2R041

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 41
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r04100
1NCQB 1VBA3 1ND3B 1QJU1 5BNNC 1PGW2 1ND2B 1TMF2 1ZBE1 2RS51 1Z7S3 1POV3 4NWVA 5CFCC 2VQ0A 1PO12 1RUE2 3CJIA 3S6PA 3VBSC 1OOPB 1NY72 1MEC2 3ZFEB 2WZR3 1TME1 1QJY3 4GB32 1RVF1 2WS93 1PVC1 1AL22 2R073 5C9AC 5K0UA 2HWE3 4Q4Y1 3VBHC 1COV3 1H8TB 4CEWA 1HX6A 4GMP3 1AR73 3JD71 5BNPB 5CFDC 1ZBA1 1HQNA 5JZGB 4CDUB 2Y26A 2HWB2 3ZXAC 4N43A 2HWF3 1AYM2 1RUF2 2BUKA 2HWD1 3DPRB 3VBRA 2BBVA 1BMV2 1RHI3 1RMU3 1HRI2 4Q4X3 1AL0G 4QPIC 2BFUS 2R061 4Q4W1 3VBFA 4NWWA 1QJZA 1VRH2 5CFDB 1PIV1 4N53C 1POV0 1VBD3 4AEDC 4WM7A 2R042 4WM8A 1RUE3 4EJRA 2FZ1A 1R081 4PDWC 1R1A2 4IV3A 5ABJA 2X5IC 5AC91 1QJU3 2TBVA 1ZBE3 1MEC3 1K5MC 1VBB1 4RR3A 1Z7S1 1POV1 5A32B 1R082 4GB33 1BEV1 1AL23 2GH8A 5C4WB 1TME3 4GH4A 3VBUC 1RVF3 1QJY1 1HXS2 4RQPA 4CEYB 1RUJ1 3VDDA 4JGZA 2R071 2HWE1 2HWB3 2WLPA 2RS31 5BNOC 4QPGB 4YVWA 1AYM3 1RUF3 2RMU2 4Q4V2 4GMP1 3JD73 2RR12 4YVSA 1AR82 1HRI3 1RUD2 4RS5B 1FOD2 3VBOC 2PLV2 3ZFGC 1VRH3 2HWF1 1NCQC 5ACA2 4RHV1 1HRV2 1ND2C 1RHI1 1R1A3 4Q4X1 1ASJ2 2HWC2 1R092 3TN91 1RUI2 3NAPB 4RFT0 1PGW1 4JGYB 1OOPC 1TMF1 1EAH2 4CDWB 1B35B 2XBO2 1R083 3ZFEC 1PO11 1RUE1 1RUC2 5GKAC 2ZAHA 1NY71 1VBB3 3J8F2 1MEC1 1NG0A 1H8TC 4CDQB 1NA1A 2RM21 1BEV3 4GB31 1AL21 1AR92 5BNPC 5J98B 5JZGC 4CDUC 2RMU3 2RM22 4Q4V3 1X33A 2RR13 1RUJ3 3CJIB 1AR83 3M8LA 3DPRC 4BCUA 1FOD3 2RS33 2HWB1 1PO22 5BNNA 1AYM1 1IHMA 1RUF1 2ZZQA 1C8M2 5CFCA 1HRV3 2RS12 1BMV1 5A33A 5K0UB 2BFUL 1HRI1 1CD3G 1ASJ3 1C8NA 2HWC3 1WCDJ 1AR62 1R093 3VBSA 1RUI3 3LOBA 4CEWB 1VRH1 4RHV3 3JBG2 2R041 1RUG2 1RUC3 1QQP2 1R1A1 1VBE2 1FMD2 3TN93 1PGL2 1DDLA 4N43B 1AUYA 1TMF3 3J8F3 3VBRB 5C4WC 1PO13 4LLFA 1QJX2 4FTBA 1VB2A 1VAKA 3VBFB 4CEYC 1RUH2 1E57A 2RM23 1EV12 4QPGC 4WM8B 4WM7B 4FSJA 1F8VA 4GH4C 1HXS1 4IV3B 5ABJB 4QPIA 4RS5C 1BBT2 4RR3B 1PO23 1V9U2 2RMU1 4Q4V1 1C8M3 4N53A 2RR11 5J96B 4AEDA 1AR81 1RUD1 1AR63 5D8AA 1FOD1 2X5IA 4Y5Z0 5FMOS 1D4M2 4GH4B 2PLV1 3NAPC 1K5MA 5ACA1 1VBA2 3JBG3 4RQPB 1HRV1 4JGYC 3VDDB 4JGZB 1RUG3 4CDXA 4CDWC 5L7OA 1QQP3 1OHFA 4FTSA 1B35C 1FMD3 1ASJ1 2HWC1 5D8AB 1R091 4YVWB 1RUI1 4IV1A 1FPN1 1NCRA 1EAH1 2R043 4YVSB 3VBUA 2XBO1 4CDXB 1RUC1 2WZR2 4CDQC 1W39A 2WFF2 2WS92 4IV1B 1FPN2 4Y4YA 1RUH3 1MQTA 1A6CA 3J8F1 2QQPA 1NCRB 1COV2 1EV13 3ZFFA 1VB4A 1VBC2 1AR72 1AR91 3CJIC 2MEV2 1MQTB 3VBOA 3ZFGA 1V9U3 3ZFFB 1NCQA 1HXS3 1ND3A 1ND2A 5DDJ2 5K0UC 1RMU2 5C8CA 1PO21 3JB4C 1NA1B 1C8M1 1OOPA 4CEWC 2RS11 1GFF2 1RUD3 3ZFEA 1AYN2 1VBD2 1AR61 2PLV3 5C8CB 4N43C 5ACA3 4Z92B 1QJU2 1H8TA 3JBG1 1ZBE2 2RS52 3JB8A 5LK7B 1RUG1 3VBRC 1QQP1 1VBE1 1FMD1 5AC93 2WFF3 1PGL1 5BNPA 5BNNB 1FPN3 3VBFC 1EAH3 5JZGA 4CDUA 5CFCB 2XBO3 1VBC3 5A33B 1TME2 1QJX1 4WM7C 4WM8C 5C9AA 3VBSB 3DPRA 1RVF2 3VBHA 1PVC2 4IV3C 2MEV3 5ABJC 4FTEA 1RUH1 4Q4Y2 1EV11 4RR3C 1RB8G 1SMVA 5CFDA 2ZTNA 1X36A 1AR93 3JD72 5DDJ3 5C9AB 3VBHB 1ZBA2 2BPA2 1BBT1 1V9U1 2IZWA 3FBMA 2HWD2 5FMOL 4RQPC 1AYN3 3VDDC 5A32A 4JGZC 1D4M1 2GSYA 5D8AC 2R062 2DF7A 4Q4W2 4YVWC 1VBA1 5C4WA 2RS13 1PIV2 1CJDA 2RS53 4PDWA 4YVSC 4QPIB 4CDXC 3HAGA 4SBVA 5L7OC 4CEYA 5AC92 4N53B 4IV1C 4AEDB 4QPGA 1VBB2 4PDWB 1NCRC 1VBE3 1Z7S2 2WZR1 4GMP0 2X5IB 2WFF1 1BEV2 1PVC3 2WS91 4Q4Y3 4RS5A 1K5MB 1COV1 1MQTC 1QJX3 1VBC1 5L7OB 3ZFFC 2FZ2A 2XPJA 1AR71 1QJY2 1RUJ2 1ZBA3 2MEV1 5BNOA 2R072 2HWE2 3IDEA 2RS32 3VBUB 3NAPA 1NA1C 4JGYA 2HWD3 5DDJ1 1ND3C 4CDWA 1B35A 5BNOB 1BBT3 1RMU1 2R063 4Q4W3 2HWF2 1PIV3 5C8CC 4RHV2 1M06G 4CDQA 1AYN1 1RHI2 1VBD1 1OPOA 2WWSA 1D4M3 4Q4X2 3VBOB 1F2NA 3ZFGB 1NOVA 5FOJB 3TN92
chains in the Genus database with same CATH superfamily
1NCQB 1VBA3 4LIVA 4C91A 1Q8VA 3OTFA 4HXCA 5IFPA 5FBZA 1S2BA 2K0GA 1Z7S3 4NWVA 2E7TA 1T2XA 1X8MA 2WFPA 2FCVA 1PO12 4L9BA 2ZX1A 1J83A 2BJSA 3OY8A 1KRIA 4BQ5A 1U5ZA 2GC3A 2GNMA 3WF2A 5LA1A 1YCIA 3ACHA 2IUWA 1NY72 1YNAA 4BISA 5JPMB 2D6KA 3PU8A 3VL8A 4H55A 3EMRA 2WZR3 3J9SA 1N1YA 1OMIA 1IS4A 1UMZA 2WS93 2GC2A 1AL22 1DYOA 1T6GC 2PA7A 2VMHA 2D6MA 5FPLA 5C9AC 3S57A 2HWE3 4Q4Y1 1QOOA 3VBHC 5KC6A 1T6BX 2XLGA 4JHZA 1SFYA 4XIKA 4BLIA 2ZMNA 1KS5A 1H1IA 1HX6A 3AZXA 2VXJA 1UL9A 1PK6A 2VXRA 2W0XA 4XUPA 2R49A 3JD71 4LKFA 4I2OA 2J1AA 1GQPA 2BVBA 2D5HA 1UXZA 3NJXA 4JZRA 2QQLA 5CB7A 2YUEA 1JUHA 2ZGNA 4XVHA 4OQ9A 3N35A 2Y26A 1W03A 2D43A 3VD7A 4IE6A 1UPSA 1AYM2 1DZQA 2WSUA 2BP6A 2DFCA 2O0OA 2D93A 2QQUA 2VQUA 2BBVA 3BPZA 1S4CA 2XWBB 2VTFA 4G3YC 4MHRA 2Q30A 2VCBA 1GP4A 1ULCA 3MW3A 1JYVA 1JUIA 1WGPA 2DBIA 1UZ0A 1E5RA 1XJAA 3UKTA 5KXEA 3ZYBA 4MGYE 4UW5A 3WF4A 3VBFA 4MVTA 5CFDB 5FCCA 5FK8A 3K3NA 3A0KA 1OVPA 4YZ1A 1Q43A 2ZGSA 5EYXA 3ZDSA 5CG9A 3O1SA 2UYAA 5EIYB 3J4UH 1O8SA 4AFMA 5ABJA 4P5HA 4LBQA 1Y7BA 4OMDA 2TBVA 1XU2A 1PGSA 3KCCA 1MEC3 1JBCA 1LKNA 4I0AA 4OYUA 3LEKA 3POEA 3H9AA 1LOBA 3O1PA 4CUBA 3OD0A 4LHSA 4XF3A 3WINE 4GB33 3POGA 2O1QA 3QD6A 3AVRA 4YRDA 3WQ0A 2WQZC 2P3YA 4EZ4A 3JUUA 5FO9B 5FZAA 2XR4A 4R9AA 4LO4B 4LNVA 2WA4A 3KZ4C 3RFRA 4E2SA 1OF4A 4OLLA 4XCAA 5LEJA 3VDDA 2WO3A 3AP7A 3WP4A 4E2QA 2R071 4BWOA 