4RHV2

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 49
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rhv200
1C8M3 1NCQA 3J8F1 2RS53 2R061 1R1A1 1PO21 5K0UB 1OPOA 1RUJ1 5A32A 2HWC3 5BNNB 4GH4C 1AYM1 1RUC1 2HWF3 1QQP1 1ND3B 4N43B 1MEC2 2R042 2WZR1 4QPIC 1RMU2 1AR71 2RMU1 5AC93 1OHFA 2WFF1 1ZBA2 1NCRA 1NY72 4FSJA 1TMF1 1VBC1 4JGZC 1PO11 4Q4X1 5BNPA 5ABJA 4AEDB 1OOPB 1NCQB 1D4M1 2WS93 1EV11 5CFDA 1H8TC 1VBD3 2RS33 4RS5C 2R062 1R1A2 1M06G 1AL0G 1PGW1 4PDWC 3ZXAC 4QPGC 3ZFGA 1RUJ2 5C4WA 5BNNC 1RUG2 2BFUS 3VBRB 1RUC2 3S6PA 1V9U1 1AR91 2HWB3 1Z7S1 1PGL1 4Q4W2 3VBHC 5ACA1 4N43C 1ASJ3 1BMV1 1F2NA 2WZR2 1AUYA 1AR72 3VBOA 2PLV1 1F8VA 3JBG1 2WFF2 1VBE3 5C9AB 3DPRB 4RR3B 4WM8C 1RVF2 4Q4X2 1AYN1 5BNPB 4JGYB 4AEDC 1OOPC 1SMVA 1AL21 1FMD3 5CFDB 1C8M1 4YVSB 2HWD3 3JD73 1ZBE3 3TN93 4GH4A 3VBSB 1PGW2 2RS51 5A33B 1VB4A 4Q4V3 3ZFGB 4QPIA 3VBRC 1VBA3 1AR92 4IV1B 1Z7S2 2HWC1 1PGL2 4Q4Y2 1RUD3 1BMV2 3JB8A 2HWF1 1QJU2 1VRH3 2RM23 4GMP3 1RUI3 5D8AB 2PLV2 4CEYC 3M8LA 4JGZA 4GMP0 1VBB3 5AC91 1TME1 5C9AC 1DDLA 3DPRC 2GSYA 3IDEA 4RR3C 1H8TA 4RS5A 1HXS3 4JGYC 2RS13 4PDWA 1AL22 2RR13 1X36A 4QPGA 4YVSC 2X5IC 2WS91 5BNNA 3VBSC 1PIV3 4GH4B 1VBD1 2RS31 2RS52 1HRI2 3VBHA 4N43A 5LK7B 2ZZQA 4IV1C 2HWB1 1RUH2 2FZ1A 2BUKA 5D8AC 1ASJ1 1QJZA 2DF7A 4WM8A 1X33A 4JGZB 1R093 1AR83 1EAH2 4AEDA 1OOPA 1RUF2 5AC92 1TME2 1COV3 1H8TB 4RS5B 1VBE1 4FTBA 4PDWB 1HRV3 4SBVA 4QPGB 2XBO3 2WS92 1BBT3 3VBRA 1FMD1 1VBD2 2RS32 3JD71 3TN91 4NWWA 3VBHB 3ZFEB 4Y4YA 5FOJB 5L7OB 4Q4V1 1QJX3 2MEV3 1RHI3 5FMOS 1R082 4CEYA 1HX6A 1PVC3 1VBA1 5C9AA 1RUD1 3DPRA 1ASJ2 4RR3A 1FOD3 1VRH1 2RM21 1FPN2 4GMP1 1AR63 1RUI1 2ZAHA 4WM8B 4JGYA 2TBVA 3J8F2 1BEV3 1RUE3 1VBB1 4YVSA 2X5IA 3VBSA 1PO22 1HXS1 5A33A 5CFCC 2RS11 4N53B 1CJDA 2RR11 1FMD2 1AYM2 4IV1A 3JD72 3FBMA 3TN92 3ZFEC 3VBUB 1PIV1 1QQP2 5L7OC 1B35C 4NWVA 1K5MC 5D8AA 4Q4V2 2R073 2BBVA 2RMU2 4CEYB 1QJY3 5J98B 2R043 1RMU3 1MQTC 4FTSA 1VRH2 1TMF2 1VBC2 1PO12 1W39A 1NA1C 4RFT0 1D4M2 1ZBA3 1R091 1AR81 1EV12 4GB33 2X5IB 1IHMA 2QQPA 1COV1 3VBFB 1HXS2 2BPA2 4N53C 4FTEA 2BFUL 4YVWC 4CEWC 3CJIC 1HRV1 2RR12 3JB4C 1V9U2 4BCUA 4RHV3 2XBO1 3HAGA 1BBT1 3VBUC 5ACA2 4CDUB 2WWSA 4WM7C 1RUG3 1VB2A 4Z92B 2FZ2A 2IZWA 3JBG2 1QJX1 2MEV1 4Q4W3 1RHI1 1ND2B 1PVC1 4Y5Z0 1AYN2 1FOD1 2WFF3 1AR61 5CFCA 1AR82 1C8M2 5BNOC 1BEV1 2VQ0A 1RUE1 1RVF3 3VBFC 4CDWB 3ZFEA 5L7OA 1B35A 1HRV2 1K5MA 1BBT2 2HWC2 4CDUC 3NAPB 5J96B 2HWF2 5JZGB 1MQTA 4IV3B 3LOBA 2HWE3 1NA1A 1QJX2 2R071 4Q4Y3 1ND2C 4EJRA 3ZFFB 1QJU3 1QJY1 1RB8G 5C8CB 2R041 5DDJ3 1RMU1 1AR62 4N53A 4YVWA 4CEWA 5CFCB 3CJIA 1ZBA1 1RUE2 4GB31 4RQPC 2HWD1 4CDWC 1ZBE1 3VBUA 1AL23 4WM7A 4CDXB 1B35B 1GFF2 1K5MB 1WCDJ 1HRI3 3NAPC 2HWB2 4RHV1 5JZGC 4IV3C 2Y26A 1MQTB 2R072 1RUG1 1NA1B 3ZFFC 1RUH3 1QJY2 3VDDB 5GKAC 4Q4W1 5BNOA 5C8CC 1VAKA 1VBE2 4LLFA 3VBFA 1EAH3 1RUF3 1TME3 4YVWB 4CEWB 3CJIB 4CDQB 4GB32 2HWD2 1ZBE2 4CDUA 4CDXC 1RVF1 4WM7B 5FMOL 1POV3 1VBA2 4RHV2 1ND2A 1POV0 5K0UC 1NG0A 1MEC3 1RUD2 2XPJA 2RM22 1RUI2 1R083 5A32B 3VDDC 2HWE1 1VBB2 4Q4Y1 1ND3C 5BNOB 1QJU1 1FPN3 4RQPA 4CDWA 3J8F3 5DDJ1 2RS12 4CDQC 1NCRB 2R063 1R1A3 1PO23 3NAPA 1PIV2 1RUJ3 5JZGA 5ABJB 1NCQC 4IV3A 1AYM3 1RUC3 1C8NA 1QQP3 3ZFFA 2WZR3 1HRI1 5C8CA 1AR73 5C4WB 2RMU3 1R092 2HWE2 1RUH1 1TMF3 1VBC3 1COV2 1PO13 4Q4X3 4RQPB 3VBOB 1D4M3 1NOVA 5DDJ2 4CDXA 1EV13 1EAH1 1RUF1 1NCRC 2XBO2 5BNPC 5ABJC 5K0UA 1CD3G 5CFDC 2ZTNA 1V9U3 1AR93 1Z7S3 1POV1 2MEV2 1RHI2 5ACA3 2WLPA 3VDDA 1PVC2 3ZFGC 1ND3A 5C4WC 1MEC1 1A6CA 2PLV3 4QPIB 1FOD2 3JBG3 1E57A 1R081 2GH8A 4CDQA 1BEV2 1NY71 1AYN3 3VBOC 1HQNA 1FPN1
chains in the Genus database with same CATH superfamily
4MSVA 2VZ1A 3J8F1 1KRIA 4W8JA 1Q43A 3KMHA 2JB8A 3ZXGA 2MHFA 4K21A 4YM2A 2OZJA 4M0HA 2R061 2VMDA 3K2OA 4JZRA 1PO21 4PF1A 4XZPA 1PMHX 1OPOA 3J26N 4YM1A 4XFIA 3W5MA 5A32A 4LK6A 2HWC3 3WT3A 5BNNB 2VXRA 5FLIA 3SC7X 3RZJA 1RINA 1U5ZA 2OUHA 1W8FA 2A5ZA 2WN2A 2YU1A 4I2OA 5LBCA 2NN8A 1QQP1 2FQPA 4GWMA 4QPIC 2WZR1 1ULPA 1RMU2 2DWRA 2E9QA 2EIBA 2ZAAA 1B09A 3LDRA 2ID4A 3OG2A 1AR71 4V1PA 2H6CA 5DZGA 1S0CA 3J7MA 2Q8EA 5GLUA 1OVPA 3V65A 1OHFA 4HG6B 3V0BA 4OVEA 4M0NA 4FPFA 4HFSA 2PHLA 4XF3A 4YNIA 3T2PA 4FAGA 3B69A 1NY72 2E31A 3FFQA 5EYXA 3K4DA 4IE6A 5JVVA 3SITA 1DQ4A 3GBWA 1VBC1 4JGZC 1PO11 4Q4X1 4BK4A 2C5DA 5ABJA 4K7JA 1LULA 3DF0A 1OOPB 2R7EB 3BN6A 4QX1A 2UY8A 2ZEWA 4QKBA 4RYDA 4MGYE 4BH9A 4O9EA 4N7IA 1ZRDA 2FDJA 4QPGC 3VKMA 1RUG2 1OF3A 1V9U1 5A6YA 1TZOA 2P5BA 3VBHC 2IVIB 3MIHA 3VGIA 4N43C 5LEKA 1DQ1A 3N4MA 4QB2A 3KV4A 2XL7A 1F2NA 1LOFA 3W9AA 3ZDSA 4M4RA 1UKGA 3K46A 3JBG1 4U36A 3WDTA 3V0BB 5H9PA 2JENA 4OHZA 2ILMA 4X6QB 1GQPA 3VL9A 2J1TA 1KITA 4BQ4A 5C9AB 2G9ZA 4RN5A 3FZ3A 1IS5A 3ZPYA 3MIFA 4JTNA 4H7LA 5C5TA 1EUUA 5AVAA 4PT6A 2VY0A 2UU8A 2VMGA 4OHVA 1CESA 3E97A 1FMD3 3KCCA 3WDVA 1UMIA 3MEPA 2PMWB 4QX8A 3OUHA 5FPVA 5A6XA 1C28A 4P08A 1HN1A 1ZBE3 2JKXA 1LHUA 4JVAA 3TN93 4DEVA 1OMIA 2V73A 1T2XA 2VR4A 3FUOA 3INAA 5FYZA 5DMYA 3AVSA 3O1PA 1YWKA 2ZEXA 4QPIA 1Q8SA 2XDVA 2H0VA 4YRDA 4BQXA 4A4AA 4DNYA 4AGVA 