4K40A

Peptidoglycan o-acetylesterase in action, 0 min
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
349
structure length
349
Chain Sequence
LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis lnp21362
molecule tags Hydrolase
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
total genus 115
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k40A02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k40A01
4K7JA 2Q0SA 3SLRA 5JD3A 4HYQA 4JHLA 4K3UA 1WABA 3DT8A 2HSJA 4RW0A 4JJ4A 2WABA 3KVNA 5B5SA 1IVNA 3DT9A 3U37A 1ESDA 1V2GA 2APJA 1PP4A 1ZMBA 4XVHA 1DEOA 4JGGA 1J00A 3DC7A 4JKOA 5A4AA 4LHSA 1Z8HA 2VPTA 4DEVA 1BWQA 4M8KA 4PPYA 3P94A 4Q7QA 2WAAA 3DCIA 1K7CA 2Q0QA 4OAPA 3C1UA 5HOEA 1DEXA 1YZFA 1VYHA 4H08A 1ESCA 2W9XA 4K40A 3HP4A 2O14A 3RJTA 4IYJA 2WAOA 1VJGA 4NRDA 5BN1A 1FXWA 4K9SA 1FXWF 1BWPA 4TX1A 3BZWA 1ES9A 5CD9A 4Q9AA 3W7VA 3DT6A 4RSHA 3PT5A 1ESEA 4S1PA 1BWRA 1U8UA 3MILA 3SKVA 4I8IA 4HF7A 4OAOA 4JJ6A 1JRLA
chains in the Genus database with same CATH superfamily
4HHEA 4WK0B 4AXOA 3I04M 1Y80A 4A9AA 2X4IA 1Z47A 3NRBA 1Q1AA 1QF9A 1X7ZB 5L9RA 5JS8A 4JL5A 1PSDA 3H9BA 4JIGA 2VJMA 1EVJA 5C5EA 1ZOOA 5HJ2A 4IR7A 1XA3A 3H2KA 1PO23 5CCDA 1KP3A 2XUAA 3TGWA 3BE4A 5HFAA 4UE2A 2V4MA 4M0MA 4BATA 1Z5PA 4M4PA 3AJ9A 1XZIA 4D3YA 3D2BA 4GL2A 1L5YA 2TMKA 5IM4A 5EJ4A 4UMVA 1CIYA 3OO0A 1CE8B 3O75A 2WIDA 1XRQA 3LBHA 1A7UA 4BNXA 2JJ1D 3MUEA 1M34E 3UWOA 3SE7A 2V45A 1UYZA 4IM7A 2PUHA 3PRJA 1ESEA 1X1QA 2R751 4KR3A 3N1UA 3R7DA 1EFCA 4IQGA 2FEAA 3B3JA 5JMTA 3WSWA 2BFEA 4IQFA 4B3GA 3WG4A 4RKRA 1XV5A 1F35A 5EIAA 3VNAA 3NV7A 3N28A 1RR6A 4XI9A 3NHPA 1B0ZA 4MIEA 3QUTA 3LDRA 4YJ3F 3ESBA 1BCRB 1SNYA 2HCBA 1GBGA 5HF9A 2WJYA 3ME2A 3ZDBA 2J4CA 4QBKA 3UYJA 3B8EA 1GN8A 1NJ5A 5CLGA 3VKFA 5IAEA 3NT5A 5G04L 1RMYA 1S3GA 3EWIA 5LNK6 1XIVA 3VNBA 3AI2A 1RWQA 3A4NA 2QUHA 4J4TA 1CZSA 4DJ5X 2MEV3 3BXZA 2XJ9A 2IPXA 2VOKA 3CA8A 2YGLA 1EE9A 2NTEA 1U0HC 4HRAA 3O1LA 3ROMA 3LQRA 4XHXA 3WE7A 3VR5H 1YGPA 2H63A 5HF8A 2ADFA 2LPMA 3QVJA 2DSTA 1OH4A 2FZ4A 1C1DB 5I7RA 4FN4A 2VJBA 3AHEA 1IC6A 2I1LA 4DZRA 2KW5A 4B71A 1U81A 3VBHB 2OV6A 3DULA 6AT1A 4IIHA 2VIIA 4O4JA 4K6FA 2OQIA 4L0QA 5C32A 4LXYA 4BB6A 2ID8A 1Z0FA 2WMOB 3N4MA 1O6CA 2Y71A 1L5GB 1RYHA 4E2XA 4XZUG 3K4DA 3H1AA 4YGYA 2Z04A 3QQPA 1OV4A 1S0EA 2DMRA 4C0WA 4RTMA 3WLHA 3QPWA 2D5CA 1D7OA 1TMF1 4AQSA 3GBFA 4AGGA 3PDQA 3LA2A 3T1HB 2GEJA 4DEVA 2CF5A 2FN7A 3LC0A 2CHGA 4EY7A 5F73A 2HWKA 2EFHB 3ZWBA 3TTVA 1AZWA 3NHMA 2ZRMA 1WBLA 3B52X 3HYSA 4LZPA 4BKMA 3BH7A 2OBXA 2XVZA 4U0JA 3WOGA 5GOZA 1GCGA 2EERA 5ALRA 3P26A 4I1UA 4IGIA 4U7FA 3OA0A 5CKQA 1C7EA 2CNBA 2PS9A 3TCKA 5KWJA 1V37A 3WNPA 2P3QA 2VMCA 4CNBA 1PDOA 1S2BA 4JI5B 3ZLIA 4LUMA 2WHXA 4MSUA 2C5AA 2B8WA 4G0NA 3U7GA 4MV4A 4G56A 2D6PA 2FKAA 3AX6A 3LA3A 3AEKA 4FBLA 4ENRA 5GONB 1DFQA 3H1YA 4RX1A 4W1RA 1ACCA 4NCBA 4I3PA 2FR8A 4S1TA 4WLFA 4EYOA 4RGQA 4DC1A 4WXYB 1XMSA 1E2NA 2PV0A 1MJNA 5CFDA 4J0JA 4B47A 2Z4TA 5CIYA 3PTYA 2VHJA 3ORSA 5I93A 1W49A 2VVEA 4HYEA 3IOMA 4KSCA 2X2OA 1EQUA 2I2SA 1DZIA 3T0BA 1YQCA 5IAGA 4FEAA 1EGVB 4KEAA 1U2PA 1CVIA 4BOYA 3STWA 5JSUA 3LZZA 2LDBA 4AEMA 4GWIA 3AF0A 4TKUA 3GGCA 3WYAA 4Y8VA 3K3PA 1IHMA 4BU0A 2FZWA 5DW0A 3OCCA 1GANA 4AE2A 1PTJA 4UOEA 2C4TA 3UUGA 4W82A 3E7XA 3U49A 2RAVA 1UP6A 1IN6A 5BW4A 1A9XA 4UUAA 1NDUA 2A57A 1XTBA 1OA3A 2VP3A 5FWXB 4O08A 4WKPA 3GLIB 1W2WB 1RZUA 1AX2A 4YRIA 2R6FA 4YMUA 2OWDA 5LBCA 5A5VA 2OT7A 1AF4A 4ZYVA 3MLLA 7AT1A 5FWYA 4BFVA 1L4BA 2JAWA 2SKEA 1XZBA 1ECLA 3RYCB 1XTIA 5IT4A 1XN4A 4LORA 3TLYA 4IHJB 5CVTA 3UMBA 3LU1A 2IXBA 4XUQA 4RK5A 1GZWB 2C5LA 4W7IA 4BIIA 2IV3A 2GRJA 5BW5A 5L6LB 4QPGA 4HD8A 3C7GA 4WM7C 1RXUA 2ATCA 4YT8A 1JZ3A 2GJ8A 3AMNA 3RFCA 1A50B 3A6DA 5D1HA 2WLTA 1VBMA 4RMHA 4YRPA 4NN0A 1KZHA 3LT0A 4TUYF 3U6BA 1DO0A 3OHMA 2HHJA 4FAHA 2PH5A 3IR7A 5JXGA 2JVKA 3SYMA 5KHKA 2CJFA 1T4GA 1E1DA 3MZ0A 4CDRA 3MJDA 4O33A 2CKDA 5EHXA 2QU7A 4R9VA 5JROA 3SBXA 2OECA 3GLIA 3I92A 3IRUA 4QXRA 4C6RA 2VF4X 3BTYA 4D42A 4HAVA 2H7YA 4YNIA 4RGGA 4XUOA 3DUFB 3DUIA 1ECJA 4Y1GA 1FYFA 1TYCA 4I0BA 1ZA7A 2FSVC 3RTEA 3AR4A 3ZPOA 3WNOA 4CP9A 3TIXB 3AUXA 5FMBA 4CLEA 2R62A 3PGXA 1C28A 4CTMA 1F4PA 1HYGA 1JMKC 3JQCA 1KFUL 1NKSA 2VHVA 5FZMA 3ZCXA 1SQ5A 3F4KA 1YDEA 1XVIA 3V6MA 1E7QA 1U9YA 4IO1A 3S5QA 4BE7B 4GWGA 2B20A 2OPKA 2CW5A 3Q6MA 1LPMA 4GYJA 1X1SA 3BRWA 4GKAA 3ZDYB 4YVFA 3LLSA 4KAXA 2W6IA 4JJ8A 3DMRA 1ADFA 3I30X 3T0GA 5HP4A 3J8F1 7MDHA 1BRMA 2XGSA 3VKVA 5EKXA 4ZOCA 1LJ7A 4GB31 4NPAA 4QKBA 2OB2A 3PC4A 2WF9A 4ZHQA 2CEKA 2JLXA 3K30A 1MA3A 3ZYCA 2W2QA 1C0PA 1CZVA 1XEXA 5BURA 3RYKA 3T1YB 4RPLA 1MW8X 4Q9NA 1YE8A 4R3UC 4DCUA 5A5EA 3LYLA 1XZCA 5B2FA 3QJYA 2XTAA 4EKYA 1NE2A 4BLUA 3NH6A 1NE4A 2HA6A 2QRZA 4UBMA 3EUAA 3GXOA 3LOPA 2ZRCA 1NA5A 1F1BA 5HUHA 2AYXA 2VK4A 2TEPA 2ZUEA 1HRV2 1PR1A 1O95A 5AC93 1DOAA 2Q28A 3L92A 3LCCA 2JI8A 1OFVA 5FUWA 2VSOA 2GC0A 2RAFA 2BDUA 3AMMA 4ALIA 4QMAA 1RUJ2 5K0CA 4Q9IA 5I51A 4XPZA 4EZIA 2QTTA 4CTEA 4ZJZA 1COWD 2WR8A 3AG5A 3PEYA 5IULC 1SHUX 3MPOA 4R1NA 1EK0A 7REQA 3K31A 3BDAA 4UFLA 1AUVA 3PJQA 4AFCA 4XJXA 2A6WA 2IV7A 4WQMA 