4BYYA

Apo glxr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 65
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4byyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4byyA01
1DPRA 1EY2A 4KL1A 4WK8F 3J7AO 3D0JA 1FZPB 5T3NA 1FX7A 1TLHB 1GHCA 2RKHA 3D5LA 5D4RA 2PYTA 4MNUA 5KBFA 2KIUA 3KEQA 2ZXJA 2DQRA 4HLTA 4MZUA 2H6BA 5K5OA 4E70A 2L54A 3H3ZA 2ATFA 4LA3A 2YX4A 5F6FA 3ZMSA 2PMHA 3UKTA 1CAVA 4UUVA 3SQNA 1IN4A 3NRVA 2MH9A 5J6XA 5L3EA 3R4KA 3FM3A 4ZYDA 3TQNA 4O6JA 1SFUA 2KXLA 4ONUA 1W4MA 3IRQA 4AVCA 5A2QK 3LAPA 4HQMA 2LNBA 2X0LA 2Z99A 1OKRA 4G9YA 2M5WA 2YX7A 1ODDA 2D5FA 2MPFA 3RIRA 4RGRA 2KKOA 2Z3YA 2BNOA 1YWKA 4BH9A 3MZYA 1J5YA 2QJVA 2PHLA 1HKSA 3MAJA 5I8SA 3W6JB 4WWCA 4HYEA 4QWQA 1MDMA 3K2ZA 1KYZA 4Q4ZF 2BNMA 4M73A 1FI2A 1RC6A 2QCSB 1LRHA 1STZA 2B0LA 1IXRC 4WXCA 1I1SA 3ZDSA 1YW7A 3I71A 1XSVA 1B4AA 1J1LA 2Z5UA 3GFLA 4HSJA 2X4HA 3C18A 5FDBA 4AXOA 4LB5A 5J7MA 1JHHA 1T39A 4IEXA 2BYVE 4ENMA 1U5TC 3CUQC 2XROA 2PHDA 3SMHA 4M9ZA 5L3CA 2FE3A 5CJ9A 2OZJA 2PMUA 2F2EA 3QP6A 2PLYA 5E18F 4CICA 2O61A 4BHCA 1TNTA 4BQAA 1QO0D 4HDVA 2OA4A 4LUKA 1YUDA 3BOQA 3H50A 4PZJA 2XHKA 4LLNA 1SD5A 2EA7A 5J8CA 5DD8A 4PDKA 1UB9A 3K1NA 4FAGA 1AWCA 2GWRA 4NB5A 3J81K 1H9TA 2OQGA 3F6VA 3HRUA 4LLLA 1ZARA 2XAQA 2RQPA 4UVBA 1OYWA 3T1BA 2D5HA 1S7AA 3WTSC 5H6QA 2PFWA 4WXHA 1O7LA 3LWCA 2HGCA 1XE8A 2ZKLA 2K9ZA 4A12A 1WWXA 1BJAA 2CAUA 4XSXF 3RJPA 3T5XA 3E5QA 3BCWA 2K4BA 3Q9VA 4KICA 1TQIA 1RNLA 2FU4A 1SFNA 2DQLA 2AS5F 4MGZE 4XFBA 5E1RA 5KHJA 3JTHA 2BEOA 5FCCA 1FXZA 3KGLA 4L9NA 1ZZCA 1DUXC 3DFGA 2STTA 5LGUA 2O3FA 2ESHA 3CEWA 6PAXA 2E1CA 4IEPA 3I53A 3O2PE 2D45A 2MC3A 1HXDA 1J75A 3VB2A 2OAZA 4JBAA 3NVCA 2BNNA 3FF5A 4JK1X 1WGPA 1PUEE 2G9WA 5ICFA 3GYHX 5KHHA 1ZVFA 2YU3A 5LRRA 1Z1DA 1RI7A 4AWXB 1T6SA 2P5KA 2BGCA 2D2WA 3T0YA 2HQRA 2W24A 2F4PA 2OQRA 2XAGA 2L4MA 3GXOA 5JCTA 1YS7A 1SAXA 2KJBA 2FQ3A 4EM0B 2OZ6A 4KUMA 1X8EA 1V70A 4RS8A 4LA2A 2YR2A 1OR7A 4RGUA 2MH2A 2FXAA 4IEVA 1Y9QA 1YIOA 2DBBA 2UXXA 5BS6A 4KWJA 4G7OF 1K7AA 4RB1A 2WFPA 1FYMA 1O57A 5CVRA 5E8IA 4IERA 3BP8A 4M9XA 4GXOA 3ZMTA 3EQLF 3HUGA 5FLJA 5HLIA 2NNYA 4K8FA 2OPKA 5CLSA 5FLHA 2WWYA 1YW9A 1ZH5A 4UBHA 3E6CC 4EJTA 3GBFA 1NXMA 4R8HA 3DPLC 4OIRF 1ZGAA 4N0BA 1DZTA 3MEXA 1P92A 4RGXA 2DFIA 2IXJA 3KFWX 5ICCA 3NEUA 2QWWA 5D8LB 5I91A 4YFXF 5L3FA 4IJAA 5I93A 4QGMA 3ZMUA 2E7XA 1JGSA 1U5TB 3CTAA 1SMTA 1TW3A 4GULA 1B9MA 1XGOA 3CLOA 5AVPA 4U7DA 5LEKA 1CAXB 1ZN2A 1JE8A 3DV8A 3M3IA 4Q0SA 2LKPA 4XFAA 3KEOA 5KHIA 1Q43A 4ENKA 1R36A 4M6XA 1R58A 1L0OC 3O6BB 5HS8A 2K0GA 3GVAA 4M72A 4OMYA 4R1HA 1EP0A 4I01A 4HBLA 4XF3A 2Z69A 3T8RA 4EGZA 4XFIA 3U11A 2P17A 1G4DA 4A0YA 3CLPA 2WTEA 1FNNA 1V4RA 3H3UA 1IF1A 3EETA 1OYIA 2EFOA 2LSOA 1W7PD 4HA8A 1IAWA 2XL7A 1FBUA 3VOEA 1YFXA 1RUNA 4HQEA 1RL3A 3B73A 1BI2A 5BUVA 1FT9A 1IRGA 3MCZA 1O5LA 4LTAA 2HWVA 2W84A 2QDRA 2MNGA 3KCCA 1SD4A 5K8SA 5CVIA 2XGXA 3ECHA 2ZCWA 3LFKA 4XBFA 4EQQA 3RPQA 3GFMA 1UFMA 3TOAA 5C6CA 4ZYEA 3QU3A 2IA2A 2V6CA 2VC0A 3SHFA 5BY5A 2FRHA 4QLCU 2GC0A 5JI6A 4XF0A 5KHGA 2VQAA 3DQVC 1ZGJA 3BZ6A 3DPTA 3EYIA 3TDUC 4H0EA 4M6YA 4UV9A 1FWZA 3I64A 1LNWA 4MGKE 2H6CA 1O4TA 1Y3TA 4UNOA 1W7PB 2A6HF 4CZZA 5CADA 3WGIA 3LSTA 3P9IA 2PQQA 2B9UA 3TNQA 2IVMA 5J8FA 1T2KA 3OGJA 2Q4SA 5DD4A 2C6YA 5LBQA 1B9NA 1IXSB 3BALA 4HVQA 2XLAA 1QXJA 4ZU5A 2FNPA 2E1NA 2JRTA 2P5VA 5EEHA 2VE9A 3KP7A 4KIFA 2Q0OA 2PA7A 4E2QA 2PAEA 4D7SA 4AIHA 2HTSA 3ABTA 1Z6TA 1FYKA 4Q48A 1J3PA 4O3MA 2CW0F 2A69F 1HKTA 1FBQA 3WODF 2EB7A 2VC1A 1CAWA 3BROA 3VEPA 5FB2A 1LDJA 4Z2YA 2OU2A 4LGWA 3QAHA 4LK1F 4RB2C 3SXYA 1R23A 2LDUA 3I7DA 3P9CA 4MEXF 1ZLKA 3SFZA 2IXHA 3MQ0A 1ZG5A 1ZZBA 2RNJA 3TO6A 2P4WA 3KZZA 4QGNA 3HSEA 4CGZA 4AQ6A 3WW2A 1JUHA 2PQ8A 2A6EF 4IRGA 4OU0A 2WC2A 4ZYGA 1LB2A 1FYLA 1LEAA 1P4WA 3E5UA 2IXIA 4YG2F 4IVNA 2RVCA 1R7JA 2HFHA 5HDGA 3GFIA 5BV6A 4EWEA 3EQEA 4ON0A 2HEOA 1USTA 3U9GA 1D8JA 1U12A 1XGMA 2DW4A 5JAXA 2F5DA 1ZREA 1G3TA 3DXJF 1ON1A 3DL3A 4QGLA 2O03A 1EH6A 5L3BA 3OCPA 5FFZA 1LDKB 1U5TA 4MQVA 2HDCA 1IRFA 3K1MA 1J2XA 1G3SA 2R3SA 2KIMA 1O3SA 1CAXA 3SCGA 3H7YA 1FPQA 4IRIA 2JPBA 3ABUA 4ZU7A 4L5IA 1R00A 2DO7A 1O7FA 4I0AA 1H1MA 4FBFA 2E9QA 2EA2A 2HOEA 2F5CA 3IHUA 4AIKA 1OPCA 3LOIA 1LVAA 5HDNA 1OFNA 5FLIA 4Q0UA 5ERIA 5LHHA 2HYFA 4FX4A 4IEZA 3ULQB 2XAJA 2XRNA 3TKYA 2V1DA 3WTVC 1C0WA 2XAHA 4S05A 2A61A 2XVCA 4PGHA 1P6RA 4XF4A 3CUOA 4KWLA 1D3YA 1XGNA 2L01A 4MTDA 1WRJA 2ZMEB 2EFPA 1BM9A 1Z6RA 2O8XA 4GO1A 4Q0PA 1FY7A 4XLNF 3LAGA 2GA1A 2M87A 3ZMZA 2G7HA 2Y48A 3F6OA 4WZCA 1QBJA 5FGMA 2OBPA 2VN2A 3BDDA 4JTNA 1GQGA 2ET7A 3TO9A 5D5WB 2Z33A 3WE2A 4D7TA 3K0LA 4OOIA 3CDHA 3SXWA 3HOTA 4A2UA 1F4KA 1TNSA 1NZCA 4KNYA 2JT1A 4XEZA 4ESFA 2NS0A 3ISPA 2IXLA 1GXQA 4HV6A 4DINB 2FBHA 3M70A 3L2HA 3J80K 1TTYA 3WW1A 1W7PA 2ISZA 2A5YB 4KYWA 1YTYA 4U0VA 3L9FA 5E17F 4HLXA 5K5RA 5HS9A 1HBXG 1ZNPA 3KGZA 2OA2A 5BPXA 4KFCA 1BI0A 2QUFA 3KLNA 4J1XA 4Z07A 4XRFA 3F72A 3IDCB 1XB4A 4LJZF 1V3FA 2EFNA 3G73A 3SHRA 1ZRCA 1P4AA 4GCVA 3EDPA 4EM1A 4XETA 5E1ZB 2UXNA 4AQ2A 2XUBA 1YFUA 1J9IA 3E6DA 3JZVA 3D82A 2GZWA 1J3RA 1EPZA 3R0AA 