4K40A

Peptidoglycan o-acetylesterase in action, 0 min
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
349
structure length
349
Chain Sequence
LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis lnp21362
molecule tags Hydrolase
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
total genus 115
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k40A02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k40A01
4NRDA 1ESDA 3DCIA 3P94A 1DEXA 2WAOA 1ZMBA 1WABA 1VYHA 4K3UA 1DEOA 4JHLA 2VPTA 4JJ4A 2Q0QA 4K7JA 4TX1A 4Q9AA 1FXWA 1ESCA 5CD9A 4Q7QA 4K40A 1BWPA 5A4AA 5B5SA 4K9SA 5HOEA 4RW0A 4H08A 4HF7A 4I8IA 3RJTA 1PP4A 2WABA 1K7CA 1JRLA 1J00A 2Q0SA 4PPYA 3DC7A 4IYJA 3DT6A 1BWRA 2O14A 1U8UA 1ESEA 1FXWF 1IVNA 3W7VA 4DEVA 4XVHA 5JD3A 3MILA 3BZWA 3HP4A 2W9XA 2HSJA 3PT5A 4M8KA 1VJGA 3DT8A 3DT9A 1BWQA 1YZFA 3C1UA 3SKVA 3U37A 3KVNA 2APJA 2WAAA 4OAPA 4HYQA 4JKOA 4JJ6A 4LHSA 1Z8HA 5BN1A 4JGGA 3SLRA 1V2GA 1ES9A 4RSHA 4S1PA 4OAOA
chains in the Genus database with same CATH superfamily
5E6RA 4Y6LA 4UEWA 5TPWB 1VHTA 2B3DA 1NM5C 3FUOA 4QGBA 5JAOA 1NVEA 2Y60A 4Q3OA 4YCNA 3PDIB 2L2QA 1AR63 2DHCA 4J0DA 3M82A 2OHIA 5DNEA 1X1BA 4AAYA 5HR5A 4AROA 1F15A 5CXXA 1L5KA 4XB2A 4GSYA 5K3CA 3MJSA 3VZLA 2Q49A 4UMEA 1UDWA 1PP4A 1XCLA 1WBLA 7AT1A 1GZ6A 1E2KA 1XELA 2A6ZA 4MQLA 1D5CA 1QVZA 3NP9A 4Y33A 3GPIA 1S4QA 1XSEA 1F38A 3CWZA 2GETA 1XU4A 4YWHA 3T7AA 3BGAA 2DUOA 4AS2A 3NJRA 3ON5A 2JD2A 4EPXA 3MTQA 3QD6A 1I7SB 4CXYA 4RBNA 1HXS1 4GI2A 1YRQA 1ADYA 4N6OA 2GD1O 1X0XA 1VRH1 1FNYA 3AKEA 1GMMA 1TE1B 2XLBA 4P54A 2K5UA 4L5YA 3WA6A 2YKGA 1E4VA 2CN1A 2XGXA 2OYCA 4EY3A 1HNWB 3PHIA 3L7CA 4B4WA 1K8QA 4HFNA 3I0ZA 1V1RA 5IUKC 3L8EA 2QUBA 1U81A 3H9EO 3B3QE 2Y0DA 2DAPA 2QD4A 2J1TA 5I9IA 1B76A 1Z47A 4RIFA 2JGNA 2ZBDA 3ODPA 4FP2A 4FR0A 4UXIA 1M06G 3FOEC 5JWPA 2OCYC 2VKQA 4KR0A 3BXGA 1R6TA 5BYNA 1IZ3A 3O1OA 4IMIB 4RY2A 4MV4A 2BPOA 4KPEC 1R15A 2W91A 3FI0A 1NGSA 1FYWA 3IEUA 4MW6A 2RGEA 4FGLA 1VQ1A 3ZDVA 1VDMA 1WF3A 3A4YA 1VBA2 1RVDA 2PFKA 4EUHA 2CLKB 4IEFB 2OFFA 3K8ZA 4ILKA 2BVBA 5ELMA 2DU1A 1P5ZB 3CKMA 4EF6A 4ZT7A 3AF0A 1EIWA 3CG4A 4AGGA 1EINA 3EZXA 5CX1A 2IHBA 3O90A 1NT4A 5D51S 4Y3OA 1E8DA 3SZLA 5DLPA 2GBCA 5SY9A 1DC6A 4O02B 4PLPA 3COYA 2XNHA 5BR7A 4IDOA 1EUDA 4RTLA 3IOYA 2O8BB 4RL6A 2B8JA 1S2KA 2HIMA 4E33A 2VG9A 3WQBA 4U1RA 4U3JB 3FKQA 1C3OB 3VHRA 1C3VA 1HC7A 1S2GA 1KNQA 1ZD2P 1DHTA 1YUNA 1VMAA 2HXSA 5DZFA 2W4MA 2RS13 1N0WA 3UPDA 5BQFA 4KAJA 4CDNA 3UK2A 1ZNQO 4YZ2A 1A96A 5LWBA 3KQNA 2Q8OA 4KVFA 1ECJA 2BM1A 4F6LA 4RJIA 1ZBE2 2ZDQA 2VLIA 4TLEA 1C81A 3O4HA 3A1FA 1JHRA 1QHSA 2IYSA 3WWZA 1OXKB 2WJZB 4IDFA 3ZCSA 4XUGB 3AB7A 3E5MA 3R9WA 3UN1A 2P6OA 3KUXA 2RAPA 5LQKA 3H2HA 1FNCA 2H7XA 1NVWQ 5ALYA 4AX8A 2NV0A 1LB2A 1E5QA 4J6EA 4B3GA 4NN0A 2GC1A 5IYZF 3NP7A 4MMXB 5JXWA 2ZE5A 2YWHA 2Q5EA 1RQRA 4ER3A 1JX6A 2IUTA 3SCFA 1IBKB 3JVIA 5TEWA 2VHVA 1G8FA 2IEYA 4H16A 2QZ4A 4LBVA 1EPWA 3USES 3AV0B 1EGMB 2BBOA 3VJKA 3RF7A 1ZCAA 3FRHA 4L0CA 2ID4A 1ABBA 2X8WA 1CY4A 2BU9A 1A9XA 3G0BA 1T2UA 1Z4KA 1M5TA 2B82A 4QX6A 1B8OA 2QL5A 3GCDA 2W2IA 5JDBA 1OOPC 3RFUA 2JH8A 3RUFA 1JZTA 3P9SA 4JITA 4S3MA 5KTNA 3VKOA 5GONF 2ZEYA 2A1UB 4JGYB 4OLAA 1JP7A 3E81A 3JARB 2JKBA 4HEA6 4LBNA 3BF7A 2WDZA 5AI4A 4URHA 5FCCA 1N3PA 3WBKA 3IIEA 4P3KA 5AVQA 1QH8A 3L6UA 3ZFGC 1Z3CA 1JHXA 2JDYA 3OPWA 1CLUA 5AW3A 1QIJA 3U1XA 4BAZA 5HM8A 2DWQA 3AETA 4HAUA 4MH0E 2XMZA 2E6KA 5BPHA 1KI3A 2JDPA 3RYKA 3NDJA 4NPHA 5DXAA 1NA1C 2GSWA 2H5IA 2CDOA 4BGIA 4MARA 3CF4A 1F48A 3OE7A 1Y33E 3IIIA 5TPWA 1TM4E 1NF3A 4KR7A 5BWMA 2EKZA 3F3KA 1XSRA 1QU3A 3C7GA 4PYQA 4MJLA 4Q39A 2WKRA 5A6XA 4PY2A 4KR6A 1XEXA 1BXRB 1BKYA 2XZPA 1XA3A 5ILOA 2PYTA 3NWKA 4CKWB 2JGEA 2XBO3 3PU3A 3R3WA 1W5FA 1SQ4A 4Y1RA 3OYWA 3WNMA 3OMLA 3W5BA 1A4IA 1OZ0A 4E3ZA 5C1BA 1ZCZA 3GLFB 1JH5A 1I1NA 1RVF3 1GGNA 1CX9B 1J2TA 1HYEA 5LMNB 3PQ5A 4B4PA 2JHAA 4ETWA 3AMPA 2VJAA 4EATA 3GNEA 2DFLA 1QDLB 2OVUA 5FWJA 5BN4A 2X9VA 3FHJA 5FFOC 4YMTA 1A7UA 4RVHA 4CNQA 2JI9A 2RMU2 3MDPA 2XWJI 2HYDA 3KE9A 1VIDA 5DTQA 4RR3A 3U3MA 1LFDB 1UH5A 1UEJA 1M2VB 3HV2A 1Z5OA 3N39C 4CU8A 3QVWA 3Q9OA 2Q3MA 2XT6A 1E9RA 1SVOA 1NN5A 2JIZA 3FFQA 3POBA 1ZYBA 1SVLA 5CUQA 3WWCA 3K7EA 3UM9A 1V5EA 1D5WA 1ZITA 1AK9A 3UK9A 2TYSB 4KNYA 5KYXB 4NZOA 2Y1LA 5CYPA 4ZGBA 5ICSA 1T0UA 1U9ZA 4BQNA 4L02A 4OHBA 1HXHA 4EJSA 1NZCA 5L6LB 2F8TA 5EIHA 1WBBA 1RUH1 2GZ2A 3UAOA 1CULC 1HJGA 3NNNA 1NNLA 4XHXA 3P4XA 2ES3A 3JV7A 3QMPA 2C4UA 2QL6A 2EFGA 3Q1KA 4FYPA 1R6AA 2OUHA 5DSZA 1X92A 1TYZA 2J7MA 1J8DA 2PXHA 1I6XA 3EJ6A 1J83A 2CY0A 2FP4A 2VSXA 2WJGA 2DKNA 3GLHA 2J3EA 1UM9A 1G18A 3RW9A 3CKHA 3WDTA 4M0MA 1E3WB 1Q77A 4NIDA 4RIGA 4RD3A 2P27A 4LDNA 3LBFA 2HU5A 2NZUG 1MRZA 4I6GA 1NLFA 1XVLA 5I45A 3C4QA 1KD7A 1G9DA 4QDKA 1DTWB 4Q5IA 3DBLA 4D74A 3AZYA 2IYPA 1UDXA 3H9BA 5IW0A 3UJ8A 4B5LA 2QTVB 5DX0A 1YB4A 3HQRA 2PUTA 5KNBA 1P75A 3KCXA 3FVWA 1K5MC 3SH5A 6CHYA 4UBJA 3PFHA 4C29A 3BSYA 4E2FA 1CIPA 5AM3A 4FBFA 1OJLA 1NYQA 3GZTB 3PVEA 4BUCA 5I7FA 4UTVA 1BBT3 3T7IA 4X94A 3IT1A 2EIXA 3BMOB 5CR9A 4CP0A 4HV4A 2IL1A 2EVWX 2GH1A 5FOWA 3IMGA 1DU3D 4E13A 