4BYYA

Apo glxr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
total genus 65
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4byyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4byyA01
3HUGA 4XRFA 2OQRA 2RKHA 2N7GA 4ZU4A 2VBYA 5LGTA 3HRSA 2IA0A 2P5KA 1FYMA 5BS6A 2K0GA 4UXNA 3NL1A 4IEQA 1NE6A 3GF2A 4U7DA 4HVOA 4O3MA 4J1XA 3SCGA 4L9NA 3SCHA 3GLXA 5E16A 1F4KA 3ABUA 4PDKA 1J7KA 4KA4A 1B9MA 4MGIE 3CJXA 3MCZA 3O2PE 2JTVA 1IXSB 2LKPA 3H8UA 1YS6A 4AD9A 5HDNA 3E6DA 1BI2A 5FDBA 3M9AA 3CDHA 5FLIA 4GYIA 5HS8A 2HR3A 2D93A 4LFUA 1U3EM 5JSOA 4YRDA 4FAGA 4LGWA 2IT0A 4ESJA 4MEYF 2MNGA 2CAVA 1U2WA 3VB2A 1XGMA 3ZMVA 1J3PA 1Z91A 2VBWA 4YFKF 3EDPA 1QY4A 3LSTA 5CYVA 3CO2A 3U2RA 4E2GA 3K1PA 2FE3A 1HKTA 1REPC 3SCFA 2ESHA 4RGSA 1IUYA 3RJPA 3D0SA 2K27A 2MC3A 1DP7P 1IPJA 2LF7A 3BP8A 2NAZA 3WTVC 4EWEA 3H1WA 5I0UA 3KP2A 1O3SA 3RKYA 1U5TC 2HQRA 4YFNF 2XROA 1I1SA 1X8MA 3FF5A 1R22A 1A04A 1KU3A 2FF4A 3DPLC 3IL2A 2ADUA 4CGZA 5DUKA 1ZRDA 1T98A 2EFOA 3S7EA 4EM2A 1CAWA 2IPQX 4EGYA 1WGPA 2FXAA 2UWMA 3GFMA 4Y13A 3KFWX 3V8JA 2WFPA 3FWEA 5H6QA 3KCCA 3RYRA 2R7DA 3JW4A 3L7WA 2CG4A 2DU9A 4N9IA 3W6JB 5L3GA 5HS7A 3N97A 5D5VB 3DN7A 3BPVA 1SFEA 3U10A 3M7GA 2DFIA 4ENNA 3OTFA 1QQIA 2VBZA 3I0TA 3H1YA 5FFZA 3H3UA 4XLPF 2Q30A 1BBYA 2ATFA 1ZRRA 2Z2SB 4E2SA 4D7TA 1G6NA 1SD7A 3OV8A 3L2HA 4XFFA 2IXHA 3KP5A 1O7LA 3GFIA 4KIBA 2NYXA 1R5HA 1OD5A 2KXLA 5KHGA 4GYGA 2KIMA 2FEZA 2Q8KA 1WRJA 4I7HA 4LK1F 2X0LA 5LEJA 2DQRA 3U1DA 1AWCA 4AIHA 1BC7C 2XGXA 3UKTA 4TV7A 4HA8A 3CJNA 3E5UA 4RB2C 1ZN2A 3DQVC 2XL9A 4Q5SF 1WWXA 3VEPA 1U78A 3CEWA 2B9UA 1XRUA 1F5TA 4FHTA 1L3JA 2PI0A 1CAUB 3GX4X 2MD5A 3PQKA 4RB0A 2PMHA 4KUMA 4I2OA 2XAGA 3KP6A 4I98B 3G7DA 5E1ZB 5J7MA 3RZZA 4EJTA 5EZWA 1FP2A 3LWFA 3RI4A 1XE8A 4BYYA 4I01A 4RGUA 3TQNA 3DV8A 2HDCA 5DCFA 5TJJA 4Z2YA 2E7XA 2XRNA 3L09A 3C3VA 3L00A 2STWA 1EH6A 5CVUA 2FMYA 3T0YA 3OCPA 2GAUA 4MGZE 4XF0A 1GXQA 1FOKA 4AQ6A 4HZFA 2M5WA 3K69A 5A2QK 2XAHA 1K7AA 2KIUA 3I59B 1J9IA 3WE2A 5FLJA 1IN6A 1RZ4A 2ISYA 1ONVA 3JSPA 3P9IA 1FC3A 1YTYA 3H9AA 1TW3A 5K1YA 3T5XA 1NXMA 2EFPA 4AWXB 1TQ5A 3R61A 3RNSA 4KFCA 2GA2A 1HKQA 3SZTA 5FCCA 4P55A 2UZKA 3M70A 3LQQA 2ETHA 2MPFA 5JAXA 2P7CB 3C1DA 2Y48A 3PLQA 5ICGA 5DCMA 2CW0F 5L3DA 3J7AO 1H1IA 4IJAA 3LAGA 2QZ8A 5CU1A 1KU9A 1S3JA 2Z3YA 2AS5F 5E1RA 3K0LA 2DW4A 2B5HA 3JZVA 5L3FA 3ELNA 4UVBA 3ST7A 3BPXA 4B8XA 1ZREA 2GU9A 3TDUC 1DUXC 4L9VA 1LDKB 1YIOA 4PIYA 4QGLA 3SZPA 3W6KB 2QM3A 3HTUA 4XETA 3HRTA 4H7LA 4KT5C 3GO5A 3BCWA 1V4RA 3B02A 2V9VA 2PN6A 3ACLA 4QMAA 2HS5A 2QENA 3E5QA 1H9TA 3WGIA 4X6RB 3ELKA 2NS0A 1X3UA 3CUQC 1JHHA 4XSXF 5D8LB 2RC4A 4ASNA 2A6HF 4YYOA 1P4AA 4PGHA 4OIQF 4FBFA 1KYZA 3JSOA 3QACA 1IN4A 5E18F 5CVJA 4MH0E 3ABTA 2VE9A 4OIPF 5HLIA 4MTDA 4KNYA 1O57A 1B59A 1VJ2A 4LLLA 3L9FA 2A61A 4WCGA 3TGNA 3M8EA 1ZGAA 2OPKA 2VN2A 2ZO4A 3SMHA 1FY7A 1SAXA 1FNNA 1FLIA 1UCXA 1IRFA 2UYBA 3I54A 2J5PA 1IRGA 2L3DA 4B09A 4MUVA 4UBHA 2KJBA 5BMZA 4EMSA 2XASA 2K9ZA 4KU8A 2K4JA 5D5WB 1CAUA 4IERA 3I4PA 4YFXF 4BNCA 5DUIA 2H0VA 1CF7A 2M1BA 4IEWA 3K9TA 2F5CA 4WZCA 1ZYRF 2FBKA 3GWZA 5FB2A 5A2QZ 1FSHA 4I3PA 3MQ0A 3EJKA 1SD6A 3RKWA 1QNTA 3WTTC 1USSA 2OBPA 5KHIA 5LLQA 2EFWA 1ZRCA 2C6YA 3PVBB 3H1MA 4KU7A 2JZYA 2ZMEA 2A68F 2HEOA 5BY5A 2ZNYA 1FPQA 2IW5A 3DKWA 1XCVA 1KA8A 3DXJF 4IEUA 5FLHA 4O5VA 3F21A 2EK5A 1ZNPA 5C6CA 4M6YA 1LEAA 1UPIA 2QVOA 2GZWA 2O1QA 2BE5F 3CUOA 2EWNA 3FZVA 4O9EA 2K02A 4HDUA 1K79A 5D5XB 4HSJA 5LEKA 1MJ9A 1D8KA 4RB1A 5CJ9A 2JRTA 5D6EA 5HLGA 1MKMA 5JFRA 4HLYA 4ORFA 4CHUA 3HHGA 3RPUA 1S8NA 3KEOA 2ZKZA 2PEXA 2EV5A 2STTA 1R1VA 4Q0UA 1JHFA 3BOQA 1STZA 5JR3A 4RS8A 4OIOF 2ZJ2A 1TQPA 1HW2A 1EP0A 2FQ3A 5BUVA 1TNSA 4MGKE 4U88A 2EFQA 3WU1B 5KVRA 2CSOA 3RPQA 1KU2A 4A2UA 1GQGA 2Y75A 2QQ9A 3LA2A 4RGXA 4IRIA 4YSFA 2Z9OA 1Y0UA 3BY6A 5KHKA 3BALA 4ESBA 1UCRA 2W85A 3I5UA 3WTWC 4KL1A 2CQKA 2WWYA 1RUNA 4XEZA 2A07F 4JBAA 3FMRA 5DDGA 3MWMA 2RGVA 4G8XA 4ZYEA 1X7NA 1P6RA 2VQAA 4ETSA 2Z33A 4IEPA 1Y3TA 2BV6A 4AVBA 4Q48A 3K2ZA 3J81Z 2JSCA 1O4TA 3IWZA 3TOBA 2DPDA 4CZZA 3IDBB 4EWAA 1PP7U 3DEUA 4WF2A 2IXKA 1BN5A 2BNNA 2LF8A 5HVQC 3I71A 4ZH4F 2CO5A 4QWQA 1GHCA 4Q4ZF 3E6BA 4KWKA 2QVSB 1U5TA 1B9NA 3EYIA 3P7NA 3OF1A 4KWLA 1LB2A 1MD0A 1V3FA 4MNUA 1CAVB 3ROUA 4D7SA 1XB4A 2CFXA 4EM1A 1EV7A 5HI0A 1SEFA 4MQVA 1CX4A 2Q0AA 3QP6A 4QM8A 1YG2A 3JTGA 3FX3A 4IHSA 3IBMA 1I1GA 2L01A 2EB7A 1O3TA 2H09A 1Q3EA 1OR7A 4G7OF 2O61A 3WW4A 2IXJA 2OD5A 2XAJA 2HJIA 2HWVA 1OMIA 4Q0VA 1YLLA 2VOPA 4EROA 3FHZA 1GQHA 1I5ZA 4A6DA 4HV6A 4I0AA 2ET1A 4LD5A 1R5GA 3QOPA 4K8FA 4O6JA 1MZBA 4QLCU 1CAVA 4OMZA 3F8MA 2HZTA 1RGSA 2P4WA 3WW1A 5FPXA 1ZZ8A 2EVXA 2LNBA 2F5EA 4E2QA 4XF1A 3GEZA 2EJRA 3EYYA 1MJAA 4H0EA 1T39A 4EM0B 5I8TA 2J5OA 2L4MA 2IA1A 1DPUA 2ESNA 1FI2A 3M3IA 4DINB 2EA2A 4LJZF 5EEGA 5FD5A 4IETA 1HXDA 1USTA 5BQTA 3O6BB 1YW8A 3TOAA 1NYWA 2VBXA 2O3FA 3WTXC 2O8XA 1AOYA 4RAZA 2QUFA 4KICA 1OPCA 4U0VA 4AVAA 2DTRA 4M9XA 4L5IA 2H6BA 3ISPA 2IRFG 4QGNA 5JSRA 3ZMTA 1Z6RA 3ES4A 4YIIA 4ZZDA 1WSUA 1RNLA 3F6OA 3S2WA 1CAXB 2X4HA 3MZYA 4CICA 2DT5A 4N9HA 2PQ8A 4HSLA 3H3ZA 