4B4RA

Crystal structure of the lectin domain of f18 fimbrial adhesin fedf in complex with blood group b type 1 hexasaccharide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F18 FIMBRIAL ADHESIN AC
publication title Structural Insight in Histo-Blood Group Binding by the F18 Fimbrial Adhesin Fedf.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Cell adhesion
total genus 31
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b4rA00
4B4RA 4B4PA 4BWOA 4W6WA 4B4QA 4W6YA 4W6XA
chains in the Genus database with same CATH superfamily
3OG2A 1V9U2 1YI7A 4Z82A 1O8PA 2D43A 3MYXA 4FPCA 1X36A 4JKMA 5FMBA 4JGYA 3IAQA 1HRI1 2EAAA 2DWRA 2R041 4P00B 3ZVXA 5IK7A 4E4DX 2BGOA 4M4PA 4UWDA 3U11A 1NZIA 1PIV2 1VIWB 3WNLA 1YFYA 1VMFA 3GXUA 4XBNA 3WG2A 4P5YA 5L7OA 4NRQA 3LEIA 3T0AA 4AEDA 4XF9A 4P14A 1UF2C 2WNVA 2YBPA 2RS13 2WNUC 3PVBB 3UL2A 2RDQA 2JB8A 5F7UA 4FFGA 2HYKA 2X5IA 3WQ7A 1U5YA 1ULPA 1UL9A 4IEVA 5I8TA 5A6QA 1SFYA 1OA4A 4CCLA 3OBRA 5J98B 4NHYA 4Y5SA 5FJHA 2B46X 2YC4A 5FP7A 2FCTA 5FOJB 1R081 2QJVA 1QNYA 1V6MA 3D3AA 3WT3A 4IEYA 3I2GA 4DINB 1GZTA 1FPN3 3VD9A 1KQRA 4UBGA 4RA0A 3CF6E 3BUCA 4Q1RA 1GICA 5JXGA 2HWB2 3C7HA 2VNRA 1WKYA 3W58A 3BPZA 1JYWA 2Z79A 3M3IA 1J3RA 3D0SA 3PJQA 1CAVA 2BOIA 3ZFGB 2FDHA 4YNIA 1GWLA 1UZYA 2X53S 2GC3A 1FNYA 1QH6A 5E89A 2ADDA 4CUBA 1GOFA 2FD8A 3CO2A 2R071 4WM7C 5B2GB 4PQQA 2GH8A 2BQPA 1ASJ3 4COYA 1CAXB 2YV8A 3M7AA 3NQHA 1N1VA 3DF0A 3ZSEA 1OF4A 1WD3A 5ACA1 2RM23 1BLZA 4Y33A 3WF4A 5BNOA 3QBQA 2R32A 3OEBA 3MO4A 2VQUA 4BDVB 1KDMA 1BEV3 2B42B 4V1PA 5GZFA 2WWJA 5AC93 1H8TB 4FPKA 3VBRA 2P34A 3KLSA 3NSTA 4IGOA 4YW1A 1NX9A 5HCAA 4BXSV 1LTEA 1W2TA 4LQRA 3THTA 4AVCA 5BYNA 3UT0A 1TNRA 1VBC1 2D93A 1V0AA 4LBKA 3UETA 3FL7A 1VAKA 3BPSA 3AP4A 4B1MA 3P6BA 5IVVA 4IE7A 1SZBA 1WGPA 5D8AA 2UWBA 5L36A 2FDKA 4ZU7A 4QHOA 4CSWA 4QHBA 1R091 2RV9A 3LB9A 4PCRA 2G9ZA 4HKOA 4B4RA 1LOGA 3AK0A 4D0QA 3O7OA 1KFXL 1UOJA 5GM0A 1AYN2 1SFNA 2UWCA 3IIIA 4K1YA 2RJKA 1VB4A 1SLTA 3RMYA 3VBFB 2BFUL 2OKXA 4F8AA 1MS4A 1YIPA 1O4TA 1WLWA 1MZ5A 4XC9A 1W8UA 1IS6A 3I2IA 3S0MA 4QXCA 4FAHA 3RZHA 3ZX7A 3WP3A 1U5ZA 1DQ6A 4BLIA 3K46A 3BN6A 2RS53 1BK0A 1CZTA 1VRBA 3CBNA 1ZBE1 4N43B 2RMU1 2JXAA 1X33A 4Q4V2 1QJFA 1XNKA 4A3XA 4ZZ5A 3O1OA 2RR13 2XB6C 5F6KA 3PU3A 2QQVA 1U12A 2A75A 1NCRB 5BNQA 2WA4A 3MIDA 3E1F1 4GMP1 2NM1A 5LK7B 2JKXA 1YJKA 3B93A 5D21A 1WUVA 2W94A 5FZBA 2WA3A 1TME2 3P1IA 2GZWA 3JBG3 4HSLA 1F4AA 5LA9A 1MS5A 4JTNA 4HXCA 2B4KA 1JH5A 3N9QA 3SQOA 5IK8A 3I2DA 4CEWA 3WXPA 1NE4A 1FMD2 2F17A 5A7OA 3J26N 4Y3OA 3WW3A 3OGGA 1UXZA 1ND3A 1WZXA 4QDSA 1UW8A 4CEYB 1XQNA 5FPAA 2JKBA 1DQ0A 1OURA 4S2GA 3SNMA 2LUWA 5C70A 2LTNA 3HR9A 2C24A 1RUI1 3G7DA 4IEPA 1E57A 1UWWA 3AKPA 5FPBA 5IT6A 4FSJA 2ADEA 1CWPA 1DBNA 5DG1A 1LRHA 1H9WA 1X9TA 4CCDA 4O7XA 4CCJA 2WNUA 3ZO0B 2JDUA 1RUD3 2R7EB 1O3TA 1SLBA 4P9YA 2XQXA 5EP9A 1TG7A 1I1EA 4I3GA 2GMEA 4PHZA 3O1VA 3E6DA 4PF1A 1OC1A 3RI9A 5F1RA 3V0AB 1LOCA 4JGZC 4KI5M 4OCTA 4EN0A 3VBUB 5GZGA 4XQWA 4U36A 2W52A 1Y3TA 3DEMA 4IL7A 5TSWA 4RL7A 2OZ6A 2ZGQA 3LDKA 4AI0A 3ATGA 4CDQC 4EN7B 3BOPA 3P5BA 3GCWA 5D2AA 4XTPA 3MEPA 1HN1A 1X8EA 2A70A 2RDNA 3WNPA 2C9AA 5CB7A 1BYHA 4L92A 1COV2 4QQLA 3LZZA 5A3TA 1YQCA 3ZXLA 4Z8BA 4CTEA 4RFRB 1NXMA 2NPIA 1VR3A 1SG3A 1ZYBA 3NNJA 4WM7A 5A7WA 3VDDC 4LK7A 4XJZA 2VMIA 4AQ6A 1RUE3 2AEYA 3ZSLA 1RUG3 1AYM1 3HMYA 4NIAA 1MQTC 5BNPB 1R1A1 3WDVA 4XJWA 3WQ1A 1S0JA 3KV4A 3WR0A 2HEVF 1X50A 1NZCA 5KWRA 4IESA 5I91A 3TWIA 5CFDC 1GANA 1REFA 3URFA 2BU9A 1KJLA 3VKNA 5FZOB 4A4AA 1HXS3 5I0SA 5L9BA 2GC2A 1V00A 5FMOL 1IQDC 3PU8A 3POYA 1XE0A 3DPRB 4GA9A 2WS93 4JDMA 4KWUA 2YZ4A 4S2DA 4FPFA 3HEIA 4UXAA 5FZGA 5F3CA 4AFBA 3UJQA 2ARBA 3RZLA 2V73A 2WJSA 2VVFA 3NAPB 5DDJ2 5ERLA 1LECA 4Q4Y2 2W1SA 1W0NA 1REEA 4LUKA 2HWD1 4NRMA 4UFMA 2VE1A 3PUSA 4FXGB 3KT1A 3WUCA 4TYSA 4CVUA 1XU1A 4S2HA 3K2OA 4I3PA 4LLOA 5FYMA 4K21A 2QKDA 1IKQA 1HB3A 1C1LA 2Z2SB 5LY1A 4KWLA 4Z07A 3ZR6A 4CE8A 4QX1A 4OHZA 3KVAA 2ZKNA 2KA3A 4BMEA 4KWJA 2WQ4A 4ZONA 4FTBA 2X8KA 4WZCA 2A6ZA 1AJKA 2XUEA 1Z7S1 5F3GA 4K20A 4URAA 1XRUA 4GXLA 3JD73 1CESA 2ZMNA 1W9SA 3NRUA 1F4HA 4IV3C 4MADA 1VE0A 1DP0A 1RMU2 2Y60A 1EAH3 4FOYA 1JYTA 1N3QA 2WBKA 3IDCB 3POSA 4AI2A 1Q56A 2E6VA 1QHDA 2CV6A 4OLLA 2WYSA 1WCUA 4U2AA 3WY6A 1BVP1 1W39A 3CL1A 1HQWA 2N7GA 3MFCA 1ALYA 4WVZA 4X8NA 4CRQA 2XVLA 1AR91 2VO5A 4DO0A 3WCRA 4IEWA 4TLFA 4COVA 4XVHA 2PHFA 3T2PA 3FWEA 1MS8A 3KF3A 3M2MA 2Y6GA 1XJAA 5IAXA 2DVGA 2R061 4N7UA 5AFBA 3FHQA 5HBAA 4LE3A 4HVOA 2L9LA 5FJKA 1QKQA 5JIAA 5DXDA 3KWVA 1BBT2 1KDKA 1V6JA 4LE4A 1GOGA 4ASKA 4LA3A 5LA1A 1VBC3 2ZZJA 2DF7A 4ZU4A 3VN4A 4OMCA 1Q5OA 3R6SA 1O59A 3SEEA 1CGPA 3ZMOA 3OPTA 4Q5OA 4UOJA 3CJIC 4UW5A 5FZDA 3IPVB 2VCMA 4BQWA 4CDQA 2PXJA 4JVAA 5CISA 3NKGA 4IE0A 3RNSA 1OH4A 3VBHA 2YUEA 2GSYA 3HBZA 4MHRA 2B39A 1WA6X 2VOVA 2OIIA 2PYTA 2WINB 5DZGA 3RFRA 1ZBA3 3SISA 1ND2A 4DUXA 3I2OA 3E5UA 3EHKA 2VBBA 3K4ZA 3E6BA 3VDDA 1C8M3 4AGGA 3TNPB 4AYUA 4IEZA 3JQWA 4M3CF 5FMCA 3GM8A 4XFBA 3ZFFC 2XLFA 4OFGA 3H8XA 2NP0A 2DTWA 1AX1A 2EIEA 1IS5A 3OBAA 5FXXA 3THDA 2XR4A 3AKSA 1NA1B 4CP1A 5HXVA 4BH9A 4EN8B 5CG8A 