3PDQA

Crystal structure of jmjd2a complexed with bipyridyl inhibitor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
353
structure length
353
Chain Sequence
SESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Inhibition of histone demethylases by 4-carboxy-2,2'-bipyridyl compounds
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 114
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2010-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3pdqA01
5F39A 5A7NA 4TN7A 5FY7A 3N9LA 5FYUA 5FY5A 5A3TA 3NJYA 5FZ6A 5FYYA 1VRBA 2YBKA 4DO0A 4LIVA 4D6SA 4AI9A 3RVHA 4CCKA 3AVRA 3N9NA 5FPBA 2YU2A 3OPTA 5FP7A 3U4SA 4CSWA 5FYMA 4IGQA 5A7QA 5FY0A 4D6QA 4EYUA 4URAA 4LIUA 5FZDA 4D6RA 2WWJA 3AVSA 4GAZA 3ZLIA 5ISLA 3K2OA 2XXZA 3AL6A 3PU3A 5FV3A 5FZ3A 5FYTA 5FPAA 5FXWA 3K3OA 4QX8A 4QX7A 5F3GA 5IVEA 3AL5A 5CEHA 4IGOA 5FZ4A 5FZFA 2GP3A 3ZPOA 5E6HA 5F5CA 2YBPA 5FXZA 5FWEA 4CCOA 4GD4A 2Q8CA 2OT7A 5IVFA 3N9MA 4XDPA 2P5BA 5F32A 5IVJA 3PUQA 3PUAA 4CCMA 3KV4A 4LITA 2PXJA 3KV5A 4EZ4A 4V2WA 4GJZA 5FZHA 5FPVA 5FYBA 5FWJA 5FP4A 5FZBA 2OX0A 4BXFA 5A3WA 4QWNA 2VD7A 5FZ7A 4C8DA 3KVAA 4AAPA 5A7PA 5F3CA 4QXHA 2XMLA 5ANQA 5A80A 4UF0B 5LY1A 4NUBA 5FY1A 5FZMA 3U78A 5FY9A 2W2IA 5FYSA 4QU1A 3OPWA 4QXCA 3N9QA 5LY2A 5FYZA 3LDBA 5FY4A 4LXLA 5FUNA 4UF0A 3KV9A 5FZ9A 5IVYA 2WWUA 4E4HA 5F2SA 5FZGA 5A1LA 2OQ7A 5IWFA 5A3NA 4XDOA 3N9OA 5A3PA 3LD8A 3PDQA 3PURA 5FBJA 2Q8EA 2YU1A 4DIQA 5FZ0A 3PTRB 2YBSA 5F5IA 5FYVA 5FZOB 5A7OA 5F3IA 5FZAA 3DXTA 3UYJA 4HOOA 2OS2A 5FJKA 5FZCA 4CCJA 5FY8A 2OQ6A 5FP9A 2GP5A 2XUEA 5KR7A 5FZ1A 5F3EA 5F37A 5A7WB 3K3NA 5FYHA 5FP8A 5IVVA 5K4LA 5FUPA 5A7SA 5LWBA 5F5AA 5FZKA 5F2WA 4ASKA 5FYCA 5FP3A 2XDVA 5A7WA 5FZ8A 4CCNA 5A1FA 4HONA 4EZHA 5FYIA 4Y3OA 2YPDA 4Y4RA 4IGPA 5FZLA 4Y33A 4BU2A 3KVBA 4QXBA 5IVCA 4GJYA 5IVBA 3PU8A 2Q8DA 4BISA 5FXVA 5FPLA 4V2VA 5FPUA 3N9PA 4CUGA 5FZIA 5FXXA 3PUSA 5FZOA 5FZEA 3KV6A 4CCLA 5IW0A 5LW9A 5FJHA 3DXUA
chains in the Genus database with same CATH superfamily
1C8NA 1AL22 1HIXA 4QT6A 4ATEA 1V6MA 1AXKA 1HB1A 1K5JA 2BV4A 3DECA 1RUE1 2BFUS 4JRLA 4MHUA 4MXVA 5LA2A 4YVSB 4XOGA 2QKDA 5FMDA 1C5HA 3MV11 2PHDA 2VMHA 3LF7A 3EXUA 1WMFA 4GWIA 2JEMA 3RS6A 1HW5A 4P9LA 1RUH2 2PHFA 1W6PB 2XXZA 5FQ0B 4XFFA 3IPVB 5KXDA 1MQTB 4XC9A 4YVWC 3OGRA 4GKXA 1RUJ1 1XU2A 2DVFA 2RM21 2YY1A 5FPAA 3S7IA 5IVEA 4XETA 4URTA 4EE2A 4RSUA 1MPXA 2UWCA 4XFIA 5D21A 3CNAA 2P37A 3KT1A 2E51A 3THTA 4DPNA 1L7RA 5KHGA 1GQHA 1KDMA 1TZOA 1K12A 2RR13 4L11A 2YZ4A 4V2WA 4A3XA 1VBE1 3A0NA 5FWJA 1EY2A 5DMYA 4XPVA 1MVEA 2ZPXA 4N9IA 5H9PA 4XILA 1GSLA 3I97A 5F3CA 3ECQA 1VBA3 5FRAA 2WWSA 4YM0A 4BPZA 1DGWX 1W6NB 3CU7A 4CDUA 3TN92 1FPN1 2R073 5CZKA 3NJZA 4F3JA 5ACA2 2RS11 4H7LA 3WG3A 3T0DA 4Z2WA 1JZ6A 4A6SA 2ZGTA 4OUMA 5ABJB 3WNXA 3WDYA 3OF1A 4O9EA 1N3OA 2WO3A 4S2GA 3ITQA 1YYNA 5A1LA 3ALQA 1UY1A 1IS6A 2NMNA 3KS7A 1CZTA 4H7MA 1G7YA 1SCSA 3HPNA 3WUCA 3BU7A 3PURA 2Q8EA 3ABZA 1POV3 1GZWA 3LA2A 1RUF3 4GA9A 2VVEA 5FZOB 2RHPA 2B46X 4DOUA 3AYDA 4OHYA 2OZJA 5GJ6A 1W2TA 3GXUA 1J59A 4L99A 5LCWL 2VY0A 2JG8A 3D82A 4X6QB 5J3UA 3GHNA 4XDQA 4FPOB 4YWAA 2XUEA 5JZGA 1AR63 1PK6B 3HEIA 4GULA 3K4ZA 1UZ0A 3ZFGB 4YM1A 4YW5A 4NIHA 5K4LA 1BHGA 5FOJB 1WA6X 3VD5A 3I2KA 2IFWA 3ELNA 3GBGA 1S2KA 1N1VA 2ZEZA 1JXNA 3VHOA 4IE5A 1O3QA 1I5PA 2B39A 3POIA 2EXIA 3AYAA 1PO21 1UMZA 3AXEA 4M00A 1QMJA 2YGLA 4K9SA 2OVUA 1RUE3 3AMNA 4LNVA 4CDXA 3I2IA 2AYHA 2CV6A 4TLGA 5J96B 3Q9OA 3P3PA 3ATGA 2JJ6A 1C1FA 3IDAA 2XONA 4HBNA 5FZIA 1D4VB 3O1OA 4IV1B 3M3IA 3MIHA 4MGTA 3FLRA 5CA6A 2NPIA 2WZ8A 3QD6A 2C26A 3I2GA 5FY7A 4AVVA 5FYYA 2JD9A 3HAGA 5LRRA 3ZN6A 1LODA 4MO3M 4CDUB 4N9HA 1YQCA 3WF4A 4AOCA 4IGQA 1N3PA 1N1YA 4TTGA 4DEVA 1FV2A 2DBIA 2DF7A 2PHTA 5HBAA 4E27A 3UKTA 3M4FA 2MNGA 2AEZA 5I8SA 4W6XA 4JKLA 3QLQA 4M4RA 4YSFA 2PLV1 4JDNA 1JYNA 1WCDJ 2HWB3 3BTXA 2JDPA 1RUD3 5L7OC 1GZWB 1EPZA 4A6OA 1UOJA 1S0IA 1ZZ9A 1OA4A 1QNWA 2FZ1A 2IXHA 2XJVA 3MW4A 4Q29A 1ZZ6A 1IQDC 3AXDA 5FXZA 3LEMA 1HKDA 3FC0A 3KHCA 3VBRA 3O1UA 5EFUA 4UXAA 3WDUA 1JS9A 2PXJA 3KV5A 2ZEYA 3FLTA 2VOWA 4BJ0A 1WGPA 1JU3A 2VZQA 2WNVA 5KC6A 1UF2C 1V9U3 4HXCA 4N43C 5FP4A 3RFRA 5AC91 5JZGB 1JOJA 4NIIA 4C8DA 4COUA 4E2SA 4IEWA 2BVBA 4RYDA 5GLZA 3BTYA 1N3QA 5F7UA 1WW6A 2IXLA 2P6CA 2W68A 2X8KA 5A3UA 5I91A 1DGLA 2VOKA 1ZREA 3RYKA 3MW2A 1XE8A 2VNGA 5FPZA 3VD7A 1ZRRA 3ACIA 1K5MB 1N1SA 1W8UA 2BERA 4F83A 2BJSA 4WVWA 1GWMA 4HMZA 2EVXA 4LBKA 3ZXJA 3AKTA 5C8CC 1MR5A 3MICA 5A6XA 1TMF1 5DUUA 2E32A 4UFIA 5FY4A 1C8M2 1GZTA 1F4AA 1YXWA 4MLOA 5FUNA 4GB31 5IVYA 5JSPA 4GZ9A 5BNOA 2HYXA 1CZVA 1AF9A 2OQ7A 2PELA 2VBBA 3FFZA 1GUIA 1CVNA 2DUQA 4TLFA 1UYXA 3WW3A 1YFUA 4AFAA 2ZHNA 3AP5A 2HEYF 4LLFA 4NAMA 2YBSA 3FBYA 4AEMA 3OBAA 3T1MA 2ZKLA 4IV3C 3IT8A 3N7LA 1COV1 2I45A 2Z5WA 5EJZB 2R49A 2WZEA 2AREA 2PHRA 3GZTB 2R16A 4KMQA 3VKOA 5LA0A 3BUCA 3Q8CA 2ZKNA 4XE9A 3ZN6B 1W6OA 3IZOA 4FFHA 1VJ2A 3VD3A 3WSOA 5JOXA 3MLKA 1PGSA 5IK7A 5J48A 5J1XA 1YO8A 1KFXL 2WYFA 3FHAA 4MGZE 5SV8A 1Z78A 5BXXA 1HRV2 2VQTA 5FYHA 3ZFFA 1QJU1 1NA1A 1G8WA 4RGAA 5APAA 1QEXA 1O5UA 2F4LA 1DIWA 1ENRA 5FUPA 2A6WA 2WL1A 3VDAA 5F2WA 1JZ5A 5FYCA 3UK9A 5CKQA 1AVBA 1ND3B 1S1AA 1HQNA 3JQWA 2XJQA 5KHIA 1XNKA 1CD3G 3MDPA 4BIOA 1UO9A 1DP0A 3PHMA 1MS4A 2YPDA 5A70A 1XE7A 3VDCA 5JMOA 2WS91 3EMRA 3NJVA 4BU2A 4BYYA 3AP7A 1POV0 4RQPA 2C6SA 5KHHA 3USSA 3VBRB 1O4YA 4Q2FA 2VU9A 4QB1A 4YM2A 5JR7B 1LB2A 1X36A 2GH2A 3WCSA 4K8RB 3OYWB 1N47A 3PUSA 2J42A 5LBFA 3JCIA 4YLZA 5FJHA 4HN1A 1JZ8A 4NVPA 4Q4Y1 3DN7A 1PO11 4DXTA 1EUUA 1RHI3 3AKPA 2VMDA 2IFRA 4ZPIA 1OURA 1QOTA 5DDJ3 3WF2A 5L19A 1NXD1 4J1WA 1QDCA 4YZ1A 4PDWA 3VLBB 4CE8A 2WLQA 5EJ3A 4D6QA 3ZPYA 4BQXA 5FDBA 1YI9A 2VQAA 1CX1A 3AVSA 1XNAA 1HJFA 4AEJA 4LMFA 3WHTA 4JGYA 4B8EA 2RR12 5BNOB 1WLDA 3POSA 2XQRA 4AQ2A 2WN3A 4RR3C 2ZGMA 3E5XA 1QJEA 2ZGSA 2K2SA 1CIWA 2WUHA 5KHKA 2EIDA 1TME1 2X5IA 3PIGA 5HPOA 1VBA2 1W0PA 2Y6LA 2OT7A 5IVFA 3WG1A 5D8AB 3PUQA 2R072 3VZKA 3ZR6A 4JGZC 1QH6A 3HVDA 4CCMA 1Q8PA 1WZXA 3SKJE 2WIIB 2DCKA 3DYOA 3RQ0A 3VBFC 1UN1A 1RIRA 1Y9MA 4CZSA 2HWD3 3IM0A 3L9JT 3MEPA 5FZBA 3ZFFB 5A3WA 4GB33 4LT5A 2DCZA 3KVAA 1ENSA 1NA1B 4UT5A 1GNYA 1D4M1 1XOYA 2ZGRA 3DPRA 4Q4W1 5IAVA 4HKLA 4FXKB 5EQUA 3ZXDA 4IE6A 5FY1A 3U78A 4QX2A 3TBDA 1RUF2 1OQDA 5FLHA 4OZXA 5FYSA 4FFFA 4YVSC 1RYYA 3OUJA 4LXLA 2YMZA 3KV9A 2WO7A 2H6CA 4RQPB 2VTXJ 1SDDB 1JYTA 1GFF2 5A3NA 1H4GA 4R9BA 4LORA 1VB4A 3N9OA 2Q1MA 2HEWF 3JZVA 2VG9A 3RDIA 4IEQA 3RSJA 2VW0A 2YU1A 4RGKA 4XFCA 4AEDC 1AR62 3LOBA 2RS33 4KG8A 2XPJA 2XL9A 1M06G 2WC2A 3AJYA 4V1PA 3N7KA 4RFT0 3HNYM 3ON7A 3ENRA 2CU5A 4QPGB 5JI7A 2JE9A 3ZYPA 3GZEA 2B8MA 2YC2A 2VBDA 3IN9A 3LA3A 1CAUA 4C1XA 1SFNA 2DBNA 4R9DA 4YW4A 2WS93 1TQ5A 4BQWA 3KMHA 5IVVA 2DFBA 2D3RA 2RVAA 1VBB3 3HN1A 3AK0A 1RUE2 4E4ZA 5F5AA 4AF9A 4PBOA 1EUTA 4JGYB 1OOPC 1NLSA 2XDVA 3IAPA 1YEWA 4OQ9A 5A7WA 3M70A 4N7UA 1JOBA 3U37A 4WM8C 1NUKA 2Y0OA 4QHBA 4EZHA 1PO13 1UYPA 5C4WB 2VECA 4IGPA 4MADA 4XMIA 2X5IB 1GOFA 1Q8VA 3R0RA 4MGSA 1AUYA 5DN2A 4KWKA 3W5MA 2BOJA 1JW6A 4FPCA 2Y6FA 1Q8SA 2GMMA 4RGGA 1T6BX 5ANNA 4UYBA 5BNNB 1IQAA 2AGSA 3NWKA 2QQWA 4J1XA 4FFIA 2TNFA 3E5UA 3KGLA 3BTZA 1D2QA 3ZN4A 5J37A 1W8TA 3O1PA 1ZZ7A 4L0PA 4AI3A 2YBKA 3RZHA 2V72A 2WKKA 2HWB2 5EP9A 4FTBA 4NROA 5DAQA 1RUD2 1SZBA 3K75B 3T3YA 4CCKA 1LU1A 2E31A 4XYXA 3VBOB 2ZGOA 5FYMA 5AVAA 1AR81 1RUNA 2XWBB 3U11A 1AXZA 4NOTA 3PL0A 1PK6C 1VMHA 1C4RA 1YQ8A 4FQ4A 3VZNA 5HI0A 3HT2A 3SH5A 3H8UA 3H42B 3H7YA 1DZRA 2WNOA 1UIKA 4O7XA 3ZFGC 4C90A 3POFA 4L2NA 4RS5B 3S7EA 3OPZA 4ORFA 1AJOA 4DMIA 1V9U2 3NO8A 4XQ4A 4X8PA 4LBJA 3M3CA 1Q56A 2YBPA 2RJKA 1D7PM 4ISRA 3WLUA 3WXPA 4F7ZA 5FMCA 3C7EA 3LSDA 5FOBB 1QQP3 1FOD1 2JDYA 4XCAA 4HK8A 3U14A 3R6SA 4LITA 5LBEA 1S0BA 2A7AA 4GJZA 2DYCA 2EF6A 3AMPA 1CAUB 3M8LA 2WAAA 1RVF3 3D8CA 5GALA 5HXVA 5JXIA 2W1UA 1KGYA 5IK5A 1ZBE3 4FPJA 4JHZA 1VLNA 1XU1A 3WW2A 4IV1C 3SISA 5J36A 4Y5SA 4WZFA 1ONAA 3HNBM 1BMV2 4UF0B 3FWEA 3USUB 1VBC1 1OH3A 4ZHNA 3S30A 2YROA 3VKMA 3OPWA 5CVRA 2BEOA 4CU9A 2R30A 4XUQA 4XABA 1VALA 5DAPA 3RG0A 4DUVA 4QB2A 1NYWA 3T2PA 1W8NA 4P08A 4FOWA 5LATA 2FMYA 1Z7S1 1O3TA 3ZOIA 2ZMKA 4D3WA 5E88A 4UW5A 5T3NA 4LE4A 4QQHA 2AC1A 5I8TA 1NZIA 5CFCA 1L7QA 4WM7B 4G4FA 3RZMA 3UJOA 4IEYA 4TWTA 1UWWA 2WNUC 2LTNA 5FK7A 5FZCA 1RUG2 2AUYA 3MLJA 3BIWE 2WN2A 2VTXA 2UWAA 3MYXA 3MIGA 1OF3A 3K3NA 1UL9A 2XVGA 1LGCA 1U5YA 3LKJA 5DG2A 2JE7A 4FOQA 2VZ1A 4OUSA 5FP3A 1XXNA 3ZXAC 2JWPA 1PVXA 1UMIA 1H2LA 1YQ6A 3H1YA 4Y1YA 1GOHA 2PQQA 1O91A 1V0AA 3FJSA 2ET7A 4B7EA 2IVJA 1H2KA 2J22A 2VPVA 1K5MC 3B5LB 3EHKA 5FZLA 3KHBA 1RHI2 2EIGA 2GSYA 2ZCWA 4QPIC 2JKXA 2CGPA 3H8OA 5IVBA 5DDJ2 1RJ7A 5FO9B 3ACLA 3AYEA 5IFTA 4CUGA 5E16A 1AR83 2KR2A 2V73A 1G86A 5CKMA 2RV9A 1US3A 2XJSA 5LZ6A 4CSWA 4JZRA 3VBUC 3A4UA 3WDTA 3E1F1 3NSTA 3SEPA 3DKQA 1QJY3 4OI4A 2P3YA 1GP5A 4AZZA 2A70A 5C9AB 1GQPA 4GKYA 4JDMA 1HN0A 4A41A 4Q4X3 1O3RA 1YWKA 4CDQA 2VJXA 3BPZA 4ZU4A 2WWJA 4JHTA 3ZLIA 5JWPA 3H8RA 1FOD3 3ZIWA 4QX1A 4XF9A 5EZWA 4YW3A 4KQ7A 4R9CA 3NKGA 2O14A 3CBNA 3LZZA 1O3SA 1CAXB 1RGSA 1JUIA 1LULA 1WCQA 2HWD2 1ND3C 4YGBA 3VN4A 3WNKA 4GB32 2VQ0A 3R4SA 1DHKB 4H3WA 3RMYA 2OZ6A 1VBC3 5F5QA 4XDPA 4A42A 1GBGA 4K1ZA 4JKKA 4EZ4A 2JB4A 2GH8A 1DQ2A 5F8PA 3ZSJA 4QQ2A 1T6GC 3LGRA 1LU2A 4O65A 4AK3A 4FAHA 3W9AA 2ZA9A 1DGRA 2BGOA 2WYSA 1WCSA 