4B4RA

Crystal structure of the lectin domain of f18 fimbrial adhesin fedf in complex with blood group b type 1 hexasaccharide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
b'SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F18 FIMBRIAL ADHESIN AC
publication title Structural Insight in Histo-Blood Group Binding by the F18 Fimbrial Adhesin Fedf.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Cell adhesion
total genus 31
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b4rA00
4B4PA 4BWOA 4W6XA 4W6YA 4B4QA 4W6WA 4B4RA
chains in the Genus database with same CATH superfamily
2C9KA 3ZO0B 2UY9A 3ZSMA 5HXVA 3NNMA 4QU2A 2P3IA 2X5IB 3TN92 1H1MA 2MEV3 5JZGC 3CJXA 1VMFA 1LESA 3I3BA 3ROUA 3POFA 4RQPC 2BPA2 1HJFA 2Y6GA 3M70A 4Y22A 3ORJA 4H55A 1JOPA 4CUGA 4GJZA 5FZIA 1BLZA 1QGLA 1FPN3 2FHRA 1REEA 2NMNA 4YM0A 3WV6A 4FI9A 2GZWA 3KHCA 3M3IA 2ZHMA 2J1UA 3VD5A 4MGIE 1RXFA 3E5QA 4KGGA 4UW6A 5F5IA 4AK3A 4DB5A 4XETA 3GALA 1A8MA 4LBNA 2VUCA 4AFDA 3NWKA 1XE0A 1MQTB 3W59A 2W87A 1MACA 4Q0VA 3ZMOA 2VMGA 2RDNA 1AR82 4MOAA 5BXXA 1Q8OA 2A6YA 2GNTA 2ZA9A 4OI1A 3ZFFB 4PIXA 3VBRC 2F6BA 3S0MA 1YEWA 3PMSA 2AR6A 4D8MA 1XU2A 5T5OA 3LPFA 4BIOA 2EA7A 1K45A 3AB0A 4FFIA 2E32A 2QQJA 1PO22 2RS33 3CNAA 1UKGA 1W8FA 4FP2A 2Y6LA 4NRQA 3U11A 3EQEA 4AVAA 2A3WA 5A6YA 1YIPA 3AXEA 4UFMA 3CQOA 5C4WC 3WQ1A 2BV4A 2P6HA 1IQAA 3PL0A 4JQTA 1OH4A 4UFHA 4WZCA 4C0HA 4CPBA 5JSRA 3BI3A 3LGRA 2CHHA 4NIGA 4JV4A 4LBQA 4RR3A 4AEDB 2PYTA 3R05A 4AQSA 3ST7A 1N3PA 1NXMA 3POGA 4ZU7A 4LIUA 1SHWB 5KWRA 1KJLA 4FPCA 5JPMB 5CADA 1YFWA 1EV11 3ECQA 2ENRA 2OA2A 5FPAA 3T1LA 2A1XA 3MLKA 3DXTA 2WYSA 1XBFA 2VNRA 2CY6A 2IFWA 1WKYA 2IXCA 3AYCA 2JG9C 1FMD1 3AZXA 3GZUC 2ZX4A 4QKNA 4W6YA 4QX0A 2YUEA 2IVIB 1SACA 3POSA 4Q4X1 3D3AA 4TZDA 2OX0A 4LK6A 5A33A 5IVBA 3VGIA 4XW3A 2F17A 5E6HA 4LBKA 5IVJA 4YZ2A 1RIRA 4MUVA 1RUD3 3AK0A 5A3TA 5AC91 1MEC1 4CP9B 1S0GA 1FT9A 2YG0A 3DECA 4AFAA 3AP5A 1IKQA 1I5ZA 2BWCA 1VB4A 1WCUA 1X9PA 2HJIA 3BTAA 4Q29A 4PBPA 1YNAA 4TWTA 3SEPA 4L92A 4D0QA 4AVSA 1IKPA 3RMXA 1CAWB 4OHXA 4ASLA 4PDWB 4YPJA 4DS0A 1JUIA 1ENXA 4P9LA 2XKOA 3LE0A 1XOYA 3WF2A 4TYSA 4TN7A 2HWC2 3WUDA 1AJKA 4EN7B 2IXIA 3VBUA 4LITA 4DUWA 4TLGA 4Q4W1 3VKMA 3VKOA 4EWDA 1UU4A 2O14A 3LEIA 1V6JA 1W9SA 1AL22 2UURA 4K8FA 3RI8A 2O8OA 1C8M3 4IE4A 2ZACA 5DAXA 3O1UA 1K5MB 4K3UA 2VZTA 4UW3A 5A7PA 4K1ZA 4HKOA 3K77A 4D94A 1HQLA 1OA3A 1OFSA 2C24A 3WNPA 5J09A 4JHTA 3VB9A 1E5IA 1MS3A 1OURA 3ZFEB 1BK1A 3ATGA 4IW3A 1BMV2 4KI5M 2D3PA 4DXZA 2R30A 5DZGA 1W8ZA 5T5LA 3OUHA 4HVOA 1TQ5A 2GN3A 5F37A 3ZXKA 4B4QA 5JI7A 1O8PA 1B35A 4P9GA 5F6LB 3BU7A 3DYPA 2ZMKA 1RUE2 2BP6A 5EP9A 3JCIA 3WZ1A 2JWPA 4I01A 3ZLIA 2R061 2BOJA 3G6JB 4NUBA 3KB5A 2KA3A 2ET1A 1YJKA 3OD0A 3OPTA 4QD2A 2Y38A 3ZFGA 2SLIA 5C3SA 3HBKA 1VBC1 4FPOB 4C90A 1AR71 1LR5A 1AYM2 2Z5WA 1IS6A 4UFJA 4QPIC 2ZGNA 3N7KA 3DUIA 3N7JA 1YYNA 3I2OA 2W1QA 1A34A 5CNAA 3N4MA 4WM8B 1GYKA 5FMBA 4KBZA 3R6SA 3ZN4A 4GD4A 5FY9A 2OZJA 3EO6A 1RUI2 3CKHA 3LDKA 2XWJB 1QY4A 1BBT3 2RMU1 1OT5A 2ILMA 3I3QA 4P00B 4Q4V3 3ALQA 2WWJA 4GB32 5A1FA 2OPKA 3J8F1 3RG0A 1PIV3 5ACA3 5JOXA 2C9AA 3AL5A 5C3PA 4PT6A 2ZGRA 3T1MA 3F95A 3WNXA 5F32A 2W3JA 5DAVA 1O6UA 2Q30A 1AR91 2Q1MA 5C8CA 3BTZA 2UYBA 4DUVA 3FBMA 3QOPA 1S0CA 3T08A 4I02A 3ZYFA 1WWYA 4GH4A 4CU7A 1ZZ6A 1R1A1 1XNCA 3DV8A 3ILNA 4CDQC 4QDRA 1RTVA 1PVC2 4CRQA 1ZZCA 4QX3A 4BDVB 1DGRA 3VHRA 1F2NA 4JCKA 2WS92 1BK0A 2NN8A 2OXBA 1RUF2 2YHJA 2Z2SB 1UL9A 2ZX1A 3ZDVA 5IFPA 5BNOA 1PK6A 3AMPA 4NRPA 4AI1A 2XJPA 4LTAA 4XXAA 2ZGTA 4D6RA 5CAZA 1OPMA 3E5XA 4LO8A 3KHBA 2W52A 1JOJA 1H2MA 4JGYC 4FVVA 1RHI3 3AX4A 1FV2A 1PGW2 3ENRA 1OKOA 2XJVA 3AKQA 4GKYA 5T50A 5IFTA 5FZDA 4GKXA 3MPBA 1OF3A 3H42B 3K75B 1DQ5A 1RMU3 1X50A 4FT8A 2VJXA 1H1IA 1O3SA 1VAKA 5FZBA 1GR3A 3CEWA 5BNPA 2JIGA 2Y6KA 5LASA 5CKNA 3VDDB 1OKQA 4DXTA 5JZGA 3HR9A 1K12A 1WUVA 2VECA 4XYXA 4W8JA 4RQPA 1V9U1 2ZABA 4QPGB 1F15A 1LOCA 2ZKNA 4ASMB 3MPPG 1LAJA 1CZTA 1IG3A 4IEPA 3LD8A 1WMXA 4I30A 1LENA 2QZ2A 1X8EA 4YM3A 3WF4A 2EAKA 3ILRA 5CISA 4XFHA 4CZSA 4OYUA 5LW9A 1KFUL 4ISQA 2P37A 3AFKA 1ZRFA 1DYPA 2A70A 4AGGA 1ODNA 2WWUA 5JMCA 3I3MA 4KU8A 1UYYA 1VBD1 1XNDA 1YXWA 3UL2A 3GCWA 5B4XA 3LEMA 4A4AA 1URXA 1UX6A 2VD7A 4XACA 5GJ6A 3ZPOA 4EE2A 4DFSA 3VBRA 2GH2A 3K3NA 3ELNA 5CG9A 2A3XA 1HRI1 4COWA 2JIJA 3UGFA 3ZPYA 4Z1VA 4NIHA 1LHVA 1JW6A 2Q1FA 5EIYB 2PHLA 4N7IA 1QQP1 5KHHA 1BZWA 1V6MA 4META 4AHYA 1PGL2 1I3HA 2BZDA 5A3NA 5C4WA 2EAAA 3L2HA 2YC4A 4OZXA 4QB2A 3HQUA 3I59B 1BYHA 1QJX3 1SG3A 2N7GA 4LMFA 4Y5Z0 5C33A 4LPLA 4Q4Y1 4J1WA 4FSJA 5C5TA 1HB1A 1VB2A 1EAH1 4IGPA 4P9XA 3RMYA 4RHV3 1HB4A 2G1MA 3N7MA 1TME1 4XDOA 2ARCA 5I0RA 3KM5A 3BUCA 2JE7A 3S30A 1ND2B 2D6MA 2VQAA 4XFBA 4YSFA 5LZ6A 4XQDA 4Q0PA 4N53C 1JZ6A 3WDYA 1T6BX 4GIQA 1OLRA 1R093 2HWF3 2PXJA 2ERFA 4NHKA 5G05L 1NE4A 2WT1A 4CCOA 1NT0A 1PO11 1RUJ1 1N1TA 1H8TC 4QX2A 1VMJA 4XF9A 2JG9A 1MZFA 3IKWA 1RITA 5HXMA 3HIFA 5FPZA 3OBAA 4IESA 4Y1UA 4Y26A 3IT8A 2WNVB 1O5UA 2JDPA 3N9OA 3WCRA 1HRV2 2YU1A 3JBG1 4XPVA 5L9VA 2QQPA 1AHSA 1O4YA 2VGDA 1LU2A 2ZTNA 4OFGA 3V0BA 2XKPA 4QT6A 5L7OC 3W58A 4U36A 4LHLA 4XAAA 