4K40A

Peptidoglycan o-acetylesterase in action, 0 min
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
349
structure length
349
Chain Sequence
b'LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis lnp21362
molecule tags Hydrolase
total genus 115
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k40A02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k40A01
1DEOA 2W9XA 2WAAA 3HP4A 4K3UA 4IYJA 1PP4A 1ES9A 2WABA 4OAOA 4S1PA 3BZWA 5A4AA 1FXWA 3DT9A 4HF7A 3DT8A 1DEXA 4JJ6A 1YZFA 3KVNA 4LHSA 2Q0SA 3DC7A 4H08A 4RW0A 5B5SA 4JGGA 2APJA 3DCIA 3MILA 5CD9A 4K7JA 1ESEA 3RJTA 4JHLA 3DT6A 5HOEA 4OAPA 4M8KA 1U8UA 4DEVA 1ESDA 4HYQA 1ZMBA 4JJ4A 4K40A 4I8IA 1BWQA 2WAOA 1V2GA 5JD3A 3SKVA 5BN1A 1BWRA 1Z8HA 1IVNA 4TX1A 2HSJA 1J00A 2O14A 3U37A 1FXWF 3SLRA 2Q0QA 4JKOA 3P94A 3PT5A 2VPTA 4RSHA 4Q9AA 3W7VA 4Q7QA 4NRDA 1JRLA 3C1UA 1BWPA 1WABA 4PPYA 4K9SA 1K7CA 1ESCA 1VYHA 1VJGA 4XVHA
chains in the Genus database with same CATH superfamily
1SXJD 3LCRA 4XYBA 3TZHA 1U9IC 2EDAA 2QRHA 3IP7A 5AFBA 1UT8A 3M6XA 1YR3A 3L43A 4JKIA 4HFMA 4F56A 1KOFA 1NQWA 4ZEOA 1XQXA 3G3EA 1PKEA 5JZBA 5BV0A 1P9NA 1LGBA 1PV1A 5JD6A 3RGBA 3OTQA 4B4OA 4Y9UA 3BKXA 4LF8B 1QLWA 3HCBA 4EF4A 4UE2A 4P4NA 4GMP1 1L3JA 1X1SA 4Y20A 3U10A 3VBRA 1ZZGA 4RTMA 3KJIA 1UK7A 2IIQA 2DLNA 3E9DA 3WISA 2RE8A 5FZDA 1BU8A 4LRQA 5JR2A 2RS51 4UEKA 2CVOA 3IKLA 1A8SA 3GT3A 3GEGA 3K2IA 3IT2A 2OFFA 4LSMA 4KL1A 3QPDA 5KPDA 3S2EA 1CUXA 4TL6A 2GF2A 4N65A 3AM4A 1IM2A 5JSYA 1PFVA 1W0NA 4KR9A 4E4ZA 2ZKIA 2WZBA 2ZPUA 1LTEA 1WD4A 4J91A 3ECSA 3KKZA 5LRRA 3SHRA 2JI9A 3B2QA 3P9ZA 4LC9A 3LVRE 3AKZA 2PBLA 3N7UA 1GFF2 3A70A 1P72A 3ICOA 1MVOA 1Y8AA 4V3BA 3DYBA 5DCLA 4YX9A 1MGOA 5F1OA 3DYVA 2QQGA 1XOYA 2HWC1 3ND7A 3KAPA 1DWQA 4IEWA 1IN8A 4P9GA 4AVVA 4ZDIA 4UOZA 1M2NA 1PIV1 2V6IA 2W1UA 2Y33A 3HJRA 3HGTA 1M2KA 3CH7A 4NIHA 1JFTA 2FQ1A 1E7RA 4DG5A 3DGTA 1ECPA 2VNRA 3LYAA 3TIVA 4NPLA 2VHXA 4IO0A 2WZQA 2GR9A 5ICEA 4YJKA 2KE5A 3NFRA 3C7AA 1NCRB 3O8CA 1U6IA 2IX9A 2ZBRA 1DDOA 4N43A 3T1YB 4V0MA 2ZSFA 1THTA 3KAKA 1D1TA 2NSYA 2ZYAA 1QX3A 4XF1A 2EKBA 5JVDF 2B1GA 3S4YA 3PHLA 3KV9A 4FOVA 3BMCB 3D43A 4RD0A 1CQIB 4CZ2A 3ORHA 2C0PA 1QRAA 4H6WA 3OIFA 4FSDA 5J3JA 3ZYRA 4MUVA 1Q8QA 4J0EA 1S0BA 2FCAA 2JDNA 3GU3A 3UB3A 2X7HA 3ACIA 1OILA 3L1KA 2GP5A 4ORFA 4KGVA 3L7YA 4TV8B 3FVRA 4X64B 5C18A 2QMOA 1IHMA 1T4DA 4GKBA 4LOLA 1C29B 2RI6A 2ZX1A 1RRVA 1UPCA 1YRQA 2YU1A 4LSGA 4MW9A 5CGQB 3IDEA 2D5BA 3LUBA 3ELUA 3MT8A 4IEIA 4D8MA 5M2QA 1Z47A 5DBOA 4R9RA 2XLGA 1XD2A 1U8XX 2H5EA 3ZWOA 1IZ9A 2DB3A 4LXQA 4FGWA 4W1SA 3L05A 3CVWA 3VZPA 3V9AA 1S0IA 5HIJA 4MHTA 2XMPA 4CMIA 3P1IA 2WNUB 1VRVA 1TLLA 2X3UA 1E3JA 2VUUA 1RM0A 4XAQA 4EE2A 2XUIA 3D5QA 3DE2X 3W1VA 1VYTA 1JG2A 1C3OA 4D6XA 3CJIB 2VS1A 1RMU2 5FMOL 4BKOA 5B7NA 3F90A 5CGZA 3FE2A 5KTSA 1VKJA 2Z57A 1HE4A 1PGW2 1CQWA 1GZ3A 3I92A 3C3MA 5BMOA 4Q29A 4PLYA 4NJ4A 1UZZA 2O8DB 5EQUA 2OR3A 3TO5A 5ICSA 5WRFA 2AVDA 3C98A 3TW4A 4R2IA 1A9YA 4JELA 2CLEB 4N0EA 3KO8A 5F7OA 4U6SA 4FP2A 1UP6A 2BGJA 3CIHA 3D1JA 1RPNA 3QXSA 4M87A 1N7GA 3RUPA 1UDWA 1IL0A 4H1VA 1MQTC 1K3FA 5LCXA 4AZ3A 1NQJA 1XE0A 1I4OA 4AEDC 5JMCA 2ZCVA 3G79A 3KKNA 4GLLA 2EP5A 3QVKA 5FO7B 2BMAA 4GP6A 3BEOA 2QMYA 2O2JA 3SX2A 2ZEYA 4WLVA 4AJPA 4PBPA 1JZ2A 3QA3E 3AGQA 4SLIA 2XDYA 4MPTA 4Q5OA 1E20A 2PLFA 1IY9A 5LLDA 3NKTA 3OT4A 3FSGD 4BBPA 4WJZA 3QUCA 2PQMA 5DTRA 3CZMA 1P2FA 4KWJA 2O8BB 4B6EA 2VPXA 1HB2A 3KCYA 1N5RA 4S3MA 1NU6A 5JNUA 3LLVA 5IYZA 4JGZA 4EWLA 1TE2A 4GIQA 2QUAA 3BL8A 4B40A 5M3BA 3VHOA 1DRUA 3CZ5A 5FL7A 3MRXA 4AAYA 5T57A 3W8NA 3P5BA 1AKWA 2PLAA 5K4GA 4ZOBA 2QXUA 3THYB 1YUBA 3WP6A 5ISLA 1NBMA 1B6SA 1D6SA 2FPGA 3RAEC 1VE0A 1TVKA 3WJ7A 3M9LA 4YRSA 5I7SA 3KQHA 2RHCA 4ZCQA 1GWNA 3MINB 5TF4A 4EN0A 4FFGA 2RGWA 1AHSA 2YMQA 1SGWA 3KVOA 2LUOA 3PJGA 4CDQB 2P78A 3VI3B 3I3DA 1M66A 3CISA 3NUQA 4DKJA 3AR8A 1AL22 1JSZA 1EAMA 2HREA 5L4SA 2ECOA 4GICA 3CUEF 1LI5A 4NHLA 4KGGA 2IP4A 3TLGA 4HO1X 1MZEA 1ST8A 1REQB 4Y2GA 3AHHA 5K0JA 3NRJA 2D2XA 1Y6ZA 9ATCA 3AMHA 1PWYE 3LA2A 4LN1A 4Q6BA 2FR8C 3G17A 2JIDA 1AOXA 1E1DA 4V0SA 1ZGGA 1ZK2A 3DKRA 1GQPA 2X9GA 5B1IA 2WWRA 1NUUA 4RF3A 4OHBA 5L4NA 3A0NA 1DAMA 1BE6A 4V1CI 2V7QD 2CNNA 2YNMA 4A10A 2LRHA 1UYXA 4OGKA 3E7DA 2QSYA 4D9GA 5LP6C 5F5AA 2LVBA 2N42A 4CU5A 1PEYA 5A7PA 4X71A 3G2OA 3NH6A 3W5HA 3FBWA 2NU9A 1N1TA 5A5VA 3SMVA 3KSCA 4TLAA 4C03A 1KWGA 2ZBEA 1ZBA1 3ITDA 5AYVA 2QM8A 2H7YA 5FPHA 3I28A 2WINI 3VNVA 2G7ZA 1MLDA 3TTUA 3GZ4A 2BH2A 4QGBA 2GMEA 3DNPA 4GI3A 4JI2B 1WKCA 3NV3A 3ZCRA 5L19A 1NFRA 5LDGA 1FV2A 2FPRA 1OVGA 2BGOA 1OOPB 1RUG3 5JWRA 4J4BA 4GI1A 5F77A 4M8NE 3UAOA 1BXRA 2VUHB 1GTSA 1D0VA 2UU8A 4F2WA 3JD71 3NHWA 3QUSA 4P5DA 1PK6C 3NIFB 1YQGA 4O8ZA 3JYLA 4XAEA 4E4DX 2IS6A 2OV4A 3AYAA 2H08A 3AY3A 1Z2DA 4Z9AA 2XWJB 1QRSA 2VJXA 3LKZA 3MZ0A 2J5KA 4YAEA 3LYLA 4HJRA 4J3JA 4X8LA 2QBYA 2QGNA 1ODTC 4WKPA 1U5IA 1LX7A 2J59A 3B6KA 2YQ4A 5LY1A 5CLJA 4P54A 2FMXA 3DUWA 2HWD2 3HHEA 3L41A 4Q16A 1U8ZA 4KXVA 3OF3A 4QKBA 1IEWA 2M2IA 2QAGA 4UBOA 2UZAA 4DQDA 3NWOA 3DOEA 1URPA 3IT0A 2VUIB 1T8SA 5AOAA 5KQSA 1ZN7A 1N5DA 5T50A 5B3AA 