4NJ4A

Crystal structure of human alkbh5
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
218
Chain Sequence
DYEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTYGAQPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA demethylase ALKBH5
publication title Structure of human RNA N6-methyladenine demethylase ALKBH5 provides insights into its mechanisms of nucleic acid recognition and demethylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 67
structure length 218
sequence length 223
chains with identical sequence B
ec nomenclature ec 1.14.11.53: mRNA N(6)-methyladenine demethylase.
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nj4A00
4NRQA 3O1RA 4IDZA 3I2OA 3BIEA 3BTZA 3O1OA 3RZGA 3O1VA 2FDFA 4NIIA 4JHTA 3RZHA 4QKFA 4ZHNA 4ZS3A 5DABA 2IUWA 3H8XA 3O1MA 3H8RA 2FDIA 4QKNA 3I3MA 3T4VA 3T4HB 4IE6A 4IE7A 3O1UA 4NIHA 4O61A 4NIGA 4NPLA 3T3YA 2FDHA 3I49A 4IE4A 3BUCA 3KHCA 3RZLA 4NJ4A 4CXWA 4IE5A 3BKZA 2FDJA 3S5AA 4NRPA 4QHOA 4NIDA 3O1TA 2FD8A 5F8PA 4NROA 4QKDA 3BI3A 3H8OA 3BTYA 3I3QA 3KHBA 4NRMA 4QKBA 3LFMA 3BTXA 4IE0A 4OCTA 2FDGA 4CXYA 3O1SA 3BU0A 4O7XA 4CXXA 3RZJA 3S57A 3O1PA 3RZKA 4ZS2A 2FDKA 4MG2A 3RZMA 4MGTA 4NPMA 4RFRB
chains in the Genus database with same CATH superfamily
1LHVA 4CUGA 4UFIA 2E26A 1U5IA 3HPNA 2ZGNA 4XF1A 3ZFGB 1VBA1 1QJEA 4F83A 3WCRA 3I2OA 5IVVA 3MW2A 1O59A 2BGOA 1C1LA 2GNBA 3BIEA 2HWB1 1RL3A 2D5HA 1HXS2 3POGA 1SQ4A 5APAA 2VAUA 3MLKA 4ZU5A 2FDFA 3N9LA 1KS4A 1O3SA 3LIHA 1AYM3 3I97A 1VBD2 5KBFA 4BQ2A 2QE3A 4FOQA 3GXUA 5C5UA 1BBT1 2K2SA 1NKGA 4QXKA 3RZHA 1I5PA 3ZXFA 3DUIA 1DP0A 2A3WA 4P9WA 5DABA 2WYFA 4QX5A 4FAGA 4MV2A 2GMPA 2XJRA 4AOCA 5JAXA 3J8F3 4E4ZA 3VDDB 2C4XA 2VMIA 5JI7A 3NL1A 4Q4W2 3MIBA 1HXS1 4N7IA 5FZ0A 4AI3A 4HVQA 4XVHA 4KBBA 2VMEA 4N7UA 3MPBA 3ETPA 1V00A 3SXWA 4Y1YA 1DQ6A 1Z78A 3WQ1A 4CCOA 4C1WA 1HV1A 3LAGA 5C9AA 5FZMA 2A1XA 1LAJA 1OHFA 1JYIA 2G4IA 2JKXA 1J3QA 4LORA 4IV3A 2R7EB 2VQAA 2CDOA 4Q4W1 1ST8A 1JOBA 2EIBA 2X09A 1SPPA 2UY8A 4IXLA 5CG8A 2BOIA 5FYVA 1F8VA 5T52A 5FUNA 2VOTA 2P6CA 3H50A 2OYZA 3BKZA 1D0HA 1REEA 1QXPA 4C0BA 1F31A 5FCCA 3DPRA 1NX9A 4R9BA 3JD72 2ET1A 3PVNA 2JIJA 3NJZA 1K5JA 2ZS6B 3L2YA 1D2QA 4IEXA 1Q8OA 5LW9A 1JZ2A 2W1UA 5AVPA 3R4SA 3WNLA 3PURA 4L99A 3S30A 4G9SB 3I3QA 3HT2A 1JYVA 1O8SA 1ASJ2 2B9UA 2OW4A 3GBWA 3J4UH 4P14A 5K8SA 4CDUC 2CGOA 2ZEWA 5FRAA 3HNYM 5FMOS 1VLNA 2GC2A 3IAQA 4DS0A 1LB2A 4WM7C 3JD71 1O5UA 1H9PA 3AKRA 4AEDA 1PVXA 5HPOA 4XUOA 4MO3M 3S6PA 2HLEA 4COUA 4Q4W3 1RUE2 3LWCA 2WNOA 2EA7A 4BOWA 1OXCA 2ETEA 5IVBA 2NQYA 1UCXA 2XVGA 1TME3 2ZGUA 3PHMA 2IXHA 4A6OA 4BLIA 2XLGA 2E7AA 4QX2A 1ASJ1 5BNOB 5A3UA 4CXXA 1H1IA 3RZJA 2B8MA 4YARA 1OA3A 4BQXA 4BLJA 4LBMA 3WW2A 1V6LA 1URXA 1VP6A 3OPWA 1K45A 1S0CA 3GYDA 5FO7B 3ZMOA 4EZHA 1RUE1 4IQPA 4LBJA 3KV9A 4D7TA 4LPLA 1W05A 4XOGA 4A45A 5FMOL 5LA1A 4R9AA 4Z92B 1UL9A 1N1SA 2I74A 2PQSA 3ENRA 2CU5A 3M8LA 5IW0A 3SISA 5A3MA 4BK5A 4QQ2A 3HT1A 4YZ5A 1TG7A 1ZX5A 2UWAA 5A33B 1OUXA 1TNRA 2QQIA 2A73B 1RHI1 1VAMA 1Y43B 4URAA 4XFAA 5FPUA 2WO2A 3DKWA 1ASJ3 3GHNA 4XJUA 1R64A 2GP3A 1OLRA 2Y6KA 3PMEA 4LK6A 2B7YA 2A6XA 4N9IA 5CFDA 2UY9A 5DAPA 3MYXA 4FCAA 2YZ4A 3IB3A 1H1AA 1HRV2 3KT4A 2QCSB 4TWTA 4YNIA 3T4VA 4NMIA 5JZGA 2ZGPA 3FE5A 3OPTA 2YUEA 4OVEA 1W2OA 4WM8C 4NIGA 2BWCA 1D2SA 2QQOA 1Q56A 3V56A 4QPGB 1YI7A 2NMOA 2HWF2 2LTNA 3JZVA 1QHDA 4LE4A 3W5NA 2E63A 1W8ZA 4GZ9A 5DMYA 1AL0G 2ZABA 4JTOA 4JC1A 1JZ5A 4B4QA 1RHI3 1Y3TA 5FAXA 4Q0VA 3AMPA 4UBGA 3ZYHA 3RWKX 4WV8A 5A7PA 4UFLA 4MHRA 4CXWA 2ZGKA 2V5YA 4QDQA 3HVDA 1IOAA 4HETA 4PIZA 3VL8A 3E6DA 2I45A 1A6CA 2WT2A 3QLQA 3RYKA 3ZXKA 5BXXA 5LBEA 2HWF1 5HXMA 2BV4A 2E32A 2VUJA 1W9WA 2YYOA 3ETQA 4ZKTB 1HQWA 4MXWB 5FMDA 3AP7A 3O12A 4NROA 3CBNA 4GULA 3WD5A 1XNKA 1JODA 1MQTC 1MS1A 3D0JA 2JJ6A 3DGTA 1ENQA 1N1VA 3LA7A 1CX1A 3J7MA 2WA3A 3M3OA 4XXAA 3R0RA 3ZIWA 2AEYA 2VE1A 4DNYA 5JSRA 1O91A 1W8OA 2Y38A 4IERA 3WNPA 2NN8A 1AZDA 1NLQA 2ZHMA 1CD3G 2FCTA 5ANQA 4DEVA 4XBNA 3HBKA 3H42B 3A7QA 4BXFA 1H2MA 1TNFA 2VCAA 2VO5A 1V70A 5F3IA 5J1XA 4Z2WA 2J1TA 3EYPA 4Q4Y2 1LOEA 2DUQA 3FFQA 2ZA9A 2QZ3A 1WCKA 3VBUC 3PUSA 3R4UA 1QH7A 1BXHA 1PO21 2Y26A 1VRBA 3LKJA 4FQ4A 3D8CA 4UW5A 1OA4A 2QVSB 5D8AB 3KWVA 2BERA 2WNVA 2EIGA 4E4DX 1NCQC 2CNAA 3FBMA 5FLHA 2ZEXA 4ZU4A 4R4ZA 1W28A 4P9YA 3QOPA 4E9KA 3NAPA 5BUVA 4Q4Y1 1DDLA 3K51A 4B1LA 5JR7B 2WZR1 1J3PA 2UYAA 2ZEYA 4HKWA 2LS6A 1HB3A 5EYXA 2QQUA 5L73A 2TUNA 1MVQA 3ZR6A 2XG3A 4QM8A 1I1EA 1GWKA 2HBUA 5A7SA 4MLOA 3EBRA 2DDUA 4CU6A 4D6QA 2TNFA 3ZR5A 4YSFA 3PJQA 4LBQB 1U5XA 2VQTA 2W92A 2HEYF 1W2NA 3MW3A 4LMFA 1IKQA 5CYYA 4NIIA 1K12A 5CEHA 2HEWF 5F9TA 1OOPB 3ABZA 1PO23 2Y0IA 2VUDA 1UMZA 3SC7X 3U07A 2Z42A 1YIFA 3WLUA 2W94A 3Q8AA 3ZKYA 1CJDA 4AW7A 3HAGA 4KG8A 2DFBA 5FYTA 2DUPA 2XVKA 3MHZA 4B4RA 1GBGA 4GB32 4N53B 4FFGA 4XFGA 1RYYA 4GJYA 3AZYA 5KXEA 5KXCA 4NR1A 5LEKA 2NP0A 1WCDJ 3VHPA 4A7YA 5A1FA 5C4WA 4BQ1A 1EV11 4Q4Y3 3U78A 4JCKA 3PVBB 1LENA 1PX4A 4O61A 5DAQA 2WZR3 1IPSA 2RS12 2ZCWA 1ULCA 4LKFA 2QQPA 2JD4A 1W8WA 2AR6A 2RM22 3PTYA 5AFEA 4XQDA 4BXSV 3WR0A 1Z0HA 4A6SA 5T50A 1XYOA 4X8NA 5CIRA 4GB31 3PUQA 3HR9A 2PAKA 3CZUA 1D7PM 1CAXA 1ZZ8A 4JGZC 2YPDA 4BE3A 1UYXA 2RS11 4M3CF 4BISA 4CSWA 4BZ4A 5LEJA 3WINE 2RM21 4GQ7A 3ST7A 4AEMA 4CTEA 3IPVB 2AUYA 4FPHA 2IXKA 2AC1A 3QBQA 2Y33A 4K8FA 5FYHA 5IWFA 3WG1A 3WQBA 3THPA 1Q8QA 1GSLA 1FXZA 2ADEA 3PLQA 1CPNA 1GZCA 4D0QA 1EV13 4LR4A 1QEXA 4YVWC 4F8AA 5C8CB 2V5DA 1S2BA 3UJQA 3S0MA 1NA1A 5FOBB 3UNPA 1QOSA 3AJZA 2VZ3A 3OD4A 4AHYA 5J37A 3Q8FA 1W6NB 1ZA4A 2IXJA 5LRRA 1AL23 4M0HA 5HCBA 4J6GA 3C8XA 1WCQA 5BNNA 2QZ2A 4LHKA 3M2MA 4JGYB 2BYVE 4Y20B 3WY6A 3KF5A 3OEAA 3AM2A 4Q0PA 4DO0A 1V6KA 3HWJA 4P08A 2VTXJ 2W5FA 3WDVA 5JMOA 1OLMA 5FYMA 3VBFB 4XILA 5CFCC 2D6PA 4XQWA 2Z4FA 3K4DA 4KQ7A 3AB0A 3HBZA 4GH4C 1C57A 4PDWB 1FMD1 3A4UA 5GM0A 4E8CA 3MO4A 1DGLA 1KITA 2RM23 3GJBA 2H0VA 4MHUA 1D4M1 1O3TA 4YW1A 1RUC3 3ZFGA 2GN3A 5FPXA 5EYYA 1QJU2 2ZJCA 4EV0A 1KDKA 3O14A 3GALA 1AXKA 2DTYA 2WWUA 1WLTA 3NNGA 2J1VA 4LOSA 4AVCA 5I0RA 5LK5A 5LCWL 2VMDA 1VMHA 4FFHA 1HQNA 2X29A 2Z79A 3M3CA 4FP3A 4NPMA 2YHJA 1OF4A 1LKNA 1LGBA 1KXGA 3K46A 4C1XA 1XSQA 3FLRA 1PNFA 1TQ5A 2JG9B 4MZUA 4Q26A 2PHLA 3MIDA 4QGLA 4DUVA 5ABJB 4YWAA 2ARAA 1DGWA 1C3HA 3AKQA 3CO2A 1QJU1 4XAAA 3VDDA 3H3UA 3WW4A 4COYA 5CBLA 3RMXA 4OFGA 2YV8A 3BTZA 3T08A 1UMIA 3RI8A 4K6BA 4IETA 1LGNA 1FMD3 1YC61 2CTVA 3CJIA 4PJYA 4Y26A 4LBNA 5ERLA 1UN1A 3RVHA 4FVVA 1D4M3 1LJ7A 5FO9B 3AP5A 3AKPA 4WVVA 2MNGA 1GQPA 1WUVA 5FZBA 3TAYA 4CPBA 5I93A 2JENA 1YHFA 2ZGMA 1GP4A 2E9QA 3RRDA 4W6WA 3T2QA 4IEOA 2VZ1A 4IV3C 3R4DB 1UXZA 4AVBA 4Z1VA 1OKOA 2JE9A 2WN3A 1VB2A 2GU9A 2F4LA 3LEGA 3LFIA 1YUDA 5FBJA 4AGGA 2GH2A 2PA7A 4CUAA 4DXSA 1VBB1 3WZ1A 3ZSJA 3AYEA 1COV3 4S2GA 3BPZA 1IPJA 1AX1A 5DG2A 4JTNA 1DYPA 2GC3A 2ZHNA 5EPAA 2Y0OA 1WGPA 3HQRA 4ET7A 4HVOA 4YLZA 4W6YA 4WZCA 5HXVA 2BJSA 1X50A 3C7FA 4CCJA 4Q8KA 1QF3A 1UY2A 2J1AA 4M4PA 4RGAA 5T5OA 1SBEA 2HWD1 2ZHKA 4ONUA 2QBXA 2OPWA 1RC6A 2DVDA 1QQP1 1UW8A 5FZLA 2FDJA 4L97A 4AFDA 1ODMA 1AR61 2D97A 2WT1A 4QD2A 4A7KA 2CAUA 2WSVA 1CQ9A 1NZCA 4OUEA 3THTA 2PMWB 1P8JA 2R0HA 1POV0 1HDKA 1J58A 5GJ6A 2A3XA 1UY3A 1H0BA 1EPWA 1IS5A 1MS3A 2OS2A 1JH5A 4QGNA 4PCRA 4D3WA 4LO5B 3BI3A 3OG2A 1VBB3 1LHNA 3RGBA 5C9AC 1JZ6A 2AEZA 5BNOA 2OPKA 2CGNA 3J7HA 3VKNA 1DZRA 1SG3A 3W58A 1QXJA 1UIJA 2JDUA 2D44A 5JXHA 5IVFA 3PL0A 3VD7A 5KC6A 1UY4A 2WUHA 2WRAA 3PDQA 4CP1A 1E5SA 1ACCA 1PK6B 4OHZA 1LOGA 1QJY3 2LW8A 4JRLA 4Y5SA 3ACIA 4K9SA 4BCUA 3SQOA 1H9WA 5C6CA 1QJZA 5HV4A 2VOVA 3IDAA 5HCFA 1SFYA 2HWD3 1PO12 3ZFEB 3DPRC 1A34A 1HV0A 1QQP3 3PU8A 1RUOA 3AP9A 2R1DA 3NKTA 4QX1A 4XF4A 1DF0A 1AR63 4AF9A 4ES8A 1O4YA 3RJ2X 2RV9A 2Y34A 1FV3A 2ID4A 3VDBA 3OBRA 2ORXA 1OI6A 5A33A 4O9EA 2YC4A 1XYNA 2W91A 1O6UA 5GZCA 1UY1A 4B4PA 4OULA 3MV01 3B3QE 1FI2A 2DTWA 1A8MA 5C3SA 1PO11 2WAOA 5FOJB 4RL7A 2D6MA 3NSTA 4GD4A 4IGPA 4AEDC 1ZREA 2Y6LA 1N3PA 3B7MA 1NQDA 4FPYA 3AZZA 5K7PA 5ACA2 3O1RA 1F5JA 1VBC1 1DBNA 3KV5A 4QM9A 4QPYA 4ZU7A 1H30A 2C0ZA 4X8PA 1NCRB 1ZZ7A 4CCNA 1AR83 2YB7A 4DUXA 4J1WA 1GFF2 3W21A 1CGPA 2RS32 3SLIA 4CEWB 4QB6A 1YQ8A 1ND3A 1G86A 4HN1A 1FPN2 5SV8A 1POV1 3OJBA 1GWLA 4AWDA 1DFQA 4QPGA 3LIGA 4XXPA 1F15A 3ITQA 4NHYA 4COZA 4R4XA 4XMIA 2C24A 2VMGA 3WT3A 1REDA 1V9U2 5ACA1 1LU2A 2TBVA 4H55A 3H8XA 1TMF3 4CPBD 1XQNA 4DINB 5F32A 1MS0A 4IE6A 2PHWA 2CV6A 2EALA 3AP4A 3P6BA 2ZMLA 4YW4A 1FPN1 1ULGA 2R1BA 3D82A 4MGKE 2WNUB 5T5PA 4BQYA 4CUBA 4IL7A 1W04A 2FBEA 1VBC3 3NW4A 5DZFA 2RR12 2Y6FA 3DCQA 4N43B 3E5XA 3N3HA 2JIGA 3UESA 4EYUA 4FSJA 3MI8A 1V9U1 4FPLA 4MXWA 4LLFA 4XBLA 3I49A 3ZXAC 2VG9A 3GM8A 5H9SA 3HIFA 4XF3A 4GALA 1POV3 2WT0A 5FJHA 3UL2A 3ZN6A 1CVNA 3WOGA 4DEQA 5AVAA 5CFDC 3KHCA 