4RHV2

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 49
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rhv200
1PVC2 4NWVA 5A33A 1R092 4IV1A 5ABJB 1ZBE1 2RS11 4N53C 4JGZA 4Q4W3 1RUD2 4RR3A 5ABJA 2R072 1VBE1 1QQP2 1QJX2 3VBFC 5L7OB 1EAH3 1VRH2 4Q4V1 1K5MB 5L7OA 2R062 3CJIC 1BEV1 1V9U1 1PIV2 4GH4B 3JD72 1R1A2 5BNOA 1NCRC 1RUG2 1RVF2 1AYN3 1ZBA3 1HXS3 2DF7A 1R081 1FPN3 2RS53 1AL21 4CDWB 1HRV1 1MEC3 3DPRB 1Z7S2 3IDEA 5AC93 3LOBA 5BNNC 1TMF1 4Q4X3 5BNPB 1AR83 1EAH2 4GMP0 2RS32 4RR3C 1AYM2 1CD3G 4YVWC 1QJU1 1RUF1 3ZFEA 2BUKA 1TME1 1COV1 1E57A 1QJY3 3HAGA 3VBHC 2HWE2 1RHI1 1B35B 4GB31 4FTEA 4CEWB 3VDDB 4Q4Y1 5JZGB 2HWF3 1RUI1 1VBC3 4CEWA 1ZBA2 4N53B 2R043 4QPIB 1BBT1 1HXS2 4WM8B 4GMP1 1FPN2 5FMOL 1AR63 2RS52 4N53A 1NCQA 2HWD3 3JBG1 2QQPA 3VBFB 2PLV2 2MEV1 5BNOC 1OPOA 1NY71 1PVC3 1R093 4CDXA 1AR91 4Q4X2 1RUD3 3J8F1 1ASJ1 2RR13 1AR82 3CJIA 5J96B 5FOJB 1QQP3 5CFCC 1BMV1 4FTSA 2XBO2 5FMOS 2XPJA 5ACA1 1H8TC 1RMU2 4RFT0 1QJZA 1OOPC 1NCRB 1QJY2 1DDLA 2WZR2 4RHV1 1RUE1 1NCRA 1PO11 4YVSA 2HWF2 1ND2A 2RM21 1POV3 3JD73 1AL0G 1R1A3 1VBB1 2TBVA 5D8AC 5BNNB 1VBD1 2GSYA 2ZAHA 5BNNA 1EV11 2HWD2 4CDQC 4RQPC 1FMD1 4RR3B 3VBSC 4YVWB 1RUH1 1Z7S3 1FOD1 1NCQC 1V9U2 3FBMA 4YVWA 3TN93 2RR12 1AUYA 1RUC1 4Y5Z0 4Y4YA 4CDXC 2HWC1 5DDJ1 4BCUA 3VBHA 2RS33 1AYM3 4AEDC 4WM7C 5CFDC 1D4M1 1R082 3S6PA 4LLFA 2WFF1 1HRV2 1VBA1 2HWE3 5BNOB 2WS91 1TMF2 1HRI3 4NWWA 3ZFFC 4YVSC 2RMU1 1PO23 1ND2C 4PDWC 1QJU2 5CFCB 4CDUA 2R071 2PLV3 2HWB1 3TN92 5CFCA 1H8TB 5C4WC 1QJX1 1RB8G 1OOPB 1H8TA 4RHV3 2FZ2A 2R061 4GB32 1OOPA 1NA1C 1C8M3 4Q4Y2 3ZFEB 2X5IA 1SMVA 1PIV1 2XBO3 5D8AB 1RMU3 1VBD3 5J98B 2BPA2 1RUJ3 5K0UC 5D8AA 2WZR3 1AR73 2Y26A 4CDQB 3VBUA 2MEV2 1RUG1 1RVF1 5C9AC 3VBSB 4CDQA 1ZBE3 1HRI2 2RS13 1AR92 1C8NA 4RQPA 1NCQB 1ASJ2 3VBSA 1PGL1 1PO22 1VBE3 3JB8A 4Q4W1 1PGW2 4CDXB 5DDJ3 4Q4V3 5ACA2 4AEDB 4WM7B 3CJIB 1BEV3 1EAH1 5CFDB 1V9U3 4EJRA 4RHV2 4AEDA 4WM7A 4CDUC 3VBRA 2FZ1A 3VBOC 5CFDA 1PO12 1C8M2 1HQNA 1VBB2 4RS5A 1VBD2 1RUJ2 1W39A 1OHFA 3ZFFB 1AR72 1EV12 1X36A 1R083 2X5IC 4YVSB 4FSJA 1ND2B 1F8VA 4PDWB 1AL23 1AYN1 1FMD2 3ZFFA 1HRV3 1HXS1 1ZBE2 2RS12 1FPN1 4PDWA 2RS51 4QPGC 4CDWC 1MEC1 1RUC2 1VBE2 1TMF3 3VBUC 5C4WB 5AC91 2VQ0A 4N43C 5DDJ2 5C4WA 1M06G 1NA1B 4Q4V2 4Q4X1 1QJU3 1NOVA 1BEV2 1AR81 1RUF3 1NA1A 1MQTA 1TME3 1COV3 4JGYC 5K0UB 3VBHB 1VBA2 1RHI3 5K0UA 4GB33 2ZTNA 1QJY1 5C8CC 5C9AB 4Q4Y3 2WS92 2BBVA 1RUI3 3VBRC 1VB2A 5C9AA 1BBT3 2ZZQA 2RMU2 5JZGC 2HWF1 4IV3A 4GMP3 1VBC1 1AL22 2R041 4QPIC 4WM8C 4RS5C 3JBG3 5LK7B 1AR61 2MEV3 2HWB2 2HWD1 1GFF2 1AR93 4SBVA 3J8F3 1ASJ3 1PVC1 1R091 4CDUB 3VBOB 4FTBA 1POV0 1RUD1 1K5MA 2RR11 4CEYC 1RUF2 3VBOA 3VDDC 1QQP1 5ACA3 1TME2 1COV2 1CJDA 4GH4A 1VRH1 3ZFGC 2X5IB 1RHI2 1RUE3 1MQTC 1PO13 3NAPC 1RUI2 2RM23 1F2NA 1VBB3 4QPGB 1BBT2 1PGL2 2BFUL 1ND3C 1POV1 3JD71 3VBUB 4Q4W2 1R1A1 4QPGA 4CDWA 3ZXAC 1VB4A 1EV13 3JBG2 3DPRA 4N43B 3JB4C 4RQPB 1FMD3 1NY72 4N43A 1RUH3 4IV3C 4IV1C 1FOD3 3J8F2 4JGZC 1IHMA 5BNPA 5ABJC 1RUC3 4JGYB 1Z7S1 3TN91 1BMV2 2HWC3 2IZWA 4JGYA 2BFUS 5C8CB 1A6CA 3VBRB 5L7OC 2WWSA 5C8CA 2RS31 1D4M3 1AYM1 1K5MC 1RUE2 1B35A 1VAKA 2WFF3 1AYN2 3VDDA 5JZGA 1VBA3 4RS5B 2RM22 4GH4C 1WCDJ 4QPIA 4WM8A 1MEC2 2HWE1 2WS93 5AC92 5A32B 2RMU3 3VBFA 1HRI1 5A32A 1ZBA1 1RUH2 1PO21 4CEYB 2R073 1FOD2 2HWB3 1NG0A 1PGW1 4CEYA 3DPRC 1QJX3 2PLV1 1VRH3 3ZFGB 2HWC2 2R063 1MQTB 3ZFGA 3NAPB 1X33A 1PIV3 5BNPC 4Z92B 1D4M2 5GKAC 1C8M1 3NAPA 3ZFEC 2GH8A 1ND3B 1VBC2 2WFF2 2XBO1 2R042 1RMU1 1HX6A 1ND3A 1RUJ1 2WLPA 1AR62 1RUG3 1RVF3 2WZR1 5A33B 1AR71 4IV3B 4IV1B 1B35C 3M8LA 4CEWC 4JGZB
chains in the Genus database with same CATH superfamily
3SH4A 1R092 3WQ1A 2PELA 4FFIA 1LEDA 1QY4A 2WAOA 3WLUA 2VTXA 2JD9A 2E51A 3AJZA 3AYCA 4JGZA 4RR3A 1J3RA 1ODNA 4R8HA 5EQUA 3T1LA 1D0GA 1W9YA 3WF0A 4ASLA 5ABJA 3FZ3A 5BNQA 2GC3A 3I2IA 2JG9C 3WV6A 2BJSA 5IVBA 2ZKLA 4ZZ8A 5JI9A 2BW8A 2L9LA 1W6PA 1VRH2 4XUTA 2Y8KA 1CGPA 4BDVB 4M0NA 5A7QA 1JYCA 1FV3A 1K5MB 3KQRA 1LOGA 2BGCA 5FYUA 1G9BA 5ERLA 1GOGA 1UIJA 4BK4A 4BYYA 1W6NA 3WNKA 1V9U1 1S0CA 5FWEA 3QLQA 1REDA 2A3WA 4CU9A 1G9DA 4V2VA 2WABA 4JKKA 1ST8A 4LORA 3H8XA 4U36A 4BXSV 4D7SA 2GZWA 4B4PA 2ORZA 1WCQA 4AR2A 4LMFA 1DLCA 2E26A 2Q4SA 5A3PA 5H9RA 2G9ZA 2NN8A 3GCWA 5D2AA 2JG8C 4Z2AA 5BY5A 5HV0A 2VVDA 2YC4A 1OLMA 2VQUA 5BNOA 3POEA 1NCRC 4IUGA 1UN1A 4UF0B 1NLRA 2VJXA 2PHUA 3C2UA 2X05A 1TG7A 2RS53 3EHKA 1IG0A 1JUIA 1CAXA 1YI7A 4KMQA 3I3DA 4P00B 5FKBA 4CDWB 4IE6A 2JIJA 2WQ4A 3IDEA 3LEIA 1UMZA 1W8TA 2C4XA 4IE0A 4PF5A 4XXPA 4A6SA 2CGPA 5JXIA 4L97A 1OMIA 1WW4A 5FZKA 2IVIB 3ME2A 5M0TA 1CVNA 3N9OA 3ZYFA 3MPPG 1OA4A 5BNPB 2VZSA 1AR83 4W65A 1AJOA 4GMP0 1ODMA 3RWKX 5FZDA 4ES8A 1AYM2 1H1MA 4YVWC 2I2SA 5F3IA 4E2GA 4I09A 3O7OA 2BUKA 2GDFA 4ATFA 5FZOB 1OA3A 3T3YA 4YG6A 4J25A 3HIFA 3LIHA 4DS0A 5FYMA 3HAGA 2J1TA 1W9WA 1RXGA 2VUDA 1POQA 1RHI1 1XE0A 2ETEA 1AXZA 1B35B 2GC2A 3FHQA 3NWKA 4GB31 4K40A 1WWYA 3S7EA 3UL2A 3VGIA 2D6NA 4BB3A 4OQ9A 1SBDA 1OSGA 2HWF3 3AMHA 4LR4A 1RUI1 3M4FA 4MV2A 4ASKA 2C1FA 4UW6A 1VBC3 2VH9A 