3LEMA 4FXGB 2HJIA 3IWZA 2VMIA 4B7KA 4YM3A 2HWC1 1EP0A 4AG4A 1NLQA 1SLTA 3P3NA 1PGL2 5F6LB 1BMV2 1LGCA 1W8UA 3CKHA 1V6LA 5HCFA 1T6GC 2KR2A 3WNNA 2R32A 2CY6A 4QX0A 5EJ3A 2ZHKA 1GOHA 2OXBA 4JGZA 2C0ZA 4TTGA 4QXBA 3G6JB 1G7YA 3DCQA 2RVAA 2X53S 1LENA 3DPRC 2EXHA 4CRQA 2VVDA 4AI1A 5ANNA 3EMRA 4Y1ZA 5LB6A 2DCJA 3BYWA 2A1XA 3VD9A 2FCVA 4BQ3A 3WG1A 1X36A 4QPGA 1QOTA 3FUQA 3U4XA 2PYTA 4K8RB 1TQ5A 4YVSC 2AEZA 4E2GA 3VBSC 5J1XA 1H1MA 1WCUA 4UFJA 1X9TA 5F3GA 3MIEA 5K8SA 1WD3A 4XQWA 3VN4A 4O9GA 1UYXA 4IE4A 3VBHA 4AWDA 4N43A 1UCXA 1LHWA 4MVTA 3WNMA 1G6NA 4FFGA 4GD4A 4PLOA 3H3LA 4P9LA 1RJ8A 1W6NA 4LNVA 5FXXA 3T30A 3I2DA 2A71A 4P9WA 4E4SA 1DZQA 2BUKA 2A3XA 2WO2A 3LWCA 5FYBA 2W1SA 3AFGA 3VUOA 3ZN5A 1N1YA 4JGZB 4UBHA 3WQ1A 2WA4A 3UETA 1RUF2 3K3OA 4UOJA 5FY0A 5L36A 1STMA 5AC92 3BTYA 3HNBM 5G04L 4YGEA 3GYDA 5LA9A 2JDYA 4X8PA 1EY2A 4FTBA 1GNHA 4COWA 1UOJA 3BTZA 3WINE 2XLAA 4QPGB 2WS92 5T54A 5L9BA 1FMD1 4J1WA 3POEA 2ARAA 3EB7A 3TN91 4ZZ5A 2Y6JA 3VBHB 3ZFEB 4CP0A 2WL1A 4Y5TA 4BWOA 5FOJB 5L7OB 1JZ7A 4NHLA 4CUBA 1SPPB 1QJX3 1WA6X 2MEV3 2PELA 3B93A 5FMOS 2LRPA 3WHTA 5FZAA 1HX6A 3RZKA 4NJ4A 3ZPOA 3KHCA 2PN5A 3LFIA 3NKTA 4ZONA 3DPRA 1ASJ2 4WVMA 4XJZA 1JBCA 1GSLA 4CPBA 2DVFA 5A6QA 1AR63 2ZAHA 4XVHA 2YBPA 5JIUA 4EZ4A 3J8F2 4ISQA 4JHTA 1URXA 4I02A 4YFZA 3AKPA 4YVSA 4KI5M 3VBSA 5A6ZA 1PO22 1WLDA 1CN1A 4CUGA 1S2KA 3LSEA 1OUSA 3MIGA 1IKPA 3IDBB 1DHKB 1H2MA 1W8WA 1F35A 1W9YA 2E7QA 1NUKA 3C3VA 1CGPA 2DUQA 3MLJA 2W94A 3FBMA 2TNFA 4AF9A 1QQP2 2X05A 3BUCA 1B35C 4ATEA 4NWVA 4Q4V2 5KHJA 4COVA 3MPPG 4Y1XA 5FJHA 4LEJA 4HSJA 5KR7A 3LDBA 3BKZA 2GN3A 3WW2A 5JR2A 2QQLA 2GC1A 4Q0SA 2XHKA 3J7NA 2R043 3MV11 3U78A 3WG3A 1MQTC 4WVMB 1XRUA 1VRH2 1VBC2 1PO12 1UZVA 3ZN6A 3CMGA 4ISRA 1OC1A 4M3CE 2PHDA 2VCCA 4QX5A 2R30A 5IK5A 4D8MA 4XCAA 2XQXA 4AFCA 5L19A 5ISLA 3IZOA 2IXJA 1DQ5A 3ZSEA 2BPA2 4LQRA 4N53C 2VPVA 4AAXA 4AI2A 4TLFA 3M3QA 4ASLA 4R9BA 2RR12 1A8MA 3BALA 2PXJA 1V9U2 1VE0A 4Y26A 2P6HA 4R9CA 1H4HA 4BCUA 2E33A 4Q0UA 4S2FA 3RVHA 1O8PA 1O7FA 3R05A 2FDHA 1IG0A 2VD7A 2EICA 4QQLA 4W4ZA 5IFTA 1VRBA 1VB2A 2XVLA 4A6SA 2IZWA 4Z92B 3JBG2 2FZ2A 1QJX1 3SKJE 4BOWA 2MEV1 4E2QA 3WF3A 1UL9A 1JYTA 3O0XA 4XHXA 2V09A 4CU7A 4HSLA 3ZN6B 4XJWA 2YGLA 4QGLA 1ZM1A 5F3IA 4L9BA 5T3NA 1AR61 4QDQA 1XNCA 2ETEA 4FT8A 1FV2A 5AFEA 3HOBA 4CCEA 3VL8A 5BNOC 4OUMA 4LO7A 1UIKA 1CAUA 2J1SA 2JIGA 2V5DA 3SHRA 1LODA 1JODA 1RVF3 1O5UA 3G7DA 2XB6C 4W65A 4BQYA 1W03A 1B35A 1NT0A 5F5QA 3GZUC 2HWC2 1UU5A 4B1LA 1QDOA 3NAPB 2JKBA 5FO8B 1CPNA 2BZDA 1ULEA 1MQTA 4IV3B 4LBQB 1U12A 5EFUA 4QXCA 2W08A 3QLQA 4I01A 4K8FA 1XU2A 2B42B 3SISA 3H8UA 2NMNA 4Y20A 5GLVA 4Q4Y3 4D94A 1ND2C 4EE2A 4EJRA 1W0NA 2JG8C 4LMFA 3ZFFB 3TAYA 5FK8A 3ZVXA 2WBKA 4F8AA 1LU1A 2XVKA 5FP7A 2VW1A 3OPZA 1VJ2A 4CP9A 2R041 3MO4A 2WT1A 2AUYA 4N53A 4UWDA 3T4VA 2MNGA 4L97A 4RD7A 5IVVA 4BQ5A 3DYOA 1CAUB 5F37A 1JOJA 1GNYA 4RQPC 1PX3A 2HWD1 1IQDC 5DAWA 4PF5A 5K4LA 3E6CC 1AL23 1EPZA 1LCLA 1MS5A 4Q5OA 2HEWF 1B35B 3BTAA 1GFF2 2DTYA 5GLZA 2YFUA 5GZFA 3UGGA 2E32A 1G9AA 4XZUG 3OD4A 3OOXA 2JD4A 2VBPA 4UW5A 3VKFC 4LULA 1UY1A 5FZLA 5E16A 3O0VA 1S2BA 2Y26A 1MQTB 3LF7A 1MS0A 1YQCA 3H8OA 1XNBA 4LBNA 3E5XA 1UY2A 1O91A 4HPKA 4HT1T 4Y20B 2IXCA 5HI0A 2XWBB 1WLCA 2VE1A 1RUH3 3MW2A 5A3LA 1QJY2 2VVEA 5GKAC 1DQ6A 5BNOA 5C8CC 4Q0PA 3WP3A 2Y6LA 1W2UA 1UY3A 4IEVA 2JIJA 1EAH3 3MIBA 1QJFA 1NQJA 4AI9A 1TME3 2ZMKA 1YEWA 3SNMA 1O8SA 4NPMA 3T2QA 3B5LB 5LBFA 5C3OA 4GB32 1S1AA 3LZZA 3NV3A 4JDMA 1EUTA 1ZBE2 1AVBA 3PIJA 2PQQA 1RVF1 1SEFA 1GUIA 4FXKB 2BGCA 4FCAA 4Z1VA 3Q9OA 4ZY9A 2XH6A 4GAZA 3O5SA 1SG3A 2D6MA 3E1F1 1SFPA 4IEUA 4RHV2 3VKOA 5IVCA 3M3CA 1ND2A 5K0UC 1WCQA 2JG8A 3KF5A 3AYAA 1JZ5A 5APAA 1ST8A 5C6CA 1UOBA 1XYOA 4UFKA 4AQ2A 1VMFA 1QOOA 2HYXA 2JJ6A 4NMIA 5SV5A 1IS6A 2ZZJA 3V56A 4B7EA 1SDDB 4Z2AA 1NQDA 3KHBA 4Q4Y1 4Q27A 5BNOB 1RC6A 3HQRA 2DCYA 3AKTA 4BK5A 2JG9C 3B3QE 5DXDA 1XXNA 4RQPA 2W91A 5FZFA 5T5OA 2OPKA 4CXXA 5I91A 1MVQA 4Y3OA 1DCSA 2RHPA 2HBUA 1NCRB 2VO5A 5JR7B 5C33A 1XB9A 1GR3A 1V6IA 2VBBA 4UF0A 1OF4A 4LO6B 1ZX5A 3AX4A 2HLEA 1D7PM 5FP8A 3N9PA 1AXKA 4D7SA 1GANA 3U75A 4KBBA 4ES8A 1AYM3 5A70A 3HIFA 1C8NA 3SEEA 3ZYBA 3LAGA 2XUMA 3WG4A 1RL3A 5FPLA 2ES3A 2V72A 3BOPA 1H30A 2VUJA 5AVPA 2VZRA 2G4IA 5C8CA 2J1VA 2AEYA 3FLRA 3ZXLA 4UXAA 4QHOA 1I5ZA 3O1VA 1DP0A 2IXKA 4E4ZA 3AL6A 4MO3M 3NJZA 3O12A 3ASIA 2VJXA 5FPUA 3PL0A 1RUH1 1TMF3 1W2TA 3UNPA 4RQPB 3MBWA 3VBOB 3U11A 2QQWA 1C3HA 2BRTA 3PLQA 2D5HA 2D5FA 1EAH1 1OH3A 2BOJA 2XJVA 5DAQA 5T55A 3WDXA 2VTFA 1Y9GA 1YFXA 3CU7A 1QGLA 3OYWA 4KG0A 1PNFA 3WDUA 4CCOA 3I2IA 3TRSB 3HMYA 3AZWA 3DKWA 2Y38A 3EXUA 1JU3A 5K0UA 4Q1PA 4LBQD 3GJBA 5JOZA 1Z78A 2WLQA 1NZCA 4CU9A 4A3XA 3VZKA 2MEV2 3N9NA 3TWIA 1UYZA 1UU6A 2WLPA 4N9HA 3AC0A 4HKLA 3ZFGC 3PUQA 3WHUA 5C4WC 4KU7A 2JG9A 2VAUA 4NRMA 2FDKA 2D6NA 3OPTA 3ENRA 4XFGA 1DGWX 4NUBA 3D82A 3Q8CA 3R6SA 5HCHA 2GMMA 3WP4A 4QKFA 2EIEA 1UD1A 1CAWA 2Q4SA 4N8MA 3OB8A 4HETA 1NY71 1AYN3 5GJ6A 4IDZA 5DUUA 1UXXX 1HQNA 2ARCA 4NIAA 4CP1A 5EQUA 2B39A 3VKLA 2F6BA 2GH2A 1S0IA 3POJA 4COZA 1PM4A 3OTFA 3T0BA 