4BYYA

Apo glxr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 65
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4byyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4byyA01
2QQAA 2XROA 2C6YA 3OCPA 3UKVA 2FF4A 4UV8A 4QLCU 2O1QA 5KHIA 3NRVA 2BNOA 4PZJA 1CAWA 3FE5A 4ZYHA 4MTEA 4L9NA 2O8XA 4HVOA 1X7NA 3I4PA 2ZNZA 2HFHA 1VP6A 2DT5A 3ZQ7A 1U2WA 5DCMA 1T98A 1J3RA 3RYRA 1UW8A 1OYWA 1SD5A 2CAUA 5BV6A 3NW4A 1KQ9A 4XFGA 4LEJA 3EUHA 2HGCA 1ZREA 3NKTA 4XF3A 3DN7A 4Q0VA 2WFPA 1AOYA 2PFWA 3CO2A 3QP6A 4DNCA 2A69F 2G7UA 1QNTA 3R0JA 1IN7A 3SMHA 4Q0UA 3F72A 2FMLA 3CL1A 4HV6A 2STTA 3H50A 3M8FA 2JTVA 3TOAA 4O9EA 2FU4A 2EFOA 2DCTA 3PQJA 4I0AA 2FBKA 2VOPA 1EV7A 1DZRA 2W85A 5D6FA 3EO6A 4GYIA 1DGRA 1RI7A 3KP4A 3PLQA 4OU0A 4HLYA 4H0EA 3OD0A 2IJLA 2V1XA 3DQVC 3U0ZA 3CUQA 4PGGA 4WZCA 5D5UB 5E18F 5CLSA 1LRHA 2C0ZA 3KFWX 5E8IA 3P7NA 1SMTA 1H9GA 4KIFA 2ZFWA 5FD5A 1Q3EA 5ICGA 4AVCA 3ZMUA 1I27A 1FYLA 3LAPA 3LOIA 3KSCA 1SD6A 3CLOA 4RB1A 3RKXA 1BN5A 3IDBB 1CGPA 1U78A 1G3SA 2A61A 1XGMA 5K5RA 3WU0A 4Z07A 2EV0A 4BYYA 3HRMA 2HJIA 3F8BA 2IP2A 1HQCA 3ISPA 3ECHA 3V8JA 4I2OA 4HBLA 3LAGA 4HVRA 2GWRA 2PJPA 1BI3A 5KHHA 2F4PA 4HAMA 4HW0A 4A0YA 1O3TA 1CX4A 2P6SA 3MZYA 4ENMA 3IKTA 3K1NA 1ZRCA 2PAEA 3BWGA 4IVNA 1IRFA 3W6KB 3F23A 4HVQA 1WLTA 3C3WA 1GQGA 1R5HA 1W4MA 1KU7A 3LFKA 2QUFA 2B9UA 3D0SA 1DUXC 1MGTA 4G9YA 4ZU7A 5ILUA 5J6XA 1DGWA 3M70A 2LF7A 4KMFA 3C1DA 4OINF 4M74A 5ILSA 1HKTA 4I7HA 3IL2A 3TGNA 4ON0A 4HDUA 5HS8A 1WI9A 4JTNA 4AXOA 1DPRA 3K1MA 4MEYF 1GHCA 2LSOA 5A2QK 2XUBA 3TO7A 5JHUA 1RL3A 3H92A 2NAZA 3HTUA 1EYBA 4P9FA 4ZU4A 4HQMA 1RTVA 2OAZA 4IHSA 3WTZA 3V8LA 1PP8F 3H1MA 1D3YA 1F1ZA 1JHHA 1G6NA 1BBYA 2D2WA 5F64A 4KICA 3OTFA 3LAJA 5AIPA 2CO5A 2O03A 3V7RA 3JTGA 1T2KA 2CV6A 5FLXZ 4QXKA 3GZ6A 1Y0UA 2QQ9A 5H6QA 3RKYA 2DO7A 5D1IA 2ISZA 2GC3A 4O5VA 1ZH5A 4FAHA 3U1DA 1HKSA 3FM3A 4KN7X 5ILVA 2ETHA 4MQ9F 4PGHA 4YIIA 4QGMA 1YFWA 5E1ZB 3VFZA 2VN2A 1L3JA 3QACA 5D4SA 4QGNA 1LEAA 1VTNC 4ESJA 3ZMDA 4KL1A 3JSPA 1IXRC 1S7AA 4A2UA 1Z05A 5DYMA 4ENKA 4N9IA 3ZMTA 1O5UA 2ZKLA 2Y48A 2PQQA 3WGHA 2IVMA 2XLFA 2PMUA 2VE8A 2MH2A 3ZMSA 2COMA 2ESHA 5FQ0A 4H7LA 1TLHB 1YLFA 4KWJA 2HKOA 1R23A 1QQIA 3EDPA 4N0BA 3N4MA 1QXRA 2P5KA 2YU3A 5BPXA 1YHFA 1Z9CA 3CF6E 4U0VA 3CLPA 4OIRF 4XSZF 5K8SA 3DPLC 5IT9K 1P4WA 1XGSA 3QRFF 3OGJA 2GA2A 5D8KB 2VBXA 1T0FA 1CAXA 3H3UA 4L18B 2NRAC 2EK5A 2O61A 2EWNA 2QNKA 3MQ0A 1IN8A 4XSXF 2IA0A 2V6CA 5LGUA 2XLGA 2XV4S 1K78B 1XRUA 4EM1A 1SFEA 2DBBA 1BC8C 1CAUB 3IWFA 1QY4A 1SEFA 3D82A 4IEVA 1HBXG 1Q43A 5DD4A 3SZTA 4MNUA 2K0GA 2QZ8A 4PDKA 4RD7A 2YPRA 2M45A 3ZMVA 5I0RA 2DFIA 4KYWA 3ULQB 4CO8A 5TRDA 4GXOA 1HW2A 5I0UA 3J80K 4QM9A 3FMRA 2LNBA 4UXNA 3REOA 2RVCA 3H1YA 4XFAA 1ZG1A 3MYXA 4LA2A 2M8EA 3RPUA 1B4AA 4KT5C 2HTJA 1XCVA 2DPDA 2QBYB 5KHJA 1B6AA 3GZ5A 4QGLA 2UXNA 4L9TA 1SAXA 4TV7A 1TQMA 2DK5A 4JBAA 2QLZA 5ED4A 2A07F 3FMQA 4EJTA 3FWEA 2Z3YA 1OKRA 1UPIA 2JT1A 1S3JA 4ENJA 4XFHA 2VONA 2VT3A 2GC0A 4U7BA 4LK0F 2NNYA 2P7CB 5EEHA 4G8XA 3FFQA 5C6CA 1W7PB 3TO6A 1W5TA 1ZG5A 5K5QA 4GULA 3CTAA 2L4AA 1J75A 5JR3A 3SXWA 3FJSA 4YFXF 5FB2A 4A12A 1ZYRF 3UKTA 2PAKA 1Q5OA 4F7ZA 1GQHA 3E5UA 3JTHA 4I01A 4O3MA 2W57A 3GYHX 2HEOA 3RJPA 3KZYA 2XL7A 4YIFA 5D5VB 1OR7A 3SHFA 4AVBA 2MLGA 5E16A 2KKOA 3BP8A 5CVIA 2IA2A 3K69A 4B09A 3FXRA 3FHIB 2PLYA 4HX7A 1LJ9A 4Z2YA 4KMUX 3BROA 5KHGA 3FHZA 1W5SA 2RV8A 4XBFA 2XIGA 1PUEE 3NQOA 1YTYA 4G6DA 4PJYA 3KP7A 3RZZA 3ZDSA 2E9QA 1R22A 2AS5F 4BIFA 5H20A 3WW3A 2CYYA 1U8RA 1O5LA 2W24A 2IXCA 3F8MA 1BC7C 3WTTC 4ASNA 1BI1A 2QYOA 4EWDA 5LHIA 1REPC 3BY6A 4M9SA 3JSOA 3BZ6A 4HN0A 3VHRA 2FXAA 3G7DA 1LEBA 3HIFA 3BB6A 3HHGA 4U88A 5L3CA 1ZARA 2FRHA 2P5VA 3E6BA 4DINB 1TQIA 4WBBA 3I58A 5L3EA 3DEUA 4LG0A 4LUKA 4D0PA 2IC1A 3NEUA 3CO6C 2HOEA 2ZO4A 2WTEA 4MQVA 1W7PD 4G94A 3IDCB 2RGVA 3GFJA 1XGNA 5BOXA 1DP7P 1LDKB 4I98B 2GA1A 4HA8A 2IXIA 2E1CA 4META 2V79A 1O3SA 2UY9A 1NE6A 3WW2A 3E6DA 1RZ4A 1XCBA 3FMSA 4OIOF 3P9CA 5FFXA 5I0TA 5DDGA 5L3BA 3WTWC 2H94A 3WODF 1L3LA 4IHTA 1FP1D 2EFWA 1QZYA 2Q8KA 1KA8A 4FX0A 2K7LA 2F5EA 1CF7A 5D5WB 5IT3A 3GVAA 3MEXA 1BI0A 1QZZA 1KU2A 2UXXA 3PQKA 2BEOA 2D45A 4LMYA 2Y0MA 3I7DA 2ESNA 4ZYGA 2Q1ZB 4A6DA 1MD0A 5HLHA 2FSWA 1ODDA 1V3FA 3KLOA 3ES1A 3HTSB 3MFKA 4XF0A 5I8YA 3BDDA 4MHGA 4IESA 1CAWB 3BOQA 1HXDA 2N7GA 3ES4A 3KGLA 3HT1A 3R60A 3HRSA 4EWEA 4CZZA 1YUDA 1KQ0A 1HSTA 1FP2A 3P9KA 1P2FA 3J81Z 4IETA 3M3IA 1I1SA 3KEOA 3NL1A 3JAMK 4E70A 4EGZA 2Z2SB 4UUVA 2J5OA 3F8NA 3M1EA 3KCCA 2TDXA 3U11A 2MNGA 4IEYA 3ZMZA 5J8CA 4HYEA 3V4GA 3BJOA 2ATFA 1J1LA 2FNPA 4BQAA 1R1VA 1ZZ6A 1MDMB 2FMYA 4MX3A 2WC2A 3H1WA 5BXXA 3KP2A 5JSPA 4AD9A 5FLIA 5AONA 1BOAA 1MZBA 2XRNA 4ENNA 3AAFA 2Y75A 4EM2A 4YFNF 1QGPA 4M6XA 1ZHFA 4IRGA 1UIJA 3RKWA 2O8QA 2XVCA 1OYIA 3FM5A 3WGIA 4ZZDA 2B5HA 2IRFG 4Y17A 1EH8A 1WQ2A 2PYTA 2PMHA 2LDUA 2MD5A 1R1UA 4UV9A 4CICA 1J2XA 2CG4A 5LBQA 1XN7A 4BHBA 1BI2A 5EEGA 4KNYA 5F6FA 3IRQA 3EYIA 5E20A 3QPHA 2HR3A 2QDRA 3HT2A 2CAVA 4FHTA 2ZBKA 1YFXA 2PTMA 3B02A 3H7YA 3F6OA 1Y9QA 1YS7A 2DW4A 2Q0OA 3TDUC 3VODA 2XASA 1Z1DA 1ZVFA 2QCSB 