4C0HA 3AZWA 1OPMA 1ZRFA 5FZHA 3VD3A 4HVRA 1W06A 4S2DA 3P5BA 2E53A 1QDCA 3AYAA 1RUI2 3N35A 3I2FA 5JZGC 3S5AA 5ACA3 2P2KA 4Y33A 2AH2A 3TB0A 2RR11 4NRPA 4DRRA 3I2GA 2JB4A 1VBE2 1YO8A 2NPIA 4NAMA 4PF5A 2IXLA 2FD8A 3KMHA 4RHV2 3VDCA 1OQDA 1S0DA 5A3LA 2B9VA 3NNMA 3TOJA 1J83A 3IDEA 1W3VA 1FPN3 4LBKA 5IFPA 5FZKA 2O8QA 4HXCA 3OUHA 2IFWA 2VMCA 2P3JA 3VBSB 5JSPA 5LA0A 3ZYRA 1AJKA 3GJAA 5D8AA 5FZ7A 1RUI1 2WWSA 5DUUA 4B29A 1PVC2 4G3YC 2B42B 5DZGA 4JX0A 3ZXLA 1VBE1 4NO4A 2TEPA 3BTAA 4RHV1 1WMFA 1NXD1 4Y1ZA 1ODNA 3H3ZA 3KCXA 1RUF2 3SH4A 5JOZA 3QD6A 2G9FA 5I0SA 3HMYA 1B35B 3AVSA 5LASA 1JHNA 2VMFA 5GZEA 5KHJA 1RUD1 2FDKA 5FTTC 1ENXA 1YFWA 1QJX2 4E4SA 2YXSA 3F95A 2AREA 4Q4V2 3LEKA 4LBQA 2VNRA 5FXZA 4EN6B 2WN2A 3PTRB 3WNOA 5FYBA 1OSGA 4XFBA 1OOPA 4C8DA 2KR2A 3GGLA 5T5JA 4O65A 5EJ1B 1RUH3 4JDMA 4LJHA 1RUF1 2VM9A 5E1RA 3CL1A 5FYZA 4DB5A 5FZEA 2ZGTA 4ZY9A 1EUUA 2VZTA 5CU1A 1C8NA 1QMJA 5E6HA 1NQJA 1W8FA 4XFIA 1XE8A 2D5FA 3IIAA 3MDPA 4HT1T 5FK7A 3RPQA 1VRH3 3U1XA 4N53A 1VBE3 2LUWA 4IEVA 4R9DA 2GNTA 1CAVB 1QJX1 1ZNPA 2Q1FA 2W87A 4LQRA 4Q4V1 1W9YA 4PF1A 2SLIA 2Y6HA 4AQSA 4EZ4A 4TLGA 4QPIB 4C91A 4DZGA 5LBFA 4EN7B 5KR7A 3AXEA 4ISRA 1RUJ2 4QAWA 2WNVC 4XJ9A 5IAXA 1GOGA 2XQRA 4RS5B 1CN1A 1WBLA 4DFSA 3MBWA 1RUD3 3POEA 2EVXA 4KWJA 4XC9A 1QDOA 4DY5A 2A6ZA 4TZDA 3NAPC 4GIQA 3WG4A 4QKNA 5FYYA 3VB9A 4ATEA 3T4HB 3J9SA 2CAVA 2W2IA 5JIAA 3SNMA 1GKBA 5GZGA 4R8HA 2A5ZA 4JAAA 1HB2A 3MUZ1 4HPKB 1KS5A 1RUJ1 3FBYA 2R16A 3LB9A 3ACLA 3IPVA 2FCVA 3ZN4A 1OPOA 4RQPA 1CJPA 3ZLIA 4YG6A 1RB8G 1H8TB 3BN6A 1SACA 1AHSA 3JBG1 1OVPA 3K3OA 3AX4A 5C8CA 1MZ5A 4CDWB 3Q9OA 2PTMA 4ASKA 1RMU1 1XJAA 2LROA 3UETA 2PFWA 2R062 4CDXB 2XMLA 4FI9A 1W6NA 4ORFA 3ACGA 3IMMA 3RG0A 3PMSA 5FY5A 2WZPP 3LSEA 3KS7A 4A7ZA 2ZMKA 4JGYA 4XACA 3FHQA 4CU7A 1V6MA 2NYYA 1WMXA 4Y20A 5A70A 5C4WC 2VXRA 4ZONA 1H6XA 4XURA 3JB4C 1GP5A 1VBD1 3VBFA 4E2GA 4IV1B 3B5LB 5I8YA 4UFMA 1MS8A 3DYOA 4PDWA 3ZFFB 1VBA3 4Z8BA 2R061 1NAEA 5FK8A 2RG4A 1JW6A 4AFAA 3VDAA 1ZZ9A 5G04L 1IG3A 4I09A 5ANNA 2K46A 1K5MB 2DU0A 2HWB3 2ENRA 3JBG3 3CU7A 4YVSB 5JLVA 4DPNA 3VBOB 3OGSA 5CNAA 4PQQA 2WWJA 4PI0A 1UOFA 2VXJA 3OGGA 4LO4B 1RMU3 2W9XA 2FDGA 1BBT3 1IS4A 1GLHA 1PIV2 3AMQA 4E4HA 3WP3A 2VZPA 1NUKA 4M0NA 4XMAA 1S0FA 3IBMA 4KBZA 4CCKA 3O1SA 2OZ6A 3R6SA 4YZ4A 1FOD2 1US2A 1O7FA 5ABJA 3H9AA 1EPZA 3AMHA 3I3BA 4LO7A 2PYTA 1HXS3 2D6KA 2OUJA 4NE9A 3NV3A 1NA1C 3RZKA 5A3WA 5FXXA 3TEYA 1JBCA 1VBD3 4OLLA 4XFHA 2AACA 1G9DA 2OZJA 2R063 5CKMA 5BNNC 1SDWA 3SMHA 4FPFA 4OQ8A 4LBQD 2HKXA 1BCXA 4QHZA 1DU3D 1R1A2 3SEEA 1FOD1 2E6VA 1W9SA 2PLV2 1DQ4A 1OC1A 2J7MA 2WQZC 3J26N 4YG0A 3SH5A 4F7ZA 5F3CA 1WW7A 4CA9A 2WIIB 3MIHA 3TYJA 2ZGOA 2YY1A 2QQLA 1XBFA 4E2QA 4LIVA 5IUQA 1MZEA 2EF6A 3PNAA 5L19A 2XKPA 3POJA 5I8TA 3BVCA 1UF2C 4FT8A 5A3PA 3ZFGC 2D6OX 1XSRA 5FZOB 2ZACA 2EAKA 3DL3A 4I30A 2ZGQA 1S4CA 3RQ0A 4D7SA 3N4MA 1R1A1 5BNPB 1W6OA 5L9RA 5FZAA 3T30A 3LA2A 3J7LA 1VJ2A 4QKFA 3WSOA 1GP6A 2P17A 1ULOA 1LOFA 1US3A 1YNAA 3I3DA 5DAWA 3WP6A 2XJVA 5K0UB 3M3EA 4GAZA 3TEWA 1Y9QA 5H9QA 3O1UA 1OMIA 1LCLA 3WF3A 1DZTA 4LKSA 1Y4WA 4FXGB 2BBVA 2F17A 3JD73 3S7IA 3VDDC 1C5IA 2RDQA 1VMFA 2GALA 4IEUA 1CZVA 2PHFA 2ES3A 2ZOEB 2QTWB 5DXDA 4XDOA 3IAPA 1FV2A 1NE4A 1XYPA 2WDBA 3CJIC 2XQXA 3VBRB 5IFTA 5F6LB 3NVCA 4AEKA 2HWC2 5A32A 3AFKA 4P9GA 2RS52 3WEZA 2MEV2 3T09A 1LGCA 1BK1A 4IE5A 5AFBA 1W2UA 1W6MB 4XZPA 1WCUA 4HFSA 3BYWA 1PK6A 2Y6JA 1RUE3 4I2OA 4LNVA 3WF2A 1XC6A 4QHOA 2E51A 3FX3A 4Y22B 1XB9A 4MYEA 3OY8B 2B5HA 1EY2A 1W8UA 4LE3A 5F8PA 1YQ2A 1UYPA 4Q2FA 4CE8A 4HMZA 5K9YA 3ZFEA 4YGBA 2HWC1 4XJ8A 2OQ6A 1MS5A 4CP2A 3AVRA 4DMIA 2CGPA 4LT5A 2JDMA 3SHRA 2RS51 4Y3OA 3BALA 4KMQA 2ZEZA 5L9BA 2MEV1 3BCWA 2MHFA 3WF0A 1I3HA 5EQUA 1HRV1 1DG6A 4E8DA 1CPMA 4FTBA 4XDPA 5C3PA 2K0GA 3D0SA 4XTPA 2WYSA 1R092 2G19A 4AQ2A 4XJWA 3WHTA 5DAXA 3LZZA 4V1PA 3ZDVA 1W0OA 4JDOA 1C5HA 2NZ9A 1CAUB 1IGOA 3HN1A 2UYBA 1MS9A 3NJXA 3VKFC 1NCRA 3A0NA 2HEVF 3MPPG 3BB6A 5BNOC 3ME2A 4CEWA 3D6EA 3PUIA 4Y5Z0 5FZ6A 4BU2A 2XOMA 4S2FA 2YU2A 5A3TA 4DIQA 3GZTB 3ASIA 1R091 2RS53 2Y6GA 4D8MA 2D7FA 1AR72 3AXDA 4MUVA 4NHMA 1ULDA 2P6HA 2VZOA 4W65A 2ATFA 3ILFA 3BIWE 1WZXA 2OQ7A 1HRV3 3WNKA 5DPNA 3WF1A 1FNZA 1UYZA 3UGHA 2AYHA 3RJRA 4NN0A 2HWF3 4LITA 5BNQA 3UGGA 2OUHA 4HG6B 4F3JA 2WNUA 5B2GB 5JOXA 4AXOA 2BRTA 1W2TA 4JKLA 4HL0A 1YEWA 4OHXA 5EHDA 1AR71 3W59A 4N43A 4XJZA 4YYOA 2XGXA 4AAXA 1W3XA 4HLTA 3JU9A 1GZWB 1CONA 3MLLA 2JD9A 4BQ5A 2VH9A 2Q1MA 3MIGA 4UBHA 5I91A 1D0GA 5GLUA 1OURA 1YJLA 1W99A 5DAVA 4YVWB 5FY8A 1S0IA 5FP7A 3VHRA 5JUVA 5FMCA 3ILNA 4TTGA 5DUXA 4EWDA 5KWRA 3LF7A 2WSUA 4FOYA 3NQHA 3AK0A 1ND3C 5F6KA 4DRVA 5FYUA 2BVVA 2JB8A 2JG8B 1N1TA 2XLFA 4QPGC 1KD7A 2EIEA 3JXSA 3SH3A 3Q8BA 3PIGA 3SKJE 3H1YA 2W1QA 3WDXA 1Z7S2 2ZX2A 4XUQA 1UU5A 4QDSA 2J1SA 4JRAA 5JCTA 5DUVA 3WP4A 5J7MA 4TN7A 4Z82A 1IZ3A 3OYWB 1BQPA 1G9BA 3ELNA 1XNDA 3FMGA 1LU1A 4FXKB 3KM5A 1KQRA 1DCSA 1F2NA 3KF3A 3W5MA 3I54A 4FFFA 2VQUA 2YROA 2WFF2 2XUMA 5FLIA 1SLTA 2ZZJA 1GU3A 1JU3A 1F35A 5F37A 1F4AA 2BEOA 1FAYA 1YXWA 3W20A 3H8OA 3BTYA 2WO1A 4RA0A 2P3YA 3I59B 4LKEA 3KHBA 3WQ7A 1RINA 2Y64A 4NRMA 4JHZA 2VCMA 1B35A 2HJIA 3DXTA 3SKVA 2JE8A 4OUSA 2RMU2 3RYRA 5H9PA 1IQAA 5FXVA 5IT6A 4LKDA 3DYMA 1YQ5A 3I3EA 5FKBA 1RUNA 3AZXA 2WL1A 1BEV2 2GMEA 2OX0A 2PAEA 1W8NA 2DCKA 2WFF1 4AQ6A 4QX3A 2ADDA 4CXYA 4XABA 5IJRA 4LHNA 3MEPA 4OHWA 2WC2A 2DYCA 1O3RA 4LOTA 1RGSA 1MS4A 2RMU1 1UXXX 5C3QA 1G7YA 1RUG2 2WS92 4GKXA 5E8AA 5EXOA 5F1RA 1LESA 1CAVA 1W0PA 2PN5A 1UZWA 4N8MA 3FHAA 3MW4A 1BEV1 3LGRA 1MEC2 4QPIA 3PUHA 2A71A 5D8AC 1Q5OA 1W9FA 2G1MA 2G9ZA 1ZZCA 1AR92 4E2SA 1W6PB 4RS5A 3VBHB 2GP5A 1HQLA 2VCBA 3HEIA 3M1HA 1N1YA 5FZDA 4GB33 3K48A 3RDIA 3UKTA 1JZ4A 1QNWA 2DBNA 2X5IB 5LWBA 3RZZA 1ZBA2 1JYXA 3B93A 4GWNA 3N9OA 3U10A 2XUEA 1NLSA 2VMHA 1RUG1 1Y9GA 2D43A 2JDPA 1LEDA 1LRHA 2CYFA 2RS13 2WFF3 2WS91 3KT1A 3DYPA 2GC0A 1MEC1 3ZSLA 4HPKA 2V4AA 3D3AA 4V2VA 3V64A 4CVUA 4OI0A 4CP9B 2FZ2A 3BU7A 3B9CA 3QCWA 4Q0UA 1JUIA 1K42A 3OBZA 4IESA 1B09A 2RMU3 4JHTA 1IS6A 3TEXA 1G9AA 1H8TA 4COWA 3A0KA 3FLPA 5JXJA 1OOPC 1ZBA1 1NLRA 2JDKA 3O1MA 5CKQA 4CDWA 2WFPA 2GSYA 1DLLA 5FLJA 5IAVA 2QQKA 3H0OA 2IWGB 1XE7A 1GANA 1UD1A 4PT6A 1UAIA 4CDXA 4IUGA 4M3CE 3E1F1 5I8SA 1HN0A 2W68A 4AK3A 1VAVA 4MGZE 1CZSA 4XE9A 4WVMB 2ZX0A 4N53C 4RR3B 5FXWA 4YM1A 4PIYA 1YIPA 5FZIA 1O3QA 2R49A 4EE2A 2WS93 3AJYA 3X29B 4QX8A 1OT5A 2PQQA 1SPPB 1HJGA 3JQWA 1V6IA 1EAH2 1BZWA 1UY0A 2Q8OA 2GNMA 4QWNA 3ZM8A 3TRSB 4IV1A 1MEC3 2EXJA 2WZ8A 3WVJA 1AYN2 3ZFFA 1T2XA 2BQPA 1NY72 2BNMA 1CWPA 1S2EA 5D2AA 2JXAA 3VBSC 3OGJA 2VTFA 1K5MA 4FPEA 4Y4RA 1QWRA 2D40A 4YVSA 3EQEA 1YJKA 3VBOA 1ZVFA 5A80A 1X36A 3KD4A 4JKMA 5LY2A 3N9QA 4NWVA 3ZO0B 1IHMA 1M4WA 1ZRIA 3ES4A 1BK0A 2C6SA 4UAPA 4QMAA 1CIYA 4LXLA 5A7QA 4RQPC 2WZEA 4KGQA 1QJU3 4RYDA 4NHKA 5FYCA 3V0AB 4Q1PA 5C8CC 2YBKA 4D7YA 1X8MA 1Y7BA 3LFMA 1FYUA 2LRPA 4FQZA 1O8PA 4U36A 4XUNA 4MOAA 2CDPA 2VQ0A 3T0AA 2EXIA 4BM8A 4MGSA 4Y4YA 3H1WA 4OZXA 2WO3A 3RS6A 4EN0A 4AE2A 1Q8VA 3U4XA 4JGYC 5JSOA 3WHUA 1V6JA 5CADA 1C4RA 1S0EA 4AHXA 2HH9A 2KXLA 3D4KA 5FQ0B 3PVEA 1JOPA 4MVTA 4CEYB 4O7XA 4AFMA 3VBFC 3ZSMA 4FTSA 4QT6A 3S57A 3M3IA 5F5IA 1DQ1A 4PDWC 1DQ5A 5T3NA 2JDYA 2OKXA 4AVTA 5JR2A 4MG2A 2GNDA 1UOBA 2DF7A 3CJXA 3IDBB 5C71A 2BVBA 1TEIA 3ZYBA 1N47A 3ZPOA 1W8TA 4Y1VA 4ITCA 5FZOA 2IXCA 3USUB 5FPAA 3B69A 4A2UA 1LHUA 3U4SA 4J1XA 4BQ4A 1FT9A 2VUAA 4IEPA 4M4RA 5BNPA 4PIXA 3WG2A 4RFRB 5JMCA 1GICA 5L7OB 1PM4A 5K0UA 3MF9A 4QGMA 2DCTA 4Q29A 3PU3A 5IHRA 2PHRA 3A22A 5I0UA 2VVDA 3IKWA 1PM7A 5ABJC 4FPCA 4HKOA 3OTFA 3SCFA 3LDKA 2ZMNA 3S5QA 1BKZA 3L9JT 5CFDB 5FBZA 2VW0A 5A1LA 5FFOC 4Y1XA 4XDQA 2WINB 2ZKLA 1BYHA 4CRQA 4P00B 1W6QB 4GKYA 5LB6A 1XRUA 3S7EA 2VECA 4V2WA 3VBRA 4D94A 1XNAA 2XBO2 3BGAA 4JV4A 4TSVA 1ALYA 5CZKA 3WNNA 3THCA 3H8RA 4RN5A 2OVUA 5FZ1A 3APBA 3ZSKA 5FP9A 2PHXA 3TEZA 1L7LA 4H7LA 2YC0A 1VAKA 3T0BA 3MFCA 4AG4A 1I5ZA 4OUMA 3WDTA 1W6MA 2E7TA 3KV6A 2NM1A 2FMYA 1SCRA 3N36A 2QQVA 3T1LA 3M4FA 4Y22A 1UU4A 2FDHA 3OY8A 3ATGA 1ULPA 4R9CA 4AI8A 1DGRA 2XBO1 5IK4A 5KXDA 2JDZA 4ATFA 3FL7A 1G9FA 5A3OA 4BQ3A 4NJ4A 2VOXA 5GALA 4ZZ8A 1WW5A 3NNFA 1LOFC 1DHKB 1PMIA 3LOIA 1SCSA 3OEBA 1R082 2QQWA 4I3PA 4GWJA 5F5AA 3RMYA 2XONA 3NKGA 5IVYA 1YCIA 1V6OA 2D3RA 2WR9A 4RFT0 5FIXA 2QFEA 2RS31 4KU8A 1PO13 1ND2B 4LULA 2HYKA 2R6QA 4FPOB 2FHRA 3POSA 4IEYA 1Q8SA 4Q4X2 3KV4A 5HV0A 4OHVA 3WW1A 4QDRA 3NO8A 1XU2A 5JOYA 4X6RB 2DURA 4K3UA 4G4FA 3VZKA 4XZUG 2R30A 1O4ZA 3E5QA 4FOWA 4QKBA 5A6YA 1R081 3URFA 3VKMA 1TZOA 2KD7A 5FREA 2WO7A 1J59A 1UPSA 4SBVA 2IVJA 3BPSA 3H1MA 1AX0A 2GAUA 1RJ7A 3H7YA 4Q4X1 1AF9A 1WA6X 3DV8A 2I2SA 2FMDA 4L2NA 4QB2A 1PK6C 3KGLA 2V4VA 4QPWA 5F2SA 5CAZA 1PZ8A 3UKNA 4UI9L 1ZYBA 2Q5TA 1YWKA 