4BYYA

Apo glxr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
total genus 65
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4byyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4byyA01
1BN5A 4HF2A 2HOEA 2M30A 4KIGA 4YRDA 3JAMK 1NYWA 1IN4A 4WVZA 4JQFA 5BS6A 3U0ZA 1R1UA 5AIPA 2HJIA 1LDKB 2OQRA 2PI0A 1QO0D 1G4DA 3RKXA 3W6JB 3MQ0A 2V09A 4GGGA 5I8YA 2Q2EA 3ZMDA 2O3FA 2DFIA 3ELNA 2A6EF 1NE6A 1USTA 1SFNA 3SXYA 4G8XA 2F2EA 3DFGA 4IHSA 4KA4A 4YIIA 4UV9A 1MJ9A 3GEZA 4QXKA 1TBXA 1FYKA 1TNSA 4P55A 1OYIA 3WTWC 3M7GA 1O3RA 4OIQF 4BIFA 3RI4A 3FM5A 4MGYE 2F4PA 1PP7U 3ES1A 1FC3A 4IEZA 1RZ4A 3HSRA 3NJZA 5JI6A 1WLTA 2D45A 4B29A 5I0UA 5T3NA 1U5TB 1K7AA 2HEOA 4RB1A 4KMFA 2L02A 4LG0A 1P4WA 2UY9A 1IN6A 3R0JA 4XSXF 4CHUA 4FBFA 3WW4A 1FPQA 4H0EA 1BIBA 2EFPA 3FJSA 3QU6A 2UWMA 3CO7C 4P9FA 3DQVC 2FMLA 4BXUA 2L01A 1J3RA 2XLAA 1HKSA 4R8HA 4LK0F 1EH6A 3VFZA 5JSPA 3IKVA 1YTYA 4IERA 2A61A 4PGGA 4A0YA 3LZZA 1MJAA 2CGPA 2CO5A 2QQBA 3I59A 4XFFA 3L2HA 3K0LA 5CJ9A 4ESBA 3T8RA 2ATFA 2QYOA 1E2XA 5DDGA 1OI6A 4EMSA 1I5ZA 3I0TA 4A0XA 2EA4A 5HDGA 2Z2SB 4AVAA 2D93A 4LLLA 4HV6A 5LHHA 3WTUC 5F1RA 4PJYA 3F22A 2VBYA 2BGCA 1RI7A 4IEOA 3IKTA 4QGMA 1BI1A 2FF4A 2DK8A 2C0ZA 1FNNA 1BM9A 3HUGA 2FBKA 4CZZA 4GULA 3G3ZA 1KQ8A 4IRIA 2O03A 2OA4A 2UYBA 5HLGA 4MEXF 2P6SA 3L7WA 4E2GA 3M3IA 2YX7A 2PBIA 3UKTA 4KT5C 5DEQA 1Q1HA 4G7HF 3FWEA 4M9XA 3P9KA 4WF2A 4Q4ZF 2EA7A 3ABTA 3ZN0A 2RQPA 3J81Z 3LA7A 2MH9A 2ET1A 5DD4A 5BV6A 3E5UA 2CYYA 2KJCA 2RVCA 2PQ8A 4PCQA 1DDNA 1J3QA 2WTEA 3IL2A 5BXXA 1J7KA 2XL9A 3HTUA 4QLCU 1FYLA 3WW2A 4O5VA 1E17A 1BI0A 4AIKA 3H8UA 1R36A 2OD5A 3ERED 4Q0SA 1HXDA 1QBJA 2IPQX 3S0MA 4LMYA 4WBBA 2XGXA 3KP7A 4AD9A 2COMA 4EGZA 1FLIA 3I64A 1ZHFA 3HT1A 1UPIA 4MTEA 2P8TA 2V79A 2QCSB 2B0LA 2Q8KA 1IUYA 2ZKZA 1O5UA 1R1VA 2DPDA 4Y17A 4LB6B 2D5HA 3SMHA 3WTYC 2NYXA 2XAJA 4FX0A 1XMKA 1TQ5A 4HZFA 1MD0A 2ZXJA 4KU7A 1GVJA 2RNJA 1HBXG 2BNOA 1OFNA 2VBXA 3GF2A 5JVTA 1G3WA 4KNYA 3GUDA 3MYXA 1Z7UA 5BMZA 3KZYA 1FZPB 2VQAA 1TQMA 1W5TA 2GXBA 1NZCA 3J80K 1ZREA 4I0AA 2B5HA 5L3GA 5H6QA 4B8XA 1GHCA 4RGXA 3EQEA 2M8EA 1I27A 2RC4A 2GC3A 3BJOA 2ZJ2A 3SHRA 4GO1A 2A68F 3G73A 4N9IA 4BNCA 3RIRA 5ICFA 4OMZA 4ON0A 2QWWA 1IXCA 5LBQA 3ZN1A 4YYOA 2LF8A 5L3BA 3HOTA 3EYIA 1FI2A 3E6DA 2X4HA 3M8EA 4ENNA 3SHFA 1P2FA 3QP6A 3ECHA 5I8SA 5FD6A 4RAZA 5KVRA 4HSJA 4K8FA 4BHCA 4HW0A 2GC2A 5TRDA 3C18A 3DPLC 3TGNA 2D1HA 5E17F 3RPQA 4LLOA 1YW7A 2ACJA 1MZBA 4U0WA 1GQGA 4OFGA 1FP2A 1CAVA 2K4JA 4HDVA 1DGWA 1J0RA 3BPVA 2EB7A 1OYYA 2G7HA 3H7JA 4HVRA 5E1WA 1HW1A 3BROA 1SFUA 5CYVA 3J80Z 4G6QA 2MNGA 3H9AA 2D5FA 1ZRDA 5ILUA 1JXSA 3E6CC 2XAHA 3FZ3A 2MBFA 1ULYA 3HHGA 4G94A 2R7DA 3BZ6A 2XIGA 2RGVA 4MHGA 4IEYA 4R52A 3K1NA 2GWRA 3NKTA 3F8MA 1T38A 2NAZA 5I8TA 4P5OA 4NQWA 2IA1A 4A2UA 1R23A 4AIJA 1IPJA 2OU2A 5E20A 2XLFA 2N7GA 1KU9A 2E7WA 1S7AA 1USSA 1KQ0A 2VOOA 3QPTA 1TLHB 2VT2A 3HQXA 5EEHA 1ZZ7A 1Z1DA 3K1PA 5FPXA 3SZPA 3LAGA 4KICA 1Y0UA 4UBHA 1BJAA 2NNNA 4NHJA 3Q5FA 3P7NA 4M9ZA 2FMYA 1DGRA 3I59B 1W4MA 4ESJA 1U2WA 2PFBA 1PM7A 2Z3YA 5HOOA 2XKPA 2K02A 3LWFA 2DQLA 2CV6A 4L9TA 2G7UA 5FGMA 4IRHA 4A6DA 3JAMZ 3IDCB 4M73A 2ZMEB 3BWGA 4JTOA 3RKYA 5K5QA 3H92A 4FT8A 1X3UA 3FXUA 4G7ZF 2P7VB 1GQHA 4MUVA 1EH7A 1XGSA 3TO7A 2E1NA 2W24A 1XSDA 2IW5A 5DD8A 1O4TA 5K8SA 1K6OA 2BYVE 2DLLA 4QM9A 2J5OA 2XL7A 1X8MA 3BJ6A 1IAWA 2YX4A 1NE4A 1RIOH 3JTHA 4M9SA 2EWNA 5JR7B 3R6SA 4S04A 1ODDA 1QGPA 3B73A 4CICA 2E7XA 2FNPA 2MD5A 1P92A 4B09A 2PMHA 3ZP5A 2FNAA 5DCFA 3PNAA 3KETA 3BP8A 3GZ6A 4LA3A 1KU3A 3QPHA 2Q0AA 3ZMVA 3IRRA 2QENA 3F6VA 2GC0A 2KXLA 1B9NA 3KEOA 2DU9A 3CUQA 4EJWA 1HQCA 1LEBA 3CJXA 5FO5A 4R1HA 2TDXA 2FXAA 2QVSB 4KWJA 1CAUA 4CGZA 2DT5A 1ZN2A 3D0JA 5H6RA 2Q30A 4UVAA 5FQ0B 2IT0A 2J5PA 1CF7B 1ZZCA 5J6XA 3T5XA 4Z2YA 2ESNA 2XRNA 3RYRA 4OIOF 3EBRA 4U7BA 1O3SA 4J1WA 2CG4A 3ML6A 5HLIA 3NW4A 4L18B 2AXLA 2HKXA 2A6HF 1ZGAA 3Q9VA 3GYHX 4DINB 4ENJA 3HTSB 5ICGA 2B9UA 3ECOA 2FQ3A 5BOXA 1S6LA 3MAJA 3S7IA 5C6CA 4L11A 2XKOA 3BDDA 4EJVA 4HOBA 2GH2A 4HLYA 1G6NA 3CTAA 1O7LA 1O57A 1ZAOA 5HS7A 3MWMA 3SXWA 5JAXA 5L3DA 4JV4A 1J9IA 4P96A 3L9FA 2V6CA 4PDKA 3TNPB 2M5WA 3T1BA 3H3UA 1UB9A 1YUDA 4O6JA 2VOPA 4P9GA 3E6BA 5LRSA 4KDPA 4D7TA 1U6GA 4YG2F 4A6EA 1BIAA 2XASA 2A3SA 3M70A 4YFKF 3RDIA 4U7DA 2EV0A 3DF8A 1CF7A 1AWCA 1SAXA 2YU3A 3LAJA 2XVCA 2PLYA 1TW3A 3WTVC 3D82A 1QQIA 3EJKA 5CADA 1ZLJA 1XGOA 1XMAA 4BHBA 4AVPA 4HLXA 2FQPA 4U88A 2M87A 2H6BA 1LDDA 4IPAA 1K78A 5D6FA 1V70A 2STTA 1MDMB 3LOIA 1CX4A 4IESA 1UIKA 3WGGA 4LK1F 2PAEA 3EHKA 1SMTA 2HFHA 2AS5F 1F5TA 3COAC 2JRTA 2VBZA 3V7CA 5KHKA 3F6OA 2CQKA 1V4RA 5FLXZ 4YSFA 4QGLA 4ZYGA 2VECA 1I1GA 2O8XA 4OINF 2QLZA 4G9YA 2IXCA 3KGZA 4ENKA 3MCZA 2A5YB 1ONVA 4NVPA 3TDZC 3T0YA 1DPRA 3HIFA 3LFKA 2IRFG 4XLPF 1TNTA 4MEYF 1U12A 1EH8A 5FFZA 1KU7A 2IP2A 2LF7A 3R61A 1D8JA 3V7RA 5FFXA 1ZVFA 4HAMA 1U5TA 3U2RA 1LRHA 1K78B 3SZTA 3CUQC 4XF9A 2GU9A 1XDSA 3NRVA 2UZKA 3TO9A 2GXGA 5HVQC 1EYBA 1H9GA 4LEJA 1R58A 3DV8A 1SD7A 1WI9A 1MDMA 2FRHA 5D6EA 4XSZF 5I0RA 2XUBA 2Z69A 4GYIA 3KP6A 4Z82A 3WG9A 3WTXC 1WWXA 1R1TA 5JSOA 