5HDGA 4S05A 4LLOA 3WE3A 5ILVA 5JCTA 2EV6A 2D2WA 3D0JA 2RVCA 1K78A 1VTNC 5CLSA 3FHIB 4L9JA 5DV5A 3H7JA 4R1HA 3CO7C 3MYXA 2G7HA 4HYEA 5I0SA 1NHAA 2FA5A 4KMUX 4OOIA 2ZKLA 1FX7A 1XE7A 5F64A 2DPUA 3FM3A 4A5NA 4DNCA 1KQ8A 3BROA 4ZZLA 2A5YB 2EV0A 2Q1ZB 1Q1HA 2O03A 3DFGA 2QDRA 1W5SA 1GVJA 1S7AA 1D5VA 1P92A 4MV2A 3GXOA 2Y0MA 4EJOA 2PBIA 3I59A 2ELHA 1RIOH 4P9UA 4IF4A 3BJ6A 3AAFA 5BPDA 2Q0OA 2NNNA 4HX7A 5FLXZ 1O3QA 2KKOA 3GYDA 1V70A 1U5TB 1X8EA 1PDNC 1R23A 4BIFA 5E1XA 1DGRA 2BBYA 3E3VA 5I8YA 2DAOA 4M72A 2M30A 5LHGA 5HS9A 4AIKA 1XSVA 1IF1A 4XFHA 1XSXA 4WXDA 2F5FA 3EQLF 3FMSA 4R52A 5J6XA 3TKYA 4PJYA 3WTZA 5D4SA 1IN8A 4L18B 4EWDA 1E2XA 3I58A 4XSZF 2ZCWA 1R58A 3WGHA 1HKSA 1DGWA 3ZN1A 4IHTA 5LHIA 5ERIA 1UIJA 4UXAA 5BPIA 4WBBA 1XGNA 4FAHA 3TO7A 5E8GA 2D5HA 3F3XA 1ZG5A 2PAMA 4JVAA 2FSWA 3SHRA 2XLGA 2P5LC 4IESA 1CAWB 4YARA 5J3UA 1G3SA 1YWKA 4M9SA 4ENMA 4TLFA 2ZFWA 2UY8A 5BXXA 3QPHA 4PIXA 5LGUA 4NB5A 2MH9A 5D5UB 1XSDA 1KGSA 4EJUA 1TLHB 4Q0QA 5LRRA 2VE8A 3IHUA 1SQ4A 2NNYA 3WTYC 3EETA 3GFJA 1Z05A 4Y15A 2PQQA 2VXZA 1FSEA 4IXAA 2PAKA 4X6QB 4ONUA 1F9NA 3RYPA 1L0OC 1P2FA 1YS7A 4LG0B 4EV0A 4LULA 3LA7A 1UW8A 4G7ZF 3REOA 3JTHA 5JI6A 1OI6A 2VT3A 3LWCA 5FPZA 2FNAA 1CGPA 4E70A 4U7BA 6PAXA 3J80Z 1XDSA 1FWZA 4Q0SA 2GIVA 4XFGA 1XMKA 1J75A 4CO8A 1U12A 3R0JA 5BOXA 3I64A 2RN7A 3TO6A 1CAXA 1Q43A 4ZU5A 2I45A 5FQ0A 5HOOA 1WQ2A 4LB6B 3EQEA 3EHKA 1Z6TA 3KLOA 1OYIA 4P9FA 3ZN0A 1KYWA 2QQAA 2XLAA 3S7IA 1O3RA 2OU2A 2VC0A 1LR5A 1ZAOA 3IRRA 4HF2A 2HYGD 4WVZA 5KK1A 4UNOA 5LBQA 4GULA 1ZARA 3CUQA 4KIFA 3FXQA 2GA1A 2PFBA 1W4MA 3CL1A 4L0YB 3OGJA 3SHFA 4ZU7A 2XAFA 3ZQ7A 4YNIA 3GYHX 1S29A 5I93A 3DPTA 4EGZA 4IVNA 1TNTA 4K2EA 5T3NA 1KU7A 3U0ZA 3FE5A 1MJBA 4HN1A 3NVCA 1S6LA 1UFMA 3VOEA 4IEOA 1Z7UA 2P17A 2OAZA 4M71A 1T6SA 4HLTA 3CLOA 2RV8A 2DCTA 3QAHA 2JT1A 2GXGA 2XV4S 2MHFA 5CVIA 1O5LA 2VECA 5D8KB 3QP5A 3NSTA 2V1DA 3ETQA 2PAEA 1ZZ7A 2D5FA 4M9ZA 2OYZA 1B6AA 1W5TA 1HW1A 2TDXA 2LDUA 2GXBA 4RGRA 3RKXA 2K7LA 3ZMDA 3D82A 1LKNA 5L3EA 5IT9K 3ES1A 1RI7A 2FOKA 1MDMA 3EO6A 3PQJA 5J48A 5KBFA 3TDZC 3SFZA 2L02A 4XF3A 3GVAA 2PMUA 1QBJA 2FBIA 2JPBA 3BU7A 1BI0A 5ICEA 5ILSA 4RD7A 4IEYA 5KHHA 3FXUA 1GXPA 3IIAA 2PHDA 1P4XA 5JSPA 3IKVA 5C8WA 1TQMA 2CV6A 3NW4A 1YFWA 3M8FA 3FM5A 4N0BA 2E7WA 1OFNA 5KHJA 4BQAA 1XDUA 4XFBA 3F72A 2GWRA 3BJOA 1O5UA 4XFIA 2XVCA 1XD7A 4BHCA 5J8FA 4L11A 3IWFA 1LEBA 5EFUA 3U9GA 1FYLA 4QX5A 5I0RA 2UXNA 2MA3A 4PZJA 4LG0A 4PGGA 4XFCA 5HDKA 4KDPA 1YLFA 1LRHA 1WA4A 3P9CA 1YFYA 2PHLA 5FGMA 5AONA 1ZLJA 1LDJA 2HQNA 3LZZA 2Y0OA 4AVPA 2R7FA 2V09A 4S04A 1RTVA 1BJAA 2MLKA 2WC2A 4Z82A 1C0WA 2VT2A 4OMYA 1ZZ9A 4HX4A 3GW2A 2COMA 3RDIA 3VFZA 2RQPA 1SFUA 1EH7A 5F1RA 2CWEA 3KP7A 1JUHA 3UKVA 1EH8A 2W57A 5DEQA 3ZMUA 3DL3A 5E8IA 1G3YA 2DLLA 4QM9A 1YYVA 3K1NA 5ICCA 1LDDA 1QO0D 2HTSA 3USSA 4I09A 3ZDSA 4MGRA 3C3WA 1D3YA 2QQBA 4P5OA 5ILUA 2GC3A 4LUKA 2O6GE 4WX9A 3WG9A 4UVAA 1B4AA 2CGPA 2XKPA 1QXJA 2DK5A 2PTMA 1FBUA 1HSJA 2IA2A 4LUMA 4RB3C 3F6VA 4JTNA 4P96A 4LEJA 4OFGA 4HDVA 3HRUA 2OA4A 2YSRA 2KJCA 4AVCA 1F1ZA 3KETA 1TW2A 1LJ9A 5D4RA 4PCQA 1ZLKA 2IJLA 3R6SA 4A0XA 4BH9A 1UHMA 3KSCA 1SFNA 1NE4A 1BI1A 3U11A 1J0RA 1IPKA 4NQWA 3V8KA 4GGGA 5AIQA 2A69F 4JTOA 2UY9A 3QRFF 2QBYA 4JV4A 1PM7A 3M1EA 2XAQA 4XLNF 3KE2A 3QPTA 2B0LA 1DPRA 1Z1DA 4CDGA 3MPBA 3KP3A 2M45A 4U0WA 2DI3A 3P9KA 3FZ3A 1R36A 1DZRA 4IEZA 2Q2EA 1MDMB 3SXWA 3V8LA 4NHJA 1TTYA 3GUDA 1RC6A 4EQQA 1WLTA 5K5QA 2QBYB 5DYMA 5D6FA 4MHGA 4ZYGA 4HOBA 1E17A 4XF9A 3ZMZA 1HW5A 2Z5UA 4MTEA 3B73A 3BJAA 4MZUA 2PJPA 4LTAA 4Q29A 2O8QA 3UKNA 5J8CA 3D5LA 2RNJA 4HW0A 5K5RA 2FMLA 2ETEA 4META 5AVPA 3H50A 3BWGA 4ENJA 3HRMA 4HBLA 3J81K 3NEUA 4IEVA 4M73A 3ULQB 4MEXF 2IXIA 3LAPA 4MQ9F 3I7DA 2WV0A 1QZZA 3F8NA 4L2NA 5F6FA 2L54A 2GC0A 2RDPA 4U0YA 3GZ6A 4ZYHA 1EPZA 4JK1X 2CAUA 2IXLA 4HBNA 1OYYA 1NZCA 1FBQA 3EUHA 3C7JA 2L4AA 3HIFA 5FO5A 1VR3A 2HKOA 1J2XA 3TO9A 5K5OA 3LOIA 1LQ1A 2HYFA 1PUEE 3BZ6A 5BV6A 3PNAA 4IEXA 3F23A 4AIJA 3WGGA 4R8HA 1JGSA 3V7CA 4G7HF 1T0FA 2DO7A 1FBSA 3NKTA 1B1BA 2QLZA 3KZZA 3FXRA 2MH2A 4G94A 4IRGA 4M74A 2OZJA 3O3KA 3F22A 2IXCA 2BGCA 1DZTA 1ZX5A 5I8SA 2Z69A 1IW7F 1I27A 3SXYA 1L3LA 2VONA 3V4GA 2GC2A 1SD5A 1RL3A 1T2KA 4XFAA 3CO6C 1J3RA 5AIPA 4HAMA 3OD0A 4UHTA 4UV8A 2BEOA 1W7PB 3K1MA 4JQFA 4HN0A 3LFKA 3QU6A 2OA2A 2VPVA 4A6EA 4HV5A 1HQCA 4LLNA 2F4PA 3FJSA 4HF1A 2EAAA 5JHUA 1YW7A 4HX8A 3SQNA 1FZPB 3HQXA 1R1TA 2AXLA 4UVCA 1XGSA 4A12A 5L3CA 3G3ZA 2GC1A 5LHHA 1YW9A 4HLXA 2VOOA 2FQPA 1PMIA 2QJVA 2QNKA 1XMAA 4WXHA 3WW2A 4WWCA 1XN7A 1QWRA 3IDCB 1R00A 2UXXA 4WK8F 3R4KA 4DQ2A 2ZBKA 1KQ9A 2YX7A 3ZMSA 1Q5OA 1UD1A 4OLLA 1W7PA 3TNQA 1G4DA 1YHFA 2XIGA 2D1HA 1LVAA 2G9WA 4HQMA 4G9YA 1SFXA 4RAYA 5DCMB 4J1WA 1FP1D 4LA2A 2V6CA 3KGLA 3I53A 2R3SA 4KN4X 4HVQA 1YQAA 3R0AA 1IXCA 5LRSA 2QWWA 4D0PA 3R60A 5DD8A 5H6RA 3DF8A 2D40A 1WKMA 5IT9Z 2ISZA 4MGYE 5BPXA 3BDDA 4A5MA 3O14A 3WTSC 3F8BA 1VP6A 3VODA 3FMQA 2HFHA 1IAWA 2HGCA 2HOEA 3LAJA 2V1UA 2H6CA 1ZG1A 3PFIA 1J58A 1KQ0A 5L3BA 2VODA 2W25A 4YIFA 3EBRA 1J5YA 3TNPB 5TRDA 2K4BA 4BHBA 3RYKA 2M87A 4FX4A 3E6CC 3E5XA 4Q0PA 1I6XA 2E1NA 2D45A 4AXOA 4M6XA 2V79A 1BIAA 2WTEA 1QZYA 4HVRA 1J1LA 3IKTA 1K78B 1J59A 3MZHA 2C0ZA 4IPAA 2P5VA 2O0YA 5ED4A 2XUBA 4A0ZA 5FFXA 4AQ2A 2JPCA 3S0MA 2DK8A 4I0BA 5E20A 5ICFA 5HLHA 4L5JA 3HSEA 3ZP5A 2KRFA 4GO1A 2PFWA 1U6GA 4BHPA 2VC1A 4L9TA 1EY2A 3V7RA 3FFQA 4F7ZA 4ESFA 4QGMA 1XGOA 1P4WA 1HBXG 1O7FA 1K6OA 4BXUA 1BC8C 5JVTA 4Z07A 3N4MA 3KZYA 1ZG3A 1BM9A 1ON2A 1ON1A 1OYWA 2GH2A 3ML6A 5DD4A 4OIRF 3H92A 3KEQA 4LLGF 3HYIA 2FNPA 5E1WA 2IP2A 2QCSB 1FXZA 3HT1A 4B29A 2P7VB 4LMYA 2KIFA 2IC1A 2XKOA 3GBFA 1UB9A 3HOTA 2PYTA 1XCBA 2HTJA 4ON0A 4EJVA 2ACJA 3KGZA 4O9GA 3MEXA 4G6DA 2OQGA 3CTAA 1ZVFA 1T38A 4CXFA 2GQQA 5CVVA 1Z9CA 1W7PD 3RIRA 4LA3A 1J3QA 2YPRA 4CYDA 1YFHA 4XBFA 1R1UA 5FLXK 2XLFA 1JE8A 2BNMA 3HT2A 4FX0A 4HMZA 2ET7A 2EFNA 1IZ1A 3ECHA 3WW3A 2G7UA 3WODF 2M8EA 3JAMK 1JXSA 2B8MA 2A6EF 3MDPA 1BOAA 1SMTA 4KIGA 1QPMA 1Y9QA 1FYKA 2YU3A 1YFUA 1WI9A 4Y17A 1MGTA 3IC7A 5I91A 3HSRA 4OINF 2LSOA 2MBFA 4HQEA 2ZNZA 4F8AA 2PG4A 4HF0A 3Q9SA 5I0TA 4WXCA 2A3SA 3LA3A 4OU0A 1LNWA 3COAC 3KMHA 1RUOA 4NVPA 1D8JA 5FQ0B 1SMYF 1TQIA 1BI3A 2E9QA 2Z99A 2EA4A 5D1IA 3IRQA 1ODDA 3HSFA 3BPZA 1G3WA 2P8TA 1H1MA 4UUVA 1UHWA 3H7YA 5CVRA 1SD4A 3F8CA 2CYYA 4IRHA 3MAJA 3CUQB 5CADA 1IN7A 4EVIA 1R7JA 4G6QA 3T8TA 1QXRA 2PA7A 1IN5A 2IVMA 4I02A 1TBXA 4ENKA 3VHRA 2HKXA 3T8RA 3V7SA 4YG2F 3J80K 3HTSB 2DBBA 4LB5A 4KMFA 2NRAC 4P9GA 5LGNA 2XHKA 4PIZA 5K8SA 3E97A 2E1CA 3NQOA 2BYVE 2H94A 3Q9VA 1ZZ6A 2UYAA 3LQRA 2PLYA 4A0YA 4MX3A 1CF7B 2DQLA 2XL7A 3GFLA 5H20A 3NRVA 3ERED 1EYBA 1X82A 1ZRFA 1G3TA 2Q4SA 3WU0A 2D1VA 5FD6A 2ZXJA 4ZYDA 1YFXA 3Q5FA 4XF4A 5EEHA 4BAYA 4UBGA 3ECOA 1DDNA 5E17F 4GCVA 2EA7A 2ZMEB 3DP7A 3BB6A 1H0MA 2H27A 3CLPA 3KLNA 1UIKA 5JR7B 1OKRA 3WTUC 1U8RA 2W84A 1YO5C 3MFKA 1ZHFA 2YX4A 1ULYA 4LK0F 1IXRC 2K86A 3RTRA 1BIBA 3F8FA 4GXOA 2P6SA 3ZPLA 4KYWA 3L2CA 3G73A 2FRHA 4QXKA 1ZGJA 2BNOA 3NJZA 4UV9A 3C18A 5IT3A 1QGPA 1ZH5A 2F2EA 3CF6E 2QYOA 4EJWA 4KWJA 2OZ6A 4L0ZB 3HHHA 4R79A 3T1BA 3QU3A 2FU4A 2W24A 3HOSA 4KN7X 2MLGA 1YUDA 3E6MA 2V1XA 3OOPA 2P6TA 2F5DA 1S7OA 1FT9A 2OZUA 2FBHA 3KP4A 1H9GA 2YR2A 4Q47A 1ZZBA 3GZ5A 1HSTA 3JAMZ 1PP8F 1ZZCA 4FT8A
chains in the Genus database with same CATH superfamily
3HUGA 4Y1VA 4ZU4A 3KV6A 3NKGA 4A3DJ 2VBYA 3JQWA 3KX2A 1FYMA 2K0GA 3NL1A 3GF2A 2QF7A 3SCHA 3GLXA 5FZ0A 2BBVA 3LSEA 2R1DA 4KA4A 1SLCA 4XKCA 4MGIE 3MCZA 2PJRB 2K3PA 4IE0A 4E7ZA 3BG3A 1YS6A 2W3JA 4HG2A 5LBFA 1BI2A 1FNYA 5FLIA 1AR61 2X05A 4GYIA 2VW1A 2D93A 5JZGA 5J47A 3KHBA 1U5ZA 4CDWC 2XAUA 4LGWA 3J7AY 4JDNA 3WNOA 2WADA 4XHXA 1U2WA 1CZVA 4XVHA 1Z91A 1S5LC 4YW1A 5CZKA 2RS53 3LSTA 3CO2A 3NAPC 1QJY3 2OJED 3U2RA 1BBT1 2F6CA 3JRCA 5IYBJ 4UW6A 4C30A 2K27A 2LALA 2EIBA 3CMMA 2OPWA 1EUTA 1OT5A 3GZUC 2BHZA 2HQRA 4YFNF 2XROA 1JMUB 3ILNA 2Q8CA 3WNKA 1X8MA 1R22A 2ZC2A 1KU3A 5FKMA 3IL2A 2ADUA 1ENQA 2QQUA 2WIIB 4EM2A 1CAWA 4EGYA 1I3AA 2HNHA 3K4AA 4KT6A 2WFPA 5CISA 1K61A 1BZWA 3L7WA 4N9IA 3BI3A 2OX0A 2DFIA 1OFSA 2VBZA 2KM2A 1HLVA 3H3UA 4XLPF 3NNLA 3LKJA 4IUGA 4ISQA 4IL7A 1BBYA 3T3YA 2RS33 3CNAA 1IUFA 2CU5A 1UYZA 1GMMA 3DEWA 1UF2C 4D7TA 1RUF1 3KWVA 3ACIA 3HN3A 1K5MB 2EF6A 4XFFA 3GALA 4M4PA 3HL2A 1UPSA 4Q27A 3H9JA 1O7LA 1T8IA 4KIBA 4FPFA 2X51A 1R5HA 3ZR5A 4FPJA 2FEZA 4XMYA 3J7LA 1WRJA 4I7HA 4LK1F 5LEJA 3U1DA 2VNRA 1VAKA 4XONA 2B45X 4K40A 1DU6A 3MFCA 2XB6C 3PIPF 2JSPA 3E5UA 1BEV2 3S2DJ 1WWXA 4E7JA 4U2AA 4CU6A 1Z7LA 3CEWA 5DAXA 3FXKA 1CAUB 4EYUA 4V2VA 2PMHA 3T0BA 3VDDA 5FO9B 4I98B 5FP4A 5E1ZB 3HGYA 2ZZJA 5J7MA 1RMU2 3LWFA 1YC61 4XBNA 3ZYIB 4KJZA 2DA4A 3DV8A 5DCFA 2HXIA 1WUVA 4ZKTB 3WNNA 5L9VA 3L00A 1EH6A 4A7KA 3ZQGA 4LOTA 2D6NA 1YITI 4UFMA 3EXUA 4AQ6A 3GJBA 3K69A 2WZR2 5FMBA 2KIUA 1J9IA 1W03A 1EAH1 1AR62 4YVSA 2JICA 2ISYA 4Y5SA 1FC3A 1H8TC 2VOVA 4YGDA 4UW5A 1TQ5A 4Q4V2 3BUCA 3RNSA 1HQLA 1SDWA 2XWBB 2A6WA 5IK5A 4KFCA 5M5WJ 3FHNA 4FSJA 3GTKJ 2GOMA 4P55A 2UZKA 3M70A 4AE2A 2MPFA 2I07B 2MEV2 2RJLA 5DCMA 2CW0F 1W8HA 3MIGA 3AKRA 1H1IA 4IJAA 4CYCB 5E1RA 1LGBA 5DTDA 2KISA 5FZFA 1R71A 5L3FA 2W91A 3IDEA 3POSA 4HFSA 1F15A 5ANQA 3ST7A 2KD7A 3BPXA 4B8XA 3PMSA 1R081 2GU9A 3TDUC 4XIKA 1I3HA 2ZX1A 1OCRH 1L7QA 1YIOA 4PIYA 1UWWA 1HLCA 4D5FA 3HRTA 1G86A 1WGXA 2NQYA 1U0JA 4A7YA 1V4RA 2DCZA 3VSKA 2C9AA 2XWJB 2QENA 4MGTA 3E5QA 3Q0WA 4BXXJ 5JOXA 3CUQC 1JHHA 4AEJA 2A6HF 4YYOA 4AQSA 2VULA 4FOVA 4B7EA 1RUD3 4XNFA 1KYZA 3QACA 5E79C 2PMZA 2P3YA 3KIOA 1S4CA 3VKNA 1CR7A 4EQVA 1O57A 1B59A 2ZSIB 2VBPA 1AYN2 3VD4A 3L9FA 2A61A 1ENSA 5IYDJ 3TGNA 3M8EA 3GZTB 4BJ5C 4CDWA 2Z1DA 2LG4A 1YJLA 1R4MB 3WSOA 3AZWA 2ZO4A 3VPRA 3SMHA 1X1BA 3ESWB 1PO21 4HNUA 5FKOA 2G1MA 1IRFA 4AI2A 4COVA 2WZEA 2L3DA 2B9SA 3OYWA 2KJBA 2BOJA 4EMSA 2XASA 4NC8A 2K9ZA 4CEWB 1CIYA 3OYGA 1EPWA 1GDTA 2K4JA 2MSYA 5DS9A 1FJLA 4IERA 4YFXF 1S2EA 4CP2A 2TEPA 2NLRA 2HBUA 2QQNA 3VBUA 1Z77A 5JVVA 3GWZA 4EN8B 5A2QZ 4I3PA 1RITA 3OPTA 2JWTA 3RKWA 5G05L 4A6SA 2OBPA 4MXWB 3DEEA 3AP6A 4NHMA 5CKNA 5A1LA 5LCWL 2C6YA 1ZBE1 1U9OA 4KU7A 2JZYA 2ZMEA 1N1SA 1NXD1 1XCVA 4WM8C 3DXJF 3FHQA 4QX0A 5FLHA 1Y8RB 1YI9A 4O5VA 3CDZB 1X50A 1ZNPA 1S0JA 2ZMLA 