2W1SA 1F4HA 1TVGA 2CWMA 3AKTA 4P5YA 5CVRA 1GZTA 5AC92 1QOTA 1JTZX 3INAA 3GCWA 2R0FA 3NJYA 2RS33 1GV9A 3ZFEC 5FP4A 2JDHA 4H3WA 1LTEA 3GBFA 3NAPB 4I0AA 1JU4A 2A3YA 4EROA 1S0GA 1DQ0A 2R072 2DFCA 4CDQB 4XF9A 1SLAA 1RVF2 1WLWA 4UF0B 3W9AA 2DVGA 2D98A 1V9U3 2GH8A 3PUAA 3T2TA 3ZXEA 3DEMA 1LECA 3T0DA 1R083 2QUOA 3N9MA 5IVCA 3SCHA 1GZWA 2ILMA 5FYIA 3WCSA 5AC91 5FWEA 4I01A 3LDRA 4I02A 4TXWA 4UYBA 5F39A 1U0AA 4UWDA 1K3IA 3VZLA 1WKYA 3KZ4C 3ALQA 4P9IA 4HK8A 2P3IA 3UV9A 4YM2A 5CISA 1JYTA 1X82A 1J1TA 1RVF1 2RR13 3N7MA 2I07B 1HJFA 4HK9A 2LM3A 3OB8A 1NCRC 1RITA 1GR3A 3QH7A 4M3CB 5FZ9A 1PVC1 1SBFA 4CYDA 3K77A 2VVEA 3ZPYA 4CEWC 1L7QA 1LHWA 1DQ2A 4ZS3A 5DN2A 2JG8A 1POQA 1XXNA 3B02A 5GZDA 2BP6A 1C1FA 2J42A 2ARBA 5KC5A 2XHNA 1M06G 4XW3A 1RUI3 4YW5A 4AGVA 3I4IA 1A78A 4QXCA 3MICA 3UJOA 4ASLA 3LEMA 3HD8B 3RI9A 3OYWA 4B1MA 5AC93 2IVIB 4BH9A 4RHV3 1AX2A 1VR3A 1MACA 3KCYA 4XCBA 1AYM2 2A7AA 4AI9A 5F3GA 2WNUC 2BOJA 2Q4SA 4L11A 5JPMB 1RVF3 3CNAA 4WZFA 1UNBA 4N43C 3RZLA 4OI1A 3I59A 2XJUA 1PVC3 4PBPA 2EIDA 3KQ4B 1J84A 3J8F2 3OGVA 4LBLA 3SEPA 5CB7A 2BNNA 3OOXA 3C7HA 3NV4A 4Y24A 4Z2AA 2D3PA 4O9GA 2R32A 2CSGA 5FZFA 5LBBA 3VGIA 5D21A 1SLLA 4CCMA 1RUF3 5JPNB 3LPFA 4J25A 1WLDA 4CDUB 2J1EA 3GBGA 1CAWB 2WNEA 4MGIE 1GUIA 4QX7A 3EXUA 3U0ZA 1JI6A 3JCIA 3ES1A 4AEJA 5KHKA 1PZ7A 2XJSA 1OH4A 4WM7B 3WNXA 3Q8CA 4H14A 1QJX3 3J8F1 2K9ZA 3ORJA 3IT8A 4Q4V3 5I0TA 4IEZA 3MUY1 5EWSA 1BHGA 3POBA 1H4HA 2DUOA 5SV5A 4FTEA 2VUCA 4FPKA 4AVSA 4FP2A 3ZKUA 5J09A 2ZAAA 2EAAA 3GDBA 1MZ6A 4KNCA 2NLRA 4HSLA 5EV7A 3WG3A 1JS9A 2BU9A 4CCDA 5F5CA 3H7JA 4DOUA 1T6GC 1W6PA 3VBHA 2PXJA 3BOPA 3MIEA 1LOAA 3CDZB 4BPZA 4FPJA 3MFAA 3VZOA 4PQ9A 2X5IA 2JDNA 3GF6A 4IGOA 2JKBA 3AMMA 3VD4A 5JDBA 2Q1ZB 4GXLA 4IGQA 5A7NA 2BZDA 1STMA 1XNTA 4MADA 1PGW2 1S55A 3P3NA 4S2HA 3B9IA 5GLTA 2OIIA 3JUUA 1RUJ3 5CA6A 1N3OA 1B35C 5BV6A 1HN1A 3RFRA 1ULFA 2C1FA 1S2KA 4CP9A 1WW6A 3LOBA 3CLPA 5HBAA 5F3EA 5LZ6A 4JQTA 3IM0A 2AENA 4XYXA 3JB8A 2BGPA 2ZTNA 1R1ZA 2DWRA 2JICA 1PNGA 3EMRA 3LA3A 1NZIA 4IDZA 1TME2 3UT0A 3CJIB 3WV6A 2J1UA 2E31A 1PGW1 2UWBA 4IEQA 4AHZA 2ZKNA 2JG9A 1UIKA 2BPA2 5IYYA 4ARXA 4D6SA 5J48A 4MXVA 4ES9A 4WVMA 4RR3A 5HI0A 2B46X 3KCCA 1OQEA 1CR7A 3OUJA 3OF1A 5FP8A 3FN9A 2PHDA 1SFPA 2P5BA 3NV2A 1KGYA 1UU6A 4QPIC 4XQ4A 4I3GA 4WM8B 1PIV1 1UZ0A 2Z69A 1KRIA 2P1BA 4Y1UA 4KWKA 1TME1 4QXHA 1FNYA 4RS5C 3V65A 3D5OA 2H6BA 2N7GA 3AKSA 4K1ZA 1AXZA 3VL9A 1VMJA 3POFA 1YQCA 2JE7A 2VW2A 4KH9A 4OI4A 4XPVA 4UFHA 1GMMA 2SBAA 2E7QA 4META 1H2KA 2IFRA 1OKQA 5B4XA 3SCGA 1UZYA 1YI9A 1DGRN 1JUHA 3JQXA 3TBDA 4ZXEA 5E89A 2ZXQA 1H2LA 1VB4A 2PELA 3C7OA 2JDAA 3J7NA 3QACA 2W46A 4N9HA 1H8TC 2PLV1 3HNMA 2D93A 3V0AA 1C28A 3NNJA 1GZ9A 1AJOA 5E16A 4CDWC 3KVAA 4Q27A 4LIUA 4QXBA 3GNEA 1I6XA 1PIV3 4CDXC 1MQTB 3C3VA 1D4VB 4BB3A 1X33A 2Q0AA 1FOD3 1GNYA 1L7RA 4L8QA 5LA2A 2DVAA 3WX5A 1V0AA 1SLCA 1LHOA 2C5DA 4ARYA 2FCUA 3ACHA 4NHXA 1ENRA 4K21A 1U5ZA 3RZGA 1LODA 1YFXA 4LO8A 2ZGSA 3DF0A 5FQ0A 3B01A 2BBAA 3BOWA 5FZ8A 4CEYA 1RHI2 2WABA 4NWWA 3O5SA 3VLBB 4M01A 4IV1C 3OGRA 4NOTA 4MSVA 4ZXKA 3U37A 1X8EA 3ZFFC 2YG0A 4CCLA 4DXRA 4LA3A 2XVLA 4D69A 4K1YA 3G7DA 3N7LA 3AYCA 4L92A 3I2IA 2X05A 1IPKA 1K5MC 2Z5WA 4OCTA 1R1A3 3VBUB 4KL1A 1X7NA 3WDWA 3USUA 2O8OA 3CF6E 2PLV3 4EQVA 1AUYA 4YVSC 1PX3A 4CCCA 3VBOC 3K3NA 2XXZA 3L2HA 4AQTA 2HYXA 1NXMA 2X10A 1NCQB 2LALA 4UFKA 1LOCA 1QIQA 5L7OA 2BNOA 3O0VA 1SBDA 2E33A 5LY1A 2ARXA 3HQXA 1QNYA 2W08A 4ZS2A 4I0BA 3WUCA 1JYNA 1CX4A 2BFUS 4MGTA 5EJ3A 4EWEA 4XIOA 2XR4A 3M70A 5FPZA 2FZ1A 1W6QA 2VL4A 2XKOA 1IS3A 1OVSA 2BW8A 2VNVA 4JZRA 5KHHA 2ZX1A 4XCAA 4C90A 1ND3B 2BDRA 4FOVA 4LTAA 3FUOA 2JX9A 1JXNA 1SEFA 3K2OA 3POIA 4XBQA 4YFWA 5EFUA 1H4GA 2P34A 4XIKA 4QX0A 2A70A 3MF6A 2ZZQA 2JWPA 3U75A 1Q3EA 4RD7A 1E5IA 1EUTA 4CU8A 3O7OA 2DVFA 5K4LA 1CZTA 3E97A 2YPJA 2ZX4A 1W03A 2HWC3 2BFUL 4XHBA 3FHIB 5FY4A 4CU9A 2IUWA 3FUQA 1BJQA 1GNZA 2VJXA 2FDIA 2W47A 2XHKA 1SZBA 2MEV3 3AFGA 4YW3A 5FV3A 5BNPC 3I3MA 3CEWA 4H2AA 5LBCA 1UOGA 5LK7B 3WP5A 1X9PA 4UW4A 2VD7A 1HB4A 1HX6A 5K0UC 4NIHA 1UPIA 5BY5A 1WMDA 3A23A 1GOHA 2L9LA 3ZYPA 1V6NA 4Z07A 1ONAA 5F7UA 2V72A 3AMNA 2VW1A 3KLSA 1UWWA 2C9KA 3ZN6B 3THDA 1ND2A 3V0BB 1PO22 4P9JA 1IKPA 3Q8EA 3ECQA 4PI2A 4XUPA 4JGZB 5T54A 1HLCA 1UMHA 4MGQA 4HONA 1W8HA 5DQ0A 3M3QA 2QKDA 4W50A 1EP0A 4IE4A 1WWYA 4JDNA 3U11A 3BUCA 1DYKA 1QU0A 5GLWA 1OUSA 2P3KA 3CHXA 3VBRC 2UU8A 5IK8A 2VOKA 2GN7A 3IIIA 4LO6B 1BMV2 4CP0A 2F6BA 3KVBA 4INDA 4NPRA 5E88A 3WDYA 3T2OA 2WZR2 5F2WA 1R093 4FFIA 4XF0A 5FKCA 1REFA 4KU7A 1VIWB 3F2ZA 4KWLA 1ZZ6A 5LATA 2GMMA 3FFZA 1UOJA 3CQOA 4UXAA 1H2NA 4AZZA 4Q8LA 4DY3A 3WNMA 2D6NA 4PLNA 1RXGA 1PMHX 3N9NA 1U12A 1L3JA 2QNKA 1MVEA 4AHWA 3ZMNA 3TN92 3WUDA 3VD9A 4SLIA 1BMV1 2DCZA 5C7GA 2FQPA 4JQRA 5CFCB 5CKNA 3ON7A 3ZXGA 4CDQA 4YW2A 2RE9A 3A21A 1Q8PA 4GH4B 3VBSA 5JWPA 4I0WB 1MR5A 1AR73 1KJRA 4UF0A 4BMEA 5A6QA 5FY1A 3N7KA 5C33A 4YRDA 4PBOA 2VZUA 2VBBA 4QQLA 1WBFA 4WBBA 5A7WB 4AFCA 2EICA 5DG1A 1GYKA 2Z2SB 3I2JA 3RSJA 3VHNA 5C5TA 2HWE2 3ROUA 4XJAA 3B00A 1EV12 2BGCA 3LCPA 1ZRCA 1MPXA 4CZSA 3M7AA 1SHWB 3ZXDA 3GZEA 4AFBA 3O1PA 4HBNA 3TN91 1XE0A 2A75A 4EN9B 2VGDA 4FAHA 5FJKA 1UKGA 1Z7S1 5IK7A 3K75B 3MZHA 2AZ5A 1AL22 3NV1A 4YM3A 4KGGA 4EWAA 4M3CA 2ZGLA 1PZ9A 5L36A 2WQ4A 3QH6A 1ZM1A 2HWE1 2XJPA 4NRQA 1SFNA 1CESA 3LPGA 4KWUA 1S1AA 4HSJA 2PHTA 4FO9A 2W3JA 1KFUL 4Q0SA 2VR4A 5DUWA 5FZ4A 4XTMA 5IVJA 3KSCA 1NG0A 2JEMA 2X8KA 1RUC2 3DKQA 1AL21 4PLOA 4RSUA 5EJZB 1XOYA 5EZWA 1A3KA 3CIHA 5GLVA 2XPJA 2YMZA 4CUCA 4OI2A 3NJVA 4E27A 4YZ2A 1UZVA 3EO6A 4IEWA 4IV3B 1ULEA 1OH3A 3K4ZA 3P3PA 4P9XA 3TN93 3WW3A 5JXIA 2VPVA 4L0PA 5ISLA 3LE0A 2YDEA 1Z7S3 1RXFA 4QU1A 1O5LA 1PGSA 4COVA 3ZYGA 4PHZA 2H6CA 2R042 2WLQA 2ZBJA 5FO8B 3R05A 4LUMA 1LNSA 2YFUA 2QQJA 1RUC1 3FZ3A 4RQPB 4MH0E 3OCPA 5CG9A 2UWCA 3FWEA 2J1RA 1QOOA 2HWE3 2WA4A 3FJSA 3K4AA 2ZGRA 1Q43A 3T3YA 1WA4A 4P02B 5FMBA 3AYDA 1FMD2 1OQ1A 4Q1RA 5LA9A 2XB6C 1UKRA 3GZAA 1G9CA 1LOBA 1D4M2 2DCYA 2PAMA 3AL6A 3CZJA 1AR91 4CDUA 4DXZA 2RJKA 1CAWA 2R041 1W39A 3H8UA 1S0JA 4FBFA 1WW4A 4ZPIA 5FZ3A 3VKOA 1ZRDA 2GZWA 3CMGA 2A6YA 2ERFA 4P9LA 1YFYA 4WM7A 2JG8C 4B3NA 2VY0A 5IVEA 1UQXA 2B4KA 4YW6A 3KGZA 1BEV3 2VNOA 4ASMB 2W0XA 4AGRA 1DLCA 2B39A 3VUOA 4AL9A 4R52A 4YZ3A 3ZVXA 3POYA 3UGFA 3ZX7A 3OPZA 1COV2 1PHMA 4YPJA 4DUWA 3MIFA 5C9AB 2UURA 4QQOA 1FX5A 5A7OA 2O0OA 1OFSA 4BIFA 1XNCA 3G6JB 4QKDA 3IWZA 4W6XA 5M0TA 4TLFA 2WKKA 1QXRA 2XDVA 2XL9A 4YFZA 1RUG3 4BDVB 4ISQA 1SLBA 5FPBA 4JKKA 3DXUA 3C2UA 3I8TA 4AI0A 4XFFA 5F5QA 2H0BA 1JOJA 2RJ2A 3DPRB 1AR93 2W52A 3AC0A 2R043 3E6BA 1COV1 2XH6A 4K40A 2VOWA 1CIWA 3LD8A 4LUKA 1UX6A 5FZCA 1OLQA 1XPWA 4H7MA 3PVOA 5A6ZA 2HBTA 3N9PA 1GQGA 1WLCA 2RHPA 4GWMA 4YG3A 5HCAA 4B7KA 5KHIA 2GDFA 1ZBA3 2QDNA 4A3XA 3BU0A 2CY6A 5HCHA 1RIRA 1C8M2 3RWNA 3ZYJB 4W8JA 4A44A 1NOVA 3ZYFA 4N90A 5JI9A 3C7GA 1EAH1 5A6XA 2RDNA 1FATA 2B45X 1VBB2 2VBDA 5BPXA 3RYPA 4OHYA 4Y5TA 1AYN1 4ZZ5A 3AP6A 4K8RB 1NY71 2Y8KA 4LHSA 3NMBA 4AEDB 4IW3A 1NYWA 5KXBA 2A6WA 3NRUA 4K20A 4YGDA 2RDSA 2CWSA 2YBPA 3AZVA 5DZEA 4YW7A 1SMVA 5BYNA 1A8DA 1QJY2 5T55A 3E6CC 3DN7A 2DBIA 1VE0A 4XAEA 1JZ3A 4TYSA 4QQHA 3ILRA 1EYBA 1C8M1 2ZHLA 4WM8A 4AI2A 2HWD2 1NE6A 4QB1A 3ZSEA 2W39A 2GC1A 4DXTA 5C3RA 5J36A 1VPHA 1QQP2 1LEMA 1E5HA 3VBHC 1W0NA 1QJFA 3ZXJA 3I2KA 2P37A 5FPLA 5DDJ2 1AR62 5KHGA 4HOOA 3O0WA 4LLOA 1OLME 2YU1A 1W6OB 2X5IC 3C7EA 3O1VA 1BVVA 3LQCA 3VZMA 3EJKA 4UW3A 4K7JA 4BA6A 1QJY1 1Y9MA 1QKQA 1WD4A 3DECA 1EAH3 1O4TA 2YGMA 4P5HA 3UYJA 4XETA 2VU9A 4ZHNA 1RJ8A 3POWA 3WDUA 1AYN3 2RDRA 2W1WA 4U2AA 3VV1A 2WLPA 1PMJX 1HW5A 4XEZA 4AR2A 3I2HA 4BYYA 5JOWA 5DDJ1 4IE7A 1KFXL 2PHUA 2QQMA 3LEIA 5FYSA 3VKLA 1HRI2 3VHOA 5EP9A 4PLMA 5C8WA 5JXGA 1AR82 2J22A 1C8M3 2ZAHA 4YM0A 2DV9A 2QDRA 3VD5A 4NPLA 1S0BA 2JG9C 2VVFA 4BJ0A 1MQTA 3HQUA 1MZFA 4L9BA 3ZDSA 2Q8EA 4A4AA 3MGUA 1JZ8A 5A32B 1GQHA 2BTVC 4RR3C 2V73A 5GZFA 3GHMA 1WCSA 4CCEA 1JYCA 3NNLA 1WMEA 2Q8CA 1HIXA 3EHKA 1H6YA 5JZGB 2V09A 3T1MA 1TMF2 1HRI1 2JECA 4NIAA 2ZPXA 3OD0A 1AR81 2Q30A 1QH6A 1APNA 3H3LA 2NMNA 4W4ZA 2W95A 5B4NA 3B94A 3KT7A 1SDDB 2YBSA 4B8EA 1OFNA 5FY0A 3PIJA 2WQ8A 4HN0A 4WVZA 3VBUA 4BHPA 3EB7A 5DDJ3 1TE1B 4NVPA 2VTXA 1GWMA 1BLZA 1QGLA 1VBC2 2YGLA 5GKAC 4XHXA 2G9GA 1NCQA 2AGSA 1TMF1 2F4PA 2O14A 3N7JA 5I0DA 2C9AA 4URTA 4YGEA 1DIWA 2WAAA 3IMNA 1W2AX 3BTXA 1I9RA 3LSDA 1IG0A 1OD5A 5C3OA 4YGCA 1H8VA 2CHHA 2Y60A 1OD3A 3HNBM 4UT5A 1IQDC 3WQ0A 3UK9A 4EJRA 1HRI3 2CL2A 3LDBA 1G8WA 2MPFA 1YRZA 3E5UA 3KQRA 1H1MA 3BODA 2DCJA 2BUKA 1YQ6A 3MV11 3OSDA 2VULA 2C26A 4JVAA 3TWIA 1LR5A 1UZZA 4GMP0 4CEYC 1JYWA 1CAUA 1ZA7A 1DZQA 1JZ7A 5JIUA 2XWJB 2OT7A 5T5LA 2VNGA 1DYOA 1ENSA 1ZZBA 4A42A 2XBO3 1VALA 1J1LA 4M00A 3ZYIB 4AVAA 2VCCA 5GLZA 2XJTA 