3PDQA

Crystal structure of jmjd2a complexed with bipyridyl inhibitor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
353
structure length
353
Chain Sequence
SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Inhibition of histone demethylases by 4-carboxy-2,2'-bipyridyl compounds
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 114
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3pdqA01
2GP3A 5A7PA 3U78A 4LITA 5F5AA 5F5CA 5FZ4A 3AL6A 5FXWA 4GAZA 2VD7A 3ZLIA 4CCKA 5FZEA 5IVEA 3N9NA 5FPAA 5IVCA 3LDBA 5FXVA 5FZ9A 5FZLA 5LY2A 5FY4A 5FZOB 3KVAA 4D6SA 4LIVA 4GD4A 5FZHA 3ZPOA 4CCOA 5LY1A 5IVJA 5F3CA 2OX0A 5FBJA 5FZIA 5A7SA 4DO0A 5A3PA 5A80A 4BXFA 3KV6A 2XMLA 3PUAA 5FYHA 5A7QA 4NUBA 2OQ7A 3KVBA 3N9LA 4UF0A 3PU3A 4LXLA 3KV4A 5K4LA 4QXBA 5F3EA 2YU2A 5F39A 3RVHA 5FXXA 3N9QA 5FPLA 4IGOA 4QXHA 2W2IA 5FP4A 5A7OA 4QX8A 4IGPA 5A7NA 4GJYA 2Q8EA 5FJHA 4QU1A 1VRBA 3U4SA 4AAPA 3KV9A 5F5IA 5IWFA 5A3NA 2WWUA 5FZAA 4EZ4A 5FZ7A 5FY7A 2Q8DA 2XXZA 3PU8A 4BISA 4XDOA 3DXTA 5FPVA 4ASKA 4EYUA 5A1FA 4Y33A 5FYVA 5FY0A 3OPWA 3OPTA 3PURA 3N9OA 5FY9A 5IVVA 3KV5A 2YPDA 2OS2A 5F32A 5FP3A 4CCMA 5LW9A 5FP9A 4HONA 5F37A 5FUNA 3K3OA 5FYTA 5FY5A 4C8DA 4CCLA 5FYBA 5FZ8A 5F3GA 4XDPA 5ANQA 4CSWA 4EZHA 5FYUA 4D6QA 4V2WA 2OQ6A 5FYZA 2XUEA 5FY1A 4V2VA 5FZ1A 3AVRA 4Y4RA 4UF0B 5FYMA 3PUSA 5FWEA 5FZDA 5F2SA 2PXJA 5FZ0A 4QWNA 5FZBA 4URAA 2WWJA 3N9PA 2YBSA 5FV3A 5FXZA 5FZKA 3PDQA 5FZ3A 5FYYA 5A1LA 3DXUA 5FPUA 4CUGA 2OT7A 2P5BA 3LD8A 5FZMA 5FYSA 2XDVA 3AVSA 4DIQA 2GP5A 5IVBA 4CCJA 2YU1A 4HOOA 4IGQA 5FZOA 5IVFA 5IW0A 5CEHA 3UYJA 5KR7A 2YBPA 5FYIA 5IVYA 5F3IA 5FJKA 5A7WA 3PTRB 5E6HA 4AI9A 5FZCA 5LWBA 5FZGA 5FPBA 4BU2A 3K2OA 5FP7A 3K3NA 4CCNA 3PUQA 4GJZA 5FUPA 5FWJA 5ISLA 5A3TA 5F2WA 5FYCA 4QX7A 3NJYA 5FZ6A 5FZFA 5A7WB 3N9MA 4TN7A 2Q8CA 4D6RA 4LIUA 5FP8A 3AL5A 5A3WA 2YBKA 4Y3OA 4QXCA 5FY8A 4E4HA
chains in the Genus database with same CATH superfamily
4B3NA 3USSA 5A70A 3WG1A 4WVWA 1YNAA 2ZJCA 2GNDA 4GAZA 3VDBA 1FPN1 2QDNA 3ZLIA 1FNZA 1DQ5A 2WUHA 1A34A 4MXWB 4A3XA 3LDBA 4R9DA 1PNGA 1W6PB 3I7DA 3WX5A 1R64A 3ZKUA 1WLCA 4Q4W1 4UW4A 5DUWA 4CDUB 4Q4Y1 3NNGA 4D6SA 3NQHA 3VBFA 2ZGQA 5JXJA 1YIFA 1CAXA 4QMAA 1N1YA 4UBGA 1W6OB 4AI1A 1DQ2A 3VD7A 3WNNA 5JAXA 2CU5A 3MLKA 1W9FA 3KV6A 2VTXJ 1N1SA 4ATEA 4COZA 2K46A 5FYHA 5A7QA 4Y22A 4BHPA 2ZZJA 4IEPA 3HWJA 1GNHA 1Q8VA 2VY0A 3I59B 5JSOA 1OH3A 1RXFA 1XPWA 3OYWB 4LJHA 4BMBA 2HWD3 4NAMA 4C0HA 5I8YA 2VL4A 4GIQA 3RZLA 3IPVB 1UMHA 1AF9A 1SBDA 3AC0A 5LBCA 2JDPA 3VBHC 5JI9A 2VO5A 4Y1ZA 1OQDA 1HRI1 1SZBA 2C1FA 3U4SA 3ZMOA 4DEVA 4ZXEA 3WP5A 3SISA 2FDGA 4UXAA 4EZ4A 1IHMA 4MUVA 2GC1A 4PIZA 2VMCA 5ABJA 4Z8BA 5C70A 3OY8B 1IKPA 5A6ZA 1VBA1 5DAWA 1RTVA 4XAEA 3POFA 1L3JA 3D0JA 2V5DA 1T6GC 3AP9A 1QIQA 1MR5A 2EVXA 2YMZA 1GNYA 3A0NA 2ZKNA 3IM0A 2P3KA 2PMWB 4QGNA 1ZBA3 3V64A 4SLIA 3ZX7A 5F37A 4XXPA 1S2KA 2RR11 2E53A 2WZR1 4D6QA 3K77A 1MEC3 1KRIA 2JG9A 2XUEA 4JKLA 5K7PA 3PIJA 5FZ1A 3ZFEA 2WS92 1MVEA 3I2KA 4W8JA 5T3NA 1RINA 3SEPA 1UOFA 3TBDA 3U37A 2QVSB 2Z5WA 5D21A 3WD5A 3LFIA 3W5NA 4UFIA 1W2OA 3PVOA 1DZRA 1MS0A 2HWF1 2WNVC 3SCFA 3LB9A 1AYN1 2EXHA 3BGAA 1FPN2 4GWJA 2FMYA 5AFBA 2RMU1 2WT1A 2YBSA 1AR61 3OUHA 4HKWA 1POV3 5C5TA 2E6VA 2A6VA 1TMF1 1W04A 1QJY3 5IK5A 3T4VA 2WABA 1O3SA 1PK6A 5BNOC 1CR7A 2ID4A 1DU3D 4HSJA 3ZDVA 1SCSA 3JD72 2W08A 1HB4A 1DYOA 1ULGA 4XTMA 1LENA 1KFXL 3PVNA 4R4XA 3AX4A 2Y26A 4OI4A 4YPJA 5L36A 2Q8OA 4F3JA 1OOPC 2XKOA 2LW8A 2Q5TA 5HCFA 2OPKA 2P3JA 3WNPA 2WLQA 1UY1A 5ISLA 2RDNA 3IDCB 1G9BA 2XLGA 5CKNA 1RVF2 3ZSKA 4AEDC 1W8NA 5DQ0A 1NQJA 3LZZA 2UYBA 1QY4A 3H8UA 5A3WA 1H1MA 1LR5A 2N7GA 4KQ7A 2PA7A 3HQUA 4CCEA 5D8AA 3WW4A 1TE1B 3DECA 1RUJ1 4O9EA 1O8PA 3RZMA 1TG7A 1VBA2 2DUPA 4NHYA 4KU7A 2W52A 2B46X 3NNLA 4XFCA 4LHSA 4NPLA 4TXWA 2B9UA 4QT6A 4GMP3 3P5BA 2RDRA 2WZR2 2JB4A 2ZAAA 4GD4A 5A6YA 2GAUA 5LA1A 1GLHA 3DKQA 1LNSA 3WF0A 4LBQA 5A80A 5B2GB 2ZMLA 3PUAA 4Q4W3 1VBC3 4MVTA 5EFUA 5F6KA 4Q4Y3 3N35A 3RSJA 4XQ4A 2HWF2 2R32A 4LEJA 4AG4A 4CDQA 4DUXA 3RVHA 4Q4V2 5FPLA 1XE7A 3DF0A 2Y33A 1QGLA 4JAAA 3ZPYA 1W0PA 1G8WA 4P9WA 4L11A 1FX5A 2Q8EA 2H0VA 4K7JA 2PQQA 4OZOA 5IFPA 5FLIA 4FAGA 4ZXKA 3V0BA 5KHJA 3VV1A 4CP2A 1KDKA 4E8DA 4XF9A 2P4EA 4XQWA 1CVNA 1HRI3 2DBIA 4BQ1A 5EYYA 2FMDA 4YGCA 4D7YA 5JOXA 3WLUA 1GFF2 4E27A 2EXJA 2WFF2 3BTZA 4O61A 4IEVA 4PQ9A 5J09A 5JIUA 1UYPA 3H1WA 4YW1A 5I0UA 4CDUC 4CCMA 3DYPA 4AK3A 3K3OA 3Q8FA 1AZDA 1OC1A 1J83A 1UZ0A 2QCSB 4CP1A 4PIXA 4AR2A 3C7OA 4OVEA 3KCCA 4WVVA 3TB0A 3VZMA 3BU0A 3UKTA 1U5ZA 3KF5A 3I2IA 1ULPA 3DYMA 1JW6A 5FYMA 4AVSA 4UW6A 4D69A 4DFSA 4NAOA 2RR13 4XJZA 4C0BA 3IWZA 4HPKB 3H8XA 1GWKA 4LO8A 2RS12 3AXDA 2DCZA 1DBNA 5C3SA 3SXWA 3POWA 4PIYA 3N9PA 1SLCA 1HW5A 2XQRA 1VMFA 3POYA 5FV3A 3W58A 2R1DA 3PLQA 4BQ2A 3PUHA 2G9GA 2HWB2 3WT3A 3WINE 4JRAA 5FZMA 3HT2A 3I2FA 2FBEA 4QPGA 3NL1A 2Y64A 1PMIA 2GP5A 1LOFA 1AYN3 1XOYA 3HVDA 4ONUA 2BGOA 1GV9A 1XNCA 4B1LA 1UZWA 1AR63 2DCKA 1K42A 2W39A 1FATA 4DZGA 1TMF3 1R081 2TEPA 1K5MB 3ZMNA 3WW3A 2VOKA 3USUA 3EO6A 1GZWB 1QF3A 2CWSA 2PAKA 3AM2A 4HMZA 3POGA 2YC0A 1DHKB 3SH3A 3UGGA 2FCTA 4XABA 3FX3A 1YJLA 2GALA 3O0VA 5LK7B 5EV7A 4BMEA 1UOBA 2JENA 1UZVA 3IMNA 4Q8LA 5C4WB 1COV3 2KM2A 2E9QA 5AC93 2XOMA 3R4UA 3X29B 3AMHA 2DVBA 2QQWA 4Q0SA 1ZX5A 3ZOIA 2RS33 1WBFA 1YFYA 4TTGA 1UY3A 3VKMA 2XONA 2ZX1A 5F5AA 3MZHA 5IK8A 2YGLA 5LCWL 5JZGB 1SEFA 3KT4A 4Y1UA 5FK8A 3KGZA 4LHNA 2ZXQA 2VQAA 3H50A 3LA2A 2VOXA 1RUJ3 2FDIA 2PQSA 4ZHNA 2BFUL 4YWAA 4QPIA 4D7TA 3H8OA 4YG6A 4AHZA 1D7PM 1VBB2 1ZRFA 3KVAA 4FPCA 3WOGA 1QNYA 3MGUA 5FBJA 2AH2A 4Q5OA 1CAVB 5FZIA 5JOYA 5A3MA 3T3YA 1ASJ1 1VPHA 1GZCA 1TQ5A 4LORA 1FOD1 5FXXA 3O0WA 1WD3A 2A6XA 4HVOA 4AAXA 1X8MA 1JTZX 4A7KA 1JN2P 2WZ8A 2RDQA 4P08A 5F5IA 2VZ3A 1ZM1A 3I8TA 4MX3A 3Q8BA 5A32A 3MBWA 3POIA 1JZ3A 4I0WB 4FCAA 2ZPXA 1XYPA 2XXZA 4M3CE 4XDOA 2JIGA 4AFDA 2OIIA 2FDJA 1AR81 4YNIA 5APAA 2CAVA 4FP2A 2O14A 1YFXA 2VZUA 5CFDA 2NM1A 1WZXA 1JHJA 3ZXGA 1I5PA 1UOGA 1WWYA 3OPTA 3IN9A 1OSGA 5H9RA 1CGPA 2VPVA 5FP3A 2Q1MA 3VBHA 2HWC2 3OGVA 5FUNA 3ZSEA 2NQYA 3F95A 1JZ4A 3GZUC 1TNRA 3FWEA 3IB3A 2QQIA 5DZEA 5FZ8A 1O3QA 3QCWA 4LT5A 1GWLA 1G7YA 3NNJA 5FYZA 3SEEA 3RS6A 1OPOA 1T2XA 1D4M1 2Y0IA 3H1MA 1V9U3 2MEV2 3I3QA 4TYSA 1UL9A 1CN1A 1W2AX 4FOQA 1UYZA 4V1PA 5FWEA 1DYKA 5F5QA 4Z07A 5GLTA 3LPFA 4CU6A 1QH6A 2RS53 1W6QB 4QB6A 2Y8KA 4D8MA 1AL0G 2BERA 5FZ3A 3B5LB 2BZDA 2ZHMA 1NCQB 2PHFA 3N7JA 2KR2A 3S5QA 4BA6A 1H2NA 1OF3A 1ZA4A 5J1XA 2R0FA 2G19A 2VU9A 1MACA 4CCJA 2YU1A 3I54A 5KHHA 3LDRA 5K8SA 1DF0A 1LRHA 5IW0A 1GMMA 5M0TA 1CX1A 1BLZA 1NLQA 3SKVA 2YBPA 3OD4A 1RUD1 4P9YA 3FHIB 4OZXA 1WW5A 2CGOA 4F83A 2B9VA 3OUIA 2W94A 2D3RA 4L92A 2JKXA 1SLBA 3MPBA 3V65A 3J7NA 2ZHLA 2CHHA 1V00A 2J1AA 1R083 2HBUA 3PHMA 1ND3B 5DDJ3 5F2WA 4A4AA 5FYCA 1WCSA 3WSOA 1CESA 1ZZ8A 1QH7A 4E4ZA 3WNOA 5BNOA 4EN8B 3FUQA 2WO1A 2LS6A 3E5UA 3I2GA 1RL3A 1VALA 3RMYA 1GP4A 2IWGB 2VXJA 2XJUA 3ZXFA 4ZU7A 2IZWA 2DVAA 3NWKA 5FXWA 1K5JA 3POEA 1OOPA 2VD7A 2IFWA 2VQTA 2VVFA 4ARXA 3ZVXA 1RUI2 2JE9A 5T5JA 5J48A 2R041 1GWMA 1CD3G 1IG3A 5CKQA 4YVWA 3ST7A 3DCQA 2D6PA 4K6BA 4B4PA 2B8MA 5CBLA 3QBQA 5JPMB 3THPA 5KXCA 4BXFA 1K5MC 3KCYA 4GH4B 1LHVA 2R061 4XQDA 3VBRB 3ZN5A 4HFSA 3ZFFB 4AGGA 2VBDA 3Q9OA 3KV4A 3AYAA 1QJU1 3M8LA 1UZZA 5F39A 2JD4A 1H2LA 3ZXJA 3I2OA 3J7LA 4YVSB 3VDDB 1GU3A 3C8XA 4WM7B 4CE8A 4E4DX 2GMEA 1W8OA 1YI9A 1ULEA 4LUMA 4COYA 1FYUA 3KGLA 4N8MA 1AR71 3WDXA 5C4WC 1L7RA 1ND2A 1ZZCA 2MNGA 2ARXA 2JJ6A 4XHBA 5KWRA 1DDLA 2AREA 3IDBB 2HYKA 3WQ0A 2V4VA 3UJOA 3HNBM 4RFRB 4BISA 2AACA 3RYKA 2VR4A 4NIAA 1X8EA 2OVUA 4ZU4A 4ASMB 5DZGA 3WG3A 2W87A 2JWPA 4Q4X1 2NMNA 1XE8A 1OUXA 5JZGC 2Z2SB 3M4FA 3UESA 1UWWA 1KJRA 2OPWA 3HR9A 4WM8B 4AGRA 4E4SA 3CBNA 2XH6A 2OS2A 1Y9MA 1AR83 2PAMA 4WV8A 4HONA 4CCLA 1GKBA 5FYBA 5LA9A 2H6CA 1CAWA 4BQXA 2W47A 3WNMA 4WBBA 3GHMA 5GLZA 1S55A 2XL9A 3CDZB 2AZ5A 5CU1A 1C4RA 1LGCA 2RM22 1RMU1 1YRZA 2BRTA 4RHV3 5JSRA 3SITA 2XBO2 1DGRN 3T1MA 1CZVA 3MF6A 2QKDA 1D4M3 3IDEA 3AYDA 3K4AA 4XZPA 1RUG1 5K0UB 5C8CA 3BTYA 2OT7A 4M01A 2Y6GA 1EAH3 1W0OA 2ZEYA 5DAQA 4RR3B 4IGQA 2BJSA 1OLRA 2D44A 2VNVA 4YSFA 1ENQA 4FPFA 4IL7A 2XLAA 4HL0A 2R062 4AI9A 1PO22 4UWDA 4BYYA 1LOAA 2D93A 1S1AA 3I3DA 3KLSA 3P6BA 4ITCA 4QDSA 4BIOA 3NJXA 3FL7A 3MLJA 3WV6A 1TME1 3O7OA 5FMDA 3FHAA 1F31A 4KL1A 5LZ6A 4YZ3A 2A6WA 1PGW2 3BIWE 3IPVA 4JQTA 4X8NA 1PO12 1AR72 1S0JA 1VBE3 3WXPA 4D6RA 1LTEA 4WVZA 3W9AA 4Q26A 1PGL2 5I0DA 2E51A 4XFIA 3S7EA 5ACA1 3BODA 4Q1RA 3PNAA 3ETPA 5FLHA 1WKYA 5GKAC 1CQ9A 3CU7A 5E88A 5JSPA 1RUC2 1MS3A 2DTWA 2BFUS 4YRDA 1BMV2 4S2HA 2BP6A 1XNKA 5FZEA 1AL22 1X9PA 4XPVA 1RB8G 3MI8A 4XVHA 1NCQC 1RC6A 3UV9A 1LCLA 1GQPA 2EICA 1Y3TA 5C6CA 5HI0A 1KS4A 3ES1A 1PVC1 3ETQA 3UK9A 4Q27A 5FY4A 1BCXA 4CCOA 1OKOA 1BEV3 2FDKA 2OX0A 2XQXA 3GCWA 2P2KA 4H7LA 1HN1A 4LBMA 4QX1A 1QJFA 3OGSA 4KGGA 5A3PA 4XF3A 2R043 5C3RA 2XMLA 4Y20A 3EHKA 3NNFA 3B01A 4YW2A 1VRH2 1XNAA 1RMU2 3AJZA 2C26A 2VECA 1AR93 3U07A 2ADDA 2LRPA 5C5UA 4UFHA 5I0TA 4QXHA 2R072 3GYDA 1NKGA 1K3IA 2DV9A 4N43B 1ND3C 4HK8A 4M0HA 1K12A 2X29A 1LGBA 4LHKA 3ZN6A 4FO9A 5DAPA 1QJU3 4AEKA 4DRVA 3RI9A 1C8M1 1W8HA 2Q0AA 4YZ1A 5FY7A 3E5QA 4MGSA 1C28A 1H4HA 1YQCA 1WCQA 3VZLA 4D94A 5CADA 4IE6A 1Q8PA 1G9AA 2ZHNA 2ZEZA 4EWEA 5IT6A 4CUCA 1HV0A 1WBLA 