3KT4A

Crystal structure of tpa1 from saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
615
structure length
563
Chain Sequence
EEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYELYMMDDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PKHD-type hydroxylase TPA1
publication title Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 183
structure length 563
sequence length 615
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3kt4A01
2.60.120.1580 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kt4A02
5L9BA 3NNLA 5IATA 3OUJA 4IW3A 5ERLA 5DAXA 2HBUA 4MHUA 3ITQA 4UWDA 4NAOA 3HQRA 3OUIA 3NNFA 4XACA 2JIJA 4J25A 4XCAA 5EQUA 4ZONA 2RDSA 4NHYA 3HQUA 4Y5TA 3GJAA 4JZRA 3W21A 5LASA 2FCTA 3GJBA 3NNJA 5C5TA 5LA9A 3BVCA 3EMRA 3OBZA 5DAWA 5HV0A 2FCVA 2HBTA 5C5UA 4BQYA 4NHLA 2A1XA 2G1MA 3KT7A 4XC9A 4XAAA 4BQXA 5DAPA 2RG4A 5LBCA 4ZPIA 3KT4A 5DAQA 4NHKA 3W20A 3MGUA 2V4AA 2JIGA 4NMIA 2RDQA 2OPWA 5L9VA 4XCBA 5LATA 4NHXA 2Y33A 3KT1A 5EP9A 5IAVA 4NHMA 5HV4A 5LBFA 3DKQA 5M0TA 5LBEA 3NNMA 4MHRA 5A3UA 5IAXA 4XABA 5EPAA 4KBZA 5LB6A 5LBBA 4BQWA 5DAVA 3OUHA 4Y5SA 2RDNA 2FCUA 2G19A 3GZEA 4Q5OA 2Y34A 5L9RA 2RDRA 3PL0A
chains in the Genus database with same CATH superfamily
5L9BA 2YGMA 2QFEA 4LBMA 4LKSA 4IEOA 2PHRA 4P9IA 1AR62 1L7RA 3BTYA 4NOTA 4Z8BA 5L7OC 3K4DA 3LFMA 4N90A 1RUE2 3RWKX 4BQ1A 1GNYA 4QPGB 1UYXA 4RYDA 1PVC1 3KV4A 3M3OA 2RS13 3NNFA 1RITA 1AYN2 3QCWA 4OI2A 4XFAA 4XIKA 4Z82A 5F3IA 2E31A 3UKVA 3K51A 4ES9A 3RI9A 5CFDA 2JKBA 5FY5A 2OYZA 2VOWA 2RMU1 1EYBA 3LEGA 4JDMA 4TWTA 5JZGC 3D8CA 3OD0A 1RUI3 3A22A 3ZMOA 2MEV1 2R041 4JZRA 4PDWB 3VBHB 2D98A 4UFJA 3BVCA 5F5QA 4CDUC 2ADDA 4GMP0 5K0UC 2JG9B 3LA2A 4XFIA 1B35A 5DZGA 5GLTA 3ZSEA 1LOFA 1A34A 2B46X 1SPPB 4Z07A 4AEJA 2RS11 1U5XA 4I3GA 3T2OA 4C1WA 1HJFA 3AKQA 1DYOA 3VZLA 3OB8A 4ASLA 2GNMA 1POV0 2XLGA 3KMHA 5A80A 3HOBA 3BODA 1ONAA 4WM7B 4D3WA 1MZEA 1APNA 3KT7A 1RC6A 4XZPA 4IGQA 4GAZA 4XXAA 4OUSA 4COWA 4HN0A 2P6CA 4J6GA 3WOGA 5T54A 3ZFGA 5FY8A 2YFZA 1PNFA 1JXNA 2EALA 2VZTA 5L73A 3WINE 3N35A 2UY9A 3NJVA 4W50A 1RMU2 3CHXA 5KWRA 2ZMKA 4UW5A 3LZZA 3NV2A 5LCWL 5FPBA 1NCQA 2ZGTA 3D82A 3PTYA 3PVEA 5SV8A 5FO8B 4A42A 4PF5A 5FOJB 4DXSA 2XDVA 3KB5A 4NHXA 4DO0A 4L8QA 3TWIA 1B09A 3RVHA 2J7MA 4LXLA 4N9IA 5FZDA 1MQTC 2ETEA 4F83A 1EV13 4YVWB 4CP9B 3U75A 2W47A 5FZEA 4AQ2A 1C5IA 5JOYA 1WD4A 3ZYIB 2WZR1 1AYM1 3ASIA 5FPAA 2KXLA 5LBEA 3OBTA 4YVSA 2A3XA 4Q0PA 5FYUA 1AL22 1PO12 4KBZA 4PLMA 3MICA 4G3YC 4QDSA 3VDDA 3I2OA 2VQAA 2W0XA 3NKGA 3MIDA 1RB8G 4YW2A 1VBA3 4XE9A 1WBLA 5CIRA 5GZFA 1TME1 2RVAA 2RR12 2RDNA 3ACFA 1LODA 1XBFA 3RGBA 3ZIXA 1UOGA 3OTFA 2X09A 3QLQA 2JE7A 2HEWF 1PK6C 1YWKA 3O5SA 1N47A 4LBKA 5FMDA 1EV11 4Q4W1 2BBVA 1XE8A 2NYYA 3MPBA 4GB33 2VBBA 4XEZA 5FY9A 2V72A 2QCSB 1CONA 1QNYA 2FMYA 5AVPA 4R9AA 3U14A 3H8XA 1G9BA 5FY0A 1CIYA 2JDPA 4YG3A 5TSWA 1SCRA 3C3VA 1DIWA 2RDRA 2Z42A 3DPRB 1CAUB 4Q2FA 5CA6A 2VMDA 3ZFFB 1OH3A 3NJXA 4K21A 2WLPA 2DUPA 4ORFA 1H8TA 1JU4A 3N36A 4I0AA 1R081 2PHLA 1AXYA 4GALA 3VBOA 4ASKA 4HKLA 2CAUA 1NXMA 3OUIA 4NRMA 4UXAA 1XJAA 2Q30A 3VKLA 4DEQA 2YGLA 3FE5A 2H6CA 2OUHA 4AHYA 4ZONA 3AVRA 5A70A 1W99A 2CAVA 1GICA 1V6JA 2BERA 4I0BA 4LMFA 2UYAA 5KXCA 3GJBA 3JQXA 5FYVA 3JB4C 3KHCA 5IYYA 1XQNA 2DDUA 4L97A 2PFWA 4IV1C 5T5OA 5T50A 4B29A 4CCCA 2HWB2 4DUXA 4Z92B 3LF7A 1GZ9A 2WNUC 3SC7X 4AFCA 1HRV2 3IMMA 1VP6A 2WC2A 4P9YA 1W8TA 5K4LA 5ABJA 3N7KA 4UI9L 3N3HA 1HRI2 3S0MA 1OKQA 1U5ZA 2XL9A 1W3VA 3OOXA 5C4WC 1GWMA 1KQRA 3AYDA 2A1XA 2VAUA 4AVSA 4DNYA 2X8KA 2NM1A 3SMHA 4D6SA 4NIGA 2VUAA 1UYYA 1LHVA 1F31A 1XRUA 2ZX1A 4RS5C 4FP3A 4BQXA 4RGAA 3PIJA 1RJ8A 5E16A 1MZFA 1FV2A 4AWDA 2GNBA 3PJYA 1N1YA 3KLSA 1W9FA 1LAJA 4MYEA 4QD2A 1CGPA 1C57A 1H4GA 2D43A 2IXIA 2VM9A 1GP4A 4ARXA 3CDZB 5JVVA 4MGSA 1OD5A 1LR5A 2RDQA 3R0RA 5IVBA 1YHFA 4E2QA 4R9DA 1GKBA 4DB5A 1S0GA 2JDHA 2SBAA 4OHYA 4RQPB 2OUJA 1D0GA 4EN0A 4FTSA 5LATA 3AL5A 2Y33A 1Z7S3 3T1MA 4PQQA 5IWFA 4AVTA 1UN1A 3THPA 3LB9A 1O3TA 3EXUA 3GZTB 1OUSA 4XQDA 4LHSA 2WLQA 5FZ6A 5IT6A 5A7NA 3WR0A 3I7DA 4GJZA 2VR4A 1L7LA 2TBVA 3ZYBA 4D8MA 3O1VA 1GWLA 2R063 4O61A 3ST7A 4FOYA 4O65A 3WF1A 1AR63 5FZ1A 3VBSB 4N43C 1ZZ6A 1MS8A 4R9BA 4FBFA 3VKFC 4XBLA 1FOD3 1S0JA 3USUA 4Y20B 4Y5SA 1Z7S1 1S55A 2OW4A 4X6RB 3E5XA 4AI1A 2BVBA 2Q0AA 3NKTA 2E7QA 5AC91 1FMD3 4XMAA 3IMNA 3VZMA 1YLLA 2R073 5CFDB 1BVP1 4Q4V2 1YQ2A 5FXWA 3H8UA 5FV3A 2QKDA 5JOZA 3NVCA 4QQLA 2VOVA 3M3CA 4OUEA 3ATGA 3WW3A 4BH9A 4WV8A 3P3PA 5FUPA 1YQ5A 3RMXA 1RUG2 3J26N 4CDQA 1ASJ2 2FDGA 1DYKA 1Y3TA 3IDAA 1ZX5A 5E6HA 3UK9A 1AR82 3VHRA 3WQ7A 1B35B 5FKBA 3JD72 3UJQA 4EV0A 2HJIA 1KJRA 2EXJA 1JOBA 1UPIA 4Q8KA 4FPLA 4COYA 1D4VB 1K5MC 1S1AA 4GWJA 4XFGA 3U10A 4PBPA 3DGTA 3LWCA 1PX3A 3WDUA 4IE6A 1W9WA 2GZWA 3Q8CA 4Q4Y2 1JW6A 3DYMA 3MI8A 3ETQA 4AHZA 1BEV3 4WVVA 4EWAA 4QHZA 5F32A 1NE4A 4FAGA 2AREA 2VUCA 5BYNA 5B4XA 3ZFGB 2Q8EA 3MBWA 3RSJA 5KHJA 3MLKA 1F9KA 1DZRA 1TG7A 2RM21 2WAAA 4LA2A 2NPIA 2ORZA 4W6YA 5C3QA 1LB2A 1QJU1 2F17A 2XHNA 1JU3A 1SG3A 5F37A 3OY8A 2HLEA 2WQZC 4IEWA 4YZ4A 4TXWA 1JZ5A 4UW3A 4Y4YA 1GQHA 4CEYA 3WDTA 4DY3A 5FP7A 1W04A 2WT2A 