4K40A

Peptidoglycan o-acetylesterase in action, 0 min
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
349
structure length
349
Chain Sequence
LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis lnp21362
molecule tags Hydrolase
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
total genus 115
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k40A02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k40A01
5CD9A 1ESEA 4HYQA 5BN1A 5HOEA 1JRLA 3DT6A 1J00A 1Z8HA 3DC7A 3P94A 4H08A 4K40A 4DEVA 2Q0SA 4JGGA 1ES9A 1BWRA 4K9SA 3DT8A 4IYJA 3C1UA 3DCIA 1BWQA 4RSHA 4S1PA 1WABA 4JHLA 3RJTA 1U8UA 1IVNA 4NRDA 3DT9A 2WAOA 1ZMBA 4Q7QA 4JKOA 4K3UA 3W7VA 2APJA 1DEXA 4XVHA 4TX1A 2Q0QA 5JD3A 1V2GA 2WAAA 4HF7A 4OAPA 3KVNA 1VJGA 4Q9AA 4M8KA 1DEOA 4JJ4A 1VYHA 3HP4A 4PPYA 3SKVA 2O14A 3U37A 3BZWA 1YZFA 4JJ6A 2W9XA 1FXWF 2WABA 3SLRA 4RW0A 1K7CA 4OAOA 1ESDA 1BWPA 3PT5A 2VPTA 1ESCA 4K7JA 4I8IA 2HSJA 3MILA 5A4AA 5B5SA 1PP4A 1FXWA 4LHSA
chains in the Genus database with same CATH superfamily
1ZXXA 1R6BX 4EYKA 1M2VB 1H4GA 4MXWB 1ZLXA 3HYTA 3WMFA 2PGJA 2W00A 1E79A 5FYDA 2CVHA 1U11A 1FTNA 5DFAA 1KZ4A 5JS8A 4EGFA 2QIPA 2ZJ3A 3KZVA 4TTTS 3GUVA 3WGZA 3ORQA 3M34A 1TQHA 5J1SB 2O8EA 3HDJA 1RJDA 3VKOA 4X8NA 1WPQA 4HTAA 2YDXA 3HCWA 1LKNA 3QOXA 1DADA 3CTPA 4UNQA 4RA6A 3G6JB 1CUSA 4F38A 5EJ4A 4EJRA 4HZGA 4IFTA 4PSCA 1ZA2A 1T8UA 1IPHA 3QVOA 1UFKA 2JGFA 2C31A 2C1ZA 2YJ5A 2AMYA 3L6CA 5FZOA 4RZQA 2Z8YA 5LUBA 1J42A 3H1YA 4KDEA 3ONDA 2P2NA 5GZGA 2PHDA 4FSHA 2EARA 4K2HA 3W5VA 1VPWA 2XR4A 3A25A 3CO2A 2A58A 5LA6B 5ERLA 1H9AA 1U63A 2X5KO 4LNAA 2D0OB 1F9AA 3AKQA 2C9OA 3UKNA 1KOFA 4D9IA 2DFNA 2B0JA 1HB3A 2JCGA 3LVRE 3IUQA 1W8IA 3PA8A 3PXAA 2QQ0A 4Q7JB 2GBFA 4ZZ2A 1EBUA 3AMMA 2SKEA 2YFKA 1KK3A 2QPOA 4RMJA 1PZMA 5LXTB 1H93A 4META 2VPXA 3LDBA 2IDKA 3CC8A 3VLBB 1WSDA 4B47A 2AUYA 4RH3A 5IK8A 4ETIA 5I9NA 1LODA 2Y3IA 2WWTA 1JZ4A 1NULA 2E7ZA 4J75A 1IN6A 5FMOL 1H69A 1IY9A 1E2MA 1BBT3 3MS2A 3ACBA 4W4ZA 1EYZA 3LK6A 4Q29A 1EUQA 4RXUA 4JSTA 1L1RA 4RGQA 2Z3VA 1K8XB 2ZJ6A 1VIAA 3FTFA 2AHOA 2HKIA 3CR8A 4LWOA 4QQKA 3OU7A 2HK8A 2EXKA 4LDPA 3GZUC 3KQYA 5I9SA 4JDNA 1Q5OA 4NMXB 2OBYA 4M00A 3M4JA 1U3CA 1FFYA 2AGVA 3ETEA 2CFOA 3DE2X 3WIUA 1E7RA 4AF9A 2VQ6A 3LE0A 4YMLA 2XCQA 3G88A 3KPJA 1G20E 3IJRA 2JHFA 3G0DA 4CMCA 3J81A 5FYHA 2PV7A 2Y0BA 3IDSA 3S2SA 5FMOS 3O2QB 1KDMA 1H2ZA 2VI5A 1Z4MA 2FRDA 2R751 1PYGA 2VHTA 4XJWA 1UODA 4DDUA 5LQCA 1CPMA 1X7YB 4B33A 3TAUA 1ECPA 1Z26A 1VGRA 1OOPB 2Z0MA 3DH0A 4N3BA 4Q05A 1T36A 4RSMA 2YC2C 1Q0TA 4L5CA 1RWXA 3RS6A 4L8WB 2ZAOA 1N2HA 1BS9A 3MWEB 3CCFA 2WZPP 1V6MA 4YT4A 4MVJD 2R1VA 2C57A 3JZVA 3E23A 2CWSA 2YFYA 3K9CA 2ILMA 4ZTBA 3G23A 3IAS1 5FO1A 1W6UA 3S44A 1UU5A 3ED5A 1UJ5A 2BY4A 1VP9A 3MT8A 3GRKA 1LQ2A 4NIGA 3MDPA 1MFZA 3AIMA 3HEIA 3O1LA 3GT0A 1WZEA 5CB4A 1ONOA 2AC7A 4E2XA 3RVSA 4FNGA 5F64A 4MINA 4RANA 4NE7A 2YH2A 2XLCA 3VH3A 4AYWA 1FS4A 5ISLA 1FE8A 3UJHA 2RVAA 4XIFA 5CM9C 4COVA 3UV7A 1G21B 1LTHR 3P94A 1EHCA 4YWHA 2CNWD 2JE8A 2XYQA 2C54A 3H2YA 4LNVA 4ZZ1A 5DYTA 3W5DA 1H0RA 4ZHQF 2P9TA 4LBQA 1LDBA 3M8KA 1L3CA 4R1TA 4GXNA 4F93B 1SBYA 1LFDB 4HBNA 4A7KA 3F3SA 3RI8A 1JHYA 4F9FA 2UVQA 4HSGA 3OX1A 1JFTA 2E9QA 4QXBA 4IFEA 1X87A 1TDJA 2PYTA 1GAEO 1QIIA 3LP5A 3SWWA 4NZZA 2QRPA 2CHHA 2WI8A 3R4VA 4OGGA 4PICA 4DXDA 2IDMA 1NQDA 2QL6A 3DL0A 1I5PA 2ZB7A 1XJ5A 4KBYA 1SCQA 1ZJZA 3JWPA 2XGSA 2M6LA 3HGTA 4UBOA 4Q12A 1T4BA 1N47A 2J1UA 1XKTA 1GYPA 1HG1A 2YZ2A 3D6HA 3LBHA 2W46A 2BN4A 4WM7A 1AQYA 1IEWA 1RXWA 4IX9A 5K45A 1JNXX 3T9CA 3EZYA 5BSTA 1KNXA 3UH1A 4F8JA 3PHCA 2IZ7A 4BP3A 1H0KA 1EVYA 1RUG1 4R9SA 4L57A 4NOKA 3VHRA 3IDAA 2RSLA 1U9YA 3A0KA 1T25A 1C8M1 3KP1A 2IVJA 4F5WA 4CKCA 1KYQA 1RVF1 4EI9A 1GPH1 3DULA 3Q98A 3TTUA 3QTBA 4XGIA 1LI4A 1XUOA 3O75A 4ZOQI 3TK1A 3RZLA 4B3FX 2O0OA 1LRJA 2BUKA 1KVQA 1QQBA 2VXRA 4FXOA 4EGCB 1E6UA 2ODNA 3JZIA 1KVTA 2YQZA 2O1SA 2H5IA 1GIAA 2IW1A 4TSFD 4DLZA 3E9RA 1CX1A 4NCAA 3JYLA 1C4OA 1PDVA 4QNMA 1DKPA 4IFIA 4ABYA 4IF4A 1G2QA 3KPUA 2MOKA 1ODLA 3VV1A 3D8TA 1AXGA 3S28A 1NY5A 3ADCA 3NO8A 4XVQA 3KQWA 3A21A 1H8VA 2WMNB 3PDQA 1Z47A 4HY3A 1RZUA 2EXXA 4IIJF 4F4JA 2OILA 1POV3 1WETA 1JDSA 3L8FA 1OX4A 2FHRA 4MP8A 3PI7A 3NKLA 2HSWA 1LGNA 1JF8A 1ZGAA 1IUOA 1TEIA 3WLRA 2QQUA 4D7TA 4K03A 5KQSA 3ZVMA 1T0UA 2YN4A 3IAEA 1A71A 1N3PA 2OAP1 1HYQA 1NFRA 4FI3F 2RR13 2Q41A 3IQHX 1LC3A 5IAJA 3IVMA 4DSNA 1AVTA 1EWRA 3TWOA 1RYEA 1N8KA 3I73A 1L4FA 1P0PA 2PT5A 3CMMA 2D5AA 4KDCA 2O48X 1G21A 2ZZJA 4YW5A 2PS3A 3FOBA 5IF3A 5KDOA 3RLIA 1OYWA 2COKA 2C88A 2BUAA 4YP1A 3Q11A 4MIOA 4FVTA 4RAOA 1ZNPA 1JHAA 1PL6A 4IGKA 3LECA 4ABTA 3DKQA 1BCSB 5U4XA 5J1XA 5FTJA 3OC0A 2QUKA 2JLWA 4IICA 5A5FA 3W3ZB 2WT0A 2X8BA 3G9TA 3HB5X 4M22A 1QKKA 4Z4IA 4TSVA 5H70A 1K6JA 3V4ZA 1XQYA 1O5TA 2WICA 4NQZA 2HLNA 1WBFA 1ZH4A 4QM7A 3FZ3A 1CG6A 3KVOA 5CFQA 4JIGA 4RESA 3BN3A 5CG8A 4PBOA 3ZD9A 2AK2A 1AYM1 4MQ6A 3RROA 3AKTA 4ZXPA 1WXQA 3GRYA 1RC8A 2PSHA 1OVPA 2XMGA 4HQ6A 5KNDH 4G8JA 2R6JA 5JOZA 2CK3D 1QJX1 4AE2A 1F3OA 1GP4A 1QO0A 3HKEA 2IHBA 4AVCA 2ZB4A 2D1YA 4RTMA 2IS4A 1GZ9A 3I49A 1E8DA 3NXSA 1DWQA 