4AOCA 4Y33A 4Z2WA 4G3YC 2HWD1 2JE8A 2A71A 2PAEA 1DP0A 4DXRA 2E26A 3AJYA 3PURA 4CEYB 3GBWA 2YHJA 1W9YA 3CMGA 5DUUA 3RMXA 1IS6A 3RNSA 4Q4X3 5F3GA 3AB0A 4LUKA 1RYYA 1IS4A 1RHI3 2YG0A 1UKRA 1LJ7A 1RUH1 2HEVF 2X5IB 5ACA2 3BKZA 1LHWA 4GH4C 2D7FA 4A44A 3VBRC 4K1ZA 4BK4A 1REFA 3ZFFC 3ZYFA 3A4UA 1F8VA 4QGLA 4I0BA 2J1RA 1LHOA 1Q3EA 2EA7A 2ZHKA 4YVSC 3VDDC 4WM7C 1HRV2 1PIV3 3LWCA 3OF1A 1JOPA 3DL3A 1CZTA 3LD8A 5FAXA 2XDVA 2YV8A 3WCSA 1OQEA 4MZUA 4EE2A 5J3UA 4QQ2A 2VZSA 5IVFA 1V6KA 3WEZA 4M3CA 5EP9A 4MXVA 3OG2A 3VL8A 3VD4A 2JIJA 1X9TA 3OBZA 1QNWA 5FYIA 5IVYA 3AP7A 5KC5A 1H8TA 1LODA 1POV1 1UYYA 4YYOA 2C0ZA 1NLRA 1Y43B 2A73B 4CDWB 1OVSA 4WM8C 3GCXA 4GJZA 2ZX2A 4E2SA 1OA3A 4QKBA 4IQPA 3VBOA 4QX7A 1AYM3 1ZRDA 5FZFA 2VMGA 4KH9A 1LHNA 3ZIWA 3TNPB 4XF1A 1S0DA 1TME3 3WR0A 1HQNA 2Z79A 2NYYA 3RZJA 5LB6A 4UBHA 3TRSB 4EWDA 2EXKA 3B9CA 4CU9A 2OYZA 1R092 3O1PA 3S57A 3SH5A 3DPRB 1N47A 5I0RA 3BI3A 5K0UC 4PF1A 3WDWA 2GDFA 5FZLA 5BNNA 5CZKA 3SH4A 4O9GA 3D0SA 3GGLA 3FLPA 2VZRA 4GZ9A 4RR3C 4QM8A 5G05L 1ULOA 3VZOA 2DDUA 4CXYA 5EIYB 3IMMA 3JB4C 4H7MA 4IE5A 3R6SA 4DO0A 5BNPA 1LOEA 1S4CA 5L7OA 1X36A 1PVC3 3VHNA 4CDXB 1H1AA 4GXLA 2VVDA 4R9BA 3IKWA 2WQZC 4HPKA 1ZBA2 1SQ4A 3B00A 5FO9B 1ZRIA 2ZGUA 4GMP1 1NA1A 5DG1A 1A3KA 4GJYA 2NPIA 3WHUA 2XWJB 1MEC2 2W9XA 4OCTA 2EIEA 2WYFA 4Y1XA 1N3PA 5IAVA 2Q1ZB 4BB3A 5K9YA 4BH9A 3VZKA 4OHWA 3AKTA 4C1XA 3POSA 5DPNA 1AJOA 1PHMA 1VBC1 4KU8A 1JHNA 3R0RA 1YEWA 2KD7A 5CIRA 4YFWA 4EYUA 3K4ZA 1VLNA 1YFUA 4LPLA 4RS5A 4LULA 1HIXA 2D6NA 1AX2A 3M3QA 4PQQA 3DN7A 1C8M3 3ZYBA 5I93A 4FQZA 1QJY2 4ZS3A 4NIHA 4FQ4A 5I0SA 2VVEA 2A3WA 2BUKA 2HWE3 4FPGA 5D1IA 2GNMA 2BOJA 3UT0A 4EN9B 4QB1A 1EPZA 2PHRA 4FOVA 1B35B 2BBAA 3QH7A 2YPJA 4IDZA 4V2VA 4YGEA 1GOGA 3ZYJB 3ZIXA 4LOTA 5JI7A 3T0BA 4UF0B 4YGBA 1EPWA 2B5HA 4XEZA 1W6MB 3ACLA 1O3RA 3APBA 3JBG1 5EHDA 1IQDC 2CNAA 4QWNA 4MV2A 2J7MA 1HXS1 2P3IA 1RUH3 3NO8A 2UU8A 2IXKA 3MW4A 4N43C 2DVDA 3BPSA 4XDQA 2NLRA 2XVGA 3DGTA 1DZTA 1H2MA 3P3PA 2A75A 4M0NA 3ZFGB 4MH0E 3ABZA 1V6JA 1ZBE1 4L9BA 5A6XA 4PHZA 1H6XA 2GH2A 3VBSB 2IXCA 1CAVA 2WFPA 3D3AA 4K20A 1ENXA 4RQPB 4U36A 5A7WA 4CP9A 1CAUB 3ON7A 3IIAA 2WC2A 2W91A 1OLME 3SC7X 1JOBA 1SLLA 2QQOA 5AFEA 1J1TA 4QGMA 4CEYC 1VBD3 3K3NA 1F5FA 1YUDA 4UW5A 2ZS6B 4FXGB 1SPPB 3U10A 1VJ2A 4LE3A 5CFCB 1F35A 1Z7S1 4NPRA 4D7SA 4JV4A 5FP8A 3KWVA 4Q4W2 1PX4A 2MHFA 4QQLA 1LAJA 2X5IC 1AX0A 4Q4Y2 1O4YA 5CISA 2FD8A 3OBRA 2TUNA 2VW0A 3MHZA 4FAHA 5FMOL 2K2SA 2JDZA 5FZ4A 1QEXA 5CKMA 3AL6A 4IE7A 4LO7A 3ZSMA 1DZQA 4OI0A 1W9TA 2OA2A 1CPMA 2J1UA 4QKFA 4UI9L 5GLWA 1NCRB 3CKHA 4MG2A 1COV1 5A3OA 1VIWB 5AC91 5BUVA 2ZAHA 3CJIB 3MLLA 3BTAA 2BTVC 5F3CA 5HCBA 2RS31 1HRI2 1W6NA 2O0OA 4Y4YA 2Y6FA 3AZWA 4LBOA 5CG8A 2NP0A 4BIFA 4NRQA 5EJ1B 3VLBB 1GZTA 4OI2A 3U75A 2WNUA 1SFNA 3E6CC 1MPXA 5KHGA 4CDWC 1KJLA 5J98B 5IJRA 1W6QA 5A7NA 2DU1A 4QQOA 3NRUA 1JUIA 4QU1A 3S6PA 4EN6B 1NCQA 2HKXA 3JCIA 5C8WA 5FQ0B 5FZ7A 4TWTA 3PU8A 4IEXA 4LKEA 4AE2A 2RR12 1YC61 2JDYA 1UPSA 1IZ3A 1WCDJ 1ZZ7A 3HNYM 1LU2A 4XIOA 4DUWA 2IUWA 5FYVA 4AHWA 1NY71 3ITQA 2DURA 3LQCA 3N9OA 2D5FA 3DPRC 5FY9A 1UX7A 2ZACA 3G7DA 2ADEA 1C5HA 2WZEA 5F32A 5T5PA 5FP9A 1AYN2 4LBKA 1U5YA 4PDWA 3VB9A 1ND3A 2RMU2 3A22A 3LOIA 3M2MA 3I4IA 4XDPA 5ANQA 1FI2A 1AR62 3ECQA 5EXOA 2WS93 2K9ZA 1TMF2 4BQYA 4KG0A 5FY1A 1VR3A 2VH9A 1SBEA 3AVRA 4BLIA 3QLQA 1STMA 4K3UA 5L9BA 2DF7A 5IHRA 4A7YA 1OT5A 2D40A 3WW1A 4DINB 5L19A 1XYOA 1AVBA 2WQ4A 4UW3A 1YHFA 4CDXC 3VD9A 4FI9A 3WDUA 5BV6A 2PTMA 2PHLA 2XJSA 1POQA 4QX2A 1WA4A 5E16A 3I3EA 4CZSA 1U0AA 4IEZA 5GZFA 1EV11 1LU1A 2AENA 5HCHA 3JXSA 4CP0A 2DCTA 3JBG3 4O65A 4LBNA 1J1LA 3FC0A 3WUCA 4CCCA 1V9U1 4EJRA 1XU2A 2RS32 1RJ7A 1C1LA 2V72A 1HXS3 2ZMNA 2QZ3A 2P1BA 4B4QA 3LA3A 4C91A 5BY5A 1V6IA 1L7QA 4ZS2A 2W3JA 2DTYA 1YWKA 2RS51 3BALA 4GH4A 4N9HA 4QXKA 5GLVA 3RWKX 3VBRA 3GM8A 3ZFFA 1F15A 1ZBE3 3K2OA 3MV11 1RUJ2 1W8ZA 5FRAA 3VDDA 3KZ4C 4K8FA 4N53A 1W90A 4IV1B 4XF4A 2WZPP 2VOVA 1B35C 1VB4A 4LIUA 1DLLA 3GXUA 2PHWA 5LATA 1BXHA 2GU9A 2RHPA 4FT8A 3RJRA 2Y38A 3V0AB 4IV3A 3HQXA 1UXXX 1UU6A 4ARYA 3GDBA 5A33A 4LITA 1HQWA 1UY2A 1Z7S3 1NY72 4HVRA 4JGZA 5DDJ1 3EB7A 1VMHA 1YXWA 3NJVA 1SLTA 1PZ9A 1U5XA 4OULA 2YB7A 3AK0A 1YI7A 5C33A 1RITA 1NX9A 2P3YA 4KWLA 3ZFGC 1OUSA 1UN1A 4Z82A 2BGCA 2CDOA 4OUMA 5DG2A 5CAZA 3VBSC 5IUQA 2QE3A 3BN6A 1DGLA 3HBZA 3ZYIB 4GWIA 4FFFA 1WLTA 4A3ZA 4RQPC 2IVIB 1MZ5A 1W06A 2Y6HA 4CTEA 5K4LA 1W2NA 2ZABA 5CB7A 1PX3A 3VBFB 3CL1A 5JDBA 1ZZ9A 2W2IA 3TEYA 1VB2A 2VMHA 2EALA 1HJFA 3GF6A 5LEJA 4MGTA 1MZEA 3AMPA 4Q0PA 1AUYA 3L2YA 1UNBA 1NXMA 4XTPA 1R1A1 4E9KA 3THDA 2XGXA 2WKKA 5CFCC 4Q8KA 2WWUA 1V9U2 4K21A 2WYSA 2Q8DA 2R6QA 2VUDA 3T4HB 2O1QA 3WP6A 3M3IA 2GC3A 4ATFA 2R0HA 3IIIA 5A1FA 2SLIA 5T5OA 1O59A 2RS52 2WFF3 2ZGSA 2QQKA 4BQWA 2ZX4A 2BW8A 3MYXA 3OPWA 1YQ8A 1MS9A 1RUF1 3NV4A 3SHRA 3PVBB 2PHTA 4RYDA 4UAPA 4NOTA 4OHXA 4COVA 4UFKA 3OOXA 2VXRA 3ATGA 4P9XA 1J3PA 1NCRC 2KXLA 3ZO0B 3GJBA 1UMIA 3KB5A 4B7KA 2Y60A 3WDVA 3BCWA 2CWMA 3B9IA 3CJIC 5DZFA 2XLFA 2RJ2A 4QDQA 1KS5A 1BHGA 3B93A 3AFGA 1TEIA 1HB2A 1OFNA 3U14A 4G9SB 2RS13 3ELNA 2EIDA 4KBZA 2XL7A 1DQ1A 1D0HA 4RGKA 2HBTA 4DNYA 4IEWA 1R082 4HN1A 4RN5A 4ZPIA 5LEKA 4NIDA 2HWB3 2JG9B 4AHYA 4GB33 3ZFEB 1ENSA 5F9TA 2I2SA 1JYVA 2A3XA 2BWAA 2P5BA 1XJAA 4RGAA 4Y1YA 5I91A 2EF6A 4R52A 5IVBA 1VE0A 2Z42A 3WP3A 4LLOA 3CF6E 4QX0A 5I8SA 4AYUA 3SCHA 4ES8A 3FBMA 3C7EA 1BBT1 3UYJA 1MS4A 3HJRA 3WF3A 4HN0A 1EV13 5F3IA 3KF3A 4RHV1 4AW7A 3PTRB 4MO3M 1ST8A 4LQRA 1PK6B 2OZ6A 4X8PA 5FPBA 3TWIA 1UD1A 1LULA 3WG2A 4BU2A 4ES9A 3S30A 4GULA 3BOPA 1KEXA 5JLVA 2OUHA 5FWJA 1EAH1 1ZYBA 4C90A 4NE9A 1A6CA 2ZA9A 4N43A 5JMOA 3VHRA 2X05A 5FMOS 1ZNPA 2J22A 4XACA 5T5LA 3CIHA 4NRPA 1UF2C 1WW7A 2VNGA 3WQBA 1FNYA 1J3RA 1QOSA 2F4LA 1BK0A 4K1YA 2RVAA 4XFBA 5E8AA 3U78A 4DXTA 1ACCA 5FK7A 2VBPA 1H30A 3UGHA 4QAWA 1ASJ2 2XPJA 2EAKA 4I09A 4UFJA 5FXVA 1JYTA 5GM0A 1FOD2 1VBE1 1VBB3 2E63A 1FMD1 3CLPA 5D8AB 1SDWA 2WNVA 2YFZA 4J1WA 2C4XA 5CG9A 1CIYA 1WMDA 3N36A 1SMVA 5LY1A 4DXSA 1OD5A 4AQ2A 2QQUA 4X6RB 4DMIA 5JIAA 1I1EA 3CQOA 2E7QA 2ILMA 3C3VA 2OXBA 1XNTA 1PZ8A 2X5IA 3OBTA 1FXZA 3KVBA 5IATA 1OLMA 3PU3A 3TN91 4R4ZA 2XJRA 5JUVA 2CSGA 2JDKA 3ROUA 1LOCA 5KC6A 5EYXA 4XMAA 1AXKA 4I3PA 1AR82 3C7FA 4IGOA 1BQPA 4J1XA 3VD5A 4UT5A 3C7HA 3TEZA 1UX6A 4QX8A 2VTFA 3I2JA 4LBQB 4CEWB 3QOPA 1BEV1 1MQTB 1GP6A 3KV9A 4IV1C 2FZ2A 2D43A 3RZKA 3JZVA 1NE6A 1TNFA 1G86A 2X8KA 4P00B 3W21A 1R1ZA 2PN5A 1IGOA 3OEBA 3A0KA 4KWKA 1AR91 1WUVA 3AKRA 1LKNA 4ISQA 3T2QA 4AEDA 3LFMA 4PJYA 3KT7A 2VQ0A 1R1A3 1DLCA 4DB5A 1D4M2 1QJX3 1LB2A 2D98A 3CZJA 3URFA 4AQSA 1OLQA 4RSUA 2VW1A 5FDBA 3V0BB 2HWC3 1OFSA 4Y1VA 3THCA 4OI1A 4BK5A 4CDWA 5HXVA 4AGVA 2YXSA 5LRRA 2JD9A 1Q5OA 5KHIA 1H9WA 3R4DB 4XFHA 5CVRA 5G04L 2E32A 2DFCA 2VCAA 1RUF3 2JX9A 4NRMA 1UY4A 3S0MA 4W6YA 4Q0VA 4NO4A 3PTYA 4Y4RA 4YW3A 4Q2FA 4YW5A 4H14A 3O1OA 2ZBJA 5T50A 1V70A 4NHKA 3MDPA 3N7LA 4EN7B 3U11A 1H9PA 4ISRA 3VBFC 5F8PA 4F8AA 4NWVA 1RUD2 2WO2A 2WT0A 2FCUA 4AI0A 2BNNA 2JECA 5FXZA 2J1TA 5L73A 1C5IA 1YJKA 3IBMA 5JR7B 3J7MA 2UWBA 3I97A 4GWNA 1DQ6A 4M00A 3FN9A 4P02B 5FYSA 4FPKA 1RHI1 4ASLA 1Y7BA 5A3LA 1BZWA 4AVTA 4FPLA 1XQNA 3AZZA 3J4UH 2ATFA 5FJKA 4EQVA 2BQPA 2GNBA 4I01A 2DUQA 1RJ8A 3OSDA 4LE4A 4QPGB 1IQAA 1PIV1 2ZGTA 3QH6A 4MHUA 3I49A 2V4AA 2ZEWA 4JHTA 2VE1A 1BBT3 1DIWA 1V6NA 4YZ4A 3ZSLA 2XJTA 1V0AA 4XJ9A 2WAAA 4OHZA 3WF1A 4LBLA 4FSJA 5IK7A 3NJYA 4XILA 1C57A 3CZUA 3J8F1 4OHYA 2UWCA 1QKQA 4MSVA 1UMZA 2D6OX 4JC1A 2R042 5GALA 3UKVA 3T30A 4MXWA 2ET7A 2YBKA 4RL7A 1W6PA 4CDUA 5LA2A 3HN3A 4UFLA 1VAMA 3WF2A 1MZFA 3D6EA 1QXJA 1W6OA 5FBZA 1A8MA 1LEDA 2DUOA 2JG9C 2C5DA 3ZFEC 1AYM1 4XMIA 1JU3A 1N3OA 2WO7A 1QJU2 3HOBA 5FZ9A 1OHFA 3AKQA 3AP4A 1MS5A 3UETA 3I59A 5FZOB 1QXPA 3OYWA 4J6GA 4A2UA 4JKKA 3FFZA 4NPMA 4ZKTB 1HB3A 1LHUA 1UXZA 2J1EA 4HBNA 1OURA 1QQP1 3PL0A 5EJ3A 1FMD3 2G1MA 4NUBA 4UF0A 4OQ8A 3G6JB 3ACFA 2GC2A 1PK6C 3NMBA 4FPHA 2G4IA 3J9SA 2YU2A 3VD3A 2H0BA 3WNKA 4CXXA 1ALYA 1D0GA 4ZZ8A 2PLV3 1PMJX 3Q8CA 4N90A 2F17A 4B1MA 5JCTA 4COWA 4Q4X2 3OY8A 2HH9A 2BVVA 3WDTA 1VRBA 4AAPA 1GQGA 3M70A 3IDAA 3POBA 4MGYE 4XBNA 3TN93 5FOBB 1RHI2 1I5ZA 4YLZA 2ZGKA 4XAAA 4CUBA 2BBVA 3ZFGA 4I2OA 4G4FA 4CU7A 4YW4A 3I3BA 4FOWA 1PM4A 5B4NA 2ZGPA 4OUSA 2AR6A 3VBSA 4ASKA 1NE4A 1W28A 4BQ5A 5FKCA 4AXOA 3RYPA 2FDHA 4RQPA 1N1TA 1CAUA 1PIV2 3WW2A 1CIWA 1OF4A 1JH5A 4AVCA 5A32B 2ZX3A 4HETA 4LA2A 5IK4A 2IC1A 1JU4A 2B7YA 2VUJA 2YFUA 4U2AA 4LTAA 5D8AC 3GJAA 5FYTA 4YG0A 1SPPA 2CV6A 2ZGLA 3MW2A 2VZVA 3AKSA 3KT1A 4W65A 5GZDA 3ZXKA 4AEJA 5CFDB 2AYHA 1RUG2 2OQ6A 4FBFA 5CFCA 1JZ8A 1APNA 4LA3A 2SBAA 2Y34A 2G9FA 2W1SA 2BPA2 3RJ2X 5GZCA 4A6SA 2XBO3 3KM5A 2Q4SA 1JZ5A 1LGNA 1HX6A 2PXJA 3O5SA 3RFRA 3S7IA 2HWE1 2GZWA 1AYM2 5FZKA 3IZOA 1F9KA 4OMCA 4CEWC 2ZMKA 1MQTC 2C9AA 1H0BA 4MOAA 5LASA 1L7LA 1DG6A 2HEYF 1XNDA 1TME2 3B94A 4HOOA 1Q8QA 1ENRA 1RUE3 1I3HA 4P9IA 3AP6A 3CJIA 4TSVA 2ZEXA 3VKFC 3WVJA 2FQPA 2I45A 1W8TA 3H3UA 1PO23 1KQRA 3ILFA 1OMIA 4QD2A 4C1WA 4BQ4A 4DRRA 4YM3A 5E6HA 3ZSJA 2R16A 5C71A 2V5YA 3U0ZA 1N3QA 5B4XA 2EXIA 3OPZA 4LKFA 5JPNB 1SCRA 3K48A 2JG8B 4AVBA 2YZ4A 4FTSA 4OFGA 1E5HA 4BM8A 3CNAA 5FLJA 3AP5A 4KBBA 4YM1A 5GLUA 2W68A 3D8CA 3AL5A 3UGFA 1OH4A 2PELA 1PVC2 4CVUA 1K45A 3ZR6A 2Q30A 1GR3A 3TEWA 4FTEA 5A7PA 3RYRA 