4BYYA

Apo glxr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 65
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4byyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4byyA01
2OZUA 4MUVA 4HF0A 4I98B 3QOPA 2GC1A 2NAZA 2VBYA 5DCMB 2QVSB 4OFGA 3RJPA 4BAYA 2L3DA 2UZKA 1RNLA 1YFYA 1I1SA 3R6SA 3BCWA 5K8SA 4RB0A 2XLGA 1U12A 1UFMA 3CJNA 1NYWA 1S7AA 3HOSA 2ZO4A 3LA2A 2ISZA 4R1HA 3BPVA 1XGSA 3V8JA 2VQAA 2RDPA 4WF2A 4BH9A 1W4MA 1R5GA 1G3TA 3F8NA 3M8EA 2IA1A 1DUXC 1ZRCA 2UYAA 4MHGA 2OZJA 5ERIA 3LAJA 1XDUA 3I71A 1XB4A 3DFGA 4RGXA 5HS8A 3RNSA 3KEOA 1STZA 3P9KA 1OKRA 1FSEA 1IN5A 3QPHA 2QQ9A 4A5NA 2D5HA 3ZMSA 4LMYA 5D8LB 4KA4A 2IXCA 1J9IA 5D1IA 4EMSA 5KK1A 1O5UA 5HVQC 4LB6B 3PVBB 1J59A 4O5VA 1YTYA 4RB2C 3KEQA 4HYEA 2ISYA 3DV8A 4G6DA 3GZ6A 3TO9A 4N9IA 3RZZA 3U11A 3TNQA 2KJCA 2JSCA 2EFQA 1L0OC 2DW4A 4ENJA 5E20A 2DAOA 1QXJA 3FZVA 1U2WA 3VEPA 2ELHA 1R1VA 4FBFA 3HRUA 1F5TA 1UIJA 4HF1A 3E3VA 4HW0A 2NS0A 2XL9A 3IDCB 4HDVA 4XLPF 4BIFA 3CEWA 4BYYA 2UWMA 2ET1A 3MQ0A 4O9GA 5ILVA 1FY7A 1R1TA 4KUMA 1FBQA 1CAVB 2ZNYA 2STWA 2E1NA 4NVPA 3GLXA 5DV5A 3OCPA 3JSOA 4UBHA 1C0WA 1B4AA 4EM2A 5LGNA 4LK1F 3F8CA 4ENMA 4PGGA 2M87A 1ZZCA 2G7HA 1MD0A 2K86A 1ODDA 2NNNA 4XEZA 1NHAA 2DO7A 4Z2YA 3RYRA 2DTRA 5JSPA 2OAZA 2PA7A 2MHFA 5ED4A 1EH8A 1BI0A 4XF9A 2QUFA 4Q47A 5LHIA 2HEOA 2HYFA 3ZMTA 3M8FA 4IRGA 1WRJA 4JBAA 2XKPA 1TW2A 3RPUA 2LSOA 2VONA 2PLYA 3CTAA 1CGPA 2OQGA 4CHUA 5LGTA 5FFXA 4LA3A 2FQPA 5K1YA 2VODA 2VECA 2QLZA 3WTVC 2H0VA 4LFUA 3H1YA 5CJ9A 2F5DA 4B29A 1O3RA 2VN2A 4P5OA 2YR2A 5ICEA 1ZRFA 3QRFF 4K8FA 4AQ6A 3L09A 4A2UA 4L9TA 3VFZA 1IN7A 1PUEE 2FNAA 2X4HA 4MTDA 3EUHA 4O9EA 1MKMA 1G4DA 3KP2A 3K9TA 1OPCA 2VPVA 3MDPA 3JTHA 4LJZF 1LDKB 2PBIA 4KWJA 1O3QA 2O0YA 3GFMA 3I7DA 1R36A 4TV7A 2EFOA 3UKVA 3FWEA 1ZZ6A 2BYVE 1ZHFA 3V8LA 1L3JA 5D5WB 2Y48A 4EQQA 1ZRDA 4CYDA 1SFEA 2PI0A 4LA2A 1R23A 1TLHB 4XF1A 4BXUA 3WU0A 4I01A 5ICCA 3AAFA 4WVZA 3RKWA 2XUBA 2HWVA 5I8TA 3OTFA 5CVUA 1QNTA 5LHHA 2VC1A 1H1MA 3CO2A 2VE8A 2QM3A 5DYMA 2P7CB 5DD4A 3S2WA 2XHKA 3H7YA 2LNBA 4A0YA 2PJPA 1ZG5A 5BXXA 3R0JA 4M71A 4G8XA 2BGCA 1WWXA 1U5TA 2ETEA 4KIFA 1YS6A 4WXCA 3HSRA 2J5OA 2HQRA 2PYTA 5CVIA 4A0ZA 4M9XA 2LDUA 2FE3A 3HUGA 3EHKA 4QWQA 2QVOA 1FNNA 1I27A 5ICFA 1YIOA 5D6EA 1QQIA 1IN8A 4EM1A 6PAXA 4HV6A 4Q0SA 1V3FA 1I6XA 4KN4X 1ZN2A 2XLAA 3ST7A 2Y75A 2K9ZA 3F23A 1TNSA 1HKTA 4GYIA 3FX3A 5E1ZB 1TQIA 1Z05A 4Q4ZF 1USTA 3CJXA 2VOOA 2A6EF 1QY4A 4LULA 4WWCA 3EYYA 2BEOA 2Y0OA 2ZFWA 1KGSA 2EFNA 1H1IA 2P5LC 3WW2A 2WWYA 2KIMA 1TNTA 3HQXA 4DNCA 1V70A 1G3YA 3N97A 3NVCA 4UXNA 2PTMA 2NYXA 1E2XA 1OYYA 2IT0A 3K2ZA 1HW1A 1W7PD 1J1LA 1RI7A 3H8UA 2D1VA 2BNMA 3PQJA 1ZLKA 2A69F 2I45A 4ONUA 2O61A 2A6HF 3KP4A 2EB7A 4XF3A 4QMAA 4ZYDA 4IEUA 3VOEA 1MJAA 5TJJA 4ZU5A 3ELNA 5KVRA 3IC7A 3C3WA 4L9VA 5FPXA 4ENKA 1ZNPA 1KU3A 1XCBA 3ERED 3KP3A 1PP7U 3LWCA 2FQ3A 4DQ2A 4L5IA 3LQRA 2W84A 4XLNF 3GF2A 1OD5A 1XGMA 3KLNA 2OU2A 1CAXA 2MNGA 5LRRA 3J80Z 1T2KA 2DT5A 1QBJA 5J8CA 2QQAA 4WX9A 2GIVA 2GA2A 2ZKLA 1CF7A 2XAGA 2ZXJA 5LHGA 1UCXA 1O3TA 3SHFA 2H6CA 1I5ZA 1FLIA 4Q0UA 4RGRA 1KQ8A 3KP7A 4GXOA 3T1BA 3KLOA 4MEYF 5D4RA 2MLKA 3MPBA 3QACA 3ETQA 5C8WA 4I3PA 3G3ZA 3DN7A 2UXXA 4PJYA 4OIRF 1G3SA 4R79A 1O5LA 2GQQA 1P2FA 1U5TB 2DCTA 2MPFA 4BHBA 5JVTA 2XGXA 3DKWA 3SFZA 4YFKF 1O7LA 3COAC 4CXFA 3ZN1A 3SMHA 2MLGA 5I0SA 3MAJA 4HBLA 1YW8A 4E70A 3H50A 4LTAA 2GC0A 2VE9A 1NE4A 4KWLA 2XAHA 1FOKA 3RKYA 4ASNA 1BC7C 3BPZA 3ZPLA 1VJ2A 1ULYA 3E6BA 1ZG1A 1QGPA 4HX4A 3H3UA 2VOPA 5FCCA 4IHTA 3FM5A 4HQEA 4D0PA 1BI2A 1T38A 1FYKA 3GXOA 5E17F 4ORFA 3LAGA 2Z33A 2D40A 4BQAA 4QX5A 1SD7A 3K0LA 2AXLA 2ZBKA 1LDDA 4UV9A 2PEXA 3PLQA 2LKPA 4NB5A 3L7WA 2L01A 3SXWA 2C6YA 1NXMA 3HOTA 4X6RB 1QO0D 4U7DA 2FBKA 3E5QA 5LGUA 2DU9A 2B5HA 4MV2A 1TQPA 3JSPA 1GXPA 2GAUA 4WCGA 2OA2A 1BOAA 1IXCA 4YIFA 2QCSB 4B09A 1RL3A 2EA7A 3S7EA 3NJZA 2EV0A 3IWZA 1VR3A 2E7XA 1B59A 3U9GA 4MGKE 2PMHA 2E1CA 3E97A 3IRRA 2YU3A 1YFUA 3D5LA 4HSJA 4R52A 2DLLA 1USSA 3L00A 3D82A 1I1GA 4KICA 3M1EA 2MH9A 2Z5UA 2JPCA 2XV4S 5BV6A 4ESFA 1YLLA 2BE5F 2P5VA 3GYHX 3BJ6A 4G7HF 1JHFA 1CAXB 3T8TA 3P9IA 3MYXA 4HA8A 3ZN0A 2MD5A 3OOPA 3ROUA 3EDPA 5I8SA 4P9UA 4U0WA 1LEAA 2QWWA 3CF6E 2IXKA 5LEKA 4YG2F 2D5FA 1WLTA 2Q4SA 5E18F 1Y9QA 2CSOA 1CAWA 3QU6A 4IEXA 1SQ4A 5FLXK 2IPQX 5EZWA 2QYOA 3ZMZA 3T5XA 5J3UA 4YARA 3KP6A 1U5TC 4XFAA 3EQLF 4AQ2A 2EFPA 5ICGA 3UKNA 3NRVA 4ENNA 4MH0E 2Z99A 3D0JA 5DEQA 3BU7A 4IEOA 3JTGA 4LK0F 2IJLA 3ABUA 5CADA 4OINF 2ET7A 3PFIA 5KHKA 1ZZ9A 2R3SA 3EJKA 1ZRRA 2G9WA 3V7RA 2IRFG 4WXDA 5BQTA 1PMIA 2Z2SB 3DXJF 4FX4A 3LA7A 5BMZA 1KU2A 2XROA 2K4JA 3ACLA 4IJAA 5CVJA 2MA3A 2HKOA 3OD0A 5F64A 4IEYA 3HHHA 3C3VA 3RDIA 4A6DA 4MEXF 4P96A 2RN7A 1HW2A 3OF1A 1OYWA 5FB2A 4LLLA 3DF8A 1J5YA 4M9SA 4HAMA 4PDKA 3F22A 2DK5A 1LJ9A 1AWCA 2VXZA 5F6FA 4L0ZB 1EYBA 1UW8A 5I8YA 2KXLA 4G7OF 3GFJA 4K2EA 2HFHA 2VT3A 3HTUA 2HYGD 1GQHA 4E2QA 4EJUA 3FF5A 4HZFA 2XRNA 1HKQA 4PIXA 4XF4A 3FMSA 1T6SA 3RTRA 1MDMA 2V1DA 2M5WA 2IXIA 1B1BA 5E16A 4I0BA 2D93A 4MZUA 3O2PE 4LEJA 2XASA 2F4PA 4CDGA 1W5SA 2O03A 2RQPA 3Q5FA 