4A36A 1LS6A 4BDTA 1QTIA 3AIOA 1OCEA 3C8XA 1PVOA 4ANFA 2WIKA 3RSCA 4BMBA 3HKEB 4REMA 4KYVA 3KQUA 5IKMA 5DMHA 3TL6A 2C2BA 3H6GA 4OQMA 3AETA 5C1OA 3PVOA 2EIDA 3PCRB 5FPUA 1PVXA 3IWZA 5LKAA 8ABPA 2BNOA 4E88A 4KH9A 2ZRPA 3MV11 2QJFA 1UJNA 3TBDA 2H0QA 5CR9A 4MWTA 4X61A 3GRRA 5K1ZA 1X8MA 4QXPA 1PR4A 2BF4A 2CJWA 3ORJA 1QUEA 1HY3A 2FRDC 3JTEA 3ONEA 3C7CB 4NBTA 3EIQA 2UY8A 5JADA 2P1BA 5K0FA 5E3IA 2JKZA 4YO8A 3GGJA 4Q4V2 2OP0A 1GPWB 2OILA 1N3LA 1A71A 2JICA 1Y7PA 5B1HA 3ISVA 5HDBB 1C1XB 1K9SA 2E1RA 1PGNA 4D9FA 1TJ3A 1XELA 3V1KA 1XBTA 2A0UA 2BU9A 3JR3A 5HCBA 2WT2A 3I6YA 4NBLA 4UAGA 1W05A 1DEAA 2Q3LA 3OM8A 2Q27A 3CLRC 4UFMA 5F9MA 2BFNA 2Y76A 4JTNA 1ENZA 2X9LA 2DHEA 4II3A 3ASYA 4MWDA 1SLLA 4MAFA 1Q7TA 4WJKB 1SA0A 1N0IA 1DJQA 4HYQA 4JHLA 2VTFA 3JWEA 1K6MA 1SVWA 3NC1C 3QKRB 1UL9A 3FI9A 3WQSB 4BBJA 1GUDA 3CEMA 1L1FA 4F97A 1DRVA 3IJ5A 1FTSA 3MXTA 2MSCB 5F7ZA 4YPVA 4NNPA 1A7AA 1C0LA 4NOMA 4DLXA 5HBRA 3ABIA 1ONBA 1HYQA 1OT3A 1YOVA 1RE1A 2GDJA 5J4KA 2HWWA 3M6IA 1ULFA 2FV8A 2IU3A 3DO5A 4OAPA 3A4UA 4QHZA 4PX2A 1POV1 2P9ZA 4QDTA 2DTYA 1U3TA 4CCWA 3OU2A 5K3EA 1TM2A 2QZ3A 3E5MA 2YS7A 1E6EA 4IF4A 4AJOA 2WSUA 1E7YA 1OXUA 1MQ8B 4LNUA 3E1GA 4KKVA 3OE5A 5D6NA 1FTWA 2WTNA 5K0UB 3NV9A 2OFXA 3C3KA 1E3SA 1QV7A 3FRHA 3H2HA 3ML1A 5CA6A 2PU5A 1E0AA 1BMFD 4K6OA 4FGWA 4IHJA 4DFDA 3EXUA 1MT0A 2WMNB 4RELA 4RO0A 3FJ1A 1PHRA 1ZGZA 3JU3A 4ASKA 2NTYC 1IN8A 2BMEA 3PGJA 3M5WA 4IY1A 3WF2A 4HG2A 1IAQA 1E3LA 1Q6YA 2GCOA 2I91A 4PTYA 2ODEA 4CUGA 1AUQA 1Q1NA 2AC7A 4PS1A 3U4QA 1EB9A 1L4NA 4FOPA 1OC2A 2VTKA 1D9ZA 4Q21A 1SDDB 3SCFA 4JI8B 1A9XB 3FIJA 4KHZA 4DLYA 1LX6A 3TLGA 1DJPA 1IBSA 2IVJA 2ZOEB 4PNHA 1ZIYA 4O9EA 1DQ2A 1QZTA 1DG9A 5LBBA 3LGXA 2HPZA 4A4DA 2YG0A 4EX6A 1HFJA 4DM3A 2VQ0A 3DL0A 1AKNA 2ZS7A 1W52X 1KS2A 4P4SB 1A1SA 4I1OA 4EA8A 2GZRA 3ACCA 2HB6A 2B4YA 1Q19A 1JFFB 3AHJA 3I2GA 2R2AA 4F11A 5BORA 1D2QA 3DV0B 4QKDA 4Q7MB 3RVHA 3UESA 2QTRA 3FWPA 4GOKA 4K86A 3N9NA 2AW3A 3EXFA 4BQXA 4A23A 5TT1A 1JQBA 1XYGA 4ZYYA 3B1XA 3I3QA 1UOFA 5AIAA 4IDZA 4W7SA 1SH7A 4BMXA 4TLFA 1BA3A 1N4DA 1WULS 4FUQA 4TZ6A 2MT9A 5AKIA 1P19A 5I9IA 4LJKA 2MU1A 4BMCA 5ALFA 3JATA 4UARA 1USVA 3JYLA 3JARA 1JUDA 3LC7O 1ICIA 4EHFA 3H1PA 4JFAA 1AXRA 5CG1A 4AY3A 4V1CA 1I5OA 4EHAA 4R9SA 5DHQA 1CUSA 2EA7A 3RWMB 1E2QA 1FE8A 3EXIA 1C0EA 3EXIB 1M2VB 2XKPA 3WLKX 2H1FA 3L1JA 1IHXA 3KB2A 3U09A 2LDXA 3PNMA 5KSWB 2AOUB 1GJRA 5KMGA 1Y5RA 3LCMA 1NT2A 3RIYA 4YP5A 4AEDC 2ZUDA 3JQ7A 1OPOA 1R1A3 3NR2A 1A2KC 2J31A 1W6OA 1VFPA 2TRSB 4D26A 3C15C 4RQTA 4JVNA 3SISA 4B3HA 1P74A 1JAYA 1CD3G 5FL7D 1EG2A 2OXBA 4PO3X 1O96B 1GXSB 2CV2A 2PGOA 4Q1BA 3PJFA 3PCTA 5J98B 4Q0UA 3BL6A 4R8SA 4PXSA 1PO21 3ZTYA 3AM1A 2Y68A 4LK3A 2EDCA 2QJVA 2SNIE 2ZBDA 1W29A 3TSZA 1V26A 2AVNA 4QX1A 4CCDA 4EZHA 1FSFA 3SC2B 1EWTA 2ZIUB 5T8KC 1VJCA 1VPTA 3OJLA 4BO7A 4DV7B 2VNGA 5JAHA 1P2GA 1GU7A 1ZA1A 4O4JB 4CMHA 3CF6E 2G1AA 3VPSA 1R8SA 5ALYA 2CFRA 1K6XA 1MO4A 4L73A 5CUQA 2Q45A 1L7AA 1BDBA 4NS4A 1ITZA 3QMVA 5TQ0B 3L06A 4XD7D 4YFVA 7ADHA 3IMFA 4JOBA 3UMYA 1GADO 1K5JA 1NONA 3VL8A 3U9TA 4Y9DA 2PSSA 5EZ5A 2RS33 3S2EA 1VCOA 2NQYA 2Y1KA 1T2UA 4WZ6A 1DV2A 4BX2A 3PURA 2FPOA 2OA2A 5GVSA 1RPNA 2HMSA 2PX3A 1KK2A 4NF2A 2BBWA 1MV5A 4YGEA 4ZC8A 2WVAA 3KB8A 5LMNB 3PRYA 1UF9A 1T9CA 2WO7A 4HQLA 4HTFA 1ZM4A 3V46A 4X7PA 1R6TA 1Q84A 3BE8A 3CX3A 1P29A 1TW2A 1HLCA 3IAQA 1CZHA 3S70A 1C9JA 3EWSA 3O47A 4I2OA 4BA6A 4BAZA 1C50A 1Z2EA 5J2UA 2GZDA 1MJ5A 1KJRA 5IAOA 1F8UA 4J03A 4EG8A 4C43A 3PJEA 3MT0A 1HE2A 5AFBA 4QWWA 1E63A 2XNJA 3WY9A 3HPQA 1I3LA 1XTJA 1M34B 1A3CA 5IW8A 1L7MA 2GOYA 5JDIA 4PTZA 2G0NA 4DDWA 1ZUWA 1L7PA 2Z57A 5DHSA 3C2UA 4KBGA 1XSEA 4UNRA 5DGDA 3TQCA 2DM6A 3HE3A 4OHPA 4Y2GA 3FKSA 1PZXA 1VLLA 1YVDA 4BWGA 2EXXA 5FKBA 1JR6A 2HL6A 3B78A 4NZMA 1NZCA 4NAHA 4FTWA 1DB3A 2A33A 1W47A 4KLNA 4NRPA 4TSFD 3A9UA 4XMAA 1R0LA 4FP3A 2AOWA 5KU1A 5EKDA 2FEPA 5K05A 3UHJA 5FLXA 2Y1LA 4CXXA 2RHDA 3VTKA 4C78A 1XFAA 2IYRA 4EJ2A 3NYRA 1T0HB 1HQCA 2GAJA 4QGHA 1BDHA 1ZN7A 1ZGBA 3DLCA 3KYDA 1RAFA 3K77A 1UFRA 3ICPA 3OCJA 4MEAA 5JY6A 5GV8A 2FDIA 3PC6A 4Y2YA 1ZREA 3K9FC 2NUTA 3WDTA 3CGWA 2PFWA 16PKA 3RS5A 4UKDA 1U2SA 2HJIA 4P93A 2ORVA 2IOQA 3OPXA 4DY5A 2BWCA 2RGUA 1XB2A 3BSWA 4XJVA 3X44A 4C4XA 3WNQA 4UVDA 3BWCA 2Q8PA 2O3RA 4ERNA 3AOEA 5SV8A 1QHIA 1V9SA 5HOQA 5ADWA 1I1NA 4X3PA 2H92A 5E9QA 2CLSA 3IP3A 4MKZA 4EKNB 1FPN3 3CVWA 4YUAA 1GKUB 5FD8A 2PVPA 2FK7A 5JSOA 2C99A 3DHYA 3EARA 3TTTA 4IV1A 2O0LA 2XMRA 1CRPA 3WNZA 4OFZA 2F00A 4CCAA 2OY0A 2D5LA 1AVTA 4UEOA 3NHYA 5JZBA 4BECA 2PL3A 4A3SA 4LS3A 5BMVA 1NOVA 1WA5A 2KWIA 1H2NA 3DGTA 1AU9A 5LQCA 1PX2A 4G24A 5FQ0B 3U3RA 4D41A 3BCUA 2FBEA 2G3YA 1UAIA 5IAXA 2ZKIA 4ZU6X 3RQ0A 5KHLB 1JH9A 1E2GA 1W36D 1EV12 5FLEX 3UENA 2OM6A 2ZS8A 3IMMA 1OU4A 3R3VA 4JYMA 4ETNA 1XKTA 4B6OA 3LUGA 5AVWA 4FGKA 1GFF2 4FYVA 1MXHA 1L1RA 3T4XA 3AY6A 4GULA 5CDYA 5JH7B 1ZH2A 1ZIOA 2YBEA 4XYGA 2ORWA 3AJ8A 4IVRA 1RBZA 3WRVA 3GBGA 2YB7A 4NVRA 3OT1A 5AVUA 2BTQA 3JD1A 1HB4A 4AG6A 3PJYA 5BQ3A 3C8ZA 1XYNA 4F2HA 2EXKA 2DVMA 3U7QA 5A4IS 2RG7A 4P7FA 4RD2A 1XTUA 1VPWA 4WPGA 4F6RB 2FFHA 1J3QA 1T6XA 3LKBA 2ILVA 