2WL1A

Pyrin pryspry domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
191
structure length
191
Chain Sequence
NVPELIGAQAHAVNVILDAETAYPNLIFSDDLKSVRLGNKWERLPDGPQRFDSCIIVLGSPSFLSGRRYWEVEVGDKTAWILGACKTSISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGIFVDYRVGSISFYNVTARSHIYTFASCSFSGPLQPIFSPGTRDGGKNTAPLTICPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PYRIN
publication title The Crystal Structure of Human Pyrin B30.2 Domain: Implications for Mutations Associated with Familial Mediterranean Fever.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2009-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
A PF13765 PRY SPRY-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wl1A00
2FBEA 4V1PA 5JI9A 2WL1A 2E63A 5JIAA 2IWGB 5C33A 3TOJA 4P9IA 3UV9A 2VOKA 5JI7A 4QT6A 4X8PA 4N7UA 4P9LA 4XW3A 4KG0A 5F6KA 2YUEA 2YYOA 5F6LB 3KB5A 4P9JA 4X8NA 2LM3A 4B3NA 4WVMB 4WVMA 3ZO0B 5JIUA 4N7IA 4B8EA
chains in the Genus database with same CATH superfamily
3KT1A 2ATFA 2VGDA 4FCAA 3CBNA 5BNNA 4SLIA 5FPVA 3VD3A 2BOIA 2V09A 5JVVA 5CIRA 4K20A 3OGJA 4TXWA 4ZY9A 4EWEA 1RJ8A 4AQ6A 2WYSA 4IEVA 4WVZA 2VUDA 4A2UA 3HT1A 1WLWA 3POGA 1WA6X 3AKPA 2XLGA 4PF5A 1WWYA 2PTMA 2Z5WA 1RHI1 1AR63 1YHFA 4WZFA 4ZS3A 5FKBA 1PO23 2GC3A 3IAQA 1ACCA 2UWAA 3DPRC 2J7MA 1AR73 1Q5OA 5T5PA 3ROUA 3WCRA 2D6LX 4Q1RA 1V9U2 3NMBA 4BHPA 1L7RA 1W90A 4BLJA 2MHFA 4E2QA 2NM1A 1UKRA 1R1A1 1Z0HA 1RJ7A 5JXJA 1PZ8A 2D6MA 4HSJA 3UKNA 3RZGA 1BMV2 2E51A 1BBT3 2FHRA 1UX7A 4YW2A 4Z1VA 1UZWA 4BYYA 1OVPA 5JPMB 1NCQC 5AFBA 2OXBA 5FYVA 1MPXA 4CDWB 1UMIA 2VVFA 4IEUA 4CTEA 3WX5A 1A6CA 1J3PA 5FY7A 1K5MB 1VBD3 1FMD1 1DIWA 3M7AA 2Z79A 1JS9A 1S0IA 2VVEA 1AL0G 4FTSA 3BALA 4NHMA 3VBOB 4NHYA 5JZGA 1VMJA 2W1QA 4YFWA 2VMCA 3IPVB 1V6MA 2UURA 3RZKA 4LMFA 1SDDB 2WQZC 3IMMA 2Q0AA 4CSWA 2Z42A 1J58A 1G9DA 1YQ6A 4LQRA 1KFUL 4YZ1A 3GZAA 1S0EA 3R05A 4HBNA 4IESA 1JZ5A 2E32A 1TZOA 4LIUA 4QQOA 4CCKA 3KQRA 2AGSA 4E27A 4AI1A 1N3PA 2BPA2 1D2SA 3ZXAC 1D4VB 4AXOA 2AZ5A 4Q0VA 3BB6A 2DUOA 4AGRA 3RVHA 4CYDA 1W2AX 1PZ7A 2W47A 5FZ3A 5LY2A 1OH4A 1QDCA 1W9TA 3LZZA 4JKLA 1RTVA 3DV8A 2XH6A 3KV5A 3VZJA 2ARBA 4MHRA 1ULFA 1NOVA 1H8TC 2OVUA 4LKFA 1YCIA 4QPGC 2FCTA 3ZSLA 1ZRRA 4UXAA 1NCRB 1ODMA 1RMU3 1QJFA 3ZFGB 4XDPA 4UFLA 1ND2B 4JDNA 4RL7A 2VNOA 3VZMA 1LOFC 1OQDA 5BPXA 2VMDA 2IC1A 1JYXA 4MX3A 3USSA 1GZCA 4ZXEA 4PDWC 1LTEA 4OFGA 3MICA 2Z69A 2A71A 2EALA 3MEPA 1PNGA 3OB8A 4K1ZA 4XJWA 4ZPIA 3VBHC 5KR7A 2P3IA 4LITA 4LHSA 5C3QA 1GUIA 1BLZA 3C7HA 2BDRA 2DVFA 4CEYC 1KDMA 4AGVA 5FQ0B 1RUJ2 2RDSA 3GHMA 1CZSA 4M01A 3AC0A 2W08A 3AP4A 2WRAA 5DAXA 2WC2A 3CHXA 2O14A 3VKOA 5FO9B 2YFUA 4BQ1A 5E1RA 1I1EA 3PJYA 4EWAA 3AMMA 2QUOA 1IG0A 3O1MA 1IZ3A 2EA7A 3GZUC 2LUWA 3MIGA 1MZ6A 3NSTA 2JDYA 4GWJA 1HRI1 4Q27A 3WINE 4QPWA 4TZDA 4AVTA 1CIYA 3N7KA 4D6QA 2I07B 3ZN6B 1OXCA 1RVF3 4F8AA 1VBB2 4Y4RA 1J1LA 4N9IA 1AR72 2D7FA 4PI0A 1Y7BA 3ETPA 4ASMB 2FDKA 4HANA 4FPEA 1NCQA 5J98B 2YBKA 5C8WA 1DGLA 4F3JA 3BIWE 1YYNA 1IS4A 3I3BA 4CE8A 2VZUA 3BPZA 4UBHA 2PLV2 2BGCA 1PVXA 1BBT2 3WF1A 4IEXA 1VB2A 2ARAA 3IM0A 1NG0A 3NJZA 2RS13 1W28A 3P3PA 4XZUG 1XJAA 4LHKA 4SBVA 1LR5A 5EJZB 4XFBA 3PIJA 1MQTC 1DGWX 1QU0A 1MACA 4M4PA 4FFHA 2JB8A 4IEPA 5FZ8A 4LNVA 1LU2A 2Y6KA 1GP5A 1PGSA 2ZZQA 4D7TA 2WT2A 1GKBA 3UV9A 5HCHA 5FREA 5A7WA 1Z7S2 1R1A3 3SITA 1SG3A 4YFZA 5JSPA 4BH9A 5FYYA 1J3RA 2ZGLA 1O4YA 3B9CA 3J7MA 4R8HA 1EP0A 1LODA 2DU0A 3IAPA 1POQA 1S0FA 3D6EA 4S2HA 4FFGA 3WF2A 1F9KA 5FYBA 4JRAA 2VNGA 1H8TA 3GF6A 1FMD3 2GNTA 3BU0A 1T2XA 3THPA 3D0SA 4K6BA 4XURA 2WR9A 4TYSA 3WQBA 2ORZA 3OJBA 4XFCA 4L2NA 1UYPA 4PIYA 2DTYA 3OBTA 4ET7A 3B9IA 4P08A 1LOFA 4LO6B 4UOJA 3VDDC 4AR2A 4DEQA 3I3DA 4XABA 3NJYA 2VG9A 2PHDA 3LEIA 1SFPA 1W8HA 2XG3A 5EJ1B 5FJHA 2A5ZA 2JDPA 5FUIA 3CU7A 4FTEA 3RQ0A 1O3QA 4KI5M 1VBA2 1RMU2 2FDJA 3AL5A 3NW4A 3HEIA 3ZPYA 1NQDA 2DWRA 4NWWA 3AFKA 2O0OA 2Y0IA 4XMAA 4CEYA 5KHGA 4XFAA 5BUVA 1UPIA 5FZKA 2BW8A 1FI2A 2GMPA 4GALA 1QOOA 3RMXA 4CZSA 2ZX1A 2VMGA 4AG4A 5C71A 3ZYJB 1TQ5A 4AVSA 1ENQA 1O5LA 1RUF2 3J7HA 4HETA 2WZ8A 1VBE2 2BP6A 2ZABA 2WBKA 2H6CA 3EHKA 3OF1A 1A34A 4NJ4A 1H8VA 1TE1B 2QQUA 3USUB 1QJU1 2VECA 3PHMA 4BWOA 1GQHA 3KZ4C 5L9RA 3THDA 1MZEA 2BBVA 3VBRC 1C5IA 1WW7A 4OVEA 5FPAA 1V6OA 5IJRA 1DQ2A 3E5XA 1JU4A 3MHZA 1O59A 2W1SA 4FP2A 3N4MA 2IXHA 2ZGNA 1QOSA 3PMSA 4DY5A 3MW2A 5F6LB 2XJRA 2HWD1 3O1UA 1WD4A 1KEXA 1RITA 1V00A 2BEOA 2TEPA 4NIHA 2HWB1 3AMHA 3VZKA 1U5ZA 1ONAA 3JXSA 5G05L 3DKWA 1EV11 5EV7A 3KF3A 1RVF2 1XE8A 3I54A 2XMLA 5DZEA 5CG8A 2C4XA 3JCIA 4RYDA 5JI9A 2XR4A 4ARXA 4PQ9A 2GP3A 1H6XA 4YLZA 2JEMA 1WCUA 4Q4Y3 4AHXA 3M3IA 4XFIA 1W8NA 5FZOA 2PFWA 1CAUA 3G7DA 3LSDA 4JDMA 2BV4A 4FP3A 2VZQA 4AEDB 2VULA 3UJOA 1UOBA 3VL8A 1BXHA 2ZPXA 3AXDA 1CAXB 2RS12 4XILA 3RYKA 3N9LA 1OOPC 4O61A 4QX8A 1HRI3 1XQNA 3N9MA 3T3YA 1G9CA 5E16A 5EPAA 1JODA 2Q8CA 4TN7A 5L7OC 2D3RA 2DDUA 4PBOA 3CJXA 4I0BA 3A21A 4LO4B 3ABZA 2XPJA 2H0VA 1OF3A 2WT1A 4CU7A 3VL9A 3ZOIA 4GULA 4ZU5A 1W8FA 3I2IA 2QTWB 1QIQA 3I3MA 1SPPA 4O9EA 4ZONA 2OT7A 5T5LA 4MGKE 2WLQA 2VCBA 2Q1MA 3AZYA 5IVJA 5FYTA 1N3QA 4XIKA 1GQPA 3MFCA 4CCMA 1NLQA 2YHJA 3H7YA 3PUAA 3VDDA 4M00A 