4B4RA

Crystal structure of the lectin domain of f18 fimbrial adhesin fedf in complex with blood group b type 1 hexasaccharide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords F18 FIMBRIAL ADHESIN AC
publication title Structural Insight in Histo-Blood Group Binding by the F18 Fimbrial Adhesin Fedf.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 31
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b4rA00
4W6XA 4B4QA 4W6WA 4BWOA 4B4RA 4B4PA 4W6YA
chains in the Genus database with same CATH superfamily
3C7HA 4FPCA 3N7KA 4XC9A 4A7KA 5ACA2 2XBO1 2HWD1 4ONUA 4XUPA 1NA1B 1HLCA 1PMJX 4WBBA 1MQTB 1MR5A 3AXDA 2E7QA 3M4FA 2QQMA 3LSDA 2QUOA 1JYIA 2B7YA 4HMZA 1VBE1 3EYPA 4K20A 4IESA 1W0PA 2BGPA 3RNSA 1ASJ1 3LFIA 3NSTA 3Q8EA 1TVGA 4Q0UA 5EJ1B 3SC7X 1PIV2 3ZFGA 1NY71 1DLCA 4FFFA 4ES9A 3NVCA 5LBEA 4QQLA 2Y6FA 4GALA 5L7OA 3UL2A 2J1TA 4JC1A 1LGCA 1UKRA 3T0DA 3ZYIB 4OUSA 1OF3A 4Y22B 3BB6A 2GMEA 3IBMA 1ULDA 2UWCA 2HWE2 4BQWA 2I2SA 3ZFFC 4HBNA 3VBFC 1LULA 3O0WA 1LOAA 4FPHA 4FO9A 5IK8A 4HN0A 5H9QA 1RVF3 4X6RB 5JUVA 1B35C 2FD8A 1GICA 1DP0A 3N9LA 5C8CB 2EA7A 4B7EA 5IVCA 1AR61 3AVSA 3O14A 2WNUB 5FYIA 1UYZA 4EYUA 4Q4Y3 1ZX5A 4GAZA 4COZA 1OQ1A 3I2DA 5LBCA 2BVVA 3KS7A 2VZPA 1RJ8A 3UYJA 4WM8B 2WWUA 2F6BA 3FHQA 3VZOA 2Z4FA 4L97A 1QJX2 1JZ3A 1W6NB 1UCXA 1BEV3 3WUCA 1QJY1 1EP0A 2LTNA 2WNEA 2XHKA 4FAHA 1DF0A 1IGOA 5ABJA 2R072 2ZHNA 5JXIA 3DPRC 1SFNA 1IS3A 2CHHA 1JYTA 2DCYA 5KR7A 1FYUA 1MPXA 2YV8A 4K6BA 1BK1A 2HWC2 1WCSA 2O8OA 2QQWA 1MEC2 2UY9A 3BPSA 4NRPA 4QD2A 4WVWA 3CJIB 5FP8A 5L36A 1RMU3 1RUI1 2Z5WA 4RHV2 2PQQA 1LENA 4FFHA 3WXPA 4JKMA 3AP6A 3WW4A 1XU1A 1C8M2 2HEWF 4LKFA 2E26A 4XACA 3VBHA 1FATA 2Y34A 3NAPC 3W59A 2Y33A 2VG9A 4PIXA 1LGNA 3VHOA 2ZCWA 2CSGA 3SEEA 1AF9A 1YQ6A 1VALA 1KD7A 5JZGA 2O1QA 1EUTA 1HRI1 2OZ6A 3HVDA 1C57A 2ZPXA 4YVWC 3FN9A 2R0HA 3U1XA 1VRBA 4QX5A 2WA3A 3O7OA 3JQWA 2RR13 5LASA 3CDZB 1UYYA 1GWKA 4Q4X1 4R4ZA 4LBQA 4LBQB 5A7WB 3AZYA 3OBTA 1NAEA 2WINB 4RD7A 4OVEA 4FP2A 4QDSA 5DABA 1IPSA 2VC9A 3CLPA 1MZ5A 3LF7A 4FPLA 3GYDA 1J84A 3RZJA 2A1XA 4FPYA 5FMDA 5LK7B 4HVRA 1R092 3OUHA 5A6QA 2JX9A 2IXHA 4A6SA 3LEMA 4P5YA 1O3RA 4HANA 2DCTA 3PIJA 2PHWA 4FPKA 4DUWA 1CESA 1ST8A 3HN3A 3FBMA 2VGDA 4E2SA 1W6OB 4K8RB 5FY9A 3I2JA 4YW5A 3NNGA 1FNZA 2OUJA 1DQ6A 1PVXA 4IEOA 4OMDA 1LHWA 2X5IC 4ASLA 4KGQA 4CDXA 2WZEA 2ZGOA 1WZXA 4GD4A 1FMD1 5AVPA 1F4HA 1JZ4A 5KWRA 2YBSA 4M3CA 3HEIA 4BQ5A 3JXSA 1H9PA 3BOPA 1H2KA 1C8NA 1ZVFA 2GNTA 2ZOEB 3OB8A 5GZGA 4XQ4A 5LW9A 1GUIA 1VB4A 1XXNA 4I3GA 1OBNA 4MOAA 4MXWB 1LTEA 3ZFEC 2QNKA 4L11A 4Y5SA 4YZ5A 4CXYA 1H8TB 1WCKA 5CKNA 1PNGA 4QAWA 2YFUA 1SDDB 2VXJA 5FMOS 3WNXA 1Y43B 1GU3A 2MNGA 4CDUB 1VLNA 5FZOA 1BBT2 3I2HA 3ZXKA 2ILMA 2W87A 3CBNA 2XHNA 1OC1A 3FFQA 1VBB1 4D6SA 1UOGA 3JD72 4H14A 3OYWB 4LHSA 4QX1A 5LA2A 1QDOA 4QPGB 4ASKA 1M06G 4CSWA 1JU3A 3LIHA 4Y33A 3KV6A 4E4DX 5JSRA 4DY3A 3DL3A 3J8F2 1JZ7A 5LK5A 3LOIA 4A6OA 3AL5A 5GLUA 4YFWA 5FP4A 4C8DA 3AKQA 4CRQA 3OPWA 4MZUA 4A3ZA 2BZDA 5JMCA 5FY1A 3O1RA 1BQPA 3E5QA 4N8MA 5FK8A 1LJ7A 4UOJA 3ZMNA 3MEPA 4XPVA 3O1PA 4CEWC 1OOPB 2ET1A 3LE0A 4S2GA 4HFSA 3I2OA 3BIWE 3ZFFA 1RUE2 1I3HA 5EXOA 2AEYA 3GF6A 3ROUA 4FQZA 4URAA 4A7YA 4MGYE 4GKYA 3MPBA 2ZMNA 3JBG3 2O0OA 4XDOA 2DCJA 2Z2SB 3GBWA 1JHJA 3SHRA 3POGA 2NLRA 1IPKA 1VBD1 2LM3A 1HV1A 3MLJA 1ENSA 4QHBA 1VRH3 2J1AA 3E6DA 3OOXA 5JLVA 3ZKYA 1SCRA 3KB5A 1RUJ3 1AL0G 2ORZA 4FI9A 4FOQA 4BLIA 4E27A 4LUKA 5JOYA 3MIBA 4EZHA 2ZGQA 1VAMA 4KBBA 5FZAA 1UL9A 5CIRA 2Z42A 1UPIA 4URTA 1QHDA 4AHXA 3BGAA 1TNRA 2R063 1ZBE1 1ZZ6A 2BEOA 2XBO2 2DVDA 2HWD2 2ID4A 2GNBA 2DVAA 1OURA 4RA0A 1N47A 4NHYA 3HNYM 3POFA 5CADA 5BNNC 1GSLA 3DPRA 2FDGA 5E6HA 1VBE2 2VVFA 3U78A 2XJPA 3KWVA 3UESA 4YVSA 1ZZ9A 3B01A 1NY72 4YVSB 4FT8A 5GZFA 2AREA 1QDCA 3VD3A 3ZYFA 4A42A 1RXGA 1W8WA 2HWB3 1ZZCA 2H6BA 3V0BB 2IXCA 5ISLA 2VECA 4WVVA 3VZMA 1SHWB 3VZJA 1LODA 1XB9A 4CP0A 1WD3A 4EN0A 5BNPC 2YU1A 1VBC2 1CJPA 3E5XA 1QXPA 2JDYA 4B4PA 4FBFA 5C8WA 3ACHA 4YVWA 4HSJA 3AXEA 3P1IA 1CAXA 4IETA 4LBOA 1EV13 1X82A 3DECA 1MS3A 4QXKA 4B8EA 1O5LA 2OYZA 1YEWA 1EUUA 4EWDA 2WLPA 2J1RA 5FPBA 4JKKA 4B1LA 4HPKB 1W8HA 2QVSB 4LE3A 3USUB 5HCFA 5FPVA 2B42B 1N1TA 1OA4A 2ZGTA 3FUOA 1POV3 4GQ7A 1SZBA 3WF4A 1QJY2 4AOCA 5FZKA 2XVKA 1NQDA 5A80A 2OUHA 1UZ0A 2BWAA 4EWEA 5IYYA 4Q4V1 2KM2A 4BQXA 5FO9B 1NXD1 1O8PA 2R042 4EN6B 5C4WB 3C7EA 5IVEA 3S5AA 1A6CA 3QLQA 3MIHA 3OTFA 1RUI2 1HXS1 3KF5A 2Q8CA 4ATEA 3DKQA 4KWKA 2TNFA 4P9LA 4CCLA 4JRAA 5DG2A 1U5IA 4ORFA 4LLOA 2ZX3A 5LZ6A 3POSA 1OT5A 1X36A 2W91A 3VBOB 2JG8B 3RYPA 4NRMA 3EJKA 4XFCA 5HXVA 3KV5A 4GJZA 4Y1YA 1HRI2 2WN2A 4MHRA 2FZ2A 5D8AB 4M01A 2GH8A 4DUVA 3FE5A 4GXLA 5FDBA 3ZXLA 4XJ8A 4A45A 1FX5A 2J1VA 5FWEA 3ZSLA 1V9U3 1O6UA 2RS11 3A21A 1JZ5A 5JOWA 3PVEA 1RUH1 1N3PA 1S2KA 4M00A 5SV8A 1RITA 1OLME 3I3QA 4QU2A 1K5JA 3HWJA 3AZVA 5B2GB 2A75A 2WWSA 3C7FA 4AVTA 4CUCA 4N53C 2BYVE 1ODNA 1STMA 1S0DA 3OY8B 4W50A 1HQWA 3AYDA 4F7ZA 5JIUA 1UY4A 4OULA 1GP5A 1PX4A 4XJ9A 5F7UA 4E2GA 1ULCA 2KD7A 4WVMB 1KGYA 4KBZA 2RE9A 2EICA 1CR7A 1NYWA 5F37A 4RGAA 5DUWA 3UKTA 4Q26A 4CDWB 1G9AA 4OZOA 5TSWA 