2K27A 1RIOH 3JW4A 3L2HA 5AIQA 3HRTA 4TLFA 2E7XA 1B59A 2IXLA 2GXGA 1U5TB 1GXPA 2VE9A 3ZP5A 4YSFA 1T38A 3VB2A 2PBIA 2XAGA 5JSOA 1YG2A 1G3TA 4HX8A 2GU9A 2KXLA 2GZWA 1FY7A 4XF9A 5E8GA 4IPAA 1WSUA 4RGRA 4NQWA 1TW2A 5CJ9A 2RN7A 2ZJ2A 5T3NA 4KUMA 5FLHA 4LLGF 3T0YA 3WTVC 1USSA 5D4RA 1VJ2A 5JR7B 1MJAA 5D6EA 2JPBA 3HRUA 3WW1A 2QVSB 4P9UA 2KJCA 4CGZA 2VECA 3SZPA 5E1XA 3MDPA 1PMIA 4HF1A 4G7HF 4OIQF 1E2XA 2V9VA 3MAJA 2E1NA 2OA4A 3BCWA 3OOPA 3TNPB 4JVAA 2VBWA 2XGXA 2RQPA 1S8NA 4IEZA 4RGUA 1IUYA 3I53A 3FXQA 1XMKA 2ZKZA 3LQRA 1UD1A 1PDNC 4PIZA 5K1YA 2PQ8A 3LA2A 3U2RA 4XETA 3SCGA 3EQEA 1QWRA 3DP7A 2ISYA 2RC4A 2MBFA 1H1MA 2IXHA 5CVRA 4AQ2A 5J7MA 3G73A 2UY8A 2PN6A 3LA7A 2XAFA 3HSEA 2P6TA 4CDGA 1ULYA 2Z69A 1LKNA 2Y0OA 5HS7A 2OPKA 5CVJA 5FO5A 4MH0E 4YG2F 5BPIA 4HZFA 4X6RB 2QVOA 1J3PA 1O3QA 3D0JA 3CO7C 2ZNYA 1XGOA 1PM7A 2LKPA 2VXZA 4IF4A 2XAJA 5L3DA 3QPTA 1SMYF 3RNSA 4HSLA 5FLXK 4GYGA 2VODA 4IJAA 3KLNA 4ZZLA 2Z5UA 1SD4A 2Q4SA 1KYZA 4MGYE 1Z91A 4KU7A 1TNTA 4QX5A 5LLQA 4R1HA 1R5GA 2OQGA 3BPXA 2M1BA 1EPZA 3PFIA 2VOOA 4QWQA 4HBNA 2D5HA 2O0YA 1U6GA 5LRRA 3H9AA 5JCTA 5HDGA 5KK1A 1FLIA 1F5TA 1B9MA 1O57A 3BJ6A 2W25A 4RAYA 4MZUA 2CGPA 3G3ZA 2IXJA 1IXCA 1OPCA 2PAMA 4A0XA 5ERIA 4L5JA 3KMHA 4I09A 1BIAA 5HI0A 5DD8A 3K2ZA 1BM9A 2BE5F 2F2EA 3NJZA 2B0LA 1Y3TA 4AIKA 4EM0B 2A68F 3GFIA 2YX4A 1UFMA 2JPCA 2XHKA 2PA7A 1K78A 1H1IA 2V1UA 3SCFA 3TOBA 4AIJA 3JZVA 4IEPA 1ON2A 1T39A 4UVBA 1CAUA 5E1WA 3E5XA 5KHKA 2EJRA 4L2NA 5KVRA 3KZZA 4M71A 5HLIA 3V7CA 3VEPA 1R58A 2H6BA 1WKMA 4PIYA 4WK8F 3QU6A 2D5FA 2QWWA 2H09A 1O3RA 2ACJA 2ZMEB 4L5IA 4XF4A 4ETSA 3CEWA 4FAGA 5I0SA 4HLTA 2YSRA 2DLLA 4LTAA 3V8KA 2EFPA 2K4JA 5LHGA 3ECOA 1J5YA 2K4BA 2P8TA 4OMZA 2IA1A 2IT0A 1IXSB 3GFLA 5BQTA 5ICCA 2JZYA 4UBGA 2EVXA 2QBYA 1RNLA 3M7GA 2OQRA 2EFNA 1C0WA 4LA3A 2M5WA 2BNMA 3KP3A 4RB3C 3WTUC 4HQEA 1LR5A 4OLLA 1X8MA 4R79A 4D7TA 1JHFA 1GVJA 2A6EF 1X82A 3GUDA 4FT8A 4EVIA 4UVCA 4U7DA 3K9TA 5LEKA 3GEZA 3U10A 1L0OC 3F8FA 2B8MA 3WTYC 1YW8A 1W7PA 2ET1A 3RI4A 2L02A 3I54A 2FBHA 2EA4A 1RGSA 2LF8A 4G7OF 4DQ2A 3FZ3A 4EMSA 4KWLA 2F5FA 3OF1A 3IWZA 1OYYA 3IIAA 2WWYA 1ZLJA 2Z33A 4M6YA 4E2QA 5EZWA 4AVAA 5TJJA 4WCGA 5JI6A 4WVZA 2GC1A 1D8KA 2FEZA 2PG4A 4EGYA 1JGSA 1SFXA 2OA2A 4N9HA 4HX4A 4I0BA 1ZG3A 4LB5A 2P17A 1WA4A 2BNNA 1WWXA 3IHUA 2A6HF 1YFYA 3F8CA 2HYFA 3PNAA 2I45A 2OZUA 2K86A 2NS0A 3DXJF 3EQLF 3DL3A 1YIOA 2DQLA 3ETQA 1UIKA 2W84A 1MJBA 1FI2A 2RNJA 1YO5C 3E5QA 2VC0A 3KEQA 4UHTA 4G6QA 1RUNA 3C18A 4GCVA 4HSJA 2A5YB 4HLXA 2L54A 4XLPF 4EROA 1XSXA 2D40A 1IN5A 4F8AA 2GH2A 1Z6RA 2O6GE 4MGRA 5K5OA 2YX7A 2PI0A 4HDVA 1IF1A 3FX3A 3O2PE 1CAVA 5E17F 4GGGA 1SD7A 4IEXA 4NVPA 3IC7A 5FLJA 4U0YA 2V1DA 5LHHA 3J7AO 2MA3A 4M72A 4CHUA 1J0RA 5HDKA 3BPZA 4IERA 3LQQA 3NVCA 1FNNA 1UB9A 4JK1X 3RTRA 2CSOA 2PEXA 4Z82A 1NXMA 4XFCA 3F21A 4R8HA 3WGGA 2VPVA 4RS8A 1FYMA 4IEUA 3P9IA 1P4AA 2IPQX 5L3FA 2K9ZA 1SFNA 5EFUA 1U5TC 5DUKA 1V4RA 4FX4A 4Q0QA 3IRRA 2UYAA 4KIGA 1ZZCA 3EBRA 1QBJA 2D93A 2KIMA 5H6RA 3WG9A 4E2SA 3WE2A 5HDNA 3I59B 3ZN0A 1ZLKA 1HSJA 1TNSA 5HOOA 3T5XA 1XDUA 1HKQA 2DQRA 2UWMA 3GXOA 3MZHA 2CFXA 3GLXA 2HDCA 1ZX5A 4WF2A 2F5DA 4BXUA 1IPJA 1KGSA 2FQPA 2MC3A 4P5OA 1LVAA 2UZKA 3LWFA 2EA7A 2QM3A 2XLAA 3R6SA 3MPBA 2OD5A 4O6JA 3HOTA 2CQKA 5D5XB 1ZZ9A 2J5PA 4A0ZA 5DCMB 5DUIA 3UKNA 1X3UA 5I93A 4XFFA 2FA5A 4Y15A 3TDZC 4KIBA 4YNIA 2MLKA 2HQRA 1K6OA 2EB7A 4Q0PA 1JUHA 3S0MA 4KA4A 3S7IA 3LZZA 4ESBA 4WX9A 3SXYA 2DPUA 1OI6A 3KP5A 3IKVA 1J7KA 4CXFA 3L7WA 3RIRA 4IXAA 2L01A 3I5UA 1S7OA 3RPQA 4PCQA 4A6EA 4OFGA 4LLNA 5I8TA 3GWZA 1TQ5A 2EA2A 2FOKA 2VT2A 1MDMA 1A04A 3B73A 2XAQA 3V7SA 1D8JA 4ZU5A 1FWZA 3J81K 3QP5A 1XDSA 3PVBB 3CUQB 2H0VA 2R7DA 4OIPF 2STWA 1FT9A 3SFZA 1ZNPA 4UNOA 1ZZBA 1P6RA 2DI3A 3C3VA 2ELHA 1YQAA 5BMZA 3ST7A 3ELKA 1V70A 3FF5A 2GQQA 4IRHA 1Z7UA 3Q5FA 4LLOA 1WRJA 5F1RA 1QXJA 1IN6A 4AIHA 5BUVA 1I6XA 1YYVA 3TQNA 2VQAA 4MGIE 4M73A 5I91A 1J9IA 4IEOA 5C8WA 1MKMA 1O7FA 2OYZA 2VBYA 4LK1F 3FZVA 1R00A 4KFCA 2AXLA 1K7AA 4J1XA 2CWEA 3EYYA 4ZYDA 1I5ZA 4RAZA 4U0WA 4XFIA 2JRTA 3E3VA 3WE3A 2BV6A 3U9GA 3EJKA 1Z6TA 2WV0A 1YLLA 4XRFA 1UHWA 1STZA 3GFMA 2OZJA 3ML6A 4EWAA 4XEZA 1ZRDA 4EQQA 3Q9SA 3R4KA 1U5TA 1FBQA 5A2QZ 2BYVE 2L3DA 2PFBA 3QAHA 4L0ZB 2VC1A 1NE4A 2FNAA 5FGMA 2YR2A 5BY5A 4Q48A 4E2GA 4XLNF 2QJVA 5ICEA 5J3UA 2V09A 2Q0AA 1FOKA 1J59A 1IPKA 2GAUA 3WW4A 3KE2A 4O9GA 4ZYEA 2UYBA 3ERED 1KU9A 3ELNA 4NHJA 2HYGD 3HSRA 2R7FA 1U12A 2HZTA 3ROUA 2PHLA 2EFQA 4WWCA 3DV8A 2ZXJA 4LFUA 2QQBA 5DV5A 1I1GA 3BPVA 2FQ3A 1S6LA 3DFGA 1ZN2A 3R0AA 4FBFA 3ZPLA 2P4WA 1LQ1A 1E17A 4LJZF 1ZZ8A 4B29A 1XSVA 1ON1A 1G3YA 2F5CA 4NB5A 1AWCA 4KWKA 5LGTA 4L0YB 2HQNA 4LLLA 6PAXA 2KRFA 5J8FA 1FZPB 1NHAA 1J58A 3CJNA 4EJWA 4HF0A 4AWXB 3H3ZA 3M9AA 4MGKE 1B9NA 4BNCA 5DEQA 4RB2C 2Z9OA 3QU3A 1P4XA 4WXDA 4Q29A 2P7VB 5CVVA 1HW5A 4K8FA 2ET7A 4IEQA 4PIXA 5FD6A 2HKXA 4YRDA 5IT9Z 3I0TA 1FPQA 4K2EA 5FQ0B 1FX7A 2QENA 3ABTA 4ZH4F 2BBYA 4YFKF 4WXCA 3GO5A 2GIVA 4M9ZA 3ACLA 2IXKA 3F6VA 1XMAA 3K1PA 4IEWA 1USTA 1S29A 3KGZA 1XB4A 1F4KA 1YFUA 2XAHA 3BU7A 2IW5A 3TO9A 1CAXB 2ZCWA 