1NCQA

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords COAT PROTEIN VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 45
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqA00
1VBC3 1OOPB 1POV3 1HQNA 5CFCC 1VBB1 2MEV2 5ABJC 3JD72 1PO22 2R042 1RUD1 2HWB2 4QPGC 2HWC3 3JBG3 1RHI2 1TMF1 4GMP0 5CFDA 1MQTA 1HXS2 1TME2 4Q4X1 4WM8A 2MEV3 3JD73 4PDWB 1PO23 2R043 2HWB3 1ND2C 1RUE2 2GH8A 1VBD1 1RB8G 5D8AB 1RHI3 4FTEA 1BMV1 1HXS3 1TME3 1QQP1 1RVF1 1MQTC 4GMP3 5C9AB 5CFDC 1RUE3 4RS5B 1ASJ2 2X5IA 2HWE2 5JZGC 1K5MB 3VBSB 3VBUB 1ND3B 1ASJ3 5K0UA 3DPRB 3ZFFC 1V9U2 1SMVA 2GSYA 2HWE3 4NWVA 1RUJ2 2R061 5J96B 2X5IC 2BPA2 5LK7B 1R1A1 1VRH2 5FOJB 3ZFGB 5ABJB 1C8M1 1FMD1 4Q4Y1 4QPGB 1RUJ3 3CJIA 1PGL2 1MEC2 1PIV1 4Q4V2 1VRH3 3VDDA 1AL23 5BNNA 1OOPA 1ND2B 1HRV2 4RFT0 3VBRC 1MEC3 3CJIC 4Y4YA 4Q4V3 1BBT2 4LLFA 2XBO2 1RMU2 3J8F2 4FTSA 1CD3G 1FOD3 1AR81 5GKAC 1E57A 1COV2 1VBC1 2HWF3 5BNNC 1POV1 1OOPC 1RUG2 4PDWA 1AR92 1X36A 1BBT3 2R072 2XBO3 1RMU3 3J8F3 5AC93 2HWC1 5JZGB 5D8AA 3JBG1 5L7OC 1RUG3 3ZFFB 4NWWA 1RUF2 1AR93 1PGW2 1R082 2MEV1 5C9AA 2R073 3JD71 1PO21 2R041 4RS5A 2HWB1 2TBVA 1RHI1 5D8AC 1HXS1 1OHFA 1R083 1TME1 1K5MA 3VBSA 1NOVA 3VBUA 1NY72 4GMP1 4CDQC 1FMD3 1ND3A 2WWSA 2IZWA 3DPRA 1RUE1 2BFUL 4CEWC 1NCQC 2RS12 1DDLA 1K5MC 2BBVA 3VBUC 1ASJ1 3VBRB 3VBOA 3ZFGA 3CJIB 3DPRC 4IV1C 4GB32 2WS92 2PLV2 2HWE1 1CJDA 2RS13 4AEDC 5BNNB 1F8VA 5A33A 4CDXB 1EV12 3JB4C 1V9U1 3IDEA 4GB33 3VBOC 1ND2A 1R092 2BFUS 2WS93 3ZFGC 1RUJ1 5L7OB 2FZ1A 3ZFEB 1AR72 1VRH1 1R093 1AL21 4JGZB 1PVC2 1PGL1 1EAH2 1MEC1 1VBA2 4Q4V1 1NCRB 3NAPA 1AR73 1FPN2 2RM22 4IV3B 5JZGA 3M8LA 1FOD1 4N53B 4CDQB 1PVC3 2HWF1 3ZFFA 1EAH3 1VBA3 4CEWB 5AC91 1BBT1 2RM23 2XBO1 1RMU1 3J8F1 4Q4W2 1NCQB 3NAPC 1RUG1 4IV1B 1AR91 4JGYC 2R071 2RR12 4Q4W3 5BNPA 4YVSC 4AEDB 1AYN2 1NG0A 1VB4A 5J98B 1PGW1 1R081 1V9U3 3VBOB 2RR13 3VBRA 5BNPC 1AYN3 1IHMA 5A33B 1ZBA2 1QJX2 1QJY2 3ZXAC 4RR3C 4CDXA 2WZR2 2BUKA 3S6PA 4CEYA 1ZBA3 1QJX3 5L7OA 1QJY3 1RUI2 2RS11 1D4M2 3ZFEA 2WZR3 2RS52 1HRV3 1AR62 4CDXC 1VBD2 4GB31 4JGZA 2WS91 3NAPB 1RUI3 4YVWB 4CEYC 1H8TC 1D4M3 1NCRA 1COV3 4IV3A 2RS53 4CDUC 1AR63 3ZFEC 4N53A 4CDQA 4JGYB 2HWD2 1R091 2WLPA 4YVSB 4JGZC 4RQPA 4CEWA 1NCQA 1B35A 1NCRC 1AR71 5ACA2 4IV3C 1RUF3 2HWD3 4N53C 1PVC1 1EAH1 4IV1A 2R062 5BNPB 1VBA1 4EJRA 4RQPC 1Z7S2 1PO12 2RM21 1HRI2 1ZBE2 2RMU2 1B35C 4AEDA 4RR3B 1RUC2 1Z7S3 1GFF2 1PO13 4GH4A 4Q4W1 1HRI3 1X33A 1ZBE3 2RMU3 3VBFB 1RUC3 4RHV2 1F2NA 2RR11 1VAKA 1BEV2 4N43B 2PLV3 4GH4C 1QJU2 4CEYB 1H8TB 1AL0G 4RHV3 1AYN1 4CDUB 1EV13 1AYM2 1RUH2 4WM7C 4QPIB 3VBHB 2VQ0A 1QJU3 3JBG2 3TN92 3LOBA 1AYM3 5BNOB 4YVWA 1ZBA1 1QJX1 1RUH3 1QJY1 5DDJ2 4SBVA 2WZR1 4BCUA 1VBE2 1HRV1 4JGYA 4CDWC 3TN93 4RQPB 4YVSA 1FPN3 2ZAHA 1B35B 1RUI1 5DDJ3 4YVWC 5C8CB 1D4M1 1COV1 5C4WA 1VBE3 2RS51 1AR61 3FBMA 5FMOL 1NA1A 2RS32 4WM8C 4RR3A 5C4WC 1RUF1 4Y5Z0 2HWD1 2Y26A 2RS33 2ZTNA 1NA1C 4GH4B 1VB2A 2WFF2 2ZZQA 5ACA1 3VBFA 4WM7B 5FMOS 1VBB2 1NY71 4FTBA 2WFF3 1RUD2 4N43A 1Z7S1 1PO11 3HAGA 1HRI1 1TMF2 1OPOA 1ZBE1 5CFCB 1H8TA 2RMU1 4Q4X2 1VBB3 5K0UC 3VBFC 1AL22 4CDUA 1RUC1 1A6CA 1RUD3 5A32B 4CDWB 4QPIA 3VBHA 1TMF3 1BMV2 2PLV1 4N43C 4Q4X3 1FOD2 1QQP2 1RVF2 4RHV1 5BNOA 1EV11 2HWF2 1C8NA 1VBD3 1BEV1 5AC92 4QPIC 4FSJA 3VBHC 1QJU1 5CFDB 1MQTB 4WM8B 1QQP3 1RVF3 3VDDC 1AYM1 5C4WB 5BNOC 5C8CA 1RUH1 1NA1B 1W39A 3TN91 2FZ2A 1AUYA 1FPN1 5ACA3 3JB8A 1R1A2 5DDJ1 4PDWC 2DF7A 1QJZA 5C8CC 1C8M2 1FMD2 4Q4Y2 1VBE1 2R063 1M06G 2X5IB 1WCDJ 1PIV2 1R1A3 5K0UB 1C8M3 4Q4Y3 5C9AC 2XPJA 4WM7A 4RS5C 1PIV3 2RS31 1HX6A 1POV0 1AR82 4Z92B 2QQPA 3VBSC 5CFCA 1VBC2 1ND3C 5ABJA 4QPGA 5A32A 1BEV3 4CDWA 2WFF1 1AR83 2HWC2 3VDDB
chains in the Genus database with same CATH superfamily
4DXRA 1OOPB 2F4LA 1POV3 4GA9A 1GWMA 1OF4A 1QJEA 2F17A 3ZN6A 5ABJC 3FHQA 2FDIA 2R042 3M4FA 2BNMA 1LOEA 2HWB2 4GKYA 2HWC3 3SITA 5FY7A 3JBG3 3LOIA 4NHKA 4DZGA 3D5OA 2Q5TA 3I3MA 1E5RA 2YYOA 1RHI2 1TMF1 4GMP0 5KR7A 4Q4X1 1HXS2 4WM8A 5F5AA 2MEV3 3FFZA 3JD73 2VJXA 1MVEA 3KCYA 2CTVA 4P02B 3QCWA 4XTPA 1RB8G 5IT6A 5BV6A 1NE4A 1BMV1 4YYOA 1REDA 1H2LA 1UZVA 1NXMA 3A0KA 3AK0A 3OOXA 1MQTC 2QQNA 3LA2A 1RIRA 2K9ZA 5KXCA 3RPQA 1YQ6A 1EPZA 2DBNA 4PBOA 3BI3A 5FR3A 3I2OA 2HWE2 5JZGC 2C6SA 3U1XA 3GNEA 3KCCA 5A6XA 1DFQA 3O1MA 1U5ZA 3DPRB 1KFXL 1PZ9A 1SMVA 3OBRA 4KL1A 5K7PA 1QOOA 4Z82A 4CCDA 1BK0A 2J1UA 1TNRA 2W91A 3KM5A 2WKKA 4NWVA 4QKBA 4C0BA 2E9QA 5J96B 3AZWA 3BU7A 4D6QA 2BPA2 3T1MA 2C9AA 2E7AA 2FDHA 5FOJB 5H9SA 5FO7B 3SH5A 4IEOA 4QPGB 4FAGA 3H1YA 5C5TA 3ZX7A 1PGL2 1MEC2 4KU8A 1PIV1 3ZXJA 1SLAA 1L7QA 2JWPA 5FZ9A 3VDDA 4XYXA 5HV0A 5JWPA 3MICA 3AL5A 4LO8A 5DQ0A 5KHHA 1D4VB 1J3QA 1UMHA 4RFT0 3DXTA 5FYMA 3CJIC 4Y4YA 3WF1A 4FTSA 4Z07A 1ULCA 1FOD3 4CCNA 2E7TA 3CQOA 1ZZCA 2VCBA 2W52A 5BNNC 1WA4A 3R4SA 3HR9A 2VE1A 4PDWA 2ZACA 4H7LA 5HXVA 2HEVF 5AC93 1V6JA 1RMU3 2XBO3 1I3HA 4MGYE 4AK3A 2EF6A 4A3XA 3IIAA 2C5DA 3VD5A 2VOTA 2VVFA 4N7IA 4QDSA 2J1SA 4BMBA 4AHWA 1RUG3 3GBWA 3BN6A 4NWWA 1RUF2 2PTMA 3SH3A 2X53S 4BQ2A 4Q8KA 5FXZA 4RS5A 2JG9B 1OLRA 2VOVA 3HN1A 