1PK6B 1PGW2 1W8TA 1PMIA 2YC2A 1VJ2A 5DN2A 4CEWA 1UAIA 3A23A 3TNPB 1YHFA 1AR83 4NIGA 2ZKNA 5FMBA 2AC1A 1Q8SA 4D8MA 4L8QA 1H2NA 3WR0A 2RJKA 3W5MA 2XJRA 3H3LA 2VXRA 2XUEA 3D0SA 5EJ3A 4ASMB 4JTOA 3ILFA 3KF3A 3VGIA 2W95A 3ZXDA 2TEPA 4LTAA 5A6XA 3BTAA 5FLIA 4TTGA 5FIXA 3WNOA 1SACA 2ZHKA 1SCSA 2VPVA 2XUMA 2ZGMA 4TWTA 1NKGA 2P17A 5BV6A 4L92A 3AK0A 3N4MA 1YO8A 4DXSA 2P5BA 2SLIA 3IN9A 4CVUA 5BNOC 3LWCA 3MIFA 2LRPA 2PA7A 3USSA 5FWJA 1W3XA 2ZA9A 4NVPA 4QPYA 1KFXL 5BNNA 2QZ2A 3BOWA 4NN0A 5DG1A 2BNMA 4LT5A 3LSEA 3R4UA 1CIWA 2VUDA 1W99A 3AVRA 4FOVA 1FPN2 2Y6LA 3N9MA 4LKSA 4RFRB 4AEDC 1JYNA 4EN8B 3D8CA 1XOYA 4AK3A 5DMYA 5C3RA 2PHRA 1W8OA 4GZ9A 5BNPA 3FHIB 1JI6A 3EHKA 4QKDA 3ZSJA 1A34A 2E6VA 3LQCA 5KC5A 1H0BA 2GALA 2JB8A 4Q4W1 4GB33 2ZEYA 1JZ8A 1HQNA 2IXKA 1W9WA 2O8QA 1VBD2 3PUIA 2ZEWA 1Q3EA 4HL0A 3AYAA 4E9KA 5A1FA 1QWRA 2GZWA 4K7JA 5C3PA 1WCDJ 3TN92 1W2AX 3NL1A 3NQHA 3POJA 1G9DA 1D0HA 2HWF1 4UW3A 4LBQD 1F5FA 5SV5A 1QQP1 2GC3A 2WO1A 1RC6A 1S1AA 1WLDA 4QPIB 3RZKA 1RUD1 1ZBE2 1OPMA 1IS6A 2DFBA 1W8ZA 1Z7S3 1GMMA 4OLLA 1CX4A 1J1TA 1QJFA 4OHYA 3LKJA 1SLCA 3UJOA 2XXZA 1DIWA 3Q9OA 1ZA4A 1SEFA 3GZTB 3JUUA 5J48A 2OXBA 5J36A 4IUGA 3CU7A 4ZU7A 3MBWA 4P9WA 2RS31 1TE1B 1KS4A 1ND3B 3VD4A 5JR2A 1QJU1 4N9HA 3SMHA 1MZEA 1NLSA 1RUC3 3OG2A 2QKDA 1HB1A 2W39A 2AACA 2PXJA 1LOEA 3JB8A 1OKOA 4KMQA 3ATGA 1V6OA 1ENXA 2D6KA 2QCSB 3ZXJA 4P00B 1DGWX 3T4HB 1W6PB 1PO22 4CXXA 3I2GA 5ACA3 5DDJ2 4LIVA 3HNBM 4H7LA 4ARYA 1ALYA 4XF0A 2PYTA 2OVUA 2QDNA 4D7SA 1GYKA 3ZYBA 4RS5C 3GJAA 4P9JA 4O7XA 3T08A 3FHAA 4IEWA 1GZ9A 2GC2A 4UYBA 1XE0A 5H9RA 1PIV3 4NPLA 3AFGA 3RZHA 5FP3A 4N53A 1OI6A 4QX0A 3ZKUA 1HW5A 1ZRDA 5FO8B 3UV9A 5AVAA 4XETA 5FY7A 2QQLA 1G8WA 2JG9C 4FFIA 1W6MA 2YUEA 3DYPA 1AYN2 4IEQA 3ASIA 1REFA 4JRLA 4Q4V2 4LE4A 5LRRA 3ZSEA 5HBAA 1EYBA 1HXS2 2ZGRA 3OUIA 4AI2A 2VUAA 2C5DA 2OQ7A 4XABA 4BK5A 5C3OA 3V0AA 1TNFA 1UN1A 3WNPA 2Z69A 1C5IA 1FOD2 3PVOA 2P2KA 3PVNA 3ZPYA 4BLJA 4DIQA 2OA2A 3PU3A 1T2XA 2RS51 4QDRA 4QX3A 4JGZC 4BIFA 4D3WA 1WMFA 1CJDA 3OBRA 4QX8A 1HN1A 1X7NA 3ZXFA 4BHPA 1E57A 4GJYA 3HD8B 1NE6A 1URXA 2ZZJA 1UOBA 1IS4A 5C71A 3WP6A 1NG0A 3ABZA 1V00A 2WRAA 1NA1C 2R073 1UMHA 5KXCA 2RS12 4LNVA 5FPAA 1R1A1 1MQTC 1OSGA 3VDDB 1PO11 2WFF1 2VOXA 3WDYA 1ZM1A 3IDCB 3JB4C 2VW0A 1FAYA 4IL7A 5T3NA 3CO2A 4JGYA 2HWC3 4NAOA 3HIFA 1AL21 1MEC3 4JGYB 2FQPA 5DQ0A 4CTEA 5BNOA 1JYVA 3ZXAC 3D5OA 3T2PA 5A33B 2CGNA 2VBDA 2BERA 2Y60A 5FBJA 1C8M3 1OA2A 2FBEA 2MEV2 3HJRA 1POQA 2UY8A 1CPMA 3DYOA 4IE0A 4N7UA 4WM7B 1YIFA 3BPZA 4LR4A 1OFSA 2VQ0A 2JEMA 4K8FA 3HQUA 3U37A 3ZO0B 2BV4A 3IZOA 3LFMA 5KHIA 2VZ1A 4KH9A 3VHPA 4AEDA 2DDUA 5FXWA 1WW5A 2IWGB 2JB4A 1JYCA 2W52A 4NHMA 3KD4A 5C8CC 3KLSA 4Z2AA 2ZZQA 3QH6A 3POYA 4I09A 5FO7B 3H1WA 2WNUC 5FCCA 3WDTA 5KXEA 5KC6A 4JHZA 2EXJA 4ZU5A 1JTZX 2ARCA 1XNCA 1UX7A 1VBA1 5FTTC 2R1DA 3MPPG 1H1MA 4TYSA 1R093 3M3QA 4UBGA 1ZZ8A 3GZUC 2LUWA 4NIAA 4FOYA 3WG4A 3RMXA 2C9AA 1OUXA 5A7QA 3ZDSA 3AKRA 5GM0A 2Z79A 1NE4A 2DV9A 4I01A 3QH7A 3MIDA 4JHTA 3VBUB 5FMOL 1JOPA 1J1LA 1AR92 3DKWA 1COV1 2UYAA 3OD0A 1PGSA 5CG8A 1X9TA 4QXBA 3TRSB 3LOBA 1XYNA 3CJIC 4JQTA 5T52A 2PELA 2VR4A 2E7AA 3AP5A 4OHXA 4PIYA 3ZR6A 1NCRB 2X8KA 4B1MA 3OUJA 1WA4A 3PIGA 4QB6A 4HSLA 5KHHA 1D4M3 1OKQA 1NLRA 1J3QA 3VBHC 1V0AA 4CXWA 5IHRA 2DCZA 5HCBA 1O5UA 3SEPA 1L3JA 5F5CA 2PLV1 3HAGA 3O1VA 2P6CA 4CPBD 4UW6A 2BGCA 3S57A 1N1VA 4Y4YA 3MO4A 3T09A 1IZ3A 4RGGA 3WEZA 5JZGC 2IXJA 2ATFA 3SITA 3MUZ1 4IERA 5FP7A 3DN7A 2ZEZA 2E9QA 5A6ZA 1W04A 4AHWA 1LEDA 4HONA 4IDZA 3WD5A 2NQYA 2GP3A 1BBT3 2PAEA 4UWDA 2WWJA 2FDIA 3MLKA 2XL9A 3W5NA 2XQXA 3JD73 3QBQA 2C26A 2ZAAA 1YIPA 2NYYA 4RS5A 2PN5A 2A6XA 4XYXA 2D44A 3O1MA 4BQ1A 2NP0A 1JOJA 4YG6A 2HWF2 2CDPA 5T5OA 4DEQA 4KU8A 4XAAA 3A0NA 3J8F3 5JR7B 5JI7A 1RUD2 5GKAC 1W2TA 4XIKA 5FKBA 2P3IA 2X09A 3KT1A 2W47A 3QOPA 4TXWA 1C4RA 1SLLA 5DXDA 2GNDA 1Q8PA 2JENA 3P3PA 1S2EA 3VN4A 2ZX1A 1RUE3 4H55A 4LHLA 5GZCA 3W58A 2WZR2 4KG8A 2R30A 4E2QA 4AG4A 5EJZB 3DEMA 3ZN6A 3FLTA 1CZTA 1AHSA 2EXKA 1YRZA 3AYEA 3Q8CA 1EAH1 2IVJA 3R4DB 1ZBA1 2H0BA 1RIRA 1ZZ7A 3K77A 4Q1RA 1HB2A 2XQRA 4LKDA 4ZONA 4DPNA 1H8TC 3KV9A 1S2BA 1IKQA 4BIOA 2XJVA 4CDQA 4DUXA 3GCWA 4CDQB 1L7RA 2YU2A 4JGZA 5BXXA 5FAXA 3WLUA 2P37A 4CDUC 2XBO3 1RUF1 2HWD3 5DAWA 4CCKA 1YLLA 5IVYA 5DZGA 5C5UA 1LHVA 2VMEA 5T5LA 2GU9A 4AR2A 4QWNA 3ZM8A 1NA1A 3H50A 4XQDA 2WT2A 1QJZA 4QXCA 1MQTA 3LPGA 2QQVA 4QMAA 1VBE3 4QPGC 2HBTA 4ET7A 1RHI2 2IVIB 4FQ4A 3ZIWA 5E89A 4AI1A 4KQ7A 3I97A 3WW3A 2VBPA 2VUCA 4XF4A 4PF1A 4ZS3A 4AI9A 5JMOA 3UJQA 2W3JA 5IWFA 2DTYA 1W2NA 5FFOC 1XNDA 1F35A 4UXAA 1YQ2A 4Y22A 2D6NA 3N7MA 5JOZA 1OOPC 1VBC3 2IFWA 2WSUA 4AFAA 3I3EA 5AC92 1G9FA 3GHNA 3LIGA 4D6QA 4CUGA 2RG4A 2IXLA 2VMFA 3VBRA 1XYOA 1XC6A 2WZPP 1E5IA 1KEXA 3NO8A 1GOGA 3VBRB 4B4RA 1LECA 1P8JA 1UY0A 3NV1A 5A70A 4CP9B 4XEZA 5I0SA 2QBXA 5FXVA 5C8CA 1YCIA 2Y38A 2R6QA 3EBRA 4D69A 2VTXA 2Y6KA 3M7AA 2HH9A 2WNUA 5T5PA 1UZVA 3RMYA 1OFNA 2RS52 1DQ5A 1F8VA 5EYYA 4ISRA 5K9YA 1BMV2 4WM8A 4QXHA 4AXOA 2OPKA 3NKGA 4TN7A 1ZYBA 4AFBA 2WABA 3AZXA 2HJIA 1QJY3 1W6NA 3O0XA 4AVSA 4LBMA 4XUQA 1RYYA 4PT6A 1S0JA 2C6SA 