3C7EA 1XNDA 3OEBA 4N53A 5FZOA 5JUVA 4W6WA 1SDDB 2Y38A 1Q56A 3ZN5A 1S0EA 1XSRA 3WG3A 2EXHA 1Q43A 2XVLA 1UY4A 4NUBA 5FAXA 2TNFA 1GOFA 4Y33A 1C5HA 1J3PA 3ACLA 2JECA 5FK7A 4DFSA 5FPUA 2DVFA 3K77A 5FRAA 1QDOA 5DUWA 1AL23 4ZPIA 4YWAA 2CSGA 1RXGA 5G04L 1P8JA 3AP7A 4IEVA 4K3UA 1G6NA 1J84A 1OOPA 1LHWA 3VDDB 2E53A 1MPXA 2HWC2 5FYBA 2WS91 1QXJA 1AR91 3IPVB 4D7YA 1PO22 1DP0A 4BK5A 5FZMA 2UYBA 2VZ1A 4I0WB 4YGEA 5BNPC 1V0AA 2YU1A 4LO8A 2VBDA 1W8UA 1ZZBA 2E9QA 4LO7A 4JGZA 3GXUA 1V9U3 2XJQA 3WDVA 2WNVA 3NAPC 3KCYA 2EIBA 4ZU4A 2QQJA 1RUJ1 1PHMA 4P9JA 4QX5A 1BBT1 3B93A 3THCA 4HVOA 2VVFA 3A7QA 1UOJA 2WZEA 1WD3A 5LB6A 5JXJA 1WA6X 2JICA 2VZRA 1XSQA 3D0SA 1H8TB 2IFRA 3UETA 2OX0A 4XFFA 4IGOA 4KWLA 5FYIA 1L3JA 2ZKLA 4IESA 4K8RB 3ZXKA 4H14A 1DGRN 1PGW2 3VBOB 2RS32 1PVXA 2OQ6A 3QBQA 1R1A3 1PZ8A 1UU5A 4FFHA 4XMIA 5FY1A 4MGTA 1QEXA 3L9JT 3ZSMA 2HWD3 1LRHA 4Y1XA 3Q8EA 4LBJA 2Y6HA 1HV1A 4ZKTB 2YHJA 2Q4SA 5JOXA 2QQLA 2F4LA 3F2ZA 4XJZA 1J1TA 4YPJA 4CZSA 3QD6A 2R30A 2J1AA 1W39A 2L9LA 2D3RA 3B9CA 2Q8OA 1ODNA 2CU5A 1NCRA 2DU1A 1CJPA 2Q8DA 2HKXA 5C3OA 2F6BA 5FDBA 5FZ3A 1QJFA 5CBLA 1OQDA 1QDCA 2YG0A 1YRZA 3LA7A 4WZFA 1UF2C 5CKQA 3VBHC 2XBO2 1VPHA 3T08A 1YQCA 2ARBA 2YY1A 3LPGA 4PF1A 4MV2A 3GF6A 1NQJA 4KNCA 1LOEA 2YMZA 4WM8C 4IEZA 3SQOA 3WNOA 4YM3A 2VZ3A 1UKRA 1SLBA 4NHYA 4JKMA 4Y5TA 4ZU7A 4Q4X3 1XU1A 3M1HA 2OA2A 4XFCA 3FL7A 4QB6A 1VMHA 5CFCC 1OLME 3ZKUA 5C71A 3KV6A 1VBD3 4CU9A 2ZZQA 5JR2A 4BXFA 2BGPA 1ENSA 2CV6A 3OYWA 4EZ4A 5EZWA 4EJRA 3N9OA 3FWEA 5LA0A 5LZ6A 3AZXA 3PTRB 2FCVA 2ZAAA 4LBLA 2OXBA 5BNOC 4QXKA 5GJ6A 1Z0HA 5F3GA 3AMMA 3VBFB 5APAA 4LK6A 3L2YA 4QPYA 3DYOA 4CDWC 3KQ4B 1MS1A 3SXWA 5B2GB 4MXWA 3I2DA 2Z5WA 5BNNA 5IVCA 2BYVE 3CEWA 1VBD1 4XF0A 2IXCA 4IE0A 4UFLA 4W65A 4A2UA 3M3EA 4IV3A 3M3QA 3LEKA 4XC9A 4KU7A 1QKQA 4RN5A 3V0BA 1SLLA 4QDQA 1XB9A 3WDYA 4UW6A 5LBCA 5AVAA 1ZBE1 3POGA 4LLFA 2D44A 4NHKA 5T3NA 4CXWA 3GBWA 1H2LA 4LIVA 1NXD1 5FZBA 3L2HA 3HN3A 3MDPA 3B5LB 4GD4A 4H7LA 5SV5A 3AJYA 3USUB 5JPMB 2IXLA 3WW1A 4AG4A 4NVPA 2P3YA 4BA6A 1REDA 4N8MA 4K20A 2YPDA 4YG6A 4PI2A 4GWNA 4LNVA 3ZM8A 5GZGA 1S0CA 2RMU2 2D6PA 3VBRC 3WNLA 4CDXC 5KXEA 3AMQA 2X5IC 5DABA 1CAVB 2MEV2 2R042 2Y0OA 2HWF3 2DFBA 2HH9A 5DN2A 5FPXA 4R9CA 4CDQB 2JG9A 3U37A 4BWOA 2G4IA 4PIZA 4ZXKA 1UNBA 4CP2A 3RZHA 2ZEYA 1YIPA 4MG2A 4IERA 3AP9A 5FZFA 1A78A 1F4AA 1YI9A 1WMFA 3Q8AA 4COZA 2PXJA 3NL1A 1VBC2 1OD3A 3LAGA 1HXS1 2BZDA 5FPVA 5FO9B 1LGBA 5HXMA 1PIV1 2D6NA 1V6MA 4LBNA 2QJVA 3DPRC 3J7LA 4XJAA 5JSPA 3U0ZA 4HFSA 3S5QA 4HANA 2A70A 1NZCA 4TZDA 2JG8A 4AZZA 4W8JA 3LE0A 2HWF1 1OA2A 1X7NA 2RJKA 2W5FA 3MLJA 4LO4B 4M3CA 3OCPA 4R8HA 2ZKNA 5CNAA 3PHMA 3WG1A 2D6KA 1PMIA 1H6YA 2GH8A 3K75B 2LUWA 4GWMA 2NP0A 2VW1A 4Y1UA 1G9CA 2WFF1 1OURA 2OZJA 1JYTA 1PZ9A 4CVUA 1ZBA2 3ECQA 2R1DA 3LDRA 4Q1RA 1KEXA 1D2SA 4KBBA 2EVXA 3OD4A 1LHNA 3OY8B 2WKKA 3MYXA 1ULEA 3H8RA 2X53S 1Q8PA 3H3LA 5GLVA 5BXXA 1JH5A 4CEYB 5BV6A 2BUKA 5IUQA 3ZN4A 3HIFA 2PMWB 4OHZA 2FDIA 2QQOA 5FZIA 2ZABA 4PIXA 5FYZA 1COV3 4RD7A 3IWZA 5HCFA 5K7PA 2DBIA 4PJYA 2CGOA 5JSOA 5ISLA 3SHRA 4CCNA 4FPFA 1V70A 4CP9A 2W52A 4JHZA 5FLHA 5ACA1 1V6NA 4AI2A 5A6ZA 4PHZA 4N9HA 4MZUA 3HAGA 2WYSA 4QXCA 2W68A 3B69A 4E2GA 1RHI1 1C8M3 4XHXA 2ZHMA 2WZR2 1AYM2 4M0NA 2ZGOA 3ZPOA 1ALYA 1NY71 2VECA 4LO6B 2HWC3 1JYWA 4NN0A 1OOPB 3FFZA 4KWUA 4OI1A 3TNPB 1ZRFA 2HBTA 1QQP1 2AYHA 3C7OA 1FPN3 1SFYA 5C5UA 5A1FA 2WZPP 4CPBD 1COV1 1W0OA 1WWYA 3WXPA 4FQZA 4JTOA 3OGRA 1NLQA 1A8MA 5A32B 1CAXB 1OA3A 1TME2 1Q8SA 2HYKA 3IM0A 4QKBA 5F3CA 1YI7A 2YC4A 1RVF2 1LENA 4NIDA 1JI6A 1UZWA 4TTGA 4JC1A 1UU6A 5DG2A 2YZ4A 3O1RA 4ZZ5A 1MS5A 4Q1PA 3BCWA 3WW4A 1YIFA 3DV8A 2V09A 5DAPA 4BYYA 1ZZ7A 2RG4A 4DRRA 4YFWA 5F6KA 3MIFA 4NR1A 1KFUL 4XBNA 3KD4A 1GUIA 3RJRA 1W8WA 2ARCA 3FBYA 3ZN6A 2VQ0A 4CUBA 5IK8A 3BI3A 3W20A 4JX0A 2PHWA 4Q0SA 3I54A 1DGLA 5C8CC 2VULA 1SZBA 4META 1O5UA 2UWCA 2QQIA 2UU8A 5HXVA 4YRDA 3AP6A 1CX4A 4K1YA 1W0PA 4M00A 1LNSA 4QDRA 5FK8A 3C7HA 3N9QA 4IXLA 4XUTA 3LA3A 1G8WA 1VRH1 3OGJA 2VL4A 1RUH3 2BJSA 3T4HB 3JXSA 2A73B 2IVJA 3TBDA 1D4M2 4HETA 3D5OA 3D6EA 1NCRB 1SBFA 2YC2A 3RZZA 4Z2AA 1CESA 1LEDA 3CO2A 5LBBA 1X9PA 4BIFA 5CISA 1NT0A 2OKXA 1F2NA 1CD3G 4BLIA 2D7FA 1JS9A 2JENA 3GNEA 3IAQA 3K2OA 4SBVA 1EAH3 2JDKA 1W8FA 2VOKA 3ZFEA 1W3XA 2J1UA 2R6QA 5T5JA 2W46A 2RS53 1F5JA 4NPMA 3WDWA 4IEQA 2WAOA 2ZMNA 3CLPA 5F5IA 5GM0A 4BLJA 2ZGQA 4LOSA 4MVTA 2IXKA 2K2SA 5L9RA 1Q8QA 5JXIA 3B9IA 3VBUA 3ZYGA 3TRSB 4D7TA 1W6OA 4GMP3 5KC6A 2Y6KA 3WG4A 3ZSJA 4A45A 1UYPA 4BM8A 2ATFA 2ZEXA 5FZCA 1EAH1 4E4SA 1UO9A 3OUJA 4QQHA 2D40A 3I3DA 3UJOA 5KHKA 1QJY3 2DU0A 5FPZA 2RS51 1JZ3A 3M8LA 3ZFGC 3IDBB 1REFA 2VCMA 1POV3 2VMFA 4GXLA 3PMEA 1PZ7A 1GBGA 2Z69A 5FIXA 3TNQA 3H1MA 3AFKA 1I6XA 4LPLA 5I93A 3N9MA 1DZQA 2DURA 3W21A 4QKNA 4PIYA 5FYTA 1QJX3 4AOCA 3NNJA 3DXTA 1O3SA 1NCQC 4IV3B 5C5TA 3K46A 1AX0A 2VZUA 5GLUA 1Q5OA 1OUXA 5JXGA 3S6PA 1TMF2 3KHBA 4OMDA 3HD8B 2CL2A 4IE5A 5HCAA 5DAWA 3VBSA 5FZ8A 1HKDA 1N3PA 2ARXA 1E5RA 2VJXA 4K1ZA 1JODA 1XYOA 3POSA 4I30A 5FY7A 4E2SA 4YLZA 1C8NA 2D3PA 1RUD1 3ZR5A 5IVEA 4Y20A 1V6LA 2XJSA 1OVPA 1W6MA 4FXKB 4X6QB 3RFRA 5E8AA 1IS4A 2B42B 