1JMUB 1KJLA 1UO9A 5FPVA 3HOBA 4OZOA 2VZVA 4XFCA 4AAPA 5C70A 2WNVB 1HKDA 1WD3A 4KI5M 4HZFA 5L7OC 3O1OA 4AI1A 1XNBA 4LA2A 1ZBE2 3RNSA 4D6RA 4X6QB 4BWOA 4BK4A 2A6VA 3OUIA 1J3RA 1OA2A 2DVBA 2XJQA 4FPGA 3T2PA 3V0BA 2QJVA 3IN9A 4JGZA 1RUH2 4GJZA 4EN8B 3ZN5A 1GNHA 2KM2A 3ZOIA 4RGGA 5FUIA 2WJSA 2ORZA 3HN3A 5D1IA 1NT0A 1T6BX 5FP3A 5IATA 5A1AA 4NUBA 4NHLA 1F5FA 2XWBB 1VRH2 4OMDA 1ZBE1 2IXIA 3IDCB 3WXPA 1YYNA 4YVWA 1PGL2 4Q4X3 2R071 2XLAA 1UYYA 2QQNA 3AL5A 4UOJA 4B7EA 4LEJA 5FR3A 4AVVA 4DQAA 1RUH1 2D6LX 4BQWA 4LBOA 3FC0A 4YZ1A 2YC2A 1RUD2 4GMP1 4NAOA 1N3QA 3CKHA 2ARCA 5C4WB 2D3SA 4BIOA 1VRH1 4OYUA 4GWIA 3MLJA 4MGYE 4UFJA 1AXYA 5JVVA 3O0XA 4OQ9A 3VZJA 1OF3A 5CFCA 5J96B 4UW6A 3UKVA 1PGL1 1RTVA 3U14A 1LULA 4GH4A 2VZSA 3KB5A 1W90A 2KA3A 5FZGA 3TNQA 4NIDA 3O1TA 1G6NA 3I7DA 1W9TA 1BVP1 4Q5OA 2IC1A 5FDBA 2YFZA 4RGKA 3P1IA 5A7WA 3GCXA 1KDMA 4HKLA 3TNPB 1ZBE3 2IZWA 2VZQA 4QU2A 4A3ZA 1ND2C 4A41A 3ZIXA 5FY9A 2VC9A 2XL7A 4LHLA 1CAXB 2OA2A 2R073 4BMBA 1X9TA 5FY7A 1YFUA 4OMCA 4XUTA 4GA9A 4QHBA 5J3UA 1UX7A 1AVBA 3FLTA 3IZOA 1QY4A 3NWKA 5L9VA 1OBNA 2RVAA 5FUPA 4IE0A 4GMP3 5IK5A 4Q0QA 3I2DA 5TSWA 3HJRA 1E57A 1KEXA 1NA1B 4KG0A 3PJYA 3OBAA 1AYM1 2OXBA 3VZNA 4QQPA 1GOFA 4LK7A 1F9KA 2VBPA 2RJLA 1ZRRA 2EXHA 4MX3A 5H9RA 1VBA2 2WBKA 5BNNB 3VN4A 1JN2P 5LRSA 1DGWX 2BWAA 3SITA 2EXKA 1JHJA 3OBTA 1YLLA 2HWB2 5EIYB 2X53S 4AYUA 1U5YA 2ET7A 2DU1A 2P4EA 2Q8DA 3RZMA 3JBG2 5A3NA 2ZX3A 3ACFA 4HANA 5G05L 1E5RA 3USSA 5J98B 2O1QA 5FWJA 3WF4A 4CDQC 2VZRA 1HB1A 1SLIA 1RMU2 1XU1A 1BBT2 4WVWA 3GZUC
chains in the Genus database with same CATH topology
4NRQA 3O1RA 4IDZA 3I2OA 3BIEA 3BTZA 3O1OA 3RZGA 3O1VA 2FDFA 4NIIA 4JHTA 3RZHA 4QKFA 4ZHNA 4ZS3A 5DABA 2IUWA 3H8XA 3O1MA 3H8RA 2FDIA 4QKNA 3I3MA 3T4VA 3T4HB 4IE6A 4IE7A 3O1UA 4NIHA 4O61A 4NIGA 4NPLA 3T3YA 2FDHA 3I49A 4IE4A 3BUCA 3KHCA 3RZLA 4NJ4A 4CXWA 4IE5A 3BKZA 2FDJA 3S5AA 4NRPA 4QHOA 4NIDA 3O1TA 2FD8A 5F8PA 4NROA 4QKDA 3BI3A 3H8OA 3BTYA 3I3QA 3KHBA 4NRMA 4QKBA 3LFMA 3BTXA 4IE0A 4OCTA 2FDGA 4CXYA 3O1SA 3BU0A 4O7XA 4CXXA 3RZJA 3S57A 3O1PA 3RZKA 4ZS2A 2FDKA 4MG2A 3RZMA 4MGTA 4NPMA 4RFRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRQ A;  3O1R A;  4IDZ A;  3I2O A;  3BIE A;  3BTZ A;  3O1O A;  3RZG A;  3O1V A;  2FDF A;  4NII A;  4JHT A;  3RZH A;  4QKF A;  4ZHN A;  4ZS3 A;  5DAB A;  2IUW A;  3H8X A;  3O1M A;  3H8R A;  2FDI A;  4QKN A;  3I3M A;  3T4V A;  3T4H B;  4IE6 A;  4IE7 A;  3O1U A;  4NIH A;  4O61 A;  4NIG A;  4NPL A;  3T3Y A;  2FDH A;  3I49 A;  4IE4 A;  3BUC A;  3KHC A;  3RZL A;  4NJ4 A;  4CXW A;  4IE5 A;  3BKZ A;  2FDJ A;  3S5A A;  4NRP A;  4QHO A;  4NID A;  3O1T A;  2FD8 A;  5F8P A;  4NRO A;  4QKD A;  3BI3 A;  3H8O A;  3BTY A;  3I3Q A;  3KHB A;  4NRM A;  4QKB A;  3LFM A;  3BTX A;  4IE0 A;  4OCT A;  2FDG A;  4CXY A;  3O1S A;  3BU0 A;  4O7X A;  4CXX A;  3RZJ A;  3S57 A;  3O1P A;  3RZK A;  4ZS2 A;  2FDK A;  4MG2 A;  3RZM A;  4MGT A;  4NPM A;  4RFR B; 
#chains in the Genus database with same CATH topology
 1LHV A;  4CUG A;  4UFI A;  2E26 A;  1U5I A;  3HPN A;  2ZGN A;  4XF1 A;  3ZFG B;  1VBA 1;  1QJE A;  4F83 A;  3WCR A;  3I2O A;  5IVV A;  3MW2 A;  1O59 A;  2BGO A;  1C1L A;  2GNB A;  3BIE A;  2HWB 1;  1RL3 A;  2D5H A;  1HXS 2;  3POG A;  1SQ4 A;  5APA A;  2VAU A;  3MLK A;  4ZU5 A;  2FDF A;  3N9L A;  1KS4 A;  1O3S A;  3LIH A;  1AYM 3;  3I97 A;  1VBD 2;  5KBF A;  4BQ2 A;  2QE3 A;  4FOQ A;  3GXU A;  5C5U A;  1BBT 1;  2K2S A;  1NKG A;  4QXK A;  3RZH A;  1I5P A;  3ZXF A;  3DUI A;  1DP0 A;  2A3W A;  4P9W A;  5DAB A;  2WYF A;  4QX5 A;  4FAG A;  4MV2 A;  2GMP A;  2XJR A;  4AOC A;  5JAX A;  3J8F 3;  4E4Z A;  3VDD B;  2C4X A;  2VMI A;  5JI7 A;  3NL1 A;  4Q4W 2;  3MIB A;  1HXS 1;  4N7I A;  5FZ0 A;  4AI3 A;  4HVQ A;  4XVH A;  4KBB A;  2VME A;  4N7U A;  3MPB A;  3ETP A;  1V00 A;  3SXW A;  4Y1Y A;  1DQ6 A;  1Z78 A;  3WQ1 A;  4CCO A;  4C1W A;  1HV1 A;  3LAG A;  5C9A A;  5FZM A;  2A1X A;  1LAJ A;  1OHF A;  1JYI A;  2G4I A;  2JKX A;  1J3Q A;  4LOR A;  4IV3 A;  2R7E B;  2VQA A;  2CDO A;  4Q4W 1;  1ST8 A;  1JOB A;  2EIB A;  2X09 A;  1SPP A;  2UY8 A;  4IXL A;  5CG8 A;  2BOI A;  5FYV A;  1F8V A;  5T52 A;  5FUN A;  2VOT A;  2P6C A;  3H50 A;  2OYZ A;  3BKZ A;  1D0H A;  1REE A;  1QXP A;  4C0B A;  1F31 A;  5FCC A;  3DPR A;  1NX9 A;  4R9B A;  3JD7 2;  2ET1 A;  3PVN A;  2JIJ A;  3NJZ A;  1K5J A;  2ZS6 B;  3L2Y A;  1D2Q A;  4IEX A;  1Q8O A;  5LW9 A;  1JZ2 A;  2W1U A;  5AVP A;  3R4S A;  3WNL A;  3PUR A;  4L99 A;  3S30 A;  4G9S B;  3I3Q A;  3HT2 A;  1JYV A;  1O8S A;  1ASJ 2;  2B9U A;  2OW4 A;  3GBW A;  3J4U H;  4P14 A;  5K8S A;  4CDU C;  2CGO A;  2ZEW A;  5FRA A;  3HNY M;  5FMO S;  1VLN A;  2GC2 A;  3IAQ A;  4DS0 A;  1LB2 A;  4WM7 C;  3JD7 1;  1O5U A;  1H9P A;  3AKR A;  4AED A;  1PVX A;  5HPO A;  4XUO A;  4MO3 M;  3S6P A;  2HLE A;  4COU A;  4Q4W 3;  1RUE 2;  3LWC A;  2WNO A;  2EA7 A;  4BOW A;  1OXC A;  2ETE A;  5IVB A;  2NQY A;  1UCX A;  2XVG A;  1TME 3;  2ZGU A;  3PHM A;  2IXH A;  4A6O A;  4BLI A;  2XLG A;  2E7A A;  4QX2 A;  1ASJ 1;  5BNO B;  5A3U A;  4CXX A;  1H1I A;  3RZJ A;  2B8M A;  4YAR A;  1OA3 A;  4BQX A;  4BLJ A;  4LBM A;  3WW2 A;  1V6L A;  1URX A;  1VP6 A;  3OPW A;  1K45 A;  1S0C A;  3GYD A;  5FO7 B;  3ZMO A;  4EZH A;  1RUE 1;  4IQP A;  4LBJ A;  3KV9 A;  4D7T A;  4LPL A;  1W05 A;  4XOG A;  4A45 A;  5FMO L;  5LA1 A;  4R9A A;  4Z92 B;  1UL9 A;  1N1S A;  2I74 A;  2PQS A;  3ENR A;  2CU5 A;  3M8L A;  5IW0 A;  3SIS A;  5A3M A;  4BK5 A;  4QQ2 A;  3HT1 A;  4YZ5 A;  1TG7 A;  1ZX5 A;  2UWA A;  5A33 B;  1OUX A;  1TNR A;  2QQI A;  2A73 B;  1RHI 1;  1VAM A;  1Y43 B;  4URA A;  4XFA A;  5FPU A;  2WO2 A;  3DKW A;  1ASJ 3;  3GHN A;  4XJU A;  1R64 A;  2GP3 A;  1OLR A;  2Y6K A;  3PME A;  4LK6 A;  2B7Y A;  2A6X A;  4N9I A;  5CFD A;  2UY9 A;  5DAP A;  3MYX A;  4FCA A;  2YZ4 A;  3IB3 A;  1H1A A;  1HRV 2;  3KT4 A;  2QCS B;  4TWT A;  4YNI A;  3T4V A;  4NMI A;  5JZG A;  2ZGP A;  3FE5 A;  3OPT A;  2YUE A;  4OVE A;  1W2O A;  4WM8 C;  4NIG A;  2BWC A;  1D2S A;  2QQO A;  1Q56 A;  3V56 A;  4QPG B;  1YI7 A;  2NMO A;  2HWF 2;  2LTN A;  3JZV A;  1QHD A;  4LE4 A;  3W5N A;  2E63 A;  1W8Z A;  4GZ9 A;  5DMY A;  1AL0 G;  2ZAB A;  4JTO A;  4JC1 A;  1JZ5 A;  4B4Q A;  1RHI 3;  1Y3T A;  5FAX A;  4Q0V A;  3AMP A;  4UBG A;  3ZYH A;  3RWK X;  4WV8 A;  5A7P A;  4UFL A;  4MHR A;  4CXW A;  2ZGK A;  2V5Y A;  4QDQ A;  3HVD A;  1IOA A;  4HET A;  4PIZ A;  3VL8 A;  3E6D A;  2I45 A;  1A6C A;  2WT2 A;  3QLQ A;  3RYK A;  3ZXK A;  5BXX A;  5LBE A;  2HWF 1;  5HXM A;  2BV4 A;  2E32 A;  2VUJ A;  1W9W A;  2YYO A;  3ETQ A;  4ZKT B;  1HQW A;  4MXW B;  5FMD A;  3AP7 A;  3O12 A;  4NRO A;  3CBN A;  4GUL A;  3WD5 A;  1XNK A;  1JOD A;  1MQT C;  1MS1 A;  3D0J A;  2JJ6 A;  3DGT A;  1ENQ A;  1N1V A;  3LA7 A;  1CX1 A;  3J7M A;  2WA3 A;  3M3O A;  4XXA A;  3R0R A;  3ZIW A;  2AEY A;  2VE1 A;  4DNY A;  5JSR A;  1O91 A;  1W8O A;  2Y38 A;  4IER A;  3WNP A;  2NN8 A;  1AZD A;  1NLQ A;  2ZHM A;  1CD3 G;  2FCT A;  5ANQ A;  4DEV A;  4XBN A;  3HBK A;  3H42 B;  3A7Q A;  4BXF A;  1H2M A;  1TNF A;  2VCA A;  2VO5 A;  1V70 A;  5F3I A;  5J1X A;  4Z2W A;  2J1T A;  3EYP A;  4Q4Y 2;  1LOE A;  2DUQ A;  3FFQ A;  2ZA9 A;  2QZ3 A;  1WCK A;  3VBU C;  3PUS A;  3R4U A;  1QH7 A;  1BXH A;  1PO2 1;  2Y26 A;  1VRB A;  3LKJ A;  4FQ4 A;  3D8C A;  4UW5 A;  1OA4 A;  2QVS B;  5D8A B;  3KWV A;  2BER A;  2WNV A;  2EIG A;  4E4D X;  1NCQ C;  2CNA A;  3FBM A;  5FLH A;  2ZEX A;  4ZU4 A;  4R4Z A;  1W28 A;  4P9Y A;  3QOP A;  4E9K A;  3NAP A;  5BUV A;  4Q4Y 1;  1DDL A;  3K51 A;  4B1L A;  5JR7 B;  2WZR 1;  1J3P A;  2UYA A;  2ZEY A;  4HKW A;  2LS6 A;  1HB3 A;  5EYX A;  2QQU A;  5L73 A;  2TUN A;  1MVQ A;  3ZR6 A;  2XG3 A;  4QM8 A;  1I1E A;  1GWK A;  2HBU A;  5A7S A;  4MLO A;  3EBR A;  2DDU A;  4CU6 A;  4D6Q A;  2TNF A;  3ZR5 A;  4YSF A;  3PJQ A;  4LBQ B;  1U5X A;  2VQT A;  2W92 A;  2HEY F;  1W2N A;  3MW3 A;  4LMF A;  1IKQ A;  5CYY A;  4NII A;  1K12 A;  5CEH A;  2HEW F;  5F9T A;  1OOP B;  3ABZ A;  1PO2 3;  2Y0I A;  2VUD A;  1UMZ A;  3SC7 X;  3U07 A;  2Z42 A;  1YIF A;  3WLU A;  2W94 A;  3Q8A A;  3ZKY A;  1CJD A;  4AW7 A;  3HAG A;  4KG8 A;  2DFB A;  5FYT A;  2DUP A;  2XVK A;  3MHZ A;  4B4R A;  1GBG A;  4GB3 2;  4N53 B;  4FFG A;  4XFG A;  1RYY A;  4GJY A;  3AZY A;  5KXE A;  5KXC A;  4NR1 A;  5LEK A;  2NP0 A;  1WCD J;  3VHP A;  4A7Y A;  5A1F A;  5C4W A;  4BQ1 A;  1EV1 1;  4Q4Y 3;  3U78 A;  4JCK A;  3PVB B;  1LEN A;  1PX4 A;  4O61 A;  5DAQ A;  2WZR 3;  1IPS A;  2RS1 2;  2ZCW A;  1ULC A;  4LKF A;  2QQP A;  2JD4 A;  1W8W A;  2AR6 A;  2RM2 2;  3PTY A;  5AFE A;  4XQD A;  4BXS