4BHPA 5F64A 4ASNA 1O3RA 2FNAA 4LEJA 4AVBA 1LR5A 4Q47A 4G94A 3H92A 1E17A 5LEJA 1YLFA 2ZBKA 1GVJA 3DN7A 4EJUA 2IXKA 3FMSA 3U2RA 1LKNA 4OFGA 5H6RA 1RGSA 1HSJA 4IHTA 2IRFG 5L3GA 2Q1ZB 4AD9A 4G6QA 2IW5A 4EJWA 3P7NA 1WKMA 3DF8A 4IF4A 2DK5A 2RV8A 2VOOA 4I09A 1X3UA 3FXQA 3EYYA 5D5VB 3I59B 4I98B 2MHFA 2L02A 3FXRA 2RC4A 5FPXA 5LLQA 1YHFA 2EVXA 2ACJA 1KQ8A 3WU1B 4ZYHA 3AAFA 3DKWA 3LA2A 5LGNA 4HBNA 2W57A 5ILUA 2DCTA 1U2WA 1ZRDA 2VT2A 3FHIB 3E97A 1B1BA 3IKTA 1XRUA 1Y0UA 4UVAA 2VE8A 3PQKA 1KGSA 3B02A 2ZFWA 4YYOA 4EJVA 4QM8A 3WW3A 5CVUA 3FM5A 3R6SA 4YFKF 2FQPA 1UIKA 3RKYA 1YW8A 2HKOA 3DP7A 4LFUA 2PI0A 3CJXA 2F5FA 2VXZA 1P4XA 3WTUC 4PIYA 3VHRA 4KIBA 1RUOA 4PJYA 4QXKA 3HT2A 1QZYA 3N4MA 1EH8A 2K27A 4IRHA 3EHKA 2CG4A 1O3QA 3ML6A 2EWNA 1CGPA 5I0UA 1W5TA 5FLXZ 5HOOA 1B59A 4IHSA 3H1MA 1IN7A 3I58A 3KP3A 3KP6A 5TRDA 1K79A 2ZMEA 3H8UA 5DCFA 1J58A 3R60A 4Q5SF 1CAWB 2M30A 4BYYA 5FO5A 5IT9Z 4F7ZA 1CX4A 2MD5A 3KMHA 4HV5A 2IA1A 3NSTA 3E6BA 4IEYA 1DDNA 2GC3A 5D5UB 4HAMA 2XASA 4OIOF 1VTNC 3RPUA 4RD7A 1XMKA 5BXXA 4K2EA 4YFNF 1PP7U 2ESNA 3WTZA 3C3WA 1YFHA 1W5SA 5FQ0A 2FMYA 3PLQA 4I0BA 4CXFA 1DP7P 4GYGA 1UCRA 3WGHA 5D6FA 1ON2A 2VBZA 3OTFA 3V8KA 3EJKA 4UV8A 4NQWA 3QOPA 3MDPA 4E2GA 5E1WA 4IETA 2P6TA 4OIPF 4TLFA 5D6EA 2MBFA 2R7DA 1NHAA 1FSHA 3E5XA 2XIGA 3C7JA 4DQ2A 5JFRA 3CUQB 3V7CA 4N9IA 3GO5A 1DGRA 5CVVA 1PDNC 1SD7A 2KRFA 4HX8A 3U0ZA 5IT3A 2XKPA 4L0ZB 3ZMVA 4A0XA 5FFXA 4J1WA 2EJRA 3FX3A 3UKVA 3HSRA 3KP5A 2QZ8A 2VOPA 4L2NA 2UWMA 2D1VA 4QM9A 4QX5A 2EFQA 2CSOA 3C1DA 4O9EA 2HS5A 3V7SA 2UY9A 3F8CA 2YPRA 3HYIA 4WCGA 3F21A 1IPKA 2GIVA 1GQHA 2QQ9A 4DNCA 1FBSA 1KQ0A 1FSEA 3GEZA 2LF8A 5CVJA 3GZ5A 3KE2A 4L18B 4BAYA 4WXDA 2H0VA 5I8TA 1HW1A 1OD5A 1BIBA 2M45A 3GUDA 4UHTA 4QMAA 4ZH4F 2QLZA 3I59A 2OZUA 4LUMA 2CQKA 4OIQF 3M8EA 1QZZA 3F3XA 4G7ZF 4ESBA 4ZZDA 2FOKA 1DPUA 2MA3A 2HYGD 3ROUA 3TNPB 2O8QA 3IDBB 5KK1A 3LZZA 4Z82A 5DV5A 1TQ5A 2CAVA 4TV7A 3FMQA 2VODA 1D5VA 5KVRA 3BU7A 2PJPA 3VFZA 1Q5OA 2COMA 1KA8A 3FE5A 4R52A 1UHWA 4KN7X 4P9GA 1BC8C 3BWGA 5JR3A 2TDXA 5H20A 2FBIA 2XLGA 4HLYA 1IN6A 3HSFA 4PCQA 2XL9A 1R5HA 3LAJA 5E1XA 4MUVA 2JPCA 3ACLA 2CWEA 4KA4A 1HW2A 4M9SA 5EFUA 4L9TA 3COAC 1ZLJA 4KWKA 3NKTA 4PIZA 5DUKA 5JHUA 4RAZA 2Q30A 1BN5A 2QNKA 4O5VA 2IC1A 5BOXA 5D1IA 2BE5F 3ZP5A 3TO7A 4GYIA 2L3DA 4ZU4A 4WBBA 3ECOA 2EV5A 2BV6A 5EEGA 2QBYB 3ZN0A 1O5UA 1IZ1A 3GZ6A 5HLHA 1R1TA 1AOYA 4MTEA 5E8GA 2D1HA 1YYVA 4XSZF 3RKWA 3GLXA 5ICGA 1NYWA 2AXLA 5LHGA 3HHHA 1S3JA 1QNTA 3QU6A 1IPJA 2NNNA 2XV4S 1SFXA 5ED4A 3E3VA 3K9TA 3TOBA 4FT8A 2GC1A 2VBWA 4KIGA 4MHGA 2DPDA 3HOSA 4HF2A 4GGGA 3IIAA 4CYDA 5FD5A 4EJOA 1UHMA 1J7KA 4MGIE 2DTRA 4I7HA 1XE7A 1KU2A 5JR7B 3FXUA 4HOBA 3HT1A 1UW8A 1QPMA 4UXNA 4KU8A 1XN7A 5E20A 1YLLA 5EZWA 5C8WA 4XF1A 4RGSA 1KU7A 3HRTA 5K5QA 2CO5A 4XFGA 3F8MA 2H27A 1G6NA 2GA2A 2DK8A 3ELNA 1BI1A 3CUQA 4YSFA 5D4SA 3WW4A 2FF4A 1EYBA 4Y13A 1UIJA 4B09A 1VP6A 4EWDA 3K69A 4YIFA 2D40A 3VODA 2DT5A 1I5ZA 2STWA 4L11A 3SZTA 2DU9A 5HVQC 1MD0A 2L4AA 3MWMA 5HS7A 1QXRA 1XCVA 5DEQA 3SCHA 1J59A 2Z2SB 1Z7UA 2Y75A 5BPDA 4I02A 1ZZ9A 3G7DA 4HVRA 5BPIA 3ZQ7A 2Q2EA 5HLGA 1PP8F 4M74A 3PVBB 3NQOA 1D8KA 1X8MA 3GYDA 2HR3A 1ZG1A 2ZKZA 4WVZA 2VECA 3CJNA 3JAMZ 4A6EA 3H9AA 1I6XA 2ET1A 2W25A 2O1QA 3ZPLA 1OMIA 3RNSA 4ENNA 5LHIA 1WSUA 2V9VA 2K7LA 4X6RB 5FLXK 4RAYA 1XMAA 1UPIA 3H1YA 4BXUA 1K78B 1I1GA 2UZKA 4ETSA 2D93A 4G6DA 2QENA 2QQBA 5IT9K 1EH7A 2PAKA 2VPVA 5I0RA 1CAUB 1SQ4A 4H7LA 1REPC 1S29A 4F8AA 3V8JA 5HDKA 2IA0A 3USSA 4NVPA 5FQ0B 4UXAA 2EV0A 4WX9A 1QY4A 2EK5A 4IXAA 2CYYA 2ISYA 3BJAA 4L9JA 3RI4A 4HDUA 1MJBA 3FWEA 1FLIA 2DI3A 4MEYF 5TJJA 3L2CA 3DEUA 4MQ9F 4HX7A 1L3LA 3L09A 2P6SA 3ETQA 1Q3EA 4XFFA 3W6KB 1S7OA 3RYRA 3FMRA 2Q0AA 3L00A 4MGRA 5JSRA 5L3DA 3HTSB 2ETHA 4RB0A 5BMZA 4BNCA 4G7HF 2NRAC 1ULYA 4KT5C 3QACA 4FX0A 1WLTA 2Y0OA 3MPBA 3F8FA 4YNIA 1R1VA 2CFXA 5ILVA 4A0ZA 2QBYA 3WTXC 4JVAA 2Y0MA 2MLKA 3M7GA 3RYKA 2V09A 4LD5A 3KZYA 4NHJA 3M8FA 2XLFA 1NE4A 4L0YB 3D0SA 2W85A 2HJIA 4FAHA 2LF7A 4HF0A 3OD0A 3E6MA 1RTVA 1XGSA 4HN1A 3RTRA 1LDDA 2MLGA 4AIJA 4ENJA 3TGNA 2ZO4A 3LA3A 3BJOA 2UYAA 4YRDA 1TQMA 3I54A 3MFKA 1ZZ7A 4LLGF 2IP2A 1MJAA 1TBXA 1ZRFA 3LA7A 1T98A 2R7FA 4A6DA 2QM3A 1A04A 3O14A 1G3YA 1GXPA 4D0PA 4L5JA 2N7GA 4RB3C 1CF7B 3EUHA 1FP1D 2PAMA 2VT3A 4JTOA 3L7WA 4YIIA 3Q9SA 3ES4A 3PQJA 3FHZA 2A3SA 3OV8A 3CO6C 2C0ZA 3CF6E 5I8YA 1DGWA 2P7VB 4UVCA 2O0YA 2K02A 3WTTC 2FSWA 1O3TA 4BHBA 3CO2A 1X82A 4OLLA 1IUYA 3QPTA 2XAFA 1BC7C 5D5XB 1XDSA 2M1BA 4EWAA 1ZRRA 4XFCA 3WTYC 3HRMA 1HKQA 4JQFA 2ZNYA 4BIFA 4HX4A 5CYVA 3KSCA 2OD5A 2V1XA 4LG0B 2UY8A 4ZZLA 3P9KA 4KMUX 2Z9OA 2CGPA 4YARA 3U10A 1ZZ6A 2J5OA 1QGPA 2PN6A 3F8BA 3F23A 3JSPA 3F8NA 1I27A 5DCMB 3BB6A 1IW7F 1WQ2A 2P7CB 1BIAA 1BBYA 2QYOA 4P55A 2QQAA 1MGTA 2F5EA 4Q0QA 3FFQA 4LB6B 2I45A 1K78A 3BJ6A 2IT0A 1YQAA 2P8TA 4O9GA 3HRSA 4I3PA 1BOAA 2PEXA 4KU7A 5JSOA 2M8EA 4XLPF 3RYPA 2FEZA 5A2QZ 1CAUA 4A5NA 2GXBA 4Y15A 3S0MA 2BBYA 1FOKA 2KJCA 2FBKA 5I0TA 1QWRA 2ZNZA 3LQRA 3J80Z 4IEQA 2K4JA 2GQQA 1IN8A 4B29A 2CV6A 1JXSA 4E2SA 1X7NA 1UD1A 1LJ9A 3MYXA 3JW4A 