1NCQA

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 45
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqA00
3JD73 1QQP1 4CDUA 4Y5Z0 5ACA1 3ZXAC 1QJU2 1HXS1 3ZFFC 1D4M1 3VBUB 3VBFC 1VBC1 5CFDC 5ACA3 4WM7C 5JZGC 1HXS3 1D4M3 1AR81 1VBC3 1F2NA 3J8F2 2X5IA 1VRH1 5C9AA 5AC92 1AR83 5CFCC 1VB2A 1TMF2 1VRH3 1AL22 3VBOA 2RM21 1NA1B 1NCQB 2ZTNA 5A33B 2RM23 3CJIC 4N53A 2WWSA 1R081 1BBT2 3JBG1 1NY72 2X5IC 4CDXB 5C9AC 4BCUA 2R041 3JBG3 4CDQA 2WZR2 3VBSB 2R043 3DPRC 3VBOC 5BNNB 1PGW1 4Q4X2 4QPGB 1VBD2 4Q4Y3 1K5MC 3LOBA 5BNOB 4IV1C 4N53C 1CD3G 1AR62 1VAKA 4FTSA 1FMD2 1RUG2 1PVC3 2TBVA 2RS31 1AR72 4RQPC 2HWB2 1RMU1 3VBHC 2RS33 1RMU3 5FMOS 4AEDA 4Q4W2 1BEV1 3TN92 5J96B 1RUJ2 3ZFEA 4GH4A 1BEV3 1VBE2 3NAPA 3JD72 1V9U1 4Q4V3 4YVSB 2PLV2 2XBO2 5FMOL 1QQP2 2MEV3 2HWF1 4QPIB 1QJX1 2RS51 4Z92B 4AEDC 5DDJ1 4NWVA 5D8AA 5A32B 5ACA2 2R061 2HWF3 1MQTA 1NCRC 1HXS2 1X36A 2RS53 1D4M2 1OOPB 5K0UA 1M06G 1VBC2 2FZ1A 4EJRA 4RR3A 1EAH1 1FOD1 1ND2A 1AR82 2HWC1 1FPN1 1E57A 1VRH2 1FOD3 3S6PA 1Z7S1 2HWC3 1RUH1 2WFF1 1Z7S3 1RUC1 1X33A 1RUH3 2RM22 4RFT0 5ABJA 5CFDB 1RUC3 1RUD3 5BNPC 1H8TA 1IHMA 1R082 1AR91 3JBG2 2HWD1 1PIV1 1ZBE1 4N43B 3VDDC 2R042 1AR93 1ZBE3 3ZFFA 3VBFA 4PDWC 4CDUB 4WM7A 5ABJC 1PGW2 5JZGA 1W39A 1H8TC 1NOVA 5CFCA 4FSJA 2X5IB 1TME1 4RHV1 5C9AB 4CDWA 2ZZQA 5C8CA 1GFF2 2RS32 1TME3 4RHV3 3VBOB 1RMU2 3CJIA 1WCDJ 1F8VA 2RR11 4N53B 2RR13 1MEC1 1BEV2 4RS5A 1C8M1 3DPRA 4CDWC 5C8CC 1MEC3 4CDQB 1V9U2 2ZAHA 1C8M3 1K5MA 1NG0A 3IDEA 1A6CA 4IV1A 5C4WC 4CEWC 2HWF2 1QJX2 2RS52 4CEYC 5DDJ2 2R062 4RS5C 1RHI1 4Q4Y1 4RQPA 2WS93 4GB31 5L7OC 3JB8A 3VBHA 3HAGA 1RHI3 1EAH2 1FOD2 1B35C 4GB33 1ND3A 2HWC2 1FPN2 2RS11 2BFUL 4JGYC 1PVC1 1Z7S2 1RUH2 2RS13 2Y26A 1AYM1 2WFF2 4AEDB 1RUC2 1AYM3 3ZFEB 4GH4B 2R071 3NAPB 1AR92 1ND3C 2R073 2HWD2 1PIV2 1RUI3 2HWE1 1BMV1 1NCRA 4Q4V1 5D8AB 2HWE3 1NA1C 1NCQC 1MQTB 4SBVA 2MEV1 5K0UB 1AUYA 4RR3B 1QJU3 1HRI1 1ND2B 5J98B 1OHFA 1TME2 4RHV2 4YVWA 1HRI3 3FBMA 1COV1 3VBSC 1RUE1 5BNPA 1TMF3 2RR12 1COV3 1AL23 1RUE3 1R091 3VDDA 1H8TB 2DF7A 1MEC2 1R093 4PDWA 4YVWC 1C8M2 1RUF1 2XPJA 1RUD1 5GKAC 3ZFFB 3VBFB 2BPA2 1ASJ1 1RUF3 1R1A1 4JGZA 4WM7B 2RMU1 5JZGB 1ASJ3 1R1A3 2RMU3 1PO21 4WM8B 1VBD3 1AYN1 5CFCB 1RHI2 4Q4Y2 1PO23 2GSYA 1AR63 1AYN3 4GB32 4CDWB 5C8CB 1QJY1 3ZFGA 4GMP1 4IV3A 4YVSC 4JGZC 1RB8G 3CJIB 1PVC2 1QJY3 2BUKA 4GMP3 1HX6A 4QPIC 1AYM2 1VBA1 3M8LA 4RS5B 1VBA3 3DPRB 1PO11 2R072 5C4WA 4CEWA 3ZFGC 4IV3C 1K5MB 1PO13 2PLV1 4IV1B 4CEYA 1HRV1 2PLV3 2HWE2 1AL0G 1BMV2 4Q4V2 2XBO3 1HRV3 2WLPA 5L7OA 1QQP3 4GMP0 4JGYB 1CJDA 1PGL1 1B35A 1VBB1 4RQPB 2MEV2 1SMVA 4JGYA 4WM8A 3VBHB 3VBRA 1VBB3 1HRI2 1EV11 2BFUS 1ND3B 4N43C 2WS91 1EV13 3VBUA 4CDUC 1COV2 4LLFA 1RUE2 2QQPA 4WM8C 3VBRC 1R092 1RVF1 1RUF2 1R083 1RUD2 1NA1A 1NCQA 1NCRB 3VBUC 1OPOA 1ZBA1 5A33A 1RVF3 1ASJ2 1R1A2 2RMU2 1RUI1 1ZBA3 1ZBE2 1POV1 1VB4A 4CDXA 1PO22 1AYN2 2IZWA 1POV3 3VBSA 4YVWB 5BNNA 4QPGA 1QJU1 1QJY2 4CDQC 5BNOA 5BNPB 4CDXC 3J8F1 3VDDB 1VBA2 5AC91 1TMF1 3J8F3 4PDWB 1AL21 5BNNC 1PO12 5AC93 4QPGC 5ABJB 1POV0 5BNOC 2VQ0A 4JGZB 1HRV2 1BBT1 1V9U3 1NY71 1BBT3 1PGL2 4YVSA 1QJX3 1VBB2 2WZR1 3ZFEC 4GH4C 5DDJ3 4FTBA 4Q4X1 1VBD1 3JB4C 2R063 3ZFGB 1HQNA 3NAPC 2WZR3 4IV3B 1EV12 4NWWA 4QPIA 4Q4X3 1AR61 2WS92 1EAH3 5A32A 1FMD1 1RUG1 1FPN3 2BBVA 1OOPA 5FOJB 5D8AC 1FMD3 1AR71 1RUG3 1MQTC 2HWB1 2WFF3 2RS12 5K0UC 4Y4YA 5C4WB 4CEWB 1AR73 4RR3C 1QJZA 1ND2C 2HWB3 4CEYB 1RVF2 2FZ2A 1DDLA 4Q4W1 3TN91 1RUJ1 1OOPC 2HWD3 1PIV3 1ZBA2 5L7OB 4Q4W3 5CFDA 3TN93 1C8NA 1VBE1 1RUJ3 2GH8A 3JD71 1RUI2 1B35B 4FTEA 5LK7B 4N43A 2XBO1 3VBRB 1VBE3
chains in the Genus database with same CATH superfamily
4XOGA 2BNNA 1QQP1 3HQRA 5FZDA 4BOWA 1IOAA 3E97A 4X6RB 4XF3A 1UXXX 4KG0A 4QGNA 4YLZA 4G4FA 4HXCA 1RYYA 5ACA1 4P5YA 3V65A 1WCSA 3LA7A 3ZFFC 5IYYA 1DQ1A 2MPFA 3DKQA 1NZCA 4UWDA 5E89A 5JLVA 3EQEA 3ZX7A 5IVCA 1RGSA 2A6YA 1D4M3 4YZ1A 1QU0A 2V4VA 1EYBA 1UY0A 3J8F2 2CL2A 2CGNA 2X5IA 4AI2A 5AFEA 5C9AA 4MLOA 3R6SA 2A71A 2BNOA 1AR83 4NN0A 2E33A 3A0KA 3OPTA 2Y6FA 3CKHA 4IETA 5FQ0B 1LB2A 1CZVA 1VRH3 2ZGRA 3VD5A 2D7FA 1Q3EA 1UPSA 2I2SA 3VBOA 2BZDA 1ULOA 2O14A 3RI9A 1POQA 3TWIA 2YU1A 3ZPOA 4D7YA 2ZTNA 3PUAA 3THTA 1DYPA 2VNRA 3O12A 3T4VA 2RM23 1LU2A 4N53A 2CGOA 4NMIA 5FZOA 3P5BA 4COVA 4YW7A 5I0DA 1LU1A 1XE0A 3MFAA 3WEZA 4KWJA 4BQYA 1I1EA 3RRDA 2ZGMA 3A21A 3U78A 2XMLA 2WZR2 2YC0A 1PZ8A 5A3OA 4FPYA 5F9TA 5IVEA 1PGW1 3KD4A 2VCAA 5FZ6A 4DY3A 1K5MC 1EPZA 3Q8AA 4LKSA 5JSOA 4Q0PA 2W92A 2ZMLA 4MXWA 5JDBA 1BQPA 4YG6A 5LWBA 4EN7B 1AR62 5T5LA 3POIA 2O1QA 1Z78A 4WZCA 2BW8A 1ENXA 2JIJA 5FZHA 5LASA 4XC9A 2RS31 4CRQA 5CKNA 1N1YA 4MGZE 3UKNA 4Y1XA 3KV9A 3ZIWA 4TTGA 1UZYA 1RMU3 4GJZA 4OMCA 3PNAA 5FPZA 5FO7B 2I07B 4DIQA 4AEDA 4D6SA 1O59A 1H2KA 3BI3A 1W8OA 1AXZA 3C3VA 3ZFEA 3LDRA 4LBLA 2P3KA 4COZA 3B9IA 2EIBA 4KWKA 3VB9A 4PQQA 1V9U1 1WLDA 1H8VA 5CU1A 3ZPYA 4HANA 3AXEA 3THDA 2XBO2 1YIFA 1S0JA 5D21A 2W1QA 4N90A 2GN3A 2YROA 4FI9A 1QGLA 2Q1MA 4XDOA 4DINB 3TYJA 1UZ0A 3E6DA 4JZRA 5DDJ1 5KHHA 2CWMA 2R061 2HWF3 4MZUA 1C28A 3RWNA 