4V1PA

Btn3 structure
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
188
structure length
188
Chain Sequence
RHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILTLEPTALSICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords BUTYROPHILIN SUBFAMILY 3 MEMBER A1
publication title Activation of Human Gammadelta T Cells by Cytosolic Interactions of Btn3A1 with Soluble Phosphoantigens and the Cytoskeletal Adaptor Periplakin.
pubmed doi rcsb
total genus 47
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
A PF13765 PRY SPRY-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4v1pA00
3KB5A 2WL1A 2YUEA 4WVMA 4KG0A 4P9JA 5F6KA 2E63A 5JIUA 4B8EA 2LM3A 4N7IA 4WVMB 3TOJA 2VOKA 2IWGB 4QT6A 4N7UA 4V1PA 2YYOA 5JIAA 4XW3A 4X8NA 2FBEA 4P9LA 4B3NA 3UV9A 4X8PA 5JI7A 3ZO0B 5F6LB 5C33A 4P9IA 5JI9A
chains in the Genus database with same CATH superfamily
2PAMA 4MSVA 1VBB3 4YVSB 4JC1A 2VMHA 1ZRCA 3BTAA 1X82A 2Y6LA 2QFEA 3ORJA 4Y5SA 5F3IA 3C7HA 5A1FA 1LEMA 2VMIA 4ONUA 3VHPA 3SCFA 4I02A 5J3UA 3HPNA 1G9FA 2AYHA 2C6SA 2VZSA 1J3QA 3AMQA 1NCRA 1UY0A 2ZX0A 3N35A 4JGYC 4JQTA 5IATA 4U2AA 5JOWA 5KR7A 4YZ2A 4RHV2 2FDGA 1U5XA 3HEIA 4LORA 2OT7A 2OW4A 2HBUA 4BXSV 3VKFC 1NE4A 3SISA 3V64A 3A22A 2F6BA 4JAAA 1PNFA 5JI9A 4XDOA 3FUQA 1W8HA 2FHRA 4WM8C 3THCA 1CWPA 4UFIA 1UY2A 2PHLA 4EJRA 2XJQA 2EIEA 2YFZA 4OFGA 2XMLA 4XFBA 3ACFA 1FPN3 1G9AA 3GZUC 5D1IA 3EHKA 1WD3A 3JBG3 4K20A 5A6QA 1CAXB 1QXRA 4YVWA 4IE7A 3LE0A 4NHLA 4XJAA 4GULA 3KGLA 2WAAA 4GB33 4XIKA 3FFZA 1Y9GA 3T2QA 4YZ5A 5A80A 3W5NA 4IEXA 2ARCA 2OZ6A 5C4WA 1KGYA 2YPJA 2D6OX 4GKXA 2WSVA 3WR0A 2DTYA 5FQ0A 3H8XA 3MZHA 4GWIA 3ZKUA 4QB2A 1W6QB 2ZHLA 4JGYB 2B9VA 1NCRC 2E51A 5G05L 1IKQA 4MLOA 4GZ9A 4BQ1A 2E7AA 3GALA 4LMFA 4YGDA 4LIUA 5FZ1A 2ZX2A 1G7YA 1GOGA 2VOKA 1D0GA 3U14A 4CDQA 5A6YA 2DURA 5DQ0A 4EWEA 3J7LA 4QQOA 5FAXA 4Q4X2 5K8SA 1RVF2 5CYYA 5IT6A 4Q5OA 4D94A 4F7ZA 1W04A 4L9BA 1V6KA 3HMYA 1HB4A 5KXBA 1LOAA 1C5HA 3MGUA 3IAPA 2DFCA 1H1MA 1OOPB 1UMZA 2J1AA 4YVWC 4OHZA 5FPUA 1UY3A 4BE3A 3OPZA 1BCXA 2ZS6B 3D0SA 4QX1A 5KXDA 1OBNA 3JD73 3OY8A 5E88A 3S57A 4RA0A 1YEWA 4JRLA 4XBQA 1AL0G 1SFNA 3PTRB 4CXWA 5C4WC 1DLCA 1W8TA 2XB6C 3UYJA 1YI7A 3POEA 4ZU4A 4AG4A 3PDQA 2ZAAA 3CNAA 4M3CF 4CP0A 3FLTA 3CU7A 4CSWA 1NCRB 4K7JA 4QU2A 5F1RA 2JEMA 2JKXA 2VMEA 1WW4A 1QMJA 3LEGA 1VRH1 3HNYM 3IN9A 3WNOA 3H1MA 2O1QA 3U11A 3M3EA 1JTZX 4CPBA 4CDQC 3BB6A 3N9LA 4YWAA 4EROA 3IAQA 3RJ2X 1KDKA 1JHNA 2I45A 1FX5A 3LDBA 5C3PA 1NQJA 5JOYA 1LOGA 1NA1A 1AR92 3LKJA 2BDRA 4AI2A 1K3IA 4QKDA 4EWAA 4PI0A 4Q4Y1 5CNAA 1CZTA 4A2UA 1RUH1 2I2SA 1QXPA 1QNWA 4O65A 3A0KA 1JHJA 3JZVA 4NHXA 4YVWB 2FBEA 5EPAA 1LKNA 1OURA 2IZWA 3FUOA 1LULA 3PVOA 4XUOA 3SLIA 1TMF3 1HLCA 1D2QA 4Q4W3 4Y5Z0 1OXCA 4KL1A 4ZY9A 4BHPA 1CJPA 1NLQA 2ZGPA 5F5IA 5IHRA 4Q8LA 1J84A 1VB4A 5KBFA 1G6NA 1ZBA1 3H42B 3WQ0A 2B42B 2GC3A 1OI6A 2MEV2 3VN4A 4E2SA 5JZGB 1FXZA 3OG2A 5LBBA 5A3TA 1VB2A 4B4PA 5A3NA 1FV3A 3HIFA 1EY2A 2XHKA 5FQ0B 1F4HA 2XVKA 3AYAA 1K5MA 1MZFA 3GBWA 5FLIA 1LOFA 3JQWA 5T5PA 3WNLA 3FFQA 3CBNA 3WUDA 1UQXA 4YFWA 3OBAA 5FJKA 2Q5TA 1PX4A 3CQOA 1NOVA 1R1A2 1RUI2 2CAUA 3OGVA 5FP3A 3ZN6B 3BOWA 4BK4A 3N9QA 4BQ4A 4FTSA 4CDQB 1GNZA 4CVUA 2ILMA 4QM8A 1F35A 2VCCA 3H3LA 3J9SA 5G04L 2D6NA 1C4RA 3Q8FA 2V72A 4LE3A 1NA1C 1ZZCA 2CNAA 5H9QA 1WMFA 5F6KA 1S1AA 5L19A 4R52A 1AHSA 3NWKA 3V65A 4M3CA 2UWAA 3UKVA 4CYDA 1GWLA 1VP6A 1YYNA 3G7DA 4C1XA 5J96B 3SITA 5F3GA 4N43A 2VBPA 1STMA 2RMU2 2JG8A 3C7EA 4C8DA 3R0RA 3S6PA 4B7EA 1LTEA 4QKNA 2GN3A 1Z7S2 2ADDA 5IAXA 1PM4A 2FZ1A 4LBKA 1M06G 1PO12 4Q4V3 4O9EA 1QJY2 4GWJA 1RUG1 2Q30A 1GV9A 1K5MC 3ZYRA 4KGQA 5EWSA 3I2HA 1LOFC 3KB5A 4YG6A 5FYUA 3SH3A 1ST8A 2W68A 3IT8A 2BV4A 4BA6A 1PO23 1W0OA 2AGSA 2VZUA 4K9SA 3NKTA 4PJYA 4Q2FA 2A71A 3TWIA 3DYPA 1D4M1 1NE6A 1DQ0A 2GMEA 4H3WA 1BEV1 3KVAA 3AYCA 5FLJA 1S0JA 2QQIA 1MACA 4LKDA 4AHWA 1W9YA 1SZBA 1QIQA 3NO8A 3PVEA 1W03A 5FZGA 3RI9A 1SFYA 3OBRA 3THPA 4CCDA 2VW0A 5L73A 3J7NA 2AZ5A 3K3OA 4WM7B 2CDPA 2BWCA 2WFPA 2VQTA 4WVZA 4PQQA 5FUIA 4AQTA 3FMGA 1J58A 2D6PA 3VV1A 5LA1A 3NSTA 5C8CA 4OZOA 3FWEA 1LCLA 2LW8A 1R083 1QJX3 1UU6A 3ENRA 1ZRFA 1IS6A 3OB8A 4W4ZA 4IV1A 4N43C 1D7PM 3NAPA 1LOBA 2A1XA 2JE9A 2JG8C 2WT0A 1COV3 3AXDA 3B69A 4HXCA 1ODNA 3AJZA 5GLVA 5A3UA 2WNVA 4QB6A 1GP6A 3SC7X 1RHI2 1OMIA 4D0QA 2PAKA 4LE4A 1K5MB 3TN92 4EN0A 1UMIA 2FDKA 1RITA 2V4AA 4Q0QA 4J1WA 3THDA 4A4AA 1D0HA 1V9U1 4FAGA 2DVGA 5C7GA 3C7GA 4KI5M 1WCKA 3A23A 3OUIA 3UK9A 1PZ8A 4AGRA 3IPVB 4A7YA 1C1FA 4OI2A 2JXAA 2VMCA 1DFQA 4FOVA 4P9IA 4AZZA 5A1AA 1ZZBA 5E8AA 3ILNA 1WZXA 5BNPA 1RUD1 1LEDA 1XNCA 4CCKA 1DZRA 3MIFA 2WS91 4B8EA 1BMV2 2XBO3 1I5PA 2VH9A 4RGGA 4WVWA 5F2WA 2VUDA 1CIYA 4IEPA 5L9RA 4BCUA 5JXJA 3I2OA 2YHJA 4N9HA 4Y1XA 3DV8A 3LGRA 4M3CB 3PUQA 5C8WA 5HV0A 1VPHA 5C8CC 4YSFA 5FY0A 1ZX5A 4LPLA 4Y5TA 5LCWL 4PIZA 4XIOA 2VQAA 4N43B 2ZABA 1BKZA 3D82A 4IV3A 4IV1C 3TEZA 1REEA 2VQ0A 2JG8B 1DHKB 1XNTA 2VZ1A 3NAPC 4QD2A 3ZLIA 2NMOA 1W8FA 4QQHA 1FOD2 2RM21 2PYTA 1IGOA 1S0GA 2WNVC 3B3QE 4D6QA 3WG2A 2IFWA 3I2IA 2J22A 4BZ4A 4KMQA 1RMU3 3AB0A 3J7MA 3SQOA 1DQ5A 4C90A 3BOPA 4BWOA 3GZAA 4X6QB 