1NCQA

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 45
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqA00
1NCQC 1RUC1 1VBE2 5A33A 1ND2B 1TME3 2RM23 3DPRA 2MEV3 3ZFEC 5DDJ1 1PVC1 1OPOA 1OHFA 1NA1C 4AEDA 1EV12 3VBHC 1R1A3 5ABJC 1RUI2 4CEWA 1AR72 1POV0 2HWE3 5BNPA 5CFDC 1QJX2 2GH8A 4RFT0 2VQ0A 5D8AA 4JGZA 1VBA3 2TBVA 1BBT1 1CD3G 2RS51 1BBT3 2WS92 3M8LA 4Q4Y1 1AYN1 5ACA3 3JBG2 4IV3A 5J98B 4Q4Y3 5JZGC 3VBOA 2RMU1 1HRI3 1VBE1 2Y26A 4Q4X1 1VBE3 4NWVA 2X5IC 1OOPC 1EV11 2R072 1NA1A 5C9AC 4QPGC 1EV13 1RUI1 3VBHA 5BNOB 3VBRB 1RUI3 2BFUL 1AR73 1NY72 2WZR2 1QJX1 3FBMA 4WM8B 1QQP2 4GH4A 1R082 5C8CB 4CEYB 2WS91 2WS93 3JBG1 2R042 3JBG3 5JZGA 1NG0A 2IZWA 1ZBE2 1PIV2 3ZFGC 1RUJ2 5AC91 5BNNC 1D4M2 1TMF3 4WM7B 4Y5Z0 2X5IA 2WFF1 1OOPA 2R073 1VB4A 5C9AA 1EAH2 4QPGA 3NAPC 4N53C 2R062 1NY71 4PDWB 4CDUB 1ND3B 4AEDC 1VBD2 2WZR3 5K0UB 1QQP1 1HRV1 1V9U1 4Z92B 1H8TB 5C4WC 1QQP3 1R081 4JGYB 1PGW2 1R083 4RR3B 4NWWA 2HWC1 4GB31 2HWF2 2R041 5CFCC 1ASJ2 4CDWC 4LLFA 5D8AC 2WLPA 3VDDB 1VBA2 1ZBE1 1PIV1 1RUJ1 1AR82 1ZBE3 1PIV3 5A32A 3ZFGA 1RUJ3 1RUD2 5BNNA 1D4M1 1MEC2 1POV1 2HWB1 1E57A 2BFUS 1D4M3 1Z7S2 1POV3 1ND2C 3VBSB 1TME1 2RM21 4N43B 2MEV1 1EAH3 1B35B 2R061 3JD72 3NAPA 4N53A 2R063 4YVSB 3CJIB 1VBD1 2RS13 1R1A1 1VBD3 4RQPA 5C4WA 2XBO2 5FOJB 2HWE1 1RHI2 4IV1B 2HWF1 1ASJ1 2HWF3 5CFCA 4CDWA 1ASJ3 1VBA1 1NCQB 4GH4C 3LOBA 1AR81 3ZFEB 5L7OB 1RUD1 1AR83 5ACA1 1BEV2 1MEC1 2PLV2 1RUD3 1RUG3 4Y4YA 1MEC3 1HRI1 4YVWB 1Z7S3 5ABJB 5J96B 1ND2A 1FPN2 3VBUB 1BMV2 1AYM2 1F2NA 3JD73 5CFDB 1AL22 1AUYA 1TMF2 1X36A 1FMD2 5BNOC 4RS5B 1DDLA 1R092 1AR71 2XBO3 1RHI3 2RR12 4WM8C 4CDQB 4QPIB 5C8CC 3ZFFB 1HQNA 4GMP1 5L7OA 1BEV1 4GMP3 1F8VA 1W39A 2PLV1 1BEV3 2PLV3 1MQTB 1RMU2 3ZXAC 1BMV1 2ZAHA 1FPN3 5GKAC 4BCUA 1AYM3 4WM7C 1AL21 1TMF1 1NCRB 3HAGA 1C8M2 1QJU3 1AL23 1ZBA2 2R071 1HX6A 1FMD3 2XPJA 5BNOA 3VBRA 4PDWC 1R093 2BBVA 4CDUC 1ND3C 1HXS2 2RR11 5K0UC 2RS12 2WZR1 3JB8A 2RR13 4WM8A 1K5MB 1H8TC 4RQPC 1WCDJ 3VBFB 4JGYC 4RR3C 4CEYA 5C8CA 4CDXB 4Q4W2 1PO23 1RUE2 4FSJA 1RMU3 5A33B 1VB2A 3DPRB 3J8F2 3JB4C 5DDJ2 1PVC2 1RUG2 4WM7A 4AEDB 1ZBA1 1C8M3 3VBSC 1ZBA3 1EAH1 1VBB2 3S6PA 2FZ2A 1B35C 4CEWB 1VAKA 1M06G 4YVSC 1X33A 1HXS1 3CJIC 4PDWA 5BNPB 4RHV2 4CDUA 1ND3A 2RS11 1HXS3 1SMVA 5K0UA 1RVF2 5D8AB 4JGZB 3VBFA 1AR92 1H8TA 2RS52 3IDEA 1QJY3 4IV1C 4JGYA 1PGW1 4RR3A 1GFF2 1AYN2 1FOD2 1PO13 2GSYA 2HWD2 1AR62 4IV3B 1RUF2 4Q4W3 2RMU2 3VBOB 3VDDA 1RUE3 4Q4X2 4FTSA 1RUH2 1RUC3 3J8F1 1CJDA 5L7OC 3J8F3 5DDJ3 1PVC3 1RUG1 4YVWC 1NA1B 2RS32 1Z7S1 3VBUC 3VBSA 1VBB1 4N43A 3VBHB 1VRH2 1VBB3 1B35A 3TN92 3JD71 4RHV1 1IHMA 4YVSA 2DF7A 3CJIA 1QJU2 4RHV3 2BPA2 1RVF1 4RS5C 1RB8G 1AR91 2QQPA 1RVF3 4GH4B 4SBVA 3VBRC 1AR93 2RS53 2FZ1A 2XBO1 1RHI1 4IV1A 1FOD1 2HWD1 1AR61 4FTBA 1AYN3 4CDQC 1FOD3 1RUF1 2HWD3 1AR63 5JZGB 1NOVA 4QPIC 1RUF3 3ZFFC 2RMU3 1NCQA 1RUH1 5FMOL 4Q4X3 5AC92 4CEYC 1RUH3 3ZFEA 4EJRA 1MQTC 1PO22 2WFF2 2X5IB 1VBC2 2RS31 1AL0G 1OOPB 4YVWA 2RS33 5C9AB 5ABJA 4QPGB 3VBUA 1VRH1 1FPN1 2ZTNA 3TN91 1AYM1 1NCRC 1VRH3 3TN93 5CFDA 1QJU1 5LK7B 1QJX3 1QJZA 1HRV2 1V9U2 1FMD1 4RS5A 2BUKA 1R091 2HWC2 4GB32 1C8NA 1K5MC 1COV2 4CDQA 4Q4V2 2WWSA 3VBFC 4QPIA 3ZFFA 4FTEA 1QJY2 5A32B 3ZFGB 5AC93 4CDXC 1PO12 5BNNB 1PGL2 1PO21 2HWB2 1VBC1 1MQTA 4GMP0 2WFF3 3VDDC 1VBC3 1TME2 2RM22 1RMU1 2MEV2 3DPRC 1RUC2 3NAPB 4N53B 1NCRA 1C8M1 1R1A2 4RQPB 4N43C 1HRV3 4CEWC 1V9U3 5C4WB 2HWE2 5BNPC 5FMOS 2HWC3 4GB33 1COV1 2R043 1A6CA 4Q4V1 1K5MA 4JGZC 5CFCB 4CDWB 1COV3 4Q4V3 1BBT2 1QJY1 5ACA2 2ZZQA 1PO11 1PGL1 4IV3C 4Q4Y2 4CDXA 3VBOC 4Q4W1 1HRI2 2HWB3 1RUE1
chains in the Genus database with same CATH superfamily
1RUC1 1SG3A 4GULA 4ARYA 4F83A 5FYSA 5T5PA 1Q8SA 2EICA 2ZGSA 1OBNA 3FHAA 3ILRA 3JXSA 3SCHA 5IAXA 3C7GA 4HVOA 3LFIA 4ZPIA 1LHUA 2HEYF 3A0KA 3T1LA 3AP7A 2ZGRA 3GJAA 3VBHC 3ZO0B 5BY5A 1ALYA 2VZUA 1WCQA 4FVVA 2LROA 4NPMA 5FUNA 5FZDA 3U75A 2D6NA 5E1RA 5FYHA 4UBHA 3V0BA 3HWJA 1EUUA 4R9CA 2WZ8A 4QX8A 4UBGA 5DAXA 3WF0A 5JMOA 2KR2A 4IE4A 3AMHA 1CN1A 1WA6X 2ZA9A 4OCTA 1NQDA 5FP4A 4JGZA 5C5UA 2GALA 2TBVA 1CD3G 2RS51 1BCXA 1VR3A 1Y7BA 3L2YA 4MXVA 3VKOA 4BE3A 1H6XA 2JDYA 1BBT3 3H8UA 4CYDA 4FPLA 1O3QA 1WLTA 5FDBA 3D5OA 1U5ZA 4IV3A 2HYKA 3VHNA 2ZHLA 3NV1A 4JHZA 4KBZA 2XGXA 4OYUA 4Q0UA 4Q4X1 2VVEA 4XFAA 2HKXA 3POGA 5A3UA 2JX9A 4FI9A 5FZCA 2ZPXA 2Z5WA 1NA1A 2AYHA 2V72A 3ORJA 4LUKA 4E2SA 3VKMA 1PK6A 3WNMA 5BNOB 1BK1A 1D4VB 2XONA 3VBRB 2BFUL 2WC2A 4MH0E 3O1VA 1KFXL 2EXHA 4HSLA 5BV6A 5EP9A 2W1SA 1J58A 4MO3M 2V5DA 2OUJA 5FYZA 1LESA 1PVXA 4CUBA 3FBMA 4QWNA 3M4FA 4XJWA 3RWKX 3TBDA 1QEXA 1UY3A 1OURA 4XHBA 1LOFC 3ZYRA 3A22A 3RJRA 1G9DA 3E5UA 4OI2A 1YQ6A 5T5LA 2YBKA 4LBOA 5ANNA 3LDRA 1K45A 3ST7A 2WS93 3ZYHA 1OC1A 1ZVFA 2X29A 3PURA 3I2KA 4X8PA 2ZOEB 5SV8A 4DEQA 4GKYA 5DMYA 5GZEA 1PM4A 3ME2A 4LO8A 5A7PA 2QQKA 4W6XA 1PIV2 2CGPA 5JR7B 4PBPA 5AC91 1ULGA 2IWGB 2Z69A 4FPYA 2VNOA 4I0AA 4IUGA 4OZXA 5CG8A 2EVXA 2BZDA 3NRUA 1TMF3 4MADA 4Y1YA 5F3IA 3ZXJA 4C91A 3PU3A 5LEKA 3VHOA 1ZX5A 1OOPA 2A5ZA 2WT2A 1V6IA 1GANA 2UY9A 4XZPA 