4K40A

Peptidoglycan o-acetylesterase in action, 0 min
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
349
structure length
349
Chain Sequence
LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis lnp21362
molecule tags Hydrolase
total genus 115
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k40A02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k40A01
4Q9AA 3SKVA 2Q0SA 1IVNA 1WABA 4M8KA 3RJTA 3PT5A 4DEVA 2HSJA 4PPYA 4LHSA 4JKOA 3MILA 1DEOA 3DT6A 2APJA 4HF7A 3SLRA 3C1UA 1BWRA 4K40A 4IYJA 5BN1A 1V2GA 4XVHA 4I8IA 5A4AA 3KVNA 5B5SA 4H08A 1VJGA 1BWPA 2W9XA 3DT9A 4K3UA 1ESEA 3DC7A 1BWQA 1FXWF 1ZMBA 3P94A 5HOEA 3BZWA 5CD9A 2Q0QA 1JRLA 1YZFA 4RW0A 1VYHA 4OAOA 4TX1A 2WABA 5JD3A 2O14A 3DCIA 2VPTA 4K9SA 3HP4A 1K7CA 4JHLA 4K7JA 1J00A 1Z8HA 1ESCA 3DT8A 4JJ4A 4RSHA 1PP4A 1U8UA 1FXWA 4JGGA 4S1PA 2WAOA 1ESDA 4Q7QA 3U37A 4NRDA 4HYQA 2WAAA 4OAPA 1DEXA 4JJ6A 1ES9A 3W7VA
chains in the Genus database with same CATH superfamily
4NYMQ 4B3DA 1QRSA 3HCBA 4YM3A 1N2CA 3T95A 4C0BA 2CLOB 3A3YA 1J8VA 3S1AA 4RGAA 1X86B 2C9DA 4JL8A 3CL1A 4F0JA 4L8FA 3VU8A 5ITZA 5FR1A 1K1EA 4MV2A 2X7JA 1RL3A 2JI8A 1ZH4A 1VFPA 1QDEA 3FZEA 5DBGA 3U3RA 2J9YB 3PEVA 4HRXA 1EK5A 3Q10A 1SFPA 4HDSA 2EZUA 4AT1A 3UK9A 4KLNA 1VHWA 2IY8A 3VBEA 4WFQA 1DQNA 5FZ3A 2Y34A 2IF0A 2ES3A 3ULKA 2YJZA 3P2EA 4B8ZA 3ZWAA 3ZW9A 2GVZC 4DIBA 2XIQA 2FFRA 4IGIA 5LQCA 1AR82 1NX6A 3FZYA 4W8GA 3C3KA 3EWIA 5E4FA 2EERA 3T5PA 1OFNA 5HXAA 3EUFA 1VKRA 4BMSA 4M9UA 3UJ6A 3F9RA 2QGZA 2J5BA 5CCBA 4ZICA 2V6FA 4ZVTA 1YJ8A 5HM6A 4DJFC 4MRAA 1ZA2A 1RUF3 1J5EB 1WD4A 3WLNA 3SFZA 4CM7A 5JSZB 1VBNA 3B82A 4GL2A 3TNJA 1N32B 1KIMA 3LQRA 1KEPA 3OOSA 4RTNA 2EGHA 1EFTA 5CDYA 4J43A 4X60A 3RSFA 3F6RA 3RWBA 3E7WA 2VQTA 4UOQA 3WWOA 4QPWA 2N9UA 1IM8A 2QP3A 1OC2A 3NH9A 4CEJB 3O38A 3HSYA 3I59A 5JASA 4OX9Y 4W9MC 3IUNA 1R083 4YMWA 2ZUCA 1ID8A 2W91A 1LBTA 2VZ8A 4QO7A 1UXXX 3WV6A 2ZGKA 3UAYA 3N75A 1R091 1SBQA 3CEPB 3O4HA 4LVOA 4S1TA 3VZQA 4SBVA 1KHHA 2H7CA 1BG6A 2VJLA 1WRBA 3N7LA 4KQCA 2PX3A 3KELA 1O97D 3UK0A 4REQA 4PG5A 5BOSB 1UBHS 1P2VA 4B09A 1XPOA 1W6PA 1CR6A 1U3FA 1KI1A 2ZITA 4Z3KA 1JNYA 2CMKA 4REOA 3HY4A 5GWXA 1I10A 3HN2A 3N74A 4WNAA 1F2UA 1SLAA 2DPXA 1N25A 4U2KA 2R7MA 4ZS3A 4MW2A 1QQ6A 4COOA 1W5EA 2QMQA 1EIZA 4QQOA 1SMVA 2IBSA 4YEDA 4OXIA 4RV4A 4ZODA 3OFNA 4B4WA 3R3SA 2QVGA 3L1VA 1ECCA 1JKXA 3V8PA 5LP6B 4RK4A 1SK9A 1PK6C 1KZ9A 2AUYA 2JFFA 4N9HA 1MJNA 2GN7A 2AT1A 3BN3A 3DLCA 3UA4A 5I6DA 4N5HX 2YCBA 4TWBA 2X0RA 5GOZA 1PO11 2J5QA 2WSVA 3JQAB 5JWPA 2QM8A 4OGWA 1DS6A 4EY5A 5CVJA 4QOSA 3HOBA 1HQYE 4NFSA 3POYA 3WYBA 1AHIA 1BH2A 3AL2A 2RBKA 4TLAA 4Z53A 1A9YA 3QWAA 1KFEB 4D7SA 4GH4C 3AR7A 4KG8A 5HKOA 3K51A 4P86A 1VSBA 1WLWA 1WUTA 3VMFA 2Q0XA 4KBZA 3EGCA 3ESRA 4OFBA 2VCYA 2VZ1A 3AEQB 1SR8A 5JZVA 1PQWA 2EXJA 3U3ZA 1GZDA 2A94A 2E48A 4G0NA 3AYAA 5BQPA 1TD9A 3PL0A 3LKDA 4X9XA 4ETNA 1SACA 1O0CA 4I0AA 4J1QA 1YDEA 2HF8A 5KYUA 2VZSA 3SNMA 2WFLA 3L7JA 2FDXA 1R5NA 2QYSA 1EAH1 4NABA 2PXCA 1XNGA 2AUMA 1OT5A 1DAGA 1W36C 3SIRA 4BZ4A 2GWRA 4K6BA 1AVBA 4UBHA 1DGRA 4PXAA 1XZGA 4BMVA 5HKKD 1DQ5A 4US1R 1K6MA 1YUDA 5C4WA 4EW2A 4BOYA 1EX6A 1W8NA 2YBEA 3HI6A 2DULA 3OKCA 2Y6KA 1MH1A 2D2EA 1TAGA 4GE3A 2ECQA 2XECA 2PT6A 3O1MA 3OIDA 4LISA 5BR7A 5EJ7A 3B9CA 2E6KA 5F9TA 4GU5A 2W5FA 2CWSA 2C8VA 4Y8VA 4KPYA 1P60A 2WM9B 3TS1A 3GQBA 5DTRA 4CEJA 4MWZA 3RSLA 2H9IA 5F1YA 1T3ZA 5JR2A 2QW8A 3R6SA 1FFAA 1VKZA 1VJRA 3OZWA 2R6AA 5CFDB 1P9WA 2GLTA 3L1IA 2JJQA 3QBTA 4X66B 4KFCA 1KJWA 3PPWA 4FSJA 4X8OA 1KP3A 3HFGA 4N5IX 3TLCA 3TB0A 1JTEA 3LBYA 2Z3WA 3IVXA 1TQ2A 1G8KA 3W5JA 2WF7A 5K09A 1WMAA 4A6SA 3TUZC 3KV1A 3EZ6A 3GWZA 2XBMA 1C3EA 4NENA 1URXA 1TF2A 3MXTA 1XQ1A 4U6SA 3ZE7A 2A9PA 1ZUIA 3DEYX 3V1YA 3FC0A 2BLLA 2I2XB 4A2QA 3UPTA 5D8DA 1R1DA 1CC1S 4MQLA 4X41A 3IQZA 1Y4AE 2Y66A 2G63A 3BFXA 4LJ9A 3Q8WA 3ZSJA 3YASA 2XYGA 3UXEA 1W1IA 3LPGA 3MWEA 1ZGAA 4FK8A 3D1LA 2Y71A 1BJTA 5LP6A 2AD1A 3R20A 2IUUA 1NKGA 1E0KA 1GKIA 4EPTA 1G9SA 3JQAA 4DPMA 1LRLA 3JWIA 4JQRA 1Q6YA 1G0NA 2CXOA 4AXBA 5MGNA 2BI4A 3CEHA 2XOXA 4X85A 1OPMA 2CVOA 4R1LA 1TM3E 5F9FA 5LEKA 2YQ4A 2NQ2C 4P7GA 3STTA 1QZXA 3NUGA 5JS8A 3DXFA 4Q29A 2HEWF 3ZYJB 4IZHA 4BLTA 2G88A 2XR4A 5BXXA 3KBOA 1DJNA 2CXTA 3DZDA 4OH1A 3MWLA 1V48A 3CGWA 3N6VA 5JSRA 2W48A 4MCIA 4QXBA 1OXKB 2CJFA 4RCVA 1QP4A 4L2NA 5DM60 1RUI1 2H6EA 3BL5A 4RZ2A 3ZE6A 4YAKA 3O2QB 4HK4A 5FYCA 1UMKA 4FE3A 2A57A 4R2IA 5JAQA 4V0ME 4UEQA 1K45A 2OB2A 1PP4A 5IC5A 1NAIA 3K09A 4IQFA 2AQKA 4Q3CA 3EXHA 1L4LA 4A8HA 1TKAA 4E0BA 3SH3A 2B4RO 3FVWA 3PEUA 4PO8A 4EO4A 3OC0A 1ZOSA 3L8CA 1AXKA 1YR9A 4TV9F 4N9QA 2QFEA 3IPCA 1HETA 3D3KA 3OPZA 5FIXA 4X92A 1G2IA 3SWWA 4OLHA 2FPLA 1TGVA 3P8ZA 5AC91 3IEMA 3HVDA 4A7ZA 2HRZA 4D46A 3ABOB 3PIDA 3PWSA 3PWZA 4O29A 4UCFA 1QYDA 3G49A 4JL6A 5IVBA 5E6RB 5EXPA 3WDKA 4FOQA 2W90A 3KF5A 2F9LA 4PFKA 2P91A 2WYWA 3G9TA 1JLLB 2HYKA 3ACGA 3K4PA 1ZD5A 3I23A 2YKGA 4ZPXA 3B69A 1SHKA 4C76A 4B1LA 3FSRA 1DEHA 4QDRA 5JD5A 2CZQA 1V7PC 4V38A 1L7BA 4RMJA 1B0ZA 4DSTA 3LYAA 2QZSA 2VNSA 1NY71 3WWYA 3QZUA 5DM4A 1H69A 2IOFA 3GQVA 2E37A 4PPNA 3II6X 