3RMXA 2RS13 4ZONA 5BV6A 4HG6B 1QNYA 1K5JA 5C3OA 5F3CA 5TSWA 1EUUA 5FOJB 3ATGA 5FYCA 1ZZ6A 4IEYA 5FFOC 3PU8A 2WRAA 4OHXA 4E8DA 4XJ9A 4JKKA 5DAXA 5BNPC 3VD5A 3BGAA 3ZYHA 4CPBD 2RMU1 5JXIA 4ZPIA 2ZEWA 1AL21 4AFCA 4XPVA 2HWE3 1I3HA 1MVEA 1RIRA 4LUKA 3HR9A 4CDUA 2W0XA 3DECA 4N53A 4HVOA 4IERA 3AZZA 4FO9A 2B4KA 3HNBM 4HL0A 2ZMLA 2DYCA 4GAZA 4XXAA 3AMNA 5GZGA 2B9UA 1CGPA 3CJXA 2Q1FA 4YYOA 3A7QA 1MZ6A 3I3DA 4FPGA 5LASA 2RS31 4IV3C 5LBFA 4AWDA 2HWC1 1RUC2 2WZR2 3NAPB 4LLFA 3PL0A 4HKLA 5FYZA 3WW4A 1UOGA 4UOJA 3QCWA 2KXLA 4CEWA 1WCUA 3H50A 1ZYBA 1NXD1 3BVCA 3S7IA 3VZMA 2Y6JA 5CAZA 4NPMA 5BNNA 4LBQA 5C33A 5A1LA 3KD4A 2F4PA 4XXPA 4BLJA 3WCSA 1X7NA 3ZIXA 1US3A 5JR2A 1VBC2 1YFWA 1HRI3 5IUQA 1U5IA 2ZZJA 1BHGA 1N1VA 4AL9A 1PIV3 5CBLA 3HOBA 4D6SA 1VBD2 4FVVA 2IWGB 1V0AA 1O5UA 1W99A 4ZS3A 3UESA 4Y1ZA 1NKGA 2W2IA 2YYOA 3GZTB 3GBFA 3J8F3 2VPVA 4CDUC 1OQDA 3VBUA 4EYUA 2EVXA 4YZ4A 4LA2A 4N53C 1WKYA 4CCJA 3N7KA 4MZUA 4GH4A 1OF3A 1W8NA 1APNA 1KFXL 1FMD3 2LROA 2A3XA 2XR4A 4CCNA 1QWRA 2YFUA 1S2KA 3WV6A 5K0UA 4HOOA 5IK8A 1Y9QA 1OHFA 1OLME 2D40A 3BIEA 4ZS2A 2R073 4NVPA 5L9BA 2GALA 4QX5A 1KD7A 3SKVA 3ZXDA 4ZKTB 2ZPXA 2HWB3 3POJA 1GYKA 1AR63 5FZ7A 5CFCA 1W6OB 4W65A 2C0ZA 1HJFA 1VAKA 4XOGA 4CEWC 4AAXA 2OKXA 5JSOA 5FRAA 1NZIA 5FY1A 4QQPA 4COWA 2OPWA 5C3SA 2E33A 3CLPA 4UFMA 4UI9L 5BNNC 1ULPA 3UETA 2BNMA 2D6LX 4KBBA 4W6YA 5KC6A 3ALQA 2G9ZA 1WLTA 3LEIA 3QD6A 4ISRA 4AVVA 3M1HA 2CGNA 2UYBA 3IB3A 2WA4A 1OLMA 4D3WA 5GLUA 2W1SA 4XHBA 4BYYA 3O1SA 4LBOA 3G6JB 5B2GB 4FPEA 2BGOA 4UFHA 5LA9A 4RHV3 1TEIA 2RDSA 3BTYA 2FD8A 5IW0A 2PMWB 1J1TA 1ASJ1 1DQ6A 1K42A 2Y6HA 1VR3A 4CDUB 1JYIA 5FPLA 3VBUC 1H30A 2Z5WA 3OUJA 4GH4C 2K0GA 4LK7A 1ZNPA 1HRV1 1PGW2 1QJU2 1UY4A 2YC0A 4WZCA 4GWNA 1AR83 1GZTA 1S2BA 4HK8A 4EZ4A 5K0UC 1I1EA 4NRPA 1MR5A 2VR4A 1MS5A 1QH7A 5F5CA 3VHRA 2VOTA 1RUJ2 4E4HA 4MGZE 2E6VA 1GSLA 2P4EA 1MS4A 5GZCA 2ZGRA 1RUE2 4LXLA 5CFCC 2WO1A 2BYVE 4S2HA 2O8QA 2BWAA 4Y1VA 1WBLA 1N1YA 2DTWA 2Y0OA 5BNNB 2I07B 1Q8PA 2JJ6A 4LBQB 1L7LA 4QX7A 3RWNA 4PLNA 4NAOA 1GZ9A 1Y43B 4BK5A 1CIWA 2EALA 3RQ0A 3ZXAC 1ULDA 2BFUS 4DIQA 1JUIA 5JOXA 5BNQA 4NWWA 1GFF2 4PT6A 3WDXA 1O6UA 1WLWA 1QEXA 2WZR1 3MDPA 4OMCA 2BJSA 3S5QA 1LAJA 5DAWA 1KITA 1YQ5A 1PVXA 2SBAA 4B1MA 3F2ZA 1C8NA 3O14A 2ZKLA 3O0WA 3NNMA 3DPRB 4GQ7A 5FIXA 3BU0A 5FZIA 1SLTA 1GP4A 4C91A 2NPIA 3POSA 4COZA 1RVF3 5FMCA 4B1LA 2ERFA 2J1SA 3NV3A 4JHZA 3K3NA 1QHDA 3DL3A 1VBA1 4LEJA 2GN7A 4JZRA 1DP0A 1S2EA 2J1RA 2HH9A 4G3YC 1JZ3A 4AAPA 5JAXA 5FV3A 2BPA2 2VNRA 2XHNA 2QKDA 2A70A 4DOUA 5IWFA 5CFCB 1MPXA 3LEKA 4EN8B 3TEWA 1WMDA 3AC0A 3EB7A 3WNMA 5IVCA 4URTA 1ULFA 1FI2A 4UFKA 2IXHA 1OPOA 5L7OB 3Q8CA 5FZ4A 3AP6A 3B9CA 2P34A 1MS8A 1SMVA 2Q8OA 4YLZA 3UGFA 4BJ0A 1C8M3 1ZZ8A 2DVAA 1UYXA 4OVEA 2PLV3 3GJBA 5FPXA 1HB1A 5FK7A 4Q4W1 1BXHA 2W94A 1O3SA 1X8EA 4P14A 1KS5A 2RS51 3ACIA 1BBT2 2QQOA 1I5ZA 1HX6A 1XBFA 4D7TA 1W90A 2ZGSA 3IM0A 4PLOA 1POV3 4AEDA 1CR7A 2EIBA 1AR93 3BN6A 3DXTA 3FL7A 2P6HA 3N3HA 4IE4A 2D97A 4RD7A 4YVSA 5M0TA 3AP9A 5T52A 5HCHA 3KGZA 4M4PA 1DZTA 1K12A 3LIGA 1CN1A 4FPFA 4S2DA 4WZFA 2BNOA 4DXTA 1VAMA 4ES9A 2O14A 2ZEYA 3CZJA 5FYIA 3W58A 1IZ3A 3GJAA 5EV7A 4HETA 4P02B 1V6IA 4Q1PA 1RGSA 2WAOA 3MIBA 4LUMA 1QQP3 4K1ZA 4OCTA 4QGLA 3ELNA 5J36A 1GANA 5IVJA 3KZ4C 1GBGA 3PUSA 4LBQD 2XVGA 2JKBA 1IPJA 1YQ2A 4JCKA 5FP9A 1O5LA 4GMP1 5JDBA 2J1UA 2P17A 1QH6A 4JX0A 4YFZA 4LO8A 4ITCA 4QM9A 3JUUA 2A6YA 4LLOA 4DUXA 2K9ZA 4XILA 2F17A 2Y6FA 1EV11 4K8FA 2W1QA 5GKAC 4JVAA 5A70A 2EAAA 1VRBA 2DV9A 1UX7A 1UOJA 1R1A3 1HXS2 1RUI3 3RZKA 3E5XA 5FWEA 5LWBA 2IVIB 2ZGNA 3LFMA 3N9PA 3EO6A 1J59A 4ZZ8A 4FPLA 2JX9A 2R063 4Q4V1 3ZXLA 4Z2WA 1A78A 4GD4A 4AEDC 2QVSB 3ZSEA 4COUA 5HXMA 2W91A 4YVSC 4ZXEA 1UZZA 5DAPA 2AC1A 1QJFA 2QZ2A 4LITA 3F95A 5BXXA 2Y6GA 3EQEA 3IIAA 1PO21 2VZQA 2XH6A 4AHXA 2VD7A 1H8VA 1UY1A 4XF3A 2AUYA 4XUNA 1W6QA 2P3KA 2ZOEB 1K45A 2XXZA 1W3VA 3ILFA 3OEAA 1UCXA 2JB4A 4JTOA 1HB2A 4LHSA 5D21A 3WQBA 4D69A 5F7UA 3WCRA 1GZCA 2DU0A 4NO4A 1XJAA 4CUGA 2XKPA 3LOIA 5IVVA 2EF6A 2BNNA 2XWBB 1SDDB 2LM3A 4CU7A 1PO13 4KQ7A 4H55A 1H2NA 2DCYA 3TEYA 1HN1A 4XACA 3V0BB 3A0NA 5F37A 1LU2A 3K48A 1LHNA 4HBNA 4MOAA 4KGGA 1VBE3 2Z69A 5DUXA 4B7KA 1WWYA 1O3TA 5FO9B 5LW9A 2EXIA 1LODA 1OFSA 4EE2A 2Y6KA 2DCZA 2XONA 3O1VA 1AYM3 1VRH2 3ASIA 1N3QA 1SBDA 1S0FA 3CO2A 4N90A 1ZM1A 3ZN4A 1OOPA 1GICA 3WT3A 3ZFEB 1KEXA 1Q8OA 1ZVFA 4Y26A 3AKRA 1HJGA 5IFPA 4IUGA 1SHWB 4CTEA 2ZKNA 1ENRA 2IFRA 3ZVXA 1SPPB 4AEDB 1OVSA 2WWJA 4FOYA 4HZFA 4ARYA 4L92A 5FCCA 4LKSA 4QHZA 5A7WB 4E27A 2A6XA 3AFKA 2CGPA 1JMUB 1IS5A 4G4FA 4Q4Y2 1RUH2 2UWCA 1UYPA 4XF0A 4N7UA 4HANA 5APAA 3ZR6A 1VMJA 3H3UA 1EP0A 4URAA 2ZA9A 5JCTA 2EXJA 4KU8A 3NV2A 5I8TA 3SCGA 2QQMA 1BBT1 2FCTA 2GNTA 4K21A 2JIGA 4AOCA 1UF2C 1NQDA 1ZBA2 5AC91 1SQ4A 5LATA 4YZ3A 3P6BA 3HBZA 1FV2A 3TN93 4FTBA 1W0PA 1GQGA 2AENA 5FZBA 4KBZA 4FP2A 3FN9A 3V56A 2DUOA 4Q0PA 3T30A 3QH7A 3BU7A 1X36A 5FPBA 1XYNA 1Y4WA 2RV9A 2AEZA 5DDJ3 1WCSA 1MQTB 2WNUB 1OOPC 4SBVA 1W2NA 3MV11 4YG0A 2ADEA 2VOVA 4FFIA 3RZHA 5FUNA 4XBNA 4IGOA 1JZ5A 5A33B 2FDHA 2VTXJ 1C3HA 1IQDC 2JDHA 2ZGMA 4OUSA 3KWVA 4CCMA 2ZACA 2RS11 5JZGA 