3PDQA

Crystal structure of jmjd2a complexed with bipyridyl inhibitor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
353
structure length
353
Chain Sequence
SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 4A
publication title Inhibition of histone demethylases by 4-carboxy-2,2'-bipyridyl compounds
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3pdqA01
4IGQA 5FYUA 3DXTA 5FY1A 5FXZA 5FYVA 5FY9A 5FZ4A 4CSWA 4CCJA 3N9OA 4EZHA 4HONA 4DIQA 3N9MA 3NJYA 2OT7A 3PTRB 3KVBA 5ANQA 5FJKA 3PUSA 5FPVA 5FXXA 4V2VA 3RVHA 5FY5A 5IVBA 5A7PA 4LIUA 3PDQA 5F5AA 3PUQA 5FP9A 2XXZA 5FZ1A 3AVRA 3KV5A 2YPDA 4LITA 3N9LA 5F2WA 5F3CA 4EZ4A 5LY1A 5FYCA 5FY8A 4DO0A 4NUBA 5A7WA 5FUPA 4GJZA 2XMLA 5LW9A 5A7NA 4QU1A 5FYTA 4XDOA 4CCNA 4Y3OA 5FZFA 4AI9A 4CCLA 5A3TA 4CCKA 5FBJA 2GP3A 5IVCA 3LD8A 5FZ8A 5KR7A 5LY2A 5A7SA 2VD7A 4ASKA 3K2OA 3UYJA 5A3NA 5FUNA 2GP5A 5F3IA 5FYYA 3KV6A 5FZCA 5FP3A 5FZMA 2P5BA 4D6QA 5F5CA 5F3EA 4BU2A 2YU2A 5ISLA 5FZ6A 5FYBA 5FZAA 2Q8CA 1VRBA 2WWUA 2OS2A 4UF0A 4V2WA 5FYSA 2Q8DA 5FXVA 5FP7A 5A7QA 5A7OA 5A7WB 5FZLA 2YU1A 4C8DA 3KV9A 2OQ7A 5FZKA 4GD4A 4AAPA 3PU8A 3N9QA 3PU3A 5A80A 5FZEA 5IVVA 4GJYA 3DXUA 5F2SA 5FZIA 5FZBA 3U78A 2OQ6A 4CCMA 5FPLA 5FY0A 4EYUA 2YBKA 4TN7A 3KV4A 3ZPOA 5FZDA 5FY4A 4QX7A 2YBPA 4URAA 5FZHA 5FYMA 5IW0A 5FP8A 4LIVA 5A3WA 2Q8EA 4D6RA 5A1FA 5F5IA 5FZGA 4D6SA 3PUAA 5FP4A 5CEHA 2XDVA 5FJHA 3OPWA 5F3GA 3U4SA 4E4HA 4HOOA 3AL5A 5F37A 5IVYA 3K3NA 5FY7A 4UF0B 5IVEA 5IWFA 3KVAA 3ZLIA 5FXWA 5LWBA 5F39A 5FZ3A 5FWEA 5A1LA 2YBSA 3LDBA 5FZOA 5FZOB 3N9PA 4BISA 4IGPA 4BXFA 2WWJA 5FPBA 4IGOA 4QXHA 4QXBA 4XDPA 4GAZA 3AL6A 3OPTA 4Y4RA 4QWNA 5FPAA 5FV3A 2OX0A 5FZ0A 2W2IA 5K4LA 4CCOA 3N9NA 5FYIA 5FYHA 5A3PA 4LXLA 3AVSA 4QXCA 4Y33A 5IVFA 3K3OA 5FYZA 5IVJA 5F32A 5FWJA 2XUEA 5FPUA 5E6HA 4QX8A 5FZ9A 4CUGA 5FZ7A 2PXJA 3PURA
chains in the Genus database with same CATH superfamily
3RZHA 2E32A 2WFF1 5FY1A 4HPKB 3MW2A 3ZFFA 1OC1A 3ZMOA 3LF7A 1CVNA 2OUHA 1FX5A 1OD3A 5EPAA 1C1FA 4HKWA 3U37A 3KVBA 3FUOA 1ZA7A 2EA7A 1LHWA 3KHBA 4M00A 1MPXA 3BPZA 1MQTA 4WM8A 3WINE 2PHWA 1ZBE2 4C0HA 5FUIA 2VQAA 1MR5A 3DYMA 4PIZA 1S0DA 5IK5A 4MOAA 2RR11 1ACCA 2WS91 2Y26A 1W05A 5KXBA 3JB8A 1R64A 4QPGC 2A3YA 3ZFGA 3ZSJA 3MBWA 4HXCA 5A7WA 3H8XA 4AHYA 4AEDC 4CXXA 4ZPIA 4IEYA 4QPGB 1W28A 3KD4A 4QU1A 4Z8BA 3VV1A 5JSRA 1OA3A 4CCLA 5A3TA 3OGSA 1YQ5A 2GP3A 2R32A 4W8JA 4FPHA 2XVGA 4AEDB 3NJZA 5A3MA 1WMXA 5C5TA 2DURA 2B46X 5FUNA 5K0UA 4V1PA 3BIWE 2QQKA 1MS3A 2P5BA 1O4YA 4D6QA 1JYNA 3FL7A 1CONA 2ENRA 2ILMA 5C3SA 1HXS2 1CD3G 1OVSA 4YWAA 5AFBA 1CZVA 2RS13 4Q4W3 4R4ZA 1AYM3 2B45X 1W2AX 2VY0A 1JZ3A 3I59B 3V64A 3POGA 4AI3A 1UPSA 3B9IA 3AB0A 3VDBA 4R9CA 3LSEA 4P08A 1JZ7A 3ZO0B 3HNBM 2WZ8A 4LO7A 3R6SA 2WA3A 3PIGA 2VECA 4ARXA 2DDUA 4AYUA 2JIJA 5HCFA 1DF0A 5HBAA 2CYFA 2DWRA 3E6DA 5FZIA 1RHI3 1JYWA 5FPLA 1BKZA 4JGZC 1VAMA 2XVLA 5JIUA 1UN1A 4CDUC 4BPZA 3GGLA 2WAAA 4JGZB 2ZABA 5LA0A 5JCTA 3O1RA 5JR2A 5FZGA 4CDUB 1CAVA 3IZOA 3PUAA 4GMP3 1LB2A 1OA2A 3HN3A 3SH4A 1HW5A 1O5LA 2VNGA 3OPWA 4GKYA 4PF1A 1ZRFA 1COV3 1CAWB 3O14A 1WZXA 4M4PA 3MPBA 2VOWA 5FY7A 2GC1A 4M0NA 5LATA 3E1F1 3VBHB 5A70A 1YO8A 4LLOA 4N9IA 1MVQA 5JPMB 4ASLA 2DBIA 3GZUC 1TME1 3VHOA 5K7PA 3A0KA 2A70A 2DFCA 2ETEA 3ATGA 5DAPA 1AL22 4CRQA 1SEFA 2W1QA 5FPAA 3NAPA 4CCCA 1AUYA 3AZWA 5A32A 1MS8A 2JG9A 2QKDA 1RUF2 3I3EA 2W46A 3S57A 1IQDC 5FPUA 5A33B 5E6HA 2C9AA 1IS4A 2CY6A 3AP6A 1VBB3 4JGYC 4KU7A 5J36A 3WUDA 3J9SA 3NNJA 1I3HA 4UW6A 4H7MA 3C7FA 5FY9A 2G19A 3FX3A 1W6NA 4QPIC 4J6GA 1JOBA 3IAQA 1GQPA 1FYUA 4KG0A 2EIGA 4QX0A 4RHV3 2R043 3T2OA 2NM1A 3D3AA 2I2SA 3N9MA 3T1LA 2OT7A 4QPIB 1NOVA 3VD3A 3ZYFA 3LKJA 3PUSA 4X6RB 5GZFA 4LJHA 4CPBA 3ZXKA 2GC0A 3T4HB 2WQZC 3AKSA 2WO1A 3T2QA 4IE4A 1A78A 1R091 1XSRA 4XJWA 3WNXA 4YLZA 1UCXA 3BPSA 2IXIA 1UOBA 3VBFA 1RVF2 2XJPA 2GNMA 3UNPA 5CFDC 5F3CA 5LY1A 1UNBA 2VM9A 4WM7A 5IATA 3MO4A 5CFDB 2D6LX 3VZNA 2JE8A 4HN1A 4CCNA 3S5AA 1O8SA 2QQOA 1UOJA 1RUD2 3VD7A 4AI9A 1HQLA 2HWE3 3QCWA 4E2QA 1K5MC 3VBRC 3WCSA 4XIOA 1ZBE1 2QBXA 4QQPA 3K2OA 4IV3B 1GV9A 3RGBA 3J7LA 3SITA 4EN7B 2IWGB 5F3IA 3TEXA 3VBRB 1RUE2 2W92A 4OUMA 3CBNA 1NCQC 4IESA 2YB7A 5FZMA 5F7UA 4UOJA 3ASIA 3PL0A 2PHTA 4CP2A 4GZ9A 1H1IA 3EHKA 4XFIA 3POJA 1UPIA 1SBEA 5E1RA 2H0BA 1GZWA 4DS0A 2DVBA 2OPKA 5C33A 4IEWA 5JXJA 5HCHA 1ULPA 2Q8DA 3ENRA 3NV1A 3PIJA 4M3CF 2ID4A 1RTVA 2AEZA 5B4XA 3AP7A 3PU8A 1RUC3 3EXUA 2VXRA 4I0BA 4UFKA 1W8WA 2ARXA 4XFAA 5A80A 3MIDA 4O9EA 3UK9A 5DZGA 2BW8A 2EIEA 5LA2A 2YBKA 3CF6E 5CFCC 2W1UA 3GHMA 3GBWA 3LE0A 1HXS1 1WW4A 3LZZA 4PDWC 4QX7A 2OYZA 2D44A 2UY8A 1JS9A 1PIV3 2V5YA 2FMYA 5FP8A 5CFCB 3MUY1 1KDKA 4PDWB 4BB3A 3B02A 1NUKA 3TEYA 3V0BB 1J83A 2VCMA 1D2SA 3EO6A 1B35A 1VMFA 3SEPA 1UOGA 1XE7A 5IWFA 3ZLIA 1QJEA 2X8KA 2ZX1A 1UXZA 3MIGA 2JD9A 2OW4A 4OYUA 3RSJA 2R6QA 1I5ZA 1XU1A 1H9WA 1LKNA 2RJ2A 4GWMA 1X8MA 4YGBA 3POIA 2ZGSA 1FT9A 4XMAA 5KHHA 5APAA 4CU6A 2BV4A 3I2HA 4K3UA 4YZ2A 1ND2A 2H6CA 1K42A 2YPJA 1RUNA 1U5YA 1HRI3 4Q0PA 3ZR6A 5CG9A 5I8TA 1RB8G 3IT8A 5JOXA 3M3EA 1G9CA 1NLQA 4BQWA 1G9AA 1QJY2 2ARBA 5FAXA 1N47A 3ZSEA 5JOZA 3MV11 1RUG2 1IG3A 1PK6B 5DXDA 1Q8PA 5A7QA 4CUGA 2J1AA 3LEGA 4OMDA 4E2SA 4IGQA 4RL7A 5C3OA 3N7MA 1AL21 2QCSB 5C9AA 3URFA 1PZ8A 2VW2A 3OGJA 3WUCA 1EYBA 4B7KA 4BHPA 2WFPA 5JZGB 4AQSA 2ORXA 4EZHA 3VD4A 1YI9A 4BQXA 4HONA 1H2MA 4YZ5A 4NRMA 4F3JA 2A3XA 2YC0A 1W6MA 2NPIA 4QQHA 3C3VA 4BYYA 1S55A 2E53A 3MIBA 5IVBA 3I3QA 1RUF1 3P3PA 4AEJA 1NCRC 4JV4A 3BUCA 1VBC2 1W6QB 5T50A 5FP9A 2Y38A 2PAMA 2ZPXA 4EN0A 4XJAA 5EJZB 3W21A 3VB9A 5JPNB 4Y1VA 4JHTA 2B9UA 1C8M2 4XF4A 5E89A 4AEKA 4N9HA 4AQ6A 2MNGA 2QQMA 1CAXB 4RGKA 4AI0A 1E5RA 2ZGRA 1IHMA 4I0AA 2X5IA 4QB2A 3CU7A 1ZM1A 2B5HA 4XDOA 3INAA 1DQ1A 4XQDA 3UESA 1US2A 4NVPA 1WLDA 2ZX2A 1OF3A 1MS5A 5BNOC 4LT5A 1WKYA 3ZYPA 3RI9A 2YFUA 1UD1A 1RVF1 2JIGA 2VVFA 5BNOB 5DPNA 4DUVA 1PX3A 5F3EA 4PI2A 2ZZQA 2CAVA 3CDZB 1HQWA 3FLPA 4AI1A 4CEWB 1MZ6A 3VDDA 2DVGA 2WWUA 5BNPC 2QUOA 3ZKUA 4UF0A 2XLAA 4K8RB 5C8CA 3KGZA 5FP7A 1S2BA 4AW7A 4C8DA 2YU1A 2P3YA 3PVNA 3TRSB 4KMQA 4YVWA 3ZYRA 1XPWA 5L19A 4QX2A 2BJSA 2PAEA 3N9QA 2SBAA 4HN0A 3WOGA 4A44A 4TTGA 4GJYA 1DQ4A 2JWPA 1RUE1 2RDRA 3APBA 3U78A 2KA3A 3HAGA 1GUIA 3ZXGA 4KU8A 2ZHMA 4AFAA 3POWA 4CDQC 3M1HA 1KGYA 5FZDA 4AEMA 2Q30A 3F95A 1MS1A 4OUSA 4Q0QA 4WVMB 1FOD3 4CDQB 1H8VA 3UT0A 5GM0A 2LTNA 1VIWB 5GZCA 1HB1A 1SG3A 3JQWA 4NN0A 4XJ9A 5FP4A 5CKMA 3OUIA 3S5QA 1FMD3 3OBRA 5FFOC 4E4HA 3EMRA 2I74A 2DVDA 2KXLA 3OGVA 2O8OA 5HCBA 5A3UA 2ZEXA 2Q1ZB 2VQTA 3D8CA 3KVAA 5DAWA 2A3WA 2ZGMA 5DAQA 3BTXA 5FXWA 3MLKA 1W2TA 2QQPA 3DYPA 3WNKA 4I09A 5DUXA 1Q8VA 4FTBA 5DZFA 1AR93 1RMU3 4ISQA 4BCUA 4IGPA 4RR3A 4F8AA 4MXWA 4CXYA 3H3UA 5C8WA 1LGBA 2ZEWA 1QXRA 1PM4A 4IEZA 2YHJA 4E27A 3I3BA 3WF4A 3AK0A 1QXPA 3IDAA 4DRRA 1SPPA 4YGDA 4JCKA 5A3PA 3N35A 4Q4V3 3U07A 1WWYA 2VMFA 3VZJA 1GU3A 2A6VA 3O0XA 1WBFA 2QQWA 1JMUB 1JHJA 4Q4W2 2RS12 1PVC3 4WZFA 4Y1ZA 1AYM2 5FZ7A 4KNCA 3G7DA 2I07B 4L99A 3RG0A 2VU9A 3OJBA 2BGPA 2W52A 4OHXA 2VQ0A 3B69A 2DUPA 5HXMA 4DIQA 3RS6A 3UKNA 2NN8A 1JZ6A 1NLSA 3NKTA 1NXMA 1RHI2 3DL3A 1YQCA 2CDPA 2P3IA 3R0RA 5KHKA 2XLFA 4PHZA 4A6OA 4YW6A 5CISA 2V73A 1QJY1 2AREA 3WG2A 1TQ5A 4AZZA 1RUG1 2GH8A 3QBQA 3PUQA 5F5AA 3IWZA 2D98A 4DMIA 4NWVA 5IT6A 2MPFA 4XVHA 2WNEA 2E7AA 1DQ0A 3C8XA 4CEYA 1EP0A 2D6NA 3VL9A 1W8OA 5FY8A 2KM2A 1X50A 1COV2 4HMZA 1N1SA 1O4TA 2XMLA 1ZRRA 3J4UH 5EJ1B 4XTPA 5F9TA 5LW9A 4NRQA 5GLTA 2V5DA 4Y3OA 3B5LB 4BQ5A 3A0NA 2YZ4A 5KXCA 1ALYA 5C71A 1VBC1 4NHLA 4YW3A 1ULOA 3WNLA 2Y8KA 3W20A 4QX5A 2GH2A 2BRTA 4IEQA 4IV1B 5G04L 5ABJB 3KV6A 1GWMA 1C8M1 1S0BA 3I2DA 4D69A 4AFBA 2Q1MA 1F31A 2VZTA 4B3NA 2WNUC 3LEMA 4YRDA 2CSGA 3RPQA 1SLTA 1R1ZA 4X8NA 5SV8A 3POYA 5D2AA 3WG4A 2WNUB 3Q8AA 1IKQA 5FMDA 3B00A 3JXSA 3SC7X 4A41A 4EQVA 1VBB2 1I1EA 1RUOA 3VGIA 2OZ6A 2GNDA 1C5HA 4LKEA 1UY2A 4IEOA 3POFA 3Q8FA 2FCVA 4FCAA 4XJ8A 1CX1A 4LBQA 5T52A 1HIXA 5F2SA 4RHV2 5JMCA 2QQNA 3GYDA 4CCMA 1YFYA 4MGSA 4QPYA 2R042 3ZXAC 4OHYA 4TN7A 3X29B 2VZSA 1DQ5A 4F7ZA 1XE0A 1W2OA 3CKHA 3T3YA 3VBUC 2YBPA 1LHOA 4BQ4A 1GLHA 1ND3C 3KS7A 4DXZA 3M70A 2V4AA 2FZ2A 4MGKE 4XQWA 5JAXA 4GIQA 5F5QA 3VBUB 2WN2A 2WNVC 2VXJA 2EF6A 4XZPA 1ND3B 5CEHA 1NE6A 2K46A 2D40A 5CVRA 3LB9A 3TWIA 5GLVA 1W8UA 2WNVB 2P6CA 1S0EA 4RGAA 1HQNA 4IEVA 2BOIA 2BWAA 5FREA 1JXNA 4CZSA 2PFWA 3JBG3 3KSCA 4HFSA 1OPMA 1REDA 1RXFA 5T5OA 4LULA 3K75B 3WF0A 2DCYA 2IFWA 4Q1RA 4TSVA 4CTEA 5IK4A 2HWE2 4PIXA 2XWJB 5H9QA 1UIJA 5CB7A 2K0GA 1W6PB 3IIAA 1ZA4A 4NAOA 3WT3A 3AL6A 1ZRCA 2OX0A 2P34A 4PIYA 3WNOA 1WA6X 1L7QA 4B29A 3MFAA 3O1TA 2Y60A 5D8AB 3ABZA 4B1LA 4RD7A 1CAUA 3HIFA 4TZDA 3ZFFC 2EAKA 1DCSA 1BEV3 1QOTA 3EBRA 3VHPA 3WDVA 2ZGNA 3BTZA 5F8PA 4YG0A 4Q27A 1VBA3 2VZQA 5BY5A 2EXJA 2IXCA 3ZFFB 4BE3A 1RUD3 3HN1A 1X82A 1RUC2 4IXLA 4WM8C 1MQTC 2ZAHA 1Q8SA 3USUB 2XPJA 2XL9A 1VRH3 2A71A 1XYPA 5ACA3 4WM8B 1C8NA 1XBFA 2ZXQA 1ENXA 4LTAA 3KT4A 1JUHA 1GWLA 2Z2SB 2GNBA 3ZYJB 2CGPA 3P1IA 1J3PA 4FFFA 4Q4W1 2IXLA 1PIV2 2RS11 2ZGKA 3OEBA 1AYM1 1WLWA 3UKVA 3ZFGC 2XBO3 3VZMA 2V4VA 5T5PA 4YARA 4RS5C 4GWNA 2ZS6B 1SBFA 3H50A 4YGEA 4AK3A 1D0HA 4QM9A 3ZFGB 2P3JA 2ZX4A 5T55A 5FUPA 2AUYA 4RS5B 2VUAA 3GBGA 2NYYA 2W94A 1XXNA 3RYKA 1Z7S3 2BZDA 4L0PA 3I2GA 4JQRA 1RHI1 2ARCA 1UY1A 2X09A 1A3KA 5A3LA 