1E9AA 4GS5A 1CNFA 3QVXA 1PNFA 3EXHA 4NHLA 1VJRA 2LR0A 9LDBA 3FHJA 5IVIA 4B6FA 4BM8A 1U5XA 1VRBA 4DS3A 2QENA 4J0FA 4E32A 3DPRC 3G7SA 2FDHA 1AQIA 2H0QA 3FMFA 5CNJA 1IN1A 1VPEA 2N75A 4C0BA 3CHYA 4FIDA 4CIXA 2AKAB 4DNXA 1OA1A 3VKVA 5B7GA 4N12A 1EM6A 2HWYA 2EIHA 5JZMA 1L3JA 3SHOA 2QQPA 2RDNA 4HYTA 4JAAA 1ZXBA 2PRSA 4BMYA 4HVCA 1ZOPA 2OCGA 5H4GA 5DUXA 1AGPA 2ZR8A 4NWIA 2JAUA 4MWSA 4X3OA 3TEJA 1UU6A 4RVNA 3HUDA 1JYVA 2JBHA 2RD2A 4AY4A 1F12A 2JG8A 4Q0QA 3PWSA 4IL7A 1NE7A 3ZE1B 2A1TS 4E2YA 1W8UA 2GC1A 4XE5A 4D3WA 2ZRCA 4D74A 3H13A 6REQB 1WOYA 1MOPA 3L3BA 4RL6A 4GOMD 2HBQA 1Y8QB 1U28C 1H3EA 3HKDA 2QM8A 3T7CA 1BXKA 3CO0S 5K8VA 3BJMA 3HGQA 2UKDA 4K26A 3VZSA 3G79A 3P97A 1X7XB 4NBLA 1MD9A 3UT5B 3M4ZA 4CMBA 4NCIA 1NW8A 1CWUA 5HIKA 3RYPA 4G09A 5ALPA 5DAPA 5AT1A 2CDAA 4XCAA 3OJXA 3CUTA 4MQLA 1TUIA 1J20A 2D62A 3VBHC 5IAVA 1FEZA 4F92B 1HMYA 2C2HA 3W1VA 3HVJA 4KPYA 1NKVA 3AETB 4R69A 3JQCA 3HVDA 5ALTA 2Z69A 2X1VA 4Q9JA 4KITB 3I0MA 3ZWKA 2C8VA 1B6RA 4MKZA 2VHQA 4KQ2A 4X45A 4XTRA 5E6SB 2YR0A 4V0RA 5DKFA 2H3EA 1YS4A 2C1EA 3ZYJB 3NV2A 5K0UB 4PHHA 1I3OA 2JJQA 4H31A 5IBRA 1FFXA 1KDVA 3IQZA 3MW2A 1FUEA 5LNK1 2M32A 1FYFA 3WF4A 4CI9A 4RD7A 3ENZA 2C9ZA 2X5NA 3AL2A 3CN9A 3WL5A 4CVNA 1RZRD 5APAA 2Z2SB 3H19A 1RUF1 5IABA 1DPFA 2EOAA 521PA 1M8PA 3TI9A 3IEIA 2XAUA 2ZWAA 2GU9A 2KLHA 3VZOA 4YM1A 3B85A 3VO8A 4YGYA 2XITA 5AC92 3T7SA 4JVLA 1VBD3 1FFBA 1W85A 5L95A 1NF8A 3GT4A 4FGWA 4R1UA 4PU0A 2JC3A 1ESZA 3CR7A 1JAHA 3FYSA 1PGSA 5I91A 1J9EA 3BD9A 1VRWA 5C3UA 4BEBA 2VKQA 2JFVA 1MENA 4WZFA 3LWNA 1XSEA 3GL9A 3T08A 1RXCA 4R0NA 1LGCA 2ZPTX 3HH8A 4J29A 5A7OA 1XD2B 1JI3A 3RWKX 2OTCA 2PD4A 1DF0A 2ZMKA 1N34B 3N2IA 4GOXA 3FSGA 1VYUA 2FWJA 4J2TA 4TVBA 4ZRMA 3NBZC 1P8AA 4BAZA 2WMYA 1MVEA 1BGWA 4JZYA 3JCIA 3GLRA 5EJ8A 2G1KA 3MLAA 4MUNA 1CRLA 1FNMA 3EIUA 5A1FA 1W1IA 3IODA 1L4UA 1UUFA 3L0OA 2YWBA 1J21A 3K4HA 3WSOA 3GNSA 1PK6B 3VBUA 1U3VA 3UB4A 2XTAA 3ITQA 3R8XA 4BMNA 3USCS 1FDRA 2REQA 4AVYA 2GN6A 3TIXB 4JLNA 4UHEA 1MVLA 1F8YA 3ISVA 4AKTA 3HZRA 4BXOB 1YDEA 4PHFA 3EMKA 3ZXUB 1A8SA 5B58C 2WE8A 4CMHA 3V56A 2WFF2 2QQGA 4C7XA 4D0SA 4JLSA 4CYDA 3SZLA 2JLYA 5CJJA 4ZI7A 1Z2EA 3DL4A 2OQVA 4BNTA 2C7RA 5CW1A 1GDTA 1VIDA 3LUCA 4J16C 1VHJA 3T1TA 1U80A 3AV3A 4OU5A 1A27A 2FCRA 1BK1A 1ZISA 4X8OA 3PX3A 4PINA 2V4VA 5LKAA 2CDOA 1Z2PX 2HHHB 1J9GA 2FUG1 4BLUA 2QN6A 2PANA 1RCUA 1JZTA 5B57C 5C46F 1N0IA 3WWYA 4OQ9A 2RGEA 4UOEA 1E1YA 2FFRA 3DXZA 1DJMA 2X0DA 1BC5A 4HSLA 1UT6A 4DQXA 1YVPA 3AI3A 3MG9A 1SHJA 3AZYA 3GF6A 2PNFA 2GJSA 3RHTA 3RS8A 1WP4A 1VG1A 4EB6A 1L7QA 4YI5A 3RS3A 3IAPA 4FMBB 4CDNA 1KDZA 2Q9CA 4Y6QA 3BCHA 3B78A 1JEOA 4YCSA 1X9PA 3I2DA 2A2ZA 8OHMA 3D54D 1ZU5A 1KPGA 4RPGA 3ZKAA 3CNOA 3GRVA 1ULHA 2DH6A 3UJ8A 2D06A 4CM9A 4R9CA 4RD0A 3OGSA 4QPPA 1T3ZA 5JAZA 1Q8QA 3P0FA 2P6HA 1BJQA 5LQKA 1QRTA 3IP9A 3B00A 2XODA 2QU7A 2FTKE 3CJTA 1HETA 2VDQB 4Z9FA 1FXSA 3DLHA 2V98A 2AKYA 3A3OA 1ECLA 1KS4A 3O2JA 3JUUA 5ED4A 4UUNA 1VAKA 3E27A 1S5PA 1M6HA 5JUVA 3BMQB 5AOCA 3Q7SA 5FWDA 3OCVA 4IE7A 2IHYA 3LNTA 3EVGA 5EERA 1OLUA 5B3JA 3SS7X 2ZUFA 2Y8EA 5CFCC 3AI1A 4JC8A 1Z35A 5INTA 1V9U3 1ASJ1 3VR0A 5FBWB 1N1TA 3ZNPA 3TEMA 3VKFC 2JHPA 4WMLA 1W9FA 2DCTA 1R3UA 1M2OB 1M34A 1KDYA 2WQ7A 5CM8B 1LLUA 4F72A 4LBKA 3G2NA 3TEFA 3KZ1E 4RGAA 2RDMA 1V1MA 3W9SA 2YZMA 1CZTA 4CCJA 3Q3EA 5H5JA 4DRZA 3U26A 5KMGB 2C82A 1D0HA 5I7HA 1WLYA 4IRMA 3KXDA 1QIJA 4LA4A 2A5ZA 1ZAKA 5L3RA 3FJSA 4QEKA 2II6A 5HA5A 2ZX4A 4AI0A 4K05A 4QHZA 5C7IO 3I3DA 5ECYA 2P9HA 3U3XA 4CKBB 3RYHA 3MJDA 2F1KA 4OF4A 5HKOA 3E5XA 1GN9A 1G8JA 1V7ZA 4BRZA 5IVKA 3FVVA 4QXOA 5JMTA 1WXXA 4YMUA 3T7IA 1XK6A 1Q0UA 3G2MA 1J5PA 3Q9OA 3CURA 4N0EA 2YRWA 4BWFB 1GVNB 1C80A 2B5VA 1GNZA 2BR4A 3KHKA 3PTZA 4BNWA 5DXFA 2O8CB 1OX4B 2RGYA 4G4GA 4TKUA 4ARBA 3WB9A 4DR1B 1ZGBA 3NFYA 4PYQA 1Y6FA 4AS3A 4QGAA 1IPSA 5K20A 2BM0A 2H17A 2ENRA 2J0EA 5JSZB 4IHJB 2IDZA 4ZOLA 2AOTB 1CJKC 5F98A 3TQTA 4N3AA 4PC6A 4ZC1A 3DPSA 1CQWA 1Z56C 1CIVA 3ZI0A 2X2FA 3LHSA 3CWZA 2CB9A 2PYDA 3U19A 1W3VA 3ZKWA 1COV2 3B9PA 3EJWA 2XVLA 3PD0A 3HV2A 4KCGA 2E0IA 2ATXA 4TYNA 1TYAE 4R5MA 1Z8HA 4U2CA 4BQNA 4F5DA 3PHBE 2A67A 1R16A 4HMPA 3NYWA 3K0FB 2O8DA 4Y20B 4N5NA 2XCLA 1EFLA 5LIRA 4OK5A 3VTKA 3KWLA 1U81A 2QJFA 3RSCA 2ZDHA 3R23A 1C8M2 1V4BA 4HWTA 1JQLB 3FHOA 5CIYA 3ZYHA 1M6NA 2CZCA 4WQMA 3DCJA 1KP9A 1JB1A 3T7DA 4G3YC 4GE3A 3STUA 5HHTA 4X90A 2W11A 2PZAA 4TZ0A 1NATA 3V1UA 1BIFA 1G41A 2O50A 4MLOA 1T3GA 4B7KA 2FMUA 2B2XA 4OB7A 4IOMA 2IY9A 3BHJA 4KYUA 3W8EA 4RAQA 2W71A 2IF2A 1WUHS 4U9UA 1KYXA 1D5WA 1ZSNA 4YMGA 1SCNE 4Z5XA 1ZA1A 1BXGA 2G6TA 4KPEC 3T3GA 5IT5A 4TVKA 3CUVA 2X8LA 2R1VB 1M74A 3REQB 2GSYA 5IJAA 1RUD3 4W8HA 2PGDA 5IU6A 3E5UA 4EARA 1EUYA 4KN8A 4DS0A 2L19A 5DWQA 5EG5A 3NPMA 3ZSKA 4ZKTB 2IOHA 4MYRA 4DMFA 2GCEA 2GD2A 2J4DA 3QVVA 1QJCA 3QMWA 2TMGA 3CZ5A 3KU4A 4DNYA 4R1MA 5D6OA 3I1JA 4PLVA 2RHJA 5CA0B 1O8CA 6CHYA 1KAHA 4YPVA 1ADYA 4DF3A 4LQCA 5DNDA 1YQ8A 2GR9A 5HXAA 1ND6A 2ZQ5A 5E8JA 4A82A 1IXYA 5FY5A 1JSZA 3MXTA 1GZSA 3LSTA 1TUEA 2WP8J 4LHWA 5K6AA 1RD4A 4DANA 3SQMA 3ZLJA 4M3NA 2W1QA 3ZDDA 4I0WB 4RQAA 1MJFA 3S81A 4FDAA 4D4IA 