3WTYC 4ETSA 3NKTA 3IBMA 3GWZA 2YSRA 2FU4A 3F6OA 1BBYA 1XD7A 2HDCA 5J7MA 3QU3A 4KFCA 5HOOA 2DPDA 2BNNA 1UCRA 4XBFA 4RB1A 3E6CC 1PDNC 1LQ1A 3I5UA 1K78A 1DGWA 1RGSA 4Q48A 4IETA 4Q0VA 3H1WA 1Z6TA 2A68F 3NL1A 2PQQA 3FMQA 1ZH5A 4CZZA 1LKNA 2HJIA 4Q0PA 4YNIA 4AVCA 4FAHA 1ZGAA 5KHJA 3I59A 3WTUC 2DQRA 2O8XA 3WODF 5D8KB 1CAWB 2FF4A 1EH7A 1UB9A 1KQ9A 4EGYA 2GC3A 3P9CA 2H6BA 3TNPB 4IERA 4F7ZA 2RGVA 3J80K 4O3MA 3WTWC 4ZYHA 3DL3A 2JT1A 2H94A 3DEUA 1J75A 4H0EA 4UXAA 1P4XA 1SD6A 3OGJA 1IXRC 4QLCU 2CFXA 3JAMZ 4AXOA 1JHHA 4BHCA 1JXSA 2M1BA 3HRTA 4AVPA 3CUQA 4MGIE 2MC3A 4HBNA 1XSXA 5D5XB 4D7TA 5D5UB 2X0LA 2HS5A 2IXJA 2WTEA 2N7GA 1GQGA 1E17A 3IWFA 2P6TA 2IXLA 4IVNA 2PFBA 4EWEA 4HDUA 1K6OA 1OYIA 4HV5A 2VBZA 3RI4A 3WTSC 2QNKA 1X82A 2MH2A 2MBFA 1B6AA 2O6GE 3EETA 3GX4X 3BROA 4P9GA 3FXQA 1PM7A 3ZP5A 3SCHA 5HI0A 4RS8A 2A61A 3LOIA 4HX7A 1D3YA 5E8IA 1X7NA 2P6SA 5I91A 2RKHA 2FBHA 1MDMB 1BI3A 5CVRA 1LR5A 5JFRA 1AOYA 1SMTA 1R00A 5KHIA 2DFIA 1WSUA 1IUYA 1S29A 1IRGA 3SHRA 1ON2A 1TQMA 3BPXA 3M9AA 3E5XA 4PGHA 4KYWA 2Q2EA 4EGZA 5HS7A 1D8JA 3JW4A 5FDBA 3M70A 4ZU4A 3TDZC 1Q3EA 2L54A 3ZMVA 3J81Z 4JQFA 2Z69A 4YFNF 1WKMA 2XAFA 4KMFA 2Y0MA 4YIIA 1DZTA 4FAGA 3SZPA 1T98A 2PMUA 3U1DA 3ZMDA 4X6QB 2VBWA 1J2XA 2GU9A 4I09A 5CYVA 5KBFA 1REPC 1K78B 4MGYE 2E7WA 3NSTA 3FM3A 1R1UA 1TW3A 3WTZA 4MQ9F 1WA4A 4EJTA 1BI1A 1LVAA 1ZGJA 2PG4A 3RIRA 1MZBA 1W7PA 4CO8A 5L3DA 4HLYA 4PIYA 5IT3A 5L3CA 2KIFA 1GVJA 4E2SA 2PFWA 3HRSA 4MX3A 2DK8A 1S7OA 2FMYA 2XL7A 4KDPA 1JE8A 4IXAA 3M7GA 3QAHA 1SFNA 2HZTA 2ADUA 2BNOA 1FYLA 1IN6A 2BV6A 1SFUA 3ES4A 4GULA 1UPIA 3BZ6A 5F1RA 1IW7F 2QBYA 2J5PA 3HYIA 4KNYA 4HMZA 1UHMA 1YFWA 1B9NA 2GA1A 3FHIB 3WGIA 1R22A 1GXQA 4WXHA 4XSXF 3G7DA 2UY9A 1H9TA 1ZVFA 3CUQB 3DPLC 2VT2A 1VP6A 2CAUA 2F5CA 5H6QA 5LRSA 4QXKA 4HOBA 2TDXA 1L3LA 2HKXA 3R0AA 1XGOA 3WGGA 4ZYEA 4Y17A 4AVBA 5HS9A 5A2QZ 1ZZ7A 4IEZA 3Q9VA 1WI9A 2OBPA 3ULQB 4KIGA 1TQ5A 4HN1A 4D7SA 5DDGA 1CAUA 1JUHA 3NW4A 4DINB 1YUDA 3EQEA 2JRTA 5D4SA 1VTNC 1SD5A 3HSFA 3BOQA 3ML6A 2WFPA 4UNOA 5H20A 4Q5SF 5LBQA 5TRDA 1NE6A 1XMKA 2FEZA 3R4KA 2PAMA 3D0SA 3LFKA 4TLFA 1R7JA 3BY6A 1DDNA 1UIKA 3CDHA 2QDRA 5E1XA 3WE3A 5BS6A 4EJVA 3F21A 4A12A 1KYZA 1S3JA 4HSLA 1KU9A 4M74A 2PHLA 3HRMA 4F8AA 3QP5A 3C7JA 2JTVA 1IAWA 3N4MA 4M6YA 4PCQA 2Q0AA 3FMRA 4L0YB 1DP7P 1XE8A 5BPXA 2PAKA 3EYIA 3I58A 4L2NA 3WTXC 4ZU7A 5C6CA 1FI2A 1WQ2A 1KQ0A 5KHHA 1YWKA 3WG9A 2OZ6A 3EBRA 1Q5OA 1KU7A 4ZZLA 1YW9A 3DP7A 3HTSB 2ZNZA 2IA2A 3KCCA 4IEQA 1FPQA 4M9ZA 2FXAA 1HW5A 4LUMA 2UYBA 3F8FA 3KFWX 4YYOA 4XFGA 3O6BB 1UD1A 1EV7A 1W7PB 1CX4A 3H7JA 3EO6A 2D2WA 3UKTA 2B9UA 4L11A 5FLIA 3ZMUA 1PP8F 2FNPA 2OA4A 3CLPA 2RNJA 5J6XA 3WGHA 2RVCA 4G94A 3GEZA 2EJRA 4UBGA 1X8EA 2K4BA 3MFKA 3BJOA 3SCFA 1HSTA 3I0TA 4G9YA 2Q0OA 2QENA 4O6JA 2QBYB 4LLOA 1XSVA 1ZREA 5DUIA 4JTOA 1Z6RA 3DQVC 3CO6C 4AIJA 3C1DA 3CUQC 3H9AA 3ES1A 5L3EA 3ECOA 5FGMA 4ESBA 3K1NA 2DI3A 1XDSA 4M73A 3CO7C 1RC6A 1MJ9A 1ZG3A 3SQNA 3SCGA 2HTJA 5HDGA 1HSJA 4HVRA 3ABTA 2B8MA 1WGPA 4GYGA 2A07F 1F1ZA 3S7IA 2XKOA 3V4GA 2Q1ZB 1ZYRF 1OR7A 2ZCWA 3FJSA 3VB2A 2O8QA 2FOKA 4IRHA 4RD7A 5AIPA 1IN4A 4MTEA 1YO5C 4S05A 3JAMK 1CF7B 2K0GA 1P4AA 5BY5A 3GO5A 3FHZA 1CAUB 5L3BA 1DPUA 3IHUA 2CAVA 2PN6A 4NQWA 4HVQA 3K69A 2KJBA 3Q9SA 3PQKA 4HX8A 4KN7X 4J1WA 3RKXA 3HT2A 4FX0A 1G3WA 3KE2A 4EWAA 4LUKA 4OIOF 5HDKA 2GXBA 4XETA 2RV8A 3WW3A 5J8FA 2HQNA 1J7KA 3U0ZA 3K1PA 1P6RA 4U0VA 4XF0A 2CQKA 4ZYGA 1XN7A 2A3SA 4M72A 2V1UA 1ZZ8A 1Z91A 3TOBA 1RUOA 3CLOA 2L4AA 1RZ4A 2CGPA 1Y3TA 1YLFA 1IXSB 4AWXB 5BPDA 3JZVA 4A0XA 2UXNA 1T0FA 1IZ1A 1Q1HA 1YFHA 5DUKA 4Y15A 1F4KA 2R7DA 2IP2A 5E8GA 2Q30A 1B9MA 5FO5A 4QGLA 3WE2A 3HSEA 1KYWA 2P4WA 3K1MA 1BJAA 1U6GA 2FA5A 2ESHA 1K79A 4WK8F 2WC2A 2OPKA 2HR3A 2P8TA 2UY8A 4JK1X 4BHPA 2YX7A 3WW1A 1ONVA 5BPIA 1BIBA 3J81K 2ZKZA 4LGWA 3V7CA 2M45A 4RGSA 3R60A 3F72A 2ACJA 4U88A 4KU8A 3RYKA 3F6VA 3ISPA 2RC4A 5AIQA 3PNAA 4LLNA 1J3RA 1QWRA 1V4RA 3C18A 2AS5F 2K7LA 4G7ZF 1LEBA 2IXHA 1Z1DA 2NRAC 2C0ZA 2Z9OA 1H0MA 4OU0A 2F2EA 1TTYA 2DQLA 4L9NA 4ON0A 4B8XA 4BNCA 4IPAA 3KMHA 1FWZA 3GUDA 3BWGA 3S0MA 1FSHA 2GC2A 1YFXA 5HLHA 2EV5A 2W24A 3GBFA 5CLSA 4AIHA 2B0LA 1X3UA 1D5VA 2LF8A 4EROA 4FHTA 3H1MA 1HXDA 5ILUA 1GHCA 4KL1A 3HIFA 2DBBA 1O4TA 1QXRA 2HOEA 3E6MA 3QP6A 5CVVA 2E9QA 3F8BA 2PQ8A 5JCTA 2IA0A 1OFNA 2IC1A 1J3PA 3KGZA 4EJOA 5I93A 2EWNA 3ZQ7A 4XFFA 5FPZA 5E1WA 4LLGF 4QM8A 1J58A 3WTTC 2P17A 4UVBA 3G73A 4IESA 4P55A 3V7SA 2O1QA 5HDNA 1YYVA 4META 3O3KA 5IT9Z 2JPBA 2XAQA 3L2CA 5JSOA 2KRFA 4MQVA 4H7LA 2L02A 4OMYA 5A2QK 1G6NA 3TDUC 3IDBB 3IKTA 3I4PA 4WBBA 5E1RA 4HF2A 4HN0A 5FFZA 3E5UA 5DD8A 1MJBA 1Z9CA 3V8KA 1FP1D 1BN5A 1FXZA 3TQNA 4Q0QA 3L9FA 4U0YA 1Q43A 3IL2A 4XSZF 4L18B 1MGTA 5BOXA 3LA3A 5AVPA 2KKOA 3TGNA 1BC8C 3H92A 3VHRA 4RAZA 2PAEA 1EH6A 3ZDSA 3P7NA 4UHTA 1LB2A 4OIQF 2GZWA 2ESNA 3BP8A 2ETHA 2WV0A 2XLFA 2CG4A 3I54A 4RB3C 1IRFA 2R7FA 4UUVA 4EM0B 1DGRA 5FLXZ 4E2GA 2D1HA 2YPRA 3KGLA 3F3XA 4ZH4F 5EEHA 5EEGA 4Z07A 3IKVA 4GCVA 5D5VB 4IHSA 4QM9A 4RGUA 4I0AA 5KHGA 1R5HA 4IRIA 1S6LA 4P9FA 4AVAA 1ZAOA 1TBXA 1YS7A 3RPQA 