3KT4A

Crystal structure of tpa1 from saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
615
structure length
563
Chain Sequence
b'EEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYELYMMDDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVKSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PKHD-type hydroxylase TPA1
publication title Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 183
structure length 563
sequence length 615
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10637 Ofd1_CTDD Oxoglutarate and iron-dependent oxygenase degradation C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3kt4A01
2.60.120.1580 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3kt4A02
5DAQA 3KT4A 4ZONA 4BQXA 5L9VA 4XAAA 5LBEA 5C5TA 2A1XA 4NHMA 4NHXA 5LATA 5C5UA 3NNMA 2HBTA 4XCAA 3KT1A 3DKQA 2V4AA 5HV0A 4XCBA 5LBCA 2RDQA 2RDNA 2RDSA 2JIJA 3W21A 5L9RA 3W20A 5DAVA 4Q5OA 4XABA 2OPWA 5EQUA 4BQYA 3NNJA 3HQUA 2JIGA 4IW3A 5LBFA 2G1MA 4BQWA 4XACA 3NNLA 3NNFA 4JZRA 4XC9A 4Y5TA 5EP9A 4UWDA 5ERLA 3GJBA 4NHKA 5M0TA 5L9BA 3GJAA 4MHRA 2FCUA 2RDRA 2FCTA 5IAVA 4ZPIA 4KBZA 2Y34A 5IATA 2RG4A 4Y5SA 2G19A 5LBBA 5A3UA 3OBZA 3BVCA 2HBUA 3KT7A 5DAWA 4MHUA 4NAOA 3PL0A 3HQRA 3ITQA 4NHYA 3OUJA 4NMIA 2Y33A 4J25A 5EPAA 2FCVA 5LB6A 3EMRA 5LA9A 5HV4A 5IAXA 3OUHA 4NHLA 5DAPA 3MGUA 5DAXA 3GZEA 3OUIA 5LASA
chains in the Genus database with same CATH superfamily
2WO1A 5FP8A 3KT4A 3SCFA 3WHTA 3U78A 3DKWA 1G9FA 5IVCA 4FAHA 4XBLA 2ETEA 1CAXA 2RMU3 2WABA 4Q1PA 4N9IA 2ZMNA 2BNOA 1MACA 2R1DA 4KG0A 3EHKA 1TQ5A 3LAGA 4META 4OYUA 4Q1RA 2QQJA 5IWFA 3VV1A 1J84A 4EV0A 1NCRC 4QM8A 4TYSA 1OD5A 3AMPA 4YVSC 1D4VB 1VBD2 3NNMA 4LUMA 2V5YA 3PLQA 5HV0A 5C70A 2FZ2A 2QQUA 1YWKA 3VD5A 1J3PA 4LK7A 2ZGKA 4QU2A 1ZZ6A 2VZSA 4AQ6A 2P3IA 3AMNA 1V6NA 4OULA 3S57A 3VKNA 5J36A 2Q8CA 3DV8A 3ZSEA 2LTNA 3WLUA 2C9AA 1VMFA 4XUTA 2VZVA 5AFBA 1MZ5A 4GA9A 4KG8A 4CRQA 1IZ3A 2GNTA 1JS9A 5BNOA 1ENSA 1AX1A 4L0PA 4Z8BA 4D6SA 4Z2WA 5LBFA 1HB1A 3SH4A 5FOBB 3ZKYA 2G1MA 1S0FA 2PHRA 2XXZA 2VNRA 1GNHA 1O4ZA 1WW5A 5FPBA 2W68A 2YU1A 2DU1A 2HWB2 5G04L 1R1A3 1W9SA 5E8AA 3GALA 3I7DA 4AGVA 4JC1A 4ZS3A 2GSYA 4D8MA 5JOZA 1PHMA 2A70A 1SLIA 4XFAA 3MW4A 1X8EA 2UYAA 2C4XA 5LY1A 3H7YA 4I3PA 1O8PA 3THDA 1QU0A 4EZHA 4AWDA 4WM8B 2WBKA 4XZUG 1UKGA 2VVFA 3HBZA 5L7OB 4B4PA 5LCWL 1UYXA 3MUZ1 3B00A 1W06A 1MS1A 3FUOA 3JBG2 4QPGC 3ZYRA 4PQ9A 5E6HA 1AHSA 2V73A 2Q1ZB 4LIUA 1LOCA 1H2LA 2A7AA 2DV9A 2PA7A 3MIBA 3Q8AA 4Y4RA 3KCCA 2C6SA 3ES4A 4E4ZA 1U5YA 4OUMA 1UXXX 3C8XA 3KF3A 1NCRA 2GDFA 2QDNA 1R64A 4R52A 4YVSA 2ZEXA 3LWCA 1BBT1 1NY71 2Y34A 4Q4V3 5C3RA 1YQ6A 4UW3A 2RG4A 5EJ3A 1EUTA 1PO11 4XF1A 4D6RA 2J1AA 5LBBA 1U5ZA 4XZPA 