4V1PA

Btn3 structure
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
188
structure length
188
Chain Sequence
RHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILTLEPTALSICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BUTYROPHILIN SUBFAMILY 3 MEMBER A1
publication title Activation of Human Gammadelta T Cells by Cytosolic Interactions of Btn3A1 with Soluble Phosphoantigens and the Cytoskeletal Adaptor Periplakin.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
A PF13765 PRY SPRY-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4v1pA00
4X8PA 5F6LB 4P9JA 2YYOA 5F6KA 5JIUA 4P9IA 5JIAA 5JI7A 4P9LA 4WVMA 4N7UA 3TOJA 2WL1A 2LM3A 3ZO0B 2IWGB 3KB5A 5C33A 4B3NA 3UV9A 4QT6A 5JI9A 4XW3A 4B8EA 4KG0A 2FBEA 2VOKA 4WVMB 4X8NA 2YUEA 4N7IA 4V1PA 2E63A
chains in the Genus database with same CATH superfamily
2OPKA 2XJQA 3QCWA 1MPXA 1GR3A 1NXMA 3PNAA 2VUCA 4XMAA 3C8XA 1ZZ9A 3K3NA 5F5IA 3WEZA 1G9DA 2Q8CA 2ZGMA 3NAPB 3RWNA 1CAVB 3TNQA 1XNDA 4C8DA 1XBFA 2AC1A 2OW4A 4BH9A 4FFGA 4RHV3 5BY5A 1Q5OA 5FZIA 1OKQA 2VBDA 4XTPA 1LOFC 2WUHA 1V6KA 3ALQA 3NNFA 5HPOA 1JYIA 5LB6A 2YBPA 4WM8B 5I0DA 2P37A 2XB6C 3AX4A 3HMYA 4XF1A 3IT8A 2PHLA 5EWSA 3GYDA 1AX1A 3ZFFB 2KR2A 2HYXA 4GJYA 2VTFA 1YXWA 5JOZA 3I8TA 4L92A 1UU4A 1WW5A 4GKXA 2Z4FA 5A70A 5JMCA 3MZHA 2JDUA 1QIQA 4DUWA 1UU5A 2O1QA 4LLOA 3S0MA 2VMEA 3NW4A 5F9TA 2G4IA 2RDNA 2PYTA 4XFGA 3OG2A 1JYTA 4GIQA 4N9IA 5A33B 1VBB1 1W05A 1VRH1 3FUOA 3OGRA 2XPJA 2FCTA 4ARYA 1XE7A 3R0RA 5DQ0A 2RJKA 4NO4A 4OUSA 4BYYA 4FBFA 2QQWA 2XJUA 4Y1ZA 1NYWA 3LOIA 5K0UB 1YQ6A 2ZABA 3JD73 2VCCA 4LBMA 4M4RA 2BNNA 4KWLA 5LK5A 2DFCA 4QXHA 3P6BA 4FQZA 4CSWA 1DZQA 1PO13 1QGLA 4UBHA 3SNMA 2IUWA 3AP4A 3TB0A 4IEZA 1ZRFA 1GZCA 1ENQA 2A7AA 2AENA 4YM1A 1OVSA 2YFUA 1E5RA 3GBFA 5JUVA 4NOTA 5A7WB 4IV3B 4MXVA 4NRMA 1OFSA 1W8OA 2HLEA 4MGKE 3BODA 1TZOA 3CU7A 2J1EA 3VD7A 5GLTA 3U11A 4B3NA 4GWJA 4CDWA 2X5IC 5JR7B 1MS8A 2ZPXA 1FPN3 1VB4A 1EUUA 2GALA 1JHJA 3MIDA 4GH4A 1KXGA 1ZREA 3VBRA 3Q8BA 3KS7A 4FAHA 3ZIXA 1RUH1 4IEVA 3DKQA 4L2NA 3FE5A 2GC0A 4O7XA 3PLQA 4FPLA 3O7OA 2PQQA 3NVCA 1GBGA 2WYSA 2EALA 3GGLA 3S30A 4JQTA 4NROA 5BNNB 4Q4X3 3AP9A 4A2UA 4IETA 2J1AA 1LHUA 4A6OA 3VBUC 1ZZ8A 2WT0A 3RWKX 4A4AA 2MEV1 5IK4A 1W28A 5A3PA 4K21A 1AR63 4KWJA 1K5JA 2KM2A 1L7RA 3N9MA 5K8SA 1UWWA 4HSLA 3ZXGA 2NN8A 3POSA 3WNLA 1QOTA 3NJZA 1DQ2A 4BQ5A 2QVSB 1CZVA 1W2OA 2X29A 2JICA 4K20A 5EV7A 5BNOC 2B45X 4ES8A 1DGWX 3MLKA 4M3CE 4IUGA 3VD4A 1DQ6A 1W9SA 2EXKA 3T1MA 1YHFA 2W5FA 3ETQA 2ET7A 2XJTA 2DCTA 2ZXQA 1SBDA 3BIWE 5EFUA 2B7YA 1UIKA 5GZDA 2XQXA 4ES9A 2WLQA 2QQNA 5H9SA 4BJ0A 1RUD3 2A3WA 2VH9A 2Y6FA 2Z69A 4Y4RA 4QPIA 2VOXA 4XZUG 1CPNA 1NUKA 2WQ8A 4YZ4A 4CU7A 2XJSA 1PM7A 5DDJ3 3CJIA 3WG3A 2WS93 1Y43B 3SCGA 2Y0IA 2VZQA 4Y22B 5FZBA 5IWFA 3J8F1 2EAKA 2WO7A 3KF5A 5FMDA 4BISA 5HBAA 2V5YA 2GH8A 4GMP0 3LEGA 4YW5A 3WDYA 2XR4A 2HWD2 5A7SA 2E31A 4Q4Y1 3JXSA 2DVGA 2YROA 5HCFA 4OMDA 5HI0A 4R9CA 1Y9MA 1Y9QA 1WMFA 2JG9B 2NP0A 1RUG3 4C0BA 2BEOA 5KHIA 4EJRA 1J84A 1LOBA 2FQPA 1ZRDA 1NA1A 1AJKA 2Z2SB 3VZLA 4HONA 1AJOA 3LQCA 4CDXC 5FY8A 1AYN3 2BOIA 1IS4A 2V5DA 3ILFA 3WP5A 3LDKA 1D4M2 1RMU2 3PHMA 4CP9A 4G9SB 1N3QA 3IIIA 4NJ4A 4XUTA 5CU1A 5FZ3A 3CJXA 1A34A 3IMNA 1COV3 1UY3A 1E5HA 3KGZA 4LKSA 3R6SA 5C4WB 5LY1A 4BIOA 3LOBA 3BTYA 1UKRA 4OI1A 2YU1A 1DZRA 1O4YA 4FPCA 4FXGB 3NKGA 4N53A 3HAGA 4YZ5A 4IE7A 4CDUA 2QNKA 3WY6A 2DYCA 1VBE3 1H8TC 2WZR3 3ZYRA 4YARA 3T4VA 1F8VA 5L73A 3IMMA 1BVVA 3O0XA 1R093 2W2IA 4QD2A 1AYM2 2A6ZA 5FZMA 3VBUA 4FAGA 1OLME 1E5IA 1CWPA 3FLPA 1A8DA 5FPUA 3S6PA 4GALA 2WKKA 3GBWA 1BMV1 4WVMA 4Q5OA 3UYJA 2W46A 1DIWA 3VZOA 4GULA 4Y1UA 4XFFA 1X33A 1RUF1 2K9ZA 2QFEA 4FXKB 1AR91 4GWMA 4X6QB 2C9KA 3HN1A 5BNOA 4DEVA 4JC1A 2EICA 4MADA 4WV8A 3Q8AA 2JJ6A 1WBLA 5JXHA 5JSOA 4XBLA 4Y20A 3F95A 4D7TA 3OCPA 4UBGA 1IG0A 2PHUA 1OQDA 1SMVA 1W6PB 3B9CA 4JTOA 3AMHA 3AXDA 1MQTA 1KRIA 1XJAA 1AF9A 2LRPA 4BLJA 4ZU7A 1SLTA 1PZ8A 2BP6A 3K3OA 3WNPA 1EV12 4EYUA 3J7LA 3UNPA 2HWF3 3NAPC 1ASJ3 5F8PA 1OT5A 5IVFA 3WHTA 2JEMA 1SFPA 3VDDA 3HNMA 1GV9A 2RR13 3UKVA 2D98A 2AEZA 1O8SA 5IVEA 1XPWA 1V9U2 4IE6A 4N43B 1JS9A 1LULA 1A8MA 3CEWA 1QJZA 3EBRA 4QT6A 4CCEA 1XNKA 4LKEA 5JVVA 3GXUA 3MIHA 1GZWA 2I45A 1PNGA 5A80A 5FCCA 1H9PA 5BNPA 3CNAA 3AVSA 1NT0A 3C7GA 5LCWL 4EE2A 1C3HA 4RQPA 3VKFC 4DO0A 5EYXA 4NWWA 4COWA 3EXUA 4IEUA 1G9CA 1GYKA 4GMP3 1W6MB 4XOGA 1OOPB 3LCPA 4PF5A 5FY5A 5FZAA 1MEC2 1EY2A 1HXS1 2EIEA 3MUZ1 4RD7A 3TN91 3W9AA 4AVCA 1H2MA 3T2PA 4CU9A 1MZ6A 5L9VA 1W6NA 4K8RB 1SLLA 2ES3A 4LORA 4ATEA 2C1FA 2GNDA 5FTTC 3H8XA 2HWB2 1H8TA 1JTZX 5HCAA 1UD1A 2ZZQA 1LU1A 3WF4A 4OI4A 3U75A 5LA1A 5LEKA 1QJEA 2DVAA 4LIVA 2E7QA 4LJHA 1ZZBA 1YI7A 3TEYA 5KXEA 1RUJ1 1ZRCA 2EIGA 1G8WA 5CKQA 3V56A 4J25A 3WW4A 4CVUA 4UOJA 4IV3C 3BOPA 1PGL2 5F2WA 1RVF1 2NMNA 2ZTNA 3H1YA 4P9LA 4Q1RA 4XILA 5FZGA 1YFWA 4CP2A 1O6UA 4PJYA 1EYBA 5FZ4A 5JXJA 1H6YA 5FLIA 5FXWA 3GJBA 5T3NA 3H8RA 1ZBA3 4P9YA 1FI2A 1EPZA 3I2HA 4XYXA 1XU1A 2B42B 4XF9A 2DUQA 3D8CA 1AL21 4QKDA 4XW3A 1LCLA 1YCIA 3RJ2X 2UWBA 1XE8A 1CAXA 1SLCA 2JECA 2CV6A 4ET7A 1ZBE1 1PIV1 2ADEA 4UFHA 1QKQA 4M3CF 