2TEPA 2JIJA 3OD0A 1Z7S3 2HWC2 5H9SA 1XNDA 5GKAC 2XMLA 4ZONA 2MHFA 4A7YA 5BNPA 3O1RA 1OFNA 3U75A 1DYKA 1VE0A 1UD1A 2XJPA 4XUOA 2RS32 2E26A 1V70A 2JDUA 4CYDA 5LY2A 2D6NA 4BQYA 1TNRA 4IUGA 1ZRFA 3I4IA 2VMIA 2BNMA 2HWF1 4AHXA 3ETPA 3FUOA 4AW7A 2OYZA 4IESA 1Q3EA 3LD8A 4XJWA 1MS5A 2IXIA 3POYA 4Q0SA 2WS92 3TOJA 3FBMA 1US2A 5JAXA 5JXGA 4OUEA 1G6NA 2FDJA 3R05A 5FUIA 1WWYA 1QF3A 4MXWA 1VBB2 4DUXA 1O6UA 2XWJB 1ULCA 3VKNA 4LBQD 1U12A 1ASJ3 2JDNA 3Q8FA 1HXS3 2GMEA 3K77A 2CL2A 3QCWA 1GMMA 1HV0A 2BNNA 3LB9A 5D8AC 4AQSA 3ES4A 1SHWB 3VUOA 1AR72 3KD4A 4LUKA 2D93A 3I59A 4ZZ8A 1IHMA 1ND2A 4XHBA 2ZX1A 3KCYA 4LOSA 2RMU1 1HRI1 2RE9A 5CBLA 2F4PA 1I9RA 3WDVA 5BY5A 1FT9A 4YNIA 4XF0A 3W58A 1REFA 3B3QE 2CY6A 1I1EA 5I8YA 5I93A 3D5OA 3WG2A 3WQBA 2GN7A 4UW6A 2J1SA 4Y33A 1DGRN 3VGIA 3MPPG 3J7MA 4YM3A 2WO2A 3IAQA 1HJGA 4BQ3A 4QXKA 1H6YA 5JMCA 1QXPA 4FFGA 2D6MA 4K8FA 1W04A 4IETA 1IG0A 2GZWA 5A3LA 5CFDB 4Q0VA 2IVIB 5AFBA 3H7JA 4XJUA 2Q1FA 5A6QA 4YG0A 3TRSB 2V5DA 5L73A 2BQPA 3THCA 4LBQB 4CEYA 1BK1A 3F95A 3MLLA 5BNPB 2AR6A 4CRQA 1SFYA 4XJ8A 3AP4A 2J1TA 5FP7A 1QKQA 1H2MA 4FQZA 4BOWA 3J26N 3FZ3A 1OLQA 1R083 4D6RA 5FMBA 3VD9A 5E8AA 1VR3A 2LM3A 2NMOA 4DS0A 4CXXA 3AL6A 1QQP2 3NW4A 3PU3A 4QX3A 1W90A 1S0CA 3AB0A 4X6RB 2ORZA 5FYTA 3ZFEB 3SCFA 5C5TA 4Y26A 4NHMA 3ZYJB 1PMHX 1OOPA 4AI2A 4PQQA 1RVF2 2V09A 4CTEA 1S0FA 1LOFA 5EWSA 3VL9A 2VUAA 1ZBE2 5DZEA 3TWIA 4XTPA 4NWVA 3H1WA 3WV6A 5HXMA 2VNOA 4FPGA 4AE2A 5C4WC 1ACCA 1BJQA 1LHOA 2KXLA 4Q0UA 5F1RA 4FTEA 5GLVA 2P34A 5FZHA 5H9QA 5JLVA 3DKWA 3HJRA 3KWVA 3OGGA 3CMGA 1MZEA 4ET7A 1KITA 3GBWA 4XQDA 4B1LA 1SDWA 2HWF3 1ND2B 2R6QA 3I59B 4CVUA 5BNNC 1LOBA 1UYZA 4OCTA 1GLHA 2B9VA 1Y7BA 3BOWA 2EAKA 4TXWA 3VZLA 4QU1A 3AKQA 4W6YA 1ZZBA 2Q5TA 3H3UA 3U0ZA 3VBOC 1WKYA 4MH0E 5T55A 3J8F1 1AX2A 1VRH1 3VZMA 4ES8A 1O4ZA 4K21A 3MO4A 3RWKX 3CJXA 3I2JA 1CQ9A 3IDBB 1S4CA 1DZTA 1GWKA 4Y1UA 5F5IA 2YG0A 4RS5C 1JYWA 4ZU5A 3M2MA 1ZBA1 4RA0A 3G7DA 4K1YA 2OS2A 1R1A1 2QBXA 2WQ4A 2WJSA 3AZVA 4YGEA 2Z4FA 1E5HA 2B45X 3GDBA 4CEYB 3DF0A 3MFAA 4LA3A 4R4XA 5C8WA 4P5YA 3AKSA 1DYOA 2Y6KA 4YW6A 1NCQA 4BH9A 4BCUA 2HBUA 3KCCA 4HFSA 4KGGA 1JYIA 2NP0A 5BYNA 1W6QA 3MUZ1 2VL4A 4ITCA 4W65A 3W59A 2WFF1 4ASKA 2J1VA 4Q27A 4Q8KA 1CESA 1SEFA 4WZCA 5FZ8A 2W94A 1F35A 4NRMA 3POBA 5FMOS 1EAH1 2VVDA 4N53A 3IDCB 2FHRA 4Y4RA 2VOTA 1XYPA 5C7GA 5K0UA 3O0XA 1QJY2 2X09A 3B02A 3F2ZA 3MW3A 2DVAA 5FXVA 1PGW2 3ZYHA 4AFMA 3N9PA 4I30A 1W9FA 4LA2A 1EV13 4Q4X2 4QMAA 2JDMA 4JCKA 3S0MA 1ULGA 1JODA 2LS6A 3ACFA 3OEBA 4NPLA 4DNYA 5I0RA 1FOD2 3GJBA 2FZ2A 4WM7C 1H9WA 4I2OA 1UYYA 2AZ5A 1X8EA 1RUC1 2WNUA 4QGLA 1KS5A 2ZX2A 3OBZA 4E4DX 3J7LA 1OKOA 1OHFA 1OPOA 2BYVE 2PFWA 4A7KA 2ZBJA 4ARXA 1AYM3 2BNOA 1YRZA 2Y6GA 1GWLA 4JC1A 2RJLA 2AACA 4IERA 3WOGA 1DLCA 1VBC2 3VDDC 2K46A 5ERLA 5D2AA 2BGCA 4PLNA 4KH9A 1X33A 4ONUA 5IFPA 3AL5A 4ARYA 5FZ4A 2CHHA 4KU7A 3CQOA 1MS8A 4AGVA 4FT8A 1Z7S2 4Y4YA 1BEV1 1MS3A 2WA3A 1PIV1 2XG3A 2FCUA 2ET1A 3MIBA 1UU4A 2B4KA 4CCOA 4PF5A 1RUJ3 3N9MA 2RM23 1H8TA 2QDNA 4GMP1 2HJIA 3UL2A 1ENXA 3UT0A 2CAUA 1DLLA 1W6MA 4YW1A 1UQXA 2PHWA 1SPPA 2TUNA 2GMPA 2WT2A 4EN6B 2ARBA 3NL1A 1UAIA 1VRH3 4KBZA 4HT1T 3TEXA 4Y1XA 4DEQA 3KSCA 5DZGA 2JENA 4H55A 1WBLA 4YARA 5LA1A 4K40A 4NUBA 2YHJA 1VBE3 2IZWA 4QHOA 3O1SA 1W28A 1ZBA3 3WF1A 1JUHA 3M3EA 4CXYA 4N53B 4JTOA 1LOCA 5A6ZA 2VUDA 5C9AC 3LDBA 1DQ4A 1S55A 2JD4A 3MIEA 4QGNA 2GNBA 3ZXLA 1ASJ2 1FPN3 5K0UB 4Q0PA 1HXS2 2RS13 4NWWA 1ZRCA 1OQ1A 3N35A 2JG8B 1JYCA 2R1DA 4PIXA 4LUMA 5FBJA 4HANA 5FYVA 2NM1A 2VCCA 3DYMA 4HOOA 2ZMNA 5B4XA 2H0BA 4AI0A 4TZDA 3THDA 3LEKA 2CDOA 4QAWA 1J3PA 1L7LA 4FPEA 4XACA 2W52A 1D0HA 3FN9A 3GZAA 4CEWA 1EAH3 3J4UH 2A73B 5FP9A 3OD4A 1WA4A 4AFBA 1DU3D 5CG8A 1KRIA 1AYN1 4RHV1 3SITA 3LOIA 4IEOA 3ST7A 2W9XA 4LBNA 1Z0HA 4CDXB 4KWJA 3IWZA 4MGQA 3H8XA 4DFSA 4IW3A 5A1FA 5FYIA 2ZACA 4Y22A 4UOJA 1Q5OA 1IPKA 2VNRA 3POGA 5IAXA 1Y9GA 1RUC3 3CJIC 3OCPA 4J6GA 1EPWA 2Z2SB 4OI2A 3S5QA 3V64A 1H8TB 3CO2A 4CP0A 2FQPA 2R041 1NCRA 4M0HA 4D94A 4JQRA 1W6MB 2Y60A 2VOVA 1PO23 2VNVA 5C5UA 1YI7A 1KD7A 1R082 5EJ1B 3V0BA 4GH4A 4CCJA 4XEZA 5F39A 4UWDA 5JCTA 1PVC2 5DAVA 2RS52 3SH4A 4LIVA 5GZGA 5JOZA 2QUOA 2D44A 3WDXA 2Y0IA 1FMD1 1BEV3 1A8MA 2VC9A 1PIV3 2O0OA 4QHZA 1CR7A 1XNTA 3I7DA 2R0FA 4QX5A 4GMP3 1PNFA 2FDGA 2W0XA 1F9KA 4NRQA 5FZ3A 4MGIE 4EN7B 2ZJCA 3ZIXA 1OA2A 3SQOA 1GNHA 3PMSA 1JMUB 2YYOA 1PGL1 3T09A 1O8SA 1QDOA 2W3JA 2DVBA 4M0NA 3BOPA 4KWLA 1OFSA 4SBVA 4YYOA 2JXAA 2WNVB 4NN0A 2C9KA 1C5IA 4FPLA 1HV1A 1NKGA 2HWF2 4E4SA 5KWRA 4CDWA 1C57A 1F15A 2VZPA 4NJ4A 3ZO0B 1GP6A 2PLV3 1W8HA 3RZGA 3KV4A 2D6KA 2D40A 1ZM1A 2CNAA 2DTYA 2OA2A 3NAPA 2LALA 4PHZA 5EPAA 4BK4A 3SEEA 3ZDSA 4IEUA 2BVVA 3I2FA 1WW5A 2VGDA 4AVSA 5FZ7A 2NZ9A 4XQWA 3LIHA 5JI9A 4QXHA 1LR5A 4RN5A 4AI1A 4COZA 3ILRA 4YFZA 1G9DA 2HKXA 2OPKA 2ZTNA 1OQEA 2B42B 3UETA 5AC93 3N36A 1XSRA 3AJZA 4P02B 1I6XA 3PNAA 4LKSA 3VBSA 1BBT1 5DABA 3LDKA 4RL7A 5FYZA 3LPFA 4CCCA 3RRDA 2JG9A 2WWUA 4LBLA 5HV0A 4CPBD 2ARAA 4XJ9A 2ZZQA 3VBHC 1AYN3 1W6OB 1ZNPA 5H9RA 4P14A 4RHV3 3ZFEC 3A0KA 1H2NA 1TMF3 4OHXA 1OSGA 2XHNA 4ZKTB 4JKMA 4L92A 4GH4B 3MF9A 2GC0A 1B35A 1HDKA 2YUEA 3IMNA 3LIGA 3PUIA 3QACA 1VMFA 1IS5A 1W3VA 4G3YC 4NHKA 3ZN5A 2D5FA 3GM8A 2OQ6A 4Q1RA 5HCAA 2ERFA 1WW7A 3H0OA 2X53S 2DUOA 2WZR1 4HG6B 1COV3 4U2AA 4GWNA 4MSVA 4NE9A 3NJXA 3RI9A 3ZYRA 1J1TA 1OA3A 2I74A 4I0AA 4KWUA 5B2GB 5HCFA 1CX4A 3N4MA 3GBFA 4P5HA 4AG4A 1S2BA 2QZ2A 4M3CE 4XXPA 1IZ3A 4YVWA 1EV12 1JH5A 1MQTC 3ZXEA 3IIAA 1NLQA 1LKNA 4HONA 5KHJA 4CA9A 1QJU3 4OHWA 1QJX1 1J3QA 1W9YA 4OMDA 1D0GA 1DQ0A 1MEC1 2WT1A 2WQ8A 2Y33A 3HMYA 5FKCA 4BDVB 1GNZA 5IVCA 4CDWB 1PZ8A 1UMHA 3PU8A 1FMD3 3WP5A 3GCWA 3JQXA 3UKNA 2VVFA 2L9LA 3LFMA 3NAPB 1NE6A 4OMCA 1AYM2 5IW0A 1VAVA 4PDWB 1P8JA 3J7HA 3BN6A 4XAEA 2CWMA 4M01A 1KJRA 2G9FA 1Y9QA 3WHUA 4W4ZA 1AL21 2AH2A 4QD2A 1TE1B 3NKTA 4D6SA 1UIJA 1I5ZA 3N9NA 2YU2A 4Y5Z0 3BYWA 1GZ9A 3VV1A 1VBD1 2V4AA 2JB8A 3N7JA 4Q4Y3 5BNQA 4GAZA 3WR0A 3FFQA 1WMEA 1RUJ2 3B69A 3P1IA 2D3PA 4QQLA 1YNAA 2RM22 5T52A 1RUH1 5FV3A 4WVMA 5ABJC 2PHXA 4AWDA 5FXWA 2ZGUA 3NV1A 2IXCA 2BBVA 1PM7A 5JDBA 4QKNA 5CISA 2GP3A 4UFHA 1XYNA 4UFKA 1VRH2 1A8DA 2G4IA 1J84A 1DYPA 3OUIA 4NIDA 3AZYA 3Q8AA 1W8OA 1O4TA 1B35B 2BFUL 3PUAA 1VBE2 2DTWA 3DPRB 2NYYA 3K51A 5DUXA 3ZXGA 3FLPA 2G9ZA 4QM9A 5IK4A 1LAJA 1LRHA 1ZBA2 1I3HA 3VZOA 1F31A 3RZLA 4META 3L2HA 3SLIA 3WP3A 1TME3 2CDPA 4NHYA 4QPWA 1S2EA 2W95A 1VAMA 3I2OA 2R32A 2GC2A 2O8OA 2QFEA 3CZUA 3D0JA 5SV5A 1FPN2 4KGQA 2BP6A 4D7YA 2RS12 2UY8A 4O9GA 1JN2P 4HL0A 3CF6E 5L36A 1QY4A 2VMCA 3M7AA 4XIOA 4JTNA 3K48A 3ZYGA 5ACA1 1ST8A 1H9PA 5DXDA 4UFJA 1NLRA 5BUVA 1D4M3 2WZPP 4Q4W3 1IKQA 5GLWA 2WR9A 1IS4A 1OI6A 3B9IA 4D8MA 4AL9A 3GYDA 4P9YA 2P2KA 4JRAA 4AFDA 3PVNA 4M3CF 4OFGA 4ZS2A 5GZFA 3I3MA 1EAH2 4XDOA 1GKBA 3S57A 5LEJA 2WZR3 5G04L 4TSVA 2A1XA 2DVGA 3C8XA 5FZAA 4EJRA 1C3HA 1OPMA 2OIIA 2IXKA 3BPSA 1AL0G 1TNFA 3I54A 5FO7B 1LCLA 4XBNA 4MG2A 1IPSA 1LGBA 4AFCA 5IYYA 3ZKUA 3O12A 2HEVF 2QTWB 2FCVA 2GP5A 2BBAA 5JXJA 1QJX3 1W9WA 3D3AA 4ISQA 5FZ1A 4P9JA 5A7WB 1MEC3 5KR7A 5J98B 4CDUC 4LKDA 1CZSA 4PIYA 4LKFA 3ME2A 1RUC2 4ZXEA 4HKOA 5FZKA 2WDBA 1SBEA 2ZOEB 1BQPA 1PO22 1S0DA 2VXRA 3BVCA 1UY4A 3PVBB 2HBTA 4YPJA 3S5AA 3IDEA 1TG7A 5GM0A 5FIXA 5L7OA 1D2SA 3UGFA 4D69A 4ASMB 1OD5A 1GU3A 1AR91 1HX6A 1NQJA 4B1MA 1VBD3 5JOYA 1PIV2 2OUJA 3RYPA 3O0VA 4B7KA 2JG8C 3GCXA 4RD7A 3MIDA 4XFHA 4DXRA 4HVOA 2A3XA 1PZ7A 2O1QA 5FY5A 4HSLA 3HBZA 4N43A 5JZGC 4AEKA 3LE0A 3T4HB 1WBFA 4IEVA 2CGOA 1OD3A 5A33A 1AX0A 5FY0A 2BDRA 4LLOA 3DUIA 1KFUL 4BE3A 1MZFA 4EYUA 4C0BA 3K2OA 1AZDA 3E6CC 3H3ZA 3SCGA 1S0JA 1CAWA 2PLV2 3ZYBA 2NN8A 5C8CA 5HCBA 2B7YA 4LK7A 5KC5A 3U4XA 5C70A 3MFCA 1XC6A 4HLTA 4AQ6A 3VHRA 3BIEA 4Z1VA 3ZPOA 2WABA 4AHZA 4CDXC 1SLTA 2HWE1 2Z79A 3WNOA 4KI5M 5CADA 4WV8A 4YZ2A 3DV8A 1WD3A 1X7NA 3AYCA 5DUVA 1DQ1A 1RUI1 5FFOC 5C3QA 4FO9A 4ZXKA 2XOMA 1WLWA 1UKGA 2GN3A 2J1AA 2W91A 4IV3A 1K45A 4Y20A 4L9BA 1JI6A 1C28A 4I3GA 5FBZA 4FAGA 5AC92 3RZZA 5JVVA 2W46A 4QWNA 2VD7A 3MHZA 1RXFA 5DQ0A 4LR4A 2QQUA 4AXOA 4EWEA 1BLZA 3A21A 1H30A 1IPJA 2E9QA 1C1LA 2Y26A 4NR1A 1XYOA 4QDRA 5EXOA 1S0EA 2E6VA 5FZMA 5C3RA 1DQ5A 1AYN2 3AMHA 3R4DB 4RHV2 3UKVA 3WT3A 1W03A 3CDZB 3R4UA 5FCCA 1TMF2 2ZXQA 2QQOA 3WNNA 3LFIA 3ZKYA 4NIGA 5CFCB 4LBOA 2ZGQA 4KNCA 3K46A 4Z07A 4DRVA 1UPSA 1OLME 5L7OB 1C8M1 1HLCA 3AKRA 4P9WA 1QHDA 2XLAA 4XZUG 5A3PA 3PDQA 4M3CA 2ZHLA 4HPKA 4ZS3A 5LB6A 5IATA 1NT0A 3VBRC 1COV2 1PZ9A 4A45A 4AR2A 1NX9A 1H1IA 1O8PA 1RUOA 1JZ3A 2WNVC 4KU8A 4N43B 1A78A 2EAAA 4H2AA 4J25A 4BWOA 1NY71 2F6BA 1QJU2 4YFWA 5A33B 1BVVA 5F37A 3UV9A 4XJZA 2PAMA 3O14A 5FP8A 2ETEA 1DF0A 3ZR5A 1HRV1 2NQYA 2OUHA 3QH7A 2FMDA 4LK6A 1SBDA 1G9AA 1CN1A 1AR93 5EYXA 3EYPA 5C8CB 1JHJA 4FBFA 1RINA 3AP9A 3KQ4B 4IQPA 2D6OX 5BNOC 3FHQA 3NVCA 1GANA 5KXCA 1VAKA 1K42A 4P9GA 1FX5A 3LQCA 3NNJA 4RR3A 4UBHA 3NNMA 2WRAA 2ZABA 1UXXX 4E8DA 2YGMA 4WVZA 4U36A 4XF4A 1DFQA 4QKDA 3VKFC 1YQ5A 4Y20B 2EALA 2X10A 2O8QA 3KGZA 4JGZA 4Q4Y2 1PO12 3VBHA 3VBFA 2X29A 5FTTC 4CDQB 3N9LA 5FYUA 3WVJA 3JUUA 1TVGA 1JYXA 3VDBA 3C2UA 2ZMLA 1FATA 2DDUA 2CYFA 3D0SA 3K4AA 3VHNA 3ZFFC 4BB3A 4Z8BA 1NA1C 4FPHA 1OBNA 2HWE3 4UFLA 1HB3A 1O5LA 2FDIA 2VMFA 1ZA7A 1MVQA 3KM5A 1RUI3 3A7QA 4LIUA 1LHNA 3UNPA 2VZTA 5DG1A 4QPYA 2J7MA 5LRSA 4YVSA 