1CX9B 5ERLA 5C5DA 3HCPA 1C4XA 1CX4A 1KTVA 3EGXA 1POQA 1KEZA 3BTYA 4NQZA 3RZLA 1QIHA 4ZAWA 3BWXA 3S28A 1E7SA 2JH3A 1IXKA 2F4NA 3CJIB 3I64A 1A71A 3WV5A 4DDUA 4W5TA 5T8KC 1ZXXA 1V6MA 4M1WA 5JJKA 1OH3A 4HO1X 1WUYA 4RF5A 2CGEA 3GWGA 2PFSA 2ZRKA 4N76A 4D3XA 3V2UA 3GUCA 3BPZA 1QZ3A 3MWGA 2WK1A 3ZX5A 3G6KA 4N5NA 2YFUA 3EOBI 3HT2A 5BO5A 4OSOA 3JXEA 3T4VA 1L4HA 3AFHA 1IS6A 4OGKA 4UXAA 4XYXA 1G2PA 1UKRA 3UJ8A 4AYXA 3EFOB 5JLJA 4IW3B 3NAPB 4P3NA 4ZVKA 1ODKA 4YONB 5C0OE 3WJ7A 3LYLA 4Y6OA 1RI2A 4AGVA 1EFVB 2YW9A 3M5DA 4N53B 2O3SA 4I6GA 3ADOA 4HDKB 2IYFA 5B7QA 4QFDA 3CKKA 4RZIA 1RTKA 3A11A 4G4SP 1C8M2 4CRWB 1S55A 5FPPA 4QDKA 1OVMA 4MRVA 1SBEA 2G17A 5EKDA 3KJNA 2OG2A 4J03A 1ELOA 3DKRA 4E1BA 4W1PA 1ATZA 4CP1A 3ZO0B 3BERA 1Y4SA 4C7BA 5KQPA 3DKQA 4FEGA 2X40A 3BJIC 4RGVA 5CCXA 1U8ZA 2ZS8A 4C7JA 5AI6A 1JEDA 4KWUA 3OEWA 4LXHA 2IYTA 3ROEA 4BM8A 1I0LA 3D8TA 1Q91A 4ZOLF 3PBKA 2FW1A 5DSTA 4JJKA 1QC5B 4GYWA 3OIUA 4BX8A 5HCBA 3ZW7A 3I1JA 5F33A 2CXNA 3GT0A 2QBYB 2AWOA 1AF9A 3ZXDA 4FQ4A 5L6MB 3GT7A 2B1QA 5EJ4A 2PE5A 1XU7A 1WDTA 3E8SA 1EVIA 1TEVA 3DB1A 3AYDA 2D5LA 5IXJA 4BKUA 3RVLA 2IUEA 2DKNA 4NJEB 1F0PA 2FOLA 1UFQA 4RPIA 1YQ5A 2EFGA 2WHXA 1XEAA 5TC4A 1GGHA 1S1CA 1HQKA 5CHYA 1R9GA 5E6RA 1X80A 2OXFA 3G2IA 5JYBA 4FZVA 1CZNA 1UMHA 2QTTA 1IFXA 1JLLA 4ALKA 4TV8B 3WBKA 2H16A 4E7OA 4XEHA 3AP4A 4A0HA 4BZWA 2HWB3 2XKJE 3GZUC 4XWYA 3PL5A 4CFZA 1MXHA 4MLCA 4BX9A 1ZGBA 3RUIA 4WADA 3MWFA 3W5IA 4LO7A 1GUDA 4M22A 3CGGA 5I8PA 1VBC2 5ETJA 1E2EA 3A9TA 4CTNA 4EFNA 3EMVA 1LDGA 1W2GA 3CO5A 3OM0A 2QTLA 2RBEA 2QENA 4D9KA 4UOZA 2VTVA 3CJIA 3RNSA 4QQPA 4PBTA 3X1YA 1L8QA 1Q5OA 1YZTA 3EQZA 2EIDA 1L5RA 2JBAB 2JIDA 4MUYA 4URVR 3RVBA 2X76A 2NUPB 3IHKA 2OENG 3N8NA 4GKVA 3UGJA 3NEYA 1XNAA 3RI9A 4YLYA 2WUVA 1WCWA 5GIPE 2OGWA 4OREX 3WMGA 2RARA 4XJUA 2XMLA 4IW3A 4AJ2A 3NAPA 3GFBA 1V6OA 1PYDA 3ABIA 1JWAB 5ESDA 3QVXA 1DU3D 3CRMA 2YU1A 1IUOA 3AB8A 3KF3A 4Q3LA 2H6CA 3RAJA 4HDKA 3ZYFA 1QLJA 3FYHA 4JCKA 4GVLA 4MUJA 3UFXA 1A4RA 1GU1A 2VF7A 4LKSA 1R74A 4BQ4A 4J25A 2V7GA 3UA3A 5DAQA 4G2TA 1ZM4A 1UZWA 3RIYA 4E2XA 2VYCA 4W99A 1WP4A 4WERA 3RZGA 2K87A 3HHPA 3KVNA 3CMCO 3KOZA 3VSBA 2ETXA 5ENVA 4ITUA 5JMOA 5JS6A 3CKYA 1THTA 3QKRB 2OVUA 1QV9A 3ND9A 4GAZA 3TR6A 3JUUA 2CC2A 2EF1A 3O8OA 4LMFA 4GD4A 1QC5A 3R6GA 4GXRA 4I6EA 2Y33A 1QOTA 5FMOL 3LIPA 3HN3A 2PLFA 1S2LA 3R23A 2ERXA 4ZWNA 2G04A 2C20A 2QBYA 2CXQA 4F3TA 1XNJA 1BCSB 5BYBA 2B39A 1KFXL 4QQ2A 1F35A 2OD7A 1DAEA 1E96A 5FBZA 1GZ6A 2NO6A 2I33A 1DJPA 5C9AA 2FMIA 4MO3M 2GZWA 1H2FA 1KSGA 1L4YA 1A3CA 4I4TB 3PPVA 4RPKA 1Q8OA 3G8CA 3NT2A 4HX5A 1VFNA 3W6PA 3UYJA 1ZDMA 4YK7A 4N82A 3NYRA 4XCAA 3IL2A 1JAIA 3CNNA 1AYM3 4Q9IA 1UMBA 4KGQA 2V1XA 1FC0A 4DBLE 3DOOA 4MHRA 3DWGA 1FS4A 4LE1A 2QZJA 2JWPA 1TYAE 2XJ9A 5K0GA 4RXMA 2FPOA 3T54A 1GGJA 1DT5A 4NBVA 3GC6A 5KYTA 4AVVA 1A96A 3ECQA 1J5PA 4YRCA 2CAUA 4FDUA 1DIBA 2C84A 2CLHB 1NQ5A 2X5IB 2P1BA 4MI1A 3S7TA 4BV9A 3DMTC 3BEDA 2IIBA 2R8XA 1E0AA 3R05A 3LUAA 5EJ1B 2JI9A 3MJDA 1G8YA 4G0WA 1UBTS 1QYRA 2XDWA 4OKIA 2NUAA 4ZEWA 1X13A 5CA1B 1TZCA 3NT4A 5B37A 4LECA 2OCDA 2JBAA 4P5YA 4B73A 5EC8A 1DX4A 4P9GA 4X84A 2A30A 4LYAA 3PTAA 3VUFA 4PW0A 4QXAA 2Y1DA 4ARXA 1FBNA 4IL7A 1HE3A 4JY7A 5B7NA 4TTAA 1UO9A 2WNUB 5DAWA 3UANA 3ZQ6A 1CAUA 5GJCA 1PX2A 1JMVA 1USWA 3TTVA 4BJHB 1Z0IA 2QJWA 2C0QA 1UKVY 5DI3B 5DHPA 2X8JB 1VHLA 3UJAA 1FU7A 1U7TA 1G3UA 1EIWA 5CITA 4JLBA 1HZJA 1TYEB 5B7GA 4DGQA 3AFOA 4LXUA 5FTWA 2FMTA 4Z51A 1PMIA 2C00A 2WV9A 1U4OA 1X9HA 5EA2A 2BN4A 4DSZA 5HS4A 3KHSA 4OJYA 1NFQA 2VZLA 5FFMA 1DL5A 4EKIA 4P5PA 2XGXA 2YBDA 1W19A 4C1XA 3WK6A 4C2UA 1PFKA 1E5SA 3N8IA 1CRWG 2ZZQA 2C07A 2IU3A 5IEBA 2C3MA 5C37A 4Q5IA 2XCSB 3CT4A 4NZYA 1U1FA 2FQQA 3UK6A 3FTEA 3NBXX 3QKRA 1ST3A 5HEKA 3ZHBA 4D7YA 1PHRA 1OFVA 3L43A 1T2VA 4MW1A 4PNPA 2YWCA 1UBOS 1LJ7A 1M1YE 1ZC4A 4OYUA 4KVZA 4U5QA 4NTZA 3RM3A 1V2HE 2IEBA 1FQJA 5L7OB 2YHBA 4BUJA 2QNIA 1YS2X 4HYTA 1KI3A 4LQCA 3V80A 4X64B 1IATA 2I87A 1JVNA 3KEQA 1UF9A 4YCDA 4JZYA 1SA0B 2YZ7A 1SXIA 3EBLA 1IHMA 3ME2A 4XVQA 2D74A 3KB8A 1YHYA 4IM7A 2AN3A 3H4VA 3ER6A 4UDNA 4NV0A 3EG5A 4A1FA 3SC6A 3RV4A 2LP4Y 2M2IA 1VE3A 4UCWA 4FFPA 2XE4A 1U11A 3ABZA 1ZD1A 1OBNA 4K9MA 4LBVA 5IAGA 3GGSA 3R6WA 2BMWA 1QLHA 1KU6A 3P26A 3DMRA 1C9JA 2O2JA 1GFF2 5KDLA 2W2LD 3W9YA 1VE5A 3U3XA 4XTRA 1PGW1 1VIDA 1NQVA 1QIKA 5HJEA 4YAIA 5KCMA 4AUNA 5BNWA 3VZSA 2ZCJA 3W9AA 3VDBA 3TRSB 2RM21 2X5IA 4I5FA 1Y6GA 1BXGB 1YZHA 2YXBA 3QE0A 1HF3A 5DM0A 2JD9A 2VBGA 2VP9A 4J90A 1VGRA 5CA1A 4L4ZA 3ZXLA 3SPXA 2A71A 2B8TA 1HM5A 1G6OA 1H8TB 2V0NA 1DKRA 5LMNB 2WAXA 2QAJA 2XUFA 3KV3O 4WZAA 3ZWMA 2AG8A 2FETA 3N9QA 1KAMA 1EUTA 2QAGC 3B3GA 5AJUA 2ZB2A 3IAEA 3A1WA 1QYCA 3JPYA 5CVEA 1UBNA 1T0IA 4ZYLA 1UZZA 5C7LO 2PKXA 4YGYA 5KVQA 5KJCA 2HEYF 3QEOA 3CG0A 4JJAA 2PUWA 4X1KB 3O4IA 1SKQA 4HVQA 2HBYA 2X8JA 4NOKA 5A7WB 4ET7A 1AS0A 5PGMA 5DHRA 3PQEA 4W1RA 5BQ3A 4UE2A 1RUD2 1MG0A 2HWYA 5B6PA 3C7GA 1A9QA 1EXDA 4RKEA 1YCDA 4CI0B 3QELB 3O84A 2VRNA 3LWDA 2QI9F 1RD4A 3PE3A 3IP1A 3W9BA 4D56A 3BJRA 2HWUA 1KP9A 3BCUA 3UMSA 5JZOA 2Y6VA 1DG6A 2IVJA 2WS93 1OA2A 1ULDA 1KBQA 3MF9A 