3DXUA 2MNGA 1LHWA 5JPNB 1SDWA 1XPWA 3GZTB 2JIJA 5BNOC 4K21A 1CX1A 1VMFA 2VU9A 5GLUA 2XJRA 4J25A 4Q4V2 1EY2A 5A3UA 5JDBA 1MS5A 2SBAA 2YFZA 3HNMA 4WVZA 4YM3A 1AR82 2BWAA 1RUD2 1UMHA 3OCPA 3BU0A 4NPMA 3Q8EA 1ZREA 2HJIA 3N9MA 3U4XA 1W05A 5FP7A 5ACA2 2D7FA 5IVBA 1R1ZA 2ZGPA 1ND2C 1U5XA 4XFFA 2D6NA 3ZKYA 1GOFA 5L73A 5CG8A 2HWC2 5T5JA 3H8OA 1GZWA 1W6PA 1R092 1U5YA 3TN91 3NAPB 1D0HA 3NO8A 4RFT0 3ATGA 4L8QA 2D6OX 3AX4A 1PGW1 2XXZA 3KQRA 1UMIA 2VNRA 3DYPA 5LY1A 4B4PA 1VR3A 1R083 1UIKA 3ZFEC 3BGAA 3NWKA 4NHMA 4XCBA 3K46A 5HCHA 4AE2A 1W6PB 1E5SA 3HPNA 4RGGA 1ZRIA 2SLIA 2IVIB 4CP2A 4XUOA 3J8F2 2LW8A 1NG0A 1H8TC 4P08A 4ZXKA 2OS2A 4LT5A 1NA1A 3DV8A 4NPLA 2E7QA 2RM21 2AYHA 1DQ6A 1QEXA 2XUEA 4KWKA 4AGVA 1UKRA 2VCAA 3N36A 4CA9A 2VO5A 1DGRN 4LQRA 4AHYA 3CJXA 3EQEA 4J1XA 2ZMLA 3GHNA 3KGZA 3AYAA 4L2NA 3D5OA 5J1XA 1SLLA 2GP3A 1V6LA 5JZGC 3PL0A 2O8QA 4UW3A 3TEWA 1X33A 5FZ3A 4DS0A 1H9PA 1AZDA 4XDPA 1MVEA 4DMIA 2RJ2A 3JXSA 1H1AA 1FOD3 5FQ0A 2OVUA 1LULA 1LECA 2HWB1 2GU9A 4XURA 1PO22 1RUNA 1MS0A 1RUF1 4QDSA 4QM9A 2PQSA 2ZZQA 3O0XA 1EUUA 2QQJA 2XJQA 5GLWA 4MXWA 4ZHNA 2BFUL 3B9CA 3I2OA 2YGMA 1ASJ3 1KJRA 4FPFA 1AR62 2FBEA 2BBAA 1RUI3 3P6BA 2JDKA 1W04A 2OUJA 1REFA 4FPLA 4RHV3 5I91A 4A45A 3JBG2 3AFGA 2ET1A 2HEWF 2R041 1IQAA 1RXGA 1QQP2 3OUJA 5A3PA 3X29B 1KGYA 2Y6KA 4QWNA 4N43B 1XYNA 1ODMA 4QD2A 2ORZA 2BGPA 5IATA 1AUYA 4QKBA 3RZJA 5FBJA 3TWIA 5FUNA 1PO13 1HIXA 4FOVA 4Y4RA 3ZXGA 3VB9A 1CAUB 3VD4A 4M4PA 5AFEA 1LCLA 4HKLA 1OA2A 5GALA 3GJBA 1VB2A 4IUGA 2DVAA 4FO9A 2BOJA 4QDRA 4CEYC 2JDNA 4CCEA 4CCCA 2PMWB 3M7AA 1OH3A 4WM7B 4WZFA 1F8VA 1W6MB 4AR2A 1N1TA 3V0AA 2VC9A 3ORJA 4LOSA 3HJRA 5K9YA 2HEVF 1CAWA 4GKYA 4A7ZA 3KVBA 1A8DA 1OQEA 2E53A 4TTGA 1BBT2 1QMJA 2VMIA 4RR3B 4IEPA 1O4YA 1V9U2 2GMEA 4ZXEA 2RMU1 1HJFA 2JDPA 2RR11 3M3EA 4QMAA 4NIHA 2WUHA 3UGGA 3UGFA 4QX1A 1PX3A 1H2KA 4E4SA 5FPZA 1RITA 2XWJB 4Z82A 1XU1A 5LA0A 5D8AA 3B93A 2WSVA 3ETQA 3KM5A 2EXIA 3CF6E 3PIJA 4ZS3A 1YQ2A 1TEIA 1DGWA 5F3CA 1PMJX 2PLV1 4JDMA 4ZU7A 4S2DA 5C33A 1YIFA 1Z78A 2VZVA 4MX3A 4N8MA 3I2HA 2VZPA 2ZKNA 3H8UA 4RQPB 1HRV1 4Q29A 4Y1ZA 3WQ1A 2YBKA 1DQ1A 3WNMA 2WA3A 1YRZA 4BB3A 3USSA 3HQXA 3EJKA 3CMGA 1FMD3 2YU1A 4XFHA 2WNVC 5D8AB 4JQTA 2OA2A 1UY0A 2R0FA 3H1YA 4XUTA 4YVWB 3SMHA 4IEYA 4CPBA 3HN1A 1FPN1 3SQOA 1GBGA 4FPOB 5FMBA 4D7SA 4LUMA 3UT0A 1CGPA 2XBO1 3NJVA 3NSTA 4ATEA 1RUC1 1S0EA 4FP3A 4CDQC 2JB4A 4F3JA 1W6OB 2XJUA 2VNGA 4XUNA 1UNBA 2XLFA 4B29A 4CU9A 1MQTA 3MYXA 4KU7A 3B9IA 5CNAA 4C0BA 1ZYBA 5BNQA 1O3TA 2QQPA 1COV2 1EV13 3FMGA 2H0BA 4MGQA 3ZFFA 1F9KA 5JOWA 1AR72 2EIBA 3SISA 3TEXA 4IETA 3WX5A 3CJIC 1SLBA 4YNIA 2MEV2 3GBFA 3MW2A 5IVFA 1MQTB 4K8FA 1K42A 5DAXA 5FMCA 1OLRA 1MZFA 3I2JA 3ZFFB 2HEYF 3W20A 3EYPA 4BHPA 1HDKA 1ND3A 5CISA 3RZMA 2R1DA 2RDSA 1IS5A 4LBJA 1ND2A 2GC0A 3FL7A 4XILA 4FOYA 5DDJ2 2C0ZA 3VDAA 3E5XA 2QZ3A 4P9GA 1N3PA 4XJ8A 1RINA 3HIFA 5K0UC 1OPMA 2VUDA 5JR2A 2PTMA 5F5IA 4A41A 1S0IA 1RXFA 3JB4C 1JYXA 4COVA 1C8M1 2FDGA 1EUTA 4OZXA 4RYDA 1PM4A 5DG2A 2RS11 1RUD3 3ZFEA 3CU7A 2DUQA 3B94A 3WP6A 3LEIA 3ETPA 3I54A 4S2GA 1UY1A 5JLVA 4N9IA 3T0AA 4X6RB 4NE9A 5ACA3 1QJU2 2ZPXA 4IERA 1H8TA 1ST8A 3GBGA 1JZ3A 2VMFA 1QOSA 4FFIA 1ZBE2 4IE7A 1HV0A 2RS52 2PAMA 1OVSA 1RUG1 3R0RA 3VBRC 1CIYA 4CP1A 3C7OA 1LODA 3RG0A 2WNEA 3A22A 5JXGA 1TG7A 2ARAA 4D6QA 5BNNB 1MR5A 3NV1A 4LUKA 2QKDA 3FZ3A 4K1ZA 3IPVB 2GMMA 1DYPA 1HQLA 1QNWA 3M4FA 4F7ZA 1LEDA 2NZ9A 3WG4A 2X53S 5JZGA 1JU4A 3O0WA 3QH6A 1WZXA 5F39A 1VBC3 1DLCA 2BU9A 2VQAA 2XONA 3E6BA 3OYWA 1N47A 1QJX1 2DVFA 1OT5A 4WM8C 1WCSA 1RVF2 1YFXA 4IV3C 3ZN6A 1QJFA 1YI9A 4UW6A 4Q2FA 1RUH1 1UY2A 3GHMA 5ANQA 3MFCA 4CTEA 5JOZA 1C57A 5IHRA 4META 5FIXA 4K1YA 2A1XA 4Y1YA 4B7EA 1RB8G 1NYWA 4C0HA 3INAA 1SMVA 5FYSA 2BQPA 1G9DA 4Y1XA 4FFHA 1X36A 3O1RA 2CSGA 3W5NA 4YW1A 3P3PA 2BZDA 3FHIB 4LBKA 5T55A 2BPA2 1F35A 2DVBA 3L2YA 5FPVA 5GZCA 5FY0A 3LA2A 2WNUC 1MACA 1O4ZA 4K40A 4Q27A 3BTAA 2V09A 1A34A 1SBEA 4RFRB 1CONA 1SHWB 5FMOL 5FLHA 3UNPA 3A7QA 5KC5A 4JKLA 3OEAA 1SLAA 4DEVA 2H6BA 5JSRA 3HOBA 2R062 3UJOA 5FY7A 2QE3A 5F3IA 4BXSV 4Y1UA 2C1FA 3WQ7A 3GYDA 3K4AA 3ZIWA 1CJDA 3O1VA 1EPZA 1W6QB 4JC1A 4PDWA 3WCRA 3ZPOA 4YVSC 5EV7A 4D6RA 1XNCA 4CDXC 3HAGA 4OCTA 2W1QA 5F5QA 3ZKUA 2BOIA 4CEYA 5A3OA 5DUXA 3SXWA 1V6MA 4OUMA 5AC92 1O3SA 1W8WA 3LWCA 4B7KA 4PI2A 2P3KA 3WW4A 4Z2AA 4AEDB 3I8TA 1VBB2 3RZLA 4I0WB 4PDWB 1Z7S2 1ZX5A 4GMP0 2WC2A 4AHZA 3ZYIB 2WJSA 2WFF1 3ZXFA 1K3IA 5FZFA 2IFRA 1PZ8A 4Q4Y3 1K5MB 2ZGRA 1W2UA 2XB6C 3OGVA 4YZ3A 1LB2A 5DUWA 1VRBA 5L7OB 4GZ9A 5J48A 1UYZA 1UCXA 2XUMA 4YGBA 1JZ7A 2LM3A 3J7HA 3LOIA 1LHUA 4MSVA 2KR2A 5IVJA 4EN9B 2HWE2 3PUQA 5HV4A 1NLSA 2JIGA 2FDFA 2RS32 3VHRA 3O1TA 3ES4A 3AP5A 4DIQA 2DCTA 4F83A 4W8JA 3ZYGA 1W0PA 3WSOA 3OG2A 2QDNA 3TBDA 2OIIA 1J59A 5T5LA 4HANA 2ZJCA 1BBT3 3N9OA 1RMU1 1S2EA 1HN0A 2IXCA 5I8YA 4A44A 4AHXA 3B01A 2VW2A 1LU1A 3A23A 5JVVA 3BOWA 3KGLA 4W6YA 4XYXA 1OUXA 1QU0A 1DLLA 4CDQA 5KHJA 2WT2A 3GALA 4AAXA 1WCKA 1F2NA 3KCYA 3ZFGB 2O14A 4KU8A 5FP9A 2VZSA 4E8DA 3IZOA 3GGLA 3TRSB 3MIGA 1UQXA 1MS4A 2K2SA 2VNOA 4HN1A 5A1AA 