4N7UA 5LA0A 1OFNA 1ZX5A 3NV1A 1ULCA 3KVBA 5GJ6A 2Y6LA 3E5UA 2KA3A 5LA2A 4JDOA 3RSJA 4YGCA 2VVDA 1FOD1 4P9JA 1CZVA 1HB2A 2IXLA 4RHV1 2FCVA 4Y20B 3AVRA 5F5AA 2JG8A 1O3RA 4GWNA 3VN4A 1FATA 2QVSB 1XBFA 2R061 5FZ7A 4DY3A 4AQSA 2XVKA 3A0NA 3AJZA 4V1PA 4XFHA 2EF6A 3J9SA 3OBZA 1W99A 3LIHA 1XNAA 2NN8A 5GM0A 1J84A 3T2TA 3ACLA 1ULEA 1W8WA 4NN0A 2VH9A 4PT6A 4A6SA 5FXZA 5J09A 2JB4A 2E26A 3MIFA 3KGLA 4QXKA 3WQ7A 3W58A 1CESA 1D4M1 1FX5A 1XU1A 1IPSA 3M2MA 3ZDVA 3H1YA 2BQPA 4YM2A 3ZMOA 1WW6A 5BV6A 4ATEA 4MO3M 5C7GA 4JC1A 3VBRA 1LRHA 1J3QA 4FOVA 2JDKA 5JOYA 1QJY3 3BTZA 4DXTA 4CCJA 5HCAA 4WM8C 1DZRA 1UF2C 5FIXA 1VAMA 1DQ5A 2ADDA 3ACFA 4B8EA 1V6IA 2ZZJA 1NT0A 3I3EA 3SH4A 5K4LA 5IHRA 1OLME 3K4DA 4QB2A 2VBPA 2W5FA 2ET7A 4XFFA 1PGW1 5CVRA 2DVAA 1WLTA 2JXAA 4XF1A 5F1RA 2XJUA 4H14A 1GOFA 2A75A 4CPBD 1HRV1 5JWPA 4NRMA 5JXGA 2XKPA 4O7XA 3WW2A 3I2DA 3HNBM 3WDWA 4GB31 4O9GA 1CX1A 4YGDA 4AOCA 4Y33A 4COWA 4XVHA 4UI9L 2IVJA 4CDQC 5BY5A 2YU2A 3NNFA 4K8FA 2VPVA 2XJVA 3N36A 4LBMA 4QQPA 1RINA 5FYZA 1QJU3 2ZJCA 1XNBA 2HWF1 4Q5OA 1QWRA 2EVXA 5B4NA 1G9BA 1JBCA 1VR3A 2MPFA 3E5QA 3OY8B 4Y5TA 3O7OA 3B94A 4QKFA 3W20A 1D2QA 2QDNA 4OHXA 2WWJA 5L7OA 5I93A 1AJOA 3KV9A 1W6NA 2WN3A 1GP6A 1W04A 3H42B 3SCHA 2RV9A 1K45A 3WD5A 3ZSMA 5C5UA 4N53C 1AR81 1SLCA 3S0MA 1JOBA 1HJFA 5FJKA 1AF9A 2HWB3 5EYYA 2GDFA 3M8LA 1MZ5A 4KQ7A 1H0BA 1NUKA 1AYM2 3JQWA 4BQ3A 4Y1VA 3SMHA 3ZYPA 2O8OA 2RVAA 4RR3C 4HFSA 4KU8A 1GWKA 1KFXL 3VLBB 4XJAA 2WO1A 3BCWA 3S7IA 2NP0A 3KD4A 3CZJA 3FFQA 4LJHA 1CPNA 4DRRA 4BZ4A 1N3OA 2WFF3 2VO5A 5FP9A 5D8AB 2W94A 4RGGA 2KM2A 4YVWB 4FO9A 5L9VA 1JHNA 3J8F3 5GZFA 1C8M3 3TYJA 2P5BA 4IGOA 4GA9A 4QGMA 2C1FA 1SPPB 3KCCA 2EIGA 2WZR1 5GLTA 4HKOA 4QPYA 1CVNA 4FQZA 1AUYA 2VL4A 2AACA 4R4ZA 2Y8KA 3H3ZA 3I59A 4IXLA 1F4AA 4XIOA 3FBMA 3VDDB 4BK5A 4ZZ8A 4PF1A 1SFNA 1S2EA 1S0GA 1RUD1 5JR7B 4JKMA 5F32A 5FZ4A 4D8MA 4M3CE 1UNBA 2AEYA 2ZGSA 4H55A 1BKZA 4CDXC 5JAXA 4UW6A 3MIEA 4INDA 1FPN1 4UFIA 1AVBA 3VKMA 2JG8B 1UY3A 2ZGQA 1ND3C 4CUBA 4AFBA 3VZLA 3CLPA 2ERFA 3CQOA 3F2ZA 3WW1A 1UQXA 3WNPA 4AFDA 3WXPA 2HWC3 2XVLA 1VRH3 4PI2A 1LGCA 3H8OA 2VNVA 4OYUA 4LE3A 1G86A 3LCPA 4EROA 2RDNA 4E9KA 1FOD3 3Q8EA 4JRLA 4RHV3 4Y1UA 1XSRA 2OZ6A 3ZN5A 1LENA 2R063 3LFMA 4XF3A 3FWEA 1QJY2 3TRSB 4BJ0A 5CKMA 1J83A 4YW5A 3RRDA 4YPJA 4PLOA 4BCUA 4BLIA 3B93A 2D44A 4CDQA 2Y6GA 3QH7A 3UETA 1TNRA 5GLUA 1W6QA 4QM9A 2G9GA 2ZHNA 1D4M3 3MPBA 4WVWA 3TN92 4JGYA 4Q4W2 3L9JT 4IERA 1HB4A 5FP8A 5KBFA 3O0VA 4ONUA 2A3YA 3QCWA 1YWKA 2P17A 1WMDA 1YNAA 4AI2A 4L0PA 4DINB 2NMNA 4LK7A 2YC4A 5FMBA 3DF0A 3BODA 4ORFA 5DG1A 4RD7A 2ADEA 3POJA 5FOBB 1C1LA 4NE9A 2W0XA 3WNOA 4N53A 2ZGRA 5HCFA 4C1WA 1WCDJ 3RZJA 1UW8A 1QJEA 3GNEA 3OTFA 2PHRA 1B35C 3BGAA 1OUSA 4KBBA 3IDEA 4RR3A 1LHOA 1JMUB 5EFUA 3UGFA 3ZFEC 2OZJA 3EXUA 4XUQA 3WG3A 2W68A 4GB33 5JR2A 4D69A 2Z2SB 5ABJB 3T0DA 2XWBB 3UK9A 4YGEA 4E8DA 5KWRA 2P4EA 4QX7A 3U1XA 4LT5A 1JOPA 5J7MA 2VTXA 2HWF3 1ZZ9A 2W39A 5FY1A 4Q1PA 3KCXA 3V0AA 4HVRA 3NAPC 5C3RA 1NAEA 4AF9A 4UFKA 3HBKA 3CKHA 1HB1A 2WFF2 3I2FA 4KL1A 2P34A 3K48A 3J8F2 1C8M2 1XB9A 3ZPOA 3POIA 5FZBA 1AR83 3WDTA 3RNSA 3VDCA 1RB8G 4XMIA 5JMOA 5IK5A 3ACGA 5C6CA 1TME2 4YW6A 3HIFA 1NE4A 4D3WA 1POV1 2ZMKA 1ND3A 3PVNA 3T0AA 4AI3A 4LXLA 5J96B 2FDHA 1V6LA 2A6VA 3PTYA 1L7LA 4CEWB 1OQ1A 2K2SA 1UAIA 5GZDA 4XCAA 2VUJA 1UIJA 3AMPA 3IIAA 4MZUA 5CKQA 1DZTA 2Y33A 5LEJA 2RE9A 4Z92B 1UX6A 1VAVA 4DUWA 3TEYA 1M06G 3I2JA 2OA2A 3SHRA 2MEV1 4O65A 2HWC2 4XEZA 1VRH2 2Q1ZB 1JH5A 4BDVB 3SQOA 1PVC2 4NHLA 1OLMA 5ACA1 1F4HA 4L99A 2XLFA 4KU7A 3BTYA 1ZM1A 3B69A 1U5XA 3RZZA 5FKCA 1WMXA 2L9LA 2X5IB 2VTXJ 3HPNA 3HQRA 4QQLA 1SEFA 2W1WA 3DXUA 1BEV1 5DDJ1 3EB7A 3LGRA 1YIPA 4FOWA 4XJ9A 3C7EA 3O1TA 5FP3A 1H2MA 3MI8A 2JG9B 4X6RB 2X29A 3AKSA 5C9AC 5DMYA 3WG4A 5IW0A 3FLRA 3GALA 4YVSA 3VBUC 4XYXA 5FYMA 1XYPA 2OPKA 2BZDA 2QQLA 4CDQB 1W6MA 1CAVA 5CKNA 1WLCA 2PHFA 3T30A 1W6QB 1B35A 2C24A 2JENA 5EXOA 3ZSKA 4R9CA 4JGYB 2XUMA 1U12A 3QH6A 1O7FA 4UF0B 3ZFEA 1MS8A 1PZ9A 1ZZCA 3S7EA 2VTFA 3PL0A 3MF6A 3H8RA 1J59A 3AZWA 4AK3A 2RJKA 3RWKX 3T1MA 1OD5A 1SBFA 3MO4A 2VW1A 4JHTA 2BNNA 5FUNA 1WD3A 4CDUC 4FFIA 2P6HA 1RUI1 4XTMA 4NIAA 1I5PA 5IK7A 5IVVA 4AVCA 3AX4A 4CCOA 1OA3A 4IDZA 2FMYA 2AENA 2PHXA 3JZVA 4AE2A 2FBEA 2CV6A 1PMHX 1KITA 1NQJA 2VOTA 2FZ2A 1F31A 3JD72 4HKLA 1MS3A 1N1YA 4QKDA 5JPNB 3ZYFA 4KH9A 5JXIA 1S2BA 3MLJA 5EZWA 5C3PA 1W6OA 1G9AA 4ASLA 3RJ2X 2P1BA 4M3CA 2HEWF 2ZGKA 4AZZA 2VUAA 4DUXA 3NNMA 1COV3 1GZWA 2BNMA 4HPKA 2QQNA 2YXSA 3WP3A 2D5FA 3OD0A 5GZCA 4WM7C 1M4WA 1OA2A 1RUF1 3NL1A 3TEXA 4TSVA 5J37A 4RS5A 1W8OA 2K9ZA 3HOBA 2QQIA 1SCSA 1PM4A 1F2NA 4PIXA 1FAYA 3HNYM 4HK8A 5I8TA 5FZ6A 1PGL1 3I49A 2Q1FA 3CNAA 1ND3B 3KF5A 1OF4A 3MIHA 4G4FA 4L92A 2JD9A 2B46X 3I3QA 5AC91 3D5OA 4IGPA 2YFZA 3O1SA 4R4XA 3W9AA 3WF4A 1A8MA 2E33A 4A44A 1R083 1UOGA 2K0GA 3OPWA 2A3XA 3ECQA 4META 4KMQA 1BYHA 5FV3A 1G9FA 3UESA 4C91A 1W2UA 2RDQA 4K21A 2ZTNA 3AYEA 4LIVA 4AWDA 1I9RA 3POBA 5M0TA 4MG2A 1NY72 3IZOA 2VXRA 3H8XA 4RQPB 3ZIXA 2WNVA 2JKBA 3KT4A 2AR6A 3JBG1 3ZM8A 5A6YA 3LE0A 4GJZA 2XB6C 4QD2A 3VBUA 1RXFA 4EN9B 2RR11 2WNUB 1HQLA 3OBRA 3AM2A 5CEHA 1BCXA 4QQHA 3ES4A 3IMNA 