4XFIA 2H94A 4BHPA 2VONA 3D0SA 1ZLKA 4HX7A 5KBFA 4I3PA 1OD5A 5IT9K 1H9TA 2K9ZA 4RD7A 4NB5A 2O1QA 4QM8A 2C6YA 3LQQA 1H0MA 2QUFA 4M6XA 2QM3A 4RAYA 1O3QA 3W6KB 2P5KA 3FZVA 2CSOA 2QBYA 1UFMA 3USSA 4XETA 4CO8A 3O3KA 3GX4X 1O5LA 4LUKA 2O8QA 1PDNC 1VJ2A 1X8EA 2ZFWA 1UCRA 1FBUA 2ZNZA 4KIBA 3S7EA 1G3YA 5I91A 1TQPA 3UKVA 4J1XA 4KMUX 4Q0QA 3C3VA 4E70A 1J5YA 2DCTA 2XAGA 2FBIA 3F8CA 3DXJF 2BNNA 3HOSA 1HW5A 3WW3A 4WXHA 3FM3A 5BPDA 4EWEA 2GA1A 4HVOA 1YFYA 5KHJA 4I0BA 2ISZA 1J58A 2HGCA 4KYWA 2EAAA 3LWCA 3IIAA 2FA5A 4PGHA 5KHHA 3UKNA 3O14A 3BY6A 4XF1A 3I54A 1DP7P 1EPZA 1GXPA 1FT9A 2MHFA 4ZU7A 1YS7A 5BQTA 3RNSA 3C1DA 2VPVA 5D1IA 3V8KA 4XFCA 1RGSA 2JZYA 4LFUA 3BB6A 3ES4A 1CAWB 4XF3A 5I0TA 1IRFA 4IEPA 4FHTA 1QNTA 4I2OA 1LDJA 4M72A 1WGPA 4EM1A 2IVMA 1Y9QA 5HS9A 3GO5A 1LVAA 2VE9A 1YIOA 1LNWA 2GA2A 2DO7A 4KN4X 1NHAA 4RB0A 1XSXA 3KP2A 4IRGA 2ZMEA 2D2WA 2EA2A 1XGNA 5E1XA 2DW4A 2I45A 1VR3A 4EJTA 3JW4A 2A07F 1KA8A 1D5VA 5EZWA 5D8KB 4RS8A 5IT3A 1IRGA 1REPC 2FBHA 2VXZA 3IBMA 2XAFA 1XRUA 2P17A 2WFPA 4XFAA 3SQNA 3FMRA 1PUEE 2ELHA 4LA2A 1PP8F 3EYYA 2EK5A 1LEAA 4O9GA 1SFXA 3E6MA 1R5GA 4Y15A 4HF0A 3AAFA 2HZTA 3ZMTA 2IXHA 2DPUA 3RYPA 4UV8A 1D8KA 3ULQB 2KKOA 1OYWA 2D1VA 4LGWA 2HTJA 5L3FA 1G3SA 4DNCA 1MGTA 5DCMB 4G6DA 4R79A 4HX8A 2VODA 4ZYDA 4O3MA 2CFXA 4CDGA 3VHRA 4MNUA 2GAUA 3JSPA 4XFGA 4A0ZA 1RC6A 3OGJA 2F5DA 4F7ZA 2NRAC 2DQRA 3K1MA 5JHUA 3CDHA 5DCMA 4RGUA 3TKYA 2GC1A 5HDNA 1ZG1A 1YLFA 3M1EA 2RN7A 2IXLA 2EJRA 1BOAA 2BNMA 3WGIA 4ZYEA 5BPXA 2QNKA 1R5HA 4XEZA 1J75A 3V8JA 5ILSA 1YFUA 2WWYA 1W7PA 5FLIA 1U78A 2PQQA 3GLXA 4ZYHA 3N4MA 2GIVA 2KIUA 2BEOA 4CYDA 2DK5A 2HYGD 3CLPA 2HS5A 2FE3A 4IF4A 3PFIA 1YWKA 4I7HA 3H1YA 4E2SA 1WA4A 2RDPA 1RUOA 4RB2C 4MX3A 1CAVB 4XBFA 2IXKA 2JPCA 4XFBA 1IN7A 1T39A 4PZJA 2W25A 2LNBA 1S3JA 1HW2A 4RB3C 2UYAA 3HRMA 3WODF 4KU8A 2NNYA 3EUHA 3VEPA 3KLNA 3KCCA 3V8LA 1OKRA 5J8FA 2PMUA 4LUMA 2V1XA 3HSEA 3P9CA 1T0FA 4HA8A 2MC3A 1RUNA 1BC7C 3EETA 4HV5A 1P4AA 2OQGA 3VOEA 3NSTA 1XD7A 4U0YA 4HX4A 1RTVA 1IXRC 2Z99A 1BI2A 4AIHA 4XF0A 2VC1A 1ZZBA 1DZTA 4HQMA 4ZZDA 3OF1A 1V3FA 1YW8A 5J7MA 3TO6A 4L9JA 3WTSC 3GFMA 2P7CB 4ZU5A 3QACA 3S2WA 1ZX5A 5ILVA 2QZ8A 4ASNA 3LAPA 1CAUB 2KIMA 1Z9CA 4MGRA 2PA7A 3CL1A 3U11A 4Z07A 3CUQB 4L0ZB 2HQNA 3ISPA 1SEFA 2W85A 3E5XA 4MV2A 4IJAA 2PEXA 1J2XA 2H27A 1XSVA 2OBPA 4A12A 2V1UA 4AVCA 2PTMA 3H3ZA 4OIRF 5CU1A 2PAMA 3G7DA 5CVUA 2K27A 3FXQA 2OZJA 1HSJA 4GCVA 4L5IA 4ZH4F 3ELKA 1J59A 2V1DA 4WCGA 2STWA 3V4GA 2ETHA 2VBWA 1TQIA 1XCVA 2KIFA 3LQRA 4L9VA 4JK1X 5LHGA 3PLQA 1UCXA 2W57A 4IEVA 3OTFA 2H0VA 1U3EM 1FWZA 3I5UA 3OV8A 2WV0A 4HQEA 2GQQA 4UUVA 3H50A 5E8IA 2M1BA 3DEUA 3BU7A 4LTAA 4IVNA 1Q3EA 1ZRFA 3BPZA 5H20A 3GZ5A 1ZZ8A 4E2QA 4HMZA 1FXZA 1IW7F 2PHLA 4AXOA 1FBSA 3U9GA 3GYDA 4KWLA 4Q5SF 1KYZA 3H1MA 3NL1A 1XE7A 1YS6A 1L3LA 5FLHA 2IXIA 1L0OC 3KE2A 3HRUA 2IC1A 5LEJA 5KK1A 2PAKA 4IEXA 1GXQA 4QX5A 2G9WA 3GWZA 2K4BA 1B4AA 4HF1A 1U8RA 1UD1A 1WKMA 3DP7A 4KFCA 3FX3A 5EFUA 1I6XA 2XV4S 5IT9Z 3I58A 1JHHA 1BBYA 2ESHA 4N9HA 3JTGA 4L9NA 4XRFA 4ZU4A 2HYFA 2DBBA 1UHMA 2LDUA 3FMQA 4I01A 2CAVA 1FY7A 2VC0A 3HSFA 1A04A 4LJZF 4I02A 1PMIA 4MQ9F 1HKQA 1ZGJA 5LGTA 4YFXF 1LQ1A 1ZYRF 1T2KA 4GYGA 2EFOA 1EV7A 1W7PB 5J3UA 1EP0A 3I7DA 4A5MA 1STZA 2VT3A 1SD6A 2QJVA 1U5TC 1VP6A 2L3DA 5HS8A 1WSUA 3RJPA 4KUMA 4MZUA 4P9UA 1UHWA 1C0WA 4UBGA 2VE8A 3GFIA 4XF4A 2PJPA 3FXRA 3ABUA 3LA3A 4WXDA 4K2EA 4HDUA 2OPKA 4MGKE 4AQ6A 3T8TA 3PQJA 4AWXB 1ZRRA 3DN7A 5FDBA 2OZ6A 2P5VA 2IA0A 4UVCA 3KEQA 5F6FA 5D4SA 2L54A 5ICCA 1SD5A 3ACLA 5D5XB 2PG4A 3IWFA 1S29A 3NEUA 2YPRA 4QGNA 3LSTA 1Z6TA 1XB4A 3K2ZA 1B9MA 1R22A 4BYYA 5ICEA 4LULA 3JZVA 5CVJA 2O61A 1XN7A 4LLNA 3RKWA 4I09A 3IRQA 1ZZ6A 3FFQA 5JR3A 2QVOA 4O9EA 3SCFA 4ORFA 4KIFA 1OMIA 5CVIA 1L3JA 4LB5A 4IHTA 1YQAA 3WE2A 4HN1A 4Y13A 3WGHA 5KHGA 5E1ZB 3QP5A 4HVQA 2OA2A 2R7FA 4ONUA 3BPXA 4EGYA 3B02A 2ZBKA 2XAQA 4OOIA 3GFLA 5JSRA 1KU2A 5LHIA 4MTDA 1DPUA 1TTYA 3CLOA 3V7SA 1T98A 3FMSA 4UXNA 4OLLA 3C3WA 4BH9A 3TDUC 2CW0F 3F3XA 4I98B 4AQ2A 5LEKA 4H7LA 4LLGF 2IXJA 1YYVA 3M8FA 1JHFA 1RL3A 4WWCA 3SCHA 3HT2A 2V9VA 2EFWA 1WQ2A 4RGSA 5D5UB 1FSHA 4YNIA 2MPFA 5E8GA 3I53A 3RZZA 1WRJA 3FHIB 4PIYA 1AOYA 1CAXB 3RPUA 3NVCA 5LGUA 3BOQA 5D5VB 4FAGA 2EV6A 3CEWA 2RV8A 5DUIA 1IXSB 1QZZA 2Q4SA 4M71A 3F8FA 2QQAA 4YIFA 3Q9SA 3ROUA 2Y48A 1Z05A 3QAHA 3HRTA 4KN7X 2CAUA 3DL3A 4UXAA 3QRFF 4IEQA 3ZQ7A 4N0BA 5K5OA 1LJ9A 5FQ0A 1KQ9A 1H1IA 3NQOA 1DZRA 4BQAA 5A2QK 3H7YA 2FSWA 1F4KA 3SFZA 4AVBA 5CVVA 4FAHA 1T6SA 2CWEA 2ZO4A 2ETEA 2P5LC 4KL1A 1RNLA 2X0LA 5J8CA 3MZHA 5E16A 4BAYA 3CO6C 4F8AA 6PAXA 1W7PD 1IN5A 1F1ZA 4HBLA 5HDKA 2K0GA 2Z5UA 3KP3A 1SMYF 2Q0OA 2K86A 2RKHA 4RGRA 1FYMA 1ZARA 5K1YA 1ZH5A 1CAWA 2HKOA 3KLOA 3PVBB 2UXXA 2YR2A 3J7AO 4JBAA 1IPKA 2YSRA 2P4WA 4WXCA 2XROA 5FLJA 3OD0A 4L5JA 2MH2A 4OIPF 5HI0A 5FB2A 3WW1A 3HHHA 2GZWA 2H09A 4M6YA 4ENMA 3J81K 1FSEA 1CGPA 1EY2A 1Y3TA 1J1LA 3E5QA 2DAOA 1YHFA 1Z6RA 5JFRA 1XDUA 2JTVA 1OPCA 3EQLF 3ETQA 3IC7A 2UXNA 5D8LB 3GW2A 3E97A 1S7OA 4M74A 4GXOA 2VN2A 2ET7A 1SD4A 3VB2A 1HKTA 1O3TA 5FCCA 1MKMA 5L3CA 4PIXA 