3PDQA

Crystal structure of jmjd2a complexed with bipyridyl inhibitor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
353
structure length
353
Chain Sequence
b'SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Inhibition of histone demethylases by 4-carboxy-2,2'-bipyridyl compounds
pubmed doi rcsb
total genus 114
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3pdqA01
4DIQA 5FUPA 5A7SA 5F2WA 5FP8A 2XDVA 5FBJA 4Y4RA 5FP4A 4IGPA 5K4LA 5IVBA 4E4HA 3N9QA 3ZPOA 4IGQA 4QWNA 5E6HA 5FXXA 5FYSA 5FZHA 2YBSA 4V2VA 4BU2A 5F5IA 4UF0A 5FZ9A 3RVHA 4EZ4A 5FYCA 5A3WA 4LITA 4DO0A 2OX0A 2GP3A 3UYJA 5FY4A 2PXJA 2GP5A 4QX7A 2YU1A 5IVYA 1VRBA 5IVCA 3AVRA 3N9MA 4QXCA 5FY5A 5A3NA 2OQ7A 4XDOA 4LIVA 2W2IA 4IGOA 3PTRB 5FYUA 4Y33A 5FPAA 3PU3A 2YPDA 5FUNA 5FYBA 5KR7A 3AVSA 3OPTA 5FPVA 3PUQA 5FV3A 5FYIA 2XUEA 5FY9A 3U78A 3ZLIA 5IVVA 4HONA 4D6RA 4GD4A 5FXWA 4BXFA 2OT7A 4QXHA 4C8DA 4CCOA 4CCLA 3KVBA 5FZ6A 4URAA 2Q8EA 4EZHA 4D6SA 5IVFA 5LY1A 5FZFA 5F3GA 2WWJA 5F3IA 5FZAA 3K2OA 5IW0A 2YU2A 3U4SA 4TN7A 5FY1A 3OPWA 5FZEA 4AI9A 3KV4A 4D6QA 3LD8A 3PURA 4XDPA 5F39A 2P5BA 5A80A 5LW9A 4QU1A 5FZLA 3KV5A 5FZIA 3N9LA 5FP7A 5FP9A 5FZBA 4LXLA 3AL6A 5A3PA 5FYZA 2XXZA 2OS2A 5FZOA 4Y3OA 5FPLA 4CSWA 4CUGA 5FZ4A 4GJZA 5FYHA 5LWBA 5FZ0A 3NJYA 5FPUA 4CCJA 4CCKA 2VD7A 3K3NA 5ANQA 5FYVA 3N9PA 5FZCA 5FYMA 5A7NA 5FPBA 5ISLA 4QX8A 5IWFA 5IVJA 5A7OA 5A1LA 5FYYA 5FZOB 5CEHA 3KV9A 4LIUA 3PDQA 3DXTA 3PU8A 5FZDA 4CCMA 5F3CA 5IVEA 5FXZA 4UF0B 4CCNA 4QXBA 3KV6A 5FYTA 5F32A 5F5CA 5FJHA 5FZMA 5FZGA 5FXVA 4V2WA 5A7WB 2YBKA 3AL5A 2Q8DA 4NUBA 5FP3A 3K3OA 5FZ7A 5F3EA 3LDBA 5FZ8A 5FY8A 2WWUA 4HOOA 4BISA 5A7QA 2XMLA 5FWJA 5A3TA 2YBPA 3N9NA 3N9OA 4GJYA 5F5AA 5FJKA 5LY2A 4AAPA 4EYUA 5F2SA 5A7WA 4GAZA 3PUSA 5FWEA 5FY0A 3KVAA 5FZKA 5FY7A 4ASKA 2OQ6A 5A7PA 3PUAA 5F37A 2Q8CA 5FZ1A 5FZ3A 5A1FA 3DXUA
chains in the Genus database with same CATH superfamily
1WD3A 1YQ8A 3L2YA 3MFAA 4XFAA 4RFRB 1AL23 2JD9A 3H8UA 1UU6A 1IS4A 1BYHA 1ND3A 2AR6A 1X8EA 2W08A 3I2GA 1L3JA 3K46A 4IGQA 1ENXA 4CXXA 1DGWA 1GNZA 3NV3A 2H6CA 4XBNA 3DYOA 3ZN5A 1DU3D 3JU9A 5HV0A 1Q8QA 2FCVA 3M1HA 4HBNA 5FZ9A 1VBB3 1DZQA 3NSTA 1LGBA 2GNTA 1NCRA 2A73B 4MHRA 4Y22B 3WQ0A 2PXJA 4MGQA 2GP5A 1PMHX 2ZKNA 3NJZA 4I09A 1RGSA 3VHPA 5DUVA 4FPEA 1RUC2 1RUH1 3C7GA 4IL7A 2WQZC 1MS3A 4A3XA 4ES8A 1VIWB 3ZXFA 1LU1A 2JG9A 5BNOB 2BJSA 3ZXGA 3B93A 3I2KA 3LA7A 5BNNB 5J1XA 3POBA 4DXTA 4FSJA 4PBPA 4FOYA 1LOBA 1QJX1 3AMMA 2FDIA 4UW4A 5F8PA 4NWWA 1ULEA 3NAPC 3WVJA 3WP6A 1KDMA 3OF1A 4LBOA 4AR2A 1MVQA 3PUHA 2F4LA 1D4M2 3N36A 3VD7A 3NL1A 4Q5OA 1XYPA 3T0BA 4A7ZA 2LRPA 2O8QA 3LF7A 1EUUA 3HD8B 1WMDA 4R8HA 1QOTA 2Q0AA 3ZXLA 4E2QA 4DFSA 3FHQA 4QX1A 3FWEA 4FOVA 2WNUA 3ZYPA 1C5HA 2V5DA 2HJIA 2WO2A 3FZ3A 4Q4V2 5F5QA 1SEFA 1W6PA 3AJYA 4K40A 5JOZA 1ULPA 3EQEA 2I45A 5LBCA 1YEWA 1XSQA 3L9JT 3BPSA 1Y7BA 4LO7A 4JGYC 1SG3A 5JPMB 3WG1A 1OI6A 2XBO2 4MVTA 1H8TB 1S55A 3HT2A 1W2TA 1PIV3 4YW1A 1QNWA 2C0ZA 2DVBA 2NQYA 2DBIA 2Y33A 1MS8A 3M3EA 5CKQA 2WZR3 1MZFA 4M3CB 1ZBA3 1OSGA 5C3QA 2PMWB 2WBKA 2FCUA 4DNYA 5I91A 3A4UA 2ET7A 1LGNA 2OA2A 3QLQA 5C9AA 1DZTA 2NPIA 1W9WA 1YHFA 3PL0A 3BCWA 2JWPA 3VL9A 2ZMNA 4OYUA 1C8NA 1AR81 2YMZA 4JKMA 2JB4A 5FJHA 5HCBA 1NA1A 3ZSMA 5GZDA 3ZKYA 4P9GA 4MGSA 4N9IA 3VLBB 1XNKA 3LB9A 2ZGNA 3JCIA 3JD72 3AZZA 3USUB 1RUD2 2XVGA 3CL1A 4K20A 2VCMA 4M4PA 4OI2A 4ORFA 4BISA 2K9ZA 2VNVA 1ZA7A 2ZX0A 1JZ3A 1LKNA 2LW8A 2ZX2A 4JGZB 2R7EB 4CU9A 1QJY2 4LHKA 4CP9B 1UX6A 4XJ8A 1D7PM 1OF3A 4KG8A 4N90A 5GLZA 4COUA 4GB31 1GWLA 2VU9A 3B00A 4AW7A 3B69A 3HNYM 4E4SA 4JVAA 4LO8A 4JDOA 4TTGA 1C8M1 1REEA 5LASA 4BK5A 3LOBA 2C26A 4X6QB 3BTAA 5CG9A 3LDRA 1FOD2 3EB7A 4K21A 4MGIE 2X5IA 4E2SA 3EBRA 4SLIA 4XF1A 4QX5A 3H1WA 3WG2A 4M3CA 2R6QA 4WM8B 1QKQA 4K1YA 4KMQA 4NE9A 4NOTA 2HWF2 2QQUA 3P3PA 1H6YA 1S0BA 1S0JA 3VKNA 2Y64A 5CFCA 1FMD1 2W9XA 3OSDA 1RMU3 3VDBA 2YG0A 4QGLA 5A3WA 2CGNA 3ZR5A 1PGW1 1GWMA 1AYM2 1H6XA 4XUPA 1W6MA 1YFYA 4FPHA 4MOAA 4AI8A 4LKDA 1V00A 1MZEA 4FPCA 2NMNA 4GXLA 4EN8B 3I3MA 1GOGA 5T54A 2CGOA 1RHI3 5KXCA 3KHCA 4ZU5A 4ASMB 1JS9A 3PTRB 4RYDA 3FHIB 5J09A 2V5YA 4MHUA 1OH4A 1RVF2 4AG4A 4FXKB 2ERFA 3TEZA 4QT6A 2D6PA 4LPLA 3INAA 1VRH1 2X53S 4JGZC 1JOBA 4NVPA 5FKCA 5FY9A 4EN0A 2QCSB 2VTXA 4HONA 2WS92 4M3CE 4WVZA 4GD4A 3HIFA 1NUKA 1NX9A 2A71A 3U75A 1BBT2 1YI9A 1N1TA 2VUJA 3IWZA 3VBHB 1CESA 3BOWA 2ES3A 4GMP3 1GP5A 1UIKA 5F3IA 4AHYA 1RUE1 5CFDC 3V0BB 1ZRIA 1LECA 2LALA 1COV1 2P5BA 2VQAA 1E5RA 1LTEA 2JE7A 3ZXJA 4D69A 1WD4A 2R1BA 2ARCA 2WA3A 1JUIA 3EJKA 2LS6A 3HQXA 3ILRA 2F4PA 3LEIA 3PVBB 4QQLA 4LJHA 4YGCA 4P14A 1PK6B 2XXZA 1AR91 4QPYA 4AHXA 2AGSA 4YGBA 3O5SA 2ZGOA 2WNOA 2RV9A 2Z4FA 5FPUA 5F7UA 3WT3A 3KQRA 3OEBA 3VBSB 2PFWA 4IEQA 3PLQA 5A7OA 5C8WA 2RMU1 1YQ5A 2NLRA 2ZZJA 3GNEA 3W20A 3WR0A 3NAPB 4HK9A 1ENSA 2AEZA 1Q5OA 2VH9A 2WN3A 3I3EA 4D94A 1GZ9A 2RS12 1AX0A 3OGGA 3E5UA 4IEXA 3HNBM 5CISA 3QCWA 1QOOA 1TNRA 1ZM1A 3AK0A 3OGJA 4JHZA 5FP3A 4EWDA 5B4NA 2OZ6A 1UXZA 2OZJA 2QQKA 3ZSJA 3ASIA 5EV7A 5C3SA 3AKRA 2HBUA 1W8ZA 1UCXA 3KCXA 2XMLA 3SQOA 3AXEA 1UMHA 4ZU7A 1WLCA 1V6KA 5FQ0A 5HXMA 3OTFA 4DY5A 4S2GA 4LULA 2XH6A 4AI3A 4LO6B 5FZKA 1ZZ9A 4JRLA 2A6XA 1AL22 2WT0A 5FMDA 2K0GA 1CN1A 3OB8A 3EXUA 3WF4A 2Q8CA 3Q8EA 4RR3B 5FZ1A 3ZOIA 5A1FA 1RUNA 2O14A 5BNPB 5L7OC 1UKRA 2YGMA 3MIBA 4N7UA 4B8EA 4UFKA 1VBB2 4FFIA 2EAKA 4LQRA 2G19A 3CO2A 3ZYHA 4CDUA 5CADA 1HQWA 1SACA 3ZMOA 4YFZA 3AP5A 2J1AA 1DLLA 3ES4A 5CA6A 1R092 1W8UA 3MI8A 2Y6JA 5DDJ1 1OQ1A 2DWRA 3H1YA 1VALA 2HWD3 3NWKA 1UOGA 5K0UB 5FRAA 1U5XA 2TBVA 2HWF3 4IDZA 5LBBA 5FY4A 1SLTA 1Z7S2 4QX7A 4CP9A 1ACCA 1WWYA 1GV9A 2OKXA 2ZHMA 4XW3A 3V0AB 2GALA 3K4ZA 1UY1A 3KWVA 3LFIA 1SZBA 2HEYF 2WZR1 3QH7A 3T08A 3SLIA 4DRVA 2BV4A 2VUDA 5DAPA 1RTVA 2YPJA 4DUWA 1W8WA 1ZNPA 5FLJA 4BDVB 3AP9A 4EQVA 5FYBA 1SLBA 3PVEA 3IIIA 1ZA4A 1DYPA 1OOPA 3ZYGA 2GNBA 4LBMA 2A6YA 2WABA 2X09A 3D6EA 3IZOA 2B45X 3ZFFB 4FI9A 4JGZA 3TBDA 4AK3A 2ORZA 1UMIA 2H0BA 2VMGA 3QD6A 2OUHA 3VZKA 5DDJ3 3PJQA 1OFNA 4CCLA 4CEYA 1RHI1 3T09A 5A6XA 5IK4A 5KC6A 1D0HA 1J84A 1IS3A 3J4UH 1EAH2 4AI9A 4D6QA 5F39A 5FMOL 2VO5A 4Z2AA 5JLVA 3DV8A 5IJRA 1UO9A 4AHWA 2I2SA 1BBT1 1PK6C 1W6OB 2EXIA 2NM1A 2VZOA 3AL6A 4BA6A 3CBNA 4Y24A 2Q1ZB 3O0XA 4MSVA 1FMD3 4I0AA 4YM3A 4CCJA 2VG9A 3WP4A 1RUF1 3CJXA 5ISLA 4XCBA 1ZZ6A 5DG1A 3OUHA 2RJ2A 1V6IA 1O5LA 4RQPA 1HX6A 2B9UA 1AR71 1VBD2 2PTMA 3N35A 5D8AB 4QKDA 5LRRA 5AC91 4W6YA 1HXS3 5A3OA 1ULOA 3VD5A 5J37A 4RS5B 4CCMA 3RZKA 4CCNA 3LFMA 2JXAA 2E32A 5FXVA 1O5UA 3AYEA 4YPJA 3ZSEA 3HMYA 2BOJA 2PHLA 4GULA 3OUJA 4HETA 3U11A 2Y0OA 4RQPB 5J36A 5L7OA 1AYN3 1CIWA 4WVMA 4HOOA 4WVMB 4ZXEA 3WD5A 1MQTA 3OG2A 1BMV1 4LLFA 1Y9GA 2DYCA 4Q4Y3 4BM8A 2KR2A 2KD7A 4O65A 4H14A 1PX3A 2W92A 4YZ2A 4CPBA 1RHI2 3CJIC 3I2FA 3OJBA 4IE0A 2XJSA 3MUZ1 3GBWA 3HBKA 1LOAA 5A7PA 1W8NA 1QEXA 1RXFA 5GLVA 5A1AA 4KWKA 2R16A 4WM8C 1XPWA 4IE7A 4A45A 3AX4A 4LO4B 4CDQB 5C9AB 5I8TA 4YM1A 2WIIB 4MUVA 2QZ3A 4NHYA 1RUE3 3I4IA 4GMP1 1W2AX 2XJTA 4PT6A 4L9BA 1ZRCA 1FYUA 3O14A 4Q26A 2IXHA 2RDSA 1TMF1 1BEV1 1YO8A 1H8TA 1A34A 4IESA 3UT0A 4CU8A 2D7FA 2WO7A 5FYCA 5M0TA 2XKPA 1U0AA 1UKGA 4IXLA 4LKEA 4MH0E 4XVHA 4HPKA 4LUMA 5JCTA 5LA0A 1HB1A 1ZZCA 5C3PA 1W6NA 2PHUA 5I0DA 2G9GA 3E6DA 1DGLA 1HN0A 3PUIA 4QD2A 4QGMA 5F6LB 2YFUA 2DU1A 2QFEA 3VD9A 3VDAA 4YZ4A 4Q4W2 3ACIA 4AFBA 2YHJA 3UKNA 3R4SA 1ND2B 1OFSA 2JDKA 3B02A 2VVFA 2VNRA 2R0HA 4PLMA 1RUH2 4EJRA 1JHNA 1V0AA 2D3SA 2CDOA 4AQ6A 3KMHA 1RUG2 4P9LA 4CU6A 4JTOA 1W3XA 4BQWA 4I3GA 2DVFA 4WVVA 3MLLA 1TMF3 3Q8AA 4A41A 2XHKA 2XR4A 1HDKA 2SLIA 1KEXA 2Q8OA 4C90A 1CONA 2FQPA 5JIUA 3H42B 1RL3A 4CEYC 4BHPA 1SFYA 4AEDB 2WWJA 3CJIB 4HLTA 1F4AA 4Q0QA 4D6RA 1S2EA 2JDNA 4COVA 5FIXA 3PURA 5A3UA 1W04A 1X8MA 1R1A1 1QWRA 1S0EA 2WYFA 4YG6A 1RMU2 1YJKA 3RZZA 3WDUA 2CDPA 2ETEA 4DUVA 1UY2A 3VDDB 4JGYB 4OFGA 4XDQA 2J1EA 5T5LA 3RZLA 1XSRA 1UX7A 3GBGA 2DCJA 2RS52 4Y1ZA 3ST7A 4YWAA 4ZY9A 3O1UA 2XVLA 3KD4A 2JDAA 1RUI3 3MF6A 3WLUA 1H2LA 1DQ2A 1GLHA 2WNVC 3A0KA 1N47A 1XJAA 3IDBB 3LOIA 3M3QA 5FQ0B 4W50A 4YYOA 3WW1A 4N43B 1K3IA 1LHUA 1WW6A 3HNMA 2Z2SB 5JSPA 1HRI1 3MIFA 3KF5A 2AC1A 5JZGC 3WQ1A 4J1WA 1XNTA 3SEPA 4JC1A 4LIUA 3RZJA 1UYYA 2WT2A 3VBRC 3B5LB 5CKNA 1ZBA1 1AR83 4YM0A 1JYNA 3VBUC 5K0UC 1DCSA 3E5XA 4LOSA 4A6OA 4Q2FA 3OD4A 1OUXA 2XJPA 3AL5A 4RHV2 1K12A 1WW5A 1TZOA 3NAPA 3QACA 2GNDA 4MV2A 3AKSA 5FZ7A 1Y9QA 2VMIA 1UZVA 2VCCA 2ZGUA 3HN3A 4XXPA 4QQPA 5A7QA 4P00B 1YIPA 5BNOA 3B3QE 4AWDA 4GJYA 5C5TA 5CAZA 4Q4Y2 1VBC2 5EQUA 2ADDA 1MZ5A 5DAXA 1OOPC 1W6MB 1KDKA 4FPGA 4NRQA 4XUQA 3WG3A 2BVVA 3KVAA 1GKBA 5FY7A 2HWF1 1RJ8A 5JR7B 1RUD1 2B42B 4DUXA 4LE4A 1H0BA 3ZM8A 4PDWB 3WF3A 1CGPA 3DXUA 4ES9A 2UYAA 1PIV2 1QJY1 1UY0A 3ZFFC 4OZOA 2VZ3A 4WM8A 5ABJA 1TG7A 2X10A 4YVWC 1GYKA 4MX3A 1POQA 4CYDA 3HBZA 1W0PA 1FV2A 3VBFA 1J83A 4M00A 4UWDA 2JG8B 4R9CA 1BJQA 1US3A 1H2MA 4IQPA 4CA9A 5C33A 5F5IA 3J9SA 4AVBA 5JI7A 1LEMA 2ZCWA 3POIA 4LEJA 4XZUG 1CIYA 1LGCA 1VBA1 4AFCA 3ZYRA 4B7KA 3HT1A 3OOXA 5LATA 2BDRA 3FFZA 3I3DA 5A70A 1O59A 2OQ7A 5JOYA 1S0CA 4XYXA 4XUNA 1PO13 2J1VA 3USUA 4LOTA 2HEVF 5I0SA 2R32A 5I93A 4P5YA 4QX3A 4FXGB 4CDWA 1YIFA 2XL7A 3NNJA 1R1ZA 3VBUB 1MEC1 3LWCA 1CD3G 1R081 3SKVA 4XILA 1VMJA 1QQP1 3IB3A 5LK7B 3N7KA 3NNMA 3U1XA 5BYNA 2JEMA 1COV2 2VBBA 1B35A 