5T5PA 1NZCA 3WXPA 3BTYA 3KV5A 2RG4A 1QJY2 2CAVA 3AL6A 3FBYA 4GWJA 1R082 3SH4A 5F39A 2Y34A 3ZKUA 1D4VB 3ZKYA 3DXUA 4P14A 1C1LA 1GUIA 4YFWA 4JDOA 1F31A 2ZEYA 4XHBA 4CA9A 2AYHA 4LULA 2R16A 1LGBA 1RJ7A 4BHPA 4PIYA 2UWBA 3D5OA 2DCTA 2D40A 4CCMA 2YPDA 5APAA 4OMCA 1VIWB 4A7KA 1C28A 4LOTA 2JDZA 2MEV2 3B9IA 4CDWA 3JB8A 3C7EA 3I2GA 1JBCA 3KCCA 2BVVA 2K46A 3N9PA 3KMHA 5GALA 1CAXA 2R49A 3GGLA 3NKTA 4YM1A 3R0RA 2WZR1 2DWRA 3NVCA 1CZSA 2VMFA 1ND3C 1FPN2 1N47A 2ADDA 3I8TA 4MLOA 1RVF2 4YVWC 1HIXA 5IK7A 1Q5OA 1C5IA 2QQOA 1YFXA 2AEZA 4FP3A 4RSUA 2DVDA 3ACIA 1OD3A 1AR61 1DIWA 5DAPA 4NR1A 3AYDA 3SH5A 5DG1A 5C71A 1UMHA 3O1VA 2W1UA 4YYOA 4XCBA 3A4UA 2GMEA 4Q1PA 2VCCA 4AYUA 4AI2A 1XU1A 4FOWA 4FPYA 5C8WA 3A0NA 4XQ4A 1CN1A 3LWCA 4H2AA 3IM0A 2RS32 5E88A 4DRVA 1HW5A 3JD71 5A7WB 2RM22 5A7NA 2WUHA 5T54A 1VAMA 3BB6A 3MFAA 4QPIA 1YQCA 2RS52 4HSLA 1TZOA 2RE9A 2A6VA 3HQRA 5T3NA 4Y4YA 1NAEA 5J7MA 2PLV1 4CDQB 1MZEA 1JYXA 2VBDA 4BZ4A 1OF4A 2W92A 1QJZA 1S0DA 4N90A 5I0SA 1ACCA 1E5SA 2LALA 3IPVB 4HANA 4NAMA 3VLBB 4ZZ5A 1W6QB 2G9GA 4I3PA 5LATA 4XJZA 1YCIA 4QKFA 3ZSJA 5IYYA 5JSOA 1RUH3 5ISLA 1OVSA 2JDMA 2YV8A 4NN0A 4JDMA 3V64A 3RZMA 1DG6A 1CZVA 1MS5A 4Q2FA 3RJRA 1JZ3A 4DEQA 3MLJA 3F2ZA 3VZOA 4HONA 4JGYB 3AMHA 3C8XA 2C6SA 4YWAA 3ZYGA 5FQ0B 1XNAA 5GLVA 2CU5A 1AYN3 3OJBA 4OI2A 4RS5C 4Q0QA 3TNPB 1WBLA 3VN4A 2LUWA 1W05A 4EN6B 1YRZA 5EYXA 1GNZA 1JHJA 2VCAA 4JQRA 2X10A 2XXZA 4CDUC 4EROA 1EV13 2X5IC 1W8OA 4R52A 3P3PA 3U4SA 4QX1A 4XJAA 4EYUA 1W06A 3I54A 1HXS1 1NYWA 2R6QA 3OPWA 4JTOA 1RUG2 3VV1A 3C7GA 2OPWA 3PU8A 3AP6A 1EUUA 3MF6A 1FMD3 1ZRIA 3WW2A 5IK4A 2ZX2A 5FLIA 2DUPA 2A5ZA 4AQ2A 3SXWA 3P1IA 1DQ1A 4XJWA 3VDAA 4QQPA 3VD3A 4CTEA 1HN1A 2VZPA 4AF9A 1VBE3 1XE7A 2OVUA 2XBO2 1YO8A 4QGMA 4YW2A 4DEVA 4Z07A 1AJOA 4YZ5A 4DIQA 3K3OA 4KWUA 1POV1 3H0OA 4XTMA 3S57A 1EP0A 1X8MA 2BNOA 3FN9A 4LO4B 5A32B 3K48A 1UOJA 4HN1A 3NV4A 4URAA 4FXKB 3ZFFC 5CKQA 5E8AA 5FY1A 4HLTA 3ZR6A 4B4PA 3PVEA 2GNMA 1LOAA 2DBIA 1JOBA 5I8YA 5SV5A 1O59A 2K2SA 4LLOA 4N7UA 1OD5A 1SPPA 4JVAA 5F2SA 2A6ZA 4EWAA 5FP7A 3SMHA 1UXXX 3KF5A 2X09A 4S2GA 3ZXLA 1V6OA 1C8M2 3MIHA 1WW6A 2HEYF 5CBLA 1W9YA 2WWSA 3VBHB 4XBLA 2H0VA 1BVP1 2RVAA 3I3EA 5FYVA 4ATFA 1LB2A 3M7AA 3C7HA 4AEDC 3VL8A 2FCVA 2GNBA 1ASJ2 2EIDA 2BNNA 3OGGA 2XOMA 3EXUA 2YGLA 3PTRB 4XCAA 2ADEA 5FY4A 3ZXGA 4MO3M 3WW4A 2JDNA 5IWFA 5GLTA 4AHWA 4D3WA 1YHFA 2E26A 2HBTA 1WW4A 1FV3A 3WQ0A 3LCPA 2ZAHA 4M3CA 1HQNA 2FZ2A 3ZMNA 4DY3A 2E31A 3I2DA 2BWAA 2D97A 1ZX5A 2R071 3P3NA 1W3XA 2ZMNA 1WMEA 5FUPA 4YZ4A 2WQZC 2E9QA 4R9CA 2B5HA 3WP5A 4EN0A 2Z79A 5HCFA 1NCQB 2WDBA 1SFNA 3UKNA 4QKDA 3UGHA 3UETA 3KCXA 4QU1A 2PQQA 3H1WA 1W6NB 4HKWA 1T2XA 5H9RA 1ULPA 2QZ3A 2OUHA 2FDFA 1Q8PA 5FY5A 4XFFA 3I4IA 4CCNA 1WA4A 2ZGMA 4NPMA 5E1RA 5F7UA 3KVAA 2VXJA 5FZ7A 1W6PB 3RSJA 5FK7A 4FAGA 5L7OB 2H0BA 4QQLA 1VBC3 3K51A 1DYKA 1AR73 3P5BA 1HQWA 3R4UA 1QIQA 3W9AA 1BBT2 4P02B 1RUOA 4K6BA 4Q4V2 3D0SA 4LJHA 4KWLA 5ACA2 1PIV2 5DABA 2DU1A 4N53A 4A3XA 4CCLA 1S0BA 4AQ6A 1NA1A 2XJUA 3V0AB 4PDWC 1O4TA 2BNMA 4ZU4A 4XURA 3VBFA 1C4RA 1E57A 3HQXA 3CL1A 1H8TA 2RMU3 2PAMA 1G9FA 3WP6A 4UW4A 2FBEA 2IC1A 3OGJA 3J8F3 5FPVA 1MZ5A 3OSDA 3BIEA 4BE3A 2VQ0A 4NIDA 1KEXA 1ZNPA 3NRUA 4XMAA 2RS12 1G9DA 1STMA 1TMF1 1LTEA 3IAPA 4CE8A 1CESA 1AR93 2BQPA 3B00A 1K5MC 4LO5B 4BM8A 2DF7A 2XHKA 3C2UA 1DZQA 1LEDA 1EY2A 1R1A3 3U10A 5AFBA 5FJHA 4W65A 2A73B 1GP4A 2BERA 3CZJA 3PNAA 2IWGB 3THDA 3HJRA 3ZFEC 3NSTA 2HWB1 1VBA3 1W39A 1RHI2 2WR9A 2ARBA 3CU7A 5FZLA 5A7SA 1ZZ9A 4QM9A 1RUC1 4Q27A 4XFIA 1RMU2 3WOGA 2WT2A 2ZGQA 5HPOA 2YB7A 5DN2A 3TN91 5FY7A 4CUAA 3D6EA 1I9RA 1PMHX 1PNFA 5JOYA 2JE9A 2QFEA 2Q5TA 3HAGA 3WT3A 3AZZA 3JZVA 2WA4A 4PBOA 4XFAA 4MVTA 3KCYA 4YG6A 3KWVA 4QPWA 2QQWA 2ES3A 3UT0A 3WD5A 1BXHA 1V6KA 2XQXA 3N36A 1U0AA 3OYWA 3PIJA 3TEXA 3WW3A 4IEOA 4QHOA 3KQ4B 4IV1A 2WNUB 4GULA 1N3QA 1ND3A 4LBLA 3UGGA 4YVWA 1YIFA 2RR11 2WT0A 2D93A 2PELA 2RJLA 2XJSA 3M3EA 2VCBA 1XC6A 1YI9A 4WM8C 1X82A 5FJKA 3LEKA 2JJ6A 4LA2A 2VZSA 3I7DA 3MZHA 2LS6A 2VVDA 3RI9A 4QQOA 4CPBD 1LRHA 3MDPA 2RV9A 4LHNA 1VJ2A 2SBAA 2E7TA 1NXD1 1U12A 4CP0A 4XJ8A 4SLIA 2VBPA 4BMBA 3WF0A 3LIGA 4Z8BA 1PO21 2DFBA 1VBD3 4IEZA 1ZRRA 2FMYA 2CDPA 2FDJA 2JEMA 3DGTA 3ZOIA 3HNMA 3M4FA 3VZKA 5K7PA 3ABZA 1V6LA 1GQGA 4QHBA 3POBA 3SCGA 4MXWA 4XILA 5EQUA 2ET7A 1X33A 4COYA 1EPZA 3I2FA 3O0VA 2XONA 1REDA 2X53S 2C1FA 4CDUB 1L7RA 1QJX2 4Y4RA 3H8OA 5FLHA 5FMDA 4IEWA 4OUEA 2AREA 2W94A 5F2WA 1IGOA 4B1LA 1QQP3 3RFRA 1DHKB 1OLMA 5LEKA 2PQSA 1LNSA 4Y20A 2TUNA 1K3IA 4RHV2 5A3OA 5K0UB 5FYUA 2IXKA 1LODA 5EJZB 1QOSA 3JXSA 4L99A 4MGZE 3OCPA 3RJ2X 3A7QA 5FYMA 4IGQA 1X9TA 2EXJA 4UF0B 2WO3A 3FUQA 4WVMA 3J9SA 1CAVA 1R092 2HWF2 2VNGA 1W90A 1ENSA 3K4DA 2VTFA 1VRH2 3MV01 1JMUB 4RS5A 5FZ0A 5C9AA 3IZOA 1E5HA 3VZLA 5JSPA 3VDDC 2TBVA 4P9YA 1JYCA 1JHNA 2X5IA 4XHXA 2QQUA 4YGEA 5DUXA 1WCQA 3B01A 3T3YA 3PDQA 3DKWA 4XTPA 4RYDA 3WDVA 2F4PA 2WRAA 2ZS6B 4QPGC 4MGYE 5A1LA 1ZM1A 1RUJ3 4K9SA 1S0JA 1D4M3 1LOFC 4XUTA 2QJVA 3WLUA 3S5AA 1SLCA 4LUMA 4BYYA 1AUYA 4COZA 2JECA 1W8UA 4EJRA 4A41A 4ZXKA 2DYCA 2P3YA 4ZY9A 3HN3A 2BYVE 1QJU3 1W0NA 3KT1A 5JIUA 4FTSA 