5F3GA 4XFBA 2VXJA 2RR11 3VL8A 2P3KA 5CAZA 5DPNA 4IGOA 4M3CB 1TME2 2XJUA 4HPKB 4RQPC 1H0BA 4YG3A 5FZFA 2W92A 1DQ6A 2E7TA 5FQ0A 3IPVA 5EV7A 1HB4A 4I3PA 2WSVA 4IE0A 3WW1A 1L3JA 4AEDA 4Q26A 2EXJA 1VBA1 2QQMA 3BCWA 4HVQA 2ZX4A 3D6EA 4FVVA 3WINE 1IS3A 1A6CA 1WUVA 4GQ7A 2JDHA 4MV2A 4BLIA 5L9RA 1VP6A 2R071 3EJKA 4IEZA 1SLLA 1U5XA 3V56A 4QPGC 3A23A 4BXFA 3WF0A 1D4M2 1W39A 4Q4W2 2K9ZA 2EXHA 1OH4A 4LEJA 2C5DA 1E5RA 2D97A 4MOAA 3O1TA 4PDWC 3AZZA 3CIHA 4JVAA 4RFRB 1F2NA 1QIQA 3W5NA 4XF3A 4COYA 3BKZA 3QH6A 2W2IA 3WNMA 5GZCA 1AJKA 1POV1 3J9SA 3LEIA 4JGYC 1KJLA 5F6KA 3S6PA 1HQWA 2QQJA 5FR3A 5TSWA 3BTAA 4WM8A 4D0QA 4MXWB 4A44A 1W2AX 3POWA 2PQSA 3T4VA 3ZSKA 2Y8KA 3OGVA 4QDSA 3ZSEA 2X5IC 5A3OA 1QJX2 4GIQA 2QDRA 3I3EA 1MEC2 5GLUA 3WEZA 4AHWA 5IUQA 3ETQA 2QQIA 1YUDA 2A3YA 5A7OA 4JGZB 3DEMA 4XUNA 5EHDA 1FXZA 2RG4A 4S2HA 1E5SA 1MS9A 2WO1A 3EQEA 5CU1A 1K3IA 1H6XA 3LDRA 3VBFB 4BLJA 1JZ4A 2WLPA 4HVRA 1FNZA 3BU0A 4YZ3A 1JZ7A 1KXGA 2JECA 1BCXA 2VH9A 1MS1A 1N1TA 2C4XA 4LQRA 5F3EA 2YFUA 4INDA 3M3QA 2A6VA 3WG4A 2D6PA 4LTAA 1ULEA 4NO4A 1KEXA 2PTMA 2XBO1 3KT7A 4DZGA 3G6JB 3ROUA 5I0DA 2DCTA 3MZHA 4JV4A 1VBD2 2SLIA 1PK6A 2PMWB 3VB9A 1HB2A 1DZQA 2VW2A 4BMEA 4Z92B 1GR3A 3H9AA 3ZFGA 5JXHA 1BK0A 2LW8A 1PNGA 3ILFA 3WUDA 2RMU3 1HRI3 4IXLA 4WVVA 2PN5A 3GF6A 4AEDB 2DV9A 2IUWA 4NPRA 3ZDVA 2Z69A 3C7OA 1ZRDA 1DDLA 5FPUA 2JDKA 3O1VA 5A3MA 4X8NA 2BZDA 1F5FA 1CIYA 1IG3A 2ZHKA 3C7HA 5FZEA 1BXHA 2P6HA 1AHSA 1BKZA 1YFXA 1RTVA 1JOPA 4GALA 4Y24A 3DXUA 3T08A 1MS0A 2W5FA 5FREA 3PVEA 5LASA 2ZGNA 5A3TA 2E33A 4DXZA 4DO0A 4Q4V1 1UCXA 4CU7A 3MI8A 4JQTA 4LPLA 4IV1A 4FP2A 1YC61 2HWB1 2LRPA 2OW4A 1AR82 2J1UA 1RUD1 2R061 3ORJA 3BGAA 3JD71 1WMDA 4BQ5A 3IIIA 2QE3A 1OOPB 4MHRA 3SMHA 2ORXA 3AP6A 1CJDA 3CEWA 3DGTA 1QH7A 2V5YA 4WM8B 1J1LA 4PI0A 2JX9A 1BVP1 1T2XA 5FLIA 4DQAA 1RMU1 3ZX7A 5F9TA 4ZU7A 3RJRA 3UESA 4WBBA 1XQNA 3M3OA 1OVPA 3PUHA 4XBQA 2VO5A 2ZZJA 5E6HA 1V9U1 4MX3A 3T0BA 1LJ7A 4CU8A 1W05A 2Q8CA 3WW4A 1UKRA 4IEPA 3OTFA 1LECA 1POQA 3VBOA 1OLMA 4C1WA 3BALA 4D7SA 2ARCA 3ZYIB 3QOPA 3JU9A 3ZM8A 5G05L 4FP3A 3GALA 3T0AA 5FKBA 1ULFA 1TEIA 3OB8A 4B29A 2W1SA 4QB6A 2CAVA 3RGBA 4BA6A 3OG2A 1MZ5A 3WP4A 2QQNA 1V6KA 2VZSA 3OUHA 1YFWA 1LTEA 1QJFA 5JPNB 3FX3A 4FTSA 4OHZA 1QU0A 1KQRA 1PMJX 2VMGA 1WLTA 4QQOA 4XUTA 5FK8A 5FY9A 2AENA 5T5LA 3SNMA 4DRRA 5JOWA 2RDQA 4CU6A 5HV4A 4HZFA 4ES9A 2YXSA 1NZCA 1QNYA 1Y3TA 1OMIA 4E8CA 3C7GA 4Q5OA 1QWRA 3JBG1 4FPYA 1MZ6A 4LKEA 3WDWA 1K5MA 2WFPA 4MYEA 4COVA 4EWAA 4BQ1A 1ULPA 4QPIA 1LGNA 3AFGA 2ADDA 2BTVC 2XKPA 2PA7A 4XAAA 4DIQA 4XFGA 2DVDA 3PTRB 5CYYA 2QQLA 4COWA 1NCQB 4HK9A 2XBO3 1GYKA 4EQVA 3J8F3 4OI1A 1OUXA 1AR92 3NRUA 5GLTA 1W6QB 1FNYA 3AFKA 2WSUA 2UU8A 3VHPA 5FJKA 2WA4A 4K7JA 4UW3A 3LAGA 3PMEA 4XJAA 4CUCA 3VBUA 2XQXA 5JIAA 3VD4A 2HH9A 4R9AA 1RUG1 3VZJA 5KXEA 5IHRA 3OSDA 1EP0A 4LBMA 1JHNA 1V6NA 1OUSA 1BZWA 1R1A3 3NMBA 4E2GA 1ODMA 4EN9B 2KD7A 4OULA 5LWBA 4FOVA 4ZZ5A 2ADEA 2DCJA 3MPBA 5A32A 4AVCA 4A3ZA 4SLIA 4XURA 4CCNA 3APBA 1XNCA 2UURA 3KZ4C 3MUY1 2UY9A 1UW8A 2WINB 1CJPA 2WFF3 3KVBA 3HNMA 1ND3A 4Q4V3 5CFCC 5CKNA 1RHI1 3KF3A 4LULA 2XGXA 2R063 4DXSA 3AZXA 3JD73 2EXKA 2Q0AA 2HWE2 3I3BA 4MZUA 2WNUB 1QGLA 2XB6C 5DDJ1 3WX5A 3IBMA 4BXSV 1RUI2 1ZZ8A 2EIEA 2K0GA 2ARXA 1QXRA 3EB7A 4FPFA 1SG3A 2XLFA 2W39A 5C33A 2OKXA 2ENRA 1LHVA 5FZ6A 1RMU3 2FBEA 2PHLA 3MIFA 4W50A 3OYWA 3OBTA 4AI9A 1VPHA 3AVRA 4DINB 3WNPA 3U4SA 5A7QA 5CB7A 4D7TA 2XHKA 2XVLA 4DY5A 4B4QA 1W0NA 3RYRA 2XUMA 2XVKA 2ZX0A 4AVTA 1RXGA 5DZFA 1GOGA 1PX3A 1LNSA 1JTZX 3AM2A 2E7QA 4CCEA 4QPIB 2EA7A 1SQ4A 1SFPA 4LHSA 4CCDA 3C7FA 1UNBA 2HWD1 2Q30A 1PHMA 3MF6A 5LA9A 1SPPB 3O7OA 4IEXA 5AFEA 4P9XA 3WQ0A 3MBWA 3JB4C 4B3NA 1IGOA 1ODNA 1J83A 5DAWA 2Z42A 2IXJA 5DUWA 2VCBA 4XW3A 2Y34A 1NXMA 2GALA 4CXWA 3URFA 1WD4A 1NAEA 3I3DA 4W8JA 3RJ2X 4PJYA 3ACHA 5FYBA 3VBUB 1W8ZA 3RPQA 3W21A 1V6IA 3CZJA 1X50A 1R1ZA 3TNPB 1V6LA 3K4DA 3JBG3 5IT6A 1R091 2WT0A 2XR4A 3HIFA 5D8AA 5JIUA 5LEKA 1XPWA 1E57A 2HWC1 1VMJA 1NY72 4YGCA 3TEYA 2QQVA 3LWCA 4XTMA 4CDQC 1SLAA 1UOBA 3HQXA 5A32B 4HKWA 3HQRA 4OZOA 2FDFA 3CLPA 2RS31 2EICA 3TNQA 3T2OA 2EIBA 2V4VA 3N9QA 4OHVA 5CIRA 4YZ5A 5J09A 3AC0A 3DCQA 4CP9A 1V00A 4AI8A 4EROA 2BOIA 4E4HA 1YIFA 2YFZA 3MGUA 1RUG3 4I0WB 5D1IA 2DFCA 4AYUA 1Q43A 3JXSA 2P3JA 5IK8A 5JSOA 4CEWB 1IKPA 2OPWA 3GZUC 3I2HA 5T50A 4EN8B 4I01A 5CG9A 3DXTA 1YIPA 4MUVA 1R64A 2VZOA 1NE4A 5I0TA 1VBB1 3KCXA 4BMBA 2BRTA 5CFDC 5FY8A 1G9FA 1AXYA 2W08A 1IOAA 2G1MA 4HN0A 1F4HA 2P3IA 2VMEA 4GWJA 2BWAA 5BNPC 1DGWA 3LSEA 3H1MA 2RMU2 1DG6A 1HRI2 2BGPA 4CPBA 1AR71 4LO8A 2VZRA 4QPGA 4Y22B 3EBRA 2X05A 1LESA 1Y43B 1V6OA 2QQKA 1SLBA 2OXBA 5FPXA 1ULOA 4XUPA 3TEZA 4LHKA 2VZVA 4UBGA 2YDEA 4IE4A 2PYTA 2A6XA 3HBKA 3WY6A 1NCRB 3T1LA 5HCHA 1NOVA 2C9AA 4NPMA 4I02A 2D6LX 4W6WA 4Y3OA 4NIAA 3ZMNA 4CP2A 2Y6HA 5F6LB 3V0BB 3WF3A 4R52A 2ILMA 1UU6A 4GXLA 1JBCA 3THPA 3B01A 2W1WA 4O61A 4Q0QA 4XVHA 1U5ZA 1QOSA 5C4WA 4CCLA 3W20A 1UXZA 3KB5A 5E89A 2N7GA 4B4RA 1QXJA 5GZDA 3V65A 2WQZC 3NJYA 4QDQA 4NHXA 4AGGA 3TB0A 2P1BA 4OVEA 2R043 3I3QA 4N8MA 4R8HA 3RVHA 5BNNA 2MPFA 1W9TA 1ND2C 1NG0A 3OPTA 4P9IA 1PM4A 3KLSA 2XL7A 3WQ7A 1XBFA 5ISLA 1DCSA 4AHYA 2BWCA 1ALYA 1YLLA 1OF4A 3PJYA 4MGYE 4CP9B 1REDA 5K8SA 1GV9A 2JDAA 4CUAA 3UGGA 2MEV1 3K3OA 2VM9A 1QQP1 3HOBA 4QX8A 4XFAA 1UY2A 3E6BA 1YQ2A 5CNAA 1JU4A 2D5HA 2FDHA 2E63A 2IC1A 3T2QA 3ZSMA 1R093 1KS4A 1EYBA 2A6ZA 1RVF1 2PAEA 3I49A 3FHIB 2CSGA 2YC4A 2HWC3 3BODA 4Y5TA 1ZBE1 4GD4A 4YG6A 4RS5A 1MACA 1XSQA 4NMIA 4PIZA 4Q1PA 4E2QA 3P5BA 2YPJA 4CEYC 4BHPA 1OC1A 4LHNA 2GNDA 4QKBA 1URXA 4YZ4A 5A7PA 3VBSB 2D43A 1JZ2A 1ZVFA 3PIJA 5LY1A 4XBLA 2JG9B 2BPA2 4K6BA 3FE5A 3VKLA 3IB3A 1G9CA 1UZVA 1LEMA 1STMA 1Y4WA 2E53A 2XBO2 4QXCA 4BM8A 3J8F2 4FSJA 4Y1ZA 2QQPA 4B4PA 3A22A 2DURA 4UF0A 3USUA 3ACGA 1YJLA 3SC7X 4DY3A 1LOFC 4HETA 1GP4A 2VAUA 3OY8A 4KL1A 1SMVA 2D98A 5B4NA 4ATFA 1CWPA 3B7MA 5AVPA 1AR73 1H4HA 1VB2A 1R1A2 2VW1A 5F3IA 1BBT3 1ZRIA 4A7ZA 1YCIA 1SLIA 5E1RA 4PI2A 3MV01 3ZVXA 2DUPA 5T54A 2E7AA 4WM7A 4A4AA 3TN91 4GMP0 3ZYFA 1X9PA 1YFYA 4PCRA 4OYUA 4YVWB 3PTYA 1GZCA 2WFF2 2D3SA 2WNEA 3J7NA 3SXWA 1W0OA 3WQ1A 3OBRA 4Q4V2 3OEAA 5A7SA 3IMMA 2R062 1LHWA 1RL3A 3JD72 2F17A 2W47A 4YGDA 3VDDA 2LUWA 3TYJA 2ATFA 3GGLA 4L97A 5JSRA 2C24A 4LE3A 4QXBA 1CPMA 4UW4A 1RMU2 3KT4A 3O0WA 1A34A 3ZSLA 2GC3A 5FPLA 3LA7A 1QJY1 5DAXA 2G9GA 3SH3A 1FI2A 1PGW1 3PVOA 3KV6A 1REEA 3SKVA 5LW9A 3BI3A 3RI8A 4Q4X1 3T2TA 5C3SA 3WCRA 5A7NA 5LK5A 5JUVA 2MEV3 2UWBA 1OLRA 1NCQC 2YB7A 1LENA 2A6YA 1WW4A 1W2NA 2JDZA 5J7MA 3INAA 1XB9A 4FCAA 4WVMB 3Q8EA 2GU9A 5FMOL 5FPBA 5IJRA 3HT1A 5L9BA 5T5PA 3U07A 2ZGKA 5C3OA 2Y38A 2B9UA 4PF1A 4TYSA 5GZEA 1UZYA 5FZDA 4LHLA 4AVAA 4HSJA 1RITA 1AL23 1CAVA 1UU5A 1PX4A 3CHXA 2PAKA 2UYAA 3AX4A 4PLOA 4N53C 4XF1A 1XNBA 1YHFA 1U0AA 3P3NA 5C9AA 2I07B 2JICA 4YW7A 3WZ1A 3OY8B 3NNGA 5T5OA 3OGSA 1W99A 4AGRA 3RMXA 4LJHA 1APNA 3HR9A 5L9VA 3NNLA 5K0UC 1BEV2 4JAAA 4S2FA 3JBG2 3ES1A 1RUH3 1SBFA 2P5BA 3FL7A 5F32A 2VOXA 3HQUA 2LROA 1CAXA 2KA3A 3B94A 2Q8OA 4XHXA 4F8AA 1A3KA 2RDNA 2OX0A 1ZZCA 1FYUA 3LCPA 3FUQA 1G9BA 4EV0A 4AAPA 4FOYA 4LO5B 1UOGA 1WCKA 3OGJA 5ANQA 2R1BA 5FAXA 5JPMB 4BQ4A 3B00A 2ZS6B 2G19A 5KBFA 2W1QA 2VZ3A 2UYBA 4N90A 3H3LA 4QQPA 4P00B 3VDDB 4AVBA 1X8MA 2A75A 4AQTA 1QJZA 4E9KA 3Q8BA 5C6CA 1OKQA 1B09A 3H50A 3M1HA 3CKHA 3B93A 2VQUA 3WNLA 2FD8A 1X9TA 2VZUA 2QJVA 4QU2A 3O5SA 2A71A 3LPGA 1OVSA 5F2SA 5FZGA 4QM8A 4M4PA 1FAYA 5IWFA 3LEGA 4UI9L 3TN93 1ASJ1 5I0SA 5ACA3 5I0UA 1HXS1 2SBAA 3CJIA 1LOGA 5FZ0A 3ASIA 2CTVA 2VBPA 2P17A 5EYYA 1H8TC 1KDKA 2CWSA 1W8WA 2KM2A 3KF5A 2DWRA 3WP6A 4BZ4A 3O1MA 1HN1A 4FPKA 5KXBA 4Y1VA 4NRPA 4L8QA 1RJ8A 2I2SA 5FO8B 4OQ8A 4JX0A 2VE1A 2WAOA 1DBNA 3C3VA 2IWGB 1F5JA 3TEWA 4H14A 4FI9A 4UFMA 4LO6B 3JB8A 1CAVB 3E97A 2QZ3A 2HLEA 4IL7A 4C91A 5T5JA 1GQGA 2DU1A 4EWDA 1V6JA 2C1FA 4DB5A 5M0TA 4C0HA 2ZEWA 3HWJA 3RNSA 1UZZA 1CPNA 3ILNA 1LOEA 3SHRA 1W06A 1WMXA 3GJAA 4GJYA 4NAOA 2XKOA 2R042 3T30A 1XJAA 4BISA 4MGKE 4YRDA 4XMAA 1CGPA 1QOOA 4PBPA 4I0BA 2QVSB 3CL1A 1UPIA 2A5ZA 4PLMA 1AX1A 4EN0A 1OXCA 1Q8OA 4QX0A 2XJRA 3X29B 3ZXFA 2GNTA 1R081 4TN7A 4CEWC 1X82A 2VUCA 3DYPA 4KBBA 2JKBA 1VRBA 3L2YA 1FV3A 1SACA 3NV2A 1PVC1 1CAWB 2RS51 1FMD2 2VUJA 3RZJA 3IKWA 5CFDA 2GNMA 1ZA4A 2RJ2A 1ZX5A 1R092 4OI0A 2W87A 2ZGLA 3V0AA 2VR4A 2AEYA 2QCSB 4Z2AA 4URAA 4LBQA 1J3RA 5K9YA 4BIFA 3RWNA 4NHLA 1SLCA 1PMIA 1PGL2 2WBKA 3HN3A 2ZGPA 3PJQA 1O59A 1W2UA 2DU0A 4QX7A 1WLCA 2XH6A 4XCBA 4UAPA 4IV3B 1ULDA 2RDRA 1J58A 5CEHA 1SCRA 4N7IA 1O7FA 3CJIB 2BUKA 2H6BA 4GWMA 2ZX3A 1RB8G 3ZMOA 5F5CA 4Z82A 1F8VA 5FWEA 5A6YA 2Q4SA 4PT6A 3GNEA 1NCRC 3ZFEA 1Q8QA 2H0VA 1NQDA 5IVJA 1GICA 3OJBA 3B9CA 4GH4C 2FDKA 4LO4B 5FPVA 3AZWA 4QKFA 4IE7A 4LOTA 3N3HA 4XXAA 5BV6A 1ZYBA 4K20A 3D4KA 5C3PA 4YW2A 2P4EA 4I09A 1UX6A 3DL3A 1BMV1 1W3XA 1H1AA 2ZEXA 1OT5A 2ZHMA 4XIKA 2J1EA 2JIGA 3FMGA 5A80A 2GDFA 3POJA 4FXGB 3OOXA 1VIWB 3NQHA 2PHUA 4XZPA 1LHUA 3AMQA 3NNFA 3UGHA 2ES3A 2ZAAA 1BBT2 2R7EB 1XE0A 1W6PA 5K7PA 2Y64A 5FZ9A 1MQTA 2C0ZA 4BK5A 3AMMA 2VULA 5LK7B 3EO6A 2Q1ZB 3HD8B 5LBCA 4CDWC 2D7FA 5LBBA 1W9SA 5JR2A 2TBVA 2BW8A 3UYJA 2B5HA 2BU9A 2YC0A 2R0HA 3NAPC 4G9SB 1C8M3 4PQ9A 4QGMA 3TAYA 1HQLA 2VTFA 3QBQA 1M4WA 2YV8A 4KG0A 2HYKA 2WZR2 3BB6A 4MVTA 3POEA 5FLJA 4DUWA 3NV3A 5A1AA 3V0AB 1RUF1 3U1XA 3RZKA 3WD5A 2VCAA 3U10A 1XRUA 1JYVA 2J1RA 4S2DA 1UX7A 1W6NA 4RR3B 2VCMA 4A2UA 2FCTA 4LO7A 3N7MA 1E5IA 1U5IA 2A3WA 2CGNA 1LEDA 3E5QA 2ID4A 2RDSA 3GHMA 4ZY9A 2DCYA 3VBSC 3ZXKA 3E6DA 5BPXA 2NLRA 4IDZA 3SCHA 4AAXA 4BQ2A 5ABJA 1YJKA 4JDOA 2JG9C 1EV11 2XLGA 3P6BA 1AR61 1HRV3 1LOAA 1UY0A 2XJTA 3PLQA 1S0GA 1W8FA 1UY3A 2MEV2 3VBHB 1PVC3 3I2DA 4ASLA 5EIYB 2RS53 4Q8LA 3UJQA 2Y6JA 2QNKA 4CUBA 1WCUA 2Q8DA 2JE8A 4K3UA 1UZWA 4V2VA 1CONA 1UOFA 3I8TA 3KQRA 5C71A 2GC1A 1W2OA 2ZAHA 1ENQA 2GAUA 5FZOA 1H8VA 5FXXA 3NV4A 1BYHA 4CP1A 1B35C 4OLLA 3DPRC 1RC6A 1H1MA 4R4ZA 1AYM1