3T0DA 1JTZX 4QMAA 4Y5Z0 4KWUA 1ZVFA 2ORXA 5IK5A 1GBGA 4URAA 2RDRA 4IV3C 1BBT3 2VJXA 4XMIA 5T55A 1UYZA 3POSA 4ARXA 4LO5B 2W39A 4OHVA 2E9QA 2WS91 3FHAA 4YW6A 3RPQA 4QM8A 3JBG3 1M06G 4GKYA 5LW9A 4QU1A 1GR3A 2VL4A 1W9SA 3H3ZA 2WFF1 4UI9L 4WZFA 3VKFC 1ZRFA 5FP9A 4YLZA 1MACA 4LXLA 3H50A 2R49A 4FQZA 2X05A 1LHVA 1S0GA 3CEWA 3LEGA 4V1PA 3VKOA 2J7MA 2VMCA 3UJOA 4BB3A 3VBSC 2Q1MA 3NJYA 4CCKA 4NRPA 3O1VA 4KGQA 3BODA 3I8TA 3IPVB 3FLRA 1GOFA 5ACA1 4HANA 1BK0A 4HPKB 3M7AA 5A1LA 4AI0A 3VZOA 4CDXC 1QJU3 3K4DA 2P6HA 3OBAA 1PGL2 2RR11 3ACLA 5JI9A 2ZGSA 3F2ZA 4P02B 5L9VA 3LIHA 3ZPYA 2VBDA 4Q4W3 2WJSA 5C8CA 2HWB1 1QJEA 1S1AA 4MGYE 3VGIA 4Q4Y1 5A7WB 4QPGA 3LPFA 1Q8SA 2YC0A 4MADA 4AEDC 1R082 2DFCA 1UL9A 3U10A 2ZEZA 3K3OA 3JUUA 5IK7A 2P3IA 2R062 3AM2A 4K1ZA 4QDQA 3TB0A 1W06A 3T1MA 1PZ7A 2WC2A 2PAEA 5F6KA 1UZZA 4YNIA 2AZ5A 4G9SB 4RL7A 1JI6A 3N9OA 1D4M1 1V9U3 1O3QA 2R073 3U37A 4Y22A 4IV3B 2Y60A 1NOVA 2JIGA 2RM23 3A22A 3PHMA 3K77A 3VBHC 3DYMA 2G9ZA 1H9PA 2G9FA 3M8LA 4QB2A 2C9KA 4FPLA 4EROA 2IXLA 3TYJA 1RUJ1 3UETA 3GZEA 5ACA3 5JOXA 5L19A 2ZGRA 3TWIA 1QJU1 5A7SA 3HPNA 4FPOB 3IKWA 2XDVA 4I0BA 4CDQC 1KRIA 4LNVA 2W5FA 5IVBA 1JUHA 3BU7A 1RUC1 3D82A 2BWCA 4CZSA 3NMBA 5FZHA 3VBFC 4CDWC 2H6BA 4RGKA 5J48A 2VZPA 5IFPA 4AOCA 2DUQA 3I3QA 4UF0A 4XETA 1UNBA 3RVHA 2HWD1 4FFFA 4P08A 3UGFA 3ZFFA 2IZWA 1IQAA 2KM2A 2D40A 3ON7A 5IVYA 1OA3A 3AVRA 1BXHA 3AMHA 5K8SA 2VOTA 1L7LA 2ZX1A 1ZZ7A 1GNHA 2VZUA 3WNKA 3ZYBA 2EIDA 3AZYA 3U07A 1JOPA 1LODA 3ENRA 3PU3A 3ZFGC 1V9U2 2C4XA 2Y6KA 2VOVA 2Z79A 3OPTA 4HT1T 1F5FA 3W59A 1UZ0A 5T52A 4RS5C 1MS0A 1P8JA 4QX0A 4Z2WA 1F4HA 1SDDB 1OLRA 1X9PA 1JW6A 3MF9A 5FUIA 3MIGA 2VMFA 2WR9A 1V6OA 2QQLA 4I02A 2D43A 2VZVA 5K0UA 4YW4A 1MEC2 3X29B 1PO11 2VGDA 5DZFA 3VD4A 2VW1A 3LEMA 4AXOA 4QGNA 4JZRA 4Y5TA 5GLUA 2ENRA 3KLSA 1UYPA 1W2UA 5EJ3A 4X6RB 1ZBE2 5CYYA 2IVIB 2BBAA 1H1MA 2BNNA 1QGLA 2RM22 1C8M3 3IMNA 3TAYA 4Z07A 2A6WA 1BVP1 1PO23 2ZA9A 5FYZA 1OOPB 3F95A 1IOAA 3RYKA 5AFBA 4AAXA 1O8PA 1WLDA 5CU1A 2FCTA 4DOUA 1TME1 1J3PA 1PGW2 5IWFA 1VBA2 3CF6E 1PX4A 3WXPA 4EN6B 3G7DA 1J1LA 4GIQA 3N4MA 4GKXA 4BXSV 5C3OA 2IVJA 1NCQB 2ZAAA 1JXNA 4NWVA 3KGZA 4JTNA 3EYPA 3SCHA 4HZFA 4TLGA 1OD5A 2A3WA 5IVEA 5KHIA 2E7QA 3MLKA 2BNMA 4B4QA 3W21A 1RUD3 5F32A 3V64A 1PVC1 1YQ6A 1ULCA 2ATFA 3RMYA 3EHKA 1STMA 5GJ6A 1DYKA 2YBKA 4E2GA 1F8VA 1MEC3 1UQXA 4KU8A 2BWAA 1HV0A 3D3AA 4I0WB 4P9WA 4CDXA 3VL8A 1UPSA 2QE3A 2ZPXA 1WCDJ 1AR63 4M0HA 4NHMA 1DP0A 4AE2A 4UBHA 2A3YA 3ECQA 1UMZA 4BQ1A 1CVNA 2F6BA 2DTYA 4R9DA 1JYCA 1WW7A 2EA7A 1F9KA 2W0XA 3POFA 1EV11 2YC4A 2LM3A 2WKKA 4CUAA 4COWA 4UFJA 3S6PA 1RUOA 4LA2A 2QQWA 4RQPC 3WHUA 1DLCA 1ND3C 3DEMA 3JB4C 3HVDA 3JBG1 3TEXA 5KHGA 2OPKA 4JHTA 4OUMA 4Q4V1 2AACA 3AP6A 2R072 5FUPA 3K4AA 2ZTNA 4JAAA 4B1MA 3M3IA 4MGTA 1NLQA 2WA4A 1AX2A 2JG8A 1IG3A 1YCIA 2DFBA 3KB5A 1CWPA 3AMPA 3N9QA 4RR3C 1DF0A 4QWNA 5E6HA 3VBHA 4Q4V3 5C8CC 3RZGA 3DECA 1R083 2Y6LA 3OY8A 1JYWA 4EZ4A 3VB9A 4FCAA 4OMDA 1PMJX 4CTEA 3RNSA 3GHNA 3N7MA 1YQ2A 3Q8FA 5DZGA 2VMEA 1NCQC 3LDKA 5K7PA 3CJIA 5D2AA 5A3MA 4LBKA 4ZZ8A 1W8TA 1QF3A 1YLLA 2ADEA 4H55A 3N7LA 3IDEA 4YVSB 1I5PA 4Y1XA 3BI3A 1N3OA 1PK6A 3PUQA 2MEV2 1CAVB 2EICA 4ZXKA 1OD3A 3WSOA 1A3KA 1N3PA 1JODA 1WCKA 2RMU3 4Y20B 4YGEA 2VOKA 4S2DA 2Y34A 1XBFA 3TN91 2RS33 1D4M3 1V9U1 3J8F3 4NAMA 4U36A 4KWLA 4K6BA 3VBOC 3ZVXA 4D6SA 1W6QA 2F17A 1CPNA 1WGPA 2CYFA 3NVCA 4QPGB 3BTXA 5IW0A 1UOBA 4FAHA 1RUG1 1Q8PA 2JG9C 1E5SA 3TN93 1OPOA 3NJVA 3LD8A 4KH9A 3S30A 1KS5A 3SCGA 1OLQA 1AUYA 1W8OA 4PIYA 3WUDA 2EIEA 4CVUA 1HXS2 1US2A 1LRHA 4FT8A 3LCPA 3LAGA 2GMMA 2BBVA 2YGLA 4N8MA 1DGRA 5D8AA 1AR93 5LA1A 5CFCC 1HRI2 2QQOA 4LKFA 4KBZA 1DG6A 1S0DA 1D2QA 1RUC3 4ATFA 4PI0A 1KFXL 5LWBA 3POYA 2D3PA 3J7LA 5IAXA 1VP6A 1CR7A 3Q8CA 5I0RA 1RXGA 2RE9A 2MNGA 3CU7A 1H4GA 1OF4A 5EPAA 1QNYA 2L9LA 3E5QA 2VOWA 2PHTA 3ETPA 1AJKA 4K3UA 2NMOA 2PLV1 2OW4A 4SBVA 1ND2C 1OQDA 4Q4X2 5C7GA 4JGYA 4Q0UA 3MICA 4AFAA 4DMIA 4HKLA 4JDNA 4PLNA 1F15A 1N1VA 1UW8A 1AL21 2Q30A 4NJ4A 1JZ8A 1WBLA 4W4ZA 3P1IA 5BNNC 4BQ3A 1OLMA 2TNFA 4H2AA 5JXGA 4Q0PA 3TN92 1HQLA 1LEDA 5G04L 5A7WA 4YW5A 3O1RA 4XCAA 4E8DA 3HR9A 5A6QA 3ZFEC 3MEPA 2FHRA 3OY8B 1B09A 1ULFA 4JX0A 1V6JA 2DURA 4PCRA 2E7AA 1W05A 2VQ0A 4HL0A 3T2OA 3WDTA 2ZX4A 3VDDC 2YC2A 2RS51 1EV12 5LRSA 3W9AA 5IT6A 2JB8A 4I30A 5KXEA 1W2NA 3MPPG 4V2VA 1KGYA 3DF0A 1GQHA 3KT1A 4S2FA 1PIV1 4LITA 1T6BX 4DINB 2OX0A 2XGXA 4P9XA 1W3VA 1G9FA 2HYKA 5B2GB 5I8YA 1CAVA 1FV3A 2PYTA 3HQUA 1LOEA 3T4HB 3J7MA 3WNOA 2IXKA 3WZ1A 4QDRA 4HVQA 3S5AA 4B29A 4Y33A 3OBRA 3BGAA 4BQXA 4QPIA 3I3BA 3B9IA 5EP9A 2HWB2 3A21A 3LIGA 2EALA 3ZFGB 5KR7A 1NQJA 3AYAA 4OULA 2E63A 4YGDA 3ZKUA 4OHYA 2BERA 2Z69A 1OXCA 3DYPA 1C5IA 4Q1RA 4DQAA 1LAJA 1QQP3 3JQWA 4FTBA 4ISQA 4L99A 2E7TA 3VKMA 2RS53 2IFRA 1D0GA 3LA2A 1TE1B 1K5MA 3AFGA 4IV1C 3SHRA 5A33B 4JCKA 4AYUA 3POWA 1NE4A 1A6CA 2D44A 2WZEA 1ZZBA 1SBFA 5FZ6A 3MV01 4EZHA 4HVOA 1IG0A 3ZFEB 3KHBA 2FDJA 2Y6GA 3K48A 4R4XA 5DABA 3U14A 1RC6A 5DZEA 2WQ4A 2BFUS 4TN7A 3IT8A 1BLZA 3UGGA 1NYWA 3NV1A 4KL1A 1JZ5A 1QXPA 5ANNA 5JMCA 4N53B 3AKPA 5FZLA 2Z42A 5KHJA 2RDNA 3GZTB 5FZBA 1FPN2 2VW0A 2FDGA 1NA1B 2W52A 3R0RA 1UWWA 2OS2A 4BIOA 5JOWA 4IERA 2QDRA 1V6LA 1VBD1 5JPNB 5I8SA 3ZYJB 3THCA 2AUYA 3DGTA 3O0VA 3VBSA 3O12A 5E8AA 4CP1A 1JZ2A 4MXVA 4C1XA 2I74A 3RMXA 5GZCA 3M3OA 1L7RA 1X33A 3LKJA 1NXD1 4QHZA 3IAQA 1K45A 3OBZA 4BK4A 2B4KA 4BQ4A 3AYDA 3EO6A 1B35B 1Q8VA 4G4FA 4CCDA 1VPHA 1VBE1 5CKMA 1BEV3 3RFRA 2DCYA 5DUUA 1E5IA 1H1IA 4XUTA 4KNCA 4PBOA 5FLHA 1NCQA 1SLIA 3AJZA 3GJAA 4AI1A 1C8M2 2AYHA 3E97A 4QDSA 4R4ZA 5C6CA 2E31A 4AVVA 1UU4A 4H3WA 5FWJA 3LGRA 4JQTA 2V09A 4FFGA 1IZ3A 4O9GA 4OQ9A 1ZBE3 5H9SA 3WG4A 1NG0A 1H2KA 2HWC2 2QQIA 3PIJA 4NIIA 1I1EA 4CEYB 4DPNA 5J7MA 3WP3A 5FWEA 1CZTA 2RDQA 1D2SA 1HQNA 1YYNA 2ZGQA 2D6LX 4NN0A 4AEDA 5EJZB 2C9AA 1X50A 5LB6A 4TXWA 4CXWA 2QZ2A 2D5HA 4CXYA 4S2HA 1S0FA 1FX5A 4Y1VA 5A32A 1V6MA 2BRTA 5EXOA 2VPVA 3KGLA 2VCBA 1RUG3 5DAVA 2GC0A 3M2MA 1XQNA 5K4LA 3SH4A 1XE0A 3VBFB 5EIYB 1POV3 5LA9A 4BMEA 1XE7A 2XBO1 2UWAA 3ITQA 3ZFEA 4BOWA 1OURA 1O4ZA 5FLIA 3AMQA 2EAAA 2VQUA 1VMFA 1FOD1 3FBYA 4XIKA 5LK5A 2P3JA 3MYXA 2C5DA 2DVGA 5FDBA 2K2SA 2RR13 3QH6A 2PHWA 3NV4A 1WMFA 3OD0A 1ASJ3 2YU1A 4MZUA 4ARYA 3BOPA 3VDDA 4CP0A 1G9DA 3HQRA 4Q29A 1V6NA 2PHDA 1OLME 3WV6A 1BEV2 3FC0A 4FP2A 2WWSA 1LR5A 4AFDA 4AEKA 4QKBA 5JSOA 4LLOA 1DQ6A 4CCEA 4YARA 1RUJ3 4GWMA 1GQPA 2D6OX 1UAIA 5FMCA 2WL1A 4XTPA 4RHV1 4IE4A 4O9EA 2XUEA 5FAXA 1LHWA 4RS5A 4W6WA 1RUE2 1BMV2 2VM9A 4N53A 2XVKA 1AYN2 3D0SA 1CAWA 2JKBA 3T2QA 3RDIA 1W28A 1ZRRA 1UY3A 4PQQA 4XAAA 2QVSB 1U12A 5DXDA 4CCOA 1HKDA 2QBXA 4OUSA 4DS0A 4LT5A 1AVBA 4EWAA 5LZ6A 1X36A 4F3JA 2YB7A 2YYOA 3RRDA 2VVDA 3MBWA 1QIQA 3AFKA 3SNMA 2YU2A 3I7DA 3ORJA 2V4VA 3MO4A 2O8OA 1REDA 3RJ2X 1EPWA 1W99A 4YVWB 1JZ4A 1Q8OA 1Q3EA 4HG6B 1WUVA 2J22A 2WT1A 3RJRA 5DUWA 3OBTA 4HFSA 3UGHA 3OGRA 3ZFGA 3NQHA 5CFCB 4DRRA 1FMD2 5CIRA 5CFDB 1K5JA 2H0VA 4KI5M 3RWKX 4AVSA 1CAUA 1Y43B 1TVGA 3UL2A 1LOCA 5J96B 2FDFA 1OPMA 4E4DX 4MYEA 5FZOB 3URFA 4O7XA 1GWKA 1N1YA 2ZHLA 3ZXEA 5C4WC 1CX4A 2CGPA 1H9WA 5HBAA 3PDQA 4FOQA 4J1XA 3ROUA 1G9AA 3BU0A 5FZDA 3HAGA 5F3CA 4UF0B 4QXBA 3GBFA 1QY4A 2VTXJ 1HRV2 5IVJA 3VD3A 1C28A 4AGGA 1O3SA 2ZKLA 5L7OB 1WCUA 1T2XA 2CY6A 1GZWA 4Y26A 4J6GA 4AHZA 2WWUA 3U4XA 5BV6A 4A7KA 4OVEA 2G4IA 3BTYA 3WCRA 5JAXA 2NZ9A 3A23A 2DUPA 4AQ2A 4ZHNA 3KCCA 3I2HA 3LZZA 5L9BA 3SH5A 2VNGA 1GFF2 1A8DA 5B4XA 3UK9A 2V4AA 1EV13 1CQ9A 5BNQA 1PO21 3MV11 1DFQA 1Z0HA 4YM2A 4TSVA 5DDJ2 2C1FA 4XFGA 1CZVA 3H7JA 1YWKA 4MXWB 2JG9B 1LHNA 2JX9A 4PI2A 3S0MA 1LOGA 2A6ZA 2LUWA 3I2IA 3UNPA 2WFF2 2OXBA 5HCAA 4BZ4A 5AVAA 4B4PA 2BQPA 3R4DB 3ZPOA 5CFDA 1NLSA 4RR3A 3I59B 4EN7B 2GC3A 2J1RA 1R64A 3LEKA 3ETQA 3WF1A 3M4FA 2AH2A 3WNXA 1AXYA 3NNGA 4ZS3A 1QDCA 5T5JA 2K46A 4XC9A 3UYJA 5JZGA 1PHMA 2AEYA 2ET1A 2RMU2 3BVCA 1QXJA 4TWTA 5BXXA 1DQ4A 4HVRA 4XBLA 2VOXA 5FFOC 4KGGA 1YC61 2D97A 3H3LA 1L7QA 1AXKA 1SPPA 1LCLA 1R091 4BPZA 3I59A 4OUEA 3THDA 5LEJA 4DZGA 1AYN1 5BNPA 3GM8A 3MHZA 3Q8BA 4D8MA 5JWPA 2VW2A 2X29A 1KQRA 2JE8A 1YUDA 2EIBA 2Y26A 1NZCA 1UF2C 1R093 4RA0A 1SBEA 1V70A 4O61A 2OPWA 2R041 2WZR2 1C3HA 3PIGA 4LHSA 4LTAA 4QU2A 2VUAA 4XFFA 2UURA 1NLRA 1XNBA 2VZ1A 2VE1A 4LK7A 1XU2A 1Y9MA 3WW4A 4QXHA 3FMGA 2A75A 4IEWA 3LSDA 4N43A 5LY1A 3D0JA 3VBOA 4EN9B 5DG2A 4OHWA 3U4SA 3K2OA 5FKBA 5GLWA 3FLTA 1COV3 3CLPA 1GZWB 4N53C 4P9YA 3AZXA 2P1BA 1LESA 5A80A 1MR5A 1W9TA 2R071 5H9RA 1RUF2 1NCRB 4GMP0 2ZGTA 1OKQA 2ZHNA 4XOGA 1GP6A 3USSA 4LBQA 1K42A 1ZX5A 1FXZA 3WNPA 2BNOA 2DCZA 1XU1A 3NW4A 4XF0A 2XBO3 3SMHA 1EAH1 1POV1 5KWRA 1CJPA 4FFHA 2W1QA 3KS7A 4GJZA 3J8F2 1AF9A 5EYYA 5FYHA 4LHNA 3AKQA 1SLLA 1LJ7A 3GXUA 3H3UA 3S7EA 3ZYFA 4BLIA 3RZMA 1VRH3 3GZUC 3W5MA 4IEZA 5FPBA 3W5NA 4OI1A 3RI8A 4OZXA 3NJXA 3CMGA 4NRMA 2BYVE 2DU0A 3J26N 4CDXB 4UW5A 4LKSA 4LBQB 3UESA 2W3JA 1OA4A 3KV9A 4BLJA 3BTZA 2QQNA 4XHXA 4ZONA 4LMFA 5FXZA 3K51A 1XC6A 3ZN6B 4Q4W1 3WNNA 2R063 1RB8G 2VMDA 5FCCA 2ID4A 2YROA 4GWJA 5LBFA 3WQBA 1H30A 1REFA 2CU5A 1XB9A 4FPFA 5CZKA 4YVWA 1DQ0A 1QJX3 2Q5TA 5DUXA 2CAUA 2MPFA 2JDHA 1AR72 2SBAA 5AC92 4JRAA 1XYOA 1XE8A 1UPIA 2O0OA 2QDNA 5FZ8A 3IM0A 4ASLA 2RR12 4XBQA 4D7TA 1JMUB 3RGBA 3SEEA 2D6MA 4CEWC 2NP0A 5A33A 1G86A 3ZO0B 5BUVA 4KU7A 4AAPA 