1NCQA

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 45
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqA00
1PO13 4SBVA 4Q4Y1 1QQP3 5L7OA 2HWD2 1RUE2 2WS93 1C8NA 1ND3C 2RS53 4GB33 1VB4A 4WM7A 4WM8B 3ZFEA 5C8CB 2HWE3 4Y5Z0 1PVC3 4NWWA 2TBVA 3ZFFC 3VDDB 5ABJA 3JB8A 1PO11 3TN92 4PDWC 4IV1A 1AR61 1AUYA 1ND2C 1AL23 3DPRA 2WS91 4FSJA 1VBC2 1ZBE2 1K5MC 2RS51 3VBUB 1RUG1 1WCDJ 2WWSA 1R081 5A32B 3VBFC 3ZFGA 2WLPA 1RUH3 1VRH2 1RB8G 2RR12 1W39A 1AR92 1AR82 1EV12 1HRV2 5JZGB 4CEWB 4EJRA 1PGL2 1A6CA 4JGZA 4Q4V3 4RR3C 5DDJ1 1DDLA 5BNPB 2DF7A 1TME3 2R043 1M06G 1FMD3 1RUJ2 1RUF2 2R062 3CJIA 1NCRC 1V9U1 4RFT0 5CFDC 3JD72 2XBO3 1Z7S2 1AL0G 1ND3B 4Y4YA 4WM8A 4Q4Y2 5ACA1 1FMD1 3VDDA 4CDQC 2BPA2 1NA1C 2XBO1 4AEDA 1RUI2 4Q4W3 4QPIC 1VAKA 5BNNA 1RUC1 2R073 3VBSA 3NAPC 5CFCB 1AR62 1FPN3 1QJX3 1D4M2 1HQNA 2ZAHA 1H8TB 1RUD3 1COV3 1HRI3 4GH4C 4Q4W1 1VBE1 1MEC3 4CEWA 1RUG2 1VBA1 4JGYC 4RR3B 1R082 5L7OB 5FOJB 1BEV3 1PGW1 1QJX1 1MQTC 3ZFEB 4WM7B 2PLV1 1PIV1 2QQPA 1ZBA3 5CFDB 5DDJ2 1MEC1 2RM23 1QJU3 4IV1B 2HWF3 1NCQC 4Q4X3 3LOBA 2RS13 1ND3A 1AYM3 4RS5C 1V9U2 3ZFFA 4PDWA 1NA1B 5J98B 1RMU3 5K0UB 1ND2A 3ZFGB 2HWF1 4Q4X1 5FMOS 5ACA2 1K5MA 1RVF3 1AYM1 3NAPB 4CDUC 1VB2A 4QPGC 1QJY1 1SMVA 4JGZB 3VBFA 4GMP0 3VBRC 1RUC2 2GH8A 1RMU1 1RHI3 1POV1 4LLFA 5C4WC 3CJIB 5D8AC 1RVF1 4RR3A 4CDXC 5BNOC 2HWC2 1VBE2 3VBOC 1VBA2 1NCRA 5CFDA 1IHMA 1PGW2 1QJX2 4RQPC 1QQP1 1VBB3 4NWVA 4AEDB 2PLV2 1HXS3 1PIV2 5BNNB 2FZ2A 1PO23 4GB31 1ASJ2 1MEC2 3VBSB 1F2NA 2HWE1 4CDQA 1PVC1 5A33A 2BUKA 1NA1A 1BMV1 5K0UA 5AC93 4QPIA 1VBB1 1GFF2 1AL21 1TMF3 4YVWC 4CEYC 4FTBA 3NAPA 1R093 1OOPC 2WFF3 1F8VA 4Q4X2 1FOD3 4GH4A 5AC91 1R1A3 1RUH1 1EAH3 1QJY2 4JGYA 1TMF1 3VBHC 1AR73 1X33A 1VBD3 1AYN3 2MEV3 1R091 2WZR3 1MQTA 4FTEA 4Q4V1 2WFF1 1TME1 1RVF2 4N43C 2R041 3ZFFB 1HX6A 4PDWB 4IV3C 4BCUA 1NCQA 3J8F3 5C9AC 3ZXAC 1ND2B 1VBD1 1NY71 1AYN1 1B35C 2MEV1 4RS5A 1K5MB 5FMOL 1PO12 2RS33 1QQP2 2X5IC 3VBFB 2WS92 3DPRC 2RS52 4GB32 1OPOA 2HWE2 1PVC2 2HWD3 1BBT3 1RUE3 2ZTNA 2R071 1BMV2 2RS31 2ZZQA 1FPN1 4N53C 3VBRA 1AL22 2GSYA 5C4WA 1RUD1 4FTSA 1COV1 5D8AA 1NCRB 1HRI1 3TN93 1BBT1 5BNOA 5AC92 1BEV1 4YVSC 1VBC3 1ZBE3 1RUH2 2FZ1A 4N43B 1TMF2 3JB4C 4GMP3 1X36A 4CDQB 5A33B 4RQPA 3TN91 1ZBA1 4Q4V2 2WFF2 2RM21 1QJU1 4QPIB 1VRH3 2RR13 1AR93 1AR83 5C8CC 1EV13 1TME2 2RS11 3HAGA 2R042 1FMD2 3VDDC 2HWB3 2XBO2 4GMP1 1AYN2 1RUJ3 4GH4B 2R063 1VRH1 3JBG3 1AR91 3FBMA 1EV11 4YVWA 4CEYA 3JD73 4JGYB 1OOPA 3VBUC 2HWB1 1MQTB 4Q4W2 4Q4Y3 5JZGC 4CEWC 1RHI1 2R072 3JBG1 4RHV3 3VBHA 1FPN2 1NCQB 3JD71 1RUI3 5BNPC 4RS5B 1RUD2 1COV2 2XPJA 1HRI2 1POV0 4N43A 2BFUS 1AR63 4IV3A 1D4M3 1BBT2 4RHV1 5C9AA 1BEV2 1B35A 5J96B 1RUI1 3S6PA 1RUG3 1HXS1 4CDUB 1R083 1PO21 4QPGB 1ZBA2 2X5IA 2RM22 4Z92B 1QJU2 1D4M1 2VQ0A 2HWF2 2RS12 3VBRB 2RMU3 1AYM2 5C4WB 5D8AB 5DDJ3 5GKAC 5CFCC 2IZWA 1CJDA 4CDXB 4CDWC 5BNOB 4N53A 1RMU2 1H8TC 3VBOB 1C8M3 1V9U3 1FOD1 2RMU1 3M8LA 5L7OC 2HWB2 1R1A1 4RQPB 1EAH1 1AR71 1NOVA 3ZFEC 4YVSA 4WM7C 5ACA3 2WZR1 1RHI2 3JBG2 1C8M1 5ABJC 4IV1C 1RUC3 3J8F1 5C8CA 4YVWB 4CEYB 4CDUA 4QPGA 4RHV2 1OOPB 2HWC3 5K0UC 1VBE3 1VBB2 3ZFGC 1HXS2 1VBA3 1CD3G 1PO22 3IDEA 3VBHB 4CDWB 3VBUA 4JGZC 4CDXA 2HWD1 5A32A 1RUE1 2PLV3 1PIV3 2HWC1 3VBOA 1ASJ3 5JZGA 3CJIC 2BFUL 4IV3B 1R092 5C9AB 5BNPA 1B35B 1FOD2 2RMU2 4WM8C 1HRV3 1OHFA 1VBC1 1ZBE1 5ABJB 1ASJ1 2BBVA 1R1A2 1EAH2 2X5IB 1AR72 1VBD2 1NY72 2MEV2 2WZR2 4AEDC 1QJZA 3DPRB 5BNNC 1RUF3 1C8M2 1QJY3 1E57A 2RR11 1AR81 3VBSC 1HRV1 1Z7S3 1PGL1 3J8F2 1POV3 4N53B 1RUJ1 1RUF1 2R061 5CFCA 4CDWA 2RS32 5LK7B 1Z7S1 1NG0A 1H8TA 2Y26A 4YVSB
chains in the Genus database with same CATH superfamily
1WUVA 2RDNA 1PO13 1HB2A 2XJPA 4HL0A 3A0KA 4QX2A 1PM4A 5ERLA 1NKGA 1CONA 5T54A 4E2SA 4Q5OA 1RUE2 4OQ9A 1C28A 1JMUB 3F2ZA 5DZGA 4KI5M 4YGBA 2WS93 4XF0A 1JYTA 1ND3C 2WZEA 2RS53 4I09A 1VB4A 3IKWA 3ZFEA 5LBFA 4NMIA 2BOJA 2P4EA 2XHNA 3S7EA 1KJRA 1Q8SA 1DHKB 1RITA 3EO6A 3NMBA 4NWWA 3ZDSA 5CEHA 2ZEYA 1STMA 4QQPA 5FPZA 3ZSEA 3JB8A 5ABJA 4PDWC 5L9VA 2CGPA 4A4AA 1AL23 3GJAA 3DPRA 1HB4A 1SBFA 4QXKA 1K5MC 4R9DA 1KS5A 3V0BA 1V0AA 4CPBA 4AR2A 3LDBA 2HEYF 4NO4A 1RUG1 2ZPXA 5FK8A 1DLLA 3VD4A 1X7NA 4A7KA 2WO2A 4XDPA 4LR4A 3ZFGA 1OLME 5T55A 2WLPA 1RUH3 4B4PA 2DCTA 1HLCA 3VKOA 1RB8G 2A3YA 1AR82 1HRV2 4BM8A 2VJXA 2ZX1A 4XW3A 1KFUL 1Q8VA 1A6CA 2PHRA 2FDHA 1V6NA 4Q4V3 3IPVA 3N9LA 2HEWF 3HEIA 3LKJA 3E97A 2VOWA 3IAPA 3Q8EA 1RC6A 1M06G 3ZXGA 1FMD3 4MGSA 5FYBA 1YEWA 4CCKA 2R062 3RYKA 2P37A 3BPZA 3ZKYA 1V9U1 1GANA 4XFHA 2JDNA 5CFDC 2GN3A 4IEQA 1W6PB 2VQTA 4OZXA 1YFUA 4Y1VA 2XOMA 3ZYRA 4QXCA 1SG3A 4Q1PA 1QOOA 3D82A 3HIFA 2XWJB 1LOBA 2Q4SA 4LA3A 2YZ4A 1GU3A 2XQRA 5C8WA 2D3PA 3H3ZA 2WSVA 1LEMA 3O0XA 3VZKA 3QACA 1YQ5A 4UOJA 1GR3A 1UX6A 1W6OB 5A6YA 3O1SA 2XBO1 4AEDA 2SBAA 1MZ6A 1XRUA 1CAXB 3FFQA 5E88A 3RZZA 5BNNA 1RUC1 1PMHX 1JYVA 3I49A 1K3IA 1J3RA 4XCAA 1SDWA 1SEFA 5CFCB 1AR62 5I8SA 1FPN3 4OHWA 5C33A 5HCHA 3DUIA 4H14A 2VVDA 3SQOA 3D5OA 1DQ6A 3SC7X 3WW1A 4XMIA 4BH9A 5ISLA 3U4SA 1H8TB 1BVVA 1DBNA 2ZAHA 5FAXA 3K51A 2LROA 