4BYYA

Apo glxr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
b'MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 65
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4byyA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4byyA01
4O6JA 4EJUA 3LOIA 4Q48A 1D3YA 4AVAA 2P6SA 1OMIA 2IA1A 2RC4A 5FD6A 1Z05A 4AVBA 2P5LC 2EV6A 3RI4A 1Q3EA 1SFEA 1MDMB 1IW7F 2DT5A 2XKPA 1EY2A 2EK5A 2IXLA 1UCRA 3WW2A 3QAHA 1Z7UA 2CV6A 2VXZA 3B02A 4META 3S2WA 2G7HA 5D8LB 3NKTA 4R1HA 4G7OF 1BOAA 5LEKA 2RGVA 2E1CA 3IC7A 5CVUA 1H1IA 3WTYC 2ETHA 3HIFA 4HSJA 1SEFA 3JW4A 2VT2A 4ZH4F 3WU1B 3K9TA 2HOEA 2G7UA 4IXAA 4IEVA 1UPIA 3SXWA 4HSLA 2IA2A 3EO6A 3P9IA 4I3PA 4RD7A 3ERED 3CLPA 4P9UA 2IXIA 3BJOA 3V7RA 1U5TA 2WTEA 4IF4A 2DFIA 3BJ6A 3C1DA 3LA3A 4TLFA 3DL3A 3CLOA 4G8XA 4GYIA 2PLYA 4OIRF 3B73A 1FZPB 1CX4A 3ACLA 2P17A 1ZREA 4AD9A 1J0RA 4AXOA 5K5OA 1IN6A 1XGOA 3HRTA 3T1BA 2E7WA 4FAHA 3ZPLA 2C0ZA 2FMLA 2UZKA 1G3YA 2PMHA 4PIYA 2A68F 3KZYA 4IPAA 4CYDA 4Z2YA 4F7ZA 1GVJA 2ZCWA 1Z6TA 1UB9A 5DUKA 3HRMA 3JAMZ 4MZUA 4OIPF 4KIFA 1FYKA 3JAMK 2WV0A 4ZU4A 4UV8A 2UY9A 2NNNA 2XL9A 4KWLA 1O3SA 1EH8A 2F5CA 4JTNA 1R1UA 3OF1A 2MD5A 3GZ5A 4YG2F 5BV6A 1H9GA 1W5SA 1ZRCA 1YLLA 3G7DA 4M9ZA 1U8RA 4ASNA 4P9GA 4HQMA 4Y15A 1R1TA 2OA4A 4KT5C 2B8MA 3S0MA 4A6EA 5E1WA 2Q0AA 4MGIE 1IXCA 4N9HA 4XF1A 3S7IA 4HW0A 3ZQ7A 1RUNA 5FPZA 5HVQC 1ZLKA 2DBBA 1B59A 3KLOA 3DQVC 5L3BA 4M74A 3COAC 1ON2A 3RPQA 1U78A 2HFHA 3L00A 2XAGA 3EUHA 2F2EA 4G6QA 4CXFA 4HOBA 4A2UA 3NL1A 4I0BA 5JSPA 4EWEA 4ESJA 2HYGD 3WGGA 2ZMEB 5FFZA 5BPDA 5J8CA 3I5UA 4RB3C 2DQLA 4KWJA 1IAWA 2ESNA 2PAKA 1XDSA 2EFWA 3IIAA 5CYVA 5ICFA 1ON1A 1QXRA 2MH2A 5HDNA 5E17F 1CAUB 1DP7P 2W85A 3LFKA 2GA1A 1Z9CA 3F6OA 5F1RA 4PGGA 4LUKA 2J5OA 2H0VA 3BB6A 1JXSA 4GCVA 2BEOA 2JTVA 3E5UA 3RYRA 1PP8F 3H3ZA 3J80Z 3CL1A 2K7LA 1L0OC 3WODF 3KEOA 1IN5A 3J80K 5JCTA 3I59A 1Y3TA 4WXCA 4QGLA 5ILSA 3I53A 2Y48A 4KU8A 5D5UB 3P9CA 1U6GA 2GAUA 2HWVA 3FFQA 4L11A 4M6XA 4R52A 4OINF 1P2FA 1IN8A 2X0LA 4PJYA 1W7PD 4XLNF 4N0BA 3DF8A 2QVSB 2XLGA 4EJOA 3JTGA 1AOYA 2YSRA 2OZJA 4BHPA 1IUYA 3GYDA 2PAEA 3FX3A 5DV5A 3N97A 5K1YA 2OQRA 2PN6A 4IESA 4JBAA 3LQRA 4AWXB 4KN4X 2JPBA 4KA4A 1WWXA 1J5YA 5DD4A 2XAJA 4HAMA 5E1ZB 2O03A 1V70A 3E3VA 1SAXA 1E2XA 1Z1DA 1YUDA 4LLGF 4H7LA 2FBHA 4YRDA 5K8SA 3CUQA 2Q2EA 1TQPA 5LRSA 2Q8KA 3D0SA 1MZBA 3SXYA 1USTA 3QP5A 1T2KA 5E8GA 1F1ZA 2PHLA 3FM5A 4HBLA 5E1XA 4E2SA 1YW9A 4RAZA 4LG0B 5D1IA 4CDGA 4MGRA 4M6YA 4A12A 2D93A 2Q30A 2DLLA 4P96A 3WGIA 1QY4A 2QBYA 2ZXJA 5KHGA 1FSHA 1CGPA 2WFPA 2VONA 5A2QZ 5EFUA 4XSZF 1DGWA 1JGSA 4KN7X 5ICEA 1Y0UA 5FD5A 2XLFA 3TDUC 3H3UA 5A2QK 2F4PA 4MQ9F 4HDVA 4CICA 5I8TA 2GC2A 2QUFA 1KGSA 2IXKA 1ZZBA 3SZTA 5DUIA 3FE5A 2STTA 2FMYA 4AQ2A 2B0LA 5JVTA 5J8FA 3F21A 3HTUA 1W7PB 3F8CA 3FMQA 1NHAA 4P5OA 2QQ9A 1K7AA 3H7JA 4HX4A 1WGPA 1O57A 4Q0PA 4U7DA 3EDPA 4FHTA 5LHIA 1B4AA 2L01A 3IRRA 3H7YA 1XN7A 4PZJA 4UBGA 5BXXA 3F23A 1GHCA 4JTOA 3C18A 2D2WA 5D8KB 1YG2A 1XE8A 2Z5UA 5L3GA 4I98B 3T8TA 3HT1A 3GWZA 2PI0A 1PUEE 3ZMSA 3GW2A 4H0EA 1USSA 2EA7A 5LBQA 2CFXA 3ML6A 2VECA 2O3FA 1T98A 2VPVA 4QWQA 5D5VB 4LFUA 2TDXA 4MGZE 3VODA 4HX7A 3F8MA 1OI6A 1R22A 1BI1A 2GC0A 2K02A 4QLCU 1QNTA 2NYXA 2GA2A 1WRJA 1XSVA 2VN2A 4MH0E 2ZFWA 5BMZA 2OU2A 3ES4A 1ZGJA 3KSCA 3EBRA 5AVPA 2DW4A 2A69F 4HBNA 4MGKE 1S7AA 1LDDA 2KRFA 1DPUA 3PVBB 5D4SA 4KFCA 1OYIA 4IEWA 3F8NA 3D5LA 2O8XA 1U12A 2ISZA 3M8EA 3K1NA 2EFNA 3H9AA 1XGMA 3BU7A 4ZU7A 5BS6A 1CAWB 1H0MA 4BHCA 2R3SA 1ZG5A 1O3TA 5K5RA 6PAXA 5L3DA 1J75A 1T39A 2FRHA 4ZYDA 1HQCA 4RGSA 4R79A 4I01A 4KWKA 4UVBA 4OU0A 2J5PA 1LQ1A 3R4KA 4XFHA 3NRVA 3WU0A 4OLLA 4EROA 3TO6A 4HV6A 1S7OA 3CUQC 5ILVA 4QM9A 1SD7A 1RTVA 4KU7A 1LEBA 3M7GA 1W5TA 1UCXA 4IEOA 3LZZA 2HKXA 3FXQA 1JHHA 2ZKZA 1EYBA 4ENJA 5HDGA 1WQ2A 4IERA 3LA7A 3REOA 5BUVA 3V4GA 1UW8A 5FGMA 3EQLF 3TOBA 4AIKA 2L4MA 3HSEA 5LGNA 3DP7A 4RGRA 3WTVC 4YFKF 3M8FA 2IPQX 3RYKA 2XRNA 1B1BA 2VC0A 4LB5A 3KZZA 2Z69A 2M87A 5CVIA 1YHFA 3H1YA 1XD7A 4FX0A 2CGPA 4CZZA 4KMUX 2XUBA 5J48A 2GWRA 3TGNA 2PAMA 1OD5A 1J58A 2CWEA 3F22A 2R7FA 1KU2A 1YFWA 1FC3A 4N9IA 3KP5A 4K2EA 4NQWA 2W25A 4XF3A 4TV7A 3V8JA 1XRUA 4Q0SA 5D5WB 4ENMA 4IRHA 3R0JA 2Z9OA 1DPRA 1YS7A 4KIBA 4MEYF 4HVOA 4ORFA 3SZPA 4ENNA 1FLIA 3V7SA 2BGCA 2D5FA 1LJ9A 3I59B 3BOQA 5I8YA 2GXBA 2QLZA 2PJPA 5KVRA 2EVXA 2BV6A 4IEXA 2Z99A 4MV2A 4K8FA 2PTMA 2IT0A 3F8FA 4S04A 3DN7A 1CAXA 2Y0OA 1X7NA 1G3TA 1MJ9A 4ENKA 1TW2A 1EPZA 4M9SA 4DNCA 1CAVA 3E6BA 1TTYA 3FM3A 2K0GA 3PLQA 3ES1A 4HZFA 1YW7A 3EYYA 4AIHA 2FXAA 3U0ZA 1OR7A 3T0YA 4QGNA 4EJWA 1S8NA 3FF5A 4BH9A 1TQ5A 3E5QA 1B6AA 1BBYA 2JPCA 3CTAA 3FWEA 2OPKA 3CUQB 3PNAA 5LEJA 5HLHA 3ZN1A 3BPVA 1KYWA 3BALA 3WTZA 1SMYF 5KHIA 3OD0A 4EJTA 1I1SA 1X82A 1FYMA 5LHHA 3VOEA 4IEYA 2FU4A 2DK5A 1BIBA 4IEQA 2QBYB 4J1WA 4IJAA 3BPXA 1IN7A 3Q5FA 5LLQA 2VBZA 4UXNA 4EGZA 1NXMA 2HS5A 1UFMA 4M73A 4XEZA 4ZU5A 3WW4A 2D1VA 2HTJA 3HQXA 1UIKA 5JSOA 2XV4S 4XFBA 4HLYA 4ZYGA 1R00A 1EH6A 3SFZA 3EQEA 2FQPA 5J3UA 4XETA 1TNTA 3KP6A 2O1QA 2JRTA 2H94A 1J59A 2F5FA 1TBXA 2O6GE 2UYBA 4AVPA 2ZNZA 5JFRA 1WA4A 3HRSA 