2HWF3 1HB2A 4YVWC 5CFDA 3OD4A 2BWCA 5CU1A 3NV2A 3VBOB 1LOEA 1PM7A 1OPMA 1G86A 1WCQA 4DB5A 3N36A 4MUVA 4QKFA 1ZZ7A 3HNBM 3HT1A 3WINE 5JZGC 1CQ9A 4I2OA 1DYKA 3BB6A 4XMAA 3CJXA 2J42A 4KMQA 3WW2A 1GOHA 3UESA 1RUH2 5B4NA 2MEV1 3K3OA 3UKTA 2P3KA 2FBEA 2JICA 5LCWL 2PQQA 4FOQA 3KV5A 5FK7A 1QJY1 4Y1YA 1PNFA 2VG9A 4XFGA 4A44A 1LODA 4E27A 3T0DA 2F6BA 3PL0A 3OYWA 4XTMA 4YPJA 4C1WA 1TNFA 5D1IA 5LA0A 3A23A 4MGKE 1OLRA 2Y38A 1LHUA 1VBA1 1X8MA 1D4M1 1RUI3 4QKBA 4IW3A 3IIAA 1WLDA 4YSFA 4GB32 5KHKA 3C7GA 1I5PA 3RVHA 4I0WB 4XJAA 5C71A 4QKDA 1SMVA 3INAA 3NNGA 2OPWA 1W8NA 5SV8A 1FXZA 4CDWA 1W8ZA 1E5IA 3PIGA 3WDUA 4BOWA 2EXIA 2X29A 4XFCA 3H3UA 4RQPC 3ZFEB 3M3EA 3U4SA 3I4IA 2ZEXA 1YNAA 3JUUA 4LHNA 3SEPA 5HV0A 4LO7A 1HQLA 4XIKA 2W91A 3AP5A 1RUF3 4M01A 5FY5A 2JIGA 3M3CA 4LMFA 1PMIA 4YM3A 4FFFA 1PVC3 3AL5A 3BODA 1K5MB 1T2XA 1YXWA 2XMLA 3IAPA 4GALA 5A7SA 4ET7A 4LBMA 4SBVA 1TQ5A 3O12A 5LA2A 4EZHA 2Y8KA 4WVMB 3OBZA 3LAGA 1VBE1 1N47A 2VULA 1PO23 4LA2A 4FTEA 3D6EA 4MVTA 4LR4A 3WHUA 1LGBA 1UY1A 1D4VB 1P8JA 1B35B 3DL3A 3PIJA 3ACGA 2BERA 4DXRA 4KWKA 1YQ8A 1Q3EA 2ARXA 3MLKA 4FPGA 5J48A 1SBEA 1R1A3 3T09A 2PHDA 1FATA 4QPYA 4RD7A 2JWPA 3NNFA 5KR7A 3WG4A 3POFA 3LOBA 4JHZA 4V2WA 3LGRA 3AZWA 1NKGA 3ORJA 5EIYB 2A3WA 2VNGA 2JJ6A 5FIXA 1W2NA 3EQEA 3H1MA 3W5NA 5HCFA 5GLWA 1UO9A 3JXSA 1XOYA 2BVVA 3K3NA 5FTTC 1AR73 2UY9A 3WP6A 4HVQA 2GNMA 1S2KA 1VRH3 5C4WB 3QH6A 5E1RA 5A3OA 4QX7A 3ZOIA 4N90A 4GMP0 3LEMA 4OQ8A 3CJIA 4IDZA 4YG6A 4OHWA 3SCGA 1VBD3 1QY4A 3SITA 2HWC2 4QX2A 1H2KA 1C1FA 2MNGA 1HV0A 1SLCA 3LIHA 3O0WA 3HJRA 1KEXA 4DRVA 2VZTA 3C7FA 5ISLA 2VCAA 3I2HA 4AAXA 1H8TC 4Y26A 4E2SA 4Q0VA 4AI1A 3AX4A 1YEWA 2XG3A 3IT8A 1VJ2A 4LBQB 3PVNA 4W50A 4BXFA 3IMNA 2JG9C 1OSGA 3OJBA 3ZFFA 3LIGA 3WF3A 5J36A 3ACIA 2BBAA 4JQTA 1RHI3 4CDUA 3P3NA 4AFDA 1MEC2 2W68A 1C4RA 1LR5A 3JZVA 3QD6A 5FLHA 5K0UA 1Z7S3 2UYAA 1N1TA 4MH0E 5LBFA 1CIWA 3AJYA 3ZPOA 3MV11 4XURA 3AM2A 5FYSA 2WRAA 2GC1A 5H9SA 5JZGA 1GQHA 2YROA 4RN5A 3VBFC 5CNAA 1UY4A 4N7IA 4NROA 2HH9A 2H0BA 4P9WA 1O8SA 1NY72 3POWA 3B94A 3JCIA 1GUIA 4I30A 4D6RA 2E7QA 2IVJA 1UY0A 4QHZA 4YVSB 3PJYA 4Q0UA 1AR81 2OT7A 1AR61 3M70A 3LFIA 2WO7A 4HMZA 4CP9A 3HVDA 1AL23 4N43C 3LF7A 4URTA 4BMBA 3VHRA 2G9FA 5FCCA 2A1XA 2V72A 2XKPA 4YYOA 2LROA 2ZGMA 1UX7A 4YGBA 5EV7A 3QLQA 1NCQB 2WZR1 3LA3A 2QFEA 4LKDA 4V2VA 2QZ3A 5E8AA 3AVRA 3U75A 2G4IA 2XJRA 4KQ7A 2YFUA 3I2JA 4YW4A 2A7AA 4KGQA 3H8UA 1EV12 2QZ2A 2DCKA 1JHNA 1MS1A 2BWAA 2DTYA 1H4GA 1L7LA 1L3JA 1W6OA 2X5IC 4FO9A 3WHTA 1FYUA 4LTAA 3NW4A 5JMOA 4RQPA 4CUGA 2WWSA 4Y5TA 4B1LA 2PQSA 5T5LA 3V65A 3I2FA 1BQPA 1POV3 1C28A 1QQP2 4YW7A 2C6SA 2VM9A 1U0AA 5FAXA 1FOD2 1S2EA 3DYPA 2WN2A 5T52A 4CEYC 4YZ2A 3UV9A 3RZGA 1QOOA 5BXXA 2EA7A 3EXUA 1WW4A 1CAUA 5F37A 3WSOA 1KGYA 2QTWB 1V9U1 5FZ9A 3VZNA 4Q0SA 5A3LA 1V6NA 4NIHA 4FI9A 3O5SA 3ACFA 3J7LA 5LB6A 4BE3A 1EUTA 1OPOA 4QX3A 1JYNA 3KHBA 4L2NA 1PIV1 2B7YA 1EPWA 1PNGA 5DN2A 2WT0A 2ARCA 3WNMA 1I9RA 3OUIA 4ONUA 4C1XA 3MPPG 3ZKUA 4N9IA 4NHMA 4AQSA 3MI8A 2RS12 3BVCA 4BIFA 4GJYA 5KBFA 5BUVA 4KG8A 2WFF3 1HN0A 1MS9A 1N3PA 2PMWB 5DUWA 4NR1A 5F2WA 4QB6A 4YGCA 1RUC3 1ONAA 3WF0A 4SLIA 3NL1A 2DU0A 3OGRA 1EPZA 3GBGA 1ULGA 5DZFA 1EYBA 1M4WA 1SCSA 1S0EA 1Y9MA 3VBRC 4TWTA 4M3CB 3GF6A 3U07A 1LAJA 2BNOA 3HNYM 4HN0A 4HFSA 4NHKA 3E6CC 2VZOA 2HWB1 2O0OA 2ZTNA 3ES4A 5LATA 2E31A 3ILFA 4ZXEA 1ULEA 2MEV3 3HIFA 3MBWA 2XHNA 5I0TA 3ZYFA 4LOTA 1CAXA 3MIFA 5JOXA 3AZVA 4QB2A 2YG0A 4EWEA 4GIQA 4CDXB 4H55A 2VMFA 1URXA 1J1TA 2A3XA 4ZXKA 1UU4A 3D4KA 1H8TA 1OH3A 4Q4W3 2GMMA 2FZ1A 1W6PB 2GDFA 1GQPA 4IEXA 4G9SB 2JG8B 2RM22 2FCUA 1WW5A 3RZKA 1JZ6A 1H9PA 4YZ5A 1OHFA 3I3DA 5GZDA 1Z0HA 1Q8PA 1BEV2 3BYWA 3HNMA 3OGSA 2CAVA 3CNAA 2GNBA 1XNAA 3KT4A 4ZS3A 5DUXA 1QGLA 5C3OA 2HLEA 5LEJA 5ABJB 3NAPC 3TYJA 1H2LA 4BCUA 3LEGA 5C8CB 3ETPA 3CZUA 3OGVA 4CUAA 3NJYA 4NIDA 3ES1A 3H9AA 5FZ1A 5FP8A 4FTSA 1G8WA 2G9GA 1D2SA 4CPBD 4Y1XA 5FZ7A 3VBFA 4YFZA 2UWAA 2B8MA 2VQTA 3OPZA 5FO7B 4RS5B 4ES8A 1H2NA 4L8QA 4QD2A 1UYYA 5FWJA 1LEMA 1VBE3 4B8EA 4NHXA 5DZEA 1ZRRA 2Z42A 3POGA 5FYZA 5L9VA 3PMSA 2VVEA 3WX5A 1AYN1 3LDRA 3T4HB 2PAEA 3J9SA 5C9AB 4N43A 1ND3C 3ENRA 4AQ2A 1W0OA 2O8QA 2R49A 4GWJA 5LRSA 2YFZA 3HPNA 4NVPA 3CLPA 1M06G 1NCRA 5CKNA 4GH4B 4DIQA 2VMEA 3N7LA 4NPMA 3J8F3 3O1MA 2RS52 3OGJA 4P9JA 1LHWA 5FUIA 2ZX0A 1ZZ6A 4Q4V1 3IDBB 3BI3A 3USUB 5CVRA 5HCBA 4FCAA 1GP5A 3GZUC 4QU2A 2RR12 2WABA 2CNAA 1SPPA 3Q8EA 4J6GA 5LY2A 2R30A 3POIA 3RS6A 4F83A 4PF5A 1XE8A 1ZZ9A 2ERFA 2WO1A 1ACCA 5FYYA 2W92A 2BJSA 1TME1 3B69A 3JBG2 4HKWA 4JCKA 5L9RA 1XPWA 3OSDA 4CEYA 5T5JA 1YFXA 3K4AA 5FYIA 3T2QA 3I3MA 1GU3A 1J84A 3SC7X 1US3A 1FMD1 3U14A 3DCQA 1HKDA 2A6YA 3BTZA 2WLPA 4ZKTB 1DYPA 2A6WA 2WO3A 4K7JA 1OKOA 1E5HA 3FUQA 3VBSB 5KHIA 1HIXA 1NLQA 1ZM1A 1OKQA 4K8FA 1W9WA 2J1SA 4BQ2A 2JE7A 5K7PA 1UZWA 2DBNA 1W3VA 4W6WA 3WDXA 2EIBA 5H9RA 3FHAA 2ZX4A 3Q8FA 3V0AA 2PHTA 1QJU3 3I2KA 3L2YA 3LSDA 1FT9A 3AZZA 1UOGA 1WA4A 1HJGA 1OA3A 3PTYA 4WV8A 5DABA 1NLRA 1UNBA 3O1UA 1DGWA 2P6CA 5FPLA 4IV1B 4W8JA 2XDVA 1GBGA 4OUMA 4NE9A 1PGSA 5JVVA 4R4XA 3WNKA 5A1LA 1QNWA 4UF0B 1CVNA 3M4FA 4D94A 2HYXA 2RS31 