4LO7A

Ha70(d3)-ha17-ha33
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
247
structure length
228
Chain Sequence
ENIQEINTAISDNYTYNIPGIVNNNPFYILFTVNTTGIYKINAQNNLPSLKIYEAAINYITGFDSPNAKSYLVVLLNKDKNYYIRVPQTSSNIENQIQFKREEGDLRNLMNSSVNIIDNLNSTGAHYYTRQSPDVHDYISYEFTIPGNFNNKDTSNIRLYTSYNQGIGTLFRVTETIDGYNLINIQQNLHLLNNTNSIRLLNGAIYILKVEVTELNNYNIRLHIDITN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HA-70
publication title Structure of a Bimodular Botulinum Neurotoxin Complex Provides Insights into Its Oral Toxicity.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Protein transport
total genus 46
structure length 228
sequence length 247
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17993 HA70_C Haemagglutinin 70 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1090 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lo7A02
2ZS6B 4EN9B 4LO7A 4EN7B 2ZOEB 4LO4B 3WINE 4EN6B 4EN8B 4LO6B 4LO5B 4QD2A 4LO8A
chains in the Genus database with same CATH superfamily
1B09A 1HIXA 2BWCA 4MZUA 3M70A 3WY6A 1PZ8A 4OUSA 3APBA 3O1SA 3AJZA 2IXCA 1VP6A 3G7DA 3POYA 4IEYA 1VAKA 4BHPA 5E8AA 3WX5A 4CU9A 3O0WA 1AXZA 1HDKA 1VRH1 2CTVA 2P4EA 2R071 1MS0A 3LFMA 5CVRA 3RQ0A 4ZU7A 3BI3A 1GYKA 2JENA 4FQZA 2Y33A 3ZFEA 3GDBA 4CDUB 5C71A 5K0UB 3AVSA 3IT8A 4XDQA 5BNNB 3H8RA 5IAVA 1OBNA 1POV3 3JB4C 1ONAA 3PIGA 4RA0A 4O65A 4XFFA 3URFA 4QB6A 4Q26A 3ETQA 2OPWA 4CEYC 1BMV2 4BQXA 4NHLA 3BIWE 3KV4A 4O7XA 4XF0A 5C9AC 3DEMA 4QB1A 1AR81 1UKGA 4JTOA 2PHUA 3LDRA 1DDLA 4EQVA 4BA6A 3BTXA 4EZHA 3A7QA 3HT2A 1NY72 2ZGOA 5JUVA 1H9PA 1EUTA 1WMFA 4FP3A 1NLQA 2D40A 3GCWA 3ABZA 2C6SA 3H42B 3LQCA 1F31A 5A7WA 2TUNA 2WS91 3BVCA 5HCFA 1LGCA 4AYUA 4A3ZA 1ODMA 4KQ7A 4QKBA 5HXVA 1W6OB 2VVFA 3OD0A 3PVEA 3U14A 1Q43A 4DS0A 1NE4A 4HSJA 5BNPB 3WD5A 5FY9A 3RMYA 1UYYA 4B4QA 2L9LA 2P3KA 4K1ZA 1DYPA 1LGBA 5FMBA 3ZFFB 3NMBA 1JYNA 1PMIA 3HBZA 3SCFA 1VMHA 1N47A 1MS4A 3N7KA 1OVPA 4YRDA 3RI9A 4DUXA 5C6CA 2HWF2 1PGL2 5FK7A 4OHXA 4CU6A 3EHKA 1UX6A 3U75A 4D94A 3HJRA 5IVBA 1QQP3 2JICA 3I97A 3KT4A 4K1YA 4AOCA 2DTYA 4FXKB 3PURA 4HZFA 2YPDA 4Q4W3 3TRSB 2GP3A 4SLIA 3W20A 5D8AA 1QJEA 2VTXA 3ZFEC 5EXOA 3MW2A 1GOGA 1OOPA 1F9KA 3LEIA 2VM9A 3J7NA 3AB0A 1AL22 1GNYA 3J8F2 4L2NA 3WNMA 5L9VA 2BOJA 3OEBA 1O3RA 4ZONA 4BYYA 1NZIA 1O3SA 5LA1A 1VMFA 2YBKA 4LBQB 4QX2A 2YFUA 3WDUA 3AFKA 4QQ2A 2OYZA 1FX5A 1JHJA 1JYIA 4IV1B 5FZEA 1KDKA 1W06A 4DO0A 1JOBA 1ULFA 4GJZA 5IT6A 4LR4A 4Q1PA 1R64A 1TG7A 1CZSA 2D6MA 1X9TA 2VL4A 4YZ3A 5H9QA 1W8WA 2O14A 2SLIA 1RUD1 3VHNA 1O3QA 4XQDA 1LOCA 1U5IA 1W03A 3WF2A 2GMEA 1QNWA 4KWUA 2JE8A 1Z7S1 3PMEA 1DQ5A 3S7IA 2IFRA 2ADDA 4UI9L 4FPJA 5SV5A 3T2OA 5FQ0B 2HWB1 2HWE2 2WLQA 4NHKA 3UNPA 2EIEA 5FP9A 4IEPA 4N90A 4MOAA 1TMF2 1RUG1 2IFWA 3VBUA 1K45A 3VGIA 4AHZA 4L99A 1E5IA 1ZZ8A 2LRPA 3RJ2X 2OS2A 5I0DA 2MEV2 5CG8A 1H0BA 2YGMA 3E97A 5K9YA 2A6YA 5J98B 1NZCA 1UL9A 4CCLA 4JDNA 1I5PA 1REFA 1LHUA 1R093 2ID4A 4B7EA 1YJKA 1GSLA 1PO21 1ZRIA 2VQUA 4Y5SA 2GNDA 1AYN1 3F2ZA 2VW2A 2X29A 3X29B 2PHLA 3J4UH 4E8CA 2RMU2 4Q0VA 2A7AA 2QJVA 1FOD3 3OGGA 5EV7A 3WQ7A 1V6JA 3R05A 3WP4A 5D8AC 3ZN5A 1W90A 2AYHA 3VZOA 3MIGA 5ACA3 2B5HA 3CIHA 2GMPA 4Q8LA 3MPBA 5FY0A 1RXGA 1W3XA 1L7QA 2ZHLA 3B93A 3K4DA 1STMA 4UW5A 3Q8AA 4HKOA 4YPJA 3RI8A 5C4WB 1QOSA 5CISA 1PO12 3LA2A 3VHOA 4QXKA 4AAPA 4MO3M 1PNFA 4AFMA 4CDXB 4ZZ8A 3FZ3A 3B01A 4BLJA 2AUYA 4CXYA 2XJTA 4HL0A 4WVZA 2PTMA 1WW6A 1FYUA 1ZX5A 1PVC1 3UV9A 1CJDA 3OUIA 4PIXA 1REDA 3DECA 3VKFC 5A7OA 2K46A 3HT1A 3I2HA 3SNMA 5JMOA 3FE5A 1UYZA 3VBRB 3DPRC 4RHV3 4QPYA 3BN6A 4BK4A 3VKMA 4ZPIA 3LEGA 2D6KA 2W1QA 4M00A 4N43C 3H8XA 5EIYB 2SBAA 1JZ8A 4Y1VA 3EB7A 3S6PA 1HN0A 1SFNA 1V6KA 3SITA 4PQ9A 2Y6HA 1AZDA 3VKOA 4RS5C 1CAXA 2RV9A 3T09A 3OBRA 3MIBA 5T3NA 3U11A 1E5HA 1WZXA 4S2DA 3WW3A 2FDIA 2PYTA 2W3JA 3KV9A 1PZ7A 1CN1A 1ENSA 5AVAA 5FYMA 2X8KA 4IL7A 1CIWA 3ZM8A 4IW3A 3VZKA 4H7MA 1RYYA 3V0AA 3TN93 2E53A 4YFZA 5LRSA 4OZOA 3BU0A 1KFUL 1XYPA 3TAYA 3GHMA 2WR9A 4KGQA 1QDOA 2ET1A 1IS3A 4M3CA 4M4PA 5BYNA 2JECA 3KF5A 2XLFA 2Q1FA 3HPNA 1QJY2 4Q1RA 1W6QA 3VL9A 4Q4V2 1JOJA 3V0BA 4XYXA 5J37A 1FT9A 4K20A 5DZGA 1NX9A 2XL7A 3BCWA 4AVAA 2WZR2 3SKVA 3THPA 4CE8A 2ZTNA 4CCEA 3DKQA 2P1BA 2X5IB 3GJAA 1S0CA 3HVDA 3M4FA 2LALA 3I3DA 4NRMA 4E2QA 3C3VA 1RGSA 2G4IA 1TNRA 1FI2A 3ES4A 1CONA 5FYIA 3RYPA 5C3SA 1LAJA 4LKEA 3FL7A 4UT5A 3KMHA 1XNDA 2BFUL 1W3VA 2FDJA 4I0WB 5FPZA 4YVSA 2HWF1 1PGL1 1CX4A 3SEEA 3THTA 2ARAA 4NROA 1L3JA 2XLAA 2W1UA 1NYWA 1IPSA 3T1LA 5LY1A 3T30A 4LIVA 3JQXA 4PT6A 1SPPA 3WF3A 4IGQA 4BMEA 3BYWA 3BIEA 1UU4A 2J1VA 3VD9A 1CQ9A 4QGNA 4GZ9A 1GP6A 1RUJ3 4WM8B 2VOXA 5GLTA 5LCWL 3ETPA 1AL21 1ND3C 3EO6A 3J8F1 4MXWA 1CESA 2QQOA 3ZXKA 3I2IA 2VQAA 3M3OA 1A8MA 2BNNA 2FBEA 3ACIA 3IIAA 4R9BA 4K40A 1I3HA 4AGGA 1O4ZA 1L7RA 1ZM1A 4H2AA 4AEDC 4TYSA 4PIZA 3BTZA 1RMU3 4H3WA 3U78A 2UYBA 3VBSB 1GLHA 3WDTA 2GNBA 2W1WA 3CKHA 3AKSA 3NAPB 1N1TA 3H1MA 3V65A 4AI8A 4YZ2A 3RZGA 4B4RA 5JXJA 4M0HA 3DXTA 5BXXA 2RJKA 1DF0A 2VBDA 3RYKA 4FPGA 4Q27A 1BKZA 1MEC2 3WVJA 2DU1A 5FXWA 1N1SA 1RL3A 3MLKA 1AR72 3RMXA 3HMYA 1V9U3 5IK5A 5LEJA 1GWLA 2V5YA 4OMCA 3HBKA 1ULOA 2MEV1 1W6OA 4Y33A 2JXAA 1RUE2 3ZMOA 