3ZN1A 2JSCA 5LRSA 3WG9A 3I5UA 2IPQX 4MH0E 4AVAA 4OINF 1YS6A 1Z05A 4P5OA 3K1PA 4U0WA 4EVIA 3U1DA 5BQTA 5KHKA 5AIQA 3I4PA 3PFIA 1KQ9A 2UYBA 1LQ1A 3REOA 1J3QA 4EROA 2H09A 4PIXA 3QRFF 1YFYA 3IL2A 2DPUA 4WF2A 1XCBA 5E16A 4FHTA 4IESA 3LQQA 3WU0A 1HSTA 2XKOA 2EA4A 3BPVA 3BPZA 5F1RA 2RGVA 4IEUA 4M71A 1XSDA 5DYMA 1MZBA 5LGTA 1U78A 5J3UA 4Q29A 1PMIA 4LLOA 1Z91A 4CO8A 3CL1A 4XF9A 3ERED 1FC3A 1YO5C 4LMYA 2B8MA 3GW2A 3J81Z 2ZJ2A 2GH2A 3OF1A 2V1UA 3FZVA 2PFBA 1H9GA 2GXGA 3HHGA 3IKVA 1HQCA 1U8RA 2J5PA 2DLLA 2YSRA 2EFWA 2NYXA 3KETA 3LWFA 1F1ZA 3F22A 3ST7A 3M1EA 3QPHA 1CF7A 3RZZA 3JAMK 4LK0F 4HMZA 1XDUA 5K1YA 4U0YA 3GWZA 3G3ZA 3GF2A 4N9HA 5AIPA 4MV2A 4U7BA 1RZ4A 1F5TA 3TDZC 3EO6A 1KYWA 1WA4A 3HQXA 3KP4A 2PTMA 1BI3A 1CAVB 4EGYA 1QQIA 3KP2A 1YFWA 4OMZA 2V79A 2PBIA 1VJ2A 2B5HA 1ZYRF 4P96A 3BY6A 3M9AA 4EM2A 4A5MA 4CHUA 3C3VA 1E2XA 2O6GE 3O3KA 3NL1A 5CU1A 4EMSA 1EV7A 4P9FA 2HQNA 3ES1A 1B6AA 2QVSB 4LG0A 3FJSA 2KIFA 1MDMB 2A68F 2HZTA 1UCXA 3IC7A 1S8NA 4HSLA 3FZ3A 1FP2A 3ZMDA 2NAZA 1TW2A 1R5GA 5FPZA 4ORFA 3V7RA 2VBYA 1T0FA 5DCMA 3KLOA 1H0MA 1SFEA 3OOPA 3WTWC 5I0SA 3UKNA 1ZHFA 1ZAOA 3IWZA 3WE3A 3EBRA 3V8LA 1IXCA 5FD6A 4B8XA 5DUIA 1LEBA 1Q1HA 4META 1S6LA 1TQPA 3R0JA 2GAUA 3S2WA 1ZZ8A 2IXCA 2ELHA 1J0RA 3S7EA 1DZRA 2E7WA 1XD7A 4X6QB 2VBXA 1P2FA 2ETEA 4KN4X 5AONA 2JZYA 1ONVA 3JSOA 1Z9CA 3S7IA 3T8TA 2VONA 3NW4A 4L9VA 5JVTA 1MKMA 4EV0A 3SZPA 2PG4A 3IRRA 1RIOH 1WI9A 1G3WA 4Y17A 1K6OA 2P5LC 3V4GA 4HZFA 1YG2A 3RDIA 3I0TA 3ELKA 4UBGA 4HF1A 1U6GA 3Q5FA 1JHFA 1SMYF 4KMFA 3H1WA 3NJZA 3MZHA 4AVPA 2IJLA 1L3JA 1OYYA 4G8XA 1T38A 3BPXA 4R79A 2A07F 2ADUA 4I2OA 4IEWA 1R22A 2HTJA 2G7UA 2K86A 4Q0VA 4MX3A 4CDGA 4JV4A 4PGGA 5HI0A 2RN7A 3WGGA 2EV6A 2FA5A 5JSPA 1NE6A 1MJ9A 3GFJA 2WV0A 3HIFA 1H1IA 2GC2A 4HN0A 2HKXA 4LULA 1KU9A 3IWFA 5D8KB 5J48A 4HVOA 3HTUA 4XFHA 1PM7A 4HW0A 4MGYE 5DDGA 1OI6A 2RDPA 5ILSA 2FMLA 3SCFA 4S04A 4IEOA 2QVOA 4U88A 4P9UA 1USSA 2JTVA 1SEFA 2H94A 3R61A 1HW5A 3RKXA 1IN5A 2DAOA 2Q8KA 1VR3A 3CO7C 1ZX5A 1XSXA 4KDPA 1F9NA 3N97A 5ICEA 1ZG3A 3IBMA 2OYZA 1SD6A 3JTGA 3GX4X 1KU3A 4ESJA 3H7JA 1U3EM 3QP5A 2EAAA 2GU9A 1R1UA 4IPAA 3PNAA
chains in the Genus database with same CATH superfamily
2ZXQA 3IDEA 4CDXA 2ZHLA 1W8TA 2X10A 3J7AO 1NKGA 1FZPB 1MMAA 1TLHB 1JS9A 3D5LA 5CFDB 2E2IJ 5KBFA 3A02A 1UF2C 5M5WJ 5K5OA 2L54A 2WABA 3J4UH 2WADA 1OUXA 3ZMSA 2PMHA 3UKTA 5H2FC 4ZY9A 1WJFA 2HOAA 3RMYA 2O9LA 3SQNA 1IN4A 2WFF1 1HXS2 3NRVA 1MMNA 1W28A 3SC7X 2IFWA 1UU5A 4CCCA 3FM3A 4ZYDA 4CZSA 2BTVC 2KXLA 4NPRA 1W4MA 2CWMA 4DUXA 3LAPA 2X0LA 4G9YA 1XSQA 4JGZA 2M5WA 2JA7J 4B4QA 2D5FA 2B7YA 3JRGA 2KKOA 4JHZA 3MZYA 3IMNA 2R7RA 1GZCA 1VQ4I 1GR3A 3W6JB 1X50A 5A3PA 3TP3A 1HN1A 3ABKH 4FPHA 1MQTC 2DOFA 3CBNA 3M3EA 4URAA 4XN0A 3VZLA 3LQCA 2IEKA 1I1SA 2VQ0A 1XTAA 1DYOA 3GFLA 4HSJA 2X4HA 3C18A 5FMDA 4LB5A 5J7MA 1CVNA 4IEXA 5CISA 4TYSA 1WLCA 3SMHA 5GZFA 4YW1A 1RUG3 4DY3A 2PLYA 1CN1A 4YGEA 4LO7A 4IO9F 4ZXKA 5K7FA 4M01A 1ZR4A 4BHCA 4M00A 4BQAA 5E6HA 3MEPA 1QO0D 4CDQC 1JT6A 2OA4A 4LUKA 2R7TA 1B35B 5J8CA 1RKTA 2WT0A 4PQQA 3K1NA 4LK6A 1WMFA 3VZMA 3ZSJA 3O0VA 2VB6A 1ZARA 4XC9A 3CZJA 4B44A 3I4MJ 3WTSC 3MW4A 2LOOA 4WXHA 1HC8A 3NAPA 3EUKL 3BTZA 4XE9A 1WWXA 2C4XA 4XSXF 4QAWA 3CMMA 2ZJCA 4KICA 3V0AA 4Q4X2 2DQLA 4A7ZA 2RHPA 4MGZE 4C0HA 2P5BA 3HNYM 4B47A 3JTHA 4BXSV 2RMU2 3ZYPA 5L36A 1ZZCA 4WZFA 2D44A 3U1XA 4PF5A 1PK6B 3RKQA 2QE3A 3OR1C 1OVSA 3ZM8A 1QJU2 1UG0A 1U9OA 3RWNA 3BU0A 5J3LA 2D45A 1SMVA 3FXOA 1T08B 2E6VA 1UNBA 1HQLA 3FHAA 5HCHA 1YX3A 2OC6A 5ABJB 2M4GA 3C7HA 1B09A 3AG1H 1WGPA 3GYHX 1QJEA 1RC9A 1XS9A 3RQ4A 3N3HA 4ZKTB 1Z1DA 4C3IJ 1T6SA 1HRV3 2VOTA 2D2WA 1O4XA 2JK3A 1URXA 5SV8A 1W5CC 2LRPA 4KGGA 5JOXA 4NJ4A 4Y52J 1W6PA 4HETA 1AZDA 4EM0B 2WQZC 2L7ZA 1NOVA 1UX7A 3KVAA 2YR2A 3B01A 5K7ZA 1YIOA 2DMPA 2UXXA 5BS6A 4G7OF 5D21A 4UF0A 2B9VA 3BP8A 2VZ1A 4GXOA 3ZMTA 1HB3A 2W91A 3I4IA 5F3EA 3EQLF 1G9BA 2WZR1 4QPGB 2L2OA 1EUUA 5FLHA 4PI0A 1JUMA 2ZXHA 2RR11 1QHHD 1DLCA 2W47A 1TP4A 3GNEA 4R9DA 5F0CA 5IK5A 2IXJA 4XUTA 5ICCA 3CMEI 3NEUA 5I91A 1QQP1 4UW6A 1ZQ3P 2WQ8A 2E7XA 1JGSA 3CTAA 1U5TB 1RUG2 1SEUA 2EZKA 2IGNA 3BTLA 1OLQA 1MEC3 4K1ZA 3RSNA 4PBOA 3O1PA 4KISA 1YI2I 1S9HA 1BVP1 1BEV3 4M6XA 3GVAA 4M72A 4MSVA 4XYXA 1TWAJ 2YY1A 1MSEC 2GIZA 1EP0A 2JKXA 4IE7A 2ZEYA 1HQWA 3OL4A 4EGZA 1JUSA 3DTKA 4AI2A 4XDOA 1G4DA 2JSPA 2WTEA 1FNNA 1V4RA 3VL8A 5FYBA 1TT0A 1S0CA 2X1CA 1W8HA 2LSOA 1IAWA 1W7PD 1VNDA 2DFFA 3OGGA 2VI6A 4QHBA 1V6OA 1YFXA 1ODNA 1RL3A 4UWDA 5BUVA 1JHNA 1RUJ1 2ZMEC 2NVUB 1IRGA 3MCZA 4R9AA 3M3YJ 3DBLB 4LTAA 2P1BA 2RS53 1ASJ1 1LULA 2MNGA 4AEMA 1SD4A 2XGXA 5CNAA 1N47A 3RPQA 5M5XJ 3OSDA 4XRSG 3BLYA 1UFMA 2P3IA 3A2KA 5C6CA 4XL9A 3VGIA 2VJ4A 1W6MA 4XF0A 5KHGA 1S7EA 3DQVC 3DPTA 3EYIA 3NWKA 4M6YA 5GZGA 1XC6A 2L0KA 2NOJB 3AL0C 4IKFA 1UYYA 2H6CA 2R071 3RFRA 4CZZA 3LSTA 3UNGC 4BUPA 4YZ1A 1RUE3 2DN0A 4MHUA 3AP7A 3OGJA 1OOPC 5LBQA 1XPXA 1W8OA 3WP6A 3VBRB 1OPMA 1A35A 1JZ3A 2ARXA 4HK8A 2FNPA 3U78A 2P5VA 3ON7A 5DPNA 3OYBA 3KP7A 4KIFA 2Q0OA 4D7SA 3ABTA 4LXLA 1MMDA 1Z3YA 2VUJA 2CW0F 3MKLA 1P7IA 1HJGA 