3NAPA 1ZRIA 1DGRN 3RZGA 3KF3A 4YW1A 4KI5M 1GSLA 3BB6A 3VDBA 2ARBA 4G4FA 3OYWB 5KR7A 3PTRB 3LFMA 3RRDA 4F83A 5CFCC 4YW3A 3PIJA 3WVJA 1MS4A 4XVHA 4NAOA 5AFBA 3BUCA 4WM8A 3TBDA 4XZPA 5A32B 3H7YA 2QZ3A 2LROA 3OBTA 1ZA4A 4UFMA 3ZMOA 5J09A 4WBBA 5J36A 3FBYA 3ZFFA 1REEA 1IS3A 3AZYA 5TSWA 2Q1MA 1OA4A 4LK7A 3B3QE 3AP7A 2VW0A 4DRVA 1X8MA 2H6CA 2ZA9A 3O1VA 4RYDA 2UWAA 3WDXA 4N7IA 3WNXA 3WNKA 2DTYA 4OZXA 4Y5TA 4AYUA 4DXSA 1DQ4A 3JB4C 4HVRA 1IS6A 1UYYA 5A33A 4AVTA 3ZVXA 1NCQB 2X10A 2JG8B 4AI9A 1N3PA 4Z07A 4MOAA 1KDKA 1RJ8A 4IV1B 5K0UA 1DG6A 3T0BA 3PDQA 3SXWA 1W0OA 5M0TA 4QX3A 1XC6A 3OUIA 3PUAA 5ACA1 4LA3A 5J48A 2RS31 3RYRA 3IN9A 1V6NA 3O0VA 3UV9A 2P4EA 3MV11 4BE3A 4IE4A 3LEKA 4QQLA 1RUH3 2BNOA 4Y5SA 4AQTA 2Q5TA 5A7WA 3E6DA 4IV3A 1BHGA 4LPLA 2IC1A 3GZEA 3HVDA 3LF7A 4HFSA 4XFAA 1CAWB 2XKPA 1FMD1 3KLSA 5FZLA 4AVBA 1ZNPA 5D2AA 5I0TA 3P1IA 3HN3A 2BV4A 4FOQA 3OGSA 1XRUA 1TNFA 2QKDA 3V0AB 1RHI2 2MEV3 3OY8B 1BK1A 4BB3A 2IFWA 4NUBA 2Y64A 5FBJA 1UPIA 1X50A 5LBFA 3NRUA 4OVEA 2DFBA 1PK6C 1XNCA 3JB8A 3OSDA 2RS32 1WD3A 3WP4A 3IAPA 3MFAA 3VKLA 1HLCA 2PFWA 1LAJA 4Y1VA 2YBKA 5FPVA 3AMQA 1BYHA 2ZS6B 5BNNA 1BK0A 1DQ1A 3ACIA 3M3OA 3WT3A 1GP6A 3LPFA 3D0JA 4JDOA 3LDBA 4W8JA 5CNAA 1IGOA 4AI8A 3SEPA 5FKBA 1FMD2 1V0AA 1W8ZA 4XFIA 5JIAA 1REDA 4CEWB 3A0KA 3T08A 4HOOA 2D7FA 5FWEA 1HRV3 3ZDSA 3J8F3 1ZX5A 2RE9A 3BGAA 3MBWA 5F5QA 1W2AX 4TXWA 1WCKA 1YJKA 3TRSB 3VHRA 3WF3A 4BXSV 5KHGA 1W9YA 1I1EA 3AYCA 5L9RA 2OA2A 4CCJA 3LSDA 1PO23 4Q0QA 4NR1A 5A3WA 1HQLA 4HT1T 5IVCA 5J7MA 5GLUA 4XF4A 1PX3A 4LXLA 3ZYPA 3DKWA 4XJ9A 1Y9GA 3B94A 3GZAA 1RUC3 5LBEA 4RHV2 5T5JA 2WNVC 2J1VA 5LATA 4Y22A 2VZ1A 5H9RA 3N9LA 3R4UA 1QWRA 3JD71 4GD4A 3UGHA 2V4VA 5FXVA 1PVXA 3WQ0A 4IGPA 4E8CA 4NIGA 1PO11 5T5PA 1MS9A 1ZZ6A 2JXAA 4OFGA 4TN7A 5A7OA 4XFBA 4A45A 4EN0A 1DYOA 2EAAA 2JG9A 2C9AA 1CAUB 3I4IA 4IERA 1T6GC 4XJUA 5JAXA 1O3QA 2RMU3 1JU3A 3N7MA 4AAPA 5AC92 2P3JA 2C4XA 3E97A 4HANA 3LA7A 2Y60A 3JBG1 3C2UA 3KT1A 3MI8A 1U5ZA 1TEIA 3U10A 5FR3A 4MGYE 3NJVA 2E26A 2YXSA 1CR7A 3Q9OA 4QDQA 4XEZA 5FUPA 5C4WA 5CG8A 4XFCA 4HXCA 2E33A 3HQUA 4LIUA 3WP6A 4XUNA 1RUF3 3K51A 4YZ1A 2VXRA 3HNYM 4W6WA 1WCSA 2CGNA 2VULA 1UX7A 4EWEA 1WUVA 4QMAA 4P9GA 4I0BA 2R042 2WINB 3CO2A 4Q4X1 4A7ZA 3MFCA 1N1SA 5F5AA 2X53S 4MLOA 1BEV3 3K4AA 2RDRA 4L99A 4MGIE 4J1XA 4KWKA 2Q8EA 4R4XA 4ASMB 3RYKA 1JZ4A 1YRZA 5GZCA 2GMMA 4AHZA 1TE1B 2VD7A 5DUUA 2C6SA 3NV1A 4OHZA 4KBZA 1W03A 4E4DX 1PVC3 2RM22 4OHXA 1K3IA 1HRI2 3SKJE 1FPN2 1QHDA 4OI2A 1JUHA 4CU6A 2Y0OA 3AZZA 1K42A 1XE0A 4BU2A 1REFA 4CEYC 1IPJA 2FD8A 5FZDA 2D3RA 1F35A 3VKMA 4HLTA 4W65A 2VQUA 3MPBA 2RS53 2OUHA 4XJAA 1AZDA 1RUD1 4Y3OA 2WNVA 1PNFA 1Q8QA 3WNNA 4R9AA 4CP0A 1PMHX 2HWE3 2A1XA 2NM1A 1POV3 5DDJ1 2HEVF 2QDNA 2WS91 3WW1A 2X5IB 4XJZA 3NNLA 3K46A 4Q4W3 1NLSA 1WLTA 1X9TA 4LR4A 1HXS3 1PHMA 4Q8KA 2W87A 1AR62 4Y26A 4N43A 5J1XA 2VE1A 4MGZE 3GHMA 5AVPA 1WWYA 4AI2A 5FYMA 5FUIA 1NLQA 4Z2AA 1W6OB 2F4PA 5ANQA 2R30A 3BN6A 1YIFA 3BU7A 2XUMA 4XE9A 1JZ2A 1ULFA 4X6RB 2VZPA 2ZACA 4E2GA 4EROA 3URFA 3VKOA 4AI1A 4YWAA 3ROUA 1QJU3 3WF2A 4JV4A 2ZHMA 1YNAA 4LUKA 3THCA 1W8UA 4KL1A 3WLUA 1VBD2 2YZ4A 3VBUB 3T09A 4B8EA 1OOPA 2A71A 4KQ7A 1PMJX 1MZFA 2F6BA 3ZPOA 3ZDVA 2WSVA 2P34A 2G1MA 2R7EB 1COV1 1UCXA 2MPFA 4AE2A 2QZ2A 4A7KA 3ES1A 1IKQA 1RTVA 2C26A 4FPGA 2NQYA 4NVPA 1CIYA 2ID4A 3WCRA 1UYXA 4R8HA 3MLJA 4AHXA 3DGTA 3N9PA 1F15A 3RZMA 1VBE1 4FP3A 1RUNA 3SH5A 4XMIA 1RUG2 3DUIA 3QH7A 3A0NA 1ZBE3 3ENRA 2GC2A 2F4LA 1W8NA 1CD3G 4FTEA 3N9QA 3H3ZA 3SC7X 4QKNA 2ZAHA 4LUMA 5T55A 1AYN2 2D6KA 2A73B 2XG3A 2VQTA 4U36A 5FIXA 5A1FA 2XDVA 4LE3A 1XSQA 4XHXA 4PDWC 5L36A 4KH9A 4BHPA 2PTMA 4LO7A 1COV2 2BTVC 3LZZA 4XCBA 3GF6A 3VUOA 2I2SA 3ZXEA 4GB33 3A21A 2BUKA 1GWLA 2N7GA 1B35C 5FKCA 4ZZ5A 5T52A 1UXXX 2EIBA 3GBGA 3AC0A 5FLHA 2V73A 5I8SA 5JR2A 2K0GA 4PI2A 2ERFA 4LTAA 5AFEA 2WZR2 4CDXB 4QU1A 4PCRA 2HWF1 3N9OA 1R092 1LGBA 2Z79A 1OXCA 3VBOC 2UYBA 4Q26A 2ZGLA 1VB2A 1XNAA 4H55A 4YLZA 5E16A 3TWIA 2RR11 3HOBA 3LB9A 1VIWB 4JHZA 3FL7A 4E8DA 3H9AA 1JZ5A 5A32A 2ZGOA 4CDQC 4OHYA 1VJ2A 3ECQA 4DRRA 1F5JA 4YG0A 2H6BA 4AQ2A 1RUE3 4B4RA 2FDFA 1QQP2 2LALA 5KC6A 3H1WA 5GLWA 3T4HB 4MH0E 3OUJA 3I2KA 1H2NA 3O1OA 3WW2A 2CAUA 2VCAA 3E5XA 1H8TB 2WBKA 3MEPA 4HKWA 1C57A 1JZ6A 4D8MA 5A7QA 1ND3C 3N7JA 1NCRC 3AYDA 4BQXA 4OCTA 1Y3TA 3U07A 3VBSB 1S0BA 3KZ4C 5GALA 4AXOA 4COYA 2VNVA 5IHRA 2X8KA 3RZKA 4FPEA 4BK4A 3N36A 1FOD2 1ASJ2 1NCQA 4YRDA 2VZVA 2JG8A 4DS0A 3LA3A 2R0HA 3WNMA 3SITA 5IT6A 2W3JA 4IV1A 2ZGSA 2W92A 2RR12 4JDNA 1ULPA 4V2VA 3IZOA 1APNA 2BNMA 4JRLA 3HPNA 3I3EA 2Q8OA 5EQUA 1QJY3 1UAIA 5FREA 2Z5WA 2JDYA 3FBMA 3O5SA 3W59A 1WCDJ 4QX8A 1CAXB 2EVXA 4NHKA 4RA0A 1HDKA 1DBNA 1C28A 5A1LA 2I74A 2VPVA 5F37A 3HR9A 3I2OA 4FPKA 1CAWA 5H9QA 3VD3A 2LTNA 4AHWA 2QCSB 3OPZA 3ZXKA 2GN7A 1AX0A 2V4AA 5DG1A 4PDWA 4D6QA 5L7OC 2H0BA 3V0AA 3IB3A 3OY8A 1ZBA1 1TME3 2C0ZA 3QOPA 4FPYA 1UIJA 2PHWA 1XYOA 4UW6A 5A7NA 3HT1A 5CIRA 5I93A 2IVIB 3M7AA 1W9TA 2D40A 2AYHA 3BCWA 4NHMA 5GLZA 2NPIA 1JOPA 3T0AA 2BBVA 4E4HA 4AVAA 3INAA 1GQPA 1V6OA 4YM0A 3T30A 2O8QA 1W2NA 1FX5A 2PELA 4J6GA 1CZSA 5GM0A 2WABA 2GH2A 3VBHC 2VNGA 