2P3KA 5HCAA 4EV0A 4N43B 4YG0A 4QB2A 3WDVA 1KRIA 4IEXA 2ADDA 1SPPB 3TEYA 4I2OA 2E63A 2R043 2WO3A 1GOFA 1AL22 5JXGA 2QZ3A 3I3BA 4Z1VA 1UIKA 1RUI3 4YVSC 5FZHA 3T1LA 3WNLA 4AEJA 4YSFA 3CJIA 3ES1A 5F5QA 1Q56A 1WCQA 4AYUA 4GIQA 3N3HA 4PLNA 5FUNA 1H4GA 4RQPB 2WBKA 4RSUA 4JQRA 4Q4Y1 3IDAA 1F9KA 5FYCA 2TUNA 5DAVA 1UOJA 2ZHMA 2A3YA 2RM21 5J7MA 4LO4B 4M4RA 2XOMA 5F6LB 5BYNA 1HRI3 2XGXA 1H6YA 1WBLA 4Q2FA 3AL6A 3N35A 3ZPOA 5I8TA 4EE2A 5JWPA 5BUVA 4BXFA 4V2VA 4EROA 4Y5Z0 1DYOA 1AR71 2EAAA 4X8PA 3T0AA 2VQAA 4OUMA 3BODA 1YUDA 3BVCA 3IIIA 2Q30A 4GWIA 2DFCA 5A7WA 5IVFA 3UGGA 1G9BA 3OSDA 3P3NA 1VBA2 3E1F1 1F5JA 1RMU1 3K3OA 4KI5M 1ZRIA 4K9SA 1UO9A 2K46A 3PLQA 3WVJA 2QTWB 2VZUA 1NQJA 4HK9A 1POV0 1J3PA 2XWJB 2PHUA 3W21A 3ZYJB 2J1SA 4ES8A 4AEKA 1COV2 2OQ6A 3AZZA 2NMNA 5C6CA 3I3DA 1W6OA 4X6QB 3RZGA 4MG2A 4AVVA 5CFDB 3K4AA 1IHMA 4YPJA 1F4AA 1OVSA 2RR11 1MACA 5L9RA 4CCJA 2PMWB 2FDKA 3B69A 4CCOA 3J4UH 1R081 2A6ZA 1CPNA 3VBOC 5I0RA 3PUQA 2JG8C 1SFYA 2D97A 3B00A 4O65A 4R9BA 3ALQA 3ES4A 2E7TA 3WSOA 5CVRA 1ND2B 2QQUA 4BWOA 4MXWA 5D8AC 2BNOA 1KS5A 3N9PA 1H8TA 1I9RA 1K5MB 4X8NA 4AHZA 2CNAA 3PNAA 2ZMKA 1W6QA 2DU1A 1W6QB 1S0FA 4H2AA 1IG3A 4W6YA 1A78A 2FHRA 4CDUA 2WDBA 4H3WA 3NJVA 4META 2OX0A 2ZACA 1GNHA 3WP4A 2ENRA 1JU4A 4OQ8A 5JSPA 2BJSA 1YI9A 3B7MA 1X33A 1SBFA 1UY1A 2VNOA 3OYWA 4QPGA 4D7YA 2D7FA 1JN2P 4GWJA 1IG0A 4GH4B 1BCXA 1SDWA 5HCHA 4DY5A 4LA3A 2XH6A 4MXVA 4OHWA 4PLOA 1FPN3 1OF4A 1GKBA 4QKBA 3WQBA 2IZWA 4CDWC 5FOBB 2JE7A 1U5XA 1PK6C 4IEVA 3V56A 5LRSA 2ZGKA 2B5HA 2H0VA 5FRAA 1OOPA 3HNMA 1J3RA 4NOTA 4PCRA 5JCTA 3GGLA 5C3QA 1I1EA 1LB2A 1LOCA 4MO3M 1XRUA 1GOHA 1ULPA 1WWYA 4LO5B 3UETA 3PUSA 1ZBA2 1FV3A 2HBUA 2BW8A 4FOWA 1GQPA 2WUHA 2EAKA 4P9GA 4XVHA 5F6KA 3AX4A 3TEWA 3TN93 5CKMA 1OD5A 1PHMA 2VOWA 2VZ3A 2FDHA 4QKNA 1MZ6A 4BMBA 3BALA 3QD6A 4JZRA 4LULA 3V64A 1ZBE3 2IXIA 3KVBA 4G9SB 1RUF2 3KCCA 2YHJA 2RDRA 3U10A 1G6NA 3WQ7A 3LPFA 2NPIA 4CZSA 2A5ZA 3WY6A 1UW8A 1Y9GA 4HLTA 4PDWB 2D98A 1SBDA 2WJSA 3UGHA 3JU9A 1UX6A 2B39A 4YW6A 3JBG1 3D3AA 3MF6A 4JV4A 1ASJ2 5BY5A 1JXNA 5FYBA 3DXTA 2CYFA 1VRH1 5C9AB 2JE8A 3ZSMA 2D6OX 3U4XA 3V0BA 1RUJ1 3RJ2X 4HG6B 1A8DA 2E31A 3K46A 4Y3OA 1FV2A 1I5PA 3AMPA 1W28A 1HB3A 4XURA 2G19A 3WCSA 3OBZA 2D3SA 4IV1B 2R061 1PO23 2DF7A 2XJSA 3C3VA 3H3ZA 4P14A 5DDJ3 3T2TA 5EZWA 4XDPA 4AF9A 4IXLA 2FZ1A 3O12A 5AFEA 5F1RA 4HXCA 4D94A 3ZN5A 2R32A 1BYHA 5M0TA 1MZFA 2RDNA 4FSJA 4M0NA 2DCKA 5FY8A 5FJKA 1OLRA 1XSQA 2VCMA 4YM2A 4IQPA 1AR62 3X29B 3KT4A 2R1BA 4HPKA 1CZSA 3U0ZA 3VDBA 3SLIA 3USUA 1S4CA 2DTWA 2RMU1 4LEJA 4AE2A 5FZ9A 4GWNA 4QPIC 4ZXKA 1RTVA 2WKKA 4RR3A 4XJAA 4YW1A 3SH5A 4RR3B 4XCAA 5A3WA 2RDQA 1RL3A 3P6BA 5CZKA 4FAGA 2DYCA 2QQKA 2FDJA 1AYN3 3INAA 4Q4V3 4FPEA 4L9BA 3RSJA 3KSCA 5FZ8A 2WR9A 2WNVB 3NNJA 3AFKA 3FC0A 3OGSA 5C4WA 4AI0A 1KXGA 1DGRN 1HXS3 1LKNA 1MS5A 3B3QE 3RGBA 4K3UA 2DUOA 2EIGA 2JDUA 2YDEA 4CPBA 1ND3C 4IE5A 1FOD3 2XONA 3MV01 1DQ4A 4BQYA 1CAVB 4DNYA 3RZLA 4IEZA 2C1FA 5DUUA 1CQ9A 2RM22 3VBOA 1HJFA 2JG8A 3B9IA 5F2WA 3NWKA 3WNMA 2JKBA 1POV1 3CL1A 4YFZA 3AP4A 2V73A 4D7TA 1NLQA 1WW4A 2VCCA 2WAOA 3WQ0A 4EZ4A 5D8AA 2JIJA 2GC1A 3ACLA 3LDKA 1AR72 1F15A 4UW4A 2RS13 3NRUA 5FZ7A 2VQUA 4HKOA 4WZFA 4Q4X2 3MFAA 5FP9A 4YW4A 5FREA 5L73A 2I07B 3BTZA 1KDKA 3M3CA 4XFFA 1XNKA 2ZGNA 3NJZA 2EXIA 3VKNA 1PVC1 2WT0A 5C7GA 1HRV3 2AZ5A 2F4LA 3G6JB 4QGLA 4QM9A 1DQ1A 2D3PA 2QDRA 2MEV3 3OY8A 1RUNA 1BXHA 4OZXA 2XVLA 1ULOA 2ZGLA 4WVMA 5FYUA 5IATA 5FZDA 1EPZA 4QGMA 3IDBB 3CZUA 2C9KA 5IK7A 4KNCA 3BYWA 1WW6A 4Y20B 1KITA 1PM4A 4LPLA 5FZ6A 1NUKA 4HVQA 4CDWA 2ZKLA 1PK6A 4QKFA 1NCQA 4LORA 2AUYA 3AKSA 1NCQB 4F3JA 4IE4A 2XKPA 4LQRA 1R082 3H8UA 5IAVA 4AAPA 1FMD2 5JIAA 4C0BA 5A1LA 2WS93 2WSVA 3O1OA 2WC2A 2EALA 4PBOA 5A32A 5CISA 1S0GA 5A32B 1DCSA 3RVHA 2YC0A 1XU2A 3H0OA 4NAMA 2JD4A 4Y1XA 5CFCB 1O4YA 5CB7A 2CL2A 1XQNA 3NNLA 2YBKA 5JOXA 1S0IA 5LEJA 3E6CC 4I30A 4AGGA 4XMAA 1G7YA 3BTYA 2VZQA 2DBNA 3DXUA 5ANNA 3L2HA 3VDDC 4LMFA 3IT8A 1LNSA 1AR93 2JXAA 2JWPA 1GR3A 4IEPA 4MGKE 4W65A 2PAMA 4KL1A 4JGYC 3CZJA 1W8NA 4BA6A 5IFTA 1LRHA 1VBB2 2BTVC 4MGZE 3ZR5A 1M4WA 5F5IA 1GWLA 4WM7C 1QU0A 1QNYA 3WV6A 3WHTA 2QFEA 4WZCA 1AZDA 1Y4WA 2RV9A 2XJQA 2ZXQA 3HOBA 1W06A 1YI7A 1D4VB 4XXAA 1YFYA 4FXKB 4YG3A 2ZX4A 2IUWA 2JDMA 2CGOA 2J1UA 3PHMA 3T0BA 2QJVA 1O8SA 2C24A 3H9AA 1YYNA 1Z78A 2PAKA 4QU1A 3UGFA 5K0UB 1G9CA 4EJRA 3RQ0A 4ARXA 2W9XA 2X05A 4C91A 2WNOA 4D6RA 1UZZA 1AXYA 2ADEA 2VUJA 3VD5A 4RYDA 3CF6E 2ZAHA 3H8RA 1J59A 3VHNA 3IAQA 5I91A 5B4NA 3WX5A 3FLPA 3ZSKA 3ILNA 2Q8DA 2HWF3 4HKLA 2VO5A 4K1YA 2ARAA 1K42A 2BUKA 5HI0A 1RUD3 3GBGA 2A7AA 3VBUC 2Y0IA 4PIZA 3WT3A 4QPIA 3MLLA 2N7GA 2D6PA 4M4PA 5FXZA 1W0NA 5J96B 2YY1A 2D5HA 4BQ2A 4COVA 1A3KA 1JOBA 3SKJE 3N9OA 1GP4A 1OH3A 3SQOA 2ARXA 2ZBJA 4E8DA 1NCRC 4O9GA 2WZR3 4DRRA 3JBG2 3A22A 1UYPA 4NROA 3GDBA 4GB31 4EN9B 4CE8A 4CYDA 1QF3A 1Q8VA 1RUG3 2V4AA 3VB9A 1MVEA 5JXJA 1LOFA 4XW3A 1IS5A 1ND3A 5FPXA 4MGQA 3PL0A 2B8MA 1R64A 1V6NA 2BFUS 3PUAA 5HPOA 2E51A 2QQPA 3POIA 3ZOIA 5FZ0A 2X53S 2Y26A 4AQ2A 1G86A 4Y24A 5LY2A 3FMGA 3ILRA 1OQDA 3J26N 2R062 3ZYHA 5D1IA 1H30A 4XFAA 1CGPA 