1QANA 2E7QA 5A3OA 1T36A 4BLPA 5BMVF 4RGAA 3WMFA 1PUXA 2DWPA 4ROSA 5L6LB 1LI7A 4PDWA 5DLQC 1CDZA 3K6JA 3SQXA 3NFYA 4GULA 3LZ6A 5HOEA 3AR9A 3DH0A 5JIUA 4E30A 2J0VA 5KVQA 3K9WA 4PG5A 1P60A 1U7DA 3A6ZA 3GDGA 5AK4A 5DHAA 4FTEA 2OYSA 4MGYR 2QBXA 4YS6A 1QF9A 2EX4A 3MMZA 3MHTA 5DUXA 1KR5A 4FE7A 5E7JA 1F2TA 4BY9E 4W6QA 1OKQA 3TWOA 2FMDA 4LORA 3RW9A 2SECE 4ZQHA 4NYMR 3O74A 3MZHA 3H1YA 5ICMA 2IV2X 4NWVA 4E2YA 3NR2A 3V8NA 3AUAA 1C4RA 5BPHA 3AFIA 3ACLA 2GC1A 4QKFA 3TAUA 1POV0 4U2GA 2J1TA 3KV1A 1C30B 3A1TA 2UWCA 2OXBA 1OREA 121PA 3TX2A 2OVBA 1CJCA 2J9ZB 4WMLA 5JEDA 4NBVA 2ANCA 3T9BA 4A41A 5EQFA 3DA8A 4GWNA 3GGCA 3GAAA 3NM5A 1UBFA 3ILRA 2ZGRA 3GBSA 2QVLA 3RI9A 1NW5A 3DPSA 3W5VA 3D3WA 2VJNA 2XVMA 2LROA 1RRKA 5ALFA 4PZLA 2YPDA 1KBQA 4UUQA 2M1ZA 3BD7A 3FM9A 3BULA 1EE9A 2Z9BA 4O2LA 1O0SA 1N8TA 1VBD3 2WICA 2R5NA 3SSMA 2R6R1 1GZSA 2QTBA 4IDQA 3WWCA 3RYPA 5CIYA 4D43A 5A3UA 3FLAA 1KHHA 2J42A 4FNGA 2WWUA 1SU7A 2QJTA 1PF7E 1ZJYA 3CIFA 4RLQA 4X41A 4NE2A 5FA8A 3GD5A 1Z0FA 1UY1A 4G9BA 2Z8ZA 1WA6X 4MHSA 2OGWA 5FYHA 3HGMA 1I4TD 4YFYA 1E2BA 2NQTA 2VF5X 3HXPA 4C7XA 1L3BA 3R0IA 4MCHA 2Q1SA 1YNAA 1NF3A 3PUWA 4GVXA 2E5WA 2HSDA 3S3TA 2NPIA 4RL7A 4XJAA 4I6EA 1XDGA 3I5YA 1XA0A 1FB5A 3KT6A 1L1EA 4URWR 5A03A 1FY2A 5A9SB 3A06A 2LNDA 4D97A 1KKUA 1FXZA 4P80A 5K0NA 1EAH3 2C77A 4MQFB 2J1EA 3H1EA 1S2KA 2Z5VA 2A0UA 3F7MA 3SEZA 3GM8A 5ILGA 1W8TA 4DXZA 3S2SA 5REQA 2CN1A 5IYYA 3T0DA 5JOYA 2JIPA 4M8KA 3HXTA 4JRLA 5JPCA 3NSTA 1YZTA 1JXOA 3EA4A 4HDNA 1F3OA 1QHEA 4QXPA 3CTMA 1E2QA 3EJWA 1ITZA 4QAJA 1XD8A 1Q77A 2W6JA 5ADWA 3LFHA 3BG5A 4NARA 1VHTA 5HJ5A 1D2SA 3S2ZA 1L5MA 4EBBA 2IXJA 2IWGB 1UPXA 4HPKA 4B4PA 4V2UA 1U5AA 1ZYUA 5C5DA 2DCTA 4FOTA 1SCNE 1LAJA 4Y1FA 1MH9A 2GC2A 4II7A 4PQFA 2Q5OA 3FUWA 3HNRA 2YUTA 5JVDA 2I5PO 2B4RO 3L07A 1E5SA 3W05A 4RN5A 2C20A 2AKEA 3HY6A 2O23A 1J1ZA 1XNCA 1FTQA 1RUI3 4MGZR 5TX7A 5EESA 3QLEA 3DECA 2HT1A 3FLPA 3QY9A 4YAOA 3HD8B 2BNOA 4NDNE 1L5FA 1XRJA 3RZGA 2QDKA 4BASA 1Z83A 1J3RA 1W6OA 1TGYA 2Q1MA 1SMKA 1DBPA 1GLHA 3EUEA 1K12A 1RI2A 1J70A 5JLAA 1US2A 4JOBA 1U7HA 2CLLB 1W6RA 4LTDA 1S0CA 4ND8B 4NHKA 3M82A 1XBTA 1W25A 5FJHA 1LLFA 4OVKA 5M7EA 3DV9A 3MWDB 3DYOA 2MMGA 4XIGS 1DIBA 4RKQA 3GNQA 4LBMA 3U6KA 1W03A 4Z8YA 5BQ5A 2V7GA 3JQGA 1VC2A 5CH8A 3EZ9A 4MV4A 5TPWB 3D54D 3N3HA 3EA5A 5IS2A 1YK1A 1PNOA 5JMWA 3UFXB 3TVDA 1YB6A 4D81A 3A4LA 3OBIA 5F7ZA 3N2NA 1FYDA 5D8AA 4G5GA 4QA9A 5IVHA 1J4AA 3DFIA 5IFKA 1VXRA 2JLVA 3NMUF 5CIQA 4CQMA 2JIZA 4X85A 1XXLA 1ZI9A 3PNPA 4KC0A 1KQPA 4EB6A 1FQKA 2DQ4A 2VZVA 8GPBA 1MKYA 1XR3A 1S9DA 3DE4X 3WP0A 3WRVA 1IM8A 4BYGA 2DBNA 3KUCA 2V74B 3K9NA 2GBFA 5JS8A 1ID1A 4A0RA 3R4SA 2IKSA 1OWNA 3EA0A 3VR6H 3V56A 1Y4SA 3R41A 3OBBA 5F33A 3EQZA 3ZIUA 3JYOA 5F12A 5F9FA 2ZSAA 4RHV3 3N4MA 3OOJA 5J59A 4URYR 5FY8A 3PQ3A 3KXIA 4ALNA 4LJ7A 1XDZA 1H2LA 1ULFA 2HLDD 2AYYA 1J0CA 2BM1A 1Q7CA 3HVKA 2YWGA 2BM9A 4M76B 2Y77A 3WRXA 3SQLA 1AJEA 2WJ6A 2BFOA 2IL1A 1YU9A 4ES9A 3IEKA 5LATA 2N7GA 2PMEA 5GZ1A 2FFHA 2W2NA 2ZVDA 3KJZA 1X87A 3R5KA 2BMEA 3DDUA 5IXSA 4JIGA 1OT3A 2BWCA 4ZN6A 1N34B 4OI0A 1H9BA 3C3XA 2AOWA 4NPMA 5BNQA 5DNEA 4RSRA 1G86A 2W22A 2A5GA 1YWKA 3RGWS 3LV8A 3C3CA 3W1EA 3ZR4B 3D1LA 2X3YA 3ES9A 4PRKA 1SBDA 1LHNA 3T4PA 3ZJ5A 2NXEA 2HU7A 1RDFA 3FFAA 3M33A 4META 4IP0A 4F8EA 2CFSA 3OPNA 3I9FA 2CXUA 2WTMA 4GWGA 3TN93 3T7DA 5DQ0A 4N3BA 2FUNB 3H8VA 3S5AA 3M2PA 4IEFB 1JHUA 4B87A 5U4XA 3BTXA 2PY6A 3G0OA 3BTUA 3R4UA 2PJRA 4DRZA 5LMUB 4P8RA 4FSHA 3M49A 2B0CA 1J7KA 2GZ1A 2XTNA 3OF1A 3A0KA 4J1XA 1ELOA 1T5LA 1KXZA 5KHKA 4Q9IA 1JODA 5BN3B 2AF4C 2PANA 2CUZA 4D79A 1KF0A 3I3BA 2P4SA 3MG9A 3SU8A 1I4EB 3UEOA 3SITA 4JIMA 3LSDA 4MOAA 1L5ZA 3LX4A 2Z79A 3E8SA 2YYAA 4Q00A 3ZDZB 2NYRA 5G3YA 2WG0A 1IU9A 3U80A 3V4LA 1KMQA 3ZK7A 3TB0A 1KYVA 2EL9A 4KAFA 4EWEA 1FNSA 4F2DA 5EFZA 4C07A 4DGQA 1QJX2 3LP6A 2VDPB 4PM4A 2EXXA 4L0MA 1F8UA 1G20B 4BC1A 3F67A 3R3SA 3MMPA 3TZLA 4TOIA 3HDVA 5A4FS 3EB9A 4P3PA 2WS93 2NOAA 3R7LA 3JBG2 3OMXA 4RH1A 3M7IA 4HKTA 1O3QA 5CPFA 1EE1A 2PE5A 1U02A 4TZTA 1BN7A 5CJPA 3U9SA 5HKLA 2JB8A 4LZLA 2B8TA 2A35A 2JJ6A 1QHNA 1H1LB 1PQWA 1R0RE 3ADDA 4IJKA 1AZDA 2C94A 2OK8A 1QH6A 1TLTA 3C39A 2HO5A 1AXKA 5BV7A 3CSSA 1OXVA 4J2OA 4WLUA 1WP4A 1N6IA 3W5MA 2XBMA 4CT5A 2CV2A 3SBDA 2QX7A 3ANMA 3AI2A 4KHPB 5EIBC 3T3EA 2I7DA 4LZZA 2XJ4A 1T15A 1JU9A 1M74A 4HSLA 1P18A 3TXXA 3P9IA 1W8WA 4RPKA 3R5FA 1BE8A 1NG1A 5IDXA 5KDDA 3VBFB 2ILMA 3NDPA 3OUJA 1VIAA 1NZFA 4GM0A 2HWB1 3C41J 1AB6A 4YLYA 5ED0A 3ESAA 2FSPA 3DOCA 3UBMA 4CIVA 1DBQA 4M00A 4EMUA 5JMOA 3GJ8A 3DBOB 1X1RA 5DBIA 1Q0LA 3OFSA 3L7DA 2C0QA 3AONB 3KD4A 4G4GA 2P5UA 3K1ZA 1HA3A 3MTDA 1BEZA 1XZQA 5EPOA 3GZEA 4EV0A 5JYDA 2QTFA 1GRRA 3D3JA 4AKTA 3B3JA 3NNDA 4HATA 2JBHA 2IFWA 1Y6GA 4B46A 2K9ZA 2D6LX 4M0PA 2ZI7A 3WNKA 4FQ8A 2O2YA 4XX1A 4WD3A 2WT8A 4ZEVA 5LMZA 4KLAA 4EPXA 3G2NA 3EHKA 3AHDA 3HUEA 5FY1A 4AI2A 4QOIA 1WXIA 2VNAA 2PVCA 3BI3A 4YJ3B 3KVRA 2OV8A 3HWWA 4QO8A 4JDPA 4RULA 4GEGA 5HDQA 2R7MA 2WFAA 5BMVA 4RE6A 2HA5A 3KZNA 3TSWA 2VZ3A 2XJPA 2E4AA 2R8BA 4DR7B 1RVF1 4OLBA 4B7KA 4RQPC 4XCAA 4HR7A 2VAWA 3H5LA 4PCRA 2ORYA 3D3QA 