3TN91 4D69A 5BNQA 2AEYA 1K3IA 4ZY9A 4XUPA 4YVSC 1WLDA 3TOJA 3ACIA 2MNGA 1DFQA 1GQPA 1VBB1 5FMOL 5J09A 3DCQA 4LKFA 4BCUA 1HJGA 4OI0A 4NIAA 5JOWA 1ND3C 2E63A 3USSA 3KCCA 4G9SB 4FPEA 3TEZA 2IWGB 2VQTA 1PGL2 4AEDB 2A75A 1GV9A 1DQ0A 4BDVB 3Q8BA 1XNTA 2GC2A 4QX8A 1EP0A 4KG8A 1BJQA 4QMAA 1OXCA 1S2KA 5E88A 4MLOA 2D97A 1SLAA 4UFKA 2NMNA 2ZGLA 1RUI1 3U4SA 4ZHNA 4XCBA 2W1UA 1MEC3 3N9PA 3P6BA 3APBA 3KT1A 3PUHA 5IJRA 2JXAA 4Y1ZA 2JG8B 1ULGA 5D8AA 4NHMA 1H8TC 2JDZA 2VC9A 2Y64A 4M3CB 1JYIA 3GDBA 4DMIA 4QU2A 1UIKA 1DQ1A 1H2KA 5L19A 3VBOC 2A6YA 3HVDA 1ZBA3 4D6RA 3O1TA 1LOAA 2H0BA 4CE8A 4HBNA 1AHSA 4GH4B 2W91A 2WINB 3POIA 2RM22 1SLIA 1NG0A 3R6SA 4L2NA 4LTAA 1DQ4A 5A7PA 3HEIA 5FYCA 4LHKA 1UL9A 2ZMLA 2JJ6A 4A3XA 3T2PA 4CP1A 2WO7A 2OVUA 1J59A 1JMUB 2XMLA 2AGSA 1DQ2A 1XNCA 1LKNA 1FYUA 1WCKA 1CPMA 3J7MA 1SMVA 2PLV3 4V2VA 1SBEA 1GZTA 1KJLA 3E6CC 1G9FA 5ABJC 2DUQA 4QPIC 5A1AA 4W6XA 3PVNA 1DGWX 2ZGSA 2VNOA 2W2IA 2I2SA 4FPHA 2R32A 1EY2A 1GWKA 1VMFA 1YJKA 2BOJA 2GH2A 2FDHA 4CU6A 1GR3A 3I8TA 1MACA 1TE1B 4YGCA 4E4ZA 2J1VA 3IPVA 2RJLA 4UWDA 3NJZA 2BNNA 4OZOA 1AXZA 1Y43B 3INAA 2WS92 2PTMA 1AR92 2IZWA 5DG1A 3R4SA 1H9PA 2JE8A 5EV7A 1JUHA 5L7OA 1ENRA 2RDSA 5FYSA 3ZVXA 3GJAA 4ZU5A 3A23A 1AJKA 1BHGA 1YNAA 2QUOA 2ZX0A 3MLLA 4JHTA 1WGPA 1RUOA 2XQXA 1MZ5A 3VZOA 2RE9A 1G86A 2QQVA 4FO9A 4H55A 4AVBA 5C3PA 2HWE3 1WLTA 2ZGNA 1PNGA 4HLTA 1RUJ2 4AVAA 4CCDA 1BBT2 1VBA1 3ZN6B 4JAAA 4AGGA 5FYHA 4U2AA 2ZGKA 4FP2A 4XJ9A 4QX7A 1VR3A 2Q8CA 4YW6A 3POFA 2BU9A 2P6HA 2WBKA 4QWNA 1LGNA 4YW1A 3AMHA 5F5CA 4BQYA 2ES3A 4WVMA 2WT0A 4GB31 2X10A 3ZOIA 3B01A 4QXBA 3JBG3 3B00A 3H9AA 3AXDA 4Q29A 5LY1A 4EWDA 3NWKA 5I8TA 1D4M3 4DS0A 3EO6A 4HVQA 4QT6A 3H0OA 1N3OA 2YC0A 1R092 3ZSLA 5DUUA 1VBE3 4CEWC 2XWBB 1I5ZA 1I9RA 1UW8A 2G9FA 1UOBA 1W9TA 4KWJA 2OIIA 1RUC3 3MV11 1UX6A 3JBG1 3J8F3 4LKEA 2PN5A 4XETA 3ZFEB 4X8NA 2JD9A 1NOVA 2DVDA 3NRUA 3SISA 3RYPA 5BY5A 2QQPA 2OQ7A 3N4MA 2JX9A 4QU1A 4CU7A 2FBEA 3AYCA 4E9KA 2ENRA 4IUGA 3VBUB 1DDLA 4JDNA 1MVQA 2CWMA 1W6OB 2NLRA 4LO5B 4MHRA 5D2AA 5F6LB 5EPAA 2P4EA 3SH4A 4BOWA 1MQTA 5EFUA 2BQPA 2AC1A 1RUC1 1QHDA 3KS7A 5CKNA 1H2MA 1XU2A 2WQ8A 1UQXA 3VBFA 2K9ZA 2RJ2A 3I2JA 4E27A 1W9SA 4HONA 1ND2B 3HT2A 4HKOA 3HJRA 4B8EA 2WZ8A 4QHOA 1GZWB 3JZVA 2XPJA 3IDCB 3ZYPA 1QH6A 2MHFA 3AP5A 2WO3A 2DF7A 4MGKE 5FXXA 1ZRDA 4Y22B 4IE4A 4ASMB 1ODMA 5F8PA 1UY0A 3W58A 2E7AA 3ABZA 4Y4RA 5CG9A 1TMF3 3MF6A 1OVSA 1PK6A 2ZPXA 4N53C 4XJWA 5EJ1B 5T55A 5A3PA 5I0DA 2XLAA 3WNXA 3AKPA 3H42B 2EAKA 3MPPG 1RUE3 4MGYE 5I0TA 2GALA 3RG0A 4MHUA 3GGLA 5JPNB 4IETA 4XPVA 1MVEA 4OQ9A 5L36A 3LEIA 1AYN3 4XACA 4ZS2A 4I09A 1AX1A 1E5IA 1W6MB 3HR9A 3OSDA 1RIRA 4IGPA 5F2WA 2EF6A 1OQ1A 1H0BA 3EQEA 4D6QA 1KS4A 3BALA 1OOPC 5FP3A 2R061 1W8ZA 4XHBA 3B7MA 1WBFA 1CAVA 1AR61 1LEMA 4LJHA 4RR3B 3EMRA 4RA0A 1KDMA 4FOVA 2Y0IA 4L9BA 4AAPA 4BIOA 1PMJX 4EN8B 4JGYA 1IPKA 3IZOA 5JR7B 1NX9A 1FOD1 1UZVA 2GC0A 2SLIA 4LT5A 2P37A 1QWRA 1AYN1 1CJDA 4JGZC 1YQ6A 4C8DA 1VMJA 1O4TA 1SLCA 3RZLA 1I5PA 1UZZA 2WNVC 1HLCA 1O8SA 4ISQA 1FMD1 2NZ9A 4WVZA 4FPKA 2R071 3JQWA 1EPWA 1NYWA 2WNUA 5FKCA 3CJIB 4YZ1A 5LEJA 4PQ9A 4AGRA 1PIV2 3JU9A 3KZ4C 1X50A 1IS3A 2ARAA 2J1SA 4R4XA 1W6PB 4FOQA 3WUCA 5D8AB 5IK7A 4AR2A 4Q8LA 4CPBA 5GZEA 3DKWA 3KSCA 2WWUA 4XAAA 5C4WA 1URXA 1RYYA 1ZRIA 3VHNA 4Z1VA 2A7AA 1EUTA 4FT8A 2I45A 4NIIA 3VUOA 2Y26A 3CQOA 1RMU3 2WFF2 4XJ8A 2BGCA 4XZUG 5A33A 4A6OA 3FBMA 3ILNA 3KCXA 3WNKA 5DXDA 4RS5A 2V4AA 2VMCA 4QX1A 2LROA 1ZM1A 2JD4A 4D7SA 3T0DA 2LW8A 1BEV1 3LKJA 1FI2A 1RUF2 3H3ZA 1NCRC 1QOSA 5LRRA 3T0AA 3HNMA 4C1XA 1UXZA 1MS9A 2XGXA 3M4FA 1JTZX 4FPCA 4EQVA 5IVJA 2VNRA 5IHRA 4MADA 1OFNA 4DY5A 2HYXA 4XFBA 5HCHA 3H7YA 1YEWA 5ACA2 3ZXAC 4AL9A 4CCMA 1PO13 1OPMA 3A0KA 2XQRA 2EXIA 2D6MA 3KV9A 3P5BA 5LEKA 1CIWA 4XQWA 1RHI2 4XOGA 3KWVA 1KS5A 3U4XA 3J7HA 4MGQA 1BVVA 1OMIA 1YJLA 2ZX4A 1NY72 1QY4A 4YGBA 2PYTA 2ZJCA 4Q0UA 2RR13 3B02A 4GWIA 4QM8A 4X8PA 4XF1A 1QQP2 3FZ3A 3J7NA 1NUKA 1Y9GA 5A32A 3MW3A 1CAXA 4AK3A 3UGHA 3OPTA 5CEHA 4UFIA 5L7OB 4MO3M 5FMBA 3POYA 4HK9A 5D1IA 1NQDA 2R16A 1O8PA 3WP5A 3WCSA 1AR72 1KD7A 1ZZ8A 2K0GA 4MX3A 4Q5OA 5JSRA 1NA1A 5EWSA 4EROA 1AL21 2C1FA 4IDZA 1PO11 4HPKA 4OUMA 1V6OA 1SFNA 2E33A 5FLIA 3RZGA 2D93A 3ELNA 5JZGB 4PI0A 4HKWA 3TEWA 3I2IA 4CUAA 5BNNC 3O1OA 3M7AA 5KHHA 2RR11 3CZUA 1IS5A 4IL7A 1GP5A 4IV3C 3HQRA 3RYKA 2WO2A 4CDUB 5IVFA 5K0UB 3RQ0A 1OI6A 2FD8A 1TQ5A 3G7DA 3EJKA 1V9U1 4WVMB 2J42A 4JDOA 3VD9A 1TVGA 1SLTA 2DCJA 2BFUL 4H7MA 1F5FA 2FCTA 2GC1A 1FNZA 3RNSA 3LFIA 3PNAA 1D0HA 4QPGC 2HWB3 1WW4A 3QOPA 2GMMA 1VRH2 1R093 4RFRB 1JYNA 5A3OA 1HRV3 1J83A 2XKOA 4AXOA 4JQRA 3BU0A 4OHWA 4CCLA 2YXSA 1AJOA 4PDWC 5H9RA 1HRI3 2Y60A 1A3KA 1R1A1 3Q9OA 4NPLA 4QAWA 2A6WA 5FYYA 5I0SA 2HWD1 5KR7A 5FLJA 2ZX2A 3GCWA 4K6BA 1OBNA 2JG9C 2VVDA 4NHLA 4IQPA 3HWJA 5JCTA 2IUWA 2PAMA 3E1F1 3BOPA 4NWVA 1W6QA 1ULCA 5ANQA 2BTVC 2EIDA 3VDBA 1WMXA 3N7LA 2R1BA 1WMEA 1HRV1 3H1WA 1AX2A 4LBOA 2UY8A 4EE2A 1ACCA 2H6BA 3TEYA 4RHV2 4WM7C 1Q3EA 3E5QA 5F39A 5LK5A 5DDJ2 1HRI1 1MS0A 4XTMA 5EYXA 3K3NA 2C5DA 2JG8C 1H4HA 4QM9A 1MQTB 3AFGA 1IGOA 2B5HA 3V56A 1KGYA 2BWCA 2PHUA 2R0FA 4NMIA 3T0BA 