1NCQA 3FUOA 3RZHA 3ITEA 4MRPA 3UBTA 1NRXA 5BOSA 3LE0A 1O95C 2WNSA 1H0SA 1K92A 4Z9BA 2R4TA 2WKWA 4YW5A 3DOFA 1FS4A 2W6JD 2YHBA 4PG8A 4W6QA 1L3JA 4DOUA 4CDUA 5IJAA 1C5KA 5MN4A 1X36A 3K5WA 2G1JA 3NTVA 5CD1A 2XB8A 3WLSA 4HB3A 3IMCA 4B7UA 2PJZA 2FDGA 2AD5A 2VYQA 4MWOA 4ENWA 1ECBA 4RVDA 2BONA 5ABJB 3ITNA 4P6VF 2ZJFA 4KN6A 3E82A 1LHOA 2E4AA 1PKEA 3OPYI 4IW3B 3ELBA 3P94A 1QNLA 2F8SA 4WZAA 5I0DA 4A6EA 4Y2QA 1JXAA 1UK9A 1KTVA 5BR8B 2X0JA 1FVOA 1G9BA 3V1TC 4UFHA 3KWLA 2XQFA 2J0QA 2YFHA 5AVSA 3LFTA 3V9PA 1N7GA 4MUXA 1BXGB 4MYHA 4QUIA 1UINA 1DKLA 5F4BA 1EPZA 2ZB3A 1B8UA 1RAHA 2UZ1B 3Q9UA 2B4KA 3UAZA 5J3JA 3HNPA 4LN1A 4OULA 4Z3KA 1CY1A 3HJUA 1NBOA 2KYRA 1BOOA 3NKVA 2BVBA 3FFBA 5EE1A 1OGYA 3ZS8A 4RDCA 3ZFGC 2DUJA 4JBYA 2XMSA 2C6SA 4CWAA 4B3SB 2RIPA 1N5RA 3AKQA 2OBFA 3FYCA 3FVWA 3H5NA 3KSRA 2X6QA 1HLPA 3RAJA 4CM5A 3PHHA 1S4MA 4GQIA 1SQGA 3NVMB 3GYBA 3TW6A 2ZGLA 1GL3A 2FX2A 1NXPA 3Q8KA 1NF8A 2I29A 3MWFA 1G5IA 3PEFA 3NAPA 1Y7BA 4JBWA 3O6VA 1BQPA 2J3HA 4J6EA 1KBQA 5KCMA 4R1OA 2P0EA 2R5FA 4LHZA 4J0DA 4BWVA 4JX0A 3HG7A 4XJUA 2YWGA 1LEMA 4FLMA 3WL4A 3WLJA 4UHHA 4M3CB 2XWSA 4HAXA 4J07A 2ZAIA 3D0QA 2A5LA 3OTFA 1W2TA 4HH0A 1V8OA 3ACHA 2FVYA 1GGKA 3GGLA 5CFPA 5F1YA 3HNRA 1LTQA 4DTCA 5T4HA 4J3FA 4FDUA 1QV6A 2B39A 1CUHA 4OLBA 5T3NA 4YJGB 1LBQA 3WBBA 1SPBS 4WKNA 5E7MA 1WZXA 3H0CA 3WNMA 5DN9A 4GQBA 4AP9A 4N7IA 1HKUA 4CF7A 1ENYA 2O8BB 3OZDA 4ZU1X 4PICA 1H1IA 4XFBA 3QOFA 1ZSVA 1CPYA 4A1OA 5EWMB 1KJYA 1UBRS 3FLAA 5JJLA 4R9DA 3F9IA 1NQOA 2HWC2 4AKHA 2R073 5L9VA 4CF3A 3WGGA 5CVJA 3A22A 2ZT6A 3TIIA 2GU9A 2AC4A 5LBFA 5FFOC 4DXDA 4QJ3A 5HNKA 3A0RB 5L19A 4M0CA 3M0EA 1OWMA 3H8UA 4UULA 4OFWA 2NYYA 4AVAA 2CK3D 1ULSA 3WL6A 4U2KA 2FX3A 3FNQA 5FRAA 4GL4A 4RJTA 1LKNA 1HK7A 3IDOA 3S6JA 1EFHA 1I0LA 1TOAA 2KI5A 3QGMA 3BSSA 1J23A 2GPJA 2B2NA 2VYVD 4HGQA 2FZ5A 2HREA 1WUKS 3OUTA 1S8FA 4ITCA 2XOXA 2GSWA 1EK2A 2YS6A 4EB8A 1NL3A 5IKEA 3NAPB 4ZV9A 4V3BA 1ZH8A 1UUFA 2XDVA 5EQUA 4NCNA 4XSHA 4HTFB 3USCS 4D8TA 3I9FA 5IFTA 2R7AA 2VP6A 1FPMA 3AJEA 3PE6A 2GUGA 3L6UA 1QS0A 4XQ9A 3GCZA 4JEUA 1ZOLA 1RC6A 3NFYA 3GZTB 1NZJA 3OJEA 1Z0AA 3VZPA 2B7CA 2FPSA 4MB0A 3V7YA 2XD4A 4LRYA 4KRGA 5JNWA 3CNOA 3K2BA 2D6FA 3KLOA 1OYYA 1TC2A 1DVRA 4AC9A 1JHJA 1VJ5A 4CM8A 1L5SA 3VVLA 4MA4A 5A02A 4HFMA 2OPWA 3W2GA 4D9KA 4ZVOA 1B43A 2I07B 1V7CA 5K3OA 3Q8CA 2Y8EA 2IIPA 3AYXB 2ZJBA 3K0FB 4TYNA 4UBOA 1OHFA 3KSUA 2N1MA 3OUUA 4KNVA 1W4BA 4FT8A 1R6VA 5H9VA 4NHKA 3JRXA 5ARDA 2VTXJ 2C2OA 4C0HA 2J3KA 3I12A 1XBFA 3HV0A 4JASB 2KPOA 4G5HA 2VZTA 1B42A 3V3KA 3ASVA 5IVBA 3WQQA 1VI2A 1XRLA 1FDIA 2R6DA 3WA7A 3LI2A 1D2HA 4GZ3A 4KQ7A 2Y38A 4TVOA 3ON5A 5JYDA 1W6PB 1OJLA 2EYUA 1XLWA 2Q3HA 4E31A 3PTAA 4EB0A 2I67A 2VF5X 1J0XO 4OXKA 1X6VA 1TZOA 4IO0A 2ZEZA 3H87A 4Z2YA 2H2WA 1A7JA 2QROA 2YDXA 3F8SA 1Z2NX 1NNUA 2NZYA 1T3SA 1YFXA 4ET7A 4J0CA 1IUNA 4CKCB 1FC0A 2WY2D 4UVHA 3LYUA 4ZO7A 1RBMA 3MTDA 5AI5A 1XPUA 2PNJA 4Y2TA 4RXUA 1XDUA 2Y6FA 5I9TA 4NAOA 2EZUA 1PGW2 4JT8A 4M98A 1ZNPA 2XHKA 4RGYA 1F6DA 5DBGA 4K7JA 2DFNA 2G7MC 3VKNA 3THYB 1U0SY 1QYVA 1PJ4A 2N1BA 3I6QA 5CFCB 2J30A 3BHJA 3DE2X 3HUTA 1S7CA 1T1GA 4D4KA 1B6RA 4QGFA 1DAKA 4WT7A 1ADCA 2VDPB 1HQLA 2FDCA 2J42A 1P3Y1 1IOLA 3GEDA 3V0AA 2AW5A 4NHYA 4IV0A 4GX2A 1N6NA 2A9KA 2AXPA 3RYRA 3KQHA 3BL5A 1QVVA 2XUJA 3CX7A 3Q8FA 4E07A 1O9GA 1P60A 1KYYA 3CF2A 3CZAA 5FNVB 2GWRA 2O14A 3AHHA 4EG1A 5E3JA 3QH6A 4YP1A 5DRTA 3EQ6A 3LBIA 1NPDA 3N7UA 3G89A 4HXEB 3B1VA 1VBC2 3GWZA 5DBIA 5JV5A 4JI3B 2JDZA 4AP5A 4XCVA 1B8PA 1ABBA 4ZAGA 1HE3A 3WRWA 5E6SA 4Y18A 1JHYA 2IXDA 2BHTA 3OFSA 1PNQA 4GMGA 1Q8SA 1NBMA 3QHAA 2HY7A 1RTKA 2C7OA 4XPVA 1VBD2 1OU0A 3ZWYA 2OR3A 4F3CA 4EKGA 4BZZA 1QQ7A 4UTRA 1XMQB 4F2GA 2HDNB 4GOOD 5G3ZA 5IU6A 2NMOA 5LA2A 1FNCA 2UVPB 3X0DA 4LNHA 4B6SA 3KQLA 4N7MA 2J4DA 1U6IA 4OIMA 1EFLA 1ZW1A 4QDJA 1XMJA 2W0MA 1U2QA 1YCDA 4WHMA 5IBQA 4PLZA 3HT1A 4ZC1A 2I8AA 4PLCA 4XW3A 1RUG3 4GPBA 1TKAA 4RQPA 4UM9D 1C14A 5E9AA 4DGQA 4MUVA 821PA 3VNUA 4WIAA 1CT9A 4Q0PA 4M0NA 2Z6QA 2IYFA 1YHZA 4DR6B 2LTNA 2Z8YM 3Q85A 3ANSA 2QAIA 5BSVA 3FJYA 3ECQA 4IDPA 5H7XA 3LW7A 3U0ZA 3OX4A 2YWCA 2A9PA 2WT9A 3OCXA 1PG5A 5I7FA 3UQYS 621PA 4WUVA 5T50A 3BGAA 2WZR1 1GHTA 1NNI1 5ECGC 1YFUA 5KQRA 4EL0A 5TGZA 4E5MA 3AL2A 5H9RA 2QCSB 4F4DA 4KI5M 2BFCB 5APAA 4GWLA 4HNQA 2IC1A 1A27A 2ZVJA 5JCJA 5A3OA 1NWCA 3VBEA 3BT7A 5U1PA 3EWAA 4D92A 4Q1RA 3B38A 4HVQA 4NYMQ 4G01B 5CDFA 4D7AA 1VE1A 3GBWA 1WA6X 2LM3A 5LWBA 2HA3A 3A25A 2H2IA 3NHBA 2B0CA 1Q44A 3ZE0B 3AGPA 4R1MA 3PGLA 4TN5A 3BIWA 1XL0A 5FPLA 1ESCA 4B6GA 4UTPA 2V9ZA 2P69A 2QMHA 4C6TA 4A42A 1OHHD 3OI7A 1T4DA 2ZI6A 4CKXA 4M37A 4MB6A 4G1UC 5H59A 3F6RA 1BWPA 4DR5B 4B31A 3T7KA 3EIHA 2BWJA 1DCSA 2WE7A 2ZBFA 3PQ2A 5CRIA 3B2EA 4QFMA 3USSA 2IL1A 2VI5A 4BFZA 1JEOA 1KSFX 1UM8A 4DLUA 3N2NA 4PHHA 2PFKA 3I5XA 1U7PA 4GF5A 3U5TA 4EKDA 2FMHA 3QUCA 4PLGA 5D2CA 4GXNA 2G82A 5I9LA 4YMWA 2FKNA 4S2DA 3BD9A 3D1JA 4XIJA 4CFZA 1P2BA 1QQTA 5AK5A 4FZ3A 2FSIA 4QQFA 1PZMA 4JGGA 4LSMA 4RDHA 4MA5A 2CJWB 2M32A 1MOZA 4GX1A 2IYZA 4NMLA 2GLUA 3KQ4B 1TT5B 4IE0A 4AF9A 3GRVA 2PUFA 2QX7A 2FWIA 4C6TB 2YU1A 1QF7A 1N3IA 3G2HA 