4LO7A

Ha70(d3)-ha17-ha33
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
247
structure length
228
Chain Sequence
b'ENIQEINTAISDNYTYNIPGIVNNNPFYILFTVNTTGIYKINAQNNLPSLKIYEAAINYITGFDSPNAKSYLVVLLNKDKNYYIRVPQTSSNIENQIQFKREEGDLRNLMNSSVNIIDNLNSTGAHYYTRQSPDVHDYISYEFTIPGNFNNKDTSNIRLYTSYNQGIGTLFRVTETIDGYNLINIQQNLHLLNNTNSIRLLNGAIYILKVEVTELNNYNIRLHIDITN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HA-70
publication title Structure of a Bimodular Botulinum Neurotoxin Complex Provides Insights into Its Oral Toxicity.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Protein transport
total genus 46
structure length 228
sequence length 247
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17993 HA70_C Haemagglutinin 70 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1090 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lo7A02
4EN7B 4EN8B 4EN9B 2ZS6B 4EN6B 4LO6B 4LO8A 4LO4B 2ZOEB 4LO7A 4LO5B 4QD2A 3WINE
chains in the Genus database with same CATH superfamily
4N7UA 1UYXA 4XILA 3DPRB 1WW4A 4XBNA 4YFWA 1DHKB 2R071 4W6XA 1ZZCA 3Q8AA 4MXWB 3ZXLA 2VO5A 3CKHA 4FQZA 4QX7A 4DEVA 4I0BA 5LCWL 2F4LA 2H6BA 2A71A 4B7KA 4MX3A 5LEKA 4D6RA 4QX3A 3TEWA 5K0UC 1CESA 2VQTA 4YW3A 5I8SA 5LEJA 4NHKA 4Q4Y2 4CTEA 4XFAA 3VL8A 3M8LA 5JUVA 5FZ7A 1PZ9A 3LB9A 4UFMA 1SLCA 4YGCA 3LE0A 5DZGA 1R1A1 1RUC2 2VBBA 3GZTB 5BXXA 1UMHA 3H1WA 4BQWA 3N3HA 2HBTA 5FZGA 4PIZA 5FZOB 1PIV2 1LGCA 3GCXA 2BTVC 1DYKA 1IPKA 1DZQA 4R52A 5CG9A 1RIRA 1OURA 3T0DA 1BBT2 1RMU2 4RSUA 5BNNB 1O6UA 5AFBA 3Q8CA 1W9YA 5JMCA 1AR72 3I3QA 3C8XA 1JZ5A 4YG0A 2WQ4A 1FATA 1IOAA 1F8VA 1LOFA 1MS3A 4XJ9A 1W2TA 1XJAA 3QLQA 1F35A 2DVDA 5FJKA 5A6ZA 1HXS3 4I01A 3AMHA 5C9AA 2H6CA 1MR5A 3WQ1A 4FSJA 1R081 2ZGPA 5CA6A 3USUA 2FDFA 1W9TA 3SMHA 4NUBA 2HWF3 1W6NB 1RXFA 3R6SA 4I0AA 4N7IA 3S5AA 2VNVA 1OA4A 3OBTA 3E5UA 3ZXFA 2FBEA 3ELNA 5T3NA 3AYAA 1DQ0A 1HX6A 5C6CA 2YMZA 3AL6A 4LBKA 4XJAA 3AP7A 1NX9A 1W2OA 2XJVA 4R9BA 1UPSA 4XJUA 3SKJE 3UNPA 3M3OA 4FPGA 3EJKA 1XU1A 1SHWB 3FJSA 3FL7A 4Z2WA 3RSJA 5CKNA 5C5TA 1O91A 3ACIA 5I0TA 1T6GC 1ULFA 1CZVA 3BGAA 1ULCA 3IIAA 4HPKB 4LHLA 5FY7A 2W39A 2VR4A 4DEQA 5LA9A 4NJ4A 4XFIA 3FBMA 4IUGA 4UFJA 1OH3A 5FPZA 3RRDA 3WW3A 1YXWA 1OLME 3ME2A 4XTMA 1QOOA 4KU7A 4QQHA 4NRQA 3AC0A 1OFSA 1REDA 3POJA 4GD4A 1QNYA 1YJKA 3R0RA 1IQDC 4AEMA 4NIGA 2FDHA 5JZGB 3TB0A 5JIAA 5T5LA 3O1RA 3SEEA 1DIWA 2B9VA 2D7FA 4XHBA 4AEKA 4ISRA 5F3GA 3D3AA 3MIBA 1YRZA 1W8WA 2ZZJA 1H30A 4BQ4A 5K9YA 1EAH3 1YI9A 5C8WA 1O8SA 2GSYA 4QDRA 1SLBA 4BB3A 3T08A 4IEYA 5FYZA 4QQPA 2QQPA 1J1TA 1B35B 2JDUA 3AP5A 2J1VA 3IDBB 2WBKA 2JJ6A 2WFPA 4PCRA 4ES8A 4CCKA 4R9CA 1S0DA 3NNMA 3B5LB 4C91A 4MYEA 1HXS2 5EYXA 3T4VA 1O5LA 5A3OA 4FTEA 4K8RB 5EQUA 2PLV1 4TLGA 1RC6A 1RUH1 3KB5A 2ZX0A 3TNPB 5I8TA 2BOJA 4ZXEA 2HWF2 2JICA 1VRH1 2KM2A 3B69A 4Q4W1 3NQHA 5FMOL 4OHVA 2QJVA 2XJSA 1A34A 1GSLA 2GNBA 3KV4A 1OT5A 4JKKA 4N43B 1VALA 1SBEA 3LQCA 4WM7A 4BYYA 4YM3A 4Q1RA 2G9ZA 4YVSA 1BKZA 3KV6A 3T2QA 1JU3A 2E26A 3VB9A 1DFQA 4CA9A 5A7OA 3KGZA 3U0ZA 1H6YA 4ISQA 4XUPA 4LLOA 4AVVA 1YI7A 1BEV3 1MS0A 2EICA 2RDQA 1CAVB 1NG0A 2WLPA 3KVAA 4NO4A 2GMMA 3BPZA 4Z82A 4PDWA 1X36A 2PHUA 4GWIA 1LOFC 5JI9A 3LEMA 2YY1A 4P5YA 1W6QA 5DDJ1 2VBDA 3ILNA 3M2MA 2DCTA 5LY1A 2VQ0A 4U2AA 3MLLA 5GLZA 2IXJA 4URAA 4FPLA 3IM0A 4URTA 1QJU1 1HRI3 2E53A 5BNOC 2OPWA 4HONA 4KBZA 4P5HA 3UL2A 5F9TA 2FQPA 4YG3A 3PURA 1COV1 4FCAA 1YUDA 1BCXA 1VAVA 2BQPA 4DB5A 2Y6JA 4UBHA 4A6SA 4TZDA 2P37A 3VBSA 1W9WA 2DCZA 2H0BA 2SBAA 2ZEYA 1SG3A 3EBRA 1EAH2 3IKWA 1F31A 3QD6A 3ZPOA 2RR11 2Y0IA 4L9BA 4XZUG 1SMVA 2YC4A 3ILFA 4B8EA 4ET7A 2JD9A 4MV2A 1CPMA 4XW3A 5F6KA 3TNQA 5KBFA 2XLAA 4CDXA 2G1MA 1AL21 1MZ6A 1H2LA 3IAPA 4MLOA 1A8DA 1VBE1 1GNZA 2BYVE 5IWFA 5HCBA 4MG2A 1YFXA 1XSQA 5JOWA 2JB4A 2WSVA 5J98B 4COYA 3M70A 2I45A 3CNAA 5FZDA 2LW8A 1XSRA 2FZ1A 3DYMA 4CUBA 4QPGA 4UF0B 4MH0E 3G7DA 4YVWB 3WF1A 1OQDA 3SKVA 3JBG1 1C8M3 3ZFGA 3BU0A 3LZZA 1HN1A 1UNBA 4XETA 5EYYA 1ZZ8A 2W2IA 1X8EA 3JQXA 1VMFA 2HYKA 5LA0A 1PVXA 4RQPA 1GZWB 2CTVA 4L92A 3ASIA 5C8CC 1UMIA 1F9KA 2YC0A 1QXPA 4COVA 1OOPA 1ULEA 1R1ZA 2WAAA 2XHNA 3FLPA 4RGAA 3JD73 5ERLA 5D8AA 4CCDA 2D6LX 2JDZA 2WLQA 4IE6A 4QT6A 1BEV2 3N9MA 5FOBB 1HN0A 3X29B 4AWDA 1AR83 3E5XA 4DRRA 4Y1ZA 2EALA 5LATA 3KD4A 3BVCA 5LK5A 2ET7A 4RGGA 2VVFA 1ENXA 3FFQA 4BQ2A 4OVEA 4JCKA 5KC5A 1HRI2 4RS5A 1N1SA 2BVBA 2ZA9A 3O12A 3QH7A 4D8MA 1DYPA 1UU6A 2FCTA 2WT1A 4JRAA 1GZCA 3I49A 5JSRA 5FPAA 4G9SB 4WV8A 2ZMNA 5FZHA 2GH8A 1CZSA 1WLWA 3N7LA 1SCRA 4YVSC 4LITA 4BQ3A 1UO9A 1VBA3 3VBFB 4RN5A 1V9U3 2G9FA 3ZKUA 2C26A 2GDFA 1S2KA 1QJX3 2HLEA 5FRAA 2OQ7A 2WWJA 2ZMLA 4BPZA 5F2SA 3HQUA 4QMAA 5FP9A 5CG8A 4JHTA 4AZZA 4E4DX 5B2GB 3ZYJB 1K5MA 1RTVA 2WO2A 1Z0HA 4DXZA 3UESA 1L7LA 3GHMA 3GALA 3VBHB 1UW8A 5ABJB 3D5OA 1PVC3 4Q4Y1 4PDWC 3ZKYA 4CSWA 5EIYB 1AYM3 2D44A 3Q8EA 2BEOA 3N9PA 3WD5A 4JGZA 4MXVA 3VDAA 3WF0A 1PM7A 2WO7A 4DIQA 4AFAA 2ZZQA 1K42A 1RUC1 2WDBA 3WXPA 2YBKA 1LU1A 4QWNA 4XJ8A 4ATEA 3NAPA 3HAGA 3K3NA 4RL7A 1PIV1 5FY0A 1C8M2 1UXZA 1GU3A 4CP1A 1SLAA 2C4XA 4IERA 3ZMOA 4K6BA 2JDAA 3FLRA 4OULA 2XBO3 3IBMA 4OYUA 2XH6A 2VNRA 1OC1A 1BBT1 1RMU1 2VM9A 3IMNA 4Q4X3 