1X36A 2RS53 1D4M2 2SLIA 2YZ4A 4XBLA 3BU7A 1ULDA 3H9AA 2ID4A 4LBMA 1D0HA 4KG8A 4CU6A 1FOD1 1JYCA 3MZHA 2Y60A 4RGAA 1AR82 2OYZA 1ZZ8A 3OY8B 5F2SA 1UCXA 1MS0A 2FDHA 1VRH2 3S6PA 3KGLA 4LBQB 2DU0A 3ZIXA 3PJYA 4MYEA 5DPNA 5F32A 5JSPA 4WVWA 5FPUA 2GC0A 5F3IA 1OKOA 3ZSMA 3WG1A 5IVVA 3O1RA 1Z7S3 3CZUA 3R4DB 4PIYA 2RM22 5LA1A 2UURA 2XQRA 3Q8BA 4M4RA 1XE7A 1ZA7A 3T09A 5A1LA 3GGLA 2WT1A 1H2LA 1G9DA 5JR7B 3LAGA 1ULGA 1Y3TA 2WT0A 2Y38A 1PNFA 1G7YA 3J7HA 3B3QE 1PIV1 4S2HA 3I3EA 4NIAA 1FV2A 3RFRA 1IGOA 4FP3A 1AR93 4OI4A 3RMYA 1ZBE3 3VBFA 4PDWC 2R16A 5C5UA 1OH4A 4AVSA 5ABJC 5JZGA 2EAAA 2Q1ZB 4DFSA 5FY8A 4Q5OA 1WWYA 4ITCA 1DYOA 3LE0A 2P34A 2FMYA 4FXKB 2KD7A 2OPWA 3LSDA 2DFCA 4FSJA 1O4YA 2D98A 1W28A 2X5IB 1SLLA 1NE6A 4LITA 4RHV1 4XEZA 3T08A 3WNNA 4C0BA 4CDWA 5C9AB 1JZ8A 2G9GA 4FPCA 1VMFA 1GFF2 3RI8A 4AYUA 1TME3 2A75A 1W3VA 4H2AA 3OGSA 1GZCA 4KBBA 1J83A 1RMU2 2G19A 3VBOB 3CJIA 4Y3OA 4AI8A 3KF5A 2LUWA 3ME2A 1T6BX 3K75B 3ZYPA 5B2GB 3JUUA 3SEEA 5IFTA 2D6NA 2XWJB 4N53B 2VZ1A 2BVBA 2RR13 1MEC1 1KD7A 4F7ZA 1CWPA 3FUQA 1C8M1 2VG9A 4AHWA 4B29A 3X29B 2ZAHA 4BMEA 2IXCA 2XDVA 4CUGA 4LO5B 1CR7A 3IDEA 1JH5A 2FDGA 1O4ZA 2YG0A 3NW4A 1QHDA 3POBA 4LHSA 2YXSA 3S7EA 3W59A 5FO8B 2KA3A 2HWF2 3NQHA 2EA7A 4LO7A 4MXWB 1LEMA 2RS52 4CCNA 3VN4A 1F5FA 3U07A 2QQLA 1A8MA 1VE0A 4YFZA 1N47A 1YWKA 4RS5C 3LWCA 5DG1A 2AEYA 4DRVA 5FMDA 2VBDA 1DBNA 3ITQA 4I30A 2CWSA 3VBHA 2YY1A 2XQXA 3RZJA 1GWMA 2QFEA 3GZEA 1AF9A 4GB33 4FXGB 3EHKA 4JGYC 3WVJA 5A3UA 3C7HA 3VKLA 2Y6JA 1Z7S2 1UZVA 3LA3A 2WNUC 2E6VA 5KHGA 2Y26A 4NJ4A 1JYVA 4PJYA 2PHWA 1W6NA 4AEDB 1IZ3A 4HVQA 3RWKX 2PQQA 1WMDA 2RVAA 4O9GA 4IE5A 2Y0OA 3WNXA 1ST8A 3ZFEB 2WR9A 3ECQA 2XHNA 5F1RA 1IG0A 4Q0QA 5BNQA 4F8AA 4CU7A 2AGSA 2VUDA 2ZGPA 3H1WA 3SKVA 1DU3D 1EUUA 1AR92 1LJ7A 1ND3C 1W3XA 1YQCA 2R0FA 5DXDA 5FAXA 5FP9A 3K2OA 3JQWA 4IESA 4QQ2A 1GR3A 2B46X 1GUIA 1RUI3 1SLIA 1BMV1 3I3DA 3ZKYA 1NCRA 1BHGA 3J7NA 3ILNA 2B8MA 1OC1A 1KS5A 3I54A 2HWE3 2EXIA 5FYBA 2WYSA 1QEXA 3RYRA 1K45A 2Y6GA 4DQAA 4GWMA 2A7AA 1YXWA 5FZ4A 3LQCA 2C24A 2QE3A 1HRI1 1KXGA 2LROA 1LRHA 1CVNA 2AEZA 4P02B 2DUQA 4DXTA 1OFSA 3F95A 3O0VA 5LK5A 1LECA 4A44A 1TME2 3HJRA 1RTVA 1LOAA 4YVWA 3KCCA 3M3CA 2QUOA 3N7MA 4XFGA 5FJHA 5FZ3A 4FAHA 3LGRA 5EJZB 4YG3A 2VQUA 2V72A 3T2PA 1COV1 3VBSC 2ZHLA 1C1FA 1LULA 2VBPA 4NPLA 4BXFA 3MO4A 1BZWA 2RR12 4KQ7A 5FYZA 1RUE3 4AFCA 3HBZA 4ET7A 4Z82A 2CHHA 1AJOA 4XQDA 3FN9A 3WW2A 2O0OA 2AC1A 2VPVA 1RUF1 2XPJA 4NO4A 2JIGA 4META 2X05A 3D4KA 1CZTA 2WO7A 3CDZB 4H14A 3T4HB 2JE7A 3VBFB 2WO1A 5FZ7A 3WP6A 3H7JA 3I2FA 4KU7A 5JXHA 1R1A1 4JGZA 3W9AA 3ZOIA 5LW9A 1X7NA 1D2QA 4R4ZA 5A7WA 4D8MA 5JZGB 1JOJA 4XDQA 2RV9A 2QQNA 3FX3A 4RFRB 4XF4A 5E1RA 2VH9A 1DZQA 2RMU3 1DQ4A 1VBD3 2A6ZA 3WNOA 4OUEA 3SLIA 2ZHNA 4B1MA 2AR6A 1W2OA 4Q4Y2 1PO23 2GSYA 3PJQA 2DCYA 4EROA 4GB32 4CDWB 2D6LX 4IQPA 3WNLA 1OA2A 1QJY1 3O1UA 3ZFGA 4IV3A 5G04L 2CAVA 1MVQA 1WGPA 1KITA 1W6MA 5K9YA 3IAPA 5EHDA 1O5LA 2WSUA 2VBBA 3CJIB 1PVC2 2EICA 2UWCA 1H2NA 1C3HA 2IXKA 3I2JA 1HX6A 4W6XA 4QM9A 4X8PA 2HEVF 1LCLA 2DU1A 4QQHA 4CP2A 2WZEA 1K5JA 2HYKA 3BALA 3MLJA 4GKXA 4AFBA 5FXXA 2Z5WA 2F6BA 1OF4A 1QY4A 2XVLA 3WDWA 3M3EA 4C8DA 3IDBB 4CEWA 4EE2A 1Q8PA 1GP6A 5C33A 4P9IA 1PO13 4XILA 3O1SA 1YFXA 5E88A 2DWRA 1F4AA 3KHBA 2NQYA 4CEYA 1W2NA 3RZHA 2PLV3 2HWE2 1AL0G 1AX1A 1Q56A 1HRV3 4Q8KA 2ENRA 1CJDA 4S2FA 1PGL1 2RDQA 1VBB1 4XABA 1OLMA 1REEA 3U4SA 4M3CA 5EWSA 3KT1A 3K77A 3VBHB 3ALQA 1E5RA 2E53A 3PHMA 4CP1A 4FBFA 1QKQA 2EIDA 5EJ1B 3PMEA 3L9JT 4XF9A 3UK9A 1UN1A 1LEDA 1SG3A 2WO3A 5FPXA 4XAEA 2VC9A 4JQTA 1SPPA 3SC7X 4QX8A 3M4FA 4CDUC 2EALA 1W6NB 2WAAA 1RUE2 2QQPA 5LA0A 3WQ1A 3BTXA 3W5MA 4HVRA 4BIFA 5JMCA 3PIJA 2XG3A 2Z79A 1H30A 1HLCA 2OIIA 1H1MA 3DYOA 1RIRA 1YQ6A 4V2WA 5DZEA 3PUQA 1MACA 3MDPA 2WZ8A 5I8YA 1PX4A 1H1IA 1UKGA 2K9ZA 4RD7A 4COYA 2VNGA 4AXOA 1RUD2 1NCQA 1NCRB 4XYXA 1OPOA 1ZBA1 5GZFA 1QXJA 1RVF3 3RNSA 3VBUC 2P3YA 4COUA 3VZJA 3A23A 2RMU2 1RUI1 4Z2AA 3ENRA 2C9KA 5EIYB 1GWKA 5I8SA 1DGRN 5C3RA 1VB4A 1GQGA 1OD5A 1KFUL 4LBJA 1PO22 2YFUA 5F5IA 4EN8B 1LOBA 1XYPA 3GM8A 4YWAA 5FZLA 5A7OA 1RUNA 3WDUA 4MO3M 1W8WA 1CAXA 1FNZA 2P5BA 3I7DA 4YVWB 5JI7A 3PVEA 3UT0A 2QZ3A 4NHXA 2VMDA 5LRRA 3RDIA 1ZRFA 3O0WA 4P08A 3AKRA 2PMWB 4AAXA 2D40A 2P17A 3IBMA 3HQXA 1SZBA 2FBEA 3DXTA 4NHYA 4ONUA 5L73A 3CEWA 5FR3A 4XJ9A 4ATFA 4CDXC 1E5SA 2IVIB 4JTNA 3FWEA 1Y43B 2VVEA 2GP3A 3S0MA 5AC91 3N35A 4CCLA 2WYFA 2XKPA 5KBFA 5FO9B 1XE8A 5BNNC 4ATEA 1PO12 5A70A 1ENRA 3RZGA 3WD5A 2R6QA 2Q0AA 4TLFA 4UT5A 4ASLA 5M0TA 3RZZA 1YHFA 1RXFA 2VZPA 4JGZB 2W2IA 5A7WB 1PMJX 2VZRA 1HRV2 1UY1A 2CNAA 3LEIA 3POWA 5FZFA 4QQOA 1S2BA 4FVVA 1WUVA 1GQPA 1YCIA 2VE1A 4PHZA 3DXUA 3J4UH 1E5IA 3AZYA 3PU3A 4FPHA 5DZGA 1O4TA 3NNFA 4KNCA 4YVSA 5HXVA 2E51A 2D93A 4GH4C 4X8NA 3O1TA 2E26A 5HCFA 3MBWA 1VBD1 3JB4C 3QCWA 5CKQA 3ZFGB 1HQNA 1UKRA 4IV3B 4YSFA 1W6MB 4NWWA 4YM1A 4ZXKA 1E5HA 3CF6E 1O8PA 4QPIA 1SLBA 1EUTA 2GC2A 4Q4X3 4DO0A 1EAH3 3O1VA 3WF4A 1I3HA 1MZFA 2WIIB 5JIUA 1OOPA 2PA7A 2BBVA 4NUBA 4IEQA 4R8HA 3SCGA 1GLHA 1SCRA 1US2A 1M4WA 5FMBA 4B4PA 