2RI6A 2A70A 3D8TA 3OFVA 3LW8A 2J0VA 3ZU4A 3CUKA 4ZA2A 3L8ZA 2BCEA 2E7QA 4U3JB 2RSLA 5FX2A 3T8YA 1U12A 1YE5A 3E3AA 5G4KA 4MUAA 2AZXA 2CFOA 2XHZA 1KAHA 1ZRNA 3V4RA 1JYVA 4QDZA 3DMPA 3HRIA 2OBMA 1SELA 1W9WA 4DBVO 3WNXA 1OTHA 3RGGA 3QWAA 5IK5A 3SEEA 2FZ1A 3DKVA 3V1MA 5LZ7A 3QG5A 1FPN2 3FZGA 3NB0A 3IO3A 4MXWB 3VC2A 5T5QA 2HWB1 2NNLD 3QE2A 2ZIVB 1I4OA 3WR0A 4DA0A 4IDCA 4RVSA 4ZO8A 4W6XA 3VKUA 5EKUA 3JALA 1TM1E 1WXEA 1NZIA 3V6LA 2A1UA 4L2IB 1UY1A 4EMSA 2GAIA 1YI8A 2WI8A 2IEZA 1QTNA 2ZBVA 3OPQA 2X0EA 5IX8A 5JU6A 4W8HA 4XMIA 3EH2A 4BFTA 2R8BA 4WESA 1QG4A 2H18A 2FUG6 3C74A 1Q7BA 4L9BA 1G3IA 4FQ8A 1U8CB 2AC1A 5EWJB 2DPXA 1ZN8A 4XR4A 4DWOA 3A9VA 1DGLA 4G9EA 5DSZA 2PT6A 3WJAA 4G8CA 1ZI6A 1KL7A 3BMCB 2VJDA 3ORYA 5CFLA 1U7WA 4DDUA 2WA2A 3RVRA 4KREA 3VHOA 3NWPA 2HPHA 4OI0A 4WLOA 3MO4A 2RGNC 1RXSA 4NMWA 5B5SA 3LLCA 3HJTA 2NUAA 1H3FA 4O8ZA 3QEOA 1W94A 2VRWA 5A4DA 1KA9H 1WPXA 1Y5MA 1JHDA 3O26A 2P3OA 3KYBA 2NTVA 2I55A 5KHIA 5LSAA 4RF2A 1SEVA 3GNSA 3K35A 2XVXA 3N5CA 4RY9A 3R0IA 3P9NA 1GWKA 2A88A 3FYDA 5DWDA 2J41A 3LH5A 4MW4A 1GY8A 1YAJA 1R1ZA 1Y6QA 1QFZA 1GFZA 1J8QA 3MFQA 1SVIA 3NHUA 2NUAB 2RHMA 3VO1A 1F2NA 4JLUA 2V8OA 5K0ZA 3OZEA 1KMHB 2VP5A 2OUHA 4N4AA 5CK4A 2QPLA 4A7YA 4PAGA 3LY9A 3BHMA 3EQ9A 4ML3A 2HQSA 4W99A 4Q18A 3ZDCA 5A62A 3PK0A 3QWHA 3DEKA 4MKGA 4NPRA 1ZRDA 3D3KA 2RS52 1Y3DE 4K9OA 1HRV3 3WKEA 2OCKA 4ZVTA 2EBUA 5KOIA 3ZM8A 3ICCA 4NMHA 3CNAA 4H3KB 2W94A 5CFCA 2JCVA 1EQAA 2UUPA 3ZD6A 1R9NA 1DGWA 3U4QB 1CRZA 4A3XA 2PL9A 4M0EA 5A2QA 4UBNA 4F7WA 1QJY2 3RSQA 3DEHA 4F21A 1H8TB 3G0OA 3KD4A 1U5BA 1WKYA 3AEZA 4E4YA 3ZTWA 1E6WA 4BV2A 3T3HA 1HL3A 4OKIA 5KYKA 1THMA 4YDSA 2DVDA 3ZFEB 4B35A 2FPWA 3H1EA 3C6MA 1RJDA 4QU9A 2DLDA 4MCHA 2ZUFA 4XF3A 1G1AA 1JX6A 3N9IA 2OW4A 3I2IA 1N57A 4N0MA 5FREA 2A94A 5FPBA 2I45A 4YPFA 3DW3X 3FBYA 3UK6A 5F5AA 1GFIA 5L3QA 2IEGA 5CFMA 1QFSA 1M2NA 3R7LA 3K9GA 1GSLA 3RKRA 1AR83 4K9QA 4BGVA 1SHJA 3LFMA 4I9UA 1QHDA 1L7NA 3RF6A 5T55A 3MSCA 3KLNA 4RKFA 2XL9A 1JG7A 2HMVA 4LKEA 1Z3CA 3QJGA 1O94C 1EUCA 1RXVA 5IAAA 5LYJA 5FZ1A 3ZXXA 3HCPA 4QFBA 4GM4A 3WDWA 2XXBA 3AV0B 3K0KA 3G9XA 1X1AA 1IVNA 3KBOA 4LA4A 2GXAA 1V6SA 3T5GA 1MG0A 4QO7A 2JNWA 1FFXB 1BHO1 2W2KA 1EFVA 1X8JA 2BMAA 5LZ5A 1Q1ZA 5ALJA 1W87A 4HDMB 1KEZA 3OA2A 3OPWA 3IT8A 3FSGA 1N7IA 4FPXA 2FSSA 3X3HA 3DCYA 4PANA 4EA9A 2ARXA 5HXVA 1E9DA 4E3WA 1FXWA 1TA4A 2V4UA 3SI7A 4V2IA 1SBFA 2QYHA 1OF1A 1C4WA 3RYIA 1BVP1 8OHMA 3D4LA 5TDHA 2VSFA 2JEZA 4PSVA 2E21A 4MVTA 1UZVA 4P34A 2JCBA 5FY1A 4MGKE 3GQBB 1CHDA 3HMYA 1KAEA 3WWOA 2VJYA 3W2EA 4G3YC 1YB2A 3BREA 4GP9A 4YAEA 3ON7A 3LS2A 4ZHNA 3MW3A 5HCAA 2O1SA 2EJCA 1PFVA 2V6BA 4OP3A 3D6NB 3OTQA 5KX5B 1OY1A 1RQNA 1QR2A 4FSHA 4L8YA 3K16A 3O4JA 2VDLB 4S12A 1CX1A 1CHNA 2D2XA 3ENQA 2B82A 2VUSA 1RRFA 5GTDA 4B87A 5I8WA 5IASA 1EX7A 1E1NA 2YY1A 2W6QA 3WVNA 1E58A 2ROQA 5EWLB 4AG3A 5KDLA 1LLFA 3DP7A 5LU8A 4G63A 1ABFA 4PWZA 6ABPA 1GKIA 5ENVA 3OEWA 1NQUA 2BUCA 1JN0A 5J09A 5HKLA 4LUKA 5JOXA 4EMUA 4CMCA 2VXBA 2Z2JA 4GE0A 2O8FB 2QMZA 4KQFA 1OJ7A 2ONZA 5IMSA 3KTAB 4K9KA 2Y0DA 3P0JA 4HETA 1YVRA 2EVWX 3WLEA 2TS1A 1NE7A 1Y1RA 3CPHA 4DIEA 1GXSA 5ED0A 2PLNA 2BD0A 4G41A 4S2UA 4N8DA 4JKKA 4GFDA 2QGFA 1W99A 1J8DA 1KO1A 3ZWCA 1ZJ5A 5FLHA 1FF9A 4X94A 1J84A 1CJUC 3JYOA 3QW4B 1UEXC 1UJ6A 3CYFA 1A95A 3D6HA 1VB4A 4L5JA 4WXRA 3SC7X 1P0CA 1NW4A 4HDQB 3GEGA 4HQOA 3AB7A 4PC6A 2VZEA 1H4QA 2ATIA 2WF7A 3D5OA 1U04A 1QUFA 4GLOA 5E6UB 1UC5B 1GGHA 1HV1A 3DLTA 4CL0A 3QCWA 1Z6TA 3IIJA 4OGWA 1J70A 4E5PA 3O2JA 3SHWA 2V5AA 3HU3A 4YAJA 4MGHA 1AN0A 4R8HA 4DCMA 3R8FA 1JYTA 2GS9A 2K0GA 1DKQA 3RHTA 1NURA 2QQ0A 1CJDA 1PX4A 2E33A 3UTCA 1LXCA 4EARA 1XAIA 1SUAA 1GAXA 2VWQA 1Z78A 1W3VA 2AV6A 5BWMA 4JBXA 3MOSA 3AHCA 4B8ZA 3KYJB 4AUKA 1EHYA 5C5CA 1QGOA 1QH0A 3POYA 1EVQA 3FYSA 3BIFA 3A3PA 3L1HA 4ABTA 3V65A 1JLLB 2QJRA 4ZQIA 3NHWA 5FO0A 2O2IA 2NO6A 1IK6A 2W7TA 4YP9A 4FFPA 2CJXA 4MX8A 5BWOA 3LL4A 3QZUA 1LQ2A 3RC1A 3ZYHA 5KTOA 1GKLA 5IJ9B 1RRKA 4X84A 4IJKA 4C2UA 2O7QA 4HNHA 2PDAA 3VBOC 5G1PA 3E18A 3W79A 3L0ZA 3UVEA 3F97A 1SUEA 3OQJA 3NHRA 4H0NA 3SBEA 3W1VA 4YPOA 3FN9A 4KL8S 3I3DA 4ZZIA 4Z9YA 4DIDA 1CUBA 4EATA 3HY3A 4H7IA 4HVTA 2XCQA 2FSPA 2E6UX 1W8FA 1G0NA 2WT1A 2G06A 5EHDA 3O4RA 5CD9A 1LNZA 5I5GA 1LGBA 3ZIWA 5T5OA 5EJ9A 4YW6A 1I9RA 4DSAA 2YN2A 4CW7A 3D7KA 3SMHA 3ZVXA 3UGGA 2QPAA 3OZGA 3HYNA 1DBNA 4CODB 4EB6A 1SC4A 4F46A 3KZMA 3LGAA 4FNGA 1O5IA 3DTTA 1KH3A 4QQKA 4L8LA 3L07A 1SC9A 2WU0A 3ORRA 5BWLA 5EEGA 4HPKA 3O3CA 3THDA 4YRFA 2E32A 4LJSA 2PUBA 3W5HA 2WT0A 1ZHHA 4HDSA 4JH0A 1HC7A 3WGQA 2A59A 4HX5A 1PUXA 2R1VA 2XHEA 2ZT8A 1KEWA 2C4NA 2ZYGA 3ZY2A 2JKYA 3STXA 1RU3A 3QK7A 1O6FA 2ZTHA 4MUBA 3L4KA 3NBFA 5JBIA 3DDWA 4IIEA 3O0TA 2GBPA 1VKJA 3RJMA 4XQGA 4EF5A 1YONA 2OQ6A 2MMGA 3FD8A 2IU0A 3IIKA 3FHLA 2H51A 1P5HA 4NDNE 2BI8A 1V45E 4G25A 3RYFA 2X15A 2P6PA 3MNFA 4I8XA 2ONCA 3PUIA 2VWPA 5FBZA 3O8NA 2H0BA 1GP4A 4OD0A 4HZGA 2AN1A 4FYMA 1RVF2 3GFGA 4FFWA 3GFOA 5JS6A 1WKBA 3MTQA 1WNTA 4LNAA 1XMXA 1VCHA 1X38A 4EECA 2Y0EA 3B1FA 3D8CA 5HKBA 4LJ7A 3OESA 4QUKA 1ZK4A 2YDEA 1K5GA 1ZH4A 3VDDC 1LW6E 3CBNA 3JB8A 1U0JA 3GROA 