4NJ4A

Crystal structure of human alkbh5
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
218
Chain Sequence
b'DYEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTYGAQPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA demethylase ALKBH5
publication title Structure of human RNA N6-methyladenine demethylase ALKBH5 provides insights into its mechanisms of nucleic acid recognition and demethylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 67
structure length 218
sequence length 223
chains with identical sequence B
ec nomenclature ec 1.14.11.53: mRNA N(6)-methyladenine demethylase.
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nj4A00
3O1TA 4IE4A 5DABA 4NRMA 2IUWA 2FDGA 4CXXA 3O1OA 3BI3A 3RZKA 4RFRB 4O61A 3BTYA 2FDKA 3O1RA 3RZMA 3O1PA 4QHOA 3T3YA 2FDFA 4NIDA 3BUCA 3BIEA 4IE5A 4OCTA 3LFMA 4CXYA 4NIHA 4QKFA 3RZJA 4QKBA 4NPLA 5F8PA 4IE0A 4ZS2A 3I2OA 4NIIA 2FDJA 4IE6A 3O1UA 3BU0A 3KHBA 3BTXA 4MG2A 3O1SA 3BKZA 3H8OA 3KHCA 3I3QA 3RZLA 4O7XA 4QKDA 3T4HB 4MGTA 4NRQA 3O1VA 4NJ4A 4NPMA 2FD8A 4NIGA 2FDHA 4NRPA 4NROA 4IE7A 4CXWA 4JHTA 4QKNA 3I3MA 4ZS3A 4IDZA 3RZHA 3H8RA 3BTZA 3T4VA 3I49A 3S57A 3O1MA 3H8XA 3RZGA 4ZHNA 3S5AA 2FDIA
chains in the Genus database with same CATH superfamily
1AYM1 2DU1A 1LR5A 3VD4A 4XF1A 2XUEA 1CJDA 1IG3A 4DMIA 4XILA 2XBO2 2JB8A 1GBGA 3AYEA 5SV5A 4OMDA 1T6GC 5FAXA 3E5XA 1ST8A 2D44A 2I2SA 3RI8A 2D6KA 1YRZA 2GDFA 1CAWB 4JX0A 3ZXEA 1GZCA 2Y6HA 3MLKA 4AQ6A 5JPMB 3AKTA 2W87A 2JG9C 1MEC1 1XNKA 2ZEXA 1YIFA 2HWE1 3WDTA 2FCTA 3C2UA 4WVVA 1O4TA 1FV2A 1W05A 5T5OA 4EYUA 3ZFGB 1GU3A 1RUJ2 2ZA9A 3CNAA 3VDCA 4M4RA 2VZTA 5C9AB 4ORFA 5I0DA 5A7SA 4X8NA 3D0JA 5LY1A 1VJ2A 3H7YA 5FRAA 1W0NA 3AZXA 3B93A 3KF3A 5LK5A 3V0AA 3AC0A 3CEWA 5E8AA 3I97A 4AHWA 1W6NA 2DV9A 1UZZA 3BPZA 1UMIA 3GF6A 1PM7A 1BEV2 4UAPA 4UFMA 5A32A 4DUVA 2VOKA 5GALA 4Q4W3 4IV3B 1MS0A 1ND2A 4NIIA 4QX7A 5FJKA 1UX7A 2V5DA 4DXRA 3R4DB 3H1MA 2YDEA 2QDRA 3TYJA 1Q5OA 1XRUA 5GZDA 1VB2A 4Y26A 1QJU2 3WUCA 3LD8A 5E6HA 1CAXB 2EIDA 2HKXA 2PQSA 2VMGA 3POBA 3OGRA 4H14A 4HL0A 4P5YA 2CGOA 3ILRA 4XVHA 2XPJA 1QXPA 2JDHA 4Q4V1 4ZU5A 3WW3A 3HQXA 3SH3A 4MGQA 2VCBA 3UGFA 4M3CF 3G6JB 2L9LA 3I3QA 3M3OA 3FZ3A 4Q27A 4XF0A 3S30A 3U37A 1VAVA 4RR3C 2XKPA 3WG2A 4BU2A 4E2SA 4DXSA 3R4SA 1W8FA 2VNVA 3ZFFA 2RR13 2AH2A 2XVLA 1LODA 1A34A 5LBBA 3N7KA 4NRQA 5FR3A 1LJ7A 2VNGA 2DCTA 5IW0A 3W58A 2G4IA 1G9AA 4PI0A 4COZA 1XNDA 3OTFA 4TN7A 2ZEWA 4L99A 4R4XA 3WF0A 1QGLA 4LBQA 3TEWA 1VBD1 2DCYA 1YFUA 4K21A 2DWRA 4KMQA 2QUOA 1RXFA 1VE0A 2XL7A 1Q43A 1RHI2 5GM0A 4J1WA 1DYKA 4XTMA 3AJYA 1H1MA 4AVVA 4G4FA 4BQWA 1UL9A 2A1XA 5APAA 4ZS3A 4OZOA 1S1AA 5DDJ3 1PMIA 1PVC1 2CDPA 2ZABA 1AR91 1TMF2 4XOGA 1RVF2 3VBFC 2ZAHA 1STMA 1G9BA 3S6PA 2YFZA 2C9KA 3T4VA 5A3WA 1PNGA 1NCRA 1HJFA 2ETEA 3VBSC 5EV7A 4IEZA 4XUTA 2B9UA 3CQOA 1XB9A 5T52A 4N7IA 4ZHNA 1VRBA 3SCGA 4LKFA 1YI9A 2DCZA 2WAAA 1YWKA 2NPIA 4C0HA 2CY6A 3OUHA 1BZWA 2GMPA 3OY8B 5FYTA 1OC1A 1J3QA 1VBE2 1W8UA 3A22A 3I4IA 4LO5B 4JTOA 4LLOA 4Y24A 5FYHA 5KXBA 5L19A 2PAKA 5FYMA 3Q8CA 4QX8A 1O3TA 1L7QA 5CZKA 1BMV2 3VBRC 1OT5A 3I2KA 1S55A 3POWA 3WNNA 1ULGA 2A6XA 1DQ2A 3C3VA 1DQ0A 3KV4A 3W5MA 3T2QA 2VBBA 3I8TA 2WZEA 1SFPA 5FY9A 4P9WA 5A1LA 1ZRIA 3IPVA 4Q0UA 3OBZA 3RZKA 1TME2 1SLBA 4BCUA 3JD71 2Y60A 4NAMA 4MO3M 5C33A 1RUOA 3PUIA 4HXCA 2DBNA 4YARA 3FJSA 1BHGA 1RL3A 4Q0PA 4H3WA 2VECA 4AFBA 3WP6A 4Y33A 1HN1A 5KXDA 4SBVA 5FIXA 3WW4A 4PBOA 3NJYA 2BGOA 3U14A 5C8CB 4I0AA 1MZFA 1KJLA 2LRPA 4J6GA 5G04L 4GWJA 3LPGA 1BK0A 1D0GA 1N1YA 1R1A1 1HRV3 4H7LA 1UMHA 4Y4YA 3ME2A 2VOWA 4KWLA 1AR72 1LTEA 1VRH3 2VY0A 5IATA 5F3IA 1QWRA 4YW6A 4V2VA 1W8NA 2A75A 3PNAA 1WCKA 2Y33A 3BTXA 4I02A 1X36A 1E57A 2PHTA 2ZXQA 3KVBA 5FZEA 3VD5A 3AYCA 2RS51 4YG3A 1QDCA 1MZ6A 4B4RA 4YWAA 5F39A 1APNA 1X9PA 2R30A 1I5ZA 3JQWA 3ES1A 3LDKA 1ENQA 2D3PA 5LBEA 3FL7A 4OI2A 1XNBA 5K8SA 5BY5A 5CFCC 1D4M1 3GHNA 1ONAA 4UYBA 4Y1YA 4LHKA 1Q56A 2Q1MA 3IKWA 2HWF1 4BMEA 4CP0A 4E4ZA 1R091 5HXVA 3GZTB 2NMNA 2VUAA 1VBC2 1YQ2A 4LBMA 2WRAA 3GZUC 3ZYIB 1JTZX 1LOBA 2ARBA 3MO4A 3VZNA 1JYXA 1RUF1 4XJWA 4LJHA 4A2UA 3WDUA 5DPNA 1PIV3 4JHTA 1ND2C 3H3ZA 4L92A 5ACA2 4XDPA 1UCXA 5L7OA 4QKNA 1RUC1 5CNAA 1F31A 4DZGA 4LE4A 3F95A 3FFZA 3KLSA 5AVAA 1ZX5A 4LO7A 5C3QA 3M3EA 3VHRA 1BK1A 4AVTA 1UY4A 3SITA 2R071 3UGHA 1O7FA 2P3YA 3KT7A 2ZKNA 1W6MA 2CDOA 5ANNA 4JGZB 2FQPA 4CPBA 4N53B 4N43A 3MW2A 2HWE3 4QT6A 4K1ZA 1SDWA 1AXKA 1VMJA 5KXEA 4AI1A 5FO9B 4KH9A 3PU3A 4COUA 3WNOA 2VQTA 4M0HA 3VDAA 4CRQA 1O8PA 1NA1B 5FZ8A 2WNUA 5GZFA 4XF4A 5I8YA 5F5AA 1HX6A 5F3CA 1L7RA 4IE4A 1OUSA 4K8FA 4PLOA 4AVBA 3P1IA 2OYZA 4ATEA 1PGL2 4HMZA 2VNOA 4C8DA 1A6CA 1S0JA 1O91A 2IVJA 4UI9L 4CDXC 3B01A 2PA7A 3H1YA 3ITQA 3KGZA 2VUJA 1UY0A 2QZ3A 1QEXA 2EIGA 2YGLA 4YZ1A 1X82A 4K20A 4M00A 4ASLA 2JDPA 5I8SA 3KZ4C 2WT1A 3SCFA 4XCAA 3T1LA 2FDKA 2AEZA 4DY5A 4IV1C 4CDQB 1OVSA 1RUG2 1SG3A 1U5XA 4QHOA 4Y5Z0 4MLOA 1O3QA 3VN4A 1UYZA 2HWB3 1DHKB 1AYM2 1EPZA 4ITCA 4KG8A 2YXSA 4QX1A 5B2GB 1SBEA 2B5HA 3HT1A 4HPKA 3POGA 5BNPB 5I91A 2R061 3LDBA 3MI8A 5F8PA 2GNMA 4LPLA 1TG7A 4Y4RA 1VMFA 3K46A 4GXLA 1SMVA 1GWKA 3OCPA 3VBOB 3RI9A 3GDBA 5B4NA 3DGTA 3I3DA 5BNNB 2ZZJA 4KBBA 1XSQA 2DUQA 1NY71 4I2OA 4DB5A 3H3UA 2XWJB 5IK5A 5GLVA 3THCA 3OYWA 2R7EB 1HQWA 4QU1A 2DTYA 2HWC1 3U0ZA 4QXCA 2D93A 1MS5A 2RS11 1XBFA 1VIWB 1RUI2 3VZKA 3J8F3 3Q8BA 1H1AA 3GGLA 4P9JA 5FO7B 1HRI1 1VAKA 2XQRA 1VBA1 3PJQA 4G3YC 4RQPC 1F2NA 1PVC3 1JN2P 1S2KA 2PMWB 2RDRA 1REEA 2X5IB 3GALA 4PJYA 3KHCA 1Y9MA 3IWZA 1S0IA 5LWBA 1S0FA 2ZX3A 1DGLA 1W06A 3T4HB 1S2EA 3L9JT 3W59A 3TEXA 4DEVA 4LO8A 3FHQA 1ULFA 5C70A 2VZQA 1UNBA 4R9DA 4X8PA 4Y1XA 3LOBA 4U36A 3FLRA 1YC61 3VDDA 4DO0A 3CDZB 4LOTA 5IHRA 1SACA 1MQTA 2WN2A 2H6CA 4QPIA 3MIEA 2BNNA 3ASIA 4EZHA 4E4SA 2A3XA 2GU9A 3ACHA 4JKMA 1LOAA 1IQAA 2ZGLA 4IE7A 2W08A 4R9CA 4COYA 4YW2A 1ZRDA 2HYKA 2ZHNA 4BLJA 4QX5A 4OHZA 2EXIA 3RZHA 2ZHKA 4EN7B 5A7WA 5A3LA 5EJ1B 1PGW1 3ACFA 5D8AB 3H8RA 1YI7A 3AZWA 3LA2A 3RQ0A 4QQHA 1G6NA 1MS4A 1NCQA 3NKTA 4R9AA 1UX6A 3DCQA 3HN1A 3JD73 4XF9A 3GYDA 4OVEA 3MF9A 1AZDA 2ZTNA 3NMBA 1JYCA 3WF4A 5FP8A 5KWRA 1C5IA 2CNAA 3VBUA 5I0RA 5CKQA 4D69A 3V64A 3ZYFA 1SBFA 5IYYA 1AX1A 2BP6A 4OHVA 5FYSA 4XAEA 2XBO1 1W9SA 1SCSA 4WM7A 4BE3A 4XZPA 5LCWL 4OI4A 2X09A 4QPWA 4D6QA 4LHNA 3WV6A 2WFF3 1AR92 4CXXA 3O1OA 4CDUB 3C7GA 4PF5A 3LSDA 2UWCA 3K51A 5DUVA 1HN0A 3E5UA 1ND3A 4Q0QA 1V6IA 3I54A 3VUOA 1NOVA 1EAH2 3NJZA 2Z69A 2VCCA 1XE0A 4YVWA 4W65A 5T3NA 1RUJ1 3GCWA 1JZ4A 4AE2A 3IAPA 1YFWA 5E16A 4HKOA 5A70A 4CUBA 1H2NA 4RA0A 4RHV3 5BV6A 3T0DA 2VG9A 3FX3A 4N43C 2YG0A 3AKPA 2VZ3A 3AJZA 1KD7A 2JDZA 4IETA 4W6WA 3LIHA 2XDVA 4RYDA 2VOXA 1LRHA 3NW4A 3P5BA 1RUH2 1BEV1 1QJEA 1UYYA 3OSDA 4QD2A 1E5SA 5JIAA 3ZKYA 4BDVB 4FI9A 4I0BA 4CCJA 1LKNA 3R0RA 1GZ9A 4HN1A 4R4ZA 3WP5A 1ZZ8A 4BISA 3LCPA 3RDIA 5KHIA 3NNFA 4QPYA 2YMZA 4D6SA 4S2HA 5JUVA 5FY8A 3MFCA 2J1VA 5FZHA 3JUUA 5A7PA 4ONUA 1CPNA 1W6QB 3JU9A 1W8OA 3KHBA 3WHUA 3H3LA 4GA9A 3VBHC 4ATFA 1LNSA 4QX3A 3RWNA 1J3RA 2ZS6B 5JZGA 2LTNA 3WQ1A 3BKZA 2ZCWA 1C57A 1CZSA 4IW3A 1U0AA 1W3XA 3N35A 4B7EA 1QJX3 2W92A 3DXTA 3KV5A 3MV11 3ILNA 2TEPA 3MGUA 3DXUA 5C4WA 4BQ1A 1G7YA 1DGWX 2JE8A 2CHHA 2ADDA 1K5MB 1VR3A 5DXDA 4RS5B 2GC2A 2WNVA 3NNJA 4B1LA 4MHRA 2BQPA 1V6MA 1XSRA 3CL1A 2UYAA 1V9U3 2ZX1A 2UY8A 1W6OB 2XJPA 4QXBA 4QX2A 3WQ7A 2QE3A 4GZ9A 1RHI1 4Q8LA 1WW4A 3AYDA 3DYMA 4UBGA 4CYDA 1GNZA 3SH5A 2WYSA 1VALA 1TMF1 2QVSB 2ZJCA 1EY2A 1YIPA 1R082 1ZZ7A 2VM9A 2P6CA 1ZZCA 1YNAA 3U4XA 1EV12 1W03A 2QNKA 1WCDJ 3LEIA 5FZGA 4YYOA 1UU4A 3LEGA 3TNQA 3ZPOA 4LITA 2PHUA 1REFA 3T2TA 4BXFA 4AHYA 4C0BA 1ASJ2 4MXWA 1Z0HA 2GN7A 3TWIA 5LBFA 3RS6A 3BCWA 4Z2WA 2WWSA 3N7MA 3ALQA 3N9PA 4UFJA 1D2QA 5FYYA 5LA9A 4B3NA 1JW6A 1XNAA 3UKVA 1LECA 3LB9A 3LOIA 3PIJA 3WDXA 3MIDA 3OPZA 5DG1A 1CWPA 4GH4A 3WUDA 4G9SB 5LY2A 3CO2A 1BMV1 2ZX0A 2JDNA 1LOEA 2Q4SA 5JOXA 4Q1RA 1QDOA 1RUC2 3BU7A 1WW6A 2VZRA 3IDCB 1ZBA2 4JAAA 4QPIC 3L2YA 2X05A 1JI6A 2HYXA 5KBFA 2EXJA 2WWJA 1R64A 3M8LA 4O65A 5FMDA 4P02B 1RIRA 3NKGA 1PX4A 2VD7A 4Q29A 5FZ0A 1UY2A 2MNGA 3R4UA 4GWMA 2YBKA 4FOQA 1TME1 3BODA 3MIFA 3N7LA 4CP1A 2HWC3 1TNRA 5F5QA 1O3SA 2G1MA 2ZKLA 1WCQA 3MLLA 2P2KA 3UKTA 1YQ8A 4IUGA 2XMLA 3NO8A 4HVOA 2W0XA 4Q4X3 1NCQC 1OQ1A 5A6XA 2WZPP 5C8WA 3JXSA 3VL8A 4JGYA 4NIHA 4A7ZA 3PL0A 2HH9A 2CGPA 4EROA 5LZ6A 2HEWF 4MGKE 3B9IA 5I0SA 1OH4A 3VBUC 4I09A 1PHMA 1N47A 1AL0G 2LROA 2WO7A 3ZSEA 4PIXA 2AACA 4AYUA 2ZGOA 1AR71 2CWMA 1X9TA 2IXJA 2P5BA 5EYYA 5JI9A 2PAEA 1Y9QA 4OHWA 2Y8KA 4WM7C 3SLIA 1V6KA 2VQAA 1E5RA 5IVCA 3I7DA 4KBZA 5A3UA 2C0ZA 4UFHA 2GAUA 3HNBM 1VB4A 2WS92 2D6NA 3H1WA 4IGPA 5FY4A 1GICA 1ND3C 4LBOA 2R16A 4QXKA 3EHKA 3D5OA 3PDQA 4PDWA 1MVQA 3USUA 4O7XA 4IEUA 