3JUUA 2LTNA 5JDBA 4Y1XA 3WQBA 1MQTA 1S0EA 4GXLA 4FOVA 4AGVA 5GLZA 3RZKA 3SCFA 2HWC1 3QBQA 3ZFFA 5D2AA 1VBB3 1PGSA 3ZDSA 2CGNA 1Z0HA 4FPKA 1HJGA 5A6QA 3O1OA 4PIZA 1JYWA 2Z69A 2BW8A 2EF6A 4F7ZA 3AJZA 4BQ5A 4JX0A 1H4GA 2GU9A 3QCWA 3V65A 5HBAA 3DYMA 3SITA 1TE1B 3HEIA 2VQUA 2BEOA 3LB9A 3DPRB 3MICA 4MGKE 5DUWA 5F8PA 5CA6A 2HWE2 2G19A 1JZ2A 2UU8A 2Z4FA 2ZAAA 2WFF3 3A21A 1BEV3 1BMV1 4RGGA 1CX4A 1MS0A 5D21A 1PNGA 3R4SA 1KQRA 3K4ZA 4MHUA 1PMIA 4AFBA 2WZR3 5JMOA 4RGAA 1D0GA 3FL7A 2ARXA 1QEXA 1RUE1 4OVEA 4QM8A 2BDRA 3IDCB 3WQ7A 2QQNA 2VZOA 4CVUA 1ND2C 2D3SA 4E8CA 1W2TA 1LECA 1LOBA 2AACA 3DEMA 4PI0A 3LZZA 1YFYA 3CDZB 4OQ8A 1SBDA 3UKTA 2W46A 2P4EA 1O3TA 1KXGA 2Z42A 4YNIA 4XJ9A 1IHMA 1AYM1 1F5FA 4XIOA 5FZ8A 4B29A 4W4ZA 1R1ZA 1RL3A 2CWMA 1OUSA 1CX1A 2NM1A 3SKVA 3E5UA 2QQMA 5JR2A 4KWKA 2RJKA 2WNVC 2VOWA 2VULA 3PJQA 4I0AA 4HETA 1J59A 3G7DA 2DCYA 4LO6B 1PZ7A 1D7PM 2VW2A 1SMVA 2VMIA 2VW0A 4LLFA 1Z7S1 5FZGA 1DLLA 2ZX0A 1RUI1 3PHMA 2W1SA 3LA7A 1H9WA 3KLSA 3B3QE 1JH5A 3NJZA 4EV0A 1TNRA 1KD7A 5JIAA 5C5UA 4CP9A 2TEPA 2XR4A 3KF3A 2Y64A 4GB31 1RUH2 4QHZA 1UOFA 3LQCA 1S1AA 3OEBA 4DNYA 4DXSA 5JXHA 3AMQA 2PLV3 4EZ4A 1SZBA 1UY4A 4PLOA 2XWBB 4PLNA 4P5YA 3FHAA 4Q8LA 1CAWA 1G9CA 4PDWA 1NKGA 4Q1RA 4E4SA 2RDQA 2D6PA 1CVNA 3D4KA 1AYN2 1OUXA 1W04A 5FDBA 5IK8A 4GMP3 2R0FA 2P5BA 3AYAA 1GP6A 3ZXAC 1PVC1 4BMEA 1DF0A 1EV12 5L36A 1IS3A 5DZEA 2BJSA 3RZHA 1F35A 3K4AA 1QHDA 2WS91 4M3CF 4ZU5A 3TEYA 3A0KA 4AQTA 3T4VA 4N43C 2L9LA 2PHXA 1H2NA 1J83A 1FMD2 3ON7A 1K5MA 2VZRA 5BNQA 2WKKA 3N9MA 3ZYRA 5BUVA 1G86A 1QH6A 1XSRA 1VBE2 3GBFA 2W68A 3AZWA 1GV9A 5FMCA 5FZOB 1PGW1 4AHZA 4E4ZA 4LXLA 3ZFEA 4HVQA 1ZBA1 3GCXA 2ZCWA 5M0TA 4MGQA 4KMQA 4XZUG 2BGOA 1IPKA 3FZ3A 3D82A 5B2GB 5JCTA 2P1BA 2VZ3A 3ZXJA 5IVFA 5CG8A 2QDRA 5A3WA 5LA9A 3GM8A 3HPNA 1POV3 2D3RA 3ACLA 1MVQA 1KJRA 1OOPB 1XNTA 4UYBA 3V56A 3W20A 5F5AA 2CAUA 3LOBA 5LBFA 1O3QA 2BFUL 1J84A 2JD4A 3VUOA 5FYYA 1PX3A 4U2AA 1WCKA 4HPKB 1ONAA 5A6XA 2YROA 3FE5A 5FO7B 2D6OX 5JAXA 4JKKA 2VU9A 1W8HA 3BYWA 4UFKA 4Y1ZA 3KGLA 3ZVXA 4WM8A 2Q8OA 4M0HA 4YW7A 5FYIA 4KH9A 4DO0A 2GC1A 1HX6A 2AENA 2VOVA 3USUB 2GMPA 3BPSA 4DMIA 1JS9A 2D6KA 1BVVA 3MIGA 3TWIA 5LCWL 4RGKA 3ZYJB 1QNWA 3AKPA 1GZTA 2OZ6A 3NV2A 2YXSA 4QB1A 3S6PA 4BQXA 4IXLA 4HL0A 4OUSA 3ZN5A 4YM2A 1LOEA 2GC3A 4PI2A 1PGL1 1ZZBA 1J1LA 4Y3OA 2Y6JA 3I2IA 4CEYC 2FQPA 4RN5A 1VRBA 1VMHA 4CXWA 1YJLA 1C5HA 5CU1A 1DFQA 1SFPA 4CXYA 3C7OA 1PHMA 4CEWB 2R073 2DBNA 5LA2A 1NCRB 4FPFA 2VNOA 3MYXA 2G4IA 4DINB 4QX8A 4ZS2A 5BPXA 1F4HA 5DQ0A 5FBJA 1YC61 1VBC2 2VBBA 4YGDA 1N3OA 3HMYA 3BU0A 2GSYA 2XJTA 1H30A 1XB9A 2DV9A 5CEHA 2Y6FA 3WG2A 3ZN6B 1HKDA 4AL9A 3RZGA 1DLCA 1W9TA 4D6SA 2QQLA 4QXHA 3SH3A 3MW4A 2FD8A 4ZHNA 2EXKA 2GP3A 1W6MB 4GZ9A 3BKZA 2GMMA 5K4LA 3WHTA 5BNNB 1JYNA 1OC1A 5LBBA 5FPLA 3B7MA 4O7XA 4LO7A 4CU9A 3BCWA 5FK8A 1WLWA 5A3PA 3N35A 2RMU2 1NY72 3O0WA 4A3ZA 5DDJ3 2LW8A 3QLQA 1HRV1 2YC2A 2V5YA 3N3HA 3J8F2 3GJAA 3ETPA 4L8QA 3VDDA 1DDLA 1FATA 1COV2 4KGQA 2I74A 4QPGA 1UF2C 4K40A 4LE4A 2OT7A 5FZMA 5IVCA 1S0FA 4CDXB 4DRRA 1LOFA 3JQWA 3VD7A 3RNSA 5DUVA 1R1A2 3OBRA 3VBHC 2E51A 5DMYA 2VOKA 4FFHA 1KFXL 4BCUA 1ULDA 3UV9A 4YRDA 1GU3A 2ARAA 3RVHA 2B39A 1TMF3 5ABJB 2NZ9A 3WDTA 2K0GA 1GMMA 1AZDA 5EV7A 3U37A 1VBA2 3USSA 4AOCA 3NNGA 4L2NA 1XNKA 2BGPA 3POEA 4BQ1A 1I1EA 1M4WA 1Y9MA 4IEXA 2JE8A 2B9VA 5EJ3A 4LQRA 2W91A 1W9FA 3OEAA 3ES4A 1J58A 4LIVA 2I07B 1G8WA 2MEV1 1OFNA 1I5PA 1GICA 1DGLA 2P6CA 2VZ1A 2ZMLA 4RL7A 1XRUA 1U5ZA 2B45X 2G9FA 2HWB3 2GNDA 2LROA 2B9UA 5FUIA 1SFYA 2VVEA 3NV3A 4DQAA 5KBFA 3POWA 3RQ0A 3D0JA 1US2A 1I6XA 3OG2A 5LWBA 2CV6A 1RVF1 4ORFA 1W0PA 2DUQA 3CJIB 1NCQC 3TN93 5CFCB 2QCSB 3MIEA 1NZIA 2B7YA 4K8RB 4WM7C 1W99A 4WVWA 5FR3A 4LHKA 2P17A 2XJRA 3I59A 4ISRA 4D7TA 4NWWA 5LB6A 1RUNA 1D2QA 4HSJA 1Q8SA 4BLJA 1OPOA 5FP4A 5D8AC 5CKMA 1A3KA 1Q43A 3VZJA 3PURA 2VUDA 1S2EA 2ZHLA 5DAQA 4B7EA 3CLPA 4AFMA 1X36A 3ACFA 1VLNA 4NHLA 5BV6A 1U5XA 3SLIA 2RR13 1QWRA 2GN7A 1WD3A 1ND2A 2EXHA 4N9HA 3WP3A 5ANQA 2J1SA 3BOPA 5J37A 2H6BA 2C4XA 2HWD3 3B69A 3HN1A 3LEGA 3B02A 4BK5A 2DVFA 1FOD1 2R043 2RM21 4XF3A 3X29B 4S2DA 1PX4A 2B42B 3UJOA 1W2UA 2WNEA 4IE5A 2EALA 2RS51 4KBBA 2CTVA 1XYPA 2VE1A 2C5DA 2ZEXA 3ZYIB 2WNVA 1V70A 5FBZA 5HI0A 1PO23 2VZVA 2EIBA 3U78A 2W2IA 4PF5A 3ZSKA 2DFCA 4GMP0 2W08A 5FO8B 1YWKA 1ENRA 1QQP2 4N43B 2VZQA 3NL1A 3ZYHA 3WG3A 2X8KA 5C3OA 4G4FA 3AMNA 4A6SA 3N9LA 2FCUA 3T2PA 3ZYBA 1GLHA 4AWDA 1QXPA 3FC0A 3GHNA 3M8LA 2Y6HA 1RJ8A 2CNAA 5FUNA 4PQ9A 2OS2A 4BQ2A 1FNZA 1V6NA 1XE8A 3NNJA 4LKEA 2PA7A 4YW5A 2HBUA 3H8UA 4FPGA 4QWNA 4JZRA 1HB2A 2VMEA 5AFEA 1AXYA 1WCDJ 1IOAA 1RUG1 3KT7A 4UT5A 2QDNA 1A8DA 2PAEA 2PFWA 1XYOA 3M1HA 4BOWA 1TNFA 4I09A 4NE9A 5FXVA 1T6GC 3A23A 4M0NA 2HH9A 1D4M2 2WNUC 2X29A 1OQEA 1POV0 2JDUA 1HDKA 2WIIB 1WA6X 2XBO1 5FZ3A 4QAWA 1LGCA 3U14A 4FXGB 3NNFA 1ULCA 5SV8A 3ACGA 3SEEA 4Q5OA 4JGZB 3POIA 4Q26A 3WSOA 1RB8G 3L2YA 1W2NA 3ZIXA 1QJU2 1F9KA 3NW4A 1C8NA 4OUMA 3FJSA 4LUKA 2ZBJA 3MF9A 4URTA 5FYBA 3EBRA 2QVSB 1GZWB 4LBJA 1GOFA 4NVPA 5KXDA 4NOTA 4LORA 2WL1A 1SLLA 1VBB2 2ZGOA 1O8SA 3NAPC 3T0AA 3GBWA 1XYNA 2B4KA 2UYAA 3KGZA 