3CJXA 4N9IA 1AR71 1RUG3 1MQTC 3CL1A 5F5AA 4B7EA 2HWB1 2WFF3 2RS12 4YRDA 1W0PA 2D6OX 5A3NA 5K0UC 1UU5A 3AC0A 2J1UA 4QDRA 3PL0A 5GLTA 4CEWB 2OW4A 1DZRA 1SHWB 4YW2A 3SQOA 3WDYA 5C70A 1V6KA 4BDVB 3RZLA 2Y0IA 3FFQA 4JX0A 1RVF2 4CEYB 2FZ2A 4Q4W1 3TN91 3ZYIB 4Z8BA 1RUJ1 4O9EA 3O1OA 1ZRCA 4N8MA 3DKWA 4Y26A 2Q8CA 2GH8A 1UMHA 4JVAA 3UNPA 2DDUA 4EZ4A 1U12A 5IT6A 4M3CB 4N43A 3WQ7A 4Z07A 2VZ3A 5JXIA 3BTZA 3D5OA 2VW2A 2D3RA 4GALA 4RGGA 1MS1A 2PQSA 3CIHA 5HBAA 4FT8A 3IAQA 3SISA 2A73B 3R4UA 5TSWA 2W91A 2GP5A 4OHYA 4D69A 3Q9OA 1SPPB 1WCUA 2JG9A 1QJU2 1HXS1 1XRUA 1STMA 1JU4A 3TEWA 1VBC1 1VMHA 4E2SA 4Y1ZA 5ACA3 5CFDC 4R9BA 4JHZA 1NLQA 3O0XA 5L9RA 3N36A 2IXHA 3MUY1 1KS4A 5FLHA 1F2NA 5FTTC 4E2GA 2BRTA 2OQ6A 3IT8A 4ARXA 1K3IA 3DCQA 5FZEA 4FFIA 1OMIA 1VB2A 3T2OA 1JU3A 1TMF2 2ZEZA 4LHKA 5ANNA 3ZXKA 4A41A 1GKBA 3FLPA 1CZSA 1QNWA 3TEZA 1LTEA 3MV01 3POFA 5FPBA 1W90A 3O14A 1NCQB 5F37A 2FDKA 2DFBA 4QHBA 1NAEA 4Q0VA 4C90A 4NIDA 4QXHA 4OUMA 4LHLA 4MXVA 5I0SA 1KDKA 5IFPA 3GZUC 4FQ4A 5FBZA 2W47A 1YFYA 2ZGNA 2X29A 2WZPP 5IVJA 1OQDA 1ULFA 4IEWA 3NO8A 3LD8A 3H50A 1UAIA 3E5XA 1XNDA 1CJPA 4CDQA 1F5JA 3A0NA 4OFGA 3T0BA 1CAXB 3APBA 3C7EA 2GNDA 1LODA 5A3LA 4Q4X2 1WMEA 3AJYA 2BWAA 1G86A 2WO2A 5FUNA 1S2EA 1LHOA 2BGCA 4IV1C 4AFAA 1O3SA 1VAKA 1N1VA 3VHOA 1CPNA 1RUG2 1VAVA 2NMOA 1HB4A 4BXSV 4HT1T 2DCKA 1JYXA 1CAWA 1DGRA 2TBVA 4XCAA 4XJWA 3SCFA 2XHKA 2R7EB 1H4GA 4XF0A 1IPJA 2RS33 1W8HA 2B39A 2P2KA 4BISA 1LKNA 2GU9A 2JDMA 1HKDA 4UFLA 3ZM8A 4P14A 3SITA 1S0BA 3KV4A 3KZ4C 1U5XA 4TYSA 3QD6A 1BEV1 4LOTA 4YM0A 1PM7A 2H6CA 3AYEA 5GLUA 4LO6B 1LAJA 2D5FA 3WCRA 2D6PA 3VZOA 1UO9A 1VP6A 2ZZJA 4EN0A 4YVSB 1AVBA 4UW3A 2ZOEB 3AP7A 5BUVA 2X10A 2VOVA 3OG2A 3PVNA 1QQP2 4WVVA 1RC6A 3HNYM 4L97A 4LHNA 3WF3A 4K9SA 4EQVA 2MEV3 4OI0A 4QPIB 1VRBA 3K3OA 4Z92B 1H9WA 4C0HA 2NLRA 1BKZA 1OFNA 1OVPA 3B9CA 5ACA2 3E6BA 1NKGA 1M06G 1OOPB 4AW7A 1X9TA 1UIJA 1J3QA 2ORXA 3RSJA 4F83A 4CCDA 4RR3A 3ZKUA 1EAH1 1S2KA 4C91A 4DNYA 5FZBA 3GF6A 4P9WA 3PUIA 4XXPA 4IERA 5A7PA 1UPIA 1FOD3 1XBFA 1NQDA 5A7NA 1H1AA 3OUIA 1DHKB 4JDOA 5FY4A 1SEFA 2WBKA 2WFF1 2WNVC 4ZY9A 4GZ9A 4LEJA 1JZ5A 1RUC1 2E9QA 3M70A 4RFT0 5ABJA 2VD7A 4YGBA 1F9KA 5DAWA 5A6XA 3BVCA 4BYYA 2XJVA 2H0VA 3VD9A 3H8UA 4N43B 4XJAA 2ET1A 2Y64A 3AB0A 4ARYA 2AYHA 2I45A 4LO4B 5GLVA 1W2UA 1O5UA 4UFIA 1I6XA 4KGQA 4OZXA 4QX7A 1XNBA 5EPAA 3WZ1A 4AVVA 1U5ZA 3CMGA 4WM7A 1S0FA 1I9RA 2WT2A 1BCXA 1PGW2 2C6SA 2JG9B 1C5IA 1W39A 5GM0A 1IG3A 5CG8A 5FY7A 3SH4A 3SH5A 4FAGA 3MIBA 3H8OA 3NVCA 5F3GA 5CFCA 3HR9A 5FBJA 2VUCA 4OHWA 5I93A 5F39A 2GC1A 1VR3A 2QCSB 2RS32 3HQUA 2P4EA 5LA9A 2Y8KA 4RHV3 5CIRA 3I4IA 5D1IA 1JUHA 1OH3A 1BJQA 1HN1A 1WCDJ 1F8VA 2RHPA 4CCOA 3NMBA 5HV4A 5J37A 1MS8A 4PIXA 4UAPA 1XU1A 2HYXA 4YPJA 1FXZA 2XJSA 4RS5A 1IPSA 3DPRA 1JTZX 2XJQA 1MEC3 3GXUA 3IDAA 3LCPA 1ZX5A 4CDQB 2UU8A 1RINA 1V9U2 1C8M3 1H0BA 1NG0A 1PNGA 2PHLA 3B7MA 3ZYGA 1A8DA 4DUWA 4HBNA 1HV1A 4J1WA 5C4WC 4QKBA 1QXPA 3T0AA 3WV6A 4DRRA 3AL6A 5LY1A 5J48A 2WNUA 3QACA 1W8TA 4F3JA 5DDJ2 5KWRA 4BQXA 3EMRA 2R062 4KBZA 2XLAA 1NYWA 4RQPA 5FYHA 2DYCA 4AFDA 1CAWB 3ASIA 5L7OC 4IXLA 1ZREA 4M00A 4AI9A 1FOD2 1WW6A 1ND3A 2W46A 3KB5A 2OQ7A 3IWZA 4QKFA 2OZJA 3HD8B 4BQ2A 2F17A 1D4VB 2OUJA 3UV9A 1BK0A 2BWCA 4OHVA 1CONA 3IMNA 1AYM1 2B4KA 4KMQA 3CU7A 5ERLA 1FX5A 4XURA 2XXZA 3VHRA 3VD4A 4P9LA 2WABA 3ETQA 4NRPA 4YYOA 2XB6C 1UZZA 3OBAA 2G4IA 1WD3A 3MF6A 5CEHA 5DUWA 2NN8A 2C9AA 3ACLA 3GCXA 3RZKA 4YGEA 3U75A 4AQSA 1I5ZA 4OQ9A 3MIDA 4IGPA 1PIV2 1R1ZA 1S55A 3BGAA 3CO2A 4I3GA 5EJ3A 3THPA 2BP6A 3ACFA 5SV5A 1RXGA 2QKDA 1EP0A 2WKKA 4XQ4A 4DZGA 1DLLA 4XVHA 5A3MA 3ZN4A 4I3PA 1X9PA 2FQPA 4MH0E 4Q1PA 2F4PA 4E4SA 1DLCA 3AKQA 5L36A 4YZ3A 3ZXFA 1YQ8A 5HPOA 2MEV1 2IXIA 3ZYBA 1AUYA 1W9YA 1VALA 1WW5A 4RR3B 4Y20A 4A6SA 1JHNA 2ZCWA 5J98B 5LBCA 2I74A 1YEWA 1WZXA 4RHV2 2EIGA 4GAZA 1HRI3 1QJEA 4FCAA 1VIWB 4YFWA 2VULA 3FBMA 1WCKA 2P6CA 5FWEA 1D2SA 4PF5A 3K4AA 2QZ2A 3B69A 3LPFA 5BNPA 5DUVA 1U5YA 1COV3 3AX4A 1AL23 2R30A 4LBQD 2ZXQA 3RPQA 1R091 3VDDA 5H9RA 3VL8A 5DQ0A 1XSRA 2YFZA 1MEC2 1XU2A 1G9CA 1ZZ9A 2XJPA 2R49A 4WZFA 2ARXA 1C8M2 3TBDA 2XVKA 1ZRIA 2DTWA 1Y7BA 3T2TA 3QOPA 3AL5A 2W94A 1RUF3 1BK1A 1ZNPA 4WM7B 3HMYA 4FOYA 2DCJA 3V0AA 1WCQA 4L92A 1R1A3 2NYYA 4JCKA 5FZAA 3BUCA 1JZ4A 3ACIA 3MUZ1 1AYN1 2NM1A 3AFGA 3KM5A 4V2VA 5CFCB 2J1EA 5GZCA 5KXDA 3GHMA 2WQ4A 1SFPA 3TRSB 3U1XA 1V6IA 1U5IA 2W87A 3VKOA 1Q8SA 3IKWA 4SLIA 3AKPA 1LOFC 5AFBA 3N4MA 1W6PA 1W9FA 4FFGA 4WBBA 1J58A 3ZLIA 4GQ7A 1QJY3 2IFWA 4BM8A 1S4CA 4HKLA 4CVUA 3SXWA 5IAXA 2NZ9A 2QQKA 3ETPA 4FFHA 1PMHX 1VBA1 3KHCA 3U4XA 3PUSA 1GQHA 1OF3A 1KQRA 1Q8OA 5DAVA 5CBLA 1H2MA 4OLLA 4RS5B 3N9OA 3I2OA 1ZVFA 1G9AA 3DPRB 1ENQA 1KEXA 3WLUA 2VQAA 2DUPA 3POJA 1WW7A 1CX4A 1UW8A 1O6UA 2QQUA 1UZWA 5JAXA 5FZOB 2Q8OA 4YW4A 3VV1A 3OUJA 1NX9A 3NL1A 3SCHA 3K48A 4JKLA 5JWPA 1QOOA 4UW6A 3W20A 1BMV2 3R0RA 2WNUB 4ZKTB 1SDDB 3RJ2X 3SKJE 1UD1A 4OMDA 2GNMA 3BU0A 2C1FA 3ZXJA 5JOYA 1B35A 4RQPB 5FREA 1YO8A 1SMVA 3H3LA 1IKPA 1QH6A 5JOXA 5T5JA 4CUCA 3TEYA 1U0AA 1VBB3 1HRI2 4FOWA 1CX1A 1EV11 2BFUS 2JDHA 