2GSYA 4CCJA 1ZBA1 5JXIA 4HMZA 1AHSA 2CAVA 2WO1A 2P34A 2R6QA 1NQDA 3LOIA 1UIJA 2QBXA 4QKNA 4XUQA 3ZSEA 2GC3A 4LNVA 2IXJA 2FCVA 3BALA 3CU7A 2PQQA 4ISRA 4YVSC 5BV6A 3VKNA 3WHUA 1Y4WA 4IQPA 3SH4A 2VMDA 3ZFFA 1V6IA 1KQRA 1RTVA 3OUHA 1C5IA 1W05A 2WNEA 1XNBA 5DUVA 2RMU1 4AI9A 2VMCA 5G05L 5A3TA 1WA4A 5FP8A 4AEMA 2QZ2A 3IAQA 2R063 3OY8A 3KHCA 3K75B 3ZXLA 4K8FA 2JDUA 3NV1A 1UZWA 2H6CA 2YC4A 2ZEXA 2EIDA 3CF6E 1Q8OA 1F5JA 4K7JA 3UYJA 1ASJ1 3AP5A 1PGW2 1EV12 1UU6A 2VNVA 4WV8A 3ZXAC 5FP3A 5K0UC 3KSCA 1BEV2 3H3ZA 1UF2C 2PHWA 4LKSA 5BNNC 2GNTA 4LOSA 1XOYA 2DBNA 5FY7A 3O1RA 1PO11 3RVHA 4YARA 5A7QA 4BQ4A 1QGLA 3RFRA 3WUDA 3CJIB 2IC1A 4LBQA 4NWWA 5IJRA 1QOOA 1RHI2 1W8ZA 5APAA 4IV1A 2CAUA 5FLIA 5GLVA 4X8PA 2VW0A 1S2BA 1ZBE3 2JE7A 4HKLA 4XBQA 4YVWB 1D4M2 1VBA3 5F2SA 1UX7A 2B9VA 3AM2A 3SQOA 3VDDB 2BGPA 2QDRA 2BOIA 1H2KA 2OZJA 4HFSA 2W91A 3CDZB 3Q8CA 3EMRA 4Z82A 5C3RA 4S2HA 1YQ8A 2D6NA 5LB6A 1JI6A 2KXLA 2XOMA 2YPJA 4RSUA 2TNFA 4LK7A 4DXSA 5FQ0A 2HH9A 1OLME 3POWA 3BODA 2GZWA 2ZA9A 1XXNA 1XE0A 4DQAA 2HWE3 2VECA 2WNOA 5BNPC 3GALA 1AXKA 2AREA 3RZMA 2WAOA 3HAGA 1XNTA 3GBWA 1TMF3 5EYYA 3WCSA 2W1SA 3POIA 2A70A 5DUWA 1W8FA 3OBAA 5LK5A 3ZFFC 2AEYA 3QD6A 3H3LA 1DQ4A 4XPVA 3KF3A 1DP0A 5A3PA 1O4YA 4HONA 2HYKA 3HQRA 4JRLA 4IETA 4LO7A 1UOJA 5HI0A 2VR4A 2ZEYA 4LO5B 5FMOL 1Y7BA 1LHNA 4YZ1A 2W47A 1HRV2 1QJY1 2IWGB 1IKPA 4Q4V1 1G6NA 3GJBA 2QQPA 4BE3A 1LECA 1UU5A 1OQEA 3K4ZA 3OGJA 3POGA 3WLUA 5H9PA 2X05A 1OKQA 2WZR1 3FMGA 1SBDA 5KXCA 2XKOA 5KHKA 3AKQA 3TYJA 4XXPA 5F32A 1Y9MA 2V4AA 2NYYA 3PL0A 3VBHA 3A0KA 4QGMA 5AC92 3WDYA 3KZ4C 1HRI3 1PHMA 4J1WA 3N7JA 3N7LA 1R1A1 3IMMA 2VBPA 4IV1C 4V1PA 4AQSA 1GZCA 3O0XA 1LTEA 3ZX7A 4DINB 4NIHA 4C90A 4IE6A 3MICA 3VD4A 2YB7A 4ZU5A 3M8LA 4DY3A 5JSPA 2VOVA 2VQ0A 4XMAA 3R4SA 4WBBA 2JWPA 2WNVB 5FPBA 5A33A 3MV11 2BVBA 1O7FA 3QOPA 4WM7B 4TTGA 1DG6A 5IW0A 3NL1A 1A6CA 5IK7A 5EPAA 4EZ4A 5GALA 1J84A 5FMDA 2CV6A 2Y26A 1JZ3A 5A1AA 1W2AX 2WO3A 2JD4A 2VC9A 5EYXA 3WG4A 4CP9B 3ZPOA 3GXUA 1H8TB 4E4SA 4LBNA 4IUGA 5DZFA 2R1DA 4CDWB 4Q8KA 5AFEA 1R082 5ANNA 1H30A 2GP5A 2ENRA 2E7QA 3FC0A 3I4IA 3Q9OA 3CBNA 1UKRA 1SDWA 2D3PA 3SCGA 2JB4A 2CGNA 4C91A 3AP7A 3IMNA 1O6UA 3MO4A 4MX3A 3WG2A 1LNSA 4AZZA 2PMWB 2KR2A 5FUIA 5C3OA 2H6BA 1HB4A 1MEC1 5A32B 4D6SA 2FDFA 2XH6A 1OMIA 1AR71 1ZA4A 4IEVA 2EF6A 5CB7A 1SBFA 1LESA 5HCBA 1CR7A 5E16A 1RUE1 1OH3A 1I9RA 3FBMA 3VBHC 4BWOA 5FRAA 5CFDA 2E6VA 4EN8B 4DXTA 1D0HA 2PLV3 1RUNA 2P5BA 2N7GA 5FLHA 2E7AA 3AP6A 4BDVB 5K8SA 1C1LA 3ZN6B 4A42A 1H8VA 1F35A 4L11A 2GDFA 4UWDA 1YFYA 1CAVB 3KD4A 4YW2A 3MF6A 3S0MA 2PXJA 5FXVA 4XMIA 3MUZ1 4Q29A 1Q8PA 2V09A 4D3WA 1C28A 4LE4A 5JIUA 3DV8A 2Q8CA 1ZRCA 1S0JA 4GB33 4N9IA 1GOHA 3J9SA 3T4VA 3LKJA 2J1RA 4ASMB 2P3YA 4K3UA 2JD9A 3W59A 4Q4W2 1BEV1 4AF9A 2IZWA 2DVAA 1T2XA 1LU1A 2E32A 2DVDA 1CGPA 3KLSA 3MDPA 1XSRA 3ST7A 1PK6A 4HVOA 2Q30A 2D3SA 1CIYA 1PM7A 1UN1A 3AXEA 3D6EA 3J7MA 4NHMA 1RHI1 4I2OA 3IB3A 1UYPA 3LF7A 3VV1A 4JVAA 4ZHNA 3KHBA 5A3OA 1F2NA 2PA7A 4QGLA 1W8HA 1D4M1 5CAZA 1W9YA 3PUSA 3Q8BA 2HEWF 4JKKA 3VBSA 2LROA 1K5MB 5J3UA 5ABJA 3AL5A 3FWEA 4XACA 3USSA 4AFDA 4ZKTB 3TEZA 4ASLA 3A0NA 4KBZA 5I0RA 4FTEA 1YEWA 2AH2A 1QJX3 3JXSA 2QCSB 3C2UA 3IPVB 5GZEA 1WGPA 5DDJ3 5B4XA 3HN1A 5GLZA 5CFDC 2JG9A 1V70A 2VPVA 3OPWA 1YCIA 4XE9A 4L9BA 2X5IC 1YC61 1X9PA 2PHFA 1OD3A 3VHPA 3MFAA 2VVDA 5FY4A 2JE9A 4XTPA 1JBCA 1DZTA 4XBLA 1OQDA 1R092 1HV0A 3AYCA 2DF7A 3H7JA 4JTNA 1YJLA 4IEXA 1HRV1 4MHUA 4NMIA 5DG2A 3FLPA 2RDQA 2WJSA 4CXXA 3EXUA 3WW4A 1W9FA 2YZ4A 4EN9B 1FOD2 1S0EA 1WLCA 4WM8C 4CP1A 2AEZA 5A70A 4NRQA 3L2YA 5ACA2 3MGUA 1IPKA 3AMMA 1B35B 4QU2A 4XILA 5AC91 1EV13 5CA6A 1QEXA 5AVPA 5JPMB 2HBTA 1VJ2A 4CYDA 4RQPB 1FV2A 4OI2A 5F3IA 4P00B 4IGOA 4ITCA 3FBYA 3I2KA 4I3GA 1XRUA 4RL7A 1GQHA 1NUKA 4CU7A 3CJIA 3KQRA 4XETA 3VBSC 3KGLA 3TEYA 4Y20A 1Y9QA 3H3UA 2D44A 2WT2A 4PI2A 4QT6A 5E6HA 5ABJC 3KVBA 1JU3A 3VBOA 3IDBB 5JCTA 1VR3A 3IAPA 3K46A 3GZTB 1S0GA 3PU8A 5GZFA 3VDDA 5F5CA 2A1XA 5IWFA 5DPNA 2EXKA 2EIGA 4RHV2 4BMBA 2VY0A 3N9PA 3WP5A 3G6JB 4ZXEA 2JDKA 4E4DX 3K3OA 4QQOA 4CUCA 1W6MB 4GXLA 4IXLA 4QB2A 3BPZA 1EP0A 1VAMA 4LBLA 4A7KA 5FR3A 1ZRDA 1POV1 3NVCA 5T50A 4NN0A 4N9HA 3SLIA 3VZNA 3AP4A 2R0HA 1OUSA 1V6OA 2QQKA 5A6YA 1C3HA 1JYVA 2H0BA 2JKBA 4FVVA 3LE0A 4QU1A 3S7EA 1JYCA 2NM1A 1DYOA 1JZ5A 4QWNA 3SISA 4A4AA 1KDMA 3AMNA 2D5FA 4X6RB 2CWSA 4KG0A 4PDWB 2RS33 2JDPA 4P5HA 4Q0SA 3T2PA 2HJIA 4CEYA 1OLMA 1OKOA 3PTRB 3WOGA 1S4CA 3MUY1 5L9BA 2VULA 1SLAA 1OA4A 2WNUB 3CHXA 2K0GA 2PN5A 4XCAA 1JZ7A 5FFOC 3WG1A 1LGNA 1YHFA 2A3XA 2I07B 2VCMA 4CPBD 1GP4A 3ZMNA 1TE1B 3K3NA 4CCKA 1YRZA 5CU1A 3LDBA 4MV2A 1XSQA 3S5AA 4DY5A 1YWKA 3CJIC 2O8QA 5LZ6A 3AL6A 4KWLA 1RUI3 1SCRA 3VBOC 1J1TA 1W2TA 4LO6B 3VDDC 3AZYA 3A22A 2BNMA 5FY1A 1EYBA 1QQP1 5FZ9A 2WNVA 3TNQA 3MFCA 4Q4W1 1GNHA 2J22A 4WM7A 4PLMA 3IM0A 4AVBA 3ZFGB 4MG2A 1RUJ2 4EE2A 3ZXFA 3E5XA 4BM8A 2VZ1A 5IVVA 5D2AA 5JZGB 5KHHA 2VH9A 1OPMA 2ZMLA 1JODA 1H8TA 1MS1A 1VRBA 2RDNA 3A21A 3NSTA 1ULGA 4G4FA 4NOTA 5GKAC 3ZSKA 5CFCB 2Q8OA 2J1UA 3H1YA 5FO8B 4WVMB 2I74A 1HW5A 2BU9A 1K12A 1RMU2 4OZXA 4N7IA 1R083 4E4HA 4UFHA 4CDQA 3MIEA 3R4DB 2VOWA 4DRVA 4FO9A 3L9JT 2ZGNA 1N1VA 4QMAA 