3ZXEA 3J8F3 1QOOA 2K0GA 3JU9A 1VBD1 1OPMA 4M3CF 4Q0UA 5IVEA 1H8VA 2PYTA 2A5ZA 1U5IA 5SV5A 2WNEA 4WVMB 3VHOA 4HANA 4RFT0 3MPPG 2LROA 3WCRA 2IXIA 2VOWA 3EXUA 4HSLA 2QDRA 3KMHA 1OA2A 2ZGOA 4YW6A 1KGYA 1FAYA 5A7SA 4E8CA 1OXCA 2ZOEB 1VRH3 2WDBA 3FBYA 4A7ZA 4Q1PA 1C8M2 2VMDA 3N9LA 4UYBA 4EN0A 2XJVA 1C1FA 4YVWB 1CX4A 4QPGC 2R073 3DYOA 1CZSA 3RPQA 1LOFC 4JGYB 5JOWA 1QQP3 1W39A 2Y6LA 4BJ0A 2P37A 2HWD2 4PI2A 1MS8A 4OUEA 1CJPA 4HXCA 3B3QE 1P8JA 1NXD1 4JTOA 3JQXA 2W95A 4CCDA 4L99A 3ZYRA 2D5HA 1IG0A 3H9AA 3JUUA 1J84A 3ZM8A 4NR1A 2GC0A 4HKOA 1S2BA 1Q8SA 3OTFA 2XHNA 4N9IA 3TNQA 4TZDA 2XG3A 5C3PA 3VDAA 3LGRA 1IPJA 1RUH2 1WA6X 1ND2B 4XCBA 1QWRA 2B39A 3INAA 5LA0A 1VAKA 3PJYA 4F7ZA 4Y5Z0 4HK9A 2VULA 4QKDA 5EQUA 2XB6C 4JHZA 2I74A 5FYUA 3ENRA 1XC6A 3MF9A 1US3A 2E7TA 2OW4A 3Q8EA 3E5XA 3SLIA 3H1YA 5KXEA 4RGGA 2WIIB 1JZ7A 1SHWB 2LUWA 2YROA 2VZQA 2DU0A 1YFWA 3V0AA 2PHDA 2QQJA 2YGMA 4PLMA 3K51A 1YQ5A 1CAWB 5FZ0A 1HRV3 4QDRA 4UFMA 4E2GA 5GZGA 3GBGA 3K4DA 1K5MA 3EYPA 3OGGA 3EQEA 2JICA 4IEOA 2Z4FA 2WS91 3P1IA 1GZWA 3AVSA 4IW3A 4AFMA 1XRUA 1BJQA 2B45X 1PZ7A 3TOJA 3VKLA 4YZ2A 2BU9A 2QQPA 3H0OA 4BZ4A 1WMXA 3LA7A 4NN0A 3SMHA 4A41A 1UU5A 3AMNA 1TZOA 1UOJA 4BPZA 2QQNA 3C2UA 4HKLA 3OEAA 4LO5B 5FCCA 4AQTA 1JZ2A 4L0PA 1UIKA 4AWDA 2QJVA 5C8CB 5C4WA 3LEMA 4DEQA 3FZ3A 1GICA 2PHUA 3H3LA 4NMIA 4PLNA 1KITA 1N1VA 2HJIA 4GQ7A 2E31A 2IFRA 4R9AA 5FP7A 5FOJB 5C7GA 3JD71 4COUA 2MPFA 3NNMA 3A7QA 2IXJA 1IPKA 1LECA 4M4RA 4DPNA 2YY1A 2ZX0A 3IAPA 5FZ6A 4TN7A 5JZGA 5CFDC 2A3YA 3N7KA 2GN7A 3O0XA 4QPYA 5CNAA 2BGPA 3MO4A 2XJQA 5D2AA 1Q56A 4MLOA 4QXCA 1WW6A 2D6MA 4LLFA 1R093 5EZWA 2WR9A 1RVF1 2ZGMA 1U12A 4A6OA 1Y9GA 2VUAA 3T0DA 1UCXA 2XUMA 1ONAA 4KGQA 1IS5A 2GSYA 3VGIA 1RUNA 1ZRCA 4XFAA 1FT9A 5EPAA 3VBUB 1SDDB 1JYNA 2W5FA 4ZZ5A 2WINB 2GN3A 4PLOA 3FLTA 2ET1A 4MYEA 1F5JA 2LALA 2OQ7A 1JODA 3NSTA 1F4HA 2VAUA 2RG4A 3O12A 4GWMA 4OMDA 4QM9A 3ASIA 4QXBA 1VBC2 2R7EB 4O7XA 4WZCA 4XUTA 1HQLA 2IVJA 2VCCA 3K75B 3RZZA 4IGPA 1PNFA 2JG8C 1NG0A 2IXHA 1G6NA 1G9FA 4JDMA 4LR4A 4PBPA 4UOJA 4AFBA 4Y20B 5F7UA 5IWFA 2A7AA 2NZ9A 3M3EA 4EROA 4EWAA 2YDEA 3OB8A 3B69A 5ERLA 2J42A 3ORJA 3R4SA 4Q4V1 5FPVA 2YUEA 5DUVA 1GYKA 5LK5A 2BEOA 1UPIA 4JZRA 3ZN6B 5FY0A 1WMEA 2ZZQA 4CUAA 2WLPA 3O1SA 4DQAA 2XJPA 3T2TA 5EWSA 3ZKYA 3NAPB 1VMJA 5HV4A 3JBG2 4AVAA 5CYYA 2HLEA 2VGDA 3WZ1A 3WUDA 4AFCA 4B7EA 2WBKA 2X10A 5FFOC 1HXS2 5FIXA 4RD7A 2W46A 3LSDA 2WL1A 3KHBA 4XC9A 1NZIA 3UL2A 2WFF1 4AL9A 3OGJA 1W9WA 4MGIE 1XNBA 2WO3A 2B42B 2Y6JA 1ZBE2 4YVWC 5JXIA 5KHKA 3A21A 3BVCA 1IOAA 2XR4A 3LIHA 4JGYC 1S0CA 4YM0A 3UNPA 1XE0A 1YIPA 2C24A 3GZEA 1ZREA 1WD4A 1AJKA 3DXUA 5A1LA 4FP3A 1QXRA 3O1TA 3PJQA 4NWWA 2H6BA 3PMSA 1LESA 2JDNA 3D4KA 4Y24A 1HDKA 5C3OA 5C9AB 4JKMA 4MGKE 3VDCA 2RS11 3MFAA 1HJGA 3VKOA 5KR7A 1C8NA 3WP4A 1UQXA 1SLAA 1Z7S2 5T52A 4P9JA 2HWB1 5LRSA 1XU1A 4A45A 3MFCA 1ND2C 2UYAA 4GB31 4MADA 4QPWA 5I8TA 2FDFA 3E97A 4MGZE 4M3CB 5FMCA 4FPEA 1FPN3 4XETA 4ZU5A 1JYCA 1HV1A 1W03A 4CA9A 3AZXA 4XJ8A 4CEWA 4P9GA 1H1IA 3LAGA 1MQTA 1H8TB 1W2UA 1JYIA 1AXYA 1ULDA 1COV2 4KWJA 5AVPA 4GKYA 3JD73 5GJ6A 5SV8A 4Y3OA 5AC92 4A42A 1IKQA 1JOJA 2JB8A 4P5YA 2D6LX 3T2OA 4JDNA 3VBOB 1D2QA 1EP0A 4XUQA 2F6BA 1BKZA 2QTWB 5F5CA 1E5SA 3F2ZA 4CCKA 1LEMA 5FPAA 4S2DA 2UWAA 1O7FA 4AFAA 1UZYA 2L9LA 5BYNA 4ET7A 4FFHA 1SBFA 3LE0A 3ACIA 3ES4A 4QHOA 2WT2A 4Y5SA 2ZGRA 1JXNA 1DGWA 3NV3A 4LNVA 3HQRA 4HZFA 2WQ8A 1J3QA 1RVF3 4YVSA 3VHPA 1BK1A 4WM7A 5ANNA 3WDYA 4SBVA 4NHXA 2O8OA 4LOSA 3RGBA 1WLWA 1W3XA 3WHTA 5A3UA 5H9PA 5C8CC 2W0XA 1ZRRA 2OKXA 2I07B 3ACGA 3B7MA 5A6QA 5BNNB 2DFBA 1O5UA 5HCAA 2HEWF 4R9CA 3AYCA 2NMOA 1VBA3 2GH8A 5JR2A 1VBB1 2OUJA 2C9KA 1OD3A 3KQ4B 3T09A 1E57A 3L2HA 3AKPA 2HYXA 5BNPB 3R05A 1BYHA 3PUIA 5L7OB 3MV01 5FPZA 4KI5M 5H9QA 1J59A 2W1WA 1NYWA 4AF9A 4WM8A 2WZR3 5LBEA 1G9DA 1ULCA 4BQ3A 2J1SA 3ILRA 3MIGA 3T0AA 1NA1B 3PMEA 3WF4A 2BDRA 3WNLA 2JXAA 5H9SA 1GUIA 2DBNA 4GB32 4P5HA 4PCRA 2HWF3 1DGRA 1QJEA 5DAVA 4Q4V3 3WG4A 3BB6A 2RMU3 2V09A 2CAUA 3VBUC 4C8DA 4DXZA 3O1VA 1RGSA 1CAXB 3ME2A 3O1MA 4RS5B 3CHXA 3ZR5A 4QQPA 1W8WA 1EV12 4B29A 4INDA 3P3NA 5IAXA 5K0UA 4PT6A 3FLRA 2WJSA 1CWPA 1V6LA 4Y22B 4CPBD 2CYFA 1QJX1 1UAIA 3PUSA 3I2DA 2DWRA 2OZJA 4MHRA 4E2QA 4RR3A 3O1RA 1V6MA 2HWC1 5F2SA 1F4AA 2NN8A 2VG9A 3M1HA 4H55A 3HIFA 3LSEA 5L9VA 3WNXA 1RXGA 1NOVA 2W1QA 1T6BX 2BYVE 4QX5A 2XVLA 2MEV1 2VZOA 1Y4WA 4DIQA 2WN3A 1NQDA 1S2EA 1VP6A 1W2TA 2BNMA 2QZ2A 4W4ZA 5FZOA 3I3MA 4DUVA 1H2KA 4IERA 3HNMA 3E6DA 3MIDA 5ABJB 2UY9A 1XYNA 4ORFA 3KHCA 3GALA 4QKNA 2J1VA 4XJUA 1US2A 5FUIA 1GQHA 1GOHA 4CU8A 1KDMA 2D97A 2FHRA 3AFKA 3AZYA 3NKGA 4LHLA 2X53S 4FVVA 4XBQA 3V56A 1TVGA 3LKJA 3NAPC 4CCNA 5BXXA 4D0QA 2ERFA 4XHXA 2WA4A 1O6UA 2BWCA 3LEGA 2GMMA 2VMFA 3N4MA 1O91A 1ZZ6A 5FPXA 1GZ9A 2GNTA 3HD8B 4LBJA 1Z0HA 4Q0QA 4FFGA 4URTA 5DDJ2 5A7WB 1JUHA 3ZYHA 4CP9B 3VUOA 1DQ4A 2C6SA 3MUZ1 1Q8OA 1OKQA 3HMYA 4TLFA 1E5RA 2G9ZA 3JQWA 4WZFA 4XUOA 5A3NA 2A1XA 2E33A 1JYXA 1E5IA 1NUKA 4QX3A 2CGPA 2QNKA 2D3SA 3SKJE 4AZZA 4B8EA 5JWPA 1JYWA 1W8FA 4XCAA 1GBGA 1C3HA 5IVCA 5LBBA 2VCBA 4QHBA 3CEWA 4CYDA 2AEZA 3DV8A 3W20A 2DCJA 2JKBA 2YC2A 4LIVA 1HB1A 3MIEA 4JTNA 2W92A 4D3WA 3OUJA 5C9AC 2Y0OA 2WAOA 3MIBA 1J58A 3H8RA 1REEA 3H3ZA 4YGDA 1OVPA 2JDUA 2TNFA 3UJQA 1I6XA 1R1A2 2VC9A 1SFYA 4OYUA 1GOFA 1QJX2 3HT1A 1FV3A 4QB2A 2IXLA 4XF0A 4ZY9A 4Z2AA 1RUI1 5FTTC 3ZXDA 4BOWA 3CO2A 4FPJA 4IE0A 4CRQA 1UW8A 1SLIA 1YLLA 1W6NB 2QFEA 1VAVA 3D82A 4LKSA 5FJHA 1RUF2 2YC4A 1UIJA 1I9RA 4YM2A 1PGSA 1H8TC 1OI6A 2WNUB 3JB8A 1ODNA 1O4TA 3KCXA 4CEYA 3E6BA 3POJA 2BV4A 4FXKB 2AUYA 2XWBB 3DXTA 4I30A 4IUGA 3E1F1 3VBOC 1MZ6A 1F2NA 1PMHX 2D3PA 2PLV1 2BVBA 2QQLA 3MIFA 3FE5A 2VZPA 2YPDA 1DQ0A 2VMEA 4DOUA 2AC1A 2JG8A 2LM3A 4META 4PF5A 5TSWA 1QDOA 4CSWA 3B02A 4IXLA 2A70A 4V2WA 5J96B 2W1UA 4HVQA 3RRDA 1Q43A 2PHXA 4FOYA 1WLDA 1REDA 3OGRA 5FO7B 3SQOA 2QUOA 5EJZB 4CDQB 5BNNC 4PDWB 4XBLA 1BBT2 1XXNA 1NZCA 2P6HA 2Z69A 4URAA 3FJSA 1XSQA 4RHV2 4DY5A 1QU0A 4DS0A 4JVAA 5FYYA 5BNPC 5DUXA 1ODMA 1HKDA 2R49A 4WVMA 3VZJA 2ORZA 2ZCWA 5L7OC 2QQMA 2YYOA 4PI0A 4IE4A 1EAH2 4JQRA 3GZAA 2RM21 2D6KA 1JMUB 1IS3A 4J25A 2VNOA 2XBO1 3MW3A 5L9RA 4YARA 1LOGA 1O8SA 1NA1C 4IETA 2ZTNA 5IYYA 2MEV3 5IFTA 1AXZA 4XYXA 2DYCA 3ZYGA 3ZYPA 1G9CA 2XVKA 2ETEA 4JGYA 1M06G 2CL2A 4IESA 2X09A 4S2GA 2R30A 3CJXA 4FFIA 1O3TA 1RUE1 3FMGA 3NKTA 2FZ1A 2ENRA 2AGSA 4KG8A 4Q29A 4RS5C 4NHLA 3TYJA 4B4RA 1PO21 1VBE2 1NLSA 3DPRA 3J7HA 1FMD2 3H7YA 4CPBA 4XZUG 3WY6A 5HBAA 2FCVA 3C7GA 5FY8A 1OQ1A 2GP3A 1BVP1 1WMFA 4K9SA 3AMMA 4N53B 1EUTA 2PLV2 1PGW1 3LEIA 1ASJ3 2UY8A 5LBFA 2VQUA 1PO11 2DVGA 1FOD3 2VUCA 4L8QA 4NVPA 3TN92 3ZN4A 3ILNA 1PGL1 2JDAA 2CY6A 2DCYA 4CDXA 4IV3B 4JRLA 4P14A 1YYNA 5LY2A 4KNCA 1D2SA 1A8DA 2VNRA 2VBBA 2CGNA 3ZPOA 5A33B 1Y9QA 5FZHA 4XE9A 5J36A 5IVJA 4Z92B 2VOTA 4JGZB 4M4PA 5ABJC 1B09A 1BEV2 3THTA 1RUC1 1BMV1 2RJKA 3USUB 3LDKA 1YCIA 3RI8A 1X7NA 1AL21 4LO6B 1UO9A 1URXA 4LXLA 2B4KA 3H42B 1D4VB 1AHSA 2EAAA 3GNEA 1O4ZA 3AXEA 1LOBA 3MICA 3U1XA 4IEQA 1AR92 3TEXA 3ZDSA 5FP4A 5KXDA 4K8RB 5A7OA 4AI8A 2V73A 1XB9A 1RUI3 4L97A 3BUCA 3VZNA 3BOWA 2A6YA 3O1UA 2AEYA 3FFQA 2RDSA 3D5OA 5BNQA 1VRH1 3T1LA 1ULFA 3AYEA 3N3HA 3IT8A 1H6YA 2R071 4K40A 4YW7A 4YZ5A 1S0BA 1B35A 1PM7A 1W9SA 1DFQA 4JCKA 2JDMA 3KS7A 3AMQA 2O8QA 2VTXA 4HG6B 4HLTA 1HLCA 1UU4A 5DMYA 3KV5A 2E7AA 4AI3A 2JEMA 4QPIB 5J7MA 1W6MA 1ZZBA 2Y6KA 1W99A 5FY5A 1RUE2 4XOGA 4FPYA 1M4WA 4LMFA 4EZHA 4BXSV 5HXMA 3KD4A 1QJZA 4MGQA 4XJAA 1CONA 1XSRA 5HPOA 3O14A 1UY0A 1GP5A 4FTBA 1QDCA 4KWUA 5JMCA 1RUD3 3T08A 5HV0A 2P17A 3U4XA 1SFPA 5KBFA 2KA3A 5FZBA 5T55A 1RUOA 3OCPA 1EYBA 1PVXA 2LTNA 3M7AA 3PDQA 3A23A 5T54A 2XHKA 1CPNA 2QBXA 2WA3A 2WWSA 4R8HA 2WNOA 3VBUA 1ZA7A 2WNUC 2EIBA 4XXAA 5FO8B 1NT0A 4XUPA 4BCUA 4AVVA 1YQ6A 5CEHA 2QQVA 4H2AA 4W50A 3J8F2 4BWOA 3LIGA 1Z78A 1X33A 4AI2A 3Q8AA 3DEMA 2WSVA 1HRV1 3K46A 5J37A 3LCPA 4JX0A 5FZGA 1KD7A 2UURA 4XJWA 2RM23 1SG3A 4YFZA 4DY3A 4EV0A 3ZXLA 5DN2A 3OBAA 2ZGNA 3VBHB 4I3GA 1UKGA 3NV1A 1DYPA 5DXDA 3BPZA 3ALQA 3N9MA 3RDIA 4RA0A 1H4GA 4QQHA 3EBRA 4X6QB 1NCRA 1FV2A 2ES3A 3PVEA 4S2FA 3WQ7A 4I02A 4CDQC 3NVCA 3QACA 4PBOA 3MUY1 4Y5TA 4PDWC 2ARCA 1QHDA 1W05A 1QQP2 1DGWX 5FR3A 2R063 1MVQA 1V6OA 2VCMA 2Q1FA 4N7UA 5JVVA 3N9NA 3GZTB 4GKXA 4W6WA 3BTXA 2R1BA 4OHVA 3L9JT 2VZTA 4BLJA 3NAPA 3M3CA 1POV0 3HPNA 1JI6A 4NIIA 1GSLA 1S0EA 2WSUA 5JXHA 2EIGA 4XURA 3GHNA 1PO13 1S0FA 1AR73 1WW4A 3S5AA 5FREA 3LEKA 2JE7A 4YG3A 4IEUA 4NROA 4XW3A 1X50A 1R091 1S0IA 3UKNA 1HN0A 3N7MA 5LW9A 3LF7A 3MIHA 3PIGA 4XFFA 3RWNA 4QU2A 2WNVB 2WN2A 4XIKA 5F3EA 4CXWA 5FQ0A 3N9QA 4XFGA 1KFUL 4AQ6A 3W59A 3LOBA 2VJXA 1RUC3 3I2HA 1W0NA 4IEYA 3QD6A 2DVFA 1AL23 5FKBA 2CTVA 4L2NA 2ARBA 4W6XA 5BNOB 3AZVA 3GBFA 3TAYA 3BU7A 2A6ZA 2PFWA 5FZAA 3FHQA 3EMRA 3NV2A 3HAGA 5C9AA 3HEIA 5C3QA 1WGPA 1ZBA1 2ORXA 4BE3A 1NAEA 4GALA 5E89A 1S0GA 2RV9A 2WRAA 3ACHA 4N53C 3IAQA 3RG0A 1OOPB 1W3VA 2VMIA 1OA4A 4QHZA 1MEC1 3HN1A 4H3WA 1MS1A 4BDVB 3RZGA 1RMU3 4LK6A 1QOTA 3T2PA 3EJKA 5CA6A 5IVVA 1WCUA 4AEMA 4IV3C 5JOZA 4AHXA 2HWE2 1RUG3 4AEDB 3NJZA 4OQ9A 1A78A 3SNMA 5FMBA 1YQ2A 1W8UA 3SCGA 2F4PA 4GMP0 3FUOA 4JGZC 4NHMA 4P9LA 3W5MA 3NW4A 4NIGA 1GNZA 5E1RA 1QJY1 3BIEA 1XBFA 2BNOA 4LO4B 4KMQA 5F6LB 3HBKA 5FZDA 4ZONA 1RIRA 2RE9A 2WWJA 4TLGA 2P34A 2BOIA 2VZ1A 2ZKLA 5DAXA 1GANA 4HT1T 3J26N 1JS9A 3M3OA 5BPXA 1SACA 3VL9A 5FPUA 4CUGA 5KXBA 2VW2A 4GA9A 1EUUA 4LK7A 3VKNA 3KQRA 5AVAA 5JXGA 2JDHA 2ARAA 1JBCA 1UYXA 2CDPA 1O5LA 3ZXAC 1KXGA 1AX1A 1ZVFA 3DKWA 4I0AA 4N7IA 4Z1VA 4Y26A 4LBQD 5DABA 2GMPA 1CJDA 4IV1A 5GZEA 3VN4A 5FZCA 5ACA3 4FPOB 5LWBA 4XUNA 4OLLA 2P6CA 4JDOA 1DCSA 2RJLA 3PUQA 1QMJA 5FUPA 3RZHA 1EY2A 3KSCA 3BYWA 4QPIC 3RQ0A 3WQ1A 5A3TA 1IPSA 1VBD2 2XKPA 3H7JA 1JZ6A 1OBNA 2Q8CA 4LKDA 5F1RA 2TBVA 3LPGA 3OD0A 3OJBA 1BVVA 1YO8A 5A1AA 2VM9A 3MEPA 1X82A 1WCKA 3DUIA 4E4HA 4NJ4A