3ZKYA 5G04L 5IJRA 3NAPC 1H2KA 3WW1A 4XZUG 3NQHA 4A6OA 4TWTA 5JLVA 4LHLA 1AHSA 3OGGA 3WW2A 1NKGA 1VBD2 2IVIB 1L3JA 1WW4A 2EIBA 2JG9B 2WZR3 3IKWA 1DHKB 3IT8A 4LO7A 4P5YA 2WQ8A 1V9U1 5F8PA 3TNPB 3WEZA 5C3SA 5C4WC 1QQP3 1GZWA 1Q5OA 2IXLA 2IXHA 3N7JA 5JR2A 1JU3A 2R30A 1R083 3I2DA 5TSWA 2HWC1 1PM7A 2DBIA 1K3IA 1W2TA 5FKBA 5FZ7A 4IEOA 1LU1A 4BZ4A 4TZDA 2JKBA 3VDDB 1WCUA 5IWFA 1VBA2 3LDBA 5KHJA 2HLEA 1PIV1 3N35A 4S2GA 1L7RA 3J4UH 5E6HA 1ZBE3 5FZIA 1JYNA 3KT1A 3P5BA 3ZFGA 4ES8A 1RUD2 1CAXB 4Z1VA 1MEC2 2JDKA 1MVEA 2AACA 1E57A 4BK4A 1DGRA 3RNSA 3WINE 1OQDA 4Q1PA 4XOGA 3J7MA 3B93A 3PHMA 3GJBA 1Y3TA 2RM21 4N43B 1W2NA 3NJXA 3MFAA 3DYPA 4WVWA 4COYA 1D2SA 3OJBA 1G9FA 1WWYA 4N53A 4PLOA 5GZDA 4YVSB 3MW2A 3JUUA 3CJIB 3MFCA 2KM2A 1VBD1 1UW8A 3RVHA 4J6GA 3BN6A 4RQPA 4UFMA 1PK6C 3DKQA 1W9SA 5FBJA 4Y22B 3ACLA 3W5MA 1LENA 1RHI2 3H9AA 3NV3A 1YRZA 3VB9A 5LW9A 2BJSA 4PIYA 4S2HA 5FR3A 1UZYA 1OD3A 1IS3A 2HWF3 3MEPA 4QQOA 1YQ8A 5CFCA 2W9XA 1VBA1 2WNVA 1JOPA 1T6BX 5FYIA 2WINB 5HXVA 5EYXA 5IAVA 3PUIA 3HNYM 1RUD1 4AVCA 1AVBA 4META 4MV2A 5JOXA 4RGGA 1U5IA 1MEC1 3R4SA 5JPNB 5CKQA 2GC3A 1OI6A 1T2XA 3KV4A 1BJQA 4Q8KA 1MS1A 2D93A 1HRI1 4AVVA 1N3PA 4HN1A 2JIJA 1FPN2 3NNMA 1YXWA 4HLTA 3V64A 3VBUB 1TQ5A 5T52A 1C57A 4HKOA 1W6MB 3TEYA 4LIVA 5I0SA 2YROA 4WVMA 2Y60A 5FKCA 2VC9A 4FPOB 5LA9A 3Q8FA 4OLLA 1QWRA 1FNYA 1RJ8A 2A6YA 2CGOA 5CISA 2DFBA 3BKZA 2CSGA 2JEMA 4QB6A 4AVTA 4A2UA 3IM0A 5JXJA 1YWKA 3GYDA 2GNDA 3OPTA 2C6SA 4IEYA 2WAAA 2RR12 4QPWA 5FY9A 2WYSA 3B69A 1I1EA 3GHMA 1ZNPA 4CDQB 5ANQA 3V65A 4HVRA 3T0AA 1X82A 2G19A 2WT1A 4EZ4A 4QPIB 3WLUA 5C8CC 3T3YA 1BVVA 5FYCA 5G05L 1QDOA 2ZABA 4A7ZA 1F8VA 1W39A 2W08A 2VW0A 3LCPA 3KMHA 3MV11 4IEVA 5T54A 3ZYFA 5GZCA 5LWBA 1UYXA 3SNMA 4ZZ8A 2PLV3 2QQVA 4M01A 4QX1A 4XW3A 1W2AX 2OIIA 4N9HA 4N90A 3WQ1A 4ZU5A 2KD7A 1C5IA 4XF1A 3MDPA 3AKSA 3O14A 4NPRA 1XE0A 5GKAC 1ENRA 1HJFA 2D3SA 4BQ5A 1NCRB 2DCTA 4YFZA 1QJU3 2O8QA 1H0BA 4DQAA 2R071 3IDCB 3U11A 2BRTA 5KHHA 5HV0A 1HX6A 2YFZA 4XE9A 3AFKA 1CJPA 1FMD3 5A6ZA 5GLUA 1UXZA 1NLQA 2GP3A 4NAMA 4CPBA 2JD4A 3K2OA 5FZLA 4YM2A 2WABA 3J7NA 4UFLA 1GOHA 4M3CB 1HXS2 1NE4A 2RR11 4I3PA 4X8NA 1YFUA 2RS12 4QKFA 5FP9A 1LOBA 3JB8A 3ZXLA 1KDMA 4BXFA 1UX6A 2Q8CA 1BVP1 1EY2A 4IETA 3VZNA 4AFBA 4RQPC 1JTZX 3WUDA 1WW6A 4TXWA 1OVSA 2O1QA 4JGYC 4EN0A 5F9TA 5FYMA 2UY8A 4J1WA 5I0DA 5ISLA 5CU1A 1SACA 2A71A 3DUIA 3U37A 1ZRFA 4LBQB 3DECA 2XQXA 3E5QA 3N7KA 5FZMA 4LBLA 4XDOA 4QB1A 5FYTA 3GNEA 2E33A 1DF0A 4I01A 2X10A 3S30A 2VUJA 1WLDA 4N7IA 3RMYA 3WG1A 5IFTA 2AH2A 1JZ3A 4DXZA 2A3XA 5L73A 4NVPA 1UYYA 1DYKA 4P08A 4A45A 1E5IA 1QKQA 4Y20A 2CHHA 4WM7A 3BVCA 3ETPA 3W59A 5A6XA 3AMPA 1C8M3 1CZSA 3VBSC 5KXBA 2GNBA 1ZBA3 5F5IA 5C3PA 1VBB2 4JDOA 1RUOA 1B35C 3HJRA 3DCQA 3IIAA 4Y1ZA 3V0BB 1HXS1 2EALA 4PDWA 2Z42A 4RHV2 3I3BA 4B4PA 4F8AA 5H9QA 2RS11 4WBBA 2A73B 1SMVA 3HN1A 2ZGNA 3VZJA 5SV5A 1LAJA 4GJZA 3S5AA 1LULA 2DVAA 2E32A 5HBAA 4CU8A 4MHRA 3OEAA 4JGZB 4XIOA 3ES1A 5LCWL 4LJHA 5FUIA 4JX0A 5IK8A 4BIFA 4QX5A 3UYJA 2CAVA 1PGW1 1GFF2 1AYN2 2PELA 1YLLA 1SLAA 2ZKNA 3PNAA 4CCEA 1Y4WA 3B5LB 3DL3A 3BPZA 4IV3B 2VNGA 4TSVA 1OT5A 2Y0OA 3IB3A 3G7DA 2VULA 2WLQA 2J1SA 1J3QA 5JVVA 3RI8A 1RUH2 1CJDA 1AXZA 4OHWA 4E4HA 2PHTA 1WKYA 5DDJ3 2P3YA 2VZQA 1BXHA 4OHZA 3WP5A 4XILA 1KJLA 2D3RA 1NA1B 4M3CF 1W06A 5GJ6A 1Z7S1 2EA7A 3A21A 4AHWA 1IS4A 4YSFA 4K6BA 1VBB1 2VOWA 1KITA 1LGBA 5FV3A 5FZ6A 3PLQA 1LOEA 3TN92 3WG2A 2NYYA 4INDA 3JD71 4N8MA 4FFHA 2IXKA 5F3GA 3FWEA 4RHV1 3NV4A 5FZKA 3ENRA 4TTGA 2FDGA 2JE9A 1DFQA 2BYVE 4EE2A 1CGPA 2F17A 2W95A 5F37A 4RS5C 1DGRN 5HPOA 4QMAA 1JHJA 1RVF3 3R4DB 2C24A 2DV9A 1AR93 3CU7A 2QE3A 1PNGA 4JKMA 5C33A 2XB6C 4IV1A 2DVFA 4Q0SA 5A3OA 1GNHA 3SXWA 4BLJA 4CRQA 4ZU4A 4LKEA 1XNCA 5DZEA 1E5HA 2GMEA 3NV2A 4L8QA 4EQVA 2HWD3 1AR63 1DGLA 5LA0A 2C1FA 5GLWA 1VP6A 1RUF3 2RMU3 1MS9A 3OF1A 1RUH1 5FJKA 5T50A 3VKFC 3WDYA 3O7OA 2JXAA 3IAQA 3ZFEA 4EJRA 1OFNA 3CIHA 3POEA 5FY7A 1TVGA 5I0TA 4CSWA 1I9RA 3MF9A 2P5BA 4D94A 4LIUA 1VBC2 1H30A 4QU2A 3VD5A 4YW4A 4GJYA 1OOPB 3KV9A 2RS33 1REEA 2Y6FA 4DEVA 1ODNA 3QD6A 4P5HA 1SBDA 4LOTA 2XJPA 3TN91 4HKLA 3ZXGA 1GP4A 1BK0A 1SFPA 3CZUA 4Y5SA 3WDTA 2XWJB 1QJX3 4LHNA 4I30A 2V5YA 5FY4A 3K4ZA 1DZRA 4YGDA 3NO8A 3AMQA 1GOFA 3BALA 4LUMA 3W58A 4NIGA 4XCAA 2P34A 1GZWB 3O1RA 1W8TA 4C8DA 1J1LA 4RGKA 3VGIA 2A6XA 1GU3A 2YB7A 4A41A 3D6EA 2W3JA 1FNZA 3GBFA 3NL1A 1J1TA 1H2LA 1K5MC 2QVSB 1SCRA 2YPJA 3ZXEA 2WWSA 3CDZB 4Y1UA 1HN1A 1UMIA 2VVDA 4ASMB 1S1AA 1UOFA 3ZFFA 2CTVA 4HMZA 4QHOA 1H2NA 1OUSA 1V6OA 3ZFGB 2JE8A 4KGGA 1PO12 1SBEA 1JOBA 4HN0A 5GLZA 1OQ1A 1VBC1 2GH2A 1YJKA 3KVAA 4GMP0 1D0GA 3K48A 2FMYA 2WFF3 4MX3A 4XBLA 3SC7X 1G9BA 4IEPA 1W04A 4Q0VA 4PLNA 5JOZA 4YGBA 5FY8A 2P3IA 2VY0A 3IIIA 2QQWA 4JCKA 1ZREA 1XU1A 2XWBB 2Q8OA 5M0TA 3RZKA 2P17A 4N53B 4OULA 3K4AA 3GXUA 5A1LA 1ZRCA 3AYCA 4R8HA 4CXYA 1LECA 3K3NA 4RQPB 1YEWA 1HRV3 3WNOA 2P1BA 4KG8A 1YO8A 4COVA 5EV7A 1F4AA 3MW4A 3BUCA 2JIGA 5FMOS 2G9ZA 3HIFA 2BGOA 2ZX1A 3WQ0A 5CFCB 1H4GA 5IYYA 1MPXA 2WNVB 5A3MA 2O0OA 1FAYA 2GMMA 1BBT2 2R6QA 4XFHA 5EJ1B 