2Y60A 4P14A 2ZGKA 1OLQA 1Q56A 1TQ5A 1N3OA 3GNEA 2OT7A 4QKDA 2CYFA 4TN7A 2W52A 4KG8A 4LTAA 3UETA 1JOPA 5GM0A 5F3GA 5I8SA 1NA1B 4KI5M 1ZVFA 2ARBA 3SXWA 4DIQA 3JZVA 5FYZA 4YZ5A 4NIDA 1V9U2 2QFEA 2CSGA 4C0HA 1JZ2A 1ZRFA 2A71A 4LBJA 3W9AA 2XMLA 2NPIA 1R091 2ZZQA 4BQ2A 1HKDA 3VDCA 4Q4X2 2ZEZA 4N53B 4SBVA 5A1FA 2DUPA 3ZIWA 3FLRA 1PX3A 1GNZA 4E4ZA 1W8NA 2JIGA 1ZZCA 3MLLA 3WQBA 1UMIA 2Z42A 4IESA 2WNVC 4JHZA 4OFGA 3O1UA 3C7FA 4Y1YA 1FOD1 3AZXA 4AEJA 3CJXA 4WM7C 2R062 3NNGA 5KHJA 1N1YA 1ALYA 4BISA 2D6OX 3OBZA 5T54A 5T55A 5ACA1 4KBBA 4AQ2A 2AACA 1O8SA 4PLNA 3UJQA 1KS4A 4HN0A 4Q0PA 4BIOA 2LS6A 3R0RA 4GWMA 4H7LA 5FYUA 3DUIA 1H8TC 3FFQA 1EUUA 5FZ6A 3UJOA 2WQZC 1HN1A 3I2GA 3JQWA 4CDWC 1W04A 2XR4A 4LQRA 4MH0E 1DCSA 4QQHA 3T2QA 1F15A 3WG3A 1G9DA 3J7HA 1UYXA 2ZCWA 4GMP3 1OVSA 2RS53 3NRUA 1QOTA 5FJKA 4CDQC 5FUPA 5FK8A 5CEHA 1LKNA 1KS5A 1ZRRA 2VAUA 5FPAA 5L73A 4YM1A 1ZBE2 4KNCA 4QPIB 2ARXA 2YMZA 3AKRA 1VBA2 4ZZ5A 1K5MA 4I02A 1CPMA 4F7ZA 1W8TA 4GALA 4RHV1 1S0FA 1T6BX 4PI0A 1LCLA 2BBAA 3GM8A 1G9CA 3OD4A 2RDSA 1MS3A 4GULA 1Q8SA 3USUA 4RYDA 2O8OA 1LEMA 4A41A 1QXJA 1N3PA 3AC0A 3N9QA 3D5OA 3V64A 3RSJA 5C8CA 1RINA 3DPRA 2VOTA 4R4XA 3RDIA 2WBKA 5FYBA 5LRRA 5JXHA 1SEFA 2VBBA 4N43A 1DYKA 3RRDA 4Q5OA 3S5QA 3OPZA 4JV4A 3N4MA 2VNOA 5FZ7A 5HV4A 3SKJE 4KWJA 5JXGA 2A3YA 4XJWA 1FNZA 4XTMA 4W8JA 5DZEA 1SLTA 2PAKA 1OI6A 3LDKA 4RS5A 3TN91 2E33A 1W9SA 1X8EA 1AX0A 2W39A 5EFUA 3MZHA 3GF6A 3SEPA 1PX4A 5IK8A 3MPPG 3T08A 1UZYA 2ES3A 3K2OA 3OBTA 3PJQA 3DF0A 3QCWA 1WCSA 1WCKA 4HLTA 2XJVA 3KT7A 3JD72 4LHKA 1OH4A 2WFF3 1RUH2 2EXJA 4A2UA 4R9AA 4XAAA 4W65A 2CU5A 2WIIB 3ZDSA 1JW6A 2HEYF 1JUHA 1KJRA 2R16A 1IGOA 3A4UA 4GWNA 1BZWA 4LBMA 3W58A 4ATEA 3WF1A 2HWD3 1UOFA 1HRI2 4HK8A 4RQPA 4CEWB 2R32A 3OOXA 4UW4A 5FUNA 2Y6JA 4YM3A 3DYOA 2WFPA 5JMCA 4AFAA 4LA2A 4AK3A 1K5MC 2XJRA 5FWEA 4AHWA 4B4PA 5F7UA 2VMHA 1FPN3 1US2A 5F5QA 2W5FA 1NXMA 5J36A 5FPVA 4ORFA 1GICA 4FFIA 3MHZA 4CVUA 4XF4A 3EQEA 2VZSA 3IIIA 5EJ3A 1J3PA 1RUJ1 1TVGA 5J7MA 5C8CC 3AYDA 2Y64A 3LGRA 4DFSA 1C4RA 4NPLA 2XUEA 1LJ7A 1UXXX 5KR7A 1W6MA 2ZEWA 3I3EA 4A45A 3P5BA 1YYNA 5FBZA 4TXWA 2WSUA 2DWRA 1W6PB 4KL1A 4XOGA 5H9RA 5JVVA 2YBPA 4OHYA 1RMU1 1ND3A 2BEOA 1H2LA 1WCQA 3UESA 2W08A 3B00A 2YU2A 4MGIE 1OXCA 3FHQA 1BMV1 2RR12 1SFPA 5IVFA 1ND2B 2O0OA 2A3WA 4P08A 5IATA 1R1ZA 4AEDA 2C9KA 4PDWA 4OUEA 4Y3OA 5T5LA 4YSFA 1GZWB 1COV3 1UOGA 4Y1XA 3RZKA 2CDPA 1NY71 4LEJA 3WCRA 5A3WA 1JN2P 1J3QA 3ILRA 1JTZX 2X09A 3A23A 4ET7A 1O91A 3BTAA 2WNUA 1VBD3 1V9U1 1U0AA 4UW6A 4Y5TA 2LUWA 2CL2A 3OTFA 1EY2A 1ENXA 1S0IA 1A8DA 3NJVA 2UWBA 3OGVA 2D6PA 4BH9A 2PLV2 4RQPC 2F17A 4PCRA 1U5YA 2W46A 2A75A 4XJZA 4XZPA 3I7DA 4LO8A 4A7YA 2XVLA 4ES8A 1XNCA 2Q8DA 3OYWB 2OZ6A 4HOOA 1LOAA 4XFAA 5GLUA 4AVVA 1LOFC 4XBNA 1GU3A 3NNMA 2IXIA 1FMD3 4CP0A 4XEZA 1HXS2 3W5NA 5CKNA 2OPKA 2R061 3ZYRA 3OSDA 4GB32 4I0BA 4O9GA 2VTFA 3ZN4A 2RDRA 3H1WA 5DAPA 5KHIA 3F95A 3HNMA 1DQ0A 4BIFA 2BTVC 4JDMA 3ZXDA 4RGGA 1UO9A 3RG0A 2Y34A 2FDGA 1GP5A 1HX6A 3VZMA 1VLNA 2VUAA 4EYUA 1DQ6A 3PTYA 4ASKA 4NIGA 4UF0B 3AKTA 3B7MA 3PUHA 1BVVA 1SACA 1V6LA 2DUQA 4OI4A 3VLBB 5JZGA 3CZJA 2D5HA 3K4AA 3U0ZA 5H9SA 3P3NA 4CDUA 1LULA 4QXBA 2VQTA 1I5ZA 3FLTA 4M01A 5E1RA 2ZHMA 5K0UA 4CU8A 5CFCA 4WVMA 1G9FA 3VUOA 5BNNA 5BNOB 1HB3A 1ZBE1 4TZDA 1TNFA 2YY1A 1VBA1 4LJHA 3K48A 3N9MA 4LORA 3AMPA 3CO2A 4PDWC 1ST8A 3AYEA 3U37A 3WW1A 4XHXA 4DNYA 1GZ9A 2DCKA 4JC1A 3ZYJB 4C1XA 4QAWA 1MQTB 3E5QA 3R4UA 4FPKA 4QPGB 2X10A 5FXZA 1EPWA 3MW4A 3AX4A 2D97A 3PDQA 2WNUC 5DN2A 1QJX2 3K51A 4GMP0 5DDJ2 5T5PA 4DOUA 2A6XA 3PJYA 1CAWB 2VW1A 1DGWX 3ASIA 1FXZA 4F3JA 5ISLA 2D3RA 4Z8BA 2HWE1 1JS9A 1H1IA 4OI1A 2DVFA 3E1F1 2GMMA 1TMF1 4D8MA 2DCJA 3DYMA 2R49A 4P9IA 5FAXA 3WF0A 1S55A 2VZ3A 4YYOA 1MS8A 4GD4A 3SC7X 5BNPA 4N53A 3B5LB 4Q4X3 1SDDB 1Z0HA 3ILNA 2MHFA 4KU8A 3BB6A 1E57A 4E9KA 4HK9A 2XWJB 4BXSV 3IWZA 1ZNPA 4OMDA 3KV5A 2BGOA 1MS5A 1MZ6A 1UZ0A 4LKFA 4XFCA 1Q3EA 2VUDA 4AI2A 3ZFGC 1SLCA 1AJOA 5EJ1B 1ULEA 1NXD1 2DBIA 2JDMA 3O5SA 5FZ4A 4DRRA 5JZGC 4QX5A 1ZYBA 2PAEA 2C0ZA 1HRI1 2J42A 3KVAA 3LFIA 3LPFA 4XHBA 4CDUC 5CFCC 5EQUA 1UWWA 2EICA 4AE2A 3ZYBA 3VBFB 4TLGA 1RIRA 2ZOEB 1IHMA 4COYA 1YLLA 5HV0A 2OQ6A 3MF9A 1QXRA 3EYPA 3FN9A 2DFCA 1PZ9A 1BQPA 4XURA 2B46X 2LTNA 5FZOB 5A7SA 4QPIA 2DCYA 4RFT0 1OT5A 2J1SA 2RG4A 3T1MA 2DU0A 2VTXJ 3NNJA 1OURA 4L92A 2HWC3 1X33A 5B4NA 4FT8A 4LLOA 4V2VA 3RYRA 1VIWB 4W50A 5LWBA 3WQ0A 4JGYB 1US3A 2D98A 3KCYA 4R9DA 4U2AA 1MACA 5CKQA 4KU7A 3PVBB 4IGPA 2B7YA 4IDZA 2ZABA 2BYVE 1UY3A 3I3BA 3JUUA 3CZUA 2P6CA 4AWDA 4N53C 5C70A 3O14A 4KMQA 1P8JA 4LUKA 3PHMA 5T5JA 1F5FA 3O1MA 2RS32 2WQ4A 4RR3B 1W6NB 3ZSMA 1O8PA 3CL1A 2ZHNA 4M0NA 1GQGA 1IQDC 3I8TA 4UYBA 2ZGRA 3B3QE 2Q1ZB 4MGSA 3B69A 5FZ0A 1UCXA 2UY9A 3AZVA 1CAUB 1NG0A 2GH2A 3B9IA 1M4WA 3P3PA 2WWSA 1DU3D 2PLV1 3JD73 4NHYA 3HWJA 2OQ7A 3HQUA 1RUH3 2FCTA 1RVF3 4FFFA 4BK5A 4BQ3A 5CKMA 2H0VA 3DCQA 4A7ZA 2XB6C 2HYXA 3N9NA 4KGGA 1XYNA 1HXS1 2GALA 4QDQA 4A6SA 1KRIA 1JH5A 5CZKA 2ZACA 4YNIA 3ZYPA 1RUI2 1HQLA 4FOWA 4GB31 5C4WA 2MPFA 1DGLA 4QPIC 4CDXA 5C9AB 3LZZA 2XBO3 4DUWA 4HKWA 5DAWA 2GC0A 1APNA 2VGDA 4LT5A 4MGKE 4U36A 5BNQA 1NLRA 1J59A 1M06G 2XQRA 1CPNA 1VALA 