2ZGMA 2ORZA 4EYUA 3TAYA 1GMMA 1AR71 1QH7A 3VDDA 5L7OB 4AOCA 2X10A 1K3IA 1QU0A 3EMRA 1IPJA 3VBSC 3OUHA 4NAOA 3ZFFC 5A7WA 1W0OA 3JD72 1JH5A 1W8NA 5IVJA 1W04A 4M3CB 4FOWA 4V2VA 1OA2A 4D6SA 5GALA 1AR82 2VOXA 3ZYFA 5H9RA 1ULGA 3ZOIA 3AFKA 4Y22B 4YYOA 1GQGA 1JYXA 1T2XA 1NCQA 2BNNA 5DUUA 1QF3A 4CCCA 4MGKE 4Q8KA 2JG8B 2VMCA 2VBPA 3B9CA 1GNYA 1PO23 3ILRA 4TYSA 4Y1YA 5GLVA 4YGDA 5H9QA 4PLOA 4RQPC 3D4KA 1GBGA 2B45X 4XOGA 1DCSA 4QKFA 4W4ZA 1VBA2 3I2IA 3MV11 1V9U2 5FZEA 1S0GA 4ONUA 4HETA 1QJX2 1VAMA 2W87A 4LPLA 4LR4A 2VG9A 1EV13 1LOCA 4RFT0 2WABA 3FBYA 3J8F3 5GLUA 5D8AC 1C28A 1BZWA 1W6MB 2J1UA 5A3PA 4PI2A 1GKBA 4IEXA 4LIVA 5FREA 5FY9A 1GUIA 2PQSA 3I3DA 5DG2A 2ZJCA 3MLJA 1PVC2 1S0FA 2V73A 4KWJA 5JAXA 1AYM2 5K0UB 2UWCA 1GOHA 2P3YA 3AXEA 2ZKLA 3HT1A 5C4WA 3WQ7A 3RZKA 3MZHA 2RHPA 4EJRA 1CONA 4MHRA 1BQPA 4WM8C 1OD5A 1GWKA 2XJTA 3WP3A 3OGJA 4FPOB 3RDIA 1LEDA 4DFSA 2EXHA 1SEFA 5A32B 3LSEA 3VBUA 4P9YA 3EXUA 2SLIA 3KT4A 5KXCA 1QDCA 1PGW2 1UU5A 1XYOA 4L11A 3E1F1 4Q4X2 5GZDA 3I4IA 5A33A 4GQ7A 1W6PB 4NN0A 4XACA 3SC7X 3KMHA 2GN7A 2WNUC 1W03A 1HXS1 3H9AA 4QQ2A 4ES9A 1RUOA 4P08A 4FFFA 1C57A 1F5JA 1FV2A 5FYUA 5FPXA 3QACA 4HLTA 4XUQA 1ONAA 1K5MC 2HWF1 3WP5A 4Y20A 5L9VA 3VKOA 1O3TA 2WYFA 4JGZC 3RZGA 1HRV1 2A6XA 1MVQA 1RUD2 1O8PA 4OZOA 4XFCA 4GALA 1SQ4A 4XUNA 4AVBA 4XMIA 1JUIA 2RS11 4N9IA 5LRRA 4FPJA 1YIFA 3NAPC 1ZRRA 3CLPA 4X6RB 5FZ6A 5FY5A 4CCNA 5FBJA 1QOTA 3PTRB 2VQUA 3KV9A 4I3GA 2YPJA 1PO22 1WLDA 4M4PA 5F32A 1AVBA 5JMOA 1PZ8A 3N7JA 4Y1UA 2JENA 1G86A 5LK7B 2WIIB 5I0SA 1XNDA 2ID4A 1GP4A 1NQDA 2W3JA 2LM3A 2WS93 3FZ3A 3MIHA 2KA3A 2XLFA 3IPVA 4GKXA 1EV12 3NNGA 4Y5Z0 2BP6A 3J8F2 3R05A 4OUMA 3FLTA 3THDA 1MS9A 4CDWC 1NZCA 1OKQA 3I59A 3K75B 5HXMA 1V00A 2ZEWA 1GLHA 3MBWA 2YFUA 1NXD1 4PLMA 1ZA4A 4OZXA 2FMYA 3P3NA 3WF3A 2CGOA 1YWKA 3NKGA 5F5IA 4OQ8A 1JU4A 4JKMA 1NCQC 4XBQA 5K8SA 1CR7A 2TUNA 4XFHA 2VMHA 3H8UA 3WUDA 1WD3A 1WGPA 1RUH3 2JE8A 1IQAA 2XL7A 2GALA 2DF7A 3HR9A 3E5QA 4WVMB 5FZAA 4GWNA 3U14A 3ZXJA 1K45A 1RUF3 5IK5A 4GZ9A 1WCQA 1SBFA 2UY9A 1TZOA 5FYTA 3T1MA 4M01A 4CDQA 2UY8A 1PX4A 2QQOA 2RVAA 2VZ1A 5B4NA 4AVCA 4P9JA 5LY2A 2CAVA 3C7EA 3D0SA 5DAXA 2YC2A 3A23A 2DWRA 3PMSA 2AC1A 1JZ6A 1WW5A 3W58A 4ITCA 4OMCA 3ON7A 4OLLA 4AVTA 4NR1A 4BA6A 1CWPA 3O14A 2FCUA 2P3KA 1OF3A 1Z7S3 4COZA 1CN1A 5JWPA 3M3EA 2OYZA 3JU9A 1CAXA 3OUJA 1VP6A 4QAWA 3WNMA 4B1LA 2ZBJA 3K4AA 1WMXA 1LJ7A 2W92A 1PO12 2D93A 4M0HA 1A6CA 3KWVA 3DXTA 3VBUC 2D5FA 2V09A 4QPIC 2QZ2A 5F37A 1BEV1 1W8OA 1SACA 3T2TA 1GZTA 2V5DA 3GM8A 4Z07A 4EWEA 3WUCA 2WL1A 3W21A 2WS92 3HQXA 2A3WA 3ZDVA 2PN5A 2VCCA 5FK8A 3PIJA 5FWJA 5FZBA 3O1PA 2XKOA 5A6XA 2HEWF 3LA3A 1IGOA 1EP0A 1HRI1 1SPPB 2BFUS 5J48A 4YZ5A 3DYOA 1W2NA 2GH2A 5BNOB 2CGPA 1QNWA 4XIOA 1AL23 1UZWA 3Q8FA 3BU7A 1VBE3 2O0OA 1W3XA 3ZYBA 1XNCA 2J7MA 4CP9A 1GANA 3APBA 1ZA7A 5APAA 2DCJA 4FOVA 2QVSB 5JDBA 1DQ2A 2Q0AA 4YARA 1U5YA 4LTAA 4E27A 2WNOA 4R8HA 3WT3A 3BTZA 3BTAA 2JKBA 1GWMA 1ZRFA 1RUF2 3MO4A 1MEC3 5FYSA 3M3CA 3JBG3 3PNAA 5DAWA 3T2PA 2NMOA 3LDRA 4QGNA 3LKJA 5GLWA 2D6NA 5EJ1B 4E2GA 3VHPA 4XAAA 4WVVA 1DF0A 3SQOA 3WG1A 4EWAA 2CHHA 2JDMA 3QH6A 1PMIA 1HKDA 1RITA 2WR9A 4LBJA 2PHRA 3RJRA 3ZM8A 2FHRA 2B7YA 4JX0A 2E7AA 3NVCA 3DXUA 4K1YA 1C8M1 2WA3A 5I93A 3FHQA 5HV4A 1Z7S2 3SEPA 2VMEA 1WMDA 1JYTA 4HXCA 3C7FA 1ZRIA 4N53C 4EN7B 5BNQA 2BPA2 3RYPA 5G04L 3KT1A 4CEWA 1HIXA 2ATFA 3VD3A 4D3WA 2QFEA 5C8CB 3KQ4B 3MYXA 4PI0A 4EZ4A 3PUHA 2VVEA 2Z4FA 5FUNA 5IAXA 5KHJA 3VGIA 3JD71 4HN1A 2RS32 4XPVA 1JYNA 1Y9QA 4AG4A 2XJQA 4NRPA 2WZPP 2Y60A 2K46A 2ZGUA 1AR81 2BGCA 3ORJA 1NY72 2WNVA 3MW4A 3NNFA 2WZ8A 4H2AA 3BTYA 3PJYA 1ZBA3 2F6BA 5FUIA 5IFPA 2JECA 2O1QA 3ENRA 4HG6B 5J1XA 2A5ZA 2LTNA 1B09A 5FKCA 3OBAA 2X8KA 4QU1A 4Y26A 3MUY1 5L9BA 2UYBA 1N1TA 1RHI2 3NJXA 4AHYA 4XQ4A 1UY1A 1W39A 3D82A 3MIGA 1AL22 2DUQA 1H4GA 5CBLA 3GCWA 4WM7B 1RJ7A 2QTWB 4ASLA 1Q8SA 2EXJA 1VBA1 2XMLA 3AYDA 3HQRA 4P14A 1V9U1 3NJVA 2A7AA 2CU5A 1DGLA 4JV4A 4YVSB 1QJX1 1KDMA 3DEMA 4XDOA 2Q8CA 4CP2A 1NOVA 1RUC3 4AAPA 4GKYA 2JX9A 5FP4A 4N9HA 2AYHA 1YEWA 2PXJA 3HN1A 1BHGA 1LOEA 1RJ8A 4LE3A 1MEC2 5FK7A 4A7KA 5GZGA 5JPMB 1PVC1 5DN2A 1C4RA 2DU0A 1AYM1 5T55A 1BBT3 3KF5A 5EFUA 2YG0A 2C9KA 2NN8A 1VE0A 4PDWB 4FAGA 3AKQA 4YFZA 2XPJA 1W6QB 1KS5A 4XUOA 3FUOA 1I3HA 2VW1A 5EXOA 2FDIA 3AJYA 4IETA 4KWLA 4E2QA 4IEVA 5A3LA 5TSWA 2P6CA 1XNKA 4NIHA 1X8MA 1FOD1 2VUJA 1PGW1 4KMQA 1NLQA 4QXKA 3WVJA 4M0NA 4Q4X1 3VBOA 1QIQA 4PQ9A 3LIHA 1TMF3 1W6OA 3WP4A 4BMEA 1RUE3 5JXIA 5ACA3 3ZXGA 2BZDA 4MO3M 1WLCA 2OVUA 3AJZA 3AVSA 3BN6A 3VBSB 4CVUA 2JKXA 5T54A 2ETEA 1KFUL 4OFGA 2K2SA 1A78A 3LAGA 2MNGA 1AZDA 3M3QA 1NYWA 2TEPA 4MGZE 1ZBA2 4SBVA 2QUOA 2W1UA 5EWSA 5ISLA 1RUD1 1Y3TA 4ZONA 1N1VA 3HOBA 1OPOA 2WJSA 3I3BA 4JC1A 2CY6A 4BQXA 5DUVA 3RZMA 2DUPA 1VR3A 4GJYA 3GXUA 1PO21 2CNAA 4D7TA 3A0KA 4XBLA 1TG7A 2RDRA 4XABA 3OF1A 3H8XA 4OHWA 2AUYA 1UX7A 3LDBA 2WKKA 4JKLA 3HMYA 4RQPB 2WT2A 5CADA 1KQRA 4Y5TA 3WINE 4QHOA 4YPJA 4TWTA 2OXBA 1EV11 2JIGA 3UGGA 3OTFA 3J8F1 3W20A 2WAOA 3ZIWA 1MQTC 5FZKA 1OOPB 5JXJA 5FZCA 4A7ZA 5D8AB 2IFRA 3CIHA 1WBFA 2L9LA 1V6JA 3V65A 5F5QA 4YW2A 4JQRA 3RG0A 1FMD3 3H50A 1UZYA 5CFCC 1WMEA 3QCWA 1W9FA 4OI2A 4BJ0A 