3KT4A

Crystal structure of tpa1 from saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
615
structure length
563
Chain Sequence
EEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYELYMMDDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PKHD-type hydroxylase TPA1
publication title Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 183
structure length 563
sequence length 615
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3kt4A01
2.60.120.1580 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kt4A02
4NHMA 2HBTA 3BVCA 4BQWA 3GJAA 4J25A 4XACA 5IAVA 4NHYA 5M0TA 3NNJA 4XAAA 4XCBA 3DKQA 5EP9A 5C5UA 4XCAA 5IAXA 2OPWA 3MGUA 3ITQA 5LBCA 3GJBA 4NHLA 5LBEA 5DAWA 3HQUA 4BQYA 5IATA 5HV0A 3KT1A 3OUJA 5L9VA 5EPAA 2G19A 2V4AA 5LASA 2RG4A 3KT7A 3OUIA 4Y5SA 4BQXA 2FCVA 4XABA 3HQRA 2JIJA 3W20A 3OUHA 5ERLA 3NNFA 4Y5TA 3NNMA 2Y34A 2RDNA 5LA9A 4Q5OA 5LB6A 3PL0A 5LBBA 2JIGA 5L9RA 2Y33A 4MHUA 5LBFA 3KT4A 2A1XA 4MHRA 4UWDA 3NNLA 3GZEA 5L9BA 4ZONA 2RDSA 4NAOA 2FCUA 3W21A 5DAXA 2FCTA 3OBZA 4JZRA 4NHKA 2RDQA 5HV4A 4NHXA 5EQUA 5C5TA 5DAVA 4ZPIA 4IW3A 2RDRA 5LATA 5DAQA 2G1MA 4XC9A 5DAPA 2HBUA 4KBZA 5A3UA 4NMIA 3EMRA
chains in the Genus database with same CATH superfamily
4YW2A 1FOD1 5FQ0A 1QMJA 2QBXA 4YG6A 1O8SA 2F4LA 4CRQA 3GHMA 2BOJA 1ULDA 5DDJ3 3ILFA 4BQWA 1H2LA 2QJVA 4N53C 1TMF3 4PDWA 2OW4A 2A6WA 4MGYE 4ZXEA 2QDNA 1OLMA 4WVMA 2N7GA 1SLLA 5FV3A 3FZ3A 2IXJA 3ZYGA 1OD3A 3PUIA 1W8ZA 2HWF2 1OH4A 2D3SA 4R4XA 1BLZA 1AYM3 2W87A 3VBUB 3BPSA 3HVDA 2WNVC 3J4UH 1GZCA 1WMEA 5FY0A 3HJRA 1DG6A 2P1BA 3CDZB 3MIEA 4B8EA 3LIHA 2LS6A 5D21A 3BN6A 3WW4A 4DXZA 2IUWA 1UZ0A 5C5UA 1IKPA 1VLNA 4QXHA 1NA1B 1UQXA 3LEIA 1IPSA 3RNSA 1MPXA 1WLWA 2CDPA 3K3OA 3T0BA 4QQ2A 3RZGA 3RZLA 4P9YA 1A8MA 3D8CA 3KCCA 1VAVA 1X7NA 1XBFA 3IM0A 1YQ6A 3EB7A 4AHWA 4DXRA 3OUJA 3I2GA 4U2AA 5L9VA 1WMDA 4HKOA 4QKBA 4XHXA 2VL4A 2VC9A 3VD5A 1Q56A 1FMD3 2A6VA 2XBO1 2E63A 1ND3A 3R0RA 4FI9A 2OZJA 3NL1A 2NLRA 4QQOA 4TLGA 3ON7A 4BQ1A 2E9QA 1OFSA 5T5JA 1QDOA 3JUUA 5FYYA 1POV0 2RS52 1EAH2 2JKXA 3ATGA 2VOKA 1XRUA 1PX3A 1U5ZA 2BYVE 5G05L 1QGLA 1BJQA 4E9KA 3K3NA 5A3WA 2J1EA 2XVGA 3C7HA 5IVJA 2HWF1 3AL6A 4LNVA 4M01A 4N43A 1D7PM 4RL7A 4COUA 4MVTA 2XL9A 2P3KA 4QAWA 3EJKA 1SLAA 1JZ8A 2H6BA 3ZN6B 4GXLA 2JKBA 2GH8A 4YWAA 3AP7A 4QKFA 4QKDA 4RA0A 5FLIA 3IPVA 5GZGA 1GV9A 1VBB1 3AXEA 1BK0A 5CADA 2WWSA 3ZLIA 2X53S 1J3RA 1UKGA 4B1MA 3DPRA 4JAAA 5FXVA 4AXOA 5BNPA 1RUG2 3Q9OA 4B7KA 2R7EB 1ZZ6A 4PCRA 2Y6LA 2HWC1 4LMFA 1UIJA 5C3QA 1JOBA 2HWB3 4CDUA 3WF2A 1DYPA 2Y0IA 3AB0A 5FXXA 1Z0HA 2FMYA 4XZPA 4NUBA 1WCSA 2XLGA 3POBA 3WP3A 4XFFA 3FX3A 4AGGA 1OQ1A 1Z7S3 1KDKA 3OPTA 1RXFA 2WKKA 1Q8PA 1ZBA3 4IV3A 5C6CA 4AEKA 4XUOA 3HNYM 4G4FA 5EQUA 2Z2SB 4GA9A 2DV9A 4PLOA 1C28A 1VBA3 3MW4A 4V2WA 3TBDA 3O5SA 1WUVA 5CIRA 3UT0A 2D5HA 2R49A 2FZ2A 4ATFA 1QJZA 4QPWA 4XW3A 2ZAAA 3ES4A 1ZBE3 5FYIA 4C1WA 1RUE1 1UOGA 3KHCA 3OEAA 4KBZA 5FMDA 2ET7A 1CONA 1KFUL 1F8VA 5A3NA 2G9ZA 1RUG1 1LESA 1OOPB 4XHBA 3ZN4A 3MO4A 2Q5TA 1RUD3 4RHV1 1TME3 1W6NA 4Y1ZA 1VB2A 3DYOA 1B35A 3BIWE 5EV7A 3I49A 3UKNA 2WZR3 3U4XA 4GJZA 4URTA 4OHXA 4LA3A 2GNMA 4D3WA 2CY6A 1US2A 1WCQA 3A0NA 3H8UA 3IDCB 3RYPA 1OPMA 5CKNA 1JYNA 3CJXA 1FNYA 1V6LA 3KCYA 1RUF3 1I5PA 4DPNA 1ZRRA 4YM3A 1TEIA 5CG8A 2X10A 5BNNA 4AI2A 4LBOA 4NIAA 1RGSA 1O3SA 3PVOA 1ALYA 3AVSA 1PK6B 2EIBA 2YBPA 4QQPA 5HI0A 3SMHA 1D2SA 3T08A 1BK1A 2C0ZA 1L3JA 1ZRFA 1OVPA 5LBCA 3SCFA 1A78A 3MIBA 1KEXA 4Q1RA 1JYWA 2AACA 4FSJA 2ENRA 1XB9A 2WNEA 4BQYA 4AVBA 4Q4Y3 3ZFFC 1RUC2 1UMHA 4CSWA 1W8TA 2YGLA 4FPJA 3TEYA 2R042 2E51A 1YXWA 4DUXA 4G3YC 1X8MA 2PLV2 3O12A 3BKZA 3RRDA 2Z69A 4A41A 1QQP2 4RS5A 4FTBA 1R1A3 2AYHA 4Q27A 2JE8A 2JIJA 5DPNA 3OUHA 4LUKA 2J1VA 3CJIB 3IMMA 3UGGA 1LU2A 5ERLA 1S2EA 2YHJA 2VBBA 5I0UA 5SV5A 1YO8A 4JDMA 3M3EA 1GQPA 5KHGA 3KLSA 4TZDA 5BNQA 5CFCA 3WF0A 3OGGA 1JUIA 5I8SA 5LA9A 4D69A 4Q4X1 2Y8KA 1WW7A 1NLRA 4GH4C 4CEYA 2FDHA 1AXYA 3B02A 4MSVA 1NY71 3UJQA 3PUQA 4R9CA 1VRH1 3JBG2 2PTMA 3VHOA 2DCYA 1DYOA 4IL7A 4DXSA 1WW5A 1FV3A 5GJ6A 3SCHA 2YDEA 1W0PA 1WD4A 4YM1A 5E8AA 2QNKA 3H50A 4JKMA 3DF0A 4MADA 1UMIA 4OVEA 1MQTC 2VNVA 4QB6A 4ZU4A 2FQPA 1UXXX 2WN2A 1FATA 1AR72 3PDQA 3L2HA 1QXJA 3NJZA 4LKFA 1DU3D 5F5IA 3WDUA 2CU5A 2BP6A 5FYTA 2IXIA 2FZ1A 4J1WA 5CFDA 3I2IA 4CP9B 4Z2WA 4OFGA 3OBZA 1WLDA 1CX1A 2ERFA 1C3HA 5E1RA 5ABJB 2MNGA 1DCSA 4E4DX 3RZMA 1QIQA 5EFUA 4EQVA 1F5FA 3J26N 4QPIC 4JRAA 4LO4B 4AEJA 3T0DA 5DZGA 3AZWA 5FKBA 1W8OA 1H4HA 4AEDB 1U5IA 4BK5A 2D93A 2X29A 4LBQA 5FYHA 1V6KA 3F2ZA 3PJYA 3PVNA 3Q8EA 4NRPA 3ZXJA 3GCXA 2YU2A 2ORZA 4PQ9A 4QPGA 3U07A 3VDAA 4E4ZA 3IWZA 3N7LA 4E2QA 1ND3B 3SLIA 4IEWA 1W2OA 4GWIA 1D4M3 1SBFA 4HK8A 1ZX5A 3I3EA 1MS5A 4QHOA 1UX6A 2C26A 2AGSA 4GMP1 5I91A 3VD3A 5C4WB 1FPN2 4RGKA 2XBO3 1ST8A 1AXKA 3IB3A 3RFRA 4L92A 4BLJA 3KWVA 2XHKA 1MVEA 1GANA 1W6QA 3AKPA 5KHKA 2B9VA 1DGWA 2VAUA 3RYKA 1UZVA 1TQ5A 2B7YA 2QQWA 3IZOA 3WDXA 3LA7A 1AJOA 3ZSKA 4FFIA 1ND2A 3A23A 3DKQA 4MXVA 4YW3A 2Q30A 4CUCA 4D94A 3IPVB 1LGNA 3ALQA 1BMV1 5C71A 1XNCA 1KJRA 2HWE2 2V5YA 2RHPA 3E5QA 3M3OA 4FPKA 4XF4A 3SCGA 3U10A 3VBHA 3SEEA 