3OBZA 5CIRA 3DF0A 5FZHA 4A6OA 4AVCA 1M06G 1F4AA 3KD4A 3AVRA 5IVEA 1ZVFA 3O1PA 4A7ZA 1Y9GA 4XBQA 5A6ZA 4ZONA 4KNCA 1ULEA 5A7WA 2XL7A 3LDBA 1UAIA 3BTXA 5KXEA 3AKTA 1SQ4A 4Y5SA 2RJ2A 5EZWA 4CEYB 1H2KA 5FPBA 2WFF2 1FAYA 1ASJ1 2A3YA 2DTWA 1BEV2 1GBGA 4IV3B 4XXPA 4CDQA 4DOUA 3KQRA 4KU7A 4XE9A 5IK5A 4Y1VA 2WC2A 1DP0A 2ORXA 2WZR2 3IPVA 2P2KA 1W6QA 1RUD2 1ZBE1 5K0UC 1KDKA 1RC6A 3MV11 5JR7B 4Q4X3 2QUOA 4OZOA 5C7GA 3MIFA 3Q8EA 4DUXA 2ZXQA 4G3YC 4N9IA 5IVYA 5A7QA 5FXZA 1N1SA 2XLAA 4W6XA 1S2KA 4GJYA 4JGYA 3WNKA 1RINA 5FQ0A 3AKSA 5AC93 3PUSA 1TEIA 1CJPA 1MEC3 1PVXA 5GLUA 4GQ7A 5FYTA 2JDYA 3HD8B 3NJVA 2DCJA 2GDFA 2I45A 2RDRA 3IDBB 2ZHNA 4AEMA 1XNBA 1MZ6A 4BQ3A 1WZXA 2J1AA 2WNOA 3FLRA 2Q1ZB 4PCRA 4LNVA 1F8VA 1Y3TA 4ARXA 1JZ4A 4MGSA 1Y9QA 3O14A 1QH7A 1AYM3 3BOWA 3MFCA 4FO9A 1LJ7A 1CWPA 1GNHA 1BBT1 1ZRDA 3S7EA 4B4RA 4UOJA 4LA3A 3VZNA 4Q4V1 1NQJA 4MG2A 1KS4A 1PIV1 3GJBA 2VOXA 3PVOA 3VBOB 1JXNA 2Y8KA 3NJXA 3ETQA 4QMAA 3H3ZA 1ULGA 1Q56A 1Z7S3 1SEFA 4Q4W3 4BK4A 1DCSA 5DG2A 5A32A 4OQ9A 4EN9B 4CSWA 4YG0A 1GQHA 2EVXA 4HFSA 4XDPA 4AAPA 1VAVA 1GZCA 1CAUB 3GHMA 4E4HA 1QXJA 3I3DA 4FAHA 3AP7A 3VD9A 4FFGA 1VP6A 1UMZA 4NPRA 4XUPA 2RS11 1J3RA 3ME2A 2VZUA 2Y0IA 5IVVA 3ZSLA 1XPWA 2AEYA 3MUY1 4YVSB 1JU4A 4XUQA 1LKNA 3DPRC 2H6CA 1JUHA 4X8NA 1WLDA 4QDSA 3FFQA 4WVVA 1UY0A 1UZ0A 3VBHA 1YQ8A 3J26N 1APNA 4WM7B 1FX5A 1QJEA 4NIIA 3ES1A 5FAXA 2R063 2NPIA 3U1XA 1QNYA 3AFGA 1RHI1 4G9SB 4J1XA 4NHXA 3WVJA 2ETEA 4JTNA 4MGTA 5K8SA 1SCRA 5EJ1B 2ZPXA 5D8AB 5EYYA 1RMU1 4S2HA 2EICA 2Y60A 3THCA 1OHFA 4QQ2A 1ZA4A 2YYOA 3DCQA 4FPHA 1KITA 1DQ0A 2GP5A 1AX1A 3VBSB 3LFIA 1ZBA3 5FV3A 3LPGA 3N9QA 4QDQA 2CYFA 5F5QA 4WZFA 3H50A 1GOGA 4CCKA 4W50A 3K46A 3RZZA 2XVKA 4LR4A 1NCQA 3MO4A 4BU2A 4D6QA 4H3WA 5IJRA 1W6NA 1W8TA 2BU9A 2KXLA 5FP8A 1QXRA 3Q8BA 4XJUA 1PMJX 4R8HA 5L9BA 4FCAA 5C3RA 1YLLA 4CYDA 4CUCA 1W6PA 5FWJA 1UU6A 3W5NA 5L7OA 2W5FA 4YFZA 3R4DB 1OSGA 4PQQA 5TSWA 1NG0A 3W21A 4E27A 5LEJA 4KG0A 3B93A 1UYZA 1S4CA 3H3UA 3T2TA 5JXJA 3N7LA 3NMBA 5JOWA 1AX0A 2A7AA 3WEZA 5JLVA 4S2FA 3V0AA 3CMGA 3VHOA 2CWSA 2E6VA 2YU2A 2EIGA 2J7MA 1Y7BA 1CIWA 1LU1A 3QH7A 3U0ZA 5I0DA 4LHSA 1JYIA 1IS5A 2VM9A 1OI6A 1PZ9A 2ZGSA 4A2UA 4E2QA 2JDKA 3DN7A 1QJX1 3UYJA 1DQ2A 1ZRCA 3AM2A 2NLRA 2WFPA 2YDEA 3SNMA 1SDWA 4E2SA 4A42A 4EQVA 4NHYA 2YBKA 5CFDB 2XHNA 3BN6A 4RHV1 3WG4A 4A44A 1KRIA 2XB6C 5I8SA 5LY2A 3OY8B 4NIAA 4XEZA 3RZJA 2YGMA 1V00A 4BIFA 4M01A 2DVBA 3ZYPA 3PTYA 1W6OB 4PJYA 1R091 3OUIA 1L7QA 1YQ2A 2QKDA 3CO2A 3NO8A 1VR3A 3O0XA 4O65A 1OXCA 5A80A 4ES8A 1GQPA 1VRH1 1V9U3 5DAWA 5IAVA 4QPYA 1XSQA 2J1TA 2JG8B 2KM2A 2PHRA 1AR81 3J7NA 4I0WB 1KS5A 4HBNA 3FX3A 2WO2A 5BY5A 3GZAA 4XC9A 5A3UA 2LRPA 5DDJ2 2UWAA 3WUCA 3E6CC 3SC7X 1WW7A 2MPFA 3CHXA 4LBQD 3WR0A 4AR2A 2HLEA 3NAPB 4AI9A 3FFZA 1JZ5A 1K42A 1A78A 1OOPC 2DVGA 2PHDA 3GBGA 3AC0A 4IQPA 2J1EA 4ZKTB 4AG4A 2HYKA 3MEPA 4LBOA 4NHMA 3OOXA 1CIYA 5ERLA 2WNUA 1HRV3 3EJKA 5LRSA 3U07A 5J1XA 1UZWA 3AZYA 1K5JA 2WSVA 3IB3A 2XMLA 4R9AA 1FYUA 1G9AA 1EPWA 3NV1A 1HRI3 3ZXEA 4JAAA 4Y22B 4XQWA 2DCKA 1LHUA 1TMF2 2CGOA 4JDNA 2DVAA 3GNEA 3ITQA 3DYOA 1WLCA 1NUKA 4IEQA 1UPIA 1G6NA 2NMOA 1U5YA 2JKBA 4LE3A 5F9TA 3TEWA 1QU0A 3E6BA 4IUGA 3AKRA 2FDIA 4BH9A 4CXXA 2Y33A 4Q4Y3 2CSGA 2F4LA 5A3MA 3WP4A 1QMJA 4C8DA 2PHFA 2PN5A 1EAH3 1ULOA 4AAXA 4Y1YA 2ZGLA 3UNPA 5FZ1A 5FZAA 5BNPC 3RWNA 4BB3A 2Y0OA 4L97A 2HWE1 4JRLA 2P3JA 2XGXA 4QGNA 2NP0A 1TME3 3A22A 3BIWE 2CGPA 4LK7A 2VAUA 4I3GA 5JXIA 4CDUA 4CEWC 4AHXA 1RGSA 2ZZJA 3OUJA 3KV6A 1NCRC 4XF0A 2HEWF 3I2HA 4OLLA 1PO13 1RVF3 2ZGKA 3AZVA 4NWVA 3RRDA 1QJFA 2WYFA 4H14A 4IL7A 4B1MA 5K0UA 4LKDA 4XBNA 4FBFA 2RR12 3VDBA 4LBQB 4RR3B 3JBG3 2Y26A 4UF0A 2HWD2 3TOJA 4Z92B 4W6WA 5BNNC 5FP3A 3RGBA 3WCSA 2R042 1NLRA 4IETA 3UJQA 2C0ZA 2BVBA 3TNQA 2D6LX 3OTFA 4XFGA 4N8MA 5DUUA 3HWJA 1SDDB 2OQ7A 1DQ4A 4ATEA 2WZPP 4AVBA 2A71A 3Q8CA 1FOD3 1XXNA 4Y33A 2RM23 4DXRA 2ZJCA 3VHNA 1AL21 4YARA 1VE0A 4OHZA 4CDXC 1RUH1 2RS53 4OHWA 4KWJA 5IHRA 5FRAA 4AE2A 5A33B 2OUJA 2OKXA 4EZHA 5I93A 4LEJA 5FYHA 1CGPA 5FOBB 1V0AA 3H1YA 4QXCA 2FDGA 4UBGA 3THTA 1O4ZA 4LT5A 2B46X 4IERA 5ABJC 5FCCA 5JWPA 1UW8A 1UWWA 4AEDA 1AYN1 4FTBA 1UZVA 2D43A 2YFUA 2BOIA 2CDOA 2E53A 2VR4A 1Y43B 3GDBA 4UFIA 5GZEA 1QDCA 2XH6A 3QD6A 3K2OA 2XUMA 5FTTC 3WNMA 5FZEA 1AR63 1H8VA 3Q8AA 4GAZA 4QX7A 3CJIC 3POYA 5CFCC 3DPRA 3LA3A 3BALA 5LRRA 1GZ9A 1VBE1 1RXGA 3VBUB 1RUG3 1UPSA 1SLTA 2ZEWA 4PLMA 4DZGA 3H8XA 2W9XA 1UYXA 4CU8A 1NLQA 3BPZA 4BLIA 1W03A 5IAXA 1HB3A 4HOOA 5JPNB 1UXZA 4H7LA 4K7JA 1AXZA 1W2AX 2MHFA 3M2MA 3JD73 4RD7A 4HN0A 4XAEA 3WDXA 4XFCA 5CVRA 5IT6A 5LA0A 1MR5A 2XBO3 5H9PA 3EHKA 5T52A 3OGRA 5KC5A 1ODMA 5KHGA 2WINB 3VZMA 4ET7A 4YZ1A 3WW1A 4EWEA 2JDAA 1PM4A 5K9YA 4IE7A 1IS4A 2JB4A 4F83A 3AVSA 5C70A 3TYJA 4E9KA 1B35B 1TVGA 4ZZ8A 4HK9A 1U5IA 4CDWC 4MV2A 1KDMA 4XIKA 3LA2A 3OF1A 4QGLA 3T4HB 5FWEA 2D5HA 4D7SA 3TEZA 1GWKA 1X7NA 1RUF1 4UXAA 4IEYA 5L9RA 3ZFGB 4CCCA 2E63A 4TTGA 5FOJB 4XOGA 2E33A 4MH0E 4MXVA 2ZEZA 1UKRA 3IIIA 4X6RB 1B09A 1DZRA 1JI6A 1GP5A 4Q4X2 5FFOC 1MS1A 3WINE 1ASJ3 3PUAA 3H7JA 2W39A 1HXS3 4NRMA 2ZOEB 4OMDA 3UESA 2BTVC 3ZX7A 4BXFA 1IG0A 