3H7JA 3JXSA 2RDNA 4XIKA 4LLFA 4LBMA 2HYXA 4IEWA 3W9AA 5C33A 5C3SA 3V0BA 2YGLA 5AVPA 4A44A 4WM8B 3SITA 4ZU5A 1LHUA 3HJRA 2CWSA 2JDYA 5D1IA 5FIXA 5FPBA 2BJSA 5FXWA 2EVXA 1NA1A 1W8UA 2WNEA 3LOIA 5DXDA 1UIKA 1ODNA 2JDKA 2NZ9A 3O5SA 2VMGA 1TMF2 2B5HA 4E8DA 1NT0A 3RGBA 4E4HA 2E33A 2D6MA 1RUE2 2EIBA 4LIUA 1LHVA 3DECA 1WA6X 3K4DA 1HRV3 3N9NA 3PU8A 5ACA2 4LBOA 5C5UA 4BHPA 2GNMA 4EROA 1G8WA 2WNUB 2Q30A 1OSGA 4IEOA 1C8NA 2RS13 4DXSA 3E6BA 4OQ9A 1QY4A 1S4CA 3AX4A 1WCSA 1UZ0A 1IG0A 5GZFA 3ES4A 1K5MB 3F2ZA 3WG4A 4W6WA 2ZAAA 2RJLA 4AK3A 2N7GA 2DYCA 2NYYA 3WG3A 2WFF3 3B94A 1X82A 4JGZB 1MACA 3IDAA 4RA0A 3RFRA 1UOBA 4JDMA 3I2OA 2RG4A 1PO11 4RGKA 1UPIA 3POGA 3LEGA 3THCA 2O8QA 3NAPB 4YW4A 4IV3A 3CF6E 4CE8A 3ZN4A 5JOYA 4NIDA 3B00A 5FR3A 3RZJA 4QXHA 4B4PA 4HN0A 3RZHA 4IEUA 3GJBA 1KJRA 1QH6A 2VH9A 2WS91 4M3CE 5FJHA 3ZR5A 4XMAA 3ZFEA 2R063 4IEQA 4FOYA 3T4HB 3UV9A 3WOGA 4ARYA 5BV6A 5C3PA 3RMYA 1UOJA 2RS53 3ACLA 4LO5B 3J7NA 4AVSA 5FYBA 4NMIA 1GQHA 5D21A 5DUXA 4CEYA 3BOPA 1DQ1A 1ULDA 2D3RA 3HEIA 4CDWB 1FMD2 1ND3A 3F95A 5C71A 4ASKA 5FFOC 4C1XA 4HKLA 1JS9A 1NKGA 2D6PA 1REEA 4XYXA 2RE9A 3KM5A 4R4ZA 1NCQB 3TN93 3WG2A 4MHUA 2VZTA 4NOTA 5T52A 4CCLA 4CDUA 4Y4RA 1ND2A 1PK6A 2I07B 3KCYA 4D94A 2YUEA 4ZZ5A 1RUF1 2DURA 4KH9A 5FMOS 1NE6A 1DQ5A 4JVAA 5AC93 1PZ7A 4H55A 2W9XA 1HRV2 4Q2FA 4GH4A 5JI7A 3T0BA 4E4SA 2Q8EA 3PHMA 1WW7A 3NV1A 1UX6A 2QNKA 2RS12 2PMWB 3LD8A 4XF0A 5G05L 1D4VB 2MHFA 2Q4SA 1W8HA 2BWAA 3NNLA 1J84A 3ZYRA 1X9TA 2XL9A 3I2KA 3S7EA 1IKPA 3ZN5A 4AI8A 1G9FA 2CWMA 4YW1A 1Z7S1 3EO6A 2A6ZA 4LBQB 1HV1A 1MS1A 3IN9A 3IB3A 4LMFA 3Q8BA 4LXLA 1ULPA 2WFF2 3HD8B 3PVOA 5ANQA 4ZKTB 2P17A 4JGYA 1AR62 2JXAA 4GMP3 4TSVA 1UOGA 5C9AC 2RMU3 2VY0A 3S6PA 1GR3A 5A6YA 2RS31 3CU7A 4KI5M 3VBUB 1AYN3 1X50A 3N7MA 1F5FA 4QPIB 1CAUA 1NY71 1ZZ7A 2HWB1 2PAMA 3ZN6B 1J3RA 2WC2A 2ZHMA 4YWAA 3HWJA 2A70A 2R062 2GP3A 5A3WA 2X09A 3RPQA 1J1LA 2WZEA 1RUG3 4KU8A 2QQIA 1CAWB 1AF9A 2RS52 2W1WA 3LEIA 4F8AA 1ZX5A 3NSTA 1Z78A 2VU9A 2Y6GA 4O61A 4B3NA 1QKQA 3DKWA 3MUZ1 4QB2A 4IQPA 3UJOA 1YLLA 2AENA 3MGUA 1RHI1 1SFPA 3P6BA 3WHTA 4C90A 5LWBA 3AMPA 2VTXA 1XOYA 4Y20B 3OB8A 4EN9B 5IK4A 3LGRA 3MLKA 3FUQA 4LO6B 4Q4V3 4AL9A 3ZIXA 1JTZX 1WW6A 4X6QB 1C5IA 1S0IA 3M7AA 3TN92 1EY2A 3O1TA 4X8NA 1LULA 1LOBA 2TNFA 1Q8PA 2W94A 4O65A 5F3IA 2RJKA 3VKFC 1DGWX 1C5HA 4IV3C 4AHWA 5A3TA 1IHMA 4I09A 4RR3A 5F39A 1MEC1 5EPAA 5FAXA 1IS4A 1LRHA 2AH2A 4XUTA 5AC92 1H6XA 2VW2A 4GXLA 5FO7B 2GC0A 2A6VA 3BIWE 3OPZA 1PNGA 1RUNA 3H8RA 1M4WA 1STMA 4UYBA 4OI1A 1HJFA 3FHAA 1DP0A 1YIPA 4UW3A 3IPVB 2ARAA 2JDNA 1DGRN 2IUWA 2QQVA 4P02B 2YBSA 5DUWA 5FPVA 3T30A 4BWOA 1OUXA 5I91A 1AR93 4XAEA 4CEYC 4A4AA 1RVF3 3NW4A 1TNFA 2JDPA 1ND3C 1GOFA 3AM2A 1JYWA 1IS3A 2VNGA 1NE4A 4UFLA 5CZKA 1UY0A 1IS6A 3A4UA 4Q0VA 4LK6A 3THTA 4D7YA 1D2SA 1POV3 4N53B 3IAQA 5FZMA 2AACA 2RMU2 3MPPG 3SCHA 1FI2A 2GAUA 4KWKA 3DYPA 4L97A 3AVRA 4LBLA 4CDUC 3BPSA 3WHUA 1ND2C 5J09A 1AYN2 3NRUA 1JOJA 5KHHA 2YDEA 4L99A 4CZSA 4JRLA 4CU9A 3BOWA 3BKZA 2V4AA 3BB6A 1JZ4A 3KHCA 1XQNA 4UXAA 1ZBA1 4WM7C 4PIYA 3IMMA 4EZHA 3FX3A 1JW6A 4CP0A 2F4PA 2XQRA 2NMNA 1CGPA 1JZ2A 1RUG2 5K7PA 4QM9A 3KCXA 3GF6A 1US3A 3VHOA 4ORFA 2JDHA 3ZLIA 3H42B 1W8FA 4LO8A 3WP6A 3WX5A 1UF2C 2VULA 1RL3A 2D40A 4NHYA 3WW4A 2VTXJ 3NV3A 4Q4V2 1CAXB 1JODA 2WQ8A 4JGYC 3VZMA 5E89A 3ZO0B 3FMGA 3LFIA 4MOAA 3W5NA 2ZX2A 4FTSA 1O5UA 2E32A 1QQP1 1JZ3A 4BH9A 1VMJA 1JZ7A 3C3VA 4NAMA 4YZ2A 3AMNA 1V6KA 1FOD3 4LA2A 1WWYA 2D6OX 2R6QA 5GKAC 2HEYF 2IXKA 3GZEA 4IGQA 4JQTA 3UK9A 1EYBA 1APNA 1H2KA 1POV0 2GC2A 3H1MA 4IE5A 3RZZA 5HCAA 1KEXA 4QPWA 4RFRB 4EN6B 4AFMA 2PFWA 1US2A 2VZQA 1AR92 1J58A 4QX0A 1W28A 1RVF2 4KBBA 2ET1A 3HNYM 1PNFA 3D6EA 1ENQA 4LOSA 4CDXC 3KLSA 2QDRA 3PMEA 2ZCWA 2XVKA 4MGQA 5DABA 1TMF1 4AFCA 3C7GA 5IVBA 1RUE1 2GN3A 1L7QA 1VBC3 5ACA1 1RUD3 2VQAA 1S0JA 1W8TA 1XNAA 2VZVA 4CXXA 5JPNB 4S2DA 1L7RA 1PGL2 4R9AA 1LHWA 1QJZA 4QPGC 4CPBD 4CU7A 4ZU7A 2EXKA 3ZFGC 2DTWA 5IVVA 3J7LA 1DGRA 5GZCA 1Q8OA 2VCBA 1K12A 5EJ3A 1H9PA 3V56A 4K20A 4GB33 5DZFA 1B35A 2RJ2A 1OOPC 1AUYA 2BU9A 2IXIA 2E7TA 2Y34A 4JHZA 2EIEA 3VL9A 2D43A 3RYRA 4ZS2A 4O7XA 1JYIA 1ZRCA 5FMDA 1OVSA 1A3KA 4AGGA 5LW9A 4EN8B 2WT0A 4NPLA 4BXFA 1XB9A 3SLIA 3ZYHA 4C0BA 2Z79A 5IVFA 4LQRA 5A1FA 2CV6A 2JG9A 2OZ6A 4CEWB 2GU9A 2ZGSA 5A3NA 2Y26A 2WQZC 5JLVA 2X5IA 2ZGQA 2CL2A 3VZNA 4IESA 4UBGA 1MQTB 1OKOA 1U0AA 4RS5C 1CVNA 5IJRA 2LUWA 3WSOA 1FOD2 5KHGA 3UT0A 2C6SA 2BNMA 1FMD1 1L3JA 5JXHA 1HQNA 3PTYA 3CO2A 4B1MA 1V6MA 1HB2A 5B4XA 1JN2P 5CFCB 2VUDA 4DZGA 2YU1A 4NWVA 2X53S 1KITA 1FYUA 1YQ8A 4LOTA 1UXXX 4AFBA 1FPN3 2G4IA 4J1XA 4QHZA 5FY1A 4BQYA 4YGEA 2YGMA 5CAZA 5FP3A 4WZCA 5FPUA 1JHNA 1S2EA 3JUUA 4LEJA 4YLZA 2OX0A 3BUCA 2JE7A 3R4SA 3KQRA 2TBVA 5KHKA 1LAJA 3I3EA 4IE0A 5IAVA 2Q5TA 5DAVA 4HK8A 1RINA 1VBC2 4GIQA 5FYCA 4HZFA 4LORA 2LRPA 3QBQA 3SCGA 4UW4A 3WEZA 1LODA 4BCUA 3LWCA 5A80A 2WYSA 1OMIA 1PO13 2J1RA 3N35A 5E88A 1CX4A 3OGSA 1SZBA 1Y4WA 1YYNA 1GQPA 3OPTA 5IW0A 3WDTA 3MI8A 1SCSA 2E9QA 5A1LA 1Q5OA 3T1LA 4R9DA 5F1RA 2OPKA 4HVOA 1ZM1A 3ACGA 3ZDSA 3ZSMA 2RV9A 3VDDC 2WFF1 2WZR3 4GB32 4HOOA 1MS5A 1AR61 3KHBA 5KXDA 3U11A 2OW4A 3EYPA 2BV4A 4WZFA 4LHKA 1OBNA 3VHNA 