chains in the Genus database with same CATH topology
5F39A 5A7NA 4TN7A 5FY7A 3N9LA 5FYUA 5FY5A 5A3TA 3NJYA 5FZ6A 5FYYA 1VRBA 2YBKA 4DO0A 4LIVA 4D6SA 4AI9A 3RVHA 4CCKA 3AVRA 3N9NA 5FPBA 2YU2A 3OPTA 5FP7A 3U4SA 4CSWA 5FYMA 4IGQA 5A7QA 5FY0A 4D6QA 4EYUA 4URAA 4LIUA 5FZDA 4D6RA 2WWJA 3AVSA 4GAZA 3ZLIA 5ISLA 3K2OA 2XXZA 3AL6A 3PU3A 5FV3A 5FZ3A 5FYTA 5FPAA 5FXWA 3K3OA 4QX8A 4QX7A 5F3GA 5IVEA 3AL5A 5CEHA 4IGOA 5FZ4A 5FZFA 2GP3A 3ZPOA 5E6HA 5F5CA 2YBPA 5FXZA 5FWEA 4CCOA 4GD4A 2Q8CA 2OT7A 5IVFA 3N9MA 4XDPA 2P5BA 5F32A 5IVJA 3PUQA 3PUAA 4CCMA 3KV4A 4LITA 2PXJA 3KV5A 4EZ4A 4V2WA 4GJZA 5FZHA 5FPVA 5FYBA 5FWJA 5FP4A 5FZBA 2OX0A 4BXFA 5A3WA 4QWNA 2VD7A 5FZ7A 4C8DA 3KVAA 4AAPA 5A7PA 5F3CA 4QXHA 2XMLA 5ANQA 5A80A 4UF0B 5LY1A 4NUBA 5FY1A 5FZMA 3U78A 5FY9A 2W2IA 5FYSA 4QU1A 3OPWA 4QXCA 3N9QA 5LY2A 5FYZA 3LDBA 5FY4A 4LXLA 5FUNA 4UF0A 3KV9A 5FZ9A 5IVYA 2WWUA 4E4HA 5F2SA 5FZGA 5A1LA 2OQ7A 5IWFA 5A3NA 4XDOA 3N9OA 5A3PA 3LD8A 3PDQA 3PURA 5FBJA 2Q8EA 2YU1A 4DIQA 5FZ0A 3PTRB 2YBSA 5F5IA 5FYVA 5FZOB 5A7OA 5F3IA 5FZAA 3DXTA 3UYJA 4HOOA 2OS2A 5FJKA 5FZCA 4CCJA 5FY8A 2OQ6A 5FP9A 2GP5A 2XUEA 5KR7A 5FZ1A 5F3EA 5F37A 5A7WB 3K3NA 5FYHA 5FP8A 5IVVA 5K4LA 5FUPA 5A7SA 5LWBA 5F5AA 5FZKA 5F2WA 4ASKA 5FYCA 5FP3A 2XDVA 5A7WA 5FZ8A 4CCNA 5A1FA 4HONA 4EZHA 5FYIA 4Y3OA 2YPDA 4Y4RA 4IGPA 5FZLA 4Y33A 4BU2A 3KVBA 4QXBA 5IVCA 4GJYA 5IVBA 3PU8A 2Q8DA 4BISA 5FXVA 5FPLA 4V2VA 5FPUA 3N9PA 4CUGA 5FZIA 5FXXA 3PUSA 5FZOA 5FZEA 3KV6A 4CCLA 5IW0A 5LW9A 5FJHA 3DXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F39 A;  5A7N A;  4TN7 A;  5FY7 A;  3N9L A;  5FYU A;  5FY5 A;  5A3T A;  3NJY A;  5FZ6 A;  5FYY A;  1VRB A;  2YBK A;  4DO0 A;  4LIV A;  4D6S A;  4AI9 A;  3RVH A;  4CCK A;  3AVR A;  3N9N A;  5FPB A;  2YU2 A;  3OPT A;  5FP7 A;  3U4S A;  4CSW A;  5FYM A;  4IGQ A;  5A7Q A;  5FY0 A;  4D6Q A;  4EYU A;  4URA A;  4LIU A;  5FZD A;  4D6R A;  2WWJ A;  3AVS A;  4GAZ A;  3ZLI A;  5ISL A;  3K2O A;  2XXZ A;  3AL6 A;  3PU3 A;  5FV3 A;  5FZ3 A;  5FYT A;  5FPA A;  5FXW A;  3K3O A;  4QX8 A;  4QX7 A;  5F3G A;  5IVE A;  3AL5 A;  5CEH A;  4IGO A;  5FZ4 A;  5FZF A;  2GP3 A;  3ZPO A;  5E6H A;  5F5C A;  2YBP A;  5FXZ A;  5FWE A;  4CCO A;  4GD4 A;  2Q8C A;  2OT7 A;  5IVF A;  3N9M A;  4XDP A;  2P5B A;  5F32 A;  5IVJ A;  3PUQ A;  3PUA A;  4CCM A;  3KV4 A;  4LIT A;  2PXJ A;  3KV5 A;  4EZ4 A;  4V2W A;  4GJZ A;  5FZH A;  5FPV A;  5FYB A;  5FWJ A;  5FP4 A;  5FZB A;  2OX0 A;  4BXF A;  5A3W A;  4QWN A;  2VD7 A;  5FZ7 A;  4C8D A;  3KVA A;  4AAP A;  5A7P A;  5F3C A;  4QXH A;  2XML A;  5ANQ A;  5A80 A;  4UF0 B;  5LY1 A;  4NUB A;  5FY1 A;  5FZM A;  3U78 A;  5FY9 A;  2W2I A;  5FYS A;  4QU1 A;  3OPW A;  4QXC A;  3N9Q A;  5LY2 A;  5FYZ A;  3LDB A;  5FY4 A;  4LXL A;  5FUN A;  4UF0 A;  3KV9 A;  5FZ9 A;  5IVY A;  2WWU A;  4E4H A;  5F2S A;  5FZG A;  5A1L A;  2OQ7 A;  5IWF A;  5A3N A;  4XDO A;  3N9O A;  5A3P A;  3LD8 A;  3PDQ A;  3PUR A;  5FBJ A;  2Q8E A;  2YU1 A;  4DIQ A;  5FZ0 A;  3PTR B;  2YBS A;  5F5I A;  5FYV A;  5FZO B;  5A7O A;  5F3I A;  5FZA A;  3DXT A;  3UYJ A;  4HOO A;  2OS2 A;  5FJK A;  5FZC A;  4CCJ A;  5FY8 A;  2OQ6 A;  5FP9 A;  2GP5 A;  2XUE A;  5KR7 A;  5FZ1 A;  5F3E A;  5F37 A;  5A7W B;  3K3N A;  5FYH A;  5FP8 A;  5IVV A;  5K4L A;  5FUP A;  5A7S A;  5LWB A;  5F5A A;  5FZK A;  5F2W A;  4ASK A;  5FYC A;  5FP3 A;  2XDV A;  5A7W A;  5FZ8 A;  4CCN A;  5A1F A;  4HON A;  4EZH A;  5FYI A;  4Y3O A;  2YPD A;  4Y4R A;  4IGP A;  5FZL A;  4Y33 A;  4BU2 A;  3KVB A;  4QXB A;  5IVC A;  4GJY A;  5IVB A;  3PU8 A;  2Q8D A;  4BIS A;  5FXV A;  5FPL A;  4V2V A;  5FPU A;  3N9P A;  4CUG A;  5FZI A;  5FXX A;  3PUS A;  5FZO A;  5FZE A;  3KV6 A;  4CCL A;  5IW0 A;  5LW9 A;  5FJH A;  3DXU A; 
#chains in the Genus database with same CATH topology
 1C8N A;  1AL2 2;  1HIX A;  4QT6 A;  4ATE A;  1V6M A;  1AXK A;  1HB1 A;  1K5J A;  2BV4 A;  3DEC A;  1RUE 1;  2BFU S;  4JRL A;  4MHU A;  4MXV A;  5LA2 A;  4YVS B;  4XOG A;  2QKD A;  5FMD A;  1C5H A;  3MV1 1;  2PHD A;  2VMH A;  3LF7 A;  3EXU A;  1WMF A;  4GWI A;  2JEM A;  3RS6 A;  1HW5 A;  4P9L A;  1RUH 2;  2PHF A;  1W6P B;  2XXZ A;  5FQ0 B;  4XFF A;  3IPV B;  5KXD A;  1MQT B;  4XC9 A;  4YVW C;  3OGR A;  4GKX A;  1RUJ 1;  1XU2 A;  2DVF A;  2RM2 1;  2YY1 A;  5FPA A;  3S7I A;  5IVE A;  4XET A;  4URT A;  4EE2 A;  4RSU A;  1MPX A;  2UWC A;  4XFI A;  5D21 A;  3CNA A;  2P37 A;  3KT1 A;  2E51 A;  3THT A;  4DPN A;  1L7R A;  5KHG A;  1GQH A;  1KDM A;  1TZO A;  1K12 A;  2RR1 3;  4L11 A;  2YZ4 A;  4V2W A;  4A3X A;  1VBE 1;  3A0N A;  5FWJ A;  1EY2 A;  5DMY A;  4XPV A;  1MVE A;  2ZPX A;  4N9I A;  5H9P A;  4XIL A;  1GSL A;  3I97 A;  5F3C A;  3ECQ A;  1VBA 3;  5FRA A;  2WWS A;  4YM0 A;  4BPZ A;  1DGW X;  1W6N B;  3CU7 A;  4CDU A;  3TN9 2;  1FPN 1;  2R07 3;  5CZK A;  3NJZ A;  4F3J A;  5ACA 2;  2RS1 1;  4H7L A;  3WG3 A;  3T0D A;  4Z2W A;  1JZ6 A;  4A6S A;  2ZGT A;  4OUM A;  5ABJ B;  3WNX A;  3WDY A;  3OF1 A;  4O9E A;  1N3O A;  2WO3 A;  4S2G A;  3ITQ A;  1YYN A;  5A1L A;  3ALQ A;  1UY1 A;  1IS6 A;  2NMN A;  3KS7 A;  1CZT A;  4H7M A;  1G7Y A;  1SCS A;  3HPN A;  3WUC A;  3BU7 A;  3PUR A;  2Q8E A;  3ABZ A;  1POV 3;  1GZW A;  3LA2 A;  1RUF 3;  4GA9 A;  2VVE A;  5FZO B;  2RHP A;  2B46 X;  4DOU A;  3AYD A;  4OHY A;  2OZJ A;  5GJ6 A;  1W2T A;  3GXU A;  1J59 A;  4L99 A;  5LCW L;  2VY0 A;  2JG8 A;  3D82 A;  4X6Q B;  5J3U A;  3GHN A;  4XDQ A;  4FPO B;  4YWA A;  2XUE A;  5JZG A;  1AR6 3;  1PK6 B;  3HEI A;  4GUL A;  3K4Z A;  1UZ0 A;  3ZFG B;  4YM1 A;  4YW5 A;  4NIH A;  5K4L A;  1BHG A;  5FOJ B;  1WA6 X;  3VD5 A;  3I2K A;  2IFW A;  3ELN A;  3GBG A;  1S2K A;  1N1V A;  2ZEZ A;  1JXN A;  3VHO A;  4IE5 A;  1O3Q A;  1I5P A;  2B39 A;  3POI A;  2EXI A;  3AYA A;  1PO2 1;  1UMZ A;  3AXE A;  4M00 A;  1QMJ A;  2YGL A;  4K9S A;  2OVU A;  1RUE 3;  3AMN A;  4LNV A;  4CDX A;  3I2I A;  2AYH A;  2CV6 A;  4TLG A;  5J96 B;  3Q9O A;  3P3P A;  3ATG A;  2JJ6 A;  1C1F A;  3IDA A;  2XON A;  4HBN A;  5FZI A;  1D4V B;  3O1O A;  4IV1 B;  3M3I A;  3MIH A;  4MGT A;  3FLR A;  5CA6 A;  2NPI A;  2WZ8 A;  3QD6 A;  2C26 A;  3I2G A;  5FY7 A;  4AVV A;  5FYY A;  2JD9 A;  3HAG A;  5LRR A;  3ZN6 A;  1LOD A;  4MO3 M;  4CDU B;  4N9H A;  1YQC A;  3WF4 A;  4AOC A;  4IGQ A;  1N3P A;  1N1Y A;  4TTG A;  4DEV A;  1FV2 A;  2DBI A;  2DF7 A;  2PHT A;  5HBA A;  4E27 A;  3UKT A;  3M4F A;  2MNG A;  2AEZ A;  5I8S A;  4W6X A;  4JKL A;  3QLQ A;  4M4R A;  4YSF A;  2PLV 1;  4JDN A;  1JYN A;  1WCD J;  2HWB 3;  3BTX A;  2JDP A;  1RUD 3;  5L7O C;  1GZW B;  1EPZ A;  4A6O A;  1UOJ A;  1S0I A;  1ZZ9 A;  1OA4 A;  1QNW A;  2FZ1 A;  2IXH A;  2XJV A;  3MW4 A;  4Q29 A;  1ZZ6 A;  1IQD C;  3AXD A;  5FXZ A;  3LEM A;  1HKD A;  3FC0 A;  3KHC A;  3VBR A;  3O1U A;  5EFU A;  4UXA A;  3WDU A;  1JS9 A;  2PXJ A;  3KV5 A;  2ZEY A;  3FLT A;  2VOW A;  4BJ0 A;  1WGP A;  1JU3 A;  2VZQ A;  2WNV A;  5KC6 A;  1UF2 C;  1V9U 3;  4HXC A;  4N43 C;  5FP4 A;  3RFR A;  5AC9 1;  5JZG B;  1JOJ A;  4NII A;  4C8D A;  4COU A;  4E2S A;  4IEW A;  2BVB A;  4RYD A;  5GLZ A;  3BTY A;  1N3Q A;  5F7U A;  1WW6 A;  2IXL A;  2P6C A;  2W68 A;  2X8K A;  5A3U A;  5I91 A;  1DGL A;  2VOK A;  1ZRE A;  3RYK A;  3MW2 A;  1XE8 A;  2VNG A;  5FPZ A;  3VD7 A;  1ZRR A;  3ACI A;  1K5M B;  1N1S A;  1W8U A;  2BER A;  4F83 A;  2BJS A;  4WVW A;  1GWM A;  4HMZ A;  2EVX A;  4LBK A;  3ZXJ A;  3AKT A;  5C8C C;  1MR5 A;  3MIC A;  5A6X A;  1TMF 1;  5DUU A;  2E32 A;  4UFI A;  5FY4 A;  1C8M 2;  1GZT A;  1F4A A;  1YXW A;  4MLO A;  5FUN A;  4GB3 1;  5IVY A;  5JSP A;  4GZ9 A;  5BNO A;  2HYX A;  1CZV A;  1AF9 A;  2OQ7 A;  2PEL A;  2VBB A;  3FFZ A;  1GUI A;  1CVN A;  2DUQ A;  4TLF A;  1UYX A;  3WW3 A;  1YFU A;  4AFA A;  2ZHN A;  3AP5 A;  2HEY F;  4LLF A;  4NAM A;  2YBS A;  3FBY A;  4AEM A;  3OBA A;  3T1M A;  2ZKL A;  4IV3 C;  3IT8 A;  3N7L A;  1COV 1;  2I45 A;  2Z5W A;  5EJZ B;  2R49 A;  2WZE A;  2ARE A;  2PHR A;  3GZT B;  2R16 A;  4KMQ A;  3VKO A;  5LA0 A;  3BUC A;  3Q8C A;  2ZKN A;  4XE9 A;  3ZN6 B;  1W6O A;  3IZO A;  4FFH A;  1VJ2 A;  3VD3 A;  3WSO A;  5JOX A;  3MLK A;  1PGS A;  5IK7 A;  5J48 A;  5J1X A;  1YO8 A;  1KFX L;  2WYF A;  3FHA A;  4MGZ E;  5SV8 A;  1Z78 A;  5BXX A;  1HRV 2;  2VQT A;  5FYH A;  3ZFF A;  1QJU 1;  1NA1 A;  1G8W A;  4RGA A;  5APA A;  1QEX A;  1O5U A;  2F4L A;  1DIW A;  1ENR A;  5FUP A;  2A6W A;  2WL1 A;  3VDA A;  5F2W A;  1JZ5 A;  5FYC A;  3UK9 A;  5CKQ A;  1AVB A;  1ND3 B;  1S1A A;  1HQN A;  3JQW A;  2XJQ A;  5KHI A;  1XNK A;  1CD3 G;  3MDP A;  4BIO A;  1UO9 A;  1DP0 A;  3PHM A;  1MS4 A;  2YPD