1AF9A 3TAYA 1ST8A 2O1QA 4F3JA 1ZBE3 1XQNA 5AC92 3VHPA 2B8MA 1MEC2 2IVJA 3HBZA 4QQHA 2W1WA 2YY1A 4WBBA 3O5SA 4KQ7A 4QXKA 2WAAA 5C6CA 4M00A 5LA1A 3RPQA 5G04L 3BGAA 4AI8A 1BKZA 3OB8A 2OYZA 2WSUA 2GH8A 3LIHA 3PVBB 4RFRB 5HCBA 2DCZA 5I0TA 5C8CB 4CUBA 2XVGA 4R9BA 4B7KA 1XJAA 3RYRA 3T2QA 4GH4B 4HT1T 1MS9A 5J48A 3UKVA 4JGZC 3SQOA 3J7HA 2R32A 3S5QA 2VY0A 5FZOA 2DUOA 3VKNA 1Z7S2 3KZ4C 4GALA 4Q4W2 5BNOB 3WF1A 1PK6B 3SHRA 1NY71 3M3OA 4NROA 2IZWA 2WQ4A 1WD4A 3GF6A 1COV1 2WO1A 4A7YA 1YQ6A 1DBNA 1SLBA 2JB8A 2GC0A 1GWLA 3S7IA 2IFRA 2JICA 5JOZA 1CD3G 4YGBA 1OOPA 2QE3A 4BPZA 4I2OA 3FWEA 4JRAA 2O0OA 1WW5A 3HOBA 2ZHKA 1UY3A 4BQ4A 5J3UA 4FPJA 1S0IA 5BNPB 2PHUA 3U75A 2J22A 4HPKA 3T0DA 2RS13 3APBA 3PUHA 5JZGB 3PUQA 1Y4WA 5J96B 1WMDA 4IV3C 2R062 1VBA1 4RQPB 3AYEA 4IE0A 5CYYA 1DGRN 2FMDA 4SBVA 1JYTA 1S2BA 5FMOL 2QTWB 4QKBA 5B4NA 2V5DA 3USUA 3MGUA 1UNBA 2V09A 2WN3A 5GKAC 2PHTA 1F5JA 5FY8A 2VUJA 1JN2P 1ZREA 1AR72 2BRTA 1SCSA 3KV4A 4Q0SA 5FYCA 2WBKA 2Q8EA 4KL1A 1O5LA 5FXXA 4BQYA 4UI9L 4IDZA 1ZBA2 4GWNA 1PM7A 4B8EA 1JODA 3AXDA 5GM0A 4CU6A 2GC2A 5FY0A 1H4HA 3OGVA 4GA9A 1J1TA 3VBRB 5FYZA 1FI2A 3PVNA 3SKJE 3WY6A 4K1YA 4FOQA 4CEWA 2VQTA 1WBFA 3NNLA 4QB6A 1NCRA 5I8TA 4MHRA 2VUAA 1CONA 3OPZA 5F6KA 5FP9A 4OCTA 4QX5A 4D7YA 1AR92 4PHZA 3MI8A 3WNLA 1QJY1 5C4WB 1R081 1LULA 2XL9A 3VBOC 2Q4SA 3I49A 1G9BA 1SBEA 4J6GA 1UQXA 3WX5A 3ZN6A 3VL9A 3CBNA 1D0HA 1W8NA 1GWMA 1W6MA 3IDAA 5EHDA 4GWMA 4XDQA 3RWKX 5BNNA 4C0BA 4C1WA 3RZLA 2RHPA 5FREA 2A6WA 1LHWA 2R1DA 2VG9A 4L9BA 1S55A 3U4XA 4YW4A 3ASIA 3QACA 3THPA 3I2JA 3ZM8A 4BQWA 1C1FA 3OGSA 4HZFA 4XUOA 3AP9A 1IPJA 4QXBA 1VPHA 2WQ8A 1NOVA 3IAQA 4ZPIA 5HV0A 4YVSC 2XDVA 2JG9B 5EFUA 1RUC3 2GAUA 2JXAA 5L73A 4CDXA 4COUA 5A3LA 4BISA 1FPN1 5BYNA 2VC9A 2W0XA 3I97A 2VTXJ 4BXSV 2OW4A 5FYSA 4UW5A 1LOGA 3IWZA 3ZSEA 3V0BB 3MIDA 3LOIA 2XG3A 2UWCA 1D2SA 1CQ9A 5ABJA 4M4RA 1V9U2 4YZ3A 1DZTA 3T0BA 4CCDA 3NJYA 1RYYA 4OULA 3NKGA 3QH6A 2R1BA 2R0HA 3KVBA 4FPLA 1NA1C 2NYYA 4XUNA 3INAA 3RS6A 5LK7B 3VBSC 1OA4A 1Q8VA 3VBFC 3IMNA 1LHOA 1VRH3 4MYEA 4AFCA 2RS31 1VBD2 1AR83 1D4M1 4P08A 2XVLA 3T30A 2J42A 1AL0G 1QKQA 3CJIA 4L11A 4Z82A 2I2SA 3FLTA 3PJYA 3VKFC 5CFCA 2VH9A 5KHKA 4CDWB 2EXIA 4O9GA 4YGCA 1QJU1 4BJ0A 2J1VA 3O1MA 1UU5A 5CZKA 1GANA 4PF1A 1HRI2 1WLTA 5DXDA 3FHIB 1CAXB 1Q3EA 4AVVA 3O1RA 4E2GA 2WLQA 1H9PA 1OA2A 2ZGPA 4XF1A 1VBB1 2WJSA 1VALA 3WDWA 4BWOA 3ZR5A 4C1XA 2VW1A 4R4XA 1H1AA 2HKXA 4X6QB 4TSVA 3AMMA 1W2OA 1V6IA 2CL2A 2BBAA 2JENA 2VXRA 4Q4Y2 5H9QA 2FDHA 1EAH2 1EUTA 2YMZA 4ES9A 4V2VA 3P6BA 2QQVA 2WZ8A 5FLJA 3FUOA 1TME2 2BFUS 3KSCA 4OI0A 3EYPA 2DTYA 2WFF1 1BEV1 4XF4A 2WO7A 3H8RA 4O61A 1BHGA 5JI9A 5DZFA 4IV1C 5CFDC 1LGNA 3IBMA 1OH3A 1RUD1 2AUYA 1N1VA 2HYXA 3EB7A 2YZ4A 3ZXDA 2HWE3 4N43A 4E4DX 1PO12 5CB7A 1RUJ2 1AVBA 3GZTB 2RDSA 3DL3A 3UK9A 4QPIB 2VCMA 4MX3A 4Z2WA 4FOYA 2JKXA 3H1MA 5FIXA 3LSDA 3FHQA 2A75A 3J7LA 4L0PA 2JD9A 4AW7A 3JBG2 4FTEA 1ZZ7A 2XLGA 3GZEA 2AZ5A 1O91A 2JG8C 2BUKA 5F3GA 1JTZX 4AI3A 1JYVA 2D98A 3VKLA 3BVCA 3WNOA 4AI0A 4E8DA 4P5HA 1QF3A 5HCHA 5IW0A 4ONUA 2Q0AA 4DPNA 3C7FA 3PLQA 1FOD2 2KD7A 1PZ8A 4UWDA 1IQDC 1OBNA 4HXCA 4WV8A 5JUVA 1J3QA 4LOSA 1C8M1 5FMOS 5LBCA 5F3EA 3HNBM 2IXLA 3MIBA 1UN1A 2WABA 3IN9A 2HWC3 4OHYA 4MSVA 4A45A 1WGPA 2ZKLA 4HG6B 2D44A 2OIIA 2D5FA 2VPVA 4O9EA 3SCHA 2VO5A 3T09A 2VOTA 1DQ6A 5I0UA 3E6DA 4JGZA 2IXHA 2AGSA 1FXZA 2FZ1A 2YFZA 2YPJA 1H6XA 3EMRA 5KC6A 1BQPA 4CP1A 1AL23 3CIHA 5FPXA 1UX7A 4BA6A 4YW1A 4GMP1 1GOHA 1GZWA 5ANNA 1JZ7A 3LDRA 1TG7A 5C3QA 4XVHA 4XMIA 5J36A 2VMCA 1R64A 1MS4A 3HVDA 2VL4A 2W47A 4YW3A 1US3A 1Q8QA 3RDIA 4Q8KA 5A70A 3IDEA 4M3CE 4LKSA 4TXWA 3O1SA 5C9AC 3TB0A 1L7LA 2ZGUA 3T2OA 1EYBA 1UIJA 1AR62 3DKQA 3IIAA 2XJQA 3M3QA 1RUE3 5E16A 4HVRA 4UBHA 3TBDA 3HT1A 4CEYA 3RYKA 2P3KA 2WZEA 3IMMA 4P9WA 1SPPB 4HKLA 4NPLA 4IEVA 3PUIA 4IV3A 4K21A 3TRSB 1YQ5A 5GZCA 3C3VA 3POJA 4AZZA 4V2WA 3MHZA 1JZ8A 1OLQA 1UZZA 2XUEA 3JD72 2P34A 3H3LA 3MW3A 3MLLA 4TLFA 2AC1A 2MNGA 4YW6A 4RR3C 5ACA1 1N1YA 3KS7A 3D8CA 1MQTC 4P9IA 3W5MA 1OMIA 2PLV2 4NAOA 1IZ3A 1GNYA 1RUI3 2YC0A 5KR7A 4UAPA 1NQDA 1CR7A 2VMHA 1MPXA 4GB33 2V72A 2IXJA 3B9CA 1SLAA 4I0BA 4M3CB 1YFUA 2VTXA 2WAOA 3FLPA 4IEUA 3VD4A 4Z2AA 1YI7A 2UY8A 5FZ4A 2E7QA 4M4PA 5GZFA 3I2KA 4B3NA 3ACHA 4NO4A 4AEJA 2BGCA 1BJQA 2K9ZA 1C57A 4CCEA 5LY1A 4JHZA 1PVC3 4ZS3A 1UY1A 3VBOA 1POQA 1QOOA 1UMIA 4FFFA 2A6XA 2WS93 3KT4A 1HXS2 1REFA 1RUF3 1GFF2 2TNFA 4IGOA 1CPNA 4FQZA 1L3JA 1UO9A 2D6NA 5EPAA 2Q8DA 3WNNA 2HEVF 4HMZA 5FZ9A 4C91A 1UIKA 5FPUA 1ZBE2 3E1F1 1GSLA 2WN2A 1CAUA 1QDOA 1ZZ8A 4LBMA 1UY2A 3J4UH 1HV1A 1NE6A 3BODA 4N53B 2X05A 1OQ1A 2C26A 2D7FA 3O1TA 1NA1B 5F5CA 1W9WA 1W8WA 3M3CA 5AVPA 3ZXFA 1GKBA 5FO9B 1UD1A 5EXOA 3WHUA 4NMIA 3VBFB 2ORZA 3H9AA 1WCSA 1C3HA 1H8TB 2GALA 2ZX3A 1UOBA 4YVSA 5HCAA 3B94A 3MBWA 4JKLA 5H9SA 2V73A 2ATFA 1KGYA 3LAGA 1HLCA 3VBUC 5JXGA 3RYPA 4WM7A 1OQDA 1HN0A 2QNKA 3LF7A 2JDHA 4RFT0 5IATA 1DGWA 4P9JA 5D8AA 1DGWX 4XZPA 5E89A 4FPEA 2V4VA 1W0OA 2XLFA 1A6CA 5AVAA 5DDJ1 5GZDA 3NQHA 3LKJA 3L9JT 2DURA 4AGRA 2QQIA 3AP4A 3O12A 3Q8FA 4J25A 4ITCA 4OI4A 5LK5A 2PAKA 4R9DA 1ULFA 3SISA 3VBSA 3WF3A 