2GC1A 4FOQA 4GJZA 4XC9A 4FPEA 4WBBA 1OA3A 1H8TA 2Y6HA 1OPMA 3GBWA 2C9AA 1U5IA 4L8QA 4CCOA 1DQ4A 2VUAA 4S2FA 2BERA 3VBOB 4P9WA 2P1BA 1ALYA 2R061 1UOFA 1W6OB 2R49A 1ZRDA 2J1AA 2XJRA 4B4QA 4IV1A 4S2GA 3CHXA 3TWIA 3AP6A 1GZWA 1VBD1 2RS51 4BDVB 1JYCA 4GULA 3AZVA 3M1HA 2KD7A 4MGYE 4MGTA 1D4M3 4BE3A 4P00B 3BIEA 1QJY3 4V2WA 4FPCA 1MZ5A 2HJIA 2NPIA 1RUJ3 2Z42A 3DN7A 3OYWB 3POEA 1G9CA 2ZOEB 3ITQA 5DQ0A 5BUVA 4K40A 1IPSA 3KV5A 2YHJA 4H7MA 4YW5A 1G9AA 3AYEA 3TN91 4BOWA 2XXZA 1FPN2 5L73A 3I8TA 1XRUA 2DV9A 1UYZA 2IXHA 4LBQD 4AF9A 4A3ZA 3DKQA 5AC91 5C4WC 1C1LA 4QXBA 4AQ2A 2XB6C 1M06G 2JG9C 5KXBA 2EF6A 5LBFA 2GC3A 3PL0A 4MADA 3K46A 5EJZB 2X5IC 4BK5A 1YFYA 4Y4YA 3VBFA 4XFFA 2RS33 2A3XA 1KRIA 3K2OA 5AFEA 2J42A 2W1QA 1Y7BA 2VAUA 4L0PA 2HWB3 4FO9A 2AREA 2WZR2 2JEMA 5A70A 1UYYA 1GNHA 3J9SA 4GMP1 5ABJA 2H0VA 2P4EA 1YFWA 4P9GA 3TBDA 2RMU1 5BNPA 1UYPA 3LEKA 3KSCA 3V0BB 4WVZA 4UWDA 5HCFA 5KHIA 1U5ZA 1YO8A 1LNSA 4NPRA 5C9AB 4HBNA 4EWDA 1AYN1 3ECQA 1GOGA 1KD7A 2RDSA 3RWNA 3USUB 4TN7A 3LA7A 4W50A 5HPOA 1KFXL 1RHI3 4BMBA 1RGSA 1IZ3A 4K8FA 1ENSA 2O14A 3MPBA 1PGSA 1QXJA 2Y0OA 4A42A 3ES1A 1O59A 1V6NA 2OIIA 5IYYA 3GZUC 2A6YA 5F3CA 3N4MA 2W08A 1RUG1 3K3OA 1U5XA 2R16A 2VPVA 2W5FA 3W5MA 2Q8DA 2ES3A 4BLIA 3LFMA 4UAPA 4XCAA 4TTGA 4QX5A 1OLMA 5H9PA 1D4M2 3ZSJA 1N3OA 2P5BA 4DY5A 4YZ3A 1QJY2 1H8VA 4PQQA 3T0AA 1RUJ2 3VZOA 1F15A 4D0QA 5L9RA 5C70A 1BXHA 5FYMA 1UY2A 1YC61 4Q4V1 3ACHA 5T5PA 3RWKX 4FQ4A 1H2NA 3AFGA 4DUXA 1QDOA 5HBAA 3B93A 1QXRA 4Y22A 3WQBA 1XNBA 1VBB3 2HKXA 2E6VA 3RQ0A 5FP7A 1G9DA 1DLCA 2OZJA 4BK4A 3OY8A 1W90A 2Y6KA 5JOZA 3VD9A 2AEYA 4IV3B 1GP5A 4HL0A 3I3MA 3I97A 1X33A 2ZGKA 3TOJA 1DDLA 1Y43B 1V70A 4AHZA 1AX0A 3VZKA 4IV1C 3PLQA 5FZ8A 2XWJB 2O8OA 4DY3A 1WMFA 4TLFA 3CJIA 4YGBA 2EA7A 4CUCA 5A7PA 2Y38A 4CRQA 2HWE3 1AR91 2VZSA 3NV2A 4K21A 1RVF1 4XJZA 2XWBB 1NUKA 3AP9A 3HBKA 4CEYB 1OQEA 1AL0G 2VCAA 1JI6A 1W6MA 1WKYA 1ND3B 2HWB2 3QOPA 5JCTA 2PHDA 4I2OA 3FHIB 1BVVA 1POV1 4XXPA 5F5CA 1RUI3 1XC6A 2XOMA 4CDQC 4DS0A 3N9OA 1HJGA 4Q0QA 4XCBA 5K0UA 4A2UA 4QB6A 4INDA 2VZPA 1PGL1 4FFGA 2P2KA 4HANA 2OKXA 4OMDA 4CDUB 5IK8A 2UWAA 1ND2B 1PK6B 3ACFA 4ZU4A 4XE9A 4LULA 1O3SA 1AJOA 2VCMA 4J25A 2XGXA 2FDGA 1DZRA 2A1XA 2ZGOA 4AYUA 4W6YA 3NKTA 3NO8A 1ZNPA 4UFIA 4GH4B 1W2UA 4QU2A 4H7LA 3OPWA 5CFDA 3V64A 1LU2A 1XE7A 2XR4A 3THPA 2J1EA 2LROA 4Q1PA 3ZXEA 1QQP3 1LB2A 1H0BA 2PTMA 3NL1A 4B29A 2PYTA 2ZTNA 3BCWA 4LO7A 4O9EA 3WV6A 4YNIA 2KR2A 3ZYIB 2VGDA 5BNPC 5KR7A 3MW2A 4JGYB 1KDKA 2QQWA 3AXDA 4Q8LA 1VBB2 1UY4A 1R091 3ROUA 2XUMA 1I5PA 3DF0A 2PAKA 3KT7A 4F3JA 1QHDA 1LECA 1J59A 2NQYA 4Y1XA 1UZZA 4P9LA 1DLLA 1RXGA 1GWLA 1CAUB 2ZPXA 1UN1A 1ULOA 4MGIE 5E16A 1GV9A 3PJQA 2FD8A 5LBEA 3B3QE 1XBFA 1NLRA 5L36A 5FXVA 4M3CF 2ZGLA 4FXGB 1VAKA 3POIA 2ARXA 2HWE2 2VW0A 3AZYA 4KG8A 4QKBA 5BY5A 3N36A 3R4DB 4W65A 4WVWA 5IVYA 2QQUA 4CDXB 3ZMNA 1EPWA 1RUI2 1TME3 3FFZA 4XTPA 5FYHA 1LGBA 4AI3A 3WNXA 1VBC1 5K4LA 5T50A 1DZTA 2ORXA 3HBZA 5HCHA 3USSA 2EXIA 5CVRA 3WNNA 3J7MA 2XLGA 4Y3OA 3K4ZA 4EQVA 4AEDA 4QPGB 2FDJA 3MEPA 3CBNA 2GNTA 3OUIA 4RR3B 1G7YA 2DVGA 4PBPA 3ZFGB 2V5YA 1D0HA 3AZXA 1WBLA 2BBAA 3VHRA 3C7OA 4LA3A 3BODA 3A0NA 4WVMA 4GB31 3Q9OA 3AB0A 1HB3A 4CEWC 1FNZA 1SLLA 3HVDA 3OGVA 1NZIA 2WINB 3CJIC 2QQLA 2VZOA 5J3UA 4TXWA 1W9SA 2W52A 1XXNA 3VUOA 3UETA 1QQP2 1W0NA 3BTXA 2Y64A 2A75A 3MFAA 2CYFA 1KJLA 4ATFA 2W46A 1EUTA 2VOWA 2WNVC 3LPGA 1S1AA 3C7HA 2EAAA 3O0XA 4FFHA 4XFGA 2WRAA 4QKNA 2R042 4S2HA 5LBBA 1X7NA 1SLTA 2E63A 2WO3A 5C3RA 1EPZA 5DZEA 1OLQA 3S7IA 3WDUA 3MIEA 4AI9A 2ZX1A 5C3OA 5JSOA 3H3LA 3PDQA 4RS5B 4LKEA 3RI8A 4YZ4A 1SLIA 5FZ1A 1H9WA 3JB8A 3POYA 1XE8A 1ZBE2 4JAAA 4KG0A 3RYKA 2QE3A 2UWBA 5LBCA 3VZLA 2Q1MA 2VXRA 1N47A 1C3HA 3U75A 1CIWA 4Q27A 5CFDC 3KVBA 5EHDA 4F7ZA 3MICA 3N9QA 1FPN1 3I2GA 2LS6A 3BYWA 3PUAA 1LTEA 2GZWA 1W06A 2CAUA 4G3YC 4RHV1 4AXOA 1JOPA 4XF1A 4A45A 4FXKB 4OUSA 2OQ6A 1TME2 2VMDA 2NM1A 1SPPA 1O3QA 2WN3A 3DL3A 1BK1A 2QBXA 1PMHX 2DBNA 5I8YA 5BNOA 3IDEA 3PIGA 2ZGTA 3DUIA 1AR63 1ENRA 4AGVA 2QQMA 4QHBA 4A41A 1PM4A 1QJEA 1D7PM 4IXLA 2Y6FA 5A7SA 5FOJB 1XE0A 2AGSA 3TEZA 5F3EA 4XEZA 2IXLA 1PX3A 2Q1ZB 2VXJA 4CXWA 5A7QA 5J37A 3ZSEA 3UKTA 3VBOC 1IKQA 2DU1A 2PQQA 2JE9A 2VMFA 2WZR1 1GFF2 1ST8A 3I2FA 5IVCA 2GMPA 1FAYA 2OUJA 3VDDB 4DUVA 5H9SA 1CZTA 3OGRA 3PU3A 4NIIA 2PHXA 4MVTA 3ATGA 3NJZA 5A7WB 1VBD3 1W05A 4MGSA 5I0UA 1VIWB 1YQ6A 1CX1A 5FV3A 1ZREA 2EIGA 2A73B 2XJPA 5JOXA 3GNEA 2PHLA 1BK0A 3WF2A 4ZY9A 3V0AA 5JXGA 4LKDA 2IFWA 4PJYA 3KCCA 5FUPA 5CB7A 4C1WA 1HQWA 3VBRA 2QDNA 2CGNA 3BALA 1VB4A 1S0BA 2MEV3 1D4M1 1WLTA 5FP8A 3HIFA 4AEDC 4BIFA 5C8CA 4IEPA 2OUHA 4BQ1A 1QJY1 2Z2SB 3U4XA 4NVPA 2XG3A 1RUJ1 5FPLA 1CIYA 1OI6A 2QQNA 4I3PA 5E1RA 1XNTA 2Y8KA 2VUCA 4CYDA 1VB2A 4XQWA 3A21A 1AXKA 2CDPA 4UI9L 2D3SA 3OCPA 5SV5A 1DG6A 2PELA 4BZ4A 4M4RA 1KGYA 1F2NA 3I7DA 4NHMA 4E9KA 3WY6A 2E51A 4FI9A 3WQ0A 4DXTA 1AXZA 3OD4A 3AMQA 5C4WB 5T5OA 3AZWA 1JHJA 2VOKA 2WO1A 2JG9B 5JR2A 3SHRA 4FAHA 1ACCA 1D0GA 1R64A 3J4UH 1FX5A 5A6QA 2YBPA 5DG1A 2X5IB 2OA2A 3LSDA 5FTTC 4Z92B 3U10A 1NCRA 4F83A 3PVNA 1NA1C 3WLUA 4AI0A 3EQEA 3PVBB 1UKRA 4XF3A 2ILMA 2W1SA 5LA2A 4D69A 4EN0A 4JZRA 1VRBA 1NXMA 5A33B 4HK9A 