4COUA 4K8FA 4QPGC 4UF0B 3LEIA 3N7LA 3VBFC 3HJRA 3L2HA 3ZSLA 3MICA 3AKRA 4CEWA 1CX4A 4DFSA 3PUQA 5F3EA 3NV3A 1NZIA 2IFRA 5L19A 4YNIA 1R1A3 5F3CA 4XQ4A 4ISQA 2HWC3 3EMRA 1CGPA 4GWNA 3GDBA 4W6XA 3AVRA 4Z1VA 1LEMA 3WQ1A 1KJLA 1ZM1A 1UYPA 2R063 3ME2A 4UFIA 3MV01 4OUEA 1QH7A 4E2QA 2V72A 3FUQA 3DXTA 5EZWA 2ENRA 1MZEA 2C5DA 1CPMA 3JBG3 3V0BB 3BIEA 1RUOA 1V6JA 2DUPA 1VBB2 1VRH2 3OTFA 4INDA 5F32A 4AEDC 1B09A 2JB4A 1JI6A 1JZ7A 4HVQA 1SCRA 1HB2A 1HQWA 5FXZA 4AW7A 2B46X 2FMDA 3AKQA 3VD5A 1S55A 4XTMA 5F6KA 1CAUA 3PVEA 4GA9A 2DF7A 4EN8B 1LNSA 3ORJA 3H0OA 3KMHA 2W1WA 2Q8DA 2Z42A 1Y4WA 5F3GA 3WQBA 4L11A 5CFCB 1VLNA 5L7OA 1LOFA 1OD5A 1ZZ7A 4LBNA 2ZHLA 2XBO1 4CP1A 3UESA 2GDFA 3KSCA 1O59A 3LKJA 4YZ3A 4DEQA 3ATGA 3X29B 4BIFA 5DG2A 1BQPA 3NL1A 5JOXA 2RDQA 4E27A 3DECA 2R0FA 5FZ8A 5HXMA 4NAMA 4H7MA 4MG2A 1GNZA 2J22A 4LLFA 1Z7S3 4RFRB 5I8TA 1YWKA 5C9AB 2IXHA 3ZSKA 1ULGA 1C8M3 1RUH2 1T6BX 1W9FA 1JYWA 5DAQA 1CIWA 3C7OA 5FJKA 4XXPA 5FZ1A 3VBHA 2ZGPA 4IEYA 4PLNA 4I02A 4ORFA 3VBFA 5IATA 1O5LA 2ZEZA 3WG2A 3ZMNA 4YGEA 1LHOA 1DQ5A 3KT7A 4H3WA 3RI9A 3RNSA 5FYYA 4M0HA 5K4LA 3R05A 4NIHA 1VPHA 3JQWA 1HRV1 3UKTA 4CUGA 2OZ6A 2MEV2 5A3UA 3MIBA 2WA4A 3O1RA 4ZONA 2A6VA 1MR5A 1IS5A 3DPRC 1GKBA 1D0GA 3CBNA 3USUB 2LS6A 1TVGA 5I8YA 3POWA 5FYTA 5FZ6A 1OH4A 1PO21 4KGGA 2RS11 1S4CA 3ABZA 5IW0A 4B1LA 4CTEA 2ZGQA 2BYVE 1RUC1 1FYUA 3KV4A 1QXJA 4XAEA 1VBC3 4MGSA 4IE5A 5IK7A 3WV6A 2JWPA 2X5IA 5FY0A 2YFZA 3FC0A 4AEDA 2JDKA 3M3CA 3LDRA 4RS5C 3M70A 1M4WA 1W2UA 2ZX2A 1S0GA 3CLPA 5AVAA 2OPWA 2D5FA 1PK6B 4TLGA 2UURA 1W6OA 5FY9A 4RSUA 1DYPA 3J8F2 1WZXA 3LSEA 1RJ7A 1XU2A 2A3XA 5C3OA 4Q4Y2 5HV0A 2RMU1 4ITCA 5JZGB 4HVOA 4QQ2A 5T54A 1N47A 1J3QA 4YVSC 2AREA 3I2FA 3VBSC 4YFWA 2JE8A 3MHZA 4R9DA 2R16A 1UY4A 2YU2A 4CE8A 1ZRRA 4Z8BA 1GZTA 2W0XA 3ZO0B 2IXCA 1U5XA 4R52A 5C3PA 2VMFA 1LENA 3H8UA 5HXVA 1MACA 2QQMA 3AL6A 3O1UA 3ASIA 2EA7A 2XONA 5LBCA 1QXRA 5GZGA 2KD7A 3BTZA 3AJZA 4MX3A 1W39A 3KVBA 4OQ8A 3FLRA 4PT6A 2HYKA 1A3KA 2Y26A 3DEMA 3I2DA 5CKNA 2TNFA 4MV2A 1EAH3 4FCAA 4COZA 5F6LB 4AG4A 1J1TA 1YUDA 2RMU2 4GXLA 2BERA 1BEV1 4UI9L 1IZ3A 2WNVB 5H9PA 3NJYA 1CX1A 1AXYA 1K5MB 2G9ZA 3FMGA 4D6SA 5CAZA 4FOVA 4DMIA 4HZFA 2VMGA 1D7PM 2Y33A 1PVC1 3AL5A 1BMV2 3EQEA 4P5YA 4QX5A 4M01A 4ATFA 3OB8A 4JKLA 5EPAA 4LITA 1X82A 1RUF2 1T2XA 1WW7A 3FN9A 3PUIA 2QTWB 4K40A 4ZXKA 2Y34A 1AR92 5CYYA 2BWAA 3AKSA 5F39A 4O9EA 1GUIA 4UAPA 2RS51 1GZ9A 4D0QA 2Y6JA 1L3JA 3DXUA 1E57A 4CDXA 4F8AA 4XDPA 5CFDB 1LEDA 5A3NA 4K3UA 2Q30A 1U12A 1JODA 2HWE1 3WCSA 5FZOA 1G86A 5DPNA 3V64A 1POV1 1OQEA 5LWBA 2D97A 4Y33A 4Y1YA 1BEV2 4FI9A 4Q4W1 1V70A 4RS5A 2JD9A 5C70A 3KHCA 1RUI1 4LT5A 1YO8A 4M0NA 4DUVA 4QHZA 2G19A 1EP0A 3AM2A 5FY7A 3WZ1A 1W0NA 1KEXA 5A1AA 2OQ6A 1L7QA 4KG0A 3T1LA 1GWMA 1PGSA 3OUHA 3LIGA 1RYYA 2UYAA 2UY8A 2WWSA 3PL0A 4YGBA 1QJU1 4YSFA 1EUTA 4JGZC 4YVSA 3VBSA 2YC0A 5FP7A 2PQSA 4GWIA 4YVWB 4TTGA 4PLMA 1C5HA 2ETEA 2XH6A 3MF6A 4PF1A 3WR0A 4A42A 3QH6A 3OEAA 4P9JA 3T2TA 1X36A 3S5QA 3CDZB 4NRPA 3L9JT 2B5HA 5FPBA 1ODMA 1VMFA 4B29A 4N90A 3AMMA 2BVBA 4Q4W2 1QJX1 4BMBA 3WHUA 3GNEA 3DL3A 1HXS2 5C33A 2FZ2A 2AUYA 3TN92 3ZYGA 3BI3A 3PMSA 4CEYB 3S7EA 2CGPA 1S2BA 3RVHA 1JYVA 3VZKA 2VVDA 2QQPA 1HKDA 5KWRA 2VMHA 3I3DA 1BVP1 1OMIA 5F2SA 2XMLA 4BZ4A 3LA2A 3E6CC 1UU6A 2VL4A 2F17A 2IXIA 2VW1A 3U4XA 1QJU2 5DUXA 1BKZA 4XQDA 3CF6E 1RUJ2 2QQJA 3ZYFA 4XPVA 5C3QA 4ARXA 3OGVA 4O9GA 3VHNA 3ZOIA 4BK5A 5DN2A 1LECA 4YGCA 2VAUA 4L0PA 3DN7A 2OKXA 1RVF2 3LWCA 4MUVA 3ZXDA 3UETA 1BBT1 1FV2A 4LO8A 4GB31 4XF3A 1MS5A 4I3PA 3HBZA 5C8CC 1ND2B 2Y6KA 3IDBB 4MGQA 4JDMA 1URXA 1NAEA 2WFF1 2O8OA 4I09A 3VL9A 1UZWA 1AL22 4N8MA 1C8NA 5LA9A 4TYSA 1JUIA 4QDRA 3WDTA 2WZPP 1UYZA 4LHLA 5C9AC 3T0DA 2CU5A 1ZBE2 1PIV2 1MS3A 2W1QA 4Y5Z0 5FFOC 3GCXA 2WRAA 2CNAA 3ACFA 2PLV1 3LGRA 4UF0A 4CZSA 3NQHA 3WDWA 3S5AA 2R32A 5IFTA 1RUE1 2WIIB 3P5BA 1WA4A 2LM3A 3VKNA 4BLIA 2GZWA 2DCKA 2JB8A 4Z2WA 4EWDA 1LHWA 3E6BA 1N1VA 3EO6A 2IVJA 4IXLA 4FPJA 1LOGA 3QLQA 4FP2A 2FBEA 3KV9A 3ST7A 2RJLA 1DGRA 4B7EA 4UFKA 1CJDA 3MGUA 1H9WA 3D0SA 3D6EA 2J1TA 4B4PA 2R6QA 1XB9A 4GAZA 2BW8A 1VBA1 5DAPA 2VTXA 1YFUA 3H50A 5EIYB 4CCKA 2SLIA 1JZ3A 3MUY1 1WA6X 2XBO3 2YHJA 2A70A 3K48A 1W8TA 4PDWB 3AP5A 4RGGA 5GZEA 1AR81 2CTVA 1YQ8A 2JDZA 4AF9A 5EXOA 3E5UA 1WCQA 1DZTA 2PAMA 3G7DA 1W04A 3F2ZA 1QJY1 1H6XA 1QDCA 1B35B 4GJZA 1AX2A 3WQ7A 2D6PA 3SHRA 1UZ0A 5ACA2 1VAKA 4DY3A 2RJ2A 4DUXA 5JOWA 1H4HA 2RHPA 2XUEA 4TSVA 2W1SA 3PJYA 1JU4A 1YEWA 2WFPA 4IL7A 5FYIA 5LA2A 4O61A 3PTYA 1UZZA 1QF3A 5J37A 5CFCA 3M3IA 3VBOB 3VB9A 5JZGC 2XL9A 1GOGA 1POQA 2NYYA 5FPZA 4DOUA 1N1YA 1LHVA 2R071 4XDOA 4EN7B 4CDQB 3CMGA 4JQRA 4QQOA 1TME1 1YQCA 1PZ7A 4QX1A 3IAQA 2VY0A 4LA2A 3SMHA 3U37A 3MW2A 3WINE 3ZFEC 2HWD3 4NRQA 1S0IA 4BWOA 1WD4A 1O91A 3RZJA 1HN1A 3FHAA 1X9PA 4I3GA 1F9KA 2DCZA 1TQ5A 1BLZA 1POV0 2MHFA 1ND3B 1NCRB 4PHZA 5G04L 2GSYA 3DF0A 2ZHKA 5C9AA 5FAXA 5JPNB 2CL2A 4ZS2A 3KV5A 1A78A 1UN1A 1D4M3 1RMU3 2RS13 4XC9A 1UW8A 5KHJA 2XXZA 2AACA 4PIXA 1F31A 5FP4A 3K75B 5E88A 4AFCA 2FCUA 4NIDA 1SZBA 2O14A 4OHWA 5FQ0B 5LY2A 2YYOA 3ACLA 2R49A 5BYNA 5LK7B 2QQKA 1K5MC 2QQIA 2W08A 4CCMA 5C6CA 