1FTYA 3R7FA 1FRFS 1QHHA 2V6FA 1C4WA 1JIJA 5AOAA 3HNYM 4PANA 3ETLA 2AN4A 5CT5A 3A9WA 2ZBQA 1D7AA 4FW8A 1L7MA 3RFRA 3HCAA 1NF2A 3MLKA 3NIWA 4XX1A 1QXJA 5EC8A 1HOXA 1YQTA 1EVZA 3HJNA 4EFKA 4NPLA 5CLJA 1ADFA 2C4VA 3EA4A 4RFLA 4YW7A 2J4FA 5KC8A 3TIGA 2OX0A 1FTGA 3A6JA 4FEGA 3MLBA 3LA6A 4JLPA 3OJLA 3UK9A 4O2AB 4OI1A 1GT6A 4JVMA 2GNAA 4PO8A 4DUXA 1SIUA 5BR4A 4MX3A 4KWKA 1V3QE 3IILA 4BLSA 3OO1A 3WIDA 2QD1A 4YGDA 1LXCA 3FOZA 4UW3A 4M6WA 1J5XA 2HEGA 4QQ2A 5KBFA 5AFBA 1CR2A 1XU4A 1ZC3A 5EZYA 4FZVA 3WGOA 1PZ9A 4RO0A 4PRKA 2VT6A 1XZCA 4RSRA 4K3VA 3ZU5A 5AKXA 3RU9A 4Q0PA 1RYHA 3BXFA 5FUIA 1Q84A 5ALZA 2Q0SA 3I04A 4KO3S 5LXTA 3MB5A 1D2CA 1SMKA 3MINB 4E7PA 3RWBA 4DCOA 2WIJA 4GWMA 1T4MA 1NP3A 3FNFA 3MEPA 3WOHA 3CG4A 3WWCA 1ZJWA 1XNJA 5JR2A 4IW3B 1E3IA 3C3AA 1PLKA 5LDGA 1BXGB 2B45X 5FZMA 1EXVA 4XPZA 3VGJA 1BXRB 1F2NA 4MV9A 2PKQP 1E1CA 2VT3A 3PQ8A 1G5IA 1OT5A 4KG0A 2AJLI 2IP2A 1GILA 4LA2A 1QE3A 5KPDA 4MUFA 3N6RA 3EF3A 2P9GA 1E5QA 3WFJA 2Y6GA 3K9HA 2GNMA 3BIEA 5ESXA 3KXLA 4GR9A 3OCCA 3BE5A 3K2BA 1N2JA 4DLUA 4KXUA 2P2KA 2X7HA 4I55F 3TNJA 4H7HA 1B0ZA 2J31A 1FL9A 4LBQB 3A4IA 3ME5A 1LC0A 3L0CA 1PT6A 4IVQA 2RGCA 1O6GA 4JS0A 1WB5A 2YV8A 1SBQA 2D98A 3ZYCA 4CTKA 2YBSA 1RC1A 4WH0A 1YC2A 1HE3A 4DDWA 1Q1ZA 4UZEA 4OQ4A 4X65B 2OHGA 1W8NA 5HP4A 4CG0A 2YZGA 1YRZA 1PG2A 2ZWVA 1SVKA 1AX2A 2WNUA 4DRXB 3COJA 2YBEA 2EKQA 1AR82 4GIQA 3BGIA 4FFOA 2Q7XA 1HXS2 4X6RB 1SXPA 3VOSA 4EAAA 3G89A 3AO0B 1PS9A 3WDTA 3AGQA 4M01A 3BGWA 2O8EB 4I14A 2IIVA 1EJ0A 3QEAZ 4XYGA 1GPBA 2DUMA 2FUEA 2XVKA 1DKRA 5FL3A 4AC9A 1F20A 3HO8A 2APJA 3AF2A 4HGOA 5FYVA 2WFLB 4QODA 1VI6A 2BFFB 2CJFA 1SVOA 4ROTA 5D2AA 2AL7A 4OB6A 1RMU3 4BCDA 3LBFA 2QORA 2IV7A 3R0QA 3W58A 1O58A 2PEZA 1XFDA 4GP9A 1PJZA 4QRDA 4JUBA 2GSDA 3BK1A 1ELOA 3F78A 2DCJA 5AHRA 4LNUB 1C4KA 5CZKA 4MGSA 4IZOA 2VMGA 1MEC2 4JC1A 3D2CA 5F1YA 3HKEB 1THGA 1Y1QA 4XCBA 2PUVA 2EEPA 1GNTA 1E4EA 4UVDA 4Y24A 4LMPA 4QU2A 3KYCB 2XCIA 4A0FA 4B4OA 1BEV1 2G04A 4CCAA 1I24A 3L8EA 3X0DA 3ROXA 2FX3A 2NOAA 1W8FA 3OVMA 1U2SA 3VPGA 5IFLA 4UUQA 1A9ZA 3WGLA 2HIGA 1XCPA 1MBZA 1L5KA 4OBXA 4C20A 3U78A 2VDVE 1PF7E 4YWAA 2PHFA 3E4DA 2J4CA 2VPIA 4G5SA 2IYWA 4B9AA 4YCJA 5JWHA 4E4HA 4Q0SA 4KO4S 2ZWIA 4OUDB 1LVGA 1UWCA 3T1NA 2VZVA 4MQEB 2C4KA 3I34X 3MAJA 1V70A 3WLQA 5K99A 4XJVA 5LBFA 4LJRA 4BQFA 2G28A 4BQ5A 2P4HX 4F2DA 4AN0A 3PNKA 3MPPG 1UZ0A 1OASA 3KXKA 2QQMA 5D8AB 3OEEA 3NRJA 3BTXA 1XXLA 4EY4A 4LOAA 3CEMA 4N7JA 2HR1A 4B76A 4JJAA 2PUTA 3HQ4O 2UYCA 4XUGB 4QM8A 4OSPA 3CNBA 3GLHE 1Z0KA 4TSFA 4RJLA 1BFDA 1OBVA 1L1QA 3MCTA 1JFSA 1CS0B 3N7JA 1W05A 3HDYA 3N5CA 3RWOA 2IWHA 1PFWA 4WLVA 1DX9A 3N74A 2HWD2 1IPJA 1QCZA 4W9NA 4R41A 3I2YX 1IHUA 2QMZA 1HTWA 3CN7A 4PXYA 1USUA 3KTAA 1X80B 1ZRFA 2CW5A 2QPTA 2WG2A 2WD7A 5J36A 1WHTA 3CRVA 1Z6PA 4E2WA 3UA4A 1N9KA 2XSZA 5DSTA 4NAMA 1UK6A 4RHXA 4JHTA 1KDKA 3NWOA 1K4YA 1UBSB 4OH1A 4FP2A 3K4QA 1JBKA 3BQ9A 3ESAA 3SSOA 1SD5A 1H5UA 1NURA 2I33A 4P1ZA 1K5PA 4A2CA 1Y8RA 3UAZA 4YBZA 4ETMA 1A8UA 2CL6X 4DBZA 4UTRA 1VLLA 2O8OA 3KEGA 4AMUA 1AB5A 1P61B 5J1TB 4EKYA 3R77A 1VIMA 2H5JA 1EVJA 3ASZA 3JQAD 2MDTA 3OPYA 4G63A 2Y27A 2D93A 2JVIA 1NU8A 3WG3A 1MQ9A 4AMYA 2Z95A 1A5BB 2HRBA 4PQRA 3FTEA 1N6HA 1II8A 4HUJA 2OG2A 1N6KA 3EVBA 3NHWA 4JUAA 5IMBA 3QITA 1V1JA 3NHPA 2HWC1 4BATA 4PLPA 2IOFK 4C4ZA 3T1QA 4KQFA 1NJFA 1ZM3A 3T7TA 2YV5A 2ZUCA 1H0HA 2V7WA 4C6TB 3OD4A 5A4FS 1DBVO 2YC2A 1JZ5A 4O9EA 2BSXA 4B4KA 2E26A 4CEJA 4O65A 3QG1A 4A8JB 3QVSA 3D59A 2ADEA 4BUZA 4W5HA 1Z07A 1L5RA 2FGKA 2X8KA 2IX3A 1CZLA 2XGJA 1RB8G 4HWKA 2DWOA 1TQDA 1NPYA 1WDWB 1I4EB 3ZWVA 4UJ5A 5C81A 3KKKA 1F2UB 3A4NA 1SA0A 4QOFA 1ORVA 1ZINA 3AK4A 1Q0LA 4HP8A 3AUUA 3B2EA 2I3GA 1J8YF 4BNDA 4LHSA 4HLDA 2Q4DA 5G53C 2AQ8A 2WKSA 5ACA1 1YR8A 5JVDA 1TU0A 2B8MA 4UE3S 2XNSA 2YYYA 3UKDA 1W34A 3L6RA 1SXIA 4DOUA 4EUFA 4PX5A 5FWJA 1K0FA 1ZBE3 4C4PA 2OORC 2FWAA 4QTUB 4NK4A 1YFKA 1D4AA 1UR5A 3DDCA 1JAYA 3LBYA 4WV3A 2O6HA 1ML4A 2HJWA 3GG2A 4KEAA 3AKCA 1X42A 3A22A 1P73A 4Z1VA 5AK5A 1E2EA 4MJ7A 4BQWA 3RT9A 4P54A 1OOPC 1GAXA 3QA9A 1OQEA 3PD7A 2Z58A 4L50A 2PA3A 3U7QA 1WLWA 3ZNQA 4PCUA 4M9SA 3OBRA 5IKPA 4MQMA 4KQ1A 1W5SA 1J99A 1C29B 4F4CA 4XLZA 3RC8A 1LBTA 1ADJA 3PFIA 2QQWA 3KS7A 1SVSA 2J42A 2H59A 2ZM5A 1C1XA 3BQMB 2W3JA 1EXDA 4IGIA 3EUEA 4YMIA 2DBZA 4P58A 2HWB1 4IJ6A 3GZNA 4BQ3A 1GZDA 3AKSA 4EKEA 1CP3A 1BMTA 1IN5A 2EEZA 2G07A 3T3MB 2H8GA 4FPXA 4Q02A 1KO7A 3B01A 2YW9A 5TT0A 1SHUX 2QI9C 2IHKA 1X7NA 3GOHA 4KH0A 1FP2A 4HN1A 4C5CA 2BMWA 1JYEA 1TKAA 4JLAA 3RNOA 2I3ZA 1VM6A 4YALA 5C5IA 4C01A 2ORED 4I50B 3CXRA 2QJRA 2I03A 3SNKA 2HBRA 4B17A 1QORA 1M2WA 1G6KA 2XUFA 2HUPA 5GV7A 1J1UA 1U1EA 3VZBA 5JQGA 1NL3A 2BZSA 1WBLA 3JU9A 1MW8X 2C29D 4L08A 1VGVA 3DOHA 2E37A 1YL5A 2QF7A 1ZRNA 3O8DA 5DYGA 3NALA 2VXOA 3HBNA 5K0BA 3UENA 2E31A 3B6IA 4E51A 5KO2A 4F5EA 3DS8A 3Q3VA 3VBOB 5KNCH 3UYJA 3IAAA 2NNWB 5BVHA 4Y2QA 4PQEA 1ZOIA 2JKBA 1Z5UA 5JRZA 1PRYA 3IYLW 1DEKA 1S96A 2B8TA 4Q4AA 5C8CB 1U6KA 2XZPA 1KYTA 2C0PA 1A9XB 3DONA 2E53A 1FSGA 3B3JA 2R16A 5AKJA 1L4KA 3OPWA 1R1A1 4UF0B 3SHWA 2QT9A 3ICEA 2JLAA 1U3DA 3HXTA 2ZHKA 2LIVA 1GGKA 4G0MA 