4K40A

Peptidoglycan o-acetylesterase in action, 0 min
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
349
structure length
349
Chain Sequence
LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis lnp21362
total genus 115
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k40A02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k40A01
5HOEA 4I8IA 1WABA 5A4AA 4Q7QA 4LHSA 4K9SA 1PP4A 2APJA 4OAOA 1DEXA 4JKOA 4JJ4A 1BWPA 2WABA 3U37A 2HSJA 3BZWA 1ES9A 1U8UA 3DCIA 3RJTA 5BN1A 2VPTA 4XVHA 3HP4A 3W7VA 4OAPA 2WAOA 4JGGA 3DC7A 1DEOA 1ESDA 1FXWA 4HF7A 4JHLA 2Q0SA 4M8KA 4DEVA 4HYQA 4S1PA 4H08A 4NRDA 2Q0QA 1ZMBA 4Q9AA 3DT8A 3DT6A 1V2GA 3SLRA 1VJGA 5B5SA 1ESEA 4K7JA 1Z8HA 4RW0A 1ESCA 4IYJA 5CD9A 1JRLA 4JJ6A 3DT9A 4K3UA 4K40A 1YZFA 1BWQA 4TX1A 3P94A 1FXWF 2W9XA 5JD3A 1K7CA 1BWRA 3MILA 2O14A 3C1UA 4PPYA 1J00A 3KVNA 4RSHA 2WAAA 1IVNA 3SKVA 3PT5A 1VYHA
chains in the Genus database with same CATH superfamily
3WL5A 4OGLA 2OPHA 4B8ZA 4NFHA 2EV9A 3OZRA 1PJ3A 5EFZA 3QSGA 4D9IA 4PZEA 1N33B 4YG3A 5FCDA 2HQBA 1NSYA 3LYHA 4YUVA 3SQNA 3KHBA 1P0PA 2HWD1 4QBHA 4BFWA 3KPJA 4PC1A 1CJUC 2PQSA 3H8UA 1UK6A 4KH0A 4JKMA 1IEWA 2FI1A 1AQIA 3O1MA 4CMGA 2YCBA 1F6WA 3NC1C 2AXQA 4F2GA 5CA6A 5BVGA 4E5YA 3RT1A 2VO5A 2WNVB 1RI3A 3N2KB 1ANKA 1E98A 2O8CA 4MZUA 2QMYA 4MMYB 3DXUA 3DQZA 1P0QA 3NHUA 2HLDA 3LO8A 3HEAA 5ADUS 4HQOA 1XTPA 4K46A 4MLOA 4Q8KA 3KO8A 5FZGA 2JIOA 3EC7A 1FQWA 4FN4A 1Y6GA 2YUTA 1Y3CE 4YARA 3NHAA 4LE2A 2P9ZA 3BF8A 2QUZA 3K73O 2JICA 3NONA 4FWIB 5K9ZA 3B6KA 4CLXA 1OYWA 1KU6A 4XGIA 5E6RB 1JIIA 3QKRB 5AOCA 3VDRA 4CGYA 2WAXA 1KI6B 4B34A 2FPGB 5B1EA 4UUNA 3GLIE 4MO3M 1IN8A 3U2QA 3PYMA 1RWXA 3EJKA 3AK0A 1W1WA 3THWA 1OXSC 4XXHA 4ZXEA 1WKYA 4UFNA 3D6UA 1QU3A 1QGZA 3QVGA 2OQ6A 3EVZA 3HBMA 1LOFC 1DC5A 1OLQA 5HRUA 3DPUA 1W28A 5GKAC 2ACEA 3IULA 3F71A 2I8AA 2OBYA 3I2DA 1C4WA 1Q77A 5EL0A 1KS2A 5ARCA 1ISHA 1SUDA 1NXXA 3EDRA 4L57A 1Z0SA 3N76A 3E27A 5KU1A 4NPMA 1Y89A 2GC3A 5LY2A 1RQRA 4ESOA 4Q3NA 5DCUA 5FFMA 4EFMA 4NCNA 3ZI0A 2IZ1A 2OCDA 3WEZA 2J3IA 2BISA 1KDPA 3CLSC 3K9CA 3E23A 4EATA 4UOJA 5JZGB 4IF6A 1WUVA 1DWQA 4P0QB 1T8TA 3RT7A 1WW2A 1BAPA 3CISA 3TRKA 1Z6QA 1D2HA 3R9XA 1L5LA 2XCQA 3FF1A 2JJ1A 5F9HA 1O3SA 3AV3A 5C33A 1ZH2A 4DKXA 4DQXA 5JXHA 1X36A 4BNYA 3A14A 2V7VA 1MIOB 4ZA2A 2OSVA 5K3EA 2JFWA 4H1UA 3CINA 3V1YA 1C28A 4TM7A 2B4AA 4Y6OA 2D5LA 2RGUA 3IGFA 1I1NA 1P2TA 4MW0A 4LO8A 2UXBB 5F3EA 5C4WA 1A88A 3FDZB 3K72B 2ST1A 1RAHA 4MQEA 4TMZA 1KJNA 2ENRA 4BVLA 4ND8B 2O2IA 5F9MA 4LKEA 4YJ3B 5K45A 1Z33A 5IT9A 4NJMA 1I4TD 3ETLA 4TRJA 4NCIA 1YJQA 2NTEA 3W5SA 2R4UA 1JIQA 5GM1A 4JGZA 1GNSA 1X38A 4LXQA 3QU4A 2R2GA 3K0FA 2V4UA 3HFRA 3MQ4A 4BLRA 1RYEA 2OKGA 5CT5A 3A4MA 1SLAA 4HBNA 3FHCB 1Z45A 5LZ4A 4TSFA 5KJCA 1A5AB 3T9EA 2VQUA 3GDBA 1UWKA 3L46A 5ITVA 2XQKA 4IRXA 4YLZA 3WR5A 1QQAA 2Q4DA 4G25A 1DKQA 3THYA 3R0XA 3OJLA 4MO2A 4Y22B 2XB8A 1VBD1 2PHLA 4QVGA 1S3IA 1XZDA 2ZBPA 1YBAA 4QD3A 1AF4A 1XK6A 4OQEA 1MNAA 1T0BA 4JWTA 4NYJQ 2VSOA 1XU1A 4MR9A 1CU1A 3OM8A 1IEXA 2B5WA 3EHDA 1FXUA 4YFYA 3UWDA 1N5RA 2FRVA 4FP3A 3WZ1A 2EX0A 1YL6A 2A8YA 5AK4A 4CKEB 2YICA 2GZWA 2XRZA 3HAGA 1R6VA 5E3HA 3OWHA 2AZXA 2ETEA 1HEIA 4HWPA 1NSTA 3Q2IA 1ZD5A 1W4RA 3CH4B 3H1BA 1YFLA 2AF3C 4PC3A 3NNSA 2YZ2A 1G4UR 1CJDA 1DWUA 1GFF2 3TUJC 5IWCA 1S2DA 1KVRA 2OCPA 3ZHOA 1MS3A 3NASA 3ZDAA 3AYCA 1GQYA 1XTRA 1KS4A 3K5WA 3TBFA 5CDUA 1VBC2 1ZICA 2C2XA 2FQYA 3ESQA 5HCNA 5G0SA 4RDHA 1KP3A 4X7MA 2W52A 5AQ1A 3G7DA 4YRNA 1T9KA 2I5PO 3ODGA 2D2VA 3HU5A 2GAUA 1XZIA 1RWOA 4ZS2A 3LFUA 1W9YA 2HNKA 1G16A 2GPJA 3VZLA 3CM0A 3CW8X 2Z2KA 2W08A 1DQ5A 5CFOA 3GZNB 1X1QA 1XEXB 1Z06A 2AJCA 4N0DA 2FPIB 5TMBA 2EL9A 1VJGA 3AM2A 1L7DA 3FPAA 2GZMA 2Y2UA 5BN5A 2X10A 2DFTA 1M1UA 3SC4A 1X2EA 4M46A 3KV6A 1Q5PA 1HUQA 2GH8A 1LR5A 4ZQHA 1NAEA 4WZAB 5EUMA 4Y8VA 3H5AA 3BN6A 1W85A 3V64A 1ONPA 5E6UA 1VSUA 1V6NA 2FPXA 3Q9UA 3QWIA 1U7XA 4C3ZA 3NHZA 1DAGA 4IMJB 4JJIA 2DLNA 1C29B 4D2IA 1HDGO 4C03A 3ZYJB 3MD0A 5IVFA 4KL8S 3PNYA 1K3UB 5F78A 2ZGRA 3ZHBA 2H7VA 4K9SA 2FJ0A 3EWSA 4MWEA 3NANA 4F93B 4PG6A 5GONF 1FDTA 4ITVA 4U2GA 5FUBA 1CQ9A 1QO9A 2KE5A 1ECLA 1L5OA 5K4LA 3O4VA 1PX4A 4MQUA 5CKMA 1JILA 4JBHA 1C3LA 1EK2A 3EXIB 3OMXA 1U3CA 4HTFA 2BRTA 3BCUA 5FNVF 2ZHMA 2PXCA 4H7FA 3L9XA 2BW8A 1NMYA 3CZ9A 4L95C 3AJDA 1EUDA 3A1DA 2Q9BA 1ODNA 1VJ1A 3UBTA 3IMCA 3F3MA 3ASZA 1FYDA 1RYFA 2IYRA 5HILA 2WR9A 1Z7S3 2WFPA 3R0QA 3ESAA 2BI4A 1CIVA 1RKUA 3UJ7A 2OUKA 4HEHA 2ZGOA 4Q21A 3OBAA 2JHGA 1FP2A 3AILA 1PIV2 3E7DA 3GBVA 1ZWLA 1MR3F 1CP3A 1ND3A 2FJUA 1JLKA 1XFDA 2NU7A 3ZQJA 3K0HA 4BX0A 3Q8XB 2RHBA 3FKJA 4IGKA 3HCAA 1OMIA 5DLPA 3SPXA 1FBNA 4RS5C 3HBJA 4CCAA 2UYYA 1C1LA 2JK1A 5BT9A 3LQRA 2VH5R 3U81A 1GAXA 4GDFA 3VQTA 2AJBA 3BMOB 3GV0A 4F2HA 1W4CA 3CEHA 4FPOB 5M34A 3WG4A 1JYNA 1VI2A 4NATA 5FOTA 1K5JA 4HZGA 1ZRDA 5DASA 3QEOA 2X8LA 2RIPA 5A9SA 4PCAA 1OUXA 1UAGA 2ZKNA 1VBNA 4P02B 1KH2A 4K6OA 5D84A 2QBYA 1JIJA 3OIWA 1IXRC 1KSFX 2R86A 4QX1A 5HF6A 2GSWA 3RUAA 2LTNA 4YUXA 3EEFA 4LAFA 4CDWB 4RXMA 1JEAA 2P2ZA 2VT6A 4JXXA 4TSRA 3DBOB 5JS2A 2X2OA 2IZWA 1OI7A 3R6WA 3ZGXA 1SZCA 