chains in the Genus database with same CATH topology
2GP3A 5A7PA 3U78A 4LITA 5F5AA 5F5CA 5FZ4A 3AL6A 5FXWA 4GAZA 2VD7A 3ZLIA 4CCKA 5FZEA 5IVEA 3N9NA 5FPAA 5IVCA 3LDBA 5FXVA 5FZ9A 5FZLA 5LY2A 5FY4A 5FZOB 3KVAA 4D6SA 4LIVA 4GD4A 5FZHA 3ZPOA 4CCOA 5LY1A 5IVJA 5F3CA 2OX0A 5FBJA 5FZIA 5A7SA 4DO0A 5A3PA 5A80A 4BXFA 3KV6A 2XMLA 3PUAA 5FYHA 5A7QA 4NUBA 2OQ7A 3KVBA 3N9LA 4UF0A 3PU3A 4LXLA 3KV4A 5K4LA 4QXBA 5F3EA 2YU2A 5F39A 3RVHA 5FXXA 3N9QA 5FPLA 4IGOA 4QXHA 2W2IA 5FP4A 5A7OA 4QX8A 4IGPA 5A7NA 4GJYA 2Q8EA 5FJHA 4QU1A 1VRBA 3U4SA 4AAPA 3KV9A 5F5IA 5IWFA 5A3NA 2WWUA 5FZAA 4EZ4A 5FZ7A 5FY7A 2Q8DA 2XXZA 3PU8A 4BISA 4XDOA 3DXTA 5FPVA 4ASKA 4EYUA 5A1FA 4Y33A 5FYVA 5FY0A 3OPWA 3OPTA 3PURA 3N9OA 5FY9A 5IVVA 3KV5A 2YPDA 2OS2A 5F32A 5FP3A 4CCMA 5LW9A 5FP9A 4HONA 5F37A 5FUNA 3K3OA 5FYTA 5FY5A 4C8DA 4CCLA 5FYBA 5FZ8A 5F3GA 4XDPA 5ANQA 4CSWA 4EZHA 5FYUA 4D6QA 4V2WA 2OQ6A 5FYZA 2XUEA 5FY1A 4V2VA 5FZ1A 3AVRA 4Y4RA 4UF0B 5FYMA 3PUSA 5FWEA 5FZDA 5F2SA 2PXJA 5FZ0A 4QWNA 5FZBA 4URAA 2WWJA 3N9PA 2YBSA 5FV3A 5FXZA 5FZKA 3PDQA 5FZ3A 5FYYA 5A1LA 3DXUA 5FPUA 4CUGA 2OT7A 2P5BA 3LD8A 5FZMA 5FYSA 2XDVA 3AVSA 4DIQA 2GP5A 5IVBA 4CCJA 2YU1A 4HOOA 4IGQA 5FZOA 5IVFA 5IW0A 5CEHA 3UYJA 5KR7A 2YBPA 5FYIA 5IVYA 5F3IA 5FJKA 5A7WA 3PTRB 5E6HA 4AI9A 5FZCA 5LWBA 5FZGA 5FPBA 4BU2A 3K2OA 5FP7A 3K3NA 4CCNA 3PUQA 4GJZA 5FUPA 5FWJA 5ISLA 5A3TA 5F2WA 5FYCA 4QX7A 3NJYA 5FZ6A 5FZFA 5A7WB 3N9MA 4TN7A 2Q8CA 4D6RA 4LIUA 5FP8A 3AL5A 5A3WA 2YBKA 4Y3OA 4QXCA 5FY8A 4E4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GP3 A;  5A7P A;  3U78 A;  4LIT A;  5F5A A;  5F5C A;  5FZ4 A;  3AL6 A;  5FXW A;  4GAZ A;  2VD7 A;  3ZLI A;  4CCK A;  5FZE A;  5IVE A;  3N9N A;  5FPA A;  5IVC A;  3LDB A;  5FXV A;  5FZ9 A;  5FZL A;  5LY2 A;  5FY4 A;  5FZO B;  3KVA A;  4D6S A;  4LIV A;  4GD4 A;  5FZH A;  3ZPO A;  4CCO A;  5LY1 A;  5IVJ A;  5F3C A;  2OX0 A;  5FBJ A;  5FZI A;  5A7S A;  4DO0 A;  5A3P A;  5A80 A;  4BXF A;  3KV6 A;  2XML A;  3PUA A;  5FYH A;  5A7Q A;  4NUB A;  2OQ7 A;  3KVB A;  3N9L A;  4UF0 A;  3PU3 A;  4LXL A;  3KV4 A;  5K4L A;  4QXB A;  5F3E A;  2YU2 A;  5F39 A;  3RVH A;  5FXX A;  3N9Q A;  5FPL A;  4IGO A;  4QXH A;  2W2I A;  5FP4 A;  5A7O A;  4QX8 A;  4IGP A;  5A7N A;  4GJY A;  2Q8E A;  5FJH A;  4QU1 A;  1VRB A;  3U4S A;  4AAP A;  3KV9 A;  5F5I A;  5IWF A;  5A3N A;  2WWU A;  5FZA A;  4EZ4 A;  5FZ7 A;  5FY7 A;  2Q8D A;  2XXZ A;  3PU8 A;  4BIS A;  4XDO A;  3DXT A;  5FPV A;  4ASK A;  4EYU A;  5A1F A;  4Y33 A;  5FYV A;  5FY0 A;  3OPW A;  3OPT A;  3PUR A;  3N9O A;  5FY9 A;  5IVV A;  3KV5 A;  2YPD A;  2OS2 A;  5F32 A;  5FP3 A;  4CCM A;  5LW9 A;  5FP9 A;  4HON A;  5F37 A;  5FUN A;  3K3O A;  5FYT A;  5FY5 A;  4C8D A;  4CCL A;  5FYB A;  5FZ8 A;  5F3G A;  4XDP A;  5ANQ A;  4CSW A;  4EZH A;  5FYU A;  4D6Q A;  4V2W A;  2OQ6 A;  5FYZ A;  2XUE A;  5FY1 A;  4V2V A;  5FZ1 A;  3AVR A;  4Y4R A;  4UF0 B;  5FYM A;  3PUS A;  5FWE A;  5FZD A;  5F2S A;  2PXJ A;  5FZ0 A;  4QWN A;  5FZB A;  4URA A;  2WWJ A;  3N9P A;  2YBS A;  5FV3 A;  5FXZ A;  5FZK A;  3PDQ A;  5FZ3 A;  5FYY A;  5A1L A;  3DXU A;  5FPU A;  4CUG A;  2OT7 A;  2P5B A;  3LD8 A;  5FZM A;  5FYS A;  2XDV A;  3AVS A;  4DIQ A;  2GP5 A;  5IVB A;  4CCJ A;  2YU1 A;  4HOO A;  4IGQ A;  5FZO A;  5IVF A;  5IW0 A;  5CEH A;  3UYJ A;  5KR7 A;  2YBP A;  5FYI A;  5IVY A;  5F3I A;  5FJK A;  5A7W A;  3PTR B;  5E6H A;  4AI9 A;  5FZC A;  5LWB A;  5FZG A;  5FPB A;  4BU2 A;  3K2O A;  5FP7 A;  3K3N A;  4CCN A;  3PUQ A;  4GJZ A;  5FUP A;  5FWJ A;  5ISL A;  5A3T A;  5F2W A;  5FYC A;  4QX7 A;  3NJY A;  5FZ6 A;  5FZF A;  5A7W B;  3N9M A;  4TN7 A;  2Q8C A;  4D6R A;  4LIU A;  5FP8 A;  3AL5 A;  5A3W A;  2YBK A;  4Y3O A;  4QXC A;  5FY8 A;  4E4H A; 
#chains in the Genus database with same CATH topology
 4B3N A;  3USS A;  5A70 A;  3WG1 A;  4WVW A;  1YNA A;  2ZJC A;  2GND A;  4GAZ A;  3VDB A;  1FPN 1;  2QDN A;  3ZLI A;  1FNZ A;  1DQ5 A;  2WUH A;  1A34 A;  4MXW B;  4A3X A;  3LDB A;  4R9D A;  1PNG A;  1W6P B;  3I7D A;  3WX5 A;  1R64 A;  3ZKU A;  1WLC A;  4Q4W 1;  4UW4 A;  5DUW A;  4CDU B;  4Q4Y 1;  3NNG A;  4D6S A;  3NQH A;  3VBF A;  2ZGQ A;  5JXJ A;  1YIF A;  1CAX A;  4QMA A;  1N1Y A;  4UBG A;  1W6O B;  4AI1 A;  1DQ2 A;  3VD7 A;  3WNN A;  5JAX A;  2CU5 A;  3MLK A;  1W9F A;  3KV6 A;  2VTX J;  1N1S A;  4ATE A;  4COZ A;  2K46 A;  5FYH A;  5A7Q A;  4Y22 A;  4BHP A;  2ZZJ A;  4IEP A;  3HWJ A;  1GNH A;  1Q8V A;  2VY0 A;  3I59 B;  5JSO A;  1OH3 A;  1RXF A;  1XPW A;  3OYW B;  4LJH A;  4BMB A;  2HWD 3;  4NAM A;  4C0H A;  5I8Y A;  2VL4 A;  4GIQ A;  3RZL A;  3IPV B;  1UMH A;  1AF9 A;  1SBD A;  3AC0 A;  5LBC A;  2JDP A;  3VBH C;  5JI9 A;  2VO5 A;  4Y1Z A;  1OQD A;  1HRI 1;  1SZB A;  2C1F A;  3U4S A;  3ZMO A;  4DEV A;  4ZXE A;  3WP5 A;  3SIS A;  2FDG A;  4UXA A;  4EZ4 A;  1IHM A;  4MUV A;  2GC1 A;  4PIZ A;  2VMC A;  5ABJ A;  4Z8B A;  5C70 A;  3OY8 B;  1IKP A;  5A6Z A;  1VBA 1;  5DAW A;  1RTV A;  4XAE A;  3POF A;  1L3J A;  3D0J A;  2V5D A;  1T6G C;  3AP9 A;  1QIQ A;  1MR5 A;  2EVX A;  2YMZ A;  1GNY A;  3A0N A;  2ZKN A;  3IM0 A;  2P3K A;  2PMW B;  4QGN A;  1ZBA 3;  3V64 A;  4SLI A;  3ZX7 A;  5F37 A;  4XXP A;  1S2K A;  2RR1 1;  2E53 A;  2WZR 1;  4D6Q A;  3K77 A;  1MEC 3;  1KRI A;  2JG9 A;  2XUE A;  4JKL A;  5K7P A;  3PIJ A;  5FZ1 A;  3ZFE A;  2WS9 2;  1MVE A;  3I2K A;  4W8J A;  5T3N A;  1RIN A;  3SEP A;  1UOF A;  3TBD A;  3U37 A;  2QVS B;  2Z5W A;  5D21 A;  3WD5 A;  3LFI A;  3W5N A;  4UFI A;  1W2O A;  3PVO A;  1DZR A;  1MS0 A;  2HWF 1;  2WNV C;  3SCF A;  3LB9 A;  1AYN 1;  2EXH A;  3BGA A;  1FPN 2;  4GWJ A;  2FMY A;  5AFB A;  2RMU 1;  2WT1 A;  2YBS A;  1AR6 1;  3OUH A;  4HKW A;  1POV 3;  5C5T A;  2E6V A;  2A6V A;  1TMF 1;  1W04 A;  1QJY 3;  5IK5 A;  3T4V A;  2WAB A;  1O3S A;  1PK6 A;  5BNO C;  1CR7 A;  2ID4 A;  1DU3 D;  4HSJ A;  3ZDV A;  1SCS A;  3JD7 2;  2W08 A;  1HB4 A;  1DYO A;  1ULG A;  4XTM A;  1LEN A;  1KFX L;  3PVN A;  4R4X A;  3AX4 A;  2Y26 A;  4OI4 A;  4YPJ A;  5L36 A;  2Q8O A;  4F3J A;  1OOP C;  2XKO A;  2LW8 A;  2Q5T A;  5HCF A;  2OPK A;  2P3J A;  3WNP A;  2WLQ A;  1UY1 A;  5ISL A;  2RDN A;  3IDC B;  1G9B A;  2XLG A;  5CKN A;  1RVF 2;  3ZSK A;  4AED C;  1W8N A;  5DQ0 A;  1NQJ A;  3LZZ A;  2UYB A;  1QY4 A;  3H8U A;  5A3W A;  1H1M A;  1LR5 A;  2N7G A;  4KQ7 A;  2PA7 A;  3HQU A;  4CCE A;  5D8A A;  3WW4 A;  1TE1 B;  3DEC A;  1RUJ 1;  4O9E A;  1O8P A;  3RZM A;  1TG7 A;  1VBA 2;  2DUP A;  4NHY A;  4KU7 A;  2W52 A;  2B46 X;  3NNL A;  4XFC A;  4LHS A;  4NPL A;  4TXW A;  2B9U A;  4QT6 A;  4GMP 3;  3P5B A;  2RDR A;  2WZR 2;  2JB4 A;  2ZAA A;  4GD4 A;  5A6Y A;  2GAU A;  5LA1 A;  1GLH A;  3DKQ A;  1LNS A;  3WF0 A;  4LBQ A;  5A80 A;  5B2G B;  2ZML A;  3PUA A;  4Q4W 3;  1VBC 3;  4MVT A;  5EFU A;  5F6K A;  4Q4Y 3;  3N35 A;  3RSJ A;  4XQ4 A;  2HWF 2;  2R32 A;  4LEJ A;  4AG4 A;  4CDQ A;  4DUX A;  3RVH A;  4Q4V 2;  5FPL A;  1XE7 A;  3DF0 A;  2Y33 A;  1QGL A;  4JAA A;  3ZPY A;  1W0P A;  1G8W A;  4P9W A;  4L11 A;  1FX5 A;  2Q8E A;  2H0V A;  4K7J A;  2PQQ A;  4OZO A;  5IFP A;  5FLI A;  4FAG A;  4ZXK A;  3V0B A;  5KHJ A;  3VV1 A;  4CP2 A;  1KDK A;  4E8D A;  4XF9 A;  2P4E A;  4XQW A;  1CVN A;  1HRI 3;  2DBI A;  4BQ1 A;  5EYY A;  2FMD A;  4YGC A;  4D7Y A;  5JOX A;  3WLU A;  1GFF 2;  4E27 A;  2EXJ A;  2WFF 2;  3BTZ A;  4O61 A;  4IEV A;  4PQ9 A;  5J09 A;  5JIU A;  1UYP A;  3H1W A;  4YW1 A;  5I0U A;  4CDU C;  4CCM A;  3DYP A;  4AK3 A;  3K3O A;  3Q8F A;  1AZD A;  1OC1 A;  1J83 A;  1UZ0 A;  2QCS B;  4CP1 A;  4PIX A;  4AR2 A;  3C7O A;  4OVE A;  3KCC A;  4WVV A;  3TB0 A;  3VZM A;  3BU0 A;  3UKT A;  1U5Z A;  3KF5 A;  3I2I A;  1ULP A;  3DYM A;  1JW6 A;  5FYM A;  4AVS A;  4UW6 A;  4D69 A;  4DFS A;  4NAO A;  2RR1 3;  4XJZ A;  4C0B A;  3IWZ A;  4HPK B;  3H8X A;  1GWK A;  4LO8 A;  2RS1 2;  3AXD A;  2DCZ A;  1DBN A;  5C3S A;  3SXW A;  3POW A;  4PIY A;  3N9P A;  1SLC A;  1HW5 A;  2XQR A;  1VMF A;  3POY A;  5FV3 A;  3W58 A;  2R1D A;  3PLQ A;  4BQ2 A;  3PUH A;  2G9G A;  2HWB 2;  3WT3 A;  3WIN E;  4JRA A;  5FZM A;  3HT2 A;  3I2F A;  2FBE A;  4QPG A;  3NL1 A;  2Y64 A;  1PMI A;  2GP5 A;  1LOF A;  1AYN 3;  1XOY A;  3HVD A;  4ONU A;  2BGO A;  1GV9 A;  1XNC A;  4B1L A;  1UZW A;  1AR6 3;  2DCK A;  1K42 A;  2W39 A;  1FAT A;  4DZG A;  1TMF 3;  1R08 1;  2TEP A;  1K5M B;  3ZMN A;  3WW3 A;  2VOK A;  3USU A;  3EO6 A;  1GZW B;  1QF3 A;  2CWS A;  2PAK A;  3AM2 A;  4HMZ A;  3POG A;  2YC0 A;  1DHK B;  3SH3 A;  3UGG A;  2FCT A;  4XAB A;  3FX3 A;  1YJL A;  2GAL A;  3O0V A;  5LK7 B;  5EV7 A;  4BME A;  1UOB A;  2JEN A;  1UZV A;  3IMN A;  4Q8L A;  