1XE8A 3VBHB 4META 3O1TA 2R1BA 4JRAA 2PAEA 2ZX1A 4UW4A 1DG6A 3MW2A 1XOYA 4EQVA 1ULOA 1VMHA 1X33A 1HXS1 2A5ZA 2D6KA 4LK6A 4OQ8A 5AFEA 2XQXA 3T4HB 1R093 4LKEA 4BOWA 4BQ3A 3ZN6A 1MS0A 1FOD3 2HWE1 1T6GC 3MLKA 4JHTA 2D3SA 2E7TA 2VVEA 2E32A 4UW3A 4DRRA 4P9LA 1JS9A 3PUHA 2P3YA 1RUG2 1TVGA 2R0FA 2ZEXA 3A4UA 4QXKA 1GOHA 2CWMA 2GAUA 1UO9A 2R7EB 1LECA 1IPKA 5FYBA 2L9LA 1D4M2 3NMBA 4NUBA 2HJIA 3O12A 3PUAA 2DF7A 4BXFA 1BEV2 3M2MA 4NAMA 3T4VA 1J3RA 2PQSA 1H1IA 4O9GA 3LDKA 5T5LA 4DXZA 3NNJA 4E4SA 4M01A 3OUHA 4HPKB 2XGXA 4DB5A 5JZGC 2IXCA 3W9AA 3ZMNA 4L2NA 2VW2A 1TQ5A 1ENXA 4A44A 3FBMA 3GM8A 1HRI1 4B3NA 1PMHX 3PJYA 1TE1B 1UNBA 1ZA4A 2FQPA 3NV4A 3QLQA 5FBZA 2HWF3 3ZDVA 1O8SA 2RJKA 4B29A 2YY1A 5FWJA 3B5LB 3ZN5A 1W3XA 1JYCA 5CKQA 5LB6A 3PVBB 5FY9A 2VZRA 1O7FA 1JI6A 4DY3A 3WNXA 3Q9OA 1QOTA 4AHYA 2YC4A 4MXVA 2NQYA 2RVAA 4XEZA 4FT8A 5F39A 1EUTA 3LFIA 4QPGB 4NMIA 1FMD1 4AYUA 5KXEA 3HAGA 1TNRA 2PHFA 4WM7A 3AYDA 1V9U2 4XCAA 4CCLA 2VULA 5B4NA 1V6JA 2QE3A 2QZ3A 2R071 3B93A 2IC1A 5JSPA 1IHMA 5A3WA 4P5HA 2G9GA 3AJYA 1GKBA 4AHZA 1W9WA 4NN0A 1QJEA 4XUTA 2RR13 4HT1T 1RUD2 3UJOA 1DLLA 1SBEA 1KDMA 2A75A 4IETA 1WD4A 2WS92 1CONA 3A21A 4NE9A 3WF0A 4QAWA 2VZ3A 2OVUA 1WW6A 4FPJA 2RJLA 4COYA 4OI4A 1GUIA 2ZGTA 4AR2A 4Y22A 5FKCA 2AREA 4BQWA 2QDNA 1OKQA 3BPSA 3HQUA 4XYXA 4YRDA 3IPVA 3WVJA 1JH5A 4M3CE 5ACA2 2CYFA 1P8JA 5DG1A 5FXXA 1EPZA 1O91A 4ARXA 1HIXA 2RM22 3KHCA 1S0CA 2CU5A 4NPLA 1JODA 3PIJA 5EHDA 5LK7B 2YBKA 3CIHA 1LHWA 1W39A 2Y34A 1BJQA 3UGHA 3I3EA 4RR3B 3ZSMA 4WM7C 1AR81 1YFXA 1XNAA 5CIRA 2CSGA 3UKNA 1DYPA 2Y60A 4TLFA 3ZXKA 4L11A 4UBHA 4WVMB 5FO7B 3ZYPA 2Y8KA 3P1IA 2HLEA 2QCSB 1C5IA 3FHAA 3MUY1 4XW3A 5I0TA 2JE7A 4GMP0 3WW3A 3GCWA 5JXHA 4NRQA 1AL22 1R1ZA 1HQNA 4TZDA 4QX8A 5F6LB 3ZOIA 3ON7A 1O59A 3EJKA 3L9JT 1WLDA 5DN2A 1W05A 5DPNA 4WBBA 2LS6A 1QJU3 1LESA 2GNMA 3VZJA 3B7MA 2ENRA 2WA3A 1QY4A 4P9JA 1CAWB 2YXSA 4CDXB 4XAEA 2DBIA 3AZXA 1RUJ3 3KT1A 4QPIB 1G9DA 4HSJA 2RS32 4BMEA 1FT9A 1Y7BA 4A41A 1RUE3 2HWC2 5FXZA 1EAH3 3LOBA 5LEJA 2DUQA 3IDEA 4J25A 2A6ZA 2WUHA 3KF3A 3R4UA 4CEYA 2GC2A 2P5BA 2YBPA 1AR73 2JDMA 3B9IA 4GIQA 1E57A 4JDOA 4U36A 5FY4A 2E31A 5FZDA 4AFBA 1OQ1A 3AL5A 3WP4A 5EJZB 3LA3A 1XNKA 3W5MA 3AL6A 4CUBA 1G9BA 4FBFA 2XJTA 3AZYA 4RYDA 1CAVA 5F5AA 3JU9A 5A32B 2WT2A 2VY0A 3KT7A 3H7JA 4LBNA 3JB8A 1XXNA 4K8RB 1J3PA 2W3JA 2EICA 4EN6B 2R49A 3WF2A 3WW2A 3V0AA 1RJ7A 1GWMA 3OEBA 3LQCA 3O0VA 2DVFA 1JYXA 4YZ1A 3GGLA 1PVC1 2D98A 5D8AB 1NCQA 2LRPA 2WN2A 3GHNA 3ES4A 1C8M1 4Y22B 2VW1A 4Q8KA 1W6NB 1ZBE1 4K1YA 2Q1ZB 4AEKA 2PLV1 4TSVA 3S7EA 4AVBA 2WDBA 5ANNA 3X29B 3E5UA 3H8UA 5FZHA 3RJRA 2VUCA 4IEZA 5GJ6A 1JYNA 3S5AA 1A34A 3C3VA 1SBFA 2CL2A 4PQ9A 4HVQA 1LGNA 4CXYA 4CEYC 1CX1A 5FO8B 3GYDA 4M4RA 1G9CA 3WG4A 3VGIA 3LSEA 3VBSB 4ASKA 4GJZA 4IE0A 5ANQA 4ZU7A 5A6XA 4IQPA 1JYWA 2ZZQA 4E4DX 5LK5A 3AK0A 3DYOA 2WNOA 2CGOA 1GMMA 1RUF3 5DG2A 3ACLA 3RSJA 4ATEA 1TG7A 2CHHA 4DINB 2OX0A 2NLRA 3ZM8A 3O1RA 1YHFA 2TBVA 3OD4A 1OPMA 1IPSA 1LHVA 5FZLA 4K40A 2XKOA 3WF4A 2TNFA 1UX6A 5ACA1 1HW5A 3JBG2 4FPHA 4GJYA 1DQ2A 2OQ6A 2WYSA 2AH2A 3OBTA 1EPWA 1JZ6A 4XZPA 4CP2A 2PA7A 2FDIA 1QQP1 5FYTA 5JPNB 1ASJ2 3IDCB 1W6OA 1U12A 2YZ4A 4XAAA 4DPNA 2O8OA 1U5ZA 1MZ5A 4Q1RA 5FY7A 1NCQC 3ZR5A 4NIGA 1HRV2 4FFGA 1MS9A 5KWRA 5I0RA 2JD4A 3ILRA 4XDQA 4KG8A 5FKBA 5LBCA 2Z42A 3VZLA 2YB7A 3ZYFA 4PF5A 3EMRA 4AVTA 2RE9A 3AP7A 4CEYB 4D6RA 3CMGA 3T0BA 1JUHA 2EA7A 2R043 3C7OA 4LULA 4X6RB 3POBA 3MW3A 4Y4YA 3LSDA 3ZXFA 5IAVA 3POFA 1B35B 3FJSA 5T5JA 3VBFB 5A7QA 1YUDA 3GHMA 1QDCA 2WSUA 3ZYIB 2RDRA 3I54A 3MO4A 2C24A 2QUOA 1HQWA 3I3QA 3HQXA 4JV4A 3WDVA 2D43A 3MEPA 4CP9B 1SCRA 1ULEA 3LWCA 4P9GA 3P5BA 1CAVB 3P3PA 3KHBA 1H8TB 3KSCA 3SKJE 1F15A 2GDFA 1WUVA 4UFJA 2VU9A 1XYPA 1TME1 3RZJA 2VXRA 1ND2B 2X10A 3HD8B 5F9TA 3TNQA 2WFF1 1G8WA 2UWBA 2ZGOA 3V0AB 3I59B 3ETPA 4FPKA 2FDFA 5I91A 3JD72 3MICA 2DUPA 4BMBA 2DBNA 3ZXJA 4A7KA 2WQ8A 2V4VA 3IKWA 3NL1A 1BVP1 5FZCA 2MHFA 3VUOA 4XBLA 2HKXA 1NCQB 1VMFA 3C7FA 5KC5A 2A7AA 2FZ2A 1DBNA 2JDAA 1VBE1 2PTMA 4NJ4A 3RFRA 4ASLA 4E9KA 3VBRB 5HCAA 1RC6A 2V09A 3WY6A 1VBA2 4ES8A 1A6CA 1W9SA 1MEC1 1UKRA 3BIWE 2P6CA 1YI9A 5E1RA 4AVCA 5FZ9A 5EJ1B 5HI0A 2A6WA 2C9KA 1JOBA 5E89A 2XPJA 5A6ZA 2R1DA 4TYSA 4NOTA 3U75A 1AUYA 3LZZA 4BLIA 5KHGA 3OCPA 1BK0A 4LT5A 1PGL1 2JENA 2VE1A 5HPOA 1VBB1 2BVVA 2QBXA 3OYWA 4GKYA 1JU4A 3DPRA 2H0VA 4HFSA 1XRUA 4LBJA 5F5QA 4OYUA 2IUWA 4J1XA 2ZJCA 2P37A 2BW8A 4G9SB 1T6BX 5CVRA 3OF1A 1EYBA 4PBPA 1UXXX 4XQ4A 5A3MA 1Q56A 1PMIA 1D2SA 1Y9MA 1F9KA 2XLFA 4CU8A 3HQRA 3ACHA 3D3AA 1VRH3 4Q4W2 2HWD3 5BYNA 4KWUA 1UOBA 2BZDA 2K46A 5FZFA 1GP5A 3ZFFB 4NHYA 1AXZA 1AYN3 4DY5A 2RS52 1OD3A 5J09A 4H7LA 4ATFA 1W2UA 4RQPB 3NJVA 5JLVA 4QMAA 1S0IA 2GZWA 1ACCA 5L7OA 3HJRA 4JDNA 2XJVA 4D7YA 2C26A 1XNBA 1ZZ9A 4LR4A 2FCUA 4ET7A 2I74A 1WW5A 2ARAA 3CJIA 3RYKA 5AFBA 1V70A 1FPN1 4UT5A 3O7OA 4Y24A 4AFMA 1NLSA 1V6MA 3JBG1 1NT0A 1UAIA 5DDJ1 2BQPA 3P3NA 4DQAA 2XG3A 5ABJB 1SCSA 1AVBA 1UIKA 1CPNA 3B94A 5FPVA 1L7RA 5FYHA 2XQRA 1XSRA 2ZHNA 3CDZB 2CAVA 1SDWA 4GB31 4I0BA 1DF0A 3NJZA 4YW2A 3TBDA 3WHTA 1LHUA 3ES1A 3LDRA 3VZOA 3VDBA 3QBQA 3DPRC 2ZXQA 2JIJA 4KU7A 