4NJ4A

Crystal structure of human alkbh5
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
218
Chain Sequence
DYEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTYGAQPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords RNA demethylase ALKBH5
publication title Structure of human RNA N6-methyladenine demethylase ALKBH5 provides insights into its mechanisms of nucleic acid recognition and demethylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 218
sequence length 223
chains with identical sequence B
ec nomenclature ec 1.14.11.53: mRNA N(6)-methyladenine demethylase.
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nj4A00
3RZGA 4NPLA 2FDGA 2FD8A 3I2OA 4NIGA 4MG2A 4CXXA 3BIEA 5DABA 3RZMA 4QKFA 4QKDA 3BU0A 3O1SA 4IE6A 3O1VA 3BKZA 2FDKA 3KHCA 4NIDA 2FDIA 3RZKA 3T4VA 4JHTA 4O7XA 4NRPA 4O61A 2FDJA 3S5AA 4NRMA 3LFMA 3BTZA 2FDFA 4NROA 2FDHA 4MGTA 4NJ4A 4IE4A 4ZHNA 3I3MA 3RZHA 4CXYA 4ZS2A 4NIIA 2IUWA 4IDZA 3I49A 3T3YA 3BI3A 3RZJA 4NPMA 3H8RA 3O1TA 3RZLA 3H8OA 4RFRB 3BTYA 3H8XA 4ZS3A 3O1RA 4QKBA 4OCTA 4IE7A 4NRQA 3O1OA 4QKNA 5F8PA 4IE0A 4NIHA 3O1UA 3KHBA 3O1MA 3O1PA 4QHOA 4IE5A 4CXWA 3T4HB 3I3QA 3BTXA 3S57A 3BUCA
chains in the Genus database with same CATH superfamily
2D98A 1AVBA 1NG0A 5DZFA 1CAWB 3TNPB 4IEUA 1PM7A 3I54A 4R9CA 1I1EA 4LQRA 1QXRA 3ILFA 4KMQA 1ZREA 4MGZE 3JZVA 1BYHA 4YW2A 1Z78A 4KI5M 3DYOA 2WR9A 3AJZA 3WNOA 2VZTA 3FUOA 2PHTA 2VAUA 3KT1A 1O4YA 4FO9A 4P14A 3ZN6A 2P3IA 4QKFA 3KV9A 1J3PA 5SV8A 3ZFFC 5LA0A 2AEYA 1NQJA 2C6SA 2WN3A 1QDOA 3LDRA 3N36A 3M2MA 4LOSA 1GQGA 4M3CF 1LGBA 4AI8A 2ZPXA 1QGLA 1NLQA 3V65A 3IIIA 1V70A 1AYN2 4I0AA 3O0WA 5C3OA 3DL3A 4UWDA 4CCCA 2BNNA 2C24A 2YC4A 4R4ZA 5GALA 3VHNA 4Z07A 4S2DA 3ZYJB 4LTAA 4OULA 5FZAA 1RUF3 2VNGA 4LLOA 3KHCA 2RS13 1LAJA 3TYJA 1AR93 4X6QB 4RGGA 4WVMB 4DUWA 1RXGA 1C1FA 4XETA 4AEDA 1W9FA 2Q8DA 3OSDA 2D43A 1LR5A 5DAVA 2BW8A 1KEXA 4UT5A 3PUIA 3ZOIA 2X5IC 3LEKA 2W2IA 4JV4A 1LHNA 4LO6B 1CQ9A 1NCQB 3HNBM 2BGCA 3E6DA 3QBQA 4HPKB 2WZPP 1V6NA 3T2QA 3ZFGB 3SKJE 1SBDA 2ZGQA 4YPJA 2PAKA 4M0HA 1NCQA 5FPBA 4AI1A 4Z92B 3MICA 3BALA 4HKOA 4QMAA 2BYVE 2VQ0A 2E63A 5T52A 4D7TA 3NAPB 3P3PA 4EROA 3LIGA 3OYWB 5BNOB 1SDDB 4RN5A 3ASIA 3NAPA 1W6QB 3OYWA 3I3DA 1ZRIA 4Q4W3 4XF1A 4J6GA 4AHWA 5HV4A 5IK8A 1OOPB 4XCAA 1FATA 2BERA 1LU1A 3MIGA 3UKTA 4Q4X1 5FWJA 4P9YA 3VBSB 1EAH3 4JRLA 4JKMA 3LDBA 4YW7A 1NA1A 1ASJ3 1PX3A 1DQ2A 5F32A 3POFA 2CGOA 2WNOA 2JDPA 1L7RA 2R042 2YU1A 4IEYA 4BZ4A 2NLRA 1W6OA 2ARAA 2R041 2VCMA 2PMWB 2VQAA 2WAOA 4IEWA 4QX5A 4CP9B 1GOGA 1YIFA 4A42A 3H1YA 3I7DA 1N1SA 2FMDA 4P9IA 2KM2A 1O3SA 2E31A 3M4FA 1LOAA 5A3PA 3PMSA 3JXSA 1YJLA 3WW2A 4ES9A 1EUUA 1C4RA 3NKGA 1TZOA 4CDXB 1Z7S2 2A75A 3BGAA 3EO6A 4QB6A 4QHOA 2B7YA 2IC1A 2JE8A 2P34A 3ZXEA 4BLJA 1VMFA 1RVF3 2Y38A 3OBTA 3ILNA 3THDA 4BOWA 4OMDA 5IVEA 1ST8A 3QH7A 1XNTA 2D6MA 1WW6A 4D6SA 4LK7A 1CVNA 2W1WA 2DV9A 4KG0A 4RGKA 1A8MA 3RRDA 4CCKA 2XLGA 4DMIA 5KXCA 1VB2A 2PLV1 1J1LA 1KFUL 2JICA 2WIIB 2FCVA 2JDMA 1HQWA 4ZXKA 2RR12 3VUOA 3B93A 5A7WB 5I8SA 2RR11 4JVAA 3GHNA 2I07B 4QKDA 3WZ1A 1X36A 5A7WA 2GAUA 4OUEA 2VMFA 2Q4SA 1KS4A 2IXHA 1JZ2A 3MIHA 2DFBA 1LRHA 2FCTA 2HJIA 4CEWC 3O1SA 2VZOA 3C7FA 4X8PA 1COV3 3W5NA 4N7IA 4XJAA 3JD72 5CEHA 5KC5A 3WUDA 1F15A 1O5UA 4RR3B 4S2FA 4KWJA 3JB8A 4DY3A 2BZDA 4YWAA 4D69A 3C7EA 2R073 4Q0UA 1WA6X 4JX0A 2D6PA 1S0IA 4JHTA 4AG4A 5AC93 2IFRA 2JDUA 1W05A 2Y6HA 1AYM2 3POJA 3M3EA 4FXKB 3THTA 2XONA 4PIYA 4AVCA 4C91A 1QJU1 1AYM1 2GP5A 4RS5B 3ZPYA 5ANQA 3O7OA 4LIUA 4NE9A 2YHJA 2DCYA 5A33B 5EV7A 5I91A 2YROA 3AYDA 2ILMA 1W6MB 5KXBA 5FBJA 1NX9A 3J9SA 3NNMA 3ZR5A 5FY9A 1W6MA 4AE2A 3KB5A 3OPTA 1YFYA 2NP0A 3LD8A 5FXWA 1V6JA 1OQDA 3FN9A 4NWVA 5DQ0A 3TRSB 1F35A 3VHPA 3B02A 4IV3A 4EN6B 1WWYA 1OI6A 1Y7BA 5EPAA 2UWAA 4GH4C 2XJPA 4Y33A 3OGGA 4UW5A 2EAAA 5CFDB 1YQ6A 2QQKA 1UCXA 4BYYA 4A45A 3S5QA 1Q8VA 2GN3A 3CEWA 5CFDA 1QF3A 3PVEA 3K2OA 5D21A 3SHRA 1OH4A 2MEV3 2ZZJA 2GC2A 4Q4Y2 3TOJA 5GJ6A 1KFXL 2E33A 1RIRA 3THPA 4FBFA 3WQ0A 3I59A 4AVSA 4Y4RA 5D8AC 4EV0A 3AYCA 4FPYA 2YB7A 1F2NA 1LOEA 2PLV3 3FUQA 5C4WC 4I0WB 1H9WA 3EQEA 4QPIB 2QTWB 5LBCA 4BM8A 5FRAA 1EPWA 3M70A 1ULGA 4KU7A 1QDCA 4QPYA 5GLZA 3VD7A 4MGSA 1G7YA 4E9KA 1UL9A 4CEYC 5FZMA 4YVWC 2HWF3 2WNVA 1YO8A 2FQPA 3I2FA 1SLAA 2GNMA 2OZJA 4W4ZA 5EJ1B 1KD7A 4HSJA 1CN1A 1RUC3 1W6NB 4GWMA 1RUD2 4I3PA 3CBNA 4AI0A 1RUD1 1D2SA 1I9RA 3GBFA 1W6NA 2EIGA 2OS2A 1WCUA 3HEIA 1GICA 4D94A 5BNPC 2VZ3A 4IV1C 1CWPA 4Y24A 4A2UA 3M8LA 3WVJA 3I2JA 3M3CA 1RUG3 2H6BA 1H2LA 3V0BA 1FNZA 1ULFA 2LTNA 4V2VA 2C4XA 2FBEA 2AYHA 2Y0OA 3T2TA 3RZGA 1N1VA 4JDOA 4CUBA 1CAUA 3W59A 1QHDA 4EWEA 5L19A 4GIQA 1UOBA 2Z5WA 1AXKA 5DG1A 4K20A 1E5SA 2PHDA 1YWKA 4IEVA 5KXDA 4N8MA 3AC0A 2HWD1 3AZVA 2GN7A 2QDRA 3MLLA 1AR72 3MUY1 4Q29A 4BCUA 1UKRA 2W0XA 2BOIA 3T09A 1WMDA 1AR71 4EN9B 3U07A 2VXJA 5A6ZA 2RM21 1UY2A 3MW4A 5FYHA 5GZCA 3WF3A 1G9AA 4JGYC 1O7FA 2ZHMA 4B29A 2V09A 1XNDA 3WDWA 1PVC3 1OSGA 3HQXA 4LORA 2W3JA 3SNMA 2E7AA 3J4UH 4H7LA 3ZR6A 1ZRFA 4UW3A 1U5YA 4OZXA 3RG0A 1XJAA 2AGSA 2B39A 2WLPA 3HAGA 3K4ZA 4ZY9A 2BBVA 3N9LA 5JXHA 1K45A 3UKNA 5A3MA 3B69A 4MXWB 1CR7A 4O7XA 3MLJA 1ACCA 3P6BA 1W2TA 3OOXA 1K5JA 4XMIA 1YQCA 2VNRA 3FE5A 4JAAA 3NVCA 4JZRA 2QQNA 4NHLA 5FP8A 3BN6A 2IXCA 3AL6A 4AQ6A 1ZZ6A 4AVBA 4J25A 4PLNA 5LBEA 1AL22 1REEA 3FFQA 1XE8A 2X10A 1VAMA 4MADA 5ACA3 2WA4A 4GQ7A 4ZZ5A 3HPNA 4YW6A 1XC6A 1TEIA 3LA2A 3RZZA 2WJSA 1NE6A 5CADA 2OUJA 5LK7B 3NJYA 4AGRA 1WKYA 3B3QE 5A6YA 4UBGA 2JXAA 2JKBA 1G8WA 1X82A 3WG1A 1UXZA 4R9BA 2D6NA 4XJZA 3H42B 5EHDA 5AVPA 2DU0A 2JDYA 1O6UA 3ZYGA 4ES8A 1EP0A 4ORFA 2QQPA 4O65A 3WW4A 5HV0A 1VBC1 1JYIA 3OD4A 1DF0A 1W06A 4RFRB 4ZU7A 5CG8A 1ODNA 4I2OA 3VZKA 4GD4A 2CGPA 3N7JA 4MOAA 5H9RA 4RHV2 3T30A 3H7JA 2G9FA 2Y33A 1WW5A 1X50A 2O8QA 5J96B 3HBKA 4RHV1 5FZOB 4AEDC 5JZGB 2XPJA 1W2NA 4HVRA 5A3NA 1OLRA 4META 4Y5Z0 3MIBA 2B46X 1MZFA 5F1RA 4LHSA 4QKNA 4QX2A 5FFOC 4OHYA 4GWIA 3NNJA 3USUA 2DF7A 3AMPA 5HXMA 4CSWA 1DBNA 1HB3A 2E7QA 4NIHA 2XB6C 1UKGA 1DQ4A 3WUCA 1UYZA 3QLQA 1V9U3 4XF3A 3HT2A 2RDSA 1ULOA 2XKPA 4P9LA 1IG0A 3IDCB 4FFHA 3TEXA 5A3WA 1HV1A 1A3KA 1KQRA 2PQQA 4C1XA 3JBG1 4Q4V2 4Z82A 1AF9A 3CO2A 1QJFA 4CU8A 2YC0A 3WNLA 4P5YA 4A3ZA 3CJIA 1OUSA 4LNVA 3UL2A 1UZVA 1IQAA 1OH3A 1RUE2 2HWE3 3F2ZA 3R4DB 4LMFA 5K8SA 1VIWB 1LODA 3I49A 3ZYPA 1PIV2 4XQDA 2FD8A 4NIGA 1UMZA 1PO13 1NA1C 1CAVB 2D97A 2VW0A 3AKRA 4INDA 3VBUA 1XNAA 2DVAA 2WUHA 4AWDA 3C7HA 5FKCA 1R091 2R0FA 5BNNB 4HXCA 2WZR1 1NCRA 2YBSA 1DHKB 2Y8KA 4QM9A 5BNNA 4XFFA 2WAAA 3BCWA 2R1DA 2VZVA 2ZGMA 1SBEA 3EHKA 3A7QA 3H9AA 1UW8A 3Q8AA 2YC2A 2RMU1 4IEXA 3O0XA 2BV4A 2JEMA 3ZSEA 1YIPA 4RA0A 4LKEA 2P17A 3WDYA 2WT1A 4Z1VA 1JU4A 5JR7B 2WC2A 2AC1A 1JYTA 3SCHA 1OQ1A 2C9KA 4QXBA 4QD2A 4DIQA 1OFNA 3OEAA 3IDBB 4WVWA 2VGDA 3KD4A 1WD4A 2JG8A 3KCCA 3WQ1A 1URXA 3LWCA 4XFHA 4A3XA 2VTXJ 4O61A 2B42B 1S0GA 3BTZA 1REFA 2FDFA 1Q43A 4NROA 4YVSB 3J8F3 2EAKA 3L2HA 2WFPA 4PBPA 3LF7A 4QQPA 1PGL2 4AGGA 1DQ0A 1REDA 1VBA2 1WZXA 5E89A 4NJ4A 4C1WA 1OD3A 3FHAA 4IE4A 4URTA 1JZ6A 1RUI1 3SEPA 1L7QA 4ASLA 1QJX2 5EYXA 1AR63 2CNAA 1GP4A 4ZS2A 1GMMA 2Y64A 3OEBA 3KV4A 4NIAA 3WF1A 1OVPA 5JCTA 4N90A 1LGCA 3VBHB 4TTGA 2VCBA 1DP0A 2X29A 3VBHA 5F5AA 1DFQA 1SLBA 5A7SA 2I2SA 5DUVA 3ZO0B 1QKQA 5DAPA 2JDKA 2Y6LA 3CMGA 3WF0A 4OHVA 1PNFA 5F6LB 1PO23 1ZBA2 3MIDA 1OLME 2EIEA 1J58A 1ZBA1 2PHFA 2WS92 3JBG3 3OJBA 4PDWB 4QQHA 4XZUG 5FLJA 3RGBA 2WS91 5CKMA 5A32A 1H6XA 3HMYA 4XE9A 4FPKA 4P9JA 3WT3A 2YUEA 3AK0A 3SC7X 3HJRA 3T2PA 4CDWA 5IT6A 2P37A 4XF4A 3UYJA 1MS4A 2A3YA 2ORZA 4G9SB 2JB4A 3O1RA 4HL0A 1CZVA 3N9NA 5T50A 1SFPA 1ZZ9A 1W9WA 5L36A 1VBE1 1X8MA 2ZGTA 4XURA 2ZKNA 4YZ5A 5ABJB 3MDPA 4HFSA 4LE3A 1O91A 5JOXA 4AVAA 3ZX7A 5ABJA 5FPVA 2OPWA 2XJVA 3A0NA 3FJSA 3O1UA 3IKWA 5FXVA 1NXD1 1L3JA 2ZEYA 3MV01 4QHBA 2TUNA 4AQSA 5CNAA 1JODA 1RUJ2 3I2DA 3T2OA 2H6CA 5L9VA 2K0GA 2XLAA 2Q1ZB 1RUJ1 4DUXA 3AMNA 1W6PB 4JHZA 3VKFC 4YARA 2TEPA 1DYOA 4I02A 1AJOA 4L99A 2ZEZA 3CLPA 4CU6A 5JXIA 5FYUA 5CG9A 3AFGA 4KGQA 3ABZA 4IV3C 4MHUA 3T0BA 4YGCA 5DXDA 1T6GC 1L7LA 3FX3A 4YSFA 1AXYA 2HWB1 1J83A 3ZFEA 3LEIA 4QX1A 1TNFA 1TVGA 1DU3D 4K6BA 4B4RA 2EVXA 2XH6A 4EJRA 4YZ2A 1OT5A 1BHGA 1ZM1A 2J1UA 2WSVA 4CYDA 1TME2 2BGOA 1UZYA 1TME1 2E51A 2WWSA 4ONUA 4E4ZA 1S0EA 2A1XA 4A6SA 4XHBA 1BK1A 2A6VA 2WNVC 3KZ4C 3ST7A 3BKZA 1DZTA 5A1FA 2PHLA 2UYAA 2Z79A 1MZEA 3DPRB 2RS33 2W92A 5C6CA 1LB2A 1US2A 2OUHA 3C2UA 1Y9GA 5C3PA 3JCIA 1K3IA 1DQ5A 4XC9A 1DQ1A 2D93A 2OX0A 4E8CA 4NRMA 5IVFA 2VBBA 4W65A 3M3IA 1BEV1 4LBJA 1WBLA 2J1AA 2FDHA 3N4MA 5F9TA 2VQUA 4GWNA 1MQTA 1DDLA 5FMBA 4MGTA 3PUQA 1BXHA 3IAQA 2YGLA 4JGZA 1DG6A 5IK5A 2Y6FA 5KC6A 4YM0A 3I3MA 3QOPA 1VBE3 2D3PA 2PHWA 4SBVA 5DPNA 