5C4W B;  1COV 3;  2KM2 A;  2E9Q A;  5AC9 3;  2XOM A;  3R4U A;  3X29 B;  3AMH A;  2DVB A;  2QQW A;  4Q0S A;  1ZX5 A;  3ZOI A;  2RS3 3;  1WBF A;  1YFY A;  4TTG A;  1UY3 A;  3VKM A;  2XON A;  2ZX1 A;  5F5A A;  3MZH A;  5IK8 A;  2YGL A;  5LCW L;  5JZG B;  1SEF A;  3KT4 A;  4Y1U A;  5FK8 A;  3KGZ A;  4LHN A;  2ZXQ A;  2VQA A;  3H50 A;  3LA2 A;  2VOX A;  1RUJ 3;  2FDI A;  2PQS A;  4ZHN A;  2BFU L;  4YWA A;  4QPI A;  4D7T A;  3H8O A;  4YG6 A;  4AHZ A;  1D7P M;  1VBB 2;  1ZRF A;  3KVA A;  4FPC A;  3WOG A;  1QNY A;  3MGU A;  5FBJ A;  2AH2 A;  4Q5O A;  1CAV B;  5FZI A;  5JOY A;  5A3M A;  3T3Y A;  1ASJ 1;  1VPH A;  1GZC A;  1TQ5 A;  4LOR A;  1FOD 1;  5FXX A;  3O0W A;  1WD3 A;  2A6X A;  4HVO A;  4AAX A;  1X8M A;  1JTZ X;  4A7K A;  1JN2 P;  2WZ8 A;  2RDQ A;  4P08 A;  5F5I A;  2VZ3 A;  1ZM1 A;  3I8T A;  4MX3 A;  3Q8B A;  5A32 A;  3MBW A;  3POI A;  1JZ3 A;  4I0W B;  4FCA A;  2ZPX A;  1XYP A;  2XXZ A;  4M3C E;  4XDO A;  2JIG A;  4AFD A;  2OII A;  2FDJ A;  1AR8 1;  4YNI A;  5APA A;  2CAV A;  4FP2 A;  2O14 A;  1YFX A;  2VZU A;  5CFD A;  2NM1 A;  1WZX A;  1JHJ A;  3ZXG A;  1I5P A;  1UOG A;  1WWY A;  3OPT A;  3IN9 A;  1OSG A;  5H9R A;  1CGP A;  2VPV A;  5FP3 A;  2Q1M A;  3VBH A;  2HWC 2;  3OGV A;  5FUN A;  3ZSE A;  2NQY A;  3F95 A;  1JZ4 A;  3GZU C;  1TNR A;  3FWE A;  3IB3 A;  2QQI A;  5DZE A;  5FZ8 A;  1O3Q A;  3QCW A;  4LT5 A;  1GWL A;  1G7Y A;  3NNJ A;  5FYZ A;  3SEE A;  3RS6 A;  1OPO A;  1T2X A;  1D4M 1;  2Y0I A;  3H1M A;  1V9U 3;  2MEV 2;  3I3Q A;  4TYS A;  1UL9 A;  1CN1 A;  1W2A X;  4FOQ A;  1UYZ A;  4V1P A;  5FWE A;  1DYK A;  5F5Q A;  4Z07 A;  5GLT A;  3LPF A;  4CU6 A;  1QH6 A;  2RS5 3;  1W6Q B;  4QB6 A;  2Y8K A;  4D8M A;  1AL0 G;  2BER A;  5FZ3 A;  3B5L B;  2BZD A;  2ZHM A;  1NCQ B;  2PHF A;  3N7J A;  2KR2 A;  3S5Q A;  4BA6 A;  1H2N A;  1OF3 A;  1ZA4 A;  5J1X A;  2R0F A;  2G19 A;  2VU9 A;  1MAC A;  4CCJ A;  2YU1 A;  3I54 A;  5KHH A;  3LDR A;  5K8S A;  1DF0 A;  1LRH A;  5IW0 A;  1GMM A;  5M0T A;  1CX1 A;  1BLZ A;  1NLQ A;  3SKV A;  2YBP A;  3OD4 A;  1RUD 1;  4P9Y A;  3FHI B;  4OZX A;  1WW5 A;  2CGO A;  4F83 A;  2B9V A;  3OUI A;  2W94 A;  2D3R A;  4L92 A;  2JKX A;  1SLB A;  3MPB A;  3V65 A;  3J7N A;  2ZHL A;  2CHH A;  1V00 A;  2J1A A;  1R08 3;  2HBU A;  3PHM A;  1ND3 B;  5DDJ 3;  5F2W A;  4A4A A;  5FYC A;  1WCS A;  3WSO A;  1CES A;  1ZZ8 A;  1QH7 A;  4E4Z A;  3WNO A;  5BNO A;  4EN8 B;  3FUQ A;  2WO1 A;  2LS6 A;  3E5U A;  3I2G A;  1RL3 A;  1VAL A;  3RMY A;  1GP4 A;  2IWG B;  2VXJ A;  2XJU A;  3ZXF A;  4ZU7 A;  2IZW A;  2DVA A;  3NWK A;  5FXW A;  1K5J A;  3POE A;  1OOP A;  2VD7 A;  2IFW A;  2VQT A;  2VVF A;  4ARX A;  3ZVX A;  1RUI 2;  2JE9 A;  5T5J A;  5J48 A;  2R04 1;  1GWM A;  1CD3 G;  1IG3 A;  5CKQ A;  4YVW A;  3ST7 A;  3DCQ A;  2D6P A;  4K6B A;  4B4P A;  2B8M A;  5CBL A;  3QBQ A;  5JPM B;  3THP A;  5KXC A;  4BXF A;  1K5M C;  3KCY A;  4GH4 B;  1LHV A;  2R06 1;  4XQD A;  3VBR B;  3ZN5 A;  4HFS A;  3ZFF B;  4AGG A;  2VBD A;  3Q9O A;  3KV4 A;  3AYA A;  1QJU 1;  3M8L A;  1UZZ A;  5F39 A;  2JD4 A;  1H2L A;  3ZXJ A;  3I2O A;  3J7L A;  4YVS B;  3VDD B;  1GU3 A;  3C8X A;  4WM7 B;  4CE8 A;  4E4D X;  2GME A;  1W8O A;  1YI9 A;  1ULE A;  4LUM A;  4COY A;  1FYU A;  3KGL A;  4N8M A;  1AR7 1;  3WDX A;  5C4W C;  1L7R A;  1ND2 A;  1ZZC A;  2MNG A;  2ARX A;  2JJ6 A;  4XHB A;  5KWR A;  1DDL A;  2ARE A;  3IDB B;  2HYK A;  3WQ0 A;  2V4V A;  3UJO A;  3HNB M;  4RFR B;  4BIS A;  2AAC A;  3RYK A;  2VR4 A;  4NIA A;  1X8E A;  2OVU A;  4ZU4 A;  4ASM B;  5DZG A;  3WG3 A;  2W87 A;  2JWP A;  4Q4X 1;  2NMN A;  1XE8 A;  1OUX A;  5JZG C;  2Z2S B;  3M4F A;  3UES A;  1UWW A;  1KJR A;  2OPW A;  3HR9 A;  4WM8 B;  4AGR A;  4E4S A;  3CBN A;  2XH6 A;  2OS2 A;  1Y9M A;  1AR8 3;  2PAM A;  4WV8 A;  4HON A;  4CCL A;  1GKB A;  5FYB A;  5LA9 A;  2H6C A;  1CAW A;  4BQX A;  2W47 A;  3WNM A;  4WBB A;  3GHM A;  5GLZ A;  1S55 A;  2XL9 A;  3CDZ B;  2AZ5 A;  5CU1 A;  1C4R A;  1LGC A;  2RM2 2;  1RMU 1;  1YRZ A;  2BRT A;  4RHV 3;  5JSR A;  3SIT A;  2XBO 2;  1DGR N;  3T1M A;  1CZV A;  3MF6 A;  2QKD A;  1D4M 3;  3IDE A;  3AYD A;  3K4A A;  4XZP A;  1RUG 1;  5K0U B;  5C8C A;  3BTY A;  2OT7 A;  4M01 A;  2Y6G A;  1EAH 3;  1W0O A;  2ZEY A;  5DAQ A;  4RR3 B;  4IGQ A;  2BJS A;  1OLR A;  2D44 A;  2VNV A;  4YSF A;  1ENQ A;  4FPF A;  4IL7 A;  2XLA A;  4HL0 A;  2R06 2;  4AI9 A;  1PO2 2;  4UWD A;  4BYY A;  1LOA A;  2D93 A;  1S1A A;  3I3D A;  3KLS A;  3P6B A;  4ITC A;  4QDS A;  4BIO A;  3NJX A;  3FL7 A;  3MLJ A;  3WV6 A;  1TME 1;  3O7O A;  5FMD A;  3FHA A;  1F31 A;  4KL1 A;  5LZ6 A;  4YZ3 A;  2A6W A;  1PGW 2;  3BIW E;  3IPV A;  4JQT A;  4X8N A;  1PO1 2;  1AR7 2;  1S0J A;  1VBE 3;  3WXP A;  4D6R A;  1LTE A;  4WVZ A;  3W9A A;  4Q26 A;  1PGL 2;  5I0D A;  2E51 A;  4XFI A;  3S7E A;  5ACA 1;  3BOD A;  4Q1R A;  3PNA A;  3ETP A;  5FLH A;  1WKY A;  5GKA C;  1CQ9 A;  3CU7 A;  5E88 A;  5JSP A;  1RUC 2;  1MS3 A;  2DTW A;  2BFU S;  4YRD A;  1BMV 2;  4S2H A;  2BP6 A;  1XNK A;  5FZE A;  1AL2 2;  1X9P A;  4XPV A;  1RB8 G;  3MI8 A;  4XVH A;  1NCQ C;  1RC6 A;  3UV9 A;  1LCL A;  1GQP A;  2EIC A;  1Y3T A;  5C6C A;  5HI0 A;  1KS4 A;  3ES1 A;  1PVC 1;  3ETQ A;  3UK9 A;  4Q27 A;  5FY4 A;  1BCX A;  4CCO A;  1OKO A;  1BEV 3;  2FDK A;  2OX0 A;  2XQX A;  3GCW A;  2P2K A;  4H7L A;  1HN1 A;  4LBM A;  4QX1 A;  1QJF A;  3OGS A;  4KGG A;  5A3P A;  4XF3 A;  2R04 3;  5C3R A;  2XML A;  4Y20 A;  3EHK A;  3NNF A;  3B01 A;  4YW2 A;  1VRH 2;  1XNA A;  1RMU 2;  3AJZ A;  2C26 A;  2VEC A;  1AR9 3;  3U07 A;  2ADD A;  2LRP A;  5C5U A;  4UFH A;  5I0T A;  4QXH A;  2R07 2;  3GYD A;  1NKG A;  1K3I A;  2DV9 A;  4N43 B;  1ND3 C;  4HK8 A;  4M0H A;  1K12 A;  2X29 A;  1LGB A;  4LHK A;  3ZN6 A;  4FO9 A;  5DAP A;  1QJU 3;  4AEK A;  4DRV A;  3RI9 A;  1C8M 1;  1W8H A;  2Q0A A;  4YZ1 A;  5FY7 A;  3E5Q A;  4MGS A;  1C28 A;  1H4H A;  1YQC A;  1WCQ A;  3VZL A;  4D94 A;  5CAD A;  4IE6 A;  1Q8P A;  1G9A A;  2ZHN A;  2ZEZ A;  4EWE A;  5IT6 A;  4CUC A;  1HV0 A;  1WBL A;  4AOC A;  4Y33 A;  4Z2W A;  4G3Y C;  2HWD 1;  2JE8 A;  2A71 A;  2PAE A;  1DP0 A;  4DXR A;  2E26 A;  3AJY A;  3PUR A;  4CEY B;  3GBW A;  2YHJ A;  1W9Y A;  3CMG A;  5DUU A;  3RMX A;  1IS6 A;  3RNS A;  4Q4X 3;  5F3G A;  3AB0 A;  4LUK A;  1RYY A;  1IS4 A;  1RHI 3;  2YG0 A;  1UKR A;  1LJ7 A;  1RUH 1;  2HEV F;  2X5I B;  5ACA 2;  3BKZ A;  1LHW A;  4GH4 C;  2D7F A;  4A44 A;  3VBR C;  4K1Z A;  4BK4 A;  1REF A;  3ZFF C;  3ZYF A;  3A4U A;  1F8V A;  4QGL A;  4I0B A;  2J1R A;  1LHO A;  1Q3E A;  2EA7 A;  2ZHK A;  4YVS C;  3VDD C;  4WM7 C;  1HRV 2;  1PIV 3;  3LWC A;  3OF1 A;  1JOP A;  3DL3 A;  1CZT A;  3LD8 A;  5FAX A;  2XDV A;  2YV8 A;  3WCS A;  1OQE A;  4MZU A;  4EE2 A;  5J3U A;  4QQ2 A;  2VZS A;  5IVF A;  1V6K A;  3WEZ A;  4M3C A;  5EP9 A;  4MXV A;  3OG2 A;  3VL8 A;  3VD4 A;  2JIJ A;  1X9T A;  3OBZ A;  1QNW A;  5FYI A;  5IVY A;  3AP7 A;  5KC5 A;  1H8T A;  1LOD A;  1POV 1;  1UYY A;  4YYO A;  2C0Z A;  1NLR A;  1Y43 B;  2A73 B;  4CDW B;  1OVS A;  4WM8 C;  3GCX A;  4GJZ A;  2ZX2 A;  4E2S A;  1OA3 A;  4QKB A;  4IQP A;  3VBO A;  4QX7 A;  1AYM 3;  1ZRD A;  5FZF A;  2VMG A;  4KH9 A;  1LHN A;  3ZIW A;  3TNP B;  4XF1 A;  1S0D A;  1TME 3;  3WR0 A;  1HQN A;  2Z79 A;  2NYY A;  3RZJ A;  5LB6 A;  4UBH A;  3TRS B;  4EWD A;  2EXK A;  3B9C A;  4CU9 A;  2OYZ A;  1R09 2;  3O1P A;  3S57 A;  3SH5 A;  3DPR B;  1N47 A;  5I0R A;  3BI3 A;  5K0U C;  4PF1 A;  3WDW A;  2GDF A;  5FZL A;  5BNN A;  5CZK A;  3SH4 A;  4O9G A;  3D0S A;  3GGL A;  3FLP A;  2VZR A;  4GZ9 A;  4RR3 C;  4QM8 A;  5G05 L;  1ULO A;  3VZO A;  2DDU A;  4CXY A;  5EIY B;  3IMM A;  3JB4 C;  4H7M A;  4IE5 A;  3R6S A;  4DO0 A;  5BNP A;  1LOE A;  1S4C A;  5L7O A;  1X36 A;  1PVC 3;  3VHN A;  4CDX B;  1H1A A;  4GXL A;  2VVD A;  4R9B A;  3IKW A;  2WQZ C;  4HPK A;  1ZBA 2;  1SQ4 A;  3B00 A;  5FO9 B;  1ZRI A;  2ZGU A;  4GMP 1;  1NA1 A;  5DG1 A;  1A3K A;  4GJY A;  2NPI A;  3WHU A;  2XWJ B;  1MEC 2;  2W9X A;  4OCT A;  2EIE A;  2WYF A;  4Y1X A;  1N3P A;  5IAV A;  2Q1Z B;  4BB3 A;  5K9Y A;  4BH9 A;  3VZK A;  4OHW A;  3AKT A;  4C1X A;  3POS A;  5DPN A;  1AJO A;  1PHM A;  1VBC 1;  4KU8 A;  1JHN A;  3R0R A;  1YEW A;  2KD7 A;  5CIR A;  4YFW A;  4EYU A;  3K4Z A;  1VLN A;  1YFU A;  4LPL A;  4RS5 A;  4LUL A;  1HIX A;  2D6N A;  1AX2 A;  3M3Q A;  4PQQ A;  3DN7 A;  1C8M 3;  3ZYB A;  5I93 A;  4FQZ A;  1QJY 2;  4ZS3 A;  4NIH A;  4FQ4 A;  5I0S A;  2VVE A;  2A3W A;  2BUK A;  2HWE 3;  4FPG A;  5D1I A;  2GNM A;  2BOJ A;  3UT0 A;  4EN9 B;  4QB1 A;  1EPZ A;  2PHR A;  4FOV A;  1B35 B;  2BBA A;  3QH7 A;  2YPJ A;  4IDZ A;  4V2V A;  4YGE A;  1GOG A;  3ZYJ B;  3ZIX A;  4LOT A;  5JI7 A;  3T0B A;  4UF0 B;  4YGB A;  1EPW A;  2B5H A;  4XEZ A;  1W6M B;  3ACL A;  1O3R A;  3APB A;  3JBG 1;  5EHD A;  1IQD C;  2CNA A;  4QWN A;  4MV2 A;  2J7M A;  1HXS 1;  2P3I A;  1RUH 3;  3NO8 A;  2UU8 A;  2IXK A;  3MW4 A;  4N43 C;  2DVD A;  3BPS A;  4XDQ A;  2NLR A;  2XVG A;  3DGT A;  1DZT A;  1H2M A;  3P3P A;  2A75 A;  4M0N A;  3ZFG B;  4MH0 E;  3ABZ A;  1V6J A;  1ZBE 1;  4L9B A;  5A6X A;  4PHZ A;  1H6X A;  2GH2 A;  3VBS B;  2IXC A;  1CAV A;  2WFP A;  3D3A