5LW9A 2ZEXA 5JOZA 2W3JA 1VBE1 2C1FA 2PHTA 2VO5A 2E9QA 2R0FA 3DCQA 3FX3A 3KT7A 4QPWA 4BPZA 3OOXA 3U11A 3H7JA 4Y26A 1R082 1LHNA 4JTOA 4URAA 1EPWA 1PGW1 5FFOC 3BTYA 1KFXL 2VG9A 3ZFEB 4TZDA 3ACLA 4DOUA 3IZOA 2YXSA 3ZPYA 1XC6A 2VNOA 2QQPA 5LA9A 1O59A 5DDJ2 1MEC1 4QU1A 3UYJA 2HBTA 5LRRA 3O0VA 1ND3A 5FO7B 3ON7A 4XACA 1I9RA 5D2AA 1AYM3 5FYYA 2J22A 3ASIA 3KQRA 4AW7A 3AYCA 2DTYA 2P2KA 2PHUA 4PIZA 1YI9A 5C3PA 3V0BB 2E7QA 4PDWA 4FOYA 3OGSA 1OVPA 5FJHA 5J98B 1RMU3 3FHQA 2WNOA 1RXFA 4XFFA 1HB1A 2HWF1 3R4SA 3WNPA 4Q4X1 3ZFGB 4AVVA 5JR2A 1LGBA 2YY1A 4X8PA 4ES9A 4DQAA 1K5MA 2ZGNA 4BQ5A 1W8FA 3AK0A 4LPLA 4RGAA 2VZTA 4V2VA 1I5PA 4YWAA 5KWRA 1ULEA 3OSDA 2RDRA 1L3JA 3T4HB 4H2AA 5F3GA 2VOKA 3ZSJA 1JZ8A 5T5JA 5A1LA 3GJBA 2PMWB 5IUQA 5CB7A 2DU1A 5HI0A 1WCKA 4IW3A 3K75B 4LLFA 1NT0A 4M4PA 3N9PA 1XE7A 4LBLA 3T2OA 5FPXA 1O4TA 2QQIA 1RVF1 2XUEA 3A0NA 4QT6A 3KGZA 4UW6A 2VMCA 1L7LA 2VZQA 3KF3A 5AVAA 3WF1A 5LATA 4XAAA 2BNNA 2C24A 4O9EA 3BUCA 4R9CA 4ZXKA 3I2HA 4GJYA 4RN5A 5CFDA 1XNTA 5HCFA 1MACA 1JS9A 3CZJA 3B5LB 4U2AA 4AEDB 4AQ2A 4INDA 4I30A 1UOBA 2PLV2 1HXS3 5FYHA 5BNNB 5CADA 5J09A 2FZ2A 1PO23 1H0BA 2JKBA 2ARXA 3I2JA 4GB31 4JV4A 3NJYA 4XBNA 3I3DA 1PVC1 2BRTA 2BUKA 4BE3A 3AP4A 3T30A 1S0FA 2BV4A 2RJKA 1CESA 1GZ9A 4QXHA 4FOQA 1GFF2 4YZ4A 5ANNA 1DIWA 5FPUA 5EFUA 4CEYC 5C6CA 1UYPA 2FQPA 1D7PM 3ABZA 1O4ZA 1QXJA 2JD4A 3R0RA 3U0ZA 3KSCA 1WLTA 4A41A 3H0OA 4O7XA 4QQOA 5JOWA 2ZKLA 4KNCA 1F8VA 1FOD3 2XG3A 2ZGTA 2W9XA 1JN2P 1LJ7A 3OF1A 2XKPA 5AC91 1ODMA 2YBSA 2O14A 1EAH3 3BPSA 1DGLA 2WABA 3WZ1A 3VBHC 1H2LA 1AR73 5FK7A 4EYUA 2MEV3 2V72A 1R1ZA 4ZPIA 5T50A 4FTEA 3WQ0A 2BW8A 4XF3A 4IETA 5FYVA 4GULA 4ET7A 4AHZA 4GKYA 3D4KA 4CP0A 4S2DA 1SHWB 2QQLA 2P1BA 1LOFC 1TME1 4EN0A 3O1MA 2R041 2Z4FA 4YG0A 2WAOA 3KF5A 4I02A 4WVMA 2E51A 4PDWB 1BVP1 3D0JA 4IV3C 4ZU5A 1WGPA 3ZYGA 4QHBA 2XQXA 5C9AC 2E31A 3ZYJB 1GNHA 1NY71 2YROA 1QJEA 4JHZA 5F37A 5IW0A 1REFA 1S0JA 1AVBA 3PUQA 4FFIA 1K5MB 1FV3A 1DGWX 3VDAA 5FZ8A 4DIQA 2UYAA 5FWJA 2BDRA 2OKXA 1WD4A 4AE2A 1QQP2 4KU7A 2A70A 3S0MA 3E6BA 1Y9GA 2ZEZA 3JUUA 3KV6A 2EF6A 4PF1A 1JUHA 2RDSA 4YSFA 4NRPA 3KS7A 3DGTA 1CVNA 3ACIA 4LBQA 2HWE2 2V5YA 4KG8A 3SCHA 4HKOA 1BBT3 2R071 1XNAA 3BOPA 5A7OA 2V5DA 1IKQA 2ZMLA 2ZZQA 4DEVA 3HBZA 4FPEA 4OLLA 3D8CA 4IUGA 1H4HA 4LA2A 3AXDA 4J6GA 2D93A 5FXXA 1RUD1 5FZ7A 1HRI1 2W46A 2W1UA 3WV6A 5IVBA 3WLUA 1OI6A 3MV01 1CAWA 3NJVA 2FDJA 5IK4A 4MGTA 1VIWB 2D40A 3CDZB 3NKGA 5FLJA 3D0SA 2P3JA 4YVSC 1ZBE3 4BYYA 2NN8A 4QHOA 2FZ1A 3I3QA 2D5FA 3QH7A 2RG4A 2VBBA 1F35A 2PAMA 1X36A 1T6BX 4GMP3 1KITA 1MS3A 4F83A 1KDKA 2D43A 4MH0E 3NV2A 4FOVA 1VRH3 1G9FA 4BXSV 4PBPA 4NIGA 2W5FA 1CAUA 2J1RA 2W94A 2L9LA 3MUY1 2XBO2 5DAQA 4URTA 1AYN2 2XJVA 1OLQA 4OCTA 3BIEA 1UY3A 3POSA 1RUJ3 5F5CA 5FKCA 4MXVA 3WHTA 2EAAA 1AR91 3FMGA 1EV11 4CEYA 4EZ4A 5FYIA 1UMIA 1MPXA 5IK7A 5DXDA 3TEXA 5A6QA 2W87A 3AMPA 4AOCA 3K4AA 4D7TA 4W65A 3POJA 3TWIA 5LEJA 3WF0A 4XILA 4LO5B 4BLJA 2Q1FA 3B9CA 4XVHA 5FZ0A 4Y1YA 4CEWC 1NZCA 1RHI1 3JCIA 4LKEA 1PK6C 3EMRA 4FQ4A 4WVMB 5JIAA 3VBHA 4CU8A 1W9SA 2WFPA 2JIGA 1X9TA 2YV8A 5KR7A 3JD71 2NP0A 3V65A 3IAQA 2G1MA 2DVGA 5CG9A 2XH6A 3LFMA 3NSTA 3CO2A 1X50A 5BUVA 2BVBA 4XTMA 2XPJA 1LOFA 2WQ8A 4PLOA 1POV0 1VJ2A 2CY6A 2PAEA 4PCRA 2BFUS 4TLGA 3P5BA 4L9BA 2UU8A 4IV3A 1D4M3 3PJYA 4LQRA 3QOPA 1CPMA 2CAUA 4XF1A 1UQXA 4DB5A 1JYCA 2P3KA 4A44A 5C9AA 4CCJA 3LCPA 4MOAA 1BEV2 2Z2SB 4K9SA 5CZKA 4NIDA 5FWEA 1B09A 1RUI1 5C5TA 3C7FA 2XUMA 3ZXJA 3LSDA 4ZKTB 1J3PA 3AL6A 3HPNA 1RUG3 4EWDA 1SPPB 4M01A 4R8HA 1ZBA2 1VE0A 3AP5A 4RFRB 2E7TA 2VE1A 4LHKA 3LFIA 1ONAA 1SZBA 2HWF2 4JDMA 1O3SA 2BOIA 4JRLA 2VMHA 4H3WA 1WMXA 5I0TA 4W6YA 2R30A 2V09A 4N90A 2YU2A 3AZYA 1DQ5A 2C0ZA 4JDOA 4IXLA 3I3MA 2IZWA 4OI1A 2BYVE 3FWEA 2HYXA 1CAWB 4P5YA 1W3VA 4D69A 5FBJA 1VALA 2LUWA 4Q8LA 3VHPA 2B42B 3DYPA 1UZ0A 1V9U3 5FZ4A 1FT9A 3PTRB 4EN6B 3WNKA 4NJ4A 4D6RA 1Q8OA 1IG3A 1H4GA 1RL3A 2DCJA 3TEWA 5SV5A 3RZMA 2E53A 2FMYA 5DMYA 4AI8A 1IQAA 3H7YA 2ZZJA 3ORJA 4YVSA 1JZ3A 2WZR1 3IDBB 1GOHA 4XJAA 1SFNA 2QTWB 3JBG2 5FR3A 1CAUB 4QKBA 3LAGA 2VM9A 4IV1C 2YC2A 1S0GA 1C1FA 1O6UA 1RUC3 3TEZA 2HEVF 3OGVA 4QKDA 3J8F1 2Y33A 4DPNA 2VW1A 5FLIA 3KB5A 4UT5A 4WVWA 5LK5A 5F1RA 1JHJA 1UWWA 3MI8A 4CEYB 1DQ0A 3M7AA 4CDUA 2UWAA 2QCSB 4P9XA 4QPGA 3WG2A 4MUVA 4D8MA 2HWC3 3PTYA 2UY9A 3U4XA 1VBE3 3LEMA 2QQNA 3MPPG 1MS5A 2JDZA 2ERFA 1UY4A 1ULPA 4XCBA 3VBHB 3C8XA 4RGGA 1XE8A 1LU2A 3LEGA 4M0NA 4CDXA 5FPLA 2JWPA 5G05L 2XJQA 1RUE1 3GCXA 3K4DA 3QBQA 2JDKA 2E7AA 2VUAA 2BVVA 3BOWA 3VD7A 1EYBA 4UXAA 2CNAA 1QNWA 3GCWA 2QQMA 5JPMB 3CJIC 1PK6A 1ZREA 4KWUA 2BFUL 4YZ2A 4IV3B 4CUAA 1U5YA 2WT0A 3GHNA 5C9AB 3LGRA 4COZA 1KJLA 1QH6A 2D44A 2GP3A 5KHHA 4HLTA 4Q0SA 3P1IA 2W52A 4XOGA 1O5UA 5LA2A 2BBVA 1R1A2 3AL5A 2VCBA 1G9BA 3O1VA 2UURA 2GNDA 3APBA 1NY72 3WR0A 1RUNA 4HN1A 4XFGA 1QJZA 3N9OA 2Q1ZB 1RUF3 4MADA 3RYPA 2Z5WA 2VW0A 1AR81 4UYBA 1HRV1 1ZA4A 3K48A 3WDVA 4RYDA 2FCVA 2P3YA 3ZYBA 4A42A 3W9AA 4V1PA 2WKKA 3THDA 2IXCA 5C5UA 5CKNA 3I2IA 1ULGA 2D6NA 2XWBB 3ACHA 1O8SA 4S2HA 4XUQA 2DCKA 2EXHA 2C26A 2R061 