4LULA 4CU7A 2PHUA 4H14A 2KR2A 4EROA 5HI0A 2VW2A 4LJHA 4LBNA 4XBQA 2F4LA 3AMHA 1RYYA 2VC9A 3AYEA 1YYNA 3M8LA 2Y26A 3OBTA 1GZ9A 1COV1 5AVPA 4AEJA 4BWOA 1OBNA 3H8RA 1GNYA 5JSRA 5BNPA 1UKGA 3RZMA 2R16A 5FYUA 5T54A 1BVVA 3ME2A 3THCA 1PGL2 3ZPYA 2JE8A 4TSVA 3U10A 4BPZA 1HRV3 2WSVA 2JDNA 2NLRA 3NJXA 3C7EA 3MW2A 2XL9A 5FZOA 4PT6A 5FY1A 2PTMA 4X6RB 4BK5A 2GP5A 2A6VA 2XBO1 1NG0A 3J7MA 2H6CA 1NT0A 3DPRA 2W2IA 1PO13 5IW0A 3AYAA 1RUJ3 1QOSA 1VBB1 5IWFA 1XU2A 2QDNA 1K42A 4FOVA 1HXS2 3BTAA 2TUNA 4NAMA 3NAPA 4Y20B 3DN7A 3ZYRA 1QJZA 3ELNA 4FFHA 3OUHA 5FDBA 3LWCA 4LITA 2DBIA 5A70A 4AGRA 2WS92 2CWMA 1CIYA 1LENA 2DCZA 1XSRA 2XUMA 2Y0OA 2FDJA 3OY8B 3T0BA 4RR3B 2NYYA 2KXLA 2TEPA 5FQ0B 2VZQA 1XYOA 1G9FA 1OQ1A 3GDBA 4XJ9A 5DDJ1 5JXJA 2BP6A 4Z2WA 4YM1A 5EFUA 4Q4Y1 4Q27A 2VW0A 5IVEA 4Q4X3 1HQNA 1UYZA 1GZWB 5K0UB 3B7MA 3GNEA 3J7NA 2ZOEB 1NXD1 3WEZA 4B4PA 3B01A 3AP6A 1ZZBA 4FPLA 3UK9A 5A6XA 2IUWA 2ZA9A 1K5MC 4AI9A 3ON7A 2JD9A 1XYPA 1G9DA 5L7OB 1ENRA 2ZGTA 5M0TA 1O91A 4OULA 3JD72 4HSJA 1W8OA 4J1WA 5F5IA 3PMEA 3S7EA 1RMU1 1EAH2 2P3YA 3PDQA 3POJA 4FVVA 2JB4A 4LBQD 2BZDA 3I3EA 2W39A 2GMPA 3N7KA 5FREA 1CN1A 3A22A 3TNQA 2RS32 4HK8A 4AW7A 1F2NA 3HQRA 4JDNA 4CPBA 2ZMKA 2ARAA 3LDBA 1D7PM 5BV6A 4WZFA 3ZN4A 5A3NA 5BY5A 2BBVA 3AB0A 1MZ6A 4PDWB 1TMF3 3VBHC 2JE9A 3KQ4B 1KITA 2ETEA 1IS3A 1ND2C 3JQXA 2PLV2 4I02A 1VMHA 5JCTA 4YWAA 4PI0A 1AXZA 1ODNA 5C4WC 4FQ4A 5C5UA 1JU4A 3L2HA 2ZEWA 2WC2A 1PK6C 5GKAC 4GULA 4MXWB 1BBT1 1X7NA 3IPVA 3TN93 3ZLIA 4DUVA 5FZCA 3TEYA 2Z4FA 4UAPA 2FDIA 2ZHKA 2B5HA 3BIWE 4YG0A 2XBO2 4IGPA 1J1LA 1V6OA 4OI4A 3SMHA 5JMCA 3UKNA 2CAUA 3KCYA 4WM8B 5FLJA 4YZ4A 5CBLA 1JN2P 2D6KA 2D6NA 3ZMNA 1MVQA 1VBB2 3N9NA 4G3YC 4UW6A 1A8DA 1LCLA 2DVAA 2JENA 5DQ0A 5FXVA 4BQ4A 1QJX3 2DV9A 3C3VA 4O9GA 3KVBA 4L99A 2ZHLA 3USSA 1LOFC 1ZBA2 2HWE3 1NAEA 2D6OX 2JDHA 2CDOA 2D6MA 5D8AB 3E5XA 4XILA 3WW1A 4XFFA 3ILRA 5H9PA 1WMFA 1JUIA 1C8M2 2E53A 1HRI3 2KD7A 1XXNA 2R043 3LOIA 3P3PA 4FPEA 1F5JA 1L7QA 2FQPA 3ZM8A 3VUOA 5FLIA 4XZUG 3LQCA 3T3YA 1ZRFA 4B29A 5DPNA 1DDLA 2OUJA 2UYBA 3HQUA 1RIRA 1S0IA 2HWF2 2OPKA 3HD8B 4CU9A 1GZCA 4P5HA 4COWA 4META 1A8MA 3RMXA 3TB0A 2ZCWA 4BZ4A 4CDWC 3R4SA 3N9OA 3WG1A 3GJBA 3M1HA 3W21A 5FYTA 2EIDA 1BZWA 2ZGRA 1UAIA 3PHMA 2CHHA 3ZIXA 1C3HA 1MS3A 3H0OA 3N3HA 5C3SA 3MIBA 1R083 1RUH1 4XFIA 4QDRA 1KRIA 1NYWA 2P3JA 2VMCA 3KF5A 2NZ9A 5EJ3A 4MSVA 1GSLA 5IVJA 1S0GA 1NCQC 1OLMA 2VZSA 4NJ4A 5T55A 1ZREA 4YG3A 4CXXA 2RG4A 2VOXA 5A3UA 5FP4A 4AVAA 3IZOA 4A6OA 4Y4RA 3U0ZA 4F7ZA 1AXYA 3B00A 4HOOA 3WG3A 1W05A 2C26A 4HT1T 4XQDA 2E7TA 2O1QA 3RWNA 4CEWB 1WD4A 3E5QA 4CCNA 4XXAA 2ATFA 5FO9B 4GB31 5J96B 2R073 3ROUA 4AQTA 1S55A 4DEQA 5CFCB 2BEOA 1R64A 4JC1A 1DYOA 2J1AA 2BOJA 5FZKA 4BM8A 3EB7A 2WZ8A 5FP3A 2XQRA 4W6YA 4AFMA 5LWBA 5A6YA 5C7GA 3LA2A 1K5MA 1PMHX 5KXEA 3ABZA 2XJVA 2QCSB 5ACA3 5AFEA 1UYXA 1J59A 1ULOA 5G04L 1JS9A 4WVMA 2O8OA 2PFWA 3AZYA 3FFQA 4NRPA 4N53B 1RUF2 2QQOA 1OFSA 5I0RA 3MICA 1JZ5A 2UURA 2V5DA 3PUQA 1F5FA 1PVC2 4YW6A 5FUNA 2AR6A 1V6IA 1FX5A 2VU9A 4HPKB 4MGTA 2P37A 1XE7A 2DFBA 1QEXA 3I59A 3O14A 2FZ2A 2YBSA 1DQ2A 1JUHA 1PO22 2IXJA 4K3UA 4RHV2 5EQUA 4PLOA 2OQ6A 5IVYA 1R093 2K9ZA 2WN3A 5FZEA 4FPHA 5APAA 1BK1A 4COUA 1YLLA 5C3QA 5IHRA 2GAUA 2X10A 1H8VA 1I3HA 1OVSA 4ZZ8A 1CZVA 4UFJA 4BHPA 4C0BA 4D6QA 2PHXA 1XSQA 3IDAA 5C4WA 4WM7B 5A7WB 3KT7A 4Z1VA 1PK6A 1DCSA 3OTFA 4JRAA 4Q0QA 1MVEA 4ASMB 2VUCA 2GC0A 1JYVA 1JI6A 1W0PA 4CDUC 1AR72 3B9CA 1RL3A 1CX1A 5A80A 2QNKA 1W6NB 2AZ5A 1ZBE3 2K46A 1VRH2 1W2UA 1WBFA 2RMU3 2WZEA 1IG0A 4CDXC 3KS7A 2XJTA 5ANQA 4EJRA 4EV0A 1VPHA 1F15A 2VBPA 3D8CA 4UFKA 2QUOA 4BQ1A 1RXFA 1VBD2 3RYRA 2HWC1 4GMP3 4XCAA 1BHGA 1A3KA 4LBQA 2ILMA 1W2AX 2JG8C 4ASLA 2BPA2 1ZX5A 4IGQA 4WVWA 4XXPA 5A6ZA 3S5QA 4K9SA 3M3QA 1HB1A 2G1MA 1LOFA 2RDRA 2WQ8A 3B5LB 3EJKA 4CXWA 4XUPA 4BISA 5CIRA 2YPDA 2B9UA 3TRSB 4DRRA 1YQ6A 4YZ1A 3MUY1 3HAGA 3BTXA 2RDSA 5T3NA 1DHKB 3VD5A 5C8CC 4ISRA 3VZJA 5KXBA 3ASIA 3UGHA 1PHMA 1C5IA 3LEKA 4BJ0A 4YGDA 4CP2A 1DQ1A 1RHI2 2EVXA 2IFRA 4MGYE 5A32A 1MEC1 2VXRA 4AL9A 1K5JA 5FP9A 3AC0A 5FXZA 4LHKA 2WQZC 4DXZA 1QWRA 1F8VA 3IWZA 2ET7A 5DG2A 4QPGC 3TEXA 1IGOA 1ZA7A 3D82A 2W0XA 3ZN6A 4YVSA 4QX0A 3WV6A 2K2SA 3VDAA 3F2ZA 4RSUA 2J1UA 4XFAA 1K12A 4A45A 3UGGA 3ALQA 1UYPA 5LASA 4BA6A 5C9AC 3AP7A 1PZ7A 1S0CA 2ZGLA 4YM0A 3PVEA 3POEA 4MGIE 4PJYA 1W8HA 3NNLA 1NY71 3S7IA 5C3PA 2WT2A 1JTZX 5A33B 4K8RB 2VAUA 4Q29A 1NCQA 3WOGA 3MFAA 4R9CA 1UCXA 1O4ZA 1LKNA 1YIFA 2WUHA 1AL22 1UOBA 2A73B 3A21A 3QH7A 3IB3A 4ZU5A 1YQ2A 2YBKA 3W59A 1QXJA 3WF1A 1LHVA 5T5OA 3PUHA 5LBEA 5KHGA 4Q8LA 4MO3M 5FOBB 2I07B 5F3EA 5IFPA 3FJSA 4XHXA 3CEWA 3RZZA 4AK3A 2WNEA 1EV11 1DGLA 2C9KA 1J58A 2JIJA 2VCBA 1DG6A 1TEIA 5JSOA 1RVF2 3UYJA 1NQDA 1AYM3 1D0GA 4MGZE 5I93A 3OPWA 2Q1ZB 1JZ2A 5FYHA 3SKJE 1SDDB 4NMIA 4XFHA 4D3WA 3T2TA 1PGW2 2MHFA 4E4HA 3S57A 1KS5A 4Z92B 4D7TA 3VBSC 1QQP1 2QDRA 2GU9A 1FOD1 3ZFGC 2VUDA 3FC0A 1W3XA 1UZZA 4RGKA 5J1XA 2ZX3A 5IATA 2D6LX 5KHJA 2XL7A 4JGZB 1A34A 2C0ZA 3A7QA 1IZ3A 1YRZA 3UGFA 1Q8SA 2H6BA 3LD8A 1N1YA 2CGPA 1A78A 2VOKA 3G6JB 3FN9A 1CJDA 2Q1MA 1VB2A 1ULCA 1O5LA 4CDQB 