3PQCA 4CU7A 4CCJA 2OD2A 4RL4A 3TB4A 4XRGA 2GZ1A 3I09A 1Y8CA 4B5KA 2VC2B 2YHUA 4BX0A 3B36A 1HTWA 3C5VA 3DEKA 3PVSA 1Z26A 1DBNA 4QYTA 3M4JA 3PWTA 3S81A 5L7OA 3VR1A 1E6CA 3O7WA 4OJNA 4URUR 3RQSA 3FW1A 4C89A 5KXEA 4DZRA 4QASA 4HN0A 4EB8A 3OQVA 2PH5A 3VZLA 5A62A 1SA0A 3NJ4A 2HRBA 3R0JA 3LRTA 3JQ6A 3I0NA 13PKA 4KIUA 5IFKA 4Y24A 1P9RA 4YV2A 3OHMA 2NN8A 3HJGA 1SXJE 4YFWA 2P11A 4KXMA 1EQUA 1T1EA 1MV8A 2JFHA 4XYMA 3N76A 3AF6A 4GGOA 4KQHA 4XHBA 3LDHA 3A05A 5FZDA 1CRZA 1QDOA 1I1HA 4Y1XA 4XYBA 1VTKA 3A6LA 5AKIA 5IYZF 2VQFB 1JZ8A 1U2DA 4ENQA 1E58A 1OGYA 2NZXA 2J59A 3RC3A 1KVRA 2W2NA 5JAHA 3TL3A 3CX6A 2D0OB 4WN9B 1I6LA 4CMEC 3R2JA 4MS3A 4FSHA 4Q1AA 4P84A 1Q56A 3RZJA 3A6EA 5DU2A 1GSAA 1RQLA 1K4KA 4RHV3 3R9WA 1Q0ZA 4P54A 3SJBA 3L4KA 4CXMA 4D8YA 3ROQA 4CHTA 3W90A 2Q4TA 3CO2A 1UMCA 3A37A 4ZGWA 1NLSA 3L01A 3B1XA 3K46A 4YRIA 1B4DA 1Q8VA 2Q62A 3GFOA 1W30A 4NECA 3PTRB 2C5DA 4LOTA 1CPMA 2PR7A 1JAYA 1M8JA 3GJ3A 5LMZA 4D2IA 2BE7A 3OM9A 2QTAA 1WXEA 4CQNA 4QYIB 2VSQA 4JT2A 3G7DA 4FCVA 1P77A 3H8SA 1V3QE 4M2LA 4AZVA 1V9CA 4Q16A 4F4FA 2HK7A 1E3QA 1NMQA 3WK9A 2PGJA 4RANA 5KTYA 2RMU2 1D4OA 3R8XA 1CDEA 3P32A 1X2EA 1VBA2 2P6UA 3TQSA 4EH1A 1W96A 4FUTA 3LEMA 3WUDA 1C3XA 2NO4A 3WNXA 1BEV1 4MB6A 1I4TD 3QELA 2VK8A 4JI3B 2YQZA 4QPJC 5TRTA 5I9MA 1K06A 3BM5A 3ONFA 3QENA 4M0NA 2R16A 5DQ0A 1USVA 4JXXA 2VCMA 121PA 3B6KA 2PHZA 3WW3A 5BY5A 2GZHA 5COQA 3L05A 2JASA 2VHTA 1XQNA 4GQ7A 3WMWA 5ERYA 5DYGA 3W4JA 4D5EA 5GZCA 1EE9A 3LOBA 2REXB 1AZWA 3T09A 2K9ZA 4MGHA 1W34A 2KI5A 2Y76A 3KFXA 3LOIA 2C2ZA 3OGVA 1UDWA 4LVCA 1F1JA 4KNYA 3MPUA 3T4PA 4ID9A 2NTVA 1ZBDA 3UMMA 2NMVA 1KYXA 3KV4A 1SEPA 4X94A 2Q6TA 5KXBA 2W22A 1I7LA 4P31A 1SZJG 4P3XA 3NKLA 4X97A 5DHSA 1U0RA 1YB2A 3ZWBA 3V1MA 4N47A 1N3YA 2VNKA 4JGBA 5DZSA 2J9FA 5EJEA 2WU0A 4L28A 3GALA 4AKIA 2C82A 1A9RA 4NYIR 1A95A 4C7MA 3JYOA 5DHAA 5CEHA 1XYPA 4KN8A 2YVQA 4PRKA 1AM4D 1ZCAA 2JARA 4AOCA 1TKBA 1NJ8A 3PFHA 1E0JA 1SHLA 4YVSC 5APAA 4LDRA 1WEKA 3MIIA 7AT1A 2C7GA 1PRYA 2VGDA 3K0HA 5GIOE 3AU8A 3HM9A 3H2ZA 1ZVMA 5F98A 1D9ZA 5TV2A 5A6VA 4KPEC 4NHXA 5CA0F 2FMYA 1G4HA 2PVPA 5DLDA 2D54A 3RGGA 1HQWA 1Y5IA 3PFFA 3GG9A 3UV9A 2XF8A 3UY4A 4LY0A 3RYFB 3CRNA 2AYYA 4JROA 1XG5A 3G6WA 3Q3JB 1DRWA 1FFWA 1XE3A 1RUH3 5DKFA 2WZDA 2DKOA 4X7MA 1Y7TA 5CP8A 1NG1A 4IMRA 3HM2A 2A1TR 3A1TA 1Y9ZA 2Q6IA 3O6VA 3CRZA 5AYVA 1IPEA 2ZK7A 2RR11 4EELA 1DKLA 4CP9A 1ZU5A 5I47A 5LB2A 1YVDA 2XVAA 5FWNA 1G5PA 3W1VA 1NV9A 1IBSA 4AY4A 1U94A 1JHXA 3TOCA 4BNDB 3WOHA 1N1VA 5IH7A 1RYHA 3FGOA 4HGZA 4BWGA 4D9HA 2WR9A 5LQRA 1TTHA 1QH1B 3GVIA 1C3OB 4ALIA 2Y9PB 4TYPA 3OJBA 2Q27A 1BEUB 2WZQA 5JCOA 1FE8A 2FN3A 4LBMA 3H9CA 3GZNA 4D4IA 5LM3A 1AXGA 1E8DA 3EULA 2GYWA 4M49A 2QSUA 4RKQA 2Y0OA 5INTA 3LHKA 4DG5A 3LT4A 3Q4GA 4CEYC 2O3QA 1T0PA 5BXQC 4IUDS 3WLOA 3CKMA 3PX3A 5B55A 2ZT6A 3DBOB 1COV2 4CPBD 4MKRA 4HNAA 2CUNA 4WIAA 1DKMA 1TZ2A 3NV3A 3EOZA 4LHSA 2O57A 5J40A 4LQRA 2Q3BA 5GLWA 2DVGA 3CEAA 2BDRA 3IO5A 3ECAA 1M33A 2ZYSA 3Q1KA 3OUZA 3RTEA 1BQPA 1G5IA 2WWFA 4DIMA 4TWAA 1ETUA 5AI4A 5F5XA 3A0UA 4YY3B 3F4KA 1AR93 3POFA 4AI0A 3DP9A 4Y0AA 1RI1A 4GI3A 3VUOA 4QX6A 4BQYA 4ZJYA 3L2HA 2AC4A 3NPAA 2VHCA 3RVJA 3EUAA 4LHNA 3B2NA 3MN1A 2XAAA 3DEHA 1ECPA 3WKBA 4QJIA 5BYKA 4YRZA 1FL9A 1ZIYA 5BNOA 3MJEA 1J8MF 3VO2A 4FPYA 2OXTA 4I50F 2VUDA 3FHOA 2VJXA 3DULA 2FPXA 1H8VA 3PQ2A 4X6RB 2QMOA 5KI6A 3VAAA 5M3BA 5LLTA 4LRUA 3O5SA 3WLFA 3KQ4B 3LDKA 3H9QA 1XZPA 1PZ7A 5H3HA 4KNVA 5LBEA 4HK8A 1UMIA 1DDLA 2EX4A 2UKDA 5F5LA 2J3HA 3IRUA 2HHHB 3ZFFA 4LJ8A 2A5LA 5HCIA 4JKYA 3FBMA 4IUCS 2H7VA 5FPYA 4HRAA 4A2PA 3UT5B 1Z56C 4GD3Q 4E3WA 2XHZA 1NMSA 5LZ6A 2YDEA 4N65A 3K96A 1S5PA 1NXVA 4ZZ2A 3HY6A 1MX9A 5DHFA 2XA2A 3RYFA 4O08A 3BDAA 2W6CX 2XRFA 1GD1O 2ZQZA 1KK3A 1KZYC 5A4FS 3RO7A 4IEPA 4J0HA 4QGMA 3QSYA 3GXBA 2WB4A 4FMDF 4DMMA 4PCUA 1XLTA 3REQA 4NIGA 1MVOA 3PIIA 3RHSA 3D4BA 4FPCA 1PWYE 4BQ5A 2RS32 4TL9A 3C5HA 3IDOA 1GNQA 4R7TA 1J8DA 2YJNA 2PBLA 2CBGA 3AHGA 5K0UB 4AKTA 1CE8B 5DSZA 3LXXA 1VLLA 1GRQA 3V42A 5AHOA 4YMIA 1CZKA 4Q9NA 1E1NA 3RC9A 5EERA 1RRVA 3EO6A 5CJJA 5AIAA 4D94A 3THOA 3QTLA 3ZHSA 3C7OA 1XL1A 1SU8A 3POEA 3PRJA 5ILGA 2B4AA 4LMRA 2JH8A 5F2NA 2BGGA 3F95A 1X1BA 3BICA 1JOPA 4BDVB 2OR3A 1K42A 2XW6A 5EKUA 5EIBC 5JIUA 3FR8A 1GZTA 4TSRA 4BBAA 3GGJA 3QKUA 2I8CA 5KNCD 1MZPA 1HSOA 3FIUA 4N39A 4BCCA 4MRMA 3LGXA 3OJFA 1MJFA 4ZC8A 3WGVA 5IEJA 1PJBA 1FB5A 4RK0A 4K9LA 2WZR2 2XONA 2R6DA 4CMBA 1PVC3 4PBSA 1OMIA 5DCWA 1XRQA 4N18A 1DIRA 4EI9A 3EEOA 2ADDA 2Z57A 1OFSA 3WRXA 1TEZA 1YRLA 4LXQA 3C45A 1UXIA 2PYZA 1Q0LA 1T9DA 4KH9A 2EJVA 3DXZA 1AG9A 3QSGA 4ES9A 5A3SA 1BZWA 2YVLA 1E2NA 4TROA 2YZMA 1YXMA 4AJOA 5CEFA 1TIPA 4FGWA 4A27A 3ZXJA 3NWPA 4XJXA 2J7KA 4RD0A 3SEPA 5GALA 1RMYA 1W49A 4RIIA 4AYWA 1S2IA 1ND5A 2L18A 2VSOA 2C9ZA 1XCLA 3UVEA 1M9NA 2UUPA 4I81A 1L3JA 3NRBA 4QM9A 1YA8A 2I4MA 3WNZA 4V2VA 2FUNB 3EB9A 5A3MA 5FA5A 5DO9A 5FTLA 4R2JA 2GC1A 1VL1A 4UUAA 2Q9AA 3AVSA 1UFVA 4E03A 3PXXA 2Y1KA 1OSGA 2QTVB 3RUDA 4RSHA 2ZRIA 2VK2A 4LZJA 4NE7A 1TUEA 2IZ7A 3O1VA 1JB1A 5JSUA 2R061 5AXBA 4BVFA 4G0UA 1WGPA 3FPHA 4QBHA 3QLEA 4JA2A 2P2CA 2R1ZA 