4GH4A 2HYXA 2YXSA 1V6JA 4ZU5A 2BU9A 4DINB 4NR1A 3THDA 4GMP1 2RJKA 1OPOA 3M2MA 2ZGLA 1Z0HA 1W0NA 4XTMA 1HRI2 1COV1 1W9FA 3AC0A 3NRUA 1W04A 4JC1A 3HQRA 4NIGA 1AXKA 2Y64A 1GYKA 4YVSC 2ZKLA 2OS2A 4I3GA 4QHOA 3NNMA 2VJXA 2XVKA 1LULA 2OVUA 3O1OA 4YVSB 2DCKA 4KWJA 1DFQA 4GXLA 5FZBA 1OBNA 5G05L 1YI7A 4AGGA 4A7ZA 3JUUA 5DUUA 2QQLA 4P9XA 4X6QB 5T3NA 5JSPA 2BGOA 3HQXA 3A22A 3ORJA 4LIVA 1E5SA 1O6UA 5BNNB 1GBGA 4Y1YA 2K2SA 1O59A 5BYNA 4XILA 5F3GA 1VBB1 1RUI3 3KWVA 2CHHA 1MVEA 5J98B 2FDKA 4IDZA 4Y5TA 3HNYM 2ZEYA 4NIIA 4QDQA 4RHV1 1DIWA 5DQ0A 1SDWA 3ZFEB 2DF7A 2R041 5JDBA 1R1A3 4CCEA 4MGYE 4NHYA 4YPJA 2JJ6A 2D93A 5F6LB 3N9PA 2D43A 2AR6A 3NWKA 3NAPC 4HSJA 5FMCA 4EN9B 1WLTA 4QXBA 1UOFA 3BIEA 1UYXA 3WQ0A 1W3XA 1WLCA 1RUH3 1W03A 2OZJA 1DZTA 3R4DB 4Z1VA 4D7YA 1QF3A 4XC9A 1YJKA 5IVFA 1SFNA 4DY3A 4A3XA 4ZHNA 3LDRA 5IUQA 1AX2A 4RSUA 3FBMA 4BWOA 4GA9A 5JOWA 5FOJB 1OUSA 1YFXA 2W91A 1UO9A 3AJYA 4W4ZA 4Y22A 1LESA 1F35A 2HWE1 4ZKTB 4LO5B 2ZX0A 5CYYA 2HWB3 4YW4A 2GC2A 3ZXJA 1W2NA 2F4PA 4IERA 4OI2A 1A6CA 2BTVC 3DCQA 2WZEA 1Q3EA 2BFUL 2TBVA 1QY4A 2EALA 3NJXA 3LEKA 4QD2A 5IJRA 3GJBA 3OG2A 1VJ2A 2D6PA 4QAWA 5ERLA 4D94A 4KGQA 4RN5A 5E16A 2RHPA 3T2PA 2P2KA 3ZSKA 3I49A 3VD5A 2VOXA 2WIIB 3HT1A 2XKOA 1G9BA 1FOD2 2B39A 1YQ6A 1IZ3A 1GKBA 4WM7C 4A2UA 5C6CA 4PLOA 1EUTA 2Y6GA 4EZ4A 2EICA 1LEMA 1WD4A 3MIHA 5C4WA 4XUQA 1FMD2 3E97A 2B4KA 4NRPA 1RUC1 4FPKA 3WEZA 2KD7A 1MACA 3GZTB 4MZUA 1JODA 3VBOA 5FCCA 4AXOA 2WZR3 2W9XA 4ZU4A 4CP1A 3O12A 4GMP0 3LD8A 5FZ8A 3WDYA 3UL2A 2WRAA 1JUIA 1YXWA 3V0AB 1AR92 1RMU2 1H2LA 1PIV1 2H6BA 2NMNA 1S2EA 3AKTA 3HT2A 5IYYA 4UI9L 4DXTA 3NV2A 4N43A 1OF4A 1SLBA 2L9LA 2UWBA 1WW5A 1O5UA 3IMNA 5GZDA 1WGPA 2LW8A 5LBCA 1G9DA 3KF5A 4LK6A 4MLOA 2A75A 2A6XA 1EPZA 4P14A 1L3JA 1OH3A 3J7HA 2YUEA 3AZVA 1GSLA 3NNFA 5LBEA 4Q4V2 1UKRA 4S2FA 4UWDA 1GZTA 4Q8KA 1GZWB 4Q0UA 5IK7A 1GNHA 2FQPA 2VGDA 4GWJA 1LODA 2DV9A 1OKQA 3IDBB 3VZKA 3IAPA 4AGVA 1PVC2 3AP5A 3U1XA 4QKNA 3Q8BA 3W9AA 2QQUA 3MF6A 4AAPA 1W2UA 3BOPA 3SH3A 1MS4A 1F9KA 1KDMA 1US3A 2WUHA 3ILRA 5KHGA 2OQ6A 2ORZA 3VKFC 1V6KA 4BDVB 1JZ4A 4D8MA 1PNFA 2JG8A 2R063 3AKRA 4W50A 5IAXA 1HRI1 3CZUA 2JDKA 2VMHA 3HMYA 5DG1A 1U5ZA 1HX6A 2AEYA 4D6RA 3AMNA 1B35C 4CDWC 5CU1A 1ZBA3 4GWIA 2DTYA 4XFFA 3RMYA 3FLRA 1AYN3 1B35B 1LGNA 4CDWB 1BCXA 4UFHA 4HVOA 1HJGA 2ZJCA 1V9U3 3S30A 4F83A 4QT6A 5F39A 1UYPA 2P17A 2PAKA 4JKLA 1ND2C 3D82A 1YJLA 4XUTA 1OQ1A 5DAXA 3VZLA 2PHRA 3H8RA 4KL1A 5FO7B 3E5XA 1ND2B 5EXOA 3KM5A 5JVVA 3KCYA 4MGIE 4CUCA 5EJ3A 3SISA 2MEV3 4JDOA 2BP6A 1K3IA 4M3CB 4N7UA 4OHWA 1KD7A 4KH9A 3THPA 1F2NA 1QU0A 4C1WA 5IVJA 4QX1A 5C9AC 5HPOA 5CNAA 4A7KA 3DECA 2PXJA 4XEZA 2JDUA 1ONAA 2W47A 5BV6A 3PVOA 5L7OA 5C9AB 5GZGA 1S0FA 4PJYA 3EYPA 4P9JA 2VZ3A 5EZWA 3GM8A 4CYDA 2ADDA 3M4FA 2XR4A 1KJLA 3ILFA 3AKPA 4DZGA 3PUHA 3S0MA 3CZJA 3M3CA 3ZDSA 4B4PA 2BEOA 4BM8A 3WDWA 1NAEA 2IZWA 3GBFA 4ZXKA 4Q4X3 1HB3A 2QE3A 4Y4YA 1LHVA 3KV5A 1AVBA 4P9WA 4NO4A 1IGOA 4FAHA 5FBZA 2VZRA 2X5IC 2Y6JA 4JAAA 3SNMA 4ZONA 2ES3A 4Q1PA 4EWAA 3AYEA 3N3HA 4DO0A 1C4RA 1C1LA 2ZMKA 3ETQA 4L92A 1JZ5A 1V6IA 5FMOL 1OKOA 4OZXA 3FBYA 2EVXA 4JGYB 3TB0A 1LOAA 3JBG2 4Q29A 4LKDA 4ZS2A 2RE9A 1RJ7A 1D4M2 4XCAA 3UGGA 2OPWA 1FOD1 2GP5A 2NZ9A 4MGQA 4LHSA 3VBSA 4AQ2A 1VALA 1TNFA 4HL0A 5FO9B 4JVAA 1FMD1 4MG2A 1D2QA 4INDA 2A6ZA 3C2UA 3NSTA 5C8CC 3NQHA 1TMF3 3D0SA 1CZSA 1LOFA 4YVWC 3PVBB 1NQDA 3WQ7A 2BOJA 3U4XA 5EWSA 5C8CB 3AYDA 1BEV2 2VNOA 4LO6B 1AR91 1RMU1 4EWEA 1VBA2 1POV3 5C5UA 4O9GA 4JQTA 4A42A 1HB2A 3RDIA 2ATFA 3ZXFA 1J1LA 1E5IA 1G86A 3FHQA 3PUIA 5C3QA 1KRIA 4FO9A 4NIAA 1VRH2 1POQA 3CJIA 5C3RA 2J1TA 3OSDA 2V09A 1K5MB 4Q4V1 5E8AA 2VTFA 3GDBA 4LBJA 1NA1A 2Q8EA 2C6SA 5ACA2 5J48A 4FFIA 3WV6A 4PQ9A 2CAUA 1PVC1 2WYFA 4NIHA 4J1WA 2G9GA 2XBO2 1NCQB 3CEWA 3K4ZA 5T5LA 2ET7A 3LFIA 3AL5A 1CPMA 5F37A 5DUWA 3WXPA 3RMXA 2IXHA 5IVEA 4HPKA 4W65A 3LA7A 4JTOA 4MVTA 4C90A 5LWBA 3GNEA 1WBLA 1VB4A 4LPLA 2ZGQA 1Z7S2 4DEQA 5A1LA 3CQOA 4AFDA 3SCFA 4AAXA 4E8DA 1GFF2 5FZOA 5LCWL 3JB4C 3JD73 3ZX7A 1OQEA 5FPBA 4RGGA 4Z2WA 4XDPA 4BLIA 2WJSA 3AMHA 3AFKA 5I0SA 3SEEA 2UYAA 1QXJA 2W2IA 1UZYA 3NL1A 3KQRA 3WD5A 5HXVA 2HBUA 2WA4A 1O3RA 1OA4A 5FZ9A 1F4HA 1GQGA 1VBD3 1J3QA 3M8LA 4YM2A 4QPGA 1BZWA 5CIRA 3U14A 5FYVA 4M4RA 1N1VA 1W3VA 4AEDA 4IUGA 1CJDA 2BBAA 4Y1UA 5KHJA 2FDFA 1KS4A 4N7IA 1TEIA 3NJYA 3PTRB 2HYKA 3P3NA 3LIGA 2VW1A 2WINB 1ODNA 4IW3A 4UFJA 1DGRA 4QHZA 2WO7A 5FPVA 5A3OA 3ZN6B 4WBBA 4LIUA 2R073 1NE4A 4LKFA 4QKDA 3LWCA 4XFHA 1FAYA 4CEYC 2WQ8A 4BIFA 3VDCA 5C7GA 1EUUA 1H30A 3GZEA 3H0OA 4NAMA 1T2XA 1S0CA 1YLLA 2VCCA 3I59A 3SH5A 1RUI2 4AHZA 2XJRA 5LA1A 4MSVA 4NUBA 3HBZA 1ASJ3 1CJPA 1KQRA 2YFZA 2ZGOA 4AQTA 1SFYA 1VMHA 2RS33 3J8F3 1UX7A 2GALA 2F4LA 5FZFA 3TBDA 5IVCA 1R1A2 4YFZA 1L7RA 2D6KA 5K8SA 1AHSA 1F15A 1HDKA 4AF9A 5A1AA 1OI6A 3SMHA 3ZVXA 2VMCA 4IQPA 4NWWA 4Y20A 3E5QA 2FD8A 5FP3A 4UAPA 3I8TA 1LEDA 3MW3A 1ZNPA 4CDUA 2CNAA 2W5FA 4YG3A 5J3UA 3MI8A 2YU2A 5ISLA 1UAIA 1X36A 4JX0A 2OIIA 1RUH2 3I54A 1IS6A 1J58A 5FYBA 4BK4A 1NCRB 1OLQA 2VMEA 4XBNA 5EP9A 3CIHA 3OGRA 4E4ZA 4P9LA 3SLIA 3RWNA 3N7JA 2W95A 2JKBA 3ZSLA 3VBHA 2AYHA 4HG6B 2QNKA 3JBG1 1ENQA 2BDRA 3MV01 3BCWA 5FPXA 4GD4A 3T08A 1RUJ3 3OBAA 3C7GA 4HANA 4LBQB 2HWB2 3L9JT 4CPBD 5A6YA 5I0RA 2D5HA 3VD9A 4EYUA 3ZPOA 2IFRA 1HRV2 3PMSA 4XDQA 3SQOA 1WA4A 1O4ZA 1REEA 3OF1A 1LU2A 5FYMA 2RM23 2VCAA 2PMWB 1ZRDA 3NVCA 4LHKA 4QU2A 3P6BA 1BEV1 2WL1A 3DN7A 1H6XA 5A33A 2QQIA 3CNAA 4DOUA 3WVJA 3HWJA 4QMAA 1Y7BA 3RNSA 4DNYA 1XRUA 1VBA1 3K3NA 3KCCA 3VDAA 5FQ0A 2AH2A 2VMGA 1RUD1 2VAUA 4CXWA 1PNGA 1OUXA 3KGLA 4OHVA 3HVDA 3K46A 3MHZA 4QKBA 5BNPB 4OFGA 1QIQA 5DMYA 2D3RA 4LK7A 1VRH1 3IMMA 2WZR2 3IDCB 4AGRA 2YROA 5ACA1 2XLGA 1BJQA 2WWJA 2PTMA 2YDEA 4IE6A 1UU4A 3QD6A 1N1YA 2XBO1 3LPGA 1H1AA 3J26N 3AYAA 4CUAA 2JDMA 3F2ZA 4A6SA 1YHFA 4XOGA 4FFHA 4Q0SA 4Y1XA 5CKQA 3OYWB 3C7EA 1H6YA 2VZOA 4QHBA 2WR9A 4Y33A 4QB1A 3PHMA 4HETA 2JDAA 2FDGA 4GB33 5FWJA 1CAUB 5DAVA 1QQP3 2Q8OA 3AP4A 1JZ8A 2ZHKA 2JDZA 3B01A 1Z7S1 5CFDA 1OSGA 2GC3A 1GP5A 3JU9A 5FO8B 5SV5A 5FYUA 3H7YA 5I0TA 3WDTA 4AVBA 1RJ8A 2X05A 5KHIA 4FPJA 3ELNA 4P9GA 3TNPB 4NIDA 3ZYGA 2XJUA 5L9VA 5JUVA 4IV3A 4DXRA 3HOBA 4CE8A 1O7FA 1R082 2HWD3 5FXXA 4MGTA 3OPZA 1DLLA 3RVHA 2B42B 3IKWA 4PBOA 5D1IA 5A7PA 2R062 4QQLA 1QJX3 1FPN3 4DY5A 2WO2A 3NO8A 3ON7A 1QJU3 1VE0A 4LA2A 2ZMNA 1M4WA 3I2JA 1BMV2 4YM3A 1PO22 1Y9MA 3PMEA 1SDDB 4OLLA 1VR3A 5FDBA 4LUMA 1BBT3 3OB8A 5F2WA 1GNZA 1EAH3 1ULCA 1ZBA2 4C1XA 4LBMA 2O1QA 2R1BA 2W68A 1V0AA 1AYN2 4KWKA 2X10A 3B9CA 4Q5OA 1J1TA 3AZXA 4GH4C 5FYTA 4XF9A 5DDJ3 1V9U2 5LBBA 3FUQA 4D7SA 4ET7A 1AL0G 5KR7A 1H8TA 1QHDA 2JX9A 4XCBA 1XB9A 4GH4B 1E5HA 4QGNA 4XFGA 1QH7A 4WVZA 2JENA 2XH6A 1V6MA 3RFRA 1SBDA 3AP9A 3WF1A 1QNWA 4ZZ8A 5I91A 2J7MA 3FMGA 3RJRA 4B1MA 5L36A 2R0HA 2E26A 4PDWA 1C3HA 4YW2A 1RUI1 2PHLA 2JB4A 4AVVA 1G6NA 1OXCA 3DKWA 3K4AA 2B9VA 2MEV2 5JWPA 3ZIXA 1C28A 1PGSA 2HKXA 4OULA 2Q8CA 3KMHA 4K1ZA 2RMU3 3PJQA 5CAZA 2EXKA 3HEIA 1Y9QA 2PYTA 4V2WA 1R1A1 2WO3A 4R9AA 3FJSA 4MXVA 1XNTA 2IVIB 4Y26A 1W9YA 2YC2A 4LBOA 4JTNA 5FK8A 3VN4A 3WLUA 4TWTA 4UFMA 1CWPA 1CESA 1Q5OA 4R4XA 5FY4A 3WNMA 4A4AA 1DYKA 1UZWA 2NP0A 4L97A 2OUJA 1RUH1 1W8ZA 2AACA 2I45A 2JECA 3ETPA 3IN9A 4P5YA 4XABA 4YSFA 4Q4Y3 1LU1A 5AVPA 4R9DA 2R30A 4BOWA 3BKZA 3RZLA 1Y4WA 1QEXA 4CP9B 4ZY9A 5BNQA 3D6EA 4IEXA 4DUXA 2XDVA 4Q4X2 1OQDA 3MEPA 3U4SA 4YM0A 3MF9A 1PK6A 1UF2C 3JQXA 3I7DA 3K77A 2BNMA 3PNAA 2HWB1 3KZ4C 2E51A 4GULA 3ZSMA 1BLZA 3VHNA 2VR4A 3BYWA 4QQOA 4UW3A 5JZGA 4FP2A 1RC6A 2OXBA 4QXKA 4YG6A 3IBMA 3LA2A 3GALA 3MUZ1 4XW3A 2QTWB 3OGGA 2GMPA 4NPMA 3PJYA 2LS6A 1OOPA 1UU6A 3OD4A 4NHKA 2EAAA 1W6OA 1ZZCA 3FFZA 4QWNA 4XIKA 3R4SA 1WCDJ 4P02B 3RJ2X 4B4QA 3I97A 3BVCA 3W59A 3K3OA 1TE1B 2HWF3 1UU5A 2ZBJA 4P00B 1CAXA 1TMF2 4FXGB 1YIPA 2DFBA 2WZR1 4OZOA 4YZ3A 5I8SA 2RS53 3MLLA 4FVVA 3OOXA 5FZ4A 3O1SA 4XACA 1XU2A 3S7EA 1D4M3 1DGRN 5FJKA 3MDPA 4YNIA 4V2VA 4PCRA 5BNOA 1P8JA 5FY5A 5CKNA 3M3QA 2ZHLA 5HV0A 3ZOIA 3B3QE 1GZ9A 2HH9A 5LA9A 4RYDA 2A1XA 2G9FA 3RQ0A 2IC1A 5L9RA 2D97A 1STMA 2VO5A 4LMFA 4CEWA 3LPFA 1YWKA 4PT6A 1W9WA 2DUQA 2HEYF 4QGLA 2WSUA 1JU3A 4LO4B 3VBOC 1JW6A 1K12A 4META 2QZ3A 1NT0A 2Y6FA 1WCUA 4Q8LA 4WZCA 4C91A 3VBOB 1GP4A 1ZZ7A 2E31A 5GLWA 3SKJE 2R061 3SHRA 4JRLA 4N43C 3N7KA 2F17A 2YG0A 1JH5A 2MHFA 2HEVF 4HK8A 4ASMB 2R7EB 2VW0A 3JD72 1CIWA 2W1WA 3VKLA 4XHBA 4UFIA 1BMV1 4N43B 4WVMA 1MQTB 4K20A 5FZCA 5F5CA 1ZBA1 4Q26A 4LQRA 4AHXA 4FOWA 4YGCA 2BGCA 2XJTA 4XE9A 1TG7A 1AYN1 3H1MA 3HQUA 2C24A 2B7YA 4JKKA 1V9U1 5FYSA 1RIRA 5FXVA 5E88A 5A7OA 1VBD2 5A7WB 4KG8A 5FZLA 3MPPG 1PMHX 5GJ6A 2XWBB 1O3QA 1EV13 2JG8C 2D5FA 4GQ7A 2GNTA 1MZFA 3DXUA 2CWMA 3KCXA 3WZ1A 3LDKA 3WDUA 5B4NA 5K0UC 4LE3A 2PLV3 4BQ1A 3NV3A 4RFRB 5FMOS 1KXGA 4AL9A 4CDXA 3TAYA 4D0QA 2VUDA 2MEV1 2JDNA 4XAEA 4YFWA 5K0UB 3ZXLA 1DGWX 3ACHA 5FZHA 2R072 2WN3A 4XFBA 4BQ2A 3DYOA 4ZU7A 2VUCA 3OY8A 3U0ZA 5FJHA 1IS3A 5JXHA 1DP0A 1F5JA 2PHXA 3EJKA 4HOOA 3FHIB 4FSJA 2DBNA 5IFPA 1TNRA 4YW1A 1QMJA 5D21A 3EQEA 4JDMA 1ASJ2 5CA6A 4FTSA 2DTWA 3O7OA 2RS32 3J8F2 3LA3A 1DZQA 3BU0A 3JZVA 3WW2A 1JYCA 2CGNA 2C1FA 1CR7A 2VMIA 2WT2A 2VOTA 3H8UA 4PLMA 4KQ7A 4IE0A 4DB5A 1NYWA 3K4DA 1A34A 4MO3M 2G4IA 3AZZA 4Q4X1 4OVEA 5J7MA 1VAKA 2DU0A 2JD4A 4CCOA 1LHUA 2ZHNA 1MEC3 