4LO7A

Ha70(d3)-ha17-ha33
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
247
structure length
228
Chain Sequence
ENIQEINTAISDNYTYNIPGIVNNNPFYILFTVNTTGIYKINAQNNLPSLKIYEAAINYITGFDSPNAKSYLVVLLNKDKNYYIRVPQTSSNIENQIQFKREEGDLRNLMNSSVNIIDNLNSTGAHYYTRQSPDVHDYISYEFTIPGNFNNKDTSNIRLYTSYNQGIGTLFRVTETIDGYNLINIQQNLHLLNNTNSIRLLNGAIYILKVEVTELNNYNIRLHIDITN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Bimodular Botulinum Neurotoxin Complex Provides Insights into Its Oral Toxicity.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Protein transport
molecule keywords HA-70
total genus 46
structure length 228
sequence length 247
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17993 HA70_C Haemagglutinin 70 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1090 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lo7A02
4QD2A 4LO5B 2ZOEB 4EN9B 4EN7B 4EN6B 4LO8A 4LO4B 3WINE 4LO7A 4LO6B 4EN8B 2ZS6B
chains in the Genus database with same CATH superfamily
4MH0E 4OI2A 2WJSA 3O12A 1DQ4A 1HB4A 3PUIA 4FOWA 5T54A 5FWJA 3O1OA 5A7QA 1RHI1 2ET1A 1FNYA 3F95A 1IZ3A 2PAEA 3J7NA 4XHBA 5GZEA 3SLIA 1SLIA 1APNA 1MR5A 1SPPB 2YBSA 1UN1A 3M3IA 3RJRA 3AZZA 4CDUA 4I30A 3HQUA 4PJYA 4CP1A 1NA1C 1NCRB 2WZR3 3VD4A 2BBVA 1O3RA 3WW3A 1KDMA 4N43A 5L9VA 5IVVA 1QEXA 3JBG1 3IM0A 5EHDA 4K20A 2VNOA 2QZ3A 5FZFA 1VMFA 1LENA 1L7QA 2DVDA 2VOKA 1YUDA 1ASJ3 2DURA 2P1BA 5AC92 5BY5A 3JU9A 4MGKE 2Q1FA 2QQIA 3ACLA 2EA7A 1PZ9A 1HIXA 2W94A 5FCCA 1GFF2 5GZFA 2PLV1 3USUB 2G4IA 3OB8A 4XF4A 2JD4A 2WZ8A 2VOVA 3FHIB 3RSJA 2XJVA 3LFMA 5C3OA 4QKFA 2VUCA 2XL9A 4B3NA 4YZ4A 4E8CA 1RL3A 1MZ5A 2Q8CA 1ZBE3 1O3SA 4QX7A 2OKXA 2WNUB 3ZDSA 4BIFA 3IDCB 4MZUA 2QZ2A 2VJXA 4PLMA 4B1MA 3WP4A 2ZGPA 3GDBA 2VCAA 2RHPA 4IEPA 5C70A 1PZ7A 2JDYA 1KQRA 1OH3A 4AI9A 1LECA 1COV3 1V70A 1GQHA 4AAPA 5A6XA 2JIJA 1VBE3 2GH8A 4JVAA 1URXA 1H2KA 1YC61 1G6NA 3GJAA 4N53B 3TOJA 1FT9A 2VW0A 1QJZA 1AYN3 3V0BB 2WNVB 4Z82A 4CDWC 3FBMA 2FHRA 3OPWA 4E4HA 4YFWA 3POYA 1C1LA 1S0DA 2EF6A 2JICA 4WM7A 1JMUB 3A4UA 1JOPA 2L9LA 3LPGA 4JTOA 4O9EA 1SLBA 1BZWA 4FFFA 4XF0A 2ZX4A 1GU3A 3ME2A 2E53A 4QXHA 4Y4RA 5D8AB 5DG1A 5GZDA 2RJ2A 5FMOL 2RS51 1ODMA 3RZMA 5AFBA 1F35A 3OEBA 3NNGA 4D7YA 4GH4A 4XABA 1CIYA 3H50A 2OYZA 4QQOA 3WNOA 3V0AA 4E8DA 2W1SA 1WMFA 5JOWA 1TNRA 5IVJA 4UBHA 2BU9A 1XBFA 5FPVA 1VMHA 1U5YA 2G9FA 2JKBA 3EQEA 1SBFA 1LU1A 4R9BA 4WVWA 3ZFFB 1X8EA 4Q4X3 3WW2A 1JODA 2C0ZA 2IUWA 4RHV1 5L9BA 3T4HB 3HNBM 5FZLA 3UKNA 1M4WA 3ACFA 4OULA 4DZGA 1CAUB 1WMEA 2IZWA 1Q8SA 4NROA 2UU8A 4ZXEA 1H1IA 1OVSA 2IXKA 3KMHA 4WVMA 3T2TA 5L36A 5T50A 1SHWB 4RQPC 3ASIA 4R8HA 5DPNA 4LKEA 4A41A 4CTEA 4ES9A 1JHJA 1A6CA 2A73B 1IOAA 4XCBA 3ZLIA 2WNEA 1AL21 3AX4A 4RN5A 2R062 1FV2A 5CAZA 4P08A 3KS7A 3J7MA 1YQ5A 4IEVA 4LXLA 1AR83 1DQ2A 2IFRA 2PMWB 2YFUA 3AM2A 3FZ3A 1XQNA 5F9TA 2ARAA 5HI0A 1RUD3 2VY0A 2BZDA 3IZOA 2PLV3 4Q0VA 4CCDA 4FXKB 5DZEA 2NLRA 2ERFA 5D1IA 2YUEA 1YEWA 1UAIA 3RYRA 3WHUA 2OS2A 3NV2A 4Z92B 1F2NA 4HVQA 4M01A 1ZRRA 3PIGA 4YVWB 3H0OA 5J96B 2DVBA 2WO2A 2WO3A 1KFXL 2EAAA 2P6HA 5CA6A 5B4NA 3AZVA 3KV9A 3NRUA 1F4AA 1GV9A 3IMMA 1CGPA 4JGYB 2XQXA 2E7TA 1ULEA 1RUE2 1LOFA 4DO0A 3ALQA 1OD5A 3TNQA 1S0EA 3ZXFA 1NQJA 1ZZBA 2B5HA 4IE6A 3UT0A 1HW5A 4JHZA 1RVF3 3HWJA 2E9QA 5FFOC 4AOCA 1BBT1 1H9WA 3JBG2 2Q30A 2LRPA 2Y6JA 4ZS2A 3KLSA 1AX1A 1W9SA 2D3SA 2ID4A 4NHKA 4XJ9A 1RUC3 4MGYE 1W6MB 1XYPA 3LOBA 1DZRA 4N9IA 1H4HA 2CAUA 3HBKA 4MGSA 3U37A 5BUVA 1O59A 3RYPA 1H9PA 3ETPA 4KGGA 5LBFA 4IV1B 4LHSA 5FQ0A 2UURA 2TNFA 4QDQA 4QT6A 4JGYA 3HT1A 4I2OA 1XNCA 1PK6A 4KG8A 4W50A 1OF4A 2RS53 1MZFA 2BOJA 4QPIB 3OBAA 4JC1A 1DQ1A 4Q4X1 3BUCA 1NZCA 2QQNA 5CNAA 2IVIB 4E4DX 1G9BA 2JJ6A 5FXZA 2ZJCA 2D5FA 2O14A 3CNAA 3OGVA 2P3YA 1OT5A 4RS5B 2JG8B 3LOIA 1ASJ2 1G86A 1IPJA 1R081 4L97A 1OUSA 3DN7A 1CAUA 1TME2 1LCLA 3VD3A 2XHKA 3ZOIA 3WG1A 1YLLA 3THPA 1CJPA 2H0BA 3ILNA 3GZTB 4QU2A 1TME3 5FZCA 1YCIA 4N7UA 3LDKA 1NT0A 4Q8KA 5FUIA 1POV1 1R1A3 5A3LA 4W6XA 3WDVA 2WYFA 1PO21 1VAKA 2PXJA 2C26A 1C1FA 1MEC2 5D21A 2ZEXA 1XRUA 1NXD1 3RG0A 4A42A 4XDQA 2R042 2ILMA 4UI9L 4YPJA 2WT1A 1MQTB 1W04A 2VD7A 3WUDA 2O1QA 5HCBA 2FD8A 5JVVA 4A4AA 4JZRA 4XQDA 4COUA 3PHMA 3ACHA 4NUBA 3GGLA 1MACA 4PDWC 4YW3A 1UZ0A 3WW4A 2ZXQA 3FLRA 5KHKA 3E6CC 4GZ9A 2KD7A 3LDRA 1TZOA 3UL2A 5LB6A 1HJFA 1PO23 2XMLA 4QXCA 3SHRA 3VBRB 5KXCA 4FTEA 1NA1A 2ENRA 2XJTA 2WWJA 4JQRA 3TWIA 3IBMA 1CAWB 1D2QA 1S4CA 4XBNA 5FZHA 2IC1A 4K21A 4S2FA 2YMZA 1ULPA 4AEJA 1QXRA 1IPSA 5HV4A 2R071 5FP4A 2QUOA 3WEZA 3W59A 3DV8A 3M7AA 5LRSA 4QX1A 4FTSA 4OI1A 5JSOA 1ZRIA 1DGWA 3WP6A 5JDBA 5G04L 3USUA 2WDBA 3JCIA 1XYNA 4L2NA 4LO6B 2CTVA 4JGZB 5EIYB 4OUSA 2ETEA 1HX6A 4GULA 4O7XA 1ALYA 1Z7S2 1UYXA 2QVSB 1BBT3 1YFYA 3ZFEB 5J09A 4YW1A 2RR13 1LHNA 2ZZQA 4COZA 3RFRA 3V65A 4XZPA 2JXAA 2HJIA 1DYOA 3M3QA 2ZAHA 4FPOB 4LHNA 3EO6A 2J1UA 4KG0A 4FBFA 1R64A 1ZBA3 3NV1A 4P9XA 4BXSV 5E89A 3DCQA 4GB31 1W8UA 4JGZC 5DUVA 1XNKA 2JECA 1QKQA 3WNNA 5ABJC 3I3DA 1AR92 5FJKA 5L19A 3ZFEC 1RUF1 1VB4A 2VTXJ 4CXWA 1UMIA 1RITA 1RYYA 1Y9QA 4M00A 3WDXA 4ZZ5A 2UY8A 4QGMA 4HETA 1NXMA 3RVHA 4Q8LA 1U12A 2VTXA 5F39A 1PGL1 3J7LA 5FDBA 1W2AX 3LEGA 5A6ZA 4LMFA 