2R041

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 41
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r04100
2GH8A 3ZFEA 4WM8B 2R062 1PIV3 5BNOA 4IV1B 5FMOS 1AL21 4AEDA 5BNPA 3VDDA 3DPRA 2R061 3J8F2 4RHV2 3VBSB 1D4M3 2RMU3 4CDUC 3J8F1 1HRI2 1ZBA3 4RHV1 4FTBA 3NAPB 4Q4X2 1RUH2 1RUG3 2ZZQA 5DDJ2 1HRI1 1R083 4N43A 1RUD3 1RUI3 1AR63 4Q4X1 1RUH1 2WFF2 4CEYA 5DDJ1 1H8TA 4Q4V2 3VBOA 1QJX2 3VBRA 4PDWB 2BPA2 5CFDA 2WFF1 4Q4V1 4PDWC 1POV1 4JGZB 1QJX1 2HWF2 1VBC3 2HWF1 1VRH2 2BFUL 4RS5A 2WS93 5C9AB 2IZWA 5JZGC 4FTEA 1ASJ2 3ZXAC 4WM7A 1ND2C 1VRH1 1AYM3 1BEV2 2PLV2 5A33A 5K0UB 2R042 2X5IC 2RS33 1ASJ1 1FOD3 2ZAHA 5C8CA 4GH4C 1BEV1 1RMU2 2FZ1A 5K0UC 1BBT3 2PLV1 4Z92B 1RUJ2 2R041 1F2NA 3VBHA 3ZFEC 3JBG3 1NCRA 5BNPB 1RUF2 4GB33 5BNOC 1PVC3 1RMU1 1RUC3 1ZBE2 4GMP0 1RUE3 1RUJ1 4AEDC 5BNPC 3VDDC 3DPRC 1RUF1 5ABJA 4CEWB 3JD73 1PO23 2HWD2 1ZBE1 1HX6A 1RUE2 1VBE3 1NA1B 1NCQA 1X36A 2HWD1 4N43B 1R1A3 1RUE1 4Y5Z0 3TN93 1H8TB 1POV0 2BUKA 3VBRB 4N43C 1DDLA 1V9U2 5BNNA 5CFDB 1OPOA 5L7OB 4CEYC 1AL23 1H8TC 3VBOC 1HQNA 1OOPB 3VBRC 4YVWA 3JB4C 1V9U1 1HRV2 4SBVA 2R063 5CFDC 1RVF2 3HAGA 1VAKA 1TME2 2RM22 1HRV1 1RVF1 3J8F3 3LOBA 1W39A 4RHV3 3FBMA 1TME1 2RM21 4RS5C 2WLPA 2RR13 1AR72 3ZFFA 1HRI3 4CDUB 5A33B 1TMF2 3ZFGA 1QJU2 2R072 4WM7C 5LK7B 4Q4X3 1RUH3 5DDJ3 4YVSA 4CDQA 1AR71 2RR12 2ZTNA 1TMF1 3VBHB 4GMP1 1QJU1 2R071 1BMV2 4IV3A 4N53A 5C8CC 4CDXA 2WFF3 4Q4V3 1POV3 1QJX3 2RR11 3VBHC 4EJRA 2VQ0A 1NCRC 1BMV1 1K5MA 3VBUA 5ABJB 4QPGA 2MEV2 5A32A 2HWF3 5FOJB 2XBO2 1EV12 1NCQB 4CDWB 5ABJC 1VBD2 4Y4YA 2MEV1 1Z7S2 1B35A 1VRH3 2XBO1 1EV11 1NCQC 2BFUS 4CDWC 5JZGB 1VBD1 5J96B 1QQP2 2GSYA 1ASJ3 1Z7S1 1HXS2 1BEV3 1ND2B 2PLV3 2WZR2 1FMD3 1IHMA 1VB4A 2R043 5ACA2 1QQP1 2X5IB 4BCUA 1HXS1 5BNNC 1RMU3 4GH4B 1FPN2 1RB8G 1RUJ3 2RS12 1C8NA 2WZR1 1FMD2 5ACA1 5J98B 4YVWC 3ZFEB 1RUF3 1WCDJ 5GKAC 5C4WA 5BNOB 1ZBE3 1FPN1 1X33A 2RS11 4WM8A 1FMD1 1MEC2 4AEDB 4NWWA 5CFCA 4IV1A 3VDDB 3DPRB 2HWD3 1MEC1 1CJDA 4YVSB 3ZFFC 3ZFGC 3VBSA 4NWVA 1AR82 4YVSC 4CDQC 2FZ2A 1AR92 1VBB2 1RHI2 1NOVA 1V9U3 1VBA2 2HWC2 4IV3C 3NAPA 4N53C 4CDXC 1AR81 4CEYB 1C8M2 3VBOB 1AR91 1VBB1 1RHI1 1VBA1 1HRV3 2HWC1 4Q4W2 1COV2 1K5MC 1RVF3 3VBUC 2HWE2 4QPIA 3S6PA 1AYN2 4QPGC 1QJY2 4RFT0 1C8M1 1TME3 2RM23 4Q4W1 1COV1 1NY72 2HWE1 1AYN1 4JGZA 1AL0G 1QJY1 1B35C 4LLFA 4RS5B 1AR73 2Y26A 1NY71 1E57A 1TMF3 4RR3A 4GMP3 1QJU3 2R073 4WM7B 2RS52 4RQPA 5C9AA 1EAH2 1PO12 4Q4Y2 2XPJA 3IDEA 2RS51 3JB8A 1EAH1 1R092 3CJIA 1PO11 5AC93 5C8CB 4Q4Y1 4JGYA 1NCRB 5CFCB 1R091 2MEV3 5C4WC 5AC92 1NG0A 4WM8C 2XBO3 1EV13 5CFCC 4IV1C 1PIV2 5FMOL 1VBD3 1Z7S3 5AC91 1MQTA 4CEWA 1PIV1 1SMVA 1QQP3 1QJZA 1NA1A 1HXS3 1ND3A 3VBSC 1D4M2 3VBFA 2RMU2 2WZR3 5ACA3 1M06G 1OHFA 1ZBA2 3NAPC 5BNNB 5D8AA 1RUG2 4QPIB 1D4M1 1FPN3 2RMU1 2RS13 1R082 1RUD2 4YVWB 1GFF2 1ZBA1 5L7OA 1RUI2 4QPIC 1AR62 1RUG1 2TBVA 1OOPA 1MEC3 1R081 1RUD1 1RUI1 1AR61 4JGZC 4RR3B 1PGL2 4RQPB 1VBC2 4RR3C 3ZFFB 3ZFGB 1PGL1 4FTSA 1CD3G 4RQPC 5C9AC 1VBC1 2WS92 1AR83 3CJIB 4CDUA 4CDQB 1AR93 1VBB3 1RHI3 1VBA3 2HWC3 4JGYB 4IV3B 1AYM2 4N53B 3CJIC 4CDXB 2WS91 2WWSA 1C8M3 2RS32 4FSJA 4JGYC 1FOD2 4Q4W3 1COV3 3M8LA 2BBVA 2QQPA 2HWE3 1AYM1 1K5MB 1AYN3 3VBUB 1BBT2 4QPGB 1QJY3 1MQTB 3JBG2 5A32B 2RS31 2HWB3 1FOD1 4GB32 1PVC2 1RUC2 1BBT1 4PDWA 1MQTC 1ND3B 1A6CA 3JBG1 1B35B 4CDWA 2DF7A 4CEWC 2HWB2 3VBFB 3JD72 1PO22 4GB31 1PVC1 1RUC1 1NA1C 1ND3C 1VBE2 2RS53 1F8VA 1EAH3 1PGW2 1AUYA 1PO13 2HWB1 5D8AB 3VBFC 4Q4Y3 5JZGA 3JD71 1PO21 1R1A2 1VBE1 1ND2A 3TN92 1PGW1 1R093 5D8AC 2X5IA 1VB2A 1R1A1 4GH4A 5L7OC 3TN91 5K0UA 1AL22 1OOPC 5C4WB
chains in the Genus database with same CATH superfamily
2GH8A 3W21A 1NYWA 1AXKA 4MHRA 1W6PB 4QQPA 2TUNA 4EN8B 4CCCA 4HVOA 3VZLA 5C5TA 3H7YA 3KS7A 3I2DA 3QACA 4QU2A 3WDWA 3T0DA 2WQ8A 1WD4A 4X8NA 4AEJA 2CTVA 4N8MA 5BNPA 3DCQA 2LALA 2VCCA 4HSJA 3CBNA 2R061 2WAAA 3I8TA 2WNUB 3HBZA 4AAXA 4DXZA 1DGRN 3VBSB 3DEMA 4BLIA 3OUJA 2EIBA 3EXUA 3BODA 3N7MA 4YGBA 3EQEA 1MS5A 3GZAA 4PT6A 2BU9A 4FPCA 3K4ZA 1ZBA3 4UFMA 4RHV1 5IVCA 2ORXA 1X8EA 3GZUC 4Q4X2 1IG3A 4UF0B 3AB0A 2ZGKA 4XURA 3WCRA 4LE3A 1H4HA 1R083 1LU2A 2XHKA 3ZYJB 3T09A 5LBBA 2Z2SB 3WG1A 4QT6A 1C57A 3T3YA 2EXHA 4XILA 1RUI3 1YIPA 1AR63 4QHZA 2WFF2 4XPVA 4YYOA 4HN1A 5DDJ1 1H8TA 1MS9A 4Q4V2 4RGKA 3ES4A 5GZDA 3U78A 3DECA 4F83A 4Y1VA 2DCJA 3GNEA 3NNLA 1K42A 2VZRA 3ZXJA 1ZRDA 1G9FA 2ARAA 4AEKA 1US2A 4WZCA 2J7MA 2JECA 3WW3A 4H7LA 2CU5A 2Y6JA 2ZEWA 4PDWC 4BK4A 2CDPA 2HWF2 4K7JA 1SEFA 5FPXA 1LB2A 5CA6A 4M3CF 2VUJA 4NPLA 3SH3A 4ES9A 3O1TA 4ASMB 4OUEA 4B7KA 5FZLA 3WD5A 2YZ4A 1PMJX 1VRH2 1OFNA 1GQHA 1Y7BA 2J22A 3G7DA 1QNWA 4QB2A 4LBQA 2A70A 4CP9B 5IVFA 2JEMA 5ISLA 1PZ9A 1ZZ7A 4ZY9A 3ZXAC 2UWAA 4PI2A 2ZGSA 5C7GA 1KXGA 4W6XA 3B00A 1DGRA 1Y43B 1QXRA 2GNDA 1VE0A 2R042 2R49A 1DCSA 4YNIA 5JXHA 2RS33 2WDBA 1J3RA 2I2SA 3T08A 4RD7A 3ZYIB 3ST7A 5FYZA 4MV2A 5C8CA 4XACA 3K46A 2FZ1A 3U1XA 5K0UC 1FNYA 3UT0A 4B7EA 1EYBA 1RUJ2 2D5HA 3TAYA 1STMA 4AI3A 4LK7A 4BZ4A 2WZEA 5DXDA 1WLTA 3R4SA 5FZDA 2QQOA 5BNPB 5IYYA 1MVEA 3C2UA 