3RZHA 4NVPA 2F6BA 2MEV3 5BYNA 5JLVA 4P9IA 4I3PA 1GZ9A 5HBAA 4I3GA 2JKXA 2VAUA 4AI9A 2ZHLA 2PQQA 3PUSA 5BNOC 1ZREA 1IS6A 4HN1A 4YVSB 2KXLA 5DAVA 1WCSA 3WW4A 3WV6A 2YC2A 1LOEA 3ZFFC 2ETEA 3OUHA 2YB7A 4W6XA 2YPDA 4R9BA 2J1UA 1NLRA 3SC7X 3WY6A 4YM3A 5DDJ3 3APBA 3O1RA 1DYKA 3A7QA 2D43A 3MIBA 3U78A 2UY9A 4MGIE 5FYIA 5AVAA 4AQTA 1B35B 4CDUA 3M3OA 3O0WA 2OUHA 1YFYA 5JSRA 4QMAA 2PHUA 3KMHA 1E5HA 1XE7A 3OOXA 4BXSV 4ISRA 3BUCA 3CJIB 1K12A 4AL9A 4GKXA 1NXMA 1QJX3 2WNOA 5DUVA 4ATFA 2DCTA 4F83A 4Y4YA 3EMRA 4XTPA 4P14A 3UGGA 1OVSA 4TLFA 1GANA 1UIKA 3MLKA 1EPZA 4IE4A 4LKDA 1CONA 2D5HA 2RM22 2XKOA 1WBFA 3UKVA 2F4PA 1TVGA 3RMYA 2C26A 1C8NA 1HV1A 2D93A 3MBWA 2ZX0A 3R6SA 1CQ9A 3A4UA 4J6GA 2V73A 2XJPA 4WM7A 3ZIWA 1AR91 3KGZA 1X8EA 3ZN4A 4DUVA 3KT7A 2R042 1OUXA 3UYJA 2WT0A 1ENXA 1COV2 1QOTA 5H9SA 3KM5A 3AP9A 4DXZA 1W6OB 3NV3A 3P1IA 5FTTC 3ZXFA 3GZTB 2GN7A 1X36A 1CJPA 4X8PA 1VBC1 4LBQB 1GZWB 1Y43B 2R0FA 1IPJA 5J1XA 4HPKB 3WCSA 2VZOA 5FXWA 2RMU3 3ZYIB 5A70A 2W2IA 3PUHA 4RS5B 4AFCA 4YZ2A 3P6BA 3R0RA 1FNZA 1YI9A 1UZYA 2DCYA 4CP2A 3DYMA 4AVBA 3DPRA 5BNNB 1R082 3L2HA 5E8AA 5FMOL 4LA3A 3NRUA 3T4HB 4A41A 2DVDA 3DXTA 2P3JA 1H6YA 4H7LA 1WLDA 3NV4A 4Q0UA 4FPCA 1UYZA 2SBAA 3AMQA 1RUH3 2WZEA 5GLVA 1MEC1 4QKBA 1AR62 3IDBB 5DPNA 1LNSA 1PO22 3SNMA 2BUKA 1U5YA 4MGSA 2QCSB 2KR2A 3NNJA 1JYVA 1LHUA 1TMF1 1SLLA 4KG0A 3FUOA 1NX9A 3T1LA 4XDOA 1W9SA 1QH7A 5BNOA 5AC93 1JXNA 2WNVB 1H4GA 5CADA 4XXAA 1REEA 3WF3A 1QF3A 1MZFA 5E88A 4YYOA 3CO2A 3ZFFA 2P6CA 3LD8A 2WQ8A 3CIHA 1B09A 1LKNA 1C1FA 4XPVA 1KRIA 2WYFA 3AFGA 1QGLA 3C2UA 1RHI3 1S1AA 1T6GC 1VBD2 1VMHA 1XNDA 2LS6A 5KXEA 4DEVA 2FDFA 2DBNA 3RYRA 1STMA 1JZ2A 4S2DA 1BQPA 1SFYA 1EPWA 4HMZA 1F5FA 4IE0A 1QMJA 4NRQA 3MF9A 1W9FA 1W0OA 3WNKA 5LASA 1YFUA 4B29A 5DAQA 3ZDSA 4MGYE 2XUEA 5DZFA 5FPBA 4BE3A 3TBDA 2Q8EA 1WW5A 4XAAA 1KDKA 2NZ9A 4OI2A 5JZGB 1IS5A 2LM3A 2W91A 2XHNA 4JVAA 4AHWA 1OPMA 4CDUB 1QNYA 2DFBA 3BYWA 1QJX2 1ZA7A 1UD1A 1ZZBA 2CSGA 4QPGA 1HXS1 1U0AA 3LPFA 3BN6A 4GAZA 1CGPA 2JE8A 4LBKA 5DAWA 1SLIA 4YW4A 1RGSA 1V6KA 4XDQA 2J42A 2QNKA 3HR9A 4OMDA 4HVQA 2XONA 4P9WA 4Q4V1 5H9PA 4NPMA 4PDWA 2WN2A 4IV1C 3VBHA 2R071 5EP9A 5L9BA 1ULDA 2HJIA 5FCCA 2WWUA 4CUGA 4BIFA 1SACA 3H1MA 3V64A 1LU1A 5IK4A 5A6QA 4UBGA 1PO11 1QY4A 1UPSA 5F2SA 5EWSA 1L3JA 5FO7B 5C8CC 5DUUA 5GZGA 4QHBA 3JU9A 5EYXA 4ASKA 4FAHA 1SDWA 2XHKA 3LAGA 3HQUA 4BQYA 5BNQA 1PIV1 1OA4A 1REDA 2PMWB 2JDHA 2RMU2 4DIQA 2ZGPA 4DXSA 1CZTA 3H0OA 4GZ9A 1AR93 4COUA 2VQTA 5IVEA 4B1LA 5I0UA 1GNZA 1IKPA 2BGOA 2WA4A 3PVOA 3J7LA 3O1OA 3MUY1 2YU1A 3GGLA 4FPLA 5T5OA 1RUH2 3GJAA 1AYN1 1OBNA 1UU5A 1VBC3 3DPRB 5FLJA 4YW3A 4OZXA 1BK1A 2GN3A 2DU1A 2G4IA 3NQHA 4QGNA 4L97A 4XOGA 5SV5A 4JTOA 2F17A 1VE0A 1MQTA 1W9YA 3X29B 4EWDA 1VRBA 1YFXA 4BOWA 3NWKA 4KGQA 3DYOA 2PHWA 3AL6A 4Z2AA 1NCQB 5FLHA 2WS91 1HN0A 4YGBA 4BMEA 1LECA 1QXRA 2AREA 5E89A 2R16A 3E6CC 3OEBA 2CAVA 1GSLA 1RUG1 1AJKA 2P2KA 3H7JA 2D97A 3LEGA 5CNAA 4LO7A 5FZ1A 3FN9A 4X8NA 1MEC3 5LK5A 1R091 1RUOA 2XLAA 1EAH1 5L36A 5LA1A 4JGZC 4CCCA 4ISQA 4NROA 3VKFC 1ZBA1 2H0BA 3E6DA 4YARA 3KHCA 4QXHA 1UYYA 5CZKA 1GYKA 5JDBA 1R1A2 1FNYA 1W0NA 5JXHA 2OUJA 1CJDA 5HCBA 3C7OA 4MUVA 3C3VA 4YW1A 3SISA 3I8TA 5KXDA 3D8CA 4WVVA 5FBZA 5A7WB 2CDOA 3EJKA 1JZ7A 4JQRA 3MZHA 2HBUA 1A3KA 5CBLA 4C90A 3GDBA 2WWSA 3ACHA 4FVVA 4XW3A 3QACA 5D1IA 1ZBE1 1CR7A 3WDUA 3KV4A 3C8XA 3OGRA 4ZHNA 3VHNA 1FMD2 2GAUA 4DZGA 4IV1A 2VZTA 3IKWA 1IQAA 5LZ6A 4Q4X1 4IEQA 3VKLA 1UU6A 5J36A 3J26N 3LDBA 2LALA 5FZMA 4LOSA 5LW9A 1GV9A 1LJ7A 1TG7A 4Q8LA 5A6ZA 1H8TB 4QPGB 1KJLA 2R7EB 2CWSA 2GH8A 3IN9A 4PHZA 4GMP1 2G9ZA 2GC1A 2AH2A 5C3SA 2CL2A 1YIFA 3J7NA 5C8CA 1IKQA 1ZRCA 2GNBA 4S2GA 1ENRA 4ARYA 1Z78A 2JICA 3J4UH 3O0XA 1X50A 3HAGA 3N7LA 1QKQA 4PDWB 4QKNA 3VBHB 5FZIA 1TNFA 1UY2A 1ZYBA 2W46A 4BQXA 5BNPC 1EUUA 4HL0A 5H9RA 4UT5A 4CEYB 1BVVA 3IB3A 3ZR5A 1P8JA 2DYCA 1KS5A 3EO6A 4YM1A 4MSVA 4ZU7A 3O1PA 4XFGA 2H6BA 1RUE1 3INAA 3AZZA 2XBO1 2VD7A 2R073 3T09A 1C28A 4M0NA 2J1EA 3U37A 1LOCA 4JHZA 5I91A 3VD4A 3A23A 5G04L 3WUDA 4YSFA 5LBCA 4XBQA 5CU1A 2PAMA 4AAXA 2NPIA 4QX2A 1AL21 3FE5A 5GKAC 2TUNA 3RS6A 3T2PA 3W5MA 1PO13 1XC6A 5CISA 4XF4A 3TEZA 1SBDA 1QQP1 1OKQA 3AYDA 1SMVA 1F15A 1H2LA 1CWPA 5FZCA 5LBEA 4NR1A 5IYYA 1H9PA 3U4XA 1PNFA 2WABA 4YZ5A 1OOPA 2YY1A 4MADA 4Q4Y2 2VM9A 5LBBA 3PVEA 3ST7A 3CMGA 1JW6A 4JGZA 4COYA 4AFMA 4XZPA 1W6PA 4EN6B 3TNPB 1L7QA 2HWD3 1MQTB 2RG4A 5F5IA 1O3TA 1ASJ1 3TAYA 1W8UA 1HRI2 5FZOB 2O8QA 2ORXA 1CAUB 5LATA 4ES9A 2XWJB 4QDQA 3CEWA 1EV13 1UWWA 4ITCA 4QAWA 4OHWA 4K8RB 1GOHA 4CPBA 2QBXA 3U11A 1JYTA 1RUC1 2VZ1A 3RGBA 1RC6A 4DB5A 2W87A 4DOUA 1HQWA 3VHPA 2CDPA 4Y24A 2TBVA 5FYHA 1UXZA 4DO0A 2Y64A 4D7SA 3WT3A 1AXZA 1KJRA 1BVP1 1IOAA 2RS31 2WL1A 4QGLA 5JIAA 1JTZX 2PXJA 1RUG3 2ZEYA 2ZXQA 2WSVA 3V0BA 2HWE1 3E1F1 3ILFA 3PNAA 1EAH3 3WR0A 2RS51 2QQPA 4I01A 5FMOS 4QM8A 3T4VA 4P9XA 1UCXA 1GLHA 5F5CA 1HLCA 1ZBA3 5DUXA 2YPJA 1ZZ7A 1O8PA 4IV1B 4LUMA 5KC5A 2JE7A 4I09A 4R9DA 3B5LB 4JV4A 5BNPA 5IATA 4D6SA 4YG0A 2DURA 1HKDA 4FXKB 5F8PA 1OURA 2BWAA 1W03A 5FO8B 1CD3G 2EIDA 2WO3A 3WNMA 4EQVA 2WJSA 4WM8A 2NLRA 4QB6A 4CUAA 3O1VA 4Q4X3 4E2SA 2IZWA 1WBLA 5EHDA 