1W6PA 3CKHA 3VDCA 4DMIA 1AYM1 5A7OA 2XVGA 1FI2A 2DUQA 4CCDA 2G9ZA 2W92A 2YPJA 4JX0A 3C7GA 4PI0A 5B4XA 3O1SA 5F3CA 4OI2A 3ZXEA 1JYWA 1RHI3 4PHZA 4A7ZA 1HJGA 2OW4A 4Q27A 4Z8BA 2RMU2 2E32A 5I8YA 1H4HA 3IPVB 4GMP0 1WLWA 4LBJA 3ZXGA 1O3SA 1W39A 3JZVA 4W8JA 4CEYB 4U36A 1LR5A 4Q0VA 3VD9A 3KHBA 4ISQA 4OHVA 2Y6JA 2HWE3 4S2FA 2BBAA 2YYOA 1BVVA 3O5SA 5D2AA 2P4EA 2WO2A 5AC93 2VBBA 1WA6X 4BM8A 5ACA1 3VKFC 3EB7A 3K3NA 2EF6A 3MICA 1HN0A 2A71A 3NJYA 4HK8A 3WW2A 3WUDA 3K2OA 4I0AA 5DUVA 3NKTA 4ITCA 5FBZA 4IW3A 4MGTA 5DPNA 5C33A 2ZGPA 2XWBB 3W9AA 3GBFA 5IVBA 4I0BA 4DXTA 5FZBA 2WYFA 1ACCA 1OPOA 2HLEA 2Y64A 1S55A 4DEVA 2ZJCA 4UI9L 3FUQA 1PIV1 3VZNA 3VLBB 1AX1A 4FPGA 4CDQC 3I3MA 4JKLA 3ME2A 3TOJA 1W0OA 1TMF1 1RINA 4BOWA 1QJX3 4E4ZA 1XE8A 4HT1T 4XCBA 2BQPA 2F17A 1T6GC 4OFGA 2VULA 4HN1A 1XNTA 3VDDA 5FZ3A 1RUH2 3ST7A 1AL23 1PVC2 3VBSB 3DGTA 1CAUB 4L2NA 1AXKA 2XR4A 5FKCA 1C28A 3AJYA 1GFF2 2W2IA 2GSYA 3O0VA 1BK0A 4B29A 3PMEA 4RHV3 4XHBA 5FY0A 1GQHA 5A33A 5FQ0A 2L9LA 3J7LA 2Q0AA 1TME1 1W2UA 3UKVA 4ZS2A 2W1UA 4WM7A 4PF5A 1VMJA 2W1QA 1UNBA 4BXSV 1DU3D 5LB6A 4COYA 2DBIA 2P6HA 3WQ1A 4XJUA 3VBRC 3GJBA 4TSVA 2ETEA 1YC61 3NV3A 4M3CF 2R071 4UW5A 1YFUA 4LO6B 2ORXA 4QQHA 2O14A 2G9FA 1K12A 3S0MA 1KQRA 3IAPA 1SLIA 2VNGA 5FYVA 3AB0A 2HWC1 5GLZA 3UT0A 1VBA3 3KQRA 5IUQA 4LIUA 4WM8C 1WGPA 3EMRA 4XAEA 2YBPA 1OLQA 1SBEA 5K4LA 5A6YA 2XLGA 4C1WA 2ZX2A 1YXWA 3ACIA 1LGBA 2ZABA 3CEWA 4N43C 3VBUA 2J42A 3GNEA 5A3TA 1WLCA 4IEUA 4Y26A 4ZY9A 4TZDA 2XJTA 4LLFA 5A7SA 1W05A 3AKTA 3GHMA 3RJRA 4BDVB 3K4ZA 1K3IA 1NCRA 4AQTA 1QOTA 3S7IA 5I8SA 2XG3A 4GKXA 1Y9MA 2TBVA 1FNYA 4ZU4A 4BZ4A 3LDRA 5CBLA 1QIQA 2AYHA 1BZWA 4IGOA 1UKGA 5EIYB 3MZHA 1ZZBA 2FDFA 3M3IA 1O7FA 2EIBA 4UF0B 2YGMA 5KXDA 1VP6A 5EYXA 3K48A 5FYMA 3L2YA 4OHZA 1QNWA 3NNMA 3I7DA 4MHUA 3E6BA 1DZRA 5FYHA 1N1SA 3RI8A 2PQSA 5DUXA 4LBKA 3E97A 3THPA 1JS9A 2YMZA 3PJQA 2B9UA 4Q4W2 2BWCA 3RDIA 4F83A 3SKVA 3ITQA 3WNKA 3LA3A 1CZVA 3MFCA 3WW1A 4NR1A 2PHDA 5FYTA 1HIXA 3OGGA 3WF3A 1D4M1 1GQGA 3I2IA 1JYXA 4GMP3 5FZLA 2NMOA 3FWEA 1QQP2 2FCUA 4R9CA 5FZEA 2XLFA 3DUIA 5EP9A 5L9BA 2VNRA 2VL4A 1E5HA 4QX7A 5CFDC 4R52A 1C1FA 3ORJA 3KZ4C 3OPTA 2VZSA 2H6CA 4XFIA 3OBAA 4FTEA 2Y6GA 5CKQA 1A8MA 3PTYA 1BLZA 4IV3B 1BBT1 2WQZC 1AX2A 4MYEA 2RS32 2RVAA 3SCHA 3N7JA 3JD71 4NHXA 1CAWB 1QJU2 4OMCA 1UOFA 1ND2C 5I0DA 2HEYF 4OI1A 1PZ9A 4HKWA 4AVBA 1N3OA 3PUHA 2ES3A 1U0AA 1K5MC 2EVXA 1I5ZA 1TZOA 3J8F1 3B9CA 3N9QA 3RZZA 3MF9A 3J7HA 4BISA 4BB3A 1RUF3 4F8AA 1AYM2 2JD9A 2RHPA 3T2OA 5I0UA 2VCBA 4MSVA 3KGZA 3VUOA 1UZYA 1V6KA 5F5AA 3QACA 3H7JA 2CV6A 4FP3A 1RUE1 2OZJA 5A1AA 1QJEA 2VMDA 3T3YA 1LHUA 1IQDC 1S0BA 4GH4C 2XL7A 1QMJA 1ASJ3 2UWAA 4FCAA 5DAPA 2J7MA 5G04L 2VTFA 4DB5A 4ZZ8A 1S0EA 1XYPA 1GZTA 3CJXA 4L99A 2ARBA 2HYKA 4NIDA 1ODMA 2VQTA 3IM0A 4OI4A 1O91A 3FFZA 3RWKX 5JSOA 1W90A 3KV4A 4MX3A 4YZ3A 2V5DA 2VMGA 2XKOA 1IKPA 3DV8A 4CU7A 4Q1PA 1L7LA 2ZEXA 5JPMB 1TQ5A 4CP9A 1X8MA 4XBLA 4QDQA 5FK7A 3Q8FA 5APAA 1AR63 1W03A 5KHKA 4ZZ5A 1BKZA 3WF0A 3A0KA 2QQJA 3MIEA 2NM1A 1O4ZA 4HVOA 4KGGA 5EV7A 2A3XA 2VJXA 3ZFGB 4I02A 2B4KA 1HDKA 3TBDA 3LEKA 1W9TA 3WCRA 1TMF2 5ANQA 5LA9A 5L7OB 1WMDA 1YWKA 4Q0SA 4ZXEA 2BOIA 4AVCA 1UU6A 3CIHA 1DYPA 2YB7A 1H9WA 3VL8A 3WDXA 5H9PA 5JVVA 1VBC1 1GNYA 5FJHA 4PDWC 2EIEA 3TB0A 1S0CA 4N43A 1R1A2 2RJ2A 1LU1A 4TLFA 1PO12 2WFF2 1SPPA 2GN3A 3WG1A 3A7QA 4YRDA 4R4XA 1RVF1 4RN5A 4SLIA 3ACGA 3OGVA 3OGJA 1MVQA 5FY4A 3SH3A 1TME2 5C9AC 3MHZA 2IFRA 4KWJA 1REEA 2Q4SA 4RQPA 3M70A 4PJYA 3BI3A 3AYCA 5E88A 2RM23 4DO0A 3AJZA 4W6WA 3H8XA 1LOBA 2E33A 4RGKA 4YZ4A 4GA9A 3R0RA 4G4FA 1V70A 2F4PA 2D43A 3HN1A 2Q8EA 4IV1C 4LO8A 2DVBA 2VU9A 3G7DA 4XUNA 1F31A 1RGSA 1C3HA 4QB1A 4FPJA 2VH9A 1BEV1 3EXUA 1ONAA 4EQVA 1AR73 4SBVA 5ABJB 1ZRCA 1I6XA 2VZOA 4LBNA 1DGRA 3WP3A 4Q4X3 2R7EB 2GNMA 2WAAA 4PLMA 1ULFA 3E5UA 1WD4A 4DOUA 5BNQA 1LOGA 2R041 4LUMA 5EWSA 4YARA 3D0JA 2YC4A 2W46A 5FZCA 1BJQA 1MS0A 4XBNA 3T4VA 1VE0A 1UWWA 4CCMA 4QHOA 4E4SA 3VBHB 5A3NA 1QOSA 3D4KA 4RR3C 3MV11 2YROA 1LEMA 2WN3A 3ZMOA 2EIDA 4XQWA 2WLQA 2CU5A 3RYRA 1J58A 5JZGB 5IFPA 3MUY1 2WNVC 1CD3G 2ZTNA 5LWBA 2W1WA 1DHKB 3ZFFB 5H9SA 3D6EA 4NRQA 1W8FA 4JVAA 5CFDA 3RS6A 5C4WC 5F8PA 4UAPA 1WMEA 4NJ4A 2B46X 2BDRA 2X10A 4Q8LA 3N7LA 4LXLA 2HYXA 3PURA 4ZHNA 1R083 5FZ1A 4B3NA 1FMD3 4MLOA 5DZEA 4E8CA 4AQ6A 1XNBA 3ETQA 1OMIA 4UFIA 2D40A 4DS0A 2VMCA 2PLV2 5LA1A 4UFHA 3UKNA 5C70A 1KDMA 3POBA 4IE7A 3ON7A 1ND2A 1NZIA 1BVP1 3IWZA 4P9YA 4Y1ZA 3BTXA 4NIHA 3SCFA 4NIIA 1YFWA 2CY6A 1K5MA 1QY4A 5FLHA 1QH6A 1W8UA 2QQIA 4YW7A 5FZGA 3KM5A 1UMIA 5E1RA 3RZMA 1KJRA 2GH2A 1DFQA 3LDBA 4UBHA 4AVAA 1WCUA 2I74A 4KWUA 2JICA 1PGW1 2VW1A 1DG6A 1U5YA 4XBQA 1JZ2A 3BIEA 2BBVA 1H6XA 1VBB3 1WMXA 4AZZA 4CDXB 3ZYRA 5FZMA 3WG2A 5CEHA 4LKEA 5HXMA 1KJLA 1D4M2 4S2DA 5FZIA 2P34A 5FMCA 1OH4A 3I54A 2D93A 5GZEA 5A7PA 3NNFA 4M3CB 5GZDA 2UU8A 5T50A 4GH4A 3O1TA 3FLRA 3ZLIA 2XJUA 4W4ZA 2XMLA 4NUBA 5FY5A 4AGVA 2CWSA 3U14A 4YZ1A 1ULGA 4JDOA 3THCA 2PHLA 3MDPA 1K45A 1JZ6A 4Q29A 3AMQA 3I2KA 3SNMA 3VHRA 1NCQC 2Q1MA 5GJ6A 1UQXA 4Q5OA 2MPFA 4P02B 2VNVA 3SISA 2GC0A 1JW6A 2R49A 1ENQA 5FZOB 5J09A 