4AYUA 4O9EA 1N1TA 1AX2A 3MGUA 4N43B 1FPN1 2VZRA 1F4HA 3OUHA 4WBBA 4QB2A 4E2QA 1NT0A 1H0BA 3HT1A 2VJXA 1EV13 3W5MA 1PMJX 4N43A 2DVBA 2ARBA 1WLTA 2W1QA 5I8YA 1W3XA 1YUDA 3U11A 5SV5A 2QQMA 1RMU3 2YBKA 3WP6A 4A6OA 5JOYA 2A5ZA 3TAYA 2LS6A 2ZJCA 4QHZA 2UU8A 4CCMA 5L73A 5FUIA 3BYWA 2J42A 5ANNA 2CWMA 2N7GA 4XFIA 5FYIA 3SISA 5IFPA 2HLEA 3VKMA 1MEC2 3UKVA 2IXLA 2NM1A 4GXLA 1AJKA 2A6XA 1FMD3 2GMPA 4COVA 1DQ6A 1HRV3 1V00A 5FLHA 1UIJA 3Q9OA 4R52A 3ZKYA 4WM7A 3ZN4A 2HWC3 1RUF2 5F8PA 2AENA 1RUF1 4LIVA 2BNMA 3LEGA 2H0BA 2RS11 1GFF2 2B4KA 1LEMA 1AR91 1O59A 5GLVA 3KQRA 2VXRA 2WFF3 2ZOEB 3CJXA 1AR83 4CP0A 4LO4B 4YW5A 3FLTA 5FP3A 1H4HA 3WY6A 4CE8A 2I74A 4BQ4A 1LHVA 2GH8A 4OLLA 5AFBA 1ULEA 2VCCA 1JU3A 3AMMA 2DUPA 4NO4A 3E1F1 4Y1YA 2XJUA 4K21A 1D0GA 2WYSA 4WV8A 4YZ3A 5E16A 5GZDA 5C8WA 2RS52 3ACFA 3FC0A 4GKXA 5E8AA 1PGSA 4IEQA 5B2GB 4HZFA 4K40A 4HANA 1CONA 4IGQA 4NPLA 4QX3A 4MYEA 3MW3A 4XTPA 3B01A 2V5YA 5FO7B 3RWNA 1F4AA 4IGOA 4LBNA 1S0CA 2F4PA 4ITCA 1LULA 5L7OB 1ZZ7A 1FX5A 1IZ3A 1XSRA 3OG2A 1GYKA 1GNZA 1OXCA 1PZ9A 2WQZC 4Q4W2 1ZNPA 4HOOA 1LHWA 3NQHA 4RQPB 5L7OA 1CPNA 4DNYA 4W8JA 4Q4W1 1O3QA 2ATFA 1R083 5FO9B 1JOBA 3JUUA 5FPXA 5F7UA 2P3JA 2TNFA 3PTYA 3GCXA 3OY8B 1EAH2 4B4PA 5IK4A 3NV3A 1EAH1 1ASJ2 1Y43B 4NHYA 4FP2A 2WSUA 1YC61 3PIGA 2ZAHA 1SFNA 2OQ7A 2ZAAA 3K3OA 1LHOA 1W9YA 2E6VA 1GZCA 2HYXA 2DU1A 1GWMA 1ND2B 2WN2A 3NNFA 4P02B 2ZGLA 5DDJ1 3BPZA 2GMMA 5F39A 3VZJA 1V6KA 4N9HA 4NUBA 1CAWA 2WNUB 5FOBB 1NZCA 4QGNA 3W20A 2Z69A 2LRPA 2NMOA 3CJIC 3AVSA 3RMXA 5LBBA 2R063 4CDQC 2ZMNA 2C1FA 2E26A 4YG6A 3V56A 3VD5A 2VOXA 4HN1A 1CZSA 3VBUC 1OUXA 2EIBA 5K9YA 1HXS3 1RVF2 2W1UA 3WX5A 1TE1B 2VZQA 3DYMA 5F3IA 5B4XA 1RVF1 3LDKA 3U1XA 4LBMA 3OPZA 2ZXQA 4RGAA 3WNMA 4I30A 1UPSA 2XWJB 1NCRC 4Q8KA 5CFCB 4XYXA 3UGGA 3VLBB 5JAXA 1MACA 1H2KA 1AL0G 4ZPIA 4M3CE 4EZ4A 5CFCA 5JSPA 1LKNA 1JYNA 2O8OA 5F2WA 2DDUA 3MPBA 5FR3A 1RINA 3D82A 5EJ3A 1CJDA 1EPZA 3BOPA 3V64A 3MUZ1 2JX9A 4WM8C 1UQXA 3N7LA 3PVNA 3PL0A 4HK9A 4WVMA 3S30A 1YLLA 3R4UA 4UFIA 4B1MA 4DUVA 4Q0SA 2WL1A 4XZPA 2A3WA 3SH4A 1CX4A 4PF1A 3NKTA 5IJRA 4DZGA 1HN1A 4MVTA 2AREA 4Q0QA 2RV9A 3ECQA 2JG8C 2QUOA 4HPKA 1VB4A 1VBD1 2W08A 4QX7A 2PTMA 2BNOA 3ZFGA 3HN1A 1COV2 3LFIA 5EJZB 3WG3A 5IATA 1QNYA 5FZIA 1COV1 2TBVA 3NV1A 3H3ZA 3LB9A 4V2WA 1VBB3 4Q1RA 4YYOA 1FOD3 1DZQA 2GC1A 4P00B 4L97A 4A7ZA 2VOKA 4FOQA 5BNOA 4IETA 1W8HA 1BJQA 2CDPA 2WBKA 1W6QA 4PHZA 4Q4X2 4QPWA 1UO9A 1HB2A 1D2QA 2R071 2CWSA 1ZZ8A 2JD4A 5AC92 1ZZCA 3VKLA 1XSQA 1OOPA 4AAXA 4ARYA 5AC91 5FUPA 4UI9L 4XF0A 4AR2A 3VBSA 2A6WA 4OHWA 5FZKA 5LEJA 5FZHA 4M3CB 2RE9A 3VBHC 4UFLA 2WRAA 4QXCA 5I0TA 2R16A 2VVDA 2HKXA 2JG9B 5FPZA 2MHFA 4M3CA 5G04L 4ASKA 1RGSA 5I0SA 5DDJ3 4CP9A 3BUCA 3SXWA 5G05L 2W46A 4XDPA 3GZTB 4GKYA 3WLUA 3K75B 2D7FA 1LECA 2BPA2 2IXKA 4N53B 3HQRA 4EYUA 1PNGA 4CDWC 2XQXA 3HR9A 4MG2A 4YM2A 4GMP0 2QBXA 3NRUA 1D4M3 1O4ZA 2R32A 5FZ4A 1V6LA 5C71A 4S2HA 3RZMA 1QJZA 1XXNA 1ZBE3 5DMYA 5JXJA 4XW3A 3C8XA 2Q8EA 3CF6E 3HN3A 4CDXA 2DTYA 5FAXA 2VR4A 3U4SA 5BXXA 2DUQA 4A4AA 5JIAA 2C26A 4LXLA 3KF5A 4XFBA 1JYWA 3CIHA 1UOGA 2MEV1 1YEWA 3IWZA 1NY71 4YFWA 3FBYA 5LA2A 4JQTA 1T6BX 3AKSA 1OD5A 2PLV2 4MGQA 5K0UB 3VD9A 5BV6A 3PVBB 1YI7A 1S0JA 2VC9A 5K0UA 3RZKA 4AK3A 1SLCA 1Y3TA 1SACA 3B94A 3KWVA 3QACA 5FZ7A 2JECA 2SLIA 5C3SA 3KGLA 2ZEWA 3LFMA 1S2KA 2HWF1 3AP4A 4XDOA 1E5IA 2UY9A 3RFRA 2XWBB 3ZFEC 1LJ7A 2BP6A 3OF1A 3FMGA 4V1PA 1RUC1 1AYN3 2EXJA 4I09A 3GBWA 1GZWB 3RI8A 1VBD3 5J48A 1X7NA 1UYPA 1BMV2 4EN8B 4EWAA 2PHXA 3VDCA 1GZWA 5APAA 1BMV1 5HCBA 1S4CA 1RUG2 4AFBA 1OFSA 2YV8A 1RUG1 4FPLA 2LROA 3IB3A 4GJZA 4PBOA 4YM3A 1ND3C 4RR3A 2DCJA 1ENRA 1XBFA 2DTWA 1JYXA 1M4WA 4CU7A 3T08A 2W47A 1JOJA 4LHNA 2VBPA 3VZOA 3H3UA 4F83A 4FVVA 3PUSA 5A3OA 1QJU2 5FK8A 4BWOA 4DXSA 4AL9A 3AFKA 5KBFA 2Y6KA 4FPJA 2QQUA 3VBFB 2YY1A 1BBT1 4JQRA 4BIFA 2IXIA 4IL7A 4RS5A 1OPOA 4AI9A 4DRVA 4DS0A 3VBFA 4BIOA 3BU7A 3KF3A 4LA3A 2NZ9A 1Q8QA 4HK8A 4N7UA 1JUHA 4QKBA 5A33A 1TMF3 3AYAA 3HNYM 2GC0A 1PVC1 3LEMA 4GALA 1YRZA 4PLMA 2Y26A 1RHI3 2ZX0A 4MZUA 3R6SA 5C33A 2Z2SB 1MQTC 3KMHA 1IQDC 2B45X 5E6HA 1NZIA 4JGZC 1M06G 3OB8A 3VDDB 3I4IA 2E53A 1UX7A 4FAHA 1F31A 1LOBA 2HEVF 1GBGA 1KDMA 3FBMA 1MS8A 5DZGA 5F2SA 5FZGA 3WCRA 5LATA 3E5UA 2R49A 4FPHA 5E88A 3D3AA 3WW3A 1GANA 2HEYF 2V72A 3LZZA 4LOTA 1UY4A 4FFIA 1WA4A 4K7JA 3IMNA 3VD3A 1H30A 1IOAA 1JS9A 3WP5A 4ASMB 5ACA1 3QCWA 3ATGA 2ZBJA 4NWWA 3MHZA 3RSJA 2P4EA 2DFCA 4XABA 4QDRA 2ZHLA 4HLTA 2QFEA 2D3RA 4XXPA 2VZUA 3SCGA 2ZTNA 2QJVA 1K5MC 4BU2A 1FI2A 1Z7S3 4QPIA 5FPAA 4U2AA 5GM0A 4GULA 4HKWA 5FP7A 2RHPA 1HN0A 3WDVA 5LASA 2JENA 1K12A 2VTFA 5C8CB 2F17A 2WZ8A 2IVJA 4Y4YA 4BK5A 3AVRA 2PELA 3E5XA 3BU0A 4MO3M 4BQ5A 1HJFA 3A23A 4WM7C 4TN7A 3CDZB 4AW7A 3VBRB 3LCPA 4X6RB 2OT7A 2RJ2A 3TN91 3IDAA 4PQ9A 3VBRA 1XB9A 2Z4FA 1VRH3 1KITA 5F3GA 2XL7A 1STMA 2Q0AA 4FAGA 2YYOA 4JTNA 2J7MA 4ISRA 3H8OA 4JDMA 1Q5OA 4QXKA 2HWD2 5FZ3A 3AZZA 3ZXAC 2WO3A 3NMBA 4HN0A 2HBUA 4TLFA 3LSEA 1R64A 1CAXB 2ZEXA 5KHKA 1OA2A 3ACGA 1BBT3 2RM22 1GSLA 5FY7A 1V9U1 2WABA 1RB8G 1JN2P 2JDNA 5EP9A 4FI9A 2D3SA 2FHRA 5JOZA 2W5FA 1I5ZA 3JD73 3APBA 4UF0B 4QXHA 3H1MA 4XJUA 3SKVA 1CZTA 1MS1A 3IAPA 4I01A 5JLVA 5CA6A 1JMUB 3EJKA 2XJSA 5FZDA 5L7OC 4XJ9A 4ISQA 1PMHX 4D7SA 4CRQA 4L0PA 2YG0A 1OMIA 1NLSA 1UN1A 1G9FA 4LKFA 2HWE1 4QU1A 1SLLA 4LHLA 1GR3A 3UGFA 1LCLA 1PO12 1QOTA 1XOYA 2GSYA 3SH3A 3T3YA 1PO11 5CB7A 4NHKA 2CV6A 5DG2A 2W87A 4XFCA 5L9RA 5A7NA 5FZBA 4C90A 3ACHA 1GLHA 2LM3A 5JSRA 5A3LA 3UV9A 2ZGKA 4MXWA 4QQOA 4XJ8A 1V6IA 1QJY3 1TNRA 2BRTA 3WHUA 2XVKA 1LTEA 1RJ7A 1WD3A 1WCSA 4E4DX 3WNPA 1H8TB 2Q5TA 1W8ZA 2L9LA 4WVZA 1AUYA 3H1WA 4YGEA 5FWEA 4OHXA 3ZLIA 2P1BA 5H9SA 5D2AA 3LIHA 4LR4A 1MZ6A 1OQEA 4AVTA 3O1OA 4WZCA 2EXKA 5A80A 5JXGA 4QPGB 5FZ0A 4XOGA 4X8NA 1R1ZA 2VNOA 5HI0A 2A7AA 4KGGA 1W3VA 3KHBA 2CAUA 4NHXA 3EYPA 2B8MA 3O1MA 3ZXGA 1H2MA 1TQ5A 1CIYA 2B5HA 1ZYBA 2EXIA 2YFZA 3KV5A 3VDAA 3WV6A 4LBQB 4E2GA 3O1PA 2WDBA 3FWEA 1VBC2 1FAYA 1X8EA 2WT2A 4Q4Y3 3UJOA 4B3NA 4CDUB 5BYNA 5CFCC 1FXZA 3HNMA 4GMP3 1MS5A 1UZZA 3J8F1 4C0HA 4XTMA 1ENQA 2WWJA 1AX1A 3TN93 1BQPA 5EZWA 5FMCA 1GU3A 3T4HB 2JE9A 4XJWA 5C9AB 1AR62 4OFGA 2R6QA 3VBOB 1PZ7A 2J1SA 1AR61 2BBAA 2VTXA 5FZOA 5JZGA 1SCRA 4BLIA 4XFGA 5F5IA 4AFMA 2MNGA 1DLLA 3R05A 5HCFA 4CXXA 4R9AA 1NCQC 2AR6A 4UW6A 1XYPA 2DVGA 4GB33 3ZFGC 1ULPA 3VGIA 1CX1A 4HVOA 1PO22 2OQ6A 3AP6A 1B35B 2O14A 1PO21 4AFAA 2FZ2A 3JBG2 1UIKA 5AVAA 3NAPC 1S0FA 1B35A 3KCXA 3ORJA 4O9GA 4XHXA 4Y22B 5FLIA 3CHXA 5IVYA 5BNOC 2ARXA 1FNYA 4L2NA 4CCOA 3WQBA 1GZ9A 5M0TA 4ZKTB 4LEJA 4XF9A 1YFUA 2FDKA 5CKNA 1OOPC 4CCEA 4NIDA 1HKDA 2VOVA 3AP5A 1PGW1 5F5CA 3VBSC 1U12A 3JQWA 1R092 2GNBA 1C1LA 2O0OA 3O14A 4N9IA 1CAVA 2WZR2 3A0KA 3TB0A 3NWKA 3WCSA 4QU2A 5JMCA 2OXBA 1S2EA 5EYYA 1O8PA 1O8SA 1ZA4A 2RDQA 2RMU2 3SQOA 3B9CA 5FMDA 3GCWA 3UGHA 2WYFA 4ZHNA 1UX6A 3UJQA 3ZFFB 4QGLA 4XBNA 4LBOA 5BNQA 3PTRB 1W28A 5H9QA 2XJRA 1UU4A 2KXLA 1ULDA 4XUNA 3ZMOA 3OGVA 4FQZA 2AEZA 4DOUA 5FYCA 5EIYB 5FCCA 1SMVA 4HMZA 4CDXC 5LRRA 2R0HA 1ZX5A 1H9PA 2BTVC 4URAA 1LOCA 3I3EA 3W21A 1N1YA 3T1MA 3WP4A 1RL3A 1N3PA 1J3RA 1EYBA 3AMQA 4AHYA 2D6KA 1SQ4A 2CDOA 3AP9A 5FQ0B 1IPKA 3RZLA 1AL23 1UZWA 4K1ZA 4Z2WA 4QT6A 4JKKA 1RUI2 4YVSA 5J37A 2X5IB 5K0UC 2VU9A 2XGXA 1KGYA 3I2GA 1IPSA 4TLGA 4W50A 3WF4A 2WO7A 1OVSA 1GP5A 1QXPA 3GJAA 4D6RA 4OCTA 4F3JA 1NLRA 3S0MA 5FIXA 1UWWA 2J1VA 2V5DA 2BFUL 2W68A 1VAVA 1HRI1 1UMHA 2RS31 3VZLA 3E97A 3U0ZA 1NXMA 3ZIXA 1NOVA 4KBBA 3HQUA 4XMAA 4EQVA 2UWBA 4GA9A 4XPVA 1J1TA 1X9TA 3ZXDA 5J98B 1UD1A 2ORXA 4LKSA 2AACA 1RUOA 4OZOA 1OF4A 1S1AA 5LY1A 2IVIB 5FJKA 1OLQA 1DGRN 5IVJA 4RR3C 2XHKA 4PDWA 1O4TA 2IWGB 3DECA 2ZGOA 2IFWA 5T3NA 4Z8BA 2PYTA 3GBGA 1VBE2 4E27A 2YGMA 1DYKA 2VVFA 5FDBA 3O5SA 3CQOA 4BISA 1QQP1 4RS5C 2DCKA 2K2SA 1EV11 1R1A3 4CZSA 1H6YA 3N9OA 4BMBA 5IVVA 1ODMA 4E8DA 1RMU1 4FT8A 4K8FA 2LALA 4Q4V3 5BY5A 1HIXA 1QEXA 2OIIA 2ZKLA 3I2HA 3RWKX 5FPUA 2VE1A 1U0AA 1YFWA 1ZRCA 3A22A 1NKGA 2WLQA 3JU9A 1W6PA 3OCPA 1RUE3 4H3WA 4COWA 3AZYA 3O1VA 1Y9QA 2YZ4A 4CUAA 1PIV3 1WBFA 1LOFA 1GUIA 1UXXX 2HWB2 3MFCA 2PFWA 5HBAA 4U36A 2A70A 1FMD1 3H3LA 1HRV1 1UY1A 4YGBA 3U78A 3B7MA 3MPPG 5CFDC 4RFT0 2R30A 4I3GA 5LK5A 3T4VA 3OGRA 2DURA 1OLMA 2BOJA 2HWC1 3S5AA 4KBZA 3WDTA 1SZBA 1FYUA 2XUMA 3URFA 1RUH3 3PNAA 5CZKA 2WFF1 1AR81 2ARCA 1G9BA 3I2IA 1W2UA 2WINB 4MXVA 5IVCA 1GQPA 4B4QA 2LUWA 4QPIC 4NOTA 4YG0A 1OKQA 4EWDA 4NIIA 1W8TA 4YM1A 2DCZA 4CEWB 4E4HA 5GZGA 4H14A 3MI8A 3IT8A 1HRI3 2IUWA 1GQHA 4W6WA 2ENRA 3LPGA 3ZSJA 4CEWA 1MS3A 4HBNA 3DPRA 5I8TA 1DYPA 1XNCA 2EIDA 2W52A 4K9SA 2BVBA 4WVVA 4FSJA 2WWUA 1SCSA 4CCLA 1JUIA 3FLPA 3ILRA 1PX4A 1DLCA 5FYTA 2D6LX 1BEV2 1IKPA 2BEOA 1VBA3 2EXHA 3RNSA 5FYSA 1WCDJ 