2Z09A 1R4ZA 2NTNA 2EBFX 3THPA 2DCJA 4LDPA 5HRCA 1JILA 3JQQA 2D74A 1EYZA 3ZKWA 4O4HF 4AMUA 2D2VA 2CCKA 1LBSA 1GZ3A 2C2HA 4QM6A 3Q6IA 3D31A 1WVGA 4EX7A 5AI9A 1QDOA 4V0SA 1IUPA 4KTVE 1OBHA 2WDBA 3VPXA 4LEJA 3RZLA 1M6WA 4ABYA 3WK4A 3AMQA 1VIMA 4FI3C 2YUEA 1HG0A 4S0ZA 1ZK1A 2Q3CA 1L5FA 1LPAB 1KVUA 3DZBA 1IHDA 4P5EA 3CIFA 1QGED 2YL2A 5SZKB 5J63A 4JZKA 4BP9A 4RTSA 1NJGA 2B83A 1IFXA 1SZDA 4FTSA 1B0UA 4O65A 3ZO0B 2NZJA 1JWBB 3N9OA 2IS1A 1QHEA 1N1MA 1IJFA 4D6YA 1T26A 3T08A 2WIFA 4G0OA 4AYUA 2HMAA 1GFWA 2R8EA 2ZB2A 1YQ8A 4M1WA 5A80A 5LPNA 4D44A 3FGPA 2VJNA 4A8HA 2Y0BA 3LF1A 1UR5A 1E5VA 5DNWA 5LY2A 4UJ5A 5EWMA 4BWYA 3VYVA 5EUQB 1XWFA 3L0DA 1I2DA 5D3QA 4YJ2F 1RUE1 5FIXA 2HT6A 4XDGA 1A78A 4F4FA 1NLQA 3O9MA 1N92A 2FLKA 5E2AA 3C3XA 1Z4PX 2BSAA 2QL5A 5E6UA 2FN9A 4WVZA 4EG7A 2TMYA 3T1VA 1W8NA 1UBFA 1PQYA 3CO0S 3QNMA 2FFJA 3R5XA 4G8DA 4WLEA 5CURA 2FCVA 2ZDQA 2W6JA 2NV2B 2DQSA 1SVSA 5LCWL 4FMCF 4ER3A 3KKEA 3AY3A 1NQTA 2F43B 5KYUB 3K6JA 2W93A 1WXIA 2YGMA 1XUOA 2DE0X 4AQYB 3ZLUA 3N8HA 4RY0A 3QMWA 4RDIA 2G08A 1UMBB 5ADHA 3D5EA 2X8JA 4O2BB 1I0IA 2AXNA 3VNVA 1TK2A 1OD6A 3T7RA 2PLFA 1NP3A 3BBLA 3T7DA 1QQ5A 4N8SA 5BQPA 4FYPA 1TZJA 3RTAA 2A92A 4CDXB 1CZKA 1FTNA 4Y1EA 5AR1A 2NP0A 1OX5A 4E6EA 1ZBE1 3GWGA 2XJVA 1JQJC 1G5HA 1Y48E 3I37X 5AW4A 1CUUA 3U60B 1OZ0A 4JEHA 1GG5A 3HLTA 3QF4A 5JANA 4D3XA 1DC7A 1ZJ6A 2YNMA 4R1QA 4XDQA 2B5WA 3F95A 4UWDA 1RVF1 5HSGA 1MB0A 1BMQA 4G1VA 4QBIA 4NYIR 2WV7A 2AN5A 3OEYA 5FJJA 1VJDA 2BFBB 1AR91 1IOVA 1PHMA 4NE9A 4AF8A 1W39A 2BEVA 3C41J 4EW6A 1Q74A 4HONA 5ANQA 5KYVA 5G1NA 2XUIA 3EF3A 5LP6C 1T3TA 3ZDQA 3S7TA 1PIWA 4P9YA 3BB1A 1H3NA 2X8LA 1P2UA 4K3VA 4UFKA 1E77A 4R9BA 1LS1A 1PO22 1TD1A 4QG3A 4ACBA 1CKEA 2QUBA 1SXJB 5K0GA 2QN1A 1AHPA 3H8OA 2P0YA 4MVCA 4G0VA 4ZHQF 4N8EA 2NP6A 3TG2A 1QF6A 2JA2A 1N0HA 2P9TA 4ZI2A 4MUMA 1XR3A 2IPLA 2B1GA 4LMFA 3J26N 4COKA 3HO1A 3U1BA 4A7PA 1R091 4RIGA 5ABJA 3ZGXA 3C16C 1G3MA 1M8GA 3H6HA 4E4SA 1ZIXA 4EG0A 3WLNA 3DUFA 4PS0A 2PZGA 2B1IA 3QVKA 4RC9A 1GRNA 5AM1A 4GNRA 5J23A 3LZ6A 3UJHA 1OYWA 4CKWA 4HYYA 4D2IA 1GQRA 2G9ZA 2AFRA 3LCRA 2QYOA 1JP7A 1W9YA 1RWKA 5ISLA 2E4VA 4ENTA 4ZOLB 4X64B 5FA5A 1CJCA 5BNNB 4U9IS 1XYOA 2IUWA 3AHDA 4JJ6A 4OQPA 2QIOA 2VN8A 1NW6A 1POV3 2H0AA 3TJZA 1H4TA 1S2NA 3S7ZA 4B45A 1H2WA 4Z7QB 5MDHA 2JGFA 1JAZA 4HYTA 3ABSB 4B74A 4NE2A 3A0NA 1VLHA 1YR9A 1W581 4ZODA 2VZOA 4S04A 1DX9A 3RNLA 2ON6A 4C7OB 3KB1A 1DXYA 4J90A 2WHQA 3OEHD 5G0WA 4QNMA 3TSWA 1XJ0A 1BXRA 1SLBA 4IH9A 1WHSB 2FN3A 1R9JA 4OHXA 2B61A 1JNYA 3JQ7B 5DXJA 1ISJA 1NKTA 4EFNA 5KMGB 1MO2A 1IPEA 3PLAE 1GP6A 3ZXYA 8ADHA 4LYJA 3VU8A 2AQKA 2O5RA 1D7PM 2ODQA 2DVGA 3WFJA 5H8WA 3TKYA 4EN6B 1GAQA 4DR3B 5A03A 4EVSA 4A2QA 5T41A 5LVAA 2W2LA 3GC6A 5GY7A 3RUEA 4E4DX 3JATB 4FW9A 2HA7A 1XZGA 2D8AA 3FKSD 2V6IA 5EZ6B 4RCYA 1NXVA 1I4TD 4WKGA 2O0KA 3ZPYA 1O7FA 4D82A 3OFKA 3JAWB 4G5RA 4O5AA 4B7KA 2FWRA 5LP1A 1GV9A 4C76A 4TLBA 2BZSA 4BN0A 3KBBA 2I7VA 2ZBEA 3BK1A 3Q5DA 5AI8A 4WERA 4EHLA 2W4IA 3OECA 4FPEA 3WCSA 1KJLA 2OV4A 2GAFA 2YUIA 4HQRA 2CYAA 4FFMA 5H4GA 2AH5A 2MSKA 5K7PA 1KI8A 1FNYA 5HOEA 3FUWA 3MGUA 3HACA 4QHTA 2Y0IA 3FJOA 1TGYA 2PAMA 1NLUA 3D6UA 3HDTA 5KC8A 2F1HA 1J3RA 1OYOA 1O77A 3QM1A 3HZZA 1DQRA 1VAMA 4EEXA 2HGZA 2ID7A 5GINE 4UVIA 1Q8OA 5LJIA 3GJYA 1T2FA 3OPTA 3HNOA 5EXXA 1HDKA 1L4UA 3ZBQA 2WUWE 4IJMA 1MT3A 4ZCTA 2LCIA 3DZIA 3MYXA 4MLZA 1RWWA 1FMTA 2XH6A 2E4XA 4EN9B 2PM8A 2XA1A 4GE3A 3RYPA 5IUQA 2AE1A 4JFRA 4P83A 1XN1A 1KARA 5DT9A 3K9QO 4YI3A 1S4QA 2OVFA 1U80A 1NU6A 3EBPA 2DQKA 3DD5A 4WM8B 4Q03A 3K53A 4BNFA 2PT9A 3C8HA 5AVYA 3O3MB 4HWPA 4ER7A 3GVIA 4L95C 2BP7B 2P3JA 5B7GA 1UQXA 1RZ3A 3C7DB 2PHXA 1UDXA 2ZULA 3U81A 1GEGA 4KVAA 3EPKA 4UBKA 2GHRA 1FFGA 4KQKA 3VBFC 1X42A 4ZGWA 2BOJA 4RJLA 4TYQA 1NUUA 4ZFNA 2HIGA 2Q1TA 3U17A 1XU7A 4F8AA 2ZGNA 3IPLA 3J81A 1P17A 5FFNA 3OTWA 4UEWA 3HS3A 3EAQA 3PQ4A 4NAUA 3UCFA 4IGEA 5CB4F 2ZIXA 3P9CA 4D4HA 3NBXX 2HU8A 3F5DA 2K2WA 1NZFA 4AI0A 1J8VA 3HDYA 4XJAA 3P2YA 3NTQA 2JD9A 4P8RA 2WIBA 2I7DA 4QTTB 4JR2A 4H17A 3B6EA 5ALNA 4EBFA 5JOYA 1I1OA 2YV1A 1FDSA 5BSMA 3HKCA 3EUWA 2DCKA 3L6OO 1DIGA 3WB2A 2A6YA 4NPLA 1HDXA 4LOIA 3MJVA 3ADBA 3FDXA 4DEXA 3TLXA 3KQRA 4JROA 4I50F 2CE7A 2DB3A 2WKRA 8LDHA 4BUJA 1AYM1 3G8DA 1T5TA 4BQFA 2A0WA 5BV6A 3B53X 3L5KA 3ZNOA 1IPKA 1IOAA 2ZWOA 4X90A 2UWBA 3FPGA 4TMZA 2NZ9A 1GU1A 5SY9A 1PS8A 2IZ0A 5JDIC 4CM4A 2XZPA 1P6XA 3D7RA 3NAZA 4P58A 4OHVA 1H8TC 3OSDA 2BEOA 3D3WA 3TCNA 1K97A 3N2YA 2ZJ8A 4DAEA 2HWB2 1Y4WA 3F6CA 4R1LA 4WCFB 5DO9A 2W90A 3IA2A 1J97A 1GZUA 1BCSB 4Z4HA 2RS31 4PZUA 2CD7A 2H2AA 4QQPA 1BJRE 4V0ME 3ZR6A 3VDQA 1J8YF 3N0RA 4MLDA 1ND3C 2EQBA 2OHOA 4PZZA 2FH5B 1BS1A 3FUXA 1O5TA 2NADA 3VHRA 1CK4A 1JQAA 5DIZA 2HNKA 1NSTA 3MT9A 2Z5VA 3K32A 1KEEB 4PCLA 5HBGA 4CGYA 4Q26A 4WXMA 4NU0A 2JLAA 1FZQA 4V0KA 2FMKA 2ZHMA 4X9XA 3SEPA 4HLUA 4R68A 4RS5A 4O25A 3KPWA 2J9GA 2UYYA 1DUVG 2RKBA 3GCGA 4R7ZA 1ZFNA 1E1RA 4N1AA 4B43A 5BNZA 1GAWA 1S0JA 1ZM1A 4M01A 3RMYA 4YM0A 4PFQA 5IZCA 4LBLA 4OYHA 1P1BA 4RLHA 4FEGA 1U2DA 2EQAA 2AK2A 3K73O 5AKJA 1Z35A 3BYZA 3L82B 4Y2JA 5JNTA 2XLBA 4D46A 4YBRA 5DLPA 4K1XA 