3NRUA 1LEAA 3HN1A 3N7MA 3C2BA 1DZQA 1VRBA 3RWKX 5CFDC 2Q1MA 3N9NA 1PYVA 1O59A 1G9DA 3JBG1 2ZGTA 2K02A 3U37A 4HK9A 4CDQB 4P1WA 4HDUA 4OQ9A 1HCRA 3POWA 2BOIA 3A1YA 1RHI2 2WO7A 2Z16A 3HDDA 2DA2A 4G4FA 5CJ9A 4AIDA 4EEFG 3ATGA 4HKOA 4OHXA 5HLGA 1OBNA 1CZTA 1AR71 3PUBA 4ORFA 3BG9A 4QDRA 2L7MP 5FKKA 2CQXA 2ZKZA 2STTA 1R1VA 4CU8A 2AHQA 5JR3A 1RVF3 4XLFA 2QEXI 4JKKA 3RI8A 4HRIA 3UGHA 5J4VA 5FMOL 1HW2A 1EP0A 4UUSB 3CCSI 2FQ3A 1T56A 1TNSA 2EFQA 2DBNA 3N9QA 5A6ZA 3ZVXA 2ZHLA 3MVPA 3LA2A 3Q0VA 1D2QA 4RGXA 4IRIA 3VBFA 3UR3C 4ESBA 1UCRA 4N53C 3WTWC 4KL1A 1JUSA 1QH6A 4XEZA 4JBAA 4HEA2 3MWMA 1WW6A 2JIJA 1HJFA 1W36C 4II3A 2E53A 1HQNA 3GCWA 1URXA 4JKMA 4L8QA 4ZYEA 1UXZA 2VQAA 1BEV3 4IV3A 4M3EA 4IEPA 4PSXA 3K2ZA 3CDIA 3H0OA 1IGOA 4FFHA 3OIQA 3D1NI 2DPDA 1V0AA 1W6OA 4CZZA 1PMJX 1AJOA 3DEUA 4WF2A 1BN5A 2IVJA 5HVQC 4ZH4F 2LK2A 1DIWA 3E6BA 2CDPA 2V73A 1KFXL 4AFBA 2WY7Q 1UY0A 2EIKH 3EYIA 3NJYA 3P7NA 2HWE3 1X3WB 2AO9A 4CDUA 5C33A 4D7SA 1K83J 5J37A 2CFXA 1ITYA 2A70A 4M3CE 1BEV1 2YYOA 4NROA 1PGW1 2WRAA 3OL4A 3QP6A 1YG2A 2FCUA 3JTGA 4ZS3A 2JD9A 3I2DA 3B00A 4N43A 2O61A 3WW4A 4Q0VA 4R9AA 1OMIA 3AYDA 3FHZA 4FTSA 3NNGA 2ZHMA 2QDNA 3LDRA 1M4WA 2A7AA 2JWPA 4I0AA 1QJX3 4XOPA 1MZBA 2VUCA 2RS11 2P4WA 2EQRA 4YM2A 1I50J 2ME0A 2IS1A 5FPBA 2QQJA 4GWNA 2EJRA 1MJAA 2PX9A 2L4MA 3M3IA 2K9SA 2R7SA 1H6YA 1MS8A 5EEGA 2Y6HA 1VBE3 2HDWA 3TRSB 2YU1A 4CSWA 1YW8A 1MNDA 5J3LA 1VRH1 1SPPA 2VQ0A 1BK1A 4KICA 1X58A 2C4XA 2YGLA 3U75A 3MD2A 2IRFG 3I97A 3WNXA 5JSRA 1Z6RA 3AL0B 2PMZN 4G9SB 1WSUA 3ZFEB 1CAXB 2P0WA 5EPAA 5F39A 4CICA 2RDSA 4QKNA 1XSQA 1H2NA 3H3ZA 2BRTA 3AX4A 4S05A 4GALA 2VI6A 5ILVA 2EV6A 3D0JA 5FY1A 3VDDB 4ARYA 4BMEA 5IVCA 3QQAA 5DV5A 3H7JA 2HWF1 2G7HA 2FA5A 2O8KA 2F5VA 1T6BX 3OEBA 1XE7A 1AYM2 2E31A 1UZZA 1AZDA 2DPUA 3J4UH 4DNCA 1KITA 4BDVB 3BROA 2A5YB 1WW5A 3MIBA 1IDZA 2Y26A 4Y26A 1FOD3 2VOKA 2QDRA 4NHYA 5DABA 3VZKA 4KH9A 5L7OC 4ZC3A 2BW3A 1R4NB 3LDBA 4OI1A 1F5JA 4DNYA 4EJOA 4EZHA 1FNZA 4YVWC 1FTTA 5DUWA 1AVBA 2FOWA 3AAFA 5BPDA 3ZSEA 1XYNA 3LE0A 5FLXZ 1YHQI 5BNGA 1HIXA 3G6JB 5GM0A 4XHBA 1O3QA 3K6GA 4S0HB 2QQLA 4OAYA 1U5TB 2HVQA 3AKQA 3ZFGC 2ZHNA 2ZAHA 5E1XA 3WQ1A 4AAXA 4BIFA 4CEWC 5JUVA 3A01B 2DAOA 4CDUC 5LHGA 2R042 2RS31 1HB2A 2NVTJ 4JRAA 5AC93 1EAH3 5LBBA 1ACCA 4SBVA 5HV4A 2F5FA 3W20A 5J6XA 3TKYA 4B43A 4XC9A 1E2XA 3AZVA 2QQOA 3I58A 1N1TA 4CYCA 1GUIA 1DLCA 2ZCWA 1GV5A 5C44J 1DGWA 4Y1YA 4XUNA 5LHIA 5ERIA 1UIJA 4A3XA 1HF0A 1ETYA 2NM1A 5F37A 3DU6A 3H35A 1MS4A 2ZGLA 2P5LC 3V0BA 3FBIB 1OFCX 4JZRA 4BE0A 3WOGA 4BE2A 1YWKA 3V56A 3A01A 4M9SA 3PUHA 2NVUB 4ENMA 5DDJ2 3SEQA 2UY8A 2ZMNA 4R4ZA 1MW7A 2CFOA 4AF9A 4LKEA 4PIXA 2VQTA 1XSDA 3BR5A 5J09A 5K0UB 4Q0QA 4XRSG 3WF3A 3GM8A 1MMGA 3PDQA 5DQ0A 2OTLI 1JOPA 3IHUA 3IKWA 3L2YA 3EETA 3KV9A 2HZDA 4DB5A 3UGFA 1Z05A 4Y15A 2W9XA 2VXZA 2HLEA 3N35A 1FSEA 2PAKA 5JXIA 1YS7A 4A4AA 3K48A 1UW8A 1RXGA 3HC7A 4A3BJ 4G7ZF 5JI6A 1OI6A 3HOZJ 5DZFA 5EDNA 3VDCA 2E71A 1CGPA 3OBRA 5IY5H 3BG7A 1VQOI 1FWZA 4URTA 1XMKA 2AQFA 1FTZA 1X1CA 2L2OA 3R0JA 2ERFA 2RN7A 4IGQA 3TO6A 1LE8A 4I0WB 4JQRA 3LCPA 4QPIB 4ZU5A 2I45A 3HG9A 1WQ2A 1RVF1 3EQEA 5FKCA 3ZQCA 3T2TA 5DMYA 3M4OJ 1D4VB 3KHCA 4P9FA 2DCJA 3MW3A 2YXSA 1X2MA 2WBMA 3WP6A 3ZN0A 3A23A 4DUWA 3S7IA 3HPHA 1DBNA 5BNPC 4NC7A 5TISC 4CEYC 5FZHA 4GA9A 2V4AA 1XYPA 2ZHKA 1KQRA 3ZGKA 3IAM2 2CUJA 4P9IA 3AYCA 3CUQA 1RESA 2GA1A 4MO3M 1MMNA 1W4MA 1GSLA 4L0YB 2ZMKA 4FPOB 2VMHA 1UYYA 5T3NA 2DDBA 2DVGA 4FP3A 2VOXA 2LY9A 1S6LA 3VOEA 3K4KA 4IEOA 3NAPA 3BTZA 2I5UA 4HLTA 1DQ0A 3QAHA 2XV4S 3ENRA 3N3HA 4XE9A 4JGYC 2VECA 1MS3A 3CMGA 3QP5A 3W21A 3J7YJ 1B6AA 2L7KA 3LOCA 5FMDA 4W65A 2LDUA 2RM22 1ZKGA 3MZ8A 3RKXA 4QXBA 4DXZA 5B4NA 3VBSA 4PDWC 1RI7A 1S2BA 4PF1A 3PSFA 3RZKA 1FAYA 5J48A 4Q4Y1 2X85A 1S1AA 4XF3A 4BUPA 2PMUA 4QWNA 1POV3 1GZTA 1CQ9A 2RJKA 1LOCA 2JPBA 3I2IA 1BW5A 2AH2A 3D5RC 3FXUA 4AEDB 1VF9A 4CUAA 2BFUL 1OQEA 4LBQB 5JSPA 3IKVA 3FXMA 1TQMA 1GWMA 3I3DA 1LULA 3OJBA 5LA0A 5FPAA 5KHJA 1YQCA 1SZBA 4M01A 5T54A 5F27A 3HUGB 3DKQA 4F3QA 1MMAA 1LEBA 3U9GA 4ZY9A 3BTYA 2VUDA 2MA3A 1IDYA 3ZXAC 1QVUA 4CEYB 4PZJA 4COUA 1G8WA 4KDPA 1YLFA 1BJQA 3VKMA 3F9KA 2MGQA 1LRHA 2AC1A 3A0NA 1YJKA 4NRMA 5BNOB 2NMNA 2CW7A 5FGMA 3B9CA 4XJUA 3LZZA 3VBRC 4XZPA 2R7FA 1Y43B 4S04A 3OGVA 1QHDA 3AVRA 4BL0B 5FZLA 4CDUB 1LNSA 1RTVA 2M9HA 2MLKA 1ZZ9A 3MV01 1AR72 2RQPA 1WFXA 1R093 2CSGA 2VOWA 2CWEA 3BZCA 2VO5A 1OURA 2C6SA 5DEQA 1QVTA 1JH5A 1OKOA 3W58A 4QM9A 4J19A 1MH3A 2ZGKA 4I99C 4XLCA 2RMU2 3O1PA 4CDXB 2HTSA 4I09A 4QSHA 1BXHA 3HBLA 4B1RA 2QQBA 2WWSA 3VBHB 4KBBA 3GZEA 2QSGX 4WM7B 4YG3A 4YG0A 2XKPA 2X29A 5EG0A 1QXJA 2PTMA 1Z21A 1HSJA 2B9VA 1LAJA 1H30A 3B6AA 1DQ1A 4RB3C 1AKHA 1E3HA 2QGUA 5EYRA 1WCKA 3RKQA 3ZQFA 3HRUA 3VB9A 1PNGA 3ZYRA 2W5FA 3M3QA 3MIEA 1TW2A 1DFQA 2QQ8A 1AX1A 1GKBA 1RUJ3 5M0TA 3KSCA 3BR6A 1SFNA 5LASA 2G9GA 3QYEA 2QFEA 4GGGA 5GZEA 5FYBA 1UG2A 5EEAA 4XLNF 3QPTA 1W2OA 2B0LA 4B4PA 1JHNA 3P9KA 3FZ3A 1R36A 1DZRA 4IEZA 2ES3A 1UN1A 4BQOA 1MSFC 1TTYA 3K4MA 1FMVA 2EXKA 3THTA 3INAA 2D5VA 1HRV3 4CCEA 4FISA 1HW5A 4BEHB 1S55A 3VLBB 