3I2JA 3PVEA 5FO7B 3N9MA 4GMP1 1XNCA 1FPN2 5J36A 4K3UA 2VQTA 3ZM8A 1BKZA 3WD5A 5JMCA 3BOWA 5C8WA 4H14A 3OGRA 2XVLA 5LBCA 1JZ5A 2PLV2 5FZ8A 4FPYA 2MEV1 1WA6X 1SLBA 4CDXA 4I0AA 4XFIA 1AR91 1G7YA 1C3HA 2XHNA 1LR5A 1LHVA 3D4KA 3ZYRA 2BRTA 1GNZA 5J96B 3QBQA 5FOJB 2WYSA 4IEVA 3PTRB 1JZ3A 3MF6A 4QGMA 1OQDA 1UY0A 2JE7A 2KD7A 4AVTA 4HZFA 3TB0A 5C3RA 4E4DX 5IFTA 2Q8EA 3S5AA 2XPJA 1LHUA 1MZFA 1YC61 1EY2A 5ACA1 2CU5A 5J3UA 1PZ8A 1QJZA 4E4SA 3KV9A 5H9SA 2W2IA 4RHV1 1REEA 3AXEA 3H7YA 3K2OA 2ZHLA 5EJ1B 4B7KA 1PO11 4LA3A 2A75A 4OFGA 5EP9A 3RI8A 5JOXA 3ZSKA 2XVKA 2RM21 3NL1A 3JD73 5KXCA 5B4NA 4LIUA 2EAAA 1ZRDA 1V70A 2YPDA 2VM9A 4TTGA 2TEPA 4Q0SA 2YU2A 5T5PA 5BNNA 5LEKA 4NHLA 2HWD2 2VMIA 1C1FA 3C3VA 1DGRN 4RQPC 1A78A 3PVBB 1LOFC 4RR3B 3SEEA 1FOD1 3HQXA 3AKRA 3U0ZA 2PAMA 3O1MA 3BI3A 1G8WA 1TNFA 3FBMA 3L9JT 1AUYA 2BQPA 4JCKA 4Y4YA 5A7SA 3W59A 4NIDA 1W6PB 3EB7A 3WQBA 3ZYJB 5IK8A 3H8OA 1VMHA 5AVPA 3IMNA 4PLMA 4YNIA 3QH7A 4BHPA 1DHKB 2V5YA 3H1WA 3VBHA 1W6NB 2RS33 3AP4A 4HVOA 4BIFA 5FZGA 4DRVA 5LB6A 1RXFA 5C5TA 4YLZA 2RDQA 2LTNA 2GP5A 2XLFA 2ZHNA 2ZX3A 3LCPA 5JI7A 4EN8B 2BWAA 3ZN5A 2VC9A 1MR5A 4CCKA 1H2KA 1XXNA 2JDZA 4XIOA 2BWCA 1LRHA 3IBMA 3PUAA 5DZFA 1CZVA 2YMZA 3TEYA 5C70A 1VBA1 3RYPA 5KHJA 1W8ZA 1Y9GA 2W47A 5F7UA 1IZ3A 1DQ0A 3TWIA 1H6YA 5BNOB 2YBPA 1OKQA 4KI5M 3RI9A 1IQAA 2VCCA 4IQPA 3ZKYA 1JHNA 4YZ1A 4MUVA 4XDOA 5IYYA 3G7DA 4KU8A 4UFHA 3EBRA 2XKOA 2GNMA 4PDWC 3ZR5A 4AQ6A 1N3OA 1DGRA 3GDBA 2LROA 4IEXA 4V1PA 5FZ1A 4QX0A 1NYWA 2JX9A 4CDUA 4F8AA 3DCQA 2A70A 2Z42A 1XE8A 1W2AX 2HWB1 4P08A 1ULDA 1BYHA 2QDNA 4QX2A 3MW2A 3TN92 3KT4A 1UYZA 3KQ4B 4DXZA 2RG4A 2JDKA 2WNVA 2ZGMA 4IE7A 3WW2A 3AM2A 1OOPA 3WZ1A 2PHWA 3BIWE 3HBKA 4Y1VA 4XC9A 1ULGA 2XOMA 3WF2A 2R16A 3NW4A 5FP7A 1WW7A 1UZ0A 3U78A 1WCUA 4BQWA 3B93A 3DYPA 1DCSA 1VBD3 1IPKA 3KF5A 1RUJ3 4QQLA 2VU9A 5J98B 4BM8A 4XZPA 4XDQA 4BQ4A 1FT9A 1XC6A 2NZ9A 2PQSA 5I8SA 3TOJA 2A7AA 5IUQA 3LEKA 4DY5A 2F4LA 1RUG1 1XNBA 2W1WA 4LHNA 3MIBA 4M3CF 4CDQA 4NAMA 1ZBE3 1F9KA 1HRI2 1K12A 3GZUC 4QGNA 1C4RA 1ASJ2 3NNFA 4IGQA 5FCCA 4BH9A 1PGL1 3A23A 3NV3A 2W3JA 1H30A 1VBE3 2WSVA 4JAAA 4OHZA 3T0DA 3I54A 1PGW2 2BNMA 1F15A 2QQJA 3PUIA 1UWWA 2QTWB 4Y5TA 3T0BA 4CDXB 1W9TA 5DDJ3 2Z5WA 2VW0A 3U07A 4Q4V3 4AFAA 3T0AA 4IGPA 4IE4A 1Q8SA 5T3NA 4QX7A 1J3QA 3PLQA 2AYHA 2HEVF 4UW3A 3RRDA 5CFDB 3K75B 3DEMA 1L7LA 2UWBA 2XWBB 4W4ZA 3TEXA 4HOOA 4DEQA 2Y33A 4Z2WA 2ZGTA 5HPOA 1HQNA 4GXLA 5C33A 4AXOA 2VQAA 3J7MA 2YBKA 2D3RA 2B9UA 1LGBA 3IIIA 5FQ0B 2Y6JA 1JZ7A 1QJEA 4YM3A 2G19A 2DVAA 1W39A 3S7IA 2W46A 3UJQA 3VB9A 4R4ZA 1GICA 3ZFFB 3TRSB 1IPJA 5FZ6A 3ABZA 2W1SA 4JX0A 4OI4A 1UY3A 1F8VA 3G6JB 4AAPA 4DZGA 3FWEA 1KJRA 4FPLA 4XFGA 3T30A 4Q8KA 1W0NA 2ID4A 4QDQA 5FXVA 1QIQA 2RS51 3MO4A 2DVDA 4FOVA 2A71A 2QZ2A 3I2FA 4IEPA 1XJAA 5D21A 2WL1A 1RUC2 3BUCA 4AW7A 1W3XA 3O5SA 3VBUC 4DB5A 3NNLA 4ZU7A 2DBNA 3JXSA 4AFCA 2JXAA 5C4WA 1L7QA 4R9CA 1M06G 3GCXA 1NA1B 1W2UA 1YHFA 2BOJA 2D44A 2ADDA 3HPNA 2P37A 1XNAA 2R1DA 1BEV2 1AR81 1RUF3 5F5AA 4FPOB 2EIGA 4PIZA 4YFWA 1GUIA 1Q8VA 4HBNA 1HIXA 1GWMA 3N7LA 2YPJA 1COV3 4JGYC 1H6XA 3AJYA 4JTOA 5FUNA 3VBHB 1H2LA 3HJRA 4KGGA 3R6SA 1FNYA 2Z2SB 4PBOA 3ZKUA 4Q4Y3 4IW3A 4E4HA 4H55A 4DRRA 3WW4A 4YM2A 4WVVA 1YIFA 5C9AA 3N7JA 5HI0A 2ZZQA 2RMU2 1H2MA 2HWF1 2QQWA 5JZGC 2YY1A 1VBC1 4LUMA 1AL22 3S0MA 3D8CA 4W6XA 3LFMA 3OPWA 4OHVA 2XJQA 4GIQA 2XG3A 5FZIA 5A3WA 5LK7B 2MHFA 2MNGA 5B2GB 2QQNA 5CU1A 2QQLA 3WG4A 5FO9B 4FXKB 4QQHA 1G9AA 1S0JA 2XVGA 1JYNA 3U4SA 2P3KA 3SC7X 4FP3A 4E27A 3OBZA 4S2FA 4CDUB 4K9SA 3VBOB 3EJKA 2DDUA 2Q8DA 2D7FA 3DGTA 2D40A 1S2EA 4JTNA 2VBPA 1SACA 3UGHA 2WNVB 2YYOA 4TSVA 3I2HA 4GH4A 2IXKA 4J6GA 3U11A 3MIGA 1QDCA 3NJZA 2WZ8A 1FI2A 3H7JA 1KRIA 1AXKA 4YFZA 1FATA 4RL7A 1TZOA 4B4RA 4E2QA 5A1AA 1MQTC 1NQDA 2EIEA 2GU9A 2RE9A 4Y1UA 4QAWA 5GLTA 4JVAA 2AGSA 4AVBA 1W06A 3POJA 5GM0A 4GZ9A 5SV8A 2PMWB 1LGNA 5T50A 4Y20A 1VBB3 5KHHA 4QPGB 5FYZA 1BBT2 4I2OA 4LO4B 2D3SA 1JOPA 2BFUL 2RHPA 1ND3C 2ZABA 3JD71 4Q4W2 1LOAA 1S0DA 4ES9A 4RFRB 4LE3A 4OHWA 1EV13 1UYYA 1VLNA 2J42A 3JBG2 3MGUA 3ROUA 3O1TA 4O9EA 4YARA 3K4AA 3NJVA 4AI3A 4QB2A 1WLTA 1RUH3 3JCIA 4IV3C 4IV1C 3E6CC 1IQDC 1E5IA 3WX5A 3J7LA 1SPPB 5B4XA 1GWKA 2VO5A 1UX6A 3WHTA 3PIJA 3ZDSA 3OEAA 4BQ1A 1EYBA 2ZX2A 1XPWA 3KHCA 1Y43B 1IG3A 1BMV2 4D7YA 3ZR6A 5DUXA 3S57A 1F5FA 3IIAA 2BFUS 4MLOA 3VZOA 2VZPA 3AC0A 5LY1A 4IESA 2ZEZA 5C8CB 2YHJA 4BIOA 5L7OC 4CCNA 3M1HA 4N90A 2RS31 1D4M3 4MGZE 4CP9A 3AMMA 1BLZA 2WC2A 1RUE2 4CP0A 1Q8QA 4OMCA 1X8MA 1PMJX 2DBIA 2WFF3 1YEWA 1XNKA 4XF0A 3VDDA 2J7MA 1OVPA 1CR7A 1S0BA 2E7TA 2CSGA 4E8DA 1WCDJ 3H3UA 3I2KA 1JYXA 4NIGA 4QPIA 4FPKA 1X7NA 1LODA 3O14A 3QOPA 1RUNA 4COZA 2AENA 3DYOA 5FPBA 5AC92 3ILRA 5FP8A 1JBCA 3GALA 3OD4A 1JXNA 2K9ZA 3KV4A 5CNAA 1DBNA 1J83A 1ZBA1 3M70A 4B8EA 3RMYA 1LTEA 5HCFA 3VKMA 2R1BA 4P9XA 2HH9A 5L73A 4EN0A 2K46A 4XBNA 4EE2A 4R9DA 5FP9A 4X6QB 2VMDA 4CEYA 4OI0A 3DKQA 4XQDA 1KITA 1VRH3 1UU4A 3IDAA 3J7HA 1ZZ6A 1RJ7A 3C7EA 4GWJA 2PN5A 4HT1T 5F6LB 3ETQA 3H1YA 4M3CA 1MS9A 3ZFGA 5JOYA 2OZJA 2FBEA 1H4HA 5T55A 2XJPA 