4RYDA 3IM0A 2YC0A 1UZ0A 4Y4YA 2QQMA 5I8SA 2ZBJA 3KGLA 3U37A 4IE6A 3ZYPA 4E2QA 3ZXAC 3WNXA 5JPMB 3VL9A 2RS11 1QMJA 4J25A 5FV3A 2HWD3 2WFF2 1QIQA 2GH2A 1JZ7A 1G9CA 1DGRN 2ZACA 4M3CA 4M4RA 2WAAA 3NNMA 4MG2A 1RUC2 5JOZA 3H50A 2DFCA 1WW7A 1H4HA 5IFTA 2VPVA 3EMRA 2Y33A 1ZZ8A 4QGNA 2OYZA 4FPYA 4LBJA 1MQTB 2VVDA 2FHRA 4PIZA 4CDXA 3N7MA 3RI8A 1OD3A 3Q8AA 4MYEA 3ITQA 3DYOA 5KC5A 3CQOA 2CGNA 4LORA 1TVGA 1UPSA 1IG3A 5SV5A 2ZXQA 5FY9A 5GJ6A 2QQJA 2AENA 4Q8KA 1W6PA 2V5YA 2ZGKA 1VAVA 4NOTA 4FBFA 2JG8A 5DMYA 1IPJA 3U1XA 2P1BA 5LEKA 4RGGA 3VDCA 3AMQA 4N8MA 1ASJ1 4LKSA 4EE2A 5IK4A 2I45A 5F5AA 3THPA 5FRAA 2F4PA 5ABJA 2RM21 5C8CA 1AR93 4H7LA 3GCXA 4JHTA 5J09A 3SCHA 1CPNA 1WW6A 2R1BA 3EO6A 4GKYA 5LK5A 1BEV1 2LW8A 2XJUA 3ETQA 5B4XA 1W03A 1NCRC 3O1PA 4RR3C 4IUGA 1LB2A 3T1LA 1ZRCA 5LW9A 2R063 4XE9A 2JDMA 3KCCA 4GZ9A 4QPGA 4RS5A 1ZZCA 2YHJA 2HKXA 3OEAA 3H1WA 3VV1A 1SLAA 5F32A 3RZJA 3AZXA 3ZXGA 4CCKA 2LRPA 4EWDA 4Y1VA 1OOPB 1D0HA 2RE9A 4M00A 5F5CA 1U5IA 5C9AA 1Z78A 1ST8A 3N9PA 4JDOA 4KH9A 4QM9A 5FZFA 5LBBA 1YHFA 3AKTA 5HXMA 4OMDA 1IOAA 1XYNA 3B9IA 2FMDA 3GGLA 3FBMA 4LUMA 1VMJA 2WNOA 4TXWA 4Y22B 4AI8A 1W8TA 2YGMA 1UN1A 5GLTA 1X9PA 4IV3B 1UQXA 4GH4A 4OHXA 4M0HA 5DAVA 2TNFA 3I7DA 4XUNA 5F6LB 2VTFA 3O0XA 1GFF2 4AGVA 5BNNB 3HOBA 1CPMA 3N9MA 4E2GA 1OA2A 2DDUA 1IPKA 2IFWA 1LESA 1SEFA 2TBVA 3OOXA 4CU8A 3SKVA 1DQ4A 1F9KA 1S4CA 1SHWB 1OXCA 2D3PA 3C2UA 1UMIA 3J8F2 5LRRA 2RS51 3RRDA 3FZ3A 4QPIB 2ID4A 4O61A 5CG9A 2B9VA 3VBUC 5A7QA 3FE5A 3BU7A 1XNBA 5FPVA 5JUVA 5E88A 2RR11 4OYUA 1H6XA 4D8MA 1RGSA 2VQAA 3DV8A 4O9EA 2GN7A 1OUXA 4I0BA 1F35A 2AC1A 3VL8A 1W9TA 4ZHNA 3MPBA 3F95A 1PVXA 3I8TA 3JBG1 4KL1A 4XABA 3VBSA 4A7ZA 3ZFGA 1YJLA 4JKKA 2BRTA 4RFT0 4OUEA 4QQ2A 3VHPA 1FPN2 4XJ8A 2IXKA 5EWSA 1SDWA 3HT2A 4E4ZA 2WWUA 1DFQA 4HZFA 3WP4A 4IE5A 3O0VA 1I6XA 1LGCA 2XONA 2NQYA 1ZVFA 1FI2A 1QJY3 3J7HA 1QOTA 5FZ6A 1H6YA 2IXHA 2QBXA 2XVKA 3AKQA 3LSEA 4WVVA 5BNPC 3V0BB 1QJU2 1US2A 1XBFA 4ATFA 2E26A 2ZGOA 1W04A 3N9LA 2AH2A 4DQAA 5FR3A 1AZDA 5FZ3A 5IUQA 3ZYBA 1ASJ2 5F5QA 1G9BA 1PX3A 1VBA3 1PX4A 1D4M3 2BVBA 2J1EA 2Y0IA 2WR9A 4NAOA 3WVJA 4C91A 1DLLA 4XUOA 3I54A 2X09A 1UIJA 2C4XA 2VOWA 4HLTA 2I2SA 3WLUA 3DPRC 4CU6A 4QGLA 5KHHA 1W2OA 2OUHA 4UYBA 4NHLA 2XKOA 5AC92 2QQIA 4CZSA 1I5ZA 2GNTA 1GP4A 3MHZA 5JR7B 5GZCA 3ZYJB 4CA9A 5DUVA 3UNPA 1W90A 3PNAA 4L97A 2PAKA 2E33A 3X29B 1YFUA 4YVWB 3UJOA 3T4VA 4XW3A 2XHKA 3HWJA 5F8PA 3IKWA 4A6SA 2CDPA 1DGWX 1W6QB 2XWJB 2V4VA 1CZSA 3SHRA 1BJQA 3LPGA 3MW3A 4A2UA 1PGL1 2VMGA 3JU9A 3SLIA 1HRV2 1QXPA 5CADA 1G9AA 2VOTA 2HBUA 3MGUA 3LCPA 3NWKA 3VZMA 1AF9A 4DPNA 5I0DA 4KBBA 2A5ZA 2XJQA 4Q1PA 4AVBA 3ZKYA 2VZPA 4Y20A 1ULDA 5JLVA 2C1FA 2XH6A 4R9DA 1EV13 3R05A 3LPFA 1PO12 1REDA 2G19A 1IQAA 1B09A 1RUJ2 1W99A 4B3NA 5FBZA 1EY2A 1WMEA 3OY8A 4P9LA 3ZXJA 4PQ9A 3CMGA 4RR3A 1HXS1 3MLLA 1JOJA 1JZ3A 2Y6FA 2E32A 4R4ZA 1GLHA 2VY0A 1QQP3 4M0NA 1W6MB 4CCEA 4W6XA 2VD7A 5J3UA 2OQ7A 5A3MA 2UY8A 2WS91 3E97A 1BMV2 4UFHA 2QQLA 4X6QB 1GZWA 4RQPB 2GN3A 4NPRA 3RSJA 3NVCA 2ZX1A 1QXRA 1N3OA 4HONA 5F39A 5CFCC 4YW2A 3ACLA 3BOWA 3KQRA 3ZDVA 2BW8A 4INDA 4QMAA 2FCVA 4Q4X2 1Y43B 2P3IA 2HEWF 2PHWA 5GALA 2DCTA 1UMZA 2OZJA 1CAUB 2R0HA 2JD4A 1AL0G 4TLGA 4CXYA 3WW4A 1DZQA 1OQEA 2VZ1A 1STMA 4MLOA 1DGRA 4FAGA 2DCYA 4L9BA 4N53C 4QXKA 1DIWA 2LS6A 4XEZA 5F9TA 3WUDA 1IPSA 5KXDA 4I09A 4HBNA 1LNSA 4BQ5A 3H8OA 3GHMA 5JPNB 1HB4A 1GR3A 2DVBA 2CY6A 3VBUA 5C3RA 1HJFA 1RUD2 4NUBA 3JD71 2YGLA 4IEQA 1L7RA 3MV01 2D98A 2ZAHA 2D40A 4YW5A 5BNOC 2GALA 1EAH1 2C5DA 4AE2A 3GBWA 4PDWA 3RWKX 5GLUA 1LU1A 2OVUA 1JMUB 2DVDA 4MOAA 4EWAA 5CEHA 2DUPA 3ZYIB 3APBA 5JXIA 4HETA 3T08A 1DU3D 2D3SA 4MGQA 3EYPA 4IETA 4Y24A 4DEVA 3H3LA 4UT5A 1HX6A 4PI2A 1TMF2 1PMJX 4AVVA 4Y1ZA 4MXWA 3MF6A 2OA2A 1FV2A 5JDBA 4QB1A 4S2FA 2PLV1 2WT1A 1AR83 2YXSA 2VUAA 3AFKA 1AR63 2BV4A 5FYVA 2VNVA 1NA1C 1PM4A 1KD7A 3KSCA 4WM8A 4OHVA 3T2OA 1EP0A 2Q8EA 1RUE2 4HVRA 3K51A 4AVSA 3VBOC 1SBDA 2VMHA 3MIHA 4UBHA 3TN92 1RUG2 2WZR3 4AVTA 2WL1A 1UZVA 3SH3A 2WYFA 2VZVA 1AJOA 3J4UH 2JG9B 4ISQA 4LO4B 4OVEA 4A7YA 4C0HA 3KGZA 5T5PA 3HN1A 1UPIA 4P08A 4XQ4A 3ZSJA 4QGMA 4CCOA 2CWSA 4C90A 1AHSA 1WLTA 2W47A 4NWVA 2ZMLA 3RJ2X 1ODMA 1R1ZA 1QJX2 4E8CA 4HN1A 1Y9QA 3OF1A 1OFNA 1C8NA 5CAZA 2HWE2 1ZBA1 4D7SA 3WNOA 3VHNA 1J3QA 3VHOA 1V9U3 1V6KA 3IN9A 1C8M1 1HRI2 2R042 2CU5A 3HBKA 5FZ8A 1XNDA 2DURA 1XC6A 2HJIA 1RC6A 1ZA4A 1D2QA 2GNDA 1FNZA 5K9YA 3VKMA 3IBMA 1PIV3 4LIUA 2NN8A 1CAWB 1LJ7A 1NLSA 2ZZQA 3ZSKA 1YI9A 1WBLA 4Q2FA 3ZFEC 3ZXKA 1JOPA 2BGCA 1UOFA 1IS4A 2Q5TA 2Y6HA 4JKLA 1LHNA 1AUYA 3FLRA 1OVPA 2D3RA 3K75B 4JGYB 4LHSA 4CUCA 2HWF1 1QDOA 4LLFA 3N7JA 3N35A 4ARYA 5GLVA 4HG6B 1GV9A 3GYDA 3AYCA 2Y6LA 5FYBA 2OXBA 5FZAA 1OMIA 2DYCA 4TN7A 1OLME 5FYCA 3QCWA 4AEDB 2WNVB 3NO8A 1R082 2IXLA 3KMHA 4JX0A 2FDFA 4AZZA 2YYOA 2QQUA 2WAOA 5FZHA 1LOBA 1SPPB 2X5IB 3C7OA 4GWMA 4AWDA 4ORFA 1OD5A 1IKPA 2R1DA 4LK6A 1W28A 4QM8A 2JDPA 2BYVE 4C8DA 2W08A 2HWB3 1B35C 4XZPA 5CFCA 3VZOA 4NWWA 1RTVA 5FZLA 2XLAA 5C33A 2VMDA 2DUOA 1GWMA 2ZJCA 1H1IA 2ES3A 3Q8BA 4NIGA 3RJRA 4CCCA 2J1VA 2D44A 2R072 2P5BA 3GZEA 3R4UA 1G6NA 2W46A 4RGAA 