2PFWA 3KFWX 3ZMZA 3IDBB 2ISYA 3IHUA 5CVRA 3F72A 3CO2A 1SQ4A 2HQRA 3TOBA 3QU3A 5LLQA 5A2QZ 1FOKA 1B6AA 2Y75A 1D3YA 5F64A 2IA2A 3ZMUA 2O0YA 3LA2A 1XE8A 2L4AA 4HN0A 1YFWA 5DUKA 2ADUA 4QWQA 4EJUA 3R4KA 5K5RA 1H1MA 1J3PA 5BPIA 3U10A 5AVPA 4LG0B 3N97A 4Q0VA 2IJLA 4XFHA 4MGIE 1YW9A 1BI3A 4EM2A 1IF1A 4TV7A 4Q48A 4OMYA 2HWVA 2UY8A 1FBQA 4Q29A 3F23A 4X6QB 1K79A 1KYWA 2D40A 3H1WA 4EVIA 3MFKA 1YFXA 3ZDSA 2ZCWA 5D4RA 1ZG5A 1FP1D 5ED4A 1ON2A 4ESFA 2XLGA 3E3VA 5J48A 5LGNA 2FU4A 3I71A 1BC8C 3DPTA 2WC2A 4U0VA 3QOPA 3WTZA 4PIZA 1OR7A 3K69A 5BUVA 2ZKLA 2Q1ZB 2BE5F 2R3SA 5AIQA 5KHIA 1QZYA 1JE8A 4YFNF 1CAXA 1R7JA 4JTNA 3F8BA 4ETSA 4G7OF 3R0AA 4MQVA 2F5CA 4UNOA 2PHDA 4EWAA 4QMAA 2K7LA 5HLHA 2O6GE 1QWRA 3BJAA 3M9AA 2Y0OA 1R00A 2FOKA 4EJOA 5FPZA 5D5WB 4HLTA 2E1CA 5FLXK 2Z9OA 3KGLA 4OU0A 3TNQA 1P6RA 2XHKA 2KJBA 3WTTC 2LSOA 2QBYB 2M45A 1JUHA 1SFEA 5E1RA 2QDRA 1QXJA 4KWKA 1I1SA 1UW8A 3JSOA 3CF6E 4Q0PA 3L09A 1LKNA 3OOPA 3MPBA 3KZZA 3GXOA 5C8WA 2OYZA 5LRRA 4DQ2A 2F5FA 2Z33A 1ZNPA 4HBNA 4FX4A 1S8NA 2P6TA 4META 1B1BA 1NXMA 1FX7A 5L3EA 1QPMA 4UHTA 1ZZ9A 2NS0A 4IEUA 4IEWA 3KMHA 3ZPLA 1O7FA 3HRSA 4TLFA 4D0PA 3CJNA 1F9NA 3ST7A 2JT1A 3KP5A 2L4MA 4L2NA 2Y0MA 3RTRA 3SCGA 5DV5A 3OCPA 5JCTA 5CLSA 2EFQA 2B8MA 1DUXC 5AONA 4IETA 5TJJA 2FEZA 3TOAA 1X7NA 1HSTA 1YLLA 4MH0E 4WK8F 4UVBA 2MA3A 1X82A 5BY5A 3MEXA 3IWZA 4WZCA 4EM0B 3EO6A 4X6RB 2JPBA 3GFJA 2DI3A 2OZUA 1MJBA 3REOA 2BV6A 5ERIA 2KRFA 2HTSA 4YARA 1YO5C 4L0YB 3D5LA 4HSLA 2HR3A 3WU1B 5I93A 1QXRA 3GVAA 2QQ9A 1ZRCA 1ZG3A 1LR5A 4A5NA 2A69F 1P4XA 1ON1A 5FD5A 3FE5A 1TW2A 3O6BB 1W5SA 3K9TA 5I0SA 3RYKA 3R60A 4MGZE 4Q0UA 2F5EA 3KSCA 4Q47A 3O2PE 2JSCA 3I4PA 2BBYA 1YFHA 1KGSA 5DYMA 4EWDA 2ZNYA 4LD5A 2MLGA 4EQQA 3TQNA 3U1DA 5EEGA 2OAZA 3EDPA 3FHZA 4EV0A 3F8NA 4WX9A 3L00A 1LB2A 4CXFA 1VTNC 3BCWA 1G3TA 2EVXA 3P9IA 3BALA 1IZ1A 4IXAA 1XCBA 1B59A 3F21A 3MDPA 4JVAA 3GBFA 2HDCA 1JGSA 4XLNF 1Q43A 3ZMSA 3MZYA 3L2CA 2W84A 4D7SA 3PQKA 4ZZLA 2DTRA 2EFNA 4HYEA 1Q5OA 4S05A 3KP4A 3WU0A 3FF5A 4EROA 3DKWA 1XGMA 2LKPA 3C7JA 3HYIA 2MLKA 3CUOA 2PN6A 5E18F 2EV5A 2E9QA 1UIJA 2H6CA 3VODA 1IN8A 2PYTA 1Z91A 1QY4A 1YG2A 3WE3A
chains in the Genus database with same CATH superfamily
5FLMJ 2HOEA 4CXYA 5F5AA 1MSEC 3CCYA 3LCPA 5BS6A 5CKQA 1BXHA 1IDYA 2ZXIA 3PUAA 3W6JB 3IKWA 2I2SA 2LD5A 2BW3B 4Y7NJ 3ELNA 2A6EF 4G8XA 1MZ6A 1EV12 5LBEA 4YIIA 5HNHA 1OC1A 1SPPB 1OYIA 3LIHA 4AQTA 3ZFEA 3VHNA 4L92A 4OIQF 1A31A 5FZKA 4B3AA 3N7MA 4DXSA 1OQ1A 4F52A 1PP7U 3ES1A 2LLKA 4IEZA 4XBQA 5JI6A 5A33B 3BR3A 4B29A 5T3NA 2E34A 1RHI2 2HEOA 2PX9A 2F6BA 1IN6A 1XMXA 2QUOA 5FYUA 2WS92 2NVTJ 1BIBA 1JN2P 2UWMA 4UW3A 1UG2A 4DEVA 4LKFA 1JH5A 3T08A 1AR82 4MXWB 4Y5SA 1GKBA 3WF1A 1DHKB 4DYCA 2LMDA 1MACA 1J3RA 4C9YA 3S16J 4P9YA 1W2OA 3IKVA 4OWRB 3W6VA 4URTA 3VDXA 3L2YA 3LZZA 3S5AA 1LAJA 2G9ZA 1COV2 2L9RA 2CGPA 3BTAA 3S6PA 3I59A 4XFFA 3K0LA 4UB8C 2ORZA 5B3SH 3ZYBA 1E2XA 5FBJA 3H5RA 4MADA 3I0TA 2ZFUA 5JZGB 5HDGA 2WZEA 1QJY3 1OCRH 4M3EA 3W5NA 2ZTNA 4MYEA 2M7AA 3DTKA 2KDZA 1RUI3 3WNPA 4P9LA 5HCBA 4PFOA 2R062 1SFPA 1RI7A 1JYWA 3ILFA 4ISQA 2FF4A 2DK8A 3BG7A 1C8M1 4ASLA 3ZSMA 3VZJA 1WW5A 4OZOA 1KQ8A 1LHVA 1V6JA 2CGOA 2JB8A 3M1HA 4G4FA 4XDPA 3U78A 1H2NA 4AWDA 2XJRA 5FIXA 2Y6FA 2P6SA 4GD4A 4B1RA 2YX7A 2PBIA 4QDQA 3OS2A 2D44A 2Y2ZA 1I3QJ 2IVJA 1WI3A 3THDA 1BBT2 3PUQA 2JUCA 1C3HA 2EA7A 1FOD3 2KDOA 5FYVA 2ZPXA 1I6HJ 5BV6A 1UAAA 5L7OC 4GXLA 2WTEA 1J7KA 1HRI2 2DVAA 1R36A 2OD5A 3VBHB 2XJTA 1HXDA 3RZMA 3S0MA 4LMYA 3ZOBA 5FXZA 2WZR2 2CWMA 3BOWA 2RJ2A 3KP7A 2COMA 3J7NA 3HT1A 1Q8PA 1XXNA 3KV9A 1IUYA 4W50A 2LK2A 2DPDA 1KGYA 5JPMB 4Z92B 2D5HA 4DBRA 4Q4W1 3WTYC 4S2HA 3DXUA 1TQ5A 3GTOJ 5F7UA 4HZFA 1BR1A 1VBE1 4KU7A 1WLCA 1UMIA 3SC7X 2A5ZA 3GUDA 2JG9B 4FTBA 1G2HA 1X1PA 4AFDA 2FCUA 2VQAA 4X6AJ 1U8BA 2DA2A 1VBA3 4SBVA 2M8EA 2RC4A 5FOJB 2ZJ2A 3BGAA 3G73A 1HOMA 1JZ5A 4ON0A 2QWWA 3EUHC 5K9YA 5LBQA 3VBRA 1G86A 4YYOA 3HOTA 2DMTA 1REFA 4IZZA 4XXAA 4PI2A 4ENNA 2RS32 5FK7A 3HGGA 3QP6A 2QQPA 5I8SA 4BHCA 3JRHA 3VYRB 4TLGA 4JGYB 5TRDA 2L9SA 2WAQA 3C18A 3DPLC 1TZLA 3U14A 2Q2EB 3HQUA 2ACJA 3K46A 5IOZA 1JYCA 5HV4A 2IUWA 4QX2A 2ZB9A 3AVRA 3OYKA 2F4MB 3DYOA 3BPVA 2OQ7A 2DMPA 2FDGA 1IO2A 1HW1A 3BG5A 1OUSA 2VR4A 3SQOA 3KZ4C 4KITB 3E6CC 2KRHA 2XBO3 1OCOH 4CP1A 1PUFB 4K6BA 2R043 3ZDVA 1IQAA 2MC4A 2R073 1RUF3 1GYKA 4LR4A 1UG0A 1R091 4IEYA 3Q9OA 4RHV3 3F8MA 4Q4X2 4Q2FA 4P5OA 4LBQA 1R23A 3FBYA 4B4QA 2E60A 1ETYA 1HIXA 4PJNA 5E20A 4FQGA 1LECA 2VI6A 3VN4A 4COUA 2E7WA 1PZ9A 2QSGX 2VOOA 1TLHB 3HWJA 3WG3A 1FAYA 1YJWI 3CKHA 5EEHA 1ZZ7A 1Z1DA 3OR1C 4XIDA 5FPXA 3SZPA 3M3QA 2K85A 3O1MA 3P7NA 4M9ZA 1DGRA 2DF7A 1W4MA 4AM3A 1U2WA 4H7MA 1E3HA 2Z3YA 3O0VA 4FOQA 3MF6A 3KCXA 2XKPA 2HOSA 5M5WJ 1IS5A 5FGMA 4JZRA 2E1OA 3JREA 1SFKA 1AL21 3NV4A 3IDCB 2WSVA 1C1FA 2R32A 3HN1A 1RUH2 2XQXA 2WB1N 2UV1A 2OV7A 1H9PA 2IFRA 2VJIA 4EE2A 3F0CA 2O14A 4BOWA 5JDBA 2E1NA 2JKXA 5J4YA 2IW5A 1O4TA 3VWBA 4CXXA 4PLMA 1CN1A 1UMHA 2YX4A 3OL3A 3A01B 4TTGA 4RM2A 3JTHA 1V6KA 3ZPOA 2EWNA 1GZ9A 4CICA 1P92A 4B09A 2XBO1 4BE3A 4RAFA 2LBFB 5C33A 