1W28A 1HDKA 2LRPA 3AKRA 4XIOA 3AM2A 2UWBA 4M3CF 2J1RA 2WABA 3AJZA 1J58A 1LULA 4AQTA 2D5HA 4HMZA 4Q4X1 1ZA4A 3PU3A 4NJ4A 3ES1A 1ULFA 2B9UA 2PA7A 3AX4A 1JZ8A 1G9AA 3C7FA 3PUIA 5FUNA 2EAAA 3FLTA 4OCTA 4O7XA 2VMEA 1QOTA 1IPJA 1VB2A 5CU1A 1F35A 3VKOA 3NNMA 3X29B 1PK6B 4LOTA 5A3UA 1IQDC 3AMPA 3W9AA 2CDPA 4YYOA 3E97A 2WWSA 3MUY1 2YYOA 1ZNPA 3DECA 4A6SA 2CGPA 1LGCA 1OSGA 3N9NA 1AL0G 4LE3A 1YFUA 2R0HA 4FI9A 4YVWC 1GNHA 2V73A 3MW2A 2BNMA 4P9WA 1YYNA 3DYPA 4YZ3A 1BXHA 1RUD2 4UBHA 4BQ2A 4ZZ8A 1X36A 1HW5A 3CBNA 4AGVA 4Q4V3 1O59A 1PVC2 4LITA 4O9EA 3POWA 4C91A 3ORJA 2DVAA 3TN92 4URAA 3BGAA 2C4XA 4LR4A 1GU3A 3SEEA 3K3OA 1VBB2 1RUG3 4UOJA 1ASJ3 1VAVA 2DCZA 4Q27A 4F3JA 2LALA 5A7OA 1V6KA 1AR83 5FP9A 4CA9A 4AHWA 4JGYB 4NPRA 3WQ0A 3JD73 5DUXA 4KGQA 4B7KA 4EN6B 2VVEA 5EIYB 2DBNA 1UCXA 1WLCA 2RV9A 1XC6A 2GAUA 1O5LA 2I74A 4LQRA 5IW0A 3S30A 3OBRA 4AEDA 4BHPA 3TAYA 5H9SA 1K42A 2QTWB 1C28A 3VDCA 4IV1B 3LCPA 4PCRA 2RS12 3WP3A 1J3QA 4FQ4A 1G7YA 1FX5A 3J9SA 2WNUB 4Q4Y3 3OPWA 3ZFFC 2Q1MA 4YW4A 4GQ7A 4JVAA 1RUG1 2XVGA 1RUI2 2VXRA 1ASJ1 3BUCA 1AR81 3MUZ1 2FDKA 4XUQA 3OGSA 5C4WB 4ITCA 2O14A 3RJ2X 1OPOA 3WF0A 3MHZA 5CADA 4M0HA 3FX3A 4GH4A 1GANA 3NMBA 5HV0A 1PM4A 1HB3A 2Y6LA 5A33B 1W6NB 3T3YA 5CFCA 1ENXA 2QQUA 2ZGUA 4RS5B 1UMHA 4WVWA 1RL3A 1QU0A 3LSDA 1GOHA 3T4VA 1RUF3 4DQAA 5J96B 2VOTA 4DXZA 5EJZB 1FV3A 4PT6A 4F7ZA 1LU2A 1A6CA 1LCLA 5BNOA 3CU7A 1HB2A 4BB3A 1QXRA 2UWAA 1DHKB 4B4RA 2VD7A 1YUDA 4CDWA 2B7YA 2KM2A 4LHLA 4EZHA 4NROA 5G05L 4P9XA 4EWEA 2PELA 4QGMA 5T52A 4P5YA 1YFYA 2P5BA 5CAZA 1FT9A 1U5YA 4R4ZA 1F15A 5DAQA 2WT1A 4MGIE 5IVVA 2VXJA 4EN7B 3OGGA 2YDEA 2WA3A 2XLFA 4I3PA 5FTTC 1PO23 3AVSA 5J98B 4GZ9A 5GKAC 1HB1A 5L9VA 3FMGA 2XXZA 3RRDA 3VBUC 2QQWA 2YPJA 3MIEA 3R4UA 1VJ2A 5CZKA 4QX3A 2FHRA 4FPGA 4N43B 5FZGA 1W06A 3NW4A 2GN7A 1X8EA 2J22A 3T2QA 4OFGA 4AEKA 3RYRA 1EV12 3K4ZA 4Q4W2 3UGGA 3T1LA 1DF0A 1NA1B 1CZTA 3WNMA 3ZYJB 4AFAA 1C8M1 4HPKB 4BISA 5IFPA 2HWC1 4RQPC 1IKPA 2NN8A 2JDUA 4LBQA 4OZXA 4CYDA 1FPN1 4GJYA 4NO4A 1T2XA 3NO8A 1SHWB 1H1MA 2YROA 4D0QA 4FCAA 4D94A 5F5AA 2RS33 1ZRCA 1K5JA 1OH4A 5LK7B 3QACA 1SBDA 1R082 3POBA 2FZ1A 2VU9A 5JIAA 1GQGA 2Z4FA 3IN9A 1GMMA 1Y4WA 2WN2A 3OEAA 3VL9A 2G19A 2BNOA 3ZXEA 4BK4A 3VBSC 3K48A 2VZOA 4LA3A 2VMHA 3SKJE 4GB32 3T09A 5FZ4A 4BZ4A 4XF3A 2ET7A 1BYHA 1FAYA 4XUOA 2C9AA 4LUMA 4XVHA 5FZ0A 3UL2A 4Q26A 2GMPA 3MV01 1M4WA 4BMEA 5CFDC 1NKGA 2BEOA 2BV4A 4YZ2A 1C1LA 4JRLA 4IW3A 5ERLA 5EYYA 4KU8A 3LOIA 2XBO3 4UF0B 2VO5A 2B39A 3PU8A 3Q8FA 1WUVA 2XH6A 4EN9B 3CNAA 4OQ8A 2B45X 3A4UA 4XCAA 1RINA 1LOBA 2O1QA 4TLGA 3WD5A 1CPNA 1WCSA 1W8OA 3OGVA 1DZTA 1B35C 4UFHA 1LOFC 2K46A 1RUH1 3PUAA 3S57A 1W6QB 4FFGA 2VNVA 5CKMA 5H9QA 1ZREA 2Z2SB 2IVIB 2D6LX 2QQKA 3E6BA 5DMYA 1JN2P 2BVVA 3AXEA 2DFCA 3I59B 3HPNA 5JMOA 2PAKA 5DDJ3 5FWJA 2AR6A 2C6SA 4OYUA 2WNOA 3H8OA 3W5NA 3DXUA 3GHNA 2QQNA 4XAEA 4IEUA 2AEZA 3B3QE 3C2UA 4LHNA 3NQHA 5FZLA 2LM3A 4TSVA 3WW2A 4QGLA 1ND2A 4OHXA 1HV0A 1N1TA 2E7TA 3EB7A 3VL8A 4BMBA 1WLWA 2P3IA 1YCIA 3I2HA 1CX1A 1GZWA 1JOPA 4FFFA 1US2A 3PJQA 2VTXJ 3BB6A 3GBFA 5FXZA 2ZCWA 4JKLA 4Y22A 5C70A 4GMP1 2BP6A 2BOIA 2KD7A 3ROUA 3BPZA 2JDYA 2O0OA 2ET1A 5LY2A 1CAWA 3ALQA 5BNPB 1U12A 1XYNA 4B7EA 4BE3A 1O6UA 2VG9A 2WFPA 1REEA 2KA3A 3I97A 1H30A 2A3WA 3MFCA 3WQBA 4B4PA 1QJY1 1BQPA 2DYCA 2VCCA 1FXZA 3NAPB 5C9AA 1ENQA 2J1TA 3BTAA 1POV1 3AKTA 3THTA 4H3WA 3TB0A 5EHDA 1JZ6A 1DBNA 5D21A 2GP5A 2JDNA 3ZSKA 3A0NA 4XJUA 1DQ6A 2W94A 4S2DA 4M01A 3IKWA 1OA4A 1Z7S2 3MIBA 5EP9A 3VZJA 1QJX1 4HSLA 3NSTA 3VV1A 5AC92 5F1RA 3VDDC 2RMU3 3ZDVA 4DIQA 4P02B 1VIWB 3S7IA 2IXHA 2MEV3 2R043 1J1LA 4RR3A 4E8DA 2BGOA 2R062 5A3MA 4DZGA 2VMGA 4NAMA 4EYUA 1CZSA 3WHUA 2VY0A 3LD8A 4AQ6A 2QZ2A 4P9GA 1BKZA 4OULA 1CWPA 5DUVA 1BK0A 4MXVA 1HIXA 4Y3OA 1M06G 3OUHA 1FOD2 1VBC3 3LDKA 3WZ1A 2JDAA 3I2KA 1F8VA 1GLHA 2GP3A 4FFIA 2GC3A 3CJIA 1FMD2 2D3SA 5E1RA 3IIIA 3W5MA 2R072 3H7JA 3AL6A 2DVGA 1BK1A 2GSYA 1W6PA 4Y1VA 3JCIA 2ORXA 3SLIA 3VHOA 1W2TA 2V5DA 2B8MA 3UT0A 5I0RA 1O4YA 5A7WB 4FAHA 5A1LA 1IHMA 3V64A 3CMGA 3MO4A 4V1PA 3ZX7A 1RJ7A 1XE7A 2XUMA 3BOWA 4WM8B 1VBC1 3R4DB 1LTEA 4URTA 3S7EA 5IATA 3UKNA 4I01A 5BPXA 1E5HA 3I3EA 2ZGPA 3AK0A 1OLMA 5CFCB 1QJU2 3OBAA 2GN3A 2J1EA 3AC0A 3ITQA 4LEJA 2A5ZA 2XONA 1US3A 1MEC1 5FZHA 2CDOA 4P14A 5FREA 5HCBA 2P34A 1LOCA 4BU2A 2CYFA 1OF4A 3FHIB 4AFBA 2TEPA 3FLRA 3I3MA 1BEV2 2IFWA 1ZZ9A 5BNOB 5LW9A 4HZFA 3ZXGA 5J37A 1SQ4A 3I2GA 3MZHA 1ZBA1 2DUOA 3UYJA 1SDWA 2KR2A 5FZKA 4QQ2A 1IZ3A 1OLQA 1QNWA 3ACHA 5LA9A 3PMSA 4CDWB 2QDRA 5EJ3A 5LWBA 1K12A 2FQPA 5GLZA 4HOOA 3SITA 2I07B 1RXFA 4BXSV 1I1EA 1Q8OA 1AYM3 1DGRA 2WZR3 2PQQA 3HMYA 4G4FA 1ULOA 1DYPA 2AZ5A 3M2MA 5C33A 4PLOA 4JRAA 1ZYBA 3M3IA 2AUYA 1UD1A 2LTNA 3RMYA 3BPSA 4AE2A 4QHBA 3O1UA 4MUVA 1OLRA 2PLV1 4K40A 2OPKA 3POJA 1BZWA 3MFAA 1TME3 3FHQA 1QXPA 4Y26A 3DF0A 3SCHA 5B4NA 1AZDA 3AB0A 1UMIA 3AZVA 1RVF3 3KVAA 4L11A 2EICA 3IBMA 2CWSA 2PHTA 2WUHA 4KI5M 4Q4W3 4BQ3A 3VDAA 3VBFC 2DCTA 1OF3A 4A44A 4CTEA 1UU4A 2YBPA 4GIQA 5JXHA 4HVRA 1QOOA 2GMEA 1Y9MA 1JZ2A 3HN1A 1KITA 1DGWA 1BCXA 4UAPA 1X8MA 4XW3A 5JZGA 4LBQB 1UIJA 1JYCA 2Q1FA 4BQ4A 3OJBA 