4MGQA 3I2OA 1YQ5A 1OFSA 1H1MA 4G3YC 3WNKA 3RJRA 3LOBA 3VBRA 1QXPA 2IXLA 3HN3A 4GKXA 4RD7A 3ZSJA 1AR93 1QKQA 2RS13 5JI7A 4OHZA 1MPXA 1TZOA 1ULDA 1ULCA 1WLDA 4JX0A 4MYEA 4OYUA 5KHGA 3PNAA 1QJFA 1TME3 4L8QA 4O61A 4QKFA 4XFGA 3WUCA 1G7YA 2J7MA 3H9AA 5LBEA 2VZPA 3LCPA 5JWPA 1CZTA 2RR13 3P1IA 1LOGA 3ES1A 2WN2A 2WO7A 1QJX1 4EWEA 4A44A 1W0NA 2XKPA 1KXGA 2W87A 2Z5WA 5A6QA 4PBOA 4ONUA 4UBHA 5DDJ1 3HOBA 1E5RA 2LM3A 3RWKX 3ACLA 3PU3A 4XIKA 5I8TA 4Y1ZA 5JI9A 5I91A 3NWKA 4LKDA 2IVJA 1AVBA 3LWCA 5IVCA 4XF3A 1D4VB 5FYYA 1OHFA 5KXEA 1A78A 1WBLA 4RN5A 3GZEA 1O5UA 5I8YA 1VBE3 3H50A 2XUMA 3OB8A 2W68A 4XZUG 2ZMKA 5FZMA 3UGGA 3WDVA 1NCRB 2YU1A 3E6DA 4CP2A 2VG9A 1K3IA 4P9JA 3OYWA 2X5IA 2ZGPA 5C4WC 4CDXC 3FFZA 3KM5A 4LA3A 4QHOA 2ZGSA 3C7OA 3ZXGA 3ENRA 1HXS3 4D7TA 5A1LA 4DZGA 4JRAA 3O1OA 2ARCA 2Y0IA 1VBC3 1LHWA 4LXLA 5A6ZA 4AAXA 5I93A 3O0VA 5DQ0A 1HJFA 1UZVA 4GWJA 5L7OB 3VBRC 4NAMA 5F6KA 5A7WB 1PGW1 1EV11 2G1MA 3GYDA 4XABA 2VZUA 3UKNA 1EPZA 5I0UA 2ZX4A 1FNYA 3SH3A 4IEZA 5CIRA 1TEIA 4WM8A 2ZKNA 1UY0A 3CQOA 3IKWA 5J96B 1NOVA 1GWMA 1RXFA 4QX8A 2HLEA 3WR0A 3L2HA 5F39A 4UW3A 5M0TA 2C26A 3RWNA 3VKLA 2RS52 3VD5A 2Y8KA 3ZXEA 3HR9A 2Q5TA 2ZAAA 2R30A 4CXWA 2RM23 4L97A 2YYOA 2BVVA 5IFPA 3I59B 4YW3A 1X8MA 2RVAA 2F4PA 4BLIA 2BRTA 3M1HA 4YWAA 2WN3A 3JBG3 4LHNA 2VZRA 3LD8A 1WLWA 1UW8A 3NAPA 3D3AA 1EAH3 4BQWA 3FJSA 2Z2SB 5FY5A 3FX3A 5FZ3A 2ZPXA 2EAAA 5G04L 1WMXA 1QIQA 1UAIA 2GAUA 4I3PA 4L0PA 4XDOA 4XF9A 4XQ4A 1I6XA 5FPLA 1GR3A 4P5YA 5IVEA 1OOPB 2XPJA 3JU9A 4Q4Y3 5FZDA 5JR7B 4CPBA 1BBT3 2XLGA 3SCHA 3WT3A 5HCAA 1QNYA 1UIKA 2RS31 1UMZA 2FMDA 1IS5A 4BQYA 5FYSA 2E31A 2RHPA 1GANA 4XJUA 5LBFA 3DGTA 4JKMA 2AZ5A 4GH4B 5LATA 3ACFA 3M3EA 4NR1A 4AQ6A 4XUPA 3POFA 4OI0A 4IE5A 1GOFA 2A73B 1FAYA 4I30A 4OHWA 1QH7A 2JKXA 3AZWA 3PVOA 2P6HA 4LBOA 1C8M3 2GN3A 3BOWA 3MBWA 3MIHA 4YGCA 3ELNA 2WFF2 3OEAA 5JIAA 3PVNA 1X50A 4EN6B 2VNRA 1Y43B 4INDA 2J1AA 3PUAA 1W0OA 3FUOA 2V5DA 2FCUA 3VBUB 1QU0A 2HWD2 3I3QA 2XQXA 1SG3A 3ZO0B 4WVWA 2KA3A 4B7KA 1RUI1 2CHHA 2OUJA 3ZYGA 5BY5A 4JGZB 3T0DA 2E9QA 4Z2AA 1QJU3 5FY8A 5C8WA 4CUAA 1GV9A 3Q8FA 1FPN2 1W0PA 4QPGC 2NP0A 1GZTA 3NAPC 4EN0A 2FZ1A 2FD8A 1DIWA 3KCXA 2A5ZA 4QDRA 1HJGA 2XONA 4IEUA 4YVWA 4AEKA 4Q0QA 3PUQA 2IXHA 3N35A 2K9ZA 2XJPA 4BQ5A 1WCDJ 2WC2A 2VXRA 5FYVA 2BNOA 5FYCA 5L36A 3B02A 4C1WA 2WWUA 3RZZA 5LA2A 5EHDA 4AL9A 2VD7A 4J1XA 1R081 1QY4A 3H8UA 3OG2A 4META 5FXXA 3UL2A 4QHZA 1JZ4A 3NO8A 5JOWA 3K77A 1COV2 2PHTA 4YW6A 4XJAA 4XW3A 1IG3A 2VXJA 4QPWA 2CGPA 2A6ZA 4P9YA 3E6BA 3AYAA 2R0FA 1O5LA 2R7EB 4G9SB 2YXSA 2R043 4Y22B 3ZKUA 1DZRA 1RUC3 1VBD2 2LW8A 2V72A 3WSOA 1GFF2 3ATGA 3GCXA 1MS9A 3VD7A 5DABA 2HKXA 1XBFA 2BW8A 1CAXB 2GN7A 1C1FA 1YQ6A 4M3CE 4C0BA 1IQAA 4XIOA 2Q8EA 3ZPYA 4D69A 1WWYA 4ATFA 1KJLA 1FMD2 3SHRA 3C8XA 3VDAA 2WZEA 2P3IA 2QQUA 1XYOA 1SLIA 4FAGA 4K8RB 2O1QA 1JXNA 3WINE 4FAHA 3AMHA 2WYSA 2Z4FA 1LENA 4IE7A 4HETA 2WKKA 2XWBB 4LHSA 1UD1A 5GZCA 4YVWC 3LEMA 1LEDA 2JDYA 3ZYFA 1XB9A 5IFTA 1DFQA 3EBRA 4M3CB 4NHXA 4R9CA 2WT0A 2ZZJA 4A3XA 1W9WA 1W6QB 5LA9A 4BOWA 4QXHA 2DYCA 1XQNA 5A7NA 2ZBJA 3NV4A 4YW5A 2HEVF 4XJ8A 4OQ9A 1WMEA 4RFRB 1X82A 4GMP1 1RUF3 4YG0A 2RS51 2ZGTA 3RPQA 4CP9A 4N8MA 4XC9A 2VZVA 4HANA 3VN4A 3BU7A 3QH6A 4CDWA 4PQQA 1W2OA 2WLPA 1W28A 3TEWA 3VZJA 3AVRA 4HN1A 4YVSB 5FWJA 1NKGA 1PM4A 2EIBA 2KD7A 1UNBA 4AXOA 2JDAA 2OIIA 5BUVA 1VPHA 3OGSA 4R4ZA 3C7GA 1WD3A 4GWIA 3LSDA 4EV0A 1PVC2 4NJ4A 4K9SA 3TOJA 1SPPB 1H4GA 2B4KA 3IN9A 1POQA 4UFLA 2Y6LA 3OGRA 4LBKA 3P6BA 4M3CF 4AGRA 5A32A 4LPLA 4I09A 1WW5A 1SFYA 4S2GA 4UOJA 4MXWB 2EVXA 3U4XA 2CDOA 4MVTA 2UY8A 2BBVA 1UY2A 4F8AA 4YM0A 1H2NA 2YBSA 2WDBA 4HXCA 2P2KA 5DAVA 1NCRA 5GZGA 1PVXA 1AR63 1D2SA 3INAA 4N7UA 3ZN6A 3FUQA 4UFJA 2I2SA 4EWAA 3ME2A 4GQ7A 1CAVA 5CBLA 5DMYA 4BB3A 4J6GA 4HG6B 4GIQA 4YG6A 4B8EA 1UOBA 2ZGUA 3BOPA 2WA4A 5LY2A 2WFF1 5E88A 2NMNA 3HEIA 1C57A 5JLVA 1D0GA 2WRAA 5D21A 1ENRA 1PIV3 5L7OA 2ZGMA 1XJAA 4AHYA 3WNNA 3ZOIA 5KXDA 5LW9A 2HWD1 4MXVA 4YM2A 1UQXA 4MGZE 3IDAA 1ZZBA 4JHTA 5FZGA 2Y38A 2XJUA 2RE9A 4NWVA 4XXAA 5A3MA 4NO4A 4MUVA 2XJSA 2ZS6B 1VBB3 5C5UA 5I0TA 1FPN1 2BDRA 4KH9A 5FO7B 5KXBA 2W0XA 4EWDA 3I2JA 3V56A 2AGSA 2JG8B 4FBFA 3S30A 1QWRA 1X36A 1MZEA 3I59A 1IOAA 1AYM3 1HB1A 3IDCB 4AQTA 3GBFA 3OY8B 1YQ2A 3ILFA 4COZA 3T4HB 4UAPA 3V0BB 1F8VA 3WNLA 2HWC2 2RJ2A 1D7PM 4Z07A 5F1RA 2ZX2A 2K2SA 4GJYA 3LB9A 4KWKA 1S2EA 1VMJA 4MHRA 5EJZB 5F5AA 4IERA 3IPVA 4QD2A 5CNAA 2XHKA 2VMIA 5FYHA 4W6YA 3UGFA 4Z1VA 4HPKB 4H14A 4JZRA 5F37A 5JOYA 2R073 1VRH3 1NCRC 4LOTA 1AJKA 1BLZA 1ENQA 3U10A 1WBFA 2G19A 1HB2A 5C5TA 2W9XA 3WV6A 1COV1 3RZLA 4D6RA 3ACHA 3QBQA 4TSVA 1OF3A 2EXHA 4GH4A 3D8CA 4EJRA 4HSLA 4GA9A 5DUXA 1KITA 5JPNB 2ZX3A 3BKZA 1VBD1 3NJXA 4AVSA 1FV3A 1W99A 2OUHA 5L7OC 1AR83 2NQYA 3OUJA 3JB8A 1WMDA 1MZ5A 4IE4A 1DQ1A 3VDBA 1WD4A 1ODNA 1NAEA 2DVBA 3TBDA 4CCCA 5A6XA 1F4HA 1RVF2 2ZX1A 5DAQA 4ZS3A 4OQ8A 3CMGA 2Y6FA 1W8UA 3PLQA 4LO4B 5F3CA 3IDEA 4W4ZA 3WF4A 2BUKA 1OA2A 1FMD1 1B35A 2WS93 1Y9GA 1BYHA 1XC6A 3VHRA 4BCUA 4FTBA 4YGEA 1ZBA2 1IZ3A 5CYYA 1VE0A 4ZS2A 3ZLIA 4JGZA 2Y6KA 5DG1A 2ZGLA 1H6YA 1S0BA 4COWA 1LOFA 2XBO2 5IVYA 4ISQA 2D6LX 2F4LA 5FP7A 1WCUA 4P9XA 4DEVA 2B39A 