4NROA 1UIJA 2NLRA 2ZABA 4D6QA 1URXA 4LE4A 3VZJA 3GYDA 4PIXA 3A7QA 3OSDA 2MPFA 2AR6A 3AK0A 2LALA 1VBD2 4HKWA 1AX1A 3DV8A 4D7SA 1TNRA 5FCCA 3JQWA 4OCTA 3EHKA 5FDBA 4PT6A 2ARBA 3UKVA 4XFBA 4XXAA 2Y6LA 3BI3A 3WNPA 4GWJA 2AEZA 4AE2A 5FQ0A 3U07A 3P3PA 1W99A 5FKBA 2UURA 3MDPA 3WF4A 3POFA 1X9PA 2XHKA 2I74A 2MEV2 2UU8A 5F5AA 4AVAA 3JCIA 4QX1A 5FO9B 1XU2A 3U1XA 4R4XA 2IVIB 2C0ZA 3NMBA 5HI0A 3ZFFA 4I02A 4J1WA 3VN4A 3E6CC 3RI9A 4DXRA 1UZVA 2BDRA 5JR7B 3ZFEC 1F4HA 5FO8B 2WSUA 3DCQA 3ALQA 3OEAA 4LHSA 1VBB1 3AZZA 4GMP0 1O7FA 5FZLA 3SXWA 4XJWA 3DPRA 2IC1A 2ZGNA 1J83A 4M00A 1H8TB 1D2QA 4MXWA 1JOBA 1JYVA 3I59B 3LCPA 4CCJA 4CPBA 1W0PA 4HT1T 4MZUA 3AKRA 2D98A 4CCMA 2YPDA 4BXSV 1GP6A 4IV1B 4AFDA 3VBRC 5FZFA 2HWE1 4Z8BA 2HWC3 5BYNA 1HLCA 2W95A 1PK6C 3GBGA 4JTOA 2Z69A 4CCEA 4IDZA 4A6OA 1OHFA 3CDZB 1P8JA 4LJHA 4UFHA 3VKMA 5FZOA 3ETPA 1RUI1 3H1YA 1H1AA 2BBVA 5GJ6A 4AW7A 4IE4A 4AAXA 4GH4C 5FZ9A 1V0AA 4CDQB 1VLNA 1HW5A 2DCKA 4CUAA 1Y9MA 1XYNA 2PHFA 3A22A 4N90A 4E8CA 2WWUA 3H0OA 5BNNA 1WCKA 2AZ5A 4LKFA 4XF4A 4DPNA 3MIFA 4Y33A 1LKNA 1H4HA 4HFSA 1MZEA 4WM8A 5CNAA 1OF4A 1LOAA 4KL1A 2OT7A 2W68A 5LRSA 1OD3A 4L2NA 3H3UA 2V4VA 1VMHA 2E7QA 3MV01 2BVVA 2C24A 4B7EA 2BOIA 1ASJ3 4AQTA 3L9JT 4YRDA 1W6NA 4BU2A 3LF7A 5IHRA 4FVVA 2JIJA 1WCDJ 2NP0A 2J1TA 2KXLA 3K77A 4A7YA 1F4AA 1R093 2Q8OA 4Z2AA 1UU4A 1NCRC 1POQA 1TE1B 1OH4A 2RM23 3PUQA 5E6HA 3OOXA 4N8MA 2WNUA 3CJXA 5F6LB 1LHOA 4ZHNA 1GICA 3DGTA 2GMEA 1SDDB 2EAKA 4AR2A 2R041 3TYJA 3SCFA 4YW6A 3J26N 1GYKA 1JUHA 2W91A 3AP4A 3FC0A 4QX8A 1W2AX 1QOSA 3HNBM 5E8AA 4IL7A 3WW2A 5BNPB 1W8ZA 3VKNA 2ZACA 4U36A 5LZ6A 3RJ2X 2DUOA 4CUGA 4HPKA 1UCXA 3B7MA 2FZ2A 2HWD3 5CKQA 2C1FA 1SBDA 3K48A 1YFUA 4XZPA 4HVRA 4YM2A 2VJXA 2XVLA 3ZX7A 3O1OA 2ARCA 1UY3A 2VTFA 2ENRA 1ZBE1 3PVEA 2BW8A 3WNKA 2ZKNA 3OBRA 1BMV2 5FXZA 1ZZBA 1GZ9A 2DVFA 1YQCA 4FP2A 4DO0A 2X29A 4CP9B 1FT9A 1YCIA 2HWC2 3HNMA 3KZ4C 5JZGA 3LIGA 3VKLA 2XJUA 1JMUB 3O1SA 1V6IA 3ETQA 3IIIA 4JDNA 4RR3C 4X8PA 4EE2A 5IATA 4YSFA 3I2JA 3T2OA 1Q43A 1N1YA 1PMJX 4RYDA 3B02A 1TME1 2IZWA 2R32A 1E5IA 3RNSA 2QCSB 1S0CA 4CDWA 2DFCA 1HQLA 2I2SA 4QM8A 3PUSA 5CISA 3U78A 1Q56A 4HKOA 1WZXA 3DPRC 2B4KA 2B39A 3WDYA 1H1MA 3OY8B 2R073 4K1ZA 2BGPA 3TEXA 1N3QA 2XQXA 2WUHA 5FXXA 4ZXKA 5I0RA 4UT5A 1ASJ2 2WWSA 5FZ3A 4DMIA 2PAEA 1E57A 1QWRA 3OJBA 4JTNA 1OUSA 4N43A 4XDPA 5FZ0A 4QDSA 1R092 1DQ6A 4QQOA 3CJIB 3OD0A 2RM22 5KWRA 2VZ3A 5A7NA 2PHWA 2YB7A 3WNLA 4Z1VA 2R0HA 2YU2A 1WD4A 2XKPA 4NRMA 3N9LA 1R1A3 1Q3EA 2HEVF 4XURA 2BWCA 2WNVB 1J3QA 4AHXA 4I0WB 5CU1A 1YQ5A 3LPFA 5F8PA 1E5SA 5BPXA 1NAEA 2ZHKA 4PBOA 4XQDA 4HVQA 5BNNC 1CAVA 4LBQA 1EUUA 3WR0A 4A3XA 4QGLA 1BVP1 2ZMKA 3G6JB 1W3VA 2HWD2 4NWWA 4P9IA 2ZHNA 4RHV3 3WW1A 3U4SA 5GZEA 4NHXA 3AYCA 1I6XA 2BRTA 1OFNA 4QGMA 4UFKA 3S30A 4LUKA 3VD4A 3S57A 1CJPA 2QQKA 5GLTA 3VD5A 4QD2A 4PLNA 2ZEZA 2DVAA 1R083 4HSJA 4QPIA 2XBO2 5FLIA 3SH3A 1UQXA 3H3ZA 1BYHA 1LCLA 3ZN6A 4LKSA 2PA7A 1BJQA 1JXNA 2QKDA 4CU6A 3LA2A 1MZFA 3O0VA 4LHNA 2ZXQA 5CFDB 4GAZA 4E4ZA 2JD4A 3S5QA 1QMJA 4O9GA 4SLIA 1HDKA 1CAWA 3KF3A 5FBZA 2R0FA 2B42B 4PF5A 2A6WA 4IGOA 3R4UA 2VNOA 2IVJA 1CQ9A 4OHXA 5M0TA 2A3YA 3IT8A 1LOGA 1S55A 1C1FA 2DTYA 2P3IA 1FV3A 1CPNA 4COWA 5CIRA 3HN3A 4FP3A 3UKNA 4LNVA 4H14A 4BLJA 1WCUA 4XVHA 5LB6A 4HMZA 1LENA 3POBA 5CEHA 2JWPA 2VZRA 1OQ1A 2R072 4NHLA 3WCRA 5IVEA 4BQ5A 3D8CA 1DGWA 4YZ1A 4UF0A 3TEYA 4YVWA 2R1BA 3WZ1A 2R7EB 4ASMB 2XVGA 1OVPA 3ZSLA 3OGGA 4LO4B 1WA4A 4DNYA 4Q0UA 5JZGC 1K5JA 2ZX3A 1J3PA 2E31A 3HT2A 3MW3A 4META 3ZXDA 4QX2A 2YROA 2F17A 5D2AA 2WN2A 1R1A2 3NV4A 3P5BA 5FZIA 1UAIA 3U37A 3NJYA 5DMYA 5JIUA 2G9GA 1KS4A 3H7YA 4OI0A 1HB1A 1B35C 5FY8A 4OHZA 3FN9A 1AHSA 3JZVA 2IWGB 1LHNA 2CDOA 2GNDA 2MEV1 4N53A 4BIOA 3OG2A 5F7UA 2VD7A 4RHV2 1WUVA 2VVDA 1VJ2A 4Q5OA 1UMZA 3IZOA 5LASA 4AEDB 2W0XA 2VECA 1O4ZA 2ZGRA 1SFYA 1EAH1 2DCYA 2J1SA 5T5JA 1R082 2ERFA 2PLV3 3LDKA 1UD1A 1ZZ9A 4KGQA 4Q4W3 1VRH3 4N43C 1VPHA 2D3PA 3ZPYA 1N3PA 2FCVA 4NIAA 1U12A 5EP9A 1UWWA 4FFIA 3VLBB 3WNOA 5A3UA 3B9IA 1Q8VA 1V6OA 4Y5SA 5KC6A 3GJAA 5I0DA 4OHYA 3IWZA 2EIDA 2XUEA 4RD7A 3SH5A 3AMMA 5DPNA 2VZUA 4HSLA 5CYYA 3VBHA 3GDBA 1XPWA 4FPFA 3VDCA 5KXEA 3AKTA 1IG3A 1ZVFA 3HPNA 3IDCB 5DDJ3 2Y33A 4AI2A 3VDBA 5IK7A 3VD7A 1NA1B 4LBNA 1CJDA 4YM0A 5FY4A 1NQJA 1E5RA 3T09A 3WCSA 4P9XA 1T6BX 1IS5A 1QJU3 2OS2A 2YV8A 3L2HA 2P34A 3OEBA 4Q29A 5IFTA 1YQ2A 1JBCA 5FZ4A 2B8MA 3CL1A 3LOBA 3SNMA 5FLJA 1COV3 2Z5WA 5L7OA 1LESA 1YNAA 4JDOA 4KGGA 3NNJA 1CD3G 1MS4A 3AKPA 5IUQA 5C7GA 1ZZ6A 2B46X 1FNYA 1QJFA 4AGRA 5J96B 4KWUA 3I2DA 3MFCA 5A3MA 3S0MA 3H8OA 5J36A 1RB8G 4M3CA 2BFUL 4OI4A 2RR13 4I30A 5DAPA 4DRVA 2HBUA 4Y1VA 4ARXA 1RYYA 2K0GA 3JB4C 3NWKA 3CEWA 3I2HA 4ZZ8A 1OLRA 4DOUA 4FTBA 1TEIA 1H8TC 3TRSB 3CZJA 2GP5A 3SH4A 2BUKA 3ZVXA 2J22A 1AX2A 1H1IA 3RVHA 2YZ4A 4YG6A 3K51A 2HH9A 2PLV2 5J7MA 4YVWC 1RUH2 2JG8A 4QB1A 4BM8A 1DYOA 4Q4W2 1AJKA 1VRH2 2YYOA 3ZXAC 3ZFEB 2VE1A 3ZSKA 2Q1FA 3O1MA 2CSGA 1PHMA 3M3IA 4Q0PA 1I1EA 1E5HA 4ZS3A 3WDWA 4IEZA 4FPKA 2B9UA 1H2MA 4FPHA 2C5DA 1AXYA 2ADEA 3GHNA 3L2YA 4AQ6A 2D97A 1SDWA 4QDQA 4AI1A 2FMDA 3RS6A 4MUVA 1G9BA 2FDKA 3B01A 5FMCA 1BMV1 2IXCA 1Q8QA 4NPMA 5GM0A 1O3RA 4BISA 3POSA 2VOVA 