1MMSA 4MLOA 3RQIA 1W8HA 4XW3A 3PNAA 5FKNA 1GU3A 3BP8A 3QPHA 1ND2A 3ZMVA 1RUH1 3ZXAC 2DA3A 5C9AA 3CCVI 2DU9A 5EGOB 3CUQA 1MMDA 1HQCA 5FZ8A 5FO5A 3TW6A 4R1HA 1K42A 2W9XA 2FXAA 1CAUA 4CGZA 2DOAA 4L9BA 4LBKA 2VTFA 1ZN2A 5KCMA 5H6RA 2Q30A 1O91A 4UVAA 1O4XA 1MEC1 4Z2YA 2XRNA 1XQNA 4U87A 5E6HA 3PIPF 1RITA 3M3OA 3ML6A 1RIRA 3NNJA 3NW4A 1S2EA 3UJOA 3JRAA 2WABA 3PMEA 3ZFEC 2V9PA 5DAQA 4GB33 4L11A 2XKOA 3BDDA 3VBOA 4EJVA 2Y33A 4M3BA 2VKEA 1ZBA1 1O57A 5HS7A 3B00A 4A3XA 5DABA 5JAXA 1AYN2 2PMZN 3C7GA 5CB7A 1Y0NA 1U0JA 4DXZA 4P9GA 3H0DA 5LRSA 2DCJA 4KDPA 1DCSA 1AX1A 4D69A 3ZRGA 3POBA 2Y30A 1Z67A 3DF8A 2K9MA 2D5VA 3LAJA 5IPAA 2FUG2 1OF4A 1LESA 5FZBA 1R082 5FZ4A 4GB31 3DBRB 4HLXA 4U88A 3I49A 1S2BA 2RS12 3A21A 2QKDA 2Z4FA 2WA3A 3URFA 3FXLA 1V70A 2STTA 3LOIA 3IAM2 2PHWA 1UIKA 1GMMA 3Q8AA 3MIHA 2GIZA 3NO8A 1L7LA 4RGKA 1F5TA 3COAC 1AXKA 1TME3 3MGUA 4K7JA 3V7CA 4WM7A 3I4IA 1E5HA 1EPWA 2WBKA 4PLOA 4ANJA 2HWE3 2IGNA 4E4HA 3H0GJ 1XC6A 2BOJA 1I1GA 1LUJB 2HBUA 1CR7A 4OINF 1ASJ3 4ENKA 3LMMA 1ONVA 5JOWA 3T0YA 3JBG3 2OCEA 1NCQA 1UJ8A 1Z7S3 3VL8A 2R92J 1XX5A 2QKMB 4MEYF 5T5PA 1U12A 3ZN5A 3J4UH 5FFXA 4IL7A 1ZVFA 2M8GX 1LRHA 1RUG2 2RDRA 1Z78A 4UF0B 2HEVF 4XF9A 4BQYA 3NRVA 1VBC1 1EYBA 4OQ8A 3GXUA 3AP5A 4AEMA 4WZFA 4NIDA 2C4XA 2FRHA 5I0RA 2XUBA 1VMJA 2Z69A 2WFF2 3CCJI 3H9GA 3HOBA 5ERLA 1HJGA 1XNAA 1C1LA 1LENA 3D0SA 3CC2I 2HYKA 3U4XA 4LIUA 4HX7A 1WLWA 3AZZA 1JTZX 4AYBA 2O1QA 4M6XA 2QM3A 5IYCJ 3U21A 1BVVA 3FBMA 1ERDA 1JOPA 5GPAA 4DBQA 2R7SA 4XETA 5FYTA 3O3KA 2L7FP 3GX4X 4LUKA 1PDNC 1DGRM 2VE1A 4CYCA 1FBUA 2ZNZA 3AM2A 4B4PA 4XUPA 1GQPA 1Y43B 4E70A 1J5YA 1IQDC 2P2KA 2DCTA 2QQMA 1GUIA 2JSPA 2D3PA 3WW3A 3K2AA 4WXHA 2Q5TA 4W8JA 2P37A 3AL5A 1GANA 1W8UA 2MYSA 2L9VA 1Y4WA 1J58A 2YYOA 4LO6B 5SV5A 4IE5A 3LWCA 1VMFA 3HR9A 3AMHA 1MSFC 1GZWA 3TN92 4QX1A 5KHHA 3UKNA 5FMCA 3I54A 2KD7A 1RUF1 4LBLA 2DYSH 1YS7A 4UFIA 3ABZA 2HYXA 3ZFFC 2X09A 3C1DA 1V5FA 2ZHLA 1ENXA 1RUJ3 2VPVA 5D1IA 5B5EC 4BJ5C 3ZOIA 1JZ2A 1RGSA 2XB0X 1YITI 3WQ7A 1W0NA 1CAWB 4XXPA 3BCAA 4XF3A 4IEPA 4FHTA 4AZZA 1LDJA 2ZXWH 5FY9A 1WGPA 2IVMA 1FMD2 1Y9QA 2ZGKA 3GO5A 1PGL1 3S15J 1LVAA 2DODA 4NPLA 4OMDA 4NC7A 3KP2A 4IRGA 3I4NJ 2I45A 5IK4A 3Q0UA 1D5VA 2O0OA 1ORKA 1V6OA 5IT3A 3SEZA 2FBHA 5C44J 2XAFA 2WFPA 2P17A 2B4KA 4FFIA 1A6IA 3HNYM 3HM5A 2F4LA 1S9HA 1PP8F 3EYYA 4OI0A 4O9GA 2GMPA 2R93J 5FP8A 2FX0A 5TISC 2ZHKA 3ZMTA 2IXHA 2L9NA 4C3IJ 2DPUA 3QYBA 3G1OA 1OYWA 1S7EA 4LGWA 2HTJA 5H9SA 5D8AC 1OD3A 1RMU3 4HX8A 4XILA 4CDGA 5FZMA 5J09A 1RC6A 2F5DA 1G8XA 2HWB1 2DQRA 1Y6IA 3HN3A 4GWIA 2HZDA 4R9AA 4WM8B 4Q26A 4QQ2A 4CP2A 1PK6A 5EQUA 4PQQA 4PJLA 1AL23 3DECA 3VUOA 1PK6C 4BQ2A 1W2AX 2QFEA 4UW6A 4UT5A 4AFBA 2GN3A 4RGGA 1VRBA 4ZYHA 4C91A 2KPMA 3N4MA 9ANTA 2VCBA 4ABZA 2BEOA 1U9OA 2VQGA 4YVWA 1LFUP 3RMYA 2FE3A 4IF4A 4RYDA 3H1YA 1ULEA 4A3ZA 4RSUA 2RM22 4E2SA 4RB2C 1OKQA 1HB2A 2GNBA 3IM0A 5T5OA 4XFBA 1IN7A 1E3PA 2W25A 2WN3A 4TN7A 1HW2A 4A45A 4AVSA 3BIWE 2UYAA 4FI9A 3UETA 3S17J 2JDKA 1OCPA 1SZBA 3ZCOA 4KU8A 2NNYA 4P08A 3KCCA 4ZS3A 4PSWA 4O7XA 5FR3A 1F4AA 4MGQA 4DY3A 3OOUA 4E7ZA 3VOEA 2MEV1 1XD7A 3B9CA 1IXRC 2XVLA 1W9YA 3OSFA 3VDBA 3LSKA 2ZJPF 4FP3A 2DA6A 4P02B 5AC92 1VRH3 4GRIA 3OF1A 1SLAA 3I2JA 5J7MA 3T2OA 3ZMNA 4L9JA 3WTSC 3M4FA 2E6VA 2P6HA 1S0CA 4Q1RA 2HXOA 2RS53 1ND2C 1H8VA 1JOJA 5DQ0A 3S2WA 2A73B 1FPN3 4NIGA 2GNTA 1MPXA 2QZ8A 3OUIA 3U75A 5T5LA 3LFIA 2KIMA 2DWRA 1Z9CA 3W3CA 5ACA3 3CUQB 1MMNA 2HQNA 2K5CA 4M3DA 2QQVA 3W58A 2E7TA 4MV2A 4AU7A 4NHXA 4NROA 2XSJC 2H27A 3JU9A 4LO7A 1XSVA 5DZFA 2OBPA 2PTMA 2PJRA 1R1A2 1KXGA 2WLQA 2MD0A 2OPTA 2K27A 3VYTB 1D5YA 2OZJA 5EYXA 1HSJA 4GCVA 4BISA 4L5IA 2EALA 4ZH4F 3VGIA 5FPVA 3ELKA 2CV1A 1WW6A 4H2AA 4CEYA 5C7GA 3GTMJ 3KQRA 3LQRA 3T0DA 5APAA 5F0HA 1UCXA 2JEMA 2E1MC 2EINH 4XUQA 1FWZA 2WV0A 2GQQA 4UUVA 5FKBA 3W21A 2BXYA 2JIGA 5J36A 4LTAA 1GWKA 1Q3EA 5LZ6A 5FJ8J 4IOCF 1K4SA 1ZRFA 1AXYA 2JDPA 3K7AJ 5H20A 3NAUA 3GZ5A 3HGYA 1JKPC 1IW7F 4LOTA 2PHLA 3U9GA 4Q5SF 3J7MA 2YC4A 2RR13 3VD3A 1WPKA 3E1F1 3VPRA 2CW8A 1BYHA 2A70A 2GLOA 3ABLH 5FKOA 2IC1A 4DOUA 2I5UA 4XRSG 4A3FJ 2W5FA 3VL9A 2YPJA 4YZ2A 4ET7A 4HF1A 1U8RA 1ACIA 3V0AA 4QKFA 4IDZA 3FC0A 3FX3A 3FLPA 1ZBE2 4UWDA 3J7AY 1W8NA 1YQ6A 1OVPA 2RS31 1V0AA 4XRFA 3K4ZA 2VMCA 4I01A 1MR5A 2CAVA 1FY7A 2VC0A 3S2HJ 2ZZQA 1WJCA 3HUGB 1ALYA 4MQ9F 1W28A 1ZGJA 5LGTA 2F48A 1LQ1A 2I10A 4CCJA 4E9KA 4H3WA 1NCQC 3RWNA 1W7PB 4FPCA 4P5HA 4ASMB 1MVEA 4CDQB 1RUH3 1VP6A 3WXPA 2Y0SA 4V19K 3IMNA 1F36A 3JD71 3B6AA 2KQRA 4P9UA 1FATA 4CCLA 1C0WA 4O61A 1DU0A 4XF4A 1FEXA 5DS9A 4FPYA 3CCLI 1HQNA 5JZGC 3FXRA 4B1LA 1ZRRA 3H1CA 3DN7A 3LB9A 4A3DJ 1MZFA 3ACLA 2W94A 5D5XB 2K2SA 4NC6A 3OYDA 2RHPA 1JUSA 3ZN6B 3T0AA 5FZ7A 4JRLA 4ZHNA 2BDRA 1B9MA 5ICEA 3RKQA 4UFMA 1WJAA 3DKQA 4BS9A 3RKWA 3UJQA 1W2TA 5JR3A 1OMIA 4M0HA 5CVIA 3VZMA 1L3JA 2O9LA 2BXZA 4DB5A 1YQAA 1OH3A 4IXLA 3WE2A 3ZXSA 2M7BA 4QPGB 2LS6A 3GZNB 2D98A 4AK3A 3L2UA 2ES3A 2R0HA 3NV1A 2MFZA 2CUEA 4ONUA 3AP4A 3BPXA 4QQOA 4QX0A 1W8TA 3AYAA 2XAQA 2OUMA 4GQ7A 4NNJA 4LQRA 4IGPA 5AVAA 5L7OA 4C3JJ 4OQ9A 1SVLA 1TTYA 