1Q43A 4AVSA 3J7NA 4PBPA 1IG3A 1C1FA 1R1A1 3ETPA 3R4DB 4GZ9A 4NMIA 4YW2A 2HWC1 3USUA 5GLVA 2JX9A 4NPLA 4MHRA 4QPYA 5ISLA 1F4HA 1AYM3 1OUXA 2J1SA 3SH3A 5C71A 4XCAA 2R061 2WT1A 3E5QA 4R4ZA 4KBBA 3WDVA 4BM8A 3GM8A 1MZ5A 4LBKA 4XAAA 3SISA 5CFDC 1GNHA 2XQRA 5L7OB 3LAGA 1Q56A 1NY71 4YZ2A 2EIDA 1W06A 4X8PA 1SLBA 2HEWF 4GQ7A 3H3UA 4LBOA 4QAWA 3WX5A 1JOJA 5SV8A 2ARXA 3KV6A 3WG1A 1YLLA 1Q8VA 3KD4A 2DURA 1DLLA 4BQ4A 1ST8A 5CBLA 5A6YA 1PK6A 1WLWA 5IK8A 3JD72 1RIRA 5IFPA 3ZSEA 1I5ZA 2FZ1A 1PO12 4C90A 5JZGA 2VW2A 1R081 2XJVA 2QQOA 3TNPB 1GICA 3OGJA 5KHHA 3ZN5A 4K9SA 4W4ZA 2JE9A 4YVWC 5I0UA 3VBHB 1PMIA 1DDLA 2A5ZA 4QPGB 1IHMA 2PHRA 3VBFB 5LRRA 2YC4A 3PU8A 1QOOA 4BMEA 1K45A 4QM8A 3JBG2 2O0OA 3B7MA 2XLAA 4P9IA 1GOFA 4PIZA 4P02B 2ZCWA 1KD7A 1BJQA 1DFQA 1L7LA 3VD9A 2NLRA 1QOSA 2VUDA 1ZZCA 4IQPA 1Z7S1 2X09A 5KXDA 1XOYA 2IWGB 1C8M1 2CSGA 2Q4SA 1G6NA 1NLRA 4ZPIA 2H0VA 5FJHA 3EB7A 3LEMA 4CCNA 4DNYA 5FPXA 3OBRA 2HH9A 3RI8A 3P3NA 5FK8A 5T5OA 5FP9A 3S57A 4Q4X2 1QDOA 4XUOA 1K5MA 3PUSA 4AFDA 1RXFA 2ARCA 1UKGA 2E9QA 3KGLA 3W20A 2BZDA 4AEDB 4S2FA 5FMBA 1RUI3 2HWB3 1C4RA 2VG9A 1SDDB 3RSJA 3KT4A 2DWRA 4ZY9A 3UK9A 5B4NA 3WP3A 2EXIA 1ND2C 5CFDA 5I0RA 3O1MA 2YPDA 2A6WA 2OS2A 1Q8OA 4Z92B 2J1UA 1VBC1 2JKXA 4JCKA 5JMOA 1UZYA 4QB1A 3AMPA 1RUD2 4PQ9A 2P3KA 3KVAA 1G9FA 4B4QA 2XLGA 4LBQB 3ZN6A 4LE4A 3WUDA 3VLBB 5DDJ2 3IWZA 2WS92 4F3JA 3JZVA 4H7LA 3QACA 4AAXA 5FYZA 1QJX3 5FMOL 2D6NA 1UQXA 2XL7A 2PXJA 3S7IA 5LA0A 2WZEA 4RL7A 4UXAA 4I0AA 3U0ZA 1UL9A 1LR5A 1MVEA 2VNRA 1HJFA 2DV9A 2VCMA 3LFIA 4A3ZA 1W9WA 3CZUA 2VECA 4XXAA 4MVTA 3OF1A 4RGAA 1GQGA 4YVWA 2DTWA 1N1TA 2ZHNA 3ZXFA 1IQDC 2ZKLA 4BQWA 5FZHA 3Q8FA 3B5LB 5G05L 3RZZA 2ADDA 3I2JA 2GMEA 2VZUA 3JCIA 4QGNA 5D8AC 4LO5B 1UOJA 3KCYA 2W95A 5LW9A 2UY9A 1KS4A 5KHKA 3ZSMA 2PAEA 3B00A 5FZFA 4D3WA 2WNEA 4NIAA 3C7FA 3DPRB 4Z82A 1LOCA 2UWCA 3AYAA 4MYEA 4R9BA 5FYCA 4CEYA 1US3A 2HJIA 5FZKA 2YG0A 1BBT3 4BA6A 3W58A 2XVGA 1JN2P 3BTXA 1EAH1 4QKFA 4K7JA 2WFF3 1VBE2 1WGPA 3KB5A 1D2SA 5LBBA 4S2HA 4EZ4A 5ABJC 1W8WA 3I97A 4FFIA 5FZOB 4AFAA 3IM0A 2AEYA 1DYKA 5A3LA 1LGNA 4Q0PA 1XNBA 3D4KA 5JPMB 2PLV3 3FWEA 3IDEA 3MW3A 3GJAA 4RS5B 4DXZA 3POBA 3V65A 3H42B 1JOBA 2DDUA 3B93A 3QD6A 1VAVA 4FPFA 3ACGA 4OZOA 1XYNA 4A41A 1OF3A 2BFUL 4K6BA 4WM7C 2QBXA 2L9LA 2ORZA 1UMZA 3POIA 2D6LX 4BCUA 1ND2A 2PHXA 4FPHA 3UKNA 1H1IA 1H8VA 3PVOA 4UFJA 1DU3D 4BQ1A 5K7PA 1GOHA 2DCJA 3POYA 3AP6A 1JBCA 1PGW1 2XJRA 4Q8LA 4YVSB 3N9NA 3IIAA 2FDKA 3AKTA 1S0EA 2OUJA 5B4XA 2BPA2 4I2OA 1HB4A 1JW6A 1VBA3 2HWF2 3J7HA 3W5MA 1RHI3 1MS1A 5KBFA 5DUWA 2KA3A 2B9VA 3APBA 5FMCA 2B9UA 4OUMA 3MIGA 3SCFA 2WYFA 5IVVA 1OFNA 3LD8A 3DYMA 1AR83 4ZXEA 3HQXA 2WO1A 2XJPA 2ZZJA 4XIKA 1SCSA 1YYNA 2XOMA 4A44A 3I59B 1W6QB 5JOYA 5T50A 1UY1A 3NKTA 2A6YA 2XGXA 4ZZ8A 2D43A 4P9XA 3RG0A 5FOBB 3AB0A 3OPWA 1QH6A 1OPOA 1WW4A 2ZKNA 2WAAA 4EQVA 2JIJA 4CCDA 2W68A 3DYOA 4IEQA 3POGA 5FZEA 4TLFA 1NQDA 2A3YA 4BQ3A 3KWVA 3ZYBA 1SPPB 3K77A 1EPWA 2P5BA 1GNYA 2R073 4AEJA 3NSTA 5FMOS 4AK3A 2VZRA 1SDWA 2TBVA 1NE6A 2W47A 4CDWC 4WVZA 2BGOA 1DF0A 3FHIB 4IGOA 2Y6GA 1RB8G 1B35A 1TG7A 2HBTA 1I3HA 4GH4C 2VJXA 2ZMKA 1J59A 3ZKYA 3VBRC 1RINA 2FDGA 1AXZA 1GWKA 4YG6A 3Q8EA 2ZMNA 4QX7A 3O14A 4YW6A 3ZXLA 5ABJA 1XQNA 3TOJA 1H4GA 1LOAA 4HPKB 1OQ1A 2BBAA 3VBOA 2A6XA 4AR2A 1NG0A 1YFYA 5J98B 2BU9A 1J1LA 1AXKA 4BXFA 3ZM8A 2LW8A 3RZLA 1RITA 3WNOA 4CDQA 2QE3A 3UGGA 3VHPA 2ZJCA 1ENSA 2BWCA 3ZIWA 1ALYA 3P3PA 2YC2A 5IAVA 1S0CA 3NMBA 4LK6A 4H14A 4WM7A 4A7YA 3TYJA 2VU9A 5FZ9A 2Y6LA 2Q0AA 4QKBA 1ZBA2 3BALA 4XF0A 1HJGA 3NO8A 1ND3A 1NCRA 3LE0A 3CQOA 3K4ZA 4JGZB 5DABA 5FO7B 4XBNA 2R1BA 4YW4A 3ZX7A 5AC93 4S2DA 1LESA 4DB5A 1SFYA 1OH3A 4XURA 3OOXA 4HSJA 1O5UA 3WD5A 4IEXA 3V0BA 4CUCA 3GZUC 1AR73 2ZEXA 4LO4B 4B7KA 5FQ0A 1RL3A 2EF6A 2XVKA 3HWJA 1UZVA 2VBPA 3FZ3A 1LU2A 3QBQA 3IDCB 4JRAA 5IK5A 2W91A 3WF1A 5SV5A 4AGGA 2BFUS 5I91A 3CJIC 2VOKA 1CZTA 3CKHA 5FP8A 3AMNA 1QJFA 1H30A 3RPQA 3RQ0A 3BU0A 1HQNA 4NPRA 1H2KA 4Q1PA 2R043 1YIPA 2ARAA 5IVYA 1WBFA 1UPSA 2DVFA 4QXBA 2Q1FA 1UXZA 3THPA 2OZJA 3N3HA 3ACHA 2A75A 4NIIA 5FZCA 2QDRA 1R083 4Q0UA 1NA1C 1VALA 3HQRA 4CA9A 5CVRA 3VV1A 1CN1A 1CQ9A 1TMF3 3RMXA 1H2LA 1WKYA 4ASKA 4P5HA 2BRTA 2JDPA 3M3QA 5JXGA 1VRBA 1WW6A 2RM23 1DLCA 3J9SA 3POEA 4Q4V3 1HRI3 4UW4A 2TEPA 2QQLA 1A6CA 1GP5A 1X8EA 2WZ8A 4H2AA 5FK7A 4TWTA 3PIGA 2P17A 1OD3A 5C8CB 4URAA 3PUHA 3BYWA 1S2KA 2ET1A 4LHKA 4Q27A 1Q8SA 3U1XA 4N53C 5IYYA 3D82A 4EV0A 1DCSA 4A3XA 5KXBA 3OPTA 4CDUC 4JAAA 4D7YA 4LHSA 5A6QA 2VMCA 2VQAA 3AZWA 2VNOA 1RC6A 3OBZA 5JI7A 2E32A 5HV4A 4OQ9A 4CCLA 3VHOA 3M8LA 4AHYA 4I01A 1FATA 3HT2A 2J42A 1JYNA 2VOVA 4QPGA 2CHHA 3MPPG 1WLDA 2JDHA 5IAXA 5D21A 4JGYC 1ULCA 2XBO2 2HWD1 1OSGA 5FO8B 3I3MA 4HG6B 1HN0A 4OI0A 5EJZB 2XWJB 1ODNA 3J4UH 4YYOA 4M3CB 3PU3A 4PLOA 3SCHA 5FLJA 4KGQA 3ILRA 1P8JA 1JXNA 3J7MA 4NHLA 4XUPA 4LMFA 4HBNA 2WLPA 3O1TA 2ZX1A 5J3UA 4RR3C 4S2GA 1VBD3 1D4M1 1RMU1 3I3QA 4P08A 1BCXA 4Q0SA 3VDAA 1MQTC 2VR4A 2PAKA 3A22A 2VZOA 5CEHA 5BV6A 5IJRA 3POFA 4BDVB 2WC2A 2GP5A 1OA3A 5FZ0A 4GKYA 3ZR5A 1HX6A 3VDDC 2ZX3A 4CPBA 2VUAA 3MLLA 2JDNA 4UW3A 1PM4A 1PX4A 2XKOA 3VZJA 3WXPA 