2CU5A 4POOA 2LRHA 4BHPA 4RTQA 1D0HA 2YCLA 4LDAA 4QWWA 4CUKA 4OKIA 2YL2A 4RFSB 4OQ8A 1G9BA 1H2BA 3ZLTA 4MUVA 4NJOA 4DQLA 2P2YA 2YHAA 3VFDA 4UTXA 3C3WA 1ACJA 4DR1B 5TT0A 4P34A 3MEQA 2QVBA 1Q7TA 3STVA 4MQ6A 2QXYA 3AB3A 1EQAA 4QOFA 1OU0A 3QJYA 4X45A 5HRAA 2O2IA 5FIUA 1GGKA 4YO7A 3U7QB 3KHBA 2REOA 1Y1QA 4J2HA 1FV2A 2JG9C 2FZ4A 2O07A 4AXBA 1KORA 2WZDA 3I42A 4G41A 4C30A 4WN9A 1PKXA 4L3OA 2IHKA 3P0FA 3AJ8A 1NYWA 5I7EA 5CMLA 2A9FA 1EFPB 5DGHA 1MO5A 1ULSA 4R2IA 2PA7A 1U11A 1AD2A 3KKOA 4QUKA 5H82A 1PFUA 1GM5A 4YXWD 2WA3A 1ZD3A 5DI3A 2JAQA 2P90A 4WCFB 3KSMA 4I3HA 4AMGA 1XD9A 3RUEA 3C8MA 3P97A 4FFMA 3DDZX 1QY4A 2FPKA 1Y4WA 5BSWA 1PX0A 1K7EB 3G8BA 3OJXA 4Q9DA 3N8HA 4H7EA 4HH4A 1VFPA 5BOSA 1L8LA 4AMUA 1WCUA 3S3TA 3ZE7A 2A1IA 3AFIA 4QYIA 4O1HA 3F90A 1QKKA 3IV9A 1KDTA 3IODA 5CH5A 3CGWA 5IVFA 2XXAA 3DEYX 2P6PA 5LDHA 2VJBA 4UW5A 4K9KA 4MMYB 4HDNB 3TLKA 2HRBA 4M7RA 3UMSA 2BGOA 1KHTA 3QPWA 3H9QA 3I49A 3EF3A 3K16A 1JN0A 4QDJA 1EFDN 1UZMA 2ZAMA 2ERYA 1GNSA 2XVAA 5H3LA 2P8JA 3M6LA 4F6CA 2W2NA 2F8SA 4RQAA 1PR1A 2XRYA 1GZCA 1KARA 2PG3A 4ZV4A 1RB8G 5AVXA 3P5BA 4AVAA 1KVRA 1NUUA 2CZQA 1T6XA 4QC2A 3OQVA 1AG9A 1GGMA 4FYXA 1Z56C 3C70A 3HPNA 4W5TA 1VYUA 3U4HA 5I4KA 2W6CX 4YRLA 1JSXA 3KOMA 2H9YA 1WUHS 1ZGZA 4AKEA 3R41A 4IXLA 3AUKA 5FYIA 2P3LA 3E4CA 3CEHA 1EX1A 1VYVA 2VYNA 1PZ9A 4OU4A 1ZU5A 4JB2A 4G84A 1DOHA 4IX1A 3PLAE 1CZSA 4G4FA 1MENA 3VBCA 1LH0A 2EFYA 2M9MA 4IJKA 1R093 3IPVA 5FKBA 4QQ2A 3CUSA 3DW3X 2ZAHA 4MYSA 4OUDB 3G7NA 5AVSA 4PX2A 3K0CA 4CDUB 3L41A 4ZYYA 3HCFA 2Z2SB 3S2ZA 4DZTA 5IJWA 4XJXA 2IS2A 2H9AA 4LKDA 5IJXA 3I4IA 3GLHB 3IAQA 3DO6A 4EW2A 3R05A 3A31A 3FPCA 2FP3A 5CA0B 4LWZA 1FS4A 4RGBA 4BBAA 3PVOA 1GYKA 2G07A 1GHTA 1H0BA 4C4OA 2WAAA 3P7MA 1IN1A 1RTVA 4C7BA 3CB2A 4JLVA 1JHPA 2J33A 1UMKA 2DLDA 3ETNA 4WOBA 1NIJA 1Y3AA 2VK8A 3ESAA 4MHSA 5HKBA 5L9VA 2P35A 1KRIA 2D5FA 2PHWA 1JH9A 2VPXA 1HL3A 3THOA 3PDCA 4MX8A 1A9TA 1XZCA 4XEZA 3BIEA 4XDQA 3TNDA 1MDBA 2HKIA 4UPEA 1SPXA 2W4QA 4PYIA 1I0ZA 2VA8A 2YJ5A 4PLWA 2ZEJA 4JZKA 2XX3A 2I1WA 1LHNA 2JAWA 4Q1VA 3E9RA 3HBZA 4PS1A 3OZGA 5E8JA 1TM5E 5CJJA 3W9UA 3W5DA 1FDIA 5KBFA 3HWWA 3TR6A 1ZQ9A 1SCIA 3DEIA 2BFDB 3HRIA 3RWBA 3OUIA 4XARA 5I0TA 3KVYA 4DIDA 3SC2A 4YJDA 1N1SA 2VT3A 3IDEA 2QVXX 1YZNA 1XCOA 4AVTA 1QTRA 2O50A 1XLTA 1DTWA 4MGEA 4E5UA 3BD8A 3OBIA 2W48A 3L02A 3FBWA 4ONEA 3A3NA 3E53A 3PF9A 4OJQA 2IZ7A 1YFKA 3A1DA 1W06A 2OKCA 4I5GA 3W59A 3GFQA 4EGSA 4O1MA 2WUHA 2NV6A 4LHNA 1D2NA 2PXCA 3MWYW 1XGKA 3VZKA 2OESA 1B41A 4RSMA 3UVEA 3DGEC 3WINE 5BXQC 3Q12A 4ARXA 1OPXA 4KQMA 2C5DA 3UAYA 4GLBA 1RYFA 2J4DA 4DB4A 3AOEA 3B1JA 1SIWA 1RACA 1EX7A 3HYTA 2VHEA 3U0BA 3MQFA 4YQYA 3KAQA 2DPMA 4R51A 2G1PA 5EJ6A 1W76A 1JIIA 4RD4A 1IHPA 4CL2A 1XTUA 3PF8A 5C4WC 3WIBA 5AI0A 1U0GA 4HXFB 1N1DA 3MINB 3M33A 1ULDA 4WASA 2G36A 3H8SA 1F2TA 2XQIA 5G04L 4YNBA 5H9VA 2CXNA 1R4NB 3HXKA 3U9LA 3CY6A 4DCNA 1QHHB 4AJ1A 3IDAA 2KM1A 2W2KA 1TU4A 3ZWVA 2P6CA 3H8JA 1OWNA 1M7GA 4XLLA 2VQAA 3ILRA 1KRXA 2BDUA 4ZO4A 5DIZA 3NATA 5C31A 2PGJA 3DPRB 2W70A 2QX6A 1Y9GA 1YHYA 4HYYA 4ITUA 1YMUA 3R7SA 3IMNA 5B1HA 2ZX3A 3TNLA 1HR0B 2GN8A 1D1QA 3S81A 1GILA 3JQXA 1XVIA 2VUUA 4Z3DA 1DBPA 4ZI7F 3K92A 3GLIE 5HJEA 2WNUC 2AFHB 4JI8B 2EG9A 1W5EA 3BBLA 2VYQA 4JLBA 3TRDA 3DDHA 2CWWA 2XCSB 3Q2IA 1AR61 2D13A 4R2MA 2Y67A 5JC1A 3ZHUA 1U2DA 2G70A 3ZKUA 2W2LD 2OBNA 1QOZA 3L07A 4NOKA 1TQDA 1QDCA 4L3WA 4TTPA 1P4RA 5AW1A 1ZBA1 1Z2EA 1FP4B 3LVRE 3RZJA 1KEVA 1YA8A 3H2GA 3K2EA 2BHTA 3AIMA 4KB5A 2JJ8A 4FT4A 4YIKA 4HRAA 4BWGA 2R8OA 4XLTA 3I28A 4NFHA 3V8NA 5EJIA 1LJLA 4HDMB 3UT5B 1ND2A 4HAXA 2QW8A 2QJTA 3AP6A 3K9GA 4RPGA 4N53A 3GNSA 2WF9A 3LVBA 5ITSA 3SCHA 3U31A 2A0UA 2IPXA 8ABPA 1H2MA 4NAHA 4N8MA 4CSWA 4DHEA 3JD4A 4W65A 1YDEA 3PPYA 5JBNA 3AL5A 5LRRA 1I3MA 5LQRA 3MOIA 4J25A 2W2PA 2LPMA 2NADA 4FGJA 1COV2 3WNQA 3H83A 1NZIA 1OQEA 1OROA 5G4LA 1HQWA 4YUYA 3AKCA 1GUFA 2RK4A 2JWPA 2MU1A 3KXPA 4OG2A 5AIBA 2IWRA 2AUNA 4NXNB 3ZNPA 3UXHA 3DLCA 2AEJA 3IBTA 1ATZA 4BLPA 2WSMA 4D4GA 1XCPA 2HAEA 4Z8XA 3LBYA 5I7OA 1EXWA 1WPGA 4WCDA 4CKZA 4TQGA 2X0EA 1P2GA 4B32A 2IIPA 1WCXA 1C29B 4YAUA 2WIJA 1AQIA 4HT1T 8OHMA 4D9HA 4DPNA 2JL1A 5CFCA 1UUFA 5D1NA 2NP6A 2H2GA 3KJHA 5FTTC 3C7HA 4K6HA 3HADA 1WZEA 1A77A 3L06A 4PI0A 3VN4A 5JZGB 4AJ9A 4Y5Z0 1FATA 3VH3A 1RVF1 4V1CI 3R0JA 2G0AA 3O8CA 3EIQA 4TM7A 1KI6B 4HZUA 1BWPA 4A9AA 2ZMLA 1U7HA 1E3JA 2OCAA 3EPRA 4GWLA 1X7DA 4I8IA 5D3MB 3OJOA 2A35A 3M34A 1C4XA 4XFFA 1NU6A 2ACKA 4KN5A 2OCDA 5FL3A 2PN1A 2VHWA 1UMDA 2VHQA 3ICWA 1DKUA 4QXMA 4C7VA 3LY9A 1Y80A 3OHSX 4UMDA 3DZJA 3WF0A 2E37A 5K20A 2JFOA 4UULA 3WG1A 5FEMA 4R84A 4HNHA 5DN2A 4KWHA 3NRUA 3K1AB 5BV7A 2YFUA 4XLZA 3KFLA 1UZWA 5JCOA 1X8MA 2JRLA 3LWZA 1W0JD 4N5IX 2V3CC 3HZZA 2OX0A 1GSHA 2H2AA 3FDJA 4LTAA 1XNGA 4BZPA 4YK7A 4G4JA 4P22A 4EG3A 1G7YA 4J6GA 5LC1A 2A9QA 3SISA 3TG8A 2E9QA 2VUSA 2JIOA 4PPGA 5GINE 2WWSA 2P5UA 4ZU1X 4UCQA 4M76B 4G0QA 2PGAA 1XEAA 5LLTA 3AILA 1YOBA 5D6OA 3PR2B 2FFJA 4Q3EA 2X7XA 1NW6A 1MJFA 2J1UA 4RHV2 2HCBA 4BU0A 4PR3A 5EY5B 1RUF1 1PFQA 5LXTF 3L0PA 2Y1OA 2JE7A 2H29A 3NFYA 1AHPA 4YJFA 4DLNA 2PBLA 1AQLA 2WQ8A 