5T54A 5FZ4A 5BNOC 4AQ2A 1RMU1 3WNMA 1RUC3 3KT1A 2EAKA 1ZBE2 4LQRA 1GLHA 3ZM8A 4DUVA 3HQXA 4FAHA 1WA4A 4AEDC 1REDA 4XFHA 3VDDC 3S5AA 4E9KA 1RUF1 3JD73 1JU3A 1NQJA 1F5FA 4XUOA 4XXAA 5GJ6A 2YU2A 4AVTA 3RZLA 1NA1B 3D6EA 4MOAA 3BTZA 1SLTA 2JJ6A 4CA9A 4MH0E 3M3IA 4PQQA 1X36A 4EE2A 2OX0A 2ARCA 3IIIA 2GDFA 1WCUA 4CTEA 5JR2A 2ORZA 1R1A3 1ACCA 1UY1A 2LUWA 4K20A 1NE6A 1FV2A 1LHWA 4YFWA 4AK3A 2VO5A 4NVPA 5JUVA 1H8TB 2WFPA 4KU8A 2JG8C 3UYJA 1N3OA 5BNNA 2QDRA 1PM4A 5T55A 2XWBB 2ZHKA 1OPOA 3NNGA 4YW2A 1C1LA 2DBIA 4AFDA 1HQNA 5FYTA 4Y4RA 2HEWF 2RJKA 2VZ1A 5J1XA 3RZGA 5IK4A 3M7AA 2QTWB 4GJYA 3AKSA 2E26A 3QOPA 1VAKA 4LA2A 5F6KA 2E63A 4FPHA 2RM22 1LR5A 3I3DA 3T4VA 4BWOA 5JSRA 3S7EA 3FZ3A 2XJPA 4DEVA 3LOBA 1ULFA 3WSOA 3WCSA 1RYYA 3LZZA 1KEXA 1UQXA 4C1WA 3GYDA 1SPPA 2Y0IA 4RS5C 4BQ4A 5FY8A 3ZFFA 4BYYA 1HRI3 4CDUB 3MI8A 5SV5A 2IFWA 4LE4A 4A42A 1W2TA 1UNBA 4FO9A 1GV9A 4P9JA 3AP7A 4YW1A 5FZAA 5A6ZA 1RUH3 4A3ZA 4IGPA 3RZMA 2YB7A 3CL1A 5A7NA 2WSUA 5FWJA 2ZGRA 2CNAA 1AR71 1D0GA 2GMPA 2EICA 4PIZA 1J3PA 1CR7A 2EVXA 1VALA 2C0ZA 2ETEA 3N7KA 4N53A 4S2HA 4CDXA 3BUCA 1LKNA 4LKFA 3BGAA 3SISA 1UAIA 1J84A 4IERA 1DQ4A 1K5MA 3VBUA 2ID4A 1F5JA 4FAGA 2MEV2 1W8NA 1CPNA 1YLLA 2XBO2 4Q0SA 3T2OA 5FDBA 3O1OA 4AG4A 4XFBA 3ZPOA 4CU7A 4CP0A 3AMNA 3MIDA 1Z7S2 1E5RA 3AFGA 2FCTA 3KGLA 4LO7A 1RTVA 1QOTA 3FFZA 4CXYA 3UETA 4LITA 2VVDA 4N90A 2QQUA 4Y1UA 5DABA 1DHKB 2D3PA 2ARBA 1VBD1 5K9YA 1QQP2 1SLIA 4L2NA 2PAKA 5FQ0A 4Q1PA 1U5IA 3RWNA 4LIUA 1XU1A 3ON7A 1BEV3 3WW4A 1O3RA 1UW8A 5JI7A 4HKOA 2PFWA 3MPPG 2WZR2 2XMLA 3BOPA 3O5SA 5ACA2 4LULA 3RGBA 4YZ3A 3SHRA 5IVYA 1GSLA 1GZTA 1HXS1 3KVAA 2W46A 2MPFA 3H3LA 4COZA 3OF1A 4OVEA 3C7GA 1YNAA 2VXJA 4ZZ5A 1UY3A 1FPN2 4GH4B 4BQYA 1QOSA 1V6OA 2Q1ZB 5FO9B 1C8NA 4C0HA 3J26N 1FMD2 2WABA 2ZS6B 2QDNA 2R7EB 3NL1A 4HBNA 5J98B 3ZFEB 3PVBB 1WLWA 4CU8A 4FXKB 4LR4A 4NHLA 3MIFA 2BP6A 3POFA 4K9SA 1WCDJ 4OUMA 4ISQA 2XDVA 3EO6A 2ZMKA 4E2GA 1X7NA 2CWSA 2RS11 3TEZA 4Y26A 4BQ2A 2VW1A 5EPAA 2LTNA 2JENA 3SKVA 3DPRB 1SQ4A 4LBMA 4BISA 1PX4A 3AKQA 2C26A 2HWD3 3I4IA 4IL7A 1CAXA 3TWIA 3LSEA 3FLTA 4QKDA 2XR4A 1MEC1 4NHXA 1RL3A 1RUOA 2JIGA 2YBSA 1ZZCA 2VZ3A 3HNBM 2DVBA 2A71A 2RG4A 1IQDC 4QDSA 3PIJA 3B9IA 4XW3A 2A1XA 5CEHA 5BPXA 2ENRA 4CDQC 3QH6A 4QGLA 1H1IA 1KD7A 1PZ7A 4QHOA 3VHOA 3ZN6B 1RHI2 1VBA2 4K40A 3KV9A 2QZ2A 2HWC2 4L8QA 3BTYA 1O6UA 1RJ7A 2D6MA 3VZKA 3O1RA 1OA4A 4NROA 3IDAA 3J9SA 1O7FA 4HVRA 3VBOB 1Q8OA 4OCTA 4QGNA 2JE9A 1HRV3 2QKDA 1YWKA 3AP6A 3RFRA 2CY6A 5FJHA 3GBGA 2D43A 4FFGA 2HWE2 1SHWB 5DZGA 4BIOA 1CAVA 4QPGC 5FZGA 1W2AX 3NKTA 1BVP1 5GLTA 2OXBA 3JUUA 3GCWA 3THDA 5A3LA 1S55A 3PU3A 4ZS2A 3P3PA 1OMIA 5JR7B 1OH3A 4HSLA 2UY9A 2P34A 1AL0G 1CQ9A 3AMQA 2PQSA 3IZOA 3OGGA 5FQ0B 3ROUA 2AACA 4META 5LCWL 4EQVA 4LLFA 5KHKA 4IEZA 3MIHA 4UOJA 1TMF3 2QQMA 4GMP3 2DURA 2R073 5IVVA 2DUPA 2B9UA 4WV8A 1O4ZA 4UW5A 3H1MA 4RQPA 3ZO0B 1KRIA 1NQDA 4Q4Y2 2WT1A 4IEYA 4A7YA 1E5HA 2WT0A 1XNAA 2JD4A 1MS3A 3JB8A 3RI9A 5FPUA 5KC6A 1EAH1 1IS6A 2FDJA 1PO11 1SCRA 5DQ0A 2EXIA 4PLMA 1JMUB 4TSVA 3U4XA 5D2AA 4KGQA 4Q0QA 1GZCA 5J48A 1OQEA 3MICA 2GNTA 4JGYA 4XDQA 4AHWA 4D7TA 3ETPA 1NCRB 2W68A 2ADDA 1WLDA 3VHPA 1GMMA 3HR9A 1AVBA 4PCRA 1YJKA 2VZTA 1T2XA 4NAOA 3ZYHA 5K4LA 2IVJA 4OQ9A 5AC92 4QKBA 5FCCA 3D0JA 1W90A 2VUCA 5IVEA 4D6RA 3NJZA 4M3CB 4V1PA 3CIHA 4LBJA 3ZSMA 1UZYA 2EA7A 1JBCA 3NW4A 4O7XA 4JDMA 1EY2A 4Y22B 4Y1ZA 3O1SA 4E27A 2YBKA 3OPZA 3ZSLA 4W65A 3VKMA 1S0FA 2A6ZA 1KS4A 5CKMA 2VOVA 1UMZA 2XVGA 4X6RB 2WO3A 4I3PA 1LOFC 3BI3A 3WLUA 2DU1A 5F6LB 3DXTA 2WNVA 5HXVA 1DGWX 1IPSA 1KDKA 2B39A 1ZBA2 2RDSA 1W9FA 3I2HA 5F2WA 4BQ3A 3EMRA 4ZKTB 1OQ1A 2RMU1 5FXXA 1OF3A 1JYTA 1R082 2VTXJ 1PMIA 4Q8LA 3ACHA 4QM8A 4YVWB 5IWFA 3ZXLA 3U10A 1RUI2 4QPIC 4W4ZA 4BQ5A 3PVNA 5JI9A 1RUG1 5ANQA 1AR62 1OOPA 4ES8A 4A7KA 2ZAAA 1OT5A 2ZEZA 3GHMA 4Y3OA 4AI8A 5A3TA 1RUD1 1W6OA 3H3ZA 4LBOA 1KQRA 2DVFA 1J58A 3HEIA 5DAQA 4CU9A 3VDCA 2FDIA 2JG9C 2O8QA 4Y33A 1ONAA 1XNDA 4AQTA 1JS9A 3B7MA 1PNGA 1OVPA 3VKNA 4Z2AA 3BU0A 4RQPB 3AZYA 2WWJA 4OUSA 1YFXA 3HQUA 1Q5OA 4FPOB 4DQAA 3RZHA 4OFGA 4RR3C 3S7IA 2J1AA 3OOXA 4ATEA 5I8TA 2P4EA 3WP5A 2YBPA 3ZFGB 1F4AA 4CCDA 1OUSA 1QJFA 1W9YA 2B5HA 5C9AC 3JU9A 1WMDA 3ZOIA 1Q8QA 3VD9A 2D40A 5IAXA 3FX3A 1AR93 2VOXA 1KITA 1U12A 3QLQA 3PUAA 2PN5A 1UL9A 2OIIA 4JGYB 4UW4A 4IV3B 3PU8A 4XBLA 2JD9A 3GDBA 3NRUA 2WS91 3SQOA 4SLIA 1ZRCA 2VG9A 1XC6A 4QB1A 1CVNA 1TZOA 2PAMA 2WN2A 4QAWA 3TYJA 4UBGA 2X05A 1LHUA 1UX6A 2RS32 1JW6A 4JVAA 3R0RA 1SBFA 5GM0A 1CWPA 4Q4W3 2BBVA 1ZZ8A 3DXUA 5FYHA 2RE9A 1J83A 2H6CA 2B8MA 5FBJA 1DG6A 4ZPIA 2DYCA 4AAPA 3ZXGA 2HWB3 5F39A 4GA9A 1ULPA 2AC1A 3L2YA 1S0GA 4R4ZA 1NLSA 4TXWA 1RUC2 2IUWA 2YGMA 4YW6A 3T2TA 2NP0A 1BBT1 4PDWA 1AHSA 2FMYA 3BCWA 4GWJA 3WP6A 1L7RA 3JBG1 4DXTA 1XYPA 2FBEA 4XJUA 3EBRA 1BHGA 2KR2A 4KWJA 1QWRA 3OGSA 3ILRA 3JD72 1GR3A 4UFIA 4GB31 5AVAA 1D4VB 2BVVA 2ET7A 1MS1A 5F32A 3U11A 2QNKA 1ND3C 2WZ8A 3ZR5A 3IPVB 4CRQA 3IMNA 2Y6HA 2K0GA 3AYEA 4IETA 3ZXFA 2YFZA 2O14A 2BQPA 2WZPP 1W2UA 2HWB1 4QX3A 3U37A 4UXAA 1PO21 1POQA 2F4LA 5FZ1A 1R1A2 3WQ7A 