4FTBA 4IW3A 1HRV2 2W52A 4JKMA 3OJBA 1OHFA 1YQ5A 3AKPA 1AYM1 1YFXA 2OYZA 3N35A 1ULOA 1TNRA 3CZJA 5BNPC 3N4MA 5ANNA 1S1AA 1OLRA 3A4UA 1Z78A 2E51A 4URTA 1AL0G 2IZWA 3BVCA 1PO22 3CL1A 4FQ4A 2D3SA 4RQPC 4AQ6A 2RS12 1OLQA 5A3MA 5I0SA 2ZEYA 1QMJA 4JHTA 4LO6B 1H1AA 3ZFEB 1RUC2 5FV3A 4LBQA 1CESA 5K9YA 1XXNA 2WR9A 3VN4A 3H7JA 3ZPYA 3J26N 2OVUA 4SLIA 3T2QA 1XYPA 5DAXA 1W8FA 1KGYA 3I54A 4JZRA 4CPBD 1LB2A 2Y8KA 4OHVA 1QXPA 2AR6A 2LUWA 2PMWB 1EV11 2PHDA 3SKVA 4ZKTB 5LZ6A 1ZYBA 2Q1ZB 1LODA 2IXJA 2VMDA 3HD8B 2VC9A 3BPZA 2PHTA 3WOGA 4JGYA 3SQOA 4LNVA 1V9U1 4QHOA 4MHUA 4MXWB 4EN9B 1QQP3 3M4FA 5GJ6A 3NNGA 2ZX0A 4FTSA 3DYPA 5EJ1B 3DPRA 1G7YA 4LBQD 2VTXJ 4B1MA 3M3EA 4IESA 2D93A 4C0HA 5DUVA 1SEFA 1DGWA 5F3IA 4D7SA 1LOEA 4RR3A 4UWDA 2ILMA 3NJXA 5BUVA 3D3AA 1HB1A 1VMHA 4DPNA 1NKGA 4C91A 2QQUA 4I30A 2WT2A 4E4ZA 2GC1A 1MEC1 1UF2C 1QU0A 1FOD3 3UL2A 2RV9A 4CCOA 5FP3A 1PZ9A 4QWNA 1KDMA 1W3XA 5EJ3A 5FYVA 4QQHA 4L8QA 3AXEA 3ZFGB 1O3TA 4XQWA 3UT0A 3FFZA 4QPIC 5JDBA 1GQHA 1OI6A 3BKZA 4L9BA 3DCQA 3ZN6B 2HWB1 4WM8C 2YMZA 5B2GB 4AGRA 4PIYA 2FDIA 3MIEA 2GC3A 3IPVB 3AYEA 4M00A 1PVC2 2BJSA 1UOBA 4WVVA 3ZFFC 2VBBA 2ATFA 3KM5A 4NHXA 2DBNA 3ON7A 4WZFA 1WLCA 1HV0A 3ZKUA 5E89A 5C5UA 4RN5A 3PJQA 5FPLA 4D69A 4DXRA 3AFKA 2AGSA 5FYUA 4P00B 1PGL1 1NZCA 2HEYF 3RDIA 3UJOA 2RS52 2YY1A 2WNUB 3JQXA 1SG3A 5JSPA 4KNCA 1FNYA 2Y38A 3VZMA 1G9BA 2HWE2 4PBOA 2DVDA 3I2GA 4G3YC 2BGCA 2RVAA 3MDPA 1KJRA 1D4VB 1OURA 5K0UC 1U5IA 3I59A 1RUI2 1W99A 1W6QA 5FY4A 2D6MA 2VZTA 5D1IA 1FXZA 4BOWA 4ISRA 1GMMA 2WA3A 3B9IA 4MSVA 1IOAA 3SEEA 4HMZA 3U14A 2VUJA 4YG3A 2BOJA 1O4TA 1ENRA 5T5LA 4QX0A 1HIXA 1V6MA 2GMPA 3AJYA 4XJWA 4XJ8A 2P3IA 1HB3A 4YM2A 2ZEWA 5HCBA 1SPPA 3HBKA 3LPGA 4QDSA 4KU8A 3I2IA 3OBAA 4LULA 3K2OA 2C24A 5BXXA 2AH2A 4UW5A 2DCYA 3RGBA 2GN3A 4FVVA 4E4SA 3ZYIB 2G9GA 3MYXA 4AWDA 1J58A 2P3YA 3Q8CA 1LJ7A 1QJX2 1YC61 2B4KA 2D3PA 4WVWA 2ZMLA 3WW3A 4AGVA 1BXHA 1OBNA 4I0WB 4IEOA 3W21A 2JENA 2WWJA 4LKDA 1CJPA 4D6RA 4NN0A 2E6VA 3T3YA 1CAVA 1KS5A 2YUEA 1STMA 1DHKB 2YGLA 5FYBA 3BTAA 1IKPA 4HPKA 5KC5A 1UMIA 4QX2A 2VVFA 5BNNC 2EXJA 1CVNA 1YQ2A 4D94A 5CADA 2OT7A 2FMYA 2W9XA 4PQQA 5E1RA 2GU9A 1VBB3 1VRH3 4UYBA 4LQRA 1U5YA 3M2MA 2GNBA 3PVBB 4FPOB 4LOTA 3NV4A 4BQ2A 3PVNA 1R64A 4AVVA 4YFZA 1R1ZA 1W3VA 1O4ZA 1UX6A 3H1MA 5EP9A 3L2YA 4QM9A 4N9HA 3VGIA 1BBT2 4JGZA 1CONA 2JIGA 4GB32 5EYYA 4JKKA 1YI9A 4CU8A 4HKLA 3FHQA 4IEWA 4XDQA 1WMXA 2WFF2 5GKAC 4HK8A 3HIFA 2SBAA 1UMHA 2ORXA 1V6IA 5D8AB 1RHI1 5C8WA 2P6HA 1F5FA 5GZFA 3OD0A 4OYUA 3FX3A 1AHSA 1WMEA 1C1LA 2CDOA 3E1F1 2PLV2 4K1YA 2VZ3A 1JYXA 5E6HA 4N7UA 4HKOA 1H1MA 2IXLA 3ZN4A 4C1XA 1G9AA 5CB7A 4ONUA 1W90A 1RUE2 2HKXA 3ZSJA 4CXWA 5CA6A 2P1BA 4UT5A 3TEWA 4Q2FA 4WZCA 4ZHNA 4FOYA 2JG9C 3NWKA 4ZU5A 1I9RA 2WN2A 3PMEA 5FWJA 3I3BA 2PHFA 5ABJB 3IDAA 5FUNA 3O1SA 1V00A 3USSA 2JD4A 4Q0VA 4KWUA 4FFFA 3OEBA 1F4AA 5CZKA 3RMYA 3H8OA 4META 1VBA2 3NV2A 3RZHA 1ULDA 4AEMA 2XVLA 4YM3A 2R1DA 2WAOA 2YB7A 4AFMA 1ZVFA 3BOWA 4ZU4A 5A3OA 3MO4A 1OA2A 4WM7B 4E2SA 5C4WC 5C8CA 1AR82 3U78A 2VZSA 4AZZA 1F2NA 1XSRA 3I7DA 3RS6A 4Y1XA 1C5IA 2V09A 2IXKA 3SLIA 1QJY2 2XHNA 2ZOEB 2NZ9A 3R4SA 5F5CA 1JMUB 2G9FA 4LHNA 2CGOA 2FHRA 2CWMA 1RXGA 4RHV1 1XNTA 1KITA 2GAUA 5F1RA 1LHNA 3VZNA 2WJSA 5C5TA 5E8AA 1VE0A 3AZVA 4QGLA 2WNOA 4U2AA 2DU0A 4NHYA 1KFUL 2R072 5APAA 1SLAA 1KFXL 3ZYHA 2B8MA 3EJKA 1TME2 1SLIA 4M3CA 3ZXAC 2J1RA 3AZXA 2WL1A 5A7PA 3GHNA 2D5HA 4EN6B 4Q4Y3 2ZGTA 5AC91 5CG9A 2CDPA 1OKOA 1LTEA 1V6LA 4Y4YA 4LBLA 4DY5A 2J7MA 1GANA 2DBIA 2VQ0A 4AFBA 2WO2A 4RFT0 1O3SA 4DQAA 2UU8A 1W2TA 4K1ZA 3A23A 4QPWA 1AR71 1Z0HA 2PA7A 3WF0A 4F7ZA 4XABA 1OC1A 3HNBM 5JCTA 4L97A 1W8HA 3GALA 2D44A 3ILNA 4LEJA 3ZFGC 1J3RA 4ASLA 4CDWB 4AI0A 3O1PA 1W0PA 1UY0A 2WSUA 3DV8A 1O8PA 3B69A 1US2A 2OIIA 4GH4B 4YPJA 2W39A 3VBRB 4N43C 4CCCA 3K4DA 2R041 1QNWA 2I07B 5FYSA 1HV1A 1QNYA 2GNTA 1FAYA 2XLFA 3H3LA 1ACCA 1QY4A 4CXXA 1R1A2 3A7QA 3AK0A 1NE4A 3KQ4B 1I5PA 4SBVA 4XBQA 1GLHA 2HWC2 2Y6HA 1EV13 3NNJA 2JDMA 4HN0A 2FDHA 2RG4A 3D5OA 1TMF1 3UJQA 4HK9A 1ONAA 3C3VA 2R062 4E9KA 4V1PA 5J96B 1OOPC 1AR72 2RM21 2WNUC 3CHXA 4Q4V1 3RFRA 4IEPA 3ZFEA 1HRI1 1FT9A 1FPN1 1UY2A 2FDJA 3AFGA 3W5NA 1V9U3 2BVVA 1NY72 2AZ5A 5F7UA 3THDA 1E5SA 5LRSA 1AR93 3BPSA 4HETA 2KXLA 4Y24A 4IGQA 4JVAA 4MO3M 5DAWA 4TZDA 1GU3A 2ZAAA 4AL9A 4IDZA 1OLMA 3KCXA 5LASA 4C1WA 2CY6A 2GP3A 5L9BA 2XHKA 1BZWA 4XHBA 1OPMA 5A6ZA 2ZX4A 3WUCA 2BQPA 3IKWA 1WMDA 1R082 5BNQA 1MEC3 3THTA 4QPIB 4QQPA 1HW5A 2BGPA 1ULEA 1TMF2 1DQ0A 1S0DA 1AR61 4YW7A 4MXWA 3CJIB 1ENXA 4IE0A 1JZ8A 4A6SA 4RGKA 4EWAA 4Q4V2 5IVJA 1OF4A 2YDEA 3IBMA 1LGCA 1K12A 2VGDA 4P9WA 4AI3A 2ZGNA 1IQAA 1FV3A 1O7FA 4QHBA 2VO5A 3VDCA 1W6PA 2E7AA 2E53A 4PI0A 4QXKA 4J1WA 2X05A 5EHDA 4CXYA 3OD4A 1VBD1 5FPAA 5KXCA 4DINB 1DP0A 1SBFA 1YJLA 2P6CA 1NA1B 1Z7S2 2VMIA 4XIOA 5FXXA 5JLVA 4YGDA 5A6XA 5IVBA 3ITQA 2JKBA 5JI9A 1MVQA 1C8M2 5FYHA 2HBUA 4QB6A 4DXTA 4FFHA 2VVEA 2YV8A 2VOTA 4OMCA 4O65A 2GNMA 3ZFGA 1S2EA 1VMJA 4CP9B 1Y7BA 4CYDA 1RGSA 2WDBA 5DZEA 2QUOA 3B01A 3TN93 1M06G 2ZBJA 3IPVA 2CWSA 1ZA7A 1JH5A 2E7TA 3MIFA 2OX0A 3ZXJA 1RUG1 4N53B 4AOCA 1UNBA 3O0WA 4CDUB 5C3SA 