3K4ZA 3WO1A 2Z08A 1SXHA 3ZDFA 2B6NA 1ULCA 1N3YA 5T5JA 1UPUA 1FP7A 3R6SA 4TQGA 2LRPA 4KH1A 2H4XA 3CF6R 2VECA 2LRHA 4G81A 1X7NA 2I87A 5J4HA 1HH4A 1ZR2A 1WHTB 2IGTA 1M1NA 3ES9A 1V2HE 1NF9A 1SWVA 3GJTA 2GBLC 3O21A 1BFUA 4EFKA 3ZZNA 4GVXA 1XQ9A 3HLYA 3BKZA 1UMZA 2ZOSA 4HAOA 1TU3A 3OTHA 3STHA 4G6ZA 1FYXA 3EDMA 2IS6A 1Z7YA 4YJGA 2JGDB 3WMFA 4M0LA 2B7YA 2MINA 2VZVA 2AKEA 1OWNA 1KI7A 1O03A 1BGVA 5LBEA 3JWPA 3CTMA 2PEYA 3BHNA 1QH1A 2QD3A 4RIEA 1DX4A 5A3WA 2BZDA 3KXPA 5M0TA 1GPUA 1E0KA 4HB0A 2BFOA 1H2KA 4YJFB 4H14A 2H54A 3EXHC 1AV6A 1IK4A 4P4NA 1Z7BA 1XQ1A 5DUVA 4LDAA 3U2QA 5C8CB 2BZ1A 4AN0A 4KIWA 4Y6QA 4EJ6A 3MILA 2YCLA 4L5YA 1D2NA 2IU6A 5IK2D 4GG1A 4WI1A 4QO8A 2FCTA 3GPLA 1BD3A 1NOKA 1EFTA 3SFVA 1G8YA 3CW9A 1KBOA 1BD4A 3NBAA 5IS2A 2ZSFA 3AP5A 2II6A 4HDKB 5DGXA 2FFRA 3WBFA 1KI9A 3BFKA 5HGXA 4LYYA 1JR3E 2OCAA 1M6VB 2GM4A 2H4WA 1IAVA 1UJMA 2AN3A 5DN2A 3TNPB 3NALA 3NTXA 2D6MA 4BAGA 5KTYA 3SQWA 3ITDA 1Q5PA 3RWOA 3VPGA 4YCAA 3V2GA 2IYNA 3MRVA 4R0NA 1O89A 5INTA 2I6SA 2WJPA 1KZ6A 4JHTA 1W9MA 2WWSA 2IYPA 4Z4CA 3WHKA 3IL2A 2HMWA 2YW9A 4IV8A 3PWZA 1YL6A 4FFHA 1FOD3 3HEBA 5BYAA 2EKZA 1MS0A 1BXGA 2EKPA 4EPYA 4MK4A 1WZUA 1ZXXA 2XADA 4DNFA 1T0JB 1ZVQA 4FPYA 2JAUA 1ZXBA 3N2KA 5KWEA 4AI3A 5FO8B 1OOPB 3IPVB 1A8MA 4XPIA 1R8QA 2G8NA 2E5FA 5B57C 4ILEA 1C3VA 1B35C 1YSCA 1Z6PA 4YT2A 3BD8A 1QCDA 2PQ2A 4YA6A 2EX1A 1AKMA 3S2YA 4IEQA 4CCJA 2A7QA 3B3QA 1LTEA 4G36A 2XR1A 4H6WA 5JJKA 5I4CA 2HCJB 3QKUA 3VDDA 2KM1A 1TMF3 5GZFA 1KJWA 1QDEA 3VO8A 3P9KA 1I8TA 4Q1CA 1T2DA 2QX8A 2FCAA 3KELA 1W6NB 1QQP2 4TKVB 4KIGA 5JAOA 2Y6JA 3E0XA 1WX1A 5A32A 2D2EA 1K4YA 1CAVA 4C89A 3M1LA 3FPSA 4OQYA 2A3NA 3S1AB 1EK5A 2VZQA 3HB5X 3CY6A 1V16B 1W0PA 2Y9PB 3HPRA 2HCTA 4Q12A 3MIGA 5SZIA 1KH1A 3FLEA 4OY3A 1W28A 1UOJA 1YQQA 1LI4A 4PDWA 2Z8XA 5B2GB 3NATA 1DT5A 2YJZA 1VSVA 5L4LA 2O2DA 2N9UA 2FDKA 1IQRA 3IX7A 4UJ3A 4BRWA 3NSTA 1V6MA 4AJLA 1V8PA 3HL0A 1L5HB 3U3DA 5EP3A 5BRNA 2RMU2 4GMKA 1CYEA 5FBVB 1YZTA 4Y20A 2P9BA 5L95A 3JVEA 5IEJA 3ONFA 4MS3B 2F9LA 1L6RA 1KDVA 5AJZA 1DHRA 1ZG3A 1C8VB 2A9OA 4HXGA 4QDQA 3VBUA 4TYPA 1AKYA 1LOGA 1WM1A 2QMUA 1L7OA 1XD2B 2IE8A 5DNUA 3UC9A 3ZYBA 4Y5Z0 3LKJA 3L7KA 1P75A 1VIVA 3FKJA 4CIAA 2JGJA 1FPQA 1ORWA 3Q2OA 3PFWO 2ACKA 2ZB8A 4DUWA 2ZBGA 4UNPA 1GPKA 4JY7A 4RH1A 3QNWA 3ZEIA 2HWE3 2JFOA 4DXAA 2XH8A 1RUJ1 1W96A 2QQPA 5HGJA 1T9BA 1AR63 3F5MA 4HBNA 3R0RA 1RHMA 4JGZB 2CN1A 3R7WB 1X0VA 4AW7A 5IVKA 2ETXA 5IJ0B 1YFWA 1X7XB 3LT4A 3ETHA 2J4FA 5FQ0A 2QA5A 4N65A 3BXFA 1RCUA 1UY0A 4HNAA 3UYKA 4AZ3A 4IH4A 4M1EA 2QAGC 5BMVB 3MW4A 4DA7A 1I3OA 3WJ7A 3QU5A 3GDWA 3S68A 2BDRA 4P3YA 5EFOA 3RF7A 5DQ0A 3TDMA 2Q8CA 3D3JA 5TEVA 5EJ5A 2AF3C 3ZV6A 2YQ5A 3L46A 4U6SA 1XALA 4MI1A 1BZWA 1FNSA 2J67A 1DRKA 1MJGA 4ZGGA 3K3NA 4Q3NA 2ZWVA 1CZLA 2UXCB 1S1CA 3EC7A 4LI3X 1MQAA 4QGGA 5ER9A 2QMEA 1S3SA 3O1PA 3LAWA 4PO8A 1T2NA 2XDQA 2BGUA 5C5DA 2IYSA 3HR7A 4RTLA 3P32A 1EFRA 2GZMA 2W4MA 2NU7B 1N8SA 1PVVA 4OX9B 1HLDA 2EXIA 3GT3A 5KINB 3HN6A 4G8BA 1QC5A 2WS91 2HDWA 3A11A 1P2TA 2FPGB 4L5CA 1Z5VA 4RWEA 1IN1A 2Z2ZA 3R9XA 1L7DA 3NV4A 3IB3A 1DDOA 2FG7C 2XKOA 5BV8A 3FLRA 4KI7A 3HGTA 2CVPA 4G4SO 1DOZA 4HNRA 1Q1EA 4UDXX 2V6FA 2WYUA 3WKCA 4WXPA 1QFXA 3ZWKA 2YHAA 3AVUA 2Y05A 1DJLA 2FPLA 2VDMB 3QU7A 3P0FA 4WDRA 1U0AA 1PK6C 2R0QC 3G6WA 4QYXA 6CHYA 2CNAA 2DUQA 2V3WA 4B3JA 2C9BA 1RI3A 4DA6A 3ENWA 3D3AA 1HG1A 1IEVA 2W00A 4IDGA 5JBQA 1S0FA 2XXAB 3EW7A 2PR2A 3WIUA 4ALLA 3CM0A 4MYEA 1UMHA 4AGRA 2R7MA 4XIKA 3VX3A 3IALA 1KQNA 4YRGA 1W9TA 3IS3A 3IUPA 2XYQA 1JJ7A 4GMDA 2J22A 1XAJA 2QORA 3RVSA 2ES3A 1SFNA 1T5OA 5EXEA 1L8XA 4V39A 2KMLA 3AQ4A 4MR9B 2J3EA 3GJAA 4MZXA 4AFBA 5KU7A 1Y7LA 5IH7A 3AZVA 4EWDA 1GZHB 4EDFA 4YZ1A 1N5DA 5J2UF 4NNOA 4NHEA 2A73B 4YPJA 3ET5A 4G4GA 1IBLB 5FXVA 4W1QA 3TSAA 2D97A 4OGFA 2RAUA 3F5SA 4G5OA 4INDA 3SNKA 5I9BA 3V1UA 2H7VA 2OXIA 2JDHA 5IWAB 3HWWA 2R4UA 3I83A 4TSKA 1C57A 3HB0A 4LBQB 1YR7A 1NTRA 1DXHA 1ISFA 4KG8A 4FYKA 5CA1A 3P0HA 4UTNA 2VDKB 1O6UA 4Y6GB 1YBAA 3SX0A 3ZHOA 4ARIA 2X7JA 3NAMA 2HWE1 1AK9A 3B6JA 1YRZA 3FW1A 1WETA 4TWZA 1P0IA 4M0KA 4YNBA 2FW9A 3PS9A 1Y63A 4OLJA 2CLCX 1FW6A 1RUH1 3W77A 4ZDKA 3UK1A 1II9A 2AX3A 3ELNA 4UM9B 4AXXA 4FYXA 2ENUA 1UIKA 1E2HA 4LY0A 1T25A 3ZWAA 4N43B 4GIQA 2C5SA 2FWAA 2E7ZA 3MK31 3VMMA 5AI0A 1VMDA 1RYEA 1RNLA 4KK3A 3USES 4PRLA 4PG7A 3ZU6A 2R2GA 2G5GX 4U6QA 5HYVA 1Q16A 3K0CA 3I3EA 3CT4A 3JVUA 2FR0A 2R061 5DYGA 2HWYA 3BE5A 1Z63A 4PBSA 3DBLA 1B4DA 2A9RA 4RAQA 4AI8A 4Y9TA 5GZ1A 1URXA 3SF8A 1K27A 2RK3A 4YB8A 5J4VA 3GUYA 3EC2A 1C8M2 4WNAA 4J16C 1BIFA 5C8YA 1D04A 2GEUA 1F5NA 4ZHSA 4N49A 3GRUA 4ZU5A 2GRAA 4HXYA 3E9EA 1RMU1 1QPZA 5EV7A 2AK3A 1MZFA 3UJAA 1G9AA 4G1CA 3P9IA 3VGIA 1PX3A 3H1MA 4Z2AA 3WD5A 3UHOA 5JPMB 1IY8A 4LJAA 2JJYA 3LUBA 3FPFA 2VSQA 1W5BA 1RI2A 4CEIB 5DCWA 5JFTA 3STUA 3PNBA 2C5HA 1PNVA 1Q0QA 1DDIA 2JG9C 1YK0A 3IAAA 2M6LA 3MN1A 4BJ1A 2BHLA 2PX0A 5L3RA 3MBWA 3NHJA 1G8AA 2W1UA 3PF9A 1EGAA 2BEUA 1ADJA 1T3HA 1UFQA 1V2GA 4ER0A 1XKQA 4XWKA 1WAMA 1X7XA 3IAEA 2QYSA 2VUCA 4JBLA 4FILA 1ZL2A 1EFPB 1ZESA 4BVGA 3W6ZA 5A7QA 1IRXA 4AZWA 4D74A 3O84A 4J91A 5CFDB 2E4UA 1XSQA 