1X8EA 4QMAA 1DZTA 4KU8A 3LA3A 5D8LB 3USSA 3KP6A 4CYDA 3GF2A 1OMIA 3C7JA 2G9WA 4S04A 4EJUA 2K02A 1KU3A 1UCRA 4B8XA 1DPUA 5CADA 3J80Z 1HW1A 2FE3A 5BPDA 2KIFA 2H27A 1FSHA 3EETA 1YWKA 2KIUA 5CYVA 4MV2A 4JTOA 2CW0F 3BALA 3L9FA 1BJAA 3WTXC 4LUMA 1QO0D 3ZN1A 4G7ZF 1TBXA 4LB6B 4R52A 3GW2A 4QM8A 2Z99A 4P55A 5ICFA 1NZCA 4IRIA 5L3GA 3FXUA 3OV8A 4I3PA 3ABUA 4ONUA 4AQ6A 4XF1A 1O4TA 5J48A 3HSFA 2FBIA 4OOIA 4BAYA 1UHMA 3SCHA 2MHFA 1FSEA 1OFNA 2BGCA 4L11A 1UCXA 2ZMEA 2PHDA 2EAAA 3W6JB 3IBMA 5FCCA 5FDBA 1ZZ7A 1RC6A 1TW3A 2M30A 1R7JA 3MWMA 4M9XA 3T8RA 1U3EM 1D5VA 2XL9A 5JVTA 4HN1A 4EV0A 1LDJA 1JE8A 1B1BA 1TQPA 2XKOA 3L00A 3TNQA 3LSTA 4J1WA 1MJ9A 3CDHA 1XD7A 1JXSA 4RB0A 1ONVA 5I8SA 1EH7A 2G7HA 4S05A 3O6BB 5FFZA 1IAWA 5JFRA 4GO1A 4I02A 4L9JA 4UXAA 4P9GA 5LGNA 1YW9A 1LB2A 5CU1A 4OMYA 2X0LA 2MPFA 2HS5A 4RGSA 3T8TA 2VBZA 3CUOA 4EJVA 1EY2A 2XKPA 3S7EA 2D1VA 3HYIA 4P96A 1IRGA 1KYWA 2D1HA 2DU9A 4A5MA 5BS6A 3COAC 2DK8A 3BJAA 4Q47A 5HLGA 4MEXF 5AVPA 3QOPA 2O3FA 2OZ6A 5HS9A 2HTSA 4HMZA 2EV5A 3F3XA 1G3WA 1XE7A 5E1RA 3GX4X 1F9NA 3VOEA 3HUGA 3O3KA 5CVUA 3SHRA 5DCFA 4YARA 4XFBA 3LWCA 1K79A 3SQNA 5KBFA 1EP0A 5LEJA 2DTRA 2ETEA 5HVQC 3I64A 3Q9VA 4KN4X 3WU1B 3CUQC 1J3QA 4ESFA 1ZRFA 4MTDA 1DDNA 4LGWA 4AVPA 1ZGAA 4RGXA 2Q30A 4L9VA 4UBHA 1SQ4A 1KQ8A 2HWVA 1VR3A 1QPMA 3KETA 2M87A 4MUVA 4ORFA 3DPTA 4LD5A 1ZGJA 2OBPA 2OU2A 3O14A 3NSTA 1T6SA 1SFUA 2P5LC 3TKYA 4JQFA 1EH6A 4BH9A 1XSDA 4HF2A 3MCZA 3E97A 3E6MA 1WGPA 3RDIA 1CAVB 2RKHA 4LG0B 3M8EA 1RUOA 3HQXA 2X4HA 2H6CA 2EV6A 3H8UA 3S2WA 5JAXA 4D7SA 3DKWA 1IN4A 3L2CA 2RDPA 1GXQA 1XE8A 1FBSA 3H7JA 1R1TA 1O7LA 2NNNA 1H0MA 4YYOA 5FPXA 4Q4ZF 2GXBA 4BHPA 3CJXA 1IW7F 3D5LA 4KDPA 5LRSA 4MGZE 3WTSC 1TTYA 3F22A 3GYDA 3R61A 4Y13A 1H9TA 1Q1HA 2DAOA 2GC2A 3RYPA 4A5NA 2A3SA 2ADUA 3HHHA 4EJOA 3E6CC 2L4MA 1YS6A 1BIBA 1CF7B 3T1BA 1G4DA 1YW7A 2E7WA 4UVAA 1OD5A 1LDDA 4X6QB 5JSRA 3K0LA 1PP7U 2KJBA 4WXHA 1ZRRA 5FPZA 3RYKA 4BHCA 3I71A 3HOSA 4Q5SF 2NYXA 4LULA 1NYWA 4JV4A 4Q0SA 1FYKA 1FXZA 3EHKA 3I59A 2JSCA 1R36A 2R3SA 3GBFA 1P92A 1LNWA 3JAMZ 2Q2EA 3L09A 1ZAOA 1IZ1A 1YFHA 4HV5A 1FBUA 1FC3A 2MH9A 3DF8A 3N97A 4HOBA
chains in the Genus database with same CATH superfamily
2QQAA 3UKVA 4N8MA 4BMBA 3NRVA 2BNOA 4COYA 3WF4A 4MTEA 3BR0A 1VBE2 3BCBA 3AMQA 1X7NA 3JQXA 2E36A 2HFHA 2BTVC 2GNDA 1VP6A 3SITA 4XPVA 2DT5A 5A3LA 3ZQ7A 3JCIA 2OCCH 5DCMA 1YE9A 3RYRA 3LSIA 2EXHA 2G9FA 2A1XA 5C9AA 5CZKA 3I2KA 4OYUA 4BKXA 2WT1A 1KXGA 2IXSA 2CNAA 1FYUA 3WV6A 2P2KA 2CUJA 1AOYA 2ZHLA 2O7OA 3QP6A 1QDCA 1SCRA 1X3ZB 4Y24A 2E2IJ 3SMHA 5JMOA 2XF6A 3CL1A 1SFKA 3W3CA 2JTVA 5EDNA 2B4KA 3TOAA 1YQ2A 2EFOA 4E9KA 4CDXC 2R7UA 2H8RA 1JN2P 1DZRA 1VZ0A 4GYIA 1RI7A 2LY9A 5EJCA 3PLQA 4OU0A 2Y9YA 2RR12 2COBA 4ASKA 5DMYA 2OPTA 2IJLA 1Z77A 3ZDVA 2JVHA 3CUQA 4XOPA 4PGGA 4JGYC 1LJ7A 4XHXA 2XDVA 4KISA 2C0ZA 3K48A 3KFWX 5E8IA 5CBLA 2XJPA 3O12A 3FBNB 4KIFA 4INDA 4K7JA 5FD5A 3ZMUA 1PO21 3ESWB 5J96B 3QPLA 4NBQA 3LOIA 3WP5A 1OURA 2BWAA 5D8AB 3CLOA 4RB1A 2YUEA 3RKXA 3IDBB 5CB7A 5C4WC 3SLIA 2A61A 5ACA1 4DZPA 5FKNA 3FMGA 4BYYA 3K4DA 3HJRA 5K7ZA 5FY7A 2YV8A 3G2BA 4AAXA 2IP2A 2K3PA 3I55I 2BV4A 4HBLA 4HVRA 2JK3A 2F4PA 4HAMA 2WBKA 5KR7A 3BTLA 4A0YA 3MIGA 4DFSA 1O4YA 2P6SA 3UNPA 3JD72 5CKNA 5IYYA 4ZTFA 1L7LA 3BWGA 1IRFA 3W6KB 3LSPA 1TWHJ 4V1PA 5A3NA 4AGGA 3AG1H 1KU7A 2V72A 5FRAA 3SH4A 2RDNA 5JOYA 3D0SA 3MICA 2R062 1G2HA 2KMUA 4HSTA 4G9YA 1DUXC 1MPXA 3WNMA 3FXLA 3AL0B 4C2UA 3JRFA 1KS5A 3MUZ1 5C44J 4OINF 1SHWB 5ILSA 1HKTA 1JZ8A 1UU6A 1MNDA 3E1SA 2ZSHB 4L99A 4JTNA 3CMYA 4AXOA 5FYSA 3BR1A 1H8TB 5CPRB 4FO9A 2LSOA 2XUBA 2R93J 3TO7A 1SVMA 1UKGA 5A1AA 5JHUA 3H9JA 2K3FA 3T2QA 4P9FA 2TUNA 4GH4C 1JHNA 2KZGA 3WTZA 3V8LA 3WNNA 4CP9B 2X6YA 5J1UA 3ZVXA 3GNEA 1D3YA 3AL5A 1JHHA 1MEC2 4II2A 2ZJRF 4R4ZA 4YG6A 3OTFA 2M0CA 2LVSA 1X1PA 4GMP1 3GZ6A 1N3OA 3ZYHA 5FYYA 2DO7A 3GTOJ 4RS5B 5IVEA 1ZH5A 3U1DA 4AYBN 1V5GA 4PGHA 3AYCA 1I5PA 5E1ZB 3ZFFA 2V4AA 1ZM1A 2VIXA 4KL1A 3JSPA 5F3IA 5FAXA 1BMV2 1IXRC 4CDXA 3KWVA 3U37A 4K3UA 1CQ9A 2XB5A 4GB33 2UUZA 1SVLA 1DZQA 2ZJCA 1RUF2 4YG0A 1NCRC 1W2OA 2PQQA 2XLFA 2VBPA 2PMUA 4RHV3 2COMA 3QWLA 3NNLA 2X85A 1M4WA 1FPN2 5FMOS 1QQIA 4JGYA 4R9BA 5FZHA 4BUPA 2OCEA 3GTKJ 4BEHA 1GUIA 1COV1 1PVXA 3LSGA 2YU3A 1YHFA 4BJ0A 1Z9CA 3CF6E 4GIQA 2L7MP 3CMAI 3OY8A 5GLVA 4XSZF 2E5ZA 1NK2P 3HD8B 4XMYA 3ZXJA 4QX3A 3HL2A 3SQOA 2RREA 5F6KA 1UY3A 3QRFF 3B94A 3R4UA 1V00A 2VBXA 3C7FA 5FWJA 1QNYA 3H3UA 1OCCH 5DN2A 2EK5A 2QNKA 3X2QH 2XV4S 4D1QA 1HQLA 1PMHX 4QPIB 4OCTA 4O65A 1CAUB 1V6OA 2BHZA 1LFUP 5IYBJ 3I3QA 2NN8A 3V0AB 3INAA 3PSFA 4NR1A 1P7IA 3GCMA 4XMAA 3P3NA 1UO9A 2DFIA 2PHWA 4QU2A 2JA6J 3GHNA 2WN3A 2OW4A 2HXOA 5I0UA 4XQDA 3N9NA 5T5PA 3CMMA 4UXNA 3EXUA 3AM2A 3REOA 2RVCA 3H1YA 4XFAA 1ZG1A 4LA2A 4YZ3A 2R1BA 1B6AA 4QGLA 4PI2A 1NCQC 2G19A 4HRIA 3FWEA 1XSQA 3ONQA 2ZA9A 1UPIA 2YB7A 4NUBA 4URAA 2CV0A 2JT1A 3BZCA 4ENJA 2HYXA 2HNHA 1W6NA 2HZDA 4LK0F 4LHKA 4EZ4A 4FP2A 4GH4A 4G8XA 1EV12 1EJ9A 5C6CA 1F5JA 1W7PB 3TO6A 1W3VA 3AC0A 3CTAA 3D1NI 2L4AA 1P8JA 5JR3A 3LSHA 2L0KA 5FB2A 4L97A 3A23A 1OSGA 