2R041

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 41
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r04100
5J96B 4Q4Y3 3DPRA 1MQTC 1PO21 4Z92B 5AC93 1VBA3 5CFCB 4YVWA 2R043 1ZBE1 3VDDA 2ZZQA 1MEC1 4PDWC 4IV1C 1AL21 1COV1 5L7OA 1H8TA 1HXS3 4Q4V1 4CDXA 4GH4C 1BBT3 4CDWB 5FMOS 5D8AB 5C8CC 5BNNB 5CFDC 1C8M2 4Y4YA 1RMU3 2HWF2 4IV3B 1RUC2 2MEV3 1E57A 4CEYB 1FPN1 1POV3 1RUI2 1QJY3 4RQPA 1RVF3 2RR13 1BMV1 5AC92 1A6CA 1NCRB 4JGZA 1VBA2 2R042 2R071 4AEDA 1NG0A 1VRH3 1PO22 2RM23 1AYN1 4QPIB 5BNPC 5C4WC 1BBT2 3VBFB 5C9AB 4GMP1 1MEC2 1NA1C 2WLPA 1COV2 2HWB3 1PIV3 5ABJB 1WCDJ 1BEV1 2HWE1 2PLV1 4RS5B 2HWD1 4Q4W3 4N53A 1Z7S3 2R061 1QJY2 1ND2B 4CDWC 1RVF2 2RR12 1VBD1 4JGYC 5D8AC 5BNNC 3VBUB 2WWSA 4WM7C 4RR3A 1RUJ1 1HRV1 1RUG1 1FOD3 4CEYC 2XPJA 3VBRC 1BMV2 1K5MA 4CDQB 1NCQA 5ACA3 1R083 1EV13 1NCRC 4N43A 1TMF3 2HWB2 1PIV2 3VBHA 1QJX3 1AYN2 3NAPA 4FTBA 1AR83 3S6PA 1Z7S2 1VBE1 5C8CB 5CFDB 1ND3C 3VBFC 2X5IC 5C9AC 3JB8A 4CEWA 1C8M1 2HWD2 2RS33 1CD3G 2HWF1 1QJZA 2WFF3 2R062 1RUC1 1AR61 1FOD2 4RS5C 1TME3 2VQ0A 1RUI1 3VBSC 1VBD2 1PO13 5DDJ3 4CDUC 4Q4Y1 4GB33 5ACA2 5BNOA 4WM8A 1R082 3VBUC 1V9U3 5AC91 1D4M3 1GFF2 1VBA1 2BFUL 4LLFA 1TMF2 2R041 3ZFEA 4Q4X3 2WS93 5BNPB 1B35C 1VBB3 5C4WB 4FTEA 1AR82 4NWWA 1HXS1 4CDQC 2BPA2 4RHV3 4YVSA 1NA1B 5K0UC 1BBT1 1OOPC 3ZFFA 1RUF3 3ZFGA 2BUKA 1RMU1 2RS13 2RS32 2WFF2 1VBE2 2MEV1 1IHMA 1PGW1 1R093 1POV1 3JD73 2RS53 4JGYB 1QJY1 1RUE3 1PO12 4WM7B 3DPRC 1RVF1 2RR11 5DDJ2 5JZGA 1FMD3 1V9U2 1AR62 4YVWC 3VBOA 3VBRB 3J8F3 1HX6A 5L7OC 1RB8G 1H8TC 4Q4X2 4EJRA 1VBB2 4Q4Y2 1VRH1 2RM21 4RHV2 2HWB1 1PIV1 3JBG3 1HXS2 3CJIA 2BFUS 2RS12 1NOVA 5J98B 1ND3B 4Q4W1 2X5IB 1R092 3JD72 4RQPC 2RS52 4QPGA 1Z7S1 5CFCA 1RUE2 3TN93 1RMU2 5A32B 2RMU3 2MEV2 4JGZC 1PGW2 3VBHB 3VBSB 1DDLA 4AEDC 1FOD1 3J8F2 3NAPB 4CDUB 5FOJB 1SMVA 1HRI3 4IV3A 5ACA1 1R081 1EV11 2QQPA 1B35B 4FSJA 1OHFA 1TMF1 1VRH2 2RM22 1QJX1 1VBC3 3JBG2 1VAKA 2WZR3 5K0UB 5LK7B 1AR81 2ZTNA 1X36A 4Y5Z0 1OOPB 2XBO3 2FZ2A 1ZBA3 2DF7A 4RR3C 2RMU2 4QPIA 4Q4W2 2RS31 3FBMA 3ZFEB 2WFF1 1PVC3 1RUD3 1RUH3 1TME1 1R1A3 2GSYA 3DPRB 4NWVA 1K5MC 1NCQC 1PO11 5ABJA 5DDJ1 4YVWB 2HWC3 1HRI2 4GB31 3VDDB 1ASJ3 1V9U1 4N43C 5L7OB 3ZFGB 1H8TB 1D4M1 1RHI3 3VBHC 1ND2A 4CDXB 3NAPC 4Q4X1 2WS91 1AR93 1VBB1 2WZR2 1EV12 1F8VA 4RHV1 2IZWA 2ZAHA 1F2NA 4CEWC 1QJX2 1RUF1 1MQTA 4FTSA 2RS11 4RQPB 2GH8A 1PVC2 1RUD2 3ZXAC 1RUH2 4PDWA 1R1A2 1R091 4IV1A 3JD71 2RS51 1AYM3 1RUE1 1HQNA 4GH4A 4JGZB 1QJU3 5BNOC 1X33A 2HWC2 1AR73 1FMD1 4AEDB 1TME2 5A33A 1RHI2 1CJDA 3ZFEC 5C8CA 3CJIB 5CFDA 3J8F1 1EAH3 4SBVA 1AR92 1AL0G 4GB32 4YVSC 4QPGB 1D4M2 3VDDC 3ZFFC 3ZFGC 1PO23 2WS92 4BCUA 4CDXC 3JBG1 4N53B 1ZBE3 1MEC3 1AL23 1COV3 2TBVA 1PGL1 1NY72 4Q4V3 1AYM2 1RUF2 4RR3B 3TN91 5JZGC 5BNPA 1QJU2 5C4WA 1AR72 3VBOC 2RMU1 4GMP0 1OPOA 1NA1A 1K5MB 1NCQB 1EAH2 3M8LA 1FPN3 1FMD2 4N43B 1HRI1 4CDWA 4JGYA 5D8AA 5BNNA 3CJIC 4WM7A 1VBC1 1ZBE2 2WZR1 2R073 2FZ1A 2Y26A 4CEWB 4CEYA 1AL22 4QPGC 5CFCC 1AYN3 1QQP1 2XBO1 1ZBA1 4Q4V2 3VBRA 4GMP3 4N53C 1AUYA 1NCRA 1PGL2 1QQP3 1BEV3 1PVC1 2HWE3 1RUD1 3TN92 2PLV3 1RUH1 1R1A1 3HAGA 2BBVA 5BNOB 4WM8B 2HWD3 1FPN2 4IV3C 2R063 1M06G 2HWC1 1ASJ1 1ND3A 1VBD3 2X5IA 3VBFA 5C9AA 1MQTB 1RHI1 1RUJ3 4YVSB 1VB2A 1HRV3 1RUG3 1AR91 5A32A 2R072 4PDWB 4IV1B 3ZFFB 4RS5A 3VBSA 5FMOL 4GH4B 1VBC2 4CDUA 3IDEA 4QPIC 3VBUA 5A33B 1QQP2 2XBO2 1ZBA2 1BEV2 2HWE2 2PLV2 5JZGB 1B35A 4RFT0 1NY71 1AYM1 5ABJC 4CDQA 3VBOB 1VBE3 1QJU1 5K0UA 3JB4C 1AR71 3LOBA 5GKAC 1C8NA 1OOPA 1VB4A 1ND2C 1C8M3 1RUJ2 2HWF3 1W39A 1EAH1 1RUC3 1HRV2 1AR63 1RUG2 4WM8C 1RUI3 1ASJ2 1POV0
chains in the Genus database with same CATH superfamily
3NV2A 4KWJA 4XPVA 3TB0A 3NVCA 4Q4Y3 3AP6A 3K46A 3BKZA 3POFA 1MQTC 1OQDA 2VMCA 2ZX3A 2P3IA 3VKOA 1XYPA 3ZYJB 4YVWA 1W9YA 2ZX4A 5DZEA 1GZWA 2UWCA 3KZ4C 1JODA 2ZZQA 1PHMA 2BEOA 1AL21 2XJTA 4I3PA 5CU1A 4HVQA 5K4LA 5B2GB 1HXS3 3AP7A 3RWNA 3NNGA 4Q4V1 1W04A 1XYOA 2ID4A 2C6SA 3LB9A 2BTVC 1BBT3 3HT1A 4XFFA 1DGRN 3IT8A 3AMQA 4W50A 2QDNA 5GLUA 3LZZA 2V09A 2B42B 2PYTA 5D8AB 2SBAA 5BNNB 2CGOA 5CFDC 3O1PA 1W0OA 3WCSA 4MG2A 3BALA 4MSVA 2HWF2 4IV3B 3NL1A 5A80A 2CGPA 1POQA 2QQKA 5FZOB 4XHXA 3N3HA 4ORFA 3CMGA 1RUI2 4ZXKA 2VUDA 5FRAA 4AHYA 5JI9A 4RQPA 2DVDA 3L2HA 3GZEA 2DWRA 1S0FA 5IK4A 3R4DB 4E4SA 2XR4A 1V6LA 1V0AA 2A3YA 3WDYA 1NCRB 4GXLA 4A41A 5AC92 2DVBA 1W8HA 3K48A 4JGZA 4R9AA 3IDAA 2R071 2E31A 2VZUA 4AYUA 1U5XA 2Y38A 4RYDA 5LATA 3ALQA 1H1AA 1US2A 1H1MA 5F3EA 1VRH3 3EBRA 2RM23 2VG9A 5EXOA 1IG3A 4ZU4A 4E27A 2HYKA 4QPIB 4XDQA 5T5LA 5C4WC 3DF0A 3N35A 3PTRB 3ZYBA 3ROUA 2YY1A 1PK6A 4QT6A 3VBFB 1YI9A 4V2WA 3KQRA 4EZ4A 3E6CC 2E7AA 4IL7A 4LKSA 4OQ8A 1KDMA 4NRMA 1LHOA 4OHXA 1NKGA 1K12A 2QFEA 3AL6A 3LQCA 4K20A 1AJOA 2PLV1 3UETA 1URXA 1C57A 3VHPA 2HWD1 1JOJA 3AVSA 3FE5A 3M1HA 2VGDA 4QX5A 4D7YA 4A6OA 3ZSKA 1VAVA 2YC4A 1OXCA 2G19A 2QCSB 1ND2B 1AXYA 1STMA 2C9AA 2ZZJA 3UKNA 1WBLA 3VHRA 1F4AA 4AE2A 4CCEA 5EYYA 2Q8DA 1RVF2 2RR12 4E4ZA 4YARA 4D6SA 3VBUB 3LEMA 1Y9QA 1RUJ1 4EWAA 3RZLA 3IMMA 3WSOA 2QNKA 2KXLA 3FWEA 