3ZXGA 1LCLA 4MV2A 4AI0A 3HT2A 2ILMA 4FSJA 2BOJA 1UOJA 5K7PA 2D3PA 4NAOA 1LAJA 3O14A 1DLLA 1V9U1 4GMP3 4LTAA 1HIXA 3VBRB 2B8MA 3U0ZA 4Y5Z0 3GM8A 1WKYA 1XNCA 2BYVE 1BMV1 3WP5A 4QHOA 2PQSA 5FZLA 4DMIA 3MUZ1 3PURA 1DP0A 1N1TA 3LIGA 3U07A 1BK0A 5JUVA 4LBOA 3URFA 2PA7A 5FY9A 3S30A 2CHHA 5FZ0A 1RUNA 4LE4A 4YZ3A 2DCZA 3BKZA 1CN1A 3LSEA 4Q26A 5A7QA 1KD7A 1RUE3 1QJU2 1R1ZA 2XBO3 3VD5A 4P9LA 2W9XA 3AP5A 4C0HA 5FZFA 5FYUA 2C9KA 4OMCA 5EQUA 3FHQA 5IVBA 4XUOA 1UZZA 4C8DA 2FDIA 2VJXA 4AHYA 1HRV3 1AL23 1DG6A 1OOPB 2VZRA 4PBPA 2EXJA 2HWD2 5FYSA 5IWFA 5I0RA 1JYWA 2Y0OA 1EUTA 2HKXA 5KHKA 2HWB2 4CU6A 2QE3A 4CDWC 1UMHA 5L7OB 3CF6E 1EV12 1W6NB 3HNMA 1NLSA 1ZRDA 4LHNA 2ZMNA 3HQXA 3AKRA 1AX0A 5IVFA 3DUIA 4XACA 2PHTA 1OH3A 3T2OA 2ZA9A 2W3JA 4FTBA 4AAPA 1DGRN 3DECA 3FUQA 1YQ2A 3A22A 3SXWA 3ILNA 4AQ2A 5T55A 5IAXA 2UY8A 1V0AA 1JZ6A 2VOWA 1H1MA 3WUCA 4NIGA 3SH5A 1AX1A 3LPGA 4XQ4A 2HYKA 1ASJ3 3ETQA 1SZBA 4NIDA 1NXD1 4UFHA 3AKTA 4GKYA 3T08A 3TB0A 4QX3A 4HG6B 4CDXA 2B39A 4FPYA 2AC1A 4RFT0 4AFAA 4ZKTB 5CFCB 3OPZA 3POYA 4BQ2A 4XXPA 2B7YA 1HB3A 1ST8A 1RUC3 2A73B 4P00B 5A3TA 1E5SA 1NZCA 5F5QA 1RUJ1 4N9HA 3RG0A 5A32A 3PIGA 1O91A 3B3QE 3I59B 2OS2A 2JX9A 2RS33 5IVYA 1H1AA 4YRDA 4MGTA 2YUEA 1E57A 3IWZA 5IAVA 5FAXA 2QDRA 5BNPB 2WZR3 5FY8A 4QPIC 2OKXA 4QU1A 4AHZA 4UW5A 1FOD2 4FXGB 4RHV2 1IG3A 3DN7A 4IV3C 1RUD3 3BI3A 1VBB1 2BTVC 3GCWA 4K40A 2R062 4P9YA 4WM8B 4XHXA 1AR71 1OSGA 2XL7A 3POEA 4OHVA 2ZX4A 1CX4A 1APNA 3A0KA 3LOIA 3ZKYA 4DNYA 5JI7A 1FPN3 2OW4A 1W2NA 5F39A 4K9SA 4J1WA 5A3WA 4A6OA 1US3A 4TLGA 2FDGA 3EBRA 2PLV1 4CCEA 2WNEA 1C5HA 3WQ0A 1BBT1 3P5BA 3IBMA 4IGQA 1D4M2 2A1XA 3HBZA 3ATGA 3MGUA 2BVBA 3QOPA 3U4SA 3WW3A 1W2TA 2K46A 5K0UC 2JJ6A 1WCQA 1S0JA 3RI8A 4X6QB 5JIUA 1PMJX 5A6XA 4JAAA 5T3NA 2HLEA 1LHNA 3ACIA 2E53A 1KQRA 2D3SA 3ITQA 3PLQA 4D7YA 4FI9A 1Z7S1 3AB0A 2XGXA 2X10A 4FT8A 1PGW2 3Q8FA 4W6WA 2QJVA 4CA9A 2Q8DA 4FAGA 1HRV2 2W92A 3M4FA 4N53B 3RDIA 2QZ2A 5DZGA 5K8SA 5F3EA 4GB32 4XUPA 2OQ6A 3NAPA 4CXXA 5CYYA 1DGRA 4OULA 3IPVA 2IUWA 1X7NA 4RR3B 4FFFA 4XJZA 3Q9OA 5CB7A 4B1MA 1QJZA 1VALA 1JUHA 2HWF2 3HVDA 4A3XA 5C70A 3OUJA 3VKNA 2BBAA 1LB2A 2A6ZA 1LULA 4UYBA 1QDOA 4LBQD 4MGQA 2QQOA 3M70A 1DGWA 2GNMA 1RMU1 1RL3A 1VBA1 1IHMA 3V0AB 4QT6A 3NNLA 4XC9A 2VQ0A 4Q0SA 1E5RA 5LBFA 2EIEA 1AR82 1FYUA 5J3UA 1VLNA 3DYPA 1UU4A 4OQ9A 4HOOA 4LUKA 4A7KA 1CIWA 1G6NA 2LTNA 3SH3A 3IT8A 2JDAA 1V70A 3N7MA 1QNWA 4ZXKA 1AXKA 1MR5A 1AHSA 1VBE1 2E7TA 2PAKA 3VUOA 1ULOA 4DRVA 1D0HA 5A33A 5LRSA 4AEKA 1H30A 1WCKA 5FPZA 4CDXB 2DVGA 5LA9A 1FV2A 1S0CA 4QPIA 4GJYA 5CA6A 4A7ZA 1SLBA 2RJ2A 1S4CA 4MYEA 1ZRFA 4MOAA 2WAAA 4ES8A 4A42A 4Q8KA 5FPLA 4IV3A 3WHUA 4FQ4A 3ZYRA 3K3NA 3M1HA 1OHFA 5A32B 3ZX7A 2CAUA 1LEMA 2YC0A 3WNXA 2WZR2 2B45X 4AEMA 3AYAA 5JOWA 3THTA 5FQ0A 4GIQA 3OD4A 2R30A 5CFDC 5DG2A 3ALQA 2NYYA 1POV3 4HLTA 2Y6HA 1SLAA 4IE6A 2ZKNA 1W06A 2VZPA 5TSWA 3WF0A 1RUD2 1RVF1 1VPHA 2B9VA 1WMEA 2CTVA 3POFA 3NO8A 3BIEA 1RUJ3 4EZHA 2XJTA 3LA7A 1YQCA 4V2VA 4P5HA 5A7OA 4BQWA 3ZKUA 1I3HA 4E4SA 5I0SA 1NE6A 1FPN2 4FOYA 5K0UA 4QHZA 5FK7A 3KV6A 3N7JA 1SQ4A 1BZWA 2YV8A 2GC0A 3JQXA 3D0JA 3ZN6A 5LK7B 5H9QA 3BU7A 2RS11 3WEZA 2LROA 4LO8A 3SEPA 3ZYBA 4G9SB 1YI7A 4XUNA 2DFCA 1OT5A 5E6HA 1XU2A 2V72A 3IIIA 4N90A 5ACA3 5C3OA 5IK8A 4L11A 3K51A 3VB9A 1UYXA 2R32A 3ENRA 5LCWL 1VBB3 4QDRA 2JECA 3LOBA 3PUQA 4FPKA 1MS1A 1O4TA 4PIZA 1Q8QA 4CCDA 1Y3TA 1W6MB 1CAVB 3AYCA 3KLSA 1BEV3 4YZ4A 2BNOA 3NKTA 1Y9QA 3NVCA 3TNQA 1YJLA 4AEJA 3ORJA 3SKJE 5A1AA 2VCCA 2PLV3 2XVGA 3VBFC 2XJSA 2ZMLA 2XXZA 3ZFEB 1VMFA 4AEDC 5KXCA 1UZVA 2CYFA 4V2WA 2D6KA 1LGNA 3I2OA 3E97A 5HXVA 4BQ5A 1FXZA 4EZ4A 2GMMA 4Z07A 3AXEA 4RSUA 1D0GA 3M3QA 4QX1A 3VDAA 1JYIA 4NPRA 4KG8A 1IS3A 4AVVA 4GWIA 3PJQA 1YXWA 3AJYA 3NAPB 4YW7A 3OGVA 5I0TA 3LA3A 1Z7S3 1JN2P 4QU2A 4IETA 4AI8A 3Q8BA 4CCLA 3WVJA 2ZEWA 4DS0A 4QX0A 3KCYA 3PMEA 1XPWA 4K1YA 2UYBA 5ERLA 2JD4A 5F3IA 1H4HA 2JDMA 3B00A 3UL2A 3TOJA 2ES3A 1XNTA 1RUI3 2UWBA 2W95A 2VOKA 1XYOA 3HN3A 4CVUA 1OMIA 2D6PA 4Q2FA 3I7DA 2VMEA 5IT6A 1V6JA 1VB4A 2X05A 1LESA 2EICA 4M3CB 4QDSA 4E4ZA 5FBJA 5T50A 1ZA4A 1MS9A 1YQ5A 1VJ2A 2JDNA 2VE1A 2XOMA 3FLTA 4XCBA 5BXXA 5FYCA 5DXDA 3GXUA 4ZZ5A 2B9UA 1AXYA 4UAPA 4DFSA 4H7MA 3Q8AA 4FPJA 4B3NA 1VBA3 5FUPA 4Y1XA 5CFDA 2WZPP 1QXJA 3ZO0B 3BOWA 3LKJA 5A33B 2IXKA 4QPIB 4MH0E 1JZ3A 2OPWA 4MXWA 5K9YA 1GBGA 1N1SA 1NA1C 2ENRA 3BTAA 4LBNA 2Q30A 3USUA 3VHRA 5KXBA 2ZOEB 4EE2A 3U10A 1RUF3 3GZEA 4IV3B 1OLQA 1I5ZA 2QKDA 2VW2A 4LHLA 1VBE3 5DQ0A 5ANNA 1XXNA 4E4DX 3QLQA 3N9PA 4GH4C 3UNPA 2RHPA 3ZYHA 5D2AA 4OI4A 4LBLA 4YG6A 5JSOA 4I30A 2OQ7A 3W5NA 4Q4Y1 5C9AB 4GMP0 1Y9GA 2BGPA 4MXVA 4K3UA 1MVQA 2GP5A 5F37A 3S5AA 1Q43A 5HXMA 2VBDA 3VBUB 2MEV2 3M3CA 3H1WA 4A3ZA 2JWPA 4JQTA 5K0UB 2YROA 2C5DA 3R4DB 1HDKA 1S0DA 4LOTA 4XETA 5ACA2 3AMNA 1YLLA 2R1DA 5GALA 1AYM1 2YBSA 2BERA 2PYTA 1DCSA 1ZZ8A 2E9QA 3T2QA 3VBFA 5JOXA 2XQRA 5FMCA 1O6UA 3JBG3 4A45A 4LPLA 4AEDA 3G6JB 4NAMA 1BEV2 2RR13 1CAXA 4PJYA 5DDJ2 4IEYA 2V4AA 2DCJA 3O12A 5F7UA 3B02A 4P9GA 1ENSA 2VCAA 3N35A 5A3UA 5B4XA 3CL1A 4CP9A 4RGAA 1OD3A 3ILRA 4D94A 4HN0A 3WOGA 2XQXA 2IXIA 3I2HA 4MHUA 4NWVA 4AYUA 2A70A 4E4HA 2CWMA 5KHIA 3KSCA 