1WCKA 1MPXA 4OVEA 4QWNA 4QB1A 4XILA 1R081 2PAEA 4P9GA 2NN8A 1QJX3 5EQUA 4AGVA 1YQ8A 4DB5A 5FO8B 3GM8A 2QQIA 3H8XA 4QX0A 4ZS3A 3D0JA 4RSUA 2CL2A 4IE7A 2ETEA 1FPN2 3B9IA 3ZIWA 1H1MA 4NPRA 1S0DA 1QQP3 5KHHA 4AZZA 2XBO1 4AHXA 4XACA 1S2BA 1G9DA 5FTTC 3DXUA 5LB6A 3MLKA 3VN4A 1HLCA 2FZ1A 4Y1XA 4HONA 2Q1MA 3RVHA 3UNPA 4MH0E 4RYDA 3X29B 4BB3A 2JIJA 3K77A 2R062 4GH4B 4COYA 2R061 1IGOA 2VMHA 5JWPA 2VOTA 2JDZA 3USSA 4IW3A 3N7KA 1HQNA 1XPWA 3THCA 1OA3A 3DN7A 3D6EA 3MBWA 3PLQA 2XHNA 2XVLA 5J36A 3LKJA 1G6NA 1HXS1 1OA4A 2VUCA 3AZWA 2A71A 3IMMA 3NV4A 1GOHA 1QNWA 3AX4A 3SCFA 1U5IA 2FCUA 3GGLA 3VL8A 5D8AB 3AM2A 4XUQA 4MGKE 4LO7A 5IYYA 2F6BA 1VRBA 5C4WB 5LW9A 2CGNA 2RS12 4YGDA 4BPZA 1E57A 5T54A 1AR92 3CU7A 3S7EA 4JDNA 2KR2A 3P3NA 5C4WA 5T5OA 4YZ1A 4QQLA 5DAXA 5F5QA 2J1RA 5FUNA 1W0PA 4YVWB 4CEYB 4D6QA 5KR7A 3V0AB 3DV8A 4YZ4A 5TSWA 4QQ2A 4CEYA 4DINB 2P3KA 3SITA 1JXNA 1VPHA 4A44A 2PHRA 1VAKA 2A6ZA 4PI2A 3ZN5A 1IG3A 1WW7A 4D0QA 3WHTA 5JPMB 2OPKA 5BNPB 3PUHA 4CCNA 4IV1B 2VUJA 2Q8CA 2D44A 5LEKA 2P3YA 2QQJA 4HSLA 3MO4A 5FY8A 3TEZA 1VBB1 2JJ6A 2VPVA 5FREA 1IKQA 1FOD1 1YI9A 5FYBA 4BDVB 5JR2A 1W39A 4DXZA 2KD7A 4AFDA 2R7EB 4RQPA 4OQ9A 2CSGA 1F5FA 5LZ6A 3H50A 5AFEA 2VUAA 5JZGC 4YLZA 2GNDA 3OY8A 4FCAA 1NYWA 2QNKA 3WDUA 5EWSA 1C57A 2XXZA 3P1IA 3D0SA 3HWJA 3LOIA 5DAQA 4CUGA 3J7NA 1SLIA 4CXYA 4JGYB 1XYOA 5J09A 2WKKA 4XAEA 3M3QA 1ZVFA 3N3HA 5DDJ2 4IDZA 1C8NA 2XBO3 2ZA9A 2PXJA 1U5ZA 4AQ2A 1ND2A 3RS6A 1VALA 5K7PA 2W91A 4PJYA 1Q56A 2ET7A 2X53S 3K4AA 1P8JA 1UMIA 2ZGPA 5ERLA 5JPNB 3LOBA 1D4M2 2WNUA 3HIFA 5IWFA 1EY2A 1DGWX 1JHNA 2CAVA 1SHWB 1D4M1 1W8FA 3IDEA 5FJHA 2DWRA 1ZBE1 3DEMA 5GZEA 5IAVA 3R4SA 2RJLA 1W8OA 5GZFA 4OI2A 1H1AA 3OBZA 4B8EA 5JI9A 5C7GA 3N9PA 2UWCA 2VMCA 2OW4A 1C3HA 5FY5A 1KJLA 4FTBA 5BNNC 4HKLA 2GALA 4MV2A 3E5QA 2EALA 3BVCA 2ID4A 2H0VA 4BHPA 1UU6A 2W9XA 4Q2FA 5FYVA 3OUIA 1JBCA 4PF5A 3MW2A 3ZN6B 4AHZA 5DUWA 4Q0VA 4DEQA 4AAPA 3ZSLA 5BUVA 5CBLA 4YW3A 1NQDA 1POV0 2CYFA 4COZA 4FFFA 1MVQA 3NJVA 4FXGB 3K46A 2VW1A 2RG4A 5FZCA 1MEC3 3RJRA 2YMZA 1GP6A 4H2AA 2P6CA 5FY0A 4BJ0A 5FV3A 5KHIA 3Q8BA 3CZJA 4NAOA 2JB8A 1KDKA 1VBD2 4K1YA 1AYN1 1QU0A 1W9SA 5JI7A 4CUCA 4XQ4A 4HETA 3ZVXA 4UAPA 2FDGA 1BVVA 1W99A 4LHKA 3ZSKA 3A4UA 4AEDB 3Q8FA 1JYVA 1APNA 2ES3A 3S57A 4YVSC 4OI4A 2ET1A 3J26N 3PVOA 2YDEA 3AKPA 2R072 2HH9A 2VCAA 1AXZA 1C8M3 2WO2A 4PLOA 1PVXA 4COUA 2BWAA 4KL1A 2GDFA 3POBA 4FPGA 2Y6JA 3ZM8A 2RS53 4D8MA 3H7YA 3MZHA 2I45A 2ERFA 3D4KA 2XR4A 3CKHA 1TMF2 5LBFA 4OQ8A 2JG9A 1GKBA 1TMF1 2VD7A 1UOFA 1Q8PA 1HB1A 1RHI2 2E32A 3ZDSA 2BUKA 3OUJA 1RHI1 3NV2A 1HDKA 1NA1B 4PDWC 4GWJA 3PJYA 4N53A 1JH5A 4L92A 3ALQA 3RJ2X 1J3QA 1JZ8A 3RYKA 4FPEA 1GZTA 1W6OB 3POWA 3S6PA 3AMHA 2ZHKA 2PHUA 4ZXEA 2V4AA 4FQ4A 2UYBA 3K4DA 5J1XA 4ZONA 3RI9A 2MEV2 1QY4A 5ABJC 3NW4A 1NY72 1VJ2A 1QOOA 3IBMA 3BODA 3WF2A 1JZ3A 3WSOA 1DGWA 1RUNA 2A73B 2ZX3A 1BCXA 1TG7A 1N3OA 3U14A 1YHFA 1WUVA 4R9DA 3ON7A 3LQCA 3NSTA 3VD4A 2W39A 1NE4A 1JYCA 2ZX1A 1Z7S1 1OF3A 3H8UA 2HWF2 4PI0A 3WR0A 1LOFC 1A6CA 3WP3A 5DUUA 4MHRA 3AB0A 4JRAA 1LU2A 2PAMA 3B5LB 1SLTA 1D0HA 2YXSA 3F95A 1RUC2 3OGSA 4GZ9A 1QXJA 2VUDA 5C5TA 4AI3A 3VKOA 3OD0A 2XJTA 3PU8A 4LITA 1B09A 1CJPA 4DXTA 5L9BA 3J7HA 2FMYA 2QE3A 4FPFA 3WG4A 3IIAA 3QD6A 2OZ6A 3UETA 4UFHA 1VRH2 4FP3A 1FT9A 3TNQA 3W58A 1WMXA 4XIOA 1VRH1 3ZMNA 5CIRA 3I3BA 4G4FA 3SMHA 1HW5A 3CZUA 5FY1A 2XDVA 2QQVA 2OKXA 1JZ5A 2JDAA 1Q8SA 2CHHA 1JTZX 4OYUA 4OMCA 1S55A 4KU8A 1BBT2 1V6MA 3ETQA 5A3UA 4YRDA 4CA9A 3DPRC 5F3EA 1T2XA 4K8RB 3EBRA 5KWRA 5CKQA 3ZXJA 1QH6A 5K4LA 1PK6B 1POV1 1W8NA 3JD71 4XUPA 3BTXA 2Y34A 1PVC2 4CCJA 3VV1A 3LSDA 1PK6A 4NMIA 3POEA 5KHGA 1V0AA 5FZ1A 4Q4X3 3FHIB 4MX3A 4R4XA 4DRRA 3JB4C 4M4PA 2PA7A 3ZDVA 1RC6A 2WA3A 3I97A 3PHMA 3VDDA 1OC1A 1W0OA 2VBDA 4LT5A 2R043 2BQPA 2AH2A 3KS7A 4MLOA 3I2KA 4ARXA 4FPCA 1QJY2 4IE6A 4JC1A 2EF6A 4N43C 4TWTA 1QJY1 5JSOA 2JE7A 1GOFA 3N35A 4L9BA 5C3RA 1ZRRA 2SBAA 3WW1A 1H8VA 5ACA2 4B1LA 2Z42A 5GLUA 2YPDA 4PIZA 4IV3B 3NO8A 1LEDA 2RVAA 3KGZA 4KH9A 2FDIA 1E5RA 3POIA 4TXWA 1J59A 1JOPA 2YPJA 3HD8B 5J7MA 1AZDA 2ZGRA 5FPLA 4NRPA 4BA6A 4OI1A 1D4VB 2VG9A 4A7YA 1ZZBA 1JZ7A 4L8QA 3TWIA 3NJZA 1A34A 2VMEA 1OBNA 1XRUA 3I59B 1BVP1 4Q8LA 4W6XA 3DCQA 4Q1PA 5E1RA 4Q4Y1 5C8CA 4M0NA 5FYMA 1W2OA 3RZHA 4GMP1 5FY4A 4LK6A 4AI2A 2DVDA 1YYNA 3TN92 1SDWA 4BQ1A 2ZMLA 3VKNA 1FV3A 3NNGA 2V4VA 2WNVB 4M01A 3EXUA 2WQ4A 3DXTA 3ELNA 1HV0A 3MIFA 5IHRA 2KA3A 2RR13 4LO5B 4BH9A 3T0DA 5IUQA 1I3HA 2XKOA 4XUTA 4FTEA 4D3WA 2G4IA 2K46A 4ZZ8A 4S2GA 5IK7A 4J1XA 3BB6A 5A7PA 4GB32 2WT0A 4Y1VA 1CD3G 1V9U2 3BOWA 4YNIA 3ZYIB 4GB31 1CAXA 1U5XA 3DYPA 3V0BB 3DUIA 5KXEA 2XJQA 1POV3 3BTYA 1RITA 1E5HA 1JW6A 3GDBA 4YW1A 1G9CA 3ZXKA 1CAUB 4E4SA 1WMEA 3C3VA 3M7AA 4UF0A 3RYRA 2Q30A 2QVSB 5FZFA 4NRQA 4RQPC 2HWE2 3AZXA 4LBQD 1ULCA 3HBZA 5JVVA 4MSVA 5IVBA 3PJQA 2MPFA 3LA3A 4JTOA 2VOWA 5FZEA 1QJU3 1AYM3 1N3QA 4IESA 1Y9MA 2BVVA 3KSCA 4RL7A 2VZPA 5IW0A 1YXWA 3HVDA 2ZS6B 3L9JT 1DGLA 4I0BA 4DFSA 4DO0A 2ZX4A 4CXWA 3GALA 1IS5A 3AKQA 3KQ4B 3NJXA 4Q0PA 4UOJA 5DZEA 2WNEA 3T0AA 4A7KA 3HOBA 4CVUA 1ND2C 2DUOA 2NPIA 4C8DA 5A7QA 4Y1UA 2E9QA 1OPMA 2IZWA 5EFUA 5FKBA 5H9PA 2GP3A 5T5LA 4TSVA 3ZXFA 3N7MA 1UYXA 1H8TA 3WQ7A 1LOGA 5JMOA 1WW4A 3VB9A 2VO5A 2WNUC 5LY2A 3I2OA 1W8UA 2XOMA 4F8AA 4ZU5A 2B9VA 1MS0A 4LBKA 2ZGNA 2XUEA 2Y0IA 1QWRA 2LW8A 5T55A 1Z0HA 4OI0A 3MEPA 3SH5A 5FZ9A 1XNKA 1O3TA 4IGPA 2W95A 2W1SA 4QPGA 1VR3A 4CP2A 2BGPA 4HT1T 1H4GA 1HB4A 2QQLA 3KVAA 5DN2A 1OKOA 2X05A 3LAGA 2VL4A 4UFMA 3VZMA 5FMOS 5A6QA 1VMHA 2K9ZA 2QKDA 3ES4A 3K51A 3J8F2 4LBQA 4XBLA 4OUMA 4FOVA 1AL21 4UW4A 4XVHA 3GJBA 1SEFA 4LULA 4CDUA 4F7ZA 1SFYA 1GNHA 3M1HA 4PCRA 1SPPB 5FMOL 2XQRA 5FK7A 4KG8A 4K3UA 1HQLA 4KNCA 1SPPA 3TEYA 5ISLA 4P5HA 1XU2A 1YNAA 4XEZA 1XQNA 5C9AA 5JDBA 3VBOA 3WNNA 1C5HA 4NHMA 1QJEA 3H0OA 3DKWA 1RUD3 2D5HA 5LCWL 2AUYA 2PN5A 1WLWA 2UURA 2J1EA 2JDHA 2WZEA 4M00A 2VZ1A 5BPXA 1C28A 4JKLA 5LA1A 3AYEA 4ET7A 4ATEA 1LESA 4IERA 1G86A 3LE0A 4XUOA 5IAXA 4EN7B 3ROUA 2G19A 3ZYRA 1UY0A 3LGRA 4B7EA 4Y22A 1O5LA 4LPLA 3L2YA 3USUB 3U4XA 4DQAA 1A78A 4P9XA 3I8TA 4XXAA 2ZZQA 4XCBA 1PGW2 2BU9A 2HWD3 1UNBA 2VNVA 1W90A 3VL9A 4IEPA 2UY8A 1AR73 5F6KA 3ZSMA 3RQ0A 3RZJA 3RMYA 3LA7A 2RM23 3PURA 4NPMA 4A41A 1DZRA 2EA7A 4LE4A 1MR5A 1QH7A 1R1A2 3MV11 1XYNA 3H8RA 1R1A1 4TYSA 3UESA 2JG9C 3CL1A 3ZKUA 2XLFA 3CJIB 4MGIE 5FYZA 4CDQB 1LGNA 1W04A 1POQA 4Q4V1 1V6OA 5T5PA 2ADDA 1LNSA 3AXEA 4CDQA 3RPQA 1BK0A 2CU5A 3FZ3A 3VBUB 2YFUA 2XVGA 4YG3A 4BQWA 1RUE1 3MYXA 4N53C 3ZFFA 1ONAA 1PIV1 2C5DA 3NNLA 5A1LA 2P2KA 1O3RA 2ZHNA 4FPOB 3C7GA 1VMJA 1NCRB 2J22A 4IE0A 3KV6A 5A6XA 1X9PA 3VHOA 1JHJA 4CU9A 1IS4A 1GNYA 5FXZA 4J1WA 4Q26A 3WOGA 1VP6A 2CTVA 2ZX2A 3GZAA 3DF0A 5I0UA 3NL1A 5A1AA 1RYYA 4Q5OA 4EZHA 4WM8B 2PQSA 1RUH2 3WDXA 1W0NA 5FQ0A 1RUH1 2VMDA 2Q8OA 2X8KA 4WM8A 4GJYA 1UF2C 3VZNA 2BFUS 2WO1A 3ITQA 1F5JA 4YFZA 1W03A 1WLDA 1VE0A 2X5IA 5KHJA 1NUKA 3MF9A 4IEZA 5D1IA 5FZ6A 3POSA 4P9WA 3CNAA 2JG8B 1MVEA 4LO8A 1QOSA 1HRI2 2RS32 1QMJA 1SBFA 5B4NA 3RYPA 2G1MA 1PZ8A 1W9TA 5FOJB 4E2SA 5C5UA 4KWLA 5FZLA 4AXOA 5F37A 2DYCA 3BIEA 4Y5TA 1VBC3 4LLFA 1UY3A 2NQYA 5DABA 3Q8EA 5T5JA 4BQ2A 4QX8A 2VM9A 2F4LA 3U10A 3DKQA 3AJYA 1ZA7A 3A21A 3TEWA 1PGL1 3IPVB 4RHV3 1H1IA 1VBA1 1HX6A 5I93A 3GF6A 3INAA 2ZCWA 2ZMKA 3VHRA 4KWUA 3IPVA 2HYKA 1QJX1 1UOJA 2D40A 3BIWE 4Y3OA 1CESA 1NAEA 4CPBD 1RTVA 2VW2A 1GWKA 5A3TA 1LHUA 3GYDA 2RDRA 2D6OX 2XG3A 5FZ8A 3G6JB 2YBPA 3KLSA 4TZDA 2Y6GA 4AF9A 5HXVA 3GHMA 1QQP2 1I5PA 1YQ2A 2G9ZA 4UFKA 1EUTA 5EXOA 1EV12 4L11A 5A70A 1ZRDA 4LJHA 2C9AA 4LUKA 2Q1FA 3VBFC 2EICA 3ENRA 1KJRA 3ZYHA 4FOYA 5A32B 2VECA 2XMLA 1RMU2 1CGPA 4CDWB 4NR1A 3OTFA 1C5IA 1FV2A 1UU5A 1PK6C 2DBNA 2VZSA 1VLNA 2VY0A 3ZYFA 3POYA 5DAWA 2GU9A 2VVEA 1WMFA 5FP9A 1XNBA 1UAIA 5I0DA 1YQ5A 4GAZA 4P08A 3B00A 4PT6A 4NAMA 4Y20B 2P6HA 1FMD2 3VDDC 1R093 1HRV2 3MFAA 4QDQA 2WZR3 4Y20A 1AHSA 3AXDA 2P5BA 2OA2A 2R1BA 3BI3A 1F8VA 4LUMA 2HWC2 4PQQA 3UT0A 3Q8CA 4Y1ZA 3WD5A 5GKAC 5C3QA 2GZWA 2V73A 3FFZA 2RMU3 4LKDA 1Q8OA 4CPBA 3VDBA 1YCIA 3O1TA 2WFF2 4JCKA 1AR82 4Z2AA 2AZ5A 3PMEA 3D8CA 4KWKA 3WG2A 2QCSB 4RD7A 3ACLA 3OBRA 4B7KA 3ZFEB 3T1LA 4BQYA 1IPJA 5HCAA 2B9UA 3U37A 1SG3A 4D7YA 1CPMA 4R8HA 1GV9A 2ADEA 1JZ4A 5IFTA 4XAAA 2QQOA 3RDIA 2ZGSA 3BPSA 3SLIA 3R0RA 4UBHA 4Y5SA 1XE0A 4QAWA 5A7OA 3IZOA 2QZ2A 4XFAA 4FOWA 4DY5A 3KVBA 2GMEA 5C8CC 1OHFA 3KT4A 2NMNA 3KCYA 3ME2A 4C0BA 1ND3B 3FL7A 5JIUA 4IQPA 3N9MA 3O12A 4MGYE 4YW4A 1W8WA 1RUI3 2DBIA 1ND3A 1R082 4IE5A 4QM8A 3ZPOA 2JD9A 3VBRC 4AOCA 3PU3A 5CYYA 3K3NA 5CAZA 5I0RA 2YU2A 1PHMA 5FYYA 4BK4A 3OGJA 3FLRA 1X33A 1WLCA 1GWLA 2VULA 1DGRA 2ZACA 3I3QA 4NVPA 3ZXLA 2W94A 4UYBA 4XBQA 4AQTA 5LA9A 3AP7A 1UZ0A 4DEVA 4DPNA 1YFXA 1XU1A 