4PIZA 2OPWA 3MPBA 1JMUB 2BNNA 4YGBA 3FL7A 5DZFA 3T2OA 5BNPB 4DS0A 1RIRA 4MYEA 5LBEA 3IIAA 3HQUA 1VAKA 1X50A 1UY2A 1VBB3 1DIWA 4AEMA 1H1MA 3MV01 4LPLA 4W50A 3IKWA 1H9WA 2G19A 2D7FA 4KU7A 5LASA 3JXSA 3KT7A 5AVPA 1D0GA 1LCLA 1AL23 2DCJA 2HWC3 2WO3A 5E89A 1VBC3 3BTYA 4MO3M 4NWWA 1ZRDA 3OOXA 1QJEA 5C8CC 1WZXA 4AGVA 5FIXA 2X5IA 4BM8A 1ONAA 1XXNA 2AZ5A 5LY1A 4YW6A 2XQXA 1O3TA 5LEJA 5GZFA 2RS32 4N90A 5DUUA 1LU1A 1Y7BA 2ZGRA 2CSGA 3ACFA 1ENQA 4Y24A 3GZUC 2QQKA 2RJLA 3HR9A 5FZ7A 2DBNA 4N9IA 3U75A 5C3PA 3QACA 3MF6A 1KITA 5D8AA 3WNNA 1QY4A 1W6NB 3M3IA 1ASJ2 2ZHMA 4PIXA 3VBSC 2VTFA 4D7SA 5IFTA 1RUE3 1COV2 5JZGA 3BTZA 4ORFA 2UWAA 5A7WB 2WFF3 2QQLA 3MW2A 3PU8A 1UOBA 3JD73 3PVEA 2UY9A 3BALA 2WO7A 1JXNA 5L73A 2ZACA 2P37A 3RZKA 1PGL2 3THTA 4FFHA 1ACCA 3LEGA 2RVAA 2UYAA 2BGCA 3EHKA 4OHVA 4S2FA 3THDA 1OXCA 3INAA 4CCMA 5JXGA 5GLWA 5FLHA 3C8XA 3AP4A 5A7PA 1WCUA 3V64A 4LK7A 3RZZA 2FCTA 2RS12 2ZGTA 3AJZA 3THCA 2DBIA 4ASLA 1W6OA 3LA2A 1JHJA 1N3QA 2Y26A 3G7DA 4NROA 4RR3C 4RSUA 3OD0A 5IVBA 1DQ1A 4JKLA 4AQ2A 3J8F3 1K5MA 2XJRA 4IW3A 3NAPB 1CAXB 2JB4A 5DAQA 4D8MA 3LEMA 3DYPA 4ONUA 1M4WA 4FQ4A 4Y3OA 4KNCA 2G9GA 4QX8A 5FO7B 4AVAA 1O59A 2A3WA 4CEWA 1LEDA 1G86A 4NMIA 4LULA 2JE7A 5ANQA 3KS7A 2ZGOA 1AR63 4RS5B 2ADDA 1QJU2 1OSGA 2JG9A 3WCSA 1RUI2 3AP6A 4CZSA 1PGW2 2AEYA 4I3PA 2ZMLA 3Q8FA 1K45A 1ODNA 1VIWB 1X33A 4J25A 1NCQB 4W6YA 1JOPA 3H8RA 4OZOA 1JN2P 2D6OX 1C8M1 4YLZA 3LDRA 1PVXA 1UY0A 5CFCB 3O0WA 4NHYA 3NNJA 2XUEA 3AKSA 4LKDA 3SC7X 3POJA 4P00B 1AX1A 4LBNA 3D4KA 4R9DA 1UU5A 1QJY2 3IIIA 1H8TC 3FFZA 2PMWB 3Q8CA 5H9QA 5JPMB 1SACA 4X8NA 4Z1VA 2KXLA 4QDSA 2K9ZA 2CNAA 2WBKA 4OZXA 3JZVA 4XCAA 3WNKA 5FZ1A 5IAXA 1JW6A 2LRPA 4Q4X3 3U11A 4F3JA 5EYYA 5FZFA 1V6OA 4MGKE 1US3A 4N8MA 4IV1C 1VRH3 1YJLA 3GJBA 1JI6A 4NHLA 4CXXA 2YY1A 4QXKA 4BH9A 5CISA 2PHUA 1V6NA 2FDGA 2XJTA 1JZ2A 2JWPA 4QHZA 1MZ5A 3MIHA 3VBFB 1W9YA 1OFNA 1JH5A 4JGYA 2Q0AA 3H7YA 4MZUA 1VRBA 1C1FA 4YVWA 3ZFGB 1UZYA 3KQ4B 4LBJA 3SNMA 3NJXA 4INDA 2XLAA 4JV4A 5CFDB 5CU1A 2W3JA 3OCPA 4BIFA 4BXSV 5IK5A 4XTPA 2ZABA 2XKOA 5ISLA 5GLUA 2WINB 1IQAA 2OX0A 2J1UA 2ID4A 2QQMA 2J22A 3ZXAC 1JYXA 5FYSA 3WG4A 4EJRA 2JB8A 2RDNA 3H1MA 2R062 4LBQB 1QJY1 3GBGA 3WLUA 3VD4A 1PO11 2HYXA 4C90A 1CIWA 5FY7A 4LITA 5LW9A 3ILNA 1XJAA 4QPGB 1GZWB 4K7JA 4NN0A 3SKVA 1VALA 1NCRA 1RUH2 4LO5B 4CCJA 2VZPA 3B93A 5FP7A 2JD4A 4ARXA 5K4LA 1V9U2 1SCSA 1BEV1 1SMVA 5E16A 2WS93 5FZOA 2JE9A 4PF5A 2NMOA 1BXHA 4NVPA 4P9WA 2BBAA 2PXJA 2TUNA 4Q8KA 2MEV1 1DLCA 1W6QB 3D6EA 2B5HA 3MIGA 4CU7A 4GMP3 3MIFA 4HLTA 3WD5A 3S6PA 3OTFA 1QNYA 1NOVA 2BERA 2CHHA 1W39A 3O0XA 1WKYA 4CCKA 5LRSA 4XTMA 1ND2B 4NE9A 1EY2A 5DAXA 4F7ZA 4KMQA 2QKDA 1F2NA 1GQHA 1SLTA 3VKFC 3VBUA 2RJKA 3LZZA 1JODA 3VBHB 1R081 2O8OA 1HB3A 5HCAA 1YCIA 3GNEA 1J59A 1LR5A 1N3PA 4AQSA 1OHFA 2DU1A 4XJUA 1NA1A 2ZEZA 3ES1A 3A7QA 3KM5A 1UYXA 2R073 1K42A 5EJ3A 1LOAA 1REFA 2RR12 1IG3A 4WVVA 3A4UA 2A71A 1H6XA 1LODA 4P9XA 2OQ6A 4LORA 1VE0A 1LKNA 5LK5A 1MACA 2WN3A 2E6VA 3H3ZA 2VVDA 5FPBA 5BNOB 1D0HA 5FOJB 2PQSA 1I5ZA 2EIEA 4Y4YA 5FCCA 2VZ1A 2X5IB 2QE3A 3GJAA 1TNFA 1YC61 1SHWB 2JJ6A 3I2KA 4FPEA 4CDQA 1JTZX 5FYUA 5A6QA 1LHUA 1W0NA 2C9AA 2C9KA 1XU2A 1SBDA 5LK7B 1LHVA 1CAUB 1WLTA 3AKTA 3NKTA 5FZDA 1G9DA 1Q8SA 1ZYBA 3BCWA 2Y0OA 2BV4A 4AOCA 2R16A 5FZ4A 4ZKTB 1O91A 2WL1A 1LENA 3NV4A 2GU9A 2XLFA 3OSDA 1NXMA 5D8AB 3WNOA 3LWCA 1C1LA 1QKQA 3ZXLA 2P2KA 2ZS6B 4HG6B 3ZN6A 1JYCA 1UU4A 1OF4A 2JDAA 2X8KA 4IE5A 2PELA 5FRAA 2ZXQA 1Z7S2 2JDPA 1JU4A 2EVXA 4HONA 5DAWA 3ZFEB 3IT8A 5HV0A 3HNBM 1UX7A 4GB32 4FCAA 4COYA 5CZKA 3VKOA 1L7QA 1OPOA 3C3VA 3KF5A 2ZX3A 3D5OA 5JDBA 2BJSA 2PHRA 5GLVA 4BZ4A 1CWPA 2XL7A 3F95A 1AL0G 5FY8A 1TNRA 4B4RA 2BWAA 4AAPA 2KR2A 2JDUA 2VZSA 3AP5A 2JDMA 4MGQA 4IERA 5H9SA 3UGHA 2VZRA 1ZBE2 4CPBD 2VVFA 4ITCA 3K4AA 4BMEA 1H2MA 2VECA 1W6OB 2Y6FA 2PAKA 3RI9A 3UKVA 5FMOS 4FXKB 1RUD2 4CTEA 3P3NA 1APNA 3MFCA 2UWBA 2Y6HA 5IK4A 5JLVA 1K5MB 3LSDA 4ISQA 5HCFA 3O1VA 2WZR2 2XXZA 1EP0A 2W92A 1NUKA 1RB8G 4Q1PA 5J1XA 1YQ2A 1ZA4A 4AZZA 1MVQA 5L7OB 1KRIA 2DYCA 5F5AA 2DVGA 2HH9A 4MGIE 1CAWA 2JIGA 2BOIA 5GZCA 3M70A 4YYOA 5JOYA 4UFJA 3UV9A 5FPUA 1BYHA 1X36A 4Q26A 2GC3A 1Y3TA 1HRI1 2WJSA 2OIIA 3FLRA 3RJ2X 3ZYJB 3UNPA 4XJ9A 1NZIA 1OOPA 1NX9A 1PVC2 1QNWA 2NP0A 4R9AA 4ES9A 4M3CF 4Y1YA 3BIEA 1ZA7A 3KGZA 4QGNA 2XJQA 3OY8A 3AFGA 2WZPP 4IQPA 4K9SA 3BUCA 2R1BA 1O3QA 1CESA 5FZHA 1V6JA 3HIFA 5T3NA 5HPOA 2ZGPA 1VB4A 5C33A 1UW8A 4P14A 3AM2A 3G6JB 5FPAA 1C8M3 1C57A 5A1FA 2GNBA 5LZ6A 2VXJA 1RMU1 1UWWA 4AQTA 4YNIA 2ZHLA 5LA1A 4K1ZA 2JG8A 2GC1A 2NMNA 2V5DA 1DZQA 3ZOIA 1Q5OA 2OZ6A 4K8FA 4HVRA 5FREA 1R1A2 3POIA 4QQLA 4S2HA 4Z82A 3R6SA 4UW6A 2HWD1 3ZX7A 2CDOA 2RDRA 1PK6C 3FC0A 3VDBA 3S5QA 4CDXC 1W2UA 2X05A 2QQUA 2HBUA 2CAUA 1IQDC 3MUY1 2WQZC 4DOUA 5IYYA 1MZFA 1LTEA 1DQ2A 3ACGA 3VZLA 5LBFA 4HT1T 3I3BA 4OHZA 4QXBA 2GNDA 4YVSB 3U37A 1AR83 4MG2A 1HRV3 1IKQA 3DKWA 1VR3A 3IDBB 3R4DB 4Q0QA 4WZFA 2D3PA 2DFBA 1VBD1 4C8DA 5C3OA 5KHJA 3TNPB 4UFHA 4YPJA 3BOWA 4BDVB 4E8CA 5A32B 5A7QA 5GKAC 2WSUA 2RMU3 3WF1A 4JVAA 5KXEA 3CJIC 2O1QA 2J7MA 2DCZA 3AFKA 1SFYA 4CYDA 2YU1A 5FZ8A 3OD4A 4XQWA 3WNLA 