1K6OA 2VBXA 5E18F 5TJJA 2OBPA 5DD8A 2OAZA 3V8LA 3SCHA 3KFWX 1XE7A 3OCPA 4YIIA 1SD4A 3QOPA 3H92A 3UKTA 5JHUA 1BN5A 4D7SA 3UKVA 3C3WA 4WBBA 1FT9A 3J7AO 3IHUA 2HKOA 1J3RA 4E2GA 4P55A 2UY8A 5BOXA 4HLXA 2FEZA 2A61A 1SFNA 4XF9A 2KKOA 1QWRA 1HW5A 4Q29A 3AAFA 2CAUA 4HF0A 1F4KA 2UYAA 3KP2A 1T6SA 3GFMA 1TQIA 3MPBA 2KJBA 2ACJA 3ZMZA 3I71A 3ULQB 5EZWA 3RKYA 1P6RA 3MYXA 3EJKA 4IRIA 5D6EA 1H1MA 1DZRA 1AWCA 1UD1A 2M30A 4EGYA 3EYIA 1HSJA 3M70A 1LEAA 3HTSB 1HXDA 1QZZA 5KK1A 4GYGA 5CVVA 3HOSA 4LULA 2ADUA 5BY5A 1OYWA 1XMAA 2IXJA 2X4HA 2PHDA 3MDPA 3U11A 1LVAA 2MA3A 3VHRA 4I09A 2NRAC 4EVIA 2B5HA 1QZYA 1BI2A 1YIOA 4Q0VA 5DYMA 3IWFA 4FAGA 3ABTA 4DQ2A 4OIQF 3H1WA 2XASA 5T3NA 1ZZ6A 4LTAA 2FBIA 2VE9A 3GLXA 3CUOA 1OKRA 1FP2A 4G9YA 1XSDA 2GIVA 4WXHA 4HF1A 5E8IA 1L3LA 4LK0F 2EB7A 4NHJA 2EFQA 4HQEA 1PDNC 5JSRA 4JV4A 4L5JA 3SCFA 3VEPA 3L2HA 5CU1A 2DTRA 3CDHA 5D4RA 2WWYA 4XLPF 2QQAA 3DXJF 4YSFA 2WC2A 5FB2A 1ZRDA 4XBFA 3E97A 5L3EA 4KICA 2PQQA 3GFIA 1REPC 1SMTA 1U5TC 3LSTA 3CF6E 2KJCA 2P7CB 4WWCA 2ELHA 4ZZDA 3NQOA 3WTWC 3QPTA 1OYYA 1BM9A 1QBJA 5CJ9A 3FZ3A 2O8QA 2EA4A 3QU3A 3QPHA 4MQVA 4EMSA 2RKHA 3KGZA 2IXHA 4O9GA 1YTYA 3LA2A 1O7LA 1HBXG 4IETA 4EWAA 1ZH5A 2VOOA 2ATFA 4EM2A 2HR3A 2GC3A 2YR2A 2R7DA 4BXUA 1RZ4A 1XCVA 2IP2A 2MPFA 1O7FA 1P4WA 2LSOA 5AIQA 3BDDA 5I0UA 3RTRA 4YFXF 4IEPA 3SHRA 1Q5OA 4IEUA 2ZKLA 5E16A 5BPIA 5C6CA 3ELNA 1IXRC 2FNAA 3HSRA 5EEHA 2EV5A 3FMRA 1BC8C 2ESHA 3RNSA 2YX7A 2IW5A 3R61A 4HN1A 4M9XA 3KETA 1RC6A 3RKXA 5J6XA 2C6YA 1GXPA 1BC7C 2IXCA 4HN0A 4L0ZB 1D8JA 3CJXA 3IDCB 3MZYA 1ZLJA 1ONVA 5I0RA 3IRQA 2QYOA 5I93A 4ETSA 5J7MA 4HDUA 1YS6A 5FQ0A 4MNUA 1J3QA 3T5XA 1YFXA 1R23A 1FYLA 4X6RB 4RAYA 4GULA 5KHJA 4FX4A 3WGHA 2PBIA 2DI3A 2VOPA 3TOAA 3NW4A 1KQ9A 2XKOA 5D5XB 1G3SA 1YWKA 2KIUA 4A5MA 1W4MA 3DPLC 2XAHA 1K79A 2D5HA 3P7NA 1CAXB 1LDJA 2XROA 4LA2A 1B9MA 2W57A 3NJZA 4RB2C 1CAVB 4Q0UA 2M5WA 1J1LA 4O3MA 2VC1A 2VODA 4AQ6A 4HVQA 3F8BA 2RV8A 4UBHA 4ESFA 2QCSB 1FWZA 3I64A 1LB2A 4YIFA 3GUDA 2CO5A 4UUVA 1S3JA 5TRDA 3MAJA 4RB0A 2LF8A 3W6KB 2L3DA 1O5UA 1CF7A 4MX3A 5ICGA 2W24A 1U5TB 2M1BA 2COMA 1UHWA 5L3FA 2XL7A 2HTSA 3L9FA 1ZZ9A 1FX7A 4X6QB 1KQ0A 2V1XA 1ZZ8A 4MEXF 2NAZA 5ICCA 4U0YA 3K1PA 4HA8A 4L2NA 4M72A 2QQBA 3J81Z 3ABUA 1T38A 2EJRA 1QGPA 1IPKA 2IVMA 2GH2A 1ULYA 3G3ZA 1ZG1A 4PIZA 4YFNF 3J81K 2H27A 4CO8A 3RIRA 1IN4A 2QVOA 2Z2SB 1EV7A 1UHMA 3R6SA 1STZA 3WTTC 4NB5A 3PQKA 3QU6A 2V09A 5DCFA 3GFLA 3NSTA 1X8MA 2L02A 1HKQA 2E1NA 3H1MA 5ERIA 3F72A 2YPRA 4YYOA 3OOPA 4U0WA 4KNYA 4A6DA 2A07F 1G4DA 4A0XA 4I02A 2GQQA 5EEGA 4AVCA 3L2CA 4I7HA 2IRFG 4BIFA 1X8EA 4WF2A 1DDNA 3I0TA 3V7CA 2BBYA 4A0ZA 3TNPB 2ISYA 4DINB 1HKTA 1PP7U 4IVNA 2DK8A 4L9VA 3BZ6A 2OD5A 3L09A 1BJAA 1J2XA 3RKWA 1FXZA 3LQQA 4ZZLA 2BNOA 1J9IA 2Z3YA 4LA3A 4GXOA 1FPQA 1XCBA 2PA7A 4ZYHA 2Z33A 1C0WA 3O3KA 5E20A 1ZARA 4LLNA 3ZMUA 3CJNA 1FBQA 1WLTA 3OV8A 3W6JB 3EETA 1Q1HA 3M9AA 2HGCA 3KGLA 4Y17A 2H6CA 4RB1A 1YFUA 4L9NA 4OIOF 3LAGA 3FZVA 3PQJA 4O5VA 2LNBA 2F5DA 5FLHA 2FSWA 4IHTA 1P92A 2FBKA 4OFGA 1S29A 4LUMA 3MEXA 2O0YA 5HDKA 2ZO4A 2M8EA 3ZMTA 4BNCA 1SQ4A 4MHGA 2RNJA 3DFGA 3G73A 3P9KA 1J3PA 1MD0A 1QO0D 4XFGA 1FP1D 1XB4A 2DAOA 1TW3A 3VFZA 2PFBA 5HS8A 3ECOA 5HI0A 3FXRA 4G7ZF 2K27A 5E1RA 1ZHFA 2XAFA 4E70A 1ZGAA 4LGWA 1R36A 4WXDA 4Z07A 2D45A 3ZMVA 1KU9A 3FXUA 3RJPA 3S7EA 2DO7A 3R0AA 4B8XA 3QP6A 2HQRA 4Q47A 5CVJA 1RUOA 2ETEA 4Q4ZF 5FO5A 1KU3A 3ZMDA 4UXAA 3WTXC 4QX5A 4MUVA 1UIJA 1TNSA 1YQAA 3F3XA 2FE3A 3TQNA 2DPDA 3TNQA 4RGXA 2HYFA 2CW0F 3RPUA 3LAPA 1VP6A 1P4XA 1W7PA 4IEZA 2B9UA 2QENA 1FNNA 3SMHA 2QZ8A 1IZ1A 5DDGA 3D82A 5D6FA 3DPTA 4LMYA 3F6VA 3HHHA 1KU7A 1HW2A 4Q0QA 1FY7A 1R58A 4XFIA 2V1UA 3BJAA 3N4MA 1JHFA 3KLNA 2ZNYA 5H6RA 3Q9SA 2Y75A 4HMZA 3HYIA 2BNMA 5JR3A 4QXKA 2MBFA 2KIMA 2K86A 1KYZA 2ET7A 1HSTA 2HJIA 4LLLA 5F64A 4A0YA 4ZYEA 2XHKA 4XSXF 2AXLA 2QDRA 4EM1A 4U7BA 1WSUA 3U2RA 2NS0A 2XLAA 1OPCA 5I0TA 5HS7A 1O5LA 4B29A 3HSFA 3GX4X 2XIGA 1B9NA 1K78A 5DEQA 5IT3A 3U1DA 4G6DA 3VB2A 1YO5C 1U2WA 4BYYA 3EHKA 4JVAA 3K1MA 3L7WA 5LGTA 4LB6B 2D1HA 2PYTA 4LK1F 2LDUA 2ZJ2A 1NZCA 2EA2A 1WKMA 2IJLA 3DV8A 1O3QA 1ZVFA 3KP3A 1SFUA 5I91A 1YFHA 2V79A 3BY6A 1L3JA 5CLSA 2PMUA 4HX8A 2P8TA 1FBUA 1HW1A 4ONUA 1ZRFA 2D40A 1NE6A 3I4PA 5HLIA 1VJ2A 2MLKA 2PG4A 4FBFA 5K5QA 4A5NA 2XVCA 2RN7A 5BQTA 3CO7C 5FQ0B 1CAWA 1R7JA 4QMAA 4L18B 3IWZA 1IRFA 4MTDA 4YNIA 1KQ8A 3K2ZA 2CQKA 3V8KA 3TKYA 1RIOH 1H9TA 3RZZA 5CADA 4Y13A 3ZDSA 3BCWA 5FLIA 3NVCA 2VBWA 1IF1A 3GYHX 4BHBA 1Y9QA 3QRFF 1ZZ7A 2OZ6A 4HYEA 2FNPA 2PQ8A 2IA0A 2UWMA 3RDIA 4LEJA 5DCMA 1LKNA 4AIJA 1ZYRF 3CO6C 3FHIB 4D7TA 1IPJA 1WI9A 4UVAA 1ZG3A 2QM3A 1A04A 4I2OA 3KE2A 3MZHA 1CF7B 1YLFA 1JUHA 2VQAA 1LR5A 3JTHA 4B09A 1ODDA 2A3SA 1O4TA 2H09A 3JSPA 3CEWA 5FLJA 2MHFA 3JZVA 3KP7A 1MJBA 1QPMA 2K4BA 1SD6A 1RI7A 1KA8A 3GFJA 2HQNA 1Z6RA 2E9QA 5FPXA 3ROUA 4CGZA 4FT8A 3FJSA 4JK1X 2FQ3A 4PIXA 2EWNA 5BPXA 3ELKA 2V6CA 1O3RA 1NYWA 2XAQA 2K4JA 5KBFA 2BYVE 4KDPA 3U10A 3TO7A 1R5HA 2HEOA 2GC1A 4GO1A 2BNNA 5KHKA 2A6HF 1GQHA 2NNYA 2QJVA 4OOIA 3KEQA 2HZTA 2FA5A 4EWDA 3KMHA 3C7JA 1LDKB 3WTUC 