4N9IA 1QWRA 2FBEA 1I1EA 3KWVA 1MZFA 3AX4A 1LTEA 2ES3A 2LALA 3EBRA 3WHUA 3GCXA 3UL2A 2BW8A 5IVEA 3VBUA 4C8DA 2WWSA 2WZ8A 3TOJA 4XMAA 1RUE1 2QQUA 4FXKB 3NV4A 2GU9A 2BFUL 3PIJA 1SDDB 1IOAA 3ETQA 4QX5A 1NCQC 2WNVC 4FPEA 4DPNA 1DQ4A 1LULA 4HVQA 1GP5A 1K5MC 1OUXA 2JDPA 3FUOA 4LBOA 2YU2A 1ASJ1 5H9RA 5I0DA 3LB9A 3WUCA 4BZ4A 4TZDA 2QE3A 4CU7A 2Y33A 4E2GA 2JENA 2WN3A 3IIIA 2PLV2 2XJTA 3AC0A 3U11A 1IPKA 2FDGA 3QLQA 3WINE 3ROUA 3DF0A 2GNTA 1JZ6A 3POBA 4AEDC 3ECQA 5F3CA 3NNFA 3IWZA 4AQ2A 3FJSA 3JB4C 4D3WA 4AL9A 4K9SA 1VR3A 3TEXA 4COZA 1V9U1 4DXZA 2Y0IA 3VBOC 1ND2A 2BFUS 3ACLA 5JXHA 1PMJX 1QMJA 2Q4SA 3LSEA 3ALQA 1IGOA 1AF9A 4QXHA 3OB8A 4YLZA 4DOUA 3THCA 1ENXA 3QACA 1XU1A 4V2WA 4YM1A 3RZMA 4ES9A 4BOWA 4JAAA 1VRH1 3WG1A 1CESA 4QKNA 4CRQA 4RD7A 5EJ1B 4KNCA 4DINB 3NV3A 4XQWA 1PVC2 1PX4A 4OLLA 2CWMA 4A7YA 2D3SA 4XDQA 1NCRB 3ACFA 1O3SA 1FPN2 2FDJA 2G9GA 1B09A 2VNOA 3I3EA 4WZCA 2Y6JA 4Y22A 4XUOA 4CCJA 1ACCA 3N9OA 4CDQB 1GZCA 5H9PA 1GV9A 1R1ZA 2ZGSA 3IB3A 2XJRA 5FMCA 3ZFFA 4CP9A 4LKEA 3LDRA 3ST7A 2PAMA 4CEWB 2WAAA 2XQXA 4UXAA 3CHXA 3U10A 3J8F1 1GSLA 1QU0A 5BUVA 5JUVA 1W3VA 5FUPA 1OVSA 2ZEXA 3IMNA 1WWYA 4IGQA 3MIEA 2XWBB 1ZA4A 3CJXA 1ZA7A 2CAVA 1AR91 4IV1B 4UF0B 4DXSA 3O0XA 5A1FA 5IAXA 2P2KA 3OCPA 1WKYA 2CAUA 5F8PA 4PIYA 2NQYA 1ALYA 2H0VA 1NG0A 3U0ZA 5LWBA 2QQJA 1QOSA 2XJUA 5J98B 2ZHLA 3RZLA 3NNMA 4CCKA 3BOPA 4L0PA 2GMEA 1RYYA 3VBRA 5FPUA 3OYWA 1S0DA 4GQ7A 1ZM1A 4I09A 4L9BA 4YWAA 1YI7A 3WP3A 1XNDA 3O0VA 3KT1A 3APBA 3SH4A 2DUPA 2WLQA 3ILFA 3RJRA 3WEZA 5I8YA 2R6QA 2H6CA 3N36A 1UYYA 3IZOA 3ZXAC 5E16A 1QNWA 4FPYA 4GJYA 3J7LA 3VGIA 1E5SA 1CAVB 2WZR2 3ZKUA 3RFRA 4CDXA 2ZHKA 3CL1A 2NYYA 3P5BA 3WNPA 4DMIA 5A3UA 3V0BA 3FHAA 2D6PA 3HBZA 4PHZA 4BXFA 3OF1A 2GN3A 1PNFA 2R32A 1D4M2 2C26A 3I59B 5JOWA 2VAUA 5FRAA 3I49A 2RS52 1DU3D 4AXOA 1T2XA 3WNMA 1C4RA 4IEWA 2XVGA 4GB31 1A8MA 1C5HA 1BYHA 1JH5A 2WS91 3K75B 3QD6A 4GULA 5JVVA 1RUI3 5AVPA 4CCCA 5CISA 4ZXEA 5FZDA 3SKJE 3W58A 3N3HA 2XHKA 1DYOA 1AR63 3DECA 4XOGA 1H2KA 3KT7A 2DV9A 2FMDA 3SLIA 1CIYA 3GXUA 4MYEA 3CZUA 1DQ0A 2XHNA 3AM2A 3JUUA 1R091 4OULA 3GBGA 3TWIA 1W90A 4YVSB 4XPVA 1O3QA 4XABA 1WGPA 4RQPA 4AWDA 3KMHA 4MXWA 1E5HA 3RYKA 2YC0A 5FY1A 1W05A 1O8SA 1YJKA 4FPGA 1RUF3 4M0NA 4XACA 2YFUA 2DTYA 4GALA 2XL7A 1SBDA 5A7WA 3UNPA 1EAH1 5FZHA 5FP3A 3OTFA 1VBA1 4IE4A 5IVJA 4OMDA 1G9DA 3L2YA 1MS0A 2RM21 3ACIA 2CGNA 1GLHA 4UT5A 1WUVA 2RMU2 1CAUB 3GF6A 3VL9A 4LLOA 3WP5A 1RUC2 1OLQA 3H0OA 5E89A 1JHNA 5FY9A 3E6CC 3WDWA 1H2NA 2FDKA 1I9RA 2IFRA 2LW8A 1LKNA 2P3JA 1TE1B 2TUNA 4LBMA 4XFFA 2D5HA 3Q8CA 1ENSA 1ZBE3 3JZVA 4Q4W1 4R9CA 5GLVA 2BP6A 3WP4A 4A2UA 1BCXA 5KXDA 3VBFB 3O1VA 2WWUA 4O65A 2IUWA 3IAPA 1JZ5A 4BLIA 3LE0A 4Q1RA 3CF6E 5I0UA 3WNOA 2VMHA 3LAGA 4KG8A 1JMUB 1AZDA 2RR11 2W47A 5J48A 1BEV2 1AXKA 5KHJA 2PLV3 2VMFA 5KC6A 2IC1A 4I02A 2Y0OA 1AL0G 1EP0A 4XBNA 4Y1UA 1JHJA 4JDNA 1LCLA 2D6LX 3I97A 3OBZA 5C8CA 1W6MB 1JZ8A 2Y6GA 1W9SA 4IW3A 1JUIA 3C7OA 4JTNA 2EXIA 1S1AA 4B3NA 1QHDA 1LEMA 1QJU3 4ATFA 3RZKA 2P1BA 4XHXA 2VW2A 1HN1A 3MYXA 4S2DA 5IK5A 2A75A 2JDZA 1WCSA 3IPVA 3J26N 5F37A 2VBDA 5BNOB 1ZRDA 2DVAA 1ZBA1 1QJX1 4D7YA 1QJY1 2A6XA 4GXLA 4ZONA 2BGCA 5IHRA 5L9VA 1G7YA 2KD7A 4BCUA 4Z8BA 1HRV1 4JGYA 2WNUC 5FFOC 3TN93 4MGIE 3OBTA 4RQPB 2W5FA 4XJ8A 1FPN3 2EIGA 1IQAA 3I2IA 1XNBA 2Q8EA 4LBLA 1NLQA 4EYUA 3N9LA 1W06A 2YPDA 4YVWC 1XNTA 4LJHA 4XFBA 5A3TA 2AACA 1COV1 5EJZB 5T5LA 4M3CB 3LA7A 2JE8A 2G1MA 2JDYA 2ZCWA 3LFIA 3FBMA 5A7WB 4S2FA 4AGGA 5GM0A 1UYZA 3H1WA 3QBQA 1CN1A 3H9AA 4FOQA 2JG8B 2XLAA 3S5AA 1C1FA 4IQPA 4HOOA 4WM8C 3R05A 3AYAA 1QH7A 4RGAA 1MACA 2GDFA 3ABZA 3OY8B 2C24A 2E26A 2QBXA 3CO2A 4XF3A 1GZTA 1HQLA 2VVEA 5DG1A 3L9JT 5FK7A 2JD4A 1UOFA 1WA6X 1UZYA 3Q8FA 1JUHA 4OUMA 5FCCA 2JKBA 4CCOA 4OMCA 5LA0A 1W6PB 2ARCA 2QCSB 5FK8A 1OH4A 4QGMA 4E27A 1UMZA 3P3NA 5F7UA 3AZZA 1KXGA 1NY71 3OGVA 2EXHA 1GOFA 1XSRA 4LORA 3RYRA 5KC5A 1IS4A 1Q3EA 2WFF3 3POGA 2DU0A 4XFIA 3AP5A 4N43A 1Z7S1 1JOBA 1PO11 4LHKA 4YARA 3SCGA 1HRI1 1OPOA 2VMGA 3ASIA 5IYYA 5FZ3A 4CDUA 3GZUC 1WW6A 2ZX4A 3BALA 5A32B 4JHZA 2E7QA 5FLIA 2IXJA 1Y3TA 4QPIA 1P8JA 3B94A 2V72A 1TMF3 3CLPA 4Q5OA 1W6NB 1SLTA 4BYYA 4Q4X3 2KXLA 3C8XA 3K77A 2GZWA 1QQP2 1RVF2 1XBFA 4FPJA 1W2TA 2BVBA 4JKMA 4RHV1 3VZNA 3ZM8A 4DY5A 3HOBA 3M3IA 5GLZA 1DZRA 1HKDA 3RNSA 4A42A 2QQMA 4HKLA 5F5CA 3VBHC 3W59A 4BQ5A 1YLLA 1W8TA 5JOYA 1MQTB 1VALA 3VDDC 4BE3A 1DHKB 1N1SA 1AYM1 2YGMA 3WT3A 1ODMA 3A21A 2GNBA 2CGOA 2GP5A 3TRSB 2B9VA 5LB6A 1W39A 1I5PA 2XMLA 4K1ZA 4YG3A 3E5QA 1IKQA 5LEKA 2FZ2A 1AUYA 2BU9A 2QQWA 3JB8A 4UFMA 3S30A 1KRIA 5D1IA 2ZGPA 4FP2A 3GCWA 4PDWC 2WN2A 4Q4Y2 4QX7A 1VBE1 1I6XA 2EXKA 2D40A 3H7JA 2DBIA 4BB3A 4EN6B 3O14A 3L2HA 4QD2A 3CBNA 1W99A 1IS5A 2L9LA 4LHNA 3WOGA 3FMGA 2H0BA 4DEQA 4PI2A 4DUWA 1UU4A 4NRPA 1KQRA 3ZIWA 2XB6C 2BWAA 3PUAA 4AYUA 1YQ2A 2UYAA 4WM7A 4RS5C 1QIQA 1V6KA 2XL9A 1VIWB 3H3ZA 1PIV3 1Q5OA 2RS31 4ZZ5A 4YM2A 4AI8A 4B4RA 4QKDA 1HX6A 4H2AA 4QPYA 3UKTA 1UU5A 1IQDC 5T5PA 4KG0A 5CFCA 3P3PA 4RSUA 4UBHA 5FKBA 5T52A 1VMHA 2IXLA 3JCIA 5CIRA 2VMEA 1BEV3 2UWCA 4CDWA 4MGSA 4ZY9A 