4N53A 5DUUA 5JAXA 2W3JA 2W95A 1SQ4A 3Q8CA 1W8FA 3WP5A 1CAVB 4HKLA 3CDZB 3Q9OA 1G7YA 4HPKA 5ACA2 5F2SA 2QQNA 2ET1A 2EAKA 3WNNA 1RUF1 2XWBB 5C6CA 4AHWA 5IJRA 4DXSA 2XLGA 4COZA 4QKNA 1PVC1 1CX4A 5CZKA 1VBC2 5E16A 5BNOB 1DLCA 4BU2A 5L19A 1O5UA 3OB8A 4GAZA 1PO21 2LALA 4K6BA 4RHV1 4F3JA 4QPWA 4NO4A 4QQHA 3VBRB 4NPLA 4K40A 3FLPA 2LM3A 4ZY9A 3DYMA 4XBLA 1R092 2Z69A 3DXTA 3CZJA 2D5FA 5ANNA 2BTVC 4IEUA 2AACA 4MV2A 2ZGNA 4A3ZA 3KM5A 2CL2A 1AX2A 2Q8CA 1BXHA 2VCCA 5H9QA 1AYN3 4GWIA 4W65A 1QDCA 2OW4A 4BIOA 5K8SA 3PUIA 4FOWA 1W6NA 1NA1A 1UX6A 4LO8A 4ATEA 2PA7A 3NJVA 4BQ3A 3QOPA 2I74A 2SLIA 2CGOA 3VBOA 3SH4A 5FKCA 3NMBA 3NV3A 4UFIA 4LO6B 1AR71 2WZPP 4AI3A 4YM2A 1GMMA 1ZBE2 2RMU2 1OT5A 1VRH1 4DOUA 4Q4V3 4XETA 2ZS6B 5FPUA 1MZFA 4EN6B 5I0UA 5FKBA 5C5TA 4LKEA 2VUJA 4XUTA 4YVSC 1AX0A 1H1AA 3ZYGA 1AXKA 1VBD1 3MZHA 4KGGA 1O3SA 4OI1A 1RJ7A 3AMPA 2ZGPA 4MGSA 2ZKLA 1TME3 3BTYA 4P02B 5FXWA 2BNMA 3W9AA 4TZDA 3KHCA 4A42A 1FMD3 2W87A 4L11A 4AHXA 4XOGA 4O65A 3GJAA 4YRDA 1W9YA 2QVSB 4AHZA 3TEZA 2WO2A 5A3WA 4YW3A 3VGIA 3FFZA 1CR7A 3OCPA 1WCKA 1O7FA 5AVAA 2IXIA 2QQWA 3CHXA 3RPQA 2X05A 1OOPC 1RHI1 1J3PA 3AYDA 1RUI2 1VP6A 3ZFEA 4CCMA 4GD4A 4D7YA 2BGPA 2EICA 4KNCA 5EYXA 1ND3B 3DKQA 3MDPA 5FK8A 2ZX2A 3VZLA 1JBCA 2IC1A 4PLNA 5JIUA 5A33A 4XYXA 1DF0A 5FZIA 1H2MA 1H0BA 2XJPA 2YPJA 3M3OA 4JV4A 4MXVA 3LA7A 4UW3A 4XF0A 4R52A 5J7MA 3GZAA 4Y1UA 4AFAA 4DY5A 4LIVA 4A41A 4JRLA 5BNNC 4YFWA 3ST7A 2E63A 2WNUB 1LOAA 1QH7A 2RS33 3L9JT 5FUPA 3BKZA 3GBFA 5IAVA 5EJZB 3WDYA 1H30A 4LPLA 2R0FA 1AL21 1YO8A 4QPIC 1B35A 2Q0AA 2ORXA 2FMYA 2W1QA 3FBYA 5GZEA 1COV3 1J83A 2PLV3 4AXOA 2NMNA 4OI0A 4IEOA 4G4FA 4XHBA 1UY2A 3EBRA 2EIGA 5A7NA 3T1MA 3S5AA 2D5HA 5LBCA 4HL0A 1S1AA 2VZRA 1DZRA 4W4ZA 1RVF1 3W20A 3FMGA 4IE4A 1AYM2 1R1A2 4BQXA 2XBO3 2VZ3A 1UIKA 4JGZA 4AF9A 1PGW1 1POV1 1A6CA 2MPFA 3OD0A 1ZNPA 4X8PA 5FZMA 5HV4A 1QJEA 1GYKA 3U4XA 1RINA 3IMMA 1VBB3 2VGDA 1W06A 1H1MA 3I49A 1ENSA 1JZ4A 1UXXX 1JODA 1MPXA 3HQXA 4LOSA 1YUDA 3RQ0A 2PHLA 1LGNA 3V56A 4N9HA 1APNA 2YB7A 3GALA 1UD1A 4PIXA 1SACA 1JYCA 4ZPIA 1E5RA 1JZ8A 1WMDA 2JEMA 2VQ0A 2QQKA 4QWNA 3H1YA 1JOBA 4FT8A 4IERA 3OUJA 4PBOA 5DDJ3 3TBDA 4Q4Y3 3RYPA 3DGTA 4M3CE 1LU2A 1SCRA 2AUYA 2HWD2 5IVBA 1GNZA 3SH5A 3O1SA 3WD5A 1YQ5A 2WFF1 4EZ4A 1MQTA 2P2KA 3WZ1A 1E5SA 5ABJC 1X82A 5HCHA 1RUC1 1LHOA 1Y9GA 2VW1A 3BIEA 4A7KA 5JOYA 1W8WA 4XF3A 2R6QA 5FBJA 5JI7A 5I8YA 2PN5A 3R0RA 4JTOA 5DAXA 4JZRA 4XF1A 2VJXA 3ACHA 1LULA 4AR2A 2A6XA 5LZ6A 1N1SA 1JYXA 5FMDA 1Z7S2 4LO5B 4RS5C 5DAPA 4AEMA 3CIHA 1KXGA 5A1FA 1HLCA 2WDBA 1EUUA 3ZXFA 3KD4A 1VALA 2WIIB 4CP0A 1RMU3 2V4AA 1UKRA 4AAPA 2OX0A 2Q4SA 4NN0A 3AJZA 1K3IA 3D5OA 4LBLA 1Y7BA 4FP3A 4AHYA 3VDBA 1S0FA 4PBPA 4UFLA 5EYYA 4Q4W1 2E9QA 5A3PA 4GH4C 4XDPA 3WQ0A 5KC6A 4XAEA 1FAYA 4P9IA 1DQ5A 2GP3A 3POBA 4CEWC 2E7AA 3U78A 2Y64A 1AR92 2BUKA 3GZTB 4BYYA 4TTGA 2QQPA 4MHUA 3ZIWA 2ZEZA 1TZOA 2VTXJ 1OI6A 1OOPA 4E9KA 5IVFA 3AVSA 1CJPA 3MUZ1 2VH9A 2R062 1GWKA 1MZEA 1WWYA 3ZYHA 4BB3A 4LT5A 2WKKA 1RXGA 4Y22A 1SLIA 1XB9A 2YU2A 4E4SA 2IXCA 1JXNA 1BBT3 2DUQA 4IV3A 3AFGA 1W9FA 3DECA 3HN3A 4WBBA 2J22A 3K48A 4OHYA 1U5XA 4QXHA 5IYYA 2UU8A 4PIYA 4QDQA 4AFCA 5BNNA 3RDIA 4IQPA 4B4QA 3IDEA 1Q8QA 3RG0A 4DXTA 2K0GA 1OQDA 2V09A 5JI9A 3TEWA 2EF6A 4RHV3 2YU1A 3AKRA 2QE3A 3FLTA 4CYDA 3WQBA 5FPZA 2IVIB 2IZWA 4QPIA 1S2BA 1YC61 2D7FA 4D6SA 3I59B 1O4YA 4FPJA 5J37A 1T6GC 2HEYF 3VB9A 1JW6A 3WF2A 2BDRA 4DMIA 2VR4A 4OUSA 4LKFA 1UU6A 3PTRB 3J8F1 1WCDJ 4AOCA 4IV1C 3H7JA 3ZR5A 4DZGA 2RJ2A 3VBHB 1UY3A 3KB5A 2AEZA 1Q8VA 3LKJA 5CYYA 1PZ8A 3VD3A 4L0PA 1ND2B 2Y34A 2ZABA 1NUKA 3PURA 1VLNA 1HDKA 2ZEYA 2J7MA 1RUOA 1SBFA 2XXZA 5FPXA 3VDDB 3MIGA 1DZTA 2EALA 2EXKA 1OUSA 2YMZA 5A1AA 1FV3A 1PK6B 4OI2A 3O1TA 4YARA 1C5HA 2EXJA 4DY3A 2E51A 2ZHMA 1RB8G 4AG4A 2Q8OA 1FPN1 2EXHA 4LXLA 5FZ4A 2RJLA 3V0BA 1RITA 1MS0A 5EPAA 2VECA 2YY1A 4FQZA 1RUH3 2MEV2 4XDQA 5CFDB 3R4DB 3AXEA 3V64A 4J1XA 1QJY2 3VZKA 1OLQA 1V70A 3S30A 2BFUS 4FPOB 5FZ0A 4DFSA 2KM2A 4ZS2A 1QJU1 3AL6A 1KS4A 1ZRIA 4H3WA 2AGSA 1F31A 2W1WA 4BK4A 1C57A 1S0DA 3I3QA 4P9XA 4Q4W2 2Y6JA 1VBA2 1D4M2 1UU5A 3FUOA 4GB33 4P9GA 4GQ7A 2P4EA 4QAWA 3NJZA 3AP9A 4FP2A 5DAWA 3VKOA 3OYWB 3NKTA 4KBZA 4OZOA 4YVWA 5JR2A 5BPXA 1O3RA 3NV4A 4KU7A 3BU0A 5AC91 2YC2A 2XVGA 5CKMA 5A32B 5L73A 1W6QA 5JOWA 1T6BX 2ZGSA 3BGAA 3WCSA 4DNYA 1Q43A 3AMMA 2DU1A 2ORZA 3K4DA 4ES9A 2VZUA 5FFOC 1NE6A 3ZN6B 4BLJA 4CDWB 4UW4A 3MW4A 5K0UC 2ENRA 4IXLA 1QU0A 1V6LA 2PHRA 2VBDA 3A0KA 1PZ9A 1HRV1 4JGYC 4UI9L 4D69A 4NIIA 4Z2AA 2A71A 4XDOA 1VBE2 4Q0PA 3TOJA 1NQJA 2VL4A 2BNNA 4KU8A 2ZAAA 2CYFA 2AREA 5K4LA 1AVBA 5L7OC 4XAAA 2NMOA 1KFUL 1W6MA 4XCBA 3USUA 4AEDC 2WNVC 1PO11 3SCFA 2HBTA 3D0JA 4B7KA 1O6UA 1RUJ1 1RVF3 2D6PA 4DUWA 5FO8B 4EYUA 3A0NA 4JAAA 3JB8A 1RUNA 3ILNA 3PVOA 2RVAA 3AMNA 1TE1B 3ZDSA 2SBAA 1MACA 1RJ8A 3C8XA 4AEKA 3H7YA 5T50A 4QXBA 5FWEA 3H42B 1BMV1 2DVFA 3H3ZA 1CONA 4Y5Z0 2JX9A 4I01A 5EHDA 4LEJA 4QX5A 3B3QE 1S0BA 5HPOA 2Z5WA 5G05L 3I3BA 4OZXA 2P17A 4PDWC 1BKZA 3UKVA 1YFWA 4HANA 5E6HA 4MZUA 4DS0A 4JQRA 3W5MA 4Q4X1 2A3YA 2VNOA 3AXDA 1YWKA 1VAMA 2HWC3 3FHIB 2O14A 3KV6A 2ZGUA 