3FN9A 2VMEA 5LASA 2GNTA 3HNMA 1W0PA 3ON7A 5FWJA 5GKAC 3NAPA 3ZFEC 3A21A 4P02B 5GLUA 4AI1A 4CTEA 3LWCA 5F2SA 1UX7A 2E53A 2BBAA 3VUOA 3CMGA 2WNOA 1UQXA 1RUJ1 5TSWA 3FLTA 3ENRA 4H3WA 2WWJA 3ZYIB 4C90A 4DUXA 1HV0A 3RGBA 3SLIA 2SBAA 4YRDA 1W0OA 3WDUA 5A33B 3OGJA 3WW1A 3V0BA 3B02A 4CEWC 1JOJA 3KD4A 2BZDA 4NWVA 4CXXA 3ZDVA 1ZBE1 1ZYBA 3LPGA 4DINB 4N53C 4RD7A 2O8OA 4QHOA 4XTMA 1YIPA 3A7QA 2DURA 3JQWA 2R072 3FX3A 5FRAA 1N47A 1VBE1 4YW1A 1YJKA 4D6QA 1QQP2 3A22A 3ACGA 3RZJA 4L11A 3VD5A 3A4UA 3O1UA 1QJX2 1CPNA 1EPZA 2WNEA 4AEKA 1WD4A 1W05A 5J09A 3FLPA 2ZGLA 4Q4V1 2Q1ZB 2UYBA 3CJIC 3J7NA 1YRZA 2W08A 5IVFA 1ULCA 1PIV2 4YW6A 1NE4A 1HN0A 2XLAA 3H42B 4ZS3A 4GH4B 1L7RA 1L3JA 5FXZA 5JSRA 2D93A 2YGLA 3FFZA 2O14A 3PVOA 4K21A 2IC1A 3CNAA 1UW8A 2XJVA 1GSLA 3AKPA 4Y20B 1AYN3 3KT7A 4UWDA 4XMAA 3NMBA 1W28A 1WLDA 3FMGA 3ST7A 2DCKA 3ZVXA 1FPN3 3OG2A 5CVRA 2ZMNA 3POBA 3LDRA 3AZXA 4HK8A 1MEC3 3MW4A 3NV1A 3AXDA 3K46A 5A80A 1Z7S2 1ALYA 4CU8A 1ZZ8A 5FZ4A 3VDBA 2QQOA 3WF1A 3W5NA 1EP0A 3LOBA 2OX0A 5FR3A 2VXJA 5I93A 1HB1A 3LEGA 1GV9A 2Y34A 1PMHX 4FPJA 4XW3A 1WCKA 4LBJA 4Q2FA 1ZRFA 1MS8A 2WWUA 1MS0A 2DCJA 3PTYA 3JUUA 2Z4FA 3IDBB 4W6YA 5FJHA 1W8HA 2CNAA 2DVGA 2Y6HA 3RVHA 3BVCA 3E5QA 3PMEA 4DUWA 1RUF1 4UT5A 4N7UA 4IERA 3E6DA 4NHKA 5C3OA 5DMYA 4I01A 1KS5A 1COV1 1E57A 1UXZA 4Y4RA 5EWSA 3I4IA 1DQ6A 3Q9OA 1SZBA 1YXWA 4C8DA 4EQVA 5F5IA 3VDDB 4GULA 4Q4Y1 2AREA 2D5FA 4HG6B 5K7PA 2VTFA 2PXJA 4D8MA 4QPIB 1LOFA 5FPVA 3MIHA 5LRSA 4OCTA 4A7YA 3T2TA 1AR63 1PK6C 3TNPB 3K4DA 1W6OB 1HB3A 2JG9B 3MICA 1T6BX 2HWD3 3CO2A 5F3GA 2YB7A 1XE7A 1O91A 2E7QA 1W9SA 1YFWA 1XB9A 1OPOA 4XBQA 2ZGOA 1PVC3 5JSPA 2A6ZA 3I2DA 2WBKA 2Y64A 1GMMA 2NMNA 2YG0A 5IVVA 2DCYA 3K48A 4YYOA 5KXBA 3UNPA 2C9KA 1NLSA 1RUD3 2ZGNA 3LA3A 3QACA 1XQNA 2P3IA 3I59B 3W58A 4QX3A 4X6RB 5A6QA 1LHOA 3OTFA 5FMCA 3MDPA 5I0TA 5IJRA 4DFSA 4K1ZA 4CCCA 3SH3A 3POSA 1H8TC 1RMU2 2WO3A 2ZJCA 2ZS6B 3T2QA 2Q1MA 5ANQA 3BU0A 4HANA 2ENRA 1NCRB 1QJY2 1GR3A 1S0EA 2YFZA 1DDLA 2WZR2 2O0OA 1Q43A 1XU2A 5KR7A 2J1VA 2B45X 4TYSA 3V0AA 2FDHA 1JU3A 1YYNA 1DFQA 5CISA 3WR0A 3IPVB 2Q8CA 2VL4A 3WDVA 4LO8A 4TZDA 2Q1FA 4AE2A 3PURA 4A44A 1R1A3 1VBB1 5D8AC 1ZNPA 1CPMA 1YO8A 3THCA 5LBEA 3V0BB 4UFIA 2ZAHA 1GP5A 1EV11 3O12A 5FTTC 3ZMOA 1F4HA 4GQ7A 1UMIA 4BZ4A 4BQ2A 2VZRA 1FAYA 2NLRA 3J26N 5FDBA 4KGQA 3LB9A 3LPFA 3MFCA 4YVWB 3FHIB 1RUH1 3D0SA 3ILFA 3VBSC 5K8SA 5GALA 5JOWA 5FZLA 1NCQC 4H2AA 1GBGA 4COUA 1V9U2 3IAQA 3TN93 3ZLIA 5EIYB 4JV4A 2WQZC 1CAVA 1GYKA 4Y5Z0 2D3PA 2OVUA 2DTWA 4C1WA 1BXHA 1V6KA 1C28A 1J58A 2HBUA 4FPFA 2D6KA 1LOBA 2UWCA 4L9BA 4BCUA 2B39A 5LA1A 3O0WA 1VE0A 3WCSA 2ARXA 3PHMA 4LUKA 4AEDC 4WM7C 4EYUA 1X8EA 3EQEA 3GM8A 1V6JA 5A7OA 4CUAA 1HDKA 3POWA 4MOAA 1D4M1 4IETA 3C7GA 1W6MB 3M3OA 2WFF1 5FP3A 1KGYA 1OD3A 1GOHA 3MLJA 2P1BA 4BOWA 4HLTA 4EN7B 4MGQA 2HWE3 2CAVA 4AGGA 3JZVA 2VG9A 4Q0PA 2QQUA 1SEFA 3D3AA 4WV8A 4YW3A 4Q1RA 3I2OA 1GZWB 1HRI3 4GWIA 4NWWA 3I3BA 2V5DA 2ZZJA 4I3PA 4QX8A 1MACA 1VP6A 1QU0A 2ZAAA 2V73A 3FC0A 4XFAA 5BUVA 3ORJA 4KU7A 3AKSA 4FOWA 4N9IA 1QKQA 2DV9A 2ZMLA 4CXWA 5CFCA 4LITA 2A6VA 5DPNA 3OGSA 1YFUA 3M3IA 2PAEA 4LHKA 3AX4A 2CAUA 2WT2A 3NRUA 4I02A 4NOTA 3WG3A 4DXSA 1HJGA 2J1SA 1SLLA 2G1MA 4JRLA 4MGKE 4XJUA 4BWOA 2QZ3A 4GB32 5JCTA 3H3ZA 2EXHA 1S2BA 1SMVA 1MZEA 4P5YA 4CCLA 2KA3A 2P3YA 2YXSA 2XBO3 3VZNA 5CG9A 2LS6A 5APAA 4FVVA 2JICA 1OPMA 2BPA2 1HB4A 5K0UC 1JZ8A 4QD2A 1HB2A 3KV6A 5CA6A 1W90A 5IK4A 2ZOEB 2Y26A 3GF6A 3VBUA 2MEV2 2A73B 4K8FA 1PGSA 1SLCA 4HSJA 1DQ2A 4Z8BA 1UU5A 1US3A 3DXUA 4AVCA 2AH2A 3ZOIA 1AR92 2D97A 2E32A 4YW2A 1RJ8A 4AVVA 3AVSA 2R30A 1A3KA 1ZZ7A 4IEQA 5IAXA 1PO22 2N7GA 3JB8A 2DTYA 2A3YA 2ZHMA 2PHLA 2XONA 4TLGA 3KCCA 4K7JA 1GU3A 2ZGKA 5L9RA 1HN1A 3MIFA 4QT6A 3WNMA 2B46X 1LULA 4IEYA 4JQRA 4LO6B 5CADA 3Q8EA 4PBPA 1LKNA 4WVWA 4E9KA 5ACA2 4DO0A 3IN9A 5T54A 4BE3A 1BEV3 5CKQA 4QXKA 2XHKA 1K3IA 1QF3A 5EV7A 4TLFA 3VL9A 4RHV2 2ES3A 2F17A 4IEZA 5FKCA 4XF3A 1STMA 2XL9A 3J9SA 4L2NA 1PO12 5CFDA 4NPRA 4JKMA 4EWAA 3LQCA 4IGOA 5IVEA 4XUNA 1GKBA 1KS4A 3N9PA 1NQJA 2PHDA 2VR4A 4LKDA 4BXFA 3FE5A 2R7EB 2EXIA 1DZQA 2R32A 2XR4A 3HOBA 1GZTA 5FPXA 2PFWA 3BTXA 3NSTA 3B69A 3V0AB 1O5LA 4KH9A 5FQ0A 1OHFA 2EIDA 2WQ8A 2X5IC 1R083 4OZOA 2WNUC 5JSOA 2V4AA 5JMOA 4FSJA 4BQ5A 4PDWB 2A6XA 5L19A 1AL23 1AYN1 3ZFFA 2GN3A 1HRV3 1CIYA 2RS12 1FPN1 1REFA 1SDDB 1IKPA 2UURA 4IXLA 4WVMB 1HKDA 4CDWC 1MEC1 4LBLA 5FO8B 3OEBA 1YUDA 1TMF3 1O3SA 3I8TA 3UKTA 3BTYA 2DU1A 2B8MA 3PDQA 2VQ0A 1BHGA 2VCBA 2BVVA 4N43C 1DG6A 2JB4A 1QWRA 4GKYA 5I8YA 2W94A 2ERFA 2ILMA 3MIEA 4M00A 2H0BA 1AX1A 2Q8OA 1QJU3 4QWNA 1CAVB 1NOVA 3LDBA 1SLAA 1NA1A 1MQTA 1F31A 2C5DA 1NZIA 3ZIXA 3OGVA 4BQ3A 1OT5A 3WP4A 3OJBA 4OUSA 4G9SB 2VMHA 3ZXLA 1N1VA 4XETA 1VBA2 4J1XA 1N1TA 4QPYA 4GWMA 3PUQA 4URTA 4HMZA 1PNGA 4EZ4A 2ZTNA 5C3SA 4CVUA 3Q8FA 1SCSA 4U2AA 1Q5OA 2BBVA 4XOGA 1XSQA 1VB2A 1BBT3 2Y38A 3AMPA 4IV3A 2JDNA 2OXBA 1RL3A 4NROA 1OD5A 1KDMA 1CX1A 4AYUA 4RS5C 2GN7A 3JBG3 1O4ZA 2W87A 1RC6A 1AR61 5F6KA 2HWB2 1VIWB 1XRUA 2FMYA 4BPZA 4BU2A 5KBFA 3WOGA 2A1XA 2HWD1 3KMHA 3ZXEA 2F6BA 