5LA1A 3MIBA 4KWUA 3ZX7A 3DXTA 1QOSA 4PLMA 2R16A 3VBRC 3V65A 3VD9A 3WNXA 1D0HA 4YG3A 1NCQA 3LFIA 1G9FA 4RL7A 4X8PA 1Q8SA 3WP4A 4DXRA 2JKXA 2VNVA 5J48A 1EV13 2ENRA 2VZOA 3EYPA 4AVAA 3MUZ1 4N43A 1TMF3 2QZ3A 2HWB2 1W28A 2QQVA 4K9SA 1OVSA 1PZ7A 3RZMA 5L19A 4MHUA 3VGIA 3ILFA 4QQOA 4FTBA 5G05L 1VP6A 4BQ1A 5T5PA 1LGBA 5H9RA 1W8FA 1Z7S2 1UYZA 4YM1A 4DOUA 2DUPA 3H9AA 4GJZA 4RN5A 5CFDB 4IEQA 4A7ZA 2OUHA 2X5IC 4NHKA 1OA3A 5EJ3A 3JB8A 4CEWA 4IEOA 4BXSV 5HV0A 2H0BA 2ZAAA 3A21A 5A3PA 2HWD2 3ELNA 2RS33 5LWBA 3N9NA 1QDOA 5A1LA 1DHKB 1RUC1 2PMWB 1GZTA 1TME3 3HNMA 4FOVA 2C4XA 2IVIB 2W5FA 2ZX2A 4Z2AA 1UIJA 2WT2A 4MXWA 3LSDA 3RRDA 4CCMA 3VD7A 4P9GA 4L8QA 1X9PA 1Y9GA 2ZGUA 4XQDA 5FYYA 4Q4Y1 5ACA2 1U5ZA 4WM8A 4XACA 1V9U3 4XCAA 5APAA 3MIHA 2EAKA 2ZMLA 3ACGA 2YPDA 1D4M3 5GJ6A 5FZ4A 1XSRA 2ZHKA 4XW3A 2WL1A 4XJ8A 2ZEXA 3ZLIA 5C8WA 1JN2P 2E7QA 3ZFEA 4FPJA 2JDPA 3VV1A 2JENA 5C4WB 3BU0A 5FZMA 1HB2A 2AYHA 4LBQA 4NWWA 1HXS1 4CDQC 4DRVA 4YVSA 5F9TA 3OOXA 1ULGA 4TTGA 1BBT1 3AL5A 1GMMA 1OOPC 2D98A 3M4FA 2CNAA 2H0VA 3ZFFA 4M01A 5I8SA 2NN8A 3SXWA 2FHRA 4QM8A 4XC9A 1YUDA 4FI9A 5E88A 5CG9A 5A3WA 5A7QA 2KM2A 2WFF2 2OKXA 2VECA 1A78A 1PGW1 3PIJA 1L7QA 2ZHNA 2RS53 2VOKA 2LW8A 5A7PA 2DBNA 4BM8A 1RUE3 2ET1A 1KJRA 2RG4A 1PO12 5HBAA 1HB3A 3OBRA 2VZ1A 4Q1RA 3DPRC 1I9RA 2WWUA 1U5YA 1NLRA 1PM4A 1ZVFA 3HNYM 4LO4B 3P3PA 4M4PA 2DURA 4L92A 4PT6A 4YW5A 3UKVA 1G6NA 5CISA 3VBOA 4NIHA 3AJYA 3PHMA 1LOCA 3VBRB 1HX6A 1OUSA 3HIFA 4LO6B 4HN1A 2VVEA 3KV4A 4Q4X2 1VBB2 4BXFA 5F2SA 4Q4Y2 4XBNA 1QKQA 2ZGNA 4LBLA 1VRH1 2RM21 4YZ5A 2R1DA 4RGKA 3D8CA 2XLAA 3P1IA 5A7WA 4COZA 1KS4A 3M3IA 4ZZ5A 1K45A 2WNEA 2OW4A 4X6QB 3LEGA 4J1WA 1FX5A 1HXS2 2CY6A 2BFUS 4XABA 4OVEA 4XVHA 4FPEA 4AI0A 3AYDA 2K0GA 2X5IB 4BQWA 1S0IA 2VXJA 3WDUA 1QH7A 5A3UA 3W5MA 3GZAA 2FDJA 2JX9A 2UY9A 4LO8A 1VLNA 3D0JA 2C5DA 4G3YC 4BYYA 3ON7A 4XIKA 2X10A 2GMEA 3LEKA 2AUYA 1PGW2 5JSRA 3LFMA 1GSLA 4W8JA 3RJ2X 2ZBJA 1JH5A 2XJVA 3ACHA 3FLPA 5FZEA 3ZR6A 3ZPOA 2Y6FA 2E6VA 2UY8A 3NAPB 1GQHA 5FZGA 3Q9OA 5FOJB 3NNJA 1UMIA 5LK5A 3T4HB 1HV0A 4AQTA 4CCLA 2HEWF 4B4QA 1NLSA 1GWKA 2W1SA 3OGSA 3SH3A 4LKDA 1S2KA 1EV11 3WW1A 4LOTA 2VM9A 5F3IA 5K9YA 1F5JA 2AENA 3DYPA 1TMF1 3OGRA 5E8AA 1VRH2 1XU2A 4AXOA 2RM22 1VBC3 3VZLA 1VAKA 1JYXA 1UYPA 1T6BX 1X36A 1OOPB 2GZWA 2Z69A 4Y5Z0 2VMHA 4CP9A 3O1RA 4BJ0A 3WF4A 4FOQA 2DF7A 2C24A 3ST7A 1WD3A 1CZSA 1IS4A 4IEPA 4FFHA 4QKFA 5KHGA 3RZJA 3RFRA 4PCRA 3MHZA 3VL8A 1LB2A 5GALA 2ARAA 1CPNA 2RMU2 3NJXA 4LA2A 5F2WA 4YM2A 4YZ1A 2RS31 2P6HA 3WNMA 1W6NB 1WBFA 1DGWA 1TME1 1UAIA 3DPRB 2A3WA 5I8YA 1ENSA 1K5MC 2XL9A 2JDZA 1JYTA 1ALYA 5IWFA 4ZPIA 5FO9B 3ZO0B 1UOBA 4AI2A 1V9U1 3DV8A 1PMIA 3I3DA 1H1IA 1Z78A 1XB9A 1D4M1 5FLIA 4UW4A 5A7SA 4CDXB 2VTXA 2W0XA 1WCSA 4NN0A 3LE0A 2J1TA 2WZR2 1JZ2A 2BOJA 3AZYA 5E16A 1I6XA 2VBPA 4MH0E 3POEA 4OFGA 1EV12 2JKBA 2LM3A 2IZWA 1IQDC 1DCSA 4MGKE 4DIQA 1O7FA 2ZGKA 5FXZA 3ZIXA 3WQ0A 4JKKA 4ES9A 1OA2A 5FY1A 4ZU5A 2A5ZA 2BGOA 2XKPA 2YMZA 4EV0A 5FYSA 1C4RA 4FTSA 5FPAA 4OUEA 1RITA 5F3CA 3MIDA 5IFTA 4WVVA 3U11A 1RUD2 3ZXAC 1RUH2 3HWJA 3OSDA 1D0GA 2YXSA 2RS51 1PNFA 3I2OA 1RUE1 4DFSA 3OY8A 2QVSB 3WDXA 4HVRA 1QJU3 2EF6A 2C9KA 2C26A 1UMHA 5KXCA 3K51A 3PVBB 5FY5A 4A44A 4AGRA 3KCCA 4IE0A 3WZ1A 3ZYRA 5A6QA 1TME2 4D94A 4M0NA 2HEVF 1CJDA 1DFQA 4I02A 1GLHA 3I59B 1SBDA 3A4UA 2VUCA 1NUKA 1YLLA 3ES1A 5I0SA 3N4MA 4L9BA 4B29A 2E53A 2GH2A 2WO3A 1QU0A 4NPRA 4IUGA 1D4M2 4LK7A 4IEZA 4KBBA 4AVVA 4MYEA 4CP1A 1JZ4A 4OMCA 2WSUA 3ZFGC 4QPYA 1PO23 1G9CA 4YW3A 3ES4A 1A8MA 3VLBB 4CXXA 1J59A 2ERFA 4JHZA 1ZBE3 2E51A 5EV7A 1JMUB 3CNAA 1MEC3 4W4ZA 3M2MA 2A6ZA 1COV3 4N7UA 4CU8A 1Y3TA 5JMOA 1LESA 3FZ3A 1IS6A 2JG9A 2ORXA 1AR72 1GZCA 1QJFA 1TE1B 2ET7A 4OZOA 5EHDA 4MLOA 2YUEA 1FXZA 4QWNA 4Y5SA 3WLUA 1A8DA 4BOWA 3ME2A 2WAOA 5EYXA 1K5MB 3LCPA 4KQ7A 4E4HA 4Y20B 4NJ4A 2JD4A 1UY2A 1W6OA 1EAH2 2RJLA 2ZHMA 3M8LA 3R05A 4LHLA 1RYYA 4Y33A 5D2AA 4BIFA 5SV5A 5HCAA 5I93A 1ZRFA 4DMIA 1EUUA 2KR2A 3TEYA 5FY7A 3NKGA 2AEZA 3UGHA 3WG1A 2WNUC 1UXZA 4NIGA 3FHAA 1G7YA 5KXEA 1JU3A 3BTAA 3ZIWA 4A2UA 3Q8AA 4CCJA 4AEJA 3AC0A 1ENRA 3CJIC 5L36A 2J1RA 1JUIA 1VBC1 2GC2A 1C28A 4HFSA 3HR9A 4RSUA 2DTYA 3AKTA 4M3CA 5IK8A 3T0DA 2FZ1A 2IUWA 2W3JA 4CEYA 4BQ4A 2YC0A 2UURA 5B4XA 5LEJA 3C7GA 1VR3A 5J1XA 5LCWL 2Y6GA 2VD7A 2C0ZA 2XHKA 3AYEA 3LPGA 3PVNA 4NHLA 4XFHA 4BQ3A 1E5SA 4GMP3 1ULCA 2Z42A 4N53C 1ZRRA 2E32A 4Q29A 3THPA 4Z1VA 4BWOA 4O7XA 5CB7A 4YGDA 1BEV3 1UU4A 2WQ8A 3LDBA 2WDBA 3ZOIA 5A3LA 2BBVA 4TLGA 3S7EA 4P08A 5EIYB 3UNPA 2BYVE 2D43A 1U12A 3X29B 2WA4A 2UYAA 1E5RA 4MADA 4NOTA 2WAAA 3FHIB 3DGTA 3BIWE 1ND3A 5C9AA 5H9PA 3ETQA 3TRSB 2R0HA 4NIAA 5E6HA 4OLLA 4MO3M 3WQBA 2BJSA 2WC2A 5CIRA 4AFDA 4QHOA 4AQ6A 2E7TA 1GOGA 4UT5A 4QAWA 4QQLA 2UYBA 3VBSA 2NYYA 4ARXA 5FY4A 4DINB 1QMJA 1QXPA 4WVMA 4GZ9A 1KFXL 5IVCA 1VBC2 4CDUA 2VMDA 3W9AA 3BYWA 3IDEA 5FMBA 5EQUA 5A33B 4QKNA 1VALA 3NNMA 1D4VB 2HEYF 2W46A 3K4AA 4LQRA 4L11A 1HN0A 2B7YA 2HWE2 2JIGA 1DGRA 5BV6A 3OYWB 4NPMA 4NO4A 4AGVA 3V0BA 1QJU1 4H14A 4XE9A 5JAXA 2O1QA 3THDA 3LOBA 1C8NA 3CDZB 1VB4A 2BWAA 