2W5FA 4E9KA 1ND3B 2G9ZA 3ORJA 3I3BA 4ZU7A 4YGDA 1NQJA 2Z69A 4HKOA 1W8NA 3VBUA 1COV2 1PX3A 4M0HA 5ISLA 1F4HA 4OHZA 1MZ5A 2EF6A 4DY5A 4MADA 4PF1A 5APAA 1XYOA 1REFA 1S0IA 1W6OA 5HCBA 2CYFA 1SBEA 4LULA 2JD4A 5F6KA 5C71A 1GNHA 5D2AA 4ASMB 1Y9QA 4FPOB 1JYNA 3KQRA 5LBBA 3UKVA 4XFIA 1NE4A 5FOBB 3MFCA 5KHJA 1RUF2 4IUGA 1R083 4DB5A 2YDEA 3MIEA 4YZ2A 1NA1A 1FV3A 4LTAA 4MHUA 4WV8A 5LEKA 4Y1YA 2QQMA 2K0GA 1MPXA 1R1A2 2OKXA 2YBKA 4BWOA 4LPLA 2VVDA 1ZBA3 2VMGA 3NNLA 3KT4A 4HZFA 1ZBE2 4CDXA 1REDA 3GYDA 4XFAA 1GZTA 4Y20B 1NXD1 4E8DA 2W9XA 1W03A 2HBTA 2IZWA 2JDNA 2YHJA 4AGGA 3P1IA 3W58A 3P3PA 5IWFA 4AEMA 5BNNA 4MGTA 2MHFA 3NV1A 2PHRA 1QJY2 2LS6A 2YC2A 3NV3A 5EV7A 4L2NA 2EAKA 3OGRA 5GJ6A 2DURA 3GALA 2XVGA 4COWA 5EYYA 3KWVA 5BNPB 3L2HA 1BXHA 2ERFA 3AZWA 5JXJA 3IPVA 1LGCA 2VXRA 4N7UA 3VDDB 2PAKA 2BBAA 5T50A 4U36A 4IEXA 1X8MA 3WW3A 4WVZA 3FLRA 2VZSA 4YG0A 1AL21 5CB7A 4E4ZA 1V6MA 5AC93 4OI2A 4QPGC 2Q5TA 5BNOC 4DEVA 4K8FA 3AM2A 4DMIA 2JDKA 5LRSA 2JXAA 3V0AB 1AX2A 4IEVA 1BBT1 2LTNA 1NY71 4CA9A 2UYBA 1W6QA 3POYA 2A6XA 4E4HA 2WL1A 3VDBA 3B01A 5C3OA 3OBZA 3AYDA 1QJX3 1VBB2 4XZPA 5FKCA 3ZFEC 1PGL2 5FK7A 1SBFA 1UOJA 3CBNA 4Y5TA 1SCSA 2RJ2A 1SACA 5LEJA 1W6PB 3ES1A 3AZVA 4LOSA 2GN7A 1PVXA 1GSLA 4EN6B 3EB7A 1FMD1 3WG4A 4R9AA 2VCMA 1FPN3 2GC3A 5FOJB 2DVAA 5C3PA 2VMHA 1GOGA 3PTRB 1XC6A 3RJRA 3NNJA 2JX9A 1C4RA 1O91A 5FZ0A 1LESA 4XTPA 3OGGA 3RVHA 1L7RA 3M3IA 5FYCA 5DAXA 2HBUA 4BIOA 4BU2A 1AR73 1SFNA 4R4XA 3PVOA 4TWTA 3E5UA 1C57A 3LB9A 3D8CA 3SHRA 2HWB3 3USUA 3I2IA 3MHZA 1MS5A 1ZZBA 2RDNA 3I3MA 3HIFA 5BXXA 4OULA 2ZJCA 1UOFA 1KRIA 1OBNA 2XONA 1DGLA 2D3SA 2HWD3 5LA2A 3VKFC 1ZBA2 1J84A 1V6OA 1J1LA 1UYXA 2WN3A 4B3NA 1OLQA 5C5TA 1W06A 4Q4W3 5CFDA 4HONA 1C8NA 3TN93 3MICA 1VBE1 1RUJ3 1JOBA 1WLWA 2HH9A 1RUI2 2VU9A 3JD71 1B35B 4FO9A 2VZTA 4PBPA 4BQ5A 1QDOA 4XQWA 1W2TA 4UFMA 2QBXA 4MG2A 4ZXEA 5A6ZA 3OBTA 2ZA9A 2VOTA 2ZKNA 4HSLA 2VNVA 4Y1UA 4Y5Z0 5LY2A 4XJUA 3SEPA 1UF2C 2Y6LA 3VKNA 2V4AA 2WA3A 1LGNA 4A7ZA 3BKZA 4AQ6A 3VBUB 4HMZA 3VBFC 1SLTA 5E8AA 4ZU4A 2GAUA 1QJFA 3C7OA 4CP0A 4CPBD 5JZGC 1HXS3 5IK5A 1CAVA 3OD4A 1B09A 4QKDA 3RYKA 3V56A 1VBC3 4IW3A 1G9BA 3FHQA 2ZABA 4H3WA 5J7MA 2UYAA 1W6OB 4HOOA 1OLRA 4QB1A 4AVBA 2VECA 4IE7A 3T1LA 5AC92 3U10A 3KV6A 1IS6A 2ILMA 2CDOA 4YW5A 4BPZA 1HW5A 3DN7A 2E32A 3B5LB 3I2HA 1NA1B 5FWJA 3AMPA 1O8SA 1W0NA 5C6CA 2XLGA 1P8JA 5FZGA 4N7IA 2CDPA 5KXBA 3CJIC 3J9SA 1GV9A 3LOIA 2WDBA 1R081 2XLFA 1ULPA 2OUHA 2Q4SA 3I2KA 5K7PA 3JBG1 4XMAA 5LB6A 3RZMA 4WVMA 4CDXB 4EWDA 5DAPA 3RGBA 4BQ1A 3WDVA 2R041 5HCHA 3E1F1 2CSGA 3SNMA 3VHNA 2B7YA 2VO5A 5IK4A 2ZX2A 1DGWA 1XNCA 5BNNB 4LO8A 2AACA 2ZACA 1IS4A 5FYTA 3ILFA 4S2DA 4IEUA 1H4HA 1VBD2 4XIOA 5FZIA 2BOJA 3I3QA 2FMDA 4LNVA 4D0QA 1CD3G 4OI1A 2P37A 4U2AA 4FTSA 2BGOA 2ZBJA 3H42B 4A7YA 1OVSA 3LFIA 3IPVB 5EFUA 1NXMA 5FCCA 5FYVA 3H8RA 1V6LA 3I2GA 1AR72 3GJBA 2KR2A 2QQIA 2VUAA 1DG6A 3VGIA 4AHYA 2OA2A 2HWB2 5IJRA 5IVFA 3VBHC 1XXNA 5DN2A 3BIEA 1ZRDA 2D6MA 1DYKA 3IB3A 5HV0A 4NRQA 1YQ2A 3ZXEA 3NJXA 2XL7A 4LK6A 5A1FA 4Q4W2 1FATA 3TN92 1OA4A 1ZYBA 4BQ3A 4D6RA 5J96B 1RUJ2 2ZGLA 4XUNA 1W6QB 2ORZA 1L7QA 2V73A 5FZ9A 1RJ7A 2WQZC 3ATGA 1BEV3 4RN5A 2PXJA 2W08A 1EY2A 2GMEA 1JHJA 3NAPA 4Q4V3 4DXZA 3ZXGA 1ZM1A 2PLV2 5FDBA 2BVVA 5LZ6A 1TNRA 3MPPG 5FMOL 5A6QA 1W99A 5FUIA 3SH3A 5FP8A 2A3WA 1QJX1 4CZSA 1D7PM 1G9FA 2ZMKA 4IE6A 5GALA 2WNOA 1TE1B 5D8AA 4DOUA 1GP5A 5A3WA 1NZIA 3I8TA 3M1HA 1NCRC 1HXS2 1VBC2 2ES3A 2FZ1A 2ZEYA 4G9SB 4XW3A 1ND2A 4QHOA 3BCWA 1PK6C 1W0OA 1PGSA 1FPN1 2HWC1 3WW1A 1A34A 1ACCA 2GNTA 4QWNA 3USUB 1Q8VA 1KFXL 1RUH1 3H1MA 3ROUA 5FYIA 3POSA 4URAA 3D0JA 3O7OA 2XWBB 1UMIA 3D6EA 3VKMA 2CU5A 1X33A 3B93A 1OQEA 2BNMA 4JC1A 2NPIA 4BK4A 4ZU5A 1DIWA 1GNYA 1N1SA 2XKOA 5CFDB 1RUC3 1OLME 3DYPA 4XAAA 5C7GA 3CZJA 4M3CE 1D0GA 4TLGA 4QDSA 2ZAAA 3WDXA 1TNFA 5DUXA 2YMZA 1HDKA 4JHTA 2J22A 2HWD1 3KVAA 1DFQA 3BPZA 4DXRA 4R52A 1SBDA 3ABZA 1MZ6A 5JMOA 4LA3A 1W8FA 3URFA 2LRPA 4FFFA 3ZFFA 1UYZA 2HLEA 2A5ZA 2G1MA 5FRAA 1GP4A 4PT6A 3DV8A 2OPKA 3MI8A 3ZDVA 5F3EA 1OT5A 3U11A 2EXHA 5FXWA 3K4ZA 5DAQA 3BYWA 1H8TC 2A1XA 3BOPA 1CAVB 5F8PA 1FYUA 2RDRA 3ZDSA 2AENA 3BIWE 3V0BA 5JR2A 4GJYA 2PHFA 2W0XA 3PIGA 4RSUA 2GMPA 3MEPA 2A3XA 4G3YC 4D7SA 3CLPA 1S0GA 1Q5OA 2WJSA 5JUVA 1XB9A 2DVDA 4HN0A 2IFRA 4PLNA 1JUIA 4YW1A 4QXCA 4ZZ8A 3QLQA 4AI1A 1H6YA 3OPWA 4L11A 2W1WA 1XQNA 3OD0A 2ARAA 3LZZA 1UOGA 1YI9A 1DQ5A 2VCBA 3AVSA 4Y22A 5J09A 1KJLA 1BEV2 3ZYJB 2JE8A 4BZ4A 1IPKA 3NNGA 3SMHA 4AGRA 4WVMB 3F2ZA 4IEOA 2BU9A 5FK8A 1WLCA 5C8CC 4TSVA 1J3RA 2VUJA 2VOXA 3ZYHA 3OYWA 1K5MA 1DP0A 4QQLA 3OGVA 1SDWA 4CEWC 5IATA 4GA9A 1JOPA 4BK5A 5IVBA 2V09A 4CUAA 3GZTB 1WBLA 2J1TA 2VXJA 3MGUA 4CEYC 4Y24A 3W21A 4YW3A 5B4XA 2ZGKA 4FPJA 3ZR5A 1DGWX 1RHI1 5JSRA 4FOVA 2WS93 3JB8A 4ISQA 3TNPB 2DUOA 3PURA 3ZYFA 4A7KA 3RG0A 4QM8A 1EAH2 5BV6A 3PDQA 1APNA 4I01A 3KCYA 3INAA 2RS11 4UW4A 5JPNB 5IK7A 1HV0A 1QMJA 2LW8A 2HJIA 1YFUA 2XR4A 3BODA 3S57A 1MVEA 2JDZA 3OPZA 5J3UA 2WFF2 5CISA 5JOZA 4NIHA 2R1BA 4QGLA 1LR5A 1RUC2 3DGTA 1CAUA 1AYM3 3VDAA 2ADDA 5FXZA 2R071 4MVTA 