3RYRA 3T08A 1ULPA 2WT2A 1J3PA 4MYEA 3IDBB 4DUXA 3ACIA 1JMUB 5FV3A 1IPKA 4CSWA 4NJ4A 2P3KA 3ZIXA 5AC92 1RUE2 1BCXA 2V72A 2VZPA 1VBC1 4BQ5A 4BQ2A 2RHPA 4AEDA 2Y0OA 2W46A 3DEMA 4QHZA 3CZJA 1A8MA 4ZXKA 5K0UA 4RL7A 1YEWA 1W04A 3LKJA 2VL4A 4HFSA 2GC1A 4YW5A 5ACA1 2W5FA 1AR62 1C5HA 2OQ7A 3G7DA 5F2SA 1D7PM 5JR2A 2YGMA 4LORA 3TEYA 1OA2A 3KS7A 2JG8A 1MZ5A 2F17A 5EYXA 2WABA 2NM1A 2NN8A 5ANQA 4Y22B 3LEMA 3U10A 2J1UA 5CBLA 3RMXA 4CEYA 2Q30A 4Y20A 4GB32 2W91A 3MEPA 1DZQA 1JHNA 1JOBA 2RDSA 1UN1A 3IB3A 3POJA 3VBSB 2AUYA 3K3NA 1QF3A 2AZ5A 3FBYA 4EWEA 5BNQA 2A6YA 2W1SA 3RJ2X 5C4WC 4JKKA 4NHKA 4P9XA 5A3PA 2VZOA 3B69A 5ISLA 2P4EA 5GLZA 1AR83 3K77A 5J98B 3CJIA 2DCJA 3B9CA 4M3CE 2RG4A 4RN5A 1PGL1 3ILFA 1K12A 5DUUA 2V09A 2OPKA 2XLFA 1WD3A 2N7GA 1KITA 1G9DA 4QB6A 3ZXJA 1MACA 3HWJA 3IIIA 4AEJA 2ET7A 1NZCA 2PXJA 1S4CA 3M4FA 4GMP1 4Z2AA 4UW4A 4NIAA 5FZAA 3AVSA 3VBRB 3A21A 2R041 1UYPA 3FBMA 3TNPB 5JOWA 3V65A 4K8RB 1PZ8A 1QJU3 2PHLA 5L73A 4O61A 2YC4A 4ZZ5A 2GC0A 1C1LA 3IDAA 5FYIA 1RUG1 5HCHA 4FPKA 5T5LA 3S7IA 1GZTA 2RM22 4FSJA 4LIUA 4CCNA 1CPMA 3WOGA 1UMZA 2WNOA 4CP9A 4ISQA 4IE5A 4YVSC 1IHMA 5JOZA 3D6EA 3VDBA 4TLGA 5KC6A 4FOWA 1YYNA 5BNOC 3ZIWA 5C71A 4GMP0 1T6BX 2E9QA 5CU1A 2BERA 1C4RA 5A1AA 2H0VA 3H0OA 1OPMA 2FDJA 1CAWA 5GLTA 4MXVA 1JZ8A 4Y3OA 3AMMA 4OI0A 3ZSKA 1CN1A 3I2IA 2WDBA 4LA3A 4QGNA 1BBT2 1ZRRA 4CCCA 2DUPA 4C90A 1COV3 3WX5A 1RUI1 1FPN2 3NV1A 3KD4A 2O14A 3K2OA 2YBSA 4CDWB 4PIYA 1RINA 3O1SA 2UYBA 3U75A 1RVF3 1Y4WA 3VHPA 1UY3A 3UV9A 5LB6A 4N90A 2IFWA 3LGRA 5C9AA 1C28A 3RZLA 2QCSB 4XUQA 1UOGA 5IWFA 4P14A 4WVWA 5C3OA 2ARCA 4GAZA 4H7MA 5T54A 2PFWA 1CQ9A 2O0OA 3JBG3 5EJ3A 3VD7A 3VGIA 4L2NA 3B5LB 2XJRA 3D3AA 4OUMA 4QQOA 1MPXA 3D82A 4UT5A 2D5HA 3ZXFA 5CFCB 1AX0A 3BYWA 4DXTA 1LOGA 2IXCA 3D8CA 4F3JA 4PLNA 5A3NA 4JGYC 1UKGA 3MIBA 1QJY2 4ZONA 1AXYA 1VBE3 1KS5A 2YU1A 2BYVE 4Z8BA 1OKQA 2Z4FA 5FP7A 5FMCA 3BPSA 3KMHA 1PK6B 1YJLA 3OJBA 1ZYBA 2W1WA 1CAXA 4HBNA 4R8HA 3ZN6B 4RD7A 4CU8A 4CU7A 3B7MA 1CAUB 3H42B 1AXZA 1IKPA 4IEVA 3VD3A 4D8MA 4HZFA 4XQWA 3ETPA 2QQKA 3O5SA 4AGVA 4LBJA 2VOVA 2OXBA 2RMU3 4UWDA 3S57A 1Z7S1 1W28A 4BK4A 3H8XA 4XETA 1JU3A 4HOOA 4E2GA 1CX1A 3POEA 1NXMA 5HI0A 4PDWC 5JXIA 2HWD2 4JV4A 1MVEA 1VLNA 1XOYA 5A33B 3CBNA 2V73A 1UPIA 2KA3A 2EF6A 3FE5A 2RV9A 3PUSA 5LK7B 1W8TA 2FZ2A 3HMYA 3O0VA 3SKJE 3OEAA 4FPOB 2VUDA 2Z5WA 2VW2A 1HJGA 5A7OA 5FUIA 1DGRN 3HAGA 4W6XA 3WF2A 4XE9A 5FDBA 5GZCA 3VZOA 1VP6A 4AEDC 1OI6A 5FYCA 5K0UC 3PJYA 3VLBB 4CDXB 4GJZA 2C4XA 3A0NA 2JDMA 1EAH1 1F4AA 1HXS3 1UXZA 3VV1A 4ARXA 5I0TA 2XUMA 4E4DX 2JG8C 3WW1A 1W6PB 4DRVA 2A5ZA 4W4ZA 5ABJB 2FMDA 3H7JA 1NG0A 2VXJA 3I3EA 1DIWA 5ERLA 3NNMA 2K0GA 1XNCA 2P17A 1NXD1 4CEYC 2HBUA 2VMCA 3OY8A 1J84A 3BIEA 4IV1B 2OT7A 3CIHA 1RUH1 5FUNA 1SLAA 1ULDA 2XVGA 4A3XA 5JDBA 4IE0A 1BVP1 1GOGA 3KQ4B 5CFDB 5EQUA 4HG6B 4HK8A 4NN0A 5L9BA 5JXHA 2Z79A 4BA6A 3B94A 2DCKA 3KCYA 3ZO0B 1H6YA 3MUZ1 1NT0A 4XMIA 4YG6A 2ZBJA 1JYTA 4Q4W2 3UKNA 1VBB3 4FFFA 4IE6A 4KGQA 4AHXA 1GZWB 2ZX4A 4HONA 1SCRA 1GP4A 1OQEA 3C7HA 1YHFA 4JQTA 2D97A 4JKLA 3VL9A 3OPTA 4DEQA 4FCAA 3TEZA 2JB4A 3CZUA 3T0BA 3J9SA 4QU2A 3ZSLA 3WP4A 1B35B 1GOFA 2Z2SB 2VCMA 2GH8A 3AYAA 3IPVB 4QKDA 2Y38A 4RQPB 4TXWA 5C8CA 4LO4B 5IFTA 2HBTA 1NQDA 3PMSA 1GNYA 1YQ5A 4QM8A 2XHKA 4DS0A 1SLLA 2B46X 2QJVA 4S2DA 3THDA 2C9AA 2J42A 2RJ2A 2V4AA 2VVEA 3MYXA 1BLZA 4GULA 3TN93 3URFA 3ZR6A 4OQ8A 4DINB 2WNEA 4QB2A 4CUAA 3K3OA 2LM3A 2LALA 3BOWA 4XTPA 4P9GA 5D21A 4Q8KA 2DVAA 1XU1A 4FPFA 1R081 4COWA 3VZMA 1EYBA 1V6NA 1PO23 4OYUA 1EV11 3WD5A 2W52A 5DDJ2 2YROA 4XC9A 5GKAC 5J1XA 5GLWA 2ZMKA 3ETQA 3AVRA 4AFCA 4EN0A 3HIFA 1ASJ1 1RC6A 1BQPA 3IMNA 2QQVA 3K4DA 2BNOA 5AVPA 4XABA 3J4UH 5FYUA 2Y34A 4Q4Y2 2E6VA 4BHPA 2BVBA 3C8XA 2VZ1A 2I45A 4YW3A 3ZSMA 1L3JA 3GZAA 1AYM3 1TE1B 3UNPA 1JXNA 4CU6A 5JVVA 2F6BA 2E7QA 1H4HA 1TZOA 3MICA 4AAPA 5D1IA 1ZBA1 3N7JA 1PZ7A 2DU0A 2TBVA 3OOXA 4CPBD 2W39A 3PVBB 3TBDA 2LW8A 4X6QB 4COVA 5H9RA 2YBPA 3O12A 2LS6A 4BQYA 2JDAA 1MEC3 4BM8A 2PAMA 4TYSA 4JGZA 3GBWA 5FZBA 4N53A 1DQ6A 2HEVF 1GKBA 2E31A 2QQOA 1DZTA 2ZGKA 3WZ1A 4B1MA 3DL3A 5A3OA 3WNXA 3IBMA 5E1RA 2EAKA 3SHRA 1IPJA 5JXGA 5C3RA 1V6LA 2E7AA 1NA1A 2V4VA 3IT8A 3AXEA 4XFAA 3ZFFC 2BW8A 4XQ4A 4AWDA 2JDUA 1LHVA 4NOTA 3A7QA 4NE9A 3J7LA 4NHLA 5F6KA 5IVYA 4CXYA 3THTA 3O0XA 3ZKUA 4QKBA 4FP2A 3KCCA 1OD3A 5FWEA 4BIFA 3MV01 2R49A 3ZSJA 4FBFA 3BOPA 1O6UA 4LUMA 1RB8G 2WWUA 1WMDA 2CAVA 1LHUA 4A42A 4L0PA 1CGPA 3WDVA 1HRV2 2R042 3ZXKA 1UD1A 3QBQA 4LA2A 4N9HA 3WXPA 2VH9A 1FXZA 1VRH2 4RGGA 2UURA 2WS91 1J1TA 3RPQA 2G9FA 2VPVA 4LR4A 3ZXGA 2JICA 2XGXA 3PMEA 3ZYRA 4Q4V3 1NCRC 2MPFA 4XHXA 4CCLA 3AB0A 4AVCA 4B4PA 3VBHB 1W9TA 5AFEA 1S2BA 3B3QE 3MIHA 3EYPA 3ZVXA 2OW4A 2WO2A 2ZEYA 4YW1A 5BNPA 2DFBA 3IAQA 1LU2A 2B42B 1IPSA 4I3GA 5AC91 1AYN2 1GP5A 1RUE1 3TB0A 3VBOA 1P8JA 1WKYA 3LQCA 5FMBA 3K48A 3LA7A 3RRDA 4BWOA 1BKZA 2ERFA 2XWBB 4ZZ8A 2C1FA 4QM9A 1VBD3 3BB6A 1AR61 2NYYA 2C5DA 4NIGA 5IVJA 2MHFA 3S5QA 4LT5A 4YGEA 1AJOA 1OXCA 2IXLA 3AXDA 1PIV2 4WVZA 5A6ZA 2UY9A 5FY7A 1AR93 3BGAA 2XB6C 5LATA 1W8ZA 1US2A 2J22A 4JQRA 5A80A 1HKDA 2PLV2 3H8UA 2X5IA 4P9LA 3PTRB 2XR4A 1EAH3 2PTMA 4LHSA 5L9VA 4GB31 1S0EA 2WO3A 3FFQA 3BIWE 4LO6B 3U78A 4K40A 1TQ5A 3J26N 3NJXA 4BH9A 5GZGA 2XVKA 3EO6A 3MDPA 4IEOA 2ZGUA 4FT8A 4FTEA 3LWCA 4A44A 3RWKX 4E27A 4JRAA 2ID4A 4BYYA 3EJKA 5JPNB 3H50A 1C8M2 4BZ4A 2VW1A 1G9CA 4CCOA 3ZMNA 2UU8A 2FBEA 5A3MA 2GC3A 2JX9A 4Z1VA 3MUY1 5KHJA 5IVEA 4WBBA 4WM8B 4NRMA 3HEIA 1DLLA 1RUH3 4MGSA 4PHZA 1N3PA 1A3KA 1RYYA 2XJQA 2CTVA 3AK0A 1HQNA 2JWPA 4TWTA 4X6RB 1OLME 2WZR2 1SPPB 4I0WB 2RJKA 2ZMNA 4KG0A 1MS9A 3OB8A 2DUOA 2B7YA 2WUHA 3PIGA 5CVRA 2BPA2 4ET7A 3ZLIA 5IFPA 4EN6B 5IK7A 3B02A 4NUBA 4QPIB 5D8AA 2YC0A 5EIYB 2JDKA 5J7MA 1Z7S2 5J48A 1SLIA 3M3CA 4RFRB 4META 5E88A 3BTYA 4LHLA 3RZMA 1CESA 2QQPA 3WG1A 2RM21 5DAXA 2MEV2 5FZ7A 4FOVA 2Y0IA 4FO9A 4E8DA 5I0UA 2Q8OA 1URXA 4BB3A 1QXRA 5A7WB 4MUVA 4C1XA 2YHJA 4QPGB 2HWB2 4XIKA 3POIA 2VULA 1NCQB 4GWIA 4XYXA 4AGRA 2J1TA 2DVDA 4B7KA 3NAPA 1R1A3 4QHBA 1FOD2 3E1F1 4XFGA 4CDUA 1W3VA 4V1PA 3W20A 4LBKA 1KEXA 4DNYA 4IEYA 5L7OC 1RXGA 2PYTA 2GZWA 2Y64A 3MW4A 1BBT1 2PHDA 4XXPA 5FZ1A 1OFSA 3ZMOA 1FPN1 5IUQA 3NNLA 4MSVA 1YJKA 2W47A 4MVTA 4OI1A 3ST7A 5HBAA 1M06G 4KGGA 1DQ1A 1WWYA 2RS53 4YRDA 1OHFA 1YFYA 5FWJA 1DLCA 1R083 1DQ5A 1RMU2 4UW6A 3J8F2 1UQXA 2A71A 1NZIA 2A3YA 2CU5A 2RDNA 2J1RA 4I30A 4L8QA 4N53C 2Q8CA 3T2PA 1HIXA 4CU9A 2OVUA 3LZZA 3PHMA 1D4M3 2HLEA 4URAA 2JJ6A 1ND3B 2JECA 2BNMA 4QDSA 2WNUC 4YM1A 4YM2A 4FTBA 2VZSA 1GQPA 2BRTA 1CAVB 2HWF3 1LU1A 3B00A 4NPMA 1XC6A 2ZGSA 4PCRA 3ZDVA 4GJYA 2EXHA 1R093 1W9WA 1QJY1 4E2QA 1AL21 2P1BA 4MOAA 1DFQA 1RUF3 1ZRFA 4YGCA 3DN7A 1QY4A 4YW7A 4NVPA 3N9LA 1F5FA 2VMHA 3HQRA 1RUC3 4XW3A 3OBRA 3LFIA 2RVAA 3EB7A 4YFWA 3SCHA 1DGWA 2R1DA 4LMFA 2NMOA 4XHBA 2XJUA 4Y5SA 3V56A 3VB9A 2R073 4FFHA 3U11A 2E32A 3ENRA 5L9RA 1HDKA 2E26A 1SLCA 2JIJA 4OULA 2A73B 4IESA 4JDOA 3WNPA 3VZLA 3RZGA 1MS8A 1SQ4A 1WLCA 4H55A 4IGQA 4B8EA 5F7UA 2HWD1 3I2JA 1SEFA 2I07B 4MGZE 3K4AA 3PVOA 2OS2A 4DIQA 1K5MA 4OFGA 2BTVC 4RS5A 1FX5A 5GLUA 1GOHA 2X53S 4K1YA 4FQ4A 4OLLA 4XFIA 1LB2A 4CA9A 4Q26A 1JBCA 1OOPA 2CWSA 3WQBA 3O1TA 3AP5A 3WDWA 4Y1ZA 1R1ZA 1UYXA 1G8WA 3VBOC 5C4WB 1IS5A 3AM2A 3NSTA 4AR2A 4UF0B 4EV0A 4EJRA 4F83A 5FPVA 3NV4A 4DOUA 3FWEA 1RGSA 1H2KA 2W1UA 4CUCA 3N9QA 2WFF2 3OUIA 2LUWA 5EZWA 3WCSA 3MPBA 1JS9A 1Q8VA 3V0BB 2W9XA 5F5CA 3UYJA 5C7GA 1NAEA 2DDUA 2GH2A 1OLRA 2W94A 3C7OA 1WD4A 5M0TA 1OMIA 2X5IC 4MV2A 1HB1A 1H8TB 2JD9A 4ZU4A 2VU9A 4LTAA 3SQOA 1A8DA 4L97A 1PO12 3UGGA 2OIIA 2ORXA 4NIDA 5CG9A 4RHV2 1ZZBA 3AMHA 2GP3A 3T30A 5K9YA 3VDDC 3MFAA 1I6XA 3WINE 2R063 4XUOA 4A45A 1V0AA 1MQTC 3HPNA 3RYPA 4YVSB 3KV9A 5DZEA 5LASA 1Y43B 1LESA 1RUE3 1UOJA 1UZWA 1V6OA 3KCXA 3S7EA 4Q4W1 5FO8B 2TNFA 1GMMA 5BNOB 1LEMA 3TAYA 4ZPIA 1GSLA 2DVGA 1SLTA 4TZDA 5C3PA 3O1UA 2C26A 1NE6A 1AR63 3DECA 3LPFA 2BWCA 4AFMA 2RS13 5BYNA 3SEEA 2JG9B 4NWWA 1HRI3 1QNWA 2AC1A 1VBA3 3M3IA 4AQTA 5C5TA 5D8AC 5JCTA 1OF4A 1W39A 3Q8AA 2BZDA 1S0DA 2W68A 4Y1UA 4O9EA 1LGNA 2QKDA 4TSVA 4LXLA 1QJX2 4XJUA 4CEWA 4GB33 3SNMA 1ODNA 1X7NA 2WSVA 1KFUL 2JEMA 3KGLA 1QJZA 1UOBA 3I2GA 5LRRA 1QKQA 2FCVA 3OBTA 4HLTA 4FPYA 2P37A 3ZFEA 1RUD2 2A6VA 2WQ4A 3CKHA 4MX3A 1PX3A 2B9VA 3ZOIA 1V9U2 4NRPA 3NAPC 1QIQA 5HPOA 4FXKB 1IS3A 1RTVA 2YC2A 5FY5A 3OBAA 5FP9A 4QQPA 3W9AA 3VKMA 5IVVA 1JHJA 1OA4A 4LE3A 2WAOA 1W8HA 2D6LX 1NYWA 1YXWA 4IDZA 2BU9A 1S0CA 5DDJ1 4YVWC 4W8JA 2QDNA 1YCIA 2AR6A 1AJKA 1ZM1A 2GN3A 3LA3A 2BFUS 2VW0A 2P34A 1H1IA 4QGLA 2G9ZA 1ALYA 1QQP2 1WMFA 3E6DA 1NKGA 5FZCA 5IAVA 1XNTA 4LIVA 4Q4Y1 4RR3B 2D3SA 4NMIA 5FKCA 1WA6X 1LHOA 4UBHA 5T55A 3ZN4A 1XE7A 5FZ6A 5FTTC 1QJFA 1W2NA 1ZRCA 4PBPA 