1QRSA 3OLXA 3QY9A 1RC1A 1G9FA 1CE8A 1E1DA 4QJ3A 4UHFA 5E6SB 5GZ6A 4GWKA 4QULA 4BLQA 4R6XA 4IZIA 2D7FA 5CA0A 2PY6A 3MGUA 1UAYA 3ZK8A 3S1LA 5DGDA 1CIPA 3OJCA 5BORA 4GBJA 2XLCA 4CKCB 3F9CA 4JHXA 1XU2A 4HX9A 3VKUA 2J5KA 1WZEA 4RNDB 4A3ZA 1AZSC 1LFDB 3QEAZ 1PHMA 1TVCA 2BFNA 1VG9B 4HZIA 1D09A 1PQWA 3N2YA 4X6LA 3EXEA 2AOUA 1NBWB 4MRAA 2FQWA 4NHKA 4PY2A 1TU0A 4NAOA 1R9JA 4ETNA 4IHJB 4MUAA 1J25A 2PSFA 3K2EA 2LCFA 5FPTA 4E5UA 3EN0A 5IKXA 2XYQA 4Q6WA 4TZKA 3K70D 1DAMA 2JENA 2ATFA 3R3SA 1OJ7A 1X9IA 2VE1A 3TM5A 1BE6A 1DO0A 2WJ6A 1BWSA 3G1TA 2J5XA 8AT1A 1IL0A 1GPAA 3I1JA 1ZRHA 4BQRA 3BZWA 2WT8A 1PWHA 4J0CA 1TM4E 4ILKA 2YRXA 1EEXB 2HJGA 2W6IA 1XN4A 2OC9A 3EY4A 2AB0A 2IPLA 3G2NA 4K8FA 3KPVA 1LAJA 3LGRA 3N35A 1OPRA 4OHRA 5I6DA 1P0CA 3AX6A 3I5UA 5FY7A 4US2R 1N4DA 1E3MA 2C0QA 3X1JA 5TEVA 2A9QA 3AJYA 2WWIA 2VHXA 2WICA 4XDPA 5IUKC 2B42B 2EFGA 5F3WB 3GRRA 4WFJA 4M37A 1Z6AA 3NJ4A 3I9FA 3O8RA 5DM0A 1NJSA 1GZ3A 3AB8A 1F3OA 1CUAA 3U4SA 4IIYA 2C0ZA 3APBA 2V73A 4IL5A 5LKAA 1L1FA 4F45A 4BQWA 2WNVA 4F46A 4R1QA 3N2KA 3ESDA 2Z9BA 2B5OA 4LDZA 1SG3A 4UM9D 4AY3A 4KN5A 5B7GA 3JW8A 3UB2A 2QN8A 1SUFA 4D8VA 5D5PA 3I04A 2AKYA 1BWPA 4Q9HA 1CS4C 4OCZA 3ZH2A 4LKOA 2J7KA 1U8XX 1ISMA 3GZUC 3DBHA 1ZBE2 2Z6VA 1M1XB 1G19A 3DC7A 4F04A 1QFXA 2VRCA 1XZHA 5CK4A 3WQBA 2ZGMA 2BGIA 2QDNA 5FMOS 4W5TA 2XCSB 4QXMA 4R1NA 3C48A 4LUCA 4DUGA 3R40A 1ZS9A 5E6RA 4V0RA 1R4MB 3QKRA 4XLTA 3RASA 2P2CA 3TNFA 3HYCA 4AG3A 1KI6A 1OA1A 4ZDJA 2FPGA 5FK8A 3I52A 1Q95A 3V1MA 3RTCA 3WMRA 3KG2A 4UNNA 3CB4A 1ZOLA 1QFSA 4GJYA 4GLFA 4L6AA 4B9AA 3RBVA 3C3CA 4MULA 3I2FA 2KBFA 4ME6A 4OLHA 1P7YA 5DHPA 2IEAA 3SXWA 3G8DA 2JE7A 1ZW6A 3DQPA 3JB8A 2MJLA 2XVXA 5ES4B 1CB7A 1AG9A 1VL6A 1X1BA 5LEJA 1OXBB 5AVWA 1XCOA 4FHGA 4ZU5A 2XVAA 2FP3A 2WWRA 2PJZA 3WLUA 1E5HA 3NQHA 4CN9A 3JYLA 4M4SA 2JD9A 4MA5A 5HG0A 5BUVA 2YDXA 3OCPA 3P9QA 3IWZA 2W6OA 2Q28A 5JZGA 3BTXA 2AR0A 2AI2A 5JS7A 2EIEA 1CZNA 4N5HX 3DKWA 3PQ5A 4QYMA 1VRH1 3M9XA 2O5CA 4UUAA 2QN3A 3HNMA 1I8TA 4DQLA 3CRNA 2HHAA 3H6GA 4C21A 4MRNA 2D5HA 4H6WA 1QDEA 3FTCA 3CZPA 5CTAA 2EP7A 2GYVA 4CP2A 4KXXA 5IVDA 5J1XA 2PEZA 4DV5B 1MIOA 5D5HA 1PSWA 2LUOA 3CGGA 1G0OA 2GI4A 5FBJA 4YT4A 4TQUS 1QRTA 3M82A 3U39A 4BBPA 1OAAA 5IHPA 5KJ1A 3FDZA 1LBTA 4F21A 3KZNA 3U17A 2PHDA 3F5SA 4JI3B 4YRSA 1TQ8A 4AZSA 4ND8A 4E2YA 3JWGA 3W8DA 3WWDA 4KN8A 3N8HA 4CG2A 5DM2A 4DQUA 1GPLA 4OP3A 4UUBA 1K45A 5LP1A 3G6JB 2PGOA 5DSTA 4XR9A 3FSJX 4MUYA 2J3KA 2Z3ZA 2VSNA 4JYZA 3GZAA 5IT5A 3GJTA 4YP1A 3SSAA 5FOQA 3HRKA 2J09A 1PG5A 1SBIA 4L4SA 1U3TA 4HGZA 2RS11 3MFQA 2TYSB 5HKKD 3AI2A 2E48A 4JUBA 4I4TB 2PWPA 2FSIA 2PKXA 2D8MA 3H1WA 1T91A 3IFSA 5AI6A 5EZ5A 4YRJA 3FKSA 3WLOA 2DJIA 4CCDA 2IV3A 3PHMA 4I3GA 1KMIY 3NW4A 4EPRA 5C8YB 3FE2A 2P9HA 1H8EA 2DY0A 4C0KA 3LOPA 4I50F 4Y0AA 1C3OB 2XHNA 1PMIA 4MDEA 2ZJ3A 1O0SA 1V37A 1ZG3A 2B4YA 2IPXA 2WLTA 4L0DA 4KHZA 4G97A 4GPEA 5IXJA 2CJYA 3KB2A 4K6KA 3MLKA 5AIAA 4N3GA 2XQXA 3W2IA 3CX7A 5KHOC 3G0BA 1W44A 2BDTA 4U6QA 1E66A 1DG6A 1GLVA 2AUTA 3PUAA 5ALFA 5JTTA 1YWKA 3SQWA 1E6KA 4G0PA 5JLAA 5C35A 4RHCA 3TFOA 4TV9F 4LMAA 4KQGA 4C6TA 2Q6TA 3AUXA 2WVAA 3IP8A 1HFWA 1TRHA 3WK5A 1ZD1A 2AREA 2FPUA 1WDLA 1DRUA 3BPSA 4PYOA 2YH2A 3HT2A 5CVCA 2QUIA 4CN8A 1L4UA 1F8GA 4JUCA 1NWHA 4QDOA 2X7JA 3ZWBA 4QAWA 1Q0SA 2O8QA 4M8SA 1A4XA 5C3UA 1CESA 1PEYA 6PFKA 1NQUA 1WPRA 5F21A 4L0CA 4DWOA 4UASA 3AWDA 3VO9A 2O05A 5CA1B 3I09A 4CMEC 4YC7A 4HAIA 5J4HA 3AM5A 2IH4A 1EGMB 3DAGA 1G6KA 1UT8A 1BDMA 1RIFA 4O29A 4BN0A 3GZNA 4NBLA 1CQJB 1KNQA 3A0UA 3RYHB 3UJ3X 3TB0A 1XEXA 1D0SA 1N5DA 3DAPA 1E18A 3WDXA 2QMOA 2YFYA 2ZRLA 2FPIA 3NDIA 3TM4A 2WNHA 1F5SA 4HL0A 3RZGA 3P9RA 2LROA 4Z7OB 3T5DA 4DLTA 2F6RA 1HNZB 5INTA 5IU6A 4RQUA 5FYUA 3U7EB 4WZAA 4AXXA 5LLTA 1BG6A 3WGGA 5CB7A 2W6MA 2YBDA 1W9FA 4ESEA 3GJ5A 1NR5A 3KAJA 5EWMB 3OX2A 4NHMA 3SFVA 1KFJB 1ADCA 2XNSA 4RC9A 1UJNA 2WPDA 3JWJA 4Y26A 1IG3A 1LDMA 2VXJA 5K0EA 1OGJA 5ILGA 4YVSA 4OXKA 1MMFB 3KZ1E 4HQRA 3EBRA 4TRRA 3BWXA 1RXYA 3MHZA 5EUBA 4HB0A 1LESA 1QGDA 1CNMA 2IZ6A 3D2AA 4LLOA 2F3SA 1DADA 2P5BA 2XNKA 1U0FA 3EXIA 2BE7A 4V0MA 2ZSDA 4ZO4A 2ZBDA 4D80A 1CAUB 3N74A 5CA0F 2AKAB 1BOOA 2Q0AA 2QEQA 2ZRPA 4QWWA 3VR6D 3JR7A 2QP9X 1FEZA 5GJVC 4PR3A 4XWKA 2GNDA 1DC8A 1FJGB 3B3QE 5LRSA 1HG1A 4DV2B 2MMGA 3N70A 3AF3A 1E3TA 2C3OA 4NMXB 4RHV2 1RMU2 3RJTA 2PGXA 4QGMA 3L1UA 2G9VA 6GPBA 2JFHA 2IXDA 3VC1A 5SZJA 2NGRA 3QKSB 5GZGA 3AGQA 2DETA 3A6ZA 3CO2A 1MOSA 1S02A 1XYPA 4ZD6A 3T8YA 4ZOLA 1OFGA 2D6KA 1TMGE 2QGZA 2FYTA 4NFLA 1R5NA 1LK5A 1U0GA 5DCWA 4ZU3A 1HB1A 4XFDA 4N3CA 2F9FA 3GCDA 2UYHA 4BTEA 1Z6TA 4Y0VA 2GN7A 2OV8A 5JMWA 3C3VA 2E4WA 2A5LA 3UAVA 4GD4A 1A4IA 2V6IA 4ZMBA 4NLLA 3DH0A 1KQPA 3Q41A 4GOLD 4UVIA 5K0UB 3FY4A 3C6ZA 3OQVA 2ZDGA 4Q3DA 2FSVA 2R7AA 1HE2A 1KJYA 3SAJA 1Z2AA 2PSHA 3WDYA 3JQAB 1NA1B 4XXAA 1FF9A 1G291 4TSKA 3UJNA 5GGXA 3EVAA 4UPVA 2O5EA 5FOVA 5L7OB 4ARBA 3DD5A 3HNBM 3CXUA 5IYYA 3HHPA 3U4HA 2G5GX 2PV0A 4K20A 3RIMA 4CDWA 1AN9A 1PZ7A 5HV0A 2BT4A 3HWSA 3S81A 1QIQA 1O95C 5HZHA 2DF8A 5IBPA 3FX2A 3GEGA 1BXRB 1VB4A 3KSUA 5E6SA 1KJRA 3WRWA 3PQDA 3I2IA 3OTIA 5JYBA 4ZANA 