4Y1XA 2HBUA 3IIAA 3UL2A 1UL9A 1LECA 3VDBA 2GNMA 4CU9A 1JOJA 4H7MA 3RWKX 3WP5A 3R6SA 5E16A 1OSGA 2V73A 3PVBB 4HK8A 4YVSB 3U37A 1H6XA 3ILNA 4S2FA 4LJHA 5B4XA 1E5SA 1JODA 3ZDVA 4LKSA 1DQ4A 4XF9A 3N7MA 1UKRA 2CAVA 1HQLA 1DGWA 2NQYA 2HWD2 4YRDA 2O8OA 4KG0A 4M3CA 4XUNA 4UW4A 4PF5A 1C8NA 5TSWA 4GB33 3UJQA 1KDMA 4M00A 4Y5Z0 1PVC3 5HBAA 1K45A 2TBVA 4IV1A 4OMDA 3IDAA 1AR61 4LKFA 3WQ7A 4B1MA 4LUMA 4E27A 3UESA 5FPBA 2BBAA 3CU7A 2ZGUA 1VBC2 4Y20A 1YFXA 2ZGLA 4OMCA 1OURA 1NQDA 3OG2A 4YW5A 3RZHA 4KQ7A 4XAEA 2AH2A 5FY7A 1R081 1TE1B 5FYCA 1QF3A 1KGYA 1AF9A 2VZ1A 1QXRA 1PGSA 3WW4A 1U0AA 3G7DA 3G6JB 4UW5A 1O5LA 3U78A 5JLVA 1AR92 5KXBA 4IE6A 1EV12 4CEWB 4HONA 1XOYA 1PK6B 3O5SA 4IGOA 4OZOA 1JYWA 4Q0UA 5DDJ1 5JDBA 4N7UA 5F5AA 2PQSA 3O0WA 4V2WA 2WQ4A 4I3GA 5FZ1A 4CYDA 1TME3 4UAPA 2R043 5BV6A 2VY0A 4NVPA 2XDVA 3CJIA 3HQXA 4L8QA 1TZOA 4FPCA 5FYTA 4FO9A 4RFT0 4HVRA 2FDFA 3JD72 5C3OA 2ARBA 1Z7S2 2VMEA 1FAYA 4KBBA 5EYYA 1KXGA 3W5MA 1GP5A 1ZYBA 3WDUA 4BISA 1UOJA 4OUMA 5FXZA 2OQ6A 4Q4Y2 1YO8A 1CZSA 3AVSA 1W28A 1JOBA 3VKMA 1UY0A 4H7LA 2PHFA 2DVBA 4LORA 3NV4A 2LRPA 1DFQA 3PHMA 2YG0A 4X8NA 2DCZA 1G6NA 5I0UA 5A7WA 1KS4A 1RUI2 2J1AA 4OHZA 4OQ8A 3ELNA 5A70A 2R073 4P9GA 3E6DA 5B2GB 1QJX3 1YYNA 2XJRA 3ZO0B 3POBA 4WBBA 2QQOA 5GLUA 2QDNA 1DP0A 1ZRFA 5IYYA 2GH2A 1H30A 1RUD3 2XB6C 3KMHA 4HETA 3VZMA 1HRI3 4XFIA 4Q4W1 2VUJA 1CIWA 4D3WA 2LW8A 2YBKA 4MGQA 2VZPA 3OEBA 1S0DA 4QB6A 2JE9A 5LWBA 1V6MA 2ILMA 3LOIA 3PUHA 4LE4A 4RR3B 2X05A 5IAVA 2IXHA 4M3CB 4QB1A 2GC3A 5DQ0A 5F3IA 3ZPOA 2GNBA 5FOJB 1LB2A 4XETA 2ZA9A 2ZX0A 5FYUA 4YPJA 3VL8A 3S30A 3MIDA 2VNRA 2R32A 5F39A 5L9BA 1W8TA 4JRAA 3ZYFA 1BHGA 2PLV1 4YW3A 2XVLA 2DYCA 1WA4A 2QDRA 3ZOIA 4KBZA 1ZVFA 5FY0A 3S57A 3AP7A 4IV1B 4BJ0A 2PHLA 4AQTA 1CAVA 4C90A 2ADEA 4MLOA 1SLAA 1L7RA 4XJUA 2I07B 2YU1A 4P00B 5C3RA 5E6HA 4BQXA 5A3LA 4Y20B 1S0EA 2F4PA 2ZAAA 2ZXQA 1WW4A 2BWCA 2EVXA 2PA7A 4UW3A 4KMQA 4F3JA 5A3PA 2W47A 2W95A 4AGGA 1JXNA 2VMGA 4Z82A 2JECA 5F3EA 4E2GA 4ZZ8A 1NA1B 2RDQA 1W6OA 3EJKA 2HH9A 2R49A 1A34A 1Z78A 3ACFA 2VW2A 1QGLA 2GDFA 4OYUA 5FMOS 2UWCA 3M3CA 2ZHLA 4LHNA 4NHMA 1WW7A 3GF6A 1SMVA 2RHPA 2ZEWA 4XMAA 1IOAA 3TNPB 3B02A 1LHUA 3VBRC 4AAXA 4P9WA 2VNVA 4YM0A 5CNAA 4Z07A 1RHI3 4K8RB 5BPXA 1GOGA 1W8WA 4KGGA 5C4WC 1UXZA 5HPOA 3CJIB 2QQWA 1BK1A 2WL1A 5J7MA 2D3RA 2VZRA 4GALA 5JR7B 1OUSA 1REDA 1UOFA 1RXGA 2OPKA 2K46A 2RJLA 3VUOA 1QOTA 3RPQA 1GMMA 1V6LA 2AC1A 4ZHNA 3UT0A 1W8HA 1JU3A 3VBOC 2Q8OA 1Q3EA 1U5ZA 5J1XA 2JEMA 3O1TA 2XGXA 1F31A 2E6VA 5C7GA 1OA2A 5F6LB 4HK9A 1JZ2A 4CSWA 1QQP1 5JI9A 3HNYM 4NWVA 4Y3OA 5A7WB 1OLMA 3HR9A 1LKNA 1PIV2 3N35A 1RINA 3Q8AA 4UFHA 5F32A 5FUNA 5FZFA 2DUPA 2QUOA 3ACGA 3WVJA 1LAJA 2HWE1 4PI2A 4AYUA 3POGA 4DY5A 1H6YA 2F6BA 4ARYA 3GBGA 4YNIA 5DZEA 2DUOA 2CDOA 4NIAA 1VBB1 2ZGMA 2W2IA 3E5QA 1TMF3 2XL7A 4YVWC 4D0QA 4GWMA 4FPHA 4IEOA 3VKFC 1R093 1URXA 1OOPC 1WMEA 4P9YA 3AKQA 2WFF3 3I7DA 4AAPA 1A78A 2RV9A 5K9YA 3FFZA 3AFKA 1FI2A 1JZ7A 2VUDA 4AFBA 3PU8A 1SBEA 1QJY2 3OBZA 2IC1A 4XFBA 4AHYA 5FBZA 3RRDA 3LPGA 1CAVB 3OGRA 2WZR3 5FYSA 2GC2A 2A71A 3ENRA 1DZRA 3KGLA 5JXJA 3K46A 1LCLA 4EQVA 5KHIA 3AJZA 5IVJA 1EP0A 2OIIA 3BODA 3MO4A 2K9ZA 4O61A 5EPAA 1ZX5A 2FD8A 2VZ3A 3FJSA 3OUJA 3J8F3 1FNYA 2IFWA 3UGHA 2VMIA 1TG7A 1WZXA 2VGDA 2Y64A 2XR4A 5FYZA 1VBD1 3ZR5A 3T2QA 1AYN1 5IVVA 3HOBA 2K0GA 1IS5A 1DG6A 5FMOL 3WP3A 4PT6A 4YW2A 2VQAA 5I0RA 2FCUA 5GLZA 5HV4A 1UIKA 4LEJA 3WINE 4W6XA 2Y8KA 4ORFA 1JYNA 5K4LA 3PL0A 2WWUA 1MS1A 3N7LA 3T08A 3PMEA 4LO4B 4P9IA 2BNOA 2FDGA 2PFWA 3ME2A 3NKTA 1RIRA 3WDTA 3SHRA 1GBGA 1H9WA 1W99A 5FMDA 3BU0A 4I2OA 3N36A 1MVEA 2JENA 4UBHA 1HW5A 4QPYA 3ST7A 3VD3A 3EHKA 1RUE3 1FX5A 3AYEA 1S1AA 1D2QA 4FPYA 4NAMA 4BU2A 5L73A 2RS31 4TN7A 2MNGA 2V4AA 4XHBA 3VBRA 2ZGSA 1SLIA 2J1EA 3MIFA 1UY2A 3FBYA 2GSYA 3BVCA 5H9SA 1OF4A 5C4WA 3CBNA 3OBRA 4TTGA 4FTSA 3S7IA 3I4IA 2WIIB 2HKXA 4LBOA 1LENA 5CYYA 1XNBA 1MVQA 1BEV1 2YUEA 1UYXA 3NL1A 4COUA 4UBGA 4D7SA 4DZGA 5FDBA 3WW3A 3NRUA 4N43B 3WQBA 3H9AA 3D3AA 5FZBA 4ES8A 2VTXA 3A22A 1MS4A 3TN91 1ZBA1 1C5HA 2PHXA 3BI3A 2WNVC 1KD7A 1UY1A 1AR83 1DGRA 5C8CC 3HAGA 5F5QA 1W2AX 1QDCA 3KZ4C 5DAWA 5FY5A 1G9AA 3IM0A 4DRVA 3VDDC 3BIWE 4A3ZA 2HWB3 3WF4A 2XKOA 2W39A 2AZ5A 2DVAA 5EWSA 3RGBA 1W6MB 3C7OA 1IS3A 3MIBA 2IVJA 4PQQA 4A6OA 3SKVA 2R063 2WYFA 3LWCA 3UGGA 2C9KA 4NN0A 4QWNA 4YVWA 3KQ4B 4AGVA 1H1MA 3Q8CA 2VCMA 1OOPA 3PUSA 4AVBA 1ZM1A 4ZONA 2W68A 5DUWA 1ST8A 3N9MA 4O9GA 1G9CA 1OH4A 4Q4W2 4U36A 3E1F1 5JZGC 3OY8A 3HD8B 4CU6A 3JBG1 4RHV3 5A1AA 5JMCA 3BKZA 4QGLA 4L99A 4QM8A 3M3OA 1LGCA 2WZ8A 3V64A 3ZN4A 1BQPA 5BNPC 2WZPP 4HMZA 1APNA 2C4XA 1QMJA 3EQEA 3C3VA 3IMMA 4QDQA 4TWTA 1COV2 4I0WB 1GICA 4NPRA 1AR63 1XBFA 4Y22A 5CU1A 3WF2A 5JOYA 1XPWA 1BZWA 1NUKA 3H1WA 4GJZA 1BBT2 1HQWA 1ACCA 2WQZC 4Q8KA 5FCCA 3M2MA 3T1LA 4YG6A 3L9JT 2CYFA 4PIYA 4EWEA 3AB0A 5IK5A 5J96B 2B8MA 2D6KA 4XEZA 5FRAA 1C3HA 1FYUA 4UF0A 2EXKA 5G04L 3SNMA 1QIQA 1J84A 3KD4A 3NNGA 1D0HA 5BNQA 2KD7A 4B7EA 1R083 1V6KA 5FY9A 4ISQA 5FZMA 3RZGA 3HMYA 3WNMA 2RM22 1QJU2 3A23A 4L2NA 1LU1A 2RS12 3VBRB 5KHGA 1DF0A 