5TGTA 2P91A 1S2GA 5FPLA 1QGDA 4CMBA 4HAWA 5FEUA 4IS3A 4YBRA 4XF9A 4A9AA 1FYWA 2W6IA 1EFRA 3FNEA 2PRIA 4ZI5A 3O0XA 4ZOEA 2ARXA 2ZSHA 2AGVA 5T4HA 4PZAA 4X6UA 2GO7A 2PL9A 1P4JA 4YGEA 4NENA 3AM2A 1YB7A 4AHWA 2FSGA 4L8YA 1OD6A 4BRSA 4FYXA 4B3JA 3CLRC 3GFRA 1W29A 1FPQA 4B3HA 5DGIA 1PO21 2BP7B 1SA0A 3ROFA 1E0DA 5DGDA 3RJ5A 2AFIB 3PUXA 1DBVO 2O7VA 3QU7A 1OGYA 4E07A 3MF6A 1R3UA 5DTMA 3KUUA 5JR7B 3R2JA 4PLVA 4G0PA 1J21A 3QEOA 2WAOA 4N41A 5A9RA 4Z49A 1O6FA 3QVWA 5GLVA 2YBDA 5EOVA 5GGYA 4GVPA 2GB4A 1EK0A 3KYBA 1OVPA 1DCFA 4EQ6B 2DH6A 4AP6A 1ZMXA 4JX9A 1UDBA 4XVQA 2CWDA 2Q8QA 6REQA 4UFHA 4BZPA 3AX6A 5BN5A 4QWMA 3ZN6B 3LK7A 1XYNA 2J9XB 4YV7A 2WNOA 3B51X 3H75A 3QMWA 3ZEIA 4WVFA 1W5BA 3EEYA 3ZVXA 3I52A 4DCGA 1XDDA 4EF5A 4HDAA 1CQ9A 1RR6A 3FW1A 3GMSA 1B43A 2W0SA 2PPLA 4EAAA 5JD5A 2IYUA 5FZ6A 3AZYA 3HAGA 1XGKA 3K09A 3MSXA 3CVVA 4N8DA 1FMD2 5JJLA 4KLRA 1QZ3A 4FQ7A 4YW7A 1ECGA 3LCPA 3GGOA 4R3UC 3HVDA 1CU1A 4AO7A 5D3MB 3N86A 2RE9A 2VK1A 4G97A 4DR6B 2ZEJA 3LKVA 3QQ5A 3ZV4A 3LGRA 4D7SA 3OKPA 4F92B 1KY2A 2WUFA 1V5FA 4GB31 1SUPA 4HS4A 3F74A 4FX5A 4X6YA 5AW2A 1F6DA 4GEKA 1VSVA 4F6RB 1LB1B 5JYBA 1ZQ9A 1SPPA 3RRZA 3UNXA 1TVGA 1UFVA 2LKDA 3UA3A 4CE8A 3V1UA 5J4YA 2ZGLA 2C4HA 4N53B 1CE8B 5HXMA 2FUG1 1F35A 1NW8A 1S7CA 3UG7A 1ZOLA 4A7PA 2V7UA 3MIGA 1ZIXA 3IVMA 1L4NA 3PTYA 4MVJE 2VW2A 1JE0A 2PT5A 4CM1A 3G49A 2PHUA 2HFJA 3QOXA 4ZHQB 4ZOLB 1D2NA 2H0VA 2X6TA 1JMKC 3F7OA 2OEPA 3OZTA 1NCRC 3NAMA 4LE1A 4A23A 1GPNA 3GVXA 4C4ZA 4C2BA 2MJLA 4UATA 1JBCA 4FNAA 1UK8A 4ZI7B 3PHGA 4AF8A 1H8HD 1UINA 4X63A 3VB9A 2HBYA 3RZHA 4Q3NA 4FOYA 4KCGA 4KRFA 3A37A 2PMBA 2B45X 4INPA 4BQXA 2IYXA 5FP8A 2A94A 4DBLC 2REXB 1B23P 5AQ1A 3GLFE 2BYTA 4FB4A 5CITA 1DTSA 1OFSA 2O2CA 3ROMA 3DCQA 4WVVA 4Z2YA 4MGKR 4AJHA 1T2CA 3LSYA 4YJGB 2VZEA 3L1IA 2ZDHA 5HDBB 4M0HA 5A02A 3PRKE 4S35A 1ZPDA 4AQ6A 2X5JO 5A32A 1IYZA 2JG9B 1YIPA 2CJXA 2YHIA 4FLEA 5COAA 4OHRA 3UANA 5T8KC 2QYOA 1PLKA 3OEWA 4PG4A 2XVGA 1IK6A 1DBIA 1FUYB 2O2HA 3K1YA 5U1PA 4H4EA 5A2QA 4JT2A 4CM3A 3NAGA 4Y9TA 2D06A 1JOJA 5DLPA 4IVQA 4YWHA 5GV7A 2JLBA 4BA6A 1ODSA 1YNSA 5GIOE 2QYTA 3V4OA 3BXGA 1KEWA 1KJYA 3DLIA 1KVQA 1MU0A 1QOTA 3GUYA 5E0KB 3U9LA 5FZLA 1N1GA 1ZX5A 1AQIA 1EUTA 3NKLA 2WNUC 2NV6A 2J0QA 2QRVA 3PGLA 1ZHOA 2NVOA 2FOIA 1OLRA 4B2IA 1TRKA 2VW1A 5CK4A 2AUTA 3TSOA 1XDUA 4DYDA 2HK7A 1B35A 2NVUB 3CJIC 5FTLA 1ONPA 4A0FA 1U7TA 2AEMA 4AI8A 1UPTA 5BXXA 2EZUA 4KQ6A 3WO0A 4RPLA 5EERA 3WNLA 4A5OA 3KGLA 4BIOA 1B1AA 2JDZA 1DB3A 2P2DA 3WNNA 1KPHA 3THCA 4RR3B 4B81A 1GA1A 1U9ZA 4M1KA 5EUCA 2WSVA 1RYHA 4ZQIA 2WBLC 1EXVA 1SKYE 3QVUA 4IX9A 3CW2A 4DNQA 4DC0A 1N5JA 2YXNA 1Z33A 2A5FA 2JKVA 4MAMA 2Q7DA 1PR0A 1ZK0A 1E7WA 3U14A 4MA4A 5DAWA 1GNPA 2EHJA 5EQJB 2PMDA 3SJCA 4UMFA 3W2FA 4QO7A 4C01A 2QRKA 5J98B 3N35A 3QE9Y 3R9XA 2GN2A 2CNAA 5E2IA 2GEVA 2G9QA 4F3TA 3P0JA 5F64A 4J2HA 4JYMA 4I4TF 1BEV3 1H2NA 1YJKA 1TEZA 1KPIA 1S2BA 3TMYA 1M3SA 1JHYA 1XZNA 4II2A 4MGHA 2YH2A 2VJKA 4I2OA 1ZMTA 1L1FA 3W8EA 2QY6A 1G8PA 2PRZA 3AKRA 3KSAC 4XQEA 4JENA 2XVYA 3OWOA 4OAOA 2ZCWA 4KYUA 2Q3CA 1UBNA 3BBPA 1DLJA 3RT9A 1UJ5A 3GJXC 3FTNA 4QGHA 4EY5A 5TEWA 2AMFA 1KI6A 3R8XA 4JGGA 3TDNA 2OOKA 4ME6A 2Y27A 4AY4A 1SKMA 5IBRA 1W9WA 5IDYA 1FMLA 3SJBA 4I5DA 4E5NA 3IHKA 4OHKA 3VZCA 3L8ZA 4TL7A 1YR1A 4FBFA 1OQ1A 4WOBA 1HYEA 4LC1A 4Q1RA 5F4ZA 3JQEA 4M98A 3O0TA 4L2IA 1Z7YA 2C97A 3URKA 2ZGTA 2G36A 3DLCA 2DVFA 1FNCA 1SXJE 4US1R 3BOPA 3LOBA 1D4M2 4P7FA 3T1LA 3PHMA 2Q8CA 1GNRA 2V55B 4PPGA 1TI7A 5EJ7A 3DWEX 1UKCA 2HWE2 4CDQC 2AMLA 3A22A 2XBO3 1Y80A 4MYEA 1ZNQO 1PP4A 4W8OA 4XD7A 1JUHA 4XYGA 5IN4A 5FA5A 5CNMA 2FDCA 4JUFA 4MV6A 3AEQA 4CDRA 1SLLA 1YRZA 3NHBA 4XXHA 3NHMA 1GHTA 2BF7A 2HL6A 4MV8A 1W2NA 3SC2B 3NP7A 2B37A 1JSRA 2LZ0A 4YQYA 2CDBA 3B7PA 5ICFA 3KRTA 3UJ6A 1FP2A 5CX4A 2QW1A 1WCKA 2RS32 3HBFA 3COJA 3VTKA 3KD3A 2ZQ5A 1OXMA 5LJIA 1DLCA 4E12A 1T5OA 3EIXA 4Q4JA 1U28C 4IMRA 4GKJB 4HL0A 4K1LA 4BFSA 1PTJC 2KHZA 3D64A 2YG0A 2UZ1A 4NMLA 1AT1A 5F7UA 3MIFA 1YA8A 2LCIA 3HWSA 3VXKA 3IXQA 1NVDA 5JAHA 1XVLA 4KVZA 1DRJA 1UMDB 1QLJA 2PZFA 1NXMA 1CLEA 4YRPA 1L7OA 1FFYA 4Y2VA 3BRWA 4GYYA 5JALA 4LPLA 3GLTA 3R6DA 4LWQA 4HMQA 2VOEA 3TZQA 3L8MA 1UXZA 1E9AA 5I7RA 1E1RD 2DHCA 3C3EA 3WD5A 4BH9A 5FQOA 1NL3A 4Q9JA 2IP1A 1OOPC 1WJGA 3H2SA 2E4WA 3NTLA 1OFVA 3W21A 4MVJD 4ARYA 3OU7A 2NZ2A 1I6XA 4RFVA 1I2DA 5CVDA 4GD4A 4FPGA 1SLAA 1Z8NA 4E5SA 1ZICA 2IDKA 4CU6A 3ZNPA 1BS9A 3MCVA 2W0XA 3IHWA 3T08A 1TCCA 1NHWA 3QV2A 5BW4A 1E32A 3HKCB 3O4VA 3CKHA 1GZWA 4YRDA 4BQ3A 4IL7A 2O2IA 3SX4A 2GBIA 4LZOA 1ZA7A 4V1PA 1UWCA 2ODBA 1U1EA 4LK2A 5LBFA 2AEEA 3VJKA 2WZ8A 5TQVA 3JVUA 1ZUWA 2A9VA 4PR3A 4OHXA 4N49A 4QGMA 1UJ4A 5BUZA 4DIFA 2HNAA 4CL0A 3SHWA 1OZ0A 1D2HA 1DT3A 3CW8X 3LY8A 2HJHA 2XHEA 2R042 2CGEA 3TGPA 3SR0A 3ZWPA 3KWLA 3LEGA 2Z4RA 3CMMA 1ZZ6A 4IO1A 1ECFA 4HQOA 1CAUA 3SEEA 1H8EA 4P32A 2OGTA 5FO1A 4HT3B 1OZHA 4ZKEA 2WSSD 4ZZ0A 3FOFC 1C9YA 1KVSA 3KEQA 2O54A 4BLIA 5FWAA 2E0IA 4HK4A 3PQ5A 2FQWA 5DI3B 3H0OA 1U63A 3O4IA 1A9PA 2OQIA 4WJKB 1S4MA 4LZJA 5ALRA 4GU5A 4TRNA 2ACEA 3JARA 3SAJA 1HKUA 4TWIA 5AW6A 1JZSA 1A97A 2IIPA 2E32A 2E5FA 