3KV4A 1DZQA 2HWC2 3OGSA 3BB6A 2IFWA 3RI9A 1ENRA 5CNAA 3VDBA 4BQXA 2V4VA 5A3PA 1HQNA 4SLIA 5B4XA 4BDVB 2A70A 1D0GA 4IGOA 3K2OA 2MEV2 3JD72 3PJYA 4K40A 1QEXA 1S55A 3BPZA 4BQ4A 3AYDA 4XZUG 5EQUA 1LB2A 1W6QB 2ZX0A 4XDOA 2JDHA 1XYPA 1ULPA 2GMMA 5DUVA 2D6KA 1OD3A 3MIHA 2BDRA 3T0AA 1ND2C 1SPPA 4P9GA 3HIFA 1GKBA 1V0AA 2WYSA 2DDUA 5FZLA 3HMYA 5FOBB 4MOAA 1NAEA 5FPBA 5J7MA 3KQRA 3ACGA 3KZ4C 1V6OA 3LEKA 4DNYA 4E4SA 4ASMB 5AFBA 5C9AB 5CFDC 4MVTA 3AJZA 1RUE3 2YMZA 4RGKA 2UYBA 5FZCA 3FE5A 1BK1A 3ZYPA 3OJBA 4ASKA 2BNOA 4COVA 2WNVB 1SEFA 3JQWA 2HEWF 5C3QA 2W95A 5FZOB 5FPZA 4LUKA 1K5MB 3PTYA 2VMDA 1W8FA 5FZ8A 1QNYA 5FO8B 1ASJ3 3T0DA 3E5XA 5EXOA 3ZFFC 2JE7A 5GLWA 2W92A 4PI0A 2CDOA 4IGPA 4AEKA 2GSYA 4RN5A 2ERFA 3AKTA 3AXEA 4FPOB 3NKTA 1LGBA 1BKZA 1HB4A 4CU6A 2XUEA 2X5IC 3AZVA 1Q8PA 3K48A 2DCYA 3P1IA 3OEAA 5GZCA 1R1A1 3TEWA 4LUMA 1KEXA 2CU5A 1YFWA 1BHGA 1C8M1 1FMD1 2J1VA 1XSQA 2BEOA 3EMRA 2WR9A 3GZTB 2XJSA 4XJWA 2WUHA 2ZZJA 2IVIB 4DUVA 5FYZA 1VRH3 1S0BA 2Y6HA 5CG9A 2V5YA 2JKXA 3OUIA 3FBYA 1YEWA 2Y60A 1OOPA 1UXZA 3BOWA 5GLUA 1JZ7A 1A34A 5FPVA 3B69A 3G7DA 1HRV2 2VCAA 4P9WA 3ZSLA 3VBRC 1KS5A 1YNAA 2A71A 4CXXA 3KVAA 3M7AA 4QMAA 4X8NA 3VD3A 3VKNA 2XBO2 1RMU2 2ZGTA 1CD3G 1AR81 3O12A 3TNQA 5FP7A 2WNEA 1E57A 4DO0A 1COV2 2B5HA 1VBC1 1V70A 2VZTA 4A41A 4KMQA 1RUG2 4HPKB 5FZMA 3EB7A 3VHRA 1MS8A 3J8F3 5F32A 3KCXA 1N3QA 4Q0VA 1SLIA 2UWAA 5FMBA 5LBCA 4IEZA 1F35A 1N3OA 2VOKA 2D97A 3VKOA 4IEVA 1T6BX 1IKPA 1AR93 2V73A 1X7NA 3B5LB 1PO21 5KHGA 3W5MA 4Q2FA 3SXWA 4HONA 1UF2C 2TBVA 1UY0A 1MZEA 4NUBA 4CCEA 4ZZ8A 5D8AC 5DZEA 3WF3A 3LCPA 2OZJA 1OHFA 1TME1 3IDAA 3KV5A 4H3WA 3I2KA 2ENRA 5GZFA 5JR7B 3ZSMA 1DQ1A 1SFPA 2GMPA 1NY72 2R49A 3N7LA 4GMP1 4JDOA 4MGQA 2IZWA 3DPRA 4UFJA 3W21A 2HBTA 2Y38A 4ZS2A 4COWA 1CJPA 1XYNA 3LDKA 3OG2A 3PVEA 1AX1A 5HCHA 5FZEA 3NV1A 1JI6A 4M01A 2VNRA 1W2AX 4DY3A 1UN1A 1EPWA 2I2SA 1LRHA 1D0HA 3WCSA 3ZXLA 4TTGA 1CX4A 4XJAA 3RZGA 3C7EA 2VVDA 2AUYA 5E88A 2VH9A 3AFKA 5D2AA 5F6KA 2Y6FA 4QX0A 3AJYA 3DUIA 4J25A 5FYIA 2WNOA 1S2EA 1UWWA 2VUJA 4P5HA 4NIIA 1FNYA 3BYWA 4B7EA 1IS3A 2G9ZA 2OUHA 4OYUA 4YFWA 5A33A 1F8VA 3HQXA 4FCAA 5FXXA 2HYXA 1ZNPA 4GB33 4B1MA 1O3TA 3ZFGC 1SFNA 1HN0A 2VBBA 2WS93 1UY2A 4HKWA 4EN7B 1WLCA 3SMHA 4BPZA 1LHWA 1RUJ1 5L7OB 2DU1A 1W2NA 2TNFA 4YG0A 2A7AA 4INDA 2DWRA 1CPMA 3A23A 3SQOA 2P34A 4PLNA 3MBWA 4U2AA 3VD7A 1R093 3DKQA 2OKXA 1GYKA 1WLTA 3WCRA 1UQXA 1CAWB 1WMXA 2A6WA 3NKGA 2ZX3A 3N7JA 1QXJA 4Q4V1 1CQ9A 3IAQA 5JCTA 1JZ2A 4QXBA 1DBNA 3M8LA 5BYNA 2AC1A 3LD8A 3PJQA 3ZYIB 4XURA 5ISLA 4BIFA 3LSDA 1EAH3 4HBNA 2CY6A 5JR2A 4AVSA 1VBA3 2V09A 1YIFA 2SLIA 1BBT1 2JG9A 2RM23 3G6JB 3V64A 3NAPC 3UETA 1GWLA 2D5FA 4NE9A 1OFSA 5FBJA 2P4EA 4YW7A 1LOFC 2ZGMA 3ZXEA 3CZJA 3VB9A 3C7HA 3UYJA 4JGYC 2WBKA 2R071 2ZS6B 3T08A 4Q4W3 2JDKA 4ASLA 5BNPA 1V6LA 3ZYJB 2I07B 5FKCA 3INAA 5IWFA 4EWDA 3AYEA 3GM8A 3O1RA 1DG6A 5LA9A 1VB4A 2E53A 2E31A 1MPXA 5F3IA 1PGW1 1R081 3ELNA 5CKMA 2RR13 1H1AA 5FTTC 1CZSA 4A6OA 4FT8A 5KHIA 5T5JA 4QM9A 4ET7A 5C3PA 1ULEA 3S7EA 3HQUA 3WQ1A 4OI0A 4PIZA 5A33B 2ZHMA 1YCIA 1DIWA 1PHMA 2J22A 3KD4A 2ET7A 2QJVA 5ANNA 3ZDSA 2BUKA 4XCAA 5B4NA 2I45A 1UX7A 1W0PA 3S6PA 1LOGA 2VTXA 1WCQA 4LK6A 3FZ3A 1WCKA 1ZBA3 1QJX3 2OT7A 2W3JA 2WQ8A 3NL1A 1QJFA 1QJY3 1RUI2 2OUJA 4AAXA 4AHYA 5A6ZA 5K8SA 2RS11 1JU4A 2VZRA 4R8HA 5DAWA 2WNUB 5GLTA 1HRV3 1AR62 4BK4A 4K8RB 2G9FA 3AP9A 4MADA 1ZVFA 1LHUA 1FI2A 5KXBA 3I4IA 4LO4B 3PDQA 4QX2A 3KGZA 4BM8A 2B7YA 4YVWB 4CEYC 2LS6A 2XH6A 2W68A 5LRRA 1NCRA 1COV3 5BNOC 2QUOA 4GWJA 4CDUC 1S0IA 3ZFEC 4NPLA 2LUWA 4CDQA 5IVVA 1WMEA 4AOCA 2DTWA 2D3PA 2BERA 4NHLA 2Q1ZB 2XONA 4JGZC 2XXZA 3NSTA 4CEWA 1K45A 4PF5A 2DVBA 3GGLA 1XE8A 1BXHA 1AR71 1HDKA 2J42A 3MHZA 4IV3C 5F6LB 3USUB 2EAAA 1CX1A 4D7TA 3SEEA 4UBGA 4CVUA 1WZXA 5JXGA 1H2MA 4N53C 1XU2A 4K3UA 3Q8EA 2GH2A 4YGDA 5ERLA 1O91A 4IV1A 1HB3A 2A6VA 4UF0A 5BNPB 4N90A 4XEZA 1YFUA 3WDYA 1G9CA 1CAXB 2EXJA 2PHWA 1SLLA 4H14A 3WQ0A 1ZBE2 3NWKA 3PURA 1OUSA 5E6HA 2D3RA 1JYXA 1B35C 5I8SA 4RR3B 5A7PA 3WX5A 4CU8A 2JDMA 5A1LA 4LOTA 3H8XA 2XR4A 1MS3A 4AQTA 1OLME 1CWPA 1Z7S3 1GFF2 1PO13 2WJSA 1HRI3 5DPNA 4OQ9A 4Q29A 5A7OA 3Q9OA 2JECA 3NMBA 2JB4A 1HB1A 2PHRA 5FZ0A 4CP0A 3KSCA 5JLVA 3GZEA 3N9NA 4QX8A 2ADEA 1H4GA 3GYDA 1CAVA 2ZJCA 1VAKA 3WSOA 1XRUA 1SLBA 1QJU2 4GH4C 2FD8A 1O5LA 5C4WB 1H8TB 4QWNA 3WNXA 2W87A 3H8UA 2K0GA 4RHV3 4P14A 1AYN1 4QQPA 1HV1A 2JICA 4D7SA 5LCWL 1H8VA 3I59A 1DLLA 2TEPA 3M70A 2YPJA 4RA0A 4WM7C 3VBHB 3GALA 3N35A 4GWNA 1N1YA 3KHCA 4A44A 5DMYA 3TN92 3LF7A 1BQPA 5FYHA 1UW8A 1AYM3 3RZZA 3KF3A 4AI9A 5FDBA 2WL1A 3TYJA 4K20A 2EAKA 1F9KA 4XF1A 4Q0UA 2YC4A 1TQ5A 3HT2A 3MF9A 1EUTA 3ZMOA 4CDWC 2HEYF 2QZ2A 4YVSA 4GWIA 4OZOA 4QKFA 2YDEA 5FWEA 4OUSA 2ZAHA 2J1AA 4QGNA 5GALA 4DUXA 1U12A 1YQ5A 2OZ6A 5A3MA 4KWKA 3LKJA 3I2FA 1LNSA 1G8WA 1VBE3 5IVYA 4UFHA 2ZEYA 2P3IA 4IEYA 4ITCA 4AFAA 5FMOL 1NA1A 2VCMA 3LQCA 4BQ1A 4GKXA 1JOPA 4QQLA 2B39A 5CKQA 2VNVA 3VHOA 3WDUA 2VZQA 3ZDVA 1W3XA 1OMIA 3ETPA 4OHVA 2GAUA 4Y33A 1CAUA 5C4WC 1ST8A 2WO2A 4BQYA 1UYPA 2HWD1 4COUA 4UW4A 2RS33 2QDRA 4JRLA 2PHUA 