4LBLA 1TEIA 4YYOA 1YNAA 4XFBA 4QQOA 5JPNB 1GLHA 4AW7A 4B7KA 3HPNA 1Q5OA 1VBD3 1EAH2 1DGWA 1RXFA 1VR3A 2GAUA 2P1BA 2OPWA 2YG0A 3A4UA 4CP2A 5CFCC 1PNFA 2JDZA 2BFUL 2FMYA 1PX3A 1V6LA 3C7OA 3HR9A 4YGDA 4CU6A 1HKDA 1UU4A 1VPHA 2BVBA 1XNAA 3ZDVA 1DLLA 2D6MA 3U07A 4BU2A 3WHUA 1FPN1 1CN1A 4CP1A 4QQ2A 4XTPA 1YQ5A 4AL9A 2W1SA 5IW0A 4O61A 1HQLA 3KCYA 1JH5A 3DF0A 3CNAA 5ERLA 1WW7A 1ZRRA 4PBPA 2PTMA 3HT1A 3CMGA 3I2FA 3M3OA 4PDWA 4XOGA 2E53A 3VBFA 3VBFB 4Q8KA 4XTMA 2Q5TA 4K1ZA 1QGLA 1YJLA 2W5FA 4DXZA 4YM3A 5LY1A 4H7MA 4LK7A 1B35A 4MV2A 1B35B 4TLGA 5D21A 2VM9A 5FR3A 2EXHA 3IMMA 5IAXA 1VMFA 2AGSA 5C9AA 1LCLA 2W08A 3TN91 3MI8A 1V6IA 4CUBA 1AUYA 2UYBA 4YM1A 1ULEA 3ECQA 4MH0E 3B5LB 4JDNA 3LB9A 3POEA 1OA3A 3K4DA 4QQPA 4Q0PA 5K0UC 3DYMA 4OUEA 4Z92B 1N1YA 3HQXA 3S6PA 1N3QA 1GP6A 1ZA7A 3BN6A 4IV1A 3LD8A 3AC0A 4EWAA 3RYKA 2NZ9A 4Z2WA 1JMUB 3H1MA 1SMVA 5DAQA 3H8OA 3DPRB 1V6JA 4UFLA 1GZWA 4CCNA 1GZWB 3NW4A 5CG9A 1FXZA 2RMU3 3EO6A 4YLZA 5E8AA 4R9DA 4N7IA 2LALA 2WYSA 1RB8G 3WNNA 5A3OA 5LBBA 2HWB1 4CUAA 5AFBA 2IC1A 3NAPA 4NHKA 3NAPB 3D82A 2AR6A 2VW2A 1WLTA 4AGRA 3I49A 3ZIXA 2JKXA 1PO21 2WNVA 4YVWB 1QEXA 5DDJ1 1CAXB 1RVF2 5EFUA 3B94A 3KVAA 4WVZA 2DUPA 1NZCA 3FL7A 3MW3A 1EV11 1LOFC 2AH2A 2VMIA 4G3YC 1U5ZA 2DURA 3TWIA 3GM8A 4UFMA 5A3PA 3BU7A 1UMZA 1CAVA 3C2UA 2W94A 4Q4Y2 2VZVA 2D5FA 1VIWB 4BE3A 1W9YA 5JXHA 1YJKA 2LROA 4Y4RA 2BOJA 2QQNA 4XFGA 1US3A 4B4QA 4A41A 2VOVA 4MGSA 4ATFA 1R1ZA 2AENA 1BEV2 2BP6A 4QGNA 3I4IA 2A6WA 4C90A 4LA2A 4S2HA 5JI9A 1AYN1 3NMBA 4KG0A 3ENRA 1VMHA 1RUH3 2VMHA 3T2QA 1PVC3 3MGUA 5J37A 1OUSA 3K75B 5EHDA 2X5IA 5F3EA 2C4XA 5F3IA 2ERFA 2X5IB 5A3LA 2XLAA 1RMU2 4P9XA 3POWA 4K40A 5T55A 3OPZA 3GCXA 1F2NA 4UT5A 1FOD1 4PI2A 2FMDA 2BRTA 4M0HA 1IPJA 4AFCA 1BHGA 5FZ4A 5I0TA 4Y1VA 4AFMA 3APBA 4DXRA 1SFPA 2ZMLA 4CEYC 1DGLA 3OF1A 3KT7A 4YW2A 3RI9A 3DCQA 3NJXA 5F3GA 3CQOA 1REDA 2K2SA 3VD7A 3ZFEA 3U11A 3ZFEB 4Y20A 5IVJA 2VZRA 3KMHA 4IGQA 4NPRA 2WIIB 1Z0HA 2W68A 4JCKA 5A3MA 3I8TA 2RR12 4YGCA 4BQ3A 3HQRA 3SCGA 4AAXA 1V9U1 3WF1A 2D6LX 3LAGA 2QE3A 1DQ0A 3H1YA 1CVNA 3RG0A 3IMNA 2K0GA 5DAXA 1EPWA 3U75A 2WO7A 1HRV1 4CCEA 1O4TA 4BH9A 1GV9A 4E4HA 1PM7A 2MEV1 2PFWA 2Q1ZB 4AI8A 3URFA 5CFCA 3HBZA 5KHGA 4V1PA 1SLAA 4LJHA 3P5BA 1CX1A 3S7EA 3ETPA 5T54A 3NV4A 1ZNPA 1HB4A 1SLBA 4RL7A 2X29A 1PZ7A 3R05A 3UNPA 2FCVA 3OEAA 2OT7A 1GANA 3VBSC 5LCWL 4J25A 5IVVA 3KGLA 5IJRA 1UIJA 4R9AA 4CEWB 2HEVF 5DZFA 4J6GA 1W3VA 3FX3A 1GZCA 4OI0A 1HX6A 4JAAA 5JDBA 1AR81 1JBCA 4AHYA 2WS91 3OEBA 2R16A 2DWRA 4FPFA 2XDVA 2P3JA 4NWWA 4YWAA 4CA9A 1UYXA 5A3UA 1H1AA 3AMNA 1QXRA 1WBFA 2LW8A 1OQEA 2RDSA 2VOKA 4I3PA 4I0WB 1MS4A 3AP9A 1W2OA 1X8EA 2JJ6A 3H3UA 3LZZA 4DINB 3H7YA 3VKLA 4NMIA 1UPSA 3MYXA 4N90A 3EQEA 2BPA2 4IEYA 2LS6A 2B45X 1APNA 1JHNA 3B02A 1KFUL 4K21A 5K0UA 2OKXA 5EQUA 1AR91 4DRVA 3PVBB 4Q4W3 1GBGA 3VZLA 4QT6A 1PZ8A 4PQ9A 1US2A 3CHXA 3LEIA 1CIYA 1YFXA 4XZUG 4IGPA 2I45A 5BNNB 5CAZA 4Z07A 4WV8A 2D3RA 4HETA 4QX2A 3TEZA 4BK4A 5F39A 1UXZA 1NX9A 4Q0QA 3WG3A 1QQP3 1XJAA 2J1EA 3N36A 2VVEA 3ZN4A 4J1XA 4FTBA 4PQQA 1E5RA 5LATA 4AI3A 3BUCA 1O3QA 4FPOB 2BGOA 4R8HA 3RWNA 2WQ4A 1RJ7A 4YNIA 5BNPB 1EY2A 3M8LA 5K8SA 3WDUA 2VCAA 4DFSA 3PU8A 2PHTA 1DBNA 4INDA 3L9JT 1QKQA 3HBKA 3S30A 5FYZA 3M2MA 4FXGB 2Q8OA 3SXWA 4YW3A 2RS33 1YQCA 3MW4A 1CWPA 1DDLA 1AJOA 3R4SA 1QJU3 4XF9A 5EPAA 4XF1A 1ENRA 1VRH2 4C1XA 5J1XA 3RRDA 4BYYA 1CONA 2GMPA 1Q8OA 1RUJ2 4XHXA 4YM0A 1XPWA 3WINE 1PGL1 4Y5TA 2JDAA 3ZVXA 4XE9A 1OXCA 3T1MA 4UFKA 1AYM3 3WOGA 1LESA 4V2WA 2VD7A 1SG3A 2YFZA 1Z7S1 1GNZA 5FYYA 2CTVA 2MHFA 1C5HA 4LOTA 1B09A 2V09A 4N9IA 1PMHX 1Y7BA 5F2SA 2UURA 4DQAA 2ZS6B 2WZR1 3TEXA 4KU7A 2Y6HA 4OQ9A 4XUOA 1D2SA 3JQXA 2XPJA 2G9GA 3S5QA 2ZGSA 1RUG1 1UD1A 3AM2A 4A3XA 1ZRFA 3H42B 3LA2A 3IPVA 3OCPA 2HWB2 4FTSA 5C3SA 3Q8AA 4CU9A 1VB2A 4XIOA 4MUVA 1RUC1 4AFDA 1JUIA 1NT0A 5F9TA 1D2QA 4CEYA 4YGEA 1O59A 1QH7A 1SQ4A 1VAKA 3GALA 3OJBA 1MS1A 5LBFA 4CU8A 3VKMA 5LA0A 1Q43A 5GALA 2W0XA 3RFRA 5K7PA 2VZTA 3SH4A 4IV3C 2V4VA 4A44A 4AQSA 1AVBA 2BU9A 5JAXA 5CNAA 4NO4A 3IKWA 4Y1UA 5FOJB 4IE6A 3T30A 1EV12 1XE7A 4P08A 2YPDA 2UWBA 5IT6A 3C8XA 4LK6A 1RHI1 2V5YA 4XJWA 3V65A 2Y8KA 3TNQA 2B9VA 2DU0A 2RS53 3LEGA 1QXJA 4Z82A 4NWVA 4N53B 2A73B 5HV0A 1TMF3 3AMMA 3OGRA 4J1WA 1LAJA 3KHCA 2Q1FA 2SBAA 2PHXA 3BCWA 4QPWA 3ELNA 1W6MB 3LA7A 1IOAA 5L19A 4XDQA 4NHLA 1LHOA 1R1A3 2HWE1 4JDMA 5AC91 4XJZA 1PO13 2GN7A 2RJLA 2WFF3 3RPQA 4P5HA 3M3EA 4BPZA 5L9VA 1NXMA 3NV2A 3KCXA 3VV1A 3VBSA 3V0AB 1CAUA 3FBYA 1Y3TA 3AMHA 5GLVA 4O9EA 2VVDA 3PDQA 4LO7A 4XF3A 2AEZA 5GLTA 3THDA 4BQ4A 3OD4A 2OS2A 1TME3 1H2MA 1XSRA 3GZEA 5J98B 5FUPA 3U4SA 2Y0OA 4D0QA 3ZYGA 1W9SA 5KXBA 1VAVA 2A3WA 2JECA 2BNNA 1BMV1 1JODA 3WDWA 4YZ2A 1MS8A 4LHNA 5G05L 1DQ2A 1DYKA 1D7PM 1QJX1 1H2LA 2CAVA 3J7MA 3HT2A 3GZAA 4M3CE 3ACFA 2WZ8A 4JTNA 2KA3A 3F95A 4QM8A 1GWMA 1L7QA 5FPZA 1UY3A 1V9U2 3N9NA 4XILA 5GLWA 3FZ3A 1IQAA 5LEKA 3AP7A 2WL1A 4QHZA 3BU0A 1HRV2 5BNOB 4XXPA 3ZFGC 3LGRA 4XUTA 1MEC1 1RUOA 4NPMA 4C0HA 2JDHA 2YXSA 2FCTA 3B93A 2YZ4A 3KQ4B 4LOSA 4RHV1 3WF2A 4A4AA 4BCUA 5L7OC 2GP5A 1OD3A 1C8M1 3K51A 4XZPA 4YGBA 3MIGA 