2LROA 4XACA 1OC1A 1FOD3 1ODNA 2JIJA 4AGVA 2RJLA 4OI4A 4TLFA 2JDMA 3KT4A 4CU7A 1QH6A 4KQ7A 1APNA 2WQ8A 1TMF2 4GQ7A 4M0NA 3RS6A 1DGWX 2VUCA 4WVWA 3BB6A 5AFEA 2FZ1A 4MO3M 4C0HA 5KHHA 2HWD2 2XB6C 5C4WA 1GANA 1CAXA 5FP8A 1SFPA 3POJA 4Y4RA 3GZAA 2D98A 3QOPA 4UXAA 5BPXA 1ND3B 2DF7A 1AXZA 1RUI1 4KWJA 3DCQA 4UFIA 3FLPA 2WAOA 2PLV3 1EUTA 5CBLA 2PA7A 4DO0A 2JD4A 1O6UA 1J3RA 4UOJA 5AVPA 5EYXA 1MS9A 4XXAA 5HCHA 4XUOA 2QNKA 2JICA 2CWMA 2VVEA 3WINE 3MUY1 4W65A 4BJ0A 1G9CA 3S57A 1SLAA 4N43C 4JV4A 1ZBA2 4QPIC 4NIDA 3AYCA 1KITA 1URXA 2Q1FA 1VBE2 1FNZA 3I2JA 3GALA 4QHBA 2ZGLA 3RQ0A 5KC5A 1WMXA 1NZIA 1Y4WA 3VHNA 1VBA3 3MGUA 1W9FA 2AENA 1WMEA 5FXWA 3LA3A 2QQPA 3IDAA 1WLTA 1LENA 3MW4A 4BYYA 1PM7A 1EYBA 2QQVA 3FN9A 3OEAA 5T3NA 3RYPA 3VZMA 1XXNA 2DVAA 5LCWL 1MS4A 2CHHA 4GH4A 3N3HA 5FK8A 3GF6A 4QKNA 5F3GA 3OYWB 4AVTA 4NPMA 1YRZA 1IHMA 3B9CA 2EXKA 5L9RA 4CDQA 5JR2A 1QJY3 3DKQA 1NCRC 4P9IA 4PIZA 1G9BA 1O8SA 4BMBA 3NO8A 1XOYA 1JHJA 1W6PB 3MPBA 4QPGC 3CDZB 1AR61 5IFTA 5FZOA 3BKZA 4FPJA 1UU5A 4UAPA 1IGOA 1W2OA 2WUHA 4BQYA 2CTVA 1RMU1 1RUF3 2VD7A 4QB1A 4D7SA 3M3CA 3IIAA 1NE6A 4LBJA 3PVOA 2JDPA 3KM5A 1K5MC 3NNFA 2PAMA 1VBC3 2GN3A 3MW3A 3IN9A 1BZWA 4UYBA 4XFBA 2VZTA 4BCUA 3I54A 4GB33 4WV8A 1JZ7A 4CCCA 1ASJ2 2P4EA 3BPZA 3KSCA 4XMAA 5FZMA 3SITA 4A6SA 4E27A 1HIXA 2DUOA 1IKQA 4ZU4A 4XZPA 4FTEA 5FPZA 2IXCA 2XPJA 4NUBA 4XFIA 1QJX2 1CPMA 2ZGKA 4R9AA 1XYNA 4UW6A 4COZA 2DDUA 3DPRA 5JMOA 3P6BA 1JZ6A 4XFCA 4B1LA 4EYUA 2J1UA 5LY2A 3OGVA 1RINA 1QDOA 4BQ5A 1WCQA 4NROA 3DL3A 1W9YA 1FPN3 1PNGA 1S2KA 3ZSLA 2BZDA 3CIHA 5G05L 2ZX3A 2BUKA 5LA2A 3ME2A 4GALA 3UV9A 5L73A 3CNAA 1ZBE1 1QJZA 1M4WA 4QXKA 4XF4A 3WDVA 2FDHA 5CNAA 2WSUA 3VHRA 1OQEA 2XOMA 1HXS1 4L0PA 4XF9A 5F2WA 2VMHA 3AB0A 5FBJA 1XNDA 1ONAA 4MGZE 3PMSA 5DQ0A 5JVVA 4XJWA 3SKJE 1WW4A 4GH4B 1ENRA 1VMHA 5FXXA 4I3PA 4I2OA 1VAKA 4FQ4A 3VN4A 2WNEA 3MDPA 1QOSA 5CB7A 2I07B 4MXWA 4AZZA 5F1RA 3IBMA 4AVCA 1J59A 1VBB1 1KFUL 3FJSA 1GNYA 3E6BA 4QXCA 1UN1A 4K8RB 4AVAA 3DKWA 4R9BA 3OCPA 2PLV2 1RIRA 4WBBA 5FPAA 2VULA 4GA9A 4P9JA 3KCYA 2YXSA 1HRV1 3ATGA 3I2DA 1U5IA 5DMYA 4XIOA 1TQ5A 1KS4A 1I5ZA 4LA3A 4XE9A 2ZOEB 3APBA 4ZKTB 1JU3A 2VCAA 2X8KA 1X82A 3VKLA 1PNFA 3ZIXA 4XJ9A 4BXFA 1EAH3 3VBUA 4Q8KA 4C8DA 2PN5A 1W8FA 4YW3A 4CE8A 2KA3A 2ZMKA 2ZXQA 4LK6A 4WM7A 3WHTA 3VV1A 1UXXX 4PF1A 1C1FA 4CUCA 5JDBA 4B4RA 4C1WA 3AXDA 5T50A 3T3YA 4XJZA 4MLOA 2B7YA 4NHXA 3G6JB 5CG8A 3MIEA 2HWC3 2ZBJA 3R6SA 3S7IA 1LHOA 2W87A 1IPKA 1IQDC 1NXMA 1Q43A 2WNVA 2KXLA 4P5HA 4AF9A 5J3UA 4FO9A 3O1SA 1U5YA 4EWEA 4TZDA 2PHFA 3JXSA 5FPXA 3U0ZA 1DGRN 4Q0VA 5C5UA 5IK8A 4HXCA 5A7NA 2HEWF 3N9PA 5HV4A 1HJFA 4A3ZA 3A7QA 1VLNA 1UIJA 2W1WA 2BGCA 2IXJA 3ACGA 2OVUA 1JOJA 4XEZA 4PJYA 2QUOA 1IS5A 2VXRA 3JD71 4IUGA 3VUOA 1O7FA 2BGOA 1YJLA 2ZACA 3DXTA 4RHV3 5IHRA 2EF6A 1X9TA 4L92A 4HN1A 2XJRA 3KV6A 2CSGA 3ELNA 1WKYA 2P6CA 4DXZA 5BNOC 2VAUA 4XURA 3C8XA 3WX5A 3ACFA 4XFHA 3ZIWA 1Q56A 4A7YA 3CKHA 4X8PA 2WLPA 2MEV3 1AHSA 2J1SA 3WOGA 3VZNA 3HOBA 5EWSA 2D93A 2B9VA 1RUJ2 4JQRA 1S2BA 4W8JA 4H7LA 1GSLA 2OIIA 2TUNA 2W91A 5F5AA 3NV2A 3O7OA 4NIAA 5HXVA 3RYRA 5IATA 4KG0A 4RGAA 1MS1A 1ULDA 4R52A 4XTMA 1OVSA 4ZS2A 4PF5A 1DIWA 4QB6A 5ERLA 4YVSC 3UKTA 2WYSA 3RWNA 1I6XA 3B7MA 5I0UA 5BY5A 2IFWA 2DCKA 1YQCA 1JBCA 3T2PA 2JG8C 4CPBD 3DN7A 1C1LA 3MIDA 4DIQA 5C70A 4F8AA 5FREA 3AZVA 3WW3A 1GOHA 1TME3 3AKTA 1ALYA 4AQTA 1NKGA 4NPLA 4PDWC 4NPRA 4EE2A 1SFNA 3JQXA 5DAQA 4C0BA 4GZ9A 4RSUA 1ZRDA 2VXJA 3GDBA 4UFHA 3ES1A 1WLWA 4AFMA 1VE0A 3HN1A 4UW3A 2PHXA 2PELA 5JUVA 3D5OA 2Y38A 2WZPP 1VRBA 1C57A 2YFZA 3LPGA 4RD7A 5FY5A 2FMDA 1SHWB 4Q27A 1VRH2 4E8CA 3MLJA 2FBEA 4AGRA 3NNLA 1AR82 2RHPA 1Z78A 1BKZA 2DBNA 2VZRA 2IXIA 1PVC3 1SBDA 4Q4X1 3WEZA 3ZSKA 3V56A 3THTA 4NR1A 3M70A 4NAOA 1J3QA 5D8AC 5FPVA 4CDUC 4FBFA 1IS6A 1A78A 1CJDA 4IE6A 3TEYA 4OHZA 5C71A 5FK7A 4Q8LA 4META 4DY3A 1ULGA 1DDLA 4IEYA 3K75B 5D1IA 1JH5A 1HN1A 1YFWA 1ND2A 1W39A 1EP0A 3KVBA 2OYZA 5T5OA 1FPN1 2GN7A 1CAUB 1OMIA 3O0WA 5GZFA 5IAVA 2BW8A 2Y8KA 3UJQA 4WM7C 5KHKA 5FZFA 4XQ4A 3ALQA 5FZAA 3IAPA 3C7EA 5LEKA 5FZEA 1PZ9A 2WS93 3KV4A 3TNQA 2HYXA 1J58A 2B5HA 4INDA 5C8CB 1F2NA 2XQXA 4GWNA 2BU9A 1RITA 4K9SA 4CEWB 2GMPA 3L2HA 4NIHA 1YI7A 1KJRA 2DCTA 4PQ9A 2E26A 4AEJA 2A3XA 3P5BA 1OT5A 2ZMLA 5EFUA 4DXRA 5A3PA 5JZGB 4CSWA 4XABA 1OH3A 3FFQA 2WRAA 2WZ8A 5EJ1B 4YZ3A 1J1TA 1W0OA 3A0NA 5FZCA 4OLLA 2ZJCA 2ZGPA 3SH3A 4D0QA 1C4RA 1WZXA 2XUMA 3C2UA 3FL7A 2W46A 2XWJB 1W90A 5CVRA 4FPKA 1JYIA 4Z8BA 5DAWA 1QJFA 1Y3TA 2YZ4A 4QAWA 1NQDA 3PU8A 5JXHA 2V72A 2MHFA 2EXHA 2R043 4HSLA 5GKAC 2UWBA 5FZGA 2P3YA 5A6ZA 3T4VA 3T30A 5BNNA 4K8FA 1JYVA 2FMYA 3ZYIB 3PMEA 2WFF3 4COYA 3LDBA 3BN6A 3ZXKA 1H4HA 1HJGA 5FY8A 4YZ1A 2RS13 1RJ7A 3POEA 4UFMA 2A7AA 2RS11 4QPIB 4KBBA 5EZWA 2ARBA 4QKFA 2YBPA 4OHXA 4WM7B 3B01A 3QBQA 4GAZA 1O91A 1HB3A 3FUQA 3H8OA 4HK8A 4DEQA 1IPJA 5HI0A 1AL0G 2ZS6B 2XLAA 5E16A 2OQ6A 2G1MA 1FNYA 3PVNA 4XF3A 2VZSA 4CDWB 1KD7A 4LE3A 4XJUA 2HWC1 3AZWA 2JDYA 5FMOS 3PTYA 3LSEA 5FP4A 5IUQA 4IGPA 1GU3A 1O4TA 2P3KA 1AR62 4J25A 3TRSB 4E4HA 1S0IA 1UOJA 2P37A 2Z5WA 1ENQA 1UYXA 2D6KA 2C24A 2WO1A 3WNLA 2GP3A 2RG4A 2VQTA 4OCTA 4FTSA 4CEWA 4ET7A 1EY2A 1G7YA 2JKXA 3V65A 2BPA2 2WNUC 5IVCA 1E57A 2HH9A 3ZXAC 5HPOA 5A3NA 4HN0A 4XDOA 3RSJA 4IGOA 2WFPA 5FO8B 3T0AA 1OBNA 2DV9A 5FYUA 4XAEA 3RZHA 4HSJA 1DZRA 4XQWA 1VB4A 3WUCA 1NY72 5FUNA 2JE9A 4NMIA 4DB5A 2B8MA 4BE3A 3H0OA 4IV1A 4GWIA 1QU0A 5FYIA 3O1OA 3C7FA 3ILFA 3FBMA 4YSFA 3O1TA 4AI2A 1LULA 2UWCA 3SXWA 5K9YA 1LU2A 2JDZA 1JN2P 3H8RA 2XONA 4IEOA 1AZDA 1R1A3 3ZMNA 3TNPB 2GH8A 4LORA 4NIGA 4QQHA 2WLQA 3FX3A 2VTFA 1RYYA 1W0NA 3MFCA 3C3VA 2MEV1 1SQ4A 1UZYA 1WA6X 4Z1VA 3GGLA 1GZTA 1E5HA 3JBG2 4OMCA 4N7IA 1N1SA 1RVF3 1JYXA 1CAWB 1WCSA 2VECA 3BIEA 3ZX7A 3N9LA 2GC1A 2X5IC 3CQOA 3C7OA 3HWJA 1LOFC 4A4AA 1PMIA 2ARXA 3MIHA 2ZEXA 3VZJA 1HRI3 2JENA 3NRUA 3PNAA 3H7YA 3KZ4C 3T2TA 2XHNA 1DHKB 1AJOA 5FZ0A 3I2OA 2D5FA 2HLEA 3K3NA 4A42A 3SISA 2DTWA 2CV6A 2GU9A 4N9HA 1CAXB 2D3RA 2CNAA 1OUSA 2ZAHA 1XNCA 1F35A 4B3NA 3ZDSA 1TNFA 5FYYA 3I97A 1XNAA 4FP3A 1AR73 5AC93 1MVEA 1IKPA 1OA2A 4GH4C 1VR3A 2BOIA 3W58A 5FBZA 2W1UA 4UT5A 2HWE2 2WN2A 2JECA 2R1DA 2Q4SA 3KF3A 4IV1B 4FOWA 4BWOA 4RN5A 4V2WA 3WCSA 2GZWA 3FUOA 1RVF1 1UY4A 3BIWE 4YG0A 2Q8DA 4D7YA 2A1XA 1QXRA 5ABJC 5SV5A 3IMMA 3NKGA 3LQCA 5F3EA 3UKVA 4OQ8A 2W68A 1PO22 2NYYA 4Q4X3 1KJLA 3OYWA 3KQ4B 2A5ZA 3WF2A 1VB2A 3GJBA 1PZ8A 3ILNA 3I49A 3VDCA 3OGSA 1DYOA 4LUKA 1UD1A 2VNOA 2E33A 5DN2A 2ILMA 2ZEYA 1WA4A 2RJKA 4MGKE 4DEVA 2VR4A 3AC0A 3CZJA 3PUAA 1YFXA 3GCWA 4Z82A 1GZCA 3TOJA 4U2AA 1SDWA 1R1A2 4QPWA 3TEWA 1AYM1 5IYYA 5E1RA 5KXDA 1G8WA 5FOBB 4Q0SA 4DXSA 4E4ZA 3V0BA 4F83A 1AR92 2LTNA 1I3HA 2QTWB 3R4UA 1GP4A 3ABZA 4PIXA 5FYSA 1SLCA 2RS31 1PM4A 2YBSA 3POGA 3VBRA 4BU2A 4L11A 3T1LA 1UZWA 5T5PA 2EVXA 5JXIA 1MS5A 5KBFA 1GUIA 1TME2 3OPZA 1K5MB 4IETA 3ZXDA 1B35C 2P34A 1A8MA 2QQJA 1O3TA 1FATA 3JZVA 3H9AA 4IEUA 3N9MA 4PLOA 4E9KA 1EPZA 1GMMA 2FZ2A 2NN8A 2D6NA 4W6XA 1CZSA 1YFUA 1OVPA 2GAUA 5FOJB 4JKKA 2O1QA 4CDUB 1TEIA 2Y6HA 5ABJB 5JSRA 2WO3A 3AVSA 5C4WB 2WDBA 3DPRC 1SPPB 2GMEA 3E1F1 3WF0A 3AP4A 1NAEA 4AQSA 3LE0A 4L97A 4YG3A 3U78A 3ZLIA 3RG0A 5IVVA 5I0TA 3PJYA 1O3RA 2QQMA 2UY8A 2PQQA 2UYBA 3AP7A 3THPA 1HB2A 3AMNA 4JDMA 2OT7A 5E89A 1MQTB 4B7EA 5SV8A 4ZZ5A 1DBNA 4BH9A 2RM21 3JB8A 5IVFA 4Z92B 4F7ZA 4LBQD 5H9PA 2QJVA 3WDWA 4RGGA 4AL9A 2R042 1MPXA 2IC1A 2W1SA 2PQSA 1PGSA 3J8F1 3O1PA 4MG2A 1QJU2 2X5IB 4IW3A 4FVVA 1T6GC 3B94A 1H8VA 3KV5A 5FP7A 1G6NA 4YZ5A 5TSWA 2GSYA 4Y3OA 2HWB3 5FPLA 2JJ6A 2VC9A 1Z7S3 4BQ2A 2ZEWA 1WBFA 2VY0A 2E53A 5D21A 1QMJA 4QHOA 5FYMA 1LNSA 3BALA 4HKWA 1PVC2 1KXGA 2XLGA 5L36A 1SMVA 4M01A 1Z7S1 1LOFA 2WINB 4ISRA 3S5QA 1VJ2A 2N7GA 2J42A 2XKOA 5CEHA 3D8CA 3JD73 4XJAA 1BVVA 4XPVA 3O1MA 4CRQA 3ZDVA 3WNMA 5FYTA 5LBEA 4A44A 1O4YA 5F5CA 4EV0A 2YDEA 1NY71 4XQDA 2BTVC 2R0FA 4IV3A 4D3WA 2E6VA 3HEIA 2A6VA 4XHBA 3WQ7A 1QHDA 1W03A 2YUEA 3CHXA 3DPRB 2YY1A 2XJVA 2BEOA 2ZHKA 3H1MA 4AEMA 1FT9A 1HW5A 1ZYBA 2WAAA 1VAMA 2HWE3 3MZHA 1H2NA 1OHFA 2HWE1 5A3TA 4HKOA 2B39A 3N9NA 5FJKA 1DQ1A 4TYSA 5F2SA 5J98B 3PUSA 4FPYA 5FY0A 1W6NB 4Y1UA 1QH7A 4QX2A 4YFWA 3J7NA 4YW2A 4M4RA 4IE5A 4X8NA 2GDFA 1PVXA 1DQ5A 2RS32 3R05A 2IUWA 4H7MA 2W95A 4JKLA 2Y0IA 3GYDA 5GZEA 1FAYA 2ARAA 2RVAA 4IEPA 1U5ZA 3V0AA 3IPVA 2FD8A 4G3YC 2XWBB 3J7HA 1F5JA 4PDWA 2IWGB 2DVDA 5F9TA 4LBNA 4Q1PA 1S4CA 5FMBA 2FDKA 1FI2A 1YXWA 5HCFA 4I01A 2XL9A 2C6SA 2VZQA 1D4VB 3C7HA 3EMRA 2UY9A 2YV8A 3OUIA 4HMZA 3Q9OA 5ACA2 4Y1YA 5A3LA 1CX1A 2WNUB 1GICA 3H8XA 4LIVA 1AX1A 2W2IA 3N7JA 1BQPA 4ITCA 4ONUA 5C3RA 4QQ2A 1BHGA 2ZGMA 2YPDA 2XJQA 4LR4A 3VHOA 1VBD3 4M3CF 1JYTA 3SCFA 4NHLA 5APAA 5FV3A 3ZN4A 2XLFA 3GCXA 2GC2A 3KT7A 1JU4A 4K7JA 1HB4A 1BK1A 2BP6A 1YNAA 3NKTA 3DUIA 5GLTA 3WDYA 1VBC1 4A2UA 2HKXA 5H9QA 4YVSA 2Q8EA 1N3QA 3WW2A 2PHRA 4BIFA 1W6QB 2BFUL 4GB32 1QQP2 4OI0A 1NA1C 5FY1A 5GZGA 3OPWA 4UBGA 5BNPC 2CAVA 5A6YA 2VBPA 3CZUA 4XDPA 5FO9B 5FR3A 1VAVA 2V73A 4Y20A 4Y5SA 5A32B 2GH2A 3ZN6A 4ATEA 3MW2A 5FZIA 1X7NA 3ZR6A 1H1AA 3IDCB 1HV1A 2WNVB 3BUCA 4PHZA 5C9AC 5E88A 1XRUA 1W8HA 5KXBA 4CUGA 2E51A 2PAKA 5FZ4A 1RUI2 2W94A 4UFLA 3VBRB 1PGL1 3E6CC 1SCRA 2P17A 3SC7X 1AYM3 1H8TC 4LBLA 5ANQA 2CL2A 5FYVA 1ST8A 2R30A 4QX8A 2W47A 3FE5A 4L2NA 4CP2A 1GQGA 4QM9A 3WDXA 2XQRA 1SCSA 2WSVA 1IPSA 2OUJA 2QKDA 5GM0A 2J1TA 4URTA 4NO4A 1W6OA 3WP5A 3D4KA 5EHDA 4LHLA 1ZZ8A 1I9RA 2HBTA 5DPNA 4IEVA 2JDUA 4C91A 2BGPA 2TEPA 3ACHA 1BCXA 1NT0A 2B46X 3VBOB 2ZZQA 1F31A 3HJRA 4L8QA 1HLCA 2A70A 1OKOA 2AREA 4ZPIA 1ZREA 2P2KA 1MQTC 3BYWA 3P3NA 1ASJ1 1VBE3 1ODMA 3VZLA 2EIGA 4NHKA 4RFT0 1RUH3 4WZCA 5JIAA 2ZABA 4Y4YA 4YW7A 2EXJA 4YRDA 1LB2A 1PO12 3WY6A 3RI9A 5GALA 5FO7B 4CUBA 2GNMA 1UOFA 4ASKA 2R061 4QQOA 5FTTC 4FAGA 5JXJA 2XG3A 3GHMA 2UU8A 2Y6FA 1MZ6A 5F37A 1HRV3 5FZ3A 2BVBA 2XJUA 2CWSA 1POV0