4N90A 4OHZA 3MLKA 4HONA 2WNVC 4J1XA 2I74A 3LKJA 5JXHA 1CN1A 1OQEA 2YU1A 2HWF3 2QQJA 1UPIA 1HRV2 2A6VA 1AR63 1S55A 1HKDA 2WNUB 3CIHA 1RUI3 1CVNA 3EJKA 3VB9A 3AB0A 3ZKYA 1PX3A 3B02A 1YWKA 3LIHA 1HJFA 1W8ZA 4LKFA 3WOGA 3KT7A 3KLSA 1SFYA 1HIXA 1PO21 4L99A 4FPKA 2VPVA 2VTFA 3SKVA 5AC93 1V6OA 1ZZ7A 2OA2A 1PNGA 1ZBE1 1D2SA 5BPXA 1CR7A 1MEC1 4PDWC 4XILA 4IV1C 4V1PA 3WNOA 4ARYA 3VZJA 1COV1 3K3OA 1QF3A 5CG8A 3ACLA 1W05A 1S0JA 2DCKA 4GH4C 4UF0B 1SFNA 1AXZA 1UIKA 3UESA 3D4KA 4CDWB 5FMOS 1LECA 4DEVA 4OHVA 3N7LA 3VKMA 5C8CC 1C8M2 4Y4YA 2EXIA 3WP3A 3MV01 2GC1A 3C7HA 5F5QA 4KGGA 4MV2A 5J36A 1H0BA 5LBCA 2MEV3 2YBPA 2JG8A 2ZABA 1JOBA 2CYFA 3BIEA 1POV3 5IYYA 5GLVA 1MACA 4MZUA 2AGSA 4TLFA 5LBEA 2XUMA 4NAMA 4LR4A 3MW4A 4LBKA 5E1RA 1RVF3 2RR13 4NR1A 1IG0A 1N47A 3ZSLA 5JVVA 4QMAA 5C3RA 4EWEA 4LBQD 3AFKA 4QHZA 1A6CA 2J1VA 1VBA2 3N7MA 4Z07A 1ZZ8A 3AKQA 3T4VA 2GC0A 2JXAA 2YG0A 4OMDA 3WDWA 3K77A 3DCQA 4AVBA 4OI2A 3IDCB 3E5QA 4IE6A 1PO22 3H1WA 4FVVA 4XFCA 5C3QA 4ATFA 4XFIA 4D69A 4OI4A 4U36A 2QQLA 1MZEA 3WNNA 2EXJA 1MEC2 1NA1C 2WLPA 4GMP1 3POIA 4JQTA 4OHWA 5HCBA 1G9AA 1COV2 1GBGA 2HWB3 1XNAA 1N3PA 2JDUA 3GCWA 1CJPA 4YZ3A 1V6JA 1BEV1 1VPHA 2Z79A 2WRAA 4FP3A 4BK5A 5GZCA 5FXWA 4RS5B 4Q4W3 3MEPA 4NUBA 5FZAA 4DXZA 2PFWA 1BK1A 1OD3A 4N53A 4QX2A 1Z7S3 1G8WA 4D3WA 1QJY2 4YYOA 1CZVA 4UAPA 2WNVB 4C1XA 3VZMA 1OFNA 2DFBA 4MGSA 2BV4A 2OVUA 2ZA9A 5D8AC 1MPXA 5BNNC 3O0XA 4MX3A 3RI8A 4RR3A 3HQRA 3LSEA 4GJYA 4RGAA 2RDNA 2EIBA 1REFA 2ZGPA 2Y6LA 3FL7A 4FT8A 4FQ4A 2K2SA 2OZ6A 1SPPA 1OC1A 1UQXA 1DG6A 4R9BA 1BYHA 3MPPG 3N9LA 2YYOA 4NRQA 3UGGA 3OD0A 1IS5A 4YRDA 5ACA3 3SKJE 2ZEYA 5H9SA 3RPQA 5FFOC 5HPOA 5F37A 1YRZA 1BXHA 2F4PA 1W2NA 1NCRC 1DQ6A 3IM0A 4QDRA 3HJRA 5I0DA 1UU6A 1BKZA 5FYVA 5CBLA 1PIV2 3VBHA 3OBAA 5F6LB 4CTEA 2ZXQA 3Q8FA 1LULA 4S2HA 3ZN4A 4MUVA 1UWWA 4BU2A 5M0TA 3FMGA 1TQ5A 2F4LA 1JYVA 4AWDA 1SLLA 4Y1ZA 2QQNA 1PX4A 4IERA 2GC3A 3PMSA 4WZCA 4XXAA 5C8CB 3VBFC 5JDBA 2PAMA 3NV1A 4CCDA 4EWDA 1CWPA 4JRAA 1UU5A 2VH9A 2VOWA 1CAWA 3C7EA 5A7NA 4HPKB 4IESA 1S0DA 1YC61 4LEJA 2VUJA 4Y24A 2HWF1 2QQMA 1GZWB 3TEWA 2WFF3 4ZONA 5KR7A 2B5HA 1W8OA 1AR61 3MW2A 5IVJA 2J1UA 3ENRA 4JKMA 1CIWA 1RUI1 1J1LA 1PO13 3RQ0A 1XPWA 4WVZA 5JUVA 1K5JA 1XBFA 5C6CA 5JXGA 1YQ5A 1R082 1YQ6A 3VBUC 1GZ9A 5AC91 2WA3A 3BTYA 1Q56A 1GFF2 4JQRA 4LLFA 3V64A 2WN3A 2JEMA 4YG6A 4CCCA 3ATGA 4Q4X3 1VBB3 5FKCA 1AR82 3OB8A 3UGFA 1DZQA 1KJLA 4FPCA 5KC5A 4BQYA 1NA1B 2XUEA 3MIGA 5DAWA 1E5IA 5F5IA 1PGSA 2YBSA 1Y7BA 1QOOA 3B3QE 2TEPA 1RJ8A 2QQIA 2FCTA 2G4IA 1W99A 2WYFA 5BXXA 1CONA 1W9FA 2QQOA 4C91A 1UY1A 4Y1UA 1ZZ6A 2B46X 2UWAA 5A1AA 1Q3EA 1XNKA 2MEV1 1W6PA 3CL1A 1POV1 4CUGA 3E5UA 5JOZA 1J3PA 3OTFA 1WWYA 2SLIA 3KMHA 3L2YA 4UOJA 4Q8KA 1SLBA 3BOPA 1RVF1 2RR11 3WXPA 5FXXA 1NE4A 3AYAA 1AR62 2E33A 1MZ6A 4LUKA 1CX4A 1DLLA 1DQ5A 4QXHA 1OURA 2P1BA 5L7OC 4FPOB 2PN5A 1GICA 4K6BA 1H8TC 1RB8G 4LHNA 5D1IA 3THCA 4A3ZA 2ZOEB 4RFRB 4AHWA 4K8RB 1O3RA 1N3OA 1GP5A 2WT1A 4RHV2 3E6DA 2ATFA 3AKSA 5LBFA 3ZN6A 3UT0A 4HOOA 5DUUA 1WGPA 1JHNA 3H3UA 2HWB1 4CU6A 4QKBA 2WUHA 4LBOA 3HT2A 2ZX0A 2RS12 1AF9A 2UWBA 5J98B 4OHYA 1OPMA 4Q4W1 3P6BA 1R092 3S5AA 1I5ZA 3G7DA 1JZ8A 4QPGA 1Z7S1 3IIAA 3WINE 3E6BA 4IETA 2RE9A 3A0NA 2CDPA 3U75A 4XUTA 4P5HA 1ENXA 1UZVA 3TNPB 5IVEA 4YZ4A 1H4HA 1LU1A 2MEV2 2RMU3 3T1MA 2VE1A 2WABA 2YC2A 1SLIA 2QQWA 3FLRA 3AP5A 4AEDC 3J8F2 4XBQA 4YW7A 1QOTA 5F1RA 2X53S 2EICA 2YU2A 3JXSA 2HKXA 4ZS3A 3W58A 3ASIA 1LOBA 3B00A 2VCMA 1QIQA 1SMVA 3GBGA 4AVSA 5A70A 1H6YA 4IV3A 3T08A 3AKRA 5ACA1 2P3YA 2WZ8A 4UW6A 4CPBA 2OPKA 5FAXA 2W52A 2DCYA 1SDWA 1WLWA 3IMNA 2DBIA 1IPSA 3TYJA 3PMEA 2ZGRA 4M0HA 4XJAA 1ZZCA 3HOBA 2WZR3 2VMEA 4IGQA 1GP4A 3PURA 2ZTNA 4R4ZA 4DUWA 1OVPA 2OT7A 5A3MA 3JU9A 2WQ4A 2BNMA 2RDRA 3N7KA 4PJYA 4S2DA 3VHOA 1T2XA 2O8QA 3E1F1 1HW5A 1ZX5A 2A7AA 4U2AA 1VJ2A 5GM0A 2O0OA 3PU3A 1V00A 1UX6A 5FYIA 1VE0A 3KV9A 5L9BA 3WUCA 4H2AA 2PQSA 1H2MA 1JTZX 2IXIA 2FCVA 2YBKA 1AX1A 4I0BA 4Q4W2 3N7JA 4QPIA 5EFUA 1IPKA 4P9IA 3ZFEB 2WFF1 5FZLA 5FLJA 5FMCA 1RUD3 5CKMA 1RUH3 5FY8A 3T30A 3U0ZA 4NWVA 1OKQA 1ACCA 4D8MA 4NIDA 4XHBA 1AJKA 1PO11 2XJQA 5CKQA 4ASKA 4LHSA 5J7MA 4MGYE 3IWZA 1HRI2 2GN7A 3VDDB 1L7RA 1G9BA 2CSGA 5L7OB 1YQ2A 5FJKA 1H8TB 1ND2A 1MVQA 2Q5TA 3UK9A 4HZFA 1H4GA 3NAPC 5CA6A 3C2UA 4Q4X1 5LA2A 2BERA 1VBB1 4K3UA 2GU9A 4A45A 1F9KA 1IZ3A 1CAXA 1GKBA 1HV1A 1Q8PA 2Q1ZB 3B5LB 2WT0A 3OUHA 1MVEA 5LRSA 2DUQA 1X8EA 4E2SA 2JE9A 1UYYA 4XUPA 1NZIA 3CZJA 1YJLA 5FYUA 1JW6A 3FJSA 4QX0A 1MQTA 2IWGB 4HKOA 2NQYA 3H50A 1LGCA 4LTAA 1WMFA 1ENQA 1GWMA 2K9ZA 3J7LA 3WG4A 4D6QA 3S30A 1PVC2 4IE5A 2VW0A 3H8OA 1NQJA 2RVAA 3I2FA 1ULFA 1PMHX 1GQPA 1HQNA 3S57A 2ZEWA 5DPNA 5BNOC 1YFUA 5GZGA 1AR73 3TNQA 4ISRA 4AEDB 1WW4A 1NXD1 4FFGA 1UZWA 1O8PA 3MF6A 4K1YA 5A6ZA 1O4YA 5CFDA 1ZZ9A 1JYWA 3S7IA 1QY4A 1EAH3 3FBYA 3LIGA 1YQ8A 1AR92 1LOFC 1AL0G 1WKYA 3VL9A 4CU9A 1W2TA 1YEWA 2XWJB 3IDBB 3AYCA 3POJA 1GR3A 4KI5M 3BODA 5AVAA 1W3XA 3J7HA 4LO7A 5T3NA 4M4RA 2VY0A 4LBMA 1XE7A 2JICA 1J3QA 3QD6A 3TOJA 3ZDSA 4L2NA 4BCUA 4CDXC 4BHPA 4PI0A 1SZBA 1CPMA 5TSWA 2OIIA 