1HN1A 4HEJA 4Z6KA 2C9AA 3PQ6A 4NSNA 1MN6A 3AYZB 1D4AA 2ZEJA 3JQGB 1R0LA 1DQ0A 3FB4A 3C6ZA 1N2CB 5IASA 3G82C 3RI8A 1DINA 4EKDA 1B0UA 1KYQA 3S1AB 3I6QA 4RFVA 5K0UA 1CE8A 4GMKA 4GNKA 1M2VA 4PN3A 5DNCA 1AN0A 5ITZB 1EP9A 3G5UA 3M9WA 1SBHA 4H6XA 2Q5IA 4DA7A 2ZSEA 5AVZA 4HXCA 3A6DA 3WG3A 1EFDN 2D8MA 2DTWA 2V97A 1KH1A 3RD5A 4XGQA 5ALQA 1IC6A 4NROA 4WBXC 4WK2B 4P3OA 4WASA 3VI4B 3ZVNA 1CZHA 4OGGA 1OKKD 3NASA 3MCZA 4BXFA 2J07A 5I0DA 3MG9A 5A03A 4RORA 3TIXB 2R1VA 4TZKA 1L5MA 2BKXA 5FPXA 2FDGA 4L3OA 2JGEA 1FUUA 2Z43A 2WE7A 3HXTA 2WYUA 4ZKDA 4MVJG 3MF4A 5H0IA 3JBG1 3VYSB 1GT91 2JE8A 2Y60A 4ILKA 5T3NA 1AKRA 2J31A 1CGPA 3KZKA 2O0MA 1T9ZA 3HZZA 3BMOA 1MW8X 4ZHNA 2QZ2A 2I8AA 5C53B 5LZ7A 5K45A 2B2CA 1FPN2 5LQUA 3D6EA 1JUIA 3FZQA 1IAVA 4ZONA 1V8FA 1XMXA 4CCLA 3I59B 3CH6A 3ZGOA 1FNNA 2GSDA 4PX3A 5KJFA 4ZV9A 4TRJA 4U4AA 5DN9A 2IEAA 4AFDA 4UNQA 5EZQA 3MWJA 5CGQB 3FCSB 1SMKA 5GZGA 5E88A 3P9SA 2RHMA 3N4MA 5SZKB 2BV4A 3CC8A 2BDTA 4BBJA 1R0ZA 1VAMA 2HMSA 3MO4A 2E4VA 3HA2A 1CLUA 4BB5A 4REQB 4DSNA 2V59A 4E9KA 4TT3A 4XTCS 4RL7A 3O1LA 1W6PB 2WY2D 1GG8A 1QYIA 4K6HA 1DKQA 2QTVA 3D7SA 3SR0A 3LHSA 4EKYA 4N1AA 1RUG3 1LPSA 5F64A 2G40A 1Y5MA 1GAEO 3CEWA 1F2UB 5D21A 3ZG6A 3C39A 3T61A 1KS2A 4JP8A 2YGLA 2XL9A 4FFWA 4IV8A 4W7IA 1S8FA 1UU6A 3STWA 2EHJA 5C8XA 1QXJA 4FX2A 4QFMA 3LPLA 2TMKA 1LH0A 1X7WA 2QLTA 1E1KA 5K0CA 4GAEA 2GEBA 1FA9A 3D8RA 2ZZKA 3B5IA 4CNBA 2MR6A 1ULTA 5CIQA 5ADHA 2BSQA 4YDHB 3JQGA 1ODCA 1R1A2 4F11A 2HHAA 3KJQA 3E7FA 2BLNA 1IY8A 2WZCA 2BL4A 1MIOB 2VZ9A 5JXHA 2DU1A 2C77A 4KQ7A 1HLDA 4RPHA 4PF1A 4L97A 1AXYA 3H6KA 3NHLA 3PC7A 4MI6A 2FGKA 2OMEA 3P9XA 2P9YA 3PUQA 2CNNA 4K88A 1R3DA 4OVKA 3RC7A 2PY6A 3DDHA 1OLME 5D2CA 4ZI2A 3ESDA 5AJZA 3BIXA 3AKCA 4B7AA 5L6LB 3AJZA 4QU8A 1T6XA 4UNPA 2PUHA 1T3HA 4O1IA 1QPBA 1QNWA 3DFZA 2B5WA 4L3VA 1Z4PX 3GNQA 4G01B 5CRIA 5A02A 2HREA 3MBIA 1X74A 4RCYA 1D09A 3OVMA 1Q17A 5KYUB 4YM0A 5ALIA 3TIFA 2WFLB 2OYCA 4JKKA 5LYJA 3MVEA 4RE5A 1DP4A 2CGOA 1SXJD 2COEA 1VJ2A 1FFBA 4KZKA 5BW6B 2OL4A 1Z8FA 1FPMA 5B1HA 4Q4W2 4FONA 2YINC 4CPBA 2VP3A 2ZYGA 5C4WB 1JJIA 2BZGA 5FQNA 2RGAA 4Y1FA 2G8LA 4H7JA 1KVSA 1V6JA 2AJBA 4JBXA 4YPOA 4XZPA 3GEPA 2JW5A 3QU5A 3C3WA 3CN7A 1YIAA 2C4KA 4M99A 2BZ1A 3CLRC 3HXMA 3GQBB 3WISA 2QWXA 3HFRA 1ZNPA 1BA2A 2BGKA 5EMNA 1DIWA 3M3IA 4WLFA 5CYFA 4GEKA 4JR2A 3ZE2B 2HSWA 4FWBA 2Y05A 2JATA 2ZVJA 3POBA 4YLZA 1CONA 4MROA 3NONA 2D62A 3NAQA 2JAOA 1ZCJA 4DIUA 3AVXA 1KQFA 5J9FA 2FSVA 2DTDA 3OG9A 4I8XA 1SVLA 4MZXA 4BDTA 3SQWA 2GC2A 3OTWA 5H9SA 2HNBA 1NUSA 2PZKA 4X7PA 5JS7A 4FCWA 5K7PA 2JB8A 3ZGZA 2AH5A 3C3CA 1T8UA 4NENB 2DTXA 1IBMB 3FCEA 4HOOA 4QNRA 1PR0A 4CR7A 2JGLA 4H55A 3RVDA 1HY3A 4HNTA 1L9XA 3EIOA 2OT7A 4L6IA 1SXHA 3IAAA 1AR72 5JR7B 2XKKA 3W7BA 3MWEB 4WLOA 2EJCA 4RTJA 2QJOA 1MX1A 1L5FA 5E6HA 3K9HA 1OPXA 5TPZD 4MKIA 5J4HA 2GXAA 1KU0A 3VNQA 3NPMA 3H1PA 4YRJA 2SKDA 2X8LA 2VBBA 2A7XA 4NBSA 2IHUA 1V1MA 1E5HA 1M2WA 1MIOA 5FMOS 3JD0A 4OIFA 4YB8A 4BAZA 3I58A 4ISRA 1KJYA 1VMHA 1UBCA 2H1CA 3MUFA 4E4RA 5HQ3A 2EG9A 5DUWA 5TSDA 1UEIA 3QU7A 4ER5A 3DHYA 1I6MA 4HNVA 1RVDA 1M3SA 4C4XA 2D98A 5ENDA 4AIIA 4DB4A 4BNVA 1UC5B 1QJX3 4YHBA 3FPLA 2CE7A 3VR4D 5ENZA 5H02A 3DEAA 4RPCA 1LRKA 3I2KA 4XOUA 3U78A 3QE3A 5IM4F 1G86A 3RFUA 3MJTA 1GXSB 5HRAA 4JI5B 3WDSA 1XRUA 1YMQA 5IHXA 3S30A 2GRJA 4UHFA 5SZIA 3ZN4A 2QKYA 2Q0SA 5DWDA 1Z38A 4LJLA 4LFBB 1JFRA 4MSUA 4MJLA 1F06A 3QH6A 2WRAA 1NT2A 2B21A 1KEEB 3GBWA 1IN7A 2EGGA 1NULA 2GEVA 3U0VA 1E79D 3EXHB 1EZ4A 4HH3C 4D8WA 5E16A 3ZWPA 4WY5A 2JA1A 5KNCA 2BGOA 5FR3A 1H6AA 3MMSA 4KH0A 3FCAA 1K27A 2DF7A 5HNKA 1PJLA 2C5BA 4G09A 4O3FA 3AF4A 3TRDA 4K2HA 4A7PA 1MX3A 2FCAA 3DZGA 1EGHA 5EMLA 2IYSA 4C87A 3LHIA 3MIGA 2FUEA 3T3HA 1YBFA 4J1WA 1QR6A 4ZTBA 4D9EA 1ZBE1 3RG8A 3SXWA 4YXWD 3EFBA 3ZTWA 3HWSA 1OROA 4U7JA 2ZI3A 4LK7A 1UXOA 2G5PA 4MHOA 4NARA 1JR2A 1NBIA 3FRJA 4D82A 3IOMA 4AFNA 1J06A 5L3QA 2RSLA 2JGRA 5DISB 4QX5A 1PL0A 1ES9A 2J7MA 2IE0A 5K4AA 2JIQA 4IGKA 3L82B 1POXA 4UEJA 5ICCA 3IAPA 2AOUA 3O1JC 1Y4WA 2CEKA 4UJ3A 1GWLA 2FRVA 1PR3A 4META 1HB2A 2FZ1A 5BNZA 1Y5LA 3EGXB 1EXMA 1P0FA 2HCTA 2R6FA 2NM1A 4CF6A 1ODIA 1T9AA 3WDUA 4R41A 5FOQA 3DAGA 1Y3TA 3C24A 4H7MA 3UAXA 2CUTA 3AUAA 2FWIA 5DLEA 1ST2A 3HEAA 4OFXA 3LUDA 8ATCA 2NQ8A 3F47A 2PEYA 3QU4A 1BTOA 2VWHA 2OKGA 4LJKA 1JS1X 4DV0B 2SBTA 1LF0A 3DXXA 3W06A 4D74A 4V39A 1MV5A 4X1OA 1MEOA 4DC9A 4FEEA 3NO4A 1NAHA 2CNOA 4F71A 4HNHA 4KGVA 4I7EA 4UXIA 4M0PA 4FQ7A 4IOKA 5AK6A 5JAOA 1YI7A 3I6BA 4INJA 4Z4FA 5J5CA 4YAGA 3JQCA 4I0BA 3WQBA 5KC5A 2R32A 1GUAA 2C2KA 3EB7A 4U7PB 3VGJA 3DVSX 3Q8AA 1WEHA 3GG2A 4WGFA 1K66A 1ZKMA 4BRZA 2ZPTX 2NLOA 5DI9A 3PUJA 1NJ5A 3SC3A 4DA8A 1GXSA 1D1TA 3RI3A 3RAEC 5TF0A 3A1DA 3FA2A 3AM5A 1JUDA 5AHKA 3NHYA 4AY2A 3T7JA 1ENZA 4KO8A 2QUHA 4QODA 3HU1A 4RFRB 1F0NA 2WSIA 4A1OA 3SU8A 1J5XA 3SSMA 4KHZA 2D97A 2FG6C 2FDIA 5SY6A 1JAXA 2R2AA 2B99A 3B13B 1KEEA 2NW6A 2OXIA 4ZI7F 1UH5A 4CM1A 2PL9A 2DWRA 1OKKA 3I6MA 2G1PA 1GUIA 2WI8A 4LC9A 4GR5A 4DLNA 1IQ0A 3WSWA 4I14A 1U8TA 2MOKA 1OTYA 2LR0A 1FQWA 1WCXA 3PVCA 3OZSA 4MHTA 2PAMA 1E2UA 1GGFA 4U9UA 1UDAA 2H1FA 4ES8A 