1CESA 2JDZA 1Q5OA 4F7ZA 1F15A 4O3MA 5L9BA 1JJ6C 1YI2I 3GYHX 2HEOA 3RJPA 1ULEA 2JDAA 3ETPA 1C4RA 3WD5A 4YIFA 3SHFA 2CYFA 3VBUC 5EJ3A 5E16A 2KKOA 1AHDP 3BP8A 3M8LA 1Y39A 3T0BA 3FHIB 1LOEA 3ZXFA 4HX7A 4XICA 1LJ9A 3ZN5A 4Z2YA 3SH5A 1W5SA 5A32B 2XXZA 1YTYA 1ETQA 4PJYA 4FP3A 2XUEA 5IVJA 5GAHJ 5H20A 1JJ8C 3C2HA 1U8RA 5M0TA 4EEFG 4F3JA 1XNAA 3PUSA 3F8MA 2GDFA 3K46A 3CJQB 3N7LA 4EWDA 5LHIA 4JDMA 3LEKA 5F37A 4CP0A 4NIGA 4ZDOA 1JYCA 2MABA 1RXGA 3G7DA 3HHGA 5L3CA 3HVDA 3RFRA 3QQAA 3IAPA 5L3EA 2V73A 4OAZA 4LG0A 4LUKA 1GQPA 3RZOJ 4LO6B 2MEV1 1HLVA 4C8DA 3CO6C 2HOEA 2R071 3DTEA 1QJY3 4QPOA 2AR6A 2EZIA 4Z6YA 4XABA 4I98B 2GA1A 2X09A 1UXXX 4XDOA 4LKFA 4MIMA 2LS6A 2VPLA 3HC7A 5EF6A 3ZKUA 3G1LA 3KCYA 5FFXA 2FDFA 1QVTA 2CUFA 2DU1A 2ORZA 2W0XA 5TISC 4C3JJ 1QZYA 3GZAA 4FX0A 2F5EA 1ULGA 1RUJ2 3HN3A 4YVSC 2W3JA 1WCQA 2E63A 5D5WB 5IT3A 1W9SA 1NCQA 1KU2A 4RFRB 3PQKA 4FASD 4ZYGA 1PZ9A 4A6DA 5C3QA 2FSWA 1R4NB 1NA1C 5FY5A 2KISA 3KLOA 3IN9A 5HNFA 3HTSB 2VXJA 5DM7F 1D4VB 2DCJA 2VI6A 3BDDA 4MHGA 4IESA 2F6CA 4Z2WA 3OYBA 2EIGA 3HPGA 5GADJ 4IV1B 2EPFA 3HRSA 1DLCA 3MFAA 1HSTA 1YIJI 1UN1A 3MBWA 5G05L 1QJX2 5C3RA 3J81Z 5J36A 3M3IA 3JAMK 4UUVA 2W1WA 1JT6A 3F8NA 3U11A 2MNGA 3VZNA 4GWMA 4LE4A 1UZZA 3D4KA 1MMSA 2LALA 2A05A 3ZMZA 1PZ8A 4IEYA 5J8CA 1PX3A 4BQAA 4QQPA 1R1VA 5IPAA 3AG2H 4YEJA 2FMYA 2WC2A 3H1WA 5BXXA 2M7AA 4MO3M 2GNBA 1ERDA 1Y1WJ 3PVEA 2DMPA 2Y75A 1W1WE 4YFNF 4LOSA 1QGPA 4M6XA 2D6PA 1D5YA 3OYMA 2FUG2 2XPWA 4MO7A 2VKDA 2YBSA 3WP3A 3DBLB 2B5HA 5AFBA 3MZ8A 3M07A 4LHNA 3ZSMA 2PMHA 2MD5A 2QQVA 2AH2A 1J2XA 2CG4A 1LULA 4AI1A 1XOYA 4KNYA 2GMPA 4QU1A 1ND3C 5FZ6A 2B7YA 5E20A 2DVBA 2AQFA 2QKLB 1V6KA 3HT2A 2M2EA 1FOXA 3H7YA 1U0AA 1YNAA 4V2WA 1YS7A 2Y6LA 1Z1DA 3JW4A 3L2HA 4TLFA 1VBA3 4E7KA 4LIUA 2IXLA 1XS9A 1U5TB 2VE9A 3ZP5A 2ZAAA 2PBIA 5FBZA 2ZGKA 1HOMA 2KXLA 1D0GA 2JG9B 3NNFA 5E8GA 4R9AA 4Y20B 5J4VA 1HQWA 4NQWA 2QTWB 3ZYBA 2ZJ2A 3E1F1 3VBRC 1AL0G 4RGAA 4NROA 3WG2A 3WTVC 1UXZA 1LOFA 2HXIA 2WWJA 5BNNC 5JR7B 5CFCA 1MJAA 1WMFA 3HRUA 4LBKA 4KBZA 2EF6A 3ZXEA 1TWCJ 1I3AA 2KJCA 4CGZA 2LC2A 3MDPA 1VQLI 1PMIA 1Y4WA 4OIQF 3LSEA 1NA1A 3FHQA 2V9VA 1BR4A 1F4AA 3BCWA 3OOPA 2R49A 2NMOA 3A4CA 2VBWA 1S8NA 4IEZA 3WZ1A 3VD4A 1UD1A 2KT0A 1PDNC 1W90A 2HWD1 1MS5A 3UK9A 2CJJA 3I9V2 1JOJA 4DEQA 1QWRA 3WU2C 1GV9A 3CCYA 3JBG3 2R7VA 2MBFA 1H1MA 3MIBA 4M3BA 5IATA 2UY8A 4JHZA 4YW1A 3HSEA 1UPSA 4CDGA 3OS0A 3PNTA 2LTNA 3M3EA 2Y0OA 2OPKA 4WM8B 4HZFA 5FZ9A 3Q8EA 2JA5J 1XGOA 3HG9A 1LOGA 3PDQA 2DA7A 3S14J 2XAJA 3NNGA 2R7OA 5EPAA 4Q4Y2 1DG6A 2Q8DA 4HSLA 3QCWA 1PGL1 3KLNA 3OYEA 2Z5UA 3H5NA 2Z16A 4MGYE 5FFOC 1JUSA 1AR82 3FBIB 1Z91A 4OQ9A 5L7OC 1I3HA 4R1HA 1O59A 2QQPA 4B4PA 4Z8BA 2E19A 2XGCA 3OYCA 2HWC1 4UFKA 3DLAA 2O0YA 5LRRA 3VBFC 2IEKA 5KK1A 1HIXA 1FLIA 1F5TA 5FYBA 4RAYA 5K7HA 2FDGA 3G3ZA 2IXJA 1IXCA 1OPCA 3TYJA 2PAMA 1AR93 4I09A 1DDLA 1BIAA 2RAEA 4JQRA 5DD8A 5HI0A 3K2ZA 3AXDA 4HFSA 2DUOA 2F2EA 1N75A 3A7QA 4AIKA 4QPYA 2JQ7A 3WXPA 3N9OA 1AA7A 2JPCA 2MFZA 3FUQA 4AIJA 5GZFA 3NARA 4L2NA 1CZTA 2OT7A 1R58A 1MS8A 2H1KA 3LIHA 2CU5A 3WDUA 4WK8F 1DF0A 2QWWA 2NMNA 2P3IA 5I0SA 4HLTA 3IH3A 3A0HC 3ECOA 1J5YA 1WA6X 4XRMA 3KZ4C 4DUVA 1W99A 1RXFA 5C71A 2XH6A 4FPYA 1OVSA 2QBYA 1RNLA 1K12A 4MADA 3C7OA 1GT0C 3FXKA 3M7GA 2OQRA 2VJ5A 4LKEA 1QH6A 4RQPC 2BNMA 4HQEA 1X1DA 1X8MA 3DEEA 1R091 4HPKB 3GUDA 4PJMA 4QPGA 3K9TA 4PSWA 3UGFA 4V2VA 5GTIC 3F8FA 5FOJB 5BNGA 3WTYC 1OBNA 1JZ3A 3RQ0A 4A93J 4I99C 3H35A 3I2DA 4YM1A 2BVBA 2YS9A 4NIDA 1OPOA 2J1RA 3SEZA 4BU2A 1R5ID 3RZDJ 5E3MA 1RUH2 4LBQA 2WWYA 3K51A 2DYRH 3VPRA 1VQ4I 2R7WA 2K9NA 4AVAA 4WVZA 4Y22A 4AC0A 2YC4A 4HX4A 1H2KA 3KB5A 4I0BA 3LFMA 3TRSB 5KXCA 1ENQA 3T1LA 3ZOBA 4AGVA 4LB5A 1WMXA 3D5SC 1MMGA 1WMEA 4DUXA 1RUE2 3EQLF 3DL3A 2RQQA 4BLIA 2DQLA 4J19A 2GH8A 2W84A 1MJBA 1YO5C 1UMQA 3E5QA 5L7OA 4FTBA 5FZGA 3QOEA 4W8JA 5FWEA 3KEQA 1YIPA 1RUNA 4HLXA 2L54A 2QSHX 3TB0A 2JA8J 3LQCA 2D40A 1IN5A 4F8AA 5B2GB 1CR7A 5EWSA 4MGQA 1E5HA 1VRH1 2MYSA 2EZLA 3T2PA 2M8GX 3NV4A 3KS7A 4HDVA 1DQ5A 1TVGA 3Q8FA 3H36A 2C26A 4GGGA 1IDZA 5D21A 2KD7A 2WYFA 5CIRA 4Y4RA 4NVPA 5FLJA 5LHHA 3VZOA 1FOD1 1J0RA 1XNDA 2W1OA 3DF0A 3S1QJ 4G12A 3RTRA 1PNFA 4Z82A 5LBFA 4OZXA 4DMIA 1HJGA 1AR61 1P4AA 3BTXA 1SFNA 5F3GA 4DB5A 5EFUA 2ZGTA 3MIHA 1NUKA 1V4RA 4Q4X3 1D4M2 5F5CA 3WDWA 3NWKA 1OKQA 1YIFA 4RBOA 4KIGA 4XVHA 2EIJH 4LHSA 1WPKA 3IV5A 2Y30A 3PU3A 3Q3SA 4K40A 3I59B 1HSJA 2QBXA 2R16A 3ACFA 4YZ2A 5KHDA 3RZMA 2VKHA 2DA2A 4OVEA 3GLXA 4WF2A 4TTGA 2JENA 4RQPA 1IPJA 4XDPA 1XC5A 5DS9A 2VR4A 5CKTA 1S7EA 2LR8A 2NOJB 5FRMA 1NQJA 2EA7A 4J25A 1QQP3 3MPBA 3R6SA 3OBAA 3HOTA 4HNUA 4A3FJ 4B1MA 2CQKA 5D5XB 3KZIC 3POJA 1ZZ9A 4M0NA 5FPAA 3UKNA 4ZXKA 1DGWX 5I93A 3N3HA 4Y1VA 1FTZA 5IVVA 4FETA 2CQQA 2J1EA 2ADEA 2EB7A 1YJLA 2PX9A 4KA4A 3S7IA 2IGKA 3KP5A 2XMLA 4URTA 3VBHB 2VVEA 4QX1A 2VZOA 4LBLA 1C8M3 1FMD1 3AP4A 4A6EA 5FXVA 4GMP0 3GWZA 3OR1C 1LGCA 3C7GA 2A3XA 2WS93 3OOUA 4FQGA 1K45A 4ATFA 1YJKA 1A04A 5E88A 3B73A 3BI3A 2XAQA 1EAH1 1FWZA 3J81K 4QDSA 3QP5A 3PVBB 2H0VA 2R7DA 4OIPF 1R1ZA 5A1FA 4NHKA 1RUI2 