1N1TA 5HV4A 1BVVA 1XXNA 3FLTA 4ZKTB 2FCUA 2D43A 4XUNA 5HV0A 1FATA 4M0NA 4A6SA 5HXMA 1GANA 2XBO3 2BOIA 2K46A 2SBAA 2QQNA 5FPBA 2J1AA 3UJOA 1FV3A 3F2ZA 4D94A 2HJIA 2ET1A 5C3SA 1D0HA 1O4YA 1H4GA 3GHMA 5FZOB 4Q2FA 5LBCA 4J1XA 3J7MA 5JSPA 3DUIA 4IL7A 5IK8A 4OMCA 1OQDA 3DYPA 1UPSA 2WA3A 5FZ4A 4D7YA 3WNLA 1DU3D 1ZZ9A 4Y22A 3VBFB 4AEDB 3H9AA 2XH6A 4GQ7A 5JZGC 1BBT3 2YZ4A 1O59A 1IZ3A 1FPN3 4W6YA 3I59B 1LEDA 5F1RA 5JIUA 1RUJ3 3O1RA 3O0WA 1Z78A 4M3CA 3ZYHA 4LBNA 3VBSA 4QXHA 5FQ0B 1JZ5A 3KVAA 2RS32 2D98A 3M70A 4CCKA 1OFNA 2OA2A 1NE4A 1WCSA 2EIEA 3HOBA 5EWSA 4AL9A 4Z92B 2ES3A 2P3IA 3DPRA 4Q4X2 2J7MA 4XFHA 2WNVC 2A7AA 4FPCA 1WW5A 3MLJA 1BEV3 1KFXL 5DAQA 3KT1A 3WW2A 4WVMA 4CEYB 4D0QA 1FAYA 2C24A 1OOPC 3UL2A 1OBNA 1QH7A 1RUNA 3CF6E 1U12A 2WA4A 4FPHA 3ZX7A 1HRV1 5FZDA 3TRSB 3ZYPA 3VBRA 1VRH1 1V70A 3JZVA 4P9IA 4LKDA 3FN9A 1POQA 2DFCA 3AP7A 3ZXDA 2ENRA 1HW5A 2EA7A 1ACCA 3QLQA 3AFKA 4BQ3A 3MF6A 2YV8A 4RGKA 3WR0A 4EN9B 5CA6A 1J59A 3MW3A 2Q5TA 3QH6A 3KQRA 5LRSA 2YPDA 3BALA 1CONA 4Q0SA 4UW5A 5I93A 1I3HA 1ZBE2 2VNRA 3DYOA 4M4PA 4S2FA 1O3RA 4KQ7A 2QBXA 2QQJA 2D40A 2AEYA 1AYN1 3DV8A 4MHUA 4RGAA 1GWLA 3AZVA 4D3WA 5FY0A 1B09A 4E9KA 4GH4C 5FOJB 4F7ZA 1CZTA 1OUXA 2ZACA 3GJAA 2VAUA 3OPWA 4N7UA 4OHYA 3CJXA 4KU7A 5EJZB 2QQIA 1UOFA 2FMYA 5LA2A 1CIWA 1RHI3 2JE9A 1KDMA 2ORZA 2XLAA 4UXAA 5JAXA 1W8WA 2YU2A 1JH5A 2VUCA 3AL5A 1LHWA 3IM0A 4FOYA 4XZUG 1PIV1 3ZFGA 2QQWA 4XJ9A 5IVBA 1TMF3 2VO5A 3FUQA 2WQZC 1H9PA 4CDWA 1ZVFA 1ZZ6A 2PLV1 4K3UA 3LE0A 3N9NA 4DUWA 4YG0A 2IXKA 4INDA 1Y9GA 3A23A 3RYKA 4AXOA 1UY1A 4GALA 5FZKA 5G05L 1JODA 5CYYA 1JOPA 4JDMA 2YFUA 5CIRA 1PGSA 1WA4A 4XFBA 3ACLA 4U2AA 1XYNA 2VR4A 4IV3A 5CFCA 2BFUL 4UOJA 2VVFA 4RSUA 1LCLA 1C8M1 3USSA 4Q1PA 4CEWC 4A3ZA 1AL22 1WW7A 2CAUA 4FTSA 1A78A 1O5LA 4YFZA 3V0AB 4JZRA 3DKQA 5FPLA 4UFLA 1AR82 1PK6A 1W6NB 1T2XA 3IZOA 5FZ3A 1XQNA 2WZR1 5A32B 1LULA 2NLRA 3ZFEC 1SHWB 2IUWA 3ZN6A 2FDGA 2XOMA 1CAUA 4WZFA 1ND2B 2R6QA 2BBVA 5FZLA 3QACA 5CKNA 3E6CC 3O14A 1GR3A 1TME3 2D6MA 3OGVA 3CU7A 2ZGMA 3AKSA 5EHDA 3WF3A 1F4HA 1YO8A 1FMD2 4BQ4A 4D7TA 1QU0A 4GIQA 1NX9A 4LBQD 4Z82A 5FOBB 3VKLA 3WY6A 2IFRA 1H9WA 3E5QA 1SDDB 2WQ8A 2WZ8A 2MEV1 4IEQA 3NRUA 2O8QA 4KWJA 4XXAA 3VKOA 2AREA 3M1HA 5FXVA 2D7FA 4XURA 1UZVA 5HCFA 1XE8A 5A33A 3T2OA 2FDFA 3OGJA 4BJ0A 2HWB1 3W21A 5FFOC 3LFMA 4XQDA 4PLMA 3GCXA 4BQXA 1UKRA 5FZIA 3ZFFB 1VAMA 4K9SA 3WNKA 2VZVA 4RFT0 4DPNA 3ES4A 3ZDSA 4E4HA 4ZS2A 1UIKA 3IIAA 5JXJA 1FOD1 2DVBA 3R05A 3I2OA 5KHKA 1AR73 3POYA 4QB1A 1ENXA 3THPA 4CDXA 1Y3TA 1FNYA 4OQ9A 1LOFA 4HETA 5JMOA 4LBQB 1HV0A 2D6OX 3GBGA 3JCIA 2WL1A 4FP3A 2WFPA 1W6PA 1WBLA 5FK7A 4BOWA 2BGPA 3WP3A 2BOJA 3LF7A 1RMU1 4LBLA 1COV2 2PHXA 1I9RA 2Y6FA 3J8F1 3P3PA 2XLGA 1NLRA 4KNCA 5ABJA 5A7QA 1UW8A 4OUEA 2WINB 3GJBA 4PQ9A 3H8OA 1EUUA 2JDYA 2SLIA 5CAZA 1NCRB 4IV1A 1XU2A 3E6BA 5JOYA 3KT4A 1IOAA 5J96B 2WYFA 3I2DA 1OURA 1Q8QA 4MGTA 3AL6A 3JBG2 1W0OA 4Q4Y3 5CFDA 4HN0A 4LULA 3CJIC 1D2SA 3HNYM 2ZOEB 1VBC3 1FYUA 3DPRC 5A7NA 3WVJA 5JLVA 1OF3A 4XF3A 3ELNA 3FHAA 2YPJA 4NHXA 4YZ4A 4YGBA 1WZXA 2IZWA 2FDHA 5ACA3 1GZWA 3Q8FA 1ZA7A 1TEIA 4XEZA 1W9FA 4LK7A 5F3GA 3AP4A 4IXLA 4B29A 1JYVA 1QOTA 1CD3G 2XJVA 4FFIA 4I01A 4MADA 4ES8A 4NWVA 5FPXA 2W2IA 2DTWA 3KF5A 5DG2A 1N1VA 5A6QA 3PUHA 1UIJA 4XJZA 4AI8A 5CG8A 1B35A 5C5UA 2XJTA 4RQPA 4P5HA 2J1SA 2RMU2 4XFFA 4YGDA 5E89A 1RJ8A 2I74A 1JYWA 2RR12 2Y6GA 4AHZA 4SLIA 2AGSA 3D4KA 4PF1A 3KWVA 5FXZA 4H2AA 2XKOA 5KR7A 4NHYA 5FP4A 3OGGA 3FHIB 2CYFA 5FBJA 1LGBA 3HJRA 5FYBA 4NHMA 1H2LA 2GSYA 4EN8B 3K4ZA 4DFSA 3PURA 4Q0VA 1SBDA 3NL1A 4XFCA 2A3WA 5BUVA 1W0PA 3L2HA 4GMP3 1UZ0A 1IGOA 2WFF1 1OKOA 2XL9A 2CSGA 2R043 2ZGPA 2VBDA 4IQPA 5K4LA 4AQSA 3ZFGC 5TSWA 4TTGA 3OG2A 4QWNA 2QTWB 3EXUA 1HXS2 4CDWC 4YSFA 3VKNA 2YY1A 5H9SA 1ULOA 5FJHA 1RUG3 3AZZA 5C9AC 1G86A 2PN5A 2WR9A 5A1FA 1YLLA 2RDQA 3O1PA 1PO11 1LENA 4BK5A 4DQAA 1CZVA 1LGCA 4RHV1 5FPAA 3RG0A 1MZEA 1EP0A 4HT1T 1U5ZA 3BUCA 5K7PA 3ZYGA 1U5IA 1W2TA 1WBFA 1J83A 5F2WA 1IS6A 4QKFA 3N9MA 3RZJA 1IS4A 4IV3C 1JU4A 4NPLA 3Q8EA 5L36A 1AYN3 2FHRA 2A70A 1X8EA 3QOPA 3SC7X 1JYNA 3VZJA 1GUIA 5F5IA 2ZGTA 3X29B 3ACGA 4ZY9A 2Q1FA 2E33A 4HVQA 3NV2A 3R6SA 1PK6C 2H0BA 3OD0A 5FK8A 2NZ9A 2WC2A 2ZMLA 3ABZA 3IDEA 4WV8A 5FP3A 3BU0A 4A41A 3U07A 1RUI3 1VBB2 1DYOA 2W1QA 4L11A 4MGIE 4N9IA 5L7OB 2VCAA 4F8AA 3GNEA 1W2UA 1ZA4A 2XHNA 4LQRA 1ZREA 3LIGA 1HV1A 2K9ZA 3AKRA 4ES9A 4I3PA 1CX4A 2PLV3 3LEKA 4FAGA 1CIYA 2KM2A 2KD7A 1Y7BA 4KL1A 1QJX1 3PVEA 1Q8PA 1W6MB 2R0HA 4N43B 1UXXX 2WJSA 3RZZA 3PU8A 3MIGA 1YQCA 2BGCA 2YB7A 3FC0A 3WG3A 1BXHA 2GALA 5CKMA 1UZYA 3OUJA 2D3RA 3OD4A 4AAXA 1RUD1 2WSUA 4YM0A 2WNUB 1C8M3 4D6RA 1W90A 3I2HA 1V9U1 3TN92 5EXOA 2WLPA 1IKQA 3A0KA 4OHXA 3S0MA 4CXWA 3BTAA 2VC9A 5D2AA 5DUWA 4BLIA 4CDQA 2BV4A 1IG0A 4J25A 1NLSA 4Y5TA 2WZR3 3ZXLA 1LOFC 2KXLA 4OZXA 2Z42A 2VMEA 4C91A 1F8VA 4V2WA 3VBHA 1PO22 5IAXA 4GWNA 2HEYF 2E51A 1Z7S3 4NPRA 2VMDA 1QQP1 1TVGA 2GNDA 3QH7A 4JHZA 1TNFA 1CJPA 3MBWA 1LOCA 3FMGA 5ABJC 3ZN5A 1JYIA 4CCDA 4ZXEA 5BNNA 1DP0A 3ZR5A 2PHRA 5FYZA 2MEV3 3HR9A 4AI3A 1QXJA 1H30A 2ZZQA 5H9QA 1EUTA 1ULEA 2FDIA 3E97A 1JZ6A 3WDYA 2O1QA 4HPKB 4K7JA 3WLUA 1AUYA 5CFDC 1HB2A 2ADEA 4XDOA 2EICA 3PTYA 1IQDC 2JXAA 5LEKA 1C3HA 2VOTA 5T5PA 4XDQA 2TUNA 2WT0A 2X10A 1DGRA 1FOD3 3BI3A 1OA3A 5GZEA 1ENSA 1W9YA 1RJ7A 4KWUA 2ZPXA 3UJQA 3VHOA 5IVFA 3OYWB 1S0GA 5J09A 2PHFA 3D0SA 4JC1A 1UU5A 2DURA 2B39A 1J1LA 1MEC2 4L9BA 4CCEA 4BXSV 1X8MA 2GMMA 2HWE2 3AKQA 3C7FA 3WSOA 4YZ5A 4M01A 2R32A 4GD4A 1RMU3 2XONA 2RS31 5C8CC 2PHWA 1B35C 1MS1A 3GXUA 3T3YA 1OLMA 1LAJA 4Q4X1 2ARAA 4EE2A 4AI0A 1OD5A 2JD4A 2DVFA 1BYHA 5DZGA 2B45X 5B4XA 4WM8A 2E7TA 2H6BA 2BBAA 2FZ1A 3Q9OA 2BUKA 5T5JA 3VD9A 4P9YA 3N3HA 1QOOA 5CEHA 3N36A 2R0FA 2E53A 3VDDB 1C1FA 3HN3A 1SPPA 1N3QA 1WLWA 1MQTB 3WCRA 2ZAAA 4JRLA 5SV8A 1ODMA 2G19A 4WZCA 3N9OA 3CMGA 1H6XA 5AFBA 4PQQA 4QX0A 3ZXAC 4CP9B 4LK6A 4LKSA 3K75B 4XUPA 4KI5M 5DQ0A 2OUJA 2ZX2A 2UWBA 1XYPA 3PLQA 1JZ2A 4D7SA 4HKLA 4MG2A 1POV1 2Q0AA 4CUGA 4IEWA 1YUDA 4LEJA 1ULCA 1KS4A 3POSA 4KU8A 3SMHA 4Q4V2 4CTEA 1DDLA 4AOCA 1OPOA 3ZM8A 1ZBE1 2IWGB 5CISA 1CVNA 4MH0E 4HSLA 4QPGA 4AVSA 4FVVA 4XMAA 5CADA 5FZMA 3PUAA 2JKBA 3KB5A 3BN6A 5FPUA 3RMYA 4QDQA 1O8SA 3WHTA 1KXGA 4XCBA 1DYPA 2VQ0A 2D6PA 2OX0A 2FD8A 1NLQA 3VBUB 2P6HA 4S2GA 3HVDA 2Y26A 4DRRA 4XAAA 2GNBA 4UFIA 1U5YA 1VBD2 3JB4C 5DAWA 3SEPA 1POV0 4AEKA 4NAOA 4WM7B 3ROUA 4B4QA 1X50A 2RJLA 1QH6A 3GBFA 4HVRA 3SISA 5IK4A 2WKKA 1H2MA 2VE1A 1EV13 3NAPB 4GKYA 4AK3A 4JGZC 1PVC2 4LLFA 1AVBA 1KDKA 3BTZA 1ASJ3 3I49A 1GYKA 2WO1A 3U1XA 3UT0A 5FY1A 2WLQA 1NA1C 2ARXA 4NO4A 4YVWB 5FMOS 1AX2A 4JTNA 2ATFA 3BVCA 4PIZA 1CAVA 1H0BA 2Y6KA 4CCMA 4CZSA 3GZEA 4Z07A 2VQUA 1D4VB 2XXZA 3AP9A 1DZRA 1HQLA 3QCWA 3WT3A 1PO13 1VMHA 4MGYE 4AGGA 4AFAA 1F9KA 5KXCA 3S5AA 2XQXA 3RFRA 1VPHA 1W2OA 3HBZA 3DF0A 3IMMA 4IERA 4PI2A 1W6QA 5JR7B 1AR81 3INAA 4XIOA 4YLZA 5KHHA 3NQHA 5EPAA 5J37A 1ZBA3 4LKEA 4DXZA 2VJXA 1F5JA 3M3QA 3OGSA 1GNHA 1E5HA 1JZ7A 5GJ6A 4QAWA 4FPJA 3AMNA 2UWAA 5A3TA 4AF9A 5DMYA 3T1MA 4LNVA 1E5IA 2G9GA 2K2SA 1O5UA 1FMD1 2OQ6A 4CDQC 1GV9A 4YZ2A 2QQMA 3VHNA 3EQEA 4URTA 3APBA 1QJU1 1GLHA 1QNYA 2W3JA 4CP2A 2X29A 4NR1A 3JD72 2EVXA 2Q1ZB 1UO9A 3HD8B 5JZGB 4HK9A 5BNPC 1G9FA 1N1SA 1SFYA 3OF1A 5LA1A 1JZ3A 2QFEA 3NVCA 1W6OA 2BJSA 3KM5A 2IVIB 3RGBA 5A6YA 4OCTA 3ATGA 5BNNC 2OPWA 3WG4A 2PELA 1UWWA 1AHSA 3EMRA 2CL2A 1GFF2 3ON7A 4UF0A 4XBLA 5FUPA 3I3BA 1NUKA 2WNVB 4AG4A 2AYHA 3NV3A 4FAHA 1W2AX 1R1A2 1RUD3 1KGYA 4AI9A 1F35A 1YQ6A 4FXGB 2A6ZA 2KR2A 5KHGA 2QQUA 4P08A 1HLCA 1OOPB 2JKXA 2WS93 4QQLA 4UW3A 3V0BA 1FNZA 2V5YA 4IEXA 1C8NA 1AF9A 1WCUA 4P00B 4QMAA 1COV1 5DN2A 3NNGA 3TOJA 2EIBA 4XACA 3RVHA 1GQHA 1H8TA 1OLQA 2RS52 2YYOA 3JQXA 5DZFA 4BMBA 4EWAA 1RVF1 5F37A 1WGPA 1BJQA 1DF0A 3HT2A 5FKBA 1XJAA 2IC1A 3FUOA 2VMIA 1OH3A 5FLJA 1QQP3 4MXWB 1L7LA 2OZJA 1D4M2 4N8MA 3JBG1 3RJRA 4AQ2A 5JWPA 1JOJA 2VXRA 3WF1A 2VMFA 4A4AA 5AC93 2CV6A 1QHDA 4YVSA 2OUHA 4ASMB 3LDRA 4YW4A 1QMJA 2HWF2 5FLHA 4BPZA 5BNOA 3POFA 3ECQA 4WM8C 5T50A 3VKFC 1R092 3MPPG 4DY3A 5KC5A 4GH4B 1DBNA 2R1BA 3HQUA 1VBE1 2QQLA 3RSJA 1RUF2 1MS3A 2B8MA 4OUSA 1N3OA 2D5FA 2JG9A 4R9BA 4K6BA 2EALA 2B4KA 3ZYBA 3I3MA 3C7EA 4UFKA 5JI7A 1J58A 2VBPA 3KSCA 4FPLA 3UK9A 5DAVA 3EBRA 5IT6A 3HNMA 3ZPYA 1GQGA 3DKWA 3NJVA 4HKWA 4QDRA 1UF2C 3SH4A 1Q8SA 4LOSA 2VTXJ 5DAPA 3ZYJB 2O8OA 2R072 2RMU1 4AW7A 1V6JA 4CVUA 4FFGA 2VTXA 2RR11 2VVDA 4GKXA 3A4UA 1JUIA 2AENA 4YPJA 2Q8EA 5FREA 3SKVA 2GMEA 4YM3A 1DCSA 1K3IA 1V00A 2IXIA 2RS33 3CHXA 4LUKA 4QPGC 2J1EA 5FZFA 3WQ0A 1F15A 2VTFA 3U4SA 4EZ4A 5FBZA 3IN9A 3P6BA 4R52A 5FPZA 2WIIB 1KJRA 4FQZA 4JGYB 5FMOL 5H9PA 5DABA 4XJ8A 4E8CA 1M4WA 1XPWA 2Y6LA 3M2MA 4MZUA 5FZ9A 2ZHMA 2YUEA 