2DVDA 1FYUA 2FDIA 1PO13 1OKQA 1V6MA 1SPPB 5FJKA 3WUCA 2IFWA 3NJVA 4JGZC 4YFZA 3M8LA 3S30A 3ASIA 2YXSA 3I2DA 1S0EA 4IE0A 4XAEA 3ZKUA 5CYYA 2DCTA 3T4HB 5F3CA 2ZGLA 1YYNA 1DYKA 2YMZA 1BEV3 1RJ8A 4GWMA 5AVAA 5I93A 2PHXA 3MF9A 1EV11 2Y6GA 2E33A 3AMNA 4PDWC 2MEV3 3OPZA 4D7YA 1X9PA 1LOFA 3DN7A 4LKEA 4CUGA 3AZZA 3RI8A 3O1UA 4PLMA 1D4M2 3HPNA 1DBNA 5I8TA 4CP9A 2WC2A 3I3QA 2XJVA 5ABJA 1ENSA 4FFFA 5F5QA 4P9LA 4AI9A 2EXKA 1IOAA 5AC93 3ZN5A 3FN9A 4TTGA 4AEDA 1YUDA 1PMJX 3OGRA 1W6MB 1VBE2 2QTWB 2WZEA 4HOOA 5T54A 3I54A 4A2UA 1SFPA 3GALA 1LRHA 1JOJA 3BTXA 2CGOA 2EXJA 2NPIA 3AMPA 5DUVA 5EYXA 2Y33A 1NE6A 3VHRA 3RS6A 4K8RB 1D4VB 5E6HA 3VUOA 2KD7A 2Q8EA 3LKJA 3PTYA 4UBGA 2IVIB 3RGBA 3AK0A 1ND3C 4QX1A 4GULA 5C4WA 4CDQB 3GXUA 2DFCA 2DUOA 3J7HA 3H42B 3ZR5A 4NAOA 4AI0A 4NO4A 3HNMA 4LR4A 1OA2A 2ZGNA 3OBAA 3ZXDA 3FBYA 4YW1A 3ZSJA 1DGRA 2ADEA 2ORXA 4N43C 2OPKA 5F2SA 2J1SA 1PIV2 1YFUA 2G4IA 3UK9A 1VBC2 2BQPA 2V09A 2H6CA 2P6CA 3PMSA 4UOJA 5FK7A 3GBFA 4HETA 2ZMKA 5A1AA 1Y9QA 3I97A 2R6QA 3E6BA 1HN0A 2XDVA 3DYMA 3IAQA 3GBWA 5ACA2 1V0AA 1BBT2 5FFOC 2H0VA 3B7MA 3DPRC 4K21A 5EIYB 1NXD1 5BNPC 5L19A 5JOWA 3N9MA 3ZYPA 4M3CA 4AVSA 2VQAA 2RS51 1EAH1 3FMGA 4XFAA 2YV8A 3UGFA 4CDUC 4QT6A 4FPGA 5HCHA 1JYIA 5LY2A 1I3HA 1QHDA 1RHI3 2LROA 4QX5A 3OEBA 3LGRA 1NLQA 3BOPA 5BYNA 1OT5A 4AFDA 5JMCA 2XJUA 1EPZA 4A3ZA 4P9JA 2ZBJA 2WFF2 3D82A 3NSTA 5M0TA 2VU9A 3JD72 2ZEXA 4WVZA 2FMDA 4IV3C 2GH2A 4FPYA 5GZDA 2FHRA 4ZS3A 1MEC2 4OI4A 1CAWB 1N1VA 5IVEA 4OUMA 5HBAA 1AZDA 3JCIA 3T09A 1HKDA 4BXFA 5FBJA 5A6XA 3UYJA 4XIOA 4XFIA 5TSWA 2XVLA 3N36A 4NR1A 1TG7A 4E2SA 3OY8B 3RMXA 5A7NA 1JU3A 4Q4W3 1ZZ7A 1HRI3 4QX2A 5A7WA 2AEZA 3J8F2 4AE2A 5I0TA 1B35C 1VAMA 2YUEA 3D0JA 3FLPA 2E32A 2W0XA 2HKXA 3JU9A 3K48A 3ROUA 2MPFA 4CPBA 4BMBA 3B5LB 2QQVA 2W52A 1GICA 1KS4A 1XSRA 3ZYRA 3K77A 2JG8B 1KXGA 2VMHA 1V70A 4O9EA 3TN93 2W91A 1AR62 5T55A 1DHKB 2R1DA 3R05A 1QJX3 4LBLA 5DUXA 5BNNC 1R093 3ZXEA 1GYKA 3I4IA 5FAXA 1OF3A 1W8UA 2ZMNA 3HMYA 4W65A 3S7IA 1HQLA 3KB5A 2PAEA 3ACIA 1DGLA 3MUZ1 3QH6A 5F3IA 3UKTA 5CAZA 2ZGMA 4D0QA 1ZRIA 3WG1A 5JSOA 1DZTA 2C6SA 1HB1A 3E5XA 3NAPA 1ZZ9A 3EYPA 1CAXA 4Q0VA 3FLTA 4B1LA 1QXRA 4MHUA 4CU9A 1F4AA 1UY4A 3ABZA 3SHRA 3ZDSA 3V56A 3VKMA 3OYWA 1NT0A 3POEA 3AP9A 1W2NA 2W94A 4QMAA 5A7SA 5F37A 3CHXA 2BVVA 4FOYA 2CAVA 5KXDA 3U0ZA 3WW3A 4RS5C 3W9AA 2W1SA 2ZKLA 5F3EA 1NCQA 2RDSA 3RMYA 4YRDA 1AUYA 1RUJ2 4K3UA 5DN2A 3M3QA 3PMEA 3WNXA 2IXLA 2K0GA 1Q8QA 3WR0A 1W05A 1VBD3 3OGSA 4YW4A 5FZ6A 2VZOA 4RGAA 1NLSA 4UF0B 5K0UB 2RM22 2LUWA 4P5HA 4DRVA 1W90A 1TVGA 2DVBA 4NHKA 3WXPA 5HV4A 1U12A 3LQCA 5CFCC 1RVF2 4UYBA 5CEHA 4OI0A 1Q8VA 3VBRA 4CEYC 2BZDA 1JZ6A 4ZZ8A 1L7LA 2E7AA 2PFWA 4XE9A 5FY9A 2VW1A 3AYDA 1E5SA 3WW2A 4K40A 4TXWA 2WT1A 1CQ9A 1RUC1 4DUVA 1ULOA 5CVRA 2B42B 1S0BA 2ZGSA 1LOEA 3FUQA 3IBMA 2R041 1FOD3 1ZM1A 3ZSEA 4D7TA 3W5MA 1CGPA 2FDFA 3RYRA 4Y1VA 3VBFA 2PLV1 4QQHA 3AVRA 3VDDB 2WRAA 4AFMA 1QQP1 1RINA 4I01A 5BY5A 1HQWA 5BXXA 2DF7A 4NHMA 3J7LA 3ZFGA 1EV13 1SCRA 2VE1A 4FPCA 4LTAA 3WCRA 3FHAA 3ZMNA 2OVUA 1YJKA 2RE9A 1XYPA 5J7MA 4O7XA 4N53B 4YZ3A 2CL2A 3FUOA 5H9PA 5CFDC 2GALA 5I0RA 4MGSA 4C0HA 1RITA 4HPKA 4TLFA 3KSCA 2ZHKA 1QDCA 3P6BA 3POSA 1W06A 3JBG1 3SXWA 4BCUA 2XJPA 2EXIA 2WNUA 4AFCA 1ZREA 5IVYA 4QHBA 1GZWA 4ET7A 4QB2A 3MGUA 3OBTA 3ITQA 4OYUA 2WZ8A 2W39A 4QPGC 5H9RA 5J3UA 3DXUA 5AFBA 1YWKA 2FDJA 3J7NA 3KT1A 4H2AA 3LCPA 1PZ7A 1DFQA 4YW5A 1AR71 2YPDA 3HBKA 3PLQA 3D0SA 2RG4A 2VCAA 4Q0SA 2R072 3TEZA 4Z07A 5HXVA 3EBRA 3K75B 1H8VA 2IXKA 1H1AA 5FZ9A 4WM8A 3WUDA 4JDNA 4IEQA 4XURA 4EN9B 4XF1A 4KGQA 4XOGA 1KJLA 2HWF3 4L8QA 4Q4V2 3WEZA 5F7UA 2P3JA 3OBRA 3I3MA 1UD1A 1CN1A 2JDHA 2Y34A 2B45X 4HBNA 5FY1A 1Q43A 1ULGA 2WSVA 2VZUA 3K46A 4LIUA 5IW0A 4DO0A 4PJYA 4QU2A 4AWDA 4QB1A 3ME2A 1LHOA 2WLPA 4LBKA 1JHNA 1IPJA 4Q5OA 3LB9A 2O14A 1HXS2 4XBLA 3A22A 3VBHC 4E8DA 3USUB 2P4EA 3MI8A 1BHGA 4AVCA 1H2KA 4CDWA 2VW2A 5FZEA 1QXPA 4M3CB 1YHFA 5FY5A 2B4KA 3O0VA 1WA4A 1FPN1 1DQ0A 2W5FA 1MR5A 3K4DA 2BEOA 3JB4C 3MEPA 5FZKA 5A70A 2SLIA 3O1RA 3LSEA 4MHRA 3AYAA 1OBNA 1YEWA 3NNLA 4YGCA 5BNOA 3GZEA 3DCQA 4M4PA 1NZCA 3P3PA 3MICA 5L9BA 1EAH3 3RVHA 4H3WA 4DRRA 1OQEA 1VPHA 2VMCA 1SDWA 1AHSA 1OUXA 2J1TA 2VR4A 2X5IC 4JHZA 2VMIA 5JCTA 2WT0A 1CAUA 2DWRA 2VBPA 4AGRA 5JI7A 1OA4A 4Z2AA 4ZHNA 1QH6A 2HWE1 3LEKA 4AW7A 5GLZA 3GZTB 1I1EA 5LA2A 2YGMA 2EALA 1PZ9A 1HQNA 2Q1MA 5C8CA 4JRLA 3M7AA 5FZ0A 4XJ8A 2W1UA 4TSVA 4BQ2A 2EAKA 3PVBB 4W8JA 1AR92 5D8AC 4FP2A 1IS4A 4M3CE 4MLOA 5JVVA 1RUG3 3ZFEA 5JZGC 5FYMA 1XU1A 4RHV3 5L36A 1PO22 4IEPA 3KQRA 2D6NA 3VZOA 5DZEA 1SFNA 4PHZA 5CBLA 2HEWF 2YB7A 3VKLA 4PBOA 2VZQA 2XWBB 4KI5M 1HN1A 5A3MA 4O61A 4XUPA 3V65A 1TZOA 5CKQA 3BVCA 2PHFA 2WDBA 4COZA 4WV8A 1YQ5A 1VP6A 3PNAA 2D6KA 1YFWA 3FE5A 4XACA 2HJIA 5IAVA 2RS31 3W58A 2F4PA 2P3YA 3I2FA 4XFHA 4CUAA 3X29B 5ANNA 5FMBA 2WFPA 2WWUA 3ENRA 3VZNA 5LCWL 5IJRA 5LEKA 5DG1A 5FMCA 2NYYA 5FZ3A 3NV2A 4XXAA 1SBEA 5L7OA 2XJSA 1ASJ1 2XR4A 2W47A 1CVNA 1AR91 3OYWB 1COV1 3H7JA 4J1XA 4RR3A 1ZZ8A 3T0AA 2RV9A 2PN5A 1OKOA 3PU3A 1POV1 1JS9A 2B9UA 3KV4A 3RWNA 4CEWC 1PGL1 4OCTA 2W46A 1GOGA 3ZFFB 5FR3A 1DGRN 2Z42A 