chains in the Genus database with same CATH topology
4DIQA 5FUPA 5A7SA 5F2WA 5FP8A 2XDVA 5FBJA 4Y4RA 5FP4A 4IGPA 5K4LA 5IVBA 4E4HA 3N9QA 3ZPOA 4IGQA 4QWNA 5E6HA 5FXXA 5FYSA 5FZHA 2YBSA 4V2VA 4BU2A 5F5IA 4UF0A 5FZ9A 3RVHA 4EZ4A 5FYCA 5A3WA 4LITA 4DO0A 2OX0A 2GP3A 3UYJA 5FY4A 2PXJA 2GP5A 4QX7A 2YU1A 5IVYA 1VRBA 5IVCA 3AVRA 3N9MA 4QXCA 5FY5A 5A3NA 2OQ7A 4XDOA 4LIVA 2W2IA 4IGOA 3PTRB 5FYUA 4Y33A 5FPAA 3PU3A 2YPDA 5FUNA 5FYBA 5KR7A 3AVSA 3OPTA 5FPVA 3PUQA 5FV3A 5FYIA 2XUEA 5FY9A 3U78A 3ZLIA 5IVVA 4HONA 4D6RA 4GD4A 5FXWA 4BXFA 2OT7A 4QXHA 4C8DA 4CCOA 4CCLA 3KVBA 5FZ6A 4URAA 2Q8EA 4EZHA 4D6SA 5IVFA 5LY1A 5FZFA 5F3GA 2WWJA 5F3IA 5FZAA 3K2OA 5IW0A 2YU2A 3U4SA 4TN7A 5FY1A 3OPWA 5FZEA 4AI9A 3KV4A 4D6QA 3LD8A 3PURA 4XDPA 5F39A 2P5BA 5A80A 5LW9A 4QU1A 5FZLA 3KV5A 5FZIA 3N9LA 5FP7A 5FP9A 5FZBA 4LXLA 3AL6A 5A3PA 5FYZA 2XXZA 2OS2A 5FZOA 4Y3OA 5FPLA 4CSWA 4CUGA 5FZ4A 4GJZA 5FYHA 5LWBA 5FZ0A 3NJYA 5FPUA 4CCJA 4CCKA 2VD7A 3K3NA 5ANQA 5FYVA 3N9PA 5FZCA 5FYMA 5A7NA 5FPBA 5ISLA 4QX8A 5IWFA 5IVJA 5A7OA 5A1LA 5FYYA 5FZOB 5CEHA 3KV9A 4LIUA 3PDQA 3DXTA 3PU8A 5FZDA 4CCMA 5F3CA 5IVEA 5FXZA 4UF0B 4CCNA 4QXBA 3KV6A 5FYTA 5F32A 5F5CA 5FJHA 5FZMA 5FZGA 5FXVA 4V2WA 5A7WB 2YBKA 3AL5A 2Q8DA 4NUBA 5FP3A 3K3OA 5FZ7A 5F3EA 3LDBA 5FZ8A 5FY8A 2WWUA 4HOOA 4BISA 5A7QA 2XMLA 5FWJA 5A3TA 2YBPA 3N9NA 3N9OA 4GJYA 5F5AA 5FJKA 5LY2A 4AAPA 4EYUA 5F2SA 5A7WA 4GAZA 3PUSA 5FWEA 5FY0A 3KVAA 5FZKA 5FY7A 4ASKA 2OQ6A 5A7PA 3PUAA 5F37A 2Q8CA 5FZ1A 5FZ3A 5A1FA 3DXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DIQ A;  5FUP A;  5A7S A;  5F2W A;  5FP8 A;  2XDV A;  5FBJ A;  4Y4R A;  5FP4 A;  4IGP A;  5K4L A;  5IVB A;  4E4H A;  3N9Q A;  3ZPO A;  4IGQ A;  4QWN A;  5E6H A;  5FXX A;  5FYS A;  5FZH A;  2YBS A;  4V2V A;  4BU2 A;  5F5I A;  4UF0 A;  5FZ9 A;  3RVH A;  4EZ4 A;  5FYC A;  5A3W A;  4LIT A;  4DO0 A;  2OX0 A;  2GP3 A;  3UYJ A;  5FY4 A;  2PXJ A;  2GP5 A;  4QX7 A;  2YU1 A;  5IVY A;  1VRB A;  5IVC A;  3AVR A;  3N9M A;  4QXC A;  5FY5 A;  5A3N A;  2OQ7 A;  4XDO A;  4LIV A;  2W2I A;  4IGO A;  3PTR B;  5FYU A;  4Y33 A;  5FPA A;  3PU3 A;  2YPD A;  5FUN A;  5FYB A;  5KR7 A;  3AVS A;  3OPT A;  5FPV A;  3PUQ A;  5FV3 A;  5FYI A;  2XUE A;  5FY9 A;  3U78 A;  3ZLI A;  5IVV A;  4HON A;  4D6R A;  4GD4 A;  5FXW A;  4BXF A;  2OT7 A;  4QXH A;  4C8D A;  4CCO A;  4CCL A;  3KVB A;  5FZ6 A;  4URA A;  2Q8E A;  4EZH A;  4D6S A;  5IVF A;  5LY1 A;  5FZF A;  5F3G A;  2WWJ A;  5F3I A;  5FZA A;  3K2O A;  5IW0 A;  2YU2 A;  3U4S A;  4TN7 A;  5FY1 A;  3OPW A;  5FZE A;  4AI9 A;  3KV4 A;  4D6Q A;  3LD8 A;  3PUR A;  4XDP A;  5F39 A;  2P5B A;  5A80 A;  5LW9 A;  4QU1 A;  5FZL A;  3KV5 A;  5FZI A;  3N9L A;  5FP7 A;  5FP9 A;  5FZB A;  4LXL A;  3AL6 A;  5A3P A;  5FYZ A;  2XXZ A;  2OS2 A;  5FZO A;  4Y3O A;  5FPL A;  4CSW A;  4CUG A;  5FZ4 A;  4GJZ A;  5FYH A;  5LWB A;  5FZ0 A;  3NJY A;  5FPU A;  4CCJ A;  4CCK A;  2VD7 A;  3K3N A;  5ANQ A;  5FYV A;  3N9P A;  5FZC A;  5FYM A;  5A7N A;  5FPB A;  5ISL A;  4QX8 A;  5IWF A;  5IVJ A;  5A7O A;  5A1L A;  5FYY A;  5FZO B;  5CEH A;  3KV9 A;  4LIU A;  3PDQ A;  3DXT A;  3PU8 A;  5FZD A;  4CCM A;  5F3C A;  5IVE A;  5FXZ A;  4UF0 B;  4CCN A;  4QXB A;  3KV6 A;  5FYT A;  5F32 A;  5F5C A;  5FJH A;  5FZM A;  5FZG A;  5FXV A;  4V2W A;  5A7W B;  2YBK A;  3AL5 A;  2Q8D A;  4NUB A;  5FP3 A;  3K3O A;  5FZ7 A;  5F3E A;  3LDB A;  5FZ8 A;  5FY8 A;  2WWU A;  4HOO A;  4BIS A;  5A7Q A;  2XML A;  5FWJ A;  5A3T A;  2YBP A;  3N9N A;  3N9O A;  4GJY A;  5F5A A;  5FJK A;  5LY2 A;  4AAP A;  4EYU A;  5F2S A;  5A7W A;  4GAZ A;  3PUS A;  5FWE A;  5FY0 A;  3KVA A;  5FZK A;  5FY7 A;  4ASK A;  2OQ6 A;  5A7P A;  3PUA A;  5F37 A;  2Q8C A;  5FZ1 A;  5FZ3 A;  5A1F A;  3DXU A; 
#chains in the Genus database with same CATH topology
 1WD3 A;  1YQ8 A;  3L2Y A;  3MFA A;  4XFA A;  4RFR B;  1AL2 3;  2JD9 A;  3H8U A;  1UU6 A;  1IS4 A;  1BYH A;  1ND3 A;  2AR6 A;  1X8E A;  2W08 A;  3I2G A;  1L3J A;  3K46 A;  4IGQ A;  1ENX A;  4CXX A;  1DGW A;  1GNZ A;  3NV3 A;  2H6C A;  4XBN A;  3DYO A;  3ZN5 A;  1DU3 D;  3JU9 A;  5HV0 A;  1Q8Q A;  2FCV A;  3M1H A;  4HBN A;  5FZ9 A;  1VBB 3;  1DZQ A;  3NST A;  1LGB A;  2GNT A;  1NCR A;  2A73 B;  4MHR A;  4Y22 B;  3WQ0 A;  2PXJ A;  4MGQ A;  2GP5 A;  1PMH X;  2ZKN A;  3NJZ A;  4I09 A;  1RGS A;  3VHP A;  5DUV A;  4FPE A;  1RUC 2;  1RUH 1;  3C7G A;  4IL7 A;  2WQZ C;  1MS3 A;  4A3X A;  4ES8 A;  1VIW B;  3ZXF A;  1LU1 A;  2JG9 A;  5BNO B;  2BJS A;  3ZXG A;  3B93 A;  3I2K A;  3LA7 A;  5BNN B;  5J1X A;  3POB A;  4DXT A;  4FSJ A;  4PBP A;  4FOY A;  1LOB A;  1QJX 1;  3AMM A;  2FDI A;  4UW4 A;  5F8P A;  4NWW A;  1ULE A;  3NAP C;  3WVJ A;  3WP6 A;  1KDM A;  3OF1 A;  4LBO A;  4AR2 A;  1MVQ A;  3PUH A;  2F4L A;  1D4M 2;  3N36 A;  3VD7 A;  3NL1 A;  4Q5O A;  1XYP A;  3T0B A;  4A7Z A;  2LRP A;  2O8Q A;  3LF7 A;  1EUU A;  3HD8 B;  1WMD A;  4R8H A;  1QOT A;  2Q0A A;  3ZXL A;  4E2Q A;  4DFS A;  3FHQ A;  4QX1 A;  3FWE A;  4FOV A;  2WNU A;  3ZYP A;  1C5H A;  2V5D A;  2HJI A;  2WO2 A;  3FZ3 A;  4Q4V 2;  5F5Q A;  1SEF A;  1W6P A;  3AJY A;  4K40 A;  5JOZ A;  1ULP A;  3EQE A;  2I45 A;  5LBC A;  1YEW A;  1XSQ A;  3L9J T;  3BPS A;  1Y7B A;  4LO7 A;  4JGY C;  1SG3 A;  5JPM B;  3WG1 A;  1OI6 A;  2XBO 2;  4MVT A;  1H8T B;  1S55 A;  3HT2 A;  1W2T A;  1PIV 3;  4YW1 A;  1QNW A;  2C0Z A;  2DVB A;  2NQY A;  2DBI A;  2Y33 A;  1MS8 A;  3M3E A;  5CKQ A;  2WZR 3;  1MZF A;  4M3C B;  1ZBA 3;  1OSG A;  5C3Q A;  2PMW B;  2WBK A;  2FCU A;  4DNY A;  5I91 A;  3A4U A;  2ET7 A;  1LGN A;  2OA2 A;  3QLQ A;  5C9A A;  1DZT A;  2NPI A;  1W9W A;  1YHF A;  3PL0 A;  3BCW A;  2JWP A;  3VL9 A;  2ZMN A;  4OYU A;  1C8N A;  1AR8 1;  2YMZ A;  4JKM A;  2JB4 A;  5FJH A;  5HCB A;  1NA1 A;  3ZSM A;  5GZD A;  3ZKY A;  4P9G A;  4MGS A;  4N9I A;  3VLB B;  1XNK A;  3LB9 A;  2ZGN A;  3JCI A;  3JD7 2;  3AZZ A;  3USU B;  1RUD 2;  2XVG A;  3CL1 A;  4K20 A;  2VCM A;  4M4P A;  4OI2 A;  4ORF A;  4BIS A;  2K9Z A;  2VNV A;  1ZA7 A;  2ZX0 A;  1JZ3 A;  1LKN A;  2LW8 A;  2ZX2 A;  4JGZ B;  2R7E B;  4CU9 A;  1QJY 2;  4LHK A;  4CP9 B;  1UX6 A;  4XJ8 A;  1D7P M;  1OF3 A;  4KG8 A;  4N90 A;  5GLZ A;  4COU A;  4GB3 1;  1GWL A;  2VU9 A;  3B00 A;  4AW7 A;  3B69 A;  3HNY M;  4E4S A;  4JVA A;  4LO8 A;  4JDO A;  4TTG A;  1C8M 1;  1REE A;  5LAS A;  4BK5 A;  3LOB A;  2C26 A;  4X6Q B;  3BTA A;  5CG9 A;  3LDR A;  1FOD 2;  3EB7 A;  4K21 A;  4MGI E;  2X5I A;  4E2S A;  3EBR A;  4SLI A;  4XF1 A;  4QX5 A;  3H1W A;  3WG2 A;  4M3C A;  2R6Q A;  4WM8 B;  1QKQ A;  4K1Y A;  4KMQ A;  4NE9 A;  4NOT A;  2HWF 2;  2QQU A;  3P3P A;  1H6Y A;  1S0B A;  1S0J A;  3VKN A;  2Y64 A;  5CFC A;  1FMD 1;  2W9X A;  3OSD A;  1RMU 3;  3VDB A;  2YG0 A;  4QGL A;  5A3W A;  2CGN A;  3ZR5 A;  1PGW 1;  1GWM A;  1AYM 2;  1H6X A;  4XUP A;  1W6M A;  1YFY A;  4FPH A;  4MOA A;  4AI8 A;  4LKD A;  1V00 A;  1MZE A;  4FPC A;  2NMN A;  4GXL A;  4EN8 B;  3I3M A;  1GOG A;  5T54 A;  2CGO A;  1RHI 3;  5KXC A;  3KHC A;  4ZU5 A;  4ASM B;  1JS9 A;  3PTR B;  4RYD A;  3FHI B;  5J09 A;  2V5Y A;  4MHU A;  1OH4 A;  1RVF 2;  4AG4 A;  4FXK B;  2ERF A;  3TEZ A;  4QT6 A;  2D6P A;  4LPL A;  3INA A;  1VRH 1;  2X53 S;  4JGZ C;  1JOB A;  4NVP A;  5FKC A;  5FY9 A;  4EN0 A;  2QCS B;  2VTX A;  4HON A;  2WS9 2;  4M3C E;  4WVZ A;  4GD4 A;  3HIF A;  1NUK A;  1NX9 A;  2A71 A;  3U75 A;  1BBT 2;  1YI9 A;  1N1T A;  2VUJ A;  3IWZ A;  3VBH B;  1CES A;  3BOW A;  2ES3 A;  4GMP 3;  1GP5 A;  1UIK A;  5F3I A;  4AHY A;  1RUE 1;  5CFD C;  3V0B B;  1ZRI A;  1LEC A;  2LAL A;  1COV 1;  2P5B A;  2VQA A;  1E5R A;  1LTE A;  2JE7 A;  3ZXJ A;  4D69 A;  1WD4 A;  2R1B A;  2ARC A;  2WA3 A;  1JUI A;  3EJK A;  2LS6 A;  3HQX A;  3ILR A;  2F4P A;  3LEI A;  3PVB B;  4QQL A;  4LJH A;  4YGC A;  4P14 A;  1PK6 B;  2XXZ A;  1AR9 1;  4QPY A;  4AHX A;  2AGS A;  4YGB A;  3O5S A;  2ZGO A;  2WNO A;  2RV9 A;  2Z4F A;  5FPU A;  5F7U A;  3WT3 A;  3KQR A;  3OEB A;  3VBS B;  2PFW A;  4IEQ A;  3PLQ A;  5A7O A;  5C8W A;  2RMU 1;  1YQ5 A;  2NLR A;  2ZZJ A;  3GNE A;  3W20 A;  3WR0 A;  3NAP B;  4HK9 A;  1ENS A;  2AEZ A;  1Q5O A;  2VH9 A;  2WN3 A;  3I3E A;  4D94 A;  1GZ9 A;  2RS1 2;  1AX0 A;  3OGG A;  3E5U A;  4IEX A;  3HNB M;  5CIS A;  3QCW A;  1QOO A;  1TNR A;  1ZM1 A;  3AK0 A;  3OGJ A;  4JHZ A;  5FP3 A;  4EWD A;  5B4N A;  2OZ6 A;  1UXZ A;  2OZJ A;  2QQK A;  3ZSJ A;  3ASI A;  5EV7 A;  5C3S A;  3AKR A;  2HBU A;  1W8Z A;  1UCX A;  3KCX A;  2XML A;  3SQO A;  3AXE A;  1UMH A;  4ZU7 A;  1WLC A;  1V6K A;  5FQ0 A;  5HXM A;  3OTF A;  4DY5 A;  4S2G A;  4LUL A;  2XH6 A;  4AI3 A;  4LO6 B;  5FZK A;  1ZZ9 A;  4JRL A;  2A6X