3I3MA 4D7SA 1IS3A 2DCJA 3KCCA 1DZQA 1W6PA 3TNPB 4MADA 4P08A 2QNKA 5CA6A 3KT4A 3CZUA 1LU1A 4LHLA 1EV12 1AX2A 2NN8A 1A8MA 1R091 1JYTA 1RJ8A 2ES3A 5KXCA 2ETEA 3NW4A 4L8QA 3WDWA 2PHTA 4QX0A 1W8ZA 5LY1A 2XVLA 1O4TA 5EQUA 3JXSA 1O4YA 4Q4V2 1BQPA 4UXAA 1GLHA 4B4RA 1H0BA 4I0AA 3U78A 4WVVA 1OVPA 3WNNA 5L7OC 4I0WB 2H6BA 2AR6A 3AVSA 2RHPA 2EAKA 3VD4A 4BIOA 2VNOA 2ZGUA 3WX5A 4NWVA 3CJIC 4Q29A 1T2XA 1QU0A 2VZTA 3RPQA 1PO22 2LUWA 5LA2A 4PLMA 4NIHA 4XMIA 5HV4A 1CPMA 2VQUA 3AP4A 4XFAA 3ZYJB 4AEJA 2N7GA 2GH2A 1UMHA 3JD71 3MLLA 4N9IA 4LKFA 4E8CA 4MUVA 2LTNA 3OYWB 3N7MA 4FOWA 3AMHA 3C2UA 4D8MA 2W9XA 4Q4X3 2WABA 4XJWA 5FREA 4FFFA 1AZDA 4B4QA 4IGPA 5H9RA 3TOJA 2XJPA 2WJSA 2X09A 1OFNA 3K51A 3RZMA 1AX0A 2FDJA 1QJZA 2HWF1 5A3OA 2WWUA 1AF9A 1YIPA 4INDA 5FP8A 5T50A 3IZOA 2E7QA 3N9OA 5FXWA 2EIDA 2JICA 2VOWA 4OQ9A 1N47A 2W39A 1W2OA 4MV2A 1BEV3 1COV2 2BU9A 5T5OA 1LGBA 3WUCA 3CHXA 3UT0A 2B39A 4OMDA 3PJQA 4HKOA 1OF4A 2UYAA 3M3CA 1MS1A 3VDCA 1QXJA 5KHIA 4BH9A 3WG1A 2CDOA 1YQ6A 2PHXA 4XHXA 3CJIB 2H6CA 5CZKA 4IE6A 3V0BA 4RGKA 4XJUA 5FZOB 4A3XA 2V5YA 4QPYA 2ZAHA 1WMEA 5FZKA 2WLQA 3WDUA 3BUCA 2ORZA 3GXUA 4CU6A 1TMF1 1POQA 3LAGA 1HB3A 2ATFA 4Y1UA 4FQ4A 3H8OA 1HKDA 2F4LA 1LR5A 2RR11 1IOAA 4OULA 4KWLA 3VHOA 5C70A 2G4IA 4RFRB 2VZPA 4I2OA 1DQ1A 3ZFEA 1AXYA 2JDZA 2ZTNA 1XU1A 1YCIA 3M8LA 4MGYE 4XZUG 4AF9A 5AC92 5LRRA 1AJOA 3UNPA 5A7OA 1W6MA 3S30A 4NIIA 2JB8A 1W6PB 1SPPA 1YJLA 2QQNA 2ZGQA 4CU9A 3E6CC 5A7WA 5LZ6A 4YM2A 2FCVA 3MFCA 5T54A 3OGSA 5A7PA 4XJ8A 2VUJA 3ME2A 1U5YA 4Q0UA 4Z82A 4YM0A 2XLAA 3OGGA 5I0SA 1REDA 1YRZA 1RUD3 3NV1A 3VKLA 4EV0A 1JZ4A 4XFCA 1UZWA 2WS93 1RMU2 2MEV3 3APBA 1N3OA 2D6MA 2CY6A 4HLTA 4HN1A 5DUVA 3USUA 1SLCA 5J48A 2RS12 3VDAA 2GMPA 5FXVA 1LNSA 1OA4A 5FZEA 3KF5A 2PXJA 4EWDA 3B02A 2QQUA 3O5SA 5I0UA 2OQ7A 3N9MA 4LQRA 4DUVA 3FLRA 5A3LA 4NPRA 3WQ7A 1ALYA 3M3QA 3K4DA 3H8RA 5HBAA 4AK3A 1MQTA 2VOXA 2WNUA 1OT5A 1AXKA 4N7IA 4Y4RA 2GP5A 3R05A 3ZFEC 2RM23 2HWE2 3QH6A 4UBGA 3U07A 4PF1A 5A33A 1I6XA 2GP3A 2OPKA 2ZMKA 3N7LA 4Q0VA 3I4IA 2X05A 1KXGA 5DUUA 3VBHA 1OLQA 2ET1A 4RGAA 4NIAA 5T55A 1SACA 4QKBA 1CAUB 1JU3A 3LPFA 2BBVA 5T3NA 2D5HA 1EAH1 3KCXA 3T09A 1DDLA 2DU1A 2YPDA 3FZ3A 2P3JA 5FZMA 2D3RA 2WL1A 1AR71 3HN1A 1O8PA 3WP5A 2Y26A 2RMU3 5FP7A 3TRSB 3CEWA 3RDIA 4F3JA 2J1TA 3GZEA 5FP4A 1ENQA 2BERA 1Z7S3 1JXNA 1V6OA 2PHRA 2XL7A 4MGTA 1NZCA 2C9AA 5DAQA 4CE8A 2KD7A 1QJY3 4JGZB 1NAEA 1L7QA 1Q3EA 1OA2A 5FTTC 1HRI2 4CUAA 2NMNA 3U10A 1HV1A 4R9DA 3PLQA 1S55A 1R081 3KS7A 1QJX1 3NVCA 5FR3A 3WF1A 3NKGA 2MNGA 3NRUA 1UD1A 5IVFA 2RS33 1H2MA 3ZO0B 3GNEA 2HWC3 4I30A 4RFT0 3T1LA 3WP6A 4RN5A 1MQTC 1COV1 1W8WA 2WNUC 4RSUA 4A45A 5FYYA 2JDPA 1H9PA 1ND3B 4PIYA 1W6MB 1RUNA 2W92A 3J8F2 3LCPA 1J1LA 5IVEA 3UKTA 4XUQA 1GNHA 2VGDA 1BK1A 5DUWA 4YGCA 3FHIB 2QTWB 1ZA7A 1FMD2 4HPKA 2Z4FA 1E5SA 2E9QA 1US2A 2QQVA 2JG9A 4PIXA 1U0AA 4YGBA 3VBHC 1GZWA 1LJ7A 2CWSA 5FUPA 2R072 3D8CA 4NHKA 2C1FA 4E2GA 4X8NA 3SH5A 3IDBB 1TZOA 4AI1A 1AR62 2VAUA 1H2LA 2ZHKA 1AX1A 2OYZA 4AI8A 5AVPA 3J26N 2VL4A 4AI3A 1WBFA 3PURA 1XNDA 3K2OA 2XBO1 3K4AA 4F8AA 4AVSA 1UPSA 3USUB 4QWNA 2Q1MA 2OS2A 1RHI3 3RZGA 2JWPA 2BFUL 3D0JA 1RUF1 3SEEA 2XOMA 3LA7A 3U37A 3I3BA 4QPGA 5BNOB 4P9WA 4PBOA 3VKMA 4FOQA 3DF0A 4YW1A 1SG3A 1YQ8A 4OLLA 5LY2A 2ZMNA 1YQCA 4BISA 2K2SA 2WYFA 4IESA 4ZU5A 3VD9A 1CZSA 4IEQA 2AACA 4BQYA 5JPMB 3WF3A 1YNAA 1DYOA 1Q5OA 3ABZA 5JI7A 1GOFA 1RMU1 3SH4A 4AFDA 5FK8A 2VC9A 1RTVA 4FI9A 3IIIA 3UGGA 2Q0AA 3VD3A 2FMYA 2ZBJA 4DO0A 1AR82 2AEYA 4YW5A 5FMBA 3RVHA 2JG9C 5FYMA 5A7SA 5EZWA 3ITQA 4FCAA 4BU2A 4OUMA 1H6YA 1UW8A 1GNYA 1UYYA 2YGMA 4DXSA 5I93A 1VLNA 1XB9A 1ONAA 3E97A 3KQRA 3U0ZA 2R041 2WIIB 3T3YA 2ZHMA 3PMSA 3D4KA 4LO6B 2YU2A 2VBBA 3MI8A 4L0PA 1GQHA 1W9TA 2DVBA 4HSLA 4R8HA 1H1AA 1ASJ3 4XCBA 4XDPA 3WDTA 4Z2AA 4BQXA 3OPTA 4NR1A 2YGLA 3U1XA 2QDRA 4Z92B 5GZEA 5IVBA 3ZSJA 1DYKA 2VBDA 3WLUA 4CRQA 4QPGC 1HRV3 4LNVA 4CCCA 1DCSA 1PK6A 2P3IA 4RR3A 4XE9A 2JE8A 4DXRA 3PU3A 5F8PA 3DXUA 1LOCA 4Q27A 1FYUA 4UYBA 3K46A 3GF6A 3ZYGA 1NXMA 1ODMA 3J4UH 3O0XA 4WVMA 1V6NA 4XUPA 5FLHA 3O1MA 3W21A 1KS4A 1BLZA 2W47A 1W06A 2BGPA 3B00A 4XF1A 3WD5A 4IW3A 3N36A 4OI0A 4AI9A 4QHBA 4DMIA 2BP6A 2JDUA 4Y20B 4FPYA 5SV5A 4HMZA 4AE2A 4JTNA 3KV6A 4WM8B 4A42A 4DZGA 2JG9B 4UAPA 5EYYA 3PHMA 1GZWB 2WQ4A 3DCQA 4UF0B 2BUKA 3BPZA 3FE5A 1UKGA 3WOGA 1YFYA 1C1LA 3ZXGA 1PIV1 5GM0A 3I2GA 2EIGA 3JB4C 1LHOA 1CAWA 1JW6A 2JECA 3E6DA 2TEPA 4CDXA 3OTFA 1PGSA 2WZR3 1RUC3 3M3IA 4QPIA 3VL9A 3OGRA 4IL7A 1MS3A 1W0NA 4AEMA 3H1YA 3I8TA 4L99A 4FSJA 3UL2A 3J8F1 4W6WA 1HDKA 4KWJA 4DEVA 3MIHA 1RL3A 2ZX4A 2XDVA 2XJUA 4FPCA 1KJLA 2ID4A 3WQ1A 1PVC2 4LA3A 1DQ4A 4R9AA 4R9CA 5DABA 1V00A 4JQRA 1C8M2 1PK6C 3TEXA 4RR3C 1IQAA 1JOPA 1VBC3 1ZBE2 2WZEA 1VBA3 2PLV2 3ZYBA 2HWD1 4E2QA 3M70A 2HWB1 5A32A 1AR61 4YNIA 2YROA 1VBD3 3GCXA 3T1MA 2Q4SA 2BVBA 3DYMA 4BDVB 1AYN1 4RL7A 4MGIE 3DGTA 2PELA 2DVDA 2VCMA 2XWJB 5LBEA 1FNYA 3WNKA 2KA3A 3NNGA 3MHZA 4BB3A 5LEKA 2R0HA 1FATA 3VHNA 2B5HA 5D8AA 5EXOA 5IK5A 2XJSA 1R64A 2NYYA 4CA9A 1W6NA 5C6CA 4ZXKA 4IDZA 4QXHA 4CDXC 3RWKX 5FDBA 1ULCA 5A3PA 4RHV1 1XQNA 4QPIC 3AKQA 4MGKE 2HEWF 4DEQA 