4BM8A 4K8RB 2QQLA 2ZZQA 1PO11 2ZGPA 5FPBA 5C5TA 5FYBA 4L9BA 4D6SA 2MNGA 4CPBD 5IVJA 1XXNA 2AEYA 2VBDA 3LA7A 4Q4W1 2HWB3 5A3LA 1RUE1 4XBNA 4N9IA 4O65A 5E88A 1XNKA 2R1BA 5A33A 1TME3 3DPRA 2DUPA 3ZFEC 3W20A 1PVC1 4ARXA 2JDUA 2ET1A 3USUA 1IG0A 4WVMB 1HKDA 4D0QA 4AEDA 4OI0A 2NN8A 2ORXA 2IC1A 3LE0A 1W6NA 1H1AA 3ILFA 1WMEA 3ASIA 1AX1A 3QACA 4NROA 4CCJA 1W6QA 4P9IA 4CEWA 1ZRIA 1REFA 5FP7A 3I7DA 4PHZA 2YXSA 2WAOA 1POV0 2WJSA 2HWE3 1SZBA 2VZTA 5BNPA 1Q8OA 2DBNA 2L9LA 3DEMA 4E2QA 1QXRA 2NMNA 2R0HA 2Y6HA 1NAEA 3JZVA 4FPJA 1OMIA 1H2MA 1QXPA 4NHXA 3LB9A 1BBT1 1XE7A 4B4QA 1CVNA 1ZM1A 4XJUA 2PQQA 2UYBA 2AC1A 2WS92 2YFUA 2X53S 5D21A 5FZOA 4DXSA 2H6CA 2PHXA 5CB7A 4EN9B 3N36A 1ZZ6A 5DG1A 3IPVA 4MGQA 5LY1A 3VBOA 5JUVA 4YZ5A 3BU7A 3OBAA 1VIWB 5F5CA 3H7YA 3SHRA 1PZ9A 1QIQA 4HPKA 4P14A 3AXEA 4K9SA 3SMHA 5KC5A 2VR4A 1XYPA 2YGLA 3D0JA 2V09A 1NZCA 4HG6B 1MS4A 1Q8QA 1TNRA 4QPGC 1EV13 2EIGA 3EQEA 2TUNA 4LTAA 4XAEA 3VBHA 1UKGA 4J25A 3VDCA 4PF5A 5I8SA 1AR73 3LF7A 3UL2A 3WQBA 2WZR2 1S0GA 2GZWA 2NPIA 2QQMA 1UIJA 3TRSB 5C8WA 3TEXA 2WO2A 3UK9A 3MLLA 4CVUA 4AGVA 5CBLA 3N4MA 4Y3OA 3BPSA 1QQP2 3VKNA 2H0VA 4YW2A 1N1SA 3ZX7A 4GH4A 5C70A 1R082 1ENXA 2JDMA 2P37A 4KU8A 2PN5A 4OVEA 2WS91 2DCJA 3ETQA 2D40A 2WA3A 3N7LA 1VMFA 3NMBA 2XVGA 3RZJA 2WDBA 1DLLA 3OB8A 1SBFA 1JZ8A 3O1UA 4U2AA 3GCWA 1YIPA 4XFIA 3ZN6A 3VZLA 3WCSA 1ZBE2 4L2NA 5FPVA 3UETA 2XLGA 5I93A 1STMA 3HN3A 3DXTA 4JQRA 2OZJA 2DCYA 1UY2A 3AZWA 4B1LA 1W05A 3M3CA 2RDRA 4WM7B 5DAQA 1QF3A 2DURA 4JDNA 3AYAA 5CG9A 5L9BA 2VUCA 4X6QB 5IHRA 3W5NA 1VB4A 2VZPA 4E4ZA 1LEMA 4EWEA 4BQ3A 3QCWA 4XXAA 5EXOA 1GP5A 2JD9A 4KU7A 4AVBA 2IFWA 4BMEA 1FYUA 4PDWB 1ZZBA 4BA6A 4AEDC 4NRPA 2UURA 2VTFA 2SLIA 1HB2A 3ACIA 1QQP1 1JZ4A 1OA4A 4Z92B 1HIXA 3WHUA 3AXDA 1R081 1LOFA 3U0ZA 2XMLA 1DGWX 5FP3A 5IVVA 4I0WB 4Y1VA 1D0HA 1UZWA 2A6WA 3OPZA 1UWWA 4GB31 2RG4A 4TN7A 1HJGA 2HWF2 1NZIA 2WWUA 2YYOA 4Q8LA 4W65A 2QQUA 4AAXA 4AQ6A 4CDWC 2DDUA 3HNMA 3HT1A 1GP6A 1QXJA 1ZBE1 3U78A 2XUEA 1JZ6A 4QGLA 1P8JA 4JVAA 2XJVA 1W28A 2Y64A 4CP2A 3WR0A 2BFUS 2J1EA 1S0IA 1D4M3 3O0XA 4XUNA 5B2GB 1POV3 5EFUA 1ND2C 4XABA 3RGBA 4AEKA 2QJVA 4LK7A 2IUWA 2MEV1 3TB0A 5EIYB 1EAH3 2WO3A 4JTNA 1JZ2A 1J59A 4QX0A 4OUMA 4FOWA 2JE7A 3NAPA 1O91A 2XJQA 1QU0A 2R063 3AP5A 4BOWA 2YU2A 2VG9A 1TNFA 1MZ5A 5FPAA 5FP8A 4ZXEA 3ALQA 1R1A1 4Q0PA 4QX2A 4NAOA 2KA3A 2QNKA 3MUY1 1O8SA 4HZFA 3AB0A 4MGSA 3Q8CA 4NRMA 5C4WA 1GZTA 3GHNA 3ZSJA 3HEIA 1US3A 4IV1B 4K7JA 4YW7A 4BQWA 2HWF1 1H1IA 1NLSA 5LBFA 1GYKA 1UL9A 4MG2A 1JYWA 1ASJ3 2B8MA 3AC0A 3C8XA 4GH4C 5F5QA 2CU5A 4GALA 3LOBA 3NNLA 2WT0A 1F31A 3ZFEB 5L7OB 2CYFA 1AR83 5ACA1 2Q1ZB 5F7UA 1B09A 3I97A 2PLV2 1MS8A 1RUG3 3IBMA 1S0BA 3X29B 5FMCA 4Y4YA 1QNYA 4ATEA 1CIYA 4OQ8A 4YZ1A 4K40A 4LITA 4QPYA 3VZKA 5FO9B 2F4LA 1LTEA 3VKLA 4IESA 3HPNA 3C7HA 4QT6A 1X36A 2D6LX 3NKGA 4GWMA 1FMD2 1JXNA 3AVRA 1PX3A 5IVBA 1DDLA 3O1OA 3ZSLA 4KWUA 2GN3A 2BTVC 5KR7A 2XBO3 3EO6A 1W0NA 3MF6A 2OQ7A 4LBMA 1ONAA 3LIGA 4AQSA 1KJRA 4WM8C 3T0BA 4FP3A 5JXGA 3HD8B 1LKNA 3OY8A 5IUQA 3T08A 3RYRA 3B7MA 1W8WA 1UAIA 4NIDA 1NUKA 4G9SB 3ZFFB 4E2GA 3UNPA 3I3MA 4XJZA 4IE0A 3J7HA 2PLV1 2BOIA 1Y9GA 2R32A 2X09A 1BEV3 1IPKA 1MACA 1OSGA 4CCNA 4GXLA 2Q1MA 5KXCA 1SHWB 1MS3A 4GWNA 5FK8A 2VNVA 3ZMNA 2R16A 4DRVA 3FLRA 2WO7A 1AYM3 3Q8EA 3WUCA 1UYPA 1RGSA 2V4VA 1OPMA 1ZZ8A 1C8M2 4ZS3A 3THPA 5CZKA 5JWPA 2DTYA 1ZBA2 3SH5A 5JXHA 1DP0A 4XETA 4M4PA 3T2QA 1VAVA 2ZHNA 3QH6A 3ZLIA 4AFDA 4AVAA 4CP0A 3K51A 2XPJA 2P6CA 3MYXA 4NHYA 1ODMA 2X05A 5A70A 1PMIA 1R093 2WIIB 4CDUC 2MPFA 1ND3C 2WO1A 2DU0A 5K0UC 1GZ9A 2RVAA 3OEBA 1WUVA 2BBAA 2YBSA 3KGZA 4UFKA 4AFCA 4BQ4A 5IK7A 4PBOA 3FZ3A 5F2SA 2VZOA 1H8TC 4B8EA 1SFNA 1WCDJ 4IQPA 4X6RB 5LA2A 3DF0A 5BUVA 3ZR6A 5JSOA 4RR3C 5DUWA 4CEYA 5C8CA 3IWZA 3BOPA 4MZUA 2WSUA 3GZUC 5LEJA 3O5SA 4FPKA 1EPZA 1PO23 2W0XA 1VAMA 4AGRA 2D5HA 3HQUA 4L92A 3HMYA 4LBJA 4UXAA 4OZOA 5FZEA 4LO5B 3FHQA 1RMU3 1U0AA 3KV5A 5A33B 1VB2A 3DPRB 2YG0A 2A75A 5DDJ2 3TEWA 1U12A 1DYOA 4D7YA 1GBGA 3USUB 1JODA 3LGRA 1JMUB 3M3IA 4UI9L 1DBNA 4AEDB 1ZBA1 3POFA 4FPEA 4ASKA 1W6NB 1UU5A 1JYXA 4W50A 4YW3A 1DLCA 3WG3A 2WBKA 5FZ0A 4OMDA 3VDBA 3S7IA 1VAKA 3LDKA 4CEWB 4K3UA 1UU4A 4PCRA 2EXIA 4XHXA 3URFA 5BNPB 1RJ7A 2XJRA 3H0OA 3BGAA 5IVEA 2ZBJA 4LO6B 3H1MA 1JOJA 2R49A 3ZYPA 1LCLA 3VL8A 2JENA 2FCVA 1RVF2 3VBFA 1N1VA 1AR92 2VQTA 3IDEA 2B39A 3N9LA 4UW4A 3RRDA 4QKDA 1R1ZA 4AHZA 1QJY3 4JGYA 3L9JT 4O9EA 5FZOB 2D5FA 1ULEA 5A3WA 3PVOA 2HWD2 2QZ3A 1AR62 3ZXDA 4XJ8A 1RUF2 2N7GA 3IPVB 3K3OA 2RMU2 5LBBA 3VBOB 2LW8A 3KZ4C 2VNRA 4FTSA 3KCYA 4ATFA 1G86A 1RUC3 4NR1A 2VTXJ 2OVUA 1XE8A 4YGCA 3WHTA 1CX4A 1W6OA 1HB4A 4HPKB 1UOGA 4XMAA 2D6PA 3S57A 4KMQA 2DUQA 4I02A 4OHYA 2V73A 3VHPA 3V0AA 1JU4A 4YVWC 2VOTA 2RS32 2W2IA 3A23A 1ENQA 2A1XA 2B46X 2PXJA 4MGKE 2BGCA 3VBSA 1UYZA 2UYAA 2OT7A 3VBHB 2FDIA 3QH7A 4KL1A 4O61A 1UD1A 1B35A 2B7YA 3I59A 2I74A 2BWCA 2K2SA 1HDKA 1JUHA 2QTWB 1IHMA 4K1YA 3M3OA 5LRRA 4EN6B 3J26N 1JYCA 2E53A 3LA2A 5K8SA 1RVF1 3C3VA 5HV4A 1RB8G 1AR91 4LNVA 2IXCA 2QQPA 3LQCA 2ARAA 4GH4B 1X8EA 4SBVA 4DB5A 2W52A 