3QCWA 1XXNA 2YDEA 2TBVA 4QB2A 1UL9A 1NY72 3H3LA 1LHWA 1ST8A 2PHTA 2Y6JA 2DVFA 5JZGC 3WW2A 5LEKA 3DKWA 4JDNA 5C4WA 2J1SA 4W6YA 1JBCA 4C1WA 1SEFA 4NRPA 1RTVA 4UYBA 2RMU1 3AK0A 4GMP0 1SLCA 3KVAA 3O12A 1Y9MA 4KG0A 4JVAA 1EPZA 1W90A 4IEWA 4NPLA 5LASA 3BTZA 1WA4A 3NNLA 4CP9B 3WF2A 4LPLA 4K8FA 4XUOA 2WO1A 1NX9A 2D3PA 2Z4FA 5CADA 3BCWA 1IKPA 3E97A 4UBHA 1CGPA 3JQWA 3KV6A 4QDSA 1X9TA 5A3OA 1F31A 3D82A 4FBFA 3VKNA 4J25A 2FDIA 4QGMA 2LS6A 5FTTC 5FMDA 3B93A 4F8AA 3B01A 1DLCA 2VXRA 2WZR1 1DYPA 3LOIA 3AP4A 2IXKA 3MBWA 3WNPA 5DZGA 2DU0A 5CFCC 1W0PA 2R30A 3GZUC 3THTA 4BK4A 2G9ZA 3UJOA 5FO8B 1QQP1 2D97A 3VBRA 4F3JA 3URFA 4C0BA 3OCPA 4P00B 4DZGA 2I45A 4JV4A 4TYSA 2B9VA 3A22A 3GCXA 3NW4A 1Q8OA 5HI0A 1OBNA 1EYBA 2HWE3 1RUD1 1RUH1 3HAGA 2FDGA 5BNOB 2WIIB 4CXWA 3I97A 4JC1A 5FP9A 1FPN2 4W65A 4DS0A 2RV9A 4LULA 3ZXLA 1M06G 1RINA 1UKGA 2PQQA 3WDTA 3OBZA 5L9RA 3PUSA 1CAUB 2AACA 2ZPXA 3WT3A 1VBD3 2Z2SB 2X5IA 3DN7A 3V56A 3AJZA 4X6RB 1LJ7A 3I8TA 4ITCA 3I54A 2K46A 2FDFA 1HRV3 1QNWA 3D6EA 4QKDA 3RYRA 3ZYPA 4BDVB 5FYZA 1RL3A 4KU7A 1BCXA 2VMFA 2EIGA 3DUIA 3I2GA 3LWCA 3TEXA 1YCIA 2F17A 2IFWA 3L9JT 1L3JA 1LRHA 1QGLA 3KQ4B 4AFBA 2J22A 2ZACA 1SHWB 2QQUA 4AOCA 2WBKA 3MV11 4Y5TA 4QPWA 5FZBA 3CHXA 2RJ2A 1H9PA 5ANQA 3NWKA 3R4UA 2R1BA 1QQP2 4BZ4A 1G86A 1TNRA 2A75A 2P17A 4LKEA 5FKBA 5JZGB 3OGGA 1JYCA 4ISQA 1JHJA 5ABJC 2ZGMA 3BGAA 3M3OA 3U07A 4PQQA 4CDQA 3FFQA 1M4WA 5EPAA 5FPBA 2XXZA 3I2KA 4TN7A 4GULA 2DCZA 1AR71 2EALA 2G9FA 3J4UH 4N9IA 1OOPA 1MZFA 1WMEA 4IEXA 5A6XA 3CZUA 4FCAA 3H8RA 1C8M3 1OLRA 5FYHA 2QZ2A 3F95A 1DU3D 2FD8A 1EAH1 1OLME 3NSTA 3SH4A 1RUG2 5CNAA 2BU9A 3KT1A 3VKFC 3MUY1 3QACA 4XFBA 1POV0 4LJHA 2IC1A 4Q0SA 4YNIA 2ZGSA 3WF0A 1N1SA 3DPRA 4P9YA 5FZHA 4COUA 4OCTA 4JKLA 3RZZA 4KG8A 3WHTA 2ZS6B 2Y0OA 4P9LA 1VBA3 5CFCB 5FDBA 2IXJA 1UCXA 4AAPA 2ZGLA 4FPHA 4OUSA 1R64A 5A1FA 3WDVA 4CDXA 3BB6A 3DYMA 2PXJA 4QXCA 5ANNA 4LITA 4CSWA 4EN8B 3GDBA 4WVWA 2D7FA 2H6BA 1ONAA 3H7YA 5ERLA 4HVOA 1RMU3 1DZTA 2E9QA 2FCUA 4UFHA 2VZSA 2FMYA 3ZYIB 1UXXX 5FZ7A 4CEYB 5KXBA 4HL0A 4L97A 2JECA 3D3AA 1QJY3 4E8DA 3IIIA 4CVUA 3ZXGA 5FZ6A 2NLRA 5A3TA 1GANA 5IVVA 3V0AA 2HYXA 3RSJA 4Y26A 3NMBA 4HT1T 5BUVA 1ZZBA 4NMIA 4XAEA 3RG0A 2CDOA 3U4XA 3VD3A 3CKHA 3AVRA 1JXNA 4O61A 4ZXEA 2IXLA 5JPMB 4QB1A 4KWLA 4XTPA 2R042 3O1MA 2AREA 2CGNA 4EROA 1MS5A 2MHFA 3RZGA 4JTNA 1KS5A 1GOHA 2DCTA 4XYXA 5J3UA 2P3KA 3CLPA 5BNPC 4QX8A 1GV9A 1ZYBA 4CCKA 5EP9A 4CUBA 1C1LA 5LY2A 3RDIA 5C9AB 4XURA 2VCCA 4AI3A 1PIV3 1QEXA 2WNOA 3HN3A 5DXDA 2EIDA 5ABJB 1WCDJ 4LIUA 5JCTA 1OH3A 2HWE1 4IEVA 3KHCA 3F2ZA 1HB4A 4COWA 1YFYA 5FZ0A 4INDA 4YW6A 4ASLA 2FBEA 4EZHA 3JQXA 1EP0A 1FATA 1E5HA 3WNLA 4LXLA 4CDWC 5K7PA 3BTXA 2ZMNA 1SCRA 3OJBA 4ES8A 5JSOA 1VBD1 2WINB 4JGYC 5FY9A 3OGJA 1UMZA 3RYKA 4AR2A 3UKTA 4WM7C 4AL9A 2Y33A 1EUTA 3BVCA 1QH6A 2A70A 4AW7A 1HRV1 1RXFA 4QXKA 5DAXA 1KGYA 1RIRA 2NPIA 3LAGA 1QJEA 3O5SA 2NM1A 1ULEA 3IPVB 2XPJA 1XYNA 1EPWA 1W6QB 1K5MA 5FQ0B 3V0BB 3U78A 2FDKA 5F5CA 2JDYA 3DECA 2ILMA 4JCKA 5A6YA 1XC6A 4AFCA 1R083 1ULDA 2NZ9A 4A7KA 4XZPA 3ACFA 1JZ5A 5AFEA 3I2IA 4Z2WA 1O91A 3N36A 2F6BA 1UY0A 4IEUA 3B94A 1AR83 3NJYA 2DTWA 2GP5A 2JB8A 3C8XA 4H3WA 3N9MA 3CQOA 4UFJA 2Q8EA 1WCKA 1ZRIA 4H55A 2AH2A 1H30A 3PVOA 5C71A 3USSA 1UN1A 2EAAA 1YJKA 2DV9A 3ECQA 1HLCA 1W6MB 2H6CA 1DBNA 2WZPP 5FZIA 3WP5A 1SFPA 2XKOA 1C8M1 3POWA 1WMDA 3H8XA 1CD3G 3JCIA 2W47A 3PDQA 5FV3A 1QJZA 3R6SA 1OFSA 1WCUA 4BLIA 1YO8A 4CPBD 1FOD2 4RS5C 2VQ0A 4DPNA 4AI9A 5DMYA 1VBD2 4RA0A 2YV8A 1T6GC 5IAVA 1UY3A 3MZHA 3AKPA 2CAUA 5JI7A 4GB33 4WZFA 5JR7B 2KA3A 4IW3A 4ZY9A 3VHNA 3AXDA 2VOTA 3AZZA 1VBA1 4Q0UA 4TXWA 1W9SA 2DVAA 4GWMA 3NRUA 3AMMA 1I3HA 1OQ1A 2AC1A 4I3GA 4Y3OA 1NYWA 4UXAA 3KHBA 1B35C 3LGRA 5BNPB 4QM9A 3BUCA 5EWSA 2V4AA 4RHV3 1KITA 3AMPA 2AZ5A 5K0UC 4XF1A 2QBXA 5KWRA 3RI9A 5DAQA 1WD4A 4E2GA 3NQHA 3USUA 3RZKA 4I2OA 2IVJA 3ZFGA 2GNTA 3RZHA 2D6MA 5I8TA 3ZSEA 4H7LA 4AI8A 1RMU1 2RS13 2ZGOA 4JDOA 1VMJA 2A6WA 2UU8A 1IQAA 3NJVA 2VMIA 3J7NA 5FPLA 2XJSA 3NKTA 1R093 4JGYB 1QJY1 2QTWB 3BI3A 2VVDA 3NJZA 4MGZE 2TNFA 4WM7B 3WF3A 4HSJA 5DDJ2 4AI1A 2JDKA 3OYWA 2WZEA 4Z8BA 1U0AA 3E5XA 1G9DA 2P2KA 4YVWC 4DB5A 1S0GA 2G9GA 3J8F3 3GM8A 1AXKA 2VQTA 4EJRA 5LRRA 2J1AA 3GJAA 5KHIA 4O9EA 2BVVA 2V73A 3U4SA 1RJ7A 4UFMA 4CU7A 1GU3A 3ZXEA 5EJZB 1SBEA 4NHXA 1A34A 1CAVA 1ZA4A 4HN0A 1VRBA 3VUOA 2WNUA 5BYNA 1X50A 1WW6A 1PIV1 5FY0A 2GN3A 2AEYA 3CJIA 5F7UA 4QU1A 2E26A 4QQHA 3VD4A 4QHBA 1I5PA 1NOVA 3KS7A 3IZOA 1SPPB 3FLTA 4ET7A 1SG3A 3JD72 4RQPC 4IDZA 4R52A 1X8MA 2XWBB 2GNDA 2TUNA 4NVPA 1RMU2 1V70A 5A32B 3IN9A 3PJYA 3K75B 4OI1A 1W8NA 4FAGA 5JSPA 4LLOA 4JGZC 3DKQA 5SV8A 3VBHB 4HK8A 2D6PA 3POSA 1DDLA 3AXEA 1V6NA 1XSQA 3Q8EA 4I01A 1JI6A 1S0CA 3KF5A 4A3XA 4UFLA 3NO8A 1UKRA 1PM7A 1X82A 3GGLA 1HRI3 4I30A 1PK6C 5EZWA 1HB1A 5GLZA 1R081 1NAEA 4HANA 3MDPA 2QQPA 1CAWB 3WV6A 5FZ8A 1B35B 2PHUA 1J58A 1UPSA 5FZ1A 3VZOA 3HEIA 1OHFA 5IUQA 4CCOA 4FSJA 3JBG2 1H9WA 3A0KA 4XFGA 4FP2A 5K0UB 4WBBA 5LK7B 1AR81 3PNAA 5T5OA 2GAUA 3AZWA 2WSVA 2W92A 5JOXA 4AHZA 4N9HA 5FZ9A 4XAAA 5T50A 