5EIYB 5IVJA 2DVDA 2JX9A 1YCIA 4YARA 3KGLA 3OCPA 4FOVA 5GZDA 1YFYA 5K0UB 5CKQA 4DB5A 3KS7A 4HOOA 2BNOA 4CZSA 4XFCA 1MS9A 4IESA 1AYM1 3ES4A 3GGLA 4DRRA 5TSWA 1GZTA 3KZ4C 2VCMA 4P00B 5FZDA 3S7IA 2RE9A 2PAEA 3ACHA 3CQOA 2XMLA 4XC9A 2R042 4LE3A 1QH6A 2VTXA 4YG3A 4UI9L 4LBOA 1P8JA 4OULA 1G9DA 3THCA 2WO7A 5AC93 3PU3A 4A7YA 1W6QA 3RPQA 5J36A 1JHNA 1CAWB 1NX9A 2VQAA 2XKPA 3E6DA 1WMEA 3RMXA 4AEJA 5JDBA 4AVVA 3ZYGA 3K51A 2RDQA 5FZ1A 4BQ1A 2OYZA 1TMF1 2JDMA 5FO7B 1OT5A 4MADA 2VZTA 3D4KA 3RJRA 1WBLA 3HNMA 2WS93 4QX3A 2BYVE 3KT4A 4D6QA 2NM1A 4I3PA 1H2LA 1H8TC 1I9RA 2VG9A 3OUJA 2RV9A 4I09A 4RGGA 4PDWC 2QNKA 1JH5A 3USSA 3ZFGA 3A22A 3POGA 3IDCB 4C0HA 4ZS2A 4Y5SA 5C4WA 2D97A 1QH7A 3T08A 1XPWA 5BNNC 5FRAA 1SBFA 3PVEA 4MGKE 3S6PA 4E4DX 3FHAA 5FPBA 1GMMA 2J42A 2WT0A 4XXPA 4PBPA 1DU3D 5JIAA 1PGL1 4GKYA 4MG2A 1ASJ3 4CUAA 1BMV1 4LORA 3ZYFA 3USUB 3TOJA 4NPLA 3N7MA 1W05A 4MZUA 2D93A 3SCFA 2A70A 1F8VA 2Q8CA 2YC2A 2D6KA 1W6QB 3M4FA 1W9TA 2DBNA 3AJYA 3O14A 1JUHA 2WABA 4NR1A 1O5LA 4P9IA 4RR3B 2Y0OA 4QWNA 2LS6A 4DY5A 3S57A 2ZGKA 1RVF2 1IG3A 1AYN1 4L99A 3FE5A 4Q1RA 4AVCA 3Q8EA 1OOPC 3O0WA 3IT8A 1REDA 1W06A 5A1LA 4LOSA 4DRVA 3T2TA 1HJFA 1ZRFA 4H3WA 4DIQA 2W95A 5FZ9A 3RZLA 4OMCA 4ZXKA 2ET7A 1PGW2 2RDSA 2JDKA 4FQ4A 2V4AA 5A33B 3ZYIB 4Q4V3 3ZFGB 4AR2A 4OI4A 2DVAA 2P3KA 2XJTA 4QB6A 4HK8A 3T1LA 4COYA 1RUOA 1J3QA 4HXCA 1OLMA 1VBA3 4IV1B 2VOXA 1YXWA 1Z7S2 2W3JA 5M0TA 4MXWB 1D2SA 1IQAA 2E6VA 4Q4Y2 4EROA 4ZXEA 1XE8A 1VRH3 4GMP3 5D8AB 2WA3A 5FZIA 5IW0A 4PHZA 3W59A 4XF1A 4CEYC 3DUIA 5JXHA 4HKWA 3BTXA 1QWRA 2YC0A 1Y43B 3AKRA 2QDNA 4Q29A 3FC0A 4KH9A 5AC91 2H6BA 3MLKA 3MUY1 1W9SA 3AFKA 1VPHA 3IDEA 4GWJA 5C9AC 1DDLA 1H8TA 3PMSA 3I49A 1PM7A 3RMYA 3I59A 1F5FA 4QXHA 2RS13 1H8VA 4M4PA 5F5CA 3WNLA 3HBZA 4PDWA 1AL22 2GAUA 5FZBA 4EN9B 4EN7B 2RR13 1E5IA 3KF3A 3WDYA 2LROA 2VH9A 2AENA 3ALQA 4Q2FA 1JYXA 2WS91 3UK9A 5BNNA 5FMBA 1WMFA 1XC6A 5LEJA 1PIV3 4KGQA 2C24A 2O14A 2OX0A 4CU6A 2ZGRA 3KVBA 3O1UA 1S0JA 4C8DA 4XACA 2ZZQA 1OI6A 1HN0A 4V2WA 2OIIA 1GP5A 3D6EA 1NYWA 1AX0A 1PK6C 3NRUA 3ZMOA 2VW0A 2WJSA 3CBNA 3K3NA 3KD4A 4LE4A 4AVBA 4OI2A 4DZGA 4YZ2A 3OEBA 3N36A 1SLIA 1RUH2 4ARXA 2VZSA 2FZ1A 2XJPA 4NOTA 5EPAA 3RZHA 3LGRA 3O7OA 1ASJ1 1QJZA 3FHQA 3X29B 2O0OA 2DUOA 4XBNA 5FQ0B 4XF0A 2BGOA 1R093 1EAH2 1OOPA 2Z2SB 2QCSB 4R4ZA 3HQUA 1TME2 3HT2A 3K4ZA 1BK1A 2D3RA 4RGAA 3POBA 1H8TB 3T0AA 1YYNA 2WZEA 3PVNA 1ZZCA 3I59B 4MOAA 3AJZA 3SQOA 4TXWA 3HEIA 4PDWB 1UWWA 5JOXA 3AXEA 4SBVA 2PTMA 4KWJA 2XBO3 3N35A 4EWAA 2ZHLA 5DZFA 3ITQA 2ZHNA 3CNAA 1JZ6A 1YJKA 2JXAA 1N3QA 2QZ2A 3I2OA 1VBD2 2RS32 1HDKA 2DUPA 4NWWA 2J7MA 2QJVA 4LLOA 1WKYA 5FMCA 2FBEA 1LKNA 5A7OA 1R1ZA 4Q4V1 3CIHA 2BEOA 4DO0A 3VHPA 3ME2A 4CEYA 5F32A 3RG0A 4BHPA 2QQVA 4JQTA 1GWKA 1KDMA 1V6OA 1PVC3 4Y1UA 5F2SA 1VBA1 4XF4A 1MVEA 5C9AA 3IN9A 3QBQA 5EJ1B 1FOD3 2ZGLA 1VRH1 4GMP1 5FY1A 4KWKA 4L0PA 1ODMA 2TBVA 2TEPA 4UW6A 1ULFA 3OF1A 5I93A 1TNFA 2R1DA 1OA4A 1BEV3 4I0AA 5A7NA 4GXLA 1ZNPA 1AHSA 1HQLA 5DAVA 4ONUA 2P1BA 5FYVA 1ENXA 3T1MA 3WQ0A 4O61A 3WW4A 1I1EA 3AZYA 4H14A 3SCGA 1YC61 4QGNA 1QEXA 1NLSA 3NO8A 2B7YA 2G9GA 3PUHA 3HN3A 2RS11 2XJQA 4AHWA 2RR11 2D43A 3HJRA 3J4UH 5IAVA 1AYM2 5A3NA 1AJOA 1XSQA 1PK6A 4BDVB 1BVVA 3JD72 3ZFEC 5A3UA 1GBGA 1MZFA 1PIV1 3MIDA 3UJOA 5L7OC 2VTXJ 1RITA 3ACFA 3FLPA 3PUSA 2VOTA 4B1MA 2PHTA 3I2JA 4E8CA 2ORXA 4AQ6A 4D7TA 4CEYB 1QJY3 1KS5A 4XHBA 1H9WA 2Y33A 2AREA 4YW4A 1LOCA 3T4HB 3ETQA 1TMF2 3ZXEA 4MX3A 1NA1C 3SEPA 4RFT0 2NPIA 2WNVC 2X09A 5EWSA 1LECA 2YXSA 1R091 5DUVA 4CCCA 4GB33 1O3QA 3WQ7A 1WMXA 2V4VA 2QQPA 4INDA 5FZ7A 1HXS2 1UX7A 3HR9A 2J1EA 4YVWC 4CEWC 5KXDA 4Z82A 3BPZA 4TN7A 5FPZA 2Y6FA 5CZKA 3LE0A 3NV1A 5FP3A 5FPXA 4RHV3 2XBO1 3HAGA 1PK6B 2WAAA 3KVAA 3RZMA 3UGHA 2ZHMA 4CDUB 2NZ9A 3ZYPA 4MGIE 4WZFA 1AJKA 2DCTA 4XJUA 1UOGA 2JDHA 4XTPA 1DIWA 4HLTA 1W6PA 2NYYA 1LHOA 3DYMA 3ZSLA 4BQWA 5FWJA 1TE1B 1OXCA 1PVC1 4HONA 1W8TA 3P5BA 3H8RA 2GP5A 3KV6A 1AYN2 3I54A 4FPEA 1FOD1 5A3WA 4DY3A 4YGBA 2WFF3 5JXJA 1D4VB 4NIGA 1AR82 2FHRA 5FPAA 1YQ6A 2WWJA 2GN7A 2LM3A 1BEV1 2AGSA 2VW2A 2YROA 3NVCA 4LOTA 2A3WA 1CJPA 2XR4A 2YGMA 1EYBA 4W6WA 5FY9A 4CDWB 1A3KA 4M3CB 3ZFEA 1MS3A 1KFUL 1MS8A 2PFWA 2Q8OA 3ZN4A 5KHKA 5L7OA 1HRV2 1QJEA 1SPPA 2GALA 3BB6A 1ULCA 1BBT2 2FD8A 1WCKA 2WFPA 1JYIA 3JXSA 3F95A 5J96B 5JWPA 1A34A 2Y6KA 1LJ7A 2SBAA 2ZS6B 5JZGB 1XE0A 1W3XA 3AYDA 4FP3A 4XDQA 2Z69A 1XYPA 5K7PA 2RJ2A 1PZ7A 5EJZB 3PUAA 1NA1A 3SH4A 2PA7A 2WNVA 2W9XA 1W6PB 5I0TA 1ENRA 5C8WA 1QJU3 1QJY1 1YUDA 1WD4A 1ZZ6A 2WINB 1RB8G 3LQCA 5IAXA 5CU1A 5IVFA 4KWLA 2JE8A 2PHWA 2ZCWA 3H1MA 4JRLA 5HPOA 5JMCA 1IGOA 4ZU7A 2ZX4A 4YVWA 4CEWA 2HKXA 5HXVA 4GALA 2ET1A 3O1MA 3A4UA 3VZMA 4UFLA 4GB31 4QAWA 4IGOA 4IE0A 1ZBE1 4A2UA 2QKDA 4LHNA 1Y7BA 1OLRA 5KXCA 4GIQA 1WW4A 4FOWA 4CDXB 3R4DB 1Q8OA 4GA9A 4XUNA 3NV2A 1GWMA 1O3RA 4NN0A 4CXYA 1QXJA 3NAPC 5FXZA 3P6BA 4URAA 1POQA 4RHV1 3GHMA 5T50A 4IV3C 3I2HA 4NIDA 4ZU4A 4DMIA 2BBAA 3V0AB 3ZKUA 2QDRA 1LB2A 2OQ7A 1NA1B 3C2UA 2GMEA 2WNVB 3ZFFC 4XUQA 3ZSJA 3VDDB 5FY5A 3WNPA 1VAKA 2ZGMA 4LLFA 1N47A 3O1TA 1V6JA 4IEQA 