A;  5A70 A;  1XE7 A;  3VDC A;  5JMO A;  2WS9 1;  3EMR A;  3NJV A;  4BU2 A;  4BYY A;  3AP7 A;  1POV 0;  4RQP A;  2C6S A;  5KHH A;  3USS A;  3VBR B;  1O4Y A;  4Q2F A;  2VU9 A;  4QB1 A;  4YM2 A;  5JR7 B;  1LB2 A;  1X36 A;  2GH2 A;  3WCS A;  4K8R B;  3OYW B;  1N47 A;  3PUS A;  2J42 A;  5LBF A;  3JCI A;  4YLZ A;  5FJH A;  4HN1 A;  1JZ8 A;  4NVP A;  4Q4Y 1;  3DN7 A;  1PO1 1;  4DXT A;  1EUU A;  1RHI 3;  3AKP A;  2VMD A;  2IFR A;  4ZPI A;  1OUR A;  1QOT A;  5DDJ 3;  3WF2 A;  5L19 A;  1NXD 1;  4J1W A;  1QDC A;  4YZ1 A;  4PDW A;  3VLB B;  4CE8 A;  2WLQ A;  5EJ3 A;  4D6Q A;  3ZPY A;  4BQX A;  5FDB A;  1YI9 A;  2VQA A;  1CX1 A;  3AVS A;  1XNA A;  1HJF A;  4AEJ A;  4LMF A;  3WHT A;  4JGY A;  4B8E A;  2RR1 2;  5BNO B;  1WLD A;  3POS A;  2XQR A;  4AQ2 A;  2WN3 A;  4RR3 C;  2ZGM A;  3E5X A;  1QJE A;  2ZGS A;  2K2S A;  1CIW A;  2WUH A;  5KHK A;  2EID A;  1TME 1;  2X5I A;  3PIG A;  5HPO A;  1VBA 2;  1W0P A;  2Y6L A;  2OT7 A;  5IVF A;  3WG1 A;  5D8A B;  3PUQ A;  2R07 2;  3VZK A;  3ZR6 A;  4JGZ C;  1QH6 A;  3HVD A;  4CCM A;  1Q8P A;  1WZX A;  3SKJ E;  2WII B;  2DCK A;  3DYO A;  3RQ0 A;  3VBF C;  1UN1 A;  1RIR A;  1Y9M A;  4CZS A;  2HWD 3;  3IM0 A;  3L9J T;  3MEP A;  5FZB A;  3ZFF B;  5A3W A;  4GB3 3;  4LT5 A;  2DCZ A;  3KVA A;  1ENS A;  1NA1 B;  4UT5 A;  1GNY A;  1D4M 1;  1XOY A;  2ZGR A;  3DPR A;  4Q4W 1;  5IAV A;  4HKL A;  4FXK B;  5EQU A;  3ZXD A;  4IE6 A;  5FY1 A;  3U78 A;  4QX2 A;  3TBD A;  1RUF 2;  1OQD A;  5FLH A;  4OZX A;  5FYS A;  4FFF A;  4YVS C;  1RYY A;  3OUJ A;  4LXL A;  2YMZ A;  3KV9 A;  2WO7 A;  2H6C A;  4RQP B;  2VTX J;  1SDD B;  1JYT A;  1GFF 2;  5A3N A;  1H4G A;  4R9B A;  4LOR A;  1VB4 A;  3N9O A;  2Q1M A;  2HEW F;  3JZV A;  2VG9 A;  3RDI A;  4IEQ A;  3RSJ A;  2VW0 A;  2YU1 A;  4RGK A;  4XFC A;  4AED C;  1AR6 2;  3LOB A;  2RS3 3;  4KG8 A;  2XPJ A;  2XL9 A;  1M06 G;  2WC2 A;  3AJY A;  4V1P A;  3N7K A;  4RFT 0;  3HNY M;  3ON7 A;  3ENR A;  2CU5 A;  4QPG B;  5JI7 A;  2JE9 A;  3ZYP A;  3GZE A;  2B8M A;  2YC2 A;  2VBD A;  3IN9 A;  3LA3 A;  1CAU A;  4C1X A;  1SFN A;  2DBN A;  4R9D A;  4YW4 A;  2WS9 3;  1TQ5 A;  4BQW A;  3KMH A;  5IVV A;  2DFB A;  2D3R A;  2RVA A;  1VBB 3;  3HN1 A;  3AK0 A;  1RUE 2;  4E4Z A;  5F5A A;  4AF9 A;  4PBO A;  1EUT A;  4JGY B;  1OOP C;  1NLS A;  2XDV A;  3IAP A;  1YEW A;  4OQ9 A;  5A7W A;  3M70 A;  4N7U A;  1JOB A;  3U37 A;  4WM8 C;  1NUK A;  2Y0O A;  4QHB A;  4EZH A;  1PO1 3;  1UYP A;  5C4W B;  2VEC A;  4IGP A;  4MAD A;  4XMI A;  2X5I B;  1GOF A;  1Q8V A;  3R0R A;  4MGS A;  1AUY A;  5DN2 A;  4KWK A;  3W5M A;  2BOJ A;  1JW6 A;  4FPC A;  2Y6F A;  1Q8S A;  2GMM A;  4RGG A;  1T6B X;  5ANN A;  4UYB A;  5BNN B;  1IQA A;  2AGS A;  3NWK A;  2QQW A;  4J1X A;  4FFI A;  2TNF A;  3E5U A;  3KGL A;  3BTZ A;  1D2Q A;  3ZN4 A;  5J37 A;  1W8T A;  3O1P A;  1ZZ7 A;  4L0P A;  4AI3 A;  2YBK A;  3RZH A;  2V72 A;  2WKK A;  2HWB 2;  5EP9 A;  4FTB A;  4NRO A;  5DAQ A;  1RUD 2;  1SZB A;  3K75 B;  3T3Y A;  4CCK A;  1LU1 A;  2E31 A;  4XYX A;  3VBO B;  2ZGO A;  5FYM A;  5AVA A;  1AR8 1;  1RUN A;  2XWB B;  3U11 A;  1AXZ A;  4NOT A;  3PL0 A;  1PK6 C;  1VMH A;  1C4R A;  1YQ8 A;  4FQ4 A;  3VZN A;  5HI0 A;  3HT2 A;  3SH5 A;  3H8U A;  3H42 B;  3H7Y A;  1DZR A;  2WNO A;  1UIK A;  4O7X A;  3ZFG C;  4C90 A;  3POF A;  4L2N A;  4RS5 B;  3S7E A;  3OPZ A;  4ORF A;  1AJO A;  4DMI A;  1V9U 2;  3NO8 A;  4XQ4 A;  4X8P A;  4LBJ A;  3M3C A;  1Q56 A;  2YBP A;  2RJK A;  1D7P M;  4ISR A;  3WLU A;  3WXP A;  4F7Z A;  5FMC A;  3C7E A;  3LSD A;  5FOB B;  1QQP 3;  1FOD 1;  2JDY A;  4XCA A;  4HK8 A;  3U14 A;  3R6S A;  4LIT A;  5LBE A;  1S0B A;  2A7A A;  4GJZ A;  2DYC A;  2EF6 A;  3AMP A;  1CAU B;  3M8L A;  2WAA A;  1RVF 3;  3D8C A;  5GAL A;  5HXV A;  5JXI A;  2W1U A;  1KGY A;  5IK5 A;  1ZBE 3;  4FPJ A;  4JHZ A;  1VLN A;  1XU1 A;  3WW2 A;  4IV1 C;  3SIS A;  5J36 A;  4Y5S A;  4WZF A;  1ONA A;  3HNB M;  1BMV 2;  4UF0 B;  3FWE A;  3USU B;  1VBC 1;  1OH3 A;  4ZHN A;  3S30 A;  2YRO A;  3VKM A;  3OPW A;  5CVR A;  2BEO A;  4CU9 A;  2R30 A;  4XUQ A;  4XAB A;  1VAL A;  5DAP A;  3RG0 A;  4DUV A;  4QB2 A;  1NYW A;  3T2P A;  1W8N A;  4P08 A;  4FOW A;  5LAT A;  2FMY A;  1Z7S 1;  1O3T A;  3ZOI A;  2ZMK A;  4D3W A;  5E88 A;  4UW5 A;  5T3N A;  4LE4 A;  4QQH A;  2AC1 A;  5I8T A;  1NZI A;  5CFC A;  1L7Q A;  4WM7 B;  4G4F A;  3RZM A;  3UJO A;  4IEY A;  4TWT A;  1UWW A;  2WNU C;  2LTN A;  5FK7 A;  5FZC A;  1RUG 2;  2AUY A;  3MLJ A;  3BIW E;  2WN2 A;  2VTX A;  2UWA A;  3MYX A;  3MIG A;  1OF3 A;  3K3N A;  1UL9 A;  2XVG A;  1LGC A;  1U5Y A;  3LKJ A;  5DG2 A;  2JE7 A;  4FOQ A;  2VZ1 A;  4OUS A;  5FP3 A;  1XXN A;  3ZXA C;  2JWP A;  1PVX A;  1UMI A;  1H2L A;  1YQ6 A;  3H1Y A;  4Y1Y A;  1GOH A;  2PQQ A;  1O91 A;  1V0A A;  3FJS A;  2ET7 A;  4B7E A;  2IVJ A;  1H2K A;  2J22 A;  2VPV A;  1K5M C;  3B5L B;  3EHK A;  5FZL A;  3KHB A;  1RHI 2;  2EIG A;  2GSY A;  2ZCW A;  4QPI C;  2JKX A;  2CGP A;  3H8O A;  5IVB A;  5DDJ 2;  1RJ7 A;  5FO9 B;  3ACL A;  3AYE A;  5IFT A;  4CUG A;  5E16 A;  1AR8 3;  2KR2 A;  2V73 A;  1G86 A;  5CKM A;  2RV9 A;  1US3 A;  2XJS A;  5LZ6 A;  4CSW A;  4JZR A;  3VBU C;  3A4U A;  3WDT A;  3E1F 1;  3NST A;  3SEP A;  3DKQ A;  1QJY 3;  4OI4 A;  2P3Y A;  1GP5 A;  4AZZ A;  2A70 A;  5C9A B;  1GQP A;  4GKY A;  4JDM A;  1HN0 A;  4A41 A;  4Q4X 3;  1O3R A;  1YWK A;  4CDQ A;  2VJX A;  3BPZ A;  4ZU4 A;  2WWJ A;  4JHT A;  3ZLI A;  5JWP A;  3H8R A;  1FOD 3;  3ZIW A;  4QX1 A;  4XF9 A;  5EZW A;  4YW3 A;  4KQ7 A;  4R9C A;  3NKG A;  2O14 A;  3CBN A;  3LZZ A;  1O3S A;  1CAX B;  1RGS A;  1JUI A;  1LUL A;  1WCQ A;  2HWD 2;  1ND3 C;  4YGB A;  3VN4 A;  3WNK A;  4GB3 2;  2VQ0 A;  3R4S A;  1DHK B;  4H3W A;  3RMY A;  2OZ6 A;  1VBC 3;  5F5Q A;  4XDP A;  4A42 A;  1GBG A;  4K1Z A;  4JKK A;  4EZ4 A;  2JB4 A;  2GH8 A;  1DQ2 A;  5F8P A;  3ZSJ A;  4QQ2 A;  1T6G C;  3LGR A;  1LU2 A;  4O65 A;  4AK3 A;  4FAH A;  3W9A A;  2ZA9 A;  1DGR A;  2BGO A;  2WYS A;  1WCS A;  2TEP A;  2JIJ A;  3OD0 A;  1Z7S 3;  2HWC 2;  5H9S A;  1XND A;  5GKA C;  2XML A;  4ZON A;  2MHF A;  4A7Y A;  5BNP A;  3O1R A;  1OFN A;  3U75 A;  1DYK A;  1VE0 A;  1UD1 A;  2XJP A;  4XUO A;  2RS3 2;  2E26 A;  1V70 A;  2JDU A;  4CYD A;  5LY2 A;  2D6N A;  4BQY A;  1TNR A;  4IUG A;  1ZRF A;  3I4I A;  2VMI A;  2BNM A;  2HWF 1;  4AHX A;  3ETP A;  3FUO A;  4AW7 A;  2OYZ A;  4IES A;  1Q3E A;  3LD8 A;  4XJW A;  1MS5 A;  2IXI A;  3POY A;  4Q0S A;  2WS9 2;  3TOJ A;  3FBM A;  1US2 A;  5JAX A;  5JXG A;  4OUE A;  1G6N A;  2FDJ A;  3R05 A;  5FUI A;  1WWY A;  1QF3 A;  4MXW A;  1VBB 2;  4DUX A;  1O6U A;  2XWJ B;  1ULC A;  3VKN A;  4LBQ D;  1U12 A;  1ASJ 3;  2JDN A;  3Q8F A;  1HXS 3;  2GME A;  3K77 A;  2CL2 A;  3QCW A;  1GMM A;  1HV0 A;  2BNN A;  3LB9 A;  5D8A C;  4AQS A;  3ES4 A;  1SHW B;  3VUO A;  1AR7 2;  3KD4 A;  4LUK A;  2D93 A;  3I59 A;  4ZZ8 A;  1IHM A;  1ND2 A;  4XHB A;  2ZX1 A;  3KCY A;  4LOS A;  2RMU 1;  1HRI 1;  2RE9 A;  5CBL A;  2F4P A;  1I9R A;  3WDV A;  5BY5 A;  1FT9 A;  4YNI A;  4XF0 A;  3W58 A;  1REF A;  3B3Q E;  2CY6 A;  1I1E A;  5I8Y A;  5I93 A;  3D5O A;  3WG2 A;  3WQB A;  2GN7 A;  4UW6 A;  2J1S A;  4Y33 A;  1DGR N;  3VGI A;  3MPP G;  3J7M A;  4YM3 A;  2WO2 A;  3IAQ A;  1HJG A;  4BQ3 A;  4QXK A;  1H6Y A;  5JMC A;  1QXP A;  4FFG A;  2D6M A;  4K8F A;  1W04 A;  4IET A;  1IG0 A;  2GZW A;  5A3L A;  5CFD B;  4Q0V A;  2IVI B;  5AFB A;  3H7J A;  4XJU A;  2Q1F A;  5A6Q A;  4YG0 A;  3TRS B;  2V5D A;  5L73 A;  2BQP A;  3THC A;  4LBQ B;  4CEY A;  1BK1 A;  3F95 A;  3MLL A;  5BNP B;  2AR6 A;  4CRQ A;  1SFY A;  4XJ8 A;  3AP4 A;  2J1T A;  5FP7 A;  1QKQ A;  1H2M A;  4FQZ A;  4BOW A;  3J26 N;  3FZ3 A;  1OLQ A;  1R08 3;  4D6R A;  5FMB A;  3VD9 A;  5E8A A;  1VR3 A;  2LM3 A;  2NMO A;  4DS0 A;  4CXX A;  3AL6 A;  1QQP 2;  3NW4 A;  3PU3 A;  4QX3 A;  1W90 A;  1S0C A;  3AB0 A;  4X6R B;  2ORZ A;  5FYT A;  3ZFE B;  3SCF A;  5C5T A;  4Y26 A;  4NHM A;  3ZYJ B;  1PMH X;  1OOP A;  4AI2 A;  4PQQ A;  1RVF 2;  2V09 A;  4CTE A;  1S0F A;  1LOF A;  5EWS A;  3VL9 A;  2VUA A;  1ZBE 2;  5DZE A;  3TWI A;  4XTP A;  4NWV A;  3H1W A;  3WV6 A;  5HXM A;  2VNO A;  4FPG A;  4AE2 A;  5C4W C;  1ACC A;  1BJQ A;  1LHO A;  2KXL A;  4Q0U A;  5F1R A;  4FTE A;  5GLV A;  2P34 A;  5FZH A;  5H9Q A;  5JLV A;  3DKW A;  3HJR A;  3KWV A;  3OGG A;  3CMG A;  1MZE A;  4ET7 A;  1KIT A;  3GBW A;  4XQD A;  4B1L A;  1SDW A;  2HWF 3;  1ND2 B;  2R6Q A;  3I59 B;  4CVU A;  5BNN C;  1LOB A;  1UYZ A;  4OCT A;  1GLH A;  2B9V A;  1Y7B A;  3BOW A;  2EAK A;  4TXW A;  3VZL A;  4QU1 A;  3AKQ A;  4W6Y A;  1ZZB A;  2Q5T A;  3H3U A;  3U0Z A;  3VBO C;  1WKY A;  4MH0 E;  5T55 A;  3J8F 1;  1AX2 A;  1VRH 1;  3VZM A;  4ES8 A;  1O4Z A;  4K21 A;  3MO4 A;  3RWK X;  3CJX A;  3I2J A;  1CQ9 A;  3IDB B;  1S4C A;  1DZT A;  1GWK A;  4Y1U A;  5F5I A;  2YG0 A;  4RS5 C;  1JYW A;  4ZU5 A;  3M2M A;  1ZBA 1;  4RA0 A;  3G7D A;  4K1Y A;  2OS2 A;  1R1A 1;  2QBX A;  2WQ4 A;  2WJS A;  3AZV A;  4YGE A;  2Z4F A;  1E5H A;  2B45 X;  3GDB A;  4CEY B;  3DF0 A;  3MFA A;  4LA3 A;  4R4X A;  5C8W A;  4P5Y A;  3AKS A;  1DYO A;  2Y6K A;  4YW6 A;  1NCQ A;  4BH9 A;  4BCU A;  2HBU A;  3KCC A;  4HFS A;  