3MCZA 3TDZC 2P4WA 1ZRRA 1DUXC 1XMKA 4PCQA 1FSEA 1MDMA 4EV0A 4GGGA 4CHUA 3SCGA 3C3VA 5JI6A 1DZTA 3IBMA 3O2PE 1VTNC 3H8UA 3HUGA 3FMSA 2AS5F 3HOTA 1VR3A 4WCGA 2CAVA 2PFWA 2EFPA 4NVPA 3E6MA 1I6XA 5HS9A 4XFCA 4F8AA 2JZYA 1J7KA 3LAJA 1YW8A 2YU3A 1D5VA 2CSOA 1MGTA 2MC3A 3KCCA 5JR7B 1U3EM 1FOKA 4Z82A 4BAYA 3SQNA 2P5VA 1Q43A 4BQAA 4XFFA 2Q4SA 3MQ0A 2DPUA 3DEUA 4PDKA 4HVRA 4HF2A 4WVZA 4UHTA 4JQFA 2FOKA 2DU9A 5ILUA 3UKNA 2UXNA 3IL2A 2FF4A 3ETQA 2F5EA 5LHGA 1G6NA 3K69A 2ZBKA 5HOOA 1HKSA 3WE2A 2V9VA 1IXSB 1F9NA 1V3FA 2BE5F 5FFXA 4U0VA 3T8RA 3O14A 2OYZA 3R60A 3U9GA 4UNOA 2VE8A 3WW1A 3JSOA 3WW3A 1G3WA 3LWFA 4XFAA 4HLTA 2G9WA 1LRHA 3GXOA 5KHHA 2A6EF 4RGUA 4IRGA 1BI0A 3GVAA 1SD5A 2GXGA 2Q0OA 2UXXA 4O9EA 3BP8A 1NE4A 3LWCA 4WK8F 2VBYA 2DQRA 3BWGA 1PMIA 4KYWA 1FI2A 2PEXA 4J1XA 3GO5A 5I8SA 4KL1A 3WE3A 5FLXZ 3ZN0A 3ST7A 5FLXK 2L54A 4R8HA 5LRRA 3OGJA 4D0PA 3TO9A 5CVRA 1E17A 3M3IA 4KUMA 1Z91A 2RVCA 3CO2A 3IKVA 4ESBA 2XGXA 4L0YB 3BROA 3IKTA 2RDPA 1X3UA 4QM8A 3KP4A 1ZZCA 1BI3A 5I0SA 1ZN2A 1V4RA 2DCTA 3FHZA 4IHSA 3WTSC 3I7DA 2KIFA 3E6CC 1K78B 2L4AA 1DGRA 2ZMEA 2P6TA 5JAXA 3USSA 2LF7A 2MH9A 2Y0MA 5AONA 4KIGA 3ISPA 2RQPA 4Q5SF 1S6LA 4PGHA 1CAUA 5H6QA 2K9ZA 1IRGA 4WZCA 1I27A 1RGSA 3O6BB 3OTFA 2KXLA 2N7GA 1OFNA 3GEZA 1TLHB 2CYYA 4HV5A 3DKWA 2EAAA 2VT3A 3QACA 3Q9VA 2Q1ZB 3HHGA 3GBFA 4OMZA 3M1EA 5FCCA 2OZUA 2GU9A 2MNGA 1XDUA 3I58A 1MKMA 4EQQA 4OMYA 1EH7A 4E2QA 5L3CA 1EP0A 2E7XA 2HDCA 3PFIA 2OA2A 3ECHA 4LD5A 2W84A 4XRFA 2O61A 1F5TA 1TQMA 1P4AA 1XSXA 4UVCA 2CG4A 3D0JA 1T0FA 3ZP5A 1ZNPA 5IT9Z 2ET1A 5DCMB 5IT9K 1I5ZA 2V1DA 4XF0A 4UV9A 3I54A 5AIPA 5H20A 4QGMA 4S05A 3MWMA 1R1VA 4LLOA 1RNLA 4G94A 1LNWA 4EJVA 5HLGA 2IC1A 3RYPA 3H50A 1YFYA 2A5YB 4LJZF 2QWWA 3HT2A 2MLGA 1ZX5A 4WX9A 1BIAA 1GXQA 1SFXA 4L5IA 1ZAOA 3GF2A 2H6BA 3GZ6A 3WG9A 5C8WA 1GQGA 2LKPA 4LG0A 1RL3A 5LGUA 5ED4A 4KMFA 2OQGA 2YX4A 3HRUA 3E6DA 2P5KA 4XF4A 2QNKA 1R5GA 1JE8A 4MGYE 2JSCA 4MTEA 5FDBA 2GZWA 3SHFA 4I0AA 4EM0B 2JT1A 3K0LA 4L9TA 2P7VB 1QXJA 4M71A 2EV0A 2M45A 1XGSA 1I1GA 4P9FA 3NEUA 3MFKA 2EFOA 1PM7A 4RS8A 2STWA 3IDBB 4U88A 1YYVA 4ON0A 1FBSA 4G7HF 1D8KA 4YARA 1MJAA 1XGNA 3E5XA 5F6FA 3BPZA 1QQIA 4L9JA 2I45A
chains in the Genus database with same CATH superfamily
2ME6A 4EJUA 3LOIA 1RPWA 1D3YA 4AVAA 2ZGPA 3DCFA 4IE5A 2P6SA 1E5SA 5FV3A 3UNGC 2LBFA 4YRVA 3M3CA 1R082 1Q3EA 3DPRA 4PF1A 3P5BA 1SFEA 4UW3A 2W5FA 4UUTA 2DT5A 5JOZA 4QPGB 3O1UA 4N53C 2IXLA 2EK5A 3HUGB 2ID3A 5ABJC 1AX1A 3GBWA 1UY0A 4META 3O1RA 3ZMNA 4G7OF 2XHNA 1BOAA 2GMPA 5LEKA 2RGVA 1OCCH 2BOIA 4AW7A 4F55A 5J3LA 4G3YC 4ZH4F 3K9TA 2HOEA 4IXAA 1KZHA 1GNHA 3LPGA 1UPIA 1G59A 2IA2A 3EO6A 2X6OA 3NWTA 3ERED 4IO9F 1TMF1 2WAOA 3A0HC 3BJOA 2DTYA 4QHOA 4IF4A 4GD4A 5F5IA 1BMV2 2VJIA 2VZRA 3K7AJ 2PLYA 4Y22A 3B6CA 2I5UA 4AD9A 3HR9A 1YC61 2V72A 3VBHB 1AR63 2QDNA 3T1BA 2E7WA 3ZN6A 2MYSA 2FMLA 2UZKA 5FMCA 4NHMA 1OQ1A 4GXLA 3DPUA 4YM3A 1NK2P 1UB9A 1PK6A 3T0AA 2WBMA 4MZUA 4N43B 4S0HB 4KIFA 1FYKA 3EXUA 4UV8A 1ALYA 2XL9A 2LRDA 1VPHA 2YC0A 1R1UA 5CEHA 3WUDA 4PLMA 2KT0A 2G19A 3HOYJ 1YLLA 1U8RA 4ASNA 3I3DA 1NCQC 4OI1A 1PMJX 4HQMA 1S0FA 4IE6A 4QX3A 3S0MA 3B5LB 2DA7A 1BL0A 1UJ8A 3OYIA 5HPOA 4N9HA 1OLTA 4NHYA 4HW0A 3ZQ7A 3RFRA 3WSOA 5HVQC 3VSLA 2FDFA 4CEWC 4YVWA 2A71A 3A21A 3DQVC 5L3BA 1W6QA 1QJX1 1RINA 1A8DA 5C3SA 4XZPA 1VQ4I 3NL1A 2WZPP 3MUY1 3ZYRA 4HNVA 4ESJA 3V0BB 1QRYA 1UL9A 3MIBA 4BMEA 3I5UA 2WKKA 1H8AC 4EN9B 1IAWA 1RUF3 2EFWA 3IIAA 1FATA 1ON1A 4ET7A 2MH2A 1YJKA 5C3EJ 4UUSB 3F6OA 4YZ4A 2OKXA 5C8CB 2J5OA 3SH4A 2W08A 5EJCA 3TW6A 3UESA 1PP8F 2VVDA 3LSPA 3H3ZA 3VBOA 1SLCA 3CL1A 1L0OC 3PIPF 3WODF 4BQQA 2A6YA 3DEEA 1NG0A 1YJWI 1MMAA 3I59A 2GLOA 2XWJB 2WAEA 1O8SA 2DCYA 4A45A 5K7FA 5FFOC 2WT2A 5D5UB 3O12A 1U6GA 5FWEA 1JUMA 2HWVA 1T08B 3FFQA 4L11A 4OINF 5TGTA 1IN8A 4S2GA 2X0LA 4C3JJ 5FZ6A 1P7IA 4AQSA 4JQRA 3ZYHA 2QFEA 4XLNF 1DF0A 1JYWA 3NNGA 5K7PA 4NWWA 4HG2A 2OZJA 4FXGB 1B35B 3FX3A 2K9LA 3WU2C 3SH5A 3BI3A 3IKWA 1WWXA 1BJQA 1J5YA 2XAJA 2HBTA 5C4WA 2LG4A 5E1ZB 1JYNA 2O03A 1Z1DA 3W2WA 2X48A 2WABA 3OYHA 5K8SA 3CLQA 3CUQA 4EN8B 3SXYA 5J96B 1VBD1 1T2KA 3G1LA 1F1ZA 5T50A 5L9VA 5JLXA 1YW9A 2DFCA 4GB33 4CDGA 2D93A 4M6YA 5C5UA 3W20A 4BXFA 1WH5A 1G9FA 3ILNA 3K4NA 2QBYA 5F37A 2WFPA 1JBCA 3IT8A 1DGWA 2VIXA 2XLFA 1PGL2 5AC91 3HBZA 1VAVA 2RREA 5I8TA 2ZGMA 2VCMA 3W5MA 1O4ZA 1ZZBA 5IUQA 3PDQA 1R49A 1S0GA 4IV1C 3S8PA 1GR3A 4QAWA 1PGSA 5JVTA 3F21A 3HTUA 1EUUA 2DVAA 4OAYA 2NLRA 1GKBA 1OLQA 4P5OA 5LB6A 3THCA 3ZFEB 4CCJA 1O57A 1ORKA 4M4RA 2IS1A 2WO7A 2QKLB 1B4AA 1TWCJ 4E4HA 4F83A 3WDUA 1RETA 3THPA 4UBGA 4B3XA 1HRV2 1O91A 1W03A 1YIJI 2Z5UA 4E6KG 1U0JA 5LCWL 2R7RA 2PI0A 5FYCA 5IVCA 2CUFA 4MLOA 4QU1A 4E9KA 2CFXA 2CU5A 1T98A 4IUGA 2VPVA 4QWQA 2TDXA 4MGZE 1OCOH 4FASD 1R22A 1UY2A 2K02A 5HXVA 3NJYA 1ZBA1 1WRJA 1XSVA 4EJRA 1XNDA 4PUSA 2ZFWA 2OU2A 3IDEA 1ZGJA 4XIOA 3EBRA 1AUYA 1CX1A 2E34A 2ZXIA 2DW4A 3MIHA 4CDUA 2E2HJ 3P1IA 4AK3A 3PVBB 4JAAA 5D4SA 4IEWA 1NH3A 1WLWA 3K3NA 2DODA 1W04A 2O8XA 1JHJA 1JZ4A 2ISZA 2DA5A 2EFNA 2VJJA 4EQVA 3H9AA 1XGMA 5BS6A 1CAWB 3WQ1A 4JGZA 