5HXMA 2JG9C 5E88A 2WQ8A 4XXPA 4EE2A 2XKPA 5KWRA 3RG0A 1JYTA 2XH6A 4ISRA 2ETEA 2RS11 3MYXA 2WIIB 4EROA 1KS5A 3EQEA 3POWA 1AYN2 1HB2A 3BB6A 5J36A 4MXWB 3HBZA 4M0HA 3VBRB 4Y5TA 5KR7A 1REEA 1AR82 1O5LA 1HRV2 2D6LX 1WW4A 4LA2A 4V1PA 3VD7A 5A6YA 4KWLA 2TEPA 1Z78A 4BISA 1CPNA 4OULA 3KZ4C 2RMU2 3AZYA 4XUNA 1R1ZA 1RUC3 5D1IA 4XFBA 1RXGA 3VZJA 2WA4A 5A3LA 3ZPYA 1QJU1 2B39A 1RUI1 4LHLA 5FXZA 1PGW1 5C3SA 1WMFA 2AR6A 3PHMA 4JGYC 4ATEA 1C4RA 5F3GA 4YVWC 4XMIA 4YVSA 5FUPA 2PLV3 1HV0A 1WCKA 4MH0E 2LM3A 1QQP3 1NYWA 3TYJA 4PI0A 2WA3A 4CU6A 5KXCA 5BUVA 4HPKB 3LOBA 3DUIA 3NNGA 2CGPA 1MQTB 3AYCA 4ASMB 3MLJA 1JZ7A 2ARAA 1K5JA 3E5UA 5DDJ2 1RUNA 4NOTA 5A32A 1TMF2 1ZVFA 2Z79A 1UF2C 2WNUB 4ARYA 5C9AA 2GN3A 4FOQA 3KMHA 2D6MA 4QM8A 2QQOA 4ZY9A 5J37A 4NHXA 1LEMA 3AC0A 1AYM2 1N1YA 3VKNA 2IVJA 2LALA 2Q1ZB 1NCRC 3WW1A 2GN7A 4QPIB 3BGAA 4IEVA 1SPPA 4MGTA 1XNTA 1O4TA 3ZIXA 5FZIA 3MZHA 1UNBA 5LATA 4QU1A 4HXCA 2VUDA 1A3KA 3LA3A 4AFBA 5CNAA 1MZ6A 1SDDB 2QZ2A 3V0BA 3CBNA 3V0AB 3BPZA 3T2PA 2BGOA 1IS3A 4AK3A 4WM8B 3TB0A 4WM7A 4BYYA 1AR73 2I74A 2R30A 2QUOA 2DVAA 4LEJA 4BWOA 3GHNA 2HBTA 5K7PA 1PNFA 1MZEA 3MDPA 2XONA 1FMD2 4Q0PA 4X8PA 4XF3A 5B2GB 1UXZA 1LOBA 3B69A 4KL1A 5J48A 1S0JA 2EICA 2R061 4OHWA 2A5ZA 5FMOL 1EPWA 2UY8A 2MHFA 3PJQA 3VBUC 2DVFA 4P02B 4QKNA 3L2YA 1J83A 4CE8A 2VNRA 4COVA 4YM0A 1RUH1 1W03A 2GAUA 5GLTA 4EWEA 4CDWB 4KG8A 3WP6A 2VTXJ 1YFXA 3UESA 1W6MA 1NA1C 5FP3A 1V9U1 1WW6A 3GGLA 3FJSA 2OA2A 3A0KA 3CZJA 3DL3A 4A42A 3M2MA 4BHPA 3MFAA 1J1TA 4FPOB 2IWGB 4M00A 5C3RA 1JZ4A 3N9OA 1VMJA 4P9IA 3TOJA 1O8PA 1ODMA 1YQCA 1FPN3 2CWMA 2EIDA 4HMZA 2VZTA 3PIGA 5EWSA 1MS9A 1A8DA 5G04L 4JX0A 4QGLA 1DQ6A 1VMFA 4HANA 1URXA 4S2GA 2D5FA 3TAYA 4CDQC 1OMIA 2C24A 2HWB2 2Z5WA 4AQ6A 4AFAA 4D6QA 3I2OA 4EV0A 5C8CB 5FPZA 1QF3A 1DDLA 2CYFA 2R0FA 1Y9GA 4JTNA 1NAEA 2HWE3 2JENA 3NRUA 5JUVA 2CGNA 1GWLA 2XHNA 1RC6A 1AJKA 2RR11 3DECA 3WY6A 2XQRA 1ZBA2 5FTTC 1C5HA 1IHMA 3CF6E 3M1HA 2A3YA 1YLLA 3C2UA 5IUQA 4BB3A 2VMGA 3KF3A 1G9FA 3J9SA 4E2GA 4IEOA 1VBA2 4CP1A 4LXLA 1XYNA 2ZOEB 3FWEA 2YYOA 3CZUA 2P5BA 4RN5A 4P08A 3TNQA 3LPFA 1XNKA 5GM0A 3WINE 1G9CA 3N9PA 1GZTA 3VLBB 2CWSA 3IMNA 1FXZA 5FPLA 1FNZA 1DZRA 3WNMA 4R8HA 1YI9A 2HYKA 4DNYA 1TME2 2P6HA 4HKWA 1O6UA 2W2IA 1H30A 1UMZA 2KA3A 1CJPA 3N9LA 4Q4W2 4XJZA 2E7QA 1I6XA 5F39A 4L97A 4NIGA 4UI9L 1R64A 4M0NA 2RS33 2VW0A 4KGGA 2EA7A 3NV1A 4OMCA 3WSOA 3Q8BA 2VMDA 2KM2A 1NQJA 1IG0A 1Z7S1 4RR3B 5FO9B 1RUF2 5DAVA 4LO8A 1W2TA 4A7ZA 3POFA 4GB31 4P9GA 2EIGA 1ASJ3 1UIKA 2A73B 3L9JT 1VBA1 4UFMA 3TEWA 1R092 1COV3 2JDZA 2EXHA 4HN1A 4WZCA 2JEMA 4XDPA 4XIKA 1OOPC 1J84A 4LO6B 4BQ4A 2DUPA 1POV3 2WNOA 1M06G 1ZBE1 4QGMA 4Q4Y2 2VOTA 4EZHA 1CZSA 2VG9A 1DP0A 2AC1A 4RGGA 2IC1A 2ZTNA 4OUSA 4MUVA 2JDKA 4AI8A 5JSRA 1RUD1 1T6BX 4HSJA 3GZAA 3SEPA 2GP3A 1DQ4A 4A6OA 1BVVA 3PIJA 2RS13 4SLIA 2WZR1 4Q2FA 1SQ4A 2PHLA 2UYBA 1H6YA 3ELNA 3H8XA 3B94A 4KWUA 2WYFA 4PI2A 3GDBA 2JG8C 3ILRA 1KFXL 1H0BA 2WR9A 4CUBA 1UAIA 4GMP0 2OT7A 4NIIA 3ZYBA 4R4ZA 1CD3G 1CZVA 5EP9A 5FYZA 2VBDA 4C91A 1CZTA 1RUF1 4KWKA 3VBOA 3UETA 1RYYA 1S0FA 1WMXA 1S0CA 2JD9A 4X6RB 4AHYA 2PQQA 2BFUS 2FD8A 4LHKA 1GSLA 2YROA 1PVC1 3B01A 3VB9A 2GNTA 2UU8A 4Y22B 5IATA 3WG2A 3O1TA 5CG9A 4UW3A 4AHZA 4IV1B 1QOOA 2BBVA 3PUHA 3POGA 4D6RA 4ZU7A 5C70A 1XOYA 4XQ4A 1FV2A 1GNHA 1XNDA 2Q8CA 2AUYA 1E5HA 3CLPA 4BQXA 3MBWA 4OI1A 1PMIA 1CAVA 5IK8A 4XEZA 2BPA2 5C9AB 5FUNA 3APBA 5A3PA 2JDNA 4UF0A 2Y38A 1O4ZA 5K0UA 1QJY3 1LB2A 1R1A1 2Q8DA 1SZBA 4DB5A 2D98A 4FTSA 1BQPA 1MS1A 4RQPA 5FJHA 3BU0A 2YZ4A 3LE0A 4IESA 2JDYA 1GMMA 1MS0A 2Y64A 2A6ZA 2OQ7A 3RPQA 5FPXA 1GOFA 1PHMA 1G6NA 1CX4A 4NAMA 1UPSA 5T5PA 1W2AX 3ORJA 2WABA 2G9FA 1JZ3A 3U14A 1N1SA 5CKMA 3V0BB 5L9RA 5F1RA 5JXJA 1GNZA 4WM7B 2OKXA 1C5IA 3AYEA 5IVCA 5I0SA 2VPVA 4B7EA 5FPVA 3VDDA 3KT4A 3O1PA 1YQ8A 4AG4A 1ULCA 5FYCA 3E97A 1LOFC 1RTVA 4HSLA 4XFGA 3CNAA 3WP4A 1UN1A 1XNBA 2BWCA 4NRMA 3K51A 4OI2A 2XBO2 4N53A 4Y1XA 1A6CA 4TYSA 2W9XA 4XF9A 4DIQA 1WBLA 2R063 1LECA 3MW3A 3NWKA 4GWNA 1FT9A 1R083 5ABJC 4JZRA 4Y20B 5KBFA 2ZX0A 4H14A 1F35A 1GR3A 4FFGA 5A80A 3U4SA 4EWAA 1PGSA 2VGDA 4AEDC 2WNVA 4F83A 5K8SA 1RUH3 1WD3A 4K20A 2HEVF 2V4VA 2ZHNA 3NJYA 4LUMA 1V9U3 2BRTA 3CEWA 4B29A 3N9QA 2A6YA 2VCCA 4C0BA 4XMAA 4DUWA 5APAA 1UL9A 5FOBB 4RYDA 3HWJA 5FKCA 1G9BA 5GALA 3ETQA 2HEYF 5C4WC 1VBB2 1XPWA 2VZVA 1S2KA 4N7UA 3I3DA 5DQ0A 4C1XA 1D4M1 4NIDA 4IEYA 3HN1A 2A75A 5B4XA 4AR2A 3LDKA 1D2QA 4XF0A 1OVSA 1AL22 1RL3A 2HWC2 3AMQA 3WZ1A 4B4PA 4IE6A 3WX5A 4BA6A 4L0PA 5CB7A 3VHNA 3U78A 3H3UA 2VVEA 2PA7A 1VBE1 4XJWA 4FVVA 2VMFA 2WAOA 2YG0A 5FZAA 4XVHA 3ZM8A 4FT8A 3ACLA 3USUA 5B4NA 2RR13 4NPMA 4UFLA 1RJ7A 2J1AA 2XG3A 3BU7A 1OD5A 4PIYA 3O1OA 1EYBA 2BW8A 3C7GA 1Y4WA 2VXRA 3SITA 1LAJA 4HVOA 1W04A 1W6PA 3GF6A 4PLNA 2W68A 4D6SA 1PZ8A 1S55A 1GP5A 2V4AA 5JWPA 4CCNA 1SG3A 3R4UA 1XNAA 5KC5A 3SKJE 1S0DA 4QPYA 1RUE2 3J7MA 3OUIA 3FFQA 4GALA 1MS3A 2D40A 1PIV1 4RHV2 1AL21 1E57A 1MS4A 3UL2A 2Y60A 1VBC1 4KG0A 4DQAA 3NMBA 2HLEA 3H9AA 2XB6C 1Q8OA 4CXYA 3ZXKA 3E6DA 4OHYA 1LHNA 4YARA 4PT6A 2EAAA 1VJ2A 1YRZA 5ACA1 4YZ4A 1BBT1 1UPIA 2YPJA 4BJ0A 1QU0A 3KV6A 2WYSA 