2RS53 1YFXA 2ZCWA 1RL3A 2F4PA 1RHI1 2CV6A 2ZHKA 1NYWA 2ILMA 2JICA 3LAGA 2HWD1 1AR61 2WL1A 3P3NA 1UNBA 4JTOA 2AENA 1FOD3 4QXBA 1RUF1 2OA2A 4GQ7A 5DAVA 3K75B 1LHNA 3OGRA 4XFCA 5DUXA 3ZN6B 2WSVA 5FAXA 4CCKA 4Q4X3 2QKDA 1LODA 2VE1A 2ZJCA 4CEYC 2E7TA 3POYA 2ID4A 2FBEA 5J09A 4E8CA 1MQTC 4C0HA 5FZ3A 1OXCA 2WFF2 2RS31 2ZAAA 5D2AA 1AL0G 3RYKA 5L36A 3AP6A 1KD7A 1LU2A 5ABJA 1YQCA 2ZGQA 3V56A 1FPN1 1XC6A 1APNA 2ZTNA 5H9RA 2BNNA 3WP4A 1VRH3 3T4HB 2VCMA 4V2WA 3WF1A 4DOUA 5J1XA 1CONA 5A1FA 5LK7B 2Y38A 1MVQA 3UGGA 3N9QA 1QJZA 3C7OA 3EYPA 3UKTA 2E6VA 1HRV2 1VJ2A 2XG3A 3FFZA 2ZACA 4QQ2A 4RS5A 1V6JA 2BUKA 3S5QA 4IEUA 4P9WA 3VUOA 3ZIXA 5F3CA 4YPJA 4EYUA 4LHSA 4I2OA 5FZFA 2WYFA 2ZMNA 4PJYA 4CU9A 2GNTA 4P02B 5A1AA 2BEOA 2QQIA 3ATGA 5CAZA 1J84A 4CCMA 4CUAA 3PTRB 3SCGA 2E9QA 1KXGA 4FO9A 3VBFC 3RSJA 3KCCA 3QLQA 4DUWA 5J36A 3KD4A 3BOWA 4BWOA 2OUHA 5AC93 1V00A 4CDXC 4KWJA 4R4ZA 2YBPA 2QUOA 2HWB2 3OD4A 1AJKA 2A3YA 2Z4FA 1G9CA 1JW6A 1GWMA 1O5LA 1DQ4A 1TME2 2VMDA 3FLTA 1IPJA 2ARCA 3VD4A 2BQPA 4FP2A 4QGMA 2YHJA 1I5ZA 3WT3A 3NAPB 4ZHNA 3KVBA 3I54A 4ONUA 2W94A 3EJKA 3VD7A 1X9TA 1WA4A 2C4XA 4IERA 3NNFA 1QJFA 1V9U3 3TOJA 1RC6A 1SDWA 4QU1A 1I3HA 2ARBA 2A70A 2HWE2 4AXOA 5C4WB 2X8KA 4M00A 4TLGA 3RG0A 2WKKA 1EYBA 4S2DA 2ZGKA 3WX5A 3AJYA 4LOSA 2HWC3 3PUHA 5FY5A 3JQWA 5DZGA 1K5MA 3AZZA 5BPXA 1XSRA 4LEJA 4L11A 3AL5A 1YCIA 3PVEA 3FLPA 4QQHA 5FO8B 3WF4A 4AHXA 1S2KA 2BWAA 1BZWA 2I07B 1JH5A 3PIGA 5LK5A 5HCHA 4A3XA 5IVFA 1MZFA 3C7FA 3WD5A 5FWJA 1LNSA 1XRUA 3CL1A 5JAXA 4QQPA 1GV9A 5DG2A 3IAPA 2RM23 3SISA 3DKWA 4V2VA 5AFEA 2PAMA 4M4RA 5IK5A 1YJLA 3I3DA 4LA3A 5F6LB 1S2BA 3AMMA 1VPHA 1OHFA 1H9WA 5A3TA 2ENRA 1EV12 1ULCA 4HBNA 4YLZA 3KT4A 3NVCA 3MIBA 5ABJC 1F5FA 3RQ0A 5FY0A 4A42A 1F5JA 1PK6B 3MUZ1 1AR72 5GZGA 1AZDA 1O59A 2UU8A 5FZ9A 1IQDC 3M2MA 3NSTA 1XYNA 4CA9A 4LXLA 4MSVA 1CAUA 2I2SA 4QXHA 1GQGA 3OY8B 5HCAA 3ZSKA 5D8AA 1LHWA 5A7OA 2ZEWA 1VBA3 2AGSA 1QOTA 1V6KA 4MXWA 5FZAA 4AK3A 1QH7A 3PUQA 2VGDA 3AK0A 3RDIA 4XYXA 1LHVA 1SLCA 1AYN1 4OHXA 4Q29A 1VE0A 2VCCA 5JZGC 4CXWA 2VPVA 4Q4Y3 1ULFA 1UZVA 2DVDA 3INAA 4BDVB 4C0BA 1HRI3 4AI9A 4DY3A 5B4NA 2W87A 2ZGUA 4FOVA 1XQNA 2VMHA 4ORFA 1VBE3 3I2OA 5I8TA 4M0NA 5F32A 1QY4A 4FPGA 5FZBA 4NWVA 3AKRA 2X5IC 1HV0A 3PL0A 3POJA 4LA2A 1EV11 3ZR5A 5C9AC 3RPQA 4BPZA 3RWNA 2FQPA 2FDFA 5BYNA 1A34A 1PGSA 1RYYA 2G4IA 5DPNA 1RUI3 1CZVA 2EXJA 3S7EA 2ZX2A 2P3KA 5JOWA 1NY72 4NRQA 4AGGA 4DXRA 4DRRA 3BTZA 3FX3A 4B7EA 2CWSA 3ZYGA 2QQOA 2LS6A 4NHLA 1POQA 3GF6A 3G6JB 1XBFA 3B3QE 3BODA 3OGSA 2VBPA 3I2IA 1CPMA 1JI6A 5C8CB 3EXUA 4CEYB 1CX1A 4AI2A 3DN7A 4HK8A 1GR3A 1EPWA 1RUNA 2H6BA 3D4KA 5FZGA 2R042 4BQXA 2VQUA 3JBG3 3O0WA 1J3PA 4BU2A 1EP0A 2B9UA 2IZWA 3ZYBA 4AEJA 3N9OA 2B4KA 1W8NA 5DABA 1ZA4A 3ZSEA 4OMCA 3E6BA 5BNNC 1IGOA 3U10A 1QOOA 5DN2A 3RI9A 1D4M2 1W8OA 2GNMA 4XPVA 4Y5Z0 4JRAA 2C9AA 3C7EA 5JI9A 3HBZA 4XXPA 3T2TA 2D6OX 2NZ9A 3ZDSA 5F39A 2R073 3GBWA 2QQJA 4ZY9A 4YARA 1S0DA 1EAH2 4XC9A 2ARXA 4QPGA 2YMZA 5HCBA 2YC4A 2BU9A 4XTPA 1X9PA 2R062 2XL9A 1NY71 1QNWA 4ISRA 2D97A 5CA6A 4BK5A 3LA3A 3BTYA 2I45A 3VV1A 3HNBM 1YI9A 4EN7B 2VMCA 3OBRA 1C28A 2QFEA 4G3YC 4HOOA 3ZOIA 3FHIB 2WNUC 2H0BA 1NQJA 5C3QA 3DXUA 4LORA 2TNFA 4CCLA 4UWDA 4JGYB 1CESA 1UQXA 4H55A 4K8FA 4AE2A 5I0UA 2R041 3H7JA 5F3EA 2Q8DA 4AR2A 4H14A 1ASJ2 3MIFA 1A8DA 1XNBA 2ZZJA 4LLFA 2ZGLA 1IS6A 3WDVA 5D8AC 1UX7A 1W2UA 2WLPA 3VN4A 2VBBA 2VECA 4HK9A 2XH6A 3PMSA 1AR82 1UN1A 4PI2A 5A32A 4HSJA 3GBGA 3POSA 3PVNA 1W6OB 2NLRA 1RUJ3 2PHUA 4KG0A 3MLJA 2J1VA 4LLOA 1H6YA 1D4M1 4LQRA 5DAWA 4OQ9A 5A3NA 1K42A 1WD3A 3V0AB 1POV1 3BIWE 2RE9A 2WRAA 2VOXA 4UOJA 1AXKA 1W3VA 4URTA 3R05A 3NJYA 3SH4A 3VBSB 4R52A 3CKHA 4IW3A 1SCSA 4XCBA 5FMDA 3NJVA 4JHTA 3ACGA 4K1ZA 1B35B 2R061 3I59B 4FQ4A 1U5XA 4U36A 1YFYA 4AVSA 2RS13 3FUQA 2O14A 3IMMA 1BQPA 1C1LA 3KQRA 5AFBA 4YWAA 3WDUA 3DGTA 3LD8A 2ZGMA 5FXZA 1JN2P 1ZZ7A 2NMOA 2JB8A 2XBO2 4QD2A 4QM9A 2ZEXA 1O5UA 4P9LA 3I4IA 4EROA 3RZGA 4D6QA 4XURA 3H3LA 2VUAA 1ASJ1 4GIQA 4AYUA 1PHMA 4COWA 3IMNA 5F5AA 2ZS6B 4CDWA 2EIDA 4QX7A 3O1SA 1N47A 1UOBA 2V4AA 1JBCA 4RGAA 4Y24A 2WQ4A 3U4XA 1AR81 1RITA 2ZXQA 2WN2A 1BEV2 4UAPA 4YGEA 2E7AA 2CGNA 2OXBA 5I91A 4XQDA 4LK6A 1W03A 4B7KA 4UT5A 4E9KA 1S55A 4R9AA 2YZ4A 2YC2A 1Z7S3 1YQ2A 1C3HA 5ABJB 1ND2A 5J96B 1N1TA 3OGVA 1O7FA 4IDZA 1AYM2 3WNKA 1F2NA 1NE6A 4W4ZA 3OUIA 3U4SA 1XPWA 2QDRA 3JD73 2PYTA 1TMF2 3BTAA 4D7TA 1O3SA 2VJXA 1V6NA 4YM3A 3L2HA 4OUSA 5KHKA 1PMHX 3AKTA 5FYYA 1CAVA 1W9YA 5BNOC 5EQUA 4RS5B 1KGYA 3VZOA 1R092 1UF2C 1LR5A 3OSDA 3IDBB 1MR5A 2XJUA 1TEIA 4KBBA 4JZRA 1A8MA 2W91A 3MPPG 5FPXA 3RJ2X 4O7XA 3PDQA 1X50A 1REDA 1W9TA 1E5RA 1O8PA 3H50A 3AMNA 1WBLA 3JQXA 4L97A 1HQNA 2P2KA 2VMFA 2G9GA 4DUXA 1BEV1 2XKPA 4GMP3 4R4XA 1QDCA 2E63A 4NO4A 5A7WA 2VW2A 5IW0A 5FPUA 1KRIA 5I0RA 1RMU2 3ZXAC 3KWVA 3FFQA 3J9SA 3O0VA 3WP3A 2Y6JA 1TZOA 1TMF1 2FCTA 4CCDA 2VM9A 3HAGA 4KI5M 4Y20B 1AL23 4HETA 5FQ0A 3I2GA 1Y43B 3B00A 2WNEA 2C26A 3WDXA 4HXCA 3T30A 2JDZA 3NW4A 1OUXA 2BBVA 3SQOA 4DXTA 2OYZA 5JIUA 3ES4A 2YC0A 3A4UA 1CIWA 3M1HA 4A44A 3B9CA 1AJOA 