3F2ZA 2WO1A 3LKJA 1LENA 1PVC1 1VRBA 2GMEA 5FYBA 4P14A 1PM4A 4NPMA 4R4XA 1JYVA 2EXJA 2LRPA 4UW4A 2I07B 4IEOA 2WDBA 5GLWA 1RUD1 4A3ZA 4FPEA 4MZUA 1VMJA 1C1LA 2RJKA 3MI8A 3VBOA 5DUVA 1ENQA 2HEYF 1TME2 2QJVA 1XBFA 5I0UA 2BP6A 1NAEA 5FYTA 1LEMA 4LO7A 5FZ3A 2WN3A 1RUE3 2VNRA 3ALQA 4KNCA 3PIGA 2VUCA 4XURA 1YNAA 1O6UA 3E6BA 2WAAA 1JMUB 2ZBJA 1UO9A 3AK0A 3AL6A 4OUMA 4RSUA 4XAEA 4FP2A 4ZU4A 2CWMA 2QNKA 3Q8BA 3AP5A 2P5BA 1PGL2 3OUHA 2VMGA 1GQHA 4LPLA 1JU4A 3VBUB 2WINB 1R1A1 4QPGA 1W2OA 3OOXA 3R4DB 1OC1A 4QDRA 3ZXAC 4PQQA 4CPBD 2R49A 1W6QA 4LA2A 4QU2A 3UK9A 3WUCA 5EYYA 5T52A 1FMD3 1NY72 5EFUA 3VL8A 2RDNA 4W6WA 2PTMA 1S0IA 1O4TA 3O1SA 3ZSMA 1EUTA 1KFUL 2NYYA 3J8F2 4JGZC 4CCEA 3AP9A 1IHMA 5HCBA 1UOFA 5ABJC 4JGYB 1SG3A 5C5UA 2WKKA 3ETPA 4JC1A 1SPPA 3HNBM 3TN91 1RINA 3ECQA 1NZCA 2P17A 3B00A 2ZHKA 5CYYA 4UAPA 2ZKNA 3P6BA 1TVGA 1H2NA 1JTZX 1SFNA 2BERA 3V65A 1DYKA 2C26A 5C8CA 5JXJA 1QOSA 3OUIA 4META 1QXRA 4QQOA 2FDKA 2W68A 1EPWA 5IWFA 1RIRA 5LRRA 1S4CA 3DKWA 3SCGA 3TAYA 4MYEA 5FYYA 3CIHA 3UETA 3TEWA 4RN5A 5E1RA 4WM8A 2FCVA 2HWE1 2RJLA 2WS93 1APNA 4BK5A 3TBDA 2DFBA 3PMSA 5A3NA 2FQPA 5A32B 2HJIA 1AX2A 3WQ7A 2W9XA 1DYPA 2QQKA 4KWUA 4R9AA 1HRI1 1U5IA 1K45A 4IE5A 1QNYA 3OYWA 2JDPA 2R073 1D4VB 2R0FA 5JR7B 4MG2A 1PGW1 3DPRC 1Q3EA 1QJX3 3ZYBA 4YW7A 1J3PA 2HWC2 2E33A 3T4VA 1BQPA 1BJQA 3ES4A 4P9YA 3T4HB 1MQTB 2H6BA 5FPUA 4FCAA 4JZRA 5LA2A 1PIV3 5F1RA 1UPIA 1MPXA 3AB0A 4Q5OA 5A7NA 2JENA 4XJAA 3RZHA 2BNOA 4K6BA 1S0GA 4MHRA 5E6HA 3UV9A 3ATGA 5LEJA 5LATA 3U4XA 1ND3B 1VBC2 2IXIA 2XBO1 4QXBA 3WW3A 1MVEA 4NRQA 1FX5A 1YQ6A 3H0OA 3HQRA 4Q8LA 5EYXA 4GAZA 5JR2A 1GP6A 4IV3B 4IV1B 5F9TA 5BV6A 4E4ZA 1ZREA 1KD7A 5A33A 5HXMA 2ZXQA 3WNPA 1OKOA 4QGLA 1LU1A 1QOTA 1W2TA 2OZ6A 3BYWA 3KT1A 3V56A 4A7ZA 3KCXA 4AGRA 4NIHA 2DCTA 5A3LA 1VR3A 5FXWA 1WLCA 3WCRA 2X8KA 1I1EA 3RS6A 5FV3A 2ZGPA 3SMHA 4CYDA 1PMIA 3N3HA 2JDMA 3R4SA 3L2HA 3ZPYA 1YJLA 5FPLA 3VBFC 3RQ0A 5L7OB 3FJSA 4LT5A 5JIAA 3BKZA 2R062 2RDSA 4P9JA 1BEV1 1VAMA 5FMBA 1W3VA 4MX3A 2JWPA 3SKJE 1WCSA 2XMLA 2E6VA 4LBOA 2BU9A 1SCRA 1LHNA 1OH3A 2X53S 5FYSA 4AVSA 2WA4A 2XDVA 2Y6GA 2VNGA 2XWJB 3QCWA 4DXTA 4F83A 5CIRA 1V6NA 3LF7A 3JD72 2ET7A 3FL7A 2X10A 2ZEXA 4XF1A 1TNRA 3D82A 4OYUA 3WP6A 2Y0IA 5KHKA 2YZ4A 4XJ8A 4XMIA 3WINE 3H9AA 1DU3D 1V6OA 1RVF2 1XYNA 5KWRA 2VZQA 2DF7A 1R081 3VV1A 5FXXA 3DYMA 4QHBA 2Y0OA 5DAXA 4SLIA 1AL21 4CCJA 1WW5A 1HRV1 3CL1A 1W6QB 2GNDA 5DN2A 3MLKA 4CE8A 2Y6KA 2BYVE 1QDOA 1ULOA 4YW5A 5FBZA 5BNNC 5J1XA 2DVBA 4XCBA 4COYA 1DIWA 1TMF1 4XUQA 5LBBA 2Z79A 1ULPA 1UY4A 4OUEA 1BZWA 1UKRA 3VD7A 1EAH2 3KGZA 5CKMA 2RS32 5J37A 1DZRA 1CD3G 5DZGA 2H0VA 1QJU1 2P3JA 2JKXA 3ASIA 1ZZ9A 4LIVA 1DQ5A 4AFMA 1LJ7A 2V4VA 5FY8A 3RSJA 1YLLA 2OPKA 1Q8PA 4P9LA 4ITCA 4XACA 4YSFA 1ONAA 3NKGA 1QJY3 3VBHC 3CQOA 1CAUB 5DAWA 5AVAA 3ZYHA 1RITA 4FTEA 2GC1A 4CEWB 1WW6A 1YCIA 4HK9A 3UT0A 1Q56A 2GC0A 2XL7A 4LE4A 3IZOA 1ZBA2 2QFEA 4N53B 2R043 1BBT1 1HXS2 4WM8B 3E97A 2E63A 3K3NA 4LKEA 2VD7A 5FK7A 5CG8A 1YI9A 2DVFA 1YFXA 1NCQA 4DEVA 5A3UA 2O8QA 3HD8B 5F39A 5A3OA 2D6OX 2FDJA 2ZEWA 3JBG1 3FFQA 1UY1A 2IXJA 1W6OA 2HYKA 2RV9A 2VOKA 5KHGA 5DABA 1CWPA 2JG9A 2JDAA 1JI6A 1R093 3OYWB 5C9AB 4D0QA 5A70A 3C7HA 4Q4X2 4Y1ZA 1XSRA 1UF2C 1GQPA 3WDTA 5GLZA 2YGMA 1UIKA 5I91A 1PHMA 2QQMA 4NN0A 1BMV1 4H7MA 3I59A 4FTSA 5D1IA 3PU3A 2NM1A 4AK3A 2XGXA 2VNOA 4QB1A 5FIXA 2OUJA 3UKVA 3LD8A 3P3NA 4D69A 4RFT0 4QX1A 4HL0A 1OOPC 1UD1A 1Z78A 1O4YA 2JG8A 2XJSA 4XFBA 5F8PA 4C1XA 5JVVA 5F32A 1RUE1 2D6PA 1NCRA 3ILNA 2EALA 4AAXA 3RJ2X 1POV3 2TBVA 2LW8A 5A7WB 2ORXA 1NX9A 2QCSB 1SFPA 1UYXA 3I2GA 3IPVA 4GWNA 1VBD1 3KZ4C 4O7XA 4FBFA 1N1SA 3T1MA 4AFBA 2DWRA 5JLVA 1UKGA 4AQTA 4I30A 4CDQC 3PJQA 4TN7A 4QM8A 3IAPA 1FMD1 4PI0A 3VZJA 3QH6A 4AQ2A 3C8XA 1Y4WA 3MYXA 1UOBA 4QQPA 4P9GA 4ARXA 1FNZA 1Y7BA 3SXWA 5LA9A 3U37A 1W8OA 4UI9L 4XCAA 4YVWA 1DQ4A 5C3PA 5LW9A 2RR12 2VUJA 2V09A 3R4UA 4YZ3A 1U5XA 1JN2P 3B5LB 5I0DA 4LBQD 3PVNA 4YPJA 3L2YA 5DDJ1 3O1RA 3LA7A 1AYM3 1CQ9A 1XNTA 1YQ8A 1SQ4A 1ENSA 5LY2A 5HCHA 1WA4A 3DECA 2VULA 4QKDA 3ZXDA 2VVFA 4GJZA 1V6IA 4LLFA 4PIYA 4NR1A 3DUIA 4CUGA 3GJAA 1W6MA 3OY8B 1QOOA 4EZHA 4JDOA 3ZO0B 2VPVA 4Z1VA 2CDPA 4XIKA 5L9BA 1AVBA 4KWLA 2WS91 5GZGA 4CSWA 2P6HA 4MXWA 4N8MA 3WXPA 4ZONA 4D3WA 4Y3OA 3INAA 3KVAA 4YVSC 1VPHA 3TYJA 1O8SA 1ND2C 1GZWA 1PO23 2HKXA 2WJSA 3PNAA 3VDCA 4Q29A 1J1TA 5JOZA 3LE0A 2GMMA 4ISRA 3WT3A 1SBEA 1ZX5A 5F3CA 2CY6A 4PQ9A 2R071 1YQ2A 2PLV3 3RZGA 1H8TB 4Y22B 1MZ5A 4AHXA 5C4WC 1O5UA 1QJX1 3ES1A 1X9PA 4OULA 3AZWA 4XUOA 3WHUA 4RHV3 5IVCA 2FZ2A 2XXZA 2WUHA 3N9LA 4PF1A 3KF3A 1HQWA 5JPNB 4Q4Y2 2X5IA 2P6CA 1PIV1 1HW5A 1MS1A 1QNWA 2ZGSA 2BEOA 3ACLA 5FPAA 5D8AB 4YGDA 4DPNA 3KLSA 3SNMA 4DMIA 1JYWA 1WMFA 3KM5A 1US2A 3I97A 5FPZA 1CIWA 3U14A 1O59A 3GGLA 4QXHA 4R52A 4XYXA 3OBAA 2CGOA 1OQ1A 1SLTA 5C9AC 3VD9A 3VBSB 5CEHA 4FO9A 4D6SA 4B1MA 2RS13 2C6SA 1AHSA 2Q0AA 4RQPA 1NCQB 3IWZA 4NVPA 3S30A 1G86A 1N1YA 2LUWA 4FFGA 2EICA 3SITA 1PVXA 1UYPA 2IXLA 4BLIA 2UY8A 4CRQA 4YZ2A 2WFPA 3N7KA 4PHZA 5E16A 3U75A 2OUHA 1OVSA 1HJFA 4AEDB 4LK6A 1ZZCA 