2RMU3 1J1TA 2D6OX 2JIJA 2ZX2A 3GZTB 5C4WB 2Q5TA 2CDPA 4BB3A 5DDJ3 3BTAA 5IK8A 1PHMA 1LNSA 1C57A 4BDVB 3SH4A 5GZCA 1S2BA 3H3UA 2X09A 3WDYA 5KXDA 1I5ZA 2Y6HA 1ULFA 2VOTA 3ZVXA 3VBOB 1C8M3 2AR6A 3Q8BA 1CJPA 3OJBA 4SLIA 4CE8A 1Y7BA 1OBNA 3JZVA 4Y24A 4YG3A 4B29A 1AHSA 2BWAA 4C0BA 5J37A 1R1A1 4OI4A 4YM3A 1N47A 1ZZ9A 2VOVA 1NOVA 2PHDA 1Y43B 2A5ZA 3OPWA 2AYHA 1A3KA 1W03A 1MR5A 2RJ2A 3O1RA 4FPLA 4PLMA 1ZZ7A 3HJRA 3THCA 4XZUG 1XXNA 2ZX4A 3A4UA 3ES4A 1N1VA 3AMNA 1CN1A 3U10A 4CXWA 2WNVA 1YNAA 3WF3A 1N3OA 4Q29A 5C8CA 4NE9A 3GALA 1C1LA 2X10A 2FBEA 2B45X 4YVWB 4EN7B 4HXCA 1JHNA 1GOFA 1SPPA 2ZX3A 5DN2A 1OOPB 3LF7A 5L9RA 3T0BA 3AXEA 4C91A 3WUDA 5EIYB 5K0UC 1VBB2 2D3SA 5JAXA 2ET7A 3SITA 4M0HA 4Y1ZA 1W9WA 3VV1A 3RZKA 4JDNA 1DCSA 1LHVA 2YYOA 4UFLA 5H9RA 5IVCA 5K8SA 5GZDA 3IDEA 3DXUA 3OY8B 5CAZA 1JW6A 5IFTA 4C8DA 4CDWB 1O3RA 2B9UA 4JGZC 5A1FA 4KWJA 2CTVA 2HWD1 2WBKA 3WNXA 5A32A 2PLV3 4LTAA 2JB8A 3WW2A 1HDKA 2D6PA 5JZGA 1Y4WA 4Y22B 4IEYA 1HKDA 1NE6A 3T0AA 2Y38A 4XJZA 1SDDB 4F8AA 4IQPA 4QKFA 4AVTA 4BQWA 2ZHKA 4D94A 5BNPA 1CGPA 3H1YA 5LY2A 2AGSA 4P08A 4FXGB 1N1TA 1D4VB 4UF0B 5FV3A 3ROUA 5C70A 3WG1A 1VBC1 1ASJ1 2VZVA 3AKRA 4WV8A 2VH9A 4IEXA 4HPKA 1NYWA 3WG3A 1XJAA 1JYXA 2QNKA 3AFGA 1UX7A 1VBD2 4GWNA 2OPWA 2ENRA 4HBNA 3RI8A 5A7PA 1O3QA 3ECQA 4ATEA 3KT1A 4HKWA 1NQJA 4BQ1A 3AZVA 1W8NA 3S5AA 2GMPA 2ORZA 1XSRA 2UYBA 2NM1A 3VBSC 2CL2A 5BXXA 4QKNA 1UN1A 2O8QA 1IQDC 1W2NA 2VXRA 3C7GA 4I0BA 3T09A 3VZLA 1W0PA 2JD9A 3FZ3A 3IMNA 1YIFA 3HWJA 3DKWA 4IERA 4XXPA 3PNAA 3WCSA 1EUUA 2IXIA 1EY2A 2RS32 5LK7B 1SCSA 5FLHA 2JE8A 1LHWA 1NG0A 1Z7S1 5FZEA 3W59A 1JBCA 2WT1A 4Q27A 1JZ4A 4BQ4A 3TB0A 4SBVA 3P6BA 4Q4Y1 4UFJA 4W50A 1QQP3 2J42A 2YPDA 3IWZA 2QQJA 3DV8A 2G9GA 4PHZA 4RD7A 3RMYA 1E5IA 2ZMKA 1SACA 1HJFA 5FY1A 2WNVB 4WM8B 5C8CB 3GM8A 2BJSA 2HWE3 1ENSA 1W3XA 3M4FA 3ZFFC 3VDDB 4MV2A 1PO11 3TN92 2E63A 4EV0A 3GZUC 1BXHA 2AENA 4E4ZA 3RJRA 4AQSA 2F4LA 5JUVA 2ZCWA 1MS8A 1KEXA 1YFYA 2WS91 3FHAA 3OCPA 4FSJA 2VD7A 3N7JA 2RS51 5FO8B 2Q8EA 2B39A 5FUPA 4PIXA 4BXFA 3FUOA 3DEMA 4HN0A 1G86A 2IFRA 4MXWA 3VDCA 2KR2A 2WWSA 5A32B 4K1ZA 3AZZA 4IGPA 3VBFC 4JCKA 2WSUA 4GAZA 5FP4A 5GLTA 1WWYA 2RR12 3M70A 2X29A 1OA4A 5JZGB 4CA9A 4JGZA 4RR3C 4BIOA 3HVDA 5DUXA 1DDLA 5BNPB 5JSPA 4MGKE 4AHXA 4TLFA 3TYJA 1Y9QA 3PVOA 1RUF2 3ZXLA 4META 4XURA 4K6BA 4NOTA 2ET1A 3AKTA 4NHLA 1UMZA 1NCRC 1OC1A 3HQRA 4OVEA 2NMOA 1Q8QA 2XBO3 3LIHA 4HPKB 4FXKB 1AXZA 2YGMA 5FP3A 3I54A 2E32A 3RFRA 4CPBD 5JSOA 4Y4YA 2GZWA 2ZGRA 4NIHA 2Y0IA 3NW4A 2VZUA 2YBPA 4P9JA 4DS0A 4L97A 3SXWA 4NAOA 1YFWA 4BOWA 2RVAA 3MIEA 4TYSA 4CCDA 1FMD1 2Q8CA 3B93A 1GNZA 5T3NA 1VMFA 1N1YA 4Q0PA 2P3IA 2ARCA 1XYNA 1XNDA 3O1PA 1NA1C 1F5FA 5LRSA 2BPA2 1V00A 4L92A 3ZKUA 1PX3A 4JQRA 2C5DA 3IB3A 3B3QE 1QH7A 4NROA 3ZN5A 1JZ6A 4JKMA 3VBSA 4LK6A 3X29B 3HNBM 4BLIA 5CBLA 3WCRA 4HANA 5EXOA 4Q1RA 4XC9A 3CL1A 4XIOA 4XQ4A 4GH4C 5FPVA 3I2KA 2WRAA 4LUKA 4DUVA 1MEC3 2Z69A 2WT2A 4CEWA 1FNZA 3IBMA 2A75A 4JGYC 2WNUC 4AVAA 2VTFA 1BEV3 1OT5A 2A6YA 5FZLA 2VMDA 2EICA 4P9LA 5FQ0B 1PIV1 2C9AA 4YZ5A 1T6GC 1ZBA3 4J1WA 5EV7A 3WEZA 2HWF3 4Q4X3 4KU8A 1I6XA 2R1DA 1OKQA 1YQCA 4RS5C 4CRQA 3H8XA 2BP6A 3CHXA 1LOCA 1Q56A 1NZIA 1WCQA 4R4XA 1L7QA 3ZFFA 2JDMA 2ID4A 5J3UA 4QAWA 3DYOA 4MXWB 3ZXFA 2BU9A 3T3YA 2WYSA 3USUA 5K0UB 5FZCA 1W0OA 2JXAA 2BZDA 2QQUA 3OYWB 3PDQA 4ZY9A 5ACA2 3O1OA 1RVF3 1AYM1 3UKTA 3NAPB 1FATA 3J7NA 2R6QA 4GQ7A 1VB2A 4OHYA 1QJY1 1UOGA 4JGZB 4QX8A 3RJ2X 4NHKA 4ZS2A 3CKHA 3K4ZA 4FOWA 4D6QA 1U12A 1RUOA 4OHVA 3VBFA 3NQHA 4GMP0 1W2UA 3EBRA 2GH8A 2V4VA 1RMU1 3A21A 4P14A 5HV0A 5I0DA 3BTXA 1POV1 2XJUA 4B3NA 5A3MA 3MFCA 3VZJA 3VB9A 4AK3A 4QHZA 4YGDA 2JG9C 3GZAA 3EB7A 2PN5A 4RR3A 1PVXA 5FZGA 1VMJA 1ZRRA 2HLEA 2A7AA 2UWBA 3VZNA 4LLOA 4W6WA 4QB2A 1JUIA 2EIEA 4X6QB 5IT6A 4LIUA 1VBA2 1H2MA 1NCRA 5A7NA 1UNBA 1IHMA 5GJ6A 1LGNA 2VCAA 1XU2A 1GYKA 1XE0A 3J9SA 5FY4A 1DZQA 2VCCA 1QJX2 3C2UA 3MIHA 4XUTA 4OHXA 3ZIXA 1AZDA 4QX1A 4AI2A 5FZOB 4DINB 2OXBA 5EJZB 3SCFA 2YC4A 1BJQA 3CNAA 3OUIA 3HN1A 1J3QA 1ASJ2 2DU0A 3CEWA 1UO9A 1F15A 1MZ5A 3P3NA 4XJ9A 3VBSB 4BMBA 4DUWA 5A33A 1MS0A 1D2SA 1GSLA 2ZS6B 2VR4A 2WA3A 1NA1A 5AC93 4UFKA 5A80A 1H9PA 5I8YA 2CV6A 3TNQA 1OPMA 2B7YA 4MGYE 4ZXEA 4A45A 4AI3A 1NAEA 4QQHA 3ZSMA 1YQ6A 1OMIA 4BIFA 3PUAA 1XSQA 2QQVA 1JTZX 4KWKA 1YXWA 3U14A 4HZFA 4JKLA 1E5RA 1YRZA 4GH4A 1QWRA 4YFWA 4JHTA 4W4ZA 1ZRCA 3J26N 1OD5A 2E33A 5LBEA 2R1BA 1R1A3 3ILFA 1SLBA 4JGYA 4DXRA 2WNUA 1X33A 3HN3A 2Q1MA 3KWVA 4NRMA 1RTVA 1PMIA 3GYDA 4FBFA 2OUHA 1NLSA 1LODA 4MO3M 4AF9A 4KWLA 5A3WA 1KQRA 4E8CA 2EXJA 1V6IA 2LTNA 3SMHA 1SFPA 3GGLA 4N43C 3WP6A 3WQ1A 2OZ6A 3ZFFB 1HJGA 4G9SB 4J25A 4JC1A 4XPVA 4BCUA 5IVYA 3PVEA 2LALA 3USUB 3ZXAC 1W0NA 4K40A 3KV5A 2OX0A 4XTPA 4HVOA 2IXKA 2MEV1 4RS5A 2VBDA 5CA6A 2EIBA 1X9PA 3OGGA 4PJYA 2FDKA 5JVVA 4IE5A 1R64A 4IEVA 1OQDA 1PO12 1WCSA 5C3SA 2AREA 3W5NA 4CP2A 3O1UA 4LHSA 2PYTA 3VBFB 2WS92 1FV2A 3DPRC 3LD8A 2RS52 5CKMA 3RG0A 2VZOA 1LOEA 2HWD3 2AUYA 1YWKA 2B46X 4AEMA 2JJ6A 1BMV2 2VAUA 4Z1VA 3OEAA 1VAVA 4NUBA 4M3CF 3ES1A 3AKPA 4PI0A 3PVNA 