2WZR1 2JG9C 2DU1A 1PX4A 3K4DA 4GD4A 1IOAA 4N7UA 3USSA 4WM8A 3FUOA 1K5MB 5EJZB 1JYIA 1FV3A 5A80A 1CZTA 4EV0A 5K7PA 4XF3A 5B4XA 4KWLA 4J1XA 2R7EB 2WUHA 3VLBB 3ZYJB 2ATFA 4YZ2A 4IL7A 4H3WA 3DYMA 4Q5OA 3VZMA 2DWRA 5FPZA 5CADA 2OS2A 3LPGA 4FSJA 4MYEA 5FBZA 5IK4A 2WN3A 1CR7A 4RSUA 3JB4C 4ZS2A 2A6ZA 2B42B 1OLMA 3Q9OA 4MHUA 3T2PA 1DQ6A 1OLQA 1GNYA 3Q8BA 5L19A 3BIEA 1IG3A 1YC61 2BNMA 1YUDA 2WR9A 4UYBA 2JDPA 4B1MA 1A3KA 1Q3EA 2VOKA 3CEWA 3LSEA 2GN7A 4HFSA 2NM1A 3VL9A 4D8MA 5KC6A 1M06G 4QM8A 4YVSC 2P6HA 1JZ5A 3CJIC 4ITCA 4CDUA 1ND3A 4E4DX 1YIFA 1CPNA 5A7QA 1WMXA 3M3EA 1CAUB 1DYPA 3PU8A 3QOPA 5K0UA 3ROUA 2CAUA 3OCPA 1GZCA 1S0JA 5DAPA 5D8AB 1QJEA 3AX4A 2YU1A 1H8TA 2RS52 1TE1B 1RINA 3FN9A 1YHFA 4JQTA 4MXWB 4NHMA 3OG2A 4FPFA 3T1MA 5JPMB 4FQZA 3SITA 4LBQA 1OH4A 4RR3A 4EZHA 4I3GA 3VDAA 5HXMA 3B94A 1FOD2 1PO13 4FPCA 5A3PA 2VUDA 5JIAA 3NWKA 1W6PA 4Q4W3 4D3WA 1C5HA 5LATA 1RUE3 4DINB 4Q4X2 3PTYA 4ZZ5A 4NN0A 3CNAA 1HN0A 4AFAA 2VCAA 1KEXA 5FXWA 3J8F3 1ZZ9A 1I5PA 1PVC3 2VMIA 4JKKA 4XTMA 2PA7A 2VCBA 4AWDA 5FOBB 2OPWA 4UW5A 5LBCA 2J1AA 4PI0A 5EWSA 1ZRRA 1PZ8A 3VBUC 3N9NA 4HL0A 5T3NA 2NQYA 1VRH2 4ZONA 2A7AA 3SEPA 2VZ3A 4PQ9A 3CMGA 3BB6A 2DF7A 3ACHA 2DCZA 1QJU2 2BP6A 3OBTA 4A6SA 3RMXA 4AZZA 4BQ1A 4V1PA 5LB6A 1W8ZA 3GGLA 4PIXA 4B4RA 4DO0A 1BKZA 5KHIA 3MZHA 3I2JA 2Q4SA 5EHDA 2W46A 3TNQA 4Y33A 2BNOA 2WZPP 3H42B 1G8WA 3KHBA 2CDOA 2VTXA 1UY4A 2FZ1A 3KGLA 3P1IA 1VMJA 3ELNA 3LEKA 5FLIA 1FOD1 4E27A 1O3RA 3ZSMA 4CDQC 3CBNA 1V6MA 4MGZE 4NHKA 1S4CA 2PTMA 3RFRA 1F4HA 2DVGA 4DFSA 5C3RA 1XJAA 5APAA 4OHVA 5H9PA 1NOVA 4QPIC 1KFUL 1GUIA 1OKQA 5KHGA 4AI8A 1NCQA 5T55A 4FXGB 2VOVA 3E6CC 5AC92 2Q1FA 3FL7A 2QDNA 3UJQA 4W6WA 3J7LA 3MPBA 5CVRA 1T6GC 1R64A 1ULDA 3B01A 2K0GA 4EWDA 3KSCA 1AX2A 2QQNA 4YVWA 4UF0A 3D0SA 4QPGB 4YFWA 3MHZA 1VRH1 3KQ4B 2FCUA 4IE7A 3AP4A 3LKJA 3HOBA 1NCRC 2B5HA 4IXLA 3AZYA 4OUEA 5CKMA 5CFDA 3HQRA 4Q26A 1JZ7A 1QJU1 4H7MA 3AJZA 1SLIA 2ZMKA 3WNXA 1UY1A 3HQXA 1I6XA 2JB4A 1V9U2 1FMD1 2C5DA 3RS6A 5BNQA 1WW7A 4BYYA 3O1TA 1UO9A 1WGPA 4XACA 2HWC2 1C8NA 1FX5A 3APBA 4MGIE 4XQ4A 1FT9A 1DQ1A 4Y1XA 4C1WA 1ZRDA 1NXD1 1UPSA 4CXXA 3OTFA 4YM1A 5HI0A 1UZ0A 1W8FA 1JS9A 2DTWA 2XJTA 5AVPA 5A32B 5JXIA 1C4RA 1PGL2 4PT6A 4XF0A 4YG0A 1MQTA 2XR4A 3WOGA 1FATA 4NPLA 4PIZA 4QXKA 2RDNA 2RM22 5H9SA 5FLHA 3SH3A 4MGYE 4AAPA 5FK7A 3OYWA 4RL7A 1QHDA 1QOSA 1HLCA 1UXXX 3UGFA 2YY1A 4PLMA 4B29A 5F1RA 2LM3A 1HQWA 4OI1A 5C3OA 4I0BA 2PAKA 5A6QA 1IKQA 1C8M1 2WQZC 3ZN5A 4YNIA 2LALA 4XIKA 3GM8A 2PMWB 3WNPA 1MS5A 4D7SA 1DU3D 1WZXA 2G1MA 3WSOA 1W6QB 1Q56A 3GDBA 4NIIA 4BHPA 4CUGA 3AP9A 1X8MA 4PF1A 3VD9A 3T0DA 1IZ3A 1V0AA 2XUMA 2ZX0A 1UOJA 4GB33 5CNAA 4W8JA 4AL9A 4XFGA 3UKNA 4LO4B 1A6CA 3OGJA 4JGZC 4P9XA 4QQLA 2ES3A 4CDWB 1COV3 4LULA 4Q4V3 1US2A 3WCRA 3UKVA 5JOYA 5ERLA 4AW7A 1K12A 3LZZA 1RXFA 1VALA 2RHPA 1G9AA 2VO5A 1XU2A 1PGL1 4Q0QA 4IV3C 4Q4Y2 4CDXA 4DNYA 1HRI2 1MZ6A 2D43A 2Y33A 1O6UA 2ZHMA 1JHNA 1NCQC 1VBE2 4P9GA 4XJAA 1ND2B 2B45X 1PMJX 3MIGA 2BERA 1AF9A 5BXXA 2MEV3 2O8OA 2Q8EA 3WP6A 5DDJ1 3KS7A 4FBFA 1OPOA 1CAWA 1OH3A 1NA1C 5E16A 3UJOA 3UESA 4JAAA 2CL2A 2WFPA 3WF3A 3WW3A 1R1A3 1CAVB 1LEDA 2XJSA 3E97A 4ES9A 4A7YA 4M0HA 1RUI2 4S2FA 1Q8PA 5T5OA 2SBAA 4QDSA 3PMEA 4NIAA 2YV8A 4WVVA 5CFDC 4K20A 3WQ7A 5K9YA 1S0EA 3D3AA 1DQ2A 1QJX2 1GKBA 1GQHA 2K9ZA 2GH8A 4IE6A 4RFT0 5LZ6A 4CP9A 3LFMA 3WNNA 1SLBA 4FPHA 2VQ0A 3ACFA 1UIKA 3PJQA 3WVJA 3RZZA 1WLWA 3TYJA 1ZA7A 4IGOA 1OA3A 1S0CA 4YZ4A 5FZ4A 2VZVA 4BIOA 3M8LA 3MBWA 2DFCA 3F2ZA 4Q4Y1 5ACA3 2JJ6A 3JBG2 5A7WB 3RZLA 4BQYA 2FD8A 5FTTC 5J98B 5J37A 1YI7A 3H8RA 1PZ7A 2ZGTA 5A7NA 2RMU1 2BVVA 1VBE1 2Y26A 1LOCA 4XUQA 2ZX3A 4OI4A 1FI2A 5GLTA 5GM0A 3Q8AA 3PUSA 5FCCA 4LHKA 2PHWA 1IKPA 2VU9A 1IPSA 2IXIA 5JCTA 1OOPC 3EB7A 2R072 2G9FA 2XXZA 3DYOA 4HT1T 4LBQD 1GMMA 2GC1A 5FQ0B 3WG4A 1MS0A 2VD7A 1RUI1 2EAKA 4Q2FA 1WCKA 1LRHA 2RDQA 4RA0A 3SCFA 2AZ5A 4SLIA 3N9MA 3IZOA 1V6LA 2LUWA 1KQRA 1QH6A 2D98A 1QJX1 2JDHA 4UFJA 4JDMA 3R6SA 1LHOA 2GC2A 1OQEA 3IDAA 1ULOA 4WM8B 3KCXA 2Z79A 1HQLA 4QDQA 1ULPA 5DQ0A 1W9WA 4LKSA 5KXEA 2J7MA 4IGPA 3ZVXA 1WCSA 4XAAA 5F6KA 1OF3A 3I8TA 2XHNA 3WXPA 3JBG1 2JDAA 1Z78A 2DUOA 2JG8A 3OD0A 2PFWA 2ETEA 5FXXA 5JZGA 1JYTA 5JDBA 4W6YA 2W5FA 1NG0A 3UGHA 1O3TA 2ADDA 4HANA 1RUJ2 1RTVA 1W8UA 3SKJE 3WDWA 3ZFGC 1HB3A 2UWAA 1XNAA 1WBFA 1DZQA 1XNDA 4H7LA 4RD7A 4TYSA 1UMHA 2ZGOA 3GCXA 2PHRA 4I09A 4LBKA 3ZPYA 1SPPA 4MVTA 3WW4A 1Y9MA 2QCSB 2Z2SB 2X5IA 2WFF1 1W90A 2P3JA 2Y6KA 5GLVA 4R9BA 4AI3A 4IEQA 4ET7A 5KBFA 4AI1A 3CF6E 4FFIA 4ISQA 5C9AA 5FO7B 5IVCA 5EJ3A 1RXGA 4QDRA 1F15A 1L7QA 1G7YA 3BTXA 4N53C 5JSPA 1BLZA 4HONA 4AOCA 5J3UA 1GSLA 4CDUB 1ND3B 2OZ6A 4GA9A 5LASA 1YNAA 2LTNA 1IQAA 3LPFA 5K0UB 4CCCA 1OA2A 1HRV1 4CCOA 4Z8BA 5LRSA 1H8TB 4XFBA 2HJIA 3OBZA 5FYUA 1OLRA 4DUVA 5C7GA 1PGW2 4UFIA 4AHYA 3OUHA 4RR3B 4NWWA 3FJSA 3LEGA 2HH9A 1S0FA 3LEMA 1HW5A 3ITQA 5CFCC 5LY2A 1W6PB 2WNVC 4BMBA 4CP1A 5LA1A 4GKXA 1VRBA 2CY6A 4AEMA 3IN9A 4YZ3A 1GLHA 4E4SA 1LJ7A 4P9JA 2WWJA 1RUJ1 5IT6A 4YW5A 4LE3A 1PIV3 5KXDA 1JYVA 2XVLA 2VZ1A 5FY1A 2JKXA 2PHFA 4DS0A 4TLFA 