4LTNA 4CDUA 1A50B 3B93A 2I87A 1QKJA 4A82A 4QGLA 3TRDA 3V80A 2CDOA 1DTEA 3RFUA 3ZIAA 1MOQA 1JILA 4YWAA 3D7NA 5FPSA 1DDGA 4R2LA 3LLUA 2HIGA 2PZMA 3LJKA 2WWVD 4IETA 2Z04A 4AF6A 4FW9A 1UH5A 5H1YA 5G3ZA 2XECA 1E1QA 4IIHA 3EDOA 5KCMA 1YBFA 4A8PA 1DBRA 2VT6A 1JYTA 2O0OA 1UWWA 2GO1A 2ZEXA 2AN1A 2Q5JA 3EVBA 4Z53A 4EH1A 4P9XA 1PK9A 3NJXA 2NYVA 2EFJA 5IVVA 3S7IA 1BVRA 5D1NA 3QPAA 5FY5A 2J8ZA 2EALA 3G9XA 1RJDA 4JJGA 3WZMA 5H5JA 4J16C 5KJ6A 2HM7A 1MO5A 5GOTA 2TRSB 3VZOA 2Q07A 5JZGB 5CW2A 4B82A 1UODA 2VYVD 1RRPA 2XT6A 4GA9A 4RKRA 3PX7A 4MPPA 2FCTA 1YRAA 2IDJA 3WGOA 1IZ7A 2HK6A 3Q0IA 2YWBA 2R25B 3GZNA 1FBTA 3WW3A 1M8GA 2RAPA 3MERA 1QO7A 1RUG1 3EISA 4AWBA 4HDMA 5LBTA 4BQIA 1FTWA 1UAGA 3IODA 3VMFA 1AUVA 1RIRA 1KY4A 2QVYX 4DNPA 1Y1PA 3AT1A 4MPRA 1GQOA 5IK7A 5G1OA 3U5TA 4QX7A 4E27A 3H5TA 2FDFA 5KNBD 4GBED 4IDBA 4UNQA 4IH9A 4G8JA 3ZLUA 3WKDA 2RDRA 3C8XA 2IPLA 3IAAA 2QRQA 4Q2FA 1JMYA 1DQ0A 4I0WB 1Y8CA 2Y6JA 4J2TA 2JDKA 5IT0A 4MX8A 4EX6A 3L0SA 4F4CA 2XKPA 3VBSB 2C1FA 1E2MA 3GXOA 1HETA 4MV2A 2FZLA 4IDGA 3WGYA 2JFPA 1E0AA 3B12A 1N2CA 4L27A 3AR5A 4REQA 3X1ZA 1I4DD 3T30A 1LPSA 1AB5A 4ENPA 5FBQB 2F1JA 3R9KA 4LFBB 2VY0A 5AW4A 2GYVA 4IJ6A 4XPIA 2GUGA 1KAOA 4OSOA 1ECBA 2H18A 4JLMA 1N0VC 1XMJA 3PVNA 2CGOA 3JYQA 1F9EA 2BI7A 4DG9A 3ZE0B 1DL5A 2ZYVX 1EYZA 5GJVC 5F1RA 4I30A 4TXJA 3N6XA 3JAKB 1GZVA 3EN0A 2ZRMA 3THWB 3BB3A 1EB9A 2B8NA 3BOWA 4LHSA 1BXZA 5ENDA 4E3ZA 3LRPA 1AX9A 4Y18A 5F5NA 2I4OA 4DNXA 3RUFA 4M7OA 1XP5A 2V8OA 2DQKA 3L2YA 3MW2A 4BNWA 5AK6A 4NS4A 2CJFA 2XMLA 1GBGA 1LXCA 3G2KA 4NQZA 1YA4A 3FMIA 2XZOA 3SY8A 3HIFA 1P1HA 3VR6A 3OZAA 1BS2A 1DBNA 2JRLA 1OUMA 4DRYA 2ZVPX 4Y33A 1K6XA 4H7KA 1XB2A 1Z4IA 4BE7B 4IF4A 4MHRA 5F5LA 2P34A 4AM8A 2QL9A 5EFOA 1G8WA 2E37A 1VE3A 1EX1A 4QKDA 5LBCA 2FEAA 2HPZA 1S3GA 2VDOB 4WXPA 2CLOB 2OAGA 5IFTA 1E79D 2C4WA 1VBD1 3M5PA 3FAZA 4ECEA 1RUE2 3D1VA 5A5DA 5DLYA 3V5NA 4GE0A 2YIDA 5C8YF 4MWEA 1I5EA 3ZZNA 5IVIA 1ECJA 2X5XA 1YRBA 5ECDA 1Q3EA 1J9GA 1DJMA 5JFGA 4LHVA 1WW5A 4ADSG 3IAPA 3UXHA 3PPIA 3R6WA 4QGAA 4PICA 1GQ2A 4MRVA 5C53B 2ORED 2YBEA 4U00A 1MEJA 1QIJA 1BWQA 4MP3A 4ZRDA 3OCUA 1ZRNA 1CZSA 3OUIA 2JARA 2DLDA 1QIQA 1KMHA 5KYWB 1N8SA 4FOPA 4HEA1 2QDRA 1IPHA 1O0BA 1EAH1 1S3IA 3WJ2A 4JI7B 2IPOA 4I1OA 1JDVA 3P2OA 4J1TC 5C4GB 1M6WA 3PC8C 2GERA 1E8MA 4ASKA 1XAHA 3VTAA 2HA0A 3QY0A 2JJ1A 4DPMA 3VVBA 4Z7NB 5JPMB 4GF5A 4HNRA 4IHKA 4NZOA 3BZWA 3SCHA 4D42A 4I4TA 4KG0A 3UK7A 4TQAA 4CKWB 3O5AA 4LNAA 2R7AA 1JEQB 4RVGA 3ZU6A 5EMLA 5ENVA 5DBFA 2ADDA 2E53A 2WR9A 1EJ2A 1TFRA 3VPGA 1DNPA 1RI3A 2YIVX 2P1BA 5B1SA 3C7FA 5GLTA 4UHCA 3NHPA 1UMHA 1KU6A 4AN4A 1IDN1 1Y1SA 1GNZA 4QUIA 2VPVA 4DARA 3UQZA 2VQEB 4TYPA 1SCAA 1SHWB 1N3QA 5IAGA 4IE7A 1JAHA 3ILFA 1Q56A 3U1VA 4XURA 5CURA 4Q1BA 2GAAA 3WGGA 1QQP2 1ZIOA 2C9CA 1HNZB 2ZRDA 5IHRA 2DCZA 4C0XA 3NS7A 1RUI1 1KFEB 4W4ZA 2FSFA 3QUQA 1U4NA 3WX0A 5FPKA 5IW0A 1O4VA 4P4UA 3OURA 5KOHA 4C88A 3CVOA 5AM1A 4W9NA 3RRDA 2X53S 3JU9A 1E59A 4BMEA 5MHTA 5EUMA 3VAYA 1W8NA 2YV3A 2EIXA 1TFUA 1AJKA 4RPHA 3P26A 5K4HA 2YYOA 1LDEA 4PLWA 2VXJA 3B6JA 4QDKA 1UWLA 2RJOA 2ZK7A 3WXPA 4AEKA 2MSDB 3L82B 3PFNA 2XNKA 2GZAA 4CUGA 4UTNA 3Q5EA 1DARA 3LIPA 3WBBA 4EI2A 3HFRA 3R3HA 2LE0A 4OLAA 4EP1A 1G2QA 1DWOA 1Y3CE 3HDHA 2PS3A 4GWMA 4QOSA 2OBNA 1QVRA 4KE6A 3A6KA 4L9AA 3ZCVA 2FMIA 1U5YA 4BO1A 1AR93 2CD9A 3UMJA 3IMKA 1CWPA 5HBGA 5G41A 4IE4A 3IPYA 3NOQA 2A5LA 3N8HA 2EKPA 2CUNA 4ZQBA 5CXSA 2Z9CA 3ZXJA 2W70A 1BXGB 1F15A 2IZZA 4YDRA 4O25A 2E7TA 3G2MA 4ARVA 4U4AA 2ZMNA 3V8MA 1XZKA 2UURA 3ENRA 1QMGA 5EYXA 3EC1A 4C6TB 5BV1A 3EEFA 3K0AB 2PXHA 4KBGA 1XYPA 5CVRA 5BN4A 3EYWA 2RDMA 5AW7A 4ASLA 3GFPA 3R44A 4LTMA 4F85A 3Q8MA 4RHV1 2W8ZA 1EFPA 3GZJA 4NJMA 4PYLA 4QQFA 4Y3OA 4LBZA 5C1OA 1UKGA 8ADHA 3I30X 2J3QA 1OA1A 1HTTA 3VBFC 2QTWB 1GO2A 4EYEA 3TTSA 2AW3A 3NBMA 2E9SA 4NOMA 4D4JA 4MP6A 1Z0HA 3RVJA 3P9XA 4LVNA 5GIPE 3QF7A 3E7WA 1P7VA 4U2BA 1YJQA 1KI9A 3I4IA 5F7JA 1VBA2 1UXXX 3E5XA 3LQQA 5FTWA 1XZEA 5ADHA 3PFCA 1G42A 1BO6A 4CEHB 1I1OA 5FUQA 2KLHA 3O14A 1I3KA 1Y1RA 4EA9A 4JOSA 5IZCC 5CBLA 1B8UA 3CF6R 1XXHA 3PQ8A 1L2TA 1K5JA 2P0YA 2P9ZA 3V4FA 2FVYA 3CG0A 3TN91 1PNQA 2FEOA 3TSCA 4EN6B 2AG6A 5CCDA 1KK1A 2FRDC 2ZITA 3A8TA 1Y8QB 5THKA 4BV3A 1N9KA 2XGSA 1FSSA 1T6BX 2BFAA 3KEFA 4N0PA 4XYMA 1XX6A 3GDHA 4NC9A 2AI1A 3FNGA 1VE5A 2IOFK 1OWMA 1Y5RA 3JYHA 2NO7A 1U5CA 1X7DA 4MWSA 4CTEA 3EIUA 4H16A 2BM0A 3NRCA 1LWOA 2XL9A 1XLWA 1E6KA 4EWDA 1TJ5A 3JALA 4NF2A 5BSRA 1FX0A 4YP7A 4NWIA 2RHTA 5JH7F 1EA7A 3D4PA 4ZAWA 3DL3A 3G9UA 3T3NA 2B36A 3GMIA 5L73A 4GWIA 3JB8A 3LCVB 4UW6A 4LZAA 4UC0A 3ULKA 5KBYA 3K4QA 2EJTA 5BVHB 3HL4A 2ZIAA 4RV9A 2PD4A 3KBOA 5L51A 4YW4A 2WS91 2X9LA 3M3PA 1FJGB 1E7MA 4K6MA 5BWBA 1DFQA 5C37A 3LKBA 3IEVA 4D98A 1L5SA 3VR4A 1OE0A 5CB6A 3DBHB 4YJHA 3ETQA 1JH8A 5ITZA 3B1JA 3MILA 1U99A 2C99A 5G53C 2W46A 3QVMA 1QXSA 3QKSB 1R0ZA 1JYEA 3FD8A 2XTMA 1KFKB 3G9TA 2ZRKA 2PAEA 5HVNA 4KQ7A 1X1QA 1Z7WA 5DU2A 1DC3A 5JZSA 2PBZA 2OYZA 4WCFA 2PHFA 1LI4A 2HWUA 1UP7A 1E3LA 3T1OA 1M1NA 3MCZA 3OPWA 4BNHA 3AP6A 3LO8A 3TXYA 3HJNA 2FPIA 2G5PA 1H4TA 4YTEA 3UG6A 2QP3A 4GI5A 