3KT4A

Crystal structure of tpa1 from saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
615
structure length
563
Chain Sequence
EEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYELYMMDDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PKHD-type hydroxylase TPA1
publication title Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 183
structure length 563
sequence length 615
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3kt4A01
2.60.120.1580 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kt4A02
4ZPIA 2V4AA 3BVCA 2OPWA 3W20A 2RG4A 3NNJA 3OUHA 2HBUA 4Y5SA 5IATA 2RDRA 5LA9A 2RDNA 3EMRA 5DAQA 5L9RA 2FCTA 5LBFA 4NMIA 2Y33A 5C5UA 4IW3A 5A3UA 5C5TA 3GJAA 4XC9A 5LBBA 3OUIA 4UWDA 5EQUA 2G1MA 3KT4A 4Y5TA 5DAXA 2RDSA 5LATA 2G19A 5LASA 3OBZA 4XCBA 5HV0A 2FCUA 4XACA 2A1XA 4J25A 5DAVA 3KT7A 4NHMA 5LBEA 4NHYA 3GJBA 3W21A 5L9BA 4NHKA 3KT1A 4KBZA 4XCAA 3ITQA 2Y34A 3PL0A 4MHRA 3OUJA 4ZONA 4BQYA 4Q5OA 3GZEA 5ERLA 5LBCA 4MHUA 4XAAA 4XABA 2HBTA 3NNMA 4BQWA 5IAXA 5L9VA 5LB6A 2JIGA 3NNLA 3HQRA 2JIJA 4NAOA 4NHXA 4BQXA 5DAWA 3MGUA 5EP9A 3NNFA 2RDQA 3DKQA 4JZRA 5DAPA 5IAVA 5HV4A 4NHLA 2FCVA 3HQUA 5EPAA 5M0TA
chains in the Genus database with same CATH superfamily
3ZLIA 5CFDA 1Q8SA 2WT0A 3N4MA 1LB2A 1CESA 1GKBA 2WZEA 1SLCA 1XYOA 2B4KA 5A3MA 1RVF2 1W8FA 4XIOA 3T08A 1W8WA 4OYUA 2ZGPA 1BBT2 2YU2A 3PDQA 1Z7S2 4Y1VA 3ZFFA 4AQSA 5I8TA 5C9AA 2JB4A 3JU9A 3O1RA 1F5JA 1U12A 3MIFA 3B9CA 2P6CA 1W8HA 3ABZA 1QH7A 2FMYA 2RM21 4LO8A 4TSVA 4I0WB 5FZCA 1ULFA 2ZZQA 3PMEA 2O8OA 5DABA 2VZUA 3VZNA 3I2GA 5K4LA 2WNEA 5FYTA 4ARYA 3LD8A 1EV11 1VRH2 3SCGA 1DCSA 4BLJA 2WQZC 5FO8B 2QQPA 1N3OA 4AGGA 1S0FA 5FZFA 2MEV1 3QACA 3KV6A 4FFHA 4CCEA 1OFNA 4UW5A 2V5YA 2VQTA 3CJIA 1IS4A 1DQ2A 1GP5A 2Y6FA 3JQXA 5FYBA 4Q8KA 4LBNA 3WHTA 1NQDA 1PMHX 4LBQB 4MLOA 3FX3A 5DZEA 1W0PA 1HRI1 1ZZ6A 3IN9A 3I3EA 3G7DA 5BNNB 2ZEYA 4YSFA 3PHMA 2DU1A 1Y9GA 3I97A 1PNGA 4KBZA 5GM0A 1AVBA 5KWRA 1W9TA 4UI9L 1HN1A 5A3TA 1VBD3 1J3RA 3I3QA 2JG9C 4CP9B 2PLV1 1QJX3 3EJKA 4EN9B 1FV3A 5FMDA 1GMMA 3KLSA 1CIWA 3MIEA 3I49A 5GLWA 2XLFA 2YFZA 1X50A 2RR12 3N7KA 2BYVE 1CGPA 3TOJA 1YXWA 1BEV3 1BK0A 2JG9A 1F9KA 1PX3A 2IFWA 1QJY3 2L9LA 4JX0A 4KL1A 5JZGB 3NSTA 4MZUA 1NCQC 1RUC2 1MEC3 2VCMA 5CNAA 3IDEA 1BLZA 4D6RA 5IVYA 3D0SA 1AR63 5IFPA 3HQXA 4GIQA 3ST7A 1F2NA 1QU0A 2B8MA 1AR81 5A6ZA 4OZXA 3DKWA 3S0MA 1WLDA 3PJYA 1POV0 1NCQA 2V4VA 3LCPA 4LK7A 1W8UA 5FYVA 4Z1VA 5JIUA 1IS5A 3BTZA 5FZGA 4CU9A 3O0VA 3D82A 2XJUA 4L2NA 1E5IA 1AYN2 3GXUA 4Y1UA 2WFF2 5LRRA 2P17A 3ZFGA 1UW8A 3OG2A 3DF0A 2VZRA 4KQ7A 5FP9A 4BK5A 2D43A 4E4DX 1VJ2A 3R4UA 5A7WB 3USUB 4BHPA 4QX2A 4MH0E 4NWVA 1PX4A 1NUKA 3RMYA 3KGZA 4IE6A 1LECA 1ENXA 1GR3A 3N7JA 1C8M3 1JYWA 3NNFA 2W52A 1MZFA 3GZAA 4X8NA 3ZXDA 2X8KA 3A4UA 4WBBA 5APAA 1BVP1 1ASJ3 5T5OA 1RUH2 4RHV2 2DVGA 2XL9A 3MYXA 4YARA 4LT5A 1FPN3 3Q9OA 3T0AA 2YC2A 3ZSEA 2XJRA 1PO21 5H9PA 3VZLA 3ZYPA 1CAUB 2Y6KA 3AMQA 3DXTA 2BWAA 4ATFA 2VZSA 4A41A 1Q8VA 2ZABA 3LQCA 4FBFA 1P8JA 4OMDA 2W92A 3LOBA 1SLIA 1O3RA 5BNNC 3GCXA 1RUE1 1UIJA 2BBAA 4YZ1A 5E88A 5FZOB 5A33B 5BUVA 2W91A 5IATA 1V6IA 2Q1FA 1Q5OA 1QWRA 2W68A 2FD8A 1PM7A 4LBQA 3HD8B 4XUQA 4O9GA 2PHTA 4R9AA 2XONA 3VKMA 4BWOA 4BXFA 4XUOA 5DAQA 4BM8A 4M4PA 5BNNA 2Q4SA 5C3QA 3OOXA 4HXCA 2JDAA 5FYIA 2MHFA 4NUBA 4UWDA 3T30A 4CP9A 1ZZ8A 4Q0PA 2EXKA 5JZGC 3IAQA 1SBFA 5DAXA 3OBRA 5BNPA 2PAEA 5LK7B 2WO2A 5LATA 3DV8A 1VMFA 4OI2A 4XQWA 1US3A 5FZ9A 3QH6A 2F6BA 1Q8OA 2HWC3 3OJBA 1I1EA 2R0HA 1Q43A 2VCAA 1FV2A 1W90A 2VMEA 5F6KA 4FAGA 2BJSA 5JZGA 4UBHA 1JYTA 4LHLA 3VBSB 2EIEA 1YFXA 2WO3A 3VKLA 1IQAA 5IK4A 2J7MA 3WNLA 2WUHA 3MFAA 3TEZA 1UO9A 3VDAA 1GWLA 5J37A 2R041 1XNBA 1NG0A 3LWCA 2Y38A 4OQ9A 1F5FA 3T2PA 4CYDA 1O4TA 4E2QA 4IDZA 2Y6HA 1TME1 4IERA 3VDBA 2E31A 1LU1A 4OMCA 2ZGUA 3HPNA 2JEMA 1R64A 4YNIA 1CN1A 4SBVA 5FZ8A 3USUA 1XPWA 3RYPA 3J7NA 4K20A 5D1IA 2JJ6A 4C91A 1AJKA 1LOGA 4QB6A 1JHJA 2HH9A 2R062 3IAPA 2VMCA 3PUQA 1NY72 2GNMA 2NN8A 4AVCA 4OVEA 1N1TA 3B7MA 1D4VB 2DFBA 5AFEA 3NVCA 4XW3A 1JZ2A 3FC0A 5JOYA 1AYM1 2PQQA 1XB9A 1MVEA 5HCBA 1PVC2 4UYBA 4CP0A 1WW5A 4ZS3A 4M01A 1OA3A 4IUGA 1O4ZA 4S2FA 2P1BA 4QAWA 3VZKA 4CEWB 4QPYA 2WBKA 2MNGA 1MS4A 4XQ4A 2R7EB 1CAUA 1QJZA 4FPGA 1VBE2 3IMMA 1VBB3 1NLSA 1ULEA 5DAWA 1UNBA 1Q56A 4AAXA 1OA2A 4AGRA 2IFRA 1NLRA 4FP3A 1H4HA 1SBDA 1LOCA 1D4M2 3DKQA 4DUVA 4HG6B 3OCPA 4XFGA 4BYYA 1GP4A 2DYCA 5JOZA 4O7XA 1R092 4XFIA 2CU5A 2C0ZA 5KXCA 1SPPB 3ES1A 4QM9A 1JBCA 5ACA3 1JZ6A 1K5MB 2R6QA 1AXKA 1TVGA 4S2GA 4B3NA 2WS93 4LE3A 1COV2 2XJQA 2HWE1 1VR3A 3T1LA 4YM0A 1MACA 5CBLA 1EPWA 1V6OA 5IVFA 3CQOA 3H1MA 3UL2A 3VBSC 2OPWA 4ES8A 2AR6A 2DTWA 2RG4A 2W9XA 1EP0A 2WINB 3BYWA 1AX1A 2YXSA 4Q27A 2QQWA 5FLIA 4AI9A 2HWF1 4X8PA 4AVSA 3AFKA 1DQ6A 2WFPA 3LZZA 3VBSA 2D3SA 1WBFA 4XF3A 1YQ8A 3W9AA 4XHBA 1PIV1 5GLTA 4YYOA 2UWBA 4K8RB 4COUA 2R073 4JC1A 1F35A 3L2HA 1W2NA 1X82A 4Y4RA 1J3PA 1J58A 1S0GA 3U14A 5EJ1B 2OZJA 1UMHA 3I2FA 2ZKLA 5A7QA 4ASKA 1GQPA 3I2DA 4PLOA 5BV6A 1QJU2 2BUKA 2PAKA 4GWNA 4NIHA 1GICA 4P9YA 4C1XA 1XRUA 1ZA7A 3IDBB 4MGTA 4LA3A 1W2OA 4AF9A 2RMU2 5GZEA 1V9U2 2ZBJA 