3S3NA 3SJMA 1FT9A 1DYPA 3KV6A 3SFZA 3W5NA 2RE9A 2DI3A 2ELHA 2DTWA 3NJYA 3J8F1 4UB8C 3DXUA 2ZGPA 3AZWA 4LLOA 1ETOA 5F1RA 3KF3A 1YYVA 3TQNA 5L73A 2VQAA 3KF5A 5I91A 1J9IA 5C8WA 2OYZA 2VBYA 5F04A 2JUCA 1JYIA 2AXLA 4MXWB 1B09A 4XACA 2VBBA 2VZ3A 1P7JA 4XAEA 1K6YA 3MV01 3U1KA 1GZ9A 5KCMA 1YLLA 1UHWA 3GFMA 1XB9A 3GJAA 2TNFA 1I3QJ 3I4MJ 1V6IA 4S2FA 1SBFA 3R4KA 2PLV3 4N43C 3FKIJ 1FBQA 3VZMA 3U4SA 1OD3A 5EYXA 2CUZA 1W8OA 2YGMA 5FPBA 3PSIA 4NIIA 2JX9A 2XPUA 4ZZ8A 3OSDA 2VQ0A 4NN0A 5KNLA 4HKWA 5J3UA 2Q0AA 2W87A 4GXLA 3ZQLA 2HLEA 3WW4A 3KE2A 2UYBA 4NHJA 4QKFA 3VD3A 4CYCB 4AOCA 1D0HA 4JGZB 2ZX3A 2GN3A 1NK3P 2R7RA 2WR9A 3ZYGA 2W4SA 3BPVA 1S6LA 4GAZA 3DFGA 4KGQA 3IUOA 2HQ5A 3SYTA 3UKGA 1BKZA 4YGBA 2P4WA 3HPHA 4PJ0C 2R0FA 1ZZ8A 3ABMH 4PLOA 1XSVA 5CKMA 3VL8A 4IQPA 1ON1A 1OA3A 4NB5A 5F9TA 3GF6A 3OYWA 1G59A 4YZ1A 2W5FA 2VCBA 3N7MA 2KRFA 1A78A 4YIRX 4FFHA 4XLHA 1NHAA 3CJNA 3HOYJ 4K20A 1B9NA 1OR7C 5LA1A 1RITA 4YG3A 4MHUA 4OWRB 3OPWA 4Y5Z0 3IDEA 5FD6A 4YRDA 4K2EA 5FQ0B 4OHXA 4C30A 4D3WA 4YFKF 4PSXA 3HOVJ 3A0KA 4UOJA 1F5FA 1WI3A 4CCJA 3S2DJ 3IAS2 1PVC3 1WZXA 4NC8A 2IXKA 4ZPIA 3D5RC 4XKVA 3HNMA 3VHPA 3NNJA 4XRSA 3KGZA 4AI8A 1XB4A 1F4KA 2XAHA 5FZAA 3BU7A 1X2NA 2IW5A 2WNUC 4CEYB 1X8EA 3VDDA 3C7JA 4YW6A 4ZTJA 1RMU3 3JU9A 4CU6A 1KU3A 3KQ4B 4B8XA 2D97A 5CADA 2KIFA 4GFBA 3WG7H 2D44A 2XJVA 2K9LA 4MV2A 2CDPA 1K61A 2A6ZA 2P37A 3WTXC 3G1OA 4Y7NJ 4UFHA 1WH7A 1YHQI 1WBFA 4JDNA 3VN4A 3VSKA 4AFAA 2R92J 1RUD3 4IRIA 4I3PA 3LEIA 3ABUA 1OOPC 3L2QA 4XJWA 1O4TA 3FHAA 2JDYA 5F0FA 3OYJA 4D6RA 1UHMA 1FSEA 2VOTA 4L11A 5JZGC 2EAAA 2XB0X 3NJXA 4XONA 4IOCF 2H0BA 5FCCA 3BU0A 3AKPA 1ZZ7A 3CCLI 3A02A 1RC6A 1S2KA 3MWMA 5KC6A 2ELJA 4M9XA 4OI0A 1Y9MA 2EIBA 5A7OA 1U3EM 2EIDA 1PJRA 3BR5A 1YC61 4LLFA 2W39A 3BG9A 1LDJA 1JE8A 1B1BA 2A75A 3I2FA 1IG7A 1MJ9A 1DU0A 1JXSA 1G7YA 4LQRA 1APLC 1ONVA 4QPGB 5I8SA 3QODA 5KXDA 2JICA 1OKOA 2HWF2 1HXS2 4X8PA 4OMYA 2RS53 5A6XA 2PHTA 1POQA 3PUBA 2AQEA 3ZXAC 3T09A 2XKPA 1HRI3 1HB2A 3G4SI 2OKXA 5FP8A 1IRGA 1Y8QB 5AC93 2D1HA 2DU9A 1LEMA 4OUEA 5FYUA 4K1YA 1JXNA 4A5MA 4FI9A 4PQ9A 2ES3A 2A5ZA 5FYMA 1R1A2 3OGGA 5J09A 4HMZA 4LBOA 3OS1A 4UF0A 2W1QA 2CU7A 2VZPA 5E1RA 2P81A 2R042 1W06A 5M5YJ 3GCWA 3RMYA 3HUGA 1PK6A 1UMHA 4YARA 5DCFA 3LWCA 3OR2C 1K79A 4K1ZA 1QHHD 1V54H 3LDBA 1FOYA 1ZBE3 3KCXA 2ZC2A 4YLZA 5A33B 1WWYA 4AVPA 1ZGAA 4E6KG 4QX2A 4IZZA 2JE7A 2YUSA 1Z78A 4LD5A 3PNYA 3AKQA 4C0HA 2OBPA 2JKXA 3MN2A 2WNUA 3UETA 1X3WB 3UJOA 3S1MJ 3L2VA 1NKGA 3E97A 3K4KA 3M8EA 1O8PA 5IHRA 2XR4A 1KQRA 2X5IC 5BNOB 3OGSA 5JAXA 3DKWA 2RS32 3TEWA 2M34A 2XGEA 1H0MA 3C7HA 4ZY9A 4Q4ZF 4D6QA 5C4XJ 1MMAA 1HRV1 1IW7F 3TN93 3WTSC 3TP3A 3GYDA 1NOVA 4Z92B 4AGRA 2DAOA 2GC2A 4A5NA 1OF3A 2GALA 4RA2A 5EG0B 3RG0A 4AI0A 1YXWA 1RKTA 4W6WA 1CF7B 4YM2A 4PLNA 4E8DA 2E7WA 2GBYA 5JZGA 1OD5A 3K0LA 1PP7U 2HH9A 5DUWA 4WXHA 5DPNA 4CTEA 2HYKA 4BHCA 1TMF1 1KDKA 3C8XA 1AYN2 4JV4A 1Z3XA 2A6TA 4Q0SA 1FYKA 4JRLA 5DUUA 1JH5A 1GLNA 2R3SA 1E3OC 3GBFA 5HV4A 3GCXA 1LNWA 3P5JA 3VD9A 3USUB 1IZ1A 2L7KA 1CIYA 1FC3A 2A5WA 4DIQA 4Y5SA 2RM21 4CDQB 1QU0A 4DGWB 4XDQA 2C6YA 3OCPA 3N9QA 2FF4A 5KHIA 3AYEA 4PZJA 5HCAA 1VB2A 4L9NA 5F0CA 3I4PA 4IV3C 3BYWA 3N36A 1ALYA 1AYM3 4XMIA 3OYAA 1U2WA 1WUVA 2FQ4A 1T98A 1AL21 4II3A 1UW8A 4EYUA 1QOTA 3NW4A 4B44A 2L9SA 4BQ5A 3ZYRA 2HGCA 1ZREA 4XF3A 2VJJA 2WAFA 1AXKA 4CCCA 4DNCA 2A69F 3CESA 1QNTA 1IN7A 2CQXA 3ORJA 4FXGB 1A3KA 2HDWA 4HV6A 1CONA 1OLME 3H50A 5IY5H 4O9EA 5FMOL 2FU4A 5FUPA 3O1TA 2DCTA 4GMP3 3PQJA 4I0AA 4AK3A 2FBKA 2W85A 3EO6A 2ME0A 2R7ZJ 3KP4A 1TME1 1OH3A 4HLYA 1ZBA1 1W8HA 5JVVA 3SEEA 3OD0A 5A6ZA 3TWIA 5JXHA 2AENA 2YXSA 1VBA2 3CQZJ 1T33A 3OIPA 3FLTA 1LRHA 2J7MA 2ZFWA 1SBEA 5J37A 5ICGA 1TEIA 5GKAC 4CU7A 1FYLA 4WVVA 3U21A 3LSMA 2ZXQA 1U78A 3BR6A 2XAUA 3ZFGA 1X9PA 4X8NA 5LY1A 1DU6A 2K40A 1WKYA 2HPMA 3TBDA 1SBDA 2EBIA 1H4GA 1HQCA 3ISPA 3ECHA 3LAGA 2X6WA 1WMDA 1F8VA 3VYRB 2VY0A 1SEUA 1U9OA 2X48A 2RR13 3HMYA 5FUNA 3IKTA 1LE8B 5FKMA 2LLKA 2DOAA 1ENSA 1LU1A 1ZRCA 2PAEA 5DG1A 4QSHA 2X51A 4A3LJ 2L2OA 2MSYA 4HVQA 3SEPA 1WLTA 2VOKA 5IK8A 3LFKA 1SAUA 2QUFA 1GZCA 3LEGA 1GKBA 4LMFA 3GHMA 4PCRA 3JBG2 3CJIB 5J6XA 1DGWA 3PM1A 3W59A 1UL9A 3M70A 3HQRA 3ACIA 2LF7A 3LNQA 4KMFA 3BPSA 3N9LA 4A3DJ 3F0CA 4I7HA 4HDUA 3CJRB 1WI9A 5HS8A 2WWSA 3WT3A 5GP9A 3H9GA 1DPRA 1GU3A 1GHCA 4AZZA 2F17A 4BA6A 4Y4YA 2X29A 5ABJC 1XNBA 2DUPA 3JD73 3HTUA 3NWSA 4HQMA 1CJDA 2YU2A 2LMDA 1BYHA 3VDXA 1UY2A 3H1MA 1F1ZA 4M4RA 2D2WA 2R5YA 1BHGA 3FC0A 4Y3OA 2ZHMA 1BQPA 3V7RA 2O03A 3JTGA 5FZDA 3ZR6A 2CV6A 3DPRC 2JA2A 2JN6A 2R063 3P5BA 1Y0UA 2QQ9A 2VUCA 5H6QA 5GZGA 1UYPA 1MH4A 4O5VA 4MG2A 4FAHA 5ILVA 4YW5A 1H2LA 4QGMA 1YFWA 4IGOA 1POGA 4M3CA 3TOJA 1L3JA 4QGNA 4ESJA 3GXUA 4ENKA 3NAUA 4DW6A 3VUOA 4N9IA 2VJXA 1O5UA 1ODMA 2ZKLA 4PBPA 4XLEA 3NMBA 5A3WA 3IM0A 2MH2A 3K75B 2ESHA 3Q8BA 1MEC3 2VMEA 1YLFA 2WO3A 3NWTA 1PIV2 3EDPA 1HA8A 2P5KA 2DN0A 5E89A 3GZNB 4A3BJ 2DOEA 4U0VA 1IGNA 5C4WB 1AR72 3LDRA 3CLPA 4OIRF 1EA3A 3U07A 2K5CA 3CP8A 3DYMA 5BNQA 1RKWA 2XRLA 2P0WA 1OFCX 4B3AA 4NHXA 3QLQA 1M06G 1CAXA 2NRAC 2R6QA 