1ZZ6A 3LPGA 5FDBA 2QKDA 2QTWB 2DURA 1GMMA 2VCAA 4FQ4A 1IS4A 1AF9A 4ARXA 4WZCA 2PELA 3POBA 2Q4SA 2PFWA 2E63A 5FZFA 2E7TA 1OOPC 4F83A 5LBBA 1ASJ2 1AR92 2WUHA 3NKTA 3PIJA 1C5HA 2G9GA 2RS12 4MLOA 3WQ1A 5CADA 5JAXA 5KC6A 1MR5A 2BZDA 3VBHB 2TEPA 1JYXA 1LRHA 2ZAHA 2VZOA 3N7MA 1NLSA 4AR2A 1TME2 1T6GC 2EALA 2UWAA 5LBCA 2FDHA 4Q0UA 4GH4C 4XFHA 3O7OA 5A33B 4FPCA 1YFWA 4EN7B 2J1EA 2WYFA 4Y4YA 2PQSA 2VJXA 4QX7A 1KD7A 2W92A 4Y1UA 4E2GA 3VB9A 1SHWB 2WO2A 5FPUA 5BPXA 5F8PA 3WXPA 3S57A 3TNPB 4Y22A 1RUD3 1W9TA 4PLOA 3GBGA 4X6QB 1QF3A 1GQPA 4QX3A 1I1EA 2PAMA 3O12A 3VBUC 1LOEA 2VZTA 1VBE2 1YUDA 1Z7S3 1B35C 1WUVA 2OXBA 1RUOA 1PNGA 4WVVA 3D0JA 1ACCA 2HWB3 4DUVA 2WABA 4JGZC 4Q4X1 5LEKA 5TSWA 3AJYA 5EP9A 4ZXKA 2CNAA 1RUG3 2YFZA 3HIFA 4K6BA 1H1AA 4DXZA 1K42A 5FZCA 1O59A 3DN7A 4CCNA 1VBC2 1BXHA 2CWMA 2BPA2 5FKBA 1POV0 2ILMA 4XVHA 1NCQB 1PO23 2XL9A 5IHRA 3KQ4B 4I0AA 4BU2A 2W95A 1AYN3 5DUUA 5A3NA 2VCCA 2D93A 1LODA 3M2MA 2BWAA 4NIIA 3ACGA 1SQ4A 3T0AA 4Z92B 5LK7B 3WP3A 2ERFA 3ZFGA 5CFDB 4IEQA 2D7FA 4RGKA 1A3KA 3VL8A 5FMCA 1V00A 3HNYM 4IV3B 2ETEA 3ROUA 1CZVA 5HCHA 3CLPA 2WWJA 3VD3A 1DZQA 1OPOA 2QQNA 2RM22 3WEZA 1R1A2 4JQTA 1U5XA 4FOQA 3NJZA 2JDNA 3GHNA 4AFBA 2OA2A 1JZ6A 1WW4A 2XXZA 1W2NA 3WNOA 3JBG2 4M4RA 5ANQA 3O1VA 2HWC1 3MYXA 2ATFA 4TWTA 1VB2A 1SLLA 2GC1A 3BPSA 4JAAA 4CCMA 1EAH2 2XVKA 3MLJA 3DXUA 2G9FA 2QQJA 1G8WA 1LHOA 2QQMA 3MIFA 1PVC3 4E8DA 3PMSA 2UYAA 2GC2A 4MSVA 4D6QA 3GGLA 2ORXA 4HBNA 5C33A 1J3RA 3T2TA 1NA1A 1QJZA 2YUEA 4FXGB 3AK0A 1PK6B 4Q4Y2 3UT0A 4AG4A 1BBT2 1HV1A 4QM9A 3RGBA 2Y6GA 5L9RA 3QACA 1J1LA 2ZJCA 2JEMA 1U5ZA 4PHZA 4D0QA 3J26N 2DDUA 5FZAA 4ES9A 5FPXA 2J1TA 4MGTA 1OLRA 2C9AA 5ABJB 3N9LA 1W8OA 1AX1A 4P02B 4UFKA 1D2QA 2QQLA 4YW1A 5SV8A 4FI9A 4LULA 2ZX0A 1RC6A 5LA0A 1IPJA 5FOBB 3ZYHA 1C8M2 3M3QA 3LAGA 1SZBA 3Q8EA 2WT1A 3JD71 4QX0A 2DUOA 4RGAA 4XJ9A 3WNPA 2QQWA 3NNFA 1RUH1 1RVF1 5JR2A 2AR6A 2FMYA 5FV3A 3D82A 4AHXA 2JG9B 3M3CA 4LITA 1UMHA 3WNXA 5EWSA 1CD3G 5FP4A 1YNAA 4AW7A 5IAXA 4PF5A 1JMUB 2CY6A 3UK9A 2JX9A 1REEA 4URTA 2DVGA 4CUBA 3KB5A 4QXCA 4X8NA 1KEXA 5A3UA 2XBO1 1YIPA 1QJU2 5FZLA 3T3YA 2WSVA 4IE0A 5FREA 5GJ6A 3TWIA 1XNAA 2JG8A 2R1BA 1RJ8A 4DMIA 1W39A 4XUTA 2FHRA 1QH6A 4YG3A 2FQPA 4COUA 4URAA 3OCPA 2G9ZA 1IG0A 3AP9A 2YG0A 4IEOA 2OKXA 1JHNA 1DLLA 1UZZA 2HWF3 4CCDA 1Q5OA 3LA3A 5GLWA 2P37A 1AR91 4LUMA 2WZPP 2RS11 1NA1C 2XJQA 2IXKA 3AXDA 3QLQA 3CEWA 3UKTA 4YGBA 1WA6X 1AXYA 2DFBA 2ZXQA 3U07A 2Q1MA 4XQWA 5F3EA 1DGRA 3FHIB 2BV4A 1TME1 1DHKB 4OULA 4HPKA 1XU1A 4QDSA 3ZR5A 3LA7A 3FHAA 4BQ1A 5K4LA 3BTYA 3BGAA 1AL23 3J8F3 3ZR6A 3SH5A 2RR11 3C7EA 1JU4A 2JIJA 2VCBA 5KWRA 4LIUA 4YFWA 1MZFA 4Y20B 4XFIA 1YI9A 3EJKA 5JOXA 3VBOB 3ZDVA 2Z69A 4YW7A 1ZREA 5I0SA 4XCBA 4BZ4A 5T52A 2XGXA 3DYPA 1WW7A 1MVQA 2R042 2NZ9A 1RUC2 4Z2WA 3HD8B 3D0SA 1CJPA 4QQPA 1ZA7A 2BFUS 1VBE1 4YLZA 4S2FA 5L19A 3E6CC 2OX0A 4OCTA 1UPIA 3GZAA 1O3TA 1XE7A 2ET7A 1XNKA 4XAEA 4XF1A 3I3MA 1UY1A 2FDKA 2VNGA 4A6OA 4JQRA 3BUCA 4Y26A 4OLLA 4YZ4A 5C7GA 1OSGA 2MEV3 2XDVA 2PHDA 4CEWA 4AVTA 1V0AA 1XE8A 4DXRA 5A80A 1ZBA3 4O9EA 2JG8C 3N3HA 2VMFA 4FFHA 4LLFA 2A6WA 1VBC1 2E51A 2QQVA 4ZU4A 2JB8A 3I2FA 4CEYB 5AFBA 2W94A 1BK0A 1SMVA 2P17A 2BERA 5FTTC 2WQ8A 3R6SA 1SBEA 2VMGA 1BJQA 2TBVA 5F5IA 2RMU3 3RS6A 5FJHA 3OPTA 2UU8A 2EXIA 3THDA 1SLBA 5ERLA 3KWVA 2IUWA 2DCZA 1RUF2 2ZMNA 1ASJ3 2B9UA 2W2IA 1LU2A 1DGWA 2RM21 2VE1A 3I2DA 4MGYE 1JYTA 1W6PA 4V2WA 4NPRA 4GKYA 2VUCA 1E5SA 1DLCA 2D43A 3HNBM 4B3NA 5DAXA 2QZ3A 1BCXA 3GZUC 3TB0A 2CGOA 1H4HA 1PO13 1Z78A 2XHNA 3JBG1 1C8NA 4BJ0A 3NKGA 5F9TA 1AX2A 2VMEA 5FO9B 4LE3A 2WL1A 4UFMA 1EAH1 3NW4A 1ND2A 4FP2A 2QUOA 4FPOB 4WZFA 5C3QA 3RZHA 4Y4RA 1NT0A 4FPYA 1YFUA 4NRPA 1GZWA 2C1FA 4AVCA 2YROA 2QVSB 4K21A 4FPEA 4UBGA 4Q4Y1 1BVP1 2MNGA 2B45X 1BBT1 2ZGQA 3B9CA 4FPFA 1VAVA 4W6XA 3WP6A 4BPZA 5IK4A 1JYWA 4NIAA 3NV2A 3ZFEB 3ORJA 1BHGA 3KCCA 1LHVA 4Y24A 5J09A 3MIDA 3AMQA 2VZQA 1LR5A 3LIGA 2DTWA 4CEWC 4P9GA 1AR62 1SCSA 4LBQD 4AI0A 4HVRA 4DPNA 3DKWA 4CDQB 1NE6A 5FIXA 1O4TA 2ADEA 2OVUA 3MV01 4CZSA 3I49A 4NUBA 1A34A 5K7PA 2P3JA 1C8M1 5FZIA 2WA3A 4I01A 4NAOA 1KFXL 5FZHA 1H9WA 2I45A 2NMOA 4B1MA 2V73A 4NVPA 2EAKA 5C3PA 2AC1A 1NCQA 1PIV2 1OF4A 3C7HA 1Y3TA 2AENA 1BK1A 3N36A 1DGRN 2BJSA 4FFGA 4FOYA 4Q2FA 5FBJA 1XPWA 2XG3A 5FCCA 1ZZ9A 1QJY3 4B1LA 5FOJB 4Q4V3 4UXAA 1H2MA 1IS6A 1GWKA 4UF0A 1LB2A 2E26A 2GH8A 4UFIA 2WZR3 1N3QA 4IV3A 3THCA 1XU2A 2YHJA 1DQ2A 4D7SA 2YGLA 2OW4A 1QJU1 1VBB2 2GNMA 4CA9A 3MI8A 4FPLA 2IVIB 5CG9A 1RITA 3O1TA 2WAAA 1Q8VA 4YGDA 4R52A 1ND2C 5BNOA 1AYM2 1R1A3 3KS7A 5FYTA 5J1XA 3CNAA 2PHRA 2WZ8A 3MW3A 4CUGA 1MQTA 3AZZA 1QQP2 4QPGA 1L7LA 5JSOA 5FLJA 1QMJA 3D4KA 1IKQA 1KGYA 3UKVA 2HBUA 5IUQA 3HQXA 1HQWA 1YFXA 5D8AB 4GAZA 5DXDA 4TLFA 5FZ1A 1CAWA 3IBMA 5FMOS 5KBFA 1S0DA 2R072 1VRH2 1MVEA 3I54A 1GUIA 1OFNA 4AI3A 1URXA 3M3IA 3TEXA 4EROA 5B2GB 2VO5A 3RZJA 4AGVA 1HLCA 5HPOA 2GU9A 3IZOA 2F6BA 2C5DA 1ZZ7A 4ZY9A 4NE9A 4H55A 5JDBA 1J58A 3DL3A 4JKLA 2B42B 3WW2A 2R041 1RUC1 1AUYA 3NV3A 1JUIA 3USUB 1NCQC 1X7NA 1AR82 3B94A 3VZLA 5T5OA 4FOVA 1YI7A 4E27A 5C8CB 1U12A 3ECQA 3KT1A 1G86A 2ZHKA 3DPRB 4CTEA 3LEKA 5F6LB 1LOBA 1OD5A 3N9OA 3KGZA 4P9WA 1UXZA 1MEC3 4DEQA 