1XNTA 3CIHA 4CDUA 5LBEA 1AL21 3OBTA 3CNAA 4HN1A 4E4HA 1DFQA 4LR4A 4CEWC 5K0UB 1MPXA 2J1SA 3JQWA 5FXVA 4WV8A 1YWKA 1EAH2 3B69A 3KGLA 1ACCA 4JHZA 4MHRA 4CEWA 1YFYA 2BGCA 2BWCA 2VNGA 3LFMA 3RSJA 5I8SA 3SKVA 4AFBA 4Q4Y2 3HBZA 2IXHA 1JZ8A 3H7YA 2FDIA 1KQRA 3AMPA 3BPSA 5B4NA 4XF0A 2ORZA 2BTVC 5ANQA 1QH6A 3PIJA 2C26A 4GWMA 1QQP2 3T3YA 1PGL1 2RS52 2QJVA 1K5JA 3E97A 2ZGNA 3ACIA 3LEGA 5FUIA 3AM2A 5IWFA 2VBPA 4XAAA 4ZS2A 5CKNA 1K5MC 5JR2A 3MICA 2GSYA 2H6BA 1O5LA 2D7FA 5J09A 3MDPA 1WKYA 2ZX1A 4QPWA 4UT5A 2YC0A 3AKQA 4BB3A 3ZPYA 5IT6A 3NJZA 1UMZA 1W2UA 1SPPA 3H1WA 1IOAA 5LB6A 1K5MA 3WDTA 3BCWA 1CJDA 4X6QB 1UY0A 3J4UH 1S55A 2R30A 2DCTA 3N7MA 5DQ0A 1Y7BA 2BNNA 2F17A 2VNVA 4CDWB 4I01A 3CMGA 3FJSA 3HQRA 4M3CA 5T52A 4EZ4A 3IMNA 2PTMA 2H0BA 2FHRA 5IUQA 1VBD1 3WP3A 4GB33 5FP7A 3WQBA 1QJX1 2H0VA 1SCRA 4HL0A 1G7YA 1MS3A 3J7LA 4LKEA 1V70A 1LHOA 2ARXA 4IETA 1W6PB 3EO6A 2BDRA 5F2SA 1WA4A 4YPJA 1WZXA 4QQ2A 1PZ8A 3B9IA 1XE0A 4XBNA 1UWWA 4P9XA 1AR93 1QJY1 2JG8B 2CGOA 4FPYA 1QHDA 4BH9A 4FAHA 3C7FA 3HQUA 3E6DA 1FX5A 3IDAA 4XFCA 4HFSA 3I3BA 3SCHA 2C4XA 1W04A 4YLZA 4QXCA 2DUQA 3E5QA 3W20A 1ZREA 2D5FA 1AX0A 3UNPA 5K0UC 3OUHA 1RITA 2OYZA 2JE8A 1IS6A 1JUHA 1WLWA 1M06G 5BXXA 3V0BB 1GQHA 1OOPB 1J83A 3VKFC 2OVUA 5DUXA 1DQ0A 5DG2A 1ULCA 4NPMA 3EXUA 1WMXA 5K0UA 3EMRA 4LE4A 5LBFA 2WZ8A 4NMIA 3POEA 4I30A 3INAA 3C7EA 3VD4A 1UF2C 2QQVA 3T0BA 4UF0A 2X5IA 5LBBA 4DINB 1LRHA 5FO9B 1WD4A 2N7GA 2WLQA 3ALQA 2EA7A 1OKQA 1G9FA 2ZJCA 1A8DA 2XPJA 2XBO1 1ASJ1 2G19A 1VB4A 2VU9A 2HWB1 3H9AA 2X10A 5FLHA 5FUPA 4B8EA 5JI7A 2KM2A 4DXZA 4BDVB 2BP6A 3DN7A 1DLLA 4LORA 5GJ6A 3D4KA 3TEYA 1IHMA 3SISA 2ZGKA 3VD3A 3KT1A 3MV01 1FMD2 3RMXA 2RR13 2VNRA 4JCKA 3VD7A 1FATA 2IXLA 4CDWC 5A3PA 3PL0A 1A6CA 3VKOA 5C33A 1RMU2 1JN2P 2Q8CA 1Y4WA 1OFSA 1RUC3 4W6XA 3GDBA 1ZYBA 2GH2A 5ERLA 4ZZ5A 1QKQA 5E89A 4D7TA 3CZJA 5C8WA 4FPCA 3LDRA 1VLNA 2AEZA 2PHDA 4MGKE 1WCKA 5DUWA 1CR7A 4AFCA 1OH3A 1OMIA 2D40A 2JG8C 2QE3A 4EWEA 1RUI3 4BQ5A 3HWJA 1W6PA 2WFF3 5JXJA 2P3IA 2YMZA 3USSA 4KMQA 5FZEA 3THDA 2JG8A 1F4HA 3TNPB 2D3RA 3ZXKA 4HK9A 1W06A 3DPRB 2ZCWA 1JYNA 2DCYA 5L9VA 1FYUA 4C0BA 5AC93 5FZDA 2E51A 3VLBB 1V6NA 3T2TA 3H1YA 1HV1A 2VTXJ 4AQ2A 3NV3A 1OOPC 5FZ1A 2GU9A 1C28A 4IV3B 1W9YA 5JUVA 4QX8A 3SHRA 2YPJA 1IG0A 4NAOA 4XUNA 1VBA2 1W9FA 3ZSKA 3NWKA 2WAOA 2BZDA 5I91A 2VZQA 3AB0A 2AZ5A 4RHV3 3ACLA 4Y33A 4NIIA 1OOPA 2WWUA 2OPKA 4GQ7A 4JHTA 4IEYA 4XBLA 5LZ6A 2P34A 2QKDA 1CX1A 1VRBA 5HV4A 4P5YA 2JENA 2R32A 2A5ZA 4AEDB 1TE1B 1WCDJ 3RZKA 1Q8PA 1XNAA 2HWD2 2B5HA 2W87A 1W05A 2A6ZA 4EROA 2WKKA 2YBKA 1VMHA 1O59A 3GHMA 3I3MA 4ASMB 1HX6A 4CPBA 2YC4A 1YNAA 4CP1A 4HVQA 4J1XA 1DU3D 2CGNA 5JOXA 1WMDA 4AVBA 1YJKA 2BVVA 2QQKA 1UQXA 1L3JA 2AYHA 1GOGA 4LBQD 5JCTA 4CDXB 1RUG2 1UL9A 2ES3A 2FQPA 1WCQA 4LA2A 4JAAA 3NMBA 4P14A 4IEPA 4QHOA 3WR0A 5LA9A 3O14A 1AHSA 2W39A 1JTZX 2ARCA 3IIAA 5FKCA 1NLQA 1HXS2 1VBB1 4YW5A 1QXJA 4PIYA 1SACA 1SQ4A 4I3PA 5FV3A 4DO0A 3MFCA 1JODA 1Y9QA 2E63A 4AVAA 4D8MA 2BGPA 3PURA 1VBC3 1YRZA 4GH4B 2BW8A 3PLQA 1TQ5A 3MI8A 4N90A 4Y5TA 5FPAA 5B2GB 3VZMA 4D6QA 2VTXA 4Z07A 3OSDA 2Y0OA 2XKOA 3IWZA 3IDCB 4KG0A 2C1FA 3JBG2 5T54A 4IEXA 1SBEA 1TMF2 1JI6A 3ZDVA 4GAZA 1ZZ7A 1ZBE2 2WS91 1RUNA 1C1LA 4PCRA 2D5HA 3H8UA 3DPRC 4MGSA 3H8XA 2R0FA 4YM1A 4RGGA 1H2LA 1WCSA 1Y9MA 3WOGA 2VUJA 2A3XA 2FMDA 2VOTA 2YZ4A 2VXRA 4JDOA 4IV3C 2B9UA 2ZHMA 4RYDA 3WVJA 3ZX7A 4CU8A 4URAA 3DPRA 3VHPA 3OUJA 1H4GA 4QB1A 5D21A 1YYNA 5ISLA 1XE8A 2R49A 3ZMNA 3WDUA 2XJVA 2JE9A 2JDYA 4NN0A 3E5XA 2IXCA 1GLHA 4A3XA 3LA7A 1WW4A 2R071 3VBOB 2R1DA 4KG8A 3K46A 4LLFA 4AL9A 1UPIA 2VG9A 5HCFA 2YROA 1PVC3 3AP9A 2UWAA 2A6WA 3PTRB 3ILFA 4MHUA 3GALA 4E9KA 4AEDC 2HLEA 4AHWA 4AR2A 1G9AA 1OI6A 4GJYA 1YQ6A 1K3IA 4XABA 1GZCA 3KWVA 4M00A 4A44A 1RUJ3 1UYPA 2HEWF 3OPWA 1VBE3 3ELNA 4AEDA 3I2OA 2UWCA 3WLUA 2XJPA 4GALA 4IE0A 3WDVA 5JXGA 1O91A 2A6VA 1ENSA 4CDXC 2XVGA 3QBQA 4QPIA 3N3HA 3SEEA 1ZRIA 1RUD2 3RZMA 2PN5A 4QXHA 4MUVA 1D4M3 4AYUA 1RHI3 2XVLA 1OKOA 1VE0A 3CJXA 1R093 3N35A 3J9SA 4YVWB 5DXDA 3J7HA 4U2AA 4PIXA 3WF0A 3LSDA 4EN8B 1KS4A 1GQGA 3M3IA 3P3PA 3N9OA 1YHFA 2ZXQA 5FZMA 1COV3 1POQA 2RJKA 3CBNA 5DDJ1 4NVPA 4GH4C 4RR3B 5FMCA 5IW0A 4AEKA 4CU7A 5FMBA 4CEYB 4CP2A 2FCVA 4P9JA 4OLLA 4B4RA 2Q1ZB 3DXUA 5HI0A 4IESA 2VE1A 2CSGA 4XZPA 2W47A 5C3PA 3GCWA 4HLTA 4OFGA 3RFRA 5M0TA 3LOIA 3LF7A 2VOKA 2WO7A 3PVNA 4ZPIA 3AKPA 3CF6E 5G05L 2WRAA 3ZYHA 5GZGA 2DF7A 4H2AA 1JYCA 2Z5WA 4URTA 1R1A2 1TNRA 4FI9A 4WVVA 3K77A 4B4PA 1UZVA 2PHFA 3AL6A 4N53B 1CAXB 2RDNA 3WW4A 4Q4X2 2I45A 2VZ3A 3WF3A 3O1VA 2JKBA 1A8MA 3POGA 5HCHA 5FMOS 3LEIA 5I0TA 2Y33A 2RS32 4Q4V2 4A6SA 5FYZA 2D6LX 2YDEA 2K46A 1NZCA 4H14A 5FZAA 3AZYA 3TN93 3VBOC 2G1MA 2LM3A 3KVBA 4LBJA 5E1RA 1SLAA 3MW4A 4E2SA 2PAMA 4E8CA 5A1FA 4X6RB 2G9GA 1STMA 4QX0A 3U4SA 3OPZA 4Q4W2 4HVOA 1TNFA 1AR91 1C3HA 1AX2A 1CZTA 3CLPA 4YG6A 5T3NA 3VBOA 4XCBA 5FREA 2CHHA 4BMEA 2X05A 5I0UA 1BZWA 3LE0A 4NHMA 2VW0A 1DZQA 1EAH3 4QX5A 1H1MA 2DCJA 4N9IA 4LK6A 1AR72 4Q4Y3 1KDMA 4Y20B 4EJRA 4IEQA 4ZONA 4CUBA 2GP3A 4AI3A 3GZEA 4YVWC 3KB5A 3VZOA 4CCCA 4XUTA 2RS53 2Q30A 2NLRA 2J1AA 5DZFA 3OF1A 5J3UA 4AI8A 