4BQ3A 3WEZA 3MF6A 5CU1A 2XBO2 1WCQA 3POGA 4NN0A 1AX0A 5F3CA 4FFGA 4DXRA 1ZBA3 1MQTB 3QH6A 3DGTA 1KRIA 1RJ8A 4UXAA 2WS93 3UK9A 1K42A 4JGZB 3GZUC 5CVRA 3ZYBA 1KS5A 1UYYA 4MUVA 4AEJA 1BLZA 2JKXA 4QDSA 5HCHA 2A6YA 5GLWA 5JUVA 2VMGA 3PIJA 1IS3A 4GH4A 2OYZA 3G7DA 4UFJA 1ENSA 4XQWA 1HXS2 2E7TA 2QQWA 1JI6A 4XIKA 3EB7A 5LRSA 4EN0A 3J7LA 4HG6B 1N47A 1OURA 2BWCA 1I6XA 2RJKA 3K48A 4AEMA 4CP1A 4CCDA 2JWPA 1DIWA 4BQXA 1QIQA 1ALYA 1W2AX 5FP4A 5GLTA 5D8AA 1XE7A 3W9AA 4CTEA 1RUJ3 2FDJA 3S7IA 1K5MB 3BTAA 1J84A 1MZ5A 3OBAA 1H8TC 4HVQA 1H2NA 2Y60A 2HEWF 1K5MA 1IHMA 1RXFA 1IS6A 2VH9A 3GXUA 2GC3A 3V0AA 4Y26A 4YVWA 1MEC1 4LA2A 4ATFA 4H7MA 2HWB3 5J3UA 2C0ZA 3EMRA 2IXJA 4IXLA 4AVVA 4WM7B 4QPGC 3E6BA 4EE2A 3SEEA 2HBTA 5FXXA 3MIEA 3AL5A 4G3YC 4BMEA 5BNPA 2VQTA 4IV1A 2OVUA 4M4RA 4SLIA 4WZFA 1Y4WA 3WINE 1VBB2 2ZABA 1F9KA 1WGPA 1FOD2 2X09A 3AKTA 4W6YA 4CDUC 2JIGA 3D5OA 3J7MA 4BE3A 1TME3 4OUSA 1DCSA 1KXGA 2DVFA 3PDQA 1C8M2 4LBLA 1BKZA 4KQ7A 1C8M1 2ZGUA 4Q27A 4AFCA 3E6CC 1UPIA 5HPOA 3O0VA 3JQXA 5C9AC 3VBOC 3U75A 2QZ3A 1US3A 2BJSA 2CY6A 2RS51 3C7OA 1BZWA 1CIWA 2BDRA 3WNXA 2WQ8A 2G9GA 2RDNA 3OPWA 1A8DA 1PM4A 1YJKA 2QDNA 2DCTA 2XL9A 2NYYA 2J1TA 3GZEA 4OHZA 5LWBA 1ENXA 4JGYA 4XDQA 4IUGA 5DUXA 5FBZA 3KM5A 1HJGA 1S0BA 3M3OA 1PMIA 4FTSA 4PIXA 5CISA 1BEV3 3TBDA 1B35C 4ZU4A 4AEKA 2O1QA 4BXSV 2VMIA 4IEOA 3P5BA 4H55A 3LPFA 3KT7A 1MS9A 1Q3EA 2A3XA 3ETPA 3FHQA 3N9QA 4BXFA 3IN9A 3ES1A 1ZBE2 1ASJ1 1D7PM 1LENA 3ACIA 2GH2A 5C70A 4QGMA 3PUAA 3GNEA 3WNKA 1FPN3 5JOWA 3IM0A 2D5FA 2GNTA 3WXPA
chains in the Genus database with same CATH topology
3RZGA 4NPLA 2FDGA 2FD8A 3I2OA 4NIGA 4MG2A 4CXXA 3BIEA 5DABA 3RZMA 4QKFA 4QKDA 3BU0A 3O1SA 4IE6A 3O1VA 3BKZA 2FDKA 3KHCA 4NIDA 2FDIA 3RZKA 3T4VA 4JHTA 4O7XA 4NRPA 4O61A 2FDJA 3S5AA 4NRMA 3LFMA 3BTZA 2FDFA 4NROA 2FDHA 4MGTA 4NJ4A 4IE4A 4ZHNA 3I3MA 3RZHA 4CXYA 4ZS2A 4NIIA 2IUWA 4IDZA 3I49A 3T3YA 3BI3A 3RZJA 4NPMA 3H8RA 3O1TA 3RZLA 3H8OA 4RFRB 3BTYA 3H8XA 4ZS3A 3O1RA 4QKBA 4OCTA 4IE7A 4NRQA 3O1OA 4QKNA 5F8PA 4IE0A 4NIHA 3O1UA 3KHBA 3O1MA 3O1PA 4QHOA 4IE5A 4CXWA 3T4HB 3I3QA 3BTXA 3S57A 3BUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZG A;  4NPL A;  2FDG A;  2FD8 A;  3I2O A;  4NIG A;  4MG2 A;  4CXX A;  3BIE A;  5DAB A;  3RZM A;  4QKF A;  4QKD A;  3BU0 A;  3O1S A;  4IE6 A;  3O1V A;  3BKZ A;  2FDK A;  3KHC A;  4NID A;  2FDI A;  3RZK A;  3T4V A;  4JHT A;  4O7X A;  4NRP A;  4O61 A;  2FDJ A;  3S5A A;  4NRM A;  3LFM A;  3BTZ A;  2FDF A;  4NRO A;  2FDH A;  4MGT A;  4NJ4 A;  4IE4 A;  4ZHN A;  3I3M A;  3RZH A;  4CXY A;  4ZS2 A;  4NII A;  2IUW A;  4IDZ A;  3I49 A;  3T3Y A;  3BI3 A;  3RZJ A;  4NPM A;  3H8R A;  3O1T A;  3RZL A;  3H8O A;  4RFR B;  3BTY A;  3H8X A;  4ZS3 A;  3O1R A;  4QKB A;  4OCT A;  4IE7 A;  4NRQ A;  3O1O A;  4QKN A;  5F8P A;  4IE0 A;  4NIH A;  3O1U A;  3KHB A;  3O1M A;  3O1P A;  4QHO A;  4IE5 A;  4CXW A;  3T4H B;  3I3Q A;  3BTX A;  3S57 A;  3BUC A; 
#chains in the Genus database with same CATH topology
 2D98 A;  1AVB A;  1NG0 A;  5DZF A;  1CAW B;  3TNP B;  4IEU A;  1PM7 A;  3I54 A;  4R9C A;  1I1E A;  4LQR A;  1QXR A;  3ILF A;  4KMQ A;  1ZRE A;  4MGZ E;  3JZV A;  1BYH A;  4YW2 A;  1Z78 A;  4KI5 M;  3DYO A;  2WR9 A;  3AJZ A;  3WNO A;  2VZT A;  3FUO A;  2PHT A;  2VAU A;  3KT1 A;  1O4Y A;  4FO9 A;  4P14 A;  3ZN6 A;  2P3I A;  4QKF A;  3KV9 A;  1J3P A;  5SV8 A;  3ZFF C;  5LA0 A;  2AEY A;  1NQJ A;  2C6S A;  2WN3 A;  1QDO A;  3LDR A;  3N36 A;  3M2M A;  4LOS A;  1GQG A;  4M3C F;  1LGB A;  4AI8 A;  2ZPX A;  1QGL A;  1NLQ A;  3V65 A;  3III A;  1V70 A;  1AYN 2;  4I0A A;  3O0W A;  5C3O A;  3DL3 A;  4UWD A;  4CCC A;  2BNN A;  2C24 A;  2YC4 A;  4R4Z A;  5GAL A;  3VHN A;  4Z07 A;  4S2D A;  3ZYJ B;  4LTA A;  4OUL A;  5FZA A;  1RUF 3;  2VNG A;  4LLO A;  3KHC A;  2RS1 3;  1LAJ A;  3TYJ A;  1AR9 3;  4X6Q B;  4RGG A;  4WVM B;  4DUW A;  1RXG A;  1C1F A;  4XET A;  4AED A;  1W9F A;  2Q8D A;  3OSD A;  2D43 A;  1LR5 A;  5DAV A;  2BW8 A;  1KEX A;  4UT5 A;  3PUI A;  3ZOI A;  2X5I C;  3LEK A;  2W2I A;  4JV4 A;  1LHN A;  4LO6 B;  1CQ9 A;  1NCQ B;  3HNB M;  2BGC A;  3E6D A;  3QBQ A;  4HPK B;  2WZP P;  1V6N A;  3T2Q A;  3ZFG B;  3SKJ E;  1SBD A;  2ZGQ A;  4YPJ A;  2PAK A;  4M0H A;  1NCQ A;  5FPB A;  4AI1 A;  4Z92 B;  3MIC A;  3BAL A;  4HKO A;  4QMA A;  2BYV E;  2VQ0 A;  2E63 A;  5T52 A;  4D7T A;  3NAP B;  3P3P A;  4ERO A;  3LIG A;  3OYW B;  5BNO B;  1SDD B;  4RN5 A;  3ASI A;  3NAP A;  1W6Q B;  3OYW A;  3I3D A;  1ZRI A;  4Q4W 3;  4XF1 A;  4J6G A;  4AHW A;  5HV4 A;  5IK8 A;  1OOP B;  4XCA A;  1FAT A;  2BER A;  1LU1 A;  3MIG A;  3UKT A;  4Q4X 1;  5FWJ A;  4P9Y A;  3VBS B;  1EAH 3;  4JRL A;  4JKM A;  3LDB A;  4YW7 A;  1NA1 A;  1ASJ 3;  1PX3 A;  1DQ2 A;  5F32 A;  3POF A;  2CGO A;  2WNO A;  2JDP A;  1L7R A;  2R04 2;  2YU1 A;  4IEY A;  4BZ4 A;  2NLR A;  1W6O A;  2ARA A;  2R04 1;  2VCM A;  2PMW B;  2VQA A;  2WAO A;  4IEW A;  4QX5 A;  4CP9 B;  1GOG A;  1YIF A;  4A42 A;  3H1Y A;  3I7D A;  1N1S A;  2FMD A;  4P9I A;  2KM2 A;  1O3S A;  2E31 A;  3M4F A;  1LOA A;  5A3P A;  3PMS A;  3JXS A;  1YJL A;  3WW2 A;  4ES9 A;  1EUU A;  1C4R A;  3NKG A;  1TZO A;  4CDX B;  1Z7S 2;  2A75 A;  3BGA A;  3EO6 A;  4QB6 A;  4QHO A;  2B7Y A;  2IC1 A;  2JE8 A;  2P34 A;  3ZXE A;  4BLJ A;  1VMF A;  1RVF 3;  2Y38 A;  3OBT A;  3ILN A;  3THD A;  4BOW A;  4OMD A;  5IVE A;  1ST8 A;  3QH7 A;  1XNT A;  2D6M A;  1WW6 A;  4D6S A;  4LK7 A;  1CVN A;  2W1W A;  2DV9 A;  4KG0 A;  4RGK A;  1A8M A;  3RRD A;  4CCK A;  2XLG A;  4DMI A;  5KXC A;  1VB2 A;  2PLV 1;  1J1L A;  1KFU L;  2JIC A;  2WII B;  2FCV A;  2JDM A;  1HQW A;  4ZXK A;  2RR1 2;  3VUO A;  3B93 A;  5A7W B;  5I8S A;  2RR1 1;  4JVA A;  3GHN A;  2I07 B;  4QKD A;  3WZ1 A;  1X36 A;  5A7W A;  2GAU A;  4OUE A;  2VMF A;  2Q4S A;  1KS4 A;  2IXH A;  1JZ2 A;  3MIH A;  2DFB A;  1LRH A;  2FCT A;  2HJI A;  4CEW C;  3O1S A;  2VZO A;  3C7F A;  4X8P A;  1COV 3;  3W5N A;  4N7I A;  4XJA A;  3JD7 2;  5CEH A;  5KC5 A;  3WUD A;  1F15 A;  1O5U A;  4RR3 B;  4S2F A;  4KWJ A;  3JB8 A;  4DY3 A;  2BZD A;  4YWA A;  4D69 A;  3C7E A;  2R07 3;  4Q0U A;  1WA6 X;  4JX0 A;  2D6P A;  1S0I A;  4JHT A;  4AG4 A;  5AC9 3;  2IFR A;  2JDU A;  1W05 A;  2Y6H A;  1AYM 2;  3POJ A;  3M3E A;  4FXK B;  3THT A;  2XON A;  4PIY A;  4AVC A;  4C91 A;  1QJU 1;  1AYM 1;  2GP5 A;  4RS5 B;  3ZPY A;  5ANQ A;  3O7O A;  4LIU A;  4NE9 A;  2YHJ A;  2DCY A;  5A33 B;  5EV7 A;  5I91 A;  2YRO A;  3AYD A;  2ILM A;  1W6M B;  5KXB A;  5FBJ A;  1NX9 A;  3J9S A;  3NNM A;  3ZR5 A;  5FY9 A;  1W6M A;  4AE2 A;  3KB5 A;  3OPT A;  1YFY A;  2NP0 A;  3LD8 A;  5FXW A;  1V6J A;  1OQD A;  3FN9 A;  4NWV A;  5DQ0 A;  3TRS B;  1F35 A;  3VHP A;  3B02 A;  4IV3 A;  4EN6 B;  1WWY A;  1OI6 A;  1Y7B A;  5EPA A;  2UWA A;  4GH4 C;  2XJP A;  4Y33 A;  3OGG A;  4UW5 A;  2EAA A;  5CFD B;  1YQ6 A;  2QQK A;  1UCX A;  4BYY A;  4A45 A;  3S5Q A;  1Q8V A;  2GN3 A;  3CEW A;  5CFD A;  1QF3 A;  3PVE A;  3K2O A;  5D21 A;  3SHR A;  1OH4 A;  2MEV 3;  2ZZJ A;  2GC2 A;  4Q4Y 2;  3TOJ A;  5GJ6 A;  1KFX L;  2E33 A;  1RIR A;  3THP A;  4FBF A;  3WQ0 A;  3I59 A;  4AVS A;  4Y4R A;  5D8A C;  4EV0 A;  3AYC A;  4FPY A;  2YB7 A;  1F2N A;  1LOE A;  2PLV 3;  3FUQ A;  5C4W C;  4I0W B;  1H9W A;  3EQE A;  4QPI B;  2QTW B;  5LBC A;  4BM8 A;  5FRA A;  1EPW A;  3M70 A;  1ULG A;  4KU7 A;  1QDC A;  4QPY A;  5GLZ A;  3VD7 A;  4MGS A;  1G7Y A;  4E9K A;  1UL9 A;  4CEY C;  5FZM A;  4YVW C;  2HWF 3;  2WNV A;  1YO8 A;  2FQP A;  3I2F A;  1SLA A;  2GNM A;  2OZJ A;  4W4Z A;  5EJ1 B;  1KD7 A;  4HSJ A;  1CN1 A;  1RUC 3;  1W6N B;  4GWM A;  1RUD 2;  4I3P A;  3CBN A;  4AI0 A;  1RUD 1;  1D2S A;  1I9R A;  3GBF A;  1W6N A;  2EIG A;  2OS2 A;  1WCU A;  3HEI A;  1GIC A;  4D94 A;  5BNP C;  2VZ3 A;  4IV1 C;  1CWP A;  4Y24 A;  4A2U A;  3M8L A;  3WVJ A;  3I2J A;  3M3C A;  1RUG 3;  2H6B A;  1H2L A;  3V0B A;  1FNZ A;  1ULF A;  2LTN A;  4V2V A;  2C4X A;  2FBE A;  2AYH A;  2Y0O A;  3T2T A;  3RZG A;  1N1V A;  4JDO A;  4CUB A;  1CAU A;  3W59 A;  1QHD A;  4EWE A;  5L19 A;  4GIQ A;  1UOB A;  2Z5W A;  1AXK A;  5DG1 A;  4K20 A;  1E5S A;  2PHD A;  1YWK A;  4IEV A;  5KXD A;  4N8M A;  3AC0 A;  2HWD 1;  3AZV A;  2GN7 A;  2QDR A;  3MLL A;  1AR7 2;  3MUY 1;  4Q29 A;  4BCU A;  1UKR A;  2W0X A;  2BOI A;  3T09 A;  1WMD A;  1AR7 1;  4EN9 B;  3U07 A;  2VXJ A;  5A6Z A;  2RM2 1;  1UY2 A;  3MW4 A;  5FYH A;  5GZC A;  3WF3 A;  1G9A A;  4JGY C;  1O7F A;  2ZHM A;  4B29 A;  2V09 A;  1XND A;  3WDW A;  1PVC 3;  1OSG A;  3HQX A;  4LOR A;  2W3J A;  3SNM A;  2E7A A;  3J4U H;  4H7L A;  3ZR6 A;  1ZRF A;  4UW3 A;  1U5Y A;  4OZX A;  3RG0 A;  1XJA