3FBMA 2PELA 3RKQA 2RJLA 5B66C 2VQHA 1AU7A 4HRIA 2VCCA 2Y0IA 4I01A 4XKCA 5FZ7A 3PU3A 1UG2A 4CPBA 4JX0A 1RUD2 3TEXA 4OWRB 3NRVA 3S5QA 2LY9A 2JDHA 3MKWB 1ZQ3P 5F0HA 2JDKA 1HB3A 1SD7A 1RTVA 1K61A 3LB9A 3HB9A 3M4FA 2HEVF 3M7GA 2IS2A 4AGVA 3ZFGC 4KMQA 3FXQA 1PO21 4EN0A 2ZKZA 4IERA 5CFCC 3PUAA 1UW8A 4Q4W1 4DZGA 3DBLB 4CP1A 3DP7A 1ND3A 1QOOA 4YFKF 3RYKA 2XRNA 5FZHA 2Z69A 3KZZA 2M87A 1T6GC 2K9SA 2A6ZA 2IFWA 1OC1A 3VDCA 1UOGA 3CMMA 4A3XA 4M0HA 1RUI3 2GWRA 3WNMA 2W94A 3TGNA 3RWKX 2PAMA 1J58A 5IPAA 2ADDA 2VG9A 3W2AA 1KU2A 5JLWA 1F5JA 4ASLA 4FOQA 3KP5A 4OI0A 4BMBA 2CNAA 1QJZA 4BJ0A 1B8IB 2W25A 4IHXA 3AKPA 1ETVA 3O1VA 1Z78A 3N36A 5FYYA 3NV1A 1W8NA 3R0JA 4XLEA 3KVAA 1JU3A 3T30A 4GA9A 2IWGB 3EPZA 1REDA 5K7HA 2BGCA 2VMCA 4QU2A 4QDQA 3EMRA 5LBFA 2DA1A 4C1XA 3LSMA 1EKEA 4NIGA 3KX2A 3ZIWA 2Y6FA 2Z99A 1W8OA 4E27A 4MV2A 2J1EA 1HCRA 3H3VK 2IT0A 3MBWA 5EYXA 4JKMA 2GNTA 4XJZA 3FISA 3DN7A 1LECA 1MJ9A 4DNCA 3L9JT 3LCPA 4XQ4A 4HZFA 3ZR5A 2QQNA 3RRDA 1QPIA 1NY71 2IFRA 1S8NA 3V0AA 3LFMA 3FF5A 3LSEA 1TQ5A 5FY0A 4OHYA 4MO7A 3MFAA 3ZPOA 3E5QA 1B6AA 1YQCA 4NROA 2YBKA 2Q2EB 3BUCA 3ZN1A 4Q4Y3 2BERA 2XF5A 3WV6A 3T09A 5TISC 1SPPB 5B3SH 2VUCA 1QVTA 2DCZA 4CYCA 3BPXA 1IN7A 3JRHA 3OYWB 3Q5FA 1EPWA 3K4CA 3JRDA 1H0BA 2HS5A 3HXLA 5FYTA 4GIQA 5JIUA 4XEZA 4XTMA 2KLOA 4PDWA 2HTJA 3CZJA 1WWYA 4U2AA 4XUNA 1UIKA 3ENRA 5JSOA 2XV4S 4HLYA 4ZYGA 2PMZN 4XETA 1XNCA 4D5FA 2EXJA 1J59A 5FKKA 2F5FA 1TBXA 2O6GE 4K21A 1IC8A 5F0CA 1SDDB 1WA4A 2DMUA 1MQTA 5E18F 3O8GA 2GNDA 4BQ5A 2OBPA 2JA6J 2OAZA 3QCWA 4JDNA 3VYSB 1XE7A 3OCPA 4YIIA 3PU8A 4GFBA 3AMPA 1BN5A 1GVDA 3LEIA 2Y6LA 3DECA 2HKOA 4S2FA 1X1PA 2AZ5A 2UY8A 4HKOA 2DF7A 2FEZA 1I39A 4C3HJ 2KKOA 2E7TA 4QXBA 1EV13 2CAUA 5EPAA 1X1CA 4P9JA 3DF0A 2UYAA 3KP2A 1F5FA 3I49A 2W68A 1TQIA 4JGYB 2KJBA 1P6RA 2EICA 2WS91 3EJKA 3H36A 3N05A 5D6EA 1H1MA 5A7WB 1HX6A 4WM7A 3K75B 2M30A 3U1XA 1GWLA 5CB7A 4EGYA 1C8NA 1LEAA 2Z1DA 1QZZA 1BEV1 3H5RA 4PJJA 2J1AA 3A1YA 2ADUA 5M3MJ 5BY5A 1XMAA 1BR1A 3U07A 1ZELA 1CZSA 2PHDA 1COV2 2MA3A 4WVVA 1XX5A 2R7EB 1HXS1 3VHRA 3E0JB 4XICA 4D6RA 2B5HA 4M6VA 1BI2A 4Q0VA 5DYMA 2OF7A 3IWFA 2V4AA 3ABTA 4OIQF 1XU2A 3KF3A 4AVSA 4LTAA 3U4SA 1U5YA 3GLXA 3CUOA 1OKRA 1XSDA 3S3OA 5E8IA 4HANA 3OBAA 1C8M3 3K2AA 4H14A 4JV4A 2EALA 3L2HA 3CDHA 1TP4A 4C8DA 1S0BA 2HWB3 4YSFA 2WC2A 1XBFA 5FB2A 5I0DA 4XBFA 4KICA 4DUXA 3GFIA 1REPC 4IXLA 4RAFA 5IYBJ 3O1SA 3ZOIA 2VUAA 2BFUS 4WWCA 3TMOA 2YG0A 3NQOA 1RUG1 4DUVA 4YVSA 1BM9A 1QBJA 5CJ9A 3FZ3A 2ARBA 3QU3A 4LO5B 4XMIA 4O7XA 2IXHA 2A05A 3LA2A 3K77A 2R7WA 1H8TA 4IETA 1VF9A 1ZH5A 2E5NA 1SLAA 4XCBA 2DMPA 4Z2WA 3VUOA 4D9JA 1PYVA 3UR3C 2RE9A 1RZ4A 2YGLA 2LD5A 2MPFA 2VXJA 4OHZA 3FC0A 4RM2A 2ZGRA 5A6YA 3BDDA 3SHRA 4RR3B 4P9IA 3ZXEA 1DGRN 4OHWA 2JA7J 2YPDA 1V5FA 2ZKLA 2BY0A 5C6CA 3ELNA 5LBBA 2FNAA 5EEHA 3AP9A 2HLEA 1F4HA 1WFXA 3NRUA 1MS3A 2IW5A 4HN1A 3AL6A 3RKXA 3AG1H 2CV0A 1G7YA 3CJXA 1D8JA 2DTWA 3IDCB 5LA2A 3WZ1A 1UMIA 4OVEA 1VQPI 2VXRA 4KI5M 1MSEC 3FXLA 1YS6A 1YFXA 1R23A 3LOBA 4OAZA 4BE1A 5M5XJ 3S32A 1AR73 1O4XA 4FX4A 3WGHA 2VOPA 2RMU2 1XOYA 3BKZA 1KQ9A 4YGBA 1G3SA 1PUFA 2C9AA 4R9DA 2KIUA 4A5MA 4LORA 4A41A 2ZSIB 3NJZA 4RB2C 1VBB2 1BOBA 1CAVB 2DUQA 2M5WA 2GMEA 5EZGA 3KHCA 2BOJA 4BWOA 2FOWA 4XJ8A 2VODA 3HJRA 4UBHA 4LHLA 4X0GA 4DEQA 1FWZA 4YIFA 4UUVA 1NCRA 1D4M1 3MAJA 4RB0A 5FPAA 3OYKA 2R5YA 1FPN3 1R091 1S9HA 3FN9A 1MZ5A 1Y39A 3CZUA 5FROA 1CF7A 1QDCA 2W24A 2M1BA 1ASJ2 2WZEA 3OY8B 1FOD2 2XL7A 4X6QB 1ZR2A 1KQ0A 2M4KA 2RHPA 5EXOA 1K4SA 2HVQA 4U0YA 3K1PA 4Y22B 3W59A 4HA8A 1AHSA 4L2NA 1US2A 4M72A 1S72I 2VZSA 1VRH3 2QQBA 3J81Z 2EJRA 2IVMA 1ULYA 1ZG1A 4PIZA 4HSRA 3OPWA 3G1MA 2QVOA 2F4MB 2Z2SB 1STZA 1YQ8A 1AKHB 5DMYA 5CKMA 1W39A 1N3OA 4ATEA 3GFLA 1X8MA 3PTYA 4TN7A 2E1NA 3H1MA 1NK3P 1EAH3 3N3HA 5FKCA 3LKJA 4Y24A 4HPKA 1JH5A 3USUB 1MS8A 2A07F 1N3PA 5EHDA 3WDVA 5E3LA 2E60A 1RHI3 5A1FA 2CDPA 4BIFA 5IYCJ 2JDUA 2M4GA 3FHQA 1DDNA 3IAQA 5GKAC 4IEJA 3TNPB 2L9LA 1HKTA 1PP7U 4YGCA 2RS11 1RUJ2 3BZ6A 2OD5A 4SBVA 2ZZQA 3Q8EA 1RMU1 3T0BA 1H2NA 1PGW1 3L09A 1ETWA 1J2XA 1D0YA 4BQWA 3AG4H 4LA3A 1FPQA 1XCBA 5IVFA 2Z33A 5M5WJ 1IJWC 3IB3A 1LESA 3O3KA 1ZARA 4B4CA 3N9MA 1KONA 2IVJA 2QKDA 3CJNA 1XJAA 1WLTA 3W6JB 2CW8A 3H35A 4H3WA 3AJZA 4CTEA 3N7KA 2WNVC 2XJQA 1JYTA 3C7HA 2J7MA 4YVWB 4C2UA 4Q1PA 5KNLA 1WW5A 3L2UA 5FY5A 3FZVA 2YC2A 1SG3A 2EIMH 2HWE1 4BDZA 2F5DA 3GCWA 4B43A 2AGSA 1I3HA 2ORZA 4IHTA 1RUJ1 2D3PA 2X6WA 3E1SA 1ZK8A 1NA1B 3B9IA 2ZMLA 3OSDA 2RNJA 2RS52 5DABA 3OGSA 1YRNA 3P9KA 3GTGJ 2JA2A 4XFGA 2JE9A 1OBNA 4EE2A 3SDGA 3CZ6A 1TW3A 5IT6A 3ECOA 2IXSA 3POIA 2PXJA 1ZHFA 2CQQA 2UWAA 4E70A 1ZGAA 4LGWA 5C4XJ 4LE3A 2YZ4A 2HWC3 3MGUA 1V5EA 1XYOA 3RJPA 1E5RA 4GJYA 4GMP1 2ZC2A 2G9GA 2DO7A 5IFPA 2DURA 1F8VA 5CVJA 4IOAF 3O5SA 4E4DX 1RUOA 5FO5A 4NRPA 3VKOA 4UXAA 1GFF2 3F3XA 2KM2A 3RPUA 5IATA 4XUOA 1AYM2 2WQ4A 1VP6A 1P4XA 2VKHA 2UUZA 1W7PA 5D8AA 1DP0A 4XABA 5DDGA 3FXKA 5JI7A 1AL21 3DPTA 2VULA 4LMYA 2ERFA 1KU7A 1HW2A 4Q0QA 4XFIA 1XYNA 3K4DA 3HG9A 3BJAA 2VUMJ 1U0AA 3N4MA 1FX5A 1HRI3 5LBCA 5GPAA 5FZ8A 1E0EA 2UWBA 4HMZA 3HYIA 