3HT2A 4PIZA 3A0NA 3GZEA 2Y64A 3BU0A 4HSLA 4YARA 3U10A 1W99A 2W95A 1DZQA 1KFUL 4P9WA 3AP6A 1NUKA 1TG7A 1SLTA 1UZVA 2GNMA 2R1DA 3FL7A 2P3IA 3LIGA 1BXHA 5F2SA 5A7WB 4AI3A 4P02B 4UFMA 1CJDA 1PMJX 2D6PA 4ZU4A 3UKTA 4BQ2A 3RI8A 2I45A 1DDLA 3DXUA 2XKOA 1OPOA 3AYCA 5FREA 4AI8A 3H9AA 4LBQB 5F8PA 5IAVA 3NV3A 1WMXA 4AFAA 2ZPXA 2A6ZA 3P5BA 1UMHA 5A1AA 5KR7A 3I3MA 1AVBA 1YNAA 1WBFA 2ZGKA 3J4UH 4M3CB 4YNIA 2PA7A 2IWGB 3FJSA 3POWA 3U4SA 2ARBA 4CDUB 3R05A 1RJ7A 1U0AA 3FBYA 1NCQC 1W8OA 4RQPB 1LODA 3EJKA 1UO9A 1H0BA 2EIDA 2W2IA 3CO2A 5LRRA 5JSPA 3ZX7A 3MLKA 4EWAA 1VP6A 3ECQA 2HYKA 4FPLA 1AR72 4GH4C 4X6RB 5CKQA 5CFCC 1YFUA 4TZDA 1GZTA 5LBEA 5D8AA 4B7KA 4DY3A 1SMVA 2A3YA 2Y0IA 3JQWA 3OTFA 4FPKA 3VD5A 4D3WA 5J37A 2X5IB 3ZXEA 1N3OA 2ZBJA 5KXEA 2W47A 2SBAA 4EN8B 3TYJA 1R082 1BK1A 4MSVA 2RR11 2D6NA 1J1LA 2WT2A 5JXIA 3LSEA 1W28A 4ZKTB 4AG4A 1U5IA 5D2AA 3OY8B 2XG3A 1BEV2 5SV8A 4CUBA 2D98A 3VKLA 1ENXA 1C4RA 4LK7A 1R1A1 2BUKA 1ZBA1 5CVRA 3U11A 3JB8A 3D8CA 2PQQA 3N9NA 3WF3A 4FFGA 4GB33 4R4ZA 5FUNA 5CG9A 1UOBA 4PF1A 3ETQA 4QXBA 3UJOA 3KQ4B 3T08A 4OMCA 1UPIA 1MS5A 3LSDA 5C4WC 2V4VA 1AJOA 4RHV3 2HEYF 2D3RA 3D82A 3OG2A 1RIRA 4L9BA 2B9UA 1N1SA 2VL4A 3PL0A 1KJRA 4V2WA 3KT1A 5FP7A 2BTVC 2QE3A 1ZX5A 1PK6B 4D94A 4AWDA 4META 3MIDA 3DYMA 2W91A 2P3JA 4KNCA 4DXSA 3B5LB 2VGDA 2V4AA 3CJIA 3KHBA 5F5QA 3G7DA 1CQ9A 5A70A 2JG8A 3KZ4C 2R072 5J7MA 4CUCA 2WFF1 4TSVA 1F5FA 4BK4A 2HWF2 4OVEA 1GP5A 1C3HA 3AYEA 3UK9A 4AQTA 3WLUA 4FVVA 1IG3A 3LB9A 4CDWB 4C1WA 1GOGA 2PELA 2RJKA 2FDKA 3KD4A 3NNFA 3PVEA 5T52A 1GP4A 4NPLA 2XJQA 1SCSA 2JG9C 4JKLA 2VVEA 5KC5A 2WZR1 4NIDA 2YPJA 4BQXA 2JKXA 4LHKA 1W2UA 1J58A 2A6XA 1E57A 5FBZA 1ZA4A 5JIAA 5FOJB 2XLGA 5FYCA 5FJHA 4AFBA 4FPEA 3VZOA 5I8SA 2UWAA 4RYDA 2GMEA 2VBBA 1ZBE1 1O8PA 5FPBA 4FPFA 4CCNA 4AR2A 5IK4A 2A5ZA 3ZIXA 4ISRA 1WKYA 5FY5A 5A3WA 4RGGA 1REDA 5K0UC 1GWMA 3ZSKA 1XU1A 2VZTA 5CZKA 3CLPA 1A3KA 2Q4SA 2Z69A 4RFRB 2HLEA 5EP9A 3ZR6A 2PHLA 1RUC1 1DF0A 3NAPA 5FY0A 4AVVA 3QH6A 5LA9A 1RUJ3 3N9MA 4NHMA 3ZR5A 2VNRA 3N3HA 4ZU5A 3G6JB 4URTA 1V9U1 1GWKA 2R1BA 2O8QA 1AR63 4QDRA 5FMBA 2LUWA 5ABJA 2BNMA 2JWPA 1U5ZA 1W6PA 3E6DA 4N8MA 4IETA 5FY7A 1JZ3A 2WZR2 5K0UB 3CIHA 1JYCA 1RUH1 2RM22 1W39A 2W0XA 3AKTA 4Q1PA 1ZZ9A 4D6RA 1LGCA 1IHMA 4HN0A 1PX3A 5KHJA 1W0PA 1UU5A 1CX1A 3RNSA 3KHCA 3MLLA 4R9CA 1WCKA 5C9AB 4E4ZA 5L73A 5LATA 5K7PA 1OLMA 2PHFA 1HXS2 1CAXB 2W08A 4QQLA 2ZEZA 3OBRA 3BCWA 1E5RA 4I0AA 4XJUA 1MZ6A 4Y4YA 3ZFFC 1VRH2 1UYZA 5JIUA 4AW7A 1XE0A 4HKOA 1DQ5A 1WW6A 4ITCA 1BJQA 4XQ4A 3LA3A 1PIV1 2A71A 4L0PA 3N4MA 2B8MA 2LM3A 4LULA 5E1RA 2XR4A 4BA6A 5BNPB 5FZKA 3HEIA 4AHYA 3I7DA 2ZHMA 3BPSA 2Y6LA 3K48A 4IDZA 4BZ4A 4WBBA 3OGSA 3VBOB 1ND2C 4FQ4A 5IT6A 1QIQA 3R4SA 4NR1A 1UU4A 3VDBA 4RS5A 3VUOA 4NWVA 3VKMA 4V1PA 1BMV2 3S5AA 3O1PA 3LA7A 3O1UA 4CDQC 1OA3A 4CCEA 4Z1VA 4XFCA 5BNOA 3E5UA 2EIGA 2XGXA 5I0TA 4K3UA 4PDWA 4TN7A 3IMNA 3ZXLA 3PTRB 1AL23 1PZ8A 4WM8B 2NYYA 1QH7A 4BIOA 1O5UA 1C8M1 3AKQA 3Q9OA 3RZZA 3I2IA 3VD7A 2F6BA 1UD1A 2H6CA 2YDEA 4RSUA 3MW3A 1JZ5A 1J59A 3T2PA 1HV0A 5LK7B 4Y22A 3VBHC 2DBIA 2OW4A 4FTBA 5JSRA 5DZFA 1MS3A 5F5IA 4ASLA 2GC3A 3AZYA 1TQ5A 3O1RA 2G9GA 1OQEA 2VE1A 2Y6KA 3MUZ1 3O14A 3ZKYA 4UF0A 2UWBA 1GNZA 1WLTA 3U4XA 3ES4A 2H6BA 2GSYA 1F31A 5JMCA 2WNUA 1AX2A 2XB6C 4AK3A 5FPLA 3TEWA 1ZRCA 5JZGC 1AR61 2BVBA 5F2WA 5CBLA 3HOBA 2Q8DA 4Q5OA 1EAH1 1E5SA 3WQ0A 1EP0A 1AHSA 3CZJA 4YW5A 1RUJ1 2FBEA 3THDA 3DECA 4NWWA 1W8TA 4NE9A 3IB3A 1VLNA 4QPYA 1OA4A 1I5ZA 1VBD1 3AJYA 4JKMA 4BH9A 1GQPA 2J1AA 1RUH3 2HWF3 4QM9A 2X05A 1D0GA 5JZGB 4AYUA 3AMHA 1UYYA 2X5IC 4QPIC 4S2GA 2VG9A 5IYYA 2HKXA 4JAAA 3CBNA 1NCRA 4LLOA 4WZCA 2WL1A 1JI6A 1OKOA 5ANNA 3CDZB 1X82A 4OUMA 2HWC2 1YFWA 3M8LA 4DEQA 3DUIA 5DN2A 5CKNA 1QOTA 1HRI1 4WVVA 3H7JA 2VZSA 2WYSA 1CN1A 2Z2SB 4OHWA 2A75A 1POQA 5FXVA 3WG4A 4DOUA 4GB32 1YQ6A 2ORZA 2QFEA 2VMDA 1VE0A 1YFXA 2WAOA 1SEFA 4JDMA 4F7ZA 5LY1A 4AQSA 2TBVA 3FWEA 3WT3A 3U0ZA 4BDVB 2JEMA 1RUG3 4GKYA 2QQUA 4R52A 2J1SA 3GHMA 2R16A 5FLJA 3W9AA 1QJX1 2QKDA 3N35A 3A0KA 3DKWA 3HD8B 4AL9A 3I59A 1Z7S1 3MW2A 1CONA 1O4TA 1UPSA 1NY72 2AEZA 3ATGA 3AZWA 3C7EA 3JBG3 3VBSC 1G9AA 2WFF3 1SFYA 2OZ6A 3KCCA 4MXWA 1MVEA 5GZGA 1DLLA 2ET7A 2SLIA 2HH9A 1ACCA 1ENQA 2GH2A 4AFMA 3K3NA 5AC91 5JLVA 2CWMA 3NMBA 2A70A 2V73A 4IEZA 1CZVA 1WMDA 2J22A 4RD7A 3MIEA 2ZGOA 5FZOB 3CMGA 1QGLA 5JXGA 4C91A 3V0BA 3V64A 2WNVA 4LKDA 2UY9A 3VKFC 5E6HA 2YV8A 4XFHA 3VBSB 1CESA 1J3PA 3C2UA 1ND3C 1LNSA 4MHUA 1NLQA 2WNUC 5AFEA 1D4VB 4EN0A 2JDKA 1W05A 3J8F3 5DXDA 4YVSB 1V6LA 3T0DA 3GXUA 1JBCA 4XUNA 1A8MA 2VBDA 2R041 3J8F2 4PBOA 3WF2A 5FY4A 5FYUA 4XBLA 5KHIA 3VZLA 1GYKA 4H7MA 2B46X 2W68A 3I4IA 2PN5A 4HBNA 1FMD2 3C7HA 1FPN1 1KJLA 3GCWA 3AL6A 4G9SB 4HKWA 1S0CA 3AK0A 5EXOA 2ZABA 2YFZA 2WSVA 1JOJA 5IWFA 3AP9A 2Z79A 2D97A 1V00A 2RS11 2OIIA 1RGSA 2CGNA 1TME1 4XVHA 2R043 1MS8A 3W58A 3AMQA 3SH5A 4Z8BA 1RUF3 2XWJB 2VM9A 2Y38A 3CHXA 2PHDA 1BKZA 1I1EA 2OXBA 4EQVA 4N43C 5C6CA 4XOGA 4P9LA 5DDJ3 2JDZA 1HN0A 1EV12 2DUQA 2WNOA 4Y1ZA 4MHRA 2WINB 1ENSA 4NIGA 1R093 2HWD2 4OMDA 4QKNA 1PO13 4J1XA 1LOBA 1HLCA 3J26N 4BQWA 3DPRB 2AUYA 1K42A 1IS6A 2GC2A 4OI0A 4XZUG 3POSA 4EN9B 4CVUA 2VVFA 1GZCA 