5EIYB 1LB2A 4I09A 4Z1VA 3WXPA 4HK9A 5DXDA 1QQP2 2RS53 2B45X 4SLIA 5C4WB 2GC0A 3VBSA 4AQ6A 1BYHA 3RYPA 2DCTA 3PUIA 2NM1A 1PK6B 5C3RA 3KVBA 4QGMA 1XYOA 5LRSA 4PDWA 3VDDA 3USSA 2WQZC 4H2AA 1ENSA 3MUZ1 1UYZA 2J1VA 4F83A 3VL8A 1VIWB 1WMXA 3I97A 2X5IA 4XURA 2WO3A 4R4ZA 4YGEA 3TYJA 4AFAA 1QGLA 4WV8A 2YDEA 1X9TA 3ST7A 1Q43A 2RG4A 3Q8AA 2BOJA 2IXIA 2WN3A 1H9WA 4ISQA 2QQPA 2PHWA 5IK7A 5CG8A 2R062 3PNAA 5JXGA 4OHWA 5ISLA 2VMFA 1GR3A 3BYWA 3KV4A 3QACA 2BEOA 4AW7A 1L3JA 3MYXA 2Q8EA 5L36A 4GMP3 5DZGA 4XMAA 3WW1A 5D8AC 4JDMA 2VECA 2WZ8A 2W1UA 2X8KA 2E63A 3NJYA 4Y3OA 3U4SA 2PN5A 4QPWA 4Q26A 3FLPA 3RNSA 3R4SA 5J7MA 2A73B 1EV13 5JMOA 4N8MA 3WINE 1TME2 2ARBA 3OY8B 1OC1A 2WFF2 5HXVA 1GWKA 1JN2P 1VALA 1YWKA 1OUXA 4QXCA 1PX3A 4UWDA 1QKQA 4IGQA 2A3YA 3VBSC 3FX3A 3DKWA 2G9FA 1HN0A 4Q4X1 3SXWA 3UV9A 1JZ7A 1B35A 3VBFA 1RVF1 1F31A 3E5QA 4PDWC 3N7JA 4Z07A 3VDDC 1VBE2 2W52A 4OI1A 3CL1A 2JDYA 2EXHA 2NP0A 4CP9A 1ZRDA 3AZVA 1MEC2 1UU4A 4H7MA 5IK4A 2X5IC 1MVQA 5GLZA 1GU3A 1AYM2 1H8TA 1UWWA 2QQWA 4XFIA 4JKLA 1WGPA 3AM2A 1H4GA 2OA2A 4FPOB 3AX4A 3RZLA 4TXWA 1ND2A 1NX9A 3I2FA 2VVFA 3IMMA 2DFBA 3I59A 1PGL2 1VAVA 1WLCA 3D6EA 4NHMA 4YW3A 3N9NA 4MGSA 1NA1B 1VBB2 4V2VA 3OPWA 3FBYA 4K6BA 2J7MA 3I49A 2Q8CA 4UW5A 1UZVA 3MIGA 4XTPA 5CISA 1LENA 1BZWA 3VBRA 1E5IA 1PHMA 1YLLA 3AKPA 2WKKA 1C57A 5L9VA 2VTXA 3B01A 3GDBA 1X9PA 4W8JA 4QX3A 3SNMA 3MBWA 2BRTA 3IWZA 5I8SA 3SHRA 3MIDA 3DEMA 2YG0A 3HBKA 4COVA 1IG0A 1OD5A 1UOFA 4XABA 4TWTA 3AP5A 2E26A 3FC0A 2WT1A 3RRDA 1B35C 1POV1 2NZ9A 3HN3A 3M7AA 5DAVA 4PDWB 1PZ9A 5AVAA 3VBFC 1AR91 3VDDB 4QX2A 4FXGB 2OZJA 3WZ1A 3BCWA 2QJVA 3H9AA 5ERLA 4AQSA 1V6LA 2Q8DA 2X5IB 2OXBA 4S2FA 3LPGA 1FPN2 4HKWA 2E53A 1H8TC 2W1WA 5DDJ2 4V2WA 4ZHNA 1ND2C 5FPZA 4GB32 3I2JA 1BBT3 2HEVF 3ZFFA 4IEUA 2MEV1 1WA6X 1OH4A 4CP1A 5AC93 4KWKA 3KV5A 5K9YA 2QQKA 5JMCA 3AKTA 5JVVA 4RQPA 2WLPA 2Y33A 5GZDA 2OIIA 1PMJX 5H9PA 1Q8VA 3RS6A 2KR2A 2D44A 3VBRC 1FAYA 4P5YA 4PCRA 2QQJA 1R1A1 2RDQA 1RUI1 5GLTA 2XL9A 4YW7A 4EZHA 1F4AA 1R092 2DDUA 3HNMA 1ZZ7A 1ZRIA 5SV8A 1XPWA 3KV9A 5ABJA 2HBTA 1FNZA 4Q0SA 5K4LA 4AXOA 4ZZ5A 1IG3A 2R061 4QQLA 1SFPA 1PNGA 2O0OA 3OGJA 4QXBA 2IVJA 2V5DA 2MPFA 1X8MA 2VO5A 3HVDA 3N4MA 2VCAA 5JWPA 1CJDA 3VLBB 4IEVA 4XTMA 4I01A 4QT6A 5FY8A 1SEFA 2GNDA 3T2TA 4PHZA 2VM9A 1ZREA 3ZMOA 2J42A 5E6HA 1HXS3 3BI3A 4FQZA 4O61A 2P1BA 1WCQA 3IDAA 3T0DA 1JBCA 2RDNA 3ZFFC 4QQ2A 1VJ2A 2XLGA 1Z7S1 5IJRA 4MYEA 2W87A 1PO11 1XU2A 5C9AA 3ROUA 3RG0A 4RQPC 1QJY1 4OUEA 1UXZA 1ZRRA 4R4XA 3AMPA 1C28A 2YUEA 3AXEA 5C8CB 5B4XA 1UZYA 4LOSA 5JIUA 1G86A 1H4HA 2HWF2 3IBMA 1NLRA 5FYVA 3THTA 4IV1B 1AYM1 4AGGA 4DRVA 5FOBB 3AVRA 3NNFA 4HONA 2J1EA 4H14A 1BVVA 2W5FA 4I3GA 2WNVB 5ABJC 4XF4A 4BM8A 5DZFA 2CTVA 3WHUA 4M0HA 3NQHA 2C5DA 4GWMA 4XETA 5FYSA 1RB8G 3MPPG 4MXWA 1XE0A 4R9BA 2HYKA 2VXJA 4Y1YA 2GU9A 3T2OA 3K4ZA 1CVNA 2BOIA 4FXKB 1YO8A 4P00B 4XFFA 5FZAA 3SMHA 2BGCA 3ZDSA 3OOXA 1QOOA 2Z2SB 4XVHA 4YG3A 2DCKA 4BPZA 5DMYA 5CU1A 4K3UA 1PZ7A 2LALA 4I3PA 3RYRA 2WR9A 2Y38A 1DIWA 1TMF2 2D93A 2ORXA 5BNPB 2JDKA 4LOTA 2RR12 1M4WA 2VNVA 4C0HA 4XJZA 4QU1A 2Z79A 1RHI1 5C9AC 5FJHA 4A3ZA 5BUVA 1N1SA 3C8XA 4Y33A 3TN91 3MIEA 5GZFA 1DGLA 3WP3A 4ASMB 4MGQA 1YXWA 1NUKA 4Q4Y3 4QB1A 2FMDA 1RUH3 4RS5A 2R30A 3LIHA 3KLSA 4LHNA 4IV3B 1RXGA 4LJHA 5FZOA 3WG3A 4XFGA 3RGBA 1YJKA 5J98B 3E1F1 3PVNA 4MHRA 2DWRA 3ECQA 2RJ2A 2VCBA 3R6SA 3J7HA 4XF9A 5FZ8A 4MH0E 1AJKA 3EXUA 4MHUA 4CDWA 1BMV1 3ZIWA 4UFLA 4YW4A 4XQWA 1CD3G 1ZBA3 1JOJA 5FZ0A 1QF3A 3L2HA 2V73A 3T0AA 2XJRA 4UW6A 4YARA 2VMDA 1W28A 2PQQA 3VZKA 1J83A 4CXXA 3I7DA 3KCYA 2B7YA 5IFTA 1QOSA 1UN1A 3Q8EA 2EXKA 4HN0A 4LO5B 2D3PA 2C4XA 4FAHA 1RINA 5CADA 4KNCA 4OHVA 3H0OA 4PI2A 3U4XA 1SLAA 3ETQA 2W46A 3LD8A 3D5OA 3O1OA 1MZEA 1DGRN 4HVRA 1FOD1 1Z0HA 3EBRA 2TUNA 4DUWA 5GLWA 5FMOS 3WNPA 2YMZA 3ZPOA 5C9AB 2A6VA 2GSYA 4N53B 4AGVA 1YFUA 2BBAA 5LA0A 5D2AA 2VUAA 5DZEA 2YU1A 3AKSA 1Q8QA 4XC9A 1LRHA 1X50A 4RS5C 3K77A 3POYA 4FFHA 5GALA 5J1XA 3URFA 4LO4B 4C1WA 2JDNA 4AI0A 4L97A 4LO7A 1O3QA 1F8VA 5FBJA 1KFUL 2D5FA 3ZFGA 1EAH2 4E4ZA 5KHKA 4CEWB 2OUJA 1CQ9A 3AZWA 2YBSA 4CDWC 1AR72 5H9SA 1Y3TA 1CZVA 2UY8A 3MF9A 4MXWB 3TB0A 3R4DB 4CZSA 5K7PA 5FPAA 2WWSA 3BALA 1N1TA 4AQ2A 4EN9B 5CEHA 1O3RA 3INAA 3ZX7A 1NY72 5FZ6A 3VKNA 3TAYA 2XUEA 2R6QA 1QDOA 1KQRA 1RUG3 2VVDA 2VTFA 2Y64A 1S0BA 4O7XA 4CUCA 1OLRA 3PIGA 4NRMA 5C71A 1RUOA 2OUHA 1O4ZA 4ORFA 1REFA 4V1PA 1R082 1QJX2 4M0NA 3UJQA 3KQ4B 4GXLA 2D7FA 2P2KA 3E6BA 1RUC1 4QDSA 2QQLA 4DFSA 5IYYA 5JUVA 5J37A 5CG9A 1D4M3 1CAUA 3OSDA 4W50A 4JKMA 3VB9A 3PTYA 3Q8BA 1IS4A 3VBUB 1IKPA 3IMNA 2X53S 3QOPA 4GH4B 4W6XA 5EYXA 3LEMA 1ULGA 3W20A 2R16A 4LHKA 1URXA 2YC2A 5F2SA 3M4FA 5FY5A 4GA9A 4RS5B 1RXFA 1VBC1 1RYYA 5EP9A 2YV8A 5K0UB 1CX4A 1XSQA 4JGZA 4YM1A 3W59A 3RI8A 1JYVA 3BTZA 1A3KA 1DGRA 1GQPA 1XE7A 2VZOA 3POGA 3VKOA 4LBMA 3ZSKA 4DS0A 3ZFGC 1A8DA 1VBD1 2VNGA 3H3ZA 4CDWB 3FHQA 1YC61 5A7NA 4YPJA 2PHUA 2UY9A 2XUMA 1HV0A 3MLJA 2XBO2 1WA4A 2WO2A 1ND3A 2GMMA 3OD0A 4IEWA 2WINB 1F2NA 3HT2A 1RUF2 1LOEA 2ZGKA 2B8MA 1PVC3 4OZXA 2G1MA 4A7ZA 1SLIA 1W8UA 2A3WA 1V9U3 5I8YA 1ZBE3 3SEPA 3ACGA 4NROA 1PM7A 3NJXA 1WCDJ 