3ZYIB 3AL0C 1SBEA 1T98A 4UXNA 4OLLA 3DXTA 3J7ZI 3HMYA 3GZEA 1GZWB 4AQ2A 4H7LA 3ZFFA 2IXJA 5IW0A 3M8FA 3MFAA 3HVDA 1RL3A 3RI8A 3GM8A 2FCTA 1W6QA 2ECCA 5D5UB 1W9WA 4YNIA 2QCOA 2MPFA 1S55A 2X5IB 3OEBA 1BR4A 3NVCA 2XOMA 4BK5A 1S0GA 5JLVA 5ACA1 1IXSB 1QZZA 2XJQA 2QQAA 4BQ1A 3ROUA 3ATGA 3AZYA 3DWLE 2DUQA 4IEQA 4N0BA 5LW9A 1LJ9A 1H1IA 3H7YA 2FSWA 1F4KA 4XJ8A 3OGSA 5CVVA 1T6SA 1GNZA 1JZ8A 4RM3A 4FE4A 4N4OB 1RNLA 5J8CA 3MZHA 2VNVA 3FXMA 1KDMA 3OBAA 3G1LA 4LNVA 3VBRC 1D4M3 2RS13 1SMYF 4CUCA 4FQ4A 2Q0OA 3AX4A 1S0IA 1BR2A 1NOVA 5EHDA 4OHWA 1ZARA 2VTXA 1GT0C 3QODA 3J7AO 1VBB3 1DGRN 4NRMA 3DEMA 3OD0A 4L5JA 2W95A 5HI0A 1AVBA 2OKXA 4W1UA 1WCDJ 3WW1A 1W3VA 2X6OA 2EIBA 4D94A 4GB32 5FXVA 4U36A 1YHFA 2LG4A 4OAZA 4MHRA 4ASKA 2LY2A 1OPCA 2UXNA 2X53S 5D8LB 3E97A 1IG3A 4PK4A 4GXOA 1N3PA 2XXZA 1C28A 2CQXA 3VB2A 2RR11 3PJYA 1HKTA 1O3TA 2WB1A 4IQ4A 1MKMA 3LIGA 3WF4A 3KFWX 5FRNA 4RL7A 2WUHA 1CESA 3ME2A 2AEZA 3VZNA 3F72A 1G9FA 2M4GA 2Y6HA 3QU3A 5A2QZ 2Y75A 1I3AA 3ZSJA 1D3YA 1OQDA 3ZMUA 3C7HA 4LLFA 3LOCA 2DFBA 4HN0A 2X29A 4QSHA 4C2UA 3BYWA 1MW7A 3AXEA 3EUKL 4D6RA 5TSWA 2IJLA 2WV1A 3CMYA 1KDKA 2A6YA 3LQCA 4EM2A 1BKZA 4Q48A 2HWVA 4A3MJ 2V5YA 3KV6A 1OOPB 3F23A 4X6QB 4JHZA 2YC0A 3H1WA 4EVIA 4NHMA 1ETVA 1ZG5A 2RVAA 4BPZA 1ON2A 4ESFA 2XLGA 1PIV3 3I71A 5E3NA 2A75A 1BC8C 1GP5A 3M3YJ 2AZ5A 1GUUA 2ZMEC 1O8PA 3WDXA 1DLLA 1OURA 4S2GA 2E51A 5DM7F 1Y7BA 1PNFA 4PIZA 1J09A 1YJKA 3O1OA 2CY6A 2ZKLA 3CJTB 2ELKA 3VDDB 4YFNF 1CAXA 2VMGA 4ETSA 4BLJA 4G7OF 3H9JA 4ZJZA 4MOAA 4EWAA 1YIJI 4GJZA 1QWRA 2NN8A 2Y0IA 3WHTA 3P3PA 1PK6B 3GLLA 5D5WB 4HLTA 2HXIA 2VMFA 2P3IA 2Z9OA 2A6TA 3N7LA 5EV7A 1LOAA 1RESA 3WTTC 5E1RA 5CFCB 1QXJA 1OLME 3JSOA 5EGOA 3CF6E 3MPPG 1AKHB 3OOPA 3MPBA 4CP9A 4INDA 4WVMA 5C8WA 2E7AA 2ZEXA 2BHZA 4PHZA 5K0UA 1OFCX 3ACGA 5LD2C 5LRRA 4C0HA 1X58A 4DQ2A 1B09A 1ZNPA 3L2RA 4FX4A 1UYZA 4BZ4A 3WU2C 3UV9A 4RQPA 1FX7A 3RZOJ 4COYA 1H2MA 1O7FA 1SBDA 1F9NA 3D5SC 2X9DA 1TG7A 2JT1A 1QJEA 3KP5A 5K4LA 2L4MA 2G9FA 4AVVA 3SCGA 3RTRA 1AR81 3OCPA 5JCTA 5CLSA 1APNA 2B8MA 4PBPA 4CDQA 5AONA 3M8JA 4IETA 2BQPA 2Y8KA 3WHCA 1YLLA 4XACA 5FZOB 2X85A 4WVVA 5LWBA 1X82A 4LJHA 1A3KA 4WZCA 3OBZA 4JKKA 4EM0B 2YC2A 3EO6A 4ZZ8A 1QQP3 4MSVA 4A44A 2ADDA 4OMCA 1MJBA 2VQLA 2KRFA 1YI2I 2NOJB 3IH3A 4HSLA 1R71A 4XVHA 1QXRA 3WINE 2VZ1A 1ZG3A 2Y60A 5CIRA 5LA9A 4EN0A 1CIWA 5FY4A 4W6WA 3LDKA 4BQOA 5CQGA 4A6SA 4HPKA 3O6BB 2ARXA 5FZDA 3PIGA 4Q0UA 3JD73 1BMV2 2L5QA 1FOD1 1JODA 3WCSA 4YVSA 1Y9GA 2YROA 1IG0A 1KGSA 1MQTB 5C70A 2ZNYA 4LD5A 4ATEA 4EQQA 4EEFG 4XDQA 3RZLA 2DJNA 3POYA 4CZCA 2DTYA 4GH4A 3IAQA 3VZLA 1XYPA 4EV0A 3F8NA 4QHBA 1LB2A 4CXFA 4CCDA 3BCWA 1G3TA 2LOOA 5JXIA 3WDWA 4FOWA 1SVOA 2V6EA 1W2NA 2R7OA 2QBXA 1WZXA 2F4IA 5LA0A 5LATA 3MW4A 1VRH2 3WU0A 3FF5A 4HKLA 2VXDA 1F15A 2YPDA 4IX7A 1K5MC 1FMVA 3CUOA 1XJAA 2MG4A 3RS6A 1J1TA 1K5MA 4JKLA 2E9QA 3RZGA 2H6CA 3ZR8X 3RI9A 1IN8A 4XJWA 3D5RC 1Z91A 3AMNA 3K4KA 4UW4A 1BLZA 1BN5A 2PMWB 3HBKA 1ZR2A 3ZXJA 4XZPA 3V0AB 4AI0A 4JQFA 5AIPA 2LTPA 4YW7A 4FP2A 3CJIC 4OUMA 1SANA 1QO0D 1G4DA 2YU1A 3LEKA 1RXFA 3OUJA 2V09A 2WADA 4GGGA 2D6OX 2A3WA 1IC8A 3U07A 4HL0A 1SBFA 4F93B 2DFIA 3HZJA 1FV2A 1NE6A 3SXYA 3WNNA 2KZVA 1LVKA 3CZ6A 1YRNB 4M3CA 2YB7A 4NHKA 3DPRB 3GEZA 1FYKA 4P55A 3AL0B 3B5LB 2EQRA 3M7GA 4AI3A 2F4PA 4COVA 3SFIA 1RZ4A 3CNAA 3HSRA 2HOTA 5DUUA 1ITYA 2CL2A 1U5TB 1K7AA 1HB3A 4B47A 4AHXA 1P4WA 3R0JA 3OYIA 2YBKA 4CDWB 3WW4A 2ARBA 2DU0A 4H0EA 3K4CA 4FVVA 4A7KA 2EFPA 3QU6A 3ILNA 4HEA2 5GP9A 4YM2A 3GBWA 2TUNA 3G2BA 3EPZA 4UUSA 1D0HA 4XQDA 2RR12 4AHWA 4BXUA 2IWGB 2XLAA 1HKSA 1R4MB 2W1OA 3VFZA 5C3QA 5F2SA 4IERA 4PGGA 5F1JA 5DAWA 3AFHA 1FTTA 5F04A 4JC1A 3EXUA 2PELA 4N7UA 4DUWA 4KBBA 4P00B 3T8RA 3S1QJ 2ATFA 3ZIXA 3V64A 2QYOA 4AUXA 2EA4A 3BTLA 1VQLI 4HRIA 2ZS6B 4M00A 2ZGOA 5L73A 4LLLA 4HV6A 5FKKA 2PLV3 3A2KA 3POFA 1ND3C 5GAGJ 4BE1A 2VBYA 2VOXA 2BGCA 1ND3A 1XE0A 1HJFA 2D7FA 1Z3XA 1QJU3 2IEKA 4QGMA 1MS0A 2GMEA 1H0BA 5EWSA 4NRQA 3HOVJ 4ZS2A 1AR83 1BM9A 4NHYA 3JCUC 4CZZA 2XWBB 3G3ZA 5LFAA 4NOTA 3ENRA 2UYBA 3NJVA 4EN8B 1EAH1 1TP4A 1M1EB 1MS1A 3ONQA 4KT5C 2XJUA 4QQLA 1BMV1 2ZZJA 3PJRA 1Q1HA 4G7HF 3Q8BA 2X6XA 4WF2A 1UYXA 5IT6A 2X5IC 1AR93 3BR6A 3AYCA 3KX2A 1VBE3 3BZCA 2YGLA 1R49A 1X1BA 4D7YA 3ZYHA 2CYYA 2KJCA 3I97A 3TN93 5L36A 5HLTA 1DDNA 1J3QA 4FFGA 5B1AH 4ES8A 2XL9A 3HTUA 4XLEA 3WW2A 3RFRA 5J37A 2WAEA 4O5VA 1E17A 3IV5A 1ETQA 3TRSB 5E8AA 1H8AC 1BI0A 1RUJ2 1BVP1 4P9JA 1BEV1 2P6CA 1QBJA 2V5DA 2IPQX 5LA2A 2ADEA 3PM1A 2UWAA 1EF4A 5AFBA 1OFSA 2ZA9A 4EGZA 3ECQA 3IH4A 1FLIA 2DCZA 3I64A 5K7PA 1ZHFA 2F5VA 2IS4A 4M6VA 3ZMOA 2B0LA 1HXS3 1VAKA 4XABA 4URAA 2E2JJ 4LB6B 3O1TA 4LT5A 2CV2A 1OPOA 1FNZA 4LOSA 2JDHA 4FX0A 2VUMJ 4BKXA 2PXJA 2RNJA 4XN0A 5M3FJ 1OFNA 2BNOA 3GF2A 5JVTA 1G3WA 3MYXA 5M5XJ 5FPAA 1NG6A 3O5SA 3PURA 2GXBA 3O12A 4Z1VA 3I56I 4B44A 2XVGA 4AW7A 4A3EJ 3P6BA 1GHCA 2EXIA 5M0TA 4RGXA 1I27A 3ZQIA 4BE2A 3THCA 2QQLA 1DGWX 1RUC1 2A68F 1NKGA 1IXCA 2AC1A 3P5JA 2LF8A 3KB5A 3ZVXA 1Z21A 1OSGA 4GZ9A 2X4HA 2KM2A 1P2FA 3FKIJ 3CCQI 1GLNA 3I8TA 2JWPA 3ZR5A 4HW0A 3IAS2 1D2QA 