1W0OA 4JDNA 3O0VA 1LB2A 5CADA 4NPRA 2C4XA 4E2SA 1POV0 4EWEA 3KCXA 1GICA 2J1TA 3S7EA 1G9FA 5IK7A 3K4AA 4N53C 2AC1A 1FNZA 2HWD1 1UXZA 4QPGB 5IFTA 1Z7S3 3ZSLA 4LBLA 1XNBA 2WS92 4MGIE 4MGZE 3LEMA 4QWNA 1L7LA 4ZXKA 1SG3A 3MUY1 3DPRC 3HNYM 4BE3A 4CU7A 5FKCA 2AGSA 4KQ7A 1XJAA 2JENA 5EPAA 3RZHA 4JHTA 3M3EA 1PMIA 3L2HA 3FMGA 4J1WA 4XIKA 4AHWA 2ZX0A 3NJYA 5FMDA 1JU3A 5J1XA 1UKGA 2DUPA 5ERLA 4CDUC 1ND2B 2BV4A 1UOJA 3WZ1A 4PF5A 4JQTA 4A6OA 4WVMB 4BHPA 5FLIA 1LKNA 1US2A 1O4ZA 4D6SA 3N36A 5A33B 1JZ8A 2W46A 2JE7A 3AZXA 3J8F1 4TXWA 4XDPA 3ZKUA 1IG0A 3B3QE 2H0VA 1BHGA 3SH3A 5KHHA 4B7EA 1O3QA 3CJXA 1W0NA 5K0UA 1AYM3 2A7AA 3N9PA 2ZA9A 4QB1A 1FPN3 2VCCA 1DIWA 3I97A 3O1MA 4UT5A 5HXMA 3S7IA 1OH4A 1HRI3 5KBFA 2VMEA 1N3QA 1W9YA 3BODA 3PVBB 4E9KA 3JQXA 4DUXA 2DFBA 3P3PA 5DAQA 1X50A 2YHJA 4I3GA 1EAH3 3EXUA 3O0XA 1GQGA 1V6IA 5K4LA 4EWDA 4DB5A 3N9OA 4C8DA 3VN4A 3QACA 5FZIA 4YW6A 2G19A 3D0SA 4PIXA 5A33A 2PHRA 4IEQA 3RWKX 1YIPA 1OQDA 3KV4A 4Q4V1 1W6QA 2D43A 3BU7A 1VRH1 3SCFA 5C4WB 5F5CA 4G3YC 1SLCA 4DXTA 4PCRA 2CDOA 4FCAA 4DMIA 4CYDA 3PURA 5C33A 1UY1A 5EFUA 4DQAA 3E1F1 3GBGA 2R6QA 2HBTA 2JG8C 3MFAA 4KWLA 3ORJA 4PQ9A 2QNKA 3NO8A 1PO11 1PNFA 3RDIA 3THTA 2VMFA 2QQOA 1RUI2 3N7KA 5JI7A 3SCHA 1DYPA 5B2GB 1RUH2 1CZTA 3AP4A 5JOYA 1JZ2A 1T6BX 2E26A 5GLZA 4FAHA 1LJ7A 4EE2A 1H8TC 2A6VA 3O5SA 4ASKA 1XE8A 4MVTA 1YO8A 1DGRN 1XNTA 2YC4A 1NX9A 2GZWA 3DF0A 4FI9A 4TLFA 4OFGA 1HRV3 4LITA 2GNDA 2Z42A 5ACA1 3B9IA 2ZGSA 1HQWA 5H9QA 2BWAA 1J84A 2R32A 3UETA 4Y5Z0 3KCYA 4AI1A 3VBUB 4B8EA 5C9AA 4I01A 4YW4A 4AI0A 2ORXA 3IIAA 4CPBD 3QD6A 1W8FA 4XBQA 2VOTA 3GF6A 1YHFA 3RYKA 4LBKA 4LPLA 4AQ2A 2W92A 3KVBA 3MBWA 2ZKLA 4AE2A 3LA2A 5IATA 1SFNA 5LBBA 1ULDA 3WINE 1KITA 1VBD2 2JDPA 4CP9B 2R0HA 4LBQA 2CL2A 3H3UA 4XHXA 3W20A 3JD72 2VZVA 2YU2A 3VBFA 1C8NA 2JDNA 1OC1A 3WX5A 2ZHLA 3W5NA 1W8ZA 1W03A 2I74A 3AVRA 2OVUA 2ZACA 3BPZA 1RXGA 2QDNA 3OUIA 3Q8AA 2OPKA 4XTPA 3ST7A 3KT7A 3RI9A 2TEPA 4LBNA 5HCFA 5D8AC 3LWCA 4FPJA 1WA6X 5IK5A 3VDAA 1RUI1 1ZNPA 4UBGA 1F8VA 2B9VA 4XXPA 4CCLA 2R30A 4NAMA 5L7OB 1H4GA 3QLQA 4XFFA 3VBSA 5A7SA 2JIGA 5LY2A 5FPXA 3RGBA 3H8OA 4URAA 4LOSA 1EYBA 3UGGA 3GM8A 1GLHA 2GC1A 1QOOA 1LGNA 2WBKA 2Y6GA 4AF9A 2E7QA 1MQTC 1REFA 1LHOA 4Q4V3 3J9SA 3RQ0A 4GWMA 2X8KA 3GYDA 4Z2AA 4FP3A 5IVFA 4O65A 4GJZA 1HB1A 2Z4FA 3D6EA 4JDOA 5EYYA 4OZXA 3VDDC 1B35A 3NJVA 4D0QA 1XE7A 3LQCA 4ORFA 3VV1A 3KQRA 1GSLA 3OEAA 4P14A 3AYAA 4RA0A 4CCJA 4DFSA 5CYYA 5LW9A 1Q8VA 3ZFGA 5L7OC 5LA1A 1JYWA 1EUTA 3CF6E 4AFCA 5F6KA 4XF1A 2IVJA 1VRH3 4GMP1 3CEWA 4FOVA 4PQQA 3ZXJA 4HANA 2EXJA 4LLFA 1PM4A 4P5HA 3VBHB 4UFLA 3SKVA 2K2SA 1ZM1A 3H1MA 5C8CC 4AEMA 2PLV2 3MV11 5FZ8A 4JX0A 4P9IA 5T5OA 4NIHA 2BNOA 5JWPA 1PIV2 3A22A 3AKSA 2W87A 1UIKA 4XF3A 1AL22 2OX0A 3KGLA 3FLTA 3T1LA 4HOOA 1H30A 3OOXA 4XMIA 3UGFA 3M4FA 3NJZA 2E31A 4P00B 1MVQA 1D4M1 2VZRA 3B93A 4H2AA 1J1TA 4QGLA 2OUJA 5JZGA 4W4ZA 1ZZ6A 1JZ4A 1QQP2 3M2MA 1W8WA 1N1YA 1DQ6A 2YPDA 3CJIB 4IEWA 3T30A 1DCSA 2OUHA 1EUUA 3FX3A 2XOMA 2RVAA 2WQ8A 2WS91 2C1FA 1OI6A 1S55A 4UFKA 1XSQA 1QJU2 2BGOA 1TEIA 1VBA2 3QCWA 3SEEA 2FQPA 5DUUA 4HK8A 4N7IA 4M3CF 4QPGC 3WV6A 2HWB2 2VBPA 4AEDC 3LDBA 1Y4WA 4QX3A 1OQ1A 2GMMA 3VLBB 1UX6A 2CSGA 2W52A 1DQ0A 5B4XA 1JYTA 2ZGRA 1RUC2 5EJ1B 5CEHA 1V9U3 4BCUA 3QH7A 1QWRA 3O1SA 2V5YA 3LFIA 1DGRA 2RS52 1H2LA 1O8SA 5CKMA 1O4YA 2VQ0A 4LO5B 3IWZA 2ZAAA 2RJLA 2ZMLA 1RTVA 4MXWB 4YVWA 3H8XA 4CU9A 1Q43A 3AB0A 3PVNA 4LO4B 2XVKA 5JPNB 4KWJA 2R7EB 1QXJA 5GLUA 3ZYFA 1JZ7A 1X8MA 2C9AA 1W8NA 3WG2A 3JD71 4CSWA 2VZQA 1W6NA 4NO4A 4XUPA 4IE7A 4I02A 4CZSA 1AYM2 5I0SA 3AFGA 3WF1A 5A7PA 4XQWA 3MLJA 4QX8A 4LUMA 1W6PB 4L99A 3H42B 2X29A 3MF6A 4A6SA 3D3AA 2I2SA 3ZSMA 2YROA 1RMU2 1Y9MA 4MG2A 4CP2A 2YBPA 2Y34A 3INAA 1ZZCA 1BEV3 1YYNA 2FCTA 1RVF2 4MV2A 5ACA2 4MGTA 1K5MB 3J7HA 4I0WB 3NNLA 2AREA 2FZ1A 2QQLA 2XHNA 1IQAA 5CFCB 2X53S 4CU8A 5IFPA 1Z78A 3BB6A 1GMMA 5FRAA 4GWIA 4ET7A 1A78A 2YGMA 5FR3A 5IVEA 1WW7A 4Q0PA 2WFPA 1IS5A 4CXYA 1PNGA 2RG4A 1VPHA 1S0BA 1AXKA 1DLCA 2OZJA 1GBGA 3RWNA 1XSRA 1WCQA 2Q1ZB 3O7OA 1VJ2A 1G9CA 1UY0A 2VMGA 4Y1VA 2RS32 1WCDJ 1Y3TA 1L7RA 1RUI3 1X9TA 5AC93 3AL5A 1Q56A 2XVGA 2WN2A 1NE6A 4HXCA 3S0MA 2XJUA 5KXDA 2DVFA 5C3SA 4M0HA 1HQNA 1OVPA 2RDRA 5FPUA 3WDYA 3M70A 4MOAA 3CQOA 4UFJA 4RGAA 4CEYC 4HFSA 5FY1A 1LRHA 5C8CA 3T09A 2VR4A 2WO1A 1UF2C 3UGHA 2CAVA 3MEPA 3VZJA 1MS0A 4QPGA 4KH9A 3ZN4A 1DGLA 3SCGA 2RR12 2W3JA 3IKWA 4A3ZA 1JU4A 5IVYA 4HPKA 2WLQA 4KU8A 2IXCA 3MGUA 2BVVA 2PHXA 3FFZA 1FMD3 1YJLA 2X10A 4HMZA 3WY6A 5JXHA 4Y3OA 2EIEA 4XUQA 1DFQA 4LO7A 2A6YA 4XUTA 5T3NA 3I2GA 4CP9A 4DUWA 3GNEA 5BPXA 1ST8A 4IV1A 1HN1A 1VBD3 2ATFA 2WUHA 5ABJB 3O1TA 4FFIA 5A3NA 2R49A 3E6BA 4DXZA 1H6YA 2DUOA 4XJAA 1LOAA 2VZOA 3GHNA 1QDOA 2G1MA 1AYN2 2VMIA 2NPIA 1KXGA 4I0BA 3T4VA 2ZMKA 1AF9A 4BPZA 1LTEA 1I3HA 1PO22 4Z2WA 3RMYA 3ZYJB 4V2VA 2WSUA 5FK7A 3E97A 3WNMA 2XJRA 3H1WA 1VBB2 4RL7A 4KL1A 4WVZA 1CX4A 1G7YA 2RS12 2ZGUA 3HR9A 5JMOA 2GALA 4COVA 4WV8A 5FY9A 2AENA 3MZHA 4AGRA 4N43B 1T2XA 1K5MA 4COWA 2HWB1 4P9GA 1R091 4KWUA 2ZCWA 5DABA 3WW1A 1VBC1 4Q4X2 1J83A 3ZO0B 2JE9A 5I0UA 1FI2A 2OQ6A 3WNKA 4EN7B 1QDCA 2YB7A 3X29B 4W6YA 1PMHX 3OPZA 4KMQA 5FZ4A 3H8UA 