4KU7A 2M30A 2V09A 4J1XA 1U8RA 2QJVA 1W5TA 1DPRA 1O7FA 1EY2A 4YFXF 1BM9A 1A04A 5JR3A 5HLGA 3USSA 4YRDA 1JGSA 1J3QA 1ZZBA 2DPUA 1FC3A 4HVOA 1U3EM 4NHJA 2FSWA 1O3SA 3U2RA 3GZ5A 4OLLA 1KA8A 4KIBA 2IW5A 2W85A 3BDDA 3WW4A 5BUVA 5FLHA 1ZX5A 4MGRA 1YHFA 1K7AA 4KMUX 2VC0A 2FRHA 4I7HA 4N0BA 1FP2A 5AONA 4LB5A 3TKYA 4I02A 2M8EA 3T8RA 2OD5A 2L4MA 2OYZA 1F9NA 3LWFA 3LQQA 5L3GA 3I59B 4HLTA 4XFCA 2QQBA 4JV4A 4XFIA 2XAJA 3DPTA 1FYMA 4IEPA 2BBYA 4AD9A 5H6RA 1SD4A 1S8NA 1FZPB 1X8MA 1XCVA 4JTNA 1HKSA 3O14A 2PHDA 3SZTA 2ZMEA 2W25A 3REOA 2QZ8A 3H3ZA 5FQ0A 1XRUA 2XVCA 3FZ3A 2EAAA 4EVIA 3BJAA 3RYPA 2K02A 3KSCA 3BB6A 2XIGA 2GXGA 4I2OA 3MZYA 2P7VB 3HT1A 2H09A 1QZYA 2O3FA 1LNWA 4ESJA 1R58A 4XFHA 4N9HA 5FLJA 1YG2A 2F5EA 1J0RA 3LSTA 1IPKA 3TO6A 4L5JA 5J48A 3W6KB 2EA2A 5D6FA 3SXYA 4LG0A 2F5FA 3MEXA 1ZARA 4RAYA 3BALA 1Z7UA 5LEJA 2EFWA 1FBSA 4OOIA 2G7UA 3J7AO 1ON1A 3TO7A 1O57A 3FFQA 4AIKA 4GGGA 3NEUA 3KZZA 1D8KA 5LLQA 4Y13A 5I0TA 1ZLJA 1RIOH 4GO1A 2IVMA 2EVXA 3QPTA 3MCZA 3KETA 4R8HA 3TOAA 4WZCA 2CV6A 3MZHA 4U7BA 5DCMA 4IEVA 2VBXA 4EV0A 1OMIA 3GFIA 3CL1A 3NQOA 5FD6A 2YX4A 4PIZA 5L3FA 1SEFA 4MGZE 4HQMA 1LRHA 2V79A 4LD5A 3I53A 2CO5A 4XRFA 3U10A 1Y0UA 3KZYA 4A6EA 1HBXG 3B02A 5I0UA 3GFLA 2OQRA 2GH2A 3E6DA 4OMZA 3FXRA 1XSDA 4Z82A 2CWEA 4HLXA 2FMLA 4FT8A 4EWDA 2LF7A 1UHWA 1U78A 1FX7A 2H27A 5JSRA 3GVAA 1BIAA 3M3IA 1QPMA 1FBUA 1FT9A 5DCFA 4KT5C 5HLIA 2Z3YA 2V6CA 4G6QA 1NZCA 1OI6A 5CU1A 2STTA 1T39A 4QGMA 4IF4A 2HTSA 4L9JA 4PZJA 5K5RA 5FD5A 2HGCA 3ECHA 2P5KA 3F8MA 3IRQA 4CICA 5JI6A 3ELKA 4QGNA 3W6JB 2D45A 4KWKA 4S04A 4Q29A 5T3NA 2NNYA 2GWRA 3T0YA 1RTVA 1SMYF 1QZZA 3WU1B 3KP5A 1DZRA 3LZZA 1HQCA 1XGNA 3FE5A 2V9VA 4MNUA 5JR7B 3I64A 2EV6A 5K5OA 5JHUA 2ZMEB 3FXUA 4UVAA 2Q8KA 2W57A 4UV8A 3IIAA 2EA4A 1XE7A 5FQ0B 3MWMA 3LAPA 1EP0A 2CW0F 5JAXA 2V1XA 1EPZA 2JZYA 3R61A 2ZJ2A 4XFBA 2KIUA 4ZZDA 5I0RA 2EK5A 1SAXA 1YW7A 2COMA 1SFXA 1YQAA 4JVAA 2K27A 5IT9K 1LDJA 1RUNA 5EFUA 3HHGA 4CGZA 3VODA 2A5YB 4A5MA 1XMAA 4UVCA 1P92A 3GYDA 4M6XA 3CUOA 3OV8A 4EJWA 5ILSA 4LG0B 1CAVA 5K5QA 2CYYA 4YSFA 3GW2A 2FBIA 1H9GA 1IF1A 4IEWA 1P4WA 4OIPF 1IPJA 3L2HA 3B73A 2ATFA
chains in the Genus database with same CATH superfamily
3MLJA 1EV12 3LPFA 2Y6FA 3O8HA 4RM2A 1ZKGA 3QOPA 4HPKB 1W9WA 1UY3A 3RJPA 2LTNA 2UZKA 1OUSA 1RNLA 2NP0A 5B1BH 5IVVA 5K8SA 4F93B 5EJCA 2XLGA 1S5LC 2R0FA 4B4QA 1UFMA 5FMOS 2LY2A 3ZXLA 1RPWA 4RGAA 1C28A 2VL4A 2JK3A 3V8JA 3AXDA 4XN0A 1BHGA 1IHMA 5FZ0A 1ETYA 2JG8C 4Z2AA 1VQ7I 1G3TA 4JQTA 5FPVA 1W6QB 4OUEA 3ZYRA 2IA1A 1G9CA 4PK4A 2VVDA 4MHGA 4AIDA 1PK6A 3LAJA 1QJY2 1XB4A 1LE8A 4DS0A 2WZ8A 4M3DA 4RGXA 2HWF1 2XVGA 4S2GA 4XTPA 3G6JB 1XC5A 2VCCA 4QX2A 3QPHA 4A5NA 2QQ9A 1VMFA 3G1LA 4LMYA 4A3BJ 2YDEA 1ALYA 5FYVA 4EMSA 3RWKX 3S17J 4CCMA 4BS9A 3MUY1 2R93J 5HVQC 3SH4A 2JEMA 3K6GA 4ITCA 3KEQA 4CXWA 3DV8A 3LFMA 3U11A 3TNQA 2M0MA 1IDZA 1L0OC 2DW4A 4JRLA 4CDQB 1QXJA 1U2WA 4XMIA 3MUZ1 4FBFA 2HXOA 3U1XA 4LMFA 3AG4H 1AJOA 4FI9A 3AB0A 3E3VA 2XL9A 4GB31 2E1MB 5GTIC 1XNDA 4AU7A 1HJFA 2WSUA 1CR7A 4BYYA 1RUG3 2ET1A 4YVSC 3MQ0A 1QIQA 5LCWL 3OYEA 2MSYA 1C5IA 2ZNYA 3AZYA 4K1YA 1QH6A 1MZ6A 5JOXA 3S15J 5F7UA 1EV11 2ZHKA 5IJRA 4XAEA 5LGNA 2XG3A 4EN0A 4ENMA 4NQWB 3AVSA 2M87A 2G7HA 2K86A 1ODDA 3POGA 3HR9A 1VQMI 5IP9J 1QJX2 4D6QA 3GF6A 1ODNA 4Z2YA 2DTRA 4TYSA 3A22A 5C4WB 4M3CB 1RUC2 4Y1ZA 5IYYA 2Y33A 5GZGA 1BI0A 4Q4V2 4MLOA 3HVDA 2DFHA 1FOYA 2R7XA 1ITYA 4N4NB 3ZMTA 4KMQA 4IRGA 5A1LA 3R4DB 1TW2A 3RZMA 4ZS2A 2LSOA 2VONA 5F0CA 4QWNA 3CTAA 3LGRA 4RLQA 3GDBA 2KZVA 2R5YB 3MIEA 2BVVA 3ZLIA 1ND3B 5FFXA 4LA3A 3IDEA 2QLZA 2H0VA 5IK4A 1J1TA 2F5DA 4B8EA 1QJY1 4BY1J 2YR2A 2DT7B 3OYDA 1ULGA 1ZRFA 4NAMA 3BR5A 4AQ6A 2E7QA 4LHKA 3H8OA 1RR7A 2Y26A 1FV2A 4D6RA 3BI3A 5FREA 4LIVA 1NLRA 3WEZA 4AQSA 2DN0A 5BNNB 4NC6A 1JODA 3VDCA 2SBAA 3ZYIB 1MS4A 4AK3A 2O0YA 3RMYA 2OUHA 1O4ZA 4L97A 3UYJA 3S3NA 5E89A 4YG3A 1IG7A 1ZHFA 3CHXA 3JREA 3ACHA 4R9BA 5D5WB 3D8CA 4CDQC 1ZRDA 4FTHA 4CYDA 3NJVA 5IVBA 2PI0A 2YS9A 5DZGA 2RDSA 4I01A 3RKWA 2OUMA 2XUBA 2HWVA 5K9YA 4UW5A 2E1MC 1K42A 1EPWA 3OTFA 5CVUA 5EDNA 4NIGA 3MV11 4UYBA 2VC1A 3MF6A 1AR62 1HA8A 3CO2A 2YUEA 5DD4A 4ATFA 2VPRA 1ULOA 1TME3 1QJZA 3PURA 2YUSA 4G8XA 2ETEA 4KIFA 1H8AC 1O8SA 3ZXSA 3HSRA 2HQRA 2LALA 1X3ZB 2PYTA 5CVIA 1W8TA 2CV1A 2P34A 2LS6A 3G71I 2WT1A 4BK5A 1YIOA 2FZ2A 1JU4A 2DFCA 1QJX1 1MVEA 4NIDA 3K2OA 1WD4A 1SCSA 3BOPA 5C4WC 2HWD2 1ZN2A 3NV4A 2L9SA 3F23A 1RUC1 2HOTA 4Q4V1 3WCSA 1GBGA 4Q4ZF 1USTA 2VOOA 2OQ7A 1QY4A 5T50A 4WWCA 4NC8A 2W82A 3OBAA 3I8TA 5F3GA 2Y0OA 1KGSA 3G1OA 2EFNA 1H1IA 1HN0A 3SYTA 3PUFA 1ND3C 4CUBA 1Y7BA 3S30A 1TNTA 3ATGA 3NNGA 2DV9A 1C4RA 3OYWB 2XDVA 5J09A 3CP2A 4ZDLA 2IT0A 4R9DA 1HW1A 1DGRM 1J1LA 3SH3A 1ZK8A 2BNMA 3PQJA 5E3OA 1BQPA 1ZLKA 2P4EA 4BGDA 3GBGA 2I45A 2J1AA 3IIIA 2HWB2 4XF3A 5FZLA 1RMU2 2EXJA 1SFOJ 1FTTA 3ELNA 2LH9A 3QD6A 3C3WA 3WP6A 1ZNPA 3IH3A 1X9TA 1WJBA 1LJ7A 1KZHA 2W84A 2VNVA 4FTEA 2WAAA 3ZX7A 4AFMA 2RS33 1H89C 4A44A 2MABA 5EXOA 2NMOA 4ITVA 5FXWA 1C5HA 1EAH1 3APBA 2L0KA 3MO4A 1XE0A 2G4IA 1UCXA 1N47A 4W97A 2H6CA 2AO9A 3HXLA 