1WMFA 3E97A 3HT2A 2XQRA 4ARYA 2PTMA 5KHJA 2O8QA 1ZA7A 4IE6A 2YBSA 4COVA 1B35C 3OBTA 4JC1A 4AVTA 2YBPA 5I91A 3LFMA 1P8JA 1DYOA 3PIGA 1COV3 1JU3A 3JQXA 3H7YA 2NQYA 1ALYA 4Q0UA 4X8PA 2V4AA 5IUQA 3AJYA 2DU0A 3CF6E 1ENQA 4H7MA 1QOTA 2R072 3HNYM 3OYWB 3ZFGC 2AH2A 5LBEA 5J98B 4JKMA 1H6YA 4IV1B 5FKBA 4AXOA 1LHNA 2WA3A 1ND3B 4RA0A 5A7OA 4YVWB 4ASKA 1OLME 1SBFA 4F8AA 5FZFA 1E5RA 3O7OA 5KXBA 2FDKA 3KV9A 3GXUA 3URFA 3MW2A 5DPNA 2QQKA 3OD4A 3FMGA 1IPSA 5F3CA 2HWF1 1YUDA 2XPJA 5D1IA 2VVFA 5F1RA 1G7YA 3MUZ1 4HK8A 3ILFA 1UZYA 4ZXEA 1OVPA 4XABA 4R4ZA 5FZKA 2QBXA 3WDUA 4DY5A 1DU3D 2DDUA 1O3RA 3CZUA 5T55A 4YG3A 2ID4A 2BBVA 1AXKA 2PMWB 4OHVA 3WG1A 5T5JA 5GZGA 4AEKA 4MZUA 1CJDA 4WVZA 4KG8A 5FZ6A 1H0BA 2Q8CA 5CFDA 3JB4C 2FCTA 4CP2A 2VNVA 5C8CC 4MXWB 3OY8A 4GH4C 3ZIWA 2JX9A 4GWIA 1MS8A 1UYPA 1AX2A 1H2LA 2E7AA 4UFLA 4V1PA 5EWSA 3GYDA 3JU9A 5FZCA 2EIEA 2HWD1 4MADA 1W6OA 2G9ZA 2ZZQA 3N9NA 1MVEA 1LCLA 5L19A 2R041 1FNYA 2WLPA 3LSEA 3PU3A 4K20A 5BNOC 2PHWA 1W28A 2OQ6A 1PK6C 2J1RA 4NJ4A 4EN8B 2JG8A 1UCXA 4Y20B 5A1AA 5GLWA 1QJY3 2KR2A 4CCJA 1R083 5FKCA 1J3PA 1ZYBA 1CPMA 4INDA 4FQ4A 1UOGA 5JVVA 4D69A 1SLIA 2R7EB 4Y24A 4Y5TA 2VMDA 1Z78A 3PMEA 4YLZA 1NLSA 5C9AB 3Q9OA 3VDCA 5KXCA 4WVMB 3NAPA 1CAVB 1O7FA 3J7MA 1LEMA 1BCXA 1W3VA 5F3IA 4LKFA 5KHIA 2HWB2 2IUWA 2LM3A 3B5LB 1NX9A 5HV4A 4RS5B 2W95A 1HV0A 5FXWA 1RUC2
chains in the Genus database with same CATH topology
3ZO0B 2UY9A 3ZSMA 5HXVA 4QU2A 2P3IA 2X5IB 3TN92 1H1MA 2MEV3 5JZGC 3CJXA 3ROUA 1LESA 4RQPC 2BPA2 4Y22A 3M70A 4H55A 1QGLA 1FPN3 2FHRA 1REEA 2NMNA 4YM0A 3WV6A 2GZWA 3M3IA 2ZHMA 4MGIE 4UW6A 3E5QA 4KGGA 4AK3A 4DB5A 4XETA 3GALA 1A8MA 4LBNA 4AFDA 3NWKA 3W59A 1MQTB 1MACA 4Q0VA 3ZMOA 2VMGA 1AR82 5BXXA 1Q8OA 2A6YA 2GNTA 2ZA9A 4OI1A 3ZFFB 4PIXA 3VBRC 2F6BA 3S0MA 3PMSA 2AR6A 1XU2A 5T5OA 4BIOA 2EA7A 3AB0A 1PO22 2RS33 3CNAA 1UKGA 4FP2A 3U11A 3EQEA 4AVAA 2A3WA 1YIPA 3AXEA 5C4WC 3WQ1A 4WZCA 1IQAA 4C0HA 5JSRA 3LGRA 4JV4A 4LBQA 4RR3A 4AEDB 2PYTA 3R05A 4AQSA 3ST7A 1N3PA 1NXMA 4ZU7A 5KWRA 1KJLA 4FPCA 5JPMB 5CADA 1YFWA 1EV11 3ECQA 2ENRA 2OA2A 3T1LA 3MLKA 2VNRA 2CY6A 2IFWA 2IXCA 3AYCA 2JG9C 1FMD1 3AZXA 3GZUC 2ZX4A 4W6YA 2YUEA 1SACA 3POSA 4Q4X1 4TZDA 5A33A 3VGIA 4XW3A 4LBKA 4YZ2A 1RIRA 4MUVA 1RUD3 3AK0A 5AC91 1MEC1 1S0GA 1FT9A 4AFAA 3AP5A 1IKQA 1I5ZA 2BWCA 1VB4A 2HJIA 3BTAA 4Q29A 4PBPA 1YNAA 4TWTA 4L92A 4AVSA 1IKPA 3RMXA 1CAWB 4OHXA 4ASLA 4PDWB 4DS0A 1JUIA 1ENXA 4P9LA 2XKOA 4TYSA 2HWC2 3WUDA 1AJKA 4EN7B 2IXIA 3VBUA 4Q4W1 3VKMA 3VKOA 4EWDA 1UU4A 1V6JA 1AL22 2UURA 4K8FA 3RI8A 2O8OA 1C8M3 2ZACA 1K5MB 4K3UA 4UW3A 4K1ZA 4HKOA 4D94A 1HQLA 1OA3A 1OFSA 1MS3A 3ZFEB 1BK1A 3ATGA 1BMV2 2D3PA 4DXZA 2R30A 5DZGA 5T5LA 4HVOA 1TQ5A 2GN3A 3ZXKA 4B4QA 5JI7A 1B35A 4P9GA 5F6LB 3BU7A 2ZMKA 1RUE2 3WZ1A 3JCIA 4I01A 2R061 3G6JB 3KB5A 2KA3A 2ET1A 1YJKA 3OD0A 4QD2A 2Y38A 3ZFGA 2SLIA 1VBC1 4FPOB 4C90A 1AR71 1LR5A 1AYM2 2Z5WA 1IS6A 4QPIC 2ZGNA 3N7KA 3DUIA 3N7JA 1YYNA 5CNAA 3N4MA 4WM8B 1GYKA 3R6SA 3ZN4A 2OZJA 3EO6A 1RUI2 2XWJB 1QY4A 1BBT3 2RMU1 2ILMA 4Q4V3 3ALQA 4GB32 5JOXA 2OPKA 3J8F1 3RG0A 1PIV3 5ACA3 2C9AA 2ZGRA 3T1MA 3WNXA 2Q30A 1AR91 2Q1MA 5C8CA 2UYBA 3FBMA 3QOPA 1S0CA 4I02A 4GH4A 1ZZ6A 1R1A1 1XNCA 3DV8A 3ILNA 4CDQC 1RTVA 1PVC2 4CRQA 1ZZCA 1DGRA 3VHRA 1F2NA 4JCKA 2WS92 2Z2SB 2NN8A 2YHJA 1RUF2 1UL9A 2ZX1A 5BNOA 1PK6A 3AMPA 4AI1A 2XJPA 4LTAA 4XXAA 2ZGTA 5CAZA 1OPMA 3E5XA 4LO8A 2W52A 1JOJA 1H2MA 4JGYC 4FVVA 1RHI3 3AX4A 1FV2A 1PGW2 3ENRA 2XJVA 4GKYA 3AKQA 5T50A 4GKXA 3MPBA 1DQ5A 1RMU3 1X50A 4FT8A 1H1IA 1O3SA 1VAKA 1GR3A 3CEWA 5BNPA 3VDDB 1OKQA 5JZGA 3HR9A 1WUVA 2VECA 4XYXA 4ASMB 4RQPA 1V9U1 2ZABA 4QPGB 1LOCA 2ZKNA 3MPPG 4IEPA 4I30A 1LENA 2QZ2A 1X8EA 4YM3A 2EAKA 3ILRA 4XFHA 4CZSA 1KFUL 4ISQA 2P37A 3AFKA 1ZRFA 1DYPA 2A70A 4AGGA 5JMCA 4KU8A 1VBD1 1XNDA 1YXWA 3UL2A 1URXA 1UX6A 5GJ6A 4DFSA 3VBRA 2GH2A 5CG9A 3ELNA 2A3XA 1HRI1 4COWA 3ZPYA 4Z1VA 1LHVA 1JW6A 2PHLA 4N7IA 1QQP1 5KHHA 1BZWA 1V6MA 4META 4AHYA 1PGL2 1I3HA 5C4WA 2EAAA 3L2HA 4OZXA 3I59B 1BYHA 1QJX3 5C33A 2N7GA 4Y5Z0 4Q4Y1 4J1WA 4FSJA 1VB2A 1EAH1 4P9XA 3RMYA 4RHV3 3N7MA 1TME1 5I0RA 3KM5A 2JE7A 3S30A 1ND2B 2D6MA 2VQAA 4XFBA 4YSFA 4XQDA 4Q0PA 4N53C 3WDYA 4GIQA 1OLRA 1R093 2HWF3 4NHKA 2ERFA 1NE4A 2WT1A 1PO11 1RUJ1 1N1TA 1H8TC 4XF9A 2JG9A 1MZFA 3IKWA 1RITA 3HIFA 5FPZA 4IESA 4Y1UA 4Y26A 3IT8A 2WNVB 1O5UA 3WCRA 1HRV2 3JBG1 4XPVA 2QQPA 1AHSA 1O4YA 2VGDA 1LU2A 2ZTNA 4OFGA 3V0BA 2XKPA 4QT6A 5L7OC 3W58A 4U36A 4LHLA 5T5PA 1NZCA 3WXPA 3FBYA 1QJY2 2CAVA 1R082 3SH4A 1D4VB 4P14A 1C1LA 4YFWA 4JDOA 1F31A 4XHBA 2AYHA 4LULA 2R16A 1LGBA 1RJ7A 4BHPA 4PIYA 2UWBA 3D5OA 2DCTA 2D40A 1VIWB 4A7KA 1C28A 2JDZA 2MEV2 3B9IA 4CDWA 3JB8A 1JBCA 3KCCA 2BVVA 3KMHA 5GALA 1CAXA 2R49A 3NKTA 4YM1A 3R0RA 2WZR1 2DWRA 3NVCA 1ND3C 1FPN2 1N47A 3I8TA 4MLOA 4YVWC 1RVF2 1HIXA 5IK7A 1Q5OA 1C5IA 1YFXA 4FP3A 4RSUA 2DVDA 1AR61 1DIWA 3SH5A 4NR1A 3AYDA 5DG1A 4YYOA 3A4UA 2GMEA 4Q1PA 4AYUA 4AI2A 1XU1A 4FOWA 4FPYA 5C8WA 3A0NA 4XQ4A 1CN1A 3LWCA 3IM0A 2RS32 5E88A 4DRVA 1HW5A 3JD71 2RM22 5T54A 1VAMA 3BB6A 3MFAA 4QPIA 2RS52 4HSLA 2RE9A 2A6VA 5T3NA 4Y4YA 5J7MA 2PLV1 