1LGBA 2J3DA 3R09A 2GD6A 1XRUA 3EGVA 3R9XB 4EB6A 5KSOA 3IKTA 2RHRA 5EUMA 3U9SA 2PXJA 2C00A 4Y2YA 3WLQA 3GFBA 1W85A 3UT0A 4AYWA 2C42A 2DFPA 5JDCA 2WHXA 1FSPA 4FFDA 4Q9LA 4PSVA 3KOWA 5DCUA 4TVBA 4IHJB 5HIKA 3H8VA 3BTZA 3A9RA 1T6GC 2H5EA 2E33A 3DD5A 1M2NA 4CETA 3NORA 3W78A 2VJQA 5LDGA 4H0NA 5DLEA 1CJBA 1W4RA 4PRLA 4FS8A 4BU1A 4DIBA 3DE4X 3O0DA 5JSYA 1C1DA 1M76A 1MP0A 3H9GA 2R1UA 2WNHA 2EFCB 4Q9JA 1OV4A 1UK8A 4F96A 3CMCO 1NVBA 2Q4RA 4LIVA 4NMWA 5CTJA 2YV8A 2O3RA 2CWSA 3OH8A 4NSNA 3AJZA 3ADOA 4CKBA 4RAOA 1ULUA 1W94A 3G49A 3QI2A 1PK6B 1H9PA 4ASMB 1EP0A 2W2XA 3LUDA 2VOEA 5KX5B 3ESRA 1WXWA 1XZQA 1K88A 2LXNA 1GOTA 2OBBA 4C4XA 1WULS 3M0EA 3INGA 3QIVA 4NBNA 3K70D 4CHTA 1A1VA 2OORC 3PPWA 4R54A 4BCBA 1ZUHA 5IKXA 5JOYA 4JGGA 1G6OA 4COVA 1YNOA 5CT8A 3CO5A 3OOXA 1GGHA 3QVLA 3BK7A 1CR1A 1XWWA 2PRYA 2BBVA 4UXHA 4WV8A 1PZFA 4PPFA 1ZBDA 2ONYA 5EVJA 1L3JA 3ND7A 4OFBA 1VECA 2Z95A 4DCOA 5LA6F 2EJUA 2B4KA 5G02A 4L0PA 1NWHA 5G41A 1NF2A 3LKDA 1NCQA 2DG2A 2GXUA 3A28A 1ZAKA 1E3MA 3PPVA 1U4NA 2BRUC 3HP1A 5DM2A 3ID6C 1YZGA 3FUUA 1DJOA 1YJBA 2ZBRA 4BKQA 4LO4B 3DMRA 3C5HA 1Z8NA 3U3DA 1E2IA 4AYTA 4BN5A 3UUEA 2ZBVA 1NV9A 1WOYA 2IEDA 2QE7A 2VSQA 1IWPB 4X7PA 3G5AA 4EEXA 1NOVA 4WEQA 2GZRA 4BA6A 1NVFA 4CRQA 2ZSEA 1PYDA 5KHLB 3MC1A 1LK0A 3ZZ1A 3LF2A 4HUQB 5FZOA 1L3IA 4QGHA 5GIOE 4CUBA 1QANA 1H1LA 1B6GA 1RRPA 2AFVA 1E5XA 1QWOA 1HZZC 1TI7A 5DT2A 3ABSB 1A5ZA 3HN6A 3OQBA 1JJAA 1H5QA 1B43A 5TMPA 5J5CA 1R8SA 4KQFA 3CG0A 1QGYA 3D1JA 2GTPA 4J7CA 3FMFA 5FI5A 3VNUA 2WFF1 2V7GA 3NBKA 3U14A 2VA9A 4Z9AA 1GNRA 4D8UA 2DVAA 3AFHA 1V48A 4W1SA 1P1RA 2WPNA 3R5FA 2AG0A 1PR4A 3U1VA 1KOJA 5GJBA 3DTVA 2J3QA 2AREA 3I45A 1UAIA 4XA8A 1ETUA 3T4VA 1DWOA 1BAPA 1K27A 2WLSA 5HIAA 3ZU2A 1OU4A 1XRRA 4LK7A 2UWCA 2C9AA 4BPZA 4R8SA 4CMHA 4B73A 1SMKA 4LYEA 4OKNA 5SYMA 4YGDA 2I7XA 3INNA 3B52X 1W88B 1SKBA 5JCPA 5EPUA 1PR6A 1XNCA 2YICA 4ZHNA 3BL5A 4CVNA 4X1OA 2ZVPX 1Q2UA 5AI9A 2Y34A 4JB3A 3TR0A 1I6LA 1M1NB 1KVSA 2AI1A 1C9EA 2H4YA 3DVRX 2BW0A 1OOPA 1SU4A 4E7OA 3JQCA 3TVDA 1ZCFA 4MQUA 4F91B 4EMBA 3HYNA 1XBTA 4LJAA 3HB4X 4MDEA 1UBJS 1FI2A 4CGYA 2D40A 1T26A 2GI4A 4JBNA 1XTPA 2CZGA 2XCQA 4LMRA 4TSVA 1IM5A 9LDBA 1VBD3 1BJRE 4CEHA 2I8LA 1FY2A 3RS9A 2CFTA 1SQSA 2R6CA 1K2WA 1UZUA 3PWTA 1Z7BA 4GMXA 2EIDA 5I6DA 1ZK0A 2UUCB 2MSKA 1E9DA 2VBDA 1XEWY 1DV1A 2ATCA 4Q24A 4E2YA 4WFQA 3A22A 1K9VF 1XZGA 5ADVA 4WM8C 1RWNA 3S99A 1OGJA 2ZSJA 1GTG1 4U9UA 4ACAA 1UC5B 3OPMA 5BNNC 4QNNA 4RTJA 2R16A 1E5RA 4MRPA 2F43B 2AZXA 5DYTA 4ZP1A 3EK2A 4BVLA 1M54A 4EP1A 3I39X 4XGQA 1GV9A 3AUTA 2X2EA 4CDXB 4Q15A 1TCCA 3SM9A 2HIGA 4CL8A 1Q1QA 5E6UA 3ZHBA 3HA3A 1DZRA 1XROA 3NM5A 5DKFA 3KUKA 4CM6A 2XKOA 2ZYTX 1GP4A 2WNUB 1CN1A 1K63A 4AHWA 3A1NA 4NMMA 2C0QA 2R86A 2PLWA 1Y1SA 2P9EA 3MGAA 1KP2A 1EUQA 4NRMA 5AW4A 1HETA 1TKCA 4BO4A 1SVMA 2SKEA 2AXQA 3UFBA 4C5CA 1II9A 4K9DA 4O5OA 1F2UB 3KQOA 3ES4A 4E4ZA 1BX1A 2DERA 2PFWA 5JSQA 3EWAA 4X90A 1JAYA 2PELA 1T35A 3GOQA 1L4MA 2WKQA 3GGGA 2FWRA 3H2BA 2VCBA 2ZR7A 4AAPA 1LBHA 1M72A 1VSVA 3AR4A 4JI3B 3I2DA 4CE6A 1IPFA 5K0NA 4B71A 4KXVA 5A62A 1X1CA 1RQPA 4PQ9A 4BQEA 1RLJA 5AM2A 3LOIA 1AF7A 1CONA 2NU8B 3AEYA 5HCNA 3AMHA 3DBRB 4C1BA 2YHBA 1W4AA 2F17A 4MWTA 2VXCA 4BRWA 5KHOC 3J7MA 3S2GA 2E9SA 1BGWA 4A3SA 4EMSA 5E6HA 1OPOA 4RPCA 4G24A 4JLWA 4YAFA 3RBZA 2D43A 2AV6A 1XQ6A 2FMYA 1UZVA 1ENOA 2DC1A 1TD1A 2BZSA 5KNBH 1I1QB 3U17A 3D7NA 1Y4DE 3ESCA 4RD0A 4PCRA 1RC0A 4LXYA 1CUSA 3KF3A 1KI2A 1QG0A 2KSQA 5F5XA 3N8DA 4BISA 2BRTA 5COAA 4M0UA 4ASKA 1JZSA 1X7YB 1ANKA 2Q50A 3LPDA 3K71B 4KKXB 4UNSA 2CFOA 5JAQA 2VH5R 1H05A 2V7UA 1LULA 4IRXA 3JZDA 1ZOPA 5E95A 4UBLA 1P3Y1 3IP9A 2R063 2YWJA 3P0IA 4I4TA 1EFVA 1M10A 3PNOA 3T94A 4LO6B 4UFNA 1SA0A 2D6MA 1XQ9A 1UXJA 4W6XA 3TZBA 3USUA 2HPVA 4NZZA 5LQCA 3V3TA 4DRVA 1MOPA 2YUTA 5C1IA 3WLRA 3HL0A 1E60A 2AEMA 3D6AA 5EE3A 1EGVB 4M1QA 1NSYA 4GXQA 3DDOA 4LRXA 4ZZ3A 4ZZIA 2JZCA 3T5PA 1CR4A 5KJFA 1XVVA 1R6VA 3QWHA 1QMJA 5H9RA 1QGUA 4Q7KA 4R8LA 4WZAE 4LBZA 1P5RA 1FJHA 4CM3A 5EC8A 2F4PA 4P2BA 4IV3C 1HK7A 2F1JA 1TKRA 2AF3C 3ML1A 3S28A 1E1RA 2XDAA 2AN5A 3CQ9A 2FCTA 1NR1A 1M8GA 3VBHB 2HO4A 2P5TB 3G9UA 1M0TA 5ENZA 4I3FA 5D86A 3UUFA 4RVUA 4MPRA 1YZ3A 4HDKB 3WGHA 3IQXA 3WW3A 3N9MA 3GYBA 5K0UA 3TEJA 1U7WA 2JG9A 5EJ3A 3U4DA 3HT2A 3SHVA 2I07B 2WJAA 3VVMA 1FVOA 4DSZA 1ISRA 4MEBA 4PZYA 3OA0A 2A3RA 5ES4B 5IF3A 5BV0A 2VUIB 4YIHA 4CG2A 1GZDA 1G5FA 4L16A 4M49A 1XEXB 3ZDBA 2D5LA 1FV3A 4FVTA 4GMP3 3D1LA 2YJNA 4WX2B 1Y3IA 1XJ5A 3AVPA 1TMOA 4OM7A 5FO8B 1WQ4A 3UJ3X 3BGSA 1D9ZA 5ALOA 3P0JA 1KJQA 1OZFA 1IOZA 1JIXA 1JFLA 1TZKA 5LQAA 2VP9A 3OZEA 5FPKA 1GXSB 2AX3A 3CHXA 4D7TA 5LASA 1Z0FA 1C8VB 2I6XA 2CVOA 3H9UA 4NHMA 4JVNA 4D8YA 5IAXA 1IJEA 3PXDA 4PF5A 3ZVKA 3U4MA 2O54A 3DPSA 4JGZA 1B3RA 4AWBA 1R5JA 3B00A 5C8VA 2MSWA 3Q3IA 1DIAA 4OYYA 4QZVA 1XAHA 4HWPA 4MDFA 4OYRA 1UEIA 3T5CA 1C0IA 3NC0C 1ADBA 1SD1A 4A2UA 2DF8A 1QJX2 4JBWA 1SQ0A 2CDPA 4WM7B 2JDHA 2RGNA 1OT5A 5J40A 3VDQA 3OQPA 5IYZA 4B81A 4L5JA 2ZJ8A 2XKBA 5BRJA 1VIMA 1RUI2 2Q2OA 4WVZA 4MP8A 5BMOA 1ZNPA 4GI3A 1YTLA 3VDXA 2ANCA 4FS3A 1KFBB 1EUDB 4RETA 4M1TA 1JHQA 3I3BA 