3A21A 4X6QB 2E6VA 3SC7X 3T2OA 2VCMA 3O1VA 2ZGQA 2WS93 5FZEA 4NVPA 1IKQA 1XNDA 3SMHA 1ENRA 1H2NA 2GP3A 2VTFA 4KWKA 5GLTA 3B00A 1QQP1 3GBWA 1JXNA 3HPNA 4YG3A 4ES8A 1Y7BA 2HWB3 2K0GA 2GN7A 3HNMA 3RMXA 2A6WA 4OHXA 3SEPA 5LEKA 3ES1A 3VBOC 3PDQA 4HVRA 5A3MA 3DGTA 1NCQB 1QJY1 1Y9GA 2PFWA 1OLME 1AR93 3TRSB 4Q0QA 1PGW1 2VCBA 3TBDA 1N3PA 3OGJA 4NRQA 4LE3A 1K5JA 2WAAA 4CDQB 2Q1MA 2D6KA 2BW8A 1UWWA 2D93A 4FFHA 4IUGA 4CDXB 1DBNA 1XU2A 2IXHA 4XFAA 5C8CB 4LE4A 3H8RA 2NZ9A 1H8TA 2CV6A 2JDMA 1YJKA 1GZ9A 4P9JA 2XUEA 3ACIA 4KBBA 5FZ3A 3BOWA 4OCTA 1RVF1 4A44A 2OPWA 4K9SA 3T3YA 1LHVA 4INDA 1WD3A 3HN1A 5DAVA 2CHHA 5JOZA 2IXIA 3AP5A 1WCSA 3C7GA 3VBOA 2ZEYA 1CPMA 5FZMA 2VQTA 1FMD1 4A7YA 2ARCA 2CU5A 2V72A 4R9AA 5J98B 4M4PA 5A3OA 4AVAA 1AYM1 1M06G 5F7UA 4HONA 3BVCA 5FO9B 4DUVA 3ILFA 1HRI2 1B35B 4QX5A 3QBQA 1H8TB 2DVGA 3AKPA 1RUE3 1E5HA 3N7LA 1F15A 3NJXA 3VBUA 2P5BA 2HYXA 3KV6A 4AAXA 3SXWA 3PTYA 1RUOA 3RRDA 3KGZA 3POJA 5FAXA 4Y26A 3ZSEA 1U5XA 2Q0AA 4N9HA 1SBEA 1AX0A 2CNAA 5LK5A 2BDRA 2D7FA 3IIIA 1I6XA 1ZVFA 4AEDB 1RINA 2JB4A 4H7LA 4BMBA 5FZAA 1CR7A 2VPVA 1JH5A 1F9KA 4A7ZA 1OOPA 3TAYA 1W2OA 2VOXA 1VALA 4C0BA 3GBFA 5LZ6A 2XVLA 3VD9A 3GZUC 5GM0A 3ACGA 1JYVA 5EYXA 3I8TA 3MICA 3TN91 4D7SA 1OPMA 3OD0A 5JAXA 3UV9A 1UCXA 2YGLA 5L9RA 3KV5A 3WQ1A 2YG0A 2DYCA 4XDOA 3KWVA 3H1YA 3MF9A 1NE4A 1UU6A 4AVSA 4QMAA 3ZFEA 4PLOA 5IK8A 1LHWA 2PQSA 2JG9B 4YZ3A 4IV1C 1QJX2 2WWSA 2HWE2 4XFBA 2W1QA 3KT4A 5F1RA 1HV1A 4XEZA 4GD4A 3PUAA 4FPCA 3DYOA 3OBZA 4I3PA 1WCUA 3K51A 2D6MA 3DPRA 5GJ6A 3N7JA 1CAVB 1PM7A 3PNAA 2GDFA 1XNAA 5JCTA 1RB8G 3MYXA 2VUDA 2BERA 4AEKA 1EY2A 3GZAA 1QJY3 5CIRA 4KU7A 1QOSA 1RMU3 3HMYA 5FY8A 1N1VA 2WIIB 5GLWA 5C3RA 4B29A 1HRV1 4IV3B 5T5LA 5FIXA 5IJRA 4COYA 2XH6A 4S2DA 1HKDA 2VZ1A 5FPAA 1QF3A 3FUOA 4O9GA 4OYUA 3ZDVA 1BVP1 1POV3 1XC6A 4PI2A 1ZA7A 3U75A 4XXAA 1CWPA 2XJSA 2RDNA 1K45A 4JKKA 4B1LA 5A3UA 3NWKA 4AVCA 2WFF2 3PU3A 5M0TA 1ULCA 1RUJ2 4QHBA 5FYZA 1IS4A 1Q8QA 2LTNA 2WZEA 3PJYA 1UOFA 3F2ZA 5A7WA 1WLWA 5BNNB 2AYHA 4EYUA 1LAJA 3VDCA 4GXLA 4IV3C 2HEWF 1O91A 4K8RB 1MS1A 1WLCA 5IUQA 2C6SA 2Q8EA 4QXKA 1MPXA 3HQRA 5E8AA 4BYYA 3NKGA 3RZLA 4NN0A 2NM1A 4B4PA 1WW4A 5C3PA 4A7KA 1FX5A 2WA3A 4WM7B 5FUPA 2Y6FA 4QHZA 4LA3A 1QH6A 2DVAA 4BQ5A 2XLFA 4HLTA 2GNBA 1BMV1 1OD3A 5FMOS 2MEV1 2LW8A 4HN1A 1SFPA 2BPA2 3R0RA 1XYOA 3N9LA 1JN2P 3KF3A 1D2SA 2WA4A 3OYWB 5SV5A 3V56A 4D7TA 4D8MA 5J3UA 3HN3A 1SQ4A 3NQHA 4K40A 4UAPA 4BK5A 3BTYA 1HRV2 3MFCA 2EXHA 2DWRA 3HJRA 2R0FA 3ZMOA 3B9CA 4FP2A 1OMIA 1IQDC 1ZBA2 2ZX3A 4ARYA 3RZGA 3BN6A 4DEVA 2ZGMA 3L2YA 4YVSA 4DNYA 2KA3A 5FZBA 1DGWX 1CIWA 4YWAA 1RJ8A 3WD5A 5BNPC 1LHUA 1O5LA 4Q2FA 1W06A 1PIV3 2J1EA 4LBOA 4QQ2A 1ND3A 3B01A 4HZFA 2WN3A 2YYOA 4YW7A 4DRRA 3KB5A 2DF7A 2EVXA 4S2HA 3IDBB 4CA9A 4PBPA 2YBKA 1EPZA 4PIYA 1V6MA 2WNVC 4K1ZA 4X8NA 4BMEA 1YI7A 1JZ6A 4FPYA 4RR3C 4EZHA 3MIGA 2HWE1 3PUQA 4IERA 1JYXA 3K3OA 4H55A 3RJ2X 5I0RA 1QJEA 4IESA 2P2KA 1OKQA 4WM8C 4DINB 4DPNA 4CUAA 3NL1A 1KS5A 2VOWA 3LD8A 2YC2A 2BNNA 3I2JA 3NNJA 4FOQA 4Q29A 2PAKA 5CB7A 1W6NB 4DIQA 2BOIA 2EIBA 4L8QA 2RM23 4QAWA 5CFDB 5I8TA 1ZRDA 1YQCA 5A3PA 1W2NA 4FPHA 4XILA 5APAA 4Y20B 5C71A 1QJFA 2AACA 2W1WA 4RR3B 3HQXA 4EZ4A 3NKTA 4GWNA 4YW2A 3POFA 4B4QA 1DG6A 5A32A 5I93A 5FXWA 3WDTA 1VBA3 2RM21 2CYFA 2E63A 4E4SA 3IN9A 1BCXA 1VAMA 5FYBA 3AKRA 4OQ9A 1UOGA 4YGCA 4F3JA 2Z5WA 1W6OB 1V9U2 3POBA 1ZRFA 3K77A 3MW4A 4IW3A 3ZXAC 4XURA 3LAGA 4NHYA 3CU7A 3SNMA 1FAYA 1AR82 1K5MC 3VB9A 3ZYRA 2VH9A 5JXJA 5JUVA 2YXSA 3ZPYA 2V09A 5LCWL 1W3VA 1RC6A 4NHXA 4WZFA 1JW6A 4UXAA 4Y1UA 1PVXA 4BQ1A 1P8JA 1C5HA 3MI8A 3PMSA 2XDVA 1GANA 3OYWA 4XETA 5C5UA 4QB2A 1QHDA 4JCKA 5G05L 5DUXA 4GIQA 5EV7A 2B42B 1MZEA 1SACA 2HWF1 4TWTA 4MADA 3KF5A 4MLOA 2DU0A 3ZFGC 5L7OA 4C0HA 1XPWA 2QBXA 1I5PA 3WDUA 3OUJA 3VDDA 5F3IA 1UY4A 1FXZA 1EPWA 4XJZA 4F8AA 4GALA 1WUVA 2P6CA 2XBO2 2BJSA 2VZPA 4CEYB 3VZNA 3UNPA 2FCUA 5EJ3A 5IVBA 1LGBA 3BIWE 3Q8BA 4H14A 4BQ4A 4GMP0 1ZREA 1NLSA 4JRAA 5K9YA 1V6KA 4CP0A 4A3XA 5C8WA 2VNVA 4HKLA 1HB3A 5F5AA 2ADDA 1S2BA 3ZFGB 5DUWA 2GNTA 1Q8OA 2GN3A 3WF0A 3D5OA 4EROA 1WGPA 1VB2A 5FZ7A 3ZXDA 2I07B 5C7GA 4CEWB 2OT7A 2KXLA 3WOGA 2K9ZA 4KI5M 3EMRA 2XXZA 4YG6A 3ZYHA 1RHI3 4OHVA 4RR3A 4U2AA 3TEYA 3OF1A 1W6MA 3AXDA 4GWJA 4EJRA 5FTTC 3BI3A 2VXJA 2ES3A 4IEUA 2Y6HA 3ZYPA 4W8JA 4RS5C 2PHTA 4IGQA 5J48A 3VZMA 5ANQA 5LEJA 2DDUA 3FE5A 2VQUA 4NRPA 4NPMA 4HVOA 4CXXA 4FAGA 2WABA 4ONUA 4YVSC 4YZ2A 2BGPA 2F17A 4FT8A 3E5XA 4Q4Y1 3PJQA 1GZWB 1T6GC 2ZGLA 3ELNA 1ULGA 2TUNA 3GALA 4CRQA 3N9QA 1A8DA 5K8SA 1JOBA 5LA0A 3IDAA 3GCXA 4LEJA 1RXFA 4AVTA 5KXBA 1PGW2 3SISA 1SPPA 3LKJA 3ZYGA 1DZTA 3JD73 4C1XA 3PUHA 1SZBA 1AXZA 1VR3A 3I3QA 3RS6A 2PAMA 1G8WA 3UKVA 2FMDA 4Y1XA 2W5FA 2WR9A 5AVAA 1AJKA 1UIJA 2AH2A 3BGAA 1FOD3 2RS13 4CDQA 3P6BA 4UWDA 2DTWA 1NG0A 5H9PA 1NAEA 1JTZX 2VUJA 1SLAA 4XFGA 2Q8OA 2NP0A 4GAZA 1OSGA 2Y60A 3H7YA 5FZDA 3VBFB 1QNYA 2O8OA 5JOXA 5FXXA 5HV0A 1US3A 1W3XA 4Y33A 2GP5A 2RE9A 4EN6B 2XPJA 2ZZJA 4LA2A 2CY6A 1PGSA 4XW3A 1C57A 3TN93 5KHGA 3IAPA 1QXPA 2UYBA 2WC2A 4MUVA 4YM3A 1LOEA 2VXRA 2DV9A 1UYPA 4L11A 4PI0A 3MDPA 1VRBA 3AMMA 3R6SA 1UZZA 2AEYA 4AVBA 3DKQA 2MNGA 1SDDB 4IGPA 1X7NA 5FZ0A 