3ZYHA 2VC9A 3D3AA 5FDBA 2MPFA 2B9VA 2WO3A 3MUZ1 2VNOA 4XUPA 4YVWB 3WNXA 1NXD1 1DLLA 4CEWB 5KHGA 1YIFA 5J09A 4OHYA 3GHNA 4B8EA 1QU0A 3OGRA 5CB7A 3RWKX 3VHNA 1SQ4A 2GDFA 2VQUA 2ZGNA 3QH7A 1WW6A 4AVTA 4ZPIA 4AVAA 2JB4A 3WF2A 4A7ZA 2WRAA 1FNZA 5FMOL 3I97A 2JDAA 1POV3 5FBZA 5FAXA 3FMGA 2ZGOA 4MGZE 4BU2A 1Q8VA 3KLSA 3I3QA 4NE9A 4COUA 1VBA2 4CCMA 3ZYJB 4K20A 2J1RA 3I2GA 3GCWA 1SLCA 4AOCA 1K3IA 1SCSA 5D1IA 2BQPA 3E5UA 5FUIA 3PUIA 1VR3A 2FCTA 2LUWA 1W6MB 4IEYA 2OS2A 1NKGA 1REFA 1ND3C 4YWAA 5JAXA 1QJU1 1H9PA 2DDUA 3JQWA 2UYAA 1HV0A 2RS12 1X8MA 4LUMA 5CKMA 2XL9A 5A7PA 4FFHA 1OLQA 1HB1A 3E6BA 1U5XA 1HB3A 2VM9A 4MYEA 3ZKYA 2UWCA 3NAPA 1PIV2 2WNUC 4L8QA 4AI0A 2C26A 2IVJA 4ATFA 4IV3A 4LBQA 1L3JA 1OD3A 4YZ1A 1Y4WA 2OKXA 1PX4A 1YIPA 4HBNA 2ZKNA 2E26A 4QX2A 3ZFFA 4XFAA 4BXFA 1AXYA 1OD5A 1QKQA 3ST7A 2GNMA 2RMU3 3LCPA 2DU0A 3J7LA 3NNFA 1QXRA 1JZ4A 1CQ9A 1R092 5FXWA 1XNDA 5JI9A 1O4ZA 3AMQA 1UF2C 3C7GA 1BYHA 4TLGA 3RS6A 4MLOA 3ILFA 2NLRA 4YW3A 4PIYA 1D4M3 1CIYA 1NOVA 5LRRA 3TYJA 3BODA 1JXNA 1XBFA 1EV13 4ZU5A 1NCRC 2XBO2 5B2GB 3AZXA 2EAKA 5F7UA 1Q5OA 3D0JA 2VGDA 3LDKA 4W50A 3LA7A 5FBJA 4OI1A 2P17A 4BPZA 5A7SA 1W2NA 1ULGA 1WA4A 1I6XA 5CFDC 4PI2A 2FCUA 1QDCA 4H7MA 1Z7S3 1POV1 3ZLIA 3AMPA 2PAKA 3HPNA 3FX3A 2XJUA 3PJQA 1LGNA 3ATGA 3RI9A 1K45A 3O1RA 1PVC2 2P3YA 3SH3A 4YZ4A 2YV8A 4XDPA 1ND3A 3F2ZA 4XFHA 1J58A 2DFBA 4JCKA 2Q8DA 1FOD2 5A3MA 1WWYA 4MUVA 2EXIA 1LR5A 1E57A 4QKDA 2VVFA 5T5PA 5IHRA 4AI8A 3PVOA 1BEV2 1OH4A 3PHMA 2VMEA 1BCXA 1UY0A 5IATA 3VBOC 3LD8A 1RXGA 3AM2A 3MPBA 3AP7A 3NJVA 1K12A 2WNUA 3ZM8A 3RI8A 1DFQA 5FXVA 2YUEA 4FFFA 4UFIA 5F3CA 4QPWA 5JPMB 1W8HA 3KM5A 4QGMA 3R0RA 2D3SA 3GF6A 5E1RA 5I8SA 3TEZA 2W47A 3DN7A 5C3RA 4OUEA 4YGDA 3U37A 2AR6A 1ZA7A 4FFIA 4GH4C 1ENQA 3RGBA 2D6PA 4MGQA 4JKKA 1ND3B 1MEC2 4B3NA 4A42A 2Z5WA 4NROA 3H8XA 3NSTA 2CU5A 2WWUA 1XJAA 5F5IA 2RMU1 2ZGPA 2N7GA 3WW1A 4QU2A 2IFWA 4L92A 3WVJA 1NCRA 4P9XA 5CKNA 5F8PA 5JOWA 1YO8A 1DYOA 1FATA 2QQNA 1UPIA 3TB0A 3ETPA 4FSJA 1CX4A 5CISA 2WNUB 3M7AA 3AL5A 3ZSKA 2HEVF 4AEDB 1D4M1 3CDZB 3DXTA 4K6BA 1EV11 3I7DA 1DBNA 5CFDA 4ARYA 1VBD3 2RS33 4RS5C 1CVNA 3FHIB 1R1A2 2WN3A 4LBKA 4META 5FZ8A 5BXXA 1BVP1 1AL0G 1PGW1 3WF1A 4AFDA 5CAZA 3ZXAC 2ATFA 3UESA 5J7MA 1LHNA 2OW4A 2XG3A 1RUJ2 4Q8KA 3K48A 4NRPA 2GU9A 5JSPA 3RZGA 2BWCA 2BFUS 4JX0A 2BGPA 1RUC2 4FVVA 4XAAA 4YYOA 4JQRA 3VBRB 3RYKA 1Z7S1 4CXWA 1L7RA 4XUTA 5FZKA 1SZBA 1S0DA 2AACA 1IPKA 2K0GA 1DQ0A 3MFCA 3W5NA 2P3JA 2QBXA 1MS4A 2K9ZA 4MGSA 3VBOA 1H6YA 3M1HA 3OUIA 5H9QA 1YI7A 1M4WA 2VBDA 4XILA 1JZ2A 2VULA 2WFF2 1QY4A 2YYOA 4J6GA 2WNOA 3THTA 1G9CA 1G86A 5B4XA 1PHMA 2VZQA 4WM8C 1Q8PA 4AAPA 2ZEYA 1AZDA 4XCBA 4AFBA 4JGYB 1SBDA 1AL21 4C0BA 5GZGA 3ZDVA 1ODNA 2IXIA 5CFDB 3N9QA 1RIRA 1WW7A 5L73A 3JD73 2DV9A 4WVZA 5FZ0A 1BJQA 4GH4A 2CL2A 3C7HA 1U5IA 3OSDA 2CTVA 4IEXA 1VB4A 3MW3A 2CDOA 4FPGA 2VZPA 4QKNA 1UZYA 3VZJA 2XKOA 3L2YA 2DTWA 1AR92 4B29A 3H9AA 4KGGA 5A1AA 4OFGA 1H0BA 1RUD3 1W6OB 5DZEA 2XQRA 3UKTA 1QJU2 2RM23 4GZ9A 3BPSA 1RUI3 2FDFA 3WNOA 1ULDA 2ZA9A 4WZCA 2PLV2 3LSDA 4QHBA 3M8LA 2D3PA 2ZKLA 2W52A 4GMP0 1VBB3 3W20A 3N9MA 5HV0A 1TME1 2NQYA 2GSYA 4RR3C 2RJKA 5E89A 1XNKA 2EIGA 4QDRA 4RS5A 3WP6A 1HXS3 3B94A 3KV9A 3TEWA 5C7GA 4M00A 1OQ1A 3IPVB 4C90A 2WQ8A 2BVVA 4NAMA 4AHYA 1E5SA 4FPLA 4LXLA 2DURA 5FZCA 1UO9A 2B5HA 3I2KA 4I3GA 1CPMA 4D0QA 5A3TA 3M70A 4YW5A 4GH4B 5JXGA 4QM8A 1VBD1 1GU3A 2RS52 2RS31 3A23A 1C1LA 2QQUA 3GZTB 5FIXA 1FX5A 3CHXA 3UGFA 1S0FA 2PAMA 1HJGA 3ILRA 4P14A 5LK7B 4WVWA 4DEQA 3M3IA 2D7FA 4IV1C 2EALA 2KA3A 2P37A 1DGRA 3IAQA 4R8HA 5CNAA 2W68A 5J37A 3OBAA 3RRDA 2W0XA 1S0EA 3IMMA 3PMEA 5D8AC 2Z79A 3VLBB 1W8ZA 2YHJA 4WM8A 2E7TA 3VD7A 4D6RA 4A7KA 1AR83 2VMHA 4Q8LA 4XOGA 4A41A 5IYYA 2X29A 4WVVA 5FY8A 3URFA 4AEKA 1KDKA 1TG7A 4LBMA 4HN1A 1COV3 3HT1A 3N9LA 4Y22A 5D2AA 5GALA 4DINB 2W1WA 4RS5B 5FYYA 2VU9A 4OI0A 5LA2A 1HRV3 1V6NA 3OBZA 3B9IA 4N90A 4W6XA 3FLTA 2UURA 4XE9A 5GZEA 3TEYA 1U0AA 3C7EA 4MHRA 3SKVA 4F7ZA 1BBT3 1DGLA 1HLCA 3FN9A 3V64A 2VNRA 4OHWA 4ITCA 2GNTA 3KWVA 3JD71 4PCRA 4B4QA 1WBFA 2BU9A 2O1QA 2Y0IA 5A7WA 3VHOA 4GJYA 2ZACA 3USUA 1OKOA 2ZXQA 1RHI3 5JXIA 2CDPA 5FYCA 2D6LX 1NZIA 5FZ3A 1MS1A 4BA6A 4B4RA 4YZ5A 5CG8A 4UBGA 4GKXA 1RUD1 3KT1A 4RR3A 1L7QA 1YJLA 1YQ8A 3LEGA 3IDAA 5FZEA 2RM21 4WM8B 1RUI1 4TZDA 1BZWA 2R49A 2CGPA 2ADEA 4XPVA 2EIDA 4V2VA 5AFBA 5CG9A 1W9WA 1VBB1 4IW3A 3WR0A 4Y22B 3MFAA 2I07B 1YQ2A 2O8QA 4P5YA 3K77A 3JU9A 2AH2A 2YPDA 1HXS1 5A33A 3CO2A 5LASA 4BMBA 3VKNA 1W8OA 5IVBA 1CJDA 1HIXA 1J3RA 1OA3A 1LRHA 4Q26A 3WNKA 4IV1A 4OZXA 4GJZA 5EYYA 3ZMNA 1UZZA 2J1AA 4MXWA 4EYUA 5FR3A 2ZGUA 3ES1A 4FOQA 4R52A 5DUWA 3VBUB 4DPNA 5BY5A 4DUXA 1C4RA 3EHKA 4NO4A 5A7WB 4CU8A 3AYCA 2CV6A 4IE7A 3U07A 5D8AA 2BW8A 1FYUA 1YLLA 2RMU2 2BBVA 2P2KA 1BQPA 1YHFA 3C8XA 3I8TA 4HN0A 1OPMA 4D7YA 4YG0A 1CAXB 4BQ2A 4P9JA 4IXLA 4UAPA 4WBBA 2A6XA 3POIA 1FXZA 4FP2A 1S0BA 1W39A 2VZ3A 1OBNA 4XMAA 3WF0A 1ZRCA 3ZXJA 1D4M2 3ZXKA 3MI8A 1JOBA 1ZBA3 1AR81 1EV12 4R9DA 4AI3A 2ZEZA 5C3PA 1E5HA 5T5LA 3A21A 3NNJA 4L11A 2Z42A 1COV1 3NNGA 1H1IA 