2EU8A 5SYNA 1PGOA 5KSZA 1ITZA 4H6VA 2C4MA 4EY8A 4RQBA 1ISIA 3B7GA 4KE7A 2HMUA 5JSHA 2WD9A 3VR1A 3LDFA 1KBQA 3EMBA 2AD5A 3FPAA 1JI0A 3VX4A 1Z4QA 2FDFA 1W6NB 4IZHA 2J5BA 5EJ1B 2EFHB 1UAAA 2KM2A 4CVUA 4M88A 1AZWA 1DO8A 1QR6A 5F2KA 1EK6A 4EA9A 4IEOA 3SQXA 3AK4A 3WC4A 4JAAA 1SKYE 1ZOLA 5EZ6B 1ULTA 1Y6QA 3FYSA 1D7OA 2QDKA 4JN6B 2O7NA 4PW0A 2JCVA 4DW8A 3MT9A 1GRNA 1DCSA 4RGAA 1M67A 1TVMA 1NHGA 2NO6A 3E1F1 3BWYA 3DDNA 4AKSA 1IEVA 5LMUB 1MX9A 3NO4A 4IDCA 1OR8A 2WVGA 1E6MA 2DF7A 3ZZNA 2BGRA 2RG7A 3IPAA 3QU7A 2E5FA 3PIRA 2YYZA 4AJPA 4OHMA 1BA3A 3OURA 1JMKC 5FFFA 4MSUA 2FCUA 4IM7A 1AY0A 3PHBE 3OFND 1IPJA 3TIFA 1VBA3 1XNDA 1U2GA 1GA1A 2FPMA 4MUFA 5CH3A 1RD4A 3H1GA 4K6CA 1H1TA 4KH0A 3U37A 1N3YA 5L7TA 1JXAA 1EFRD 2IJGX 2C2GA 2EHJA 1B26A 3CR3C 4XR9A 3FTPA 4JJKA 2Q0XA 4YONB 1JIQA 4EKEA 3QLUA 2Q3FA 3POFA 1CJCA 1XU9A 5FBZA 3ESQA 1KQPA 1SZBA 5JAXA 3CF4G 3Q15C 4JKIA 4Q5OA 4E94A 3N75A 2IV3A 3EG5A 3BHMA 4YJ2A 4YLYA 3VZCA 3K3OA 3HBMA 3PDQA 3WB1A 4PDWC 5AVUA 4TS1A 2XRFA 2HRRA 4KRXA 4ZYVA 4AF9A 4WV3A 2WYHA 2CE2X 1A9RA 2G5TA 2WTBA 4C9BA 3LEKA 1WUVA 3CZAA 2VNKA 4XYLA 1XRMA 3BFXA 5JSKA 4ZT5A 5JU6A 1UDBA 1NI5A 1DG1G 2WM8A 1QJEA 3TIXB 4ZJYA 1O6GA 3JB8A 3DT9A 5IBQA 1YJ5A 2OA2A 5AK5A 3DKRA 4L5CA 5FLIA 2E21A 2XL9A 4AQ7A 5ADWA 1G3RA 1ZO8A 2ZK7A 4CEYA 2QRMA 2ZU0C 3W5IA 2P0YA 5JZBA 3EDQA 4BASA 2VDWA 5I4BA 1YB2A 2B4RO 5DX8A 5JCJA 5IAKA 3HJFA 2FV8A 3SAJA 1Z8DA 1WUIS 3QEBZ 1KI6A 2PH1A 3D3QA 3O1TA 4CTOA 1E7SA 4KI0A 5JQGB 1JHOA 2SHKA 4LXTA 2CFRA 1Z75A 1ILEA 4OUDA 4XGKA 1HT2E 3D4LA 3O8RA 2E4WA 5LCWL 4EG8A 1RMYA 1M2VA 2NTVA 4XJTA 3ET4A 3DYBA 4ZQHA 4JI5B 4MVJH 3VZDA 1LSJA 1TXGA 5EJ9A 3MB5A 4UCFA 3Q4GA 4JKLA 3ADDA 4JOSA 4O4IF 1U0HC 1X0VA 1V6IA 5AW5A 4DM4A 3C3YA 2DQSA 1VCHA 1KETA 5T55A 1QZTA 4D3SA 4CCKA 5FBLB 2V5VA 2B83A 5A70A 3W5MA 1QC5A 5CDYA 1TC2A 4IMJB 3RNLA 3AI7A 1PJBA 5JFGA 4XF4A 3Q1LA 5A7SA 5EJ7A 2WF8A 3PTLA 5KXCA 5L3SB 4CKWA 1ISMA 5IUQA 3A7QA 3V7UA 5I91A 4UTPA 4WKBA 3F95A 1CY0A 3ZI4A 1NN3A 3BCUA 2QN6A 3CSUA 5B2EA 3ER6A 4GAZA 4QOHA 1PTJC 3C3EA 1ZCJA 2PJZA 4UCXA 1ILWA 2OL4A 3HYLA 4RJ2A 1G8JA 5FLEX 1WHTA 1EUCA 5GONA 3S2FA 2P2ZA 5TQ2A 4ANFA 4BAUA 3VKWA 5I4CA 3IP7A 1QH0A 5DCLA 3V6MA 3C8HA 1JN2P 1PX4A 3AP1A 3FVRA 1JPJA 3T06B 4GB33 2A3NA 5JC8A 4LXHA 3RS8A 4BKOA 4MVJM 3AP3A 1O6BA 3ADCA 2XZDA 5FZ4A 1U0TA 3S7ZA 4FOWA 4CM4A 1G2IA 1RAGA 3SJAA 1SNYA 1IE3A 2R44A 3PNQA 2Q6TA 2ZJAA 1YDGA 5JPNB 5K05A 3MWLA 4DDVA 1XK6A 2IYLD 4FHFA 5BYAA 3M4FA 3PLRA 4D4JA 1SPPB 5AW6A 2O5EA 3BRCA 4S1VA 1Z6XA 2AGVA 4F1JA 4EY6A 2QQ0A 3MAGA 3EZ6A 3PSHA 1C41A 2RB4A 2EYUA 3B9IA 1R0XA 1RYMA 4UUMA 1HDIA 4ZS2A 4X6XA 2V7PA 4FZ5A 5CT6A 3LW8A 3UY4A 3EGOA 4LYAA 1SOWA 4UAPA 4RH1A 1LU9A 2XXZA 5EXXA 1VRVA 1WUTA 4BFTA 2LCIA 4YT5A 3EUFA 2HLPA 2PUVA 4OQ4A 3KB2A 2WZBA 1CRQA 5FLKA 3KP1A 2QQFA 1AUPA 3GQVA 4DG5A 5GLZA 2WP0A 3LU1A 4MV3A 4UHFA 1S0BA 4HQ0A 3W04A 2VBCA 4DY3A 2EP5A 7MDHA 2REXB 1Z63A 4ZAGA 2ST1A 4UD2A 4YUAA 2ZAIA 4EHFA 1Z7EA 1Q1ZA 4N7UA 3ZHZA 1Q43A 3QUTA 1OH4A 1RUD3 2WSIA 2H0QA 1CDEA 1CERA 2Q2NA 2XMQA 3KSAC 3A4MA 4RA6A 4G63A 4BC1A 2BCJQ 2PUBA 1PQPA 2ORED 1U0FA 3JTMA 4URYR 3TOZA 2GP3A 1G291 4BGVA 2A5JA 3IKVA 1BCSB 4TLFA 4EV0A 3UMBA 3RJ5A 3R20A 2JHPA 1GUZA 1PVC2 1O58A 4CPBD 3A4IA 3ELNA 2OXCA 4TVOA 3O4RA 4Y3UA 4NCXA 5HV0A 3JZFA 1EKXA 1B6TA 5F33A 4E46A 4KU8A 2NSHA 3KFVA 1ZD4A 1K8YB 4JGBA 1JYEA 1KS2A 1UPBA 3FROA 4CDWC 5BNPA 5E2BA 3VI4B 2RE8A 3GA7A 3CC8A 4L5IA 4QB6A 3Q72A 2R85A 3KSCA 2Q4DA 1GGFA 4MKRA 4D42A 3EBOA 4XEHA 3OX3A 5G53C 3HJRA 3PS9A 4MW1A 3GAFA 1EVLA 2O1WA 3NHLA 5E4YA 5BPXA 4LFAB 2HJVA 2PNFA 3ZCXA 1DG3A 3CRQA 2Y0OA 2QM7A 5ESDA 1QGDA 2VWQA 4OGLA 3PXAA 5HTKA 3SC4A 1F2UA 3ZHXA 2IWGB 3WWPA 4I50F 3M2TA 5IBCA 4W5HA 3K15A 1LDGA 4MVYA 3GT0A 5JH7B 1K7YA 4ZZ5A 2ZSUA 2VUCA 3QCWA 1LI7A 4V0RA 3CH7A 1CNMA 3KLNA 1JXNA 1JR2A 1U8XX 1E6LA 1VLNA 4I0AA 5F9FA 5LKAA 3C8XA 2PA3A 2E4XA 1TFUA 3B2QA 5HIMA 3VYVA 1KAEA 1UD1A 1Z4PX 4NOJA 5EIEA 4ZC8A 2ZCWA 4XUCA 3AJYA 4TTRA 5JZ9A 4XUPA 2C8KA 5GGXA 5A6QA 2CLHB 2YFYA 3BCSA 1FYUA 5AM5A 2XA9A 2HRCA 2H1LA 3STWA 3WIUA 3CX7A 4BMDA 3LYHA 4RQPC 4G07A 5SZIA 1A69A 2WMDA 1PV1A 4OTZA 4H1WA 4C1WA 3TCNA 1KPHA 4OYUA 3MWGA 1J09A 3OMWA 1ZLYA 1UBKS 4BVKA 2P3IA 1Y3HA 4FGKA 3SKYA 4UBMA 1K3TA 5LOVA 4MO3M 2Z42A 5FXVA 5FZ1A 1FK8A 2EEPA 5E9QA 1Y8ZA 3TWOA 3AUSA 2PMCA 1YBVA 4TRNA 1GIAA 3ZFFC 3VJRA 2CLIB 2OXFA 4EQ6B 3H87A 2J48A 2XH6A 2W0SA 1YWGO 3JR7A 3KL4A 3HR9A 3EJWA 4BNFA 1EESA 2PGXA 4BQXA 2I7DA 2XF8A 3Q3CA 1PGL1 1QIDA 1XAJA 3ZXKA 3QHQA 2VSNA 1U1FA 2JIDA 2RMU1 4XFIA 2DU0A 2YC2A 3EH1A 4AULA 5DM60 5EZWA 1DQ4A 2XQXA 2ZU6A 1H8HD 1EGAA 4Z07A 4ZEMA 1F4LA 3RRFA 3I61A 4JL8A 2C24A 3P9YA 2JCYA 2CXTA 1T5SA 5GZDA 4AEJA 4BMNA 1N78A 2AG1A 2DY0A 3NOOA 1TJ5A 3PTZA 3TI7A 3BOPA 2BCEA 4JQTA 3ZLUA 2IH5A 1HFKA 1B16A 2VH2A 3D6EA 3DOJA 5T3YA 4YMUA 5A7WB 3OLYA 4M6WA 5C7LO 2H0AA 5EYXA 2HY7A 4ZEXA 1W34A 3MCAA 2HMAA 4IGFA 2AB0A 1E66A 5AD1A 2BGCA 3VKFC 1Z6TA 5EHDA 2IUEA 3T9CA 2R8EA 1GTL1 1XMXA 2YXEA 4RV5A 3PEFA 1SB9A 3UWDA 1U63A 3KDSE 2D3RA 1DAEA 1GZUA 2ATXA 2MEV2 2ZJ2A 1VB2A 4UFMA 1S3SA 7GPBA 1GITA 5HDBB 3I3MA 1NFRA 1XLVA 