2IVJA 4Q0VA 1CAVB 5DZEA 1QKQA 3AJZA 4MHRA 4XMIA 5L7OC 2WNOA 1RINA 2ZMLA 1JOPA 4ZXEA 3UETA 4LBQD 1V6OA 2VNRA 3OBZA 3FC0A 3WP4A 4S2HA 1J3RA 4TLGA 2Q4SA 5JXIA 1RUJ2 1IG0A 2J1UA 4LOTA 3OBTA 5JLVA 1H1MA 1UWWA 1A8DA 4IV1A 5ABJA 4LKSA 5LB6A 4FPLA 1SZBA 4PI0A 2JG9C 1NX9A 4MGZE 5HV4A 4QB6A 3NAPB 3RI8A 1APNA 1SACA 1TMF1 5GALA 1FNYA 4MV2A 2RM22 4AHWA 3CJXA 5A32B 2A5ZA 2JG9B 3QH6A 4G3YC 4LHNA 2JDYA 4FQ4A 3AFGA 2WNUA 1OD5A 1VBE3 2J22A 2VZPA 4UW4A 4GJZA 2XGXA 1XYNA 3FFQA 1POV1 1UYYA 1CIYA 4WVWA 2W3JA 2PHDA 3VUOA 5EV7A 1J84A 1XQNA 2UWAA 4AE2A 1W6NB 2WABA 3Q8CA 4P5HA 5H9RA 4B4RA 4ES9A 1REFA 2C26A 2VD7A 1HRV3 1T6GC 3GJAA 4FPGA 3VBSC 1QJZA 1I5PA 5LEJA 3VBFC 4I02A 4GALA 1LOFC 4OQ8A 2Q0AA 1ND3A 3VBFB 2CWSA 4L9BA 4YZ1A 1FATA 3O0WA 4K8FA 2VVEA 2WAOA 4N53A 4UYBA 3DGTA 3ZYBA 4GB32 1S0JA 4EJRA 1QQP2 2QQJA 1D7PM 4K1YA 4MX3A 4WM7B 4YYOA 1AR83 1HJFA 1HN1A 2WYSA 4K7JA 4ISRA 2D6OX 4I3PA 2DCTA 3ZYHA 5FZKA 1Q56A 2AZ5A 3ES4A 3JD71 1OH4A 3NW4A 5IVVA 5IK8A 3I3DA 1DU3D 1DBNA 2GMMA 3CJIC 4S2DA 1L7LA 2QDNA 1JBCA 5EIYB 2R1DA 3M3IA 1Y43B 4LUKA 4N90A 5GLZA 3B7MA 3KV4A 3WQ1A 5JSOA 2C0ZA 3CJIB 2HWD2 3BOWA 1AJKA 1XOYA 5AC92 2VOKA 4HLTA 1QJX2 1FPN2 4C0BA 1LNSA 1QJU2 2ZACA 5D8AA 5L73A 1WUVA 1OVPA 2WLQA 4Z2AA 2J1EA 1VBD1 1S2KA 2B8MA 1ENRA 4R8HA 1HN0A 3D4KA 1BBT2 1ULDA 2JE7A 3OEAA 4KWLA 4R52A 1EAH2 1UMIA 4XETA 1HV1A 5JI9A 2NMOA 2CGOA 2GDFA 4A45A 1Y3TA 2VMDA 4HKOA 5FWEA 2PHUA 2F6BA 2IXKA 3USUA 5DDJ2 1PGL2 4CU9A 5FZOB 4BXSV 3I3MA 3E5UA 1H4HA 1R083 1WCQA 1W8HA 2R071 4QKFA 4COUA 3UGHA 1KJRA 1DHKB 4RQPA 4QXHA 1XNBA 3OUJA 4NPLA 1UQXA 4CA9A 1PO23 3NMBA 5H9SA 1GICA 2PHFA 5A6ZA 1GANA 1YQ8A 2XG3A 3LGRA 3GZAA 4JZRA 5FYZA 5F32A 1ASJ1 1XNDA 2N7GA 1PHMA 4QX8A 3WP5A 3BB6A 2RS31 4RS5A 2CDOA 2RMU2 3J8F1 1GQHA 3DV8A 3DEMA 4LO8A 1AR63 3E6BA 3WY6A 5FXZA 3DPRA 2ZGPA 3SXWA 5FRAA 2VZVA 1VP6A 2FMDA 1NZIA 3R4UA 4COYA 2IUWA 2GMEA 2R49A 2WBKA 2C9KA 4AG4A 4L2NA 2WQ4A 2PA7A 4EROA 2YYOA 4EN6B 4NHXA 1W8TA 4Q4Y2 1UY4A 3AVRA 1POV0 1PO13 4H14A 1ODMA 3GF6A 2Y33A 2ARAA 2TEPA 1MZEA 1GNYA 3ECQA 4DQAA 4AWDA 5J96B 3BN6A 2VOVA 2Y6HA 3VHRA 1RUJ1 3I2FA 1JYXA 3HNMA 1W8NA 4YVSA 4LBKA 4URTA 1UW8A 1IPSA 4ATFA 1NLRA 4WV8A 5DN2A 1LOBA 2R0FA 4FFGA 4O61A 3ITQA 4QDRA 2G1MA 2WT0A 4KI5M 3TOJA 4ASKA 5A3NA 2VNVA 3QLQA 4FTEA 1W6MB 5EQUA 2AENA 1YIFA 3LOBA 2RM21 4Y20B 1XNAA 3TNQA 1QDOA 5BNNA 1DLCA 2Q1FA 4LBLA 1XNCA 2BNNA 5FZ6A 1PVXA 4MADA 3VBHC 1LJ7A 1ZRIA 2UU8A 5FZAA 2DYCA 4AOCA 2Z5WA 3FZ3A 2FCTA 2FDIA 2ZKNA 2GAUA 4D7TA 4XUPA 5FLJA 2HWF2 1QOOA 1F4AA 1WMDA 3MGUA 2FBEA 3ZFEA 3R05A 5FOBB 3H8OA 3THCA 5LEKA 2X5IB 2RS52 2D3SA 2AC1A 1CN1A 2EXIA 5AFEA 5J09A 4EV0A 2VH9A 3J7MA 1KS5A 4R9BA 2A6YA 3MW4A 3TN93 4HSLA 4GKXA 4M01A 2JDPA 3ACIA 1JYIA 2UYBA 2P4EA 2DCZA 2X29A 3VLBB 3BTAA 4X8PA 3HJRA 1WMEA 1DG6A 3LIHA 4XJZA 3P5BA 1BQPA 3QH7A 5A3WA 3CHXA 2D3PA 2ZZJA 4GB31 3VDDC 4D6SA 1QQP1 4FOVA 4IETA 3N36A 4UW5A 5JIAA 2ZGTA 3IPVA 1WCKA 5LK5A 3VDDB 3MIFA 1S0IA 1OHFA 2RJLA 4Z07A 3RRDA 1JOJA 3FHAA 1FNZA 3H3ZA 1Q43A 4UF0B 2J1SA 5FQ0B 4E9KA 5EYXA 4YVWB 4BLJA 4ATEA 5GZEA 2ET1A 2HWD1 1UY0A 5I93A 2HEWF 3ACGA 5T5JA 4BISA 4I01A 5HCAA 5AC91 3T30A 3ME2A 1QJX1 1FPN1 3WNPA 2E6VA 3LAGA 1QJU1 5KBFA 3QOPA 5AC93 1VB2A 3OPTA 4GAZA 4Y4RA 5FV3A 2ZCWA 2OKXA 4AR2A 1BBT1 3B93A 1N1TA 4PF5A 1EAH1 1BVVA 1WCSA 2TUNA 1H9PA 4ARYA 3B94A 5F6KA 1PGW2 2VZUA 2BVBA 1BXHA 3RZMA 4I30A 1BK1A 4JDNA 4U36A 3ZKYA 3POSA 2VE1A 1W99A 1PGL1 5DDJ1 4CUBA 1QWRA 2J1VA 2RDQA 3HBKA 4XURA 3MIEA 2ZAAA 1H0BA 4IV3C 3U11A 2WC2A 1UY3A 4E4DX 4RR3C 4OI0A 1LRHA 2VTXA 4IL7A 2WZPP 1QNYA 4Z82A 1NG0A 1EV12 2DUOA 3VKMA 3V0AA 2EXHA 2RDSA 2RG4A 3K48A 1LAJA 3AMPA 2HBTA 3OD0A 4MXWB 1AR73 3NNGA 4RR3B 4BMBA 4NE9A 2PLV2 2ZA9A 3NV4A 2RDNA 1XE8A 4E8CA 4XF3A 5FZ1A 1SPPB 2RMU1 2XQRA 2E7QA 2GN7A 2OA2A 1IKPA 2HWC3 2IXJA 3N4MA 3Q9OA 4ORFA 2QJVA 4FPEA 4W6YA 3H1YA 3T0DA 3WG3A 3ZYIB 1LENA 1MS0A 1H8TC 2X53S 1ZZBA 1JU4A 4EE2A 3OUHA 5A7NA 2E33A 3ZN4A 5EHDA 2WFF3 3MICA 4J1XA 1H8TB 2YV8A 1LR5A 1YNAA 2R16A 2AGSA 2NQYA 3KQ4B 1BVP1 3UYJA 5KXDA 1YYNA 4Q4Y1 3H7JA 3WP6A 3SCHA 1ENSA 3WP3A 4O7XA 5FTTC 1F5FA 1ZZ6A 2Y0OA 1YEWA 3H42B 3LQCA 2W0XA 4B8EA 1BYHA 1MEC2 4CDWA 4CEYB 3IDEA 4CU7A 2RR13 2WS93 4G9SB 2PQSA 5KC5A 2VULA 2E9QA 4LORA 1BK0A 3AXDA 4FPCA 1OURA 5KXEA 2CTVA 5FZEA 3W5NA 2XL7A 3WF3A 4FT8A 3ALQA 5FY0A 1QJFA 3U75A 1VMJA 2WLPA 3HR9A 5JR7B 4LR4A 4BQ3A 5TSWA 1OLRA 3V65A 4AI8A 1V6LA 4PQQA 4BIOA 4JGZA 1X8EA 3WQBA 4URAA 5A1FA 1XSQA 1V00A 3BU7A 4QGMA 1PK6C 1WMFA 1YCIA 1I9RA 3KB5A 3CL1A 4H3WA 4M3CA 2HWF1 4N8MA 4XUNA 4YM1A 3T0AA 4OUEA 1ZREA 4ZS3A 2VBBA 2ADEA 3KF3A 1U0AA 1AXYA 4FI9A 1PMIA 2RS51 4JRAA 1CAWA 2VBDA 5JZGC 2VTXJ 4RA0A 2JE9A 3V56A 2D7FA 3LOIA 4EWDA 2JKXA 1VBE2 2O0OA 4Z92B 4FOQA 4PBPA 3FE5A 4K40A 4BMEA 1SCRA 5FZ3A 1D4M1 2WKKA 1CX4A 1DGWA 4LE4A 1OOPC 2FDJA 4XHXA 2JXAA 3NNLA 4Y5Z0 1HV0A 3WW3A 5JI7A 4LOSA 1OOPB 1SHWB 3ZIWA 4H2AA 2VG9A 1W6OB 2FCUA 1Q8OA 4FBFA 4CU8A 3BI3A 2DU1A 1YQ2A 2NLRA 4OMCA 5FZ0A 5K9YA 2UWCA 4XJUA 5F1RA 2LALA 2PN5A 4QXCA 4AVCA 1NZCA 2ZGUA 4RFT0 4K6BA 2Z4FA 1IOAA 1SLIA 3UJQA 2O8QA 2RVAA 4IE5A 5BUVA 3LCPA 1GWKA 3O0VA 3FWEA 4ONUA 3I4IA 3CO2A 1UX6A 2CU5A 3DXTA 1U5XA 1Z78A 3D0JA 4QDSA 5GLUA 1AR82 4JGYA 4CCJA 3O1MA 2FZ1A 2BUKA 1QH6A 2LUWA 4FPFA 1TME3 4YW7A 5BXXA 1PX4A 4QPIA 3WX5A 2GSYA 1ZVFA 4COVA 1AXZA 4HK9A 4MYEA 4OCTA 4XXAA 5LRSA 2YC4A 2A6WA 5LK7B 1CQ9A 4BJ0A 1PGW1 1YFUA 4DRVA 4CEWC 4FPOB 4SLIA 1SLLA 4YZ4A 1HKDA 3USSA 5LZ6A 5FYCA 4NHMA 5AVAA 2QDRA 4LBNA 3AYCA 4LEJA 4OQ9A 2Y6LA 3WG1A 5IFTA 2Y6KA 2ZTNA 1EV11 3GXUA 4DEVA 1W90A 2O14A 2VCBA 4CVUA 3ZPYA 4AI2A 4NROA 1O8PA 3JCIA 3LSDA 2PLV1 1C5IA 1U5IA 5FBJA 1H2NA 5LY2A 3ZM8A 3PTYA 1UMHA 4BZ4A 3UV9A 2JICA 1XC6A 1FI2A 2WDBA 1K5MA 3VBRA 4DPNA 1XNKA 3H9AA 4BK5A 1U12A 1D4VB 3C7OA 4FAGA 1R093 2P6HA 3AM2A 4H55A 1WD3A 1NCQA 1W0PA 1PZ7A 1X9TA 2ERFA 5B2GB 3SKVA 4Y5SA 4FXKB 1W8FA 4JHZA 5H9PA 3S7IA 1ULFA 4HVQA 2J1RA 2K9ZA 4ES8A 4TXWA 2JB8A 4LHLA 1AR62 5JMOA 1URXA 4LA3A 3WHTA 3PU3A 2YGMA 4AFCA 4M3CE 2DCJA 3KLSA 3H1WA 4MUVA 4NPRA 4CDXC 5DG2A 1CZTA 1SQ4A 4COWA 1UZVA 4IEUA 3RZGA 1LGCA 1UIKA 2W87A 4FP3A 1J59A 4CDXB 4IEPA 1ZBE3 1V70A 4WVVA 2BFUS 1MEC1 5JOYA 1QDCA 5CFCA 1SCSA 3WSOA 3V0BA 3ZDVA 3OY8B 2J42A 3GHNA 5FIXA 3VL8A 3THTA 5FR3A 1DGLA 1EPWA 1PO12 1S4CA 3UKTA 3RWKX 3T1MA 1VPHA 1AX0A 3AXEA 2JEMA 1GOHA 4DXSA 1WW7A 1NY72 3NJVA 1O91A 4MHUA 5FKCA 1KFXL 2JDHA 4TLFA 1LCLA 5FPZA 2DVFA 2BVVA 4SBVA 5FLHA 3A4UA 4BXFA 1BHGA 1FXZA 2XJQA 1F8VA 3LFMA 3ZN6A 5BPXA 3WHUA 2YMZA 2UURA 2VC9A 4E4SA 3W5MA 1HXS3 4QX3A 1H4GA 2XOMA 4XAAA 4ZZ5A 3OTFA 4BQYA 1OT5A 3AVSA 1HLCA 1SLAA 1VBE1 4W6WA 2E63A 1GR3A 1WW6A 2XONA 4OI4A 4QM8A 4XPVA 3ROUA 3A21A 4XBLA 4B7EA 4K9SA 1KITA 1H2KA 3GCXA 3BTYA 2QZ2A 4Y24A 4P9YA 4CSWA 1OFSA 1NQJA 1JN2P 1ZZ9A 3UJOA 1JYVA 1AJOA 1HRV1 4IV1C 5ABJC 4AVSA 1OLMA 5ANQA 4AVAA 2ZX3A 3AKQA 3TN92 3A7QA 3L2HA 4COZA 5CADA 2XJVA 2LRPA 4IE7A 3GCWA 3IM0A 1W6QA 1ST8A 1N3PA 2Q5TA 5LASA 4D3WA 2XXZA 2HLEA 1LOEA 1NCRA 1DYPA 1UZZA 5JXGA 1MS9A 2TNFA 1V6NA 3QACA 1QOSA 1YC61 3KT7A 3N7LA 1YUDA 1AR81 4UBGA 5ANNA 2P37A 4J25A 4KWUA 4E2GA 1A8MA 3KHCA 4Y22B 4YW5A 4OI1A 5I0DA 4TYSA 1JZ2A 1UZ0A 3OCPA 1AL23 1IPKA 1RITA 3AMQA 2E7TA 5HI0A 4OHZA 3D5OA 4LNVA 4HVRA 3NKGA 3SCGA 1W9TA 2WSVA 1G8WA 1N3QA 4L8QA 4PLNA 2GU9A 1CPNA 4N53C 2LROA 4L11A 1UMZA 1RUF3 4JKMA 5EFUA 3L2YA 4DFSA 1CGPA 4HT1T 3RZZA 2XUMA 4KBBA 5C4WC 2KR2A 3TYJA 5T54A 4XBQA 2ZOEB 3RZKA 4N53B 1GOGA 1VRBA 3K51A 5FK7A 4W6XA 1NXD1 5FLIA 1UYZA 2WT1A 2XHNA 1M06G 2V72A 3FLTA 3POEA 5C4WB 1ZX5A 3M7AA 3Q8EA 5BNPA 3KV9A 3W58A 3WW1A 2P1BA 3PVEA 3ZN5A 1R081 1AX1A 1UL9A 1K45A 5A6XA 3AX4A 1W06A 3T0BA 2A7AA 4HZFA 2HJIA 2Y34A 1IPJA 2VZ1A 3O1UA 4HKLA 2W39A 4XUOA 1RXGA 1AR72 1PO21 5D8AC 5DUVA 2BBVA 2XKPA 3ZXEA 2SLIA 4CDQA 1N3OA 1RVF3 5KWRA 2G9ZA 3I2IA 3OYWA 4DUWA 2BERA 2GZWA 2VUJA 3WW4A 5IHRA 3BODA 3T2TA 1KFUL 5FMBA 1AR61 2RV9A 1KEXA 2HWC2 3MYXA 5C3PA 2W08A 3KT1A 5CG8A 1K5JA 4FOYA 5CBLA 3HPNA 1RYYA 2CL2A 1W39A 3ST7A 2C5DA 1TVGA 1QGLA 3RZJA 3VZOA 3WF2A 1IS5A 2YBSA 3LDBA 1E57A 4RQPC 5FKBA 1FV2A 2PELA 2WFF2 2XQXA 3CLPA 3I2OA 4NJ4A 1X33A 1YFWA 1ULEA 4RQPB 1RUE3 4IGOA 1SLCA 5C70A 2JG8B 2P3KA 1O3TA 1W9SA 3DKQA 4MH0E 4UXAA 1PO11 3N9NA 5FYIA 3E6CC 4LXLA 4KGGA 3IIIA 1LOCA 3VKNA 3WCRA 2W1SA 1OLME 1NY71 4Q2FA 3DPRC 4H7LA 1RL3A 3PURA 2RR12 2VVDA 1C57A 2WS92 1JHNA 4S2GA 5CZKA 5I0UA 1OMIA 3FN9A 1SFPA 3ES1A 5EYYA 3WDXA 2D6MA 3DPRB 4FPYA 1D0GA 3N9OA 1G9FA 3BGAA 2Z69A 4M0HA 2Z42A 3HD8B 3G6JB 4I2OA 1AF9A 3ACLA 5I8YA 3O1PA 2XJSA 1Q8QA 1IQAA 4I0WB 1I6XA 3PDQA 2BQPA 1TZOA 3TEWA 2UY9A 2YPDA 4CP0A 4LITA 3N9LA 4UBHA 4K21A 3BALA 1UKGA 3A23A 2PQQA 1VLNA 3H3LA 2ZEZA 2Y0IA 4XF1A 4NOTA 4G4FA 5J37A 2VPVA 1GP6A 5A6QA 3CMGA 1PZ9A 5L7OB 1ULGA 4XXPA 2QFEA 2XHKA 3AMMA 5DABA 3TN91 3RYPA 3WNNA 1FV3A 1LHNA 2WWSA 1Y9GA 3M3OA 4CCKA 5A7SA 3MZHA 4P9IA 3DUIA 4NMIA 5BNNC 3S6PA 3T09A 3WR0A 3IB3A 1RGSA 5FYYA 2QQVA 2FHRA 2Z79A 3EB7A 3ILNA 3J7NA 4CP9A 4BU2A 3POBA 5M0TA 4XF0A 5IAVA 1QJY3 5LRRA 4A7YA 1T6BX 2VBPA 1RUG3 4FQZA 3ZFEC 3O5SA 3T4VA 1LOGA 1XYOA 1GZCA 1UXXX 2VL4A 1JTZX 1B09A 1ZZ8A 4UFLA 1O3SA 1JI6A 5J1XA 1OFNA 3LEIA 2OQ7A 3ZR5A 1LTEA 2YGLA 3O1VA 2BWCA 2CV6A 4EN8B 5LBFA 3PLQA 2DVAA 2LM3A 2QVSB 1VAVA 1PMJX 1TME2 2EIDA 4UT5A 1YRZA 3MFCA 1VBC3 4HBNA 4QQ2A 1MZ5A 1EY2A 2H0VA 1G7YA 1DYOA 1GMMA 2YY1A 3ACFA 3C7HA 5IW0A 1ZYBA 3VBSB 4ITCA 4XZUG 5F5IA 3VBUA 4KBZA 5GKAC 1C8M3 3VKOA 4BH9A 3ZMNA 1DQ6A 3IPVB 1DDLA 1XJAA 4AVTA 2BPA2 5IVYA 2WNVA 2VQUA 1S1AA 4CCDA 3MLJA 4O65A 1HB4A 3I2KA 4AFMA 3UGFA 1JYTA 1AR71 1AZDA 2C4XA 4XQ4A 4U2AA 3TEZA 1LECA 2GN3A 2A73B 5KC6A 1W6PA 4A3ZA 4QPWA 5L9BA 1PM7A 1DZRA 1NA1C 2BYVE 1GOFA 1S0GA 5K4LA 1DQ2A 2FDHA 1SMVA 1X9PA 2EIBA 1NA1B 1X7NA 2HWC1 5FYHA 3ZXDA 4BA6A 2XB6C 3AZYA 3DF0A 4LLFA 4XYXA 3RYRA 1W0OA 1R092 2BNOA 2XUEA 3U10A 4XFCA 1NKGA