4N9IA 3PJQA 2A73B 4XBQA 4ZU7A 2EALA 4XABA 4TXWA 1AL22 3VD9A 1UU4A 5KXCA 2VUCA 3WSOA 1COV1 3M1HA 1NCRB 5LZ6A 2R16A 1OH3A 4FP3A 3POFA 5FOBB 1CX1A 2H6CA 4O65A 1S0BA 4LBMA 1BBT1 2YGLA 3RQ0A 3POYA 1VBC3 4E8DA 4AFAA 4X6RB 1RUH2 1S0IA 1TMF2 3PLQA 4FQZA 4CCEA 1VMHA 3JB4C 3CF6E 4LBJA 4K3UA 2TNFA 3RZJA 4LBQD 2Q0AA 2VU9A 4EWAA 5FIXA 5A33B 2WR9A 4Q4V2 5A6XA 2CGOA 2WFF2 2RM21 4BK4A 1QJU1 4AFCA 1LOGA 1AR93 4XZPA 1EV13 1K12A 1IKPA 2RS11 1UAIA 4K20A 5BYNA 1Q5OA 3GHMA 1FMD2 1DQ1A 4FFFA 5T5LA 4K1YA 2YB7A 4Y5TA 2ZMNA 3SKJE 2PELA 4IE7A 5A6ZA 3ZXEA 4GMP1 4MZUA 4QU2A 1YCIA 3IDCB 1TQ5A 4GH4B 3KHCA 1VRH1 2YPJA 5IFPA 2HJIA 1WA6X 3FBMA 4UWDA 1P8JA 3JD73 3MEPA 3WD5A 2NPIA 4JGYB 2OYZA 1W9TA 3MBWA 2WNUB 1WMDA 3VBUC 1GQHA 4FFGA 1QNYA 4MSVA 4I0AA 2GN7A 5CIRA 3FLTA 3KVAA 4C1XA 5EJ3A 4Q4Y3 4IEUA 3CMGA 3R05A 5EHDA 2LS6A 5FREA 4DUXA 1J83A 1D0GA 2ZBJA 5H9QA 1FPN2 1RUI3 5J48A 1YUDA 3M3QA 3OTFA 2H6BA 4HVQA 3GNEA 4RS5B 3DXTA 4D7YA 1G7YA 2PHWA 3H3LA 3NNJA 4XE9A 4N43A 1DYKA 3B9IA 1OF3A 2DDUA 1WD3A 1O91A 2P5BA 3B69A 3RNSA 4DO0A 3K3OA 4AQ6A 4EE2A 1OXCA 2YC0A 1US2A 5FMBA 3S6PA 3WHUA 2VL4A 4BQYA 2B5HA 2VOXA 3B94A 3NNLA 3T2TA 1UCXA 4Z8BA 1W2OA 1DYOA 2MHFA 2Q30A 3QD6A 1PNGA 2DFBA 4QGMA 2E26A 2WUHA 4FPOB 5JXHA 1D4M1 2VQ0A 3ETQA 1GP6A 2OW4A 5JSRA 1W6MA 5DABA 3JQXA 4S2GA 4IE4A 3VKNA 3MPBA 1AYM2 5IWFA 3O12A 3E5UA 4OULA 3QLQA 5FYMA 2W08A 2WN2A 2GAUA 2JE7A 2PAKA 4NRQA 4QXBA 5FP8A 2JG9B 3DN7A 5GKAC 1CJDA 3U75A 4I01A 3PIGA 4CDWC 3MZHA 3KM5A 3MDPA 3JU9A 1QY4A 1WBFA 1H1AA 4AI9A 5M0TA 2O0OA 1RMU2 3VLBB 3I3BA 3LA2A 4GZ9A 3CLPA 1LESA 1AXYA 2ZGKA 3EXUA 1ZRIA 2UY8A 3M8LA 1HN1A 3WXPA 2WO7A 5L7OC 2HWB2 2XJSA 3EYPA 4IESA 3UK9A 2D6MA 4LBKA 4COWA 5HXMA 3ATGA 4WM7C 5BNOB 1BYHA 4IEPA 2DVFA 3DKQA 4FPKA 5KXEA 4YARA 1XNCA 4EROA 2CWMA 1UZYA 1SFYA 2EAKA 2XLFA 4R9BA 2W1WA 3TEYA 1WW6A 4KGQA 3T2PA 1GUIA 3H8OA 3CIHA 1FXZA 4NR1A 1OD3A 3GBFA 3J7HA 2JG8C 4RHV2 2I2SA 2P17A 4CP9A 5IAXA 3I59A 4OI2A 1MS9A 1ODNA 4CCOA 4AGRA 5L19A 3ZSKA 2D97A 3FN9A 4QD2A 3ITQA 3LPFA 3TOJA 1HXS2 1JOPA 2SLIA 1CR7A 1PO22 5J36A 5JPNB 4LK7A 3JXSA 1F4AA 2AEYA 2KA3A 2Y6LA 4XIKA 3VBUA 2EIDA 1UPIA 1PIV3 2YFZA 3W20A 4GXLA 1GZTA 2HWC1 3VBOA 1XU1A 2D98A 3MLJA 3ZXDA 3KT4A 5L36A 2IUWA 3A7QA 3OPTA 4QDRA 3J7LA 2AACA 2AEZA 2IXLA 1WMFA 2H0VA 3C7EA 3ZYHA 5FO9B 4LBNA 3ZSLA 2DFCA 1RGSA 1H2NA 2ETEA 1FOD2 3B7MA 4Q0QA 2XVKA 2ADDA 5T5OA 2RMU2 1OVSA 4WM8C 1HRV3 2CHHA 1TVGA 2J1UA 2OZJA 3UNPA 5ABJB 2A3WA 5K7PA 1SCRA 1EAH2 3GZEA 4LITA 4LE3A 4NHYA 2R0HA 4YW7A 4CZSA 4UI9L 1AR72 3GXUA 4GWIA 2NZ9A 5F2SA 2JDHA 1RYYA 1BLZA 2A3XA 2MEV2 4QQ2A 3MF9A 1DYPA 3OGJA 3DPRB 5KC5A 4LKDA 5LASA 3MLLA 4B8EA 1XQNA 2BGCA 1C8M2 1LULA 1QJY3 2RR11 2X8KA 2VNGA 3SEPA 2QBXA 2YHJA 3SISA 4FP2A 2XMLA 4FAHA 2BERA 5IVEA 1ZZCA 1POV3 3CJXA 3WNLA 4LOSA 2QFEA 3N9QA 1GZWA 1N3QA 5HCBA 2ZGQA 4ARXA 4E9KA 2QVSB 3MUZ1 2CU5A 1OFNA 1NX9A 1RUF1 3B00A 3I2GA 4ASLA 5C3QA 4CDWA 1DGRN 4K7JA 3IPVB 4CCLA 4AVCA 3OUHA 2DVDA 1TEIA 4LOTA 1GP4A 4OFGA 1IG0A 2Y26A 4FI9A 3GBWA 3VD5A 5H9PA 3T1MA 4JKKA 3UKVA 1ZRDA 5A3OA 5AFBA 4A2UA 1NE4A 4YYOA 5L7OA 3NJXA 3DECA 2W0XA 2GMMA 1JZ5A 3AM2A 2WJSA 5T52A 4WM7A 1SQ4A 1I3HA 4PLNA 2H0BA 5DAPA 1AX0A 4DRRA 4FCAA 2NMNA 1RJ8A 3QCWA 4QQLA 3BN6A 4GKXA 1RJ7A 3ZN6A 1WBLA 2TUNA 4GD4A 4CP9B 3I59B 1AUYA 1EUTA 1UPSA 1HIXA 4IE0A 3U1XA 4K8FA 2MPFA 3MYXA 1ND2C 1BK0A 4XFAA 2DCYA 4UFIA 2J7MA 5DPNA 4YW1A 2GC0A 3I97A 4CTEA 2Y6FA 4LMFA 1ZBE2 2G9FA 3HNMA 3RDIA 1NLQA 4WVVA 1XB9A 4LIVA 5I93A 2JG8A 3AMQA 3N7KA 4G3YC 2DBIA 4ATFA 3AVRA 2DBNA 4RGKA 2J1TA 3VBUB 4CCNA 5F9TA 2YMZA 1WCDJ 3V56A 1X8MA 2VZSA 3C7HA 4C0HA 3AC0A 3P3PA 1VRH2 1W39A 1YQ2A 4E4SA 2QZ3A 1VP6A 2KXLA 5DUUA 4E4HA 4EJRA 1PGL2 2OQ7A 1ZNPA 1S4CA 4XQWA 1PZ9A 5KBFA 1UU5A 1F4HA 1AXKA 1QHDA 5CG8A 2DF7A 2QJVA 1DU3D 4Y33A 1WLCA 3H42B 4CUCA 1K42A 1DQ2A 2WO3A 3MF6A 4NIIA 3U07A 1RUJ2 1Q43A 1W8OA 2J1SA 2G9ZA 3VHRA 1WLWA 4P5HA 1OQEA 1A8DA 1TNRA 5BY5A 4IGQA 3B01A 5E89A 1ZZ8A 1GZCA 1AL0G 4DFSA 1ND3B 3OD4A 2WINB 4AEJA 1W8ZA 4Z2WA 2C6SA 1H8VA 4WM8A 4XDQA 5EZWA 1S2KA 1UYYA 4AG4A 1AX1A 3E5XA 2QZ2A 1IS4A 3W21A 2OUJA 5ACA1 1UW8A 3VDDA 3MW2A 5JOXA 5KHKA 4CDQC 3THTA 2WC2A 1TNFA 2XXZA 5LBBA 2A6VA 2D5HA 2ORXA 4Q4W3 4QPIC 1VAKA 5EYXA 4EN8B 2YDEA 4F7ZA 1GZWB 3OBAA 4AI0A 1W06A 1GV9A 4OUSA 3K2OA 5DG1A 3NAPC 3MGUA 5DZFA 1D4M2 1PZ8A 1JH5A 1HQNA 4IL7A 2BNMA 1COV3 3RZLA 4NHXA 1CQ9A 5JIUA 1RUG2 1VBA1 3I8TA 5L7OB 4FFHA 4AFMA 5F7UA 3VGIA 2ZJCA 4XQDA 2N7GA 2W1SA 1QJX1 1MQTC 5DG2A 5FZ6A 1ZZ6A 4WM7B 4AI1A 3AJYA 1YHFA 3WX5A 1OQ1A 5F2WA 4DEQA 5CFDB 5LCWL 1V70A 1XNKA 4PBOA 2RM23 3AX4A 1QJU3 5E1RA 3TRSB 3WUCA 3ZN6B 1N1SA 1NCQC 2GNTA 3LOBA 2RS13 2OVUA 1LHOA 1LEDA 1X8EA 1YC61 3DF0A 5F8PA 3ZYPA 5IHRA 2TEPA 2BGOA 3SCGA 3AMHA 4DXZA 1V9U2 4BA6A 1VR3A 1IPJA 2DWRA 2JG8B 5A3NA 4R9AA 5FZIA 1U5XA 1NXMA 2XONA 3NV3A 2XL9A 4FPFA 2DURA 4ZU4A 1ND2A 3AP9A 4IDZA 3BCWA 4LHLA 5FXVA 2GC1A 1PM7A 1EPZA 3I3EA 3LEIA 3LA7A 4MVTA 4YZ3A 1VPHA 4CDUC 4XUOA 3MV11 4QPGC 5FKBA 1N3PA 1C5IA 1VRBA 1HV1A 2P6HA 4LNVA 3TBDA 4CCMA 1W6QA 2BEOA 4DXSA 1OFSA 1RUC2 4L0PA 4A3XA 1SLCA 4YW4A 