3ANXA 1HO3A 1OMOA 3GD5A 2CXPA 4A4DA 2PS9A 3G82C 4U39A 2ETVA 2F9FA 1IMOA 3E84A 4OUSA 3FZEA 1T1SA 1KY5A 3DVAA 4DUPA 4B80A 2O2DA 4JTOA 1EHIA 2V4AA 3M6XA 4LYFA 2OCGA 3RT7A 2GO7A 3CLTC 4NU8X 4K9NA 1PT7A 5B58T 4K0KB 3OZVA 1UY2A 3U3JA 3U4GA 2KX7A 5E6UB 1GEEA 1RQNA 2DSTA 2FZGA 4LITA 2Y1WA 1WBFA 3NHMA 4Y30A 1N6OA 4K05A 4Q9IA 1Z5VA 2J1SA 5JUWA 3RS7A 2VS1A 5TC4A 3VGPA 5A4FS 4MCIA 5KTYA 1XTZA 1HRV1 4ZCPA 3IYLW 3NBZC 3EO6A 4BNXA 2DLNA 4K21A 4EYUA 3PFGA 5D8AB 3A25A 3TOCA 3PTAA 2QQWA 3VR5H 3IL2A 3QEAZ 4MGIE 1QFZA 4EI7A 3GYDA 5L4LA 2RS52 3P0EA 5IJRA 3KX2A 3ZYBA 3HJNA 1P4GA 4LMPA 2Y6HA 2X0DA 3MUY1 1OUMA 5ESRA 4BZQA 4P6VF 2XEXA 2V1XA 3AERB 4EW1A 5ALGA 3F6EX 5F23A 1QGOA 4BJHB 2D62A 4C08A 2VHYA 3F7NA 4PIZA 4FW8A 3AHFA 3J8F3 5KWRA 3OGGA 3H42B 3I32A 5DAQA 4G5OA 4JLNA 2FLKA 2OUKA 4EN6B 1TPYA 1BN7A 2EHDA 4HX9A 1L7QA 3C74A 3E5NA 1B0PA 4GWNA 3ZXAC 5ADUS 1UBLS 3D6MA 3LL7A 1OA1A 2GB4A 2D06A 5FZ6A 1R9MA 5F3IA 2A7XA 1WLSA 4GAEA 2QLMA 4UNRA 1R082 1CYDA 4XF9A 3VR2A 2R84A 1XBFA 4G97A 1F5FA 1Q8SA 4EO9A 3UCXA 4B4QA 4Z7QB 5H9PA 2AR9A 4X1IB 4DLKA 4GP9A 4WNAA 4TYQA 5IC4A 2WILA 2RGYA 1R9NA 2BEJA 1I13A 1WA5A 3RUCA 3E3MA 1DE0A 3ILXA 1WRBA 4LV8B 4WZBB 2PH5A 4YDHB 3EIWA 1H6DA 1V1RB 5FQ0A 4HTFA 3PMSA 4FB4A 4HLUC 4KP7A 1XYVA 1E2HA 3OMXA 1QDOA 2D74A 3BQMB 5E88A 1UPAA 3ROPA 4LEIA 5FQOA 3ZS8A 4B85A 4KPFC 3BFVA 2R7EB 1SC9A 4IIYA 5I8WA 2Z5WA 4HOYA 2VUAA 2ID8A 2AXEA 3GRFA 1OYOA 3VU3A 3LSEA 1LPPA 3DLTA 1TME1 4XTCS 5FMCA 4MITA 3UB2A 4KWCA 4MIEA 2RV9A 1MH9A 2ORWA 3EVAA 2G77B 3M7AA 1IN4A 3AX6A 3M5DA 2DVBA 1X8LA 4GLOA 3GMTA 4RM2A 3RFFA 3I4CA 3PJYA 3TOVA 2H17A 4KLNA 1XE0A 1X14A 1ZSNA 4X64B 1N5LA 4QXBA 4WVVA 3DTVB 3LQ2A 3KQ4B 1XN4A 1CY7A 1X7XB 5FBHA 2WKKA 1YYNA 3TZLA 4HD8A 4MTCA 5ALFA 4MYEA 1YQCA 3EW9A 3GDHA 3OA2A 5J2UF 2QXTA 1UWLA 3ASUA 1JJVA 3H3UA 4N0DA 3I01M 4KQKA 2F4LA 3CUWA 3GV0A 5IJ9A 1JYXA 1HXS2 1CS0A 1TUIA 5A5FA 2EF0A 4OHVA 2R6FA 3S4YA 2VPPA 3EDCA 1BSVA 2X5IA 2VC2B 4S0ZA 4ZRNA 3VNVA 3JATA 5HGXA 3MGGA 4CI0B 4KRGA 4TV9B 2CL0X 1OYVA 3CVXA 2P4SA 2QPTA 4UBGA 2X0KA 1CETA 1QYCA 4QFMA 3UHOA 1KYQA 3INRA 4TTTS 1R0RE 3ESBA 5K0LA 1QWSA 4IXWA 3TAXA 5DABA 1RRCA 1LTQA 1R7RA 3L6DA 3RYFB 2G5GX 4PZPA 4JJEA 1PGNA 1IBRA 3BIWE 3K4AA 3FDIA 4LS3A 4E2SA 1CRPA 4UARA 4L4RA 3ROEA 1NBOA 4C43A 4XAQA 2IW1A 5GPBA 1RU3A 1MAVA 2HFKA 3CRVA 4R69A 4KXYA 1W6NA 4BECA 1CVIA 1RKVA 3G2JA 4FD3A 1BDMA 1MR3F 4YY3B 1MIHA 3ED1A 3ZDDA 1N3LA 3R3VA 3THRA 4R5HA 4DR7B 2ZX2A 4MIOA 3D7RA 2VDWB 1DMSA 3AUUA 2UYOA 1KVQA 3D7LA 5A03A 3M3HA 3WGIA 1G9AA 2ZAYA 4ZT4A 5JLVA 4XQDA 2HA7A 1QIKA 3T5BA 1R0ZA 4XGIA 2SKDA 5I5EA 4MSVA 3I1JA 2PUJA 1TKBA 5J47A 3JD73 1JNXX 1WU8A 2A5ZA 4B0PA 1J0DA 2M32A 4ZO6A 1L7OA 1Z39A 2ZRNA 3THYB 2AZMA 4O8ZA 3SIRA 1E1QD 2ZIZA 4YMVA 1ZX1A 3OE1A 3NT5A 5CPFA 1AZLA 2R072 1W87A 1JEQB 2UYHA 1DBNA 3C3KA 1PS0A 4OPMA 4JAVC 2VRWA 2C2XA 1FNBA 2BFBB 3ACLA 2VYVD 3AL6A 3EZGA 3LCRA 4FDAA 2WHYA 1B73A 2FFBA 1QJX3 2QG9A 3AINA 5K0GA 1UBNA 2ZE8A 3L4SO 1CE8A 1FXUA 5HRCA 4AVSA 2CHEA 1O7FA 3W3AD 1NT2A 5K3EA 2Z08A 2AF4C 4FZRA 3EQ8A 1Y9DA 2OHVA 2RS53 4V03A 3M3IA 2JVJA 3QWBA 2XCTB 1MEC2 2XLFA 3A3KA 3SH4A 1Y7LA 2BFAA 1T0IA 2QD2A 4DIQA 1DX9A 1JU3A 3K8YA 1ZVMA 2W7TA 3TLEA 4IS3A 4RQTA 4J75A 1DJPA 4DV6B 1EV11 2L18A 1IPSA 2Q4OA 3FRIA 5EKXA 4N43A 4AS3A 1L5QA 2K7ZA 1NOIA 2B98A 2V5DA 3GJ8A 4E1VA 2RH8A 3BRSA 2Z9CA 4CM8A 4F97A 1FXWF 2BYTA 4G1MB 2L19A 3PJDA 3K51A 3FWKA 1IOVA 2RGNC 5KC6A 1GKKA 4DLPA 3UT5A 2WF5A 4QAQA 4FO9A 4JVSB 3SDBA 1HRI2 1PNFA 5DTIA 5KYYB 2ZT6A 1E1CB 4RZSA 1NQ5A 3BXOA 3JQ9A 4XUTA 2HSDA 4EHLA 1GZ9A 4LXUA 1IDOA 1ENSA 1H9BA 2HH9A 3SQLA 2FN7A 3ZLIA 3BIWA 1SKQA 1V5GA 4MQEB 3NHRA 3PVBB 3NL1A 1ZICA 3N87A 2WQ7A 4KX5A 4W4TA 1I51A 1ZJ4A 3ZHRA 2FMTA 4M99A 1C1HA 1PMJX 4WZZA 1JU9A 1GR0A 1PWHA 3SBXA 1H30A 3GDGA 4AC9A 2DV9A 1DT5A 1FNMA 4TTGA 1Y8AA 2VDVE 1TJPB 1UPFA 4RE5A 4W9NC 5D3MA 2OZ6A 4QXOA 2IV2X 4UOJA 3JQ8B 5TE9A 4MVJE 2BELA 2ZRDA 3H3JA 4LIUA 4RV9A 5F9HA 2DVFA 2G9ZA 2YYOA 1X3LA 3W5HA 1NQAO 1UW8A 1H3FA 1UMCA 1OASA 2HV9A 4L8FA 4KWTA 4AXOA 1T3GA 2VWHA 1MEC1 5CTAA 4M0FA 3FZNA 4F2WA 5JZGA 2WUGA 1RPAA 2PX0A 2I54A 3KYCB 1QIEA 4GPBA 4JLAA 4DB2A 2XGOA 4XGRA 2IYAA 3ZSJA 2HI0A 1DZIA 4LHYA 4MHTA 4NJEB 1GPYA 3OTIA 5CYOA 3PTRB 3KD2A 1HLDA 4Q4W1 1RUE2 3SZMA 3GNTA 4WLOA 2RVAA 4N3CA 4YBZA 3SOZA 3A1UA 4TXMA 3FF1A 1KS9A 1RLOA 3LW7A 1U2SA 5C3MA 2NM1A 4MW0A 4KNVA 3UG7A 1VE7A 4DQVA 1D4AA 2TS1A 4L6CA 1PX3A 4MUKA 5JSPA 2HTFA 2VO1A 4UWDA 3K5PA 4KMOA 1T8YA 2R0HA 3WWDA 4OQDA 2V73A 5BVGA 5EWSA 2A3YA 4XQ4A 4DVGA 3FUVA 4FFSA 3QLUC 4C01A 3UMRA 3RS6A 5LA0A 3H7AA 3GBGA 3BMQB 4UW4A 4JHTA 2EIHA 1P5JA 1Q0TA 4DJTA 4PTYA 2QRLA 3KSBC 2DZDA 1SC1A 3E48A 1UMBB 4U7TB 4CDWB 3IZOA 2CXUA 1FBTA 3MS7A 3JQEA 4EN9B 3AM1A 3GDFA 5A1LA 1C0EA 3AV3A 2WKPA 5BYJA 5C5IA 3HFGA 4L74A 4AK9A 2E82A 1KQRA 1QYXA 1T13A 1DC8A 3G5TA 4PQEA 3CF2A 4LOHA 3TB4A 2WG2A 2UY8A 2G04A 1SBFA 1V26A 2BKUA 3UK1A 3O0VA 5F2NA 1MR5A 2P30A 1ZA4A 4E07A 4LA4A 1KO5A 2R041 4JT8A 2IGTA 2ESRA 1Q11A 5K4LA 2OO5C 4MS3B 4Q19A 3MRTA 4JMLA 3NIGB 5A6ZA 5CDFA 2OORA 1HDOA 1VSUA 3WYFA 1NRWA 1ACMA 4TMYA 1TVCA 1PK7A 4IEZA 2IELA 