2BNMA 2A5WA 4DUWA 2MBFA 2FBEA 1QQP3 4D7NA 1J83A 1HSTA 4AFCA 2Z79A 3DCQA 1UMQA 3VGIA 5F64A 2RM22 2B46X 1ENQA 2AXLA 1JOPA 1MS1A 2A3YA 1UG0A 5JZGC 1RB8G 5SV8A 1A31A 4UY8I 3WCSA 3JB4C 3GZTB 2V26A 1W9SA 5I0TA 2CUZA 4AFBA 2LUWA 1XNTA 1C57A 1BR4A 1B9NA 3ZOBA 5IT3A 1UZWA 3VB2A 4JVAA 3TP3A 2M7BA 3OYLA 3A22A 2ZJ2A 3C2UA 3DV8A 2JK3A 2DFEA 2V79A 5BNPC 1K5MB 3JD73 5FZFA 1OA2A 3M3YJ 2R7VA 1VJ2A 2C4XA 1OLRA 1SFYA 4FBFA 4RS5A 5A3WA 2OTLI 3J7AY 4WVMB 3CO7C 4AF9A 4FPHA 1R7JA 1ETXA 2JE7A 1IRFA 4YNIA 3K2ZA 3TEDA 1JOJA 5HBAA 1HDKA 3HKZN 5E89A 1H9TA 3M8LA 4BU2A 1JKPC 3ZDSA 2TNFA 2VB6A 3NVCA 2VBWA 1IF1A 3I8TA 2WR9A 3LEMA 3GYHX 3EUAA 3QRFF 1ZZ7A 2DTZA 2LR8A 2XJVA 2OZ6A 4HYEA 1BK0A 2UWMA 5C9AC 4K6BA 4LEJA 4AIJA 4BDYA 1VALA 1IPJA 4HG6B 4WM8A 2M2EA 3GJAA 3POYA 4V2FA 3K46A 2VBBA 3KE2A 4NDLA 1YLFA 3WDTA 3JTHA 4FE7A 4JYKA 3ZFFC 2UWCA 3CEWA 3EB7A 1WCUA 5FLJA 3SEZA 2A6VA 2W39A 4NC6A 2MHFA 3KP7A 1RVF2 4P9LA 1QPMA 2F4IA 2K4BA 1JZ5A 1SD6A 4FPJA 1VBE3 1FV2A 2XBO1 2E9QA 3ROUA 4CGZA 4DJAA 4CEYC 4PIXA 2EWNA 5BPXA 2XAQA 2K4JA 4FFHA 1MPXA 2WAQA 2BYVE 4XBLA 1Z0HA 4TZDA 3U10A 3VBSC 4BM8A 3CF2A 5F8PA 3B6AA 3GTLJ 2VBPA 2A6HF 3LDBA 2NNYA 2BVBA 4EWDA 1MVEA 3NNLA 5BNOC 2L7FP 1W0PA 4MG2A 2EIDA 2LK2A 3MVPA 3TDZC 1SVOA 1DUXC 4IQJA 2J22A 4F3JA 1FSEA 2FCTA 1MDMA 4EV0A 5FKMA 1A6CA 4CHUA 3SCGA 1POV0 1DZTA 3IBMA 3O2PE 2NS8A 1VTNC 3H8UA 3HEIA 4EN6B 1QOTA 2LKSA 2D6NA 3FMSA 4YW1A 1RIRA 3PNTA 5LA1A 2BY1A 4COWA 2LW8A 2EFPA 4NVPA 2FDJA 4C0BA 3WLUA 1Y1WJ 4LO6B 2R5ZA 3OGVA 3UGHA 2E5ZA 3S6PA 5GLZA 4B4PA 4FETA 2GOXB 2ZGNA 4QKNA 1J7KA 2M0CA 4JX4A 3PIJA 2CSOA 3GZAA 1MGTA 5JR7B 3ZSJA 3PUIA 1U3EM 4XMYA 4Z82A 3SQNA 1UHSA 4MFDA 2JWPA 2IGNA 4MIMA 3MQ0A 3K10A 2CUJA 2BZDA 3I2HA 1MBJA 3DEUA 3ZGKA 4HVRA 2YU9J 2FOKA 2DU9A 2UXNA 2FF4A 1XS9A 3OYCA 2F5EA 3G71I 5FZ4A 1W6OA 2ZBKA 5FMBA 4UB8C 1VAMA 1E5HA 1IXSB 1F9NA 2BE5F 2YC4A 3O14A 1PX3A 1SFOJ 3WW1A 5IP7J 3JSOA 2WJSA 4URAA 5C7GA 5T54A 4AEDC 3C2BA 3HNBM 1QHDA 1BI0A 2Q0OA 4O9EA 2UXXA 5JXJA 1G9AA 1NE4A 2QQPA 4WK8F 2GN7A 1BVP1 4RQPC 2HOSA 3BTAA 3VDDC 4KYWA 1N47A 3VBUC 4HK8A 5FRMA 4KL1A 5FREA 2PX9A 1X36A 3VDAA 2RV9A 1AR62 5DUUA 1YI9A 3POWA 1G9DA 3DTIA 2XPVA 5IYYA 1R71A 1E5IA 4CH7A 4CDQA 1LHWA 2LOOA 2E36A 1D2SA 5CVRA 2R92J 4COVA 2YFUA 1O6UA 3OYDA 2Y38A 1Z91A 5B5EC 4ESBA 3NJXA 3RG0A 3BROA 3BG5A 3NV3A 5FZBA 2LP0A 3RZKA 2W1QA 4R9AA 3BQYA 3IKTA 2RDPA 2EIJH 3TEZA 4N53A 4QM8A 3WNPA 3PJQA 1ZZCA 4CDWB 5ABJA 1ZN2A 3HVDA 5KXEA 4NOTA 3HEFA 2VOWA 1AZDA 1QNWA 3E6CC 1SLBA 2JENA 1BW6A 1KS4A 4CCMA 5JAXA 2ZX0A 2QF7A 2JQ7A 3N9OA 2LF7A 2Z4FA 1QJX3 5FMDA 3KHBA 1IG3A 3B94A 2RQPA 4PLOA 1S6LA 3CCLI 1KDMA 3DXTA 5A33B 2MGQA 1UKRA 1I27A 4BEHA 4QPGC 3OTFA 3I2IA 5CFDB 4II3A 2N7GA 3GEZA 4HV5A 4LHKA 3Q9VA 3PUQA 4MVTA 3AYAA 2OPTA 2QTWB 4EQQA 4OMYA 1MZFA 1EP0A 1RUF2 4D69A 2HDCA 2WDBA 3OBRA 3CDLA 1XSRA 4OHVA 3K70C 4CP9A 4AZZA 1TQMA 4UVCA 2VAUA 1T0FA 4BUPA 1W2NA 4IV1B 5DCMB 1JYXA 1RITA 3NWSA 1Y56A 3AFGA 4MGSA 4ZC3A 4XF0A 3VYTB 2BP6A 4BXXJ 1BHGA 5AIPA 2GP3A 1R1VA 2KMUA 1MS5A 3WF0A 3JXSA 3KB5A 1PO11 2WZR2 2K40A 1YFYA 4XHBA 2QWWA 3HT2A 3VBHC 1LOAA 4HETA 4GZ9A 1QHHD 2W00A 5FOJB 3SEQA 1BIAA 1NCQA 2W48A 1VB4A 1UNBA 2YMZA 3CP2A 2XUMA 2VW0A 2WIIB 4ZY9A 4XE9A 4O61A 2LKPA 4LG0A 4XLAA 5JVVA 1S0EA 5ED4A 1ODMA 4J00A 4LQRA 1X3WB 3HRUA 3S57A 3WNLA 4UFHA 2VNOA 4NAMA 1W8HA 4CEWA 2WL1A 3OD4A 4N43C 5FDBA 3CCVI 4EM0B 3ZYFA 3FBYA 3U37A 3ZYPA 3K0LA 4L9TA 3S1QJ 1VBD3 2P7VB 4K9SA 2M45A 3WHBA 3NEUA 3IPVB 2EFOA 4FQZA 4PQ9A 1Z7S3 2STWA 2VNGA 3VB9A 3ZIXA 2VY0A 2P3KA 3ZXFA 1XGNA 3BPZA 4GB32 4BB3A 2ZHNA 4BOWA 1HB1A 2BFUL 4NIHA 3H9QA 2FD5A 4JDOA 3THTA 2JVGA 2RC4A 1KEXA 2EV6A 1S1AA 3RI4A 3POSA 3J7LA 3I2OA 4IE4A 5FYZA 2XPJA 2CFOA 3WG3A 2VTFA 4YWAA 2IUWA 4A3CJ 2KD7A 5C5TA 2JDMA 4FVVA 1EY2A 5IK8A 3LGRA 5IAVA 4XN3A 2CV6A 3IN9A 5F27A 3B02A 3G6EI 4W50A 3S2WA 2G7HA 1ND2B 2F4LA 3RGBA 4A42A 3NKTA 3VBFB 1J1TA 3WTYC 2ICWG 1RJ7A 1UX6A 4AI3A 3HIFA 4HSJA 1JMUB 1GOGA 1POV1 4IEVA 3SXWA 2E7QA 2BW8A 2TBVA 5A1AA 3P9IA 4XOPA 4YG6A 2XPUA 4DBRA 5C8CC 4P9UA 5A3LA 4E7KA 1YRZA 2G1MA 2W4SA 2WTEA 2JX9A 3ZFGB 4TLFA 4V1PA 3I4MJ 3CLOA 4A3JJ 1SCSA 4G8XA 4BQXA 1FZPB 4XKWA 3AYCA 1MBFA 1ZREA 4BE3A 1J0RA 2YXSA 5K5OA 1XGOA 1Y1VJ 3AJYA 4I76A 4FAHA 1ZBA3 1G3YA 2PMHA 4PIYA 1W1WE 4Y4RA 3WP4A 2A68F 1BW5A 3KZYA 4Z2YA 2VC9A 1US3A 1I1EA 1B35C 4Q4V1 3HRMA 3JAMZ 1KRIA 4OIPF 5B4XA 4AGGA 3QYBA 3SQOA 2WV0A 4ZU4A 4PJMA 2NNNA 3KCXA 5J36A 4W97A 2F5CA 3OF1A 2MD5A 1H88C 4YG2F 5BV6A 3FKIJ 1Y9MA 3BCBA 4AYBA 4M9ZA 1ZR4A 4IV3B 3MLLA 3JBG2 2NVUB 3MLJA 4P9GA 3TWIA 4Y15A 4BK4A 1R1TA 1ULOA 4V2VA 4UFKA 5F2SA 4CU9A 2JG9C 1IXCA 2FQ4A 1OPMA 2R5YB 3Q8BA 1APNA 4QB2A 3PIGA 1T2XA 2DBBA 4XURA 3KLOA 2XJTA 5EJ3A 5GJ6A 3COAC 1HDDC 4PT6A 2DWRA 4GWMA 2XAGA 4BKXA 2TCTA 3DBHB 5EF6A 2VZOA 2YGMA 1YX5A 4A2UA 1ZGWA 1YQ2A 4I0BA 2OVUA 1PO23 2XB6C 3WGGA 5JXGA 5IP6A 1DCSA 3RZJA 1DGRM 1XDSA 2BY3A 4Q4W3 5CYVA 2XUEA 2P3IA 2XJRA 4RA2A 5ICFA 3SDBA 5C3QA 5FMOL 1CAUB 1DP7P 4KH9A 3ZFEC 3CBNA 1Z9CA 2ARAA 2DBNA 4XUTA 1N3QA 5F1RA 4LUKA 1W06A 3TOJA 2H0VA 2DA2A 3GTPJ 2ZSHB 2BEOA 3CQOA 