chains in the Genus database with same CATH topology
4IGQA 5FYUA 3DXTA 5FY1A 5FXZA 5FYVA 5FY9A 5FZ4A 4CSWA 4CCJA 3N9OA 4EZHA 4HONA 4DIQA 3N9MA 3NJYA 2OT7A 3PTRB 3KVBA 5ANQA 5FJKA 3PUSA 5FPVA 5FXXA 4V2VA 3RVHA 5FY5A 5IVBA 5A7PA 4LIUA 3PDQA 5F5AA 3PUQA 5FP9A 2XXZA 5FZ1A 3AVRA 3KV5A 2YPDA 4LITA 3N9LA 5F2WA 5F3CA 4EZ4A 5LY1A 5FYCA 5FY8A 4DO0A 4NUBA 5A7WA 5FUPA 4GJZA 2XMLA 5LW9A 5A7NA 4QU1A 5FYTA 4XDOA 4CCNA 4Y3OA 5FZFA 4AI9A 4CCLA 5A3TA 4CCKA 5FBJA 2GP3A 5IVCA 3LD8A 5FZ8A 5KR7A 5LY2A 5A7SA 2VD7A 4ASKA 3K2OA 3UYJA 5A3NA 5FUNA 2GP5A 5F3IA 5FYYA 3KV6A 5FZCA 5FP3A 5FZMA 2P5BA 4D6QA 5F5CA 5F3EA 4BU2A 2YU2A 5ISLA 5FZ6A 5FYBA 5FZAA 2Q8CA 1VRBA 2WWUA 2OS2A 4UF0A 4V2WA 5FYSA 2Q8DA 5FXVA 5FP7A 5A7QA 5A7OA 5A7WB 5FZLA 2YU1A 4C8DA 3KV9A 2OQ7A 5FZKA 4GD4A 4AAPA 3PU8A 3N9QA 3PU3A 5A80A 5FZEA 5IVVA 4GJYA 3DXUA 5F2SA 5FZIA 5FZBA 3U78A 2OQ6A 4CCMA 5FPLA 5FY0A 4EYUA 2YBKA 4TN7A 3KV4A 3ZPOA 5FZDA 5FY4A 4QX7A 2YBPA 4URAA 5FZHA 5FYMA 5IW0A 5FP8A 4LIVA 5A3WA 2Q8EA 4D6RA 5A1FA 5F5IA 5FZGA 4D6SA 3PUAA 5FP4A 5CEHA 2XDVA 5FJHA 3OPWA 5F3GA 3U4SA 4E4HA 4HOOA 3AL5A 5F37A 5IVYA 3K3NA 5FY7A 4UF0B 5IVEA 5IWFA 3KVAA 3ZLIA 5FXWA 5LWBA 5F39A 5FZ3A 5FWEA 5A1LA 2YBSA 3LDBA 5FZOA 5FZOB 3N9PA 4BISA 4IGPA 4BXFA 2WWJA 5FPBA 4IGOA 4QXHA 4QXBA 4XDPA 4GAZA 3AL6A 3OPTA 4Y4RA 4QWNA 5FPAA 5FV3A 2OX0A 5FZ0A 2W2IA 5K4LA 4CCOA 3N9NA 5FYIA 5FYHA 5A3PA 4LXLA 3AVSA 4QXCA 4Y33A 5IVFA 3K3OA 5FYZA 5IVJA 5F32A 5FWJA 2XUEA 5FPUA 5E6HA 4QX8A 5FZ9A 4CUGA 5FZ7A 2PXJA 3PURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGQ A;  5FYU A;  3DXT A;  5FY1 A;  5FXZ A;  5FYV A;  5FY9 A;  5FZ4 A;  4CSW A;  4CCJ A;  3N9O A;  4EZH A;  4HON A;  4DIQ A;  3N9M A;  3NJY A;  2OT7 A;  3PTR B;  3KVB A;  5ANQ A;  5FJK A;  3PUS A;  5FPV A;  5FXX A;  4V2V A;  3RVH A;  5FY5 A;  5IVB A;  5A7P A;  4LIU A;  3PDQ A;  5F5A A;  3PUQ A;  5FP9 A;  2XXZ A;  5FZ1 A;  3AVR A;  3KV5 A;  2YPD A;  4LIT A;  3N9L A;  5F2W A;  5F3C A;  4EZ4 A;  5LY1 A;  5FYC A;  5FY8 A;  4DO0 A;  4NUB A;  5A7W A;  5FUP A;  4GJZ A;  2XML A;  5LW9 A;  5A7N A;  4QU1 A;  5FYT A;  4XDO A;  4CCN A;  4Y3O A;  5FZF A;  4AI9 A;  4CCL A;  5A3T A;  4CCK A;  5FBJ A;  2GP3 A;  5IVC A;  3LD8 A;  5FZ8 A;  5KR7 A;  5LY2 A;  5A7S A;  2VD7 A;  4ASK A;  3K2O A;  3UYJ A;  5A3N A;  5FUN A;  2GP5 A;  5F3I A;  5FYY A;  3KV6 A;  5FZC A;  5FP3 A;  5FZM A;  2P5B A;  4D6Q A;  5F5C A;  5F3E A;  4BU2 A;  2YU2 A;  5ISL A;  5FZ6 A;  5FYB A;  5FZA A;  2Q8C A;  1VRB A;  2WWU A;  2OS2 A;  4UF0 A;  4V2W A;  5FYS A;  2Q8D A;  5FXV A;  5FP7 A;  5A7Q A;  5A7O A;  5A7W B;  5FZL A;  2YU1 A;  4C8D A;  3KV9 A;  2OQ7 A;  5FZK A;  4GD4 A;  4AAP A;  3PU8 A;  3N9Q A;  3PU3 A;  5A80 A;  5FZE A;  5IVV A;  4GJY A;  3DXU A;  5F2S A;  5FZI A;  5FZB A;  3U78 A;  2OQ6 A;  4CCM A;  5FPL A;  5FY0 A;  4EYU A;  2YBK A;  4TN7 A;  3KV4 A;  3ZPO A;  5FZD A;  5FY4 A;  4QX7 A;  2YBP A;  4URA A;  5FZH A;  5FYM A;  5IW0 A;  5FP8 A;  4LIV A;  5A3W A;  2Q8E A;  4D6R A;  5A1F A;  5F5I A;  5FZG A;  4D6S A;  3PUA A;  5FP4 A;  5CEH A;  2XDV A;  5FJH A;  3OPW A;  5F3G A;  3U4S A;  4E4H A;  4HOO A;  3AL5 A;  5F37 A;  5IVY A;  3K3N A;  5FY7 A;  4UF0 B;  5IVE A;  5IWF A;  3KVA A;  3ZLI A;  5FXW A;  5LWB A;  5F39 A;  5FZ3 A;  5FWE A;  5A1L A;  2YBS A;  3LDB A;  5FZO A;  5FZO B;  3N9P A;  4BIS A;  4IGP A;  4BXF A;  2WWJ A;  5FPB A;  4IGO A;  4QXH A;  4QXB A;  4XDP A;  4GAZ A;  3AL6 A;  3OPT A;  4Y4R A;  4QWN A;  5FPA A;  5FV3 A;  2OX0 A;  5FZ0 A;  2W2I A;  5K4L A;  4CCO A;  3N9N A;  5FYI A;  5FYH A;  5A3P A;  4LXL A;  3AVS A;  4QXC A;  4Y33 A;  5IVF A;  3K3O A;  5FYZ A;  5IVJ A;  5F32 A;  5FWJ A;  2XUE A;  5FPU A;  5E6H A;  4QX8 A;  5FZ9 A;  4CUG A;  5FZ7 A;  2PXJ A;  3PUR A; 
#chains in the Genus database with same CATH topology
 3RZH A;  2E32 A;  2WFF 1;  5FY1 A;  4HPK B;  3MW2 A;  3ZFF A;  1OC1 A;  3ZMO A;  3LF7 A;  1CVN A;  2OUH A;  1FX5 A;  1OD3 A;  5EPA A;  1C1F A;  4HKW A;  3U37 A;  3KVB A;  3FUO A;  1ZA7 A;  2EA7 A;  1LHW A;  3KHB A;  4M00 A;  1MPX A;  3BPZ A;  1MQT A;  4WM8 A;  3WIN E;  2PHW A;  1ZBE 2;  4C0H A;  5FUI A;  2VQA A;  1MR5 A;  3DYM A;  4PIZ A;  1S0D A;  5IK5 A;  4MOA A;  2RR1 1;  1ACC A;  2WS9 1;  2Y26 A;  1W05 A;  5KXB A;  3JB8 A;  1R64 A;  4QPG C;  2A3Y A;  3ZFG A;  3ZSJ A;  3MBW A;  4HXC A;  5A7W A;  3H8X A;  4AHY A;  4AED C;  4CXX A;  4ZPI A;  4IEY A;  4QPG B;  1W28 A;  3KD4 A;  4QU1 A;  4Z8B A;  3VV1 A;  5JSR A;  1OA3 A;  4CCL A;  5A3T A;  3OGS A;  1YQ5 A;  2GP3 A;  2R32 A;  4W8J A;  4FPH A;  2XVG A;  4AED B;  3NJZ A;  5A3M A;  1WMX A;  5C5T A;  2DUR A;  2B46 X;  5FUN A;  5K0U A;  4V1P A;  3BIW E;  2QQK A;  1MS3 A;  2P5B A;  1O4Y A;  4D6Q A;  1JYN A;  3FL7 A;  1CON A;  2ENR A;  2ILM A;  5C3S A;  1HXS 2;  1CD3 G;  1OVS A;  4YWA A;  5AFB A;  1CZV A;  2RS1 3;  4Q4W 3;  4R4Z A;  1AYM 3;  2B45 X;  1W2A X;  2VY0 A;  1JZ3 A;  3I59 B;  3V64 A;  3POG A;  4AI3 A;  1UPS A;  3B9I A;  3AB0 A;  3VDB A;  4R9C A;  3LSE A;  4P08 A;  1JZ7 A;  3ZO0 B;  3HNB M;  2WZ8 A;  4LO7 A;  3R6S A;  2WA3 A;  3PIG A;  2VEC A;  4ARX A;  2DDU A;  4AYU A;  2JIJ A;  5HCF A;  1DF0 A;  5HBA A;  2CYF A;  2DWR A;  3E6D A;  5FZI A;  1RHI 3;  1JYW A;  5FPL A;  1BKZ A;  4JGZ C;  1VAM A;  2XVL A;  5JIU A;  1UN1 A;  4CDU C;  4BPZ A;  3GGL A;  2WAA A;  4JGZ B;  2ZAB A;  5LA0 A;  5JCT A;  3O1R A;  5JR2 A;  5FZG A;  4CDU B;  1CAV A;  3IZO A;  3PUA A;  4GMP 3;  1LB2 A;  1OA2 A;  3HN3 A;  3SH4 A;  1HW5 A;  1O5L A;  2VNG A;  3OPW A;  4GKY A;  4PF1 A;  1ZRF A;  1COV 3;  1CAW B;  3O14 A;  1WZX A;  4M4P A;  3MPB A;  2VOW A;  5FY7 A;  2GC1 A;  4M0N A;  5LAT A;  3E1F 1;  3VBH B;  5A70 A;  1YO8 A;  4LLO A;  4N9I A;  1MVQ A;  5JPM B;  4ASL A;  2DBI A;  3GZU C;  1TME 1;  3VHO A;  5K7P A;  3A0K A;  2A70 A;  2DFC A;  2ETE A;  3ATG A;  5DAP A;  1AL2 2;  4CRQ A;  1SEF A;  2W1Q A;  5FPA A;  3NAP A;  4CCC A;  1AUY A;  3AZW A;  5A32 A;  1MS8 A;  2JG9 A;  2QKD A;  1RUF 2;  3I3E A;  2W46 A;  3S57 A;  1IQD C;  5FPU A;  5A33 B;  5E6H A;  2C9A A;  1IS4 A;  2CY6 A;  3AP6 A;  1VBB 3;  4JGY C;  4KU7 A;  5J36 A;  3WUD A;  3J9S A;  3NNJ A;  1I3H A;  4UW6 A;  4H7M A;  3C7F A;  5FY9 A;  2G19 A;  3FX3 A;  1W6N A;  4QPI C;  4J6G A;  1JOB A;  3IAQ A;  1GQP A;  1FYU A;  4KG0 A;  2EIG A;  4QX0 A;  4RHV 3;  2R04 3;  3T2O A;  2NM1 A;  3D3A A;  2I2S A;  3N9M A;  3T1L A;  2OT7 A;  4QPI B;  1NOV A;  3VD3 A;  3ZYF A;  3LKJ A;  3PUS A;  4X6R B;  5GZF A;  4LJH A;  4CPB A;  3ZXK A;  2GC0 A;  3T4H B;  2WQZ C;  3AKS A;  2WO1 A;  3T2Q A;  4IE4 A;  1A78 A;  1R09 1;  1XSR A;  4XJW A;  3WNX A;  4YLZ A;  1UCX A;  3BPS A;  2IXI A;  1UOB A;  3VBF A;  1RVF 2;  2XJP A;  2GNM A;  3UNP A;  5CFD C;  5F3C A;  5LY1 A;  1UNB A;  2VM9 A;  4WM7 A;  5IAT A;  3MO4 A;  5CFD B;  2D6L X;  3VZN A;  2JE8 A;  4HN1 A;  4CCN A;  3S5A A;  1O8S A;  2QQO A;  1UOJ A;  1RUD 2;  3VD7 A;  4AI9 A;  1HQL A;  2HWE 3;  3QCW A;  4E2Q A;  1K5M C;  3VBR C;  3WCS A;  4XIO A;  1ZBE 1;  2QBX A;  4QQP A;  3K2O A;  4IV3 B;  1GV9 A;  3RGB A;  3J7L A;  3SIT A;  4EN7 B;  2IWG B;  5F3I A;  3TEX A;  3VBR B;  1RUE 2;  2W92 A;  4OUM A;  3CBN A;  1NCQ C;  4IES A;  2YB7 A;  5FZM A;  5F7U A;  4UOJ A;  3ASI A;  3PL0 A;  2PHT A;  4CP2 A;  4GZ9 A;  1H1I A;  3EHK A;  4XFI A;  3POJ A;  1UPI A;  1SBE A;  5E1R A;  2H0B A;  1GZW A;  4DS0 A;  2DVB A;  2OPK A;  5C33 A;  4IEW A;  5JXJ A;  5HCH A;  1ULP A;  2Q8D A;  3ENR A;  3NV1 A;  3PIJ A;  4M3C F;  2ID4 A;  1RTV A;  2AEZ A;  5B4X A;  3AP7 A;  3PU8 A;  1RUC 3;  3EXU A;  2VXR A;  4I0B A;  4UFK A;  1W8W A;  2ARX A;  4XFA A;  5A80 A;  3MID A;  4O9E A;  3UK9 A;  5DZG A;  2BW8 A;  2EIE A;  5LA2 A;  2YBK A;  3CF6 E;  5CFC C;  2W1U A;  3GHM A;  3GBW A;  3LE0 A;  1HXS 1;  1WW4 A;  3LZZ A;  4PDW C;  4QX7 A;  2OYZ A;  2D44 A;  2UY8 A;  1JS9 A;  1PIV 3;  2V5Y A;  2FMY A;  5FP8 A;  5CFC B;  3MUY 1;  1KDK A;  4PDW B;  4BB3 A;  3B02 A;  1NUK A;  3TEY A;  3V0B B;  1J83 A;  2VCM A;  1D2S A;  3EO6 A;  1B35 A;  1VMF A;  3SEP A;  1UOG A;  1XE7 A;  5IWF A;  3ZLI A;  1QJE A;  2X8K A;  2ZX1 A;  1UXZ A;  3MIG A;  2JD9 A;  2OW4 A;  4OYU A;  3RSJ A;  2R6Q A;  1I5Z A;  1XU1 A;  1H9W A;  1LKN A;  2RJ2 A;  4GWM A;  1X8M A;  4YGB A;  3POI A;  2ZGS A;  1FT9 A;  4XMA A;  5KHH A;  5APA A;  4CU6 A;  2BV4 A;  3I2H A;  4K3U A;  4YZ2 A;  1ND2 A;  2H6C A;  1K42 A;  2YPJ A;  1RUN A;  1U5Y A;  1HRI 3;  4Q0P A;  3ZR6 A;  5CG9 A;  5I8T A;  1RB8 G;  3IT8 A;  5JOX A;  3M3E A;  1G9C A;  1NLQ A;  4BQW A;  1G9A A;  1QJY 2;  2ARB A;  5FAX A;  1N47 A;  3ZSE A;  5JOZ A;  3MV1 1;  1RUG 2;  1IG3 A;  1PK6 B;  5DXD A;  1Q8P A;  5A7Q A;  4CUG A;  2J1A A;  