4A41A 1KQ8A 3K75B 3KP7A 2DA5A 4GXOA 1NUKA 1AR61 2A6TA 3KLOA 1WW4A 1DGWY 4RGKA 4MEYF 2YC4A 2BGOA 4QIWN 1KQRA 5LD2C 4W6XA 5C8WA 2WZR2 4HL0A 3VPRA 2UXXA 1DQ4A 1UY0A 2HWC2 5K4LA 2KPMA 3DEMA 2DCZA 2IS4A 4I0WB 5DXDA 4GA9A 4BHBA 5GLWA 3GCXA 1CONA 2R7OA 3COAC 3KLSA 2D43A 2QQLA 4UFKA 4QX7A 4V2FA 1OF3A 4RS5B 3LSKA 4HBLA 1DDLA 1RESA 4MGSA 4LTAA 3MIBA 1XPXA 5GLTA 2HWD1 3NWTA 2IZWA 2E31A 2QKMB 5FUPA 4BQYA 5LA2A 3WP5A 4ASNA 3ZPLA 3PO2J 1ZG1A 3X29B 2V26A 4BJ6C 3MW2A 4C1WA 4QX8A 1MS5A 4HQEA 1BI2A 4GD4A 4ATEA 2D40A 4L92A 4BQAA 4QX5A 3AM2A 1MMSA 4UV9A 2PEXA 4YZ4A 1V6IA 3H0OA 2CUEA 3HOTA 2W48A 5M5YJ 2FBKA 2DU9A 1TQPA 4WCGA 1IXCA 4N43A 4BB3A 2HWB1 2EZIA 5K0UA 5B3SH 2RJ2A 3NJZA 2EV0A 3IWZA 1RMU1 1VR3A 2PXJA 3W5MA 4QD2A 3NV2A 5J1UA 3EUHC 1ORKA 1NA1A 4BA6A 3D5LA 4HSJA 1NG7A 3AFKA 1OQYA 2ARCA 1T33A 1LHUA 4R52A 4Q4Y3 2WQZC 3A0BC 3D82A 3AYEA 1VBC3 4LKSA 1IRXA 2XV4S 2HVSA 1WJFA 2BE5F 3GYHX 3BJ6A 5FZ7A 1H88C 1QA6A 1JHFA 5JVGF 3WF3A 4LG3A 2Y38A 3TEXA 3ZN0A 1OXCA 2MD5A 1QOTA 1AXZA 2V5YA 1V6KA 1JOPA 4E27A 4XC9A 3AC0A 2VJIA 4BJ0A 1HLCA 2HQAA 1DLLA 5FWEA 4BQ1A 3OOUA 4YG2F 1Y1WJ 1RXGA 2CJJA 2ZGUA 3WINE 4COUA 2R30A 2WZR1 4W65A 2XJPA 2IPQX 4BOWA 2QYOA 2YPDA 1X3WB 4HSTA 2HQ5A 3PSIA 2EFPA 1DYOA 4ENNA 1RUE2 5DEQA 4G9SB 1PUFA 3BU7A 4IEOA 5FUIA 4RS5C 5CFDA 4OINF 2XJSA 3BR2A 3PFIA 5CBLA 3JR9A 5LK5A 4EEFG 3HZJA 4KNCA 2LG4A 3H3LA 2HNHA 4FP3A 4MO3M 4EE2A 4H7MA 2CNAA 2Z2SB 3I2KA 1Z78A 4BU2A 2XROA 1FOXA 4YM2A 2WS92 2ZA9A 3ACLA 4IJAA 1WWYA 1MH4A 2HKOA 2W4SA 4A3CJ 1PIV3 3RDIA 4CA9A 3ETPA 4UW6A 4Y20A 2RN7A 3B7MA 2WAQA 1OYWA 5FB2A 2G9GA 2CUJA 2ZGLA 4IQJA 1Q8OA 4HAMA 3DYOA 5EYXA 1YQ8A 5I8YA 3FL7A 1QNYA 3FBYA 4G7OF 2LK2A 3GFJA 1MZFA 4K2EA 2HFHA 2VT3A 3HTUA 2HYGD 5B5EC 1H8TB 1GQHA 1JKRC 2VW1A 4CP9B 4MHRA 2OCCH 3M4FA 4I3GA 2RS12 4AW7A 3RTRA 3W6VA 4LR4A 2M5WA 2IXIA 1B1BA 4HONA 3WUDA 2F4PA 4CDGA 1D5YA 3OPTA 4O65A 5JPNB 3NKTA 4R4ZA 4G6TB 4OQ8A 3M8LA 4QPGB 2ZXWH 4FOVA 2HDDA 2HDCA 1XD7A 5J7MA 4KFCA 5HOOA 2DPDA 2BNNA 1W5CC 4LBNA 5L19A 4EZHA 1D1BA 1N75A 2ME6A 1K61A 3I5UA 1LQ1A 2GSYA 1DGWA 3BTIA 4IETA 4B4RA 5FBZA 3OMYA 1GU3A 1FIAA 3OYIA 1YJWI 1ZH5A 4YNIA 4DEQA 1ZGAA 1BEV2 2JIJA 5A7WB 1HRV3 2ZBJA 2O9LA 1K4SA 4HRIA 4DUXA 5D8KB 4LKFA 5LFAA 3A01B 1WCKA 2AGSA 3P9CA 4OAZA 2QQWA 3S5AA 4IERA 4FXGB 4O3MA 1RUE1 5M3MJ 1RITA 1QMJA 3DL3A 2H94A 2OS2A 3DEUA 2JE9A 3RRDA 5I0DA 5L7OB 1LCLA 2VXDA 1W0OA 3OGJA 1ZRIA 2R49A 2CFXA 3PNTA 1DQ0A 2FHRA 4ASMB 1W99A 1JHHA 2PMZN 4BHCA 1JXSA 2M1BA 4J01A 1WCUA 2WNUB 2X10A 2YXSA 4JZRA 3VZOA 3NNJA 4XHBA 2M9HA 2MC3A 5J40A 4HBNA 2VZRA 1BJZA 3OEAA 4MYEA 2V4JC 3T4VA 4XL9A 2N7GA 2WS91 1GQGA 2CU5A 1E17A 2IXLA 3CNAA 4JQRA 4PSXA 3OYGA 1D0ZA 4HDUA 4LBMA 1U8BA 2W00A 3RI4A 2QNKA 2DA1A 2MFZA 2MBFA 4Y5Z0 4ASKA 1CD3G 3WHBA 4IOCF 2PHWA 5DAQA 2JDYA 3ME2A 2IGNA 1W2AX 3SJMA 3GX4X 3BROA 4P9GA 4AI0A 5FLMJ 5JXJA 3ZQCA 1H8TC 4E6KG 3ZP5A 2R1DA 5KAIC 3BG7A 5C9AA 2CRGA 3SEPA 2RS11 4KQ7A 4JHZA 3VDDA 4W50A 5F0FA 2CL2A 3WHTA 2VASA 5JFRA 3RS6A 5KHIA 2DFIA 2V9PA 1WSUA 2FMDA 3K3OA 2VZTA 3CDLA 4QDRA 4OQ9A 3RVHA 3E5XA 1MS0A 3GTOJ 4Q4W3 4AVSA 3CLQA 4JX4A 1X36A 2WWSA 5EPAA 3SZGA 4QQ2A 2Y0MA 4FAGA 1OHFA 4EN6B 2ZB9A 1T98A 3U1DA 4L9BA 2VOKA 1J2XA 5KBFA 1BR4A 1RHI3 1H0BA 1JMUB 3DYMA 1R1UA 1TW3A 3WTZA 4MQ9F 3TMOA 3FXKA 1BEV1 2R7WA 1LVAA 1W7PA 4CO8A 5L3DA 4XKBA 3JD72 1G9DA 3HQUA 2D44A 4KG8A 1S7OA 3QYFA 5DUUA 1SC7A 2ENRA 4IOAF 3HOZJ 4HG2A 2E2JJ 5GADJ 2HZTA 1E3HA 5L7OC 2BNOA 1JT6A 5IVEA 1SFUA 2K9QA 1OQ1A 2VMFA 3F0CA 3ZPYA 3THCA 4KNYA 4HMZA 1YFWA 2WNUC 2GA1A 3WGIA 3W2WA 2PLV3 1DQUA 4XSXF 1GXQA 2YG0A 3GZEA 1AVBA 4XDOA 4XORA 2HWF3 1AR82 3DPLC 5IFTA 2WY8Q 3C7GA 4QXKA 5GAEJ 3PTRB 4XUQA 4QPIA 1M1EB 5A3TA 2GP5A 1J83A 5HXVA 2DA6A 1AHSA 4AVBA 3OGGA 2TUNA 1MR5A 3VV1A 2CU7A 1HN1A 1LEDA 2OBPA 4XURA 5APAA 1MMDA 3I4NJ 3NW4A 3ZXAC 1KGYA 2W1QA 2GOMA 1CZTA 3V56A 1SD5A 2WFPA 1A36A 3AZVA 2OW4A 5F3CA 4UNOA 5H20A 4Q5SF 3OD4A 5TRDA 4D0QA 1NE6A 2ECBA 2X09A 1NT0A 1X19A 4GB33 2VUAA 5F37A 1OCTC 1W6OA 1ZBA2 3CDHA 2QDRA 2DTYA 3I4IA 3HRMA 3J8F3 2JTVA 1IAWA 3N4MA 1LHVA 4NIAA 4M6YA 4FFFA 2Q0AA 2Y6HA 1SVLA 5A3LA 2VIXA 2TEPA 3VBFB 3WTXC 3B5LB 1FI2A 3ON7A 1KQ0A 1EV13 5KHHA 2K9LA 3OYLA 2OZ6A 2ZMLA 1Q5OA 2VW0A 4ZZLA 4BQ3A 3HTSB 2ZNZA 2IA2A 3PUSA 3WG1A 4P1WA 3AZXA 4Q4X2 2FXAA 1HW5A 3KV6A 4GRIA 1SBFA 3F8FA 1BW5A 3KFWX 4F92B 1DZQA 3ZN6B 3JD71 4IE4A 5KAFC 5FO8B 2CS3A 4RBOA 1GP5A 2D2WA 3ZQQA 1JZ5A 4L11A 1LFBA 1HRI2 5D8AA 5FLIA 4Y26A 1O8PA 2PHXA 1UYXA 3OSFA 3CCMI 2RVCA 3V65A 2R7ZJ 3GEZA 4ARYA 4UBGA 1V0AA 2K4BA 3OYKA 4D94A 1HSTA 3I0TA 4F91B 1HXS2 1RKWA 2QENA 3BTZA 2LRPA 1ZREA 1Z6RA 3DQVC 3WHUA 3C1DA 3PNYA 3ES1A 1AR81 1KD7A 5FGMA 4A69C 5AC92 4DZPA 2W47A 2DI3A 1XDSA 3AG2H 1ZG3A 4AHYA 3SCGA 4U2AA 5HDGA 1HSJA 3B6AA 5JLVA 2DFFA 5A3NA 2A07F 3BN6A 3BCBA 4IW3A 2LRDA 4R9CA 1MACA 1KITA 1ZYRF 3P3NA 3FJSA 2UWCA 3POEA 4WM8A 4OHXA 1T56A 4BLIA 4IRHA 2WO2A 2LD5A 2HXIA 3QPLA 1YO5C 3HD8B 5A3PA 3K77A 3GO5A 4S0HB 1W8FA 2KM2A 3IHUA 3GJBA 2CAVA 2ID3A 1QHGA 2FDHA 4ZYAA 1Y1VJ 4K1ZA 4HX8A 2E5ZA 3AP4A 5FYBA 3MBWA 2ZXHA 4FX0A 3OPWA 