4CDUC 1NQJA 1REDA 4CEWB 1KQRA 5HCAA 4FPGA 3W5NA 2ILMA 1KRIA 5J36A 2ZGNA 3WEZA 5FYVA 3PUQA 2ZEZA 5LW9A 1DG6A 2Y6JA 1UAIA 2OZ6A 3MHZA 2P3JA 1SZBA 1WMEA 2JE7A 2VZUA 3ZFEB 2JIGA 1K45A 4TLFA 5FLIA 3AMQA 1PMJX 1HXS1 1Q3EA 2GP5A 4JDNA 2IXHA 3J7NA 5F9TA 4KWKA 4AFDA 4ARYA 1YFXA 4RR3A 3WNMA 5EP9A 2RM23 5LEJA 4IEPA 3O7OA 1POV3 3OEBA 1W99A 5HCBA 4C1WA 4PDWB 3GM8A 1PVXA 3USUB 2A6WA 3RNSA 2NQYA 4A6OA 1ZBE3 2VGDA 2BVVA 5JMCA 1WLTA 3QD6A 3UETA 3NWKA 1PMHX 3KV6A 2F4PA 4Q5OA 3T09A 2R062 2X8KA 1I1EA 3AZYA 2WN3A 2EXKA 5FZOA 4AVAA 3HBKA 2W95A 1UU6A 1S0BA 2E63A 2OKXA 1ZNPA 2ZHLA 4HSJA 5F6LB 2CGNA 5I8TA 3I2FA 1H8VA 1NY72 4XPVA 4Y1VA 3AMPA 3CLPA 3AFGA 5K0UB 1LHNA 3VBFA 1VBB1 1OSGA 1WLDA 2EAAA 1Q8OA 3I59A 1ENRA 2HWC2 5J3UA 5FXXA 1HB3A 1OVPA 1PNFA 4CE8A 2RS12 2JG8B 1K5JA 1JUHA 5DUXA 1O4ZA 1HRI2 1XYOA 2ZGQA 1VBA2 3LSEA 1GWMA 3ORJA 5FQ0A 1SFNA 1HB4A 4HANA 1EPWA 1I5PA 4QGMA 1K5MC 2Q8DA 1FI2A 4RS5C 3PVNA 4A7KA 4Y20B 5EFUA 3UESA 3AX4A 3N4MA 3J7HA 1X33A 3O1VA 2DYCA 5F32A 2GNTA 4M3CB 3M7AA 3AP6A 1QJY3 1FT9A 3JB8A 2QZ2A 4EQVA 1AL23 3TN91 2ZGRA 4YZ3A 1DQ4A 4AEMA 3T0AA 3CJIB 4NROA 3DPRB 2WBKA 3MZHA 5IJRA 1WUVA 2BWAA 3FLPA 4EWDA 4WVMB 5CB7A 4YNIA 4ZU7A 4XBQA 5BXXA 1PO21 2XG3A 5C6CA 3P3NA 5BPXA 3SXWA 4BIOA 4O9GA 4PT6A 1GP6A 1WMXA 5JSOA 4ISRA 5F3EA 5FXWA 2BDRA 1PGW2 2DBIA 4ASKA 1FMD3 1PM4A 4AI2A 2DF7A 3O1MA 2BEOA 1CR7A 2JENA 1RITA 2XJSA 3LAGA 1H8TC 1K42A 2HWD3 4IGOA 4JCKA 4JVAA 4QQ2A 4A7YA 2C6SA 5FCCA 5JSRA 2NP0A 1MR5A 4W50A 1QOSA 4XJAA 4FPEA 4AZZA 4XBNA 2F4LA 5LA0A 2RE9A 2PQQA 1PZ9A 1US3A
chains in the Genus database with same CATH topology
3O1TA 4IE4A 5DABA 4NRMA 2IUWA 2FDGA 4CXXA 3O1OA 3BI3A 3RZKA 4RFRB 4O61A 3BTYA 2FDKA 3O1RA 3RZMA 3O1PA 4QHOA 3T3YA 2FDFA 4NIDA 3BUCA 3BIEA 4IE5A 4OCTA 3LFMA 4CXYA 4NIHA 4QKFA 3RZJA 4QKBA 4NPLA 5F8PA 4IE0A 4ZS2A 3I2OA 4NIIA 2FDJA 4IE6A 3O1UA 3BU0A 3KHBA 3BTXA 4MG2A 3O1SA 3BKZA 3H8OA 3KHCA 3I3QA 3RZLA 4O7XA 4QKDA 3T4HB 4MGTA 4NRQA 3O1VA 4NJ4A 4NPMA 2FD8A 4NIGA 2FDHA 4NRPA 4NROA 4IE7A 4CXWA 4JHTA 4QKNA 3I3MA 4ZS3A 4IDZA 3RZHA 3H8RA 3BTZA 3T4VA 3I49A 3S57A 3O1MA 3H8XA 3RZGA 4ZHNA 3S5AA 2FDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O1T A;  4IE4 A;  5DAB A;  4NRM A;  2IUW A;  2FDG A;  4CXX A;  3O1O A;  3BI3 A;  3RZK A;  4RFR B;  4O61 A;  3BTY A;  2FDK A;  3O1R A;  3RZM A;  3O1P A;  4QHO A;  3T3Y A;  2FDF A;  4NID A;  3BUC A;  3BIE A;  4IE5 A;  4OCT A;  3LFM A;  4CXY A;  4NIH A;  4QKF A;  3RZJ A;  4QKB A;  4NPL A;  5F8P A;  4IE0 A;  4ZS2 A;  3I2O A;  4NII A;  2FDJ A;  4IE6 A;  3O1U A;  3BU0 A;  3KHB A;  3BTX A;  4MG2 A;  3O1S A;  3BKZ A;  3H8O A;  3KHC A;  3I3Q A;  3RZL A;  4O7X A;  4QKD A;  3T4H B;  4MGT A;  4NRQ A;  3O1V A;  4NJ4 A;  4NPM A;  2FD8 A;  4NIG A;  2FDH A;  4NRP A;  4NRO A;  4IE7 A;  4CXW A;  4JHT A;  4QKN A;  3I3M A;  4ZS3 A;  4IDZ A;  3RZH A;  3H8R A;  3BTZ A;  3T4V A;  3I49 A;  3S57 A;  3O1M A;  3H8X A;  3RZG A;  4ZHN A;  3S5A A;  2FDI A; 
#chains in the Genus database with same CATH topology
 1AYM 1;  2DU1 A;  1LR5 A;  3VD4 A;  4XF1 A;  2XUE A;  1CJD A;  1IG3 A;  4DMI A;  4XIL A;  2XBO 2;  2JB8 A;  1GBG A;  3AYE A;  5SV5 A;  4OMD A;  1T6G C;  5FAX A;  3E5X A;  1ST8 A;  2D44 A;  2I2S A;  3RI8 A;  2D6K A;  1YRZ A;  2GDF A;  1CAW B;  4JX0 A;  3ZXE A;  1GZC A;  2Y6H A;  3MLK A;  4AQ6 A;  5JPM B;  3AKT A;  2W87 A;  2JG9 C;  1MEC 1;  1XNK A;  2ZEX A;  1YIF A;  2HWE 1;  3WDT A;  2FCT A;  3C2U A;  4WVV A;  1O4T A;  1FV2 A;  1W05 A;  5T5O A;  4EYU A;  3ZFG B;  1GU3 A;  1RUJ 2;  2ZA9 A;  3CNA A;  3VDC A;  4M4R A;  2VZT A;  5C9A B;  4ORF A;  5I0D A;  5A7S A;  4X8N A;  3D0J A;  5LY1 A;  1VJ2 A;  3H7Y A;  5FRA A;  1W0N A;  3AZX A;  3B93 A;  3KF3 A;  5LK5 A;  3V0A A;  3AC0 A;  3CEW A;  5E8A A;  3I97 A;  4AHW A;  1W6N A;  2DV9 A;  1UZZ A;  3BPZ A;  1UMI A;  3GF6 A;  1PM7 A;  1BEV 2;  4UAP A;  4UFM A;  5A32 A;  4DUV A;  2VOK A;  5GAL A;  4Q4W 3;  4IV3 B;  1MS0 A;  1ND2 A;  4NII A;  4QX7 A;  5FJK A;  1UX7 A;  2V5D A;  4DXR A;  3R4D B;  3H1M A;  2YDE A;  2QDR A;  3TYJ A;  1Q5O A;  1XRU A;  5GZD A;  1VB2 A;  4Y26 A;  1QJU 2;  3WUC A;  3LD8 A;  5E6H A;  1CAX B;  2EID A;  2HKX A;  2PQS A;  2VMG A;  3POB A;  3OGR A;  4H14 A;  4HL0 A;  4P5Y A;  2CGO A;  3ILR A;  4XVH A;  2XPJ A;  1QXP A;  2JDH A;  4Q4V 1;  4ZU5 A;  3WW3 A;  3HQX A;  3SH3 A;  4MGQ A;  2VCB A;  3UGF A;  4M3C F;  3G6J B;  2L9L A;  3I3Q A;  3M3O A;  3FZ3 A;  4Q27 A;  4XF0 A;  3S30 A;  3U37 A;  1VAV A;  4RR3 C;  2XKP A;  3WG2 A;  4BU2 A;  4E2S A;  4DXS A;  3R4S A;  1W8F A;  2VNV A;  3ZFF A;  2RR1 3;  2AH2 A;  2XVL A;  1LOD A;  1A34 A;  5LBB A;  3N7K A;  4NRQ A;  5FR3 A;  1LJ7 A;  2VNG A;  2DCT A;  5IW0 A;  3W58 A;  2G4I A;  1G9A A;  4PI0 A;  4COZ A;  1XND A;  3OTF A;  4TN7 A;  2ZEW A;  4L99 A;  4R4X A;  3WF0 A;  1QGL A;  4LBQ A;  3TEW A;  1VBD 1;  2DCY A;  1YFU A;  4K21 A;  2DWR A;  4KMQ A;  2QUO A;  1RXF A;  1VE0 A;  2XL7 A;  1Q43 A;  1RHI 2;  5GM0 A;  4J1W A;  1DYK A;  4XTM A;  3AJY A;  1H1M A;  4AVV A;  4G4F A;  4BQW A;  1UL9 A;  2A1X A;  5APA A;  4ZS3 A;  4OZO A;  1S1A A;  5DDJ 3;  1PMI A;  1PVC 1;  2CDP A;  2ZAB A;  1AR9 1;  1TMF 2;  4XOG A;  1RVF 2;  3VBF C;  2ZAH A;  1STM A;  1G9B A;  3S6P A;  2YFZ A;  2C9K A;  3T4V A;  5A3W A;  1PNG A;  1NCR A;  1HJF A;  2ETE A;  3VBS C;  5EV7 A;  4IEZ A;  4XUT A;  2B9U A;  3CQO A;  1XB9 A;  5T52 A;  4N7I A;  4ZHN A;  1VRB A;  3SCG A;  4LKF A;  1YI9 A;  2DCZ A;  2WAA A;  1YWK A;  2NPI A;  4C0H A;  2CY6 A;  3OUH A;  1BZW A;  2GMP A;  3OY8 B;  5FYT A;  1OC1 A;  1J3Q A;  1VBE 2;  1W8U A;  3A22 A;  3I4I A;  4LO5 B;  4JTO A;  4LLO A;  4Y24 A;  5FYH A;  5KXB A;  5L19 A;  2PAK A;  5FYM A;  3Q8C A;  4QX8 A;  1O3T A;  1L7Q A;  5CZK A;  1BMV 2;  3VBR C;  1OT5 A;  3I2K A;  1S55 A;  3POW A;  3WNN A;  1ULG A;  2A6X A;  1DQ2 A;  3C3V A;  1DQ0 A;  3KV4 A;  3W5M A;  3T2Q A;  2VBB A;  3I8T A;  2WZE A;  1SFP A;  5FY9 A;  4P9W A;  5A1L A;  1ZRI A;  3IPV A;  4Q0U A;  3OBZ A;  3RZK A;  1TME 2;  1SLB A;  4BCU A;  3JD7 1;  2Y60 A;  4NAM A;  4MO3 M;  5C33 A;  1RUO A;  3PUI A;  4HXC A;  2DBN A;  4YAR A;  3FJS A;  1BHG A;  1RL3 A;  4Q0P A;  4H3W A;  2VEC A;  4AFB A;  3WP6 A;  4Y33 A;  1HN1 A;  5KXD A;  4SBV A;  5FIX A;  3WW4 A;  4PBO A;  3NJY A;  2BGO A;  3U14 A;  5C8C B;  4I0A A;  1MZF A;  1KJL A;  2LRP A;  4J6G A;  5G04 L;  4GWJ A;  3LPG A;  1BK0 A;  1D0G A;  1N1Y A;  1R1A 1;  1HRV 3;  4H7L A;  1UMH A;  4Y4Y A;  3ME2 A;  2VOW A;  4KWL A;  1AR7 2;  1LTE A;  1VRH 3;  2VY0 A;  5IAT A;  5F3I A;  1QWR A;  4YW6 A;  4V2V A;  1W8N A;  2A75 A;  3PNA A;  1WCK A;  2Y33 A;  3BTX A;  4I02 A;  1X36 A;  1E57 A;  2PHT A;  2ZXQ A;  3KVB A;  5FZE A;  3VD5 A;  3AYC A;  2RS5 1;  4YG3 A;  1QDC A;  1MZ6 A;  4B4R A;  4YWA A;  5F39 A;  1APN A;  1X9P A;  2R30 A;  1I5Z A;  3JQW A;  3ES1 A;  3LDK A;  1ENQ A;  2D3P A;  5LBE A;  3FL7 A;  4OI2 A;  1XNB A;  5K8S A;  5BY5 A;  5CFC C;  1D4M 1;  3GHN A;  1ONA A;  4UYB A;  4Y1Y A;  4LHK A;  1Q56 A;  2Q1M A;  3IKW A;  2HWF 1;  4BME A;  4CP0 A;  4E4Z A;  1R09 1;  5HXV A;  3GZT B;  2NMN A;  2VUA A;  1VBC 2;  1YQ2 A;  4LBM A;  2WRA A;  3GZU C;  3ZYI B;  1JTZ X;  1LOB A;  2ARB A;  3MO4 A;  3VZN A;  1JYX A;  1RUF 1;  4XJW A;  4LJH A;  4A2U A;  3WDU A;  5DPN A;  1PIV 3;  4JHT A;  1ND2 C;  3H3Z A;  4L92 A;  5ACA 2;  4XDP A;  1UCX A;  5L7O A;  4QKN A;  1RUC 1;  5CNA A;  1F31 A;  4DZG A;  4LE4 A;  3F95 A;  3FFZ A;  3KLS A;  5AVA A;  1ZX5 A;  4LO7 A;  5C3Q A;  3M3E A;  3VHR A;  1BK1 A;  4AVT A;  1UY4 A;  3SIT A;  2R07 1;  3UGH A;  1O7F A;  2P3Y A;  3KT7 A;  2ZKN A;  1W6M A;  2CDO A;  5ANN A;  4JGZ B;  2FQP A;  4CPB A;  4N53 B;  4N43 A;  3MW2 A;  2HWE 3;  4QT6 A;  4K1Z A;  1SDW A;  1AXK A;  1VMJ A;  5KXE A;  4AI1 A;  5FO9 B;  4KH9 A;  3PU3 A;  4COU A;  3WNO A;  2VQT A;  4M0H A;  3VDA A;  4CRQ A;  1O8P A;  1NA1 B;  5FZ8 A;  2WNU A;  5GZF A;  4XF4 A;  5I8Y A;  5F5A A;  1HX6 A;  5F3C A;  1L7R A;  4IE4 A;  1OUS A;  4K8F A;  4PLO A;  4AVB A;  3P1I A;  2OYZ A;  4ATE A;  1PGL 2;  4HMZ A;  2VNO A;  4C8D A;  1A6C A;  1S0J A;  1O91 A;  2IVJ A;  4UI9 L;  4CDX C;  3B01 A;  2PA7 A;  3H1Y A;  3ITQ A;  3KGZ A;  2VUJ A;  1UY0 A;  2QZ3 A;  1QEX A;  2EIG A;  2YGL A;  4YZ1 A;  1X82 A;  4K20 A;  4M00 A;  4ASL A;  2JDP A;  5I8S A;  3KZ4 C;  2WT1 A;  3SCF A;  4XCA A;  3T1L A;  2FDK A;  2AEZ A;  4DY5 A;  4IV1 C;  4CDQ B;  1OVS A;  1RUG 2;  1SG3 A;  1U5X A;  4QHO A;  4Y5Z 0;  4MLO A;  1O3Q A;  3VN4 A;  1UYZ A;  2HWB 3;  1DHK B;  1AYM 2;  1EPZ A;  4ITC A;  4KG8 A;  2YXS A;  4QX1 A;  5B2G B;  1SBE A;  2B5H A;  3HT1 A;  4HPK A;  3POG A;  5BNP B;  5I91 A;  2R06 1;  3LDB A;  3MI8 