3RYRA 1WJ5A 3L2YA 1DU3D 2CMPA 3J80Z 2K7LA 3JREA 2B45X 3DKXA 5C33A 2GNBA 1RUI2 2D3SA 1R4NB 2QEXI 5ILSA 4XK4A 2Y48A 2W2IA 2D3RA 4R52A 1RRJA 4RN5A 3MLKA 2QVSB 3N35A 1OA3A 1UZYA 2A73B 3GYDA 1EA3A 1FV3A 1MMDA 5DV5A 3ZQLA 4GJZA 3N97A 2OQRA 4IESA 2ZEWA 4KN4X 1MMGA 1VNDA 4KA4A 2RVAA 1RESA 2JVHA 4Q4X3 5FAXA 3E3VA 2LTNA 3CP8A 4LLGF 1OVSA 1K12A 2FBHA 3M1CA 1TQPA 2ZEZA 2HQ5A 3MW2A 2LRPA 3GTKJ 5E8GA 2PHLA 3OOUA 4XQFA 4E2SA 2RDRA 1SVMA 4NC7A 1XSQA 4MGRA 5IVJA 3WY6A 1JT0A 2XDVA 2HOTA 4FPLA 4BA6A 1OCPA 3W2VA 1C3HA 1JZ7A 1FSHA 2VONA 4QB1A 3M2MA 2P0WA 4S2DA 4XSZF 4MXWA 5ICEA 1JKOC 5HXMA 3MHZA 2JUGA 4HL0A 1N77A 4NBQA 3ZQIA 4HDVA 2VM9A 4KBBA 1SCRA 4Q4Y2 5LASA 4LT5A 4HPQA 5BNNB 2WFF1 3SZTA 3HOXJ 5CZKA 2STTA 1UZVA 4AQ2A 5CKNA 3IP4B 1W7PB 4AI0A 4V19K 5DAPA 3HPNA 1K7AA 4HX4A 2O8OA 3ZMOA 4Q0PA 3MUZ1 2ZGTA 5DDJ1 3CIHA 2DJNA 1Y6IA 1HQWA 1W6PB 3OYNA 5T52A 3POFA 3GNEA 3WG1A 5L3GA 4Q4Y1 1H2LA 4ES8A 3FLPA 2BU9A 3T4HB 3GW2A 4H0EA 1S5LC 5DZGA 3ML6A 2IAIA 3OUJA 5L9RA 2O3FA 4PCRA 3CCSI 1CD3G 1SLIA 4OZOA 3VODA 2X09A 2VJ5A 4QLCU 1UMHA 5FBJA 4YEJA 1QNTA 3H9JA 2R4GA 2X53S 4K1YA 1Z67A 4MH0E 5HCBA 4YLZA 3ES4A 4DYQA 1OCTC 5AVPA 1EV12 5H9RA 1UELB 2A69F 1CPNA 1VQMI 2WS93 1MW7A 1N1YA 1OYIA 2LH9A 1WCKA 2CV1A 1YXWA 3D5LA 4RS5B 3MIGA 2D7FA 1PZ7A 3ON7A 4BHCA 2R3SA 1ZG5A 1O3TA 1QA6A 2N8GA 1LJ7A 2B42B 1J75A 4B1LA 1JYVA 2FRHA 1HQCA 1XPXA 4RGSA 1HXS3 2RJKA 4IHVA 4CDXA 4QKDA 2DA3A 4K8RB 2KZGA 1V0AA 2VZQA 4PK4A 1GZCA 4OLLA 1DQUA 3RZMA 4X8NA 5KR7A 3ABZA 3JRIA 4HV6A 4UFLA 5LY1A 1PVEA 2WNUB 4CXWA 1S7OA 1ZKGA 1SFPA 3DLAA 4QM9A 4DQAA 1H89C 1LEDA 4FPGA 2Y34A 1D4VB 4AOCA 1YI7A 2EXIA 4URTA 3LZZA 5B4NA 1C8M2 1E57A 4XQWA 2D6KA 2R30A 1JHHA 4LKFA 5GAGJ 4ENJA 2CW7A 2IBDA 5CYYA 2RR13 4CUGA 2HWB2 3TOBA 1D0GA 5LGNA 4RGRA 5AVAA 3MD2A 1JTXA 1W9TA 2BHYA 2OCCH 5CVIA 1RUG3 1Z7LA 1YHFA 3H1YA 2A70A 4FX0A 2CGPA 4Q8KA 4RYDA 3HN1A 2OTJI 1UYYA 2CWEA 3F22A 5F6LB 1D0HA 3W9AA 2C1FA 4N9IA 3JCIA 4NQWA 1T56A 2Q8OA 4NPRA 4XF3A 1RUH1 2D6MA 4Q0SA 3ZR6A 3A03A 1UY1A 4ENMA 5A1LA 1M4WA 5KAFC 2JKBA 4GH4B 4IRHA 4DXTA 4KIBA 4MEYF 1A8MA 1SLLA 4ORFA 2XOMA 1QHGA 4ENNA 4KNCA 4ZPIA 1FLIA 4EYUA 2X1DA 1LJ9A 3FK7A 3AZWA 4XUQA 5FZOB 2GXBA 2DOAA 2QLZA 2WAFA 1NX9A 3FBIB 3UETA 2BV6A 4JGYC 4GDFA 2EZLA 2ZA9A 2NOJB 4K8FA 2KRCA 1I6HJ 1C1FA 1OXCA 4PJ0C 1X7NA 3PVNA 1EPZA 2YV8A 4M9SA 1U9NA 2WSVA 3E6BA 1UMZA 3UJQA 2K0GA 3D5RC 2R5ZB 4QD2A 2AENA 2ZZJA 4JHTA 2ZGOA 4AIHA 1JJ8C 2AH2A 1OR7A 4QGNA 1GUUA 1WJCA 2CV2A 5FY4A 1QF3A 5FKLA 4BH9A 1AR72 2QCOA 4AEJA 1W8TA 3CTAA 2VZ3A 2OPKA 3IDAA 2W87A 5HLHA 1K5JA 3H42B 1VIWB 3WHCA 1K6YA 3WTZA 4K20A 3ONQA 1SMYF 1K83J 3MEPA 1RC9A 1I1SA 1X82A 3P5JA 3VOEA 4MO3M 2PJRA 2DK5A 5J37A 2AC1A 2WNVB 4J1WA 5C4JJ 4IJAA 1R093 4FTBA 3M4OJ 4KGQA 5LLQA 3H0DA 3AP6A 4DNYA 4TXWA 3HN3A 1UFMA 2TRTA 4M73A 3NAPB 1VMHA 4FFFA 1FPN2 5KXBA 2D1VA 3SKVA 4AFDA 1AX2A 1EH6A 3SFZA 3EQEA 2FQPA 2R0FA 4ASMB 1TNTA 3KP6A 2H94A 4E7LA 1VMFA 3LOCA 2UYBA 2F4OB 3HRSA 5FYBA 1K6OA 2QQUA 3ETPA 5E3MA 2W46A 1VRH2 1GWKA 1XYPA 5JHUA 1JZ6A 3FIWA 4WBBA 3ECQA 4M3CB 5KHDA 1LEMA 3AP5A 4CDQB 4NWVA 4Y5TA 2ZHKA 4CCLA 5BOXA 1W99A 1DYPA 1EAH2 5HCAA 5C3RA 4BLIA 1HW5A 3BZCA 4Q29A 3KF5A 4DPNA 1F4KA 2RS13 5DN2A 1BBT3 4RR3C 1RMU3 1T6SA 1RHI2 3N7LA 2JG8B 3K2OA 1R64A 1HOMA 2ACJA 2ZHLA 5LW9A 3I71A 5C70A 3ULQB 4UW4A 3MYXA 5T5PA 1PVXA 4PQQA 4IRIA 4CU7A 1DZRA 1AWCA 1VRH1 2VW2A 3ZN5A 3M70A 2E1MB 3ABKH 2GXAA 1AR93 3WG7H 3H8XA 3S2DJ 4N90A 3OL3A 4LULA 3D3AA 3KZ4C 1OYWA 2VOTA 2X4HA 2R32A 4ZKTB 5JLVA 2HWE3 1RR7A 2HYJA 3U11A 4XDPA 4I09A 5C3OA 2NRAC 4QHBA 2WAAA 4ZHNA 2ZKNA 2HWF1 3H1WA 5T3NA 4G9YA 5GZEA 3OB8A 1XNAA 1L3LA 1SBFA 3R4SA 5E3OA 1IV6A 2P5BA 1LHOA 4FPCA 2EFQA 5IVBA 4HQEA 4NRQA 2GP5A 1TWFJ 3SNMA 2NMOA 4XR6A 5CU1A 4Y1XA 5D4RA 2WWYA 3CJIB 3FHNA 2M7AA 3DXJF 2EXHA 5EQUA 2XRLA 1U9OA 2EIEA 2XB0X 1ZRDA 2VO5A 2DN0A 4KQ7A 1PVC1 2QBXA 5DPNA 4GMP3 1W3XA 1N1SA 4AHZA 2VE1A 4XLHA 4CP2A 1C28A 1X1BA 2HWC2 2QQJA 3CD6I 5M0TA 2YB7A 4Z1VA 3UYJA 2DOFA 1W8FA 1DU0A 2O9LA 2CQ7A 4ES9A 3QPTA 3IH3A 4YW4A 4Z6YA 2EXKA 1QXPA 1RUE1 2OUHA 3QPHA 4MQVA 2VMEA 1T8IA 2O0OA 3KGZA 1PIV1 1AL23 1HBXG 4LG3A 4B7EA 2JIJA 3FXMA 2ATFA 2JB8A 2YR2A 3IUOA 2K85A 3QOEA 4BXUA 5CQGA 2IP2A 1Q8PA 2JDZA 1XQNA 2LSOA 4RHV3 3GXUA 3AMMA 3CCMI 4YFXF 4IEPA 3RQ4A 1HRI2 4XM3A 1TWGJ 5E16A 2DVBA 3HSRA 1WH7A 5FJ8J 3D8CA 1CJPA 5A6XA 1MNDA 1QQP2 2OPWA 2OJED 3RNSA 2X9DA 2YX7A 1GNYA 2P37A 4OQ8A 3TBDA 2VOVA 4UW6A 2IXCA 4XACA 2KQRA 4OHXA 4L0ZB 3LSKA 4I6ZA 5ANQA 3WNKA 4BK5A 1XXNA 1ZLJA 4QQLA 1ONVA 5I0RA 2XF7A 1G86A 5JXIA 2QYOA 4ETSA 1X1AA 5FQ0A 3J8F1 2MEV1 4X6RB 1SLTA 5LD2C 4YVWC 4GULA 4ARYA 2PBIA 3NW4A 3MICA 1CPMA 2XKOA 5D5XB 2BW3A 4DGWB 5H9PA 4A3ZA 3WF1A 3DPLC 1JHNA 2XAHA 3JD72 2XC7A 2AEYA 1CAXB 3VD4A 1LDJA 1WMXA 2Z42A 3OL4A 4LR4A 1B9MA 3VBSB 3I3QA 1JODA 3WF2A 1NA1C 3WCRA 4O3MA 2R1DA 3BPSA 5CA6A 4A3EJ 1KITA 3QYFA 5FO8B 4II2A 1Z0XA 4ESFA 3I3LA 2Y9ZA 1LB2A 2CWSA 5JPMB 3BCAA 3T3YA 4D0QA 1L7RA 3W6KB 3C2GA 1HB2A 5GZDA 1IKPA 3JQXA 1JUIA 2IGMA 4M3BA 1JI6A 4Y20A 1JT6A 2V1XA 1POGA 4PFOA 1U8BA 2XGDA 1O4YA 3BR3A 2ILMA 2A75A 