1ODNA 3NAPB 4HL0A 4XTMA 2VZQA 5CAZA 2WN2A 2W3JA 5KC5A 1CPMA 5A3TA 1TEIA 3DECA 2J1RA 2Z42A 1JODA 4Q4V1 5A7QA 4A45A 4JKMA 5D8AB 3R4SA 5IVYA 2Q8EA 3I59A 4EN9B 1W8UA 1JW6A 1NCQC 3OB8A 4SBVA 3N9LA 2VOKA 4Q8LA 1JI6A 3EO6A 5EP9A 1ND2B 2YYOA 2QTWB 3A22A 3FHAA 2Q8DA 4LK7A 1ALYA 2ETEA 4ISRA 4AR2A 1UY3A 3FJSA 4MOAA 2YU2A 4HK9A 1JYTA 3HOBA 3RMXA 1JXNA 3B02A 4AI0A 1YC61 4XBQA 4Q29A 4QMAA 3MV11 5C8WA 2VTXJ 4LE4A 1UYYA 5FZ8A 2EVXA 4W4ZA 1N3PA 1VMJA 3A7QA 5CG9A 4GIQA 3AP6A 3NV2A 3LSEA 4B8EA 4CXYA 4CUBA 1V0AA 3O1MA 1LHVA 1R093 4QX0A 1Z0HA 4O7XA 4PDWA 5JVVA 1T2XA 5C3QA 3T30A 3MW3A 4B7KA 3AKSA 4QX3A 4XMIA 1ULCA 1LOFA 2P3JA 3KS7A 3ZFFB 5KXCA 1ASJ1 4LBOA 4V1PA 5A80A 4INDA 1XOYA 5FJKA 1GMMA 3WR0A 1F35A 3ZSEA 1N3QA 1HJGA 2VW0A 1DF0A 2VMCA 3NKGA 4JTOA 2GZWA 5F2WA 3RS6A 5JOWA 3V0BB 3IN9A 2VM9A 2CY6A 4DUXA 1AR63 1AYN3 1YRZA 2GALA 2JG8C 2VY0A 3AK0A 4GMP1 3K3NA 4AFMA 1VAMA 4YVSC 3ZYRA 2B42B 3VZMA 1RB8G 4NROA 2BUKA 4UYBA 3FHIB 4NOTA 4LBQA 1OD3A 2A3YA 2B45X 3O5SA 3KQ4B 4QPIC 5FPVA 4LA2A 1AYM2 2WNEA 1YUDA 1JZ3A 2P3IA 4Y22B 5GZEA 2B9VA 3TAYA 3M8LA 2ZPXA 4LT5A 1V70A 2WWJA 4Q0UA 1XNTA 1VBA3 4XBNA 5JI9A 4MX3A 4EWAA 4ZHNA 2V5DA 3R05A 3MLKA 5IK8A 3OYWB 1K5MB 3WF1A 2Y33A 4CE8A 4PIZA 3PVBB 4J25A 4NPMA 2QQWA 4FPKA 4BQ4A 5JXGA 1QF3A 3CNAA 2A6WA 5T54A 2VJXA 3WG3A 2XBO3 2WLPA 5LATA 2ZHMA 4GMP0 3P6BA 4LIUA 1VJ2A 2BERA 1XNKA 2VMIA 1IKQA 3AMHA 2QQOA 2MEV2 1QDCA 2ET7A 2GH2A 3I97A 4JGYA 1KJRA 4D94A 5FY9A 3AYCA 3OF1A 2AUYA 4N43C 2YGMA 3D0SA 2WS91 1US3A 1V6NA 1EPWA 2ZMNA 5I0TA 2CV6A 3HWJA 1EV13 2QVSB 3M3QA 5JCTA 3WSOA 1DZTA 2HEWF 3WUCA 1UL9A 1WLTA 4LR4A 2JG9C 4NAOA 1CAUB 4CP9A 5F7UA 4P9YA 4Y1VA 1O3RA 1AZDA 4WM8C 3MIHA 3VBRC 4C1XA 1ZZ7A 4L99A 4Z1VA 5HCAA 1R092 3ACHA 2ADEA 2UY8A 4GULA 2YGLA 4ZPIA 4PCRA 4HPKA 1IQAA 2W1UA 4AQTA 2UWAA 4ASKA 2FCUA 4LXLA 4NRMA 2ZX0A 5FP7A 4XZUG 2J7MA 3AMMA 5A33A 4K6BA 4XHBA 1ODMA 2ZGOA 5C3SA 5I0UA 1Y9GA 4Y33A 3I59B 4UF0A 1J59A 5I91A 5CVRA 3S7IA 3THCA 5H9SA 1POV1 3VDCA 1OPMA 2E7QA 4UI9L 1HQWA 1AYN2 5LBFA 3H0OA 4TN7A 2ZGTA 1BVP1 4A2UA 2R0HA 4QXBA 3WG2A 3VBSA 3GJAA 4XDPA 1NLSA 3OSDA 2Q1FA 4J6GA 4Q1RA 3LEMA 1JBCA 4I0AA 4QPGA 1BVVA 2ATFA 4CDQC 1O3TA 1JYIA 1ZA4A 1TQ5A 4KU8A 3PLQA 4CYDA 2ARBA 5BNOA 3FE5A 2FDFA 3LFMA 3Q8EA 2PFWA 1UIKA 4IGOA 3WNPA 2G9FA 4ES8A 2WA4A 5BY5A 2OXBA 2VGDA 4M4PA 3J8F1 4IL7A 2K2SA 4K40A 1VBA2 3M3OA 3PMSA 2Y6KA 5E6HA 2K46A 1V6JA 4IEPA 5KC6A 4QX1A 4PDWB 5A3PA 1S1AA 1XJAA 2JDPA 3OTFA 2GDFA 5ABJB 2A6VA 3BOWA 4LIVA 1POV0 3WHUA 1J1TA 2VR4A 3CHXA 5FIXA 5KHKA 3S5AA 3VD3A 3QH7A 3TNQA 3LEGA 1MS9A 1LENA 2BYVE 4A3XA 2PTMA 2OX0A 4PQ9A 3LDBA 3N9NA 5KHIA 2YBSA 3LPGA 2XH6A 1BBT3 4MGSA 4AVAA 3ZSJA 2C26A 4UFJA 2QDRA 3Q8CA 3WNMA 5L9VA 1A78A 2WZR1 2ZHKA 2BTVC 2ZGSA 3E6CC 1AX0A 2B5HA 2ZGQA 3HEIA 5GLZA 1LOGA 2VZVA 4N9HA 4XFBA 5EYXA 1YQ5A 2JENA 1EV12 5GZGA 1MZEA 3M2MA 1AR61 2H0BA 2X8KA 5FPLA 1WBFA 5A32A 3RYPA 4FPGA 1SLCA 2VAUA 1WW4A 2YUEA 1W9WA 1VLNA 4QX2A 1CN1A 1FMD3 2PHTA 4AI3A 3KMHA 4K1ZA 1LHNA 2OT7A 4MGQA 4XFCA 4I02A 5GZDA 4A42A 4RR3C 1QJZA 3OEAA 2X53S 1WMFA 5CA6A 3AMNA 4LLOA 3CQOA 3UGHA 4BA6A 2HKXA 3MPBA 4JDNA 3ZXDA 5B4NA 3POGA 4CU8A 4EZHA 1DDLA 2YB7A 4M01A 1AJKA 2JB4A 4URTA 5F5CA 1GU3A 5FP4A 2RG4A 4IE4A 2E63A 3C8XA 2MNGA 4CCEA 2JECA 2ZEXA 4PI0A 3UJOA 4FTEA 1A3KA 4OUSA 3NRUA 2XBO1 4JGYB 4GWIA 4QU2A 4BE3A 1VBE3 5AVAA 1LOCA 2FHRA 3JD73 3PU8A 3FZ3A 2ZX1A 3VUOA 1I5PA 5J36A 5FV3A 4CDUA 4CCKA 4AEJA 3ZXAC 2BDRA 3AVRA 3ON7A 1C1LA 1D4M1 4XIKA 2D6KA 2YC4A 4WM7C 2WINB 4K8RB 4CP9B 2ZX3A 5JPMB 1AR81 1L7LA 3JQXA 1VRH1 4AHZA 2JKBA 4QPYA 1JS9A 3N3HA 5CFCC 4HPKB 2VNOA 1DQ0A 4AG4A 5FZCA 1AL22 2D97A 3U0ZA 1TZOA 2WWUA 2W1SA 2KM2A 2RM21 1UXZA 4NVPA 2D5HA 2AH2A 2E7AA 3FUOA 3J7MA 2C0ZA 3ZSLA 4O61A 5A33B 2PN5A 3LF7A 5H9QA 3AMQA 4L8QA 3WF2A 2WWSA 3IIIA 4UF0B 1W2AX 3MW4A 4LORA 1BBT2 4OCTA 1NY72 2X5IC 3WP4A 3HN1A 4QB2A 3D82A 4BCUA 5C9AC 1RITA 5T55A 3JZVA 3H1YA 1RUOA 3JBG3 3PTYA 3KV5A 4XE9A 2J1VA 2JE9A 2Y6HA 5FP3A 1W9TA 2QJVA 3VBSB 2BQPA 2R043 3DPRC 3VBOC 1OURA 1SFYA 1UX6A 4QPGB 1JMUB 3N9PA 3ZN6A 1FT9A 1FI2A 3FC0A 4Q4Y3 4NIIA 3EJKA 4FPEA 5BNOB 3MYXA 2VMEA 5DZFA 4CPBA 4N53C 3LOBA 5H9PA 3ES4A 5ANQA 5E16A 2YPJA 1FMD2 2EXKA 4K7JA 3HVDA 4KGGA 2XUEA 1PVC3 4AE2A 1GWLA 4EYUA 2TEPA 3O1PA 1OSGA 3IMMA 3B00A 4J1XA 1JYWA 4RQPC 2W52A 5FYSA 4CTEA 1GANA 1RMU1 4XPVA 2A70A 1HQLA 4K3UA 1YYNA 5FPAA 2F4LA 4W50A 4XACA 3PUHA 5FMOS 3ILRA 1H6XA 1PHMA 3HBKA 3ZR6A 3AP9A 2R1DA 3I49A 3MF9A 2EIEA 4YZ4A 2PHDA 4KL1A 4GH4A 3GHNA 1RL3A 4DPNA 1H9PA 1VBE2 3JD72 3KSCA 1TVGA 3GBWA 4LE3A 1S0EA 1PK6A 3IZOA 4MHRA 4Q0SA 4CSWA 4HN1A 5LBEA 4D6QA 1QNYA 5CZKA 3C7FA 4IGQA 3VZNA 3NSTA 2UY9A 2HWF1 4XHXA 4QQPA 3AZXA 2ZGUA 2RS51 3K51A 3OCPA 4MGKE 5FY0A 4AEDC 4BQWA 4H55A 1V00A 1R64A 1IQDC 4NWVA 4PLMA 5FYUA 5A32B 3WF0A 2GMMA 4ZONA 1HB1A 1MQTA 2DBNA 3BTYA 3FMGA 2D44A 4FPFA 5K0UA 5EZWA 2W39A 2VMFA 4AOCA 4EJRA 4NIGA 3OJBA 5L19A 3DUIA 3WHTA 2DVFA 1E57A 2VZUA 4I0WB 3WUDA 1Z7S1 2HWC3 3I2DA 3AKTA 1WKYA 3AFKA 4BMBA 4Q2FA 3ST7A 3WQBA 5A7SA 1HN0A 4QAWA 1RUH3 3AP4A 1OKQA 1GYKA 4UFKA 4IDZA 1UY2A 4RA0A 