A;  2AGS A;  2B39 A;  2WLP A;  3HAG A;  3K4Z A;  4ZY9 A;  2BBV A;  3N9L A;  5JXH A;  1K45 A;  3UKN A;  5A3M A;  3B69 A;  4MXW B;  1CR7 A;  4O7X A;  3MLJ A;  1ACC A;  3P6B A;  1W2T A;  3OOX A;  1K5J A;  4XMI A;  1YQC A;  2VNR A;  3FE5 A;  4JAA A;  3NVC A;  4JZR A;  2QQN A;  4NHL A;  5FP8 A;  3BN6 A;  2IXC A;  3AL6 A;  4AQ6 A;  1ZZ6 A;  4AVB A;  4J25 A;  4PLN A;  5LBE A;  1AL2 2;  1REE A;  3FFQ A;  1XE8 A;  2X10 A;  1VAM A;  4MAD A;  5ACA 3;  2WA4 A;  4GQ7 A;  4ZZ5 A;  3HPN A;  4YW6 A;  1XC6 A;  1TEI A;  3LA2 A;  3RZZ A;  2WJS A;  1NE6 A;  5CAD A;  2OUJ A;  5LK7 B;  3NJY A;  4AGR A;  1WKY A;  3B3Q E;  5A6Y A;  4UBG A;  2JXA A;  2JKB A;  1G8W A;  1X82 A;  3WG1 A;  1UXZ A;  4R9B A;  2D6N A;  4XJZ A;  3H42 B;  5EHD A;  5AVP A;  2DU0 A;  2JDY A;  1O6U A;  3ZYG A;  4ES8 A;  1EP0 A;  4ORF A;  2QQP A;  4O65 A;  3WW4 A;  5HV0 A;  1VBC 1;  1JYI A;  3OD4 A;  1DF0 A;  1W06 A;  4RFR B;  4ZU7 A;  5CG8 A;  1ODN A;  4I2O A;  3VZK A;  4GD4 A;  2CGP A;  3N7J A;  4MOA A;  5H9R A;  4RHV 2;  3T30 A;  3H7J A;  2G9F A;  2Y33 A;  1WW5 A;  1X50 A;  2O8Q A;  5J96 B;  3HBK A;  4RHV 1;  5FZO B;  4AED C;  5JZG B;  2XPJ A;  1W2N A;  4HVR A;  5A3N A;  1OLR A;  4MET A;  4Y5Z 0;  3MIB A;  2B46 X;  1MZF A;  5F1R A;  4LHS A;  4QKN A;  4QX2 A;  5FFO C;  4OHY A;  4GWI A;  3NNJ A;  3USU A;  2DF7 A;  3AMP A;  5HXM A;  4CSW A;  1DBN A;  1HB3 A;  2E7Q A;  4NIH A;  2XB6 C;  1UKG A;  1DQ4 A;  3WUC A;  1UYZ A;  3QLQ A;  1V9U 3;  4XF3 A;  3HT2 A;  2RDS A;  1ULO A;  2XKP A;  4P9L A;  1IG0 A;  3IDC B;  4FFH A;  3TEX A;  5A3W A;  1HV1 A;  1A3K A;  1KQR A;  2PQQ A;  4C1X A;  3JBG 1;  4Q4V 2;  4Z82 A;  1AF9 A;  3CO2 A;  1QJF A;  4CU8 A;  2YC0 A;  3WNL A;  4P5Y A;  4A3Z A;  3CJI A;  1OUS A;  4LNV A;  3UL2 A;  1UZV A;  1IQA A;  1OH3 A;  1RUE 2;  2HWE 3;  3F2Z A;  3R4D B;  4LMF A;  5K8S A;  1VIW B;  1LOD A;  3I49 A;  3ZYP A;  1PIV 2;  4XQD A;  2FD8 A;  4NIG A;  1UMZ A;  1PO1 3;  1NA1 C;  1CAV B;  2D97 A;  2VW0 A;  3AKR A;  4IND A;  3VBU A;  1XNA A;  2DVA A;  2WUH A;  4AWD A;  3C7H A;  5FKC A;  1R09 1;  2R0F A;  5BNN B;  4HXC A;  2WZR 1;  1NCR A;  2YBS A;  1DHK B;  2Y8K A;  4QM9 A;  5BNN A;  4XFF A;  2WAA A;  3BCW A;  2R1D A;  2VZV A;  2ZGM A;  1SBE A;  3EHK A;  3A7Q A;  3H9A A;  1UW8 A;  3Q8A A;  2YC2 A;  2RMU 1;  4IEX A;  3O0X A;  2BV4 A;  2JEM A;  3ZSE A;  1YIP A;  4RA0 A;  4LKE A;  2P17 A;  3WDY A;  2WT1 A;  4Z1V A;  1JU4 A;  5JR7 B;  2WC2 A;  2AC1 A;  1JYT A;  3SCH A;  1OQ1 A;  2C9K A;  4QXB A;  4QD2 A;  4DIQ A;  1OFN A;  3OEA A;  3IDB B;  4WVW A;  2VGD A;  3KD4 A;  1WD4 A;  2JG8 A;  3KCC A;  3WQ1 A;  1URX A;  3LWC A;  4XFH A;  4A3X A;  2VTX J;  4O61 A;  2B42 B;  1S0G A;  3BTZ A;  1REF A;  2FDF A;  1Q43 A;  4NRO A;  4YVS B;  3J8F 3;  2EAK A;  3L2H A;  2WFP A;  4PBP A;  3LF7 A;  4QQP A;  1PGL 2;  4AGG A;  1DQ0 A;  1RED A;  1VBA 2;  1WZX A;  5E89 A;  4NJ4 A;  4C1W A;  1OD3 A;  3FHA A;  4IE4 A;  4URT A;  1JZ6 A;  1RUI 1;  3SEP A;  1L7Q A;  4ASL A;  1QJX 2;  5EYX A;  1AR6 3;  2CNA A;  1GP4 A;  4ZS2 A;  1GMM A;  2Y64 A;  3OEB A;  3KV4 A;  4NIA A;  3WF1 A;  1OVP A;  5JCT A;  4N90 A;  1LGC A;  3VBH B;  4TTG A;  2VCB A;  1DP0 A;  2X29 A;  3VBH A;  5F5A A;  1DFQ A;  1SLB A;  5A7S A;  2I2S A;  5DUV A;  3ZO0 B;  1QKQ A;  5DAP A;  2JDK A;  2Y6L A;  3CMG A;  3WF0 A;  4OHV A;  1PNF A;  5F6L B;  1PO2 3;  1ZBA 2;  3MID A;  1OLM E;  2EIE A;  1J58 A;  1ZBA 1;  2PHF A;  2WS9 2;  3JBG 3;  3OJB A;  4PDW B;  4QQH A;  4XZU G;  5FLJ A;  3RGB A;  2WS9 1;  5CKM A;  5A32 A;  1H6X A;  3HMY A;  4XE9 A;  4FPK A;  4P9J A;  3WT3 A;  2YUE A;  3AK0 A;  3SC7 X;  3HJR A;  3T2P A;  4CDW A;  5IT6 A;  2P37 A;  4XF4 A;  3UYJ A;  1MS4 A;  2A3Y A;  2ORZ A;  4G9S B;  2JB4 A;  3O1R A;  4HL0 A;  1CZV A;  3N9N A;  5T50 A;  1SFP A;  1ZZ9 A;  1W9W A;  5L36 A;  1VBE 1;  1X8M A;  2ZGT A;  4XUR A;  2ZKN A;  4YZ5 A;  5ABJ B;  3MDP A;  4HFS A;  4LE3 A;  1O91 A;  5JOX A;  4AVA A;  3ZX7 A;  5ABJ A;  5FPV A;  2OPW A;  2XJV A;  3A0N A;  3FJS A;  3O1U A;  3IKW A;  5FXV A;  1NXD 1;  1L3J A;  2ZEY A;  3MV0 1;  4QHB A;  2TUN A;  4AQS A;  5CNA A;  1JOD A;  1RUJ 2;  3I2D A;  3T2O A;  2H6C A;  5L9V A;  2K0G A;  2XLA A;  2Q1Z B;  1RUJ 1;  4DUX A;  3AMN A;  1W6P B;  4JHZ A;  3VKF C;  4YAR A;  2TEP A;  1DYO A;  4I02 A;  1AJO A;  4L99 A;  2ZEZ A;  3CLP A;  4CU6 A;  5JXI A;  5FYU A;  5CG9 A;  3AFG A;  4KGQ A;  3ABZ A;  4IV3 C;  4MHU A;  3T0B A;  4YGC A;  5DXD A;  1T6G C;  1L7L A;  3FX3 A;  4YSF A;  1AXY A;  2HWB 1;  1J83 A;  3ZFE A;  3LEI A;  4QX1 A;  1TNF A;  1TVG A;  1DU3 D;  4K6B A;  4B4R A;  2EVX A;  2XH6 A;  4EJR A;  4YZ2 A;  1OT5 A;  1BHG A;  1ZM1 A;  2J1U A;  2WSV A;  4CYD A;  1TME 2;  2BGO A;  1UZY A;  1TME 1;  2E51 A;  2WWS A;  4ONU A;  4E4Z A;  1S0E A;  2A1X A;  4A6S A;  4XHB A;  1BK1 A;  2A6V A;  2WNV C;  3KZ4 C;  3ST7 A;  3BKZ A;  1DZT A;  5A1F A;  2PHL A;  2UYA A;  2Z79 A;  1MZE A;  3DPR B;  2RS3 3;  2W92 A;  5C6C A;  1LB2 A;  1US2 A;  2OUH A;  3C2U A;  1Y9G A;  5C3P A;  3JCI A;  1K3I A;  1DQ5 A;  4XC9 A;  1DQ1 A;  2D93 A;  2OX0 A;  4E8C A;  4NRM A;  5IVF A;  2VBB A;  4W65 A;  3M3I A;  1BEV 1;  4LBJ A;  1WBL A;  2J1A A;  2FDH A;  3N4M A;  5F9T A;  2VQU A;  4GWN A;  1MQT A;  1DDL A;  5FMB A;  4MGT A;  3PUQ A;  1BXH A;  3IAQ A;  2YGL A;  4JGZ A;  1DG6 A;  5IK5 A;  2Y6F A;  5KC6 A;  4YM0 A;  3I3M A;  3QOP A;  1VBE 3;  2D3P A;  2PHW A;  4SBV A;  5DPN A;  4AYU A;  4O9E A;  1N1T A;  1AX2 A;  3MGU A;  4N43 B;  1FPN 1;  2VZR A;  1F4H A;  3OUH A;  4WBB A;  4QB2 A;  4E2Q A;  1NT0 A;  1H0B A;  3HT1 A;  2VJX A;  1EV1 3;  3W5M A;  1PMJ X;  4N43 A;  2DVB A;  2ARB A;  1WLT A;  2W1Q A;  5I8Y A;  1W3X A;  1YUD A;  3U11 A;  5SV5 A;  2QQM A;  1RMU 3;  2YBK A;  3WP6 A;  4A6O A;  5JOY A;  2A5Z A;  3TAY A;  2LS6 A;  2ZJC A;  4QHZ A;  2UU8 A;  4CCM A;  5L73 A;  5FUI A;  3BYW A;  2J42 A;  5ANN A;  2CWM A;  2N7G A;  4XFI A;  5FYI A;  3SIS A;  5IFP A;  2HLE A;  3VKM A;  1MEC 2;  3UKV A;  2IXL A;  2NM1 A;  4GXL A;  1AJK A;  2A6X A;  1FMD 3;  2GMP A;  4COV A;  1DQ6 A;  1HRV 3;  1V00 A;  5FLH A;  1UIJ A;  3Q9O A;  4R52 A;  3ZKY A;  4WM7 A;  3ZN4 A;  2HWC 3;  1RUF 2;  5F8P A;  2AEN A;  1RUF 1;  4LIV A;  2BNM A;  3LEG A;  2H0B A;  2RS1 1;  1GFF 2;  2B4K A;  1LEM A;  1AR9 1;  1O59 A;  5GLV A;  3KQR A;  2VXR A;  2WFF 3;  2ZOE B;  3CJX A;  1AR8 3;  4CP0 A;  4LO4 B;  4YW5 A;  3FLT A;  5FP3 A;  1H4H A;  3WY6 A;  4CE8 A;  2I74 A;  4BQ4 A;  1LHV A;  2GH8 A;  4OLL A;  5AFB A;  1ULE A;  2VCC A;  1JU3 A;  3AMM A;  2DUP A;  4NO4 A;  3E1F 1;  4Y1Y A;  2XJU A;  4K21 A;  1D0G A;  2WYS A;  4WV8 A;  4YZ3 A;  5E16 A;  5GZD A;  5C8W A;  2RS5 2;  3ACF A;  3FC0 A;  4GKX A;  5E8A A;  1PGS A;  4IEQ A;  5B2G B;  4HZF A;  4K40 A;  4HAN A;  1CON A;  4IGQ A;  4NPL A;  4QX3 A;  4MYE A;  3MW3 A;  4XTP A;  3B01 A;  2V5Y A;  5FO7 B;  3RWN A;  1F4A A;  4IGO A;  4LBN A;  1S0C A;  2F4P A;  4ITC A;  1LUL A;  5L7O B;  1ZZ7 A;  1FX5 A;  1IZ3 A;  1XSR A;  3OG2 A;  1GYK A;  1GNZ A;  1OXC A;  1PZ9 A;  2WQZ C;  4Q4W 2;  1ZNP A;  4HOO A;  1LHW A;  3NQH A;  4RQP B;  5L7O A;  1CPN A;  4DNY A;  4W8J A;  4Q4W 1;  1O3Q A;  2ATF A;  1R08 3;  5FO9 B;  1JOB A;  3JUU A;  5FPX A;  5F7U A;  2P3J A;  2TNF A;  3PTY A;  3GCX A;  3OY8 B;  1EAH 2;  4B4P A;  5IK4 A;  3NV3 A;  1EAH 1;  1ASJ 2;  1Y43 B;  4NHY A;  4FP2 A;  2WSU A;  1YC6 1;  3PIG A;  2ZAH A;  1SFN A;  2OQ7 A;  2ZAA A;  3K3O A;  1LHO A;  1W9Y A;  2E6V A;  1GZC A;  2HYX A;  2DU1 A;  1GWM A;  1ND2 B;  2WN2 A;  3NNF A;  4P02 B;  2ZGL A;  5DDJ 1;  3BPZ A;  2GMM A;  5F39 A;  3VZJ A;  1V6K A;  4N9H A;  4NUB A;  1CAW A;  2WNU B;  5FOB B;  1NZC A;  4QGN A;  3W20 A;  2Z69 A;  2LRP A;  2NMO A;  3CJI C;  3AVS A;  3RMX A;  5LBB A;  2R06 3;  4CDQ C;  2ZMN A;  2C1F A;  2E26 A;  4YG6 A;  3V56 A;  3VD5 A;  2VOX A;  4HN1 A;  1CZS A;  3VBU C;  1OUX A;  2EIB A;  5K9Y A;  1HXS 3;  1RVF 2;  2W1U A;  3WX5 A;  1TE1 B;  2VZQ A;  3DYM A;  5F3I A;  5B4X A;  1RVF 1;  3LDK A;  3U1X A;  4LBM A;  3OPZ A;  2ZXQ A;  4RGA A;  3WNM A;  4I30 A;  1UPS A;  2XWJ B;  1NCR C;  4Q8K A;  5CFC B;  4XYX A;  3UGG A;  3VLB B;  5JAX A;  1MAC A;  1H2K A;  1AL0 G;  4ZPI A;  4M3C E;  4EZ4 A;  5CFC A;  5JSP A;  1LKN A;  1JYN A;  2O8O A;  5F2W A;  2DDU A;  3MPB A;  5FR3 A;  1RIN A;  3D82 A;  5EJ3 A;  1CJD A;  1EPZ A;  3BOP A;  3V64 A;  3MUZ 1;  2JX9 A;  4WM8 C;  1UQX A;  3N7L A;  3PVN A;  3PL0 A;  4HK9 A;  4WVM A;  3S30 A;  1YLL A;  3R4U A;  4UFI A;  4B1M A;  4DUV A;  4Q0S A;  2WL1 A;  4XZP A;  2A3W A;  3SH4 A;  1CX4 A;  4PF1 A;  3NKT A;  5IJR A;  4DZG A;  1HN1 A;  4MVT A;  2ARE A;  4Q0Q A;  2RV9 A;  3ECQ A;  2JG8 C;  2QUO A;  4HPK A;  1VB4 A;  1VBD 1;  2W08 A;  4QX7 A;  2PTM A;  2BNO A;  3ZFG A;  3HN1 A;  1COV 2;  3LFI A;  5EJZ B;  3WG3 A;  5IAT A;  1QNY A;  5FZI A;  1COV 1;  2TBV A;  3NV1 A;  3H3Z A;  3LB9 A;  4V2W A;  1VBB 3;  4Q1R A;  4YYO A;  1FOD 3;  1DZQ A;  2GC1 A;  4P00 B;  4L97 A;  4A7Z A;  2VOK A;  4FOQ A;  5BNO A;  4IET A;  1W8H A;  1BJQ A;  2CDP A;  2WBK A;  1W6Q A;  4PHZ A;  4Q4X 2;  4QPW A;  1UO9 A;  1HB2 A;  1D2Q A;  2R07 1;  2CWS A;  1ZZ8 A;  2JD4 A;  5AC9 2;  1ZZC A;  3VKL A;  1XSQ A;  1OOP A;  4AAX A;  4ARY A;  5AC9 1;  5FUP A;  4UI9 L;  4XF0 A;  4AR2 A;  3VBS A;  2A6W A;  4OHW A;  5FZK A;  5LEJ A;  5FZH A;  4M3C B;  2RE9 A;  3VBH C;  4UFL A;  2WRA A;  4QXC A;  5I0T A;  2R16 A;  2VVD A;  2HKX A;  2JG9 B;  5FPZ A;  2MHF A;  4M3C A;  5G04 L;  4ASK A;  1RGS A;  5I0S A;  5DDJ 3;  4CP9 A;  3BUC A;  3SXW A;  5G05 L;  2W46 A;  4XDP A;  3GZT B;  4GKY A;  3WLU A;  3K75 B;  2D7F A;  1LEC A;  2BPA 2;  2IXK A;  4N53 B;  3HQR A;  4EYU A;  1PNG A;  4CDW C;  2XQX A;  3HR9 A;  4MG2 A;  4YM2 A;  4GMP 0;  2QBX A;  3NRU A;  1D4M 3;  1O4Z A;  2R32 A;  5FZ4 A;  1V6L A;  5C71 A;  4S2H A;  3RZM A;  1QJZ A;  1XXN A;  1ZBE 3;  5DMY A;  5JXJ A;  4XW3 A;  3C8X A;  2Q8E A;  3CF6 E;  3HN3 A;  4CDX A;  2DTY A;  5FAX A;  2VR4 A;  3U4S A;  5BXX A;  2DUQ A;  4A4A A;  5JIA A;  2C26 A;  4LXL A;  3KF5 A;  4XFB A;  1JYW A;  3CIH A;  1UOG A;  2MEV 1;  1YEW A;  3IWZ A;  1NY7 1;  4YFW A;  3FBY A;  5LA2 A;  4JQT A;  1T6B X;  3AKS A;  1OD5 A;  2PLV 2;  4MGQ A;  5K0U B;  3VD9 A;  5BV6 A;  3PVB B;  1YI7 A;  1S0J A;  2VC9 A;  5K0U A;  3RZK A;  4AK3 A;  1SLC A;  1Y3T A;  1SAC A;  3B94 A;  3KWV A;  3QAC A;  5FZ7 A;  2JEC A;  2SLI A;  5C3S A;  3KGL A;  2ZEW A;  3LFM A;  1S2K A;  2HWF 1;  3AP4 A;  4XDO A;  1E5I A;  2UY9 A;  3RFR A;  2XWB B;  3ZFE C;  1LJ7 A;  2BP6 A;  3OF1 A;  3FMG A;  4V1P A;  1RUC 1;  1AYN 3;  2EXJ A;  4I09 A;  3GBW A;  1GZW B;  3RI8 A;  1VBD 3;  5J48 A;  1X7N A;  1UYP A;  1BMV 2;  4EN8 B;  4EWA A;  2PHX A;  3VDC A;  1GZW A;  5APA A;  1BMV 1;  5HCB A;  1S4C A;  1RUG 2;  4AFB A;  1OFS A;  2YV8 A;  1RUG 1;  4FPL A;  2LRO A;  3IB3 A;  4GJZ A;  4PBO A;  4YM3 A;  1ND3 C;  4RR3 A;  2DCJ A;  1ENR A;  1XBF A;  2DTW A;  1JYX A;  1M4W A;  4CU7 A;  3T08 A;  2W47 A;  1JOJ A;  4LHN A;  2VBP A;  3VZO A;  3H3U A;  4F83 A;  4FVV A;  3PUS A;  5A3O A;  1QJU 2;  5FK8 A;  4BWO A;  4DXS A;  4AL9 A;  3AFK A;  5KBF A;  2Y6K A;  4FPJ A;  2QQU A;  3VBF B;  2YY1 A;  1BBT 1;  4JQR A;  4BIF A;  2IXI A;  4IL7 A;  4RS5 A;  1OPO A;  4AI9 A;  4DRV A;  4DS0 A;  3VBF A;  4BIO A;  3BU7 A;  3KF3 A;  4LA3 A;  2NZ9 A;  1Q8Q A;  4HK8 A;  4N7U A;  1JUH A;  4QKB A;  5A33 A;  1TMF 3;  3AYA A;  3HNY M;  2GC0 A;  1PVC 1;  3LEM A;  4GAL A;  1YRZ A;  4PLM A;  2Y26 A;  1RHI 3;  2ZX0 A;  4MZU A;  3R6S A;  5C33 A;  2Z2S B;  1MQT C;  3KMH A;  1IQD C;  2B45 X;  5E6H A;  1NZI A;  4JGZ C;  1M06 G;  3OB8 A;  3VDD B;  3I4I A;  2E53 A;  1UX7 A;  4FAH A;  1F31 A;  1LOB A;  2HEV F;  1GBG A;  1KDM A;  3FBM A;  1MS8 A;  5DZG A;  5F2S A;  5FZG A;  3WCR A;  5LAT A;  3E5U A;  2R49 A;  4FPH A;  5E88 A;  3D3A A;  3WW3 A;  1GAN A;  2HEY F;  2V72 A;  3LZZ A;  4LOT A;  1UY4 A;  4FFI A;  1WA4 A;  4K7J A;  3IMN A;  3VD3 A;  1H30 A;  1IOA A;  1JS9 A;  3WP5 A;  4ASM B;  5ACA 1;  3QCW A;  3ATG A;  2ZBJ A;  4NWW A;  3MHZ A;  3RSJ A;  2P4E A;  2DFC A;  4XAB A;  4QDR A;  2ZHL A;  4HLT A;  2QFE A;  2D3R A;  4XXP A;  2VZU A;  3SCG A;  2ZTN A;  2QJV A;  1K5M C;  4BU2 A;  1FI2 A;  1Z7S 3;  4QPI A;  5FPA A;  4U2A A;  5GM0 A;  4GUL A;  4HKW A;  5FP7 A;  2RHP A;  1HN0 A;  3WDV A;  5LAS A;  2JEN A;  1K12 A;  2VTF A;  5C8C B;  2F17 A;  2WZ8 A;  2IVJ A;  4Y4Y A;  4BK5 A;  3AVR A;  2PEL A;  3E5X A;  3BU0 A;  4MO3 M;  4BQ5 A;  1HJF A;  3A23 A;  4WM7 C;  4TN7 A;  3CDZ B;  4AW7 A;  3VBR B;  3LCP A;  4X6R B;  2OT7 A;  2RJ2 A;  3TN9 1;  3IDA A;  4PQ9 A;  3VBR A;  1XB9 A;  2Z4F A;  1VRH 3;  1KIT A;  5F3G A;  2XL7 A;  1STM A;  2Q0A A;  4FAG A;  2YYO A;  4JTN A;  2J7M A;  4ISR A;  3H8O A;  4JDM A;  1Q5O A;  4QXK A;  2HWD 2;  5FZ3 A;  3AZZ A;  3ZXA C;  2WO3 A;  3NMB A;  4HN0 A;  2HBU A;  4TLF A;  3LSE A;  1R64 A;  1CAX B;  2ZEX A;  5KHK A;  1OA2 A;  3ACG A;  1BBT 3;  2RM2 2;  1GSL A;  5FY7 A;  1V9U 1;  2WAB A;  1RB8 G;  1JN2 P;  2JDN A;  5EP9 A;  4FI9 A;  2D3S A;  2FHR A;  5JOZ A;  2W5F A;  1I5Z A;  3JD7 3;  3APB A;  4UF0 B;  4QXH A;  3H1M A;  4XJU A;  3SKV A;  1CZT A;  1MS1 A;  3IAP A;  4I01 A;  5JLV A;  5CA6 A;  1JMU B;  3EJK A;  2XJS A;  5FZD A;  5L7O C;  4XJ9 A;  4ISQ A;  1PMH X;  4D7S A;  4CRQ A;  4L0P A;  2YG0 A;  1OMI A;  1NLS A;  1UN1 A;  1G9F A;  4LKF A;  2HWE 1;  4QU1 A;  1SLL A;  4LHL A;  1GR3 A;  3UGF A;  1LCL A;  1PO1 2;  1QOT A;  1XOY A;  2GSY A;  3SH3 A;  3T3Y A;  1PO1 1;  5CB7 A;  4NHK A;  2CV6 A;  5DG2 A;  2W87 A;  4XFC A;  5L9R A;  5A7N A;  5FZB A;  4C90 A;  3ACH A;  1GLH A;  2LM3 A;  5JSR A;  5A3L A;  3UV9 A;  2ZGK A;  4MXW A;  4QQO A;  4XJ8 A;  1V6I A;  1QJY 3;  1TNR A;  2BRT A;  3WHU A;  2XVK A;  1LTE A;  1RJ7 A;  1WD3 A;  1WCS A;  4E4D X;  3WNP A;  1H8T B;  2Q5T A;  1W8Z A;  2L9L A;  4WVZ A;  1AUY A;  3H1W A;  4YGE A;  5FWE A;  4OHX A;  3ZLI A;  2P1B A;  5H9S A;  5D2A A;  3LIH A;  4LR4 A;  1MZ6 A;  1OQE A;  4AVT A;  3O1O A;  4WZC A;  2EXK A;  5A80 A;  5JXG A;  4QPG B;  5FZ0 A;  4XOG A;  4X8N A;  1R1Z A;  2VNO A;  5HI0 A;  2A7A A;  4KGG A;  1W3V A;  3KHB A;  2CAU A;  4NHX A;  3EYP A;  2B8M A;  3O1M A;  3ZXG A;  1H2M A;  1TQ5 A;  1CIY A;  2B5H A;  1ZYB A;  2EXI A;  2YFZ A;  3KV5 A;  3VDA A;  3WV6 A;  4LBQ B;  4E2G A;  3O1P A;  2WDB A;  3FWE A;  1VBC 2;  1FAY A;  1X8E A;  2WT2 A;  4Q4Y 3;  3UJO A;  4B3N A;  4CDU B;  5BYN A;  5CFC C;  1FXZ A;  3HNM A;  4GMP 3;  1MS5 A;  1UZZ A;  3J8F 1;  4C0H A;  4XTM A;  1ENQ A;  2WWJ A;  1AX1 A;  3TN9 3;  1BQP A;  5EZW A;  5FMC A;  1GU3 A;  3T4H B;  2JE9 A;  4XJW A;  5C9A B;  1AR6 2;  4OFG A;  2R6Q A;  3VBO B;  1PZ7 A;  2J1S A;  1AR6 1;  2BBA A;  2VTX A;  5FZO A;  5JZG A;  1SCR A;  4BLI A;  4XFG A;  5F5I A;  4AFM A;  2MNG A;  1DLL A;  3R05 A;  5HCF A;  4CXX A;  4R9A A;  1NCQ C;  2AR6 A;  4UW6 A;  1XYP A;  2DVG A;  4GB3 3;  3ZFG C;  1ULP A;  3VGI A;  1CX1 A;  4HVO A;  1PO2 2;  2OQ6 A;  3AP6 A;  1B35 B;  2O14 A;  1PO2 1;  4AFA A;  2FZ2 A;  3JBG 2;  1UIK A;  5AVA A;  3NAP C;  1S0F A;  1B35 A;  3KCX A;  3ORJ A;  4O9G A;  4XHX A;  4Y22 B;  5FLI A;  3CHX A;  5IVY A;  5BNO C;  2ARX A;  1FNY A;  4L2N A;  4CCO A;  3WQB A;  1GZ9 A;  5M0T A;  4ZKT B;  4LEJ A;  4XF9 A;  1YFU A;  2FDK A;  5CKN A;  1OOP C;  4CCE A;  4NID A;  1HKD A;  2VOV A;  3AP5 A;  1PGW 1;  5F5C A;  3VBS C;  1U12 A;  3JQW A;  1R09 2;  2GNB A;  1C1L A;  2O0O A;  3O14 A;  4N9I A;  1CAV A;  2WZR 2;  3A0K A;  3TB0 A;  3NWK A;  3WCS A;  4QU2 A;  5JMC A;  2OXB A;  1S2E A;  5EYY A;  1O8P A;  1O8S A;  1ZA4 A;  2RDQ A;  2RMU 2;  3SQO A;  3B9C A;  5FMD A;  3GCW A;  3UGH A;  2WYF A;  4ZHN A;  1UX6 A;  3UJQ A;  3ZFF B;  4QGL A;  4XBN A;  4LBO A;  5BNQ A;  3PTR B;  1W28 A;  5H9Q A;  2XJR A;  1UU4 A;  2KXL A;  1ULD A;  4XUN A;  3ZMO A;  3OGV A;  4FQZ A;  2AEZ A;  4DOU A;  5FYC A;  5EIY B;  5FCC A;  1SMV A;  4HMZ A;  4CDX C;  5LRR A;  2R0H A;  1ZX5 A;  1H9P A;  2BTV C;  4URA A;  1LOC A;  3I3E A;  3W21 A;  1N1Y A;  3T1M A;  3WP4 A;  1RL3 A;  1N3P A;  1J3R A;  1EYB A;  3AMQ A;  4AHY A;  2D6K A;  1SQ4 A;  2CDO A;  3AP9 A;  5FQ0 B;  1IPK A;  3RZL A;  1AL2 3;  1UZW A;  4K1Z A;  4Z2W A;  4QT6 A;  4JKK A;  1RUI 2;  4YVS A;  5J37 A;  2X5I B;  5K0U C;  2VU9 A;  2XGX A;  1KGY A;  3I2G A;  1IPS A;  4TLG A;  4W50 A;  3WF4 A;  2WO7 A;  1OVS A;  1GP5 A;  1QXP A;  3GJA A;  4D6R A;  4OCT A;  4F3J A;  1NLR A;  3S0M A;  5FIX A;  1UWW A;  2J1V A;  2V5D A;  2BFU L;  2W68 A;  1VAV A;  1HRI 1;  1UMH A;  2RS3 1;  3VZL A;  3E97 A;  3U0Z A;  1NXM A;  3ZIX A;  1NOV A;  4KBB A;  3HQU A;  4XMA A;  4EQV A;  2UWB A;  4GA9 A;  4XPV A;  1J1T A;  1X9T A;  3ZXD A;  5J98 B;  1UD1 A;  2ORX A;  4LKS A;  2AAC A;  1RUO A;  4OZO A;  1OF4 A;  1S1A A;  5LY1 A;  2IVI B;  5FJK A;  1OLQ A;  1DGR N;  5IVJ A;  4RR3 C;  2XHK A;  4PDW A;  1O4T A;  2IWG B;  3DEC A;  2ZGO A;  2IFW A;  5T3N A;  4Z8B A;  2PYT A;  3GBG A;  1VBE 2;  4E27 A;  2YGM A;  1DYK A;  2VVF A;  5FDB A;  3O5S A;  3CQO A;  4BIS A;  1QQP 1;  4RS5 C;  2DCK A;  2K2S A;  1EV1 1;  1R1A 3;  4CZS A;  1H6Y A;  3N9O A;  4BMB A;  5IVV A;  1ODM A;  4E8D A;  1RMU 1;  4FT8 A;  4K8F A;  2LAL A;  4Q4V 3;  5BY5 A;  1HIX A;  1QEX A;  2OII A;  2ZKL A;  3I2H A;  3RWK X;  5FPU A;  2VE1 A;  1U0A A;  1YFW A;  1ZRC A;  3A22 A;  1NKG A;  2WLQ A;  3JU9 A;  1W6P A;  3OCP A;  1RUE 3;  4H3W A;  4COW A;  3AZY A;  3O1V A;  1Y9Q A;  2YZ4 A;  4CUA A;  1PIV 3;  1WBF A;  1LOF A;  1GUI A;  1UXX X;  2HWB 2;  3MFC A;  2PFW A;  5HBA A;  4U36 A;  2A70 A;  1FMD 1;  3H3L A;  1HRV 1;  1UY1 A;  4YGB A;  3U78 A;  3B7M A;  3MPP G;  5CFD C;  4RFT 0;  2R30 A;  4I3G A;  5LK5 A;  3T4V A;  3OGR A;  2DUR A;  1OLM A;  2BOJ A;  2HWC 1;  3S5A A;  4KBZ A;  3WDT A;  1SZB A;  1FYU A;  2XUM A;  3URF A;  1RUH 3;  3PNA A;  5CZK A;  2WFF 1;  1AR8 1;  2ARC A;  1G9B A;  3I2I A;  1W2U A;  2WIN B;  4MXV A;  5IVC A;  1GQP A;  4B4Q A;  2LUW A;  4QPI C;  4NOT A;  4YG0 A;  1OKQ A;  4EWD A;  4NII A;  1W8T A;  4YM1 A;  2DCZ A;  4CEW B;  4E4H A;  5GZG A;  4H14 A;  3MI8 A;  3IT8 A;  1HRI 3;  2IUW A;  1GQH A;  4W6W A;  2ENR A;  3LPG A;  3ZSJ A;  4CEW A;  1MS3 A;  4HBN A;  3DPR A;  5I8T A;  1DYP A;  1XNC A;  2EID A;  2W52 A;  4K9S A;  2BVB A;  4WVV A;  4FSJ A;  2WWU A;  1SCS A;  4CCL A;  1JUI A;  3FLP A;  3ILR A;  1PX4 A;  1DLC A;  5FYT A;  2D6L X;  1BEV 2;  1IKP A;  2BEO A;  1VBA 3;  2EXH A;  3RNS A;  5FYS A;  1WCD J;  1WCK A;  1MPX A;  4OVE A;  4QWN A;  4QB1 A;  4XIL A;  1R08 1;  2PAE A;  4P9G A;  2NN8 A;  1QJX 3;  5EQU A;  4AGV A;  1YQ8 A;  4DB5 A;  5FO8 B;  3GM8 A;  2QQI A;  3H8X A;  4QX0 A;  4ZS3 A;  3D0J A;  4RSU A;  2CL2 A;  4IE7 A;  2ETE A;  1FPN 2;  3B9I A;  3ZIW A;  1H1M A;  4NPR A;  1S0D A;  1QQP 3;  5KHH A;  4AZZ A;  2XBO 1;  4AHX A;  4XAC A;  1S2B A;  1G9D A;  5FTT C;  3DXU A;  5LB6 A;  3MLK A;  3VN4 A;  1HLC A;  2FZ1 A;  4Y1X A;  4HON A;  2Q1M A;  3RVH A;  3UNP A;  4MH0 E;  4RYD A;  3X29 B;  4BB3 A;  2JIJ A;  3K77 A;  2R06 2;  4GH4 B;  4COY A;  2R06 1;  1IGO A;  2VMH A;  5JWP A;  2VOT A;  2JDZ A;  3USS A;  4IW3 A;  3N7K A;  1HQN A;  1XPW A;  3THC A;  1OA3 A;  3DN7 A;  3D6E A;  3MBW A;  3PLQ A;  2XHN A;  2XVL A;  5J36 A;  3LKJ A;  1G6N A;  1HXS 1;  1OA4 A;  2VUC A;  3AZW A;  2A71 A;  3IMM A;  3NV4 A;  1GOH A;  1QNW A;  3AX4 A;  3SCF A;  1U5I A;  2FCU A;  3GGL A;  3VL8 A;  5D8A B;  3AM2 A;  4XUQ A;  4MGK E;  4LO7 A;  5IYY A;  2F6B A;  1VRB A;  5C4W B;  5LW9 A;  2CGN A;  2RS1 2;  4YGD A;  4BPZ A;  1E57 A;  5T54 A;  1AR9 2;  3CU7 A;  3S7E A;  4JDN A;  2KR2 A;  3P3N A;  5C4W A;  5T5O A;  4YZ1 A;  4QQL A;  5DAX A;  5F5Q A;  2J1R A;  5FUN A;  1W0P A;  4YVW B;  4CEY B;  4D6Q A;  5KR7 A;  3V0A B;  3DV8 A;  4YZ4 A;  5TSW A;  4QQ2 A;  4CEY A;  4DIN B;  2P3K A;  3SIT A;  1JXN A;  1VPH A;  4A44 A;  2PHR A;  1VAK A;  2A6Z A;  4PI2 A;  3ZN5 A;  1IG3 A;  1WW7 A;  4D0Q A;  3WHT A;  5JPM B;  2OPK A;  5BNP B;  3PUH A;  4CCN A;  4IV1 B;  2VUJ A;  2Q8C A;  2D44 A;  5LEK A;  2P3Y A;  2QQJ A;  4HSL A;  3MO4 A;  5FY8 A;  3TEZ A;  1VBB 1;  2JJ6 A;  2VPV A;  5FRE A;  1IKQ A;  1FOD 1;  1YI9 A;  5FYB A;  4BDV B;  5JR2 A;  1W39 A;  4DXZ A;  2KD7 A;  4AFD A;  2R7E B;  4RQP A;  4OQ9 A;  2CSG A;  1F5F A;  5LZ6 A;  3H50 A;  5AFE A;  2VUA A;  5JZG C;  4YLZ A;  2GND A;  3OY8 A;  4FCA A;  1NYW A;  2QNK A;  3WDU A;  5EWS A;  1C57 A;  2XXZ A;  3P1I A;  3D0S A;  3HWJ A;  3LOI A;  5DAQ A;  4CUG A;  3J7N A;  1SLI A;  4CXY A;  4JGY B;  1XYO A;  5J09 A;  2WKK A;  4XAE A;  3M3Q A;  1ZVF A;  3N3H A;  5DDJ 2;  4IDZ A;  1C8N A;  2XBO 3;  2ZA9 A;  2PXJ A;  1U5Z A;  4AQ2 A;  1ND2 A;  3RS6 A;  1VAL A;  5K7P A;  2W91 A;  4PJY A;  1Q56 A;  2ET7 A;  2X53 S;  3K4A A;  1P8J A;  1UMI A;  2ZGP A;  5ERL A;  5JPN B;  3LOB A;  1D4M 2;  2WNU A;  3HIF A;  5IWF A;  1EY2 A;  1DGW X;  1JHN A;  2CAV A;  1SHW B;  1D4M 1;  1W8F A;  3IDE A;  5FJH A;  2DWR A;  1ZBE 1;  3DEM A;  5GZE A;  5IAV A;  3R4S A;  2RJL A;  1W8O A;  5GZF A;  4OI2 A;  1H1A A;  3OBZ A;  4B8E A;  5JI9 A;  5C7G A;  3N9P A;  2UWC A;  2VMC A;  2OW4 A;  1C3H A;  5FY5 A;  1KJL A;  4FTB A;  5BNN C;  4HKL A;  2GAL A;  4MV2 A;  3E5Q A;  2EAL A;  3BVC A;  2ID4 A;  2H0V A;  4BHP A;  1UU6 A;  2W9X A;  4Q2F A;  5FYV A;  3OUI A;  1JBC A;  4PF5 A;  3MW2 A;  3ZN6 B;  4AHZ A;  5DUW A;  4Q0V A;  4DEQ A;  4AAP A;  3ZSL A;  5BUV A;  5CBL A;  4YW3 A;  1NQD A;  1POV 0;  2CYF A;  4COZ A;  4FFF A;  1MVQ A;  3NJV A;  4FXG B;  3K46 A;  2VW1 A;  2RG4 A;  5FZC A;  1MEC 3;  3RJR A;  2YMZ A;  1GP6 A;  4H2A A;  2P6C A;  5FY0 A;  4BJ0 A;  5FV3 A;  5KHI A;  3Q8B A;  3CZJ A;  4NAO A;  2JB8 A;  1KDK A;  1VBD 2;  4K1Y A;  1AYN 1;  1QU0 A;  1W9S A;  5JI7 A;  4CUC A;  4XQ4 A;  4HET A;  3ZVX A;  4UAP A;  2FDG A;  1BVV A;  1W99 A;  4LHK A;  3ZSK A;  3A4U A;  4AED B;  3Q8F A;  1JYV A;  1APN A;  2ES3 A;  3S57 A;  4YVS C;  4OI4 A;  2ET1 A;  3J26 N;  3PVO A;  2YDE A;  3AKP A;  2R07 2;  2HH9 A;  2VCA A;  1AXZ A;  1C8M 3;  2WO2 A;  4PLO A;  1PVX A;  4COU A;  2BWA A;  4KL1 A;  2GDF A;  3POB A;  4FPG A;  2Y6J A;  3ZM8 A;  2RS5 3;  4D8M A;  3H7Y A;  3MZH A;  2I45 A;  2ERF A;  3D4K A;  2XR4 A;  3CKH A;  1TMF 2;  5LBF A;  4OQ8 A;  2JG9 A;  1GKB A;  1TMF 1;  2VD7 A;  1UOF A;  1Q8P A;  1HB1 A;  1RHI 2;  2E32 A;  3ZDS A;  2BUK A;  3OUJ A;  1RHI 1;  3NV2 A;  1HDK A;  1NA1 B;  4PDW C;  4GWJ A;  3PJY A;  4N53 A;  1JH5 A;  4L92 A;  3ALQ A;  3RJ2 X;  1J3Q A;  1JZ8 A;  3RYK A;  4FPE A;  1GZT A;  1W6O B;  3POW A;  3S6P A;  3AMH A;  2ZHK A;  2PHU A;  4ZXE A;  2V4A A;  4FQ4 A;  2UYB A;  3K4D A;  5J1X A;  4ZON A;  3RI9 A;  2MEV 2;  1QY4 A;  5ABJ C;  3NW4 A;  1NY7 2;  1VJ2 A;  1QOO A;  3IBM A;  3BOD A;  3WF2 A;  1JZ3 A;  3WSO A;  1DGW A;  1RUN A;  2A73 B;  2ZX3 A;  1BCX A;  1TG7 A;  1N3O A;  3U14 A;  1YHF A;  1WUV A;  4R9D A;  3ON7 A;  3LQC A;  3NST A;  3VD4 A;  2W39 A;  1NE4 A;  1JYC A;  2ZX1 A;  1Z7S 1;  1OF3 A;  3H8U A;  2HWF 2;  4PI0 A;  3WR0 A;  1LOF C;  1A6C A;  3WP3 A;  5DUU A;  4MHR A;  3AB0 A;  4JRA A;  1LU2 A;  2PAM A;  3B5L B;  1SLT A;  1D0H A;  2YXS A;  3F95 A;  1RUC 2;  3OGS A;  4GZ9 A;  1QXJ A;  2VUD A;  5C5T A;  4AI3 A;  3VKO A;  3OD0 A;  2XJT A;  3PU8 A;  4LIT A;  1B09 A;  1CJP A;  4DXT A;  5L9B A;  3J7H A;  2FMY A;  2QE3 A;  4FPF A;  3WG4 A;  3IIA A;  3QD6 A;  2OZ6 A;  3UET A;  4UFH A;  1VRH 2;  4FP3 A;  1FT9 A;  3TNQ A;  3W58 A;  1WMX A;  4XIO A;  1VRH 1;  3ZMN A;  5CIR A;  3I3B A;  4G4F A;  3SMH A;  1HW5 A;  3CZU A;  5FY1 A;  2XDV A;  2QQV A;  2OKX A;  1JZ5 A;  2JDA A;  1Q8S A;  2CHH A;  1JTZ X;  4OYU A;  4OMC A;  1S55 A;  4KU8 A;  1BBT 2;  1V6M A;  3ETQ A;  5A3U A;  4YRD A;  4CA9 A;  3DPR C;  5F3E A;  1T2X A;  4K8R B;  3EBR A;  5KWR A;  5CKQ A;  3ZXJ A;  1QH6 A;  5K4L A;  1PK6 B;  1POV 1;  1W8N A;  3JD7 1;  4XUP A;  3BTX A;  2Y34 A;  1PVC 2;  4CCJ A;  3VV1 A;  3LSD A;  1PK6 A;  4NMI A;  3POE A;  5KHG A;  1V0A A;  5FZ1 A;  4Q4X 3;  3FHI B;  4MX3 A;  4R4X A;  4DRR A;  3JB4 C;  4M4P A;  2PA7 A;  3ZDV A;  1RC6 A;  2WA3 A;  3I97 A;  3PHM A;  3VDD A;  1OC1 A;  1W0O A;  2VBD A;  4LT5 A;  2R04 3;  2BQP A;  2AH2 A;  3KS7 A;  4MLO A;  3I2K A;  4ARX A;  4FPC A;  1QJY 2;  4IE6 A;  4JC1 A;  2EF6 A;  4N43 C;  4TWT A;  1QJY 1;  5JSO A;  2JE7 A;  1GOF A;  3N35 A;  4L9B A;  5C3R A;  1ZRR A;  2SBA A;  3WW1 A;  1H8V A;  5ACA 2;  4B1L A;  2Z42 A;  5GLU A;  2YPD A;  4PIZ A;  4IV3 B;  3NO8 A;  1LED A;  2RVA A;  3KGZ A;  4KH9 A;  2FDI A;  1E5R A;  3POI A;  4TXW A;  1J59 A;  1JOP A;  2YPJ A;  3HD8 B;  5J7M A;  1AZD A;  2ZGR A;  5FPL A;  4NRP A;  4BA6 A;  4OI1 A;  1D4V B;  2VG9 A;  4A7Y A;  1ZZB A;  1JZ7 A;  4L8Q A;  3TWI A;  3NJZ A;  1A34 A;  2VME A;  1OBN A;  1XRU A;  3I59 B;  1BVP 1;  4Q8L A;  4W6X A;  3DCQ A;  4Q1P A;  5E1R A;  4Q4Y 1;  5C8C A;  4M0N A;  5FYM A;  1W2O A;  3RZH A;  4GMP 1;  5FY4 A;  4LK6 A;  4AI2 A;  2DVD A;  1YYN A;  3TN9 2;  1SDW A;  4BQ1 A;  2ZML A;  3VKN A;  1FV3 A;  3NNG A;  2V4V A;  2WNV B;  4M01 A;  3EXU A;  2WQ4 A;  3DXT A;  3ELN A;  1HV0 A;  3MIF A;  5IHR A;  2KA3 A;  2RR1 3;  4LO5 B;  4BH9 A;  3T0D A;  5IUQ A;  1I3H A;  2XKO A;  4XUT A;  4FTE A;  4D3W A;  2G4I A;  2K46 A;  4ZZ8 A;  4S2G A;  5IK7 A;  4J1X A;  3BB6 A;  5A7P A;  4GB3 2;  2WT0 A;  4Y1V A;  1CD3 G;  1V9U 2;  3BOW A;  4YNI A;  3ZYI B;  4GB3 1;  1CAX A;  1U5X A;  3DYP A;  3V0B B;  3DUI A;  5KXE A;  2XJQ A;  1POV 3;  3BTY A;  1RIT A;  1E5H A;  1JW6 A;  3GDB A;  4YW1 A;  1G9C A;  3ZXK A;  1CAU B;  4E4S A;  1WME A;  3C3V A;  3M7A A;  4UF0 A;  3RYR A;  2Q30 A;  2QVS B;  5FZF A;  4NRQ A;  4RQP C;  2HWE 2;  3AZX A;  4LBQ D;  1ULC A;  3HBZ A;  5JVV A;  4MSV A;  5IVB A;  3PJQ A;  2MPF A;  3LA3 A;  4JTO A;  2VOW A;  5FZE A;  1QJU 3;  1AYM 3;  1N3Q A;  4IES A;  1Y9M A;  2BVV A;  3KSC A;  4RL7 A;  2VZP A;  5IW0 A;  1YXW A;  3HVD A;  2ZS6 B;  3L9J T;  1DGL A;  4I0B A;  4DFS A;  4DO0 A;  2ZX4 A;  4CXW A;  3GAL A;  1IS5 A;  3AKQ A;  3KQ4 B;  3NJX A;  4Q0P A;  4UOJ A;  5DZE A;  2WNE A;  3T0A