5CYYA 3VBFB 4AL9A 4HANA 5EZWA 2WDBA 5FK7A 4PLNA 4S2HA 2IXLA 1HRV1 5KWRA 1ZREA 1YRZA 2FMYA 3JB4C 5DG2A 4AHZA 1BHGA 1BBT1 4K40A 4YW6A 4WM7C 5FYSA 1A8DA 3NKGA 4BJ0A 1LGBA 1JOPA 5FQ0A 3ZOIA 1N1TA 4E8DA 1D0GA 2WKKA 2WC2A 5FYUA 3UT0A 1W04A 4CUCA 4Q4W3 1RHI1 3T09A 1KJRA 4BIOA 4PJYA 3KGZA 1ZYBA 4QT6A 5FOBB 3IAPA 4K9SA 1US2A 1SCRA 4DXTA 5BYNA 2GC3A 2WIIB 2ZMNA 4Y5Z0 5H9SA 4EV0A 2ZABA 4HKOA 5FZ4A 1MR5A 4XFFA 2YY1A 3WLUA 3LPFA 2CGNA 2LTNA 4LIVA 4JRAA 4QXKA 3VD3A 2VQTA 1SFNA 5CADA 4XETA 3VD4A 2AYHA 3MHZA 1ULOA 2DCKA 4P9GA 1J1LA 3B00A 2Q1FA 1X9PA 4CDUC 3H1YA 3U4SA 1UIJA 2DCZA 5LATA 3ZXFA 5DAXA 3NJYA 5F2WA 3WQBA 3A0KA 4BB3A 2R1BA 4XEZA 1W3VA 2WAOA 3BOWA 1SLBA 3ACGA 1X82A 4BE3A 5FY7A 5BUVA 3LOBA 1YFWA 4OQ8A 4U2AA 5DUXA 1UYPA 4EWEA 2EXKA 2CWMA 3CLPA 1N3OA 2VCAA 1LU2A 2ARXA 2JDPA 2OUJA 4KNCA 3WD5A 2EA7A 1C1FA 2VXJA 2RG4A 5I0SA 4UYBA 4UFHA 1UN1A 1VIWB 1KGYA 1ALYA 1H1AA 1ZBA1 3KB5A 3UKNA 2CNAA 1RUE2 3W21A 1EPWA 1VMJA 5FKBA 4CDWC 2VZOA 2F4PA 3D5OA 2W92A 4HL0A 4WM7A 4AHXA 2B9UA 4QHZA 2EAAA 5EHDA 4CCLA 5JUVA 3I3DA 1JN2P 3BU0A 5FZHA 2QQIA 4BISA 2FDGA 3VDAA 3RSJA 1H2KA 1Y9QA 5C5UA 1HRI3 1X7NA 5FYMA 2XXZA 5J48A 5E8AA 5JZGC 2C6SA 2Y34A 1QXPA 1SFYA 3BIWE 3IKWA 5I8YA 1F31A 3CF6E 2ZGQA 5EV7A 5F1RA 4XAEA 2R072 5BV6A 1JMUB 1QMJA 2DBIA 2VUDA 3H3UA 3PJYA 2R6QA 4KWUA 4Q4W1 4AFAA 2GP3A 4AVSA 3S5QA 4KMQA 4LBJA 4BZ4A 5FFOC 5DG1A 2X8KA 4JC1A 1JZ8A 2BJSA 3VD5A 4CDQB 4IEOA 3KQ4B 5GLWA 3O1SA 1VAMA 1TNRA 3R4UA 2VMCA 4OZOA 4CDUA 1Z0HA 2GMPA 4CDXC 1JUIA 2ZPXA 3AP5A 3OEAA 4WM7B 3SH5A 4WV8A 1S55A 2A6VA 2JICA 4GWNA 4O65A 4E27A 4YG6A 4I30A 5FYIA 1POV0 1NG0A 1MEC3 1QOSA 3MGUA 1RUD2 2RDRA 2XPJA 1OA2A 1JU4A 2RM22 4IETA 1RUI2 1R083 3Q8AA 5A32B 4D3WA 3GM8A 3TBDA 3VDDC 3J9SA 1KQRA 1VBB2 1DG6A 1ZVFA 2BNNA 3ZR5A 1FPN3 4TSVA 5LK5A 4DXSA 1GV9A 3IBMA 4M3CA 4CDWA 5IJRA 4FPKA 4LO4B 1K5JA 5D21A 5LY2A 2QQKA 3CL1A 4JKMA 3OGJA 1GOGA 5C71A 4LKFA 4OYUA 3QCWA 1W90A 1R1A3 4QMAA 1J83A 2A6ZA 1GLHA 3N9OA 3AP4A 3AP6A 3ECQA 1ZZ7A 2CAUA 4EWDA 1VP6A 1LEDA 1RUJ3 5H9RA 5ABJB 3BCWA 1NCQC 5JZGA 2JE9A 1XOYA 2QVSB 2PQSA 2DYCA 1DYPA 4CCJA 1HB4A 2IFRA 1RUC3 3RDIA 3TNPB 1GP6A 3GDBA 4LITA 4S2GA 5FREA 2ZGTA 3MW4A 5K9YA 1OLME 2JWPA 3CJXA 3RQ0A 3WSOA 1HRI1 2DVGA 3WY6A 5KXEA 4DOUA 2GC0A 1SHWB 3Q8FA 4MH0E 1HW5A 1GP4A 3B7MA 2Z4FA 3TNQA 4CCKA 1I3HA 5F3EA 1DYKA 5FTTC 1BXHA 1LOBA 1QNWA 1ZRIA 1PMIA 2GNBA 2HWE2 3GXUA 4I0WB 4UW3A 4Y1VA 5IK7A 1DGWA 5IFPA 3BU7A 3CZJA 3IIIA 5GLTA 4AQSA 2V5YA 1COV2 1YNAA 3AMHA 4HMZA 3GJAA 5DDJ2 1MZ5A 2YBKA 4CDXA 2BTVC 1T6BX 5BNQA 3VHRA 3VB9A 4FPOB 1NXMA 1L7LA 2JDNA 1APNA 2KXLA 1UNBA 3UKVA 3LKJA 3ZYRA 5BNPC 3BIEA 1GWLA 3EBRA 1W2AX 2W1UA 1F9KA 4MHUA 2Q1ZB 2DVBA 1OFSA 2WSUA 1HKDA 1PVXA 2OA2A 1AR93 2XGXA 2ZTNA 4Z07A 5A80A 3SXWA 3WCSA 2UY9A 4AK3A 1RHI2 5ACA3 1OVSA 4JDOA 5DPNA 3QOPA 1LNSA 2A3YA 3VDDA 1WLWA 4TYSA 1MEC1 3MYXA 1A6CA 2PLV3 4QPIB 3OGGA 4FPHA 1UMZA 4NHXA 3THDA 3M3OA 3RYRA 4LO8A 2GC2A 1R081 5LY1A 5JI7A 3NJXA 3LB9A 3ZXDA 1H2NA 3OBRA 4IQPA 3MF6A 4P02B 4XMIA 3K75B 2A7AA 5FUNA 1FPN1 2A6WA 5FP9A 1C8M3 2VNGA 1NCQA 4FO9A 1XNTA 3AZVA 3WP5A 3KCXA 3WEZA 5JSOA 4FBFA 1VAVA 2RS53 1R1A1 4E4HA 1F4AA 3RZZA 2BVBA 1JTZX 1RUJ1 1W0PA 2EF6A 1ZZBA 1KEXA 1W99A 2I74A 2HBTA 4HK9A 1RUC1 1W6MA 1QIQA 3QACA 1W8NA 2VUAA 3QH6A 2HWF3 3DXUA 4AFMA 2XUEA 4CCNA 2ARBA 4FPCA 3C7FA 3PDQA 4N43B 3GCXA 4NHKA 1ONAA 1W0OA 2BERA 1IKQA 2JDUA 3D0SA 1DLCA 2FMDA 4XXAA 2P6CA 1W6NB 2WFF1 3KT7A 1ZBA2 2YDEA 3MDPA 4H2AA 4OMDA 3AVRA 5IT6A 2WZ8A 1CZSA 1PNGA 2E53A 4LR4A 5F39A 4C1WA 5BNPA 2VUCA 4N9IA 4BXSV 1JZ3A 3ABZA 4LUKA 3LA2A 1NCQB 2ZBJA 3ZIWA 2QTWB 2YU2A 3LPGA 1V6KA 4LJHA 4PQ9A 3NV4A 4XYXA 3HBKA 4PBOA 2E7AA 2R062 3HWJA 3VV1A 1M06G 4IEZA 4EN0A 1YI9A 1UW8A 3MZHA 2WR9A 1XNAA 1MZEA 2C1FA 4XJAA 5LBEA 5A3PA 5C3QA 1BK0A 1X50A 4AGRA 3KCYA 5EXOA 5B4NA 3RYPA 4ZHNA 4Y24A 5FV3A 3I3EA 1AR91 2H0BA 2HWB3 4PLMA 3UV9A 2E51A 4Q4W2 5ACA1 1AX2A 3ZSMA 1NE4A 1ZZ9A 3P3PA 4XABA 4XIKA 2WZR2 1G8WA 4ASKA 1AUYA 1Y9MA 2YB7A 4Y1YA 5FYHA 1AR72 4JKLA 2BWAA 1MZ6A 5DN2A 1JYNA 2PLV1 4C91A 4EZHA 1G9BA 4ES9A 1UXZA 1FAYA 1OQEA 4UFMA 4LA2A 4XBLA 1RGSA 4IGQA 2GNDA 1VBE3 3IMNA 3B01A 3LOIA 3DPRB 5FZ6A 5IK4A 4YLZA 2OT7A 3ELNA 3IIAA 4Q4X2 5BNPB 2Q30A 4AEDC 2BDRA 1SMVA 3KV5A 3FL7A 2DFCA 3R4SA 4G9SB 5FYTA 1NAEA 1ENSA 1Q8QA 1C8M1 3Q8BA 4YVSB 3KSCA 2HWD3 1C5HA 4QPYA 3VBSB 1VALA 2R0FA 2RS51 3DKQA 3I3BA 1NE6A 4ASMB 1WGPA 1CZTA 4LHSA 5G05L 1XU1A 3VBRC 3TEXA 4N7UA 5F9TA 4OHXA 4Z8BA 4URTA 3ACIA 4X8NA 3M2MA 2WZPP 1ACCA 2VZVA 3JB8A 2HWF1 2QUOA 2X10A 1F15A 4LKEA 4K1ZA 3WCRA 2FDIA 4DS0A 2K2SA 3NQHA 3C7OA 4DXRA 4LHKA 5FCCA 2CWSA 4FQZA 1VLNA 2B4KA 2P34A 4OUSA 5LA1A 4EN6B 3GALA 1DZRA 1IS3A 4W6YA 2J22A 4JGYC 5C3SA 2R0HA 2WNEA 4YPJA 1IS4A 2QQJA 4YW1A 1MACA 1JYWA 3U0ZA 3WXPA 1TEIA 2X5IC 5CVRA 2R16A 2QQOA 2W5FA 1DGRN 4K1YA 2A6YA 1UZWA 2F17A 2W2IA 4XUOA 3VDCA 3OPWA 1HRI2 3D8CA 4FPJA 2IC1A 4I0BA 5KHHA 4PI0A 3PURA 2ENRA 2D40A 3N3HA 5FLHA 5HBAA 4ORFA 2Y60A 2IXHA 4UW4A 3U14A 1DQ2A 2G1MA 4X6RB 5LBBA 2HWB1 2QFEA 3H50A 1GICA 4IERA 2HH9A 2B8MA 4HVRA 2DF7A 3DGTA 1CZVA 