3IDAA 4HETA 5G04L 5CFCC 4AEKA 3U07A 2J7MA 2WBKA 3CJIA 4TXWA 4GULA 3KHBA 1GWMA 3FLRA 1MS9A 1OKQA 1OOPB 4MADA 3N9LA 1CWPA 1YHFA 1BK0A 1MEC2 1NT0A 3BKZA 4I09A 1TME1 1GOHA 5B2GB 2ZGLA 1W6NA 4ZONA 5EJZB 4UXAA 4Y22A 4GB32 2D97A 3ZXEA 3USUB 4FOWA 4GXLA 2UWAA 1BJQA 2R073 5LWBA 3S7EA 4QB1A 2JECA 5K0UA 3OUIA 1COV3 1CPMA 4BE3A 5IFTA 3IDBB 1WCQA 4NUBA 1VAVA 4LA2A 4XJWA 1H30A 1FV2A 5FY9A 2IFWA 1AR73 4IE0A 1HJGA 1UZZA 5FXXA 1HKDA 1W2OA 3RMYA 2PFWA 1KJLA 2DVGA 4FI9A 4P9XA 2RV9A 2W52A 4K20A 4QXHA 2A3WA 2YB7A 2GMPA 3TAYA 1LHOA 4XFCA 5CFDC 4PLOA 2YXSA 5IVCA 5HBAA 3RZGA 4CDUB 2W87A 4PLMA 3T4HB 3RGBA 5C3QA 3MPBA 5FZ1A 3WZ1A 4GWNA 1HLCA 2ERFA 2BUKA 1X7NA 2JG8B 2VTXA 4FPGA 4BQ3A 2HWD1 3VBRA 3O1UA 1A3KA 1IPSA 2UWCA 2V72A 2P4EA 4YFWA 2ZABA 4YARA 2ZA9A 2JENA 3BUCA 5FZ0A 3RQ0A 4QGMA 3LF7A 4IE5A 3JQWA 4UFIA 2BFUS 5FY4A 2CV6A 4HLTA 4Q4W1 1AXZA 5IVEA 1WCUA 5CKNA 4DPNA 1PIV1 4N53C 4IEWA 2RJKA 3NNFA 3UESA 3A4UA 3CO2A 3IAPA 4WZCA 1FX5A 2WYFA 4WM8A 3ZDVA 4EJRA 3RYPA 2QZ2A 3U37A 3ACIA 4IV3A 3WNPA 4A2UA 1QJU3 1B09A 1H9WA 1P8JA 5FMDA 4NROA 1ZBE3 1JTZX 3RRDA 3N9PA 4UAPA 3WXPA 2W95A 2QBXA 3WT3A 1POV1 5LBCA 4DFSA 1PMHX 1R082 3Q8AA 4IGQA 5FYYA 1BEV1 2VMDA 4KWJA 2P5BA 4Q8LA 5FRAA 3DKQA 2WO2A 3IN9A 3FBYA 1DF0A 2D3SA 2VH9A 2Z4FA 2DDUA 3MFAA 4O61A 3SHRA 2WNUA 1QIQA 4GH4A 4QKNA 4OHXA 3VBUC 1RVF3 5CYYA 2VMEA 4AG4A 1RUJ1 1SPPA 1YJKA 3V65A 4C1XA 2WKKA 2HWB3 1V6JA 2ZHNA 5BV6A 1VIWB 4QB6A 1LJ7A 1RUF3 3AP9A 1S0DA 3KV6A 4KG8A 3HVDA 4GMP1 5DN2A 1XNDA 4QQ2A 4EV0A 1W90A 4XDOA 1VMJA 2Y38A 2PHWA 3AMHA 4H3WA 4IGOA 1G7YA 4YVSA 5FZKA 3JQXA 3ECQA 3AB0A 5H9QA 2R32A 4QPWA 4LK7A 4BIOA 4RS5B 4V2VA 3EHKA 1FOD2 1FAYA 3IMNA 5FZDA 3K2OA 5IJRA 1WUVA 2ZHKA 2ZX0A 4A6OA 3T4VA 2C5DA 2OT7A 2PHFA 4NRPA 5T50A 3AYCA 3O14A 5FPBA 3UGHA 1YXWA 2WR9A 4Q4X1 1YQCA 4YZ4A 1ASJ2 3ILRA 4K6BA 3GXUA 2J1VA 1RUI2 1WKYA 1WW7A 5C3PA 3H8RA 2EICA 1TMF1 1YFWA 2EA7A 1H2LA 1LR5A 2RE9A 1EAH2 3OPWA 4CDWB 1ENRA 1F5FA 1BLZA 3CNAA 1QXJA 1RUE1 1W28A 1QDCA 5DABA 3WV6A 4XACA 3LKJA 2VVDA 2JICA 5GKAC 5KHIA 2ZAHA 3RZKA 2Z5WA 2XJVA 4AI9A 5FKBA 1VBB3 2W92A 3HBKA 4I3PA 2VTXJ 3PTRB 4QQPA 1D4VB 1DQ0A 2EAKA 5KBFA 1OD3A 3I3MA 4D0QA 1W8ZA 4P9WA 1AR92 4UFHA 4EN0A 4LIUA 2ZX4A 5J98B 4EN6B 2DYCA 2JX9A 3ABZA 1GZTA 3ACFA 5FZEA 1AHSA 2RMU3 3OB8A 2RR13 4ARYA 3MGUA 4YWAA 4YGDA 3GZAA 1GLHA 1US3A 2ZGMA 5A7WA 2DU0A 1XYPA 2H0VA 3OY8B 4G9SB 3BIEA 1QH7A 5LA2A 3DPRC 1QOTA 1H0BA 4BCUA 1QDOA 4XDQA 1J1TA 2RS33 1U5IA 3B02A 4QKDA 1J1LA 3H7JA 2G19A 3OBRA 3RZHA 1LOFC 1O3QA 1L7QA 4HK9A 3W9AA 4HVQA 5CFCA 1HRV3 2QQNA 3RS6A 5LBFA 1BMV1 2AGSA 3IKWA 5A33A 2YYOA 2UY8A 3AXEA 4M3CA 1HRI1 5CIRA 1UX7A 4NIIA 5IYYA 1Q8QA 1WCDJ 4XF9A 3HMYA 4ZU4A 1R64A 1YIPA 4LKSA 1PM7A 5FO7B 3PNAA 1VRH1 3HR9A 1PK6B 2E7AA 4TSVA 3WP3A 3BB6A 1ZRDA 1IPKA 2ZEZA 4YM0A 5DAPA 1RUC3 5FJHA 3MUY1 3SKVA 4M3CB 1R1A1 4TWTA 4URTA 1WA6X 1SZBA 1FMD2 1UN1A 1W8UA 4PI0A 4FAHA 2PHLA 1PGL2 2ZAAA 3C8XA 1NXD1 2DTYA 3F95A 4MGSA 4BA6A 2D44A 1XBFA 2BRTA 2PAEA 3S7IA 3BTZA 3TEYA 5SV5A 2X29A 5C4WC 1JOJA 1YQ6A 4CCOA 5ISLA 3WDUA 1QF3A 4LLFA 2BV4A 4XAEA 1SQ4A 3ST7A 1TQ5A 2VQTA 2Y60A 3WW1A 2E33A 3VBFB 4YW3A 1W8FA 5FAXA 4XPVA 5FZOA 3VD3A 3SCHA 1NUKA 5IVYA 1S0FA 4JQRA 5AVPA 1WBFA 3E97A 3MF9A 1N1SA 1EV12 4QPGC 1UOGA 4XZPA 1ZRFA 1G9CA 5LEKA 4FSJA 4D3WA 1HXS1 1GNZA 2EXJA 5ABJB 4HFSA 1GWKA 1JZ2A 4LBQB 5JI7A 1H8VA 1WA4A 3UYJA 1UY3A 1RUOA 2VZOA 5F6KA 4N9HA 3M70A 4OQ8A 3HBZA 2B9UA 2C6SA 1C8M3 1SBFA 1FATA 1C1LA 1I3HA 2P6HA 3GNEA 3M2MA 4LO6B 4N53A 3WHTA 3ZLIA 4DRVA 5J96B 1WMFA 5J3UA 2XGXA 4HVOA 4QDQA 2GH2A 3LE0A 4AQ2A 1C5HA 4NIAA 3DUIA 4Y5Z0 5FMOS 3PVOA 3WF0A 3VDBA 1D4M2 4MHUA 3PVNA 1L3JA 1XE0A 2BNOA 1GICA 1ZM1A 2VZ1A 3AM2A 4HSLA 3NKTA 1CAXA 1XOYA 4QXBA 2YC4A 4NHXA 1STMA 2G4IA 2P17A 1CZVA 1YQ5A 4LO7A 4FOQA 3DEMA 2QQKA 2YG0A 4JHTA 1RUG3 4JGYC 4I3GA 3VDDB 4ZZ5A 4CXYA 2D3RA 4JV4A 4FTSA 3SH4A 4OZOA 1B35C 4GA9A 5A3MA 1BYHA 3LPGA 2PELA 2WWJA 1UU5A 1RTVA 4IL7A 1JH5A 4IV1A 4PIZA 2Q5TA 4XABA 4XQ4A 3H3ZA 3DYMA 1NCRA 3R6SA 4CCMA 2VNVA 4QM8A 2XL7A 3VBUA 2WLQA 4R52A 4W6XA 2VG9A 2K9ZA 5DPNA 3BI3A 2G9ZA 2CWSA 4FPJA 2ZS6B 3GCWA 4IV1B 1RUH3 4NRQA 4R9CA 4CCNA 3BIWE 3S5AA 2XQXA 2AZ5A 2JDAA 1NCRB 2OX0A 1LOCA 2RDNA 3IIIA 4MLOA 1I1EA 1VB4A 1VBC2 2AR6A 3AKSA 4XC9A 5F3EA 2A73B 1GZWB 4QPYA 3WQBA 4MGZE 2OYZA 1K5JA 2QDRA 2UYBA 2NPIA 2P1BA 4AQTA 3VL9A 1AX2A 3T09A 3VUOA 1LEMA 1QXRA 4DEQA 1CN1A 1FNYA 3RVHA 1W2AX 5DZFA 3THDA 2ZEYA 4X8NA 4EQVA 4LHLA 1PVXA 2W9XA 5FV3A 5A80A 3HEIA 4LBNA 2XJPA 4B4QA 2GZWA 4Y33A 3BU7A 1NA1B 3ZMOA 2X05A 3ACGA 4CEWC 2Z2SB 3PU3A 3PLQA 1W3VA 1GFF2 1UZVA 1WLDA 2CL2A 4L92A 3WCSA 1JYTA 3K75B 1VBD2 3DN7A 4Y20A 5HPOA 1CAVA 2ETEA 5FXZA 4BIFA 3I3EA 4YW6A 2QTWB 4LBQD 4XMIA 1LTEA 2NP0A 1X50A 2YY1A 5EZWA 5A70A 1W8TA 2Y34A 1LHVA 1X82A 2CWMA 4H7MA 4LA3A 3ES1A 4EN8B 4LXLA 4QHZA 4BK4A 4XHBA 5BUVA 3CEWA 4NJ4A 1VBE1 5FQ0B 2WFF3 5H9RA 3OD4A 3FLTA 3TEZA 3T3YA 4AI1A 5B4NA 1WW5A 1LU2A 1EAH3 3VLBB 1J84A 4MXWB 3Q8FA 2BDRA 2IXHA 4GALA 3U4SA 3K51A 1DFQA 3ZSMA 4LBLA 5I0TA 1FV3A 3ZSEA 1X9TA 3DPRA 3D82A 5C9AA 3VBHA 1QNYA 2JG9C 2XG3A 