V;  3WR0 A;  1Z0H A;  4A6S A;  5T50 A;  1XYO A;  4X8N A;  5CIR A;  4GB3 1;  3PUQ A;  3HR9 A;  2PAK A;  3CZU A;  1D7P M;  1CAX A;  1ZZ8 A;  4JGZ C;  2YPD A;  4BE3 A;  1UYX A;  2RS1 1;  4M3C F;  4BIS A;  4CSW A;  4BZ4 A;  5LEJ A;  3WIN E;  2RM2 1;  4GQ7 A;  3ST7 A;  4AEM A;  4CTE A;  3IPV B;  2AUY A;  4FPH A;  2IXK A;  2AC1 A;  3QBQ A;  2Y33 A;  4K8F A;  5FYH A;  5IWF A;  3WG1 A;  3WQB A;  3THP A;  1Q8Q A;  1GSL A;  1FXZ A;  2ADE A;  3PLQ A;  1CPN A;  1GZC A;  4D0Q A;  1EV1 3;  4LR4 A;  1QEX A;  4YVW C;  4F8A A;  5C8C B;  2V5D A;  1S2B A;  3UJQ A;  3S0M A;  1NA1 A;  5FOB B;  3UNP A;  1QOS A;  3AJZ A;  2VZ3 A;  3OD4 A;  4AHY A;  5J37 A;  3Q8F A;  1W6N B;  1ZA4 A;  2IXJ A;  5LRR A;  1AL2 3;  4M0H A;  5HCB A;  4J6G A;  3C8X A;  1WCQ A;  5BNN A;  2QZ2 A;  4LHK A;  3M2M A;  4JGY B;  2BYV E;  4Y20 B;  3WY6 A;  3KF5 A;  3OEA A;  3AM2 A;  4Q0P A;  4DO0 A;  1V6K A;  3HWJ A;  4P08 A;  2VTX J;  2W5F A;  3WDV A;  5JMO A;  1OLM A;  5FYM A;  3VBF B;  4XIL A;  5CFC C;  2D6P A;  4XQW A;  2Z4F A;  3K4D A;  4KQ7 A;  3AB0 A;  3HBZ A;  4GH4 C;  1C57 A;  4PDW B;  1FMD 1;  3A4U A;  5GM0 A;  4E8C A;  3MO4 A;  1DGL A;  1KIT A;  2RM2 3;  3GJB A;  2H0V A;  4MHU A;  1D4M 1;  1O3T A;  4YW1 A;  1RUC 3;  3ZFG A;  2GN3 A;  5FPX A;  5EYY A;  1QJU 2;  2ZJC A;  4EV0 A;  1KDK A;  3O14 A;  3GAL A;  1AXK A;  2DTY A;  2WWU A;  1WLT A;  3NNG A;  2J1V A;  4LOS A;  4AVC A;  5I0R A;  5LK5 A;  5LCW L;  2VMD A;  1VMH A;  4FFH A;  1HQN A;  2X29 A;  2Z79 A;  3M3C A;  4FP3 A;  4NPM A;  2YHJ A;  1OF4 A;  1LKN A;  1LGB A;  1KXG A;  3K46 A;  4C1X A;  1XSQ A;  3FLR A;  1PNF A;  1TQ5 A;  2JG9 B;  4MZU A;  4Q26 A;  2PHL A;  3MID A;  4QGL A;  4DUV A;  5ABJ B;  4YWA A;  2ARA A;  1DGW A;  1C3H A;  3AKQ A;  3CO2 A;  1QJU 1;  4XAA A;  3VDD A;  3H3U A;  3WW4 A;  4COY A;  5CBL A;  3RMX A;  4OFG A;  2YV8 A;  3BTZ A;  3T08 A;  1UMI A;  3RI8 A;  4K6B A;  4IET A;  1LGN A;  1FMD 3;  1YC6 1;  2CTV A;  3CJI A;  4PJY A;  4Y26 A;  4LBN A;  5ERL A;  1UN1 A;  3RVH A;  4FVV A;  1D4M 3;  1LJ7 A;  5FO9 B;  3AP5 A;  3AKP A;  4WVV A;  2MNG A;  1GQP A;  1WUV A;  5FZB A;  3TAY A;  4CPB A;  5I93 A;  2JEN A;  1YHF A;  2ZGM A;  1GP4 A;  2E9Q A;  3RRD A;  4W6W A;  3T2Q A;  4IEO A;  2VZ1 A;  4IV3 C;  3R4D B;  1UXZ A;  4AVB A;  4Z1V A;  1OKO A;  2JE9 A;  2WN3 A;  1VB2 A;  2GU9 A;  2F4L A;  3LEG A;  3LFI A;  1YUD A;  5FBJ A;  4AGG A;  2GH2 A;  2PA7 A;  4CUA A;  4DXS A;  1VBB 1;  3WZ1 A;  3ZSJ A;  3AYE A;  1COV 3;  4S2G A;  3BPZ A;  1IPJ A;  1AX1 A;  5DG2 A;  4JTN A;  1DYP A;  2GC3 A;  2ZHN A;  5EPA A;  2Y0O A;  1WGP A;  3HQR A;  4ET7 A;  4HVO A;  4YLZ A;  4W6Y A;  4WZC A;  5HXV A;  2BJS A;  1X50 A;  3C7F A;  4CCJ A;  4Q8K A;  1QF3 A;  1UY2 A;  2J1A A;  4M4P A;  4RGA A;  5T5O A;  1SBE A;  2HWD 1;  2ZHK A;  4ONU A;  2QBX A;  2OPW A;  1RC6 A;  2DVD A;  1QQP 1;  1UW8 A;  5FZL A;  2FDJ A;  4L97 A;  4AFD A;  1ODM A;  1AR6 1;  2D97 A;  2WT1 A;  4QD2 A;  4A7K A;  2CAU A;  2WSV A;  1CQ9 A;  1NZC A;  4OUE A;  3THT A;  2PMW B;  1P8J A;  2R0H A;  1POV 0;  1HDK A;  1J58 A;  5GJ6 A;  2A3X A;  1UY3 A;  1H0B A;  1EPW A;  1IS5 A;  1MS3 A;  2OS2 A;  1JH5 A;  4QGN A;  4PCR A;  4D3W A;  4LO5 B;  3BI3 A;  3OG2 A;  1VBB 3;  1LHN A;  3RGB A;  5C9A C;  1JZ6 A;  2AEZ A;  5BNO A;  2OPK A;  2CGN A;  3J7H A;  3VKN A;  1DZR A;  1SG3 A;  3W58 A;  1QXJ A;  1UIJ A;  2JDU A;  2D44 A;  5JXH A;  5IVF A;  3PL0 A;  3VD7 A;  5KC6 A;  1UY4 A;  2WUH A;  2WRA A;  3PDQ A;  4CP1 A;  1E5S A;  1ACC A;  1PK6 B;  4OHZ A;  1LOG A;  1QJY 3;  2LW8 A;  4JRL A;  4Y5S A;  3ACI A;  4K9S A;  4BCU A;  3SQO A;  1H9W A;  5C6C A;  1QJZ A;  5HV4 A;  2VOV A;  3IDA A;  5HCF A;  1SFY A;  2HWD 3;  1PO1 2;  3ZFE B;  3DPR C;  1A34 A;  1HV0 A;  1QQP 3;  3PU8 A;  1RUO A;  3AP9 A;  2R1D A;  3NKT A;  4QX1 A;  4XF4 A;  1DF0 A;  1AR6 3;  4AF9 A;  4ES8 A;  1O4Y A;  3RJ2 X;  2RV9 A;  2Y34 A;  1FV3 A;  2ID4 A;  3VDB A;  3OBR A;  2ORX A;  1OI6 A;  5A33 A;  4O9E A;  2YC4 A;  1XYN A;  2W91 A;  1O6U A;  5GZC A;  1UY1 A;  4B4P A;  4OUL A;  3MV0 1;  3B3Q E;  1FI2 A;  2DTW A;  1A8M A;  5C3S A;  1PO1 1;  2WAO A;  5FOJ B;  4RL7 A;  2D6M A;  3NST A;  4GD4 A;  4IGP A;  4AED C;  1ZRE A;  2Y6L A;  1N3P A;  3B7M A;  1NQD A;  4FPY A;  3AZZ A;  5K7P A;  5ACA 2;  3O1R A;  1F5J A;  1VBC 1;  1DBN A;  3KV5 A;  4QM9 A;  4QPY A;  4ZU7 A;  1H30 A;  2C0Z A;  4X8P A;  1NCR B;  1ZZ7 A;  4CCN A;  1AR8 3;  2YB7 A;  4DUX A;  4J1W A;  1GFF 2;  3W21 A;  1CGP A;  2RS3 2;  3SLI A;  4CEW B;  4QB6 A;  1YQ8 A;  1ND3 A;  1G86 A;  4HN1 A;  1FPN 2;  5SV8 A;  1POV 1;  3OJB A;  1GWL A;  4AWD A;  1DFQ A;  4QPG A;  3LIG A;  4XXP A;  1F15 A;  3ITQ A;  4NHY A;  4COZ A;  4R4X A;  4XMI A;  2C24 A;  2VMG A;  3WT3 A;  1RED A;  1V9U 2;  5ACA 1;  1LU2 A;  2TBV A;  4H55 A;  3H8X A;  1TMF 3;  4CPB D;  1XQN A;  4DIN B;  5F32 A;  1MS0 A;  4IE6 A;  2PHW A;  2CV6 A;  2EAL A;  3AP4 A;  3P6B A;  2ZML A;  4YW4 A;  1FPN 1;  1ULG A;  2R1B A;  3D82 A;  4MGK E;  2WNU B;  5T5P A;  4BQY A;  4CUB A;  4IL7 A;  1W04 A;  2FBE A;  1VBC 3;  3NW4 A;  5DZF A;  2RR1 2;  2Y6F A;  3DCQ A;  4N43 B;  3E5X A;  3N3H A;  2JIG A;  3UES A;  4EYU A;  4FSJ A;  3MI8 A;  1V9U 1;  4FPL A;  4MXW A;  4LLF A;  4XBL A;  3I49 A;  3ZXA C;  2VG9 A;  3GM8 A;  5H9S A;  3HIF A;  4XF3 A;  4GAL A;  1POV 3;  2WT0 A;  5FJH A;  3UL2 A;  3ZN6 A;  1CVN A;  3WOG A;  4DEQ A;  5AVA A;  5CFD C;  3KHC A;  4C0H A;  3AZW A;  1OPM A;  1ZRF A;  5FZH A;  3VD3 A;  4HVR A;  1W06 A;  4S2D A;  3P5B A;  2E53 A;  1QDC A;  3AYA A;  1RUI 2;  3N35 A;  3I2F A;  5JZG C;  3S5A A;  5ACA 3;  2P2K A;  4Y33 A;  2AH2 A;  3TB0 A;  2RR1 1;  4NRP A;  4DRR A;  3I2G A;  2JB4 A;  1VBE 2;  1YO8 A;  2NPI A;  4NAM A;  4PF5 A;  2IXL A;  2FD8 A;  3KMH A;  4RHV 2;  3VDC A;  1OQD A;  1S0D A;  5A3L A;  2B9V A;  3NNM A;  3TOJ A;  1J83 A;  3IDE A;  1W3V A;  1FPN 3;  4LBK A;  5IFP A;  5FZK A;  2O8Q A;  4HXC A;  3OUH A;  2IFW A;  2VMC A;  2P3J A;  3VBS B;  5JSP A;  5LA0 A;  3ZYR A;  1AJK A;  3GJA A;  5D8A A;  5FZ7 A;  1RUI 1;  2WWS A;  5DUU A;  4B29 A;  1PVC 2;  4G3Y C;  2B42 B;  5DZG A;  4JX0 A;  3ZXL A;  1VBE 1;  4NO4 A;  2TEP A;  3BTA A;  4RHV 1;  1WMF A;  1NXD 1;  4Y1Z A;  1ODN A;  3H3Z A;  3KCX A;  1RUF 2;  3SH4 A;  5JOZ A;  3QD6 A;  2G9F A;  5I0S A;  3HMY A;  1B35 B;  3AVS A;  5LAS A;  1JHN A;  2VMF A;  5GZE A;  5KHJ A;  1RUD 1;  2FDK A;  5FTT C;  1ENX A;  1YFW A;  1QJX 2;  4E4S A;  2YXS A;  3F95 A;  2ARE A;  4Q4V 2;  3LEK A;  4LBQ A;  2VNR A;  5FXZ A;  4EN6 B;  2WN2 A;  3PTR B;  3WNO A;  5FYB A;  1OSG A;  4XFB A;  1OOP A;  4C8D A;  2KR2 A;  3GGL A;  5T5J A;  4O65 A;  5EJ1 B;  1RUH 3;  4JDM A;  4LJH A;  1RUF 1;  2VM9 A;  5E1R A;  3CL1 A;  5FYZ A;  4DB5 A;  5FZE A;  2ZGT A;  4ZY9 A;  1EUU A;  2VZT A;  5CU1 A;  1C8N A;  1QMJ A;  5E6H A;  1NQJ A;  1W8F A;  4XFI A;  1XE8 A;  2D5F A;  3IIA A;  3MDP A;  4HT1 T;  5FK7 A;  3RPQ A;  1VRH 3;  3U1X A;  4N53 A;  1VBE 3;  2LUW A;  4IEV A;  4R9D A;  2GNT A;  1CAV B;  1QJX 1;  1ZNP A;  2Q1F A;  2W87 A;  4LQR A;  4Q4V 1;  1W9Y A;  4PF1 A;  2SLI A;  2Y6H A;  4AQS A;  4EZ4 A;  4TLG A;  4QPI B;  4C91 A;  4DZG A;  5LBF A;  4EN7 B;  5KR7 A;  3AXE A;  4ISR A;  1RUJ 2;  4QAW A;  2WNV C;  4XJ9 A;  5IAX A;  1GOG A;  2XQR A;  4RS5 B;  1CN1 A;  1WBL A;  4DFS A;  3MBW A;  1RUD 3;  3POE A;  2EVX A;  4KWJ A;  4XC9 A;  1QDO A;  4DY5 A;  2A6Z A;  4TZD A;  3NAP C;  4GIQ A;  3WG4 A;  4QKN A;  5FYY A;  3VB9 A;  4ATE A;  3T4H B;  3J9S A;  2CAV A;  2W2I A;  5JIA A;  3SNM A;  1GKB A;  5GZG A;  4R8H A;  2A5Z A;  4JAA A;  1HB2 A;  3MUZ 1;  4HPK B;  1KS5 A;  1RUJ 1;  3FBY A;  2R16 A;  3LB9 A;  3ACL A;  3IPV A;  2FCV A;  3ZN4 A;  1OPO A;  4RQP A;  1CJP A;  3ZLI A;  4YG6 A;  1RB8 G;  1H8T B;  3BN6 A;  1SAC A;  1AHS A;  3JBG 1;  1OVP A;  3K3O A;  3AX4 A;  5C8C A;  1MZ5 A;  4CDW B;  3Q9O A;  2PTM A;  4ASK A;  1RMU 1;  1XJA A;  2LRO A;  3UET A;  2PFW A;  2R06 2;  4CDX B;  2XML A;  4FI9 A;  1W6N A;  4ORF A;  3ACG A;  3IMM A;  3RG0 A;  3PMS A;  5FY5 A;  2WZP P;  3LSE A;  3KS7 A;  4A7Z A;  2ZMK A;  4JGY A;  4XAC A;  3FHQ A;  4CU7 A;  1V6M A;  2NYY A;  1WMX A;  4Y20 A;  5A70 A;  5C4W C;  2VXR A;  4ZON A;  1H6X A;  4XUR A;  3JB4 C;  1GP5 A;  1VBD 1;  3VBF A;  4E2G A;  4IV1 B;  3B5L B;  5I8Y A;  4UFM A;  1MS8 A;  3DYO A;  4PDW A;  3ZFF B;  1VBA 3;  4Z8B A;  2R06 1;  1NAE A;  5FK8 A;  2RG4 A;  1JW6 A;  4AFA A;  3VDA A;  1ZZ9 A;  5G04 L;  1IG3 A;  4I09 A;  5ANN A;  2K46 A;  1K5M B;  2DU0 A;  2HWB 3;  2ENR A;  3JBG 3;  3CU7 A;  4YVS B;  5JLV A;  4DPN A;  3VBO B;  3OGS A;  5CNA A;  4PQQ A;  2WWJ A;  4PI0 A;  1UOF A;  2VXJ A;  3OGG A;  