1F5JA 1X33A 4CVUA 2UYBA 2XHNA 1GZ9A 1UX6A 1O59A 2PHUA 3EJKA 3OY8A 5I0UA 3RNSA 4AEDA 1PMJX 3WW3A 2Y6GA 4NHYA 2PHXA 3ACLA 4Y4RA 4CTEA 2ZOEB 4LO5B 2ZMLA 3A0NA 1H6XA 4MXVA 2I2SA 1VBE1 1WCSA 5SV8A 3W58A 1CIWA 1FV3A 1UMHA 3QD6A 1MPXA 4RA0A 4QX7A 4JTOA 4AE2A 4CA9A 3GBFA 4F3JA 5HXMA 3VBRA 5A3OA 2RDNA 1UQXA 2KM2A 5KC5A 3BVCA 3VDBA 4Y4YA 2KD7A 1KD7A 3ON7A 1Y3TA 2YC4A 3WOGA 4QQPA 1R64A 4NHMA 3ILNA 1R082 1H4GA 2WQZC 5FLJA 3PTRB 1FI2A 4B4PA 1U5YA 4MV2A 1AX1A 3LA3A 2W39A 2HEYF 4KQ7A 1ZRRA 3DYPA 1TVGA 4XJ8A 1FPN2 2Y64A 1XQNA 4JGYA 1QNYA 3OY8B 3PVBB 4OLLA 2W87A 4XF9A 3DV8A 2BOIA 3THPA 1PGSA 1UYYA 2G19A 1RUE3 4JDNA 4KBZA 5T52A 2X5IA 2XJSA 2BNMA 2PHRA 4CP9B 5GZCA 4YFWA 2SLIA 4JHZA 1HV1A 2OQ6A 3NNLA 5CFCC 3LEKA 4AEMA 4N53B 5JPNB 3DL3A 1UZ0A 1FMD2 2YPJA 1PZ9A 3ORJA 1CONA 4P9YA 3K4AA 3TN92 3AKSA 4BLJA 1W6OA 3KQRA 4DFSA 1W9FA 3O1OA 3AP9A 2CSGA 3FFZA 2E63A 4GULA 4XFBA 4YM0A 3RFRA 3RJ2X 1K5MC 4IL7A 2R073 2Y6HA 4XIOA 1LTEA 3AMMA 2Q0AA 4NRQA 5HCBA 2EVXA 2IWGB 4LKDA 5IK8A 5J98B 1HQWA 2ADDA 1IPSA 1S2EA 2PHFA 1RMU3 2B46X 2OVUA 3H1WA 5L9RA 4FTSA 4CPBD 2RJLA 5E88A 2AZ5A 4BIFA 2VL4A 1UOFA 5IVYA 5CIRA 4RSUA 3IPVA 4Y33A 3LFMA 1CAVA 4HPKB 5HCAA 3S0MA 1RXFA 1XSRA 5FJKA 5FKCA 4D6SA 3POYA 1XYNA 2X5IB 1IHMA 3POWA 2NP0A 3T0DA 3H3ZA 5IVEA 2A75A 5CA6A 4FTEA 1KJLA 2BFUL 4PIXA 3CEWA 2Q1MA 3CJIC 4F83A 4BMEA 4LTAA 3WG2A 2I45A 2LALA 3NW4A 3OGSA 5I0RA 1O3TA 2D44A 4AZZA 4AYUA 3OJBA 3VBUC 5ACA2 1N1VA 4LHLA 3T3YA 2WWSA 4LA3A 4LK7A 4QM9A 3AYEA 3N7JA 2XLGA 5T5JA 3WZ1A 1O4TA 3OBTA 4LKSA 5FUPA 4R4XA 1RUG3 1KFXL 2WUHA 1KS4A 4C1XA 4D69A 2W46A 2UWBA 1GOFA 1O4YA 5BPXA 4ZZ8A 3CZUA 4FAHA 1S4CA 1ND2B 4QQOA 2JG8B 5DQ0A 1AF9A 1V6MA 3MF9A 4NIHA 3AKQA 4IEPA 4JAAA 1W2OA 4KL1A 3NNMA 1GQHA 3NL1A 5LCWL 3N7KA 2J1UA 1CAVB 2JECA 5CFCA 2C9KA 1C8M2 1OFNA 2BV4A 2O8OA 2ZX1A 3LEIA 3UJQA 5FO9B 1JS9A 3FWEA 3MLLA 5JSRA 2C4XA 2VQ0A 1RUE1 5KXBA 3VBFC 1US3A 2VOWA 3H0OA 2Q5TA 3OD0A 1V0AA 1WMDA 4S2DA 5F5AA 3ROUA 5CEHA 1K5MA 4HVOA 4M01A 2YZ4A 1E5RA 5GM0A 3S7EA 4UF0B 4BLIA 4BYYA 3SLIA 1JYCA 2HWF2 4FOYA 5JMOA 4AXOA 3LIHA 3POSA 3JUUA 3OGVA 1LOGA 5FY4A 2VOVA 5CBLA 4PIZA 2HWE3 1DZTA 1QJX2 2R071 2ZX0A 3EYPA 3MV01 4G4FA 4IUGA 4O7XA 5IUQA 2CYFA 2F4LA 3JQXA 5E6HA 5KC6A 1DF0A 2G9FA 4AQTA 2JD9A 4QQHA 3APBA 1RJ7A 2NMOA 2VZUA 5C8CB 1RUNA 3PTYA 2IUWA 2GZWA 1RMU1 5DDJ3 5FP4A 4IE5A 3B02A 3ZO0B 1AR62 1VMHA 2YMZA 1O3SA 5CFCB 2XWJB 4NIIA 5FWEA 3CJIA 3HN1A 2P4EA 4Z2WA 4YW7A 1ZA4A 1WUVA 1GNZA 5KBFA 3GNEA 1OUXA 5LRSA 4XBQA 3VBUA 3WV6A 1LAJA 1I5PA 4QD2A 1AXZA 3I3MA 1K5MB 3GZEA 3OYWB 3IB3A 3H7JA 1V70A 1GZWA 1WCDJ 3EO6A 1J84A 3MICA 1CAXA 2HWB2 4QU1A 1SACA 4CE8A 1CR7A 3HQXA 3PU8A 3RWNA 4DXZA 4E2SA 2ZX2A 4CP2A 1FNYA 4ZS3A 3L2HA 2A73B 4QQ2A 1SLLA 1RUG1 2WQ4A 5IWFA 1RTVA 2CGOA 4EN8B 3EQEA 4R9AA 1REEA 4A44A 4XQDA 5FZMA 1VBE2 1J1TA 3GZAA 2JG9B 4IGPA 4UT5A 4P5HA 3VBFA 1Q56A 1XE7A 1RUF3 1SBEA 4LPLA 1IZ3A 3FJSA 2W1QA 3AK0A 4J1XA 4DUWA 3T2OA 1JI6A 3CJIB 3I2FA 1S0GA 1UY4A 1OQDA 2JEMA 1A78A 3DECA 2HWD2 1OURA 1YQ5A 3E5QA 1G9FA 1IPJA 4YSFA 2CAVA 5A1FA 2UWAA 2LW8A 4GWIA 2XOMA 3UYJA 1PZ8A 1GZWB 4NAOA 5LWBA 4RGKA 5I0DA 2VNVA 1NLRA 2L9LA 4YW2A 3WX5A 4E9KA 2Y8KA 1X8EA 5DAPA 4CYDA 5EP9A 1D0HA 1LEMA 4G3YC 4EQVA 1GKBA 3SCHA 2OZ6A 4K3UA 5DABA 4XTMA 2HWE1 3NMBA 1QF3A 4CSWA 1UPSA 4YGCA 1WW5A 4PQQA 5ANQA 4BM8A 2B45X 3H42B 3B9CA 3JZVA 4AW7A 1LESA 2WSVA 1FT9A 2XJRA 3WDWA 5JCTA 5LZ6A 4A6OA 3J8F3 3NWKA 5DDJ1 2CHHA 3BGAA 1LOAA 3BI3A 4NPRA 5A7QA 4CDQC 3H7YA 3U1XA 3M3EA 3AXDA 3POFA 3U10A 2R063 3VZLA 5L9VA 4OQ9A 1JHJA 1PO23 2QQMA 1LHVA 2XVGA 3FBYA 4ZKTB 3AZZA 5J3UA 5FZOA 1K42A 3UL2A 5C70A 1OKQA 1BLZA 3HVDA 1C57A 5FZGA 1J59A 2JE7A 1KXGA 3P1IA 4XURA 4TWTA 3IM0A 3AMNA 1GQGA 4FPYA 3DEMA 3ZR6A 1Q3EA 2TUNA 1QQP3 3PNAA 4LBLA 2OPWA 1YFUA 4OCTA 2WZR3 2K46A 3S30A 1AR73 4KG8A 4IEWA 2HYKA 5C4WB 3GBGA 2EXJA 1RYYA 1V00A 4GQ7A 4QB1A 2YG0A 2DU1A 3WUDA 2ZGSA 2D6OX 3LIGA 4XDOA 4Q0VA 1C5IA 1QHDA 2YBSA 2YFZA 4DUVA 4HZFA 3ZIXA 4A3ZA 1VBC3 3HD8B 1GYKA 1PO13 4Q4X3 4QDSA 3VZNA 1WLTA 2AC1A 5FMDA 3JCIA 4JV4A 3AB0A 1JW6A 2BP6A 2P3IA 4FI9A 4YZ3A 1D2QA 5I8TA 1JYVA 2D98A 3SMHA 1RUF1 1UKRA 1GZCA 3N7LA 2JDZA 5JOYA 2ZJCA 1HB2A 3I4IA 4Q0QA 5ERLA 2QE3A 3S5AA 2WYFA 3PIGA 1SLAA 5FZOB 3ZX7A 5ABJC 1W28A 1CWPA 2WYSA 4DQAA 4NVPA 1J3PA 3WUCA 4XQ4A 1CD3G 1WZXA 3V0AA 2ORZA 1V9U3 2XLFA 1N3PA 2C9AA 5LW9A 4HVQA 4LIUA 1BKZA 1UAIA 2XONA 4RL7A 4LT5A 1O6UA 4MGTA 1CX1A 4J25A 2ERFA 4XJ9A 4A45A 4SLIA 1N1SA 1F4HA 2QZ3A 3VZOA 5JLVA 3WF4A 3J7HA 1UU4A 1LOEA 1OSGA 1SDWA 2VECA 1IOAA 4H55A 3JBG3 4XW3A 4ET7A 2VMFA 2VCBA 5LA0A 2WT2A 4CCDA 4AGGA 1ZZ8A 2GH8A 4CDQA 3A7QA 1LOFC 4L2NA 5F6KA 2VOKA 5HV4A 5KHIA 3L9JT 4M3CF 2ZX3A 2WO1A 4KU8A 4RFRB 3HNYM
chains in the Genus database with same CATH topology