1LU2A 1QH7A 4WM7B 3MBWA 5KHIA 4RYDA 2PQQA 3M3QA 3P5BA 4EJRA 1CJPA 5C3QA 1F4AA 3B01A 4PLNA 3V64A 5F37A 1JZ4A 5F3EA 3WNOA 1WMDA 3BODA 2WZPP 4CP1A 1UNBA 1C8M2 2DUQA 2CWSA 4F7ZA 4CXYA 5ISLA 2W92A 1JHJA 5GZDA 3DF0A 3O0VA 1VBB2 1W8WA 3GHMA 2JG8B 3J4UH 4RS5A 3TNQA 4NJ4A 5EPAA 3FHAA 4TWTA 1D2SA 3M3CA 4ORFA 3VKFC 1AR72 1EV12 2VUAA 2XLGA 3CDZB 2D6LX 4QB6A 4UFLA 4CU7A 1GQGA 1CX4A 4OQ8A 4NHXA 2EXKA 4Q0QA 1LOCA 4RGGA 1JYTA 1VALA 4PI2A 5IVYA 3UYJA 1H4GA 3HVDA 4PDWA 3RWNA 1UCXA 3CF6E 4CPBA 4WVMA 1W99A 2Z69A 4AHZA 4MHUA 1ZVFA 4LHSA 4A2UA 2J22A 2ZGQA 2AUYA 4COVA 3WF3A 5BPXA 1W8UA 2PYTA 3AL5A 2ARCA 1OH4A 3POGA 1NE6A 3AMQA 1I5PA 5LWBA 4I3GA 4QHZA 2WYFA 1TME3 1XNDA 4NUBA 4KWKA 5F5QA 1S2KA 5K0UB 4OVEA 4AI2A 2W52A 2D43A 4Q1PA 3BGAA 2VZ1A 4MVTA 2QQVA 1QJY1 4EV0A 1I6XA 2J1AA 3K3OA 4ARYA 3O1VA 3VBRC 1W9FA 4CUBA 2FDIA 5SV5A 1OFSA 3KB5A 5FUPA 4XHXA 2I74A 4YZ5A 1CZSA 3MV11 5JXHA 3RDIA 3PJYA 5LA0A 1IS5A 4A3XA 2R041 4QPIC 3A0NA 4NAOA 5ANNA 4MH0E 4MXWB 2R6QA 2G4IA 1DYOA 4UYBA 2PHFA 1NUKA 2CYFA 5GZCA 5IATA 1GFF2 1NXMA 2KR2A 2DUOA 5FYHA 3J8F3 2J1RA 3AMNA 1ASJ3 3URFA 1R091 2OQ7A 1GLHA 4BMEA 2FDFA 5FK8A 2VZ3A 3ZX7A 2OYZA 3CLPA 4COWA 1POV0 2LM3A 4AQSA 2FD8A 2VAUA 2VVEA 3ZSLA 4LQRA 1QH6A 3AZZA 4CEYC 2JE9A 4PJYA 1E5HA 3O0XA 1TQ5A 4XEZA 5A7PA 5CFCB 3I49A 3PL0A 4HKLA 5CBLA 1UZZA 2ZMKA 5LBFA 4UXAA 4A7KA 4KBZA 4XHBA 5DUWA 5FZ0A 1VRH1 4LBMA 1OI6A 3RJRA 3ZFGC 1S0FA 2XJRA 5E88A 2YROA 2X5IB 4OHYA 1LNSA 1RHI2 1O8PA 2WNUB 2QVSB 3NAPC 3BTAA 1RUI2 2G9FA 3ZXGA 4DUVA 3LZZA 2W91A 3Q8AA 4FOYA 1V00A 2G9GA 1AJKA 5G04L 2H6CA 2KXLA 1POV1 5FP4A 1ZRIA 3WG2A 2DFCA 1MS3A 1WZXA 1J84A 3DPRA 4N43B 5L9VA 2PHRA 3JB4C 4LOTA 1O3TA 1S1AA 2C0ZA 3LEMA 4RQPB 4YM1A 4A45A 1XYPA 4IDZA 3C7FA 5J48A 1Y3TA 3CZJA 3DV8A 2FDGA 3CU7A 1QXPA 4FFFA 4PIXA 2TNFA 1YWKA 4NRPA 2IWGB 3H3LA 5E8AA 4FFHA 3MW3A 1RUC3 5JDBA 2WO2A 3B3QE 1AZDA 2NMOA 3U1XA 1JZ2A 1MS5A 1PNFA 3POYA 2XUMA 2HWC3 4JGYA 4HKWA 4NE9A 3KSCA 2VZVA 5JAXA 2AZ5A 5JIUA 4L92A 3RYRA 3N9QA 3THTA 1A6CA 1GOFA 2WSUA 4NIIA 3BU7A 4AI0A 3MZHA 2WWSA 2X09A 3N4MA 1U12A 4KG8A 3VD3A 1NT0A 1WGPA 1AYM1 3APBA 1K5MC 3VLBB 3ZN6A 4R9BA 4ZKTB 1VAKA 4WZFA 1AYN2 4MADA 2NPIA 5JZGA 1H8VA 4RS5B 1YQCA 1DGWX 2RM22 5FZ9A 1ZA4A 3B7MA 5DXDA 2QKDA 2OKXA 5BYNA 1IS3A 3WVJA 4YM0A 5H9PA 1MEC2 3NJXA 4YGBA 4AEMA 5LCWL 4QX5A 1CONA 5L36A 3OB8A 2RMU3 3VBFA 2VBDA 3GBGA 2EA7A 3TEZA 3USUA 4Y1XA 5A32A 3UGFA 4YG0A 1PO21 1YQ5A 1FOD2 5FZCA 5HXVA 1JUHA 2W5FA 4QQ2A 2FMDA 1JS9A 4Y33A 5FZMA 1NG0A 4MGTA 1XU1A 4XZUG 1UOGA 3W20A 1QHDA 4AHWA 1T6GC 2UU8A 3GYDA 2PLV1 4C0BA 1DP0A 4IEWA 3FBYA 2XQRA 4FPGA 1AXYA 3CZUA 4ZY9A 1GWLA 5J7MA 1TEIA 3HMYA 4LLOA 5FY1A 5K4LA 3ACIA 3K4ZA 2R063 4NO4A 4O65A 2GP3A 3WF4A 4BA6A 1X33A 5BNPC 1UMHA 4XVHA 5GJ6A 5T5LA 3WDXA 5DUUA 2P2KA 2GH8A 3M2MA 4XAAA 2VGDA 4OHXA 3VKNA 1LHWA 2Y6FA 1IPSA 4M4RA 5EHDA 4ZZ5A 4B29A 3FUQA 3VHNA 1HX6A 2VOVA 1ND3A 3ACHA 4NRMA 5FY4A 1AR62 4UW5A 1HLCA 1RVF3 2Q5TA 1K5JA 5FZHA 4QM9A 5F5CA 4B3NA 1JH5A 1PX4A 1B35C 2K0GA 1W8NA 3M8LA 3BCWA 3WY6A 3KV5A 4JGZB 4EN9B 1PVC2 2O1QA 3N35A 4IV1A 1PZ7A 5ABJB 1ZRCA 2RS11 4CUCA 4Q4W3 3R0RA 1RUD2 1DZTA 2CTVA 3WDWA 4JHTA 2WT0A 1G9CA 2VTXJ 5FREA 2VCAA 5DG1A 3MF9A 5FYVA 3U10A 1LECA 4XILA 2Q30A 3D5OA 4L0PA 2YC0A 1CAWA 3PU8A 3WP3A 1EAH3 3WUDA 1OLME 4M01A 3KWVA 1UAIA 4S2HA 3SH5A 3GHNA 2E31A 2YFUA 4E8CA 5L7OA 5FZ7A 1J59A 4BISA 1JOBA 4NPLA 3CBNA 2ATFA 1JYIA 1KDKA 3A0KA 3AZYA 4XFHA 1GZCA 3GZAA 2ZX1A 3RG0A 3SQOA 2B9VA 1R1A2 4DQAA 1QGLA 3F95A 4LKFA 3NQHA 3SHRA 1PM7A 2K2SA 4B1LA 1BVVA 1RUG2 2VECA 4K8RB 1ZBA3 2EF6A 4TXWA 4HVRA 2AEZA 3H50A 4CCDA 1CAXB 1HXS3 3AP7A 3RZLA 4G3YC 4YZ4A 3VKLA 4EROA 2OPWA 4Q26A 4DOUA 2RDRA 1O3RA 2JDUA 3IKWA 4FI9A 4N7IA 3E5UA 5FUIA 2JE8A 3DPRB 2VZTA 3BIEA 5AC93 2Y6LA 4LTAA 2QE3A 4Y24A 1H9PA 3I3QA 3SCFA 2C9AA 1CZTA 1S55A 4Q4X3 1CN1A 1Y9MA 2BVBA 1V6MA 2JKBA 3OD0A 4P5HA 2ET1A 1DLLA 3RFRA 4RR3C 1H1IA 2DYCA 4XQWA 1X50A 3FLRA 4QKFA 3MPBA 4UBHA 2DCZA 5I0RA 3ZFEA 1IS6A 2OA2A 5IVJA 3H8RA 1LESA 1TME1 2E7AA 5FY0A 3RYKA 2QUOA 1EUUA 4ZXEA 2P4EA 5AFEA 4LBQA 2YV8A 1UPSA 4LOSA 2CGNA 2HWE2 3ZN6B 3W5MA 2CV6A 3OSDA 3MFAA 1WBLA 3VZKA 4DY3A 3PUHA 1FYUA 5JZGB 1GZ9A 1CAUA 4D6RA 4CEWA 1UXXX 4ZXKA 1W2NA 1Z0HA 5E89A 3VDAA 1WMEA 4Z82A 3AZVA 1ACCA 3NJYA 5FMOL 2RS52 2W1UA 4N53A 4X8PA 5A3TA 4FQZA 4XF4A 3THPA 3AYAA 3EMRA 2QQPA 3VBFB 1IOAA 5BNOC 3EXUA 1KQRA 3USUB 1LB2A 4FQ4A 1GNHA 3GJBA 2JJ6A 1NY71 1KXGA 1RYYA 4NMIA 3LA2A 1IGOA 1LOEA 3AFKA 3D0JA 3J8F1 1ASJ1 2RR13 2ZGUA 1AR82 3CJIA 4O9GA 5DAVA 4M4PA 1GP4A 2IFWA 1QQP3 4FPCA 4JDMA 5FY9A 5KXDA 4XJZA 3BALA 5I8TA 2D5HA 2DUPA 2XJUA 5CFCC 1J1LA 2W39A 2XB6C 1FV2A 3IM0A 2I45A 4JKLA 2XBO2 5FMOS 5A6YA 5HV4A 4Q27A 4ZS2A 3CJXA 2OW4A 3I3MA 5FZFA 3BTZA 1RGSA 2JEMA 1OA2A 4ASMB 1P8JA 2PA7A 2ARAA 4QKBA 4NIAA 4URAA 2Y60A 3KCYA 2EAKA 4YVSA 2HWF2 2VMCA 3M7AA 4JHZA 1ND2A 4HSLA 1AL0G 3HQUA 4G4FA 5BNNB 2GH2A 2WR9A 5DQ0A 3ACFA 4Y5SA 3MLLA 2GSYA 2WRAA 3JQXA 5A7WA 3RNSA 1XOYA 4JDNA 4UFJA 3T08A 4IEUA 2PAKA 5I0SA 3BPZA 4Q0VA 3LDKA 4QDSA 4EWDA 3IDCB 4L99A 4FPHA 4WBBA 4HKOA 5C71A 1A8MA 