1IN8A 4XSXF 4XXPA 5C4JJ 5LGUA 2XLGA 2F6BA 2DXIA 1K78B 2DCYA 3J26N 4W6XA 1V55H 1ND2A 2ZGRA 5F27A 1QJU2 2O0OA 1RUF3 3RVHA 2ZJQF 4AYBA 1SEFA 1Z7S2 3D82A 5HCFA 4YRVA 3SKVA 1HBXG 2DJNA 5DD4A 3SZTA 4DYRA 4UY8I 2NOGA 3JUUA 3ZIWA 2R7EB 4AHYA 4RD7A 3ZMVA 2XQXA 3V65A 4Y5TA 1HW2A 1K5MC 4QM9A 3FMRA 3CZJA 2WAOA 1JOPA 2C6SA 1B4AA 2DPDA 2Z4FA 4DRRA 3CCMI 1SAXA 3OPZA 4JBAA 5ED4A 3N9MA 3FMQA 2Z3YA 1JYVA 4LR4A 1OKRA 2WADA 1MZ6A 1HB3A 3UESA 1S3JA 1VBC2 4XFHA 4U7BA 5ABJA 4XN0A 2ZABA 2P7CB 5EEHA 3AKTA 3FFQA 2CSGA 1ZG5A 4GULA 4HANA 3MHZA 1J75A 5H9RA 4FPLA 5JOZA 1C5IA 3FJSA 2DWRA 3WHCA 4A12A 3VBSB 1PM4A 3DPRA 3W2WA 1R6RA 3UKTA 2HVQA 4IGPA 1VE0A 3E5UA 4E7SA 5APAA 1Y7BA 3ZRGA 2W57A 2AYHA 5EZHA 3KZYA 2XL7A 3HZJA 4V2GA 4EZHA 4FPKA 3BIWE 5IVCA 3LE0A 5FMDA 4AVBA 3FXJA 3HBZA 5CVIA 3AVSA 2ADDA 4ES9A 1UYZA 1XE0A 2XBO1 4UF0B 1NCRB 4UW5A 4B09A 4X1EA 1JYNA 2PLYA 1W39A 2VUAA 5JLWA 1VQNI 2VMFA 1LODA 3BROA 4XBFA 1GZWB 3KV4A 3NQOA 3VKLA 3SDBA 4G6DA 1EV13 1UY4A 2LW8A 3B00A 3VBOC 4BQYA 4QQOA 5F2WA 1BEV1 3PL8A 4CCKA 3RZZA 2E9QA 1PO11 3KD4A 4BIFA 1OA2A 3JRHA 2ECBA 4B48A 2Y34A 2CYYA 1O5LA 2JECA 1BC7C 5K7FA 2L7FP 1PZ7A 4P9JA 4P9YA 1BBT1 2JWTA 2NXNB 1PGW2 3P3PA 4C2MJ 3BZ6A 1TP4A 4F93B 1RVF2 2B7EA 2E2JJ 1LEBA 3BB6A 4CXYA 2BDRA 1POV0 2IZWA 2P1BA 4FE7A 1G9FA 2FRHA 1OPMA 3E6BA 5D8AC 4DINB 4GZ9A 2VL4A 4RGKA 1B35B 3DEUA 2JVGA 4G9SB 5CKQA 2ZO4A 5HCBA 3ZFEB 1NTCA 2DFHA 4N4NB 1XGNA 4UFIA 3CQOA 4LHLA 1DP7P 2OTLI 4F92B 2E1CA 4META 4QX8A 4RLQA 3WP6A 1NE6A 1UY1A 2O5RA 4LBQD 1RZ4A 3FMSA 4OIOF 3P9CA 4B4RA 3R0RA 5B1AH 2WLQA 5DDGA 2VW1A 3WODF 1LESA 4IHTA 1ACCA 1TZOA 1FP1D 5LD2C 1RHI2 2Q8KA 5AFEA 2M0MA 4W1UA 1C28A 3AL0C 1S1AA 5CISA 2A6XA 4YW2A 5KC5A 4PDWA 2UXXA 2D3PA 3LOBA 2D45A 2Y0MA 3OBRA 3HOWJ 1VBD2 2B9SA 3N9PA 2PJRA 4V19K 2DUQA 1V3FA 2BERA 1F43A 1GUUA 3ES1A 4FFGA 2XF7A 4QQLA 5I8YA 1H8TC 2BOIA 4A3EJ 2N7GA 5FP4A 3KGLA 1TG7A 3W6VA 3CC7I 1YUDA 3AMHA 2KDZA 3VBUB 4BE3A 3CCRI 2BQPA 1W8FA 5E8AA 1KZHA 1W6MB 2YBPA 4E70A 1W9WA 4M3EA 1S9HA 4ZC3A 4COUA 1XSRA 4RS5C 4HYEA 2ATFA 1J1LA 1PGSA 1ZZ6A 2VULA 3AK0A 1MDMB 4OZOA 1RINA 1R081 3BOWA 3H0OA 2WA3A 5FLIA 4C91A 5C70A 2F48A 4ENNA 4OHZA 2ARBA 4C3IJ 4IE0A 4Q4W1 1ZHFA 4YVWC 3RKWA 2WFF2 2BZTA 2O8QA 2XVCA 5FZKA 1VMFA 2ZB9A 4ZZDA 1QJX3 2IRFG 4Y17A 1EH8A 2PLV2 4FXKB 1HDKA 4DZGA 2JEMA 2LDUA 2VXDA 1R1UA 4TXWA 4W50A 1FIPA 1WJBA 4BHBA 3LPGA 1BI2A 2E33A 3ZFGB 4BK5A 5GPAA 3T1MA 3EYIA 1I6HJ 3MVPA 3OOXA 2QDRA 3RKQA 2HWC3 4PFPA 3F6OA 1Y9QA 1X1BA 4SBVA 2XASA 2E7XA 3AL6A 3BTCA 1WLDA 4P9IA 1X58A 4QHZA 2W46A 1T38A 3ZX7A 3K6GA 4D5CA 2XJUA 4LXLA 5JSOA 2NYYA 4BBRJ 4TWTA 1GANA 1RUG1 2KPMA 4XBLA 5T54A 5FO7B 2VMDA 5DZEA 4RGRA 5E6HA 5CJ9A 2BWCA 2RN7A 4KUMA 3T0YA 1W8NA 1QF3A 1USSA 2ZMEC 1S4CA 2JMWA 2NVTJ 4A3IJ 2JPBA 3WW1A 4P9UA 1WJFA 1WW7A 2DODA 1UQXA 3WOGA 5FMBA 5JVGF 4NRMA 5C3SA 5IAXA 1X1AA 3VSLA 5EV7A 2HBTA 1LOCA 3JB4C 1E2XA 4I0WB 2YPJA 1ZELA 1X4PA 1FATA 4RGUA 1IUYA 1H8TA 3ILFA 2IVJA 1WW4A 3FXQA 2ZKZA 3LQRA 1FV3A 1IGOA 1ZYBA 2BW3B 2PQ8A 1JU4A 3MKLA 4CP9A 5EYYA 2RMU1 4CUCA 3DP7A 3ZSKA 1Z21A 4S2GA 1Y0NA 2FX0A 4HOOA 2VB6A 2CMPA 5J7MA 1GP6A 1MNEA 1R093 3LA7A 3UT0A 2GOMA 2VQHA 2XAFA 4CDUB 2P6TA 3V0BB 5EQUA 3PURA 4RS5A 1F2NA 3RZKA 5CVJA 5A7WB 4E27A 1XU1A 5BPIA 3GJBA 4BY7J 1J3PA 5FP3A 4A4AA 3D0JA 2ZNYA 2E32A 2XOMA 2LKPA 2FCUA 4IF4A 5L3DA 1CJPA 5J1RA 3RNSA 2YC2A 1NY72 4XKBA 1ULCA 3AZVA 1U5YA 3ITQA 3BGAA 4RL7A 3OSGA 1YX5A 3ZXKA 3CDIA 1TNTA 4QX5A 3CCVI 2LTPA 5LLQA 2BP6A 1R5GA 1GBGA 2DYSH 3I2JA 2Y31A 3I4IA 1GLHA 2M1BA 1EPZA 2LM3A 2CY6A 1ND3B 4QWQA 4HBNA 3VWBA 2VZUA 3J7NA 1OF4A 4BWOA 1MBHA 1W0UA 5HDGA 2TEPA 2Q5TA 1B9MA 1O57A 4ISRA 2PHUA 4ATEA 5ERIA 3KMHA 4JC1A 1BM9A 1IV6A 4XTMA 2J42A 5JOWA 3NJZA 3KHBA 4Q4Y3 2Y2ZA 2A68F 2LH9A 2YX4A 1OCTC 1UFMA 3Q8AA 5GZDA 1H1IA 3SCFA 1ON2A 4QPIA 1CAUA 5E1WA 3THDA 1LFBA 2EJRA 5KHKA 1TL8A 3JCUC 5KVRA 3KZZA 4M71A 2CTVA 4XL9A 3VBRB 3TEYA 3V0AA 4D94A 3QU6A 3O1SA 2H09A 1PNGA 3TW7A 2GXAA 4L5IA 5BNNB 3CEWA 4TZDA 4UUTA 3OYIA 3CBNA 4QAWA 3S17J 1OVPA 2RS52 2EFPA 3LIGA 1BLZA 1K5JA 5FKCA 2ZEYA 4PLMA 1HRI2 2WV1A 5FK7A 3FHNA 2F4MB 2OUJA 2IT0A 3GFLA 2WKKA 1S0DA 2LUWA 5JLXA 3HBKA 2Y26A 3W21A 2C24A 2GLOA 5FKLA 2XVKA 4BIOA 2EFNA 1XNCA 1C0WA 1VALA 1W05A 4LA3A 3KP3A 4BE1A 3WY6A 3CCQI 2VLAA 2J1SA 1HJFA 1BZWA 5E3NA 1LR5A 1IQDC 1W3XA 1LHNA 2IFRA 5FZ4A 2A6EF 2A71A 4FT8A 3TEZA 4LBNA 3B7MA 3QH6A 1QGLA 2VMHA 3U10A 4OHVA 1L0OC 3SNMA 2EXJA 3WG4A 2WBMA 2JIGA 2R7XA 1W7PA 3L9JT 2F4OB 2QQKA 3RI4A 2L02A 3VGIA 2FBHA 4IV1C 4BGDA 4YPJA 4GB31 2EA4A 3W20A 3B9CA 1RGSA 4G7OF 5FPVA 4W6YA 2F5FA 3OF1A 3H3LA 4RHV1 3MUY1 5C9AC 3IWZA 2VOVA 5TGTA 1W2NA 3O1PA 2MC4A 4DPNA 2NS8A 1ZLJA 5EZWA 1YYNA 5TJJA 4WCGA 4DOUA 2LBFB 2PELA 2R7TA 2GC1A 2FEZA 2PG4A 1HKDA 2XJQA 4EGYA 1JGSA 1SFXA 3PUAA 1ZG3A 2WZR1 2GMEA 2P17A 4BQ2A 1WA4A 1WWXA 3IHUA 3SFIA 4A3ZA 1YFYA 4DXTA 2WIIB 1BL0A 3F8CA 1BVP1 2I45A 3OPTA 3UJQA 2OZUA 4ITCA 2K86A 5DUXA 3OD4A 1YIOA 1LOAA 1PO22 5A32A 3GTGJ 1E5SA 2V4VA 3VBFB 1FMWA 1GWLA 1XNTA 4A3GJ 1LNSA 3TL4X 2FZ1A 3AKSA 5ACA2 3C18A 5FOBB 1HX6A 3ACGA 1APNA 2VOXA 