2VC1A 4Q4Y3 1LDJA 2OU2A 1FV2A 3QAHA 3FBMA 1KS4A 1HCRA 3AVSA 4G12A 3SXYA 4W1UA 2AEYA 1MBHA 3I7DA 1OLRA 2IXHA 2WKKA 4QKNA 3MQ0A 2DURA 2XXZA 3OYDA 1ZG5A 1GT0C 2V72A 5B5EC 4XXPA 5C3EJ 1YRNA 4QGNA 1PGW2 4BXFA 5H9PA 3WW2A 1JUHA 4D5FA 5A33B 2I07B 4BU2A 1ACIA 3FK7A 1VMHA 1LB2A 1FYLA 1LEAA 1LU1A 4YG2F 2RVCA 5J36A 1AVBA 1MQTA 1NY72 3OB8A 2ERFA 1L7QA 2D97A 5BV6A 1V6MA 5FYIA 4CU8A 4ON0A 2HEOA 5F04A 2HWD1 1U12A 3CC4I 1D8JA 1XGMA 3ZQHA 2DW4A 2RDQA 2D3SA 2F5DA 1SLBA 1ND2B 3Q0UA 1W39A 4DEVA 1ON1A 2KHMA 2O03A 1EH6A 5LATA 3F2ZA 1WMDA 3OCPA 5FZFA 5FFZA 3POWA 1IRFA 4NWWA 1J2XA 1WJEA 4LOTA 1O59A 3V56A 2JX9A 3EPZA 5FV3A 3ZKYA 1R00A 2XF6A 1YIFA 4I0AA 4FTEA 4CDQA 2EIMH 4AIKA 5CKQA 2A6YA 3LSMA 3MLKA 5HDNA 4QDSA 1R1ZA 3CNAA 5FLIA 4QD2A 3KB5A 3QOEA 3O7OA 4H55A 4YM2A 2EXKA 2JD9A 3J8F3 3TKYA 2V1DA 2XAHA 1GP6A 3CCLI 4RS5B 2R5YB 1PHMA 4MTDA 2EFPA 4FFFA 4GJZA 3VBUC 1KONA 3AL6A 1U5IA 2YU9J 3VBSC 3LSGA 3HNBM 4XLNF 2M87A 3MLLA 5FZ3A 1QOTA 1GWLA 2Y48A 3BVCA 4OI1A 1VE0A 5FGMA 2Q1MA 1GQGA 1US2A 2ET7A 3TO9A 4QKBA 2Z33A 4D7TA 1BQPA 3K0LA 3CDHA 1ENSA 3HBZA 5HV4A 2Y38A 3SXWA 3MN2A 3HOTA 4B43A 2R5ZB 4CCLA 4PCRA 1RMU1 4E7ZA 4AIDA 4XEZA 5JLVA 4ESFA 3HPHA 3ISPA 2OT7A 1YX5A 4HV6A 4DINB 3L2HA 1RUE2 5IP7J 4FXGB 3I2JA 3NWSA 3WW1A 2NOGA 4KYWA 1TME2 4DJAA 3RZLA 2VY0A 5E17F 3CDLA 2R93J 3H0DA 4PJNA 1R64A 1LTEA 1H8TB 1UU4A 2NLRA 1HBXG 1ZNPA 2OA2A 4XRFA 3F72A 1IPSA 4G9SB 5CKNA 3T0DA 2JE9A 3SHRA 2FDKA 2UXNA 2XUBA 1YFUA 3V42A 5F39A 3ZR8X 3HZJA 4XJ9A 4NUBA 3KYCB 5JI7A 1RUC1 3GF6A 5FO9B 3R0AA 2L7MP 2QSHX 1XU1A 2FNAA 4OHWA 4QPQA 1LR5A 5JVVA 4ES8A 4AFBA 4Q47A 4XCAA 3BYWA 4G6TB 5LEJA 4QTRA 1WH5A 2MGQA 1K12A 1WCQA 4QU1A 5DUXA 3FMSA 4FP3A 4JP0A 1UMHA 4OFGA 3OYNA 2OCEA 1MNMC 2WUHA 2XWJB 2HVSA 1RIRA 3OIOA 2ECCA 4EATA 1F8VA 2BW3B 4BDVB 2J1AA 4CDUA 4EJWA 1NT0A 4IQPA 1MMGA 4IF4A 3K4ZA 2RV8A 1F5FA 3EYYA 2G9ZA 1JH5A 2ZSIB 2MC4A 4LKSA 1ETQA 3FXRA 4AEJA 1AX2A 3O1MA 4NIGA 1VBA1 2EVXA 3ZYGA 2VCMA 4ZYHA 3AAFA 2VOKA 3DKWA 1QMJA 4HBNA 4XAAA 5ILUA 2YBPA 2ZBJA 1U2WA 1ZRDA 2VT2A 3FHIB 1U5ZA 2HWE3 2JDKA 1F36A 2JG9B 4UVAA 4IL6C 2BVBA 2ZFWA 5DG2A 3I8TA 3JRFA 3VPRA 3WW3A 1WCKA 1FMWA 3R6SA 2E1MB 4LQRA 3LSDA 5AC92 4LO4B 3G71I 5FPBA 2PI0A 4FO9A 2FX0A 4OMCA 2Y6HA 5A7NA 4PIYA 4Q1PA 3VHRA 1ORKA 1RUOA 3WG7H 4PJYA 3HT2A 3AJYA 2K27A 4IRHA 1UO9A 1YHQI 2LM3A 3ZVXA 5IP6A 4RR3B 3LEIA 4IHSA 3VD5A 5JXJA 3U21A 5F5QA 2ZMEA 2VMEA 2BUKA 2LRDA 1J58A 1I3QJ 4GB31 3R60A 2QQWA 2M30A 3QYBA 3Q8EA 2P6HA 5FPAA 1XNAA 4WM7B 3KMHA 2RDSA 1SLLA 1GZWB 3BR1A 2NS8A 2ZEXA 3NSTA 4IEYA 2AYHA 2RJKA 3AMMA 3KHBA 1IG7A 2GC3A 4XORA 4UW5A 4BXXJ 5C4WB 2W87A 2JA2A 4TZDA 2CU5A 2E36A 4YW6A 3WTZA 1VMJA 2VG9A 1F5JA 1REDA 4NIAA 1ZRIA 2FMYA 3PLQA 4I0BA 4CXFA 2VBZA 3V8KA 4ZS3A 3CU7A 2JG8C 4GIQA 4UV8A 1OOPA 4F83A 4E2GA 3O1SA 5LY1A 1BXHA 3MHZA 3FHQA 4IETA 2VZVA 2XF5A 2K46A 3HJEA 5GM0A 3THTA 3R0RA 3KT7A 2WN2A 2XMLA 2L5QA 4AI3A 4W50A 4M0NA 4AHYA 4XNFA 3W6VA 5FYCA 5IT3A 3M1HA 3H36A 4L0ZB 3ZMVA 4E27A 2ZEWA 4B3AA 5FFXA 4AQTA 1V9U3 1VQMI 2EJRA 1H9WA 3POGA 2QZ8A 3SEEA 2XDVA 4L2NA 2UWMA 1WLDA 4QX5A 5FMCA 2BHYA 4UI9L 4PQ9A 1SG3A 1PO22 4Y1VA 2YPRA 1JOJA 1FJLA 1IPKA 4IQ4A 3Q8BA 2CGOA 1VIWB 3VZKA 4DNCA 1KQ0A 2LF8A 5CFCB 4CDWA 4BAYA 1MS0A 3FKIJ 3T0BA 3AYDA 2LG4A 2H0VA 3A0HC 1RUD1 1G8WA 1F35A 2R7UA 5DABA 1CONA 4HONA 5JR2A 1T8IA 2CQKA 2X29A 5C9AA 4OIQF 3KPHA 1K5JA 3AK0A 1DG6A 1QZZA 2HWE2 5A80A 5EYYA 4ZZDA 4ASKA 2G19A 2GMEA 1PIV1 1DPUA 5A7SA 4QHZA 5T5PA 2MA3A 2HYGD 3THPA 3TNPB 5E3OA 4AOCA 2AENA 2PJRA 1AR63 4GWJA 3S2HJ 1XBFA 2VODA 3PU3A 4LO6B 5KVRA 4BEHB 3FE5A 4R52A 2WWSA 1BC8C 1WCDJ 2ILMA 1IN6A 3HSFA 4CCKA 1R5HA 2WNOA 4MUVA 2JPCA 2CSGA 1LE8A 2CWEA 4KA4A 4QQOA 4M9SA 1GUIA 4YW5A 1PX3A 3NKTA 5JHUA 2QNKA 3ZP5A 2L3DA 2LTPA 2VBDA 3OYAA 3VBUA 4RA0A 4QX2A 3VBSA 5F6LB 2IZWA 4LBQD 4RFT0 1O5UA 1IG3A 4FOWA 1VBD3 2Q1FA 1AR93 5DUUA 4MTEA 1YYVA 3RKWA 3GLXA 3VKMA 3JRAA 2AXLA 5F7UA 3C7FA 3HHHA 1KXGA 1S3JA 1QNTA 4NRPA 2Z5WA 1U0JA 3QU6A 1YQ6A 2AZ5A 2Y6LA 1IPJA 2XV4S 1R083 4LHSA 3R4SA 3I2DA 3K9TA 4P9JA 4MIMA 1RJ8A 3BR6A 3OYWA 1W0UA 4COWA 2M2EA 2VBWA 4KIGA 4PUSA 3CF5F 4GGGA 3ACIA 2ZX0A 4NHKA 3VKOA 1J7KA 4MGIE 2ZACA 3MV01 4HOBA 1I1EA 5A32A 1B35C 1OQEA 1QPMA 4YVSC 2DU0A 1NA1C 2QKDA 1WZXA 5E20A 4M3EA 4XPVA 4GD4A 2HYXA 4XF1A 4YGBA 3WF0A 5K5QA 2QQ8A 1S2BA 5T5JA 2DK8A 4NIHA 4D9JA 1BI1A 1BYHA 3O5SA 3WW4A 4II3A 5A6YA 1RHI2 5A6ZA 1HRV1 1PZ9A 1V9U2 1S72I 1SDWA 4OVEA 4YIFA 2D40A 5A3UA 3SZTA 3T08A 4A44A 3MWMA 5DEQA 3HGGA 5CKTA 3V0BB 1Z7UA 2Y75A 3MLJA 1BW6A 3ZFEC 1ZZ9A 4MGTA 5EZGA 1OA4A 1GV2A 3AKTA 1M4WA 2CQQA 3NQOA 3O8GA 2HR3A 1GP4A 3DXUA 1NG7A 4Q4W2 1AL23 4YVWB 4WVZA 3CJNA 2J1SA 2WNUA 2L9VA 4YIRX 3H9AA 1I6XA 2BVLA 2LR8A 3RNSA 2CUJA 5ABJC 5D8AB 2DTZA 4ZTFA 2JENA 4X6RB 4COUA 5FLXK 4C30A 3H1YA 1UPIA 4BXUA 5DAXA 1SFKA 2BBAA 3UETA 1S0EA 5IT9K 1EH7A 1HDKA 2KT0A 4OULA 3V8JA 1C5HA 3USSA 4CU6A 1SLIA 2FZ1A 1LJ7A 1MEC1 5GTHC 5EHDA 4ASMB 2R043 3OS0A 3BJAA 4L9JA 4FTBA 1BEV1 2DI3A 2WNVB 3L2CA 4GALA 4XILA 4MQ9F 1L3LA 2P6SA 3MMYB 3VDXA 1CPNA 4TN7A 2WA4A 2R063 4X8NA 1D0ZA 4QPGC 