5BNNA 3LWCA 3U14A 1PNFA 3FBYA 1OVPA 1WMDA 4MGTA 2EIEA 2HWB1 4COUA 4MUVA 1Z7S2 1UPIA 5FLJA 2E51A 3KLSA 4K21A 4RYDA 1H4HA 2DYCA 2XOMA 3O12A 1TME1 1N3OA 4XF9A 1OKOA 4H2AA 4YG6A 2YDEA 5FJHA 2D6MA 5CEHA 3AVSA 3JD72 2GAUA 3ZM8A 2ORZA 3HVDA 1H1MA 3A0NA 3AKPA 4IGQA 1OLME 3H3UA 4LKDA 3GZEA 1D2QA 4LBNA 1VBD3 5FXVA 2RJ2A 4WZCA 3P3PA 2FZ2A 2OPKA 4YM0A 2D6KA 2WNUA 5FOJB 2A6VA 2HWE1 1V70A 3CJXA 4LE4A 4WZFA 4BLIA 4C90A 2OW4A 2VW1A 3O1MA 3N9PA 4M3CE 5FYVA 1LOAA 3MO4A 5D1IA 2EF6A 3ZIWA 2AEZA 2HEWF 5IVYA 2AUYA 1NCQB 3U1XA 1LGCA 2W92A 2JWPA 5DUVA 3AL6A 2UWBA 4Y26A 3ZYIB 4KWKA 1RUD3 1WLCA 2JG8C 2E31A 4YW1A 3MLKA 1MEC3 1N1YA 2RJKA 2W1WA 1QMJA 4GAZA 4QKNA 4YVWB 3NNGA 4CU6A 1TG7A 4UF0B 2PAEA 2FMDA 4LR4A 3BU0A 1N3QA 1BMV2 2W47A 3I2FA 1UZZA 3GALA 4NJ4A 4QHZA 4A3ZA 4CUCA 3OOXA 1HV1A 1KS4A 3I3EA 4FAGA 5A6YA 2ERFA 3R0RA 1AL22 1AUYA 5CFDB 5JMCA 5L9RA 3AZXA 3KF5A 1Q43A 4FOQA 4P00B 3VHRA 4L99A 1W9FA 1GICA 2XKOA 3T2OA 1W0PA 4BQ2A 2CDPA 3ZKUA 4G4FA 1J83A 4Q27A 1VMHA 1BHGA 4LKFA 1DQ5A 1AR71 5LBEA 2GP5A 4COZA 1RHI3 2ZEYA 5DZFA 5K4LA 3UT0A 2BVBA 2R0FA 5FZHA 3ON7A 3MGUA 3THDA 1ST8A 2YUEA 3N3HA 2DVBA 3QBQA 3CQOA 3JU9A 1F9KA 4GMP1 4F7ZA 5L7OA 3BCWA 1E5SA 3CZJA 3LEIA 1LOGA 3EMRA 1C1FA 2W1QA 4XEZA 2E7QA 4NOTA 2D3PA 2EAAA 2FDJA 2YPDA 1MQTB 3MV01 4BJ0A 2JECA 5AVAA 1SLLA 1X7NA 3M7AA 3GZTB 4FXKB 2AREA 1WMFA 5FFOC 1BMV1 2ZAHA 3OYWB 1FPN3 1M4WA 1DZTA 3AM2A 4JV4A 5T5JA 3P6BA 3THTA 4BCUA 4WM7C 1AL21 2HBUA 3W21A 4D6RA 3CO2A 4JC1A 4GWJA 2J1TA 3AYEA 2RJLA 2GDFA 4XQWA 3WF2A 3K46A 4KQ7A 1DG6A 4IEWA 4MOAA 4DPNA 5CIRA 4QB2A 3THCA 2GC0A 5BNOA 2NP0A 3OPWA 4FT8A 3VBRA 4PDWC 1SLTA 3A7QA 1KDKA 2J42A 1YQ5A 5FWEA 4BH9A 2J1UA 2XLFA 3R4UA 4XUPA 2RR13 1YYNA 1GWLA 1OD5A 3ILNA 1W99A 4KGQA 1GWKA 2Q5TA 1XOYA 3POBA 3VBFB 3K77A 1O4TA 2OKXA 3ZPOA 1GNZA 3CHXA 3POIA 4F3JA 2F6BA 1ZYBA 2Q0AA 4YRDA 3KV6A 2VMGA 4IEXA 3CLPA 4AI0A 4CDXB 4LT5A 4Q4W2 5IATA 3I2HA 4YG3A 2EXKA 5CYYA 1RUE2 1UMZA 2ZX4A 1XB9A 4RN5A 2HYXA 3WZ1A 2IVJA 4FCAA 4XMIA 2RV9A 3UV9A 4WV8A 3J8F2 4BB3A 2B9VA 1PVC2 1RIRA 1O4YA 1L7LA 3KHCA 4A4AA 5IFPA 1RUG2 1W3XA 1CAWB 3EBRA 4ZXKA 2VVFA 1W0OA 1CWPA 4EN8B 2Y6GA 1OF4A 3HT2A 3LOIA 3WV6A 1EAH1 1AX0A 3S6PA 1HB1A 4CZSA 2PHDA 1UY0A 2BW8A 3KF3A 4YYOA 3RZMA 4KH9A 1LGNA 3PJYA 3TWIA 1X33A 1NX9A 1GQPA 2DCKA 4R9DA 1J3RA 2PQSA 3B02A 1WD4A 1HXS3 3AZVA 3OUJA 2C9KA 2CWMA 4CE8A 2JG9A 4CP9B 3POWA 3BI3A 3PVBB 4QGNA 2D44A 4QAWA 3NNJA 1NLRA 4NIHA 3HR9A 4L0PA 3MIDA 4IV1C 4Z2WA 2Y6LA 4Z07A 1JUIA 1CQ9A 3I3QA 1U5YA 2R1DA 1H8VA 4ZU7A 4RFRB 2GSYA 3FC0A 1UKRA 4AFMA 4Y4RA 4XUOA 1IS5A 1UU6A 1AXYA 2MHFA 3VDDA 4EWAA 4CU7A 2VL4A 1MZEA 2FDHA 1Q8VA 3J8F1 2VAUA 4FOYA 4O9GA 1VLNA 5L7OC 3S0MA 1ACCA 2AR6A 2WZEA 1CAXA 3ZXKA 4DIQA 5E8AA 4P9YA 1RUG1 3MI8A 2CNAA 5HCFA 4UW6A 2WNOA 3I49A 2VH9A 2Y8KA 2W68A 3D82A 4N43A 4B3NA 3W9AA 2GU9A 1DGWA 3D8CA 1XYOA 2LRPA 3PUAA 1VBB3 3NJZA 4DZGA 4Z82A 4CTEA 4AQ2A 4AF9A 1ENSA 1WW5A 4XBQA 4YVSA 3CJIA 2HBTA 2PHLA 1DQ0A 4RHV3 3U07A 2VQAA 4GZ9A 2J22A 2BPA2 1BYHA 3MIEA 4XDQA 1EUTA 1Y9QA 1YFWA 3ZDVA 1OFSA 4Y22A 3VBRC 3TAYA 4GWIA 2HEVF 1UCXA 3SLIA 2JDNA 2VXJA 2XBO1 4BXSV 2UWCA 1DIWA 1URXA 3E5XA 1XSQA 3C2UA 4NMIA 3WNLA 4AQTA 4DY5A 3DV8A 3VD3A 4FTBA 1AYN3 1NT0A 2JG8B 2Q30A 3H1YA 3NKTA 5JZGB 3H8XA 2QZ2A 1F35A 4Q1RA 1NXMA 5GALA 1ZZCA 5FREA 3ZFFC 4QX3A 5FMOL 1QGLA 2XVKA 3MW3A 4AG4A 2FHRA 4ZKTB 2XHKA 1RUH3 5FIXA 4XVHA 4XFFA 4ASLA 1D7PM 4FFGA 2XL7A 1SPPB 1PO22 2ADEA 4NE9A 4UW3A 2X5IB 5A7SA 2WA4A 3EHKA 4A7KA 1DCSA 1KS5A 2ZKLA 3AYDA 4DMIA 2BOJA 2IXJA 2W1UA 3T09A 5C9AB 4KNCA 2RDSA 2Y0IA 1W8HA 4YW6A 3VBUA 4C1XA 4URAA 4HVQA 2P4EA 3E6DA 1AYM1 1W6MA 3LIHA 2J1RA 2OX0A 3PIJA 3N7MA 4MLOA 4PQQA 5DUUA 5EPAA 3TN93 5C71A 3H8OA 3B9IA 3E1F1 5FPLA 2VXRA 4OFGA 5JSRA 1A78A 2IFRA 1FXZA 5E89A 2FDKA 2XQRA 4LMFA 1S2EA 2BV4A 2VMEA 1R091 4XDPA 4GB32 3KM5A 5FZ8A 5CKNA 3FE5A 5I8YA 2VZRA 1SDDB 2KXLA 3ZXFA 1COV2 5J48A 4CDQA 1O4ZA 4Q4V2 5DXDA 2ZMLA 3HBKA 4HKWA 4QPIA 4D69A 5JI7A 4LPLA 5GZFA 4FTEA 1QJY2 3M3QA 2W39A 2E26A 5FZ1A 4JRLA 4JKLA 5BNNB 1PO21 1XNTA 3WY6A 1SEFA 3RZHA 3VDDC 2YGMA 1VBC3 5KWRA 2ET7A 1FV2A 1RMU1 2XDVA 3ECQA 2MEV2 3DPRC 3MIHA 1RUC2 3SEEA 5EZWA 3ZN4A 1G6NA 2VZSA 2K46A 2BGPA 5EYYA 3M70A 1NCRA 4QHBA 2C0ZA 3TEZA 4QKBA 2A3WA 1SQ4A 4BISA 5J7MA 3BYWA 1R1A2 3F95A 4IE5A 4WVZA 4E8DA 1Z0HA 3H1WA 4UFHA 3RYPA 4N43C 4CEWC 3AFGA 5L9VA 5FRAA 4Z2AA 1K5JA 2WNUB 3GZAA 5FMBA 2TEPA 5BNPC 3O1PA 3H3ZA 4M3CA 1GOGA 2GMPA 1LB2A 1COV1 2R043 2XLAA 2OQ6A 2Y34A 3KB5A 3LSDA 4IEZA 4Q4V1 3AKQA 2D7FA 1QJY1 3SKVA 3ZMOA 2ZEZA 3KT7A 3MICA 5ACA2 3JCIA 4NUBA 4FAHA 4XUTA 4FFFA 3FMGA 1W2OA 2BDRA 3ABZA 1SFYA 5F2WA 3VBOC 4QXCA 5FUPA 3T4VA 4Y5TA 2QBXA 4XF4A 5C6CA 4XJ9A 1H9PA
chains in the Genus database with same CATH topology