5LB6A 1Q3EA 4E4SA 4HKLA 1V00A 1VMHA 4GB33 2Y6JA 2VQ0A 1WWYA 3HQXA 4HL0A 2VH9A 2ES3A 2J1RA 5FP4A 4PBPA 3T4VA 5CA6A 2VQUA 2ATFA 1XE0A 2VUJA 2XOMA 5FO8B 4QDRA 3JQWA 2VCBA 2F6BA 1H9PA 4QX7A 2V73A 2J42A 4NJ4A 2ZGQA 3B9IA 3ZVXA 4EZ4A 1FX5A 4B3NA 2PHDA 2WFF1 3QLQA 3ST7A 5A3OA 2VO5A 3JD71 5JMOA 5LWBA 2QZ3A 5JIUA 4LKSA 1OQDA 1RMU3 3I59B 3MLKA 4I02A 1MEC1 1P8JA 3PUAA 4FO9A 4L9BA 4CCOA 1G8WA 3O1SA 1KGYA 4DY3A 2RDQA 3VBOB 4AVTA 1W28A 1LJ7A 3NV3A 1LGCA 2HWD3 4JCKA 5C5TA 4OQ8A 5K9YA 3CL1A 3NAPC 1JUHA 4DEQA 5A1LA 5KXBA 3J8F1 5BPXA 4WBBA 1DGWX 4Q4X2 1PVC3 4H7LA 1NY72 1XE7A 1ENRA 1VRH2 4CDXB 3ZFFA 3WT3A 5I8YA 4HFSA 1CAVB 3S0MA 3CKHA 3I2JA 2XWJB 3H1YA 1NCQC 3AKQA 4LBMA 1AR61 4PF1A 1S2BA 4IE4A 4MX3A 3T1LA 4RQPB 4X6QB 4BE3A 3OG2A 3O1MA 4NIHA 2RJ2A 3HEIA 4MXWA 3HN3A 1EUUA 4SBVA 1OI6A 3WV6A 2VNOA 3H3LA 4CA9A 2IZWA 3GM8A 3BTAA 3EO6A 4QX3A 3VBRC 1S0IA 5JR2A 1JBCA 3CQOA 1V6IA 1C8NA 2JX9A 2W1WA 5HCBA 4KWJA 3C7FA 4KBBA 5FZMA 4EYUA 4JDOA 3S5AA 1JYVA 4H7MA 1GBGA 2R0HA 4OQ9A 2O8QA 4GH4A 2BU9A 1H1IA 5DG2A 5F9TA 4JQRA 4F8AA 1UYZA 3N7KA 5JIAA 4N9HA 3S7EA 1UOJA 1GQGA 4JGZB 3T3YA 5LA0A 1ZZBA 3VBFC 5C7GA 1POQA 1S1AA 5FBZA 3WQ1A 5JOXA 3NW4A 2BGPA 1HDKA 1HLCA 1RUJ1 2WS92 3ZFGC 5FQ0B 1G7YA 4I0BA 3ZYFA 2OUJA 4I0AA 4RFT0 2RM21 4ZU5A 1MQTA 2A6XA 1QOSA 4LHSA 2FCVA 3C7EA 4PDWB 4I2OA 4XABA 3BI3A 1RVF1 2IFRA 2A70A 4WVMB 3SH4A 5FDBA 2WNVB 2DCKA 5IHRA 4XBNA 3B00A 4QDQA 2PYTA 4IE7A 4FBFA 5I0DA 2WNUC 3DXTA 5FYBA 5JXIA 1X82A 2C4XA 3HOBA 1IPKA 2QDRA 3SH3A 4LT5A 5JOZA 4QPIA 4MOAA 2PHTA 2YFZA 2Q8OA 4NPLA 3CO2A 2OS2A 2YC4A 4BQ5A 3ZYHA 2NN8A 2NQYA 5J09A 1BMV2 1I9RA 2ZX1A 2CV6A 4XDQA 1KD7A 4NPRA 5FP8A 4AI3A 4A7YA 4HZFA 4U36A 3V0AA 3NVCA 5IT6A 1OC1A 3DGTA 2A1XA 3ZXFA 4W6WA 4XZUG 2WS91 1SLIA 4QX0A 3TEXA 1NQDA 4WM8C 2TBVA 4S2DA 2H0BA 5FLJA 3WDVA 1S0GA 1XC6A 4ZONA 2FCUA 4XETA 1ND2C 5DUWA 1OLME 3USSA 1PMHX 2LW8A 4Y26A 5DABA 2QQJA 4E27A 1HB4A 3QH7A 3ZO0B 3O14A 1GKBA 1LHWA 2VJXA 4CP0A 1F5JA 3MPPG 4N43B 2XVKA 4GQ7A 1VBE3 1OA3A 4DMIA 1IZ3A 1F15A 2TNFA 5SV8A 4IDZA 1SLBA 1XYOA 4EN8B 2D44A 2X09A 3FHQA 4CDWC 4GIQA 4HK9A 1W3VA 3VN4A 1W6PB 4FPFA 4FQZA 2PAMA 5FZBA 1N47A 3FBMA 4YGEA 1F9KA 4OLLA 1OUSA 4QWNA 4FAGA 2G1MA 4XC9A 4BOWA 2R071 1J1LA 2RS53 3VL9A 3DPRB 5BNOC 5FWEA 4NRQA 5T5LA 3R4SA 4ES8A 1BZWA 1LNSA 4FP3A 4KU8A 1NG0A 3WG3A 3PUSA 4Q4V1 4DFSA 1ZNPA 4CDUB 1HX6A 1LGBA 4URAA 1J58A 3ZDVA 5JI9A 1BKZA 3WVJA 1PIV3 1HW5A 4BU2A 1UCXA 3JB8A 4OMDA 1WBFA 4XFCA 1HXS1 3KD4A 3N9NA 4A4AA 4LIVA 2IXHA 2P17A 4YW7A 4BPZA 4IV3B 4GD4A 1A34A 4QM9A 1GWMA 3LD8A 3QBQA 4LOTA 3UJOA 1XE8A 4A44A 5FP9A 3ZKYA 3KCXA 1BBT3 3OF1A 5ACA3 1B09A 3BYWA 4YM2A 2BDRA 3ZFEC 1ZZCA 3A21A 1UZWA 3B9CA 2C5DA 2ZAHA 1W3XA 2NM1A 4YG3A 3HT1A 4J6GA 5EJ1B 3VBSA 4NWVA 1GP4A 1K12A 2VY0A 3OGVA 1UZZA 1EUTA 1OLRA 2ZEYA 4R9BA 3IAPA 4IEXA 1B35B 4Y5SA 4YGDA 1U0AA 2VNGA 2ZEWA 1O4YA 4HN0A 3HQRA 3MLLA 3ZSMA 4R52A 3AJYA 4QXCA 3Q8AA 4CCDA 1HIXA 1K5MC 1MEC3 3NNFA 1AXZA 3NNMA 5EJZB 2E26A 1GZ9A 4XILA 1C8M2 1HJFA 1UOFA 5JAXA 3AZVA 2ZPXA 5BNNB 5L7OC 2WT2A 1L7RA 1W9SA 5GZEA 4FXGB 1QOTA 3TWIA 1S4CA 3VGIA 3U1XA 3ZXGA 1UYPA 1PO21 1XSQA 3VV1A 4XUQA 4GZ9A 4CCEA 5JSPA 2XMLA 4H55A 4FPHA 2NZ9A 4WVWA 3N7JA 4Z8BA 3LFIA 2VTXA 2VUCA 5IFPA 1WCDJ 4I09A 4UWDA 4A45A 1CIYA 3LAGA 4BIOA 2W95A 5DMYA 3H8OA 4E4HA 4GKXA 2IXCA 4COWA 4CP2A 2FDKA 3T1MA 4K1YA 2ZZJA 3WQBA 1NKGA 5FZGA 3SH5A 3OGJA 4N7IA 3W21A 1BCXA 2E31A 5FK8A 1JZ5A 3I7DA 3CIHA 2YC0A 1GFF2 1GP6A 2EF6A 2W1QA 3E1F1 1YIPA 4GH4B 1HJGA 3AZXA 4YG0A 1SLCA 1H8TA 2OYZA 5A7OA 2DURA 1IS6A 3WDWA 1T2XA 2VQTA 4CEYB 2GMEA 4PQQA 4AYUA 3AX4A 4LK6A 3T2TA 2R043 1PO12 2A3XA 5KHIA 4Y22A 2I2SA 3HAGA 3WOGA 1W0OA 1F4HA 4B4QA 1Y9MA 3N7MA 1U5YA 1AVBA 2QQNA 4IV1A 4Y5Z0 4DY5A 4LHNA 2D97A 2ZJCA 4FOWA 4YVSC 3EMRA 1IGOA 1BEV2 5A3TA 1LOGA 1RUJ3 1AYN1 1HV1A 2WO1A 4AHXA 4DXTA 5IVVA 3SQOA 3S57A 2ARBA 2YC2A 1QJFA 3K4ZA 2RM23 4XDOA 1AR81 3VL8A 2MEV2 1HRV1 1FAYA 2YBSA 1RVF3 2I07B 4O9GA 2UURA 4CU8A 5C9AC 5BV6A 3JBG3 1W99A 2ET1A 2WQ4A 1ULFA 2BTVC 4ZXKA 3N35A 3K2OA 2RMU1 1UU6A 3B3QE 3QD6A 4ASKA 2VMEA 3VD9A 3BODA 4GAZA 5AC92 1ENXA 2P3IA 4IGOA 4ZZ5A 4AAXA 3RZHA 3WQ0A 3WDYA 1R082 4UBHA 2ZX4A 3QCWA 1GOHA 3NO8A 5T52A 4L2NA 5A33A 1W8FA 3C7OA 4UAPA 2GC0A 3WQ7A 1LOCA 3KVAA 5C8WA 3NQHA 4Q29A 4CXWA 2DTWA 4AF9A 4JC1A 4WM7C 2VOWA 3T2QA 4RFRB 3ZMOA 1H4GA 2ZGUA 2D43A 2WO2A 2YBKA 1O5UA 3PURA 4DZGA 5DDJ1 2I45A 4A6SA 1GWKA 1SEFA 1TMF1 2FBEA 3POYA 3RDIA 2F17A 1DF0A 2ZCWA 4HVQA 2JICA 3GCWA 5FXWA 4FAHA 3IDEA 5FUIA 5EZWA 1STMA 3LF7A 1AF9A 4JTOA 3W20A 2B8MA 3WHTA 1AYM1 4Y20A 3ZSLA 1RUOA 3SISA 5FY4A 4OUEA 4IGQA 1OURA 5DXDA 5FYVA 4YZ5A 2E7TA 3ZR6A 3AXDA 5T50A 1DLLA 2D6PA 4I3GA 1CPMA 1K3IA 2D3RA 1UKRA 4IGPA 5AC91 3AL5A 3CU7A 3PL0A 4XYXA 5LBBA 3LDBA 3GYDA 2BVBA 4YZ2A 2ZZQA 4LOSA 2PHWA 3WDTA 1J3PA 5KHHA 3FHIB 4LE4A 2VOXA 5F6KA 3RSJA 1PNGA 2K46A 3LOIA 4LQRA 4UFKA 1FMD1 5D2AA 1H2NA 2BNMA 4JQTA 3N4MA 3JQXA 4BK4A 1UY1A 4YZ1A 3AMHA 1OH3A 4QD2A 4Q8LA 3RWKX 5J98B 1QH7A 3KVBA 4Q4V3 2AH2A 4Q0UA 3KV5A 2W08A 3WHUA 4IEUA 1NE4A 1RHI2 3H0OA 1Y43B 2P34A 4DEVA 3EXUA 4BLIA 2GC2A 2ILMA 2XUMA 4LJHA 1UO9A 1QWRA 2XPJA 4BQ3A 4CCCA 