5AVPA 4B7EA 1YO8A 3LA2A 3UKTA 2ZX2A 3FHIB 2C0ZA 4IEZA 1RXGA 1X9TA 1NYWA 4XBLA 2BWCA 4URTA 2C9AA 4XHBA 5DUWA 2GZWA 1PK6C 4XJ8A 3ZXJA 3WG1A 2F4LA 3VGIA 1DFQA 2WLPA 4XQDA 3LDKA 2IVIB 2YYOA 5D8AC 4S2FA 2ZGUA 2W1UA 3KB5A 4HZFA 4YVWC 3WDYA 4Y20A 4FPFA 4BMBA 1OKOA 3NV2A 4M3CF 2EIBA 1RUI2 1Q8PA 3MV01 4HKWA 1VIWB 4N43C 1GZTA 2DTWA 4KWLA 4WM7B 5EJ3A 1U5IA 5KHHA 1XE0A 5FZHA 4I2OA 5FZAA 2WIIB 2V5YA 2X8KA 1QJY1 4BA6A 1H9WA 3WDXA 2AYHA 1YUDA 2A6YA 1XNKA 4OZOA 5FWEA 1NA1A 5FY0A 3FMGA 3K3OA 4DQAA 4BU2A 2JDZA 2DVBA 2R6QA 3LB9A 2E6VA 1O5UA 4RGKA 5L73A 1LOGA 1HN1A 5A1LA 4HVOA 2IFWA 1GWLA 1W0PA 3ZR6A 1LOAA 2J1TA 4XQWA 2JG8C 1K5JA 3MDPA 1IGOA 1DQ4A 2VMFA 3N9OA 5HV4A 4GXLA 2EXIA 2ZAAA 4LORA 4CUCA 4GH4A 2QQJA 4BXFA 2WAOA 3TN91 4Q4W1 5CFDB 1C57A 2ZEZA 4XBNA 4CP0A 1SLTA 1GFF2 1HV0A 4XUTA 5SV8A 4MXWB 2CGNA 2X09A 1HQNA 1O3SA 3C7FA 3VBSC 2VMIA 2GNDA 1JOJA 1KS4A 1YEWA 3RPQA 3OUIA 5JOZA 1PGL2 1S2KA 3WLUA 4OHYA 3S57A 1LOBA 2PN5A 2B5HA 2ZAHA 3CDZB 3H3UA 3NNGA 1W2OA 5I0DA 3TEWA 3GCXA 1UKGA 5AC92 3ZXEA 3ASIA 2FMDA 2BU9A 1I6XA 2D6NA 4MLOA 3N9NA 1NKGA 4LR4A 2QZ3A 1W9WA 4B4QA 3LWCA 3ME2A 5BNOB 3OY8A 3DCQA 3KHBA 1RHI2 3ZXKA 4C1XA 3FBYA 1O8SA 1WW4A 3EQEA 4N7IA 3ZFFB 2GMEA 1C3HA 1MS0A 3FX3A 4JX0A 3JBG2 1YJKA 5FOJB 4R52A 1TMF3 2E63A 2RR12 4MGZE 1X33A 1JZ4A 4GWMA 5T52A 3SEEA 1Q56A 3K46A 2WFF1 4K7JA 3VBFB 4NPLA 2WA3A 3RI9A 2I74A 4W6YA 4AGGA 1X8MA 5C5TA 4N8MA 3H9AA 3J8F1 1DYPA 1C8M1 3WP4A 3QBQA 4EN0A 4PLMA 3UT0A 2BRTA 2VCMA 3GHNA 4QB1A 4RN5A 4G3YC 4WBBA 1PK6A 5ABJC 1AYM3 1TME1 3FLPA 2V4VA 3ZXDA 3OYWA 1JZ8A 2Q4SA 2XL9A 4CP9B 3KVAA 3VZOA 3CZUA 2J1RA 4L9BA 4E8CA 5D8AA 2WO2A 3VZNA 3LDRA 4YVWA 3U75A 1PMIA 3S6PA 4OHZA 3DGTA 2EAAA 2DUQA 3MPPG 4Q0PA 2QFEA 5FXXA 2A7AA 2CGOA 3FZ3A 5FZDA 2ZGMA 4N43A 5LRRA 2VOVA 1REFA 2ZHKA 5FLIA 4EYUA 5F3CA 3VHOA 1WZXA 3OCPA 3WSOA 3ZSEA 1RIRA 2HWC1 2N7GA 3ZSJA 1QXPA 1VRH1 4B7KA 4OQ8A 3RFRA 2EAKA 3OGSA 3RYPA 4NUBA 1HXS3 1W3VA 2E7QA 1PVC1 1O4ZA 2I45A 3POSA 4XF0A 2BFUL 1ULPA 4AVAA 5A7NA 5A3MA 2DUPA 3POWA 5L19A 4Q4V3 4IEWA 4XJUA 2YG0A 2B42B 4CEWC 3LFIA 3LEKA 1DDLA 4Y1ZA 2Y38A 3I4IA 1S55A 2VU9A 3W59A 2ZGOA 1SBEA 5FZ9A 1H2NA 3KS7A 1AR92 3K2OA 4W8JA 4OLLA 1ODNA 1NA1B 2ZBJA 1JHJA 1N1VA 2VR4A 2ZKLA 3H3LA 3LQCA 4LULA 4FOQA 4ZS2A 3VBSA 2YZ4A 3SCFA 1GU3A 3I97A 3M3EA 2ZEXA 1YFWA 2HEYF 4DPNA 2JIGA 4EV0A 3EYPA 5FPUA 1YQ8A 2DBIA 2WFPA 4GH4B 2QQMA 4HK9A 4NHXA 5LB6A 1VBC2 2FD8A 1E5IA 4NHKA 1POV0 5CAZA 3HMYA 2UYAA 2X5IC 1PIV3 1H1IA 2C6SA 2WUHA 2GSYA 1JUIA 2R49A 2VNRA 5FP7A 5FFOC 1F8VA 2DF7A 3AK0A 2JG9C 2V5DA 3BPSA 3ES1A 1F35A 5C33A 3ZMNA 3E6BA 4FPOB 4CRQA 1ULGA 3TN93 4Q4W3 2PAEA 2OIIA 5FXVA 4B4RA 5FR3A 1UY4A 1JYNA 3JB4C 4LLOA 2PHLA 4XE9A 3MV11 1AZDA 4WZCA 3KQ4B 1MEC2 1AYN3 1PX3A 4NRPA 1Q3EA 3UJQA 4J25A 5C4WC 1DBNA 5A80A 3LF7A 2TNFA 4JGYC 4LO5B 3B7MA 2J22A 4FBFA 3GBGA 4OUMA 1KXGA 1GP4A 1FV3A 1TMF2 1UO9A 1F5JA 2PELA 4KGGA 3GBFA 2DCKA 1GMMA 1ALYA 1ZVFA 3FL7A 3JD71 5F2WA 2P37A 5ABJA 2GC2A 3DL3A 4HSLA 3UGHA 1UZ0A 3OEAA 3R4UA 3C7GA 2XJQA 2WS93 2YDEA 3N9QA 4ZU4A 2Q8OA 2WO7A 2IWGB 3NKGA 4NO4A 5C9AA 1MS4A 4QXCA 4FPGA 1KGYA 4I0WB 2NQYA 5KC6A 3H50A 1R093 2VZVA 4JCKA 5DN2A 1US2A 2O1QA 3OGGA 3ZYGA 3MLLA 2A3WA 4Z8BA 1DQ0A 3FC0A 5FP4A 2EXHA 5F6KA 4U36A 1PK6B 2WSUA 4J1XA 3OYWB 2P3KA 4OI1A 3PUIA 3IDCB 2AUYA 2FCUA 5HV0A 4M4RA 2R0HA 4KNCA 5T5JA 1YC61 5B2GB 3AP7A 3SKVA 3D82A 1NZIA 1HW5A 4TWTA 5ANQA 1FT9A 2WDBA 2Y6FA 1ZBE3 4BK4A 4N43B 1IQDC 3ELNA 1TME3 3WNNA 4CEWA 1WA4A 5HPOA 3FHAA 3ZXLA 1HXS2 1DF0A 1GICA 2VUCA 3D4KA 4JZRA 2D6OX 5C8CB 4LKSA 4QWNA 4IUGA 2HYXA 1NY71 5FRAA 4MVTA 2WINB 3D3AA 4UFJA 4UWDA 4A4AA 4COVA 2GH2A 4QX5A 3VDBA 4Q4V2 1TEIA 4Y22A 1OPOA 1QHDA 4LEJA 4PLNA 2R072 3ZVXA 2G19A 4XAEA 3RZMA 2D98A 1PM7A 3DKQA 3WP6A 2Y34A 4IEOA 1UOFA 3MYXA 2ZCWA 1OC1A 1BJQA 3PDQA 4IW3A 2HH9A 2X5IA 1PVC3 2ZHMA 1PO12 2E31A 1WGPA 2CNAA 3PTRB 4D6RA 2X53S 4I02A 4M0HA 4QXBA 1H2KA 2NMOA 3QD6A 3VBSB 4PQQA 1Q8SA 2ZGTA 2JG9A 2VZSA 3V65A 5IFTA 2VXJA 2VBBA 4RQPC 1R64A 4LK6A 1DLCA 3K75B 1PIV2 3TWIA 5D21A 2OX0A 3BOPA 4BB3A 4W65A 3T0BA 1UMZA 3L2YA 3SLIA 3GBWA 4JKKA 5A3NA 1MVEA 2VMHA 1W39A 2FZ1A 2GALA 2WNUC 2A6XA 2MNGA 4CU8A 1LHWA 2FQPA 3JUUA 5C4WA 2G1MA 3ON7A 2CGPA 3VD9A 1ZZ6A 2J1AA 3AKQA 2G9FA 4Y5SA 3NJXA 4UF0A 2KD7A 1DHKB 3HN1A 3B01A 1QQP3 2YGMA 2CU5A 2Y60A 2ZACA 5J48A 1Y9MA 1AYN2 1IPKA 1VAKA 1HX6A 1WUVA 3PU8A 3PVBB 1K5MC 1W6PB 4JGZB 4OI0A 1QH6A 1XOYA 4YVSC 1MS5A 4NMIA 4PCRA 4IL7A 2ARCA 2P3YA 4FPHA 4EN8B 5AFEA 3VBOC 5IVCA 4KWUA 5CG9A 1W8TA 2RM21 2YGLA 2QQVA 5FK8A 4U2AA 5FZGA 4D0QA 1CAWA 1EY2A 5A3PA 2RDRA 3AZXA 3K4ZA 2WS92 3R4SA 4BIOA 5KHJA 3FFZA 4WVMA 3CJIC 1RUG2 3AP6A 3I2GA 4W4ZA 2R041 4XF9A 5LY1A 1AX2A 1QEXA 1COV1 2Q5TA 2B4KA 1R092 2JE9A 4IQPA 1Y4WA 3FJSA 4HONA 1EAH2 4CU9A 2J1VA 4HXCA 4AW7A 1XYNA 3NJVA 4OUSA 4QQ2A 5JMCA 1LHVA 3V0BB 1ZBA2 3V56A 1K42A 4R9AA 4BPZA 3THCA 3F95A 3JD73 4HT1T 3BTXA 3U14A 4BQ4A 1OLRA 3W21A 4LLFA 1NCRC 4OCTA 2A6WA 4RA0A 3ZFGC 4CXYA 1ND2C 2ARXA 4NIIA 4YG3A 2UU8A 1OFSA 3OPTA 1ZBE2 4UW3A 1R081 1Q8OA 2HWE3 5I8SA 4KBZA 1J1TA 1ZRIA 2VQAA 3P3NA 5GZEA 2VOXA 2RS53 4BISA 5A7PA 5CFCC 5LWBA 4Q4X2 5A3LA 2RJLA 2R1BA 1JI6A 3WNLA 1AR61 5FDBA 2VW0A 3JB8A 1PO21 3N3HA 3O5SA 2YBPA 1GQGA 1N47A 1D7PM 5DAPA 5FWJA 4IE7A 3MFAA 4RS5C 3MIDA 5FY4A 2ET1A 4LBJA 3MW3A 1OQEA 1UY1A 4Y22B 1RYYA 4KWKA 1Q8VA 1SHWB 3HWJA 3SCGA 5I8YA 4RQPA 4TTGA 4Z2WA 4YWAA 5BNNC 5APAA 2EXKA 2VZ3A 2WNUA 2Y26A 3WDVA 1VBD1 4LA2A 5JCTA 1A78A 4RFRB 3WG2A 1GR3A 4F7ZA 1JU3A 2ID4A 2UWCA 5A1FA 3OSDA 4EN7B 1RUE2 1V9U3 2XBO2 1DZQA 4UFMA 4H3WA 3AVSA 4OUEA 4URAA 2HBTA 1GOGA 2LW8A 5ISLA 5FPXA 5F3GA 1DU3D 1VP6A 4CDWA 4JTNA 3RZLA 1GNYA 2WNVC 3K77A 1K5MA 3Q8CA 1G7YA 3GYDA 4CP1A 2YMZA 5EIYB 2D40A 2JIJA 2Z4FA 3WQ1A 1AL22 3PU3A 4H2AA 1A8DA 1YRZA 3VBOA 4CXWA 4W50A 2I2SA 1G8WA 1ZNPA 4IE5A 1QJX1 2JDUA 2ZS6B 4B4PA 4DXRA 1QQP2 1X9PA 5C4WB 5GLZA 4C0BA 5FZEA 2AEZA 4A7YA 5FY5A 2QQWA 5T54A 1EYBA 3IDAA 1LGBA 3ZLIA 2IXJA 4I0AA 1K3IA 1XRUA 4BM8A 2BFUS 3BVCA 1W05A 4Y3OA 3CJIA 2HEVF 2E7AA 2J1SA 5IFPA 2OYZA 5F9TA 1W8ZA 4WV8A 3VV1A 2IFRA 1LEDA 1PHMA 3DEMA 4EJRA 2QQKA 5LEKA 1GNHA 1BHGA 1GWMA 5JZGC 4GD4A 4P5YA 3WHTA 1ASJ2 4COZA 2IXCA 2WKKA 2WQ4A 1CAWB 4CCNA 1WMFA 2CY6A 4NOTA 5GLWA 3HJRA 1DYOA 1URXA 4KWJA 3MW4A 1NCRA 4WVMB 3H8UA 4Y26A 2VC9A 1X82A 3ZFGA 1PX4A 5DABA 4YNIA 4Q0QA 1ND2A 1RUC2 2GU9A 5A3OA 3VD7A 3WZ1A 1XSQA 1CPMA 1UY0A 2RM23 4Z82A 1SCRA 3HD8B 2VY0A 2RMU1 4LKEA 3OG2A 5CFCA 2XDVA 4L8QA 1W3XA 2RS32 2Y6JA 1UL9A 5FMDA 3RJRA 2SLIA 1V6NA 3KWVA 2BVVA 4P02B 4UW4A 1C4RA 3K4AA 2R043 4Q29A 1DQ6A 2DV9A 2W52A 4LBQA 3LEMA 2HWE2 3RWNA 3S5QA 5A7SA 4E2GA 2VQUA 2LRPA 1OI6A 2RS52 1JYCA 3GJBA 1DQ1A 3OBAA 4Y1YA 1RUH1 1UN1A 4YM0A 5IUQA 2BJSA 5HI0A 1UXXX 1S0BA 3AZVA 3I2KA 1HJGA 2ZX3A 1T6BX 4GQ7A
chains in the Genus database with same CATH topology
3KT1A 2ATFA 2VGDA 4FCAA 5BNNA 4SLIA 2V09A 5JVVA 5CIRA 4K20A 3OGJA 4EWEA 1RJ8A 4AQ6A 4IEVA 4A2UA 4WVZA 3HT1A 1WLWA 3AKPA 2XLGA 4PF5A 2PTMA 2Z5WA 1RHI1 1AR63 1YHFA 4WZFA 1PO23 2GC3A 2UWAA 3DPRC 5T5PA 1AR73 1Q5OA 3ROUA 3WCRA 2D6LX 4Q1RA 1V9U2 4BHPA 4BLJA 2MHFA 4E2QA 2NM1A 1UKRA 1R1A1 1Z0HA 1RJ7A 1PZ8A 2D6MA 4HSJA 3UKNA 1BMV2 2E51A 1BBT3 2FHRA 4YW2A 4Z1VA 4BYYA 5JPMB 1NCQC 5AFBA 4CDWB 2VVFA 4IEUA 4CTEA 3WX5A 1A6CA 1J3PA 1K5MB 1VBD3 1FMD1 1DIWA 3M7AA 2Z79A 1S0IA 2VVEA 1AL0G 4FTSA 3BALA 4NHMA 3VBOB 5JZGA 4YFWA 3IPVB 1V6MA 2UURA 2WQZC 2Q0AA 2Z42A 1J58A 1G9DA 1KFUL 4YZ1A 3GZAA 1S0EA 3R05A 4HBNA 4IESA 4QQOA 3KQRA 2AGSA 4E27A 4AI1A 1N3PA 2BPA2 1D2SA 3ZXAC 1D4VB 4AXOA 2AZ5A 4Q0VA 3BB6A 2DUOA 4AGRA 4CYDA 1PZ7A 1QDCA 3LZZA 1RTVA 3DV8A 2XH6A 3VZJA 2ARBA 1ULFA 1NOVA 1H8TC 2OVUA 1YCIA 4QPGC 3ZSLA 1ZRRA 4UXAA 1NCRB 1RMU3 3ZFGB 1ND2B 4JDNA 4RL7A 2VNOA 3VZMA 1LOFC 1OQDA 5BPXA 2IC1A 4MX3A 3USSA 1GZCA 5CFCB 4PDWC 1LTEA 4OFGA 3MICA 2Z69A 2A71A 2EALA 3MEPA 1PNGA 4K1ZA 4XJWA 3VBHC 2P3IA 2DVFA 4CEYC 1KDMA 4AGVA 5FQ0B 1RUJ2 3GHMA 4M01A 2W08A 3AP4A 2WC2A 3VKOA 5FO9B 4BQ1A 5E1RA 1I1EA 3PJYA 4EWAA 3AMMA 2QUOA 1IZ3A 2EA7A 3GZUC 2LUWA 3MIGA 1MZ6A 3NSTA 4Q27A 3WINE 1HRI1 4TZDA 4AVTA 3N7KA 2I07B 3ZN6B 1RVF3 4F8AA 1VBB2 1J1LA 4N9IA 1AR72 2D7FA 4ASMB 1Y7BA 4HANA 4FPEA 1NCQA 5J98B 5C8WA 1DGLA 4F3JA 3BIWE 1YYNA 1IS4A 3BPZA 4UBHA 2PLV2 2BGCA 1PVXA 1BBT2 4IEXA 1VB2A 3IM0A 1NG0A 3NJZA 2RS13 3P3PA 4LHKA 4SBVA 1LR5A 4XFBA 1MQTC 1DGWX 1QU0A 1MACA 4IEPA 4LNVA 1LU2A 4D7TA 1PGSA 2ZZQA 2WT2A 1GKBA 3UV9A 5FREA 1Z7S2 1R1A3 3SITA 4YFZA 5JSPA 4BH9A 1J3RA 2ZGLA 1O4YA 3B9CA 4R8HA 1EP0A 1LODA 2DU0A 1S0FA 3D6EA 4S2HA 1F9KA 4JRAA 2VNGA 1H8TA 3GF6A 1FMD3 2GNTA 3THPA 3D0SA 4K6BA 4TYSA 3OJBA 4XFCA 4L2NA 4PIYA 2DTYA 3OBTA 3B9IA 1LOFA 4LO6B 3VDDC 2VG9A 2PHDA 2XG3A 2A5ZA 3CU7A 4FTEA 3RQ0A 1O3QA 1VBA2 1RMU2 3NW4A 3ZPYA 1NQDA 2DWRA 4NWWA 3AFKA 2O0OA 2Y0IA 4XMAA 4CEYA 5KHGA 4XFAA 5BUVA 1UPIA 2BW8A 1FI2A 2GMPA 4GALA 1QOOA 3RMXA 4CZSA 2ZX1A 2VMGA 4AG4A 3ZYJB 1TQ5A 4AVSA 1ENQA 1O5LA 1RUF2 4HETA 1VBE2 2ZABA 3OF1A 2H6CA 3EHKA 1H8VA 1TE1B 3USUB 1QJU1 2VECA 3PHMA 4BWOA 1GQHA 3KZ4C 1MZEA 2BBVA 3VBRC 1C5IA 1WW7A 4OVEA 1V6OA 1DQ2A 3E5XA 4FP2A 3N4MA 2IXHA 2ZGNA 1QOSA 3PMSA 4DY5A 3MW2A 5F6LB 2XJRA 2HWD1 1WD4A 1RITA 1V00A 2BEOA 2TEPA 2HWB1 3AMHA 3VZKA 1U5ZA 1ONAA 3DKWA 1EV11 5EV7A 1RVF2 1XE8A 3I54A 5DZEA 5CG8A 3JCIA 5JI9A 4PQ9A 4YLZA 2JEMA 4Q4Y3 4AHXA 3M3IA 4XFIA 2PFWA 1CAUA 3G7DA 3LSDA 4JDMA 4FP3A 4AEDB 2VULA 3UJOA 3VL8A 1BXHA 2ZPXA 3AXDA 1CAXB 2RS12 4XILA 3RYKA 1OOPC 1HRI3 1XQNA 1G9CA 5E16A 5L7OC 2D3RA 4PBOA 3CJXA 4I0BA 4LO4B 2XPJA 2H0VA 2WT1A 3VL9A 4GULA 4ZU5A 4O9EA 5T5LA 4MGKE 2WLQA 2Q1MA 3AZYA 1N3QA 4XIKA 3MFCA 3H7YA 2YHJA 3VDDA 4M00A 4N7UA 1OFNA 1ZX5A 3NV1A 1ULCA 5GJ6A 3E5UA 2KA3A 4JDOA 3RSJA 4YGCA 2VVDA 1FOD1 4P9JA 2IXLA 4RHV1 1O3RA 4Y20B 2JG8A 4GWNA 3VN4A 1FATA 2QVSB 2R061 4DY3A 4AQSA 2XVKA 3A0NA 3AJZA 4V1PA 4XFHA 2EF6A 3J9SA 2NN8A 5GM0A 3T2TA 3ACLA 1ULEA 4NN0A 2VH9A 5J09A 3MIFA 3KGLA 4QXKA 3WQ7A 3W58A 1CESA 1D4M1 1FX5A 1XU1A 3M2MA 3H1YA 2BQPA 4YM2A 3ZMOA 1WW6A 4ATEA 4JC1A 3VBRA 1LRHA 1J3QA 4FOVA 5JOYA 1QJY3 5HCAA 4WM8C 1DZRA 1UF2C 4B8EA 1VAMA 1DQ5A 1V6IA 2ZZJA 3SH4A 4XFFA 5CVRA 2ET7A 1PGW1 2DVAA 1WLTA 2JXAA 4XF1A 5F1RA 2XJUA 4H14A 2A75A 5JWPA 1HRV1 2XKPA 3WW2A 3I2DA 3WDWA 4GB31 4O9GA 4YGDA 4COWA 4CDQC 5BY5A 4K8FA 2VPVA 2XJVA 3N36A 4LBMA 4QQPA 1RINA 1QJU3 2ZJCA 1XNBA 2HWF1 1QWRA 2EVXA 1G9BA 1JBCA 1VR3A 2MPFA 