4OI0A 2WWJA 1JI6A 1S2EA 1HN0A 2VTXJ 2ZABA 5D8AC 4HT1T 5FZ3A 2BGPA 4JAAA 1WKYA 4EZHA 3VKLA 4CDXC 4COYA 5FJKA 1POQA 3RSJA 2ATFA 5C71A 5BNOC 3THPA 4MG2A 2HWC2 2VULA 2Y6JA 1GWLA 4XDOA 2NYYA 1VBE2 3OBTA 2WAAA 4G4FA 2KM2A 3NNFA 4FVVA 5FQ0A 4TSVA 4PQ9A 3S5QA 1K5JA 1PGW2 5CKQA 4MX3A 3H50A 4DXTA 4RQPC 4YFZA 2DTWA 3ZX7A 5HCAA 5GALA 1VBB3 5FZAA 2EIGA 3FE5A 4ITCA 4DMIA 3ETPA 1ALYA 1J58A 2GP5A 2ARAA 1YI7A 2NLRA 1MEC2 5IJRA 3N4MA 3N9NA 1ENXA 1SLLA 5AVPA 3KLSA 1F2NA 1Z0HA 4CDQA 1ULDA 4E2QA 1BKZA 2JX9A 4C1WA 1OA3A 3LSEA 5GLVA 1DLCA 1BMV1 5K0UA 2PTMA 4ASKA 4QPIA 1QXPA 2JKXA 3KCCA 3OYWA 3I2DA 4LBQB 5CVRA 5LBCA 2P6CA 1AL21 3WY6A 3WDXA 1UKGA 4FTBA 3NAPA 3KCYA 1PMJX 1QEXA 4HKLA 4FPGA 3AYAA 4Y4RA 3RYRA 1X82A 4Q4X2 4BHPA 4DNYA 2Q8DA 3MIGA 4R4ZA 1W05A 3AKSA 4AEKA 3KCXA 1W9FA 3INAA 5F6KA 1YIPA 1KRIA 3R4UA 2A6WA 1XYPA 1RUH1 3KHBA 5I8TA 1YJKA 1QU0A 5FZHA 1TMF1 3IIIA 2FDIA 2Y6GA 1F5JA 3UV9A 1VBD3 2DUQA 3VHOA 1AYN3 1R091 4Q2FA 2A6XA 3BU7A 5DUVA 1MQTA 3ZMNA 1OLRA 1QDOA 1GWKA 2FCTA 2WFF1 4Q4V1 2WN3A 3V0AA 2IVIB 3CZUA 1A8MA 1UZVA 3HBKA 1RVF2 3NVCA 5A3TA 1CWPA 1IS6A 1HX6A 2CSGA 4Q0VA 4LT5A 1PNFA 2JDYA 3BB6A 1NCQA 4QDSA 5DAXA 1GNYA 3E6CC 1REEA 1ND2B 5FZOA 4D6SA 4AL9A 1B35C 1ULCA 2WA4A 4YZ1A 3MW4A 2JDAA 2Y6KA 3AP6A 3PIJA 1W6NA 4YM1A 1BCXA 4RA0A 5FZDA 3USSA 2RS33 4KL1A 2W92A 5JCTA 5A3UA 2X5IC 1CPNA 3H8RA 1OKOA 1LRHA 1W6QB 1W2TA 3L2YA 5JI7A 4GB32 4N8MA 1OPOA 2ZGPA 3DL3A 2XLGA 4JQTA 3KV4A 1PVC2 1ZA7A 4J1XA 5AFEA 2ZTNA 1W9YA 2WNEA 1WW5A 1FPN1 4N53C 4GIQA 3LQCA 5GZGA 3T0DA 4CCCA 4ASMB 4GA9A 4LO7A 2BQPA 5GM0A 1H1IA 5D8AA 2JICA 5I0SA 3ILRA 3TN93 3QH6A 2JDPA 4BZ4A 5GLWA 5BNOA 2EXIA 5EJ1B 4JZRA 3UJOA 5AC92 3BTZA 3BGAA 1H2KA 1QOSA 2R7EB 3MFAA 1HV0A 1ZZBA 3FLRA 3OPZA 5GZEA 1YQ8A 3ZIWA 3MLKA 1LR5A 3FC0A 2D6LX 2WO1A 2XLAA 3MW3A 1UU6A 3H8UA 1UZZA 3SH5A 5SV8A 4HG6B 3LE0A 3ZMOA 1O8PA 4RQPA 4CDQB 4BQ3A 3LB9A 4XYXA 4W8JA 2GMEA 1ENRA 4QPIB 4XJWA 4ZZ5A 1CX4A 4BWOA 2RR13 4Y5SA 1UXXX 1GQGA 1TME2 2R042 3NV1A 3D6EA 2JB4A 1ENQA 2PXJA 4XXAA 4B7KA 2VVEA 3K77A 3K3NA 2FHRA 3WOGA 1PX4A 4OUEA 1WCUA 1MZEA 5FUIA 3HT2A 4AVSA 1I1EA 1LOAA 1UD1A 4AHWA 3URFA 1V6OA 4COVA 2VQUA 1W90A 3RVHA 3JBG3 5JXGA 3HQUA 3PUIA 5FXWA 3FUQA 2OA2A 4Z2AA 5CISA 3J4UH 4ISRA 2HWB1 1AX2A 3WNOA 1MQTB 2EA7A 1SBDA 1Q8PA 2GALA 4N7IA 5FZ9A 4QX7A 3V0AB 1CIYA 2VECA 4XF4A 1E5HA 2IWGB 3OB8A 4L11A 2R072 5A7SA 3UKNA 5KHJA 2BTVC 4EN9B 1G9DA 2PQQA 1NCQB 2VPVA 2G4IA 3BALA 2D7FA 4CUBA 3FL7A 2Y34A 1JU4A 1MZFA 4YGEA 1RUD2 3UETA 2Y60A 5KC6A 1HRI2 4WZCA 3NWKA 4BMEA 1W6NB 4H55A 1Y9MA 3R4DB 2XHKA 4MHUA 2XVGA 3JQWA 1OUXA 2VBPA 4MYEA 4RHV1 1M4WA 3LIGA 3LEKA 1B35A 3I2OA 1QKQA 3LA3A 2B4KA 1ULOA 1O4YA 2Z79A 3ALQA 3WDWA 3SLIA 1HXS1 4B4RA 2ZHMA 4CDUB 4A6SA 4QPGB 1PO21 4XJ8A 5EP9A 1VLNA 2X53S 3MHZA 3PURA 2X5IA 4M3CE 5FMCA 4CXYA 4Z92B 4E4DX 4CVUA 1VAMA 4JVAA 4GWJA 4QGNA 3ZYIB 5LY1A 4ZS3A 1UZWA 1W8UA 4UFMA 2IXJA 2QQKA 2I74A 3M3EA 1LTEA 2WDBA 4LULA 1GLHA 5D8AB 5JMOA 2CWSA 1UMHA 2A1XA 2Y0OA 3RWNA 1G8WA 5CFCC 4CDXB 1UIJA 5LEKA 2WLQA 4Y1UA 5FPAA 3L2HA 2JDUA 3LDKA 3POWA 4LXLA 3AMMA 3AZXA 1YJLA 1H8TC 3FLPA 4N53A 2VVFA 4XBLA 3NNMA 4MGZE 4LO6B 1SLTA 2YFUA 1FOD1 2Z42A 3VN4A 4B4QA 2RMU1 2LM3A 3SH3A 2I45A 3LDRA 5FP9A 4RQPB 1EAH1 2P34A 4FAGA 3AZWA 1UYZA 4NPMA 2QKDA 1AR71 2GU9A 5E8AA 2ZACA 3SEEA 3VHNA 3WP4A 3ZFEC 3NJZA 5ACA3 3O7OA 5FP7A 1HB3A 4JTNA 4I3PA 1RHI2 3O14A 2QE3A 1C8M1 2ZKNA 3NO8A 4AZZA 4IEWA 2RE9A 4M4RA 1U5IA 5B4NA 4CUGA 5ABJC 1Y3TA 1GKBA 4ONUA 1QJFA 2B9VA 3WNNA 4NPLA 5EQUA 2ZOEB 5DAVA 4YW6A 1F9KA 3KVBA 4RSUA 4XHXA 4BK5A 2VC9A 1AJOA 2DV9A 2W1QA 3IT8A 1YLLA 2HYKA 4YGCA 1J1LA 4FT8A 3AYDA 3PMSA 5IVFA 1GWMA 4LO8A 4K21A 5GZFA 5FZKA 3ZFGC 5LA0A 5D1IA 3HT1A 4XUPA 5A7QA 3WT3A 4QX5A 3ZM8A 1VBA3 3VZOA 1CD3G 3DYMA 4QM9A 3POEA 1IZ3A 4CXXA 2JG9A 2ZHNA 3Q8FA 1IPSA 1O3TA 2ES3A 3T4VA 1JYIA 4YLZA 1NXD1 4A7YA 3ZR6A 1DZTA 4Q26A 1IPKA 2G19A 1ASJ3 2XJTA 3F95A 4HFSA 4QX3A 4AFDA 1GQPA 1V6JA 3ZXKA 1S0CA 4AWDA 5LB6A 3LZZA 1R092 2ZGOA 1AJKA 3N3HA 3ZLIA 5JWPA 4A7ZA 5APAA 3KV9A 5HXVA 4RL7A 3W58A 1B35B 2O1QA 4WZFA 5F3CA 3Q9OA 2J1VA 5LA1A 2OT7A 3OD0A 1UF2C 1OHFA 4IEZA 3BYWA 4HOOA 3I2FA 4R52A 1ZBE1 3H1MA 2W91A 4WVZA 1W6PA 2X5IB 5JXIA 3J7MA 3VL9A 1W04A 3RMXA 1CZTA 3WG4A 2A6ZA 4AEDC 2WZR2 1US3A 1J59A 4XFCA 2VXJA 5D21A 5F5IA 3IN9A 5BNNC 4DY3A 3MICA 1XYOA 1E57A 3CQOA 4P02B 1WLDA 3FHIB 2K2SA 4CP1A 2OS2A 1C4RA 5T5PA 4AXOA 1T2XA 3TAYA 1Z7S3 5I91A 5IATA 1PGL1 3RS6A 1IGOA 3GDBA 4CU7A 3J8F2 4N53B 2VMFA 3UGFA 4QMAA 1CAXA 3M3IA 5ANQA 1O7FA 2FMDA 4HSJA 4QX0A 1RUJ1 4HSLA 4KH9A 5FTTC 5CFCA 4B1LA 4FPJA 4YM2A 5FY8A 3RI9A 3POIA 2F17A 4N9HA 4JX0A 1H8TA 4MGIE 2CGNA 1PZ7A 1S55A 1NLRA 3PU3A 1CZVA 4BQ2A 4MHRA
chains in the Genus database with same CATH topology