4XJAA 1HXS3 3KV9A 2VM9A 2JXAA 2BUKA 3HT2A 1AX0A 1GUIA 3MV11 4V2VA 4UW5A 4ZPIA 3URFA 2BFUL 3VHPA 5FZCA 4XBQA 2V72A 2QFEA 2GMMA 3RQ0A 5F6LB 1X9TA 2OXBA 3O7OA 4RD7A 5IK7A 3ACHA 3I8TA 3VBSB 3IN9A 1ULEA 1KQRA 2O0OA 5DAPA 1WGPA 2VCMA 1QEXA 1CJDA 5T5OA 1WA6X 5JZGB 5A3UA 2OUHA 3W5NA 1W9TA 4LO7A 2QCSB 4META 4LE3A 2HWB1 2L9LA 3HD8B 1O7FA 1W8NA 1HRI2 2Q4SA 4GJYA 4L99A 1PM7A 1YI7A 3P1IA 5EXOA 3M3CA 3TRSB 1J3QA 1GU3A 1YIFA 3RJRA 2Z4FA 4O65A 4UFIA 5EHDA 5F8PA 3OPWA 5A6ZA 1CR7A 1W9WA 3KHBA 4ZS2A 5JXHA 1RHI1 1XQNA 4L11A 5FWJA 1GLHA 2ZKNA 3ZIWA 4AI1A 4CCLA 4XAAA 1ZBA1 3W59A 4P5YA 4XCBA 3THPA 3TN92 2K2SA 4W4ZA 1N1TA 1U5XA 3LIGA 3E6CC 2GSYA 1QJX2 1AR93 3H1WA 1RMU2 4TWTA 2C1FA 4LLFA 4XPVA 3VZKA 4EN6B 2WLQA 3NKGA 2WUHA 4I0WB 2VUAA 4G9SB 4KH9A 4IXLA 2SBAA 2WWJA 2DUQA 1PO23 2LTNA 4M4RA 4Y33A 1ULPA 2GDFA 2ZGKA 5IWFA 1X8EA 2HWD2 4EWDA 1REDA 2AENA 5AFEA 5JR7B 4KQ7A 1TME1 5EPAA 4CEWB 5KC6A 2VZ3A 2Y6KA 5F32A 3MIDA 2AREA 2GP5A 3CMGA 4Q4W1 4AVVA 3T30A 2JG9B 1IS5A 4MV2A 3VDCA 1W9FA 2DU0A 1KDMA 2VD7A 4YFWA 1F31A 5F5CA 5IVFA 4Z92B 4FOVA 3I59A 1E5IA 4I30A 4YSFA 4MGZE 4GKYA 4IEZA 5JPNB 3DV8A 2E53A 1E5RA 3OB8A 4DINB 5F2WA 1H8TB 2UWCA 1VBD2 3OJBA 2VULA 4A3XA 4UT5A 3TN91 2DTYA 2YFUA 2ZA9A 3VBOC 3WNPA 4JHTA 1QJX1 3KGLA 3ECQA 1R091 3ZPOA 5J96B 3IDAA 2QQIA 4EN0A 2A7AA 3LPGA 4W6XA 1YFYA 1QJU3 1AX2A 1RUI3 3VZMA 5LRRA 2Q1FA 4Q4Y1 1PK6A 1OLQA 2ZX2A 4EN7B 1TE1B 3AKRA 4CDXA 4AL9A 2GZWA 1BVP1 1FI2A 4K6BA 2QVSB 1LULA 1UY3A 2R32A 4JKKA 1FOD2 2ARCA 4JGYB 4Y1UA 1UYYA 4YVWB 2QQPA 1T6GC 3RZJA 3ZYIB 3MHZA 1AYN3 4Y4RA 1PM4A 5FZLA 1EV12 1WLCA 5K0UC 2VOVA 4UXAA 1W8WA 1MS8A 1YNAA 4GWJA 3QOPA 2GMPA 2CTVA 4RQPC 2ARXA 1PX4A 3CJIA 4FTEA 3WF4A 4LLOA 3AMMA 3WF3A 5A33B 1W8HA 4A7KA 3N3HA 1GNYA 2BNOA 3ETPA 3PTRB 4IETA 3M4FA 3I2HA 3LFMA 1N3OA 4LBQD 1NCRB 2B46X 3D3AA 3DEMA 4FPLA 2WAAA 4CVUA 1O3RA 4TN7A 1ZRCA 1G9AA 4JGZA 2XGXA 4XQDA 2DDUA 5FZOB 3VDDC 4IUGA 3WP5A 4UW4A 2JECA 1DQ5A 4XUTA 3P5BA
chains in the Genus database with same CATH topology
4YW2A 1FOD1 5FQ0A 1QMJA 4YG6A 4CRQA 3GHMA 1ULDA 4BQWA 3ILFA 5DDJ3 1H2LA 2QJVA 4N53C 1TMF3 4PDWA 2OW4A 2A6WA 4MGYE 2QDNA 4WVMA 2N7GA 1SLLA 3FZ3A 2IXJA 3ZYGA 2HWF2 2D3SA 4R4XA 1AYM3 3VBUB 2WNVC 3J4UH 1GZCA 1WMEA 1DG6A 3MIEA 4B8EA 5C5UA 3WW4A 4DXZA 1IKPA 1VLNA 1NA1B 3RNSA 1WLWA 4QQ2A 4P9YA 1A8MA 3D8CA 3KCCA 1VAVA 1X7NA 3IM0A 4AHWA 3OUJA 4U2AA 5L9VA 1WMDA 4HKOA 4XHXA 1Q56A 1FMD3 2A6VA 2XBO1 2E63A 1ND3A 3R0RA 2OZJA 3NL1A 2NLRA 4QQOA 4BQ1A 2E9QA 1OFSA 5T5JA 1QDOA 3JUUA 1POV0 2RS52 1EAH2 3ATGA 2VOKA 1XRUA 1U5ZA 2BYVE 1QGLA 1BJQA 4E9KA 2XVGA 2HWF1 4LNVA 4M01A 4N43A 4RL7A 4COUA 4MVTA 2XL9A 2P3KA 3EJKA 1SLAA 2H6BA 3ZN6B 4GXLA 2JKBA 2GH8A 3AP7A 4RA0A 5FLIA 3IPVA 5GZGA 1GV9A 1VBB1 3AXEA 5CADA 2WWSA 2X53S 1J3RA 1UKGA 3DPRA 4JAAA 4AXOA 5BNPA 1RUG2 3Q9OA 4B7KA 1ZZ6A 4PCRA 2HWC1 1UIJA 2HWB3 4CDUA 1DYPA 2Y0IA 3AB0A 1Z0HA 2FMYA 4XZPA 1WCSA 2XLGA 3WP3A 4XFFA 3FX3A 4AGGA 1OQ1A 1Z7S3 1KDKA 2WKKA 1Q8PA 1ZBA3 4IV3A 5C6CA 4AEKA 4G4FA 5EQUA 2Z2SB 4GA9A 2DV9A 4PLOA 1C28A 1VBA3 3MW4A 3TBDA 3O5SA 1WUVA 5CIRA 2D5HA 2R49A 2FZ2A 4ATFA 1QJZA 4XW3A 2ZAAA 3ES4A 1ZBE3 4C1WA 1RUE1 4KBZA 2ET7A 1CONA 1KFUL 1F8VA 1RUG1 1LESA 1OOPB 4XHBA 3ZN4A 2Q5TA 1RUD3 4RHV1 1TME3 1W6NA 4Y1ZA 1VB2A 1B35A 3BIWE 5EV7A 3UKNA 2WZR3 3U4XA 4URTA 4OHXA 4LA3A 2GNMA 4D3WA 2CY6A 3H8UA 3A0NA 3IDCB 3RYPA 1OPMA 3CJXA 1FNYA 1V6LA 3KCYA 1RUF3 4DPNA 1ZRRA 4YM3A 1TEIA 5CG8A 5BNNA 4AI2A 4LBOA 1RGSA 1O3SA 3PVOA 1ALYA 1PK6B 4QQPA 5HI0A 3SMHA 1D2SA 1BK1A 2C0ZA 1L3JA 1ZRFA 5LBCA 3SCFA 1A78A 3MIBA 4Q1RA 4FSJA 2ENRA 4BQYA 2WNEA 4AVBA 4Q4Y3 3ZFFC 1RUC2 2YGLA 4FPJA 2R042 2E51A 1YXWA 4G3YC 1X8MA 2PLV2 3O12A 3RRDA 2Z69A 1QQP2 4RS5A 4FTBA 1R1A3 2AYHA 4Q27A 2JIJA 3OUHA 4LUKA 3CJIB 1LU2A 5ERLA 2YHJA 5I0UA 5SV5A 1YO8A 4JDMA 3M3EA 5KHGA 4TZDA 3KLSA 5BNQA 5CFCA 3OGGA 5LA9A 1JUIA 5I8SA 4D69A 4Q4X1 1WW7A 1NLRA 4GH4C 4CEYA 1AXYA 3B02A 4MSVA 1NY71 3UJQA 4R9CA 1VRH1 3JBG2 2PTMA 3VHOA 2DCYA 4IL7A 1WW5A 1FV3A 5GJ6A 3SCHA 2YDEA 1W0PA 1WD4A 4YM1A 5E8AA 2QNKA 3H50A 4OVEA 3DF0A 4ZU4A 1MQTC 2FQPA 1FATA 1AR72 3L2HA 1QXJA 3NJZA 1DU3D 3WDUA 2IXIA 2FZ1A 4J1WA 5CFDA 4Z2WA 4OFGA 3OBZA 1WLDA 2ERFA 1C3HA 5E1RA 5ABJB 2MNGA 4E4DX 5EFUA 1F5FA 3J26N 4QPIC 4JRAA 4LO4B 4AEJA 5DZGA 3AZWA 1H4HA 4AEDB 1U5IA 2D93A 2X29A 4LBQA 1V6KA 3PJYA 3PVNA 3ZXJA 4PQ9A 4QPGA 3U07A 4E4ZA 3IWZA 3N7LA 4E2QA 1ND3B 3SLIA 4IEWA 1D4M3 1SBFA 4HK8A 1ZX5A 1MS5A 1UX6A 2AGSA 4GMP1 5I91A 5C4WB 1FPN2 2XBO3 1AXKA 4L92A 4BLJA 2XHKA 1MVEA 1GANA 1W6QA 3AKPA 5KHKA 1DGWA 3RYKA 1TQ5A 2B7YA 3WDXA 3LA7A 1AJOA 3ZSKA 1ND2A 3DKQA 4MXVA 4YW3A 2Q30A 4D94A 3IPVB 1LGNA 3ALQA 1BMV1 1XNCA 1KJRA 2HWE2 2V5YA 2RHPA 3E5QA 3M3OA 4FPKA 4XF4A 3SCGA 3U10A 3VBHA 4PIZA 2OPWA 3MPBA 2BNNA 4YGBA 5DZFA 5BNPB 4DS0A 1RIRA 5LBEA 4MYEA 3IIAA 3HQUA 1VAKA 1X50A 1VBB3 1DIWA 4AEMA 1H1MA 3IKWA 1H9WA 2G19A 2D7FA 4KU7A 5LASA 3KT7A 5AVPA 1D0GA 1LCLA 1AL23 2DCJA 2HWC3 5E89A 1VBC3 4NWWA 1ZRDA 5C8CC 4AGVA 2X5IA 4BM8A 1ONAA 1XXNA 2AZ5A 1O3TA 5LEJA 5GZFA 2RS32 4N90A 5DUUA 1LU1A 1Y7BA 2ZGRA 1ENQA 4Y24A 3GZUC 2RJLA 3HR9A 4N9IA 3QACA 3MF6A 1KITA 5D8AA 1QY4A 1W6NB 