1SMVA 3NRUA 2EIGA 3GNEA 4QHBA 1JMUB 4HZFA 4XHXA 1G9DA 2Z42A 3DGTA 4S2DA 4RR3C 4YVWA 4ZU5A 1OUXA 4A42A 1LGCA 1MS0A 2RM22 2WLPA 4O65A 1O3SA 4LEJA 1GNHA 2WSVA 2WNOA 2RV9A 3RJRA 4XJ8A 3H8RA 1VMJA 4KI5M 2AENA 1EV12 2I07B 4RR3A 3FE5A 2CY6A 1DP0A 2BFUL 4BQ3A 1H9WA 4XFAA 5JSRA 4Q0UA 4AEJA 2YPDA 3Q8FA 2MEV2 4TLGA 5F37A 1HKDA 5SV8A 2KR2A 3GZUC 4E2GA 3PTYA 1LHWA 2IWGB 2VBBA 2JECA 5T50A 4N53C 1LCLA 2D3PA 5CU1A 1JS9A 3WQ7A 1NKGA 3JB8A 5EV7A 1UKGA 5A80A 4B7KA 3MLJA 2W95A 4AK3A 1RJ8A 2ZAAA 5KC5A 5T5LA 1HRI2 1RB8G 4Z82A 1D2SA 4DRVA 1K12A 4N53A 3R0RA 3LIHA 3WG1A 3JD73 3WNMA 4JRAA 2OQ7A 3BALA 1RXGA 3L9JT 3I7DA 3WW3A 1GOHA 3T0DA 1PO13 3RYKA 1SFPA 4N43B 5J36A 5FYHA 4QKNA 1UN1A 1YIFA 3MBWA 4YG0A 1RUI1 2P2KA 1PGW2 1VAVA 3WDXA 4LBOA 4FXGB 5FMOL 3WD5A 3I2IA 1WW7A 3NNJA 4I0AA 5F3IA 4CA9A 2GZWA 3A21A 2E7AA 3AX4A 5I0RA 4CVUA 1AR82 1H6XA 1QXRA 2HBUA 3EHKA 2XLGA 1I6XA 4XAEA 2XQXA 1IGOA 5AC91 1JYIA 2X29A 3ZXEA 3LSEA 1OC1A 3QD6A 2YGLA 2YG0A 1QY4A 2GDFA 3I59B 1ND3B 2JD4A 4P9WA 3O1PA 5A3UA 2O1QA 2WNVC 3WF4A 4AXOA 2P3YA 4RHV1 2GNTA 5EQUA 1KD7A 4HONA 1UY1A 2BVBA 4UW4A 5CVRA 1NXD1 1ULOA 1X8MA 3P3NA 3THCA 2YUEA 3RGBA 3VN4A 3CHXA 1HIXA 3KQRA 1S0IA 5FZ7A 2IUWA 2PA7A 3OBZA 3T2OA 3MF9A 3K75B 1AXYA 1FI2A 1MZ6A 1RUF3 2ZEWA 2Y26A 5GLUA 4NIDA 1ZM1A 3ILRA 4QQOA 5KHJA 3KT7A 4FQ4A 2DUPA 5C7GA 3FBYA 3C7GA 1HQLA 4QPGB 3WP6A 4RQPB 3S5AA 3HVDA 4NHYA 4NR1A 4IV1B 4OHZA 5F3CA 1PZ9A 2CWMA 4ET7A 2VD7A 5KC6A 2WA3A 5KXBA 5FAXA 1PO22 3ORJA 5HXVA 3K3OA 3OY8B 2Q1MA 4XCAA 5JAXA 3VV1A 3TNQA 2GP5A 4PJYA 4YFWA 3SNMA 2IC1A 4F3JA 1H1AA 2ARBA 2LALA 2QTWB 5A7SA 2OA2A 2W46A 2ZTNA 3C8XA 2GMEA 4SLIA 5L19A 1OSGA 1JU4A 1RUE2 4PF1A 1NE6A 2OW4A 2XHKA 3H0OA 3O7OA 1QOTA 2BQPA 1A34A 4WZFA 1IZ3A 3TB0A 3OBAA 3DYMA 3HBKA 3ETPA 3OEBA 5F3GA 1VBC1 3AP6A 1AZDA 2VECA 4FFFA 1SFNA 4IGOA 4N43C 5JIAA 2O0OA 1CAVB 1F31A 3IB3A 4QD2A 4KGGA 1YUDA 3AKTA 3AMHA 5F32A 5FBJA 5LY2A 3WNXA 2NZ9A 1SDWA 3B5LB 5FCCA 2GNBA 2ZAHA 3ES4A 4KNCA 4N43A 4B1MA 1AL0G 2SBAA 2XWJB 4NJ4A 4K1YA 2GMMA 5CAZA 3FLRA 2GMPA 3I2JA 1KJLA 3U75A 1UOGA 4BCUA 5A7WA 2PMWB 4QGLA 1YI9A 3SH5A 3E6CC 1UOJA 5GLVA 3BKZA 5FZ3A 2ZS6B 3FFZA 1ND3C 4I2OA 3WG2A 3NNGA 4LUMA 5JLVA 2R042 3GM8A 2PQSA 2WWJA 2HWD3 1HQWA 3JB4C 3VHOA 1OUSA 1UKRA 5F9TA 3FN9A 3I59A 1ND3A 4XFHA 4AVTA 2VMDA 4CPBD 1JOPA 3I3DA 2XB6C 1PVC1 1YFUA 5FBZA 2HEYF 1UD1A 3NO8A 4FFIA 5FTTC 3J8F1 3BU0A 2CGPA 1YQ5A 3A0NA 3M4FA 1QJFA 4MSVA 4EE2A 2JX9A 3R4SA 2JWPA 3N9NA 4J1WA 1RUJ1 3WUCA 4AG4A 3CKHA 1H8TB 3B00A 4QPGC 4RQPC 3V56A 4YW2A 4IV1C 5GKAC 4AZZA 4WVWA 1HXS3 3ZYRA 4Y5SA 4QM8A 1AYM2 4YW7A 3AYEA 3ZSLA 5LEKA 2D6PA 2RDRA 4FPOB 3AL5A 5FPBA 2LTNA 5FZOA 5A33A 3H3ZA 3BTYA 4IV1A 1ODNA 1AF9A 3SITA 1U5IA 3QH7A 1D4M1 2NQYA 1RHI1 2WN2A 3OY8A 3AC0A 1U0AA 1R091 3ZN4A 2WJSA 3JBG3 1LGBA 1YLLA 2WQ4A 4D7SA 1TMF3 3FLPA 2QDRA 1DQ1A 2OQ6A 1ZBE3 3W5NA 4L99A 2A75A 4FVVA 5DMYA 3B01A 2Y6JA 2ADEA 1OT5A 2PFWA 4COZA 4QGMA 2OUHA 1WA6X 5FK8A 3O1OA 3IPVB 1HRV1 5JSPA 5HBAA 2XQRA 4QDRA 4XJUA 1CAVA 1V6JA 4E8DA 4LHKA 1MZ5A 3GBWA 2MPFA 3NV1A 1R083 2AC1A 2XHNA 4G3YC 3F95A 5A6QA 1ZBA2 3PNAA 3U10A 4D7YA 5FRAA 1ALYA 1GOFA 2D6KA 2VR4A 4P08A 1V00A 4WM7B 2DTYA 1CWPA 3AMMA 1ND2B 4Q5OA 2FDJA 3ZM8A 3AVSA 4NROA 2HWF2 4XMAA 3VD5A 1DYPA 5IJRA 3NKTA 5T5PA 1RYYA 1LOAA 1QDOA 1BMV1 3POSA 1IPKA 1PIV2 2EICA 1LOEA 4QXKA 3CEWA 3I54A 1V6LA 2VZOA 4RGAA 3TN91 4IXLA 4OHXA 5K8SA 3BPZA 5F8PA 3S5QA 1FOD1 2WZR2 3KM5A 4Y22B 4R9CA 3RPQA 1S4CA 5F5QA 2WYFA 1UOBA 1H8TC 2YBPA 1D2QA 2HKXA 3M70A 1CPNA 3J7MA 4GWIA 1NAEA 3WNNA 1JUIA 1JOJA 3OTFA 4N9HA 3D8CA 4MXVA 2XXZA 4JGYB 2VMIA 2JIJA 2IXKA 4PQ9A 2ARAA 3AZZA 2XVKA 4QKBA 1AL22 4IQPA 4DUXA 1XSQA 2UURA 3H42B 4NRPA 1KFXL 4F83A 1S0EA 4FPHA 4FTSA 1BHGA 1XJAA 2RVAA 5IVJA 1CD3G 4DEQA 4AQ6A 4WM8B 5A6XA 1DGRN 1EY2A 4OUSA 3NJYA 5DG1A 1ZVFA 4YM3A 2VVFA 4YZ5A 4PF5A 3ZYJB 2XH6A 1H2NA 5JDBA 3WG3A 5EYXA 5HPOA 1E57A 2VQAA 5CKMA 3UGFA 3WQ0A 4AI1A 1RJ7A 2EIBA 2QQOA 4Q4X3 4MG2A 1PGL2 5CIRA 1M4WA 3HNBM 4KWUA 1W39A 2Y6LA 4QXBA 4TZDA 4W8JA 3A7QA 4MGYE 5I8YA 1XU1A 5F2WA 5CISA 2B9VA 4PIZA 1UIKA 3FBMA 4WM7C 2CAUA 1BEV1 3AK0A 5FZ6A 1ND2C 4RL7A 2WZPP 4DZGA 4KH9A 2O8QA 2CWSA 4TN7A 1S2KA 1L7RA 3EBRA 4FPJA 1XXNA 4Q4W3 4UW3A 1MEC1 5FYUA 4A6OA 1RVF3 4XFBA 5KHGA 4UOJA 3JD71 4YRDA 1AR61 1BBT3 1ND2A 3VHRA 4BMBA 1VBD2 1Z7S3 1DG6A 4BXSV 3G6JB 1REEA 4XFFA 4AE2A 5A1LA 2DCKA 1A3KA 1TEIA 1PO11 3RI9A 3RWNA 4FOQA 4HKOA 1UX7A 2VO5A 3PIGA 3POFA 3ENRA 4L92A 4HBNA 4R4XA 2EF6A 1QJY2 1MS5A 4MYEA 1UU5A 3IM0A 4AEMA 2DVAA 4K9SA 3TEXA 1Y43B 1VRH3 3PUAA 5TSWA 3N9PA 5KHHA 4XURA 1BKZA 3ZYFA 4Y22A 5BYNA 3FL7A 1UOFA 4R4ZA 3ACGA 4JGYC 5FY8A 4G9SB 2BEOA 1QNWA 4QU2A 4Y3OA 5F3EA 1C8M1 5BNOB 3FHAA 4INDA 4O61A 4QB2A 4KWKA 4C8DA 5FPXA 3LDKA 3PUSA 4HVRA 2E53A 4HKWA 3WHUA 3HNYM 4DXSA 3IBMA 4JGYA 3ZVXA 1X7NA 4NIGA 2BRTA 2F4PA 3MW3A 4XDPA 3E6BA 5L36A 3PUHA 1FPN1 2P3JA 4D0QA 1UZ0A 4WM8C 5IFTA 3C7OA 1DF0A 1OLQA 2GH8A 2J1UA 3IT8A 2RS12 3UGHA 1UXZA 2QFEA 2E32A 1C5IA 2ZKNA 2WQ8A 4A4AA 2J42A 5KBFA 4WM8A 1CVNA 3FHIB 1RUF1 3U07A 4MADA 4KGQA 1X9TA 1SCSA 1RGSA 2VW1A 1QGLA 2XBO2 4XZUG 5D8AB 2AACA 5JSOA 1ASJ2 3OYWB 5IK7A 2JD9A 