3E5QA 3OY8B 3O7OA 3B94A 1D2QA 2QDNA 4OHXA 5L7OA 5I93A 1AJOA 1W6NA 3SCHA 3WD5A 3ZSMA 4N53C 1AR81 1SLCA 3S0MA 1AF9A 2HWB3 5EYYA 2GDFA 3M8LA 1MZ5A 4KQ7A 1H0BA 3JQWA 1AYM2 4Y1VA 3SMHA 3ZYPA 2O8OA 4RR3C 4HFSA 4KU8A 1KFXL 3VLBB 4XJAA 3BCWA 3S7IA 2NP0A 3KD4A 3FFQA 1CPNA 4DRRA 4BZ4A 1N3OA 2WFF3 5D8AB 4RGGA 2KM2A 4YVWB 4FO9A 1JHNA 3J8F3 5GZFA 1C8M3 3TYJA 4GA9A 4QGMA 2C1FA 3KCCA 2EIGA 2WZR1 5GLTA 4HKOA 4QPYA 1CVNA 4FQZA 1AUYA 4R4ZA 3H3ZA 3I59A 4IXLA 3VDDB 4XIOA 3FBMA 1SFNA 1S0GA 5JR7B 1RUD1 4M3CE 2ZGSA 4H55A 1BKZA 4CDXC 5JAXA 4UW6A 3MIEA 4INDA 1FPN1 3VKMA 1AVBA 2JG8B 2ZGQA 1ND3C 4AFBA 3VZLA 3CLPA 2ERFA 3WW1A 4AFDA 3WXPA 2HWC3 2XVLA 1VRH3 1LGCA 4LE3A 1G86A 3LCPA 4EROA 4E9KA 1FOD3 4JRLA 4RHV3 3ZN5A 2OZ6A 1LENA 2R063 4XF3A 3FWEA 1QJY2 3TRSB 4YW5A 3RRDA 4PLOA 4BCUA 4BLIA 3B93A 2D44A 4CDQA 3QH7A 1TNRA 5GLUA 1W6QA 4QM9A 2G9GA 2ZHNA 1D4M3 3MPBA 4WVWA 3TN92 4JGYA 4Q4W2 3L9JT 4IERA 5KBFA 3O0VA 4ONUA 2A3YA 3QCWA 1YWKA 2P17A 1WMDA 1YNAA 4AI2A 4DINB 2NMNA 3DF0A 3BODA 4ORFA 5DG1A 4RD7A 5FOBB 1C1LA 2W0XA 4N53A 2ZGRA 5HCFA 4C1WA 1WCDJ 1UW8A 3GNEA 3OTFA 2PHRA 1B35C 4KBBA 3IDEA 4RR3A 1LHOA 5EFUA 3ZFEC 2OZJA 3EXUA 3WG3A 2W68A 4GB33 4D69A 2Z2SB 5ABJB 2XWBB 3UK9A 4YGEA 5KWRA 4LT5A 5J7MA 2HWF3 1ZZ9A 2W39A 4Q1PA 3KCXA 3V0AA 4HVRA 3NAPC 4AF9A 2WFF2 4KL1A 2P34A 3K48A 3J8F2 1C8M2 1AR83 3WDTA 3RNSA 1RB8G 4XMIA 5IK5A 5C6CA 1TME2 3HIFA 1NE4A 4D3WA 1POV1 2ZMKA 1ND3A 3PVNA 4AI3A 5J96B 1V6LA 2A6VA 3PTYA 4CEWB 1OQ1A 2K2SA 1UAIA 5GZDA 2VUJA 1UIJA 3AMPA 3IIAA 4MZUA 1DZTA 5LEJA 2RE9A 4Z92B 1UX6A 1VAVA 1M06G 2OA2A 3SHRA 2MEV1 2HWC2 4XEZA 1VRH2 2Q1ZB 1JH5A 1PVC2 4NHLA 5ACA1 4L99A 2XLFA 4KU7A 1ZM1A 3B69A 1U5XA 3RZZA 2X5IB 4QQLA 1SEFA 1BEV1 5DDJ1 3LGRA 1YIPA 4FOWA 4XJ9A 1H2MA 3MI8A 2JG9B 4X6RB 2X29A 3AKSA 5C9AC 3WG4A 3FLRA 3GALA 4YVSA 3VBUC 4XYXA 1XYPA 2OPKA 4CDQB 1W6MA 1CAVA 1WLCA 2PHFA 1W6QB 1B35A 2JENA 5EXOA 3ZSKA 4R9CA 4JGYB 2XUMA 1U12A 3QH6A 1O7FA 3ZFEA 1MS8A 1PZ9A 1ZZCA 3S7EA 3MF6A 1J59A 3AZWA 4AK3A 2RJKA 3T1MA 1OD5A 1SBFA 2VW1A 2BNNA 1WD3A 4CDUC 1RUI1 4XTMA 5IK7A 4AVCA 3AX4A 1OA3A 2FMYA 2AENA 2PHXA 3JZVA 4AE2A 2FBEA 2CV6A 1KITA 1NQJA 2FZ2A 1F31A 3JD72 4HKLA 1MS3A 1N1YA 5JPNB 4KH9A 1S2BA 3MLJA 5EZWA 1W6OA 1G9AA 4ASLA 3RJ2X 4M3CA 2HEWF 2ZGKA 2VUAA 1COV3 1GZWA 2BNMA 4HPKA 2YXSA 3WP3A 2D5FA 3OD0A 5GZCA 4WM7C 1M4WA 1OA2A 1RUF1 3NL1A 5J37A 4TSVA 4RS5A 2K9ZA 1SCSA 1F2NA 4PIXA 1FAYA 4HK8A 5I8TA 1PGL1 3CNAA 1ND3B 4L92A 3MIHA 4G4FA 2B46X 5AC91 3D5OA 4R4XA 3W9AA 1A8MA 1R083 2K0GA 2A3XA 3ECQA 4META 1BYHA 1G9FA 4C91A 1W2UA 4K21A 2ZTNA 3AYEA 4AWDA 1I9RA 1NY72 2VXRA 4RQPB 3ZIXA 2WNVA 2JKBA 3KT4A 2AR6A 3JBG1 3VBUA 2XB6C 4QD2A 4EN9B 2RR11 2WNUB 1HQLA 3OBRA 3AM2A 1BCXA 4QQHA 3ES4A 3IMNA 4NVPA 2F6BA 2MEV3 5BYNA 5JLVA 4P9IA 4I3PA 1GZ9A 5HBAA 4I3GA 2ZHLA 2PQQA 5BNOC 1ZREA 1IS6A 4HN1A 4YVSB 2KXLA 1WCSA 3WW4A 3WV6A 1LOEA 3ZFFC 2ETEA 4W6XA 4R9BA 3WY6A 1NLRA 4YM3A 5DDJ3 3APBA 1DYKA 3MIBA 2D43A 2UY9A 4MGIE 4AQTA 5AVAA 1B35B 4CDUA 3M3OA 3O0WA 2OUHA 1YFYA 5JSRA 4QMAA 2PHUA 3KMHA 1XE7A 4ISRA 3CJIB 4GKXA 1NXMA 1QJX3 4F83A 5DUVA 4ATFA 2DCTA 4Y4YA 4XTPA 4P14A 4TLFA 1GANA 1UIKA 3MLKA 1EPZA 1CONA 2D5HA 2RM22 2XKOA 1WBFA 3UKVA 2F4PA 3RMYA 1C8NA 1HV1A 2D93A 3R6SA 2ZX0A 1CQ9A 3A4UA 4J6GA 2V73A 2XJPA 4WM7A 3ZIWA 1AR91 3KGZA 1X8EA 3ZN4A 3KT7A 2R042 2WT0A 1ENXA 1COV2 1QOTA 5H9SA 3KM5A 3AP9A 4DXZA 1W6OB 3NV3A 5FTTC 3ZXFA 3GZTB 2GN7A 1X36A 1CJPA 4X8PA 1VBC1 4LBQB 1GZWB 1Y43B 2R0FA 1IPJA 4HPKB 3WCSA 2RMU3 3ZYIB 4RS5B 4AFCA 4YZ2A 3R0RA 1FNZA 1YI9A 1UZYA 2DCYA 4CP2A 4AVBA 3DPRA 5BNNB 1R082 3L2HA 5E8AA 5FMOL 4LA3A 2DVDA 2P3JA 4H7LA 4Q0UA 1WLDA 3NV4A 4FPCA 2SBAA 3AMQA 1RUH3 5GLVA 1MEC1 1AR62 3IDBB 1PO22 3SNMA 2BUKA 1U5YA 2QCSB 1LHUA 1TMF1 1SLLA 4KG0A 3FUOA 3T1LA 1QH7A 5BNOA 5AC93 1JXNA 2WNVB 1H4GA 5CADA 4XXAA 1REEA 1QF3A 1MZFA 5E88A 4YYOA 3CO2A 3ZFFA 1B09A 1LKNA 1C1FA 4XPVA 1KRIA 3AFGA 1QGLA 3C2UA 1RHI3 1S1AA 1T6GC 1VBD2 1XNDA 5KXEA 3RYRA 4S2DA 1BQPA 1SFYA 1EPWA 4HMZA 1F5FA 1QMJA 3MF9A 1W0OA 1YFUA 4B29A 3ZDSA 4MGYE 5DZFA 4BE3A 3TBDA 1WW5A 1KDKA 2NZ9A 4OI2A 5JZGB 1IS5A 2LM3A 4JVAA 4AHWA 1OPMA 4CDUB 1QNYA 2DFBA 1QJX2 1UD1A 1ZZBA 4QPGA 1HXS1 1U0AA 1CGPA 4LBKA 4YW4A 1SLIA 1RGSA 1V6KA 4XDQA 2QNKA 3HR9A 4HVQA 4P9WA 4Q4V1 5H9PA 4PDWA 4IV1C 3VBHA 2R071 1ULDA 2HJIA 5FCCA 4BIFA 1SACA 3H1MA 3V64A 1LU1A 5IK4A 4UBGA 1PO11 1QY4A 1UPSA 5EWSA 1L3JA 5FO7B 5C8CC 5DUUA 5GZGA 4QHBA 3JU9A 5EYXA 4FAHA 1SDWA 2XHKA 3LAGA 5BNQA 1PIV1 1OA4A 1REDA 2RMU2 2ZGPA 3H0OA 1AR93 4COUA 5I0UA 1GNZA 1IKPA 2WA4A 3PVOA 4FPLA 5T5OA 1RUH2 1AYN1 1UU5A 1VBC3 3DPRB 5FLJA 4YW3A 4OZXA 1BK1A 2GN3A 2DU1A 2G4IA 4QGNA 4L97A 4XOGA 5SV5A 4JTOA 3X29B 1MQTA 4EWDA 1YFXA 4BOWA 3NWKA 4KGQA 2PHWA 1NCQB 5FLHA 2WS91 4YGBA 4BMEA 1LECA 1QXRA 2AREA 5E89A 2R16A 3E6CC 2P2KA 2CAVA 1GSLA 1RUG1 1AJKA 3H7JA 2D97A 5CNAA 4LO7A 1RUOA 4X8NA 1MEC3 5LK5A 1R091 2XLAA 1EAH1 5L36A 4JGZC 4ISQA 3VKFC 1ZBA1 2H0BA 3E6DA 4YARA 5JDBA 1GYKA 1R1A2 1FNYA 2OUJA 1CJDA 5HCBA 4YW1A 4MUVA 3C3VA 3SISA 3I8TA 5KXDA 3D8CA 4WVVA 5FBZA 3MZHA 3EJKA 4JQRA 1A3KA 5CBLA 4C90A 2WWSA 4FVVA 4XW3A 3QACA 5D1IA 1ZBE1 1CR7A 3WDUA 3VHNA 1FMD2 2GAUA 4DZGA 4IV1A 