5A3OA 1QDOA 1F15A 1PGW1 1R093 1DZTA 2DCYA 5D8AC 2VZVA 5C3QA 1Q8VA 3I7DA 3WVJA 4XF1A 2Q30A 4AL9A 1ULEA 1W6OB 2WQ4A 4YZ4A 5L7OC 5K0UA 3WUDA 1F9KA 4LBNA 5JXGA 3U0ZA 3BPSA 2NZ9A 4WM8B 2QFEA 2VR4A 4EZ4A 1PIV3 3WG2A 5BNOA 4IV1B 4FPFA 4AOCA 2W1QA 3M3CA 1AL21 2ZJCA 4FI9A 4QPWA 4AEDA 1AJKA 1GQGA 1S0CA 3TB0A 3VDDA 1HJFA 1IZ3A 3SH4A 1YQ6A 4P5YA 5A80A 4QDRA 5ERLA 4PF5A 4Q5OA 3LA3A 3SH5A 3AMMA 4OLLA 3KV6A 3HVDA 5EHDA 5FYCA 3Q8BA 3KD4A 5E88A 1D4M3 5EZWA 3APBA 3J8F1 1HRI2 4AVCA 4FPJA 3HQRA 1FT9A 1QU0A 1SACA 3LCPA 2VOWA 3PUSA 4F7ZA 4FTBA 4TZDA 3NAPB 3BU7A 1DBNA 1RUH2 2UWCA 3KV4A 2Z69A 3UJOA 2JG8A 4YM1A 2W92A 4UYBA 4BB3A 1DIWA 1MZEA 2VW2A 2ZX0A 2OPWA 2ZHMA 4YGEA 4E4SA 2ZMNA 1CESA 3OCPA 3KB5A 5F2SA 2HEVF 1ZA4A 4PDWB 5FREA 2AENA 3G6JB 2PHRA 1XE0A 3SEEA 1OUXA 4QHBA 1QF3A 4Y20A 1OLRA 1MPXA 4HPKB 5A3WA 2XVLA 1J1LA 4NPMA 4LTAA 1UCXA 1O3TA 3ZYRA 1POV1 1S2BA 1QJX1 1V6NA 2BEOA 2RDQA 4JGZB 5CIRA 2UYBA 5HCFA 1VBC3 1UOJA 1HW5A 2ZXQA 1UOBA 2GC1A 2VU9A 1S2KA 2JDMA 2C9KA 2OZJA 2ZGMA 4WVZA 2BFUL 4IGOA 3OD4A 3WP4A 3C7EA 4QD2A 2VULA 4RS5A 4CP1A 1LOEA 1C5HA 1U5ZA 3KCXA 5FLHA 2EF6A 4FTEA 2E32A 2E7QA 1XRUA 3RYRA 4COUA 1AYM3 1BEV2 3ES1A 2XL7A 4OHVA 1XQNA 3WINE 5A33A 5FPLA 5FZBA 5K0UB 3O1MA 4OI0A 1KS5A 1WGPA 3OTFA 4JDOA 3RZJA 5H9SA 2WINB 3BALA 1ASJ1 1FOD3 4FQZA 4XE9A 2C9AA 3TNQA 5FY1A 2FDFA 5LRSA 3AVRA 2PLV1 3WW1A 1OI6A 4A3XA 5CB7A 3OY8B 1UO9A 3VZNA 3O14A 1WA6X 4ZS3A 3SMHA 1PVC3 1SFPA 2WQZC 4LPLA 4CP2A 2DVAA 2P3JA 3BVCA 4H3WA 4URAA 1JZ3A 4KBZA 1JYIA 3MDPA 3JQWA 4UW3A 4XDPA 4QX0A 1O91A 2J1RA 5LA0A 1MZFA 4XMAA 2HWD2 3WNNA 1HX6A 1APNA 3CQOA 3L9JT 1RUE2 1VBE3 1OVSA 1UXXX 2H6BA 2YG0A 4YW5A 2WIIB 3RQ0A 4AFCA 1SDWA 4BH9A 1NXMA 4PQ9A 2HJIA 2LROA 3OGJA 3TNPB 3N9QA 4BMEA 2JG8B 3OUIA 3KHCA 4GXLA 2V5DA 4XHBA 2GMEA 3PTYA 4I0BA 4RGAA 4ZXKA 4GAZA 4M3CE 4MYEA 1QEXA 3M1HA 3H50A 2X29A 1W9SA 2PYTA 1POV0 1DDLA 3OYWA 1WCQA 2X8KA 1H1AA 5FPAA 4Q2FA 5FZIA 1H6XA 2JDKA 3K4AA 3OGVA 3B3QE 4GWNA 4Q29A 4CEYC 3GBWA 3JCIA 3NJXA 3VBRC 3V0AA 3MPBA 4K8RB 2E7AA 1V9U1 1HRV2 3LOIA 2R063 5F5CA 5FYIA 5IFTA 3UL2A 3SITA 3HJRA 1CJPA 4H7MA 3OGRA 3C7FA 2VMIA 2XKOA 1CIWA 4NO4A 2VH9A 3JXSA 4GKXA 4QX7A 2WA4A 2YDEA 2GC3A 3D4KA 2VMEA 4MGQA 3AKRA 4E4DX 1RVF1 3WG4A 3E6DA 5C8WA 3WDVA 1GYKA 5BV6A 4RHV3 1YQ5A 3WHTA 2RHPA 1TME1 2W9XA 4HL0A 3THTA 2VD7A 1UIKA 3AP5A 3GJBA 4FCAA 2RR13 1HLCA 5A33B 1TMF2 1GUIA 1HKDA 1W03A 2WBKA 3UGGA 1JH5A 2R072 4FPEA 1QIQA 1XNCA 1JN2P 1O4YA 4WM7C 5DUWA 5FV3A 1WLCA 2WR9A 1F35A 4CCEA 5DDJ3 4CDQA 1X9PA 5FUPA 1W2OA 2Q5TA 5CAZA 1BXHA 4JTOA 5T3NA 1QJU1 1BMV2 1Y4WA 4JQTA 2BJSA 1YHFA 2GN3A 3LFMA 5CYYA 4ZU7A 1ZNPA 2AZ5A 2RR11 4UT5A 3VBHC 4EJRA 4LMFA 4QQOA 2BBAA 4ARYA 1P8JA 4FPKA 1YYNA 1W8UA 2Y6KA 4FP2A 1VMJA 2D6NA 4QPGA 1PZ8A 1URXA 1JHNA 3ZSJA 1X50A 2ILMA 1RUNA 2SLIA 3AYDA 3C8XA 5EJ1B 3WT3A 5F3IA 1WBLA 2VOKA 2D98A 2ZACA 3AYCA 4Y4YA 2DWRA 4KBBA 5L9RA 1EV11 2BFUS 1JXNA 4DXSA 4Z8BA 1MS4A 2Q1FA 1UMIA 5T5JA 5JZGB 3LGRA 1ZRRA 3I2JA 3IIAA 4K1YA 5LBFA 1HN1A 1ND2B 1YFYA 5H9PA 4B1LA 3H8UA 2B9VA 3P5BA 2B46X 2X5IB 4UFKA 5GZEA 4BCUA 1UY4A 4YZ2A 2LRPA 5GZFA 1RMU3 5FFOC 2K9ZA 1CPMA 5T50A 4XFCA 3UESA 4PI0A 4TN7A 5EQUA 1W6QA 2PHFA 1UY0A 1N3QA 2NM1A 2C5DA 2BYVE 3WR0A 1RUF3 5LATA 2ZHNA 4AI1A 1CAWA 1GP4A 1N1TA 2JDNA 4NIHA 1LU1A 1WCKA 3ILNA 4BHPA 2J1UA 4NMIA 1RITA 1W99A 1XNTA 1Q8SA 2VCBA 4P02B 4XQ4A 4CVUA 2YROA 2Y38A 5TSWA 5KWRA 2GU9A 5FY0A 1ST8A 1OLME 5J09A 3GGLA 3LE0A 4CCNA 1Y9GA 2VVFA 3WQBA 3O0XA 1LGBA 5JIAA 3BIWE 1GNHA 4XF4A 1YEWA 5IAVA 2JDYA 1MVQA 1S0BA 1WW7A 3QD6A 4OYUA 4QQ2A 4XBNA 3WNXA 1LOFA 3R4UA 5FP7A 3MV11 1RXFA 5A7WA 1ULDA 5LEJA 1AR92 1V0AA 2VOTA 4DUWA 2LS6A 2QQNA 4XXPA 1CX1A 1NLQA 3POGA 5JXIA 4LHNA 4R4XA 4D7YA 1AR81 1BJQA 4J1XA 3IWZA 2OS2A 2PTMA 2WYFA 2XJQA 1VBB1 2IWGB 2IC1A 4B4RA 1SZBA 2GMMA 4XFAA 4Q4W2 3RI8A 4OZOA 5EYXA 1LESA 1W0NA 2PHXA 4QPIA 1NX9A 3S6PA 5A6XA 1SBEA 1UXZA 2G19A 1C8M1 5DG2A 1N1SA 2VJXA 5EFUA 2WNOA 3BN6A 4J1WA 1LENA 1COV1 3SNMA 3H8XA 1PMHX 1NY72 4BQ1A 1AYN1 2JG9A 2OQ6A 1OC1A 2Q1MA 1QJY1 1B35C 3MUY1 5DAVA 5A1LA 1W8OA 4CYDA 4QQLA 4LBQB 1G7YA 3IM0A 1AR73 2Y26A 5FO7B 4ONUA 4RR3A 2VZOA 2NQYA 3UV9A 3KF3A 5FO8B 3LEKA 3MFAA 3POIA 2VZUA 3ZYGA 4CSWA 1FATA 2P6HA 4HN0A 2XJRA 4AVBA 5C9AA 5JSPA 2OYZA 2P5BA 3V0BA 1LEDA 2CWMA 3MEPA 2WT2A 1BQPA 3RYPA 5FZ3A 3FL7A 4N7IA 4TWTA 3B01A 4MGTA 4MSVA 2RS51 1R092 4LXLA 5C8CB 4FPLA 3AL5A 3WHUA 3CHXA 1XU2A 3F95A 5A6QA 5I0SA 2WN3A 3LDKA 4CCKA 4HMZA 4BIFA 2BTVC 2E7TA 4AW7A 5C4WC 3NNMA 2XWJB 4Z1VA 2DCTA 1NG0A 4XF0A 5FY7A 1KFXL 2L9LA 3FUOA 4XJ8A 4LNVA 3ACGA 3IAPA 5FMBA 3WY6A 5A1AA 4B29A 1KFUL 2EIEA 5E8AA 5CFCC 5JXJA 1PIV2 5FMOL 4ARXA 1VBD3 2WAOA 3PUIA 4KI5M 3UNPA 4AF9A 4MGSA 4Q8KA 2DVGA 4N7UA 4CEWA 2AGSA 1W0OA 1QJEA 3NNFA 4E4HA 2WNUC 2V5YA 3RRDA 5D1IA 1SMVA 2E6VA 2D97A 1QJZA 3I2KA 1HXS3 1ND3A 1XNBA 4EN9B 3VBSC 5C3OA 2W5FA 2ZX4A 1D4M2 2B45X 2D7FA 2E31A 2OQ7A 4R9CA 1FXZA 4D7SA 4MZUA 3D5OA 2YPDA 5LBEA 4JTNA 1SG3A 4DY5A 4QGMA 3WV6A 3HD8B 4P9YA 5BNNB 1Z78A 5I91A 5D8AA 4QPIB 1FAYA 2RS13 4ITCA 1LEMA 4Y5SA 2C6SA 2X09A 1AX2A 2BNNA 4LLOA 1GFF2 