4YG0A 4RGGA 4G7HF 2BXYA 3A03A 1JYNA 4BISA 1G7YA 4A0ZA 3H9JA 3WTXC 5TISC 1OCCH 2MLKA 3RYKA 1BMV1 2EXJA 2WNEA 3VBHC 4OMDA 5EJ1B 2RS51 1Z78A 1R082 1Z77A 2LF7A 4HF0A 3OD0A 5IJRA 1YQ8A 4B1LA 3AYCA 2VAUA 3I54A 4NHLA 1ZBE3 5HPOA 2C24A 2Q8EA 4LLGF 1ZRFA 1T98A 1W3VA 3AG3H 4YW7A 4QX8A 2JB4A 1G3YA 4XQFA 3JU9A 4QB2A 2X5IB 4BE1A 1GXPA 2JG8A 2N7GA 1K42A 3ZFFB 5EDNA 1FP1D 4JTOA 2JDAA 1NG6A 3ES4A 1MZEA 2P7VB 4C90A 3WCRA 2R7OA 1H2KA 3LSIA 4UVCA 1V54H 4RBOA 1UAAA 3WTTC 2BZDA 2IFRA 3KQ4B 4MXWB 1O6UA 1X82A 3QPTA 2G0EA 3ZXFA 3J7ZI 3K46A 2VMIA 1BCXA 2WSUA 1XMXA 4Q4Y1 3GTPJ 3VUOA 4FPJA 4B4CA 4BIFA 5IVJA 4HX4A 2ZHKA 3UNPA 2WZPP 3PUQA 2FUG2 1JU4A 2YC4A 4AGRA 3U10A 2PHWA 1N3PA 2A6VA 3F23A 1DDLA 3W2WA 5B1AH 3K4AA 3WF1A 2Z16A 3K75B 5DCMB 3BZKA 4CA0A 2JQ7A 3OY8B 1IW7F 1NK3P 2JA5J 3HN1A 4A45A 2HLEA 2QYOA 3BG7A 3EYPA 3TEZA 4BQYA 3DECA 4NDLA 4FFIA 2VPLA 1ETVA 1MMSA 3FFQA 1GP5A 3LSKA 2I45A 1K78A 2IT0A 4XKVA 3MUY1 2LYCA 1YQAA 3SFIA 3ALQA 1R093 4HNTA 2OQ7A 1Y8RB 2XVLA 4JKLA 4K20A 4NHXA 1RUD2 4RHV1 5A2QZ 1CAUA 2NN8A 2DMNA 3WY6A 1QNYA 2E7TA 3HXLA 3ZMOA 2OUHA 3S0MA 3RGBA 2XBO1 3ZXJA 5EXOA 2FBKA 2RNGA 1LOBA 3LQRA 2K4JA 3LSJA 4KG0A 2GQQA 2AQFA 2BERA 3ZQGA 1IN8A 5IP9J 2VNVA 3WG4A 1XJAA 3MYXA 3JW4A 3WDYA 1WZ2A 3GZUC 2HPIA 3I5UA 2OVUA 4L5EA 5FY4A 1DYKA 4OINF 1K4SA 2I10A 1JN2P 5TSWA 4DY5A 1JXNA 2XJRA 4P5OA 3U1DA 5BQTA 1U8BA 3AM2A 3J8F1 4XR6A 4AVTA 1J3QA 4EROA 1PMHX 1OCRH 3U4SA 4C8DA 1WH7A 2CHHA 1OF3A 2HYKA 2OPWA 4BZ4A 5FYMA 4IESA 3LQQA 2EA4A 3RZOJ 2MEV3 3OG2A 2EXHA 2WAQA 3FLPA 2A5WA 2B4KA 3ABZA 4IEUA 2Y6JA 2DODA 3K4NA 4CUCA 2HDWA 5J1RA 5DYMA 4XVHA 1UHSA 4XJUA 4IOCF 4LLOA 2A05A 2D6OX 1TMF2 1C3HA 4CE8A 4BJ0A 3H42B 2F4MB 3J81Z 1G9FA 4M0HA 1RJ7A 5A7PA 4CDXB 3JCUC 4ES9A 1HQCA 3I3LA 2YSRA 3KETA 1F1ZA 3F22A 4YVSA 2HEWF 4FQGA 1NA1A 3ABLH 3LFMA 2JUCA 3S30A 1CF7A 2DJNA 1N1VA 3BUCA 1OHFA 5KXEA 3DTIA 3ZSLA 3TDZC 3EO6A 3DKYA 2J7MA 2QF7A 2L7FP 1DIWA 5IT6A 1KDMA 3KP4A 2ZFUA 1Y4WA 4EGYA 1QQIA 4K40A 3VBOC 2PQSA 2PBIA 3FISA 2YZ4A 4P96A 1OR7C 3M9AA 3CMAI 4A5MA 1GANA 4CHUA 4JGZB 3C3VA 2W48A 2QA4I 5CIRA 3RMXA 1W8NA 4UFHA 2ZGPA 3ZFEA 5CU1A 4EMSA 4UFIA 3HB9A 2DYSH 2QVSB 5FZBA 2A1XA 3ZGKA 3D4KA 1MR5A 1FP2A 4OHXA 3H5NA 1YJ9I 4JGYA 2VBYA 2W3JA 1YEWA 1H0MA 3L2RA 1Y1WJ 5I0SA 2TRTA 4ET7A 4AYBN 1H8TC 4HNVA 3S2DJ 1ZHFA 5GLTA 3IWZA 3WE3A 4BL0B 1JZ6A 2NM1A 4A3BJ 1TT5B 2BBVA 4AEDA 1Q1HA 1S6LA 2HVRA 2E53A 3R0JA 2WZ8A 2GAUA 3S7EA 1APLC 2YB7A 2E7WA 1VQKI 1XD7A 3K2OA 2LKXA 5AONA 4HPQA 3KF5A 1JZ8A 2VONA 1MKMA 1RIOH 1WI9A 2A7AA 1G3WA 1K6OA 2P5LC 3V4GA 3HVDA 2WSVA 4UBGA 3LB9A 4HF1A 1U6GA 4DIQA 1BVVA 2ZX4A 3OUJA 5CZKA 1XB9A 4KITB 1D2SA 2JWTA 2WY8Q 2ADUA 4I2OA 1R22A 2K86A 4Q0VA 1SACA 4MX3A 3HN3A 4E4DX 3THCA 2K9QA 1QZEA 5HI0A 2RN7A 4BQNA 3BTYA 4M3CF 3NAPB 3FK6A 4CUAA 2EF6A 4YM0A 3W5MA 3T4VA 2BU9A 5D8KB 3V0AB 3I3DA 2UU8A 2PMZN 2Z79A 4J6GA 3POIA 5L7OB 3SCFA 5FJHA 2WIIB 2QVOA 4U88A 4P9UA 3VBHA 2R0HA 1SEFA 2FZ2A 2H94A 5DDJ3 2RS13 3R61A 5CPRB 1HW5A 4M6VA 2DYCA 3I2FA 4Y24A 2VMCA 3MV11 2VXRA 2Q8KA 3WX5A 1MVQA 3T09A 1ZX5A 4KDPA 4XLHA 5FIXA 1ETOA 4H4KC 4AM3A 3IH4A 3ZR6A 3GX4X 4ESJA 2HDDA 3IH3A 4GWNA 3B9CA 3WINE 1Y7BA 3ZXKA 2EAAA 2GU9A 2HPMA 4IPAA 3PNAA 4LOSA 1EY2A 4KL1A 2SBAA 5GLZA 2VOXA 3W2AA 4XUOA 4NIDA 2RKHA 4PFPA 5FZ8A 5D4RA 2KIUA 4J01A 2OUMA 3KEQA 4HLTA 2OIIA 3HD8B 1OFSA 3BC8A 2H6BA 4OAZA 4E70A 4RR3C 1TC3C 3H3ZA 4B7KA 2YX4A 5F6FA 1W6PB 1CAVA 4MYEA 3N9LA 2OPTA 3R4KA 4WM7C 2VTFA 1E5HA 1VRH3 1YO8A 3Q0VA 3TQNA 2Y64A 2ZGNA 3MF6A 4EN0A 1FOD2 4AWDA 4HQMA 4FOVA 3Q8AA 1WMEA 1IGOA 4DQAA 1Y9GA 2MPFA 3RIRA 4NAOA 4RGRA 3LSPA 4GRIA 1YWKA 3ATGA 2AC1A 2PHLA 2V4VA 1HKSA 3PUHA 3JBG3 4GWMA 5C4XJ 3GTQJ 5FBZA 3K2ZA 1KYZA 4Q4ZF 2BNMA 2C1FA 1Y9MA 3KX2A 1DQ0A 1STZA 1IXRC 1UJ8A 1QHDA 3AP4A 4L9BA 5FP9A 3ZN6A 5FUNA 1B4AA 2FQ4A 2OCCH 2Y6KA 1GDTA 5FDBA 4AXOA 5T52A 1JHHA 3M07A 4CEWA 5EF6A 4X6AJ 2BYVE 4ENMA 3S8PA 3LPFA 2DUOA 2XROA 1MW7A 5L3CA 1GNHA 2F2EA 5GPAA 1PGL2 3JR9A 2O61A 1OLME 2YPDA 3JRDA 4HDVA 1RUI2 1AR61 3BOQA 2W0XA 4BJTA 4PZJA 4XIOA 1XG1A 3D3AA 4DXRA 2VUCA 4FQ4A 4FAGA 1AWCA 2GWRA 1GICA 4NB5A 1XE0A 3F6VA 3HRUA 3MKWB 3NNLA 4LLLA 1F4HA 2DFBA 2QDNA 2WWJA 3G4SI 1DQ4A 1OYWA 2CW7A 1S7AA 4YW4A 5H6QA 2KP6A 4PHZA 3QODA 3LWCA 3HKZA 1A36A 2HGCA 2K9ZA 4A12A 2CAUA 4XABA 3T5XA 4QQPA 2EPFA 2K4BA 3Q9VA 1A34A 1TQIA 2MFZA 2FU4A 3GBWA 5DDJ2 2BJSA 4XOTA 5FCCA 1UPSA 2K9NA 5LBBA 3KGLA 1W6MB 1MIJA 4W6XA 2N8GA 4E4ZA 2XPWA 3I2OA 1VBD1 1JJ8C 3S1RJ 1LOFC 1AR91 3CEWA 5JPNB 3VZJA 1PO13 2E1CA 4IEPA 1OXCA 2XJTA 4LHNA 4M3DA 4BK5A 4QPYA 4UUTA 2MC3A 3DCQA 1HXDA 2XJVA 3N9OA 1GWMA 4JBAA 2VQCA 3NVCA 1WCUA 2E19A 1VLNA 2JN6A 2W46A 5KHHA 5FY8A 1DQ5A 4AFAA 5DUVA 1RI7A 4V1PA 2BGCA 1O4ZA 4B8EA 3T0YA 1VBE2 2HQRA 1E57A 4MO3M 4RM2A 4YM3A 3B69A 1VQ8I 2VQLA 3T1MA 5JCTA 3VBOA 4KWUA 3WNLA 1VBC3 1SAXA 2KJBA 2D7FA 2XRLA 3JCIA 1OR7A 2W1UA 1K61A 1QHGA 4LO5B 3DGTA 4IEVA 4A3ZA 2IVJA 2WFPA 2CGNA 1FYMA 1O57A 3JD73 5CVRA 5E8IA 5J98B 2BY2A 3OOUA 3M4OJ 1CR7A 1CWPA 2D6MA 3JBG2 4AK3A 1FMD3 5IVBA 1A6QA 3OYEA 1IQAA 3TN93 4AUXA 4FP2A 1MQTB 4IHYA 2W00A 4N0BA 