4KGG A;  1JYI A;  2NP0 A;  5BYN A;  1W6Q A;  3MUZ 1;  2VL4 A;  4ITC A;  4W65 A;  3W59 A;  2WFF 1;  4ASK A;  2J1V A;  4Q27 A;  4Q8K A;  1CES A;  1SEF A;  4WZC A;  5FZ8 A;  2W94 A;  1F35 A;  4NRM A;  3POB A;  5FMO S;  1EAH 1;  2VVD A;  4N53 A;  3IDC B;  2FHR A;  4Y4R A;  2VOT A;  1XYP A;  5C7G A;  5K0U A;  3O0X A;  1QJY 2;  2X09 A;  3B02 A;  3F2Z A;  3MW3 A;  2DVA A;  5FXV A;  1PGW 2;  3ZYH A;  4AFM A;  3N9P A;  4I30 A;  1W9F A;  4LA2 A;  1EV1 3;  4Q4X 2;  4QMA A;  2JDM A;  4JCK A;  3S0M A;  1ULG A;  1JOD A;  2LS6 A;  3ACF A;  3OEB A;  4NPL A;  4DNY A;  5I0R A;  1FOD 2;  3GJB A;  2FZ2 A;  4WM7 C;  1H9W A;  4I2O A;  1UYY A;  2AZ5 A;  1X8E A;  1RUC 1;  2WNU A;  4QGL A;  1KS5 A;  2ZX2 A;  3OBZ A;  4E4D X;  3J7L A;  1OKO A;  1OHF A;  1OPO A;  2BYV E;  2PFW A;  4A7K A;  2ZBJ A;  4ARX A;  1AYM 3;  2BNO A;  1YRZ A;  2Y6G A;  1GWL A;  4JC1 A;  2RJL A;  2AAC A;  4IER A;  3WOG A;  1DLC A;  1VBC 2;  3VDD C;  2K46 A;  5ERL A;  5D2A A;  2BGC A;  4PLN A;  4KH9 A;  1X33 A;  4ONU A;  5IFP A;  3AL5 A;  4ARY A;  5FZ4 A;  2CHH A;  4KU7 A;  3CQO A;  1MS8 A;  4AGV A;  4FT8 A;  1Z7S 2;  4Y4Y A;  1BEV 1;  1MS3 A;  2WA3 A;  1PIV 1;  2XG3 A;  2FCU A;  2ET1 A;  3MIB A;  1UU4 A;  2B4K A;  4CCO A;  4PF5 A;  1RUJ 3;  3N9M A;  2RM2 3;  1H8T A;  2QDN A;  4GMP 1;  2HJI A;  3UL2 A;  1ENX A;  3UT0 A;  2CAU A;  1DLL A;  1W6M A;  4YW1 A;  1UQX A;  2PHW A;  1SPP A;  2TUN A;  2GMP A;  2WT2 A;  4EN6 B;  2ARB A;  3NL1 A;  1UAI A;  1VRH 3;  4KBZ A;  4HT1 T;  3TEX A;  4Y1X A;  4DEQ A;  3KSC A;  5DZG A;  2JEN A;  4H55 A;  1WBL A;  4YAR A;  5LA1 A;  4K40 A;  4NUB A;  2YHJ A;  1VBE 3;  2IZW A;  4QHO A;  3O1S A;  1W28 A;  1ZBA 3;  3WF1 A;  1JUH A;  3M3E A;  4CXY A;  4N53 B;  4JTO A;  1LOC A;  5A6Z A;  2VUD A;  5C9A C;  3LDB A;  1DQ4 A;  1S55 A;  2JD4 A;  3MIE A;  4QGN A;  2GNB A;  3ZXL A;  1ASJ 2;  1FPN 3;  5K0U B;  4Q0P A;  1HXS 2;  2RS1 3;  4NWW A;  1ZRC A;  1OQ1 A;  3N35 A;  2JG8 B;  1JYC A;  2R1D A;  4PIX A;  4LUM A;  5FBJ A;  4HAN A;  5FYV A;  2NM1 A;  2VCC A;  3DYM A;  4HOO A;  2ZMN A;  5B4X A;  2H0B A;  4AI0 A;  4TZD A;  3THD A;  3LEK A;  2CDO A;  4QAW A;  1J3P A;  1L7L A;  4FPE A;  4XAC A;  2W52 A;  1D0H A;  3FN9 A;  3GZA A;  4CEW A;  1EAH 3;  3J4U H;  2A73 B;  5FP9 A;  3OD4 A;  1WA4 A;  4AFB A;  1DU3 D;  5CG8 A;  1KRI A;  1AYN 1;  4RHV 1;  3SIT A;  3LOI A;  4IEO A;  3ST7 A;  2W9X A;  4LBN A;  1Z0H A;  4CDX B;  4KWJ A;  3IWZ A;  4MGQ A;  3H8X A;  4DFS A;  4IW3 A;  5A1F A;  5FYI A;  2ZAC A;  4Y22 A;  4UOJ A;  1Q5O A;  1IPK A;  2VNR A;  3POG A;  5IAX A;  1Y9G A;  1RUC 3;  3CJI C;  3OCP A;  4J6G A;  1EPW A;  2Z2S B;  4OI2 A;  3S5Q A;  3V64 A;  1H8T B;  3CO2 A;  4CP0 A;  2FQP A;  2R04 1;  1NCR A;  4M0H A;  4D94 A;  4JQR A;  1W6M B;  2Y60 A;  2VOV A;  1PO2 3;  2VNV A;  5C5U A;  1YI7 A;  1KD7 A;  1R08 2;  5EJ1 B;  3V0B A;  4GH4 A;  4CCJ A;  4XEZ A;  5F39 A;  4UWD A;  5JCT A;  1PVC 2;  5DAV A;  2RS5 2;  3SH4 A;  4LIV A;  5GZG A;  5JOZ A;  2QUO A;  2D44 A;  3WDX A;  2Y0I A;  1FMD 1;  1BEV 3;  1A8M A;  2VC9 A;  1PIV 3;  2O0O A;  4QHZ A;  1CR7 A;  1XNT A;  3I7D A;  2R0F A;  4QX5 A;  4GMP 3;  1PNF A;  2FDG A;  2W0X A;  1F9K A;  4NRQ A;  5FZ3 A;  4MGI E;  4EN7 B;  2ZJC A;  3ZIX A;  1OA2 A;  3SQO A;  1GNH A;  3PMS A;  1JMU B;  2YYO A;  1PGL 1;  3T09 A;  1O8S A;  1QDO A;  2W3J A;  2DVB A;  4M0N A;  3BOP A;  4KWL A;  1OFS A;  4SBV A;  4YYO A;  2JXA A;  2WNV B;  4NN0 A;  2C9K A;  1C5I A;  4FPL A;  1HV1 A;  1NKG A;  2HWF 2;  4E4S A;  5KWR A;  4CDW A;  1C57 A;  1F15 A;  2VZP A;  4NJ4 A;  3ZO0 B;  1GP6 A;  2PLV 3;  1W8H A;  3RZG A;  3KV4 A;  2D6K A;  2D40 A;  1ZM1 A;  2CNA A;  2DTY A;  2OA2 A;  3NAP A;  2LAL A;  4PHZ A;  5EPA A;  4BK4 A;  3SEE A;  3ZDS A;  4IEU A;  2BVV A;  3I2F A;  1WW5 A;  2VGD A;  4AVS A;  5FZ7 A;  2NZ9 A;  4XQW A;  3LIH A;  5JI9 A;  4QXH A;  1LR5 A;  4RN5 A;  4AI1 A;  4COZ A;  3ILR A;  4YFZ A;  1G9D A;  2HKX A;  2OPK A;  2ZTN A;  1OQE A;  2B42 B;  3UET A;  5AC9 3;  3N36 A;  1XSR A;  3AJZ A;  4P02 B;  1I6X A;  3PNA A;  4LKS A;  3VBS A;  1BBT 1;  5DAB A;  3LDK A;  4RL7 A;  5FYZ A;  3LPF A;  4CCC A;  3RRD A;  2JG9 A;  2WWU A;  4LBL A;  5HV0 A;  4CPB D;  2ARA A;  4XJ9 A;  2ZZQ A;  3VBH C;  1AYN 3;  1W6O B;  1ZNP A;  5H9R A;  4P14 A;  4RHV 3;  3ZFE C;  3A0K A;  1H2N A;  1TMF 3;  4OHX A;  1OSG A;  2XHN A;  4ZKT B;  4JKM A;  4L92 A;  4GH4 B;  3MF9 A;  2GC0 A;  1B35 A;  1HDK A;  2YUE A;  3IMN A;  3LIG A;  3PUI A;  3QAC A;  1VMF A;  1IS5 A;  1W3V A;  4G3Y C;  4NHK A;  3ZN5 A;  2D5F A;  3GM8 A;  2OQ6 A;  4Q1R A;  5HCA A;  2ERF A;  1WW7 A;  3H0O A;  2X53 S;  2DUO A;  2WZR 1;  4HG6 B;  1COV 3;  4U2A A;  4GWN A;  4MSV A;  4NE9 A;  3NJX A;  3RI9 A;  3ZYR A;  1J1T A;  1OA3 A;  2I74 A;  4I0A A;  4KWU A;  5B2G B;  5HCF A;  1CX4 A;  3N4M A;  3GBF A;  4P5H A;  4AG4 A;  1S2B A;  2QZ2 A;  4M3C E;  4XXP A;  1IZ3 A;  4YVW A;  1EV1 2;  1JH5 A;  1MQT C;  3ZXE A;  3IIA A;  1NLQ A;  1LKN A;  4HON A;  5KHJ A;  4CA9 A;  1QJU 3;  4OHW A;  1QJX 1;  1J3Q A;  1W9Y A;  4OMD A;  1D0G A;  1DQ0 A;  1MEC 1;  2WT1 A;  2WQ8 A;  2Y33 A;  3HMY A;  5FKC A;  4BDV B;  1GNZ A;  5IVC A;  4CDW B;  1PZ8 A;  1UMH A;  3PU8 A;  1FMD 3;  3WP5 A;  3GCW A;  3JQX A;  3UKN A;  2VVF A;  2L9L A;  3LFM A;  3NAP B;  1NE6 A;  4OMC A;  1AYM 2;  5IW0 A;  1VAV A;  4PDW B;  1P8J A;  3J7H A;  3BN6 A;  4XAE A;  2CWM A;  4M01 A;  1KJR A;  2G9F A;  1Y9Q A;  3WHU A;  4W4Z A;  1AL2 1;  2AH2 A;  4QD2 A;  1TE1 B;  3NKT A;  4D6S A;  1UIJ A;  1I5Z A;  3N9N A;  2YU2 A;  4Y5Z 0;  3BYW A;  1GZ9 A;  3VV1 A;  1VBD 1;  2V4A A;  2JB8 A;  3N7J A;  4Q4Y 3;  5BNQ A;  4GAZ A;  3WR0 A;  3FFQ A;  1WME A;  1RUJ 2;  3B69 A;  3P1I A;  2D3P A;  4QQL A;  1YNA A;  2RM2 2;  5T52 A;  1RUH 1;  5FV3 A;  4WVM A;  5ABJ C;  2PHX A;  4AWD A;  5FXW A;  2ZGU A;  3NV1 A;  2IXC A;  2BBV A;  1PM7 A;  5JDB A;  4QKN A;  5CIS A;  2GP3 A;  4UFH A;  1XYN A;  4UFK A;  1VRH 2;  1A8D A;  2G4I A;  1J84 A;  1DYP A;  3OUI A;  4NID A;  3AZY A;  3Q8A A;  1W8O A;  1O4T A;  1B35 B;  2BFU L;  3PUA A;  1VBE 2;  2DTW A;  3DPR B;  2NYY A;  3K51 A;  5DUX A;  3ZXG A;  3FLP A;  2G9Z A;  4QM9 A;  5IK4 A;  1LAJ A;  1LRH A;  1ZBA 2;  1I3H A;  3VZO A;  1F31 A;  3RZL A;  4MET A;  3L2H A;  3SLI A;  3WP3 A;  1TME 3;  2CDP A;  4NHY A;  4QPW A;  1S2E A;  2W95 A;  1VAM A;  3I2O A;  2R32 A;  2GC2 A;  2O8O A;  2QFE A;  3CZU A;  3D0J A;  5SV5 A;  1FPN 2;  4KGQ A;  2BP6 A;  4D7Y A;  2RS1 2;  2UY8 A;  4O9G A;  1JN2 P;  4HL0 A;  3CF6 E;  5L36 A;  1QY4 A;  2VMC A;  3M7A A;  4XIO A;  4JTN A;  3K48 A;  3ZYG A;  5ACA 1;  1ST8 A;  1H9P A;  5DXD A;  4UFJ A;  1NLR A;  5BUV A;  1D4M 3;  2WZP P;  4Q4W 3;  1IKQ A;  5GLW A;  2WR9 A;  1IS4 A;  1OI6 A;  3B9I A;  4D8M A;  4AL9 A;  3GYD A;  4P9Y A;  2P2K A;  4JRA A;  4AFD A;  3PVN A;  4M3C F;  4OFG A;  4ZS2 A;  5GZF A;  3I3M A;  1EAH 2;  4XDO A;  1GKB A;  3S57 A;  5LEJ A;  2WZR 3;  5G04 L;  4TSV A;  2A1X A;  2DVG A;  3C8X A;  5FZA A;  4EJR A;  1C3H A;  1OPM A;  2OII A;  2IXK A;  3BPS A;  1AL0 G;  1TNF A;  3I54 A;  5FO7 B;  1LCL A;  4XBN A;  4MG2 A;  1IPS A;  1LGB A;  4AFC A;  5IYY A;  3ZKU A;  3O12 A;  2HEV F;  2QTW B;  2FCV A;  2GP5 A;  2BBA A;  5JXJ A;  1QJX 3;  1W9W A;  3D3A A;  4ISQ A;  5FZ1 A;  4P9J A;  5A7W B;  1MEC 3;  5KR7 A;  5J98 B;  4CDU C;  4LKD A;  1CZS A;  4PIY A;  4LKF A;  3ME2 A;  1RUC 2;  4ZXE A;  4HKO A;  5FZK A;  2WDB A;  1SBE A;  2ZOE B;  1BQP A;  1PO2 2;  1S0D A;  2VXR A;  3BVC A;  1UY4 A;  3PVB B;  2HBT A;  4YPJ A;  3S5A A;  3IDE A;  1TG7 A;  5GM0 A;  5FIX A;  5L7O A;  1D2S A;  3UGF A;  4D69 A;  4ASM B;  1OD5 A;  1GU3 A;  1AR9 1;  1HX6 A;  1NQJ A;  4B1M A;  1VBD 3;  5JOY A;  1PIV 2;  2OUJ A;  3RYP A;  3O0V A;  4B7K A;  2JG8 C;  3GCX A;  4RD7 A;  3MID A;  4XFH A;  4DXR A;  4HVO A;  2A3X A;  1PZ7 A;  2O1Q A;  5FY5 A;  4HSL A;  3HBZ A;  4N43 A;  5JZG C;  4AEK A;  3LE0 A;  3T4H B;  1WBF A;  4IEV A;  2CGO A;  1OD3 A;  5A33 A;  1AX0 A;  5FY0 A;  2BDR A;  4LLO A;  3DUI A;  1KFU L;  4BE3 A;  1MZF A;  4EYU A;  4C0B A;  3K2O A;  1AZD A;  3E6C C;  3H3Z A;  3SCG A;  1S0J A;  1CAW A;  2PLV 2;  3ZYB A;  2NN8 A;  5C8C A;  5HCB A;  2B7Y A;  4LK7 A;  5KC5 A;  3U4X A;  5C70 A;  3MFC A;  1XC6 A;  4HLT A;  4AQ6 A;  3VHR A;  3BIE A;  4Z1V A;  3ZPO A;  2WAB A;  4AHZ A;  4CDX C;  1SLT A;  2HWE 1;  2Z79 A;  3WNO A;  4KI5 M;  5CAD A;  4WV8 A;  4YZ2 A;  3DV8 A;  1WD3 A;  1X7N A;  3AYC A;  5DUV A;  1DQ1 A;  1RUI 1;  5FFO C;  5C3Q A;  4FO9 A;  4ZXK A;  2XOM A;  1WLW A;  1UKG A;  2GN3 A;  2J1A A;  2W91 A;  4IV3 A;  1K45 A;  4Y20 A;  4L9B A;  1JI6 A;  1C28 A;  4I3G A;  5FBZ A;  4FAG A;  5AC9 2;  3RZZ A;  5JVV A;  2W46 A;  4QWN A;  2VD7 A;  3MHZ A;  1RXF A;  5DQ0 A;  4LR4 A;  2QQU A;  4AXO A;  4EWE A;  1BLZ A;  3A21 A;  1H30 A;  1IPJ A;  2E9Q A;  1C1L A;  2Y26 A;  4NR1 A;  1XYO A;  4QDR A;  5EXO A;  1S0E A;  2E6V A;  5FZM A;  5C3R A;  1DQ5 A;  1AYN 2;  3AMH A;  3R4D B;  4RHV 2;  3UKV A;  3WT3 A;  1W03 A;  3CDZ B;  3R4U A;  5FCC A;  1TMF 2;  2ZXQ A;  2QQO A;  3WNN A;  3LFI A;  3ZKY A;  4NIG A;  5CFC B;  4LBO A;  2ZGQ A;  4KNC A;  3K46 A;  4Z07 A;  4DRV A;  1UPS A;  1OLM E;  5L7O B;  1C8M 1;  1HLC A;  