4LO4 B;  1RMU 3;  2W9X A;  2FDG A;  1BBT 3;  1IS4 A;  1GLH A;  1PIV 2;  3AMQ A;  4E4H A;  3WP3 A;  2VZP A;  1NUK A;  4M0N A;  4XMA A;  1S0F A;  3IBM A;  4KBZ A;  4CCK A;  3O1S A;  2OZ6 A;  3R6S A;  4YZ4 A;  1FOD 2;  1US2 A;  1O7F A;  5ABJ A;  3H9A A;  1EPZ A;  3AMH A;  3I3B A;  4LO7 A;  2PYT A;  1HXS 3;  2D6K A;  2OUJ A;  4NE9 A;  3NV3 A;  1NA1 C;  3RZK A;  5A3W A;  5FXX A;  3TEY A;  1JBC A;  1VBD 3;  4OLL A;  4XFH A;  2AAC A;  1G9D A;  2OZJ A;  2R06 3;  5CKM A;  5BNN C;  1SDW A;  3SMH A;  4FPF A;  4OQ8 A;  4LBQ D;  2HKX A;  1BCX A;  4QHZ A;  1DU3 D;  1R1A 2;  3SEE A;  1FOD 1;  2E6V A;  1W9S A;  2PLV 2;  1DQ4 A;  1OC1 A;  2J7M A;  2WQZ C;  3J26 N;  4YG0 A;  3SH5 A;  4F7Z A;  5F3C A;  1WW7 A;  4CA9 A;  2WII B;  3MIH A;  3TYJ A;  2ZGO A;  2YY1 A;  2QQL A;  1XBF A;  4E2Q A;  4LIV A;  5IUQ A;  1MZE A;  2EF6 A;  3PNA A;  5L19 A;  2XKP A;  3POJ A;  5I8T A;  3BVC A;  1UF2 C;  4FT8 A;  5A3P A;  3ZFG C;  2D6O X;  1XSR A;  5FZO B;  2ZAC A;  2EAK A;  3DL3 A;  4I30 A;  2ZGQ A;  1S4C A;  3RQ0 A;  4D7S A;  3N4M A;  1R1A 1;  5BNP B;  1W6O A;  5L9R A;  5FZA A;  3T30 A;  3LA2 A;  3J7L A;  1VJ2 A;  4QKF A;  3WSO A;  1GP6 A;  2P17 A;  1ULO A;  1LOF A;  1US3 A;  1YNA A;  3I3D A;  5DAW A;  3WP6 A;  2XJV A;  5K0U B;  3M3E A;  4GAZ A;  3TEW A;  1Y9Q A;  5H9Q A;  3O1U A;  1OMI A;  1LCL A;  3WF3 A;  1DZT A;  4LKS A;  1Y4W A;  4FXG B;  2BBV A;  2F17 A;  3JD7 3;  3S7I A;  3VDD C;  1C5I A;  2RDQ A;  1VMF A;  2GAL A;  4IEU A;  1CZV A;  2PHF A;  2ES3 A;  2ZOE B;  2QTW B;  5DXD A;  4XDO A;  3IAP A;  1FV2 A;  1NE4 A;  1XYP A;  2WDB A;  3CJI C;  2XQX A;  3VBR B;  5IFT A;  5F6L B;  3NVC A;  4AEK A;  2HWC 2;  5A32 A;  3AFK A;  4P9G A;  2RS5 2;  3WEZ A;  2MEV 2;  3T09 A;  1LGC A;  1BK1 A;  4IE5 A;  5AFB A;  1W2U A;  1W6M B;  4XZP A;  1WCU A;  4HFS A;  3BYW A;  1PK6 A;  2Y6J A;  1RUE 3;  4I2O A;  4LNV A;  3WF2 A;  1XC6 A;  4QHO A;  2E51 A;  3FX3 A;  4Y22 B;  1XB9 A;  4MYE A;  3OY8 B;  2B5H A;  1EY2 A;  1W8U A;  4LE3 A;  5F8P A;  1YQ2 A;  1UYP A;  4Q2F A;  4CE8 A;  4HMZ A;  5K9Y A;  3ZFE A;  4YGB A;  2HWC 1;  4XJ8 A;  2OQ6 A;  1MS5 A;  4CP2 A;  3AVR A;  4DMI A;  2CGP A;  4LT5 A;  2JDM A;  3SHR A;  2RS5 1;  4Y3O A;  3BAL A;  4KMQ A;  2ZEZ A;  5L9B A;  2MEV 1;  3BCW A;  2MHF A;  3WF0 A;  1I3H A;  5EQU A;  1HRV 1;  1DG6 A;  4E8D A;  1CPM A;  4FTB A;  4XDP A;  5C3P A;  2K0G A;  3D0S A;  4XTP A;  2WYS A;  1R09 2;  2G19 A;  4AQ2 A;  4XJW A;  3WHT A;  5DAX A;  3LZZ A;  4V1P A;  3ZDV A;  1W0O A;  4JDO A;  1C5H A;  2NZ9 A;  1CAU B;  1IGO A;  3HN1 A;  2UYB A;  1MS9 A;  3NJX A;  3VKF C;  1NCR A;  3A0N A;  2HEV F;  3MPP G;  3BB6 A;  5BNO C;  3ME2 A;  4CEW A;  3D6E A;  3PUI A;  4Y5Z 0;  5FZ6 A;  4BU2 A;  2XOM A;  4S2F A;  2YU2 A;  5A3T A;  4DIQ A;  3GZT B;  3ASI A;  1R09 1;  2RS5 3;  2Y6G A;  4D8M A;  2D7F A;  1AR7 2;  3AXD A;  4MUV A;  4NHM A;  1ULD A;  2P6H A;  2VZO A;  4W65 A;  2ATF A;  3ILF A;  3BIW E;  1WZX A;  2OQ7 A;  1HRV 3;  3WNK A;  5DPN A;  3WF1 A;  1FNZ A;  1UYZ A;  3UGH A;  2AYH A;  3RJR A;  4NN0 A;  2HWF 3;  4LIT A;  5BNQ A;  3UGG A;  2OUH A;  4HG6 B;  4F3J A;  2WNU A;  5B2G B;  5JOX A;  4AXO A;  2BRT A;  1W2T A;  4JKL A;  4HL0 A;  1YEW A;  4OHX A;  5EHD A;  1AR7 1;  3W59 A;  4N43 A;  4XJZ A;  4YYO A;  2XGX A;  4AAX A;  1W3X A;  4HLT A;  3JU9 A;  1GZW B;  1CON A;  3MLL A;  2JD9 A;  4BQ5 A;  2VH9 A;  2Q1M A;  3MIG A;  4UBH A;  5I91 A;  1D0G A;  5GLU A;  1OUR A;  1YJL A;  1W99 A;  5DAV A;  4YVW B;  5FY8 A;  1S0I A;  5FP7 A;  3VHR A;  5JUV A;  5FMC A;  3ILN A;  4TTG A;  5DUX A;  4EWD A;  5KWR A;  3LF7 A;  2WSU A;  4FOY A;  3NQH A;  3AK0 A;  1ND3 C;  5F6K A;  4DRV A;  5FYU A;  2BVV A;  2JB8 A;  2JG8 B;  1N1T A;  2XLF A;  4QPG C;  1KD7 A;  2EIE A;  3JXS A;  3SH3 A;  3Q8B A;  3PIG A;  3SKJ E;  3H1Y A;  2W1Q A;  3WDX A;  1Z7S 2;  2ZX2 A;  4XUQ A;  1UU5 A;  4QDS A;  2J1S A;  4JRA A;  5JCT A;  5DUV A;  3WP4 A;  5J7M A;  4TN7 A;  4Z82 A;  1IZ3 A;  3OYW B;  1BQP A;  1G9B A;  3ELN A;  1XND A;  3FMG A;  1LU1 A;  4FXK B;  3KM5 A;  1KQR A;  1DCS A;  1F2N A;  3KF3 A;  3W5M A;  3I54 A;  4FFF A;  2VQU A;  2YRO A;  2WFF 2;  2XUM A;  5FLI A;  1SLT A;  2ZZJ A;  1GU3 A;  1JU3 A;  1F35 A;  5F37 A;  1F4A A;  2BEO A;  1FAY A;  1YXW A;  3W20 A;  3H8O A;  3BTY A;  2WO1 A;  4RA0 A;  2P3Y A;  3I59 B;  4LKE A;  3KHB A;  3WQ7 A;  1RIN A;  2Y64 A;  4NRM A;  4JHZ A;  2VCM A;  1B35 A;  2HJI A;  3DXT A;  3SKV A;  2JE8 A;  4OUS A;  2RMU 2;  3RYR A;  5H9P A;  1IQA A;  5FXV A;  5IT6 A;  4LKD A;  3DYM A;  1YQ5 A;  3I3E A;  5FKB A;  1RUN A;  3AZX A;  2WL1 A;  1BEV 2;  2GME A;  2OX0 A;  2PAE A;  1W8N A;  2DCK A;  2WFF 1;  4AQ6 A;  4QX3 A;  2ADD A;  4CXY A;  4XAB A;  5IJR A;  4LHN A;  3MEP A;  4OHW A;  2WC2 A;  2DYC A;  1O3R A;  4LOT A;  1RGS A;  1MS4 A;  2RMU 1;  1UXX X;  5C3Q A;  1G7Y A;  1RUG 2;  2WS9 2;  4GKX A;  5E8A A;  5EXO A;  5F1R A;  1LES A;  1CAV A;  1W0P A;  2PN5 A;  1UZW A;  4N8M A;  3FHA A;  3MW4 A;  1BEV 1;  3LGR A;  1MEC 2;  4QPI A;  3PUH A;  2A71 A;  5D8A C;  1Q5O A;  1W9F A;  2G1M A;  2G9Z A;  1ZZC A;  1AR9 2;  4E2S A;  1W6P B;  4RS5 A;  3VBH B;  2GP5 A;  1HQL A;  2VCB A;  3HEI A;  3M1H A;  1N1Y A;  5FZD A;  4GB3 3;  3K48 A;  3RDI A;  3UKT A;  1JZ4 A;  1QNW A;  2DBN A;  2X5I B;  5LWB A;  3RZZ A;  1ZBA 2;  1JYX A;  3B93 A;  4GWN A;  3N9O A;  3U10 A;  2XUE A;  1NLS A;  2VMH A;  1RUG 1;  1Y9G A;  2D43 A;  2JDP A;  1LED A;  1LRH A;  2CYF A;  2RS1 3;  2WFF 3;  2WS9 1;  3KT1 A;  3DYP A;  2GC0 A;  1MEC 1;  3ZSL A;  4HPK A;  2V4A A;  3D3A A;  4V2V A;  3V64 A;  4CVU A;  4OI0 A;  4CP9 B;  2FZ2 A;  3BU7 A;  3B9C A;  3QCW A;  4Q0U A;  1JUI A;  1K42 A;  3OBZ A;  4IES A;  1B09 A;  2RMU 3;  4JHT A;  1IS6 A;  3TEX A;  1G9A A;  1H8T A;  4COW A;  3A0K A;  3FLP A;  5JXJ A;  1OOP C;  1ZBA 1;  1NLR A;  2JDK A;  3O1M A;  5CKQ A;  4CDW A;  2WFP A;  2GSY A;  1DLL A;  5FLJ A;  5IAV A;  2QQK A;  3H0O A;  2IWG B;  1XE7 A;  1GAN A;  1UD1 A;  4PT6 A;  1UAI A;  4CDX A;  4IUG A;  4M3C E;  3E1F 1;  5I8S A;  1HN0 A;  2W68 A;  4AK3 A;  1VAV A;  4MGZ E;  1CZS A;  4XE9 A;  4WVM B;  2ZX0 A;  4N53 C;  4RR3 B;  5FXW A;  4YM1 A;  4PIY A;  1YIP A;  5FZI A;  1O3Q A;  2R49 A;  4EE2 A;  2WS9 3;  3AJY A;  3X29 B;  4QX8 A;  1OT5 A;  2PQQ A;  1SPP B;  1HJG A;  3JQW A;  1V6I A;  1EAH 2;  1BZW A;  1UY0 A;  2Q8O A;  2GNM A;  4QWN A;  3ZM8 A;  3TRS B;  4IV1 A;  1MEC 3;  2EXJ A;  2WZ8 A;  3WVJ A;  1AYN 2;  3ZFF A;  1T2X A;  2BQP A;  1NY7 2;  2BNM A;  1CWP A;  1S2E A;  5D2A A;  2JXA A;  3VBS C;  3OGJ A;  2VTF A;  1K5M A;  4FPE A;  4Y4R A;  1QWR A;  2D40 A;  4YVS A;  3EQE A;  1YJK A;  3VBO A;  1ZVF A;  5A80 A;  1X36 A;  3KD4 A;  4JKM A;  5LY2 A;  3N9Q A;  4NWV A;  3ZO0 B;  1IHM A;  1M4W A;  1ZRI A;  3ES4 A;  1BK0 A;  2C6S A;  4UAP A;  4QMA A;  1CIY A;  4LXL A;  5A7Q A;  4RQP C;  2WZE A;  4KGQ A;  1QJU 3;  4RYD A;  4NHK A;  5FYC A;  3V0A B;  4Q1P A;  5C8C C;  2YBK A;  4D7Y A;  1X8M A;  1Y7B A;  3LFM A;  1FYU A;  2LRP A;  4FQZ A;  1O8P A;  4U36 A;  4XUN A;  4MOA A;  2CDP A;  2VQ0 A;  3T0A A;  2EXI A;  4BM8 A;  4MGS A;  4Y4Y A;  3H1W A;  4OZX A;  2WO3 A;  3RS6 A;  4EN0 A;  4AE2 A;  1Q8V A;  3U4X A;  4JGY C;  5JSO A;  3WHU A;  1V6J A;  5CAD A;  1C4R A;  1S0E A;  4AHX A;  2HH9 A;  2KXL A;  3D4K A;  5FQ0 B;  3PVE A;  1JOP A;  4MVT A;  4CEY B;  4O7X A;  4AFM A;  3VBF C;  3ZSM A;  4FTS A;  4QT6 A;  3S57 A;  3M3I A;  5F5I A;  1DQ1 A;  4PDW C;  1DQ5 A;  5T3N A;  2JDY A;  2OKX A;  4AVT A;  5JR2 A;  4MG2 A;  2GND A;  1UOB A;  2DF7 A;  3CJX A;  3IDB B;  5C71 A;  2BVB A;  1TEI A;  3ZYB A;  1N47 A;  3ZPO A;  1W8T A;  4Y1V A;  4ITC A;  5FZO A;  2IXC A;  3USU B;  5FPA A;  3B69 A;  4A2U A;  1LHU A;  3U4S A;  4J1X A;  4BQ4 A;  1FT9 A;  2VUA A;  4IEP A;  4M4R A;  5BNP A;  4PIX A;  3WG2 A;  4RFR B;  5JMC A;  1GIC A;  5L7O B;  1PM4 A;  5K0U A;  3MF9 A;  4QGM A;  2DCT A;  4Q29 A;  3PU3 A;  5IHR A;  2PHR A;  3A22 A;  5I0U A;  2VVD A;  3IKW A;  1PM7 A;  5ABJ C;  4FPC A;  4HKO A;  3OTF A;  3SCF A;  3LDK A;  2ZMN A;  3S5Q A;  1BKZ A;  3L9J T;  5CFD B;  5FBZ A;  2VW0 A;  5A1L A;  5FFO C;  4Y1X A;  4XDQ A;  2WIN B;  2ZKL A;  1BYH A;  4CRQ A;  4P00 B;  1W6Q B;  4GKY A;  5LB6 A;  1XRU A;  3S7E A;  2VEC A;  4V2W A;  3VBR A;  4D94 A;  1XNA A;  2XBO 2;  3BGA A;  4JV4 A;  4TSV A;  1ALY A;  5CZK A;  3WNN A;  3THC A;  3H8R A;  4RN5 A;  2OVU A;  5FZ1 A;  3APB A;  3ZSK A;  5FP9 A;  2PHX A;  3TEZ A;  1L7L A;  4H7L A;  2YC0 A;  1VAK A;  3T0B A;  3MFC A;  4AG4 A;  1I5Z A;  4OUM A;  3WDT A;  1W6M A;  2E7T A;  3KV6 A;  2NM1 A;  2FMY A;  1SCR A;  3N36 A;  2QQV A;  3T1L A;  3M4F A;  