5JIUA 4ISRA 2AENA 3VBRB 2VQUA 4CDXB 4QB1A 2X5IB 4JTNA 1ZZCA 3UKTA 2XG3A 2BWAA 4CDUA 1ND3A 3VD4A 5K0UA 3PIGA 4YM0A 1R083 2JB4A 4HXCA 2WN3A 1RVF1 5DQ0A 5A7SA 2WIIB 4IEPA 4FPYA 4CXYA 1NE6A 3ZIWA 3EYPA 1HB4A 5CG8A 1V9U2 2VCBA 4FSJA 1C3HA 3P1IA 2ID4A 3DKQA 3FUOA 3LIGA 1GZCA 3UESA 3BU7A 4DUWA 5FQ0A 2YV8A 2XJRA 3SNMA 4Z2WA 2HWE1 1SCSA 4XBQA 4KWKA 5M0TA 5FMOS 4P9LA 5KHIA 5FZ7A 2DTYA 5LRSA 3PDQA 2P3JA 2GNDA 3ES4A 2FDJA 3MIGA 4CCJA 2MPFA 4XILA 4AVCA 3T2TA 1ULPA 2OS2A 4IE7A 3WQ1A 4BPZA 5FXVA 1OKOA 2WRAA 4INDA 3E6DA 1HN1A 2A6VA 3ZR6A 1N1VA 4GKXA 4JKKA 2XVKA 4B4QA 1R1A2 2GU9A 4CDQC 4JGYC 3DN7A 1LHOA 2HWD2 2OZ6A 3O0XA 3WNNA 1SACA 1VB4A 4L99A 3WP4A 1IKQA 4LBQD 5FZ9A 1N1SA 1D4M1 1TNRA 1UY1A 2O8QA 2N7GA 4L92A 4MOAA 1AF9A 3HBKA 2XUEA 5DZEA 3T30A 1X9TA 2BPA2 4AAXA 1VBE1 1BMV1 2WYFA 3WF3A 1E57A 5GZCA 4AFMA 2P1BA 4ES8A 2H0VA 2E6VA 1UYZA 1O7FA 4UW4A 4QPIA 1C1FA 3OF1A 2HBUA 4QKDA 3J8F1 1C4RA 4M3CE 4NAOA 3RWNA 1HN0A 2ZS6B 2D5FA 2WQ4A 3SEPA 1ZRRA 4J25A 2TUNA 2QNKA 1S0FA 3LSEA 4U36A 1Y9QA 4LULA 2BBAA 4NRQA 4YG0A 2QDNA 4CXXA 5FOBB 5IFTA 1QMJA 1UOFA 4Q4X2 4AI9A 5AFBA 2ZXQA 5I0UA 4QQOA 1T6GC 1VBD2 4P08A 4S2GA 1QGLA 4CEYC 1W0NA 1CAWB 2EIEA 4TYSA 4NRPA 3ZYFA 4FVVA 4WZCA 2VMIA 3NV3A 3VD5A 5J1XA 2YB7A 1W8HA 5C9AB 1GSLA 1VAMA 1ZBE2 3BIWE 5F2SA 2ZACA 3I3BA 4CU8A 4FTBA 1U5IA 1O3QA 4C0BA 4LORA 2ZTNA 5AC93 2VBPA 5FUIA 1MS3A 2W3JA 4CUCA 2VPVA 4K7JA 1TMF1 5C8CB 3SCGA 2PHDA 3WEZA 3DL3A 5CYYA 4FOWA 4FXGB 4YNIA 2ZX3A 1V6IA 2BDRA 1RUE1 1DLCA 5FP8A 1UZ0A 4N7IA 1WW5A 3CZJA 4XUNA 2W1QA 1OQEA 2ZEWA 2C26A 2FDFA 2X05A 4XYXA 4P5HA 3ILRA 4S2FA 4XQ4A 1UXXX 4IV1A 1NA1C 2R49A 3I2FA 1LU1A 4CEWA 1HXS2 2P3KA 5K9YA 1EUUA 3F95A 1F4HA 4YW7A 2W92A 1XNKA 3CL1A 3KF3A 1GFF2 2V4VA 2YBSA 4COVA 5J48A 1FATA 3AZYA 1ZA7A 2YFUA 3LDBA 1IQAA 2FZ2A 2E26A 2HWF2 3CF6E 3KF5A 1PGL1 4UYBA 3GYDA 2VCAA 2A6XA 3GM8A 4HK8A 4CUGA 4CCEA 1JBCA 1UKGA 1VAKA 3PVBB 4COUA 3ZMNA 4DEVA 4YARA 5C3SA 5IVYA 5H9PA 2RM23 2O8OA 1W6NA 2VGDA 4KL1A 2VUDA 1QJU3 2ILMA 1KRIA 5J36A 2C24A 3MF9A 3A21A 2WSUA 4UBGA 3RI8A 2ZZJA 4AW7A 3GZAA 3TYJA 3VKMA 2W1SA 4ET7A 1IS6A 2YUEA 5KBFA 1WCUA 1V00A 2GDFA 2XHKA 2XOMA 1YO8A 2QZ3A 3ZXLA 3WY6A 3O14A 1PM7A 2DCYA 3GZEA 1H8VA 2JKXA 2Y34A 1XNAA 4O9GA 3URFA 1RMU1 5A6YA 3R05A 4GULA 1TNFA 3FFQA 4AQSA 3WSOA 5I8SA 2Z79A 2A71A 3D4KA 4P00B 3LGRA 3WNPA 1H2NA 1XXNA 2BRTA 3CIHA 1WKYA 2EIGA 1NCQB 1POQA 3M70A 1DCSA 4AEMA 5HI0A 3CJXA 3FJSA 1JYXA 2WS93 2ZOEB 4J1XA 1AR93 2AACA 5EQUA 4I2OA 1TZOA 2ZHLA 1UY3A 1S4CA 4OVEA 4N43A 1COV2 3PUSA 1WMDA 3BIEA 2FMDA 3HQUA 3LEMA 2WWJA 3WX5A 1S2EA 2XJVA 3VKNA 3MEPA 2XB6C 3ZYRA 4C90A 4RL7A 3AP4A 3LOBA 5FBJA 4XFHA 3D0JA 4XDQA 4CSWA 2QQMA 3AYAA 4YVSB 4IEYA 2PHXA 1KDKA 3GCXA 5I8YA 1C8M2 1RUJ3 2C0ZA 2JEMA 1BBT3 3POEA 1HX6A 1W90A 3H50A 3FLPA 4E4DX 1FPN2 2ERFA 1EPZA 4AI8A 5C7GA 4A4AA 4CCKA 1ND3B 1A8DA 1HQNA 4YGDA 4ATEA 1LESA 5KXBA 4RFT0 3IT8A 2G9GA 3U07A 4LLOA 1GNZA 3IIAA 5FWEA 4XTPA 5HPOA 1K5MA 3I3QA 4A7KA 2B4KA 1H9WA 5FO7B 5FY4A 1PMHX 3DEMA 5C3RA 5FQ0B 2Q1ZB 3RZJA 3U78A 1PX4A 3HNYM 3LIHA 4UT5A 3AZWA 2P2KA 5GALA 1SFPA 2A3YA 5JAXA 3MGUA 1RGSA 5F7UA 2JIGA 4XF4A 5A3TA 4UF0A 1KFXL 3EHKA 4N7UA 3FC0A 3OPZA 4B1MA 2DCKA 4LE4A 1W2AX 3IDEA 3WCRA 4QPWA 4XDOA 2WA4A 2WO1A 2W9XA 2Y8KA 1XNBA 4HT1T 5HV4A 5A3WA 1XPWA 4AEDC 1QJEA 2HWB1 3ZPYA 2HEYF 3D3AA 5A3NA 1R091 1RUH2 2DVBA 2E32A 3I59A 5CVRA 2EA7A 1JUIA 1R1ZA 2JWPA 3BYWA 1UY2A 3THDA 2XKPA 2ZEZA 4JV4A 2XWJB 3KV5A 2V5YA 1K45A 1S0DA 4QB2A 2VNGA 1VALA 2A6ZA 3V65A 5ABJB 4Y1YA 1TEIA 4QPIB 1WCQA 5IK4A 5JLVA 2OT7A 3K4AA 1S2BA 2PAEA 1EAH2 3HT1A 4GA9A 3NJYA 4MH0E 3VD3A 1W9YA 4M4RA 4DOUA 3W59A 2D6OX 1JOJA 2F4PA 4AVVA 2RS52 1JZ7A 1O3RA 3V0AA 2ZHKA 1NLSA 4GH4C 5I91A 3SKVA 3WF2A 4XURA 5J7MA 3QH6A 3KQRA 3LPFA 1HQWA 3HNBM 1DG6A 1VLNA 2PQSA 5BNPA 1N3QA 4KGGA 2XR4A 3ZXJA 3VZNA 3UGFA 2DTWA 3NAPA 4ARYA 1ZBE3 3DUIA 4TLFA 1UAIA 4J1WA 2ZA9A 1X82A 5A7QA 1WW6A 1QJY2 2W87A 4CRQA 5BUVA 4NIHA 1YQ8A 2JIJA 4DUVA 4OMCA 1XYPA 3BKZA 3VHPA 1ZVFA 4LUKA 1NLRA 2Y6GA 5ANNA 4ATFA 1AVBA 5FPLA 1NAEA 3J4UH 1IOAA 3G6JB 4CP0A 3I4IA 4E8CA 1QJX2 4QX0A 2RHPA 1I3HA 2ZBJA 1UX7A 3VZKA 4FPOB 1CN1A 4DXRA 1W2OA 1UZYA 2VW2A 4AI0A 3SH5A 4A41A 4E4HA 4YSFA 1W03A 5FZAA 1OC1A 4XF9A 2X29A 2ADEA 2HEVF 4CCOA 5HBAA 4QPGA 4AFDA 2NMOA 3BTXA 1MR5A 4Q4V1 3RZKA 1HXS3 3FN9A 4C0HA 2VH9A 1OHFA 1CQ9A 1LECA 2JE9A 1PIV3 4CEWB 2G1MA 3SH3A 3WG2A 1XOYA 5FJHA 4YM2A 4L0PA 1S0IA 4PDWA 3VBHA 2Q5TA 2EXKA 1L7QA 1UMZA 4KQ7A 4TN7A 4SLIA 4XXPA 5J3UA 1STMA 5A7WA 3JD71 5JI7A 4I02A 2BFUS 4OLLA 2WNEA 1GOGA 3JB8A 3WLUA 4WM8A 3ZDSA 3ZKYA 1OT5A 5LA1A 1MS4A 2WFF3 4YM1A 1SPPA 3AKSA 3VLBB 4FPJA 3B94A 4HN1A 4YFZA 3QH7A 4R52A 5K8SA 4Q4Y1 4Q0QA 4A7YA 4AHXA 2OPWA 2VZQA 4RSUA 4WM7A 1XE0A 3BTZA 3RS6A 4DINB 1Y7BA 1MEC2 1E5SA 3KGLA 5T5PA 1IPSA 4JCKA 2NQYA 1Q8VA 2ZAHA 5JWPA 5FFOC 3ENRA 5FJKA 5LBFA 4S2HA 1YC61 4BJ0A 1G9DA 5CB7A 1OFSA 1S0BA 4QXHA 3N9LA 4DRVA 3RZMA 2G9ZA 3KGZA 4KG0A 4OI4A 4K9SA 4YZ5A 3ZFEC 5KC5A 5ACA3 3UNPA 4DPNA 1RTVA 2W95A 3E5UA 3O0VA 4QGNA 3PVOA 3C8XA 4XDPA 5A6XA 1IG0A 1RHI3 1YXWA 4BQ5A 5DAVA 1RUF1 3JUUA 3NV4A 4DXTA 2PHFA 3I49A 5LA2A 2GNTA 4MGZE 3ZXFA 