1WUVA 1PO13 2XJPA 4HL0A 3A0KA 1CONA 5T54A 4E2SA 1RUE2 1C28A 5DZGA 4YGBA 2WS93 4XF0A 1ND3C 2RS53 4I09A 1VB4A 3IKWA 3ZFEA 3S7EA 3ZDSA 1KJRA 1Q8SA 1DHKB 1RITA 3EO6A 4NWWA 4QQPA 5FPZA 3ZSEA 3JB8A 5ABJA 4PDWC 2CGPA 1AL23 3DPRA 1SBFA 4QXKA 1K5MC 4R9DA 1KS5A 3V0BA 2HEYF 4NO4A 1RUG1 2ZPXA 1DLLA 1X7NA 4A7KA 4LR4A 3ZFGA 5T55A 2WLPA 1RUH3 4B4PA 2DCTA 1HLCA 3VKOA 1RB8G 2A3YA 1AR82 1HRV2 4BM8A 2ZX1A 4XW3A 1KFUL 1Q8VA 1A6CA 2PHRA 1V6NA 4Q4V3 3IPVA 2HEWF 3LKJA 3E97A 2VOWA 1RC6A 1M06G 3ZXGA 1FMD3 2R062 3RYKA 2P37A 3BPZA 1V9U1 1GANA 4XFHA 5CFDC 2GN3A 4IEQA 1W6PB 4OZXA 1YFUA 4Y1VA 3ZYRA 4Q1PA 1QOOA 3D82A 3HIFA 2XWJB 1LOBA 2Q4SA 4LA3A 2YZ4A 5C8WA 2D3PA 3H3ZA 2WSVA 1LEMA 3O0XA 3VZKA 3QACA 1GR3A 1UX6A 1W6OB 2XBO1 4AEDA 2SBAA 1MZ6A 1XRUA 1CAXB 3FFQA 5E88A 3RZZA 5BNNA 1RUC1 1J3RA 1SDWA 1SEFA 5CFCB 1AR62 5I8SA 1FPN3 4OHWA 5C33A 3DUIA 4H14A 2VVDA 3D5OA 1DQ6A 3WW1A 4BH9A 4XMIA 1H8TB 1BVVA 1DBNA 2ZAHA 5FAXA 3K51A 5JOZA 1VBE1 2C1FA 2PHTA 3KT7A 2E9QA 2R0FA 3FX3A 4BPZA 3U11A 3H7JA 4Y26A 1R082 1LHNA 4JTOA 1EPWA 1PGW1 5FFOC 1KFXL 2VG9A 3ZFEB 4TZDA 3ACLA 4DOUA 3ZPYA 2YXSA 2VNOA 2QQPA 5DDJ2 1MEC1 5LRRA 3O0VA 1ND3A 5FO7B 1I9RA 1AYM3 3ASIA 3KQRA 4AW7A 3AYCA 2DTYA 2P2KA 2PHUA 4PIZA 1YI9A 3V0BB 2E7QA 4PDWA 4FOYA 5J98B 1RMU3 4XFFA 3R4SA 2HWF1 3ZFGB 4Q4X1 4AVVA 1LGBA 2YY1A 4X8PA 4ES9A 4DQAA 1K5MA 2ZGNA 3AK0A 4RGAA 5KWRA 1ULEA 1L3JA 2VOKA 3ZSJA 5T5JA 5IUQA 5CB7A 2DU1A 5HI0A 1WCKA 4LLFA 1XE7A 4LBLA 5FPXA 1O4TA 4QT6A 1RVF1 3A0NA 4UW6A 3KGZA 5AVAA 2BNNA 4O9EA 4R9CA 4ZXKA 5CFDA 5HCFA 1MACA 3B5LB 4U2AA 4AEDB 4AQ2A 4INDA 4I30A 2PLV2 5CADA 1HXS3 5BNNB 5J09A 2FZ2A 1PO23 1H0BA 2JKBA 2ARXA 4GB31 4JV4A 4XBNA 1PVC1 2BUKA 4BE3A 3AP4A 1S0FA 2RJKA 1CESA 1GZ9A 4FOQA 1GFF2 4YZ4A 1DIWA 5EFUA 4CEYC 5C6CA 2FQPA 1O4ZA 1QXJA 2JD4A 3R0RA 3U0ZA 3KSCA 1WLTA 5JOWA 3H0OA 4QQOA 2ZKLA 4KNCA 1F8VA 1FOD3 2XG3A 2ZGTA 1JN2P 1LJ7A 3OF1A 2XKPA 5AC91 1EAH3 1DGLA 3WZ1A 3VBHC 1AR73 1H2LA 2MEV3 1R1ZA 5T50A 4FTEA 3WQ0A 2BW8A 4XF3A 4IETA 4GULA 4AHZA 4GKYA 3D4KA 4CP0A 4S2DA 1LOFC 1TME1 4EN0A 2R041 4YG0A 4I02A 4WVMA 2E51A 4PDWB 1BVP1 3D0JA 4IV3C 4ZU5A 1WGPA 3ZYGA 4QHBA 5C9AC 3ZYJB 1GNHA 1NY71 2YROA 1REFA 1S0JA 1AVBA 1K5MB 1FV3A 1DGWX 2UYAA 1WD4A 4AE2A 1QQP2 4KU7A 2A70A 3S0MA 3E6BA 3JUUA 2EF6A 1JUHA 4YSFA 3KS7A 3DGTA 1CVNA 4LBQA 2HWE2 2V5YA 4KG8A 3SCHA 4HKOA 1BBT3 2R071 3BOPA 1IKQA 2ZMLA 2ZZQA 3HBZA 4FPEA 4OLLA 3D8CA 1H4HA 4LA2A 3AXDA 4J6GA 2D93A 1RUD1 1HRI1 3WV6A 3WLUA 1OI6A 1CAWA 5IK4A 1VIWB 2D40A 3NKGA 5FLJA 3D0SA 2P3JA 4YVSC 1ZBE3 4BYYA 2NN8A 2FZ1A 2D5FA 3QH7A 2PAMA 1X36A 4GMP3 1KITA 1MS3A 4F83A 1KDKA 2D43A 4MH0E 3NV2A 4FOVA 1VRH3 1G9FA 4PBPA 1CAUA 2XBO2 4URTA 1AYN2 2XJVA 1OLQA 3POSA 1RUJ3 4MXVA 3WHTA 2EAAA 1AR91 3FMGA 1EV11 4CEYA 5IK7A 5DXDA 3AMPA 4D7TA 4W65A 3TWIA 5LEJA 4XILA 4LO5B 4BLJA 3B9CA 4Y1YA 4CEWC 1NZCA 1RHI1 3JCIA 1PK6C 3VBHA 4FQ4A 4WVMB 5JIAA 2YV8A 2WFPA 2NP0A 3JD71 3V65A 2DVGA 5CG9A 2XH6A 3NSTA 3CO2A 1X50A 5BUVA 2BVBA 4XTMA 2XPJA 1LOFA 4PLOA 1POV0 1VJ2A 2CY6A 2PAEA 4PCRA 2BFUS 4L9BA 2UU8A 4IV3A 1D4M3 3PJYA 4XF1A 3QOPA 1CPMA 2CAUA 4DB5A 1JYCA 2P3KA 5C9AA 3LCPA 1BEV2 2Z2SB 4K9SA 1B09A 1RUI1 2XUMA 3ZXJA 3LSDA 4ZKTB 1J3PA 1RUG3 4EWDA 4M01A 4R8HA 1ZBA2 3AP5A 2E7TA 4LHKA 4JDMA 1ONAA 2HWF2 1O3SA 4JRLA 2VMHA 4H3WA 5I0TA 4W6YA 2R30A 2V09A 4N90A 3AZYA 1DQ5A 2C0ZA 4JDOA 4IXLA 2IZWA 4OI1A 2BYVE 3FWEA 1CAWB 4D69A 1VALA 2LUWA 4Q8LA 3VHPA 2B42B 1V9U3 1FT9A 4EN6B 1Q8OA 1H4GA 1RL3A 2DCJA 5SV5A 2E53A 2FMYA 4AI8A 1IQAA 3H7YA 2ZZJA 4YVSA 2WZR1 3IDBB 4XJAA 1SFNA 3JBG2 1CAUB 3LAGA 4IV1C 1S0GA 1C1FA 1RUC3 2HEVF 3J8F1 4DPNA 2VW1A 5FLIA 3KB5A 4WVWA 5LK5A 5F1RA 3MI8A 4CEYB 1DQ0A 3M7AA 4CDUA 2UWAA 2QCSB 4P9XA 4QPGA 3WG2A 4MUVA 2HWC3 3PTYA 2UY9A 3U4XA 1VBE3 3MPPG 1MS5A 2JDZA 2ERFA 3VBHB 4RGGA 1XE8A 1LU2A 4CDXA 4M0NA 2XJQA 1RUE1 3QBQA 2E7AA 2VUAA 2BVVA 3BOWA 1EYBA 4UXAA 2CNAA 1QNWA 5JPMB 3CJIC 1PK6A 1ZREA 2BFUL 4YZ2A 4IV3B 1U5YA 2WT0A 3GHNA 5C9AB 3LGRA 4COZA 1KJLA 1QH6A 2D44A 5KHHA 4HLTA 4Q0SA 2W52A 4XOGA 1O5UA 2BBVA 1R1A2 1G9BA 2UURA 2GNDA 3APBA 1NY72 3WR0A 1RUNA 4HN1A 4XFGA 1QJZA 2Q1ZB 1RUF3 3RYPA 2Z5WA 2VW0A 1AR81 1HRV1 1ZA4A 3K48A 3WDVA 3W9AA 4V1PA 2WKKA 2IXCA 1ULGA 2D6NA 2XWBB 4S2HA 2DCKA 2EXHA 2R061 4Y1XA 3UL2A 3IIAA 1UL9A 1LECA 2GNMA 1JOJA 4H7MA 3WP5A 3R6SA 5E16A 1OSGA 2V73A 3PVBB 4HK8A 4YVSB 3ILNA 4S2FA 4XF9A 1DQ4A 3N7MA 1UKRA 2CAVA 1HQLA 1DGWA 2NQYA 2HWD2 4YRDA 2O8OA 4KG0A 4M3CA 4UW4A 4PF5A 1C8NA 5TSWA 4GB33 3UJQA 1KDMA 4M00A 4Y5Z0 1PVC3 5HBAA 2TBVA 4IV1A 1AR61 3WQ7A 4LUMA 4E27A 3CU7A 2ZGUA 1VBC2 4Y20A 1YFXA 2ZGLA 1NQDA 4YW5A 4KQ7A 2AH2A 1R081 1TE1B 1QF3A 1AF9A 1QXRA 1PGSA 3WW4A 1U0AA 3G7DA 3G6JB 4UW5A 1O5LA 5JLVA 1AR92 5KXBA 1EV12 4CEWB 1PK6B 3O5SA 4Q0UA 5DDJ1 5JDBA 4N7UA 3O0WA 2WQ4A 4I3GA 4CYDA 1TME3 2R043 5BV6A 2VY0A 4NVPA 3CJIA 3HQXA 4L8QA 4FPCA 4FO9A 4RFT0 4HVRA 3JD72 2ARBA 1Z7S2 1FAYA 4KBBA 5EYYA 1KXGA 1ZYBA 3WDUA 4OUMA 4Q4Y2 1YO8A 3VKMA 4H7LA 2PHFA 2DVBA 3NV4A 1DFQA 3PHMA 4X8NA 2DCZA 1G6NA 5I0UA 1KS4A 1RUI2 4OHZA 3ELNA 2R073 4P9GA 3E6DA 5B2GB 1QJX3 1YYNA 2XJRA 3ZO0B 4WBBA 5GLUA 2QDNA 1ZRFA 2GH2A 1H30A 1RUD3 2XB6C 3KMHA 4HETA 3VZMA 1HRI3 4XFIA 4Q4W1 2VUJA 1CIWA 4D3WA 1S0DA 2JE9A 1V6MA 2ILMA 3LOIA 4RR3B 4LE4A 4AGRA 2IXHA 4M3CB 2GC3A 5FOJB 2GNBA 1LB2A 4XETA 2ZA9A 2ZX0A 3VL8A 3S30A 3MIDA 2VNRA 2R32A 4JRAA 2PLV1 4YW3A 2XVLA 2DYCA 1WA4A 2QDRA 1ZVFA 3AP7A 4IV1B 2PHLA 4AQTA 