2YPJA 4JX0A 5J09A 4H7MA 3FN9A 3M3CA 2W2IA 4GKXA 4BA6A 2RDSA 2FDHA 4YLZA 1WCQA 1YHFA 4ONUA 4DXSA 2XONA 3Q8BA 4TZDA 5FPVA 1L7LA 3I3EA 5JOWA 4P9WA 2P6CA 2GNBA 1RC6A 3FBMA 4MOAA 1PVC3 5FYMA 3HVDA 2GSYA 5F5AA 1JUHA 1NCQC 3OPTA 2GP3A 4IEYA 2BBAA 4YVWB 2OYZA 3PUAA 4GB31 1JS9A 2YFUA 3OPWA 2XH6A 4N43C 4XZUG 3WEZA 3WG3A 3IKWA 5FBJA 5B4NA 2WNVA 1UF2C 1W8TA 3ZVXA 5IK7A 3BN6A 1WMXA 4W6XA 4XJZA 1AR93 2BW8A 3AM2A 3EQEA 1W6PB 4N8MA 2YGMA 1NT0A 3SH5A 1F8VA 2D6KA 4RHV1 4ZS2A 1NQDA 2QJVA 4Y1YA 4BQ2A 3H3ZA 5FZCA 4MHRA 4CEWC 2JIJA 3J26N 1W9TA 3ZXFA 3H8UA 1VIWB 4JAAA 1LKNA 3POBA 4Y1XA 5KHKA 1RUOA 3PIGA 4LK6A 2VZTA 4PLOA 2RS11 3I3MA 4RQPB 2GH8A 4PBPA 4YSFA 4CP2A 4S2FA 3ABZA 2HBUA 4Y22A 4PDWA 1R1A2 1GUIA 1R091 3I2HA 4IV1A 3POGA 4K21A 5FUNA 2XLGA 4IE7A 4MGQA 4QXBA 2A1XA 3D0SA 3U14A 3WF1A 4GH4A 4JGZB 5FYCA 1SACA 2I07B 3MLLA 3VDAA 2HWC2 2XVLA 3A23A 1YFWA 2VZ3A 2XG3A 3CEWA 3ZPYA 2XMLA 1BK0A 1LODA 3I2JA 4Q0VA 4P9JA 3ZDVA 4EE2A 5LW9A 1RHI2 3SHRA 3ZFEC 5C8CA 3O1UA 2LALA 4EQVA 1LEMA 3J8F1 3WW4A 1CZTA 5FUPA 4LIVA 3RGBA 2VNRA 1PK6B 3KCXA 4GB32 4YVSC 3OEBA 1DYKA 4FO9A 4HPKA 4D0QA 4QPGB 4QGNA 3PUIA 3EO6A 2CTVA 3POYA 1F5FA 1GQGA 2W91A 1W2OA 3VDDC 1J83A 3ZFFC 1FAYA 4AEMA 3ZYGA 1OUXA 5BNQA 4D6RA 5FWEA 4I0AA 2W39A 5FLHA 2G1MA 4G4FA 3W21A 5JMCA 1MS0A 3DL3A 4A6SA 2Q30A 4C8DA 2BNOA 2L9LA 1PVXA 5DUVA 2XHNA 4QX7A 5DUWA 2W1UA 5GLTA 2GDFA 1AYM2 3S5QA 1AX2A 4KU8A 3GJBA 4E2QA 1FYUA 4A7YA 2JD9A 3J9SA 1OF3A 1OLQA 1YI7A 3MO4A 3LA2A 4YFZA 5LA0A 1O4TA 3SITA 1QXJA 3VBOC 1IKQA 2ADEA 3HNBM 3IAPA 1OPOA 1NA1A 1S2EA 1LTEA 3FC0A 3PUQA 5T55A 4E9KA 1IOAA 4OI0A 1NCQB 1O8SA 2W9XA 3KF3A 1SCSA 5FP8A 2FMDA 1IS3A 1FPN3 3ITQA 2PELA 2D6OX 1OD5A 4HLTA 4N43B 4XF3A 4CXYA 1HRI1 4IGOA 2ARCA 4LE3A 2ZKNA 1XJAA 1NE6A 1UW8A 3K4ZA 1F35A 1XNDA 3WP6A 2WKKA 5D8AA 4PIXA 2XJUA 5BNNA 4FOWA 2WFPA 2I2SA 2O8OA 3B9IA 1N1YA 2CWSA 1TG7A 2DUOA 1C5HA 2VTXJ 1LOEA 2XL7A 3OEAA 4PF5A 3CJXA 4Z82A 4LA3A 5FO7B 4AZZA 4EN6B 3HQXA 5FZOA 2ADDA 1AL22 4XCBA 4CEWB 2HLEA 3NNFA 4I09A 1JYNA 1AYN3 1CESA 4Q4V2 3KGLA 1V6KA 3EXUA 2VAUA 3PU8A 1MR5A 2PHXA 2X29A 3EB7A 3OUIA 2RDQA 4KL1A 3WHUA 4GAZA 1XU1A 4YW2A 1LAJA 5HXVA 4KH9A 1LEDA 2OZJA 3T09A 2JE8A 3ZSJA 1NCRA 1OF4A 4MXWB 5JIAA 5HXMA 1QQP3 1UZYA 2P34A 3O1TA 4JTOA 1PVC1 2WQZC 4XDOA 1RUNA 4JDMA 4KMQA 3RVHA 1CAXB 1AX0A 2WLQA 4WM8B 2PHLA 1FV2A 1V6IA 1OA4A 2VQAA 3LDRA 4W6WA 5GLWA 2R063 5LB6A 2VJXA 4DUVA 3R4SA 4FOYA 3VBFA 2FQPA 1YNAA 5FUIA 2EXKA 1MQTB 4MXVA 4LBQB 3KM5A 3GALA 5DG1A 1UNBA 4YVSB 3VZKA 1QXRA 2R6QA 1XNTA 1VB2A 1YQCA 2VVFA 1RUG3 1AR91 1SQ4A 3U10A 2VOXA 2R072 3ZFFB 1R1ZA 4YW4A 4QX3A 1W06A 3I3BA 1GYKA 1OKOA 1ZREA 4YZ2A 2IXCA 2XJRA 4A42A 1C5IA 1CQ9A 2BGCA 3SCFA 2R0FA 1FI2A 4YGBA 5JOYA 4XXPA 5T5JA 2PHRA 3H1YA 5CVRA 2W1QA 3B69A 1F15A 1US3A 3VBUA 5JWPA 4YFWA 3RS6A 4KWKA 5IVFA 3SNMA 5LY1A 3T2PA 2PLV2 3M70A 2ZGQA 1W0NA 4RFT0 1NY71 1REEA 2W1WA 2WR9A 3H42B 5F32A 5FP3A 3PL0A 1N3QA 3VBOB 5L9VA 4FAHA 1DYOA 1VBE3 1ZRCA 1IGOA 4YW1A 3GNEA 3JB4C 2GALA 1LHVA 1DQ4A 2VO5A 3VD5A 5GZDA 1WW7A 4Q0QA 3LA3A 2W87A 3O7OA 4FXGB 4K7JA 3SLIA 3ZMOA 1RUJ2 2D3SA 2XB6C 1H8VA 1W39A 2DDUA 2Q4SA 5A7WB 1V6MA 4LUMA 5EJ1B 3VZNA 5CAZA 3BPZA 5J96B 2JDAA 4BMEA 4YG0A 3ZN5A 1GNHA 3JZVA 3MI8A 4DXTA 4FFIA 4XF9A 1W8UA 2V5DA 4R9DA 4AQSA 4Z92B 5T54A 2VU9A 2DCJA 2OS2A 3T1LA 2R043 2CL2A 3VDDA 4S2GA 4HKLA 2Z5WA 2Q0AA 4OYUA 5L7OA 1H8TA 2D44A 5F39A 3MGUA 4XBLA 5JR2A 3WCRA 4AGGA 4HXCA 3OG2A 5F6KA 1W2AX 2VZPA 2WO2A 3CO2A 3KVBA 3ZXKA 4XDPA 5DZFA 3LF7A 4EYUA 5CEHA 2AR6A 4LORA 5DQ0A 1SLAA 2JJ6A 4UW5A 1OMIA 1RUC2 1E57A 3LD8A 2YGLA 5T52A 1FPN1 3N9QA 1J84A 4DNYA 1DGLA 1DGWX 5E89A 4JRLA 4Y4RA 1Q8QA 3KT4A 1W2UA 4MVTA 2A6YA 2LTNA 2WWJA 4BQXA 4IQPA 5IT6A 1BMV1 2XGXA 5IK5A 1LENA 5FPUA 3QOPA 3QH6A 4UBGA 4M3CE 1FT9A 4B1LA 3UV9A 1HJGA 5KHJA 3HD8B 4NROA 1IPJA 4AEDA 4LO5B 1NG0A 4LBJA 4B4RA 2ZKLA 4B8EA 1XRUA 2Y60A 3R0RA 1ODMA 5HV4A 5I91A 4IE4A 5KXDA 1UX7A 1AYN1 2X05A 4HG6B 3T2TA 2JG9C 1LOGA 2VOVA 3BPSA 1N1TA 1BBT2 5C33A 2JDHA 2JDNA 1XNBA 2CAVA 1ODNA 4XUQA 4CZSA 3EMRA 4YPJA 3GHNA 1O3SA 1O5UA 1VMFA 2VZVA 4NE9A 1Q8VA 3HQUA 2ZMKA 3MICA 5IATA 5JXIA 1RGSA 1KDKA 5IFPA 4CUAA 2QUOA 2R061 3INAA 4UFIA 3VDCA 1RXGA 1HQLA 3I2DA 1BHGA 1O6UA 5AVPA 4DO0A 2WWSA 4F83A 4META 1H2NA 2CWMA 5FXVA 3K4DA 4B1MA 4AAXA 4COVA 2DVGA 5FK8A 3DYOA 1QDCA 4EN9B 1RUG1 1FOD3 3CU7A 4UW3A 4CEYC 5BY5A 2CHHA 5JIUA 2B4KA 1K42A 4XJWA 3O14A 1BMV2 2BZDA 4CDQB 3AMNA 1EY2A 3JUUA 4Q8LA 3OPZA 1APNA 4SLIA 3I49A 1BQPA 3QBQA 1PZ9A 4NIIA 2B8MA 4QD2A 4ZZ8A 5C5TA 3ZXJA 1J1TA 2D93A 2EVXA 3CF6E 4Q1PA 3OY8B 4YWAA 4J6GA 1QJX3 1YIFA 1AYN2 1Z0HA 2VW2A 4HBNA 5FPXA 1O4ZA 5HCHA 1WUVA 4AHXA 3NAPA 1HN1A 3S6PA 5L73A 2VNOA 4C90A 1ZRDA 2VC9A 2MPFA 4PHZA 3GHMA 1VBE1 5FBZA 3SEEA 2IXHA 5FOBB 1ND3C 2NMOA 5C9AC 4BH9A 1DQ0A 1W3VA 5IJRA 3FFZA 3VN4A 3K3NA 4FQZA 5D21A 1S4CA 2MNGA 2R062 2YROA 4PF1A 4XTMA 2WYSA 3GZTB 1DQ2A 3D5OA 2HJIA 3VBSC 3PLQA 1KEXA 2D5HA 4XQWA 3VKLA 2N7GA 3S0MA 4AFAA 4PIZA 5DDJ3 3M3QA 4CDUC 2NMNA 4AFMA 4CE8A 3OD4A 3KV5A 1LR5A 4A4AA 3MLJA 4L0PA 5GZEA 5BNOA 1SBFA 2P4EA 2VZQA 