2WFF2 2YFZA 5J36A 3I2DA 4LKSA 4QQHA 5I0RA 1MVQA 2BOJA 4DXTA 5ACA1 2ZMKA 3VBFA 1VAMA 3AZXA 3LIHA 3ME2A 4HSLA 3DYMA 2V4AA 4LOSA 5FMOS 2ZGRA 1WW7A 5IFTA 4I0AA 4LIVA 4F3JA 1G9FA 1O7FA 1JU3A 3AMQA 1CZVA 3HAGA 1TMF2 3KHBA 1LOAA 4Q4X2 3TNPB 5GZDA 5KBFA 3V0AA 4MO3M 2BOIA 1YHFA 1FT9A 4NIDA 5FYUA 1QF3A 1W6MA 2ZKLA 5FO9B 3I2GA 2WWJA 2H6BA 4NVPA 3WQBA 1HLCA 3NV2A 4S2HA 5LEJA 1MR5A 3PL0A 3RSJA 1BMV2 4EZ4A 3B02A 3M3QA 2NMNA 3HT1A 2RDRA 2YROA 1PVXA 5I0TA 4QT6A 5JIAA 1JYWA 3IDCB 3O0WA 5BNOA 3NVCA 4QXCA 4PLMA 4IEXA 5TSWA 1OH3A 3O1TA 3LEMA 4AFMA 3ON7A 2Q8OA 3RGBA 2W39A 3A22A 3WR0A 3KB5A 1CR7A 4FSJA 5CU1A 1PK6C 1Q8VA 3I3BA 3LEGA 5CFDB 2YZ4A 5FQ0B 3BTAA 3MPBA 3PVNA 3W5NA 4CCMA 4L11A 4N7UA 1UOGA 1RUH1 4MUVA 1W8NA 4M3CA 1NA1B 1JYNA 2FDFA 2VU9A 1C5IA 4MGZE 1NUKA 1MZ6A 2AEZA 3ES4A 3E1F1 3OSDA 4Q0SA 3THTA 1FX5A 2P3KA 2O1QA 1N47A 4N9HA 4AI0A 4YW1A 4AFDA 5A3WA 4YSFA 1CPNA 2JG8A 5DDJ1 3ZO0B 4D6RA 5C8CC 1F4HA 2FCVA 3OY8A 4NRQA 4UW6A 2BBAA 3VD9A 2KM2A 2X5IB 5FP4A 1W6OB 4CUCA 3MIBA 1PIV2 4YW3A 1YYNA 1A3KA 1R1A3 3GHNA 2RDQA 5K0UB 1XB9A 4PQ9A 4K7JA 1W6PA 1C8M3 3A0NA 5J09A 2RE9A 1W8UA 1SCRA 2ZAAA 1JZ3A 1DGLA 3UJOA 3WW3A 4OCTA 5LA1A 2XG3A 3OPWA 3VKLA 3LDBA 2CL2A 4M3CF 4AI1A 1POV0 1RJ7A 2RDNA 1G9AA 1Y9GA 3V0AB 2A3YA 5F39A 2NZ9A 3PU3A 5ABJA 1GBGA 1Y9QA 3ZSKA 5LW9A 2P3YA 5A32A 2ETEA 4UWDA 1UX6A 4FO9A 3EHKA 2GC1A 5BY5A 4O7XA 1AR83 2WA3A 1UOBA 1S0JA 1U5YA 5FZ4A 4MGKE 2BGPA 3MIFA 1VBC3 1S2BA 1W6NA 2KR2A 2X29A 3WNNA 4LHLA 1UIJA 4ZS3A 3T1LA 5BXXA 1VBB1 3LFMA 1RUOA 3UKVA 1RUD1 4AEJA 4BLJA 4QPGC 3WZ1A 3U4SA 3AFGA 1UKRA 2DVGA 2YGLA 2BJSA 2NLRA 4DFSA 3WNLA 4XBLA 3HNMA 4WVMB 1MQTA 2VXRA 3DV8A 5LBFA 1PO23 1STMA 1SACA 1ZYBA 2VW0A 3ENRA 4XFAA 4NIAA 3THDA 1RUE2 5LBBA 4XJ9A 3KS7A 4PIXA 4TLFA 1PM7A 5D8AB 5F1RA 3WLUA 1TME3 2EA7A 4CCLA 1J58A 1GUIA 1IPJA 1LR5A 1H6YA 4GMP3 1PGSA 2EALA 1G6NA 4R9AA 4W6WA 1RXGA 4M4PA 2EIDA 1ASJ2 5T5OA 2VGDA 4FXGB 3WY6A 4YZ2A 5DAVA 3ZPYA 2JXAA 5J37A 2BZDA 2EIBA 1G9BA 3CKHA 4CYDA 3FLTA 1O6UA 5A6QA 1XXNA 3GHMA 4I0WB 4CA9A 2RG4A 4TYSA 1OA2A 3VBSB 2GNMA 1SBFA 1YJLA 2XUMA 1ND3B 2B42B 4XIKA 1V9U2 4AHZA 2WYFA 2VZVA 3H1MA 3UGHA 1REEA 3E6DA 1L7LA 4PCRA 2BRTA 4NROA 4DIQA 4Y20B 1FAYA 1MS1A 1NT0A 4D6SA 1WD3A 3B00A 3FUQA 2ZEWA 3ZYHA 3UGFA 4Y3OA 4E8CA 2D6OX 4KWLA 1VRH2 2OPWA 4XFGA 4DQAA 3T2PA 5HCBA 4UAPA 2VQUA 3ZFGB 4W4ZA 5ABJB 3V56A 2Z42A 1ULOA 3MLKA 3MGUA 1RUJ3 3CJIA 2VR4A 1KDKA 1YQ8A 2PELA 1YC61 3ZXDA 2WDBA 5L73A 2UY8A 3S5QA 4LULA 5BNNA 1GICA 4R9DA 4AAPA 5C3OA 4YZ4A 4AVBA 2VZ3A 2LTNA 4QX3A 4Q4V3 2YU1A 4Q1PA 4MX3A 2YBKA 3JQXA 4XF0A 4YW2A 3WF0A 3J8F2 5F3GA 3NRUA 3N7MA 3HVDA 1N3PA 3MIGA 1W6QA 1X8EA 2DYCA 1XJAA 1XPWA 2JIGA 2WABA 4Z1VA 2QFEA 5JMCA 4LE3A 4ARYA 4ZPIA 2GALA 2Q0AA 3USSA 1AR92 4HVOA 1FATA 4OQ8A 1BBT3 4LBQB 1VMFA 4YGCA 2OQ7A 3T09A 3B3QE 3M3CA 4JCKA 5JZGB 1US3A 1ZRRA 3I3DA 4JHTA 4FFGA 1YIPA 4MSVA 4NPRA 3T3YA 1UD1A 2QNKA 3SNMA 3N9QA 2DUOA 4OI2A 2ID4A 5C9AA 1FNZA 2R073 1RGSA 5I91A 4LA3A 5J1XA 2R041 4LT5A 3CEWA 4QX1A 1QGLA 2HWB1 2ZGOA 5FYYA 4CTEA 5JPMB 5FZIA 4FOWA 4P9IA 2WNVA 2A73B 1RHI1 3M2MA 1ZZBA 2DCJA 2YUEA 3IDBB 4NHMA 4QDQA 2YXSA 1HXS1 5SV5A 1R083 5FZOA 3HNYM 1K5MA 3PLQA 1NOVA 4CE8A 4IE7A 2R16A 4YPJA 4CDQC 1GQGA 3BU0A 3SKVA 3ZXGA 1OSGA 3WG3A 1WD4A 2C1FA 1YFXA 4CEWC 5HV4A 4FAHA 4Y4RA 4WV8A 2G4IA 2CDPA 4E9KA 4NIGA 5EP9A 3MUY1 1QOTA 5EV7A 4F83A 3T2QA 2JDNA 1ZZ6A 3AB0A 4UOJA 4ISRA 1LENA 3EO6A 4XJZA 3VBUC 1Q8SA 1OA3A 3VBOA 1YWKA 1BLZA 3NJXA 4LKFA 3CJIB 2WSUA 3M3OA 3VL8A 1TVGA 4IV1C 4GB32 2VD7A 2WS92 4QAWA 3TB0A 2XKOA 2HWE1 4QB6A 1CJDA 2RS13 3RMYA 4Q26A 5BNNB 4QB1A 2VECA 4JDMA 1UY3A 2ZKNA 1ULFA 2Z2SB 3D0SA 3DN7A 5C3SA 1DP0A 1R092 2CV6A 5IW0A 4HKOA 4I3GA 4V2VA 5FLJA 1T6GC 3D3AA 4K1YA 2OYZA 4NPMA 2VMCA 1IZ3A 2FZ1A 3ZFEB 2JIJA 3PU8A 5HXMA 2HJIA 4DRRA 2ATFA 1AL21 2A1XA 2VXJA 2ZGKA 3PTRB 5JSRA 1WW4A 1DZTA 4HPKA 4JGZB 4AVAA 1PGL1 1EAH2 3U37A 1MEC1 1VBA2 2IWGB 1UMIA 3I7DA 5EZWA 1AR73 2RM22 4IV3B 4URAA 4LBNA 2FQPA 1OQEA 4N53B 4OHWA 3WXPA 3MEPA 3KQ4B 4HN1A 4JZRA 1LHNA 2DCZA 1PMHX 3PUIA 5G05L 2HWF1 5A7NA 4WVWA 4NR1A 3K3NA 3PUSA 1V6MA 1PNGA 2OPKA 2X8KA 2FHRA 3KLSA 2O8OA 5KHKA 4LIUA 4Q4W2 1DQ5A 4XUNA 1NCQB 4KBZA 1K12A 4P08A 3POJA 3VZLA 3EQEA 3OBAA 1VJ2A 4IERA 4FI9A 2Q1MA 2CYFA 2VOWA 4ZU5A 2OVUA 5JDBA 1UZZA 2P6HA 5FZ7A 5EIYB 3O1PA 4LR4A 1HJGA 2RR12 1AX2A 2PAEA 3ITQA 4E4DX 4M0HA 4YVSC 2BQPA 2VZ1A 4FPHA 4IE6A 2IXKA 2NM1A 4XE9A 5LY1A 2N7GA 4AEDB 3ORJA 4ZKTB 1JW6A 3MF6A 4QU1A 1V9U3 1AXYA 2D7FA 3VBOB 3ZOIA 3BVCA 4LK7A 4YZ3A 1URXA 5FYCA 2AZ5A 1RTVA 1PMIA 3B9IA 2IVJA 4EN8B 4XC9A 1AYN3 1IHMA 4A6SA 4AE2A 2RHPA 4Y1YA 4CP2A 4NAMA 1UPIA 3RVHA 3B01A 1V6NA 1ZBA2 1QJX2 4Z2AA 1QJY2 3AYCA 2B4KA 4AI3A 3WUDA 3OGJA 1NLRA 4OUEA 4URTA 3THPA 2Y8KA 5E1RA 4CPBA 3HJRA 4YG6A 2JE9A 1UO9A 2WRAA 5L7OA 4YW6A 2HH9A 3AZYA 4ISQA 4MHRA 4O9EA 2VOXA 3RRDA 4G4FA 1KDMA 1LAJA 3ZYBA 2O8QA 2P37A 1H4HA 4CDXC 2QQOA 1US2A 2ARBA 3SC7X 3KGLA 3U14A 2J1EA 2PXJA 1CAWA 2WFPA 3NO8A 3E97A 5FZAA 4RYDA 3ZVXA 2WZPP 4LO6B 4LNVA 1EYBA 3O1UA 3RMXA 2ZABA 2PHDA 2PA7A 3VKFC 3HNBM 2R7EB 4RGGA 4YM3A 1NYWA 