM0A 2DTYA 3BPZA 4CP2A 2VPVA 4PLNA 2VH9A 3OGJA 5EXOA 1WLTA 2YDEA 4WZFA 3OJBA 3CJIA 4AEMA 2WLQA 3VHOA 3CF6E 2OPKA 3ZFGB 1GZWB 2A5ZA 3RMXA 5CG9A 4RGGA 4COZA 1D2SA 1Y7BA 2LM3A 2ZHKA 4B4PA 4XETA 4QPIB 5FDBA 3WG3A 4AI3A 4LR4A 1NE4A 2VQAA 1W6QB 4GB33 1TE1B 1MS8A 1DQ4A 4UBHA 4JAAA 5BY5A 2JJ6A 1MVQA 4XQDA 4BE3A 1UZYA 5FOBB 1S0GA 1K5MB 1F5JA 3OD4A 1N1VA 3NWKA 4QQPA 1KITA 2EIGA 3KT4A 3H8UA 2PAKA 1A78A 1IGOA 3VLBB 5JZGB 4Q29A 5KHIA 4W6WA 1X36A 4Z82A 4IEXA 3OD0A 1OFNA 1DGRA 1G9BA 4DQAA 3O7OA 2RR12 4D7TA 2HWF2 4IV3A 1SQ4A 3ZYRA 3LA7A 5LK7B 3AK0A 3C3VA 1UCXA 4YM0A 2WNEA 4WVZA 2GALA 1QOSA 2R073 2MEV2 1HRI2 4Q4Y2 3VGIA 3U07A 4YVSC 3B00A 1HV0A 4FT8A 3WW2A 2XPJA 1AYN2 1KDMA 3BTAA 5LRRA 4K7JA 1RB8G 4CEWA 1QF3A 1UD1A 4KBBA 3V0AB 4FPFA 4RS5B 1IZ3A 2DCKA 3S7EA 1PNGA 1HXS3 1AR93 1ZM1A 4AFCA 4Y22A 2HWB3 2RHPA 4DOUA 3UKTA 1U12A 3USUB 1UU4A 1S2BA 1BVP1 4ATEA 1H9PA 4NOTA 2O8QA 5K7PA 1ZRCA 2WFPA 1MZFA 3RWNA 5BYNA 4YM1A 1PGL2 1DYPA 1ZVFA 3ZIWA 2X5IC 4EROA 1CAXB 3FUOA 2KM2A 3L9JT 4CZSA 4LE4A 1V9U1 4DZGA 1AVBA 2XJSA 4IXLA 1CIWA 4FPEA 4IV1B 1EPZA 5FLHA 4WM7A 4LO5B 1WMEA 4JQRA 4HVQA 2DCJA 4LBMA 2DU1A 5IT6A 4K21A 3RYKA 2H6BA 3O12A 1BCXA 2QE3A 4COUA 4RR3C 5E1RA 2ILMA 5F6KA 2D98A 2D6OX 1UPIA 4H7MA 2WNVB 2ZGQA 4MH0E 3SH5A 1NXMA 4AWDA 1H1IA 1SLIA 2DURA 1GANA 4M0NA 1EAH2 1C1FA 2DFBA 4X6RB 2NYYA 4HPKA 5JOXA 4LHLA 4QHBA 3ZFFB 4Q8KA 1OPOA 2E7QA 1YWKA 1EV12 2K9ZA 4BA6A 4HZFA 5GALA 4NPRA 1NLRA 2D6PA 2C1FA 1JBCA 5GLZA 3UK9A 1FNYA 2VU9A 4XTMA 2GC3A 3SITA 1DIWA 1UU6A 2XJTA 3E97A 5DDJ1 2ZX4A 4XF0A 1YRZA 4FTEA 1OQ1A 2N7GA 4MGKE 3JD73 1JOJA 2RS31 1VBE1 1RITA 4NVPA 3GALA 2XJUA 3MW2A 1ZBA2 1O3TA 3FE5A 4Y5Z0 5J98B 4AW7A 1Z0HA 4QGLA 4ZU7A 1Q8PA 3N3HA 4MGYE 4I3GA 3CJXA 2D43A 1RUE2 4QPIC 3BU7A 5DZGA 2GMEA 1ZZ7A 4BIFA 1BBT2 1N1YA 2D3SA 4R4ZA 3RDIA 3AFKA 3H0OA 3FBYA 4AYUA 1LENA 2EAAA 3FJSA 4M0HA 3PMEA 1DQ2A 1K5MC 4HMZA 1SLBA 1AZDA 1NYWA 1ZRRA 3NW4A 4ZXKA 4BZ4A 1PZ8A 2JX9A 1W6OB 5IK4A 2YZ4A 1JUIA 2ZPXA 1KQRA 5EV7A 2QDRA 1JHNA 4N43B 4PIXA 5DUXA 1JXNA 1KXGA 4AFDA 3ZXLA 4AGGA 1UIJA 3DN7A 4LBQB 5I0SA 5I0UA 1CR7A 4P9LA 1ZZ6A 2XH6A 1BK1A 1H4GA 1WW5A 2ET1A 2R061 3HAGA 2FZ2A 4EWAA 2XHKA 1MS5A 2RM22 4XHBA 3UV9A 2BNMA 2PHTA 4KG0A 4KGQA 3TN93