5BNNA 4CU2A 3GHYA 1EZ4A 4QDKA 3FHJA 1YU9A 5FUMA 1NR5A 2QRUA 1KGYA 4ONEA 1EP9A 4DYDA 1BU5A 1J49A 3MMXA 3FNIA 4FEEA 1GGVA 1AA9A 3OYWA 2C7VA 2QQGA 2POQX 2X2EA 5DU2A 1JR2A 3K48A 2JFNA 1V43A 3PL0A 3LXUX 1CIVA 4ZJYA 3RDPA 2ZJZA 1AS0A 1A34A 5FZ7A 4TWJA 3S27A 4AY2A 1FMD3 3HU2A 1X1CA 3KJFA 1GCOA 1D2RA 4P84A 2Q5FA 3NANA 1ZQ1A 1QKIA 3RK0A 4XUNA 4Z3DA 1YQEA 5L40A 3HB4X 2J7PA 2ZXQA 3GLSA 1QHHA 3T3MB 1O4TA 3O14A 3OD5A 5JS2A 5ELXA 3FWYA 1W4LA 2G4VA 3P5SA 1ESZA 3AF5A 2ORED 3MPUA 1N34B 1RBYA 3TB0A 4YZ4A 2J7PD 1O59A 3MMNA 3LDHA 3Q3IA 4Z4QA 1P7ZA 2GJAA 3DAPA 1YTLA 1QH6A 3NKTA 1C3OA 1DEXA 3VJLA 4GD4A 3FI0A 4BXSV 1ILWA 4IGKA 3AZWA 2DJ5A 3R7BA 1W0JA 4ZT5A 4FE7A 2GNDA 5A71A 1BMDA 3DBIA 3R5TA 4BYGA 3JSXA 3B48A 3H18A 1NE6A 3ZWWA 3IKWA 4QRDA 3AY7A 5ITZB 2V5DA 3NEYA 3SZRA 5GP1A 2HO4A 2JCYA 3I6ZA 3WMXA 4RH3A 4RTNA 2OKXA 2HBRA 3DBLB 3LUDA 1EAH3 1I1HA 4LTMA 5ECYA 4BCCA 3PL1A 1YA4A 3VV3A 2C2WA 1NG1A 2C26A 4HV4A 5FBQB 1HT2E 2FZLA 4HFNA 1XCLA 1K5MC 5EPUA 3FYTA 3RT7A 1ZC4A 3SS7X 2Q8NA 3U37A 5F98A 5ANNA 1BS2A 1RW4A 4C88A 2HWB3 4J4BA 3TD2A 4JWTA 1KFJB 2XD9A 1CLUA 5GADl 1K6EA 1WIWA 4L3VA 2RS32 3ZGLA 1ZOIA 4HPWA 3H17A 4NENA 4TWRA 3IEIA 1N1YA 4AURA 1A2QA 5A1TA 4PVCA 1R6XA 2HH9A 1CXZA 1TPZA 2V55B 3CVJA 2ZAGA 4YMVA 3EFHA 1MQTA 1QLWA 5EIHA 4XQDA 2H5JA 1I3MA 4P53A 1H9CA 3G9ZA 3G8YA 5B3JA 3R3JA 1MAWA 3DCNA 5FADA 4XH9B 3PDCA 5COBA 1PGL2 1BLZA 3EY4A 1UK8A 3QVOA 4L9WA 3VDCA 4DADA 2OGUA 2VBIA 4A5SA 4X60A 1E66A 3LLUA 2WSYB 2DQYA 3VXKA 2RS13 2MYNA 5EHIA 2ZE6A 1JB9A 4CT5A 4DIMA 5T5PA 3HFSA 2GTIA 1NUKA 3KK0A 9LDBA 1JHVA 1ODNA 4J0HA 1KNQA 3L7NA 4M38A 2P2GA 1KQ3A 2O8DA 2BGCA 1TKBA 2DT8A 2I3ZA 2GC3A 2GEKA 1C9MA 1NBIA 3JZFA 3AYDA 4U7JA 4XSVA 3H2ZA 4Q8KA 5FBHA 3SC3A 3OQ1A 1MC4A 1JL3A 2F3PA 1WY5A 2E18A 3OKFA 2O57A 2IYOA 4BZWA 4FFGA 1YB1A 2HPVA 3QEMA 5TC4A 3JV7A 1YR6A 1PFKA 1LCLA 1Q43A 3LGRA 2JGNA 3CH6A 5AD1A 3X1ZA 4QGBA 2I7CA 1P0PA 4H7EA 3OE4A 3HKEA 1BYUA 5FOQA 1B6SA 1XRSB 4XGIA 3VNQA 2IHVA 2NVOA 2VXYA 4KWCA 2OAQ1 5CB7A 3VI4B 3UMSA 2PIDA 5DB4A 4GC9A 4LVUA 5DUUA 1NLZA 4ZZ1A 4Q4CA 4KO2S 3LMKA 1WHTA 4QL3A 3VKGA 4HNVA 4I14A 1WMSA 5FPAA 1X1EA 5B30A 3QELB 1Q0HA 4RH0A 3LHDA 4CKZA 4QXHA 2VQSA 1T0UA 1TD9A 2VNJA 2XQGA 5DTEA 1CEYA 2JG9B 4F3KA 2E6VA 2BTOA 3GV0A 2D13A 3N74A 1LRLA 3S8YA 2IK8A 4JLVA 1RVDA 4E46A 1LLDA 3LVBA 1SLAA 1AS2A 3ZWOA 1HXS3 2CU5A 1LPPA 1GICA 2CWWA 1IZ0A 3F3MA 4YRQA 4KYIB 1XMPA 4OCTA 1JDZA 4JCOA 4ETMA 1KI3A 3ZXIA 4FJ1A 2ZANA 4AEKA 5KWVA 2WAOA 3KJEA 1XHLA 2XZDA 3ANXA 3WV4A 2DPGA 3KM5A 3EDQA 5TXGA 1B76A 4KFTA 1ZHFA 3B3QE 2XZTA 3H9QA 1IIBA 5I91A 3A1TA 4PSCA 1CZNA 3OZTA 3OM0A 2XI4A 1A8UA 5BNOC 3T4PA 3OU6A 3T3YA 3K8ZA 2UWAA 4TLMB 3IODA 1P3DA 5KYGA 1SZCA 1OILA 1L7VC 4BMPB 1R4NA 3FVQA 4EL5A 4LPKA 1NVAA 1SCAA 3NAGA 4FI9A 1LESA 3AI1A 2XCLA 5C3QA 1XXHE 5LC1A 2RJ2A 3HVHA 4M00A 4PBOA 4F45A 3WXMA 4DCOA 4PVDA 2X9NA 1PIV3 4JQOA 3RIMA 4FOWA 4L3WA 3L7BA 1UBCA 3MMZA 1MACA 2AJTA 4US0R 4F60A 3GEMA 1JF8A 4N5MA 3FCUB 3UKTA 1MS5A 3A14A 5M34A 1QO7A 1B8VA 1A0OA 4HC4A 2GH1A 3BJMA 2X5IB 4KDEA 1XRPA 1Q0LA 2I0FA 5E95A 1NCQC 1FU7A 2GEVA 4JGYA 5JWRA 1SXJD 2ADDA 1QWOA 5AIBA 1N2HA 4WD3A 1RWBA 5KKCA 1KXJA 3H84A 3K1AA 5IHXA 3P3PA 2F4LA 5DZGA 1QBGA 2BZ0A 4Q5IA 2C54A 2AFVA 3FWZA 5A5FA 4RS5C 2P90A 3TPCA 2VKQA 5HR5A 2BC9A 5E6HA 1D1SA 1PWHA 2ZWAA 3WP6A 4WKOA 4LGVA 4NHOA 5AOVA 1IG0A 1Q95A 2R062 4G4IA 2C59A 1G16A 3ROPA 1NIJA 2CMDA 1V6IA 4LHKA 4C0SA 1P8JA 1GPH1 2XQVA 1V39A 3GDGA 1KU6A 4BVBA 1HEIA 3DR5A 3LOIA 2V7XA 5CBPB 2BMDA 1H42A 3BMOA 1YQGA 5JZVA 3PQ6A 1RRVA 2ZX0A 3WYEA 5HPOA 5G0VA 3WYCA 4KXYA 2KB0A 1OXBB 2OM2A 4Q4W2 2ZAHA 2HSGA 3AERB 1PR5A 3A31A 3WLTA 4ARBA 1Z36A 4AMVA 1Z12A 3RODA 3OCWA 3OPYB 4J7UA 1R0ZA 2BW0A 1I7NA 4MVJG 1AHHA 2X0RA 3E3OA 1L3CA 3ENVA 1NX6A 1SN7A 3I61A 4ZRMA 1E7MA 2XQRA 2BTQB 3GIDA 1EESA 4B4KA 3PFGA 3GNQA 4QXAA 3N0VA 3H11A 1H1LB 3ZHCA 1SVUA 5KWRA 3DKRA 4IEWA 2Z5WA 3GUHA 2ZM6B 4QGLA 1OA1A 2HBQA 1Y1SA 2Q8EA 2FLWA 1M8KA 3QKRA 1NXSA 3PEEA 4IIUA 4EA6A 1B7GO 1AHSA 2IQ5A 2LV8A 3B60A 4NDAA 1EAYA 4C1WA 2J3DA 2OHGA 4Y9SA 3G49A 2LNDA 5AJTA 3KVOA 1WBFA 4HDRB 2ZUBA 3A4VA 2OGTA 1P2DA 1KNXA 2QX4A 4LGMA 3NJRA 3G2NA 5FJIA 4EENA 4Z8YA 4WFKA 1S2KA 3MS2A 4CM9D 3SHTA 3HWSA 5J2TB 4KR2A 1W8IA 5NLLA 1MB4A 2WU4A 3MUFA 4AKIA 3U4SA 1DIOB 4Q48A 2JLWA 1E6CA 2NV6A 1NI4B 3NBMA 5KAMA 3C3YA 3H3UA 5D01A 1KRXA 3D54D 2JAHA 4ZWNA 1E69A 4K1LA 3KHCA 2R6QA 5JOQA 4FPOB 3AYEA 4F0JA 5DFAA 4FDTA 3VPCA 4BLSA 1AX0A 2D7FA 5K0BA 4BM8A 4H1HA 4OZXA 4EAQA 2BGPA 1OKQA 1QVWA 2FU5C 4PYKA 3VD5A 2VH1A 4D57A 2O8EB 3BK7A 2FQXA 4LJ8A 5JAXA 2HCFA 2ZKNA 3NNJA 1WMEA 1SUBA 3ZSLA 4EF6A 1TEXA 1MG5A 5HCIA 4CV2A 3HNYM 2VW2A 4ZYWA 4U02A 3DE0X 4IESA 4K9RA 2RKWA 5IXYA 3DV2A 5LATA 3FCAA 1RUI3 1DAEA 5A4AA 1ULOA 2QAJA 1KHTA 3FHAA 4AVCA 1I3HA 4DWJA 3ZKWB 3DB2A 3L7JA 1W2UA 4AFDA 3TLMA 2JJMA 3I4FA 3B51X 3M34A 2GJSA 4EW1A 4MV7A 1FNNA 4C2AA 2QTVA 4A2PA 1OLSB 2X5JO 7MHTA 1KITA 4BVLA 1E1MA 1SUPA 4UUQA 5LQJA 5TPWB 3VJKA 5M7EA 1DT3A 1WO8A 3BRWD 2QQIA 1ZBE3 3A05A 4F71A 2PMCA 2ACVA 4UD2A 1OURA 1QKQA 3DPIA 1ODMA 2PH3A 3DBRA 1ZBDA 1FXUA 3SVTA 2JEYA 4M89A 3A4MA 3L79A 