1Z7S3 2WZEA 5FY5A 4Q0UA 3GXUA 3MIDA 5IK5A 3MUY1 1RUC1 4NHYA 3LGRA 4OZXA 1CAWB 2BGPA 1G9FA 2A6YA 4HONA 4DIQA 4AVAA 4CDXC 2HWC1 1DF0A 4KBBA 3Q8CA 4J1WA 3ZSEA 1RTVA 4K20A 1N3PA 4WVZA 5HBAA 5CKNA 5FOBB 2QBXA 2A3XA 1KJLA 2NP0A 5CFDC 3QD6A 1R082 5LK5A 1V0AA 4LEJA 1UZWA 3S6PA 4H7LA 2ARBA 4OI1A 2AR6A 4GKXA 4WZCA 1HRV2 1O3QA 3N7MA 3CEWA 1PK6A 1WKYA 5FZBA 4E2SA 3ITQA 4JRAA 2JDHA 4BQYA 4W8JA 3HEIA 1XYOA 2HYXA 3C7OA 3GNEA 3OY8A 4AZZA 5A1LA 1TMF2 1G6NA 2J1UA 4XFCA 1ULEA 3VZLA 1IKQA 4CU6A 5JUVA 1LAJA 2BGOA 4I0BA 3ZFFC 1MS4A 3ZPOA 2OIIA 5DAPA 2RMU1 1T2XA 3K77A 3S5QA 2VXRA 2RVAA 3E5XA 2AC1A 2CDOA 4XBLA 4MGSA 3USSA 1QJU2 2J1EA 2EIBA 3LIGA 1I9RA 4D7TA 4BMBA 1MVQA 1DGWA 2VMFA 2VCMA 2ZX4A 3O1OA 5K9YA 2EVXA 5A6XA 3N36A 3T09A 2VOTA 1DGLA 4LBKA 1RB8G 4XABA 1OOPB 1PZ9A 2ZA9A 3B9IA 3RZZA 3WNXA 1WLWA 1H8TA 2YC2A 4Y22A 5T5OA 2VY0A 4OMDA 4BQXA 1C5HA 1VAVA 2R061 3ELNA 3IT8A 1NA1C 1Y9QA 4XJWA 5CB7A 1C8M3 3ZFEB 1JZ6A 3VD4A 5BXXA 4S2DA 4RGKA 5IFPA 5FZEA 3I7DA 3UKNA 4LBQB 4ZU5A 4YW4A 3HN3A 1RMU3 2IXCA 1UOJA 4M0HA 3WNNA 1OLRA 3LFIA 4HFSA 4S2GA 5D8AA 1KFXL 1UZYA 1WUVA 3JU9A 2WZR3 2CHHA 3D6EA 1AR73 4CDQB 3UJOA 3WG1A 4BLJA 1BK0A 3E1F1 5JWPA 1W03A 1RVF1 1SLIA 4HPKA 4UFKA 4AFDA 2F4PA 1C8NA 4A41A 4UBGA 1F5JA 1W8FA 3VBSA 2BNNA 4XE9A 1SBFA 4C0HA 2IUWA 5FFOC 3SKVA 3LSDA 2QDRA 4PCRA 4PLOA 1UZVA 4Q4W1 4AI8A 4KWJA 5FY7A 1D0HA 4HVQA 2ZEYA 2ADEA 4QMAA 2WN2A 3ZMNA 3B94A 3BOPA 1YFYA 3DL3A 4QU1A 5F2WA 3EYPA 3CJIB 2HLEA 4I0WB 1EAH1 4L8QA 1V9U3 5FLJA 4Y1YA 1WD3A 2VZUA 4HN0A 1SFYA 3M3EA 4AEDA 4WM7A 4CDUC 4UOJA 1R1ZA 3HN1A 3VBRA 1H1AA 5G05L 1O7FA 2FZ1A 2VOWA 3POIA 1WBFA 4YG3A 3VBOC 3RZMA 2KM2A 3KVBA 5GLVA 3AP6A 4MXVA 4LHLA 5CZKA 5IHRA 5EJ3A 2WNVC 2LALA 2VNVA 4P9IA 1VBD2 1RUJ2 4ZPIA 1OURA 3WP5A 2YUEA 5DAQA 2YU1A 1Q8OA 4YVSB 1VMFA 1X36A 2XKPA 3ZYPA 4MGIE 1ND2B 2BTVC 5A3MA 5LZ6A 5JXGA 1FMD2 1OUXA 4B7EA 1HXS1 1JW6A 2JD4A 1ZBE2 2WO7A 3OBRA 1ZZBA 5EXOA 2ZPXA 2XQXA 4QPGC 4A6OA 3OUJA 1H0BA 1NKGA 1VBE2 5C4WB 2PHXA 3ZXFA 5AC91 5JPMB 1D7PM 3GZEA 4FT8A 4MGYE 3VKOA 5GZEA 4FAGA 5CAZA 1A34A 5DDJ2 4Q4V2 4Q4X1 2UYAA 4INDA 1OF3A 3AVRA 3HWJA 1R64A 1SHWB 1UY2A 2CL2A 4LULA 3AYEA 3T2PA 3BB6A 1I5ZA 2E9QA 2HEWF 3CKHA 1AF9A 4XXAA 2WLQA 3RMXA 1OF4A 2VBBA 3ZSJA 1OFNA 2D98A 2JECA 4AL9A 5A1FA 5T5JA 3VHOA 4XQ4A 4AEJA 1ZM1A 3DN7A 3OPZA 3H8UA 2VZOA 1RHI3 4ONUA 3AYDA 4XF9A 5DG2A 5K0UA 4GB33 3ZXJA 1RUOA 1U0AA 1X82A 1U5ZA 3B9CA 3P1IA 3T2OA 3UGGA 4F3JA 5C8CC 2WS92 3OGGA 5FAXA 4P9WA 1RUI3 3BN6A 4FOQA 5FYIA 4FAHA 1B09A 3ZIWA 5KC5A 5EJZB 4XJ9A 2TUNA 3P3PA 2A5ZA 4GMP3 1PK6B 3X29B 1FXZA 4DNYA 4WM8C 4HETA 3VHPA 2V72A 3NV2A 2HBTA 3WDYA 3NNGA 1C5IA 2MEV3 1ZA7A 3WQ0A 1D2QA 1TE1B 4XDPA 3K51A 4AGVA 4BJ0A 1OUSA 1OXCA 1AR93 1SDWA 4SBVA 4YWAA 3I3EA 4O61A 5H9QA 5IT6A 3O1PA 1CESA 1F35A 4LK7A 3ZXKA 2VOXA 4AWDA 4AHYA 4CP2A 4FTBA 2W1QA 3W21A 1K5MA 1X9TA 2RR11 4KL1A 1RUF2 1BCXA 4IL7A 4LNVA 4DXRA 5AFBA 1QQP1 4RGAA 5IAVA 3NNJA 3NO8A 2P34A 5ACA3 1COV2 3AKTA 1I3HA 1CJDA 2AACA 3DXTA 3EO6A 4GD4A 1IS4A 1MZ6A 2B42B 2OT7A 2ZACA 4KQ7A 4QXCA 4KG0A 2B5HA 1OQEA 3CHXA 1PO13 4OLLA 5C6CA 1HV1A 3MUZ1 2B4KA 2C24A 3SCHA 1LGCA 1U5YA 2WNUA 3N9NA 4RA0A 2RM23 1F2NA 3OF1A 3SEPA 1WMXA 1HQLA 1N3QA 4UF0A 4W50A 1ZRRA 5DZEA 4AOCA 2NQYA 3IB3A 1W04A 1BK1A 2YBSA 5FLHA 4CDWA 4A4AA 1VB4A 2OS2A 4LO5B 2IVJA 1QXJA 4HPKB 5KXEA 2B7YA 3VN4A 3LAGA 1V6LA 2R0HA 4N43A 4Z07A 4AI9A 3HT1A 1C57A 1E5SA 1FOD3 2BOIA 3KS7A 3NV4A 2XUEA 4MO3M 4V2WA 4QKNA 4C91A 3OBTA 3AFGA 3RZKA 2WA3A 2YDEA 5BNPA 1Z7S1 1QEXA 2JIGA 3NKTA 2IFRA 2UY9A 3HNYM 3HR9A 3MHZA 3W9AA 4XUPA 2ZGRA 3H1MA 2MPFA 1URXA 1UL9A 2IZWA 3IMMA 3WSOA 5C7GA 2GALA 3HT2A 5HCAA 4CP9B 1K42A 1DQ1A 4QPWA 5FZOA 3THDA 3FUOA 5FLIA 3VBRB 5FYCA 3UESA 4GJYA 3SISA 3AKQA 3R05A 4GA9A 4CCMA 3WNLA 4CZSA 2IXHA 4ATEA 1B35A 3GBFA 4K1YA 2ZCWA 4X8NA 1VBA3 4B4QA 4CCOA 2X29A 2SLIA 3KHBA 4GH4C 5IK7A 2GMPA 3HBZA 3NNMA 3NVCA 1E5RA 3ZN4A 2D6MA 1LCLA 1M4WA 1OLQA 1ENRA 2WIIB 4YGEA 3VZMA 2A6WA 4FXGB 2RJ2A 2PHTA 3BPSA 3KGLA 5FBJA 4M3CE 2VW1A 1QMJA 1ENXA 4XPVA 4EWEA 2GAUA 4HXCA 1RUH2 4PT6A 1PX3A 5IW0A 4A42A 4CA9A 4CEYB 1BVP1 2GNBA 2UWAA 5A6ZA 2HWB3 5KC6A 2ZX0A 3GZTB 3GBWA 2FCUA 3RPQA 5FMDA 3WEZA 1JODA 1QJFA 2WT1A 4JQTA 4M3CB 3MEPA 1OBNA 2AEYA 1A8DA 3ZFGB 4OI2A 4NHMA 2JB8A 5EZWA 2VW2A 1GNYA 2VE1A 3NAPB 4AF9A 1UU6A 3POFA 2BV4A 4XFFA 5FZAA 4EN6B 4MSVA 4Z92B 1ULFA 3LOIA 4LJHA 2XJTA 1D4M2 4AG4A 1C8M1 3OCPA 5FJKA 4D94A 2BDRA 2OQ6A 2W95A 4LKSA 5GZFA 2XH6A 4Y26A 3MV01 2WFF2 4YGCA 2W0XA 3PUSA 2R042 2FHRA 4N9HA 3ZYGA 3OPTA 4GALA 4LXLA 1RMU1 2DU0A 4ET7A 1GANA 1NXD1 1VJ2A 2FCTA 2QQIA 2WLPA 4HN1A 4ZHNA 1RUG3 2JDYA 3LSEA 2WZR1 1H9WA 1AX0A 1AR71 4ISQA 4UFMA 4XTPA 3VHRA 1NLQA 1KEXA 3VDDC 4LBNA
chains in the Genus database with same CATH topology