4CDQB 1MZEA 4BZ4A 1QJZA 1S0DA 4N90A 5I0SA 2LALA 3IPVB 4HANA 3VLBB 1W6QB 2G9GA 4I3PA 3ZSJA 4XJZA 1YCIA 1RUH3 2YV8A 4NN0A 4JDMA 3V64A 1DG6A 1MS5A 4Q2FA 3RJRA 3MLJA 3VZOA 4JGYB 3AMHA 3ZYGA 5FQ0B 3VN4A 1AYN3 3OJBA 4OI2A 4RS5C 4Q0QA 3TNPB 1WBLA 2LUWA 4EN6B 1YRZA 5EYXA 1GNZA 4JQRA 4EROA 4CDUC 1EV13 2X5IC 4R52A 3P3PA 4XJAA 3I54A 1HXS1 1NYWA 2R6QA 4JTOA 1RUG2 3VV1A 3AP6A 3MF6A 1FMD3 3WW2A 5IK4A 2ZX2A 5FLIA 2DUPA 2A5ZA 4AQ2A 3SXWA 4XJWA 1DQ1A 4QQPA 4CTEA 4AF9A 1VBE3 1XE7A 2OVUA 2XBO2 1YO8A 4QGMA 4YW2A 4Z07A 1AJOA 4YZ5A 1POV1 3H0OA 4XTMA 1EP0A 1X8MA 2BNOA 4LO4B 5A32B 3K48A 4HN1A 3NV4A 4FXKB 3ZFFC 5E8AA 4HLTA 4B4PA 3PVEA 2GNMA 1LOAA 5I8YA 5SV5A 4N7UA 2K2SA 4LLOA 1OD5A 4JVAA 2A6ZA 4EWAA 3SMHA 4S2GA 3ZXLA 1V6OA 1C8M2 3MIHA 1WW6A 2HEYF 5CBLA 2WWSA 3VBHB 4XBLA 2H0VA 1BVP1 4ATFA 1LB2A 3M7AA 4AEDC 3VL8A 2GNBA 1ASJ2 2BNNA 3OGGA 3EXUA 2YGLA 3ZXGA 3WW4A 4D3WA 5GLTA 4AHWA 1YHFA 1WW4A 1FV3A 3WQ0A 3LCPA 2ZAHA 4M3CA 1HQNA 2FZ2A 3ZMNA 4DY3A 3I2DA 2BWAA 2D97A 1ZX5A 2R071 3P3NA 2ZMNA 1WMEA 4YZ4A 2WQZC 2E9QA 4R9CA 2B5HA 3WP5A 4EN0A 2Z79A 5HCFA 1NCQB 1SFNA 3UKNA 3KCXA 5H9RA 2PQQA 3H1WA 1W6NB 4HKWA 2QZ3A 2OUHA 1Q8PA 4XFFA 3I4IA 1WA4A 2ZGMA 5E1RA 1W6PB 3RSJA 4FAGA 5L7OB 2H0BA 4QQLA 1VBC3 3K51A 1DYKA 1AR73 1HQWA 3R4UA 3W9AA 1BBT2 1RUOA 4K6BA 4Q4V2 3D0SA 4KWLA 5ACA2 1PIV2 2DU1A 4N53A 4A3XA 1S0BA 4AQ6A 1NA1A 2XJUA 3V0AB 4PDWC 1O4TA 2BNMA 4ZU4A 3VBFA 1C4RA 1E57A 3HQXA 3CL1A 1H8TA 2RMU3 2PAMA 1G9FA 3WP6A 4UW4A 2FBEA 2IC1A 3OGJA 3J8F3 1MZ5A 4BE3A 2VQ0A 1ZNPA 4XMAA 2RS12 1G9DA 1TMF1 1LTEA 1CESA 1AR93 2BQPA 3B00A 1K5MC 4LO5B 4BM8A 2DF7A 2XHKA 3C2UA 1DZQA 1LEDA 1EY2A 1R1A3 3U10A 5AFBA 4W65A 2A73B 3PNAA 2IWGB 3ZFEC 3NSTA 2HWB1 1VBA3 1W39A 1RHI2 2ARBA 3CU7A 1ZZ9A 4QM9A 1RUC1 4Q27A 4XFIA 1RMU2 3WOGA 2WT2A 2ZGQA 3TN91 5JOYA 3D6EA 1I9RA 1PNFA 2JE9A 2QFEA 2Q5TA 3HAGA 3WT3A 3AZZA 3JZVA 2WA4A 4PBOA 4XFAA 4MVTA 3KCYA 4YG6A 2ES3A 3WD5A 1BXHA 1V6KA 3WW3A 3N36A 1U0AA 3OYWA 4IEOA 4IV1A 2WNUB 4GULA 1N3QA 1ND3A 4LBLA 4YVWA 1YIFA 2RR11 2WT0A 2D93A 2PELA 2RJLA 2XJSA 3M3EA 1YI9A 4WM8C 1X82A 2JJ6A 4LA2A 3I7DA 3MZHA 2VVDA 3RI9A 4QQOA 1LRHA 3MDPA 4LHNA 1VJ2A 2SBAA 2E7TA 1NXD1 1U12A 4CP0A 4XJ8A 4SLIA 4BMBA 4Z8BA 1PO21 2DFBA 1VBD3 4IEZA 1ZRRA 2FMYA 5K7PA 2JEMA 3DGTA 3VZKA 3M4FA 1V6LA 1GQGA 4QHBA 3SCGA 4MXWA 4XILA 2ET7A 1X33A 4COYA 1EPZA 3O0VA 1REDA 2X53S 2C1FA 4CDUB 1QJX2 5FLHA 4IEWA 2AREA 1IGOA 1QQP3 1DHKB 5LEKA 4Y20A 2TUNA 4RHV2 5K0UB 2IXKA 1LODA 1QOSA 4L99A 4MGZE 3OCPA 3RJ2X 2EXJA 3FUQA 4WVMA 3J9SA 1CAVA 1R092 2HWF2 2VNGA 1ENSA 1VRH2 4RS5A 5C9AA 3VZLA 5JSPA 3VDDC 2TBVA 4P9YA 1JYCA 1JHNA 2X5IA 4XHXA 4YGEA 5DUXA 3B01A 3DKWA 4XTPA 3WDVA 2F4PA 2ZS6B 4QPGC 4MGYE 1ZM1A 1RUJ3 4K9SA 1S0JA 1D4M3 1LOFC 2QJVA 3WLUA 1SLCA 4LUMA 4BYYA 1AUYA 4COZA 2JECA 4EJRA 4ZXKA 2DYCA 5JIUA 4FTSA 2BYVE 1QJU3 3KT1A 3JUUA 2LTNA 5JDBA 4Y1XA 1MQTA 1S0EA 4GXLA 4FOVA 4AGVA 5GLZA 3SCFA 2HWC1 3QBQA 3ZFFA 3ZDSA 1VBB3 1PGSA 2CGNA 1Z0HA 4FPKA 4PIZA 2Z69A 2BW8A 2EF6A 4F7ZA 3AJZA 1H4GA 2GU9A 3QCWA 3V65A 5HBAA 3SITA 1TE1B 4MGKE 5CA6A 2BEOA 3LB9A 3DPRB 3MICA 5DUWA 2HWE2 2UU8A 2ZAAA 2WFF3 1BMV1 1BEV3 4RGGA 1CX4A 1MS0A 1PNGA 3R4SA 1KQRA 1PMIA 4AFBA 2WZR3 4RGAA 1D0GA 2ARXA 1RUE1 4OVEA 4QM8A 3IDCB 3WQ7A 1ND2C 2D3SA 1LECA 1LOBA 3LZZA 1YFYA 1SBDA 3UKTA 1O3TA 1KXGA 2Z42A 4YNIA 4XJ9A 1IHMA 1AYM1 1F5FA 4XIOA 4B29A 1R1ZA 1RL3A 2CWMA 2NM1A 3E5UA 4KWKA 2RJKA 2WNVC 2VOWA 2VULA 3PJQA 4I0AA 4HETA 1J59A 3G7DA 2DCYA 4LO6B 1PZ7A 2VW2A 1SMVA 2VMIA 2VW0A 4LLFA 1Z7S1 1DLLA 2ZX0A 1RUI1 3PHMA 3LA7A 1H9WA 3KLSA 3B3QE 1JH5A 3NJZA 4EV0A 1TNRA 1KD7A 5JIAA 2TEPA 4GB31 1RUH2 1S1AA 4DNYA 3AMQA 2PLV3 4PLOA 2XWBB 4PLNA 4Q8LA 1CAWA 1G9CA 4PDWA 4E4SA 4Q1RA 2D6PA 1CVNA 3D4KA 1AYN2 5FDBA 5IK8A 4GMP3 2R0FA 3AYAA 4BMEA 3ZXAC 1PVC1 1DF0A 1EV12 5L36A 1IS3A 5DZEA 1QHDA 2WS91 4M3CF 4ZU5A 3A0KA 4AQTA 4N43C 2PHXA 1H2NA 1FMD2 1K5MA 5BNQA 2WKKA 3ZYRA 5BUVA 1G86A 1QH6A 1VBE2 3GBFA 2W68A 3AZWA 1GV9A 4AHZA 1PGW1 4E4ZA 3ZFEA 4HVQA 1ZBA1 2ZCWA 1IPKA 3FZ3A 3D82A 5B2GB 5JCTA 3ZXJA 5CG8A 2QDRA 1POV3 2D3RA 3ACLA 1MVQA 1KJRA 1OOPB 3V56A 2CAUA 3LOBA 1O3QA 2BFUL 2JD4A 3VUOA 4U2AA 1WCKA 4HPKB 1ONAA 2YROA 3FE5A 5FO7B 2D6OX 5JAXA 2VU9A 4Y1ZA 3KGLA 3ZVXA 4WM8A 2Q8OA 4M0HA 4KH9A 2GC1A 1HX6A 2VOVA 2AENA 3USUB 2GMPA 4DMIA 2D6KA 1BVVA 3MIGA 3TWIA 3ZYJB 1QNWA 3AKPA 2OZ6A 3NV2A 2YXSA 3S6PA 4IXLA 4HL0A 4OUSA 3ZN5A 4YM2A 1LOEA 2GC3A 1PGL1 1ZZBA 1J1LA 4CEYC 2FQPA 1YJLA 1C5HA 5CU1A 1DFQA 1PHMA 4CEWB 2R073 1NCRB 4FPFA 2VNOA 3MYXA 2G4IA 4DINB 5BPXA 1VBC2 4YGDA 1N3OA 3HMYA 2GSYA 2XJTA 1H30A 2DV9A 3WG2A 3ZN6B 1HKDA 3SH3A 3MW4A 2EXKA 1W6MB 2GMMA 3WHTA 5BNNB 3B7MA 4LO7A 3BCWA 1WLWA 3N35A 2RMU2 1NY72 3O0WA 5DDJ3 3QLQA 1HRV1 2V5YA 3N3HA 3J8F2 4L8QA 1DDLA 3VDDA 1FATA 1COV2 4KGQA 2I74A 4QPGA 1UF2C 4K40A 4LE4A 1S0FA 4CDXB 4DRRA 1LOFA 3JQWA 3RNSA 5DUVA 1R1A2 3OBRA 3VBHC 2E51A 2VOKA 1KFXL 4BCUA 1ULDA 3UV9A 4YRDA 2B39A 1TMF3 5ABJB 2NZ9A 3WDTA 2K0GA 5EV7A 1AZDA 3USSA 1VBA2 4L2NA 1I1EA 1XNKA 4BQ1A 1M4WA 4IEXA 5EJ3A 3ES4A 1J58A 2I07B 1G8WA 2MEV1 1OFNA 2ZMLA 1GICA 1DGLA 4RL7A 1XRUA 1U5ZA 2B45X 2G9FA 2HWB3 2GNDA 2B9UA 1SFYA 