2YJGA 3IXLA 3QU5A 1JKFA 2PLAA 1KRWA 1CY0A 1FP7A 4CKCA 3NBMA 1IZ7A 1OIWA 4OXYA 1SGWA 1QGYA 3FAZA 4XFCA 1WTAA 3R7LA 1H4VB 1FOD3 5COAA 1TM2A 4G81A 4MYSA 3U13A 3WHKA 2H48A 4JLJA 5FTLA 4WECA 4MOWA 5HZGA 2NT3A 2Q7OE 1JTVA 4JRAA 1C9KA 1SUCA 2FDHA 4IHJA 2WPNA 3JYNA 2YRFA 3FR8A 1FP1D 3R7WB 3VISA 1JLSA 1DSSG 5JSRA 2EJWA 4DA6A 3WB1A 1K2VN 3H3XA 1M34E 2G08A 5KNBH 4XD7D 5K01A 2XA9A 3N0WA 5EHXA 3WNXA 3M6IA 4DSOA 2C3PA 2VXCA 1U0JA 1ZLXA 1IHYA 2WR8A 4YAOA 4KAAA 1F06A 4UNRA 4B82A 3F5DA 3AFIA 3E48A 2QUBA 5BXYA 1DBRA 5HZKA 3DYPA 1KY3A 3FRHA 5JU6A 1F38A 1XBFA 2Q3LA 4CHTA 2Z6QA 2XKKA 3V1KA 4LWOA 4WEQA 5KX5F 2O54A 2JGMA 1WJGA 1EUZA 4UT5A 4N5IX 2GA8A 3I01M 3L8GA 4MGQA 3V8BA 2Z1MA 1R9MA 2B1GA 2G40A 1T1IA 4MDHA 4X1IB 4F0JA 1PZGA 2C6SA 1DPGA 3PWTA 3UKOA 3ZUPA 3FDJA 3V0AB 3OPTA 1G6OA 2HNAA 5BV6A 2VHWA 1L1EA 3UG6A 2FWNA 3NVMB 1VG8A 3BWDD 3MF4A 2OA0A 1E9FA 2ZTUA 2RHMA 5LCXA 5AVAA 4A4DA 4BYYA 1N5IA 1XZJA 3BWVA 2PYDA 2PH1A 5K8IA 2B8WA 2HK6A 1EP3B 4QKFA 1L3JA 4RZ2A 4C2AA 1GZUA 5C5CA 5B2EA 3QU9A 1DC7A 1Z2EA 1N6KA 3ZXJA 4R1TA 4ZK6A 5JIAA 4R6WA 4DQAA 3CMCO 2ATCA 1U2RA 3HSYA 1FATA 1TME3 1BEEA 1FUYB 3BTSA 4PV7A 1HRV3 5ALOA 3VR4H 1G4HA 1GQHA 2F7SA 2OXTA 1ULBA 4KQ6A 2NQTA 3LA2A 2YBSA 4YJ3F 1PHRA 3PDQA 3UANA 3BAFA 1Y5LA 1XQ9A 1ONAA 2A3YA 1B6TA 4PIPA 2VT7A 3PTZA 3VPBA 1UF9A 4C1BA 1KYWA 3T95A 1NW9B 3T3EA 2GCPA 4FPEA 6Q21A 4NHEA 1TU4A 4UVGA 5IVVA 2ISCA 3SMHA 4FM9A 4F2DA 4GIBA 5C3PA 2QUJA 3T2OA 1YMQA 1XTQA 2R1UA 5FBZA 1QOQB 4UE2A 3DPRC 2ZAHA 3N6XA 5P21A 2DH6A 1U0HC 3Q11A 1RUG2 4JBNA 5DW3A 1R1DA 1CZOA 5IBRA 5LMNB 3TDKA 1JMUB 2ZBJA 2QB5A 3MVEA 4P7GA 1Z29A 2HU8A 2GP5A 1IN1A 2BD0A 4AB1A 2I66A 1Y9QA 2Q7XA 2WVJA 4LJ6A 2BKEA 1LSUA 1FY2A 2JLYA 1QJEA 1KPIA 2YN0A 4GKJB 2JI7A 4Q37A 1LLQA 1TK2A 4GR5A 5MGNA 3VDNB 1UBKS 4KI5M 1XAGA 2YQZA 1BFDA 1NVBA 2RJOA 3WNOA 5JYEA 4AM8A 7ABPA 4B1FA 1HGXA 4E22A 1ZD3A 3DLTA 1CX1A 4MCHA 4XIJA 1E61A 1W99A 1XZNA 3FNRA 2Y1WA 1V1RA 1SBTA 2LM3A 4ASLA 2O8CB 5D86A 3VBFC 3RWBA 4Z9XA 4DJ5X 1M3SA 4U36A 5C52B 2JDAA 2OORA 3GYBA 1AUOA 3PIGA 3AJEA 3JS5A 1EFPB 4CF3A 3HGQA 1IQ0A 3QENA 5FR1A 1XHEA 1DFQA 1A77A 1F5JA 1T5TA 1JZ5A 1H1AA 3OYWB 4KWTA 2CLCX 5TS2A 3WF4A 3TLEA 1W0KA 4YCCA 2NYYA 1NBEA 1X8MA 2H5JA 2IEBA 3T0IA 4JLBA 1CUSA 2HRBA 3HR4A 3VYTB 3ZW8A 1IPSA 1PNQA 1BK1A 1G5RA 5JMCA 2O59A 5CG8A 3K9LA 2QVSB 4QAQA 4X6YA 2HOQA 4RTRA 4C4SA 3K8ZA 3B38A 1AX9A 3V1LA 5CYFA 2FETA 3F5MA 4K9KA 3JQRA 4GOJA 2J8ZA 3VU1A 1AK1A 1PDOA 4I4TA 1D3AA 1PG0A 2XYVA 3Q7QA 2FCRA 5CVTA 1A1VA 5CFCC 3LCPA 5HF5A 4PWZA 3AL6A 2ZT6A 2VWQA 1IH8A 4IQPA 4D4MA 1M73E 5A3JA 1XXHB 3B20A 2XRYA 2DVGA 3AVSA 4L9SA 3EB7A 4B7EA 5KHGA 1C3OA 1FFDA 3G23A 1G7YA 1XLWA 3VC2A 1A7JA 4TOIA 4BQYA 5AJYA 4AG5A 1RAIA 1TF7A 1G4AE 2KXLA 3E2MA 4XB1A 3MTAA 4F4JA 4PBTA 3G85A 2BMFA 2VJCA 4F8JA 3TX2A 1XDUA 3B00A 2M6KA 3AFOA 5BNOB 1CJKC 2C3UA 3R8XA 1TA9A 4BJ6A 2OZKA 4DRYA 4C4XA 1UOFA 3BWEA 1YZLA 3QPBA 3WDVA 4IVRA 5TF4A 3ID6C 1TNDA 1Y7LA 2XMRA 4UQLA 3BL6A 1XB9A 4DDVA 4RQTA 4XVUA 1I10A 4B4VA 3IT0A 1U63A 2IU4A 1PJBA 5FUQA 4IEOA 2VTEA 2GF2A 1MAAA 2PL1A 4COUA 4JC4A 2E7TA 4XCVA 3R7AA 5CA1A 4LE1A 1OVSA 3C85A 4LTNA 1NRXA 4B3RB 1E57A 4L85A 4DB2A 4QD2A 1I6KA 1TA0A 2ZAAA 3GVPA 4YAWA 3MERA 3B5IA 2JE8A 5EZ6B 1CQJA 4AMBA 2CUTA 3RYHA 3ILXA 4RKRA 3ENWA 5J59A 5DGTA 1UODA 1H3NA 4RHFA 2YNMA 3PRYA 3V8VA 3THYB 2PX2A 1V9SA 1S5PA 1RRKA 3OD0A 3RSOA 1COV2 4RH3A 1DJNA 4NMIA 1FI2A 3TLZA 1WB4A 4NE2A 2DTXA 1N2ZA 1VPLA 3I23A 2YHUA 1U90A 3KQMA 4MR9B 4G0XA 2V7PA 4M9ZA 1ECGA 2DCZA 4C8DA 4IF4A 2MYNA 5D3MB 1DEKA 3IYLW 3JD72 1ZM7A 4OCTA 4HG2A 4MV7A 2GXUA 3A36A 5EWMA 4XLZA 4N43A 3DL2A 5FV7A 1IWPB 4TS9A 5SY9A 4YYZA 3D2CA 1GRCA 1CPYA 1SJ9A 3N7LA 4Q1EA 4QHZA 1W0CA 3B8EA 3NOOA 3MFCA 4Q5IA 3K6JA 3O1VA 4FIDA 3OE7D 4SBVA 4K81B 3DEYX 4N5NA 3V46A 4YHBA 5BO5A 4Q7QA 4ZCLA 3K0AB 4D9KA 5AJXA 5KINB 3Q3JB 1ACJA 4R40A 5KJFA 5GTDA 4GL4A 3NWOA 2DPHA 5BRAA 1Z47A 1N6HA 2CNDA 4YRIA 3NWKA 4EAAA 2RGDA 3VTFA 1DELA 1BVRA 3AIMA 1T6XA 2NU8B 3GYGA 4Y1YA 1KZYC 2KA3A 5AOVA 5K03A 1GTZA 4CQNA 1YZHA 3RVMA 3N4MA 3J8F2 4M9QA 9ABPA 1KO5A 1S0JA 4RY2A 1FMJA 5GV7A 5J3JA 5FZ6A 3W5VA 1H1IA 3JQGB 3IMGA 3X43A 2X2FA 1DHRA 4EL0A 2VZ8A 2NO4A 3P0EA 4BO5A 5C7OO 3FFZA 4BNMA 1PO21 4B6OA 4UFKA 3QKSA 5CAZA 5CNAA 1ISGA 1IN4A 4OXNA 4I99A 5REQB 1UBRS 4ZJYA 1W4LA 2HMWA 3RMXA 4GZ3A 3BHNA 3SX0A 2O2GA 2FP4A 3P4UA 4PHCA 1JJAA 5EHGA 3OC0A 1OX6A 2E9SA 3QM1A 4PYIA 2YOGA 4UCWA 5E6UB 2YY7A 3MHPA 5JAMA 1JLLB 3ZZTA 2JCBA 1SXHA 2OV6A 1ENSA 1TO2E 3UK2A 1Q92A 4RJJA 3ZHVA 3SR0A 3DEHA 4UTNA 5K0UA 4FCTA 1MF7A 1SBCA 3I3EA 4F5ZA 3OOHA 2JE9A 4HNHA 4G5HA 1SG9A 2YXDA 3C2QA 2A9KA 4WLUA 3JQAA 3OUTA 1NA1A 4O65A 1O77A 4CDUC 1GXSB 3VGPA 1W35A 2DT8A 4JITA 2Q3EA 5L7OA 3NBQA 2NG1A 4JSYA 4PS1A 1TCAA 3OOWA 3UOGA 3AZZA 4XFHA 5CK5A 4P3OA 4BO1A 5TT1A 3R7DA 3CSDA 2VBIA 4F60A 3NHJA 3ZZUA 1T1JA 2WF9A 1DT5A 5GPBA 2FFBA 2ZSAA 3ZKAA 4MK4A 4W5NA 1A8HA 3AUKA 1BXRA 1EUDB 1A8IA 5I9MA 1VAMA 3BM5A 4CT5A 3HXKA 1E5LA 3G0GA 3P9SA 3VAYA 4ZREA 3SZLA 2VTXJ 1Z6YA 4LRYA 3TECE 2I33A 1P7ZA 5FZMA 1GA4A 4OPMA 3II6X 4NU8X 4PYRA 1AHIA 1RWWA 1TEVA 3FL7A 4NPAA 