4K9PA 4POAA 1D0GA 2GPYA 4KQIA 4O5OA 5CU7A 1ODIA 4BGUA 2ZMNA 1D4OA 2QSYA 1XXHE 2MCFA 5FP8A 3MJ4A 5A3SA 5BYNA 4V02A 1QDUA 3A58B 3DXFA 2QXTA 3NQHA 3R3SA 5AC93 1PDOA 1E2HA 4O0MA 4HDQB 4G84A 1UBUS 4LXTA 3KB2A 3HN3A 3E15A 5DDJ1 4B84A 1JHJA 4R7GA 3KSBC 3MB8A 2HJSA 4C4XA 2VZ9A 5IP5A 3R7WB 3VV2A 2B83A 3AVQA 3NWEA 3ZVRA 5IDWA 2I2XB 4L4SA 3NM6B 4BQOA 4LBNA 2FQQA 2JGDB 3EVTA 4B75A 4W8JA 2K2WA 1R9NA 3K9NA 2YHIB 2QE7D 4LYJA 1TVKB 3JVIA 3BCUA 5JCOC 3PIGA 1WW2A 3OGJA 1Y0BA 3JARA 2BGNA 4OFZA 4JLJA 3GGSA 2OSVA 3AHCA 3NVAA 4MQFA 1KGSA 3FOAA 3REGA 3G0HA 1EFVA 2GBCA 3KDSE 2XBO1 1QH8A 4RTJA 1JQBA 1JPJA 4EW6A 1F7VA 2CSGA 1NBWB 1N78A 3WWEA 1M66A 3TGWA 3EODA 2XX3A 3CVOA 2R8EA 2XHKA 3VBRC 3TRJA 2WIDA 3BCRA 3FZNA 1M2FA 3QJ5A 3E4CA 1IWBB 1KZ1A 3ROGA 3ZV7A 2Z8ZA 5DBOA 1GMMA 1X8XA 3C7AA 3KPWA 5L51A 4O9GA 3SYLA 4UHDA 1RLJA 5B30A 4D9BA 3Q88A 5B58T 3EJ6A 3IALA 5JEDA 3RT1A 4ZQEA 3I3MA 3GNEA 3JCZA 4G0VA 5L4NA 1ZM2A 2YXLA 4LPSA 3VU8A 3T4VA 2P9ZA 3D0RA 3IRVA 4RTLA 3POEA 2YHAA 2YVAA 1EPWA 1Y1TA 4ZRDA 2Q7DA 2E85A 3G6KA 5BWLA 2O8BA 4PBRA 1G2PA 4IIXA 3L46A 5AVJA 1F35A 1H2XA 3VYRB 4A1OA 3H8RA 4CGZA 2Q5EA 2WYSA 3HXKA 5FADA 3ZXEA 4TKLA 3AESA 4UHHA 2CL0X 3ZV3A 1AR72 1SBHA 4IUBS 4PAQA 4A8HA 3P9QA 1HQCA 3I1FA 4BFLA 1N6NA 2FW8A 3TRSB 1NBIA 4B74A 3PNLA 4DFSA 2GJ8A 1RAHA 2ZXUA 4ALNA 3U5TA 3PUSA 1SUSA 2G8NA 1E1NA 1GTG1 3OA2A 3RBAA 1QB7A 4LOHA 2M2IA 3EG9B 3HN2A 5F1PA 2YYOA 4H59A 1QMJA 1KIMA 3QQ5A 3C3CA 5FBVB 4Z7QB 4KYVA 4KK3A 1JVSA 1G6HA 1GA1A 1YWKA 3FKQA 1CAUB 2ST1A 2B42B 2RS52 4M83A 1EX6A 4EYSA 2OKGA 1PR6A 5BNIA 2HK6A 1IVNA 3AB8A 1IS3A 1OI6A 4QGBA 4KAJA 2CEKA 1EXNA 4QUBA 4COUA 1SK9A 5IDVA 1J8VA 1C3EA 3GMDA 3AOEC 1RYFA 3JWGA 3RS4A 3U16A 2G9FA 2EKBA 5CYPA 4XTCS 1I4OA 4EPVA 2O52A 4DQAA 3NETA 4WZBE 1HJFA 3NVKI 5CB4F 3KV9A 1ENPA 2E5WA 4TMWA 4P92A 3GP3A 2OHVA 4ZXEA 5DI3A 4MQEA 1A1SA 4NYMR 2JDYA 3NIDB 1ZD9A 3MRTA 4U0KA 3OBBA 3I3OA 3J7TA 3NJZA 1F2UA 3PGVA 4YB8A 3F1KA 3JQBA 4DZZA 4HQKA 4YW4A 5FNVB 1X2BA 3AXEA 2PX6A 2IXIA 3N8NA 1YFUA 3R4SA 5JS7A 4IEIA 1QOOA 4W7SA 3NOOA 5AFSA 3H3ZA 1NQVA 2PUJA 4ZU7A 5EIBC 2WV9A 3OY8B 3K5IA 3C6ZA 3MS7A 3WA6A 4JEIA 3DLTA 5BWMA 5ACA3 4DHWA 1E2BA 3PVNA 3Q6NA 1WVIA 2FZ1A 2Y1WA 3OLVA 3JQAB 3GLGB 5C5UA 2VOTA 4LVOA 3EXHB 4IWYA 1OLSA 2YFZA 1UQTA 1FVHA 3L05A 1WDKA 1WBDA 3TB4A 4F9GA 3DMYA 5JRDS 3QMVA 2E49A 3ZLBA 1I7LA 3AJ9A 5KNCD 3CVYA 3DL7A 3R0XA 4ATNA 4Z0TA 4S2DA 2YJGA 4B3NA 3TECE 1RXYA 2WY2D 3VR6H 1JYCA 1YZQA 5J9FA 2CLHB 3V8VA 3E3MA 2QD4A 5JOWA 2FW9A 4YN3A 1UCXA 2FFQA 1CUZA 1O4YA 4J16A 3CX7A 3W7BA 2DTYA 2W47A 4GECA 1LX6A 2IH2A 1YOBA 2WJPA 5L19A 1K66A 4AJ1A 3EVEA 5I3ZA 3H0EA 1Z12A 1B0UA 1ZRSA 5ISMA 3GZNB 3JYQA 1OI3A 5JDCC 4E0BA 4K9NA 3AFGA 2MSKA 5FRDA 2D6PA 1IK6A 2ZQZA 3CWQA 2VWHA 1JJ7A 2OR3A 3AVUA 2EZ9A 1UL1X 4AUKA 1XZEA 1BBT2 4AEDB 4F71A 1I3LA 1NNSA 2F1JA 3L1IA 4IDGA 1RUH3 5JO0A 4DXHA 1K6EA 3HBKA 2E82A 3ZW9A 2WNVC 3OA0A 3RYRA 1GL9B 5FBLB 5I4CA 4A10A 1SPXA 5DAWA 1P18A 4R68A 5EXOA 2VEOA 3H17A 5F39A 1UBFA 2B9VA 2NN3C 4EMSA 1VBA1 4IHJF 3TLGA 1E1KA 2PJZA 4DM3A 1YHNA 4LAFA 4QLAA 1RUOA 2CE2X 1C3VA 1FJHA 2FZ2A 4EG4A 3K77A 1DRUA 1KE2A 1FV3A 2FR8C 5C37A 5K03A 1GSIA 1HB1A 2BP6A 1I3CA 2I7VA 5GJCA 4KRYA 3R4DB 4HLUC 3GYGA 1N5MA 2BD0A 1SCBA 5A7FA 3FPHA 2DPYA 1Y7PA 2WZ8A 3KQHA 5DTMA 4GBGA 1WG8A 3QKWA 5F73A 3EXG1 5BYKA 1PK8A 4IDBA 4DADA 3QXGA 4RQPA 4XD7D 1N5IA 2DQZA 3BBLA 1X38A 2VUHB 2IPAB 1QOPB 2EGUA 1TTPB 1CU1A 4QG7A 2RGXA 1W36D 1ORHA 1DE0A 1A69A 4TXMA 3Q4GA 2JHCA 4AG5A 1NBOA 5AKYA 2ZUEA 3HEMA 1RHMA 3VZDA 4MKRA 4OUKX 3VBHA 1ZUIA 1F51E 2DSNA 1D03A 2QRMA 4MCHA 2FSPA 4UAUA 5IUKC 5EQUA 4CEHA 5JS2A 4RPLA 3FRJA 3DNPA 5BNNB 4F4IA 1XKLA 1W52X 4Q4V2 3HU1A 3A1FA 3AG6A 2R5NA 1H4SA 2XRYA 5TB5A 4YV2A 3BKWA 1FNCA 4WZZA 4BQ2A 3L1KA 2IXLA 3C5EA 4QX8A 1PLLA 2F4NA 1O5LA 3B8HA 3KXPA 5AFEA 3Q8FA 3B70A 2JIOA 1NW5A 4ZU4A 5HCAA 1YI7A 4WLFA 2DWUA 1N77A 2VNGA 4URZR 1ZUNA 2VJAA 3B36A 3X1XA 1YK1A 2WFMA 4L8FA 1X13A 4JU9A 4K6GA 3M5PA 4GZ6A 4CDXC 2PUAA 1DQPA 4U8GA 2KW5A 1QQ5A 4WSOA 2HOQA 3L2HA 5E3IA 1DEAA 2VYNA 3MWKA 5CDSA 3M1LA 1XQ6A 2QTBA 4GF5A 1RPNA 1R27A 5C1OA 4EITA 1BQPA 3P9YA 4ASMB 2KXLA 1XDZA 3ZYIB 1Y3HA 2SECE 2MJLA 1PO22 3DV0A 5F35A 4C9BA 1XROA 1ONSA 2QG4A 5TS3A 5ESWA 2OBMA 4BO8A 1O1YA 2W6QA 4PYJA 3LA3A 4JGZA 3QY0A 2AS0A 2A9PA 4J7XA 1L8LA 1AXRA 5J7MA 5JSOA 1YIFA 3PHGA 3OJBA 3X2EA 2VCMA 1V6SA 2F3UA 4DJTA 3B6EA 3W3AA 4KXLA 4BIFA 1LJ7A 1N6LA 3JYNA 5EE5B 3TFWA 1F2DA 1V16A 2RGNC 3EGCA 2WJIA 1KEEB 1R083 1V5WA 3NSTA 3ZXJA 3V9PA 2PN1A 1KARA 5IJRA 3HBZA 3AUKA 1KQNA 1PEAA 4G23A 1KOGA 1ID1A 3UCXA 5J2UB 2FJUA 3AJZA 4E3ZA 1JH9A 5A6ZA 2PLAA 4MLPA 3WWDA 2B8JA 3IH5A 1FRNA 3IT2A 4P0PB 4QBGB 4RM2A 3ZFGB 3V4VB 1S1AA 4NE2A 4D0NA 5JZBA 5FH9A 4TTSA 3AFNA 3LFMA 3PE6A 3BYZA 2XNDD 2PBLA 2HMYB 1Y9DA 4KOEC 4F7WA 3ISTA 4IV3B 2B4QA 2P3SA 3LW8A 5E7IA 4ARYA 3B1YA 3WNVA 4PX9A 4N5LA 2AEJA 4PGAA 2QUAA 1GPYA 3D0QA 1UP6A 3INAA 3PUHA 3KQUA 1PW5A 1W4AA 1ALYA 2QVYX 1J49A 2ZKNA 1W03A 1ENYA 1CUXA 3L1UA 3OWHA 2LRPA 1W2OA 3NYQA 3GBSA 1LJLA 2FEMA 1T1SA 4BKMA 4ORFA 3PNSA 1GKKA 2VBCA 1L5SA 1QTQA 2VE1A 2PQSA 4M21A 2P3YA 1E1MA 