1CAVA 4C90A 4MLOA 1SLAA 4XJUA 2I07B 5A3LA 4Y20B 1S0EA 2F4PA 2ZAAA 4UW3A 1WW4A 2BWCA 2EVXA 2PA7A 4F3JA 4AGGA 1JXNA 2VMGA 4Z82A 2JECA 4E2GA 1NA1B 3EJKA 1W6OA 2R49A 1Z78A 2VW2A 1QGLA 2GDFA 5FMOS 2UWCA 3M3CA 2ZHLA 4LHNA 4NHMA 1WW7A 3GF6A 1SMVA 2RHPA 4XMAA 1IOAA 3TNPB 3B02A 1LHUA 3VBRC 4P9WA 4YM0A 5CNAA 4Z07A 1RHI3 5BPXA 4KGGA 5C4WC 3CJIB 1BK1A 2WL1A 5J7MA 2D3RA 4GALA 5JR7B 1REDA 2OPKA 2RJLA 1QOTA 3RPQA 1V6LA 3VBOC 2Q8OA 1Q3EA 1U5ZA 2JEMA 2XGXA 1F31A 2E6VA 1OA2A 5F6LB 4HK9A 1QQP1 5JI9A 4NWVA 3HR9A 1LKNA 1PIV2 3N35A 1RINA 2DUPA 2QUOA 3WVJA 2HWE1 4AYUA 4DY5A 2F6BA 3GBGA 4YNIA 5DZEA 2DUOA 1VBB1 2ZGMA 3E5QA 1TMF3 2XL7A 4YVWC 4GWMA 4FPHA 4IEOA 3VKFC 1R093 1URXA 1OOPC 1WMEA 4P9YA 3AKQA 2WFF3 3I7DA 1A78A 5K9YA 3FFZA 3AFKA 1FI2A 4AFBA 1SBEA 1QJY2 2IC1A 4XFBA 4AHYA 5FBZA 3RRDA 1CAVB 2WZR3 2A71A 2GC2A 3ENRA 1DZRA 3KGLA 1LCLA 5KHIA 3AJZA 1EP0A 2OIIA 3BODA 2K9ZA 1ZX5A 3FJSA 3J8F3 1FNYA 2IFWA 2VMIA 2VGDA 1VBD1 1AYN1 2K0GA 1IS5A 1DG6A 5FMOL 3WP3A 4YW2A 2VQAA 5I0RA 5GLZA 1UIKA 4LEJA 3WINE 4W6XA 4ORFA 3N7LA 1MS1A 3PMEA 4LO4B 4P9IA 2BNOA 2PFWA 3ME2A 3NKTA 1RIRA 3WDTA 3SHRA 1GBGA 1H9WA 4I2OA 3N36A 1MVEA 2JENA 4UBHA 1HW5A 4QPYA 3ST7A 3EHKA 1RUE3 1FX5A 3AYEA 1S1AA 1D2QA 4FPYA 5L73A 2RS31 2MNGA 3VBRA 4XHBA 2ZGSA 1SLIA 3MIFA 3FBYA 2GSYA 5H9SA 5C4WA 3OBRA 4FTSA 3S7IA 3I4IA 2WIIB 2HKXA 4LBOA 1LENA 1XNBA 1MVQA 1BEV1 2YUEA 3NL1A 4COUA 4D7SA 4UBGA 4DZGA 5FDBA 3WW3A 4N43B 3H9AA 4ES8A 1MS4A 3TN91 1ZBA1 1C5HA 2PHXA 2WNVC 1KD7A 1AR83 1DGRA 5C8CC 3HAGA 5F5QA 1QDCA 3KZ4C 1G9AA 3IM0A 4DRVA 3VDDC 3BIWE 2HWB3 2XKOA 2W39A 2AZ5A 2DVAA 5EWSA 1W6MB 3MIBA 1IS3A 2R063 3LWCA 4NN0A 4YVWA 4AGVA 1H1MA 1OOPA 4AVBA 1ZM1A 2W68A 5DUWA 4O9GA 1G9CA 4Q4W2 4U36A 5JZGC 3OY8A 3HD8B 3JBG1 4RHV3 5JMCA 4QGLA 4L99A 4QM8A 3M3OA 1LGCA 3V64A 3ZN4A 1BQPA 5BNPC 2WZPP 4HMZA 1APNA 1QMJA 3EQEA 3C3VA 4TWTA 1COV2 4I0WB 1GICA 4NPRA 1AR63 4Y22A 5CU1A 5JOYA 1BZWA 3H1WA 1BBT2 1HQWA 2WQZC 4Q8KA 5FCCA 3M2MA 4YG6A 3L9JT 2CYFA 4PIYA 4EWEA 3AB0A 5IK5A 5J96B 2B8MA 2D6KA 4XEZA 5FRAA 1C3HA 1FYUA 2EXKA 3SNMA 3KD4A 1D0HA 5BNQA 4B7EA 1R083 1V6KA 4ISQA 3HMYA 2RM22 1QJU2 4L2NA 1LU1A 2RS12 3VBRB 5KHGA 1DF0A 2RMU3 1J1TA 2D6OX 2ZX2A 3GZTB 5C4WB 2Q5TA 5IK8A 5DDJ3 3BTAA 1PHMA 1C57A 3SH4A 5GZCA 1S2BA 3H3UA 3WDYA 5KXDA 1I5ZA 1ULFA 3ZVXA 3VBOB 1C8M3 2AR6A 1CJPA 3OJBA 4SLIA 1Y7BA 3JZVA 4Y24A 4YG3A 4B29A 1AHSA 2BWAA 4C0BA 5J37A 1R1A1 4OI4A 4YM3A 1N47A 1ZZ9A 2VOVA 1NOVA 2PHDA 1Y43B 2A5ZA 2AYHA 1A3KA 1MR5A 4FPLA 4PLMA 1ZZ7A 1XXNA 2ZX4A 3A4UA 3ES4A 1N1VA 3AMNA 1CN1A 3U10A 2WNVA 1YNAA 1N3OA 4Q29A 5C8CA 3GALA 1C1LA 2FBEA 2B45X 4YVWB 4EN7B 1JHNA 2ZX3A 1OOPB 3AXEA 4C91A 3WUDA 5K0UC 1VBB2 2D3SA 5JAXA 2ET7A 3SITA 4M0HA 4Y1ZA 3VV1A 2YYOA 1LHVA 5H9RA 5K8SA 5GZDA 3IDEA 3OY8B 5CAZA 1JW6A 4CDWB 1O3RA 2B9UA 4JGZC 4KWJA 2CTVA 2HWD1 5A32A 3WNXA 2PLV3 4LTAA 3WW2A 1HDKA 2D6PA 5JZGA 4Y22B 4IEYA 1HKDA 1NE6A 2Y38A 4XJZA 4F8AA 4IQPA 4AVTA 4D94A 2ZHKA 5BNPA 1CGPA 3H1YA 2AGSA 4FXGB 1N1TA 1D4VB 3ROUA 3WG1A 1VBC1 1ASJ1 3AKRA 4WV8A 2VH9A 4IEXA 4HPKA 1NYWA 3WG3A 2QNKA 3AFGA 1VBD2 4GWNA 4HBNA 3RI8A 2ENRA 1O3QA 3ECQA 4ATEA 3KT1A 4HKWA 1NQJA 4BQ1A 3AZVA 2UYBA 2GMPA 2NM1A 3VBSC 2CL2A 5BXXA 1UN1A 2O8QA 2VXRA 3VZLA 4I0BA 1W0PA 3FZ3A 3IMNA 1YIFA 3HWJA 3DKWA 4IERA 4XXPA 3PNAA 3WCSA 2IXIA 1EY2A 2RS32 5LK7B 1SCSA 5FLHA 1LHWA 1NG0A 1Z7S1 3W59A 1JBCA 2WT1A 4Q27A 3TB0A 4SBVA 4Q4Y1 1QQP3 3IWZA 3DV8A 2G9GA 4RD7A 3RMYA 2ZMKA 1SACA 2WNVB 4WM8B 5C8CB 2HWE3 1ENSA 3M4FA 3ZFFC 3VDDB 4MV2A 1PO11 3TN92 2E63A 4EV0A 3GZUC 1BXHA 2AENA 4E4ZA 3RJRA 4AQSA 2ZCWA 1MS8A 1YFYA 2WS91 4FSJA 3OCPA 3N7JA 2RS51 5FO8B 2B39A 4PIXA 3FUOA 4HN0A 1G86A 2IFRA 4MXWA 2WWSA 5A32B 4K1ZA 3AZZA 3VBFC 4JCKA 2WSUA 5GLTA 2RR12 3M70A 2X29A 1OA4A 5JZGB 4JGZA 4RR3C 4BIOA 5DUXA 1DDLA 5BNPB 5JSPA 4MGKE 4AHXA 4TLFA 3TYJA 1Y9QA 3PVOA 1RUF2 3ZXLA 4META 4K6BA 4NOTA 2ET1A 3AKTA 4NHLA 1UMZA 1NCRC 4OVEA 2NMOA 1Q8QA 2XBO3 4HPKB 4FXKB 1AXZA 2YGMA 5JSOA 3I54A 4Y4YA 2GZWA 2ZGRA 2Y0IA 3NW4A 4P9JA 4DS0A 4L97A 3SXWA 1YFWA 4BOWA 3MIEA 4TYSA 1FMD1 3B93A 1GNZA 5T3NA 1N1YA 4Q0PA 2P3IA 1XYNA 1XNDA 2BPA2 1NA1C 1F5FA 5LRSA 1V00A 4L92A 4JQRA 2C5DA 3B3QE 1QH7A 3ZN5A 3VBSA 3X29B 4BLIA 5CBLA 3WCRA 4HANA 5EXOA 4Q1RA 3CL1A 4XIOA 4XQ4A 4GH4C 4LUKA 1MEC3 2Z69A 2WT2A 4CEWA 1FNZA 3IBMA 2A75A 4JGYC 2WNUC 4AVAA 1BEV3 2A6YA 4P9LA 5FQ0B 1PIV1 2C9AA 4YZ5A 1T6GC 1ZBA3 4J1WA 5EV7A 2HWF3 4Q4X3 4KU8A 1I6XA 2R1DA 1OKQA 4RS5C 4CRQA 1LOCA 1Q56A 3ZFFA 4R4XA 5J3UA 4MXWB 3ZXFA 3USUA 5K0UB 1W0OA 2JXAA 3OYWB 5ACA2 1RVF3 1AYM1 3UKTA 3NAPB 1FATA 2R6QA 4GQ7A 1VB2A 4OHYA 1QJY1 4JGZB 3RJ2X 4NHKA 1RUOA 4FOWA 1U12A 4OHVA 3VBFA 4GMP0 1W2UA 3EBRA 2GH8A 4P14A 1RMU1 1POV1 2XJUA 4B3NA 5A3MA 3MFCA 3VZJA 4AK3A 4YGDA 2JG9C 3GZAA 2PN5A 4RR3A 1PVXA 1ZRRA 2A7AA 2UWBA 3VZNA 4LLOA 4W6WA 1JUIA 4X6QB 5IT6A 1VBA2 1H2MA 1NCRA 3T1LA 1IHMA 5GJ6A 1LGNA 1XU2A 1GYKA 3J9SA 1DZQA 3C2UA 1QJX2 3MIHA 4OHXA 3ZIXA 1AZDA 4AI2A 4DINB 3SCFA 1BJQA 3CNAA 3HN1A 1J3QA 1ASJ2 2DU0A 3CEWA 3P3NA 4XJ9A 1MZ5A 3VBSB 4BMBA 5A33A 1MS0A 1D2SA 1GSLA 2ZS6B 2WA3A 1NA1A 5AC93