2HWB2 3CZUA 5JVVA 4U36A 1OQDA 2W1SA 4JQRA 1LOFC 1N3PA 3ZKUA 1GFF2 4OI1A 5FY9A 3LA3A 4CDWA 1OBNA 4J6GA 5I93A 4P9IA 3MIBA 3UKNA 2OUJA 1UU6A 2ERFA 2QQJA 4XEZA 5H9SA 4FCAA 2ZGSA 4UFJA 5A3LA 1O6UA 2QNKA 5FWJA 1S2BA 1OHFA 3EYPA 5A70A 3R6SA 1AJOA 4JZRA 4PQQA 2RE9A 1IPSA 3P1IA 4LNVA 1AYN3 3PUIA 3CU7A 4Y4YA 4IE4A 1C4RA 5FK7A 2HWC1 4AOCA 5SV5A 5FIXA 1REFA 2WNUB 4JGZB 1IKQA 2VUDA 5A3OA 1ONAA 2V5DA 3FUQA 3K2OA 3KHBA 1KITA 3MZHA 3LAGA 4XIKA 4Y5Z0 1ODMA 3N7LA 2QBXA 5FZ4A 4XJWA 4S2HA 2W08A 1DZRA 1ULDA 2CL2A 2VXJA 2EXJA 1CPMA 3B94A 3GHNA 2BU9A 1PM4A 4TWTA 1RUH3 4ARXA 3V0BA 5FZLA 3POJA 3Q8CA 3R4DB 1OPOA 4ISQA 4LIVA 2VQUA 3VGIA 4PLNA 2K2SA 5BNOC 4DEVA 2ZGLA 1V0AA 3R05A 1C1FA 4IW3A 4B29A 4Y1YA 4XC9A 3BU7A 3P5BA 4YW3A 4CSWA 1XQNA 3B02A 4Z2AA 3KT4A 1JU3A 1PNFA 2TNFA 4OI4A 4BE3A 2ZX2A 1GNYA 1OA4A 1Q3EA 4FOVA 4JV4A 5J98B 3WDYA 4C90A 5EHDA 4DRRA 3O1SA 2JDUA 4LTAA 1F4AA 1W8ZA 4F8AA 1S0CA 3DUIA 5JPNB 1HB1A 4JTOA 1DGLA 5FWEA 3IIIA 3A0KA 1NE4A 4QQLA 4COVA 1Q8QA 2QVSB 4LOSA 1SLLA 4Y1ZA 1VIWB 1QJEA 2JDPA 1JOBA 2ZX0A 2GC0A 3VKNA 3LDBA 3AZXA 4I09A 5D8AC 4CDQC 4DB5A 2LS6A 1VAMA 1WCUA 3VDCA 2FDGA 2B7YA 2OIIA 2CYFA 4N7IA 1T6GC 3FFQA 1OF4A 2XLAA 3BUCA 5D8AA 3APBA 4Q26A 1W8TA 3OYWA 4IEZA 4XDOA 4IGQA 1O3QA 1GZWB 1QOOA 1CONA 2ATFA 3AP5A 4FPLA 3D5OA 4ZKTB 4YFZA 1NA1B 1LR5A 4YG3A 3T4VA 5FY4A 4MOAA 3RNSA 1URXA 2WSUA 5JR7B 2G4IA 5G04L 1VBB2 2HEVF 4ZY9A 3WINE 5ACA1 1I9RA 4W4ZA 2WNUC 2E7TA 4JGZC 3KD4A 3C3VA 2HBTA 3NNMA 3RS6A 3RRDA 3TEWA 2VTFA 4A3ZA 2A7AA 2VM9A 4ZU4A 1G8WA 1J3QA 3POYA 4HMZA 2GAUA 3DYPA 2AUYA 2XUMA 2WNUA 4JGZA 2A73B 4HPKB 3VD9A 2PYTA 5FLJA 1JZ7A 3I2HA 3OEAA 2R063 1UAIA 2EAAA 1HLCA 1CQ9A 1XE7A 4O9EA 4IV3A 2ILMA 4JVAA 1W6QB 1FNZA 2WS92 4I3GA 1DBNA 1D0GA 1R081 4Q2FA 1E5SA 2BNOA 3ILNA 1LHVA 3MGUA 3O12A 4AGVA 4BQ2A 3OD4A 1JXNA 1N3QA 4KBBA 2LW8A 4W6WA 3OPTA 3W59A 4AW7A 4XBQA 2GC1A 2VQ0A 1NQJA 2VZTA 4A7ZA 1RUOA 1W8NA 2DVDA 3VBFB 2NMOA 1PZ7A 2E9QA 1PMJX 3K4ZA 3S7EA 5FOBB 2XJTA 3PVBB 4NRMA 1GZ9A 3CDZB 2R072 3QLQA 2VH9A 1QEXA 3NJVA 4GMP3 3BVCA 1SHWB 3OGRA 2VVDA 2J22A 4OQ8A 4META 2VMGA 2CTVA 2C5DA 1IQDC 4EV0A 1IG3A 3THTA 3ZFFB 1FT9A 4NOTA 4OHVA 4KWJA 1A78A 2ZACA 2D97A 4FXKB 2BFUS 4CDXA 2Z2SB 2C9KA 1DYOA 3BN6A 1HB4A 3H3LA 4MGZE 3POWA 4AVVA 2Q8DA 3V0AB 3HT2A 4YZ3A 2WT2A 3T09A 4DY5A 2B45X 2VGDA 5C5TA 4LIUA 3SEPA 5A1AA 2VY0A 2XWBB 2RJLA 2Z79A 1NA1C 3JCIA 3QCWA 4Q0VA 4GH4A 3ZXLA 5FYSA 4IE5A 2TEPA 2WAAA 2Z69A 2D98A 4K3UA 4PLMA 3VHNA 3AXEA 2OT7A 2D6NA 4Q8LA 4NE9A 5I0DA 3MIGA 1IPJA 2CNAA 2PELA 3V65A 2VCCA 1NA1A 2VZPA 2Q0AA 3H50A 4LKSA 4IL7A 3BI3A 5DAVA 5DDJ2 1G9BA 4C0HA 2I74A 4PHZA 2VVEA 3GGLA 2Y0IA 2Y60A 3BOWA 3H7JA 5GZFA 3W58A 1ZBA3 1LULA 3GJBA 4MGQA 5FYCA 3W21A 5KXDA 4AI2A 1GV9A 3NKGA 4BQ1A 1H6YA 1QJU3 1OD5A 2XJSA 3NL1A 2ID4A 3I8TA 4QHZA 1UZZA 5F39A 4ASLA 2YFUA 3WT3A 4GB31 4HPKA 5EJ3A 3S30A 5C70A 2QZ3A 1ZRCA 1W3XA 4Z8BA 1PIV3 5ANNA 2GN7A 5JMCA 2RMU3 1N47A 1V9U3 4D94A 5J7MA 2TUNA 1JH5A 5B4XA 1WMFA 2DCZA 1XNDA 5LBCA 1W6QA 4R9DA 2IXJA 2WZR3 2WC2A 5LEJA 3BIWE 4YW6A 4RFT0 2VUCA 3M3QA 5LRSA 2JDHA 2DDUA 3VBFC 1RVF1 3VZJA 2PHUA 3RG0A 1BBT1 2LRPA 1Y3TA 5ABJB 1Z7S1 3ME2A 1WBLA 5IVVA 3T1MA 1KRIA 3MPPG 4QX7A 1NCRB 2LUWA 4BQWA 3VBFA 4MO3M 5IAXA 5JI9A 4PT6A 1KJRA 4CCJA 4M0HA 3S7IA 3URFA 3ZN6B 1AL23 1AR92 1R1ZA 1US2A 3U1XA 4RFRB 3ZFFC 4CU6A 5C9AC 3KF3A 3BTAA 1QQP3 3ZXGA 1VRH1 2WNVB 4OUEA 2EAKA 2ET7A 3BB6A 1PGSA 1YFWA 4BQXA 2V73A 5LA0A 1LENA 1LODA 3KZ4C 5F6LB 5FXZA 2PHWA 1DZTA 3LPFA 2ADDA 3QOPA 1JYVA 3VBUB 5BNQA 1XSRA 1YC61 4Q1RA 4A7YA 4BIFA 4ZZ8A 4ZXEA 4NAMA 1F8VA 4UFKA 2WR9A 3V0AA 4FPEA 1YO8A 4LMFA 3WF2A 1DGRA 4FOWA 1POV3 2NYYA 3MLLA 2QQUA 4JTNA 4PI2A 3GBFA 3X29B 2VCBA 3CJIC 2OS2A 5EPAA 5FXWA 5EIYB 1UPSA 1QXPA 3D0JA 3SXWA 2V4AA 1UY2A 2GC2A 3ZR6A 3VL8A 4IEVA 4AFMA 4HANA 2XKPA 3UJOA 1V6MA 4FFGA 1CJPA 2D6MA 2JXAA 2RR11 1WLCA 1ZRDA 4AHZA 2UYAA 1L7LA 4BLIA 4RGKA 2PHRA 2FDKA 4IEUA 2DBIA 4JDMA 3ZYIB 3K51A 4NPRA 3U37A 1RUC1 2ORXA 1CAXA 1XC6A 3GYDA 1LTEA 4N8MA 3TAYA 3SLIA 5FZBA 1G6NA 5L9RA 2FCTA 2CDOA 2PLV2 4FT8A 3OGGA 4BU2A 2DVFA 3HEIA 2WYSA 4UXAA 5CEHA 1OURA 2OXBA 2OX0A 4K7JA 4XJZA 5FXXA 4CE8A 3WW2A 4DXRA 5BNPB 2QUOA 2ZEZA 1UXXX 4UFHA 3RZGA 2ZPXA 3U78A 4M3CF 4R8HA 1AYN1 2JDMA 3FWEA 2B42B 2WFF1 1PGW1 1Z0HA 5ABJC 1UY3A 1F15A 1EPZA 4E4ZA 2FCUA 1YEWA 5C4WB 1NCRC 2HJIA 3DECA 4MX3A 2QZ2A 4RD7A 4HSJA 1HN0A 1JW6A 2J1EA 5L9BA 3ZFGC 4DNYA 4L11A 5ABJA 5A7OA 4XPVA 5JXIA 1W0NA 1QMJA 1NCRA 1RUI2 4DQAA 2A70A 2Y34A 1X33A 4G4FA 1DLCA 4TXWA 5EFUA 4Y20A 1DHKB 1RUH1 5F7UA 2GALA 3ZN6A 3A23A 3L2YA 4WVMB 5FYMA 4K21A 4UFLA 3VBUC 3ZXFA 1X36A 3MV11 2RS13 4A45A 3HOBA 2WNVA 1HW5A 4MGIE 5AC92 3EB7A 2R1BA 4LOTA 2R16A 4HETA 4DS0A 3AXDA 4Y1XA 5K9YA 5KXEA 1DYKA 1T6BX 3LFIA 5CKQA 3TBDA 5JOWA 1FMD3 1FAYA 5EJZB 1LU2A 1W6MB 4L9BA 4L97A 3VBUA 3VUOA 1NZIA 2VW2A 3MEPA 2XBO3 4GWJA 3WX5A 5C3RA 3BOPA 4PDWB 1RMU3 2HWB3 2XR4A 1BVVA 2A71A 2JDKA 3AFGA 4XXPA 2C9AA 4N7UA 3BODA 4E27A 1UZYA 2O14A 1TG7A 4PI0A 4UBGA 2QQMA 2P5BA 3AKRA 1CZSA 3N36A 1PVXA 4PBPA 4YWAA 5CFCB 5FPUA 3KQ4B 1LNSA 4FSJA 4Y24A 3AP4A 2VUAA 3M7AA 5K7PA 2DU0A 2H6CA 2VZ1A 3D3AA 4KU8A 