4CU9A 4H08A 4LZJA 1LOCA 2ECOA 3KBOA 3CSSA 3M2MA 3HU2A 3CUSA 3KKLA 3IVAA 4ZVQA 3BIFA 4XYXA 2VJOA 5LOVF 3T2OA 4HL0A 3CNEA 3U4XA 5AVTA 1IHYA 1GQGA 1OMOA 1LDEA 2FFHA 3UTCA 5GONF 2XDQA 3HA2A 4Y2PA 4TS4A 4C07A 3C6BA 2Q5IA 3GGPA 2J0QA 3TQIA 4LNUA 4TX1A 1DJQA 2NMOA 3E8SA 1BHJA 1ZAYA 3TW4A 4ZFNA 4MHRA 2GH2A 1IEXA 3GLSA 4XVRA 1TIBA 3R7SA 2XT0A 2XECA 1EAH3 3ZMOA 4PLNA 1OFUA 1AYN1 3WUCA 3OPYB 3KMHA 1XHEA 3DE4X 2CE7A 2VOJA 4H3HB 4N3CA 3IXQA 1E1LA 2XB2A 1N1EA 3I6ZA 2HWD3 1ZZ8A 2R30A 4RHTA 2RGUA 2AI3A 2BRUA 4HANA 1H1LA 3DUFB 5HF6A 2ZX3A 4LDNA 1UBRS 1J1LA 2WO1A 4K6OA 1ZD5A 3OSUA 1Q7RA 1VPTA 5KYGA 1G8HA 1V7PC 5LD2B 4O33A 1U7UA 4YAFA 3ETDA 1MU0A 1RHQA 2ERCA 3ABOB 2OHHA 5JHGB 3PJQA 3L4EA 2F8SA 3AB3A 4WDRA 2WZR2 3V1MA 1RMTA 2BBAA 1JYIA 4IJMA 1N2XA 2ZSJA 1AC5A 3JD2A 4LZAA 1KD7A 2C7PA 1WU7A 5CRIA 2E4YA 4L8LA 4DV2B 7AT1A 5LZ9A 4KI5M 1ZVVA 1SC4A 2F59A 4RD2A 2O8CA 2ZA9A 2OMKA 3L6DA 5CH8A 4MLDA 2VS1A 3I2HA 3RSOA 2B8EA 2P62A 4OP2A 1R4NB 1GGEA 1RAGA 1X6VA 4BB9A 4IO1A 4W1RA 3TMYA 3ACGA 4DXSA 1UK9A 2YWRA 5HGXA 3PC6A 2JD9A 1E62A 5JIBA 2P2YA 1O5IA 2A86A 2WHQA 1HV0A 3C7GA 5KHAA 4HKLA 5T7BA 1Z75A 2Q4SA 3SQNA 4BGEA 1E7QA 4WOBA 2FW6A 2VKTA 1AZLA 2ORVA 1W2NA 4JBWA 5FUQA 1PFGA 1DAHA 1E2JA 3IBCA 2GI4A 3D6VA 3X1ZA 1FLAA 3GGCA 4B2IA 3U61B 4BQSA 1CESA 3VPXA 2Y0EA 4O5AA 3ONEA 4BMOB 1OOEA 3ZHQA 4BTLA 2HQRA 4HVQA 3NATA 1TZCA 2Q3LA 2O14A 2R063 3CTMA 1OXKB 5CW2A 3MVEA 2VJMA 4WJLA 1JEYB 1SUIA 4JI0B 5EINA 3H50A 4I4CA 4BE4A 2PMWB 1SLTA 1WZUA 1SD1A 5J37A 1QFZA 2Q30A 1A8MA 3PTYA 4ZDIA 4OQPA 2I65A 2JENA 3U75A 2Q1FA 2D1QA 5A7WB 4IDQA 2PRIA 2HWE2 1H42A 1R4ZA 4DQLA 2GPBA 1ODFA 2XUDA 3OB8A 4JLVA 3EPKA 5DHSA 2HA7A 3FBGA 4GM0A 3AXSA 1B0AA 2W8BB 4ZGGA 4R01A 5FOBB 1HDGO 1ZJJA 2PQ6A 3WX0A 1LF5A 3OECA 4R40A 1C30B 1LLCA 4R3NA 4U5XA 4EVRA 3QXCA 1XWWA 5KHIA 2AX4A 1T6ZA 5GALA 4O4LB 4HH3C 2EQ5A 3AZXA 3WLUA 2H1OA 1U94A 1H2FA 3R5XA 3LIHA 4D6RA 3KGZA 3T15A 4UDXX 5H02A 3TDMA 4YW3A 3ZN6A 3OCUA 4Q1FA 1F4LA 3O9ZA 4S1WA 2H0VA 5LRRA 4AR2A 1K3IA 5BNNA 4Y22A 2LS6A 3ULKA 2XUZA 3E2MA 2C24A 5CAEB 3S2IA 2AXEA 3HVKA 2YZKA 4JLWA 4ENPA 3MUY1 2J1LA 1QYWA 3TMAA 3TRFA 4RM3A 4ZI7B 2OVFA 1QXRA 3NM4A 4QXKA 4FT4A 5ALQA 2PUDA 1RWQA 3KKQA 1OLXB 4MRVA 5IT4A 1GOHA 4NJEB 3JZAA 2VYVD 3V97A 1AR93 2NVBA 1P5FA 2IELA 1DDLA 1VIYA 4EY5A 1NBEA 2QW0X 1VBA3 4EABA 4EYGA 5B2FA 2YWJA 3HWX1 3OZFA 5KQPA 3H4MA 2HO4A 3H11B 2XLAA 2WIFA 3C7FA 1ZJ4A 3VOBA 4O4LF 4PYIA 3ME2A 1NIPA 2HMUA 3L7BA 3UT6A 3ZXGA 3AMPA 2G25A 4A8PA 4NENB 3W8NA 1JS9A 5DZFA 1Q3KA 3GRZA 1D6MA 3W9AA 2XTMA 4JKIA 4BGDA 1K42A 3WF1A 3FNEA 1T8WA 2GDJA 4QOHA 3RZGA 3PI6A 1Z29A 4X97A 4R54A 1GCOA 1Y9AA 2X5IA 2FCTA 1TMKA 3IAUA 1WUVA 1U2ZA 3AK0A 1SQ6A 4N18A 4WBNA 3QSGA 1SPPB 5L8VA 1QZUA 5HE9A 5T5JA 2RJOA 4BZPA 1W4LA 1H3NA 5C1BA 4S12A 4J7CA 1Q8OA 2YICA 4NKRA 3SEZA 4PSDA 5FX2A 1ZR2A 3HCCA 1RWOA 5FIUA 2R8YA 4JXZA 3S7IA 3MJEA 4FPJA 3QBVA 3N53A 5B12A 2Z42A 4ZCPA 4QU9A 3K6SB 2BOJA 1HPLA 3R8FA 1SZDA 3UATA 4ZZ0A 4BFVA 1BEV3 4XTPA 3IKWA 5JBQA 1PJ8A 2QY9A 4YVSB 3ROMA 3GYDA 4P5EA 3ZFEB 1HT3A 4KR6A 1WLCA 3W5JA 2AX3A 3DZ8A 4BCBA 2IHNA 3N9PA 2C97A 2D4AA 2HN9A 5D21A 3AWIA 3V9AA 3M1HA 4EZ4A 3VR6D 1C0IA 3EQEA 6PFKA 4HVTA 4RY9A 1J59A 1CD5A 2DM6A 4FCWA 1AGYA 5KWRA 4NFHA 3RZHA 4RGVA 5L53A 3AUAA 5KOYA 1UIMA 5T8KA 5FQ0B 5CNMA 4FOYA 3WQ1A 2W2IA 3UOGA 4AAPA 1Z5ZA 4IG9A 4UHKA 1LOAA 1NCRB 4RIEA 3X1KA 3IO5A 4HMQA 2ZPAA 2HF9A 2Q21A 1GZ4A 2HYKA 1W36C 1CY1A 1FLVA 4X6QB 3ANMA 2AE2A 2QN9A 3QPDA 3ZSMA 1SKAA 1P6QA 4FSXA 1E6LA 3PYXA 6ABPA 5BSKA 5AVVA 1KOJA 4WXMA 1MB0A 3VPAA 4URWR 1YRQA 3IAM6 4HNTA 4QKQA 3K3NA 3D4LA 4MUIA 4Q7MB 1Y82A 3QLQA 1JQ5A 4NBTA 2Q5OA 4CDUC 4CZ2A 4JBYA 2XADA 3L8ZA 1P1FA 5EFZA 2DR3A 3H3FA 3KZMA 3BJEA 3E0QA 5TT1A 3CRNA 2V9PA 4HRVA 3WGKA 4QM9A 3UW3A 1EVIA 1QAOA 2AV6A 5ERXA 1U4OA 2PPVA 3T5BA 5BNOC 4CM1A 4DG9A 1IOAA 4US0R 2LIPA 2B5WA 1FI2A 3AKZA 3U14A 1A2BA 4MLCA 1UJMA 1TI7A 2GMMA 2XB6C 1O08A 2QD2A 1B2LA 3LUKA 3WIEA 2OESA 4LZNA 3BC1A 4FM9A 1OA0A 4OLJA 3GXOA 2RS11 1TRKA 1AV6A 3I6MA 4QQOA 2IUUA 1Z82A 4EUEA 2VH9A 1C4RA 4JCKA 4W65A 3VZLA 1DX6A 2H0BA 3CMCO 3C4VA 2FK7A 4H1UA 4RL7A 4HMOA 4Y1RA 3DF0A 3RYTC 3LLCA 3W79A 5I6DA 2BMEA 1OVGA 1BH2A 4EHIA 2X5IC 1DL5A 1C8KA 5CD1A 2F2TA 1ZD8A 2E4XA 4GD4A 1DP4A 2X9GA 4DQDA 1IXSB 4UM9D 1T2VA 3WYCA 2ZITA 4PFQA 3WG2A 2BTOA 2BRTA 2O8BB 4IDHA 2QDNA 3NUQA 3EUWA 4PZ9A 1ND2B 3E9YA 3BXXA 1OOPA 4TQUS 2ZIAA 5HRCA 4KQKA 5JD5A 4HL6A 2VJPA 4FFBB 1G8GA 4JASB 4IE5A 4JGZC 1VJDA 3H8XA 4JX9A 4E5PA 5BO5A 2VCBA 1C1DA 1NLRA 1GOFA 4OXXA 1CKEA 4IV1B 3QPCA 4G0QA 1OGJA 1RBZA 1UMCA 3L6EA 4DCTA 4DG8A 2KJQA 2DQKA 1IPKA 2GFQA 3OG2A 3GARA 5K1ZA 4A4AA 1OI7A 2AXQA 4NDNE 1S4MA 1T9BA 3WADA 4D2IA 1C7RA 4DREA 4E22A 1T4GA 1Z36A 1WY5A 4IRXA 2V54A 1K6XA 3VBSC 4RC9A 3M5CA 3KJZA 1D1PA 2JEOA 3E70C 3HFRA 3O2NA 4KH1A 1VMEA 2FETA 1WMAA 4YJ3A 3K9QO 5L7WA 4Z7NB 2GPNA 1JFFB 3HQUA 3UFBA 4HXCA 1HKUA 4DV6B 3AL5A 4XDQA 2H2DA 1QKIA 2DG2A 3IESA 2O5EA 3KZ4C 1JAIA 5IH3A 4LHNA 3R6SA 5A05A 5CHYA 3NNFA 5LLTA 2OPBA 3BM5A 5HMMA 3T2TA 4FQZA 2YW2A 3RIXA 3MZ0A 4MVTA 4MR7A 1GG9A 3PGMA 4JJIA 3ABZA 1L9KA 1GGMA 2CJWB 4ED9A 