A;  4K20 A;  1ENX A;  4RQP B;  4U36 A;  5A7W A;  4CP9 A;  1CAU B;  3ON7 A;  3IIA A;  2WC2 A;  2W91 A;  1OLM E;  3SC7 X;  1JOB A;  1SLL A;  2QQO A;  5AFE A;  1J1T A;  4QGM A;  4CEY C;  1VBD 3;  3K3N A;  1F5F A;  1YUD A;  4UW5 A;  2ZS6 B;  4FXG B;  1SPP B;  3U10 A;  1VJ2 A;  4LE3 A;  5CFC B;  1F35 A;  1Z7S 1;  4NPR A;  4D7S A;  4JV4 A;  5FP8 A;  3KWV A;  4Q4W 2;  1PX4 A;  2MHF A;  4QQL A;  1LAJ A;  2X5I C;  1AX0 A;  4Q4Y 2;  1O4Y A;  5CIS A;  2FD8 A;  3OBR A;  2TUN A;  2VW0 A;  3MHZ A;  4FAH A;  5FMO L;  2K2S A;  2JDZ A;  5FZ4 A;  1QEX A;  5CKM A;  3AL6 A;  4IE7 A;  4LO7 A;  3ZSM A;  1DZQ A;  4OI0 A;  1W9T A;  2OA2 A;  1CPM A;  2J1U A;  4QKF A;  4UI9 L;  5GLW A;  1NCR B;  3CKH A;  4MG2 A;  1COV 1;  5A3O A;  1VIW B;  5AC9 1;  5BUV A;  2ZAH A;  3CJI B;  3MLL A;  3BTA A;  2BTV C;  5F3C A;  5HCB A;  2RS3 1;  1HRI 2;  1W6N A;  2O0O A;  4Y4Y A;  2Y6F A;  3AZW A;  4LBO A;  5CG8 A;  2NP0 A;  4BIF A;  4NRQ A;  5EJ1 B;  3VLB B;  1GZT A;  4OI2 A;  3U75 A;  2WNU A;  1SFN A;  3E6C C;  1MPX A;  5KHG A;  4CDW C;  1KJL A;  5J98 B;  5IJR A;  1W6Q A;  5A7N A;  2DU1 A;  4QQO A;  3NRU A;  1JUI A;  4QU1 A;  3S6P A;  4EN6 B;  1NCQ A;  2HKX A;  3JCI A;  5C8W A;  5FQ0 B;  5FZ7 A;  4TWT A;  3PU8 A;  4IEX A;  4LKE A;  4AE2 A;  2RR1 2;  1YC6 1;  2JDY A;  1UPS A;  1IZ3 A;  1WCD J;  1ZZ7 A;  3HNY M;  1LU2 A;  4XIO A;  4DUW A;  2IUW A;  5FYV A;  4AHW A;  1NY7 1;  3ITQ A;  2DUR A;  3LQC A;  3N9O A;  2D5F A;  3DPR C;  5FY9 A;  1UX7 A;  2ZAC A;  3G7D A;  2ADE A;  1C5H A;  2WZE A;  5F32 A;  5T5P A;  5FP9 A;  1AYN 2;  4LBK A;  1U5Y A;  4PDW A;  3VB9 A;  1ND3 A;  2RMU 2;  3A22 A;  3LOI A;  3M2M A;  3I4I A;  4XDP A;  5ANQ A;  1FI2 A;  1AR6 2;  3ECQ A;  5EXO A;  2WS9 3;  2K9Z A;  1TMF 2;  4BQY A;  4KG0 A;  5FY1 A;  1VR3 A;  2VH9 A;  1SBE A;  3AVR A;  4BLI A;  3QLQ A;  1STM A;  4K3U A;  5L9B A;  2DF7 A;  5IHR A;  4A7Y A;  1OT5 A;  2D40 A;  3WW1 A;  4DIN B;  5L19 A;  1XYO A;  1AVB A;  2WQ4 A;  4UW3 A;  1YHF A;  4CDX C;  3VD9 A;  4FI9 A;  3WDU A;  5BV6 A;  2PTM A;  2PHL A;  2XJS A;  1POQ A;  4QX2 A;  1WA4 A;  5E16 A;  3I3E A;  4CZS A;  1U0A A;  4IEZ A;  5GZF A;  1EV1 1;  1LU1 A;  2AEN A;  5HCH A;  3JXS A;  4CP0 A;  2DCT A;  3JBG 3;  4O65 A;  4LBN A;  1J1L A;  3FC0 A;  3WUC A;  4CCC A;  1V9U 1;  4EJR A;  1XU2 A;  2RS3 2;  1RJ7 A;  1C1L A;  2V72 A;  1HXS 3;  2ZMN A;  2QZ3 A;  2P1B A;  4B4Q A;  3LA3 A;  4C91 A;  5BY5 A;  1V6I A;  1L7Q A;  4ZS2 A;  2W3J A;  2DTY A;  1YWK A;  2RS5 1;  3BAL A;  4GH4 A;  4N9H A;  4QXK A;  5GLV A;  3RWK X;  3VBR A;  3GM8 A;  3ZFF A;  1F15 A;  1ZBE 3;  3K2O A;  3MV1 1;  1RUJ 2;  1W8Z A;  5FRA A;  3VDD A;  3KZ4 C;  4K8F A;  4N53 A;  1W90 A;  4IV1 B;  4XF4 A;  2WZP P;  2VOV A;  1B35 C;  1VB4 A;  4LIU A;  1DLL A;  3GXU A;  2PHW A;  5LAT A;  1BXH A;  2GU9 A;  2RHP A;  4FT8 A;  3RJR A;  2Y38 A;  3V0A B;  4IV3 A;  3HQX A;  1UXX X;  1UU6 A;  4ARY A;  3GDB A;  5A33 A;  4LIT A;  1HQW A;  1UY2 A;  1Z7S 3;  1NY7 2;  4HVR A;  4JGZ A;  5DDJ 1;  3EB7 A;  1VMH A;  1YXW A;  3NJV A;  1SLT A;  1PZ9 A;  1U5X A;  4OUL A;  2YB7 A;  3AK0 A;  1YI7 A;  5C33 A;  1RIT A;  1NX9 A;  2P3Y A;  4KWL A;  3ZFG C;  1OUS A;  1UN1 A;  4Z82 A;  2BGC A;  2CDO A;  4OUM A;  5DG2 A;  5CAZ A;  3VBS C;  5IUQ A;  2QE3 A;  3BN6 A;  1DGL A;  3HBZ A;  3ZYI B;  4GWI A;  4FFF A;  1WLT A;  4A3Z A;  4RQP C;  2IVI B;  1MZ5 A;  1W06 A;  2Y6H A;  4CTE A;  5K4L A;  1W2N A;  2ZAB A;  5CB7 A;  1PX3 A;  3VBF B;  3CL1 A;  5JDB A;  1ZZ9 A;  2W2I A;  3TEY A;  1VB2 A;  2VMH A;  2EAL A;  1HJF A;  3GF6 A;  5LEJ A;  4MGT A;  1MZE A;  3AMP A;  4Q0P A;  1AUY A;  3L2Y A;  1UNB A;  1NXM A;  4XTP A;  1R1A 1;  4E9K A;  3THD A;  2XGX A;  2WKK A;  5CFC C;  4Q8K A;  2WWU A;  1V9U 2;  4K21 A;  2WYS A;  2Q8D A;  2R6Q A;  2VUD A;  3T4H B;  2O1Q A;  3WP6 A;  3M3I A;  2GC3 A;  4ATF A;  2R0H A;  3III A;  5A1F A;  2SLI A;  5T5O A;  1O59 A;  2RS5 2;  2WFF 3;  2ZGS A;  2QQK A;  4BQW A;  2ZX4 A;  2BW8 A;  3MYX A;  3OPW A;  1YQ8 A;  1MS9 A;  1RUF 1;  3NV4 A;  3SHR A;  3PVB B;  2PHT A;  4RYD A;  4UAP A;  4NOT A;  4OHX A;  4COV A;  4UFK A;  3OOX A;  2VXR A;  3ATG A;  4P9X A;  1J3P A;  1NCR C;  2KXL A;  3ZO0 B;  3GJB A;  1UMI A;  3KB5 A;  4B7K A;  2Y60 A;  3WDV A;  3BCW A;  2CWM A;  3B9I A;  3CJI C;  5DZF A;  2XLF A;  2RJ2 A;  4QDQ A;  1KS5 A;  1BHG A;  3B93 A;  3AFG A;  1TEI A;  1HB2 A;  1OFN A;  3U14 A;  4G9S B;  2RS1 3;  3ELN A;  2EID A;  4KBZ A;  2XL7 A;  1DQ1 A;  1D0H A;  4RGK A;  2HBT A;  4DNY A;  4IEW A;  1R08 2;  4HN1 A;  4RN5 A;  4ZPI A;  5LEK A;  4NID A;  2HWB 3;  2JG9 B;  4AHY A;  4GB3 3;  3ZFE B;  1ENS A;  5F9T A;  2I2S A;  1JYV A;  2A3X A;  2BWA A;  2P5B A;  1XJA A;  4RGA A;  4Y1Y A;  5I91 A;  2EF6 A;  4R52 A;  5IVB A;  1VE0 A;  2Z42 A;  3WP3 A;  4LLO A;  3CF6 E;  4QX0 A;  5I8S A;  4AYU A;  3SCH A;  4ES8 A;  3FBM A;  3C7E A;  1BBT 1;  3UYJ A;  1MS4 A;  3HJR A;  3WF3 A;  4HN0 A;  1EV1 3;  5F3I A;  3KF3 A;  4RHV 1;  4AW7 A;  3PTR B;  4MO3 M;  1ST8 A;  4LQR A;  1PK6 B;  2OZ6 A;  4X8P A;  5FPB A;  3TWI A;  1UD1 A;  1LUL A;  3WG2 A;  4BU2 A;  4ES9 A;  3S30 A;  4GUL A;  3BOP A;  1KEX A;  5JLV A;  2OUH A;  5FWJ A;  1EAH 1;  1ZYB A;  4C90 A;  4NE9 A;  1A6C A;  2ZA9 A;  4N43 A;  5JMO A;  3VHR A;  2X05 A;  5FMO S;  1ZNP A;  2J22 A;  4XAC A;  5T5L A;  3CIH A;  4NRP A;  1UF2 C;  1WW7 A;  2VNG A;  3WQB A;  1FNY A;  1J3R A;  1QOS A;  2F4L A;  1BK0 A;  4K1Y A;  2RVA A;  4XFB A;  5E8A A;  3U78 A;  4DXT A;  1ACC A;  5FK7 A;  2VBP A;  1H30 A;  3UGH A;  4QAW A;  1ASJ 2;  2XPJ A;  2EAK A;  4I09 A;  4UFJ A;  5FXV A;  1JYT A;  5GM0 A;  1FOD 2;  1VBE 1;  1VBB 3;  2E63 A;  1FMD 1;  3CLP A;  5D8A B;  1SDW A;  2WNV A;  2YFZ A;  4J1W A;  2C4X A;  5CG9 A;  1CIY A;  1WMD A;  3N36 A;  1SMV A;  5LY1 A;  4DXS A;  1OD5 A;  4AQ2 A;  2QQU A;  4X6R B;  4DMI A;  5JIA A;  1I1E A;  3CQO A;  2E7Q A;  2ILM A;  3C3V A;  2OXB A;  1XNT A;  1PZ8 A;  2X5I A;  3OBT A;  1FXZ A;  3KVB A;  5IAT A;  1OLM A;  3PU3 A;  3TN9 1;  4R4Z A;  2XJR A;  5JUV A;  2CSG A;  2JDK A;  3ROU A;  1LOC A;  5KC6 A;  5EYX A;  4XMA A;  1AXK A;  4I3P A;  1AR8 2;  3C7F A;  4IGO A;  1BQP A;  4J1X A;  3VD5 A;  4UT5 A;  3C7H A;  3TEZ A;  1UX6 A;  4QX8 A;  2VTF A;  3I2J A;  4LBQ B;  4CEW B;  3QOP A;  1BEV 1;  1MQT B;  1GP6 A;  3KV9 A;  4IV1 C;  2FZ2 A;  2D43 A;  3RZK A;  3JZV A;  1NE6 A;  1TNF A;  1G86 A;  2X8K A;  4P00 B;  3W21 A;  1R1Z A;  2PN5 A;  1IGO A;  3OEB A;  3A0K A;  4KWK A;  1AR9 1;  1WUV A;  3AKR A;  1LKN A;  4ISQ A;  3T2Q A;  4AED A;  3LFM A;  4PJY A;  3KT7 A;  2VQ0 A;  1R1A 3;  1DLC A;  4DB5 A;  1D4M 2;  1QJX 3;  1LB2 A;  2D98 A;  3CZJ A;  3URF A;  4AQS A;  1OLQ A;  4RSU A;  2VW1 A;  5FDB A;  3V0B B;  2HWC 3;  1OFS A;  4Y1V A;  3THC A;  4OI1 A;  4BK5 A;  4CDW A;  5HXV A;  4AGV A;  2YXS A;  5LRR A;  2JD9 A;  1Q5O A;  5KHI A;  1H9W A;  3R4D B;  4XFH A;  5CVR A;  5G04 L;  2E32 A;  2DFC A;  2VCA A;  1RUF 3;  2JX9 A;  4NRM A;  1UY4 A;  3S0M A;  4W6Y A;  4Q0V A;  4NO4 A;  3PTY A;  4Y4R A;  4YW3 A;  4Q2F A;  4YW5 A;  4H14 A;  3O1O A;  2ZBJ A;  5T50 A;  1V70 A;  4NHK A;  3MDP A;  3N7L A;  4EN7 B;  3U11 A;  1H9P A;  4ISR A;  3VBF C;  5F8P A;  4F8A A;  4NWV A;  1RUD 2;  2WO2 A;  2WT0 A;  2FCU A;  4AI0 A;  2BNN A;  2JEC A;  5FXZ A;  2J1T A;  5L73 A;  1C5I A;  1YJK A;  3IBM A;  5JR7 B;  3J7M A;  2UWB A;  3I97 A;  4GWN A;  1DQ6 A;  4M00 A;  3FN9 A;  4P02 B;  5FYS A;  4FPK A;  1RHI 1;  4ASL A;  1Y7B A;  5A3L A;  1BZW A;  4AVT A;  4FPL A;  1XQN A;  3AZZ A;  3J4U H;  2ATF A;  5FJK A;  4EQV A;  2BQP A;  2GNB A;  4I01 A;  2DUQ A;  1RJ8 A;  3OSD A;  4LE4 A;  4QPG B;  1IQA A;  1PIV 1;  2ZGT A;  3QH6 A;  4MHU A;  3I49 A;  2V4A A;  2ZEW A;  4JHT A;  2VE1 A;  1BBT 3;  1DIW A;  1V6N A;  4YZ4 A;  3ZSL A;  2XJT A;  1V0A A;  4XJ9 A;  2WAA A;  4OHZ A;  3WF1 A;  4LBL A;  4FSJ A;  5IK7 A;  3NJY A;  4XIL A;  1C57 A;  3CZU A;  3J8F 1;  4OHY A;  2UWC A;  1QKQ A;  4MSV A;  1UMZ A;  2D6O X;  4JC1 A;  2R04 2;  5GAL A;  3UKV A;  3T30 A;  4MXW A;  2ET7 A;  2YBK A;  4RL7 A;  1W6P A;  4CDU A;  5LA2 A;  3HN3 A;  4UFL A;  1VAM A;  3WF2 A;  1MZF A;  3D6E A;  1QXJ A;  1W6O A;  5FBZ A;  1A8M A;  1LED A;  2DUO A;  2JG9 C;  2C5D A;  3ZFE C;  1AYM 1;  4XMI A;  1JU3 A;  1N3O A;  2WO7 A;  1QJU 2;  3HOB A;  5FZ9 A;  1OHF A;  3AKQ A;  3AP4 A;  1MS5 A;  3UET A;  3I59 A;  5FZO B;  1QXP A;  3OYW A;  4J6G A;  4A2U A;  4JKK A;  3FFZ A;  4NPM A;  4ZKT B;  1HB3 A;  1LHU A;  1UXZ A;  2J1E A;  4HBN A;  1OUR A;  1QQP 1;  3PL0 A;  5EJ3 A;  1FMD 3;  2G1M A;  4NUB A;  4UF0 A;  4OQ8 A;  3G6J B;  3ACF A;  2GC2 A;  1PK6 C;  3NMB A;  4FPH A;  2G4I A;  3J9S A;  2YU2 A;  3VD3 A;  2H0B A;  3WNK A;  4CXX A;  1ALY A;  1D0G A;  4ZZ8 A;  2PLV 3;  1PMJ X;  3Q8C A;  4N90 A;  2F17 A;  4B1M A;  5JCT A;  4COW A;  4Q4X 2;  3OY8 A;  2HH9 A;  2BVV A;  3WDT A;  1VRB A;  4AAP A;  1GQG A;  3M70 A;  3IDA A;  3POB A;  4MGY E;  4XBN A;  3TN9 3;  5FOB B;  1RHI 2;  1I5Z A;  4YLZ A;  2ZGK A;  4XAA A;  4CUB A;  2BBV A;  3ZFG A;  4I2O A;  4G4F A;  4CU7 A;  4YW4 A;  3I3B A;  4FOW A;  1PM4 A;  5B4N A;  2ZGP A;  4OUS A;  2AR6 A;  3VBS A;  4ASK A;  1NE4 A;  1W28 A;  4BQ5 A;  5FKC A;  4AXO A;  