2AUYA 3WDUA 4DYQA 4LMFA 5FOBB 3RPQA 2BW3A 1DQ6A 1GQGA 4WVWA 3IAPA 1FP2A 2K4JA 4HDVA 1J0RA 2EB7A 3H36A 1VQ6I 5EIYB 3H7JA 4LIVA 5C9AC 4NE9A 5L7OB 3OWTA 5CYVA 4RQPC 1F43A 4G6QA 4FE7A 2AQEA 1H6XA 1ZRDA 5ILUA 5HBAA 5E79C 5JLWA 1HF0A 2BY0A 2ZACA 1D4M2 4ATFA 4LPLA 3BZKA 1Z7LA 2HWB3 1QOSA 3EUAA 4G94A 1DP3A 3I3EA 2J42A 4QQHA 3R4DB 1DU6A 4D6QA 4D6SA 3OPTA 1RC9A 1GNYA 1T38A 3SH5A 4BJTA 1YHQI 1U9NA 5I8TA 3GF6A 4CDWC 4AIJA 4AC0A 2RS11 1RUC3 4JGYC 1ZK8A 1S0EA 1S7AA 4CA9A 1KQ0A 3AP9A 4W6XA 2UU8A 3L1PA 5KAIC 1HX6A 1IV6A 1VQ7I 2Y6JA 3K1PA 3LAGA 1JZ7A 4KG0A 3OJBA 4Q5OA 2YHJA 4NHJA 1F31A 1TEIA 3VBFC 2FMYA 2PFBA 1URXA 5LBCA 2VVDA 4I3GA 4NPMA 2XRLA 1KFUL 1X1DA 3ZFEB 1F5JA 4DZJA 4L9TA 1SHWB 4IRHA 4A6DA 2LY9A 2NMNA 2CWSA 4E7SA 5GLTA 2ZMEB 3PNTA 4JTOA 3RKYA 2OIIA 3H92A 4FT8A 1ZBE1 2YU2A 4G7ZF 1DQ1A 3HNBM 1PX4A 5FZ0A 4BQ5A 3POWA 1GQHA 5C3RA 1RETA 1XGSA 2W24A 1XSDA 1AXZA 2XDVA 2B42B 1K6OA 2ZMKA 4QM9A 2DLLA 3ZX7A 2CH0A 5J96B 1ENHA 2GALA 3BJ6A 4LHNA 5C3PA 1WMEA 1RIOH 2VKDA 3OBRA 3I3LA 4CEYB 4S04A 1ODDA 1QGPA 1XYOA 2E7XA 2MD5A 5F32A 2V9KA 5FYBA 5A80A 3KETA 2OQ6A 1RVF1 3GMEA 2LUWA 3POSA 3UNPA 3M3EA 2QENA 3RZJA 4QB2A 3AG4H 3F6VA 2GC0A 5GTIC 1B9NA 2BP6A 1W5CC 1LEBA 2HBTA 3BIEA 2DCEA 5IVYA 2OXBA 2QVSB 1NCRC 2DFFA 1W36C 3ILRA 3T4VA 2DT5A 5JLXA 3BLYA 3N35A 2ZSIB 5JZGA 4NIAA 5E3LA 3WUDA 2PLV1 3KT4A 4GA9A 4CEWC 1PGL2 1XTAA 2X1DA 4JDMA 3PJQA 3EBRA 3GZTB 1O3SA 5HLIA 1R083 4L18B 1WJFA 4ZDLA 2AXLA 3USUB 1ZGAA 4YZ1A 5CEHA 3HTSB 5ICGA 2B9UA 3ECOA 4BEHB 3WR0A 2BBAA 2FQ3A 5HV0A 4HNTA 1LOEA 3PUBA 4BLIA 3M4OJ 3OIPA 5JPNB 3T09A 2XPWA 1BZWA 1G6NA 1VBB1 4PJ0C 1OA4A 1X36A 4OHYA 1ZAOA 3SXWA 1LU2A 5J3LA 4JV4A 4P96A 3HBZA 3L9FA 2RM21 4Z2AA 4BEHA 1F8VA 1C5HA 3ZFFB 3JBG1 3J26N 3H3UA 1UB9A 4O6JA 5A33A 2VOPA 2W39A 3E6BA 1PZ8A 2DA5A 4YG2F 4BU2A 1BIAA 1UZVA 2XASA 1XB9A 3M70A 5H9PA 2WIIB 1V00A 5FZ9A 4U7DA 1X2NA 1WW4A 1AU7A 1SAXA 2DMNA 2R49A 2YU3A 3JB8A 3PHMA 3OGVA 1ZLJA 4BHBA 2FQPA 2DMUA 2M87A 1LDDA 2DTZA 4IPAA 1VBA1 1MDMB 4IESA 2YBSA 1ZELA 1SMTA 1W1WE 5FFOC 4M0NA 3BTJA 4RQPB 5CG8A 1LEDA 4QPWA 4B1MA 5GLWA 1SCSA 1V4RA 5C4XJ 2AYHA 2ZJQF 2EZLA 5GLUA 3OR2C 4AEKA 1BW6A 2QLZA 3LFMA 2IXCA 1K45A 2ICWG 3MFCA 3ZSLA 3ZPYA 1LODA 1WJDA 1EH8A 1KU7A 1RUG1 3R61A 1D8JA 4XJAA 3V7RA 1H1AA 2BU9A 4M01A 4RFT0 4LBJA 3WF0A 4HAMA 3FISA 1K78B 3SZTA 2E2IJ 2HWD2 2ZC2A 2KT0A 5FLVA 3SKJE 5HVQC 3RWKX 1H9GA 1XBFA 4LEJA 3W59A 2D3RA 4QHZA 5D6EA 1OOPA 2X5IA 4Y5Z0 2HWB2 2UWBA 3KP6A 1TMF1 4FISA 1R092 4IE0A 1XU2A 5LK5A 5IYDJ 3VBUA 1HRI3 4B43A 3WCRA 2WT2A 3VBUC 1W39A 2DXIA 5A7WB 3OGRA 4RD7A 1H9TA 2ZGMA 1V5EA 3PSFA 4QM8A 2C6YA 1H0MA 1COV1 2QUFA 4CTEA 1W6MA 3MW3A 2QBYA 4AEDC 3USSA 3HJEA 3AYDA 2JDZA 1RUD2 1JHJA 2ZFWA 3SKVA 4TYSA 3S7EA 3DU6A 1G3YA 1N3OA 2OS2A 1TQPA 3PVOA 4Q0QA 1B8IB 5EEAA 2G4IA 1TZOA 2BNNA 4UYBA 2DOFA 3HOSA 1FOD2 1TNFA 3OYNA 2CU5A 3FM3A 4BQWA 1LFPA 5BPDA 4EWEA 1PVC3 1UKRA 1YFYA 1NTCA 4I0BA 2ISZA 5CYYA 2BW8A 2EICA 2HGCA 3O1UA 3N9NA 1D1CA 3POEA 5G04L 1NH3A 2WYFA 1YXWA 4DRRA 2VZPA 1VBA2 4ZU7A 4AQSA 2LRPA 3PU8A 3BPSA 5K7FA 1WKYA 2JG9C 4PT6A 4LFUA 2JG9A 2B39A 5F2WA 1REDA 4I2OA 2O5RA 3LSPA 1SC7A 3O8HA 2BGOA 2WDBA 5FYIA 1G59A 1PO12 4HNUA 1P8JA 3BR1A 3OG2A 5C3OA 3H5AA 1AR61 2VE9A 3LDBA 5FUIA 1LNWA 2GA2A 2DO7A 4KN4X 3K6GA 4RB0A 3LSRA 2XPVA 3TMOA 2ZMEA 2D2WA 1OA2A 1MH3A 1XOYA 4PFPA 2P3YA 2VVFA 3JW4A 2A07F 1KA8A 3ZQFA 4AI8A 4Y24A 5D8KB 4UB6C 4RS8A 2QF7A 1IRGA 1REPC 2VXZA 1XRUA 4DEQA 4XPVA 3L9JT 3FMRA 4LBMA 2Q8EA 3CJQB 1PUFA 2WL1A 2W47A 1IRZA 4Y15A 1AR62 1U5ZA 1X1CA 4II2A 2NOGA 2V1NA 3B9IA 3CDZB 3RYPA 1UAIA 5F5IA 3KF5A 1XC5A 2IS1A 1D8KA 4IUGA 4YGDA 3LF7A 4FTEA 2H8RA 1T33A 4IV1C 2VG9A 4DNCA 4BQNA 4G6DA 1W6NA 3W2WA 4E7HA 4FPKA 1K5MB 1BQPA 4FFHA 5J1XA 4MNUA 1AR73 2KA3A 2A1XA 4XFGA 3MVPA 4LHSA 4F7ZA 3K1MA 1DGWY 5FY0A 5DCMA 3LGRA 3PSIA 3MV01 3AMPA 2RDQA 1S0JA 2RN7A 3WG4A 4ZY9A 1ZGWA 2EJRA 1BOAA 2WAQN 2QZ2A 4ZYEA 5KAFC 3CJIB 1GZCA 1IUFA 3M7AA 1J75A 1YFUA 2FDKA 2WWYA 1PYVA 1W7PA 1OA3A 2VCCA 4XC9A 4BE0A 2PQQA 2WS91 2KIUA 1E5SA 3AB0A 2AXTC 4B4CA 2E31A 3ZXFA 3CLPA 1AYM2 1YWKA 3PFIA 5A1AA 1XYNA 2BJSA 2EAKA 2C26A 2EZKA 1WA4A 2GSYA 4OI1A 2RDPA 2IGMA 3AP7A 3TOJA 2YU9J 1US2A 1CAVB 1BL0A 1P9QC 2WWUA 1EV13 2WA0A 4PZJA 2C6SA 3JRFA 4J6GA 1S3JA 4XCBA 4RB3C 3HRMA 1IHMA 3LSJA 3WODF 3AYEA 3KLNA 5A3UA 1K83J 4DUXA 3BTZA 3K4JA 3V8LA 2ARCA 1OKRA 5J8FA 2PMUA 3NNLA 2V1XA 1T0FA 3K4BA 2MC3A 1RUNA 1NLRA 1SLIA 3EETA 3GJAA 1P4AA 4AEDB 4XBNA 2QQOA 5FJKA 3MLJA 4WM8C 5JHFA 4U0YA 1LJ7A 4BM8A 4WM8A 1BI2A 1HDDC 5DUWA 2VMHA 4AIHA 2JQ7A 2GM4A 2VC1A 1ZZBA 3WDTA 1UWWA 3K3NA 4CVUA 1PVC2 4JGZB 4ISRA 2GNMA 2ZGNA 3A23A 1JI6A 3TO6A 4YVSC 2VXJA 1A5JA 1DG6A 2W2IA 2AHQA 5ILVA 3VKNA 3D5OA 1CAUB 5ANNA 5ABJA 1RVF3 4CCCA 3FK6A 4ES9A 3CL1A 3U11A 3OYLA 2IVIB 4J25A 1NCRA 2TCTA 3J8F2 1VBE2 2W85A 3E5XA 3JR9A 5FRMA 1VBD3 2A6ZA 3T1LA 3A4CA 4A12A 1B35B 5CKTA 4AVCA 5FYYA 3H3ZA 5CU1A 3C8XA 5CVUA 3B3QE 4QHOA 2R063 3VYUB 1XSQA 1UZ0A 1DGLA 1UOGA 1LNSA 1J59A 4XHXA 3QH7A 1G9AA 4II3A 3I2OA 3V4GA 1VQ9I 1XCVA 4KWUA 3RRDA 2R7QA 5FXXA 4JK1X 4JRAA 3OTFA 