4YW1A 2ELJA 2P81A 1ZBA1 1G3WA 2WLPA 4EWAA 5HDKA 2RAEA 5FMCA 5IVFA 2HQNA 1J7KA 5F5AA 1YHQI 2IVIB 1ULFA 4XN3A 1VQ6I 2BV4A 5KXBA 2A6YA 2XMLA 3VBFC 3T2TA 1AL0G 4YZ5A 2CQKA 4M72A 3KVAA 1ZZ8A 2AH2A 4C2MJ 3GMEA 3VDXA 2X6YA 4IQPA 3MD2A 4B48A 5BPDA 2YV8A 2O5RA 2UXNA 4Q4X1 1QJX3 4KJZA 5FKNA 1IPSA 2VJ5A 1RUC3 3H8XA 4KI5M 4Q4V3 1B9MA 2QQPA 5F27A 1VMJA 2XONA 1KYWA 1PZ7A 1K79A 1HRI1 2WC2A 3B01A 5FYTA 2HWE2 3MFCA 3WW1A 1HB3A 1LKXA 2ZKZA 1YJLA 2M45A 4RGSA 1W04A 4XBQA 2QGUA 4ZTJA 3BTJA 1HXS1 1XSRA 2RC4A 4LLNA 1J3RA 1JT0A 5JDBA 1Z1DA 2A5ZA 3PU3A 4WVMA 3RJ2X 5AC91 1JJ8C 3EUAA 4OU0A 1M06G 2QTWB 2DQLA 3VYRB 4B8XA 1K83J 4TTGA 3JQWA 4IPAA 1A8MA 2DMNA 4PF1A 2Y6LA 1SLIA 3BWGA 1FSHA 2JA2A 2F4IA 2HYXA 4LOCA 2GC2A 3PFYA 2EV5A 2QUOA 1YRNA 4W6YA 3DTEA 3K4KA 1LHNA 1D5VA 2LF8A 2C9KA 1COV3 1YJNI 1SZBA 2OCEA 1N77A 4XUNA 5H9RA 2DBBA 3E0JB 1EAH3 5IK5A 2XB5A 1F9KA 4XBLA 3F8BA 2PQ8A 1BJQA 2IA0A 2IC1A 1J3PA 4LE4A 1F31A 5FPZA 4LLGF 3LSGA 3N9PA 4QM8A 2P17A 1AR63 2XH6A 2JDUA 1YI9A 4IESA 3PVNA 4P55A 1UO9A 3V7SA 2O1QA 3E7LA 2KD7A 4N4OB 3KV9A 2KRFA 4MQVA 4ZONA 1U5IA 1G6NA 3O1RA 2R7QA 1SDDB 2XB6C 3FK7A 1GUIA 3U78A 1PUFB 4WBBA 1W36D 5E1RA 1QNWA 1PYVA 4HF2A 2JXAA 1MJBA 1SFKA 3CCUI 5CFDB 4Q0QA 4PF5A 5DABA 2WV1A 1CESA 2OIIA 4GH4A 4AVTA 5BOXA 2YBSA 2HWD3 3TGNA 1BC8C 3SH5A 4GMP3 2DMTA 2PAEA 2ZHNA 2DT6A 5DAWA 1VE0A 2HBTA 4QT6A 3P7NA 2RQQA 4OIQF 5H9QA 2K5CA 2GZWA 2ETHA 5FYIA 3RPUD 4OI0A 2VG9A 1NKGA 5FZ9A 1H2KA 3DTKA 3AZWA 2R7FA 1K4TA 2W1WA 3HQRA 4Y20B 3PDQA 4EM0B 4E7JA 1LOFC 1DGRA 1QOOA 5FLXZ 1JHNA 5FYSA 2DCJA 3C8XA 3UETA 1BKZA 2H8RA 4ZS3A 3KHCA 4LBQB 4I0AA 2GMPA 3J9SA 3VBSA 3HN1A 2D3SA 3H5NA 1WW5A 2ILMA 4DFSA 1ZAOA 5F9TA 3GZUC 2QF7A 2HWB3 3HBKA 1U8RA 3CJQB 3RSNA 1RMU3 1EY2A 5FLVA 4QX1A 1BM9A 1C1LA 4OCTA 4IKFA 3SLIA 4YRDA 2BBAA 3RKQA 4XNFA 1UWWA 2A73B 1S0FA 4FVVA 2HPMA 2W52A 1O3SA 3CDZB 5EP9A 2A6VA 4CU8A 3DLLF 2XPUA 5A7PA 3BDDA 2ZMKA 2YZ4A 5FLHA 4MGRA 1YHFA 4KMUX 1JYIA 4II3A 1UY1A 4C3HJ 4LB5A 3TKYA 4I02A 2JUCA 2M8EA 5ISLA 4A3XA 3J7YJ 2XAUA 4C3IJ 2WNVB 3CC2I 1OQEA 4A6SA 2EZKA 4COZA 3LQQA 2VZSA 4YFZA 2BFUL 1IKQA 4XFIA 1FYMA 2WZR3 3PUAA 3AJYA 2BBYA 4C91A 2DUQA 4D6SA 1X8MA 3LB9A 3O14A 4FPFA 1WJAA 2PHDA 4M4PA 5CFDC 2ZMEA 3OUIA 2BVMA 5FQ0A 4XJUA 2XVCA 3FZ3A 4EVIA 3J7LA 2OF7A 3W2AA 5FXZA 3BB6A 2VPLA 4YFWA 3AZZA 5JZGA 1FMWA 2GXGA 2WBMA 3OBZA 3HT1A 2VZOA 1QZYA 5F8PA 4ESJA 1R58A 2D3RA 4RR3B 3TO6A 4L5JA 4GWIA 3S3MA 2ZGQA 3I2IA 2NS7A 4YWAA 3ZIXA 5K7ZA 1ZARA 1O4YA 3IH4A 3PM1A 1BL0A 1GQPA 1OH3A 4YW7A 2G7UA 2A6ZA 4DOUA 2ZKNA 1O57A 3VZNA 4AIKA 4OUMA 3NEUA 3KZZA 1ASJ3 4XCAA 4ZZ8A 1R1ZA 5I0TA 2FDGA 5CPRB 4UB6C 2GOXB 3QPTA 3KB5A 2I07B 1IV6A 3W2VA 4XJWA 3TOAA 4WZCA 3HOYJ 2YB7A 3CL1A 3NQOA 2VW2A 3LSPA 2VCAA 3OL4A 4HQMA 1W8HA 3FISA 2V79A 3ZXKA 4LD5A 4IHYA 3UT0A 3AP5A 2CO5A 4XRFA 2WA3A 5LBEA 3U10A 1HBXG 4BL0B 3U07A 3CESA 4PLMA 1QJFA 1XSDA 4Z82A 5FRAA 2QKLB 2FMLA 4PFOA 4EWDA 1U78A 5JSRA 3MI8A 4Y5TA 1BIAA 1GOFA 3M3IA 2WNVC 2LLKA 4KT5C 2V6CA 1OI6A 4F3QA 3K51A 3WCRA 4MHUA 4PZJA 1DQ5A 2LREA 4Y4RA 1DU0A 3R0RA 4JDOA 2P5KA 1TWFJ 4CICA 5JI6A 3W6JB 4IX7A 4F3JA 1YI2I 4C90A 3MEPA 1OQDA 3T0YA 5FAXA 1QZZA 4BY7J 3KP5A 5FPAA 3H1CA 1HQCA 2CQ7A 1UELB 1RUE3 1XGNA 3FXLA 4BQ5A 1TWAJ 4AFCA 3HGGA 3SFIA 2LOOA 1EKEA 4UV8A 2GNTA 2P5BA 3MWMA 1EP0A 5JAXA 5DAXA 2R0QC 1Q8QA 4N7IA 1EPZA 2DFBA 2JZYA 5C70A 2EK5A 2IUWA 4Q5OA 5ERLA 2KL4A 2K85A 4RR3C 4V1PA 3LEMA 4P9JA 2R92J 1JYTA 1GMMA 2WS93 5IT9K 3SC7X 5J1RA 3S8PA 1V6MA 2BFUS 5CISA 2JQ7A 3CUOA 5LK7B 4LG0B 4WM7A 2DF7A 4YSFA 3EPZA 2FBIA 1H9GA 2DVFA 3KT1A 2TCTA 3L2HA 3MKZA 2A70A 5C9AC 2W1OA 4V2VA 4RYDA 1AR72 4HFSA 2OZUA 4AHXA 1LGCA 2C5DA 4YELA 2VBYA 2RS13 5DCMB 3B6CA 2QVSB 4OFGA 4BAYA 1W6OB 1I1SA 4OVEA 3BCWA 4RB0A 1IQDC 4D5CA 3WR0A 5KCMA 3CJNA 2ZO4A 2TNFA 4UOJA 1O4XA 5FRNA 3CF5F 4C0HA 1A8DA 5H9PA 3BPVA 1GNHA 3ZFGB 4AVVA 4DUWA 2VQAA 5JXGA 2X1CA 1A6CA 1FMVA 1UG0A 3F8NA 5FY1A 4OI4A 3M8EA 2YYOA 1OKOA 4QSHA 1ZRCA 3A03A 2VMIA 2JECA 2WDBA 3CQZJ 2P3IA 1XDUA 3I71A 1BEV3 3DFGA 1QJU2 5GLZA 4YPJA 1CQTA 1X1DA 3CJRB 3ZGKA 3ZMSA 1GP6A 3MIDA 1Y6IA 2J1RA 3ZSEA 1J9IA 5DZFA 4HEA2 2GM4A 3POIA 3WP3A 1TMF3 3O1PA 5FZEA 5EGOA 1SEUA 1E5HA 4RB2C 1OOPA 4HYEA 2ISYA 4I76A 4G6DA 3GZ6A 3TO9A 3RZZA 2F4MB 1D7PM 1PGW2 2M34A 1GV9A 1LPQA 2EFQA 1JZ4A 4ENJA 5A3WA 5E20A 5FYZA 5JOWA 4SBVA 3HRUA 1F5TA 4YVWA 3Q8FA 3J7MA 2IXSA 5FPBA 4OI1A 4ARXA 2NS0A 2JIGA 4HDVA 4D5FA 4XLPF 4IE5A 3CMEI 4COWA 1FY7A 1R1TA 1QRYA 2WQ8A 3DUIA 3VKMA 5HNHA 3POJA 1MNMC 1H9PA 3VYUB 4HPQA 4E4HA 2STWA 3POWA 3OCPA 3JSOA 5CKNA 3M3CA 4UBHA 1C0WA 4JRAA 1AR71 1PVEA 1H2MA 2WT0A 2G19A 1ACIA 3AL0B 3VBOA 1ZQ3P 4XEZA 5SV8A 4E7IA 4NPMA 3VZLA 3RYRA 3FLRA 3UR3C 3OJBA 3T4HB 2PA7A 5ED4A 2A5WA 2DODA 4NOTA 1YITI 1X50A 4XF9A 4YG0A 4XOTA 5HBAA 3GTQJ 2AEZA 1WRJA 5BNPB 5IYDJ 4LKEA 4QQPA 1G9FA 5F1JA 2EXIA 2F6BA 2VJJA 1UG2A 3PL0A 1C1FA 5GLUA 3HB9A 3J7AY 2FQPA 3UGHA 5K1YA 1H30A 2VECA 4HT1T 1S0DA 2FQ4A 3L2UA 4P5OA 4GJZA 3LSEA 1QJU1 3VDAA 4BDYA 4QB2A 1LENA 4FASD 3JD73 2WZEA 2CV2A 3VFZA 3NKGA 3J4UH 5FXXA 4XLAA 2DCEA 5A7QA 4IV1A 1G4DA 4W4ZA 