A;  5F8P A;  2GNM A;  4LPL A;  1TG7 A;  4Y4R A;  1VMF A;  3K46 A;  4GXL A;  1SMV A;  1GWK A;  3OCP A;  3VBO B;  3RI9 A;  3GDB A;  5B4N A;  3DGT A;  3I3D A;  5BNN B;  2ZZJ A;  4KBB A;  1XSQ A;  2DUQ A;  1NY7 1;  4I2O A;  4DB5 A;  3H3U A;  2XWJ B;  5IK5 A;  5GLV A;  3THC A;  3OYW A;  2R7E B;  1HQW A;  4QU1 A;  2DTY A;  2HWC 1;  3U0Z A;  4QXC A;  2D93 A;  1MS5 A;  2RS1 1;  1XBF A;  1VIW B;  1RUI 2;  3VZK A;  3J8F 3;  3Q8B A;  1H1A A;  3GGL A;  4P9J A;  5FO7 B;  1HRI 1;  1VAK A;  2XQR A;  1VBA 1;  3PJQ A;  4G3Y C;  4RQP C;  1F2N A;  1PVC 3;  1JN2 P;  1S2K A;  2PMW B;  2RDR A;  1REE A;  2X5I B;  3GAL A;  4PJY A;  3KHC A;  1Y9M A;  3IWZ A;  1S0I A;  5LWB A;  1S0F A;  2ZX3 A;  1DGL A;  1W06 A;  3T4H B;  1S2E A;  3L9J T;  3W59 A;  3TEX A;  4DEV A;  4LO8 A;  3FHQ A;  1ULF A;  5C70 A;  2VZQ A;  1UNB A;  4R9D A;  4X8P A;  4Y1X A;  3LOB A;  4U36 A;  3FLR A;  1YC6 1;  3VDD A;  4DO0 A;  3CDZ B;  4LOT A;  5IHR A;  1SAC A;  1MQT A;  2WN2 A;  2H6C A;  4QPI A;  3MIE A;  2BNN A;  3ASI A;  4EZH A;  4E4S A;  2A3X A;  2GU9 A;  3ACH A;  4JKM A;  1LOA A;  1IQA A;  2ZGL A;  4IE7 A;  2W08 A;  4R9C A;  4COY A;  4YW2 A;  1ZRD A;  2HYK A;  2ZHN A;  4BLJ A;  4QX5 A;  4OHZ A;  2EXI A;  3RZH A;  2ZHK A;  4EN7 B;  5A7W A;  5A3L A;  5EJ1 B;  1PGW 1;  3ACF A;  5D8A B;  3H8R A;  1YI7 A;  3AZW A;  3LA2 A;  3RQ0 A;  4QQH A;  1G6N A;  1MS4 A;  1NCQ A;  3NKT A;  4R9A A;  1UX6 A;  3DCQ A;  3HN1 A;  3JD7 3;  4XF9 A;  3GYD A;  4OVE A;  3MF9 A;  1AZD A;  2ZTN A;  3NMB A;  1JYC A;  3WF4 A;  5FP8 A;  5KWR A;  1C5I A;  2CNA A;  3VBU A;  5I0R A;  5CKQ A;  4D69 A;  3V64 A;  3ZYF A;  1SBF A;  5IYY A;  1AX1 A;  2BP6 A;  4OHV A;  5FYS A;  4XAE A;  2XBO 1;  1W9S A;  1SCS A;  4WM7 A;  4BE3 A;  4XZP A;  5LCW L;  4OI4 A;  2X09 A;  4QPW A;  4D6Q A;  4LHN A;  3WV6 A;  2WFF 3;  1AR9 2;  4CXX A;  3O1O A;  4CDU B;  3C7G A;  4PF5 A;  3LSD A;  2UWC A;  3K51 A;  5DUV A;  1HN0 A;  3E5U A;  1ND3 A;  4Q0Q A;  1V6I A;  3I54 A;  3VUO A;  1NOV A;  1EAH 2;  3NJZ A;  2Z69 A;  2VCC A;  1XE0 A;  4YVW A;  4W65 A;  5T3N A;  1RUJ 1;  3GCW A;  1JZ4 A;  4AE2 A;  3IAP A;  1YFW A;  5E16 A;  4HKO A;  5A70 A;  4CUB A;  1H2N A;  4RA0 A;  4RHV 3;  5BV6 A;  3T0D A;  2VG9 A;  3FX3 A;  4N43 C;  2YG0 A;  3AKP A;  2VZ3 A;  3AJZ A;  1KD7 A;  2JDZ A;  4IET A;  4W6W A;  3LIH A;  2XDV A;  4RYD A;  2VOX A;  1LRH A;  3NW4 A;  3P5B A;  1RUH 2;  1BEV 1;  1QJE A;  1UYY A;  3OSD A;  4QD2 A;  1E5S A;  5JIA A;  3ZKY A;  4BDV B;  4FI9 A;  4I0B A;  4CCJ A;  1LKN A;  3R0R A;  1GZ9 A;  4HN1 A;  4R4Z A;  3WP5 A;  1ZZ8 A;  4BIS A;  3LCP A;  3RDI A;  5KHI A;  3NNF A;  4QPY A;  2YMZ A;  4D6S A;  4S2H A;  5JUV A;  5FY8 A;  3MFC A;  2J1V A;  5FZH A;  3JUU A;  5A7P A;  4ONU A;  1CPN A;  1W6Q B;  3JU9 A;  1W8O A;  3KHB A;  3WHU A;  3H3L A;  4GA9 A;  3VBH C;  4ATF A;  1LNS A;  4QX3 A;  3RWN A;  1J3R A;  2ZS6 B;  5JZG A;  2LTN A;  3WQ1 A;  3BKZ A;  2ZCW A;  1C57 A;  1CZS A;  4IW3 A;  1U0A A;  1W3X A;  3N35 A;  4B7E A;  1QJX 3;  2W92 A;  3DXT A;  3KV5 A;  3MV1 1;  3ILN A;  2TEP A;  3MGU A;  3DXU A;  5C4W A;  4BQ1 A;  1G7Y A;  1DGW X;  2JE8 A;  2CHH A;  2ADD A;  1K5M B;  1VR3 A;  5DXD A;  4RS5 B;  2GC2 A;  2WNV A;  3NNJ A;  4B1L A;  4MHR A;  2BQP A;  1V6M A;  1XSR A;  3CL1 A;  2UYA A;  1V9U 3;  2ZX1 A;  2UY8 A;  1W6O B;  2XJP A;  4QXB A;  4QX2 A;  3WQ7 A;  2QE3 A;  4GZ9 A;  1RHI 1;  4Q8L A;  1WW4 A;  3AYD A;  3DYM A;  4UBG A;  4CYD A;  1GNZ A;  3SH5 A;  2WYS A;  1VAL A;  1TMF 1;  2QVS B;  2ZJC A;  1EY2 A;  1YIP A;  1R08 2;  1ZZ7 A;  2VM9 A;  2P6C A;  1ZZC A;  1YNA A;  3U4X A;  1EV1 2;  1W03 A;  2QNK A;  1WCD J;  3LEI A;  5FZG A;  4YYO A;  1UU4 A;  3LEG A;  3TNQ A;  3ZPO A;  4LIT A;  2PHU A;  1REF A;  3T2T A;  4BXF A;  4AHY A;  4C0B A;  1ASJ 2;  4MXW A;  1Z0H A;  2GN7 A;  3TWI A;  5LBF A;  3RS6 A;  3BCW A;  4Z2W A;  2WWS A;  3N7M A;  3ALQ A;  3N9P A;  4UFJ A;  1D2Q A;  5FYY A;  5LA9 A;  4B3N A;  1JW6 A;  1XNA A;  3UKV A;  1LEC A;  3LB9 A;  3LOI A;  3PIJ A;  3WDX A;  3MID A;  3OPZ A;  5DG1 A;  1CWP A;  4GH4 A;  3WUD A;  4G9S B;  5LY2 A;  3CO2 A;  1BMV 1;  2ZX0 A;  2JDN A;  1LOE A;  2Q4S A;  5JOX A;  4Q1R A;  1QDO A;  1RUC 2;  3BU7 A;  1WW6 A;  2VZR A;  3IDC B;  1ZBA 2;  4JAA A;  4QPI C;  3L2Y A;  2X05 A;  1JI6 A;  2HYX A;  5KBF A;  2EXJ A;  2WWJ A;  1R64 A;  3M8L A;  4O65 A;  5FMD A;  4P02 B;  1RIR A;  3NKG A;  1PX4 A;  2VD7 A;  4Q29 A;  5FZ0 A;  1UY2 A;  2MNG A;  3R4U A;  4GWM A;  2YBK A;  4FOQ A;  1TME 1;  3BOD A;  3MIF A;  3N7L A;  4CP1 A;  2HWC 3;  1TNR A;  5F5Q A;  1O3S A;  2G1M A;  2ZKL A;  1WCQ A;  3MLL A;  2P2K A;  3UKT A;  1YQ8 A;  4IUG A;  2XML A;  3NO8 A;  4HVO A;  2W0X A;  4Q4X 3;  1NCQ C;  1OQ1 A;  5A6X A;  2WZP P;  5C8W A;  3JXS A;  3VL8 A;  4JGY A;  4NIH A;  4A7Z A;  3PL0 A;  2HH9 A;  2CGP A;  4ERO A;  5LZ6 A;  2HEW F;  4MGK E;  3B9I A;  5I0S A;  1OH4 A;  3VBU C;  4I09 A;  1PHM A;  1N47 A;  1AL0 G;  2LRO A;  2WO7 A;  3ZSE A;  4PIX A;  2AAC A;  4AYU A;  2ZGO A;  1AR7 1;  2CWM A;  1X9T A;  2IXJ A;  2P5B A;  5EYY A;  5JI9 A;  2PAE A;  1Y9Q A;  4OHW A;  2Y8K A;  4WM7 C;  3SLI A;  1V6K A;  2VQA A;  1E5R A;  5IVC A;  3I7D A;  4KBZ A;  5A3U A;  2C0Z A;  4UFH A;  2GAU A;  3HNB M;  1VB4 A;  2WS9 2;  2D6N A;  3H1W A;  4IGP A;  5FY4 A;  1GIC A;  1ND3 C;  4LBO A;  2R16 A;  4QXK A;  3EHK A;  3D5O A;  3PDQ A;  4PDW A;  1MVQ A;  3USU A;  4O7X A;  4IEU A;  3RYR A;  3T08 A;  1ULP A;  2WT2 A;  1J3P A;  4MYE A;  3IDB B;  4DUX A;  3ACI A;  1JMU B;  5FV3 A;  1IPK A;  4CSW A;  4NJ4 A;  2P3K A;  3ZIX A;  5AC9 2;  1RUE 2;  1BCX A;  2V72 A;  2VZP A;  1VBC 1;  4BQ5 A;  4BQ2 A;  2RHP A;  4AED A;  2Y0O A;  2W46 A;  3DEM A;  4QHZ A;  3CZJ A;  1A8M A;  4ZXK A;  5K0U A;  4RL7 A;  1YEW A;  1W04 A;  3LKJ A;  2VL4 A;  4HFS A;  2GC1 A;  4YW5 A;  5ACA 1;  2W5F A;  1AR6 2;  1C5H A;  2OQ7 A;  3G7D A;  5F2S A;  1D7P M;  5JR2 A;  2YGM A;  4LOR A;  3TEY A;  1OA2 A;  3KS7 A;  2JG8 A;  1MZ5 A;  2F17 A;  5EYX A;  2WAB A;  2NM1 A;  2NN8 A;  5ANQ A;  4Y22 B;  3LEM A;  3U10 A;  2J1U A;  5CBL A;  3RMX A;  4CEY A;  2Q30 A;  4Y20 A;  4GB3 2;  2W91 A;  3MEP A;  1DZQ A;  1JHN A;  1JOB A;  2RDS A;  1UN1 A;  3IB3 A;  3POJ A;  3VBS B;  2AUY A;  3K3N A;  1QF3 A;  2AZ5 A;  3FBY A;  4EWE A;  5BNQ A;  2A6Y A;  2W1S A;  3RJ2 X;  5C4W C;  4JKK A;  4NHK A;  4P9X A;  5A3P A;  2VZO A;  3B69 A;  5ISL A;  2P4E A;  5GLZ A;  1AR8 3;  3K77 A;  5J98 B;  3CJI A;  2DCJ A;  3B9C A;  4M3C E;  2RG4 A;  4RN5 A;  1PGL 1;  3ILF A;  1K12 A;  5DUU A;  2V09 A;  2OPK A;  2XLF A;  1WD3 A;  2N7G A;  1KIT A;  1G9D A;  4QB6 A;  3ZXJ A;  1MAC A;  3HWJ A;  3III A;  4AEJ A;  2ET7 A;  1NZC A;  2PXJ A;  1S4C A;  3M4F A;  4GMP 1;  4Z2A A;  4UW4 A;  4NIA A;  5FZA A;  3AVS A;  3VBR B;  3A21 A;  2R04 1;  1UYP A;  3FBM A;  3TNP B;  5JOW A;  3V65 A;  4K8R B;  1PZ8 A;  1QJU 3;  2PHL A;  5L73 A;  4O61 A;  2YC4 A;  4ZZ5 A;  2GC0 A;  1C1L A;  3IDA A;  5FYI A;  1RUG 1;  5HCH A;  4FPK A;  5T5L A;  3S7I A;  1GZT A;  2RM2 2;  4FSJ A;  4LIU A;  4CCN A;  1CPM A;  3WOG A;  1UMZ A;  2WNO A;  4CP9 A;  4ISQ A;  4IE5 A;  4YVS C;  1IHM A;  5JOZ A;  3D6E A;  3VDB A;  4TLG A;  5KC6 A;  4FOW A;  1YYN A;  5BNO C;  3ZIW A;  5C71 A;  4GMP 0;  1T6B X;  2E9Q A;  5CU1 A;  2BER A;  1C4R A;  5A1A A;  2H0V A;  3H0O A;  1OPM A;  2FDJ A;  1CAW A;  5GLT A;  4MXV A;  1JZ8 A;  4Y3O A;  3AMM A;  4OI0 A;  3ZSK A;  1CN1 A;  3I2I A;  2WDB A;  4LA3 A;  4QGN A;  1BBT 2;  1ZRR A;  4CCC A;  2DUP A;  4C90 A;  1COV 3;  3WX5 A;  1RUI 1;  1FPN 2;  3NV1 A;  3KD4 A;  2O14 A;  3K2O A;  2YBS A;  4CDW B;  4PIY A;  1RIN A;  3O1S A;  2UYB A;  3U75 A;  1RVF 3;  1Y4W A;  3VHP A;  1UY3 A;  3UV9 A;  5LB6 A;  4N90 A;  2IFW A;  3LGR A;  5C9A A;  1C28 A;  3RZL A;  2QCS B;  4XUQ A;  1UOG A;  5IWF A;  4P14 A;  4WVW A;  5C3O A;  2ARC A;  4GAZ A;  4H7M A;  5T54 A;  2PFW A;  1CQ9 A;  2O0O A;  3JBG 3;  5EJ3 A;  3VD7 A;  3VGI A;  4L2N A;  3B5L B;  2XJR A;  3D3A A;  4OUM A;  4QQO A;  1MPX A;  3D82 A;  4UT5 A;  2D5H A;  3ZXF A;  5CFC B;  1AX0 A;  3BYW A;  4DXT A;  1LOG A;  2IXC A;  3D8C A;  4F3J A;  4PLN A;  5A3N A;  4JGY C;  1UKG A;  3MIB A;  1QJY 2;  4ZON A;  1AXY A;  1VBE 3;  1KS5 A;  2YU1 A;  2BYV E;  4Z8B A;  1OKQ A;  2Z4F A;  5FP7 A;  5FMC A;  3BPS A;  3KMH A;  1PK6 B;  1YJL A;  3OJB A;  1ZYB A;  2W1W A;  1CAX A;  4HBN A;  4R8H A;  3ZN6 B;  4RD7 A;  4CU8 A;  4CU7 A;  3B7M A;  1CAU B;  3H42 B;  1AXZ A;  1IKP A;  4IEV A;  3VD3 A;  4D8M A;  4HZF A;  4XQW A;  3ETP A;  2QQK A;  3O5S A;  4AGV A;  4LBJ A;  2VOV A;  2OXB A;  2RMU 3;  4UWD A;  3S57 A;  1Z7S 1;  1W28 A;  4BK4 A;  3H8X A;  4XET A;  