3GYDA 4KGQA 3ZYHA 1O3QA 4R4XA 5G04L 2DFCA 1FV3A 2BFUL 3PJQA 2R32A 1TMF2 2R041 4LE4A 3J7MA 2PAEA 4COYA 1CAUA 4K40A 1MZ5A 1W6NA 2WS93 2JG9B 4FTEA 4ATEA 3PUHA 1LOFA 5JPNB 2BPA2 4AVTA 2CV6A 2BNNA 3GBWA 5C70A 1BVVA 3V0AB 1W8WA 4P9XA 4MGTA 1W6OB 5FIXA 2VCBA 1P8JA 4PIYA 3ZXDA 1RUF3 3APBA 3HBKA 1W03A 2BUKA 4GWIA 4URAA 5LZ6A 1WLCA 4URTA 4GA9A 4Q2FA 5DAVA 5FZDA 2RS32 2YHJA 4RD7A 2VR4A 1VBE2 3T0BA 1IHMA 2D40A 1H2LA 4QX1A 3SQOA 2YB7A 3JD73 3ACIA 4GKYA 1NZCA 2A71A 4LOSA 5FK7A 1OI6A 1ULOA 3AMHA 4XOGA 2X09A 3RNSA 3WQ1A 5IVBA 5JZGA 4M3CB 4GWJA 4R8HA 3O1OA 1FMD3 1D7PM 1N1VA 4FXKB 1V9U2 2Y34A 2D6LX 2HBTA 4AEKA 2ZGTA 4UI9L 1PMJX 3OF1A 2VNGA 4CYDA 2XVKA 1Y43B 4IXLA 4P5YA 4WV8A 5FCCA 3PTYA 1ZM1A 3EHKA 2B9UA 2XDVA 4FPLA 1MS9A 3N9PA 2WO7A 3WUDA 3I7DA 4QQPA 1HDKA 4NHYA 3U37A 3KCYA 1AHSA 3JBG3 1WA6X 3I59A 1QWRA 2EXHA 4HMZA 2JG8C 3MPBA 1ND3B 2W08A 1C3HA 3ZKUA 2ZX1A 1ZA7A 2RS52 5CFCA 3ZSMA 4Q0PA 1RUE2 3TN93 1K3IA 2R49A 4GQ7A 4FFFA 3H0OA 1VAMA 2CU5A 5FR3A 2LROA 4GALA 1GOFA 2W94A 1GP6A 5I0TA 1TZOA 2J42A 2BRTA 3VBSB 2ZHLA 2A73B 1BLZA 1FOD1 5F8PA 4WVMB 5FYTA 3O0WA 1KFUL 2LRPA 2PA7A 4HSLA 4CDUB 2E63A 1HQWA 1MS3A 3WD5A 1SLTA 2D5FA 4FPYA 3SISA 2V72A 1J3RA 3QLQA 4B7KA 3O1SA 3HMYA 3LEIA 3M7AA 1LNSA 4HETA 4BPZA 1H2KA 3ZR5A 4B3NA 4PLNA 1YFXA 3KB5A 3HPNA 3W20A 1UO9A 3RMYA 1YXWA 1KD7A 3UYJA 2XQXA 2YFZA 1QJX1 1LOAA 1TNFA 2B39A 2JDMA 2OQ6A 4JHTA 3C3VA 4Y20A 4OQ9A 3WX5A 5KC6A 1S1AA 4M3CF 1YYNA 2BWCA 2QKDA 1UY4A 2XBO3 3A7QA 3KGZA 1ZBA3 2FZ2A 4PQ9A 2Y8KA 2ZCWA 5KHHA 3PVEA 2PTMA 3O0VA 3W59A 1MS1A 1XQNA 5FJHA 4BB3A 4EN0A 4M00A 4RR3C 1F4HA 2VZRA 3RWKX 4EN7B 1SDDB 2VMGA 5C5UA 2A6XA 2Y0IA 3AX4A 2O14A 1S0BA 4OUMA 5IHRA 2ETEA 2XOMA 2V5YA 1R1A3 3SMHA 2XJPA 1O5LA 2J1EA 2YZ4A 2PAKA 1DF0A 3MFCA 4XETA 3T0AA 4AQ2A 5JXJA 5ABJA 2JB4A 2PHFA 5C3PA 5J37A 5DDJ1 3IB3A 3B7MA 4YM0A 1AZDA 1Q5OA 2HWC3 3FHQA 5H9QA 4XQ4A 3RYPA 4AF9A 1ASJ3 1FNYA 3USUB 4BIOA 3ILRA 4BISA 2DYCA 3ZFGB 4DRRA 1RHI3 2D6NA 3TAYA 2HH9A 3VBHC 4E8CA 1CX1A 1WW5A 1DQ1A 2WS91 1XNCA 1BZWA 3RJRA 2C1FA 4MGIE 4YGCA 3ILNA 5DN2A 2ZAHA 5C3OA 3FUQA 2GMMA 4KBZA 1F2NA 2VCAA 1UD1A 3OBTA 4NHMA 5FZKA 4CCNA 1JYIA 4KNCA 2KD7A 2RJKA 1QJX2 2Y6KA 3IPVA 2IFRA 1GNZA 1RUF1 2JG8B 3MIEA 3TBDA 4ZHNA 1W6QA 5FQ0A 1O3TA 1XE8A 1A3KA 3P3NA 4QQ2A 3P5BA 4LBNA 2J7MA 1XE0A 1JOPA 3MW3A 3JD71 1PZ8A 3HN1A 3G6JB 4Q26A 1AYM3 3T3YA 4LNVA 4O65A 1CAVB 2QE3A 3KSCA 4IGPA 1X33A 1BJQA 1H6XA 5FZFA 2D3RA 5KBFA 3W5NA 2W68A 5FREA 1FMD1 4FPGA 3SCHA 2OUJA 1JZ6A 3TEZA 5F3GA 4HK9A 5A33A 4DQAA 2OXBA 4LMFA 3MF9A 4C0HA 3CJIB 5ISLA 3ZM8A 2GNMA 2Q8CA 4P14A 1FNZA 5C3SA 1W6MA 4SBVA 2OX0A 4XF0A 2Y64A 4XUNA 2RHPA 5A7OA 1OLMA 2BDRA 3MIFA 5JLVA 3M3EA 3KWVA 2BGPA 1S2BA 2VBDA 1LCLA 4CA9A 2VBBA 1Q43A 4AG4A 3GXUA 1O59A 2EIEA 1ZNPA 2WS92 3C7OA 4CP0A 3VDBA 2BP6A 3K2OA 3JBG1 4N53B 4XEZA 5DABA 3T2QA 5AFBA 1S0EA 4NAOA 2P5BA 3IBMA 1U5IA 4XIOA 5DAPA 1AL23 3WVJA 1TEIA 2R7EB 1B09A 4XJ9A 1PGL1 2VQUA 4Q4V3 1RUF2 4ASMB 1LU2A 4RR3B 3TN91 4UFKA 3LDKA 4Y1VA 5BNPA 1QJU2 3KD4A 5FP4A 1VMHA 4D7TA 4OZXA 3AP9A 2V4VA 2ZEZA 4TSVA 3H7JA 4OULA 1UZ0A 4GIQA 2VL4A 3AZVA 2W95A 4YGEA 2XVGA 4B7EA 1W9WA 4DEQA 3GBFA 4E4DX 3SC7X 1FMD2 5LA9A 1OT5A 5DG2A 4BMBA 1BVP1 5FYBA 5HCFA 4UF0A 4D7SA 1KQRA 3AFGA 4CDWA 1QNYA 2ES3A 2ZJCA 4DY3A 5K8SA 4TWTA 3OGVA 4FPFA 4JGYA 1AVBA 2DU1A 3WG2A 1REDA 4N7IA 4WM7A 3LA7A 3N9OA 1ZBE2 3HBZA 3ZMNA 2R073 2X8KA 5CZKA 3DXUA 2OQ7A 2WN2A 2Y26A 3FUOA 5GZFA 4QGLA 5FWJA 4QPGC 3I3QA 1UYXA 4GD4A 3RMXA 4XF4A 2XBO1 2QDRA 4LHKA 1ZBA1 1YIPA 4ZU7A 1UOFA 5A3NA 2JE7A 4BLJA 4V2VA 2ARBA 5FPZA 1KRIA 5C7GA 3C7FA 2Q8OA 1UZZA 1WLDA 3CBNA 4G9SB 3WR0A 1AUYA 1UOGA 1PGL2 2Y6HA 4GWNA 2BQPA 4XMAA 3WW3A 3BU7A 1DZRA 2PHWA 1MS4A 4I0WB 3TN92 2PLV3 1R1A1 4QDQA 1LGNA 4K1ZA 4AVCA 1I1EA 2HWD3 2B45X 2ORZA 1NXMA 4IV3C 3ETPA 1LHNA 3BOWA 2NP0A 3IAQA 2P3JA 1ULPA 2A3XA 2HWC1 3FX3A 3LPFA 2Q1FA 2XLFA 2XQRA 1ASJ1 4Q5OA 4AK3A 4CUCA 5CYYA 3H1MA 3ORJA 3T2OA 3TWIA 4JZRA 1RHI1 4QB6A 1WLTA 4PI2A 1RUJ3 5FZ3A 3U1XA 1OSGA 1DP0A 1NLQA 2EA7A 4X8NA 5CKNA 5A32A 5IAXA 4Y22B 3Q8CA 2BVBA 4PDWB 4IV1B 4RS5A 4XJUA 4XFAA 5IVYA 1TVGA 3UJQA 2ARXA 5FMOL 4GH4B 3I4IA 3GF6A 2P37A 1UOJA 3WNKA 4LT5A 4DY5A 2BOIA 2VULA 4BE3A 4QPIC 2WJSA 3WQ7A 1D2QA 3MYXA 1XOYA 2Q1MA 2XBO2 4O9GA 1ZBA2 1BEV2 3UL2A 4ZKTB 4R9CA 2JWPA 4XMIA 3B9CA 4HKWA 4P02B 1B35A 2VW1A 1JZ7A 1X7NA 1AYM1 4F7ZA 4YM3A 1C1FA 2GMPA 1JZ3A 1OH4A 4DUXA 3AZXA 1KXGA 3QH7A 1Y4WA 3NV3A 5I0UA 5K0UA 1GWLA 3ZYFA 1QHDA 2PHDA 5DUXA 3O1VA 5FP7A 5GKAC 4UWDA 4PBOA 5LBBA 1JU4A 1MS8A 1ND2C 1WZXA 1LHUA 3SCGA 3WY6A 4BQ5A 2OPWA 4B4PA 3SEPA 4RGGA 5I0RA 1GNYA 1CIYA 1RUC3 4QU2A 3OUJA 1DIWA 4WM8C 2LUWA 3ZN6B 4CRQA 3MFAA 1ASJ2 3NV4A 2VUAA 5IW0A 4Q27A 3DEMA
chains in the Genus database with same CATH topology