3INAA 3MF6A 5FMBA 3V0AB 1QEXA 1UKGA 3CMGA 3GGLA 2HWC1 2DDUA 1OXCA 3E97A 3N7KA 5ANNA 3UGFA 2UYAA 3POWA 1REFA 3J7HA 4QPYA 5DDJ2 3VBRB 2BGOA 1ODMA 5C3QA 2V72A 3KGLA 4ZPIA 5EZWA 5A1AA 4KQ7A 4DUWA 4Q0SA 3T3YA 4C8DA 1TVGA 1MQTA 5A32A 4PHZA 2R1DA 2YFZA 3ABZA 4NE9A 4MSVA 3WDXA 1QJU2 3WDVA 3KS7A 3RMXA 5JSPA 2WA4A 1ZYBA 2JB8A 4K9SA 1Y9GA 3AKSA 1W6PA 2P3JA 1COV2 2ZS6B 4IGPA 5CFCA 5JVVA 1YHFA 2X05A 3VBFC 5FWEA 2ZX4A 2VOTA 3GBFA 4UW5A 3FWEA 3O1UA 3ST7A 5L19A 2QQJA 5DAQA 4XF9A 4J6GA 4K3UA 2DBIA 1I9RA 2RR12 3W59A 2VMIA 2ZEXA 1ASJ1 2P6HA 2R043 4DQAA 4OUEA 5ABJC 3EB7A 3PUIA 2PHTA 3AL5A 5FLHA 2XDVA 3VBHC 4EV0A 4QXCA 4CU8A 1A8MA 1VBE2 4LT5A 1MPXA 1UL9A 1NLSA 3D0JA 1DU3D 4K7JA 4Q4Y3 3SISA 3VV1A 1I5ZA 2RM21 5IT6A 3O1VA 2ZAHA 1LR5A 3GZAA 1HV0A 1O4YA 1NCRB 3CQOA 3MHZA 4XDQA 4FPYA 3RZLA 1V6LA 4UW6A 4LUMA 5HXVA 2YXSA 1KXGA 1DBNA 3MF9A 4B4RA 1O4TA 5FYIA 4GWMA 1MS8A 1PIV3 1ZBE3 4Q26A 1LGNA 3JBG2 2VC9A 3O0WA 4COUA 4E2SA 3ZR6A 4YW7A 4FT8A 3ZYGA 2QZ3A 2W47A 1RMU3 2R30A 5L7OC 1QGLA 3ZXKA 5LA1A 1AR73 2HWD1 5FYVA 3ZYPA 1HB4A 4PF1A 4G4FA 2XONA 1XYPA 4LK7A 5F2WA 1G6NA 1S0EA 2DFBA 5AVAA 3UGHA 4XHXA 3UJQA 1TQ5A 4YM1A 1SFNA 1MVEA 2XBO1 4DINB 4IE7A 5FQ0B 5CKMA 4AEJA 2ZHLA 3C2UA 4KNCA 1BLZA 3P1IA 3CZUA 4FBFA 4UOJA 4C0HA 2D5HA 4IW3A 3OBZA 5SV8A 3M4FA 3URFA 4CXYA 3UYJA 3E6DA 3MIDA 4QQLA 5FYYA 1YJLA 3ZFFB 2ADDA 2JG8C 1S2BA 2D6KA 2VL4A 3FE5A 4GA9A 5EV7A 2BNOA 1LEMA 4QKDA 4Y24A 4AQSA 4W8JA 2G19A 3I54A 1JZ8A 3O7OA 2K9ZA 3OYWA 2DVBA 4V1PA 1FXZA 4H3WA 5HV0A
chains in the Genus database with same CATH topology
4N7UA 4XILA 3DPRB 1WW4A 4XBNA 4YFWA 1DHKB 2R071 4W6XA 1ZZCA 4MXWB 3ZXLA 4FQZA 4I0BA 2H6BA 2A71A 4B7KA 4MX3A 5LEKA 5K0UC 1CESA 4YW3A 5I8SA 5LEJA 4NHKA 4Q4Y2 4CTEA 4XFAA 3VL8A 3M8LA 1PZ9A 3LB9A 1SLCA 4YGCA 5DZGA 1R1A1 1RUC2 5BXXA 3GZTB 3H1WA 3N3HA 4PIZA 1PIV2 1LGCA 2BTVC 1DYKA 1IPKA 1DZQA 4R52A 5CG9A 1RIRA 1BBT2 1RMU2 4RSUA 5BNNB 5AFBA 5JMCA 1AR72 1F8VA 4YG0A 2WQ4A 1FATA 1IOAA 1LOFA 1MS3A 4XJ9A 3QLQA 2DVDA 1HXS3 4I01A 3AMHA 5C9AA 2H6CA 1MR5A 3WQ1A 4FSJA 1R081 2ZGPA 5CA6A 3USUA 3SMHA 2HWF3 1W6NB 3R6SA 4I0AA 4N7IA 1OA4A 3OBTA 3E5UA 3ZXFA 2FBEA 3ELNA 5T3NA 3AYAA 1DQ0A 1HX6A 5C6CA 2YMZA 4LBKA 4XJAA 3AP7A 2XJVA 4R9BA 1UPSA 4XJUA 3M3OA 4FPGA 3EJKA 1XU1A 3FJSA 4Z2WA 3RSJA 1O91A 5I0TA 1T6GC 1ULFA 3IIAA 4HPKB 1ULCA 4LHLA 2W39A 4XFIA 3FBMA 3WW3A 5FPZA 3RRDA 1YXWA 3ME2A 4XTMA 1QOOA 4KU7A 4QQHA 1OFSA 1REDA 1QNYA 1YJKA 3R0RA 4AEMA 5JZGB 3TB0A 5JIAA 5T5LA 1DIWA 2D7FA 4XHBA 4AEKA 4ISRA 3MIBA 1YRZA 2ZZJA 1H30A 5K9YA 1EAH3 1YI9A 5C8WA 2GSYA 1SLBA 4IEYA 4QQPA 2QQPA 1J1TA 1B35B 3AP5A 3IDBB 2JJ6A 2WFPA 4PCRA 4ES8A 4R9CA 1S0DA 3B5LB 4C91A 4MYEA 1HXS2 5EYXA 1O5LA 4FTEA 2PLV1 1RC6A 1RUH1 3KB5A 2ZX0A 3TNPB 5I8TA 2HWF2 2JICA 1VRH1 2KM2A 3B69A 4Q4W1 5FMOL 4OHVA 2QJVA 2XJSA 1GSLA 2GNBA 4YM3A 4N43B 4WM7A 1VALA 1SBEA 4BYYA 4Q1RA 4YVSA 1BKZA 1DFQA 3KGZA 3U0ZA 4ISQA 4LLOA 4AVVA 1YI7A 1BEV3 1MS0A 2WLPA 1CAVB 1NG0A 4NO4A 2GMMA 3BPZA 4Z82A 4PDWA 1X36A 2PHUA 5JI9A 1LOFC 2YY1A 5DDJ1 1W6QA 3ILNA 3M2MA 2DCTA 2VQ0A 4U2AA 3MLLA 5GLZA 2IXJA 4FPLA 3IM0A 4URTA 1QJU1 1HRI3 2E53A 5BNOC 4P5HA 3UL2A 2FQPA 4YG3A 1COV1 4FCAA 1YUDA 1BCXA 1VAVA 2BQPA 4DB5A 4UBHA 4TZDA 2P37A 3VBSA 2DCZA 2H0BA 2SBAA 3EBRA 3QD6A 3IKWA 1EAH2 1F31A 2RR11 2Y0IA 4L9BA 4B8EA 1SMVA 3ILFA 4MV2A 1CPMA 4XW3A 5F6KA 3TNQA 5KBFA 2XLAA 4CDXA 1AL21 1MZ6A 1H2LA 4MLOA 1A8DA 1VBE1 1GNZA 2BYVE 5HCBA 1YFXA 5JOWA 2WSVA 5J98B 4COYA 3M70A 2I45A 3CNAA 2FZ1A 4QPGA 4MH0E 3G7DA 4YVWB 1OQDA 3JBG1 1C8M3 3ZFGA 3LZZA 4XETA 5EYYA 1ZZ8A 1X8EA 3JQXA 2HYKA 1PVXA 4RQPA 1GZWB 2CTVA 4L92A 3ASIA 5C8CC 1F9KA 2YC0A 1QXPA 4COVA 1OOPA 1ULEA 1R1ZA 4RGAA 3FLPA 3JD73 5D8AA 2D6LX 2JDZA 2WLQA 4QT6A 1BEV2 5FOBB 3X29B 4AWDA 1AR83 3E5XA 4DRRA 4Y1ZA 2EALA 3KD4A 5LK5A 2ET7A 4RGGA 2VVFA 1ENXA 3FFQA 4OVEA 4JCKA 5KC5A 1HRI2 4RS5A 1N1SA 2BVBA 2ZA9A 3O12A 3QH7A 1DYPA 1UU6A 2WT1A 4JRAA 1GZCA 5JSRA 4G9SB 4WV8A 2ZMNA 2GH8A 4YVSC 1WLWA 3N7LA 1SCRA 1VBA3 3VBFB 1V9U3 2G9FA 2GDFA 1S2KA 1QJX3 5FRAA 2ZMLA 4BPZA 4QMAA 5CG8A 4E4DX 5B2GB 3ZYJB 1K5MA 1RTVA 1Z0HA 4DXZA 5ABJB 3GHMA 3GALA 3VBHB 1UW8A 3D5OA 1PVC3 4Q4Y1 4PDWC 1AYM3 2D44A 2BEOA 3WD5A 4JGZA 4MXVA 1PM7A 4AFAA 2ZZQA 1RUC1 3WXPA 1LU1A 4XJ8A 4ATEA 3NAPA 3HAGA 4RL7A 1PIV1 4CP1A 1C8M2 1SLAA 3ZMOA 4IERA 4K6BA 3FLRA 4OULA 2XBO3 3IBMA 2XH6A 2VNRA 1BBT1 1RMU1 4Q4X3 3IMNA 2ZGMA 3TAYA 1AR71 1QH7A 3VDDA 5L7OB 1QU0A 1IPJA 3VBSC 3ZFFC 1W0OA 3JD72 1JH5A 4M3CB 4FOWA 1OA2A 5GALA 1AR82 2VOXA 5H9RA 1ULGA 3AFKA 4Y22B 4YYOA 1GQGA 1NCQA 2BNNA 5DUUA 1QF3A 4MGKE 4Q8KA 2JG8B 5H9QA 3B9CA 3ILRA 1PO23 4TYSA 4Y1YA 5GLVA 4YGDA 4PLOA 4RQPC 3D4KA 1GBGA 2B45X 4XOGA 1VBA2 1V9U2 1S0GA 4ONUA 4HETA 1QJX2 1VAMA 4LR4A 2VG9A 1EV13 1LOCA 4RFT0 5F9TA 3FBYA 3J8F3 5GLUA 5D8AC 1C28A 1BZWA 1W6MB 5FREA 1GKBA 4IEXA 5DG2A 2ZJCA 3MLJA 1PVC2 1S0FA 2V73A 4KWJA 5JAXA 1AYM2 5K0UB 2UWCA 3AXEA 3HT1A 2ZKLA 5C4WA 3WQ7A 3MZHA 2RHPA 4EJRA 1CONA 4WM8C 1BQPA 1OD5A 2XJTA 3WP3A 3OGJA 4FPOB 3RDIA 1LEDA 4DFSA 2EXHA 1SEFA 5A32B 3LSEA 3VBUA 4P9YA 3EXUA 2SLIA 3KT4A 5KXCA 1QDCA 1PGW2 1UU5A 1XYOA 4L11A 4Q4X2 5GZDA 3I4IA 5A33A 4GQ7A 1W6PB 4NN0A 3KMHA 2GN7A 2WNUC 4ES9A 1HXS1 