2MPFA 4E2SA 1UIKA 1CZTA 3AP4A 1S4CA 4HSJA 4XXPA 3FLPA 5I8TA 4D94A 1KJLA 2SBAA 1SQ4A 4IDZA 3OGRA 1E5IA 2B45X 5CAZA 2HWD3 4GIQA 4NRMA 4R4XA 5DXDA 1FXZA 3PUQA 1EUUA 1PVC1 3MW3A 5FYVA 3SCFA 3OPTA 3VZMA 4A45A 5GJ6A 1EY2A 3MW2A 4RQPC 1Z7S2 1PO12 2B9UA 1SHWB 1VMJA 1A78A 1HRI2 3VZJA 5FP9A 3ZN4A 1APNA 2WINB 1RJ8A 2GP3A 3K4AA 3BUCA 5C33A 3S0MA 5L36A 5C3RA 1F5FA 1JXNA 3AMMA 2FMYA 4CXYA 1OC1A 3O1SA 4OI4A 2VM9A 1SBEA 1X33A 1K5JA 4QDRA 4AHXA 3TBDA 5C71A 3LEIA 4JVAA 1DYPA 4RHV2 4BMEA 3ZSJA 4QU2A 5CYYA 4EZHA 1LEDA 2BNNA 2QQKA 4QQ2A 3T30A 4AFBA 1R64A 2ZX1A 2D43A 2E32A 5A7SA 1UCXA 2E6VA 4KGQA 4XQ4A 2VL4A 4LE4A 4FPCA 4ORFA 3UT0A 2VTFA 4FPLA 4HL0A 5K9YA 3MIDA 3POSA 1VLNA 1AYM2 2W08A 5JOZA 3WQ7A 2WZEA 1H30A 2WNUA 3PUHA 1PK6B 1UXXX 2XKPA 5F5QA 3RWNA 5CADA 3WV6A 1FYUA 2MHFA 1U5XA 3PHMA 4BIOA 2MNGA 2CSGA 4TSVA 2QVSB 3ZLIA 3H7YA 4EWAA 1WLWA 1DGRA 3AKQA 4YVWA 1W8OA 1XE0A 4KI5M 1RUH3 1H1MA 3WDVA 3I2JA 3RQ0A 1Y43B 4SBVA 2WZR1 1J1TA 1KITA 1VBE2 3DEMA 1QY4A 5F9TA 4XIOA 1OF3A 4AVVA 2JJ6A 1X8MA 4Q8LA 5CVRA 3UV9A 1JTZX 3PVBB 2AENA 3FFQA 5DDJ3 3AMNA 4NIHA 5C8CB 4QM8A 1Y7BA 1D4M1 3BCWA 4UYBA 4XILA 5FZ1A 3USUA 1O4YA 2RS51 1W8HA 4FP3A 3OUJA 3ZXFA 1PZ8A 4P9YA 4CXWA 5HBAA 3SISA 4D0QA 2BYVE 4LHSA 2RS32 2OA2A 5EYYA 5JSOA 4MG2A 1BZWA 1CAXA 4QQOA 5LRSA 3KT4A 1QH6A 5JOXA 1JYTA 2Z5WA 4RR3A 3O1OA 2Y26A 3R0RA 3MPPG 3LPFA 1LODA 1S0GA 5IK7A 2ZTNA 1H9PA 2NMOA 1IG3A 4HXCA 4TXWA 5A70A 4RL7A 2D6MA 3OD0A 2ZGNA 4NOTA 1OBNA 3NNJA 4XF9A 3HQRA 4UFKA 1RINA 2DURA 5L19A 3IT8A 4FTBA 4ARXA 3M3EA 4Q0QA 1OXCA 2YB7A 2WO3A 3NNLA 1H9WA 4AGRA 2FCUA 4IXLA 1O3RA 4LQRA 5FJHA 1F15A 1BVVA 4HVRA 3GJAA 1GR3A 2A6ZA 1H8TA 2RMU1 4JQRA 4F7ZA 1VBB3 2VTXJ 2F4PA 1AL22 1ZZ9A 1HW5A 1RUC1 3P6BA 4YW4A 5T55A 2D44A 1RUD3 3B93A 5G04L 2W1UA 4HG6B 4JC1A 5CZKA 5LZ6A 3FX3A 2X05A 3V65A 3VBHA 5IK8A 4XETA 5A7QA 1HQWA 1WLDA 1XQNA 3LZZA 4N43C 1J3RA 5FZFA 3FHIB 4CUAA 2DVFA 2J1RA 2WSVA 3AKSA 2ADDA 3ZN6B 4OFGA 2ZGUA 1ODNA 2HKXA 1ULDA 1EV11 2HWF2 3KV6A 4BH9A 4CP1A 1HV0A 1O59A 2UURA 3BGAA 4QPWA 4FQZA 4HMZA 4KWJA 1BEV1 4PJYA 2CNAA 4QPIC 3RG0A 1MZ5A 2AR6A 3C3VA 4C0HA 1PZ7A 4WM8B 5DAPA 4IL7A 4LXLA 4ATEA 3A7QA 3UKNA 4G3YC 4WVZA 2W9XA 4COYA 1NE6A 2XLFA 1UPSA 4P00B 3HPNA 3GJBA 4NMIA 1XNAA 5IATA 3LWCA 1OI6A 3N4MA 4LKDA 1Y9MA 1L3JA 2C4XA 3AXDA 3H50A 5KWRA 4P9LA 2HYKA 1R1A2 2XDVA 4YZ5A 2VUDA 3C7GA 4TLGA 2ZBJA 2DF7A 3PIGA 1C8M2 1FMD2 4L2NA 3VV1A 1C57A 1V6IA 4HZFA 4AF9A 1Z0HA 5FZBA 5FZ6A 1WCDJ 2IXIA 1LGCA 2OIIA 3FN9A 2OW4A 5FAXA 3WP6A 4H7MA 1GZ9A 2I74A 1QKQA 1LU2A 3OUHA 1OVPA 5HCFA 5C9AC 1NQJA 1QXPA 5IFPA 5AFEA 1X9TA 1DCSA 2J7MA 4NO4A 3GDBA 5L9RA 5JMOA 1O4TA 1RL3A 5C7GA 3W20A 2J1TA 3DYPA 1POQA 2K46A 1AR82 5DZFA 1AHSA 3T4VA 5JIUA 2QQPA 1VBC2 1Q43A 4OZXA 1HIXA 3VHNA 3RZHA 3F2ZA 2C9KA 5C5UA 3PMSA 1SLCA 2JDUA 5IUQA 4UW5A 3VDDB 4NN0A 1AXZA 2UWBA 5M0TA 5FUNA 4AFCA 3J7HA 1FV3A 3IBMA 3LGRA 2ZX2A 1O4ZA 3HEIA 5CFCC 2Y64A 3RWKX 4K8FA 3ZR5A 1PO22 2VUAA 2XGXA 2PQSA 2Y6KA 4LBJA 1XYOA 2HBUA 3POYA 1TZOA 4JRAA 1DF0A 2Z4FA 1PM4A 2P5BA 5DUUA 2B46X 2OXBA 3D82A 3U07A 4OVEA 4R52A 2R1BA 1BVP1 1TME2 5CFDA 5IK4A 3H8OA 5FQ0A 4PDWB 1OQ1A 1RXFA 2R043 4YRDA 1UYXA 1U0AA 2HWB3 5A6YA 4B4QA 4JKLA 2GH8A 4P5YA 1VBD1 4HK9A 2E51A 4WVVA 1RHI3 1JZ4A 4FTEA 3QH7A 2CHHA 1HXS3 5FPAA 2F6BA 4XFHA 2A3XA 2YBPA 2AREA 3NJZA 1QQP1 1RVF1 3AL6A 1DGWX 3NQHA 4HN0A 4RS5B 4PBPA 1UL9A 4CPBD 4W6XA 3VD4A 4DS0A 3VZOA 4JX0A 2PYTA 1WBLA 1W0OA 1W6OA 2HLEA 2ORZA 2WC2A 2JB8A 2PN5A 2X5IA 3LIGA 5LA2A 4K21A 1TNFA 2YC2A 5FY4A 3WG2A 3O5SA 3VBUB 2A3WA 4XAAA 5IJRA 1V00A 3PMEA 4Y24A 5K0UA 2VQAA 2P17A 3PNAA 2W46A 2WQ4A 1JODA 2HWE3 3O7OA 1M4WA 1RUJ2 1S0CA 2R061 2WO1A 4FFFA 5IVFA 5LK7B 1YFYA 4XFCA 1GP4A 5T3NA 1GNYA 1WBFA 4BJ0A 1JYVA 1JYIA 4C1WA 1ENQA 1N1VA 4KH9A 2VC9A 4Q4Y1 4QHZA 5T50A 3T4HB 3RS6A 1ZRCA 1W28A 3CMGA 5JXJA 4L8QA 4Q4V2 2ZPXA 5DN2A 3URFA 2XJQA 2VO5A 4GD4A 2LM3A 1W8WA 3FC0A 4C91A 1N1TA 1Q8OA 3BPSA 1AL23 3K51A 2AYHA 3K3OA 4Y26A 4EN9B 5IVCA 5DAQA 1K42A 1BJQA 1ND2B 2YBSA 2AGSA 3I2HA 3N7KA 4HK8A 2DVDA 5EWSA 5FLHA 4R4ZA 3WNKA 3NW4A 1MEC3 2WT0A 3ZR6A 1S0FA 4MV2A 5FIXA 1BBT2 2GC0A 4LLFA 5FXWA 5CEHA 2X09A 2Y34A 1NKGA 4FPFA 5GKAC 3T2TA 3QH6A 1MS5A 3D4KA 3DKWA 4XAEA 4WVMA 2IXCA 2HWF3 4ONUA 1POV1 1OOPC 3WVJA 3UGGA 3GZAA 3MDPA 1X36A 2R072 1AJKA 4R9BA 1Q8QA 5CKNA 4XXAA 1DYKA 2HWC1 4I0BA 5FWJA 1LESA 3NJVA 3JBG1 5D8AA 4Y22B 5F5IA 4AI2A 5L7OC 2RJKA 3WG4A 3VKMA 4I2OA 2DFCA 4XTMA 3ZFFB 1SFYA 4CP9B 5EYXA 3WF2A 1PGW2 1R082 2VULA 1UY1A 2MEV1 2XJPA 3J7MA 2GN7A 3JD71 2DFBA 1W9YA 3NJYA 4L99A 5GZEA 5L9BA 1GNZA 1ZZ8A 2VCCA 2QQIA 4FVVA 1UY4A 5JI9A 5JXIA 3POWA 1TG7A 2BWCA 2RV9A 4MLOA 4J1WA 1GP6A 2VZUA 4EE2A 2PHFA 2ZOEB 3UESA 5CBLA 4YNIA 3VBSA 1YUDA 3MV01 4RFRB 1FMD3 1ND3A 2VQTA 2KA3A 5JSPA 4Z2WA 3FL7A 2ILMA 1NX9A 3ILRA 3J9SA 1YQCA 1GU3A 4XUQA 4Y20A 1H0BA 2W0XA 5F3EA 1GOGA 3VLBB 3MO4A 2RS12 3U75A 2VZOA 3I8TA 1DDLA 2BBVA 2Y6LA 2W94A 1VAVA 3VBRB 1FV2A 2E63A 3ZFGA 4B7KA 3OYWB 3DPRC 4KBBA 1DLCA 1NXD1 1UKGA 3BTXA 1Q56A 4E2QA 1VPHA 2XOMA 3JU9A 3ZYRA 5FMDA 1H1IA 4YZ1A 4CDXB 1EV12 4ZXKA 4LPLA 1VRBA 4A7KA 3IDEA 