5A3MA 2DUPA 1U3EM 1EJ9A 1RMU1 3GCMA 3OV8A 4HQEA 2IZWA 2NMOA 3CCSI 2M1BA 3DEUA 3BU7A 4CZSA 4IVNA 4GKYA 4JX6A 2EIDA 2VQCA 3G71I 5B66C 3KHCA 5JUVA 2GN7A 3WF3A 1ZZ8A 3N9OA 3GBGA 2BGPA 2R7XA 1ZA4A 4JQTA 3CJIA 5ACA2 4AXOA 1WFXA 3GYDA 2ZMNA 2K3PA 3NL1A 3WQBA 3MHZA 4A6OA 1SLBA 1L3LA 2Y6KA 1QF3A 5FLHA 2IXIA 3RSJA 3KE2A 5HCHA 4LO5B 4QU2A 4AFAA 4GWJA 1GXQA 3V65A 1NG7A 1N47A 2AO9A 1HDPA 1RUC2 3GWZA 2Y0SN 5A32A 2M2EA 1WKMA 4MHUA 2R0FA 3I3MA 1CD3G 2R5ZA 1KZHA 3TAYA 2ZXHA 2XV4S 3CC7I 4YRVA 1JHHA 2KHMA 4CH7A 1ENSA 3KT1A 3RG0A 4N7IA 1UOFA 2P0WA 4I76A 4EJRA 1AYN3 3OYAA 2HPIA 3G1MA 2VCMA 1A04A 1PMIA 3JD72 3NJXA 1W0PA 4MIMA 1C4RA 2EFOA 3LEGA 4M3CB 1WD4A 1EP0A 3I7DA 3AG2H 4A5MA 3OOXA 1STZA 2CU7A 5FROA 3QPSA 3IZOA 3PVEA 3ZQCA 3CHXA 1CQ9A 4XBLA 1BBT3 2QSFX 2VH9A 4UBGA 2A6VA 2PJPA 3ABUA 2AR6A 4K2EA 4MGKE 3IDEA 2B45X 2ECBA 5HNFA 5FDBA 4ZTJA 4HXCA 3KEQA 5F6FA 3HL2A 1YOVB 2L54A 5D4SA 1SD5A 5ICCA 4JAAA 3AL6A 2UWCA 4FO9A 2GMMA 3OYGA 4HG2A 5F37A 3KCYA 4XKBA 3S1NJ 2VQTA 2RJKA 3K2ZA 2WZR3 3JZVA 3N7JA 2EIJH 4R4XA 4M3GA 1C57A 2E36A 3ZQHA 2Q8CA 3S8PA 1UHSA 1UY1A 4J01A 4NIIA 2DVFA 4QPIB 3M8LA 2XR4A 2VJXA 2W3JA 5FK8A 1NK2P 3MI8A 1EV11 4G6TB 1YIFA 5HCFA 2WSUA 1HV0A 1W0TA 5KHGA 4DPNA 3QP5A 2TBVA 2OCCH 1STMA 4Y20A 2GXAA 3HD8B 4OOIA 5HXMA 2WQ4A 1AJOA 1OF3A 1UNBA 3GFLA 2ZAHA 3OPWA 4BJ0A 2QQNA 2I07B 1EKEA 1GWMA 3VB9A 3WP5A 3FMSA 3NJYA 4RHV2 3KD4A 3C3WA 3TDUC 2CW0F 3BTCA 1N1SA 4IE7A 4I98B 2QA4I 1DP0A 1YYVA 2NLRA 2B46X 3KZIC 1JHFA 3BCBA 1E5RA 2WZR1 4EZ4A 2V9VA 1POV3 4M3FA 3OSDA 3BUCA 1K12A 1FSHA 5JOZA 2ZGLA 1PJRA 4OUSA 4XLCA 3RZZA 2X10A 2AH2A 4QU1A 1AOYA 4AEJA 1CAXB 3RPUA 3PO2J 4XKCA 4FAGA 4Y33A 2VAUA 2RV8A 5DUIA 3FXJA 3F8FA 4DIQA 4XRSA 3PTYA 3V42A 3DEEA 3SLIA 2Y48A 3QAHA 4BQ3A 4KN7X 2MABA 4E7LA 3DL3A 3CLQA 4UXAA 4AF9A 3POIA 1JJ8C 1QGLA 3ZQ7A 5K5OA 5IOYA 4FPHA 2D43A 4D0QA 1DZRA 4BQAA 1X3ZB 4AE2A 2IS2A 3CMGA 2VXRA 4FXKB 1U5XA 5B2GB 2XBO2 2Y34A 4E7JA 2CWEA 1Q8SA 2ETEA 2P5LC 1HC8A 4D7NA 3DGTA 3J8F3 1FTZA 1W7PD 2DJIA 3OY8A 1SFOJ 5IP7J 3TEWA 3KP3A 2G19A 5EG0B 4FOYA 5DMYA 4LHKA 2JJ6A 4RGRA 1FYMA 4H14A 5K1YA 1ZH5A 1CAWA 1FMD3 3PVBB 1Y8RB 2YSRA 1QJX1 4IV1A 4WXCA 3BR2A 3CMAI 2XROA 3IIIA 1W6OA 3VD5A 2MH2A 2XUEA 1UF2C 1R9TJ 5K0UC 2ZGSA 4ZYAA 3HHHA 1QVUA 2H09A 4ENMA 3J81K 1EY2A 4XDOA 1Y3TA 3BG3A 4IGQA 2DAOA 5FY1A 2JTVA 3EQLF 5IVJA 4M74A 4KISA 1LULA 1VRH1 4XHBA 2ZOEB 4I99C 3G6EI 1NY72 5FCCA 5L3CA 5GZEA 4CDQC 3LE0A 5CVRA 1IS3A 3PVNA 5BNNC 3CO2A 3WNOA 4BQ4A 5LLQA 3VDDA 4RN5A 5LA1A 3LA2A 4HOOA 1O6UA 5DUKA 1FOYA 3DTEA 3MIEA 2B7EA 3QPLA 4CDWA 5K5RA 1JYXA 4RA2A 5BPIA 4L97A 1JJ6C 3N97A 3FK7A 4XFHA 4MGIE 1YW9A 3I2GA 5E3OA 4YZ5A 1IF1A 1S1AA 2ENRA 2NYYA 1CONA 2VNGA 4A93J 2D40A 4N90A 2BY3A 1UKGA 3LPFA 3WDYA 3OD4A 5D4RA 2ZJCA 3ZSKA 4W65A 5I0DA 5F0FA 2FU4A 1GR3A 3M3CA 4KG8A 3UKGA 1AYN1 1PX3A 5D21A 4YM1A 4LKDA 2BZDA 1OR7A 5FREA 4YVSB 2BE5F 2BY2A 2R3SA 2JD4A 5KHIA 3WVJA 5FZLA 2QE3A 1S0FA 3MUZ1 4GH4C 2CQQA 2XGEA 1JE8A 1R7JA 2LBFA 3F8BA 4Q4V1 3R0AA 2F5CA 2PHDA 2K7LA 3U1XA 1GOFA 3BJAA 2Y0OA 4YWAA 4QB1A 1HDKA 3SEEA 4QPGA 2E1CA 3HG9A 1XPXA 3KGLA 5B4XA 1P6RA 1R093 3DEWA 2QBYB 2LSOA 1IZ3A 4XLFA 2WN2A 1I1SA 2BHYA 1JTYA 4Q0PA 1F5FA 3PNVA 3WUCA 3KZZA 2PHXA 2OYZA 5IUQA 2CHHA 4QDRA 1JXNA 4I30A 4HBNA 1FPN1 3I2KA 4CPBD 1EUUA 5FP7A 1G9CA 5A70A 3ZPLA 4D0PA 3CJNA 4A4AA 2D6LX 2FOWA 3MMYB 1X9PA 3HBLA 1D1AA 4AG4A 1VQ4I 3TEDA 4UFKA 1TWAJ 2VQUA 5DV5A 2VW1A 3WNMA 1DUXC 2Z1DA 5TJJA 1WCKA 3MN2A 2DT6A 1HSTA 4CEWA 2COBA 4NO4A 4UVBA 3VV1A 5BY5A 1RUI1 1LGNA 3H8XA 3IWZA 4UFJA 1AR72 3IB3A 4F55A 1YI7A 3QQAA 5CFCC 2OZUA 4B48A 3K4AA 1UZZA 2PHRA 4YARA 2EXKA 2DFEA 5JI7A 5J1YA 3GVAA 5EPAA 2R7UA 4GAZA 3CESA 1LCLA 2A69F 2DTWA 4KJZA 1RYYA 4HG6B 1CX1A 1P4XA 2WFF1 4V2WA 4CP0A 1W5SA 2R5YB 3DPRC 4GJYA 2DUOA 3R60A 1UYPA 4BJ6C 4JHTA 2F5EA 1PO21 3VKLA 2VIXA 1LEMA 3KSCA 1XNCA 2WY8Q 1RR8C 4Q47A 3O2PE 3GCXA 2PQSA 3ZN6A 3ZXLA 1ZA7A 3D1NI 3C7FA 4P1WA 4XTPA 3TQNA 1W9TA 2OAZA 4BUPA 1QDCA 4IV3B 3AKPA 1V6MA 4GMP0 4PJMA 3L00A 2BZTA 1VTNC 2JECA 3BALA 3ZFGC 4IXAA 1RUE1 3S2DJ 3RZDJ 4JVAA 1DFQA 3CQZJ 3GBFA 4B8EA 2DDAA 1OBNA 1TL8A 1Q43A 4C8DA 3S30A 4CU8A 2ZSHB 3HAGA 2CDPA 4PSXA 4D7SA 3PQKA 4ZZLA 3DBLB 3DF0A 2RDSA 3V56A 2EFNA 4LORA 1UN1A 4KGQA 3FKJA 3KP4A 4BB3A 3DKWA 4XUTA 1XGMA 1ULPA 4XE9A 5F39A 2KP6A 3HYIA 4M3CE 5D2AA 2WNVC 5E18F 5EZGA 2EV5A 1BA5A 2RMU1 5FZOA 3E7LA 5C8CB 2CMPA 1YG2A 4HF2A 3N9LA 1PHMA 4YRDA 1I50J 3THTA 5FMOL 2K9LA 3JAMK 1SDDB 3K4MA 1W05A 2YUEA 1R1UA 5DZGA 4QKDA 4HNVA 1LDKB 1GFF2 2XJSA 4ZPIA 1PIV1 2VB6A 2K9SA 3FHAA 3MQ0A 1VIWB 3BOPA 1H6YA 5I8YA 4CCMA 2HLEA 3ZMDA 2O3FA 1ZBA2 5F08A 1RJ8A 4Y1YA 3VBUB 1SFNA 4C3HJ 3B6CA 2F2EA 1OT5A 2WT1A 3FUOA 4IHSA 4KA4A 5IJRA 1MJ9A 4AGRA 4QXKA 1TNSA 2JE8A 3HDDA 1T6GC 2QQIA 1JYIA 2P1BA 1O3RA 4BIFA 5F5QA 1R081 1J84A 1FC3A 3W2VA 1AX0A 2VLAA 2D45A 4GMP1 1QJZA 5I0UA 3ACIA 4CA0A 2DT7B 3ZYJB 4KMFA 3KM5A 2L02A 4LG0A 3AMQA 2EIGA 1A8MA 2BFUL 4XSXF 4COZA 4A69C 4KH9A 4ZXKA 3I3QA 3HEFA 5A7SA 4B7KA 3VZOA 3FJSA 1ENQA 4N53C 3CO7C 4P9FA 2QSHX 5CPRB 4K40A 4C0BA 2WZPP 2L01A 3GTQJ 4BDYA 