3WDMA 4MWZA 3GWGA 5JBQA 3VR2A 1SQFA 1GCAA 1YTUA 1AYN2 3UWPA 7ADHA 2IVIB 4AC9A 4FFPA 2QMQA 1BW9B 3PJYA 1PNVA 2AR9A 1YU9A 5DUUA 4WN9B 3EVGA 4YW4A 5MFZA 1VHQA 4D46A 3R7WA 4IP0A 2CD7A 4EEKA 3B9CA 1Z7GA 4EQVA 1A2OA 2D0DA 2CN1A 3BOWA 2F4VB 5IYZB 2VXRA 4KQXA 1XRJA 3HUEA 2VECA 4MQBA 4AFCA 3AJ9A 2M1XA 2A2ZA 2DHDA 3SEEA 5DM60 4Z4QA 3LLCA 3DKKA 1DJPA 4L78A 1L7OA 1JF8A 2B7BA 2ZT8A 2Q4OA 4HONA 2KLBA 4UMEA 4XEUA 4FOSA 4TYPA 3EXHA 1Y4UA 1IUOA 4KUHA 4PHZA 4FEAA 3MLEA 3V0AA 3AINA 4IV0A 2E4VA 4RLHA 3TOXA 3L7DA 4O59O 4BU2A 1QHNA 3BMCA 4GX0A 4ZCRA 2GAAA 1WVIA 3HM2A 1H69A 1T0IA 2C07A 2C61A 5AUQA 4GYYA 3ETPA 1FK8A 2X9QA 3WT3A 2YMZA 1ZGJA 4P92A 2ZE7A 1MQSA 2Z5FA 2DBNA 4J9UE 3OQHA 1N77A 2WUDA 3WFIA 1WLYA 5CG1A 4V0NA 4NDAA 2IVZA 4NHYA 5I7VA 3C4QA 1NOJA 4FTBA 4CYMA 3HWX1 3MJHA 4FEEA 1TCUA 5AHWA 2AFIA 1WBLA 4JAAA 3M1HA 2WFZA 2A3XA 4ML3A 3AFKA 2D1QA 2BUCA 5KOYA 3FROA 2J33A 3ZU6A 3V8MA 5LBUA 2WD8A 5EJ7A 1YR9A 3WKCA 2ZTNA 3C7AA 3GLSA 1WXDA 5A4DA 2O2ZA 5IVBA 1MFPA 5ER9A 5L95A 4LYYA 4URFA 2C9MA 1GQSA 1DXQA 1S1AA 4LNVA 1K7FB 2OFWA 1U80A 2O50A 3NEPX 2VAWA 3V8RA 5A3QA 2YXNA 2ZPUA 1CX4A 1ZGBA 1U5ZA 4PTZA 2YQ4A 2A30A 5EJ1B 3M6WA 2FKAA 4RZIA 3OJ0A 2GHTA 3ZK9A 4F8AA 2G4CA 4IJVA 1N2JA 5IC6A 4AZTA 3D8CA 3LZ6A 5C8YF 1RAEA 4JR0A 4MVJH 4DJEC 5KO2A 3G2LA 3DD1A 3RKRA 1JIKA 1F31A 4M89A 2VAUA 3DMRA 4QUJA 5COQA 2BGLA 3KQTA 3MGGA 4BEJA 5JDIA 2RC6A 1CCWA 1D8TA 3CKLA 2J9YB 1JJ7A 3KKKA 1TZCA 2XJSA 3FTEA 3MV11 4EUSA 4FN5A 3E4DA 4X54A 2ZYIA 1MCZA 1H42A 2IEGA 1XEWX 3WLHA 3SF0A 1IDOA 4XMIA 3LW7A 4PNPA 4NCKA 3N39C 4A26A 4R3NA 2RM22 2YZKA 2OYSA 2D5FA 4KRGA 3O8OB 2DTEA 4K5QA 2QT9A 4IZHA 4TQGA 1JKJA 5FL3A 2BHRA 2DLCX 1POQA 1CFJA 4Q00A 5A3OA 4EYOA 1EFPA 4FYWA 3LC2O 4D94A 3DBHB 5IHRA 3KQNA 3U62A 4A0QA 2KBEA 3KOWA 1RJDA 1IE3A 4IOKA 1GICA 3NBKA 2AJDA 4I4NA 3B94A 4YCJA 4A8TA 3OYWA 3IV9A 3REFA 5AICA 2P6UA 4KB5A 1YQTA 3NGMA 3IVXA 2G67A 4FJ0A 3A6DA 2MSNA 2EATA 2XSZD 4GI7A 4YJDA 4UHBA 3HVHA 2XF8A 3LLSA 4P6VF 2GBCA 4P36A 4UUMA 3C8DA 3PTRB 1BCSB 1JHOA 5AM1A 2Q2VA 4UW9A 2FAXA 2PH5A 5EQTA 1OTYA 2AGSA 1QGUB 5IAVA 1ZBDA 3OCYA 2Y26A 1P1FA 4PHHA 1EV11 1W8WA 4LKFA 3PC8A 4M0EA 4FT8A 4XQ0A 1NR1A 1JQEA 4DCGA 3CT4A 3ICCA 3PITA 1EVZA 2OFOA 3K4HA 3GFGA 2QIOA 1XXHA 1JU9A 2H17A 3IS3A 2I4TA 1AKRA 3OGVA 1D07A 2YFQA 2D06A 5LDDC 1REEA 1ZU4A 4CIVA 1H8TC 4PZPA 4EHDA 4F84A 2PLV1 4LECA 2E2WA 4KMMA 4IJQA 4L51A 1WZCA 3SXJA 1NBIA 2IP2A 4E2WA 4YRPA 5D1NA 3I9JA 5K3BA 1ZBQA 1K89A 2BL4A 3FCEA 3WGKA 1SKUA 2D7JA 4JX9A 3MT0A 3NFRA 5BNOA 2OB2A 1M2NA 2IZZA 1KK3A 4DMMA 3NNLA 2IIQA 2Q2NA 1AO3A 2O6HA 3H1YA 5GZCA 1NI4B 1QOOA 3R3VA 4CCYA 5K7PA 2I6UA 3ZGYA 3ANTA 1PZEA 1Z5VA 5IC4A 4RPKA 1VC2A 4EKEA 3FVQA 5LA2A 4EJRA 3M2MA 2EYQA 5KPJA 4DYDA 4I66A 1RPJA 1XZ8A 1RUE1 1FFWA 1QR2A 1VL2A 3J4UH 1GNVA 1Y9MA 3KEGA 1KHTA 4BQ3A 2CY6A 4GWLA 3M3DA 1WBJB 2CFCA 2QW8A 2X0NA 3UOAB 2JI4A 4OUEA 1XEAA 4HFMA 2PVPA 2VZEA 4M9XA 2HRRA 3DJYA 5E88A 2C4UA 4V38A 3MW8A 4R31A 2P67A 3ZDFA 4FGLA 3QYFA 1WD4A 2AOXA 4EG4A 2C7BA 1EFRA 2GS9A 4ERXA 3CN9A 4JYPA 3NORA 3OU7A 3FOAA 3DBIA 4QOGA 4LOKA 5KTNA 2ERFA 3ECAA 2ZRAA 2GN4A 2WIAA 4MV2A 1Q15A 1MPXA 5D3MA 2QS9A 4B73A 5C5DA 3E5HA 2PAEA 1H0KA 4H3KB 4XC9A 3Q5EA 2HMTA 3SHVA 1RRVA 1TI7A 3W8EA 4DLRA 3JQBC 5JW6A 4EO4A 1B8VA 4UC0A 3AZYA 1GZVA 2GD0A 5EP4A 4OMDA 2ADOA 4BAGA 4CU7A 3ROPA 1M6NA 1CONA 2PS9A 4PINA 1G3QA 4H15A 3K0AA 2D13A 5KEIA 4KN6A 2KR2A 3ZN2A 4IOMA 2GO1A 4C6TB 2JG8C 4X3CA 5JHGB 1V48A 3DYOA 1DV2A 3ZLTA 4KKVA 3GFQA 4AHZA 3M81A 3AYEA 2GBPA 2VNAA 4CCJA 2HWE3 1RWNA 5KNCD 4TTTS 2G9UA 1RWBA 4M7RA 4H1VA 1N7HA 4BU1A 2EQBA 2NU8A 1FDIA 4RD0A 2KPOA 1KMQA 1RD4A 1K6EA 1VBD3 1VSBA 2XBMA 1CZVA 4C4PA 2VCEA 1BH2A 1PJCA 1NPTO 1R093 2R8BA 1WCUA 3JQGA 1SXIA 3USCS 2NV6A 3AIIA 3F8SA 1SBEA 1FTGA 3SYTA 1U8UA 3CO0S 4QGSA 4BB3A 5FEMA 2JZOA 1OBOA 4IEUA 1HQWA 3HABA 4HLTA 5DIFA 2FXIA 4GRAA 3QPWA 4XCAA 5REQA 1GQFA 1MUUA 2NX2A 3ZY3A 1KYZA 2NAPA 4NAHA 1ZJ5A 4OI2A 3WDSA 3FRIA 1JEJA 1PR2A 3WFJA 3ZCQA 1HRI1 2LP4Y 1SC1A 4JQSA 5HUJA 2EU8A 4LWZA 3RF7A 4M2LA 4N90A 1MC4A 3A37A 1HSOA 2OVUA 2WFF2 1HTWA 3LQKA 3ZOIA 3LSEA 1D2CA 1JLLA 1CUIA 4MAMA 3STXA 1PFWA 2Q7DA 5I8TA 3SYRA 5CDTA 1XMQB 4DCVA 2Z08A 1NQXA 4CU6A 1ZNZA 3MJ4A 4GSLA 1IHDA 3ZHXA 3ACLA 4YVSB 3I64A 3DKVA 4JZKA 2EERA 4GWIA 1R0KA 1R6TA 1XSEA 1GXSA 2EEPA 1P73A 2YIVX 3H1AA 4A2WA 3PDCA 2ZYGA 3ZY2A 3OIFA 5DN6D 1PR9A 1PS0A 1O91A 3WP3A 3URFA 4Q1FA 3R4DB 4GPD1 3IAUA 1BXGB 2BGJA 3RH0A 4CM9D 1KKUA 5LB6A 1K5MC 3VDDC 1D4M3 1Q3HA 2BFEB 1R082 5F3DA 4QBIA 3VVLA 1XZEA 1T15A 1Z0HA 4JS0A 2Q5OA 2ZEZA 4OVKA 2TNFA 1G3MA 2W6JA 4LPSA 3EA5A 4XOIA 3QW4B 3K9NA 3TQCA 4RLFA 3QITA 2PKCA 3ZZ0A 4FS3A 3OF2A 1C9EA 3UKDA 4FMCB 1PJLA 3L2YA 2JIPA 5GGYA 2ECOA 1XLVA 1YE5A 3KOXA 1U0TA 1M2KA 3EPJA 2EJBA 5FO7B 4COYA 4L07A 3QFTA 4EY7A 3U7FB 2JDIA 4LVCA 4ZOLB 4HEA6 1BW9A 4TXJA 3U0VA 3ROZA 2GN3A 2IY8A 4B3BA 1G8FA 4DLPA 3D4PA 4R2LA 2WS92 3DAFA 4WN9A 3OFKA 3WI7A 1VJ5A 3QRWA 3VBOC 1IOLA 2VNOA 1JZQA 2KWIA 2Y4NA 1SZBA 1HZZC 4H1HA 5DX8A 3TGWA 2A4KA 2L0XA 2HIAA 2VDVE 4CIYA 4BC0A 3U37A 2JD2A 3H4IA 2VZPA 5IYZA 3UUEA 3HWWA 4QGNA 2PHTA 2DBYA 