3AKR A;  4P9W A;  1QHD A;  2XLA A;  4XZU G;  5A3P A;  3PDQ A;  4M3C A;  2ZHL A;  4HPK A;  4ZS3 A;  5LB6 A;  5IAT A;  1NT0 A;  3VBR C;  1COV 2;  1PZ9 A;  4A45 A;  4AR2 A;  1NX9 A;  1H1I A;  1O8P A;  1RUO A;  1JZ3 A;  2WNV C;  4KU8 A;  4N43 B;  1A78 A;  2EAA A;  4H2A A;  4J25 A;  4BWO A;  1NY7 1;  2F6B A;  1QJU 2;  4YFW A;  5A33 B;  1BVV A;  5F37 A;  3UV9 A;  4XJZ A;  2PAM A;  3O14 A;  5FP8 A;  2ETE A;  1DF0 A;  3ZR5 A;  1HRV 1;  2NQY A;  2OUH A;  3QH7 A;  2FMD A;  4LK6 A;  1SBD A;  1G9A A;  1CN1 A;  1AR9 3;  5EYX A;  3EYP A;  5C8C B;  1JHJ A;  4FBF A;  1RIN A;  3AP9 A;  3KQ4 B;  4IQP A;  2D6O X;  5BNO C;  3FHQ A;  3NVC A;  1GAN A;  5KXC A;  1VAK A;  1K42 A;  4P9G A;  1FX5 A;  3LQC A;  3NNJ A;  4RR3 A;  4UBH A;  3NNM A;  2WRA A;  2ZAB A;  1UXX X;  4E8D A;  2YGM A;  4WVZ A;  4U36 A;  4XF4 A;  1DFQ A;  4QKD A;  3VKF C;  1YQ5 A;  4Y20 B;  2EAL A;  2X10 A;  2O8Q A;  3KGZ A;  4JGZ A;  4Q4Y 2;  1PO1 2;  3VBH A;  3VBF A;  2X29 A;  5FTT C;  4CDQ B;  3N9L A;  5FYU A;  3WVJ A;  3JUU A;  1TVG A;  1JYX A;  3VDB A;  3C2U A;  2ZML A;  1FAT A;  2DDU A;  2CYF A;  3D0S A;  3K4A A;  3VHN A;  3ZFF C;  4BB3 A;  4Z8B A;  1NA1 C;  4FPH A;  1OBN A;  2HWE 3;  4UFL A;  1HB3 A;  1O5L A;  2FDI A;  2VMF A;  1ZA7 A;  1MVQ A;  3KM5 A;  1RUI 3;  3A7Q A;  4LIU A;  1LHN A;  3UNP A;  2VZT A;  5DG1 A;  4QPY A;  2J7M A;  5LRS A;  4YVS A;  5F3G A;  4XFB A;  2VXJ A;  2RR1 1;  3VL8 A;  2P3K A;  5CAZ A;  5DPN A;  4IGO A;  4M3C B;  1TME 2;  2XJU A;  4HPK B;  4RQP C;  1H0B A;  4YG3 A;  5FZF A;  2W92 A;  1DQ6 A;  2E7T A;  5FQ0 A;  3IPV A;  5EV7 A;  1HB4 A;  4I3P A;  2WSV A;  4IE0 A;  3WW1 A;  1L3J A;  4AED A;  4Q26 A;  2EXJ A;  1VBA 1;  2QQM A;  3BCW A;  4HVQ A;  2ZX4 A;  3D6E A;  4FVV A;  3WIN E;  1IS3 A;  1A6C A;  1WUV A;  4GQ7 A;  2JDH A;  4MV2 A;  4BLI A;  5L9R A;  1VP6 A;  2R07 1;  3EJK A;  4IEZ A;  1SLL A;  1U5X A;  3V56 A;  4QPG C;  3A23 A;  4BXF A;  3WF0 A;  1D4M 2;  1W39 A;  4Q4W 2;  2K9Z A;  2EXH A;  1OH4 A;  4LEJ A;  2C5D A;  1E5R A;  2D97 A;  4MOA A;  3O1T A;  4PDW C;  3AZZ A;  3CIH A;  4JVA A;  4RFR B;  1F2N A;  1QIQ A;  3W5N A;  4XF3 A;  4COY A;  3BKZ A;  3QH6 A;  2W2I A;  3WNM A;  5GZC A;  1AJK A;  1POV 1;  3J9S A;  3LEI A;  4JGY C;  1KJL A;  5F6K A;  3S6P A;  1HQW A;  2QQJ A;  5FR3 A;  5TSW A;  3BTA A;  4WM8 A;  4D0Q A;  4MXW B;  4A44 A;  1W2A X;  3POW A;  2PQS A;  3T4V A;  3ZSK A;  2Y8K A;  3OGV A;  4QDS A;  3ZSE A;  2X5I C;  5A3O A;  1QJX 2;  4GIQ A;  2QDR A;  3I3E A;  1MEC 2;  5GLU A;  3WEZ A;  4AHW A;  5IUQ A;  3ETQ A;  2QQI A;  1YUD A;  2A3Y A;  5A7O A;  4JGZ B;  3DEM A;  4XUN A;  5EHD A;  1FXZ A;  2RG4 A;  4S2H A;  1E5S A;  1MS9 A;  2WO1 A;  3EQE A;  5CU1 A;  1K3I A;  1H6X A;  3LDR A;  3VBF B;  4BLJ A;  1JZ4 A;  2WLP A;  4HVR A;  1FNZ A;  3BU0 A;  4YZ3 A;  1JZ7 A;  1KXG A;  2JEC A;  1BCX A;  2VH9 A;  1MS1 A;  1N1T A;  2C4X A;  4LQR A;  5F3E A;  2YFU A;  4IND A;  3M3Q A;  2A6V A;  3WG4 A;  2D6P A;  4LTA A;  1ULE A;  4NO4 A;  1KEX A;  2PTM A;  2XBO 1;  3KT7 A;  4DZG A;  3G6J B;  3ROU A;  5I0D A;  2DCT A;  3MZH A;  4JV4 A;  1VBD 2;  2SLI A;  1PK6 A;  2PMW B;  3VB9 A;  1HB2 A;  1DZQ A;  2VW2 A;  4BME A;  4Z92 B;  1GR3 A;  3H9A A;  3ZFG A;  5JXH A;  1BK0 A;  2LW8 A;  1PNG A;  3ILF A;  3WUD A;  2RMU 3;  1HRI 3;  4IXL A;  4WVV A;  2PN5 A;  3GF6 A;  4AED B;  2DV9 A;  2IUW A;  4NPR A;  3ZDV A;  2Z69 A;  3C7O A;  1ZRD A;  1DDL A;  5FPU A;  2JDK A;  3O1V A;  5A3M A;  4X8N A;  2BZD A;  1F5F A;  1CIY A;  1IG3 A;  2ZHK A;  3C7H A;  5FZE A;  1BXH A;  2P6H A;  1AHS A;  1BKZ A;  1YFX A;  1RTV A;  1JOP A;  4GAL A;  4Y24 A;  3DXU A;  3T08 A;  1MS0 A;  2W5F A;  5FRE A;  3PVE A;  5LAS A;  2ZGN A;  5A3T A;  2E33 A;  4DXZ A;  4DO0 A;  4Q4V 1;  1UCX A;  4CU7 A;  3MI8 A;  4JQT A;  4LPL A;  4IV1 A;  4FP2 A;  1YC6 1;  2HWB 1;  2LRP A;  2OW4 A;  1AR8 2;  2J1U A;  1RUD 1;  2R06 1;  3ORJ A;  3BGA A;  3JD7 1;  1WMD A;  4BQ5 A;  3III A;  2QE3 A;  1OOP B;  4MHR A;  3SMH A;  2ORX A;  3AP6 A;  1CJD A;  3CEW A;  3DGT A;  1QH7 A;  2V5Y A;  4WM8 B;  1J1L A;  4PI0 A;  2JX9 A;  1BVP 1;  1T2X A;  5FLI A;  4DQA A;  1RMU 1;  3ZX7 A;  5F9T A;  4ZU7 A;  3RJR A;  3UES A;  4WBB A;  1XQN A;  3M3O A;  1OVP A;  3PUH A;  4XBQ A;  2VO5 A;  2ZZJ A;  5E6H A;  1V9U 1;  4MX3 A;  3T0B A;  1LJ7 A;  4CU8 A;  1W05 A;  2Q8C A;  3WW4 A;  1UKR A;  4IEP A;  3OTF A;  1LEC A;  1POQ A;  3VBO A;  1OLM A;  4C1W A;  3BAL A;  4D7S A;  2ARC A;  3ZYI B;  3QOP A;  3JU9 A;  3ZM8 A;  5G05 L;  4FP3 A;  3GAL A;  3T0A A;  5FKB A;  1ULF A;  1TEI A;  3OB8 A;  4B29 A;  2W1S A;  4QB6 A;  2CAV A;  3RGB A;  4BA6 A;  3OG2 A;  1MZ5 A;  3WP4 A;  2QQN A;  1V6K A;  2VZS A;  3OUH A;  1YFW A;  1LTE A;  1QJF A;  5JPN B;  3FX3 A;  4FTS A;  4OHZ A;  1QU0 A;  1KQR A;  1PMJ X;  2VMG A;  1WLT A;  4QQO A;  4XUT A;  5FK8 A;  5FY9 A;  2AEN A;  5T5L A;  3SNM A;  4DRR A;  5JOW A;  2RDQ A;  4CU6 A;  5HV4 A;  4HZF A;  4ES9 A;  2YXS A;  1NZC A;  1QNY A;  1Y3T A;  1OMI A;  4E8C A;  3C7G A;  4Q5O A;  1QWR A;  3JBG 1;  4FPY A;  1MZ6 A;  4LKE A;  3WDW A;  1K5M A;  2WFP A;  4MYE A;  4COV A;  4EWA A;  4BQ1 A;  1ULP A;  4QPI A;  1LGN A;  3AFG A;  2ADD A;  2BTV C;  2XKP A;  2PA7 A;  4XAA A;  4DIQ A;  4XFG A;  2DVD A;  3PTR B;  5CYY A;  2QQL A;  4COW A;  1NCQ B;  4HK9 A;  2XBO 3;  1GYK A;  4EQV A;  3J8F 3;  4OI1 A;  1OUX A;  1AR9 2;  3NRU A;  5GLT A;  1W6Q B;  1FNY A;  3AFK A;  2WSU A;  2UU8 A;  3VHP A;  5FJK A;  2WA4 A;  4K7J A;  4UW3 A;  3LAG A;  3PME A;  4XJA A;  4CUC A;  3VBU A;  2XQX A;  5JIA A;  3VD4 A;  2HH9 A;  4R9A A;  1RUG 1;  3VZJ A;  5KXE A;  5IHR A;  3OSD A;  1EP0 A;  4LBM A;  1JHN A;  1V6N A;  1OUS A;  1BZW A;  1R1A 3;  3NMB A;  4E2G A;  1ODM A;  4EN9 B;  2KD7 A;  4OUL A;  5LWB A;  4FOV A;  4ZZ5 A;  2ADE A;  2DCJ A;  3MPB A;  5A32 A;  4AVC A;  4A3Z A;  4SLI A;  4XUR A;  4CCN A;  3APB A;  1XNC A;  2UUR A;  3KZ4 C;  3MUY 1;  2UY9 A;  1UW8 A;  2WIN B;  1CJP A;  2WFF 3;  3KVB A;  3HNM A;  1ND3 A;  4Q4V 3;  5CFC C;  5CKN A;  1RHI 1;  3KF3 A;  4LUL A;  2XGX A;  2R06 3;  4DXS A;  3AZX A;  3JD7 3;  2EXK A;  2Q0A A;  2HWE 2;  3I3B A;  4MZU A;  2WNU B;  1QGL A;  2XB6 C;  5DDJ 1;  3WX5 A;  3IBM A;  4BXS V;  1RUI 2;  1ZZ8 A;  2EIE A;  2K0G A;  2ARX A;  1QXR A;  3EB7 A;  4FPF A;  1SG3 A;  2XLF A;  2W39 A;  5C33 A;  2OKX A;  2ENR A;  1LHV A;  5FZ6 A;  1RMU 3;  2FBE A;  2PHL A;  3MIF A;  4W50 A;  3OYW A;  3OBT A;  4AI9 A;  1VPH A;  3AVR A;  4DIN B;  3WNP A;  3U4S A;  5A7Q A;  5CB7 A;  4D7T A;  2XHK A;  2XVL A;  4DY5 A;  4B4Q A;  1W0N A;  3RYR A;  2XUM A;  2XVK A;  2ZX0 A;  4AVT A;  1RXG A;  5DZF A;  1GOG A;  1PX3 A;  1LNS A;  1JTZ X;  3AM2 A;  2E7Q A;  4CCE A;  4QPI B;  2EA7 A;  1SQ4 A;  1SFP A;  4LHS A;  4CCD A;  3C7F A;  1UNB A;  2HWD 1;  2Q30 A;  1PHM A;  3MF6 A;  5LA9 A;  1SPP B;  3O7O A;  4IEX A;  5AFE A;  4P9X A;  3WQ0 A;  3MBW A;  3JB4 C;  4B3N A;  1IGO A;  1ODN A;  1J83 A;  5DAW A;  2Z42 A;  2IXJ A;  5DUW A;  2VCB A;  4XW3 A;  2Y34 A;  1NXM A;  2GAL A;  4CXW A;  3URF A;  1WD4 A;  1NAE A;  3I3D A;  4W8J A;  3RJ2 X;  4PJY A;  3ACH A;  5FYB A;  3VBU B;  1W8Z A;  3RPQ A;  3W21 A;  1V6I A;  3CZJ A;  1X50 A;  1R1Z A;  3TNP B;  1V6L A;  3K4D A;  3JBG 3;  5IT6 A;  1R09 1;  2WT0 A;  2XR4 A;  3HIF A;  5D8A A;  5JIU A;  5LEK A;  1XPW A;  1E57 A;  2HWC 1;  1VMJ A;  1NY7 2;  4YGC A;  3TEY A;  2QQV A;  3LWC A;  4XTM A;  4CDQ C;  1SLA A;  1UOB A;  3HQX A;  5A32 B;  4HKW A;  3HQR A;  4OZO A;  2FDF A;  3CLP A;  2RS3 1;  2EIC A;  3TNQ A;  3T2O A;  2EIB A;  2V4V A;  3N9Q A;  4OHV A;  5CIR A;  4YZ5 A;  5J09 A;  3AC0 A;  3DCQ A;  4CP9 A;  1V00 A;  4AI8 A;  4ERO A;  2BOI A;  4E4H A;  1YIF A;  2YFZ A;  3MGU A;  1RUG 3;  4I0W B;  5D1I A;  2DFC A;  4AYU A;  1Q43 A;  3JXS A;  2P3J A;  5IK8 A;  5JSO A;  4CEW B;  1IKP A;  2OPW A;  3GZU C;  3I2H A;  5T50 A;  4EN8 B;  4I01 A;  5CG9 A;  3DXT A;  1YIP A;  4MUV A;  1R64 A;  2VZO A;  1NE4 A;  5I0T A;  1VBB 1;  3KCX A;  4BMB A;  2BRT A;  5CFD C;  5FY8 A;  1G9F A;  1AXY A;  2W08 A;  1IOA A;  2G1M A;  4HN0 A;  1F4H A;  2P3I A;  2VME A;  4GWJ A;  2BWA A;  5BNP C;  1DGW A;  3LSE A;  3H1M A;  2RMU 2;  1DG6 A;  1HRI 2;  2BGP A;  4CPB A;  1AR7 1;  4LO8 A;  2VZR A;  4QPG A;  4Y22 B;  3EBR A;  2X05 A;  1LES A;  1Y43 B;  1V6O A;  2QQK A;  1SLB A;  2OXB A;  5FPX A;  1ULO A;  4XUP A;  3TEZ A;  4LHK A;  2VZV A;  4UBG A;  2YDE A;  4IE4 A;  2PYT A;  2A6X A;  3HBK A;  3WY6 A;  1NCR B;  3T1L A;  5HCH A;  1NOV A;  2C9A A;  4NPM A;  4I02 A;  2D6L X;  4W6W A;  4Y3O A;  4NIA A;  3ZMN A;  4CP2 A;  2Y6H A;  5F6L B;  3V0B B;  3WF3 A;  4R52 A;  2ILM A;  1UU6 A;  4GXL A;  1JBC A;  3THP A;  3B01 A;  2W1W A;  4O61 A;  4Q0Q A;  4XVH A;  1U5Z A;  1QOS A;  5C4W A;  4CCL A;  3W20 A;  1UXZ A;  3KB5 A;  5E89 A;  2N7G A;  4B4R A;  1QXJ A;  5GZD A;  3V65 A;  2WQZ C;  3NJY A;  4QDQ A;  4NHX A;  4AGG A;  3TB0 A;  2P1B A;  4OVE A;  2R04 3;  3I3Q A;  4N8M A;  4R8H A;  3RVH A;  5BNN A;  2MPF A;  1W9T A;  1ND2 C;  1NG0 A;  3OPT A;  4P9I A;  1PM4 A;  3KLS A;  2XL7 A;  3WQ7 A;  1XBF A;  5ISL A;  1DCS A;  4AHY A;  2BWC A;  1ALY A;  1YLL A;  1OF4 A;  3PJY A;  4MGY E;  4CP9 B;  1RED A;  5K8S A;  1GV9 A;  2JDA