4PINA 1R7RA 5A3JA 4B46A 4NWWA 2RGGA 3SYTA 2I3GA 3DBLB 1SXJB 1ZREA 1P0CA 4M46A 2QQGA 4BP1A 1EWYA 5H9QA 1X80B 4G0YA 1YJBA 1K7YA 4G4IA 2DVMA 5TQ2B 3GFSA 3RPQA 1UAAA 4XAEA 5CFRA 1I3MA 4R1MA 1JTZX 3Q0EA 3RFTA 1F2VA 4EVQA 2ONZA 2OQIA 3L7MA 4BFZA 1DYOA 5H8WA 4B7CA 1SLIA 5BRNA 2HGSA 2BHLA 3JXSA 4IEOA 5EUMA 2ILVA 4PS0A 3LF1A 3CMMA 3GGPA 2AKEA 1OFTA 1XNQB 1H4VB 3EZ9A 1WXGA 4A8JB 2ZWIA 2E63A 3IUJA 1U8UA 5FWEA 3A22A 2D2XA 2GNAA 1HYQA 3EPHA 1XMPA 5KU1A 4JKIA 3HCWA 1IKQA 2GB4A 1WBFA 2WYOA 4TLEA 2FOIA 4HDMB 2O1WA 1N8KA 5DTQA 4EE2A 1QQP3 4UDOA 2LPMA 4M9CA 2VZTA 2DXIA 3A6GA 5CFLA 5L3RA 1DIGA 1AX2A 5BN1A 4CIAA 3GMTA 2ZUBA 1LPNA 1YB7A 1VKHA 4H4EA 1TB4A 3K3PA 2OFOA 4YT2A 3UFXB 1SFNA 4XMIA 1XKXA 4KTTE 5KYYA 5C7IO 4XWGA 2X42A 3TVDA 3IUQA 4AAYA 3IIEA 1M2OB 1OXTA 5K3SA 4X6QB 4BXOA 3G7UA 3KR9A 5CFCC 4GXNA 4ZO9A 1HKHA 4L9RA 4IDQA 3FUOA 1XLVA 1RPNA 2UYBA 3WB9A 5CPFA 5T3YA 1ONSA 1PZHA 4M1QA 4BEWA 3FOZA 1WW2A 2A0KA 3KR1A 4HWKA 1QP8A 2E1RA 2HBUA 4PC1A 3STYA 1G9DA 1G8MA 1Q0TA 3HJUA 3PNMA 1NR7A 1NCRA 2V09A 4RHEA 2BU9A 1JR3E 3O8OB 1WY7A 3CN9A 1LPBB 3I4LA 4E2FA 3QMVA 1O91A 3AETA 2NVWA 4Q21A 4CEHB 1ZPDA 4NYIQ 4EL0A 221PA 1MEEA 5FRDA 1Z4JA 3PLNA 5DYIA 4HN9A 4FR2A 4BO7A 4DUZB 3VPCA 3VZJA 3SLIA 1NXD1 1U2RA 5C9AB 3WG4A 1UFRA 4RS5C 1ZONA 2A78A 4L5CA 2XBO1 1GU0A 2JG9A 1P4AA 5TY0A 3IBTA 1TME3 1H4TA 1S4MA 5LIPA 2CLKB 3CPSA 2B8WA 4D0RA 1MUUA 3P94A 3DBLA 1SXJA 1PTKA 1YR6A 1F4LA 2G19A 1KMCA 4Y2JA 3D3WA 3BE5A 1PG2A 4OO3A 1GGEA 3RS3A 1ZRIA 1SUAA 4GQIA 4QPDA 1UMBB 4CPDA 3GHMA 4YRTA 5DG1A 4Y1GA 4DNYA 2VH2A 1DOHA 2P9FA 5TQ2A 1ZEJA 3SZRA 4PLNA 3U19A 2J09A 3NNJA 1MDFA 1CJSA 2UYOA 3Q9LA 4RJTA 3FKJA 3E3LA 5C1BA 1VCMA 3M89A 4WINA 3I3QA 4G4JA 1XI2A 2CDPA 1DU4A 3FMFA 4IIFA 1VCHA 2PA0A 5FPKA 3D7MA 1GN8A 2VUUA 2NUAB 2VCCA 1Q1QA 2GH2A 3BIFA 1ZH2A 3ITNA 4A8JA 1JS9A 4NV3A 1CULC 5E7IA 3S2FA 2VT2A 1JIQA 5EFZA 5K5EA 1XXHE 4YRNA 2WWSA 3E3AA 1KA9H 3ECCA 4HDMA 1XR3A 4GDMA 2PNFA 1Y63A 3OD4A 2DETA 2YWGA 1R6TA 1CUCA 5AVTA 1XNRB 1CAUB 4XGRA 1F15A 1S96A 1H9PA 2ORWA 3FBWA 3JQDA 4FJ2A 5AW3A 1F6DA 3CNEA 5K3BA 3LL4A 3TN92 1DX6A 4L4YA 1LI7A 1KY2A 1C0EA 3BHMA 1PJ8A 5AJTA 5TPZA 3S70A 2V5AA 1V1RB 1M2OA 4N12A 1UBKS 4HVCA 3JQRA 3GU3A 1V5FA 1JXOA 4B3BA 2ERFA 3LDAA 2NTJA 1OI3A 2MINA 4HX9A 2CHFA 5AHWA 1U8YA 1TJ3A 3N58A 2Q0HA 3ONNA 3AV3A 3DOFA 1XAHA 3S5QA 3TGWA 3QE4A 2HL6A 4W7HA 1H3FA 1JEAA 4CEHA 1PMHX 1QIIA 2QBXA 2GNMA 1OBCA 3VR4A 4A16A 4ZYUA 5IVCA 1BBT3 3AHIA 1VRH1 4BU0A 1VSQA 4OXXA 3WIBA 3AKRA 1HMYA 1U3VA 2IU0A 4A2UA 1L1FA 1OUMA 4YVFA 2EVXA 4YDQA 1FIUA 2ZZJA 2UWBA 3IFSA 5AJVB 4HYEA 2G7ZA 1OI4A 3GL9A 4YW2A 1ZICA 1TT7A 1UPXA 3RYTC 1NUKA 1WQ1R 1AHSA 3Q7EA 1QX3A 1UJCA 4AURA 3ETGA 3F5FA 2PXJA 1ZJ4A 4LXIA 3DZJA 4XWOA 1GP6A 3IERA 1RVF1 5HKKA 4UMFA 1W2HA 1N77A 4UBGA 1FF9A 4AR2A 1DWUA 2JEYA 2PMKA 1PFWA 3SIXA 4NZZA 1XXNA 1NUHA 2MEV1 3MTGA 3NW4A 3L7OA 3W77A 2DPLA 3NAMA 2OUKA 2R5FA 4LYEA 3HD8B 3W5DA 5AOVA 2P2YA 1B43A 3M2PA 5DTIA 1P9OA 3PU3A 2GPAA 2YV5A 3ZZTA 4AXXA 3NBUA 4JBWA 2G1UA 2PSDA 2V5YA 3NR2A 3G0IA 4YXWA 2JGJA 1TO1E 3SHOA 4X45A 3R3JA 3NH6A 5I4IA 5IK5A 3A14A 2A3YA 4MWCA 1VRVA 5BV7A 3CTPA 1WZIA 2PT7A 5K0EA 3IDBB 4QPYA 3K9QO 4M3CF 4NF2A 2E53A 1OR8A 5DNYB 4JGGA 1ULEA 4WZAB 2PJRA 1YUMA 3R9KA 4EENA 4OQYA 3LDBA 1Z7BA 2Q5LA 3UL2A 4A41A 3P45A 4OM7A 2QV0A 2HT1A 1H9BA 2W83A 4BWYA 1ZM9A 4EYUA 1P75A 4NXMB 5KEIA 4XFJA 2BM0A 3ETCA 3W4KA 1JHOA 1XCOA 4L51A 2ET7A 1FU8A 2A9FA 1EGVB 3ZXFA 2OB1A 3JU9A 2IW3A 3GFGA 4HLQB 2C9MA 4Q1CA 1CR2A 2ACEA 2XMPA 2P2ZA 1A8IA 1V1RA 4L4RA 5HK9A 1X0VA 1J0XO 2DQ4A 5EIYB 4UULA 2PH7A 3ELBA 2QQPA 1IBCA 4L5BA 4LA4A 2AN4A 3WB2A 1QCCA 1A77A 4BQPA 1GAXA 1YR8A 2D4HA 2GLXA 1YBVA 1KVUA 4BNWA 1RUF1 2QJFA 3K30A 4HAZA 3UEOA 3TEMA 3ZLVA 2B25A 5DP2A 5SICE 1V95A 2HWD3 2O9JA 1XNHA 2H1WA 4TZ0A 5MN5A 1UBLS 3JYLA 4J6GA 1AL23 3QVVA 1TLFA 4HQ6A 3PNBA 5AH0A 2PV7A 3B52X 2VXOA 3UQYS 1W75A 2FMFA 3OPQA 5KSZA 4Q4HB 2WV7A 3VJKA 4ZVMA 3WWPA 3ILHA 4P92A 1H4QA 5DM2A 5AHXA 3FHQA 1JLKA 1WB4A 2VHEA 2YV4A 2AOWA 1YIFA 4YGEA 3M4FA 1RQ7A 4A7YA 2KLHA 4MLOA 5E1BA 2DJIA 5DSXA 3PFGA 3V8VA 4L5JA 3LE8A 3L4SO 5KCZA 1SUIA 4R9AA 1VMDA 5ALKA 2OWDA 4KJZA 2LUOA 2PKYX 1ZA7A 2AR0A 3H16A 2Y6HA 1KZ7B 2VW1A 3GDHA 1H4GA 2E0IA 4PAWA 3WIEA 3H5OA 4AC9A 4MS3B 3VX4A 1E9RA 3C8HA 1UM8A 4KYTA 4GPIB 2O7VA 3W1WA 1G291 5FWDA 1UMCB 5AMXA 2PQMA 3L4BA 4ZU5A 3NKVA 2NSJA 3I52A 4POOA 1YIPA 5IBRA 4GUDA 1KAOA 4PO9A 3OZVA 4XSVA 3SZOA 4WM7A 1VZ3A 1W8FA 2ERCA 1SUFA 3M5PA 4AZ3A 3BF7A 5B7PA 1VSUA 1G4UR 1HT1E 3EAGA 3H7IA 3PD7A 1BXHA 1T6BY 4KH1A 4E22A 3OQMA 4CVNA 4B7UA 1YJ5A 5CIRA 1B1AA 3JARA 4N9IA 2CXHA 3FR7A 2B8NA 3A06A 2NMNA 1CJTC 2O2ZA 3PJYA 1R1ZA 2I6QA 3VZMA 3L02A 1N47A 5KWJA 3LGSA 4TWJA 1EGMB 3UB3A 3LZCA 4NAOA 4BQ3A 1VXRA 2PWAA 4JITA 4CDMA 1MLDA 5JQGF 1L7AA 2V4VA 3BWVA 2Y4OA 1TEXA 2BBWA 3GRFA 3FFWA 1PQUA 5JATA 3H87A 4EUSA 2XUMA 5E3HA 1ZD2P 4GBMA 3D43A 4HSJA 3VBRC 4H0FA 1TVEA 3V56A 4S3MA 4E70A 4U5XA 2ZUSA 2ZBPA 1KI2A 4P7BA 3D6FA 4ZRNA 1O57A 2Y1GA 2JLRA 3CSDA 3MXOA 3I49A 4RVDA 1XC7A 3OHSX 4I55B 3MTJA 4MKZA 2Q28A 1XBFA 3DW1X 1ND3A 1P8JA 5FFFA 3AM3A 4PZDA 