4IDAA 1KFUL 1EM8B 5DI9A 2PZBA 1S2NA 4KQXA 4E7PA 4UATA 3ZQJA 1X1EA 2O23A 3RG2A 3V8MA 2J5RA 3BJMA 2L42A 3PFWO 4F2HA 1OVPA 1GOFA 3NR2A 3ZXXA 2X2PA 4M0PA 4ZJUA 4BZXA 1MZVA 4HAOA 5ULLA 1TQ2A 2OG1A 1MVEA 3OZSA 5IM4A 4ZZ8A 1Z4NA 3EEOA 1WETA 3QG1A 4G5XA 1GO2A 5DW3A 1S1AA 1FRNA 2WAXA 3NV4A 3RZHA 2QLLA 4KVZA 4MLPA 3DTTA 2QN1A 1D4VB 2C99A 2NZVG 1S5PA 2VNSA 2A0FA 2BI4A 4UDXX 4FOTA 5FWEA 2BFPA 4A36A 1N2JA 1MXHA 5ER9A 4F4JA 4LO7A 2OFPA 4Q0PA 1WZCA 5EQFA 2W1QA 1ISFA 5CDSA 1UBTS 3ZYRA 4RXUA 5EIBD 3F78A 1K5DA 3L3BA 1G59A 5FOQA 1YUMA 2VNAA 3D6VA 2WNSA 2Y8EA 1SXHA 2A67A 2PWZA 5LBBA 3VOSA 1CUHA 4JBYA 3IIMA 1FNNA 3FOCA 1ZL0A 1R27A 3GFSA 5GTDA 1XI2A 4QBHA 5FZFA 4Z92B 3FCEA 2B7LA 2FRDA 4GECA 1TME2 1E2MA 1WWYA 1XAIA 3OEHA 4EYKA 3RKUA 4G67A 5ICEA 5C4WA 3PG5A 1XQ1A 2JASA 3BX1A 3HXLA 1E2NA 4QTUB 1VHJA 4YW6A 3IAFA 4UZEA 1NU8A 2J0QA 2R1ZA 1ZINA 1E7RA 1XIVA 4D1YA 3MNFA 4ZT2A 4MQ5A 2HGZA 3DCJA 2XJ9A 5FPLA 3AVUA 4BCCA 3ZFEA 3KEMA 1JFFB 4UU1A 5FDFA 4KIJA 5IDQA 2DURA 4N9IA 5J1XA 3SQWA 4P86A 1K1EA 5JOZA 1MS0A 4GRDA 5G0WA 4QYIB 2I34A 4M8LA 5BR8B 2GH2A 4FQZA 3ONVA 5AJTA 5EZSA 4Y2QA 2Y64A 2W2QA 4BGEA 4ZALA 1GNQA 1X8KA 5EYPA 1EB8A 1G5RA 2ZR0A 2WNIA 1ZC3A 3P71T 4N5DA 3QX9A 3VJMA 3TGPA 4KW7A 3ABQB 1O95A 5JCZA 3LQKA 4WCFA 3DEAA 5EIFA 4D0LB 4LBOA 1R081 5DULA 3UF0A 2E4VA 4GDMA 1OSGA 4B7AA 1MQSA 2D8MA 3IB6A 4XIKA 3M9XA 3IXLA 4LC1A 4I66A 3FPSA 3T4PA 1ZIOA 1W8ZA 1S0DA 4K9OA 4MHRA 2AE1A 1JLLB 2ZB7A 2NZ8A 4QL3A 1FF9A 1G21B 1PYGA 5T6MA 2ZEZA 3B1YA 4LLOA 4UF0B 2YJGA 3TNQA 3Q6NA 2Y33A 3K53A 4QX5A 3MCWA 3UATA 2NU7B 2A0YA 4WM8A 1NBEA 1DIGA 5F1KA 4D25A 3SQMA 1GCUA 4FMDF 3KQYA 1W581 2XVZA 4WVMA 3HA5A 2C92A 2WO7A 5A7QA 2RIPA 3JASA 2RS51 2DULA 2XXAB 2AHOA 5CIYA 4IJUA 5A3NA 5DSTA 3GJ3A 2GESA 1DPGA 3CSDA 1U5BA 1Z5UA 4M38A 4OK5A 4CLRB 4BX0A 4ZI7A 1CUYA 3SNMA 3K9WA 4N3AA 5BW8A 4R16A 2QVZX 1BTOA 3ZWXA 3GVPA 2XOMA 4XCVA 2C2MA 4C6RA 3FAKA 4YP6A 4Q2FA 4QLOA 3LA7A 1SFRA 4W5OA 2YNMA 2VQ6A 4JGIA 1C0LA 4DRYA 1MXFA 2CVHA 3SLRA 5WRFA 4OUMA 4RU1A 1XVTA 3P3NA 2HFJA 2FKNA 3CPSA 2ZJ1A 5BMVF 3WMFA 3RWMB 1B93A 5AICA 1C1DB 5HUJA 2OR3A 4G3XA 2YX1A 3DXTA 3W2TA 1LPNA 3L5OA 1EUTA 2ZUFA 5FK8A 1GQYA 2XDWA 1S7CA 5IC5A 3ZOIA 3L2YA 4O2RA 1YNSA 1BMFA 4QU5A 4DKJA 3R7WA 3UW3A 1VLMA 2JLSA 4RW0A 1YZVA 3RNOA 4A8HA 2Y1FA 1QE5A 2GASA 3K96A 4RNDB 4QOJA 5EGSA 1KY4A 2X0JA 3K6SB 2HDHA 2BEVA 5LEKA 4OBEA 1A1SA 2IXAA 2RCNA 2X9LA 1OOEA 2MEV1 4YWAA 1M2HA 2V9ZA 3OCCA 1OH7A 4EF5A 2IA5A 1EWTA 1B0ZA 4CCDA 3WYDA 4DRRA 1VJ5A 3FB1A 5A32B 3B5JA 5EE5B 2JKXA 1PZ7A 4Y1YA 3HYRA 4ATFA 2BM9A 3VO9A 5D5HA 5L4NA 4D6XA 3BTYA 5CU7A 521PA 3W5UA 2RG1A 3BZBA 3PGVA 1JA9A 3LM8A 3WZ2A 3QH4A 2OV2A 3WLSA 2WVHA 3GA0A 3DYPA 4O4JF 3U3ZA 2W6JD 4OHUA 1AOXA 3F9RA 2R49A 3OY7A 1LGCA 2PBRA 2WUDA 3RVNA 1XJCA 4Z51A 5LY1A 1N8TA 3OT1A 3P2MA 3D0RA 4YRPA 3AB0A 2OGZA 5JZOA 1U3WA 3NNGA 2NT4A 2ZUUA 4D9EA 1F8XA 2G76A 1XAGA 3DUIA 2ZIGA 1SHWB 2XMDA 1GNLA 2CJWB 4NBKA 2PHFA 2YGLA 3HUEA 5KYTA 5CG1A 1GGJA 4EPVA 5K8IA 4U2GA 1VB5A 3F71A 3F49S 3GUHA 1EVZA 2IZ1A 3SJ7A 4N82A 5BQOA 3GVIA 3NJ4A 3AWDA 2REQA 1O87A 1OA2A 1IY8A 3G0GA 2HDOA 3KZXA 1EV13 4QASA 1XF1A 4MB0A 1WXQA 1ENXA 4M6WB 1G6KA 3FLPA 1SXGA 1W59A 1UZZA 4V0QA 1EXVA 2R0FA 3T95A 2JD0A 4DQUA 1R0WA 1V7ZA 1YOVA 4NVRA 1E1KA 4YP1A 1JXQA 3LUJA 1ESDA 4WM7C 2X1VA 3T9EA 3FCXA 3KEFA 3FY4A 3EIHA 1WGPA 1SHLA 2OAGA 2Q9AA 3Q8CA 1YB7A 2C5FA 1JZ2A 1ISGA 4NNOA 3VKHA 4YCCA 4DPLA 5BURA 2Z0MA 3AYEA 2XW6A 3TGLA 1W8IA 2GDFA 3CU7A 5HRUA 4NHKA 2RIRA 1C1YA 5K0UC 1HJFA 3VRHA 2Y4NA 2OPHA 3HA2A 1ODIA 4LUKA 4DCUA 1OXSC 1RC8A 1VJRA 3SHQA 1ORWA 4XE5A 4U2FA 4D0QA 1VC2A 1RI5A 2JZOA 5IH3A 4DG8A 1OAOC 1D0SA 1ORIA 4JQZA 2PMFA 3EQZA 3WLTA 3L4KA 4YRDA 5HHTA 3DDCA 4RIEA 2IZ5A 3ZZTA 4I36A 1O91A 4HS4A 2AX4A 3GXUA 4KGQA 3MTEA 3HKBA 2P3SA 1UMCB 4E5NA 1OE0A 2JBAA 4ZCQA 4O4HB 3AFNA 2A6XA 4F46A 1L6RA 3U4CA 3HMQA 3ZV3A 3A14A 3N6XA 2XDYA 2CUTA 3RE1A 2HWXA 5C2JB 4OVEA 3ZEIA 1C4KA 4IKPA 2FA9A 4A10A 3HYCA 5EOVA 1O59A 5BY2A 2HWUA 1R8XA 4HTFB 4QJIA 1O6UA 5ENVA 2VRNA 1N5RA 2QJVA 2DBQA 1X1AA 1YRZA 1KWGA 4WNAB 1U90A 2H52A 2J9RA 2PS1A 3I9FA 4DLWA 3WQ1A 5I8ZA 5DEIA 3P1JA 4OGFA 4ZCIA 2CAUA 1NR7A 3ZSEA 1WDMA 1M0EA 1J99A 1DAGA 3IGFA 3EMDA 2FRVA 2OCBA 2WZEA 1CQWA 3KEGA 3EZ2A 3WHIA 1CZKA 3OEEA 5DGXA 2BW8A 1JR4A 4BQWA 3RDIA 3IAM1 4LXLA 5KWSA 4ISCA 5EJ8A 1JZ4A 2B5OA 2M6LA 2KLBA 4DLBA 5MN6A 1TCVA 4PQGA 2H2IA 1LOEA 4FLMA 4P82A 2QT9A 3ZTWA 3LMKA 3HU1A 5LLDA 4KXQA 4I1YA 2RHJA 5LA1A 5C9AB 2YROA 1UFKA 1TUGA 3OETA 5LBUA 5DN9A 2AH5A 1VJTA 1N7JA 4ZK2A 2X23A 1HT1E 3TEFA 1TLTA 2F8MA 3KPVA 3L1IA 2OC9A 4WA7A 1G41A 2POCA 1SVUA 3GH1A 3G9TA 2IK8A 4YGXB 1HA3A 5G3YA 1TRHA 4YRAA 4FQ4A 3ZYPA 4FQ7A 4H08A 5EYYA 4QU2A 1JZ8A 2LD4A 1WBJB 5JO9A 3V64A 4AW7A 3P0HA 5DXDA 1PF7E 1HZZA 4IFEA 2FQ1A 4CMBA 2Q8NA 1VPVA 3SF8A 1LCIA 1CRZA 1QMGA 1FTSA 4KDCA 2QLBA 3ZDCA 3EIEA 1JHDA 1BVHA 1T43A 1P9NA 5F2SA 4X1KA 4KCGA 4FK8A 3ZWKA 3F4KA 1ST2A 3E03A 1GLVA 1PSDA 3ZQUA 4QHTA 3K09A 2FWJA 1G5IA 1NX6A 2NQ8A 4AAXA 1V1MA 1ND2B 5KKCA 1GDDA 1W6QA 2PVPA 4RWZA 3A06A 2G1AA 2IPAB 3KZOA 2F6BA 4DY5A 4CMCA 2EZ8A 5ABPA 5ES3A 4DDMA 2WT9A 