3KWVA 3BTAA 2A73B 1MS0A 3RMYA 2P3YA 5DAWA 5L7OA 3EJKA 1OKQA 2F17A 2TBVA 4G9SB 2ZHLA 4HETA 1ZX5A 3VL8A 4WVMA 4XZUG 2KD7A 5JOXA 1MEC3 2LM3A 1U5YA 4JRAA 2F6BA 4YM3A 4A4AA 1PNFA 1DU3D 3DN7A 1CX4A 4YGDA 4E8CA 5G05L 4I01A 1LJ7A 4NHKA 4RR3B 3EYPA 1SDDB 1LOGA 2R0FA 3UKVA 3GALA 5T5OA 1J1TA 1VBC2 2OW4A 3EHKA 1SPPB 1SBDA 2OZ6A 4CZSA 2NMOA 5FP4A 3ZFFB 4IUGA 2VW0A 1PGL1 3MYXA 3E6CC 3OJBA 3T0BA 5GZGA 1WWYA 3ZSEA 1DYOA 3LFIA 4XTPA 2FDKA 2A3XA 2FMDA 2R32A 3U14A 3WQ0A 1DGLA 2XLAA 3R6SA 1JOJA 1LTEA 3D3AA 1O4TA 1AYM2 4I09A 4W8JA 4N53B 4CDXB 4A41A 4HG6B 1ZVFA 2V73A 5I0RA 2ZPXA 3N7JA 1H6YA 5BUVA 1FOD2 3CZUA 1JYVA 1J59A 2PMWB 3J7NA 4JCKA 1K5MB 3VBUB 3LIGA 2XLFA 1LCLA 3WF2A 3KLSA 3T2QA 3J7MA 1OQDA 2UWBA 3RG0A 2AH2A 1WCSA 1ZYBA 2XXZA 4CPBA 3N9LA 1PVC2 1UYXA 4FVVA 5LW9A 2R30A 4XJAA 1SLAA 1MQTC 3RVHA 3RYKA 4GJZA 3USSA 1GWLA 1ND3B 4IEXA 3NV3A 3H3UA 4CDWA 2YMZA 2DF7A 4IESA 2VUDA 1DF0A 3THPA 1JZ2A 1WW6A 2A75A 2EIDA 3T1LA 4LT5A 1DFQA 4L9BA 3USUA 1LRHA 2Z4FA 4DB5A 2GC0A 1MS8A 5LK5A 1NA1C 4CCLA 2I45A 1VBE2 3UK9A 1YCIA 1E5IA 2D44A 1HN0A 1VAVA 2Y8KA 1EAH3 4UFHA 4DPNA 1PO13 3K3OA 5D8AB 1JI6A 2D6OX 3VB9A 4FP3A 3K75B 3IB3A 3THCA 2RJ2A 4OZXA 3POEA 3ENRA 1BYHA 5FOBB 3Q8AA 4BDVB 1V6JA 4HK8A 2H0BA 3M3OA 3TOJA 5AFEA 2YC2A 4H14A 3RZKA 1XYOA 4O9EA 2QQVA 3J7LA 4I0AA 4JZRA 3TN91 1OF4A 3MF9A 4OI2A 1QGLA 4YPJA 1PM7A 1YQ8A 5JPNB 5EV7A 5A7PA 3WEZA 1FI2A 2VNVA 2R062 3V56A 4A2UA 1LOAA 2D3RA 5FMOS 2Q8DA 2DDUA 2K2SA 5CISA 3I3QA 1GICA 3DYPA 1CAXB 1YI9A 1CONA 4B1MA 3GBFA 2WKKA 1UN1A 2IXCA 1HV1A 3FBYA 2VMDA 3PIGA 3QH7A 3P6BA 4RHV2 3ZN4A 1JUIA 3WNOA 4LUKA 4QPYA 2RMU3 3FUQA 2DCZA 3HNMA 4NE9A 2O8OA 4CDUC 4HVQA 1UYZA 3NVCA 4GIQA 1ZREA 3N3HA 4XUQA 3W59A 1M4WA 1RGSA 4A45A 2A3YA 2VGDA 3E5QA 1Q3EA 1YJLA 5FK8A 2ZX2A 1RUG3 5FMDA 5DDJ2 3K4DA 4XFFA 5JDBA 1N47A 1RUD3 1UU6A 1H2NA 2XLGA 2ZGPA 3H1YA 3OEAA 4FFHA 4BE3A 3T1MA 1HB3A 4UW6A 4Q4X1 2XQRA 4CEYA 3WOGA 1CAVB 3F2ZA 1A3KA 5A7QA 3VBRA 4YZ1A 4MXWA 2AEZA 2ZGTA 2BPA2 5IK8A 2YUEA 1VRBA 1SLLA 4MVTA 3POYA 2WFF1 4NOTA 1EUUA 3E5XA 3USUB 3ZMOA 4Q4V1 1HDKA 2OA2A 2DBNA 3HN3A 2ERFA 3K3NA 4YRDA 3N9PA 5A70A 4M0HA 4LO5B 2FCVA 3KSCA 3WG3A 5L19A 2B7YA 5F9TA 3C7HA 3RJ2X 2JWPA 5FP8A 2HWF1 5FUNA 5A3UA 4Y1YA 4CU6A 5AFBA 5HV0A 5E16A 2WS93 2IZWA 4NHMA 2DFCA 2XGXA 3U75A 5FP9A 1CIYA 2QQIA 3ORJA 4COVA 2LW8A 4K1ZA 4WM7A 4BJ0A 1ZZ6A 1VIWB 4F8AA 1VRH1 2A6YA 3OBTA 4JDNA 1YQCA 1CAUA 1VPHA 3RMXA 1NT0A 4BK5A 3M3QA 1SLCA 3ALQA 4MUVA 4GH4C 1H1MA 1RMU2 1UZVA 4CXWA 4L11A 3VDAA 2B42B 4AI9A 4AWDA 5FR3A 1BBT3 3ZLIA 4Z92B 1XXNA 2R041 2DUOA 3NNJA 2OUHA 3JBG3 3VBHA 3ZFEC 5LA2A 4AR2A 4BU2A 3SCGA 4NN0A 5EWSA 1RUF2 2QVSB 4IEUA 5GLUA 3ECQA 4GB33 3I2OA 3WNKA 4B4PA 4GMP0 1QNYA 4IE7A 1RUJ1 4XUTA 1REFA 4P9LA 5C5UA 1WZXA 2CHHA 2VTXA 3DYOA 4NHYA 3DPRC 4E8DA 3DL3A 1OBNA 1PO23 3URFA 4LKSA 3BKZA 1ZBE1 4XTMA 3INAA 3TBDA 1H8VA 3MHZA 3FLRA 1YFWA 4AFMA 4D6SA 1S0DA 2QZ3A 1NUKA 2D6LX 2D3SA 5F5QA 1GP6A 2QUOA 5HBAA 1GWKA 4H55A 5FZOA 2WNVB 4Y5Z0 3K48A 4NUBA 2Y6LA 4XIKA 5LRRA 4EN6B 2Q8CA 2BUKA 1GOGA 3I3BA 3PUQA 4N43C 3VBRB 3KQ4B 3VL9A 1ZRFA 4HANA 2SBAA 1B09A 3VD5A 1AL23 2VL4A 3VBOC 1ENQA 2R6QA 1OOPB 4XF9A 1GBGA 3M4FA 3H8RA 3JB4C 4B8EA 1QHDA 4SBVA 5CFDC 4LK6A 1S1AA 2OT7A 3HAGA 3OD0A 4Z07A 2YGLA 5FYBA 4QKFA 4O65A 3T2PA 4HONA 3D8CA 3PJYA 2R1BA 3RWKX 3ZXEA 3J4UH 3W9AA 4HKWA 2AR6A 4CUBA 1H2LA 1LGCA 2CDOA 2ZA9A 4YM0A 1KGYA 5C71A 3J8F3 3GZEA 3LPGA 1ZM1A 1W39A 1IG0A 4JKLA 5EIYB 1I1EA 3FBMA 3LSDA 2ZOEB 5DAXA 1J3QA 2RM21 4XJ9A 4XCAA 1AR72 1IKPA 2YY1A 3CKHA 4ZU5A 3PVOA 4BXFA 4XBQA 4FPGA 4IE5A 5BY5A 5LK7B 5IK5A 1YFUA 3NQHA 4H2AA 4DOUA 2KM2A 1NLRA 5FZEA 4ET7A 3VHRA 3ZYPA 1OA3A 4L0PA 2WJSA 4WVVA 2ZTNA 1U5XA 3VBHB 3M70A 3CNAA 5LBCA 2GALA 4IE0A 3Q8EA 4UBHA 3IBMA 3MLJA 2VY0A 3ZYBA 2ZEXA 1I5PA 4NPRA 2IXJA 4PLOA 1POV3 3FHIB 1QJX3 2IXLA 5A7OA 4U2AA 1YC61 1CZTA 1KJLA 2BVBA 3LDBA 1H2KA 4XABA 4COYA 3N9OA 1NCRC 2V09A 5H9RA 5H9QA 3HWJA 1FYUA 4X8PA 1JOPA 5IUQA 2R16A 2J1VA 3ZPYA 5A32A 1BVVA 4ORFA 5FOJB 3S0MA 1BK1A 1TNFA 5JOZA 1PVXA 3OUHA 3BYWA 5ABJC 1H0BA 2E33A 4CCJA 2ZBJA 1VLNA 1VBD2 1QXJA 4KL1A 5C33A 2MEV1 4LHKA 2VBBA 1B35A 2Z42A 5F5IA 5FZOB 2HBUA 2W52A 2XBO1 1NCQC 3ETQA 1Z0HA 3PNAA 5E6HA 3WDXA 4AHXA 4CDWC 3SC7X 2NYYA 3MV01 1W8WA 3C7OA 5J96B 4IW3A 2GSYA 1XPWA 1ASJ3 1FV3A 1Z7S1 1HXS2 1ODMA 1NZCA 2XUEA 3LWCA 4NR1A 4XAEA 4YG0A 3AM2A 2BOIA 2P17A 2PLV3 2WSVA 1FMD3 1IHMA 1VB4A 1C5IA 1QQP1 2CYFA 2WRAA 1FX5A 5DZFA 3IDCB 2F4PA 3AC0A 4HXCA 1JZ4A 4MGZE 1MZ6A 3TEWA 4KG0A 4M0NA 2RS12 2WZR1 2HYXA 5ACA1 4YVWC 4HZFA 2JIJA 4QX2A 1RC6A 5AVPA 1OFSA 2OVUA 1W2NA 1G9BA 2X10A 4DO0A 3OPTA 5GKAC 5C4WA 1R1ZA 5BNOB 1FPN1 1VP6A 3POJA 1W6PA 4FQ4A 1FMD1 4P00B 1MEC2 4AEDB 2VZPA 3IT8A 2ZKLA 5FPZA 5CFCA 3VDDB 1UU4A 4XQDA 2A3WA 1DQ5A 3KM5A 1S0EA 3O1VA 3TEXA 5LZ6A 2ZMLA 4HKLA 3S30A 2VECA 4WZFA 3MGUA 1CJDA 4YFZA 2E53A 2QCSB 5HCBA 4W50A 2BWCA 2WNUA 5I0UA 4XOGA 3ZFGC 4CUCA 5DUXA 5KR7A 4IGQA 1K5JA 3PVEA 1I3HA 3O0WA 3VBSA 1JZ7A 1OKOA 1D7PM 1DQ2A 2ZX1A 4OI1A 3AYAA 1O3SA 3A21A 4XFGA 3POBA 4NRMA 2Y6GA 2D6KA 5FRAA 2Q8EA 4YVSC 1S4CA 