4POAA 2QE7D 4JDOA 2GF9A 1M1YB 3D5TA 1RT9A 2G8NA 3DUFB 4W5QA 4Z92B 3A10A 1YULA 3EMBA 1C0KA 5C33A 3VZDA 4MR9A 1G7TA 2CLSA 1MMFB 3IQWA 4O65A 1W0KA 2NO5A 3WWEA 1DG6A 4RK7A 2QVZX 2Y76A 2ECQA 3GLHE 1GZDA 4X44A 3PGMA 3V48A 4DZZA 3M3DA 3LPGA 1Q0QA 3ERCA 3DL0A 1E2GA 2OPHA 4IKOA 3ZMOA 4MGEA 4MGYE 3A1UA 4FFHA 3BH0A 3U4XA 1NCQA 4BQ1A 3O1JC 1L4MA 1SLCA 4N5HX 1V3QE 2VFAA 2NU7B 4KO2S 4KNYA 3QX9A 5KNCH 3KHBA 4TYWA 4IDOA 4IW3B 4DWWA 3KYDB 4MKHA 4RESA 3TLBA 2NP6A 2YGLA 4Q5IA 1XELA 2QRZA 3SWWA 1DMRA 4AWDA 2NMNA 2WO1A 3AFNA 5C4WA 1U31A 1F48A 3HH8A 2J7MA 5IUNC 1Z6XA 4U9HS 1Q95A 1DPFA 5CLQA 4BJ1A 4MS3A 4QT6A 3L04A 2H31A 4IOLA 2XUOA 1W5SA 2PYDA 4OHOA 2XF8A 2FPGB 3ZDDA 4Y2JA 2EEPA 4C05A 2G08A 1GPBA 1ZI6A 3OMLA 2WSMA 4N53C 2IXTA 5AM0A 2NN8A 4QHBA 3CZUA 1U7UA 2DQYA 3UCXA 2I4NA 5AVUA 5DG1A 3TNQA 3D0KA 3T6KA 3R0QA 2LWIA 4OUEA 4CU2A 3C6XA 4PTZA 2DJ5A 4UEOA 5SY4A 1HWYA 4RLHA 1B3RA 4W7HA 1OC1A 5B4TA 3KSZO 2Q49A 1IMOA 1HEYA 1KVRA 4JI4B 5LBUA 2DWOA 4ZCIA 4MHOA 1D0GA 3K4ZA 4FYIA 1G98A 3E1F1 4GQIA 3BX1A 1Z5PA 2ZU6A 1CDEA 1CUVA 1LQTA 4B32A 3OGVA 1U3UA 4JLJA 3PVOA 4MV3A 1V1RA 3JZMA 5K3DA 1P6UA 1WU8A 3V8EA 1XFDA 3IVAA 3AILA 5ISMA 5L3ZA 3RREA 4AJ4A 2BT4A 1UIKA 3MCAA 2ZRFA 2P2GA 4FE4A 4DM7A 3J7HA 2IS2A 4WPGA 4IJQA 4CKCB 2ZLBA 5A62A 1VOTA 2VN8A 3FFTA 1QH7A 3ZSMA 2PXCA 2JG9C 1SEVA 1JXQA 3BK2A 3GLKA 2JFZA 1YHFA 1ICEA 2RGBA 1SIBE 2HLNA 2V7XA 5DBHX 3GC6A 1R00A 5KZMB 4JUDX 4AJOA 1SHUX 1AZSC 3U26A 1YV9A 2IUSA 3GLIA 3WLSA 2YUEA 3B78A 5C8YA 4Q4W2 4HYYA 1EFVB 4D6RA 3GJ3A 3WL3A 2ZTHA 1JKXA 4JI1B 1TZJA 4NROA 3R5JA 2QLMA 4FYJA 1H2EA 2Q99A 2WSIA 4QQKA 4HUQB 2C1XA 1W0JD 2P9CA 2UYQA 4MQEB 4DV7B 3KB8A 3BTSA 2VNOA 2IXIA 4HNSA 1J09A 3AEXA 3W9BA 4B4VA 2P9EA 4N03A 4EB3A 5HGXA 3DHVA 3DOUA 1W6PA 4NOTA 5L3VA 1YFYA 4MGZE 1GAWA 1K7CA 5GGXA 4AT1A 1JPNA 5L53A 4CIXA 2F3UA 3C0KA 3ED1A 3BFXA 2ZRJA 1ZXXA 5KXDA 4AFCA 4S1PA 3HBZA 2AZ5A 3WHUA 5JWHA 3EJ6A 3DHYA 4RR3C 5CYPA 1DOZA 1NKGA 3JQ7A 5FI3A 3WG9A 4FXKB 1O6CA 4XOIA 5TMDA 4XUCA 4D3DA 1OIVA 3WXMA 1C9JA 3WYGA 2LKCA 4HLUC 1ZISA 3E8XA 3DOJA 1HE5A 4ENTA 4TPKA 2NXNA 3BZUA 2AC1A 4LJHA 4FFBA 5DEOA 1QUFA 2B6HA 3LH5A 4BVGA 3NVMB 5JQGF 2JDID 3BALA 2Q8NA 4P4TA 3HC7A 1A8HA 2BONA 4Z6KA 4FNOA 4F4FA 3FDZB 2Q0AA 4HQ6A 4KBFA 1D5WA 3TJMA 1IQUA 4XUOA 1QOQB 4O4IF 1NT2A 2JH8A 2BI8A 3L8YA 3UKNA 3SXJA 4I0AA 1P1RA 1BH6A 3G85A 4IX1A 4G23A 4CEIB 4IICA 3Q85A 3WKEA 2BL4A 2E85A 2CL5A 4RQTA 4RKWA 2H16A 2I80A 3EXIA 1YMUA 4LDJA 4X94A 3H9JA 1Z07A 1HDXA 3BM5A 2HZ7A 1DELA 3WQSB 3T0AA 4JB8A 4Z7OB 3I32A 1Y48E 3ZOKA 2VQTA 1J2EA 3GPIA 2RONA 1F5SA 3AI7A 3FOZA 3L0ZA 1M2JA 3VD9A 2VRCD 3PNYA 4G8CA 1PSZA 3K5PA 5ALHA 2ZTSA 3LW7A 4MUIA 5K09A 3PIRA 1JHDA 2XVAA 3I9V1 2WVGA 2DM6A 1TAHA 3PDIA 2OD2A 4MR8A 5LK7B 2D13A 3RBZA 3MJFA 4FPCA 4I55F 2D74A 1X7GA 4FSXA 2AX3A 5GZ3A 4EN7B 1T3GA 3GA0A 2HA7A 4NYIR 1C7QA 3PKIA 1HXS3 3K94A 2K6GA 3D6NB 5JNLA 1AR82 4IGIA 3IUQA 1G55A 1TA4A 3BA6A 2XB8A 3GA5A 3ZYFA 1GICA 5K03A 5BWCA 2GYUA 1W99A 3FYTA 3ZX5A 2W2LA 1YUNA 4BBZA 4B83A 3E6CC 1DWUA 1RLMA 3HDJA 4F2PA 1ZU5A 4K2HA 2JGEA 5D6OA 4X92A 1SU6A 1QJ4A 3IN9A 3ZC3A 4UVHA 1X0VA 3OZSA 4KX3A 1Z2AA 4AG3A 2R4QA 3W79A 4AEMA 2W4IA 5FYMA 3V46A 3ZLVA 3PL5A 1YEWA 4J1SA 4GSYA 4AI0A 4HZGA 3PRYA 5CT5A 1NLFA 3OPYB 1RUC2 2MYPA 5I7VA 4IIJB 4BQEA 1F3LA 2HPAA 3C6BA 2D98A 1GLNA 1A9ZA 1CV2A 2MCFA 4RDXA 1T5BA 1JLMA 2LCFA 1QHFA 4LF4B 2G6TA 4PC2A 2P3JA 1L7DA 1Y1TA 1J6UA 4DCCA 2BKVA 5DJ5A 2HSJA 3NC4A 1DP4A 5D5QA 1WKBA 1ISSA 3MLEA 3CMGA 1RJFA 1T2EA 4E32A 3VMMA 2FQPA 3FJ1A 1O96A 2ZR8A 4CTKA 1YS7A 3V8BA 1GAQA 3EGVA 1JWBB 1I6LA 5D2AA 1DGRN 3T41A 1NX6A 5F21A 3FETA 3TECE 2JBWA 2ACWA 2WU0A 4OGLA 1JR3A 4BBJA 3T4HB 4UARA 1WCXA 2JGDA 1VPWA 5KWVA 2BUBA 3HJCA 2DMRA 3UY4A 3OIWA 3O84A 2PAKA 2IT1A 4V2IA 3QW4B 5CG9A 1AIPA 4NX2A 1BEV1 1MO3A 5ALEA 2O50A 1NJGA 1WZXA 3TEYA 3HEBA 4LOHA 4F5WA 4PC7A 4WE3A 2FMYA 4XW2A 2ISSD 2QZ2A 4PLMA 5KYGA 1IZYA 1SG9A 5DZSA 2ATVA 1XUOA 3AKQA 5LR6A 1FRFS 3Q8WA 4WZBB 3HEIA 3RIMA 4KIJA 3ZVKA 1H4QA 2BPOA 3POJA 3WUCA 1Y3AA 1W73A 2LCQA 3WDSA 2W4MA 1D2MA 4UXIA 1ZA4A 4RHFA 1YJCA 3RV3A 4W4TA 4BNGA 5AWFC 1Z0UA 5CFNA 3NAZA 1U9JA 4L02A 1WUKS 2GEJA 2ILVA 4ES8A 2CYFA 2GSWA 4UXAA 3D4KA 5EZ5A 4Q26A 4WOPA 2O7RA 3TW8A 2G5CA 2J45A 2XGGA 1NONA 2OOSA 1WLYA 4JC8A 5GONF 1PYOA 3CUUA 3FGOA 1HE1C 3PDWA 2H3HA 5JH7A 4BWFB 1NXVA 4EGSA 4KLCA 5FUXA 5LXTB 5K1ZA 4HPJB 3PFIA 3WYNA 5LEJA 2IC1A 4F60A 1FATA 1CUAA 3W6PA 4LBQA 2W6ZA 3JXEA 2R0FA 5IDVA 4FYMA 4SBVA 4CQMB 3J81k 2XBO1 1F2UA 1PO13 2J9YB 3RLFA 4DUWA 3BJEA 2NNLD 3EIFA 4HLQB 1Z0IA 2WFF2 1SU8A 3W3AA 1V25A 3S28A 5IAAA 3CF0A 3QEAZ 4KHZA 3O73A 5ALNA 2NO1A 1THMA 4N3GA 3LQRA 3ZSLA 2C03A 5TLSA 5IJAA 2E4YA 3ADCA 1NBOA 3DHEA 5TQ0A 1LHOA 1O95A 1UBLS 2ZYSA 2WKKA 1Q7BA 1IUKA 5A05A 3GRPA 2X5IA 2B2CA 1OLUA 4OY3A 3WLOA 2G5TA 1NJSA 3H6KA 2JFBA 4YV1A 1AXYA 3ZQ4A 1B0ZA 1KFUL 3L01A 4A6EA 5JWOA 1OXKB 1HQKA 1U7XA 1QF6A 1SVUA 3O0WA 2ZJCA 2PKCA 3RTCA 2MSLA 3DFFA 1WPGA 3ESXA 3GT4A 3IIIA 5FYSA 1CUDA 1U2GC 3BN6A 1W0CA 2BRTA 2ZM5A 3EGEA 5JZGC 3KJGA 1A5BB 3IH5A 3VDCA 2ZT6A 4IGAA 5FBRB 1DZ3A 3JQRA 2G40A 5HZMA 4JBXA 1C1HA 