2ZEZA 3MPBA 3MF6A 5CFDA 2VJXA 3LB9A 1W2AX 3H7YA 1POV0 2CV6A 5IVYA 4CCOA 3T08A 3KM5A 1S0EA 1I9RA 1Q8SA 2IXKA 3LF7A 5JR7B 1OUSA 1S4CA 3K75B 4MX3A 5JIAA 4XFHA 3VBOA 3L2YA 2GH8A 4C0BA 3JCIA 3SCHA 5I0DA 1NYWA 2IXJA 4S2GA 2UURA 1VE0A 4QGNA 4FP3A 3PMEA 5BY5A 4JGZC 4QDRA 1JZ8A 3M3OA 2VMGA 3EYPA 2G19A 2ARXA 4AVAA 4DNYA 5BNOA 2VG9A 1W9FA 3DUIA 3ZFGB 1SLLA 2VZVA 2W95A 5ACA3 3T2PA 3WDYA 3POIA 2X29A 3I2DA 2R042 4OHYA 3BTXA 1LGCA 1UU5A 3JQXA 3MW4A 1OSGA 2ZGLA 2Y0IA 1ND3C 1OKOA 3WSOA 4BIFA 1H2KA 1KJRA 1F5FA 5F32A 5CKMA 1PGW1 1QJU1 5HCFA 4A6OA 3NNLA 4BQ2A 2GC1A 4MVTA 1DGWX 5BPXA 1SLBA 3CKHA 4TN7A 3ZPYA 1KRIA 1HQLA 1RUJ1 5JSRA 3RMYA 3O1UA 3OBZA 3GBGA 4LTAA 3RZZA 5CFDC 1RUE1 2JD9A 4NIDA 4GALA 4XQDA 3BKZA 4IXLA 2SLIA 1D4VB 3VZNA 1CAXA 5E16A 1WW7A 1YIFA 3AMMA 3ZSLA 4QDQA 3HWJA 1F5JA 5KHJA 4P9YA 3VBOC 1AL23 1TNFA 5C5UA 3CF6E 3BODA 1CESA 1S0DA 4A6SA 4MG2A 3O1PA 2W08A 1NY71 3AYEA 3MV01 4FTEA 1UIJA 2UU8A 2WNEA 1N3PA 4MO3M 4QHOA 3DKQA 1UPIA 5CB7A 3VD7A 1DU3D 4CCEA 3WEZA 5C3QA 5BNOC 2GNBA 2KM2A 5EFUA 1PIV2 1UL9A 4QKFA 4JGYA 2HYXA 1E5HA 1TME3 5C5TA 3KMHA 1B09A 2WFF3 2WO7A 4KH9A 4TLGA 5HCBA 4EN7B 2WBKA 3MFAA 4M00A 1OQEA 1UZ0A 3AFGA 4IEOA 3DN7A 4KG0A 3ZXEA 3HT1A 3POWA 4IE5A 4Y20A 5CKNA 2PFWA 3H1WA 4BQ5A 4Z8BA 5FMDA 1OA3A 3S0MA 4YW6A 1Z78A 4LIVA 4WM8A 5KHHA 1XC6A 2ET7A 2HEYF 2IXLA 4J6GA 3OJBA 1MEC3 1H6XA 2H0BA 4UF0A 3LA2A 5CFDB 1JZ2A 5JOZA 3I2KA 1W8OA 4TTGA 2HWD2 2R32A 1E5RA 1DGWA 2HWB2 4P9XA 2PHDA 4X8PA 5FMOL 4YM3A 2WZPP 1NG0A 5F3EA 1OH3A 1AYN2 2WC2A 2ZX3A 4LBLA 2BTVC 3VBOB 3ZKYA 5FZ3A 1W2TA 5EJ3A 2B46X 2ZCWA
chains in the Genus database with same CATH topology
2PAMA 4MSVA 1VBB3 4YVSB 4JC1A 2VMHA 1ZRCA 3BTAA 1X82A 2QFEA 1LEMA 2VMIA 4ONUA 3VHPA 3SCFA 4I02A 5J3UA 1G9FA 2AYHA 1J3QA 3AMQA 1NCRA 2ZX0A 3N35A 4JGYC 5JOWA 4U2AA 4YZ2A 4RHV2 1U5XA 2OW4A 3VKFC 1NE4A 3SISA 3V64A 2F6BA 4JAAA 1PNFA 5JI9A 3FUQA 4WM8C 2FHRA 2PHLA 4EJRA 2XJQA 4OFGA 4XFBA 1G9AA 1FPN3 3GZUC 3EHKA 1WD3A 3JBG3 4K20A 1CAXB 1QXRA 4YVWA 4NHLA 4XJAA 4GULA 3KGLA 4GB33 4XIKA 3FFZA 4YZ5A 4IEXA 2OZ6A 5C4WA 2YPJA 2D6OX 4GKXA 2WSVA 3WR0A 2DTYA 5FQ0A 3MZHA 1W6QB 2ZHLA 4JGYB 1NCRC 2E51A 1IKQA 4MLOA 4BQ1A 2E7AA 3GALA 4YGDA 2ZX2A 1G7YA 2VOKA 4CDQA 1D0GA 2DURA 4EWEA 4QQOA 5FAXA 4Q4X2 5K8SA 1RVF2 5IT6A 4F7ZA 4D94A 4L9BA 1V6KA 3HMYA 5KXBA 1LOAA 1C5HA 3MGUA 2DFCA 1H1MA 1OOPB 1UMZA 4YVWC 4OHZA 4BE3A 3OPZA 1BCXA 2ZS6B 3D0SA 5KXDA 3OY8A 3JD73 5E88A 4RA0A 4JRLA 4XBQA 1AL0G 1SFNA 5C4WC 2XB6C 4AG4A 1YI7A 4ZU4A 2ZAAA 3CNAA 4M3CF 4CP0A 3FLTA 3CU7A 1NCRB 4K7JA 4QU2A 5F1RA 2JEMA 1WW4A 1QMJA 1VRH1 3IN9A 3H1MA 2O1QA 3U11A 3M3EA 1JTZX 4CDQC 3BB6A 4EROA 3RJ2X 1KDKA 1JHNA 2I45A 1FX5A 1NQJA 5JOYA 1LOGA 1NA1A 1AR92 3LKJA 4AI2A 4EWAA 4Q4Y1 5CNAA 4A2UA 1RUH1 2I2SA 1QXPA 1QNWA 3A0KA 3JZVA 4YVWB 2FBEA 3SLIA 1LKNA 2IZWA 3PVOA 3FUOA 1LULA 1TMF3 1HLCA 1D2QA 4Q4W3 4Y5Z0 4KL1A 4BHPA 1CJPA 2ZGPA 4Q8LA 1VB4A 5KBFA 1G6NA 1ZBA1 3WQ0A 2B42B 2GC3A 1OI6A 2MEV2 3VN4A 4E2SA 5JZGB 1FXZA 1VB2A 4B4PA 1FV3A 3HIFA 1EY2A 2XHKA 5FQ0B 2XVKA 3AYAA 1K5MA 1MZFA 3GBWA 5FLIA 1LOFA 3JQWA 5T5PA 3FFQA 4YFWA 2Q5TA 1NOVA 1R1A2 1RUI2 2CAUA 3ZN6B 3BOWA 4FTSA 4CDQB 1GNZA 2ILMA 4QM8A 3J9SA 2D6NA 1C4RA 4LE3A 1NA1C 1ZZCA 2CNAA 5H9QA 1WMFA 5F6KA 1S1AA 5L19A 4R52A 1AHSA 3NWKA 3V65A 4M3CA 2UWAA 3UKVA 4CYDA 1VP6A 1YYNA 3G7DA 4C1XA 5J96B 3SITA 4N43A 2RMU2 2JG8A 3R0RA 3S6PA 4B7EA 1LTEA 2GN3A 1Z7S2 1M06G 2FZ1A 4LBKA 1PO12 4Q4V3 4O9EA 1QJY2 1RUG1 2Q30A 1GV9A 1K5MC 3ZYRA 4KGQA 5EWSA 3SH3A 1LOFC 3KB5A 4YG6A 2W68A 3IT8A 4BA6A 1PO23 1W0OA 2AGSA 4K9SA 4Q2FA 3NKTA 4PJYA 3TWIA 2A71A 1D4M1 1NE6A 1DQ0A 2GMEA 4H3WA 1BEV1 5FLJA 3AYCA 1S0JA 1MACA 4AHWA 3NO8A 3PVEA 3RI9A 3THPA 1SFYA 3OBRA 2VW0A 5L73A 2AZ5A 4WM7B 2WFPA 2BWCA 4AQTA 4WVZA 3FMGA 1J58A 2D6PA 3VV1A 3NSTA 5C8CA 3FWEA 1LCLA 1R083 1QJX3 1UU6A 3ENRA 1ZRFA 1IS6A 4IV1A 4N43C 3NAPA 1LOBA 2JE9A 2JG8C 2WT0A 3AXDA 1COV3 5GLVA 3B69A 3WUDA 3AJZA 2WNVA 1RHI2 1OMIA 2PAKA 4LE4A 1K5MB 3TN92 4EN0A 1RITA 4Q0QA 4J1WA 1D0HA 1V9U1 4FAGA 2DVGA 1WCKA 4AGRA 3UK9A 1PZ8A 3IPVB 4A7YA 1C1FA 4OI2A 2JXAA 1DFQA 4FOVA 4P9IA 1ZZBA 5E8AA 3ILNA 5BNPA 1RUD1 1LEDA 1XNCA 1DZRA 3MIFA 2WS91 4B8EA 1BMV2 2XBO3 4RGGA 2VH9A 4WVWA 4IEPA 4BCUA 2YHJA 4N9HA 4Y1XA 3DV8A 3LGRA 4M3CB 5C8WA 5C8CC 4YSFA 1ZX5A 4PIZA 4XIOA 2VQAA 4N43B 2ZABA 1BKZA 3D82A 4IV3A 4IV1C 1REEA 2VQ0A 2JG8B 1DHKB 4QD2A 3NAPC 2NMOA 4QQHA 2RM21 1FOD2 2WNVC 1IGOA 1S0GA 2PYTA 3B3QE 3WG2A 2IFWA 4BZ4A 1RMU3 3AB0A 1DQ5A 4C90A 3BOPA 4BWOA 3GZAA 4X6QB 3RMXA 2RS13 5BV6A 1QNYA 5FOJB 5TSWA 3ATGA 1ZZ6A 4IEYA 5FFOC 4OHXA 4XJ9A 5BNPC 2RMU1 1AL21 4AFCA 4XPVA 2HWE3 1I3HA 1MVEA 1RIRA 4LUKA 3HR9A 4CDUA 2W0XA 4N53A 4HVOA 4IERA 3AZZA 4FO9A 4HL0A 2ZMLA 2DYCA 4XXAA 3AMNA 5GZGA 2B9UA 1CGPA 3CJXA 4YYOA 1MZ6A 4FPGA 2RS31 4IV3C 4AWDA 2HWC1 1RUC2 2WZR2 3NAPB 4LLFA 4HKLA 3WW4A 3QCWA 2KXLA 4CEWA 3H50A 1ZYBA 1NXD1 3S7IA 5CAZA 3VZMA 5BNNA 4LBQA 5C33A 3KD4A 2F4PA 4XXPA 4BLJA 3WCSA 1X7NA 3ZIXA 1VBC2 1YFWA 1HRI3 5IUQA 1U5IA 2ZZJA 1N1VA 1PIV3 5CBLA 1VBD2 4FVVA 2IWGB 1O5UA 4Y1ZA 2YYOA 3GZTB 3GBFA 3J8F3 2VPVA 4CDUC 1OQDA 3VBUA 2EVXA 4YZ4A 4LA2A 4N53C 3N7KA 4MZUA 