3LEG A;  4OMD A;  4E2S A;  4IGQ A;  4RL7 A;  5C3O A;  3N7M A;  1AL2 1;  2QCS B;  5C9A A;  3URF A;  1PZ8 A;  2VW2 A;  3OGJ A;  3WUC A;  1EYB A;  4B7K A;  4BHP A;  2WFP A;  5JZG B;  4AQS A;  2ORX A;  4EZH A;  3VD4 A;  1YI9 A;  4BQX A;  4HON A;  1H2M A;  4YZ5 A;  4NRM A;  4F3J A;  2A3X A;  2YC0 A;  1W6M A;  2NPI A;  4QQH A;  3C3V A;  4BYY A;  1S55 A;  2E53 A;  3MIB A;  5IVB A;  3I3Q A;  1RUF 1;  3P3P A;  4AEJ A;  1NCR C;  4JV4 A;  3BUC A;  1VBC 2;  1W6Q B;  5T50 A;  5FP9 A;  2Y38 A;  2PAM A;  2ZPX A;  4EN0 A;  4XJA A;  5EJZ B;  3W21 A;  3VB9 A;  5JPN B;  4Y1V A;  4JHT A;  2B9U A;  1C8M 2;  4XF4 A;  5E89 A;  4AEK A;  4N9H A;  4AQ6 A;  2MNG A;  2QQM A;  1CAX B;  4RGK A;  4AI0 A;  1E5R A;  2ZGR A;  1IHM A;  4I0A A;  2X5I A;  4QB2 A;  3CU7 A;  1ZM1 A;  2B5H A;  4XDO A;  3INA A;  1DQ1 A;  4XQD A;  3UES A;  1US2 A;  4NVP A;  1WLD A;  2ZX2 A;  1OF3 A;  1MS5 A;  5BNO C;  4LT5 A;  1WKY A;  3ZYP A;  3RI9 A;  2YFU A;  1UD1 A;  1RVF 1;  2JIG A;  2VVF A;  5BNO B;  5DPN A;  4DUV A;  1PX3 A;  5F3E A;  4PI2 A;  2ZZQ A;  2CAV A;  3CDZ B;  1HQW A;  3FLP A;  4AI1 A;  4CEW B;  1MZ6 A;  3VDD A;  2DVG A;  2WWU A;  5BNP C;  2QUO A;  3ZKU A;  4UF0 A;  2XLA A;  4K8R B;  5C8C A;  3KGZ A;  5FP7 A;  1S2B A;  4AW7 A;  4C8D A;  2YU1 A;  2P3Y A;  3PVN A;  3TRS B;  4KMQ A;  4YVW A;  3ZYR A;  1XPW A;  5L19 A;  4QX2 A;  2BJS A;  2PAE A;  3N9Q A;  2SBA A;  4HN0 A;  3WOG A;  4A44 A;  4TTG A;  4GJY A;  1DQ4 A;  2JWP A;  1RUE 1;  2RDR A;  3APB A;  3U78 A;  2KA3 A;  3HAG A;  1GUI A;  3ZXG A;  4KU8 A;  2ZHM A;  4AFA A;  3POW A;  4CDQ C;  3M1H A;  1KGY A;  5FZD A;  4AEM A;  2Q30 A;  3F95 A;  1MS1 A;  4OUS A;  4Q0Q A;  4WVM B;  1FOD 3;  4CDQ B;  1H8V A;  3UT0 A;  5GM0 A;  2LTN A;  1VIW B;  5GZC A;  1HB1 A;  1SG3 A;  3JQW A;  4NN0 A;  4XJ9 A;  5FP4 A;  5CKM A;  3OUI A;  3S5Q A;  1FMD 3;  3OBR A;  5FFO C;  4E4H A;  3EMR A;  2I74 A;  2DVD A;  2KXL A;  3OGV A;  2O8O A;  5HCB A;  5A3U A;  2ZEX A;  2Q1Z B;  2VQT A;  3D8C A;  3KVA A;  5DAW A;  2A3W A;  2ZGM A;  5DAQ A;  3BTX A;  5FXW A;  3MLK A;  1W2T A;  2QQP A;  3DYP A;  3WNK A;  4I09 A;  5DUX A;  1Q8V A;  4FTB A;  5DZF A;  1AR9 3;  1RMU 3;  4ISQ A;  4BCU A;  4IGP A;  4RR3 A;  4F8A A;  4MXW A;  4CXY A;  3H3U A;  5C8W A;  1LGB A;  2ZEW A;  1QXR A;  1PM4 A;  4IEZ A;  2YHJ A;  4E27 A;  3I3B A;  3WF4 A;  3AK0 A;  1QXP A;  3IDA A;  4DRR A;  1SPP A;  4YGD A;  4JCK A;  5A3P A;  3N35 A;  4Q4V 3;  3U07 A;  1WWY A;  2VMF A;  3VZJ A;  1GU3 A;  2A6V A;  3O0X A;  1WBF A;  2QQW A;  1JMU B;  1JHJ A;  4Q4W 2;  2RS1 2;  1PVC 3;  4WZF A;  4Y1Z A;  1AYM 2;  5FZ7 A;  4KNC A;  3G7D A;  2I07 B;  4L99 A;  3RG0 A;  2VU9 A;  3OJB A;  2BGP A;  2W52 A;  4OHX A;  2VQ0 A;  3B69 A;  2DUP A;  5HXM A;  4DIQ A;  3RS6 A;  3UKN A;  2NN8 A;  1JZ6 A;  1NLS A;  3NKT A;  1NXM A;  1RHI 2;  3DL3 A;  1YQC A;  2CDP A;  2P3I A;  3R0R A;  5KHK A;  2XLF A;  4PHZ A;  4A6O A;  4YW6 A;  5CIS A;  2V73 A;  1QJY 1;  2ARE A;  3WG2 A;  1TQ5 A;  4AZZ A;  1RUG 1;  2GH8 A;  3QBQ A;  3PUQ A;  5F5A A;  3IWZ A;  2D98 A;  4DMI A;  4NWV A;  5IT6 A;  2MPF A;  4XVH A;  2WNE A;  2E7A A;  1DQ0 A;  3C8X A;  4CEY A;  1EP0 A;  2D6N A;  3VL9 A;  1W8O A;  5FY8 A;  2KM2 A;  1X50 A;  1COV 2;  4HMZ A;  1N1S A;  1O4T A;  2XML A;  1ZRR A;  3J4U H;  5EJ1 B;  4XTP A;  5F9T A;  5LW9 A;  4NRQ A;  5GLT A;  2V5D A;  4Y3O A;  3B5L B;  4BQ5 A;  3A0N A;  2YZ4 A;  5KXC A;  1ALY A;  5C71 A;  1VBC 1;  4NHL A;  4YW3 A;  1ULO A;  3WNL A;  2Y8K A;  3W20 A;  4QX5 A;  2GH2 A;  2BRT A;  4IEQ A;  4IV1 B;  5G04 L;  5ABJ B;  3KV6 A;  1GWM A;  1C8M 1;  1S0B A;  3I2D A;  4D69 A;  4AFB A;  2Q1M A;  1F31 A;  2VZT A;  4B3N A;  2WNU C;  3LEM A;  4YRD A;  2CSG A;  3RPQ A;  1SLT A;  1R1Z A;  4X8N A;  5SV8 A;  3POY A;  5D2A A;  3WG4 A;  2WNU B;  3Q8A A;  1IKQ A;  5FMD A;  3B00 A;  3JXS A;  3SC7 X;  4A41 A;  4EQV A;  1VBB 2;  1I1E A;  1RUO A;  3VGI A;  2OZ6 A;  2GND A;  1C5H A;  4LKE A;  1UY2 A;  4IEO A;  3POF A;  3Q8F A;  2FCV A;  4FCA A;  4XJ8 A;  1CX1 A;  4LBQ A;  5T52 A;  1HIX A;  5F2S A;  4RHV 2;  5JMC A;  2QQN A;  3GYD A;  4CCM A;  1YFY A;  4MGS A;  4QPY A;  2R04 2;  3ZXA C;  4OHY A;  4TN7 A;  3X29 B;  2VZS A;  1DQ5 A;  4F7Z A;  1XE0 A;  1W2O A;  3CKH A;  3T3Y A;  3VBU C;  2YBP A;  1LHO A;  4BQ4 A;  1GLH A;  1ND3 C;  3KS7 A;  4DXZ A;  3M70 A;  2V4A A;  2FZ2 A;  4MGK E;  4XQW A;  5JAX A;  4GIQ A;  5F5Q A;  3VBU B;  2WN2 A;  2WNV C;  2VXJ A;  2EF6 A;  4XZP A;  1ND3 B;  5CEH A;  1NE6 A;  2K46 A;  2D40 A;  5CVR A;  3LB9 A;  3TWI A;  5GLV A;  1W8U A;  2WNV B;  2P6C A;  1S0E A;  4RGA A;  1HQN A;  4IEV A;  2BOI A;  2BWA A;  5FRE A;  1JXN A;  4CZS A;  2PFW A;  3JBG 3;  3KSC A;  4HFS A;  1OPM A;  1RED A;  1RXF A;  5T5O A;  4LUL A;  3K75 B;  3WF0 A;  2DCY A;  2IFW A;  4Q1R A;  4TSV A;  4CTE A;  5IK4 A;  2HWE 2;  4PIX A;  2XWJ B;  5H9Q A;  1UIJ A;  5CB7 A;  2K0G A;  1W6P B;  3IIA A;  1ZA4 A;  4NAO A;  3WT3 A;  3AL6 A;  1ZRC A;  2OX0 A;  2P34 A;  4PIY A;  3WNO A;  1WA6 X;  1L7Q A;  4B29 A;  3MFA A;  3O1T A;  2Y60 A;  5D8A B;  3ABZ A;  4B1L A;  4RD7 A;  1CAU A;  3HIF A;  4TZD A;  3ZFF C;  2EAK A;  1DCS A;  1BEV 3;  1QOT A;  3EBR A;  3VHP A;  3WDV A;  2ZGN A;  3BTZ A;  5F8P A;  4YG0 A;  4Q27 A;  1VBA 3;  2VZQ A;  5BY5 A;  2EXJ A;  2IXC A;  3ZFF B;  4BE3 A;  1RUD 3;  3HN1 A;  1X82 A;  1RUC 2;  4IXL A;  4WM8 C;  1MQT C;  2ZAH A;  1Q8S A;  3USU B;  2XPJ A;  2XL9 A;  1VRH 3;  2A71 A;  1XYP A;  5ACA 3;  4WM8 B;  1C8N A;  1XBF A;  2ZXQ A;  1ENX A;  4LTA A;  3KT4 A;  1JUH A;  1GWL A;  2Z2S B;  2GNB A;  3ZYJ B;  2CGP A;  3P1I A;  1J3P A;  4FFF A;  4Q4W 1;  2IXL A;  1PIV 2;  2RS1 1;  2ZGK A;  3OEB A;  1AYM 1;  1WLW A;  3UKV A;  3ZFG C;  2XBO 3;  3VZM A;  2V4V A;  5T5P A;  4YAR A;  4RS5 C;  4GWN A;  2ZS6 B;  1SBF A;  3H50 A;  4YGE A;  4AK3 A;  1D0H A;  4QM9 A;  3ZFG B;  2P3J A;  2ZX4 A;  5T55 A;  5FUP A;  2AUY A;  4RS5 B;  2VUA A;  3GBG A;  2NYY A;  2W94 A;  1XXN A;  3RYK A;  1Z7S 3;  2BZD A;  4L0P A;  3I2G A;  4JQR A;  1RHI 1;  2ARC A;  1UY1 A;  2X09 A;  1A3K A;  5A3L A;  4GH4 A;  2HYX A;  2YXS A;  1V6J A;  4ZU5 A;  2BU9 A;  4DIN B;  4NR1 A;  3THD A;  4GMP 1;  2RJK A;  1OPO A;  3M2M A;  2ZGL A;  1Z0H A;  1W0N A;  4XTM A;  1HRI 2;  1COV 1;  1W9F A;  3AC0 A;  3NRU A;  1W04 A;  4JC1 A;  3HQR A;  4NIG A;  1AXK A;  2Y64 A;  1GYK A;  4YVS C;  2ZKL A;  2OS2 A;  4I3G A;  4QHO A;  3NNM A;  2VJX A;  2XVK A;  1LUL A;  2OVU A;  3O1O A;  4YVS B;  2DCK A;  4KWJ A;  1DFQ A;  4GXL A;  5FZB A;  1OBN A;  5G05 L;  1YI7 A;  4AGG A;  4A7Z A;  3JUU A;  5DUU A;  2QQL A;  4P9X A;  4X6Q B;  5T3N A;  5JSP A;  2BGO A;  3HQX A;  3A22 A;  3ORJ A;  4LIV A;  1E5S A;  1O6U A;  5BNN B;  1GBG A;  4Y1Y A;  2K2S A;  1O59 A;  5BYN A;  4XIL A;  5F3G A;  1VBB 1;  1RUI 3;  3KWV A;  2CHH A;  1MVE A;  5J98 B;  2FDK A;  4IDZ A;  4Y5T A;  3HNY M;  2ZEY A;  4NII A;  4QDQ A;  4RHV 1;  1DIW A;  5DQ0 A;  1SDW A;  3ZFE B;  2DF7 A;  2R04 1;  5JDB A;  1R1A 3;  4CCE A;  4MGY E;  4NHY A;  4YPJ A;  2JJ6 A;  2D93 A;  5F6L B;  3N9P A;  2D43 A;  2AR6 A;  3NWK A;  3NAP C;  4HSJ A;  5FMC A;  4EN9 B;  1WLT A;  4QXB A;  1UOF A;  3BIE A;  1UYX A;  3WQ0 A;  1W3X A;  1WLC A;  1RUH 3;  1W03 A;  2OZJ A;  1DZT A;  3R4D B;  4Z1V A;  4D7Y A;  1QF3 A;  4XC9 A;  1YJK A;  5IVF A;  1SFN A;  4DY3 A;  4A3X A;  4ZHN A;  3LDR A;  5IUQ A;  1AX2 A;  4RSU A;  3FBM A;  4BWO A;  4GA9 A;  5JOW A;  5FOJ B;  1OUS A;  1YFX A;  2W91 A;  1UO9 A;  3AJY A;  4W4Z A;  4Y22 A;  1LES A;  1F35 A;  2HWE 1;  4ZKT B;  4LO5 B;  2ZX0 A;  5CYY A;  2HWB 3;  4YW4 A;  2GC2 A;  3ZXJ A;  1W2N A;  2F4P A;  4IER A;  4OI2 A;  1A6C A;  2BTV C;  3DCQ A;  2WZE A;  1Q3E A;  2BFU L;  2TBV A;  1QY4 A;  2EAL A;  3NJX A;  3LEK A;  4QD2 A;  5IJR A;  3GJB A;  3OG2 A;  1VJ2 A;  2D6P A;  4QAW A;  5ERL A;  4D94 A;  4KGQ A;  4RN5 A;  5E16 A;  2RHP A;  3T2P A;  2P2K A;  3ZSK A;  3I49 A;  3VD5 A;  2VOX A;  2WII B;  3HT1 A;  2XKO A;  1G9B A;  1FOD 2;  2B39 A;  1YQ6 A;  1IZ3 A;  1GKB A;  4WM7 C;  4A2U A;  5C6C A;  4PLO A;  1EUT A;  2Y6G A;  4EZ4 A;  2EIC A;  1LEM A;  1WD4 A;  3MIH A;  5C4W A;  4XUQ A;  1FMD 2;  3E97 A;  2B4K A;  4NRP A;  1RUC 1;  4FPK A;  3WEZ A;  2KD7 A;  1MAC A;  3GZT B;  4MZU A;  1JOD A;  3VBO A;  5FCC A;  4AXO A;  2WZR 3;  2W9X A;  4ZU4 A;  4CP1 A;  3O12 A;  4GMP 0;  3LD8 A;  5FZ8 A;  3WDY A;  3UL2 A;  2WRA A;  1JUI A;  1YXW A;  3V0A B;  1AR9 2;  1RMU 2;  1H2L A;  1PIV 1;  2H6B A;  2NMN A;  1S2E A;  3AKT A;  3HT2 A;  5IYY A;  4UI9 L;  4DXT A;  3NV2 A;  4N43 A;  1OF4 A;  1SLB A;  2L9L A;  2UWB A;  1WW5 A;  1O5U A;  3IMN A;  5GZD A;  1WGP A;  2LW8 A;  5LBC A;  1G9D A;  3KF5 A;  4LK6 A;  4MLO A;  2A75 A;  2A6X A;  1EPZ A;  4P14 A;  1L3J A;  1OH3 A;  3J7H A;  2YUE A;  3AZV A;  1GSL A;  3NNF A;  5LBE A;  4Q4V 2;  1UKR A;  4S2F A;  4UWD A;  1GZT A;  4Q8K A;  1GZW B;  4Q0U A;  5IK7 A;  1GNH A;  2FQP A;  2VGD A;  4GWJ A;  1LOD A;  2DV9 A;  1OKQ A;  3IDB B;  3VZK A;  3IAP A;  4AGV A;  1PVC 2;  3AP5 A;  3U1X A;  4QKN A;  3Q8B A;  3W9A A;  2QQU A;  3MF6 A;  4AAP A;  1W2U A;  3BOP A;  3SH3 A;  1MS4 A;  1F9K A;  1KDM A;  1US3 A;  2WUH A;  3ILR A;  5KHG A;  2OQ6 A;  2ORZ A;  