3BGAA 4QKFA 3UESA 1AL21 4RGXA 2JMWA 2DFIA 1LVKA 3KFWX 5GPCA 4Z2WA 5L3FA 2VZOA 4S2GA 4I3GA 2RM23 1LFUP 4E8DA 4P9WA 3ZMUA 2DT6A 1HX6A 5EQUA 1SMTA 1TW3A 1RB8G 2I5UA 3CLOA 1FOYA 1ZN2A 2VQGA 1JE8A 2VW2A 4DMIA 2A70A 2XB5A 1WW5A 5JZGC 2ZEZA 2P81A 4CDQB 1L0OC 5HS8A 2K0GA 3G1OA 2E7AA 3TEYA 1F4AA 4OMYA 4I01A 4HBLA 1MPXA 2HEVF 3KEYA 1SBDA 1Q8PA 4XFIA 3U11A 1TG7A 5EIYB 1AYN3 4A0YA 2R041 3WNPA 1IF1A 4BCUA 4PJMA 2EFOA 2XL7A 5A7WA 4B4PA 1FBUA 2EBIA 2TBVA 1BI2A 5HXMA 3FIWA 2DV9A 3PVOA 3BR3A 3DLLF 2M7BA 4JRLA 4XTMA 4OWRB 2R061 5F9TA 4PLNA 5D8AC 2ZZQA 2QDRA 3KCCA 4AHZA 2KA3A 1MH4A 3ECHA 4XBFA 4EQQA 2C26A 1BJZA 2UURA 1UZYA 4Q4V2 5FZ1A 1DYPA 3SHFA 2CRGA 2FRHA 3JB8A 4LPLA 2DVBA 3I2GA 3S1QJ 4BPZA 2KR2A 1ZGJA 3A0BC 3TDUC 4B7EA 1OURA 1VAKA 2JVGA 1LNWA 1Y3TA 2XJUA 1C8M3 2Y34A 3WGIA 2BP6A 2OTJI 1BOBA 4LK7A 1PMJX 4YW2A 2PQQA 2B9UA 5J8FA 1T2KA 1ZBE1 5FKOA 2C6YA 1LFPA 2WNVC 1IXSB 3CJRB 3WZ1A 1AA7A 4FI9A 4HVQA 4ASLA 1DF0A 1QXJA 3DYPA 2E1NA 3ZOIA 3H9GA 2R7ZJ 2JRTA 5EEHA 1X4OA 2DT7B 4AIHA 2WT1A 2YHJA 1W04A 5DN2A 4RR3A 3DPRA 2W7NA 1Z6TA 1FYKA 4Q48A 1BR1A 3ME2A 1VBC2 3PNVA 1HF0A 2DA3A 5DXDA 1FBQA 4AHWA 1LEDA 5FB2A 4Z2YA 5M5YJ 1LOEA 2ZXWH 4IHWA 1RYYA 3J7LA 2ECBA 1W9TA 1DP3A 1VMFA 4A4AA 2LDUA 1NZIA 1ZLKA 4MEXF 3SFZA 1RESA 2GLOA 4AFDA 3PDQA 1ZZBA 1M06G 2NZ9A 3KZZA 1OCZH 4CGZA 4BMBA 1FMD2 2IS2A 4CDUB 5DQ0A 2D6KA 1EKEA 4IRGA 4OHZA 2EZIA 4IL7A 3BR5A 3DKXA 3FUQA 4ZYGA 3KQRA 1I6HJ 3VZOA 3LEMA 2A5ZA 1P4WA 3TBDA 2HZDA 5K7HA 2IXIA 1R7JA 1H6YA 2GDFA 3ZO0B 5EPAA 5HDGA 4DXSA 1LGBA 2X5IC 3ITQA 1TWGJ 3OBRA 4BK4A 1G3TA 5FZEA 3K4LA 2DCJA 5L3BA 3ZPYA 4MQVA 2HDCA 3K1MA 2BFUS 3A7QA 2KIMA 2YDEA 1CAXA 2JRMA 1HDDC 3SCGA 1R091 3ABUA 3LKJA 4LBMA 4S0HB 3PUIA 3H3LA 1O7FA 4JX6A 3VD7A 4A3KJ 2E9QA 2EA2A 3BIEA 2DOEA 3IHUA 2ZX2A 4NHMA 1LVAA 1N1TA 2V9KA 4XRMA 3C2UA 5JXIA 1VQPI 4YW3A 2E33A 2V4JC 5ERIA 4FX4A 4IEZA 3WHBA 3VZNA 3ULQB 3V64A 1JT0A 3QBQA 2XAJA 2XRNA 4S05A 2A61A 2XVCA 4PGHA 1P6RA 4XF4A 3CUOA 4KWLA 3VSLA 1GLNA 1GV5A 2VKEA 1WRJA 5FY7A 2ZMEB 4W4ZA 4C3JJ 5LA0A 2E26A 4Q0PA 2HOTA 2GA1A 2PLV3 2RE9A 4DW6A 2ENRA 3AMHA 4LHLA 3AFGA 2VKDA 1QBJA 1RUF2 2OBPA 3BDDA 4JTNA 4OOIA 3GBGA 4GWIA 4A2UA 1NZCA 3FKJA 4LBNA 2E71A 2JT1A 2MEV1 3HUGB 5IVYA 2CFOA 3M70A 2COBA 2A6WA 3J80K 3TEXA 2ZGUA 1TTYA 3UJOA 2GMMA 3M3QA 2ORXA 1W7PA 1KGYA 1LOGA 4FPCA 1FNYA 4NN0A 4P14A 5H9SA 4Z6YA 3PVNA 3L9FA 4HLXA 2VL4A 4OI4A 5HS9A 5JLXA 3RQIA 3ZN5A 2QQOA 3KGZA 3VDCA 4KFCA 2XG3A 2QUFA 3F95A 3KLNA 4Z07A 3IDCB 3ASOH 3G73A 5FZMA 4GCVA 4D1QA 3WG3A 4AQ2A 1J3RA 2WS93 1AYM3 1EPZA 4A93J 2ZGQA 3WSOA 4YG6A 1O3RA 4LEJA 2P2KA 2FHRA 4E6KG 5C5TA 1YLFA 3KT1A 1KEXA 2ZBKA 3KYLA 3GTKJ 5IW0A 2MD0A 3CLQA 5FKMA 3U2RA 4AVZA 1U9NA 2DMUA 1YJLA 2HXOA 1HSJA 2BY1A 2GALA 2RDNA 4YG3A 5L3GA 2DFHA 4IEJA 2HWB3 4CDWB 3J26N 2IW5A 3PURA 5B2GB 2DK5A 5LA9A 4XICA 1JHJA 5JXGA 2RS33 2AUYA 1KRIA 4RLFA 1BHGA 1GQPA 3MIEA 3TOJA 5C9AB 3AP6A 1CPMA 4ZZ8A 1KQ8A 3RZMA 3LA2A 3WQBA 1FNZA 5F0FA 3CP2A 1RXGA 2W1WA 4D0QA 3E97A 2W5FA 1DQ2A 1T95A 5CQGA 5FR3A 1DP0A 1Z7S2 2P3JA 4UFLA 1G9DA 4B48A 2VE8A 2ORZA 4AEKA 3PQKA 1KGSA 1MBKA 1W2UA 1ND3B 1H4GA 5CVUA 3FM5A 5JZGA 1K4TA 2FQPA 4MHRA 3K4BA 4LFUA 3O1RA 2YC2A 3HBKA 4JGZC 5E89A 1OPOA 1IUFA 4AQSA 3ZR5A 4A6OA 1AL0G 2FOWA 4KIBA 4PJ0C 1MH3A 3RWKX 4D5CA 1ZKGA 5IHRA 4XKBA 1QZYA 5T54A 3EHKA 2TUNA 3N9QA 2CG4A 4QQLA 1O3QA 5ANNA 1BK1A 5EP9A 2EWNA 3ZXEA 5FO8B 3H1MA 1IN7A 3I58A 3WDXA 3VBSB 3LEKA 1OKQA 3B6CA 1CAWB 5C8CA 3GCMA 4BYYA 1W03A 2TEPA 5D8AA 4F7ZA 2YPJA 1CX4A 4DO0A 4IV1C 2MD5A 1J1TA 3NAUA 2VJXA 5FAXA 4HV5A 2C9AA 3J7NA 1PUFA 2X09A 1CQTA 3E6BA 1DDNA 2NPIA 1G2HA 2VD7A 3KS7A 3BN6A 3RZHA 4OIOF 1VTNC 3RPUA 1QIQA 3IPVA 5CA6A 1YJWI 4YFNF 1FATA 2RS11 1YFHA 2A3XA 1GOHA 2VZUA 1UXXX 2NMOA 1NCQB 1OQDA 3ZYJB 3OIPA 4TXWA 2GOXB 3KLSA 4DYQA 5A32B 2DVDA 2VTXA 3OTFA 2W1OA 3NRUA 3EJKA 2UWCA 1TZLA 3SISA 3QOPA 1JYTA 5FROA 4Y5SA 1E3OC 3EUHC 3WP3A 1ZBA3 2FDFA 4MFDA 1R1A2 3CKHA 4P1WA 4XZPA 2MBFA 1NHAA 2Y26A 1AYM2 3P5JA 5FFOC 3NAPC 2XIGA 2VZRA 2CUEA 2E35A 1PDNC 2KRFA 5HNHA 4HX8A 5B66C 3HBLA 1VBB3 3ZXAC 2K2SA 2PHRA 5L7OC 1WLWA 4LBKA 4Y20B 4QIWN 1SLCA 3IT8A 3UR3C 3BTXA 3GLLA 2PX9A 4QM9A 2EFQA 2CSOA 3HOVJ 4O9EA 2HS5A 3V7SA 2GN3A 2UY9A 4IOAF 1JUIA 2X6YA 1LCLA 3F8CA 1POV1 1VRH1 4WCGA 2GIVA 1GQHA 1IV6A 1RVF3 2VCAA 3Q8CA 3AZZA 1FBSA 1GZTA 3E7LA 2WNUB 5CVJA 5IOYA 3KE2A 4L18B 4NOTA 2WB1N 2VR4A 1QOSA 3DCFA 1HW1A 5CBLA 1T33A 3GUDA 3ILRA 5KR7A 2OJED 4DGWB 5HNFA 1D4M2 2VL8A 3I59A 3I97A 2YS9A 1EF4A 4YEJA 5J40A 1NLRA 1OKOA 3PIJA 4HPKA 1QVUA 2K3PA 3PIPF 3OS2A 2ZJPF 5EYRA 4MFEA 4B1RA 1HLCA 5FPLA 1W05A 4L0PA 2KFDA 4JQRA 2DU1A 3T30A 4XQDA 3ROUA 3LZZA 2JDUA 1TQ5A 4OUSA 2C9KA 1D5VA 4MXWA 4RYDA 1CIWA 2DCKA 5HODA 3O12A 2PJPA 3NNGA 4LJHA 4X1EA 3VFZA 1Q5OA 2E5ZA 4P08A 1KA8A 1YXWA 1UHWA 4KN7X 1HXS3 2ZOEB 5LY2A 4A3FJ 3K4JA 2XL9A 4E9KA 4BQXA 4A3JJ 1FPN2 1GBGA 2J22A 1HW2A 2E32A 5FO7B 3AYEA 4SBVA 5EFUA 1ZLJA 2VMGA 2JD4A 3AP9A 3RZDJ 4RAZA 4JX5A 2R7WA 2Q30A 3SITA 5B4NA 4O5VA 3DU6A 4GYIA 4M3FA 2M9HA 4FPGA 4WBBA 1IS5A 5EEGA 4BWOA 3VYSB 4N43C 3ZN0A 1IZ1A 2H1KA 