2VVEA 3NV3A 4DQAA 5KBFA 3POWA 3RQ0A 3D0JA 1I6XA 2CV6A 1RVF1 4ORFA 1W0PA 2DUQA 3CJIB 1NCQC 3TN93 5CFCB 2QCSB 3MIEA 2B7YA 4WVWA 4WM7C 4LHKA 2P17A 2XJRA 3I59A 4ISRA 4D7TA 4NWWA 1RUNA 1D2QA 4HSJA 1Q8SA 4BLJA 1OPOA 5D8AC 3VZJA 1A3KA 1Q43A 4B7EA 2ZHLA 3CLPA 4AFMA 1X36A 1VLNA 4NHLA 5BV6A 1U5XA 3SLIA 2RR13 1QWRA 2GN7A 1WD3A 1ND2A 2EXHA 4N9HA 3WP3A 3BOPA 5J37A 2H6BA 2HWD3 3B69A 3HN1A 3B02A 2DVFA 1FOD1 2R043 2RM21 4XF3A 3X29B 4S2DA 2B42B 3UJOA 1W2UA 2WNEA 2EALA 2RS51 4KBBA 2CTVA 1XYPA 2C5DA 3ZYIB 2WNVA 1V70A 5FBZA 5HI0A 1PO23 4PF5A 3ZSKA 2DFCA 4GMP0 2W08A 5FO8B 1YWKA 1ENRA 1QQP2 4N43B 3NL1A 3WG3A 2X8KA 4G4FA 3AMNA 4AWDA 1GLHA 1QXPA 3FC0A 3GHNA 3M8LA 1RJ8A 2CNAA 4PQ9A 1FNZA 1V6NA 1XE8A 2PA7A 4YW5A 3H8UA 4FPGA 5AFEA 1AXYA 1WCDJ 1IOAA 1RUG1 3KT7A 2QDNA 1A8DA 2PAEA 2PFWA 1XYOA 3M1HA 4BOWA 1TNFA 4I09A 1T6GC 4M0NA 1D4M2 2X29A 2WNUC 1OQEA 1POV0 1HDKA 2WIIB 2XBO1 3ZIXA 5J09A 1LGCA 4FXGB 5SV8A 1ULCA 4JGZB 4Q26A 1RB8G 3L2YA 1QJU2 1F9KA 3NW4A 1C8NA 4OUMA 3FJSA 4LUKA 2ZBJA 3MF9A 4URTA 3EBRA 2QVSB 1GZWB 4LBJA 4NVPA 4NOTA 2WL1A 1SLLA 1VBB2 2ZGOA 3NAPC 3GBWA 1XYNA 5CIRA 2UYAA 3KGZA 5JSOA 4AVCA 3DF0A 1M06G 3KD4A 1ZVFA 4A7ZA 4XBQA 4KNCA 1ULEA 2XL7A 1UAIA 5KXEA 3AKTA 1SQ4A 5EZWA 4CEYB 1H2KA 2WFF2 1FAYA 1ASJ1 2A3YA 2DTWA 1BEV2 1GBGA 4IV3B 4XXPA 4CDQA 4DOUA 3KQRA 4KU7A 4XE9A 5IK5A 4Y1VA 2WC2A 2WZR2 3IPVA 2P2KA 1W6QA 1RUD2 1ZBE1 5K0UC 1KDKA 1RC6A 5JR7B 4Q4X3 2QUOA 3MIFA 4G3YC 4N9IA 1N1SA 2XLAA 4W6XA 1S2KA 4JGYA 1RINA 5FQ0A 3AKSA 5AC93 1TEIA 1CJPA 1MEC3 1PVXA 5GLUA 4GQ7A 3HD8B 2DCJA 2GDFA 2I45A 3IDBB 2ZHNA 4AEMA 1XNBA 1MZ6A 3FLRA 2Q1ZB 4PCRA 4LNVA 1F8VA 1Y3TA 1Y9QA 3O14A 1QH7A 1AYM3 3BOWA 3MFCA 4FO9A 1LJ7A 1GNHA 1BBT1 1ZRDA 3S7EA 4B4RA 4LA3A 3VZNA 4Q4V1 1NQJA 1KS4A 1PIV1 3VBOB 2VOXA 3PVOA 1JXNA 3ETQA 4QMAA 3H3ZA 1ULGA 1Q56A 1Z7S3 1SEFA 4Q4W3 5DG2A 5A32A 4EN9B 4YG0A 1GQHA 2EVXA 4HFSA 1VAVA 1GZCA 1CAUB 3GHMA 4FAHA 1QXJA 3AP7A 1VP6A 1UMZA 4NPRA 2RS11 1J3RA 3ME2A 2Y0IA 3ZSLA 4YVSB 1LKNA 3DPRC 2H6CA 1JUHA 4X8NA 1WLDA 3FFQA 4WVVA 3VBHA 3J26N 1APNA 4WM7B 1FX5A 3ES1A 5FAXA 2R063 2NPIA 3WVJA 1QNYA 3AFGA 1RHI1 4G9SB 4J1XA 5KXDA 2ETEA 4JTNA 5K8SA 1SCRA 2ZPXA 5D8AB 5EYYA 1RMU1 4S2HA 1OHFA 4QQ2A 1ZA4A 2YYOA 4FPHA 1KITA 1DQ0A 1AX1A 3VBSB 1ZBA3 2CYFA 5F5QA 4WZFA 3H50A 3RZZA 2XVKA 4LR4A 1NCQA 4H3WA 1W6NA 2KXLA 1QXRA 4XJUA 4R8HA 4FCAA 1YLLA 4CYDA 1W6PA 1UU6A 5L7OA 4YFZA 3R4DB 1OSGA 5TSWA 1NG0A 4E27A 5LEJA 4KG0A 3B93A 3T2TA 3H3UA 3N7LA 5JOWA 1AX0A 2A7AA 5JLVA 4S2FA 3V0AA 3VHOA 2CWSA 2E6VA 2EIGA 1Y7BA 1CIWA 1LU1A 3QH7A 3U0ZA 1JYIA 1IS5A 1OI6A 1PZ9A 2ZGSA 4A2UA 4E2QA 3DN7A 1QJX1 1DQ2A 1ZRCA 3AM2A 2NLRA 2WFPA 2YDEA 3SNMA 1SDWA 4E2SA 5CFDB 4RHV1 3WG4A 1KRIA 2XB6C 5I8SA 3OY8B 4XEZA 2YGMA 1V00A 4BIFA 4M01A 2DVBA 3ZYPA 3PTYA 1W6OB 4PJYA 1R091 4AGRA 3O0XA 2QKDA 3NO8A 3CO2A 4ES8A 1VR3A 1VRH1 1V9U3 4QPYA 2JG8B 4I0WB 2KM2A 2PHRA 1AR81 1KS5A 4HBNA 3FX3A 5BY5A 3GZAA 3E6CC 5DDJ2 2UWAA 3WUCA 1WW7A 2MPFA 4LBQD 3WR0A 3NAPB 3FFZA 1A78A 1OOPC 2DVGA 2PHDA 3GBGA 4ZKTB 4IQPA 4AG4A 2HYKA 3MEPA 4LBOA 4NHMA 2WNUA 1HRV3 3EJKA 5LRSA 3U07A 3AZYA 1G9AA 2WSVA 4R9AA 1FYUA 1EPWA 3NV1A 1HRI3 3ZXEA 4JAAA 4Y22B 4XQWA 2DCKA 1LHUA 1TMF2 2CGOA 4JDNA 2DVAA 3GNEA 1WLCA 4IEQA 1UPIA 1G6NA 2NMOA 1U5YA 2JKBA 4LE3A 5F9TA 1QU0A 3E6BA 3AKRA 4BH9A 4Q4Y3 5A3MA 3WP4A 1QMJA 2PHFA 2PN5A 1EAH3 4Y1YA 2ZGLA 5BNPC 3RWNA 2Y0OA 4L97A 2HWE1 4JRLA 2P3JA 2XGXA 4QGNA 2NP0A 1TME3 3BIWE 2CGPA 4I3GA 4CDUA 4CEWC 4AHXA 1RGSA 2ZZJA 1NCRC 4XF0A 2HEWF 4OLLA 1PO13 1RVF3 2ZGKA 3AZVA 4NWVA 3RRDA 4H14A 4IL7A 5K0UA 4XBNA 4FBFA 2RR12 4LBQB 4RR3B 3JBG3 2Y26A 2HWD2 3TOJA 4W6WA 5BNNC 3WCSA 2R042 1NLRA 4IETA 3UJQA 2C0ZA 2BVBA 3TNQA 2D6LX 3OTFA 4XFGA 5DUUA 3HWJA 1DQ4A 4ATEA 2WZPP 4AVBA 2A71A 1FOD3 1XXNA 2RM23 2ZJCA 3VHNA 1AL21 4YARA 4OHZA 4CDXC 1RUH1 2RS53 4OHWA 4KWJA 5FRAA 4AE2A 5A33B 2OUJA 5I93A 4LEJA 1CGPA 5FOBB 3H1YA 4UBGA 3THTA 1O4ZA 4LT5A 2B46X 4IERA 5ABJC 5FCCA 5JWPA 1UW8A 4AEDA 1AYN1 4FTBA 2D43A 2E53A 1Y43B 5GZEA 1QDCA 2XH6A 3QD6A 2XUMA 5FTTC 1AR63 1H8VA 3CJIC 3POYA 5CFCC 3DPRA 3LA3A 3BALA 5LRRA 1GZ9A 1VBE1 3VBUB 1RUG3 1UPSA 1SLTA 4PLMA 4DZGA 3BPZA 4BLIA 5JPNB 4H7LA 4K7JA 1AXZA 2MHFA 3M2MA 3JD73 4RD7A 4HN0A 3WDXA 4XFCA 5CVRA 5IT6A 1MR5A 2XBO3 5H9PA 3EHKA 5T52A 5KC5A 5KHGA 2WINB 3VZMA 4YZ1A 3WW1A 4EWEA 5K9YA 1IS4A 4F83A 3TYJA 4E9KA 1B35B 4HK9A 1U5IA 4CDWC 4MV2A 1KDMA 4XIKA 3LA2A 3OF1A 4QGLA 2D5HA 4D7SA 1X7NA 1RUF1 4UXAA 4IEYA 3ZFGB 2E63A 5FOJB 4XOGA 4MH0E 4MXVA 1UKRA 4X6RB 1B09A 1DZRA 4Q4X2 5FFOC 3WINE 1MS1A 1ASJ3 3H7JA 2W39A 1HXS3 2ZOEB 2BTVC 3ZX7A 1AF9A 3TAYA 2O1QA 4F3JA 1ZBE3 1XQNA 5AC92 3VHPA 2B8MA 1MEC2 3HBZA 4QQHA 2YY1A 4WBBA 3O5SA 4KQ7A 4QXKA 5C6CA 4M00A 3RPQA 4AI8A 1BKZA 2OYZA 2WSUA 2GH8A 3PVBB 5HCBA 2DCZA 5I0TA 5C8CB 2XVGA 4R9BA 3RYRA 4GH4B 4HT1T 1MS9A 5J48A 3UKVA 4JGZC 2R32A 2VY0A 2DUOA 3VKNA 1Z7S2 3KZ4C 4GALA 4Q4W2 5BNOB 1PK6B 3SHRA 1NY71 3M3OA 2IZWA 2WQ4A 1WD4A 3GF6A 1COV1 4A7YA 1DBNA 1SLBA 2GC0A 3S7IA 2IFRA 2JICA 5JOZA 1CD3G 4YGBA 1OOPA 2QE3A 4BPZA 4I2OA 3FWEA 4JRAA 2O0OA 1WW5A 2ZHKA 5J3UA 4FPJA 1S0IA 5BNPB 2PHUA 4HPKA 2RS13 3APBA 5JZGB 5J96B