3B3QE 3H3UA 5EQUA 3S0MA 4Q4Y2 4M4RA 4FCAA 4PLNA 4AFDA 4K8RB 4M3CF 2XDVA 1VJ2A 1AXYA 1AR93 3JD72 3POYA 5LK5A 2DURA 3WW2A 5C9AB 2WQ4A 3D6EA 4UWDA 3VBHB 4AGGA 5CEHA 3I7DA 4P9YA 1JYWA 3CLPA 3ZMNA 1OA4A 1Y9MA 2P3IA 3M3IA 4BU2A 2YBPA 4X8PA 4QU2A 3KT1A 3FBMA 3VKMA 1POQA 4H14A 2ZGTA 2RDRA 2W1UA 1TZOA 3DCQA 1NLQA 3PVBB 4E4DX 1OI6A 3HT2A 3OPZA 5A32A 4JGZC 4YYOA 4BQWA 3O1OA 1DYKA 3WLUA 4A42A 5A7QA 4D8MA 1GANA 3OBTA 4XJ9A 2HBTA 4P14A 2DUPA 4BH9A 4DXTA 1VBA1 5C4WA 1XNBA 2HH9A 2J42A 4CE8A 3WNOA 3V0AB 4GKXA 2A5ZA 4WVMA 2A6ZA 4QHOA 1QH6A 1LRHA 1CAWB 4XBNA 2ILMA 2FDHA 2MHFA 2ZHMA 4AHWA 4EE2A 4FFGA 4GJZA 4JDNA 3RYKA 5L7OC 2ID4A 4K9SA 2ATFA 4A7KA 1W9YA 5FYUA 2CYFA 2IVJA 1VP6A 5FP4A 4AFCA 2VM9A 4CU6A 5C5UA 4DNYA 2Z42A 2ZGOA 3SH3A 4QU1A 2OXBA 3H0OA 3RNSA 4QPGA 2NMOA 1V00A 4NAOA 2WZR1 2ZEXA 4PBOA 4QQOA 5D1IA 1UAIA 4XBQA 3ITQA 2GDFA 2E51A 2WS91 4COWA 1ENXA 4LE3A 3WDWA 2OKXA 1AJOA 2WL1A 1W9WA 2DBNA 2ZBJA 4GWIA 2PAKA 5I93A 3AKTA 5T3NA 3IMMA 1GWLA 4COUA 4R9DA 1DP0A 5APAA 3MIEA 4N7UA 3FWEA 4XFBA 2DV9A 3K3OA 5FZBA 4OI1A 5BNOA 2R072 2Y64A 4HVRA 4IEOA 5LATA 3Q9OA 1KFXL 4N90A 2CY6A 3F2ZA 3IDEA 1URXA 2KM2A 3PIGA 4TYSA 3DXTA 3UJQA 4Q8KA 4I0BA 2EVXA 3URFA 4YPJA 1CIWA 4JGYA 4Y24A 4E4ZA 2HWD3 3I3DA 4L0PA 4E2GA 1EPWA 4AVBA 1B35A 3T2OA 1JW6A 3ZXKA 3MV01 5BNOB 2CHHA 5J37A 3NV2A 5ANNA 1UYYA 4LJHA 5HI0A 4Q4W3 2QQMA 2RHPA 1UY4A 4WBBA 4MV2A 1PHMA 1PIV3 2H6CA 3EXUA 3RI8A 5C8CC 3NMBA 5L9VA 4EZHA 1IPJA 1M06G 4QAWA 4XFIA 1AYN1 1OPOA 4FXGB 4PHZA 1D4M3 2VBDA 3MHZA 2EIGA 4WVWA 3IT8A 2LTNA 1QJEA 1UIJA 1RYYA 2ZOEB 5FZCA 3TN92 5FOJB 1UPIA 2Q1ZB 4FVVA 5C5TA 4YFZA 2HYKA 1ND3B 1PGW2 5BPXA 1JN2P 1ND2B 2G9GA 3KF5A 2UY9A 1ZVFA 1POV3 4LK6A 3WG2A 5JWPA 1W3XA 2VQ0A 2FDIA 3H3LA 4ORFA 1GKBA 4B3NA 4YM1A 1DU3D 2EF6A 1N3OA 1WW6A 1ZZ9A 3S6PA 3VBSC 4ASMB 1NXMA 4KBBA 4C90A 4DOUA 4H7LA 1I5ZA 4P00B 3NNJA 3KV4A 2W1SA 3HD8B 3DF0A 2A7AA 3ZFEB 4Y26A 2VW0A 4XMAA 2PYTA 4GAZA 4CUAA 4N7IA 2E26A 4C1WA 3FLPA 3H7YA 4QGLA 1ZZ8A 1PVC1 5I8SA 2CGPA 2ZXQA 2IWGB 1J3PA 4XE9A 3AKPA 5GZFA 2Q8DA 1H8TB 5H9SA 3U14A 2JKXA 2JKBA 1SFPA 5I0UA 3VN4A 3AKRA 4CEWA 4Z1VA 4M00A 4GMP3 4MUVA 4CP9A 5FYMA 3N9QA 2CNAA 5IK7A 5JAXA 4COYA 1WLTA 5A7PA 2VUJA 1ZBA1 2GAUA 3Q8CA 1HQNA 2GNDA 2CDPA 2ENRA 3KMHA 3VKLA 3WDYA 2HWB2 3VZOA 3ZXAC 5JZGB 2Q0AA 1IS3A 4OFGA 1RUF2 3OYWB 3G7DA 3ZSLA 1OURA 3UKNA 1EYBA 1TNRA 1MS3A 3I97A 4U36A 3ZN6B 4CYDA 3AMQA 3WNLA 2W94A 1KITA 2QNKA 4OUSA 4Q4X3 5F5CA 1AL0G 2PHXA 4QPIC 4AEJA 5DUUA 1V6NA 4CPBD 4KQ7A 1W06A 3FHQA 3SEEA 4URAA 2ZKLA 4BZ4A 3M3QA 1I9RA 3NNGA 3V64A 1POV0 1VBD3 5GJ6A 2R042 4NHYA 3DECA 5JOXA 1RUE3 5JXIA 2B8MA 1D2SA 1R081 5EXOA 3ZYHA 1JZ6A 3U11A 2JG9A 2W47A 2Y6GA 1U12A 2X5IC 4KBZA 4DZGA 5JXJA 2VR4A 2VZ3A 3NW4A 4M0HA 2VOTA 4AGRA 2GNBA 2WINB 3ZIXA 5FYVA 2VUCA 1RC6A 1C4RA 2W68A 3CDZB 1SACA 1JS9A 5CKMA 2DVDA 3BVCA 4BMBA 1OLME 2A6VA 3VZMA 3BODA 3OPTA 1MVQA 3P3NA 4K3UA 4D7YA 2XKPA 2GH8A 3WDXA 2OQ7A 3I3BA 5I0SA 1TNFA 4A4AA 3UV9A 4FBFA 3N9NA 2J22A 4MO3M 4XAAA 4U2AA 4UBHA 5A7NA 3KD4A 2YPJA 1QJY1 2GP5A 3NNMA 5GZEA 3GCXA 3FUQA 4UFLA 4CEYB 3POIA 4JGZA 3ZR5A 5A6XA 4GJYA 5FYIA 3IM0A 4CSWA 1JHNA 1DQ4A 2G9FA 2WLPA 1FT9A 3QBQA 5LRRA 1U0AA 3WNNA 2QQIA 1JYIA 2RMU2 2FCUA 1GOGA 2O8OA 1C1FA 1UZWA 2RR12 2VY0A 3JD73 1VMHA 4ISQA 4CXXA 3POSA 5I8TA 4R4ZA 4BK5A 1QKQA 1XRUA 1H1MA 2YMZA 1W99A 2PXJA 3WDVA 1HRI3 4HPKA 3WR0A 4Z8BA 3G6JB 4LHKA 5LZ6A 1YO8A 2B7YA 1DZTA 2E9QA 4KNCA 4MGIE 3VBOC 1W9FA 2R0HA 2PLV2 5A1FA 1VRH3 2BGCA 2HWF1 1NZCA 3AJZA 1O5LA 2B46X 4WV8A 4XBLA 1NCQC 4RHV1 4XETA 2LRPA 3WF3A 1HRV2 1D2QA 3CQOA 2WNVA 1RHI1 5IK5A 5J36A 2KD7A 2Q8OA 4AFBA 1R1A3 1XQNA 4AQ6A 1GQHA 3AYEA 4HBNA 2C9AA 1E5IA 2Y0IA 5A1LA 3JZVA 4CCLA 5DMYA 4QQLA 4Y5SA 4AZZA 4QXKA 1UF2C 3RI9A 2CAUA 2LS6A 2WNOA 1MPXA 2Y33A 1RJ7A 2YBSA 5HXVA 3THTA 3U0ZA 1S0CA 5IUQA 2XBO2 3AL5A 3N3HA 1PO11 1RUC2 4NO4A 5FZ6A 5A6YA 4JAAA 2EIDA 5JUVA 3VZKA 1NY71 1IGOA 1JHJA 5EPAA 4AYUA 2ORXA 2RDQA 2WZ8A 4CDQB 3CZUA 4OHZA 3VHOA 2G1MA 1DGWX 3WG3A 3AKQA 2XVLA 3DKWA 1AL21 4QB2A 4CUGA 1FI2A 3KCXA 3KT7A 3ENRA 4QT6A 3ZYFA 1M4WA 4M0NA 1GMMA 3NL1A 5EWSA 5KHKA 3E6DA 4PT6A 3KVAA 5C7GA 3WNXA 4HN0A 4OULA 2VZQA 4MOAA 5DG1A 4PIYA 4JKMA 1Z0HA 5LCWL 2P37A 2BTVC 2EXKA 3CJIB 4XFAA 5TSWA 1G8WA 1H4GA 3I2KA 3M8LA 2A6XA 4JKKA 5T5PA 3ZOIA 3FHAA 3WDTA 1GV9A 3AMNA 1HN1A 1J3QA 1ZZ6A 3GDBA 4W50A 4XXAA 2XVKA 2PHDA 4ASKA 4ARXA 1AYM1 3A0NA 1C8M2 1W6NB 2LUWA 1UYXA 1APNA 2R30A 2XH6A 3LCPA 4QX7A 4Y22B 3VKOA 1CZSA 4RL7A 2RS12 4V1PA 1LOAA 2DUOA 2J1SA 1CESA 1CD3G 5K0UB 3AC0A 1Y9GA 1C8NA 4EWDA 5BXXA 4CRQA 3VBSA 4ITCA 3MICA 1LGBA 5EHDA 2VZUA 1XC6A 2ZCWA 4LE4A 1JZ8A 1GZCA 4O9GA 2DCKA 4LO5B 5D21A 3CBNA 3O1MA 1W2NA 1RUG2 3T2QA 2AH2A 2C9KA 5HCFA 4XFGA 3TN93 4ZS2A 5JSOA 1OD5A 2W08A 3MIBA 4AI2A 4GQ7A 4JTNA 2DTWA 4L11A 2WQ8A 1JODA 3W59A 5KXDA 2P2KA 3RWNA 3VBRB 1XE7A 3AYDA 1DGRA 1LGNA 3WVJA 5A3TA 3RZZA 3WY6A 1QJX2 3HT1A 4L97A 4ASLA 2VECA 1OFSA 1VAKA 5CADA 1IQDC 1DGLA 3PUHA 1RUH2 2VUAA 4I01A 5A3NA 5EJ1B 4OI2A 4JCKA 4QKFA 2RM23 1C28A 4IEVA 2VMCA 3MIHA 4NHKA 4WM8B 2Z69A 4NMIA 2TEPA 4IV3B 