4GWMA 2CGPA 2JE9A 1O3TA 5J3UA 1UXXX 3HMYA 4MGIE 5HV4A 2WFPA 1Q8QA 1XBFA 4AEDB 4BJ0A 2JIGA 4ZPIA 1COV3 2WQ8A 4NE9A 4W6XA 2JDKA 4P9IA 3FJSA 1WUVA 2V72A 3F2ZA 3QCWA 1YQ8A 4OCTA 2ZHLA 3M1HA 5FYSA 2DVGA 1AR82 2NN8A 2WS92 1DZTA 5A7NA 1SLTA 1AX0A 5I93A 2VY0A 1J83A 4RQPC 2KXLA 4XMIA 2PLV3 3TYJA 5CU1A 5FPLA 5BPXA 1LU2A 5T5JA 1E5SA 3J9SA 1W9FA 4COUA 1MS9A 1OVPA 1V6MA 1X9PA 1R091 4UF0A 3IDEA 4COWA 3VZKA 5ABJC 4MVTA 3IB3A 1UZWA 3VDAA 3ZX7A 2R0FA 4LITA 2DVFA 2CDOA 5KHJA 3UK9A 4HZFA 4AEMA 3GXUA 5CYYA 4KWLA 1LHNA 4MADA 2ZGUA 2P3YA 2GMMA 4FFGA 4UFJA 4ZKTB 4HOOA 4AWDA 2JDPA 2VTXJ 4DZGA 1U12A 5KBFA 1OLMA 3IIAA 2QQOA 2J22A 4EN7B 2HKXA 3WP5A 2GDFA 4U2AA 4BMEA 2ZX0A 4OYUA 1OHFA 5FLJA 3LCPA 5F32A 3VKOA 1H8VA 5C5TA 2A6YA 2VOTA 4GB32 4IV3A 2JDNA 1D0GA 1NOVA 1HV0A 1T6BX 4LHKA 5FQ0B 2K9ZA 1EAH3 1DZQA 2A70A 2KR2A 1UF2C 3AZWA 1ZBA3 5FZFA 4RS5B 1CAWA 3ZYPA 2YGLA 1UU5A 2VAUA 4GMP1 3J7NA 3JCIA 3R6SA 3PJYA 1H1IA 3THTA 1PGL2 3MW2A 2WT1A 4XFHA 1UY2A 2CAUA 4A2UA 1JUHA 1AXZA 3Q8BA 2JG9A 3BKZA 1Z7S2 2A6VA 2G4IA 2JG9B 2WA4A 3PMSA 3WZ1A 1FT9A 2XB6C 5IK4A 5FXXA 4CDXC 1ZREA 1Y9QA 1TG7A 2CWMA 4L0PA 3TAYA 3W20A 2G1MA 5FV3A 3VL9A 3ZN6B 2PHFA 3AKPA 2VE1A 1RUG2 5CA6A 3O1UA 4CCCA 1X50A 1AJKA 4FVVA 5FUIA 4GULA 2ET7A 1RUC2 2C0ZA 2OIIA 3PTRB 4RFT0 5FPUA 1C1LA 3I59A 1QOOA 3I59B 5E16A 5IK5A 4JGZB 1WKYA
chains in the Genus database with same CATH topology
4FPCA 3N7KA 4A7KA 5ACA2 2XBO1 2HWD1 4ONUA 1NA1B 1HLCA 4WBBA 1MQTB 1MR5A 3AXDA 2E7QA 3M4FA 3LSDA 2QUOA 1JYIA 2B7YA 4HMZA 1VBE1 4K20A 4IESA 1W0PA 3RNSA 1ASJ1 3NSTA 4Q0UA 3ZFGA 1PIV2 4ES9A 1NY71 3NVCA 4QQLA 4GALA 5L7OA 3UL2A 4JC1A 1LGCA 1UKRA 3ZYIB 4OUSA 4Y22B 3BB6A 2GMEA 3IBMA 1ULDA 2UWCA 2HWE2 2I2SA 3ZFFC 4HBNA 3VBFC 1LULA 3O0WA 1LOAA 4FPHA 4FO9A 5IK8A 4HN0A 5H9QA 1RVF3 4X6RB 1B35C 1GICA 5C8CB 2EA7A 4B7EA 1AR61 3O14A 2WNUB 4Q4Y3 1ZX5A 4COZA 1OQ1A 3I2DA 2BVVA 3KS7A 1RJ8A 4WM8B 2F6BA 3VZOA 4L97A 1QJX2 1W6NB 1UCXA 1BEV3 3WUCA 1QJY1 1EP0A 2LTNA 2WNEA 2XHKA 4FAHA 1DF0A 1IGOA 5ABJA 2R072 2ZHNA 3DPRC 1SFNA 1IS3A 2DCYA 1FYUA 2YV8A 4K6BA 1BK1A 2HWC2 1WCSA 2O8OA 2UY9A 1MEC2 4QD2A 4WVWA 3CJIB 5L36A 1RMU3 1RUI1 2Z5WA 4RHV2 2PQQA 1LENA 3WXPA 3AP6A 3WW4A 1XU1A 1C8M2 2HEWF 3VBHA 1FATA 3NAPC 3W59A 2VG9A 4PIXA 1LGNA 3VHOA 2ZCWA 1AF9A 1VALA 1KD7A 5JZGA 2O1QA 2OZ6A 1HRI1 1C57A 2ZPXA 4YVWC 2R0HA 4QX5A 2WA3A 3O7OA 3JQWA 2RR13 4Q4X1 4R4ZA 4LBQA 4LBQB 3AZYA 3OBTA 2WINB 4RD7A 4OVEA 4FP2A 3CLPA 1MZ5A 4FPLA 3GYDA 4FPYA 5LK7B 4HVRA 1R092 2JX9A 2IXHA 1O3RA 4HANA 2DCTA 2PHWA 4FPKA 1CESA 3FBMA 2VGDA 4E2SA 1W6OB 4YW5A 4IEOA 1FNZA 2OUJA 1DQ6A 1PVXA 1LHWA 2X5IC 4ASLA 4KGQA 4CDXA 2ZGOA 1FMD1 5AVPA 5KWRA 4M3CA 1H9PA 3BOPA 1H2KA 1C8NA 1ZVFA 2GNTA 2ZOEB 5GZGA 4XQ4A 1VB4A 1XXNA 4I3GA 4MXWB 3ZFEC 1LTEA 2QNKA 4L11A 1H8TB 1WCKA 1PNGA 5FMOS 3WNXA 1Y43B 2MNGA 4CDUB 1VLNA 3ZXKA 1BBT2 2ILMA 3FFQA 1VBB1 3JD72 4H14A 3OYWB 1QDOA 4QPGB 1M06G 4E4DX 5JSRA 4DY3A 3DL3A 3J8F2 5LK5A 3LOIA 4CRQA 5GLUA 4YFWA 3AKQA 4MZUA 5JMCA 1BQPA 3E5QA 1LJ7A 3ZMNA 3MEPA 4XPVA 4CEWC 1OOPB 2ET1A 4S2GA 4HFSA 3BIWE 3ZFFA 1RUE2 1I3HA 5EXOA 3GF6A 3ROUA 4FQZA 4A7YA 4MGYE 4GKYA 3MPBA 2ZMNA 3JBG3 2O0OA 2DCJA 2Z2SB 3GBWA 3SHRA 2NLRA 1IPKA 1VBD1 2LM3A 1HV1A 3MLJA 1ENSA 4QHBA 1VRH3 3E6DA 5JLVA 1SCRA 3KB5A 1RUJ3 1AL0G 4FOQA 4BLIA 4E27A 4LUKA 3MIBA 2ZGQA 1VAMA 4KBBA 1UL9A 2Z42A 1UPIA 4URTA 1QHDA 4AHXA 1TNRA 2R063 1ZBE1 1ZZ6A 2BEOA 2XBO2 2DVDA 2HWD2 2GNBA 2DVAA 4RA0A 1N47A 5CADA 5BNNC 1GSLA 3DPRA 1VBE2 2VVFA 2XJPA 4YVSA 1ZZ9A 3B01A 1NY72 4YVSB 4FT8A 5GZFA 2AREA 1QDCA 2HWB3 1ZZCA 2H6BA 3V0BB 2IXCA 2VECA 4WVVA 3VZMA 3VZJA 1LODA 4CP0A 4EN0A 1WD3A 5BNPC 1VBC2 1CJPA 3E5XA 1QXPA 5C8WA 4B4PA 4FBFA 4YVWA 4HSJA 3AXEA 1CAXA 4IETA 4LBOA 1EV13 1X82A 1MS3A 4QXKA 4B8EA 1O5LA 2OYZA 4EWDA 2WLPA 4HPKB 4LE3A 2QVSB 3USUB 5HCFA 2B42B 1N1TA 1OA4A 2ZGTA 3FUOA 1POV3 4GQ7A 1QJY2 2XVKA 1NQDA 2OUHA 2BWAA 4EWEA 4Q4V1 2KM2A 5FO9B 1NXD1 2R042 4EN6B 5C4WB 1A6CA 3QLQA 3MIHA 3OTFA 1RUI2 1HXS1 4ATEA 4KWKA 2TNFA 4P9LA 4JRAA 5DG2A 1U5IA 4ORFA 4LLOA 2ZX3A 3POSA 1X36A 3VBOB 2JG8B 3RYPA 3EJKA 4XFCA 5HXVA 4Y1YA 1HRI2 2FZ2A 5D8AB 4M01A 2GH8A 3FE5A 4GXLA 5FDBA 3ZXLA 4XJ8A 1FX5A 3ZSLA 1V9U3 2RS11 5JOWA 3PVEA 1RUH1 1N3PA 1S2KA 4M00A 5SV8A 1RITA 4QU2A 3HWJA 3AZVA 5B2GB 2A75A 2WWSA 4AVTA 4N53C 2BYVE 1S0DA 3OY8B 4F7ZA 1HQWA 3AYDA 5JIUA 4OULA 4XJ9A 4E2GA 1ULCA 4WVMB 2RE9A 1CR7A 1NYWA 4RGAA 5DUWA 3UKTA 4Q26A 4CDWB 1G9AA 5TSWA 1PK6B 1PGW2 1PMIA 4CEWA 1VJ2A 1UAIA 3TNPB 1YHFA 1AR83 2ZKNA 1Q8SA 4L8QA 1H2NA 3WR0A 2RJKA 2XJRA 2VXRA 3D0SA 5EJ3A 4ASMB 4JTOA 3ILFA 3VGIA 3ZXDA 2TEPA 4LTAA 3BTAA 5FLIA 1SACA 2ZHKA 1SCSA 2VPVA 2XUMA 2ZGMA 4TWTA 2P17A 5BV6A 4L92A 3AK0A 3N4MA 1YO8A 2SLIA 3IN9A 5BNOC 3LWCA 3MIFA 2PA7A 3USSA 2ZA9A 4NVPA 4QPYA 1KFXL 5BNNA 2QZ2A 3BOWA 4NN0A 5DG1A 2BNMA 4LT5A 3LSEA 3R4UA 1CIWA 4FOVA 1FPN2 4AEDC 4EN8B 3D8CA 4AK3A 2PHRA 5BNPA 3FHIB 3EHKA 3ZSJA 2E6VA 5KC5A 1H0BA 2GALA 4Q4W1 4GB33 1HQNA 2IXKA 2O8QA 1VBD2 1Q3EA 4HL0A 3AYAA 4E9KA 1QWRA 2GZWA 4K7JA 1WCDJ 3TN92 3NL1A 1G9DA 1D0HA 2HWF1 4UW3A 4LBQD 1F5FA 5SV5A 1QQP1 2GC3A 4QPIB 1RC6A 1S1AA 1WLDA 1RUD1 1ZBE2 1OPMA 1IS6A 2DFBA 4OLLA 1Z7S3 1CX4A 1J1TA 4OHYA 3LKJA 1SLCA 3UJOA 1DIWA 3Q9OA 1ZA4A 1SEFA 3GZTB 3JUUA 5J48A 5J36A 3CU7A 4ZU7A 4P9WA 2RS31 1TE1B 1KS4A 1ND3B 1QJU1 4N9HA 3SMHA 1MZEA 1NLSA 1RUC3 2QKDA 2W39A 1LOEA 3JB8A 3ATGA 1V6OA 1ENXA 2D6KA 2QCSB 3ZXJA 1DGWX 1W6PB 1PO22 5ACA3 5DDJ2 4H7LA 1ALYA 4XF0A 2PYTA 2OVUA 2QDNA 4D7SA 1GYKA 4RS5C 4P9JA 4IEWA 1GZ9A 2GC2A 5H9RA 1PIV3 3AFGA 1ZRDA 4N53A 1OI6A 1HW5A 5FO8B 3UV9A 5AVAA 4XETA 1G8WA 2JG9C 1W6MA 2YUEA 1AYN2 4IEQA 3ASIA 1REFA 4JRLA 4Q4V2 4LE4A 5LRRA 3ZSEA 5HBAA 1EYBA 1HXS2 2ZGRA 3V0AA 4AI2A 2VUAA 2C5DA 1TNFA 1UN1A 2Z69A 1C5IA 1FOD2 3PVOA 2P2KA 3PVNA 3ZPYA 4BLJA 2OA2A 2RS51 4BIFA 4JGZC 4D3WA 1WMFA 1CJDA 3OBRA 1X7NA 3ZXFA 4BHPA 1E57A 3HD8B 1NE6A 1URXA 2ZZJA 1IS4A 3WP6A 1NG0A 1V00A 5KXCA 1NA1C 2R073 2RS12 4LNVA 1R1A1 1MQTC 1OSGA 3VDDB 1PO11 2WFF1 2VOXA 3WDYA 1ZM1A 3IDCB 3JB4C 2VW0A 1FAYA 4IL7A 5T3NA 3CO2A 4JGYA 2HWC3 3HIFA 1AL21 1MEC3 4JGYB 2FQPA 4CTEA 5BNOA 3ZXAC 3D5OA 5A33B 2CGNA 5FQ0B 1C8M3 1OA2A 2FBEA 2MEV2 4N7UA 2UY8A 5CIRA 1CPMA 3WHUA 4DRVA 4WM7B 1YIFA 3BPZA 4LR4A 1OFSA 2VQ0A 2JEMA 4K8FA 3ZO0B 5KHIA 4KH9A 3VHPA 4AEDA 1WW5A 2IWGB 1JYCA 2W52A 4NHMA 3KD4A 5C8CC 3KLSA 2ZZQA 3QH6A 3POYA 4I09A 5FO7B 3H1WA 2WNUC 5FCCA 3WDTA 5KXEA 5KC6A 2EXJA 4ZU5A 1JTZX 1XNCA 1VBA1 5FTTC 2R1DA 3MPPG 1H1MA 4TYSA 1R093 3M3QA 4UBGA 1ZZ8A 3GZUC 2LUWA 3WG4A 4FOYA 3ZDSA 3RMXA 2C9AA 3AKRA 5GM0A 2Z79A 1NE4A 2DV9A 4I01A 3QH7A 3MIDA 3VBUB 5FMOL 1J1LA 1AR92 3DKWA 1COV1 2UYAA 3OD0A 1PGSA 5CG8A 3TRSB 3LOBA 1XYNA 3CJIC 5T52A 2PELA 4OHXA 2E7AA 3AP5A 4PIYA 1NCRB 2X8KA 5KHHA 1WA4A 4HSLA 1D4M3 1OKQA 1NLRA 1J3QA 3VBHC 2DCZA 5HCBA 1O5UA 1L3JA 2PLV1 3HAGA 4UW6A 2BGCA 1N1VA 4Y4YA 5JZGC 1IZ3A 4RGGA 2IXJA 2ATFA 3SITA 4IERA 3DN7A 2E9QA 4AHWA 1LEDA 3WD5A 2NQYA 1BBT3 2PAEA 3MLKA 2XL9A 3JD73 3QBQA 2ZAAA 1YIPA 2NYYA 4RS5A 2PN5A 2A6XA 4XYXA 2D44A 2NP0A 4BQ1A 1JOJA 4YG6A 2HWF2 5T5OA 4KU8A 3A0NA 3J8F3 5JR7B 5JI7A 1RUD2 5GKAC 4XIKA 2P3IA 3KT1A 3QOPA 1C4RA 1SLLA 5DXDA 2GNDA 1Q8PA 2JENA 3P3PA 3VN4A 2ZX1A 1RUE3 4H55A 4LHLA 5GZCA 3W58A 2WZR2 4KG8A 2R30A 4E2QA 4AG4A 3ZN6A 3FLTA 1AHSA 2EXKA 1YRZA 3AYEA 1EAH1 3R4DB 1ZBA1 2H0BA 1RIRA 1ZZ7A 4Q1RA 4DPNA 1H8TC 1S2BA 1IKQA 4BIOA 2XJVA 4CDQA 4CDQB 5BXXA 4JGZA 5FAXA 3WLUA 2P37A 4CDUC 2XBO3 1RUF1 2HWD3 1YLLA 5DZGA 1LHVA 5T5LA 2GU9A 1NA1A 3H50A 4XQDA 2WT2A 1QJZA 1MQTA 4QMAA 1VBE3 4QPGC 1RHI2 4FQ4A 3ZIWA 5E89A 4AI1A 4KQ7A 3WW3A 4XF4A 3UJQA 2DTYA 5FFOC 1XNDA 4UXAA 4Y22A 2D6NA 3N7MA 5JOZA 1OOPC 1VBC3 2IFWA 2WSUA 4AFAA 5AC92 1G9FA 3GHNA 2IXLA 3VBRA 1XYOA 2WZPP 3VBRB 4B4RA 3NO8A 1LECA 3NV1A 4XEZA 5I0SA 5C8CA 1YCIA 2Y38A 2R6QA 3EBRA 4D69A 3M7AA 2WNUA 5T5PA 3RMYA 1OFNA 2RS52 1DQ5A 1F8VA 5EYYA 4ISRA 5K9YA 1BMV2 4WM8A 4AXOA 2OPKA 3NKGA 1ZYBA 4AFBA 3AZXA 2HJIA 1QJY3 1W6NA 3O0XA 4AVSA 4LBMA 1S0JA 2P3KA 5HCAA 4EV0A 4N43B 4YG0A 1KRIA 3WDVA 4IEXA 4I2OA 2E63A 2R043 1AL22 2QZ3A 4Z1VA 1UIKA 1RUI3 4YVSC 3T1LA 4AEJA 4YSFA 3CJIA 3ES1A 5F5QA 1Q56A 4AYUA 4GIQA 3N3HA 4PLNA 1H4GA 4RQPB 4RSUA 4JQRA 4Q4Y1 1F9KA 2TUNA 2ZHMA 2A3YA 2RM21 5J7MA 4LO4B 5F6LB 5BYNA 1HRI3 2XGXA 1WBLA 4Q2FA 5I8TA 3N35A 5JWPA 5BUVA 4EROA 4Y5Z0 1AR71 2EAAA 4X8PA 2VQAA 4OUMA 3BODA 1YUDA 2Q30A 2DFCA 1G9BA 3P3NA 1VBA2 1F5JA 1RMU1 4K9SA 3PLQA 3WVJA 1NQJA 4HK9A 1POV0 1J3PA 2XWJB 2PHUA 3ZYJB 4ES8A 4AEKA 1COV2 3AZZA 2NMNA 5C6CA 1W6OA 4X6QB 4AVVA 5CFDB 1IHMA 2RR11 1MACA 3B69A 3J4UH 1R081 2A6ZA 1CPNA 3VBOC 5I0RA 4R9BA 2JG8C 1SFYA 2D97A 3B00A 3ALQA 3ES4A 2E7TA 5CVRA 1ND2B 4BWOA 4MXWA 5D8AC 2BNOA 1KS5A 1H8TA 1I9RA 1K5MB 4X8NA 4AHZA 2CNAA 3PNAA 2ZMKA 1W6QA 2DU1A 1W6QB 1S0FA 4W6YA 1A78A 2FHRA 4CDUA 4H3WA 4META 2ZACA 1GNHA 3WP4A 2ENRA 5JSPA 1YI9A 3B7MA 1X33A 1SBFA 3OYWA 2VNOA 4QPGA 4D7YA 2D7FA 1JN2P 4GH4B 1BCXA 1SDWA 4DY5A 4LA3A 2XH6A 4MXVA 4OHWA 4PLOA 1FPN3 1GKBA 2IZWA 4CDWC 5FOBB 2JE7A 1U5XA 1PK6C 4IEVA 3V56A 5LRSA 2ZGKA 2B5HA 2H0VA 5FRAA 1OOPA 4NOTA 1J3RA 4PCRA 5JCTA 1I1EA 1LB2A 1LOCA 1XRUA 4LO5B 1ZBA2 1FV3A 2BW8A 4FOWA 4P9GA 2EAKA 5F6KA 3AX4A 3TN93 1OD5A 1PHMA 2VOWA 1MZ6A 4BMBA 3BALA 3QD6A 4LULA 3V64A 1ZBE3 2IXIA 4G9SB 1RUF2 3KCCA 2YHJA 3U10A 1G6NA 3WQ7A 2NPIA 4CZSA 2A5ZA 3WY6A 1UW8A 4HLTA 4PDWB 2D98A 1SBDA 2WJSA 3JU9A 1UX6A 2B39A 3JBG1 3MF6A 4JV4A 1ASJ2 5BY5A 1JXNA 2CYFA 1VRH1 5C9AB 3ZSMA 2D6OX 3U4XA 3V0BA 1RUJ1 3RJ2X 1A8DA 1FV2A 3AMPA 3WCSA 2D3SA 4IV1B 2R061 1PO23 2DF7A 2XJSA 3C3VA 3H3ZA 4P14A 5DDJ3 3T2TA 5EZWA 4AF9A 4IXLA 2FZ1A 3O12A 5AFEA 5F1RA 4D94A 3ZN5A 2R32A 1BYHA 1MZFA 4FSJA 4M0NA 2DCKA 1AR62 1OLRA 4YM2A 4IQPA 3X29B 3KT4A 2R1BA 4HPKA 3U0ZA 3SLIA 3USUA 2RMU1 2DTWA 4LEJA 4AE2A 4GWNA 4QPIC 4ZXKA 1RTVA 2WKKA 4RR3A 4XJAA 4YW1A 3SH5A 4RR3B 1RL3A 4FAGA 2DYCA 1AYN3 3INAA 4Q4V3 4FPEA 4L9BA 3RSJA 3KSCA 2WNVB 3AFKA 3FC0A 5C4WA 4AI0A 1KXGA 1DGRN 1HXS3 1LKNA 1MS5A 3B3QE 4K3UA 2DUOA 2EIGA 2YDEA 1ND3C 1FOD3 4DNYA 1DQ4A 1CAVB 4IEZA 2C1FA 5DUUA 1CQ9A 2RM22 3VBOA 2JG8A 3B9IA 3NWKA 2JKBA 1POV1 3CL1A 4YFZA 3AP4A 2V73A 4D7TA 1WW4A 3WQ0A 5D8AA 2GC1A 3ACLA 1AR72 4UW4A 2RS13 4HKOA 4WZFA 4Q4X2 3MFAA 5FREA 4YW4A 5L73A 2I07B 1KDKA 3M3CA 4XFFA 1XNKA 2ZGNA 3NJZA 2EXIA 3VKNA 1PVC1 