3GZ6A 4S2HA 5HLHA 2GNDA 5ICGA 3CQZJ 5F08A 4LLFA 5G04L 2QQUA 2NNNA 1H30A 3TOBA 2XB6C 1QH7A 1U5XA 3CQOA 3JXSA 4MHGA 2DPDA 2OXBA 4CYDA 3BKZA 3POFA 3VBFC 2A3YA 5H9RA 3LIGA 2B9SA 1PO11 3DYMA 3WNXA 2QZ3A 3UGFA 2YUEA 5BNOA 1S0FA 3UL2A 1XNCA 5C3PA 4UXNA 1YLLA 2OX0A 4D7MA 5EZWA 5C8WA 3B93A 1KD7A 5FPVA 2CO5A 1PVC2 2VCCA 4XFGA 2NP0A 1IS4A 4PF1A 2HWF2 2VOWA 1G6NA 3GTJJ 3SNMA 3S1MJ 2NXNB 3FL7A 3W2VA 5IK4A 3CUQA 2J1RA 5D4SA 4YSFA 2FF4A 1GNYA 4Y13A 1X2NA 1UIJA 1ACCA 1EV13 4UUSA 4Y4RA 3NKGA 2DT5A 1EAH3 3MFAA 2STWA 4Q4X3 1AX1A 3WU2C 4Q2FA 5HVQC 1MD0A 5HS7A 4NBQA 1QXRA 2XQXA 3DWLE 2RMU3 3ZIXA 4I02A 1MNDA 1RVF2 4A3MJ 1S0GA 2YBKA 5A7OA 3TWIA 4Y5TA 1Q8SA 4XDPA 2ZKZA 4UW4A 5C71A 4DYRA 3JD71 4AHXA 3KWVA 1BR4A 3VD3A 1XNKA 1LHUA 1BJQA 3H0GJ 3ZPLA 2ARBA 3CF2A 3C8XA 5IK8A 1WSUA 2V9VA 3TN91 2K7LA 1P9QC 1K78B 2UZKA 3GMEA 4KNCA 2XGCA 1HRI2 2D93A 4P00B 2NMNA 2VNOA 2IXSA 3OEAA 2PAKA 2VULA 3OYKA 2VPVA 1CAUB 5FKNA 4XK4A 1SQ4A 1TVGA 2RM21 4BJ5C 2QEXI 3S17J 1S29A 4F8AA 1E5RA 1DGRN 4L8QA 5FQ0B 1JMUB 3RS6A 2J42A 2EK5A 3WNMA 4J19A 3VDBA 4NPLA 4WVWA 2RJ2A 4JAAA 4K1YA 3FWEA 4QPOA 4WV8A 3W9AA 4FSJA 1SLAA 5H9QA 2BOIA 1VB4A 3L2YA 4M3CA 3OPZA 2W9XA 3W6KB 1HJFA 3RYRA 4FFGA 3FMRA 1R5ID 2Q0AA 4MGRA 1NX9A 1GOGA 4NPMA 1AYN1 2ETHA 1HOMA 3TEWA 5LCWL 5GP9A 2NRAC 1I39A 3ZX7A 3AMPA 2WO3A 2CL2A 3MPBA 4R9CA 3F8FA 2BDRA 4IUGA 3OUIA 1R1VA 2IWGB 4N8MA 4IV1A 4AGVA 4QPIA 4D6SA 5KAFC 3M7GA 3BIWE 4OHYA 2JDNA 1NE4A 5EWSA 3GALA 3OBAA 1XGSA 1LOAA 3AMNA 2J1UA 1LDDA 4AIJA 2ZO4A 3LA3A 1Y6IA 3BJOA 3WHUA 5FXVA 3HM5A 5J47A 1TBXA 2KRHA 1LHOA 3LA7A 2R7FA 4GAZA 2QM3A 3JRCA 2EIJH 1POQA 2LC2A 3H0OA 3BQYA 5E79C 2W82A 4YVSB 1NA1B 1C8M1 2VVEA 4M3GA 4RB3C 1CF7B 4GQ7A 1X9PA 3EUHA 5HV0A 4WM8B 3POYA 4YIIA 1W9FA 4LBQA 3PSFA 3CF6E 3MI8A 2WO1A 1YE9A 4EN6B 4CEYB 3Q0WA 1OJLA 2O0YA 2K02A 1QJX2 2HBTA 1JTYA 1AR72 1EV12 4BHBA 3FBIB 1EAH2 1BBT3 3DLAA 1IUYA 2XAFA 1BC7C 1N3OA 5D5XB 5L7OA 1AR82 1ZRRA 1IS6A 5ACA3 3DBHB 1HIXA 2XJSA 3ZFEB 2BOJA 1HKQA 1MBGA 1FX5A 3CCSI 5CQEA 5CYVA 4UFMA 3M8LA 1OD3A 3T2OA 3IKWA 2WWUA 3MW3A 3P9KA 2Z9OA 2HWC2 3ORJA 4RSUA 3BCAA 5F8PA 3AG2H 3F8NA 4JGYB 2VMFA 1IZ3A 3T0AA 1IKQA 3BB6A 1ZR2A 5FLMJ 3G6JB 4NR1A 1WQ2A 1MNEA 1QJZA 4DYCA 1BIAA 1BBYA 4P55A 4XM3A 2QQAA 2Y0SN 1MGTA 2CW8A 5GAEJ 1OBNA 5FYTA 4AEDB 4LB6B 1GV9A 3BJ6A 3U4XA 2VMDA 4RGAA 1RITA 2BY0A 2P8TA 2WAFA 2CYFA 4O9GA 5I0DA 1O8SA 1BOAA 4KU7A 1A8DA 2UUZA 3RYPA 5DAPA 2A6XA 1JOBA 3OUHA 4FASD 3N9NA 5FY9A 2GXBA 1DGWY 4Y15A 3SZGA 2BBYA 1OCPA 1BL0A 1FOKA 2WT2A 2ZGRA 3CCRI 1VQ6I 4PDWA 2ZNZA 2DFEA 3J80Z 1JKQC 4BDYA 3R4DB 5LK7B 1W8WA 4ZC3A 1WBLA 3CCJI 1UD1A 1KFXL 3GHMA 2KL4A 4CDUC 4E7SA 4CCJA 3WG9A 4BLIA 4OQ9A 4AVAA 1YI9A 3J7HA 2E5NA 5GLVA 4DB5A 4AFMA 5AIQA 4FPKA 1COV2 2VOVA 3TMOA 4PBPA 4UW3A 2JJ7A 4WVVA 3A21A 4PIXA 3DEWA 3IL2A 3JQXA 4N43A 1D1AA 3HMYA 4WF2A 1XCBA 3VBHB 1WJCA 5E16A 4P5HA 4FHTA 1VPHA 3WU0A 3WQ7A 2PLV1 4AU7A 3OS1A 3BPVA 1SLTA 2K9SA 3BPZA 1LKXA 1IDZA 1XSDA 1NLQA 4I76A 2AGSA 2KM2A 2HYJA 1X33A 4Q29A 3CL1A 3ERED 4LMYA 3AB0A 2ZJ2A 3OF1A 3VBFA 3W20A 5IAXA 1H9GA 3MIFA 3IKVA 3IMMA 1ENHA 2J5PA 1PVXA 3I2KA 2NYXA 3LWFA 1QJY2 1ZA4A 2LROA 3M1EA 2P3YA 1Q8VA 1WPKA 4HMZA 5KWRA 3V65A 3GJAA 3GWZA 4DPNA 2OQ6A 1U5YA 4V19K 1L7RA 1KYWA 5GADJ 2BV4A 1WA4A 1ZK8A 2PTMA 2X53S 4IV3A 3O1UA 1BI3A 1BBT2 1CAVB 3KP2A 1YFWA 3HJRA 2IAIA 3GZTB 3VN4A 2V79A 4H14A 4FPFA 5FBJA 2WS91 1ZYRF 1KQRA 5ACA2 3WOGA 3BY6A 1V6KA 5GAGJ 4YRVA 2PHFA 2FBEA 2VIXA 1OVPA 3H8XA 1UY2A 3VWBA 1TE1B 1W0NA 1EV7A 2YMZA 2O8OA 3ES1A 3PUFA 1B6AA 4LG0A 2XJQA 3EUAA 4Q8KA 2A68F 3IC7A 5J4YA 3FZ3A 3NARA 2NAZA 2YUSA 1EUTA 4RGKA 3MIBA 1R5GA 1VI0A 5FPZA 2HWB1 3FXLA 2R30A 4ORFA 3MIDA 4K3UA 4JZRA 1TME3 3ZN6B 1FV3A 2R0QC 2RS31 4BBRJ 1W0PA 4GDFA 3V8LA 3K48A 4GH4C 4CEWB 3PMEA 5FD6A 5DUIA 3KV5A 2KDZA 1LEBA 1XX5A 1OQYA 1KDKA 4CCEA 1DLLA 1QGLA 1DZRA 2VBXA 5FYUA 1ONVA 4IGQA 3S7IA 2D43A 3T8TA 1V5GA 4ZYAA 4R4ZA 3SZPA 3KCYA 2CY6A 1VQ9I 4Y17A 3RDIA 5T5OA 2KIQA 3ELKA 4D6QA 2XQRA 1RINA 1SMYF 3NJZA 1LUJB 4AVPA 1L3JA 1X2MA 4QX0A 4IEWA 2G7UA 3MPPG 2JDYA 4CDWC 5FY5A 4JV4A 2EV6A 2WFF2 4IGOA 4UFKA 5EGOA 2R16A 3LMMA 3HQUA 4LULA 5C9AC 2YBSA 4HW0A 2LS6A 2BRTA 5CEHA 2EALA 5FXZA 4IEOA 2JTVA 1W6QA 5FY1A 2XWBB 2VUAA 3AFHA 2FCUA 3IAPA 1SPPA 1RKWA 5ICEA 3LL7A 1ND3C 1UMIA 2OYZA 2A71A 5JIUA 5K0UC 4SLIA 2RR13 3A01A 3JTGA 1E3PA 2W92A 3H7JA 3CCMI 3CMGA 3KCXA 3M3CA 1DQUA 3RPUD 5AC93 3S14J 4AL9A 4CCOA 2K40A 2HOSA 2IGKA 4WK8F 4I30A 2QQPA 5KAIC 4KMQA 1H4HA 1FX7A 1GHCA 2J1TA 4CUGA 3S3OA 2DQRA 4MZUA 1NAEA 1ZBA1 2WLQA 2QQIA 3GGLA 3FFZA 1RUH1 2ATFA 4BJ6C 3VBOB 3JRIA 4UUVA 1QU3A 3POJA 5J6XA 5L3EA 4JYKA 4YGCA 2XSJC 1VBB1 4XCBA 3IRQA 1UZ0A 4CP0A 5A2QK 3TP0A 1W0OA 1HA8A 3EMRA 1Z67A 1OKRA 1MS4A 1X36A 2R92J 2D3PA 1ODDA 4EE2A 2Z3YA 2W4SA 2BNOA 1J5YA 4P5YA 2QKMB 2QJVA 1DU0A 5I8SA 3GM8A 4WWCA 3ENRA 2LTNA 1NCQC 4QWQA 4YWAA 1MDMA 2ZHMA 1ASJ3 4AZZA 2WY7Q 3OYGA 2V4AA 2NVQJ 1YQCA 1RC6A 2QCSB 1LRHA 4Z8BA 3AVRA 1Z0HA 3ZDSA 1YW7A 3I71A 1AKHB 3I9V2 1T39A 3MZ8A 4XXAA 4Y1ZA 1DGRM 2BW8A 1XNDA 2VUDA 4AFCA 2PHDA 4M9ZA 5FJ8J 3G2BA 4QWNA 