1OA3A 5HXMA 4PJYA 4IV3C 3NNLA 4N43B 2PHXA 1AR73 2WS92 2QE3A 4PF1A 2B8MA 4JCKA 1RUE3 3POSA 4HVQA 4RS5B 1RJ7A 5GZDA 1YQCA 2YDEA 2VVEA 5BNOC 3VBFA 1ULPA 3AFGA 4D7YA 1NQJA 4P9LA 3WDXA 1CX1A 5FZKA 3ZSLA 1PMHX 1CWPA 2JDZA 2YV8A 4FSJA 4LK6A 3AKPA 1MQTC 4XFBA 5FZOA 1PGSA 1S1AA 1UY4A 3WDWA 4BXFA 2C24A 4B29A 2QNKA 1YO8A 3H8OA 4LMFA 3U1XA 3MEPA 1RUF1 4DB5A 1HQNA 1PK6C 2V4VA 1G9BA 2WINB 4JGYA 4QQLA 1BEV3 1F4AA 5F2WA 4E2SA 4LHLA 1QDCA 1WLTA 3RNSA 3OF1A 1Q8QA 4JDOA 1W2UA 3QH7A 1YXWA 3ZYIB 3ZIXA 4XUOA 1J83A 3M7AA 2RJLA 2ORZA 2VUJA 1FATA 2FZ2A 4ARYA 1RHI3 3KV6A 2BGCA 3W5MA 3PUIA 2Z79A 5LASA 2QDNA 3NJYA 3W21A 2ZKLA 4COVA 4CRQA 4CSWA 4RR3A 1W6NA 3LSEA 1GBGA 4MADA 1D4M3 5JOZA 4Y5Z0 1AL0G 1OUXA 1RUD2 4FCAA 1CVNA 3U4SA 2UWCA 2JG9C 2Y0OA 4W6WA 4AFCA 3JCIA 3POJA 1CAUA 1Z7S2 3POEA 3ITQA 4NPMA 1AR61 1ND3B 3ALQA 1OQ1A 2JJ6A 1RB8G 2HWB2 3H0OA 4OHVA 5HBAA 3E5UA 1H6XA 3VBFC 2C4XA 4OUMA 2EA7A 1RUG2 2NN8A 5KC5A 1UPSA 5D1IA 4AEDB 3ZVXA 1S2KA 3TN92 1YIFA 3OJBA 3V0AB 1DBNA 2XVGA 4XDPA 1QHDA 5C9AA 2KM2A 2BQPA 3J7LA 1PIV1 4AI1A 2NLRA 5JSRA 4OVEA 3LIHA 3ZKYA 1PMJX 1PO22 3ZXJA 5IYYA 1HRV3 1AYN2 3UGHA 4HT1T 4FTSA 4C8DA 2BP6A 5FKCA 2YC0A 2UURA 2YC2A 1GKBA 4JGYC 4YW4A 1G9AA 5FZBA 4QX1A 4PIYA 4PBPA 4J25A 1K5JA 5EZWA 1VBB1 5IVJA 1V6MA 4FPHA 2DV9A 4CCOA 2A6VA 2VOKA 5J48A 1V6NA 4IEWA 2JDHA 4XUNA 2X53S 5A3LA 1WKYA 5AC93 4QM8A 2DCTA 3WZ1A 1VB4A 3NQHA 3H7YA 1AYM1 5FZ8A 3SMHA 2VU9A 3WHTA 2Q0AA 3ON7A 5E89A 4RR3C 5A7PA 2QQIA 3T0BA 4QHBA 1OC1A 4R8HA 3O1PA
chains in the Genus database with same CATH topology
1B09A 1HIXA 2BWCA 4MZUA 3M70A 3WY6A 1PZ8A 4OUSA 3APBA 3AJZA 2IXCA 1VP6A 3G7DA 3POYA 4IEYA 1VAKA 4BHPA 5E8AA 3WX5A 3O0WA 1AXZA 1HDKA 1VRH1 2CTVA 2R071 5CVRA 1MS0A 3RQ0A 4ZU7A 1GYKA 2JENA 4FQZA 4CDUB 3ZFEA 5K0UB 3IT8A 4XDQA 5BNNB 3JB4C 1POV3 1ONAA 4RA0A 4XFFA 3URFA 4Q26A 3ETQA 4CEYC 1BMV2 4NHLA 3BIWE 4XF0A 5C9AC 1AR81 1UKGA 4JTOA 2PHUA 1DDLA 4BA6A 3HT2A 1NY72 2ZGOA 1H9PA 1WMFA 4FP3A 2D40A 1F31A 2TUNA 2WS91 5HCFA 4AYUA 1LGCA 4KQ7A 5HXVA 1W6OB 2VVFA 3OD0A 3PVEA 1Q43A 4DS0A 1NE4A 4HSJA 5BNPB 3WD5A 3RMYA 4B4QA 2P3KA 4K1ZA 1DYPA 1LGBA 3ZFFB 1PMIA 3HBZA 3SCFA 1N47A 1MS4A 3N7KA 4YRDA 3RI9A 2HWF2 1PGL2 4OHXA 3EHKA 1UX6A 4D94A 1QQP3 2JICA 3KT4A 4K1YA 2DTYA 4FXKB 4HZFA 3TRSB 4Q4W3 4SLIA 3ZFEC 5D8AA 5EXOA 3MW2A 1OOPA 1F9KA 3AB0A 1AL22 3J8F2 4L2NA 1O3RA 1O3SA 4BYYA 4LBQB 3WDUA 1JYIA 3AFKA 4QQ2A 2OYZA 1FX5A 4IV1B 1KDKA 1ULFA 5IT6A 4LR4A 4Q1PA 2D6MA 4YZ3A 5H9QA 2SLIA 1RUD1 3VHNA 1O3QA 4XQDA 1LOCA 1U5IA 2GMEA 1QNWA 1Z7S1 3PMEA 1DQ5A 3S7IA 2IFRA 4FPJA 5SV5A 5FQ0B 2HWB1 2HWE2 2WLQA 4NHKA 4IEPA 4N90A 1TMF2 1RUG1 2IFWA 3VBUA 3VGIA 4AHZA 4L99A 1ZZ8A 3RJ2X 2MEV2 5CG8A 1H0BA 2YGMA 3E97A 5K9YA 2A6YA 5J98B 1NZCA 1UL9A 4JDNA 1REFA 1LHUA 1R093 4B7EA 1YJKA 1GSLA 1PO21 2GNDA 1AYN1 2VW2A 2X29A 3X29B 2PHLA 3J4UH 2RMU2 4Q0VA 2A7AA 2QJVA 1FOD3 3OGGA 5EV7A 3WQ7A 1V6JA 3R05A 3WP4A 5D8AC 3ZN5A 2AYHA 3VZOA 3MIGA 5ACA3 2B5HA 4Q8LA 2GMPA 3MPBA 2ZHLA 3B93A 4UW5A 3RI8A 4HKOA 5C4WB 1QOSA 1PO12 3LA2A 3VHOA 4QXKA 4AFMA 4CDXB 1PNFA 3FZ3A 3B01A 4BLJA 2AUYA 2XJTA 4HL0A 4WVZA 2PTMA 1WW6A 1FYUA 1ZX5A 1PVC1 3UV9A 1CJDA 4PIXA 1REDA 3VKFC 3HT1A 3SNMA 3FE5A 3VBRB 3DPRC 4RHV3 4QPYA 3VKMA 2D6KA 4M00A 4N43C 2SBAA 4Y1VA 3S6PA 1V6KA 1SFNA 3SITA 4PQ9A 1AZDA 3VKOA 4RS5C 1CAXA 3OBRA 3MIBA 5T3NA 3U11A 4S2DA 3WW3A 2PYTA 1PZ7A 1CN1A 1ENSA 5AVAA 2X8KA 4IL7A 1CIWA 3VZKA 4H7MA 3V0AA 3TN93 2E53A 4YFZA 5LRSA 1KFUL 1XYPA 3TAYA 3GHMA 4KGQA 1QDOA 2ET1A 1IS3A 4M3CA 5BYNA 2JECA 2XLFA 1QJY2 4Q1RA 1W6QA 3VL9A 4Q4V2 1JOJA 4XYXA 5J37A 1FT9A 4K20A 5DZGA 2XL7A 3BCWA 4AVAA 2WZR2 3THPA 2ZTNA 2X5IB 1S0CA 3M4FA 2LALA 4E2QA 3C3VA 1RGSA 2G4IA 1TNRA 1FI2A 3ES4A 1CONA 3RYPA 3KMHA 1XNDA 2BFUL 5FPZA 4I0WB 4YVSA 2HWF1 1PGL1 1CX4A 3THTA 1L3JA 2XLAA 1NYWA 3T1LA 3JQXA 4BMEA 1UU4A 1CQ9A 4QGNA 1RUJ3 4WM8B 2VOXA 5GLTA 1AL21 1ND3C 3EO6A 3J8F1 4MXWA 1CESA 3ZXKA 2VQAA 3M3OA 1A8MA 2BNNA 2FBEA 3IIAA 4R9BA 4K40A 1I3HA 4AGGA 1O4ZA 1ZM1A 4AEDC 4TYSA 4PIZA 1RMU3 4H3WA 2UYBA 3VBSB 1GLHA 3WDTA 2GNBA 3NAPB 3AKSA 4AI8A 1N1TA 3H1MA 3V65A 4YZ2A 4B4RA 4M0HA 5BXXA 2RJKA 1DF0A 3RYKA 4FPGA 4Q27A 1BKZA 1MEC2 3WVJA 2DU1A 1N1SA 1RL3A 3MLKA 1AR72 3RMXA 3HMYA 1V9U3 5IK5A 5LEJA 2V5YA 2MEV1 1W6OA 2JXAA 1RUE2 3ZMOA 2GSYA 1ZBA1 4HMZA 1AHSA 2CAVA 3LOIA 2R6QA 2P34A 1NQDA 3ZSEA 1UIJA 2GC3A 4LNVA 2IXJA 3BALA 3CU7A 2PQQA 4ISRA 4YVSC 5BV6A 3VKNA 3WHUA 3ZFFA 4IQPA 3SH4A 1V6IA 1KQRA 1RTVA 1C5IA 2WNEA 1XNBA 5DUVA 2RMU1 1WA4A 4AEMA 2QZ2A 2R063 3OY8A 3ZXLA 4K8FA 3NV1A 2H6CA 3V0BA 3CF6E 4K7JA 1Q8OA 1F5JA 1ASJ1 3AP5A 1PGW2 1EV12 1UU6A 4WV8A 3ZXAC 5K0UC 3KSCA 1BEV2 3H3ZA 1UF2C 2PHWA 5BNNC 2GNTA 1PO11 4YARA 1QGLA 3WUDA 3CJIB 2IC1A 4LBQA 4NWWA 1QOOA 1RHI2 4IV1A 2CAUA 5FLIA 5GLVA 4X8PA 2VW0A 1S2BA 1ZBE3 2JE7A 4HKLA 4XBQA 4YVWB 1D4M2 1VBA3 3AM2A 3VDDB 2QDRA 4HFSA 2OZJA 1H2KA 4Z82A 4S2HA 2D6NA 2KXLA 2YPJA 4RSUA 2TNFA 5FQ0A 3POWA 3BODA 2GZWA 2ZA9A 1XXNA 4DQAA 2HWE3 2VECA 5BNPC 3GALA 1AXKA 2AREA 3HAGA 3GBWA 1TMF3 5EYYA 3WCSA 2A70A 5DUWA 5LK5A 3ZFFC 3QD6A 1DQ4A 4XPVA 1O4YA 2HYKA 4JRLA 4LO7A 4IETA 5HI0A 4YZ1A 4LO5B 5FMOL 1Y7BA 1LHNA 1HRV2 1QJY1 2IWGB 1IKPA 4Q4V1 1G6NA 2QQPA 