3NV2A 4KWJA 4XPVA 3TB0A 3NVCA 4Q4Y3 3AP6A 1MQTC 1OQDA 2ZX3A 2P3IA 3VKOA 1XYPA 3ZYJB 4YVWA 2ZX4A 5DZEA 1GZWA 2UWCA 3KZ4C 2ZZQA 1PHMA 2BEOA 1AL21 2XJTA 4I3PA 5CU1A 4HVQA 5B2GB 1HXS3 3AP7A 3RWNA 4Q4V1 1XYOA 3LB9A 2BTVC 1BBT3 3HT1A 4XFFA 1DGRN 3IT8A 3AMQA 2QDNA 5GLUA 3LZZA 2V09A 2B42B 2PYTA 5D8AB 2SBAA 5BNNB 2CGOA 5CFDC 1W0OA 3WCSA 3BALA 4MSVA 2HWF2 4IV3B 3NL1A 2CGPA 4XHXA 3N3HA 4ORFA 1RUI2 4ZXKA 5FRAA 4AHYA 5JI9A 4RQPA 2DVDA 3L2HA 2DWRA 1S0FA 5IK4A 3R4DB 4E4SA 1V6LA 2A3YA 3WDYA 5AC92 1NCRB 4GXLA 2DVBA 3K48A 4JGZA 4R9AA 2R071 4AYUA 1U5XA 2Y38A 3ALQA 1H1AA 1H1MA 1VRH3 3EBRA 2RM23 2VG9A 5EXOA 4ZU4A 4E27A 2HYKA 4QPIB 4XDQA 5T5LA 5C4WC 3DF0A 3N35A 3ROUA 2YY1A 1PK6A 4QT6A 3VBFB 1YI9A 3KQRA 3E6CC 2E7AA 4IL7A 1KDMA 1LHOA 4OHXA 2QFEA 4K20A 1AJOA 2PLV1 1URXA 1C57A 3VHPA 2HWD1 1JOJA 3FE5A 3M1HA 4QX5A 2VGDA 4D7YA 3ZSKA 1VAVA 2ZZJA 3UKNA 2QCSB 1ND2B 1AXYA 3VHRA 2C9AA 1WBLA 4AE2A 4E4ZA 5EYYA 1RVF2 2RR12 4YARA 3VBUB 1Y9QA 1RUJ1 4EWAA 2QNKA 2KXLA 3FWEA 3MIBA 3ZX7A 1QOSA 4PLMA 2R16A 3VBRC 3V65A 3WNXA 1D0HA 4YG3A 1NCQA 1G9FA 4RL7A 4X8PA 1Q8SA 3WP4A 5J48A 1EV13 2ENRA 4AVAA 4N43A 1TMF3 2QZ3A 2HWB2 4K9SA 1PZ7A 5L19A 3VGIA 3ILFA 4QQOA 4FTBA 1VP6A 4BQ1A 5T5PA 1LGBA 5H9RA 1Z7S2 4YM1A 4DOUA 2DUPA 3H9AA 5CFDB 4IEQA 4A7ZA 2OUHA 2X5IC 4NHKA 1OA3A 5EJ3A 3JB8A 4CEWA 4IEOA 2H0BA 2ZAAA 2HWD2 3ELNA 2RS33 1QDOA 1DHKB 1RUC1 4FOVA 1TME3 2ZX2A 1UIJA 2WT2A 4MXWA 3LSDA 3RRDA 4P9GA 4L8QA 4XQDA 2ZGUA 4Q4Y1 5ACA2 1U5ZA 4WM8A 1V9U3 3MIHA 2EAKA 2ZMLA 5GJ6A 1D4M3 2ZHKA 4XW3A 2WL1A 4XJ8A 5C8WA 1JN2P 2E7QA 3ZFEA 4FPJA 3VV1A 2JENA 5C4WB 2AYHA 4LBQA 4NWWA 4DRVA 1HXS1 4CDQC 4YVSA 5F9TA 1ULGA 1BBT1 1OOPC 2D98A 3M4FA 2CNAA 2H0VA 3ZFFA 4M01A 5I8SA 2NN8A 3SXWA 2FHRA 4QM8A 1YUDA 5E88A 5CG9A 2KM2A 2WFF2 2VECA 1A78A 1PGW1 2ZHNA 2RS53 2VOKA 4BM8A 1RUE3 2ET1A 1KJRA 1PO12 5HBAA 3OBRA 4Q1RA 3DPRC 1I9RA 4LO4B 1U5YA 1NLRA 1ZVFA 3P3PA 2DURA 4L92A 4YW5A 3UKVA 1G6NA 3VBOA 3AJYA 3PHMA 1LOCA 3VBRB 1HX6A 3HIFA 4LO6B 4HN1A 2VVEA 4Q4X2 1VBB2 4Q4Y2 4XBNA 1QKQA 2ZGNA 4LBLA 1VRH1 2RM21 4YZ5A 2R1DA 3D8CA 2XLAA 4COZA 1KS4A 3M3IA 2WNEA 2OW4A 4X6QB 4J1WA 1FX5A 1HXS2 2CY6A 2BFUS 4OVEA 4FPEA 4AI0A 3AYDA 2K0GA 2X5IB 1S0IA 3WDUA 1QH7A 3GZAA 2JX9A 2UY9A 4LO8A 1VLNA 3D0JA 2C5DA 4G3YC 4BYYA 4XIKA 2GMEA 2AUYA 1PGW2 5JSRA 1GSLA 3RJ2X 2ZBJA 1JH5A 2XJVA 3FLPA 2E6VA 2UY8A 3NAPB 1GQHA 3Q9OA 5FOJB 5LK5A 4AQTA 1HV0A 2HEWF 4B4QA 1NLSA 3SH3A 1S2KA 1EV11 3WW1A 5K9YA 1F5JA 2AENA 1TMF1 5E8AA 1VRH2 1XU2A 4AXOA 2RM22 1VBC3 3VZLA 1VAKA 1X36A 4Y5Z0 1OOPB 2GZWA 2Z69A 2VMHA 4FOQA 2DF7A 3ST7A 1WD3A 5KHGA 1IS4A 4IEPA 4PCRA 3VL8A 1LB2A 5GALA 2RMU2 1CPNA 4LA2A 4YZ1A 4YM2A 2RS31 1W6NB 1WBFA 1DGWA 1TME1 1UAIA 3DPRB 2A3WA 5I8YA 1ENSA 1K5MC 2XL9A 2JDZA 1ALYA 5FO9B 3ZO0B 4AI2A 1V9U1 3DV8A 1PMIA 1H1IA 1Z78A 1D4M1 5FLIA 4UW4A 4CDXB 2W0XA 1WCSA 4NN0A 2WZR2 3AZYA 5E16A 1I6XA 4MH0E 4OFGA 1EV12 2JKBA 2LM3A 2IZWA 4MGKE 1O7FA 2ZGKA 3ZIXA 3WQ0A 4ES9A 1OA2A 4ZU5A 2A5ZA 2XKPA 2YMZA 4EV0A 4FTSA 1C4RA 1RITA 3MIDA 4WVVA 3U11A 1RUD2 3ZXAC 1RUH2 3HWJA 1D0GA 2YXSA 2RS51 1PNFA 1RUE1 4DFSA 3OY8A 2QVSB 3WDXA 4HVRA 1QJU3 2EF6A 5KXCA 3K51A 3PVBB 4AGRA 3KCCA 3WZ1A 3ZYRA 1TME2 4D94A 4M0NA 2HEVF 1CJDA 1DFQA 4I02A 1GLHA 3I59B 1SBDA 3A4UA 1YLLA 3ES1A 5I0SA 3N4MA 4L9BA 4B29A 2E53A 2GH2A 4NPRA 1QU0A 1D4M2 4IEZA 4KBBA 4AVVA 4MYEA 4CP1A 2WSUA 3ZFGC 4QPYA 1PO23 1G9CA 4YW3A 3ES4A 1A8MA 3VLBB 1J59A 2ERFA 1ZBE3 2E51A 5EV7A 3CNAA 1MEC3 3M2MA 2A6ZA 1COV3 4N7UA 1Y3TA 1LESA 3FZ3A 1IS6A 2JG9A 1AR72 1GZCA 1TE1B 2ET7A 4MLOA 2YUEA 1FXZA 3WLUA 4BOWA 1A8DA 3ME2A 5EYXA 1K5MB 3LCPA 4KQ7A 4Y20B 2JD4A 1W6OA 2ZHMA 1EAH2 2RJLA 3M8LA 3R05A 4LHLA 4BIFA 5HCAA 5SV5A 5I93A 1ZRFA 4DMIA 3NKGA 3WG1A 2WNUC 1G7YA 5KXEA 3BTAA 3ZIWA 4A2UA 4AEJA 1ENRA 3CJIC 5L36A 1JUIA 1VBC1 2GC2A 1C28A 4HFSA 3HR9A 4RSUA 2DTYA 3AKTA 4M3CA 5IK8A 2FZ1A 4CEYA 2YC0A 2UURA 5LEJA 1VR3A 2XHKA 2C0ZA 3AYEA 3PVNA 4XFHA 4NHLA 4GMP3 1ULCA 2Z42A 4N53C 1ZRRA 4Q29A 3THPA 4Z1VA 4BWOA 5CB7A 4YGDA 1BEV3 1UU4A 5A3LA 2BBVA 3S7EA 2BYVE 2D43A 1U12A 3X29B 2WA4A 2UYAA 4NOTA 3FHIB 3DGTA 3BIWE 1ND3A 5C9AA 5H9PA 3ETQA 3TRSB 2R0HA 4OLLA 2WC2A 5CIRA 4AFDA 4AQ6A 2E7TA 4QQLA 2UYBA 3VBSA 2NYYA 4DINB 1QMJA 1QXPA 4WVMA 1KFXL 1VBC2 4CDUA 3W9AA 3IDEA 5A33B 1VALA 1D4VB 2HEYF 4L11A 2B7YA 2HWE2 5BV6A 1DGRA 3OYWB 4NO4A 4AGVA 3V0BA 1QJU1 4H14A 4XE9A 5JAXA 2O1QA 3LOBA 1C8NA 1VB4A 2BWAA 4N90A 4OHZA 3MLKA 2WNVC 4J1XA 2I74A 3LKJA 1CN1A 1OQEA 2HWF3 1UPIA 1HRV2 2A6VA 1AR63 1S55A 1HKDA 2WNUB 1RUI3 1CVNA 3EJKA 3AB0A 3B02A 1YWKA 3WOGA 3KT7A 3KLSA 1SFYA 1HIXA 1PO21 4L99A 4FPKA 2VPVA 5AC93 1V6OA 1ZZ7A 2OA2A 1PNGA 1ZBE1 1D2SA 5BPXA 1CR7A 1MEC1 4PDWC 4XILA 4IV1C 4V1PA 3VZJA 1COV1 1QF3A 5CG8A 3ACLA 1S0JA 2DCKA 4GH4C 1SFNA 1AXZA 1UIKA 3D4KA 4CDWB 5FMOS 1LECA 4OHVA 3N7LA 3VKMA 5C8CC 1C8M2 4Y4YA 2EXIA 3WP3A 2GC1A 5F5QA 5J36A 4KGGA 4MV2A 1H0BA 2MEV3 2JG8A 2ZABA 2CYFA 1POV3 5GLVA 1MACA 4MZUA 2AGSA 4TLFA 2XUMA 4LR4A 3MW4A 4LBKA 5E1RA 1RVF3 2RR13 4NR1A 3ZSLA 1N47A 5JVVA 4QMAA 4EWEA 4LBQD 3AFKA 1A6CA 1VBA2 3N7MA 4Z07A 1ZZ8A 3AKQA 2GC0A 2JXAA 3WDWA 4AVBA 4OI2A 3IDCB 3E5QA 1PO22 3H1WA 4FVVA 4XFCA 4ATFA 4XFIA 4D69A 4OI4A 4U36A 1MZEA 2EXJA 1MEC2 1NA1C 2WLPA 4GMP1 4OHWA 5HCBA 1G9AA 1COV2 1GBGA 2HWB3 1N3PA 1CJPA 4YZ3A 1V6JA 1BEV1 2Z79A 4FP3A 5GZCA 4RS5B 4Q4W3 3MEPA 4DXZA 2PFWA 1BK1A 4N53A 4D3WA 1Z7S3 1G8WA 1QJY2 4YYOA 2WNVB 4C1XA 3VZMA 