1E5RA 4NARA 1ZH0A 1N6RA 4A8PA 2VJOA 2HMYB 3FLBA 3I6ZA 2QTGA 3U16A 1WW5A 4D4IA 4KHPB 2IBSA 1ID8A 3VKNA 5FKCA 3SDBA 1NLMA 4K9NA 4D3YA 2R32A 4JLAA 5E7JA 1P5RA 5FZKA 3H2YA 1YR6A 2V97A 3D3WB 4I08A 3QPDA 2FMYA 4OK3A 3CRRA 5FQ0B 1RACA 4J1WA 3I7DA 1I2ZA 4B3NA 2D62A 5DN2A 2QW1A 2Q6IA 1QVZA 2RMU2 1XRRA 4BVJA 2H8GA 1XDBA 4P80A 3ROFA 4G2NA 3DE1X 2EIBA 4PO1A 2WAMA 4ZYVA 3EIUA 4MKHA 5AHXA 3DW1X 2YWFA 4YHHB 2HR1A 2X1MA 2XADA 2ARXA 1YQUA 3WSTA 2EC5A 1NQDA 5DDJ2 3KUCA 2P2KA 4HK8A 1X39A 4UOZA 4NU5A 3UJQA 3X3HA 1ZISA 1GAEO 1SRQA 1H22A 1XOIA 2DR0A 2Q3MA 4CKXA 1H9WA 1UINA 2WJGA 5EA2A 1GGJA 1R1A3 2R60A 3K32A 2Y33A 2VWHA 5JATA 4JBWA 5E9QA 3RQSA 3CR8A 1ZR4A 3RS9A 2BRUC 1VP3A 4ZYYA 1OD3A 4R8HA 3GWZA 3A9RA 1Q8PA 2AYZA 4Q1AA 1M2JA 1FP4B 2XKBA 1G8KA 4BXFA 4XW3A 1CXZA 1PW5A 1VL0A 4EKYA 4HNTA 1H4HA 3FF4A 2BEJA 4KITB 3K0KA 4GXRA 4YBZA 3SH5A 2UZ0A 4OMFG 4LBOA 1Z15A 3WHPA 3PA6A 3HKCB 1GANA 2YFUA 1SCUB 2BMEA 3GT4A 3WCRA 3EH1A 4KQ7A 1YQQA 3PVBB 2XTNA 1SCKA 2AEFA 3KKLA 4K0KB 4EGJA 4NDZA 1D7AA 1ZYUA 1UMDA 3E9NA 4LYAA 3EG9B 4CEJA 4ZRDA 2PR7A 1IDN1 2WT0A 3WLSA 4H7JA 1RHKA 4Y6QA 4Q4AB 3AEZA 1X19A 4OSOA 1L5GB 2JLAA 4R71A 3OZGA 3RLFA 1EVLA 3WLIA 5IDQA 2EA7A 4D4GA 2GBLC 4XJVA 1EGAA 1VI6A 1DGLA 1RGSA 2JDHA 3I6BA 4IIBA 4MGIR 4WLNA 2ZYDA 2K46A 4G0NA 1YRQA 3ZNNA 5JISA 3ORQA 5ELMA 4QA9A 3IXMA 2R6DA 4YAKA 1LBEA 4XKJA 1A5TA 2J7PD 1EFLA 4HAYA 2BM0A 3NG1A 121PA 3PTAA 3O8OA 3UW3A 1BOFA 1TPYA 4DIKA 4M0CA 1WDMA 5AHOA 5CNKA 4IV3C 4CM5A 3F6EX 2H18A 3UGJA 1YB7A 5C8CB 4BFVA 1JU3A 1PJTA 1JT9A 3AP2A 1IOAA 3LKZA 1H2BA 1Y3AA 3QWAA 5ITWA 5JARA 4B45A 3ZVXA 4OQPA 3KLPX 4HNSA 5JRJA 4FK8A 4REQB 5LB2A 1RXWA 4C4AA 4L3OA 3RUIA 2PS0A 1JPNA 1AUQA 3RCBA 4ARIA 5B37A 4RD6A 4B3CA 1CZSA 3VVBA 2TMDA 5K4HA 2JLBA 3ZE1B 5LU8A 2QRQA 3C3JA 3LEMA 4M0MA 3QE2A 2UZ3A 1PQYA 4F3TA 4JQCA 4BQIA 4ZKTB 1G3RA 3KBOA 1BCSA 4IDEA 2V74B 2D3SA 3ZWQA 4WWHA 4Q4Y2 1LHOA 1ESEA 1P5HA 2VIIA 4AF6A 2Q5TA 1QGUA 3N87A 2J08A 3SQOA 2O2CA 2UKDA 2IU0A 1GKLA 3UCFA 4E21A 1K2WA 1G9SA 3T35A 2ZEJA 5C71A 1P9WA 3RWNA 1CVLA 4H77A 5A3VA 4FPCA 4QPZA 3MG9A 4M8IA 1Q57A 1SCIA 3ECSA 3N75A 1SD2A 3RS7A 3GLQA 3PNVA 1AXRA 1US3A 3GHHA 1CIJA 2A7XA 1WWKA 2P27A 4LJLA 5AP9A 1ZZ6A 4KQHA 3LZDA 2OYRA 4MR8A 3TF5A 1C7EA 5H16A 4UDOA 2NO9A 1WW4A 2X9LA 4BQPA 5ESDA 3ZJ5A 5CVUA 4ITRC 4FT4A 4XWOA 4OATA 2XAUA 3ISTA 2N3ZA 1V1RB 1BSVA 3TPZA 3V9PA 3KC2A 5IAOA 1FFYA 1SUBA 2VHZA 5GP1A 4P3YA 1HJFA 1EHIA 2PSSA 2C95A 2OO3A 1C3JA 3KVRA 2DTDA 2PXXA 3QUCA 1HETA 2BUKA 3A3OA 3TRJA 1WY5A 1F0NA 1NI4A 4QIHA 4HSLA 1VBFA 4QU0A 3QNMA 5DULA 3E4CA 1HT3A 3MJVA 5KAMA 4JNKA 4OZXA 2NO6A 1BMV1 3S5JA 3QLVA 1OLUB 2BMJA 5M04A 5FMCA 3FOBA 1NW8A 4Q0VA 3CWCA 3EJ6A 4W65A 5F5XA 3ZHTA 3CCFA 5DYTA 4RQAA 1KU0A 1T8SA 3UUGA 1WL8A 4RX1A 5SZKB 1USUA 4OYUA 4RLSA 1RUD2 2H1CA 3RWOA 1DKMA 1TNRA 4TN5A 4P7JA 1JHVA 5CFZA 4KLAA 5ALEA 1OTXA 4HH3C 4TZ6A 4JUAA 1VRH3 3PTYA 1P39A 4AK3A 5A2GA 2DHRA 2XUQA 1NCRC 1BCXA 4NCBA 5CB0A 2P6PA 5JD4A 3VO2A 2YWJA 2WINI 4PYNA 1BEV3 3VSAA 1KDKA 4AW9A 2EG9A 3N1UA 4J90A 2VPZA 3QEBZ 1N3PA 4ZFNA 4BIMA 2YWDA 1U1CA 2JGDB 4FR0A 5JWOA 4HFNA 1L5VA 2V6BA 4M1EA 1Q2UA 4TRMA 3O4GA 2VCHA 3KHUA 1OFUA 1N0WA 1KAQA 3B2NA 1PI3A 2F1JA 4D6RA 4AQYB 1IXYA 4YAGA 6LDHA 2PUDA 3EDMA 2PHFA 2GEFA 5E7QA 2JLCA 3GIDA 2XYGA 4UEQA 4DCJA 1VJ0A 1PWXA 3IEIA 3RARA 3H9BA 2H07A 4E7PA 5IKOA 3HCCA 2QM3A 1LCIA 3T1OA 3WW1A 2CNAA 621PA 1Y1RA 3DEKA 4Q0SA 1BE1A 2P1RA 1UKZA 3MMZA 5C8ZA 3ZLBA 4CM3A 4F4UA 3CIHA 1KK1A 2YGMA 1C7IA 1Y8CA 1AH2A 5T50A 2HREA 4LZZA 2GM5A 3LPAA 2GYYA 1ZZBA 3LA6A 4NAVA 2V7QA 1LPBB 2QQ5A 3H5OA 3Q0TA 3PE6A 4YPFA 1Z7WA 5KQLA 3PJEA 1JR3E 2D59A 1XK7A 1LCLA 5KSPA 4UDYX 1RYHA 2ZM5A 4MAAA 4MQLA 5BWOA 1YFKA 3ND6A 3T4UA 1RZUA 2WAAA 3FYCA 4FD3A 4X6QB 5EZQA 4G5SA 2QQKA 2VVFA 4QJBA 2AEEA 2X0KA 5I7EA 4YQZA 1WZ2A 3CRQA 3CS3A 3A32A 3UMFA 1MDFA 4YTEA 4YREA 4RK0A 5ADVA 1YVEI 3LJKA 4N43B 4DZZA 4MINA 1HMPA 4AMYA 2WJJA 1KL7A 3MI8A 2NNLD 4B3MB 4FD2A 1VBA1 3QVLA 2H2AA 3RUDA 2CEAA 1W36D 3T6KA 4PLNA 1Q0QA 1EJ0A 2AF4C 1TC1A 2OA2A 4R84A 4MGSA 4UE6A 5C37A 3EZ6A 1BXGA 5DIZA 2W5FA 5FPPA 3GFRA 4AJEA 3AKPA 4Q9LA 1Q6YA 4M1MA 1V47A 3UWMA 4WNIA 2OSBA 1CEQA 2PMEA 5IATA 4AEKA 2BFEA 1UJ2A 3WXPA 2ODWA 2UXDB 1YCIA 2PFSA 3TGLA 1EP1B 3UHAA 1T1EA 1PGW2 1JBQA 4DIMA 1EDZA 4FYXA 1L5HB 5FIUA 2EP8A 2WZR1 4EYEA 2WWXA 3QYJA 1YUDA 1A3CA 3LVQE 2WHXA 2GSYA 2Q9CA 2Y1LA 3NETA 3WQ0A 3ONEA 4ARUA 2ZTLA 4RK7A 3AF5A 5EKSA 4LFCB 1V6LA 3KXLA 4JEUA 3AMNA 4COKA 1AR93 1HG0A 4RE6A 4BV3A 1RYBA 1ULCA 1L7LA 2A7QA 5K0TA 4EN9B 2CLDX 1ZRRA 1SPXA 2II6A 2RH9B 4EVIA 1BHO1 1EFDN 1HDXA 2ZS7A 3JARA 1HE5A 1XWIA 1UBNA 3BA6A 4BPRA 1O8CA 1UEXC 2HMVA 3NRBA 4AAXA 3ES9A 3CRZA 2ZBRA 5FPXA 4Q5OA 1R3DA 2PD4A 3WKDA 2FP4B 3OOEA 1W2OA 1HLPA 4AFNA 1WBFA 4B2YA 1QJFA 2KYRA 1JVBA 2XDVA 1XNTA 3K20A 3I01A 4YR9A 3KQPA 3OBZA 4OXRA 2DVMA 2VP2A 4TSVA 4LDNA 1XRLA 1G1AA 1YSCA 3O0XA 4PBPA 4PSAA 3B3JA 4RU1A 4P9GA 4D3FA 3MRVA 2Q29A 1VBE1 4NYMR 4JJGA 4F8YA 3PZRA 5CFPA 4QDXA 4HFJA 4JGIA 3VZJA 2GH2A 2IDMA 4UQOA 1UAAA 3WK8A 2JFUA 5J5VA 2IHKA 4HNQA 2OZPA 4UBHA 1QH8B 1XNHA 1N4AA 4LF4B 1R5BA 4N03A 