3A22A 4D3WA 2R0HA 5CBLA 2FZ2A 2XJUA 4XF3A 2PHTA 1V9U3 2N7GA 2PHLA 1W6MA 5I0TA 4IV3C 1O8PA 2VPVA 3OSDA 4LHSA 4UF0A 1PK6C 4IEPA 3BPZA 4UFLA 2K46A 3POSA 5CKNA 1RHI1 1VBA1 3KV5A 2VE1A 2A5ZA 2HWC1 1D2SA 4NAMA 5T5PA 1RVF3 4AGVA 3Q8FA 3VD7A 3OBAA 5FPVA 4Y20B 1IKQA 5M0TA 5E89A 4RFT0 4YG3A 1W9WA 3RDIA 5BNQA 1N1YA 1TME3 1OD3A 2PXJA 4HLTA 3SLIA 2O1QA 4UI9L 1WMEA 2HWE1 5FZCA 1NE4A 1PHMA 1VAMA 4DMIA 5FKBA 5BYNA 2WWUA 4AEMA 4GZ9A 5FXWA 3OBRA 1XB9A 3T30A 3M2MA 3U07A 1WD3A 2A6VA 4FXGB 4RS5B 3SKJE 5FYVA 1E57A 4LHLA 2G1MA 1QJU3 4LO4B 5LEKA 5FK7A 1ZRIA 5HPOA 4CP9A 4DUXA 2RVAA 1EAH2 5CVRA 1PO12 3HNYM 3WDTA 1X82A 1N1VA 1TVGA 4OHZA 2JKBA 3CEWA 2WUHA 3IDEA 3L2HA 3B93A 3ZYFA 1OD5A 4PBOA 5J37A 1Y9MA 2VNGA 4MGIE 3SEPA 3D82A 3K2OA 3I49A 5AC93 3WDUA 3UGHA 4IEOA 4Q4Y1 4Y5TA 3VD3A 2C4XA 5L36A 1ZA7A 4RA0A 2VM9A 4TLGA 4YW7A 5LWBA 3U4SA 3UKNA 1I5ZA 4KNCA 3WUCA 5CFCB 2TNFA 4OHYA 2CSGA 5FWEA 2UYAA 4WM8C 2VC9A 1EV13 1W8ZA 4OHWA 4EWEA 5C3SA 4JHTA 3CJXA 1LNSA 3MW2A 5J7MA 4IV1C 2G9FA 3PLQA 2JDPA 2CL2A 2PELA 5JWPA 5AC91 4AFAA 1MQTA 4X6QB 2DU0A 1HB1A 3R4DB 3LQCA 4QXBA 4KGGA 4XJZA 2VBDA 4OI4A 5HI0A 1NA1A 3Q8CA 3DF0A 3HT1A 3N35A 3VZMA 4GULA 1W6MB 4KWKA 2PHUA 4DFSA 5DMYA 4XVHA 5FZHA 3ZXKA 2VNRA 4AQ6A 1NXD1 5FIXA 1AXZA 2RMU2 3FLPA 5GLVA 4CPBD 5C3RA 4C91A 3KZ4C 2XUMA 1DZRA 4DINB 5FZKA 2ZGLA 1OHFA 3OYWB 5LB6A 2DUQA 2AYHA 3NAPC 4P08A 5KBFA 4OQ8A 2C24A 2D6PA 1UOGA 5L73A 3H7JA 3WXPA 1RUG2 4QXHA 2VMHA 1X8MA 1E5SA 2MHFA 1W8TA 2XONA 4LOTA 4XETA 4LO6B 1TG7A 2W08A 1RUD2 3V0AB 3VLBB 1AJOA 1ZBA1 5FY5A 3LD8A 3CMGA 4W6WA 5HXMA 3NV2A 2Y64A 2RJLA 3AXDA 4FFFA 1DZQA 1ENXA 1L7LA 1R081 5SV8A 2J1TA 5DUUA 3ACFA 2JB8A 3MW4A 1IQAA 1RXGA 5FZ8A 3X29B 1ODNA 5I8YA 3PMEA 4I3GA 1RUI1 5FPBA 1AR61 4L92A 4JGZC 2NLRA 5JMOA 3WNLA 2H0VA 2G9ZA 1ALYA 2W91A 3ZR6A 2FDGA 4XHXA 1JUHA 1QH6A 1PX3A 3ILFA 5DN2A 3NMBA 4YZ5A 4JV4A 1PGSA 3V65A 4XEZA 3VV1A 4GQ7A 4FTSA 5KC5A 1CD3G 3AP9A 1A78A 4AI0A 2WS92 1IGOA 1AR83 4CDUA 1OA2A 4I0WB 4JAAA 2WO2A 4CDQB 1SCSA 3CF6E 4DEQA 1VBB3 5IT6A 2P2KA 4Z82A 5L9BA 4R8HA 2QJVA 3BB6A 3CJIC 1HQWA 2WNEA 3FFQA 1QMJA 2GZWA 4M00A 5FUIA 1C8M3 3ASIA 4QWNA 2VVEA 1G9CA 2ZGQA 1IS4A 3ZIXA 3E97A 4IQPA 5JPMB 2JE7A 1G86A 1COV3 3M8LA 4NRPA 1VR3A 1DYKA 5EP9A 1WBFA 5GALA 4YARA 1AYN3 3FN9A 3OEBA 2QQPA 2QQJA 1BBT2 2UY8A 1QJY3 4QPGB 5CG8A 1MQTB 2ZZJA 3JBG2 4HFSA 1ENSA 2RS31 4BQWA 3ZKYA 2NPIA 4GB32 1HIXA 1GOFA 3A23A 3I2FA 1JHJA 4LA3A 2GP3A 2X53S 3ACLA 3LB9A 4PF1A 5FZ0A 5C6CA 5GZCA 3A0NA 2HWB2 4IXLA 4PIYA 5FLJA 5KHGA 3PURA 1PO22 5FZMA 3SCFA 4BPZA 1BCXA 3I2GA 3V64A 4MO3M 1RUC1 3KT7A 4QX8A 3RNSA 2VXRA 2XB6C 2RS53 1F8VA 2Y33A 1PGW2 1AUYA 2YC4A 3T0AA 4EWAA 3VBFC 2FQPA 3WDYA 2W2IA 5A3PA 3JD71 3MLKA 4R52A 4DZGA 1QH7A 1O3QA 2DCKA 2XVKA 2NN8A 4KU7A 5FYMA 3I3MA 2A7AA 4U36A 4DNYA 4UWDA 1JZ8A 1DP0A 3ME2A 2DTYA 1TE1B 3AZZA 3DYMA 3HIFA 3D0SA 3LA7A 4L99A 2G9GA 5FZ9A 5JSOA 2MNGA 2V4AA 1W6QB 1LOCA 4R9AA 4MLOA 1VB2A 2VCMA 1R1A1 4MADA 4L97A 2EALA 4GH4A 4PIXA 1W8HA 2P3KA 4AGGA 2FDHA 1CAWB 2VMFA 3VKFC 1AL22 5I93A 3ZFEA 1HB4A 3O1UA 1EPWA 2KXLA 4D94A 5B4XA 3E6BA 1VMFA 4YLZA 5IATA 1WMXA 2KA3A 1ULCA 1QKQA 3K77A 3I54A 4TYSA 2I74A 4JHZA 4YW4A 3ZMNA 4IEQA 4OULA 5DPNA 1VJ2A 5IHRA 3DPRA 1GKBA 4EN0A 1W05A 3ATGA 3EB7A 1OURA 3J8F2 4PLNA 5A7SA 3TRSB 4K6BA 2VQTA 2OKXA 3NWKA 4W6YA 3J7HA 4RGGA 3S57A 2VUAA 4Q27A 3I97A 2D93A 1R64A 5J3UA 3PDQA 4YG6A 2IVIB 2R1DA 1Q8PA 1T6GC 5A7WB 1WUVA 4MGYE 5EYYA 4D6QA 2WO7A 1W9TA 1OLQA 2YHJA 4O61A 5EXOA 4NIIA 2ZZQA 2BERA 5E1RA 3ZN6A 4C8DA 1XJAA 1RIRA 4JRLA 1HRI1 2BOJA 3B5LB 1O59A 1Y9QA 4N43A 4AHYA 3VD4A 2QQLA 3FHQA 5FYYA 4DRRA 2VMGA 3PMSA 1UD1A 1HQLA 1GNYA 1RUH1 4OMCA 4P9IA 3VBOA 5JAXA 1QJX2 3H42B 4LORA 1W3VA 2YPJA 4PHZA 2HYKA 3O1PA 1UF2C 3A7QA 1YRZA 2GNMA 2XH6A 5CFDA 1A34A 4QXKA 2AREA 4XFIA 2W94A 2JG9B 5JMCA 3ZKUA 4FOVA 4PJYA 3UJQA 1EUTA 1Q56A 3P1IA 2JDZA 4AI2A 2DV9A 5KXBA 4MG2A 2RDRA 3KCCA 1S0JA 5DAPA 3NKGA 4EROA 5EJZB 4IE4A 4AQSA 2XJTA 4PBPA 1GNZA 1JYCA 2Z79A 1LHOA 3ZDSA 1C4RA 2XKPA 4HT1T 3MW3A 2PA7A 3HBKA 2QQKA 4MX3A 3MFCA 5F3EA 5C9AB 1JYWA 5JZGC 4AVSA 2ATFA 1L7QA 3V0BB 4FOYA 1XYNA 1ASJ2 4TTGA 4RYDA 4N9HA 2PHWA 4MHUA 4RN5A 1ND2C 1V6IA 2O0OA 2OUJA 3AJYA 3B9CA 1JODA 2PLV2 3WZ1A 3VHNA 4LBLA 2X5IC 4NIAA 3KT4A 2QE3A 5F5AA 3NO8A 2ZAHA 4R9BA 1GOHA 1DYPA 2CGNA 4AHZA 1BEV1 2BGOA 4KQ7A 3HPNA 1F2NA 2NMNA 1V6MA 3AJZA 5T5LA 2VNOA 4P14A 3RPQA 5IK7A 3A4UA 1NCRA 4XIOA 5G04L 4DIQA 3MIBA 5JIUA 2GP5A 5KHJA 2VQUA 3IDBB 3PUHA 4JC1A 4YGCA 2GNBA 3AKPA 3WF0A 5D21A 4DRVA 3VDBA 2FD8A 3B69A 1RUE3 2BW8A 5KHIA 3AMHA 4QXCA 3MIEA 4M3CA 3KCYA 1DLLA 5BNPC 3MLLA 4HOOA 1AX0A 5BXXA 5ABJA 1YQ2A 4CEWB 5CNAA 2Z5WA 1S2EA 3HN1A 3SXWA 1W8FA 3N4MA 4GKYA 4M01A 2P37A 4I02A 4Y22A 1JU4A 1NCQA 2AEYA 1BK0A 2BZDA 2WYSA 3RSJA 1GZWA 2Q0AA 4YSFA 4GWMA 3H1WA 2HWD1 3ABZA 1BKZA 2FHRA 4FFIA 4G3YC 4N43B 1RUE1 1EP0A 3MIGA 4P9WA 4KMQA 1XNKA 1XOYA 3HOBA 4KWUA 4A6SA 3TN93 1LULA 1MR5A 5F8PA 4QDQA 5FY9A 2Y0OA 2DTWA 5CZKA 4AE2A 1GWMA 1V9U2 2VAUA 3ZVXA 4IEWA 4Y1XA 2CAVA 1IPKA 1DQ0A 4LJHA 1WKYA 4ZXEA 4C1XA 5A3MA 3H8OA 4N9IA 5CFDB 