A;  4A7K A;  3HOB A;  4CVU A;  1ND2 C;  2DUO A;  2NPI A;  4C8D A;  5A7Q A;  4Y1U A;  2E9Q A;  1OPM A;  2IZW A;  5EFU A;  5FKB A;  5H9P A;  2GP3 A;  5T5L A;  4TSV A;  3ZXF A;  3N7M A;  1UYX A;  1H8T A;  3WQ7 A;  1LOG A;  5JMO A;  1WW4 A;  3VB9 A;  2VO5 A;  2WNU C;  5LY2 A;  3I2O A;  1W8U A;  2XOM A;  4F8A A;  4ZU5 A;  2B9V A;  1MS0 A;  4LBK A;  2ZGN A;  2XUE A;  2Y0I A;  1QWR A;  2LW8 A;  5T55 A;  1Z0H A;  4OI0 A;  3MEP A;  3SH5 A;  5FZ9 A;  1XNK A;  1O3T A;  4IGP A;  2W95 A;  2W1S A;  4QPG A;  1VR3 A;  4CP2 A;  2BGP A;  4HT1 T;  1H4G A;  1HB4 A;  2QQL A;  3KVA A;  5DN2 A;  1OKO A;  2X05 A;  3LAG A;  2VL4 A;  4UFM A;  3VZM A;  5FMO S;  5A6Q A;  1VMH A;  2K9Z A;  2QKD A;  3ES4 A;  3K51 A;  3J8F 2;  4LBQ A;  4XBL A;  4OUM A;  4FOV A;  1AL2 1;  4UW4 A;  4XVH A;  3GJB A;  1SEF A;  4LUL A;  4CDU A;  4F7Z A;  1SFY A;  1GNH A;  3M1H A;  4PCR A;  1SPP B;  5FMO L;  2XQR A;  5FK7 A;  4KG8 A;  4K3U A;  1HQL A;  4KNC A;  1SPP A;  3TEY A;  5ISL A;  4P5H A;  1XU2 A;  1YNA A;  4XEZ A;  1XQN A;  5C9A A;  5JDB A;  3VBO A;  3WNN A;  1C5H A;  4NHM A;  1QJE A;  3H0O A;  3DKW A;  1RUD 3;  2D5H A;  5LCW L;  2AUY A;  2PN5 A;  1WLW A;  2UUR A;  2J1E A;  2JDH A;  2WZE A;  4M00 A;  2VZ1 A;  5BPX A;  1C28 A;  4JKL A;  5LA1 A;  3AYE A;  4ET7 A;  4ATE A;  1LES A;  4IER A;  1G86 A;  3LE0 A;  4XUO A;  5IAX A;  4EN7 B;  3ROU A;  2G19 A;  3ZYR A;  1UY0 A;  3LGR A;  4B7E A;  4Y22 A;  1O5L A;  4LPL A;  3L2Y A;  3USU B;  3U4X A;  4DQA A;  1A78 A;  4P9X A;  3I8T A;  4XXA A;  2ZZQ A;  4XCB A;  1PGW 2;  2BU9 A;  2HWD 3;  1UNB A;  2VNV A;  1W90 A;  3VL9 A;  4IEP A;  2UY8 A;  1AR7 3;  5F6K A;  3ZSM A;  3RQ0 A;  3RZJ A;  3RMY A;  3LA7 A;  2RM2 3;  3PUR A;  4NPM A;  4A41 A;  1DZR A;  2EA7 A;  4LE4 A;  1MR5 A;  1QH7 A;  1R1A 2;  3MV1 1;  1XYN A;  3H8R A;  1R1A 1;  4TYS A;  3UES A;  2JG9 C;  3CL1 A;  3ZKU A;  2XLF A;  3CJI B;  4MGI E;  5FYZ A;  4CDQ B;  1LGN A;  1W04 A;  1POQ A;  4Q4V 1;  1V6O A;  5T5P A;  2ADD A;  1LNS A;  3AXE A;  4CDQ A;  3RPQ A;  1BK0 A;  2CU5 A;  3FZ3 A;  3VBU B;  2YFU A;  2XVG A;  4YG3 A;  4BQW A;  1RUE 1;  3MYX A;  4N53 C;  3ZFF A;  1ONA A;  1PIV 1;  2C5D A;  3NNL A;  5A1L A;  2P2K A;  1O3R A;  2ZHN A;  4FPO B;  3C7G A;  1VMJ A;  1NCR B;  2J22 A;  4IE0 A;  3KV6 A;  5A6X A;  1X9P A;  3VHO A;  1JHJ A;  4CU9 A;  1IS4 A;  1GNY A;  5FXZ A;  4J1W A;  4Q26 A;  3WOG A;  1VP6 A;  2CTV A;  2ZX2 A;  3GZA A;  3DF0 A;  5I0U A;  3NL1 A;  5A1A A;  1RYY A;  4Q5O A;  4EZH A;  4WM8 B;  2PQS A;  1RUH 2;  3WDX A;  1W0N A;  5FQ0 A;  1RUH 1;  2VMD A;  2Q8O A;  2X8K A;  4WM8 A;  4GJY A;  1UF2 C;  3VZN A;  2BFU S;  2WO1 A;  3ITQ A;  1F5J A;  4YFZ A;  1W03 A;  1WLD A;  1VE0 A;  2X5I A;  5KHJ A;  1NUK A;  3MF9 A;  4IEZ A;  5D1I A;  5FZ6 A;  3POS A;  4P9W A;  3CNA A;  2JG8 B;  1MVE A;  4LO8 A;  1QOS A;  1HRI 2;  2RS3 2;  1QMJ A;  1SBF A;  5B4N A;  3RYP A;  2G1M A;  1PZ8 A;  1W9T A;  5FOJ B;  4E2S A;  5C5U A;  4KWL A;  5FZL A;  4AXO A;  5F37 A;  2DYC A;  3BIE A;  4Y5T A;  1VBC 3;  4LLF A;  1UY3 A;  2NQY A;  5DAB A;  3Q8E A;  5T5J A;  4BQ2 A;  4QX8 A;  2VM9 A;  2F4L A;  3U10 A;  3DKQ A;  3AJY A;  1ZA7 A;  3A21 A;  3TEW A;  1PGL 1;  3IPV B;  4RHV 3;  1H1I A;  1VBA 1;  1HX6 A;  5I93 A;  3GF6 A;  3INA A;  2ZCW A;  2ZMK A;  3VHR A;  4KWU A;  3IPV A;  2HYK A;  1QJX 1;  1UOJ A;  2D40 A;  3BIW E;  4Y3O A;  1CES A;  1NAE A;  4CPB D;  1RTV A;  2VW2 A;  1GWK A;  5A3T A;  1LHU A;  3GYD A;  2RDR A;  2D6O X;  2XG3 A;  5FZ8 A;  3G6J B;  2YBP A;  3KLS A;  4TZD A;  2Y6G A;  4AF9 A;  5HXV A;  3GHM A;  1QQP 2;  1I5P A;  1YQ2 A;  2G9Z A;  4UFK A;  1EUT A;  5EXO A;  1EV1 2;  4L11 A;  5A70 A;  1ZRD A;  4LJH A;  2C9A A;  4LUK A;  2Q1F A;  3VBF C;  2EIC A;  3ENR A;  1KJR A;  3ZYH A;  4FOY A;  5A32 B;  2VEC A;  2XML A;  1RMU 2;  1CGP A;  4CDW B;  4NR1 A;  3OTF A;  1C5I A;  1FV2 A;  1UU5 A;  1PK6 C;  2DBN A;  2VZS A;  1VLN A;  2VY0 A;  3ZYF A;  3POY A;  5DAW A;  2GU9 A;  2VVE A;  1WMF A;  5FP9 A;  1XNB A;  1UAI A;  5I0D A;  1YQ5 A;  4GAZ A;  4P08 A;  3B00 A;  4PT6 A;  4NAM A;  4Y20 B;  2P6H A;  1FMD 2;  3VDD C;  1R09 3;  1HRV 2;  3MFA A;  4QDQ A;  2WZR 3;  4Y20 A;  1AHS A;  3AXD A;  2P5B A;  2OA2 A;  2R1B A;  3BI3 A;  1F8V A;  4LUM A;  2HWC 2;  4PQQ A;  3UT0 A;  3Q8C A;  4Y1Z A;  3WD5 A;  5GKA C;  5C3Q A;  2GZW A;  2V73 A;  3FFZ A;  2RMU 3;  4LKD A;  1Q8O A;  4CPB A;  3VDB A;  1YCI A;  3O1T A;  2WFF 2;  4JCK A;  1AR8 2;  4Z2A A;  2AZ5 A;  3PME A;  3D8C A;  4KWK A;  3WG2 A;  2QCS B;  4RD7 A;  3ACL A;  3OBR A;  4B7K A;  3ZFE B;  3T1L A;  4BQY A;  1IPJ A;  5HCA A;  2B9U A;  3U37 A;  1SG3 A;  4D7Y A;  1CPM A;  4R8H A;  1GV9 A;  2ADE A;  1JZ4 A;  5IFT A;  4XAA A;  2QQO A;  3RDI A;  2ZGS A;  3BPS A;  3SLI A;  3R0R A;  4UBH A;  4Y5S A;  1XE0 A;  4QAW A;  5A7O A;  3IZO A;  2QZ2 A;  4XFA A;  4FOW A;  4DY5 A;  3KVB A;  2GME A;  5C8C C;  1OHF A;  3KT4 A;  2NMN A;  3KCY A;  3ME2 A;  4C0B A;  1ND3 B;  3FL7 A;  5JIU A;  4IQP A;  3N9M A;  3O12 A;  4MGY E;  4YW4 A;  1W8W A;  1RUI 3;  2DBI A;  1ND3 A;  1R08 2;  4IE5 A;  4QM8 A;  3ZPO A;  2JD9 A;  3VBR C;  4AOC A;  3PU3 A;  5CYY A;  3K3N A;  5CAZ A;  5I0R A;  2YU2 A;  1PHM A;  5FYY A;  4BK4 A;  3OGJ A;  3FLR A;  1X33 A;  1WLC A;  1GWL A;  2VUL A;  1DGR A;  2ZAC A;  3I3Q A;  4NVP A;  3ZXL A;  2W94 A;  4UYB A;  4XBQ A;  4AQT A;  5LA9 A;  3AP7 A;  1UZ0 A;  4DEV A;  4DPN A;  1YFX A;  1XU1 A;  4BQ3 A;  3WEZ A;  3MF6 A;  5CU1 A;  2XBO 2;  1WCQ A;  3POG A;  4NN0 A;  1AX0 A;  5F3C A;  4FFG A;  4DXR A;  1ZBA 3;  1MQT B;  3QH6 A;  3DGT A;  1KRI A;  1RJ8 A;  4UXA A;  2WS9 3;  3UK9 A;  1K42 A;  4JGZ B;  3GZU C;  5CVR A;  3ZYB A;  1KS5 A;  1UYY A;  4MUV A;  4AEJ A;  1BLZ A;  2JKX A;  4QDS A;  5HCH A;  2A6Y A;  5GLW A;  5JUV A;  2VMG A;  3PIJ A;  1IS3 A;  4GH4 A;  2OYZ A;  3G7D A;  4UFJ A;  1ENS A;  4XQW A;  1HXS 2;  2E7T A;  2QQW A;  1JI6 A;  4XIK A;  3EB7 A;  5LRS A;  4EN0 A;  3J7L A;  4HG6 B;  1N47 A;  1OUR A;  2BWC A;  1I6X A;  2RJK A;  3K48 A;  4AEM A;  4CP1 A;  4CCD A;  2JWP A;  1DIW A;  4BQX A;  1QIQ A;  1ALY A;  1W2A X;  5FP4 A;  5GLT A;  5D8A A;  1XE7 A;  3W9A A;  4CTE A;  1RUJ 3;  2FDJ A;  3S7I A;  1K5M B;  3BTA A;  1J84 A;  1MZ5 A;  3OBA A;  1H8T C;  4HVQ A;  1H2N A;  2Y60 A;  2HEW F;  1K5M A;  1IHM A;  1RXF A;  1IS6 A;  2VH9 A;  3GXU A;  2GC3 A;  3V0A A;  4Y26 A;  4YVW A;  1MEC 1;  4LA2 A;  4ATF A;  4H7M A;  2HWB 3;  5J3U A;  2C0Z A;  3EMR A;  2IXJ A;  4IXL A;  4AVV A;  4WM7 B;  4QPG C;  3E6B A;  4EE2 A;  3SEE A;  2HBT A;  5FXX A;  3MIE A;  3AL5 A;  4G3Y C;  4BME A;  5BNP A;  2VQT A;  4IV1 A;  2OVU A;  4M4R A;  4SLI A;  4WZF A;  1Y4W A;  3WIN E;  1VBB 2;  2ZAB A;  1F9K A;  1WGP A;  1FOD 2;  2X09 A;  3AKT A;  4W6Y A;  4CDU C;  2JIG A;  3D5O A;  3J7M A;  4BE3 A;  1TME 3;  4OUS A;  1DCS A;  1KXG A;  2DVF A;  3PDQ A;  1C8M 2;  4LBL A;  1BKZ A;  4KQ7 A;  1C8M 1;  2ZGU A;  4Q27 A;  4AFC A;  3E6C C;  1UPI A;  5HPO A;  3O0V A;  3JQX A;  5C9A C;  3VBO C;  3U75 A;  2QZ3 A;  1US3 A;  2BJS A;  2CY6 A;  2RS5 1;  3C7O A;  1BZW A;  1CIW A;  2BDR A;  3WNX A;  2WQ8 A;  2G9G A;  2RDN A;  3OPW A;  1A8D A;  1PM4 A;  1YJK A;  2QDN A;  2DCT A;  2XL9 A;  2NYY A;  2J1T A;  3GZE A;  4OHZ A;  5LWB A;  1ENX A;  4JGY A;  4XDQ A;  4IUG A;  5DUX A;  5FBZ A;  3KM5 A;  1HJG A;  1S0B A;  3M3O A;  1PMI A;  4FTS A;  4PIX A;  5CIS A;  1BEV 3;  3TBD A;  1B35 C;  4ZU4 A;  4AEK A;  2O1Q A;  4BXS V;  2VMI A;  4IEO A;  3P5B A;  4H55 A;  3LPF A;  3KT7 A;  1MS9 A;  1Q3E A;  2A3X A;  3ETP A;  3FHQ A;  3N9Q A;  4BXF A;  3IN9 A;  3ES1 A;  1ZBE 2;  1ASJ 1;  1D7P M;  1LEN A;  3ACI A;  2GH2 A;  5C70 A;  4QGM A;  3PUA A;  3GNE A;  3WNK A;  1FPN 3;  5JOW A;  3IM0 A;  2D5F A;  2GNT A;  3WXP A; 
#chains in the Genus database with same CATH homology
 3RZG A;  4NPL A;  2FDG A;  2FD8 A;  3I2O A;  4NIG A;  4MG2 A;  4CXX A;  3BIE A;  5DAB A;  3RZM A;  4QKF A;  4QKD A;  3BU0 A;  3O1S A;  4IE6 A;  3O1V A;  3BKZ A;  2FDK A;  3KHC A;  4NID A;  2FDI A;  3RZK A;  3T4V A;  4JHT A;  4O7X A;  4NRP A;  4O61 A;  2FDJ A;  3S5A A;  4NRM A;  3LFM A;  3BTZ A;  2FDF A;  4NRO A;  2FDH A;  4MGT A;  4NJ4 A;  4IE4 A;  4ZHN A;  3I3M A;  3RZH A;  4CXY A;  4ZS2 A;  4NII A;  2IUW A;  4IDZ A;  3I49 A;  3T3Y A;  3BI3 A;  3RZJ A;  4NPM A;  3H8R A;  3O1T A;  3RZL A;  3H8O A;  4RFR B;  3BTY A;  3H8X A;  4ZS3 A;  3O1R A;  4QKB A;  4OCT A;  4IE7 A;  4NRQ A;  3O1O A;  4QKN A;  5F8P A;  4IE0 A;  4NIH A;  3O1U A;  3KHB A;  3O1M A;  3O1P A;  4QHO A;  4IE5 A;  4CXW A;  3T4H B;  3I3Q A;  3BTX A;  3S57 A;  3BUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...