4MSVA 3J8F1 1KRIA 1Q43A 3KMHA 3ZXGA 2MHFA 4K21A 4YM2A 2OZJA 4M0HA 2R061 1PO21 4XZPA 1OPOA 3J26N 4YM1A 4XFIA 5A32A 2HWC3 3WT3A 5BNNB 2VXRA 5FLIA 1RINA 1U5ZA 2OUHA 2A5ZA 4I2OA 2NN8A 1QQP1 2FQPA 4GWMA 4QPIC 2WZR1 2E9QA 1RMU2 2DWRA 2ZAAA 1B09A 1AR71 4V1PA 2H6CA 5DZGA 1S0CA 5GLUA 3V65A 1OHFA 3V0BA 4OVEA 4M0NA 4FPFA 4HFSA 2PHLA 4XF3A 4YNIA 4FAGA 3B69A 1NY72 3FFQA 5EYXA 5JVVA 3SITA 1DQ4A 3GBWA 1VBC1 4JGZC 1PO11 4Q4X1 2C5DA 5ABJA 4K7JA 1LULA 3DF0A 1OOPB 2UY8A 4MGYE 4BH9A 4O9EA 4N7IA 1ZRDA 4QPGC 3VKMA 1RUG2 1V9U1 3VBHC 3MIHA 3VGIA 4N43C 5LEKA 1DQ1A 3N4MA 2XL7A 1F2NA 1LOFA 3W9AA 3ZDSA 1UKGA 3JBG1 4U36A 3WDTA 3V0BB 5H9PA 2JENA 4OHZA 2ILMA 4X6QB 3VL9A 1KITA 5C9AB 3FZ3A 1IS5A 3ZPYA 3MIFA 4JTNA 4H7LA 5AVAA 2VY0A 2UU8A 2VMGA 4OHVA 1CESA 3E97A 1FMD3 3KCCA 3WDVA 3MEPA 1C28A 1ZBE3 4JVAA 3TN93 1LHUA 1OMIA 2V73A 3FUOA 3INAA 1YWKA 4QPIA 1Q8SA 2H0VA 4YRDA 4DNYA 4AGVA 4FXGB 2HJIA 3IWZA 2VMIA 4B7KA 4YM3A 1EP0A 2HWC1 4AG4A 3P3NA 1SLTA 1PGL2 5F6LB 1BMV2 1LGCA 1V6LA 5HCFA 1T6GC 2R32A 2CY6A 5EJ3A 2ZHKA 4JGZA 2C0ZA 3G6JB 1G7YA 2X53S 3DPRC 1LENA 2EXHA 4CRQA 2VVDA 4AI1A 4Y1ZA 2DCJA 3WG1A 1X36A 4QPGA 1QOTA 3FUQA 3U4XA 2PYTA 4YVSC 1TQ5A 4E2GA 3VBSC 1H1MA 3MIEA 5K8SA 1WD3A 4XQWA 3VN4A 4O9GA 3VBHA 4AWDA 4N43A 1UCXA 1LHWA 4MVTA 1G6NA 4PLOA 4P9LA 1RJ8A 1W6NA 4LNVA 3I2DA 2A71A 4P9WA 4E4SA 1DZQA 2BUKA 2A3XA 3LWCA 3AFGA 3VUOA 3ZN5A 1N1YA 4JGZB 4UBHA 3WQ1A 2WA4A 1RUF2 5L36A 5AC92 4YGEA 3GYDA 4X8PA 1EY2A 4FTBA 1GNHA 4COWA 3WINE 2XLAA 4QPGB 2WS92 5T54A 1FMD1 4J1WA 3TN91 3VBHB 3ZFEB 4CP0A 2WL1A 4BWOA 5FOJB 5L7OB 4NHLA 1QJX3 2MEV3 2PELA 3B93A 5FMOS 3WHTA 1HX6A 2PN5A 3NKTA 3DPRA 1ASJ2 4WVMA 4XJZA 1JBCA 1GSLA 2DVFA 1AR63 2ZAHA 5JIUA 3J8F2 4ISQA 1URXA 4I02A 4YFZA 3AKPA 4YVSA 3VBSA 1PO22 1WLDA 1CN1A 1S2KA 3LSEA 3MIGA 1IKPA 3IDBB 1DHKB 1H2MA 2E7QA 3C3VA 1CGPA 2DUQA 3MLJA 3FBMA 4AF9A 2TNFA 1QQP2 1B35C 4ATEA 4NWVA 4Q4V2 5KHJA 4COVA 3MPPG 4Y1XA 4LEJA 4HSJA 2GN3A 3WW2A 2GC1A 4Q0SA 2XHKA 3WG3A 2R043 1MQTC 4WVMB 1XRUA 1VRH2 1VBC2 1PO12 3ZN6A 4ISRA 4M3CE 2PHDA 4QX5A 2R30A 5IK5A 4AFCA 5L19A 2IXJA 1DQ5A 3ZSEA 2BPA2 4N53C 2VPVA 4AI2A 4TLFA 3M3QA 4ASLA 4R9BA 2RR12 1A8MA 3BALA 1V9U2 4BCUA 4R9CA 1H4HA 4Q0UA 4S2FA 1O7FA 3R05A 4QQLA 1VB2A 2XVLA 4Z92B 2IZWA 2FZ2A 3JBG2 1QJX1 4BOWA 2MEV1 4E2QA 1UL9A 3O0XA 4XHXA 2V09A 4HSLA 3ZN6B 4XJWA 2YGLA 4QGLA 1ZM1A 4L9BA 5T3NA 1AR61 5AFEA 1XNCA 2ETEA 4FT8A 1FV2A 3VL8A 5BNOC 4OUMA 4LO7A 1UIKA 1CAUA 3SHRA 1LODA 1RVF3 1O5UA 3G7DA 2XB6C 4W65A 1B35A 5F5QA 3GZUC 2HWC2 1UU5A 1QDOA 3NAPB 2JKBA 5FO8B 1CPNA 1ULEA 1MQTA 4IV3B 4LBQB 1U12A 5EFUA 2W08A 3QLQA 4I01A 4K8FA 1XU2A 2B42B 3SISA 3H8UA 2NMNA 4Y20A 5GLVA 4Q4Y3 4D94A 1ND2C 4EJRA 2JG8C 3ZFFB 3TAYA 3ZVXA 4F8AA 1LU1A 2XVKA 2VW1A 3OPZA 1VJ2A 2R041 2WT1A 2AUYA 4N53A 2MNGA 4L97A 4RD7A 1CAUB 1JOJA 4RQPC 2HWD1 3E6CC 4PF5A 1AL23 1EPZA 1LCLA 1MS5A 2HEWF 1B35B 3BTAA 1GFF2 2DTYA 5GLZA 5GZFA 1G9AA 3OD4A 2JD4A 4UW5A 3VKFC 4LULA 5E16A 3O0VA 1S2BA 2Y26A 1MQTB 1MS0A 1XNBA 4LBNA 3E5XA 1O91A 4HPKA 4HT1T 4Y20B 2IXCA 5HI0A 2XWBB 1WLCA 1RUH3 3MW2A 5A3LA 1QJY2 2VVEA 5GKAC 1DQ6A 5BNOA 5C8CC 4Q0PA 3WP3A 1W2UA 4IEVA 1EAH3 3MIBA 1NQJA 1TME3 2ZMKA 3SNMA 3B5LB 4GB32 1S1AA 3LZZA 3NV3A 4JDMA 1ZBE2 1AVBA 2PQQA 1RVF1 1SEFA 4FXKB 2BGCA 4FCAA 4Z1VA 3Q9OA 2XH6A 3O5SA 2D6MA 4IEUA 4RHV2 3VKOA 3M3CA 1ND2A 5K0UC 2JG8A 3AYAA 5C6CA 1XYOA 4AQ2A 1QOOA 2JJ6A 5SV5A 3V56A 1IS6A 2ZZJA 4B7EA 1NQDA 4Q4Y1 4Q27A 5BNOB 1RC6A 2DCYA 3AKTA 2JG9C 3B3QE 5DXDA 1XXNA 4RQPA 5T5OA 2OPKA 5I91A 1MVQA 2RHPA 1NCRB 5JR7B 5C33A 1GR3A 1V6IA 4LO6B 1ZX5A 3AX4A 1AXKA 4D7SA 1GANA 4KBBA 4ES8A 1AYM3 3HIFA 1C8NA 3LAGA 2XUMA 3WG4A 1RL3A 2ES3A 3BOPA 1H30A 2VUJA 5AVPA 2G4IA 5C8CA 3FLRA 3ZXLA 4UXAA 1I5ZA 2IXKA 4E4ZA 3NJZA 3O12A 3ASIA 1RUH1 1TMF3 4RQPB 3VBOB 3U11A 1C3HA 3PLQA 2D5HA 2XJVA 1EAH1 2D5FA 5T55A 3WDXA 3OYWA 1YFXA 3CU7A 1QGLA 4KG0A 1PNFA 3WDUA 3TRSB 3HMYA 3AZWA 3DKWA 2Y38A 3EXUA 5K0UA 4Q1PA 4LBQD 5JOZA 1Z78A 2WLQA 1NZCA 4A3XA 3VZKA 2MEV2 3TWIA 1UU6A 2WLPA 4N9HA 4HKLA 3ZFGC 3WHUA 5C4WC 4KU7A 2JG9A 2D6NA 4XFGA 3ENRA 3R6SA 1DGWX 3D82A 2GMMA 3WP4A 1UD1A 1CAWA 2Q4SA 4HETA 1NY71 1AYN3 5GJ6A 5DUUA 1HQNA 4CP1A 3VKLA 2B39A 2F6BA 2GH2A 1S0IA 4COZA 3OTFA 2DVDA 2JX9A 1YCIA 4YARA 3KGLA 3OCPA 4FOVA 5GZDA 1YFYA 5K0UB 4DB5A 3KS7A 2BNOA 4CZSA 4XFCA 1MS9A 4IESA 1AYM1 3ES4A 4DRRA 5TSWA 3KZ4C 3S7IA 2RE9A 2PAEA 2R042 4LE3A 1QH6A 4YG3A 4LBOA 4OULA 1G9DA 5AC93 4A7YA 1W6QA 3RPQA 5J36A 1JHNA 1CAWB 2VQAA 2XKPA 3E6DA 3RMXA 1WMEA 4AEJA 5JDBA 4AVVA 3ZYGA 3K51A 4BQ1A 2OYZA 1TMF1 5FO7B 3D4KA 3RJRA 1WBLA 2WS93 2BYVE 3KT4A 2NM1A 4I3PA 1H2LA 1H8TC 1I9RA 2VG9A 4I09A 4RGGA 4PDWC 2QNKA 1JH5A 3USSA 3ZFGA 3IDCB 4C0HA 5C4WA 2D97A 1QH7A 5BNNC 5FRAA 1SBFA 3PVEA 4MGKE 3S6PA 4E4DX 2WT0A 4XXPA 4PBPA 1DU3D 5JIAA 1PGL1 4GKYA 1ASJ3 1BMV1 3USUB 3TOJA 3N7MA 4MZUA 2D93A 3SCFA 2A70A 1F8VA 2D6KA 1W6QB 3M4FA 3O14A 3AJYA 4NR1A 1JUHA 4P9IA 1O5LA 4RR3B 2Y0OA 4DY5A 2ZGKA 1RVF2 4AVCA 1AYN1 4L99A 3FE5A 4Q1RA 1OOPC 3O0WA 3IT8A 1REDA 4DRVA 3T2TA 1ZRFA 4H3WA 4ZXKA 2ET7A 1PGW2 4FQ4A 5A33B 3ZYIB 4Q4V3 3ZFGB 4OI4A 2DVAA 2P3KA 2XJTA 4COYA 4HK8A 3T1LA 1RUOA 1J3QA 1VBA3 4IV1B 2VOXA 1YXWA 1Z7S2 4MXWB 1D2SA 1IQAA 2E6VA 4Q4Y2 4EROA 1XE8A 1VRH3 4GMP3 5D8AB 2WA3A 3W59A 4XF1A 4CEYC 3DUIA 4HKWA 1QWRA 2YC0A 1Y43B 3AKRA 2QDNA 4Q29A 3FC0A 4KH9A 5AC91 2H6BA 3MLKA 5C9AC 3AFKA 3IDEA 1DDLA 1H8TA 3PMSA 1PM7A 3RMYA 