4EMTA 4HC4A 3DAHA 1WXXA 5ERYA 1O5UA 5B2FA 4FPEA 3ICPA 4QDUA 1OX4A 4D4HA 3FCYA 3P45A 3ZW7A 3T4VA 4JSRA 4KQHA 1LHWA 3PU8A 1JSCA 2FRXA 3E03A 3AM5A 5FWYA 3NYIA 2OUJA 5L7OA 2BFFB 4QUAA 1CT9A 2IPMA 3P2JA 1U8CB 3IKMB 3Q7IA 4MIKA 4QNNA 1KZ9A 4X7MA 2OXCA 5DUUA 2WJIA 1YDFA 5CLFA 4YCBA 4BFTA 2JCSA 4UBHA 2BHLA 1U2TA 4CRQA 2TSYB 4LMBA 1TIBA 4EZHA 1L6IA 4JUIA 1L4BA 3TS1A 4BIMA 1LBTA 3RG0A 4NU6A 4D9FA 3HQUA 4ZYLA 3CIOA 3DS8A 1XVIA 5LUBA 1L4UA 1NURA 1Z16A 2YQZA 1M2VB 2Y99A 4PTYA 3VBSC 3ROQA 4YG3A 4CN8A 1AGYA 2I34A 4OQ9A 3NOVA 1RHUA 3E9YA 3N36A 1ZM2A 4PHGA 2OZEA 1U4SA 1MNAA 3PRHA 3NGXA 4CDNA 1KS4A 4N1AA 1EJ6A 3H4MA 1XLTC 4QWNA 2XONA 3NEAA 3C6KA 3ZXUB 4LBJA 3ZR6A 2ZRBA 3FTQA 3I9KA 4BNLA 1KI2A 2I55A 4BFVA 4Q7LA 2VD7A 5DXFA 3SYMA 2EBWA 3I2GA 2BKUA 3STYA 1JQ5A 2ZYUX 3FUUA 5E6UB 1SVOA 4CM7A 3B7MA 3OC0A 2PVSA 2HDOA 2FCUA 3ENVA 4Y8VA 4OEHA 4DE5A 3M9XA 2G9UA 2V09A 3I3EA 1UJBA 1Q50A 4AE2A 4BXSV 5AJVB 3M3OA 4BP1A 3V1TC 3S1AB 2P77A 4HXEB 4LDAA 3DEJA 3LW8A 1CIJA 4CMEA 4EYSA 3BL6A 4O5AA 4A3XA 4P3NA 3TVTA 3QNUA 2PUJA 3T2QA 3BGIA 4WZFA 3JZVA 1CIPA 2CDPA 4LITA 3E7XA 3IDZA 4X1YB 3LG2A 3I4CA 4EITA 3ASIA 1SKQA 1K89A 4B48A 2YY6A 4OFXA 4YRCA 4AZ0A 4OI2A 1OYVA 2Z2JA 1WBDA 3CZ9A 5GMOA 1UMBB 1EBUA 4ZT2A 2NQ8A 1OW3B 5EUQB 4J43A 3EQ6A 5KOYA 5FNVF 4R5HA 4FHCA 1M8KA 2J5XA 4C3VA 4DYHA 1MG0A 4M3CF 1LPOA 3IRUA 5JJKA 2Q0XA 2RMKA 1EFHA 1RYZA 5JADA 3R6SA 2HSWA 4FI3F 3ISVA 1VE7A 2BFMA 5IARA 2VP5A 1UDCA 4LLFA 2ALJA 4P53A 2Q1YA 2O06A 1TTQB 1M2OA 4ZV9A 1O03A 5C71A 4BLRA 1KEZA 4RFT0 1N9ZA 3A58B 2I6QA 4KDFA 2HWF3 3M81A 3K2BA 5TRTA 4MSVA 1EESA 3WMGA 4JKYA 2VXYA 1MDFA 1SDDB 3K4AA 4XJTA 2B5HA 3EPHA 1I0ZA 5FZ0A 1AY0A 3RTBA 3AEYA 1Q15A 2Q2WA 4KR2A 5EJIA 1G2OA 2RHHA 3A6FA 3AKDA 4U6QA 3TYJA 4QX0A 1NUPA 3V1KA 5EZQA 5F5CA 4MGKE 3GZTB 2D4AA 2ZAMA 1CXZA 1NC1A 1PVDA 2F62A 5BMVB 2PX0A 5CFPA 2OA2A 1SXPA 1H0SA 5KI6A 3LU1A 3OJFA 2DGDA 2VULA 1PGL1 4KFTA 4YAIA 1ZC3A 1I33A 4DILA 1IZ8A 5JQGA 1O8PA 3GJ4A 4DV3B 3BWVA 1CUIA 2GK4A 3I1YA 2WZCA 3HP4A 4W8HA 1JTEA 4ISCA 3EOZA 4ZS3A 1NQDA 2DR0A 1IEXA 2DFKB 3RS2A 4QHOA 1XQNA 3HDTA 4GZ5A 3LA6A 1J25A 4DLNA 3ZMNA 2Q7OE 4G86A 3BWBA 1H2WA 2X0IA 1RD4A 4O4IA 4DQUA 4ZVPA 4OLLA 3RUCA 5CCXA 4M0CA 5FPTA 3EY4A 3UWKA 2M6KA 3VH4A 721PA 2K7FA 3L8CA 1WBJB 2VAMA 3G68A 2ZSEA 1X33A 1I01A 3I97A 1KI3A 3WZ2A 4K46A 2AQKA 3AUYA 1Y9GA 3QWHA 4BNDB 3AETA 5CH3A 2BSAA 5HE9A 3EBRA 3W6UA 4M9SA 4JCCA 3O8NA 1TD1A 1AKUA 3U78A 2X86A 2F00A 5KYYB 2OO5C 1QEXA 3PMEA 3H9AA 4P7JA 1EEHA 2WJPA 3ROTA 3IB3A 5BQFA 5AFSA 1YAJA 2JDMA 5DSTA 4D56A 4I55A 4IBOA 9LDTA 1SCDA 5HA5A 4F97A 3MDPA 1CERA 1XEAA 5LWHA 2YBKA 4ZYVA 5A3VA 5C1PA 2C5HA 1SBHA 3H0EA 4EUSA 2OD7A 2OAP1 3OEHA 4WDRA 2Z4FA 1HR0B 2YS7A 3TE7A 3AF5A 1IRXA 2REQA 3FSEA 4QX8A 1C3JA 4TWAA 4PBTA 4QPGB 1H65A 3QD6A 1PZFA 3GP5A 2UYGA 1PJTA 4GRAA 4PQGA 2J1UA 3FGNA 3AUKA 2VJCA 1ACCA 4F38A 2QQMA 1MJNA 1NN3A 1W59A 3ZKWB 2DPHA 3UIEA 5KINB 1FP6A 1QS0A 1UKEA 4TYNA 2E1RA 3OTGA 2FPXA 4IMJB 4K9OA 3UGGA 3NLLA 3P9PA 4YW3A 2WT4A 3S2FA 2OPWA 3OWHA 4FYYA 3DFZA 4KQKA 2GJ4A 1XMPA 4O63O 4UFIA 1BX1A 2FEPA 2JE9A 5C7IO 2Q5QA 2GEKA 4OYHA 3V55A 1H2BA 3G2HA 2IF2A 5L6MB 4XUPA 1WL8A 4MI1A 2PSSA 1O97D 3L9XA 1QP4A 2Y9PB 5CFCA 5IM4F 5LBEA 2H06A 4WASA 3T1HB 3WNXA 4M4RA 3RS4A 2GM4A 2XTZA 5K0LA 2RB5A 3V0BB 1VJTA 5E8JA 4D4IA 1TZ2A 4ZJPA 1X1TA 1NVAA 1N78A 3O7OA 3FCEA 3IBYA 4D44A 4P4SB 2CHQA 4XJ8A 3OOEA 3H0KA 1YNOA 1QH1A 4XIYA 3ESQA 2IE0A 1JMVA 3VBHA 1UIJA 4RA6B 3OGJA 3NEJA 2ATEA 1NLZA 3WF1A 1JIUA 2CGPA 3ISJA 4C2UA 1M34A 1D07A 4K6CA 2VTVA 2CNKA 4D3ZA 2X05A 3NT5A 3QLVA 1GZCA 1E6MA 2W5FA 1QJU3 4O4LB 3IDSA 5KJFA 3BPSA 3VZLA 2P67A 3C3YA 3ME5A 3VO9A 4M49A 3G8BA 4AAPA 1G5PA 4HDRB 1JI6A 1XNRB 2ZETA 3TEWA 2GCPA 3WV4A 3MBKA 2EIDA 3PJYA 5C8CB 4LBOA 1MVNA 2ORVA 4CF6A 3G7NA 2C5BA 4DIMA 4NR1A 4MUHA 2EW1A 5L3SA 2RS52 2JGIA 1NBAA 3CLHA 2BOJA 2OO7A 5JOXA 1U2DC 1EPUA 1N2SA 4MWOA 2JXAA 3PPYA 5ELMA 1RL3A 3O8QA 5FUYA 1OHFA 5B7QA 3PQ7A 4IJ5A 1WB6A 4MS4B 1CJPA 4BMSA 4LX8A 3TLEA 1J8MF 3BREA 5GONA 1M83A 4NCIA 1R083 3NHZA 1O5TA 4H7MA 2BRUC 4HI0E 2PA3A 3VBCA 4TS4A 2AHRA 3RC1A 4TMFA 3TL3A 1Y98A 4OU4A 4KWTA 4W8GA 5BRNA 4H77A 3OEED 5K0TA 3KAQA 3MF9A 1K88A 2HWC2 1KY5A 5BSTA 3CJRA 2W1SA 2F9FA 1ND2A 2BLLA 1PIV2 1B2RA 1RI4A 3HO6A 2X0JA 3BAFA 1P44A 3LBAA 3W5IA 1UBOS 2VNVA 2P62A 4RETA 1IWPB 1ARZA 4XFAA 1UMZA 4JAVC 2Y3IA 1HM5A 3Q8LA 5JJ5A 3IVGA 1Q91A 4D7AA 2RHDA 4NIAA 4YAGA 1EP9A 1E7YA 1YQDA 2NUBA 1Q22A 4D0GA 4BVEA 4FOWA 3DXZA 2QLNA 3KUKA 1YS1X 2A3XA 5AM2A 4RHUA 4KMOA 3OQ6A 1WY5A 3RSQA 2PHDA 1FFXA 2P2ZA 2V3VA 1HRV3 4QU0A 2DFTA 4HX9A 1AR91 4I09A 1XAIA 1WPXA 2JBAA 2OAQ1 1K45A 2RAFA 3UJAA 1KDZA 3SS9X 1DGWA 2JKZA 4KODA 4OQ8A 2YWRA 2AVNA 3DDOA 3OZIA 4YW1A 1SO8A 4RTJA 1WZCA 3WGVA 4RA9A 3R4CA 2IOFA 2MEV2 2QEQA 3UJNA 3C74A 1D1SA 5GZDA 1WDWB 1W93A 3UTDA 3KLNA 4ZEMA 4XA8A 5JO9A 2BGIA 5B37A 3EO6A 2GXSA 2Q0HA 5DIZA 3PYLA 2GKGA 2FQYA 1DJLA 4P9YA 4G3YC 4X1KA 2GMPA 2ORWA 2FEWB 4G5YA 3VISA 1NXQA 3RYRA 1A2KC 1AQUA 3AVWA 3ACCA 3OE5A 4LNUB 4NHMA 3IP6A 2JEYA 3G13A 1WW6A 3L1UA 3R7SA 3AESA 3L6UA 1C3EA 1Y89A 1SELA 4GWLA 4BLSA 4BWYA 