3BZKA 1EAH3 1RUH3 2GH2A 1Z6RA 2J1VA 1PX4A 5K5OA 4BOWA 4KITB 1E5IA 1OCOH 3GLLA 2C9KA 2VCAA 3FX3A 2OC6A 1CAVA 1KITA 2D6LX 1YX3A 5E17F 1POV3 3IZOA 1SD7A 2WUHA 2ILMA 2ORXA 2MA3A 4M72A 4IERA 3BTYA 3LQQA 4LITA 2K46A 3BCAA 1G86A 3ECQA 4JK1X 2WA0A 2PEXA 3AP9A 3F21A 4R8HA 4JHTA 4ASMB 1IS5A 2RS11 1JI8A 5DAPA 4IEUA 3A01B 3EMRA 1U5TC 1IKQA 5DUKA 3HB9A 3S1RJ 3BT9A 4LT5A 1GR3A 4TLGA 4L9BA 2Y0SN 2D93A 2KIMA 5H6RA 1EUUA 3WE2A 3ZN0A 1ZLKA 3N35A 1KGYA 5F3CA 3BOPA 2KZVA 5EZGA 1W36C 1JUPA 5HOOA 5DG2A 1XDUA 2WQZC 5CNAA 3MZHA 1MZFA 3QPSA 2HDCA 3I2OA 1ZX5A 5JHFA 2BY2A 4B4CA 2VZTA 4EN7B 3ILNA 2KP6A 5F1JA 1ITYA 2FQPA 3H0DA 3PVNA 3LWFA 3VYTB 1FTTA 3VHOA 1R64A 4O6JA 4G6TB 1UAIA 1VQ8I 3AYAA 1S0BA 1FJLA 1VQ5I 4A0ZA 4PUSA 2VASA 1M1EB 3AFHA 5BNPB 4AFCA 5EYRA 4E7HA 1D4M3 4XFFA 4Y15A 4CU8A 2MLKA 4IV1A 1K6OA 1UZYA 4AI9A 1H4HA 3DCQA 1F9KA 3C7EA 1DP3A 3LZZA 2V4JC 4WX9A 2DOFA 4LO4B 4BBSJ 2JXAA 3PTYA 1K83J 3RIRA 3N7JA 3WR0A 1HF0A 3I5UA 1S7OA 3RPQA 4AHXA 4B1LA 3MEPA 4WM8C 5G04L 3ZFFC 1HDDC 5A1LA 4GWJA 5FROA 3ZPYA 1COV2 2EA2A 3QBQA 2VT2A 3AJYA 4YGDA 4CDWB 2EIEA 1D8JA 4ZU5A 2V9KA 1XDSA 4BQNA 1ETYA 4WM7B 1ZK8A 4BB3A 4BQWA 3IT8A 4UNOA 3NV2A 1MZ5A 3C3VA 4AQSA 1ETVA 1YQAA 2DA3A 2VOWA 4FTSA 1S0JA 1QJY1 3H8RA 3WQ1A 2GQQA 1IN6A 1SFOJ 4W4ZA 1I6XA 1O7FA 3FK6A 5FKOA 4AHWA 1WCUA 3AG4H 3FZVA 5FPUA 1R00A 2WQ8A 2BOJA 1K7AA 3M2MA 2Q1FA 4U0WA 2VQCA 3E3VA 2BV6A 3U9GA 4P9LA 4XOGA 4H4KC 3M1CA 3B93A 3EPZA 1RUI3 3GZTB 3Q9SA 3M4FA 1AF9A 4YGEA 2HWE1 1JKRC 1U5TA 3FN9A 2WT0A 1XTAA 4M3CF 3WG1A 2WAEA 1XMXA 3JRDA 2HVRA 4FFFA 1TNFA 4KG0A 3CHXA 1REEA 5CQEA 2JG9A 1ETXA 3A4UA 2W9XA 2LREA 4Y20A 1WLCA 3I2IA 1FOKA 4E4ZA 1IPKA 2GAUA 3POGA 1STMA 2E51A 2K85A 4ZYEA 3LEMA 3U4XA 3ELNA 3GM8A 4BACA 2XSJC 4QQHA 2YG0A 2A6YA 2HYGD 3HSRA 1ZA4A 1MQTA 1U12A 3ROUA 4AE2A 2EFQA 4NAOA 2QZ3A 4XIOA 3PU8A 4RR3B 3DV8A 4H55A 2X1CA 1I1GA 2MW8A 3MD2A 4M6VA 4EJRA 4NOTA 4A42A 1ZN2A 3R0AA 1YQCA 1WCSA 2C5DA 5A3OA 4FBFA 2RJKA 1LQ1A 1IO2A 5GZCA 4BZ4A 3LSRA 4B3XA 1HCRA 2F5CA 1AWCA 3NV1A 2CV2A 1FMVA 2HQNA 1V6MA 3DYOA 1J58A 4YZ5A 1GWMA 3CF5F 4AWXB 2JB4A 3THPA 1GVDA 3M9AA 2EZHA 4B3NA 3BR2A 5CYYA 1O6UA 1W9YA 1MSEC 1XJAA 5DXDA 4WXDA 2V5DA 3HN1A 3OYHA 4WM8A 3CCEI 4C90A 5CVVA 4HK9A 4K8FA 2E5NA 5F08A 1JKOC 3W58A 2OUHA 4YW4A 4NNJA 2KIQA 4GA9A 3MMYB 2WZEA 1FX7A 1GDTA 3ABTA 2BBYA 1IUFA 1D1CA 3POSA 3KIOA 4RAGA 3H8XA 4M9ZA 3ACLA 2OVUA 4CUBA 3T08A 5HXMA 4LJHA 1JMUB 5J47A 5LBBA 4A6OA 2VZVA 2ERFA 1YFUA 2XUMA 3ZYJB 3PL0A 2MEV2 1V6JA 1WHUA 2WY8Q 5FZ1A 2JG8A 2R072 5D8LB 2TBVA 4CYDA 1TT0A 1A6CA 4P00B 5GTHC 1UCRA 4XIDA 1DPUA 4NE9A 1DGRM 4ZONA 3AZYA 3AP7A 1SFPA 2AEYA 2KIUA 5CYVA 2XB6C 3MW3A 3IMMA 1A8DA 2VW2A 4N43B 2WN2A 2ZGNA 1QO0D 3ZN1A 1LHVA 5M3FJ 2M4GA 4LB6B 1CVNA 1T95A 4QM8A 1N1VA 2Z99A 2W95A 4BK4A 3H8OA 4P55A 4D0QA 4XOTA 5L3GA 4AQ6A 4XF1A 5JIUA 1LEDA 3HSFA 1QXPA 4OOIA 4QXCA 1B8IB 2IGNA 3SCHA 1OLMA 3BTIA 2BGCA 2QQOA 1K3IA 3C2GA 3ZN6B 2VE1A 2Y33A 4EE2A 2M7BA 4IE7A 1TW3A 2M30A 2CRGA 4FPHA 4IQJA 3K10A 4OHWA 4AWDA 3MW4A 4FOQA 2E1OA 3AMMA 4HN1A 4EV0A 3K4CA 2ZXWH 1XD7A 4RB0A 2WNOA 4OUMA 3QH7A 4RM2A 3DUIA 4E7ZA 1TMF3 5FFZA 4A41A 1IAWA 2UV1A 5JFRA 2AC1A 4GO1A 4X6AJ 4GALA 4HPKA 4P9GA 1LGBA 1R49A 4QPQA 5CU1A 2X0LA 1F31A 2HS5A 4RGSA 3CUOA 1CZVA 3TP0A 5I0DA 2D6NA 2NVUB 2D1VA 1XYPA 4J00A 2Q8CA 3EUHC 1KYWA 3O1UA 5B3SH 3LF7A 4NRQA 3H5RA 3BJAA 4NWVA 4MEXF 3B3QE 5AVPA 5J40A 1W0TA 3QOPA 2V7FA 1JI6A 3F3XA 3VBHC 1VPHA 4AEMA 1AXZA 2WT2A 4XM3A 2ZMLA 2R5ZA 5CVUA 1FOWA 1NLSA 1O91A 1F35A 2I8DA 1EP0A 1W6OB 1AR91 3S3MA 2HWF3 2P3KA 1HXS3 4KN4X 4ESFA 3WDVA 1ZRFA 3IAM2 1L7QA 4LGWA 3H42B 1SQ4A 1E5RA 2ID6A 1VR3A 3J7MA 3KETA 3T30A 3BG3A 4MUVA 4XORA 1QPIA 2OU2A 4NJ4A 2OF7A 5IJRA 2P5LC 2IS6A 2PMWB 1W5CC 4HT1T 3BQYA 1GV5A 1R9TJ 3DU6A 5FLVA 5F6LB 3POYA 1CAVB 4BQ3A 1KONA 3HQXA 1RUOA 1R1A3 2H6CA 1RJ8A 1PHMA 4PK4A 1BOBA 2R043 3L2CA 3ZR5A 4NIHA 2Y6HA 1FBSA 2OUMA 1W0PA 1R1TA 5IVYA 4FQZA 4HG6B 4BHPA 2D3SA 3ASIA 1N3QA 3D5LA 3THCA 4MGZE 3GBGA 1SLCA 2GNTA 1TTYA 5FJHA 5TSWA 1H9TA 1Q1HA 2HWB1 4LOTA 3RYPA 4LPLA 1QEXA 1O8SA 5HBAA 4EJOA 3K7AJ 3S3OA 2L4MA 2I10A 1YS6A 1BIBA 1J83A 1QMJA 3GTLJ 4ANJA 3JREA 3VKFC 1QHDA 4ZS3A 3F95A 1G4DA 1YW7A 1YEWA 4MFEA 4UVAA 3FBYA 1DGRN 4K21A 4X6QB 2KJBA 3THTA 3LFIA 5GALA 4LULA 3OL3A 4PF5A 1LOFC 3J7LA 3I59A 3WNKA 1R36A 2HWD2 5CFCC 2PMZA 3A03A 2RS33 2BHYA 2LP0A 3L09A 3HKZN 1HLCA 3A22A 3I8TA 3S93A 5DAQA 3DF8A 3D5OA 1S55A 3DYPA 2XROA 3AKRA 1HN0A 3R4DB 4QLCU 1XXNA 4JGZC 1WLWA 1CAWA 3FE5A 4ZYHA 1MBEA 4Q2FA 4AFBA 2O8XA 2B39A 1BA5A 2ZNZA 2VBDA 1WD4A 5GLZA 5FZOB 2DBIA 5T52A 3T2OA 1H0BA 4FCAA 4RYDA 3RJ2X 5FLMJ 2CAUA 4DO0A 4BQ4A 4G3YC 2P6CA 4TN7A 3RGBA 4LEJA 1OUXA 1VNDA 3ZYIB 3EUHA 3DN7A 2WFPA 1LCLA 2PFWA 3CO2A 1AYN3 1PGL2 3LKJA 3F72A 4XZUG 2STTA 3K2AA 3M8FA 1W8ZA 2I5UA 2E26A 3VBHA 4ARXA 3VD5A 1OCZH 3LL7A 5D6FA 2VAUA 3RCOA 1ULPA 3I2GA 2HWC2 2PHRA 4F52A 4AR2A 3BUCA 4H0EA 3O0WA 4LO5B 4AQTA 2D43A 3U0ZA 1LFPA 4KBBA 4YGCA 5D5UB 5E18F 5CLSA 1SMTA 2KR2A 1SLTA 4KWUA 1VIWB 1Q3EA 4AVCA 2RDSA 2X5IB 1SD6A 4GQ7A 3OGVA 2NP0A 1G3SA 4Q4X1 4IE4A 3WU0A 