1RUC1 4GULA 4F83A 5T5PA 1Q8SA 2ZGSA 3ILRA 3SCHA 4HVOA 1LHUA 2HEYF 3A0KA 3T1LA 3AP7A 2ZGRA 3VBHC 3ZO0B 5BY5A 1ALYA 4FVVA 2D6NA 5E1RA 4UBHA 3V0BA 3HWJA 4R9CA 4UBGA 3AMHA 1CN1A 2ZA9A 1NQDA 4JGZA 2GALA 2TBVA 1CD3G 2RS51 1BCXA 1VR3A 1Y7BA 3L2YA 4MXVA 3VKOA 4BE3A 3H8UA 1BBT3 4CYDA 1O3QA 4FPLA 1WLTA 5FDBA 3D5OA 1U5ZA 4IV3A 2HYKA 3VHNA 2ZHLA 3NV1A 2XGXA 4Q0UA 4Q4X1 2VVEA 4XFAA 2HKXA 2JX9A 2ZPXA 2Z5WA 1NA1A 2AYHA 4LUKA 4E2SA 3VKMA 1PK6A 5BNOB 1BK1A 1D4VB 3VBRB 2BFUL 2WC2A 4MH0E 1KFXL 2EXHA 4HSLA 5BV6A 1J58A 2OUJA 1LESA 1PVXA 3FBMA 4XJWA 3M4FA 4XHBA 1LOFC 3ZYRA 3RJRA 1G9DA 3E5UA 4OI2A 5T5LA 4LBOA 3ST7A 2WS93 1ZVFA 2X29A 5SV8A 4X8PA 2ZOEB 4GKYA 5GZEA 3ME2A 4LO8A 4W6XA 1PIV2 2CGPA 5JR7B 4PBPA 5AC91 1ULGA 2IWGB 2Z69A 4FPYA 2VNOA 4I0AA 4OZXA 5CG8A 2EVXA 4Y1YA 1TMF3 3ZXJA 4C91A 5LEKA 3VHOA 1ZX5A 1OOPA 2A5ZA 2WT2A 1V6IA 1GANA 2UY9A 4XZPA 3NAPC 1H2KA 3WW1A 4TWTA 5JLVA 4LHLA 1AHSA 3OGGA 3WW2A 3T2TA 1VBD2 2WZR3 1L3JA 1WW4A 3IKWA 2JG9B 3IT8A 4LO7A 1DHKB 3ZIXA 4DXZA 1V9U1 3TNPB 5C4WC 1QQP3 1GZWA 1Q5OA 2IXLA 2IXHA 3N7JA 2R30A 1R083 3I2DA 5TSWA 2HWC1 1PM7A 4BZ4A 4IEOA 1LU1A 4TZDA 2JKBA 3VDDB 1VBA2 1PIV1 3N35A 4S2GA 3J4UH 1ZBE3 3KT1A 3ZFGA 4ES8A 1RUD2 1CAXB 4Z1VA 1MEC2 1MVEA 1E57A 1DGRA 3RNSA 3WINE 1OQDA 4Q1PA 4XOGA 3B93A 3PHMA 1Y3TA 2RM21 4N43B 3MFAA 4WVWA 4COYA 1D2SA 3OJBA 1G9FA 4N53A 4PLOA 5GZDA 4YVSB 3MW2A 3JUUA 3CJIB 3MFCA 2KM2A 1VBD1 1UW8A 4J6GA 4RQPA 1PK6C 4Y22B 3ACLA 1LENA 1RHI2 3H9AA 3NV3A 1YRZA 4PIYA 4S2HA 1UZYA 2HWF3 1IS3A 3MEPA 4QQOA 5CFCA 2WNVA 1VBA1 2WINB 5HXVA 5EYXA 1RUD1 4AVCA 1AVBA 4META 4MV2A 5JOXA 4RGGA 1U5IA 1MEC1 3R4SA 5JPNB 2GC3A 1OI6A 1BJQA 4Q8KA 1MS1A 2D93A 1HRI1 4AVVA 1N3PA 4HN1A 1FPN2 1YXWA 4HLTA 3V64A 3VBUB 1TQ5A 5T52A 1C57A 4HKOA 1W6MB 5I0SA 2YROA 4WVMA 4FPOB 4OLLA 1QWRA 1FNYA 1RJ8A 2A6YA 2CGOA 2DFBA 2JEMA 4AVTA 4A2UA 3IM0A 1YWKA 3GYDA 2GNDA 4IEYA 2RR12 3B69A 1I1EA 3GHMA 1ZNPA 4CDQB 3V65A 4HVRA 1X82A 2WT1A 4QPIB 3WLUA 5C8CC 1BVVA 1QDOA 2ZABA 4A7ZA 1F8VA 1W39A 2W08A 2VW0A 3LCPA 3KMHA 4IEVA 5T54A 5GZCA 3SNMA 2PLV3 4M01A 4XW3A 3WQ1A 2OIIA 4N9HA 4N90A 4ZU5A 1C5IA 4XF1A 3MDPA 3AKSA 3O14A 4NPRA 5GKAC 1ENRA 2D3SA 1NCRB 2DCTA 4YFZA 1QJU3 2O8QA 1H0BA 4DQAA 2R071 3IDCB 3U11A 5KHHA 1HX6A 4XE9A 3AFKA 1CJPA 1FMD3 5GLUA 2JD4A 4YM2A 4M3CB 1HXS2 1NE4A 2RR11 4I3PA 4X8NA 1YFUA 2RS12 3ZXLA 1LOBA 3JB8A 1KDMA 1UX6A 1BVP1 1EY2A 4IETA 3VZNA 4AFBA 4RQPC 1JTZX 3WUDA 1WW6A 2O1QA 4JGYC 4EN0A 5F9TA 2UY8A 4J1WA 5CU1A 1SACA 2A71A 3DUIA 1ZRFA 4LBQB 3E5QA 3N7KA 4LBLA 3GNEA 1DF0A 4I01A 3S30A 2VUJA 1WLDA 4N7IA 3RMYA 3WG1A 2AH2A 2A3XA 5L73A 4NVPA 1DYKA 1QKQA 4Y20A 4WM7A 3W59A 3AMPA 1C8M3 3VBSC 5KXBA 2GNBA 1ZBA3 1VBB2 4JDOA 1RUOA 1B35C 3IIAA 4Y1ZA 3V0BB 1HXS1 2EALA 4PDWA 2Z42A 4RHV2 4B4PA 4F8AA 5H9QA 2RS11 4WBBA 2A73B 1SMVA 3HN1A 2ZGNA 3VZJA 5SV5A 1LULA 2DVAA 5HBAA 4JGZB 4XIOA 3ES1A 5IK8A 4QX5A 2CAVA 1PGW1 1GFF2 1AYN2 2PELA 1YLLA 1SLAA 2ZKNA 3PNAA 3DL3A 3B5LB 3BPZA 4IV3B 2VNGA 4TSVA 2Y0OA 3G7DA 2VULA 2WLQA 1J3QA 5JVVA 3RI8A 1RUH2 1CJDA 1AXZA 4OHWA 2PHTA 5DDJ3 1BXHA 4OHZA 3WP5A 4XILA 1KJLA 2D3RA 1NA1B 4M3CF 5GJ6A 1Z7S1 2EA7A 4AHWA 1IS4A 4YSFA 4K6BA 1VBB1 2VOWA 1KITA 1LGBA 3PLQA 1LOEA 3TN92 3WG2A 2NYYA 4INDA 3JD71 2IXKA 3FWEA 4RHV1 3NV4A 3ENRA 2JE9A 1DFQA 2BYVE 1CGPA 4RS5C 1DGRN 4QMAA 1RVF3 3R4DB 2DV9A 1AR93 3CU7A 2QE3A 1PNGA 5C33A 2XB6C 4IV1A 2DVFA 4Q0SA 1GNHA 3SXWA 4BLJA 4CRQA 4ZU4A 1XNCA 5DZEA 2GMEA 3NV2A 4L8QA 2HWD3 1AR63 1DGLA 2C1FA 5GLWA 1VP6A 1RUF3 2RMU3 1MS9A 3OF1A 1RUH1 5T50A 3VKFC 3WDYA 3O7OA 2JXAA 3ZFEA 4EJRA 1OFNA 5I0TA 1I9RA 3MF9A 4D94A 1VBC2 1H30A 4QU2A 4YW4A 1OOPB 2RS33 1REEA 3QD6A 4P5HA 1SBDA 2XJPA 3TN91 4HKLA 3ZXGA 3WDTA 2XWJB 1QJX3 4LHNA 4I30A 2V5YA 1DZRA 4YGDA 3NO8A 3AMQA 3BALA 4LUMA 3W58A 2P34A 1GZWB 1J1LA 3VGIA 2A6XA 3D6EA 1FNZA 3GBFA 3NL1A 1J1TA 1H2LA 1K5MC 2QVSB 1SCRA 2YPJA 3ZXEA 2WWSA 4Y1UA 2VVDA 4ASMB 1S1AA 3ZFFA 2CTVA 4HMZA 1H2NA 1V6OA 3ZFGB 4KGGA 1PO12 1SBEA 4HN0A 5GLZA 1OQ1A 1VBC1 2GH2A 1YJKA 4GMP0 1D0GA 3K48A 2FMYA 2WFF3 4MX3A 4XBLA 1G9BA 4IEPA 4Q0VA 4PLNA 5JOZA 4YGBA 2P3IA 2VY0A 4JCKA 1ZREA 1XU1A 2XWBB 2Q8OA 2P17A 4N53B 4OULA 1ZRCA 3AYCA 4R8HA 1LECA 4RQPB 1HRV3 4KG8A 1YO8A 4COVA 5EV7A 3MW4A 5FMOS 3HIFA 2ZX1A 3WQ0A 5CFCB 1H4GA 2WNVB 5A3MA 2O0OA 1FAYA 2GMMA 1BBT2 2R6QA 4XFHA 4BM8A 2ZZQA 1PO11 2ZGPA 4L9BA 2MNGA 1XXNA 3LA7A 4Q4W1 2HWB3 5A3LA 1RUE1 4XBNA 4N9IA 5E88A 1XNKA 2R1BA 5A33A 1TME3 3DPRA 2DUPA 3ZFEC 1PVC1 2ET1A 3USUA 4WVMB 1HKDA 4AEDA 4OI0A 2NN8A 2IC1A 1W6NA 1H1AA 3ILFA 1WMEA 3ASIA 1AX1A 3QACA 1W6QA 4P9IA 4CEWA 1REFA 3I7DA 2YXSA 1POV0 2WJSA 2HWE3 5BNPA 1Q8OA 4E2QA 1QXRA 2NMNA 2R0HA 4FPJA 3JZVA 1OMIA 1H2MA 1QXPA 3LB9A 1BBT1 1XE7A 4B4QA 1CVNA 1ZM1A 4XJUA 2PQQA 2UYBA 2WS92 2X53S 2H6CA 2PHXA 5CB7A 4EN9B 3N36A 1ZZ6A 5DG1A 3IPVA 3VBOA 4YZ5A 3BU7A 1VIWB 3H7YA 3SHRA 1PZ9A 4HPKA 4P14A 3AXEA 4K9SA 3SMHA 5KC5A 3D0JA 1XYPA 2YGLA 2V09A 1NZCA 1MS4A 1Q8QA 1TNRA 4QPGC 1EV13 2EIGA 3EQEA 2TUNA 4LTAA 3VBHA 1UKGA 4PF5A 5I8SA 1AR73 3UL2A 2WZR2 1S0GA 2GZWA 2NPIA 3TRSB 1UIJA 5C8WA 3UK9A 3MLLA 4AGVA 5CBLA 3N4MA 1QQP2 3VKNA 2H0VA 4YW2A 1N1SA 3ZX7A 4GH4A 1R082 1ENXA 2P37A 4KU8A 4OVEA 2PN5A 2WS91 2DCJA 3ETQA 2D40A 2WA3A 3N7LA 2XVGA 1DLLA 1SBFA 4U2AA 3ZN6A 1YIPA 4XFIA 3VZLA 3WCSA 1ZBE2 4L2NA 2XLGA 5I93A 4JQRA 5KHJA 2OZJA 2DCYA 3AZWA 3M3CA 4WM7B 1QF3A 2DURA 4JDNA 3AYAA 5CG9A 4X6QB 1VB4A 4E4ZA 1LEMA 4EWEA 3QCWA 4XXAA 