4GZ5A 4E09A 2CLHB 3AFGA 3ONWA 3H4MA 3Q72A 1RI5A 1QCCA 3TLAA 3ZXUB 3VLBB 1RE0A 3QHPA 5JW6A 1JJIA 4M6WB 5F3CA 4KYTA 3WA6A 4B3IA 4IZOA 4HH4A 1W1IA 2WSSD 4NL4H 4YMLA 2AN9A 1NUPA 1DAOA 1PGOA 1R5OA 1TEZA 1JEEA 4BNVA 3VOAA 5TVGA 5JYEA 1SCUA 3FROA 5I0UA 1TMYA 2AMJA 2E9QA 4OVKA 3NYWA 5A6XA 3VR4H 2K2SA 3D43A 3FZNA 5JSPA 3LDKA 3R5KA 3Q12A 3MS7A 2JGIA 2W0XA 1XCOA 4MS1B 4NV1A 3KXLA 2AG6A 1RCTE 4M86A 2PS1A 3MOGA 5CBPA 2QUKA 1NI3A 4ZI5A 2EYQA 3O83A 1YR3A 1M0SA 2R85A 3CNNA 4U63A 2OCXA 4RS5B 3USUB 4XEZA 1AR81 1GLNA 2J45A 3KXKA 3KT4A 5D3ZA 1QYRA 2VLBA 4JGYC 3A6GA 3BRQA 2ZJAA 2JGMA 1C8LA 3D3NA 2CLMB 4NRQA 1LTHR 4NVPA 5JI3E 2O4CA 3TVTA 4RHV3 1S2OA 4IEOA 3B9CA 5AQEA 3B9QA 3KKKA 4CCNA 1X94A 1AQIA 4JLWA 2Y1OA 4F7ZA 1BE8A 3QKSB 1AF7A 2ZRDA 4WZAB 3V1NA 4C20A 4BCDA 1CX9B 3GP5A 5JSZB 3CZJA 1B35A 3H42B 2ZTMA 3KQNA 1AR73 1J33A 3LUAA 1GTL1 3CSSA 2ZUVA 2ZYSA 1CERA 1W04A 1OXTA 5F5LA 1B35B 3CN7A 1NVTA 1V8DA 5KYYB 3FMOB 3MLKA 4HMPA 1L5HA 2J3IA 1GTJ1 1QOQB 2VAWA 1EHIA 3DV9A 1UEJA 1VSBA 1U2EA 4I30A 3K1JA 3I59A 3CJTA 3TGPA 1S9DA 5AKEA 3KUKA 1Y8ZA 4LC1A 1Z4JA 2JLYA 3TNYA 3L84A 1EB8A 1Y1TA 3AXSA 5FY5A 3DE5X 4C1BA 4BO1A 5BMVF 2OCPA 1IMOA 4PJYA 1XLUA 3OUJA 3A2NA 3VO9A 3DAGA 3V32A 4PQRA 3S6PA 1CAVB 5EPAA 5CP8A 4F9FA 3LUPA 1QP0A 3IQIX 4GDMA 2HV8A 3TBKA 5HZKA 1GZ5A 2Y2VA 1R092 4WXHA 1LFDB 3H2SA 4NE7A 3ESQA 3HCOA 1DG1G 3QA3E 3KQQA 1ODFA 4E27A 4X93A 5BNPB 2ODTX 1Z5NA 1VSTA 1W4RA 4IJVA 3ZLTA 3LQ1A 4KXFB 4OHRA 4CP0A 4ONUA 1KVSA 4HL6A 3FRJA 2DFCA 4NU8X 1MUUA 3PIGA 1WPRA 4EPWA 5CG8A 3EGEA 3OGGA 1ZY2A 4GKKB 4DUXA 4XOUA 3LK6A 3BQNB 1C30A 3L8GA 4CR7A 3WYNA 3C8MA 1XJCA 1VXRA 4KFUA 5IUJC 1UYPA 2W83A 4MHUA 4ZXPA 5F39A 4J6FA 4ETWA 3H4IA 1WUTA 3QKTA 4F8YA 4WZBE 4WVLA 2ZBQA 2FPXA 2WIJA 1GAJA 2YXDA 2WRAA 4NARA 4X24A 2GX6A 4YVWA 4IQPA 3PU3A 5DGCA 2QE7A 4MVJM 3C3JA 4PLWA 1W2GA 3LO5A 2EIHA 3TL2A 1UXZA 3EYAA 4UZFA 1OBFO 1ZRRA 4M0PA 2D8MA 3ES4A 3ZDEA 4CV0A 5FUBA 5KDDA 1W06A 2N42A 4XEUA 1YHYA 2QVBA 4BYYA 2NVBA 3GVHA 5FUXA 2P6NA 1G5PA 1PLLA 2XT9A 1RUC2 3R75A 4WVMA 2FFQA 2QZJA 5BN1A 1A6CA 1ZNXA 4F06A 2JHGA 5JNLA 2IS2A 1ISMA 3V8EA 4URTA 1NVVR 4EO9A 2H31A 4ND2A 4JQSA 1MZ5A 1U7ZA 5EJ8A 3HUUA 4JBHA 4QQLA 1F17A 1NPTO 4BQ2A 4NBUA 3UY4A 2PD3A 1YCGA 3IVAA 3INTA 2Q0SA 3NOOA 1XJAA 5K4AA 5FOVA 3GB9A 4JT2A 1E2LA 4LC0A 4D0SA 1KFCB 4F9EA 5AVOA 5KHGA 1NJFA 3I58A 3U75A 2XUPA 4RTKA 3CT6A 1KHHA 3GZEA 4D94A 1HFEL 3I6MA 3Q41A 2OEPA 3QX7A 4B3DA 4IL5A 2D1TA 2B2XA 4JI1B 3QFTA 2FMTA 5DNVA 3AY0A 1QDUA 2VRNA 5IP5A 4CCSA 2EIEA 4U7DA 1A9SA 2HCRA 2WWHA 3C6KA 1O8PA 3C5VA 4BP3A 2OT3B 3CR7A 5I9SA 1AX9A 1I6XA 1XE8A 2GILA 4AP6A 3LIPA 3KKQA 3NI2A 4ZCRA 1JZTA 1LGYA 3ZDVA 1KAQA 5M29A 3ZVMA 4F38A 3DL2A 1J7JA 3GT0A 2PJUA 2JI7A 4FI3F 1WW6A 5ALHA 1J58A 4BQ3A 4BMEA 5F77A 4MUJA 5G4LA 3EBOA 1A4XA 1RFGE 5JR7B 4G5XA 3UMJA 1SZPA 5IK7A 4UUPA 1QP8A 1BMV2 3ZWDA 2MYUA 4DZTA 2BGIA 1LK0A 4OXYA 3CR8A 1AXZA 1T6YA 4INPA 2PSJA 4N12A 1KZ7B 3IAXA 1S2LA 4HGYA 2CWDA 2EL7A 2H4JA 2FDJA 1TCBA 4HZUA 5FAKA 4UNNA 3FUVA 4DSNA 3HD8B 3AESA 1K5PA 3T2TA 2WYWA 4Z2WA 4TWAA 1OXKB 5BN4A 2XYPA 3BCRA 4AY5A 1SXJC 1Z8HA 5K4HA 3E6AA 5ABPA 3U1TA 3SE0A 2QBYB 4PSAA 4JJ7A 1PDVA 2XB6C 4XAQA 4CLOB 1QGLA 1NW8A 4W9MC 4CF6A 4P7GA 2Y6LA 3CEJA 2CCGA 721PA 3ZVRA 1G6NA 2VYNA 4LE1A 4X6YA 3FTPA 3EODA 2IOFA 5BYNA 3P4UA 1SQ6A 5BRAA 5L7OA 1WR8A 4CUJA 1TQ2A 1H0RA 3D4KA 4M8SA 1VE7A 4CN9A 2XDQB 4J43A 2HBZA 4B9AA 5AK6A 3D6VA 4MLPA 4O2LA 1B6TA 2Z6AA 4R7GA 4XUTA 3NMBA 1E79A 3L4BC 2D5BA 3FMPB 1EJ6A 4E2YA 2NZVG 2BSQA 4JB3A 3F71A 3BCWA 4NDZA 1HDZA 1MGOA 3CLRD 2NYUA 3G6KA 1GZ4A 4RZHA 2FX5A 4Q1EA 3TZQA 4GBGA 3S0JA 3O1UA 4N9QA 1D6NA 4BEVA 2WO2A 1AJEA 2XE6A 4X1OA 3RJ5A 1I3NA 3AB0A 3KV4A 1PGQA 3IEMA 3T4VA 5ETJA 2ET7A 2F3QA 4H08A 3T3EA 2JG8C 3M9WA 4OQNA 5L7YA 4IH1A 3AM3A 3GI1A 5DYWA 4FOVA 1ZNYA 2ZR8A 3NGXA 4YG0A 3EVDA 4ITVA 3ZYFA 5E9WA 4QJ4A 3WFIA 2OIIA 2VT7A 4RD4A 4Q9DA 3QRWA 3KQPA 2QL7A 4IXWA 2GXSA 5IAJA 3STTA 3QVSA 3B5IA 4HATA 4NEGA 4ODIA 1S1MA 4AHWA 2V7VA 3L5OA 1X7ZA 1AQJA 4UXIA 3OF3A 1DKPA 1VCNA 3BA1A 1LVUA 1CR7A 4GBMA 3DL7A 1ZJWA 3K4AA 2A1IA 3I4CA 1XCMA 3WDLA 1M2VA 2V0NA 3HB9A 1JLRA 5DMXA 3OJXA 1SB8A 3VD3A 1ZEMA 2PZ8A 5IM4F 4JX8A 1U3UA 3L7OA 4WBNB 1OGIA 2J07A 4D6QA 1IUOA 1Z6QA 5K51A 2WOOA 3K0CC 1SQ4A 4DBLC 4B73A 4XBQA 3S2FA 2BKXA 4WNIA 2XB2A 1E5XA 2GK7A 5JOWA 3Q7RA 4A6OA 2ZRQA 1Q5OA 3L7DA 4ER6A 4ZOQI 1HNNA 4IRMA 3TINA 2F3TA 4ZVUA 2VHYA 4QNRA 4LBYA 3PZRA 1AL0G 4JKIA 4YW2A 3A9WA 1E8NA 3S2GA 4E94A 5FXZA 1OT5A 4D8XA 3VJRA 2OC9A 2VTEA 4GKJB 4RJ2A 3B7MA 2ILTA 2BNMA 3ZW9A 2CSGA 5JSQA 1O5LA 1YDFA 5KVQA 3FZYA 1RB8G 2GPBA 2EFEB 4EROA 4MINA 5E38A 2ZQ5A 4PZPA 4FDMA 4HGRA 4LJLA 2I22A 1IBRA 2PQ0A 4D45A 1KFKB 3I01A 1I6LA 1Y1LA 4AXBA 4Q7EA 2CLIB 1ZZBA 4Z3OA 2PJRA 4URVR 1VIYA 3MRXA 3KGZA 3KVBA 2WOJA 4M8KA 4DKJA 1FS6A 3WY6A 3OKAA 2QRMA 3HZOA 2XZOA 4L5BA 1WBBA 5JYCA 1LDGA 2FW1A 1QZUA 2AJBA 5HFNA 1RXYA 1JDSA 2WFLA 4UEQA 4DHWA 2VBDA 2YV5A 2AB0A 3L6DA 2WS92 4ZTZB 3BJZA 3RVBA 3G7UA 2RR13 3CURA 3PT9A 4H77A 2OD7A 1IZ7A 2VMHA 2RH8A 3WISA 4IXNA 3ITKA 1BKZA 1OX6A 1VRCA 4MUIA 1DJNA 3IE0A 4CZ2A 5LJLA 4PONA 3K75B