3VKF C;  1V6K A;  4BDV B;  1JZ4 A;  4D8M A;  1PNF A;  2JG8 A;  2R06 3;  3AKR A;  4W50 A;  5IAX A;  1HRI 1;  3CZU A;  2JDK A;  2VMH A;  3HMY A;  5DG1 A;  1U5Z A;  1HX6 A;  2AEY A;  4D6R A;  3AMN A;  1B35 C;  4CDW C;  5CU1 A;  1ZBA 3;  4GWI A;  2DTY A;  4XFF A;  3RMY A;  3FLR A;  1AYN 3;  1B35 B;  1LGN A;  4CDW B;  1BCX A;  4UFH A;  4HVO A;  1HJG A;  2ZJC A;  1V9U 3;  3S30 A;  4F83 A;  4QT6 A;  5F39 A;  1UYP A;  2P17 A;  2PAK A;  4JKL A;  1ND2 C;  3D82 A;  1YJL A;  4XUT A;  1OQ1 A;  5DAX A;  3VZL A;  2PHR A;  3H8R A;  4KL1 A;  5FO7 B;  3E5X A;  1ND2 B;  5EXO A;  3KM5 A;  5JVV A;  3KCY A;  4MGI E;  4CUC A;  5EJ3 A;  3SIS A;  2MEV 3;  4JDO A;  2BP6 A;  1K3I A;  4M3C B;  4N7U A;  4OHW A;  1KD7 A;  4KH9 A;  3THP A;  1F2N A;  1QU0 A;  4C1W A;  5IVJ A;  4QX1 A;  5C9A C;  5HPO A;  5CNA A;  4A7K A;  3DEC A;  2PXJ A;  4XEZ A;  2JDU A;  1ONA A;  2W47 A;  5BV6 A;  3PVO A;  5L7O A;  5C9A B;  5GZG A;  1S0F A;  4PJY A;  3EYP A;  4P9J A;  2VZ3 A;  5EZW A;  3GM8 A;  4CYD A;  2ADD A;  3M4F A;  2XR4 A;  1KJL A;  3ILF A;  3AKP A;  4DZG A;  3PUH A;  3S0M A;  3CZJ A;  3M3C A;  3ZDS A;  4B4P A;  2BEO A;  4BM8 A;  3WDW A;  1NAE A;  2IZW A;  3GBF A;  4ZXK A;  4Q4X 3;  1HB3 A;  2QE3 A;  4Y4Y A;  1LHV A;  3KV5 A;  1AVB A;  4P9W A;  4NO4 A;  1IGO A;  4FAH A;  5FBZ A;  2VZR A;  2X5I C;  2Y6J A;  4JAA A;  3SNM A;  4ZON A;  2ES3 A;  4Q1P A;  4EWA A;  3AYE A;  3N3H A;  4DO0 A;  1C4R A;  1C1L A;  2ZMK A;  3ETQ A;  4L92 A;  1JZ5 A;  1V6I A;  5FMO L;  1OKO A;  4OZX A;  3FBY A;  2EVX A;  4JGY B;  3TB0 A;  1LOA A;  3JBG 2;  4Q29 A;  4LKD A;  4ZS2 A;  2RE9 A;  1RJ7 A;  1D4M 2;  4XCA A;  3UGG A;  2OPW A;  1FOD 1;  2GP5 A;  2NZ9 A;  4MGQ A;  4LHS A;  3VBS A;  4AQ2 A;  1VAL A;  1TNF A;  4HL0 A;  5FO9 B;  4JVA A;  1FMD 1;  4MG2 A;  1D2Q A;  4IND A;  2A6Z A;  3C2U A;  3NST A;  5C8C C;  3NQH A;  1TMF 3;  3D0S A;  1CZS A;  1LOF A;  4YVW C;  3PVB B;  1NQD A;  3WQ7 A;  2BOJ A;  3U4X A;  5EWS A;  5C8C B;  3AYD A;  1BEV 2;  2VNO A;  4LO6 B;  1AR9 1;  1RMU 1;  4EWE A;  1VBA 2;  1POV 3;  5C5U A;  4O9G A;  4JQT A;  4A42 A;  1HB2 A;  3RDI A;  2ATF A;  3ZXF A;  1J1L A;  1E5I A;  1G86 A;  3FHQ A;  3PUI A;  5C3Q A;  1KRI A;  4FO9 A;  4NIA A;  1VRH 2;  1POQ A;  3CJI A;  5C3R A;  2J1T A;  3OSD A;  2V09 A;  1K5M B;  4Q4V 1;  5E8A A;  2VTF A;  3GDB A;  4LBJ A;  1NA1 A;  2Q8E A;  2C6S A;  5ACA 2;  5J48 A;  4FFI A;  3WV6 A;  4PQ9 A;  2CAU A;  1PVC 1;  2WYF A;  4NIH A;  4J1W A;  2G9G A;  2XBO 2;  1NCQ B;  3CEW A;  3K4Z A;  5T5L A;  2ET7 A;  3LFI A;  3AL5 A;  1CPM A;  5F37 A;  5DUW A;  3WXP A;  3RMX A;  2IXH A;  5IVE A;  4HPK A;  4W65 A;  3LA7 A;  4JTO A;  4MVT A;  4C90 A;  5LWB A;  3GNE A;  1WBL A;  1VB4 A;  4LPL A;  2ZGQ A;  1Z7S 2;  4DEQ A;  5A1L A;  3CQO A;  4AFD A;  3SCF A;  4AAX A;  4E8D A;  1GFF 2;  5FZO A;  5LCW L;  3JB4 C;  3JD7 3;  3ZX7 A;  1OQE A;  5FPB A;  4RGG A;  4Z2W A;  4XDP A;  4BLI A;  2WJS A;  3AMH A;  3AFK A;  5I0S A;  3SEE A;  2UYA A;  1QXJ A;  2W2I A;  1UZY A;  3NL1 A;  3KQR A;  3WD5 A;  5HXV A;  2HBU A;  2WA4 A;  1O3R A;  1OA4 A;  5FZ9 A;  1F4H A;  1GQG A;  1VBD 3;  1J3Q A;  3M8L A;  4YM2 A;  4QPG A;  1BZW A;  5CIR A;  3U14 A;  5FYV A;  4M4R A;  1N1V A;  1W3V A;  4AED A;  4IUG A;  1CJD A;  2BBA A;  4Y1U A;  5KHJ A;  2FDF A;  1KS4 A;  4N7I A;  1TEI A;  3NJY A;  3PTR B;  2HYK A;  3P3N A;  3LIG A;  2VW1 A;  2WIN B;  1ODN A;  4IW3 A;  4UFJ A;  1DGR A;  4QHZ A;  2WO7 A;  5FPV A;  5A3O A;  3ZN6 B;  4WBB A;  4LIU A;  2R07 3;  1NE4 A;  4LKF A;  4QKD A;  3LWC A;  4XFH A;  1FAY A;  4CEY C;  2WQ8 A;  4BIF A;  3VDC A;  5C7G A;  1EUU A;  1H30 A;  3GZE A;  3H0O A;  4NAM A;  1T2X A;  1S0C A;  1YLL A;  2VCC A;  3I59 A;  3SH5 A;  1RUI 2;  4AHZ A;  2XJR A;  5LA1 A;  4MSV A;  4NUB A;  3HBZ A;  1ASJ 3;  1CJP A;  1KQR A;  2YFZ A;  2ZGO A;  4AQT A;  1SFY A;  1VMH A;  2RS3 3;  3J8F 3;  1UX7 A;  2GAL A;  2F4L A;  5FZF A;  3TBD A;  5IVC A;  1R1A 2;  4YFZ A;  1L7R A;  2D6K A;  5K8S A;  1AHS A;  1F15 A;  1HDK A;  4AF9 A;  5A1A A;  1OI6 A;  3SMH A;  3ZVX A;  2VMC A;  4IQP A;  4NWW A;  4Y20 A;  3E5Q A;  2FD8 A;  5FP3 A;  4UAP A;  3I8T A;  1LED A;  3MW3 A;  1ZNP A;  4CDU A;  2CNA A;  2W5F A;  4YG3 A;  5J3U A;  3MI8 A;  2YU2 A;  5ISL A;  1UAI A;  1X36 A;  4JX0 A;  2OII A;  1RUH 2;  3I54 A;  1IS6 A;  1J58 A;  5FYB A;  4BK4 A;  1NCR B;  1OLQ A;  2VME A;  4XBN A;  5EP9 A;  3CIH A;  3OGR A;  4E4Z A;  4P9L A;  3SLI A;  3RWN A;  3N7J A;  2W95 A;  2JKB A;  3ZSL A;  3VBH A;  2AYH A;  4HG6 B;  2QNK A;  3JBG 1;  1ENQ A;  2BDR A;  3MV0 1;  3BCW A;  5FPX A;  4GD4 A;  3T08 A;  1RUJ 3;  3OBA A;  3C7G A;  4HAN A;  4LBQ B;  2HWB 2;  3L9J T;  4CPB D;  5A6Y A;  5I0R A;  2D5H A;  3VD9 A;  4EYU A;  3ZPO A;  2IFR A;  1HRV 2;  3PMS A;  4XDQ A;  3SQO A;  1WA4 A;  1O4Z A;  1REE A;  3OF1 A;  1LU2 A;  5FYM A;  2RM2 3;  2VCA A;  2PMW B;  1ZRD A;  3NVC A;  4LHK A;  4QU2 A;  3P6B A;  1BEV 1;  2WL1 A;  3DN7 A;  1H6X A;  5A33 A;  2QQI A;  3CNA A;  4DOU A;  3WVJ A;  3HWJ A;  4QMA A;  1Y7B A;  3RNS A;  4DNY A;  1XRU A;  1VBA 1;  3K3N A;  3KCC A;  3VDA A;  5FQ0 A;  2AH2 A;  2VMG A;  1RUD 1;  2VAU A;  4CXW A;  1PNG A;  1OUX A;  3KGL A;  4OHV A;  3HVD A;  3K46 A;  3MHZ A;  4QKB A;  5BNP B;  4OFG A;  1QIQ A;  5DMY A;  2D3R A;  4LK7 A;  1VRH 1;  3IMM A;  2WZR 2;  3IDC B;  4AGR A;  2YRO A;  5ACA 1;  2XLG A;  1BJQ A;  2WWJ A;  2PTM A;  2YDE A;  4IE6 A;  1UU4 A;  3QD6 A;  1N1Y A;  2XBO 1;  3LPG A;  1H1A A;  3J26 N;  3AYA A;  4CUA A;  2JDM A;  3F2Z A;  4A6S A;  1YHF A;  4XOG A;  4FFH A;  4Q0S A;  4Y1X A;  5CKQ A;  3OYW B;  3C7E A;  1H6Y A;  2VZO A;  4QHB A;  2WR9 A;  4Y33 A;  4QB1 A;  3PHM A;  4HET A;  2JDA A;  2FDG A;  4GB3 3;  5FWJ A;  1CAU B;  5DAV A;  1QQP 3;  2Q8O A;  3AP4 A;  1JZ8 A;  2ZHK A;  2JDZ A;  3B01 A;  1Z7S 1;  5CFD A;  1OSG A;  2GC3 A;  1GP5 A;  3JU9 A;  5FO8 B;  5SV5 A;  5FYU A;  3H7Y A;  5I0T A;  3WDT A;  4AVB A;  1RJ8 A;  2X05 A;  5KHI A;  4FPJ A;  3ELN A;  4P9G A;  3TNP B;  4NID A;  3ZYG A;  2XJU A;  5L9V A;  5JUV A;  4IV3 A;  4DXR A;  3HOB A;  4CE8 A;  1O7F A;  1R08 2;  2HWD 3;  5FXX A;  4MGT A;  3OPZ A;  1DLL A;  3RVH A;  2B42 B;  3IKW A;  4PBO A;  5D1I A;  5A7P A;  2R06 2;  4QQL A;  1QJX 3;  1FPN 3;  4DY5 A;  2WO2 A;  3NO8 A;  3ON7 A;  1QJU 3;  1VE0 A;  4LA2 A;  2ZMN A;  1M4W A;  3I2J A;  1BMV 2;  4YM3 A;  1PO2 2;  1Y9M A;  3PME A;  1SDD B;  4OLL A;  1VR3 A;  5FDB A;  4LUM A;  1BBT 3;  3OB8 A;  5F2W A;  1GNZ A;  1EAH 3;  1ULC A;  1ZBA 2;  4C1X A;  4LBM A;  2O1Q A;  2R1B A;  2W68 A;  1V0A A;  1AYN 2;  4KWK A;  2X10 A;  3B9C A;  4Q5O A;  1J1T A;  3AZX A;  4GH4 C;  5FYT A;  4XF9 A;  5DDJ 3;  1V9U 2;  5LBB A;  3FUQ A;  4D7S A;  4ET7 A;  1AL0 G;  5KR7 A;  1H8T A;  1QHD A;  2JX9 A;  4XCB A;  1XB9 A;  4GH4 B;  1E5H A;  4QGN A;  4XFG A;  1QH7 A;  4WVZ A;  2JEN A;  2XH6 A;  1V6M A;  3RFR A;  1SBD A;  3AP9 A;  3WF1 A;  1QNW A;  4ZZ8 A;  5I91 A;  2J7M A;  3FMG A;  3RJR A;  4B1M A;  5L36 A;  2R0H A;  2E26 A;  4PDW A;  1C3H A;  4YW2 A;  1RUI 1;  2PHL A;  2JB4 A;  4AVV A;  1G6N A;  1OXC A;  3DKW A;  3K4A A;  2B9V A;  2MEV 2;  5JWP A;  3ZIX A;  1C28 A;  1PGS A;  2HKX A;  4OUL A;  2Q8C A;  3KMH A;  4K1Z A;  2RMU 3;  3PJQ A;  5CAZ A;  2EXK A;  3HEI A;  1Y9Q A;  2PYT A;  4V2W A;  1R1A 1;  2WO3 A;  4R9A A;  3FJS A;  4MXV A;  1XNT A;  2IVI B;  4Y26 A;  1W9Y A;  2YC2 A;  4LBO A;  4JTN A;  5FK8 A;  3VN4 A;  3WLU A;  4TWT A;  4UFM A;  1CWP A;  1CES A;  1Q5O A;  4R4X A;  5FY4 A;  3WNM A;  4A4A A;  1DYK A;  1UZW A;  2NP0 A;  4L97 A;  2OUJ A;  1RUH 1;  1W8Z A;  2AAC A;  2I45 A;  2JEC A;  3ETP A;  3IN9 A;  4P5Y A;  4XAB A;  4YSF A;  4Q4Y 3;  1LU1 A;  5AVP A;  4R9D A;  2R30 A;  4BOW A;  3BKZ A;  3RZL A;  1Y4W A;  1QEX A;  4CP9 B;  4ZY9 A;  5BNQ A;  3D6E A;  4IEX A;  4DUX A;  2XDV A;  4Q4X 2;  1OQD A;  3MEP A;  3U4S A;  4YM0 A;  3MF9 A;  1PK6 A;  1UF2 C;  3JQX A;  3I7D A;  3K77 A;  2BNM A;  3PNA A;  2HWB 1;  3KZ4 C;  2E51 A;  4GUL A;  3ZSM A;  1BLZ A;  3VHN A;  2VR4 A;  3BYW A;  4QQO A;  4UW3 A;  5JZG A;  4FP2 A;  1RC6 A;  2OXB A;  4QXK A;  4YG6 A;  3IBM A;  3LA2 A;  3GAL A;  3MUZ 1;  4XW3 A;  2QTW B;  3OGG A;  2GMP A;  4NPM A;  3PJY A;  2LS6 A;  1OOP A;  1UU6 A;  3OD4 A;  4NHK A;  2EAA A;  1W6O A;  1ZZC A;  3FFZ A;  4QWN A;  4XIK A;  3R4S A;  1WCD J;  4P02 B;  3RJ2 X;  4B4Q A;  3I97 A;  3BVC A;  3W59 A;  3K3O A;  1TE1 B;  2HWF 3;  1UU5 A;  2ZBJ A;  4P00 B;  1CAX A;  1TMF 2;  4FXG B;  1YIP A;  2DFB A;  2WZR 1;  4OZO A;  4YZ3 A;  5I8S A;  2RS5 3;  3MLL A;  4FVV A;  3OOX A;  5FZ4 A;  3O1S A;  4XAC A;  1XU2 A;  3S7E A;  1D4M 3;  1DGR N;  5FJK A;  3MDP A;  4YNI A;  4V2V A;  4PCR A;  5BNO A;  1P8J A;  5FY5 A;  5CKN A;  3M3Q A;  2ZHL A;  5HV0 A;  3ZOI A;  3B3Q E;  1GZ9 A;  2HH9 A;  5LA9 A;  4RYD A;  2A1X A;  2G9F A;  3RQ0 A;  2IC1 A;  5L9R A;  2D97 A;  1STM A;  2VO5 A;  4LMF A;  4CEW A;  3LPF A;  1YWK A;  4PT6 A;  1W9W A;  2DUQ A;  2HEY F;  4QGL A;  2WSU A;  1JU3 A;  4LO4 B;  3VBO C;  1JW6 A;  1K12 A;  4MET A;  2QZ3 A;  1NT0 A;  2Y6F A;  1WCU A;  4Q8L A;  4WZC A;  4C91 A;  3VBO B;  1GP4 A;  1ZZ7 A;  2E31 A;  5GLW A;  3SKJ E;  2R06 1;  3SHR A;  4JRL A;  4N43 C;  