4GH4A 1APNA 1KFXL 1FMD3 2A3XA 1QWRA 1S2KA 3WV6A 5K0UA 5IK8A 1Y9QA 1OHFA 2D40A 2R073 4NVPA 4ZKTB 2GALA 4QX5A 1KD7A 3ZXDA 2ZPXA 2HWB3 1GYKA 1AR63 5CFCA 1W6OB 4W65A 2C0ZA 4CEWC 1VAKA 4XOGA 5JSOA 5FRAA 4QQPA 4COWA 3CLPA 5BNNC 2BNMA 2D6LX 4KBBA 4W6YA 5KC6A 3ALQA 1WLTA 3QD6A 4ISRA 4AVVA 3M1HA 2CGNA 2UYBA 2WA4A 4D3WA 5GLUA 4XHBA 4BYYA 4LBOA 3G6JB 5B2GB 4FPEA 4RHV3 1TEIA 1J1TA 1ASJ1 1DQ6A 1VR3A 4CDUB 1JYIA 3VBUC 1H30A 2Z5WA 4GH4C 2K0GA 1ZNPA 2YC0A 1HRV1 1PGW2 1QJU2 4WZCA 4GWNA 1AR83 4HK8A 1S2BA 1I1EA 5K0UC 1MR5A 1MS5A 1QH7A 3VHRA 1RUJ2 4MGZE 2E6VA 1GSLA 5GZCA 1MS4A 2ZGRA 1RUE2 5CFCC 2BYVE 4S2HA 2O8QA 2BWAA 4Y1VA 1WBLA 1N1YA 2DTWA 2Y0OA 5BNNB 2I07B 1Q8PA 2JJ6A 4LBQB 3RWNA 4PLNA 1GZ9A 1Y43B 1CIWA 2EALA 3RQ0A 3ZXAC 1ULDA 2BFUS 1JUIA 5JOXA 5BNQA 4NWWA 1GFF2 3WDXA 1WLWA 2WZR1 3MDPA 1KITA 1PVXA 2SBAA 1C8NA 3O14A 2ZKLA 3O0WA 3DPRB 4GQ7A 1SLTA 4C91A 2NPIA 3POSA 4COZA 1RVF3 2ERFA 3NV3A 1QHDA 3DL3A 1VBA1 4LEJA 2GN7A 4G3YC 5JAXA 2BPA2 2VNRA 4DOUA 2QKDA 2A70A 5CFCB 4EN8B 1WMDA 4URTA 1ULFA 1FI2A 2IXHA 1OPOA 5L7OB 3AP6A 3B9CA 2P34A 1MS8A 1SMVA 2Q8OA 4YLZA 1C8M3 1ZZ8A 2DVAA 4OVEA 2PLV3 5FPXA 4Q4W1 1BXHA 1O3SA 1X8EA 4P14A 1KS5A 2RS51 1BBT2 1I5ZA 1HX6A 4D7TA 3IM0A 2ZGSA 4PLOA 1POV3 4AEDA 1CR7A 3ZO0B 1AR93 4RD7A 4YVSA 3N3HA 2D97A 3AP9A 5T52A 3KGZA 1DZTA 1CN1A 4FPFA 4S2DA 4WZFA 2BNOA 4ES9A 1VAMA 3W58A 1IZ3A 5EV7A 4HETA 1V6IA 4Q1PA 1RGSA 3MIBA 4LUMA 1QQP3 4K1ZA 4QGLA 3ELNA 5J36A 1GANA 3KZ4C 1GBGA 4LBQD 2XVGA 2JKBA 1IPJA 4JCKA 1O5LA 4GMP1 5JDBA 2P17A 1QH6A 4YFZA 4LO8A 4ITCA 4QM9A 3JUUA 2A6YA 4LLOA 2K9ZA 4XILA 1EV11 4K8FA 5GKAC 4JVAA 2DV9A 2EAAA 1R1A3 1HXS2 1RUI3 3E5XA 2ZGNA 3EO6A 1J59A 4FPLA 2JX9A 2R063 4Q4V1 3ZXLA 4Z2WA 1A78A 4COUA 4AEDC 2QVSB 3ZSEA 4YVSC 1UZZA 2QZ2A 5BXXA 3EQEA 3IIAA 1PO21 2XH6A 4AHXA 1H8VA 4XF3A 2AUYA 1W6QA 2P3KA 2ZOEB 3ILFA 4JTOA 1UCXA 4D69A 3WCRA 1GZCA 2DU0A 4NO4A 2XKPA 3LOIA 2EF6A 2BNNA 2XWBB 2LM3A 1PO13 4KQ7A 4H55A 1H2NA 2DCYA 3V0BB 3A0NA 1LU2A 3K48A 1LHNA 4HBNA 4KGGA 1VBE3 2Z69A 5DUXA 4B7KA 1O3TA 5FO9B 2EXIA 1LODA 1OFSA 2DCZA 1AYM3 1VRH2 3ASIA 1N3QA 1SBDA 1S0FA 3CO2A 4N90A 1ZM1A 3ZN4A 1OOPA 1GICA 3WT3A 3ZFEB 1Q8OA 1ZVFA 4Y26A 3AKRA 4CTEA 2ZKNA 1ENRA 2IFRA 3ZVXA 4AEDB 4FOYA 4HZFA 4L92A 5FCCA 4E27A 2A6XA 3AFKA 2CGPA 4G4FA 1IS5A 4Q4Y2 1RUH2 2UWCA 4XF0A 4N7UA 4HANA 3H3UA 1EP0A 2ZA9A 5JCTA 2EXJA 4KU8A 3NV2A 5I8TA 3SCGA 1BBT1 2GNTA 4K21A 1UF2C 1NQDA 1ZBA2 5AC91 1SQ4A 4YZ3A 3HBZA 1FV2A 3TN93 4FTBA 1W0PA 1GQGA 2AENA 4FP2A 3V56A 2DUOA 4Q0PA 3QH7A 3BU7A 1X36A 1XYNA 5DDJ3 1WCSA 1MQTB 2WNUB 1OOPC 4SBVA 4YG0A 2VOVA 4XBNA 5A33B 1C3HA 4OUSA 2ZGMA 5JZGA 2ZACA 2RS11 1XE8A 3VBHB 4META 2R1BA 4JRAA 2PAEA 2ZX1A 4UW4A 1DG6A 3MW2A 1X33A 1HXS1 2A5ZA 2D6KA 5AFEA 1R093 4BOWA 3ZN6A 1MS0A 1FOD3 2HWE1 1T6GC 3MLKA 2D3SA 2E7TA 2VVEA 4UW3A 4DRRA 4P9LA 1RUG2 2R0FA 3A4UA 4QXKA 2CWMA 2GAUA 1LECA 1IPKA 1D4M2 2HJIA 3O12A 2DF7A 1BEV2 3M2MA 1J3RA 1H1IA 4O9GA 4DXZA 5T5LA 4E4SA 4M01A 4HPKB 2XGXA 4DB5A 5JZGC 2IXCA 3W9AA 3ZMNA 4L2NA 2VW2A 1TQ5A 1ENXA 3FBMA 1HRI1 4B3NA 3PJYA 1TE1B 1ZA4A 2FQPA 3NV4A 3QLQA 5FBZA 2HWF3 4B29A 2RJKA 2YY1A 3B5LB 3ZN5A 1JYCA 3PVBB 1O7FA 4DY3A 3WNXA 3Q9OA 1QOTA 4AHYA 4MXVA 2NQYA 4XEZA 4FT8A 4AYUA 4QPGB 5KXEA 1FMD1 3HAGA 1TNRA 2PHFA 4WM7A 3AYDA 1V9U2 2VULA 1V6JA 2QE3A 2QZ3A 2R071 3B93A 2IC1A 5JSPA 1IHMA 4P5HA 2G9GA 3AJYA 1GKBA 4AHZA 4NN0A 2RR13 4HT1T 1RUD2 3UJOA 1DLLA 1SBEA 1KDMA 2A75A 4IETA 1WD4A 2WS92 1CONA 2OVUA 1WW6A 4FPJA 2RJLA 4COYA 4OI4A 2ZGTA 4Y22A 2AREA 2QDNA 1OKQA 4XYXA 4YRDA 3IPVA 3WVJA 1JH5A 4M3CE 5ACA2 2CYFA 5DG1A 1EPZA 1O91A 1HIXA 2RM22 1S0CA 5LK7B 1LHWA 1W39A 1BJQA 4RR3B 3ZSMA 4WM7C 1AR81 1YFXA 5CIRA 3UKNA 1DYPA 4TLFA 3ZXKA 4L11A 4UBHA 4WVMB 5FO7B 3ZYPA 2QCSB 1C5IA 4XW3A 5I0TA 2JE7A 4GMP0 3WW3A 1AL22 1R1ZA 1HQNA 4TZDA 5F6LB 3EJKA 3L9JT 1WLDA 4WBBA 3VZJA 1QJU3 1LESA 2GNMA 3B7MA 2ENRA 2WA3A 1QY4A 4P9JA 1CAWB 2YXSA 4CDXB 3AZXA 1RUJ3 3KT1A 4QPIB 1G9DA 4HSJA 2RS32 4BMEA 1FT9A 1Y7BA 1RUE3 2HWC2 1EAH3 3LOBA 5LEJA 2DUQA 3IDEA 2A6ZA 3R4UA 4CEYA 2GC2A 3B9IA 4GIQA 1AR73 4JDOA 4U36A 1E57A 4AFBA 1OQ1A 3WP4A 3LA3A 1XNKA 1G9BA 4FBFA 2XJTA 3AZYA 1CAVA 3JU9A 5A32B 2WT2A 2VY0A 3KT7A 3H7JA 4LBNA 3JB8A 1XXNA 1J3PA 4EN6B 2R49A 3WW2A 3V0AA 1RJ7A 3O0VA 2DVFA 4YZ1A 1PVC1 2D98A 5D8AB 1NCQA 3GHNA 3ES4A 1C8M1 4Y22B 2VW1A 4Q8KA 1W6NB 1ZBE1 4K1YA 2Q1ZB 4AEKA 2PLV1 4TSVA 3S7EA 4AVBA 3X29B 3E5UA 3H8UA 3RJRA 5GJ6A 4IEZA 3C3VA 1SBFA 2CL2A 4PQ9A 4HVQA 1LGNA 4CEYC 5FO8B 3GYDA 1G9CA 3WG4A 3VGIA 3LSEA 3VBSB 4ZU7A 4IQPA 2ZZQA 4E4DX 5LK5A 3AK0A 2CGOA 1RUF3 4ATEA 5DG2A 3ACLA 3RSJA 4DINB 2NLRA 2TBVA 1YHFA 3OD4A 1OPMA 1LHVA 4K40A 2XKOA 2TNFA 1UX6A 5ACA1 1HW5A 3JBG2 4FPHA 1DQ2A 2AH2A 3OBTA 1EPWA 4XZPA 4CP2A 2PA7A 1QQP1 5JPNB 1ASJ2 3IDCB 1W6OA 1U12A 2YZ4A 4DPNA 2O8OA 1U5ZA 1MZ5A 4Q1RA 1NCQC 1HRV2 1MS9A 5KWRA 5I0RA 2JD4A 3ILRA 4XDQA 4KG8A 2Z42A 3VZLA 4PF5A 4AVTA 2RE9A 3AP7A 4CEYB 1JUHA 2EA7A 2R043 4LULA 4X6RB 4Y4YA 3MW3A 3ZXFA 3LSDA 1B35B 3FJSA 5T5JA 3VBFB 1YUDA 3GHMA 1QDCA 2WSUA 3ZYIB 3I54A 2QUOA 1HQWA 3WDVA 3HQXA 4JV4A 2D43A 3MEPA 1SCRA 1ULEA 3LWCA 4P9GA 1CAVB 3P3PA 1H8TB 3KSCA 2GDFA 1WUVA 