3FE5A 1UPSA 5L7OB 2B4KA 5C3PA 5GLZA 1H8TC 2YU1A 4MGKE 3GM8A 4AYUA 4EN7B 1K45A 1I9RA 2JDAA 1O5LA 4IE6A 4RL7A 4YVWA 3PJQA 4WVMB 1LGNA 2Y60A 4WVWA 5IVJA 1RVF2 2WA3A 2YFUA 3LEGA 2XOMA 2JE8A 2WLQA 2W3JA 3FMGA 2WL1A 1H4GA 5FKCA 3VUOA 1TME2 4KH9A 1HRV1 2E9QA 4EZHA 1HB2A 3AMPA 3ITQA 4Q26A 1G8WA 1GANA 5K7PA 1LOBA 3LKJA 3GF6A 3I59A 3P3NA 1W0PA 4KG8A 4LIVA 4ASKA 5KXCA 1DGWA 2BNMA 4I30A 5B4NA 2WLPA 4C90A 4P5HA 5KHHA 3ZFGA 1QJU2 2ZGUA 4LKDA 4S2FA 3RZZA 2HEYF 5JCTA 4IEVA 4Q4X3 4YVSA 2RR12 1TMF1 1I6XA 1O8SA 4GMP1 4QU1A 2R071 1AZDA 4D0QA 2JXAA 1ZZBA 4IV3A 3WW2A 4GWIA 4E4ZA 5C8CC 3QCWA 4CUGA 3ACIA 5GLWA 1PK6A 2WFF3 5HCAA 3O12A 1BLZA 4Q4V3 4AVAA 3OB8A 4QX1A 4OMDA 1JYXA 1ULGA 1G9AA 2CGOA 2VQ0A 3GXUA 4FOWA 1BMV1 2BRTA 3O0VA 3W5MA 1IS3A 5ABJB 1GZ9A 1K12A 1XE7A 2JB4A 3ZSKA 3K51A 1ENRA 2HWF3 2OPKA 2UU8A 3NV1A 4XAAA 1NKGA 3UKTA 1EV12 1TEIA 4FPYA 1UU5A 3IKWA 1NCQB 5IJRA 2Y34A 4CDWB 5A6YA 1XSQA 1IOAA 2GC2A 5IVBA 1NZIA 5F1RA 1JZ5A 1GZWB 4G4FA 5DUVA 4QM9A 1GQPA 4ZZ8A 4HK9A 5JOWA 3GCXA 4WBBA 2VQAA 2XJVA 4OHXA 1VRH3 1Y3TA 4XQWA 1XSRA 2ES3A 2WC2A 3W5NA 1OH4A 5EJ3A 3IPVA 1IS5A 2G4IA 3T4HB 4LBKA 1G6NA 4EYUA 5JVVA 2EIGA 3FWEA 2CAUA 2RV9A 4RSUA 3KHBA 5FYSA 1SFYA 2R043 4UFJA 1N3PA 1V6KA 3LDRA 1F31A 3BOWA 1IPJA 3LEMA 3B94A 5FXZA 4BQXA 2FCUA 5BNNC 2C1FA 1QDCA 2I07B 1F4HA 2BDRA 2TEPA 3WF1A 4B3NA 1XE8A 1RB8G 4COWA 3H9AA 1RUJ3 3Q9OA 1RJ8A 3PL0A 1UY2A 4Q0VA 1OLMA 2Y6FA 4JQRA 1FNZA 1GP5A 1UMHA 3IN9A 1OSGA 2W87A 2QBXA 3DKWA 2J1SA 4QB6A 2PQQA 1ZBE3 1X33A 1UPIA 3LIHA 4XC9A 1UX7A 3MBWA 4WM8A 3GHNA 4AGRA 1UZZA 4EV0A 3I59B 4FT8A 2J1EA 3HMYA 1LHVA 4NWWA 3JQXA 1YI7A 1H9WA 3NJVA 4IV1A 4UAPA 4MXVA 3VKOA 2JX9A 4BXSV 1X9TA 3M3EA 4A44A 3BTXA 1UOFA 1UIJA 2WO1A 2ZABA 2JDUA 3VKLA 4YVSB 3ZFFC 3PTRB 4KWLA 1AX1A 3WF3A 1UZWA 1QXPA 1DLCA 2JDHA 5HCHA 4NWVA 3POWA 2QQWA 4DXRA 1AR82 1PK6B 2P1BA 1TNRA 2VBPA 3AK0A 1EPZA 5FTTC 1Q43A 1VBB2 2P6CA 1NOVA 3WF4A 2DVDA 4YM2A 5FJKA 3NAPA 4XUNA 2GH2A 3PHMA 4N53C 3B02A 4CDXC 2GN7A 1CGPA 4Z2WA 4XDOA 1DQ6A 2VCAA 4ZONA 1H9PA 2VZQA 4CEYB 1C8M2 2CV6A 3AP4A 4NRQA 5LY2A 1AR91 3KMHA 4MXWB 3MO4A 5DG1A 4ZU4A 4CCOA 3TEYA 1COV2 2DFBA 1K5MC 3VBUC 2W1WA 1WW4A 5HV4A 1O5UA 3ZX7A 1AYN2 3N9NA 3N7LA 4DY3A 5J36A 1W06A 3CO2A 5FLIA 5FMCA 5FP3A 1ULOA 1QJY2 1W6NA 3VGIA 3RJRA 3E1F1 1C28A 2RM23 4K21A 3VZJA 4HPKA 4Q4W1 4NJ4A 2BGCA 4BM8A 4CXXA 4JGZA 1XBFA 2VTFA 5LA9A 1H2MA 3AL6A 4F3JA 4M4RA 2BGPA 3DUIA 1UYPA 3ZXDA 3RS6A 4XYXA 3MF6A 2ZEYA 1NY71 5A1FA 1UYYA 2CGPA 5I8SA 4DS0A 5CADA 4J6GA 2IXKA 3IMMA 4WM7B 2RS52 1SFNA 4YWAA 3FJSA 3GJAA 2XPJA 2XG3A 5CKQA 1CAUB 3O7OA 4GALA 2Q8OA 4FBFA 3A0KA 3NSTA 1CN1A 4V2VA 5F7UA 4LBQD 5DZEA 4XZPA 2V4VA 3CJIA 2IXHA 3NJYA 3DKQA 2EAAA 2W0XA 5IW0A 1V6LA 2ET1A 4V2WA 4ASLA 1T6BX 1UKRA 3AZXA 1R091 2MEV3 2XL9A 4INDA 1AXYA 5LA1A 4NIGA 4BMBA 1CZSA 2JICA 3OY8A 4JX0A 4Q1RA 2XBO3 4URTA 4AXOA 1UKGA 4QX5A 3W20A 3AKTA 4EWDA 1WW5A 5IFPA 2ARXA 5FZ6A 1AF9A 1Z7S3 2YYOA 3H0OA 4LKEA 2A6WA 2D5FA 2RDNA 1JTZX 1LHNA 5K8SA 3WQ1A 3N9MA 3C3VA 5T52A 3WNPA 3CZJA 3LAGA 1JYNA 1US3A 1PIV1 4Q0PA 1YXWA 1QQP3 1YIFA 1A8MA 3UGFA 2IFRA 1JOBA 4TLFA 1LAJA 4M4PA 3QBQA 3VBFA 4J25A 2WZR3 4Y24A 4C0BA 5ACA3 4E2SA 4P9XA 1M06G 4XCBA 3AX4A 3KQRA 2ZX3A 5F3GA 1GU3A 4AVVA 4BLJA 4AZZA 1D4M1 1FPN3 2XHNA 4BA6A 3N36A 4R9DA 2YXSA 4A6OA 2Q4SA 3LPFA 1W6NB 2ZGNA 2JKXA 2ZGOA 3ZN5A 4ZHNA 5A3NA 1YUDA 3ZIWA 2VMCA 2W47A 3GZTB 3SCHA 2YV8A 4B4QA 4JKMA 5F3CA 3CU7A 2W39A 4QMAA 5ANNA 1KJRA 3DGTA 2ADEA 1WMFA 4CE8A 1JZ6A 1D2QA 4CUAA 1PGL2 4A7ZA 3LA2A 1QY4A 1ZZ9A 4D8MA 2HKXA 5CU1A 5KXDA 5LY1A 5APAA 1QOOA 1SLBA 3CDZB 5FBZA 3VZOA 3W58A 1HV0A 4JKKA 4O9GA 2XJSA 2P3IA 1OXCA 3OBZA 5FYUA 5FZ7A 4I2OA 1H30A 1S0IA 4P9GA 5I0DA 4RQPC 4D69A 1VBC1 1BZWA 1OPMA 3CJIB 3AFKA 4S2GA 4NIDA 5FZFA 2E51A 1RHI3 1VBA3 2BWAA 3KF5A 2HWC3 3ELNA 2BV4A 1W04A 1A8DA 2VZSA 3KVBA 3AZVA 1KDMA 2HH9A 2UURA 3R05A 1W3XA 4FOQA 2WWSA 4AFBA 2GAUA 3LEIA 1UZ0A 2V72A 3CLPA 4RFRB 4ATFA 5F37A 2AUYA 1DQ1A 4FSJA 4JGYC 1MZ5A 2YC0A 2W1UA 1HJGA 1AYM1 2HWE3 3OPWA 4GD4A 2PHDA 2PAEA 3AVSA 1G9DA 2IXIA 3S5QA 2EXKA 4QQHA 3HT2A 5JLVA 5A32B 3NV4A 3JZVA 1FOD1 2HLEA 2ZKNA 3ZDVA 5CG9A 4K8FA 1V00A 1V70A 4CCMA 4XMIA 5KXEA 4XJWA 3WP3A 4YW3A 3FC0A 4LO8A 4LEJA 4LOSA 1A6CA 4XUPA 1MACA 1B35B 1LECA 1REEA 5C70A 2EXJA 1VMHA 5FXVA 4IDZA 3VBFB 5JOYA 1NAEA 1K3IA 1LODA 3IAQA 5LASA 1PVC1 4CEWC 3MZHA 3AXEA 5L9VA 3I2IA 2XQXA 5FY4A 5JZGA 4Q4Y3 4LUMA 3FHAA 3I3EA 4ISRA 4QKNA 2WNVC 1UWWA 1TQ5A 1VBE1 1U0AA 4S2DA 1ND2A 5FAXA 4K3UA 4E2QA 3LF7A 3TN92 2J42A 4BOWA 2HBTA 1RINA 2W1SA 3MUZ1 2X5IA 3VN4A 1D0HA 4Q0UA 3WX5A 1C1FA 3OG2A 3DV8A 3KGZA 2A6XA 2BNOA 1W28A 1CZVA 2W95A 2ZCWA 3E5UA 3BIEA 5B2GB 1YO8A 3AZWA 1C3HA 1L3JA 1OOPC 5C4WB
chains in the Genus database with same CATH topology