5GZDA 1VPHA 4GKXA 2ZHNA 5GALA 1NT0A 4ONUA 3THPA 1GANA 4CUAA 5JMOA 1JHNA 4XYXA 2C24A 1CZVA 1G86A 2K0GA 5DAPA 3ZDSA 5BNPC 2JB8A 3KVAA 3FZ3A 4DXTA 1NYWA 3ZO0B 2JDNA 4JKMA 5BY5A 2TBVA 3FMGA 4LUKA 1VBA3 5LK5A 4DMIA 4KU7A 4Q0QA 5LY1A 3AYDA 1O5UA 5EWSA 3SKJE 2A3YA 4CCLA 4H3WA 3ZYGA 5C4WC 2A3WA 5AFBA 4AHYA 3OB8A 5IYYA 3K4AA 4I0BA 1H2KA 4MVTA 1VBC2 1NX9A 1CIYA 3NW4A 3RQ0A 1I5PA 5FPVA 2WO1A 5C4WA 2JE7A 2ZMNA 3ZSJA 4XMIA 4ES9A 1D7PM 5CG9A 2XDVA 1W6OB 2R061 2VULA 2G9FA 5EYYA 3O1TA 1SFYA 1NY71 2VZVA 1ZNPA 3AZWA 1WMEA 2W5FA 2XGXA 4F7ZA 4GULA 2WT1A 3OGVA 4LBLA 3RYRA 1O8PA 1TME2 2GNDA 3VDDB 2W2IA 3LIGA 1VB2A 2HYKA 1QF3A 5FDBA 4V2WA 2E26A 1RUG3 1S0DA 1X8EA 4WVMA 1JZ5A 3HN3A 3MW2A 1S0JA 4HKLA 3AP7A 1FXZA 5LASA 3SQOA 3RDIA 1DQ4A 1LHNA 3I4IA 3OD0A 1QIQA 2WABA 1RC6A 2P4EA 3E1F1 4K1ZA 4PDWC 4CDUB 1VBE1 2YB7A 3S6PA 5AVAA 2BV4A 5FR3A 2A1XA 3H3UA 5F5IA 1ENRA 3ZSMA 2VC9A 5F5AA 1AUYA 1W6MA 3ACHA 3GZTB 1XU2A 4ISRA 4QPGA 4GMP1 4RQPA 3SC7X 4B4QA 5FY5A 1PHMA 2Y64A 3SMHA 4PDWA 4Q0SA 1OPMA 3JUUA 5CFCC 3J8F2 2SLIA 2WWSA 1UX6A 2AH2A 3VL9A 3BGAA 4LHNA 3MPBA 1W0OA 3RZZA 4XTMA 2Q8OA 1RUJ2 5FZKA 4UAPA 4XILA 5A3WA 4CCMA 4YZ2A 5CFCA 2D93A 3ZR5A 3BIEA 1COV1 2K9ZA 1H2MA 2IVIB 1C57A 4R9BA 4XF9A 4DFSA 4COWA 1K45A 1E5HA 3JXSA 1OLRA 1MVQA 2XMLA 3CL1A 5FFOC 3WP5A 5IK8A 3ZFEB 1KFUL 4D6SA 2EXIA 1HB2A 1RHI2 2BOJA 2P3KA 2VOXA 4QKFA 2WN3A 4YW4A 1W6NB 1FNYA 4BIOA 1PMIA 3DCQA 1W99A 2HWE2 4W50A 4CTEA 4LKFA 4W65A 1LKNA 1O7FA 1HDKA 3B93A 3PVEA 1ZA4A 5CA6A 1ZBA1 3W5MA 4M3CB 1W28A 4QMAA 4QT6A 1YQ2A 5FP8A 4ATEA 1QJU1 4UW6A 4YZ4A 3OGJA 1BJQA 5CG8A 1HRV2 3T2QA 3PMSA 4QX3A 2VOVA 1WD3A 2RHPA 4M0NA 3WF1A 5J48A 2BOIA 4QKDA 3VDDC 2YY1A 1W6OA 2BGOA 2RMU1 5IVCA 1V9U1 4XF1A 3ZMOA 1IS3A 4CXWA 1TZOA 5FJKA 3NQHA 1W8OA 2WZR1 4QQHA 3WCRA 1RUD3 3ZIXA 3VDDA 2BPA2 3U11A 1BK1A 1XNCA 4LITA 5IVEA 3A22A 2CV6A 1YJLA 5A7PA 4CDUC 4TTGA 1N1YA 1BMV2 3UKVA 1EAH1 5A6YA 2XOMA 3SH4A 4OULA 2PXJA 3WEZA 4ZHNA 3M2MA 3TN92 4BOWA 2ZHKA 2W1QA 1H8TA 2D44A 4Q4Y1 3KCYA 2QQLA 2V72A 1FOD2 4LPLA 3Q8EA 4EYUA 3AYAA 2VMFA 1U5XA 1HQNA 3TWIA 2AGSA 2UU8A 4XVHA 1QQP1 4IE7A 5KHKA 2RS51 4XTPA 3PU3A 2B46X 2DFCA 2X5IB 4M4RA 1KXGA 1SEFA 2EIDA 3CO2A 4UF0B 4Y26A 3UESA 3K4DA 4CXYA 1H8VA 3WNPA 4WZCA 5DN2A 4LULA 4LO4B 4NO4A 1GU3A 1R1A3 5FJHA 2Q8EA 4IEOA 3VB9A 2NP0A 5KR7A 5GLZA 5DDJ3 2RDSA 3ZFEC 2FZ1A 4K40A 3U0ZA 3LB9A 1NOVA 1E5RA 2W1WA 1W2TA 1POV1 3C7HA 2AEYA 4LLOA 1Z78A 4MXWB 1ULGA 4QDQA 4OI0A 4JKKA 1WUVA 2Z4FA 4DOUA 4YM2A 4W6YA 3ZFEA 1GWKA 2RS33 3NJXA 4Q4V3 4XJAA 1UYXA 5H9QA 3IPVA 1ULPA 3ASIA 1DIWA 2DWRA 1W6NA 4YGBA 4E4SA 4XUPA 3ITQA 1L7QA 2I2SA 5E8AA 4LJHA 1S1AA 3ACFA 4LO5B 1YQCA 4LKDA 4LXLA 3O1UA 1LHUA 1GP6A 2FBEA 4QWNA 5FY7A 4BQYA 2BBVA 3HAGA 4WM7A 3I2KA 1EUTA 2FZ2A 4L0PA 2WDBA 5FZ0A 3HJRA 2KA3A 3IZOA 2AREA 4UFMA 4AAPA 2JDZA 4C1WA 1QJX2 2ZOEB 3WW1A 1DGWX 1XBFA 2W94A 2F4LA 5T55A 1AR73 1BEV2 3K48A 2VJXA 2QCSB 1YI7A 3NV2A 4Z92B 2B39A 5JXHA 1LGNA 5FPLA 3RZLA 2X09A 5H9RA 2ETEA 1MEC2 5FPZA 3FHQA 3ZPOA 3WV6A 1K42A 3AMNA 3KMHA 3WUDA 5LCWL 3JD72 3T4HB 5IHRA 1AR62 1KGYA 3WQ1A 2JICA 4CCKA 2GN3A 4ITCA 1VAKA 4HK8A 5LWBA 1LOBA 3LEKA 1WLTA 2E33A 1CX4A 1RTVA 3M3OA 3M3EA 3POIA 4CCNA 1PO12 1J1TA 2ZGTA 1OQ1A 2JIGA 5L73A 1DDLA 3DYOA 5CZKA 4CZSA 2RM23 5C71A 3AVRA 4LO7A 3RI8A 2NM1A 1RXFA 3HT1A 4YVSB 1T2XA 1PK6B 3UT0A 3NAPB 5A3NA 1CAWB 1EV13 2X5IC 5D2AA 4FTEA 1HJFA 1OD3A 5DPNA 1OLMA 1UYZA 5JWPA 2WL1A 4A7KA 3JZVA 1G9CA 3HIFA 3KF5A 5AVPA 2XUEA 2PHLA 1W3VA 2QQNA 3ON7A 2RS11 2W1UA 3LKJA 2MEV3 4ORFA 5IAVA 5C3OA 1XOYA 1C8M2 4NHLA 5FOJB 4KWLA 2J1TA 3M3CA 4P00B 4XXAA 4EN7B 1GNZA 2UYBA 1FMD1 4CRQA 1N1SA 5HXMA 4IGPA 3SCFA 2ZX3A 4CDQB 1BYHA 2DUOA 4B7EA 4GZ9A 4R52A 1HRI3 4XOGA 1FPN2 3P6BA 3TYJA 1J84A 1RMU1 4GJZA 1SLTA 1S2EA 1WGPA 2WIIB 4OCTA 4LO6B 2W3JA 4LHSA 3OGSA 4NRQA 5C8CB 4JQTA 2E7QA 2PLV3 4MXWA 3MHZA 5L7OB 4EZHA 5IK5A 2VNOA 1LOFA 3MIHA 1B09A 2ZMLA 5DZGA 5FYYA 4XF4A 1W9WA 4DPNA 1O4YA 2RJ2A 1RUF2 2X53S 2QQIA 1ZX5A 4ZU7A 4QGNA 4I02A 4FPFA 4FQZA 4EWAA 1MQTB 3MF6A 4B1LA 5C5UA 3GJAA 2G9ZA 5J1XA 2FDFA 1LEDA 3N9QA 3OUIA 5J96B 3WNOA 1O8SA 3WY6A 1UU4A 3LA2A 5E6HA 3RVHA 5KHIA 2UY8A 1AR83 2ENRA 2DURA 2DV9A 3M8LA 1OVPA 1VALA 2BNMA 1JZ4A 5E16A 1OQEA 5I0SA 4HSLA 2GC3A 2VPVA 4J25A 1WW6A 1VBA1 1KEXA 1UYYA 4NWWA 1O3TA 2HWC2 1J1LA 4K6BA 1EUUA 1GYKA 4AWDA 4EQVA 2ZZJA 3AJYA 4NHKA 1MS1A 4P9GA 4GD4A 4OHWA 3UJQA 4A2UA 3ROUA 4FOYA 1B35B 4QU1A 4YGDA 1GSLA 4YGCA 2W0XA 4TYSA 3UV9A 2ZGMA 2FDHA 1ST8A 4FP2A 2IZWA 4GXLA 1U5YA 1XYNA 4UFIA 5C6CA 1C5HA 2QDNA 4YVSC 1MZEA 3FLTA 1PK6C 1RIRA 1QOSA 1XYPA 3LGRA 3NAPC 2HWD1 2ZA9A 3KV9A 1SLBA 4LQRA 4OZOA 5BNOA 1BXHA 4H7LA 2YYOA 4EN6B 1MS9A 3N9MA 3VBHB 5FQ0B 2J1RA 5FUNA 1XNKA 2VOWA 1IKPA 3KCCA 3MIDA 1NXMA 4YVSA 5CADA 1PK6A 4CCOA 1PO23 3NAPA 3ZXAC 1X9PA 1RINA 2WA4A 1CAWA 4BQ4A 1SDDB 1ZZ9A 5GZCA 4RS5B 2P6HA 1REDA 1RUG1 2VAUA 2VL4A 2XL7A 5DUVA 5LA2A 2OKXA 4BZ4A 2ZMKA 2EALA 5FKBA 5FZIA 1HXS1 2UY9A 3GBGA 1RUE3 2ZEXA 3C2UA 4NPLA 5FY0A 2XG3A 4QPIB 3PU8A 3TRSB 2Y6GA 2YHJA 4TLFA 3AYCA 4CDQA 4CCDA 3MUZ1 5C8CC 5L7OC 3HMYA 3NNLA 3WCSA 3LPGA 1J59A 1UMIA 2NPIA 1S0BA 3AZVA 3UK9A 3V64A 4JDNA 