3DKWA 3LE0A 1UMHA 4XPVA 1Q8OA 3RYKA 4QQPA 1GNHA 3KV9A 2XJSA 1KJRA 2XPJA 2WFPA 3B02A 4XF4A 3T30A 4B7EA 4K1ZA 4YZ3A 2P6HA 3CJIB 3TAYA 3N4MA 1LEDA 5GLZA 2VTXA 1BCXA 2Q8DA 1IHMA 2XGXA 4IV1A 1WCSA 4FXKB 4LHLA 3DUIA 4R8HA 3VKLA 4QX8A 4GKXA 4H2AA 1NOVA 4LNVA 1SFPA 4XUQA 4UF0A 4WM8C 1CD3G 1SLLA 3A4UA 4QU1A 1RUD1 3ECQA 3RGBA 3ZXDA 2J1RA 4H7MA 1ENXA 2DCJA 1GKBA 1JU3A 1XNCA 1MEC3 4EQVA 1WLCA 5FMOS 3FX3A 3ZN5A 2XOMA 4XJUA 1POQA 2IWGB 5EXOA 2H0VA 2B45X 5DAQA 3LFMA 3QACA 4QT6A 3CU7A 5KXCA 1WMXA 3ZFFB 3WDWA 3BALA 2Q1FA 1QF3A 3WDTA 2D97A 5C8WA 1GQGA 3GHNA 5D8AC 4CDUB 3VLBB 2AYHA 3MF9A 2YDEA 4HK9A 4Q26A 4YGEA 4ARXA 3K77A 3KZ4C 1TMF1 1ENQA 2CTVA 5FY4A 1OF3A 2Q30A 2WSUA 1K45A 2W5FA 1GP6A 1AR82 2J1TA 2CSGA 2RHPA 5JZGB 2W9XA 3I97A 1Y4WA 1YCIA 1AR62 4KG0A 4YLZA 2PAMA 5JXHA 4FFIA 5A7PA 1XNTA 2JG9A 4MX3A 5FY7A 3ZXEA 4XIOA 3VKFC 1HV1A 3MIEA 1RUE1 4XACA 3ZSMA 2JECA 5CA6A 3MLJA 4I0AA 2WLQA 3TN91 1ZRDA 1HW5A 1RUG1 2WZR2 4BQYA 2FDGA 2VXJA 3PUAA 3SXWA 5IK5A 4CP9B 4ITCA 2JDKA 1MR5A 4GWNA 5FY8A 2JDZA 5IVCA 4PLMA 5F3IA 1JYIA 2PELA 3O1RA 1JHJA 3S6PA 5JWPA 2JDYA 2W1UA 1POV0 1O3QA 5FY0A 5FQ0A 3CKHA 5JSPA 5CKQA 3DXUA 1QJX1 3JB4C 3KCXA 5EZWA 4QPGB 2ZHNA 4R9BA 4E8DA 1FOD3 3VD4A 2ZPXA 3VD7A 2HWE1 2JDAA 3BCWA 4R9AA 4QQOA 3NV1A 4XMIA 1ULFA 4GJZA 1CAWA 1W6OB 2OS2A 2Y6KA 4LBOA 5EJ1B 4OQ9A 4EN9B 3PLQA
chains in the Genus database with same CATH topology
1V9U2 1YI7A 4Z82A 3MYXA 2D43A 4FPCA 1X36A 4JGYA 1HRI1 2EAAA 2DWRA 2R041 3ZVXA 5IK7A 4E4DX 3U11A 1PIV2 1VIWB 1YFYA 4XBNA 3WG2A 5L7OA 4AEDA 4XF9A 4P14A 1UF2C 2WNVA 2RS13 2WNUC 3PVBB 3UL2A 2HYKA 2X5IA 3WQ7A 1U5YA 4IEVA 1UL9A 5I8TA 1SFYA 1OA4A 3OBRA 5J98B 2B46X 5FOJB 1R081 2QJVA 1QNYA 1V6MA 3WT3A 4IEYA 4DINB 1FPN3 1KQRA 4UBGA 4RA0A 3CF6E 4Q1RA 1GICA 2HWB2 2VNRA 3W58A 3BPZA 2Z79A 3M3IA 1J3RA 3D0SA 3PJQA 1CAVA 3ZFGB 4YNIA 1UZYA 2X53S 2GC3A 1FNYA 1QH6A 5E89A 3CO2A 2R071 4WM7C 5B2GB 2GH8A 2BQPA 1ASJ3 4COYA 1CAXB 2YV8A 3M7AA 1N1VA 3DF0A 3ZSEA 1WD3A 5ACA1 2RM23 5BNOA 3QBQA 2R32A 1KDMA 1BEV3 2B42B 4V1PA 5GZFA 5AC93 1H8TB 4FPKA 3VBRA 2P34A 3KLSA 3NSTA 4YW1A 5KBFA 5HCAA 1LTEA 3THTA 4AVCA 5BYNA 1TNRA 1VBC1 2D93A 4LBKA 1VAKA 3AP4A 1WGPA 5D8AA 2UWBA 5L36A 4ZU7A 4QHBA 1R091 3LB9A 4PCRA 4HKOA 4B4RA 1LOGA 3AK0A 3O7OA 1KFXL 5GM0A 1AYN2 1SFNA 2UWCA 4K1YA 2RJKA 1VB4A 1SLTA 3RMYA 3VBFB 2BFUL 4F8AA 1MS4A 1YIPA 1O4TA 1WLWA 1MZ5A 1IS6A 3S0MA 4FAHA 3ZX7A 3WP3A 1U5ZA 1DQ6A 4BLIA 2RS53 4N43B 1ZBE1 2RMU1 2JXAA 1X33A 4Q4V2 1XNKA 4A3XA 2RR13 2XB6C 5F6KA 1U12A 2A75A 1NCRB 5BNQA 2WA4A 3MIDA 4GMP1 2NM1A 5LK7B 3B93A 1YJKA 1WUVA 2WA3A 1TME2 2GZWA 3JBG3 4HSLA 1MS5A 4JTNA 1JH5A 5IK8A 3I2DA 4CEWA 3WXPA 1NE4A 1FMD2 3J26N 3WW3A 3OGGA 1ND3A 1UW8A 4CEYB 1XQNA 2JKBA 1DQ0A 4S2GA 3SNMA 2LUWA 2LTNA 3HR9A 1RUI1 3G7DA 4IEPA 1E57A 3AKPA 4FSJA 5IT6A 1DBNA 5DG1A 1LRHA 1H9WA 2WNUA 3ZO0B 1RUD3 1O3TA 1SLBA 4P9YA 1I1EA 4I3GA 2GMEA 3E6DA 3RI9A 5F1RA 3V0AB 1LOCA 4JGZC 4EN0A 3VBUB 5GZGA 4XQWA 4U36A 2W52A 1Y3TA 4IL7A 5TSWA 4RL7A 2OZ6A 2ZGQA 4AI0A 3ATGA 4CDQC 4EN7B 3BOPA 4XTPA 3MEPA 1X8EA 2A70A 2C9AA 5CB7A 1BYHA 4L92A 1COV2 4QQLA 3LZZA 3ZXLA 4Z8BA 4CTEA 1NXMA 2NPIA 1VR3A 1ZYBA 4WM7A 4AQ6A 3VDDC 4XJZA 2VMIA 1RUE3 3ZSLA 1RUG3 1AYM1 3HMYA 5BNPB 1MQTC 1R1A1 3WDVA 4XJWA 3WQ1A 1S0JA 3WR0A 2HEVF 1X50A 1NZCA 5KWRA 4IESA 5I91A 3TWIA 5CFDC 1GANA 1REFA 3URFA 1KJLA 3VKNA 1HXS3 5I0SA 2GC2A 1V00A 5FMOL 3POYA 3DPRB 4GA9A 2WS93 4JDMA 2YZ4A 4S2DA 4FPFA 4UXAA 4AFBA 3UJQA 2ARBA 2V73A 2WJSA 2VVFA 3NAPB 5DDJ2 1LECA 4Q4Y2 1REEA 4LUKA 2HWD1 4FXGB 3KT1A 3WUCA 4TYSA 1XU1A 4S2HA 4I3PA 4LLOA 4K21A 2QKDA 1IKQA 1C1LA 2Z2SB 4KWLA 4Z07A 4OHZA 2ZKNA 2KA3A 4BMEA 4KWJA 2WQ4A 4FTBA 2X8KA 4WZCA 2A6ZA 1AJKA 1Z7S1 4K20A 1XRUA 4GXLA 3JD73 1CESA 2ZMNA 4IV3C 1RMU2 1EAH3 4FOYA 1N3QA 3IDCB 3POSA 4AI2A 1Q56A 2E6VA 1QHDA 2CV6A 4OLLA 3WY6A 4U2AA 1BVP1 1W39A 3CL1A 1HQWA 2N7GA 3MFCA 1ALYA 4WVZA 4X8NA 4CRQA 2XVLA 1AR91 3WCRA 4IEWA 4TLFA 4COVA 2PHFA 3FWEA 1MS8A 3M2MA 2DVGA 2R061 4N7UA 5AFBA 5HBAA 4LE3A 4HVOA 5JIAA 1QKQA 5DXDA 1BBT2 1KDKA 1V6JA 4LE4A 4LA3A 1VBC3 2ZZJA 2DF7A 4ZU4A 3VN4A 1Q5OA 3R6SA 1CGPA 3ZMOA 3CJIC 4UW5A 3IPVB 4CDQA 4JVAA 3NKGA 3RNSA 3VBHA 2YUEA 2GSYA 3HBZA 2B39A 2VOVA 2OIIA 2PYTA 2WINB 5DZGA 1ZBA3 3SISA 1ND2A 3E5UA 3EHKA 3E6BA 3VDDA 1C8M3 4AGGA 3TNPB 4AYUA 4IEZA 3JQWA 4M3CF 4XFBA 3ZFFC 2XLFA 4OFGA 2NP0A 2DTWA 1AX1A 1IS5A 3AKSA 4EN8B 1NA1B 4CP1A 5HXVA 4BH9A 5CG8A 2HWF3 4YVWC 5CFDA 3OD4A 2BWCA 5CU1A 3NV2A 3VBOB 1LOEA 1PM7A 1OPMA 1G86A 4DB5A 3N36A 4MUVA 1ZZ7A 3HT1A 3WINE 5JZGC 1CQ9A 4I2OA 1DYKA 3BB6A 4XMAA 3CJXA 3WW2A 1RUH2 2MEV1 3UKTA 2P3KA 2FBEA 2JICA 2PQQA 4FOQA 1QJY1 4Y1YA 1PNFA 2VG9A 4XFGA 1LODA 4E27A 2F6BA 4C1WA 3OYWA 4XTMA 1TNFA 5D1IA 4MGKE 1OLRA 2Y38A 1LHUA 1VBA1 1X8MA 1D4M1 1RUI3 5KHKA 3IIAA 1WLDA 4YSFA 4GB32 4I0WB 4XJAA 1SMVA 3INAA 5SV8A 1FXZA 4CDWA 3WDUA 4BOWA 2EXIA 2X29A 4XFCA 3H3UA 4RQPC 3ZFEB 3M3EA 3I4IA 1YNAA 3JUUA 4LHNA 4LO7A 1HQLA 4XIKA 3AP5A 1RUF3 4M01A 3M3CA 1PMIA 4YM3A 1PVC3 3BODA 1K5MB 1YXWA 4GALA 4LBMA 4SBVA 1TQ5A 3O12A 4WVMB 3LAGA 1VBE1 1N47A 2VULA 1PO23 4LA2A 4FTEA 3D6EA 4MVTA 4LR4A 3WHUA 1LGBA 