A;  1AL2 2;  2WT0 A;  5FMD A;  2K0G A;  1CN1 A;  3OB8 A;  3EXU A;  3WF4 A;  2Q8C A;  3Q8E A;  4RR3 B;  5FZ1 A;  3ZOI A;  5A1F A;  1RUN A;  2O14 A;  5BNP B;  5L7O C;  1UKR A;  2YGM A;  3MIB A;  4N7U A;  4B8E A;  4UFK A;  1VBB 2;  4FFI A;  2EAK A;  4LQR A;  2G19 A;  3CO2 A;  3ZYH A;  4CDU A;  5CAD A;  1HQW A;  1SAC A;  3ZMO A;  4YFZ A;  3AP5 A;  2J1A A;  1DLL A;  3ES4 A;  5CA6 A;  1R09 2;  1W8U A;  3MI8 A;  2Y6J A;  5DDJ 1;  1OQ1 A;  2DWR A;  3H1Y A;  1VAL A;  2HWD 3;  3NWK A;  1UOG A;  5K0U B;  5FRA A;  1U5X A;  2TBV A;  2HWF 3;  4IDZ A;  5LBB A;  5FY4 A;  1SLT A;  1Z7S 2;  4QX7 A;  4CP9 A;  1ACC A;  1WWY A;  1GV9 A;  2OKX A;  2ZHM A;  4XW3 A;  3V0A B;  2GAL A;  3K4Z A;  1UY1 A;  3KWV A;  3LFI A;  1SZB A;  2HEY F;  2WZR 1;  3QH7 A;  3T08 A;  3SLI A;  4DRV A;  2BV4 A;  2VUD A;  5DAP A;  1RTV A;  2YPJ A;  4DUW A;  1W8W A;  1ZNP A;  5FLJ A;  4BDV B;  3AP9 A;  4EQV A;  5FYB A;  1SLB A;  3PVE A;  3III A;  1ZA4 A;  1DYP A;  1OOP A;  3ZYG A;  2GNB A;  4LBM A;  2A6Y A;  2WAB A;  2X09 A;  3D6E A;  3IZO A;  2B45 X;  3ZFF B;  4FI9 A;  4JGZ A;  3TBD A;  4AK3 A;  2ORZ A;  1UMI A;  2H0B A;  2VMG A;  3QD6 A;  2OUH A;  3VZK A;  5DDJ 3;  3PJQ A;  1OFN A;  4CCL A;  4CEY A;  1RHI 1;  3T09 A;  5A6X A;  5IK4 A;  5KC6 A;  1D0H A;  1J84 A;  1IS3 A;  3J4U H;  1EAH 2;  4AI9 A;  4D6Q A;  5F39 A;  5FMO L;  2VO5 A;  4Z2A A;  5JLV A;  3DV8 A;  5IJR A;  1UO9 A;  4AHW A;  2I2S A;  1BBT 1;  1PK6 C;  1W6O B;  2EXI A;  2NM1 A;  2VZO A;  3AL6 A;  4BA6 A;  3CBN A;  4Y24 A;  2Q1Z B;  3O0X A;  4MSV A;  1FMD 3;  4I0A A;  4YM3 A;  4CCJ A;  2VG9 A;  3WP4 A;  1RUF 1;  3CJX A;  5ISL A;  4XCB A;  1ZZ6 A;  5DG1 A;  3OUH A;  2RJ2 A;  1V6I A;  1O5L A;  4RQP A;  1HX6 A;  2B9U A;  1AR7 1;  1VBD 2;  2PTM A;  3N35 A;  5D8A B;  4QKD A;  5LRR A;  5AC9 1;  4W6Y A;  1HXS 3;  5A3O A;  1ULO A;  3VD5 A;  5J37 A;  4RS5 B;  4CCM A;  3RZK A;  4CCN A;  3LFM A;  2JXA A;  2E32 A;  5FXV A;  1O5U A;  3AYE A;  4YPJ A;  3ZSE A;  3HMY A;  2BOJ A;  2PHL A;  4GUL A;  3OUJ A;  4HET A;  3U11 A;  2Y0O A;  4RQP B;  5J36 A;  5L7O A;  1AYN 3;  1CIW A;  4WVM A;  4HOO A;  4WVM B;  4ZXE A;  3WD5 A;  1MQT A;  3OG2 A;  1BMV 1;  4LLF A;  1Y9G A;  2DYC A;  4Q4Y 3;  4BM8 A;  2KR2 A;  2KD7 A;  4O65 A;  4H14 A;  1PX3 A;  2W92 A;  4YZ2 A;  4CPB A;  1RHI 2;  3CJI C;  3I2F A;  3OJB A;  4IE0 A;  2XJS A;  3MUZ 1;  3GBW A;  3HBK A;  1LOA A;  5A7P A;  1W8N A;  1QEX A;  1RXF A;  5GLV A;  5A1A A;  4KWK A;  2R16 A;  4WM8 C;  1XPW A;  4IE7 A;  4A45 A;  3AX4 A;  4LO4 B;  4CDQ B;  5C9A B;  5I8T A;  4YM1 A;  2WII B;  4MUV A;  2QZ3 A;  4NHY A;  1RUE 3;  3I4I A;  4GMP 1;  1W2A X;  2XJT A;  4PT6 A;  4L9B A;  1ZRC A;  1FYU A;  3O14 A;  4Q26 A;  2IXH A;  2RDS A;  1TMF 1;  1BEV 1;  1YO8 A;  1H8T A;  1A34 A;  4IES A;  3UT0 A;  4CU8 A;  2D7F A;  2WO7 A;  5FYC A;  5M0T A;  2XKP A;  1U0A A;  1UKG A;  4IXL A;  4LKE A;  4MH0 E;  4XVH A;  4HPK A;  4LUM A;  5JCT A;  5LA0 A;  1HB1 A;  1ZZC A;  5C3P A;  1W6N A;  2PHU A;  5I0D A;  2G9G A;  3E6D A;  1DGL A;  1HN0 A;  3PUI A;  4QD2 A;  4QGM A;  5F6L B;  2YFU A;  2DU1 A;  2QFE A;  3VD9 A;  3VDA A;  4YZ4 A;  4Q4W 2;  3ACI A;  4AFB A;  2YHJ A;  3UKN A;  3R4S A;  1ND2 B;  1OFS A;  2JDK A;  3B02 A;  2VVF A;  2VNR A;  2R0H A;  4PLM A;  1RUH 2;  4EJR A;  1JHN A;  1V0A A;  2D3S A;  2CDO A;  4AQ6 A;  3KMH A;  1RUG 2;  4P9L A;  4CU6 A;  4JTO A;  1W3X A;  4BQW A;  4I3G A;  2DVF A;  4WVV A;  3MLL A;  1TMF 3;  3Q8A A;  4A41 A;  2XHK A;  2XR4 A;  1HDK A;  2SLI A;  1KEX A;  2Q8O A;  4C90 A;  1CON A;  2FQP A;  5JIU A;  3H42 B;  1RL3 A;  4CEY C;  4BHP A;  1SFY A;  4AED B;  2WWJ A;  3CJI B;  4HLT A;  1F4A A;  4Q0Q A;  4D6R A;  1S2E A;  2JDN A;  4COV A;  5FIX A;  3PUR A;  5A3U A;  1W04 A;  1X8M A;  1R1A 1;  1QWR A;  1S0E A;  2WYF A;  4YG6 A;  1RMU 2;  1YJK A;  3RZZ A;  3WDU A;  2CDP A;  2ETE A;  4DUV A;  1UY2 A;  3VDD B;  4JGY B;  4OFG A;  4XDQ A;  2J1E A;  5T5L A;  3RZL A;  1XSR A;  1UX7 A;  3GBG A;  2DCJ A;  2RS5 2;  4Y1Z A;  3ST7 A;  4YWA A;  4ZY9 A;  3O1U A;  2XVL A;  3KD4 A;  2JDA A;  1RUI 3;  3MF6 A;  3WLU A;  1H2L A;  1DQ2 A;  1GLH A;  2WNV C;  3A0K A;  1N47 A;  1XJA A;  3IDB B;  3LOI A;  3M3Q A;  5FQ0 B;  4W50 A;  4YYO A;  3WW1 A;  4N43 B;  1K3I A;  1LHU A;  1WW6 A;  3HNM A;  2Z2S B;  5JSP A;  1HRI 1;  3MIF A;  3KF5 A;  2AC1 A;  5JZG C;  3WQ1 A;  4J1W A;  1XNT A;  3SEP A;  4JC1 A;  4LIU A;  3RZJ A;  1UYY A;  2WT2 A;  3VBR C;  3B5L B;  5CKN A;  1ZBA 1;  1AR8 3;  4YM0 A;  1JYN A;  3VBU C;  5K0U C;  1DCS A;  3E5X A;  4LOS A;  4A6O A;  4Q2F A;  3OD4 A;  1OUX A;  2XJP A;  3AL5 A;  4RHV 2;  1K12 A;  1WW5 A;  1TZO A;  3NAP A;  3QAC A;  2GND A;  4MV2 A;  3AKS A;  5FZ7 A;  1Y9Q A;  2VMI A;  1UZV A;  2VCC A;  2ZGU A;  3HN3 A;  4XXP A;  4QQP A;  5A7Q A;  4P00 B;  1YIP A;  5BNO A;  3B3Q E;  4AWD A;  4GJY A;  5C5T A;  5CAZ A;  4Q4Y 2;  1VBC 2;  5EQU A;  2ADD A;  1MZ5 A;  5DAX A;  1OOP C;  1W6M B;  1KDK A;  4FPG A;  4NRQ A;  4XUQ A;  3WG3 A;  2BVV A;  3KVA A;  1GKB A;  5FY7 A;  2HWF 1;  1RJ8 A;  5JR7 B;  1RUD 1;  2B42 B;  4DUX A;  4LE4 A;  1H0B A;  3ZM8 A;  4PDW B;  3WF3 A;  1CGP A;  3DXU A;  4ES9 A;  2UYA A;  1PIV 2;  1QJY 1;  1UY0 A;  3ZFF C;  4OZO A;  2VZ3 A;  4WM8 A;  5ABJ A;  1TG7 A;  2X10 A;  4YVW C;  1GYK A;  4MX3 A;  1POQ A;  4CYD A;  3HBZ A;  1W0P A;  1FV2 A;  3VBF A;  1J83 A;  4M00 A;  4UWD A;  2JG8 B;  4R9C A;  1BJQ A;  1US3 A;  1H2M A;  4IQP A;  4CA9 A;  5C33 A;  5F5I A;  3J9S A;  4AVB A;  5JI7 A;  1LEM A;  2ZCW A;  3POI A;  4LEJ A;  4XZU G;  1CIY A;  1LGC A;  1VBA 1;  4AFC A;  3ZYR A;  4B7K A;  3HT1 A;  3OOX A;  5LAT A;  2BDR A;  3FFZ A;  3I3D A;  5A70 A;  1O59 A;  2OQ7 A;  5JOY A;  1S0C A;  4XYX A;  4XUN A;  1PO1 3;  2J1V A;  3USU A;  4LOT A;  2HEV F;  5I0S A;  2R32 A;  5I93 A;  4P5Y A;  4QX3 A;  4FXG B;  4CDW A;  1YIF A;  2XL7 A;  3NNJ A;  1R1Z A;  3VBU B;  1MEC 1;  3LWC A;  1CD3 G;  1R08 1;  3SKV A;  4XIL A;  1VMJ A;  1QQP 1;  3IB3 A;  5LK7 B;  3N7K A;  3NNM A;  3U1X A;  5BYN A;  2JEM A;  1COV 2;  2VBB A;  1B35 A;  3T0D A;  1JTZ X;  4QMA A;  4Y5Z 0;  4KWU A;  1ZVF A;  2ORX A;  5IK5 A;  1GBG A;  4URA A;  2RDR A;  4IV3 C;  1BBT 3;  2VJX A;  4XMI A;  5T55 A;  1UYZ A;  3POS A;  4ARX A;  4LO5 B;  2W39 A;  4OHV A;  2E9Q A;  2WS9 1;  3FHA A;  4YW6 A;  3RPQ A;  4QM8 A;  3JBG 3;  1M06 G;  4GKY A;  5LW9 A;  4QU1 A;  1GR3 A;  2VL4 A;  1W9S A;  3H3Z A;  2WFF 1;  4UI9 L;  4WZF A;  3VKF C;  1ZRF A;  5FP9 A;  4YLZ A;  1MAC A;  4LXL A;  3H50 A;  2R49 A;  4FQZ A;  2X05 A;  1LHV A;  1S0G A;  3CEW A;  3LEG A;  4V1P A;  3VKO A;  2J7M A;  2VMC A;  3UJO A;  4BB3 A;  3VBS C;  2Q1M A;  3NJY A;  4CCK A;  4NRP A;  3O1V A;  4KGQ A;  3BOD A;  3I8T A;  3IPV B;  3FLR A;  1GOF A;  5ACA 1;  4HAN A;  1BK0 A;  4HPK B;  3M7A A;  5A1L A;  4AI0 A;  3VZO A;  4CDX C;  1QJU 3;  3K4D A;  2P6H A;  3OBA A;  1PGL 2;  2RR1 1;  3ACL A;  5JI9 A;  2ZGS A;  3F2Z A;  4P02 B;  5L9V A;  3LIH A;  3ZPY A;  2VBD A;  4Q4W 3;  2WJS A;  5C8C A;  2HWB 1;  1QJE A;  1S1A A;  4MGY E;  3VGI A;  4Q4Y 1;  5A7W B;  4QPG A;  3LPF A;  1Q8S A;  2YC0 A;  4MAD A;  4AED C;  1R08 2;  2DFC A;  1UL9 A;  3U10 A;  2ZEZ A;  3K3O A;  3JUU A;  5IK7 A;  2P3I A;  2R06 2;  3AM2 A;  4K1Z A;  4QDQ A;  3TB0 A;  1W06 A;  3T1M A;  1PZ7 A;  2WC2 A;  2PAE A;  5F6K A;  1UZZ A;  4YNI A;  2AZ5 A;  4G9S B;  4RL7 A;  1JI6 A;  3N9O A;  1D4M 1;  1V9U 3;  1O3Q A;  2R07 3;  3U37 A;  4Y22 A;  4IV3 B;  2Y60 A;  1NOV A;  2JIG A;  2RM2 3;  3A22 A;  3PHM A;  3K77 A;  3VBH C;  3DYM A;  2G9Z A;  1H9P A;  2G9F A;  3M8L A;  4QB2 A;  2C9K A;  4FPL A;  4ERO A;  2IXL A;  3TYJ A;  1RUJ 1;  3UET A;  3GZE A;  5ACA 3;  5JOX A;  5L19 A;  2ZGR A;  3TWI A;  1QJU 1;  5A7S A;  3HPN A;  4FPO B;  3IKW A;  2XDV A;  4I0B A;  4CDQ C;  1KRI A;  4LNV A;  2W5F A;  5IVB A;  1JUH A;  3BU7 A;  1RUC 1;  3D82 A;  2BWC A;  4CZS A;  3NMB A;  5FZH A;  3VBF C;  4CDW C;  2H6B A;  4RGK A;  5J48 A;  2VZP A;  5IFP A;  4AOC A;  2DUQ A;  3I3Q A;  4UF0 A;  4XET A;  1UNB A;  3RVH A;  2HWD 1;  4FFF A;  4P08 A;  3UGF A;  3ZFF A;  2IZW A;  1IQA A;  2KM2 A;  2D40 A;  3ON7 A;  5IVY A;  1OA3 A;  3AVR A;  1BXH A;  3AMH A;  5K8S A;  2VOT A;  1L7L A;  2ZX1 A;  1ZZ7 A;  1GNH A;  2VZU A;  3WNK A;  3ZYB A;  2EID A;  3AZY A;  3U07 A;  1JOP A;  1LOD A;  3ENR A;  3PU3 A;  3ZFG C;  1V9U 2;  2C4X A;  2Y6K A;  2VOV A;  2Z79 A;  3OPT A;  4HT1 T;  1F5F A;  3W59 A;  1UZ0 A;  5T52 A;  4RS5 C;  1MS0 A;  1P8J A;  4QX0 A;  4Z2W A;  1F4H A;  1SDD B;  1OLR A;  1X9P A;  1JW6 A;  3MF9 A;  5FUI A;  3MIG A;  2VMF A;  2WR9 A;  1V6O A;  2QQL A;  4I02 A;  2D43 A;  2VZV A;  5K0U A;  4YW4 A;  1MEC 2;  3X29 B;  1PO1 1;  2VGD A;  5DZF A;  3VD4 A;  2VW1 A;  3LEM A;  4AXO A;  4QGN A;  4JZR A;  4Y5T A;  5GLU A;  2ENR A;  3KLS A;  1UYP A;  1W2U A;  5EJ3 A;  4X6R B;  1ZBE 2;  5CYY A;  2IVI B;  2BBA A;  1H1M A;  2BNN A;  1QGL A;  2RM2 2;  1C8M 3;  3IMN A;  3TAY A;  4Z07 A;  2A6W A;  1BVP 1;  1PO2 3;  2ZA9 A;  5FYZ A;  1OOP B;  3F95 A;  1IOA A;  3RYK A;  5AFB A;  4AAX A;  1O8P A;  1WLD A;  5CU1 A;  2FCT A;  4DOU A;  1TME 1;  1J3P A;  1PGW 2;  5IWF A;  1VBA 2;  3CF6 E;  1PX4 A;  3WXP A;  4EN6 B;  3G7D