2G9ZA 1CVNA 2QQMA 2ZMNA 4XCAA 2FDFA 5FYSA 4AEDA 4K6BA 5A80A 4BISA 1X9PA 3OJBA 1BVVA 2RV9A 5A7NA 1RUNA 4HT1T 4K7JA 5F3EA 3EB7A 4FQZA 1D0HA 1V6OA 2B4KA 4OZOA 2LALA 4LT5A 4XFIA 2MHFA 1OFNA 1J3QA 1AZDA 4IV3A 4IXLA 2ADEA 2WQZC 1C8M3 2VMHA 4LO8A 3ZN5A 4LKSA 4QGNA 3USSA 5JI9A 3AJZA 2C9KA 2B7YA 1LULA 4XF9A 1AR73 3APBA 1R1ZA 1COV2 4AXOA 1HQLA 2E7AA 2YC0A 4Q4Y3 3U07A 2DBNA 4ZPIA 1EV13 1GNYA 4MO3M 4YG0A 5CU1A 2CDPA 3S57A 1RUF2 3WVJA 4MXVA 1AR91 2F4LA 1AR81 3CJIC 3PIJA 4LQRA 2ZX2A 4YZ5A 5IVCA 5BXXA 4TTGA 3AFKA 1F5JA 2VECA 2YZ4A 5A7OA 3WCSA 2HEVF 3I2FA 5CFDC 2DCKA 1HXS1 4LJHA 4ATEA 5FZGA 3WXPA 4N53A 2BBAA 3I3BA 4CCOA 3SH4A 2RMU1 3LF7A 5C4WA 4SLIA 5EWSA 1C5IA 3NSTA 2LS6A 3ON7A 4W65A 5AVPA 4E2GA 1S1AA 5HCHA 5DAWA 1IGOA 1IKPA 2DTYA 4LIVA 1B35C 4NJ4A 4MX3A 3DL3A 5FV3A 1ASJ1 1FOD1 1O7FA 5GZCA 3P3NA 4ZONA 4IE0A 4JV4A 3T1MA 2P37A 1KGYA 1CPNA 2BWCA 4LBQD 4YM1A 4H3WA 1B09A 3POIA 1QJU1 2KM2A 3QOPA 4XIOA 2VW2A 5A3TA 1NY71 3A23A 3IPVB 4IE4A 3VHPA 2W39A 2VC9A 3HIFA 3WP3A 2ZHKA 3D0JA 3B94A 5FZOA 3TNPB 2PYTA 4GH4B 1N1TA 4XPVA 3WUCA 4XMAA 3RPQA 5DAXA 2NQYA 5FZ6A 3SITA 2BFUS 4BLIA 4M0NA 1OOPC 4M3CE 3VL8A 1QJX3 4AGVA 2VMCA 3I2DA 5CFCA 5FOBB 2HWE3 4YM2A 3VBRC 2OA2A 5BNNA 1ZBE2 2ARXA 3IAQA 4G4FA 3MIFA 2P3KA 3LEKA 1PX4A 2B45X 1DHKB 2EICA 2J7MA 3ITQA 4LORA 4F83A 2DCZA 1A34A 5CG8A 2P4EA 1AL0G 4YGEA 3VBUC 1GP6A 2VU9A 2BGCA 1JUIA 5FP8A 5BNQA 1XB9A 1W9TA 5HPOA 5ACA3 4DXRA 2C24A 1W2TA 2HBUA 4XE9A 3JUUA 4AQ6A 3URFA 5F3CA 4QKBA 1LU2A 2DCJA 4BWOA 4LIUA 3MPPG 2VULA 4D6QA 3JB4C 2B39A 2VAUA 5FYVA 1YRZA 2E33A 3O0WA 2VQAA 4AFDA 1LOCA 4YM0A 1W6OA 5DQ0A 3VHOA 2FDJA 3FHAA 4NRMA 3OBTA 2BYVE 3PVOA 5IHRA 1QMJA 4BJ0A 4IQPA 5E16A 1AR62 1SCRA 1W9FA 1WLDA 1XOYA 4IEYA 2XJPA 3D4KA 5BV6A 3B02A 1RUE1 1KEXA 2RMU3 5C5TA 4ZHNA 1ZZ8A 3M1HA 1RUG1 2FCVA 4LNVA 1ZZ7A 4C90A 4NOTA 1KS4A 1OFSA 4A45A 2GMPA 2FDHA 1NCQA 5H9RA 4FOYA 3DEMA 2A1XA 1DP0A 4Q0SA 2WQ4A 4NAOA 1H8VA 3S6PA 2NN8A 4JTNA 5I8YA 1VMJA 1ONAA 4BLJA 4D69A 5J36A 1G9DA 3U78A 1ULOA 2GU9A 3UESA 4ZS3A 1V6JA 1ODNA 4UYBA 2EALA 5A32B 3VDDB 5GLVA 1L3JA 5JR2A 5IAXA 4J25A 3PLQA 4UFIA 1BEV1 1RUD1 1N47A 1TNFA 3VKOA 2XKPA 3NW4A 3Q8EA 3OGGA 4QPWA 1H2MA 2E32A 1W8HA 2AZ5A 1J3RA 1NQDA 4XC9A 1NA1B 1NCRC 2VNGA 4QDSA 4YSFA 2IXLA 3WR0A 3OCPA 2MEV2 2CGOA 1S0FA 3NV4A 3VL9A 3IDEA 4IL7A 4FSJA 3WNLA 2MEV3 4UF0B 2Y8KA 1WBLA 3UJQA 3WQBA 1S0IA 5F3GA 3ZMNA 4CEWA 4X8PA 5KC6A 4OQ8A 1AR71 5DZGA 3VHRA 3ZPOA 2AR6A 3LZZA 3AMPA 4M4RA 4FXGB 1JS9A 3OUHA 4AZZA 1BQPA 2HWD3 2DFCA 1VIWB 1VBC3 4XAAA 4ASMB 1H1MA 1LEDA 2XQRA 1NYWA 3DYPA 5DDJ2 1VBB3 2VW1A 3OD4A 4R9DA 3TN92 1SBDA 2FDGA 1WZXA 1YXWA 1TMF3 1HB2A 1PVC1 5H9SA 4YYOA 4Q26A 1YIFA 4UOJA 1WWYA 1MS4A 1QQP3 2WLPA 3AXEA 5EJZB 5BNOB 2W1UA 3KSCA 4CDXA 2ZX1A 2WWUA 1K12A 4DRVA 1ULFA 1DU3D 2JX9A 4L92A 3VBHA 3WNXA 2D6OX 3JZVA 3EHKA 5DDJ1 2X09A 1FATA 5EQUA 4HSJA 1OLQA 2D5HA 4CEYA 4CCMA 4E27A 1NZIA 1O6UA 3T2QA 4U36A 4OLLA 4YGDA 4AGGA 3LEIA 4ZU7A 4Q0UA 4AHXA 4BQ3A 2XWBB 3KM5A 4GKXA 3I3EA 3CKHA 3OPTA 5BNOC 5E88A 2WKKA 1BLZA 1UMZA 2VZUA 3BYWA 3ZIWA 1PGL2 3T0BA 2DCYA 2DU1A 2XL7A 1D4M2 3HVDA 5F32A 3ROUA 3W21A 3WNPA 1JYNA 2VZ3A 2E51A 4Z07A 2QCSB 2R063 1CZSA 2JDHA 4LOTA 5LBCA 3HBZA 1BYHA 3L9JT 4QU1A 1Z0HA 2XONA 3BKZA 2D6LX 5GALA 1REEA 1IPKA 1FV3A 3K75B 2PHWA 4TYSA 3WP5A 1RUD2 1R1A2 2Q5TA 3I49A 1FYUA 1Q3EA 1UNBA 1GZWA 1I9RA 5FO8B 1WW5A 3OGRA 2A3WA 3CL1A 1OBNA 3PMEA 4ARXA 2WRAA 3NVCA 3ZFFA 3WF4A 1QJY2 3FN9A 4HG6B 4XUOA 3LIHA 5HCAA 4QM8A 1YQ2A 4PT6A 4QQHA 3V0AB 4LK6A 1NOVA 5F6LB 1VAVA 3Q8FA 3EBRA 3M3CA 3MPBA 1X33A 1QJU3 4CDXC 1RUG2 2UYAA 3ZYIB 3I2OA 5FO7B 5FYIA 2VVDA 4I09A 2RDQA 2ZGNA 4E2QA 2OQ7A 2YU1A 3ZM8A 3S30A 5EZWA 4CE8A 5FQ0B 3FUQA 2EAKA 1LOGA 1S0GA 4NIAA 1C28A 2WZPP 5T5PA 1IS3A 3ABZA 3E5QA 3OSDA 4DY5A 4BQYA 1Y43B 2D40A 2JDAA 3IT8A 2RS33 3WQ7A 1AXYA 1S0JA 3OY8A 2QQPA 1PVC3 1TE1B 5BYNA 3AVSA 4FO9A 4YVWC 1YQ8A 3POGA 5HBAA 1UY3A 4P5YA 1TVGA 1PK6C 2WO7A 1QNWA 4UW5A 4JGYC 5FKBA 3ZSJA 5A1LA 4CEWC 1RHI2 4BU2A 2O0OA 3K4ZA 2J42A 4CU6A 4RGKA 5TSWA 1V0AA 4UFHA 4NHLA 4YZ1A 2J1VA 5FWEA 4PHZA 5DMYA 2YY1A 5CISA 2HWC3 1EV11 1MEC1 3KVAA 2IFWA 4JRLA 2F4PA 2W9XA 5FBJA 4IEXA 4RQPA 2WT0A 5FYYA 4ZZ8A 5FPZA 3H3LA 2JD9A 5T5JA 2GC0A 2JDUA 4M3CA 5GKAC 2QQVA 1H6XA 4NMIA 4QX2A 4Q4W3 5FYMA 4UW3A 4QX0A 2QDRA 3ZN6B 1LOFC 3ILRA 2JG9A 5HXVA 5IW0A 5JPMB 4Q4W2 1QY4A 2VUAA 5FP3A 4B4RA 5A6YA 4XAEA 1MEC3 1UQXA 2ZTNA 5F37A 3U1XA 3R4UA 1K3IA 4KBZA 4P9YA 1VBE2 3R4DB 3AP7A 5C3QA 4Y20A 1CAWA 1VBC2 3WSOA 1W6QB 1R092 1UL9A 1MS9A 4RFT0 3C8XA 2X5IA 4QPIA 3MIHA 3PU8A 5T55A 4LKFA 1FOD2 3K4DA 1GWLA 4R4XA 3ZN6A 3ZVXA 3FHQA 3WDWA 4QHOA 5LWBA 1WD4A 4WM7C 4Y5TA 2QQJA 3WG3A 3THCA 1PO12 4HPKB 1VBB1 3FFQA 3I59B 4BOWA 4OUEA 4HK9A 4LUKA 3WHTA 1TMF1 2RMU2 1LEMA 4XJWA 1GKBA 1BBT2 3VBFC 2ZHNA 3BOPA 2ZEWA 4LBJA 4QB6A 1ND3B 1LESA 1SLLA 4W6WA 4LBMA 4MGQA 4CCKA 4PLNA 4Q4V2 1Q5OA 3B69A 4BB3A 2K46A 3VHNA 3RZKA 2VO5A 3BTAA 3ENRA 3W5MA 4ATFA 3FC0A 2ZGTA 4Y24A 1MQTA 4OI4A 3ZXKA 4NIIA 2RS31 5C9AC 3CZUA 3VGIA 1RMU1 1JHNA 1X36A 5LA2A 3IPVA 3LE0A 4A2UA 4YFZA 1COV1 2IXJA 1OF3A 1D4M3 3C7OA 2QQKA 5DAPA 3M3OA 1HDKA 2BRTA 2JE8A 3VBRA 5BNNC 1PHMA 2XBO1 1UY2A 1JYIA 4WM8A 