1G9AA 2F4PA 3SH5A 4AI0A 5FZIA 5C6CA 5D2AA 2OW4A 5FJKA 3AP6A 3SC7X 4QPIA 3TNQA 1OLMA 2MPFA 5JXHA 1W2TA 5FR3A 4IXLA 3J26N 1PMIA 2VOKA 3POFA 4KGQA 4Q4V1 3VZJA 2B4KA 3P5BA 4Y1VA 4FPYA 3AZZA 1L7LA 4UF0A 1AX0A 4PQ9A 1AR81 3BYWA 5E88A 2XMLA 1RUD1 1KFUL 2NQYA 2ZGUA 5EP9A 3VD9A 1Q3EA 2X5IA 1RJ8A 1WLCA 2WNUB 4GH4B 2DFBA 3DGTA 3T30A 1S2KA 3NAPC 5IVVA 4LHNA 3RJ2X 5ACA1 4IEZA 4LEJA 4Q1PA 1WMEA 5CZKA 1O91A 2D98A 2XJTA 1SPPB 3MLLA 3B00A 4CDXA 2Y6FA 1UOJA 3HNBM 4HMZA 2HWC1 5CU1A 4NPRA 4IDZA 1R091 1CZTA 1IKPA 4Z07A 2OUHA 2QQOA 4MH0E 3I49A 1MZ6A 4PIXA 2A6WA 1XSQA 3C7EA 2VE1A 1VLNA 3OGJA 2R043 4NRMA 4YVSB 3U10A 4CDXB 1F31A 4DUXA 5FY5A 1LAJA 5EYYA 1VE0A 1VAMA 2F17A 1W39A 2WFF2 5JR7B 1GNHA 5LBEA 1K12A 1SCRA 1YI7A 2CU5A 2IXIA 3ZVXA 4RA0A 4B4RA 4Y4YA 3GM8A 5I0DA 1QY4A 3ZXJA 1WD3A 3T0DA 2X8KA 3MIFA 1A6CA 3J8F1 5IWFA 4QX3A 2V5DA 2QQVA 5DAWA 3CL1A 2QJVA 3EO6A 2XOMA 3S5QA 1G9FA 2QCSB 4UW4A 4BMEA 5IK4A 3HQRA 1GU3A 1GNYA 4BLJA 1XSRA 5K7PA 2PHUA 3UETA 2D6LX 4GIQA 3VBOA 4B8EA 4BM8A 1J58A 4SLIA 1RL3A 1NCQA 1W0NA 4XJUA 4EYUA 5F8PA 1OLQA 1ACCA 2W3JA 1RGSA 1UU6A 5M0TA 1S0GA 4AI3A 5L9RA 5KXCA 3ZXLA 1RMU2 4BQ4A 3E6CC 5F9TA 1PO21 3C3VA 4DRRA 4XHXA 4JTOA 2FCTA 4CP0A 3LQCA 1LENA 2WZEA 1MS8A 1H6XA 2E63A 2ZZJA 5FY8A 1V70A 2GNTA 5K4LA 3D3AA 1AR61 5CKQA 5IT6A 3KT4A 2BWCA 2PLV3 2UU8A 3OOXA 2DWRA 3PURA 3ZN5A 4KGGA 3ZSKA 1O59A 4N43C 4HSJA 4E9KA 4EWEA 4Z92B 4RN5A 3H1MA 3JBG1 5A7WB 2AEZA 2R16A 3JB8A 3KV9A 1QQP1 1YEWA 2P6CA 3T1MA 1NQDA 4FQ4A 2GN3A 2ZEWA 2PQQA 4Q26A 4QX2A 4EWAA 2JEMA 3OGGA 1FPN3 1Q8SA 2BYVE 3O7OA 4XIOA 3U1XA 3FC0A 5CFCB 2XBO3 1O6UA 5CBLA 2W1WA 4YW2A 1GP5A 4E27A 1TME2 5A33B 3POJA 4WM7C 5JI9A 1ENSA 5FZ4A 4DUVA 5CA6A 4QX0A 3V56A 2YROA 1NLRA 2ADEA 2W2IA 2K46A 5GLZA 1E5HA 1QHDA 2XQRA 1G9BA 2VL4A 4WVVA 4LITA 2YC0A 3VHPA 4EN7B 4V2WA 5C71A 5JCTA 4RR3C 2CDOA 3ILNA 3LDBA 5CFDA 2ZTNA 4P9IA 5J09A 1VALA 2EXHA 2QFEA 4NR1A 5J7MA 3FN9A 1REDA 4FPEA 1DHKB 3L2HA 2VW1A 4C8DA 5F32A 5FZMA 1BQPA 5A6QA 4ATFA 1BBT1 3PMSA 4J6GA 3MDPA 4F8AA 4HOOA 4ES9A 1V9U1 1XE8A 3FFZA 4LBOA 2IZWA 4KWUA 1S0JA 3H1WA 3O5SA 5GLTA 2TNFA 1TE1B 3OEBA 5BY5A 2WABA 2HWD2 2D40A 1WD4A 2V4AA 4RQPC 1AYN3 3RPQA 1W9TA 4Q0UA 5KR7A 1UKGA 2FD8A 3ON7A 2Y6JA 5FZOB 3NRUA 2WO7A 2BERA 2GSYA 5D8AC 5FWJA 4A6SA 4AFAA 2DF7A 4KL1A 4Q4W2 4YVWC 5BYNA 3C7FA 2RS13 1PIV2 5IW0A 3GBWA 3ELNA 5FYZA 5FZ8A 4ZPIA 4JDOA 2V73A 3HN3A 1TVGA 4XTMA 3U78A 4IW3A 5C3SA 1N1VA 3OSDA 5LY2A 1C3HA 3DYOA 1REEA 2VBBA 4YG6A 3OBAA 4N53B 3MEPA 1WMXA 4J1WA 1BHGA 3LFIA 4AL9A 1HB4A 1WMDA 2A71A 2D5FA 3JCIA 3WNKA 4FXKB 4LTAA 5F3GA 1XNAA 3O0VA 1H2MA 5LB6A 2V4VA 5FUIA 1BEV2 4QX8A 5E89A 1PVC3 3AVSA 4HT1T 4BQXA 4AVCA 2YPDA 1IG3A 1CAXB 4D7TA 1MZEA 4K7JA 4QHBA 3RSJA 3NQHA 1DIWA 1COV1 1MQTC 4XEZA 1QJX3 1C5IA 3I4IA 3THCA 5KWRA 3ZFFC 2D6PA 1AR71 3QLQA 4BYYA 3H42B 3B69A 3KF3A 3ROUA 4EROA 3GJAA 1RUJ2 5FYCA 1ZBA3 1DQ2A 1H2NA 2MEV1 3CIHA 3ZX7A 1UX6A 3ALQA 5JIUA 3EB7A 3VBUB 3NAPA 2F4LA 2AENA 4LKDA 1ZZ7A 2ARCA 1MS1A 2J1EA 5DDJ1 5T5OA 3T1LA 1ND3C 3VV1A 2VULA 3BCWA 3C7GA 1I5PA 4RSUA 2CTVA 3NJYA 5CAZA 1W9SA 1Y3TA 4GWJA 2VCCA 3ASIA 3LSEA 3VHNA 3LEGA 2JDZA 4A3ZA 1ODNA 4FP2A 3LB9A 5EFUA 1DG6A 3I2GA 1CJPA 2WT0A 1LNSA 3P1IA 3R4UA 4ISRA 1SDDB 1YLLA 4MYEA 2I2SA 4UFMA 1QGLA 3ZN4A 5LA9A 4Q4X2 4A7YA 1AJKA 4QX5A 2PHRA 3R4DB 4XTPA 1NOVA 2ZHLA 4CVUA 5IAXA 4CU8A 3MLJA 4IE4A 2WYSA 2WDBA 1QJU1 5BNNC 4M01A 4ZU5A 4Q0SA 1TMF2 1ZBE1 2B39A 2RS51 1H4HA 3MLKA 5ERLA 1RUE2 5FZ7A 4UI9L 4IEXA 3LZZA 4AOCA 4BQ1A 3E1F1 2BW8A 2AREA 1LESA 3FFQA 4QGNA 1XNTA 4YG0A 2FMDA 3OF1A 4Q0PA 1W8OA 2VBPA 1ZZCA 2WN2A 4LKEA 4XF0A 2YHJA 4Y20B 4COZA 2BNMA 1CAVB 1CVNA 5I0RA 1QJY3 1PX4A 1Y43B 1ZRRA 1RVF1 1Q56A 1CX4A 1YWKA 2Y6HA 3SITA 4FT8A 3OJBA 4Q0QA 5JOYA 4XQWA 4B1MA 5F1RA 5FZ9A 2JD9A 1DCSA 1F15A 2JD4A 5DXDA 2D3PA 2PN5A 1Q5OA 1BKZA 4TN7A 1MZ5A 5A3LA 4QQHA 4CCJA 3QACA 4OMCA 1BZWA 5C3RA 2FDKA 5FP3A 2JE9A 1LOFA 3N7MA 1Q8OA 3RYRA 1WWYA 4N43A 1JYCA 3AZWA 4UT5A 3OUHA 4W65A 2HWF3 2YV8A 2AACA 2YU2A 2WAOA 4OHWA 3W58A 2VZTA 4AI8A 2VOWA 5C8WA 1JYNA 3MPPG 3DPRB 1BMV2 1RHI3 3THPA 4ES8A 1RMU3 1CAUA 4Y5TA 1HRI2 4YGCA 1IZ3A 4HG6B 1ULGA 2VD7A 5DQ0A 3T08A 2R061 2DU1A 1NE6A 1YQ8A 2EALA 4NWWA 1QJZA 1VRH2 2B9VA 2WRAA 1V6OA 4G4FA 4YM2A 4AVTA 4MGKE 4JVAA 5FXVA 5IK8A 4NVPA 4AEDC 4WM7A 2OQ6A 5FYBA 1W6MA 4R9BA 4YLZA 2FZ1A 4CZSA 2VCMA 4PDWC 1N3QA 4YW5A 1R1A2 1G86A 3W21A 3NV3A 5AC91 3AZYA 3J7MA 4DO0A 5FTTC 2YZ4A 4DQAA 4NOTA 2Y6LA 4O9EA 2I74A 4NN0A 1K5MC 1SLTA 1VBB1 4R4XA 4RR3A 5FXWA 2VOXA 1GZ9A 3VGIA 4TZDA 2OPWA 1SBDA 1Z7S1 2ZGQA 3KS7A 3KV5A 3OGRA 5A32B 5EJ3A 3ZO0B 2A6YA 4LPLA 4UBGA 1UYPA 1WBLA 3VKFC 1AL23 3LEMA 2ARBA 3AXDA 3LSDA 3PTYA 1SG3A 1OBNA 1YYNA 2NYYA 1CR7A 4DB5A 1OXCA 4IGPA 5C4WB 5F2SA 5A6ZA 2R6QA 3BALA 1TME3 1XB9A 4WVMB 2ZACA 4IEQA 2E6VA 2VPVA 3VZNA 1HXS2 5LRSA 1AF9A 4RQPA 5FZLA 3KWVA 1FXZA 2AUYA 3FX3A 3PDQA 1IKQA 1EP0A 3R4SA 5H9PA 5T52A 2HWE1 3K4ZA 1V6IA 2RS31 3A21A 2JDUA 2E31A 3AFKA 3R05A 4QPGB 4IEUA 4UFKA 2C26A 4YVWA 1AYM3 4O65A 2JDYA 4AK3A 2NMNA 2OZ6A 3OBZA 2J1TA 3V0BA 2Q4SA 2XHKA 3HWJA 2EAAA 4LO8A 