3KP2A 2DVGA 1WCMJ 2C9AA 1OPCA 3MDPA 1LDKB 4KWJA 4YZ1A 4LQRA 3GFMA 3I7DA 3BG9A 1JYWA 1MSEC 2BTVC 1NK2P 2JWPA 1ZZ6A 3V8LA 1PGW1 3WU2C 3SQOA 4EQQA 2FD5A 1TLHB 2VULA 4XF1A 4BXUA 1Y8QB 1AR83 1BVP1 3AAFA 4Z2WA 3OWTA 1NCRA 2JUGA 1XNKA 5L9RA 3LL7A 1QNTA 2QQMA 1N1TA 1HOMA 5KR7A 1H1MA 1SMVA 3BG5A 5EZGA 5GZCA 2Z79A 1UHSA 3S2WA 1Q1VA 4Y22A 4G12A 1WA6X 3H7YA 1W0UA 1JI8A 4A0YA 4FOWA 3WDTA 1ZG5A 4M71A 2WZPP 3JRDA 4GQ7A 2X5IA 4WXCA 1A78A 2J5OA 1T08B 2CYFA 1UZWA 4LORA 3PVOA 4M9XA 3OB8A 3HUGA 3ZXEA 4QWQA 2QVOA 2VNOA 4PT6A 2NOGA 1ENXA 5ICFA 3ZFFA 3EMRA 3AL0C 3CJIA 1MS3A 4HG6B 4HV6A 4K6BA 1I6XA 2CFOA 2XLAA 2XQRA 3ST7A 2Y75A 4XVHA 4DYRA 2I2SA 1TNSA 2QSGX 1HKTA 4C9YA 5E1ZB 3DCQA 1Z05A 4BWOA 3CJXA 5BNPC 2A6EF 1HQLA 2D6KA 3PUHA 1G7YA 3TEWA 3VD4A 2E63A 5EYRA 4JGYB 4BIOA 2EIMH 5M5XJ 5KC6A 2P5LC 3WW2A 3FLPA 1ENSA 4AFBA 4X8NA 3T1LA 2K9MA 1QDOA 2KIMA 4DXTA 4NJ4A 3HQXA 4QHZA 3RZLA 1YX5A 3T0DA 4GWJA 3P6BA 3NVCA 4IHVA 4WVVA 1OYYA 4NDLA 4HNVA 2B9SA 3H8UA 1W8OA 3V0BB 1D1AA 2A1XA 3P1IA 1VQOI 1VFCA 1NCQA 2LP0A 2WFF2 1AYN2 2WL1A 5FZAA 2WABA 4JC1A 3RG0A 3H9QA 4ZU5A 5KVRA 4PI2A 4XQFA 1KU3A 1LFPA 3LWCA 3HL2A 2KMUA 4XLNF 1OD5A 3KLNA 4FPGA 4INDA 1CAXA 2MNGA 1LECA 1T2KA 3IPVB 1HXS3 2DT5A 4UF0A 1QBJA 2QQAA 2GIVA 1K3IA 1CF7A 2XAGA 2VOTA 4PQQA 2ZXJA 2VQCA 2L9LA 2Y8KA 5AC93 1I5ZA 1FLIA 2P2KA 2BPA2 1PX4A 4AR2A 5B1AH 2CQXA 3BQYA 1OJLA 2WA4A 5D4RA 3HMYA 4AWDA 1W6MA 2Y6JA 2IFRA 3PJQA 1NQDA 4LK7A 3ETQA 3ZYGA 1ST8A 4OIRF 4AI2A 2DVAA 1D0XA 1U5TB 3I2JA 5A1AA 1N3QA 4RL7A 3ABLH 2MPFA 4CEYB 1Q8PA 1JJ6C 3SFZA 4YFKF 1O7LA 5KXCA 3NV1A 3SMHA 3MKYB 2MLGA 3MAJA 1O59A 3C7EA 3MICA 4E70A 5IW0A 3PL8A 4A3MJ 3FXOA 2GC0A 4H55A 1S7EA 1NE4A 4KWLA 3AMHA 3ZXGA 1VJ2A 3PO3J 3E6BA 2VXRA 1QGPA 4HX4A 3H3UA 2VTFA 1LOBA 3FM5A 4D0PA 4JGYC 1QEXA 5FROA 2X48A 4FQZA 3GXOA 5IHRA 2Y9ZA 4IHXA 1B8IB 3VBRA 3LAGA 4LITA 1SD7A 1ETWA 3K0LA 2QQJA 2OQ6A 3LKJA 1JGGA 3D6EA 3PNVA 4YRVA 2LKPA 3L7WA 2L01A 1OPOA 1Z7S2 1DFQA 1S55A 1NXMA 4IGQA 4X6RB 2W0XA 1X2NA 3VD5A 5K7FA 3TOJA 2RS32 4E8CA 1XPWA 4BKXA 2YY1A 1BOAA 2QCSB 4B09A 2WFF1 5IVCA 3S7EA 1AYN1 2YFUA 1S2EA 3U9GA 2PMHA 1E5RA 3VLBB 3KM5A 2YU3A 3WQ0A 3JCUC 1QVUA 1USSA 1UF2C 2ERFA 5FP4A 1B35B 2VMHA 4BQ4A 4KICA 3M1EA 3K4BA 5FZGA 4ESFA 4JKLA 2P5VA 1XXNA 4G7HF 2X51A 5L9VA 3P9IA 1VAMA 4CTEA 3S93A 4Q1RA 3JBG2 4CVUA 3EDPA 3GM8A 5I8SA 4D7YA 4MXWB 1LEAA 4KISA 3CF6E 5CB7A 3IV5A 1V5GA 1WLTA 2Q4SA 3GZNB 4AEKA 1UMHA 2QDNA 3QU6A 1YJ9I 2JX9A 3THDA 1YRZA 2JDPA 5EJ1B 4CZCA 2NZ9A 4XFAA 1U5TC 2P37A 4OHVA 3RI9A 2H1KA 3EQLF 4AQ2A 5ICGA 4ZXKA 2DYSH 3KYLA 4XPVA 5FY0A 1E3PA 4CEYC 2Z99A 1MMNA 3HEIA 4PUSA 2KFDA 4AYBA 3HG9A 3O1SA 3WVJA 5F2SA 2HI3A 2IJLA 2DDAA 3CMYA 5CADA 4XCBA 4AGGA 1ZR4A 1JKQC 2M4KA 2E2IJ 5KHKA 3UJOA 1QU3A 3EJKA 4OZOA 1Y4WA 1OLMA 3QPSA 3JU9A 4FX4A 3LA7A 1KU2A 4XDPA 5C3OA 2ZGRA 5CVJA 2R0HA 3I2HA 3AL5A 5DM7F 5F64A 1HV1A 4IEYA 5FZOB 3HHHA 1GZCA 2CQNA 3C3VA 4KITB 4P96A 3LF7A 3P3PA 4LLLA 4IV3A 1Z7S1 4Q4Y2 3WOGA 3DF8A 1J5YA 4P00B 3WF0A 2KLOA 1VBC2 3ZSMA 4BQNA 3F22A 1S2KA 2DK5A 1AWCA 2VXZA 1BBT2 5F6FA 1EYBA 2GH8A 2KXLA 3S3OA 4DXRA 2ZGOA 1ZTRA 2R5ZB 4HZFA 2OTJI 4PIXA 4IDZA 1MDMA 2V1DA 1VALA 5ABJB 3WHCA 4ZPIA 4NHMA 1B35C 3A0HC 1W39A 4XLFA 2OXBA 3O2PE 4UI9L 2XASA 1MMGA 2ZMNA 5CAZA 4XHXA 3NV3A 3N7MA 2JRMA 2W46A 4DJAA 3WTYC 1SPPA 1LU1A 5HCAA 5J1YA 3UV9A 1BBYA 1TEIA 1VBD3 1WJCA 1UCRA 3JBG1 4RB1A 3ZR6A 1Z67A 3BT9A 4AZZA 2ZHMA 4A3JJ 3KQRA 1RRJA 2HJIA 3ZM8A 3ASIA 4FAHA 5KHJA 3I59A 2MG4A 4CCCA 3U21A 2DQRA 1VZ0A 2O8XA 3WODF 2PHRA 1MSFC 1DU6A 1CAWB 2FF4A 1PZ9A 3O0VA 1EH7A 4XYXA 5B4XA 2GC3A 2H6BA 3FBNB 5FKCA 3J80K 1XS9A 4LLFA 4O61A 3WTWC 5T54A 2CH0A 2JT1A 1DYKA 1GFF2 3JB8A 1KS5A 5FY5A 1CWPA 3VBUA 2AQFA 1PIV2 4H0EA 4UXAA 3FLTA 1E0EA 1IC8A 3TEYA 1IXRC 4QLCU 2V1NA 3AJZA 4XZUG 3VZJA 5LBCA 1OLRA 4HOOA 1YE9A 3HNMA 3UESA 4J00A 1P9QC 1F36A 3HOVJ 3DXUA 3CUQA 3LIGA 5F5IA 5J98B 2BZTA 3MV01 4MGIE 1XSXA 5A7NA 5D5UB 1TE1B 2X0LA 2WTEA 1UYZA 3ZCOA 2XOMA 1VQLI 2X6XA 1R6RA 2ZFUA 1K6OA 1S0GA 4HV5A 5C3QA 3ZYPA 3WTSC 4Q4Y1 1D0YA 1VBC1 4XICA 5DPNA 3V64A 4V2WA 1TC3C 1BBT1 4QKBA 2GNBA 3FXQA 2P6HA 4WV8A 3AP9A 5HI0A 4PDWA 2A61A 2I5UA 3LOIA 2RMU2 3N7LA 4HX7A 4UY8I 1CN1A 2BXYA 1D3YA 3P5JA 1X7NA 1KFXL 5ABJC 2BW3B 5I91A 1JYCA 1AOYA 5EIYB 2Q1MA 3ZSJA 2RHPA 3I3QA 1ON2A 1TQMA 1HRV2 2NVUB 2Q2EA 4EGZA 2JDZA 1X1BA 5HS7A 5FDBA 3JW4A 4ZU4A 3TDZC 2HDWA 2L54A 3O8GA 3ZMVA 2QZ3A 4JQFA 3RZJA 2Z69A 5CNAA 1IQAA 5D2AA 1DZTA 2A3WA 5DZEA 4DUVA 2KISA 2ZZQA 3ZMDA 2EF6A 4KGQA 4I09A 1K78B 2E7WA 5IY5H 3EYPA 3TWIA 1TVGA 2A6XA 5GP9A 1AR91 1WA4A 4XQWA 4EJTA 1W1WE 3NNLA 1ZGJA 1Y39A 1MZBA 2QQNA 2YGMA 4MADA 2XB0X 3B00A 5IT3A 2KIFA 1GVJA 5FO7B 2PFWA 3HRSA 1AU7A 3VHNA 2FMYA 2XL7A 4KDPA 4RM3A 3SDGA 4IXAA 5C44J 1YQ2A 3ZFEB 3QAHA 4A3DJ 4J6GA 2ADUA 1FYLA 1PIV1 1UPIA 3BZ6A 2JVGA 1IW7F 5JIUA 1B9NA 4XXPA 4NMIA 3G7DA 1NTCA 4X1EA 3BTXA 4XONA 1ZVFA 1OBNA 2JD9A 1PX3A 2WRAA 4MG2A 2JSPA 3CBNA 2F5CA 2VMDA 5K7HA 1X1AA 4IV1B 4K20A 1VB2A 1KXGA 4B7KA 2HKXA 2Y30A 4HKLA 3H3VK 2RNGA 4GDFA 1IOAA 1FYUA 4Z6YA 5HS9A 4CDWB 3Q9VA 5DAVA 1R71A 4KIGA 