3RYP A;  2FDH A;  4RQP A;  1N1T A;  1CAU A;  1PIV 2;  3WW2 A;  1CIW A;  1OF4 A;  1JH5 A;  4AVC A;  5A32 B;  2ZX3 A;  4HET A;  4LA2 A;  5IK4 A;  2IC1 A;  1JU4 A;  2B7Y A;  2VUJ A;  2YFU A;  4U2A A;  4LTA A;  5D8A C;  3GJA A;  5FYT A;  4YG0 A;  1SPP A;  2CV6 A;  2ZGL A;  3MW2 A;  2VZV A;  3AKS A;  3KT1 A;  4W65 A;  5GZD A;  3ZXK A;  4AEJ A;  5CFD B;  2AYH A;  1RUG 2;  2OQ6 A;  4FBF A;  5CFC A;  1JZ8 A;  1APN A;  4LA3 A;  2SBA A;  2Y34 A;  2G9F A;  2W1S A;  2BPA 2;  3RJ2 X;  5GZC A;  4A6S A;  2XBO 3;  3KM5 A;  2Q4S A;  1JZ5 A;  1LGN A;  1HX6 A;  2PXJ A;  3O5S A;  3RFR A;  3S7I A;  2HWE 1;  2GZW A;  1AYM 2;  5FZK A;  3IZO A;  1F9K A;  4OMC A;  4CEW C;  2ZMK A;  1MQT C;  2C9A A;  1H0B A;  4MOA A;  5LAS A;  1L7L A;  1DG6 A;  2HEY F;  1XND A;  1TME 2;  3B94 A;  4HOO A;  1Q8Q A;  1ENR A;  1RUE 3;  1I3H A;  4P9I A;  3AP6 A;  3CJI A;  4TSV A;  2ZEX A;  3VKF C;  3WVJ A;  2FQP A;  2I45 A;  1W8T A;  3H3U A;  1PO2 3;  1KQR A;  3ILF A;  1OMI A;  4QD2 A;  4C1W A;  4BQ4 A;  4DRR A;  4YM3 A;  5E6H A;  3ZSJ A;  2R16 A;  5C71 A;  2V5Y A;  3U0Z A;  1N3Q A;  5B4X A;  2EXI A;  3OPZ A;  4LKF A;  5JPN B;  1SCR A;  3K48 A;  2JG8 B;  4AVB A;  2YZ4 A;  4FTS A;  4OFG A;  1E5H A;  4BM8 A;  3CNA A;  5FLJ A;  3AP5 A;  4KBB A;  4YM1 A;  5GLU A;  2W68 A;  3D8C A;  3AL5 A;  3UGF A;  1OH4 A;  2PEL A;  1PVC 2;  4CVU A;  1K45 A;  3ZR6 A;  2Q30 A;  1GR3 A;  3TEW A;  4FTE A;  5A7P A;  3RYR A;  3ZXE A;  3J8F 3;  1QOO A;  2K0G A;  3JU9 A;  1VBD 1;  1OPM A;  4M3C F;  4Q0U A;  5IVE A;  1H8V A;  2PYT A;  2A5Z A;  1U5I A;  5SV5 A;  2WNE A;  4WVM B;  3VHO A;  4HAN A;  4RFT 0;  3MPP G;  2LRO A;  3WCR A;  2IXI A;  2VOW A;  3EXU A;  4HSL A;  2QDR A;  3KMH A;  1OA2 A;  2ZGO A;  4YW6 A;  1KGY A;  1FAY A;  5A7S A;  4E8C A;  1OXC A;  2ZOE B;  1VRH 3;  2WDB A;  3FBY A;  4A7Z A;  4Q1P A;  1C8M 2;  2VMD A;  3N9L A;  4UYB A;  4EN0 A;  2XJV A;  1C1F A;  4YVW B;  1CX4 A;  4QPG C;  2R07 3;  3DYO A;  1CZS A;  3RPQ A;  1LOF C;  4JGY B;  5JOW A;  1QQP 3;  1W39 A;  2Y6L A;  4BJ0 A;  2P37 A;  2HWD 2;  4PI2 A;  1MS8 A;  4OUE A;  1CJP A;  4HXC A;  3B3Q E;  1P8J A;  1NXD 1;  4JTO A;  3JQX A;  2W95 A;  4CCD A;  4L99 A;  3ZYR A;  2D5H A;  1IG0 A;  3H9A A;  3JUU A;  1J84 A;  3ZM8 A;  4NR1 A;  2GC0 A;  4HKO A;  1S2B A;  1Q8S A;  3OTF A;  2XHN A;  4N9I A;  3TNQ A;  4TZD A;  2XG3 A;  5C3P A;  3VDA A;  3LGR A;  1IPJ A;  1RUH 2;  1WA6 X;  1ND2 B;  4XCB A;  1QWR A;  2B39 A;  3INA A;  5LA0 A;  1VAK A;  3PJY A;  4F7Z A;  4Y5Z 0;  4HK9 A;  2VUL A;  4QKD A;  5EQU A;  2XB6 C;  4JHZ A;  2I74 A;  5FYU A;  3ENR A;  1XC6 A;  3MF9 A;  1US3 A;  2E7T A;  2OW4 A;  3Q8E A;  3E5X A;  3SLI A;  3H1Y A;  5KXE A;  4RGG A;  2WII B;  1JZ7 A;  1SHW B;  2LUW A;  2YRO A;  2VZQ A;  2DU0 A;  1YFW A;  3V0A A;  2PHD A;  2QQJ A;  2YGM A;  4PLM A;  3K51 A;  1YQ5 A;  1CAW B;  5FZ0 A;  1HRV 3;  4QDR A;  4UFM A;  4E2G A;  5GZG A;  3GBG A;  3K4D A;  1K5M A;  3EYP A;  3OGG A;  3EQE A;  2JIC A;  4IEO A;  2Z4F A;  2WS9 1;  3P1I A;  1GZW A;  3AVS A;  4IW3 A;  4AFM A;  1XRU A;  1BJQ A;  2B45 X;  1PZ7 A;  3TOJ A;  3VKL A;  4YZ2 A;  2BU9 A;  2QQP A;  3H0O A;  4BZ4 A;  1WMX A;  3LA7 A;  4NN0 A;  3SMH A;  4A41 A;  1UU5 A;  3AMN A;  1TZO A;  1UOJ A;  4BPZ A;  2QQN A;  3C2U A;  4HKL A;  3OEA A;  4LO5 B;  5FCC A;  4AQT A;  1JZ2 A;  4L0P A;  1UIK A;  4AWD A;  2QJV A;  5C8C B;  5C4W A;  3LEM A;  4DEQ A;  3FZ3 A;  1GIC A;  2PHU A;  3H3L A;  4NMI A;  4PLN A;  1KIT A;  1N1V A;  2HJI A;  4GQ7 A;  2E31 A;  2IFR A;  4R9A A;  5FP7 A;  5FOJ B;  5C7G A;  3JD7 1;  4COU A;  2MPF A;  3NNM A;  3A7Q A;  2IXJ A;  1IPK A;  1LEC A;  4M4R A;  4DPN A;  2YY1 A;  2ZX0 A;  3IAP A;  5FZ6 A;  4TN7 A;  5JZG A;  5CFD C;  2A3Y A;  3N7K A;  2GN7 A;  3O0X A;  4QPY A;  5CNA A;  2BGP A;  3MO4 A;  2XJQ A;  5D2A A;  1Q56 A;  4MLO A;  4QXC A;  1WW6 A;  2D6M A;  4LLF A;  1R09 3;  5EZW A;  2WR9 A;  1RVF 1;  2ZGM A;  1U12 A;  4A6O A;  1Y9G A;  2VUA A;  3T0D A;  1UCX A;  2XUM A;  1ONA A;  4KGQ A;  1IS5 A;  2GSY A;  3VGI A;  1RUN A;  1ZRC A;  4XFA A;  1FT9 A;  5EPA A;  3VBU B;  1SDD B;  1JYN A;  2W5F A;  4ZZ5 A;  2WIN B;  2GN3 A;  4PLO A;  3FLT A;  2ET1 A;  4MYE A;  1F5J A;  2LAL A;  2OQ7 A;  1JOD A;  3NST A;  1F4H A;  2VAU A;  2RG4 A;  3O12 A;  4GWM A;  4OMD A;  4QM9 A;  3ASI A;  4QXB A;  1VBC 2;  2R7E B;  4O7X A;  4WZC A;  4XUT A;  1HQL A;  2IVJ A;  2VCC A;  3K75 B;  3RZZ A;  4IGP A;  1PNF A;  2JG8 C;  1NG0 A;  2IXH A;  1G6N A;  1G9F A;  4JDM A;  4LR4 A;  4PBP A;  4UOJ A;  4AFB A;  4Y20 B;  5F7U A;  5IWF A;  2A7A A;  2NZ9 A;  3M3E A;  4ERO A;  4EWA A;  2YDE A;  3OB8 A;  3B69 A;  5ERL A;  2J42 A;  3ORJ A;  3R4S A;  4Q4V 1;  5FPV A;  2YUE A;  5DUV A;  1GYK A;  5LK5 A;  2BEO A;  1UPI A;  4JZR A;  3ZN6 B;  5FY0 A;  1WME A;  2ZZQ A;  4CUA A;  2WLP A;  3O1S A;  4DQA A;  2XJP A;  3T2T A;  5EWS A;  3ZKY A;  3NAP B;  1VMJ A;  5HV4 A;  3JBG 2;  4AVA A;  5CYY A;  2HLE A;  2VGD A;  3WZ1 A;  3WUD A;  4AFC A;  4B7E A;  2WBK A;  2X10 A;  5FFO C;  1HXS 2;  5FIX A;  4RD7 A;  2W46 A;  3LSD A;  2WL1 A;  3KHB A;  4XC9 A;  1NZI A;  3UL2 A;  2WFF 1;  4AL9 A;  3OGJ A;  1W9W A;  4MGI E;  1XNB A;  2WO3 A;  2B42 B;  2Y6J A;  1ZBE 2;  4YVW C;  5JXI A;  5KHK A;  3A21 A;  3BVC A;  1IOA A;  2XR4 A;  3LIH A;  4JGY C;  1S0C A;  4YM0 A;  3UNP A;  1XE0 A;  1YIP A;  2C24 A;  3GZE A;  1ZRE A;  1WD4 A;  1AJK A;  3DXU A;  5A1L A;  4FP3 A;  1QXR A;  3O1T A;  3PJQ A;  4NWW A;  2H6B A;  3PMS A;  1LES A;  2JDN A;  3D4K A;  4Y24 A;  1HDK A;  5C3O A;  5C9A B;  4JKM A;  4MGK E;  3VDC A;  2RS1 1;  3MFA A;  1HJG A;  3VKO A;  5KR7 A;  1C8N A;  3WP4 A;  1UQX A;  1SLA A;  1Z7S 2;  5T52 A;  4P9J A;  2HWB 1;  5LRS A;  1XU1 A;  4A45 A;  3MFC A;  1ND2 C;  2UYA A;  4GB3 1;  4MAD A;  4QPW A;  5I8T A;  2FDF A;  3E97 A;  4MGZ E;  4M3C B;  5FMC A;  4FPE A;  1FPN 3;  4XET A;  4ZU5 A;  1JYC A;  1HV1 A;  1W03 A;  4CA9 A;  3AZX A;  4XJ8 A;  4CEW A;  4P9G A;  1H1I A;  3LAG A;  1MQT A;  1H8T B;  1W2U A;  1JYI A;  1AXY A;  1ULD A;  1COV 2;  4KWJ A;  5AVP A;  4GKY A;  3JD7 3;  5GJ6 A;  5SV8 A;  4Y3O A;  5AC9 2;  4A42 A;  1IKQ A;  1JOJ A;  2JB8 A;  4P5Y A;  2D6L X;  3T2O A;  4JDN A;  3VBO B;  1D2Q A;  1EP0 A;  4XUQ A;  2F6B A;  1BKZ A;  2QTW B;  5F5C A;  1E5S A;  3F2Z A;  4CCK A;  1LEM A;  5FPA A;  4S2D A;  2UWA A;  1O7F A;  4AFA A;  1UZY A;  2L9L A;  5BYN A;  4ET7 A;  4FFH A;  1SBF A;  3LE0 A;  3ACI A;  3ES4 A;  4QHO A;  2WT2 A;  4Y5S A;  2ZGR A;  1JXN A;  1DGW A;  3NV3 A;  4LNV A;  3HQR A;  4HZF A;  2WQ8 A;  1J3Q A;  1RVF 3;  4YVS A;  3VHP A;  1BK1 A;  4WM7 A;  5ANN A;  3WDY A;  4SBV A;  4NHX A;  2O8O A;  4LOS A;  3RGB A;  1WLW A;  1W3X A;  3WHT A;  5A3U A;  5H9P A;  5C8C C;  2W0X A;  1ZRR A;  2OKX A;  2I07 B;  3ACG A;  3B7M A;  5A6Q A;  5BNN B;  2DFB A;  1O5U A;  5HCA A;  2HEW F;  4R9C A;  3AYC A;  2NMO A;  1VBA 3;  2GH8 A;  5JR2 A;  1VBB 1;  2OUJ A;  2C9K A;  1OD3 A;  3KQ4 B;  3T09 A;  1E57 A;  3L2H A;  3AKP A;  2HYX A;  5BNP B;  3R05 A;  1BYH A;  3PUI A;  5L7O B;  3MV0 1;  5FPZ A;  4KI5 M;  5H9Q A;  1J59 A;  2W1W A;  1NYW A;  4AF9 A;  4WM8 A;  2WZR 3;  5LBE A;  1G9D A;  1ULC A;  4BQ3 A;  2J1S A;  3ILR A;  3MIG A;  3T0A A;  1NA1 B;  3PME A;  3WF4 A;  2BDR A;  3WNL A;  2JXA A;  5H9S A;  1GUI A;  2DBN A;  4GB3 2;  4P5H A;  4PCR A;  2HWF 3;  1DGR A;  1QJE A;  5DAV A;  4Q4V 3;  3WG4 A;  3BB6 A;  2RMU 3;  2V09 A;  2CAU A;  3VBU C;  4C8D A;  4DXZ A;  3O1V A;  1RGS A;  1CAX B;  3ME2 A;  3O1M A;  4RS5 B;  3CHX A;  3ZR5 A;  4QQP A;  1W8W A;  1EV1 2;  4B29 A;  4IND A;  3P3N A;  5IAX A;  5K0U A;  4PT6 A;  3FLR A;  2WJS A;  1CWP A;  1V6L A;  4Y22 B;  4CPB D;  2CYF A;  1QJX 1;  1UAI A;  3PUS A;  3I2D A;  2DWR A;  2OZJ A;  4MHR A;  4E2Q A;  4RR3 A;  3O1R A;  1V6M A;  2HWC 1;  5F2S A;  1F4A A;  2NN8 A;  2VG9 A;  3M1H A;  4H55 A;  3HIF A;  3LSE A;  5L9V A;  3WNX A;  1RXG A;  1NOV A;  2W1Q A;  1T6B X;  2BYV E;  4QX5 A;  2XVL A;  2MEV 1;  2VZO A;  1Y4W A;  4DIQ A;  2WN3 A;  1NQD A;  1S2E A;  1VP6 A;  1W2T A;  2BNM A;  2QZ2 A;  4W4Z A;  5FZO A;  3I3M A;  4DUV A;  1H2K A;  4IER A;  3HNM A;  3E6D A;  3MID A;  5ABJ B;  2UY9 A;  1XYN A;  4ORF A;  3KHC A;  3GAL A;  4QKN A;  2J1V A;  4XJU A;  1US2 A;  5FUI A;  1GQH A;  1GOH A;  4CU8 A;  1KDM A;  2D97 A;  2FHR A;  3AFK A;  3AZY A;  3NKG A;  4LHL A;  2X53 S;  4FVV A;  4XBQ A;  3V56 A;  1TVG A;  3LKJ A;  3NAP C;  4CCN A;  5BXX A;  4D0Q A;  2ERF A;  4XHX A;  2WA4 A;  1O6U A;  2BWC A;  3LEG A;  2GMM A;  2VMF A;  3N4M A;  1O91 A;  1ZZ6 A;  5FPX A;  1GZ9 A;  2GNT A;  3HD8 B;  4LBJ A;  1Z0H A;  4Q0Q A;  4FFG A;  4URT A;  5DDJ 2;  5A7W B;  1JUH A;  3ZYH A;  4CP9 B;  3VUO A;  1DQ4 A;  2C6S A;  3MUZ 1;  1Q8O A;  1OKQ A;  3HMY A;  4TLF A;  1E5R A;  2G9Z A;  3JQW A;  4WZF A;  4XUO A;  5A3N A;  2A1X A;  2E33 A;  1JYX A;  1E5I A;  1NUK A;  4QX3 A;  2CGP A;  2QNK A;  2D3S A;  3SKJ E;  4AZZ A;  4B8E A;  5JWP A;  1JYW A;  1W8F A;  4XCA A;  1GBG A;  1C3H A;  5IVC A;  5LBB A;  2VCB A;  4QHB A;  3CEW A;  4CYD A;  2AEZ A;  3DV8 A;  3W20 A;  2DCJ A;  2JKB A;  2YC2 A;  4LIV A;  1HB1 A;  3MIE A;  4JTN A;  2W92 A;  4D3W A;  3OUJ A;  5C9A C;  2Y0O A;  2WAO A;  