3H9AA 4QQ2A 1RUOA 1C57A 1F5JA 1FV2A 5FPXA 3QACA 4HLTA 1ONAA 1K5MC 2HWF1 3WP5A 4Y20A 3VKOA 1O3TA 4JGZC 1HRV1 2A6XA 1MVQA 1RUD2 4XFCA 4GALA 1SQ4A 4AVBA 4XMIA 1JUIA 2RS11 4N9IA 5LRRA 4FPJA 1YIFA 3NAPC 1ZRRA 3CLPA 4X6RB 1QOTA 4I3GA 2YPJA 1PO22 1WLDA 1AVBA 5LK7B 1PZ8A 3N7JA 4Y1UA 2JENA 1G86A 2WIIB 5I0SA 1XNDA 1NQDA 2LM3A 2WS93 3FZ3A 3MIHA 2KA3A 2XLFA 3IPVA 4GKXA 1EV12 4Y5Z0 3J8F2 3R05A 4OUMA 3FLTA 1MS9A 4CDWC 1NZCA 1OKQA 3I59A 1V00A 1GLHA 1NXD1 4PLMA 1ZA4A 4OZXA 2FMYA 3P3NA 2CGOA 1YWKA 3NKGA 1NCQC 4XBQA 5K8SA 1CR7A 2TUNA 4XFHA 2VMHA 3H8UA 3WUDA 1WD3A 1WGPA 1RUH3 2XL7A 1IQAA 2GALA 2DF7A 3HR9A 3E5QA 4WVMB 3ZXJA 4GWNA 5IK5A 1RUF3 1SBFA 2UY9A 3T1MA 4M01A 4CDQA 2UY8A 4AVCA 4P9JA 2CAVA 3D0SA 3PMSA 2DWRA 1WW5A 3W58A 4ITCA 4BA6A 4OLLA 4AVTA 4NR1A 3O14A 2P3KA 1Z7S3 4COZA 1CN1A 5JWPA 3M3EA 2OYZA 3JU9A 1CAXA 1VP6A 2ZBJA 1LJ7A 1PO12 2D93A 4M0HA 1A6CA 3VBUC 2D5FA 2V09A 4QPIC 2QZ2A 1BEV1 1SACA 3T2TA 4Z07A 4EWEA 3WUCA 2WL1A 2WS92 3HQXA 2A3WA 2PN5A 2XKOA 2HEWF 3LA3A 1IGOA 1EP0A 1HRI1 2BFUS 5J48A 4YZ5A 2GH2A 5BNOB 2CGPA 1QNWA 4XIOA 1AL23 3BU7A 1VBE3 2O0OA 1XNCA 1GANA 3APBA 2DCJA 4FOVA 2QVSB 5JDBA 1DQ2A 2Q0AA 4YARA 1U5YA 4LTAA 4E27A 4R8HA 3WT3A 3BTAA 2JKBA 1ZRFA 1RUF2 1MEC3 3M3CA 3JBG3 3PNAA 2NMOA 4QGNA 3LKJA 5GLWA 2D6NA 4E2GA 3VHPA 4WVVA 1DF0A 3WG1A 4EWAA 3QH6A 1PMIA 1HKDA 1RITA 4LBJA 2PHRA 3RJRA 2FHRA 2B7YA 2E7AA 3NVCA 4K1YA 1C8M1 2WA3A 5I93A 1Z7S2 1WMDA 5BNQA 4N53C 4EN7B 2BPA2 3RYPA 3KT1A 4CEWA 1HIXA 2ATFA 4D3WA 2QFEA 5C8CB 3MYXA 2VVEA 5KHJA 3VGIA 3JD71 4HN1A 2RS32 4XPVA 1Y9QA 4AG4A 2XJQA 2WZPP 2ZGUA 1AR81 2BGCA 1NY72 2WNVA 3MW4A 3PJYA 1ZBA3 2F6BA 2JECA 2O1QA 3ENRA 2A5ZA 2LTNA 1B09A 2X8KA 4Y26A 2UYBA 1N1TA 1RHI2 4AHYA 4XQ4A 1W39A 3D82A 3MIGA 1AL22 2DUQA 1H4GA 4WM7B 1RJ7A 4ASLA 1Q8SA 2EXJA 1VBA1 3AYDA 4P14A 4YVSB 1V9U1 2A7AA 1DGLA 4JV4A 1QJX1 1KDMA 4CP2A 1NOVA 1RUC3 4GKYA 2JX9A 4N9HA 2AYHA 3HN1A 4A7KA 5GZGA 1LOEA 1RJ8A 4LE3A 5JPMB 1MEC2 1PVC1 1C4RA 2DU0A 1AYM1 5T55A 1BBT3 5EFUA 4PDWB 2NN8A 4YFZA 4FAGA 2XPJA 3AKQA 1W6QB 1KS5A 3FUOA 1I3HA 2VW1A 5EXOA 3AJYA 4IETA 4KWLA 4E2QA 4IEVA 5A3LA 5TSWA 1XNKA 1X8MA 1FOD1 2VUJA 1PGW1 4QXKA 3WVJA 4M0NA 4Q4X1 3VBOA 4PQ9A 1TMF3 1W6OA 3WP4A 4BMEA 1RUE3 5ACA3 3ZXGA 1WLCA 2OVUA 3AJZA 3VBSB 5T54A 2ETEA 1KFUL 4OFGA 2K2SA 1A78A 3LAGA 2MNGA 1AZDA 3M3QA 2TEPA 1NYWA 4MGZE 1ZBA2 4SBVA 2QUOA 5EWSA 1RUD1 1Y3TA 1N1VA 1OPOA 2WJSA 4JC1A 2CY6A 5DUVA 2DUPA 1VR3A 4D7TA 1PO21 2CNAA 3A0KA 4XBLA 3OF1A 4OHWA 2AUYA 2WKKA 3HMYA 4RQPB 2WT2A 5CADA 1KQRA 3WINE 4TWTA 1EV11 3ZIWA 3OTFA 3J8F1 1MQTC 1OOPB 4A7ZA 5D8AB 2IFRA 1WBFA 1V6JA 3V65A 5F5QA 4YW2A 4JQRA 3RG0A 1FMD3 3H50A 1UZYA 5CFCC 1WMEA 3QCWA 4OI2A 3H7JA 4XIKA 4LLFA 4LBMA 4IEWA 3W9AA 5C33A 3V0BA 2YGLA 5AVPA 4WM8B 3SITA 4ZU5A 1LHUA 2CWSA 5D1IA 2EVXA 1NA1A 2WNEA 3LOIA 5DXDA 1UIKA 2NZ9A 3O5SA 2VMGA 1TMF2 2B5HA 2D6MA 1RUE2 1LHVA 1HRV3 5ACA2 4LBOA 4BHPA 2GNMA 4EROA 2WNUB 1G8WA 2Q30A 1OSGA 4IEOA 1C8NA 2RS13 3E6BA 1QY4A 3AX4A 1WCSA 5GZFA 3ES4A 1K5MB 3WG4A 4W6WA 2ZAAA 2RJLA 4AK3A 2N7GA 2DYCA 2NYYA 3WG3A 2WFF3 3B94A 1X82A 4JGZB 1MACA 4RA0A 4JDMA 1PO11 1UPIA 2O8QA 3NAPB 4YW4A 4IV3A 3CF6E 3ZN4A 5JOYA 3B00A 4B4PA 4HN0A 4IEUA 1KJRA 1QH6A 2VH9A 2WS91 4M3CE 4XMAA 3ZFEA 2R063 4IEQA 4FOYA 3UV9A 3WOGA 5BV6A 3RMYA 3ACLA 2RS53 4LO5B 4AVSA 1GQHA 5DUXA 4CEYA 3BOPA 1DQ1A 1ULDA 2D3RA 4CDWB 1FMD2 1ND3A 5FFOC 4C1XA 4HKLA 2D6PA 1REEA 4XYXA 2RE9A 3KM5A 4R4ZA 1NCQB 3TN93 3WG2A 4NOTA 5T52A 4CDUA 1ND2A 1PK6A 2I07B 3KCYA 4D94A 2YUEA 1RUF1 2DURA 4KH9A 5FMOS 1NE6A 1DQ5A 4JVAA 5AC93 1PZ7A 4H55A 1HRV2 4Q2FA 4GH4A 5JI7A 4E4SA 3PHMA 1WW7A 3NV1A 1UX6A 2QNKA 2RS12 4XF0A 1D4VB 2MHFA 2Q4SA 2BWAA 2XL9A 3S7EA 1IKPA 3ZN5A 4AI8A 1G9FA 2CWMA 4YW1A 1Z7S1 3EO6A 2A6ZA 4LBQB 1HV1A 1MS1A 3IN9A 5CBLA 3HD8B 2WFF2 3PVOA 4ZKTB 2P17A 4JGYA 1AR62 2JXAA 4GMP3 4TSVA 5C9AC 2RMU3 2VY0A 3S6PA 1GR3A 2RS31 3CU7A 3VBUB 1AYN3 1X50A 3N7MA 1F5FA 4QPIB 1CAUA 1NY71 1ZZ7A 2HWB1 2PAMA 3ZN6B 1J3RA 2WC2A 2ZHMA 3HWJA 2A70A 2R062 3RPQA 1J1LA 1RUG3 4KU8A 1CAWB 1AF9A 2RS52 4F8AA 1ZX5A 3NSTA 1Z78A 2VU9A 4B3NA 1QKQA 3DKWA 4IQPA 3UJOA 1YLLA 2AENA 3MGUA 1RHI1 3WHTA 4C90A 3AMPA 4Y20B 4EN9B 5IK4A 3LGRA 3MLKA 3FUQA 4LO6B 4Q4V3 3ZIXA 1JTZX 1WW6A 4X6QB 1C5IA 1S0IA 3M7AA 3TN92 1EY2A 4X8NA 1LULA 1LOBA 2TNFA 1Q8PA 3VKFC 4AHWA 2RJKA 1DGWX 1C5HA 4IV3C 1IHMA 4I09A 4RR3A 1MEC1 5FAXA 1IS4A 1LRHA 2AH2A 5AC92 4GXLA 2VW2A 5FO7B 2GC0A 2A6VA 3BIWE 3OPZA 1PNGA 1RUNA 1M4WA 4OI1A 1YIPA 4UW3A 3IPVB 1DGRN 4BWOA 1M06G 5DUWA 5I91A 1AR93 4CEYC 1RVF3 3NW4A 1TNFA 3AM2A 1ND3C 1IS3A 2VNGA 1NE4A 3THTA 1IS6A 3A4UA 4Q0VA 4D7YA 1D2SA 1POV3 4N53B 2RMU2 3MPPG 3SCHA 1FI2A 2GAUA 4KWKA 4L97A 4LBLA 4CDUC 3WHUA 1ND2C 5J09A 1AYN2 5KHHA 1JOJA 2YDEA 4L99A 4CZSA 4JRLA 3BOWA 3BB6A 1XQNA 4UXAA 1ZBA1 4WM7C 4PIYA 3FX3A 1JW6A 4CP0A 2F4PA 2NMNA 1CGPA 1RUG2 5K7PA 4QM9A 3KCXA 3GF6A 3VHOA 4ORFA 4LO8A 3WP6A 3WX5A 1UF2C 2VULA 1RL3A 2D40A 3WW4A 3NV3A 4Q4V2 1CAXB 4JGYC 3VZMA 5E89A 3ZO0B 3FMGA 4FTSA 2ZX2A 1O5UA 1QQP1 4BH9A 3C3VA 4YZ2A 3AMNA 1V6KA 1FOD3 4LA2A 2D6OX 2R6QA 5GKAC 2HEYF 2IXKA 3UK9A 1EYBA 1APNA 1H2KA 1POV0 2GC2A 3H1MA 3RZZA 5HCAA 4EN6B 4AFMA 2PFWA 1AR92 1J58A 1RVF2 4KBBA 2ET1A 