1OFNA 2DFBA 2ZA9A 2OVUA 5D8AC 5BNNC 3O0XA 4MX3A 3RI8A 4RR3A 3LSEA 4RGAA 2ZGPA 4FT8A 1REFA 4FQ4A 2K2SA 2OZ6A 1DG6A 4R9BA 1BYHA 3MPPG 2YYOA 3OD0A 1IS5A 4YRDA 5ACA3 5H9SA 3RPQA 5FFOC 1YRZA 1BXHA 2F4PA 3IM0A 1NCRC 1DQ6A 1UU6A 1BKZA 5CBLA 1PIV2 3VBHA 5F6LB 4CTEA 1LULA 4S2HA 3ZN4A 4MUVA 3FMGA 1TQ5A 4AWDA 1SLLA 4Y1ZA 4IERA 2GC3A 3PMSA 4WZCA 4XXAA 5C8CB 3VBFC 5JDBA 2PAMA 3NV1A 4EWDA 4JRAA 1UU5A 2VH9A 2VOWA 1CAWA 4HPKB 4IESA 1S0DA 4LEJA 4Y24A 2VUJA 2HWF1 1GZWB 2WFF3 2B5HA 3MW2A 1AR61 3ENRA 1CIWA 1RUI1 1J1LA 1PO13 3RQ0A 4WVZA 5C6CA 1R082 3VBUC 1GZ9A 5AC91 2WA3A 1Q56A 1GFF2 4JQRA 4LLFA 3V64A 2JEMA 4YG6A 3ATGA 4Q4X3 1VBB3 1AR82 1DZQA 1KJLA 4FPCA 5KC5A 1NA1B 3MIGA 1PGSA 1Y7BA 1QOOA 3B3QE 2TEPA 1RJ8A 2G4IA 5BXXA 1CONA 4C91A 4Y1UA 1ZZ6A 2B46X 2UWAA 1Q3EA 1XNKA 2MEV1 1W6PA 3CL1A 1POV1 3E5UA 5JOZA 1J3PA 3OTFA 2SLIA 3KMHA 3L2YA 4Q8KA 1SLBA 3BOPA 1RVF1 2RR11 3WXPA 1NE4A 3AYAA 1AR62 1MZ6A 4LUKA 1CX4A 1DLLA 1DQ5A 5L7OC 4FPOB 2PN5A 1GICA 4K6BA 1H8TC 1RB8G 4LHNA 5D1IA 2ZOEB 4AHWA 1O3RA 1N3OA 2WT1A 4RHV2 3E6DA 2ATFA 3AKSA 3ZN6A 5DUUA 1WGPA 1JHNA 3H3UA 2HWB1 4LBOA 3HT2A 2ZX0A 2RS12 1AF9A 2UWBA 5J98B 4OHYA 1OPMA 4Q4W1 1R092 1I5ZA 3G7DA 4QPGA 1Z7S1 3IIAA 3WINE 3E6BA 4IETA 2RE9A 3A0NA 4P5HA 1ENXA 3TNPB 4YZ4A 1H4HA 1LU1A 2MEV2 2RMU3 3T1MA 1SLIA 3FLRA 3AP5A 4AEDC 3J8F2 4XBQA 5F1RA 1QOTA 2X53S 2HKXA 3W58A 3ASIA 1LOBA 3B00A 1SMVA 3GBGA 4AVSA 4IV3A 5ACA1 3AKRA 4UW6A 2OPKA 5FAXA 2W52A 2DCYA 1SDWA 1WLWA 3IMNA 3TYJA 3PMEA 2ZGRA 4M0HA 4XJAA 1ZZCA 2WZR3 2ZTNA 4R4ZA 5A3MA 3JU9A 2WQ4A 2BNMA 3N7KA 4PJYA 4S2DA 3VHOA 2O8QA 4U2AA 1HW5A 1ZX5A 2A7AA 5GM0A 1VJ2A 2O0OA 1V00A 1UX6A 3WUCA 1H2MA 1JTZX 2IXIA 4I0BA 4Q4W2 1AX1A 4QPIA 3N7JA 5EFUA 1IPKA 4P9IA 3ZFEB 2WFF1 5FLJA 1RUD3 1RUH3 3U0ZA 4NWVA 1OKQA 4XHBA 1AJKA 1PO11 2XJQA 5J7MA 4MGYE 3IWZA 1HRI2 2GN7A 3VDDB 1G9BA 5L7OB 1H8TB 1ND2A 1MVQA 2Q5TA 3UK9A 4HZFA 1H4GA 3NAPC 5CA6A 3C2UA 4Q4X1 1VBB1 4K3UA 2GU9A 1F9KA 2Q1ZB 1IZ3A 1CAXA 1GKBA 1HV1A 1Q8PA 3B5LB 2WT0A 1MVEA 5LRSA 2DUQA 1X8EA 4E2SA 2JE9A 1YJLA 1JW6A 3FJSA 1MQTA 2IWGB 4HKOA 2NQYA 3H50A 1LGCA 4LTAA 1WMFA 1ENQA 2K9ZA 3WG4A 3S30A 1PVC2 2VW0A 1NQJA 1ULFA 1HQNA 5BNOC 1YFUA 5GZGA 1AR73 3TNQA 4ISRA 4AEDB 1WW4A 1NXD1 4K1YA 3MF6A 1O4YA 5CFDA 1ZZ9A 3S7IA 1QY4A 1EAH3 3FBYA 1AR92 1LOFC 1AL0G 3VL9A 2XWJB 3IDBB 3AYCA 1GR3A 5AVAA 3BODA 4LO7A 5T3NA 2VY0A 4LBMA 1XE7A 2JICA 1J3QA 3QD6A 3TOJA 3ZDSA 4L2NA 4BCUA 4CDXC 4BHPA 1CPMA 5TSWA 2OIIA 3QCWA 1XXNA 2YDEA 2TBVA 1UL9A 1NY72 1LHWA 2PHTA 2DVFA 5JZGC 3WW2A 5LEKA 3DKWA 4JDNA 5C4WA 4W6YA 1JBCA 4C1WA 1SEFA 1RTVA 2RMU1 3AK0A 4GMP0 1SLCA 3O12A 4KG0A 4JVAA 1EPZA 4IEWA 1WA4A 4K8FA 2D3PA 5CADA 1CGPA 3BCWA 1IKPA 3E97A 4UBHA 3JQWA 1F31A 3D82A 4FBFA 3VKNA 4QGMA 5FTTC 4F8AA 3B93A 3B01A 2VXRA 2WZR1 1DYPA 3LOIA 3AP4A 2IXKA 5DZGA 2DU0A 5CFCC 1W0PA 2R30A 3GZUC 3THTA 3UJOA 5FO8B 1QQP1 2D97A 3VBRA 4F3JA 3URFA 4C0BA 3OCPA 4DZGA 2I45A 4JV4A 4TYSA 3NW4A 1Q8OA 5HI0A 2HWE3 1EYBA 1RUD1 1RUH1 3HAGA 5BNOB 2WIIB 4JC1A 1FPN2 4W65A 4DS0A 4LULA 3ZXLA 1M06G 1RINA 1UKGA 2PQQA 3WDTA 1CAUB 2ZPXA 3WT3A 1VBD3 2Z2SB 2X5IA 3DN7A 3V56A 3AJZA 4X6RB 1LJ7A 3I8TA 4ITCA 3I54A 1HRV3 1QNWA 3D6EA 3RYRA 3ZYPA 1RL3A 4KU7A 1BCXA 3DUIA 2EIGA 3LWCA 1YCIA 2IFWA 3L9JT 1L3JA 1LRHA 1QGLA 4AFBA 2ZACA 1H9PA 3NWKA 3R4UA 2R1BA 1QQP2 4BZ4A 1G86A 1TNRA 2A75A 2P17A 5JZGB 3OGGA 1JYCA 4ISQA 5ABJC 2ZGMA 3M3OA 3U07A 4CDQA 3FFQA 1M4WA 4GULA 2DCZA 1AR71 2EALA 2G9FA 3J4UH 4N9IA 1OOPA 1MZFA 1WMEA 4IEXA 4FCAA 1C8M3 1OLRA 2QZ2A 1DU3D 1EAH1 3NSTA 3SH4A 1RUG2 5CNAA 3KT1A 3VKFC 3QACA 4XFBA 1POV0 2IC1A 4Q0SA 4YNIA 2ZGSA 1N1SA 3DPRA 4P9YA 4COUA 3RZZA 4KG8A 3WHTA 2ZS6B 2Y0OA 4P9LA 1VBA3 5CFCB 5FDBA 2IXJA 1UCXA 2ZGLA 4FPHA 4OUSA 3WDVA 4CDXA 3BB6A 4EN8B 4WVWA 2D7FA 2H6BA 1ONAA 3H7YA 4HVOA 1RMU3 1DZTA 2E9QA 2FMYA 4CEYB 5KXBA 4HL0A 4L97A 2JECA 1QJY3 3ZXGA 2NLRA 1GANA 3V0AA 3RSJA 4Y26A 4HT1T 5BUVA 1ZZBA 3U4XA 3RG0A 1JXNA 5JPMB 2IXLA 4KWLA 4XTPA 2R042 2AREA 2CGNA 4EROA 1MS5A 2MHFA 4JTNA 1KS5A 2DCTA 4XYXA 5J3UA 2P3KA 3CLPA 5BNPC 1GV9A 1ZYBA 1C1LA 3RDIA 5C9AB 4AI3A 1PIV3 5DXDA 5ABJB 5JCTA 1WCDJ 2HWE1 4IEVA 1YFYA 4ASLA 4INDA 2FBEA 3JQXA 1EP0A 1FATA 4CDWC 5K7PA 2ZMNA 1SCRA 3OJBA 4ES8A 5JSOA 1VBD1 2WINB 4JGYC 3OGJA 1UMZA 3RYKA 3UKTA 4WM7C 4AW7A 1QH6A 2A70A 1HRV1 4QXKA 1RIRA 2NPIA 3LAGA 2XPJA 3O5SA 2NM1A 1ULEA 3IPVB 1XYNA 1EPWA 1W6QB 1K5MA 5FQ0B 3V0BB 2ILMA 4JCKA 4AFCA 1R083 1ULDA 2NZ9A 4A7KA 4XZPA 5AFEA 4Z2WA 1O91A 3N36A 2F6BA 4IEUA 3B94A 1AR83 2DTWA 4H3WA 1WCKA 4H55A 2AH2A 1H30A 3PVOA 3USSA 1UN1A 2EAAA 1YJKA 2DV9A 3ECQA 1HLCA 1W6MB 2H6CA 1DBNA 2WZPP 3WP5A 2XKOA 1C8M1 3POWA 1WMDA 1CD3G 3JCIA 1QJZA 3R6SA 1OFSA 4BLIA 1YO8A 1FOD2 4RS5C 2VQ0A 4DPNA 1VBD2 4RA0A 2YV8A 1T6GC 3MZHA 3AKPA 2CAUA 5JI7A 4GB33 4WZFA 5JR7B 2KA3A 3VHNA 3AXDA 3AZZA 1VBA1 4Q0UA 2DVAA 4GWMA 3AMMA 1I3HA 1OQ1A 4I3GA 1NYWA 4UXAA 5BNPB 1B35C 3LGRA 4QM9A 5EWSA 4RHV3 1KITA 3AMPA 2AZ5A 5K0UC 4XF1A 5KWRA 3RI9A 4I2OA 1WD4A 4E2GA 3USUA 3ZFGA 2GNTA 2D6MA 5I8TA 3ZSEA 4H7LA 4AI8A 1RMU1 2RS13 2ZGOA 4JDOA 2A6WA 2UU8A 1IQAA 2VMIA 2XJSA <