4R8HA 1EH6A 5A3PA 2A05A 1YTYA 3NMBA 3AC0A 2QKLB 2HVSA 4A0YA 2HWC3 4PCRA 1MJAA 3IPVA 5LBBA 3A0BC 1NCRB 1R5ID 4C1WA 5FUNA 1YQ2A 3L2HA 1RJ7A 5CJ9A 1APLC 4ZZ5A 4ESBA 1XNDA 3C2UA 4GKXA 3BR5A 1W8WA 3WP4A 2HVRA 4RDUA 2Z2SB 4AVAA 1W03A 3A0NA 1RUF2 2JG8C 2YFZA 4Y52J 2W52A 2VZRA 5LHHA 1LKXA 5F1RA 2BUKA 2D6KA 1WD3A 1VQ5I 3F22A 1UX6A 4NQWB 1HLVA 4D8MA 2ID4A 2PHUA 1WUVA 4IEOA 2JD9A 2WAFA 1BI1A 2HDWA 4IQPA 2ZGQA 2IGOA 2C0ZA 2KFDA 1CWPA 2JX9A 1NCQB 3KWVA 4CXWA 4EN9B 4YW2A 5CG9A 1JYVA 2FBKA 2PHFA 1FJLA 2I8DA 1WA6X 2E63A 3CD6I 1WVRA 2O03A 4NRPA 2OA4A 1HXS2 1F4HA 1HQWA 3DKXA 4MEXF 1AL22 3L7WA 4E2GA 3M3IA 3UKTA 1MS9A 3GTPJ 4QKBA 4EZHA 4CE8A 2J22A 4M9XA 1QDOA 3P9KA 4Q4ZF 5GM0A 3ABTA 1OVSA 4D1QA 2RQPA 4BK4A 3A1YA 2MH9A 2CDOA 4QAWA 5IK8A 2VVEA 3D4KA 5C4WB 2PQ8A 2VY0A 5BNNA 4CDUB 3IL2A 5BXXA 1ZQ3P 3SH4A 1FYLA 1NLQA 4AIKA 3H8UA 2XC7A 4OHZA 4Q0SA 3LSMA 1BBT1 2TRTA 4JGYA 1SG3A 4FASD 2R5YA 4WBBA 2XGXA 1QQP1 2VTXJ 1OLMA 1MVQA 4Y1UA 2YS9A 2Q8KA 2ZKZA 1R1VA 5LBFA 2DBNA 1IV8A 3TP0A 3VBFA 5IK5A 5JMOA 5FP3A 1MD0A 1GVJA 1IJWC 1UPSA 2IS6A 4EN6B 2WNUC 4KNYA 3TYJA 1LOGA 2WNUA 1Z7UA 4HSRA 4Q4W3 3OB8A 2RG4A 5BMZA 3KZYA 1FZPB 1TQMA 1W5TA 1ZKGA 2QQUA 5FKMA 1RKWA 1NZCA 2YZ4A 3J80K 4I0AA 2B5HA 3PO3J 1WW7A 5L3GA 3VDCA 5H6QA 2V4VA 4B8XA 2VL4A 2FDFA 3EQEA 3K48A 4NMIA 3TB0A 3BJOA 4X8PA 4QTRA 3CU7A 4I0WB 4GO1A 1IRXA 4N9IA 5FZHA 4BNCA 2JVGA 3RIRA 4OMZA 1AR63 4G12A 5L3BA 4XQFA 3EYIA 1FI2A 4QPGC 3E6DA 2JK3A 2JWTA 3SHFA 1TT5B 5T54A 5KVRA 3LOBA 2K46A 5M3MJ 3OY9A 5IVVA 1XNTA 3TGNA 3MIBA 2D1HA 5E17F 3MLKA 2EXJA 2EILH 1MZBA 1WMDA 4FPGA 4E7IA 1F35A 4U0WA 1W90A 1CAVA 2CV0A 3DLLF 2JA7J 1VQMI 4L0PA 3MKLA 1Z0XA 2E26A 4BXFA 2CQ7A 4HVRA 5E1WA 3BROA 1SFUA 3LSDA 4QX3A 1OLRA 1PVEA 1IKQA 5GAEJ 3H9AA 2R071 1PNGA 2D5FA 4QXBA 1JXSA 4AHYA 2FDHA 1RRJA 3M2MA 2FD8A 2TEPA 3BT9A 4DW6A 2R7DA 2D6MA 2MEV3 3BZ6A 4QQPA 3AKSA 2KIQA 2GWRA 3NKTA 1SLCA 4UF0A 1SAUA 5BNNB 2NAZA 3IDAA 4NQWA 4A2UA 1IPJA 2YGMA 2M4KA 3VBSB 5CFCA 5GAHJ 3J7YJ 1VPHA 2XLFA 4B3XA 5DDJ1 1KU9A 1USSA 2ZJRF 3QPTA 3OYEA 2VT2A 2W1SA 3HQXA 3N9MA 4OI2A 5BNGA 4A3BJ 4ARYA 2LVSA 2VKHA 2ERFA 4Y20B 1PMJX 2P3JA 1Y0UA 4K21A 4YEJA 2NNNA 1GICA 4RS5A 2M34A 2Y31A 1PVXA 3I59B 4RS5C 2FJ1A 4ESJA 1PM7A 1GWLA 3HB9A 3LEIA 3OYHA 5HOOA 4B4RA 3LWFA 2OUHA 4DOZA 2DQLA 5T5JA 3QD6A 3Q0WA 2YMZA 2G7UA 1Y39A 3JAMZ 1Y56A 4UUSB 1QHDA 4M73A 1NUKA 1NA1A 5K5QA 1T2XA 1NA1C 1X1AA 3CP8A 3JCIA 2P7VB 1US3A 4MUVA 3HOWJ 1EH7A 4YW4A 4NWVA 3TO7A 4NR1A 3ZFGA 3G6JB 4AVTA 5K8SA 3WV6A 2J5OA 3VKOA 1X8MA 1KRIA 1IAWA 2YUSA 5EJZB 1NE4A 1TWCJ 4K1ZA 2P5BA 4FCYA 4RA0A 3KQ4B 1G9BA 4MG2A 1NXD1 5CAZA 5JR7B 3FLRA 3PTRB 1RUE2 4V2GA 3KVBA 2FNAA 1VBC3 4XLHA 5DCFA 4JCKA 3JRDA 1FIAA 1FV3A 1ZYBA 2NZ9A 3MO4A 5B4NA 1ZTRA 2Q0AA 3N9PA 3IRRA 4BQXA 3NWKA 1QPIA 2KXLA 1QRYA 3NAPB 4B7EA 3CJXA 1HXS1 3CZJA 3OY8B 4NIHA 2OPWA 4RR3B 2TDXA 4CRQA 5KXBA 5KR7A 1W06A 1IG7A 4ZKTB 2W7NA 5FWEA 2J1UA 5C3EJ 3NV3A 1OOPC 3D0JA 1DQUA 3QYFA 4Q4Y1 1SPPA 2XGCA 2J5PA 3AFKA 3SISA 1NAEA 5GLVA 5J6XA 5DZEA 2ESNA 3RYRA 4OIOF 4U7BA 2LRDA 3WZ1A 4CPBA 4CU7A 4J1WA 1CJPA 3OL4A 2R30A 2A6HF 1UU6A 3GYHX 4DINB 4ENJA 2Y69H 2ZX0A 5KWRA 1YE9A 5BOXA 2D3SA 5GLZA 2N8GA 3S7IA 2R5ZB 1ODMA 5C6CA 4AEDA 1MIJA 2XF7A 2BPA2 2K9QA 1WH7A 4GWMA 1O7LA 3GCWA 3WD5A 3VZKA 5IVFA 4YFWA 2EIKH 1J9IA 5F6LB 3MLLA 2V6CA 4PDKA 2VZQA 2Q8OA 3T1BA 4F91B 3USUA 4BMEA 1YUDA 4LBQD 1O4YA 2BERA 2XF6A 4N53A 4CDXB 3ASNH 4D7TA 5K7ZA 4A6EA 2A3SA 4Q4W2 4YFKF 3RDIA 2PN5A 1CF7A 2VOVA 2EF6A 2R7WA 1AWCA 3RGBA 3NQHA 5FP4A 4KGGA 1SMVA 1TW3A 2VZSA 1KITA 3KT7A 3ZIWA 1DQ4A 3WT3A 3ESWB 1I5PA 1XGOA 1XMAA 3DTIA 2DDBA 2WYSA 1A6QA 2LREA 4FPJA 2H6BA 2NM1A 4WM7B 1K78A 5D6FA 4ITCA 1UXZA 4QPYA 4CUAA 1W9SA 5CA6A 3KS7A 3WGGA 2RV9A 3QCWA 4FQZA 2HFHA 2AS5F 5LASA 4R9CA 2JRTA 1XS9A 2JG8A 1QH6A 5KHKA 4MGTA 3F6OA 1AHSA 1VE0A 2ZHMA 4BBRJ 3OYWA 3VBSA 4QGLA 4ZYGA 1BCXA 2VECA 2X48A 4QKNA 1PIV2 4G9YA 5LCWL 3MCZA 2A5YB 1KFXL 3TDZC 4LKSA 1DPRA 4BCUA 2IRFG 1GLHA 3CDIA 2VULA 1YIPA 4JYKA 2E35A 5FFZA 5M5YJ 1G8WA 1VB4A 1W3XA 1U5TA 3SNMA 4TSVA 4GDFA 3FIWA 3LPGA 2HOAA 3TO9A 2GXGA 1R58A 1ASJ1 1SD7A 4XQ4A 2JA6J 1WGXA 5AC91 1PGW1 4XSZF 1R4NB 1G7YA 4QPQA 4DYRA 4GYIA 1HRI1 2HWF1 3WG9A 2MEV2 3K4NA 2R061 2DDUA 3WTXC 1WWXA 5JSOA 4XFIA 5JVVA 3ZO0B 1HB1A 2BOLA 4BHPA 2VONA 2PLV2 1S2KA 1TT0A 2ZGUA 5KBFA 5LY1A 4WVMB 4Q4X3 2DA7A 3AJZA 2K9ZA 3LQQA 5EJ3A 1KS5A 1IOAA 4CU9A 3WDVA 2P5KA 3FZVA 1UFMA 1DQ5A 1Q8VA 1PM4A 1O5LA 2VNOA 3HXLA 1UCRA 4KIBA 1S72I 5I91A 2JA8J 2ZGPA 3AVSA 1U0AA 4J1XA 3C3VA 2DCKA 3DBHB 2XAGA 1K3IA 3OPZA 4XYXA 1AF9A 4IV3A 2R4GA 2YY1A 1IGOA 1OLTA 1IS4A 2VQHA 1PMHX 4SLIA 2JUGA 5L19A 2D6NA 5EF6A 2EAAA 3IIAA 2DU1A 2LKXA 2FA5A 4PGHA 2XH6A 2HH9A 4XIOA 1OISA 3VDDC 2ZKNA 1EPZA 1YRNA 1UY0A 1FT9A 3DYPA 1CQTA 4R9BA 2V4JC 1HRV1 2Z5WA 2CGNA 3BB6A 1CVNA 3ES4A 1QNTA 1DDLA 3VBRB 5FPBA 2GP3A 1T0FC 4MFEA 4EM1A 1ZBE3 2L9LA 1JZ3A 2R16A 4XN3A 2HI3A 1MBGA 2H1KA 4KQ7A 2EXHA 4LE3A 4JX5A 2CUJA 2X1CA 2X6YA 3WOGA 3QOEA 4JDOA 4Y4RA 1CZVA 5FMDA 1NHAA 1RXGA 2VNRA 2NVQJ 5FZ1A 4CDUC 1XSXA 1QVTA 4K9SA 1A34A 3IN9A 4A3KJ