2VU9A 1XYPA 1TME1 2VXRA 1ND2B 3HD8B 5F9TA 3TNQA 2WFF1 1G8WA 2UWBA 2ZGOA 3V0AB 3I59B 4FPKA 5I91A 3JD72 3MICA 2DUPA 4BMBA 3ZXJA 4A7KA 3NL1A 3IKWA 3VUOA 1BVP1 2MHFA 4XBLA 2HKXA 1NCQB 2A7AA 2FZ2A 1DBNA 2PTMA 1VBE1 4ASLA 4E9KA 3VBRB 5HCAA 1RC6A 2V09A 3WY6A 1VBA2 4ES8A 1A6CA 1MEC1 1UKRA 3BIWE 1YI9A 5E1RA 4AVCA 5HI0A 2A6WA 5E89A 2XPJA 2R1DA 4TYSA 4NOTA 4BLIA 1AUYA 3LZZA 5KHGA 3OCPA 1PGL1 4LT5A 2JENA 1VBB1 2BVVA 3OYWA 4GKYA 4HFSA 3DPRA 2H0VA 4LBJA 1XRUA 5F5QA 4J1XA 2ZJCA 2P37A 2BW8A 4G9SB 5CVRA 3OF1A 1EYBA 4PBPA 4XQ4A 5A3MA 1Q56A 1PMIA 1D2SA 1F9KA 2XLFA 4Q4W2 1VRH3 2HWD3 5BYNA 3ZFFB 1AXZA 1AYN3 4DY5A 2RS52 5J09A 4H7LA 4ATFA 1W2UA 4RQPB 5JLVA 4QMAA 1S0IA 2GZWA 5L7OA 4JDNA 4D7YA 2XJVA 1XNBA 1ZZ9A 4LR4A 2I74A 1WW5A 3CJIA 3RYKA 5AFBA 1V70A 1FPN1 4AFMA 3O7OA 4Y24A 1NLSA 1V6MA 3JBG1 1UAIA 4DQAA 5DDJ1 2BQPA 3P3NA 2XG3A 5ABJB 1SCSA 1AVBA 1UIKA 1CPNA 3B94A 5KC5A 2ZHNA 3TBDA 2CAVA 1SDWA 4GB31 4I0BA 1DF0A 3NJZA 4YW2A 3WHTA 1LHUA 3ES1A 3VZOA 3QBQA 3DPRC 4KU7A 4D7SA 1IS3A 2DCJA 3KCCA 1DZQA 1W6PA 3TNPB 2QNKA 5CA6A 3KT4A 1LU1A 4LHLA 1EV12 1AX2A 2NN8A 1A8MA 1R091 1RJ8A 2ES3A 2ETEA 3NW4A 4L8QA 3WDWA 2PHTA 2XVLA 1O4TA 1O4YA 4Q4V2 1BQPA 4UXAA 1GLHA 4B4RA 1H0BA 4I0AA 4WVVA 5L7OC 4I0WB 2H6BA 2AR6A 2RHPA 2EAKA 4BIOA 2VNOA 2ZGUA 3WX5A 4NWVA 3CJIC 4Q29A 3RPQA 1QU0A 1PO22 2LUWA 4PLMA 4XMIA 1CPMA 3AP4A 4XFAA 3ZYJB 4AEJA 2N7GA 2GH2A 3JD71 3MLLA 4N9IA 4MUVA 2LTNA 3OYWB 3N7MA 4FOWA 3AMHA 3C2UA 4Q4X3 4XJWA 5FREA 1AZDA 4B4QA 5H9RA 3TOJA 2XJPA 2WJSA 1OFNA 3K51A 1AX0A 1QJZA 2HWF1 1AF9A 1YIPA 4INDA 5T50A 2E7QA 2JICA 2VOWA 1N47A 2W39A 4MV2A 1BEV3 1COV2 5T5OA 1LGBA 3WUCA 2B39A 3PJQA 4HKOA 2UYAA 3M3CA 1MS1A 1QXJA 5KHIA 4BH9A 3WG1A 2PHXA 4XHXA 3CJIB 2H6CA 3V0BA 4XJUA 4A3XA 2V5YA 4QPYA 2ZAHA 1WMEA 2WLQA 3WDUA 1TMF1 3LAGA 2ATFA 4Y1UA 4FQ4A 1HKDA 2RR11 1LR5A 4OULA 1IOAA 4KWLA 3VHOA 2G4IA 4I2OA 1DQ1A 3ZFEA 1AXYA 2JDZA 2ZTNA 1XU1A 1YCIA 3M8LA 4MGYE 4AF9A 5AC92 5LRRA 1AJOA 1W6MA 3S30A 1W6PB 1YJLA 2ZGQA 3E6CC 4YM2A 3MFCA 5T54A 4XJ8A 2VUJA 3ME2A 1U5YA 4Q0UA 4Z82A 4YM0A 2XLAA 3OGGA 5I0SA 1REDA 1YRZA 1RUD3 3NV1A 3VKLA 4EV0A 4XFCA 2WS93 1RMU2 2MEV3 3APBA 1N3OA 2D6MA 2CY6A 4HLTA 4HN1A 5DUVA 3USUA 1SLCA 5J48A 2RS12 2GMPA 1OA4A 4EWDA 3B02A 3O5SA 5I0UA 3FLRA 5A3LA 4NPRA 3WQ7A 1ALYA 3M3QA 5HBAA 4AK3A 1MQTA 2VOXA 2WNUA 4N7IA 1AXKA 3ZFEC 3R05A 2RM23 2HWE2 3QH6A 4UBGA 3U07A 5A33A 1I6XA 2OPKA 2ZMKA 3N7LA 4Q0VA 3I4IA 1KXGA 5DUUA 3VBHA 1OLQA 2ET1A 4RGAA 5T55A 1SACA 2BBVA 1CAUB 5T3NA 2D5HA 1EAH1 3KCXA 1DDLA 2DU1A 3FZ3A 2P3JA 2D3RA 2WL1A 1AR71 3HN1A 3WP5A 2Y26A 2RMU3 3TRSB 4F3JA 3CEWA 3RDIA 1ENQA 1Z7S3 1JXNA 1V6OA 2PHRA 2XL7A 1NZCA 2C9AA 1QJY3 4JGZB 1Q3EA 1OA2A 5FTTC 1HRI2 2NMNA 3U10A 1HV1A 4R9DA 3PLQA 1S55A 1R081 3KS7A 1QJX1 3NVCA 3NKGA 2MNGA 1UD1A 2RS33 1H2MA 3GNEA 2HWC3 4I30A 4RFT0 3T1LA 3WP6A 1MQTC 1COV1 2WNUC 4RSUA 1H9PA 1ND3B 4PIYA 1W6MB 1RUNA 3J8F2 3LCPA 1J1LA 3UKTA 1GNHA 2VGDA 1BK1A 5DUWA 4YGCA 3FHIB 1FMD2 4HPKA 2E9QA 2JG9A 4PIXA 1U0AA 4YGBA 3VBHC 1GZWA 1LJ7A 2CWSA 2R072 3D8CA 4NHKA 2C1FA 4E2GA 4X8NA 3SH5A 3IDBB 4AI1A 1AR62 1H2LA 2ZHKA 1AX1A 2OYZA 4AI8A 5AVPA 3J26N 4AI3A 1WBFA 1XNDA 2XBO1 4F8AA 4AVSA 1UPSA 3USUB 2Q1MA 1RHI3 3D0JA 2BFUL 1RUF1 3LA7A 4QPGA 5BNOB 4P9WA 4PBOA 3VKMA 4FOQA 3DF0A 4YW1A 4OLLA 2ZMNA 2K2SA 4ZU5A 4IESA 4IEQA 5JPMB 1YNAA 1Q5OA 5JI7A 1RMU1 3SH4A 4AFDA 1RTVA 2Q0AA 2FMYA 2ZBJA 1AR82 4YW5A 2JG9C 5EZWA 4FCAA 4OUMA 1UW8A 2YGMA 5I93A 1VLNA 1ONAA 3E97A 3KQRA 3U0ZA 2R041 2WIIB 2ZHMA 3PMSA 3D4KA 4LO6B 3MI8A 1GQHA 2DVBA 4HSLA 4R8HA 1H1AA 1ASJ3 3WDTA 4NR1A 2YGLA 4Z92B 2QDRA 5GZEA 3ZSJA 1DYKA 3WLUA 4CRQA 4QPGC 1HRV3 4LNVA 1PK6A 2P3IA 4RR3A 4XE9A 1LOCA 4Q27A 1FYUA 3GF6A 3ZYGA 1NXMA 3J4UH 3O0XA 4WVMA 5FLHA 1V6NA 1KS4A 3B00A 4XF1A 4OI0A 3WD5A 3N36A 4QHBA 4DMIA 4Y20B 4FPYA 5SV5A 4HMZA 4AE2A 4JTNA 4WM8B 4DZGA 2JG9B 5EYYA 3PHMA 1GZWB 2WQ4A 2BUKA 3BPZA 3FE5A 1UKGA 3WOGA 1YFYA 1C1LA 3ZXGA 1PIV1 5GM0A 3JB4C 2EIGA 1LHOA 1CAWA 1JW6A 2JECA 3E6DA 2TEPA 4CDXA 3OTFA 1PGSA 2WZR3 1RUC3 3M3IA 4QPIA 3VL9A 4IL7A 1MS3A 4AEMA 3H1YA 3I8TA 4L99A 4FSJA 3UL2A 3J8F1 4W6WA 1HDKA 4KWJA 3MIHA 1RL3A 2ZX4A 2XJUA 4FPCA 1KJLA 3WQ1A 1PVC2 4LA3A 1DQ4A 4R9AA 4R9CA 1V00A 4JQRA 1C8M2 1PK6C 4RR3C 1IQAA 1VBC3 1ZBE2 1VBA3 2PLV2 2HWD1 4E2QA 3M70A 2HWB1 5A32A 1AR61 4YNIA 2YROA 1VBD3 3T1MA 5KXCA 2Q4SA 2BVBA 1AYN1 4RL7A 4MGIE 3DGTA 2PELA 2DVDA 2XWJB 1FNYA 2KA3A 5LEKA 2R0HA 1FATA 3VHNA 2B5HA 5D8AA 5EXOA 5IK5A 2XJSA 2NYYA 1W6NA 5C6CA 4ZXKA 4CDXC 5FDBA 1ULCA 4RHV1 1XQNA 4QPIC 3AKQA 4MGKE 2HEWF 1LB2A 4I09A 4Z1VA 3WXPA 4HK9A 5DXDA 1QQP2 2RS53 2B45X 4SLIA 5C4WB 2GC0A 3VBSA 4AQ6A 1BYHA 3RYPA 2DCTA 2NM1A 1PK6B 4QGMA 1XYOA 5LRSA 4PDWA 3VDDA 3USSA 2WQZC 1ENSA 4F83A 3VL8A 1VIWB 2X5IA 3TYJA 4R4ZA 4YGEA 4AFAA 1QGLA 4WV8A 2YDEA 3ST7A 1Q43A 2IXIA 1H9WA 4ISQA 2QQPA 2PHWA 5IK7A 5CG8A 2R062 3PNAA 4OHWA 1GR3A 3QACA 2BEOA 4AW7A 1L3JA 3MYXA 5L36A 4GMP3 5DZGA 4XMAA 3WW1A 5D8AC 4JDMA 2VECA 2X8KA 2E63A 2PN5A 4Q26A 3FLPA 3RNSA 3R4SA 5J7MA 2A73B 1EV13 3WINE 1TME2 2ARBA 3OY8B 2WFF2 5HXVA 1JN2P 1VALA 1YWKA 1QKQA 2A3YA 3VBSC 3FX3A 3DKWA 2G9FA 4Q4X1 3SXWA 3UV9A 1B35A 3VBFA