3SH4A 1R092 3WQ1A 2PELA 1LEDA 1QY4A 3WLUA 2E51A 3AJZA 3AYCA 4JGZA 4RR3A 1J3RA 4R8HA 3T1LA 1D0GA 5ABJA 4ASLA 5BNQA 3FZ3A 2GC3A 3WV6A 2JG9C 2ZKLA 5JI9A 1CGPA 2BW8A 1W6PA 1VRH2 4M0NA 1JYCA 1FV3A 1K5MB 3KQRA 1LOGA 2BGCA 1G9BA 1UIJA 4BYYA 1W6NA 1V9U1 1S0CA 3QLQA 1REDA 2A3WA 1G9DA 4U36A 4D7SA 2GZWA 4B4PA 2Q4SA 5H9RA 2NN8A 5BY5A 2JG8C 2VVDA 5BNOA 1NCRC 1UN1A 1NLRA 2PHUA 3C2UA 2RS53 3EHKA 1JUIA 4CDWB 1CAXA 1YI7A 2WQ4A 3IDEA 4PF5A 1UMZA 4XXPA 2CGPA 4L97A 1OMIA 1WW4A 3ME2A 1CVNA 3MPPG 1OA4A 5BNPB 1AR83 4W65A 1AJOA 4GMP0 4ES8A 1AYM2 1H1MA 4YVWC 2I2SA 4E2GA 4I09A 3O7OA 2BUKA 2GDFA 4ATFA 1OA3A 4YG6A 3HIFA 4DS0A 3HAGA 1RHI1 2ETEA 3S7EA 1AXZA 1B35B 2GC2A 4GB31 3NWKA 4K40A 3UL2A 3VGIA 2D6NA 1SBDA 1OSGA 2HWF3 3AMHA 4LR4A 1RUI1 3M4FA 4MV2A 2C1FA 4UW6A 1VBC3 2VH9A 3PVEA 5FO7B 4GMP1 1XNCA 1FPN2 5J36A 4K3UA 1BKZA 3WD5A 5JMCA 3BOWA 5C8WA 4H14A 2XVLA 2PLV2 4FPYA 2MEV1 1SLBA 4CDXA 4I0AA 4XFIA 1AR91 1G7YA 1C3HA 1LR5A 1LHVA 3D4KA 3ZYRA 1GNZA 5J96B 3QBQA 5FOJB 4IEVA 3MF6A 4QGMA 1OQDA 2JE7A 4AVTA 4HZFA 3TB0A 4E4DX 2XPJA 1LHUA 1MZFA 1EY2A 5ACA1 5J3UA 1PZ8A 1QJZA 4E4SA 5H9SA 4RHV1 1REEA 3AXEA 3H7YA 2ZHLA 4B7KA 1PO11 4LA3A 2A75A 4OFGA 3RI8A 5JOXA 3ZSKA 2XVKA 2RM21 3NL1A 3JD73 5KXCA 1ZRDA 2EAAA 1V70A 2TEPA 4Q0SA 5T5PA 5BNNA 5LEKA 4NHLA 2HWD2 2VMIA 1C1FA 3C3VA 1DGRN 4RQPC 1A78A 3PVBB 1LOFC 4RR3B 1FOD1 3HQXA 3AKRA 3U0ZA 2PAMA 1G8WA 1TNFA 3FBMA 3L9JT 1AUYA 2BQPA 4JCKA 4Y4YA 3W59A 1W6PB 3ZYJB 5IK8A 5AVPA 3IMNA 4PLMA 4YNIA 3QH7A 4BHPA 1DHKB 2V5YA 3H1WA 3VBHA 1W6NB 2RS33 3AP4A 4HVOA 4BIFA 4DRVA 4YLZA 2LTNA 2XLFA 3LCPA 2ZHNA 2ZX3A 5JI7A 4EN8B 2BWAA 3ZN5A 1MR5A 1H2KA 1XXNA 2JDZA 4XIOA 2BWCA 1LRHA 3IBMA 5DZFA 2YMZA 5KHJA 1VBA1 3RYPA 1IZ3A 1DQ0A 3TWIA 5BNOB 1OKQA 3RI9A 1IQAA 4IQPA 1JHNA 4MUVA 3G7DA 4KU8A 3EBRA 2XKOA 2GNMA 4PDWC 4AQ6A 1N3OA 1DGRA 4IEXA 5CFCB 4V1PA 4CDUA 4F8AA 1NYWA 2JX9A 2A70A 2Z42A 1XE8A 2HWB1 1ULDA 1BYHA 2QDNA 3TN92 3MW2A 3KT4A 4DXZA 2WNVA 2ZGMA 3WW2A 3AM2A 1OOPA 3WZ1A 2PHWA 3BIWE 4Y1VA 1ULGA 2R16A 3NW4A 1WW7A 3B93A 1VBD3 1IPKA 5J98B 1RUJ3 4QQLA 2VU9A 4BM8A 4XZPA 4XDQA 1FT9A 2NZ9A 5I8SA 3TOJA 2A7AA 5IUQA 4DY5A 1RUG1 1XNBA 4LHNA 3MIBA 4M3CF 4CDQA 1ZBE3 1F9KA 1HRI2 3GZUC 4QGNA 1C4RA 1ASJ2 5FCCA 1PGL1 4BH9A 3NV3A 4JAAA 1H30A 1VBE3 2WSVA 4OHZA 3I54A 1PGW2 2BNMA 4CDXB 5DDJ3 2Z5WA 2VW0A 3U07A 4Q4V3 4AFAA 1Q8SA 5T3NA 1J3QA 3PLQA 2AYHA 2HEVF 4UW3A 3RRDA 5CFDB 2UWBA 2XWBB 4Z2WA 2ZGTA 1HQNA 4GXLA 5C33A 4AXOA 2VQAA 2D3RA 2B9UA 1LGBA 5FQ0B 4YM3A 2DVAA 1W39A 3S7IA 3UJQA 4R4ZA 1GICA 3ZFFB 3TRSB 1IPJA 4OI4A 1F8VA 3G6JB 4DZGA 3FWEA 1KJRA 4FPLA 4XFGA 4Q8KA 4FOVA 2RS51 2DVDA 2A71A 2QZ2A 4IEPA 2WL1A 1RUC2 4AW7A 3O5SA 3VBUC 4DB5A 4AFCA 2JXAA 5C4WA 4R9CA 1M06G 1NA1B 1W2UA 1YHFA 2D44A 2P37A 2R1DA 1BEV2 1AR81 1RUF3 4FPOB 2EIGA 4PIZA 4YFWA 1Q8VA 4HBNA 1HIXA 3N7LA 2YPJA 1COV3 4JGYC 3AJYA 4JTOA 3VBHB 1H2LA 4KGGA 3R6SA 1FNYA 2Z2SB 4PBOA 4Q4Y3 4H55A 4DRRA 3WW4A 4YM2A 4WVVA 1YIFA 5C9AA 3N7JA 5HI0A 2ZZQA 2RMU2 1H2MA 2HWF1 5JZGC 2YY1A 1VBC1 4LUMA 1AL22 3S0MA 3D8CA 4W6XA 4OHVA 2XJQA 4GIQA 2XG3A 5LK7B 2MHFA 2MNGA 5B2GB 5CU1A 3WG4A 5FO9B 4FXKB 4QQHA 1G9AA 1S0JA 2XVGA 4E27A 2P3KA 4FP3A 4S2FA 4CDUB 4K9SA 3VBOB 3EJKA 2D7FA 3DGTA 2D40A 4JTNA 1SACA 2WNVB 2YYOA 4TSVA 4GH4A 2IXKA 4J6GA 3U11A 3MIGA 1QDCA 3NJZA 3H7JA 1FI2A 1KRIA 1AXKA 4YFZA 1FATA 4RL7A 4B4RA 4E2QA 1MQTC 1NQDA 2GU9A 2RE9A 4Y1UA 5GLTA 4JVAA 2AGSA 4AVBA 5GM0A 5SV8A 1LGNA 5T50A 4Y20A 1VBB3 5KHHA 4QPGB 1BBT2 4I2OA 4LO4B 2D3SA 2BFUL 2RHPA 1ND3C 2ZABA 3JD71 4Q4W2 1LOAA 1S0DA 4ES9A 4LE3A 4OHWA 1EV13 1VLNA 3JBG2 3MGUA 3ROUA 4O9EA 4YARA 4AI3A 1WLTA 1RUH3 3JCIA 4IV3C 4IV1C 3E6CC 3WX5A 3WHTA 1UX6A 3ZDSA 4BQ1A 1EYBA 2ZX2A 1Y43B 1BMV2 4D7YA 5DUXA 1F5FA 3IIAA 2BFUS 4MLOA 3VZOA 4IESA 5C8CB 2YHJA 4BIOA 5L7OC 3M1HA 4N90A 2RS31 1D4M3 4MGZE 3AMMA 2WC2A 1RUE2 4CP0A 1Q8QA 1X8MA 2WFF3 4XF0A 1XNKA 3VDDA 1S0BA 1CR7A 2E7TA 1WCDJ 3H3UA 4QPIA 4FPKA 1X7NA 1LODA 3O14A 3QOPA 1RUNA 4COZA 2AENA 5AC92 3ILRA 1JBCA 3GALA 3OD4A 1JXNA 2K9ZA 5CNAA 1DBNA 1ZBA1 3M70A 4B8EA 3RMYA 1LTEA 5HCFA 3VKMA 2R1BA 4P9XA 5L73A 4EN0A 4XBNA 4R9DA 4CEYA 4X6QB 4OI0A 4XQDA 1KITA 1VRH3 1UU4A 5F6LB 1ZZ6A 1RJ7A 4HT1T 2PN5A 3ETQA 3H1YA 4M3CA 1MS9A 3ZFGA 5JOYA 2OZJA 2FBEA 1H4HA 5T55A 2XJPA 2GNTA 1W0PA 5GKAC 3NAPA 3ZFEC 5GLUA 4AI1A 4CTEA 3LWCA 2E53A 3VUOA 1RUJ1 5TSWA 3FLTA 3ENRA 4H3WA 3ZYIB 4C90A 1HV0A 3SLIA 2SBAA 4YRDA 1W0OA 3WDUA 5A33B 3OGJA 3WW1A 3V0BA 3B02A 4CEWC 1JOJA 3KD4A 4NWVA 1ZBE1 1ZYBA 4DINB 4N53C 4RD7A 2O8OA 4XTMA 1YIPA 2DURA 3JQWA 2R072 3FX3A 5FRAA 1N47A 1VBE1 4YW1A 1YJKA 1QQP2 4L11A 3A4UA 1QJX2 1CPNA 1EPZA 2WNEA 4AEKA 1WD4A 5J09A 3FLPA 2ZGLA 4Q4V1 2Q1ZB 2UYBA 3CJIC 1YRZA 2W08A 1ULCA 1PIV2 1NE4A 2XLAA 4GH4B 1L3JA 5JSRA 2D93A 2YGLA 3FFZA 3PVOA 4K21A 2IC1A 3CNAA 1UW8A 2XJVA 1GSLA 3AKPA 4Y20B 1AYN3 3KT7A 4XMAA 1WLDA 3FMGA 3ST7A 2DCKA 3ZVXA 1FPN3 5CVRA 2ZMNA 3AZXA 4HK8A 1MEC3 3MW4A 3NV1A 3AXDA 1Z7S2 1ALYA 1ZZ8A 3LOBA 1EP0A 5I93A 1GV9A 4FPJA 4XW3A 1WCKA 4LBJA 4Q2FA 1ZRFA 1MS8A 1MS0A 2DCJA 3PTYA 3JUUA 3IDBB 4W6YA 2CNAA 2DVGA 3E5QA 3PMEA 1RUF1 4N7UA 4IERA 3E6DA 4NHKA 4I01A 1KS5A 1COV1 1E57A 5EWSA 3I4IA 1DQ6A 3Q9OA 1YXWA 3VDDB 4GULA 4Q4Y1 2AREA 2D5FA 5K7PA 4QPIB 1LOFA 3MIHA 5LRSA 4A7YA 3T2TA 1AR63 1PK6C 3TNPB 1W6OB 2JG9B 3MICA 2HWD3 3CO2A 1XE7A 1O91A 2E7QA 1YFWA 5JSPA 1OPOA 4XBQA 2ZGOA 1PVC3 2A6ZA 3I2DA 2NMNA 2DCYA 3K48A 4YYOA 5KXBA 