2P3KA 3K4DA 3WR0A 2B46X 2Y64A 5FZOB 2GLOA 4GAZA 5C3SA 4D0QA 4DOUA 5JDBA 3D5LA 5J1XA 4HW0A 1AL23 3H50A 4ENJA 2XUMA 5A3TA 3GGLA 4HBLA 4B8EA 3LEKA 1NG6A 1S0CA 4M73A 4LNVA 4N8MA 1SPPB 2W95A 4ATFA 4MQ9F 2BBAA 3I7DA 3G1OA 1MBJA 5AC92 1QF3A 2E36A 1IG7A 4L2NA 5F6FA 3D5OA 2BZTA 2HWF3 3I2GA 5JOWA 4JK1X 2CAUA 2IXLA 1QIQA 4HBNA 1JYWA 4XUOA 3QPSA 3WQBA 2OC6A 1NZCA 1Y4WA 3EUHA 2A3XA 2LROA 2ZS6B 3AP5A 2WQ4A 1ETXA 3PTYA 3X2QH 1G9BA 1J2XA 3FUOA 3JB8A 2X6WA 5CB7A 2HYFA 3FFZA 3DECA 2TCTA 3SC7X 4AIJA 2XPJA 3WGGA 4H7MA 2X1EA 2K40A 2MEV1 4IGPA 4Q1PA 5LK5A 5T55A 4CU9A 1B1BA 2OUJA 2BU9A 2VU9A 4BZ4A 2DYSH 4IRGA 3ZOBA 3LDKA 2DOAA 4RGGA 3BQZA 2EXHA 2UWBA 2BGCA 2UUZA 4BQYA 5I8SA 2P1BA 2Z69A 3JD73 3SXYA 4FOQA 3ZYHA 3UL2A 2VONA 3PFYA 1GNHA 4YW3A 1SD5A 3SJMA 3LB9A 3VZOA 4AFAA 4R9BA 4HAMA 3V0AA 2RS32 1OPOA 1A36A 2XHNA 3SNMA 2P3JA 5DAPA 4F92B 2E32A 2OA2A 3PIOF 4RQPB 1DP0A 5GTHC 4HF1A 3V0AB 5JHUA 1H4GA 4UVCA 4A12A 3DPRA 4OYUA 3M8LA 2VZPA 2QNKA 1WMXA 2JDPA 1XMAA 3JD71 1ND2A 1H4HA 2OUMA 3OYMA 2VCAA 5GJ6A 4WK8F 1IHMA 4V2WA 4FVVA 4DQ2A 3OR2C 1HB4A 1AYN1 1MMSA 4NN0A 5FY8A 1Q5OA 1JI6A 1K4TA 1VB4A 2VCBA 1PJRA 1LVAA 4A69C 5FOBB 5DCMB 4J1WA 1FP1D 4LA2A 4D94A 5CIRA 3AB0A 4UB8C 2VBDA 3KGLA 3SH4A 4AI8A 2CNAA 5C8CA 5C3EJ 1OCCH 5H6RA 2D40A 2CV2A 1V6JA 4H4KC 1OVPA 4QQPA 3ABMH 5BPXA 1NAEA 1ND3B 2SLIA 3K2OA 1HJGA 1VMHA 3WTSC 5ACA2 1X2NA 3CZ6A 5F04A 5C71A 1FMWA 1J58A 3HM5A 1Z7S3 4CPBA 2W92A 4V1PA 5FWEA 1UNBA 3BOPA 4CA9A 4NPRA 2HEYF 4X0GA 3TNPB 4DFSA 3BODA 2O14A 2K4BA 3OR1C 4BHBA 3RYKA 2M87A 4FX4A 2DF7A 3M2MA 4GJYA 3B69A 4AXOA 4M6XA 4FE7A 3VBUB 4IL6C 2ZXWH 3RZJA 5FO8B 1TME3 1LU2A 1J59A 3MZHA 2C0ZA 1IGNA 2GH8A 2ARBA 2RVAA 1WA6X 3CCUI 5IVFA 5ED4A 3BYWA 2XUBA 1FMD3 2KDZA 4LXLA 4FTEA 3UV9A 5ICFA 1PGL2 4L5JA 5FPVA 4COWA 2Q8OA 4PLMA 3LEIA 4YWAA 1RUG3 1MMDA 3V7RA 1Z0HA 4F7ZA 2VY0A 4IV1C 1XGOA 2IUWA 2VGDA 2WAOA 4BXUA 1BC8C 4FPGA 5JVTA 5CPRB 2O5RA 3KZYA 2FDGA 2AEZA 1ZG3A 2TBVA 1BM9A 5HNHA 3M4FA 3UESA 3ML6A 5DD4A 4OIRF 2L9SA 1W06A 4LLGF 1LOGA 2JDNA 1W0PA 3JRAA 4ZS2A 4ZTJA 2F17A 4LMYA 2GSYA 4NHKA 2XKOA 4PJJA 1UB9A 3TN92 4MHUA 3HOTA 4K21A 4ON0A 4EJVA 4PQ9A 4B4RA 3CC4I 4DBRA 4UAPA 3VYSB 2GNDA 3WF4A 3Q8FA 2YPRA 1C1LA 4XBFA 1SBFA 2QQIA 4IKFA 5DDJ3 1BA5A 1OH3A 4FX0A 1N1YA 4Q8LA 1XG1A 4BQ3A 4OULA 1W6QB 3WW3A 1J83A 4LBQA 4XACA 1RUH3 2M8EA 4BDZA 3M3YJ 2HXOA 2A6EF 4LBJA 1BOAA 3OYBA 1VBB2 4C1WA 2LC2A 5FLVA 3HOWJ 1SMTA 4A3IJ 3POGA 1H8TB 1FYKA 2QUOA 1OXCA 4QKBA 2W68A 1MGTA 5GALA 5F3IA 2WWJA 1AHDP 2VBBA 3IC7A 4LJHA 5A7WA 3B9IA 2WUHA 2JUGA 4CUCA 5DDJ1 4ZDLA 3Q9SA 5I0TA 1GICA 3CCJI 1RUOA 1B35C 5EZGA 4NVPA 1OUSA 4QB2A 1BR4A 5FQ0B 1MEC3 1TQIA 4C2TA 1CJPA 4PJMA 4CDXA 2LY1A 4FOWA 1J1TA 3IRQA 2JJ6A 4Y1ZA 4L5EA 3PVNA 3HSFA 3WZ1A 2KHMA 1VPHA 5IWFA 1AJKA 2VNGA 2P8TA 3FC0A 5KCMA 3HOXJ 3TEXA 3H7YA 1UU5A 2LLKA 4PFOA 5CVRA 1UY4A 5A7WB 3F8CA 2VQCA 1POV1 3VDBA 1NY72 1SLLA 3CC2I 4Y4RA 5FLMJ 4CXXA 3H1CA 5DG2A 1ZA4A 3T8RA 3V7SA 3V64A 1MQTC 5FOJB 2G9FA 2L0KA 1AU7A 4QTRA 4PIZA 2LFBA 5DAWA 1ZRIA 3NQOA 3RZGA 2MG4A 1WCUA 4QKDA 1UMHA 1MR5A 3ZPYA 2HOSA 1TVGA 2CL2A 2QKLB 3ASIA 5CQEA 1S0GA 4IE6A 2DQLA 5GKAC 1HRI3 3B3QE 2BGOA 5H20A 1C8NA 3KT4A 4ZZ5A 3W2VA 2X10A 3MFAA 2IBDA 4S2DA 2W82A 5EEHA 4UBGA 3KZ4C 5DM6F 2Y2ZA 4RR3A 4GCVA 2EA7A 4TXWA 3CD6I 3GTJJ 5EYXA 3ZIXA 3K4JA 3T0DA 2V72A 1ZHFA 3S3MA 1GP4A 4LK0F 4J6GA 2CH0A 3RTRA 2GP5A 2HWC2 3L2CA 4QX7A 4QXKA 1PM4A 1ZGJA 3H36A 4ZPIA 4UV9A 5IT3A 1ZH5A 3N9PA 4AQTA 1SLBA 3ABZA 2OZ6A 3VL8A 2EALA 2J1SA 3T1BA 3QU3A 2A3YA 2FU4A 3KT7A 2M4GA 3BQYA 3PO2J 1NK3P 3FBYA 2VAUA 3C7HA 3E6MA 4KG0A 2P6TA 1LPQA 2COBA 3GJAA 1H9GA 4FFFA 3W2AA 1W6MA 5AC91 2YR2A 4HNVA 3GZ5A 2YUEA 3VZLA 1PP8F 1ZZCA 5DUVA 1IKQA 4FT8A 2VXRA 1TG7A 2OQRA 2K5CA 2R7XA 1WZ2A 1LTEA 1STMA 4IEQA 4HVOA 1VQ5I 4YM1A 2FUG2 4L9NA 1C28A 5E16A 1F4KA 4XM3A 3DUIA 5JXGA 1QJU2 1JZ2A 5E3NA 2VMCA 1B9MA 2EXJA 1UG0A 2JTVA 2BWCA 4QPQA 1HOMA 5EP9A 4XOGA 1B8IB 4E7IA 3RSJA 3M9AA 5FDBA 2W7NA 4IXLA 1WWYA 2HH9A 3TN91 5ABJC 2W39A 1EUUA 2HR3A 3OY8B 2HWC3 1H0BA 2IT0A 5GAHJ 4ESJA 4B3AA 5LZ6A 2MNGA 4I30A 5JIUA 2JD4A 1J3PA 1QY4A 2VXJA 5FYYA 3HKZA 4QQ2A 2DA6A 2EBIA 5CFCA 1LU1A 1S0DA 2ZZQA 1IUYA 2VJXA 3OYKA 3DPRB 1ERDA 3RJPA 3D0SA 2MC3A 2NVQJ 2NAZA 3LPGA 3H1WA 5I0UA 1JUPA 1O3SA 3KQ4B 4NJ4A 3EUKL 4RQPA 3GLLA 4SLIA 3A22A 5K0UA 2WSVA 5GLWA 1Q56A 2EFOA 3PUIA 5FY0A 4LHSA 3OSGA 5FXZA 2ZKNA 2CJJA 1ZBA3 2XONA 4CVUA 2NOJB 3KFWX 3LGRA 3ZO0B 1OOPA 3KCCA 1OJLA 2DU9A 5HS7A 1SFPA 3N97A 5D5VB 1OUXA 2OPTA 3U10A 1EF4A 3EPZA 2R7UA 2L9LA 4ENNA 1VQ7I 4O65A 1QQIA 4QHBA 3USUB 5FFZA 1S2KA 2FDFA 1MZ6A 2QA4I 1GWLA 3O5SA 1OR7C 2ATFA 2EIEA 4RMNA 4E2SA 1SD7A 4HKWA 3OV8A 2JB8A 5F0HA 1P9QC 3C7EA 2JA2A 3KP5A 4YIRX 3GFIA 2D98A 3ZSKA 5KHGA 2P5BA 4MGQA 2BJSA 3IV5A 3VBUC 1A3KA 2RHPA 2ZBJA 4TLGA 2HOAA 3K10A 2DMQA 1BVVA 1Q8QA 2X0LA 1OKQA 4OWRB 5CFDB 4WV8A 4AIHA 1D0YA 1RUI2 4CUGA 4TV7A 1RJ7A 1X9PA 3CMYA 4HA8A 1ZN2A 3HMYA 4XMIA 1PZ8A 3O8GA 3RJ2X 4RHV1 1XRUA 1F5TA 4FHTA 1FMD1 3LSIA 5E88A 2HPIA 3RWNA 5IVEA 3PQKA 4KUMA 4FQZA 4I2OA 3KP6A 3G7DA 1ULPA 4F93B 3RZZA 2J1VA 4EJTA 