2OD9A 4D7AA 5EP2A 5AUPB 2XAUA 4Q4HA 5SYNA 1CVNA 4LTMA 1QX4A 3ES1A 2X5JO 4R9SA 2VUSA 4LQDA 3F97A 4WXEA 1SPBS 1NG9A 1NRXA 1BQEA 2B0CA 2ADEA 3BZBA 4GVXA 2BTVC 4AI2A 4UFLA 1UEXC 2J9FB 3F3MA 3ZIDA 4TL8A 5CMLA 3SM9A 3BWYA 2F8MA 3IMFA 2V03A 4JLKA 3PQDA 2PZFA 4LRQA 3JCIA 2PD6A 2ZACA 6LDHA 4QLOA 4QUAA 3IUBA 3PVEA 1H2AS 1WD5A 3HVJA 2D1RA 3FWHA 2CYBA 2H63A 1QO7A 1RCFA 3PSAA 3POWA 3A58B 1WULS 4L9BA 4JMLA 5L3SB 4TN5A 4ND5A 2EL9A 4ZAZA 1S0FA 2IF2A 5JVVA 2C58A 3AFMA 4JHXA 3NGLA 3WNLA 4G2NA 3LMKA 3ZDAA 4ESEA 1TE2A 1MX5A 5EV7A 5CDFE 2RH5A 5J48A 2O2YA 4KQFA 2Q9CA 4BQ1A 1MACA 2ZUDA 5DYNA 3OESA 3IMEA 2RHLA 1RHKA 2A6WA 3HR4A 2O07A 1O4TA 1Q8SA 3ODPA 4N54A 2FJUA 5HG0A 4YJHA 2R97A 3R75A 2HPZA 3LFHA 3ANLA 1C1HA 4XWAA 2C4HA 4AS1A 1TYZA 1RUI2 2WABA 1GLVA 4CP9B 4TRRA 3D6UA 4QSMA 3W78A 4Q7MB 4WKPA 5AOCA 1QCDA 5FOWA 5BN5A 3NDPA 5F7JA 1OH4A 3F78A 4PYNA 1XPJA 5EYXA 1AU9A 3NL1A 2D2FA 1Y42X 5DNDA 5LB4A 1T4DA 1UOEA 2IBTA 3EE6A 3U4GA 3T8YA 5G41A 1EDDA 4F2HA 4J76A 2JDAA 1P1RA 3GZNB 4M4SA 4ER7A 4IAOA 1D4M3 3G2QA 1UY4A 2ASVA 2G1JA 1AS3A 4D3YA 1P2GA 2AEJA 1HT3A 1KYTA 4IIJF 4PRZA 1GANA 2QR5A 5FXZA 4HBZA 3G6JB 2I7XA 5ABJC 3TQTA 4BAGA 3JQFC 4JJ7A 2V7UA 4HNAB 3HEMA 4WHMA 4IS2A 2G4CA 4BBZA 1BS9A 4GBGA 1A6CA 1FDOA 2SECE 2IZWA 1PBTA 4HQNA 3VO8A 2NZVG 4RQTA 1G1AA 4RMNA 1JDUA 1OGIA 1JYXA 4QVGA 1JQBA 1P7VA 4C0SA 4BXSV 2V8BA 1QOPB 2QLFA 2QZ4A 1XRRA 4I55A 1SG3A 3UHPA 1NYLA 3UXYA 3NKTA 1G7TA 3AHFA 3FYCA 4C4TA 2XJSA 1YULA 3TBDA 2YMQA 3O8RA 1TDJA 2IZOA 4A2CA 3OETA 4UBLA 1GTVA 1N6KA 5FIUA 1J23A 3WRYA 4FFGA 1DMRA 2FZ2A 1TZBA 4OZOA 4MW5A 4BQEA 3W5VA 2QZZA 3NNFA 3KQPA 5BNOB 3VBFC 1YJLA 1G18A 4D4HA 2V0GA 3EW7A 2NPIA 3WLAA 3ONWA 5K8UA 3GBSA 1V16A 2VXRA 3M33A 2F3RA 4LE4A 4K9DA 1R64A 4EPVA 4DAEA 4ZN6A 4AI6A 5L51A 2HIMA 4QEZA 3WF2A 3TSAA 1UPBA 2JX9A 1L7RA 3GAZA 4CTMA 4ZYVA 3A7EA 3UJOA 4Z7JA 3C0KA 1X15A 3WD5A 1KDYA 2QQFA 5L3SA 1ZJWA 1A5BB 3ZFFB 1I13A 2R071 3ZJ4A 5AK0A 1K2VN 4BWFB 2HA3A 4EGAA 1BOFA 1VBB3 1XD8A 5JQWA 5GOTA 3ZSEA 3Q2OA 4BUCA 4DSUA 4DR4B 1YAHA 3O3NB 5FUMA 2PRSA 2WUWE 2H2IA 5KTNA 3VR6D 1JDNA 1KITA 3QOXA 2F1IA 4JB3A 4AI8A 1SC4A 4UD2A 1IVNA 1RYMA 4DR7B 3REQB 4LHYA 2NZYA 3B48A 4IINA 3KUXA 1LSOA 1H4SA 5T54A 4XOGA 3CR8A 1U5BB 2ZRGA 1VI6A 5SYMA 1VI5A 2Z2ZA 3ZY6A 1X3SA 4EJFA 3OI7A 2VULA 2ADFA 5KQMA 1QYXA 4K3UA 2J67A 1UDBA 3F96A 5DX1A 3GFRA 2HEVF 1P4HA 1E98A 3KRTA 5EHQA 1Q5PA 4H2DA 3WO1A 1F7UA 1Z7YA 2YXNA 3RG2A 2FSIA 1NQAO 3JRWA 4EWEA 3NHBA 1XTUA 1JR3D 5CH3A 1OLMA 1NSFA 3FFQA 3ZWVA 3F3SA 4J6FA 5I3CA 1IN1A 2XVYA 2WWYA 4GOKA 5JS2A 3K5HA 4XFHA 2WRZA 2JD2A 1EB8A 4MRMB 4MWBA 2YUIA 5GM2A 2YJGA 5E9AA 2YXLA 3BTXA 3K6SB 3N5CA 3NEJA 5AT1A 3ET5A 3K0CA 2X10A 5GJVC 3FRHA 2BFOA 1NUQA 1LGYA 1V45E 2GN1A 4HTFB 3SHWA 1U0BB 5CR9A 1ILEA 1IXZA 3MS4A 3MJFA 2RAFA 1X7ZB 4CM6A 5CG2A 1PGL1 3HVIA 4I4IA 3JZMA 5CX1B 3ZH9B 3EOAI 1YQXA 1C41A 1NN0A 1JKIA 1RWPA 1NKVA 3B5LB 4BFSA 4K1LA 2ZSUA 4GOLD 1ZYUA 2JG8B 4KQ6A 2O7QA 4AECA 3GBVA 3PV0A 3OE1A 4KCGA 3AWDA 2WQ7A 1QVZA 1SFYA 1J97A 2WDBA 1PD1A 3OCXA 1FYUA 5FYIA 2XHEA 4NPCA 2QYTA 2O4UX 1UJMA 2HJRA 3IPRA 5MF6A 2JGIA 2C1FA 4BLUA 2RS53 1L7NA 4HC4A 1JG1A 3RAPR 1E7WA 4RADA 2MYNA 2PT9A 3WGYA 4PC3A 2POQX 3NHPA 1B1CA 5F7XA 2ZYDA 3IBGA 1T0JB 4HDQB 4DLXA 5JJBA 3SJCA 1FDSA 4XURA 1PGNA 1KOJA 2PTHA 3SMQA 2ZSBA 1JDVA 1WOYA 1DQPA 2H1VA 1EY2A 4HQRA 4FZJA 1NA1C 4LF4B 2F3PA 4HRVA 1KZ6A 3GCGA 5LA6B 3FVVA 2EGUA 3DAOA 5JV5A 1UAYA 4D79A 1AX0A 4MOWA 4L0QA 2WIAA 3GGCA 2MTBA 1V8PA 2W2LA 5FBVB 2J32A 4RACA 2NVOA 3AQIA 5DK6A 3H05A 3KVOA 1Q0SA 1ZI9A 3HWRA 2J48A 3BB4A 5IT5A 1ITZA 1NVBA 3WLTA 3OJXA 2Y1EA 4Y26A 2HWC3 1U5BA 4CL2A 2A3NA 4RESA 3OH8A 4G0XA 3RTGA 1BHO1 3HJBA 4TMFA 1M2VB 2ABWA 4EQ6B 1VPLA 1E3WA 1F31A 4HLCA 1QJZA 4WVVA 1DV1A 2LTAA 1PL6A 2ODBA 4Z3OA 3C3DA 2VP0A 2XHNA 4O4HB 3WYFA 5KX5F 3VKFA 4DMFA 1S7GA 3BUCA 3NANA 3PKJA 5GGYA 3RBVA 2PQQA 4Y2SA 1XDBA 2WTEA 2VWQA 2VK1A 4O2RA 2Q1TA 4D8XA 4HXFB 2R1VB 4YQFA 3ZFGA 4YBRA 3K6SA 1ZA1A 2R8EA 4YDSA 2FW8A 5EQDA 4J7CA 2X09A 3N87A 1R0SA 1YE3A 3U80A 3L92A 4I0WB 1X9PA 4U63A 4HTFA 1D2EA 5A4MS 2IHNA 3HNBM 4EUHA 4WCDA 4DRRA 4V0NA 1R4MB 3H3XA 4FYYA 1X7ZA 2DURA 4ZU4A 2VSXA 5BW5A 3BMOB 2OK7A 2BH2A 3ZCUA 3B20A 1LU1A 3KT6A 5CX1A 1Y34E 1F12A 4KU8A 3BK2A 4UZSA 4DLPA 5DDIP 2OY0A 2ZBJA 1AYM1 4QGNA 2JG8A 3GJZA 3MIDA 1ODFA 2HF7A 2NU6A 4B3IA 1QQBA 4J4BA 5JPNB 3GN2A 2J3DA 4ILEA 4P33A 3MILA 4WXYB 2W6QA 3QKWA 1NPTO 4LLOA 4MW7A 3ZNOA 3FY4A 5HV4A 1PQPA 1AJKA 4JYCA 4PEVA 3R7DA 1R10A 2E49A 4AULA 4KWLA 2QZ9A 3PPYA 1DRUA 5H9PA 4YQYA 4NHKA 2X86A 4XI9A 1CFJA 2XL7A 1XYOA 5SZHB 1T36A 3KL4A 4K8RB 3DOUA 3CYFA 2QQJA 3D31A 1GAJA 4LF9B 5DDJ3 3C6XA 4NCHA 1UIRA 1G16A 2Q1XA 5AIBA 3HVUA 3H1YA 3I1YA 4Y6RA 3Q3GE 5IAOA 4YCSA 4DQLA 1H5UA 4IGQA 1M7BA 1AYN1 5LA6A 3Q5DA 3SEFA 4EX6A 5KSOA 1HFJA 1PM4A 3OTHA 1PX4A 4ZZ1A 4GWIA 3FTDA 1FTNA 1D4ZA 1JPJA 4DV5B 1JAHA 1X7WB 2ZSIA 1TU4A 1JYWA 1TCVA 1F5JA 2DECA 2VCBA 1QK3A 4U2AA 1WABA 4IQGA 2IOHA 2FXIA 4IIXA 3DHEA 5EL0A 4YUYA 5DNVA 1S3FA 2ZBDA 1KKMA 3KHKA 4CEIB 1YUBA 1PFYA 1ZN2A 2W43A 2ZIXA 3BFPA 3DEMA 1YFYA 2F4LA 5IFTA 4MYDA 4PLZA 3Q41A 4EQ6A 