2GH8A 1NYWA 1AXKA 1W6PB 4QQPA 2TUNA 4EN8B 4HVOA 3VZLA 3H7YA 3KS7A 3I2DA 3QACA 4QU2A 3WDWA 1WD4A 4X8NA 4AEJA 2CTVA 5BNPA 2LALA 4HSJA 2R061 3I8TA 2WNUB 3HBZA 4DXZA 1DGRN 3VBSB 4BLIA 3EXUA 3BODA 3N7MA 4YGBA 3EQEA 1MS5A 3GZAA 4FPCA 1ZBA3 4RHV1 1X8EA 3GZUC 4Q4X2 3AB0A 2ZGKA 3WCRA 4LE3A 1H4HA 1R083 1LU2A 2XHKA 3ZYJB 3WG1A 2Z2SB 4QT6A 1C57A 2EXHA 4XILA 1RUI3 1YIPA 1AR63 2WFF2 4XPVA 4YYOA 4HN1A 5DDJ1 1H8TA 1MS9A 4Q4V2 5GZDA 3ES4A 4F83A 4Y1VA 2DCJA 3GNEA 3ZXJA 1ZRDA 1G9FA 4AEKA 4WZCA 2JECA 3WW3A 4H7LA 4PDWC 2HWF2 4K7JA 1SEFA 5FPXA 5CA6A 4M3CF 2VUJA 3SH3A 4ES9A 4ASMB 4B7KA 3WD5A 2YZ4A 1VRH2 1OFNA 1GQHA 1Y7BA 3G7DA 1QNWA 4LBQA 2A70A 2JEMA 1PZ9A 1ZZ7A 3ZXAC 2UWAA 2ZGSA 1KXGA 4W6XA 3B00A 1DGRA 1Y43B 1QXRA 2GNDA 2R042 2R49A 4YNIA 2RS33 3ZYIB 1J3RA 2I2SA 4RD7A 3ST7A 4MV2A 5C8CA 2FZ1A 5K0UC 1FNYA 4B7EA 1EYBA 1RUJ2 2D5HA 3TAYA 4AI3A 4BZ4A 5DXDA 1WLTA 3R4SA 5BNPB 1MVEA 3C2UA 5T54A 5BNOC 4AQ2A 1RMU1 1RUC3 3KT1A 2EAKA 1ZBE2 1GLHA 3HQXA 4FAHA 1WA4A 4AEDC 1REDA 4XFHA 3VDDC 4E9KA 1RUF1 3JD73 1NQJA 1F5FA 4XXAA 5GJ6A 4AVTA 1NA1B 3D6EA 1SLTA 2JJ6A 4MH0E 3M3IA 1X36A 2GDFA 4CTEA 1R1A3 2LUWA 4K20A 1NE6A 1FV2A 1LHWA 4YFWA 4AK3A 4NVPA 1H8TB 2WFPA 4KU8A 2JG8C 1N3OA 5BNNA 2QDRA 5T55A 2XWBB 2ZHKA 1OPOA 4YW2A 1C1LA 4AFDA 1HQNA 2HEWF 2RJKA 5IK4A 3M7AA 3AKSA 3QOPA 4LA2A 1VAKA 5F6KA 2E63A 4FPHA 2RM22 1LR5A 5JSRA 4BWOA 3S7EA 3FZ3A 2XJPA 3LOBA 1ULFA 3WCSA 3LZZA 4C1WA 3GYDA 2Y0IA 4RS5C 3ZFFA 4BYYA 1HRI3 4CDUB 3MI8A 5SV5A 2IFWA 4LE4A 4FO9A 4YW1A 1GV9A 4P9JA 3AP7A 1RUH3 3CL1A 2WSUA 2ZGRA 2CNAA 1AR71 1D0GA 2GMPA 4PIZA 1J3PA 1CR7A 2EVXA 1VALA 2C0ZA 2ETEA 3N7KA 4N53A 4S2HA 4CDXA 1LKNA 3SISA 1UAIA 4IERA 1DQ4A 1K5MA 3VBUA 1F5JA 4FAGA 2MEV2 1CPNA 1YLLA 2XBO2 4Q0SA 5FDBA 4AG4A 4XFBA 4CP0A 3AMNA 3MIDA 1Z7S2 3KGLA 3AFGA 4LO7A 1RTVA 1QOTA 3FFZA 2VVDA 4N90A 5K9YA 4Y1UA 1DHKB 2D3PA 2ARBA 1VBD1 1QQP2 1SLIA 4L2NA 2PAKA 5FQ0A 4Q1PA 1U5IA 3RWNA 1XU1A 1BEV3 3WW4A 1O3RA 1UW8A 5JI7A 4HKOA 2PFWA 3MPPG 2WZR2 3BOPA 3O5SA 5ACA2 4LULA 4YZ3A 3SHRA 1GSLA 1HXS1 2MPFA 3OF1A 4OVEA 1YNAA 4GH4B 1FPN2 1QOSA 1V6OA 2Q1ZB 5FO9B 1C8NA 4C0HA 3J26N 1FMD2 2ZS6B 3NL1A 2QDNA 4HBNA 5J98B 3ZFEB 3PVBB 1WLWA 4FXKB 4LR4A 4NHLA 3MIFA 4K9SA 1WCDJ 4OUMA 4ISQA 3EO6A 2ZMKA 4E2GA 1X7NA 2CWSA 2RS11 4Y26A 2VW1A 2LTNA 2JENA 3DPRB 1SQ4A 4LBMA 3AKQA 2HWD3 3I4IA 4IL7A 1CAXA 3TWIA 3LSEA 3FLTA 1MEC1 1RL3A 1RUOA 1ZZCA 2DVBA 2A71A 3B9IA 4XW3A 5BPXA 2ENRA 4CDQC 3QH6A 4QGLA 1H1IA 1KD7A 1PZ7A 3VHOA 3ZN6B 1RHI2 1VBA2 4K40A 2QZ2A 2HWC2 4L8QA 1RJ7A 2D6MA 3VZKA 1OA4A 3J9SA 1O7FA 4HVRA 3VBOB 1Q8OA 4QGNA 2QKDA 1HRV3 2JE9A 1YWKA 3AP6A 2CY6A 3GBGA 2D43A 4BIOA 2HWE2 5DZGA 1CAVA 4QPGC 3NKTA 1BVP1 5GLTA 3JUUA 5A3LA 1S55A 3P3PA 1OMIA 5JR7B 4HSLA 2UY9A 2P34A 1AL0G 1CQ9A 3AMQA 3OGGA 5FQ0B 3ROUA 4META 4LLFA 5KHKA 4IEZA 3MIHA 1TMF3 4GMP3 2DURA 2R073 2DUPA 2B9UA 4WV8A 1O4ZA 4UW5A 3H1MA 4RQPA 3ZO0B 1KRIA 1NQDA 4Q4Y2 2WT1A 4IEYA 4A7YA 2WT0A 2JD4A 1MS3A 3JB8A 3RI9A 5KC6A 1EAH1 1IS6A 1PO11 1SCRA 2EXIA 4PLMA 4TSVA 3U4XA 4KGQA 4Q0QA 1GZCA 5J48A 1OQEA 3MICA 2GNTA 4JGYA 4XDQA 4AHWA 4D7TA 1NCRB 2W68A 1WLDA 3VHPA 3HR9A 4PCRA 1AVBA 4A2UA 1YJKA 5AC92 5FCCA 3D0JA 3NJZA 4M3CB 4V1PA 4LBJA 3ZSMA 1UZYA 2EA7A 1JBCA 3NW4A 4JDMA 1EY2A 4Y22B 4Y1ZA 4E27A 3OPZA 3ZSLA 4W65A 3VKMA 1S0FA 2A6ZA 1KS4A 2VOVA 1UMZA 2XVGA 4X6RB 4I3PA 1LOFC 3WLUA 2DU1A 5F6LB 2WNVA 5HXVA 1DGWX 1KDKA 2B39A 1ZBA2 4ZKTB 1OQ1A 2RMU1 1R082 1PMIA 4Q8LA 4QM8A 4YVWB 3ZXLA 3U10A 1RUI2 4QPIC 5JI9A 1AR62 3PVNA 1RUG1 1OOPA 4ES8A 4A7KA 2ZAAA 3GHMA 4AI8A 1RUD1 1W6OA 3H3ZA 4LBOA 1KQRA 2DVFA 1J58A 2JG9C 2O8QA 1ONAA 1XNDA 4AQTA 3B7MA 1PNGA 3VKNA 4RQPB 3AZYA 4OUSA 1YFXA 1Q5OA 4FPOB 4DQAA 4OFGA 4RR3C 3S7IA 4ATEA 5I8TA 3WP5A 3ZFGB 2B5HA 5C9AC 3JU9A 1WMDA 1Q8QA 2D40A 3FX3A 1AR93 2VOXA 1KITA 1U12A 3QLQA 4JGYB 2PN5A 1UL9A 2OIIA 4UW4A 4XBLA 4IV3B 2WS91 1ZRCA 4SLIA 2VG9A 1CVNA 2PAMA 3TYJA 4UBGA 2RS32 1LHUA 1UX6A 1JW6A 4JVAA 3R0RA 1SBFA 5GM0A 4Q4W3 2BBVA 1ZZ8A 2RE9A 2H6CA 2B8MA 1DG6A 2DYCA 3ZXGA 2HWB3 4GA9A 3L2YA 4R4ZA 1S0GA 1NLSA 3T2TA 1RUC2 2YGMA 2NP0A 1BBT1 4PDWA 1AHSA 2FMYA 3BCWA 3WP6A 3JBG1 1XYPA 2FBEA 4XJUA 3EBRA 4KWJA 4CEWC 1QWRA 3ILRA 3JD72 1GR3A 5AVAA 4GB31 1D4VB 2BVVA 2ET7A 1MS1A 3U11A 2QNKA 1ND3C 3IPVB 4CRQA 3IMNA 3ZXFA 2K0GA 3AYEA 4IETA 2BQPA 2WZPP 1W2UA 2HWB1 4UXAA 1PO21 1R1A2 3WQ7A 1QDOA 1PGW1 1R093 1DZTA 2DCYA 5D8AC 1Q8VA 3I7DA 3WVJA 4XF1A 2Q30A 1ULEA 1W6OB 2WQ4A 4YZ4A 5L7OC 5K0UA 3WUDA 1F9KA 4LBNA 3U0ZA 2NZ9A 4WM8B 2QFEA 1PIV3 3WG2A 5BNOA 4IV1B 4FPFA 3M3CA 1AL21 2ZJCA 4AEDA 1AJKA 1GQGA 1S0CA 3TB0A 3VDDA 1IZ3A 3SH4A 4PF5A 3LA3A 3SH5A 3AMMA 4OLLA 5E88A 3KD4A 1D4M3 5EZWA 3APBA 3J8F1 1HRI2 4AVCA 4FPJA 1FT9A 1QU0A 1SACA 3LCPA 2VOWA 4F7ZA 4FTBA 4TZDA 3NAPB 3BU7A 1DBNA 1RUH2 2UWCA 2Z69A 3UJOA 2JG8A 4YM1A 1DIWA 1MZEA 2VW2A 2ZX0A 2ZHMA 4YGEA 4E4SA 2ZMNA 1CESA 3OCPA 3KB5A 2HEVF 1ZA4A 4PDWB 5FREA 2AENA 3G6JB 2PHRA 4QHBA 1QF3A 4Y20A 1OLRA 4HPKB 2XVLA 1J1LA 4LTAA 1UCXA 1O3TA 3ZYRA 1POV1 1S2BA 1QJX1 1V6NA 2BEOA 4JGZB 5CIRA 2UYBA 5HCFA 1VBC3 1HW5A 2GC1A 2VU9A 1S2KA 2OZJA 2ZGMA 4WVZA 2BFUL 3WP4A 3OD4A 4QD2A 2VULA 4RS5A 4CP1A 1LOEA 1C5HA 1U5ZA 3KCXA 5FLHA 2EF6A 4FTEA 2E7QA 1XRUA 3RYRA 4COUA 1AYM3 1BEV2 3ES1A 2XL7A 4OHVA 1XQNA 3WINE 5A33A 4OI0A 5K0UB 1KS5A 1WGPA 3OTFA 4JDOA 5H9SA 2WINB 3BALA 1ASJ1 1FOD3 4FQZA 4XE9A 2C9AA 3TNQA 5LRSA 2PLV1 3WW1A 1OI6A 4A3XA 5CB7A 3OY8B 3VZNA 