4IE0A 3UKTA 1ZZCA 2B9UA 2QDNA 4MGIE 4AQ2A 1RUD3 5BNPC 1H8TA 3GNEA 1IHMA 2SBAA 1R082 2PHXA 1AR91 3GBFA 3GDBA 5F6LB 3JBG2 1DQ6A 3USSA 1ZBE1 1QH7A 3VDDC 4YNIA 2VTFA 4QX5A 4AZZA 2R042 4BLJA 2UWBA 4OYUA 3J7LA 4P9GA 1YI7A 4CDUB 5BYNA 1UOBA 2JEMA 3BTAA 4Z2WA 3LDKA 5CADA 2IC1A 1X82A 4LUKA 4DEQA 4D7TA 4AGVA 2YV8A 1DQ2A 1QXRA 1YJKA 3G7DA 2XJTA 1IS3A 3VLBB 1NOVA 3DL3A 5DG2A 1FAYA 2D43A 1WD4A 3MIGA 4R9CA 1GOHA 3HT2A 3P3NA 1TME1 4XXAA 4LMFA 2ZZQA 3KGZA 4FOQA 5C8CA 2RJKA 2XL9A 2IVJA 3HNBM 3FL7A 1N1TA 1MS4A 2WC2A 2WSVA 5DABA 2AZ5A 1WMXA 1UX7A 4DXSA 3IDCB 2BOIA 2RR11 5F3CA 2HEYF 3RQ0A 5A6YA 1O3QA 2IWGB 4HKWA 3TB0A 2VTXA 1YJLA 2DBIA 5FZKA 1CIYA 3C7GA 5LCWL 1WA4A 4LBNA 2JB8A 4CDWC 2VZOA 3AYAA 3GBGA 2QNKA 3OGJA 3QH6A 3BPSA 5SV8A 3FFZA 1A6CA 4OQ8A 4IV1A 4MGYE 3ZN6B 4CXWA 1LOEA 3AP5A 3H3ZA 2CTVA 4KH9A 5J1XA 3AXDA 5IAVA 1HB3A 1PMIA 4CU9A 1IS5A 1QJX2 1PM4A 5FZ1A 1C5HA 4A3ZA 4Q4Y1 4TZDA 4KWUA 4YW6A 4GD4A 4UXAA 4GB31 2J1AA 2V5YA 4BJ0A 3HAGA 1MS3A 1RHI3 4Q26A 3H7YA 1B35C 4XF1A 3HPNA 3LKJA 4MUVA 2HWC2 1FPN2 2BFUL 2ARCA 1JZ2A 1PVC1 4H7LA 5FLIA 4XUPA 1F15A 4JRAA 4BHPA 4LKFA 4QHZA 3G6JB 1RUH2 2IXLA 2RS13 5T5OA 1W05A 2CGPA 2FCTA 2VCCA 1CESA 2LM3A 2Z4FA 4JV4A 5AVPA 2BGPA 3WCSA 4UOJA 4M0NA 4GH4B 4UBHA 3VHPA 1L3JA 3JXSA 2O8QA 2XJRA 4UW5A 2RJLA 2XUMA 5FLJA 3QBQA 3KVBA 1PK6B 1UY4A 2R073 2ZS6B 2HWD2 4LKEA 4B4QA 4HSJA 4CCJA 3EYPA 4OZOA 5FMCA 2DTYA 1XNAA 1XSQA 4MSVA 2HWE1 3TEXA 4FPLA 4K1YA 2JDYA 2DCTA 5K4LA 3HT1A 3T0DA 1AHSA 1NA1C 1MQTB 1HIXA 4ORFA 1NT0A 4CCCA 4E4DX 2JKXA 3EBRA 3T2QA 5K0UB 5FXVA 1JZ6A 1GNZA 1MR5A 4JQRA 2DCZA 1QJU3 5FKBA 2OVUA 1KGYA 1OHFA 3B94A 4YZ5A 1URXA 2X09A 4QXKA 2WNVA 4QKNA 1BLZA 1G6NA 3GZAA 4E27A 3C2UA 3HNMA 1CIWA 4A4AA 4D3WA 3UYJA 3WDTA 5F5QA 3OOXA 1ZZ6A 1LHUA 5T5PA 1RUE1 3ZXLA 3A4UA 2FDIA 1SQ4A 2WQ8A 1TMF3 3K4DA 1W04A 5KXEA 4EV0A 3ZMOA 2J1SA 4LJHA 4C1WA 1J3PA 3AZZA 1H8TB 4K20A 2DF7A 3MIFA 4P5HA 3VZLA 3WP5A 3NJVA 3JU9A 3UL2A 4YVWC 3H3UA 1O7FA 3UGGA 1RUD1 5GKAC 2LALA 4W8JA 2JG8A 1F31A 3N9MA 2BPA2 5CYYA 4ES9A 3U37A 1QOSA 2TUNA 4GXLA 5EQUA 3MW2A 2RMU1 2TNFA 4PBOA 4LQRA 1CGPA 3WXPA 1ASJ3 1VPHA 1X8EA 1SLAA 2BEOA 1Q43A 2W68A 1PO21 5FUPA 2PAEA 1HB2A 2KXLA 2RE9A 5L9BA 2NP0A 1Y9MA 3UJQA 1RHI2 1PZ7A 3WT3A 4P9XA 5FYMA 5C8CB 2OZ6A 4JAAA 1ZRRA 3E5QA 4NHLA 3ZO0B 4QGMA 4JGZC 3ACGA 2FCVA 3IM0A 4GMP3 4KWLA 3WINE 5FYYA 2QQVA 3T1MA 2CAUA 3AJZA 1GZ9A 3JCIA 3L2YA 2OS2A 2Z2SB 4XUTA 5FZMA 4AWDA 1ONAA 2NMNA 4AAPA 2XJUA 2DVBA 4E2QA 1FNYA 3LIHA 4L9BA 4E8CA 3OUHA 3W5NA 1GZWA 2PAMA 4ZS3A 1G8WA 1PO11 4B1LA 4P00B 2R072 4ZS2A 3VZKA 4AHXA 1TG7A 5C4WA 3ZFGC 4IV3C 3NKTA 3WOGA 4GKYA 1OA3A 1WA6X 3N7LA 4FP2A 4AK3A 1OXCA 4IEZA 5I8TA 5K8SA 2EXJA 2PLV1 2N7GA 3ZN5A 4IV1B 1HRV1 1X50A 2E31A 4DUVA 4XJ8A 2BJSA 1OUSA 4UFHA 3V64A 1AXKA 4Q4V2 4QT6A 4AVCA 5L7OA 3NJZA 1QQP3 2IXJA 4Q27A 2PHUA 3KCXA 3J26N 4W6YA 3UGFA 2L9LA 3NWKA 4WM8A 1YFWA 3VBRA 1NUKA 2H6BA 1UQXA 3KLSA 4HVOA 5IW0A 2DVGA 3MLLA 2AREA 2W95A 3BN6A 4IEYA 1HJFA 2JD9A 3KT7A 4O65A 1ENSA 1XYNA 3NJYA 3VD7A 4LLFA 1RJ8A 2P1BA 3T3YA 4GWJA 4XFFA 4NR1A 3LA2A 4XUQA 2ZKLA 5A1AA 4Y4RA 1QOTA 4A6OA 4XJZA 2VW1A 3WNKA 3N9QA 5FQ0A 2JDAA 2VL4A 4BB3A 3OEBA 1RVF1 2JJ6A 5IUQA 3GCWA 3N7JA 4TXWA 4K21A 2IUWA 1T6GC 2PYTA 5I0RA 2VOWA 1UWWA 1ASJ2 4JDMA 3KF3A 2WUHA 4XCBA 1LNSA 1ULEA 5EXOA 5FY5A 2XOMA 3WQ0A 2XGXA 1N3OA 5DUUA 1Q8QA 1LGBA 1XPWA 1K12A 1Y4WA 2R32A 1DCSA 1YNAA 2WLQA 3NV4A 4YM2A 3IIAA 4YGCA 4AL9A 1POV3 3M7AA 3LIGA 1K42A 2P6HA 1CQ9A 4BLIA 2WNVB 1S0CA 2Q30A 4M3CF 4Y5SA 5T3NA 3S30A 1QJU1 2RDSA 1UYPA 4NHMA 3ZMNA 4HG6B 3ZSKA 3LEKA 2JDUA 1OQ1A 5KR7A 5CKMA 1UU4A 1QIQA 4HETA 4LBKA 3DF0A 2VVFA 3BB6A 4L0PA 4QU1A 3H8XA 2FDJA 3FLTA 1OUXA 2WAOA 1NLRA 2ZEWA 1UMZA 5BPXA 3WY6A 4RGKA 5CNAA 1TMF1 3J8F3 3DEMA 2DV9A 4PLOA 2YBPA 4W65A 4EWEA 4HK8A 2JG8B 5JIAA 4JKKA 4QDQA 4QD2A 2WFPA 1YIPA 2VQ0A 3ELNA 4LUMA 5G05L 3UESA 1S0DA 1V9U3 3ZVXA 4H7MA 5FY1A 2JWPA 4R9DA 1GOFA 2PELA 4HLTA 4NE9A 3D3AA 4AF9A 5T52A 2J42A 5HXMA 5DMYA 3NNMA 2D3PA 2ZX4A 4GWNA 4I0BA 4MV2A 4P9JA 3TOJA 3DYMA 5FFOC 2Y34A 4NHKA 5DDJ3 4FTBA 4Q4X1 3S5QA 4I2OA 2FD8A 2R063 2WRAA 1UU6A 3NAPC 1AXYA 2WZR3 4W6WA 4XFHA 4BH9A 4HFSA 2WS92 1JN2P 2E7TA 1BYHA 3WP3A 2VQTA 3UETA 4YARA 4ZZ5A 2C5DA 3EXUA 4RYDA 4AVTA 1PZ9A 1RUG1 2C4XA 2QQJA 3VL9A 4FQZA 5D8AC 5GLWA 3FBYA 4I09A 1YLLA 4NAMA 4UBGA 1GICA 3POEA 4XUOA 3WX5A 1GZWB 4DS0A 2YPDA 5IHRA 2BV4A 3OY8A 4Y4YA 4OVEA 5C4WB 4QPWA 1KDMA 4B4RA 4CCMA 1ND2C 4CXXA 4S2GA 4PI2A 1JZ7A 4LKDA 4X6QB 3Q8FA 4AEKA 1LHWA 1W9SA 4JRLA 3OBRA 1OOPC 1GBGA 1OI6A 1PIV3 1QWRA 4NPRA 5HI0A 5L7OB 1W8ZA 2JICA 2GNBA 4YM3A 4XETA 2O8OA 4QB6A 3U14A 4OHXA 3WW4A 4RL7A 3K46A 4KI5M 3N7KA 5LK7B 1UNBA 4WM8B 3VBRB 3HN3A
chains in the Genus database with same CATH topology