1F2DA 5ALJA 4B44A 1K7XB 2FD8A 2ZGUA 2ZBFA 3D3WA 4HK4A 1AMUA 2FU5C 4PZ9A 5LMZA 5FQ0A 3ZEIA 1ZZGA 1SU6A 3GLGB 1U9IC 2A14A 4TYWA 2J45A 3GK3A 1W1UA 3EF1A 1RHMA 2AXNA 4OM7A 4EW3A 4AY6A 4JGYB 5EJ3A 2QUKA 3W8FA 2R85A 1FT9A 3H3JA 1KPHA 3GFOA 3LQYA 2AEMA 3BRQA 5KHJA 5BQ5A 3L7CA 4MCAA 1Z56C 3I5XA 5TPZA 2IYTA 4RORA 1MB0A 3ROEA 1JEEA 1QKQA 5DUVA 1YRHA 4JC8A 1PJSA 1X2BA 3VH1A 5GVRA 1AQUA 3ICVA 1FPN1 2IXTA 3KHCA 4GB33 1J7KA 4MTLA 4A5OA 1QF3A 4RKWA 4N54A 5FUWA 3T4HB 4H7IA 5KHKA 4J3NA 1PLKA 3RS8A 1G6Q1 1IY9A 2ZR7A 1TA4A 4LK7A 1NOIA 5F2NA 3EXUA 4LC1A 2D7CA 3HMYA 3OZWA 3I5AA 4RYLA 1FP4A 2PAFA 3LP5A 1TKAA 4GF5A 4XZ3A 1TT5B 3ZN6A 1YFZA 2R1TB 2J1EA 4ALKA 1AU9A 4IIFA 1AY0A 4GR9A 1U28A 1UFQA 2ECFA 4B2IA 5CFDB 1Y9ZA 4QDZA 1IHPA 2HSEA 2YDEA 3AQ4A 5HF9A 1XMIA 2FEOA 1HXS1 3HKCA 1VPDA 1FYUA 1KEZA 1DU4A 1SCUA 4ER6A 4XWGA 4E3ZA 6ABPA 3DLBA 1PGNA 4P22A 1ML3A 5J09A 3DL4A 4C05A 2PRJA 5JZSA 1NRIA 2PZAA 4BNKA 4XIOA 4FHFA 5K6RA 3EXHB 4UARA 2XLBA 1GCGA 3EG9A 2QZ3A 2E49A 3HY6A 5HBAA 1XVAA 3UB4A 1OVPA 5ABJB 2J1LA 4R54A 4N01A 4Q4AA 2HMUA 5B7QA 3BMCB 4LQDA 1Q1QA 2WM3A 4YMWA 2FDCA 3D4IA 5EIXA 1JR3D 1U9YA 4RZXA 4WKCA 3GY0A 4JL6A 3TDMA 2QVLA 5CKQA 2Y1GA 1G9AA 2WWHA 4XYGA 4QPDA 2D5AA 4YQFA 4LWQA 3IVRA 2ZOEB 1IHMA 2HA6A 2Q4EA 2WHRA 3IALA 2JLXA 4YT8A 5LJLA 4BNVA 1A8QA 5J4KA 2IQIA 3WOHA 2ZCVA 2AFIB 1J0CA 3U7QA 1T2AA 4ZHSA 2GX6A 3IBGA 5DM4A 5CMLA 5LY1A 3FOCA 4JI7B 1DQRA 3IC5A 1UEJA 2Q3DA 5C8CA 2YG0A 2IS4A 4U9UA 3T3HA 5KDLA 4PPNA 3G2PA 2O7RA 3TCKA 4B5LA 4REQA 1H2EA 3BU7A 3HYNA 3MW3A 1ZI6A 1U7ZA 1M54A 2WC2A 2WLSA 2G6TA 3LUBA 1Y4WA 3NV3A 2Q4SA 1A50B 1ZH6A 3D6JA 2P3SA 4JFAA 3AEKB 1UIMA 3ZGLA 1B1AA 4EG0A 4MVWA 5ELXA 2P8JA 3U56A 1Z22A 5JCTA 2XKJE 5LU9A 1RL3A 2QAJA 3QPVA 3OX3A 3FNEA 4QB2A 2DV9A 5ER6A 2Z4TA 2PUTA 2EAAA 2VDOB 1JHMA 5IH3A 2A3NA 5J4VA 5BV7A 2W3JA 4MP6A 4Y30A 1QS0B 2UUAB 4QRIA 3NHPA 4IKEA 4LQRA 3ZFEC 2P68A 1TM7E 5JUVA 4XARA 4R2WA 4PJYA 3JQEA 2TS1A 3VBRC 2F55A 3PWKA 3ZN5A 1GZHB 1W6PA 4LDRA 4XEZA 1LOGA 5C3RA 1HT2E 3WF1A 1M75A 3ADCA 3EXG1 1RVF3 1IJFA 1WP9A 4AZ3B 2ZGNA 2HK7A 2EXIA 5JO0A 2IXIA 1NVUQ 1B6RA 2ID7A 1JKJB 3MJEA 1X14A 3ZI4A 4MRMB 3U7RA 5NULA 3RVPA 2VQTA 1AGRA 4TVKA 1KKLA 1HXHA 3CG0A 1DG9A 4U39A 2YHJA 2H7YA 5K3DA 2P9GA 4GQ7A 2R96A 1BJRE 1UBCA 2O1XA 3LY8A 4AVTA 3PIRA 3LKBA 2COUA 5JROA 2RH8A 1AR61 4BNGA 1AVBA 1KXJA 4HDKA 1ZRNA 1OLUA 2XMGA 4EB0A 4ENPA 1XDSA 3A3PA 4AKGA 5IW0A 3IDFA 4R8SA 5DUXA 5DAWA 3OKAA 4EROA 3BSFA 3KCNA 4TS3A 5COBA 2D97A 2HWE2 1WO8A 5BY2A 3WKEA 4EGFA 5FD8A 3COWA 3F6RA 5L9VA 2CCGA 1T2XA 4P08A 5GALA 4FYKA 2AFHE 1HPLA 2O19A 2JAHA 1E3JA 1M2HA 1Z6GA 4LORA 3DVQX 3VRHA 4DJJA 3BZBA 1LBHA 1D8AA 3Q72A 1FX1A 1G8AA 2H0VA 1B35B 2FE4A 3VZMA 1NUUA 1QKJA 3EIWA 4LA3A 3S44A 4RSRA 2V54A 1KAOA 1S1MA 3PYXA 1K8YB 5CBPA 3JD3A 3WL6A 3BORA 2CLKB 4ZALA 1AL23 1V35A 3POJA 1A78A 3W9UA 3LQ2A 4IIDA 2FWPA 1QHFA 3PWZA 1TIBA 1VLHA 3ELNA 3JSAA 3AF2A 2CU5A 3C41J 2ZRHA 1L7XA 4I1RA 3FFTA 4EG1A 4EHHA 4UVDA 3WRXA 2JGDA 3K6SA 4DB4A 5FFFA 5FYYA 2DPMA 2DBVO 4BCBA 4RPLA 2ZX4A 4PYLA 4ALIA 2H4ZA 4Z53A 1YQCA 5A3UA 5KXCA 3UK1A 3KCXA 1OQDA 2Z3VA 4RGKA 1LY1A 1Q8QA 3OY2A 4DZGA 3T3OA 1AXEA 4CDXC 1C8M3 3TINA 3H7AA 2C88A 4J75A 4ZVLA 3IAS6 4YVWC 4WVZA 3SYNA 4CCYB 3QELB 2Y0PA 5E38A 3P1IA 4JR1A 4RMGA 4CV2A 5G41A 4XF9A 3ZSEA 3KS7A 3WX5A 4JCCA 2QTNA 1A98A 5AM5A 3V3KA 1YMVA 1UIRA 5KHAA 1ESMA 4H6PA 3AY7A 1JTEA 1Q2XA 2QZJA 2QV0A 3EQ7A 2YZ7A 4FMCF 4E2SA 3PNKA 2RS51 2GN2A 3AMVA 3J7NA 2ONYA 4ZGWA 4Z92B 4BUZA 2YHAA 2EIHA 3I9LA 3HVJA 4Y2YA 4AGRA 4ZV7A 5CIRA 2ZSFA 1GDDA 1O6CA 2MSEB 2FEPA 3DV2A 4ZOLF 3NBUA 1J9EA 5D5QA 4LEJA 1Z7S2 4IGPA 2GO7A 4AD8A 1YWGO 5EAIA 4Q4W1 3KGZA 2XL9A 3VDQA 4QICA 4H17A 1SKMA 4DR5B 2IXKA 4IMIB 1OI3A 3VDCA 2BIFA 2OW4A 4WIAA 4C0AC 1C7FA 4IDPA 1KQRA 3H4MA 1LF0A 2HYIC 3G2OA 1HKDA 3EO6A 4HVRA 1QB8A 1M33A 1F3LA 4Y1UA 3D4OA 3ZV7A 1UUFA 3CE6A 4QDQA 2Q46A 4QX3A 4FONA 1JXAA 5B5SA 4EMBA 2EBFX 4L76A 3ZQ4A 1DQ0A 1Q5OA 1JNYA 2WB4A 3DKPA 4EM6A 1OU4A 2VNGA 1J0AA 1X3LA 3SWWA 4C91A 2O2DA 4NZZA 1ONNA 1RUF1 4DY3A 3EPLA 1W6OA 2A3WA 1W03A 4GDMA 1K68A 1DLLA 2NMOA 4ZO9A 4PLMA 2OK8A 1S0EA 4J7XA 3EDQA 1WW8A 3VKVA 3BD7A 3MLLA 2G80A 3RYFB 4ZJPA 1VRWA 1H4QA 1FU4A 4Y3OA 4MADA 5DWQA 1P77A 4OHBA 2GZ3A 5DGHA 2QIPA 3E7WA 2J0SA 2WU8A 1DQ2A 3JZFA 1L5HA 3VJRA 2TECE 3E5QA 2HXGA 3HP4A 2VK4A 5CLFA 1JIUA 3BIWE 4E14A 2ID9A 3V2UA 4Q3BA 1F8FA 3Q10A 2MMCA 1E7YA 1EWTA 4FCAA 1NJ8A 2PKEA 3SEFA 1GU3A 1IHUA 4I01A 4A8JC 3NAPC 2A58A 4AS2A 2L2QA 4ITCA 3AEUA 3OCUA 4IHJF 3PGA1 3OPWA 1W8NA 4KWEA 4NIMA 3OO0A 2ZU0C 4NI5A 2FLVA 2Y71A 2J46A 3IOCA 3IUEA 1JDZA 4RL6A 4H59A 5JI3E 1KDMA 1V71A 3C3XA 2FMXA 1PTJC 1EMDA 3WRYA 1NN3A 2ZXFA 3AUUA 2XYPA 4G5GA 5EMLA 3TEXA 3NV9A 2I3GA 3ESYA 4G0WA 4IDHA 3N2NA 3DMPA 3ACBA 1YMUA 3DDSA 3CLRD 3AVQA 4NG4A 1UW8A 1CDZA 5A1TA 5FI5A 1TK3A 2ADEA 2RKWA 2PE5A 3O4HA 1Z2DA 3ZQUA 4UD6A 3PKJA 1NNEA 3R8FA 1C0LA 4NJOA 4BMNA 4LV5B 5KNDH 3OT1B 1L8XA 2GEJA 1P1RA 3ZFFB 1C0PA 3D4NA 1CEYA 4ID9A 1QH8A 2VQ3A 3PE3A 4JCKA 1ZVQA 2WRZA 2NZ9A 3UJBA 3KV3O 4YO8A 4MGIE 4BQ1A 1QM5A 4IWYA 2QX4A 4GZ9A 4LHVA 2E37A 2DSNA 1G2PA 