1WA4A 5I91A 2GAUA 2BP6A 2PHUA 1R083 4K8FA 1F4HA 1V6NA 2R061 1W9WA 3Q8CA 4SBVA 3I2HA 5DG2A 2HWC1 1UZWA 1OLRA 2A3XA 4Y5SA 3VKNA 3ZXGA 3UYJA 4CDWA 4GQ7A 4XTMA 4Y22B 5FZ1A 3MO4A 1DYKA 2JB8A 3SKJE 3POEA 2XUMA 2QTWB 4GMP3 4XYXA 3TEXA 4EV0A 3B7MA 1TMF2 4LHLA 3DXTA 1UKRA 1H1AA 3AC0A 1ND2A 4Q4W1 4MYEA 1GOHA 3SQOA 1UXXX 2C5DA 5BNPA 1UW8A 4GA9A 3GJBA 3VZKA 4QD2A 4OHZA 1QU0A 1OUXA 3RZJA 1HJGA 1W90A 2ZKNA 5A6QA 1OOPB 2V5DA 4RHV2 4TLGA 4YGBA 4UW6A 1OHFA 4XACA 2Y0OA 1OA2A 1LR5A 3EYPA 1NKGA 1BK0A 3MIBA 4KGQA 2QQWA 4LR4A 1S2EA 2ZOEB 3C7FA 3HAGA 1EAH2 4CPBA 3I54A 5JR7B 3BTXA 2FZ2A 3I2KA 4Q27A 1Q8PA 5CFDA 4OHYA 3LPFA 1OXCA 2FDIA 2NMNA 5LASA 3H3ZA 4GJYA 1UX7A 3P1IA 2Y26A 2EXKA 1GOFA 3NNMA 3T0AA 1KD7A 4J6GA 3A7QA 4ZY9A 4CCCA 1HXS3 3NAPB 4AI2A 3FLPA 1YWKA 4O61A 2QJVA 1GR3A 2R073 1STMA 2BQPA 1PVC2 3PUSA 4CUGA 3U14A 3JXSA 4BXFA 2MPFA 2BEOA 2P34A 4IEOA 2Y33A 1GNHA 2RDSA 3WCRA 4XJ8A 2PTMA 5KWRA 2ZS6B 2D44A 1YI9A 1C8M2 1CAXA 1S2KA 2UWCA 3C3VA 5I0DA 3N7MA 2J1RA 3ZYBA 4Q1RA 1CAVA 1AYN1 4QKDA 4AHZA 1VBE1 4K1YA 1ZYBA 5ISLA 1O3TA 1GUIA 2KR2A 2NMOA 4ISQA 3AYDA 3NAPC 4N90A 4LTAA 3BIEA 3BALA 5FYHA 3MHZA 4DS0A 4JGZA 3MV01 1UZYA 4Q4Y2 3LGRA 5FYTA 3S5QA 2FMYA 3TB0A 2CGPA 4HL0A 2EXIA 5FMCA 1D7PM 2D3PA 5FK8A 3K2OA 5FLHA 3AMNA 2P17A 2CWSA 1AUYA 1KDKA 3LCPA 4BM8A 1E5IA 4IE5A 1FPN2 1OURA 2BFUL 5A1FA 1KRIA 1XXNA 4IGOA 2DCTA 4QQPA 3K46A 1CD3G 5FP9A 1VBA1 1SDWA 4YLZA 1NLRA 1JUHA 2XLAA 3BTZA 2LROA 5FZ9A 2XBO3 2N7GA 4PDWB 4UW4A 4Y1YA 4YRDA 4FPGA 3TEZA
chains in the Genus database with same CATH topology
4MH0E 4OI2A 2WJSA 3O12A 1DQ4A 5T54A 4FOWA 1RHI1 2ET1A 1FNYA 4XHBA 1IZ3A 2PAEA 5GZEA 3SLIA 1SLIA 1APNA 1MR5A 1UN1A 3M3IA 3RJRA 3AZZA 4CDUA 4I30A 4PJYA 4CP1A 1NA1C 1NCRB 2WZR3 2BBVA 1O3RA 3WW3A 1KDMA 4N43A 3JBG1 3IM0A 4K20A 2VNOA 2QZ3A 1LENA 2DVDA 2VOKA 1YUDA 1ASJ3 2DURA 5AC92 5BY5A 3JU9A 4MGKE 4D7TA 5CA6A 3ACLA 2EA7A 1PZ9A 1HIXA 5FCCA 3USUB 1GFF2 5GZFA 2PLV1 2G4IA 4XF4A 2JD4A 3FHIB 2VOVA 3RSJA 2XJVA 2XL9A 4B3NA 4YZ4A 1RL3A 1MZ5A 1O3SA 1ZBE3 2WNUB 3ZDSA 4BIFA 3IDCB 4MZUA 2QZ2A 4PLMA 3WP4A 2ZGPA 4IEPA 2RHPA 1PZ7A 1KQRA 1LECA 1COV3 1V70A 1GQHA 1VBE3 2GH8A 4JVAA 1URXA 1H2KA 4N53B 1G6NA 3TOJA 1FT9A 2VW0A 1QJZA 1AYN3 3V0BB 2WNVB 4Z82A 4CDWC 3FBMA 2FHRA 4YFWA 3POYA 1C1LA 1S0DA 2EF6A 2JICA 4WM7A 3A4UA 4XMIA 4FTEA 4JTOA 4O9EA 4XF0A 1SLBA 1BZWA 5GZDA 2ZX4A 3ME2A 5D8AB 2E53A 5DG1A 5FMOL 2RS51 5AFBA 4D7YA 4GH4A 3H50A 2OYZA 4QQOA 3V0AA 1WMFA 5JOWA 1TNRA 4UBHA 1U5YA 2G9FA 2JKBA 3EQEA 1SBFA 1LU1A 4R9BA 4WVWA 3ZFFB 1X8EA 4Q4X3 3WW2A 2C0ZA 4RHV1 3UKNA 1M4WA 4OULA 4DZGA 1CAUB 1WMEA 2IZWA 1Q8SA 2UU8A 1H1IA 2IXKA 3KMHA 4WVMA 3T2TA 5L36A 5T50A 4RQPC 3ASIA 4R8HA 4CTEA 4ES9A 1A6CA 2A73B 1IOAA 2WNEA 1AL21 3AX4A 2R062 1FV2A 5CAZA 3KS7A 4IEVA 5KC6A 1AR83 1DQ2A 2IFRA 3AM2A 3FZ3A 5F9TA 1XQNA 5HI0A 1RUD3 2VY0A 2PLV3 4Q0VA 4FXKB 5DZEA 2NLRA 2ERFA 5D1IA 2YUEA 3RYRA 1UAIA 3WHUA 4Z92B 3NV2A 1F2NA 4HVQA 4M01A 1ZRRA 4YVWB 5J96B 3H0OA 2DVBA 1KFXL 2EAAA 3AZVA 1GV9A 1CGPA 4JGYB 2E7TA 1ULEA 1RUE2 1LOFA 3ALQA 1OD5A 3TNQA 1S0EA 3ZXFA 1NQJA 1ZZBA 2B5HA 1HW5A 1RVF3 3HWJA 2E9QA 5FFOC 1BBT1 1H9WA 3JBG2 2Q30A 3KLSA 1AX1A 2D3SA 4NHKA 4XJ9A 1RUC3 4MGYE 1W6MB 1XYPA 3LOBA 1DZRA 4N9IA 1H4HA 2CAUA 5BUVA 3RYPA 1H9PA 4KGGA 4IV1B 5FQ0A 2UURA 2TNFA 4QT6A 4JGYA 3HT1A 4I2OA 1XNCA 1PK6A 4KG8A 2RS53 1MZFA 4QPIB 4JC1A 1DQ1A 4Q4X1 1NZCA 5CNAA 4E4DX 1G9BA 2JJ6A 3CNAA 2ZJCA 2D5FA 4RS5B 2JG8B 3LOIA 1ASJ2 1G86A 1IPJA 1R081 4L97A 3DN7A 1CAUA 1TME2 1LCLA 2XHKA 3WG1A 1YLLA 3THPA 1CJPA 2H0BA 3ILNA 3GZTB 4QU2A 1TME3 1YCIA 4N7UA 4Q8KA 1POV1 1R1A3 5A3LA 4W6XA 3WDVA 1PO21 1VAKA 1C1FA 1MEC2 1XRUA 1NXD1 3RG0A 4XDQA 2R042 2ILMA 2WT1A 1MQTB 3WUDA 2O1QA 5HCBA 5JVVA 4XQDA 4COUA 3PHMA 1MACA 4PDWC 4YW3A 3WW4A 3FLRA 5KHKA 3E6CC 3UL2A 3VBRB 1PO23 3SHRA 5KXCA 2XJTA 1NA1A 2ENRA 4JQRA 3TWIA 3IBMA 1CAWB 1D2QA 4XBNA 2IC1A 4K21A 4S2FA 2YMZA 4AEJA 1QXRA 2R071 2QUOA 3W59A 3DV8A 3M7AA 5LRSA 4FTSA 4OI1A 5JSOA 1DGWA 3WP6A 3USUA 3JCIA 1XYNA 4L2NA 4LO6B 2CTVA 4JGZB 4OUSA 2ETEA 1HX6A 4GULA 1ALYA 1Z7S2 2QVSB 1BBT3 1YFYA 3ZFEB 5J09A 4YW1A 2RR13 1LHNA 2ZZQA 4COZA 3V65A 4XZPA 2JXAA 2HJIA 3M3QA 2ZAHA 4FPOB 4LHNA 3EO6A 4KG0A 4FBFA 1ZBA3 3NV1A 4P9XA 5E89A 4GB31 4JGZC 5DUVA 1XNKA 2JECA 1QKQA 5ABJC 1AR92 5L19A 3ZFEC 1RUF1 1VB4A 1RITA 1Y9QA 4M00A 3WDXA 2UY8A 4QGMA 4HETA 1NXMA 4Q8LA 1U12A 1PGL1 5FDBA 3HT2A 4PIZA 3A0NA 4HSLA 4YARA 3U10A 1DZQA 1KFUL 4P9WA 3AP6A 2R1DA 1SLTA 2GNMA 2P3IA 1BXHA 4AI3A 1CJDA 2D6PA 4ZU4A 3UKTA 3RI8A 2I45A 1DDLA 2XKOA 1OPOA 3AYCA 5FREA 4AI8A 3H9AA 4LBQB 3NV3A 4AFAA 2ZPXA 2A6ZA 1AVBA 1YNAA 1WBFA 2ZGKA 3J4UH 4M3CB 4YNIA 2PA7A 2IWGB 3FJSA 3POWA 2ARBA 4CDUB 3R05A 1RJ7A 1U0AA 3FBYA 1NCQC 4RQPB 1LODA 3EJKA 5LRRA 1H0BA 3CO2A 5JSPA 3ZX7A 3MLKA 4EWAA 1VP6A 3ECQA 2HYKA 4FPLA 1AR72 4GH4C 4X6RB 5CFCC 1YFUA 4TZDA 5D8AA 4B7KA 4DY3A 1SMVA 2A3YA 2Y0IA 3JQWA 3OTFA 4FPKA 4D3WA 5J37A 2X5IB 3ZXEA 1N3OA 2ZBJA 5KXEA 2SBAA 4EN8B 3TYJA 1R082 1BK1A 4MSVA 2RR11 2D6NA 1J1LA 2WT2A 3LSEA 4ZKTB 4AG4A 1U5IA 3OY8B 2XG3A 1BEV2 2D98A 3VKLA 1ENXA 1C4RA 5CVRA 1R1A1 2BUKA 1ZBA1 3U11A 3JB8A 3D8CA 2PQQA 4GB33 4R4ZA 5CG9A 3ETQA 3UJOA 1UPIA 1MS5A 3LSDA 