1IXYA 1RUC3 3MF6A 3KYCA 2ZHLA 4MH0R 3QIAA 3ITKA 4NS1A 3WP0A 2BTOA 4OCZA 2V6IA 1KY2A 2Y77A 3WZLA 3ZSKA 2XE7A 4YVSC 3U4IA 1DEOA 4Z1MD 5BWCA 3FFXA 3V48A 1LF0A 4BFYA 4NMLA 2BV3A 3L49A 4AY3A 1CESA 1UJ4A 2BM0A 2X6QA 1FOD2 3AM4A 3CKKA 1VKNA 4LQ4A 4BZ4A 2VZ8A 4FPEA 3VBOA 3SN6A 5C4MA 4UTRA 4NAVA 3NNMA 3SMHA 5JD6A 2XAUA 3PQ6A 3RS4A 5F9MA 2C1FA 4PC3A 4DV2B 3EBRA 3NAQA 1LLQA 1CR6A 3GWGA 5I3ZA 1Z7GA 2WIDA 2Q1ZB 3DFUA 3F1LA 1VBNA 2F59A 1HGXA 1QGZA 3J7AC 1O08A 2QQKA 2F48A 4BOYA 1Z4LA 4KJXA 4YCSA 4CM4B 2BMDA 2HNKA 1YQEA 2ZREA 2ODNA 4FFBB 5BOVA 1Q6YA 1YQGA 2XOKA 1ULZA 4N3BA 3HDJA 2BEOA 1Q3TA 4B4DA 1V4VA 5ALSA 4NPMA 1P4AA 3H2JA 5KNCA 2X7JA 1L5VA 5KC9A 5LZ4A 4HS9A 1KEEA 4GB32 3B3JA 2P0AA 4KYIB 4M1KA 1USWA 2HKXA 4YLEA 4D46A 1E5LA 4LVUA 3NNSA 1W5AA 1T10A 3OKPA 1WDWB 1RKXA 4M4SA 2J30A 2RDMA 5KS2A 4EAAA 4GL2A 3S5JA 5BV6A 2QU8A 1QHYA 3UNPA 2VQDA 2GNDA 2BGKA 1L6IA 4ISQA 3ZPXA 5DE3A 13PKA 1S2MA 4I5EA 3G2OA 1QAOA 2DJ5A 3DR3A 3DJYA 4QO8A 4U7WA 1OB2A 3TRIA 2FN9A 1BNCA 3R9KA 4OLBA 4XM2A 2W1WA 1HKUA 1HYGA 3GAAA 3I23A 1KDRA 3OIWA 4Z82A 4D8XA 2B25A 3P32A 5K0FA 4BUZA 1MEC3 4N7JA 3B1ZA 4U6SA 2W2MA 3J9SA 3PE3A 4EHAA 1YRBA 2QU7A 3VR6D 4CIYA 1YIFA 2ZIEA 1QCYA 1K6MA 1I7LA 1R4NA 4F72A 5MGNA 1RYYA 3H2YA 1QMPA 2RI0A 5ACA1 5GZ1A 2H4WA 5FNVA 4LY0A 3ZV5A 3UGGA 2RKBA 2I4MA 1GQHA 2V8BA 3U7IA 3O8LA 2IITA 1A8IA 3D6NB 3JD71 3F3MA 3GJ0A 4AWDA 2CNLA 3H5WA 1DFQA 3KWFA 1DAOA 5A3SA 1CZTA 4DLYA 1A0OA 5L3VA 1RJFA 3WNVA 3U19A 4IOLA 3B5IA 3UJHA 4CIXA 4D8VA 2F1OA 3ZWYA 3BIXA 4B6PA 1I6MA 2C2OA 1X13A 3O4JA 4RD2A 3HO1A 2QX4A 3S2EA 1EFVB 1YQWA 4AB1A 3K5HA 1DFIA 3SX2A 4ODIA 1QEXA 1H4TA 6ABPA 3EXFA 4RHV3 3DAYA 1X7YA 3LPLA 3LOUA 5AVOA 4HMOA 3GC6A 2GC3A 1FUEA 5HKKD 2AH2A 2FG5A 3SC2B 3ZIWA 2XUOA 5EHIA 2C5EA 2FWNA 3BWEA 3SQOA 4OXQA 4UHDA 5F51A 1UJMA 4MUIA 1A8PA 5HFJA 1LLUA 2YBKA 3E5QA 4PTZA 3PXGA 4A41A 4G2NA 1UN1A 3ZOKA 2OP0A 3OCZA 1AZSC 3FHAA 2GN3A 3UKDA 4OQMA 3JCZA 1RWVA 1VBB3 1GADO 2AMYA 1R4MA 4BU2A 4N12A 1VG0B 2HK6A 1JHVA 3A9CA 1GAQA 2GJ4A 4XOUA 1TZJA 2XWJB 4R1NA 5H9QA 2W42A 3QKRB 4D26A 2ADFA 1Q3KA 4H4CA 2QSJA 3OFNA 1XB2A 1XG5A 3V9AA 2HWB1 4YRBA 2AVNA 1U5BB 4XYBA 5ALTA 4ZV9A 4XFBA 2XYGA 2G09A 1I1OA 2IIQA 2KR2A 1ORVA 1EUZA 4ADSG 1E2GA 2XUAA 3TSYA 3PEUA 3KR1A 2M6RA 1LRLA 2HEGA 5KCZA 1WCKA 2H16A 2X29A 4AL9A 3ILYA 5IXJA 3WNOA 3WMGA 3JQ9C 3IPCA 1RC6A 3GLIB 5HFAA 2PGOA 2AOWA 3GN2A 4J2OA 4UHJA 2EF1A 2ZRIA 2Y6GA 1D09A 2Q5TA 4KDFA 2LDXA 3DUWA 4CRWB 5EV7A 4N48A 4Q66C 1EFKA 5KDDA 1RIFA 4ME6A 4L0QA 5FZOB 4PN7A 1PFYA 4O2AA 5AW7A 2DUUA 4Q4HA 1GCIA 3L0DA 1ETHA 3DKQA 3KT3A 3E8SA 5JTUA 2QUOA 2XAAA 1G8YA 1Q7GA 3QUQA 1GOHA 2OHFA 4EG0A 4CU9A 3OPTA 1IPHA 1XEFA 2W92A 1FPN2 2WZ8A 4Q1FA 1BJKA 4IWXA 1SUIA 3A1CA 3ZXDA 1F2DA 2GKGA 4JELA 2QZ3A 4Q3CA 2HWYA 5CLGA 3H3FA 3SNHA 2P9FA 4I4LA 5TMDA 3UOAB 2VR4A 3I3EA 4J7AA 1JYFA 3L93A 4W9RA 5DMXA 3F67A 5B4XA 1EQ2A 4H7DA 2ATEA 3GEDA 5CLFA 4WZBE 4QXPA 1WXDA 1SZDA 3TDKA 4JP2A 3HBNA 3M3OA 2CE7A 3JQBC 3T7RA 5T7BA 2BGLA 1VP9A 4HSLA 3ME2A 1XXHA 3OFVA 3TTYA 2O7VA 3NJ8A 4F83A 2GNOA 2BMFA 5HS6A 3AR8A 3QMWA 3RAPR 3FAZA 5LXTB 4WZAB 3P45A 1Y5MA 1HQYE 2DHRA 1OLME 2ZGTA 1JQJC 1F17A 2PUWA 3VAZA 3F7MA 5KSWB 4D3DA 2OENG 3FVQA 2CLOB 2L0XA 5CKMA 1TT7A 4RY9A 4DTIA 2JD4A 2BFFA 4PHTA 1VSQA 1USKA 2YDXA 3SX0A 3IP8A 1DGRN 1RMU1 1AU9A 5T41A 4E5VA 1ZHOA 5IAJA 1UFRA 4LV6A 2YRFA 2YG0A 1O4WA 2ZULA 5L9AA 1ZVKA 4GD4A 3SP1A 4JDUA 3WQQA 3W4JA 3FTDA 4EQ6A 4QXCA 1MA3A 3EZFA 4V1PA 4A3XA 1XUOA 4CLOA 1HMYA 2P0EA 3NIWA 1EVIA 2YXNA 1TQ8A 4BZZA 1YZHA 1DARA 2RH5A 2AJBA 2PQMA 2ZYDA 4R3UC 2E3JA 3FIJA 1Y81A 1DQNA 4PO8A 1QNYA 1NY5A 3V1TC 2R8BA 1ID8A 1W6OA 4H7IA 4DA4A 4C7XA 1JKJB 1J97A 4BFCA 4B74A 3TTUA 4TUYA 5BNWA 4AZ3A 1TM3E 4K86A 4Q3AA 2VMGA 3JQPA 1D7AA 3E61A 1LVGA 4IG9A 4MGKE 2O8VA 5CBPA 2H59A 2YC2C 3LTNC 2C57A 4G6ZA 1Z5PA 2H11A 1X7NA 3RU7A 2XV1A 2QJFA 2JLVA 3TLGB 1UKVY 3KOZA 2V97A 2EAKA 1P72A 1T5LA 5D5QA 1YCGA 1YR3A 3PGMA 4ZRMA 1J70A 3ZFGB 4J94A 1DCMA 3IP1A 4GBGA 4JOBA 1HE8B 2NPIA 5DI3B 1G3QA 3CH6A 4Q1EA 3AEKA 4QPWA 4BRZA 5LOVF 3HR8A 3KKZA 3U7JA 5E6SA 4JQRA 3M4JA 4DRZA 2B3TA 1H6YA 4TWJA 1U0BB 2GPBA 1AR83 3HNPA 5AVTA 3FSGA 4AKTA 1QHNA 2X05A 4HF7A 4BNDA 3PEWA 3AI1A 1TMKA 2B7CA 4NCNA 1RHKA 4QO7A 1BD4A 3TN91 3D5OA 4PPYA 5LBEA 5HJ2A 4RESA 3BG5A 1N77A 1PEYA 2QP9X 3VTKA 4LZAA 2QTBA 5JXIA 2OXEA 3L7JA 3EDMA 3ZK8A 4KIGA 2OZJA 2I6UA 4DNPA 3J7LA 1AYM3 4OSEA 4AEDA 3OE4A 2GS9A 1DZQA 4AKIA 1SA0B 3RYPA 3WIEA 3OY8B 1U0JA 2X4IA 1H4HA 1WZUA 4CF4A 3KR2A 2I4RA 2PWPA 3NC1C 3GLFA 5LLSA 3BODA 3LAGA 2VBIA 2HF8A 1WTCA 1TO2E 7MHTA 5K4AA 3EXUA 1R50A 3KDAA 4WVLA 5JDIC 2LKDA 4Q4JA 4MRVA 1KAQA 4P33A 5B7QA 1N1YA 3NTRA 5JHHB 1US3A 5EWJB 4L8YA 4MPPA 5FWXB 1C50A 4YFZA 2BFWA 4AZVA 4BMBA 1V00A 1LWOA 4P4TA 4DA9A 2A2ZA 2XGSA 2OCPA 3S7EA 4YEDA 1C2YA 3ALQA 1G9XA 1BHSA 2HJWA 3S2IA 2XNDA 1V6LA 4ALLA 4XUOA 1KZHA 1Y1TA 3A2MA 2WRZA 4D79A 1JAXA 3UBMA 1FYXA 5F98A 2D7FA 5K4HA 4BMVA 3QPDA 4HBGA 1KZ6A 1S2OA 4CN8A 4CCEA 4AZTA 3AUXA 3TQOA 5P8WA 5JISA 4CMIA 4FW9A 3WNPA 1DRVA 4DR2B 1W8FA 4PHCA 2XODA 3L77A 4EN8B 1YI0A 5LBTA 2YIVX 2I3BA 5TSWA 1Q12A 4YZ1A 5JWRA 