1NQJA 4KU7A 5DAVA 2QJVA 1OVPA 1X7NA 3MF9A 4LOSA 3T2OA 1Q3EA 3KHBA 3WDUA 1AYN1 3GZTB 4M4PA 2WN3A 1RUJ3 4KG8A 4BPZA 1IPSA 1AVBA 1LKNA 1W6MA 4JX0A 2WNUA 4FT8A 2VCBA 2PN5A 4P14A 1VP6A 1DGLA 1MS0A 3FFQA 4OULA 2RDSA 1GFF2 4HN1A 4WVMB 2QQVA 2W94A 3FLTA 1GP4A 4JGYB 4CRQA 1D0HA 1NCQC 2XWBB 1VBC2 4NE9A 3ZYJB 1RVF3 4OLLA 1IPKA 1VR3A 2JG8C 2W1UA 2TUNA 1QEXA 4QB2A 4QXCA 4UFLA 4ZS3A 3N7KA 4XFHA 2WQ4A 3MW4A 4IV1C 2NMOA 4W50A 5BNOB 4DZGA 5JIUA 3FJSA 3O12A 4LKFA 4LBJA 2BDRA 3ZR6A 1UO9A 4JTNA 1H0BA 2VXJA 1N3OA 3M1HA 3WSOA 2WZR1 3JU9A 5C3RA 4Y20B 1UOGA 5IUQA 1I6XA 1NOVA 1U0AA 1AL23 2OXBA 5A3TA 4RR3B 1R091 4BQYA 4DIQA 5FZ7A 1MQTB 1PIV3 1JHNA 3C7EA 3HEIA 3CIHA 2YGMA 2WQZC 5DMYA 4KMQA 3PURA 5LEJA 4FOWA 1WCUA 5BPXA 2DU1A 2WWUA 2JDAA 1SFNA 2YPJA 1O3RA 3VDDB 4HL0A 2MNGA 1QQP1 5CISA 3GCWA 4V2WA 3G6JB 4FSJA 3VL8A 4Q29A 1NXD1 1FNZA 2DUOA 5FO9B 1GZWB 4MZUA 1SHWB 2OQ7A 1NX9A 3POJA 5BNPB 2CYFA 3ELNA 3SH4A 5JSRA 1S0FA 1D2QA 1LRHA 2CAVA 3KCCA 4RQPB 1FOD1 1ASJ1 3RYPA 1EAH2 3OYWA 4CUBA 2K2SA 3C7HA 4FO9A 5DXDA 4XUQA 1SBEA 2EXHA 1S0JA 1Q8PA 1SACA 2ZGRA 4XETA 4MGTA 1UOFA 4NWVA 2K46A 3TEZA 3NNMA 5CKMA 5FOJB 4X8NA 3KQRA 5JWPA 3B02A 3WG4A 1W6NB 5JXIA 2E63A 5FY1A 5DZFA 4CEWC 5ERLA 3JUUA 1OUSA 2WO3A 4COVA 1JYCA 2B39A 3OGGA 4W6YA 5ACA3 1VAMA 3EYPA 2RS33 2DVBA 3RJRA 5FDBA 2FCVA 4EZHA 4AEKA 4XACA 1J3PA 1AUYA 2D6OX 3ES4A 5FRAA 3TAYA 3UGFA 3U4SA 4GMP1 3ZLIA 2YBSA 1PGW2 2ZGKA 5D8AA 4CUAA 1SQ4A 2VOWA 3LIHA 1FMD3 2JE7A 2P2KA 2ZGUA 3TEXA 4QGMA 5DZGA 5FBZA 3EHKA 4AQSA 1KQRA 4QU2A 3I49A 2VM9A 1J83A 4NPMA 5C7GA 5HCHA
chains in the Genus database with same CATH topology
2OPKA 2XJQA 3QCWA 1GR3A 1NXMA 3PNAA 4XMAA 1ZZ9A 1G9DA 2ZGMA 3NAPB 3RWNA 1CAVB 3TNQA 1XNDA 2OW4A 4BH9A 5BY5A 4RHV3 1Q5OA 1OKQA 4XTPA 1LOFC 3ALQA 1V6KA 1JYIA 4WM8B 2P37A 2XB6C 3AX4A 3HMYA 4XF1A 3IT8A 2PHLA 5EWSA 3GYDA 1AX1A 3ZFFB 1YXWA 5JOZA 3I8TA 4L92A 1UU4A 1WW5A 4GKXA 5JMCA 3MZHA 1UU5A 2O1QA 4LLOA 3S0MA 3NW4A 5F9TA 2G4IA 4XFGA 2PYTA 4GIQA 4N9IA 5A33B 1VBB1 2XPJA 1VRH1 3FUOA 1XE7A 3R0RA 4BYYA 2RJKA 4NO4A 4OUSA 4FBFA 2XJUA 4Y1ZA 1NYWA 3LOIA 5K0UB 2ZABA 3JD73 4LBMA 2BNNA 4KWLA 5LK5A 2DFCA 4FQZA 1DZQA 1PO13 1QGLA 4UBHA 3SNMA 3AP4A 3TB0A 4IEZA 1ZRFA 1GZCA 1ENQA 2A7AA 2AENA 4YM1A 3GBFA 4NOTA 4IV3B 4MXVA 1OFSA 4MGKE 3BODA 3CU7A 5GLTA 3U11A 4B3NA 4CDWA 2X5IC 5JR7B 1MS8A 2ZPXA 1FPN3 1VB4A 2GALA 3MIDA 4GH4A 1KXGA 1ZREA 3VBRA 3KS7A 4FAHA 3ZIXA 1RUH1 4IEVA 4L2NA 3FE5A 2GC0A 3PLQA 4FPLA 3O7OA 2PQQA 3NVCA 1GBGA 2EALA 3S30A 5BNNB 4Q4X3 3AP9A 4A2UA 4IETA 1LHUA 3VBUC 1ZZ8A 2WT0A 2MEV1 5IK4A 4K21A 1AR63 4KWJA 2KM2A 5K8SA 4HSLA 3ZXGA 2NN8A 3POSA 1QOTA 3NJZA 1DQ2A 2QVSB 4K20A 2X29A 5BNOC 2JICA 5EV7A 2B45X 4ES8A 1DGWX 3MLKA 4M3CE 1DQ6A 2EXKA 3T1MA 1YHFA 3ETQA 2ET7A 2XJTA 2DCTA 1SBDA 3BIWE 5EFUA 2B7YA 1UIKA 5GZDA 4ES9A 2WLQA 5H9SA 1RUD3 2A3WA 2VH9A 2Z69A 4QPIA 2VOXA 1CPNA 4YZ4A 2XJSA 1PM7A 5DDJ3 3CJIA 3WG3A 2WS93 1Y43B 3SCGA 2Y0IA 4Y22B 3J8F1 2EAKA 5HBAA 2V5YA 2GH8A 4GMP0 4YW5A 3WDYA 2HWD2 4Q4Y1 2DVGA 2YROA 5HCFA 5HI0A 4R9CA 2NP0A 1Y9QA 1WMFA 2JG9B 1RUG3 4C0BA 2BEOA 5KHIA 4EJRA 2FQPA 1LOBA 1ZRDA 1NA1A 1AJKA 2Z2SB 3VZLA 1AJOA 4CDXC 1AYN3 1IS4A 3WP5A 3ILFA 1D4M2 1RMU2 3PHMA 4G9SB 1N3QA 5CU1A 3CJXA 3IMNA 1COV3 3KGZA 3R6SA 5C4WB 4BIOA 3LOBA 1UKRA 4OI1A 1DZRA 1O4YA 4FPCA 4FXGB 3NKGA 4N53A 3HAGA 4YZ5A 4CDUA 2QNKA 3WY6A 2DYCA 1VBE3 1H8TC 2WZR3 3ZYRA 4YARA 1F8VA 5L73A 1BVVA 3O0XA 1R093 4QD2A 1AYM2 2A6ZA 4FAGA 3VBUA 3FLPA 1A8DA 3S6PA 4GALA 2WKKA 3GBWA 1BMV1 4WVMA 3VZOA 1DIWA 4GULA 4Y1UA 4XFFA 1X33A 1RUF1 2K9ZA 2QFEA 4FXKB 1AR91 4GWMA 4X6QB 5BNOA 3HN1A 4JC1A 4WV8A 2JJ6A 1WBLA 5JSOA 4XBLA 4Y20A 4D7TA 3OCPA 4UBGA 2PHUA 1OQDA 1SMVA 1W6PB 3B9CA 4JTOA 3AMHA 3AXDA 1MQTA 1KRIA 1AF9A 4BLJA 4ZU7A 1SLTA 1PZ8A 1EV12 2HWF3 3NAPC 1ASJ3 3WHTA 2JEMA 3VDDA 1GV9A 2RR13 3UKVA 2D98A 1V9U2 4N43B 1LULA 1A8MA 3CEWA 1QJZA 3EBRA 4QT6A 1XNKA 5JVVA 3MIHA 1GZWA 2I45A 1PNGA 5FCCA 1H9PA 5BNPA 3CNAA 1C3HA 4RQPA 3VKFC 5EYXA 4NWWA 4COWA 3EXUA 4IEUA 1G9CA 1GYKA 4GMP3 1W6MB 4XOGA 1OOPB 3LCPA 4PF5A 1MEC2 1EY2A 1HXS1 4RD7A 3TN91 3W9AA 4AVCA 1H2MA 1MZ6A 1W6NA 1SLLA 2ES3A 4ATEA 2C1FA 2GNDA 5FTTC 2HWB2 1H8TA 1JTZX 5HCAA 1UD1A 2ZZQA 1LU1A 5LEKA 4OI4A 2DVAA 2E7QA 1ZZBA 1YI7A 5KXEA 1RUJ1 1ZRCA 2EIGA 1G8WA 3V56A 3WW4A 4IV3C 3BOPA 1PGL2 1RVF1 2NMNA 2ZTNA 3H1YA 4P9LA 4Q1RA 4XILA 4CP2A 1YFWA 4PJYA 1EYBA 5FLIA 5T3NA 1ZBA3 4P9YA 1FI2A 1EPZA 4XYXA 1XU1A 2B42B 4XF9A 2DUQA 3D8CA 1AL21 4XW3A 1LCLA 1YCIA 3RJ2X 2UWBA 1XE8A 1CAXA 1SLCA 2JECA 2CV6A 1ZBE1 1PIV1 1QKQA 4M3CF 3NAPA 1DGRN 4YW1A 1GSLA 3BB6A 2ARBA 4G4FA 3OYWB 3RRDA 4F83A 5CFCC 4YW3A 3WVJA 1MS4A 5AFBA 4WM8A 3TBDA 4XZPA 5A32B 3H7YA 2QZ3A 3OBTA 1ZA4A 3ZMOA 5J09A 4WBBA 5J36A 3FBYA 3ZFFA 1REEA 1IS3A 3AZYA 5TSWA 2Q1MA 1OA4A 3B3QE 3AP7A 2VW0A 4DRVA 1X8MA 2H6CA 2ZA9A 2UWAA 3WDXA 4N7IA 3WNXA 2DTYA 4OZXA 4AYUA 1DQ4A 3JB4C 4HVRA 1IS6A 5A33A 4AVTA 3ZVXA 1NCQB 2JG8B 1N3PA 4Z07A 1KDKA 1RJ8A 4IV1B 5K0UA 1DG6A 3SXWA 1W0OA 5ACA1 5J48A 4LA3A 2RS31 3RYRA 3IN9A 1V6NA 3O0VA 3UV9A 4BE3A 4QQLA 1RUH3 2BNOA 4AQTA 2Q5TA 3E6DA 4IV3A 2IC1A 4HFSA 4XFAA 1CAWB 2XKPA 1FMD1 3KLSA 4AVBA 