1HB3A 2GALA 5A7SA 5E8AA 3ILFA 1ULOA 1NKGA 2CGOA 3PUAA 1DZRA 3ZFGC 1W6OA 3LD8A 2ZGKA 1JOPA 4UYBA 3RMXA 5JMOA 1UW8A 3ZPYA 4KWLA 2UWBA 1HQWA 3V0BB 1PNFA 2VZRA 2YFUA 3LA7A 4DINB 3AK0A 1O7FA 3WG1A 3WF1A 5FY1A 3E5QA 5JIAA 1WW4A 5DUVA 3WP5A 1Y9QA 2JJ6A 3RDIA 4CXWA 4JGYB 1OOPC 3I3QA 3N7KA 5HCAA 1B35B 4MGTA 1GQGA 1JMUB 4AVVA 3N7JA 1BXHA 3CZJA 4YZ5A 3MZHA 3QOPA 4GWMA 2NN8A 4XF4A 1QWRA 4LULA 3POBA 1MEC1 3NJZA 1KXGA 2GC1A 4XQDA 3U75A 1NX9A 2X10A 1BEV3 5C3OA 1VPHA 4GB31 3IWZA 1OC1A 4ONUA 1PZ7A 3MF6A 4BQ2A 1O8PA 4KMQA 1DQ5A 5BNPC 3VD5A 1XYOA 3FJSA 4XJZA 5F5AA 2A3YA 3AJYA 5FFOC 2C4XA 4CDUC 1KS4A 2RM22 3LFMA 3N7LA 4Q4V3 4FQZA 1RUJ3 4MZUA 3MV11 1PZ9A 5LASA 3SCFA 4DXSA 1FYUA 1GUIA 1AR83 2JG8C 4JRAA 3QH7A 5HCBA 3LGRA 5FOBB 2L9LA 3IB3A 4P9LA 1S55A 3ME2A 1S1AA 2WAAA 5BNNA 1NE4A 1KEXA 1IHMA 5GZDA 5C70A 1SFNA 3H50A 5FO8B 4IESA 4ZKTB 3IPVA 5AFBA 5DAQA 2FMYA 4AQSA 4NHLA 4ET7A 2J1RA 1D0GA 2AEYA 4HZFA 2Q1MA 1W0OA 2HWC3 2QUOA 3IAQA 1R093 2C24A 1K45A 1IS6A 3LOBA 2VGDA 4CEWB 4DY5A 3LAGA 3PJYA 4Q1RA 2DCJA 4CP9B 1OSGA 4W6WA 1S0BA 3VKNA 3W5MA 1G6NA 4JRLA 3UL2A 1BCXA 1VBE2 1F5JA 4LORA 1ZRCA 4OHVA 5DZGA 2IXJA 4BOWA 1JOBA 1DDLA 3GZEA 1LOGA 2Y8KA 3RWKX 1TMF3 2KA3A 2AC1A 3J8F3 2WO1A 4AVAA 5FZHA 2ES3A 1HV1A 1FNZA 1UD1A 2R7EB 3C7HA 3FUOA 5FKCA 2W39A 5A3WA 2W91A 4FTBA 5E1RA 2BVVA 4CUCA 1KQRA 4S2HA 4DXZA 3WUCA 3K77A 1E57A 2HLEA 4NIGA 5L19A 4OUEA 2RJLA 2WWUA 3BPSA 4O7XA 2A3XA 4S2FA 3M1HA 4GH4C 2JG9B 3WUDA 1OUSA 1W6QA 2IXLA 5FYTA 1X8EA 4OHYA 3CHXA 4HKOA 1UOBA 1A8MA 4RS5C 4XOGA 4FAGA 2JXAA 2BNNA 2XKOA 1PO23 4L99A 2ET7A 4LOTA 1YFUA 4DY3A 2JB8A 4LLOA 3AMPA 4FPKA 2HYXA 4YW7A 3ZYJB 3ZYPA 4AEDA 2LROA 1AVBA 1DBNA 3PJQA 3NNLA 2Q8EA 4AXOA 1PNGA 1W8HA 1AR63 2V5YA 1FOD1 4HK8A 1KDKA 3MO4A 5FYHA 3L9JT 3B5LB 2BEOA 4Q5OA 1HB2A 1O3RA 1K5MA 1SLCA 2J1UA 1VBA2 2Y0OA 2YC2A 3I2IA 3JBG3 4Y3OA 5FLIA 3TOJA 4QXCA 4JGZB 5E6HA 3LA3A 4ZZ8A 4PCRA 5L36A 1BVVA 4CDWC 5L7OA 1QQP3 1OHFA 3EBRA 4Q0VA 3IIAA 5T54A 1ASJ1 2HKXA 1ULFA 3PVEA 3M3OA 1OH4A 1GSLA 1RUI1 3FE5A 2JDMA 4CU7A 2I07B 4ZY9A 4YSFA 5LW9A 4AW7A 1EAH1 2P3JA 1O4TA 5FPAA 3ZR6A 1SLIA 3C2UA 4HPKB 1NQJA 2WZR2 4GD4A 4XXPA 5K8SA 3J7LA 5DAVA 3NKGA 3APBA 1V0AA 2WS92 3I59A 1FPN2 2DCZA 4Z2WA 4OI0A 3GF6A 2XVGA 3MBWA 4LMFA 1V6KA 4P02B 2WNVB 3CKHA 3VDCA 2RG4A 2YDEA 1UOFA 1X9PA 2KXLA 3I2DA 2P34A 3POWA 3LDKA 3OGSA 3N4MA 5F6LB 5GLVA 3D4KA 3MW4A 4B1LA 2XHNA 1AR91 3NV4A 2TUNA 4YG3A 2GN7A 1IOAA 1I6XA 2UURA 4HKWA 2ZX3A 3MUZ1 3I59B 4DXRA 4A3XA 1OF3A 1UO9A 3MI8A 1ZNPA 3ZFGA 4I30A 1V9U3 4P5YA 4XW3A 5KHGA 1ULEA 1KD7A 3WD5A 1HW5A 3UK9A 4H2AA 1HXS3 2VAUA 3RJRA 2Q1FA 3S30A 2X09A 4P9JA 1UWWA 1A78A 2XL9A 3K48A 3ZXDA 5FPUA 1LHNA 3KLSA 4PF5A 4YGEA 4MG2A 3KHCA 2WZPP 5KXBA 3SEPA 1LGCA 1L7RA 2WT1A 3B7MA 4RGAA 4BJ0A 5C8CA 2OPKA 1OOPA 5E16A 1OKOA 4OI4A 5BNPB 1QXPA 1PK6C 3BTXA 4AF9A 1JI6A 2VVFA 4D94A 1AYN2 2QVSB 4RD7A 1O5UA 1US2A 1Y4WA 2A70A 1BVP1 1OQDA 2JE7A 5FWEA 3USUA 1ULPA 5C8CB 4E4HA 5FLJA 3SLIA 2DCYA 2BGOA 5FZGA 1GYKA 5LBBA 2ADDA 5LK7B 2XLAA 5A7OA 2IXKA 4AWDA 5FP8A 2E32A 3T0BA 1FMD1 4E8CA 3KSCA 5AC93 1PGL1 1ALYA 5BNPA 3I2FA 2JWPA 1H6YA 3LDRA 4BDVB 3Q8BA 4NIDA 2B5HA 2W5FA 2F6BA 3VBFC 3DL3A 5FDBA 3AMMA 4CDUA 3ZSJA 1F4AA 1SCSA 2Z79A 3D0SA 4KH9A 1UZYA 2IC1A 3PHMA 3T2PA 1OQ1A 3TYJA 2JDHA 2N7GA 3D8CA 2JG8A 4M3CE 1J3RA 3VBSB 4BPZA 1AXKA 1PVC2 2A75A 3HNYM 2MEV3 5ABJC 4FTEA 1GP6A 3HQUA 4FFFA 4NAMA 2VMGA 2QQWA 1SEFA 1HB1A 1CPNA 3AZVA 5FREA 1JZ4A 1EV11 2YGLA 2HBUA 4IQPA 1NZIA 1YUDA 3SNMA 2NM1A 3SCGA 5G05L 2B42B 5DDJ3 3TNPB 3K4DA 4YZ2A 4HONA 1ZBA2 1NAEA 2I45A 5F7UA 3O12A 5CVRA 4D69A 1JU3A 3ZM8A 2CGNA 3PMEA 4KG0A 4OVEA 4PBPA 3SKJE 2B45X 4FPCA 3MIDA 3BTYA 3NVCA 5GM0A 2ZMKA 2ARXA 4LBMA 5HXMA 3VDDC 5AVAA 3QCWA 3J7NA 1D4M1 2CAVA 3BOPA 4LR4A 3LIGA 2XJSA 3ZYRA 1XXNA 2WIIB 3T2TA 3H8XA 1RIRA 2RVAA 1ZA4A 2ZX2A 4W4ZA 2PHTA 2LALA 3LPFA 1WLWA 2RS53 3M3CA 3PUIA 4XZUG 5HV0A 4UOJA 4CCKA 4QPIB 4SBVA 1YC61 1AX1A 4AVSA 2FDJA 3JU9A 4XF1A 1Q8PA 3KB5A 3TB0A 3WOGA 4IV1C 1LOEA 3UKVA 3WEZA 3GZUC 4UF0B 4D6SA 4XUQA 1NCRC 1VBE3 4YW4A 2R1BA 1BK1A 1ZA7A 2FHRA 2X5IB 5FPXA 2WN3A 5IAVA 4PQQA 5KHHA 1F4HA 2VOVA 1OFNA 1ULDA 2NLRA 1D7PM 1YFYA 4HL0A 5JSPA 4RS5A 1YJLA 3AL6A 4PF1A 2EIEA 4BQYA 5GZGA 1CQ9A 3PUSA 1VBC1 4CCDA 4JX0A 2OZJA 3VZLA 1OA3A 2FZ2A 2XPJA 2W46A 1QJY2 2VJXA 4I02A 1W8NA 5FK7A 1XNKA 5JMCA 3KQ4B 4AAPA 3AP4A 5DZEA 5FUPA 1JXNA 5F2WA 1ONAA 4TLFA 4XJAA 1NA1C 3BN6A 4KI5M 1IG0A 1KDMA 3IBMA 1UU4A 4CDWA 4R8HA 3E5UA 3IDCB 3WW3A 2FQPA 1JZ5A 4INDA 1GR3A 4FPHA 2R063 2Q8CA 4BXFA 4RGKA 5L9BA 5F37A 4TLGA 2HWF2 4DUWA 1ZZBA 4RHV2 4UFJA 5B4XA 2JE8A 4MXVA 1RHI2 1VBD1 1ENQA 3D0JA 2WWSA 3LIHA 2VVEA 3WHUA 3VBOB 1UXXX 4AEMA 5SV8A 3ACLA 4X6QB 4PJYA
chains in the Genus database with same CATH topology