3OZBA 4NBLA 1UBRS 2VPIA 2GEUA 4IQGA 3L0YA 2YCBA 3SYTA 2AMFA 3G68A 3WBBA 3O7MA 1HEUA 4CUJA 3EHKA 1F0NA 3F74A 1NVGA 2ZCVA 3BWXA 1ZOIA 1OH5A 2BMEA 2JJ2D 3JTEA 3L8DA 1LBEA 4M36A 2IZ6A 3SFVA 4LNAA 4F2GA 3C87A 2DETA 4KQ7A 2NMNA 4JV5B 3VKVA 3RGWS 4JT9A 5AVWA 1T34A 5ALZA 1SWVA 4ZQBA 3ZR4B 4DR4B 3PXXA 4XFKA 2GZ3A 2UXCB 3B48A 5C9AA 1VE9A 1C9KA 3A9SA 2I55A 2XYQA 5BUSA 4HK9A 3FBYA 1CU1A 1AVBA 1T6NA 2TMGA 2ODWA 1PSWA 1MO2A 4B87A 2PZKA 5AM4A 1GU3A 1I9RA 3KXDA 1ZZCA 4PHHA 2PX3A 4L9AA 6ADHA 4WMLA 3OECA 2LCQA 2WI8A 3GIWA 1WA6X 3C3BA 3I30X 1WKCA 3UPUA 4ND6A 2EAAA 3WUCA 4D6RA 1Q8OA 1PGJA 3OEYA 1ZSVA 4JWKA 4QOIA 1YFUA 4PPQA 1SEVA 1YS1X 1YD7A 3OUZA 1JG1A 1CIVA 3KHTA 2NYUA 4ONUA 5GP1A 1ZVQA 3WV4A 3HR7A 3RSZA 3L43A 5JQGF 3CUTA 3I4LA 3CZ5A 1X8EA 5JNRA 4KO3S 2QOEA 3EZYA 1ESZA 1BVUA 2JG3A 1KFEB 3F6SA 4KC0A 2AWNA 3FKJA 4BQPA 3VBFB 1XD8A 5LKRA 2DKFA 2BZ1A 5DM70 3FLBA 1RI3A 4GSLA 5MGBA 1KP9A 1G1AA 4LE4A 1D07A 3WSWA 3R4UA 3OHMA 3WGTA 1HRDA 2BZGA 1TK2A 4EN7B 3AFGA 1RYNA 1E3EA 1MT3A 2P5BA 4WWHA 1PIV1 4AOCA 2C84A 4DGQA 1N0IA 1TO1E 1L5NA 2B46X 4L11A 1LKNA 1XOIA 3KLPX 3H8WA 4I09A 1G4AE 3WQ0A 8ATCA 4ZJPA 1X2BA 1I9CA 4QHBA 2X0RA 4AN1A 1ND3C 3KUCA 4ESVA 5AK0A 1TYCA 3H7YA 2A0KA 1LC0A 2AZ4A 3QXHA 1XKQA 4DIMA 2QZZA 3LFUA 4ND1A 1MC8A 1U4SA 4HN1A 1H2EA 3E3AA 1CEQA 3BSSA 2QRHA 3EIXA 1I3OA 3KCCA 3ZYHA 4D9JA 1ONPA 2PFSA 2L9LA 1Q50A 3IE0A 2YB7A 2XCOA 2ZZQA 3SZ3A 1VGVA 4LT5A 1HDCA 4L8GA 5ISMA 2WJ4A 3QFTA 1VFNA 2GHRA 2R65A 1CP3A 3CEWA 3AVWA 4Q4AA 5ECDA 4K6FA 1UIKA 4ASLA 1KFCB 2QN2A 2FQQA 1EVKA 4WZCA 3H5NA 2JDIA 3LHDA 4LTMA 4F4IA 5JSRA 1P8AA 2IGBA 5L45A 1LOAA 3WIDA 1LW7A 1ENYA 3URMA 1IZ9A 3M81A 5L3RA 1CUUA 1CVNA 4EZHA 2OYSA 4MGTA 4DBVO 4RV4A 4BUJA 3OICA 4ZPXA 3RAJA 2J9GA 1BH2A 4TLGA 1LC3A 3D4IA 1Q57A 4Y1GA 3S27A 4BJ3A 1ZK3A 3SY8A 5AUPB 2GCPA 3OSZA 4IFIA 3ETEA 3LT5A 3PFFA 4ZOAA 2DWPA 4CTEA 1JYWA 1GAWA 3W2HA 5D6NA 3W8FA 3ACDA 4JGYC 2CXQA 3I58A 3VPFA 1T8UA 4S0XA 5C3SA 1TZBA 4ZOLF 5FPZA 4U2KA 4LX8A 1YI7A 4TPKA 2H57A 1H65A 5CA1B 4HXYA 5ERGB 2EFEB 5C4IA 4XJAA 1DQ1A 4D99A 4R9BA 1L4HA 4EYGA 3HPQA 3RMXA 4KWIA 2VJNA 3TCXB 2UWAA 2I87A 2VC9A 1FP2A 5EJ5A 1L8XA 5D2AA 4DRXB 4TROA 1ZBQA 3AP7A 3J7NA 3ZDAA 1SBNE 1EFTA 3NEAA 2IRWA 1A71A 1NVVR 1E8NA 1LSOA 3ZXYA 4PRZA 3OQMA 1SUFA 3OZFA 1AJOA 4NH0A 1BMV1 4I9GA 1NQDA 1Z7YA 1YHZA 5TGDA 4PVDA 3TUZC 4NAOA 4CIDA 4CCCA 3CWCA 2J08A 1KI7A 3UJOA 5A4IS 3AT1A 3HDVA 4BP3A 2H1OA 1RUD2 3Q5EA 1ZWLA 1QRSA 4Y1VA 2BSXA 3B38A 1BVP1 2IDZA 2BWAA 2I29A 4KLRA 1IQDC 4OBXA 4G4IA 2ATFA 3T0BA 2C6SA 3OO1A 4HAIA 4O4LB 1ZIYA 4GOOD 4GMHA 3K4PA 1OI2A 1OA0A 4BLQA 1IGOA 3BGVA 3DNPA 3MLBA 4A6XA 4Y6SA 2H5LA 3FETA 2I2SA 2RR11 4ZMSA 4Z4IA 2MSNA 3FUXA 1I4OA 3VB9A 1JDVA 1U7PA 1L1QA 3K2BA 5KAMA 2WFLA 3ZFFA 1DKMA 4HG2A 1DOAA 4C6SA 3R3ZA 1CUEA 3SCZA 4QGSA 3C45A 4E22A 2G8NA 1IOWA 5A3OA 4BS9A 5JQGA 3MFAA 5KXBA 1QHDA 4QAWA 1G3IA 4DBLE 4QDXA 1Z06A 2WNOA 1B0UA 1W90A 1HORA 2V54A 4QTXA 5IAAA 3H16A 1D2MA 4FMCB 3MLKA 3N8KA 2G3YA 3QKSB 4XWGA 3HCNA 4BO6A 2VUTA 4S1PA 3A36A 1TZOA 4P7KA 1TTQB 1VALA 2A4MA 1JEOA 1DGWA 2PTHA 3LBHA 4RGVA 2FMKA 4R2LA 2AIRA 4RHYA 2QMOA 3ZDRA 1TCAA 2QT0A 1Z18A 2WNVB 3W20A 3NHSA 4G01B 3PJQA 1SBIA 4WM8B 3WR0A 3S70A 4RH0A 5HOEA 4KSCA 1NW8A 2Z6AA 1DBRA 2DHDA 3Q8WA 3D5TA 4K9QA 4KXMA 4Y22A 3N2YA 3ROFA 3JR3A 2MR6A 4JBXA 3G0OA 1T0BA 1Q91A 3ESYA 1RVF2 5FR1A 2Z4FA 1E5VA 4KIWA 1QO0D 1I5RA 3NV1A 5EXSA 1L9XA 1CJDA 3ZKWB 3W6NA 1UMIA 1UFQA 1AO3A 4JT4A 1NURA 1K06A 1M6EX 5FBVB 3BU7A 2IHNA 1OVSA 3PFNA 1QLJA 2GLXA 2B99A 3VDNB 3G3EA 1MX5A 4ZVLA 2XBLA 4YW2A 3TPZA 3VR6A 2YWXA 2BNOA 3CT6A 1DRWA 1H8EA 3ANTA 2FCVA 2P11A 2FW0A 5A7NA 5D1HA 9MHTA 3OTWA 1Q8VA 2VQTA 3BD7A 2GPAA 3HJHA 2H7YA 3LO8A 5AXBA 4RTSA 3N2ZB 2CL6X 4FPFA 4WDRA 4TTVA 1A8UA 2BUBA 2QD3A 1DJNA 3KXLA 3A6PC 2VNOA 1O94C 3QQ5A 1CUDA 2FJ0A 4MROA 2COUA 1ZGBA 3EXIB 5G4KB 4ZZ2A 5BSHA 4JHXA 1P17A 3E3OA 4JENA 2HM7A 4QATA 3IJPA 1UFOA 2PIDA 4JEHA 1FMD1 1FDOA 2V74B 4CDUA 3VHPA 1CWUA 1APBA 1LX6A 1B6RA 1COV1 1BWRA 3O2SB 4UAVA 3CLUC 3CLRD 4QGAA 4Q4LA 4WXYB 4GXNA 5IX8A 16PKA 4R9RA 5FI0B 3TTVA 2RGXA 3IMCA 1YCDA 3OTFA 3BCHA 3U4QA 4FOSA 1MEOA 1T6ZA 5F5IA 1P2BA 4BJ6A 3NGMA 4RVDA 4LRYA 3FPGA 2UYYA 2IY9A 2NO1A 1CUCA 4KTTE 2JFUA 4BLRA 4R1TA 3UV9A 1KMMA 2GR9A 2GZWA 1ZG3A 2BFNA 2VY0A 4KXUA 2YJ3A 3BXXA 5FOSA 2Q5JA 3ZI7A 3HWSA 3QLVA 3PNSA 1ZBA2 4WW0A 2DTWA 2Z8ZA 5IARA 4DCVA 1Z5WA 3FJYA 5D3ZA 2HWB3 2FCRA 1VXRA 5ESXA 2R4UA 2CCJA 4TMKA 3HSYA 4IE5A 3VMFA 1T5IA 3H5IA 1TJNA 3EFHA 3HNMA 5K3FA 3IE1A 1AR62 4D4KA 5AIAA 1K3IA 3AHHA 4YRGA 3HS3A 1X9PA 4C2TA 1KK0A 4L6IA 5AKKA 3COJA 5D3QA 1MS5A 2Q1MA 1MPTA 3WZ1A 5ALMA 4XF0A 1MO6A 2V7TA 1RUG2 5A9SB 4K03A 5IP5A 1L5GB 5KX5A 4FHCA 3O7OA 3MXTA 2A9VA 2FE4A 2VAXA 4YGEA 1KQFA 2C5GA 1JALA 3ETGA 1B74A 4KL8S 4US2R 3O2NA 5ECYA 3QMVA 3HYSA 5KYVA 3GAZA 1UF9A 5C0OE 2XH8A 2ATIA 1E6WA 3A6KA 1WW7A 2PSEA 1QGUB 3OIVA 3HZHA 2Y6VA 2ZM6B 5KTKA 4Q7QA 1E9AA 1QO7A 2IVZA 2WSSA 3PQDA 3NOQA 1FQOA 4YX9A 2NAFA 1WKBA 1CUAA 4IYRA 4B8WA 3C7AA 1THZA 4BE3A 3WDKA 1G3MA 3IO3A 3G9ZA 2ZXQA 4IDZA 3ND6A 5GM1A 4JHZA 2F3SA 2AG6A 1EEHA 2B92A 5B3KA 2QQ5A 1N5JA