5C4WC 1AJOA 4RHV3 2HEYF 2D3RA 3D82A 1RIRA 4L9BA 2B9UA 1N1SA 1KJRA 3KT1A 2BTVC 2QE3A 1ZX5A 1PK6B 4D94A 4AWDA 4META 3MIDA 4KNCA 2P3JA 3B5LB 2VGDA 3CJIA 5F5QA 3G7DA 1CQ9A 2JG8A 3KZ4C 2R072 5J7MA 2WFF1 4TSVA 1F5FA 2HWF2 4OVEA 1C3HA 3AYEA 3UK9A 4AQTA 3WLUA 4FVVA 3LB9A 4CDWB 4C1WA 2PELA 2RJKA 3KD4A 3PVEA 5T52A 2XJQA 1SCSA 2JG9C 5KC5A 2VVEA 2WZR1 2YPJA 4LHKA 1W2UA 1J58A 2A6XA 1E57A 5FBZA 1ZA4A 5JIAA 5FOJB 2XLGA 4AFBA 4FPEA 3VZOA 5I8SA 2UWAA 2GMEA 1ZBE1 4FPFA 5IK4A 2A5ZA 3ZIXA 4ISRA 4RGGA 1REDA 5K0UC 3ZSKA 1XU1A 3CLPA 1A3KA 2Q4SA 2Z69A 2PHLA 1RUC1 1DF0A 3NAPA 4AVVA 3QH6A 1RUJ3 4NHMA 2VNRA 3N3HA 4ZU5A 3G6JB 4URTA 1V9U1 2R1BA 2O8QA 1AR63 2LUWA 5ABJA 2BNMA 3E6DA 1U5ZA 1W6PA 4IETA 2WZR2 5K0UB 1JYCA 1RUH1 2RM22 1W39A 2W0XA 3AKTA 4Q1PA 1ZZ9A 1LGCA 1IHMA 4HN0A 5KHJA 1W0PA 1UU5A 3RNSA 3MLLA 4R9CA 1WCKA 5C9AB 4E4ZA 5L73A 5K7PA 2PHFA 1HXS2 1CAXB 2W08A 4QQLA 3OBRA 3BCWA 4I0AA 4XJUA 1MZ6A 4Y4YA 3ZFFC 1VRH2 5JIUA 4AW7A 4HKOA 1DQ5A 1WW6A 4ITCA 1BJQA 4XQ4A 3LA3A 1PIV1 2A71A 3N4MA 2B8MA 2LM3A 4LULA 5E1RA 4BA6A 5BNPB 4AHYA 3I7DA 2ZHMA 3K48A 4BZ4A 4WBBA 3VBOB 1ND2C 4FQ4A 5IT6A 3R4SA 4NR1A 1UU4A 4RS5A 3VUOA 4NWVA 3VKMA 4V1PA 1BMV2 3LA7A 4CDQC 1OA3A 4Z1VA 4XFCA 5BNOA 3E5UA 2EIGA 2XGXA 5I0TA 4K3UA 4PDWA 3IMNA 3ZXLA 1AL23 1PZ8A 4WM8B 2NYYA 1QH7A 4BIOA 1O5UA 1C8M1 3AKQA 3Q9OA 3RZZA 2F6BA 1UD1A 2H6CA 2YDEA 4RSUA 3MW3A 1J59A 5LK7B 1HV0A 4Y22A 3VBHC 2OW4A 4FTBA 5JSRA 5DZFA 1MS3A 4ASLA 2GC3A 3AZYA 1TQ5A 2G9GA 1OQEA 3O14A 3U4XA 2UWBA 1GNZA 1WLTA 3ES4A 2H6BA 2GSYA 1F31A 5JMCA 2WNUA 1AX2A 2XB6C 4AK3A 1ZRCA 5JZGC 1AR61 2BVBA 5CBLA 3WQ0A 1EAH1 1EP0A 1AHSA 4YW5A 1RUJ1 2FBEA 4NWWA 1VLNA 4QPYA 1OA4A 1I5ZA 1VBD1 3AJYA 4BH9A 1RUH3 2HWF3 4QM9A 1D0GA 5JZGB 4AYUA 3AMHA 2X5IC 4QPIC 4S2GA 2VG9A 2HKXA 4JAAA 4LLOA 1NCRA 4WZCA 2WL1A 1X82A 4OUMA 2HWC2 1YFWA 3M8LA 3DUIA 1QOTA 1HRI1 4WVVA 3H7JA 2Z2SB 1CN1A 4OHWA 2A75A 4DOUA 3WG4A 4GB32 2QFEA 1YFXA 4JDMA 1SEFA 4F7ZA 4AQSA 2TBVA 3FWEA 3WT3A 3U0ZA 2JEMA 1RUG3 4GKYA 4R52A 5FLJA 3W9AA 3GHMA 2R16A 1QJX1 2QKDA 3N35A 3A0KA 3DKWA 3HD8B 3I59A 1Z7S1 3MW2A 1CONA 3AZWA 1O4TA 1NY72 1UPSA 3ATGA 3VBSC 3JBG3 1G9AA 2WFF3 1SFYA 2OZ6A 3KCCA 4MXWA 1MVEA 5GZGA 1DLLA 2ET7A 2SLIA 1ENQA 2GH2A 4AFMA 5AC91 5JLVA 2CWMA 2A70A 2V73A 4IEZA 1WMDA 4RD7A 3MIEA 2ZGOA 1QGLA 4C91A 3V0BA 3V64A 2WNVA 2UY9A 3VKFC 2YV8A 4XFHA 3VBSB 1CESA 1J3PA 3C2UA 1ND3C 2WNUC 5AFEA 1D4VB 4EN0A 4YVSB 3J8F3 5DXDA 1V6LA 1JBCA 1A8MA 2R041 3J8F2 4PBOA 4XBLA 5KHIA 3VZLA 1GYKA 4H7MA 2B46X 2W68A 3I4IA 2PN5A 4HBNA 1FMD2 1FPN1 1KJLA 4HKWA 4G9SB 1S0CA 3AK0A 5EXOA 2ZABA 2WSVA 1JOJA 3AP9A 2Z79A 2D97A 1V00A 2RS11 2OIIA 1RGSA 2CGNA 1TME1 2R043 1MS8A 3W58A 3AMQA 3SH5A 4Z8BA 1RUF3 2XWJB 2Y38A 2PHDA 1BKZA 1I1EA 4N43C 5C6CA 4XOGA 4P9LA 5DDJ3 2JDZA 1EV12 2DUQA 4Y1ZA 2WINB 1ENSA 1R093 2HWD2 1PO13 4J1XA 1LOBA 1HLCA 3J26N 3DPRB 2AUYA 1IS6A 2GC2A 4OI0A 3POSA 4EN9B 2VVFA 1GZCA 1W0OA 4JDNA 3O0VA 1LB2A 5CADA 4NPRA 4E2SA 1POV0 4EWEA 3KCXA 1GICA 3S7EA 1G9FA 5IK7A 4N53C 1FNZA 2HWD1 4QPGB 1Z7S3 3ZSLA 4LBLA 1XNBA 2WS92 4MGIE 4MGZE 4ZXKA 3DPRC 4BE3A 2AGSA 4KQ7A 2JENA 3M3EA 1PMIA 3L2HA 3FMGA 4J1WA 4XIKA 4AHWA 2ZX0A 1UKGA 2DUPA 4CDUC 1ND2B 3WZ1A 4PF5A 4WVMB 4BHPA 5FLIA 1LKNA 1O4ZA 3N36A 5A33B 3AZXA 2JE7A 3J8F1 3B3QE 2H0VA 3SH3A 5KHHA 4B7EA 1O3QA 3CJXA 5K0UA 1AYM3 2A7AA 2ZA9A 1FPN3 1DIWA 3S7IA 1HRI3 5KBFA 1N3QA 3BODA 3PVBB 4E9KA 3JQXA 2DFBA 3P3PA 1X50A 2YHJA 4I3GA 1EAH3 3EXUA 3O0XA 1GQGA 1V6IA 4EWDA 4DB5A 3VN4A 3QACA 3D0SA 4PIXA 5A33A 2PHRA 4IEQA 1YIPA 1OQDA 4Q4V1 1W6QA 2D43A 3BU7A 1VRH1 3SCFA 5C4WB 4G3YC 1SLCA 4PCRA 5C33A 4FCAA 4DMIA 4CYDA 5EFUA 4DQAA 3GBGA 3MFAA 2R6QA 2JG8C 4PQ9A 4KWLA 2QNKA 3NO8A 1PO11 1PNFA 3RDIA 3THTA 3N7KA 3SCHA 1RUI2 5JI7A 1DYPA 5B2GB 1RUH2 3AP4A 5JOYA 4FAHA 5GLZA 1LJ7A 1H8TC 2A6VA 3O5SA 1XE8A 4MVTA 1YO8A 1DGRN 2GZWA 3DF0A 4TLFA 4OFGA 1HRV3 5ACA1 2GNDA 2Z42A 3B9IA 2ZGSA 1HQWA 5H9QA 2BWAA 2R32A 4AI1A 4Y5Z0 3KCYA 4B8EA 3VBUB 5C9AA 4I01A 4YW4A 4AI0A 3IIAA 3QD6A 4XBQA 3GF6A 1YHFA 3RYKA 4LBKA 4AQ2A 4AE2A 2ZKLA 3LA2A 1SFNA 3WINE 1ULDA 1KITA 1VBD2 2R0HA 4LBQA 2CL2A 3H3UA 4XHXA 3JD72 3VBFA 1C8NA 3WX5A 2ZHLA 2I74A 3BPZA 2OVUA 2ZACA 2QDNA 2OPKA 4XTPA 3ST7A 3KT7A 3RI9A 2TEPA 4LBNA 5HCFA 5D8AC 3LWCA 4FPJA 5IK5A 1RUI1 1ZNPA 4UBGA 1F8VA 4XXPA 2R30A 5L7OB 1H4GA 3QLQA 4XFFA 3VBSA 5FPXA 1EYBA 1GLHA 2GC1A 1QOOA 1LGNA 4AF9A 2E7QA 1MQTC 1REFA 1LHOA 4Q4V3 3J9SA 3RQ0A 4GWMA 2X8KA 3GYDA 4FP3A 4JDOA 3D6EA 5EYYA 4OZXA 3VDDC 1B35A 1XE7A 4ORFA 3VV1A 3KQRA 1GSLA 4P14A 3AYAA 4RA0A 4DFSA 1Q8VA 3ZFGA 5L7OC 3CF6E 4AFCA 5F6KA 4XF1A 1VRH3 4GMP1 3CEWA 4FOVA 3ZXJA 4HANA 2EXJA 4LLFA 4P5HA 3VBHB 2K2SA 1ZM1A 3H1MA 5C8CC 4AEMA 2PLV2 4P9IA 5T5OA 2BNOA 5JWPA 1PIV2 3AKSA 1UIKA 4XF3A 1AL22 3KGLA 3FLTA 3T1LA 1H30A 3M4FA 3NJZA 1MVQA 1D4M1 3B93A 4QGLA 1J1TA 5JZGA 2OUJA 1ZZ6A 1QQP2 3M2MA 1N1YA 1DQ6A 3CJIB 4IEWA 2OUHA 3FX3A 2WS91 2C1FA 1OI6A 1S55A 1QJU2 1TEIA 1VBA2 3QCWA 2FQPA 5DUUA 4HK8A 4N7IA 4M3CF 4QPGC 3WV6A 2HWB2 4AEDC 1OQ1A 2GMMA 3VLBB 1UX6A 2W52A 1DQ0A 2ZGRA 1RUC2 1V9U3 4BCUA 3QH7A 1QWRA 2V5YA 1DGRA 2RS52 1H2LA 1O4YA 2VQ0A 4LO5B 3IWZA 2ZAAA 2RJLA 2ZMLA 1RTVA 4MXWB 4YVWA 1Q43A 3AB0A 3PVNA 4LO4B 