3N7K A;  2F17 A;  2YG0 A;  1JH5 A;  2MHF A;  2HEV F;  4HK8 A;  4ASM B;  2R7E B;  2VW0 A;  3JD7 2;  1CIW A;  2W1W A;  3VKL A;  4XHB A;  4UFI A;  1BMV 1;  4N43 B;  4WVM A;  1MQT B;  4K20 A;  5FZC A;  5F5C A;  1ZBA 1;  4Q26 A;  4LQR A;  4AHX A;  4FOW A;  4YGC A;  2BGC A;  2XJT A;  4XE9 A;  1TG7 A;  1AYN 1;  3H1M A;  3HQU A;  2C24 A;  2B7Y A;  4JKK A;  1V9U 1;  5FYS A;  1RIR A;  5FXV A;  5E88 A;  5A7O A;  1VBD 2;  5A7W B;  4KG8 A;  5FZL A;  3MPP G;  1PMH X;  5GJ6 A;  2XWB B;  1O3Q A;  1EV1 3;  2JG8 C;  2D5F A;  4GQ7 A;  2GNT A;  1MZF A;  3DXU A;  2CWM A;  3KCX A;  3WZ1 A;  3LDK A;  3WDU A;  5B4N A;  5K0U C;  4LE3 A;  2PLV 3;  4BQ1 A;  3NV3 A;  4RFR B;  5FMO S;  1KXG A;  4AL9 A;  4CDX A;  3TAY A;  4D0Q A;  2VUD A;  2MEV 1;  2JDN A;  4XAE A;  4YFW A;  5K0U B;  3ZXL A;  1DGW X;  3ACH A;  5FZH A;  2R07 2;  2WN3 A;  4XFB A;  4BQ2 A;  3DYO A;  4ZU7 A;  2VUC A;  3OY8 A;  3U0Z A;  5FJH A;  1IS3 A;  5JXH A;  1DP0 A;  1F5J A;  2PHX A;  3EJK A;  4HOO A;  3FHI B;  4FSJ A;  2DBN A;  5IFP A;  1TNR A;  4YW1 A;  1QMJ A;  5D21 A;  3EQE A;  4JDM A;  1ASJ 2;  5CA6 A;  4FTS A;  2DTW A;  3O7O A;  2RS3 2;  3J8F 2;  3LA3 A;  1DZQ A;  3BU0 A;  3JZV A;  3WW2 A;  1JYC A;  2CGN A;  2C1F A;  1CR7 A;  2VMI A;  2WT2 A;  2VOT A;  3H8U A;  4PLM A;  4KQ7 A;  4IE0 A;  4DB5 A;  1NYW A;  3K4D A;  1A34 A;  4MO3 M;  2G4I A;  3AZZ A;  4Q4X 1;  4OVE A;  5J7M A;  1VAK A;  2DU0 A;  2JD4 A;  4CCO A;  1LHU A;  2ZHN A;  1MEC 3;  2IVJ A;  4Q0V A;  1CAV B;  5DZE A;  1QKQ A;  3AJZ A;  4MHR A;  4XMI A;  5L7O C;  2WNO A;  1RIN A;  2ZML A;  1JOP A;  4ZXE A;  3UET A;  4LBQ D;  1V6O A;  2VNR A;  3OBZ A;  3FC0 A;  3WP4 A;  4S2H A;  1J3R A;  4TLG A;  2Q4S A;  5JXI A;  1RUJ 2;  1IG0 A;  2J1U A;  4LOT A;  3OBT A;  5JLV A;  1H1M A;  1UWW A;  1A8D A;  4IV1 A;  5ABJ A;  4LKS A;  5LB6 A;  4FPL A;  1SZB A;  4PI0 A;  2JG9 C;  1NX9 A;  4MGZ E;  5HV4 A;  4QB6 A;  3NAP B;  3RI8 A;  1APN A;  1SAC A;  1TMF 1;  5GAL A;  1FNY A;  4MV2 A;  2RM2 2;  4AHW A;  3CJX A;  5A32 B;  2A5Z A;  2JG9 B;  3QH6 A;  4G3Y C;  4LHN A;  2JDY A;  4FQ4 A;  3AFG A;  2WNU A;  1OD5 A;  1VBE 3;  2J22 A;  2VZP A;  4UW4 A;  4GJZ A;  2XGX A;  1XYN A;  3FFQ A;  1POV 1;  1UYY A;  1CIY A;  4WVW A;  2W3J A;  2PHD A;  3VUO A;  5EV7 A;  1J84 A;  1XQN A;  2UWA A;  4AE2 A;  1W6N B;  2WAB A;  3Q8C A;  4P5H A;  5H9R A;  4B4R A;  4ES9 A;  1REF A;  2C26 A;  2VD7 A;  1HRV 3;  1T6G C;  3GJA A;  4FPG A;  3VBS C;  1QJZ A;  1I5P A;  5LEJ A;  3VBF C;  4I02 A;  4GAL A;  1LOF C;  4OQ8 A;  2Q0A A;  1ND3 A;  3VBF B;  2CWS A;  4L9B A;  4YZ1 A;  1FAT A;  3O0W A;  4K8F A;  2VVE A;  2WAO A;  4N53 A;  4UYB A;  3DGT A;  3ZYB A;  4GB3 2;  1S0J A;  4EJR A;  1QQP 2;  2QQJ A;  1D7P M;  4K1Y A;  4MX3 A;  4WM7 B;  4YYO A;  1AR8 3;  1HJF A;  1HN1 A;  2WYS A;  4K7J A;  4ISR A;  2D6O X;  4I3P A;  2DCT A;  3ZYH A;  5FZK A;  1Q56 A;  2AZ5 A;  3ES4 A;  3JD7 1;  1OH4 A;  3NW4 A;  5IVV A;  5IK8 A;  3I3D A;  1DU3 D;  1DBN A;  2GMM A;  3CJI C;  4S2D A;  1L7L A;  2QDN A;  1JBC A;  5EIY B;  2R1D A;  3M3I A;  1Y43 B;  4LUK A;  4N90 A;  5GLZ A;  3B7M A;  3KV4 A;  3WQ1 A;  5JSO A;  2C0Z A;  3CJI B;  2HWD 2;  3BOW A;  1AJK A;  1XOY A;  5AC9 2;  2VOK A;  4HLT A;  1QJX 2;  1FPN 2;  4C0B A;  1LNS A;  1QJU 2;  2ZAC A;  5D8A A;  5L73 A;  1WUV A;  1OVP A;  2WLQ A;  4Z2A A;  2J1E A;  1VBD 1;  1S2K A;  2B8M A;  1ENR A;  4R8H A;  1HN0 A;  3D4K A;  1BBT 2;  1ULD A;  2JE7 A;  3OEA A;  4KWL A;  4R52 A;  1EAH 2;  1UMI A;  4XET A;  1HV1 A;  5JI9 A;  2NMO A;  2CGO A;  2GDF A;  4A45 A;  1Y3T A;  2VMD A;  4HKO A;  5FWE A;  2PHU A;  2F6B A;  2IXK A;  3USU A;  5DDJ 2;  1PGL 2;  4CU9 A;  5FZO B;  4BXS V;  3I3M A;  3E5U A;  1H4H A;  1R08 3;  1WCQ A;  1W8H A;  2R07 1;  4QKF A;  4COU A;  3UGH A;  1KJR A;  1DHK B;  4RQP A;  4QXH A;  1XNB A;  3OUJ A;  4NPL A;  1UQX A;  4CA9 A;  1PO2 3;  3NMB A;  5H9S A;  1GIC A;  2PHF A;  5A6Z A;  1GAN A;  1YQ8 A;  2XG3 A;  3LGR A;  3GZA A;  4JZR A;  5FYZ A;  5F32 A;  1ASJ 1;  1XND A;  2N7G A;  1PHM A;  4QX8 A;  3WP5 A;  3BB6 A;  2RS3 1;  4RS5 A;  2CDO A;  2RMU 2;  3J8F 1;  1GQH A;  3DV8 A;  3DEM A;  4LO8 A;  1AR6 3;  3E6B A;  3WY6 A;  5FXZ A;  3DPR A;  2ZGP A;  3SXW A;  5FRA A;  2VZV A;  1VP6 A;  2FMD A;  1NZI A;  3R4U A;  4COY A;  2IUW A;  2GME A;  2R49 A;  2WBK A;  2C9K A;  4AG4 A;  4L2N A;  2WQ4 A;  2PA7 A;  4ERO A;  2YYO A;  4EN6 B;  4NHX A;  1W8T A;  4Q4Y 2;  1UY4 A;  3AVR A;  1POV 0;  1PO1 3;  4H14 A;  1ODM A;  3GF6 A;  2Y33 A;  2ARA A;  2TEP A;  1MZE A;  1GNY A;  3ECQ A;  4DQA A;  4AWD A;  5J96 B;  3BN6 A;  2VOV A;  2Y6H A;  3VHR A;  1RUJ 1;  3I2F A;  1JYX A;  3HNM A;  1W8N A;  4YVS A;  4LBK A;  4URT A;  1UW8 A;  1IPS A;  4ATF A;  1NLR A;  4WV8 A;  5DN2 A;  1LOB A;  2R0F A;  4FFG A;  4O61 A;  3ITQ A;  4QDR A;  2G1M A;  2WT0 A;  4KI5 M;  3TOJ A;  4ASK A;  5A3N A;  2VNV A;  3QLQ A;  4FTE A;  1W6M B;  5EQU A;  2AEN A;  1YIF A;  3LOB A;  2RM2 1;  4Y20 B;  1XNA A;  3TNQ A;  1QDO A;  5BNN A;  1DLC A;  2Q1F A;  4LBL A;  1XNC A;  2BNN A;  5FZ6 A;  1PVX A;  4MAD A;  3VBH C;  1LJ7 A;  1ZRI A;  2UU8 A;  5FZA A;  2DYC A;  4AOC A;  2Z5W A;  3FZ3 A;  2FCT A;  2FDI A;  2ZKN A;  2GAU A;  4D7T A;  4XUP A;  5FLJ A;  2HWF 2;  1QOO A;  1F4A A;  1WMD A;  3MGU A;  2FBE A;  3ZFE A;  3R05 A;  5FOB B;  3H8O A;  3THC A;  5LEK A;  2X5I B;  2RS5 2;  2D3S A;  2AC1 A;  1CN1 A;  2EXI A;  5AFE A;  5J09 A;  4EV0 A;  2VH9 A;  3J7M A;  1KS5 A;  4R9B A;  2A6Y A;  3MW4 A;  3TN9 3;  4HSL A;  4GKX A;  4M01 A;  2JDP A;  3ACI A;  1JYI A;  2UYB A;  2P4E A;  2DCZ A;  2X29 A;  3VLB B;  3BTA A;  4X8P A;  3HJR A;  1WME A;  1DG6 A;  3LIH A;  4XJZ A;  3P5B A;  1BQP A;  3QH7 A;  5A3W A;  3CHX A;  2D3P A;  2ZZJ A;  4GB3 1;  3VDD C;  4D6S A;  1QQP 1;  4FOV A;  4IET A;  3N36 A;  4UW5 A;  5JIA A;  2ZGT A;  3IPV A;  1WCK A;  5LK5 A;  3VDD B;  3MIF A;  1S0I A;  1OHF A;  2RJL A;  4Z07 A;  3RRD A;  1JOJ A;  3FHA A;  1FNZ A;  3H3Z A;  1Q43 A;  4UF0 B;  2J1S A;  5FQ0 B;  4E9K A;  5EYX A;  4YVW B;  4BLJ A;  4ATE A;  5GZE A;  2ET1 A;  2HWD 1;  1UY0 A;  5I93 A;  2HEW F;  3ACG A;  5T5J A;  4BIS A;  4I01 A;  5HCA A;  5AC9 1;  3T30 A;  3ME2 A;  1QJX 1;  1FPN 1;  3WNP A;  2E6V A;  3LAG A;  1QJU 1;  5KBF A;  3QOP A;  5AC9 3;  1VB2 A;  3OPT A;  4GAZ A;  4Y4R A;  5FV3 A;  2ZCW A;  2OKX A;  4AR2 A;  1BBT 1;  3B93 A;  1N1T A;  4PF5 A;  1EAH 1;  1BVV A;  1WCS A;  2TUN A;  1H9P A;  4ARY A;  3B94 A;  5F6K A;  1PGW 2;  2VZU A;  2BVB A;  1BXH A;  3RZM A;  4I30 A;  1BK1 A;  4JDN A;  4U36 A;  3ZKY A;  3POS A;  2VE1 A;  1W99 A;  1PGL 1;  5DDJ 1;  4CUB A;  1QWR A;  2J1V A;  2RDQ A;  3HBK A;  4XUR A;  3MIE A;  2ZAA A;  1H0B A;  4IV3 C;  3U11 A;  2WC2 A;  1UY3 A;  4E4D X;  4RR3 C;  4OI0 A;  1LRH A;  2VTX A;  4IL7 A;  2WZP P;  1QNY A;  4Z82 A;  1NG0 A;  1EV1 2;  2DUO A;  3VKM A;  3V0A A;  2EXH A;  2RDS A;  2RG4 A;  3K48 A;  1LAJ A;  3AMP A;  2HBT A;  3OD0 A;  4MXW B;  1AR7 3;  3NNG A;  4RR3 B;  4BMB A;  4NE9 A;  2PLV 2;  2ZA9 A;  3NV4 A;  2RDN A;  1XE8 A;  4E8C A;  4XF3 A;  5FZ1 A;  1SPP B;  2RMU 1;  2XQR A;  2E7Q A;  2GN7 A;  2OA2 A;  1IKP A;  2HWC 3;  2IXJ A;  3N4M A;  3Q9O A;  4ORF A;  2QJV A;  4FPE A;  4W6Y A;  3H1Y A;  3T0D A;  3WG3 A;  3ZYI B;  1LEN A;  1MS0 A;  1H8T C;  2X53 S;  1ZZB A;  1JU4 A;  4EE2 A;  3OUH A;  5A7N A;  2E33 A;  3ZN4 A;  5EHD A;  2WFF 3;  3MIC A;  4J1X A;  1H8T B;  2YV8 A;  1LR5 A;  1YNA A;  2R16 A;  2AGS A;  2NQY A;  3KQ4 B;  1BVP 1;  3UYJ A;  5KXD A;  1YYN A;  4Q4Y 1;  3H7J A;  3WP6 A;  3SCH A;  1ENS A;  3WP3 A;  4O7X A;  5FTT C;  1F5F A;  1ZZ6 A;  2Y0O A;  1YEW A;  3H42 B;  3LQC A;  2W0X A;  4B8E A;  1BYH A;  1MEC 2;  4CDW A;  4CEY B;  3IDE A;  4CU7 A;  2RR1 3;  2WS9 3;  4G9S B;  2PQS A;  5KC5 A;  2VUL A;  2E9Q A;  4LOR A;  1BK0 A;  3AXD A;  4FPC A;  1OUR A;  5KXE A;  2CTV A;  5FZE A;  3W5N A;  2XL7 A;  3WF3 A;  4FT8 A;  3ALQ A;  5FY0 A;  1QJF A;  3U75 A;  1VMJ A;  2WLP A;  3HR9 A;  5JR7 B;  4LR4 A;  4BQ3 A;  5TSW A;  1OLR A;  3V65 A;  4AI8 A;  1V6L A;  4PQQ A;  4BIO A;  4JGZ A;  1X8E A;  3WQB A;  4URA A;  5A1F A;  1XSQ A;  1V00 A;  3BU7 A;  4QGM A;  1PK6 C;  1WMF A;  1YCI A;  1I9R A;  3KB5 A;  3CL1 A;  4H3W A;  4M3C A;  2HWF 1;  4N8M A;  4XUN A;  4YM1 A;  3T0A A;  4OUE A;  1ZRE A;  4ZS3 A;  2VBB A;  2ADE A;  3KF3 A;  1U0A A;  1AXY A;  4FI9 A;  1PMI A;  2RS5 1;  4JRA A;  1CAW A;  2VBD A;  5JZG C;  2VTX J;  4RA0 A;  2JE9 A;  3V56 A;  2D7F A;  3LOI A;  4EWD A;  2JKX A;  1VBE 2;  2O0O A;  4Z92 B;  4FOQ A;  4PBP A;  3FE5 A;  4K40 A;  4BME A;  1SCR A;  5FZ3 A;  1D4M 1;  2WKK A;  1CX4 A;  1DGW A;  4LE4 A;  1OOP C;  2FDJ A;  4XHX A;  2JXA A;  3NNL A;  4Y5Z 0;  1HV0 A;  3WW3 A;  5JI7 A;  4LOS A;  1OOP B;  1SHW B;  3ZIW A;  4H2A A;  2VG9 A;  1W6O B;  2FCU A;  1Q8O A;  4FBF A;  4CU8 A;  3BI3 A;  2DU1 A;  1YQ2 A;  2NLR A;  4OMC A;  5FZ0 A;  5K9Y A;  2UWC A;  4XJU A;  5F1R A;  2LAL A;  2PN5 A;  4QXC A;  4AVC A;  1NZC A;  2ZGU A;  4RFT 0;  4K6B A;  2Z4F A;  1IOA A;  1SLI A;  3UJQ A;  2O8Q A;  2RVA A;  4IE5 A;  5BUV A;  3LCP A;  1GWK A;  3O0V A;  3FWE A;  4ONU A;  3I4I A;  3CO2 A;  1UX6 A;  2CU5 A;  3DXT A;  1U5X A;  1Z78 A;  3D0J