4BE3A 1LECA 1UU5A 1OQEA 3WLUA 3OGJA 5H9PA 1OKQA 2WZR1 3FMGA 1SBDA 5KXCA 2XKOA 5KHKA 3AKQA 3TYJA 4XXPA 2NYYA 3VBHA 3A0KA 4QGMA 5AC92 3WDYA 3KZ4C 1HRI3 1PHMA 4J1WA 3N7JA 3N7LA 1R1A1 4IV1C 4V1PA 4AQSA 1GZCA 3O0XA 1LTEA 3ZX7A 4DINB 4C90A 3MICA 4ZU5A 3M8LA 4DY3A 5JSPA 2VOVA 2VQ0A 4XMAA 3R4SA 4WBBA 2WNVB 5A33A 2BVBA 1O7FA 3QOPA 4WM7B 1DG6A 3NL1A 1A6CA 5IK7A 5GALA 2CV6A 2Y26A 2JD4A 5EYXA 3WG4A 1H8TB 4E4SA 4LBNA 5DZFA 4CDWB 2R1DA 4Q8KA 5AFEA 1R082 1H30A 2ENRA 2E7QA 3FC0A 3I4IA 3Q9OA 1UKRA 1SDWA 2D3PA 3SCGA 4C91A 2CGNA 3AP7A 3IMNA 4MX3A 3WG2A 2H6BA 1MEC1 5A32B 2XH6A 1OMIA 1AR71 1ZA4A 4IEVA 2EF6A 5CB7A 1SBFA 1LESA 5HCBA 1CR7A 5E16A 1RUE1 1I9RA 3FBMA 3VBHC 4BWOA 5FRAA 5CFDA 2E6VA 4EN8B 1D0HA 2PLV3 1RUNA 2N7GA 5FLHA 2E7AA 3AP6A 5K8SA 1C1LA 3ZN6B 1H8VA 4L11A 2GDFA 1YFYA 1CAVB 3KD4A 4YW2A 3MF6A 3S0MA 4XMIA 4Q29A 1Q8PA 2V09A 4D3WA 1C28A 4LE4A 5JIUA 3DV8A 1ZRCA 1S0JA 4GB33 4N9IA 3J9SA 3LKJA 4ASMB 4K3UA 3W59A 4Q4W2 1BEV1 4AF9A 2IZWA 2DVAA 1LU1A 2DVDA 1CGPA 3KLSA 3MDPA 3ST7A 1PK6A 4HVOA 2Q30A 2D3SA 1PM7A 1UN1A 3AXEA 4NHMA 3D6EA 4I2OA 1RHI1 3VV1A 4JVAA 1F2NA 2PA7A 4QGLA 1D4M1 5CAZA 2HEWF 3VBSA 1K5MB 5J3UA 5ABJA 3FWEA 3USSA 4AFDA 4ZKTB 4ASLA 3A0NA 5I0RA 4FTEA 2AH2A 1QJX3 2QCSB 3C2UA 3IPVB 5GZEA 1WGPA 5DDJ3 3HN1A 5GLZA 5CFDC 2JG9A 1V70A 2VPVA 4XE9A 1YCIA 4L9BA 2X5IC 2PHFA 3VHPA 3MFAA 2VVDA 2JE9A 4XTPA 1JBCA 1DZTA 4XBLA 1OQDA 1R092 1HV0A 3AYCA 2DF7A 3H7JA 4JTNA 1YJLA 4IEXA 1HRV1 5DG2A 3FLPA 2WJSA 3EXUA 3WW4A 2YZ4A 4EN9B 1FOD2 1S0EA 1WLCA 4WM8C 4CP1A 3L2YA 5ACA2 3MGUA 1IPKA 3AMMA 1B35B 4QU2A 4XILA 5AC91 1EV13 5CA6A 5AVPA 5JPMB 1VJ2A 4CYDA 4RQPB 1FV2A 4OI2A 4ITCA 3FBYA 4I3GA 1XRUA 4RL7A 1GQHA 3CJIA 3KQRA 4XETA 3VBSC 3KGLA 4Y20A 1Y9QA 3H3UA 2D44A 2WT2A 5ABJC 4QT6A 3VBOA 3IDBB 5JCTA 1VR3A 5GZFA 3GZTB 1S0GA 3VDDA 4BMBA 2EXKA 2EIGA 4RHV2 2VY0A 3WP5A 3G6JB 4E4DX 4QQOA 1W6MB 4GXLA 4IXLA 3BPZA 1EP0A 1VAMA 4LBLA 4A7KA 1ZRDA 1POV1 3NVCA 5T50A 4NN0A 4N9HA 3SLIA 3VZNA 3AP4A 2R0HA 1V6OA 1C3HA 2H0BA 2JKBA 4FVVA 3S7EA 1JYCA 2NM1A 3SISA 1KDMA 3AMNA 2D5FA 4X6RB 2CWSA 4KG0A 4PDWB 2RS33 4P5HA 4Q0SA 4CEYA 2HJIA 3WOGA 2VULA 1SLAA 1OA4A 2WNUB 2K0GA 2PN5A 5FFOC 3WG1A 1LGNA 1YHFA 2A3XA 2I07B 3ZMNA 1TE1B 1YRZA 5CU1A 4MV2A 4DY5A 1YWKA 3CJIC 2O8QA 4KWLA 1RUI3 1SCRA 3VBOC 1J1TA 4LO6B 3VDDC 3AZYA 3TNQA 2BNMA 1EYBA 1QQP1 2WNVA 3MFCA 4Q4W1 1GNHA 4WM7A 4PLMA 3IM0A 4AVBA 3ZFGB 1RUJ2 3ZXFA 3E5XA 4BM8A 5JZGB 5KHHA 2VH9A 1OPMA 2ZMLA 1H8TA 1MS1A 3NSTA 5GKAC 3ZSKA 1ULGA 4G4FA 4NOTA 5CFCB 2Q8OA 3H1YA 5FO8B 4WVMB 1HW5A 1RMU2 4OZXA 4N7IA 1R083 4CDQA 3MIEA 3R4DB 2VOWA 4DRVA 4FO9A 3L9JT 2ZGNA 1N1VA 4QMAA 4P14A 2ZGKA 1OLQA 1Q56A 1TQ5A 1N3OA 3GNEA 2CYFA 2W52A 4KG8A 4LTAA 5GM0A 5I8SA 1NA1B 1ZVFA 2ARBA 3SXWA 3JZVA 4YZ5A 1V9U2 2QFEA 4C0HA 1ZRFA 2A71A 4LBJA 3W9AA 2NPIA 1R091 2ZZQA 1HKDA 4Q4X2 4N53B 4SBVA 2DUPA 3ZIWA 3FLRA 4E4ZA 1GNZA 1ZZCA 3MLLA 2Z42A 4IESA 2WNVC 4OFGA 4Y1YA 1FOD1 3AZXA 4AEJA 3CJXA 4WM7C 2R062 5KHJA 1N1YA 1ALYA 2D6OX 5T54A 5T55A 5ACA1 4KBBA 4AQ2A 4PLNA 3UJQA 1KS4A 4HN0A 4Q0PA 4BIOA 3R0RA 4GWMA 4H7LA 3DUIA 1H8TC 3FFQA 3UJOA 2WQZC 3JQWA 4CDWC 4MH0E 4QQHA 1G9DA 3WG3A 2ZCWA 4GMP3 2RS53 1QOTA 4CDQC 1LKNA 1KS5A 1ZRRA 5L73A 4YM1A 1ZBE2 4KNCA 4QPIB 2ARXA 2YMZA 3AKRA 1VBA2 1K5MA 4I02A 1CPMA 4F7ZA 4GALA 4RHV1 1S0FA 1LCLA 1G9CA 3OD4A 3USUA 1MS3A 4GULA 1Q8SA 2O8OA 1LEMA 1QXJA 1N3PA 3V64A 5C8CA 3D5OA 3RSJA 1RINA 3DPRA 4R4XA 3RDIA 5LRRA 1SEFA 3RRDA 4N43A 1DYKA 3OPZA 4JV4A 3N4MA 2VNOA 4KWJA 2A3YA 4XJWA 1FNZA 4XTMA 5DZEA 1SLTA 2PAKA 1OI6A 4RS5A 3TN91 1X8EA 1AX0A 2W39A 5EFUA 3MZHA 3GF6A 5IK8A 3MPPG 1UZYA 2ES3A 3OBTA 3PJQA 3DF0A 3QCWA 1WCSA 1WCKA 4HLTA 2XJVA 3KT7A 3JD72 4LHKA 2WFF3 1RUH2 2EXJA 4A2UA 4R9AA 4W65A 2WIIB 3ZDSA 1KJRA 2HEYF 1JW6A 1JUHA 2R16A 1IGOA 3A4UA 4GWNA 1BZWA 4LBMA 3W58A 4ATEA 2HWD3 1HRI2 4HK8A 4RQPA 4CEWB 2R32A 4UW4A 4YM3A 2WFPA 5JMCA 4AFAA 4LA2A 4AK3A 1K5MC 2XJRA 4AHWA 4B4PA 2VMHA 1FPN3 5F5QA 1NXMA 5J36A 4ORFA 1GICA 4XF4A 3EQEA 5EJ3A 1J3PA 1RUJ1 5J7MA 5C8CC 3AYDA 3LGRA 4DFSA 1C4RA 1LJ7A 1W6MA 1YYNA 5FBZA 2WSUA 2DWRA 1W6PB 4KL1A 4XOGA 5H9RA 5JVVA 4OHYA 1RMU1 1ND3A 2BEOA 1H2LA 2W08A 3B00A 4MGIE 1BMV1 2RR12 1ND2B 2O0OA 2A3WA 1R1ZA 4AEDA 4PDWA 5T5LA 4YSFA 1GZWB 1COV3 4Y1XA 1NY71 4LEJA 3WCRA 1JN2P 1J3QA 3ILRA 1JTZX 1O91A 3BTAA 2WNUA 1VBD3 1V9U1 1U0AA 4UW6A 2LUWA 2CL2A 3OTFA 1EY2A 1ENXA 1S0IA 1A8DA 2UWBA 2D6PA 4BH9A 2PLV2 4RQPC 4PCRA 1U5YA 4XJZA 2A75A 4XZPA 4A7YA 3I7DA 4LO8A 4ES8A 2XVLA 1XNCA 3OYWB 2OZ6A 4XFAA 1LOAA 5GLUA 4AVVA 1LOFC 4XBNA 2IXIA 1FMD3 4CP0A 4XEZA 1HXS2 2OPKA 2R061 3ZYRA 4GB32 4O9GA 4I0BA 3ZN4A 3H1WA 5KHIA 1DQ0A 4BIFA 2BTVC 4JDMA 3ZXDA 4RGGA 3RG0A 1HX6A 3VZMA 1VLNA 2VUAA 1DQ6A 3PTYA 3AKTA 3B7MA 1BVVA 1SACA 1V6LA 2DUQA 4OI4A 3VLBB 5JZGA 2D5HA 3U0ZA 5H9SA 3P3NA 4CDUA 1LULA 5K0UA 3FLTA 1I5ZA 5CFCA 4M01A 5E1RA 2ZHMA 4WVMA 1G9FA 3VUOA 5BNNA 5BNOB 4TZDA 1ZBE1 1TNFA 2YY1A 1VBA1 3K48A 3AMPA 3CO2A 4PDWC 3AYEA 3WW1A 4DNYA 4XHXA 1GZ9A 2DCKA 4JC1A 3ZYJB 4C1XA 1MQTB 3E5QA 3R4UA 4FPKA 4QPGB 1EPWA 3MW4A 3AX4A 2D97A 2WNUC 1QJX2 3K51A 4GMP0 5DDJ2 5T5PA 4DOUA 2A6XA 3PJYA 1CAWB 2VW1A 1DGWX 3ASIA 1FXZA 4F3JA 2D3RA 4Z8BA 2HWE1 1H1IA 4OI1A 2DVFA 