4BM8A 1HGXA 1NAEA 1A72A 1A9SA 3RS5A 1HH4A 1BQ4A 4UVDA 2VJMB 1Z35A 5KREA 4L7QA 1EFLA 3IO5A 1VMAA 2XE7A 3C15C 1JHOA 5JDIC 4EYQA 3WB2A 2C88A 1DKMA 4G07A 5D21A 5I7EA 2R11A 5AI4A 1RC6A 5I0DA 1K4KA 4E8DA 4B7AA 1XKTA 3F3SA 1LW7A 4R3NA 3OECA 1V6JA 1EG7A 1BHSA 5E38A 1JDPA 2H4HA 4AKHA 3H3XA 1Y3IA 5LLSA 4ISBA 5I8TA 1C9DB 1HURA 3MOGA 4OUDA 3TI9A 2PKXA 5AVOA 1JJAA 3LXUX 1U8TA 4JASB 5EP2A 4LE3A 4DT1A 4E15A 3LUJA 1LNQA 4NVRA 1LBHA 4F3RA 2ZRHA 4LBNA 1F5FA 4BGEA 4WM7A 1ND3A 4WBBA 5FADA 3AHFA 4HG6B 2P5BA 2XB9A 1CLUA 4Y2SA 3WLNA 1J2TA 1K68A 1UYZA 2C5GA 2A1UA 2X6RA 4KQ2A 2ZIZA 3NALA 2P9JA 1Y4UA 2SCUB 5IPFA 2OBYA 3WG2A 4B3IA 1QTNA 2XOKA 2NPFA 4AN1A 1DBWA 3TQQA 3K05A 2ST1A 3A3OA 5B1EA 1Z6TA 1V4BA 2E4UA 5F3WB 4CI9A 1L7EA 3R7AA 2NU8B 2G71A 2QSJA 4YRNA 2ZUBA 3WW1A 4P92A 3U3MA 1WUYA 4HETA 2ZIXA 3THXB 1PLJA 5G04L 2F8SA 1RXGA 2IXLA 1JYWA 2XCQA 4ZREA 1IXZA 3H3JA 3RPEA 1E9DA 5A1FA 1SLBA 1R1ZA 5DGTA 4D3WA 2YNMC 1WE2A 3A2NA 4J6GA 5CA0B 3LSEA 4ZZ3A 4A6XA 4Q9AA 1JYIA 5M04A 2ENUA 1CPMA 1KNQA 4A2QA 2XQJA 2PWPA 4TQGA 2J3DA 1ZGAA 2EIGA 1PR4A 3D0RA 2YW2A 2J22A 2W6QA 2R073 1DAEA 1VGVA 2JAPA 2XDWA 4AMUA 5BV6A 1TYCA 2DPGA 2DCMA 4CCYB 1J20A 2COUA 3VZMA 4C1WA 5FNVA 5EIXA 1QGUB 3KYCB 4NOJA 1PX4A 1Y7IA 3GARA 3R0RA 2Q27A 3OQ1A 5EJZB 2D8AA 4M3CA 3HCNA 4RZSA 4MVJM 5AK5A 1SCKA 3M7AA 4E6PA 4C4SA 1GSLA 1BK0A 2ZS7A 3JATB 1BX0A 2QXYA 4NYJQ 4D0LB 4MUGA 5JJCA 4FDLA 3LC7O 2Z6UA 1MQ8B 2FSVA 1GGKA 5P8WA 4YVWB 1UDRA 3A4TA 5BT9A 3QFCA 2AQIA 3PEVA 5FPVA 1O9HA 3WNPA 1DKUA 5TE9A 2H4YA 2I67A 2GARA 3THRA 1YK0A 3VDBA 4R1TA 1TM5E 1P2BA 2ADOA 2O2GA 5LZ5A 3SYNA 2XWSA 1S1MA 8OHMA 1UQTA 5HCUA 2ZYIA 2WK1A 1SKAA 4DLZA 4KEAA 1GZWB 3SH5A 5LA1A 4OOEA 1MAUA 4BS9A 1L5LA 2BFBA 4KIGA 3HYLA 4RNCA 3SC4A 4ARCA 3OTOB 4L4XA 1GGHA 3MPPG 1L5YA 3PD0A 1I7DA 2H1FA 2IELA 1LZKA 2VO5A 1OFUA 3FCSB 3TOXA 4Q4V2 1RXIA 2DU1A 4AQ2A 3EVDA 4RS5A 3GP3A 3LXXA 3IOEA 1RHI2 1ZBA2 2X2OA 4KWUA 4PSUA 1NN5A 1DGLA 5HKKA 5LBIA 3HNPA 3PHHA 3ZYHA 3IMNA 2JLAA 3VC2A 2G6BA 2RHBA 1ZNPA 4MKFA 5DRYA 1SPBS 4H2AA 2WTUA 4BP8A 4PNPA 4EARA 2HQRA 1C0PA 1ZP6A 3EGIA 5IVPA 4O9EA 4DQKA 3F5SA 2YFQA 2F3QA 3VV2A 1RPZA 2WT0A 5KTTA 3O1UA 1CESA 3SP1A 1BVHA 5L36A 3EGDA 1J39A 1MJHA 2PZAA 2EJCA 2Y1KA 3LAWA 3TOCA 3H3LA 3NBXX 1IWOA 1T91A 4HNGA 3GNEA 3BJIC 2E89A 4G4IA 3Q7EA 2FN9A 1NIPA 5K0EA 2YJ5A 4I1VA 3P2YA 1HNXB 2G1AA 5DNUA 1AS0A 3GD7A 1AR62 4X8MA 2V4MA 3FOCA 5U4QA 3AHCA 5ALDA 2VBCA 3R5TA 4N9HA 4DOMA 2ZXUA 2NADA 3CRRA 2C9MA 3N0WA 5JAPA 5AKXA 2H1RA 4J0HA 5LNK6 3VYTB 2ZGOA 3ZYIB 1CY1A 1UAAA 5ANQA 4D3XA 4JJ4A 2O59A 4NCAA 2ZMKA 4HMOA 4BKPA 2C96A 5TVGA 3DXTA 1W9FA 3PFFA 3MWKA 3X2FA 1D03A 3E27A 1KFCB 2NAPA 1IE3A 2WJAA 1SUFA 1B8NA 3S5UA 4IDZA 3MJVA 4YP1A 4BVAA 3WYDA 5FIXA 1AN0A 1BHGA 4MI3A 4O5OA 1W46A 6AT1A 4RWZA 2TYSB 4UM5A 5KYXA 2Y64A 1YS2X 3M4NA 1YZVA 3QWBA 1YZFA 1VB3A 4DFDA 1Q2XA 4W5HA 4RVHA 2HGSA 3O3NB 4F71A 1O3YA 3K0EA 4HB3A 4Y24A 1PZ9A 4G37A 4I19A 3S6PA 3QEJA 3ETDA 3QYAA 3H1TA 2XCTB 5IM4A 1T0PA 5AW9A 3T34A 2XQKA 1M2FA 3FYUA 3MS4A 5JSFA 2A6YA 1DEAA 1NP3A 4AZVA 1QFZA 3GVPA 3CZJA 5JHGB 1G19A 4HY3A 1N2JA 1KQNA 4MV9A 1OUSA 4KR7A 1S8OA 5KXEA 2DXIA 2OP0A 5MN4A 2NU6A 4V02A 3ZE1B 3CB4A 5JNWA 1YA6A 2RAUA 1I2BA 1JZ6A 5JZVA 4MR7B 2R60A 2NSJA 3J26N 3ABRB 4QU9A 1PZMA 1PR1A 3HB1A 5A7WA 4HDQB 3NP9A 1IPSA 5F98A 1Z2PX 1OASA 3HR8A 4PAGA 4I4LA 4Y1EA 3SBEA 1UEJA 2ECFA 2ET7A 4LBKA 1S7GA 1M67A 5JG7A 5LL6P 3PK0A 4N6NA 2I6SA 1MVEA 2X42A 4JLSA 3E1SA 3F6CA 3EARA 6ABPA 2AF3C 2XPJA 2RM22 8MHTA 1PD0A 4Z4HA 4Y20B 3E35A 1N7JA 2BIFA 2GM3A 3VBRB 2JA2A 3PKZA 1F1JA 3A6PC 3ACBA 4RY2A 2XA1A 1UBKS 2GP3A 1BGVA 1BSVA 1D1QA 3Q7QA 1V2GA 5J5CA 3P9KA 4BNFA 2AOUA 3AP4A 3JQAA 3AOGA 1GTL1 3UJQA 3ZV6A 4OGGA 1UZ0A 5K3AA 4MVJI 1M9NA 2P4UA 1ZRIA 4A27A 2EBUA 1VIWB 2LBPA 4OJQA 4IXWA 2UZIR 1Z15A 1ENQA 1JNXX 1J2JA 3E81A 5IWCA 2CNBA 4RDCA 2D3PA 2QQ0A 5BUSA 2X10A 4LGVA 3WOHA 1RQNA 2JB9A 2HBTA 1B74A 5JAUA 1QJFA 5G1PA 1ZR2A 5EA2A 1H2AS 2GKOA 1R3DA 1EGQA 1YB5A 2C5LA 4BQFA 5FCCA 1IHXA 3UZUA 4F3KA 3OESA 3SVZA 2I6XA 3HYSA 1HXS1 1ZN8A 4PGGA 3RFXA 2XIJA 2E26A 4DUGA 3NM4A 3H7JA 2K2QB 1JT2A 1L8QA 4ITCA 3CCBA 1ZBDA 4MDEA 3RI8A 2UVQA 4N43B 4PBSA 4I01A 5FY4A 3T5AA 3CNNA 1UY3A 2EF0A 5CKMA 2PTHA 5KTNA 1DKNA 2BW0A 1ZIDA 3D8TA 4QOFA 5JTUA 2O3UA 2IKQA 3WFIA 3OYWA 4X3OA 1W90A 2IYTA 2HEVF 3N28A 4BMXA 1ESNA 1NW9B 2PS9A 3U16A 2EJBA 5CB4F 3AYEA 4FPLA 3MUY1 2VHZA 3G8YA 4OYLA 3WXBA 3WYCA 2B4QA 2W6NA 2H7CA 2JD4A 1ZWKA 3UV7A 2H9IA 5F1YA 3BGAA 4BV2A 4XDOA 1GPLA 1RUH3 2AB0A 1BOOA 5ICCA 4CCEA 4WCVA 5HCNA 3CNAA 3IAM6 1J24A 2QQFA 4QVGA 4A8TA 2TEPA 5KJ1A 2G1PA 3OGSA 1NVKA 1NQ5A 4V0RA 4EROA 2BY4A 3AW8A 3FOEC 3L5OA 1Z2EA 2AX4A 3K9LA 1GL7A 2R4TA 4BATA 4KH0A 1CAXA 5FDBA 1XD2B 1WHTA 3BB4A 4FILA 2V9PA 1ULTA 2Z08A 5DYYA 1W39A 5SZKB 4KOAA 1WVMA 2UY9A 2FZ5A 2BH9A 5FTTC 4OB8A 4IGOA 2EFCB 1GXSA 1X7XA 4CMIB 5A6SA 5D01A 2W4QA 3R0ZA 2C31A 2WPDA 4EHBA 4DCJA 2NMOA 3ZYZA 2R32A 1PX0A 1Y42X 1PMJX 2VMDA 1C3OB 3WJ1A 2PRKA 3RVDA 4KG7A 3POGA 2I8AA 3IMFA 1LDYA 2RGCA 3B70A 1P7ZA 3LGXA 1AU9A 3CS3A 3KS9A 5CD1A 5E0OA 3T7RA 4J9VA 3SOZA 1MS1A 2HBUA 1TA0A 3R3ZA 