1ZNPA 5I0TA 4FOQA 1XRUA 1TNFA 2QKDA 3V0AB 1RHI2 2MEV3 3OY8B 1BK1A 2IFWA 1UPIA 1X50A 4OVEA 2DFBA 1PK6C 1XNCA 3JB8A 2RS32 1WD3A 3WP4A 3VKLA 3MFAA 1HLCA 2PFWA 4Y1VA 3AMQA 1BYHA 2ZS6B 5BNNA 1DQ1A 3M3OA 3WT3A 3D0JA 4JDOA 5CNAA 1IGOA 4AI8A 1FMD2 4XFIA 5JIAA 1REDA 4CEWB 3A0KA 2D7FA 1HRV3 3ZDSA 3J8F3 1ZX5A 2RE9A 5F5QA 1WCKA 1YJKA 3TRSB 3VHRA 5KHGA 1I1EA 3AYCA 2OA2A 3LSDA 1PO23 4Q0QA 4NR1A 1HQLA 4HT1T 5J7MA 5GLUA 4XF4A 3ZYPA 3DKWA 4XJ9A 3B94A 3GZAA 1RUC3 4RHV2 5T5JA 2WNVC 4Y22A 5H9RA 3R4UA 1QWRA 3JD71 1PVXA 3WQ0A 1PO11 5T5PA 1MS9A 1ZZ6A 2JXAA 4OFGA 4XFBA 4EN0A 2EAAA 2JG9A 2C9AA 1CAUB 3I4IA 4IERA 1T6GC 4XJUA 5JAXA 1O3QA 2RMU3 3N7MA 5AC92 2P3JA 3E97A 4HANA 3LA7A 3JBG1 3C2UA 3KT1A 3MI8A 1U5ZA 1TEIA 3U10A 4MGYE 3Q9OA 4XEZA 2YXSA 1CR7A 5CG8A 5C4WA 4XFCA 3WP6A 1RUF3 3K51A 4YZ1A 2VXRA 4W6WA 1WCSA 2CGNA 2VULA 4EWEA 1WUVA 4QMAA 4P9GA 4I0BA 2R042 2WINB 3CO2A 4Q4X1 4A7ZA 3MFCA 1N1SA 2X53S 4MLOA 1BEV3 4L99A 4MGIE 4J1XA 4KWKA 4R4XA 4ASMB 3RYKA 1YRZA 5GZCA 2GMMA 4AHZA 1TE1B 5DUUA 4OHZA 3NV1A 4E4DX 1PVC3 2RM22 4OHXA 1HRI2 1FPN2 1QHDA 4OI2A 1JUHA 2Y0OA 3AZZA 1REFA 4CEYC 1IPJA 2D3RA 3VKMA 4HLTA 4W65A 3MPBA 2RS53 2OUHA 4XJAA 1AZDA 1RUD1 2WNVA 1PNFA 1Q8QA 4CP0A 4R9AA 2HWE3 2NM1A 1POV3 5DDJ1 2HEVF 2QDNA 2WS91 3WW1A 2X5IB 4XJZA 4Q4W3 1NLSA 1WLTA 4LR4A 1HXS3 1PHMA 4Q8KA 1AR62 4Y26A 4N43A 4MGZE 3GHMA 5AVPA 4AI2A 1W6OB 2F4PA 2R30A 1YIFA 3BU7A 2XUMA 4XE9A 1ULFA 4X6RB 2ZACA 4E2GA 4EROA 3URFA 3VKOA 4AI1A 3ROUA 1QJU3 4JV4A 2ZHMA 1YNAA 4LUKA 4KL1A 3WLUA 1VBD2 2YZ4A 3VBUB 4B8EA 1OOPA 2A71A 4KQ7A 2F6BA 1MZFA 2WSVA 2P34A 1COV1 1UCXA 2MPFA 4AE2A 2QZ2A 4A7KA 3ES1A 1IKQA 1RTVA 4FPGA 2NQYA 4NVPA 3WCRA 4R8HA 3MLJA 4AHXA 3DGTA 1VBE1 4FP3A 1RUNA 3SH5A 4XMIA 1RUG2 3DUIA 3QH7A 3A0NA 1ZBE3 3ENRA 2GC2A 1CD3G 4FTEA 3H3ZA 2ZAHA 4LUMA 5T55A 1AYN2 2D6KA 2A73B 2XG3A 4U36A 4LE3A 4XHXA 4PDWC 5L36A 4KH9A 4BHPA 2PTMA 4LO7A 1COV2 2BTVC 3LZZA 3GF6A 3VUOA 2I2SA 3ZXEA 4GB33 2BUKA 2N7GA 1B35C 5T52A 5I8SA 3GBGA 5FLHA 2V73A 2K0GA 2ERFA 4LTAA 5AFEA 2WZR2 4CDXB 4PCRA 2HWF1 1R092 1LGBA 2Z79A 3VBOC 2UYBA 4Q26A 2ZGLA 1VB2A 4H55A 4YLZA 5E16A 3TWIA 2RR11 3LB9A 1VIWB 3H9AA 5A32A 2ZGOA 4CDQC 4OHYA 1VJ2A 3ECQA 4DRRA 1F5JA 4YG0A 2H6BA 4AQ2A 1RUE3 4B4RA 1QQP2 2LALA 5KC6A 3H1WA 5GLWA 4MH0E 1H2NA 3WW2A 2CAUA 3E5XA 1H8TB 3MEPA 4HKWA 1C57A 1ND3C 3N7JA 1NCRC 3AYDA 1Y3TA 3U07A 3VBSB 1S0BA 3KZ4C 5GALA 4AXOA 4COYA 2X8KA 4FPEA 3N36A 1FOD2 1ASJ2 1NCQA 4YRDA 2JG8A 4DS0A 3LA3A 2R0HA 3SITA 5IT6A 4IV1A 2ZGSA 2RR12 4JDNA 1APNA 2BNMA 4JRLA 2Q8OA 1QJY3 1UAIA 5FREA 2Z5WA 3O5SA 3FBMA 3W59A 1WCDJ 1CAXB 2EVXA 4NHKA 4RA0A 1HDKA 1DBNA 1C28A 2I74A 2VPVA 3HR9A 4FPKA 1CAWA 5H9QA 2LTNA 4AHWA 2QCSB 3OPZA 3ZXKA 2GN7A 1AX0A 5DG1A 5L7OC 4PDWA 2H0BA 3V0AA 3OY8A 1ZBA1 1TME3 2C0ZA 3QOPA 4FPYA 1UIJA 2PHWA 1XYOA 4UW6A 3HT1A 5CIRA 5I93A 3M7AA 2D40A 2AYHA 3BCWA 4NHMA 5GLZA 2NPIA 2BBVA 4AVAA 3INAA 1V6OA 4YM0A 2O8QA 1FX5A 2PELA 4J6GA 5GM0A 2GH2A 3VBHC 2VNGA 4COUA 4K8FA 4QPGC 4D7YA 3ZSLA 3N7LA 3VBFC 3L2HA 4DFSA 4CEWA 3MICA 3AKRA 1CX4A 3NV3A 2IFRA 5L19A 4YNIA 1R1A3 4XQ4A 4ISQA 2HWC3 1CGPA 4GWNA 4W6XA 4Z1VA 1LEMA 3WQ1A 1KJLA 1ZM1A 2R063 3ME2A 1QH7A 4E2QA 3FUQA 5EZWA 2ENRA 1MZEA 2C5DA 1CPMA 3JBG3 1RUOA 1V6JA 2DUPA 1VBB2 1VRH2 3OTFA 4INDA 4AEDC 1B09A 4HVQA 1SCRA 1HQWA 4AW7A 2B46X 2FMDA 3AKQA 1S55A 4XTMA 5F6KA 1CAUA 3PVEA 4GA9A 2DF7A 4EN8B 3H0OA 3KMHA 2Z42A 5CFCB 4L11A 1VLNA 5L7OA 1LOFA 1OD5A 1ZZ7A 4LBNA 2ZHLA 2XBO1 4CP1A 2GDFA 3KSCA 3LKJA 4YZ3A 3ATGA 3X29B 4BIFA 5DG2A 1BQPA 3NL1A 5JOXA 4E27A 2R0FA 4H7MA 1GNZA 4LLFA 1Z7S3 5I8TA 1YWKA 5C9AB 2IXHA 3ZSKA 1ULGA 1C8M3 1RUH2 1CIWA 4XXPA 3VBHA 2ZGPA 4IEYA 4PLNA 4I02A 4ORFA 3VBFA 1O5LA 3WG2A 3ZMNA 4YGEA 1LHOA 1DQ5A 3KT7A 4H3WA 3RI9A 3RNSA 4M0HA 3R05A 3JQWA 1HRV1 3UKTA 2OZ6A 2MEV2 3MIBA 2WA4A 2A6VA 1MR5A 1IS5A 3DPRC 1GKBA 1D0GA 3USUB 5I8YA 3POWA 1PO21 4KGGA 2RS11 4CTEA 2ZGQA 2BYVE 1RUC1 1FYUA 1QXJA 1VBC3 5IK7A 3WV6A 2X5IA 3FC0A 4AEDA 3M3CA 4RS5C 3M70A 1M4WA 1W2UA 2ZX2A 1S0GA 3CLPA 5AVAA 2D5FA 1PK6B 2UURA 1W6OA 4RSUA 1DYPA 3J8F2 3LSEA 1RJ7A 1XU2A 2A3XA 4Q4Y2 2RMU1 4ITCA 5JZGB 4HVOA 4QQ2A 5T54A 1N47A 1J3QA 4YVSC 2AREA 3VBSC 4YFWA 4R9DA 2R16A 1ZRRA 4Z8BA 2W0XA 3ZO0B 2IXCA 1U5XA 4R52A 1LENA 3H8UA 5HXVA 1MACA 3ASIA 2EA7A 5GZGA 1QXRA 3AJZA 4MX3A 1W39A 3FLRA 2HYKA 1A3KA 2Y26A 3I2DA 2TNFA 4MV2A 1EAH3 4FCAA 4COZA 5F6LB 4AG4A 1J1TA 1YUDA 2RMU2 4GXLA 1BEV1 1IZ3A 2WNVB 5H9PA 1AXYA 1K5MB 3FMGA 5CAZA 4FOVA 4DMIA 4HZFA 2VMGA 1PVC1 1BMV2 3EQEA 4QX5A 4M01A 4ATFA 1X82A 1RUF2 4K40A 1WW7A 4ZXKA 1AR92 2BWAA 3AKSA 4O9EA 2RS51 1GZ9A 1L3JA 1E57A 4CDXA 4F8AA 5CFDB 1LEDA 4K3UA 2Q30A 1U12A 2HWE1 3WCSA 1G86A 3V64A 1POV1 1OQEA 2D97A 4Y1YA 1BEV2 4Q4W1 1V70A 4RS5A 1RUI1 4LT5A 1YO8A 4M0NA 1EP0A 3AM2A 3WZ1A 3T1LA 4KG0A 1PGSA 2UYAA 2UY8A 2WWSA 4YGBA 1QJU1 4YSFA 4JGZC 4YVSA 3VBSA 2YC0A 4YVWB 4PLMA 1C5HA 2ETEA 2XH6A 3MF6A 3WR0A 3QH6A 4P9JA 3T2TA 1X36A 3L9JT 2B5HA 4B29A 4N90A 3AMMA 2BVBA 4Q4W2 1QJX1 4BMBA 3WHUA 3GNEA 3DL3A 1HXS2 5C33A 2FZ2A 2AUYA 3TN92 3ZYGA 3PMSA 4CEYB 3S7EA 2CGPA 1S2BA 3VZKA 2VVDA 2QQPA 1HKDA 5KWRA 2VMHA 1BVP1 1OMIA 4BZ4A 3LA2A 3E6CC 1UU6A 