A;  1J1L A;  4GIQ A;  3N4M A;  4GKX A;  4BXS V;  5C3O A;  2IVJ A;  1NCQ B;  2ZAA A;  1JXN A;  4NWV A;  3KGZ A;  4JTN A;  3EYP A;  3SCH A;  4HZF A;  4TLG A;  1OD5 A;  2A3W A;  5IVE A;  5KHI A;  2E7Q A;  3MLK A;  2BNM A;  4B4Q A;  3W21 A;  1RUD 3;  5F32 A;  3V64 A;  1PVC 1;  1YQ6 A;  1ULC A;  2ATF A;  3RMY A;  3EHK A;  1STM A;  5GJ6 A;  1DYK A;  2YBK A;  4E2G A;  1F8V A;  1MEC 3;  1UQX A;  4KU8 A;  2BWA A;  1HV0 A;  3D3A A;  4I0W B;  4P9W A;  4CDX A;  3VL8 A;  1UPS A;  2QE3 A;  2ZPX A;  1WCD J;  1AR6 3;  4M0H A;  4NHM A;  1DP0 A;  4AE2 A;  4UBH A;  2A3Y A;  3ECQ A;  1UMZ A;  4BQ1 A;  1CVN A;  2F6B A;  2DTY A;  4R9D A;  1JYC A;  1WW7 A;  2EA7 A;  1F9K A;  2W0X A;  3POF A;  1EV1 1;  2YC4 A;  2LM3 A;  2WKK A;  4CUA A;  4COW A;  4UFJ A;  3S6P A;  1RUO A;  4LA2 A;  2QQW A;  4RQP C;  3WHU A;  1DLC A;  1ND3 C;  3DEM A;  3JB4 C;  3HVD A;  3JBG 1;  3TEX A;  5KHG A;  2OPK A;  4JHT A;  4OUM A;  4Q4V 1;  2AAC A;  3AP6 A;  2R07 2;  5FUP A;  3K4A A;  2ZTN A;  4JAA A;  4B1M A;  3M3I A;  4MGT A;  1NLQ A;  2WA4 A;  1AX2 A;  2JG8 A;  1IG3 A;  1YCI A;  2DFB A;  3KB5 A;  1CWP A;  3AMP A;  3N9Q A;  4RR3 C;  1DF0 A;  4QWN A;  5E6H A;  3VBH A;  4Q4V 3;  5C8C C;  3RZG A;  3DEC A;  1R08 3;  2Y6L A;  3OY8 A;  1JYW A;  4EZ4 A;  3VB9 A;  4FCA A;  4OMD A;  1PMJ X;  4CTE A;  3RNS A;  3GHN A;  3N7M A;  1YQ2 A;  3Q8F A;  5DZG A;  2VME A;  1NCQ C;  3LDK A;  5K7P A;  3CJI A;  5D2A A;  5A3M A;  4LBK A;  4ZZ8 A;  1W8T A;  1QF3 A;  1YLL A;  2ADE A;  4H55 A;  3N7L A;  3IDE A;  4YVS B;  1I5P A;  4Y1X A;  3BI3 A;  1N3O A;  1PK6 A;  3PUQ A;  2MEV 2;  1CAV B;  2EIC A;  4ZXK A;  1OD3 A;  3WSO A;  1A3K A;  1N3P A;  1JOD A;  1WCK A;  2RMU 3;  4Y20 B;  4YGE A;  2VOK A;  4S2D A;  2Y34 A;  1XBF A;  3TN9 1;  2RS3 3;  1D4M 3;  1V9U 1;  3J8F 3;  4NAM A;  4U36 A;  4KWL A;  4K6B A;  3VBO C;  3ZVX A;  4D6S A;  1W6Q A;  2F17 A;  1CPN A;  1WGP A;  2CYF A;  3NVC A;  4QPG B;  3BTX A;  5IW0 A;  1UOB A;  4FAH A;  1RUG 1;  1Q8P A;  2JG9 C;  1E5S A;  3TN9 3;  1OPO A;  3NJV A;  3LD8 A;  4KH9 A;  3S30 A;  1KS5 A;  3SCG A;  1OLQ A;  1AUY A;  1W8O A;  4PIY A;  3WUD A;  2EIE A;  4CVU A;  1HXS 2;  1US2 A;  1LRH A;  4FT8 A;  3LCP A;  3LAG A;  2GMM A;  2BBV A;  2YGL A;  4N8M A;  1DGR A;  5D8A A;  1AR9 3;  5LA1 A;  5CFC C;  1HRI 2;  2QQO A;  4LKF A;  4KBZ A;  1DG6 A;  1S0D A;  1D2Q A;  1RUC 3;  4ATF A;  4PI0 A;  1KFX L;  5LWB A;  3POY A;  2D3P A;  3J7L A;  5IAX A;  1VP6 A;  1CR7 A;  3Q8C A;  5I0R A;  1RXG A;  2RE9 A;  2MNG A;  3CU7 A;  1H4G A;  1OF4 A;  5EPA A;  1QNY A;  2L9L A;  3E5Q A;  2VOW A;  2PHT A;  3ETP A;  1AJK A;  4K3U A;  2NMO A;  2PLV 1;  2OW4 A;  4SBV A;  1ND2 C;  1OQD A;  4Q4X 2;  5C7G A;  4JGY A;  4Q0U A;  3MIC A;  4AFA A;  4DMI A;  4HKL A;  4JDN A;  4PLN A;  1F15 A;  1N1V A;  1UW8 A;  1AL2 1;  2Q30 A;  4NJ4 A;  1JZ8 A;  1WBL A;  4W4Z A;  3P1I A;  5BNN C;  4BQ3 A;  1OLM A;  2TNF A;  4H2A A;  5JXG A;  4Q0P A;  3TN9 2;  1HQL A;  1LED A;  5G04 L;  5A7W A;  4YW5 A;  3O1R A;  4XCA A;  4E8D A;  3HR9 A;  5A6Q A;  3ZFE C;  3MEP A;  2FHR A;  3OY8 B;  1B09 A;  1ULF A;  4JX0 A;  1V6J A;  2DUR A;  4PCR A;  2E7A A;  1W05 A;  2VQ0 A;  4HL0 A;  3T2O A;  3WDT A;  2ZX4 A;  3VDD C;  2YC2 A;  2RS5 1;  1EV1 2;  5LRS A;  3W9A A;  5IT6 A;  2JB8 A;  4I30 A;  5KXE A;  1W2N A;  3MPP G;  4V2V A;  1KGY A;  3DF0 A;  1GQH A;  3KT1 A;  4S2F A;  1PIV 1;  4LIT A;  1T6B X;  4DIN B;  2OX0 A;  2XGX A;  4P9X A;  1W3V A;  1G9F A;  2HYK A;  5B2G B;  5I8Y A;  1CAV A;  1FV3 A;  2PYT A;  3HQU A;  1LOE A;  3T4H B;  3J7M A;  3WNO A;  2IXK A;  3WZ1 A;  4QDR A;  4HVQ A;  3S5A A;  4B29 A;  4Y33 A;  3OBR A;  3BGA A;  4BQX A;  4QPI A;  3I3B A;  3B9I A;  5EP9 A;  2HWB 2;  3A21 A;  3LIG A;  2EAL A;  3ZFG B;  5KR7 A;  1NQJ A;  3AYA A;  4OUL A;  2E63 A;  4YGD A;  3ZKU A;  4OHY A;  2BER A;  2Z69 A;  1OXC A;  3DYP A;  1C5I A;  4Q1R A;  4DQA A;  1LAJ A;  1QQP 3;  3JQW A;  4FTB A;  4ISQ A;  4L99 A;  2E7T A;  3VKM A;  2RS5 3;  2IFR A;  1D0G A;  3LA2 A;  1TE1 B;  1K5M A;  3AFG A;  4IV1 C;  3SHR A;  5A33 B;  4JCK A;  4AYU A;  3POW A;  1NE4 A;  1A6C A;  2D44 A;  2WZE A;  1ZZB A;  1SBF A;  5FZ6 A;  3MV0 1;  4EZH A;  4HVO A;  1IG0 A;  3ZFE B;  3KHB A;  2FDJ A;  2Y6G A;  3K48 A;  4R4X A;  5DAB A;  3U14 A;  1RC6 A;  5DZE A;  2WQ4 A;  2BFU S;  4TN7 A;  3IT8 A;  1BLZ A;  3UGG A;  1NYW A;  3NV1 A;  4KL1 A;  1JZ5 A;  1QXP A;  5ANN A;  5JMC A;  4N53 B;  3AKP A;  5FZL A;  2Z42 A;  5KHJ A;  2RDN A;  3GZT B;  5FZB A;  1FPN 2;  2VW0 A;  2FDG A;  1NA1 B;  2W52 A;  3R0R A;  1UWW A;  2OS2 A;  4BIO A;  5JOW A;  4IER A;  2QDR A;  1V6L A;  1VBD 1;  5JPN B;  5I8S A;  3ZYJ B;  3THC A;  2AUY A;  3DGT A;  3O0V A;  3VBS A;  3O12 A;  5E8A A;  4CP1 A;  1JZ2 A;  4MXV A;  4C1X A;  2I74 A;  3RMX A;  5GZC A;  3M3O A;  1L7R A;  1X33 A;  3LKJ A;  1NXD 1;  4QHZ A;  3IAQ A;  1K45 A;  3OBZ A;  4BK4 A;  2B4K A;  4BQ4 A;  3AYD A;  3EO6 A;  1B35 B;  1Q8V A;  4G4F A;  4CCD A;  1VPH A;  1VBE 1;  5CKM A;  1BEV 3;  3RFR A;  2DCY A;  5DUU A;  1E5I A;  1H1I A;  4XUT A;  4KNC A;  4PBO A;  5FLH A;  1NCQ A;  1SLI A;  3AJZ A;  3GJA A;  4AI1 A;  1C8M 2;  2AYH A;  3E97 A;  4QDS A;  4R4Z A;  5C6C A;  2E31 A;  4AVV A;  1UU4 A;  4H3W A;  5FWJ A;  3LGR A;  4JQT A;  2V09 A;  4FFG A;  1IZ3 A;  4O9G A;  4OQ9 A;  1ZBE 3;  5H9S A;  3WG4 A;  1NG0 A;  1H2K A;  2HWC 2;  2QQI A;  3PIJ A;  4NII A;  1I1E A;  4CEY B;  4DPN A;  5J7M A;  3WP3 A;  5FWE A;  1CZT A;  2RDQ A;  1D2S A;  1HQN A;  1YYN A;  2ZGQ A;  2D6L X;  4NN0 A;  4AED A;  5EJZ B;  2C9A A;  1X50 A;  5LB6 A;  4TXW A;  4CXW A;  2QZ2 A;  2D5H A;  4CXY A;  4S2H A;  1S0F A;  1FX5 A;  4Y1V A;  5A32 A;  1V6M A;  2BRT A;  5EXO A;  2VPV A;  3KGL A;  2VCB A;  1RUG 3;  5DAV A;  2GC0 A;  3M2M A;  1XQN A;  5K4L A;  3SH4 A;  1XE0 A;  3VBF B;  5EIY B;  1POV 3;  5LA9 A;  4BME A;  1XE7 A;  2XBO 1;  2UWA A;  3ITQ A;  3ZFE A;  4BOW A;  1OUR A;  1O4Z A;  5FLI A;  3AMQ A;  2EAA A;  2VQU A;  1VMF A;  1FOD 1;  3FBY A;  4XIK A;  5LK5 A;  2P3J A;  3MYX A;  2C5D A;  2DVG A;  5FDB A;  2K2S A;  2RR1 3;  3QH6 A;  2PHW A;  3NV4 A;  1WMF A;  3OD0 A;  1ASJ 3;  2YU1 A;  4MZU A;  4ARY A;  3BOP A;  3VDD A;  4CP0 A;  1G9D A;  3HQR A;  4Q29 A;  1V6N A;  2PHD A;  1OLM E;  3WV6 A;  1BEV 2;  3FC0 A;  4FP2 A;  2WWS A;  1LR5 A;  4AFD A;  4AEK A;  4QKB A;  5JSO A;  4LLO A;  1DQ6 A;  4CCE A;  4YAR A;  1RUJ 3;  4GWM A;  1GQP A;  2D6O X;  1UAI A;  5FMC A;  2WL1 A;  4XTP A;  4RHV 1;  4IE4 A;  4O9E A;  2XUE A;  5FAX A;  1LHW A;  4RS5 A;  4W6W A;  1RUE 2;  1BMV 2;  2VM9 A;  4N53 A;  2XVK A;  1AYN 2;  3D0S A;  1CAW A;  2JKB A;  3T2Q A;  3RDI A;  1W28 A;  1ZRR A;  1UY3 A;  4PQQ A;  4XAA A;  2QVS B;  1U12 A;  5DXD A;  4CCO A;  1HKD A;  2QBX A;  4OUS A;  4DS0 A;  4LT5 A;  1AVB A;  4EWA A;  5LZ6 A;  1X36 A;  4F3J A;  2YB7 A;  2YYO A;  3RRD A;  2VVD A;  3MBW A;  1QIQ A;  3AFK A;  3SNM A;  2YU2 A;  3I7D A;  3ORJ A;  2V4V A;  3MO4 A;  2O8O A;  1RED A;  3RJ2 X;  1EPW A;  1W99 A;  4YVW B;  1JZ4 A;  1Q8O A;  1Q3E A;  4HG6 B;  1WUV A;  2J22 A;  2WT1 A;  3RJR A;  5DUW A;  3OBT A;  4HFS A;  3UGH A;  3OGR A;  3ZFG A;  3NQH A;  5CFC B;  4DRR A;  1FMD 2;  5CIR A;  5CFD B;  1K5J A;  2H0V A;  4KI5 M;  3RWK X;  4AVS A;  1CAU A;  1Y43 B;  1TVG A;  3UL2 A;  1LOC A;  5J96 B;  2FDF A;  1OPM A;  4E4D X;  4MYE A;  5FZO B;  3URF A;  4O7X A;  1GWK A;  1N1Y A;  2ZHL A;  3ZXE A;  5C4W C;  1CX4 A;  2CGP A;  1H9W A;  5HBA A;  3PDQ A;  4FOQ A;  4J1X A;  3ROU A;  1G9A A;  3BU0 A;  5FZD A;  3HAG A;  5F3C A;  4UF0 B;  4QXB A;  3GBF A;  1QY4 A;  2VTX J;  1HRV 2;  5IVJ A;  3VD3 A;  1C28 A;  4AGG A;  1O3S A;  2ZKL A;  5L7O B;  1WCU A;  1T2X A;  2CY6 A;  1GZW A;  4Y26 A;  4J6G A;  4AHZ A;  2WWU A;  3U4X A;  5BV6 A;  4A7K A;  4OVE A;  2G4I A;  3BTY A;  3WCR A;  5JAX A;  2NZ9 A;  3A23 A;  2DUP A;  4AQ2 A;  4ZHN A;  3KCC A;  3I2H A;  3LZZ A;  5L9B A;  3SH5 A;  2VNG A;  1GFF 2;  1A8D A;  5B4X A;  3UK9 A;  2V4A A;  1EV1 3;  1CQ9 A;  5BNQ A;  1PO2 1;  3MV1 1;  1DFQ A;  1Z0H A;  4YM2 A;  4TSV A;  5DDJ 2;  2C1F A;  4XFG A;  1CZV A;  3H7J A;  1YWK A;  4MXW B;  2JG9 B;  1LHN A;  2JX9 A;  4PI2 A;  3S0M A;  1LOG A;  2A6Z A;  2LUW A;  3I2I A;  3UNP A;  2WFF 2;  2OXB A;  5HCA A;  4BZ4 A;  5AVA A;  4B4P A;  2BQP A;  3R4D B;  3ZPO A;  5CFD A;  1NLS A;  4RR3 A;  3I59 B;  4EN7 B;  2GC3 A;  2J1R A;  1R64 A;  3LEK A;  3ETQ A;  3WF1 A;  3M4F A;  2AH2 A;  3WNX A;  1AXY A;  3NNG A;  4ZS3 A;  1QDC A;  5T5J A;  2K46 A;  4XC9 A;  3UYJ A;  5JZG A;  1PHM A;  2AEY A;  2ET1 A;  2RMU 2;  3BVC A;  1QXJ A;  4TWT A;  5BXX A;  1DQ4 A;  4HVR A;  4XBL A;  2VOX A;  5FFO C;  4KGG A;  1YC6 1;  2D97 A;  3H3L A;  1L7Q A;  1AXK A;  1SPP A;  1LCL A;  1R09 1;  4BPZ A;  3I59 A;  4OUE A;  3THD A;  5LEJ A;  4DZG A;  1AYN 1;  5BNP A;  3GM8 A;  3MHZ A;  3Q8B A;  4D8M A;  5JWP A;  2VW2 A;  2X29 A;  1KQR A;  2JE8 A;  1YUD A;  2EIB A;  2Y26 A;  1NZC A;  1UF2 C;  1R09 3;  4RA0 A;  1SBE A;  1V70 A;  4O61 A;  2OPW A;  2R04 1;  2WZR 2;  1C3H A;  3PIG A;  4LHS A;  4LTA A;  4QU2 A;  2VUA A;  4XFF A;  2UUR A;  1NLR A;  1XNB A;  2VZ1 A;  2VE1 A;  4LK7 A;  1XU2 A;  1Y9M A;  3WW4 A;  4QXH A;  3FMG A;  2A75 