4NHXA 3WP4A 1GBGA 3ATGA 4V1PA 3WNKA 3ZYBA 3LEMA 4EN0A 5A7NA 4OHYA 1UY4A 3HN1A 3VBRB 2A6YA 5C8CA 5L7OA 1I3HA 4AI0A 4XQDA 1MQTC 4FPKA 1WWYA 3JBG1 1ZZBA 5CB7A 1N1VA 4XE9A 2CAVA 1TMF1 3ETQA 3ECQA 1ZBE1 3KCXA 1APNA 3NV4A 3J26N 1H1IA 5T5JA 3O5SA 1MQTA 2DVBA 3RJ2X 1HV0A 4CXXA 3Q8BA 4YGEA 5DUUA 3U4XA 4GKYA 3WDWA 1GZTA 3MUY1 3Q8AA 2NMNA 4Q29A 3S57A 1HJGA 1LJ7A 1DQ5A 3H8OA 1W9SA 1VP6A 3GF6A 1HB3A 2R043 5ACA2 4XETA 2KD7A 4M3CE 2DBNA 4HOOA 4Q1PA 5FY1A 1H9PA 4Z2WA 2JKXA 4WVZA 2CDPA 5F1RA 4RSUA 1TME3 1B35C 2BERA 3KSCA 2ZHLA 4L8QA 4YW1A 1V6KA 5EZWA 4K8FA 2J1VA 4QDSA 1JZ3A 4LBKA 4P02B 5BPXA 4FO9A 1SG3A 4P9LA 4CEYC 5A32B 2A6XA 3UKTA 3O0XA 4AFDA 1B35A 3KHCA 1OVSA 4BISA 4CUGA 4PBOA 3VBHC 4DIQA 4FTBA 4EWDA 2V09A 1R082 4CUCA 4NIAA 3POBA 4CEYA 5CFDB 2IVJA 1AYM3 3DEMA 4AFAA 5F5CA 5FO7B 3FUOA 4IEWA 4RS5C 4COYA 3VBHA 2YBSA 5FQ0A 1EYBA 1RUD1 1BQPA 5HV0A 1W03A 3UETA 4XACA 1H30A 3HR9A 3J8F3 3UYJA 2D6OX 5C9AB 5C3SA 1LAJA 4H55A 4RS5A 4XDQA 1KS5A 3O1MA 4JRLA 3ZOIA 4QPIC 2VMHA 1DGWA 3PVOA 1OLME 3MO4A 4QQPA 3RZJA 3D6EA 3PJQA 1UCXA 4HN0A 3ZKYA 1OH4A 1UZWA 4AQTA 4GA9A 1ENQA 4QX1A 5EXOA 3UGGA 4BPZA 1YCIA 5CYYA 4LBMA 4RA0A 3VBRC 2EVXA 2P37A 1LEMA 4D69A 5FZHA 3B3QE 3WG4A 3DL3A 1GZWA 1ZRRA 1OF3A 4RN5A 3CJIB 5FP4A 1RL3A 1JYXA 3VBRA 3AKSA 2HWE3 1LESA 5LW9A 1R1A1 2YGMA 3IKWA 4JKLA 2LROA 4OUMA 3SH3A 2Q5TA 4ZXKA 1H0BA 3F2ZA 1MS8A 4Q4X1 1AXZA 3RZHA 4DUWA 2HWF3 2C6SA 3HNMA 4MV2A 2ZX4A 3ZXJA 2IXIA 1I5ZA 3M1HA 1GUIA 1U5ZA 2ZGOA 4BA6A 4D3WA 5LA1A 4GMP0 3ZIWA 1HRV3 3KS7A 2RS31 4Q4V1 3WXPA 4P5HA 2PHXA 2E6VA 2JG9B 3KV5A 5FP3A 2HYXA 2YU1A 3AJZA 4HT1T 4BJ0A 3E5UA 4V2VA 1BCXA 3WSOA 3O0WA 3MLKA 1GWMA 5HCAA 2KXLA 4Q4W1 5EP9A 2OZ6A 2ET1A 2ZGQA 2RDQA 1W2AX 2EXHA 3N9LA 3BTXA 3KV4A 5JPMB 1ZRFA 4H7MA 1KDKA 1NCQB 2ZGRA 1C8NA 1SZBA 4DY3A 4GB32 4XJ9A 4AHXA 2VBDA 1D0HA 3RWKX 5CFDC 5A32A 4BK4A 2Y8KA 1OXCA 1ZZCA 5IVBA 2YV8A 3EQEA 1QNYA 1YIPA 1AR71 3ZFGB 1QDCA 3ZN5A 1MR5A 3K3NA 1FOD3 3WZ1A
chains in the Genus database with same CATH topology
5CFDA 1Q8SA 2WT0A 3N4MA 1LB2A 1CESA 1GKBA 1SLCA 1XYOA 5A3MA 1RVF2 4XIOA 2ZGPA 1BBT2 1Z7S2 4Y1VA 3ZFFA 4AQSA 5I8TA 5C9AA 3JU9A 1F5JA 1U12A 3MIFA 3B9CA 1QH7A 2FMYA 2RM21 4LO8A 4TSVA 4I0WB 1ULFA 2ZZQA 3PMEA 2O8OA 3VZNA 2WNEA 1EV11 1VRH2 3SCGA 4BLJA 2WQZC 5FO8B 2QQPA 1N3OA 4AGGA 1S0FA 2MEV1 3QACA 1OFNA 4UW5A 2V5YA 3CJIA 1IS4A 1DQ2A 3JQXA 4Q8KA 4LBNA 3WHTA 1NQDA 4LBQB 4MLOA 3FX3A 5DZEA 1W0PA 1HRI1 1ZZ6A 3IN9A 3G7DA 5BNNB 4YSFA 3PHMA 2DU1A 4KBZA 1PNGA 5GM0A 1AVBA 5KWRA 1VBD3 1J3RA 2JG9C 2PLV1 1QJX3 3EJKA 4EN9B 1FV3A 3KLSA 1CIWA 3MIEA 5GLWA 2XLFA 1X50A 2RR12 3N7KA 2BYVE 1CGPA 3TOJA 1YXWA 1BEV3 2JG9A 1F9KA 2IFWA 1QJY3 4KL1A 5JZGB 3NSTA 4MZUA 1NCQC 1RUC2 1MEC3 5CNAA 3IDEA 3D0SA 1AR63 3HQXA 4GIQA 3ST7A 1F2NA 1QU0A 2B8MA 1AR81 4OZXA 3DKWA 3S0MA 1WLDA 3PJYA 1POV0 1NCQA 3LCPA 4Z1VA 5JIUA 1IS5A 3O0VA 3D82A 2XJUA 4L2NA 4Y1UA 1AYN2 2WFF2 5LRRA 2P17A 3ZFGA 1UW8A 3DF0A 4KQ7A 2D43A 4E4DX 1VJ2A 3R4UA 3USUB 4BHPA 4MH0E 4NWVA 3RMYA 3KGZA 1LECA 1ENXA 1GR3A 3N7JA 1C8M3 3NNFA 2W52A 1MZFA 3GZAA 4X8NA 3ZXDA 2X8KA 3A4UA 4WBBA 1BVP1 1ASJ3 5T5OA 1RUH2 4RHV2 2DVGA 2XL9A 3MYXA 4YARA 4LT5A 1FPN3 3Q9OA 3ZSEA 2XJRA 1PO21 5H9PA 3VZLA 3ZYPA 1CAUB 3AMQA 2BWAA 4ATFA 1Q8VA 2ZABA 4FBFA 3LOBA 1SLIA 1O3RA 5BNNC 1RUE1 1UIJA 4YZ1A 5A33B 5IATA 5E88A 5BUVA 1V6IA 1Q5OA 1QWRA 2W68A 1PM7A 4LBQA 3HD8B 4BWOA 4O9GA 2PHTA 4R9AA 3VKMA 5DAQA 4BM8A 5BNNA 2Q4SA 2MHFA 4UWDA 1ZZ8A 4Q0PA 2EXKA 5JZGC 5DAXA 1SBFA 3OBRA 5BNPA 2PAEA 5LK7B 5LATA 3DV8A 4OI2A 4XQWA 1I1EA 3QH6A 2F6BA 1Q8OA 2HWC3 3OJBA 2R0HA 1Q43A 1FV2A 5JZGA 5F6KA 4FAGA 4UBHA 4LHLA 3VBSB 1YFXA 3VKLA 1IQAA 5IK4A 3MFAA 5J37A 2R041 1XNBA 1NG0A 3LWCA 2Y38A 1F5FA 4CYDA 1O4TA 4E2QA 1TME1 4IERA 1LU1A 2ZGUA 2JEMA 4YNIA 1CN1A 4SBVA 3USUA 3RYPA 4K20A 5D1IA 2JJ6A 4C91A 1AJKA 1LOGA 2R062 1NY72 2GNMA 2NN8A 4AVCA 4OVEA 1N1TA 3B7MA 1D4VB 2DFBA 5AFEA 3NVCA 4XW3A 3FC0A 5JOYA 1AYM1 2PQQA 1MVEA 5HCBA 1PVC2 4CP0A 1WW5A 4M01A 1OA3A 4S2FA 1O4ZA 3VZKA 4CEWB 4QPYA 2MNGA 1MS4A 4XQ4A 1CAUA 1QJZA 4FPGA 1VBE2 1VBB3 1NLSA 1ULEA 5DAWA 1Q56A 1OA2A 4AGRA 2IFRA 1NLRA 4FP3A 1H4HA 1SBDA 1LOCA 3DKQA 1D4M2 3OCPA 4XFGA 4BYYA 2DYCA 5JOZA 1R092 4XFIA 2C0ZA 5KXCA 3ES1A 4QM9A 1JBCA 5ACA3 1K5MB 2R6QA 1AXKA 4S2GA 1ZRFA 4B3NA 2WS93 4LE3A 1COV2 2XJQA 2HWE1 1VR3A 3T1LA 4YM0A 1MACA 5CBLA 1EPWA 1V6OA 3H1MA 3UL2A 3VBSC 2OPWA 4ES8A 2RG4A 2AR6A 2DTWA 1EP0A 2WINB 1AX1A 2YXSA 4Q27A 5FLIA 2HWF1 4X8PA 4AVSA 3AFKA 1DQ6A 2WFPA 3LZZA 3VBSA 2D3SA 1WBFA 4XF3A 3W9AA 4XHBA 1PIV1 5GLTA 4YYOA 2UWBA 4COUA 2R073 4JC1A 3L2HA 1X82A 1J3PA 1J58A 1S0GA 2OZJA 2ZKLA 3I2DA 4PLOA 5BV6A 1QJU2 2BUKA 2PAKA 4GWNA 1GICA 4P9YA 4C1XA 1XRUA 3IDBB 4LA3A 4AF9A 2RMU2 5GZEA 1V9U2 2ZBJA 4CDUA 5LBEA 1AL21 3OBTA 3CNAA 4HN1A 1DFQA 4LR4A 4CEWC 5K0UB 3JQWA 4WV8A 1YWKA 1EAH2 3B69A 3KGLA 4MHRA 4CEWA 1YFYA 2BGCA 2BWCA 2VNGA 3RSJA 5I8SA 4AFBA 4Q4Y2 3HBZA 2IXHA 3H7YA 1KQRA 3AMPA 4XF0A 2BTVC 1QH6A 4GWMA 1QQP2 1PGL1 2RS52 2QJVA 3E97A 2ZGNA 3AM2A 4XAAA 1K5MC 3MICA 2GSYA 2H6BA 1O5LA 2D7FA 5J09A 3MDPA 2ZX1A 2YC0A 3AKQA 5IT6A 3ZPYA 3NJZA 1UMZA 1W2UA 3H1WA 1IOAA 5LB6A 1K5MA 