5DRTA 3T54A 3GLGA 5KQMA 1YF3A 2HADA 1SBZA 2VCCA 1AMOA 3SDSA 3DAYA 4JGYA 1T3GA 1ZK1A 1D6JA 2ZZNA 5L3QB 4CEWA 1KAGA 3OT5A 3S1AB 5LOVB 1Y8RA 3D7RA 1K86A 3DTTA 4JSTA 1C30A 1LSOA 3RAPR 3G2MA 2PD3A 3NNNA 4COVA 3NS7A 1GUZA 1PYGA 1OILA 1ODSA 3A3NA 1UPFA 1YCGA 2XITA 4PQ9A 3FMPB 2DCYA 1XF9A 2B3TA 3DLHA 3GCXA 7AT1A 3L8CA 1V0AA 3UMMA 2BCGY 1MRZA 2WF8A 1KNXA 3IE0A 4G0QA 2JGFA 1NPDA 4R2MA 4MH0R 3NKTA 3HP7A 2C00A 4O25A 3GCGA 2QRHA 2X7HA 2A9FA 1KI4A 1IIBA 4J2TA 1YAHA 4YMGA 1PYOA 1TT5A 4WCDA 1ZSNA 3P4XA 2R1TA 5C3MA 3I2JA 2NZ8A 1YASA 1V7CA 1R50A 4UTPA 5CFDA 1ZGHA 4MMZB 3DEZA 3N53A 4C87A 4U7HA 3EOZA 1JZSA 1G9XA 4KL1A 4EMSA 4JC5A 4JIGA 1KDOA 3ECCA 4F2PA 3AP1A 2XI4A 1JFRA 3ILVA 3NNFA 3HJFA 4IINA 2ZUEA 3RAFC 1A7AA 1EHCA 1X1RA 2JK0A 2JG9A 2CXNA 2VHUA 1QTQA 4RVNA 1UD1A 5ABJA 1IKQA 3TZCA 1GWKA 2XZOA 5BUSA 2I3BA 5LWBA 2WU0A 5FL7A 3AMHA 1K8XB 4G41A 4R1UA 3KVBA 2BI8A 4WKNA 2ZRKA 3CX8A 1QLJA 4X90A 3UETA 1F0PA 5A7WB 1PZFA 1ZA2A 3HKDA 3RKSA 5A0VA 1HMYA 1NLRA 4L0MA 2GDZA 1F4AA 3R5JA 1N34B 4DW8A 1LFAA 1QLWA 1U1GA 3H2SA 1OF4A 3H1MA 1MB4A 2W2LD 5F7UA 1AQJA 3DT6A 1ND2C 2OBMA 4ASUA 2IPMA 2BJHA 2I6GA 4RFSB 3ZXDA 3EVCA 4XX0B 2ECPA 4YDHB 4UHJA 2JANA 4P33A 2Y0IA 5ALPA 1RZRA 4TTSA 4NYIQ 1RUH1 3I72A 2I62A 3Q98A 1DVRA 2KB0A 2VA9A 1BHGA 4ZKDA 5TPWB 4IPTA 1MB9A 3DUWA 3B2QA 4GE3A 2IYNA 2B0CA 3NM6B 3RC2A 1ZM1A 2WQZA 2ZOSA 2ZI4A 4DR7B 2VRWA 2B6HA 1R88A 1SHWB 5LZ5A 1DEHA 4RIFA 1CJPA 1GRRA 3AEKA 3WLFA 1TL7C 1H0RA 3BT7A 2Y67A 1XNJA 4BX9A 2W1UA 1P2UA 2ZSKA 2XZTA 4EJ0A 1QMGA 1UFVA 4I4TF 1NW3A 1XTKA 4B40A 3L0SA 4QQOA 3U9TA 4F96A 3IRVA 1UY2A 4HANA 4HQ6A 3U5ZB 3MOIA 1H1MA 4HATA 2ZVJA 3NRUA 4D9GA 4FVTA 1UMDB 3A2KA 4HR7A 2CDCA 1PAUA 4CEJB 2ZWAA 4JB3A 3NAZA 1K0UA 4L72A 4KXQA 1QS0A 4C3OB 5DG2A 1BMTA 3CWZA 2EX1A 5K3AA 2JCVA 1CK4A 2XOKD 2R1DA 2GA9A 3RYPA 1ML4A 4DVGA 1RHQA 3ES4A 5EKUA 1JQJC 1URPA 4JP2A 3P52A 3GRPA 2GOYA 1KAHA 2AI3A 2ZB2A 1J83A 1OHHD 5AC93 4GOXA 3O75A 3W5IA 4AN1A 5A33B 4JJ8A 4RVUA 2VBGA 2ZS8A 3PRHA 4FPLA 3AHJA 4MCIA 2J1SA 4C5AA 1GGKA 2GNOA 2CGOA 5I8WA 3ZGOA 4AZ3A 4GD3Q 3NT5A 3TB4A 1YDMA 2QE6A 1K75A 2ODPA 3GA7A 1XWWA 3UFBA 4RVSA 2R00A 2JFBA 4MRMA 4U8GA 4GRIA 4GX2A 4QQKA 4FBFA 4D9JA 2QU8A 3DBRB 3FVRA 2EXJA 4QODA 5LQDA 4NROA 3SNMA 4CTNA 1I9CA 3KX2A 2E1PA 3PNMA 4L4YA 3IKWA 2QN2A 2QP4A 3BULA 3EMVA 1JBCA 2R073 3BJIC 2EQAA 1OIVA 3Q3CA 3ZR5A 5CA1F 1ZFNA 2R041 2WHYA 4WK0B 4QDKA 4DDMA 3RRYA 4OA8A 3HVRA 1M6VB 3C15C 2VHTA 1UY4A 4BDSA 2PGNA 2HWD3 3ENVA 2O8VA 3OGSA 1ZA4A 1NKSA 3BIFA 2MSLA 1A96A 3AXTA 2F3PA 4KI0A 1WS6A 4EUNA 1F4PA 4DNPA 5G0WA 4DDHA 3ZD8A 2Q8QA 3HJAA 1MZ5A 3D0KA 1B35A 3STTA 3ZDCA 1U0LA 1LPPA 2FZWA 2X1VA 3RSLA 4RAQA 1GR0A 4Q8LA 1GT91 3T5BA 1YVUA 4WK2B 5ANNA 4FZ5A 2IP1A 1C1YA 2YVUA 3ZU2A 2BZDA 2NPIA 2WUEA 1SULA 1OA4A 3A6FA 3PSAA 5AUPB 4ET7A 4NRPA 1RXFA 1WCDJ 2OV1A 2GWRA 4C6RA 5HHTA 5JD5A 5GLWA 1CVNA 4MR8B 1OH5A 4XGQA 1A9SA 2G8NA 4KQCA 1AHHA 1LDBA 3IP1A 2XXAA 1FJHA 5EFUA 1NULA 4NTZA 1Z34A 1NUQA 3PICA 4HLUC 1Z4QA 3OGJA 1JR2A 1FTQA 3K1JA 1N2OA 2ZS9A 3AH8A 4R7TA 1X1SA 3CBQA 4QT6A 2AUYA 3WJ1A 1TDJA 4LSGA 1RSZA 3QUSA 3QELA 2IUFA 1KI7A 3VBSB 3LYLA 5FZHA 3AFHA 2ZTSA 1TIPA 3DL0A 2ZSIA 1QQTA 1T9GR 5E7IA 4AP6A 4EFNA 2JJ1D 2XT6A 2MYPA 5KYGA 4Z7NB 3N9MA 2WTUA 3LQQA 1NFFA 2EBHX 3H04A 3IHWA 2QJTA 5A71A 5FRAA 3RJMA 2VDLB 2CYFA 3ETDA 2VZSA 3PDUA 2EW8A 1L3IA 5GZ1A 3CVXA 2PJDA 4HTAA 5I45A 4KIJA 5FZ7A 3MAJA 2DLDA 4DA9A 2PKWA 3PQ7A 3A1SA 5LD2C 1S8FA 2VZOA 5J3UA 2WZQA 3L06A 3SJBA 1WMDA 2LVBA 2WM2A 3GD7A 4UHEA 2AACA 1R37A 2C04A 5HGJA 3L7YA 5BQ3A 3LSYA 2BSXA 4WXPA 5LBEA 4OBBA 3VD9A 1SEVA 1P6UA 2KMLA 2RHWA 1CNEA 3N2EA 4C6SA 4HVLA 4R16A 4F1JA 2XR1A 1QEXA 2Q1YA 5B6IA 2LRHA 3U19A 2AMVA 3V9AA 3SS8A 4YLEA 1JH9A 1NUHA 1IM2A 2BV3A 4TSFD 3RTGA 1EZ1A 2ID8A 3DR3A 3DEIA 3GH1A 4YBRA 1MKYA 3ABSB 4O9EA 3I1FA 2RDNA 3ILNA 1FA9A 4DV3B 4MWGA 3H3ZA 1O4TA 4FFGA 2WHPB 4BISA 4CA9A 1RUE3 5IZCC 3GGSA 2A1TS 2RMKA 3TTUA 3BUCA 2Q4TA 3LF2A 4F5DA 4U2AA 4KO8A 4PAGA 2XOEA 2VOJA 4Y9SA 2CF6A 1X1EA 1X8EA 3RYFA 1IOZA 2NUAA 4NRDA 4GMXA 4D6SA 2IXGA 3HQRA 4XZPA 2RJKA 4RHXA 3I9MA 3OTFA 4F38A 2I4IA 5E89A 2H4WA 5GIPE 3Q7RA 4B75A 4DSNA 1E6LA 5ERXA 5TGTA 4RVHA 1J8QA 4LYEA 1MX5A 3BA1A 2ZHLA 3FDFA 2VXYA 2Y1XA 1FDSA 3P9CA 3RRDA 4AOCA 2GP3A 3K4AA 5AKKA 3GZJA 4NBWA 3GBPA 3DECA 1PFGA 3EBLA 4GR4A 1G7TA 3R5XA 1FOD2 3K70C 4OAOA 1W0NA 4EWAA 2VT3A 3LWBA 4D0SA 2NN3C 4Z4HA 4NOMA 1C1XB 1DX9A 3DOFA 3KQYA 3MMPA 5JFTA 1SWWA 4W6ZA 1O5TA 3GDHA 4ZTZB 4UW4A 5D8AA 2H5LA 3MIEA 1IPEA 2YIDA 3LMKA 1VTKA 1IBLB 3ANXA 2QRVA 4DZTA 1NGSA 5KJ6A 5T8KC 2X3FA 3BD8A 5J7MA 3EQ2A 1J9ZA 2FMIA 3GGPA 1RXIA 2V03A 3I9KA 4FWTA 1LPMA 3EIXA 3OFJA 5IAJA 3GRCA 1TTHA 2GCEA 4MGHA 3KQWA 5DBGA 1GAJA 1JZ6A 4ABYA 5FI1B 1QG0A 4EJSA 3CQOA 1AR71 4YX9A 3OT1A 2RAUA 3ZFFA 3GJ0A 3OE5A 3IXQA 3EGCA 4FOQA 1W9WA 1V6CA 2TBVA 3QLTA 1WLTA 1SCDA 4ZYUA 5EP3A 1N6PA 3FH0A 5KWJA 2A9JA 1GU7A 3WFZA 3WDWA 3LE8A 3TNQA 3P2KA 3R9IA 4YRKA 3A21A 1Q3TA 3GP5A 1RYMA 3R6DA 1Z88A 5CFNA 1TJNA 4CMAA 4RTLA 5BSUA 4Z7QB 5L3QA 1Y8ZA 2Q1TA 4NY1A 3S1AA 5LOVA 4OU4A 2H6CA 4WM7B 1Z0KA 3QPAA 4BA6A 3ICOA 1RC8A 5BNPC 