3IKWA 1IQAA 4Q4X1 4IEQA 3VKLA 1UU6A 5J36A 3J26N 2LALA 1GV9A 1LJ7A 4Q8LA 1H8TB 4QPGB 1KJLA 2CWSA 2GH8A 3IN9A 4GMP1 2GC1A 2AH2A 2CL2A 1YIFA 5C8CA 1ZRCA 1IKQA 2GNBA 4S2GA 1ENRA 1Z78A 2JICA 3J4UH 3O0XA 1X50A 3HAGA 3N7LA 1QKQA 4PDWB 4Y1UA 3VBHB 5BV6A 1TNFA 1ZYBA 5BNPC 4HL0A 5H9RA 4CEYB 1BVVA 2DYCA 1KS5A 3EO6A 4YM1A 4MSVA 4ZU7A 4XFGA 2H6BA 1RUE1 3INAA 3AZZA 2XBO1 2R073 1C28A 4M0NA 1LOCA 5I91A 3WUDA 4YSFA 4XBQA 5CU1A 2PAMA 2NPIA 1AL21 3FE5A 5GKAC 2TUNA 3RS6A 1PO13 4XF4A 1SBDA 1QQP1 1OKQA 3AYDA 1SMVA 1H2LA 4NR1A 3U4XA 1H9PA 1PNFA 4YZ5A 1OOPA 2YY1A 4Q4Y2 3PVEA 3ST7A 1JW6A 4JGZA 4COYA 4AFMA 4XZPA 1W6PA 4EN6B 3TNPB 2HWD3 1MQTB 1O3TA 1ASJ1 3TAYA 1HRI2 2O8QA 4ES9A 1CAUB 2XWJB 3CEWA 1EV13 4ITCA 4OHWA 3U11A 1RUC1 4DB5A 4DOUA 1RC6A 1HQWA 3VHPA 4Y24A 2TBVA 4D7SA 3WT3A 1AXZA 1KJRA 1BVP1 1IOAA 2RS31 2WL1A 4QGLA 5JIAA 1JTZX 1RUG3 2WSVA 3V0BA 2HWE1 3ILFA 3PNAA 1EAH3 3WR0A 2RS51 2QQPA 4I01A 5FMOS 4QM8A 4P9XA 1UCXA 1GLHA 1HLCA 1ZBA3 5DUXA 2YPJA 1ZZ7A 4IV1B 4LUMA 5KC5A 2JE7A 4I09A 4R9DA 3B5LB 4JV4A 5BNPA 4YG0A 2DURA 1HKDA 4FXKB 2BWAA 5FO8B 1CD3G 2WJSA 4WM8A 2NLRA 4Q4X3 4E2SA 2IZWA 1WBLA 3ZXGA 1LCLA 4MV2A 4AI0A 3HT2A 2ILMA 4FSJA 5K7PA 2D3PA 3O14A 1DLLA 1V9U1 4GMP3 4LTAA 1HIXA 3VBRB 2B8MA 3U0ZA 4Y5Z0 2BYVE 1XNCA 1BMV1 3WP5A 4DMIA 1N1TA 3U07A 4LBOA 3URFA 2PA7A 3S30A 1RUNA 4LE4A 4YZ3A 2DCZA 1CN1A 3LSEA 4Q26A 1KD7A 1RUE3 1QJU2 1R1ZA 2XBO3 4P9LA 3AP5A 4C0HA 1UZZA 4AHYA 1HRV3 1AL23 1DG6A 1OOPB 4PBPA 2EXJA 2HWD2 5I0RA 2Y0OA 2HKXA 5KHKA 2HWB2 2QE3A 4CDWC 5L7OB 3CF6E 1EV12 1W6NB 1NLSA 1ZRDA 4LHNA 2ZMNA 3HQXA 3AKRA 1AX0A 3DUIA 2PHTA 2ZA9A 4FTBA 1DGRN 3FUQA 3SXWA 3ILNA 4AQ2A 5T55A 2UY8A 2VOWA 1H1MA 3WUCA 3SH5A 1AX1A 4XQ4A 2HYKA 1ASJ3 3ETQA 1NXD1 3AKTA 4GKYA 3TB0A 4CDXA 2B39A 4FPYA 4AFAA 4RFT0 4ZKTB 3OPZA 3POYA 4XXPA 2B7YA 2A73B 1RUC3 1NZCA 5F5QA 1RUJ1 4N9HA 3RG0A 5A32A 1O91A 3B3QE 3I59B 2JX9A 2RS33 1H1AA 4YRDA 2YUEA 1E57A 3IWZA 5FAXA 2QDRA 5BNPB 2WZR3 4QPIC 4AHZA 4UW5A 1FOD2 4FXGB 4RHV2 3DN7A 4IV3C 1RUD3 1VBB1 2BTVC 4K40A 2R062 4P9YA 4WM8B 4XHXA 1AR71 1OSGA 2XL7A 4OHVA 2ZX4A 1CX4A 1APNA 3A0KA 3LOIA 4DNYA 5JI7A 1FPN3 2OW4A 4K9SA 4J1WA 3EBRA 2PLV1 2WNEA 1C5HA 3WQ0A 1BBT1 3IBMA 1D4M2 3HBZA 3ATGA 3MGUA 2BVBA 3QOPA 3WW3A 5K0UC 2JJ6A 1S0JA 3RI8A 4X6QB 5JIUA 4JAAA 5T3NA 1LHNA 2E53A 1KQRA 2D3SA 3PLQA 4D7YA 1Z7S1 3AB0A 2XGXA 4FT8A 1PGW2 4W6WA 2QJVA 4FAGA 1HRV2 3M4FA 4N53B 3RDIA 2QZ2A 5DZGA 5K8SA 4GB32 3NAPA 1DGRA 4OULA 3IPVA 1X7NA 4RR3B 4XJZA 3Q9OA 5CB7A 1QJZA 1VALA 1JUHA 2HWF2 4A3XA 3VKNA 1LB2A 2A6ZA 1LULA 1QDOA 4LBQD 3M70A 1DGWA 1RMU1 1VBA1 1RL3A 2GNMA 1IHMA 3V0AB 4QT6A 2VQ0A 4Q0SA 1AR82 1FYUA 5J3UA 1VLNA 1UU4A 4LUKA 4A7KA 1CIWA 1G6NA 2LTNA 3SH3A 3IT8A 3N7MA 1V70A 1QNWA 4ZXKA 1AXKA 1MR5A 1AHSA 1VBE1 2E7TA 2PAKA 3VUOA 4DRVA 1D0HA 5A33A 5LRSA 4AEKA 1H30A 1WCKA 5FPZA 4CDXB 2DVGA 1FV2A 1S0CA 4QPIA 5CA6A 4A7ZA 1SLBA 4MYEA 1ZRFA 4ES8A 4Q8KA 4IV3A 3WHUA 4FQ4A 3ZYRA 5A32B 3M1HA 1OHFA 3ZX7A 4AEMA 2CAUA 1LEMA 2YC0A 3WNXA 2WZR2 2B45X 5JOWA 3AYAA 3THTA 5FQ0A 4GIQA 3OD4A 2R30A 5CFDC 5DG2A 3ALQA 2NYYA 1POV3 4HLTA 1SLAA 2ZKNA 5TSWA 5C9AA 1RUD2 1RVF1 2CTVA 1WMEA 3NO8A 1RUJ3 2XJTA 3LA7A 4P5HA 1I3HA 4E4SA 5I0SA 1NE6A 1FPN2 4FOYA 5K0UA 3N7JA 1SQ4A 1BZWA 2YV8A 2GC0A 3JQXA 3D0JA 3ZN6A 5LK7B 5H9QA 3BU7A 2RS11 4LO8A 4G9SB 1YI7A 5ACA3 2DFCA 5IK8A 1XU2A 4N90A 4L11A 3K51A 2R32A 3ENRA 1VBB3 2JECA 3LOBA 4FPKA 1MS1A 1O4TA 4PIZA 1Q8QA 1Y3TA 1W6MB 1CAVB 3AYCA 3KLSA 1BEV3 4YZ4A 2BNOA 3NKTA 1Y9QA 3NVCA 3TNQA 1YJLA 4AEJA 2XVGA 2PLV3 3VBFC 2XJSA 2ZMLA 3ZFEB 4AEDC 5KXCA 2CYFA 2D6KA 1LGNA 3E97A 5HXVA 1FXZA 2GMMA 4Z07A 3AXEA 4RSUA 1D0GA 3M3QA 1JYIA 4NPRA 4KG8A 1IS3A 4AVVA 3PJQA 1YXWA 3AJYA 3NAPB 5I0TA 3LA3A 1Z7S3 1JN2P 4QU2A 4IETA 4AI8A 3WVJA 4DS0A 3KCYA 3PMEA 4K1YA 2UYBA 2JD4A 1H4HA 3B00A 3UL2A 3TOJA 2ES3A 2UWBA 1RUI3 2VOKA 1XYOA 1OMIA 2D6PA 4Q2FA 3I7DA 5IT6A 1V6JA 1VB4A 1LESA 4M3CB 4E4ZA 5T50A 1ZA4A 1MS9A 5BXXA 1VJ2A 3FLTA 3RWNA 5DXDA 2B9UA 1AXYA 4DFSA 4H7MA 4FPJA 4B3NA 1VBA3 4Y1XA 5CFDA 2WZPP 1QXJA 3ZO0B 3BOWA 3LKJA 5A33B 2IXKA 4QPIB 4MH0E 4MXWA 5K9YA 1GBGA 1N1SA 1NA1C 2ENRA 3BTAA 4LBNA 2Q30A 3USUA 3VHRA 5KXBA 2ZOEB 3U10A 1RUF3 4IV3B 1OLQA 1I5ZA 2QKDA 2VW2A 4LHLA 1VBE3 4E4DX 1XXNA 3QLQA 4GH4C 2RHPA 4OI4A 4LBLA 4YG6A 5JSOA 4I30A 4Q4Y1 5C9AB 4GMP0 4MXVA 4K3UA 1MVQA 1Q43A 3VBUB 2MEV2 3M3CA 3H1WA 5K0UB 2YROA 2C5DA 3R4DB 1HDKA 1S0DA 4XETA 5ACA2 3AMNA 1YLLA 2R1DA 5GALA 1AYM1 2PYTA 1ZZ8A 2E9QA 3VBFA 5JOXA 3JBG3 4AEDA 3G6JB 4PJYA 1BEV2 2RR13 1CAXA 5DDJ2 4IEYA 2DCJA 3O12A 3B02A 4P9GA 1ENSA 3N35A 3CL1A 4RGAA 3ILRA 4D94A 4HN0A 3WOGA 2IXIA 4NWVA 5KHIA 4AYUA 2A70A 2CWMA 3KSCA 5AVPA 4B7EA 1YO8A 3LA2A 3UKTA 2ZX2A 3FHIB 2C0ZA 4IEZA 1NYWA 4XBLA 2BWCA 4URTA 2C9AA 4XHBA 5DUWA 2GZWA 1PK6C 4XJ8A 3ZXJA 3WG1A 3VGIA 1DFQA 2WLPA 4XQDA 2YYOA 5D8AC 4S2FA 2ZGUA 3KB5A 4HZFA 4YVWC 3WDYA 4Y20A 4FPFA 4BMBA 3NV2A 4M3CF 1RUI2 1Q8PA 4HKWA 4N43C 1VIWB 5KHHA 2DTWA 4KWLA 5EJ3A 4WM7B 1U5IA 4I2OA 2WIIB 2V5YA 2X8KA 1QJY1 4BA6A 1H9WA 3WDXA 2AYHA 1YUDA 2A6YA 1XNKA 4DQAA 1NA1A 3FMGA 2JDZA 2DVBA 2R6QA 3LB9A 2E6VA 1O5UA 5L73A 1LOGA 4HVOA 2IFWA 1W0PA 1LOAA 4XQWA 2JG8C 3MDPA 1IGOA 1DQ4A 4GXL