3WDTA 3BCWA 1CJDA 4X6QB 3J4UH 1S55A 2R30A 2DCTA 3N7MA 1Y7BA 2BNNA 4CDWB 4I01A 3HQRA 3FJSA 4M3CA 5T52A 3IMNA 2PTMA 2H0BA 2FHRA 5IUQA 1VBD1 3WP3A 4GB33 1QJX1 2H0VA 1SCRA 4HL0A 1G7YA 1MS3A 1V70A 1LHOA 2ARXA 4IETA 1W6PB 3EO6A 1WA4A 4QQ2A 1PZ8A 3B9IA 4XBNA 4P9XA 1AR93 1QJY1 2JG8B 2CGOA 4FPYA 1QHDA 4BH9A 4FAHA 3HQUA 3E6DA 1FX5A 4XFCA 4HFSA 3SCHA 4YLZA 2DUQA 3W20A 3E5QA 1ZREA 2D5FA 1AX0A 5K0UC 3OUHA 1RITA 2OYZA 1M06G 1IS6A 1JUHA 1WLWA 5BXXA 3V0BB 1GQHA 1OOPB 3VKFC 2OVUA 5DUXA 1DQ0A 5DG2A 1ULCA 3EXUA 5K0UA 3EMRA 4LE4A 5LBFA 4NMIA 4I30A 3INAA 1UF2C 4DINB 5LBBA 2X5IA 1LRHA 5FO9B 1WD4A 2N7GA 2WLQA 3ALQA 2EA7A 1OKQA 1G9FA 2ZJCA 1A8DA 2XPJA 2XBO1 2G19A 1ASJ1 1VB4A 2VU9A 2HWB1 3H9AA 5FLHA 4B8EA 5JI7A 2KM2A 4DXZA 3DN7A 1DLLA 5GJ6A 3D4KA 1IHMA 3SISA 2ZGKA 3KT1A 1FMD2 3RMXA 2VNRA 2RR13 4JCKA 4CDWC 1FATA 2IXLA 3PL0A 1A6CA 3VKOA 5C33A 1RMU2 1JN2P 1OFSA 1RUC3 4W6XA 5ERLA 1ZYBA 2GH2A 1QKQA 5E89A 4D7TA 5C8WA 4FPCA 1VLNA 5DUWA 2PHDA 4MGKE 1WCKA 4AFCA 1CR7A 1OMIA 2D40A 2JG8C 2QE3A 4EWEA 1RUI3 3HWJA 1W6PA 2WFF3 2P3IA 2YMZA 3USSA 2JG8A 3TNPB 2D3RA 3ZXKA 4HK9A 3DPRB 2ZCWA 2DCYA 5L9VA 1FYUA 4C0BA 5AC93 2E51A 3VLBB 1V6NA 3T2TA 3H1YA 1HV1A 4AQ2A 3NV3A 1OOPC 2GU9A 1C28A 4IV3B 3SHRA 4NAOA 2YPJA 3ZSKA 1VBA2 3NWKA 5I91A 3AB0A 2AZ5A 4RHV3 3ACLA 1OOPA 2OPKA 4GQ7A 4IEYA 4XBLA 2P34A 2QKDA 5HV4A 2JENA 2R32A 2A5ZA 4AEDB 1TE1B 1WCDJ 1Q8PA 2HWD2 4EROA 2B5HA 2A6ZA 2WKKA 3GHMA 4ASMB 1HX6A 4HVQA 1YNAA 4CP1A 5JOXA 4J1XA 1DU3D 2CGNA 1WMDA 4AVBA 1YJKA 2BVVA 1L3JA 2AYHA 4LBQD 5JCTA 4CDXB 1RUG2 1UL9A 2ES3A 2FQPA 4LA2A 4JAAA 3WR0A 4P14A 4IEPA 5LA9A 3O14A 1AHSA 2W39A 1JTZX 3IIAA 1HXS2 1VBB1 4YW5A 1QXJA 4PIYA 1SACA 1SQ4A 4I3PA 3MFCA 1Y9QA 2E63A 4AVAA 4Y5TA 1VBC3 1YRZA 4GH4B 2BW8A 3PLQA 1TQ5A 3MI8A 4N90A 3WDYA 5B2GB 3VZMA 4Z07A 2Y0OA 2XKOA 3IWZA 3IDCB 4KG0A 2C1FA 3JBG2 5T54A 4IEXA 1SBEA 1TMF2 1ZZ7A 1ZBE2 2WS91 1RUNA 1C1LA 4PCRA 2D5HA 3H8UA 3DPRC 2R0FA 4YM1A 4RGGA 1H2LA 1WCSA 3WOGA 2VUJA 2A3XA 2FMDA 2YZ4A 2VXRA 4JDOA 4IV3C 2B9UA 2ZHMA 3WVJA 3ZX7A 3DPRA 3VHPA 3OUJA 1H4GA 1YYNA 1XE8A 2R49A 3ZMNA 3WDUA 2XJVA 2JE9A 4NN0A 3E5XA 2IXCA 1GLHA 4A3XA 3LA7A 1WW4A 2R071 3VBOB 2R1DA 4KG8A 4LLFA 1UPIA 2VG9A 5HCFA 2YROA 1PVC3 3AP9A 4MHUA 2A6WA 2UWAA 3ILFA 3GALA 4E9KA 4AEDC 4AHWA 1G9AA 1OI6A 4XABA 1GZCA 4M00A 1RUJ3 2HEWF 1VBE3 3ELNA 4AEDA 2UWCA 3WLUA 2XJPA 4GALA 3WDVA 1O91A 2A6VA 1ENSA 4CDXC 2XVGA 3QBQA 4QPIA 3N3HA 1RUD2 2PN5A 4MUVA 1D4M3 4AYUA 1RHI3 2XVLA 3CJXA 4YVWB 1R093 3N35A 3J9SA 5DXDA 4U2AA 4PIXA 3LSDA 4EN8B 1KS4A 1GQGA 3M3IA 3P3PA 1YHFA 1COV3 2RJKA 5DDJ1 4AEKA 4NVPA 4GH4C 4RR3B 4CP2A 2FCVA 4P9JA 4OLLA 4B4RA 2Q1ZB 5HI0A 4IESA 4XZPA 4HLTA 4OFGA 5M0TA 3LOIA 4ZPIA 2VOKA 3PVNA 3AKPA 3CF6E 5GZGA 2DF7A 1JYCA 2Z5WA 4URTA 1R1A2 1TNRA 4WVVA 4B4PA 2PHFA 4N53B 2RDNA 1CAXB 3WW4A 4Q4X2 2I45A 2JKBA 1A8MA 5FMOS 5I0TA 2Y33A 2RS32 4Q4V2 2D6LX 2YDEA 3TN93 1NZCA 4H14A 3VBOC 3AZYA 2G1MA 2LM3A 4LBJA 5E1RA 1SLAA 3MW4A 4E2SA 2PAMA 4X6RB 2G9GA 3OPZA 4Q4W2 4HVOA 1TNFA 1AR91 1C3HA 1AX2A 3CLPA 4YG6A 3VBOA 5T3NA 4XCBA 5FREA 4BMEA 5I0UA 4NHMA 1BZWA 2VW0A 1DZQA 1EAH3 4QX5A 1H1MA 2DCJA 4N9IA 1AR72 4Q4Y3 1KDMA 4Y20B 4EJRA 4IEQA 4ZONA 4AI3A 3GZEA 4YVWC 3KB5A 3VZOA 2RS53 2Q30A 2NLRA 5DZFA 3OF1A 5J3UA 4AI8A 1SMVA 2EIGA 3GNEA 4QHBA 4HZFA 4XHXA 1G9DA 2Z42A 3DGTA 4S2DA 4RR3C 4YVWA 4ZU5A 1LGCA 1MS0A 2RM22 2WLPA 1O3SA 4LEJA 1GNHA 2WSVA 3RJRA 4XJ8A 2AENA 1EV12 2I07B 4RR3A 3FE5A 2CY6A 2BFUL 1H9WA 4XFAA 5JSRA 4Q0UA 4AEJA 2MEV2 1HKDA 5SV8A 3GZUC 4E2GA 3PTYA 1LHWA 2IWGB 5T50A 2JECA 4N53C 1LCLA 2D3PA 5CU1A 3WQ7A 3JB8A 5EV7A 1UKGA 4B7KA 3MLJA 4AK3A 1RJ8A 2ZAAA 5KC5A 5T5LA 1HRI2 1RB8G 4Z82A 1D2SA 4DRVA 4N53A 3R0RA 3WG1A 3JD73 4JRAA 3BALA 3L9JT 3I7DA 3WW3A 1PO13 3RYKA 5J36A 4N43B 1UN1A 1YIFA 4YG0A 1RUI1 2P2KA 1PGW2 1VAVA 3WDXA 4LBOA 4FXGB 5FMOL 3WD5A 1WW7A 3NNJA 4I0AA 2GZWA 3AX4A 2E7AA 5I0RA 1AR82 3EHKA 1QXRA 2HBUA 2XLGA 1I6XA 1IGOA 5AC91 1JYIA 2X29A 3ZXEA 3LSEA 3QD6A 2YGLA 1QY4A 2GDFA 3I59B 1ND3B 2JD4A 4P9WA 5A3UA 2O1QA 2WNVC 4AXOA 4RHV1 5EQUA 2GNTA 1KD7A 4UW4A 2BVBA 5CVRA 1NXD1 1X8MA 3P3NA 2YUEA 3VN4A 1HIXA 3KQRA 1S0IA 3OBZA 2PA7A 3MF9A 1AXYA 1FI2A 1MZ6A 1RUF3 2Y26A 5GLUA 1ZM1A 3ILRA 4QQOA 5KHJA 3KT7A 4FQ4A 2DUPA 3FBYA 3WP6A 1HQLA 4QPGB 4RQPB 4OHZA 4NHYA 4NR1A 4IV1B 1PZ9A 2CWMA 5KC6A 5KXBA 2WA3A 5FAXA 1PO22 5HXVA 3OY8B 2Q1MA 4XCAA 5JAXA 3VV1A 3TNQA 4PJYA 4YFWA 3SNMA 2IC1A 4F3JA 1H1AA 2ARBA 2LALA 2OA2A 2ZTNA 2GMEA 4SLIA 5L19A 1OSGA 1RUE2 1NE6A 2OW4A 2XHKA 3H0OA 3O7OA 1QOTA 2BQPA 4WZFA 1IZ3A 3TB0A 1VBC1 3AP6A 1AZDA 2VECA 1SFNA 4N43C 5JIAA 2O0OA 1CAVB 1F31A 4QD2A 4KGGA 1YUDA 3AKTA 3AMHA 3WNXA 2NZ9A 1SDWA 3B5LB 5FCCA 2GNBA 2ZAHA 3ES4A 4KNCA 4N43A 1AL0G 2SBAA 2XWJB 4K1YA 2GMMA 5CAZA 3FLRA 2GMPA 1KJLA 4BCUA 4QGLA 1YI9A 3SH5A 3E6CC 5GLVA 2ZS6B 3FFZA 1ND3C 4I2OA 3WG2A 4LUMA 5JLVA 2R042 2HWD3 1HQWA 3JB4C 3VHOA 1UKRA 5F9TA 3I59A 1ND3A 4XFHA 4AVTA 2XB6C 1PVC1 1YFUA 5FBZA 2HEYF 1UD1A 3NO8A 5FTTC 3J8F1 2CGPA 3A0NA 3M4FA 4MSVA 2JX9A 3R4SA 4J1WA 3WUCA 1RUJ1 4AG4A 4QPGC 1H8TB 3B00A 4RQPC 3V56A 4YW2A 4IV1C 5GKAC 4WVWA 1HXS3 3ZYRA 4Y5SA 4QM8A 1AYM2 5LEKA 3AYEA 