1JU3 A;  4HOO A;  4E2G A;  1CX1 A;  3POE A;  1NXM A;  5HI0 A;  4PDW C;  5JXI A;  2HWD 2;  4JV4 A;  1MVE A;  1VLN A;  1XOY A;  5A33 B;  3CBN A;  2V73 A;  1UPI A;  2KA3 A;  2EF6 A;  3FE5 A;  2RV9 A;  3PUS A;  5LK7 B;  1W8T A;  2FZ2 A;  3HMY A;  3O0V A;  3SKJ E;  3OEA A;  4FPO B;  2VUD A;  2Z5W A;  2VW2 A;  1HJG A;  5A7O A;  5FUI A;  1DGR N;  3HAG A;  4W6X A;  3WF2 A;  4XE9 A;  5FDB A;  5GZC A;  3VZO A;  1VP6 A;  4AED C;  1OI6 A;  5FYC A;  5K0U C;  3PJY A;  3VLB B;  4CDX B;  4GJZ A;  2C4X A;  3A0N A;  2JDM A;  1EAH 1;  1F4A A;  1HXS 3;  1UXZ A;  3VV1 A;  4ARX A;  5I0T A;  2XUM A;  4E4D X;  2JG8 C;  3WW1 A;  1W6P B;  4DRV A;  2A5Z A;  4W4Z A;  5ABJ B;  2FMD A;  3H7J A;  1NG0 A;  2VXJ A;  3I3E A;  1DIW A;  5ERL A;  3NNM A;  2K0G A;  1XNC A;  2P17 A;  1NXD 1;  4CEY C;  2HBU A;  2VMC A;  3OY8 A;  1J84 A;  3BIE A;  4IV1 B;  2OT7 A;  3CIH A;  1RUH 1;  5FUN A;  1SLA A;  1ULD A;  2XVG A;  4A3X A;  5JDB A;  4IE0 A;  1BVP 1;  1GOG A;  3KQ4 B;  5CFD B;  5EQU A;  4HG6 B;  4HK8 A;  4NN0 A;  5L9B A;  5JXH A;  2Z79 A;  4BA6 A;  3B94 A;  2DCK A;  3KCY A;  3ZO0 B;  1H6Y A;  3MUZ 1;  1NT0 A;  4XMI A;  4YG6 A;  2ZBJ A;  1JYT A;  4Q4W 2;  3UKN A;  1VBB 3;  4FFF A;  4IE6 A;  4KGQ A;  4AHX A;  1GZW B;  2ZX4 A;  4HON A;  1SCR A;  1GP4 A;  1OQE A;  3C7H A;  1YHF A;  4JQT A;  2D97 A;  4JKL A;  3VL9 A;  3OPT A;  4DEQ A;  4FCA A;  3TEZ A;  2JB4 A;  3CZU A;  3T0B A;  3J9S A;  4QU2 A;  3ZSL A;  3WP4 A;  1B35 B;  1GOF A;  2Z2S B;  2VCM A;  2GH8 A;  3AYA A;  3IPV B;  4QKD A;  2Y38 A;  4RQP B;  4TXW A;  5C8C A;  4LO4 B;  5IFT A;  2HBT A;  1NQD A;  3PMS A;  1GNY A;  1YQ5 A;  4QM8 A;  2XHK A;  4DS0 A;  1SLL A;  2B46 X;  2QJV A;  4S2D A;  3THD A;  2C9A A;  2J42 A;  2RJ2 A;  2V4A A;  2VVE A;  3MYX A;  1BLZ A;  4GUL A;  3TN9 3;  3URF A;  3ZR6 A;  4OQ8 A;  4DIN B;  2WNE A;  4QB2 A;  4CUA A;  3K3O A;  2LM3 A;  2LAL A;  3BOW A;  4XTP A;  4P9G A;  5D21 A;  4Q8K A;  2DVA A;  1XU1 A;  4FPF A;  1R08 1;  4COW A;  3VZM A;  1EYB A;  1V6N A;  1PO2 3;  4OYU A;  1EV1 1;  3WD5 A;  2W52 A;  5DDJ 2;  2YRO A;  4XC9 A;  5GKA C;  5J1X A;  5GLW A;  2ZMK A;  3ETQ A;  3AVR A;  4AFC A;  4EN0 A;  3HIF A;  1ASJ 1;  1RC6 A;  1BQP A;  3IMN A;  2QQV A;  3K4D A;  2BNO A;  5AVP A;  4XAB A;  3J4U H;  5FYU A;  2Y34 A;  4Q4Y 2;  2E6V A;  4BHP A;  2BVB A;  3C8X A;  2VZ1 A;  2I45 A;  4YW3 A;  3ZSM A;  1L3J A;  3GZA A;  1AYM 3;  1TE1 B;  3UNP A;  1JXN A;  4CU6 A;  5JVV A;  2F6B A;  2E7Q A;  1H4H A;  1TZO A;  3MIC A;  4AAP A;  5D1I A;  1ZBA 1;  3N7J A;  1PZ7 A;  2DU0 A;  2TBV A;  3OOX A;  4CPB D;  2W39 A;  3PVB B;  3TBD A;  2LW8 A;  4X6Q B;  4COV A;  5H9R A;  2YBP A;  3O12 A;  2LS6 A;  4BQY A;  2JDA A;  1MEC 3;  4BM8 A;  2PAM A;  4TYS A;  4JGZ A;  3GBW A;  5FZB A;  4N53 A;  1DQ6 A;  2HEV F;  1GKB A;  2E31 A;  2QQO A;  1DZT A;  2ZGK A;  3WZ1 A;  4B1M A;  3DL3 A;  5A3O A;  3WNX A;  3IBM A;  5E1R A;  2EAK A;  3SHR A;  1IPJ A;  5JXG A;  5C3R A;  1V6L A;  2E7A A;  1NA1 A;  2V4V A;  3IT8 A;  3AXE A;  4XFA A;  3ZFF C;  2BW8 A;  4XQ4 A;  4AWD A;  2JDU A;  1LHV A;  4NOT A;  3A7Q A;  4NE9 A;  3J7L A;  4NHL A;  5F6K A;  5IVY A;  4CXY A;  3THT A;  3O0X A;  3ZKU A;  4QKB A;  4FP2 A;  3KCC A;  1OD3 A;  5FWE A;  4BIF A;  3MV0 1;  2R49 A;  3ZSJ A;  4FBF A;  3BOP A;  1O6U A;  4LUM A;  1RB8 G;  2WWU A;  1WMD A;  2CAV A;  1LHU A;  4A42 A;  4L0P A;  1CGP A;  3WDV A;  1HRV 2;  2R04 2;  3ZXK A;  1UD1 A;  3QBQ A;  4LA2 A;  4N9H A;  3WXP A;  2VH9 A;  1FXZ A;  1VRH 2;  4RGG A;  2UUR A;  2WS9 1;  1J1T A;  3RPQ A;  2G9F A;  2VPV A;  4LR4 A;  3ZXG A;  2JIC A;  2XGX A;  3PME A;  3ZYR A;  4Q4V 3;  1NCR C;  2MPF A;  4XHX A;  4CCL A;  3AB0 A;  4AVC A;  4B4P A;  3VBH B;  1W9T A;  5AFE A;  1S2B A;  3B3Q E;  3MIH A;  3EYP A;  3ZVX A;  2OW4 A;  2WO2 A;  2ZEY A;  4YW1 A;  5BNP A;  2DFB A;  3IAQ A;  1LU2 A;  2B42 B;  1IPS A;  4I3G A;  5AC9 1;  1AYN 2;  1GP5 A;  1RUE 1;  3TB0 A;  3VBO A;  1P8J A;  1WKY A;  3LQC A;  5FMB A;  3K48 A;  3LA7 A;  3RRD A;  4BWO A;  1BKZ A;  2ERF A;  2XWB B;  4ZZ8 A;  2C1F A;  4QM9 A;  1VBD 3;  3BB6 A;  1AR6 1;  2NYY A;  2C5D A;  4NIG A;  5IVJ A;  2MHF A;  3S5Q A;  4LT5 A;  4YGE A;  1AJO A;  1OXC A;  2IXL A;  3AXD A;  1PIV 2;  4WVZ A;  5A6Z A;  2UY9 A;  5FY7 A;  1AR9 3;  3BGA A;  2XB6 C;  5LAT A;  1W8Z A;  1US2 A;  2J22 A;  4JQR A;  5A80 A;  1HKD A;  2PLV 2;  3H8U A;  2X5I A;  4P9L A;  3PTR B;  2XR4 A;  1EAH 3;  2PTM A;  4LHS A;  5L9V A;  4GB3 1;  1S0E A;  2WO3 A;  3FFQ A;  3BIW E;  4LO6 B;  3U78 A;  4K40 A;  1TQ5 A;  3J26 N;  3NJX A;  4BH9 A;  5GZG A;  2XVK A;  3EO6 A;  3MDP A;  4IEO A;  2ZGU A;  4FT8 A;  4FTE A;  3LWC A;  4A44 A;  3RWK X;  4E27 A;  4JRA A;  2ID4 A;  4BYY A;  3EJK A;  5JPN B;  3H50 A;  1C8M 2;  4BZ4 A;  2VW1 A;  1G9C A;  4CCO A;  3ZMN A;  2UU8 A;  2FBE A;  5A3M A;  2GC3 A;  2JX9 A;  4Z1V A;  3MUY 1;  5KHJ A;  5IVE A;  4WBB A;  4WM8 B;  4NRM A;  3HEI A;  1DLL A;  1RUH 3;  4MGS A;  4PHZ A;  1N3P A;  1A3K A;  1RYY A;  2XJQ A;  2CTV A;  3AK0 A;  1HQN A;  2JWP A;  4TWT A;  4X6R B;  1OLM E;  2WZR 2;  1SPP B;  4I0W B;  2RJK A;  2ZMN A;  4KG0 A;  1MS9 A;  3OB8 A;  2DUO A;  2B7Y A;  2WUH A;  3PIG A;  5CVR A;  2BPA 2;  4ET7 A;  3ZLI A;  5IFP A;  4EN6 B;  5IK7 A;  3B02 A;  4NUB A;  4QPI B;  5D8A A;  2YC0 A;  5EIY B;  2JDK A;  5J7M A;  1Z7S 2;  5J48 A;  1SLI A;  3M3C A;  4RFR B;  4MET A;  5E88 A;  3BTY A;  4LHL A;  3RZM A;  1CES A;  2QQP A;  3WG1 A;  2RM2 1;  5DAX A;  2MEV 2;  5FZ7 A;  4FOV A;  2Y0I A;  4FO9 A;  4E8D A;  5I0U A;  2Q8O A;  1URX A;  4BB3 A;  1QXR A;  5A7W B;  4MUV A;  4C1X A;  2YHJ A;  4QPG B;  2HWB 2;  4XIK A;  3POI A;  2VUL A;  1NCQ B;  4GWI A;  4XYX A;  4AGR A;  2J1T A;  2DVD A;  4B7K A;  3NAP A;  1R1A 3;  4QHB A;  1FOD 2;  3E1F 1;  4XFG A;  4CDU A;  1W3V A;  4V1P A;  3W20 A;  4LBK A;  1KEX A;  4DNY A;  4IEY A;  5L7O C;  1RXG A;  2PYT A;  2GZW A;  2Y64 A;  3MW4 A;  1BBT 1;  2PHD A;  4XXP A;  5FZ1 A;  1OFS A;  3ZMO A;  1FPN 1;  5IUQ A;  3NNL A;  4MSV A;  1YJK A;  2W47 A;  4MVT A;  4OI1 A;  3ST7 A;  5HBA A;  1M06 G;  4KGG A;  1DQ1 A;  1WWY A;  2RS5 3;  4YRD A;  1OHF A;  1YFY A;  5FWJ A;  1DLC A;  1R08 3;  1DQ5 A;  1RMU 2;  4UW6 A;  3J8F 2;  1UQX A;  2A71 A;  1NZI A;  2A3Y A;  2CU5 A;  2RDN A;  2J1R A;  4I30 A;  4L8Q A;  4N53 C;  2Q8C A;  3T2P A;  1HIX A;  4CU9 A;  2OVU A;  3LZZ A;  3PHM A;  1D4M 3;  2HLE A;  4URA A;  2JJ6 A;  1ND3 B;  2JEC A;  2BNM A;  4QDS A;  2WNU C;  4YM1 A;  4YM2 A;  4FTB A;  2VZS A;  1GQP A;  2BRT A;  1CAV B;  2HWF 3;  1LU1 A;  3B00 A;  4NPM A;  1XC6 A;  2ZGS A;  4PCR A;  3ZDV A;  4GJY A;  2EXH A;  1R09 3;  1W9W A;  1QJY 1;  4E2Q A;  1AL2 1;  2P1B A;  4MOA A;  1DFQ A;  1RUF 3;  1ZRF A;  4YGC A;  3DN7 A;  1QY4 A;  4YW7 A;  4NVP A;  3N9L A;  1F5F A;  2VMH A;  3HQR A;  1RUC 3;  4XW3 A;  3OBR A;  3LFI A;  2RVA A;  3EB7 A;  4YFW A;  3SCH A;  1DGW A;  2R1D A;  4LMF A;  2NMO A;  4XHB A;  2XJU A;  4Y5S A;  3V56 A;  3VB9 A;  2R07 3;  4FFH A;  3U11 A;  2E32 A;  3ENR A;  5L9R A;  1HDK A;  2E26 A;  1SLC A;  2JIJ A;  4OUL A;  2A73 B;  4IES A;  4JDO A;  3WNP A;  3VZL A;  3RZG A;  1MS8 A;  1SQ4 A;  1WLC A;  4H55 A;  4IGQ A;  4B8E A;  5F7U A;  2HWD 1;  3I2J A;  1SEF A;  2I07 B;  4MGZ E;  3K4A A;  3PVO A;  2OS2 A;  4DIQ A;  1K5M A;  4OFG A;  2BTV C;  4RS5 A;  1FX5 A;  5GLU A;  1GOH A;  2X53 S;  4K1Y A;  4FQ4 A;  4OLL A;  4XFI A;  1LB2 A;  4CA9 A;  4Q26 A;  1JBC A;  1OOP A;  2CWS A;  3WQB A;  3O1T A;  3AP5 A;  3WDW A;  4Y1Z A;  1R1Z A;  1UYX A;  1G8W A;  3VBO C;  5C4W B;  1IS5 A;  3AM2 A;  3NST A;  4AR2 A;  4UF0 B;  4EV0 A;  4EJR A;  4F83 A;  5FPV A;  3NV4 A;  4DOU A;  3FWE A;  1RGS A;  1H2K A;  2W1U A;  4CUC A;  3N9Q A;  2WFF 2;  3OUI A;  2LUW A;  5EZW A;  3WCS A;  3MPB A;  1JS9 A;  1Q8V A;  3V0B B;  2W9X A;  5F5C A;  3UYJ A;  5C7G A;  1NAE A;  2DDU A;  2GH2 A;  1OLR A;  2W94 A;  3C7O A;  1WD4 A;  5M0T A;  1OMI A;  2X5I C;  4MV2 A;  1HB1 A;  1H8T B;  2JD9 A;  4ZU4 A;  2VU9 A;  4LTA A;  3SQO A;  1A8D A;  4L97 A;  1PO1 2;  3UGG A;  2OII A;  2ORX A;  4NID A;  5CG9 A;  4RHV 2;  1ZZB A;  3AMH A;  2GP3 A;  3T30 A;  5K9Y A;  3VDD C;  3MFA A;  1I6X A;  3WIN E;  2R06 3;  4XUO A;  4A45 A;  1V0A A;  1MQT C;  3HPN A;  3RYP A;  4YVS B;  3KV9 A;  5DZE A;  5LAS A;  1Y43 B;  1LES A;  1RUE 3;  1UOJ A;  1UZW A;  1V6O A;  3KCX A;  3S7E A;  4Q4W 1;  5FO8 B;  2TNF A;  1GMM A;  5BNO B;  1LEM A;  3TAY A;  4ZPI A;  1GSL A;  2DVG A;  1SLT A;  4TZD A;  5C3P A;  3O1U A;  2C26 A;  1NE6 A;  1AR6 3;  3DEC A;  3LPF A;  2BWC A;  4AFM A;  2RS1 3;  5BYN A;  3SEE A;  2JG9 B;  4NWW A;  1HRI 3;  1QNW A;  2AC1 A;  1VBA 3;  