1NCQB 1VBA3 4C91A 1Q8VA 3OTFA 5FBZA 1S2BA 2K0GA 1Z7S3 4NWVA 2E7TA 1X8MA 2WFPA 4L9BA 1PO12 2ZX1A 1KRIA 3OY8A 1U5ZA 2GC3A 2GNMA 1YCIA 1NY72 1YNAA 5JPMB 2D6KA 3VL8A 4H55A 2WZR3 3J9SA 1N1YA 1OMIA 1IS4A 1UMZA 2WS93 2GC2A 1AL22 1T6GC 2PA7A 2VMHA 2D6MA 5C9AC 2HWE3 4Q4Y1 1QOOA 3VBHC 5KC6A 2XLGA 1SFYA 4XIKA 4BLIA 2ZMNA 1KS5A 1H1IA 1HX6A 3AZXA 1UL9A 1PK6A 2VXRA 2W0XA 2R49A 3JD71 4I2OA 2BVBA 2D5HA 5CB7A 2YUEA 1JUHA 2ZGNA 3N35A 2Y26A 2D43A 1UPSA 1AYM2 1DZQA 2WSUA 2DFCA 2O0OA 2D93A 2BBVA 3BPZA 2XWBB 4G3YC 2Q30A 1ULCA 3MW3A 1JUIA 1WGPA 3UKTA 5KXEA 4MGYE 4UW5A 3VBFA 4MVTA 5CFDB 5FCCA 3A0KA 4YZ1A 1Q43A 2ZGSA 5EYXA 3ZDSA 5CG9A 2UYAA 3J4UH 4AFMA 5ABJA 4P5HA 4LBQA 1Y7BA 2TBVA 1XU2A 1PGSA 3KCCA 1MEC3 1JBCA 1LKNA 4I0AA 3H9AA 1LOBA 3OD0A 4XF3A 3WINE 4GB33 2O1QA 3QD6A 4YRDA 3WQ0A 2WQZC 3JUUA 5FO9B 4R9AA 4LO4B 4LNVA 2WA4A 3KZ4C 4E2SA 4OLLA 5LEJA 3VDDA 3AP7A 3WP4A 4E2QA 2R071 4BWOA 2MNGA 1LHWA 5JPNB 1SDWA 5BNOC 3GZTB 4K21A 2VU9A 5GLUA 2XJRA 4Q4V2 1EY2A 5JDBA 1MS5A 2SBAA 4WVZA 4YM3A 1AR82 2BWAA 1RUD2 3OCPA 1ZREA 2HJIA 3U4XA 5ACA2 2D7FA 1R1ZA 2ZGPA 1ND2C 1U5XA 4XFFA 2D6NA 5L73A 5CG8A 2HWC2 5T5JA 1GZWA 1W6PA 1R092 1U5YA 3TN91 3NAPB 1D0HA 3NO8A 4RFT0 3ATGA 4L8QA 2D6OX 3AX4A 1PGW1 3KQRA 2VNRA 4B4PA 1VR3A 1R083 1UIKA 3ZFEC 3NWKA 4NHMA 4AE2A 1W6PB 4RGGA 2SLIA 4CP2A 3J8F2 1NG0A 1H8TC 4ZXKA 4LT5A 1NA1A 3DV8A 3U0ZA 2E7QA 2RM21 2AYHA 1DQ6A 4AGVA 4KWKA 1UKRA 3N36A 1DGRN 4AHYA 3CJXA 3EQEA 4J1XA 2ZMLA 3GHNA 3KGZA 3AYAA 4L2NA 3D5OA 1SLLA 1V6LA 5JZGC 4UW3A 2O8QA 1X33A 4DS0A 1H9PA 1AZDA 1MVEA 4DMIA 1H1AA 1FOD3 5FQ0A 2OVUA 1LULA 1LECA 2HWB1 2GU9A 1PO22 1RUNA 1MS0A 1RUF1 4QM9A 2ZZQA 3O0XA 5GLWA 2XJQA 4MXWA 2BFUL 3B9CA 2YGMA 1ASJ3 1KJRA 4FPFA 1AR62 2FBEA 1RUI3 2OUJA 1REFA 4FPLA 4RHV3 5I91A 3JBG2 3AFGA 2ET1A 2HEWF 2R041 1IQAA 1QQP2 3X29B 4N43B 1XYNA 4QD2A 1AUYA 3TWIA 1PO13 1HIXA 4FOVA 3ZXGA 1CAUB 5AFEA 1LCLA 4HKLA 1OA2A 5GALA 1VB2A 2DVAA 4FO9A 4CEYC 3M7AA 4WM7B 4WZFA 1F8VA 1W6MB 1N1TA 3V0AA 5K9YA 2HEVF 1CAWA 4GKYA 4A7ZA 1A8DA 1OQEA 2E53A 1BBT2 1QMJA 2VMIA 4RR3B 4IEPA 1O4YA 1V9U2 2GMEA 2RMU1 2RR11 3M3EA 4QMAA 4E4SA 1H2KA 5FPZA 1RITA 2XWJB 4Z82A 1XU1A 5D8AA 3B93A 2WSVA 3ETQA 3KM5A 2EXIA 3CF6E 1TEIA 1DGWA 2PLV1 4ZU7A 4JDMA 4S2DA 5C33A 1YIFA 1Z78A 4MX3A 4RQPB 2ZKNA 3H8UA 1HRV1 4Q29A 4Y1ZA 3WQ1A 1DQ1A 2WA3A 1YRZA 3USSA 3HQXA 3EJKA 1FMD3 4XFHA 2WNVC 5D8AB 2OA2A 2R0FA 4YVWB 3H1YA 3SMHA 4IEYA 3HN1A 1FPN1 1GBGA 4FPOB 4D7SA 4LUMA 1CGPA 2XBO1 4ATEA 3NSTA 1RUC1 1S0EA 4FP3A 4CDQC 4F3JA 1W6OB 2XJUA 2VNGA 4B29A 2XLFA 1MQTA 3MYXA 4KU7A 3B9IA 5CNAA 4C0BA 1ZYBA 5BNQA 2QQPA 1COV2 1EV13 3FMGA 2H0BA 3ZFFA 5JOWA 1F9KA 1AR72 3SISA 4IETA 3WX5A 3CJIC 1SLBA 4YNIA 2MEV2 3GBFA 3MW2A 1MQTB 4K8FA 1OLRA 1MZFA 3ZFFB 2HEYF 4BHPA 1HDKA 1ND3A 2R1DA 1IS5A 4LBJA 1ND2A 2GC0A 4XILA 4FOYA 5DDJ2 2C0ZA 3E5XA 2QZ3A 4P9GA 1N3PA 4XJ8A 1RINA 3HIFA 5K0UC 1OPMA 2PTMA 1S0IA 3JB4C 4COVA 1C8M1 4OZXA 5DG2A 2RS11 1RUD3 3ZFEA 3CU7A 2DUQA 3B94A 3WP6A 3I54A 4S2GA 5JLVA 4N9IA 5ACA3 4X6RB 1QJU2 2ZPXA 4IERA 1H8TA 3GBGA 1QOSA 1ZBE2 1HV0A 2RS52 2PAMA 3R0RA 1RUG1 3VBRC 4CP1A 1LODA 3RG0A 2WNEA 5BNNB 1MR5A 3NV1A 4LUKA 2QKDA 3FZ3A 4K1ZA 3IPVB 2GMMA 1DYPA 1HQLA 1QNWA 3M4FA 4F7ZA 1LEDA 2NZ9A 3WG4A 2X53S 5JZGA 3QH6A 3O0WA 1VBC3 2VQAA 3E6BA 3OYWA 1N47A 1QJX1 2DVFA 4WM8C 1WCSA 1RVF2 1YFXA 4IV3C 3ZN6A 1YI9A 4UW6A 4Q2FA 1RUH1 3GHMA 3MFCA 4CTEA 5JOZA 1C57A 4META 4K1YA 4Y1YA 4B7EA 1RB8G 1NYWA 4C0HA 3INAA 1SMVA 2BQPA 1G9DA 4Y1XA 1X36A 4YW1A 3P3PA 3FHIB 4LBKA 5T55A 2BPA2 3L2YA 2DVBA 5GZCA 3LA2A 2WNUC 1MACA 1O4ZA 4K40A 4Q27A 3BTAA 2V09A 1SBEA 1CONA 5FMOL 5FLHA 5KC5A 1SLAA 2H6BA 5JSRA 2R062 3UJOA 2QE3A 4Y1UA 2C1FA 3WQ7A 3GYDA 3ZIWA 1CJDA 1EPZA 1W6QB 4JC1A 4PDWA 3WCRA 4YVSC 5EV7A 1XNCA 4CDXC 3HAGA 5F5QA 4CEYA 3SXWA 5DUXA 1O3SA 1V6MA 4OUMA 5AC92 3LWCA 4B7KA 2P3KA 3WW4A 4AEDB 3I8TA 1VBB2 4I0WB 4PDWB 1Z7S2 1ZX5A 4GMP0 2WC2A 4AHZA 3ZYIB 2WJSA 2WFF1 3ZXFA 2IFRA 1PZ8A 4Q4Y3 1K5MB 2ZGRA 1W2UA 2XB6C 4YZ3A 1LB2A 5DUWA 5L7OB 5J48A 2XUMA 1UCXA 4YGBA 2LM3A 3LOIA 1LHUA 4MSVA 4EN9B 2HWE2 1NLSA 2RS32 3VHRA 3ES4A 3AP5A 2DCTA 4F83A 3ZYGA 1W0PA 3TBDA 2QDNA 2OIIA 1J59A 5T5LA 4HANA 2ZJCA 1BBT3 1RMU1 2IXCA 5I8YA 4AHXA 3B01A 2VW2A 1LU1A 5JVVA 3BOWA 3KGLA 4W6YA 4XYXA 1QU0A 1DLLA 4CDQA 5KHJA 2WT2A 3GALA 1WCKA 1F2NA 3KCYA 3ZFGB 4KU8A 3TRSB 3MIGA 2VNOA 1MS4A 2K2SA 4HN1A 4HETA 5CFCC 4AEKA 3U07A 3CJIA 4GULA 3FLRA 1MS9A 1OKQA 1OOPB 1YHFA 1MEC2 4I09A 1TME1 5B2GB 2ZGLA 1W6NA 4UXAA 4Y22A 4GB32 2D97A 3ZXEA 3USUB 4FOWA 4GXLA 2UWAA 1BJQA 2R073 3S7EA 5K0UA 2JECA 1COV3 1CPMA 4BE3A 3IDBB 1VAVA 4LA2A 4XJWA 1H30A 1FV2A 3RMYA 2IFWA 1AR73 1UZZA 1HKDA 2PFWA 1KJLA 2DVGA 4P9XA 5BNPB 2W52A 4K20A 5CFDC 2A3WA 3TAYA 2GMPA 1LHOA 4XFCA 4PLOA 2YXSA 5HBAA 4CDUB 4PLMA 3MPBA 3WZ1A 4GWNA 1HLCA 2ERFA 2BUKA 1X7NA 2JG8B 4FPGA 2HWD1 3VBRA 1A3KA 2UWCA 4YFWA 2ZABA 4YARA 2ZA9A 2JENA 3RQ0A 4QGMA 3JQWA 2BFUS 2CV6A 4HLTA 4Q4W1 1AXZA 4DPNA 1PIV1 4N53C 4IEWA 2RJKA 3A4UA 3CO2A 4WZCA 1FX5A 4WM8A 4EJRA 3RYPA 2QZ2A 4IV3A 4A2UA 1QJU3 1B09A 1H9WA 1ZBE3 1JTZX 3RRDA 3WXPA 3WT3A 1POV1 4DFSA 1R082 1BEV1 4KWJA 4Q8LA 5FRAA 3IN9A 3FBYA 1DF0A 2D3SA 2VH9A 3MFAA 3SHRA 2WNUA 4GH4A 4OHXA 3VBUC 1RVF3 4AG4A 1RUJ1 1YJKA 3V65A 4C1XA 2WKKA 2HWB3 1V6JA 2ZHNA 5BV6A 1VIWB 1LJ7A 1RUF3 3AP9A 1S0DA 4KG8A 4GMP1 1XNDA 4QQ2A 4EV0A 2Y38A 3AMHA 2PHWA 4H3WA 1G7YA 4YVSA 3JQXA 3ECQA 3AB0A 5H9QA 2R32A 