3ZSLA 2D6PA 2RDRA 4FPOB 5A33A 2LTNA 3H3ZA 4IV1A 1AF9A 3SITA 1U5IA 3QH7A 1D4M1 2NQYA 1RHI1 3OY8A 1U0AA 1R091 3ZN4A 2WJSA 3JBG3 1LGBA 1YLLA 2WQ4A 4D7SA 1TMF3 3FLPA 2QDRA 1DQ1A 1ZBE3 4L99A 2A75A 4FVVA 3B01A 2PFWA 4COZA 4QGMA 2OUHA 3IPVB 1HRV1 5JSPA 5HBAA 4XJUA 1CAVA 1V6JA 4LHKA 1MZ5A 3GBWA 2MPFA 3NV1A 1R083 4G3YC 1ZBA2 3PNAA 3U10A 4D7YA 5FRAA 1ALYA 2D6KA 4WM7B 1V00A 2DTYA 3AMMA 4Q5OA 1ND2B 2HWF2 4XMAA 1DYPA 3NKTA 5T5PA 1LOAA 1QDOA 1BMV1 3POSA 1IPKA 1PIV2 4QXKA 1LOEA 4RGAA 3CEWA 3I54A 1V6LA 3TN91 4IXLA 4OHXA 5K8SA 3BPZA 1FOD1 2WZR2 3KM5A 4Y22B 4R9CA 3RPQA 5F5QA 1H8TC 3M70A 1D2QA 2HKXA 1CPNA 1JUIA 1JOJA 3OTFA 4N9HA 3D8CA 4MXVA 4JGYB 2VMIA 2JIJA 2IXKA 4PQ9A 3AZZA 2XVKA 1AL22 4IQPA 2UURA 1KFXL 4F83A 1S0EA 4FPHA 4FTSA 1CD3G 4AQ6A 4WM8B 1DGRN 1EY2A 4OUSA 5DG1A 1ZVFA 4YM3A 2VVFA 4YZ5A 4PF5A 3ZYJB 2XH6A 1H2NA 5JDBA 3WG3A 5EYXA 1E57A 2VQAA 3WQ0A 4AI1A 1RJ7A 4Q4X3 1PGL2 5CIRA 1M4WA 1W39A 4TZDA 4MGYE 5I8YA 1XU1A 4PIZA 1UIKA 3FBMA 4WM7C 2CAUA 1BEV1 3AK0A 1ND2C 4RL7A 2WZPP 4DZGA 4KH9A 2O8QA 2CWSA 1S2KA 3EBRA 4FPJA 4Q4W3 1XXNA 4UW3A 1MEC1 1RVF3 4XFBA 5KHGA 3JD71 4YRDA 1AR61 1BBT3 1ND2A 3VHRA 4BMBA 1VBD2 1Z7S3 1DG6A 3G6JB 1REEA 4XFFA 4AE2A 2DCKA 1A3KA 1TEIA 1PO11 3RI9A 3RWNA 4FOQA 4HKOA 3ENRA 4L92A 4HBNA 4R4XA 2EF6A 1QJY2 1MS5A 4MYEA 1UU5A 3IM0A 4AEMA 2DVAA 4K9SA 1Y43B 1VRH3 5TSWA 5KHHA 1BKZA 5BYNA 4Y22A 4R4ZA 4JGYC 4G9SB 2BEOA 1QNWA 4QU2A 1C8M1 5BNOB 4INDA 4KWKA 5FPXA 3WHUA 4HVRA 2E53A 4HKWA 3IBMA 4JGYA 3ZVXA 1X7NA 2F4PA 3MW3A 3E6BA 5L36A 1FPN1 2P3JA 4WM8C 1DF0A 1OLQA 2GH8A 3IT8A 2RS12 2QFEA 1C5IA 2ZKNA 5KBFA 4WM8A 1CVNA 3FHIB 1RUF1 3U07A 4KGQA 1SCSA 1RGSA 2VW1A 1QGLA 2XBO2 5JSOA 5D8AB 5IK7A 1ASJ2 3OYWB 2HWB2 5JVVA 4U36A 1OQDA 4JQRA 1LOFC 1N3PA 1GFF2 4OI1A 3LA3A 4CDWA 4J6GA 5I93A 4P9IA 3MIBA 3UKNA 2OUJA 1UU6A 2ERFA 4XEZA 5H9SA 4FCAA 2ZGSA 5A3LA 2QNKA 1S2BA 1OHFA 3R6SA 1AJOA 4JZRA 2RE9A 4LNVA 1AYN3 3CU7A 4Y4YA 1C4RA 2HWC1 5SV5A 1REFA 2WNUB 4JGZB 1IKQA 1ONAA 3FUQA 3MZHA 1KITA 3LAGA 4XIKA 4Y5Z0 3N7LA 4XJWA 4S2HA 2W08A 1DZRA 1ULDA 2CL2A 2EXJA 1CPMA 3B94A 3GHNA 4TWTA 1RUH3 3V0BA 3R4DB 1OPOA 4ISQA 3VGIA 4PLNA 2K2SA 5BNOC 2ZGLA 3R05A 1C1FA 4IW3A 4B29A 4Y1YA 4XC9A 3BU7A 4YW3A 1XQNA 3B02A 3KT4A 2TNFA 1PNFA 4OI4A 4BE3A 2ZX2A 1OA4A 1Q3EA 4FOVA 4JV4A 5J98B 4DRRA 4LTAA 4F8AA 1S0CA 3DUIA 5JPNB 4JTOA 1DGLA 3A0KA 1NE4A 4QQLA 4COVA 1Q8QA 2QVSB 4Y1ZA 1SLLA 1VIWB 2ZX0A 2GC0A 3VKNA 3AZXA 4I09A 5D8AC 4CDQC 4DB5A 1VAMA 2B7YA 2OIIA 2CYFA 4N7IA 1T6GC 3FFQA 2XLAA 5D8AA 3APBA 4Q26A 3OYWA 4IEZA 1O3QA 1GZWB 1QOOA 1CONA 2ATFA 3AP5A 4FPLA 3D5OA 4ZKTB 4YFZA 1NA1B 1LR5A 4YG3A 3RNSA 1URXA 2WSUA 5JR7B 2G4IA 1VBB2 2HEVF 3WINE 5ACA1 1I9RA 2WNUC 2E7TA 4JGZC 3KD4A 3C3VA 2HBTA 3NNMA 3RS6A 3RRDA 2A7AA 4ZU4A 1G8WA 1J3QA 3POYA 4HMZA 2GAUA 2AUYA 2XUMA 2WNUA 4JGZA 2A73B 4HPKB 2PYTA 5FLJA 2R063 1UAIA 2EAAA 1HLCA 1CQ9A 1XE7A 4O9EA 4IV3A 2ILMA 4JVAA 1W6QB 1FNZA 2WS92 4I3GA 1DBNA 1D0GA 1R081 4Q2FA 2BNOA 3ILNA 1LHVA 3MGUA 3O12A 4AGVA 3OD4A 1JXNA 1N3QA 4KBBA 4W6WA 3W59A 4AW7A 4XBQA 2GC1A 2VQ0A 1NQJA 4A7ZA 1RUOA 3VBFB 2DVDA 2NMOA 1PZ7A 2E9QA 3S7EA 5FOBB 2XJTA 3PVBB 1GZ9A 2R072 3QLQA 2VH9A 4GMP3 3BVCA 2VVDA 4META 2VMGA 2CTVA 2C5DA 4EV0A 3THTA 3ZFFB 1FT9A 4NOTA 4OHVA 4KWJA 1A78A 2ZACA 2D97A 4FXKB 2BFUS 4CDXA 2Z2SB 4MGZE 3POWA 4AVVA 3V0AB 3HT2A 4YZ3A 2WT2A 4DY5A 2B45X 5C5TA 2VGDA 2VY0A 2XWBB 2RJLA 2Z79A 1NA1C 3JCIA 3QCWA 4Q0VA 4GH4A 3ZXLA 2TEPA 2Z69A 4K3UA 2D98A 4PLMA 3VHNA 3AXEA 2D6NA 4Q8LA 3MIGA 1IPJA 2CNAA 2PELA 3V65A 1NA1A 2Q0AA 3H50A 4IL7A 5DAVA 5DDJ2 1G9BA 4C0HA 2I74A 2VVEA 3H7JA 2Y0IA 3BOWA 3W58A 5GZFA 3GJBA 1LULA 1ZBA3 3W21A 5KXDA 4AI2A 1GV9A 3NKGA 4BQ1A 1QJU3 1OD5A 2XJSA 3NL1A 3I8TA 1UZZA 4ASLA 3WT3A 4GB31 4HPKA 5EJ3A 3S30A 2QZ3A 1ZRCA 4Z8BA 1PIV3 2GN7A 5JMCA 2RMU3 1N47A 1V9U3 4D94A 5J7MA 2TUNA 1JH5A 1WMFA 2DCZA 1XNDA 5LBCA 1W6QA 4R9DA 2IXJA 2WZR3 2WC2A 5LEJA 3BIWE 4RFT0 3M3QA 5LRSA 3VBFC 1RVF1 3VZJA 2PHUA 3RG0A 1BBT1 5ABJB 1Y3TA 1Z7S1 3ME2A 1WBLA 3T1MA 1KRIA 3MPPG 1NCRB 2LUWA 4BQWA 3VBFA 5IAXA 5JI9A 1KJRA 4M0HA 3S7IA 3URFA 3ZN6B 1AL23 1AR92 1R1ZA 3ZFFC 5C9AC 3BTAA 1QQP3 3ZXGA 1VRH1 2WNVB 2EAKA 2ET7A 3BB6A 1PGSA 1YFWA 4BQXA 2V73A 1LENA 1LODA 3KZ4C 5F6LB 2PHWA 1DZTA 3QOPA 3VBUB 5BNQA 4A7YA 4Q1RA 4BIFA 1F8VA 3V0AA 4FPEA 1YO8A 1DGRA 4FOWA 1POV3 2NYYA 3MLLA 4JTNA 3GBFA 3X29B 3CJIC 5EPAA 1UPSA 1QXPA 3D0JA 3SXWA 2V4AA 2GC2A 3VL8A 4IEVA 4AFMA 4HANA 2XKPA 3UJOA 1V6MA 1CJPA 2D6MA 2JXAA 2RR11 1WLCA 1ZRDA 4AHZA 2UYAA 4BLIA 2PHRA 4IEUA 4JDMA 3ZYIB 3K51A 4NPRA 1RUC1 1CAXA 3GYDA 1LTEA 3TAYA 3SLIA 5L9RA 1G6NA 2FCTA 4FT8A 2PLV2 3OGGA 2DVFA 4UXAA 4K7JA 4XJZA 3WW2A 5BNPB 2QUOA 2ZPXA 4M3CF 4R8HA 1AYN1 3FWEA 2B42B 2WFF1 1PGW1 1Z0HA 5ABJC 1EPZA 4E4ZA 2FCUA 5C4WB 1NCRC 2HJIA 4MX3A 2QZ2A 4RD7A 4HSJA 1JW6A 4DNYA 5L9BA 3ZFGC 5ABJA 4L11A 4XPVA 1QMJA 1NCRA 1RUI2 4DQAA 2A70A 2Y34A 1X33A 4G4FA 5EFUA 4Y20A 1DHKB 1RUH1 2GALA 3ZN6A 3L2YA 4WVMB 4K21A 3VBUC 3ZXFA 1X36A 2RS13 2WNVA 1HW5A 4MGIE 5AC92 2R1BA 2R16A 4HETA 4DS0A 3AXDA 4Y1XA 5K9YA 5KXEA 1DYKA 3TBDA 5JOWA 1FMD3 1FAYA 1LU2A 1W6MB 4L9BA 4L97A 3VBUA 3VUOA 2VW2A 3MEPA 2XBO3 3WX5A