3M3I A;  4AQT A;  5C5T A;  5D8A C;  5JCT A;  1OF4 A;  1W39 A;  3Q8A A;  2BZD A;  1S0D A;  2W68 A;  4Y1U A;  4O9E A;  1LGN A;  2QKD A;  4TSV A;  4LXL A;  1QJX 2;  4XJU A;  4CEW A;  4GB3 3;  3SNM A;  1ODN A;  1X7N A;  2WSV A;  1KFU L;  2JEM A;  3KGL A;  1QJZ A;  1UOB A;  3I2G A;  5LRR A;  1QKQ A;  2FCV A;  3OBT A;  4HLT A;  4FPY A;  2P37 A;  3ZFE A;  1RUD 2;  2A6V A;  2WQ4 A;  3CKH A;  4MX3 A;  1PX3 A;  2B9V A;  3ZOI A;  1V9U 2;  4NRP A;  3NAP C;  1QIQ A;  5HPO A;  4FXK B;  1IS3 A;  1RTV A;  2YC2 A;  5FY5 A;  3OBA A;  5FP9 A;  4QQP A;  3W9A A;  3VKM A;  5IVV A;  1JHJ A;  1OA4 A;  4LE3 A;  2WAO A;  1W8H A;  2D6L X;  1NYW A;  1YXW A;  4IDZ A;  2BU9 A;  1S0C A;  5DDJ 1;  4YVW C;  4W8J A;  2QDN A;  1YCI A;  2AR6 A;  1AJK A;  1ZM1 A;  2GN3 A;  3LA3 A;  2BFU S;  2VW0 A;  2P34 A;  1H1I A;  4QGL A;  2G9Z A;  1ALY A;  1QQP 2;  1WMF A;  3E6D A;  1NKG A;  5FZC A;  5IAV A;  1XNT A;  4LIV A;  4Q4Y 1;  4RR3 B;  2D3S A;  4NMI A;  5FKC A;  1WA6 X;  1LHO A;  4UBH A;  5T55 A;  3ZN4 A;  1XE7 A;  5FZ6 A;  5FTT C;  1QJF A;  1W2N A;  1ZRC A;  4PBP A;  1N1T A;  5HV4 A;  1BVV A;  1XXN A;  3FLT A;  4ZKT B;  2FCU A;  2D43 A;  4XUN A;  5HV0 A;  1FAT A;  4M0N A;  4A6S A;  5HXM A;  1GAN A;  2XBO 3;  2BOI A;  2K46 A;  2SBA A;  2QQN A;  5FPB A;  2J1A A;  3UJO A;  1FV3 A;  3F2Z A;  4D94 A;  2HJI A;  2ET1 A;  5C3S A;  1D0H A;  1O4Y A;  1H4G A;  3GHM A;  5FZO B;  4Q2F A;  5LBC A;  4J1X A;  3J7M A;  5JSP A;  3DUI A;  4IL7 A;  5IK8 A;  4OMC A;  1OQD A;  3DYP A;  1UPS A;  2WA3 A;  5FZ4 A;  4D7Y A;  3WNL A;  1DU3 D;  1ZZ9 A;  4Y22 A;  3VBF B;  4AED B;  3H9A A;  2XH6 A;  4GQ7 A;  5JZG C;  1BBT 3;  2YZ4 A;  1O59 A;  1IZ3 A;  1FPN 3;  4W6Y A;  3I59 B;  1LED A;  5F1R A;  5JIU A;  1RUJ 3;  3O1R A;  3O0W A;  1Z78 A;  4M3C A;  3ZYH A;  4LBN A;  3VBS A;  4QXH A;  5FQ0 B;  1JZ5 A;  3KVA A;  2RS3 2;  2D98 A;  3M70 A;  4CCK A;  1OFN A;  2OA2 A;  1NE4 A;  1WCS A;  2EIE A;  3HOB A;  5EWS A;  4AL9 A;  4Z92 B;  2ES3 A;  2P3I A;  3DPR A;  4Q4X 2;  2J7M A;  4XFH A;  2WNV C;  2A7A A;  4FPC A;  1WW5 A;  3MLJ A;  1BEV 3;  1KFX L;  5DAQ A;  3KT1 A;  3WW2 A;  4WVM A;  4CEY B;  4D0Q A;  1FAY A;  2C24 A;  1OOP C;  3UL2 A;  1OBN A;  1QH7 A;  1RUN A;  3CF6 E;  1U12 A;  2WA4 A;  4FPH A;  3ZX7 A;  1HRV 1;  5FZD A;  3TRS B;  3ZYP A;  3VBR A;  1VRH 1;  1V70 A;  3JZV A;  4P9I A;  4LKD A;  3FN9 A;  1POQ A;  2DFC A;  3AP7 A;  3ZXD A;  2ENR A;  1HW5 A;  2EA7 A;  1ACC A;  3QLQ A;  3AFK A;  4BQ3 A;  3MF6 A;  2YV8 A;  4RGK A;  3WR0 A;  4EN9 B;  5CA6 A;  1J59 A;  3MW3 A;  2Q5T A;  3QH6 A;  3KQR A;  5LRS A;  2YPD A;  3BAL A;  1CON A;  4Q0S A;  4UW5 A;  5I93 A;  1I3H A;  1ZBE 2;  2VNR A;  3DYO A;  4M4P A;  4S2F A;  1O3R A;  4KQ7 A;  2QBX A;  2QQJ A;  2D40 A;  2AEY A;  1AYN 1;  3DV8 A;  4MHU A;  4RGA A;  1GWL A;  3AZV A;  4D3W A;  5FY0 A;  1B09 A;  4E9K A;  4GH4 C;  5FOJ B;  4F7Z A;  1CZT A;  1OUX A;  2ZAC A;  3GJA A;  2VAU A;  3OPW A;  4N7U A;  4OHY A;  3CJX A;  4KU7 A;  5EJZ B;  2QQI A;  1UOF A;  2FMY A;  5LA2 A;  1CIW A;  1RHI 3;  2JE9 A;  1KDM A;  2ORZ A;  2XLA A;  4UXA A;  5JAX A;  1W8W A;  2YU2 A;  1JH5 A;  2VUC A;  3AL5 A;  1LHW A;  3IM0 A;  4FOY A;  4XZU G;  1PIV 1;  3ZFG A;  2QQW A;  4XJ9 A;  5IVB A;  1TMF 3;  2VO5 A;  3FUQ A;  2WQZ C;  1H9P A;  4CDW A;  1ZVF A;  1ZZ6 A;  2PLV 1;  4K3U A;  3LE0 A;  3N9N A;  4DUW A;  4YG0 A;  2IXK A;  4IND A;  1Y9G A;  3A23 A;  3RYK A;  4AXO A;  1UY1 A;  4GAL A;  5FZK A;  5G05 L;  1JOD A;  5CYY A;  1JOP A;  4JDM A;  2YFU A;  5CIR A;  1PGS A;  1WA4 A;  4XFB A;  3ACL A;  4U2A A;  1XYN A;  2VR4 A;  4IV3 A;  5CFC A;  2BFU L;  4UOJ A;  2VVF A;  4RSU A;  1LCL A;  1C8M 1;  3USS A;  4Q1P A;  4CEW C;  4A3Z A;  1AL2 2;  1WW7 A;  2CAU A;  4FTS A;  1A78 A;  1O5L A;  4YFZ A;  3V0A B;  4JZR A;  3DKQ A;  5FPL A;  4UFL A;  1AR8 2;  1PK6 A;  1W6N B;  1T2X A;  3IZO A;  5FZ3 A;  1XQN A;  2WZR 1;  5A32 B;  1LUL A;  2NLR A;  3ZFE C;  1SHW B;  2IUW A;  3ZN6 A;  2FDG A;  2XOM A;  1CAU A;  4WZF A;  1ND2 B;  2R6Q A;  2BBV A;  5FZL A;  3QAC A;  5CKN A;  3E6C C;  3O14 A;  1GR3 A;  1TME 3;  2D6M A;  3OGV A;  3CU7 A;  2ZGM A;  3AKS A;  5EHD A;  3WF3 A;  1F4H A;  1YO8 A;  1FMD 2;  4BQ4 A;  4D7T A;  1QU0 A;  4GIQ A;  1NX9 A;  4LBQ D;  4Z82 A;  5FOB B;  3VKL A;  3WY6 A;  2IFR A;  1H9W A;  3E5Q A;  1SDD B;  2WQ8 A;  2WZ8 A;  2MEV 1;  4IEQ A;  3NRU A;  2O8Q A;  4KWJ A;  4XXA A;  3VKO A;  2ARE A;  3M1H A;  5FXV A;  2D7F A;  4XUR A;  1UZV A;  5HCF A;  1XE8 A;  5A33 A;  3T2O A;  2FDF A;  3OGJ A;  4BJ0 A;  2HWB 1;  3W21 A;  5FFO C;  3LFM A;  4XQD A;  4PLM A;  3GCX A;  4BQX A;  1UKR A;  5FZI A;  3ZFF B;  1VAM A;  4K9S A;  3WNK A;  2VZV A;  4RFT 0;  4DPN A;  3ES4 A;  3ZDS A;  4E4H A;  4ZS2 A;  1UIK A;  3IIA A;  5JXJ A;  1FOD 1;  2DVB A;  3R05 A;  3I2O A;  5KHK A;  1AR7 3;  3POY A;  4QB1 A;  1ENX A;  3THP A;  4CDX A;  1Y3T A;  1FNY A;  4OQ9 A;  1LOF A;  4HET A;  5JMO A;  4LBQ B;  1HV0 A;  2D6O X;  3GBG A;  3JCI A;  2WL1 A;  4FP3 A;  2WFP A;  1W6P A;  1WBL A;  5FK7 A;  4BOW A;  2BGP A;  3WP3 A;  2BOJ A;  3LF7 A;  1RMU 1;  4LBL A;  1COV 2;  2PHX A;  1I9R A;  2Y6F A;  3J8F 1;  3P3P A;  2XLG A;  1NLR A;  4KNC A;  5ABJ A;  5A7Q A;  1UW8 A;  4OUE A;  2WIN B;  3GJB A;  4PQ9 A;  3H8O A;  1EUU A;  2JDY A;  2SLI A;  5CAZ A;  1NCR B;  4IV1 A;  1XU2 A;  3E6B A;  5JOY A;  3KT4 A;  1IOA A;  5J96 B;  2WYF A;  3I2D A;  1OUR A;  1Q8Q A;  4MGT A;  3AL6 A;  3JBG 2;  1W0O A;  4Q4Y 3;  5CFD A;  4HN0 A;  4LUL A;  3CJI C;  1D2S A;  3HNY M;  2ZOE B;  1VBC 3;  1FYU A;  3DPR C;  5A7N A;  3WVJ A;  5JLV A;  1OF3 A;  4XF3 A;  3ELN A;  3FHA A;  2YPJ A;  4NHX A;  4YZ4 A;  4YGB A;  1WZX A;  2IZW A;  2FDH A;  5ACA 3;  1GZW A;  3Q8F A;  1ZA7 A;  1TEI A;  4XEZ A;  1W9F A;  4LK7 A;  5F3G A;  3AP4 A;  4IXL A;  4B29 A;  1JYV A;  1QOT A;  1CD3 G;  2XJV A;  4FFI A;  4I01 A;  4MAD A;  4ES8 A;  4NWV A;  5FPX A;  2W2I A;  2DTW A;  3KF5 A;  5DG2 A;  1N1V A;  5A6Q A;  3PUH A;  1UIJ A;  4XJZ A;  4AI8 A;  5CG8 A;  1B35 A;  5C5U A;  2XJT A;  4RQP A;  4P5H A;  2J1S A;  2RMU 2;  4XFF A;  4YGD A;  5E89 A;  1RJ8 A;  2I74 A;  1JYW A;  2RR1 2;  2Y6G A;  4AHZ A;  4SLI A;  2AGS A;  3D4K A;  4PF1 A;  3KWV A;  5FXZ A;  4H2A A;  2XKO A;  5KR7 A;  4NHY A;  5FP4 A;  3OGG A;  3FHI B;  2CYF A;  5FBJ A;  1LGB A;  3HJR A;  5FYB A;  4NHM A;  1H2L A;  2GSY A;  4EN8 B;  3K4Z A;  4DFS A;  3PUR A;  4Q0V A;  1SBD A;  3NL1 A;  4XFC A;  2A3W A;  5BUV A;  1W0P A;  3L2H A;  4GMP 3;  1UZ0 A;  1IGO A;  2WFF 1;  1OKO A;  2XL9 A;  2CSG A;  2R04 3;  2ZGP A;  2VBD A;  4IQP A;  5K4L A;  4AQS A;  3ZFG C;  5TSW A;  4TTG A;  3OG2 A;  4QWN A;  2QTW B;  3EXU A;  1HXS 2;  4CDW C;  4YSF A;  3VKN A;  2YY1 A;  5H9S A;  1ULO A;  5FJH A;  1RUG 3;  3AZZ A;  5C9A C;  1G86 A;  2PN5 A;  2WR9 A;  5A1F A;  1YLL A;  2RDQ A;  3O1P A;  1PO1 1;  1LEN A;  4BK5 A;  4DQA A;  1CZV A;  1LGC A;  4RHV 1;  5FPA A;  3RG0 A;  1MZE A;  1EP0 A;  4HT1 T;  1U5Z A;  3BUC A;  5K7P A;  3ZYG A;  1U5I A;  1W2T A;  1WBF A;  1J83 A;  5F2W A;  1IS6 A;  4QKF A;  3N9M A;  3RZJ A;  1IS4 A;  4IV3 C;  1JU4 A;  4NPL A;  3Q8E A;  5L36 A;  1AYN 3;  2FHR A;  2A70 A;  1X8E A;  3QOP A;  3SC7 X;  1JYN A;  3VZJ A;  1GUI A;  5F5I A;  2ZGT A;  3X29 B;  3ACG A;  4ZY9 A;  2Q1F A;  2E33 A;  4HVQ A;  3NV2 A;  3R6S A;  1PK6 C;  2H0B A;  3OD0 A;  5FK8 A;  2NZ9 A;  2WC2 A;  2ZML A;  3ABZ A;  3IDE A;  4WV8 A;  5FP3 A;  3BU0 A;  4A41 A;  3U07 A;  1RUI 3;  1VBB 2;  1DYO A;  2W1Q A;  4L11 A;  4MGI E;  4N9I A;  5L7O B;  2VCA A;  4F8A A;  3GNE A;  1W2U A;  1ZA4 A;  2XHN A;  4LQR A;  1ZRE A;  3LIG A;  1HV1 A;  2K9Z A;  3AKR A;  4ES9 A;  4I3P A;  1CX4 A;  2PLV 3;  3LEK A;  4FAG A;  1CIY A;  2KM2 A;  2KD7 A;  1Y7B A;  4KL1 A;  1QJX 1;  3PVE A;  1Q8P A;  1W6M B;  2R0H A;  4N43 B;  1UXX X;  2WJS A;  3RZZ A;  3PU8 A;  3MIG A;  1YQC A;  2BGC A;  2YB7 A;  3FC0 A;  3WG3 A;  1BXH A;  2GAL A;  5CKM A;  1UZY A;  3OUJ A;  2D3R A;  3OD4 A;  4AAX A;  1RUD 1;  2WSU A;  4YM0 A;  2WNU B;  1C8M 3;  4D6R A;  1W90 A;  3I2H A;  1V9U 1;  3TN9 2;  5EXO A;  2WLP A;  1IKQ A;  3A0K A;  4OHX A;  3S0M A;  4CXW A;  3BTA A;  2VC9 A;  5D2A A;  5DUW A;  4BLI A;  4CDQ A;  2BV4 A;  1IG0 A;  4J25 A;  1NLS A;  4Y5T A;  2WZR 3;  3ZXL A;  1LOF C;  2KXL A;  4OZX A;  2Z42 A;  2VME A;  4C91 A;  1F8V A;  4V2W A;  3VBH A;  1PO2 2;  5IAX A;  4GWN A;  2HEY F;  2E51 A;  1Z7S 3;  4NPR A;  2VMD A;  1QQP 1;  1TVG A;  2GND A;  3QH7 A;  4JHZ A;  1TNF A;  1CJP A;  3MBW A;  1LOC A;  3FMG A;  5ABJ C;  3ZN5 A;  1JYI A;  4CCD A;  4ZXE A;  5BNN A;  1DP0 A;  3ZR5 A;  2PHR A;  5FYZ A;  2MEV 3;  3HR9 A;  4AI3 A;  1QXJ A;  1H30 A;  2ZZQ A;  5H9Q A;  1EUT A;  1ULE A;  2FDI A;  3E97 A;  1JZ6 A;  3WDY A;  2O1Q A;  4HPK B;  4K7J A;  3WLU A;  1AUY A;  5CFD C;  1HB2 A;  2ADE A;  4XDO A;  2EIC A;  3PTY A;  1IQD C;  2JXA A;  5LEK A;  1C3H A;  2VOT A;  5T5P A;  4XDQ A;  2TUN A;  2WT0 A;  2X10 A;  1DGR A;  1FOD 3;  3BI3 A;  1OA3 A;  5GZE A;  1ENS A;  1W9Y A;  1RJ7 A;  4KWU A;  2ZPX A;  3UJQ A;  3VHO A;  5IVF A;  3OYW B;  1S0G A;  5J09 A;  2PHF A;  3D0S A;  4JC1 A;  1UU5 A;  2DUR A;  2B39 A;  1J1L A;  1MEC 2;  4L9B A;  4CCE A;  4BXS V;  1X8M A;  2GMM A;  2HWE 2;  3AKQ A;  3C7F A;  3WSO A;  4YZ5 A;  4M01 A;  2R32 A;  4GD4 A;  1RMU 3;  2XON A;  2RS3 1;  5C8C C;  2PHW A;  1B35 C;  1MS1 A;  3GXU A;  3T3Y A;  1OLM A;  1LAJ A;  4Q4X 1;  2ARA A;  4EE2 A;  4AI0 A;  1OD5 A;  2JD4 A;  2DVF A;  1BYH A;  5DZG A;  2B45 X;  5B4X A;  4WM8 A;  2E7T A;  2H6B A;  2BBA A;  2FZ1 A;  3Q9O A;  2BUK A;  5T5J A;  3VD9 A;  4P9Y A;  3N3H A;  1QOO A;  5CEH A;  3N36 A;  2R0F A;  2E53 A;  3VDD B;  1C1F A;  3HN3 A;  1SPP A;  1N3Q A;  1WLW A;  1MQT B;  3WCR A;  2ZAA A;  4JRL A;  5SV8 A;  1ODM A;  2G19 A;  4WZC A;  3N9O A;  3CMG A;  1H6X A;  5AFB A;  4PQQ A;  4QX0 A;  3ZXA C;  4CP9 B;  4LK6 A;  4LKS A;  3K75 B;  4XUP A;  4KI5 M;  5DQ0 A;  2OUJ A;  2ZX2 A;  2UWB A;  1XYP A;  3PLQ A;  1JZ2 A;  4D7S A;  4HKL A;  4MG2 A;  1POV 1;  2Q0A A;  4CUG A;  4IEW A;  1YUD A;  4LEJ A;  1ULC A;  1KS4 A;  3POS A;  4KU8 A;  3SMH A;  4Q4V 2;  4CTE A;  1DDL A;  4AOC A;  1OPO A;  3ZM8 A;  1ZBE 1;  2IWG B;  5CIS A;  1CVN A;  4MH0 E;  4HSL A;  4QPG A;  4AVS A;  4FVV A;  4XMA A;  5CAD A;  5FZM A;  3PUA A;  2JKB A;  3KB5 A;  3BN6 A;  5FPU A;  3RMY A;  4QDQ A;  1O8S A;  3WHT A;  1KXG A;  4XCB A;  1DYP A;  2VQ0 A;  2D6P A;  2OX0 A;  2FD8 A;  1NLQ A;  3VBU B;  2P6H A;  4S2G A;  3HVD A;  2Y26 A;  4DRR A;  4XAA A;  2GNB A;  4UFI A;  1U5Y A;  1VBD 2;  3JB4 C;  5DAW A;  3SEP A;  1POV 0;  4AEK A;  4NAO A;  4WM7 B;  3ROU A;  4B4Q A;  1X50 A;  2RJL A;  1QH6 A;  3GBF A;  4HVR A;  3SIS A;  5IK4 A;  2WKK A;  1H2M A;  2VE1 A;  1EV1 3;  3NAP B;  4GKY A;  4AK3 A;  4JGZ C;  1PVC 2;  4LLF A;  1AVB A;  1KDK A;  3BTZ A;  1ASJ 3;  3I49 A;  1GYK A;  2WO1 A;  3U1X A;  3UT0 A;  5FY1 A;  2WLQ A;  1NA1 C;  2ARX A;  4NO4 A;  4YVW B;  5FMO S;  1AX2 A;  4JTN A;  2ATF A;  3BVC A;  4PIZ A;  1CAV A;  1H0B A;  2Y6K A;  4CCM A;  4CZS A;  3GZE A;  4Z07 A;  2VQU A;  1D4V B;  2XXZ A;  3AP9 A;  1DZR A;  1HQL A;  3QCW A;  3WT3 A;  1PO1 3;  1VMH A;  4MGY E;  4AGG A;  4AFA A;  1F9K A;  5KXC A;  3S5A A;  2XQX A;  3RFR A;  1VPH A;  1W2O A;  3HBZ A;  3DF0 A;  3IMM A;  4IER A;  4PI2 A;  1W6Q A;  5JR7 B;  1AR8 1;  3INA A;  4XIO A;  4YLZ A;  5KHH A;  3NQH A;  5EPA A;  5J37 A;  1ZBA 3;  4LKE A;  4DXZ A;  2VJX A;  1F5J A;  3M3Q A;  3OGS A;  1GNH A;  1E5H A;  1JZ7 A;  5GJ6 A;  4QAW A;  4FPJ A;  3AMN A;  2UWA A;  5A3T A;  4AF9 A;  5DMY A;  3T1M A;  4LNV A;  1E5I A;  2G9G A;  2K2S A;  1O5U A;  1FMD 1;  2OQ6 A;  4CDQ C;  1GV9 A;  4YZ2 A;  2QQM A;  3VHN A;  3EQE A;  4URT A;  3APB A;  1QJU 1;  1GLH A;  1QNY A;  2W3J A;  4CP2 A;  2X29 A;  4NR1 A;  3JD7 2;  2EVX A;  2Q1Z B;  1UO9 A;  3HD8 B;  5JZG B;  4HK9 A;  5BNP C;  1G9F A;  1N1S A;  1SFY A;  3OF1 A;  5LA1 A;  1JZ3 A;  2QFE A;  3NVC A;  1W6O A;  2BJS A;  3KM5 A;  2IVI B;  3RGB A;  5A6Y A;  4OCT A;  3ATG A;  5BNN C;  2OPW A;  3WG4 A;  2PEL A;  1UWW A;  1AHS A;  3EMR A;  2CL2 A;  1GFF 2;  3ON7 A;  4UF0 A;  4XBL A;  5FUP A;  3I3B A;  1NUK A;  2WNV B;  4AG4 A;  2AYH A;  3NV3 A;  4FAH A;  1W2A X;  1R1A 2;  1RUD 3;  1KGY A;  4AI9 A;  1F35 A;  1YQ6 A;  4FXG B;  2A6Z A;  2KR2 A;  5KHG A;  2QQU A;  4P08 A;  1HLC A;  1OOP B;  2JKX A;  2WS9 3;  4QQL A;  4UW3 A;  3V0B A;  1FNZ A;  2V5Y A;  4IEX A;  1C8N A;  1AF9 A;  1WCU A;  4P00 B;  4QMA A;  1COV 1;  5DN2 A;  3NNG A;  3TOJ A;  2EIB A;  4XAC A;  3RVH A;  1GQH A;  1H8T A;  1OLQ A;  2RS5 2;  2YYO A;  3JQX A;  5DZF A;  4BMB A;  4EWA A;  1RVF 1;  5F37 A;  1WGP A;  1BJQ A;  1DF0 A;  3HT2 A;  5FKB A;  1XJA A;  2IC1 A;  3FUO A;  2VMI A;  1OH3 A;  5FLJ A;  1QQP 3;  4MXW B;  1L7L A;  2OZJ A;  1D4M 2;  4N8M A;  3JBG 1;  3RJR A;  4AQ2 A;  5JWP A;  1JOJ A;  2VXR A;  3WF1 A;  2VMF A;  4A4A A;  5AC9 3;  2CV6 A;  1QHD A;  4YVS A;  2OUH A;  4ASM B;  3LDR A;  4YW4 A;  1QMJ A;  2HWF 2;  5FLH A;  4BPZ A;  5BNO A;  3POF A;  3ECQ A;  4WM8 C;  5T50 A;  3VKF C;  1R09 2;  3MPP G;  4DY3 A;  5KC5 A;  4GH4 B;  1DBN A;  2R1B A;  3HQU A;  1VBE 1;  2QQL A;  3RSJ A;  1RUF 2;  1MS3 A;  2B8M A;  4OUS A;  1N3O A;  2D5F A;  2JG9 A;  4R9B A;  4K6B A;  2EAL A;  2B4K A;  3ZYB A;  3I3M A;  3C7E A;  4UFK A;  5JI7 A;  1J58 A;  2VBP A;  3KSC A;  4FPL A;  3UK9 A;  5DAV A;  3EBR A;  5IT6 A;  3HNM A;  3ZPY A;  1GQG A;  3DKW A;  3NJV A;  4HKW A;  4QDR A;  1UF2 C;  3SH4 A;  1Q8S A;  4LOS A;  2VTX J;  5DAP A;  3ZYJ B;  2O8O A;  2R07 2;  2RMU 1;  4AW7 A;  1V6J A;  4CVU A;  4FFG A;  2VTX A;  2RR1 1;  2VVD A;  4GKX A;  3A4U A;  1JUI A;  2AEN A;  4YPJ A;  2Q8E A;  5FRE A;  3SKV A;  2GME A;  4YM3 A;  1DCS A;  1K3I A;  1V00 A;  2IXI A;  2RS3 3;  3CHX A;  4LUK A;  4QPG C;  2J1E A;  5FZF A;  3WQ0 A;  1F15 A;  2VTF A;  3U4S A;  4EZ4 A;  5FBZ A;  3IN9 A;  3P6B A;  4R52 A;  5FPZ A;  2WII B;  1KJR A;  4FQZ A;  4JGY B;  5FMO L;  5H9P A;  5DAB A;  4XJ8 A;  4E8C A;  1M4W A;  1XPW A;  2Y6L A;  3M2M A;  4MZU A;  5FZ9 A;  2ZHM A;  2YUE A;  4CDU C;  1NQJ A;  1RED A;  4CEW B;  1KQR A;  5HCA A;  4FPG A;  3W5N A;  2ILM A;  1KRI A;  5J36 A;  2ZGN A;  3WEZ A;  5FYV A;  3PUQ A;  2ZEZ A;  5LW9 A;  1DG6 A;  2Y6J A;  1UAI A;  2OZ6 A;  3MHZ A;  2P3J A;  1SZB A;  1WME A;  2JE7 A;  2VZU A;  3ZFE B;  2JIG A;  1K45 A;  4TLF A;  5FLI A;  3AMQ A;  1PMJ X;  1HXS 1;  1Q3E A;  2GP5 A;  4JDN A;  2IXH A;  3J7N A;  5F9T A;  4KWK A;  4AFD A;  4ARY A;  1YFX A;  4RR3 A;  3WNM A;  5EP9 A;  2RM2 3;  5LEJ A;  4IEP A;  3O7O A;  1POV 3;  3OEB A;  1W99 A;  5HCB A;  4C1W A;  4PDW B;  3GM8 A;  1PVX A;  3USU B;  2A6W A;  3RNS A;  2NQY A;  4A6O A;  1ZBE 3;  2VGD A;  2BVV A;  5JMC A;  1WLT A;  3QD6 A;  3UET A;  3NWK A;  1PMH X;  3KV6 A;  2F4P A;  4Q5O A;  3T09 A;  2R06 2;  2X8K A;  1I1E A;  3AZY A;  2WN3 A;  2EXK A;  5FZO A;  4AVA A;  3HBK A;  2W95 A;  1UU6 A;  1S0B A;  2E63 A;  2OKX A;  1ZNP A;  2ZHL A;  4HSJ A;  5F6L B;  2CGN A;  5I8T A;  3I2F A;  1H8V A;  1NY7 2;  4XPV A;  4Y1V A;  3AMP A;  3CLP A;  3AFG A;  5K0U B;  1LHN A;  3VBF A;  1VBB 1;  1OSG A;  1WLD A;  2EAA A;  1Q8O A;  3I59 A;  1ENR A;  2HWC 2;  5J3U A;  5FXX A;  1HB3 A;  1OVP A;  1PNF A;  4CE8 A;  2RS1 2;  2JG8 B;  1K5J A;  1JUH A;  5DUX A;  1O4Z A;  1HRI 2;  1XYO A;  2ZGQ A;  1VBA 2;  3LSE A;  1GWM A;  3ORJ A;  5FQ0 A;  1SFN A;  1HB4 A;  4HAN A;  1EPW A;  1I5P A;  4QGM A;  1K5M C;  2Q8D A;  1FI2 A;  4RS5 C;  3PVN A;  4A7K A;  4Y20 B;  5EFU A;  3UES A;  3AX4 A;  3N4M A;  3J7H A;  1X33 A;  3O1V A;  2DYC A;  5F32 A;  2GNT A;  4M3C B;  3M7A A;  3AP6 A;  1QJY 3;  1FT9 A;  3JB8 A;  2QZ2 A;  4EQV A;  1AL2 3;  3TN9 1;  2ZGR A;  4YZ3 A;  1DQ4 A;  4AEM A;  3T0A A;  3CJI B;  4NRO A;  3DPR B;  2WBK A;  3MZH A;  5IJR A;  1WUV A;  2BWA A;  3FLP A;  4EWD A;  4WVM B;  5CB7 A;  4YNI A;  4ZU7 A;  4XBQ A;  5BXX A;  1PO2 1;  2XG3 A;  5C6C A;  3P3N A;  5BPX A;  3SXW A;  4BIO A;  4O9G A;  4PT6 A;  1GP6 A;  1WMX A;  5JSO A;  4ISR A;  5F3E A;  5FXW A;  2BDR A;  1PGW 2;  2DBI A;  4ASK A;  1FMD 3;  1PM4 A;  4AI2 A;  2DF7 A;  3O1M A;  2BEO A;  1CR7 A;  2JEN A;  1RIT A;  2XJS A;  3LAG A;  1H8T C;  1K42 A;  2HWD 3;  4IGO A;  4JCK A;  4JVA A;  4QQ2 A;  4A7Y A;  2C6S A;  5FCC A;  5JSR A;  2NP0 A;  1MR5 A;  4W50 A;  1QOS A;  4XJA A;  4FPE A;  4AZZ A;  4XBN A;  2F4L A;  5LA0 A;  2RE9 A;  2PQQ A;  1PZ9 A;  1US3 A; 
#chains in the Genus database with same CATH homology
 3O1T A;  4IE4 A;  5DAB A;  4NRM A;  2IUW A;  2FDG A;  4CXX A;  3O1O A;  3BI3 A;  3RZK A;  4RFR B;  4O61 A;  3BTY A;  2FDK A;  3O1R A;  3RZM A;  3O1P A;  4QHO A;  3T3Y A;  2FDF A;  4NID A;  3BUC A;  3BIE A;  4IE5 A;  4OCT A;  3LFM A;  4CXY A;  4NIH A;  4QKF A;  3RZJ A;  4QKB A;  4NPL A;  5F8P A;  4IE0 A;  4ZS2 A;  3I2O A;  4NII A;  2FDJ A;  4IE6 A;  3O1U A;  3BU0 A;  3KHB A;  3BTX A;  4MG2 A;  3O1S A;  3BKZ A;  3H8O A;  3KHC A;  3I3Q A;  3RZL A;  4O7X A;  4QKD A;  3T4H B;  4MGT A;  4NRQ A;  3O1V A;  4NJ4 A;  4NPM A;  2FD8 A;  4NIG A;  2FDH A;  4NRP A;  4NRO A;  4IE7 A;  4CXW A;  4JHT A;  4QKN A;  3I3M A;  4ZS3 A;  4IDZ A;  3RZH A;  3H8R A;  3BTZ A;  3T4V A;  3I49 A;  3S57 A;  3O1M A;  3H8X A;  3RZG A;  4ZHN A;  3S5A A;  2FDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...