1D4VB 1B35B 3DL3A 4KWKA 1Q3EA 2ARXA 3MLKA 4FPGA 5J48A 1SBEA 1R1A3 2PHDA 1FATA 4QPYA 4RD7A 3WG4A 3LOBA 3LGRA 3AZWA 2A3WA 2VNGA 2JJ6A 3EQEA 3H1MA 5HCFA 5GLWA 5FTTC 5FO8B 2BVVA 3WP6A 4HVQA 1AR73 2UY9A 2GNMA 1S2KA 1VRH3 5C4WB 3QH6A 5E1RA 4N90A 4GMP0 3CJIA 4YG6A 4OHWA 3SCGA 1VBD3 1QY4A 3SITA 2HWC2 1H2KA 1C1FA 2MNGA 1HV0A 1SLCA 3O0WA 4DRVA 1H8TC 4Y26A 4E2SA 4Q0VA 4AI1A 3AX4A 2XG3A 3IT8A 1VJ2A 4LBQB 3PVNA 3IMNA 2JG9C 1OSGA 3OJBA 3ZFFA 5J36A 1RHI3 4CDUA 3P3NA 4AFDA 1MEC2 2W68A 1C4RA 1LR5A 3JZVA 3QD6A 5FLHA 5K0UA 1Z7S3 2UYAA 1N1TA 4MH0E 1CIWA 3AJYA 3AM2A 2GC1A 5H9SA 5JZGA 1GQHA 2YROA 3VBFC 5CNAA 4N7IA 2H0BA 4P9WA 1NY72 3POWA 3B94A 3JCIA 4I30A 2E7QA 4YVSB 3PJYA 4Q0UA 1AR81 1AR61 3M70A 4HMZA 1AL23 4N43C 4URTA 4BMBA 3VHRA 2G9FA 5FCCA 2XKPA 4YYOA 2ZGMA 4YGBA 5EV7A 3QLQA 1NCQB 2WZR1 3LA3A 2QFEA 2QZ3A 5E8AA 2G4IA 2XJRA 4KQ7A 4YW4A 2A7AA 4KGQA 3H8UA 1EV12 2QZ2A 2DCKA 1JHNA 1MS1A 2BWAA 2DTYA 1H4GA 1W6OA 1L3JA 3WHTA 2X5IC 4FO9A 1FYUA 4LTAA 3NW4A 4RQPA 2WWSA 5T5LA 3V65A 1BQPA 1POV3 1C28A 1QQP2 5FAXA 1U0AA 5T52A 1FOD2 4CEYC 4YZ2A 3UV9A 1QOOA 5BXXA 2EA7A 3EXUA 1WW4A 1CAUA 3VZNA 1V9U1 4Q0SA 5A3LA 1V6NA 3O5SA 4BE3A 1OPOA 4L2NA 1PIV1 2B7YA 1EPWA 1PNGA 2WT0A 1I9RA 4C1XA 4ONUA 3MPPG 4N9IA 4NHMA 4AQSA 3MI8A 2RS12 4BIFA 5BUVA 4KG8A 2WFF3 1MS9A 1N3PA 5DUWA 4NR1A 4YGCA 1RUC3 1ONAA 4SLIA 3NL1A 2DU0A 1EPZA 3GBGA 1ULGA 5DZFA 1EYBA 1M4WA 1SCSA 1S0EA 3VBRC 5IK5A 4TWTA 4M3CB 3GF6A 3U07A 2BNOA 4HN0A 4HFSA 4NHKA 3E6CC 2HWB1 2O0OA 2ZTNA 3ES4A 3ILFA 1ULEA 2MEV3 3HIFA 5I0TA 1CAXA 3MIFA 5JOXA 3AZVA 4EWEA 4GIQA 4CDXB 4H55A 1URXA 1J1TA 2A3XA 4ZXKA 1UU4A 3D4KA 1H8TA 4Q4W3 2GMMA 2FZ1A 1W6PB 2GDFA 4IEXA 4G9SB 2JG8B 2RM22 1WW5A 1H9PA 4YZ5A 1OHFA 5GZDA 1Z0HA 1Q8PA 1BEV2 2CAVA 3CNAA 2GNBA 3KT4A 5DUXA 1QGLA 5LEJA 5ABJB 3NAPC 3TYJA 1H2LA 4BCUA 5C8CB 3ES1A 3H9AA 4FTSA 1G8WA 2G9GA 1D2SA 4Y1XA 3VBFA 4YFZA 2UWAA 2B8MA 3OPZA 5FO7B 4RS5B 4ES8A 1H2NA 4L8QA 4QD2A 1LEMA 1VBE3 4B8EA 5DZEA 1ZRRA 2Z42A 3PMSA 2VVEA 3WX5A 1AYN1 2PAEA 3J9SA 5C9AB 4N43A 1ND3C 3ENRA 4AQ2A 1W0OA 2O8QA 2R49A 5LRSA 4NVPA 3CLPA 1M06G 1NCRA 4GH4B 3N7LA 3J8F3 2RS52 3OGJA 4P9JA 1LHWA 2ZX0A 1ZZ6A 4Q4V1 3IDBB 3USUB 5CVRA 5HCBA 4FCAA 3GZUC 4QU2A 2RR12 2CNAA 4J6GA 3RS6A 2R30A 4F83A 4PF5A 1XE8A 1ZZ9A 2ERFA 3B69A 1TME1 3JBG2 4HKWA 4JCKA 4CEYA 5T5JA 1YFXA 1FMD1 1HKDA 2A6YA 2WLPA 4ZKTB 1DYPA 2A6WA 4K7JA 3FUQA 3VBSB 5KHIA 1HIXA 1ZM1A 1OKQA 4K8FA 5K7PA 2JE7A 4W6WA 3WDXA 5H9RA 2ZX4A 3V0AA 2PHTA 1QJU3 3L2YA 3LSDA 1FT9A 3AZZA 1WA4A 1OA3A 3PTYA 4WV8A 1NLRA 1DGWA 4IV1B 5JVVA 1GBGA 4OUMA 1PGSA 4R4XA 1QNWA 1CVNA 3M4FA 4D94A 4LULA 2RS31 2PHUA 4H14A 4EROA 5HI0A 2VW2A 4XBQA 4LBNA 3AMHA 3AYEA 1YYNA 3M8LA 2Y26A 3OBTA 1GZ9A 1COV1 5AVPA 4AEJA 4BWOA 5JSRA 5BNPA 1UKGA 2R16A 5T54A 1BVVA 3ME2A 1PGL2 3ZPYA 4TSVA 3U10A 4BPZA 1HRV3 2WSVA 2NLRA 3MW2A 2XL9A 2PTMA 4X6RB 2A6VA 2XBO1 1NG0A 2H6CA 3DPRA 1PO13 3AYAA 1RUJ3 1QOSA 1VBB1 1XU2A 2QDNA 4FOVA 1HXS2 3BTAA 2TUNA 3NAPA 4Y20B 3DN7A 3ZYRA 1QJZA 3ELNA 5FDBA 3LWCA 4AGRA 2WS92 2CWMA 2DCZA 1LENA 2XUMA 2Y0OA 3OY8B 4RR3B 2NYYA 2KXLA 2TEPA 5FQ0B 1XYOA 1G9FA 1OQ1A 4XJ9A 5DDJ1 4Z2WA 4YM1A 5EFUA 4Q4Y1 4Q27A 2VW0A 4Q4X3 1HQNA 1GZWB 5K0UB 3B7MA 3GNEA 2ZOEB 1NXD1 4B4PA 3B01A 3AP6A 1ZZBA 4FPLA 3UK9A 2ZA9A 1K5MC 1XYPA 1G9DA 5L7OB 1ENRA 2ZGTA 1O91A 4OULA 3JD72 4HSJA 4J1WA 3PMEA 3S7EA 1RMU1 1EAH2 4FVVA 4LBQD 2W39A 2GMPA 3N7KA 5FREA 1CN1A 3TNQA 2RS32 4HK8A 4AW7A 1F2NA 4JDNA 2ZMKA 5BV6A 4WZFA 3ZN4A 2BBVA 5BY5A 3AB0A 1MZ6A 4PDWB 1TMF3 3VBHC 2JE9A 1KITA 2ETEA 1IS3A 1ND2C 3JQXA 2PLV2 4I02A 5JCTA 1AXZA 5C4WC 4FQ4A 3L2HA 2WC2A 1PK6C 5GKAC 4GULA 4MXWB 1BBT1 1X7NA 3IPVA 3TN93 2ZHKA 2B5HA 3BIWE 4YG0A 2XBO2 4OI4A 1J1LA 1V6OA 3SMHA 5JMCA 3UKNA 2CAUA 3KCYA 4WM8B 5FLJA 4YZ4A 5CBLA 1JN2P 2D6KA 2D6NA 3ZMNA 1MVQA 1VBB2 4G3YC 4UW6A 1A8DA 1LCLA 2DVAA 2JENA 1QJX3 2DV9A 3C3VA 4O9GA 4L99A 2ZHLA 3USSA 1LOFC 1ZBA2 2D6OX 2HWE3 2D6MA 5D8AB 3E5XA 4XILA 3WW1A 4XFFA 3ILRA 5H9PA 1WMFA 1JUIA 1C8M2 2E53A 1HRI3 4FPEA 1XXNA 2R043 3LOIA 3P3PA 1F5JA 2FQPA 3VUOA 5FLIA 1ZRFA 4B29A 1DDLA 2OUJA 2UYBA 1RIRA 1S0IA 2HWF2 2OPKA 3HD8B 1GZCA 4P5HA 4COWA 4META 1A8MA 3RMXA 3TB0A 2ZCWA 4BZ4A 4CDWC 3R4SA 3WG1A 3M1HA 1BZWA 2ZGRA 1UAIA 3PHMA 3ZIXA 1C3HA 1MS3A 3H0OA 3N3HA 3MIBA 1R083 1RUH1 4XFIA 1KRIA 1NYWA 2P3JA 2NZ9A 5EJ3A 4MSVA 1GSLA 1NCQC 1S0GA 5T55A 1ZREA 4YG3A 2VOXA 4AVAA 3U0ZA 4F7ZA 1AXYA 3B00A 3WG3A 4XQDA 3RWNA 4HT1T 4CEWB 2E7TA 2O1QA 1WD4A 3E5QA 4XXAA 2ATFA 5FO9B 4GB31 5J96B 2R073 3ROUA 4AQTA 1S55A 5CFCB 2BEOA 4JC1A 4BM8A 4AFMA 4W6YA 3LA2A 1K5MA 5KXEA 2XJVA 2QCSB 5ACA3 5AFEA 1J59A 4WVMA 2O8OA 2PFWA 3AZYA 3FFQA 4N53B 1RUF2 1OFSA 5I0RA 3MICA 2UURA 1F5FA 1PVC2 2AR6A 1V6IA 1FX5A 2VU9A 4HPKB 2P37A 1XE7A 2DFBA 3I59A 3O14A 2FZ2A 1DQ2A 1JUHA 1PO22 2IXJA 4K3UA 4RHV2 4PLOA 1R093 2K9ZA 4FPHA 1BK1A 4COUA 1YLLA 2GAUA 1H8VA 1I3HA 4BHPA 4C0BA 2PHXA 5C4WA 4WM7B 3KT7A 4Z1VA 1PK6A 3OTFA 4JRAA 4Q0QA 4ASMB 1MVEA 2GC0A 1W0PA 4CDUC 1AR72 3B9CA 1RL3A 2QNKA 1W6NB 2AZ5A 1ZBE3 4CDXC 1VRH2 1W2UA 1WBFA 2RMU3 3KS7A 2XJTA 4EJRA 4EV0A 3D8CA 2QUOA 4BQ1A 1VBD2 3RYRA 2HWC1 4GMP3 4LBQA 1A3KA 2ILMA 