A;  4IEW A;  3LSD A;  4N43 A;  5LY1 A;  3D0J A;  3VBO A;  4EN9 B;  5DG2 A;  4OHW A;  3U4S A;  3K2O A;  5FKB A;  5GLW A;  3FLT A;  1COV 3;  3CLP A;  1GZW B;  4N53 C;  4P9Y A;  3AZX A;  2P1B A;  1LES A;  5A80 A;  1MR5 A;  1W9T A;  2R07 1;  5H9R A;  1RUF 2;  1NCR B;  4GMP 0;  2ZGT A;  1OKQ A;  2ZHN A;  4XOG A;  1GP6 A;  3USS A;  4LBQ A;  1K42 A;  1ZX5 A;  1FXZ A;  3WNP A;  2BNO A;  2DCZ A;  1XU1 A;  3NW4 A;  4XF0 A;  2XBO 3;  3SMH A;  1EAH 1;  1POV 1;  5KWR A;  1CJP A;  4FFH A;  2W1Q A;  3KS7 A;  4GJZ A;  3J8F 2;  1AF9 A;  5EYY A;  5FYH A;  4LHN A;  3AKQ A;  1SLL A;  1LJ7 A;  3GXU A;  3H3U A;  3S7E A;  3ZYF A;  4BLI A;  3RZM A;  1VRH 3;  3GZU C;  3W5M A;  4IEZ A;  5FPB A;  3W5N A;  4OI1 A;  3RI8 A;  4OZX A;  3NJX A;  3CMG A;  4NRM A;  2BYV E;  2DU0 A;  3J26 N;  4CDX B;  4UW5 A;  4LKS A;  4LBQ B;  3UES A;  2W3J A;  1OA4 A;  3KV9 A;  4BLJ A;  3BTZ A;  2QQN A;  4XHX A;  4ZON A;  4LMF A;  5FXZ A;  3K51 A;  1XC6 A;  3ZN6 B;  4Q4W 1;  3WNN A;  2R06 3;  1RB8 G;  2VMD A;  5FCC A;  2ID4 A;  2YRO A;  4GWJ A;  5LBF A;  3WQB A;  1H30 A;  1REF A;  2CU5 A;  1XB9 A;  4FPF A;  5CZK A;  4YVW A;  1DQ0 A;  1QJX 3;  2Q5T A;  5DUX A;  2CAU A;  2MPF A;  2JDH A;  1AR7 2;  2SBA A;  5AC9 2;  4JRA A;  1XYO A;  1XE8 A;  1UPI A;  2O0O A;  2QDN A;  5FZ8 A;  3IM0 A;  4ASL A;  2RR1 2;  4XBQ A;  4D7T A;  1JMU B;  3RGB A;  3SEE A;  2D6M A;  4CEW C;  2NP0 A;  5A33 A;  1G86 A;  3ZO0 B;  5BUV A;  4KU7 A;  4AAP A;  2LRO A;  4XAC A;  1OC1 A;  1FOD 3;  1ODN A;  2JIJ A;  4AGV A;  2RJL A;  4OI4 A;  4TLF A;  2JDM A;  3KT4 A;  4CU7 A;  1QH6 A;  4KQ7 A;  1APN A;  2WQ8 A;  1TMF 2;  4GQ7 A;  4M0N A;  3RS6 A;  1DGW X;  2VUC A;  4WVW A;  3BB6 A;  5AFE A;  2FZ1 A;  4MO3 M;  4C0H A;  5KHH A;  2HWD 2;  2XB6 C;  5C4W A;  1GAN A;  1CAX A;  5FP8 A;  1SFP A;  3POJ A;  4Y4R A;  3GZA A;  2D98 A;  3QOP A;  4UXA A;  5BPX A;  1ND3 B;  2DF7 A;  1AXZ A;  1RUI 1;  4KWJ A;  3DCQ A;  4UFI A;  3FLP A;  2WAO A;  2PLV 3;  1EUT A;  5CBL A;  2PA7 A;  4DO0 A;  2JD4 A;  1O6U A;  1J3R A;  4UOJ A;  5AVP A;  5EYX A;  1MS9 A;  4XXA A;  5HCH A;  4XUO A;  2QNK A;  2JIC A;  2CWM A;  2VVE A;  3WIN E;  3MUY 1;  4W65 A;  4BJ0 A;  1G9C A;  3S57 A;  1SLA A;  4N43 C;  4JV4 A;  1ZBA 2;  4QPI C;  4NID A;  3AYC A;  1KIT A;  1URX A;  2Q1F A;  1VBE 2;  1FNZ A;  3I2J A;  3GAL A;  4QHB A;  2ZGL A;  3RQ0 A;  5KC5 A;  1WMX A;  1NZI A;  1Y4W A;  3VHN A;  1VBA 3;  3MGU A;  1W9F A;  2AEN A;  1WME A;  5FXW A;  3LA3 A;  2QQP A;  3IDA A;  1WLT A;  1LEN A;  3MW4 A;  4BYY A;  1PM7 A;  1EYB A;  2QQV A;  3FN9 A;  3OEA A;  5T3N A;  3RYP A;  3VZM A;  1XXN A;  2DVA A;  5LCW L;  1MS4 A;  2CHH A;  4GH4 A;  3N3H A;  5FK8 A;  3GF6 A;  4QKN A;  5F3G A;  3OYW B;  4AVT A;  4NPM A;  1YRZ A;  1IHM A;  3B9C A;  2EXK A;  5L9R A;  4CDQ A;  5JR2 A;  1QJY 3;  3DKQ A;  1NCR C;  4P9I A;  4PIZ A;  1G9B A;  1O8S A;  4BMB A;  3NO8 A;  1XOY A;  1JHJ A;  1W6P B;  3MPB A;  4QPG C;  3CDZ B;  1AR6 1;  5IFT A;  5FZO A;  3BKZ A;  4FPJ A;  1UU5 A;  4UAP A;  1IGO A;  1W2O A;  2WUH A;  4BQY A;  2CTV A;  1RMU 1;  1RUF 3;  2VD7 A;  4QB1 A;  4D7S A;  3M3C A;  3IIA A;  1NE6 A;  4LBJ A;  3PVO A;  2JDP A;  3KM5 A;  1K5M C;  3NNF A;  2PAM A;  1VBC 3;  2GN3 A;  3MW3 A;  3IN9 A;  1BZW A;  4UYB A;  4XFB A;  2VZT A;  4BCU A;  3I54 A;  4GB3 3;  4WV8 A;  1JZ7 A;  4CCC A;  1ASJ 2;  2P4E A;  3BPZ A;  3KSC A;  4XMA A;  5FZM A;  3SIT A;  4A6S A;  4E27 A;  1HIX A;  2DUO A;  1IKQ A;  4ZU4 A;  4XZP A;  4FTE A;  5FPZ A;  2IXC A;  2XPJ A;  4NUB A;  4XFI A;  1QJX 2;  1CPM A;  2ZGK A;  4R9A A;  1XYN A;  4UW6 A;  4COZ A;  2DDU A;  3DPR A;  5JMO A;  3P6B A;  1JZ6 A;  4XFC A;  4B1L A;  4EYU A;  2J1U A;  5LY2 A;  3OGV A;  1RIN A;  1QDO A;  4BQ5 A;  1WCQ A;  4NRO A;  3DL3 A;  1W9Y A;  1FPN 3;  1PNG A;  1S2K A;  3ZSL A;  2BZD A;  3CIH A;  5G05 L;  2ZX3 A;  2BUK A;  5LA2 A;  3ME2 A;  4GAL A;  3UV9 A;  5L73 A;  3CNA A;  1ZBE 1;  1QJZ A;  1M4W A;  4QXK A;  4XF4 A;  3WDV A;  2FDH A;  5CNA A;  2WSU A;  3VHR A;  1OQE A;  2XOM A;  1HXS 1;  4L0P A;  4XF9 A;  5F2W A;  2VMH A;  3AB0 A;  5FBJ A;  1XND A;  1ONA A;  4MGZ E;  3PMS A;  5DQ0 A;  5JVV A;  4XJW A;  3SKJ E;  1WW4 A;  4GH4 B;  1ENR A;  1VMH A;  5FXX A;  4I3P A;  4I2O A;  1VAK A;  4FQ4 A;  3VN4 A;  2WNE A;  3MDP A;  1QOS A;  5CB7 A;  2I07 B;  4MXW A;  4AZZ A;  5F1R A;  3IBM A;  4AVC A;  1J59 A;  1VBB 1;  1KFU L;  3FJS A;  1GNY A;  3E6B A;  4QXC A;  1UN1 A;  4K8R B;  4AVA A;  3DKW A;  4R9B A;  3OCP A;  2PLV 2;  1RIR A;  4WBB A;  5FPA A;  2VUL A;  4GA9 A;  4P9J A;  3KCY A;  2YXS A;  1HRV 1;  3ATG A;  3I2D A;  1U5I A;  5DMY A;  4XIO A;  1TQ5 A;  1KS4 A;  1I5Z A;  4LA3 A;  4XE9 A;  2ZOE B;  3APB A;  4ZKT B;  1JU3 A;  2VCA A;  2X8K A;  1X82 A;  3VKL A;  1PNF A;  3ZIX A;  4XJ9 A;  4BXF A;  1EAH 3;  3VBU A;  4Q8K A;  4C8D A;  2PN5 A;  1W8F A;  4YW3 A;  4CE8 A;  2KA3 A;  2ZMK A;  2ZXQ A;  4LK6 A;  4WM7 A;  3WHT A;  3VV1 A;  1UXX X;  4PF1 A;  1C1F A;  4CUC A;  5JDB A;  4B4R A;  4C1W A;  3AXD A;  5T50 A;  3T3Y A;  4XJZ A;  4MLO A;  2B7Y A;  4NHX A;  3G6J B;  5CG8 A;  3MIE A;  2HWC 3;  2ZBJ A;  3R6S A;  3S7I A;  1LHO A;  2W87 A;  1IPK A;  1IQD C;  1NXM A;  1Q43 A;  2WNV A;  2KXL A;  4P5H A;  4AF9 A;  5J3U A;  4FO9 A;  3O1S A;  1U5Y A;  4EWE A;  4TZD A;  2PHF A;  3JXS A;  5FPX A;  3U0Z A;  1DGR N;  4Q0V A;  5C5U A;  5IK8 A;  4HXC A;  5A7N A;  2HEW F;  3N9P A;  5HV4 A;  1HJF A;  4A3Z A;  3A7Q A;  1VLN A;  1UIJ A;  2W1W A;  2BGC A;  2IXJ A;  3ACG A;  2OVU A;  1JOJ A;  4XEZ A;  4PJY A;  2QUO A;  1IS5 A;  2VXR A;  3JD7 1;  4IUG A;  3VUO A;  1O7F A;  2BGO A;  1YJL A;  2ZAC A;  3DXT A;  4RHV 3;  5IHR A;  2EF6 A;  1X9T A;  4L92 A;  4HN1 A;  2XJR A;  3KV6 A;  2CSG A;  3ELN A;  1WKY A;  2P6C A;  4DXZ A;  5BNO C;  2VAU A;  4XUR A;  3C8X A;  3WX5 A;  3ACF A;  4XFH A;  3ZIW A;  1Q56 A;  4A7Y A;  3CKH A;  4X8P A;  2WLP A;  2MEV 3;  1AHS A;  2J1S A;  3WOG A;  3VZN A;  3HOB A;  5EWS A;  2D93 A;  2B9V A;  1RUJ 2;  4JQR A;  1S2B A;  4W8J A;  4H7L A;  1GSL A;  2OII A;  2TUN A;  2W91 A;  5F5A A;  3NV2 A;  3O7O A;  4NIA A;  5HXV A;  3RYR A;  5IAT A;  4KG0 A;  4RGA A;  1MS1 A;  1ULD A;  4R52 A;  4XTM A;  1OVS A;  4ZS2 A;  4PF5 A;  1DIW A;  4QB6 A;  5ERL A;  4YVS C;  3UKT A;  2WYS A;  3RWN A;  1I6X A;  3B7M A;  5I0U A;  5BY5 A;  2IFW A;  2DCK A;  1YQC A;  1JBC A;  3T2P A;  2JG8 C;  4CPB D;  3DN7 A;  1C1L A;  3MID A;  4DIQ A;  5C70 A;  4F8A A;  5FRE A;  3AZV A;  3WW3 A;  1GOH A;  1TME 3;  3AKT A;  1ALY A;  4AQT A;  1NKG A;  4NPL A;  4PDW C;  4NPR A;  4EE2 A;  1SFN A;  3JQX A;  5DAQ A;  4C0B A;  4GZ9 A;  4RSU A;  1ZRD A;  2VXJ A;  3GDB A;  4UFH A;  3ES1 A;  1WLW A;  4AFM A;  1VE0 A;  3HN1 A;  4UW3 A;  2PHX A;  2PEL A;  5JUV A;  3D5O A;  2Y38 A;  2WZP P;  1VRB A;  1C57 A;  2YFZ A;  3LPG A;  4RD7 A;  5FY5 A;  2FMD A;  1SHW B;  4Q27 A;  1VRH 2;  4E8C A;  3MLJ A;  2FBE A;  4AGR A;  3NNL A;  1AR8 2;  2RHP A;  1Z78 A;  1BKZ A;  2DBN A;  2VZR A;  2IXI A;  1PVC 3;  1SBD A;  4Q4X 1;  3WEZ A;  3ZSK A;  3V56 A;  3THT A;  4NR1 A;  3M70 A;  4NAO A;  1J3Q A;  5D8A C;  5FPV A;  4CDU C;  4FBF A;  1IS6 A;  1A78 A;  1CJD A;  4IE6 A;  3TEY A;  4OHZ A;  5C71 A;  5FK7 A;  4Q8L A;  4MET A;  4DY3 A;  1ULG A;  1DDL A;  4IEY A;  3K75 B;  5D1I A;  1JH5 A;  1HN1 A;  1YFW A;  1ND2 A;  1W39 A;  1EP0 A;  3KVB A;  2OYZ A;  5T5O A;  1FPN 1;  2GN7 A;  1CAU B;  1OMI A;  3O0W A;  5GZF A;  5IAV A;  2BW8 A;  2Y8K A;  3UJQ A;  4WM7 C;  5KHK A;  5FZF A;  4XQ4 A;  3ALQ A;  5FZA A;  3IAP A;  3C7E A;  5LEK A;  5FZE A;  1PZ9 A;  2WS9 3;  3KV4 A;  3TNQ A;  2HYX A;  1J58 A;  2B5H A;  4IND A;  5C8C B;  1F2N A;  2XQX A;  4GWN A;  2BU9 A;  1RIT A;  4K9S A;  4CEW B;  2GMP A;  3L2H A;  4NIH A;  1YI7 A;  1KJR A;  2DCT A;  4PQ9 A;  2E26 A;  4AEJ A;  2A3X A;  3P5B A;  1OT5 A;  2ZML A;  5EFU A;  4DXR A;  5A3P A;  5JZG B;  4CSW A;  4XAB A;  1OH3 A;  3FFQ A;  2WRA A;  2WZ8 A;  5EJ1 B;  4YZ3 A;  1J1T A;  1W0O A;  3A0N A;  5FZC A;  4OLL A;  2ZJC A;  2ZGP A;  3SH3 A;  4D0Q A;  1C4R A;  1WZX A;  2XUM A;  3C2U A;  3FL7 A;  2W46 A;  2XWJ B;  1W90 A;  5CVR A;  4FPK A;  1JYI A;  4Z8B A;  5DAW A;  1QJF A;  1Y3T A;  2YZ4 A;  4QAW A;  1NQD A;  3PU8 A;  5JXH A;  2V72 A;  2MHF A;  2EXH A;  2R04 3;  4HSL A;  5GKA C;  2UWB A;  5FZG A;  2P3Y A;  5A6Z A;  3T4V A;  3T30 A;  5BNN A;  4K8F A;  1JYV A;  2FMY A;  3ZYI B;  3PME A;  2WFF 3;  4COY A;  3LDB A;  3BN6 A;  3ZXK A;  1H4H A;  1HJG A;  5FY8 A;  4YZ1 A;  2RS1 3;  1RJ7 A;  3POE A;  4UFM A;  2A7A A;  2RS1 1;  4QPI B;  4KBB A;  5EZW A;  2ARB A;  4QKF A;  2YBP A;  4OHX A;  4WM7 B;  3B01 A;  3QBQ A;  4GAZ A;  1O91 A;  1HB3 A;  3FUQ A;  3H8O A;  4HK8 A;  4DEQ A;  1IPJ A;  5HI0 A;  1AL0 G;  2ZS6 B;  2XLA A;  5E16 A;  2OQ6 A;  2G1M A;  1FNY A;  3PVN A;  4XF3 A;  2VZS A;  4CDW B;  1KD7 A;  4LE3 A;  4XJU A;  2HWC 1;  3AZW A;  2JDY A;  5FMO S;  3PTY A;  3LSE A;  5FP4 A;  5IUQ A;  4IGP A;  1GU3 A;  1O4T A;  2P3K A;  1AR6 2;  4J25 A;  3TRS B;  4E4H A;  1S0I A;  1UOJ A;  2P37 A;  2Z5W A;  1ENQ A;  1UYX A;  2D6K A;  2C24 A;  2WO1 A;  3WNL A;  2GP3 A;  2RG4 A;  2VQT A;  4OCT A;  4FTS A;  4CEW A;  4ET7 A;  1EY2 A;  1G7Y A;  2JKX