1CR7A 1VRBA 2CTVA 1O4ZA 3KVBA 3VD7A 3ZXDA 4N53B 5FZOB 1W05A 1QQP3 3WV6A 2CY6A 2VZVA 2FCUA 2VTXA 5JMCA 1H1IA 4PLNA 1O91A 3EBRA 2PLV2 1UPSA 2XJUA 2VE1A 1AR73 3U1XA 4YVWA 4B3NA 4QX2A 1VE0A 3PUQA 4YW5A 1X33A 4YW3A 2AH2A 3N7MA 4ZXEA 4LK7A 1DU3D 2JDMA 3O1PA 2LS6A 3PLQA 1HQLA 2WDBA 2W1WA 1ND2C 3PL0A 1JHNA 2DV9A 2VUJA 5FP4A 2WL1A 4NE9A 3NNLA 3ZYHA 1PO21 4HSJA 2Y6JA 5DAXA 4MSVA 3VN4A 4CDXA 3ILFA 3VBRA 1CZVA 3O1MA 3SCFA 4KMQA 1QIQA 1JHJA 2X5IA 4HL0A 5F9TA 4AF9A 1VBA2 4LKDA 5C8WA 3PURA 1AR71 1LHUA 2XJPA 3AZZA 4JGZB 3O1SA 1H1AA 2C9KA 1FNYA 1SEFA 1LJ7A 2WNVB 1K5MB 3ON7A 1LOGA 5LASA 3O0WA 5C9AC 2CHHA 3FUQA 3HBZA 2CNAA 3DPRA 3O12A 1CAUA 1D7PM 1QH7A 3C7GA 4HG6B 1VRH3 4QQPA 5FYMA 3ZFFA 3GALA 3IB3A 4PBOA 5IK5A 2E51A 1QF3A 1DLLA 2HWE2 3OBZA 3ZO0B 4JQTA 4K8FA 1YFWA 5KXDA 2VW0A 3GZUC 1PGW1 2Y6FA 2RS31 1W2UA 1U0AA 3LQCA 1NZIA 4FTEA 4RGKA 1JYVA 1RUNA 5JI9A 3P3NA 4RR3C 1ST8A 2UURA 1JZ4A 4H2AA 3UV9A 2YBKA 5A3LA 3RPQA 2DWRA 4RGGA 3WVJA 2BW8A 2ZHNA 3JBG2 4B1LA 2ZGMA 3VB9A 1AXKA 1Z78A 3GBGA 2VZSA 4ONUA 5F3EA 5DPNA 3TEXA 3CJIC 3KM5A 5EXOA 4RHV3 3ME2A 3KT4A 3VGIA 5KHGA 2XBO1 1VBE2 4Y24A 1BMV2 2B9VA 2W08A 4OHVA 3NV1A 2QVSB 1R64A 5FBZA 3H1YA 3ZLIA 3WF4A 2IC1A 2R7EB 1KXGA 5D8AC 2JB8A 1W2NA 5C6CA 1AUYA 1W8NA 2IXJA 1ULDA 4UFMA 1RUC2 3S5AA 1UWWA 3J8F2 2QBXA 3CKHA 3N7JA 2XJTA 4AI3A 2ZGRA 3H3UA 3WDXA 3GHMA 3AYEA 3WUDA 1IG3A 3V0AB 5IAVA 1WCDJ 2VZPA 4Y5Z0 1GP6A 2VTFA 4QKFA 4W4ZA 5JDBA 3ACGA 1WW7A 3MW4A 3OG2A 4RHV1 5FR3A 1DQ5A 1CVNA 5DDJ1 2CGNA 1J3RA 3ETPA 3FHAA 4A7ZA 4KH9A 3RDIA 2W39A 3OYWB 2WR9A 3NNGA 1GYKA 5FMCA 5IAXA 1T6BX 4XABA 4LIUA 2XL7A 4F8AA 1QJZA 4ZS3A 3O7OA 5AFEA 4BQWA 5GZDA 3WHTA 5E89A 2WJSA 5A6QA 4IEXA 1MZ6A 5DZFA 3U11A 3WP6A 4Q0VA 1BLZA 3WT3A 3IAPA 1RUD3 4RQPA 1WZXA 3AMNA 3MIHA 4A3ZA 5T5LA 2WSVA 4MXWB 1PVC3 3BN6A 3HQXA 2QE3A 1PGSA 4M4PA 5BNNB 3TN93 5GLWA 2P17A 4WBBA 5FCCA 1WA4A 2YU2A 1VBB3 5C8CA 4AYUA 1H6XA 2VOXA 1YFXA 3V0BB 1D2QA 4GKYA 4NWWA 4V2WA
chains in the Genus database with same CATH topology
5L9BA 2YGMA 2QFEA 4LBMA 4P9IA 4IEOA 2PHRA 1AR62 4NOTA 4Z8BA 5L7OC 4N90A 1RUE2 4BQ1A 4QPGB 3E6CC 1PVC1 3M3OA 4OI2A 2RS13 3NNFA 1RITA 1AYN2 3QCWA 4XIKA 4XFAA 4Z82A 3UKVA 4ES9A 3K51A 3RI9A 5CFDA 2JKBA 2OYZA 2VOWA 2RMU1 1EYBA 4JDMA 4TWTA 5JZGC 3D8CA 3OD0A 1RUI3 3ZMOA 2MEV1 4JZRA 2R041 4PDWB 3VBHB 2D98A 3BVCA 5F5QA 4CDUC 4GMP0 5K0UC 2JG9B 3LA2A 4XFIA 1B35A 5DZGA 5GLTA 3ZSEA 1LOFA 2B46X 4Z07A 4AEJA 2RS11 1U5XA 4I3GA 4C1WA 3AKQA 3VZLA 4ASLA 2GNMA 1POV0 2XLGA 3KMHA 3BODA 1ONAA 4WM7B 4D3WA 1MZEA 1APNA 3KT7A 1RC6A 4XZPA 4XXAA 4OUSA 4COWA 4HN0A 4J6GA 3WOGA 5T54A 3ZFGA 5L73A 1PNFA 1JXNA 2EALA 3WINE 3N35A 2UY9A 1RMU2 5KWRA 2ZMKA 4UW5A 3LZZA 3NV2A 1NCQA 2ZGTA 3D82A 3PTYA 3PVEA 5SV8A 5FO8B 4PF5A 5FOJB 3KB5A 4NHXA 4L8QA 3TWIA 1B09A 4N9IA 1MQTC 2ETEA 4F83A 1EV13 4YVWB 4AQ2A 1C5IA 5JOYA 1WD4A 3ZYIB 5LBEA 1AYM1 2WZR1 3ASIA 2KXLA 3OBTA 4YVSA 2A3XA 4Q0PA 1AL22 1PO12 4KBZA 4PLMA 3MICA 4G3YC 3VDDA 2VQAA 2W0XA 3NKGA 3MIDA 1RB8G 4YW2A 1VBA3 4XE9A 1WBLA 5CIRA 5GZFA 1TME1 2RR12 2RDNA 1LODA 3ZIXA 3OTFA 3QLQA 4LBKA 2JE7A 2HEWF 1PK6C 1YWKA 3O5SA 1N47A 3WG1A 2BBVA 1EV11 4Q4W1 1XE8A 2NYYA 3MPBA 4GB33 4XEZA 2QCSB 1CONA 1QNYA 2FMYA 5AVPA 4R9AA 1G9BA 4YG3A 5TSWA 1SCRA 3C3VA 1DIWA 2RDRA 2Z42A 3DPRB 1CAUB 4Q2FA 5CA6A 3ZFFB 4K21A 2WLPA 2DUPA 4ORFA 1H8TA 3N36A 4I0AA 1R081 2PHLA 1AXYA 4GALA 3VBOA 4HKLA 3OUIA 1NXMA 2CAUA 4UXAA 3VKLA 2Q30A 2YGLA 3FE5A 2H6CA 2OUHA 4AHYA 4ZONA 2CAVA 1GICA 1V6JA 4I0BA 2UYAA 5KXCA 3GJBA 3JQXA 3JB4C 1XQNA 4L97A 5T5OA 2PFWA 4IV1C 5T50A 4B29A 4Z92B 2HWB2 1GZ9A 2WNUC 4AFCA 1HRV2 1VP6A 2WC2A 4P9YA 5ABJA 3N7KA 3N3HA 1HRI2 3S0MA 1OKQA 1U5ZA 2XL9A 5C4WC 1KQRA 3AYDA 2A1XA 4AVSA 4DNYA 2X8KA 2NM1A 3SMHA 2VUAA 1LHVA 1F31A 1XRUA 2ZX1A 4RS5C 4FP3A 4BQXA 4RGAA 1RJ8A 5E16A 1MZFA 1FV2A 4AWDA 2GNBA 3PJYA 1N1YA 3KLSA 4MYEA 4QD2A 1CGPA 1C57A 1H4GA 2D43A 2IXIA 5JVVA 1OD5A 1LR5A 2RDQA 3R0RA 1YHFA 4E2QA 4R9DA 1GKBA 4DB5A 1S0GA 4OHYA 2SBAA 4RQPB 2OUJA 1D0GA 4EN0A 4FTSA 5LATA 2Y33A 1Z7S3 3T1MA 4AVTA 1UN1A 3THPA 3LB9A 1O3TA 3EXUA 3GZTB 4XQDA 2WLQA 5IT6A 3WR0A 3I7DA 2TBVA 2R063 3ST7A 4FOYA 1AR63 3VBSB 4N43C 1ZZ6A 1MS8A 4R9BA 4FBFA 3VKFC 4XBLA 1FOD3 1S0JA 3USUA 4Y20B 4Y5SA 1Z7S1 1S55A 2OW4A 4X6RB 3E5XA 4AI1A 2BVBA 2Q0AA 3NKTA 2E7QA 5AC91 1FMD3 4XMAA 3IMNA 3VZMA 1YLLA 2R073 5CFDB 1BVP1 4Q4V2 3H8UA 2QKDA 5JOZA 3NVCA 4QQLA 2VOVA 3M3CA 4BH9A 3ATGA 3WW3A 4WV8A 3P3PA 3RMXA 1RUG2 3J26N 4CDQA 1ASJ2 1DYKA 1Y3TA 1ZX5A 3UK9A 3VHRA 1AR82 3WQ7A 1B35B 3JD72 3UJQA 4EV0A 2HJIA 1KJRA 2EXJA 1UPIA 4Q8KA 4FPLA 4COYA 1D4VB 1K5MC 1S1AA 4XFGA 3U10A 4PBPA 3DGTA 3LWCA 3WDUA 2GZWA 4Q4Y2 1JW6A 3MI8A 3ETQA 4AHZA 1BEV3 4WVVA 4EWAA 1NE4A 4FAGA 2AREA 5BYNA 3ZFGB 3RSJA 5KHJA 3MLKA 1F9KA 1DZRA 2RM21 4W6YA 4LA2A 2NPIA 1LB2A 1QJU1 3OY8A 2WQZC 4IEWA 4YZ4A 4UW3A 4Y4YA 1GQHA 4CEYA 3WDTA 4DY3A 2WT2A 1XNDA 4N53A 4W6WA 3ZN5A 2Y38A 1Q56A 1S0EA 3WG3A 2EXHA 1Q43A 2XVLA 5FAXA 2TNFA 1C5HA 1J3PA 3ACLA 2JECA 4DFSA 2DVFA 5FRAA 1QDOA 5DUWA 1AL23 4ZPIA 3AP7A 4IEVA 4K3UA 1G6NA 1OOPA 1LHWA 3VDDB 2E53A 2HWC2 2WS91 1QXJA 1AR91 3IPVB 4D7YA 1PO22 2UYBA 4I0WB 4YGEA 