1PNFA 3D6EA 1ENQA 4CDXC 3KLSA 2QDRA 3PMEA 2ZCWA 2XVKA 1TMF1 4AFCA 1RUE1 2GN3A 1VBC3 5ACA1 1RUD3 2VQAA 1S0JA 5JPNB 1PGL2 4S2DA 4R9AA 1LHWA 1QJZA 4QPGC 4ZU7A 2EXKA 3ZFGC 2DTWA 1DGRA 5GZCA 1Q8OA 5EJ3A 1H9PA 3V56A 4K20A 4GB33 5DZFA 1B35A 1OOPC 1AUYA 2IXIA 2E7TA 3VL9A 2D43A 3RYRA 1JYIA 1ZRCA 4AGGA 1A3KA 4EN8B 2WT0A 3SLIA 4C0BA 2Z79A 2CV6A 2JG9A 2OZ6A 4CEWB 2GU9A 2ZGSA 2Y26A 2WQZC 5JLVA 2X5IA 2ZGQA 2CL2A 3VZNA 4IESA 4UBGA 1MQTB 1U0AA 4RS5C 1CVNA 2LUWA 1FOD2 5KHGA 2BNMA 1FMD1 1L3JA 1HQNA 3PTYA 3CO2A 1V6MA 1JN2P 5CFCB 4DZGA 4NWVA 2X53S 1KITA 1FYUA 4AFBA 1FPN3 2G4IA 4J1XA 4YGEA 2YGMA 5CAZA 4WZCA 1JHNA 3JUUA 4LEJA 4YLZA 2JE7A 3R4SA 3KQRA 2TBVA 5KHKA 2Q5TA 4HK8A 1RINA 1VBC2 4GIQA 4HZFA 3QBQA 3SCGA 4UW4A 1LODA 4BCUA 3LWCA 3N35A 1OMIA 1PO13 5E88A 1CX4A 1YYNA 3WDTA 3MI8A 1SCSA 2E9QA 1Q5OA 3T1LA 4R9DA 5F1RA 2OPKA 4HVOA 1ZM1A 3ZDSA 3ZSMA 3VDDC 2WFF1 2WZR3 4GB32 1MS5A 1AR61 5KXDA 3U11A 2OW4A 4WZFA 4LHKA 3VHNA 2GC1A 4FOQA 4FPEA 4WBBA 1OA3A 1H8TA 1OPMA 3GBWA 2C9AA 1U5IA 4L8QA 1DQ4A 2VUAA 4S2FA 3VBOB 4P9WA 1ALYA 2R061 1W6OB 2R49A 1ZRDA 2XJRA 4B4QA 4IV1A 4S2GA 3TWIA 3AP6A 1GZWA 1VBD1 2RS51 1JYCA 4GULA 3AZVA 3M1HA 4MGYE 1D4M3 4BE3A 1QJY3 4FPCA 1MZ5A 2HJIA 2NPIA 1RUJ3 2Z42A 3DN7A 3OYWB 1G9CA 2ZOEB 5BUVA 4K40A 2YHJA 4H7MA 4YW5A 1G9AA 3AYEA 3TN91 4BOWA 1FPN2 5L73A 3I8TA 1XRUA 2DV9A 2IXHA 4LBQD 4AF9A 5AC91 5C4WC 1C1LA 4AQ2A 2XB6C 2JG9C 5KXBA 2EF6A 2GC3A 2X5IC 1YFYA 4Y4YA 3VBFA 4XFFA 2RS33 2A3XA 1KRIA 5AFEA 1Y7BA 2HWB3 4FO9A 2WZR2 2AREA 2JEMA 1GNHA 3J9SA 4GMP1 5ABJA 2H0VA 4P9GA 1YFWA 3TBDA 5BNPA 2RMU1 3V0BB 3KSCA 4WVZA 5HCFA 5KHIA 1U5ZA 1YO8A 5C9AB 4NPRA 4HBNA 4EWDA 1AYN1 3ECQA 1KD7A 3RWNA 3USUB 3LA7A 1KFXL 1RHI3 4BMBA 1RGSA 1IZ3A 4K8FA 1ENSA 3MPBA 1PGSA 1QXJA 2Y0OA 3ES1A 2OIIA 1V6NA 3N4MA 3GZUC 2A6YA 2W08A 1RUG1 1U5XA 2R16A 2VPVA 2ES3A 4BLIA 4QX5A 5H9PA 1D4M2 3ZSJA 1N3OA 4DY5A 4YZ3A 1QJY2 1H8VA 1RUJ2 1BXHA 4Q4V1 5T5PA 4FQ4A 1H2NA 3AFGA 1QDOA 5HBAA 3B93A 1QXRA 4Y22A 1XNBA 1VBB3 2HKXA 2E6VA 3RQ0A 1G9DA 2OZJA 3OY8A 5JOZA 4IV3B 4HL0A 1X33A 2ZGKA 3TOJA 1DDLA 1Y43B 1V70A 4AHZA 1AX0A 3VZKA 4IV1C 3PLQA 2XWJB 2O8OA 4DY3A 1WMFA 3CJIA 4YGBA 2EA7A 2Y38A 4CRQA 2HWE3 1AR91 3NV2A 4K21A 1RVF1 4XJZA 2XWBB 3AP9A 4CEYB 1OQEA 1AL0G 1W6MA 2HWB2 1ND3B 5JCTA 3QOPA 2PHDA 4I2OA 3FHIB 1BVVA 1POV1 4XXPA 1RUI3 4CDQC 4DS0A 4Q0QA 5K0UA 4A2UA 4INDA 1PGL1 4HANA 2P2KA 4CDUB 5IK8A 2UWAA 1ND2B 1PK6B 4ZU4A 1O3SA 4XE9A 4LULA 1AJOA 2XGXA 1DZRA 2ZGOA 4AYUA 4W6YA 3NKTA 3NO8A 1ZNPA 4GH4B 1W2UA 4QU2A 4H7LA 5CFDA 3V64A 1LU2A 1XE7A 3THPA 4Q1PA 3ZXEA 1QQP3 1LB2A 1H0BA 2PTMA 3NL1A 4B29A 2PYTA 2ZTNA 3BCWA 4LO7A 4O9EA 3WV6A 4YNIA 3ZYIB 2VGDA 5BNPC 3MW2A 4JGYB 1KDKA 3AXDA 4Q8LA 1VBB2 1R091 3ROUA 2XUMA 3DF0A 2PAKA 3KT7A 4F3JA 1QHDA 1LECA 1J59A 2NQYA 4Y1XA 1UZZA 4P9LA 1DLLA 1CAUB 2ZPXA 1UN1A 4MGIE 5E16A 1GV9A 3PJQA 3B3QE 1NLRA 5L36A 4M3CF 2ZGLA 4FXGB 1VAKA 2ARXA 2HWE2 2VW0A 3AZYA 4KG8A 5BY5A 3N36A 3R4DB 4W65A 4WVWA 4CDXB 3ZMNA 1EPWA 1RUI2 1TME3 3FFZA 4XTPA 1LGBA 4AI3A 3WNXA 1VBC1 5T50A 1DZTA 3HBZA 3USSA 2EXIA 5CVRA 2XLGA 4AEDA 4QPGB 4RR3B 3MEPA 2GNTA 1G7YA 2DVGA 4PBPA 3ZFGB 2V5YA 1D0HA 3AZXA 1WBLA 3VHRA 4LA3A 3BODA 3A0NA 4WVMA 4GB31 3Q9OA 3AB0A 4CEWC 1FNZA 1SLLA 2WINB 3CJIC 5J3UA 2W52A 1XXNA 3VUOA 1QQP2 3MFAA 2A75A 4ATFA 1KJLA 2CYFA 2WNVC 2VOWA 1S1AA 2EAAA 3O0XA 4XFGA 2R042 4S2HA 1X7NA 1SLTA 2E63A 1EPZA 5DZEA 1OLQA 3S7IA 3WDUA 3MIEA 2ZX1A 5JSOA 4RS5B 3RI8A 4YZ4A 1SLIA 1H9WA 3JB8A 3POYA 1XE8A 1ZBE2 4JAAA 4KG0A 3RYKA 2QE3A 2UWBA 3VZLA 2Q1MA 2VXRA 1N47A 1C3HA 1CIWA 4Q27A 5CFDC 4F7ZA 3MICA 1FPN1 1LTEA 2GZWA 4G3YC 2CAUA 4RHV1 4AXOA 4XF1A 4FXKB 4OUSA 1TME2 2NM1A 1O3QA 3DL3A 1BK1A 5I8YA 5BNOA 3IDEA 2ZGTA 3DUIA 1AR63 1ENRA 4AGVA 4QHBA 4IXLA 5FOJB 2AGSA 4XEZA 2IXLA 2Q1ZB 5J37A 3ZSEA 3UKTA 3VBOC 1IKQA 2PQQA 2DU1A 2JE9A 2WZR1 1GFF2 2GMPA 1FAYA 2OUJA 3VDDB 5H9SA 2PHXA 4MVTA 3ATGA 3NJZA 1VBD3 5I0UA 1VIWB 2EIGA 2A73B 2XJPA 5JOXA 3GNEA 2PHLA 3V0AA 4PJYA 2IFWA 5CB7A 3KCCA 4C1WA 1HQWA 3VBRA 2QDNA 2CGNA 3BALA 1VB4A 1S0BA 2MEV3 1D4M1 1WLTA 3VZOA 3HIFA 4AEDC 4BIFA 5C8CA 4IEPA 2OUHA 4BQ1A 1QJY1 2Z2SB 3U4XA 4NVPA 2XG3A 1RUJ1 1OI6A 4I3PA 5E1RA 4CYDA 1VB2A 4XQWA 1AXKA 2D3SA 3OCPA 5SV5A 1DG6A 2PELA 4BZ4A 1F2NA 3I7DA 4NHMA 4E9KA 3WY6A 2E51A 3WQ0A 1AXZA 3OD4A 3AMQA 5C4WB 5T5OA 3AZWA 2VOKA 2JG9B 3SHRA 4FAHA 1D0GA 3J4UH 1FX5A 5DG1A 2X5IB 2OA2A 3LSDA 5FTTC 4Z92B 3U10A 1NCRA 4F83A 3PVNA 1NA1C 3WLUA 4AI0A 3EQEA 3PVBB 1UKRA 4XF3A 2ILMA 4EN0A 4D69A 1NXMA 5A33B 4HK9A 1UIJA 2NLRA 2ZABA 1URXA 4LE4A 3VZJA 3GYDA 4PIXA 2MPFA 2AR6A 3AK0A 2LALA 1VBD2 4HKWA 1AX1A 3DV8A 4D7SA 1TNRA 5FCCA 3JQWA 3EHKA 5FDBA 2ARBA 3UKVA 4XFBA 4XXAA 4AE2A 5FQ0A 3U07A 3P3PA 2UURA 3MDPA 2XHKA 2I74A 2MEV2 2UU8A 4AVAA 3JCIA 5FO9B 1XU2A 4R4XA 2C0ZA 5HI0A 3ZFFA 4I02A 4J1WA 3VN4A 3E6CC 3RI9A 5JR7B 5FO8B 3ZFEC 2WSUA 3ALQA 1VBB1 3AZZA 4GMP0 1O7FA 3SXWA 4XJWA 3DPRA 2IC1A 2ZGNA 4M00A 1H8TB 1D2QA 4MXWA 3I59B 3LCPA 1W0PA 4HT1T 4MZUA 3AKRA 2D98A 4IV1B 4AFDA 3VBRC 2HWE1 4Z8BA 2HWC3 5BYNA 1HLCA 1PK6C 3GBGA 4JTOA 2Z69A 1OHFA 3VKMA 1RUI1 3H1YA 1H1AA 2BBVA 5GJ6A 4AW7A 4GH4C 4CDQB 1VLNA 1HW5A 2DCKA 1ZREA 2PHFA 1XYNA 4N90A 5BNNA 3H0OA 1WCK