4MRRA 3ZLJA 5KR7A 2A3WA 4HH4A 2VQ0A 3HEMA 3V1MA 4HQKA 2I4LA 5A6QA 3HU3A 4DFSA 4IOMA 2YWHA 2JCYA 2QTRA 4QG3A 1C9EA 1VI5A 1YFJA 1EGVB 4OM7A 1TX4B 2UWBA 3K4PA 3EFOA 2O7NA 2XG3A 2Z83A 5I3ZA 3C45A 4JTOA 1CJBA 5CVCA 4ZQGA 4OQEA 1QSGA 3FPFA 3BD8A 5GOZA 3VFDA 4PBRA 4CCNA 1A5TA 1XJWA 1FSPA 1VRCA 5B6JA 2J1RA 4MRNA 4AZ3B 3TRJA 3SCFA 2C3YA 4C43A 5JRZA 3SZ3A 4Q27A 2D54A 1WA4A 3RSCA 1EJBA 2ZI6A 1SQ0A 3HZHA 4CMCA 3SQWA 1LQUA 3LFIA 1BLZA 1RQGA 3PA8A 4DIQA 1EKXA 4R6XA 4BMNA 3AOEC 2W2KA 3O91A 5LK5A 5KJCA 1PGPA 3SIWA 1EVZA 3NPAA 1GNYA 2X6QA 3GH3A 5EPEA 1PO11 1YZUA 1Y9QA 3T7JA 4Z9FA 3E18A 4AJLA 3VNAA 5DDIP 3KQVA 1DC4A 4W9MC 2BGMA 4YM0A 1KSJA 3BXFA 4YI3A 5IYZB 2CKMA 1H05A 1Q14A 2VZQA 4JGZB 2YFZA 4DXTA 5EFUA 1SCRA 4WRRA 1WZNA 3S29A 4LQCA 4R7TA 1T2FA 2UUPA 3PNSA 1XTIA 2CL7X 1E3SA 5CFQA 4CDWA 4XUNA 3KKEA 5FB3A 4HNVA 3GZAA 4PPNA 2FN7A 4DSAA 4DZTA 1QK3A 2ODEA 3C8ZA 2ID9A 2HO4A 3E1KA 1JHMA 3V7YA 4QREA 4KLNA 4M8IA 1OLXA 1KH3A 1TVKB 3CLSD 4DRVA 3VDDA 3HFJA 2HCBA 2X5OA 4AZZA 2XADA 4LZPA 5C1DA 2UYOA 3RU3A 3DKVA 2XNDA 2VPWA 3S7TA 1IBCA 2WF5A 1CR1A 4GP7A 3H87A 3WINE 4EUNA 4LA3A 3TLGB 4LRXA 3K9HA 4G84A 2WNVA 1DKRA 5TT1A 4NPRA 1Y3BE 3SJAA 1HDKA 2YOHA 2QP9X 3CNQS 4QDZA 4H7LA 1SBNE 2ABWA 3GPDG 2DQZA 4GYWA 2R7NA 1ZRSA 1SB9A 2EYUA 2HDNB 1S2OA 4KGDA 1P2DA 4MJ3A 2LRPA 2RJNA 4IIBA 2JH3A 3TAHA 1QHSA 2J08A 3KD2A 2DFPA 4RMJA 3OM1A 1USUA 1JJVA 5IDWA 5ALLA 1JF8A 4BWVA 4XYXA 1G21A 5F2WA 2VT7A 3NC1C 2NU9B 2GD6A 4FCWA 1JH5A 1CZOA 2XMRA 3NAPA 1HW5A 1QGED 4WXHA 3RWMB 4MQLA 3I05A 1KO8A 4MIEA 4QQRA 5KQPA 3HSKA 2ZTNA 1K5DA 3DXUA 4K8FA 1X42A 4RTPA 2CDRA 5C34B 3OCZA 1W6UA 2B7YA 3LVBA 4BZWA 3WF4A 2OORA 4J7CA 4KWKA 3ER9A 2RIRA 4NMWA 3DDWA 4ZPXA 5EE3A 3S7EA 2NVWA 1V0AA 1DDIA 3WLJA 4E8CA 1QTQA 3NV1A 1J7JA 5T5LA 1BXRB 1LOFC 3DE7X 6PFKA 1QGAA 1AR73 1QDUA 4JX8A 4UUNA 2BBAA 3B5JA 3QI7A 2Q5CA 1NVVR 2DERA 3BWDD 4KGXA 3GBPA 4UM9B 1G4AE 1WNFA 3QPWA 1H85A 2QBYB 2CAVA 5JNVA 4AJIA 4N9IA 3T06B 2AK3A 4KFUA 4LI3X 1Z7S2 4JDNA 1CRZA 3E9EA 3K6SA 4E51A 4L4RA 1M1NB 5FZIA 3OJCA 1FUKA 2QAGB 2VK8A 1A7JA 3RRJA 1F06A 5FUBA 3PXUA 3H5OA 2D00A 1T36B 1F51E 5K0BA 4G0UA 3R75A 4BRWA 3PXEA 4HNUA 3JQBA 1E5HA 2A70A 3D5OA 3AKSA 5IBPA 4PDWB 3RVQA 1RVF2 3KJQA 1AJOA 3EXG1 1HT3A 2YWEA 1A0OA 4KN8A 3KKQA 4P34A 2DF7A 4QPGC 4B75A 3LDUA 4FDUA 4HVTA 1KIFA 4U7DA 2CMFA 2MT9A 4MGSA 4EPRA 3O2SB 5EKTA 2GRAA 1XU9A 3J7TA 1N8KA 2HNBA 5JCOA 3D8NA 3NDJA 5JU6A 2ZYWX 3PUVA 1F2TB 5CU7A 3IMCA 1PR2A 1ZC4A 2JPDA 3FHTA 3OBAA 2O9JA 4QLOA 1LKZA 1DP0A 2FSSA 3GLSA 3VR2D 2PLRA 5D3QA 2QTGA 5DX1A 5DYTA 2VH1A 3FHQA 2FFQA 3V8PA 3W9SA 1U04A 1E5LA 1USGA 1EUDA 2HWF1 3HSYA 3OG2A 1QXRA 4ITVA 4DC9A 4YACA 1BBT3 3TLXA 3F78A 4Z54A 1H8VA 1EWVA 1IQDC 4EO9A 3HY3A 4MS3B 3N7MA 3UJ9A 2Z2KA 4D2IA 3OHMA 1RW4A 2EFYA 5KSYA 1BDBA 3D3WB 4WLOA 1UMIA 3T9EA 2AFHA 3KQLA 1DUIA 2X7JA 3S1SA 3AZPA 4JEHA 2IXBA 2X4GA 5FP0A 4FDAA 2FOXA 3QZUA 4XFJA 5H7XA 2RD2A 3A4NA 4N5DA 4TQ9A 3PIDA 2GJ8A 1C81A 1BCXA 2ARCA 2GCNA 4CIBA 1W9YA 2DFBA 1N2IA 5A4DA 4XM2A 1A2BA 5TR9A 4RM2A 4GR9A 3SZUA 2QY9A 2RBEA 4YYZA 1WO8A 1Z2OX 4XUQA 2A88A 3M1LA 3UNPA 3NRUA 3NGLA 4JXZA 2PKEA 1E66A 2C6SA 5C8VA 1YU6A 2AG1A 3DTVA 3PJRA 3ON7A 1K92A 3UESA 3MN1A 1KEXA 2C7BA 1E2IA 1W35A 1POXA 1RABA 2GHIA 5C8CC 5SY6A 2VH5R 2A71A 3SEPA 1KQFA 1K6JA 3I23A 4F96A 3U0ZA 4UW3A 5DN6A 1RXYA 3RYCA 3R0JA 3TQHA 3OOXA 3VOBA 4ZO6A 2DHQA 3WLRA 1L4YA 3DO6A 4MITA 3OZVA 5GM0A 5FOWA 1VI6A 2LALA 1ZU4A 2HRDA 3DMNA 5REQB 3WGUA 4ETWA 1UKYA 4EW3A 3Q8AA 1EK5A 2QMZA 2QD3A 2ES4A 3GRAA 1TXGA 1QK5A 2BBSA 4TTTS 4HDNB 1U94A 1CRWG 1GADO 2BGGA 3GYBA 3UGKA 2YU2A 1RYDA 4GZLA 5C4IA 2VJOA 1NRWA 4L22A 4ZQFA 1GL6A 3R7NA 2VTKA 2CVHA 4C0LA 4CLOA 4M9CA 4HPKB 3MK31 3TRFA 4LOAA 2O8NA 1Z4PX 4FGJA 2JHAA 2ZCJA 1BC5A 5JVDB 1W28A 4HN0A 3VTZA 4P08A 5CIRA 4OMUA 2HQSA 1U3GA 5CB4A 1WUTA 7MDHA 4IJMA 4EG4A 1SKBA 1GT6A 5D5PA 2A0XA 5FZHA 2NYYA 3UB4A 2E9QA 3FHIB 3I6QA 2HA4A 4B7XA 1XTTA 1U80A 4BX3A 1KGYA 4E21A 4JKMA 2R6AA 1W6OB 1CRPA 1NNUA 1NV9A 1SWVA 1FK8A 5KYVA 4HWGA 1HV8A 1XZPA 5IKPA 4UEWA 1OU0A 3IESA 1IS6A 1GZUA 3RDIA 1D6JA 1NJ5A 4IGQA 4XIFA 4XUTA 4ZJYA 3D3EA 3T0IA 2IZ7A 4ZXPA 4JYPA 5C8WA 4BBAA 4ZONA 5GM2A 1ZGHA 1LNSA 1W47A 3OQHA 3MAJA 1ZGCA 1B3BA 1XLUA 3JQGB 1XQWA 3ZLTA 1LBIA 3CLPA 2HSEA 3TR5A 4Y1GA 1NPDA 3L7IA 5ARDA 3OU2A 1A8UA 4DA8A 2DZDA 5JNSA 3CZPA 1ZGBA 3GCDA 1T26A 1OWOA 2NLOA 5D8AB 5HIKA 4XSGA 4Y5SA 2LW8A 4D5GA 3N9OA 4OXRA 3LECA 1K27A 4M1QA 3OFKA 3WVNA 1YQWA 1SRQA 3LA3A 4WUTA 1VP6A 3A4UA 2XWPA 5DBGA 4EB6B 1QJU1 1QCYA 4JXJA 2XB6A 2B6NA 4MYRA 4RJJA 3WNZA 5I7FA 3OH8A 1IEQA 1RUJ2 1TLFA 2C1ZA 1ALYA 4S04A 5EP1A 4CWAA 5LU8A 2Y0BA 4EN9B 3EEIA 2WZPP 4BVHA 1NVTA 3TZEA 2QOEA 5J4KA 2R47A 5KAMA 1R0SA 3AL0C 4YUYA 5BN1A 1R5NA 2XRYA 4ZDKA 1RUF3 1YBVA 2ONYA 1N3BA 1NM5A 4WERA 4FQZA 3H5VA 1ZDMA 3R3UA 5TARA 1GUYA 2CJWA 4F11A 2CV0A 3DF9A 1VJ0A 1ML3A 3K7EA 4B3DA 4M0EA 1EPWA 3NZEA 4HVCA 4C4PA 3KJEA 1R081 2Q4TA 4M3NA 4L51A 4CUZA 2VHCA 1II8A 4XDHA 3GWGA 4DTIA 5JBNA 1NAHA 1E6EA 2CZGA 2GS9A 3IAQA 4A45A 2B61A 2FKNA 2B35A 1QHIA 1SN7A 4FWTA 2PS0A 1G8YA 3H4VA 5C9AA 4FBLA 5JCJD 4XQ9A 2I4MA