5EXOA 4KU7A 4AVBA 2IFWA 4BMEA 1FYUA 4PDWB 1ZZBA 4BA6A 4AEDC 2UURA 2SLIA 1QQP1 1OA4A 4Z92B 1HIXA 3WHUA 3AXDA 1R081 1LOFA 3U0ZA 1DGWX 4I0WB 4Y1VA 1D0HA 2A6WA 5FCCA 3OPZA 4GB31 4W65A 2HWF2 2YYOA 4Q8LA 4AQ6A 4CDWC 3HT1A 1QXJA 1ZBE1 4QGLA 4JVAA 2XJVA 4CP2A 3WR0A 2BFUS 1S0IA 1D4M3 3O0XA 5B2GB 1POV3 5EFUA 1ND2C 4AEKA 2QJVA 3TB0A 2MEV1 1EAH3 4JTNA 1J59A 4OUMA 4FOWA 2JE7A 3NAPA 1O91A 2XJQA 1QU0A 2R063 3AP5A 4BOWA 2VG9A 1TNFA 1MZ5A 3ALQA 1R1A1 4Q0PA 2KA3A 2QNKA 4HZFA 3AB0A 5C4WA 3GHNA 3ZSJA 4IV1B 4K7JA 2HWF1 1H1IA 1NLSA 1GYKA 1UL9A 1ASJ3 2B8MA 4GH4C 5F5QA 4GALA 3LOBA 2WT0A 1F31A 3ZFEB 5L7OB 2CYFA 1AR83 5ACA1 2Q1ZB 1B09A 2PLV2 1MS8A 1RUG3 3IBMA 1S0BA 3X29B 4Y4YA 1QNYA 4ATEA 4YZ1A 4K40A 4QPYA 3VZKA 5FO9B 1LTEA 3VKLA 4IESA 4QT6A 1X36A 2D6LX 3NKGA 4GWMA 1FMD2 1JXNA 1DDLA 3ZSLA 2GN3A 2BTVC 2XBO3 3EO6A 4AQSA 3MF6A 4LBMA 1ONAA 1KJRA 4WM8C 4FP3A 3HD8B 1LKNA 3OY8A 5IUQA 3RYRA 3B7MA 1UAIA 4G9SB 3ZFFB 4E2GA 4XJZA 2PLV1 2R32A 1BEV3 1IPKA 1MACA 1OSGA 4GXLA 2Q1MA 5KXCA 1MS3A 4GWNA 3ZMNA 2R16A 4DRVA 3FLRA 1AYM3 3WUCA 1RGSA 1OPMA 1ZZ8A 1C8M2 3THPA 5JWPA 2DTYA 1ZBA2 3SH5A 4XETA 1VAVA 2ZHNA 3QH6A 4AFDA 4CP0A 4AVAA 3K51A 2XPJA 3MYXA 1PMIA 1R093 2WIIB 4CDUC 2MPFA 1ND3C 2DU0A 5K0UC 1GZ9A 1WUVA 5IK7A 3KGZA 4AFCA 4PBOA 3FZ3A 4B8EA 1H8TC 1SFNA 1WCDJ 4IQPA 4X6RB 3DF0A 5BUVA 5JSOA 4RR3C 5DUWA 4CEYA 5C8CA 3IWZA 3BOPA 4MZUA 2WSUA 3GZUC 5LEJA 3O5SA 4FPKA 1EPZA 1PO23 2W0XA 1VAMA 4AGRA 2D5HA 4L92A 3HMYA 4LBJA 4UXAA 4LO5B 1RMU3 1U0AA 5A33B 1VB2A 3DPRB 5DDJ2 2A75A 1U12A 4D7YA 1GBGA 3USUB 3LGRA 3M3IA 1DBNA 4AEDB 1ZBA1 4FPEA 1W6NB 1UU5A 4YW3A 3WG3A 3S7IA 1VAKA 4CEWB 4K3UA 1UU4A 4PCRA 2EXIA 4XHXA 3URFA 5BNPB 1RJ7A 2XJRA 3H0OA 2ZBJA 4LO6B 3H1MA 1JOJA 2R49A 3ZYPA 1LCLA 3VL8A 2JENA 1RVF2 3VBFA 1N1VA 1AR92 3IDEA 2B39A 4UW4A 3RRDA 1R1ZA 4AHZA 1QJY3 4JGYA 3L9JT 4O9EA 2D5FA 1ULEA 3PVOA 2HWD2 2QZ3A 1AR62 3ZXDA 4XJ8A 1RUF2 2N7GA 3IPVB 2RMU2 3VBOB 3KZ4C 2VNRA 4FTSA 3KCYA 4ATFA 1G86A 1RUC3 4NR1A 2OVUA 1XE8A 4YGCA 3WHTA 1CX4A 1W6OA 4HPKB 4XMAA 2D6PA 2DUQA 4I02A 4OHYA 2V73A 3VHPA 3V0AA 4YVWC 2RS32 1ENQA 2B46X 4MGKE 2BGCA 3VBSA 2UYAA 3VBHB 3QH7A 4KL1A 1UD1A 1B35A 2B7YA 3I59A 2I74A 2BWCA 2K2SA 1HDKA 1JUHA 1IHMA 4K1YA 3M3OA 5LRRA 4EN6B 3J26N 1JYCA 2E53A 3LA2A 5K8SA 1RVF1 3C3VA 1RB8G 1AR91 4LNVA 2IXCA 2QQPA 4GH4B 4SBVA 1X8EA 4DB5A 2W52A 2RS53 1YFXA 2ZCWA 1RL3A 2F4PA 1RHI1 2CV6A 2ZHKA 1NYWA 2ILMA 2JICA 3LAGA 2HWD1 1AR61 2WL1A 3P3NA 4JTOA 3TBDA 2AENA 1FOD3 1RUF1 2OA2A 4GQ7A 1LHNA 4XFCA 5DUXA 3ZN6B 2WSVA 5FAXA 4Q4X3 2QKDA 1LODA 2ZJCA 4CEYC 2E7TA 3POYA 2FBEA 5J09A 1MQTC 4C0HA 2WFF2 2RS31 2ZAAA 1AL0G 3RYKA 5L36A 3AP6A 1KD7A 1LU2A 5ABJA 2ZGQA 3V56A 1FPN1 1APNA 2ZTNA 5H9RA 2BNNA 3WP4A 1VRH3 4DOUA 1CONA 5LK7B 2Y38A 1MVQA 1QJZA 3UKTA 2E6VA 1HRV2 1VJ2A 2XG3A 3FFZA 2ZACA 4QQ2A 4RS5A 1V6JA 2BUKA 4IEUA 4P9WA 3VUOA 4I2OA 2ZMNA 4PJYA 2GNTA 2BEOA 5CAZA 3ATGA 3SCGA 2E9QA 1KXGA 4FO9A 3VBFC 3RSJA 3KCCA 3QLQA 5J36A 3KD4A 3BOWA 4BWOA 2OUHA 5AC93 1V00A 4CDXC 4KWJA 4R4ZA 2QUOA 2HWB2 3OD4A 1AJKA 2A3YA 1G9CA 1JW6A 1O5LA 1DQ4A 1TME2 3FLTA 1IPJA 2BQPA 4FP2A 4QGMA 2YHJA 1I5ZA 3WT3A 3NAPB 3I54A 4ONUA 3EJKA 1WA4A 4IERA 1V9U3 3TOJA 1RC6A 1SDWA 1I3HA 2ARBA 2A70A 2HWE2 4AXOA 5C4WB 2X8KA 4M00A 3RG0A 2WKKA 1EYBA 4S2DA 2ZGKA 3WX5A 3AJYA 2HWC3 3JQWA 5DZGA 1K5MA 3AZZA 5BPXA 4LEJA 4L11A 1YCIA 3PVEA 3FLPA 4QQHA 5FO8B 4AHXA 1S2KA 2BWAA 1BZWA 2I07B 1JH5A 5LK5A 4A3XA 1MZFA 3WD5A 1XRUA 3CL1A 5JAXA 4QQPA 1GV9A 5DG2A 2RM23 3SISA 3DKWA 5AFEA 2PAMA 5IK5A 1YJLA 4LA3A 5F6LB 1S2BA 3AMMA 1OHFA 1H9WA 2ENRA 1EV12 1ULCA 4HBNA 4YLZA 3KT4A 3NVCA 3MIBA 5ABJC 1F5FA 3RQ0A 1F5JA 1PK6B 1AR72 5GZGA 1AZDA 2UU8A 3M2MA 3NSTA 1XYNA 4MSVA 1CAUA 2I2SA 1GQGA 3OY8B 5HCAA 3ZSKA 5D8AA 1LHWA 1VBA3 2AGSA 1QOTA 1V6KA 4MXWA 4AK3A 1QH7A 2VGDA 3AK0A 3RDIA 4XYXA 1LHVA 1SLCA 1AYN1 4OHXA 4Q29A 5JZGC 2VPVA 4Q4Y3 1ULFA 2DVDA 3INAA 4C0BA 1HRI3 4DY3A 2ZGUA 4FOVA 1XQNA 2VMHA 4ORFA 1VBE3 5I8TA 4M0NA 1QY4A 4FPGA 4NWVA 3AKRA 2X5IC 1HV0A 4LA2A 1EV11 5C9AC 3RPQA 4BPZA 3RWNA 2FQPA 5BYNA 1PGSA 2G4IA 1RUI3 3S7EA 2EXJA 2ZX2A 2P3KA 5JOWA 1NY72 4AGGA 4DRRA 3FX3A 4B7EA 2CWSA 3ZYGA 4NHLA 3GF6A 3G6JB 3B3QE 3BODA 1CPMA 5C8CB 3EXUA 4CEYB 4AI2A 3DN7A 4HK8A 1GR3A 1EPWA 1RUNA 2H6BA 3D4KA 2R042 3JBG3 3O0WA 1J3PA 1EP0A 2B9UA 2IZWA 4AEJA 1ZA4A 3ZSEA 3E6BA 5BNNC 1IGOA 3U10A 1QOOA 3RI9A 1D4M2 2GNMA 4XPVA 4Y5Z0 4JRAA 2C9AA 5JI9A 3HBZA 4XXPA 2D6OX 2NZ9A 3ZDSA 2R073 3GBWA 4YARA 1S0DA 1EAH2 2ARXA 4QPGA 2YMZA 5HCBA 4XTPA 2R062 2XL9A 1NY71 1QNWA 4ISRA 2D97A 5CA6A 3LA3A 2I45A 3VV1A 1YI9A 4EN7B 3OBRA 1C28A 2QFEA 4G3YC 3FHIB 2WNUC 2H0BA 1NQJA 2TNFA 4JGYB 1CESA 4H55A 4K8FA 4AE2A 5I0UA 2R041 3H7JA 4H14A 1ASJ2 3MIFA 1A8DA 1XNBA 2ZZJA 4LLFA 2ZGLA 1IS6A 3WDVA 5D8AC 1W2UA 2WLPA 3VN4A 2VECA 4HK9A 2XH6A 3PMSA 1AR82 1UN1A 5A32A 4HSJA 3GBGA 3POSA 3PVNA 1W6OB 2NLRA 1RUJ3 2PHUA 4KG0A 3MLJA 4LLOA 4BIFA 4DS0A 1D4M1 1WD3A 3V0AB 1POV1 3BIWE 2RE9A 2VOXA 1AXKA 4URTA 3R05A 3SH4A 3VBSB 4R52A 1SCSA 4K1ZA 1B35B 2R061 3I59B 4FQ4A 1U5XA 4U36A 1YFYA 4AVSA 2RS13 3FUQA 1BQPA 1C1LA 3KQRA 5AFBA