3V0BB 4IEPA 2CGPA 3QOPA 1DGRN 4CSWA 4NJ4A 3H3UA 2LROA 4MHUA 3ILNA 1XE7A 2PMWB 5FYSA 4JKKA 4XZPA 3H3LA 1AR72 2ZHNA 4FQ4A 4W8JA 5A3OA 2RVAA 5SV8A 2WAOA 2JDAA 5FYTA 5K4LA 5HI0A 5D21A 2Q8DA 1W2UA 2R1DA 3RI8A 3MLLA 2A5ZA 4WBBA 4GJZA 3WW2A 1J3PA 4I01A 2VNGA 4LBQA 3SHRA 4Y1XA 3NAPA 1C3HA 1QDOA 4MXVA 5JZGA 2PHXA 4FBFA 3R4DB 1FOD1 1W9FA 3MW4A 3DL3A 1W2OA 4HLTA 2QQLA 2FCTA 1LOFA 1UNBA 5I93A 1PVC3 4IE0A 4A7ZA 1HB2A 3HBKA 1OT5A 1WMFA 2W1SA 3KF5A 3JXSA 2PFWA 1DQ2A 4MXWB 5AC91 1RC6A 1RMU1 2XBO1 4X8PA 5FV3A 3B9CA 5DAXA 5JPNB 5HCAA 3ZYGA 2EIEA 2O14A 1LOCA 2W1WA 1GMMA 1RUG1 2WQZC 3A4UA 3AMHA 4M00A 3SCHA 4EWEA 1ZRIA 4X6RB 2A6YA 3S57A 4ZU7A 4HT1T 2OX0A 3EJKA 4IEUA 1GQHA 2JG9C 1IG0A 4I3PA 4UI9L 2D93A 1AYN2 1XNCA 2ZA9A 4XW3A 2Z69A 3TEYA 3BTYA 1QDCA 3RJ2X 3ZKYA 1GNHA 1SDWA 5A3NA 3C7FA 3WHTA 3CU7A 4CUBA 4XMIA 2O0OA 3T0BA 4C1XA 5BNPC 3ES1A 4D8MA 1RUNA 1K3IA 1VP6A 3H42B 5LBEA 4BK5A 5I0SA 1CGPA 4O61A 1F4AA 4DRVA 1AVBA 5CA6A 4RR3C 1C1LA 4I30A 5E8AA 1SG3A 3MV11 4QXKA 2IXHA 4CEYA 1I5ZA 4CU9A 2VW1A 1D2QA 2UY9A 1UZ0A 5FYBA 1JBCA 1LECA 3AKPA 3ZFEA 2WZR3 2RJ2A 1O8PA 3IN9A 4YGEA 2NPIA 3BODA 2VZPA 1OA4A 4AQSA 1U5IA 4LBKA 1A8DA 1X9PA 1VBD2 2XLGA 4HANA 4E4ZA 4XQDA 4JGZA 2QTWB 2BV4A 4A4AA 3LPGA 2OQ6A 3E5UA 3IPVB 3OGGA 3NAPB 5EHDA 4OI1A 3RDIA 4CZSA 2GNDA 5C6CA 4LA2A 2JX9A 4W50A 1H8TC 1D4M3 3ZXKA 2WIIB 5FPXA 2PHLA 3IKWA 4IV3A 2RS53 4IUGA 4XVHA 3H8RA 3DGTA 1XOYA 1XC6A 4PF1A 2GC3A 4N53A 4FOVA 1L7RA 4JGYB 2HWD2 4M4RA 2WLPA 1DQ6A 1WMDA 2Z79A 2EVXA 3D0JA 3MUZ1 5ANQA 4O9GA 4BISA 3MLJA 4IE5A 3ZPOA 3D6EA 1S2KA 3BIWE 4GWMA 5JI7A 5JAXA 1NCQA 5DUWA 1B35A 3FWEA 5H9QA 1NCRC 5ACA2 5KXEA 1JYCA 1ZX5A 5FXVA 4B4PA 4MH0E 1KFUL 3HD8B 2YY1A 2ZXQA 1W04A 3POIA 1QXRA 2R062 3VDAA 4BQWA 3OD4A 2ZGQA 1C28A 2QKDA 2YV8A 3S7IA 4AEMA 4EJRA 1W9TA 3WW1A 4BXSV 4KWUA 4K6BA 4S2GA 4LITA 1Z78A 2R0FA 4PQQA 4AEDA 4QHBA 3WDTA 5IVBA 1W9WA 1KGYA 2VBPA 4M3CE 5FUIA 2DUQA 1OURA 1UU6A 4GH4A 1REFA 1PX3A 2DCKA 4BQ3A 2RMU3 1OFNA 4BHPA 2WT1A 3BKZA 4NHYA 3UJQA 4BA6A 5A1AA 3C2UA 1RUC3 1ZREA 5FPLA 2BVVA 5FREA 5HPOA 1X82A 3VZKA 1JN2P 3ZMNA 4OHXA 3AMPA 3WD5A 1F5JA 3Q8AA 4L92A 1F2NA 5DABA 3ZYFA 4LTAA 4N43B 3K4DA 5C8WA 4CEYB 2R0HA 4FOYA 4OHZA 2WT2A 3D8CA 3F95A 4CDUB 1EV13 1GZWA 3J4UH 5DZGA 5GZGA 1YRZA 5LK5A 2W1QA 3EXUA 2VG9A 1RUH2 4UFLA 4FFIA 3FLRA 5EJ3A 1OPMA 2QQVA 2B8MA 4QPIB 1W8ZA 3M1HA 4D69A 2VQ0A 1LHVA 1VE0A 4DB5A 4JQTA 1CVNA 2V5DA 3AP6A 3CNAA 3IMMA 3U4XA 4MGTA 2VY0A 3JBG2 1AX0A 3LOBA 1IPSA 2DCTA 1J1LA 1NZCA 1IS6A 1YO8A 5DDJ2 3RYPA 4IESA 3I3QA 5F2SA 1J83A 4LO5B 3MI8A 2ARAA 4ES8A 4KQ7A 4IEQA 3HN3A 1W0NA 2LRPA 3N9PA 4NHXA 4YGBA 3VN4A 4V1PA 4JTOA 5LATA 2ARXA 1B35B 1O5UA 1RUI1 4JV4A 4XUTA 5J3UA 4B1LA 2OS2A 5C4WA 1RITA 1AR61 2C0ZA 4YW5A 3B7MA 3ATGA 5F2WA 1NZIA 2BTVC 1G86A 1NLSA 1OD5A 4J6GA 3TAYA 3ZSEA 3VDCA 1J59A 5FY8A 3DYOA 2VZSA 3NNGA 1XNKA 4PT6A 2D6NA 5T54A 1RUF1 4X6QB 1UZWA 4Y5Z0 5BPXA 3MFAA 4Y5SA 4AVTA 1NA1C 4GH4B 3N9MA 4YFZA 1CIWA 1VB2A 4L97A 5EFUA 3VUOA 4QHOA 4EROA 2UU8A 2ZZQA 4FPKA 1JS9A 2VUCA 4W6YA 4EN0A 2JD9A 4HFSA 4LEJA 2Q1FA 5C70A 5DUXA 5A3LA 2XVLA 4YM0A 1TEIA 2WO7A 4WM7B 3E6BA 5FJKA 1VBB2 4Y5TA 1AJOA 1LHOA 3Q8BA 2R30A 3IM0A 3OPZA 1RUD2 4H55A 3CDZB 2RJLA 1LOBA 1YI9A 2ZEZA 3AVSA 3R4UA 3KVBA 4HETA 2G19A 4XDPA 1ZBE1 4KGGA 5FZKA 4B29A 5CFCB 1GZWB 1MS9A 3KV9A 3VBFC 2E33A 2AEYA 5K0UC 1NQDA 3AKRA 1A6CA 1MS4A 1UOJA 3TEZA 2W2IA 4CDWB 1LJ7A 4B8EA 1GOHA 5CB7A 1PK6A 1H6XA 5LY2A 1GWKA 4OHYA 1KS4A 2ET1A 4BWOA 3HWJA 2PLV1 1GANA 1FOD2 4WZFA 4IETA 5BNQA 2Q8CA 2K2SA 4LMFA 3ZN5A 1YXWA 5FY0A 1C8NA 1KJRA 4PLOA 2VPVA 4TN7A 5B2GB 1VBD3 4TWTA 4AG4A 3RZJA 3ACHA 2XQRA 1LU1A 2D98A 4W65A 5AC92 2PQQA 1QJU1 1GQPA 2Q30A 4Q0PA 4KU7A 4N8MA 5FY5A 1QQP3 1RVF3 2EICA 4EV0A 3AVRA 2GC2A 3LA3A 1S0EA 1DGWA 1ULGA 1SZBA 2PHTA 2ZMNA 3EYPA 3J7NA 1SPPB 5FBZA 3ZIXA 2JEMA 2BGOA 4UW3A 4XUPA 5EPAA 4EQVA 1F31A 2QZ3A 1OLMA 1J84A 2QDNA 4Y1VA 4FFHA 4LO7A 1X50A 2PAKA 2CWSA 5DG2A 3TN91 3WDXA 4AZZA 2P6CA 4P9XA 4E4HA 4QGLA 3X29B 2RDSA 3K46A 4AQ6A 1FPN1 4Q27A 5ACA3 2XJVA 5FP8A 1WCUA 3WF4A 4XF4A 5A80A 4XHBA 1QJZA 2WA4A 5FZGA 1KD7A 1ONAA 2XWJB 3OEBA 2R063 3BTZA 2ZGLA 1D7PM 1M06G 4NAOA 1OKOA 1D2SA 3POFA 2X10A 4QB2A 4UFIA 1CONA 2YHJA 4AGVA 3VHPA 4AR2A 4META 3SEPA 2YG0A 4E8DA 4A3ZA 3T2OA 3R6SA 4Y1ZA 4XCBA 2JG8C 4U36A 4XJUA 1ZZ7A 4Q4Y3 5IAVA 4BU2A 1ZRFA 2XPJA 3K4ZA 1HJFA 5AVAA 4XBQA 4DEVA 1OQDA 4F8AA 2ORXA 3CIHA 4LBQD 1W03A 3MFCA 5CG8A 4P9JA 3AP7A 4AVCA 2AH2A 2ZMLA 1WW5A 4CUGA 3BIEA 1Y4WA 4Z92B 3W9AA 5LASA 1LGNA 3VBSC 3I54A 5APAA 2NN8A 1UAIA 3POEA 1ND3C 4C90A 1JOJA 2NP0A 3PVOA 3U78A 3GBFA 4ZHNA 1SCSA 2XVKA 4MZUA 4QPGA 3MZHA 3DXUA 1OKQA 2VMIA 4G9SB 3UK9A 2WFF1 4GZ9A 4J1XA 4AW7A 4ZU4A 4GAZA 3WW4A 3DCQA
chains in the Genus database with same CATH topology