A;  4QDS A;  5GLU A;  1AR8 2;  4JGY A;  4CCJ A;  3O1M A;  2FZ1 A;  2BUK A;  1QH6 A;  2LUW A;  4FPF A;  1TME 3;  4YW7 A;  5BXX A;  1PX4 A;  4QPI A;  3WX5 A;  2GSY A;  1ZVF A;  4COV A;  1AXZ A;  4HK9 A;  4MYE A;  4OCT A;  4XXA A;  5LRS A;  2YC4 A;  2A6W A;  5LK7 B;  1CQ9 A;  4BJ0 A;  1PGW 1;  1YFU A;  4DRV A;  4CEW C;  4FPO B;  4SLI A;  1SLL A;  4YZ4 A;  1HKD A;  3USS A;  5LZ6 A;  5FYC A;  4NHM A;  5AVA A;  2QDR A;  4LBN A;  3AYC A;  4LEJ A;  4OQ9 A;  2Y6L A;  3WG1 A;  5IFT A;  2Y6K A;  2ZTN A;  1EV1 1;  3GXU A;  4DEV A;  1W90 A;  2O14 A;  2VCB A;  4CVU A;  3ZPY A;  4AI2 A;  4NRO A;  1O8P A;  3JCI A;  3LSD A;  2PLV 1;  1C5I A;  1U5I A;  5FBJ A;  1H2N A;  5LY2 A;  3ZM8 A;  3PTY A;  1UMH A;  4BZ4 A;  3UV9 A;  2JIC A;  1XC6 A;  1FI2 A;  2WDB A;  1K5M A;  3VBR A;  4DPN A;  1XNK A;  3H9A A;  4BK5 A;  1U12 A;  1D4V B;  3C7O A;  4FAG A;  1R09 3;  2P6H A;  3AM2 A;  4H55 A;  1WD3 A;  1NCQ A;  1W0P A;  1PZ7 A;  1X9T A;  2ERF A;  5B2G B;  3SKV A;  4Y5S A;  4FXK B;  1W8F A;  4JHZ A;  5H9P A;  3S7I A;  1ULF A;  4HVQ A;  2J1R A;  2K9Z A;  4ES8 A;  4TXW A;  2JB8 A;  4LHL A;  1AR6 2;  5JMO A;  1URX A;  4LA3 A;  3WHT A;  3PU3 A;  2YGM A;  4AFC A;  4M3C E;  2DCJ A;  3KLS A;  3H1W A;  4MUV A;  4NPR A;  4CDX C;  5DG2 A;  1CZT A;  1SQ4 A;  4COW A;  1UZV A;  4IEU A;  3RZG A;  1LGC A;  1UIK A;  2W87 A;  4FP3 A;  1J59 A;  4CDX B;  4IEP A;  1ZBE 3;  1V70 A;  4WVV A;  2BFU S;  1MEC 1;  5JOY A;  1QDC A;  5CFC A;  1SCS A;  3WSO A;  3V0B A;  3ZDV A;  3OY8 B;  2J42 A;  3GHN A;  5FIX A;  3VL8 A;  3THT A;  5FR3 A;  1DGL A;  1EPW A;  1PO1 2;  1S4C A;  3UKT A;  3RWK X;  3T1M A;  1VPH A;  1AX0 A;  3AXE A;  2JEM A;  1GOH A;  4DXS A;  1WW7 A;  1NY7 2;  3NJV A;  1O91 A;  4MHU A;  5FKC A;  1KFX L;  2JDH A;  4TLF A;  1LCL A;  5FPZ A;  2DVF A;  2BVV A;  4SBV A;  5FLH A;  3A4U A;  4BXF A;  1BHG A;  1FXZ A;  2XJQ A;  1F8V A;  3LFM A;  3ZN6 A;  5BPX A;  3WHU A;  2YMZ A;  2UUR A;  2VC9 A;  4E4S A;  3W5M A;  1HXS 3;  4QX3 A;  1H4G A;  2XOM A;  4XAA A;  4ZZ5 A;  3OTF A;  4BQY A;  1OT5 A;  3AVS A;  1HLC A;  1SLA A;  1VBE 1;  4W6W A;  2E63 A;  1GR3 A;  1WW6 A;  2XON A;  4OI4 A;  4QM8 A;  4XPV A;  3ROU A;  3A21 A;  4XBL A;  4B7E A;  4K9S A;  1KIT A;  1H2K A;  3GCX A;  3BTY A;  2QZ2 A;  4Y24 A;  4P9Y A;  4CSW A;  1OFS A;  1NQJ A;  1JN2 P;  1ZZ9 A;  3UJO A;  1JYV A;  1AJO A;  1HRV 1;  4IV1 C;  5ABJ C;  4AVS A;  1OLM A;  5ANQ A;  4AVA A;  2ZX3 A;  3AKQ A;  3TN9 2;  3A7Q A;  3L2H A;  4COZ A;  5CAD A;  2XJV A;  2LRP A;  4IE7 A;  3GCW A;  3IM0 A;  1W6Q A;  1ST8 A;  1N3P A;  2Q5T A;  5LAS A;  4D3W A;  2XXZ A;  2HLE A;  1LOE A;  1NCR A;  1DYP A;  1UZZ A;  5JXG A;  1MS9 A;  2TNF A;  1V6N A;  3QAC A;  1QOS A;  1YC6 1;  3KT7 A;  3N7L A;  1YUD A;  1AR8 1;  4UBG A;  5ANN A;  2P37 A;  4J25 A;  4KWU A;  4E2G A;  1A8M A;  3KHC A;  4Y22 B;  4YW5 A;  4OI1 A;  5I0D A;  4TYS A;  1JZ2 A;  1UZ0 A;  3OCP A;  1AL2 3;  1IPK A;  1RIT A;  3AMQ A;  2E7T A;  5HI0 A;  4OHZ A;  3D5O A;  4LNV A;  4HVR A;  3NKG A;  3SCG A;  1W9T A;  2WSV A;  1G8W A;  1N3Q A;  4L8Q A;  4PLN A;  2GU9 A;  1CPN A;  4N53 C;  2LRO A;  4L11 A;  1UMZ A;  1RUF 3;  4JKM A;  5EFU A;  3L2Y A;  4DFS A;  1CGP A;  4HT1 T;  3RZZ A;  2XUM A;  4KBB A;  5C4W C;  2KR2 A;  3TYJ A;  5T54 A;  4XBQ A;  2ZOE B;  3RZK A;  4N53 B;  1GOG A;  1VRB A;  3K51 A;  5FK7 A;  4W6X A;  1NXD 1;  5FLI A;  1UYZ A;  2WT1 A;  2XHN A;  1M06 G;  2V72 A;  3FLT A;  3POE A;  5C4W B;  1ZX5 A;  3M7A A;  3Q8E A;  5BNP A;  3KV9 A;  3W58 A;  3WW1 A;  2P1B A;  3PVE A;  3ZN5 A;  1R08 1;  1AX1 A;  1UL9 A;  1K45 A;  5A6X A;  3AX4 A;  1W06 A;  3T0B A;  2A7A A;  4HZF A;  2HJI A;  2Y34 A;  1IPJ A;  2VZ1 A;  3O1U A;  4HKL A;  2W39 A;  4XUO A;  1RXG A;  1AR7 2;  1PO2 1;  5D8A C;  5DUV A;  2BBV A;  2XKP A;  3ZXE A;  2SLI A;  4CDQ A;  1N3O A;  1RVF 3;  5KWR A;  2G9Z A;  3I2I A;  3OYW A;  4DUW A;  2BER A;  2GZW A;  2VUJ A;  3WW4 A;  5IHR A;  3BOD A;  3T2T A;  1KFU L;  5FMB A;  1AR6 1;  2RV9 A;  1KEX A;  2HWC 2;  3MYX A;  5C3P A;  2W08 A;  3KT1 A;  5CG8 A;  1K5J A;  4FOY A;  5CBL A;  3HPN A;  1RYY A;  2CL2 A;  1W39 A;  3ST7 A;  2C5D A;  1TVG A;  1QGL A;  3RZJ A;  3VZO A;  3WF2 A;  1IS5 A;  2YBS A;  3LDB A;  1E57 A;  4RQP C;  5FKB A;  1FV2 A;  2PEL A;  2WFF 2;  2XQX A;  3CLP A;  3I2O A;  4NJ4 A;  1X33 A;  1YFW A;  1ULE A;  4RQP B;  1RUE 3;  4IGO A;  1SLC A;  5C70 A;  2JG8 B;  2P3K A;  1O3T A;  1W9S A;  3DKQ A;  4MH0 E;  4UXA A;  1PO1 1;  3N9N A;  5FYI A;  3E6C C;  4LXL A;  4KGG A;  3III A;  1LOC A;  3VKN A;  3WCR A;  2W1S A;  1OLM E;  1NY7 1;  4Q2F A;  3DPR C;  4H7L A;  1RL3 A;  3PUR A;  2RR1 2;  2VVD A;  1C57 A;  2WS9 2;  1JHN A;  4S2G A;  5CZK A;  5I0U A;  1OMI A;  3FN9 A;  1SFP A;  3ES1 A;  5EYY A;  3WDX A;  2D6M A;  3DPR B;  4FPY A;  1D0G A;  3N9O A;  1G9F A;  3BGA A;  2Z69 A;  4M0H A;  2Z42 A;  3HD8 B;  3G6J B;  4I2O A;  1AF9 A;  3ACL A;  5I8Y A;  3O1P A;  2XJS A;  1Q8Q A;  1IQA A;  4I0W B;  1I6X A;  3PDQ A;  2BQP A;  1TZO A;  3TEW A;  2UY9 A;  2YPD A;  4CP0 A;  4LIT A;  3N9L A;  4UBH A;  4K21 A;  3BAL A;  1UKG A;  3A23 A;  2PQQ A;  1VLN A;  3H3L A;  2ZEZ A;  2Y0I A;  4XF1 A;  4NOT A;  4G4F A;  5J37 A;  2VPV A;  1GP6 A;  5A6Q A;  3CMG A;  1PZ9 A;  5L7O B;  1ULG A;  4XXP A;  2QFE A;  2XHK A;  3AMM A;  5DAB A;  3TN9 1;  3RYP A;  3WNN A;  1FV3 A;  1LHN A;  2WWS A;  1Y9G A;  3M3O A;  4CCK A;  5A7S A;  3MZH A;  4P9I A;  3DUI A;  4NMI A;  5BNN C;  3S6P A;  3T09 A;  3WR0 A;  3IB3 A;  1RGS A;  5FYY A;  2QQV A;  2FHR A;  2Z79 A;  3EB7 A;  3ILN A;  3J7N A;  4CP9 A;  4BU2 A;  3POB A;  5M0T A;  4XF0 A;  5IAV A;  1QJY 3;  5LRR A;  4A7Y A;  1T6B X;  2VBP A;  1RUG 3;  4FQZ A;  3ZFE C;  3O5S A;  3T4V A;  1LOG A;  1XYO A;  1GZC A;  1UXX X;  2VL4 A;  1JTZ X;  1B09 A;  1ZZ8 A;  4UFL A;  1O3S A;  1JI6 A;  5J1X A;  1OFN A;  3LEI A;  2OQ7 A;  3ZR5 A;  1LTE A;  2YGL A;  3O1V A;  2BWC A;  2CV6 A;  4EN8 B;  5LBF A;  3PLQ A;  2DVA A;  2LM3 A;  2QVS B;  1VAV A;  1PMJ X;  1TME 2;  2EID A;  4UT5 A;  1YRZ A;  3MFC A;  1VBC 3;  4HBN A;  4QQ2 A;  1MZ5 A;  1EY2 A;  2H0V A;  1G7Y A;  1DYO A;  1GMM A;  2YY1 A;  3ACF A;  3C7H A;  5IW0 A;  1ZYB A;  3VBS B;  4ITC A;  4XZU G;  5F5I A;  3VBU A;  4KBZ A;  5GKA C;  1C8M 3;  3VKO A;  4BH9 A;  3ZMN A;  1DQ6 A;  3IPV B;  1DDL A;  1XJA A;  4AVT A;  2BPA 2;  5IVY A;  2WNV A;  2VQU A;  1S1A A;  4CCD A;  3MLJ A;  4O65 A;  1HB4 A;  3I2K A;  4AFM A;  3UGF A;  1JYT A;  1AR7 1;  1AZD A;  2C4X A;  4XQ4 A;  4U2A A;  3TEZ A;  1LEC A;  2GN3 A;  2A73 B;  5KC6 A;  1W6P A;  4A3Z A;  4QPW A;  5L9B A;  1PM7 A;  1DZR A;  1NA1 C;  2BYV E;  1GOF A;  1S0G A;  5K4L A;  1DQ2 A;  2FDH A;  1SMV A;  1X9P A;  2EIB A;  1NA1 B;  1X7N A;  2HWC 1;  5FYH A;  3ZXD A;  4BA6 A;  2XB6 C;  3AZY A;  3DF0 A;  4LLF A;  4XYX A;  3RYR A;  1W0O A;  1R09 2;  2BNO A;  2XUE A;  3U10 A;  4XFC A;  1NKG A; 
#chains in the Genus database with same CATH homology
 4IGQ A;  5FYU A;  3DXT A;  5FY1 A;  5FXZ A;  5FYV A;  5FY9 A;  5FZ4 A;  4CSW A;  4CCJ A;  3N9O A;  4EZH A;  4HON A;  4DIQ A;  3N9M A;  3NJY A;  2OT7 A;  3PTR B;  3KVB A;  5ANQ A;  5FJK A;  3PUS A;  5FPV A;  5FXX A;  4V2V A;  3RVH A;  5FY5 A;  5IVB A;  5A7P A;  4LIU A;  3PDQ A;  5F5A A;  3PUQ A;  5FP9 A;  2XXZ A;  5FZ1 A;  3AVR A;  3KV5 A;  2YPD A;  4LIT A;  3N9L A;  5F2W A;  5F3C A;  4EZ4 A;  5LY1 A;  5FYC A;  5FY8 A;  4DO0 A;  4NUB A;  5A7W A;  5FUP A;  4GJZ A;  2XML A;  5LW9 A;  5A7N A;  4QU1 A;  5FYT A;  4XDO A;  4CCN A;  4Y3O A;  5FZF A;  4AI9 A;  4CCL A;  5A3T A;  4CCK A;  5FBJ A;  2GP3 A;  5IVC A;  3LD8 A;  5FZ8 A;  5KR7 A;  5LY2 A;  5A7S A;  2VD7 A;  4ASK A;  3K2O A;  3UYJ A;  5A3N A;  5FUN A;  2GP5 A;  5F3I A;  5FYY A;  3KV6 A;  5FZC A;  5FP3 A;  5FZM A;  2P5B A;  4D6Q A;  5F5C A;  5F3E A;  4BU2 A;  2YU2 A;  5ISL A;  5FZ6 A;  5FYB A;  5FZA A;  2Q8C A;  1VRB A;  2WWU A;  2OS2 A;  4UF0 A;  4V2W A;  5FYS A;  2Q8D A;  5FXV A;  5FP7 A;  5A7Q A;  5A7O A;  5A7W B;  5FZL A;  2YU1 A;  4C8D A;  3KV9 A;  2OQ7 A;  5FZK A;  4GD4 A;  4AAP A;  3PU8 A;  3N9Q A;  3PU3 A;  5A80 A;  5FZE A;  5IVV A;  4GJY A;  3DXU A;  5F2S A;  5FZI A;  5FZB A;  3U78 A;  2OQ6 A;  4CCM A;  5FPL A;  5FY0 A;  4EYU A;  2YBK A;  4TN7 A;  3KV4 A;  3ZPO A;  5FZD A;  5FY4 A;  4QX7 A;  2YBP A;  4URA A;  5FZH A;  5FYM A;  5IW0 A;  5FP8 A;  4LIV A;  5A3W A;  2Q8E A;  4D6R A;  5A1F A;  5F5I A;  5FZG A;  4D6S A;  3PUA A;  5FP4 A;  5CEH A;  2XDV A;  5FJH A;  3OPW A;  5F3G A;  3U4S A;  4E4H A;  4HOO A;  3AL5 A;  5F37 A;  5IVY A;  3K3N A;  5FY7 A;  4UF0 B;  5IVE A;  5IWF A;  3KVA A;  3ZLI A;  5FXW A;  5LWB A;  5F39 A;  5FZ3 A;  5FWE A;  5A1L A;  2YBS A;  3LDB A;  5FZO A;  5FZO B;  3N9P A;  4BIS A;  4IGP A;  4BXF A;  2WWJ A;  5FPB A;  4IGO A;  4QXH A;  4QXB A;  4XDP A;  4GAZ A;  3AL6 A;  3OPT A;  4Y4R A;  4QWN A;  5FPA A;  5FV3 A;  2OX0 A;  5FZ0 A;  2W2I A;  5K4L A;  4CCO A;  3N9N A;  5FYI A;  5FYH A;  5A3P A;  4LXL A;  3AVS A;  4QXC A;  4Y33 A;  5IVF A;  3K3O A;  5FYZ A;  5IVJ A;  5F32 A;  5FWJ A;  2XUE A;  5FPU A;  5E6H A;  4QX8 A;  5FZ9 A;  4CUG A;  5FZ7 A;  2PXJ A;  3PUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...