1TQ5A 4D7SA 3OPZA 5DDGA 1REFA 1CAUA 1JUHA 3A21A 4ZC3A 4Q4W2 3ZOBA 4Y7NJ 5ACA3 3EQEA 2WB1A 4YVWC 1HDDC 1LOAA 2RMU1 1BMV2 2ARBA 2QA4I 5LBQA 2VMEA 3K70D 1OSGA 4ZJZA 4ZXEA 3K4ZA 2XPWA 5FJKA 1ULDA 5FWJA 4M3GA 2FEZA 3R4KA 1GKBA 4XIKA 1JZ7A 2PAMA 3KYCB 1RHI2 4TLFA 3BY6A 1UIKA 4Y22B 1KYZA 4HSLA 4M74A 5J3LA 1OCRH 1R4NB 4PCQA 3HDDA 4L0YB 1DP7P 3WG7H 3KZ4C 3EYIA 3I58A 3OGVA 5DUWA 1PZ8A 3DTIA 1WQ2A 1AR73 1QZEA 5FJHA 1KU7A 4ES9A 2CGOA 3DP7A 4IEQA 2VZQA 4NR1A 2M7BA 3S1NJ 4M9ZA 2E60A 2RM22 4XKWA 2UYBA 2ZAAA 2K9NA 4DEVA 4YYOA 3JXSA 1N1VA 2PLV2 2AACA 1GZWA 4S2HA 2WBKA 1QJEA 3JRGA 3ZYFA 3MKWB 3ZFEC 4MXVA 1ZGWA 4DRVA 1IS5A 2EIDA 1PP8F 1AA7A 2RNJA 5ANQA 3AL6A 2AQEA 1X8EA 4N53B 2MYSA 4G9YA 1LNSA 3UL2A 2QBYB 4FFHA 2HH9A 5DUIA 4JTOA 5JWPA 3CO6C 3K48A 4AIJA 2JE8A 5L3EA 1QJU3 4AFDA 3OYMA 2VQ0A 4IV1C 4AUXA 1S0BA 2W1UA 2HTJA 2AENA 4HVRA 3ABTA 2B8MA 3FN9A 1WGPA 3JRBA 3E1F1 1VQKI 1JTXA 3PSFA 3S7IA 2WADA 2XKOA 4CDWC 4DNYA 1VAVA 2P6CA 2ZCWA 1GNYA 1TWGJ 3J8F2 1LFUP 3VB2A 3CCEI 2FOKA 1WKYA 1IN4A 4MTEA 2SLIA 4EN7B 4FE4A 1RVF2 5IUQA 4Q4W1 3JAMK 1CF7B 2UWAA 3WDYA 4RA2A 2VY0A 1BMV1 1Y56A 5IAXA 1FNYA 2E26A 4HVQA 4YM0A 1XBFA 1N25A 3Q9SA 2G1MA 3MF9A 3OOXA 1RHI1 2PHUA 1Z7LA 1W6MB 3KE2A 4NAOA 4CDXA 4FTSA 2RV8A 3UNPA 3IKWA 1U5ZA 2M8GX 1P6RA 4YGCA 4J25A 4P02B 3POSA 4J19A 3CLOA 2L4AA 2HZDA 2JA6J 2CGPA 4DYCA 1XU2A 1WGXA 3BPSA 2VGDA 1WD3A 1RB8G 4XABA 2GN3A 2BVBA 1T0FA 2RM21 1IZ1A 3ZPOA 5DUKA 4D69A 2PLV1 2R7DA 1EF4A 4E7LA 2BUKA 2IP2A 1MEC2 4AI1A 4AC0A 1JOJA 1A35A 2FA5A 2DTWA 4OHZA 5BNOB 2FD8A 3VBRB 1RUH2 2UY8A 2ZS6B 1ONVA 1GR3A 3CIHA 1OFCX 3J81K 1TT5B 4LGWA 4N53C 2ACJA 4U88A 4KU8A 3QODA 1X1CA 3T1MA 2OC6A 3ISPA 1V55H 5DG2A 2FBEA 2YU1A 5CFCB 3OY8A 2AS5F 2K7LA 4G7ZF 1AXKA 5A7SA 1H0MA 3AYAA 4TZDA 1TTYA 2R7VA 1ETVA 4ON0A 3ZQHA 3Q8AA 3USUB 4WZFA 3WNKA 3V42A 2MEV3 3NNFA 1VMHA 3S0MA 4RDUA 1YFXA 1EA3A 3BG6A 3MVPA 2XWJB 2F4OB 2W24A 3GBFA 5FZMA 3JRCA 4ZDOA 2M3AA 2UV1A 3FKJA 3J8F1 1POV1 2JG9B 4DXSA 1HXDA 1GWLA 1GHCA 4KL1A 1RVF1 4LBOA 1O4TA 1JTYA 1I3QJ 3C7OA 1VBA3 1NX9A 3KGZA 5LZ6A 2EWNA 2ZEWA 5E1WA 4LJHA 3HNYM 4BEHA 4PJ0C 5H2FC 1KONA 5HDNA 1YYVA 3WG3A 5IYBJ 1LOCA 4META 4XJ8A 1WZ2A 5IT9Z 3T30A 5JSOA 4AHZA 3Q0WA 2L02A 1W6PA 3IDBB 1IGNA 3I4PA 1HB4A 5EV7A 2V6EA 2WIIB 1Z9CA 3LMMA 4GKYA 1H4GA 4QHOA 2PJRA 2FDKA 5J1XA 5JVVA 2ZX2A 3IL2A 2WA0A 2PMWB 4L18B 4JGZB 3LDRA 1B72A 3CJTB 3H92A 3HM5A 4RAZA 2E51A 3A1YA 1BZWA 1EH6A 3ZDSA 4XMAA 5BNOC 3G6EI 1MEC1 4UHTA 4XBNA 2ZJCA 4ISQA 3NQHA 3VBRC 2ESNA 5G05L 2WV0A 1ZR2A 1RUH1 2CTVA 3I54A 4JKKA 4RB3C 2V73A 1IRFA 3VYSB 1H9WA 4AGVA 1FATA 2AUYA 5IOYA 5E88A 5EEHA 5EEGA 5D5VB 4FP2A 5CFCC 2F5VA 4RGUA 4LO8A 5KHGA 1COV2 1Z3XA 4XK4A 4E7HA 3JQXA 3HOXJ 4IRIA 3DU5A 1S6LA 4P9FA 1MS8A 1EAH2 2GXAA 2C6SA 4Y3OA 2WFF3 1VQ5I 1AYN3 1W5TA 1KFUL 2DMUA 1DPRA 2RJLA 4LO5B 4BDVB 1KS4A 4AE2A 4CP0A 1W8ZA 4IZZA 3USSA 4HANA 1UOFA 2B4KA 2R7EB 1JGSA 1ZZBA 2DPUA 3MHZA 1PGSA 1U3EM 5FJ8J 3U2RA 1JUIA 2JG9C 4EZ4A 1KA8A 1OR7C 3G4SI 3KS7A 2V9KA 1A6IA 5BUVA 5DQ0A 2EIKH 1ZX5A 1MZEA 4I7HA 4N0BA 3C7HA 2JG8A 3T08A 2YU2A 2VOXA 1VQ9I 2G9FA 3WLUA 1UYPA 5FKLA 3OIPA 2L4MA 3GJAA 2ZJRF 4DW6A 3LWFA 3I2OA 5L3GA 3I59B 4XFCA 2QQBA 1UKRA 3DPTA 3LFUA 4IEPA 4CU9A 2DA3A 1SAUA 1UAAA 3GCWA 1S8NA 1FZPB 3I9V2 2L7FP 1XU1A 4Q8KA 2QQKA 2Y69H 5F32A 4PBPA 1PVXA 2W25A 4PHZA 1XRUA 4N90A 2JA8J 4JGZC 1IG3A 3BJAA 1E5SA 4NE9A 2E2HJ 3QLQA 1FMD2 3POFA 5FKKA 3DKQA 1HQNA 2P7VB 2WAQN 2NPIA 3BOWA 2H09A 3JCIA 4GXLA 2O3FA 3HPGA 1WBLA 3GGLA 1LNWA 4XFHA 1ND2A 4N9HA 1SLCA 5A80A 4MFEA 1J0RA 3LSTA 4XXAA 4M0HA 1DQ1A 1RUI1 2IWGB 5J48A 3W6KB 2AHQA 3SXYA 4CUAA 4IV3C 3DEEA 3MEXA 1OLTA 1Z7S3 1FBSA 2KP6A 4OOIA 3K7AJ 3HAGA 4CH7A 3PUBA 4GGGA 4QX3A 1COV1 1PGL2 5LLQA 5FOJB 3S1MJ 1RIOH 4GO1A 2R072 2IVMA 3U37A 3MCZA 3KETA 2VBBA 3A0NA 2MW8A 1JKOC 4U7BA 4IEVA 2BWAA 2VBXA 4EV0A 3GFIA 2BERA 2K46A 1NZIA 4PIZA 5FV3A 2PX9A 5HXMA 1LRHA 1IJWC 4CCEA 5FY9A 4RA0A 3WUCA 3I53A 1IG0A 1OA4A 1Y0UA 3KZYA 2W9XA 3B02A 2GH2A 3E6DA 5FP8A 3FXRA 3T3YA 2WN3A 4LBKA 2DU1A 5KHDA 1W6QA 4PCRA 1FX7A 4MGQA 3SITA 2M7AA 4CEWB 3JBG3 3VZKA 2CY6A 3F2ZA 5HLIA 3QYEA 2A6WA 1YQ5A 5JLWA 1LHOA 1NZCA 4BXXJ 2WJSA 4U87A 2R063 5JI7A 3ERMA 1T39A 3L9JT 3CU7A 4QGMA 1SFYA 4L9JA 4YEJA 3RGBA 4A4AA 5FD5A 1FPN1 5FPUA 2HGCA 4FOYA 4ASLA 3M3YJ 3F8MA 3IRQA 2RDQA 2VKDA 3ELKA 4QGNA 3K4NA 4GMP1 1KRIA 2D45A 3I3DA 1XQNA 5C8CB 1IKPA 4AVZA 4Q29A 2K3FA 1SMYF 3WU1B 1BK0A 1K12A 3FE5A 2RVAA 2V9VA 2P3YA 3GXUA 2JDMA 4UVAA 3FXUA 2Q8KA 5FO9B 3EB7A 1SHWB 3A7QA 3ZYBA 2W57A 2PN5A 3VBHA 1OPMA 3FHAA 2CW0F 1FMD1 2BZDA 2V1XA 4CDQA 3N9MA 2OV7A 1ASJ2 4K8RB 1RJ7A 2ZJ2A 5FOBB 1T8IA 4E7SA 5I0RA 3IDAA 2COMA 1SFXA 5CA6A 2K27A 1GYKA 2WAOA 3HHGA 1Z0XA 3CC7I 2A5YB 4AI9A 3S6PA 5IVJA 3BCAA 4XRSG 4EJWA 2QQ8A 4LHSA 2EIGA 2CYYA 2ID4A 4HKWA 1BBT3 2FCTA 1PGL1 4OIPF 1QXPA 1JZ8A 2R071 4PDWC 3B73A 5IVYA 1YYNA 3BVCA 3J7NA 4QU2A 4HF0A 4I98B 2GC1A 3PIOF 3ACGA 2L3DA 5C4WA 1YFYA 4M3CA 1DQ2A 3R6SA 2YROA 4BPZA 4Y5SA 3KCXA 1U12A 3D1NI 2HLEA 3LA2A 4QB6A 2ISZA 3WNLA 1UMZA 2IS2A 3WF2A 4MIMA 3J7HA 1AKHB 1XGSA 1NQJA 5BYNA 