2IXIA 2VW1A 3U4XA 1QJU2 5DUXA 1BKZA 4XQDA 3CF6E 1RUJ2 4XPVA 4O9GA 3VHNA 1LECA 4YGCA 3DN7A 1RVF2 3LWCA 4MUVA 3ZXDA 1BBT1 1FV2A 4LO8A 4GB31 4XF3A 1MS5A 4I3PA 3HBZA 5C8CC 1ND2B 3IDBB 4JDMA 1URXA 2WFF1 2O8OA 4I09A 3VL9A 1AL22 1C8NA 3WDTA 4TYSA 1JUIA 2WZPP 4LHLA 5C9AC 1ZBE2 1PIV2 4Y5Z0 1MS3A 5FFOC 2CNAA 2PLV1 3LGRA 4CZSA 3WDWA 2R32A 1RUE1 2WIIB 1WA4A 2LM3A 3VKNA 4BLIA 2GZWA 2DCKA 4Z2WA 4EWDA 1LHWA 3E6BA 1N1VA 3EO6A 4IXLA 4FPJA 1LOGA 3QLQA 4FP2A 2FBEA 3ST7A 2RJLA 1DGRA 4B7EA 4B4PA 1CJDA 3MGUA 1H9WA 3D0SA 3D6EA 2R6QA 2BW8A 1VBA1 1YFUA 3H50A 2SLIA 2XBO3 2YHJA 2A70A 3K48A 4PDWB 4RGGA 3AP5A 5KC5A 5GZEA 1AR81 2CTVA 2JDZA 4AF9A 5EXOA 3E5UA 1DZTA 2PAMA 3G7DA 1QJY1 1QDCA 1B35B 1AX2A 3WQ7A 2D6PA 3SHRA 5JOWA 5ACA2 1VAKA 4DY3A 1H4HA 2RHPA 4TSVA 3PJYA 2WFPA 4IL7A 3PTYA 1UZZA 1QF3A 5J37A 5CFCA 3M3IA 3VBOB 5JZGC 2XL9A 2NYYA 5FPZA 4DOUA 1N1YA 1LHVA 2R071 4EN7B 4CDQB 4JQRA 4QQOA 1TME1 1PZ7A 3ZFEC 2VY0A 4LA2A 3SMHA 3WINE 3MW2A 2HWD3 1S0IA 4BWOA 1WD4A 1O91A 4I3GA 1F9KA 2DCZA 1TQ5A 1POV0 2MHFA 1ND3B 1NCRB 2GSYA 3DF0A 2ZHKA 5C9AA 5FAXA 5JPNB 2CL2A 1A78A 1UN1A 1D4M3 1RMU3 2RS13 1UW8A 5KHJA 4PIXA 3V0BB 1F31A 4AFCA 5E88A 4OHWA 5FQ0B 2YYOA 3ACLA 2R49A 5BYNA 5LK7B 1K5MC 2W08A 5C6CA 1Q43A 4AVSA 4PBPA 3R4DB 1C1FA 1R1A1 4YW2A 2HWC1 3USUA 5GLVA 2JX9A 4QPYA 1AYM3 3SH3A 2R061 2WT1A 3E5QA 4R4ZA 4KBBA 3WDVA 4BM8A 5CFDC 1MZ5A 4LBKA 3SISA 1GNHA 5L7OB 3LAGA 1Q56A 1NY71 4YZ2A 4X8PA 1SLBA 2HEWF 4GQ7A 3H3UA 4LBOA 3WX5A 1JOJA 5SV8A 2ARXA 3WG1A 1YLLA 1Q8VA 3KD4A 2DURA 1DLLA 5CBLA 5IK8A 1PK6A 1WLWA 3JD72 1RIRA 3ZSEA 1I5ZA 2FZ1A 1PO12 4C90A 5JZGA 2VW2A 1R081 2XJVA 3TNPB 1GICA 3OGJA 5KHHA 3ZN5A 4K9SA 2JE9A 4YVWC 5I0UA 3VBHB 1PMIA 1DDLA 2A5ZA 4QPGB 1IHMA 2PHRA 3VBFB 5LRRA 1QOOA 4BMEA 4QM8A 3JBG2 2O0OA 3B7MA 2XLAA 4P9IA 4PIZA 2ZCWA 1KD7A 1BJQA 1DFQA 2NLRA 1QOSA 4IQPA 1ZZCA 1Z7S1 5KXDA 2IWGB 1C8M1 2Q4SA 1G6NA 1NLRA 2H0VA 5FPXA 4DNYA 3OBRA 3RI8A 3P3NA 5T5OA 4Q4X2 1QDOA 1K5MA 4AFDA 2E9QA 1UKGA 3KGLA 4AEDB 4S2FA 1RUI3 2HWB3 1C4RA 2VG9A 3RSJA 3KT4A 2DWRA 3UK9A 3WP3A 2EXIA 1ND2C 5CFDA 5I0RA 2A6WA 1Q8OA 4Z92B 1VBC1 4JCKA 1UZYA 3AMPA 1RUD2 4PQ9A 2P3KA 1G9FA 4B4QA 2XLGA 4LBQB 3ZN6A 4LE4A 3WUDA 3VLBB 5DDJ2 3IWZA 2WS92 4F3JA 3JZVA 4H7LA 3QACA 1QJX3 5FMOL 2D6NA 2XL7A 3S7IA 4RL7A 4UXAA 4I0AA 3U0ZA 1UL9A 1LR5A 1MVEA 2VNRA 2DV9A 2VECA 4XXAA 4MVTA 3OF1A 4RGAA 1GQGA 4YVWA 2DTWA 1N1TA 2ZHNA 3ZXFA 2ZKLA 3B5LB 3RZZA 2GMEA 3JCIA 4QGNA 5D8AC 4LO5B 3KCYA 2UY9A 1KS4A 5KHKA 3ZSMA 2PAEA 3B00A 4D3WA 2WNEA 3DPRB 4Z82A 1LOCA 2UWCA 3AYAA 4MYEA 4R9BA 4CEYA 2HJIA 1BBT3 4BA6A 3W58A 2XVGA 1JN2P 1EAH1 4K7JA 2WFF3 1VBE2 1WGPA 3KB5A 1D2SA 4S2HA 5ABJC 4AFAA 3IM0A 5A3LA 1DYKA 1LGNA 4Q0PA 1XNBA 3D4KA 5JPMB 2PLV3 3FWEA 3IDEA 3MW3A 4RS5B 4DXZA 3V65A 3B93A 3QD6A 1VAVA 4FPFA 1XYNA 2BFUL 4K6BA 4WM7C 1UMZA 2D6LX 4BCUA 1ND2A 2PHXA 4FPHA 3UKNA 1H1IA 1H8VA 3PVOA 4BQ1A 1DU3D 5K7PA 2DCJA 3POYA 3AP6A 1JBCA 1PGW1 2XJRA 4Q8LA 4YVSB 3IIAA 3AKTA 1S0EA 2OUJA 2BPA2 4I2OA 1JW6A 1VBA3 2HWF2 1RHI3 1MS1A 5KBFA 5DUWA 2KA3A 3APBA 2B9UA 4OUMA 3MIGA 3SCFA 1OFNA 1AR83 3HQXA 2XJPA 2ZZJA 4XIKA 1SCSA 1YYNA 3I59B 1W6QB 5JOYA 5T50A 3NKTA 2A6YA 2XGXA 2D43A 4P9XA 3RG0A 5FOBB 3AB0A 1QH6A 1OPOA 1WW4A 2ZKNA 2W68A 4IEQA 4TLFA 1NQDA 2A3YA 1EPWA 2R073 4AEJA 3NSTA 5FMOS 4AK3A 2TBVA 1SDWA 1NE6A 4CDWC 4WVZA 1DF0A 3FHIB 1RB8G 1B35A 4GH4C 1I3HA 2ZMKA 1J59A 3VBRC 1RINA 1AXZA 4YG6A 2ZMNA 3O14A 3ZXLA 5ABJA 1XQNA 3TOJA 1H4GA 1LOAA 4HPKB 1OQ1A 3VBOA 2A6XA 1NG0A 1YFYA 5J98B 1J1LA 1AXKA 1RITA 4CDQA 2QE3A 3VHPA 2ZJCA 1ENSA 2BWCA 3ZIWA 1ALYA 3P3PA 4A7YA 1S0CA 4H14A 4WM7A 3TYJA 2VU9A 2Q0AA 1ZBA2 3BALA 4XF0A 3NO8A 1ND3A 1NCRA 4JGZB 5FO7B 4XBNA 2R1BA 4YW4A 3ZX7A 5AC93 4S2DA 1LESA 4DB5A 1SFYA 4HSJA 1O5UA 3WD5A 4IEXA 3V0BA 3GZUC 1AR73 4LO4B 4B7KA 5FQ0A 1RL3A 2EF6A 2XVKA 3HWJA 3FZ3A 4JRAA 4QPIC 1LU2A 3QBQA 3IDCB 5IK5A 5SV5A 4AGGA 2BFUS 5I91A 3CJIC 2VOKA 3AMNA 1H30A 3RPQA 3RQ0A 1HQNA 4NPRA 1H2KA 4Q1PA 2R043 1YIPA 1WBFA 1UPSA 2DVFA 3THPA 2OZJA 3N3HA 2A75A 2QDRA 1R083 4Q0UA 1NA1C 1VALA 5CVRA 3VV1A 1CN1A 1CQ9A 1TMF3 3RMXA 1H2LA 4P5HA 3M3QA 1WW6A 2RM23 3J9SA 4Q4V3 1HRI3 4UW4A 2TEPA 1A6CA 1X8EA 4TWTA 2P17A 5C8CB 1S2KA 2ET1A 4LHKA 4Q27A 1Q8SA 5KXBA 4N53C 3D82A 4EV0A 4A3XA 4CDUC 4JAAA 2VQAA 3AZWA 2VNOA 1RC6A 5JI7A 3VHOA 3M8LA 4AHYA 4I01A 1FATA 3HT2A 2VOVA 4QPGA 3MPPG 1WLDA 4JGYC 1ULCA 2XBO2 2HWD1 1OSGA 5FO8B 4OI0A 2XWJB 3J4UH 4YYOA 4M3CB 4PLOA 3SCHA 5FLJA 4KGQA 3ILRA 1JXNA 4NHLA 4HBNA 2WLPA 2ZX1A 5J3UA 4RR3C 4S2GA 1VBD3 1D4M1 1RMU1 4Q0SA 1BCXA 1MQTC 2PAKA 5BV6A 2WC2A 1OA3A 4GKYA 1HX6A 3VDDC 2ZX3A 2VUAA 3MLLA 4UW3A 2XKOA 3VZJA 3WXPA 4FTBA 1HRV2 2W52A 3OJBA 1OHFA 3AKPA 1AYM1 1YFXA 2OYZA 3N35A 1TNRA 5BNPC 3N4MA 1S1AA 1OLRA 3A4UA 1Z78A 2E51A 4URTA 1AL0G 2IZWA 1PO22 3CL1A 4FQ4A 2D3SA 4RQPC 4AQ6A 2RS12 1OLQA 5I0SA 1QMJA 4LO6B 1H1AA 3ZFEB 1RUC2 4LBQA 1CESA 5K9YA 1XXNA 3VN4A 3H7JA 3ZPYA 3J26N 2OVUA 4SLIA 1XYPA 1LB2A 3I54A 4OHVA 1QXPA 2AR6A 2LUWA 1EV11 2PHDA 4ZKTB 1ZYBA 2Q1ZB 1LODA 2IXJA 3HD8B 3BPZA 2PHTA 3WOGA 4JGYA 4LNVA 1V9U1 4MXWB 4EN9B 1QQP3 3M4FA 5GJ6A 2ZX0A 4FTSA 3DPRA 1G7YA 4LBQD 3M3EA 4IESA 2D93A