A;  3V65 A;  2BPA 2;  2WNU C;  5IVC A;  1E57 A;  2HH9 A;  3ZXA C;  5HPO A;  5A3N A;  4HN0 A;  4XDO A;  3RSJ A;  4IGO A;  2WFP A;  5FO8 B;  3T0A A;  1OBN A;  2DV9 A;  5FYU A;  4XAE A;  3RZH A;  4HSJ A;  1DZR A;  4XQW A;  1VB4 A;  3WUC A;  1NY7 2;  5FUN A;  2JE9 A;  4NMI A;  4DB5 A;  2B8M A;  4BE3 A;  3H0O A;  4IV1 A;  4GWI A;  1QU0 A;  5FYI A;  3O1O A;  3C7F A;  3ILF A;  3FBM A;  4YSF A;  3O1T A;  4AI2 A;  1LUL A;  2UWC A;  3SXW A;  5K9Y A;  1LU2 A;  2JDZ A;  1JN2 P;  3H8R A;  2XON A;  4IEO A;  1AZD A;  1R1A 3;  3ZMN A;  3TNP B;  2GH8 A;  4LOR A;  4NIG A;  4QQH A;  2WLQ A;  3FX3 A;  2VTF A;  1RYY A;  1W0N A;  3MFC A;  3C3V A;  2MEV 1;  1SQ4 A;  1UZY A;  1WA6 X;  4Z1V A;  3GGL A;  1GZT A;  1E5H A;  3JBG 2;  4OMC A;  4N7I A;  1N1S A;  1RVF 3;  1JYX A;  1CAW B;  1WCS A;  2VEC A;  3BIE A;  3ZX7 A;  3N9L A;  2GC1 A;  2X5I C;  3CQO A;  3C7O A;  3HWJ A;  1LOF C;  4A4A A;  1PMI A;  2ARX A;  3MIH A;  2ZEX A;  3VZJ A;  1HRI 3;  2JEN A;  3NRU A;  3PNA A;  3H7Y A;  3KZ4 C;  3T2T A;  2XHN A;  1DHK B;  1AJO A;  5FZ0 A;  3I2O A;  2D5F A;  2HLE A;  3K3N A;  4A42 A;  3SIS A;  2DTW A;  2CV6 A;  2GU9 A;  4N9H A;  1CAX B;  2D3R A;  2CNA A;  1OUS A;  2ZAH A;  1XNC A;  1F35 A;  4B3N A;  3ZDS A;  1TNF A;  5FYY A;  3I97 A;  1XNA A;  4FP3 A;  1AR7 3;  5AC9 3;  1MVE A;  1IKP A;  1OA2 A;  4GH4 C;  1VR3 A;  2BOI A;  3W58 A;  5FBZ A;  2W1U A;  4UT5 A;  2HWE 2;  2WN2 A;  2JEC A;  2R1D A;  2Q4S A;  3KF3 A;  4IV1 B;  4FOW A;  4BWO A;  4RN5 A;  4V2W A;  3WCS A;  2GZW A;  3FUO A;  1RVF 1;  1UY4 A;  3BIW E;  4YG0 A;  2Q8D A;  4D7Y A;  2A1X A;  1QXR A;  5ABJ C;  5SV5 A;  3IMM A;  3NKG A;  3LQC A;  5F3E A;  3UKV A;  4OQ8 A;  2W68 A;  1PO2 2;  2NYY A;  4Q4X 3;  1KJL A;  3OYW A;  3KQ4 B;  2A5Z A;  3WF2 A;  1VB2 A;  3GJB A;  1PZ8 A;  3ILN A;  3I49 A;  3VDC A;  3OGS A;  1DYO A;  4LUK A;  1UD1 A;  2VNO A;  2E33 A;  5DN2 A;  2ILM A;  2ZEY A;  1WA4 A;  2RJK A;  4MGK E;  4DEV A;  2VR4 A;  3AC0 A;  3CZJ A;  3PUA A;  1YFX A;  3GCW A;  4Z82 A;  1GZC A;  3TOJ A;  4U2A A;  1SDW A;  1R1A 2;  4QPW A;  3TEW A;  1AYM 1;  5IYY A;  5E1R A;  5KXD A;  1G8W A;  5FOB B;  4Q0S A;  4DXS A;  4E4Z A;  3V0B A;  4F83 A;  1AR9 2;  2LTN A;  1I3H A;  2QTW B;  3R4U A;  1GP4 A;  3ABZ A;  4PIX A;  5FYS A;  1SLC A;  2RS3 1;  1PM4 A;  2YBS A;  3POG A;  3VBR A;  4BU2 A;  4L11 A;  3T1L A;  1UZW A;  5T5P A;  2EVX A;  5JXI A;  1MS5 A;  5KBF A;  1GUI A;  1TME 2;  3OPZ A;  1K5M B;  4IET A;  3ZXD A;  1B35 C;  2P34 A;  1A8M A;  2QQJ A;  1O3T A;  1FAT A;  3JZV A;  3H9A A;  4IEU A;  3N9M A;  4PLO A;  4E9K A;  1EPZ A;  1GMM A;  2FZ2 A;  2NN8 A;  2D6N A;  4W6X A;  1CZS A;  1YFU A;  1OVP A;  2GAU A;  5FOJ B;  4JKK A;  2O1Q A;  4CDU B;  1TEI A;  2Y6H A;  5ABJ B;  5JSR A;  2WO3 A;  3AVS A;  5C4W B;  2WDB A;  3DPR C;  1SPP B;  2GME A;  3E1F 1;  3WF0 A;  3AP4 A;  1NAE A;  4AQS A;  3LE0 A;  4L97 A;  4YG3 A;  3U78 A;  3ZLI A;  3RG0 A;  5IVV A;  5I0T A;  3PJY A;  1O3R A;  2QQM A;  2UY8 A;  2PQQ A;  2UYB A;  3AP7 A;  3THP A;  1HB2 A;  3AMN A;  4JDM A;  2OT7 A;  5E89 A;  1MQT B;  4B7E A;  5SV8 A;  4ZZ5 A;  1DBN A;  4BH9 A;  2RM2 1;  3JB8 A;  5IVF A;  4Z92 B;  4F7Z A;  4LBQ D;  5H9P A;  2QJV A;  3WDW A;  4RGG A;  4AL9 A;  2R04 2;  1MPX A;  2IC1 A;  2W1S A;  2PQS A;  1PGS A;  3J8F 1;  3O1P A;  4MG2 A;  1QJU 2;  2X5I B;  4IW3 A;  4FVV A;  1T6G C;  3B94 A;  1H8V A;  3KV5 A;  5FP7 A;  1G6N A;  4YZ5 A;  5TSW A;  2GSY A;  4Y3O A;  2HWB 3;  5FPL A;  2JJ6 A;  2VC9 A;  1Z7S 3;  4BQ2 A;  2ZEW A;  1WBF A;  2VY0 A;  2E53 A;  5D21 A;  1QMJ A;  4QHO A;  5FYM A;  1LNS A;  3BAL A;  4HKW A;  1PVC 2;  1KXG A;  2XLG A;  5L36 A;  1SMV A;  4M01 A;  1Z7S 1;  1LOF A;  2WIN B;  4ISR A;  3S5Q A;  1VJ2 A;  2N7G A;  2J42 A;  2XKO A;  5CEH A;  3D8C A;  3JD7 3;  4XJA A;  1BVV A;  4XPV A;  3O1M A;  4CRQ A;  3ZDV A;  3WNM A;  5FYT A;  5LBE A;  4A44 A;  1O4Y A;  5F5C A;  4EV0 A;  2YDE A;  1NY7 1;  4XQD A;  2BTV C;  2R0F A;  4IV3 A;  4D3W A;  2E6V A;  3HEI A;  2A6V A;  4XHB A;  3WQ7 A;  1QHD A;  1W03 A;  2YUE A;  3CHX A;  3DPR B;  2YY1 A;  2XJV A;  2BEO A;  2ZHK A;  3H1M A;  4AEM A;  1FT9 A;  1HW5 A;  1ZYB A;  2WAA A;  1VAM A;  2HWE 3;  3MZH A;  1H2N A;  1OHF A;  2HWE 1;  5A3T A;  4HKO A;  2B39 A;  3N9N A;  5FJK A;  1DQ1 A;  4TYS A;  5F2S A;  5J98 B;  3PUS A;  4FPY A;  5FY0 A;  1W6N B;  4Y1U A;  1QH7 A;  4QX2 A;  4YFW A;  3J7N A;  4YW2 A;  4M4R A;  4IE5 A;  4X8N A;  2GDF A;  1PVX A;  1DQ5 A;  2RS3 2;  3R05 A;  2IUW A;  4H7M A;  2W95 A;  4JKL A;  2Y0I A;  3GYD A;  5GZE A;  1FAY A;  2ARA A;  2RVA A;  4IEP A;  1U5Z A;  3V0A A;  3IPV A;  2FD8 A;  4G3Y C;  2XWB B;  3J7H A;  1F5J A;  4PDW A;  2IWG B;  2DVD A;  5F9T A;  4LBN A;  4Q1P A;  1S4C A;  5FMB A;  2FDK A;  1FI2 A;  1YXW A;  5HCF A;  4I01 A;  2XL9 A;  2C6S A;  2VZQ A;  1D4V B;  3C7H A;  3EMR A;  2UY9 A;  2YV8 A;  3OUI A;  4HMZ A;  3Q9O A;  5ACA 2;  4Y1Y A;  5A3L A;  1CX1 A;  2WNU B;  1GIC A;  3H8X A;  4LIV A;  1AX1 A;  2W2I A;  3N7J A;  1BQP A;  4ITC A;  4ONU A;  5C3R A;  4QQ2 A;  1BHG A;  2ZGM A;  2YPD A;  2XJQ A;  4LR4 A;  3VHO A;  1VBD 3;  4M3C F;  1JYT A;  3SCF A;  4NHL A;  5APA A;  5FV3 A;  3ZN4 A;  2XLF A;  3GCX A;  2GC2 A;  3KT7 A;  1JU4 A;  4K7J A;  1HB4 A;  1BK1 A;  2BP6 A;  1YNA A;  3NKT A;  3DUI A;  5GLT A;  3WDY A;  1VBC 1;  4A2U A;  2HKX A;  5H9Q A;  4YVS A;  2Q8E A;  1N3Q A;  3WW2 A;  2PHR A;  4BIF A;  1W6Q B;  2BFU L;  4GB3 2;  1QQP 2;  4OI0 A;  1NA1 C;  5FY1 A;  5GZG A;  3OPW A;  4UBG A;  5BNP C;  2CAV A;  5A6Y A;  2VBP A;  3CZU A;  4XDP A;  5FO9 B;  5FR3 A;  1VAV A;  2V73 A;  4Y20 A;  4Y5S A;  5A32 B;  2GH2 A;  3ZN6 A;  4ATE A;  3MW2 A;  5FZI A;  1X7N A;  3ZR6 A;  1H1A A;  3IDC B;  1HV1 A;  2WNV B;  3BUC A;  4PHZ A;  5C9A C;  5E88 A;  1XRU A;  1W8H A;  5KXB A;  4CUG A;  2E51 A;  2PAK A;  5FZ4 A;  1RUI 2;  2W94 A;  4UFL A;  3VBR B;  1PGL 1;  3E6C C;  1SCR A;  2P17 A;  3SC7 X;  1AYM 3;  1H8T C;  4LBL A;  5ANQ A;  2CL2 A;  5FYV A;  1ST8 A;  2R30 A;  4QX8 A;  2W47 A;  3FE5 A;  4L2N A;  4CP2 A;  1GQG A;  4QM9 A;  3WDX A;  2XQR A;  1SCS A;  2WSV A;  1IPS A;  2OUJ A;  2QKD A;  5GM0 A;  2J1T A;  4URT A;  4NO4 A;  1W6O A;  3WP5 A;  3D4K A;  5EHD A;  4LHL A;  1ZZ8 A;  1I9R A;  2HBT A;  5DPN A;  4IEV A;  2JDU A;  4C91 A;  2BGP A;  2TEP A;  3ACH A;  1BCX A;  1NT0 A;  2B46 X;  3VBO B;  2ZZQ A;  1F31 A;  3HJR A;  4L8Q A;  1HLC A;  2A70 A;  1OKO A;  2ARE A;  4ZPI A;  1ZRE A;  2P2K A;  1MQT C;  3BYW A;  3P3N A;  1ASJ 1;  1VBE 3;  1ODM A;  3VZL A;  2EIG A;  4NHK A;  4RFT 0;  1RUH 3;  4WZC A;  5JIA A;  2ZAB A;  4Y4Y A;  4YW7 A;  2EXJ A;  4YRD A;  1LB2 A;  1PO1 2;  3WY6 A;  3RI9 A;  5GAL A;  5FO7 B;  4CUB A;  2GNM A;  1UOF A;  4ASK A;  2R06 1;  4QQO A;  5FTT C;  4FAG A;  5JXJ A;  2XG3 A;  3GHM A;  2UU8 A;  2Y6F A;  1MZ6 A;  5F37 A;  1HRV 3;  5FZ3 A;  2BVB A;  2XJU A;  2CWS A;  1POV 0; 
#chains in the Genus database with same CATH homology
 4DIQ A;  5FUP A;  5A7S A;  5F2W A;  5FP8 A;  2XDV A;  5FBJ A;  4Y4R A;  5FP4 A;  4IGP A;  5K4L A;  5IVB A;  4E4H A;  3N9Q A;  3ZPO A;  4IGQ A;  4QWN A;  5E6H A;  5FXX A;  5FYS A;  5FZH A;  2YBS A;  4V2V A;  4BU2 A;  5F5I A;  4UF0 A;  5FZ9 A;  3RVH A;  4EZ4 A;  5FYC A;  5A3W A;  4LIT A;  4DO0 A;  2OX0 A;  2GP3 A;  3UYJ A;  5FY4 A;  2PXJ A;  2GP5 A;  4QX7 A;  2YU1 A;  5IVY A;  1VRB A;  5IVC A;  3AVR A;  3N9M A;  4QXC A;  5FY5 A;  5A3N A;  2OQ7 A;  4XDO A;  4LIV A;  2W2I A;  4IGO A;  3PTR B;  5FYU A;  4Y33 A;  5FPA A;  3PU3 A;  2YPD A;  5FUN A;  5FYB A;  5KR7 A;  3AVS A;  3OPT A;  5FPV A;  3PUQ A;  5FV3 A;  5FYI A;  2XUE A;  5FY9 A;  3U78 A;  3ZLI A;  5IVV A;  4HON A;  4D6R A;  4GD4 A;  5FXW A;  4BXF A;  2OT7 A;  4QXH A;  4C8D A;  4CCO A;  4CCL A;  3KVB A;  5FZ6 A;  4URA A;  2Q8E A;  4EZH A;  4D6S A;  5IVF A;  5LY1 A;  5FZF A;  5F3G A;  2WWJ A;  5F3I A;  5FZA A;  3K2O A;  5IW0 A;  2YU2 A;  3U4S A;  4TN7 A;  5FY1 A;  3OPW A;  5FZE A;  4AI9 A;  3KV4 A;  4D6Q A;  3LD8 A;  3PUR A;  4XDP A;  5F39 A;  2P5B A;  5A80 A;  5LW9 A;  4QU1 A;  5FZL A;  3KV5 A;  5FZI A;  3N9L A;  5FP7 A;  5FP9 A;  5FZB A;  4LXL A;  3AL6 A;  5A3P A;  5FYZ A;  2XXZ A;  2OS2 A;  5FZO A;  4Y3O A;  5FPL A;  4CSW A;  4CUG A;  5FZ4 A;  4GJZ A;  5FYH A;  5LWB A;  5FZ0 A;  3NJY A;  5FPU A;  4CCJ A;  4CCK A;  2VD7 A;  3K3N A;  5ANQ A;  5FYV A;  3N9P A;  5FZC A;  5FYM A;  5A7N A;  5FPB A;  5ISL A;  4QX8 A;  5IWF A;  5IVJ A;  5A7O A;  5A1L A;  5FYY A;  5FZO B;  5CEH A;  3KV9 A;  4LIU A;  3PDQ A;  3DXT A;  3PU8 A;  5FZD A;  4CCM A;  5F3C A;  5IVE A;  5FXZ A;  4UF0 B;  4CCN A;  4QXB A;  3KV6 A;  5FYT A;  5F32 A;  5F5C A;  5FJH A;  5FZM A;  5FZG A;  5FXV A;  4V2W A;  5A7W B;  2YBK A;  3AL5 A;  2Q8D A;  4NUB A;  5FP3 A;  3K3O A;  5FZ7 A;  5F3E A;  3LDB A;  5FZ8 A;  5FY8 A;  2WWU A;  4HOO A;  4BIS A;  5A7Q A;  2XML A;  5FWJ A;  5A3T A;  2YBP A;  3N9N A;  3N9O A;  4GJY A;  5F5A A;  5FJK A;  5LY2 A;  4AAP A;  4EYU A;  5F2S A;  5A7W A;  4GAZ A;  3PUS A;  5FWE A;  5FY0 A;  3KVA A;  5FZK A;  5FY7 A;  4ASK A;  2OQ6 A;  5A7P A;  3PUA A;  5F37 A;  2Q8C A;  5FZ1 A;  5FZ3 A;  5A1F A;  3DXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...