2XVKA 5JPNB 4KWJA 1QXJA 5GLUA 1X8MA 2C9AA 3WG2A 3JD71 1W6NA 4NO4A 5I0SA 4CZSA 4I02A 1AYM2 3AFGA 4XQWA 3MLJA 4LUMA 1W6PB 4L99A 2X29A 3MF6A 2I2SA 3ZSMA 2YROA 1RMU2 4CP2A 3INAA 1ZZCA 1BEV3 1YYNA 1RVF2 4MV2A 5ACA2 1K5MB 4I0WB 2AREA 2FZ1A 1IQAA 5CFCB 2X53S 1Z78A 3BB6A 5FRAA 1A78A 2YGMA 1WW7A 4Q0PA 2WFPA 1IS5A 1PNGA 1S0BA 1AXKA 2OZJA 3RWNA 1GBGA 2Q1ZB 3O7OA 1VJ2A 1G9CA 2VMGA 4Y1VA 2RS32 1WCDJ 1Y3TA 1RUI3 5AC93 1Q56A 2XVGA 1NE6A 3S0MA 2XJUA 5KXDA 2DVFA 4M0HA 1HQNA 3WDYA 3M70A 4CEYC 4RGAA 4HFSA 5C8CA 1LRHA 1UF2C 3VZJA 2CAVA 3MEPA 1MS0A 4QPGA 4KH9A 3ZN4A 1DGLA 3SCGA 2RR12 3IKWA 4HPKA 2WLQA 4KU8A 2IXCA 3MGUA 2BVVA 2PHXA 3FFZA 1FMD3 1YJLA 4HMZA 3WY6A 1DFQA 4LO7A 2A6YA 5T3NA 3GNEA 5BPXA 4IV1A 1VBD3 2ATFA 5ABJB 2R49A 3E6BA 4DXZA 2DUOA 4XJAA 1LOAA 3GHNA 1QDOA 1AYN2 2VMIA 2NPIA 1KXGA 4I0BA 2ZMKA 1AF9A 4BPZA 1LTEA 1I3HA 1PO22 4Z2WA 3RMYA 3ZYJB 2WSUA 3E97A 2XJRA 3H1WA 1VBB2 4RL7A 4KL1A 4WVZA 1CX4A 1G7YA 2RS12 2ZGUA 3HR9A 2GALA 4COVA 4WV8A 2AENA 3MZHA 4AGRA 4N43B 1K5MA 4COWA 2HWB1 4P9GA 1R091 2ZCWA 3WW1A 1VBC1 4Q4X2 3ZO0B 2JE9A 5I0UA 1FI2A 4EN7B 1QDCA 3X29B 4W6YA 3OPZA 3H8UA 4X6QB 2E6VA 2ZGQA 2WS93 4NVPA 1IKQA 1XNDA 3SMHA 1ENRA 1H2NA 4KWKA 5GLTA 3B00A 1QQP1 3GBWA 1JXNA 4YG3A 4ES8A 1Y7BA 2HWB3 2K0GA 2GN7A 3RMXA 2A6WA 4OHXA 5LEKA 3ES1A 3VBOC 4HVRA 5A3MA 3DGTA 1NCQB 1QJY1 2PFWA 1AR93 3TRSB 4Q0QA 1PGW1 3TBDA 1N3PA 3OGJA 4LE3A 4CDQB 2Q1MA 2D6KA 2BW8A 2D93A 4CDXB 5C8CB 1DBNA 1XU2A 2IXHA 4XFAA 4LE4A 2NZ9A 1H8TA 2CV6A 1YJKA 1GZ9A 4P9JA 4KBBA 3BOWA 1RVF1 4K9SA 1LHVA 4INDA 1WD3A 3HN1A 5JOZA 2IXIA 3AP5A 1WCSA 3VBOA 1CPMA 1FMD1 4A7YA 5J98B 4R9AA 4AVAA 1AYM1 1M06G 5FO9B 3ILFA 1HRI2 1B35B 4QX5A 3QBQA 1H8TB 2DVGA 3AKPA 1RUE3 3VBUA 3N7LA 3SXWA 3PTYA 1RUOA 3RRDA 3KGZA 5FAXA 4Y26A 3ZSEA 1U5XA 2Q0AA 4N9HA 1SBEA 1AX0A 2CNAA 5LK5A 2D7FA 1I6XA 1ZVFA 4AEDB 1RINA 4H7LA 4BMBA 1CR7A 2VPVA 1JH5A 1F9KA 4A7ZA 1OOPA 3TAYA 2VOXA 1VALA 4C0BA 3GBFA 2XVLA 3GZUC 5GM0A 5EYXA 3I8TA 3MICA 3TN91 4D7SA 1OPMA 3OD0A 5JAXA 3UV9A 1UCXA 2YGLA 3WQ1A 2DYCA 3H1YA 3MF9A 1NE4A 1UU6A 4AVSA 4QMAA 3ZFEA 4PLOA 5IK8A 1LHWA 2JG9B 4YZ3A 4IV1C 1QJX2 2WWSA 2HWE2 4XFBA 3KT4A 5F1RA 1HV1A 4XEZA 4FPCA 4I3PA 3K51A 2D6MA 3DPRA 5GJ6A 3N7JA 1CAVB 1PM7A 3PNAA 2GDFA 5JCTA 1RB8G 3MYXA 4AEKA 1EY2A 3GZAA 1QJY3 5CIRA 4KU7A 1QOSA 1RMU3 3HMYA 1N1VA 2WIIB 5GLWA 4B29A 1HRV1 4IV3B 5T5LA 4COYA 2XH6A 4S2DA 1HKDA 1QF3A 3FUOA 4O9GA 1BVP1 1POV3 4XXAA 2XJSA 3NWKA 4AVCA 2WFF2 1ULCA 1RUJ2 4QHBA 1IS4A 1Q8QA 2LTNA 3PJYA 1WLWA 5BNNB 2AYHA 4GXLA 4IV3C 2HEWF 1O91A 1MS1A 1WLCA 5IUQA 4BYYA 4QXKA 5E8AA 3NKGA 4NN0A 2NM1A 4B4PA 1WW4A 4A7KA 1FX5A 2WA3A 4WM7B 4LA3A 1QH6A 2DVAA 2XLFA 4HLTA 2GNBA 1BMV1 5FMOS 2MEV1 4HN1A 2BPA2 3R0RA 1XYOA 1JN2P 3OYWB 1D2SA 2WA4A 5SV5A 3V56A 5J3UA 1SQ4A 4K40A 1HRV2 3MFCA 2EXHA 2DWRA 2R0FA 3ZMOA 3B9CA 4FP2A 1OMIA 1ZBA2 2ZX3A 2ZGMA 3L2YA 4YVSA 4DNYA 2KA3A 1DGWX 1CIWA 3WD5A 1RJ8A 5BNPC 1LHUA 1O5LA 4Q2FA 1PIV3 4LBOA 4QQ2A 1ND3A 3B01A 4HZFA 2YYOA 4DRRA 3KB5A 2DF7A 2EVXA 4S2HA 3IDBB 4PBPA 1EPZA 4PIYA 1V6MA 2WNVC 4K1ZA 4X8NA 4BMEA 1YI7A 4FPYA 4RR3C 3MIGA 2HWE1 4IERA 4H55A 3RJ2X 5I0RA 4IESA 2P2KA 1OKQA 4WM8C 4DINB 4DPNA 3NL1A 1KS5A 2VOWA 4FOQA 5SV8A 2BNNA 5CB7A 4Q29A 2PAKA 1W6NB 4L8QA 2RM23 5CFDB 5I8TA 1ZRDA 4FPHA 4XILA 4Y20B 4RR3B 3HQXA 3NKTA 4GWNA 4YW2A 4B4QA 1DG6A 5A32A 5I93A 3WDTA 1VBA3 2RM21 2CYFA 2E63A 4E4SA 3IN9A 1BCXA 1VAMA 3AKRA 4YGCA 4F3JA 2Z5WA 1W6OB 1V9U2 1ZRFA 3MW4A 3ZXAC 3LAGA 3CU7A 1FAYA 1AR82 1K5MC 3ZYRA 2VH9A 2YXSA 3ZPYA 2V09A 1RC6A 4WZFA 1JW6A 4UXAA 4Y1UA 1PVXA 4BQ1A 3MI8A 1C5HA 3PMSA 1GANA 3OYWA 4XETA 1QHDA 4JCKA 5DUXA 4GIQA 5EV7A 2B42B 1MZEA 1SACA 2HWF1 4TWTA 4MLOA 2DU0A 3ZFGC 5L7OA 4C0HA 3WDUA 3VDDA 1FXZA 1EPWA 4XJZA 4F8AA 4GALA 1WUVA 2XBO2 4CEYB 3VZNA 5EJ3A 1LGBA 3BIWE 4H14A 4GMP0 1ZREA 1NLSA 4JRAA 5K9YA 1V6KA 4CP0A 4A3XA 5C8WA 4HKLA 1S2BA 3ZFGB 5DUWA 2GNTA 1Q8OA 2GN3A 3D5OA 4EROA 1WGPA 1VB2A 3ZXDA 2I07B 4CEWB 2KXLA 3WOGA 2K9ZA 4YG6A 1RHI3 4OHVA 4RR3A 4U2AA 3OF1A 1W6MA 3AXDA 4EJRA 5FTTC 2ES3A 4IEUA 3ZYPA 4RS5C 2PHTA 5J48A 3VZMA 5LEJA 3FE5A 4HVOA 4FAGA 4ONUA 4YVSC 4YZ2A 4FT8A 3E5XA 4Q4Y1 3PJQA 1GZWB 1T6GC 2ZGLA 3ELNA 1ULGA 2TUNA 3GALA 4CRQA 1A8DA 5K8SA 4LEJA 4AVTA 5KXBA 1PGW2 3SISA 3LKJA 3ZYGA 1DZTA 3JD73 4C1XA 1AXZA 1VR3A 3RS6A 2PAMA 1G8WA 3UKVA 2FMDA 4Y1XA 5AVAA 1AJKA 1UIJA 2AH2A 1FOD3 2RS13 4CDQA 2DTWA 1NG0A 5H9PA 1JTZX 2VUJA 1SLAA 4XFGA 2Q8OA 2NP0A 1OSGA 3H7YA 5JOXA 3VBFB 1QNYA 2O8OA 2RE9A 4EN6B 2XPJA 2ZZJA 4LA2A 2CY6A 1PGSA 4XW3A 1C57A 3TN93 5KHGA 1QXPA 2UYBA 2WC2A 4MUVA 4YM3A 1LOEA 2VXRA 2DV9A 4L11A 3MDPA 3AMMA 3R6SA 1UZZA 4AVBA 2MNGA 1X7NA 2ZMNA 1CVNA 4AEDA 4K6BA 3OJBA 1BVVA 1RUNA 4HT1T 4K7JA 4FQZA 1D0HA 1V6OA 2LALA 4LT5A 4XFIA 2MHFA 1OFNA 1J3QA 1AZDA 4IV3A 4IXLA 2WQZC 1C8M3 2VMHA 4LO8A 3ZN5A 4QGNA 3USSA 5JI9A 3AJZA 2B7YA 1LULA 4XF9A 1AR73 3APBA 1R1ZA 1COV2 4AXOA 1HQLA 2E7AA 2YC0A 4Q4Y3 3U07A 1EV13 4YG0A 5CU1A 1RUF2 3WVJA 4MXVA 1AR91 1AR81 3CJIC 2ZX2A 4YZ5A 5BXXA 3AFKA 1F5JA 2VECA 2YZ4A 3WCSA 2HEVF 5CFDC 2DCKA 1HXS1 4ATEA 3WXPA 4N53A 3SH4A 2RMU1 5C4WA 4SLIA 5EWSA 1C5IA 3NSTA 4W65A 5AVPA 4E2GA 1S1AA 1IGOA 1IKPA 2DTYA 1B35C 4MX3A 3DL3A 5GZCA 1ASJ1