5EZWA 2XGCA 3QOEA 5C9AB 3BTXA 1GR3A 4FOYA 4RYDA 3J8F1 1KEXA 5GLUA 4CCNA 1JXNA 3F95A 2E7XA 3H5AA 3L09A 4JX6A 4L9BA 3WDUA 2STWA 4Y20B 1ZK8A 5CVUA 1RR8C 3RGBA 3MICA 3POIA 2FMYA 5C9AA 3TP0A 2GAUA 5FZ4A 1MVQA 5FP9A 1WCSA 1FOKA 3H0GJ 2TNFA 2YB7A 2M5WA 2E33A 4ZDOA 3GCXA 3BIWE 2K9QA 3I59B 4P14A 1AA7A 3NJXA 4K8RB 1Y8QB 3OY9A 3WE2A 2CV0A 1XMXA 3JSPA 4HXCA 4P9LA 1YTYA 2WJSA 3H9AA 3DTKA 1TW3A 3LF7A 2BDRA 3J7ZI 4K3UA 1LODA 1ETWA 2RS13 1R1A2 2XOMA 2GA2A 4LG3A 3W6VA 3K70C 3LQQA 1UX7A 3ILFA 2JK3A 1DHKB 3J7AO 3LAGA 1KU9A 4X1EA 2Z3YA 3K0LA 1W6PA 4B3XA 1K45A 2B5HA 3D6EA 4QD2A 4MG2A 1ZREA 2BP6A 3WG2A 4L9VA 2KFDA 1LDKB 4XUTA 4QGLA 3W6KB 2QM3A 2IS6A 3K4ZA 4MADA 4V2FA 1AHSA 4LE4A 3KM5A 2R7WA 2LMDA 3O1RA 5A7SA 1W8WA 4QPGA 3VD3A 3NV2A 2HI3A 5FP8A 3ZXKA 2HS5A 4XBQA 1H9TA 3WGIA 1V9U1 3CCLI 3DYMA 1Z78A 4XSXF 4ASNA 2DT7B 5I0DA 4OIQF 1B35B 4FBFA 4IV1B 4BB3A 1PK6C 1UY3A 2DDAA 4AW7A 3Q8CA 2IWGB 1G9FA 1JYTA 1Y56A 5BNOA 2CGNA 5HLIA 2G0EA 3PJYA 3VUOA 3P3PA 1JS9A 1OLME 5A80A 1EA3A 1Q8PA 4LLLA 1WCQA 4HPKB 4XUQA 1FOD1 4BBRJ 1P7IA 4M3FA 1PNFA 2EIMH 2A6VA 1DGLA 3PMEA 1VQKI 1FY7A 4RR3C 1N75A 1WJBA 4W8JA 5KR7A 1ALYA 4DRVA 1TWAJ 4B7KA 2BXZA 2VW2A 5T5LA 4KU8A 5CNAA 5D5WB 1REEA 4BNCA 3S15J 2H0VA 4LO6B 4DGWB 2M1BA 2F5CA 3PVOA 5FB2A 1UQXA 1XNCA 3ZPOA 3IPVB 5SV8A 3EJKA 5GAEJ 2JA8J 3WTTC 2WA0A 5LLQA 2EFWA 2ZFUA 2ELJA 4RHV2 1W0TA 4BDYA 3I2FA 4DXSA 1SANA 2HEOA 5BY5A 2NVYJ 2ECBA 5L9BA 1ENRA 1VBE1 3PU3A 2XGEA 4IEUA 1MSEC 2BQPA 5FK7A 3F21A 1T95A 4M6YA 2M0CA 4RA0A 2MYSA 4MFDA 1QOOA 3IMNA 2W1OA 2GZWA 3O1VA 1MEC1 2EWNA 4TTGA 2KDOA 1BMV1 4YGEA 5J40A 4QX1A 2M34A 2NZ9A 5D5XB 3D5SC 2WFF1 5FZOA 3T2OA 2DVBA 2M2EA 5FZ6A 1RUD1 1D8KA 2XVLA 2JENA 5D6EA 1MKMA 2UV1A 1HB3A 1ZM1A 4HKLA 3HNBM 3HHGA 3HPNA 1RIRA 4EN6B 2PEXA 1RVF2 2YFZA 1QPIA 1S0BA 4AZZA 1JHFA 4XJWA 4RS8A 3WQ7A 3ZFEA 4FPLA 2ZJ2A 4IE7A 2HWB1 1BYHA 3CP2A 2VCCA 4DRRA 5BUVA 3K4NA 1NA1B 4XDPA 2WFF3 3WU1B 3UNGC 3FBMA 5KVRA 2CSOA 3MIDA 4ZHNA 1W9SA 1GQGA 2Y75A 2QQ9A 2LTNA 3CC7I 4JAAA 3A4UA 2Z9OA 5T50A 3BALA 3ON7A 4XJZA 1H88C 4Y5TA 2VOTA 3NAUA 3IIIA 3FXLA 3SISA 3FMRA 2WZ8A 3BVCA 3BTLA 3OYAA 1D4M3 4G8XA 5GLZA 4ETSA 1ASJ2 4AVBA 1JZ6A 3IWZA 3TOBA 2G4IA 2BPA2 3IDBB 2IEKA 1RUI3 1PP7U 3FN9A 2E6VA 2IXKA 5LD2C 3ILRA 4FPEA 4LK7A 2LF8A 1XYOA 1ZBA2 5A7OA 4Q4ZF 4QB1A 5IW0A 4C1XA 1U5TA 1LEDA 2EZIA 3O0VA 4IX7A 1MS0A 3OF1A 2E35A 4KMQA 1LB2A 3GDBA 3KLSA 4MNUA 1CAVB 4CEWA 2BUKA 5FXVA 1WKYA 2XB5A 1EV7A 4XRMA 3MKZA 2VL4A 4QDSA 3WUDA 5HI0A 2VG9A 1CX4A 3SEEA 4XXAA 1CQTA 4QM8A 5EJ1B 2EPFA 4OUMA 4IHSA 3IBMA 2NS8A 1I1GA 2YC0A 1C5IA 2ZPXA 1Q3EA 4LIVA 1RUE3 2IXJA 2XAJA 3QLQA 2VOPA 4EROA 5KXEA 5HBAA 1GQHA 1GP6A 1I5ZA 1OQDA 4HV6A 2ZEXA 1R5GA 1HB1A 4K8FA 4O6JA 4QLCU 1WJFA 2R30A 3S17J 1LJ7A 4OMZA 5A6QA 1ND2B 2HZTA 2VUAA 1CZSA 2LNBA 2F5EA 4JX4A 2OCCH 2FX0A 4C90A 1SG3A 2WNVC 4C0HA 1T39A 3OUIA 4EM0B 1K5JA 5I8TA 1FI2A 4CDQA 4DINB 1JOJA 2RR13 3J8F2 3Q8AA 5KXCA 1HXDA 1USTA 3O6BB 2V26A 1NYWA 2VBXA 2O3FA 3WTXC 3S3OA 2O8XA 1LENA 4UOJA 1AOYA 4A3EJ 4RAZA 2QSHX 4U0VA 2AGSA 4M9XA 4L5IA 3T08A 5ABJA 2H6BA 1O4YA 3U21A 2YHJA 4XQFA 5E89A 2J1AA 5CQGA 2KIQA 3ES4A 1FPN1 2CS3A 4CP0A 4IGOA 2IFRA 4XDQA 3MZYA 2HWE1 2DT5A 1UOJA 4N9HA 1BCXA 2OW4A 5F2SA 5HDGA 3G4SI 4DW6A 3CCYA 1QJEA 1AX2A 1K78A 1AYM3 5CLSA 3BTJA 4L9JA 5FXWA 5FYMA 4HYEA 5I0SA 4BIOA 2ZKLA 1COV1 1FX7A 5F64A 3HJEA 3FM3A 5LB6A 3Q8EA 2EV0A 2FDHA 3T09A 1IQDC 1Q1HA 2O03A 1VNDA 3F0CA 3OWTA 1Q8SA 1JUMA 1QJFA 1GVJA 4JHTA 3WDVA 5ANNA 1D0HA 3J8F3 1RIOH 4IF4A 2Y69H 5EZHA 3GBGA 3T2PA 2Q0OA 4RAGA 4NIIA 2NNNA 3MUY1 3B6CA 3SITA 1AR81 1V70A 2DMPA 1X8EA 1T0FC 3MKYB 4M72A 2M30A 1DQ5A 1R49A 5HS9A 4Z6YA 4BQXA 4KNCA 4Q8KA 4GMP0 2DFBA 1ULFA 4XFHA 2DCKA 1W2NA 4PJYA 3WTZA 5D4SA 4UUTA 4L18B 3WG1A 4XSZF 1W6PB 1HKSA 3ZN1A 2VZSA 4K6BA 5BPIA 2W1UA 1XGNA 4WBBA 2KP6A 3HNMA 4IQPA 4AEMA 2PAMA 1Y7BA 3SHRA 4PBPA 4CZCA 4XR6A 1CAWB 4NBQA 3WP4A 2ZGPA 3K2AA 3AZYA 4TLFA 4LBOA 5AFEA 1NZIA 4QPWA 2ZFWA 4OHZA 5BXXA 3M8JA 2ZGUA 3AMPA 4YVWA 4QPGB 3S32A 3HEFA 5D5UB 2JEMA 1VZ0A 4FTHA 3TB0A 2O8OA 4XPVA 3UNPA 1U9NA 3CESA 1XQNA 4BQQA 3QYBA 4Q2FA 4IXAA 1F9NA 4NRPA 3VBFC 1QJY1 2Z4FA 1ACIA 3H42B 3REOA 3AM2A 2R0FA 4FE4A 3LWCA 5FPZA 4GRIA 2FNAA 1U5YA 2OQ6A 2NXNB 4U7BA 3W3CA 1XDSA 1QEXA 4XFGA 4LE3A 4CO8A 3C7OA 3WD5A 1CAXA 1CWPA 1OF4A 1Z7S2 1Z6TA 1VBA2 5FFOC 4XTPA 4HETA 1B09A 4HPKA 3OBTA 3VBOC 1LECA 2W46A 4GXLA 1F5FA 3K46A 2VC0A 5JPNB 1ZAOA 4AVTA 4UB6C 4RS5B 3IRRA 1DU0A 5AVAA 2HYGD 1HC8A 5DN2A 1ONAA 1JYXA 1IRXA 3ZR6A 1ZARA 1V6KA 4KIFA 1S72I 2AYHA 4MHRA 4XJ9A 4DYRA 5B2GB 2I10A 4YW6A 3M1CA 4W1UA 1PGL1 2RE9A 5DAVA 3QWLA 3SHFA 4DXTA 1YIJI 4YM3A 4DZPA 4YNIA 3B7MA 1TNTA 4Q4V1 1BJZA 1W05A 3VZNA 3H8RA 1W8NA 2OT7A 1I39A 1OCZH 3PJQA 2NPIA 2VJJA 3EYPA 4XZUG 5EJCA 1Z7UA 2OAZA 3PUSA 1T6SA 2JT1A 3U78A 2MHFA 1XU1A 5CVIA 2LW8A 2WINB 3KV5A 3VBOA 1BLZA 5D8KB 3J7HA 3NSTA 2V1DA 5CYYA 2D5FA 1W5TA 1IS6A 2GXBA 1H2MA 1D1CA 3P5BA 2VPLA 2KR2A 3D82A 1LKNA 4GH4C 4GZ9A 5L3EA 5IT9K 3ES1A 4CE8A 4BXFA 1AL21 2FOKA 1R1A3 5KBFA 3SFZA 4E27A 4RQPC 4B3NA 1QDOA 2B39A 5M5YJ 2Z5WA 3N9OA 