1NLSA 1RUD3 2ZGNA 3LA3A 3QACA 1XQNA 2P3IA 3I59B 3W58A 4X6RB 1LHOA 3OTFA 3MDPA 5I0TA 4DFSA 4K1ZA 3SH3A 3POSA 1H8TC 1RMU2 2ZJCA 2ZS6B 2Q1MA 4HANA 2ENRA 1NCRB 1QJY2 1GR3A 1S0EA 1DDLA 2WZR2 2O0OA 1Q43A 1XU2A 2B45X 4TYSA 3V0AA 1YYNA 1DFQA 3WR0A 3IPVB 3WDVA 4LO8A 4TZDA 4AE2A 1R1A3 1VBB1 5D8AC 1ZNPA 1CPMA 1YO8A 3V0BB 2ZAHA 1EV11 3O12A 5FTTC 3ZMOA 4BZ4A 4GQ7A 1FAYA 2NLRA 3J26N 5FDBA 4KGQA 3LB9A 3VBSC 3MFCA 4YVWB 3FHIB 1RUH1 3D0SA 3ILFA 5K8SA 5GALA 5JOWA 1NCQC 1GBGA 4COUA 1V9U2 3TN93 4JV4A 2WQZC 1CAVA 1GYKA 4Y5Z0 2D3PA 2OVUA 2DTWA 4C1WA 1BXHA 1V6KA 1C28A 1J58A 4FPFA 4L9BA 2D6KA 1LOBA 2UWCA 4BCUA 2B39A 3O0WA 3WCSA 2ARXA 3PHMA 4LUKA 4AEDC 4WM7C 1X8EA 3EQEA 1V6JA 1HDKA 3POWA 1D4M1 4IETA 1W6MB 3M3OA 2WFF1 4BOWA 3MLJA 4EN7B 4HLTA 2HWE3 2CAVA 4AGGA 3JZVA 2VG9A 4Q0PA 1SEFA 4WV8A 4YW3A 4Q1RA 1GZWB 1HRI3 4NWWA 2ZZJA 4I3PA 1MACA 1VP6A 1QU0A 2ZAAA 2V73A 3FC0A 4XFAA 5BUVA 4KU7A 3AKSA 4FOWA 4N9IA 1QKQA 2DV9A 2ZMLA 5CFCA 2A6VA 1YFUA 3M3IA 2PAEA 4LHKA 3AX4A 2CAUA 2WT2A 4NOTA 4I02A 3WG3A 4MGKE 1SLLA 4JRLA 4XJUA 4BWOA 2QZ3A 4GB32 5JCTA 3H3ZA 2EXHA 1S2BA 1SMVA 1MZEA 2KA3A 2YXSA 3VZNA 2XBO3 5CG9A 4FVVA 2JICA 1OPMA 2BPA2 5K0UC 4QD2A 5CA6A 5IK4A 2ZOEB 2Y26A 3GF6A 3VBUA 2MEV2 2A73B 4K8FA 1PGSA 1SLCA 4HSJA 1DQ2A 4Z8BA 1UU5A 4AVCA 2AH2A 1AR92 2D97A 4YW2A 1RJ8A 4AVVA 2R30A 1A3KA 1ZZ7A 4IEQA 1PO22 2N7GA 3JB8A 2DTYA 2A3YA 2ZHMA 2PHLA 3KCCA 4K7JA 2ZGKA 4QT6A 3MIFA 2B46X 1LULA 4IEYA 4JQRA 4LO6B 5CADA 4PBPA 4E9KA 1LKNA 4WVWA 5ACA2 3IN9A 5T54A 4BE3A 1BEV3 4QXKA 2XHKA 1QF3A 5EV7A 4TLFA 3VL9A 4RHV2 2ES3A 4IEZA 4XF3A 3J9SA 2XL9A 4L2NA 5CFDA 1PO12 4NPRA 4EWAA 1GKBA 1KS4A 1NQJA 2PHDA 3FE5A 2EXIA 1DZQA 2R32A 5FPXA 2PFWA 3NSTA 3B69A 3V0AB 1O5LA 4KH9A 5FQ0A 1OHFA 2X5IC 5JSOA 1R083 2WNUC 4FSJA 4PDWB 2A6XA 5L19A 1AL23 1AYN1 3ZFFA 2GN3A 1HRV3 2RS12 1FPN1 1REFA 2UURA 1IKPA 4IXLA 4WVMB 1HKDA 4CDWC 1MEC1 4LBLA 1YUDA 1TMF3 1O3SA 3I8TA 3UKTA 2DU1A 2B8MA 2VQ0A 2BVVA 4N43C 1DG6A 5I8YA 1QWRA 4GKYA 2ERFA 2ILMA 3MIEA 4M00A 2H0BA 1AX1A 2Q8OA 1QJU3 1CAVB 1NOVA 1SLAA 1NA1A 1MQTA 1F31A 2C5DA 3ZIXA 3WP4A 3OJBA 4OUSA 4G9SB 2VMHA 3ZXLA 1N1VA 4XETA 1VBA2 4J1XA 1N1TA 4QPYA 4GWMA 4URTA 4HMZA 1PNGA 2ZTNA 1SCSA 4U2AA 1Q5OA 2BBVA 4XOGA 1VB2A 1BBT3 2Y38A 3AMPA 4IV3A 1RL3A 1OD5A 1KDMA 4AYUA 4RS5C 2GN7A 3JBG3 1O4ZA 1RC6A 1AR61 5F6KA 2HWB2 1VIWB 1XRUA 2FMYA 4BPZA 5KBFA 3WOGA 2HWD1 3KMHA 3ZXEA 2F6BA 3LKJA 1LENA 1PVC1 2GMEA 4P14A 4R4XA 2EXJA 4UW4A 2I07B 4IEOA 5GLWA 1RUD1 4FPEA 4MZUA 1C1LA 2RJKA 3MI8A 3VBOA 5DUVA 1ENQA 2HEYF 1TME2 2QJVA 5I0UA 1LEMA 4LO7A 1RUE3 2VNRA 3ALQA 4KNCA 1YNAA 4OUMA 3E6BA 2ZBJA 3AK0A 4RSUA 4FP2A 4ZU4A 2CWMA 2QNKA 3AP5A 1PGL2 2VMGA 1GQHA 3VBUB 2WINB 1R1A1 4QPGA 3R4DB 3ZXAC 2R49A 1W6QA 4LA2A 4QU2A 3UK9A 3WUCA 5EYYA 5T52A 1FMD3 1NY72 5EFUA 3VL8A 4W6WA 2PTMA 1S0IA 1O4TA 3ZSMA 1KFUL 2NYYA 3J8F2 4JGZC 3AP9A 1IHMA 5HCBA 5ABJC 4JGYB 2WKKA 4JC1A 3TN91 1RINA 3ECQA 1NZCA 2P17A 3B00A 2ZHKA 2ZKNA 3V65A 1H2NA 1JTZX 1SFNA 1DYKA 5C8CA 1QOSA 4META 1QXRA 4QQOA 2W68A 1EPWA 1RIRA 5LRRA 3SCGA 3DKWA 3TAYA 4MYEA 5E1RA 4WM8A 2HWE1 2RJLA 2WS93 1APNA 3TBDA 2DFBA 3PMSA 2FQPA 5A32B 2HJIA 1AX2A 3WQ7A 1DYPA 4R9AA 1HRI1 1U5IA 1QNYA 3OYWA 2R073 1D4VB 2R0FA 5JR7B 1PGW1 3DPRC 1Q3EA 1QJX3 1J3PA 2HWC2 1BQPA 1BJQA 3ES4A 4P9YA 1MQTB 2H6BA 4FCAA 1PIV3 5F1RA 1UPIA 3AB0A 2JENA 4XJAA 2BNOA 4K6BA 1S0GA 3UV9A 5LEJA 3ATGA 3U4XA 1ND3B 1VBC2 2IXIA 2XBO1 3WW3A 1MVEA 5EYXA 1FX5A 3H0OA 4Q8LA 4IV3B 4IV1B 5F9TA 5BV6A 4E4ZA 1ZREA 1KD7A 5A33A 4QGLA 1LU1A 1QOTA 2OZ6A 3KT1A 3V56A 4A7ZA 3KCXA 4AGRA 2DCTA 5A3LA 1VR3A 1WLCA 3WCRA 2X8KA 1I1EA 3RS6A 2ZGPA 3SMHA 4CYDA 1PMIA 3N3HA 3R4SA 3L2HA 3ZPYA 1YJLA 3VBFC 5L7OB 3RQ0A 3FJSA 4LT5A 5JIAA 2R062 4P9JA 1BEV1 1VAMA 4MX3A 1WCSA 4LBOA 2E6VA 1SCRA 1LHNA 2X53S 4AVSA 2WA4A 2VNGA 2XWJB 3QCWA 4F83A 5CIRA 1V6NA 3JD72 2ET7A 4XF1A 1TNRA 3D82A 5KHKA 3WP6A 2Y0IA 2YZ4A 4XJ8A 4XMIA 3WINE 3H9AA 1DU3D 1V6OA 1RVF2 1XYNA 5KWRA 2DF7A 1R081 3VV1A 4QHBA 2Y0OA 4SLIA 1AL21 1WW5A 1HRV1 3CL1A 1W6QB 2GNDA 3MLKA 2BYVE 1QDOA 4YW5A 5FBZA 5BNNC 2DVBA 4COYA 1DIWA 1TMF1 2Z79A 1BZWA 1UKRA 1EAH2 3KGZA 2RS32 5J37A 1DZRA 1CD3G 5DZGA 2H0VA 1QJU1 2P3JA 3ASIA 1ZZ9A 1DQ5A 4AFMA 1LJ7A 3RSJA 1YLLA 2OPKA 1Q8PA 4P9LA 4ITCA 4YSFA 1ONAA 3NKGA 1QJY3 3VBHC 1CAUB 5AVAA 1RITA 4FTEA 2GC1A 4CEWB 1WW6A 1YCIA 4HK9A 1Q56A 2GC0A 2XL7A 4LE4A 1ZBA2 2QFEA 4N53B 2R043 1BBT1 1HXS2 4WM8B 3E97A 2E63A 5CG8A 1YI9A 2DVFA 1YFXA 1NCQA 2O8QA 3HD8B 2D6OX 3JBG1 3FFQA 2IXJA 1W6OA 2HYKA 2VOKA 5KHGA 2JG9A 1R093 3OYWB 4Q4X2 4Y1ZA 1UF2C 3WDTA 5GLZA 2YGMA 1UIKA 5I91A 1PHMA 4NN0A 1BMV1 4H7MA 3I59A 4FTSA 5D1IA 4AK3A 2NM1A 2XGXA 2VNOA 3UKVA 2OUJA 3P3NA 4D69A 4RFT0 4HL0A 1OOPC 1UD1A 1Z78A 1O4YA 2JG8A 2XJSA 4XFBA 4C1XA 5JVVA 1RUE1 2D6PA 1NCRA 3ILNA 2EALA 3RJ2X 1POV3 2TBVA 3IPVA 2QCSB 4GWNA 4FBFA 1VBD1 3KZ4C 1N1SA 3T1MA 4AFBA 2DWRA 5JLVA 1UKGA 4AQTA 4I30A 4CDQC 3PJQA 4QM8A 1FMD1 3VZJA 3QH6A 4AQ2A 3MYXA 4QQPA 4P9GA 1FNZA 1Y7BA 3SXWA 4YVWA 1DQ4A 2RR12 2VUJA 2V09A 3R4UA 4YZ3A 1U5XA 1JN2P 3B5LB 4LBQD 3PVNA 3L2YA 5DDJ1 3LA7A 1AYM3 1CQ9A