4Z07A 3H1CA 2EV0A 4D7NA 2E7AA 3HRMA 3I2HA 3CDLA 1CN1A 4MXWA 3V8JA 1UOBA 1NLRA 1BI3A 5LCWL 2ZX1A 4Q4V1 2L9LA 1GOFA 1CX4A 3MZYA 3M4OJ 4ENMA 3WHUA 2QQ8A 2Z42A 1I1EA 3F23A 4MXVA 4UW6A 3ZCOA 5J1YA 3C3WA 1R5HA 1NAEA 3ACHA 2B9UA 3BTAA 3ASOH 1QQP1 1LHWA 2Y6FA 5ILUA 3ON7A 5IYCJ 2R0HA 1ZKGA 4LBMA 1R092 4JZRA 2QQJA 3IL2A 2VJIA 4ON0A 2ENRA 1ETWA 4DNYA 1K42A 4RMNA 4MEYF 1MQTB 1VQOI 3ZQCA 4IV3B 5C5TA 5KAFC 1RL3A 3IPVA 4CYCA 4ZU4A 4AFDA 2KHMA 2OAZA 1VF9A 1RTVA 3DECA 4JGZA 4LBJA 4IHSA 5GJ6A 2Y6GA 2DA5A 5F39A 1C8M1 3HNYM 4QPGC 1G6NA 4Q8LA 1BBYA 4LE3A 5F64A 3ZSEA 4KICA 4GWIA 5AIPA 2WS91 3P1IA 3ZOIA 4PI0A 2Y0IA 4QXKA 1U5ZA 4CSWA 4XLFA 2XWJB 3WSOA 1QJZA 3RKYA 3O8GA 4OQ8A 2ISZA 2GC3A 3S57A 4CU9A 4CRQA 2ETHA 4MQ9F 1NLQA 5IVBA 2VZRA 4DXZA 1MBGA 2VN2A 3QACA 5D4SA 2D6KA 1LEAA 3LSKA 4CCEA 2LK2A 1S7AA 5FYTA 4ISQA 4FPEA 2VVFA 3ZMTA 3GTPJ 1MBKA 1Z7LA 2Y48A 2IVMA 2DA1A 4XRSG 5FQ0A 1TLHB 3OIQA 1N77A 1RR8C 3MO4A 4KWJA 3VLBB 4OUSA 2HKOA 3DPUA 4N0BA 1VRH2 4YZ4A 3N4MA 3O5SA 5M5WJ 5JI7A 3WF3A 5M3MJ 5BPXA 1H9WA 1X33A 4C3HJ 4FPCA 1FOD2 5K8SA 4C9YA 2JG8B 3DPLC 1A34A 3HOXJ 4CEYA 3AJZA 3OGJA 2HQAA 5D8KB 4L18B 1W8UA 2EWNA 2DT6A 1I50J 3MQ0A 3TEXA 1G9AA 3DGTA 1AR62 1JT0A 3ZQGA 1XRUA 3CLQA 2FZ2A 4HSRA 3GTMJ 1BC8C 1GOHA 3T4HB 3MW2A 4ZKTB 4E7LA 2CQ7A 4DQAA 1IQAA 4QIWN 3AXEA 1WGXA 1PIV3 1A8MA 4QDRA 4MNUA 1IKPA 2E31A 2K0GA 1QIQA 1W6PB 4XHBA 4PJNA 5I0RA 3BTJA 3I3LA 4KYWA 3ZSLA 3Q0VA 4GXOA 1AR73 5DABA 3GDBA 3DU5A 2LNBA 5LASA 4NRPA 2X6XA 4DXRA 3MYXA 2D7FA 2ZEWA 1RUC1 3RPUA 1G9DA 4KGGA 5KHJA 3ZPOA 3KYLA 4IE5A 4TV7A 2A07F 5LA9A 1V5EA 4EJTA 2MD0A 1IS6A 1DFQA 1X2MA 1QJU3 9ANTA 2VONA 2VT3A 2L9VA 4E7IA 1Z7S3 2NNYA 3V64A 1SLBA 3HR9A 4RAFA 3JRAA 1UAAA 4CEWB 1W5TA 5K5QA 3I3MA 2WNVB 2A70A 1E3HA 3D8CA 3ZIXA 3SXWA 1LVKA 4YFXF 2A6WA 3F2ZA 2TRTA 5FK8A 1ZYRF 2PAKA 5EGOB 1FMD2 2IWGB 3LMMA 3AG3H 1HDPA 2ZKNA 1PVC1 1C8NA 2BY3A 2HI3A 1EAH2 4GWNA 4AG4A 5FYVA 1BW6A 1S0EA 1OISA 3M3OA 1GP4A 2EXKA 4XE9A 3K69A 3D3AA 2J1TA 4XCAA 1GYKA 3EB7A 2OPWA 2L9RA 3CCSI 1AHSA 1VBC3 2R5ZB 2OQ7A 2IS1A 3H5AA 3FHZA 2RV8A 1PUEE 2XIGA 2DVAA 3J8F2 1DQ2A 1RMU1 3ZGKA 4S2DA 3FK7A 3KP7A 2YHJA 2BRTA 3BLYA 3ZDSA 2AS5F 4XN3A 5FYHA 3WW3A 3MV11 5A33A 1ZRIA 1ODNA 4BE0A 4CUAA 3WTTC 4UT5A 4ASNA 2QYOA 2OTJI 1DIWA 5IFTA 3U75A 4B47A 3BY6A 4M9SA 3JSOA 4QKNA 1RUD1 5A6YA 3VD7A 2LG4A 2DURA 1WH5A 4XQWA 1ZARA 2P5VA 3ZSJA 3L2WA 1TQIA 4BM8A 2HBUA 3I58A 3O1MA 4F83A 4D0PA 4BQOA 3NEUA 4MVTA 3AX4A 2WL1A 5BNOA 1W0OA 2WTEA 1W7PD 2VD7A 4G94A 3IDCB 2RGVA 4FSJA 5BOXA 1K5MB 4HA8A 1NG7A 2IXIA 1VB4A 4DZJA 5CG9A 2V79A 3KX2A 1O3SA 2UY9A 1D7PM 2KLOA 2X10A 1LECA 4JX0A 1XQNA 5FXXA 3T3YA 4UUSB 1XCBA 1NX9A 3ENRA 1H6XA 5I0TA 5EG0A 2R7QA 1L3LA 2DA4A 1GP5A 4TSVA 1KA8A 2JUGA 1CF7A 1H30A 1RVF3 3CMEI 3KYDB 4QB1A 3MKZA 3CJIC 3GVAA 3MEXA 1BI0A 5DZGA 1QZZA 2BEOA 2VO5A 2B45X 1YCIA 4QX7A 2Q1ZB 1MD0A 4C1WA 1ODDA 5A3UA 4Y26A 5AC91 4AHZA 3MFKA 4BJTA 4XF0A 3PMSA 1UMIA 3USUA 1MW7A 5K7PA 1CAWB 3BOQA 2YROA 4CDQA 1WFXA 5CQGA 3HT1A 2E1MB 4U2AA 3BKZA 2DVFA 4EWEA 4CZZA 1W6QB 1QOSA 3PMEA 1P2FA 1V9U1 3R4SA 3PIJA 1V0AA 4A44A 1ZBE1 1RHI3 2Z2SB 3M1EA 3KCCA 2TDXA 5FRNA 3A2KA 2YC0A 3VDAA 5CFDA 3OWTA 3BJOA 1OFSA 2ZFUA 4YM0A 3HGYA 2RMU3 3K4AA 3B69A 5FZ3A 3BIEA 3BG5A 1VBD3 3VBOB 2O8OA 4MX3A 4OMCA 5GLWA 2ZBJA 4AD9A 5AONA 2XRNA 5C8CA 5EP9A 3C2BA 4CXWA 3RZJA 1ASJ1 2Y60A 3LOCA 4AEDB 4IHXA 4D8MA 5DDJ1 2HOTA 3RRDA 3FM5A 2ARCA 5A7NA 1KJRA 3AZZA 3S16J 3KEYA 2XONA 1C1LA 4XUNA 4JQTA 4OHYA 4CICA 5FYCA 4PJLA 1XN7A 3TN91 5FZCA 5F6FA 1WCMJ 4FPJA 3I56I 4H7MA 4LKDA 5CEHA 3VDDC 2NVXJ 4QX0A 4IO9F 2QQUA 2ZBKA 2ZS6B 1YFXA 2DW4A 2Q0OA 3NKGA 3VODA 2DTYA 3TBIA 5AIQA 3HRTA 2Y9ZA 2JB8A 3S5AA 1B59A 2ZGLA 3NO8A 4YSFA 1C57A 2WFF3 3AZXA 2XAGA 3J7HA 1LE8A 1YG2A 4BJ6C 1U5IA 1G3TA 2E60A 4HX8A 5HCHA 1YO8A 2HU9A 1WJAA 2V6EA 1FY7A 3WCRA 5K0UB 4BISA 1WSUA 4XQFA 1Y8RB 2VQUA 4OAYA 1TW2A 5T3NA 5DTDA 1S0GA 4P9XA 3AFGA 4LLGF 1SVOA 3PTRB 4RGGA 4XLAA 4V2FA 3CJIA 4IGQA 1VBB1 1AYM1 5D6EA 4QHOA 4AIDA 2QVSB 5IT6A 1OLRA 2VECA 3SZPA 5E1XA 4NIAA 3NRUA 3FXMA 3DKQA 3TNPB 2GIZA 3MKWB 4JVAA 4NHMA 2RQPA 3IPVB 2QQMA 1D0ZA 2IS2A 3FL7A 2EALA 5HLTA 3J7YJ 4K6BA 3IP4B 2OQ6A 5K1YA 3FLRA 2K9MA 3U2RA 2ARAA 5L36A 4XETA 2BVLA 3SCGA 3EQEA 1EF4A 1UOJA 5LZ6A 2RC4A 2IXHA 3VBSC 4OMDA 3JRGA 2JA7J 3PUFA 1VBE1 2WINB 2E34A 1ULYA 2ZZQA 3WQBA 5HS7A 2VUJA 5FO5A 2BVVA 4MH0E 4YG2F 4AVVA 3MF9A 1F36A 3CO7C 2WO2A 3RI8A 1JZ2A 2DVGA 3T4VA 3PUHA 4NAMA 3AVRA 5DAWA 3JQWA 1VQ9I 1SMYF 4YVWB 3HNBM 1I9RA 2RHPA 2VODA 4IJAA 4MGSA 4U36A 4RN5A 1PK6C 3K4JA 1VRBA 2Q4SA 3OY9A 3GMEA 2F4LA 4KU7A 4HONA 2DMUA 3BPXA 2OQGA 2W00A 3CC2I 2WZR3 2VPRA 5ISLA 1MMNA 1W36D 3PFIA 1AJKA 2RR11 4R9DA 4XLCA 2D5HA 1U6GA 2PQSA 3H9AA 2W1SA 1AKHB 2NM1A 1Z67A 5C4WA 5GAEJ 1VQKI 2O14A 2C9AA 4MZUA 2JDUA 2W47A 3WDXA 5EHDA 1LHOA 1S72I 4A0XA 4L5JA 1HRV2 3K4BA 4WVMB 4BQ1A 2BE5F 4XBNA 4Z1VA 2B0LA 1Y3TA 5FMCA 1ULFA 4P9WA 4NPRA 3PJRA 3GFIA 4JKKA 4DEVA 1B35C 2XHKA 2D6OX 4N7UA 2PA7A 1K78A 4Y1YA 3IH4A 2FDHA 3TOBA 4IEPA 1YOVB 2ZX0A 4DYCA 3ZFEC 1VAKA 3ZN4A 3VEPA 5F5IA 3RZHA 1TMF2 4M01A