5DTQA 4DIOA 2VNVA 4CM4B 2BFOA 5ESDA 3B8EA 1YZVA 2XE7A 3SCGA 4D6QA 2ZYWX 4GNKA 3CNQS 4KIUA 3IDFA 3SDBA 2HPVA 2QM0A 1A9XA 5JY1A 4UU1A 3AVRA 3JSXA 1SBNE 3QXXA 1RC0A 3NV9A 2Q0XA 3RGGA 4X0EA 4YAEA 3UW1A 2IW3A 2G4IA 2V97A 4A41A 3K73O 1HT1E 1ID8A 4HJXA 1RUE3 3LAWA 3AXTA 3NWJA 3UYLA 3DN7A 1S0EA 1KC3A 2YUIA 1VPDA 1QE5A 3MQ2A 4UDOA 3RBVA 3E6DA 4N39A 4JP1A 1E64A 3N2ZB 4IJKA 4EM6A 2VG8A 4Q4V3 1BWSA 3ROQA 1C1LA 3WHTA 1W1WA 1NDUA 1ZD3A 2DBNA 4ZCMA 1G64A 4BV8A 1M5TA 4DQKA 4CA9A 3RFCA 1FY2A 3OD5A 1AIPA 4L28A 3LIIA 1JR3A 5AJVB 5JLVA 3VU9B 1WKBA 1H2EA 1N0HA 2CFSA 2W22A 2HO5A 3OM8A 4OOFA 2JI9A 5TJ9A 4CDGA 1JR6A 3T1MA 2OUHA 3MS4A 1W88B 1C8LA 4LYDA 4R3UC 3FMGA 2W0SA 4GBED 1DCFA 5F37A 5B4UA 5CVVA 3EEYA 1EM8A 4OBWA 2D5IA 3DFUA 5F76A 1S3FA 3TQOA 2I78A 5LWQA 4CIYA 2CYFA 2X2EA 2Q1UA 2R7MA 4DB2A 1FVXA 3B38A 1DAOA 1FQOA 5EPOA 4H7FA 1YUBA 3RI9A 2K7ZA 4TLFA 5KX5B 4ZDJA 3BSSA 1D9XA 3S1SA 4KQGA 4C0LA 3U4MA 5SV8A 3JZMA 1OBCA 4X1OA 1XVAA 1KEXA 1WMXA 3QXJA 4CG3A 4IV1A 5EJ7A 1GRNA 1BE0A 2Q7OE 2O2GA 3ORJA 2G9NA 2BTEA 1BA2A 5FPZA 4RHCA 2IVIB 2GPTA 3IAQA 3TQRA 4O4IB 2GS9A 1GNPA 2I4IA 3QUBA 4JLMA 1B41A 4GA9A 1E9VA 5U9CA 4UBLA 2IU4A 4ZDKA 1WZ2A 2KLBA 2Q4RA 2PZ8A 4LKOA 5A06A 4DMIA 4KL8S 3VBFB 2GTPA 5EKXA 2CWMA 2ZT6A 4DY3A 2ZB8A 4IIFA 1IHXA 4D4GA 1SOVA 3JQGA 4LFCB 1R1DA 1B0PA 2XKKA 3JQAA 3UGJA 2WUFA 4DCUA 1E2QA 1ZH2A 4RORA 2OZLB 5FPBA 1AZWA 1JKFA 3DT9A 2COEA 3RKSA 2C20A 3LYLA 4N47A 1VDZA 3GDOA 3UT5A 5CEJA 2VP4A 2DHCA 4K9KA 3RM3A 1INLA 2VD7A 4YRMA 1AG9A 1F2TA 5JPIA 5JR3A 2V5DA 2W1WA 2B9UA 2WTBA 2ZUSA 1T9AA 3H1EA 1UWWA 4MWDA 3ZWCA 2CJXA 5AVQA 3PF8A 3EAFA 3A9RA 5DB4A 3I97A 3G5UA 2GD1O 3QVLA 3JYPA 4FJ1A 2F3QA 2BGLA 1P4AA 4ARXA 1ZZ6A 2FR1A 5SZKB 4TVOA 1MABB 2X9LA 3TPZA 4FJ2A 3LU1A 3Q5EA 4DW8A 2VDJA 3CRRA 4AECA 4MZDA 2JPDA 4ZKEA 2WQ4A 4V0NA 1CUFA 4HFMA 2NO4A 4AJHA 1UXZA 3AKRA 4XFHA 1CUHA 4D82A 3ELDA 2R8RA 4BMPB 5A3RA 4AK9A 5I9BA 4ZO7A 1E5IA 5FUYA 4I3PA 1DQ2A 4DV0B 2WS91 2FVXA 3DHWC 1HDZA 4AZVA 3A36A 3R3JA 2CBXA 3VSEA 2PMFA 4Y6OA 3VPBA 4LXYA 1Y9QA 3LCJA 4FE4A 4Y1UA 1VYTA 1YRAA 2J3EA 4QREA 5BPHA 2CYCA 3W06A 5JIAA 1CY6A 4MGIR 2WDZA 2V03A 1SRQA 4CLDA 3ZIAD 1FXUA 1NXXA 1A7AA 2HAEA 1NMQA 5B3AA 2OXCA 4BE9A 1RUJ1 2VW2A 1AA9A 2ZFUA 3R41A 3SC4A 2WNVB 1GYRA 1Y5RA 1UBEA 1MC5A 3DTVB 1QPGA 1XN4A 3EOZA 1AKEA 2WTMA 1E1RD 1KHTA 2ZRQA 2MR5A 2KE5A 2JDIA 2BSQA 5BSGA 1VB5A 2ZRHA 2QZ2A 3AYXB 1NNLA 3BL8A 1DINA 3A1UA 2Z5LA 1TUBB 3DNMA 3ALQA 4M0EA 5BSVA 4MW2A 1U7XA 1COWA 2EF0A 4HK9A 3HSKA 2GX6A 5CLHA 4CE8A 2ZRPA 1JW6A 1GUIA 3FD8A 1P2SA 2W6CX 4ITVA 4U2BA 4P36A 3OLQA 3KX2A 2AFHA 2V8OA 3FBYA 2FN4A 2OCLA 3AMNA 3HWJA 2AYYA 2HBTA 3KAQA 3CX6A 5CVEA 2YCBA 3UGKA 4P9WA 1UMBA 1XI2A 1RXEA 4QRIA 3ZSLA 1OIXA 2QQJA 1EG7A 1IIBA 1FNDA 4YP7A 3V2GA 4CIDA 1J6UA 1A97A 4MW1A 5TMBA 3RVNA 2XMQA 3FX2A 1VBE1 3LMKA 4DR2B 1WY7A 4D3FA 2IU6A 4Q8LA 1XLVA 5K0NA 3AJRA 4BS9A 1IAVA 2OV1A 2D6LX 2OT7A 3HYRA 1CJBA 2K6GA 4P3XA 4I4TA 3BYWA 5GZEA 1W25A 4CM8A 3BD8A 1E3JA 1SDWA 1QVAA 1MQTA 4NRMA 3C7KA 1WCIA 1Z17A 4Z9BA 3KZCA 1PNVA 4NYMQ 2VAXA 3HVRA 1E66A 2JFGA 4QFMA 4YY3B 4W99A 1WQ1R 3ANLA 3H3XA 4B09A 3N2YA 4FYPA 2W2KB 2FJ0A 1DIBA 4GPAA 3MTGA 2QMQA 2XDYA 1XXNA 2ZUWA 4E5VA 1OV6A 5A80A 4C5BA 1HDKA 4QT6A 2Q6IA 5H80A 5EJGA 1POWA 1T5TA 3R5SA 2KWIA 1AA6A 3S55A 1DOHA 3MGAA 1YRLA 3FX3A 1P2VA 1Z2CA 2XGGA 4E27A 1G18A 3WGUA 4K1XA 4IKEA 5HYVA 1ULCA 1ZDMA 1ADGA 4V0OA 3JR7A 3W34A 3AU8A 1YTLA 3TCXB 3BSWA 4G5YA 1YQ6A 4K1ZA 5HDQA 4K21A 5G0UA 3IZOA 3KSUA 2DTXA 2NQ8A 1QTNA 4WOJA 3QEOA 2H65A 2FFBA 3IIMA 4OFWA 3G85A 3VNAA 5K3FA 1NG9A 1DARA 4UM5A 4MAFA 1MR3F 5KDLA 4PQFA 1PR4A 3KHCA 4K6CA 1RJ8A 2C5DA 2R8XA 2XUQA 1FS5A 1YZGA 2QXYA 4M9ZA 4NHYA 5KYUB 4LXUA 1JAXA 2R1DA 5JNWA 3INRA 2EBFX 3WK4A 2DVMA 3AGPA 1C7IA 3X1YA 4FILA 4XYMA 3JASA 5I93A 3ZQKA 2G71A 2WWUA 3BICA 1K3UB 4CLXA 3HUUA 5FY8A 3FZQA 3ZVKA 1XVVA 1DIWA 3LTEA 4V0ME 2OSBA 3GLIE 3TNPB 2JFWA 4HJRA 2ZR7A 5JDCA 1K5DA 2BHSA 4D3XA 1B73A 3LQRA 1L5GB 1Y6QA 4BJ0A 1M10A 3ZCUA 4X60A 1QYRA 1AN0A 1UJNA 1CFZA 1UKAA 3PCTA 2XCSB 4IY1A 4AEJA 2I3DA 3MMZA 3MTAA 5TPWB 3K75B 1TC1A 2VF2A 3E5RA 4MVJG 5C7GA 1W581 2P2CA 1QHHB 5FCDA 4I1SA 5KMGA 1SUAA 3GU3A 5D8AC 4OPMA 2BT4A 5JSYA 1CUDA 2D2VA 1CF2O 1NZDA 3PUIA 2ZPXA 1C9YA 4G9GA 3IPVB 1OYYA 3O7MA 4BHPA 4HT3B 4JI8B 1J3QA 2WQ6A 2Z6UA 2RARA 1PT7A 2CXPA 3DTNA 2UYYA 1NONA 2ZSEA 3OTWA 2QZZA 3RC1A 2RG7A 3FTQA 1LNQA 4D6YA 3HCNA 5D3KA 2PKRA 1Y1KE 4J0EA 4MIKA 3OLXA 2HA6A 2A84A 4MX8A 1GWKA 2IODA 4OX9Y 4Y2HA 3PZRA 2W6IA 2BVNA 1ECBA 3PRJA 2VHCA 1RRMA 2AI2A 4P84A 1TYCA 4BFXA 4MGKE 1XYGA 2WWHA 3DEFA 5T4EA 5C8YF 4NULA 2QSZA 3HKDB 4BJ1A 3TR0A 1BSVA 2GEJA 4EG3A 2RH5A 2JDPA 3L4BA 2VK1A 2VIIA 4N4AA 3RARA 1EFHA 5L4SA 3GHMA 3AX6A 4I2NA 1LV8A 4G1BA 1U8CB 1JBEA 3EDQA 5FKJA 3UK2A 2VCEA 3HDGA 3U4HA 1KS2A 5K4GA 3RFFA 4Q3EA 3E6CC 3C4JA 4X3CA 4OHKA 4Y6SA 2Q3BA 1ZSVA 5EHIA 2HJIA 4KUHA 3Q3JB 2ZRFA 4FVVA 2C1XA 1U4NA 4L8GA 4MA0A 5AUPB 5A7PA 2IYLD 1REQB 4ZMRA 4D79A 2K2QB 2VUCA 5AM1A 2Z3WA 2L69A 1OTXA 3TTXA 2VCCA 4PO3X 2XHZA 4OQQA 5IT9A 2GB4A 2WINI 1PR5A 2VJDA 3FDZA 3PFBA 4ESEA 3AEZA 4BWYA 3DBLA 1KH2A 2WPDD 