3MIB A;  1J58 A;  3H8R A;  1REE A;  3H3Z A;  4YGD A;  1OVP A;  2JDU A;  2TNF A;  3UJQ A;  1I6X A;  1R1A 2;  2VC9 A;  1SFY A;  4OYU A;  1GOF A;  1QJX 2;  3HT1 A;  1FV3 A;  4QB2 A;  2IXL A;  4XF0 A;  4ZY9 A;  4Z2A A;  1RUI 1;  5FTT C;  3ZXD A;  4BOW A;  3CO2 A;  4FPJ A;  4IE0 A;  4CRQ A;  1UW8 A;  1SLI A;  1YLL A;  1W6N B;  2QFE A;  1VAV A;  3D82 A;  4LKS A;  5FJH A;  1RUF 2;  2YC4 A;  1UIJ A;  1I9R A;  4YM2 A;  1PGS A;  1H8T C;  1OI6 A;  2WNU B;  3JB8 A;  1ODN A;  1O4T A;  3KCX A;  4CEY A;  3E6B A;  3POJ A;  2BV4 A;  4FXK B;  2AUY A;  2XWB B;  3DXT A;  4I30 A;  4IUG A;  3E1F 1;  3VBO C;  1MZ6 A;  1F2N A;  1PMH X;  2D3P A;  2PLV 1;  2BVB A;  2QQL A;  3MIF A;  3FE5 A;  2VZP A;  2YPD A;  1DQ0 A;  2VME A;  4DOU A;  2AC1 A;  2JG8 A;  2LM3 A;  4MET A;  4PF5 A;  5TSW A;  1QDO A;  4CSW A;  3B02 A;  4IXL A;  2A70 A;  4V2W A;  5J96 B;  2W1U A;  4HVQ A;  3RRD A;  1Q43 A;  2PHX A;  4FOY A;  1WLD A;  1RED A;  3OGR A;  5FO7 B;  3SQO A;  2QUO A;  5EJZ B;  4CDQ B;  5BNN C;  4PDW B;  4XBL A;  1BBT 2;  1XXN A;  1NZC A;  2P6H A;  2Z69 A;  4URA A;  3FJS A;  1XSQ A;  4RHV 2;  4DY5 A;  1QU0 A;  4DS0 A;  4JVA A;  5FYY A;  5BNP C;  5DUX A;  1ODM A;  1HKD A;  2R49 A;  4WVM A;  3VZJ A;  2ORZ A;  2ZCW A;  5L7O C;  2QQM A;  2YYO A;  4PI0 A;  4IE4 A;  1EAH 2;  4JQR A;  3GZA A;  2RM2 1;  2D6K A;  1JMU B;  1IS3 A;  4J25 A;  2VNO A;  2XBO 1;  3MW3 A;  5L9R A;  4YAR A;  1LOG A;  1O8S A;  1NA1 C;  4IET A;  2ZTN A;  5IYY A;  2MEV 3;  5IFT A;  1AXZ A;  4XYX A;  2DYC A;  3ZYG A;  3ZYP A;  1G9C A;  2XVK A;  2ETE A;  4JGY A;  1M06 G;  2CL2 A;  4IES A;  2X09 A;  4S2G A;  2R30 A;  3CJX A;  4FFI A;  1O3T A;  1RUE 1;  3FMG A;  3NKT A;  2FZ1 A;  2ENR A;  2AGS A;  4KG8 A;  4Q29 A;  4RS5 C;  4NHL A;  3TYJ A;  4B4R A;  1PO2 1;  1VBE 2;  1NLS A;  3DPR A;  3J7H A;  1FMD 2;  3H7Y A;  4CPB A;  4XZU G;  3WY6 A;  5HBA A;  2FCV A;  3C7G A;  5FY8 A;  1OQ1 A;  2GP3 A;  1BVP 1;  1WMF A;  4K9S A;  3AMM A;  4N53 B;  1EUT A;  2PLV 2;  1PGW 1;  3LEI A;  1ASJ 3;  2UY8 A;  5LBF A;  2VQU A;  1PO1 1;  2DVG A;  1FOD 3;  2VUC A;  4L8Q A;  4NVP A;  3TN9 2;  3ZN4 A;  3ILN A;  1PGL 1;  2JDA A;  2CY6 A;  2DCY A;  4CDX A;  4IV3 B;  4JRL A;  4P14 A;  1YYN A;  5LY2 A;  4KNC A;  1D2S A;  1A8D A;  2VNR A;  2VBB A;  2CGN A;  3ZPO A;  5A33 B;  1Y9Q A;  5FZH A;  4XE9 A;  5J36 A;  5IVJ A;  4Z92 B;  2VOT A;  4JGZ B;  4M4P A;  5ABJ C;  1B09 A;  1BEV 2;  3THT A;  1RUC 1;  1BMV 1;  2RJK A;  3USU B;  3LDK A;  1YCI A;  3RI8 A;  1X7N A;  1AL2 1;  4LO6 B;  1UO9 A;  1URX A;  4LXL A;  2B4K A;  3H42 B;  1D4V B;  1AHS A;  2EAA A;  3GNE A;  1O4Z A;  3AXE A;  1LOB A;  3MIC A;  3U1X A;  4IEQ A;  1AR9 2;  3TEX A;  3ZDS A;  5FP4 A;  5KXD A;  4K8R B;  5A7O A;  4AI8 A;  2V73 A;  1XB9 A;  1RUI 3;  4L97 A;  3BUC A;  3VZN A;  3BOW A;  2A6Y A;  3O1U A;  2AEY A;  3FFQ A;  2RDS A;  3D5O A;  5BNQ A;  1VRH 1;  3T1L A;  1ULF A;  3AYE A;  3N3H A;  3IT8 A;  1H6Y A;  2R07 1;  4K40 A;  4YW7 A;  4YZ5 A;  1S0B A;  1B35 A;  1PM7 A;  1W9S A;  1DFQ A;  4JCK A;  2JDM A;  3KS7 A;  3AMQ A;  2O8Q A;  2VTX A;  4HG6 B;  4HLT A;  1HLC A;  1UU4 A;  5DMY A;  3KV5 A;  2E7A A;  4AI3 A;  2JEM A;  4QPI B;  5J7M A;  1W6M A;  1ZZB A;  2Y6K A;  1W99 A;  5FY5 A;  1RUE 2;  4XOG A;  4FPY A;  1M4W A;  4LMF A;  4EZH A;  4BXS V;  5HXM A;  3KD4 A;  1QJZ A;  4MGQ A;  4XJA A;  1CON A;  1XSR A;  5HPO A;  3O14 A;  1UY0 A;  1GP5 A;  4FTB A;  1QDC A;  4KWU A;  5JMC A;  1RUD 3;  3T08 A;  5HV0 A;  2P17 A;  3U4X A;  1SFP A;  5KBF A;  2KA3 A;  5FZB A;  5T55 A;  1RUO A;  3OCP A;  1EYB A;  1PVX A;  2LTN A;  3M7A A;  3PDQ A;  3A23 A;  5T54 A;  2XHK A;  1CPN A;  2QBX A;  2WA3 A;  2WWS A;  4R8H A;  2WNO A;  3VBU A;  1ZA7 A;  2WNU C;  2EIB A;  4XXA A;  5FO8 B;  1NT0 A;  4XUP A;  4BCU A;  4AVV A;  1YQ6 A;  5CEH A;  2QQV A;  4H2A A;  4W50 A;  3J8F 2;  4BWO A;  3LIG A;  1Z78 A;  1X33 A;  4AI2 A;  3Q8A A;  3DEM A;  2WSV A;  1HRV 1;  3K46 A;  5J37 A;  3LCP A;  4JX0 A;  5FZG A;  1KD7 A;  2UUR A;  4XJW A;  2RM2 3;  1SG3 A;  4YFZ A;  4DY3 A;  4EV0 A;  3ZXL A;  5DN2 A;  3OBA A;  2ZGN A;  3VBH B;  4I3G A;  1UKG A;  3NV1 A;  1DYP A;  5DXD A;  3BPZ A;  3ALQ A;  3N9M A;  3RDI A;  4RA0 A;  1H4G A;  4QQH A;  3EBR A;  4X6Q B;  1NCR A;  1FV2 A;  2ES3 A;  3PVE A;  4S2F A;  3WQ7 A;  4I02 A;  4CDQ C;  3NVC A;  3QAC A;  4PBO A;  3MUY 1;  4Y5T A;  4PDW C;  2ARC A;  1QHD A;  1W05 A;  1QQP 2;  1DGW X;  5FR3 A;  2R06 3;  1MVQ A;  1V6O A;  2VCM A;  2Q1F A;  4N7U A;  5JVV A;  3N9N A;  3GZT B;  4GKX A;  4W6W A;  3BTX A;  2R1B A;  4OHV A;  3L9J T;  2VZT A;  4BLJ A;  3NAP A;  3M3C A;  1POV 0;  3HPN A;  1JI6 A;  4NII A;  1GSL A;  1S0E A;  2WSU A;  5JXH A;  2EIG A;  4XUR A;  3GHN A;  1PO1 3;  1S0F A;  1AR7 3;  1WW4 A;  3S5A A;  5FRE A;  3LEK A;  2JE7 A;  4YG3 A;  4IEU A;  4NRO A;  4XW3 A;  1X50 A;  1R09 1;  1S0I A;  3UKN A;  1HN0 A;  3N7M A;  5LW9 A;  3LF7 A;  3MIH A;  3PIG A;  4XFF A;  3RWN A;  4QU2 A;  2WNV B;  2WN2 A;  4XIK A;  5F3E A;  4CXW A;  5FQ0 A;  3N9Q A;  4XFG A;  1KFU L;  4AQ6 A;  3W59 A;  3LOB A;  2VJX A;  1RUC 3;  3I2H A;  1W0N A;  4IEY A;  3QD6 A;  2DVF A;  1AL2 3;  5FKB A;  2CTV A;  4L2N A;  2ARB A;  4W6X A;  5BNO B;  3AZV A;  3GBF A;  3TAY A;  3BU7 A;  2A6Z A;  2PFW A;  5FZA A;  3FHQ A;  3EMR A;  3NV2 A;  3HAG A;  5C9A A;  3HEI A;  5C3Q A;  1WGP A;  1ZBA 1;  2ORX A;  4BE3 A;  1NAE A;  4GAL A;  5E89 A;  1S0G A;  2RV9 A;  2WRA A;  3ACH A;  4N53 C;  3IAQ A;  3RG0 A;  1OOP B;  1W3V A;  2VMI A;  1OA4 A;  4QHZ A;  1MEC 1;  3HN1 A;  4H3W A;  1MS1 A;  4BDV B;  3RZG A;  1RMU 3;  4LK6 A;  1QOT A;  3T2P A;  3EJK A;  5CA6 A;  5IVV A;  1WCU A;  4AEM A;  4IV3 C;  5JOZ A;  4AHX A;  2HWE 2;  1RUG 3;  4AED B;  3NJZ A;  4OQ9 A;  1A78 A;  3SNM A;  5FMB A;  1YQ2 A;  1W8U A;  3SCG A;  2F4P A;  4GMP 0;  3FUO A;  4JGZ C;  4NHM A;  4P9L A;  3W5M A;  3NW4 A;  4NIG A;  1GNZ A;  5E1R A;  1QJY 1;  3BIE A;  1XBF A;  2BNO A;  4LO4 B;  4KMQ A;  5F6L B;  3HBK A;  5FZD A;  4ZON A;  1RIR A;  2RE9 A;  2WWJ A;  4TLG A;  2P34 A;  2BOI A;  2VZ1 A;  2ZKL A;  5DAX A;  1GAN A;  4HT1 T;  3J26 N;  1JS9 A;  3M3O A;  5BPX A;  1SAC A;  3VL9 A;  5FPU A;  4CUG A;  5KXB A;  2VW2 A;  4GA9 A;  1EUU A;  4LK7 A;  3VKN A;  3KQR A;  5AVA A;  5JXG A;  2JDH A;  2ARA A;  1JBC A;  1UYX A;  2CDP A;  1O5L A;  3ZXA C;  1KXG A;  1AX1 A;  1ZVF A;  3DKW A;  4I0A A;  4N7I A;  4Z1V A;  4Y26 A;  4LBQ D;  5DAB A;  2GMP A;  1CJD A;  4IV1 A;  5GZE A;  3VN4 A;  5FZC A;  5ACA 3;  4FPO B;  5LWB A;  4XUN A;  4OLL A;  2P6C A;  4JDO A;  1DCS A;  2RJL A;  3PUQ A;  1QMJ A;  5FUP A;  3RZH A;  1EY2 A;  3KSC A;  3BYW A;  4QPI C;  3RQ0 A;  3WQ1 A;  5A3T A;  1IPS A;  1VBD 2;  2XKP A;  3H7J A;  1JZ6 A;  1OBN A;  2Q8C A;  4LKD A;  5F1R A;  2TBV A;  3LPG A;  3OD0 A;  3OJB A;  1BVV A;  1YO8 A;  5A1A A;  2VM9 A;  3MEP A;  1X82 A;  1WCK A;  3DUI A;  4E4H A;  4NJ4 A; 
#chains in the Genus database with same CATH homology
 2GP3 A;  5A7P A;  3U78 A;  4LIT A;  5F5A A;  5F5C A;  5FZ4 A;  3AL6 A;  5FXW A;  4GAZ A;  2VD7 A;  3ZLI A;  4CCK A;  5FZE A;  5IVE A;  3N9N A;  5FPA A;  5IVC A;  3LDB A;  5FXV A;  5FZ9 A;  5FZL A;  5LY2 A;  5FY4 A;  5FZO B;  3KVA A;  4D6S A;  4LIV A;  4GD4 A;  5FZH A;  3ZPO A;  4CCO A;  5LY1 A;  5IVJ A;  5F3C A;  2OX0 A;  5FBJ A;  5FZI A;  5A7S A;  4DO0 A;  5A3P A;  5A80 A;  4BXF A;  3KV6 A;  2XML A;  3PUA A;  5FYH A;  5A7Q A;  4NUB A;  2OQ7 A;  3KVB A;  3N9L A;  4UF0 A;  3PU3 A;  4LXL A;  3KV4 A;  5K4L A;  4QXB A;  5F3E A;  2YU2 A;  5F39 A;  3RVH A;  5FXX A;  3N9Q A;  5FPL A;  4IGO A;  4QXH A;  2W2I A;  5FP4 A;  5A7O A;  4QX8 A;  4IGP A;  5A7N A;  4GJY A;  2Q8E A;  5FJH A;  4QU1 A;  1VRB A;  3U4S A;  4AAP A;  3KV9 A;  5F5I A;  5IWF A;  5A3N A;  2WWU A;  5FZA A;  4EZ4 A;  5FZ7 A;  5FY7 A;  2Q8D A;  2XXZ A;  3PU8 A;  4BIS A;  4XDO A;  3DXT A;  5FPV A;  4ASK A;  4EYU A;  5A1F A;  4Y33 A;  5FYV A;  5FY0 A;  3OPW A;  3OPT A;  3PUR A;  3N9O A;  5FY9 A;  5IVV A;  3KV5 A;  2YPD A;  2OS2 A;  5F32 A;  5FP3 A;  4CCM A;  5LW9 A;  5FP9 A;  4HON A;  5F37 A;  5FUN A;  3K3O A;  5FYT A;  5FY5 A;  4C8D A;  4CCL A;  5FYB A;  5FZ8 A;  5F3G A;  4XDP A;  5ANQ A;  4CSW A;  4EZH A;  5FYU A;  4D6Q A;  4V2W A;  2OQ6 A;  5FYZ A;  2XUE A;  5FY1 A;  4V2V A;  5FZ1 A;  3AVR A;  4Y4R A;  4UF0 B;  5FYM A;  3PUS A;  5FWE A;  5FZD A;  5F2S A;  2PXJ A;  5FZ0 A;  4QWN A;  5FZB A;  4URA A;  2WWJ A;  3N9P A;  2YBS A;  5FV3 A;  5FXZ A;  5FZK A;  3PDQ A;  5FZ3 A;  5FYY A;  5A1L A;  3DXU A;  5FPU A;  4CUG A;  2OT7 A;  2P5B A;  3LD8 A;  5FZM A;  5FYS A;  2XDV A;  3AVS A;  4DIQ A;  2GP5 A;  5IVB A;  4CCJ A;  2YU1 A;  4HOO A;  4IGQ A;  5FZO A;  5IVF A;  5IW0 A;  5CEH A;  3UYJ A;  5KR7 A;  2YBP A;  5FYI A;  5IVY A;  5F3I A;  5FJK A;  5A7W A;  3PTR B;  5E6H A;  4AI9 A;  5FZC A;  5LWB A;  5FZG A;  5FPB A;  4BU2 A;  3K2O A;  5FP7 A;  3K3N A;  4CCN A;  3PUQ A;  4GJZ A;  5FUP A;  5FWJ A;  5ISL A;  5A3T A;  5F2W A;  5FYC A;  4QX7 A;  3NJY A;  5FZ6 A;  5FZF A;  5A7W B;  3N9M A;  4TN7 A;  2Q8C A;  4D6R A;  4LIU A;  5FP8 A;  3AL5 A;  5A3W A;  2YBK A;  4Y3O A;  4QXC A;  5FY8 A;  4E4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...