5BNPC 4LO8A 1ZZBA 2E9QA 4LO7A 4JGZA 3WDVA 1V9U3 2XJQA 2WNVA 3NAPC 3KCYA 4ZU4A 1RUJ1 1PHMA 4P9JA 4QX5A 1BBT1 3B93A 4HVOA 2VVFA 1WD3A 5LB6A 2JICA 3D0SA 1H8TB 2IFRA 4XFFA 4KWLA 1L3JA 2ZKLA 4IESA 4H14A 1DGRN 1PGW2 3VBOB 2RS32 1PVXA 3QBQA 1R1A3 1PZ8A 1UU5A 4XMIA 3L9JT 3ZSMA 2HWD3 1LRHA 4Y1XA 4LBJA 1HV1A 4ZKTB 2YHJA 2Q4SA 5JOXA 4CZSA 4XJZA 1J1TA 3QD6A 2R30A 1W39A 2D3RA 3B9CA 2Q8OA 1NCRA 2DU1A 1CJPA 2HKXA 5FDBA 2F6BA 5CBLA 1OQDA 1QDCA 1YRZA 3LA7A 4WZFA 1UF2C 3VBHC 2XBO2 2ARBA 2YY1A 4MV2A 3GF6A 1NQJA 4KNCA 1LOEA 2YMZA 4WM8C 4IEZA 4YM3A 1UKRA 1SLBA 4NHYA 4Y5TA 4ZU7A 4Q4X3 1XU1A 3M1HA 2OA2A 4XFCA 5CFCC 1VBD3 2ZZQA 1ENSA 2CV6A 3OYWA 5EZWA 4EJRA 3FWEA 3AZXA 2FCVA 2ZAAA 4LBLA 5BNOC 4QXKA 5GJ6A 1Z0HA 3AMMA 3VBFB 3L2YA 4QPYA 4CDWC 1MS1A 3SXWA 5B2GB 4MXWA 3I2DA 2Z5WA 5BNNA 2BYVE 3CEWA 1VBD1 4XF0A 2IXCA 4W65A 4A2UA 3M3EA 4IV3A 4XC9A 3M3QA 4KU7A 1QKQA 3V0BA 1SLLA 3WDYA 4UW6A 5LBCA 5AVAA 1ZBE1 4LLFA 2D44A 4NHKA 5T3NA 3GBWA 1H2LA 1NXD1 3L2HA 3MDPA 3B5LB 4H7LA 5SV5A 3AJYA 3USUB 5JPMB 2IXLA 3WW1A 4AG4A 4NVPA 4BA6A 1REDA 4K20A 4YG6A 4GWNA 4LNVA 5GZGA 1S0CA 2RMU2 2D6PA 3VBRC 4CDXC 5KXEA 3AMQA 2X5IC 2MEV2 2R042 1CAVB 2Y0OA 2HWF3 2DFBA 5FPXA 4R9CA 4CDQB 2JG9A 4BWOA 2G4IA 4PIZA 4ZXKA 4CP2A 1YIPA 4IERA 3AP9A 1A78A 1YI9A 1WMFA 4COZA 3NL1A 1VBC2 3LAGA 1HXS1 5FO9B 1LGBA 1PIV1 2D6NA 1V6MA 4LBNA 2QJVA 3DPRC 4XJAA 5JSPA 3U0ZA 4HFSA 4HANA 2A70A 1NZCA 4TZDA 2JG8A 2HWF1 1OA2A 2RJKA 1X7NA 3MLJA 4LO4B 4R8HA 4M3CA 3OCPA 2ZKNA 5CNAA 3PHMA 2D6KA 1PMIA 4GWMA 2GH8A 2NP0A 2LUWA 2VW1A 4Y1UA 1G9CA 2WFF1 2OZJA 1PZ9A 1ZBA2 3ECQA 2R1DA 4Q1RA 1D2SA 4KBBA 2EVXA 3OD4A 1LHNA 3OY8B 2WKKA 3MYXA 1ULEA 2X53S 1Q8PA 5BXXA 5GLVA 1JH5A 4CEYB 5BV6A 2BUKA 5IUQA 3ZN4A 3HIFA 4OHZA 2ZABA 4PIXA 1COV3 4RD7A 3IWZA 5HCFA 5K7PA 4PJYA 2CGOA 5JSOA 3SHRA 4FPFA 1V70A 2W52A 5ACA1 5FLHA 1V6NA 4AI2A 4N9HA 4MZUA 3HAGA 2W68A 3B69A 4E2GA 1RHI1 1C8M3 4XHXA 2ZHMA 2WZR2 1AYM2 4M0NA 2ZGOA 1ALYA 1NY71 2VECA 4LO6B 2HWC3 4NN0A 1OOPB 3FFZA 3TNPB 4OI1A 1ZRFA 2HBTA 1QQP1 2AYHA 5C5UA 1FPN3 1SFYA 2WZPP 1COV1 1W0OA 3WXPA 4FQZA 4JTOA 5A32B 1A8MA 1CAXB 1OA3A 1TME2 1Q8SA 2HYKA 3IM0A 1YI7A 1RVF2 1LENA 4JC1A 1UU6A 5DG2A 2YZ4A 1MS5A 4Q1PA 3BCWA 3WW4A 5DAPA 1YIFA 2V09A 3DV8A 4BYYA 2RG4A 1ZZ7A 4DRRA 4YFWA 5F6KA 3MIFA 4NR1A 1KFUL 4XBNA 3KD4A 3RJRA 3FBYA 3ZN6A 2VQ0A 5IK8A 3W20A 2PHWA 4Q0SA 3I54A 1DGLA 5C8CC 2VULA 4META 1O5UA 2UWCA 2UU8A 5HXVA 4YRDA 3AP6A 1CX4A 4K1YA 1W0PA 4M00A 4IXLA 3LA3A 1G8WA 1VRH1 3OGJA 1RUH3 2A73B 3TBDA 1D4M2 4HETA 3D5OA 3D6EA 1NCRB 1SBFA 3RZZA 1CESA 1LEDA 5LBBA 3CO2A 4BIFA 1F2NA 1CD3G 4BLIA 2D7FA 2JENA 3GNEA 4SBVA 1EAH3 3ZFEA 2VOKA 2R6QA 5T5JA 2RS53 1F5JA 3WDWA 4IEQA 2ZMNA 3CLPA 5GM0A 4BLJA 2ZGQA 4MVTA 5L9RA 2IXKA 2K2SA 1Q8QA 3B9IA 3VBUA 3ZYGA 3TRSB 4D7TA 1W6OA 4GMP3 5KC6A 4BM8A 3WG4A 3ZSJA 2ATFA 1EAH1 4E4SA 3OUJA 4QQHA 2D40A 3UJOA 5KHKA 1QJY3 2DU0A 5FPZA 2RS51 3M8LA 3ZFGC 3IDBB 1REFA 1POV3 4GXLA 3PMEA 1PZ7A 1GBGA 2Z69A 3TNQA 3H1MA 3AFKA 1I6XA 5I93A 1DZQA 3W21A 2DURA 4PIYA 1QJX3 1O3SA 3NNJA 5C5TA 1NCQC 4IV3B 1AX0A 5GLUA 1Q5OA 3S6PA 1TMF2 3HD8B 2CL2A 5HCAA 5DAWA 3VBSA 1HKDA 1N3PA 2ARXA 4K1ZA 1XYOA 3POSA 4I30A 4E2SA 4YLZA 1C8NA 2D3PA 1RUD1 4Y20A 1V6LA 2XJSA 1W6MA 4FXKB 4X6QB 5E8AA 1IS4A 2B42B 3TN91 4D69A 5BNQA 4YVSC 1WLDA 3TOJA 2MNGA 1DFQA 1VBB1 5FMOL 5J09A 4BCUA 4OI0A 5JOWA 1ND3C 2E63A 3USSA 3KCCA 4G9SB 4FPEA 2IWGB 1PGL2 4AEDB 2A75A 1GV9A 1DQ0A 2GC2A 1EP0A 4KG8A 1BJQA 4QMAA 1S2KA 5E88A 4MLOA 2D97A 1SLAA 2NMNA 2ZGLA 1RUI1 4XCBA 1MEC3 3APBA 3KT1A 2JXAA 4Y1ZA 2JG8B 1ULGA 5D8AA 4NHMA 1H8TC 2JDZA 4M3CB 1JYIA 4DMIA 4QU2A 1UIKA 1DQ1A 1H2KA 5L19A 3VBOC 2A6YA 1ZBA3 1LOAA 2H0BA 4HBNA 1AHSA 4GH4B 2WINB 2RM22 1SLIA 1NG0A 3R6SA 4L2NA 4LTAA 1DQ4A 4A3XA 4LHKA 1UL9A 2ZMLA 2JJ6A 4CP1A 2OVUA 1J59A 2AGSA 1DQ2A 1XNCA 1LKNA 1FYUA 1WCKA 1CPMA 1SMVA 2PLV3 1SBEA 1KJLA 1G9FA 5ABJC 2DUQA 4QPIC 4W6XA 3PVNA 1DGWX 2ZGSA 2VNOA 2I2SA 4FPHA 2R32A 1EY2A 1YJKA 2GH2A 1GR3A 3I8TA 1MACA 1TE1B 4YGCA 4E4ZA 3IPVA 4UWDA 2RJLA 3NJZA 2BNNA 1AXZA 1Y43B 3INAA 2WS92 2PTMA 1AR92 2IZWA 5DG1A 3R4SA 1H9PA 5EV7A 5L7OA 1JUHA 1ENRA 2RDSA 3ZVXA 3GJAA 4ZU5A 1AJKA 2QUOA 1YNAA 3MLLA 2ZX0A 1WGPA 1RUOA 1MZ5A 3VZOA 2RE9A 1G86A 4AVBA 4FO9A 4H55A 2HWE3 1WLTA 2ZGNA 1PNGA 4HLTA 1RUJ2 4AVAA 1BBT2 1VBA1 3ZN6B 4JAAA 4AGGA 4U2AA 2ZGKA 4FP2A 4XJ9A 1VR3A 1LGNA 4YW1A 3AMHA 4BQYA 2ES3A 4WVMA 2WT0A 4GB31 3B01A 3JBG3 3B00A 3H9AA 3AXDA 4Q29A 4EWDA 3NWKA 5I8TA 1D4M3 4DS0A 3EO6A 4HVQA 4QT6A 3H0OA 1N3OA 2YC0A 1R092 3ZSLA 5DUUA 1VBE3 4CEWC 2XWBB 1I5ZA 1I9RA 1UW8A 2G9FA 4KWJA 2OIIA 1RUC3 1UX6A 3JBG1 3J8F3 3ZFEB 2PN5A 4XETA 4X8NA 1NOVA 2DVDA 3SISA 3RYPA 5BY5A 2QQPA 3N4MA 2JX9A 2FBEA 3AYCA 4E9KA 2ENRA 3VBUB 1DDLA 4JDNA 4MHRA 1MVQA 1W6OB 2CWMA 2NLRA 4LO5B 5F6LB 4BOWA 5EPAA 3SH4A 1MQTA 5EFUA 2BQPA 1RUC1 1QHDA 3KS7A 1H2MA 1XU2A 3VBFA 2K9ZA 4E27A 1ND2B 3HT2A 4HKOA 4B8EA 1GZWB 3JZVA 2XPJA 3IDCB 3ZYPA 1QH6A 2MHFA 3AP5A 4MGKE 2DF7A 1ZRDA 4Y22B 4ASMB 3W58A 2E7AA 5CG9A 1TMF3 3MF6A 1PK6A 2ZPXA 4N53C 4XJWA 5T55A 2XLAA 3WNXA 3AKPA 2EAKA 3MPPG 1RUE3 4MGYE 5I0TA 2GALA 3RG0A 4MHUA 5JPNB 4IETA 4XPVA 1MVEA 5L36A 