3M3IA 1ASJ2 2ZHMA 4PIXA 3VBSC 4D7SA 5JZGA 1RUE3 1COV2 4ORFA 2UWAA 2WFF3 3MW2A 3JD73 3PVEA 2UY9A 3BALA 5L73A 1JXNA 1PGL2 2ZACA 2P37A 3THTA 3EHKA 2UYAA 2BGCA 4OHVA 4S2FA 3INAA 5GLWA 5FLHA 3AP4A 3V64A 3RZZA 2FCTA 2RS12 2ZGTA 3AJZA 4ASLA 1W6OA 3LA2A 2Y26A 1N3QA 3G7DA 4RR3C 4RSUA 3OD0A 1DQ1A 4AQ2A 3J8F3 1K5MA 2XJRA 4IW3A 3NAPB 5DAQA 1CAXB 4ONUA 1M4WA 4FQ4A 4KNCA 2G9GA 5FO7B 4AVAA 2A3WA 4CEWA 1G86A 1LEDA 4NMIA 4LULA 2JE7A 3KS7A 2ZGOA 1AR63 4RS5B 1QJU2 2JG9A 1OSGA 3WCSA 1RUI2 3AP6A 4CZSA 1PGW2 4I3PA 2ZMLA 1VIWB 1X33A 4J25A 1NCQB 4W6YA 1JN2P 2D6OX 1C8M1 4YLZA 1PVXA 5CFCB 3O0WA 4NHYA 3NNJA 3AKSA 1AX1A 4LBNA 3D4KA 4R9DA 1UU5A 1QJY2 1H8TC 3FFZA 5H9QA 5JPMB 1SACA 4X8NA 4Z1VA 2KXLA 2K9ZA 2CNAA 5IAXA 4XCAA 3JZVA 4OZXA 1JW6A 4Q4X3 3U11A 4F3JA 5EYYA 1V6OA 4MGKE 4IV1C 3GJBA 4NHLA 1VRH3 1YJLA 2YY1A 4QXKA 4BH9A 2PHUA 1V6NA 2XJTA 3VBFB 1MZ5A 3MIHA 1OFNA 1JH5A 4JGYA 2Q0AA 3H7YA 4MZUA 1C1FA 4YVWA 3ZFGB 1UZYA 4LBJA 3SNMA 4INDA 2XLAA 4JV4A 5CFDB 5CU1A 3OCPA 4BIFA 5IK5A 4XTPA 2ZABA 2XKOA 5GLUA 2WINB 1IQAA 3ZXAC 3WG4A 4EJRA 2RDNA 3H1MA 2R062 4LBQB 1QJY1 3GBGA 3WLUA 1PO11 4C90A 1CIWA 3ILNA 4QPGB 1GZWB 4K7JA 4NN0A 1VALA 1NCRA 1RUH2 4LO5B 3B93A 2JD4A 1V9U2 1SCSA 1BEV1 1SMVA 5E16A 2WS93 2JE9A 4PF5A 2NMOA 1BXHA 4NVPA 4P9WA 2TUNA 4Q8KA 2MEV1 1W6QB 3D6EA 2B5HA 3MIGA 4GMP3 3MIFA 4HLTA 3WD5A 3S6PA 3OTFA 1QNYA 1NOVA 1W39A 3O0XA 5LRSA 4XTMA 1ND2B 1EY2A 5DAXA 4F7ZA 2QKDA 1F2NA 1GQHA 1SLTA 3VKFC 3VBUA 2RJKA 3LZZA 3VBHB 1R081 2O8OA 5HCAA 1YCIA 3GNEA 1J59A 1LR5A 1N3PA 4AQSA 1OHFA 2DU1A 4XJUA 1NA1A 3ES1A 3KM5A 2R073 5EJ3A 1LOAA 1REFA 2RR12 4WVVA 3A4UA 2A71A 1LODA 4P9XA 1LKNA 5LK5A 1MACA 2E6VA 3H3ZA 2VVDA 5BNOB 1D0HA 5FOJB 1I5ZA 4Y4YA 5FCCA 2X5IB 3GJAA 2QE3A 1TNFA 4FPEA 2JJ6A 4CDQA 1JTZX 1LHUA 2C9AA 5LK7B 1XU2A 1SBDA 1LHVA 1CAUB 1WLTA 3AKTA 3NKTA 1G9DA 1Q8SA 1ZYBA 3BCWA 2Y0OA 2R16A 4ZKTB 1O91A 2WL1A 1LENA 3NV4A 2GU9A 2XLFA 1NXMA 5D8AB 3LWCA 1C1LA 1QKQA 3ZXLA 2P2KA 2ZS6B 3ZN6A 1JYCA 1UU4A 2X8KA 2PELA 5FRAA 1Z7S2 2EVXA 5DAWA 3ZFEB 5HV0A 3IT8A 4GB32 4FCAA 4COYA 3VKOA 1OPOA 3C3VA 2ZX3A 3D5OA 5JDBA 2PHRA 5GLVA 4BZ4A 2XL7A 1AL0G 4B4RA 1TNRA 2BWAA 3AP5A 5H9SA 4IERA 1ZBE2 2VVFA 4ITCA 4BMEA 1H2MA 2VECA 1W6OB 2PAKA 3RI9A 3UKVA 5FMOS 4FXKB 1RUD2 4CTEA 3P3NA 1APNA 3MFCA 2UWBA 5IK4A 5JLVA 1K5MB 3LSDA 4ISQA 5HCFA 2WZR2 1EP0A 1RB8G 4Q1PA 1ZA4A 1MVQA 5L7OB 1KRIA 2DYCA 2DVGA 4MGIE 1CAWA 2JIGA 5GZCA 3M70A 4YYOA 5JOYA 3UV9A 1BYHA 1X36A 4Q26A 2GC3A 1Y3TA 1HRI1 2WJSA 2OIIA 3FLRA 3RJ2X 3ZYJB 4XJ9A 1OOPA 2NP0A 1PVC2 1QNWA 4R9AA 4ES9A 4M3CF 4Y1YA 3KGZA 4QGNA 2XJQA 3OY8A 3AFGA 2WZPP 4IQPA 4K9SA 2R1BA 1O3QA 1CESA 1V6JA 3HIFA 5T3NA 2ZGPA 1VB4A 5C33A 1UW8A 4P14A 3AM2A 3G6JB 1C8M3 1C57A 2GNBA 1RMU1 4AQTA 4YNIA 2ZHLA 4K1ZA 2JG8A 2GC1A 2NMNA 1DZQA 1Q5OA 2OZ6A 4K8FA 4HVRA 5FREA 1R1A2 4QQLA 4S2HA 4Z82A 3R6SA 4UW6A 2HWD1 3ZX7A 2RDRA 1PK6C 3FC0A 4CDXC 1W2UA 2HBUA 2CAUA 2WQZC 4DOUA 1MZFA 1LTEA 1DQ2A 3VZLA 5LBFA 4HT1T 4OHZA 2GNDA 4YVSB 1AR83 1HRV3 1IKQA 3DKWA 1VR3A 3IDBB 3R4DB 4Q0QA 4WZFA 2D3PA 2DFBA 1VBD1 5KHJA 3TNPB 3BOWA 5A32B 5GKAC 2WSUA 2RMU3 4JVAA 5KXEA 3CJIC 2O1QA 2DCZA 3AFKA 1SFYA 4CYDA 3OD4A 4XQWA 2DVDA 1FYUA 1PO13 1OKQA 1V6MA 3WUCA 2IFWA 4JGZC 4YFZA 3M8LA 3S30A 3ASIA 2YXSA 3I2DA 1S0EA 2DCTA 2ZGLA 1YYNA 1DYKA 2YMZA 1BEV3 1RJ8A 4GWMA 5AVAA 5I93A 2PHXA 3MF9A 1EV11 3AMNA 4PDWC 2MEV3 3OPZA 4D7YA 1LOFA 3DN7A 3AZZA 3RI8A 4PLMA 1D4M2 1DBNA 5I8TA 2WC2A 2XJVA 5ABJA 1ENSA 5F5QA 4P9LA 2EXKA 1IOAA 5AC93 3ZN5A 4AEDA 1YUDA 1W6MB 1VBE2 4A2UA 5T54A 3I54A 3GALA 1LRHA 1JOJA 2CGOA 2EXJA 2NPIA 3AMPA 5DUVA 5EYXA 2Y33A 1NE6A 3VHRA 3RS6A 1D4VB 3VUOA 3LKJA 3PTYA 4UBGA 3AK0A 1ND3C 4GULA 5C4WA 4CDQB 2DFCA 2DUOA 4AI0A 4NAOA 4NO4A 4LR4A 1OA2A 2ZGNA 3ZXDA 3FBYA 4YW1A 3ZSJA 1DGRA 4N43C 2OPKA 1PIV2 1YFUA 2G4IA 3UK9A 1VBC2 2BQPA 2V09A 2H6CA 3PMSA 3GBFA 4HETA 2ZMKA 1Y9QA 2R6QA 3E6BA 3GBWA 5ACA2 1BBT2 5FFOC 2H0VA 3B7MA 3DPRC 4K21A 1NXD1 5BNPC 5L19A 5JOWA 3ZYPA 4M3CA 4AVSA 2VQAA 2RS51 1EAH1 3FMGA 4XFAA 2YV8A 4CDUC 1JYIA 4QT6A 4FPGA 1I3HA 1QHDA 1RHI3 4QX5A 3LGRA 3BOPA 5BYNA 4AFDA 5JMCA 2XJUA 1EPZA 4P9JA 2ZBJA 2WFF2 3D82A 5M0TA 3NSTA 2VU9A 3JD72 4WVZA 2FMDA 4IV3C 2GH2A 4FPYA 5GZDA 2FHRA 1MEC2 4OI4A 1CAWB 1N1VA 4OUMA 5HBAA 1AZDA 3JCIA 1HKDA 4XIOA 4XFIA 5TSWA 2XVLA 3N36A 4NR1A 4E2SA 3OY8B 3RMXA 4Q4W3 1ZZ7A 1HRI3 4AE2A 3J8F2 5I0TA 1B35C 1VAMA 2YUEA 3D0JA 3FLPA 3K48A 2W0XA 2HKXA 3JU9A 3ROUA 2MPFA 4BMBA 3B5LB 2W52A 1GICA 1KS4A 3ZYRA 2JG8B 1KXGA 2VMHA 1V70A 4O9EA 3TN93 1AR62 5T55A 1DHKB 2R1DA 3R05A 1QJX3 4LBLA 5DUXA 5BNNC 1R093 3ZXEA 1GYKA 3I4IA 5FAXA 3HMYA 2ZMNA 4W65A 3S7IA 1HQLA 3KB5A 2PAEA 1DGLA 3QH6A 3UKTA 5CAZA 2ZGMA 3WG1A 5JSOA 1DZTA 3E5XA 3NAPA 1ZZ9A 1CAXA 4Q0VA 3FLTA 4MHUA 1QXRA 3SHRA 3ZDSA 3V56A 3VKMA 3OYWA 3AP9A 4QMAA 2BVVA 4FOYA 2CAVA 5KXDA 3U0ZA 3WW3A 4RS5C 3W9AA 2ZKLA 2RDSA 1NCQA 3RMYA 4YRDA 1AUYA 1RUJ2 4K3UA 3M3QA 3PMEA 3WNXA 2IXLA 2K0GA 1Q8QA 3WR0A 4YW4A 1VBD3 4RGAA 1NLSA 5K0UB 2RM22 2LUWA 4P5HA 4DRVA 4NHKA 2DVBA 5HV4A 3WXPA 1U12A 5CFCC 1RVF2 4OI0A 1Q8VA 3VBRA 4CEYC 2E7AA 2PFWA 4XE9A 2VW1A 3AYDA 3WW2A 4K40A 2WT1A 1CQ9A 1RUC1 5CVRA 