1CF9A 4Q82A 1WV0A 1CQJA 1PV1A 4PRZA 2ZBGA 2LWIA 3IV6A 2GILA 3GFPA 1FLNA 2QRJA 1EWQA 2D0IA 4DVGA 2I1VB 1YS2X 4I1IA 1KK2A 2JLUA 2BMVA 1TLFA 2QN8A 2FG7C 5KU1A 3A1VA 1YAHA 1U0EA 2PQ0A 3PHJA 3WL4A 3E22B 5K09A 4JXKA 3F3MA 3COVA 4LBQD 1ZY2A 5JJKA 4WW0A 1X7GA 3QX3A 1AK1A 2F17A 3DMTA 2ZYTX 5HBGA 4IVNA 1YJKA 4M3CA 4E08A 4DUPA 2VHEA 4B4QA 1PEKE 1HWYA 2XDQB 5CB6A 5JG7A 2EIDA 4X93A 5EESA 1UXXX 4F04A 1C0LA 1EAH1 3ROZA 1IS6A 4QHBA 2BFMA 3FOWA 3RYFA 3FFBA 2X6QA 4OFBA 3C5WP 1QNLA 5HF8A 2YMQA 3HJGA 2YHIA 4D3DA 4R7TA 1VQ1A 2B69A 4R2LA 2IK8A 5BQXA 4ZPXA 2QRVB 1HFWA 1PR0A 4BJ5A 4DAEA 3K1JA 3PIDA 2C2OA 1D3AA 3R9XA 4C2TA 3NLLA 3TFOA 4PYRA 1P1JA 1XALA 1TMF2 1UT8A 4INAA 3ZZMA 2ZWOA 1IZYA 3PSAA 4IIJA 3JTMA 1LEDA 3FR8A 2PSDA 1Z7BA 3A04A 1SUWA 3WSVA 3VRHA 2UZ3A 3HJCA 3GNQA 2ZZMA 3QYPA 4PLZA 3EXEA 1PR3A 4J6GA 4WESB 1GJRA 2DQ4A 3HLKA 5F3RA 1D2QA 1FNNA 4OKSA 2FQYA 2IXAA 3NOVA 4C21A 2SHKA 5CNAA 1NNUA 3K1ZA 3QYFA 3R6TA 2R60A 4UPVA 4OREX 4PYLA 4L5YA 1ARZA 1I7SB 4DPKA 1UXOA 1H85A 1GZWA 3ZE2B 3DV9A 4QVIA 4PAOA 4OV6B 4IDOA 5DHUA 5DPMA 4UFNA 3T3IA 4OP1A 3DVSX 1JDTA 3KEOA 2OCPA 2VDMB 4ENRA 1QF6A 4D7SA 1RPTA 3LSEA 5FZ1A 1KJYA 3R44A 4K6MA 4NRQA 4OUDA 4FOVA 2ARKA 5EIAA 1UY2A 4IXMA 3FL7A 4IV3C 5AKZA 5JNTA 3LPFA 3MUNA 4I6EA 1L4BA 2O8DB 3I9V1 1Z2AA 4RPCA 3W6UA 1OI2A 1Z5OA 1XKQA 4JB2A 1Z4QA 4C8DA 2CY0A 5UKDA 5K8SA 3DPRB 1T9HA 1OJ7A 5AI4A 1LBHA 2JDZA 1L5QA 4GI2A 5KYVA 4WK2B 2X9QA 1BDMA 2O06A 1C41A 2GXQA 3A4MA 4BX9A 4J0GA 3V0BA 3VD4A 3EXFA 3ONVA 3H6HA 4LJ8A 1XSQA 2MR6A 4J4HA 4CV1A 1EX9A 1SDDB 4RPHA 3VBUC 1ISJA 4GOKA 4R9RA 4KPUA 1ZK1A 3WDUA 4HTFA 2TS1A 3TWIA 2BM1A 3VVCA 2FWRA 4AKEA 2G80A 1GZHB 1WDTA 3ZG6A 2BBVA 3D1JA 2IZ0A 3PUVA 5E9WA 5B1YA 1GCGA 2WO2A 2HJGA 1SKYB 5CPFA 5CISA 1U31A 1DVRA 4JHZA 4LX0A 2XHNA 2WD7B 3MNFA 4RBNA 3NCTA 5KSWB 4G36A 4YAJA 5F7UA 1XDUA 2DFBA 4N7RA 4QKBA 1RAEA 2WF8A 4PYNA 1O0SA 2G1PA 4MG2A 5FO8B 4AI9A 5H7XA 3OHSX 3JRXA 4QAWA 4ILEA 1KDRA 4GKVA 3BRWA 1OHFA 1PQPA 4RV4A 4DARA 2Z5GA 4G0XA 2DJ5A 1JLRA 2VYVA 4GRIA 3GVHA 5JS6A 4P7KA 1TQ4A 3IUEA 2QTCA 2CEAA 2NZJA 2JGKA 5H4HA 1NE4A 3HY3A 1NLUA 3IPLA 3KLBA 3TSCA 1CY8A 1ZBA1 3FCAA 3FLRA 3M7IA 3DEHA 3A0NA 3P4YA 3DCQA 2YN0A 1RLUA 1D2SA 4EWAA 2IYUA 3HXMA 1ZMRA 1P9WA 2ZMLA 4YRKA 3GC6A 4YJFB 1TNDA 1K2WA 1ZK3A 1T2DA 4I9NA 3GJ8A 4UEJA 1RLMA 1L7XA 4CM4A 1TO1E 1DDIA 1ZMTA 2XWPA 4RWEA 4IEVA 4WESA 1NXPA 5LP6A 4Y98A 5ITWA 4UPDA 2A73B 1GNRA 2O5CA 3EGVA 4PLFA 5SY4A 2JGMA 4CKBA 2X29A 4ZO9A 5I7AA 2KI5A 4FZRA 4NPRA 4UD2A 4FN5A 1RWMA 3KELA 3MLEA 5DEOA 3CT4A 1ZN2A 1FX1A 3PEVA 3WHKA 4DB4A 3SZOA 2XCUA 3V7NA 2IYYA 4Y9UA 4EELA 2DVDA 3F6RA 2GMPA 3A1DA 1E0SA 3CH5A 1SG3A 1KZ9A 4PE5B 1DT3A 1QV6A 4BVHA 3HVIA 5GOTA 2RK4A 4IIVA 2G88A 3FYUA 5A3JA 1ZA4A 4E9KA 2VZ0A 4K9RA 5BURA 2WT4A 3OLZA 3FGNA 3GDWA 4U7FA 3HP1A 4TXLA 2YVKA 1AM4D 5EAIA 4BKPA 3F2VA 4QUDA 3WLLA 1YXWA 5BNPC 2J5RA 1D6SA 4W8OA 4WERA 1JJBA 4K20A 1USVA 2B82A 5EGSA 2WE7A 4OQDA 1AR63 1DS6A 4OQZA 2A9JA 2C4NA 2PL3A 1ONBA 3VR1A 1PWXA 5JC1A 3ZJTA 3K6KA 4JWKA 1P1BA 1I3MA 4B3MB 4CEWA 4NL4H 1MC8A 3AVWA 1PK6C 1ETHA 3M6MD 4DINB 4NZYA 1E77A 4TMTA 4AGGA 3O1PA 1JTZX 5DHTA 1D1SA 1DV1A 3RGBA 1UOEA 3I1YA 4RVFA 1KORA 1YDHA 3FUUA 4MV8A 1OC4A 4N76A 2X4DA 5C4GB 1XAHA 1NG1A 2ERXA 2M1ZA 4XJ8A 4QFDA 1MCZA 4N8DA 4TS1A 3IEKA 4FS8A 1EXWA 1JILA 1SPPA 5EKSA 4EA9A 4BNIA 4PHGA 1SWWA 1YU9A 3C3KA 3O4FA 3IR7A 3EDRA 3WI7A 3WJ1A 3QTLA 5T55A 3RNSA 1CX4A 4RHYA 1Q1NA 4B83A 3PCXA 3WYDA 2CZQA 3VM6A 2IUEA 1XTTA 1IXKA 2HYDA 1P4SA 3AERA 3G49A 2DLCX 1Q7BA 2VDOB 4XJAA 2XL9A 4HNVA 3ZCQA 2VUUA 2A92A 4EG8A 5IJ0A 2AOUA 5ICCA 3EPLA 1DQZA 4FLMA 1E6MA 4QJ5A 4EENA 1WW5A 2HH9A 1SKQA 4CFZA 3L01A 5DIZA 3FUCA 2BFDB 4IH1A 1HQYE 2WRZA 1JQAA 5HBAA 3O0DA 3H1TA 2VWQA 1C1HA 4X62B 3WLSA 3L1HA 1T5HX 1BVHA 2PY6A 2NGRA 2ZREA 2B1RA 1QTIA 4LOJA 5JFTA 4MDFA 3V2IA 3WDWA 1P1IA 2JG9C 1FOD1 4KAXA 1IBMB 4KHPB 5FZDA 4JZRA 2JIRA 2DSTA 1QRRA 2QN3A 4MS4A 3JW8A 3LCRA 1XU7A 3FPJA 1O94A 3WFIA 2RMU3 1Z6YA 3Q9LA 1N2CE 5DDJ3 4H6XA 2RS31 1BJTA 2TUNA 3OMLA 4ZQHA 2X76A 2FEAA 4QWNA 1VJTA 1R74A 4LRSB 4HRYA 3LWBA 4A6SA 2P77A 1MPTA 2V7VA 3KOMA 4YGBA 2IS6A 5TQ0B 2E7TA 5CFPA 4CCEA 4EJ0A 1FCJA 3EF0A 2N3ZA 1S2DA 4FMPA 2QTGA 1VP6A 2Z98A 3KJIA 1HEUA 3DTYA 2AMVA 5FWXB 3STXA 3KOWA 3Q3GE 4XCXA 1CZRA 3IIIA 4HPJB 4AXOA 1IDN1 3NNJA 2QHXA 2PZMA 4RQUA 5LCWL 2VO5A 4G1UC 3AY7A 2P1RA 3GJ0A 4QXQA 4BO0A 3BTSA 3GJTA 4ML3A 4ZT5A 3QH4A 5JZGA 3K5WA 3ASIA 1XEAA 4RH0A 4N48A 3KCNA 3A6GA 2J7KA 2AQKA 3CEPB 4EGQA 4JVAA 1FA9A 4Y1RB 1KTIA 3GH1A 3TLKA 1RQPA 2OBLA 1QF3A 3OQIB 2PCLA 4BRWA 1BYHA 2IXKA 4OQXA 1DRVA 1JR4A 1DLCA 4L7VA 3RVLA 4TKUB 2XCRB 3GUZA 1VIVA 5BW5A 3C1TA 3ER6A 3KJXA 4HATA 5DZSA 4FBMA 4NATA 1CSEE 5DAVA 1LOBA 1QQAA 3VU9A 3FDXA 4P81A 4CMIA 3GEDA 2PFKA 4ARSA 3LWCA 4IHAA 2JIDA 4MWOA 2QYSA 3A05A 2OQRA 5C8VA 1VKNA 4YGCA 4I08A 4NNJA 4B29A 5BV0A 1LOFC 3V1YA 3RRNA 1PYOA 5BW8A 1Z7YA 3NWBA 3Q8WA 1UBOS 1EEHA 3LFHA 2NYYA 4MWZA 4Q4X3 1GQPA 2CAUA 1UQRA 1U1CA 3ILRA 4NRPA 4XILA 1GNLA 2HDOA 2NSLA 3GCDA 1G2OA 3OCWA 3PYMA 5LKRA 3SY8A 1E1CB 4P82A 4LZZA 5JU6A 3C87A 2B46X 2OK8A 5A2QA 1ZRDA 1PHMA 1G20A 