4XOGA 2BNNA 1QQP1 4BOWA 1IOAA 3E97A 4X6RB 4XF3A 4YLZA 4KG0A 4QGNA 4G4FA 5ACA1 3V65A 1WCSA 3LA7A 3ZFFC 1DQ1A 2MPFA 5E89A 1NZCA 5JLVA 3EQEA 3ZX7A 1RGSA 2A6YA 1D4M3 4YZ1A 1QU0A 1EYBA 3J8F2 2CL2A 2CGNA 2X5IA 4AI2A 5AFEA 5C9AA 4MLOA 3R6SA 2A71A 2BNOA 1AR83 4NN0A 3A0KA 5FQ0B 4IETA 1LB2A 1VRH3 2ZGRA 2D7FA 1Q3EA 1UPSA 2I2SA 3VBOA 3RI9A 3TWIA 4D7YA 2ZTNA 3THTA 1DYPA 2VNRA 3O12A 2RM23 1LU2A 4N53A 2CGOA 4COVA 1LU1A 3MFAA 4KWJA 1I1EA 3RRDA 2ZGMA 2WZR2 2YC0A 1PZ8A 5F9TA 4FPYA 1PGW1 3KD4A 4DY3A 1K5MC 1EPZA 5JSOA 4Q0PA 2ZMLA 4MXWA 5JDBA 1BQPA 4YG6A 1AR62 4EN7B 5T5LA 2O1QA 1Z78A 4WZCA 2BW8A 1ENXA 2RS31 4CRQA 1N1YA 4MGZE 3UKNA 4Y1XA 3ZIWA 1UZYA 1RMU3 5FPZA 3PNAA 5FO7B 2I07B 4AEDA 1H2KA 1AXZA 3C3VA 3ZFEA 4LBLA 2P3KA 4COZA 3B9IA 4KWKA 5CU1A 1V9U1 1WLDA 1H8VA 3ZPYA 4HANA 3AXEA 2XBO2 1YIFA 1S0JA 4N90A 2GN3A 2YROA 1QGLA 2Q1MA 4DINB 3TYJA 3E6DA 5DDJ1 5KHHA 2CWMA 2R061 2HWF3 4MZUA 1C28A 3RWNA 1X36A 2RS53 1D4M2 2SLIA 2YZ4A 4XBLA 3BU7A 1ULDA 3H9AA 4LBMA 1D0HA 4KG8A 1FOD1 1JYCA 3MZHA 4RGAA 1AR82 2OYZA 1ZZ8A 3OY8B 1UCXA 1MS0A 1VRH2 3S6PA 3KGLA 4LBQB 2DU0A 3ZIXA 3PJYA 4MYEA 5JSPA 4WVWA 2GC0A 3ZSMA 3WG1A 1Z7S3 3R4DB 4PIYA 2RM22 2UURA 1XE7A 2WT1A 1H2LA 1G9DA 5JR7B 3LAGA 1ULGA 1Y3TA 2WT0A 2Y38A 1PNFA 1G7YA 3B3QE 1PIV1 4S2HA 1FV2A 1IGOA 4FP3A 1AR93 4OI4A 1ZBE3 3VBFA 4PDWC 2R16A 4AVSA 5ABJC 5JZGA 2EAAA 2Q1ZB 4DFSA 4ITCA 2P34A 2FMYA 4FXKB 3LSDA 4FSJA 2DFCA 1O4YA 2D98A 2X5IB 1SLLA 1NE6A 4C0BA 4RHV1 4XEZA 5C9AB 4CDWA 2G9GA 4FPCA 1GFF2 3RI8A 4AYUA 1TME3 2A75A 1GZCA 4KBBA 3VBOB 1RMU2 3CJIA 4AI8A 2LUWA 3ME2A 3ZYPA 5B2GB 3JUUA 2D6NA 2XWJB 4N53B 2BVBA 2RR13 1MEC1 1KD7A 4F7ZA 3FUQA 1C8M1 2VG9A 4AHWA 4B29A 3X29B 2ZAHA 4BMEA 2IXCA 4LO5B 1CR7A 3IDEA 1JH5A 1O4ZA 3NW4A 1QHDA 3S7EA 2YXSA 3W59A 5FO8B 2KA3A 2HWF2 2EA7A 4LO7A 4MXWB 1LEMA 2RS52 3VN4A 1F5FA 3U07A 1A8MA 1N47A 1YWKA 4RS5C 3LWCA 5DG1A 4DRVA 1DBNA 4I30A 2CWSA 3VBHA 2YY1A 2QFEA 1AF9A 4GB33 4FXGB 3EHKA 4JGYC 3WVJA 3VKLA 1Z7S2 3LA3A 2WNUC 2E6VA 5KHGA 2Y26A 4PJYA 2PHWA 1W6NA 4AEDB 1IZ3A 4HVQA 2PQQA 1WMDA 4O9GA 3WNXA 2Y0OA 3ZFEB 3ECQA 5F1RA 4Q0QA 5BNQA 4F8AA 2AGSA 2ZGPA 3H1WA 1DU3D 5DXDA 1AR92 1LJ7A 1ND3C 2R0FA 5FAXA 3JQWA 4IESA 4QQ2A 1GR3A 2B46X 1RUI3 1SLIA 1BMV1 1NCRA 3ILNA 2B8MA 1KS5A 3I54A 2HWE3 2EXIA 3RYRA 4DQAA 4GWMA 2A7AA 1YXWA 2QE3A 1HRI1 1KXGA 1LRHA 1CVNA 2DUQA 1OFSA 5LK5A 3O0VA 1LECA 1TME2 4YVWA 1RTVA 1LOAA 3RMYA 3KCCA 3M3CA 2QUOA 3N7MA 4XFGA 4FAHA 3LGRA 4YG3A 1COV1 3VBSC 2ZHLA 1C1FA 1LULA 1BZWA 2RR12 4KQ7A 1RUE3 4AFCA 3HBZA 4Z82A 1AJOA 4XQDA 3WW2A 2O0OA 2VPVA 1RUF1 2XPJA 4NO4A 4META 3D4KA 4H14A 3VBFB 2JE7A 3WP6A 3H7JA 4KU7A 1R1A1 4JGZA 3W9AA 1X7NA 1D2QA 4R4ZA 5JZGB 1JOJA 4XDQA 3FX3A 4XF4A 5E1RA 2VH9A 1DZQA 2RMU3 1DQ4A 1VBD3 2A6ZA 3SLIA 2ZHNA 2AR6A 4Q4Y2 1PO23 2GSYA 3PJQA 2DCYA 4EROA 4GB32 4CDWB 2D6LX 4IQPA 1OA2A 1QJY1 3ZFGA 4IV3A 2CAVA 1MVQA 1WGPA 1KITA 1W6MA 5K9YA 1O5LA 2WSUA 3CJIB 1PVC2 2UWCA 1H2NA 1C3HA 2IXKA 1HX6A 4W6XA 4QM9A 4X8PA 2HEVF 1LCLA 2DU1A 4QQHA 4CP2A 2HYKA 3BALA 3MLJA 4GKXA 4AFBA 2Z5WA 2F6BA 1QY4A 2XVLA 3WDWA 3M3EA 4CEWA 3IDBB 1Q8PA 5C33A 4P9IA 1PO13 4XILA 1YFXA 5E88A 2DWRA 2NQYA 4CEYA 2PLV3 2HWE2 1AL0G 1AX1A 1Q56A 1HRV3 4Q8KA 2ENRA 1CJDA 4S2FA 1PGL1 1VBB1 1REEA 4M3CA 5EWSA 3KT1A 3VBHB 3ALQA 3PHMA 2E53A 4CP1A 4FBFA 1QKQA 3PMEA 3L9JT 4XF9A 3UK9A 1UN1A 1LEDA 5FPXA 3M4FA 4CDUC 2EALA 1W6NB 1RUE2 2QQPA 4HVRA 4BIFA 5JMCA 2XG3A 2Z79A 1H30A 1HLCA 2OIIA 1H1MA 1RIRA 5DZEA 1MACA 3MDPA 5I8YA 1H1IA 1UKGA 2K9ZA 4RD7A 4COYA 2VNGA 4AXOA 1RUD2 1NCQA 1NCRB 4XYXA 1OPOA 1ZBA1 5GZFA 1QXJA 1RVF3 3RNSA 3VBUC 4COUA 3VZJA 2RMU2 1RUI1 3ENRA 5I8SA 1DGRN 1VB4A 1GQGA 1OD5A 1KFUL 4LBJA 1PO22 4EN8B 1LOBA 1XYPA 1RUNA 3WDUA 1CAXA 1FNZA 3I7DA 5JI7A 4YVWB 3PVEA 2QZ3A 5LRRA 3RDIA 1ZRFA 3O0WA 3AKRA 2D40A 2P17A 3IBMA 3HQXA 2FBEA 5L73A 4ONUA 3CEWA 4XJ9A 4ATFA 4CDXC 4JTNA 3FWEA 1Y43B 2VVEA 3S0MA 5AC91 3N35A 2XKPA 5KBFA 5FO9B 1XE8A 5BNNC 4ATEA 1PO12 1ENRA 3WD5A 2R6QA 2Q0AA 4TLFA 4ASLA 3RZZA 1YHFA 4JGZB 1HRV2 2CNAA 3POWA 4QQOA 1S2BA 4FVVA 1WUVA 1YCIA 3J4UH 3AZYA 4FPHA 5DZGA 1O4TA 4KNCA 5HXVA 4YVSA 2E51A 2D93A 4GH4C 4X8NA 5HCFA 1VBD1 3JB4C 3QCWA 3ZFGB 1HQNA 1UKRA 4IV3B 4YSFA 1W6MB 4NWWA 4YM1A 4ZXKA 3CF6E 4QPIA 1SLBA 2GC2A 4Q4X3 1EAH3 1I3HA 1MZFA 2WIIB 5JIUA 1OOPA 2PA7A 2BBVA 4IEQA 4R8HA 3SCGA 1GLHA 1SCRA 1M4WA 4B4PA 3CJXA 4N9IA 1AR71 1RUG3 1MQTC 3CL1A 4B7EA 2HWB1 2WFF3 2RS12 4YRDA 1W0PA 2D6OX 5K0UC 1UU5A 5GLTA 4CEWB 2OW4A 1DZRA 4YW2A 3WDYA 1V6KA 2Y0IA 3FFQA 4CEYB 1RVF2 2FZ2A 4Q4W1 3TN91 3ZYIB 4Z8BA 1RUJ1 4O9EA 1ZRCA 3DKWA 4Y26A 2GH8A 4JVAA 1U12A 5IT6A 4M3CB 4N43A 3WQ7A 4Z07A 3D5OA 2VW2A 2D3RA 4GALA 4RGGA 1MS1A 5HBAA 4FT8A 3SISA 2A73B 3R4UA 5TSWA 4OHYA 4D69A 3Q9OA 2JG9A 1QJU2 1HXS1 1XRUA 1VBC1 4E2SA 5CFDC 4Y1ZA 5ACA3 4R9BA 3O0XA 3N36A 2IXHA 1KS4A 5FLHA 1F2NA 5FTTC 4E2GA 3IT8A 1OMIA 1VB2A 1TMF2 3ZXKA 4LHKA 1GKBA 3FLPA 1QNWA 1LTEA 3O14A 1NCQB 2DFBA 4QHBA 4Q0VA 4C90A 4OUMA 4LHLA 4MXVA 5I0SA 1KDKA 3GZUC 4FQ4A 5FBZA 1YFYA 2ZGNA 2X29A 2WZPP 1OQDA 1ULFA 4IEWA 3NO8A 3H50A 1UAIA 3E5XA 1XNDA 1CJPA 4CDQA 1F5JA 3A0NA 4OFGA 1CAXB 3APBA 2GNDA 1LODA 5A3LA 4Q4X2 1WMEA 3AJYA 2BWAA 1G86A 1LHOA 2BGCA 4IV1C 4AFAA 1O3SA 1VAKA 1N1VA 3VHOA 1CPNA 1RUG2 1VAVA 2NMOA 4HT1T 2DCKA 1CAWA 1DGRA 2TBVA 4XJWA 3SCFA 2XHKA 1H4GA 4XF0A 1IPJA 2RS33 2B39A 2P2KA 1LKNA 2GU9A 1HKDA 4P14A 3SITA 1S0BA 3KZ4C 1U5XA 4TYSA 3QD6A 1BEV1 5GLUA 4YM0A 