2B42B 1S0BA 2ZGSA 1LOEA 3FUQA 3IBMA 2R041 1FOD3 1ZM1A 3ZSEA 4D7TA 1CGPA 4Y1VA 3VBFA 2PLV1 4QQHA 3VDDB 4AFMA 1QQP1 1RINA 4I01A 5BY5A 1HQWA 5BXXA 2DF7A 4NHMA 3ZFGA 1EV13 1SCRA 4FPCA 4LTAA 3WCRA 3ZMNA 2OVUA 1YJKA 2RE9A 1XYPA 5J7MA 4N53B 4YZ3A 2CL2A 3FUOA 5H9PA 5CFDC 2GALA 5I0RA 4C0HA 1RITA 4HPKA 4TLFA 3KSCA 2ZHKA 1QDCA 3POSA 3JBG1 3SXWA 4BCUA 2XJPA 2EXIA 2WNUA 4AFCA 1ZREA 4QHBA 1GZWA 3MGUA 3OBTA 3ITQA 4QPGC 5H9RA 2W39A 5J3UA 5AFBA 1YWKA 3KT1A 3LCPA 1PZ7A 1DFQA 4YW5A 1AR71 3PLQA 3D0SA 2RG4A 4Q0SA 2R072 4Z07A 5HXVA 3EBRA 1H8VA 2IXKA 1H1AA 3WUDA 4WM8A 4JDNA 4IEQA 4EN9B 4XF1A 4KGQA 4XOGA 1KJLA 2HWF3 4L8QA 4Q4V2 2P3JA 3OBRA 1UD1A 1CN1A 4HBNA 2Y34A 2B45X 1Q43A 1ULGA 2WSVA 4PJYA 4QU2A 4AWDA 3ME2A 1LHOA 2WLPA 4LBKA 1JHNA 4Q5OA 1IPJA 3LB9A 3VBHC 1HXS2 4XBLA 3USUB 3MI8A 4AVCA 1H2KA 4CDWA 2VW2A 1QXPA 4M3CB 1YHFA 3O0VA 1WA4A 1FPN1 1DQ0A 1MR5A 2BEOA 3JB4C 3MEPA 2SLIA 3LSEA 4MHRA 3AYAA 4YGCA 3NNLA 5BNOA 3GZEA 1NZCA 3P3PA 5L9BA 3MICA 1EAH3 4DRRA 4H3WA 1OQEA 1SDWA 1AHSA 2X5IC 2VMIA 5JCTA 2WT0A 1CAUA 2DWRA 4AGRA 5JI7A 1OA4A 1QH6A 2HWE1 4AW7A 5GLZA 3GZTB 1I1EA 2YGMA 2EALA 1PZ9A 1HQNA 2Q1MA 5C8CA 4JRLA 3M7AA 4XJ8A 4TSVA 2EAKA 3PVBB 1AR92 5D8AC 4FP2A 1IS4A 4M3CE 4MLOA 5JVVA 1RUG3 3ZFEA 5JZGC 1XU1A 4RHV3 5L36A 1PO22 4IEPA 3KQRA 2D6NA 3VZOA 5DZEA 1SFNA 5CBLA 2HEWF 3VKLA 4PBOA 2XWBB 5A3MA 3V65A 3BVCA 2PHFA 4COZA 4WV8A 1VP6A 3PNAA 2D6KA 1YFWA 3FE5A 4XACA 2HJIA 5IAVA 2RS31 3W58A 2F4PA 4XFHA 3X29B 2WFPA 3ENRA 3VZNA 5LEKA 5DG1A 2NYYA 3NV2A 4XXAA 1SBEA 5L7OA 2XJSA 1ASJ1 1CVNA 1AR91 3OYWB 1COV1 3H7JA 4J1XA 4RR3A 1ZZ8A 2PN5A 1POV1 2B9UA 3RWNA 4CEWC 1PGL1 3ZFFB 1DGRN 2Z42A 2JG9C 5E88A 4XXPA 2XKPA 5KWRA 3RG0A 2XH6A 4ISRA 2ETEA 2RS11 3MYXA 2WIIB 4EROA 1KS5A 3EQEA 3POWA 1AYN2 3BB6A 5J36A 4MXWB 3HBZA 4M0HA 3VBRB 4Y5TA 1REEA 1AR82 1O5LA 1HRV2 2D6LX 1WW4A 4LA2A 4V1PA 4KWLA 2TEPA 1Z78A 1CPNA 4OULA 3KZ4C 2RMU2 3AZYA 1R1ZA 1RUC3 5D1IA 4XFBA 3VZJA 2WA4A 5A3LA 3ZPYA 1QJU1 2B39A 1RUI1 4LHLA 1PGW1 1WMFA 2AR6A 3PHMA 4JGYC 4ATEA 1C4RA 4YVWC 4XMIA 4YVSA 2PLV3 1HV0A 1WCKA 4MH0E 2LM3A 1QQP3 1NYWA 3TYJA 2WA3A 5KXCA 5BUVA 4HPKB 3LOBA 3DUIA 2CGPA 1MQTB 3AYCA 4ASMB 3MLJA 5DDJ2 3E5UA 1RUNA 4NOTA 5A32A 1TMF2 1ZVFA 2Z79A 1UF2C 2WNUB 5C9AA 2GN3A 4FOQA 3KMHA 2D6MA 4QM8A 5J37A 4NHXA 1LEMA 1AYM2 1N1YA 3VKNA 2LALA 3WW1A 2Q1ZB 1NCRC 2GN7A 4QPIB 4IEVA 3MZHA 1O4TA 3ZIXA 5LATA 1A3KA 3LA3A 4AFBA 5CNAA 1MZ6A 2QZ2A 3V0BA 3V0AB 3BPZA 1IS3A 4AK3A 4WM8B 3TB0A 4WM7A 4BYYA 1AR73 2I74A 2R30A 2QUOA 2DVAA 4LEJA 4BWOA 3GHNA 2HBTA 5K7PA 1PNFA 1MZEA 3MDPA 4Q0PA 1FMD2 4X8PA 4XF3A 5B2GB 4KL1A 1LOBA 3B69A 5J48A 1S0JA 2R061 4OHWA 2A5ZA 5FMOL 1EPWA 2UY8A 2MHFA 3PJQA 3VBUC 2DVFA 3L2YA 2VNRA 4COVA 4YM0A 1RUH1 2GAUA 5GLTA 4EWEA 4CDWB 4KG8A 3WP6A 1YFXA 1W6MA 1NA1C 1V9U1 1WW6A 3FJSA 2OA2A 3A0KA 3DL3A 4BHPA 3M2MA 3MFAA 1J1TA 4FPOB 2IWGB 4M00A 4P9IA 3TOJA 1FPN3 2CWMA 4HMZA 5EWSA 1MS9A 1A8DA 4QGLA 1DQ6A 4HANA 1URXA 4S2GA 2D5FA 3TAYA 4CDQC 1OMIA 2HWB2 2Z5WA 4AQ6A 4AFAA 4EV0A 5C8CB 5FPZA 1QF3A 1DDLA 2CYFA 2R0FA 4JTNA 2HWE3 2JENA 2CGNA 1RC6A 1AJKA 2RR11 3WY6A 1ZBA2 5FTTC 1C5HA 1IHMA 3CF6E 3M1HA 2A3YA 1YLLA 3C2UA 5IUQA 2VMGA 1G9FA 3J9SA 4E2GA 4IEOA 1VBA2 4CP1A 1XYNA 2ZOEB 3FWEA 2YYOA 3TNQA 1XNKA 5GM0A 3WINE 1G9CA 3VLBB 2CWSA 3IMNA 1FXZA 1FNZA 1DZRA 4R8HA 1YI9A 2HYKA 4DNYA 1TME2 4HKWA 1H30A 1UMZA 2KA3A 1CJPA 4Q4W2 4XJZA 2E7QA 1I6XA 4L97A 4M0NA 2RS33 2VW0A 4KGGA 2EA7A 3NV1A 2KM2A 1NQJA 1Z7S1 4RR3B 5FO9B 5DAVA 1RUF2 4LO8A 4A7ZA 4GB31 4P9GA 2EIGA 1ASJ3 1UIKA 2A73B 3L9JT 1VBA1 1R092 1COV3 2JDZA 2EXHA 4HN1A 4WZCA 2JEMA 4XIKA 1OOPC 4LO6B 1M06G 2DUPA 1POV3 1ZBE1 4QGMA 4Q4Y2 2VG9A 4RGGA 2IC1A 2ZTNA 4OUSA 4MUVA 4AI8A 5JSRA 1RUD1 4HSJA 3GZAA 1DQ4A 1BVVA 2RS13 4SLIA 2WZR1 4Q2FA 1SQ4A 2PHLA 2UYBA 3ELNA 3B94A 2JG8C 3ILRA 1KFXL 1H0BA 1UAIA 4GMP0 4R4ZA 1CD3G 5EP9A 4C91A 1RUF1 4KWKA 3VBOA 1S0FA 4AHYA 1S0CA 4X6RB 2PQQA 2BFUS 4LHKA 1GSLA 2YROA 1PVC1 3B01A 2GNTA 2UU8A 4Y22B 5IATA 3WG2A 5CG9A 4UW3A 4AHZA 4IV1B 1QOOA 2BBVA 4ZU7A 4XQ4A 1FV2A 1GNHA 1XNDA 2AUYA 3CLPA 4BQXA 4OI1A 1PMIA 1CAVA 5IK8A 4XEZA 2BPA2 5C9AB 3APBA 2Y38A 1O4ZA 5K0UA 1QJY3 1LB2A 1R1A1 4DB5A 2D98A 4FTSA 1BQPA 1MS1A 4RQPA 2YZ4A 4IESA 1MS0A 3RPQA 5FPXA 2A6ZA 1PHMA 1G6NA 1CX4A 5T5PA 1UPSA 2G9FA 1N1SA 3V0BB 5L9RA 5F1RA 1GNZA 4WM7B 1C5IA 3AYEA 5I0SA 2VPVA 4B7EA 3VDDA 3KT4A 4AG4A 1ULCA 3E97A 1LOFC 1RTVA 4HSLA 4XFGA 3CNAA 3WP4A 1UN1A 1XNBA 2BWCA 3K51A 4OI2A 2XBO2 4N53A 4Y1XA 1A6CA 4TYSA 4XF9A 1WBLA 2R063 1LECA 3MW3A 3NWKA 4GWNA 1FT9A 1R083 5ABJC 4JZRA 4Y20B 5KBFA 2ZX0A 4H14A 1GR3A 4EWAA 1PGSA 2VGDA 4AEDC 2WNVA 4F83A 5K8SA 1RUH3 1WD3A 4K20A 2HEVF 2ZHNA 4LUMA 1V9U3 3CEWA 4B29A 2A6YA 4C0BA 4XMAA 1UL9A 5FOBB 3HWJA 1G9BA 5GALA 3ETQA 2HEYF 5C4WC 1VBB2 4N7UA 1S2KA 4C1XA 1D4M1 4IEYA 3HN1A 2A75A 1D2QA 4XF0A 1AL22 1RL3A 2HWC2 3AMQA 3WZ1A 4B4PA 3WX5A 4BA6A 3VHNA 5CB7A 3H3UA 2VVEA 2PA7A 1VBE1 4XJWA 4FVVA 4FT8A 3ACLA 3USUA 2RR13 1RJ7A 2XG3A 3BU7A 1OD5A 4PIYA 1EYBA 2BW8A 2VXRA 3SITA 4HVOA 1W6PA 3GF6A 4PLNA 2W68A 1PZ8A 1S55A 2V4AA 5JWPA 3R4UA 5KC5A 1S0DA 4QPYA 1RUE2 3OUIA 3FFQA 4GALA 1MS3A 2D40A 1PIV1 4RHV2 1AL21