1OOPB 1POV3 4GA9A 3ZN6A 5ABJC 2R042 3M4FA 2BNMA 1LOEA 2HWB2 4GKYA 2HWC3 3SITA 3JBG3 3LOIA 4NHKA 4DZGA 3D5OA 2Q5TA 2YYOA 1RHI2 1TMF1 4GMP0 4Q4X1 1HXS2 4WM8A 2MEV3 3FFZA 3JD73 1MVEA 3KCYA 2CTVA 3QCWA 4XTPA 1RB8G 5IT6A 5BV6A 1NE4A 1BMV1 4YYOA 1REDA 1H2LA 1NXMA 3A0KA 3AK0A 1MQTC 3LA2A 1RIRA 2K9ZA 5KXCA 3RPQA 1EPZA 4PBOA 2HWE2 5JZGC 3GNEA 3KCCA 1DFQA 1U5ZA 3DPRB 1KFXL 1PZ9A 1SMVA 3OBRA 4KL1A 5K7PA 1QOOA 4Z82A 1TNRA 3KM5A 2WKKA 4NWVA 4C0BA 5J96B 2E9QA 3AZWA 3BU7A 2BPA2 3T1MA 2C9AA 2E7AA 5FOJB 5H9SA 5FO7B 3SH5A 4IEOA 4QPGB 4FAGA 3H1YA 3ZX7A 1PGL2 1MEC2 4KU8A 1PIV1 3ZXJA 1SLAA 3VDDA 5JWPA 3MICA 4LO8A 5KHHA 1D4VB 1J3QA 4RFT0 3CJIC 4Y4YA 4FTSA 4Z07A 1ULCA 1FOD3 2E7TA 1ZZCA 2W52A 5BNNC 1WA4A 3R4SA 3HR9A 4PDWA 2ZACA 4H7LA 5HXVA 2HEVF 5AC93 1V6JA 1RMU3 2XBO3 1I3HA 4MGYE 4AK3A 2EF6A 4A3XA 3IIAA 2C5DA 2VVFA 4N7IA 4BMBA 4AHWA 1RUG3 3GBWA 4NWWA 1RUF2 2PTMA 3SH3A 2X53S 4Q8KA 4RS5A 2JG9B 1OLRA 2VOVA 3HN1A 4N9IA 1QWRA 2FBEA 1I1EA 1MZFA 3AX4A 1LTEA 2ES3A 2LALA 3EBRA 3WHUA 3UL2A 2BW8A 3VBUA 2WWSA 3TOJA 4XMAA 1RUE1 4FXKB 3NV4A 2GU9A 2BFUL 1IOAA 3ETQA 4QX5A 1NCQC 2WNVC 4FPEA 4DPNA 1DQ4A 1LULA 4HVQA 1K5MC 3FUOA 4LBOA 1ASJ1 5H9RA 3LB9A 3WUCA 4BZ4A 4TZDA 2QE3A 4E2GA 2JENA 3U11A 2PLV2 2XJTA 1IPKA 3QLQA 3WINE 3ROUA 3DF0A 2GNTA 4AEDC 3ECQA 4AQ2A 3IWZA 3FJSA 3JB4C 4D3WA 4COZA 4K9SA 1VR3A 1V9U1 4DXZA 2Y0IA 3VBOC 1ND2A 2BFUS 3ACLA 1QMJA 2Q4SA 3LSEA 3ALQA 1IGOA 1AF9A 4YLZA 4DOUA 1ENXA 3QACA 1XU1A 4YM1A 4ES9A 4BOWA 4JAAA 1VRH1 3WG1A 1CESA 4CRQA 4RD7A 4KNCA 4DINB 3NV3A 4XQWA 1PVC2 4OLLA 2CWMA 4A7YA 2D3SA 4XDQA 1NCRB 1O3SA 1FPN2 4WZCA 2G9GA 1B09A 2VNOA 4Y22A 4CDQB 1GZCA 5H9PA 1GV9A 1R1ZA 2ZGSA 2XJRA 3ZFFA 3ST7A 2PAMA 4CEWB 3U10A 4UXAA 3J8F1 1GSLA 1QU0A 5BUVA 3IMNA 3MIEA 2XWBB 1ZA4A 3CJXA 2CAVA 4IV1B 1AR91 3O0XA 2P2KA 3OCPA 2CAUA 4PIYA 2NQYA 1ALYA 2H0VA 1NG0A 3U0ZA 1QOSA 2XJUA 5J98B 2ZHLA 3BOPA 2GMEA 3VBRA 3OYWA 1S0DA 4GQ7A 1ZM1A 4I09A 4L9BA 1YI7A 3WP3A 1XNDA 3O0VA 3KT1A 3APBA 3SH4A 2DUPA 2WLQA 3ILFA 3RJRA 5I8YA 2R6QA 2H6CA 3N36A 3ZXAC 5E16A 1QNWA 4FPYA 4CDXA 3VGIA 1CAVB 2WZR2 2ZHKA 3CL1A 2NYYA 4DMIA 3V0BA 2D6PA 3HBZA 3OF1A 2GN3A 1PNFA 2R32A 1D4M2 3I59B 5JOWA 5FRAA 2RS52 1DU3D 4AXOA 1C4RA 4IEWA 2XVGA 4GB31 1A8MA 1C5HA 1BYHA 1JH5A 2WS91 4GULA 3QD6A 5JVVA 1RUI3 5AVPA 3W58A 3N3HA 2XHKA 1AR63 4XOGA 1H2KA 3KT7A 2DV9A 2FMDA 3SLIA 4AI1A 4MYEA 1DQ0A 3AM2A 3JUUA 1R091 4OULA 3GBGA 3TWIA 4YVSB 4XPVA 1O3QA 1WGPA 4RQPA 4AWDA 3KMHA 4MXWA 3RYKA 2YC0A 4FPGA 1YJKA 1RUF3 4M0NA 2DTYA 4GALA 2XL7A 1SBDA 1EAH1 3OTFA 1VBA1 1G9DA 3L2YA 2RM21 1MS0A 2CGNA 1GLHA 1WUVA 2RMU2 1CAUB 3GF6A 3VL9A 4LLOA 3WP5A 1RUC2 1OLQA 3H0OA 5E89A 1JHNA 3E6CC 3WDWA 1H2NA 1I9RA 2IFRA 2TUNA 1LKNA 2P3JA 1TE1B 4LBMA 4XFFA 2D5HA 4Q4W1 1ENSA 1ZBE3 3JZVA 4R9CA 5GLVA 4A2UA 5KXDA 3WP4A 1BCXA 3VBFB 4BLIA 4Q1RA 3CF6E 5I0UA 2VMHA 3LAGA 4KG8A 1AZDA 2RR11 5J48A 5KHJA 1BEV2 1AXKA 2PLV3 5KC6A 2IC1A 4I02A 2Y0OA 1AL0G 1EP0A 4XBNA 4Y1UA 4JDNA 1LCLA 2D6LX 1W6MB 1JUIA 4JTNA 1S1AA 2EXIA 4B3NA 1QHDA 1LEMA 1QJU3 4ATFA 4XHXA 2VW2A 3MYXA 4S2DA 5IK5A 2A75A 2JDZA 1WCSA 3IPVA 3J26N 5BNOB 1ZRDA 2DVAA 1ZBA1 1QJX1 4D7YA 1QJY1 2A6XA 4GXLA 2BGCA 1G7YA 4BCUA 4Z8BA 1HRV1 4JGYA 2WNUC 5FFOC 3TN93 4MGIE 3OBTA 4RQPB 4XJ8A 1FPN3 2EIGA 1IQAA 1XNBA 4LBLA 4YVWC 4XFBA 1COV1 5T5LA 4M3CB 3LA7A 2ZCWA 3FBMA 4S2FA 4AGGA 5GM0A 3H1WA 3QBQA 1CN1A 3H9AA 4FOQA 2JG8B 2XLAA 1C1FA 4IQPA 4WM8C 3R05A 3AYAA 1QH7A 4RGAA 1MACA 2GDFA 3OY8B 3CO2A 4XF3A 1HQLA 2VVEA 5DG1A 3L9JT 2JD4A 1UZYA 1JUHA 4OUMA 5FCCA 2JKBA 1W6PB 4E27A 2QCSB 4QGMA 1UMZA 3P3NA 3AZZA 1KXGA 1NY71 2EXHA 5KC5A 3RYRA 1IS4A 1Q3EA 2WFF3 2DU0A 4XFIA 3AP5A 4N43A 1Z7S1 1PO11 4LHKA 4YARA 3SCGA 1HRI1 1OPOA 2VMGA 3ASIA 4CDUA 3GZUC 1WW6A 2ZX4A 3BALA 5A32B 2E7QA 5FLIA 2IXJA 1Y3TA 4QPIA 3B94A 1TMF3 3CLPA 1W6NB 1SLTA 4BYYA 4Q4X3 2KXLA 2GZWA 1QQP2 1RVF2 4RHV1 4FPJA 3VZNA 2BVBA 4DY5A 3M3IA 5GLZA 1DZRA 1HKDA 3RNSA 4HKLA 3VBHC 3W59A 1YLLA 5JOYA 1MQTB 1VALA 3VDDC 1DHKB 1N1SA 1AYM1 2YGMA 3WT3A 3TRSB 2GNBA 2CGOA 1W39A 4K1ZA 4YG3A 3E5QA 1IKQA 5LEKA 2FZ2A 1AUYA 3JB8A 1KRIA 3S30A 5D1IA 2ZGPA 4FP2A 4PDWC 4Q4Y2 1VBE1 1I6XA 2EXKA 2D40A 3H7JA 4EN6B 3O14A 3L2HA 4QD2A 4LHNA 1IS5A 3WOGA 3FMGA 2H0BA 1UU4A 1KQRA 3ZIWA 2XB6C 2BWAA 4AYUA 2UYAA 4WM7A 4RS5C 1V6KA 2XL9A 1VIWB 3H3ZA 1PIV3 1Q5OA 2RS31 4YM2A 4AI8A 4B4RA 1HX6A 4QPYA 3UKTA 1UU5A 5T5PA 4KG0A 5CFCA 3P3PA 4RSUA 4UBHA 5T52A 2IXLA 3JCIA 5CIRA 1BEV3 2UWCA 4CDWA 1DZQA 2HWC2 3BB6A 2IFWA 3RI9A 1ENRA 5CNAA 1HQNA 4SLIA 2A70A 1D0GA 2MEV2 3JD72 3PJYA 4K40A 1S55A 3BPZA 3AYDA 1LB2A 1W6QB 2ZX0A 1XYPA 2GMMA 5DUVA 2D6KA 3MIHA 1ND2C 4P9GA 3HIFA 1GKBA 3HMYA 5FOBB 5J7MA 3KQRA 3KZ4C 4E4SA 1V6OA 5AFBA 4DNYA 5C9AB 4ASMB 5CFDC 4MVTA 3AJZA 1RUE3 2YMZA 2UYBA 3FE5A 1BK1A 3ZYPA 3OJBA 4COVA 2BNOA 2WNVB 1SEFA 3JQWA 2HEWF 5FPZA 4LUKA 1K5MB 3PTYA 1QNYA 5FO8B 1ASJ3 3E5XA 5EXOA 3ZFFC 2JE7A 5GLWA 4AEKA 2GSYA 2ERFA 3AKTA 3AXEA 4FPOB 3NKTA 1LGBA 1BKZA 2X5IC 3AZVA 1Q8PA 3K48A 2DCYA 5GZCA 1R1A1 4LUMA 1YFWA 1C8M1 1FMD1 2BEOA 3GZTB 2XJSA 4XJWA 2ZZJA 1VRH3 1S0BA 5CG9A 2V5YA 3FBYA 3BOWA 1OOPA 5GLUA 3B69A 3G7DA 1HRV2 4P9WA 3ZSLA 3VBRC 1KS5A 1YNAA 2A71A 3M7AA 4QMAA 4X8NA 3VKNA 2XBO2 1RMU2 2ZGTA 1CD3G 1AR81 3O12A 3TNQA 2WNEA 1E57A 1COV2 2B5HA 1VBC1 1V70A 1RUG2 4HPKB 3VHRA 1MS8A 3J8F3 3KCXA 1N3QA 4Q0VA 1SLIA 2UWAA 4IEZA 1N3OA 2VOKA 2D97A 3VKOA 4IEVA 1IKPA 1AR93 2V73A 1X7NA 3B5LB 1PO21 