2FE3A 5CJ9A 5M0TA 2PMUA 3QP6A 1A78A 3UKGA 3IN9A 4OI2A 3VKFC 1QA6A 1XSRA 2E51A 4CICA 2ZSHB 4LIUA 3G1LA 3BTIA 3KD4A 4P9XA 1TEIA 4JKMA 2ICWG 3AP5A 3OEBA 5DD8A 2Y6FA 4FISA 3J7YJ 4LORA 1YC61 3ZXGA 4MO7A 1S0DA 1HXS1 2JDMA 1PGSA 1XNTA 3J81K 1ZELA 3H9QA 1H9TA 1PO23 2OQGA 1RPWA 5FLVA 1LGNA 5A7WB 3CCVI 4PLOA 1V55H 2WNUC 2YFUA 2PFWA 1O7LA 3VKNA 1XE8A 4V2FA 2VC9A 1YRZA 4W8JA 1BJAA 3M3OA 5K7PA 4NO4A 3BCWA 1OCOH 3OWTA 1RNLA 1SFNA 4XMAA 3J9SA 5E1RA 5KHJA 4XIDA 1QPIA 3LFIA 2V1NA 1CD3G 5JWPA 1JKPC 3N9MA 4BE2A 2WZR2 3DFGA 2OF7A 2JA8J 4ARYA 4NMIA 6PAXA 2RR12 2H8WA 1JUPA 4BY1J 4ITCA 3USUA 1OT5A 2V7FA 3I53A 2X48A 1QQP2 1XXNA 2X6OA 3GCXA 3Q3SA 4L99A 4RQPC 3H5AA 3QWLA 3PUAA 1VAMA 1WBFA 5JHFA 4AC0A 1H8AC 5E3LA 1PUEE 1CJDA 4D3WA 5ICFA 3SLIA 1NK2P 4PI2A 1ZVFA 2O5RA 5LRRA 4AWXB 5GAHJ 4XHXA 3DPRB 2P5KA 4YZ4A 1RR7A 3ZSMA 3QQAA 5GZDA 2LY9A 2OQRA 2XAGA 3GXOA 1YS7A 1UY3A 3WQ1A 1X8EA 4KUMA 1V70A 2VVFA 4RS8A 1CZTA 3UK9A 3VDDB 4LA2A 4RGUA 2CV2A 2FXAA 3N7MA 5C5UA 2DBBA 4OHVA 4KWJA 5KNLA 5FKKA 1SBEA 4YZ2A 2XPJA 4RB1A 4Q4X1 1ONAA 3MIGA 3R05A 4NC6A 4IERA 1RUJ2 4XLFA 4XLCA 2RMU1 3HUGA 5FLJA 5HLIA 2NNYA 1ASJ2 1S0BA 3TW7A 1NCRC 4ZDLA 1E3HA 2OPKA 4AAPA 3X29B 2WWYA 1YW9A 1ZH5A 4EJTA 2Y30A 4R8HA 3VHNA 3DPLC 1ZGAA 2GH8A 2AHQA 1QJU1 5IVEA 1BKZA 5FRAA 4YELA 2QKLB 3L1PA 4YFXF 4GH4A 1W3XA 2WZEA 4J25A 4QGMA 3CCYA 2R072 4FTHA 1B9MA 1XGOA 3UV9A 4U7DA 5LEKA 3WG2A 3AYAA 4XBQA 2CH0A 3WDTA 1CAXB 4ISQA 1QKQA 1W2OA 5FZGA 4Q0SA 5E88A 3BG9A 3KEOA 4XFAA 1RHI3 4ENKA 4CU9A 3O6BB 4XRSA 1JGGA 4ZS2A 2AR6A 3VV1A 4GMP0 2FD8A 1IQDC 4PSWA 4XF3A 2Z69A 1T6GC 2LBFA 3N7KA 2FJ1A 4A42A 3OYFA 2P17A 3E1SA 3FLRA 3H3UA 1JYVA 5IYYA 4I0WB 2R0FA 5FXWA 1QOOA 2EXIA 3CCEI 1JW6A 4HA8A 4JDNA 1RUNA 1HKDA 3IH2A 3B73A 5FYYA 4Q4W3 5AFBA 1IRXA 4A3IJ 2ADEA 1FT9A 4F55A 4TSVA 2J1VA 2HWVA 2W84A 4PT6A 3GTGJ 1RRJA 3VD4A 4CSWA 2ZMLA 1R49A 4UB6C 1JTZX 3VYRB 2DWRA 2K9MA 3QU3A 1JOPA 2WRAA 3OPWA 5JI6A 5FZLA 4XBLA 4HOOA 2VQAA 3BZ6A 3HOZJ 1Z3XA 3HOUJ 4UV9A 3BR2A 1SZBA 1ND3A 2OW4A 4QSHA 3I64A 5K0UA 2B7EA 1O4TA 1RUG1 1W7PB 2HWD2 1WFXA 3NJVA 4IQJA 3P9IA 2KMUA 2BFUL 3CCUI 1UAIA 2IVMA 3FXKA 2VO5A 2DJIA 2Q4SA 3ILFA 1B9NA 3BALA 1WMXA 3N35A 2XLAA 2VE9A 3VKLA 1SCRA 5LA1A 2PA7A 4E2QA 3H8OA 1LHNA 4CUBA 3IV5A 3ZQCA 3MD2A 2LVSA 2F48A 4UB8C 4O3MA 2A69F 2VUMJ 5F0HA 3WODF 2EB7A 1CAWA 3BROA 1LOCA 3PNTA 5F5AA 3TAYA 1WCMJ 1W36C 4AAXA 1R23A 3P9CA 4AG4A 4LMFA 1JYIA 3M7AA 3TO6A 2ZGKA 2DXIA 3HSEA 1JZ7A 4AQ6A 3RCOA 2UWAA 3VDAA 5KXCA 3JREA 2A6EF 2WJSA 3NV3A 4HANA 4OU0A 2WC2A 5A1FA 4KBZA 5CB7A 1NCQA 3QPLA 2X1DA 1VF9A 2VW1A 1VQNI 3VYTB 3PL8A 3LDKA 2HFHA 3GFIA 5E8AA 5DM7F 1NG0A 1YJNI 4EWEA 3EQEA 4Y1YA 3NV1A 3HC7A 1YIJI 1RMU2 4WM8C 5JAXA 4XDQA 4LBOA 1ZREA 3B9IA 3DXJF 1T6BX 4QGLA 1Y0NA 3I55I 4K9SA 4N53A 1PYVA 3MFCA 4CEYC 4UOJA 1N25A 2DA5A 2MYSA 1G3SA 3AKPA 5FUIA 1D1CA 5JZGB 1NTCA 3H7YA 1FPQA 2JPBA 2PHTA 1WA6X 4ZU7A 3WHTA 4NWVA 2MSYA 2E2JJ 2DO7A 1H1MA 1ETYA 5L19A 3B5LB 2F5CA 3K4CA 4ANJA 4Y20A 4AW7A 3LOIA 1V5EA 4OUEA 4D7NA 1RUC2 5F37A 2EIGA 2HYFA 1L7LA 3U07A 5LA2A 3VLBB 1C0WA 2XPUA 2JVHA 1CX1A 1XGNA 2L01A 2D3RA 4HK9A 4CXXA 3FLTA 4JGYC 3ZRGA 1PGW1 2QQNA 1BM9A 5J1UA 3GTMJ 4GO1A 3OYMA 1RETA 1A8MA 3HL2A 3IAM2 5C8CB 5JMCA 1FY7A 3LAGA 2F5VA 4K6BA 3LF7A 3PVEA 2G7HA 4WZCA 3TL4X 5FREA 4DRRA 5DS9A 5JVGF 1PUFB 3N7JA 4AEDC 5D5WB 3WE2A 4Y1UA 1NY71 1US3A 3K70C 3AZWA 4IE6A 3IPVB 1SVMA 2G4IA 1F4KA 1RUD3 1GXQA 1VBA2 1X1BA 5FMOS 1X58A 2DVAA 3IM0A 3OR2C 4RLQA 3CJIB 2M34A 5A1AA 1YTYA 4RQPA 4B3XA 1TNRA 1IO2A 4U0VA 1ITYA 3ZFGC 5KCMA 1H1AA 3AKZA 2RQQA 1PIV3 4J1XA 1XB4A 4LJZF 1V3FA 1MVEA 2EFNA 2B63J 3ZQIA 1ZRCA 1P4AA 3EDPA 4EM1A 4XETA 5E1ZB 1J9IA 3E6DA 3JZVA 5K9YA 4DXTA 4BHPA 2QQJA 1A5JA 5F64A 4ASNA 4LIVA 1PVEA 2EIEA 4AVBA 1REEA 3A0NA 1S2EA 4G94A 3H92A 1QU0A 2M8GX 3OJBA 3OBTA 2V5DA 3DN7A 1K3IA 1MS8A 1UY1A 3NMBA 3L2QA 3FUOA 3LPGA 4CPBD 5KXBA 1LKNA 3RI9A 1HB2A 5IFTA 3VYUB 2IRFG 4AD9A 1F31A 4BE3A 4G6QA 4GB32 4ZHNA 3P7NA 5JPMB 3DF8A 2W1QA 2VOOA 1TMF3 1X3UA 3FXQA 1NCRA 1SVLA 1FOXA 3DPUA 4BY7J 5BNQA 5JUVA 3RZGA 3I59B 2OUJA 3PHMA 2CWSA 4IGPA 2MHFA 4E4HA 2RC4A 1W6OA 4XONA 4HPKB 2VPRA 4FCYA 2PHXA 1RUE1 1ERDA 1GWKA 3WU1B 3DU5A 3W21A 5LGNA 2RDRA 2NVXJ 3OYIA 2ES3A 5LB6A 2W57A 3CDIA 1JBCA 2DCTA 2R32A 1TME1 4LR4A 3I3MA 4Y3OA 4B4RA 3BTCA 1XRUA 1Y0UA 2V6EA 3GZEA 3OIQA 3IAQA 3B02A 2VNRA 3NQHA 4YYOA 2RV9A 4QM8A 3DBRB 1UELB 1AHDP 5GKAC 2DFCA 3I56I 4YFKF 1YW8A 3DP7A 3PIOF 1KFUL 2YC0A 2VXZA 5AFEA 1P4XA 3OBZA 2GNTA 5HCFA 4QXKA 2IBDA 4XMIA 3N4MA 1V6IA 2VQTA 4C2UA 4N4OB 1OH4A 1CGPA 5I0UA 1W5TA 1B59A 3T1LA 2A73B 3KP3A 3KP6A 2BPA2 5TRDA 1K79A 3U1KA 3H8UA 3KYDB 4Q5SF 5FO5A 2WLPA 1QVTA 2QQLA 1S1AA 3RZJA 2ZB9A 3VD9A 2JKBA 3A22A 2TCTA 4KQ7A 2IA1A 4CEWC 1C57A 1OC1A 4EZ4A 4ZXEA 5IK7A 5LBEA 1XMKA 4K2EA 3PUSA 2ESNA 5C70A 3C3WA 1D0YA 2LK2A 1W5SA 5F27A 4LBLA 5FQ0A 3BTAA 1W06A 2QFEA 3MF9A 1ZTRA 5BNOB 3WEZA 2DA4A 4JX4A 1UCRA 3WGHA 5D6FA 3LSRA 1ON2A 1LHVA 1N1SA 2R6QA 1PIV2 3MDPA 5E1WA 3PM1A 5AC91 5E3NA 3K7AJ 2GNMA 2LY2A 5D6EA 2R7DA 1FSHA 4BKXA 3CJQB 2ZGOA 3C7JA 5JFRA 1JYWA 3CUQB<