2D5FA 1YB1A 1EINA 2IXKA 5FP9A 1YNOA 1UN1A 5DM70 4Q26A 3ME5A 1P2DA 1P6QA 2XSZD 1QU0A 4JQTA 3I9JA 4O4HA 3MFQA 5HCNA 2PEZA 3VVBA 4E3ZA 2AREA 3N0XA 4B5LA 5HOEA 4BB6A 3E0QA 1QOSA 3F7MA 3L4JA 3E1SA 2PKQO 1QHFA 4KR7A 4MUVA 2X8WA 4CDRA 1VYHA 5CDSA 1J4AA 2WO3A 1TT5A 1CUFA 1R15A 4YRPA 1R0CA 4G8JA 3RVHA 2XWBB 5H1YA 1NVWQ 3RJMA 1Y48E 1RYNA 2AZTA 5GINE 3V6MA 3URFA 4QQ8A 1D7OA 3IAUA 4K28A 2WLTA 3C8MA 4GOOD 4X61A 2XVGA 1A9SA 4R8MA 4EA6A 3UOAB 5LYJB 1YRQA 4RIEA 3LP6A 3PURA 1AKUA 4V0MA 2ZIFA 4K9KA 4DLZA 3B1KA 2E1PA 4PQEA 1JV2B 3LC7O 4HLUC 1R4MA 2FQWA 3S4YA 5EG5A 5FY0A 1HEYA 3DO6A 2JFOA 4D4JA 5A4KA 2R8RA 2JFZA 4G65A 2R2GA 3TIVA 1PO23 1YS4A 4K9RA 3KR0A 4JYAB 2Q3CA 5FYSA 3USZA 1TVGA 2G07A 2YOFA 3IKLA 2NV2B 1PD0A 3BBLA 3M3OA 1NF9A 3SFVA 2HXSA 2G9FA 2XGSA 2W08A 2PDAA 1L5GB 3RIGA 2R5WA 4ZXFA 1ZX1A 2A3XA 4OI0A 3SYLA 3MRTA 5GGXA 3MB5A 1TK9A 1JZ2A 1N6OA 4QXKA 2DCJA 4JEUA 3AOEC 1USGA 4PRLA 1F17A 1AV6A 5LQKA 4Z8XA 3FSEA 1WCYA 4EN0A 3HDQA 4FXOA 3OQBA 2YASA 1TFUA 1Q95A 1S4QA 3F6BX 3BU7A 5HYVA 5I8ZA 2GO1A 3CZCA 1GYKA 1BMTA 1XVUA 4PYRA 5GLZA 2IYXA 1V9SA 2RGYA 2J1RA 4G25A 4GLJA 1UU4A 2CL2A 2XNHA 3ITEA 1EU1A 1N8TA 3WKAA 1I33A 2CFTA 2VHZA 1F7VA 3C8DA 2VHVA 5D3QA 1GOGA 1XOYA 3ELWA 3H0KA 4ZZ0A 2ZX3A 4HP8A 5IT4A 3PUVA 4XUDA 2ATFA 2Z8ZA 1ODNA 4MR9A 2NGRA 4E5YA 5FWYA 1W5SA 4GMDA 3KAJA 1W5TA 3R4VA 3ROMA 3HCNA 2ZYHA 5FYQA 1JL3A 4CEIA 2FFBA 4F3NA 1V1MB 1RTVA 4OHZA 3KWJA 4ZDJA 1HO3A 2WIGA 4NZPA 3ZHTA 3VR6A 5HQ3B 2CV6A 2O59A 1IJKA 2YY5A 2G36A 1ZO8A 3THPA 2IITA 4HJXA 5FOJB 4B3SB 3ZGNA 3RUHA 2LNDA 1T8RA 3IDAA 1Z6AA 1GKUB 2Y4NA 4G1EB 3ILYA 3N2ZB 2IYEA 4G5GA 4QVIA 5EYYA 2WS91 2CDOA 3HMKA 2NV0A 3SBEA 5JEEA 3CNQS 2PZJA 4MXWB 3RYPA 2UYHA 1Z12A 5FX2A 1SULA 2DLCX 5AW0A 2NYRA 2X77A 4BFWA 4MMXB 1WB5A 5AP9A 1I8TA 1IPJA 5FYDA 4R2WA 1JBKA 4ALJA 3WF3A 3BGDA 5FK7A 1YS9A 1WETA 4Q3NA 3RR2A 3CRVA 4ZANA 5LBFA 4INZA 2WHQA 2C31A 2NO0A 4Q8LA 1G55A 4C1WA 2I6XA 4XQWA 3HNMA 3GLTA 3E5HA 1ISFA 2QXYA 1JR3A 1PI3A 5BSGA 2Y6LA 4QPCA 1AQYA 2OUJA 2GHTA 2UZ3A 2R0QC 1PFUA 4PFQA 1TECE 3I9OA 1SVKA 4XGNA 4EZ4A 3UG6A 2WC2A 3KT7A 1MZVA 1ASJ3 5EIOA 3OX4A 1OXMA 4RZSA 3CLSD 2VYND 1GDHA 2IPXA 3B93A 2G5TA 3DE2X 4UM7A 2YR0A 1DWQA 5LLDA 4QPZA 5A6YA 3DNPA 1YBMA 4ZVLA 5UKDA 3ESQA 4XUQA 1TYBE 2QQNA 1ILWA 2JKXA 3ENQA 4BEJA 3IELA 3B6EA 5DP1A 3IIIA 1WA5A 2E4UA 1EPZA 3TMKA 1BEZA 1B8PA 1Q1GA 4OQZA 1JIXA 2QNKA 1MHPA 5L3QB 4RHV1 4F2PA 1UWVA 3AEYA 1P19A 4LEIA 4JOQA 3HKEA 4Y1VA 3U1XA 3IDZA 4QKQA 2SLIA 3MZ0A 3S3TA 4URTA 3C3PA 5EIEA 3Q72A 2ZPXA 2AOUB 2ZIGA 4ARVA 3MOSA 2QN9A 2BDEA 1JGTA 4X8NA 4YARA 4Q39A 5L4SA 3TEJA 2ZDQA 1IM2A 3DKKA 3ETEA 3HY3A 4G07A 2CXXA 2J42A 2G1MA 1WCQA 3HJHA 2VPXA 3AP6A 4OFWA 2ECPA 5AVWA 4EPYA 3AHHA 4CG0A 5KHOC 1CP2A 3HIFA 3Q8KA 3GPDG 3U4IA 1D2AA 3O47A 1IE3A 2PAEA 1VM6A 1JN0A 2AI3A 2FMKA 3O2SB 4B82A 3L5OA 4IFTA 3LQ1A 2ZXUA 4IIDA 4ZT7A 1SH7A 2X6RA 2KQUA 2GT1A 5JNSA 3WDVA 5EINA 3ANMA 5E6UA 4AB1A 2RK6A 1XXHA 2Q5HA 2GZDA 4E5KA 3ALQA 4AAXA 2Z5LA 2FB9A 1JKJA 3BMCA 1GL7A 1YHFA 2ZSJA 4BCDA 4IGOA 1JHDA 4NFLA 2OOSA 2OQ2A 1VZ2A 4E5VA 4X7RA 5E8RA 1XDUA 1VG9B 1R8JA 4PGHA 5HCUA 3THYA 5ELXA 1O4ZA 4F3CA 3ZDCA 3KLBA 2ARKA 3PFWO 1KE2A 3KEMA 2HXGA 4DF3A 4ACAA 3D8SA 4PCLA 1N7GA 2UZ1A 1SPXA 2AEYA 3T15A 4MXWA 2FWPA 3JR7A 3NJ8A 2YZ2A 1ZVQA 4EW6A 1RE1A 3FLEA 1QOOA 1SXGA 4MAAA 1DQ6A 1LBQA 4YPJA 4NI5A 2OCXA 2FJ0A 1WW8A 4A44A 3D6NB 3S7EA 1P3DA 3OUIA 5T5LA 1N75A 2X13A 3H9JA 2WU3A 1JEYB 3AHJA 1M1YB 5T67A 2QX8A 1J2UA 4RKFA 3AVWA 3EXIB 1T5IA 3UJBA 4WM8C 1X94A 3T3EA 1Q20A 2R79A 4YFVA 4NOTA 2QKDA 3O1PA 5BSKA 5CT5A 5CFMA 4CV2A 4P8RA 3KTAB 5ACA3 5BWNA 4UI9L 2FPPA 3WWCA 3VOAA 1XD9A 5HF8A 4BQWA 2XMQA 1W9HA 4BVKA 4YRFA 1D2MA 3G2MA 1S0BA 3H18A 4NCJA 3GZAA 4F04A 1I5ZA 1XTIA 2JZNA 4NP6A 2PAFA 3LQYA 1TRKA 5T3UA 4B6FA 2RGNC 2HRCA 1BRTA 2XBLA 4DDTA 1QZUA 3NUQA 2WF6A 3BE4A 4TVBA 3SE0A 4IDZA 1JZQA 4L2IB 3HQUA 5FV4A 3IOEA 5I7UA 5FJKA 2WQ6A 3HBNA 1ECFA 2CKDA 4ZI3A 5IK2D 4FDVA 1VBD2 2C78A 4G0OA 2UXBB 4LYJA 2MPFA 1VG0B 1C1DA 1OXXK 2GPSA 4O65A 1QAMA 3WSOA 3PS9A 1PG0A 2VAUA 5BSTA 4QJ4A 3W6NA 1CIWA 2JI6A 3LYHA 4JKMA 4N40A 3C7CB 4JA0A 3HUFA 1BAPA 4ENRA 2IK8A 1ZVKA 1KVTA 4U7GA 3HYCA 4EB0A 3FX3A 1Z25A 2WFF2 2A70A 4E31A 3VZPA 1DG3A 3R0RA 5EFUA 2GALA 3GYBA 2JXAA 3OQHA 3ZXYA 4L3WA 2YNMC 4U02A 4MGKE 4PXSA 4FEAA 4RQBA 1ZNZA 4RSRA 2P75A 4HANA 1YZKA 4WN3A 3I5MA 3GMSA 2J3EA 1F0KA 4P9WA 2OBXA 5T4BA 1SM4A 3QFRA 2AE2A 1KZHA 3HGTA 5G05L 4DLUA 3J7LA 4Z8YA 3UBTA 5ALZA 1T35A 1MHTA 4CM9D 2EX0A 5LQAA 2IHZA 2XKPA 3OT1B 5HA5A 3THDA 2XV1A 3OE4A 3PRKE 1GUBA 2C54A 2I7DA 1W0KD 1K8QA 4LGMA 1VLVA 4PHGA 1O6CA 2D8AA 1G7YA 3LUPA 5LMUB 5KYYB 1CHNA 4FGUA 1QR2A 4LJ5A 2MYTA 3ZPOA 2WAOA 5D8AB 4NBNA 1T2FA 4BXOB 1DEXA 3GI1A 2XJ4A 3OIVA 4RTOA 1QNFA 5K8IA 3C74A 3LA3A 2Z2SB 2BEVB 1A9TA 1RBQA 3KKZA 1I2DA 2BKAA 1HEUA 3EEFA 3KWMA 4IH9A 2GUWA 1RZVA 3KKKA 2P6HA 2XSZA 2GESA 1JEYA 4UTOA 3ID6C 3DJYA 3SD7A 3P27A 4EWLA 1NCRB 2IU4A 1M1YA 5L45A 3SEAA 1LX7A 1RLOA 1UPUA 1DUSA 1SZBA 3EXIA 2QXUA 5F6LB 3AETB 3WQ1A 1SWVA 3QYFA 3PGKA 2IPNA 4KWJA 3A9UA 2EICA 3PEYA 2VVEA 3LB9A 1YZFA 3FCOA 3KEOA 3KTAA 