5KHGA 4Q2FA 3SXWA 1UF2C 2TBVA 1MZEA 5D8AC 5DZEA 3LCPA 2OZJA 1OHFA 1TME1 4H3WA 5GZFA 5JR7B 3ZSMA 2ENRA 5JMCA 1DQ1A 2GMPA 3N7LA 1NY72 2R49A 4GMP1 4JDOA 2IZWA 3DPRA 2Y38A 4COWA 1CJPA 1XYNA 3PVEA 1AX1A 3NV1A 4M01A 2VNRA 4DY3A 1UN1A 1EPWA 2I2SA 1LRHA 1D0HA 3WCSA 3ZXLA 1CX4A 4XJAA 2VVDA 2AUYA 5E88A 2VH9A 3AFKA 5F6KA 3AJYA 3DUIA 2VUJA 4P5HA 1FNYA 4B7EA 1IS3A 2OUHA 4YFWA 5A33A 1F8VA 3HQXA 4FCAA 1ZNPA 4GB33 1O3TA 3ZFGC 1SFNA 4HKWA 2WS93 4EN7B 1WLCA 3SMHA 4BPZA 1LHWA 1RUJ1 5L7OB 2DU1A 2TNFA 4YG0A 2A7AA 4INDA 2DWRA 1CPMA 2P34A 4PLNA 4U2AA 1R093 1GYKA 1WLTA 3WCRA 1CAWB 2A6WA 3NKGA 2ZX3A 3N7JA 1QXJA 4Q4V1 1CQ9A 5JCTA 1DBNA 3M8LA 5BYNA 3PJQA 3ZYIB 4BIFA 3LSDA 1EAH3 4HBNA 2CY6A 4AVSA 1VBA3 2V09A 1YIFA 2SLIA 1BBT1 2JG9A 2RM23 3G6JB 3V64A 3NAPC 2D5FA 1OFSA 1LOFC 2ZGMA 3ZXEA 4JGYC 2R071 2ZS6B 4Q4W3 4ASLA 5BNPA 1V6LA 3ZYJB 2I07B 3INAA 4EWDA 3AYEA 1DG6A 1VB4A 2E53A 1PGW1 1R081 3ELNA 2RR13 1H1AA 5FTTC 5KHIA 4FT8A 5T5JA 4QM9A 1ULEA 3S7EA 3WQ1A 4OI0A 4PIZA 5A33B 2ZHMA 1YCIA 1DIWA 1PHMA 3KD4A 2ET7A 2QJVA 3ZDSA 2BUKA 2I45A 1W0PA 3S6PA 1LOGA 3FZ3A 1WCKA 1ZBA3 1QJX3 4AHYA 3NL1A 2OUJA 1QJY3 1RUI2 5K8SA 2RS11 4R8HA 2WNUB 5GLTA 1HRV3 1AR62 2G9FA 3AP9A 1ZVFA 1LHUA 1FI2A 5KXBA 3I4IA 4LO4B 3KGZA 4BM8A 2B7YA 4YVWB 4CEYC 2XH6A 2W68A 5LRRA 1NCRA 1COV3 2QUOA 4CDUC 1S0IA 3ZFEC 2LUWA 4CDQA 1WMEA 2DTWA 2D3PA 4NHLA 2Q1ZB 4JGZC 3NSTA 4CEWA 4PF5A 2DVBA 1XE8A 1BXHA 1AR71 1HDKA 3USUB 4IV3C 5F6LB 2EAAA 4D7TA 4UBGA 1H2MA 4N53C 1XU2A 4K3UA 2GH2A 4YGDA 1O91A 4IV1A 2A6VA 5BNPB 4N90A 4XEZA 1YFUA 3WDYA 1G9CA 1CAXB 2PHWA 2EXJA 1SLLA 4H14A 3WQ0A 1ZBE2 3NWKA 4BE3A 2D3RA 1B35C 5I8SA 4RR3B 3WX5A 1MS3A 4AQTA 1Z7S3 1GFF2 1PO13 2WJSA 1HRI3 4Q29A 3Q9OA 2JECA 2PHRA 4CP0A 3KSCA 5JLVA 1H4GA 3GYDA 1CAVA 2ZJCA 1VAKA 1XRUA 1SLBA 1QJU2 4GH4C 1O5LA 1H8TB 3WNXA 3H8UA 2K0GA 4RHV3 4P14A 1AYN1 4QQPA 1HV1A 2JICA 4D7SA 1H8VA 3I59A 1DLLA 2TEPA 3M70A 2YPJA 4RA0A 4WM7C 3VBHB 3GALA 3N35A 4GWNA 1N1YA 3TN92 1BQPA 1UW8A 1AYM3 3RZZA 5FDBA 2WL1A 3TYJA 4K20A 2EAKA 1F9KA 4XF1A 4Q0UA 1TQ5A 3HT2A 3MF9A 3ZMOA 4CDWC 2HEYF 2QZ2A 4YVSA 2YDEA 4OUSA 2ZAHA 4QGNA 5GALA 1U12A 2OZ6A 5A3MA 4KWKA 3LKJA 1G8WA 1VBE3 2P3IA 4IEYA 4ITCA 4AFAA 5FMOL 1NA1A 4BQ1A 4GKXA 4QQLA 2B39A 3VHOA 3WDUA 1OMIA 4OHVA 2GAUA 1CAUA 5C4WC 2HWD1 4COUA 4UW4A 2RS33 2QDRA 4JRLA 2PHUA 2WFF2 5J36A 3I2DA 4QQHA 5I0RA 1MVQA 5ACA1 2ZMKA 3VBFA 1VAMA 3AZXA 3ME2A 4HSLA 5FMOS 2ZGRA 1WW7A 4I0AA 4F3JA 1G9FA 1O7FA 3AMQA 3HAGA 1TMF2 1LOAA 4Q4X2 3TNPB 5GZDA 5KBFA 3V0AA 1YHFA 1FT9A 1QF3A 1W6MA 2ZKLA 5FO9B 4NVPA 2H6BA 1HLCA 3NV2A 4S2HA 5LEJA 1MR5A 3RSJA 1BMV2 3B02A 3M3QA 2NMNA 3HT1A 2YROA 5I0TA 1PVXA 5JIAA 4QT6A 3IDCB 3O0WA 5BNOA 3NVCA 4PLMA 4IEXA 5TSWA 2Q8OA 3WR0A 2W39A 3KB5A 1CR7A 4FSJA 5CU1A 1PK6C 1Q8VA 5CFDB 2YZ4A 5FQ0B 3BTAA 3MPBA 3PVNA 4L11A 4N7UA 1RUH1 4MUVA 4M3CA 1NA1B 2VU9A 1C5IA 4MGZE 3ES4A 1MZ6A 4Q0SA 3THTA 1FX5A 2P3KA 2O1QA 1N47A 4N9HA 4AI0A 4YW1A 4AFDA 4YSFA 1CPNA 2JG8A 5DDJ1 3ZO0B 5C8CC 3OY8A 4UW6A 2KM2A 2X5IB 1W6OB 3MIBA 1PIV2 4YW3A 1YYNA 1A3KA 1R1A3 3GHNA 5K0UB 4PQ9A 4K7JA 1W6PA 1C8M3 3A0NA 5J09A 2RE9A 1SCRA 2ZAAA 1DGLA 3UJOA 3WW3A 2XG3A 3VKLA 2CL2A 4M3CF 1POV0 1RJ7A 1G9AA 3V0AB 2A3YA 2NZ9A 5ABJA 1GBGA 1Y9QA 3ZSKA 5A32A 2ETEA 1UX6A 4FO9A 3EHKA 2GC1A 5BY5A 1AR83 2WA3A 1S0JA 1U5YA 4MGKE 3MIFA 1VBC3 1S2BA 1W6NA 2X29A 4LHLA 1UIJA 3T1LA 5BXXA 1VBB1 1RUOA 3UKVA 1RUD1 4AEJA 4BLJA 4QPGC 3WZ1A 3AFGA 1UKRA 2DVGA 2YGLA 2NLRA 4DFSA 4XBLA 4WVMB 1MQTA 2VXRA 3DV8A 1PO23 1SACA 1ZYBA 2VW0A 3ENRA 4XFAA 1RUE2 4XJ9A 3KS7A 4PIXA 4TLFA 1PM7A 5D8AB 5F1RA 3WLUA 1TME3 2EA7A 1J58A 1IPJA 1LR5A 4GMP3 1PGSA 2EALA 1G6NA 4R9AA 4W6WA 3WY6A 1ASJ2 5T5OA 2VGDA 4FXGB 4YZ2A 3ZPYA 2JXAA 5J37A 1G9BA 4CYDA 3FLTA 1XXNA 3GHMA 4I0WB 4TYSA 1OA2A 3VBSB 2GNMA 1SBFA 1YJLA 2XUMA 1ND3B 2B42B 4XIKA 1V9U2 4AHZA 3H1MA 1REEA 3E6DA 4PCRA 4Y20B 1FAYA 1MS1A 1WD3A 3B00A 3FUQA 2D6OX 4KWLA 1VRH2 4XFGA 4DQAA 5HCBA 3ZFGB 5ABJB 3V56A 2Z42A 3MLKA 3MGUA 1RUJ3 3CJIA 1KDKA 2PELA 3ZXDA 5L73A 2UY8A 4LULA 5BNNA 1GICA 4R9DA 4YZ4A 4AVBA 2LTNA 4Q4V3 4XF0A 4Q1PA 4MX3A 3JQXA 4YW2A 3J8F2 3N7MA 3MIGA 1N3PA 1W6QA 1X8EA 2DYCA 4Z1VA 2QFEA 4LE3A 2GALA 2Q0AA 3USSA 1AR92 4HVOA 1FATA 1BBT3 4LBQB 4YGCA 3B3QE 3M3CA 4JCKA 5JZGB 1ZRRA 1YIPA 4MSVA 4NPRA 1UD1A 2QNKA 3SNMA 2DUOA 4OI2A 5C9AA 1FNZA 2R073 1RGSA 5I91A 4LA3A 4LT5A 2R041 3CEWA 1QGLA 2HWB1 2ZGOA 4CTEA 5JPMB 4FOWA 4P9IA 2WNVA 2A73B 1RHI1 3M2MA 1ZZBA 2DCJA 2YUEA 3IDBB 4NHMA 5SV5A 2YXSA 1HXS1 1R083 3PLQA 1K5MA 1NOVA 2R16A 4CDQC 1GQGA 3ZXGA 1OSGA 3WG3A 1WD4A 2C1FA 1YFXA 4CEWC 4FAHA 4WV8A 2G4IA 4E9KA 1QOTA 5EV7A 4F83A 1ZZ6A 3AB0A 4ISRA 1LENA 3EO6A 4XJZA 3VBUC 1Q8SA 1OA3A 3VBOA 1YWKA 3VL8A 3CJIB 2WSUA 3M3OA 4IV1C 4GB32 2WS92 3TB0A 2XKOA 2HWE1 1CJDA 2RS13 3RMYA 4Q26A 5BNNB 2VECA 4JDMA 3D0SA 2ZKNA 1ULFA 2Z2SB 3DN7A 1R092 2CV6A 4HKOA 4I3GA 5FLJA 1T6GC 4K1YA 2OYZA 1IZ3A 2FZ1A 3ZFEB 2HJIA 4DRRA 2ATFA 1AL21 2ZGKA 5JSRA 1WW4A 1DZTA 4HPKA 4JGZB 4AVAA 1PGL1 1EAH2 1MEC1 1VBA2 2IWGB 3I7DA 5EZWA 1AR73 2RM22 4IV3B 4LBNA 2FQPA 1OQEA 4N53B 4OHWA 3WXPA 3MEPA 4HN1A 1LHNA