1QBJA 3VV1A 3R0RA 4IQ4A 1KDMA 5ICEA 4RD7A 1NA1A 1O8SA 5JMOA 1GXPA 3LSPA 3IIAA 2XF5A 2PHDA 1HA8A 1P4XA 3VBRA 1EJ9A 4Z8BA 1YFWA 3JBG2 1OFNA 5IP9J 2X1DA 3WT3A 4BQAA 4OCTA 2LP0A 2GWRA 3IMMA 3BJOA 1O5UA 4XFIA 2XVCA 1MS5A 1VBB3 1XD7A 4XURA 5H9PA 5J8FA 2ARCA 5C4XJ 4L11A 4HT1T 3O8HA 1K42A 5I0RA 1FV2A 2UXNA 2WAFA 4XYXA 3DKYA 3WG7H 4XFCA 3GCMA 1HKDA 1WA4A 3P9CA 4KBZA 1V9U2 3ASNH 5GP9A 4PDWA 2PHLA 2LBFA 1KD7A 3L9JT 1YJNI 1W2AX 4E7LA 1LDJA 2XPWA 2Z42A 4AVPA 2FDIA 2G9ZA 3FLRA 5KHDA 4UFKA 3HOVJ 3ZR8X 4CU7A 1GOGA 2WC2A 1XJAA 2VT2A 1CIWA 3ZKYA 1RKTA 3MN2A 5IAVA 4BK5A 3RDIA 5IVYA 4DZGA 5A3NA 2GMPA 1EH7A 5F1RA 3KP7A 3OYWB 3WG4A 1JUHA 3UKVA 1EH8A 1Y0NA 2Q5TA 3OYNA 1NCQB 3DL3A 5E8IA 4DUVA 4QX2A 1YYVA 3PIJA 3K1NA 1OC1A 2ZEYA 1D3YA 2PHWA 4EJRA 5ILUA 2GC3A 2O6GE 4JYKA 2WS93 1F4AA 4UVAA 1B4AA 5FKNA 1XPWA 1WJCA 2CQQA 5EJZB 2XJPA 4NIHA 2DURA 3SYTA 1NCRB 2IA2A 1IS3A 2V9PA 4LEJA 2BXYA 1C8M1 3P1IA 1SLAA 1N47A 2OA4A 2KJCA 3KETA 5LBCA 3ZOIA 4CCJA 2WA3A 5D4RA 5M5XJ 4BH9A 1MACA 1AF9A 1UHMA 4UF0A 2F4LA 1MBGA 3RQIA 3M3CA 1RUJ2 1NE4A 3T4VA 5IHRA 1IPKA 4GKYA 4NQWA 3V8KA 5H9SA 2W2IA 4JTOA 2QBYA 2VQLA 2E26A 1PM7A 2UU8A 3M1EA 2X1CA 2O9LA 1WD4A 1DPRA 3UETA 1SBDA 2M45A 1WLWA 1X4PA 2X6XA 1MH4A 4NHJA 5E6HA 4EQQA 3LSKA 1NCQC 1WLTA 2E7AA 4NRQA 2BTVC 5DYMA 2W48A 2Q8DA 5D6FA 3JREA 3IDAA 4MHGA 4RLQA 1OOPB 4XKWA 1E17A 3AMHA 2DJNA 1W3VA 2HWE2 4CPBD 5FJ8J 4CP9B 2DMTA 3QH6A 3HJRA 4PLNA 1PX4A 1QHGA 5K5RA 2ETEA 3R4UA 1W90A 3HRMA 4CUBA 3J81K 4NIGA 5L7OB 5CFDA 3AYEA 5CG9A 4MEXF 2ZGOA 2XJTA 4BXSV 1LVKA 3LAPA 1UOBA 1GU3A 1QZZA 1W3XA 3B94A 3S30A 3NMBA 3KCXA 3AG3H 2OTJI 2ZTNA 2ZX3A 5A3LA 4A3FJ 3ASOH 4PHZA 1OYYA 5FMCA 5ISLA 1FBQA 1F43A 3HIFA 3MKLA 3VDDC 3PUFA 1D4M2 3WNLA 2WAQA 3CJTB 2LY2A 2HKOA 3K75B 3TO9A 5K5OA 1K4SA 1W6OB 5BV6A 3PNAA 4IEXA 5JZGB 2B7EA 2A6TA 4R8HA 2JUCA 2CU7A 1JGSA 3NARA 3V7CA 5F5CA 4Q26A 1T0FA 1FBSA 4FFIA 2QSFX 3N9LA 3KZZA 3FXRA 2MH2A 4G94A 2ZGQA 3O1UA 2Y6FA 3GTLJ 2IXCA 1ZX5A 3APBA 2D6LX 1I27A 4QQHA 2R043 3TAYA 5AIPA 3ZSJA 3OD0A 3VBHA 3IB3A 3I4NJ 2C26A 3K1MA 1SVLA 4JQFA 4HN0A 2HEWF 1HRV1 2VR4A 3IAS2 4CZSA 4A6EA 1W8ZA 4PCRA 1NX9A 2JN6A 1YW7A 4HX8A 3HQXA 1FZPB 2IGNA 1QXPA 3L2WA 1AKHB 1RUE2 1XGSA 5L3CA 2VQHA 4LITA 3DYOA 2QJVA 1ENHA 4A42A 3T4HB 5DUUA 4LPLA 4B47A 1AYM1 4Z2AA 1JHJA 1R00A 2RV9A 2EZKA 1GYKA 1V6LA 3R4KA 2CGOA 2XBO1 1W7PA 1G4DA 1YHFA 2J7MA 4FPCA 2XUEA 2P3IA 1SFXA 2V4JC 4BQ4A 2J1UA 5T5OA 1R092 2ZEZA 4NWVA 3OS0A 4LO8A 2JDZA 4IDZA 4COZA 1VQMI 1NK2P 1D7PM 4HVQA 3WHTA 1JZ5A 3BCAA 3R0AA 1I1EA 1GWKA 5LRSA 2JA7J 4D0PA 3KD4A 2NOGA 3DF8A 1WKMA 2ISZA 3VYUB 2M3AA 2XXZA 1D5YA 2YUSA 2VE1A 2RDRA 3BPSA 3BDDA 1QJY2 4BS9A 4MO7A 2HOTA 4JGZB 4FXKB 2ECCA 4A6OA 2BY3A 3VODA 2L7ZA 2CW8A 2V1UA 2DUOA 1ZG1A 1RETA 3DLAA 3U4XA 2JG8A 5L3BA 4IW3A 2Y6LA 2W25A 1ND2C 3DGTA 5IYCJ 3T30A 4M3CB 4DS0A 3NQHA 3RI9A 5TRDA 4LBNA 4WM8B 2ZJCA 2RS12 3E6CC 1OLQA 4Q0PA 2J42A 3CKHA 2DN0A 1JKPC 2D45A 1C8M2 3ZMNA 3FXJA 5IATA 1TWHJ 2V79A 4AFCA 4JGZA 4ABZA 3CCRI 1WPKA 2OQ7A 2O0YA 2Y9ZA 3I55I 4M3GA 2JPCA 4GB31 2R7TA 5HLHA 5FO7B 3HBZA 1SDDB 3ZP5A 5HCBA 3RQ4A 2PFWA 1OLTA 1RB8G 5HPOA 1U6GA 2VC1A 5FY4A 2EIGA 4XAAA 4ESFA 4J00A 2WNUC 5JPMB 3E1F1 1HBXG 1TNRA 3S93A 3N4MA 4OZOA 1ON1A 3VBOB 2GH2A 2R061 4DIQA 1OLRA 5E1WA 5GPCA 1FXZA 5C4JJ 2JRMA 5JXJA 4B29A 2P7VB 1RUJ1 4YFWA 2WV1A 1V6OA 2PYTA 3KGZA 3IT8A 2QZ3A 4CXFA 1VBA1 2GQQA 1Z9CA 4P9WA 5HXVA 2ME6A 3RIRA 2C1FA 1C8M3 4CYDA 5F7UA 1R1UA 1DGRM 1FMD2 2QQPA 2XLFA 1JE8A 2E2IJ 1Z3XA 3DPRC 4B1LA 3MPPG 2I74A 1WMEA 3WODF 4D1QA 1JXSA 1YXWA 2XJSA 4FP2A 3ZYJB 3ZFFA 1QMJA 2PN5A 4ASMB 2D43A 4ZJZA 4KIGA 3KVBA 1GFF2 1QPMA 4ATEA 2Y8KA 3THPA 5FRMA 4Y17A 1FV3A 1G8XA 1GZWB 1JT6A 2P34A 2HWD3 2MBFA 2ZNZA 1RKWA 3TYJA 3WQ0A 1WD3A 2XJVA 2RREA 3GZAA 1LFBA 3TN93 1LNWA 3COAC 2CDOA 5FZ3A 1ORKA 1N3QA 3VGIA 1D1BA 4DJAA 1C5HA 2PXJA 1BI3A 2E9QA 2E1MB 2Z99A 1JYVA 4BQ5A 3NO8A 1AXYA 3MW4A 5IP7J 1SLTA 4IE4A 3AMQA 2IS4A 4L92A 4LORA 2CHHA 1XTAA 5FRNA 2WBKA 4GH4A 4NAOA 1D0ZA 4CP1A 1SD4A 2VMFA 5C4WA 1S0EA 4BKXA 4DY3A 2CYYA 2A6YA 2JA5J 3MAJA 3JQXA 1JUIA 3CUQB 5G04L 2MEV3 5HV0A 4EVIA 1JZ8A 4UFJA 2IVIB 1KDKA 3GXUA 2DFCA 1HV1A 1GZCA 1IN5A 2IVMA 4AL9A 5JR2A 3RMYA 1BQPA 4AYUA 4ENKA 3VHRA 3X29B 3SLIA 4YG2F 3J80K 5DG1A 5FZBA 2R073 1NCRA 4P9GA 5FUNA 3KYDB 2D44A 5FBZA 3OSFA 4XBLA 2JXAA 2H94A 2V6EA 2ZJQF 1EKEA 4AYBN 3ZKUA 3Q9VA 1ZZ6A 3LQRA 2PLYA 4IQJA 3ETPA 1CF7B 2IAIA 5C4WC 4UT5A 1OSGA 3I3LA 3NRVA 5LA9A 1EYBA 1LFUP 4CXYA 1ZRFA 2D1VA 5FD6A 2ZXJA 4PQQA 2YV8A 5JIAA 1F2NA 1YFXA 1ZGWA 1S9HA 4GFBA 4BAYA 3WX5A 2HYJA 4PI2A 3THCA 1YI2I 3HZJA 1JU4A 3DP7A 4BK4A 5E3OA 1AYN3 1MNEA 4DXRA 2H27A 2DVDA 3WV6A 5T5JA 3K77A 1V6MA 3KLNA 2X5IB 5JR7B 1OKRA 4E8DA 4BJTA 1U8RA 1YO5C 1N3PA 2RDQA 4Y1UA 5J4YA 1NCRC 2XF7A 1IXRC 2K86A 3F8FA 5A32A 3PL0A 4ZTFA 3NJZA 3C18A 1JW6A 2W24A 3S3NA 4KN7X 4UY8I 1TZOA 1ULDA 4XIDA 2F6BA 1XX5A 1TMF3 3OOPA 5FUPA 2F5DA 1FT9A 4II2A 3RMXA 4F83A 1ST8A 4Q47A 2VMEA 1ZZBA 4UFLA 1HSTA 3JAMZ 4C3HJ 1A6QA 1E3PA 4E6KG 1FYUA 3BGAA 3WNPA 2RKHA 3C2GA 4XOTA 2N7GA 2C5DA 4PUSA 2HVRA 3GMEA 2IA0A 