4Y22 A;  1UU4 A;  2FDH A;  3OY8 A;  3ATG A;  1ULP A;  4R9C A;  4AI8 A;  1DGR A;  2XBO 1;  5IK4 A;  5KXD A;  2JDZ A;  4ATF A;  3FL7 A;  1G9F A;  5A3O A;  4BQ3 A;  4NJ4 A;  2VOX A;  5GAL A;  4ZZ8 A;  1WW5 A;  3NNF A;  1LOF C;  1DHK B;  1PMI A;  3LOI A;  1SCS A;  3OEB A;  1R08 2;  2QQW A;  4I3P A;  4GWJ A;  5F5A A;  3RMY A;  2XON A;  3NKG A;  5IVY A;  1YCI A;  1V6O A;  2D3R A;  2WR9 A;  4RFT 0;  5FIX A;  2QFE A;  2RS3 1;  4KU8 A;  1PO1 3;  1ND2 B;  4LUL A;  2HYK A;  2R6Q A;  4FPO B;  2FHR A;  3POS A;  4IEY A;  1Q8S A;  4Q4X 2;  3KV4 A;  5HV0 A;  4OHV A;  3WW1 A;  4QDR A;  3NO8 A;  1XU2 A;  5JOY A;  4X6R B;  2DUR A;  4K3U A;  4G4F A;  3VZK A;  4XZU G;  2R30 A;  1O4Z A;  3E5Q A;  4FOW A;  4QKB A;  5A6Y A;  1R08 1;  3URF A;  3VKM A;  1TZO A;  2KD7 A;  5FRE A;  2WO7 A;  1J59 A;  1UPS A;  4SBV A;  2IVJ A;  3BPS A;  3H1M A;  1AX0 A;  2GAU A;  1RJ7 A;  3H7Y A;  4Q4X 1;  1AF9 A;  1WA6 X;  3DV8 A;  2I2S A;  2FMD A;  4L2N A;  4QB2 A;  1PK6 C;  3KGL A;  2V4V A;  4QPW A;  5F2S A;  5CAZ A;  1PZ8 A;  3UKN A;  4UI9 L;  1ZYB A;  2Q5T A;  1YWK A;  2W1S A;  1F4H A;  1TVG A;  2CWM A;  3AKT A;  4P5Y A;  5CVR A;  1GZT A;  5AC9 2;  1QOT A;  1JTZ X;  3INA A;  3GCW A;  2R0F A;  3NJY A;  2RS3 3;  1GV9 A;  3ZFE C;  5FP4 A;  2JDH A;  4H3W A;  1LTE A;  3GBF A;  3NAP B;  4I0A A;  1JU4 A;  2A3Y A;  4ERO A;  1S0G A;  1DQ0 A;  2R07 2;  2DFC A;  4CDQ B;  4XF9 A;  1SLA A;  1RVF 2;  1WLW A;  4UF0 B;  3W9A A;  2DVG A;  2D98 A;  1V9U 3;  2GH8 A;  3PUA A;  3T2T A;  3ZXE A;  3DEM A;  1LEC A;  3T0D A;  1R08 3;  2QUO A;  3N9M A;  5IVC A;  3SCH A;  1GZW A;  2ILM A;  5FYI A;  3WCS A;  5AC9 1;  5FWE A;  4I01 A;  3LDR A;  4I02 A;  4TXW A;  4UYB A;  5F39 A;  1U0A A;  4UWD A;  1K3I A;  3VZL A;  1WKY A;  3KZ4 C;  3ALQ A;  4P9I A;  4HK8 A;  2P3I A;  3UV9 A;  4YM2 A;  5CIS A;  1JYT A;  1X82 A;  1J1T A;  1RVF 1;  2RR1 3;  3N7M A;  2I07 B;  1HJF A;  4HK9 A;  2LM3 A;  3OB8 A;  1NCR C;  1RIT A;  1GR3 A;  3QH7 A;  4M3C B;  5FZ9 A;  1PVC 1;  1SBF A;  4CYD A;  3K77 A;  2VVE A;  3ZPY A;  4CEW C;  1L7Q A;  1LHW A;  1DQ2 A;  4ZS3 A;  5DN2 A;  2JG8 A;  1POQ A;  1XXN A;  3B02 A;  5GZD A;  2BP6 A;  1C1F A;  2J42 A;  2ARB A;  5KC5 A;  2XHN A;  1M06 G;  4XW3 A;  1RUI 3;  4YW5 A;  4AGV A;  3I4I A;  1A78 A;  4QXC A;  3MIC A;  3UJO A;  4ASL A;  3LEM A;  3HD8 B;  3RI9 A;  3OYW A;  4B1M A;  5AC9 3;  2IVI B;  4BH9 A;  4RHV 3;  1AX2 A;  1VR3 A;  1MAC A;  3KCY A;  4XCB A;  1AYM 2;  2A7A A;  4AI9 A;  5F3G A;  2WNU C;  2BOJ A;  2Q4S A;  4L11 A;  5JPM B;  1RVF 3;  3CNA A;  4WZF A;  1UNB A;  4N43 C;  3RZL A;  4OI1 A;  3I59 A;  2XJU A;  1PVC 3;  4PBP A;  2EID A;  3KQ4 B;  1J84 A;  3J8F 2;  3OGV A;  4LBL A;  3SEP A;  5CB7 A;  2BNN A;  3OOX A;  3C7H A;  3NV4 A;  4Y24 A;  4Z2A A;  2D3P A;  4O9G A;  2R32 A;  2CSG A;  5FZF A;  5LBB A;  3VGI A;  5D21 A;  1SLL A;  4CCM A;  1RUF 3;  5JPN B;  3LPF A;  4J25 A;  1WLD A;  4CDU B;  2J1E A;  3GBG A;  1CAW B;  2WNE A;  4MGI E;  1GUI A;  4QX7 A;  3EXU A;  3U0Z A;  1JI6 A;  3JCI A;  3ES1 A;  4AEJ A;  5KHK A;  1PZ7 A;  2XJS A;  1OH4 A;  4WM7 B;  3WNX A;  3Q8C A;  4H14 A;  1QJX 3;  3J8F 1;  2K9Z A;  3ORJ A;  3IT8 A;  4Q4V 3;  5I0T A;  4IEZ A;  3MUY 1;  5EWS A;  1BHG A;  3POB A;  1H4H A;  2DUO A;  5SV5 A;  4FTE A;  2VUC A;  4FPK A;  4AVS A;  4FP2 A;  3ZKU A;  5J09 A;  2ZAA A;  2EAA A;  3GDB A;  1MZ6 A;  4KNC A;  2NLR A;  4HSL A;  5EV7 A;  3WG3 A;  1JS9 A;  2BU9 A;  4CCD A;  5F5C A;  3H7J A;  4DOU A;  1T6G C;  1W6P A;  3VBH A;  2PXJ A;  3BOP A;  3MIE A;  1LOA A;  3CDZ B;  4BPZ A;  4FPJ A;  3MFA A;  3VZO A;  4PQ9 A;  2X5I A;  2JDN A;  3GF6 A;  4IGO A;  2JKB A;  3AMM A;  3VD4 A;  5JDB A;  2Q1Z B;  4GXL A;  4IGQ A;  5A7N A;  2BZD A;  1STM A;  1XNT A;  4MAD A;  1PGW 2;  1S55 A;  3P3N A;  4S2H A;  3B9I A;  5GLT A;  2OII A;  3JUU A;  1RUJ 3;  5CA6 A;  1N3O A;  1B35 C;  5BV6 A;  1HN1 A;  3RFR A;  1ULF A;  2C1F A;  1S2K A;  4CP9 A;  1WW6 A;  3LOB A;  3CLP A;  5HBA A;  5F3E A;  5LZ6 A;  4JQT A;  3IM0 A;  2AEN A;  4XYX A;  3JB8 A;  2BGP A;  2ZTN A;  1R1Z A;  2DWR A;  2JIC A;  1PNG A;  3EMR A;  3LA3 A;  1NZI A;  4IDZ A;  1TME 2;  3UT0 A;  3CJI B;  3WV6 A;  2J1U A;  2E31 A;  1PGW 1;  2UWB A;  4IEQ A;  4AHZ A;  2ZKN A;  2JG9 A;  1UIK A;  2BPA 2;  5IYY A;  4ARX A;  4D6S A;  5J48 A;  4MXV A;  4ES9 A;  4WVM A;  4RR3 A;  5HI0 A;  2B46 X;  3KCC A;  1OQE A;  1CR7 A;  3OUJ A;  3OF1 A;  5FP8 A;  3FN9 A;  2PHD A;  1SFP A;  2P5B A;  3NV2 A;  1KGY A;  1UU6 A;  4QPI C;  4XQ4 A;  4I3G A;  4WM8 B;  1PIV 1;  1UZ0 A;  2Z69 A;  1KRI A;  2P1B A;  4Y1U A;  4KWK A;  1TME 1;  4QXH A;  1FNY A;  4RS5 C;  3V65 A;  3D5O A;  2H6B A;  2N7G A;  3AKS A;  4K1Z A;  1AXZ A;  3VL9 A;  1VMJ A;  3POF A;  1YQC A;  2JE7 A;  2VW2 A;  4KH9 A;  4OI4 A;  4XPV A;  4UFH A;  1GMM A;  2SBA A;  2E7Q A;  4MET A;  1H2K A;  2IFR A;  1OKQ A;  5B4X A;  3SCG A;  1UZY A;  1YI9 A;  1DGR N;  1JUH A;  3JQX A;  3TBD A;  4ZXE A;  5E89 A;  2ZXQ A;  1H2L A;  1VB4 A;  2PEL A;  3C7O A;  2JDA A;  3J7N A;  3QAC A;  2W46 A;  4N9H A;  1H8T C;  2PLV 1;  3HNM A;  2D93 A;  3V0A A;  1C28 A;  3NNJ A;  1GZ9 A;  1AJO A;  5E16 A;  4CDW C;  3KVA A;  4Q27 A;  4LIU A;  4QXB A;  3GNE A;  1I6X A;  1PIV 3;  4CDX C;  1MQT B;  3C3V A;  1D4V B;  4BB3 A;  1X33 A;  2Q0A A;  1FOD 3;  1GNY A;  1L7R A;  4L8Q A;  5LA2 A;  2DVA A;  3WX5 A;  1V0A A;  1SLC A;  1LHO A;  2C5D A;  4ARY A;  2FCU A;  3ACH A;  4NHX A;  1ENR A;  4K21 A;  1U5Z A;  3RZG A;  1LOD A;  1YFX A;  4LO8 A;  2ZGS A;  3DF0 A;  5FQ0 A;  3B01 A;  2BBA A;  3BOW A;  5FZ8 A;  4CEY A;  1RHI 2;  2WAB A;  4NWW A;  3O5S A;  3VLB B;  4M01 A;  4IV1 C;  3OGR A;  4NOT A;  4MSV A;  4ZXK A;  3U37 A;  1X8E A;  3ZFF C;  2YG0 A;  4CCL A;  4DXR A;  4LA3 A;  2XVL A;  4D69 A;  4K1Y A;  3G7D A;  3N7L A;  3AYC A;  4L92 A;  3I2I A;  2X05 A;  1IPK A;  1K5M C;  2Z5W A;  4OCT A;  1R1A 3;  3VBU B;  4KL1 A;  1X7N A;  3WDW A;  3USU A;  2O8O A;  3CF6 E;  2PLV 3;  4EQV A;  1AUY A;  4YVS C;  1PX3 A;  4CCC A;  3VBO C;  3K3N A;  2XXZ A;  3L2H A;  4AQT A;  2HYX A;  1NXM A;  2X10 A;  1NCQ B;  2LAL A;  4UFK A;  1LOC A;  1QIQ A;  5L7O A;  2BNO A;  3O0V A;  1SBD A;  2E33 A;  5LY1 A;  2ARX A;  3HQX A;  1QNY A;  2W08 A;  4ZS2 A;  4I0B A;  3WUC A;  1JYN A;  1CX4 A;  2BFU S;  4MGT A;  5EJ3 A;  4EWE A;  4XIO A;  2XR4 A;  3M70 A;  5FPZ A;  2FZ1 A;  1W6Q A;  2VL4 A;  2XKO A;  1IS3 A;  1OVS A;  2BW8 A;  2VNV A;  4JZR A;  5KHH A;  2ZX1 A;  4XCA A;  4C90 A;  1ND3 B;  2BDR A;  4FOV A;  4LTA A;  3FUO A;  2JX9 A;  1JXN A;  1SEF A;  3K2O A;  3POI A;  4XBQ A;  4YFW A;  5EFU A;  1H4G A;  2P34 A;  4XIK A;  4QX0 A;  2A70 A;  3MF6 A;  2ZZQ A;  2JWP A;  3U75 A;  1Q3E A;  4RD7 A;  1E5I A;  1EUT A;  4CU8 A;  3O7O A;  2DVF A;  5K4L A;  1CZT A;  3E97 A;  2YPJ A;  2ZX4 A;  1W03 A;  2HWC 3;  2BFU L;  4XHB A;  3FHI B;  5FY4 A;  4CU9 A;  2IUW A;  3FUQ A;  1BJQ A;  1GNZ A;  2VJX A;  2FDI A;  2W47 A;  2XHK A;  1SZB A;  2MEV 3;  3AFG A;  4YW3 A;  5FV3 A;  5BNP C;  3I3M A;  3CEW A;  4H2A A;  5LBC A;  1UOG A;  5LK7 B;  3WP5 A;  1X9P A;  4UW4 A;  2VD7 A;  1HB4 A;  1HX6 A;  5K0U C;  4NIH A;  1UPI A;  5BY5 A;  1WMD A;  3A23 A;  1GOH A;  2L9L A;  3ZYP A;  1V6N A;  4Z07 A;  1ONA A;  5F7U A;  2V72 A;  3AMN A;  2VW1 A;  3KLS A;  1UWW A;  2C9K A;  3ZN6 B;  3THD A;  1ND2 A;  3V0B B;  1PO2 2;  4P9J A;  1IKP A;  3Q8E A;  3ECQ A;  4PI2 A;  4XUP A;  4JGZ B;  5T54 A;  1HLC A;  1UMH A;  4MGQ A;  4HON A;  1W8H A;  5DQ0 A;  3M3Q A;  2QKD A;  4W50 A;  1EP0 A;  4IE4 A;  1WWY A;  4JDN A;  3U11 A;  3BUC A;  1DYK A;  1QU0 A;  5GLW A;  1OUS A;  2P3K A;  3CHX A;  3VBR C;  2UU8 A;  5IK8 A;  2VOK A;  2GN7 A;  3III A;  4LO6 B;  1BMV 2;  4CP0 A;  2F6B A;  3KVB A;  4IND A;  4NPR A;  5E88 A;  3WDY A;  3T2O A;  2WZR 2;  5F2W A;  1R09 3;  4FFI A;  4XF0 A;  5FKC A;  1REF A;  4KU7 A;  1VIW B;  3F2Z A;  4KWL A;  1ZZ6 A;  5LAT A;  2GMM A;  3FFZ A;  1UOJ A;  3CQO A;  4UXA A;  1H2N A;  4AZZ A;  4Q8L A;  4DY3 A;  3WNM A;  2D6N A;  4PLN A;  1RXG A;  1PMH X;  3N9N A;  1U12 A;  1L3J A;  2QNK A;  1MVE A;  4AHW A;  3ZMN A;  3TN9 2;  3WUD A;  3VD9 A;  4SLI A;  1BMV 1;  2DCZ A;  5C7G A;  2FQP A;  4JQR A;  5CFC B;  5CKN A;  3ON7 A;  3ZXG A;  4CDQ A;  4YW2 A;  2RE9 A;  3A21 A;  1Q8P A;  4GH4 B;  3VBS A;  5JWP A;  4I0W B;  1MR5 A;  1AR7 3;  1KJR A;  4UF0 A;  4BME A;  5A6Q A;  5FY1 A;  3N7K A;  5C33 A;  4YRD A;  4PBO A;  2VZU A;  2VBB A;  4QQL A;  1WBF A;  4WBB A;  5A7W B;  4AFC A;  2EIC A;  5DG1 A;  1GYK A;  2Z2S B;  3I2J A;  3RSJ A;  3VHN A;  5C5T A;  2HWE 2;  3ROU A;  4XJA A;  3B00 A;  1EV1 2;  2BGC A;  3LCP A;  1ZRC A;  1MPX A;  4CZS