2JG8C 4ASLA 2BPA2 1ZX5A 4WVWA 4XXPA 4K9SA 3M3QA 1LOFA 3B5LB 3EJKA 5CIRA 3TRSB 2B9UA 4DRRA 4YZ1A 3HAGA 5T3NA 1DHKB 5C8CC 4ISRA 3VZJA 5KXBA 3ASIA 1PHMA 1C5IA 4YGDA 4CP2A 1DQ1A 1RHI2 2EVXA 2IFRA 4MGYE 5A32A 1MEC1 2VXRA 4LHKA 2WQZC 4DXZA 1QWRA 1F8VA 3IWZA 2ET7A 5DG2A 4QPGC 1IGOA 3D82A 2W0XA 3ZN6A 4YVSA 3WV6A 2K2SA 4RSUA 4XFAA 5C9AC 3ALQA 4BA6A 3AP7A 1PZ7A 1S0CA 2ZGLA 4YM0A 3PVEA 4MGIE 4PJYA 3S7IA 1NY71 2WT2A 1JTZX 5A33B 4Q29A 1NCQA 3WOGA 3MFAA 4R9CA 1UCXA 1O4ZA 1LKNA 1YIFA 4ZU5A 1AL22 2A73B 3QH7A 3W59A 1QXJA 1LHVA 5T5OA 5KHGA 4Q8LA 5FOBB 2I07B 3FJSA 4XHXA 3CEWA 3RZZA 4AK3A 2WNEA 1EV11 1DGLA 1J58A 5JSOA 1DG6A 1TEIA 1RVF2 1NQDA 1AYM3 1D0GA 4MGZE 5I93A 2Q1ZB 4D3WA 4XFHA 3T2TA 1PGW2 2MHFA 1KS5A 4Z92B 4D7TA 3VBSC 1QQP1 2QDRA 2GU9A 1FOD1 3ZFGC 3FC0A 1UZZA 2ZX3A 5KHJA 2D6LX 2XL7A 4JGZB 2C0ZA 1IZ3A 1YRZA 1Q8SA 2H6BA 2CGPA 1N1YA 1A78A 2VOKA 3G6JB 1CJDA 2Q1MA 1VB2A 1ULCA 1O5LA 4CDQB 3IM0A 2YC0A 4Y4YA 5I8SA 4E2QA 2ZBJA 3KGLA 3ZYPA 3ZXAC 3WNXA 5JPMB 3VL9A 2RS11 1QMJA 2HWD3 2WFF2 2GH2A 1G9CA 1DGRN 2ZACA 4M3CA 1RUC2 5JOZA 3H50A 2DFCA 1WW7A 1H4HA 2VPVA 1ZZ8A 4QGNA 2OYZA 4FPYA 4LBJA 1MQTB 2VVDA 2FHRA 4PIZA 4CDXA 3N7MA 3RI8A 5KC5A 4MYEA 2CGNA 1UPSA 5SV5A 5GJ6A 2AENA 4Q8KA 1W6PA 2V5YA 2ZGKA 1VAVA 4NOTA 4FBFA 2JG8A 1IPJA 5LEKA 4RGGA 3AMQA 1ASJ1 5IK4A 2I45A 3THPA 5FRAA 2F4PA 5ABJA 2RM21 5C8CA 1AR93 4H7LA 5J09A 3SCHA 1CPNA 1WW6A 2R1BA 3EO6A 4GKYA 5LK5A 1BEV1 2XJUA 3ETQA 1NCRC 4RR3C 1LB2A 3T1LA 1ZRCA 2R063 4XE9A 3KCCA 4QPGA 4RS5A 1ZZCA 2YHJA 2HKXA 3H1WA 3VV1A 1SLAA 3AZXA 3ZXGA 4EWDA 4Y1VA 1OOPB 1D0HA 2RE9A 4M00A 1U5IA 5C9AA 1Z78A 4JDOA 4QM9A 4KH9A 1YHFA 3AKTA 1IOAA 1XYNA 3B9IA 2FMDA 4Y22B 3FBMA 4LUMA 4AI8A 2YGMA 1UN1A 5GLTA 4IV3B 4GH4A 4OHXA 4M0HA 2TNFA 3I7DA 5F6LB 3O0XA 4AGVA 1GFF2 5BNNB 1CPMA 4E2GA 1OA2A 1IPKA 2IFWA 1LESA 1SEFA 2TBVA 1DQ4A 1F9KA 3C2UA 5LRRA 2D3PA 3J8F2 2RS51 3RRDA 3FZ3A 4QPIB 5CG9A 3VBUC 3FE5A 3BU7A 1XNBA 5E88A 2RR11 1RGSA 2VQAA 3DV8A 4O9EA 2GN7A 4I0BA 3VL8A 3MPBA 3I8TA 1PVXA 3JBG1 3VBSA 4KL1A 4A7ZA 3ZFGA 1YJLA 4RFT0 4QQ2A 3VHPA 1FPN2 4XJ8A 2IXKA 5EWSA 1SDWA 3HT2A 4E4ZA 1DFQA 4HZFA 3WP4A 3O0VA 1I6XA 1LGCA 2NQYA 1ZVFA 1FI2A 1QJY3 1QOTA 3LSEA 2IXHA 2XVKA 3AKQA 5BNPC 3V0BB 4WVVA 1QJU2 4ATFA 2ZGOA 2AH2A 4DQAA 1AZDA 5IUQA 1ASJ2 5F5QA 1G9BA 1VBA3 1D4M3 2BVBA 2Y0IA 3WVJA 4C91A 1DLLA 3I54A 1UIJA 2VOWA 4HLTA 2I2SA 3WLUA 3DPRC 4QGLA 5KHHA 2OUHA 5AC92 4NHLA 2XKOA 4CZSA 1I5ZA 2GNTA 5JR7B 5GZCA 3ZYJB 5DUVA 3PNAA 4L97A 2PAKA 3X29B 1YFUA 4YVWB 3UJOA 4XW3A 2XHKA 3HWJA 3IKWA 1DGWX 1W6QB 2XWJB 3SHRA 1BJQA 3MW3A 4A2UA 1PGL1 2VMGA 3JU9A 3SLIA 1HRV2 1QXPA 5CADA 1G9AA 3MGUA 3LCPA 3NWKA 3VZMA 1AF9A 4DPNA 4KBBA 2A5ZA 2XJQA 4Q1PA 4AVBA 4Y20A 1ULDA 5JLVA 2C1FA 2XH6A 4R9DA 1EV13 3R05A 1PO12 1REDA 1IQAA 1B09A 1RUJ2 4B3NA 5FBZA 1EY2A 1WMEA 3OY8A 4P9LA 3ZXJA 4PQ9A 4RR3A 1HXS1 3MLLA 1JOJA 4R4ZA 1GLHA 2VY0A 1QQP3 4M0NA 1W6MB 4W6XA 5J3UA 5A3MA 2UY8A 2WS91 3E97A 1BMV2 4X6QB 1GZWA 4RQPB 2GN3A 4NPRA 3RSJA 3NVCA 2ZX1A 1QXRA 1N3OA 5CFCC 4YW2A 3ACLA 3BOWA 3KQRA 2BW8A 4INDA 4QMAA 4Q4X2 1Y43B 2P3IA 2HEWF 2PHWA 5GALA 2DCTA 1UMZA 2OZJA 1CAUB 2R0HA 2JD4A 1AL0G 3WW4A 1DZQA 1OQEA 4MLOA 1DGRA 4FAGA 2DCYA 4L9BA 4N53C 4QXKA 1DIWA 4XEZA 3WUDA 5KXDA 4I09A 4HBNA 3GHMA 5JPNB 1GR3A 2DVBA 2CY6A 3VBUA 1RUD2 3JD71 2YGLA 4IEQA 2D98A 2ZAHA 2D40A 4YW5A 2GALA 1EAH1 2C5DA 4AE2A 3GBWA 4PDWA 5GLUA 1LU1A 2OVUA 2DVDA 4EWAA 2DUPA 3ZYIB 3APBA 4HETA 1DU3D 2D3SA 4IETA 4Y24A 1HX6A 1TMF2 4AVVA 4Y1ZA 4MXWA 3MF6A 2OA2A 1FV2A 5JDBA 4S2FA 2PLV1 2WT1A 1AR83 2YXSA 2VUAA 3AFKA 1AR63 1NA1C 1KD7A 3KSCA 4WM8A 4OHVA 1EP0A 4AVSA 1RUE2 4HVRA 3K51A 3VBOC 1SBDA 2VMHA 3MIHA 4UBHA 3TN92 1RUG2 2WZR3 4AVTA 2WL1A 3SH3A 1AJOA 3J4UH 2JG9B 4ISQA 4LO4B 4OVEA 4A7YA 4C0HA 3KGZA 5T5PA 3HN1A 1UPIA 4XQ4A 3ZSJA 4QGMA 4C90A 2CWSA 1AHSA 1WLTA 4NWVA 3RJ2X 2ZMLA 1R1ZA 1QJX2 4HN1A 1Y9QA 3OF1A 1OFNA 1C8NA 5CAZA 2HWE2 1ZBA1 4D7SA 3VHNA 1J3QA 3VHOA 1V9U3 1V6KA 3IN9A 1C8M1 1HRI2 2R042 1XNDA 2DURA 2HJIA 1RC6A 1ZA4A 1D2QA 2GNDA 1FNZA 5K9YA 3VKMA 3IBMA 1PIV3 2NN8A 1CAWB 1LJ7A 1NLSA 2ZZQA 3ZSKA 1YI9A 1WBLA 4Q2FA 3ZFEC 3ZXKA 2BGCA 1IS4A 2Q5TA 1LHNA 1AUYA 3FLRA 2D3RA 4JGYB 2HWF1 1QDOA 4LLFA 3N7JA 3N35A 5GLVA 1GV9A 3GYDA 3AYCA 1OMIA 2DYCA 4AEDB 3QCWA 2WNVB 3NO8A 1R082 2IXLA 3KMHA 2YYOA 1LOBA 2X5IB 4GWMA 4AWDA 4ORFA 1OD5A 1IKPA 2R1DA 4QM8A 2BYVE 2W08A 2HWB3 1B35C 4XZPA 5CFCA 3VZOA 4NWWA 1RTVA 2XLAA 5C33A 2DUOA 2ZJCA 1H1IA 2ES3A 3RJRA 2R072 2D44A 3R4UA 1G6NA 4RGAA 4N53A 5DUUA 5JAXA 1SQ4A 3WP5A 1CAVB 4HKLA 3Q9OA 1G7YA 4HPKA 5ACA2 2ET1A 2EAKA 1RUF1 2XWBB 5C6CA 4AHWA 2XLGA 4COZA 1PVC1 1CX4A 1VBC2 5E16A 5BNOB 5L19A 1O5UA 1PO21 2LALA 4K6BA 4RHV1 4F3JA 4NO4A 4QQHA 3VBRB 4K40A 3FLPA 2LM3A 4XBLA 1R092 2Z69A 2D5FA 2BTVC 4IEUA 4MV2A 2ZGNA 3KM5A 2CL2A 1AX2A 1BXHA 5H9QA 1AYN3 4W65A 1QDCA 2OW4A 4BIOA 5K8SA 4FOWA 1W6NA 1NA1A 1UX6A 4LO8A 4ATEA 2PA7A 3QOPA 2I74A 2SLIA 2CGOA 3VBOA 3SH4A 3NV3A 4LO6B 1AR71 2WZPP 4AI3A 4YM2A 1ZBE2 2RMU2 1VRH1 4DOUA 4Q4V3 4XETA 2ZS6B 1MZFA 4EN6B 5I0UA 2VUJA 4YVSC 1AX0A 1H1AA 3ZYGA 1AXKA 1VBD1 3MZHA 4KGGA 1O3SA 4OI1A 1RJ7A 3AMPA 2ZGPA <