1ZD9A 1XQVA 4BVBA 4O6VA 1K3TA 3OPNA 2JG9B 3EVBA 4G8DA 2P2LA 4A6XA 4A6OA 4IGEA 1T0BA 4TYQA 3CEJA 2H1HA 1BGXT 2ZROA 3N3BC 4A0GA 2ZCWA 3KUCA 1YLLA 2DUMA 3D3WB 3L8DA 3G8YA 2ET6A 2ZG6A 1F5SA 2YIJA 4ASLA 5IJRA 2ZIAA 5CDUA 4L2IA 4DXHA 3P0IA 5DWQA 2H0BA 4B9EA 4XGIA 4YM2A 3U16A 3J9SA 4FIZA 3ZJ5A 4GLOA 5BPFA 4CDGA 3QMMA 2UVQA 1AE1A 2W5UA 1HLFA 3AVOA 4IHJB 3RSZA 2C9CA 4Y1RB 2OYSA 1E99A 1TJ4A 4KBFA 4FTSA 2ETEA 3IAFA 4FNAA 3V64A 4INOA 4MX3A 3TEXA 3OWOA 2PH1A 3WGLA 1XCBA 4PWYA 4NAHA 5CBLA 2EIGA 1DXYA 3ND8A 3KTFA 2C7PA 4KI5M 4YAFA 2ZOSA 2QUZA 4YJ3F 3WQ7A 3ZXEA 5L7WA 5HFJA 4UEOA 2C88A 2I74A 1KI4A 2HSGA 1H05A 4AYTA 4DR6B 1HDCA 3ZE0B 1FQKA 1A9OA 4MW0A 3L77A 1Z68A 3L7AA 3V1UA 2B3TA 2ZIEA 2BGWA 1IJBA 1D7PM 3FE5A 4O5OA 5H16A 3WLUA 5EUCA 3IP8A 3TWOA 4HV4A 2PUAA 3OT1A 3TMAA 1WO8A 3L93A 1NF3A 1H2RS 3VGPA 5DGDA 2UXCB 2OXBA 2I71A 4WVWA 3NWOA 2X41A 4DCCA 1CQPA 1PEAA 2YVUA 2OFFA 3LI2A 3RVPA 4X90A 1UZNA 4FTEA 4CL0A 4LDJA 1V26A 2Y6FA 2P79A 3FLTA 4XIJA 5D8AA 3E9EA 4HFJA 4DXSA 2GMMA 4JYBA 2Y68A 5TJHA 1W4ZA 2ORYA 3O26A 2J1EA 3NP9A 3A3NA 4RMGA 4IV5A 1GSLA 3BSYA 2MINB 4UU7A 2BEVA 4J0FA 3BH0A 2DKFA 4DMCA 5JRZA 5KQGA 3LBFA 4C3VA 5JROA 2PSSA 5JH7F 1JHNA 3D6MA 4MLZA 4I4NA 1WA4A 3FNEA 5IS2A 4F3JA 1M34E 3PU8A 3K2BA 1CHDA 1DCMA 1JHJA 5BR8B 1RIRA 3IT8A 4LYYA 4AKEA 2F67A 3SY8A 5HF6A 3S2SA 3ZZNA 2ZX2A 4ARZB 4H18A 2GM4A 4A3ZA 4PX9A 4QPGA 4IEFB 2O2GA 3BD7A 1S02A 2NACA 1K5MC 4PM4A 3WW1A 2ZE7A 1OHHD 4RABA 2VTDA 1YR1A 2OUIA 5IX8A 1VMIA 2FFQA 4KXQA 2W6NA 4R9VA 4OYLA 1IL0A 3TQCA 2BGJA 2X4IA 4L5AA 1KXGA 1EM6A 2IEIA 3GDOA 4DMLA 1WW5A 1PWEA 1NMXA 4QKNA 2PWPA 3BIJA 3KJFA 1VP6A 5KNBH 4DIEA 1O5OA 4EV0A 2GCPA 2VYNA 2WWRA 1P0QA 4DRVA 3ZD6A 3R74A 3PHGA 1NBEA 4MRPA 4IHJA 3V1TC 4Y1RA 5FNVB 1TJNA 2Q3EA 3DBIA 2IDMA 4H9GA 3S7ZA 1M6EX 5CDFA 3VJMA 1G63A 3BFJA 2B30A 3UMVA 3OE7D 3JQEA 1V8ZA 1RM5A 3LY5A 3PX2A 2CD9A 3ACFA 4LOKA 4K1ZA 4YAWA 3UF0A 2RK4A 4YN3A 4QDOA 2RB5A 5DIFA 2BSAA 3K6KA 1VMFA 3T7RA 3RROA 5GZDA 1X0XA 4J91A 2WWHA 3GXOA 3KUUA 4OI4A 2YWXA 1LA2A 4WESA 2JAUA 2XRMA 3X1XA 4IHAA 5ALEA 4WI1A 1MVLA 4UAVA 1A34A 4O2AA 2NG1A 1AHPA 2JAPA 4F83A 4DUVA 1CVLA 1XHFA 4MV9A 3PHBE 3K8YA 2VNOA 3B2EA 4IEQA 1JQ5A 2AYXA 1QK4A 1VRWA 4HRYA 2HSZA 3VAZA 1M1ZA 1SK8A 1U65A 3OURA 3A36A 3L8MA 2E26A 3IN9A 4IDDA 3UKVA 3A2LA 3F71A 1W94A 1Z2DA 4RF3A 4ALMA 2JDMA 3VBSC 5FYTA 5B53A 4DZTA 2O14A 1ADYA 1ANKA 4JC0A 4B6QA 1DUVG 1E1CB 4NCNA 3EEQA 4HUTA 1FP6A 2ZJ6A 3W5NA 3WICA 1C7RA 3E6AA 1QP0A 2XE8A 1QIQA 5C3SA 1LPOA 3J7AC 1EUYA 3HDVA 1BXZA 2ZBQA 1YQGA 5A6ZA 3AVUA 5IVKA 5EMHA 3LRPA 4A92A 4UUOA 5TT0A 2XYRA 3IR6A 4R54A 3KX2A 4IMPA 4R68A 5T5OA 4EI2A 1SKBA 1UD1A 3C41J 3KT3A 2RCYA 4TMWA 2JFNA 3AR4A 1PNQA 1NNEA 4M83A 5JDCC 4B34A 3N2KA 4ARZA 2YG0A 5AVOA 4HEA1 4WLNA 4DXAA 2E6VA 3KB1A 3LLCA 3GDWA 3VHQA 4HSGA 3S68A 3FSJX 4EAQA 1IEXA 2VLIA 1CN1A 2P5TB 4MEBA 1FSPA 3RIEA 4NEGA 3V0AB 4PO3X 2G5GX 3KDAA 4JL5A 4U2FA 4Y6LA 3QFCA 5EIAA 3BTZA 2ERYA 4LOIA 4PT6A 3I12A 1E79A 2JIJA 1MOQA 5FUBA 2RHWA 2ZULA 1SHUX 2R49A 3MCVA 5AM5A 1ZRSA 3WP0A 4K3VA 4R5MA 5ES3A 4KPUB 4NE9A 1GEGA 3LUCA 4IEIA 2JIMA 3GJXC 3O0TA 3IVGA 5F3CA 1KO8A 3ZU5A 4C29A 5FNVA 2P3OA 2B6NA 1S0GA 5L8VA 4OHUA 4H6VA 5C71A 3P9ZA 3ASZA 2HA5A 1U9CA 1HKUA 3AVQA 5H82A 2OE2A 4Q4V3 3RC2A 1KYYA 2P9JA 1NVGA 2I2SA 3BK1A 1MA0A 1AX1A 5LN1A 2X5KO 3DPRB 1FSZA 5IK2A 2P7HA 5CLLA 4WM7B 1HDXA 2F00A 4G41A 4AZ3B 3Q9OA 2FKAA 4HDRB 4OHCA 1SOMA 3U4CA 2HMAA 2X4DA 2MSCB 1QZTA 2NO1A 4UARA 4XTMA 1Z8HA 3RHZA 1Y6QA 5IJ0B 4ZVSA 4DYDA 1HG1A 4WWHA 3JARB 3HEIA 2HYIC 2GLUA 2JLVA 3PQ3A 1GQSA 1GPUA 2DYKA 2Z95A 3RU2A 1N5MA 4A8TA 1L9KA 2A67A 4JQZA 4NOLA 2ZI6A 4ENUA 3UKTA 4MQBA 3COZA 3RASA 2VDRB 1K5JA 1P9NA 4I66A 4LKDA 5EJIA 1ZM1A 3EX7C 3MMPA 1E1CA 1R5BA 1F0YA 3WAKA 2V73A 1CZSA 2BNMA 1R092 4XQEA 4CM9A 6ADHA 4CUJA 4XF1A 1I2ZA 1VC2A 3ZDSA 5T5JA 3CLUD 5AKJA 2O52A 3QJGA 1W0KA 1FSSA 3VKWA 4QT6A 1G5TA 5I0SA 2HDOA 3CUEF 3WHUA 3FUUA 2HCBA 4P0QB 1KGDA 2VOEA 1AHHA 2RDMA 2RVAA 3NIGB 1UYZA 1D2QA 5K4GA 1K7XB 2IV7A 3EZGA 2WP0A 1ND3B 2A9RA 4TXLA 2QMHA 3USCS 3U4HA 1TMKA 1R081 2VZRA 4J3NA 1JXNA 4JNKA 3J7MA 4KR9A 4BYGA 3IR7A 1OXBB 1IRXA 2VRBA 4L5IA 4XCVA 1A2BA 4XF0A 5EJGA 3UWOA 1QAOA 1P1IA 1JZ5A 3V0AA 3G0DA 5U9CA 1ULGA 3ZSKA 4Z2YA 5CEEA 3IGFA 1PF7E 2RHCA 2BISA 3LPMA 5BWLA 4LORA 2J5KA 4LE3A 4P3PA 4CR8A 3DG9A 3ASUA 3AF3A 1U4SA 4DV1B 4B3FX 1T1IA 1PO12 2QW1A 1AXZA 2R8OA 1O4WA 2BVNA 2XUPA 4KR6A 5FA6A 1GTMA 1U5XA 4K6MA 4KPUA 4K0KB 2ZJ4A 4J1SA 2BR4A 4BZPA 4FPJA 5LDHA 4DABA 4BGIA 1SKMA 5J2TB 1JB9A 4X8HA 3MYYA 2FSUA 2Q50A 5EKTA 4KL1A 2C1EA 2GFHA 3AW9A 3GGLA 4Q4LA 1FDWA 5LY1A 5T5QA 4P4LA 3LT5A 2ZX1A 3U9LA 3DPRA 1Z88A 1M75A 2R6R1 5F3DA 1DJMA 4YJHB 4FP3A 5C32A 2P3QA 2VQ6A 1NUPA 6CHYA 2R0FA 4IJ5A 4EYOA 4XD7D 4RYLA 1EAH2 3H2HA 3SHTA 4HDRA 4E30A 1XDZA 1HUQA 4IV3C 4CV3A 3NALA 5BN5B 2YV8A 5BRJA 1UZMA 1H9CA 5LD2B 3CUTA 4Z49A 5IJ0A 1JFVA 4G97A 3DF0A 4TYMA 3SHVA 1GPBA 3IP5A 1X1EA 2XD4A 1N5RA 3D8HA 4OXKA 1YFWA 5FY4A 4GULA 4M9ZA 3HDTA 2IRWA 4PX5A 1PFGA 2J9RA 3ETHA 1Z5PA 3TSZA 4R1PA 3VYRB 4FE7A 3IMKA 5B3JC 1MNQA 4NIAA 3IQDB 1E5XA 4FMCF 4JRLA 2RONA