4XACA 1AYN3 4I09A 1AX1A 1W6MB 3HR9A 1RIRA 2EF6A 1OQ1A 1H0BA 3EQEA 1KS4A 3BALA 1OOPC 2R061 4XHBA 3B7MA 1WBFA 1CAVA 1AR61 1LEMA 4RR3B 3ZXFA 3EMRA 4RA0A 1KDMA 4FOVA 2Y0IA 4L9BA 4BIOA 4EN8B 4JGYA 1IPKA 5JR7B 1FOD1 2GC0A 2SLIA 4LT5A 2P37A 1QWRA 1AYN1 1CJDA 4JGZC 1O4TA 1SLCA 1UZZA 2WNVC 1HLCA 4ISQA 1FMD1 2NZ9A 4WVZA 4FPKA 2R071 3JQWA 1EPWA 1NYWA 2WNUA 4YZ1A 3CJIB 5LEJA 4PQ9A 4AGRA 1PIV2 3JU9A 3KZ4C 1X50A 1IS3A 4R4XA 1W6PB 4FOQA 3WUCA 5D8AB 5IK7A 4Q8LA 5GZEA 4XAAA 3DKWA 3KSCA 5C4WA 1URXA 3VHNA 4Z1VA 2A7AA 4FT8A 2I45A 3VUOA 2Y26A 1RMU3 2WFF2 4XJ8A 2BGCA 5A33A 3FBMA 3ILNA 3KCXA 5DXDA 4RS5A 2V4AA 1ZM1A 2JD4A 4D7SA 1BEV1 3LKJA 1FI2A 1RUF2 3H3ZA 1NCRC 1QOSA 5LRRA 4C1XA 2XGXA 1MS9A 3M4FA 1JTZX 4FPCA 2VNRA 1OFNA 4DY5A 4XFBA 3H7YA 5ACA2 3ZXAC 1PO13 1OPMA 3A0KA 2EXIA 2D6MA 5LEKA 1CIWA 4XQWA 1RHI2 4XOGA 1KS5A 3U4XA 1BVVA 1OMIA 1YJLA 2ZX4A 1NY72 1QY4A 4YGBA 2PYTA 2ZJCA 4Q0UA 2RR13 3B02A 4QM8A 4XF1A 4X8PA 1QQP2 3FZ3A 5A32A 3MW3A 1CAXA 4AK3A 5L7OB 3POYA 4HK9A 5D1IA 1NQDA 2R16A 3WP5A 3WCSA 1AR72 4Q5OA 1KD7A 1ZZ8A 2K0GA 4MX3A 5JSRA 1NA1A 5EWSA 4EROA 1AL21 2C1FA 4OUMA 1PO11 4HPKA 5FLIA 1V6OA 1SFNA 2D93A 3ELNA 5JZGB 4HKWA 5BNNC 3M7AA 5KHHA 2RR11 1IS5A 4IL7A 4IV3C 3HQRA 3RYKA 4CDUB 5K0UB 3RQ0A 1OI6A 1TQ5A 3G7DA 3EJKA 1V9U1 4WVMB 4JDOA 1SLTA 2DCJA 2BFUL 4H7MA 1F5FA 2FCTA 2GC1A 1FNZA 3RNSA 3PNAA 1D0HA 4QPGC 2HWB3 1WW4A 3QOPA 2GMMA 1VRH2 1R093 1HRV3 2XKOA 4AXOA 4JQRA 4OHWA 2YXSA 1AJOA 4PDWC 5H9RA 1HRI3 1A3KA 1R1A1 3Q9OA 2A6WA 5I0SA 2HWD1 5FLJA 2ZX2A 4K6BA 2JG9C 4NHLA 2VVDA 4IQPA 3HWJA 5JCTA 2PAMA 3BOPA 4NWVA 1W6QA 1ULCA 2BTVC 3N7LA 2R1BA 1WMEA 1HRV1 3H1WA 1AX2A 4LBOA 2UY8A 2H6BA 4RHV2 4WM7C 1Q3EA 3E5QA 5LK5A 3ZXKA 5DDJ2 1HRI1 1MS0A 4XTMA 5EYXA 2C5DA 2JG8C 1H4HA 4QM9A 1MQTB 3AFGA 1IGOA 2B5HA 3V56A 2R0FA 2BWCA 2PHUA 4NMIA 1HDKA 3AKRA 4XIOA 3AM2A 2UWBA 4M3CF 3AJZA 1J58A 1LULA 4AQTA 2D5HA 4HMZA 4Q4X1 1ZA4A 3ES1A 1ULFA 2B9UA 2PA7A 3AX4A 1G9AA 2EAAA 3FLTA 1QOTA 1IPJA 1VB2A 5CU1A 3X29B 3VKOA 3NNMA 1PK6B 5A3UA 3W9AA 3AMPA 4YYOA 3E97A 2WWSA 2YYOA 1ZNPA 2CGPA 1LGCA 1OSGA 1AL0G 4LE3A 1YFUA 2R0HA 4YVWC 1GNHA 2V73A 3MW2A 2BNMA 4P9WA 1YYNA 4YZ3A 1BXHA 1RUD2 4UBHA 1X36A 1HW5A 4AGVA 4Q4V3 4O9EA 1PVC2 4C91A 3POWA 2DVAA 3TN92 4LR4A 1VBB2 1RUG3 1ASJ3 1VAVA 2DCZA 4Q27A 4F3JA 2LALA 1V6KA 1AR83 4AHWA 4JGYB 4NPRA 3WQ0A 3JD73 5DUXA 4KGQA 4B7KA 4EN6B 2VVEA 1UCXA 1WLCA 4BHPA 2GAUA 1O5LA 2I74A 3S30A 4AEDA 3OBRA 3TAYA 5H9SA 1C28A 4IV1B 3LCPA 4PCRA 2RS12 3WP3A 1J3QA 4FQ4A 1G7YA 1FX5A 3J9SA 2WNUB 4Q4Y3 3ZFFC 2Q1MA 4YW4A 4GQ7A 4JVAA 1RUG1 2XVGA 1RUI2 2VXRA 1ASJ1 1AR81 5C4WB 4ITCA 3RJ2X 1OPOA 5CADA 4M0HA 3FX3A 4GH4A 1GANA 5HV0A 5A33B 1W6NB 5CFCA 1ENXA 2ZGUA 4RS5B 4WVWA 1RL3A 1QU0A 3LSDA 1RUF3 4DQAA 5J96B 4DXZA 1FV3A 4F7ZA 1LU2A 1A6CA 1LCLA 5BNOA 3CU7A 1QXRA 2UWAA 1DHKB 4B4RA 1YUDA 4CDWA 2B7YA 2KM2A 4LHLA 4P9XA 4EWEA 2PELA 4QGMA 5T52A 1YFYA 5CAZA 1FT9A 1U5YA 4R4ZA 5DAQA 2WT1A 4MGIE 4EN7B 3OGGA 2YDEA 2WA3A 2XLFA 4I3PA 5FTTC 1PO23 5J98B 5GKAC 5L9VA 3FMGA 3VBUC 3RRDA 3MIEA 2YPJA 3R4UA 1VJ2A 2FHRA 4FPGA 4N43B 3NW4A 2GN7A 1X8EA 4OFGA 4AEKA 3RYRA 1EV12 4Q4W2 3T1LA 1DF0A 1NA1B 3ZYJB 4AFAA 1C8M1 4HPKB 2HWC1 4RQPC 1IKPA 2NN8A 4LBQA 4OZXA 4CYDA 1FPN1 4NO4A 3NO8A 1H1MA 2YROA 4D94A 4FCAA 2RS33 1ZRCA 5LK7B 3QACA 1SBDA 1R082 2FZ1A 2VU9A 5JIAA 1GQGA 3IN9A 3VL9A 2G19A 2BNOA 3ZXEA 4C0BA 3VBSC 3K48A 4LA3A 2VMHA 4GB32 4BZ4A 4XF3A 2ET7A 1BYHA 1FAYA 2C9AA 4LUMA 3UL2A 4Q26A 2GMPA 1M4WA 4BMEA 5CFDC 2BEOA 4YZ2A 1C1LA 4JRLA 4IW3A 5ERLA 5EYYA 4KU8A 3LOIA 2XBO3 2B39A 1WUVA 2XH6A 4EN9B 3CNAA 2B45X 3A4UA 4XCAA 1RINA 1LOBA 2O1QA 3WD5A 1CPNA 1WCSA 1DZTA 1B35C 1LOFC 1RUH1 1W6QB 5H9QA 1ZREA 2Z2SB 2D6LX 3E6BA 1JN2P 2BVVA 3AXEA 2DFCA 3I59B 2PAKA 5DDJ3 2AR6A 3GHNA 4IEUA 3B3QE 3C2UA 4LHNA 2LM3A 4TSVA 3WW2A 4QGLA 1ND2A 4OHXA 1HV0A 1N1TA 2E7TA 3VL8A 4BMBA 1WLWA 2P3IA 1YCIA 1GZWA 3PJQA 3BB6A 3GBFA 2ZCWA 4Y22A 4GMP1 3ROUA 3BPZA 2O0OA 2ET1A 1CAWA 3ALQA 5BNPB 1U12A 1XYNA 4B7EA 4BE3A 2VG9A 4B4PA 2WFPA 1REEA 2KA3A 3MFCA 1H30A 2A3WA 1QJY1 1BQPA 2DYCA 3NAPB 1FXZA 5C9AA 1ENQA 3BTAA 1POV1 3AKTA 3THTA 4H3WA 3TB0A 1DBNA 3ZSKA 3A0NA 4XJUA 1DQ6A 4S2DA 4M01A 3IKWA 1OA4A 1Z7S2 5EP9A 3MIBA 3VZJA 1QJX1 4HSLA 3NSTA 3VV1A 5AC92 5F1RA 3VDDC 2RMU3 1VIWB 3S7IA 2IXHA 2MEV3 2R043 1J1LA 4RR3A 2R062 5A3MA 4DZGA 2VMGA 3WHUA 2VY0A 4AQ6A 2QZ2A 4P9GA 1BKZA 4OULA 5DUVA 4MXVA 1M06G 1HIXA 3OUHA 1FOD2 1VBC3 3WZ1A 1F8VA 1GLHA 2GC3A 3CJIA 1FMD2 2D3SA 5E1RA 2R072 3H7JA 2DVGA 1BK1A 2GSYA 1W6PA 4Y1VA 3JCIA 3SLIA 3VHOA 2B8MA 5I0RA 1O4YA 4FAHA 1IHMA 3V64A 4V1PA 3ZX7A 1RJ7A 1XE7A 2XUMA 3BOWA 4WM8B 1VBC1 3R4DB 1LTEA 4URTA 3S7EA 5IATA 3UKNA 4I01A 5BPXA 2ZGPA 3AK0A 5CFCB 1QJU2 2GN3A 3ITQA 4LEJA 2A5ZA 1MEC1 4P14A 5FREA 5HCBA 2P34A 1LOCA 2CYFA 3FHIB 4AFBA 2TEPA 3FLRA 1BEV2 2IFWA 1ZZ9A 5BNOB 4HZFA 3ZXGA 5J37A 1SQ4A 3MZHA 1ZBA1 2DUOA 1SDWA 4QQ2A 1IZ3A 1OLQA 1QNWA 5LA9A 3PMSA 4CDWB 2QDRA 5EJ3A 2FQPA 5GLZA 3SITA 2I07B 1I1EA 1Q8OA 1AYM3 1DGRA 2WZR3 2PQQA 3HMYA 4G4FA 1DYPA 2AZ5A 3M2MA 5C33A 4PLOA 4JRAA 1ZYBA 3M3IA 2AUYA 1UD1A 2LTNA 3RMYA 4AE2A 4QHBA 4MUVA 1OLRA 2PLV1 4K40A 2OPKA 1BZWA 3MFAA