4WF2A 3I55I 1W4MA 4CEWC 1UNBA 4HETA 1ND3A 1XMXA 1WBFA 4FPHA 4A3GJ 1TZOA 3UKGA 4F83A 2D98A 2EAKA 1DUXC 1DU3D 2NM1A 4NRQA 4B4PA 1V5EA 2OZJA 3GTPJ 1HB2A 3O12A 5ERIA 1AR93 3WNNA 3D4KA 2EZHA 2ARXA 4RFT0 3IAPA 3OYJA 5C8CC 3BTCA 3P9KA 1C8NA 1ZBE3 3VN4A 1OKRA 1FSEA 1IN5A 5BNNA 4FETA 3POYA 4JX0A 4DB5A 5D8LB 4KA4A 1PJRA 3KD4A 1ULCA 2W39A 4BMEA 1URXA 5KK1A 1O5UA 4RQPB 4YM1A 4LB6B 5A70A 1LHWA 1G9BA 4O5VA 2VUDA 3DLAA 2ELKA 1YEWA 1V9U2 2WT2A 4NHYA 3NAPB 2W1SA 4EYUA 1ASJ1 3HBZA 3BZKA 2DAOA 3FZVA 5FY7A 2IAIA 5B66C 1UIJA 1S0CA 4XMYA 3R05A 4M3CF 2BBVA 4CYCB 2XGEA 4HF1A 4XTMA 4R9AA 4RMNA 4CRQA 4HW0A 4QQHA 2Z16A 4BIFA 1UZZA 3LPGA 1Y8RB 1NK3P 3WXPA 2UWMA 4CDUB 5ILVA 5JOYA 4YZ2A 4KUMA 2Y6KA 3DBHB 1CPMA 5FFOC 1CAVB 5F5QA 4ZHNA 2PHFA 2A75A 5HV4A 5DV5A 1JU3A 1W05A 1OKQA 3IAM2 1B4AA 4TN7A 2RV9A 4RGGA 2RR13 3F8CA 2RMU3 4PGGA 1H8VA 3W59A 3O1TA 1RIRA 1ZZCA 4M3FA 1MD0A 4Q27A 2ZJQF 2W94A 3T0BA 2NNNA 4Y1YA 1IGOA 3FMGA 4S2FA 3GHNA 4UUSA 2VH9A 4BQ2A 2X6WA 4CDXB 2XF6A 2OAZA 3DBRB 2JDKA 3HBLA 1V00A 3KF3A 2GMEA 1FIPA 4Q47A 5LHIA 2HEOA 2HYFA 2VKVA 4E7ZA 1UX6A 4IGOA 2MGQA 1H1AA 4JBAA 2XKPA 3RPUA 1XNCA 5FK7A 2LR8A 2PLYA 2RG4A 2EXKA 3DECA 2QSFX 2EILH 1R1A2 4CHUA 4AEMA 5LGTA 3OYWA 1TMF2 5FMBA 3TYJA 2JE7A 2B46X 3TEDA 2VODA 3WTVC 1V54H 5CJ9A 1W06A 1P8JA 1O3RA 2VB6A 1N3OA 1PK6B 5ICEA 3QRFF 5EJZB 2HBUA 1LE8B 2FOWA 1OCPA 3L09A 4JOMA 4A2UA 4L9TA 4GJYA 5EG0A 3NJYA 3O1VA 2FNAA 2VD7A 5GZEA 3EUHA 4RQPC 3K9TA 1XTAA 3JTHA 3H0GJ 3QCWA 4JDMA 4GKXA 1O3QA 4B3AA 1R36A 1V9U1 4JYKA 3UKVA 3BUCA 4O7XA 2YFZA 3NAPC 4YM3A 1EUUA 1L3JA 4NN0A 2O7OA 2XHNA 4AGRA 2J1VA 1SFEA 1R23A 4M3BA 4L8QA 2Y9YA 2HEWF 3N9OA 4WVZA 5I8TA 5FZIA 1GOGA 4BISA 4CDUC 2VE8A 2QM3A 4UFHA 5DYMA 2P7CB 2DUPA 5CIRA 4A7ZA 2V4VA 2PJPA 3ZOIA 2BGCA 1YX3A 1KJRA 1ETOA 1VB4A 2NMNA 3ZMNA 4UW3A 4LKDA 4UW4A 2XXZA 5F3IA 4DYQA 3EHKA 1POGA 4RS5A 1T6GC 4OMCA 5D6EA 1VRBA 3ORJA 4CDXC 4DY3A 4TSVA 4KN4X 4BEHB 1NY72 2K9ZA 1UY2A 3CQOA 4AM3A 3FX3A 4M3EA 4W8JA 1XNAA 1Z3YA 1H4HA 4XIDA 1TQIA 3SEEA 3O1MA 1PNFA 4DZJA 3QOEA 3VL8A 4LULA 4CE8A 3EYYA 2BEOA 4RFRB 4A3EJ 2R7TA 5J96B 5DDJ2 1CJPA 1R1A1 1QKQA 1OLQA 1S0IA 1TMF1 3O7OA 3H0DA 2PJRB 1T0FC 5B4NA 5HPOA 4UXNA 1YJKA 2NYXA 1X9PA 1PK6C 2VU9A 2RM23 3K2ZA 4ABZA 5FKOA 4NRMA 1JBCA 5F08A 4XRSA 2A69F 4BDZA 4ONUA 3KP4A 2EB7A 2KDZA 4QMAA 4Q2FA 4ZYDA 3AKTA 4IEUA 3VOEA 5TJJA 2NVXJ 3GTKJ 3IC7A 2TRTA 1XCBA 3M07A 3ERED 3I3EA 1PP7U 1POV0 3IH2A 4DQ2A 3U14A 3GF2A 1STMA 3BODA 1LGBA 5E79C 5LRRA 3J80Z 4E9KA 1VQPI 5J8CA 4WX9A 4UAPA 2GA2A 2GNDA 4AYUA 5LHGA 2E1OA 1JUPA 1O3TA 1RUD3 3SHFA 1ZELA 3M3OA 3HWJA 2QE3A 2XBO2 2D6NA 2ZGPA 4YLZA 3T1BA 4IUGA 4GIQA 5LA0A 1TP4A 4I3PA 2ZX3A 2BHZA 4PJYA 1G3SA 1HDPA 4R79A 1POV3 2GQQA 4KBZA 1P2FA 4CCLA 1G86A 3ABMH 4LXLA 1RVF3 1FOD2 3FIWA 3M1CA 5JVTA 3DKWA 3W58A 4QU1A 2LKSA 3ZN1A 3A0KA 1T2XA 1HKDA 1NY71 3OS1A 2C4XA 3DKYA 2VE9A 2L5QA 3BIWE 3AXEA 2VZPA 2XAHA 3RKYA 4BBSJ 3HPNA 3BPZA 1QH7A 3K2AA 2FJ1A 1QHHD 2VOPA 5FCCA 2I10A 4IHTA 2XWBB 2HOAA 3F95A 3ZR5A 2HYJA 1T6BX 3TEZA 1WZXA 4S2DA 2XGDA 4KG0A 1S0JA 5DDJ1 3L2VA 1OCCH 2ZBKA 5FMDA 4QKFA 3PLQA 4NB5A 1VI0A 2BWCA 3SXWA 3IAQA 3FFZA 4DIQA 1QO0D 3LEGA 1LU2A 5LGUA 2B5HA 1PVC2 5C4JJ 3JSPA 2GAUA 1H8TA 2OA2A 1DGRN 2E7TA 2C1FA 2JKXA 4YIFA 4CP9A 3GTMJ 1ND2B 4YGDA 4D1QA 4AOCA 1MEC3 3J26N 2E7XA 3W9AA 2E1CA 3IRRA 1WI3A 1RUH3 3Q8EA 2DLLA 3L00A 1I1GA 2MH9A 4QPGA 2ZSIB 1DYPA 2FCVA 2JPCA 2JDAA 2GLOA 3VDBA 5F04A 5BV6A 5T52A 4IXLA 5LW9A 2HEVF 3KYDB 1SLBA 3T8TA 2ZABA 3MYXA 1JUMA 4HA8A 4C2UA 1REEA 1UQXA 3ILFA 3ROUA 4P5HA 1QVTA 4U0WA 2QWWA 1APNA 2XBO1 5LEKA 4CCNA 4UWDA 2Q8DA 2D5FA 4UFLA 3KZIC 3AKQA 5A7WA 2E6VA 5E18F 5FZ3A 2XPVA 3GTGJ 3DXTA 4CUCA 1OA2A 1WW6A 3H8RA 2BOLA 5FLXK 3A01A 4FFIA 5IPAA 2HOSA 3V0AA 4YARA 3KP6A 3TP0A 1FOWA 3A23A 4M4RA 3UKNA 1XNTA 1FOD1 3WQ7A 1NLSA 3ZR8X 5L7OA 1YIPA 3JTGA 1W3VA 3MLKA 2DTZA 1GLNA 5F3EA 2WNUA 3WD5A 1EUTA 3RZOJ 3GLLA 4HK8A 2R3SA 3Q8CA 2G9WA 3V7RA 4BBRJ 2VZVA 1D1CA 2IRFG 4Z92B 4OWRB 1JYNA 3DXJF 2GBYA 5BMZA 2PELA 3WQ1A 2RJKA 3JRHA 3S32A 2IGKA 4TXWA 2D6MA 4A45A 3K4CA 4Y24A 2MA3A 3OD0A 2WY7Q 1O91A 4A6DA 2ZPXA 4MEXF 1LOGA 3OF1A 3ZQGA 2B39A 2R7RA 1FEXA 1UZYA 4M9SA 1RUJ1 4PDKA 3LOBA 3VBHB 4JX5A 1PVC1 3NWSA 1UW8A 1W2UA 3VKLA 4ZKTB 5AFEA 1TZLA 3O5SA 1ND2C 1VRH3 1CIWA 3K4DA 1F2NA 3TW6A 1GP4A 1US3A 3FF5A 3HOBA 2XRNA 1HKQA 1X33A 4N43B 4XF4A 5K0UB 2LY9A 4NPLA 1GLHA 4XLCA 1RUI3 5E16A 3WNXA 4LE3A 2D93A 3ZQIA 4MZUA 4LEJA 1NA1B 1AYM3 1SDWA 2RQPA 3K4JA 2J1EA 2DCYA 3GWZA 2YSRA 4P9LA 2FU4A 2XGCA 4CU7A 3ZSLA 3F6OA 1VF9A 5AVAA 2Y64A 5L36A 1V6JA 1NAEA 4Y52J 4XBFA 4Q48A 4QDSA 2PQQA 3BKZA 2DDBA 4CZZA 1LKNA 4GMP0 4Q0PA 5KXEA 3WTUC 2ZX1A 2XSJC 3K3NA 1BA5A 3WT3A 1X4OA 3WZ1A 3PU8A 4JCKA 1KQ9A 1ETKA 4A3IJ 3LOCA 3N35A 4M00A 3TNPB 4CXYA 3M2MA 4BJ5C 2QBXA 4LOTA 5C5TA 4IEJA 1B09A 5FPLA 4ZYHA 3CCLI 1SANA 2DMPA 1J75A 4W6WA 1ERDA 2BOJA 2CQQA 1R64A 5A6XA 3I4MJ 3OIOA 4HNUA 4B43A 3FHQA 4Y1XA 2I74A 3JAMZ 4AXOA 3N05A 2ZGKA 1UMIA 4I30A 4IQ4A 1OFSA 4Y4YA 5T5OA 1FPN3 4XQ4A 4CP1A 5D5XB 4D7TA 4AAXA 4BE2A 1QQP2 4QKNA 3BYWA 2HS5A 2IXJA 3AMPA