A;  4CUA A;  3UGG A;  2MEV 1;  3K3O A;  2VM9 A;  1QQP 1;  3HOB A;  4QX8 A;  4XFA A;  1UY2 A;  3E6B A;  1YQ2 A;  5CNA A;  1JU4 A;  2D5H A;  2FDH A;  2E63 A;  2IC1 A;  3T2Q A;  3ZSM A;  1R09 3;  1KS4 A;  1EYB A;  2A6Z A;  1RVF 1;  2PAE A;  3I49 A;  3FHI B;  2CSG A;  2YC4 A;  2HWC 3;  3BOD A;  4Y5T A;  1ZBE 1;  4GD4 A;  4YG6 A;  4RS5 A;  1MAC A;  1XSQ A;  4NMI A;  4PIZ A;  4Q1P A;  4E2Q A;  3P5B A;  2YPJ A;  4CEY C;  4BHP A;  1OC1 A;  4LHN A;  2GND A;  4QKB A;  1URX A;  4YZ4 A;  5A7P A;  3VBS B;  2D43 A;  1JZ2 A;  1ZVF A;  3PIJ A;  5LY1 A;  4XBL A;  2JG9 B;  2BPA 2;  4K6B A;  3FE5 A;  3VKL A;  3IB3 A;  1G9C A;  1UZV A;  1LEM A;  1STM A;  1Y4W A;  2E53 A;  2XBO 2;  4QXC A;  4BM8 A;  3J8F 2;  4FSJ A;  4Y1Z A;  2QQP A;  4B4P A;  3A22 A;  2DUR A;  4UF0 A;  3USU A;  3ACG A;  1YJL A;  3SC7 X;  4DY3 A;  1LOF C;  4HET A;  1GP4 A;  2VAU A;  3OY8 A;  4KL1 A;  1SMV A;  2D98 A;  5B4N A;  4ATF A;  1CWP A;  3B7M A;  5AVP A;  1AR7 3;  1H4H A;  1VB2 A;  1R1A 2;  2VW1 A;  5F3I A;  1BBT 3;  1ZRI A;  4A7Z A;  1YCI A;  1SLI A;  5E1R A;  4PI2 A;  3MV0 1;  3ZVX A;  2DUP A;  5T54 A;  2E7A A;  4WM7 A;  4A4A A;  3TN9 1;  4GMP 0;  3ZYF A;  1X9P A;  1YFY A;  4PCR A;  4OYU A;  4YVW B;  3PTY A;  1GZC A;  2WFF 2;  2D3S A;  2WNE A;  3J7N A;  3SXW A;  1W0O A;  3WQ1 A;  3OBR A;  4Q4V 2;  3OEA A;  5A7S A;  3IMM A;  2R06 2;  1LHW A;  1RL3 A;  3JD7 2;  2F17 A;  2W47 A;  4YGD A;  3VDD A;  2LUW A;  3TYJ A;  2ATF A;  3GGL A;  4L97 A;  5JSR A;  2C24 A;  4LE3 A;  4QXB A;  1CPM A;  4UW4 A;  1RMU 2;  3KT4 A;  3O0W A;  1A34 A;  3ZSL A;  2GC3 A;  5FPL A;  3LA7 A;  1QJY 1;  5DAX A;  2G9G A;  3SH3 A;  1FI2 A;  1PGW 1;  3PVO A;  3KV6 A;  1REE A;  3SKV A;  5LW9 A;  3BI3 A;  3RI8 A;  4Q4X 1;  3T2T A;  5C3S A;  3WCR A;  5A7N A;  5LK5 A;  5JUV A;  2MEV 3;  2UWB A;  1OLR A;  1NCQ C;  2YB7 A;  1LEN A;  2A6Y A;  1WW4 A;  1W2N A;  2JDZ A;  5J7M A;  3INA A;  1XB9 A;  4FCA A;  4WVM B;  3Q8E A;  2GU9 A;  5FMO L;  5FPB A;  5IJR A;  3HT1 A;  5L9B A;  5T5P A;  3U07 A;  2ZGK A;  5C3O A;  2Y38 A;  2B9U A;  4PF1 A;  4TYS A;  5GZE A;  1UZY A;  5FZD A;  4LHL A;  4AVA A;  4HSJ A;  1RIT A;  1AL2 3;  1CAV A;  1UU5 A;  1PX4 A;  3CHX A;  2PAK A;  2UYA A;  3AX4 A;  4PLO A;  4N53 C;  4XF1 A;  1XNB A;  1YHF A;  1U0A A;  3P3N A;  5C9A A;  2I07 B;  2JIC A;  4YW7 A;  3WZ1 A;  3OY8 B;  3NNG A;  5T5O A;  3OGS A;  1W99 A;  4AGR A;  3RMX A;  4LJH A;  1APN A;  3HR9 A;  5L9V A;  3NNL A;  5K0U C;  1BEV 2;  4JAA A;  4S2F A;  3JBG 2;  3ES1 A;  1RUH 3;  1SBF A;  2P5B A;  3FL7 A;  5F32 A;  2VOX A;  3HQU A;  2LRO A;  1CAX A;  2KA3 A;  3B94 A;  2Q8O A;  4XHX A;  4F8A A;  1A3K A;  2RDN A;  2OX0 A;  1ZZC A;  1FYU A;  3LCP A;  3FUQ A;  1G9B A;  4EV0 A;  4AAP A;  4FOY A;  4LO5 B;  1UOG A;  1WCK A;  3OGJ A;  5ANQ A;  2R1B A;  5FAX A;  5JPM B;  4BQ4 A;  3B00 A;  2ZS6 B;  2G19 A;  5KBF A;  2W1Q A;  2VZ3 A;  2UYB A;  4N90 A;  3H3L A;  4QQP A;  4P00 B;  3VDD B;  4AVB A;  1X8M A;  2A75 A;  4AQT A;  1QJZ A;  4E9K A;  3Q8B A;  5C6C A;  1OKQ A;  1B09 A;  3H50 A;  3M1H A;  3CKH A;  3B93 A;  2VQU A;  3WNL A;  2FD8 A;  1X9T A;  2VZU A;  2QJV A;  4QU2 A;  3O5S A;  2A71 A;  3LPG A;  1OVS A;  5F2S A;  5FZG A;  4QM8 A;  4M4P A;  1FAY A;  5IWF A;  3LEG A;  4UI9 L;  3TN9 3;  1ASJ 1;  5I0S A;  5ACA 3;  5I0U A;  1HXS 1;  2SBA A;  3CJI A;  1LOG A;  5FZ0 A;  3ASI A;  2CTV A;  2VBP A;  2P17 A;  5EYY A;  1H8T C;  1KDK A;  2CWS A;  1W8W A;  2KM2 A;  3KF5 A;  2DWR A;  3WP6 A;  4BZ4 A;  3O1M A;  1HN1 A;  4FPK A;  5KXB A;  4Y1V A;  4NRP A;  4L8Q A;  1RJ8 A;  2I2S A;  5FO8 B;  4OQ8 A;  4JX0 A;  2VE1 A;  2WAO A;  1DBN A;  3C3V A;  2IWG B;  1F5J A;  3TEW A;  4H14 A;  4FI9 A;  4UFM A;  4LO6 B;  3JB8 A;  1CAV B;  3E97 A;  2QZ3 A;  2HLE A;  4IL7 A;  4C91 A;  5T5J A;  1GQG A;  2DU1 A;  4EWD A;  1V6J A;  2C1F A;  4DB5 A;  5M0T A;  4C0H A;  2ZEW A;  3HWJ A;  3RNS A;  1UZZ A;  1CPN A;  3ILN A;  1LOE A;  3SHR A;  1W06 A;  1WMX A;  3GJA A;  4GJY A;  4NAO A;  2XKO A;  2R04 2;  3T30 A;  1XJA A;  4BIS A;  4MGK E;  4YRD A;  4XMA A;  1CGP A;  1QOO A;  4PBP A;  4I0B A;  2QVS B;  3CL1 A;  1UPI A;  2A5Z A;  4PLM A;  1AX1 A;  4EN0 A;  1OXC A;  1Q8O A;  4QX0 A;  2XJR A;  3X29 B;  3ZXF A;  2GNT A;  1R08 1;  4TN7 A;  4CEW C;  1X82 A;  2VUC A;  3DYP A;  4KBB A;  2JKB A;  1VRB A;  3L2Y A;  1FV3 A;  1SAC A;  3NV2 A;  1PVC 1;  1CAW B;  2RS5 1;  1FMD 2;  2VUJ A;  3RZJ A;  3IKW A;  5CFD A;  2GNM A;  1ZA4 A;  2RJ2 A;  1ZX5 A;  1R09 2;  4OI0 A;  2W87 A;  2ZGL A;  3V0A A;  2VR4 A;  2AEY A;  2QCS B;  4Z2A A;  4URA A;  4LBQ A;  1J3R A;  5K9Y A;  4BIF A;  3RWN A;  4NHL A;  1SLC A;  1PMI A;  1PGL 2;  2WBK A;  3HN3 A;  2ZGP A;  3PJQ A;  1O59 A;  1W2U A;  2DU0 A;  4QX7 A;  1WLC A;  2XH6 A;  4XCB A;  4UAP A;  4IV3 B;  1ULD A;  2RDR A;  1J58 A;  5CEH A;  1SCR A;  4N7I A;  1O7F A;  3CJI B;  2BUK A;  2H6B A;  4GWM A;  2ZX3 A;  1RB8 G;  3ZMO A;  5F5C A;  4Z82 A;  1F8V A;  5FWE A;  5A6Y A;  2Q4S A;  4PT6 A;  3GNE A;  1NCR C;  3ZFE A;  1Q8Q A;  2H0V A;  1NQD A;  5IVJ A;  1GIC A;  3OJB A;  3B9C A;  4GH4 C;  2FDK A;  4LO4 B;  5FPV A;  3AZW A;  4QKF A;  4IE7 A;  4LOT A;  3N3H A;  4XXA A;  5BV6 A;  1ZYB A;  4K20 A;  3D4K A;  5C3P A;  4YW2 A;  2P4E A;  4I09 A;  1UX6 A;  3DL3 A;  1BMV 1;  1W3X A;  1H1A A;  2ZEX A;  1OT5 A;  2ZHM A;  4XIK A;  2J1E A;  2JIG A;  3FMG A;  5A80 A;  2GDF A;  3POJ A;  4FXG B;  3OOX A;  1VIW B;  3NQH A;  2PHU A;  4XZP A;  1LHU A;  3AMQ A;  3NNF A;  3UGH A;  2ES3 A;  2ZAA A;  1BBT 2;  2R7E B;  1XE0 A;  1W6P A;  5K7P A;  2Y64 A;  5FZ9 A;  1MQT A;  2C0Z A;  4BK5 A;  3AMM A;  2VUL A;  5LK7 B;  3EO6 A;  2Q1Z B;  3HD8 B;  5LBC A;  4CDW C;  2D7F A;  5LBB A;  1W9S A;  5JR2 A;  2TBV A;  2BW8 A;  3UYJ A;  2B5H A;  2BU9 A;  2YC0 A;  2R0H A;  3NAP C;  4G9S B;  1C8M 3;  4PQ9 A;  4QGM A;  3TAY A;  1HQL A;  2VTF A;  3QBQ A;  1M4W A;  2YV8 A;  4KG0 A;  2HYK A;  2WZR 2;  3BB6 A;  4MVT A;  3POE A;  5FLJ A;  4DUW A;  3NV3 A;  5A1A A;  3V0A B;  1RUF 1;  3U1X A;  3RZK A;  3WD5 A;  2VCA A;  3U10 A;  1XRU A;  1JYV A;  2J1R A;  4S2D A;  1UX7 A;  1W6N A;  4RR3 B;  2VCM A;  4A2U A;  2FCT A;  4LO7 A;  3N7M A;  1E5I A;  1U5I A;  2A3W A;  2CGN A;  1LED A;  3E5Q A;  2ID4 A;  2RDS A;  3GHM A;  4ZY9 A;  2DCY A;  3VBS C;  3ZXK A;  3E6D A;  5BPX A;  2NLR A;  4IDZ A;  3SCH A;  4AAX A;  4BQ2 A;  5ABJ A;  1YJK A;  4JDO A;  2JG9 C;  1EV1 1;  2XLG A;  3P6B A;  1AR6 1;  1HRV 3;  1LOA A;  1UY0 A;  2XJT A;  3PLQ A;  1S0G A;  1W8F A;  1UY3 A;  2MEV 2;  3VBH B;  1PVC 3;  3I2D A;  4ASL A;  5EIY B;  2RS5 3;  4Q8L A;  3UJQ A;  2Y6J A;  2QNK A;  4CUB A;  1WCU A;  2Q8D A;  2JE8 A;  4K3U A;  1UZW A;  4V2V A;  1CON A;  1UOF A;  3I8T A;  3KQR A;  5C71 A;  2GC1 A;  1W2O A;  2ZAH A;  1ENQ A;  2GAU A;  5FZO A;  1H8V A;  5FXX A;  3NV4 A;  1BYH A;  4CP1 A;  1B35 C;  4OLL A;  3DPR C;  1RC6 A;  1H1M A;  4R4Z A;  1AYM 1; 
#chains in the Genus database with same CATH homology
 5F39 A;  5A7N A;  4TN7 A;  5FY7 A;  3N9L A;  5FYU A;  5FY5 A;  5A3T A;  3NJY A;  5FZ6 A;  5FYY A;  1VRB A;  2YBK A;  4DO0 A;  4LIV A;  4D6S A;  4AI9 A;  3RVH A;  4CCK A;  3AVR A;  3N9N A;  5FPB A;  2YU2 A;  3OPT A;  5FP7 A;  3U4S A;  4CSW A;  5FYM A;  4IGQ A;  5A7Q A;  5FY0 A;  4D6Q A;  4EYU A;  4URA A;  4LIU A;  5FZD A;  4D6R A;  2WWJ A;  3AVS A;  4GAZ A;  3ZLI A;  5ISL A;  3K2O A;  2XXZ A;  3AL6 A;  3PU3 A;  5FV3 A;  5FZ3 A;  5FYT A;  5FPA A;  5FXW A;  3K3O A;  4QX8 A;  4QX7 A;  5F3G A;  5IVE A;  3AL5 A;  5CEH A;  4IGO A;  5FZ4 A;  5FZF A;  2GP3 A;  3ZPO A;  5E6H A;  5F5C A;  2YBP A;  5FXZ A;  5FWE A;  4CCO A;  4GD4 A;  2Q8C A;  2OT7 A;  5IVF A;  3N9M A;  4XDP A;  2P5B A;  5F32 A;  5IVJ A;  3PUQ A;  3PUA A;  4CCM A;  3KV4 A;  4LIT A;  2PXJ A;  3KV5 A;  4EZ4 A;  4V2W A;  4GJZ A;  5FZH A;  5FPV A;  5FYB A;  5FWJ A;  5FP4 A;  5FZB A;  2OX0 A;  4BXF A;  5A3W A;  4QWN A;  2VD7 A;  5FZ7 A;  4C8D A;  3KVA A;  4AAP A;  5A7P A;  5F3C A;  4QXH A;  2XML A;  5ANQ A;  5A80 A;  4UF0 B;  5LY1 A;  4NUB A;  5FY1 A;  5FZM A;  3U78 A;  5FY9 A;  2W2I A;  5FYS A;  4QU1 A;  3OPW A;  4QXC A;  3N9Q A;  5LY2 A;  5FYZ A;  3LDB A;  5FY4 A;  4LXL A;  5FUN A;  4UF0 A;  3KV9 A;  5FZ9 A;  5IVY A;  2WWU A;  4E4H A;  5F2S A;  5FZG A;  5A1L A;  2OQ7 A;  5IWF A;  5A3N A;  4XDO A;  3N9O A;  5A3P A;  3LD8 A;  3PDQ A;  3PUR A;  5FBJ A;  2Q8E A;  2YU1 A;  4DIQ A;  5FZ0 A;  3PTR B;  2YBS A;  5F5I A;  5FYV A;  5FZO B;  5A7O A;  5F3I A;  5FZA A;  3DXT A;  3UYJ A;  4HOO A;  2OS2 A;  5FJK A;  5FZC A;  4CCJ A;  5FY8 A;  2OQ6 A;  5FP9 A;  2GP5 A;  2XUE A;  5KR7 A;  5FZ1 A;  5F3E A;  5F37 A;  5A7W B;  3K3N A;  5FYH A;  5FP8 A;  5IVV A;  5K4L A;  5FUP A;  5A7S A;  5LWB A;  5F5A A;  5FZK A;  5F2W A;  4ASK A;  5FYC A;  5FP3 A;  2XDV A;  5A7W A;  5FZ8 A;  4CCN A;  5A1F A;  4HON A;  4EZH A;  5FYI A;  4Y3O A;  2YPD A;  4Y4R A;  4IGP A;  5FZL A;  4Y33 A;  4BU2 A;  3KVB A;  4QXB A;  5IVC A;  4GJY A;  5IVB A;  3PU8 A;  2Q8D A;  4BIS A;  5FXV A;  5FPL A;  4V2V A;  5FPU A;  3N9P A;  4CUG A;  5FZI A;  5FXX A;  3PUS A;  5FZO A;  5FZE A;  3KV6 A;  4CCL A;  5IW0 A;  5LW9 A;  5FJH A;  3DXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...