2GMMA 1TMF1 2DCJA 5FAXA 2R49A 4P9IA 1S55A 4YYOA 1MS8A 5BNPA 4N53A 3B5LB 4Q4X3 1Z0HA 3ILNA 2MHFA 4KU8A 3BB6A 1E57A 4E9KA 4HK9A 2XWJB 3IWZA 1ZNPA 1MS5A 1MZ6A 4XFCA 1Q3EA 4AI2A 3ZFGC 1SLCA 1AJOA 1ULEA 1NXD1 3O5SA 4DRRA 5JZGC 4QX5A 1ZYBA 2PAEA 2C0ZA 1HRI1 4XHBA 4CDUC 5CFCC 4AE2A 3VBFB 1RIRA 2ZOEB 1IHMA 4COYA 1YLLA 3MF9A 1QXRA 2DFCA 1PZ9A 1BQPA 2B46X 2LTNA 4QPIA 2DCYA 4RFT0 3T1MA 2DU0A 4L92A 2HWC3 1X33A 4FT8A 4LLOA 3RYRA 1VIWB 3WQ0A 4JGYB 3KCYA 2D98A 4R9DA 4U2AA 1MACA 4KU7A 3PVBB 2B7YA 2ZABA 2BYVE 3JUUA 4AWDA 4N53C 3O14A 4LUKA 3PHMA 5T5JA 1F5FA 2RS32 2WQ4A 4RR3B 1W6NB 3ZSMA 3CL1A 2ZHNA 4M0NA 1GQGA 3I8TA 2ZGRA 3B3QE 2Q1ZB 3B69A 1UCXA 2UY9A 3AZVA 1CAUB 1NG0A 2GH2A 3B9IA 1M4WA 3P3PA 2WWSA 1DU3D 2PLV1 3JD73 3HWJA 1RUH3 1RVF3 2H0VA 4A7ZA 2XB6C 4KGGA 1XYNA 1HXS1 2GALA 1KRIA 1JH5A 2ZACA 4YNIA 3ZYPA 1RUI2 1HQLA 4FOWA 4GB31 5C4WA 2MPFA 1DGLA 4QPIC 4CDXA 5C9AB 3LZZA 2XBO3 4HKWA 2GC0A 1APNA 2VGDA 4LT5A 4MGKE 4U36A 5BNQA 1NLRA 1J59A 1M06G 1CPNA 1VALA 1OFSA 1H1MA 4G3YC 3RJRA 3LOBA 3VBRA 1QXPA 2IXLA 4GKXA 4RD7A 3ZSJA 1AR93 1QKQA 2RS13 5JI7A 4OHZA 1ULDA 1ULCA 1WLDA 4MYEA 5KHGA 3PNAA 1TME3 4L8QA 4XFGA 3WUCA 1G7YA 3H9AA 3LCPA 5JWPA 2RR13 1LOGA 3ES1A 1QJX1 4EWEA 2XKPA 1KXGA 2Z5WA 4PBOA 4ONUA 4UBHA 5DDJ1 2LM3A 5I8TA 3ACLA 4XIKA 5JI9A 4Y1ZA 5I91A 3NWKA 1AVBA 3LWCA 4XF3A 1D4VB 1OHFA 5KXEA 1A78A 1WBLA 1O5UA 5I8YA 1VBE3 3H50A 2XUMA 2W68A 2ZMKA 3WDVA 1NCRB 3E6DA 4CP2A 2VG9A 4P9JA 3OYWA 2X5IA 2ZGPA 5C4WC 4CDXC 3FFZA 3KM5A 4LA3A 2ZGSA 3ZXGA 3ENRA 1HXS3 4D7TA 4DZGA 4JRAA 2Y0IA 1VBC3 1LHWA 5I93A 3O0VA 5L7OB 3VBRC 5F6KA 1PGW1 1EV11 3GYDA 3UKNA 1EPZA 5I0UA 2ZX4A 1FNYA 3SH3A 4IEZA 5CIRA 1TEIA 4WM8A 2ZKNA 3IKWA 5J96B 1NOVA 3WR0A 3L2HA 4UW3A 3RWNA 3VKLA 2RS52 3ZXEA 3HR9A 2Q5TA 2ZAAA 2R30A 2RM23 4L97A 2YYOA 2BVVA 3I59B 4YW3A 1X8MA 2F4PA 4BLIA 3M1HA 4LHNA 3JBG3 1WLWA 1UW8A 3NAPA 1EAH3 3FJSA 2Z2SB 3FX3A 2ZPXA 2EAAA 1UAIA 2GAUA 4I3PA 4XF9A 4XQ4A 1I6XA 1GR3A 1OOPB 2XPJA 3JU9A 4Q4Y3 5JR7B 1BBT3 2XLGA 3SCHA 3WT3A 5HCAA 1QNYA 1UIKA 2RS31 1UMZA 2FMDA 1IS5A 2RHPA 1GANA 4XJUA 4DXZA 3DGTA 2AZ5A 4GH4B 4AQ6A 3M3EA 4NR1A 4OI0A 2A73B 1FAYA 4I30A 4OHWA 1QH7A 3AZWA 3PVOA 4LBOA 1C8M3 2GN3A 3BOWA 3MIHA 4YGCA 3ELNA 2WFF2 5JIAA 3PVNA 1X50A 4EN6B 2VNRA 1Y43B 4INDA 1W0OA 3FUOA 3VBUB 1QU0A 2HWD2 3ZO0B 4WVWA 2KA3A 4B7KA 1RUI1 2OUJA 3ZYGA 5BY5A 4JGZB 2E9QA 1QJU3 5C8WA 1GV9A 1FPN2 1W0PA 4QPGC 2NP0A 3NAPC 4EN0A 2FZ1A 1DIWA 3KCXA 2A5ZA 4YVWA 4IEUA 4AEKA 4Q0QA 2IXHA 3N35A 2K9ZA 2XJPA 1WCDJ 2WC2A 2VXRA 2BNOA 5L36A 3B02A 4C1WA 3RZZA 4J1XA 1R081 1QY4A 3H8UA 4META 3UL2A 3NO8A 5JOWA 1COV2 2PHTA 4XJAA 4XW3A 2CGPA 2A6ZA 4P9YA 3E6BA 3AYAA 2R0FA 1O5LA 4G9SB 2YXSA 2R043 4Y22B 1DZRA 1RUC3 1VBD2 1GFF2 3ATGA 1MS9A 2HKXA 2BW8A 1CAXB 2GN7A 1C1FA 4M3CE 4C0BA 1IQAA 4XIOA 3ZPYA 4D69A 4ATFA 1KJLA 1FMD2 3SHRA 2P3IA 4FAGA 1XYOA 1SLIA 2O1QA 1JXNA 3WINE 4FAHA 3AMHA 1LENA 4HETA 2WKKA 2XWBB 1UD1A 5GZCA 4YVWC 1LEDA 1DFQA 3EBRA 4M3CB 4R9CA 2WT0A 2ZZJA 4A3XA 1W6QB 4BOWA 2DYCA 1XQNA 2ZBJA 3NV4A 4YW5A 2HEVF 4XJ8A 1WMEA 1X82A 4GMP1 1RUF3 4YG0A 2RS51 2ZGTA 3RPQA 4HANA 3VN4A 3BU7A 3QH6A 4CDWA 2WLPA 3VZJA 4YVSB 4HN1A 4AXOA 2OIIA 5BUVA 4R4ZA 1WD3A 3LSDA 4EV0A 1PVC2 3TOJA 4K9SA 1H4GA 3IN9A 4LBKA 4M3CF 4AGRA 5A32A 4I09A 1WW5A 1SFYA 4S2GA 4MXWB 2EVXA 3U4XA 4MVTA 2UY8A 2BBVA 4F8AA 4YM0A 1H2NA 2P2KA 1NCRA 5GZGA 1PVXA 1AR63 1D2SA 3INAA 4N7UA 3ZN6A 3FUQA 4EWAA 2I2SA 3ME2A 4GQ7A 1CAVA 5CBLA 4J6GA 4GIQA 4YG6A 4B8EA 2ZGUA 3BOPA 2WA4A 2WFF1 5E88A 2NMNA 1C57A 5JLVA 1D0GA 1ENRA 1PIV3 5L7OA 2ZGMA 4AHYA 5KXDA 2HWD1 4MXVA 4YM2A 4MGZE 1ZZBA 2Y38A 2XJUA 2RE9A 4NWVA 4XXAA 5A3MA 4NO4A 4MUVA 2XJSA 2ZS6B 1VBB3 5I0TA 1FPN1 4KH9A 5FO7B 5KXBA 2W0XA 4EWDA 3V56A 2AGSA 2JG8B 4FBFA 3S30A 1QWRA 1X36A 1MZEA 3I59A 1IOAA 1AYM3 3IDCB 4AQTA 3GBFA 3OY8B 3ILFA 4COZA 3V0BB 1F8VA 2HWC2 4Z07A 5F1RA 2ZX2A 2K2SA 3LB9A 4KWKA 4IERA 3IPVA 4QD2A 5CNAA 2XHKA 2VMIA 4W6YA 4Z1VA 4HPKB 4H14A 5JOYA 2R073 1VRH3 1NCRC 1AJKA 1ENQA 3U10A 1WBFA 3WV6A 1COV1 3QBQA 4TSVA 2EXHA 4GH4A 3D8CA 4EJRA 4HSLA 4GA9A 5DUXA 1KITA 5JPNB 2ZX3A 1VBD1 4AVSA 1FV3A 2OUHA 5L7OC 1AR83 2NQYA 3JB8A 1WMDA 1MZ5A 1DQ1A 1WD4A 3TBDA 2DVBA 1RVF2 2ZX1A 3PLQA 4LO4B 3IDEA 2BUKA 1OA2A 1FMD1 1B35A 2WS93 1BYHA 3VHRA 4BCUA 4FTBA 4YGEA 1ZBA2 1IZ3A 4JGZA 5DG1A 2ZGLA 1S0BA 4COWA 1LOFA 2XBO2 4ISQA 2D6LX 4P9XA 2B39A 1ZZ6A 5FDBA 2QKDA 2DURA 4FQ4A 1IS4A 1AF9A 4WZCA 2PELA 2Q4SA 2PFWA 2E63A 2E7TA 1OOPC 4F83A 1ASJ2 1AR92 3NKTA 4MLOA 3WQ1A 1C5HA 2G9GA 2RS12 5CADA 5JAXA 5KC6A 1MR5A 3VBHB 2TEPA 1LRHA 2ZAHA 3N7MA 1NLSA 1TME2 1T6GC 2EALA 2UWAA 4Q0UA 4GH4C 4XFHA 3O7OA 5A33B 4FPCA 1YFWA 4EN7B 4Y4YA 1KD7A 4Y1UA 4E2GA 5BPXA 3WXPA 3TNPB 4Y22A 1RUD3 4PLOA 3GBGA 4X6QB 1QF3A 1I1EA 2PAMA 3O12A 3VBUC 1LOEA 1VBE2 1YUDA 1Z7S3 1B35C 1WUVA 1RUOA 1PNGA 4WVVA 3D0JA 2HWB3 4JGZC 4Q4X1 5LEKA 5TSWA 3AJYA 4ZXKA 2CNAA 1RUG3 3HIFA 4K6BA 1H1AA 3DN7A 1VBC2 1BXHA 2CWMA 2BPA2 1POV0 2ILMA 1NCQB 1PO23 2XL9A 4I0AA 5DUUA 1AYN3 2D93A 1LODA 3M2MA 2BWAA 4Z92B 1SQ4A 5LK7B 3WP3A 2ERFA 3ZFGA 5CFDB 4IEQA 2D7FA 1A3KA 3VL8A 1V00A 4IV3B 2ETEA 3ROUA 3CLPA 1DZQA 1OPOA 2RM22 1R1A2 1U5XA 4FOQA 3NJZA 3GHNA 4AFBA 2OA2A 1WW4A 3JBG2 2HWC1<