3O14A 3SMHA 1PVC3 2WQZC 4CP2A 2DVAA 2P3JA 4H3WA 1JYIA 3MDPA 3JQWA 4UW3A 1O91A 1MZFA 4XMAA 2HWD2 1HX6A 1APNA 3L9JT 4YW5A 1RUE2 1VBE3 2H6BA 2WIIB 3RQ0A 4AFCA 1SDWA 4BH9A 1NXMA 4PQ9A 2HJIA 3OGJA 3TNPB 4BMEA 2JG8B 4GXLA 4XHBA 2GMEA 3PTYA 4I0BA 4RGAA 4ZXKA 4M3CE 4MYEA 3M1HA 3H50A 2X29A 2PYTA 1POV0 1DDLA 3OYWA 2X8KA 1H1AA 4Q2FA 3B3QE 4GWNA 4Q29A 4CEYC 3GBWA 3JCIA 3VBRC 3V0AA 3MPBA 2E7AA 1V9U1 1HRV2 3LOIA 2R063 3UL2A 3SITA 1CJPA 4H7MA 2VMIA 2XKOA 1CIWA 4NO4A 2VH9A 4GKXA 2WA4A 2YDEA 2GC3A 3D4KA 3AKRA 4E4DX 1RVF1 3WG4A 3E6DA 5C8WA 3WDVA 1GYKA 5BV6A 4RHV3 3WHTA 2RHPA 1TME1 4HL0A 3THTA 1UIKA 3AP5A 4FCAA 2RR13 1HLCA 5A33B 1TMF2 1HKDA 1JH5A 2R072 4FPEA 1XNCA 1JN2P 1O4YA 4WM7C 5DUWA 1WLCA 5DDJ3 4CDQA 2Q5TA 5CAZA 1BXHA 4JTOA 5T3NA 1QJU1 1BMV2 1YHFA 2GN3A 4ZU7A 1ZNPA 2AZ5A 2RR11 3VBHC 4EJRA 4QQOA 4FPKA 1YYNA 4FP2A 2D6NA 4QPGA 1PZ8A 1URXA 1JHNA 3ZSJA 1X50A 2ILMA 1RUNA 2SLIA 3AYDA 3WT3A 1WBLA 2VOKA 2D98A 2ZACA 3AYCA 4Y4YA 2DWRA 4KBBA 1EV11 2BFUS 1JXNA 4Z8BA 1MS4A 5T5JA 5JZGB 3LGRA 1ZRRA 3IIAA 4K1YA 1ND2B 1YFYA 5H9PA 3H8UA 2B46X 2X5IB 5GZEA 4BCUA 4YZ2A 5GZFA 1RMU3 5FFOC 2K9ZA 1CPMA 5T50A 4XFCA 1W6QA 2PHFA 1N3QA 2NM1A 2C5DA 2BYVE 3WR0A 1RUF3 2ZHNA 4AI1A 1CAWA 1N1TA 1LU1A 1WCKA 3ILNA 4BHPA 1RITA 1Q8SA 4XQ4A 2YROA 2Y38A 5TSWA 5KWRA 2GU9A 5J09A 2VVFA 3O0XA 1LGBA 5JIAA 3BIWE 1GNHA 4XF4A 1MVQA 1S0BA 1WW7A 3QD6A 4QQ2A 4XBNA 3WNXA 1LOFA 3R4UA 1ULDA 5LEJA 1AR92 4XXPA 4LHNA 4R4XA 4D7YA 1AR81 1BJQA 4J1XA 3IWZA 2XJQA 2PTMA 1VBB1 2IWGB 2IC1A 4B4RA 4XFAA 2GMMA 5I91A 4Q4W2 3RI8A 5EYXA 1LESA 4QPIA 2PHXA 3S6PA 1SBEA 1C8M1 5DG2A 1N1SA 5EFUA 4J1WA 1LENA 1COV1 3SNMA 1NY72 4BQ1A 1AYN1 2JG9A 2Q1MA 1QJY1 1B35C 4CYDA 4QQLA 4LBQB 1G7YA 3IM0A 1AR73 2Y26A 5FO7B 4ONUA 4RR3A 2NQYA 3UV9A 5FO8B 3MFAA 3ZYGA 1FATA 4AVBA 4HN0A 2XJRA 5C9AA 5JSPA 2OYZA 3V0BA 1LEDA 2CWMA 3MEPA 2WT2A 1BQPA 3RYPA 4TWTA 4N7IA 3B01A 4MSVA 2RS51 1R092 5C8CB 4FPLA 3WHUA 1XU2A 5I0SA 4HMZA 4BIFA 2BTVC 2E7TA 4AW7A 5C4WC 2XWJB 4Z1VA 2DCTA 1NG0A 4XF0A 1KFXL 3FUOA 4XJ8A 4LNVA 3WY6A 4B29A 1KFUL 5E8AA 5CFCC 1PIV2 5FMOL 1VBD3 4AF9A 4Q8KA 2DVGA 4N7UA 4CEWA 2AGSA 1W0OA 2WNUC 2V5YA 3RRDA 5D1IA 1SMVA 2E6VA 2D97A 1QJZA 1HXS3 1ND3A 1XNBA 4EN9B 3VBSC 2ZX4A 1D4M2 2B45X 2D7FA 1FXZA 4D7SA 4MZUA 3D5OA 4JTNA 4DY5A 4QGMA 3WV6A 3HD8B 4P9YA 5BNNB 1Z78A 5D8AA 4QPIB 1FAYA 2RS13 4ITCA 1LEMA 1AX2A 2BNNA 4LLOA 1GFF2 3BTAA 2A73B 1MS0A 3RMYA 5L7OA 3EJKA 1OKQA 4G9SB 2TBVA 2ZHLA 4HETA 1ZX5A 3VL8A 4WVMA 5JOXA 1MEC3 2LM3A 1U5YA 4JRAA 2F6BA 4YM3A 1PNFA 1DU3D 3DN7A 1CX4A 4YGDA 4I01A 1LJ7A 4NHKA 4RR3B 1LOGA 2R0FA 3UKVA 3GALA 5T5OA 1J1TA 1VBC2 2OW4A 3EHKA 1SBDA 2OZ6A 4CZSA 2NMOA 3ZFFB 2VW0A 1PGL1 3MYXA 3E6CC 3OJBA 5GZGA 3ZSEA 4XTPA 2A3XA 2FMDA 2R32A 3WQ0A 1DGLA 2XLAA 3R6SA 1JOJA 1LTEA 1O4TA 1AYM2 4I09A 4N53B 4CDXB 1ZVFA 2V73A 5I0RA 2ZPXA 3N7JA 5BUVA 1FOD2 1J59A 4JCKA 1K5MB 3VBUB 2XLFA 1LCLA 3KLSA 1OQDA 2UWBA 3RG0A 2AH2A 1WCSA 1ZYBA 1PVC2 4FVVA 2R30A 4XJAA 1SLAA 1MQTC 3RYKA 3USSA 1ND3B 4IEXA 3NV3A 3H3UA 4CDWA 2YMZA 2DF7A 4IESA 1DF0A 3THPA 1WW6A 2A75A 3T1LA 4LT5A 1DFQA 4L9BA 3USUA 1LRHA 4DB5A 2GC0A 1MS8A 5LK5A 1NA1C 2I45A 1VBE2 3UK9A 1YCIA 2D44A 4DPNA 1VAVA 1EAH3 1PO13 5D8AB 2D6OX 4FP3A 4OZXA 3ENRA 1BYHA 5FOBB 1V6JA 4HK8A 2H0BA 3M3OA 3TOJA 5AFEA 4H14A 1XYOA 4O9EA 4I0AA 3TN91 3MF9A 4OI2A 1QGLA 1PM7A 5JPNB 5EV7A 1FI2A 2R062 3V56A 1LOAA 2D3RA 5FMOS 2K2SA 1GICA 1CAXB 1YI9A 1CONA 3GBFA 2WKKA 1UN1A 2IXCA 1HV1A 3FBYA 3QH7A 4RHV2 3ZN4A 1JUIA 4LUKA 4QPYA 2RMU3 3FUQA 2DCZA 4CDUC 4HVQA 2O8OA 3NVCA 4GIQA 1ZREA 3N3HA 3W59A 1M4WA 1RGSA 2A3YA 2VGDA 3E5QA 1Q3EA 1YJLA 2ZX2A 1RUG3 5DDJ2 4XFFA 5JDBA 1N47A 1RUD3 1UU6A 1H2NA 2XLGA 2ZGPA 3H1YA 4BE3A 3T1MA 4UW6A 4Q4X1 4CEYA 3WOGA 1CAVB 1A3KA 3VBRA 4YZ1A 4MXWA 2ZGTA 2BPA2 5IK8A 2YUEA 1SLLA 4MVTA 3POYA 2WFF1 4NOTA 3E5XA 3USUB 3ZMOA 4Q4V1 2OA2A 1HDKA 2ERFA 4YRDA 4M0HA 4LO5B 3KSCA 3WG3A 5L19A 2B7YA 5F9TA 3RJ2X 2HWF1 4Y1YA 5AFBA 5E16A 2WS93 2IZWA 4NHMA 2DFCA 2XGXA 4COVA 4K1ZA 4WM7A 1ZZ6A 1VIWB 4F8AA 1VRH1 2A6YA 3OBTA 4JDNA 1CAUA 3RMXA 3M3QA 1SLCA 3ALQA 4MUVA 4GH4C 1H1MA 1RMU2 4L11A 4AWDA 2B42B 1BBT3 4Z92B 1XXNA 2R041 2DUOA 3VBHA 2OUHA 3JBG3 3ZFEC 3SCGA 4NN0A 5EWSA 1RUF2 2QVSB 4IEUA 5GLUA 3ECQA 4GB33 4B4PA 4GMP0 1QNYA 1RUJ1 1REFA 4P9LA 3DPRC 3DL3A 1PO23 3URFA 1ZBE1 4XTMA 3INAA 3TBDA 1H8VA 3FLRA 1YFWA 4AFMA 1S0DA 2QZ3A 2D6LX 2D3SA 5F5QA 2QUOA 5HBAA 4H55A 2WNVB 4Y5Z0 3K48A 4XIKA 5LRRA 4EN6B 2BUKA 3VBRB 4N43C 3VL9A 1ZRFA 4HANA 2SBAA 1B09A 1AL23 3VBOC 1ENQA 2R6QA 1OOPB 4XF9A 1GBGA 3M4FA 3JB4C 4B8EA 1QHDA 4SBVA 5CFDC 1S1AA 3HAGA 3OD0A 4Z07A 2YGLA 3D8CA 3PJYA 2R1BA 3ZXEA 3J4UH 3W9AA 4HKWA 2AR6A 1H2LA 1LGCA 2ZA9A 4YM0A 3J8F3 1ZM1A 1W39A 1I1EA 3FBMA 3LSDA 2ZOEB 1J3QA 2RM21 4XJ9A 1AR72 1IKPA 2YY1A 4ZU5A 3PVOA 4XBQA 4FPGA 5BY5A 5LK7B 5IK5A 1YFUA 4DOUA 2KM2A 1NLRA 3VHRA 3ZYPA 1OA3A 2WJSA 4WVVA 2ZTNA 1U5XA 3VBHB 3M70A 3CNAA 2GALA 4UBHA 3IBMA 3MLJA 2VY0A 4NPRA 2IXJA 4PLOA 1POV3 3FHIB 1QJX3 2IXLA 4U2AA 1KJLA 2BVBA 1H2KA 4COYA 1NCRC 2V09A 5H9RA 5H9QA 3HWJA 1FYUA 4X8PA 5IUQA 2R16A 3ZPYA 5A32A