4BIOA 4RS5B 3EHKA 1FOD2 1FAYA 3IMNA 1WUVA 2ZHKA 2ZX0A 2C5DA 2PHFA 5T50A 3AYCA 3O14A 1YXWA 4Q4X1 4YZ4A 1ASJ2 3ILRA 4K6BA 1RUI2 1WW7A 1TMF1 1YFWA 2EA7A 1H2LA 1LR5A 2RE9A 1EAH2 4CDWB 1ENRA 1F5FA 3CNAA 1QXJA 1RUE1 1QDCA 3WV6A 3LKJA 2VVDA 2JICA 5GKAC 5KHIA 2ZAHA 2Z5WA 2XJVA 1VBB3 4I3PA 4QQPA 1D4VB 1DQ0A 2EAKA 5KBFA 4P9WA 1AR92 4EN0A 2ZX4A 5J98B 4EN6B 2DYCA 2JX9A 1AHSA 2RMU3 2RR13 3MGUA 4YGDA 3GZAA 1GLHA 2ZGMA 2DU0A 1XYPA 2H0VA 3OY8B 4G9SB 1QH7A 3DPRC 1QOTA 1H0BA 4BCUA 1QDOA 4XDQA 1J1TA 2RS33 1U5IA 3B02A 1J1LA 3H7JA 3OBRA 1LOFC 1O3QA 4HK9A 3W9AA 4HVQA 5CFCA 1HRV3 3RS6A 1BMV1 2AGSA 3IKWA 5A33A 2YYOA 2UY8A 3AXEA 4M3CA 1HRI1 5CIRA 1Q8QA 1WCDJ 4XF9A 3HMYA 4ZU4A 1YIPA 5FO7B 1PM7A 3PNAA 1VRH1 3HR9A 1PK6B 2E7AA 4TSVA 3WP3A 3BB6A 1ZRDA 1IPKA 4YM0A 1RUC3 4M3CB 1R1A1 4TWTA 4URTA 4FAHA 1O3TA 1FMD2 1UN1A 1PGL2 2PHLA 2ZAAA 1NXD1 2DTYA 4BA6A 2D44A 2PAEA 3S7IA 5SV5A 2X29A 5C4WC 1JOJA 3WDUA 1QF3A 4LLFA 1SQ4A 3ST7A 1TQ5A 3WW1A 3VBFB 4YW3A 5FAXA 4XPVA 3SCHA 1S0FA 4JQRA 5AVPA 1WBFA 3E97A 3MF9A 1N1SA 1EV12 4QPGC 4XZPA 1ZRFA 4FSJA 1G9CA 5LEKA 4D3WA 1HXS1 1GNZA 2EXJA 5ABJB 4HFSA 4LBQB 5JI7A 1H8VA 1WA4A 1RUOA 5F6KA 4N9HA 3M70A 3HBZA 2B9UA 1C8M3 1SBFA 1FATA 1C1LA 1I3HA 3GNEA 3M2MA 4LO6B 4N53A 4DRVA 3WHTA 5J96B 1WMFA 5J3UA 2XGXA 4HVOA 2GH2A 4AQ2A 1C5HA 3DUIA 4Y5Z0 5FMOS 3PVOA 1D4M2 3PVNA 1L3JA 3AM2A 2BNOA 1GICA 1ZM1A 4HSLA 3NKTA 1CAXA 2G4IA 2P17A 4LO7A 4FOQA 4JGYC 4I3GA 3VDDB 1RUG3 2D3RA 4JV4A 4FTSA 3SH4A 1B35C 4GA9A 5A3MA 1BYHA 2PELA 1UU5A 1RTVA 4IL7A 1JH5A 4IV1A 4PIZA 2Q5TA 4XQ4A 3H3ZA 1NCRA 3R6SA 4QM8A 3VBUA 2XL7A 2WLQA 4R52A 4W6XA 2VG9A 2K9ZA 2CWSA 4FPJA 2ZS6B 4IV1B 1RUH3 4R9CA 3BIWE 2AZ5A 1NCRB 4MLOA 1LOCA 1I1EA 1VB4A 1VBC2 2AR6A 3AKSA 2A73B 1GZWB 4QPYA 4MGZE 2OYZA 2QDRA 2UYBA 2NPIA 4AQTA 3VL9A 1AX2A 3VUOA 1LEMA 1QXRA 1CN1A 1FNYA 5DZFA 4X8NA 4LHLA 1PVXA 4LBNA 2XJPA 4B4QA 2GZWA 3BU7A 1NA1B 3ZMOA 4CEWC 2Z2SB 3PLQA 1GFF2 1WLDA 4L92A 2CL2A 3WCSA 1VBD2 3DN7A 4Y20A 1CAVA 2ETEA 4BIFA 2NP0A 4LBQD 4XMIA 1LTEA 1X50A 2YY1A 5EZWA 1LHVA 1X82A 2CWMA 4H7MA 4LA3A 3ES1A 4EN8B 5BUVA 4XHBA 3CEWA 1VBE1 5FQ0B 2WFF3 5H9RA 3OD4A 3FLTA 4AI1A 1WW5A 1LU2A 1EAH3 3VLBB 4MXWB 2IXHA 4GALA 3K51A 1DFQA 3ZSMA 4LBLA 5I0TA 1FV3A 3ZSEA 5C9AA 3DPRA 3D82A 3VBHA 1QNYA 2JG9C 2XG3A 3B3QE 3H3UA 3S0MA 4Q4Y2 4FCAA 4PLNA 4AFDA 4M3CF 1VJ2A 1AXYA 1AR93 3JD72 3POYA 5LK5A 2DURA 3WW2A 5C9AB 2WQ4A 3D6EA 3VBHB 4AGGA 3I7DA 4P9YA 3CLPA 3ZMNA 1OA4A 2P3IA 3M3IA 4X8PA 4QU2A 3KT1A 3FBMA 3VKMA 4H14A 2ZGTA 3PVBB 4E4DX 1OI6A 3HT2A 3OPZA 5A32A 4JGZC 4YYOA 1DYKA 3WLUA 1GANA 3OBTA 4XJ9A 4P14A 2DUPA 4BH9A 1VBA1 5C4WA 1XNBA 3V0AB 4GKXA 2A5ZA 4WVMA 2A6ZA 1QH6A 1LRHA 1CAWB 4XBNA 2ILMA 2MHFA 2ZHMA 4AHWA 4JDNA 3RYKA 5L7OC 4K9SA 2ATFA 4A7KA 2CYFA 1VP6A 4AFCA 4DNYA 2Z42A 2ZGOA 3SH3A 3H0OA 3RNSA 4QPGA 2NMOA 1V00A 2WZR1 4PBOA 4QQOA 5D1IA 1UAIA 4XBQA 2GDFA 2E51A 2WS91 4COWA 1ENXA 4LE3A 3WDWA 1AJOA 2WL1A 2ZBJA 2PAKA 5I93A 3AKTA 5T3NA 4COUA 4R9DA 3MIEA 4N7UA 3FWEA 4XFBA 2DV9A 4OI1A 5BNOA 2R072 4HVRA 4IEOA 3Q9OA 1KFXL 4N90A 2CY6A 3IDEA 1URXA 2KM2A 4TYSA 4Q8KA 3UJQA 4I0BA 2EVXA 3URFA 1CIWA 4JGYA 4Y24A 4E4ZA 2HWD3 4E2GA 1EPWA 4AVBA 1B35A 1JW6A 3ZXKA 5BNOB 5J37A 3NV2A 5HI0A 4Q4W3 2RHPA 4WBBA 4MV2A 1PHMA 1PIV3 2H6CA 3EXUA 3RI8A 5C8CC 1IPJA 1M06G 4XFIA 1AYN1 1OPOA 4FXGB 1D4M3 4WVWA 2EIGA 3IT8A 2LTNA 1UIJA 2ZOEB 5FOJB 3TN92 2Q1ZB 1UPIA 4FVVA 4YFZA 2HYKA 1ND3B 1PGW2 5BPXA 1JN2P 1ND2B 2G9GA 2UY9A 1ZVFA 1POV3 3WG2A 5JWPA 2VQ0A 4ORFA 1GKBA 4B3NA 4YM1A 1DU3D 2EF6A 1N3OA 1WW6A 1ZZ9A 3S6PA 3VBSC 4ASMB 1NXMA 4KBBA 4C90A 4DOUA 4H7LA 1I5ZA 3HD8B 3DF0A 2A7AA 3ZFEB 4Y26A 2VW0A 4XMAA 2PYTA 4N7IA 4C1WA 3FLPA 3H7YA 4QGLA 1ZZ8A 1PVC1 5I8SA 2IWGB 1J3PA 4XE9A 3AKPA 5GZFA 1H8TB 5H9SA 2JKBA 5I0UA 3VN4A 4CEWA 3AKRA 4Z1VA 4M00A 4GMP3 4MUVA 2CNAA 5IK7A 5JAXA 4COYA 1WLTA 2VUJA 1ZBA1 2GAUA 1HQNA 2GNDA 2ENRA 3KMHA 3VKLA 3WDYA 2HWB2 3VZOA 3ZXAC 5JZGB 2Q0AA 1IS3A 4OFGA 1RUF2 3OYWB 3G7DA 3ZSLA 3UKNA 1EYBA 1TNRA 1MS3A 4U36A 3ZN6B 4CYDA 3AMQA 1KITA 2QNKA 4OUSA 4Q4X3 1AL0G 2PHXA 4QPIC 4AEJA 5DUUA 1V6NA 4KQ7A 2ZKLA 4BZ4A 3M3QA 1I9RA 3V64A 1POV0 1VBD3 5GJ6A 2R042 5JOXA 1RUE3 2B8MA 1D2SA 1R081 5EXOA 3U11A 2JG9A 1U12A 2X5IC 4DZGA 3NW4A 4M0HA 4AGRA 2GNBA 2WINB 3ZIXA 1RC6A 1C4RA 2W68A 1SACA 2DVDA 4BMBA 2A6VA 3VZMA 3BODA 1MVQA 3P3NA 4K3UA 4D7YA 2XKPA 2GH8A 3WDXA 5I0SA 1TNFA 3UV9A 4FBFA 4U2AA 4UBHA 3KD4A 2YPJA 1QJY1 5GZEA 3FUQA 4CEYB 4JGZA 3IM0A 1JHNA 1DQ4A 2G9FA 2WLPA 1FT9A 3QBQA 5LRRA 1U0AA 1JYIA 2RMU2 2O8OA 2VY0A 1C1FA 3JD73 2RR12 4ISQA 5I8TA 3POSA 4R4ZA 1QKQA 1XRUA 1H1MA 2YMZA 3WR0A 3WDVA 1HRI3 4HPKA 4Z8BA 3G6JB 4LHKA 1YO8A 2B7YA 1DZTA 2E9QA 4KNCA 4MGIE 3VBOC 2R0HA 2PLV2 1VRH3 2BGCA 2HWF1 1NZCA 3AJZA 1O5LA 2B46X 4WV8A 4XBLA 1NCQC 4RHV1 4XETA 1HRV2 1D2QA 5IK5A 2WNVA 1RHI1 5J36A 4AFBA 2Q8OA 4AQ6A 1R1A3 1XQNA 1GQHA 3AYEA 4HBNA 2C9AA 2Y0IA 3JZVA 4QQLA 4QXKA 1UF2C 3RI9A 2CAUA 5HXVA 3THTA 1RJ7A 1S0CA 5IUQA 2XBO2 3N3HA 1PO11 1RUC2 4NO4A 4JAAA 3VZKA 1NY71 1IGOA 4AYUA 4CDQB 4OHZA 3VHOA 1DGWX 3WG3A 3AKQA 2XVLA 3DKWA 1AL21 1FI2A 3KCXA