A;  3M7A A;  1SHW B;  3ZXD A;  3GZE A;  4AFB A;  3O1P A;  4HBN A;  3TN9 1;  1XE0 A;  2A75 A;  4EN9 B;  2VGD A;  4FAH A;  5FJK A;  1UKG A;  1Z7S 1;  5IK7 A;  3K75 B;  3MZH A;  2AZ5 A;  1AL2 2;  3NV1 A;  4YM3 A;  4KGG A;  4EWA A;  4M3C A;  2ZGL A;  1PZ9 A;  5L36 A;  2WQ4 A;  3QH6 A;  1ZM1 A;  2HWE 1;  2XJP A;  4NRQ A;  1SFN A;  1CES A;  3LPG A;  4KWU A;  1S1A A;  4HSJ A;  2PHT A;  4FO9 A;  2W3J A;  1KFU L;  4Q0S A;  2VR4 A;  5DUW A;  5FZ4 A;  4XTM A;  5IVJ A;  3KSC A;  1NG0 A;  2JEM A;  2X8K A;  1RUC 2;  3DKQ A;  1AL2 1;  4PLO A;  4RSU A;  5EJZ B;  1XOY A;  5EZW A;  1A3K A;  3CIH A;  5GLV A;  2XPJ A;  2YMZ A;  4CUC A;  4OI2 A;  3NJV A;  4E27 A;  4YZ2 A;  1UZV A;  3EO6 A;  4IEW A;  4IV3 B;  1ULE A;  1OH3 A;  3K4Z A;  3P3P A;  4P9X A;  3TN9 3;  3WW3 A;  5JXI A;  2VPV A;  4L0P A;  5ISL A;  3LE0 A;  2YDE A;  1Z7S 3;  1RXF A;  4QU1 A;  1O5L A;  1PGS A;  4COV A;  3ZYG A;  4PHZ A;  2H6C A;  2R04 2;  2WLQ A;  2ZBJ A;  5FO8 B;  3R05 A;  4LUM A;  1LNS A;  2YFU A;  2QQJ A;  1RUC 1;  3FZ3 A;  4RQP B;  4MH0 E;  3OCP A;  5CG9 A;  2UWC A;  3FWE A;  2J1R A;  1QOO A;  2HWE 3;  2WA4 A;  3FJS A;  3K4A A;  2ZGR A;  1Q43 A;  3T3Y A;  1WA4 A;  4P02 B;  5FMB A;  3AYD A;  1FMD 2;  1OQ1 A;  4Q1R A;  5LA9 A;  2XB6 C;  1UKR A;  3GZA A;  1G9C A;  1LOB A;  1D4M 2;  2DCY A;  2PAM A;  3AL6 A;  3CZJ A;  1AR9 1;  4CDU A;  4DXZ A;  2RJK A;  1CAW A;  2R04 1;  1W39 A;  3H8U A;  1S0J A;  4FBF A;  1WW4 A;  4ZPI A;  5FZ3 A;  3VKO A;  1ZRD A;  2GZW A;  3CMG A;  2A6Y A;  2ERF A;  4P9L A;  1YFY A;  4WM7 A;  2JG8 C;  4B3N A;  2VY0 A;  5IVE A;  1UQX A;  2B4K A;  4YW6 A;  3KGZ A;  1BEV 3;  2VNO A;  4ASM B;  2W0X A;  4AGR A;  1DLC A;  2B39 A;  3VUO A;  4AL9 A;  4R52 A;  4YZ3 A;  3ZVX A;  3POY A;  3UGF A;  3ZX7 A;  3OPZ A;  1COV 2;  1PHM A;  4YPJ A;  4DUW A;  3MIF A;  5C9A B;  2UUR A;  4QQO A;  1FX5 A;  5A7O A;  2O0O A;  1OFS A;  4BIF A;  1XNC A;  3G6J B;  4QKD A;  3IWZ A;  4W6X A;  5M0T A;  4TLF A;  2WKK A;  1QXR A;  2XDV A;  2XL9 A;  4YFZ A;  1RUG 3;  4BDV B;  4ISQ A;  1SLB A;  5FPB A;  4JKK A;  3DXU A;  3C2U A;  3I8T A;  4AI0 A;  4XFF A;  5F5Q A;  2H0B A;  1JOJ A;  2RJ2 A;  3DPR B;  1AR9 3;  2W52 A;  3AC0 A;  2R04 3;  3E6B A;  1COV 1;  2XH6 A;  4K40 A;  2VOW A;  1CIW A;  3LD8 A;  4LUK A;  1UX6 A;  5FZC A;  1OLQ A;  1XPW A;  4H7M A;  3PVO A;  5A6Z A;  2HBT A;  3N9P A;  1GQG A;  1WLC A;  2RHP A;  4GWM A;  4YG3 A;  5HCA A;  4B7K A;  5KHI A;  2GDF A;  1ZBA 3;  2QDN A;  4A3X A;  3BU0 A;  2CY6 A;  5HCH A;  1RIR A;  1C8M 2;  3RWN A;  3ZYJ B;  4W8J A;  4A44 A;  1NOV A;  3ZYF A;  4N90 A;  5JI9 A;  3C7G A;  1EAH 1;  5A6X A;  2RDN A;  1FAT A;  2B45 X;  1VBB 2;  2VBD A;  5BPX A;  3RYP A;  4OHY A;  4Y5T A;  1AYN 1;  4ZZ5 A;  3AP6 A;  4K8R B;  1NY7 1;  2Y8K A;  4LHS A;  3NMB A;  4AED B;  4IW3 A;  1NYW A;  5KXB A;  2A6W A;  3NRU A;  4K20 A;  4YGD A;  2RDS A;  2CWS A;  2YBP A;  3AZV A;  5DZE A;  4YW7 A;  1SMV A;  5BYN A;  1A8D A;  1QJY 2;  5T55 A;  3E6C C;  3DN7 A;  2DBI A;  1VE0 A;  4XAE A;  1JZ3 A;  4TYS A;  4QQH A;  3ILR A;  1EYB A;  1C8M 1;  2ZHL A;  4WM8 A;  4AI2 A;  2HWD 2;  1NE6 A;  4QB1 A;  3ZSE A;  2W39 A;  2GC1 A;  4DXT A;  5C3R A;  5J36 A;  1VPH A;  1QQP 2;  1LEM A;  1E5H A;  3VBH C;  1W0N A;  1QJF A;  3ZXJ A;  3I2K A;  2P37 A;  5FPL A;  5DDJ 2;  1AR6 2;  5KHG A;  4HOO A;  3O0W A;  4LLO A;  1OLM E;  2YU1 A;  1W6O B;  2X5I C;  3C7E A;  3O1V A;  1BVV A;  3LQC A;  3VZM A;  3EJK A;  4UW3 A;  4K7J A;  4BA6 A;  1QJY 1;  1Y9M A;  1QKQ A;  1WD4 A;  3DEC A;  1EAH 3;  1O4T A;  2YGM A;  4P5H A;  3UYJ A;  4XET A;  2VU9 A;  4ZHN A;  1RJ8 A;  3POW A;  3WDU A;  1AYN 3;  2RDR A;  2W1W A;  4U2A A;  3VV1 A;  2WLP A;  1PMJ X;  1HW5 A;  4XEZ A;  4AR2 A;  3I2H A;  4BYY A;  5JOW A;  5DDJ 1;  4IE7 A;  1KFX L;  2PHU A;  2QQM A;  3LEI A;  5FYS A;  3VKL A;  1HRI 2;  3VHO A;  5EP9 A;  4PLM A;  5C8W A;  5JXG A;  1AR8 2;  2J22 A;  1C8M 3;  2ZAH A;  4YM0 A;  2DV9 A;  2QDR A;  3VD5 A;  4NPL A;  1S0B A;  2JG9 C;  2VVF A;  4BJ0 A;  1MQT A;  3HQU A;  1MZF A;  4L9B A;  3ZDS A;  2Q8E A;  4A4A A;  3MGU A;  1JZ8 A;  5A32 B;  1GQH A;  2BTV C;  4RR3 C;  2V73 A;  5GZF A;  3GHM A;  1WCS A;  4CCE A;  1JYC A;  3NNL A;  1WME A;  2Q8C A;  1HIX A;  3EHK A;  1H6Y A;  5JZG B;  2V09 A;  3T1M A;  1TMF 2;  1HRI 1;  2JEC A;  4NIA A;  2ZPX A;  3OD0 A;  1AR8 1;  2Q30 A;  1QH6 A;  1APN A;  3H3L A;  2NMN A;  4W4Z A;  2W95 A;  5B4N A;  3B94 A;  3KT7 A;  1SDD B;  2YBS A;  4B8E A;  1OFN A;  5FY0 A;  3PIJ A;  2WQ8 A;  4HN0 A;  4WVZ A;  3VBU A;  4BHP A;  3EB7 A;  5DDJ 3;  1TE1 B;  4NVP A;  2VTX A;  1GWM A;  1BLZ A;  1QGL A;  1VBC 2;  2YGL A;  5GKA C;  4XHX A;  2G9G A;  1NCQ A;  2AGS A;  1TMF 1;  2F4P A;  2O14 A;  3N7J A;  5I0D A;  2C9A A;  4URT A;  4YGE A;  1DIW A;  2WAA A;  3IMN A;  1W2A X;  3BTX A;  1I9R A;  3LSD A;  1IG0 A;  1OD5 A;  5C3O A;  4YGC A;  1H8V A;  2CHH A;  2Y60 A;  1OD3 A;  3HNB M;  4UT5 A;  1IQD C;  3WQ0 A;  3UK9 A;  4EJR A;  1HRI 3;  2CL2 A;  3LDB A;  1G8W A;  2MPF A;  1YRZ A;  3E5U A;  3KQR A;  1H1M A;  3BOD A;  2DCJ A;  2BUK A;  1YQ6 A;  3MV1 1;  3OSD A;  2VUL A;  2C26 A;  4JVA A;  3TWI A;  1LR5 A;  1UZZ A;  4GMP 0;  4CEY C;  1JYW A;  1CAU A;  1ZA7 A;  1DZQ A;  1JZ7 A;  5JIU A;  2XWJ B;  2OT7 A;  5T5L A;  2VNG A;  1DYO A;  1ENS A;  1ZZB A;  4A42 A;  2XBO 3;  1VAL A;  1J1L A;  4M00 A;  3ZYI B;  4AVA A;  2VCC A;  5GLZ A;  2XJT A;  1JMU B;  1KJL A;  1UO9 A;  5FPV A;  3HOB A;  4OZO A;  2VZV A;  4XFC A;  4AAP A;  5C70 A;  2WNV B;  1HKD A;  1WD3 A;  4KI5 M;  4HZF A;  5L7O C;  3O1O A;  4AI1 A;  1XNB A;  4LA2 A;  1ZBE 2;  3RNS A;  4D6R A;  4X6Q B;  4BWO A;  4BK4 A;  2A6V A;  3OUI A;  1J3R A;  1OA2 A;  2DVB A;  2XJQ A;  4FPG A;  3T2P A;  3V0B A;  2QJV A;  3IN9 A;  4JGZ A;  1RUH 2;  4GJZ A;  4EN8 B;  3ZN5 A;  1GNH A;  2KM2 A;  3ZOI A;  4RGG A;  5FUI A;  2WJS A;  2ORZ A;  3HN3 A;  5D1I A;  1NT0 A;  1T6B X;  5FP3 A;  5IAT A;  5A1A A;  4NUB A;  4NHL A;  1F5F A;  2XWB B;  1VRH 2;  4OMD A;  1ZBE 1;  2IXI A;  3IDC B;  3WXP A;  1YYN A;  4YVW A;  1PGL 2;  4Q4X 3;  2R07 1;  2XLA A;  1UYY A;  2QQN A;  3AL5 A;  4UOJ A;  4B7E A;  4LEJ A;  5FR3 A;  4AVV A;  4DQA A;  1RUH 1;  2D6L X;  4BQW A;  4LBO A;  3FC0 A;  4YZ1 A;  2YC2 A;  1RUD 2;  4GMP 1;  4NAO A;  1N3Q A;  3CKH A;  2ARC A;  5C4W B;  2D3S A;  4BIO A;  1VRH 1;  4OYU A;  4GWI A;  3MLJ A;  4MGY E;  4UFJ A;  1AXY A;  5JVV A;  3O0X A;  4OQ9 A;  3VZJ A;  1OF3 A;  5CFC A;  5J96 B;  4UW6 A;  3UKV A;  1PGL 1;  1RTV A;  3U14 A;  1LUL A;  4GH4 A;  2VZS A;  3KB5 A;  1W90 A;  2KA3 A;  5FZG A;  3TNQ A;  4NID A;  3O1T A;  1G6N A;  3I7D A;  1W9T A;  1BVP 1;  4Q5O A;  2IC1 A;  5FDB A;  2YFZ A;  4RGK A;  3P1I A;  5A7W A;  3GCX A;  1KDM A;  4HKL A;  3TNP B;  1ZBE 3;  2IZW A;  2VZQ A;  4QU2 A;  4A3Z A;  1ND2 C;  4A41 A;  3ZIX A;  5FY9 A;  2VC9 A;  2XL7 A;  4LHL A;  1CAX B;  2OA2 A;  2R07 3;  4BMB A;  1X9T A;  5FY7 A;  1YFU A;  4OMC A;  4XUT A;  4GA9 A;  4QHB A;  5J3U A;  1UX7 A;  1AVB A;  3FLT A;  3IZO A;  1QY4 A;  3NWK A;  5L9V A;  1OBN A;  2RVA A;  5FUP A;  4IE0 A;  4GMP 3;  5IK5 A;  4Q0Q A;  3I2D A;  5TSW A;  3HJR A;  1E57 A;  1KEX A;  1NA1 B;  4KG0 A;  3PJY A;  3OBA A;  1AYM 1;  2OXB A;  3VZN A;  4QQP A;  1GOF A;  4LK7 A;  1F9K A;  2VBP A;  2RJL A;  1ZRR A;  2EXH A;  4MX3 A;  5H9R A;  1VBA 2;  2WBK A;  5BNN B;  3VN4 A;  1JN2 P;  5LRS A;  1DGW X;  2BWA A;  3SIT A;  2EXK A;  1JHJ A;  3OBT A;  1YLL A;  2HWB 2;  5EIY B;  2X53 S;  4AYU A;  1U5Y A;  2ET7 A;  2DU1 A;  2P4E A;  2Q8D A;  3RZM A;  3JBG 2;  5A3N A;  2ZX3 A;  3ACF A;  4HAN A;  5G05 L;  1E5R A;  3USS A;  5J98 B;  2O1Q A;  5FWJ A;  3WF4 A;  4CDQ C;  2VZR A;  1HB1 A;  1SLI A;  1RMU 2;  1XU1 A;  1BBT 2;  4WVW A;  3GZU C; 
#chains in the Genus database with same CATH homology
 4NRQ A;  3O1R A;  4IDZ A;  3I2O A;  3BIE A;  3BTZ A;  3O1O A;  3RZG A;  3O1V A;  2FDF A;  4NII A;  4JHT A;  3RZH A;  4QKF A;  4ZHN A;  4ZS3 A;  5DAB A;  2IUW A;  3H8X A;  3O1M A;  3H8R A;  2FDI A;  4QKN A;  3I3M A;  3T4V A;  3T4H B;  4IE6 A;  4IE7 A;  3O1U A;  4NIH A;  4O61 A;  4NIG A;  4NPL A;  3T3Y A;  2FDH A;  3I49 A;  4IE4 A;  3BUC A;  3KHC A;  3RZL A;  4NJ4 A;  4CXW A;  4IE5 A;  3BKZ A;  2FDJ A;  3S5A A;  4NRP A;  4QHO A;  4NID A;  3O1T A;  2FD8 A;  5F8P A;  4NRO A;  4QKD A;  3BI3 A;  3H8O A;  3BTY A;  3I3Q A;  3KHB A;  4NRM A;  4QKB A;  3LFM A;  3BTX A;  4IE0 A;  4OCT A;  2FDG A;  4CXY A;  3O1S A;  3BU0 A;  4O7X A;  4CXX A;  3RZJ A;  3S57 A;  3O1P A;  3RZK A;  4ZS2 A;  2FDK A;  4MG2 A;  3RZM A;  4MGT A;  4NPM A;  4RFR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...