3IQDB 4JEHA 5FMBA 2AG6A 3COPA 1M0WA 1PN3A 4BVJA 1Y7HA 2QE6A 2VDKB 4AW9A 1YDGA 4TZKA 1SHTX 1Y3CE 2BGKA 3S7ZA 5BN3A 1GOGA 2GM4A 4ENSA 4GU5A 2HXYA 4ZGBA 1XZMA 2V7GA 3VU3A 2PWAA 1GV9A 1Q2UA 5LBIA 2BEVB 1W0JA 2MINB 1XC7A 4DV4B 5EE9A 3P2OA 3PJFA 2NUAB 2J85A 2Z4FA 1J07A 2P8JA 1H2KA 4M38A 5KYWB 5CVRA 3PXXA 1HA3A 4MQBA 1XEFA 1NVBA 1NQXA 1T2FA 2ZE8A 4I4IA 4HDSB 3F9CA 3VHQA 3RODA 2AZTA 1DKLA 4ONEA 5ALLA 2GCIA 5CDHA 3ZWQA 5LQUA 1ENSA 5BW6B 1QDEA 4KFCA 3IFSA 5F5XA 2VHXA 1M2VA 2JLQA 1LWNA 5C7YA 1THTA 2UU8A 1T8SA 3IUSA 1LBIA 1J90A 1HM5A 5K3FB 3RQ0A 5T50A 3U17A 4P9LA 2OXTA 1F60A 1G66A 2VA8A 5IT0A 2OKCA 5JYDA 1L8QA 4FUQA 2HWKA 2BNMA 3T0GA 2GD6A 1ZITA 2V59A 1KFCB 4PLCA 2AJDA 3K2EA 4RHFA 1UKZA 5FPQA 1FPN3 5HKAA 3D6EA 4RUKA 1U8ZA 1OXUA 3FNGA 3HRKA 3RVDA 3DWIA 1GZVA 4JQOA 1HQKA 3DDSA 2I8AA 1KY4A 3PC8C 2EAUA 4QHOA 2XNHA 1NVTA 5LU9A 4XQWA 2HV9A 2P6MA 4K9LA 3S8MA 4E6EA 1QJZA 4BLTA 3OX4A 1DQ0A 3EPHA 5DSZA 5ALKA 4PGGA 1O59A 4FHZA 1VBMA 2ZJFA 1J4AA 5GM1A 4YUAA 4WUVA 3WLFA 1U1IA 3HS3A 4S2HA 3C6XA 1XU1A 3DV8A 2NWQA 1JBQA 3JWIA 3MQFA 4ASUD 4I0AA 4AHWA 2FYTA 5DG2A 5FJKA 1W99A 3JQFA 1WZIA 3Q15C 2NXCA 3D0JA 1VALA 4DLWA 1EU1A 5ENVA 3DG9A 2FLVA 3INGA 1SEVA 1AMNA 3KHBA 5AOBA 1M54A 1LVHA 4KR2A 4IOJA 1QGDA 3VR2A 2PNJA 4KE9A 3KQNA 4Q6WA 1KITA 1W9HA 3RTDA 3WYGA 3UB3A 2BPOA 3FPAA 3SR4A 1UU4A 2O7VA 1JLLB 4FFGA 4BHTA 4MAMA 1ULEA 5EJIA 4XYEA 3ZM8A 4AHYA 2I91A 1EJ2A 2P9EA 2XAAA 4R84A 1XP8A 1V9LA 1JWBB 4OUMA 4MGZE 3EEBA 3KTOA 3PEYA 4JI7B 4Q1EA 1HRV2 1RHI2 4V0SA 4M3CF 1U0SY 3N6VA 2VMFA 4GP6A 1MS5A 2DFDA 1RXUA 2J32A 1G6OA 1RQGA 4P9YA 2XUAA 3PNVA 3BMXA 5AXBA 2AOUB 1MGPA 4QPZA 3DE7X 1QZZA 4DA7A 3M0EA 2G9GA 5KTRA 1ABEA 1NMXA 4NCJA 3SIPA 3T09A 3WDKA 2PGAA 3SZUA 1FSPA 4UQLA 3GAAA 4TVSA 1QJEA 4MR8B 2XOKA 3NJ4A 2E1RA 1LW6E 4MOAA 1YR2A 3V5NA 3QWIA 3D6TB 2VYFA 2G9ZA 1ESDA 5K3SA 3BVPA 1DWOA 3E0XA 2BM9A 4HDCA 2WG0A 4GYKA 2QJWA 1P1HA 4PS0A 5A1LA 1K5MB 4BV2A 5JRJA 1EFRD 4X61A 4MVJA 3AYAA 1H2HA 2FWBA 4KSCA 4AMBA 1BZWA 2HDNB 1SK8A 2DR0A 3GM8A 3B3QE 5FXMA 3K2QA 5B2EA 4R1LA 5L7OA 1RADA 1UN1A 1KJQA 2FA9A 4ZA2A 1PYDA 3PL5A 1LHUA 1BROA 3QU2A 2H07A 2VZRA 2BQPA 1U0AA 1ENOA 1G5HA 3SEQA 4EWEA 2I7CA 1F17A 5FT9A 5H8WA 2I1QA 3NHBA 5DGCA 2Z4RA 5AM3A 1KMIY 2CWWA 4XBQA 3SU8A 1CLEA 1KJWA 3MW3A 2WNUB 1DEOA 2VOEA 1AX9A 4GQAA 2IYVA 3U11A 5K5EA 1NLMA 1I7NA 5MGBA 4TMFA 1VRH3 2XMPA 4IQGA 3EHKA 3A9UA 1L5OA 3NEAA 2WHXA 3NVDA 4E1BA 3J8F1 2VH1A 4ZT2A 2PUBA 4RH1A 4GPTA 4EA8A 1CY2A 2E89A 2TBVA 3H11A 3WMWA 3C85A 4K0RA 2ZRLA 4PZDA 4ZI7F 1KSHA 2YOGA 3A0RB 4DKXA 3GRUA 1VDMA 5JAHA 3DOJA 2CNDA 3PNBA 3FWHA 2GLTA 4J4BA 1ODMA 3TD2A 1JIIA 1I80A 8LDHA 3F97A 1VE0A 3N2KA 1D09A 3ZH2A 2VQFB 1HFJA 1PDWA 5CIQA 3KT7A 1JG3A 5AJHA 2CGPA 1RI2A 5T41A 4X1YA 4KFRA 2WUWE 4WGGA 3MWJA 1LSJA 3U7QB 2J8ZA 3BWMA 2HBZA 1UBGA 3NANA 1NBHA 3BU7A 2JJMA 3ZCXA 4JJZA 4A8TA 4AJ4A 3S99A 1HNWB 5TPWA 4AZSA 4URAA 2JFNA 1XNRB 2FOLA 2J7PA 3WISA 4KGDA 5CT9A 4WCFA 1C5IA 1XTKA 3I45A 1MH9A 4WKGA 4AGVA 2NV2B 4DC9A 3GBGA 3BZBA 1Y89A 3BL5A 2Z56A 4D26A 3M6FA 1F4VA 1PJ3A 3BTAA 1BGXT 3VAZA 1NI3A 4DL9A 3PTLA 2KA3A 4FCVA 4QT4A 1V1RA 5AP9A 2FFJA 1ACJA 1JA0A 1RWKA 5G3YA 1KGDA 1NUSA 4K28A 4C87A 5HKKA 2K0GA 4LZWA 3OM1A 1IHPA 4GZ5A 1QLJA 3ECQA 1YHYA 4REOA 1IM2A 1KU0A 4UOZA 2WNIA 3QF4B 1ZO8A 4FLEA 1RRFA 2ZGNA 5CCDA 1RKBA 3T7EA 4EUNA 3ZWMA 1GL6A 2QUIA 4ZICA 1QGOA 3E22A 3O1HB 1G6Q1 1V6LA 3ZK8A 4KWUA 5H9SA 2VPPA 1XMQB 2UUBB 2XGOA 5FV7A 3NHZA 3EXFB 4GWIA 5T4HA 4ZO4A 1AR83 2LBPA 2Y1DA 2YTZA 4RYDA 1C0EA 2XBUA 2CV6A 1JFVA 1RQLA 1SCUA 3FHLA 1LLQA 5F52A 1IFXA 1KSFX 4AFMA 4CETA 4X8PA 1RBMA 3ZV4A 3I5MA 2W0XA 1EX1A 4ISBA 3CIOA 4ASLA 1IKQA 3CBQA 4CMGA 5KC9A 4I30A 5KUTA 4A7PA 5FR3A 2D1FA 3NTXA 2LVBA 3VJRA 3U7GA 4NN0A 3OLYA 1X8LA 1N2OA 1QG6A 1O57A 4IMRA 3GJAA 1VLQA 3WL3A 3NBFA 1U5AA 3E5NA 1A2QA 4WCDA 3SHFA 2XOEA 2WWXA 1YACA 4KMRA 1ZKMA 4TLGA 1AJKA 3GJ5A 3KWMA 2ZYHA 2JECA 3GJXC 3HBMA 1DTWA 3OOJA 1FNYA 3KWVA 4P3NA 1DYPA 3KWJA 5FF9A 3CSUA 3KUXA 2ZI9A 1VCIA 5SV2A 3INNA 3ND6A 1JX6A 1XDGA 3IE0A 3FI9A 2RHGB 4GVPA 2R3SA 1XLTA 2AENA 4JBHA 1QVVA 5A32B 4OGWA 3SH5A 3OHMA 3EVZA 3IIEA 1H2AS 2G17A 3FSJX 4OATA 4BKQA 4FKBA 4EQVA 1WEHA 1OIVA 3ZGXA 2OECA 4R98A 4GMKA 1RRCA 2P2GA 1W3XA 5FZBA 1W6MA 2I2DA 4P98A 3X2SA 5FNVF 3DYPA 3HI6A 1DXQA 2PO7A 1Z0SA 4F4UA 4IM7A 3IA2A 1IZ0A 3EVDA 4HDMB 5LL6P 5FJHA 5LM3A 1DHTA 1XQWA 2IOYA 5FI5A 4AI3A 4OX9B 2EICA 4BJ3A 2P2SA 1BDJA 3QACA 4H77A 2NO9A 4GFDA 1D4M1 1UJ2A 2CMGA 4Y67A 1C1DB 2BNOA 1JJFA 1EDBA 4Z7JA 2F4VB 3LRPA 4U6QA 1YCHA 1VBC1 3OSDA 4YMVA 2IHVA 2YXEA 3TGLA 1R66A 3DXUA 4PPYA 1TE1B 4BYGA 5CXXA 1LNZA 4I9UA 2FFAA 3NYIA 2BZ1A 3MYRA 3HZHA 4MUHA 3ZJYA 5KSZA 2RJKA 1DGQA 2ZLBA 4RVDA 1OVSA 2AUMA 4QXMA 3D4OA 2BIFA 2JIZA 2QKYA 2E4VA 2ZT8A 3KWFA 1SGWA 2R00A 1U0OC 1Q17A 3IC5A 2K87A 1EDOA 3OCZA 3N7TA 4Y30A 3OCXA 1YUNA 3KDPA 4L2NA 4U2FA 4ER3A 1CEYA 3PDWA 4N82A 4Q9IA 4D81A 4TZTA 5I45A 4E33A 4XDHA 5KYWA 4MRNA 4X1IA 2AXNA 3AHHA 4BKRA 5ILGA 5B7PA 4Y6PA 3BX1A 2W2TA 4KI7A 2Q1XA 4HEJA 3IS3A 3KG2A 2VBFA 3FZEA 1QGUB 10MHA 4BP8A 3RRMA 2O0MA 2W6ID 1LOGA 3GEIA 3CY6A 2YOFA 3OU6A 4CIVA