5BS6A 2VPRA 1Q8OA 4U7DA 2XQXA 4O3MA 4EATA 4J1XA 3SCGA 5J36A 2KT0A 1S7EA 5F5AA 1LEMA 1I5PA 3SFIA 4PDKA 3I4MJ 1PUFB 3U07A 2V5YA 1MPXA 3AZZA 1QGLA 4C2MJ 1IXSB 2LKPA 4RGKA 3H8UA 4HANA 3E6DA 3CDHA 1HDKA 3K4LA 4Q5OA 1VRH3 1GV9A 5B1AH 5HS8A 5FV3A 4E4SA 1CESA 2EILH 3WG3A 4LO5B 1G59A 4WM7A 2VZ3A 3O1SA 3EB7A 4LFUA 3WF0A 4XUPA 4MEYF 3A2KA 2FD5A 2FCVA 3CJRB 2CAVA 2GN7A 4JKLA 1XGMA 3ZMVA 1POV0 2JDKA 2VBWA 4YFKF 4QB6A 3EDPA 5CYVA 1CPMA 3RVHA 2AXTC 3S1QJ 4E2GA 3K1PA 3WDXA 1MNMC 2Y9YA 2FE3A 1HKTA 1XE0A 2ARAA 4LKDA 1REPC 1C3HA 2J1EA 2ESHA 3SCFA 5FYSA 5F3GA 4RGSA 3LEGA 3MF6A 2YC4A 3BP8A 3WTVC 1YYNA 4AWDA 4A3KJ 4CTEA 3KP2A 1DQ4A 2WSUA 1LFPA 3RKYA 1I1SA 3FF5A 3W9AA 1G2HA 4CGZA 1T98A 2R5ZB 2WY8Q 1S0FA 2IPQX 1WGPA 2VZUA 2UWMA 1XPXA 3FL7A 5H9QA 4Y13A 3AG1H 5H6QA 4A3MJ 4WVWA 2PHXA 3RYRA 3AKTA 5FKBA 4M4RA 3HOBA 2CG4A 2MC4A 5L3GA 3R4DB 3ZCOA 5A33A 1RUH1 3WHCA 1QNWA 3BPVA 4BU2A 2V5DA 4LMFA 3FKIJ 1SFEA 3M7GA 3JD72 3I0TA 1M1EB 1V6NA 1K5MA 2XF6A 2FHRA 4H3WA 4OVEA 3MF9A 1ZRRA 1BR1A 2Z2SB 4AK3A 1G6NA 4RS5C 2MFZA 3L2HA 3WCRA 2XPUA 2IXHA 1VFCA 4AGVA 2ARXA 2VB6A 2KIMA 2Q8KA 3IH2A 3BZKA 5B1BH 3FK6A 3N36A 3PVEA 3UKTA 4L97A 3P3NA 1W8TA 1W6NB 2FDJA 2R7QA 3DQVC 4CRQA 3ZRGA 1OOPC 4XK4A 4Q5SF 3VEPA 1U78A 2R6QA 4Y4YA 2B9UA 4XLEA 1DGWX 2PI0A 1YNAA 4NPMA 5K9YA 2XJUA 4W97A 3DWLE 2XSDC 3ZXDA 1H2KA 4WM8A 5FAXA 1KXGA 1MBHA 4B4CA 1QDCA 3RI4A 4BYYA 4I01A 2JB4A 4RGUA 4AI1A 4FETA 4XORA 5JLXA 1WCMJ 3GTGJ 1UZCA 3L2QA 2X48A 1UZWA 1QZEA 1YE9A 3C3VA 3P6BA 2X5IC 1HX6A 3WHUA 4MGZE 4B4QA 4XF0A 1GXQA 2R5YB 1TWGJ 2Q1FA 4D6QA 3UYJA 4HZFA 2PHUA 3V0BB 5A2QK 1K7AA 4OHYA 5FLJA 1IN6A 2HWF2 4AHXA 2R5YA 1ONVA 4RSUA 1RUC1 3FXOA 5JZGC 4ZZ8A 3VD9A 1TE1B 2EFPA 1YEWA 4AWXB 2WN3A 3W59A 1JI8A 3K4BA 2M7AA 1JBCA 1C4RA 4K9SA 1TL8A 1HKQA 4XJ8A 3S57A 3GNEA 4KI5M 3AVSA 4DUXA 4D6SA 5JAXA 2P7CB 3C1DA 2Y48A 4KISA 3VKOA 4CXWA 5L3DA 3UGGA 4G3YC 2QZ8A 4COYA 1XB9A 1S3JA 2AS5F 3R05A 3RZDJ 2DW4A 2FCTA 4PT6A 3VZJA 3CCEI 3BTIA 4YPJA 5GLVA 4A93J 3UJQA 1VALA 5FZCA 2ZEWA 1MIJA 4DO0A 1E3OC 2AACA 3SZPA 5IP6A 3HTUA 3NWKA 4H7LA 1W5CC 3GO5A 2DCEA 1GP5A 3B02A 2V9VA 2PN6A 3ACLA 4LR4A 1PO23 2NS0A 2RC4A 4PGHA 1W2UA 4E7SA 5IFPA 3ABLH 3JSOA 4PFPA 3T1LA 1R083 4NWWA 5E18F 5CVJA 3ABTA 3FK7A 3FUQA 1VQNI 3IP4B 4Q4W2 2K3FA 3L2RA 1KJRA 2HDDA 3HPGA 4WCGA 1ZGAA 2GNMA 3BR2A 3S14J 2DFEA 1SFKA 1I3QJ 3POBA 1FNNA 5FMOS 3O1OA 1FLIA 5J96B 1UCXA 3LD8A 5K7ZA 2UYBA 1BW6A 4B09A 4MUVA 1H89C 3OPZA 5BMZA 3I4PA 2OF7A 3HQUA 5DUIA 1CF7A 2R071 3K9TA 3JBG3 3AL6A 2NVXJ 4WZCA 1ZYRF 1G7YA 1FSHA 4FASD 3AFKA 1DYOA 1YRNB 1SD6A 4WVMB 1PIV1 1USSA 4OI0A 1ZRCA 2PELA 3H1MA 2ZX4A 1YJWI 4BGDA 5GLTA 3WDYA 4OQ8A 2UWCA 5KAFC 1TWFJ 2X5IA 1KA8A 2YBPA 2ZXHA 1YCIA 1DGRN 2EK5A 1A8DA 3OIPA 4HPQA 1GT0C 5D8AC 3M7AA 3I2HA 5DUXA 2O1QA 2BE5F 1H9WA 3FZVA 1DYKA 2K2SA 4O9EA 4YELA 1QQP3 1W9YA 1FX5A 1K79A 4HSJA 4MXWA 2ZMEC 4JDOA 4CP9A 5LEKA 1AR92 4F3JA 1ASJ3 1MJ9A 3HVDA 2JRTA 1O4ZA 5FYIA 2JG9B 1Z67A 5EYYA 2L9NA 4RL7A 4CCCA 4CHUA 1R1ZA 3VBSB 4KWUA 4BA6A 5HNFA 3KEOA 1H8TA 3BN6A 2BHYA 5CEHA 2EV5A 4A45A 2VVEA 4JP0A 4Q0UA 5B66C 2LM3A 2ID6A 1R5ID 2WS92 5CAZA 4OIOF 3JB4C 4Q1RA 1TQPA 2OCEA 4AR2A 4Z2WA 2IGOA 5FZDA 1KU2A 3L1PA 2O7OA 2PHRA 2VKEA 4GMP3 3BY6A 1A5JA 5KHKA 1Z3YA 2W85A 3I5UA 3BTAA 1V55H 4NC6A 3KB5A 2WWYA 4IV3B 2QQVA 2EINH 1T08B 2A07F 3GTQJ 3VBFB 4C91A 5EV7A 2RGVA 1B35A 1JOBA 4JDMA 3QCWA 2XH6A 3SKVA 1LUJB 1VQ4I 2Z33A 1W0NA 1Y3TA 4Q48A 2JSCA 1QQP2 5A1AA 5CA6A 4IHVA 3ACFA 1WCDJ 3CU7A 4K20A 1AL0G 4XW3A 2BNNA 2DFFA 1W1WE 5K0UC 1X1PA 1LCLA 4KWKA 3E1SA 4LO7A 1JTZX 5EXOA 3PIGA 4EZ4A 1YI7A 5C3PA 3UJOA 2LREA 2QBXA 3ZSLA 1MD0A 1V3FA 4D9JA 3ROUA 1TT0A 2RS51 1IRZA 2B7YA 3KT1A 3ALQA 3A21A 4DZJA 2WQ8A 3S5QA 5BNQA 1SEFA 4MQVA 1WMFA 4E4ZA 2TRTA 3KV4A 3LOBA 2YGMA 1VMJA 4GB32 2D6PA 3FX3A 3NWSA 2QCOA 2EB7A 1O3TA 1OR7A 2R1BA 5FZMA 3TEDA 3AP7A 2OS2A 2HWVA 5FYZA 5C3RA 1YLLA 3LL7A 4QDQA 3VWBA 4A6DA 4NE9A 3QOPA 4MVTA 3HAGA 2WT2A 3BU0A 4QU1A 1XC5A 1VBD1 3FLPA 3F8MA 1RGSA 2P6CA 3WW1A 2VUMJ 1QJU3 5FPXA 1MQTB 1ZZ8A 2AENA 2EVXA 3LPFA 4AM3A 4E2QA 5C3OA 2Y34A 2WO2A 4H0EA 3EYYA 2IA1A 3LSGA 3Q3SA 2VVDA 2EA2A 1MQTA 3O1TA 3H5RA 5FD5A 4AU7A 3ZN4A 5FK8A 4IETA 4XN3A 4XABA 1RINA 4BACA 2QUFA 3VYTB 1OPCA 1CJDA 2CYFA 3ZFFC 2DTRA 1VBD2 3ISPA 2YZ4A 1ZELA 1VBB1 3CMAI 3ZFGA 3ZMTA 2OKXA 1W6NA 2A5ZA 4MSVA 4XCBA 4YIIA 5CBLA 4JGZC 1V5FA 2V7FA 4ZZDA 2GMMA 2WAAA 3F6OA 3S2WA 1PVEA 1PVC1 3ZXLA 1VQ6I 1R091 3VKFC 3MLLA 2QQKA 2R7RA 1UX6A 1XNAA 2WKKA 5JCTA 1J09A 2D2WA 4MIMA 2XSJC 2RVCA 1SVOA 4RAFA 4R1HA 3CO7C 1NHAA 3KF5A 5J1RA 1S0IA 3PUQA 1UKRA 2PQSA 4FPHA 1GLNA 4A5NA 3FIWA 5KNLA 4ZZLA 4OUSA 4FCAA 2ZA9A 4CDXC 3DFGA 3NV1A 3JCUC 1SEUA 1P92A 4MV2A 3I3BA 4XILA 3GXOA 2Y0MA 1JJ8C 3JXSA 2A05A 2CWMA 1A78A 4HX7A 5FUIA 2YFUA 3TBIA 2R32A 4XQWA 2KKOA 3GYDA 2DJIA 1PDNC 1BOBA 2BBYA 1GOHA 5I8YA 1NA1C 2B4KA 1EV11 2XJRA 1WZXA 3FBNB 1O8PA 1LOFC 1XSVA 1N1VA 1IF1A 1XSXA 4WXDA 4K1YA 3WCSA 3EQLF 4EWDA 1IN8A 4IHTA 2DTZA 1V5GA 1YIFA 4QPGC 3C7GA 4FAHA 3TO7A 5C70A 4OI4A 1M06G 1ZG5A 5LY1A 2HVSA 2R7VA 4IESA 2EZLA 1Y1VJ 5F3CA 3AG4H