2WT0A 1HRV3 2AZ5A 3G6JB 4QGLA 4QM9A 1DQ1A 2D3PA 2QDRA 2MEV3 3OY8A 1RUNA 1BXHA 4OZXA 2XVLA 2ZGLA 4WVMA 1EPZA 4QGMA 3IDBB 5IK7A 4KNCA 1WW6A 4Y20B 1KITA 4HVQA 4CDWA 2ZKLA 1PK6A 1NCQA 2AUYA 3AKSA 1NCQB 4F3JA 2XKPA 1R082 3H8UA 4C0BA 1FMD2 5JIAA 2WSVA 2WS93 2WC2A 2EALA 4PBOA 5A32A 1S0GA 5A32B 2YC0A 1XU2A 3H0OA 2JD4A 4Y1XA 5CFCB 1O4YA 5CB7A 2CL2A 1XQNA 5LEJA 5JOXA 1S0IA 3E6CC 4I30A 4AGGA 4XMAA 1G7YA 3VDDC 3L2HA 3IT8A 2JXAA 1AR93 1GR3A 4IEPA 4MGKE 4W65A 2PAMA 4KL1A 4JGYC 4BA6A 1LRHA 1VBB2 2BTVC 4MGZE 1M4WA 4WM7C 1QU0A 1QNYA 3WV6A 3WHTA 2QFEA 4WZCA 1AZDA 2XJQA 1YI7A 1D4VB 4XXAA 1YFYA 4FXKB 4YG3A 2ZX4A 2CGOA 3PHMA 2QJVA 3H9AA 1YYNA 1Z78A 2PAKA 1G9CA 5K0UB 4EJRA 3RQ0A 4C91A 1UZZA 1AXYA 2VUJA 3CF6E 2ZAHA 1J59A 3VHNA 5I91A 3WX5A 3FLPA 3ZSKA 3ILNA 2HWF3 4HKLA 4K1YA 2BUKA 5HI0A 1RUD3 3GBGA 2A7AA 3VBUC 2Y0IA 4PIZA 3WT3A 4QPIA 3MLLA 2N7GA 2D6PA 5J96B 2YY1A 2D5HA 4COVA 1A3KA 2ARXA 2ZBJA 1NCRC 4O9GA 2WZR3 4DRRA 3JBG2 4GB31 4EN9B 4CYDA 1QF3A 1Q8VA 1RUG3 1MVEA 1LOFA 4XW3A 1IS5A 1ND3A 5FPXA 2B8MA 1V6NA 2BFUS 2E51A 2QQPA 2X53S 2Y26A 4AQ2A 1G86A 4Y24A 3FMGA 3ILRA 1OQDA 3J26N 2R062 5D1IA 1H30A 4XFAA 1CGPA 1W6PA 4DMIA 1AYM1 2XVGA 1FI2A 2DUQA 2YPJA 4OI2A 3ZXEA 1RHI3 4A7ZA 2OW4A 4Q27A 4Z8BA 2RMU2 5I8YA 1H4HA 3IPVB 4GMP0 1WLWA 4LBJA 3ZXGA 1O3SA 1W39A 3JZVA 4CEYB 4U36A 1LR5A 4Q0VA 4ISQA 4OHVA 2HWE3 4S2FA 2YYOA 5AC93 1BVVA 3O5SA 4BM8A 5ACA1 3VKFC 3MICA 2EF6A 4HK8A 2A71A 3WW2A 3WUDA 4I0AA 5DUVA 3NKTA 4ITCA 5FBZA 5C33A 2ZGPA 2XWBB 3W9AA 3GBFA 4I0BA 1OPOA 1S55A 2ZJCA 3FUQA 1PIV1 3VZNA 3VLBB 1AX1A 4FPGA 4CDQC 3ME2A 3TOJA 1W0OA 1TMF1 1RINA 4BOWA 1QJX3 4E4ZA 1XE8A 4HT1T 2BQPA 1T6GC 4OFGA 2VULA 4HN1A 3VDDA 1RUH2 3ST7A 1AL23 1PVC2 3VBSB 3DGTA 1CAUB 4L2NA 1AXKA 1C28A 3AJYA 1GFF2 2GSYA 3O0VA 4B29A 3PMEA 4RHV3 4XHBA 5A33A 1GQHA 5FQ0A 2Q0AA 1TME1 1W2UA 3UKVA 4WM7A 4PF5A 1DU3D 4COYA 3WQ1A 4XJUA 3VBRC 4TSVA 2ETEA 3NV3A 4M3CF 2R071 4UW5A 1YFUA 4LO6B 4QQHA 2G9FA 3S0MA 1KQRA 1SLIA 2VNGA 3AB0A 2HWC1 5GLZA 1VBA3 3KQRA 5IUQA 4WM8C 1WGPA 1OLQA 1SBEA 2XLGA 4C1WA 2ZX2A 1YXWA 1LGBA 2ZABA 3CEWA 4N43C 3VBUA 3GNEA 1WLCA 4IEUA 4Y26A 4TZDA 2XJTA 4LLFA 3AKTA 3GHMA 3RJRA 1NCRA 4AQTA 1QOTA 3S7IA 5I8SA 2XG3A 4GKXA 2TBVA 1FNYA 4ZU4A 4BZ4A 5CBLA 2AYHA 1BZWA 1UKGA 3MZHA 1ZZBA 3M3IA 1O7FA 2YGMA 5KXDA 1VP6A 5EYXA 3K48A 4OHZA 3L2YA 1QNWA 3I7DA 3E6BA 1DZRA 1N1SA 3RI8A 5DUXA 4LBKA 3E97A 3THPA 2YMZA 3PJQA 2B9UA 4Q4W2 2BWCA 3RDIA 4F83A 3LA3A 3MFCA 3WW1A 4NR1A 2PHDA 1HIXA 3OGGA 1D4M1 1GQGA 4GMP3 2NMOA 3FWEA 1QQP2 4R9CA 2XLFA 3DUIA 2VNRA 5CFDC 4R52A 1C1FA 3KZ4C 2H6CA 4XFIA 4FTEA 1A8MA 3PTYA 4IV3B 1BBT1 2WQZC 1AX2A 4MYEA 2RS32 3SCHA 3N7JA 3JD71 1CAWB 1QJU2 1ND2C 2HEYF 4OI1A 1PZ9A 4HKWA 4AVBA 1N3OA 2ES3A 1U0AA 1K5MC 2EVXA 1I5ZA 3J8F1 3RZZA 3B9CA 3MF9A 1RUF3 4F8AA 1AYM2 2RHPA 5I0UA 4MSVA 3KGZA 3VUOA 1UZYA 1V6KA 3QACA 3H7JA 2CV6A 4FP3A 1RUE1 2OZJA 1LHUA 1S0BA 4GH4C 2XL7A 1QMJA 1ASJ3 2UWAA 4FCAA 4DB5A 1S0EA 1XYPA 3CJXA 4L99A 2ARBA 2HYKA 3IM0A 4OI4A 1O91A 3FFZA 5JSOA 4MX3A 4YZ3A 2VMGA 2XKOA 1IKPA 3DV8A 4Q1PA 5JPMB 1TQ5A 1X8MA 4XBLA 1AR63 5KHKA 1BKZA 3A0KA 3MIEA 4KGGA 2NM1A 1O4ZA 4HVOA 5EV7A 2A3XA 3ZFGB 4I02A 1HDKA 3TBDA 3WCRA 1TMF2 5L7OB 1WMDA 1YWKA 4Q0SA 4AVCA 1UU6A 1DYPA 1H9WA 3VL8A 3WDXA 5H9PA 5JVVA 1VBC1 3TB0A 4PDWC 1S0CA 4N43A 1R1A2 1LU1A 4TLFA 1PO12 2WFF2 2GN3A 3WG1A 4YRDA 4R4XA 1RVF1 4SLIA 3OGJA 1MVQA 3SH3A 1TME2 5C9AC 2IFRA 4KWJA 1REEA 2Q4SA 4RQPA 3M70A 4PJYA 3AYCA 5E88A 2RM23 3AJZA 4W6WA 1LOBA 4YZ4A 4GA9A 3R0RA 4G4FA 1V70A 2F4PA 2D43A 3HN1A 4IV1C 4LO8A 2DVBA 2VU9A 3G7DA 1F31A 1RGSA 1C3HA 4FPJA 2VH9A 1BEV1 3EXUA 1ONAA 5ABJB 1AR73 4SBVA 1ZRCA 1I6XA 4LBNA 3WP3A 1DGRA 4Q4X3 2GNMA 4PLMA 1ULFA 3E5UA 1WD4A 4DOUA 5BNQA 1LOGA 2R041 4LUMA 5EWSA 4YARA 3D0JA 1BJQA 1MS0A 4XBNA 4E4SA 3VBHB 1QOSA 3D4KA 4RR3C 2YROA 1LEMA 3ZMOA 4XQWA 2WLQA 3RYRA 1J58A 5JZGB 2WNVC 1CD3G 2ZTNA 1DHKB 5C4WC 5H9SA 3D6EA 5CFDA 4JVAA 3RS6A 1WMEA 2B46X 4Q8LA 3N7LA 1R083 4B3NA 1FMD3 4MLOA 5DZEA 4AQ6A 1XNBA 3ETQA 1OMIA 2D40A 4DS0A 2PLV2 3UKNA 1KDMA 4P9YA 1ND2A 4Y1ZA 1BVP1 3IWZA 3SCFA 1YFWA 2CY6A 1K5MA 1QY4A 5FLHA 1QH6A 3KM5A 5E1RA 1KJRA 2GH2A 1DFQA 4UBHA 4AVAA 2I74A 2JICA 2VW1A 1PGW1 1DG6A 1U5YA 4XBQA 2BBVA 1VBB3 4CDXB 5KHJA 3ZYRA 3WG2A 1KJLA 1D4M2 4S2DA 2P34A 3I54A 2D93A 5GZEA 4M3CB 5GZDA 2UU8A 5T50A 4GH4A 3FLRA 2XJUA 4AGVA 2CWSA 4YZ1A 1ULGA 4JDOA 2PHLA 3MDPA 4Q29A 3AMQA 3SNMA 5JOYA 3VHRA 1NCQC 2Q1MA 5GJ6A 2MPFA 3SISA 2GC0A 1JW6A 2R49A 1ENQA 5J09A 4LBLA 1TEIA 4YYOA 1YNAA 4XFBA 4QQOA 5JPNB 1GLHA 4AW7A 4B7KA 1Q5OA 1VBD3 1EAH2 1DGWA 2GAUA 1VR3A 3A4UA 4CP2A 5CFCC 1PNFA 2JDZA 2BFUL 2FMYA 3HR9A 1V6LA 4YGDA 1HKDA 1UU4A 2BVBA 1DLLA 2D6MA 3U07A 1FPN1 1CN1A 4CP1A 4QQ2A 4XTPA 1HQLA 3KCYA 1JH5A 3DF0A 3CNAA 1WW7A 1ZRRA 4PBPA 2PTMA 3HT1A 4XOGA 4PDWA 3M3OA 3VBFA 3ZFFB 2E53A 3VBFB 4Q8KA 4XTMA 2Q5TA 4K1ZA 1QGLA 1YJLA 4DXZA 4YM3A 4H7MA 1B35A 4MV2A 1B35B 2EXHA 2AGSA 5C9AA 1LCLA 2W08A 3TN91 3MI8A 1V6IA 1AUYA 2UYBA 4YM1A 1ULEA 3ECQA 4MH0E 3B5LB 4JDNA 3LB9A 1OA3A 4QQPA 4Q0PA 5K0UC 4Z92B 1N1YA 3HQXA 3S6PA 1N3QA 4IV1A 4EWAA 3RYKA 2NZ9A 4Z2WA 3H1MA 1SMVA 3DPRB