3I59A 1F5FA 2RS13 1H8VA 3HBZA 4PDWA 1AL22 2GAUA 4EN7B 4EN9B 2RR13 3WDYA 2VH9A 2AENA 3ALQA 4Q2FA 2WS91 3UK9A 5BNNA 1WMFA 5LEJA 1PIV3 4KGQA 2ZGRA 1S0JA 2ZZQA 1OI6A 2OIIA 3D6EA 1NYWA 1AX0A 1PK6C 3ZMOA 2VW0A 2WJSA 3KD4A 4LE4A 4AVBA 4DZGA 4YZ2A 4OI2A 3N36A 1SLIA 1RUH2 2FZ1A 2XJPA 4NOTA 3LGRA 3O7OA 1ASJ1 1QJZA 3X29B 2O0OA 2DUOA 4XBNA 5FQ0B 4XF0A 1R093 1EAH2 1OOPA 2Z2SB 2QCSB 4R4ZA 1TME2 3HT2A 1BK1A 2D3RA 4RGAA 1H8TB 1YYNA 3PVNA 1ZZCA 3I59B 3AJZA 4PDWB 5JOXA 3AXEA 4SBVA 2PTMA 4KWJA 2XBO3 3N35A 4EWAA 2ZHLA 5DZFA 2ZHNA 3CNAA 1YJKA 2JXAA 1N3QA 2QZ2A 1VBD2 2RS32 1HDKA 2DUPA 4NWWA 2QJVA 4LLOA 2FBEA 1LKNA 1R1ZA 4Q4V1 2BEOA 3VHPA 3ME2A 4CEYA 3RG0A 4BHPA 1KDMA 4Y1UA 1V6OA 1PVC3 1VBA1 4XF4A 1MVEA 5C9AA 3IN9A 3QBQA 1FOD3 2ZGLA 1VRH1 4GMP1 4KWKA 4UW6A 2TBVA 2TEPA 1ULFA 3OF1A 5I93A 1TNFA 2R1DA 1OA4A 1BEV3 4I0AA 4GXLA 1ZNPA 1AHSA 1HQLA 1I1EA 4ONUA 3T1MA 1ENXA 3WQ0A 3WW4A 3AZYA 4H14A 3SCGA 4QGNA 1NLSA 3NO8A 2B7YA 2G9GA 2RS11 2XJQA 4AHWA 2RR11 2D43A 3J4UH 1AYM2 1AJOA 1PK6A 1BVVA 3JD72 3ZFEC 1GBGA 1MZFA 1PIV1 3MIDA 3UJOA 5L7OC 1RITA 3FLPA 2PHTA 4D7TA 4AQ6A 4CEYB 1QJY3 1KS5A 4XHBA 1H9WA 2AREA 4YW4A 1LOCA 3ETQA 1TMF2 3ZXEA 4MX3A 1NA1C 4RFT0 2NPIA 2WNVC 5EWSA 1LECA 2YXSA 1R091 5DUVA 4GB33 1O3QA 3WQ7A 2QQPA 4INDA 1HXS2 3HR9A 5KXDA 4YVWC 4CEWC 4Z82A 3BPZA 5FPZA 3NV1A 5FPXA 4RHV3 2XBO1 3HAGA 1PK6B 2ZHMA 4CDUB 2NZ9A 3ZYPA 4MGIE 4WZFA 1AJKA 2DCTA 4XJUA 4XTPA 1DIWA 4HLTA 1W6PA 2NYYA 1LHOA 3ZSLA 1TE1B 1PVC1 1AYN2 3I54A 4FPEA 1FOD1 4DY3A 4YGBA 2WFF3 1D4VB 1AR82 2FHRA 2YROA 2GN7A 2LM3A 2VW2A 1BEV1 2AGSA 3NVCA 2A3WA 1CJPA 2YGMA 1EYBA 4W6WA 4CDWB 1A3KA 4M3CB 3ZFEA 1MS3A 1KFUL 1MS8A 2PFWA 2Q8OA 3ZN4A 5KHKA 5L7OA 1HRV2 2GALA 3BB6A 1ULCA 1BBT2 1WCKA 2WFPA 1JYIA 5J96B 5JWPA 1LJ7A 2SBAA 2ZS6B 5JZGB 4FP3A 3AYDA 4XDQA 2Z69A 1XYPA 5K7PA 1PZ7A 1NA1A 3SH4A 2PA7A 2WNVA 1W6PB 5I0TA 1ENRA 5C8WA 1QJU3 1QJY1 1YUDA 1WD4A 1ZZ6A 2WINB 1RB8G 5CU1A 4KWLA 2PHWA 2ZCWA 3H1MA 4JRLA 5JMCA 1IGOA 4ZU7A 2ZX4A 4YVWA 4CEWA 2HKXA 5HXVA 4GALA 2ET1A 3A4UA 3VZMA 4GB31 1ZBE1 4A2UA 2QKDA 4LHNA 1Y7BA 1OLRA 5KXCA 4GIQA 1WW4A 4FOWA 4CDXB 3R4DB 1Q8OA 4GA9A 3NV2A 1O3RA 4NN0A 1QXJA 3NAPC 4RHV1 3GHMA 5T50A 4IV3C 4ZU4A 4DMIA 3V0AB 2QDRA 1LB2A 1NA1B 3C2UA 2GMEA 2WNVB 3ZFFC 3ZSJA 3VDDB 1VAKA 2ZGMA 4LLFA 1N47A 1V6JA 4IEQA 5FDBA 2MPFA 2VNOA 4YVWB 3WNXA 4CEWB 1NXD1 1DLLA 5KHGA 1YIFA 5J09A 4OHYA 3GHNA 4B8EA 1QU0A 5CB7A 3VHNA 1SQ4A 2GDFA 2ZGNA 4AVTA 3QH7A 1WW6A 4AVAA 4A7ZA 1FNZA 5FMOL 1POV3 5FBZA 5FAXA 3FMGA 2ZGOA 4MGZE 1Q8VA 3KLSA 4COUA 1VBA2 3ZYJB 4K20A 1SLCA 1SCSA 5D1IA 2BQPA 3E5UA 1VR3A 2LUWA 1W6MB 4IEYA 1REFA 1ND3C 5JAXA 1QJU1 1H9PA 3JQWA 2UYAA 1HV0A 2RS12 1X8MA 4LUMA 2XL9A 1OLQA 3E6BA 1U5XA 4MYEA 2UWCA 3NAPA 1PIV2 2WNUC 4L8QA 4AI0A 4ATFA 4IV3A 4LBQA 1L3JA 4YZ1A 1YIPA 4HBNA 2ZKNA 3ZFFA 4XFAA 1AXYA 1OD5A 1QKQA 3ST7A 2GNMA 2RMU3 3LCPA 2DU0A 1QXRA 1CQ9A 1R092 1XNDA 5JI9A 1O4ZA 3AMQA 1UF2C 1BYHA 3RS6A 4MLOA 3ILFA 2NLRA 4YW3A 4PIYA 1D4M3 1NOVA 5LRRA 3TYJA 3BODA 1JXNA 1EV13 4ZU5A 1NCRC 2XBO2 5B2GB 3AZXA 2EAKA 1Q5OA 3D0JA 2VGDA 3LA7A 4OI1A 2P17A 4BPZA 1ULGA 1WA4A 1I6XA 5CFDC 4H7MA 1QDCA 1Z7S3 1POV1 3AMPA 2PAKA 3FX3A 2XJUA 3PJQA 1LGNA 3ATGA 3RI9A 1PVC2 3SH3A 4YZ4A 2YV8A 1ND3A 4XFHA 1J58A 2DFBA 4JCKA 1FOD2 5A3MA 4MUVA 2EXIA 1LR5A 1E57A 2VVFA 5T5PA 4AI8A 3PVOA 1BEV2 3PHMA 1BCXA 3VBOC 3AM2A 3MPBA 3AP7A 2WNUA 3RI8A 1DFQA 2YUEA 5JPMB 3KM5A 4QGMA 3R0RA 2D3SA 3GF6A 5E1RA 5I8SA 3DN7A 4YGDA 2AR6A 4GH4C 1ENQA 2D6PA 1ND3B 1MEC2 4B3NA 2Z5WA 3NSTA 2RMU1 2ZGPA 2N7GA 3WW1A 4QU2A 2IFWA 4L92A 3WVJA 1NCRA 4P9XA 5JOWA 1YO8A 1FATA 3TB0A 1UPIA 4FSJA 1CX4A 2WNUB 3M7AA 3ZSKA 2HEVF 4AEDB 1D4M1 4K6BA 1EV11 3I7DA 1DBNA 5CFDA 1VBD3 2RS33 4RS5C 1CVNA 3FHIB 1R1A2 4LBKA 4META 5BXXA 1BVP1 1AL0G 1PGW1 4AFDA 4OI0A 5CAZA 3ZXAC 2ATFA 5J7MA 1LHNA 2OW4A 2XG3A 1RUJ2 4Q8KA 3K48A 2GU9A 5JSPA 2BWCA 2BFUS 4YYOA 3VBRB 1RUC2 4FVVA 4JQRA 3RYKA 1Z7S1 1S0DA 3MFCA 1IPKA 2K0GA 1DQ0A 2P3JA 1MS4A 2K9ZA 3VBOA 3M1HA 5H9QA 1YI7A 1M4WA 4XILA 2VULA 2WFF2 1QY4A 2YYOA 4J6GA 3THTA 1G9CA 1G86A 1PHMA 4WM8C 1Q8PA 1AZDA 4AFBA 4JGYB 1SBDA 1AL21 4C0BA 5GZGA 2IXIA 5CFDB 1RIRA 1WW7A 5L73A 3JD73 2DV9A 4WVZA 1BJQA 4GH4A 2CL2A 1U5IA 2CTVA 4IEXA 1VB4A 3MW3A 4FPGA 1UZYA 3VZJA 2XKOA 3L2YA 2DTWA 1AR92 4B29A 3H9AA 4KGGA 4OFGA 1H0BA 1RUD3 1W6OB 5DZEA 3UKTA 1QJU2 2RM23 1RUI3 1ULDA 2ZA9A 4WZCA 2PLV2 3LSDA 4QHBA 3M8LA 2D3PA 2ZKLA 2W52A 4GMP0 1VBB3 1TME1 2NQYA 2GSYA 4RR3C 2RJKA 5E89A 1XNKA 2EIGA 4RS5A 3WP6A 1HXS3 3B94A 4M00A 1OQ1A 3IPVB 4C90A 2BVVA 4AHYA 4FPLA 2DURA 2B5HA 4I3GA 1CPMA 3M70A 4YW5A 4GH4B 4QM8A 1VBD1 2RS31 2RS52 1C1LA 3GZTB 1FX5A 1S0FA 2PAMA 3ILRA 4P14A 5LK7B 4WVWA 3M3IA 2D7FA 4IV1C 2EALA 2KA3A 2P37A 1DGRA 4R8HA 5CNAA 2W68A 5J37A 3RRDA 2W0XA 1S0EA 3PMEA 5D8AC 2Z79A 3VLBB 2YHJA 4WM8A 2E7TA 4A7KA 1AR83 2VMHA 4Q8LA 4XOGA 2X29A 4WVVA 3URFA 4AEKA 1KDKA 4LBMA 4HN1A 1COV3 3HT1A 4Y22A 4DINB 5GALA 4RS5B 2VU9A 1HRV3 1V6NA 4W6XA 3B9IA 4N90A 4XE9A 3FLTA 2UURA 5GZEA 1U0AA 4F7ZA 1BBT3 1DGLA 1HLCA 3V64A 2VNRA 4OHWA 4ITCA 2GNTA 3JD71 4PCRA 4B4QA 1WBFA <