4JZYA 4BRSA 1YJ8A 1I0IA 5EQDA 4KRFA 3CVOA 4IFTA 1W5EA 2C24A 3JARB 2R8RA 1J8MF 2ALJA 1CQWA 3O1RA 1MACA 3GAAA 5KVSA 2WIBA 2PS3A 3UJDA 1QOPB 3ZJVA 4YG0A 1XEWY 1OV6A 3L6BA 4INPA 2UVDA 4JT4A 1L5NA 4DCMA 1TME2 4HYEA 4HEQA 5EZSA 1HRV2 1EFKA 2QX8A 1CUCA 3DDOA 4WGGA 3AHGA 3GLRA 1PQ4A 4QM7A 1QYDA 1WRBA 4UAUA 3U48A 3OUHA 3WLQA 2PZ8A 1V6IA 5IT0A 5M7EA 3MWLA 3RRJA 3RVBA 4UW5A 1S0CA 1ZPDA 9GPBA 4E88A 1IFXA 4W4ZA 4RTPA 3SKYA 4EKDA 3PUIA 3LYUA 1VLNA 2HUPA 3AZPA 1V4VA 3FAKA 1W7AA 1T3TA 2WSMA 2BNOA 2XJ9A 4AS1A 5JQWA 3GP8A 4EQZA 1W90A 3IEMA 2PQ0A 5AH0A 1Z2NX 1UIKA 3ZHZA 4JLOA 3W58A 3PHJA 221PA 4OJQA 3OZFA 4HMOA 4FDVA 1NONA 3PD1A 2A5FA 4BLOA 4LO6B 2X4IA 4QB6A 1XO1A 4BEVA 1GKIA 4BGIA 3C3PA 3AB0A 4A15A 3DNPA 2HQSA 1AB6A 5A7WA 3A1VA 3OSZA 4B4UA 4X24A 3HYLA 5IDWA 1YHYA 1I2MA 5LA6B 2DERA 3HUDA 4EW6A 2ZZQA 2EZTA 1JKIA 4RFSA 2QLJA 1O6UA 4M49A 4XX0A 1H8HA 4LCBA 5GZDA 3D4LA 4R81A 4X61A 1FW8A 3K9FC 3B51X 3LPCA 1P9RA 3C2UA 4ALLA 3ELUA 4MARA 1X3SA 2BGMA 1RVF2 2KSQA 1OU0A 2IOHA 5KYYB 1U2ZA 5TPWA 4DABA 4JBLA 2I3AA 5ANRB 3C24A 3SZ3A 1OXTA 3H4TA 4RWZA 1S8OA 5FK7A 3ZN6B 1SQ5A 1J1ZA 3I8OA 3TD6A 3MICA 1YJLA 2DUJA 4CV0A 3FIUA 4F3CA 2QRLA 1NN1A 2JZNA 1E3LA 3EAGA 3LSTA 4UZEA 4F86A 1BKDR 3RABA 1DZIA 4S0ZA 3ANMA 4BVAA 2CL0X 3CNAA 3ND8A 1R0ZA 4MJ7A 1KQFA 2AYXA 3GH3A 3BGVA 5C4GB 3MGBA 4DOMA 2JEOA 2FDFA 5HR5A 4JENA 2Q4BA 1GQPA 3HIFA 1DJOA 4TXLA 1YVRA 4PRYA 4QDSA 1XYOA 3H65A 3VDMA 3QE0A 4BKUA 1P0IA 3EEIA 3RVJA 1W2AX 3TQOA 2ZA9A 4QL3A 2GZ1A 3CKYA 3BRCA 1C0KA 2QG4A 1J3RA 4URTA 1PGJA 4HPWA 5C7GA 2J5QA 1LOAA 3FWZA 2R6R1 5KSYA 3M89A 5H8WA 5HCUA 5U4XA 3O7WA 5A33A 4PSUA 2W6ID 4LYHA 5JNLA 2DFPA 2XT0A 2EBWA 4U7WA 4AEJA 3FPJA 2WSSD 4GXNA 1W39A 2BLNA 2OHHA 2P1DA 5DGXA 4ENQA 3K15A 3U7QB 5F1RA 2FWRA 3GLFB 3NGLA 3DBRA 2XKOA 1SZJG 5DBOA 3QGMA 4ZT4A 1IGOA 1U94A 1ZUWA 1RYDA 2PTGA 3I9V6 3NW9A 1G86A 3WNMA 5K0JA 3ACIA 4OV6B 1MZVA 3WP6A 2GT1A 5E1BA 1PM7A 2GK6A 3DMTC 3A23A 4JEMA 1CD3G 3T2PA 2VMEA 1F4HA 1M6VA 4EAQA 2C59A 1AQYA 4DIUA 2YZ4A 1E79D 4DXHA 4UBLA 5LJIA 1V7ZA 2KX7A 3Q6IA 4C0XA 1QJY1 2GEKA 3H84A 2UV8A 3WMEA 2J3QA 4WLEA 2AFVA 4HYTA 1XNAA 3M5WA 3AR7A 4CSWA 1FMTA 2H4JA 1Y7PA 4MVXA 1E2MA 4MV4A 3VFDA 4I5EA 3RUFA 5ALMA 3ZBTA 2H1OA 4C6HA 4G4SO 1C8VB 4DUGD 5CG9A 3U4QB 1S2KA 3GGDA 3HMQA 4MW9A 3HQUA 1B41A 2DVFA 2G72A 1JA9A 5HI0A 3CL1A 1EPZA 2VZRA 2HJSA 1MQTA 3TJMA 4FNGA 1RUC1 3SYMA 1KZ4A 1N9ZA 3JD4A 3OZTA 3GU3A 5AI8A 3AW8A 2IX9A 5T64A 3WCSA 1UZVA 1W36C 2H11A 1GTJ1 2WSUA 1W6PB 3ACHA 2OQ2A 5JPCA 5E1MA 1XU4A 2WEKA 5HJEA 1TEXA 3UAWA 1SVIA 1AB5A 3ZGVA 3OLVA 1EFVB 1C8NA 1BXHA 2PM8A 2XLFA 4J4TA 4MDFA 4RFRB 1ZC3A 1ZL0A 1U99A 5HDBB 4K9DA 4MO9A 3QK7A 4WUVA 1RHJA 2OHGA 3FGZA 4RENA 3VBSA 2CMGA 1NQTA 5JYDA 2DB3A 4WRRA 3B9BA 3GRAA 2ZI5A 1NCQC 2ERCA 1VMJA 4NXNB 4CMIB 3M3HA 4HDKB 4S1PA 4EW1A 5AM0A 2GM9A 1Y1PA 3J7HA 2LGJA 2WIJA 4D8UA 4ZC1A 4UATA 4PWYA 5CM9C 4Q18A 1KYIA 3KLBA 4GZ5A 3ETQA 4UZSA 2E7AA 3WO1A 4YNIA 1V3TA 1NLFA 1ST3A 4A2CA 4L1KA 1JZ2A 2RGEA 3C39A 4DHEA 4PXSA 1ZINA 2Q45A 3EZ9A 4IEEA 1DBIA 2RGNC 4XASA 4AJIA 3M3IA 2QV7A 1DHKB 3AVVA 1CGPA 4AI3A 4GPBA 1H9PA 4J6FA 1G20E 2OS2A 2YX1A 5DTQA 3YASA 4PAQA 5CBPB 1T2VA 4BV8A 1XNRB 3FNIA 1VP9A 4BZXA 1PV2A 1EWRA 1FFCA 2J3DA 4QUDA 4ZO6A 4BNXA 2XMDA 1TF5A 4ENWA 2JVJA 1P4SA 3I39X 3LCVB 1SQ4A 5KYVA 1QTIA 1YZGA 1PK6C 2JJ2D 3K6SB 4JQTA 5KOJB 2XPCA 4PIXA 5JWHA 2QTLA 1O9BA 1WV1A 4GMFA 3SEAA 4XF4A 5F5LA 4JDMA 1UADA 1OQAA 5CP8A 3SP1A 2JGIA 2M32A 4LF5B 2WHPA 1BX1A 2HFKA 3FKSD 1V8ZA 1DFHA 1N57A 3MT8A 5JZ9A 2PRSA 4X3OA 1WF3A 5JAIA 4HVCA 1POWA 3CDZB 1XRPA 1LX7A 4IQ4A 3FHLA 1FVOA 2WTEA 1B0UA 3ZR6A 4M99A 3O74A 4BFUA 1D0HA 1N9GB 1LNZA 2H6BA 3O0VA 1EJ6A 2EJUA 5CISA 5HE9A 2RS13 2C4MA 4QTTB 5EERA 3T1NA 1I3KA 4PM4A 5C1PA 4TYYA 4Z8XA 5KR7A 4P9LA 4AFAA 3PQ2A 2OV3A 3LA8A 2VZQA 3A6PC 3NDBB 4L27A 2DGDA 1KSGA 1OOPC 1MXFA 4IIEA 1ODJA 2QVCA 3GRUA 3P9ZA 1V5FA 2Q99A 4X7RA 5IUNC 4B6JA 2JDNA 4IDNA 3QJYA 4FDAA 5BR8B 4YDRA 3WBBA 4FEGA 4D9BA 1F60A 3P8ZA 2JHAA 4MGZR 4MH0E 2W2QA 4H08A 3OEED 3WLNA 4QNRA 5FOUA 1MVLA 3UGKA 1C1XA 4A4AA 1FFXA 3JPYA 5LQMA 2O23A 2CB9A 5IYZF 3B13B 3PFBA 3O14A 3DMHA 1JSLA 4JDUA 3ZDZB 2CBXA 1D9ZA 3KQSA 2P17A 4ZMRA 4KDRA 3INYA 4C4TA 1PG2A 3TFQA 4GLJA 1IK4A 4AVVA 4JLVA 5CX4A 4ZAZA 1PR5A 4BL5A 3MB5A 4ZCMA 3KVOA 1L2TA 3DFZA 3IQIX 3UHJA 3UZUA 2QSJA 4XRGA 4XBQA 2IHUA 2EARA 1DKPA 3HBKA 2WA4A 4AJPA 4XAQA 5MN6A 3LK6A 3CX3A 1W6OB 1ENRA 4JDPA 1L4YA 3QIVA 3SIRA 2VG8A 4RIGA 4XFFA 4YW7A 1DIOB 3JQ9A 2GC1A 4ENTA 3UBMA 3ISVA 3Q3EA 3VSBA 3KE9A 4RD4A 2JAUA 1F35A 1GYKA 4RK1A 1OE0A 3SLIA 3VV2A 3O8CA 4Q4DA 3QVJA 1JPUA 4KP7A 1QOZA 2ZYSA 3I9OA 2IPOA 4PHTA 4EGCB 3C8XA 2ZQYA 4TTAA 2IXAA 1ZCFA 1P1KA 4L28A 2VHJA 5JZVA 3CJXA 1E92A 1QF9A 4JC0A 4OEHA 4WM7A 4LBLA 2J31A 4HKLA 4E27A 1JHNA 2PVCA 1VOTA 3GHMA 3AEUB 4CP0A 4YFZA 1SN7A 4XOGA 3SLKA 1DZQA 2O2JA 3CV3A 3G17A 4V0SA 1PDWA 3PRJA 3W05A 4MI9A 3WGUA 3AZXA 2WZ8A 3D6VA 3HK2A 3T0GA 3GT7A 3FZEA 3KZMA 3GEHA 2VDUE 1XKQA 4POOA 1BO6A 3AB7A 3FM9A 1OGIA 4GO1A 1PGL2 4ZZ8A 3MGAA 1PMHX 2PZMA 3DS8A 1ZGZA 1GGMA 4IX1A 1NV9A 5KI6A 3RYKA 1VBKA 4WL0A 4WM8B