3CCUI 4B4QA 1SHWB 2WA4A 3INAA 3M1HA 1S4CA 3HD8B 3J81K 2H27A 4IGOA 1UU5A 4LBNA 1LFPA 2E26A 4W6XA 3WTTC 3SH3A 1JUPA 2AUYA 5JZGA 3VHNA 4AAPA 5IP9J 2L02A 1YOVB 5ERIA 2YPRA 1N78A 4YYOA 3CJRB 4DW6A 4A6DA 5F3GA 4RGKA 3AXEA 2XBO3 4A0XA 4P9XA 3A01A 3L2CA 2IRFG 2KHMA 1UY3A 3FMGA 4DMIA 5B1AH 3J7ZI 4L9VA 5BNPA 1VBE2 4BBRJ 2AACA 3OIPA 3PUFA 4P02B 3RKWA 1FXZA 4ZZLA 3RZLA 2BNOA 1J9IA 1E3HA 1IZ3A 2PA7A 3H0GJ 4E4SA 5E20A 3ZMUA 5GLTA 1CN1A 1VMJA 2HGCA 2H6CA 4RB1A 1PZ8A 5HODA 3NNFA 1W6NB 1D7PM 4QQ2A 5FLHA 1TG7A 1S0CA 1GBGA 1K5MC 2FBKA 5DUXA 4OFGA 3MEXA 5A32A 2BVVA 3N9NA 4BCUA 3K4MA 3VBRA 2ORXA 2CQNA 5C9AA 5GP9A 1ZYBA 4HONA 2QSHX 2A7AA 1J3PA 5T5JA 1QO0D 2OW4A 1XB4A 5HV4A 1TT0A 3GHMA 2X85A 2YS9A 3I2GA 3WHTA 5A3UA 4NO4A 2JE8A 2Q1FA 4IHYA 2QQWA 4PBPA 5EP9A 2W82A 2K27A 2AREA 2XAFA 1ZBE1 3VD7A 5A3PA 5C71A 5IOYA 4Z07A 3ZFFA 3ZMVA 1KU9A 2V5YA 4B8XA 3QP6A 4E7ZA 4Q47A 3OYFA 5E79C 4FQGA 2ETEA 1GZWA 4A44A 3ZMDA 3BYWA 3PUHA 3WTXC 4QX5A 5DS9A 4XJAA 1YQAA 3PJRA 2CW0F 3FK6A 3U4XA 5F9TA 2XXZA 2QENA 3SMHA 4A6SA 3AZVA 4JX5A 4LIUA 1R1A1 3MI8A 3F6VA 1TMF2 2W1WA 1FY7A 1UOFA 2V1UA 3GBGA 2BZTA 1Q8QA 1RKWA 3KLNA 2ZNYA 5H6RA 5DQ0A 5BNOA 5FO7B 1SDWA 5LFAA 2E33A 1KYZA 2ET7A 2ENRA 3RMYA 3OYAA 2QQIA 2TUNA 4NN0A 3UV9A 4Y52J 1QEXA 2QDRA 1UXZA 3K3OA 1PHMA 1WSUA 1GWMA 2B9SA 1ULCA 3TW7A 1OPCA 1QIQA 1NQDA 2F5VA 1K78A 3P3NA 2WWJA 3U1DA 4MXWB 4BYYA 2PYTA 3AZXA 5KAIC 4LK1F 2E19A 1NZCA 5A7QA 1WKMA 3HGYA 1OF3A 1L7LA 2P1BA 3BY6A 3C7EA 3WNXA 2P8TA 3PL0A 5FUIA 1HW1A 2D40A 3I4PA 4OYUA 3HAGA 3VSKA 4RL7A 4ITVA 4M01A 2PG4A 4A5NA 1MNMC 2NYYA 5BQTA 4Y4YA 3IWZA 4QX8A 3NQHA 3CQZJ 1F15A 3GM8A 4HFSA 3V8KA 2NPIA 3TKYA 1RIOH 2DCJA 1K4TA 1B72A 4NR1A 1QJU1 4CPBD 5K4LA 1QJX2 4NRMA 1VQLI 2YUEA 2E35A 3CCRI 4WZFA 5K0UB 5LZ6A 2BBAA 4AEDA 2Y6HA 4F93B 2A5ZA 2PQ8A 2IA0A 2WQZC 1LOEA 2KR2A 1W2UA 2WA0A 2XVKA 4LBKA 3CO6C 1W8WA 1IPSA 4RQPA 4A6OA 2VQUA 5EG0A 3VDDA 3VBUA 3QD6A 3LDKA 1JUHA 3FHAA 5IY5H 2VQCA 1O4TA 4I0WB 4K7JA 5JWPA 3JSPA 3SEEA 1IS5A 1TEIA 4LBQA 4CA0A 4XKVA 1WMDA 1XU1A 3ALQA 1W6MB 4COZA 2H1KA 4HK9A 1MMSA 2RS33 1PO13 1Z6RA 3ZQQA 3FJSA 3VZMA 4JK1X 2FQ3A 1VQKI 3ELKA 2DCEA 3ZXKA 1FTZA 1NYWA 2DMTA 3DXUA 2AQEA 3NWKA 5D21A 1W36C 4KDPA 5J1YA 4IE0A 2BNNA 1YYNA 3BG3A 4EZHA 1JKQC 3IV5A 5BNQA 4L5EA 1BR2A 5DUWA 3KMHA 3C7JA 3Q8CA 1Y8QB 4DZPA 4F3QA 1J84A 3MCZA 4ZDPA 1LFUP 2QQLA 2P4WA 4BY7J 1ZRRA 3JRGA 3UGGA 3PHMA 3OY9A 3VL9A 3EUKL 1Y4WA 1WJAA 1OUXA 4HEA2 3LEGA 1VBD2 4XXAA 3M07A 1D1BA 4QPGA 2FDHA 4A4AA 1P9QC 1UYZA 3HUGA 1Z7S2 2W7NA 1Z77A 4CDWC 1V00A 1S2KA 2WLQA 3KYCB 4WCGA 1W36D 1OVPA 4UF0B 4BGDA 2WT1A 2QGUA 2OUMA 3HOVJ 3RZGA 1ACIA 1H9PA 1POQA 3BG7A 2JZYA 3BLYA 3S17J 5AC92 2JEMA 3A0KA 3PNVA 3LAJA 4FO9A 1YW8A 1D5VA 3V56A 1P7JA 2BUKA 2MC3A 5IW0A 4MFEA 1FOKA 2LYCA 4BAYA 1HV0A 4DBQA 2P5VA 4E8CA 4BQAA 4XFFA 4AC0A 2W1OA 1IRZA 3ZSEA 3TYJA 4A93J 3C7GA 5CFDC 3HJEA 4WVZA 1AJOA 5F7UA 1FMVA 2JG9B 4AFMA 1Z7S1 2X6YA 3N9PA 5ILUA 1A5JA 3UKNA 2VASA 4C3IJ 1GDTA 5J1UA 3MKLA 1POV3 1WZXA 4CXYA 1HKSA 2X6XA 3VBHA 4AEMA 2V9VA 2ZABA 1W2TA 1V3FA 4IL6C 3SC7X 3L2RA 2VMFA 3U9GA 2XGCA 2R043 2B4KA 4N4NB 3LWFA 2G9WA 3OYMA 4BACA 2FX0A 4IRGA 2GXGA 1UOBA 3ZX7A 3TB0A 4B3AA 2SLIA 3LWCA 2WN3A 4N43A 3AZYA 1MSFC 1PMIA 2QZ2A 1FI2A 4IQ4A 2PEXA 3KV9A 2WWSA 2JXAA 5FLXZ 5LK7B 3ZN0A 1LOFC 1ZBA2 1WCQA 5G05L 2L54A 2KP6A 3O0WA 4Q4V3 2R49A 1G8XA 4D0PA 1E17A 1YIFA 2F17A 3BU0A 2HVSA 3M3IA 4LO4B 3RJRA 1ETYA 1URXA 5FP9A 5F5QA 4NE9A 2RVCA 4AI9A 4RDUA 3IKVA 2Y31A 4CU6A 4NIDA 4L0PA 2BGPA 4L0YB 2BY2A 5A7PA 4PSWA 4DOZA 5L9BA 3C7OA 3LL7A 5CKTA 2HPIA 1R5ID 4OI4A 1YEWA 1IDYA 4XNFA 3HDDA 1QJEA 3DEWA 1OKQA 3L2QA 3V0BA 2VVEA 5TSWA 1TE1B 1TVGA 4FCAA 4YG0A 1MS4A 2UURA 5EGOA 4LITA 1U5XA 3ABMH 4CCOA 4KIGA 4BQNA 3CDZB 3AMHA 4PGHA 2V73A 2CGNA 3VKFC 1UOJA 4UUSA 3DKYA 1IRGA 2E53A 2E32A 4WZCA 5C8CA 4AU7A 3ASIA 1RGSA 1WCDJ 4YM2A 2EPFA 2X5IA 1TLHB 3KD4A 2CYYA 3AL0B 2Q5TA 5L7OB 2EZKA 1NUKA 1PO22 2P81A 3GBFA 4UB6C 3M1EA 1ND2C 2OZUA 1B09A 5FXVA 1XDUA 5L3CA 1QGLA 1REFA 3VBFC 3Q0VA 4Q4W2 5A3OA 1LUJB 3PFIA 4D5CA 1O59A 4DEVA 4P5HA 3AXDA 5A3TA 1OSGA 4Y33A 1WKYA 1LE8B 1XSXA 2OT7A 3D0JA 4AYUA 1PNFA 5IOZA 5FRNA 4FISA 3K4LA 2ET1A 1YQ6A 1B35A 1NT0A 3ZXGA 1I5ZA 1ETOA 4S05A 2CHHA 3MFCA 4LLOA 4G94A 5HLGA 5JMCA 1DQ0A 2Q8CA 4ARXA 2A5YB 4JKKA 1KJRA 3KCYA 3B00A 4B1RA 3MW3A 4IZZA 5C44J 1ZX5A 4XILA 4AEKA 3LSDA 1GXQA 1SFXA 1OURA 4L5IA 4CP0A 4JDMA 1GZ9A 3GF2A 2H6BA 2A6WA 3WG9A 1GQGA 3MKZA 1RL3A 5LGUA 1FOWA 4KMFA 3RCOA 5EJ1B 2QNKA 1R5GA 1JE8A 3S1MJ 2P6HA 4MGYE 5A3NA 3SHFA 4M71A 2EV0A 3I3EA 4P9FA 1JXNA 3KIOA 4U88A 1W90A 4ON0A 1FBSA 4P1WA 1D8KA 4IV3C 4A69C 3RSJA 3OUIA 4JX6A 1IHMA 3LPFA 1Q8OA 5F6FA 4TWTA 1G2HA 1NY72 2I45A 3OPZA 5E3NA 3VKMA 2LROA 4ZXKA 1BYHA 5EV7A 4OCTA 5A70A 4CRQA 1OMIA 2IA1A 5A6QA 3KZIC 4AVBA 2P5LC 4I99C 3ZFEA 2KPMA 4FXKB 4X6AJ 3HOZJ 1IW7F 4AG4A 2ECBA 2WFF3 3AYDA 2VU9A 4Z2AA 2B63J 4Q4X1 3WW2A 3QAHA 1Z7UA 1OOPB 4CCKA 4QPIB 2JD9A 2GMMA 4XQDA 3PO3J 4ASKA 1C5IA 1TWHJ 1F43A 4B8EA 2ADEA 4R1HA 1FMD1 4NPLA 4BQOA 3THDA 3TRSB 2E1CA 3IC7A 1H1IA 3SKJE 5DDJ3 3CC7I 2ETHA 1UWWA 