1PM7A 2H6CA 3AYEA 4LO6B 2D5FA 3WCRA 2D6PA 3VZOA 1VP6A 2ZZJA 4EN0A 4YVSB 1AVBA 4UW3A 2ZOEB 3AP7A 5BUVA 2VOVA 3PVNA 1QQP2 4WVVA 1RC6A 4L97A 4LHNA 4YFZA 4K9SA 2MEV3 4OI0A 4QPIB 4Z92B 1H9WA 4C0HA 2NLRA 1BKZA 1OFNA 3B9CA 5ACA2 3E6BA 1M06G 1OOPB 4AW7A 1UIJA 1J3QA 3RSJA 4F83A 4RR3A 4C91A 1EAH1 1S2KA 4DNYA 3GF6A 4P9WA 4XXPA 4IERA 1UPIA 1FOD3 1NQDA 1H1AA 1DHKB 4JDOA 1SEFA 2WFF1 2WNVC 4LEJA 1RUC1 2E9QA 3M70A 4RFT0 5ABJA 4YGBA 1F9KA 4BYYA 2XJVA 2H0VA 3H8UA 4N43B 4XJAA 2ET1A 3AB0A 2AYHA 2I45A 4LO4B 5GLVA 1W2UA 1O5UA 1I6XA 4KGQA 4OZXA 1XNBA 3WZ1A 4AVVA 1U5ZA 4WM7A 1S0FA 1I9RA 2WT2A 1BCXA 1PGW2 2JG9B 5GM0A 1C5IA 1W39A 5CG8A 3SH4A 3SH5A 4FAGA 3MIBA 3NVCA 5CFCA 3HR9A 4OHWA 5I93A 2GC1A 1VR3A 2QCSB 2RS32 4RHV3 5CIRA 3I4IA 5D1IA 1JUHA 1BJQA 1WCDJ 1F8VA 2RHPA 5J37A 1MS8A 4PIXA 1XU1A 1FXZA 2XJSA 4RS5A 3DPRA 1JTZX 2XJQA 1MEC3 3LCPA 1ZX5A 4CDQB 2UU8A 1RINA 1V9U2 1C8M3 1H0BA 1NG0A 1PNGA 2PHLA 3B7MA 3ZYGA 1A8DA 4HBNA 1HV1A 4J1WA 5C4WC 1QXPA 3WV6A 4DRRA 5J48A 2WNUA 3QACA 4F3JA 5DDJ2 5KWRA 2R062 2XLAA 1NYWA 4RQPA 2DYCA 4AFDA 1CAWB 3ASIA 5L7OC 4IXLA 1ZREA 4M00A 1FOD2 1WW6A 1ND3A 3KB5A 3IWZA 2OZJA 3HD8B 1D4VB 2OUJA 3UV9A 2BWCA 4OHVA 1CONA 3IMNA 1AYM1 3CU7A 1FX5A 3VHRA 4P9LA 3ETQA 4YYOA 2XB6C 1UZZA 2G4IA 1WD3A 3MF6A 5DUWA 2NN8A 2C9AA 3ACLA 4YGEA 4AQSA 1I5ZA 3MIDA 1PIV2 1R1ZA 1S55A 5EJ3A 3CO2A 4I3GA 3THPA 5SV5A 2QKDA 1EP0A 2WKKA 4XQ4A 4DZGA 1DLLA 5A3MA 3ZN4A 4I3PA 2FQPA 4MH0E 4Q1PA 2F4PA 4E4SA 3AKQA 5L36A 4YZ3A 3ZXFA 2MEV1 2IXIA 1AUYA 1VALA 1WW5A 4RR3B 4Y20A 1JHNA 2ZCWA 5J98B 2I74A 4RHV2 2EIGA 1HRI3 4FCAA 1VIWB 4YFWA 2VULA 3FBMA 1WCKA 1D2SA 4PF5A 2QZ2A 3B69A 5BNPA 5DUVA 1U5YA 1COV3 3AX4A 1AL23 2R30A 4LBQD 3RPQA 1R091 3VDDA 5H9RA 3VL8A 1G9CA 1MEC2 1XU2A 1ZZ9A 2XJPA 2R49A 4WZFA 2ARXA 1C8M2 3TBDA 2XVKA 2DTWA 1Y7BA 3T2TA 3QOPA 1RUF3 1BK1A 1ZNPA 4WM7B 3HMYA 4FOYA 2DCJA 3V0AA 4L92A 1R1A3 2NYYA 4JCKA 1AYN1 2NM1A 3AFGA 3KM5A 5CFCB 5GZCA 5KXDA 3GHMA 2WQ4A 3TRSB 1V6IA 1U5IA 3VKOA 1Q8SA 3IKWA 4SLIA 3AKPA 1LOFC 5AFBA 3N4MA 1W6PA 4WBBA 1J58A 4GQ7A 1QJY3 2IFWA 4BM8A 4HKLA 3SXWA 2NZ9A 1VBA1 3U4XA 1GQHA 1KQRA 1Q8OA 5CBLA 1H2MA 4OLLA 4RS5B 1ZVFA 1G9AA 3DPRB 1ENQA 3WLUA 2VQAA 2DUPA 1WW7A 1CX4A 1UW8A 5JAXA 2Q8OA 4YW4A 3VV1A 3NL1A 3SCHA 3K48A 5JWPA 1QOOA 4UW6A 1BMV2 3R0RA 2WNUB 4ZKTB 3RJ2X 1UD1A 2GNMA 2C1FA 3ZXJA 5JOYA 1B35A 4RQPB 5FREA 1YO8A 1SMVA 1IKPA 1QH6A 5JOXA 5T5JA 1U0AA 1VBB3 1HRI2 4FOWA 1EV11 2BFUS 4E9KA 1ND3B 4ZU7A 4YGDA 1NQJA 2Z69A 4HKOA 3VBUA 1COV2 4M0HA 4OHZA 1MZ5A 2EF6A 4DY5A 1XYOA 1REFA 1S0IA 1W6OA 5HCBA 2CYFA 1SBEA 4LULA 2JD4A 5F6KA 1GNHA 4ASMB 1Y9QA 4FPOB 3KQRA 3UKVA 4XFIA 1NE4A 5FOBB 3MFCA 5KHJA 1RUF2 1R083 4DB5A 2YDEA 3MIEA 4YZ2A 1NA1A 1FV3A 4LTAA 4WV8A 5LEKA 4Y1YA 2K0GA 1R1A2 4BWOA 2VVDA 1ZBA3 2VMGA 3KT4A 4HZFA 1ZBE2 4CDXA 1REDA 3GYDA 4XFAA 4Y20B 1NXD1 2IZWA 4AGGA 2YHJA 3W58A 3P3PA 4AEMA 5BNNA 2MHFA 3NV1A 2PHRA 1QJY2 3NV3A 5EV7A 4L2NA 2EAKA 5GJ6A 2DURA 3GALA 2XVGA 4COWA 5EYYA 5BNPB 3L2HA 1BXHA 2ERFA 3AZWA 3IPVA 1LGCA 2VXRA 4N7UA 3VDDB 2PAKA 5T50A 4U36A 4IEXA 1X8MA 3WW3A 4WVZA 3FLRA 4YG0A 4E4ZA 1AL21 5CB7A 1V6MA 5AC93 4OI2A 4QPGC 2Q5TA 5BNOC 4K8FA 3AM2A 4DMIA 5LRSA 2JXAA 3V0AB 1AX2A 4IEVA 1BBT1 2LTNA 1NY71 2UYBA 1W6QA 3POYA 2A6XA 2WL1A 3B01A 4XZPA 3AYDA 1QJX3 1VBB2 3ZFEC 1PGL2 1SBFA 1SCSA 5LEJA 1SACA 1W6PB 3ES1A 3AZVA 2GN7A 1PVXA 1GSLA 4EN6B 1FMD1 3WG4A 4R9AA 1FPN3 2GC3A 5FOJB 2DVAA 2VMHA 3RJRA 2JX9A 1C4RA 1O91A 1LESA 4XTPA 3OGGA 3M3IA 4BIOA 1AR73 1SFNA 4R4XA 3PVOA 4TWTA 3E5UA 1C57A 3LB9A 3D8CA 3SHRA 2HWB3 3USUA 1MS5A 1ZZBA 3HIFA 5BXXA 4OULA 2ZJCA 1KRIA 1DGLA 2D3SA 2HWD3 3VKFC 1ZBA2 1V6OA 1J1LA 4B3NA 1OLQA 4Q4W3 5CFDA 3TN93 1C8NA 3MICA 1VBE1 1RUJ3 1WLWA 2VU9A 3JD71 1RUI2 4FO9A 4PBPA 1B35B 3WQ1A 1QDOA 4XQWA 3OBTA 2ZA9A 2ZKNA 4HSLA 4Y1UA 4Y5Z0 4XJUA 1UF2C 3VKNA 2WA3A 1LGNA 4A7ZA 4AQ6A 3VBUB 4HMZA 3VBFC 1SLTA 5E8AA 4ZU4A 2GAUA 4CP0A 5JZGC 5IK5A 1HXS3 1CAVA 3OD4A 1B09A 3RYKA 3V56A 1VBC3 1G9BA 2ZABA 4H3WA 5J7MA 2UYAA 1W6OB 1OLRA 4AVBA 2VECA 3T1LA 5AC92 3U10A 1IS6A 2ILMA 4YW5A 4BPZA 1HW5A 3DN7A 3B5LB 1NA1B 3AMPA 5C6CA 2XLGA 5KXBA 4N7IA 3CJIC 3J9SA 1GV9A 3LOIA 1R081 2XLFA 2OUHA 2Q4SA 5K7PA 3JBG1 4XMAA 4WVMA 4CDXB 4EWDA 4BQ1A 3WDVA 2R041 3SNMA 3VHNA 2B7YA 5IK4A 2ZX2A 1DGWA 1XNCA 5BNNB 4LO8A 2ZACA 1IS4A 3ILFA 4S2DA 4IEUA 1H4HA 1VBD2 4XIOA 2FMDA 4LNVA 1CD3G 4OI1A 2P37A 4U2AA 4FTSA 2ZBJA 4A7YA 3IPVB 5EFUA 1NXMA 5FCCA 1V6LA 1AR72 2VUAA 1DG6A 3VGIA 4AHYA 2OA2A 2HWB2 3VBHC 1XXNA 1ZRDA 2D6MA 1DYKA 3ZXEA 2XL7A 4Q4W2 1FATA 3TN92 1OA4A 1ZYBA 5J96B 1RUJ2 2ZGLA 1W6QB 2V73A 1RJ7A 2WQZC 3ATGA 1BEV3 2W08A 1EY2A 2GMEA 3NAPA 4DXZA 4Q4V3 5FDBA 3ZXGA 1ZM1A 2PLV2 2BVVA 1TNRA 3MPPG 5FMOL 3SH3A 2A3WA 1QJX1 4CZSA 1G9FA 2ZMKA 5GALA 1TE1B 5D8AA 4DOUA 3I8TA 3M1HA 1NCRC 1HXS2 1VBC2 2ES3A 2FZ1A 4G9SB 4XW3A 1ND2A 3BCWA 1PK6C 1W0OA 1PGSA 1FPN1 2HWC1 3WW1A 2GNTA 3USUB 1Q8VA 1KFXL 1RUH1 3H1MA 3ROUA 3POSA 3D0JA 3O7OA 2XWBB 3VKMA 3D6EA 3B93A 1X33A 1OQEA 2BNMA 4JC1A 2NPIA 4ZU5A 1DIWA 1N1SA 2XKOA 5CFDB 1RUC3 4M3CE 1D0GA 3WDXA 2ZAAA 1TNFA 5DUXA 2YMZA 1HDKA 2HWD1