5FPVA 1BKZA 1SEFA 3JW4A 1UPSA 2VT2A 3WU1B 3MO4A 2PLV1 2G7UA 1GMMA 2NVTJ 5F5CA 4CA9A 3QWLA 2IXIA 1TT5B 3V7RA 1U5TA 2DU1A 4ZZ5A 3BJ6A 3C1DA 3LA3A 5KXCA 3DL3A 4GYIA 1JYCA 3B73A 3O1OA 1KFUL 5FPUA 1PMHX 3POBA 2YU2A 3HRTA 3RSNA 2VBDA 1I5PA 1V6MA 5ISLA 5FPLA 1A3KA 3G1OA 3ZXDA 3GZNB 2VCBA 1GVJA 5JOXA 5IK7A 4RLQA 4LOSA 1Z6TA 4X8PA 3A4UA 3LSJA 3ZCOA 1IOAA 1CWPA 5DUKA 1MBKA 2R6QA 3JAMK 2XONA 4W1UA 4W4ZA 5A7OA 3PVOA 2WS92 2M3AA 4C91A 3K51A 1EH8A 3FUOA 3CCEI 1W0UA 2Y6GA 5JHFA 1F4AA 1W5SA 1NG6A 4BJ5C 4XOTA 2JD4A 1GYKA 2R93J 4C30A 4MHRA 1BEV2 1SACA 1AXYA 4KT5C 1EJ9A 1MH3A 4MGIE 1QDOA 4XXPA 4XF1A 1HXS2 1QU0A 1ITYA 1CQTA 5FPZA 1RUC1 5JIAA 5A7NA 4AM3A 5DAXA 4A3BJ 1Q8VA 4XDQA 1OFSA 3RPQA 2HFHA 2F2EA 5FXXA 4HOBA 2QKMB 4RA0A 2JKXA 5JSPA 2VL8A 4A3FJ 1CONA 5BNNC 2HYGD 1JW6A 2ZMEB 2CSGA 4GWNA 5J8CA 4RGAA 4BBSJ 4RB3C 1V9U1 4GMP0 4NIIA 2ESNA 2PAKA 1STMA 3Q0WA 1LHUA 4JP0A 3FBNB 1X58A 5HDNA 3RI9A 5E17F 1B8IA 2RR12 3A0BC 3LFKA 5J1RA 2GA1A 2R7ZJ 3RS6A 3BB6A 1JXSA 4GCVA 4D6SA 5AFEA 1N1VA 3DYPA 1RUG2 3VV1A 3VPRA 2GM4A 3KEYA 2ZHMA 3BOPA 3IAM2 1JYIA 3J80K 1VBA1 2X8KA 3FDYA 1SVLA 4LMFA 5SV5A 4QGLA 5FP8A 3I53A 1WMFA 1RUH3 3IM0A 4FP2A 4BQ1A 4CCNA 3HQRA 3PSIA 3BG9A 4M6XA 3RPUD 1U5ZA 1W7PD 4JZRA 4N0BA 4MADA 4QX1A 2R063 2RR11 4EJOA 3JTGA 1AOYA 4BHPA 1IUYA 2PAEA 3PSFA 3LFUA 1AYN3 2YPJA 1S2BA 4AWXB 5IWFA 3CKHA 1AF9A 2JPBA 1ZM1A 1LGCA 3VZNA 5IVEA 2L7ZA 4HAMA 1V70A 5A32B 1E2XA 4Y3OA 2VNVA 1YUDA 3VBRB 4YGEA 4H7LA 2ZB9A 5JR2A 2Q2EA 1WD3A 2WWUA 5LRSA 1FEXA 4RS5C 1USTA 3QP5A 1KS5A 5DM6F 3FM5A 4HBLA 5E1XA 1I3AA 1UKGA 4M3CF 5ACA1 4A12A 4RFT0 3G6JB 2DLLA 4P96A 3WGIA 1SPPA 5LBEA 3BTZA 1QY4A 2OCEA 3E7LA 5FZGA 5KHGA 3L1PA 5A2QZ 5EFUA 1IGOA 1JGSA 1H9WA 1Y0UA 3UNPA 1AHDP 3H3UA 2F4PA 2L2OA 2Y9YA 1VQ7I 4MQ9F 3UL2A 3C8XA 4J01A 3OIQA 2QUFA 3MIFA 4BJ6C 2IXKA 4F52A 1S7EA 2WY7Q 1QOSA 3B3QE 2WNUC 2ZX2A 5IVVA 2FMYA 3BR2A 3VYRB 2B0LA 4O65A 3ZQGA 4HKWA 3FMQA 1UF2C 2Y2ZA 1DGWY 1D4M2 4COYA 5DAQA 2DYRH 3KM5A 1RYYA 2LBFB 3H7JA 1R092 2CQXA 3CCQI 1WGPA 3DPRB 4U7DA 4XBQA 4FHTA 3S3NA 5LHIA 2L01A 2A3WA 1GT0C 1SC7A 3EUHC 2DBIA 5A3MA 2CTVA 1XN7A 1R1ZA 1A6IA 4PZJA 3VKLA 3H5AA 3F23A 4JTOA 5FY1A 2J1SA 1ST8A 3GWZA 3AZZA 3DEMA 1PUEE 2GBYA 4E7JA 1VQ8I 1MR5A 5FYMA 1CESA 1A36A 2W91A 2CUEA 2ELJA 2LLKA 5LBQA 4YIRX 2NM1A 5LWBA 2VECA 4JGYA 4H55A 4LKSA 3KQRA 4COUA 1YCIA 4QB6A 3DU5A 5D5VB 4GWJA 3A23A 2VGDA 5JXHA 5A7WA 3K4BA 2I10A 2GC0A 1BI1A 1LCLA 3NAUA 5M5YJ 2GOMA 2SBAA 2NYXA 3AKZA 1IKQA 3OGRA 4GH4C 2VN2A 2YHJA 2QQKA 4BE0A 3S5AA 1NTCA 4DRVA 2AR6A 2WB1N 2A6XA 3KSCA 2ZTNA 2K9NA 2RS12 4MGKE 1S7AA 1LDDA 1BBT2 2KRFA 1RMU2 1Y8RB 4KFCA 1PGW2 4KBZA 3ZN6B 1U12A 2VKDA 3B01A 1F2NA 3DTKA 3HOWJ 2W0XA 4IE7A 2EIKH 3BU7A 4U36A 4DS0A 2O7OA 1H0MA 5K5RA 1PNGA 6PAXA 1OQYA 5L3DA 4CXXA 3ASNH 1AR92 1T39A 3M3OA 1PK6B 4ZYDA 1KFXL 2GNMA 4RLFA 4R79A 3WVJA 1CQ9A 4OUSA 1MZEA 5G04L 2J5PA 1LQ1A 2HWE2 1ERDA 2DVGA 2VUJA 2HWF3 2WY8Q 3WU0A 4BXSV 4TYSA 2DT7B 3H9GA 3F0CA 2GIZA 3LD8A 3CHXA 3TO6A 1BBT1 5FXZA 1TL8A 1RVF3 3KV6A 4KU7A 5FK7A 1LEBA 2R7SA 4MXVA 4IEOA 3KT7A 2HEWF 1PZ9A 2ZGQA 1UQXA 5HDGA 1AR91 1PVC3 1WQ2A 3LA7A 3BZKA 1AR81 3LE0A 1T33A 2COBA 1W6QB 4Y5Z0 4AIKA 4OI2A 2R0QC 1JJ6C 2L4MA 3HSEA 1K42A 3NAPC 1DU6A 3OYJA 3M8FA 3RMXA 2NP0A 5GTIC 1VE0A 1UAIA 1B1BA 2MC4A 1AXKA 4C0HA 1ETQA 1RUE3 4CZZA 4KMUX 4YPJA 1G9CA 2MW8A 3KS7A 1PIV3 2BBVA 1OD5A 5EZHA 3BODA 2WB1A 1YFWA 4Q27A 1FC3A 1QJY3 3JR9A 4LOTA 3ZYBA 1TME3 5FZ1A 4K2EA 3A4CA 1EF4A 1AL22 3H0OA 3KV5A 4UT5A 4TV7A 3V8JA 4KT6A 1C4RA 1XRUA 1V6JA 5CISA 5F6KA 3WINE 1AX0A 2E71A 2Z9OA 5A7SA 4CDQC 1YS7A 4HVOA 3VBOB 3APBA 4AE2A 3V7SA 4RHV2 4QKBA 2Z5WA 3I59B 3BOQA 2PJPA 4GKXA 3GTMJ 4XAAA 3WF4A 3I4NJ 3AMNA 2JG8C 2PTMA 3HC7A 3LSIA 4I3GA 5FZLA 3HNYM 4S04A 1OQEA 2Y0OA 1G3TA 5IAXA 3J8F3 3GCMA 2MEV3 4LXLA 4P08A 1CAVA 2E1MC 2ME0A 1TTYA 1JKRC 3FM3A 2ZGLA 2L9SA 3ES1A 2VMGA 2NQYA 3U0ZA 4EJWA 5C4WB 4RHV1 4FPFA 1D1AA 3B9CA 1BBYA 3URFA 5K9YA 2D97A 3ACFA 3FWEA 3CUQB 5LEJA 1R081 1H8VA 4UAPA 1KYWA 3O8HA 3BALA 1GOHA 2X10A 3OY8A 5KHIA 5IJRA 3ZSMA 4EJTA 1QH7A 2VTXA 1FYMA 5LHHA 1WLDA 4IEYA 1BIBA 2KFDA 2QBYB 1UN1A 2IVIB 3GMEA 1NXD1 2NN8A 3M7AA 2D5VA 2NOGA 3KPHA 4EGZA 4QDSA 5FO9B 3CJIC 1OT5A 4ZU5A 2XF6A 1AKHA 1WVRA 2V1NA 5DXDA 1T0FC 3TP0A 2WAQN 3HQXA 5LA0A 1GV5A 2CJJA 5J3UA 2B7EA 1AVBA 5F32A 3POGA 4L99A 3TN93 3U1KA 1JTZX 4AVPA 2ZNZA 2TEPA 3USUA 1HJGA 4GRIA 1BMV1 2VBXA 4W6WA 5TJJA 3FLRA 4B48A 3SCHA 3KFWX 1Z21A 1SD4A 3H92A 3IMMA 3UKTA 5FZ0A 1Y7BA 3UKVA 2PHXA 3B7MA 1FT9A 3J7AO 3IHUA 4DOUA 1J3RA 5FY9A 4P55A 4HLXA 3I9V2 2YBSA 2UV1A 1SFNA 1HN1A 3ITQA 3OR2C 4XF9A 3CU7A 3AAFA 3HGGA 4HF0A 1X4PA 3I3MA 3OS2A 2JRMA 1H4HA 3ZSLA 1HQLA 4KJZA 2XBO2 1IV8A 1ONAA 3GFMA 1BK1A 2AO9A 3MPBA 3RQ0A 4D7MA 3HL2A 1JOBA 5HNFA 3ERMA 1UD1A 4QT6A 4G6TB 4J19A 3CMGA 2CDOA 4XJ9A 3KT1A 4PLNA 1HSJA 3NNJA 5FRAA 1NA1A 4UFIA 5CAZA 4IQPA 1T95A 4Q8LA 3TEWA 5EGOB 3F95A 2VZPA 4GYGA 3HOSA 5CG8A 3PUBA 2IXJA 4CDUB 1UZZA 4NIAA 4LBLA 2NS7A 4EVIA 4D3WA 3NJVA 1HQNA 1NKGA 1YIOA 5LK5A 2IGKA 2XASA 1ULDA 1ZZ6A 3ZDVA 2X5IB 2FBIA 2VE9A 5F04A 1WBFA 4JGZB