3VBRB 3WVJA 4A42A 1O5UA 1OOPB 1VPHA 1RJ7A 3I2KA 4P9IA 2CAUA 5FYSA 2VECA 3SEEA 1PK6C 2VMCA 1FV3A 4XTMA 1RIRA 2VQUA 3ILFA 1WMXA 3IAPA 3MW3A 4UFJA 5D8AB 3FFZA 2WFPA 5FQ0B 3T4VA 4DRVA 3CJIB 3D0JA 1KRIA 4BQ4A 1X8MA 5J09A 2E33A 3K2OA 5A6ZA 3GGLA 3AP7A 1WW6A 3QLQA 4G9SB 4UFMA 1GYKA 3PIGA 3VZLA 1PGL1 2RV9A 4CDWC 4EN8B 4I3GA 1LENA 1LGCA 3IDEA 4YRDA 1B09A 2EVXA 4CP0A 2YY1A 3FHAA 2QTWB 5F8PA 2YXSA 4AZZA 3F2ZA 1RB8G 3AYDA 2HH9A 5FY8A 3KQRA 5C4WB 1LAJA 1QXPA 1R1A2 1QOTA 1W03A 2AACA 5EJZB 1ASJ1 1US2A 1SQ4A 5FPZA 1RXFA 1OKQA 1FOD1 4YARA 4MUVA 4TLFA 5GZEA 4BXSV 3E5XA 3MI8A 5T50A 2VJXA 4Q4X3 3PJYA 4E2QA 4KGGA 5A1LA 4BQ2A 1RMU2 2WWJA 4QB2A 1DGLA 4RS5B 2A3WA 5F3GA 3WF0A 4AQTA 1DQ4A 1C5IA 1NAEA 1VP6A 1JUHA 1ENQA 3D5OA 3LKJA 3AJZA 5A7WB 4CVUA 3W58A 4CP9A 5DAVA 4Q5OA 4UW6A 5FLHA 4YG3A 5BYNA 2RR13 1EP0A 1CAVA 1REEA 4XQWA 2VOWA 4QX1A 2W5FA 4COYA 3NO8A 3WG3A 1QJU1 2Y6GA 1PK6A 1XYPA 1OKOA 3OEBA 4FOYA 3E97A 1SZBA 4QXHA 4CZSA 1OOPA 2J1VA 2P17A 2YFZA 5G05L 1JUIA 5I8YA 1V6LA 4AXOA 5T5JA 2A6XA 2HKXA 2E7AA 3EB7A 4BLIA 1MS5A 1AUYA 2FDJA 1JOBA 2W87A 3NKGA 4GMP3 4OHWA 5D8AA 3B9IA 4CDWA 5F3CA 4XC9A 1ZBA3 2B8MA 4IGQA 2VMGA 4N53C 3UKTA 3I3QA 5FXZA 2X05A 1OURA 3ATGA 5ERLA 5CFCC 3N36A 1OSGA 1K5MB 5DDJ3 1JYCA 5IW0A 3WP3A 5C6CA 1ND2B 1SPPA 4HVRA 1CAUA 1R083 2CWSA 3AP9A 4JGZC 5L19A 4IE6A 1BXHA 1AYM2 3ZR6A 4QU1A 4P9GA 2ARAA 1VBD1 2Y6JA 3HT2A 5FCCA 3IDAA 1W0NA 2G9ZA 1MEC3 1Q8SA 3IPVB 1HV0A 5I91A 4NIGA 4P14A 1OH4A 4M01A 1H4HA 4Q4X2 4JHZA 4LKDA 4X8PA 4B8EA 2OX0A 3E6DA 4RS5A 4NE9A 3BTAA 1OA4A 1PZ9A 1V70A 3WQ0A 2D3SA 4H14A 3URFA 2F4LA 4E9KA 2CDPA 1QY4A 4K21A 1XE0A 4FPFA 3M1HA 4MVTA 3WNKA 4S2DA 1YLLA 2Y33A 4YG6A 1KJRA 2Z69A 3HPNA 5KBFA 1MS4A 2K0GA 1Y9QA 5FYMA 1QHDA 3WNPA 4AVBA 5IK8A 2HWB1 5AFEA 3GBGA 1CD3G 1AXYA 1APNA 1ULGA 3M3CA 1ZRCA 4CXWA 2H0BA 3AZVA 3KHCA 2XL7A 2WKKA 5E16A 4QQOA 3T0AA 4N9HA 3D3AA 1UIKA 2XPJA 4IXLA 3JD73 5DXDA 1SBDA 5FYTA 1YNAA 2WL1A 5J37A 3U10A 1H8VA 4LMFA 5IVEA 4LORA 2WFF1 1XNBA 3LFIA 1POV3 4R4ZA 3BYWA 3JBG1 4XOGA 1CPNA 2RS33 3WW1A 2HYXA 1EY2A 5ACA2 1EV11 1X82A 1EAH2 4FOQA 3ZPYA 1MVQA 2XOMA 3AMQA 4LLOA 1BJQA 4JGZA 4Y1VA 3ILRA 3RWKX 4NRPA 1O91A 4YZ3A 4AI8A 1K5MA 4CCJA 1VBB2 3RG0A 1PX4A 2RMU1 4EROA 4IEYA 3VD3A 5C5UA 3V64A 1R082 1RL3A 3RVHA 4FQZA 3UL2A 3IKWA 4FPCA 3VKLA 2DU0A 5TSWA 1O3TA 4XCBA 2FDIA 5HCBA 4V2VA 1OLMA 4MXWB 4D6QA 1JZ3A 1YI7A 3N7LA 4TLGA 5KHJA 1UZVA 1DZRA 3RZJA 4QKDA 1QJX2 5EQUA 1UMHA 2D93A 4IE5A 2ZZJA 1AXZA 3NRUA 4LKFA 4UW5A 2Q8EA 4B29A 4MLOA 4NIHA 3ZFEB 1VALA 4I02A 4BXFA 5FZIA 3RGBA 1VBE3 2BZDA 1OFNA 3ME2A 5JZGB 4KQ7A 4D3WA 1IG0A 2VMEA 4IGPA 4RHV2 3VDCA 1ZNPA 4OHZA 1JZ5A 3RZLA 1O3QA 2E6VA 3TBDA 2JE9A 4Z07A 3T4HB 1ACCA 3TN93 4OLLA 4A6SA 1VRBA 4QX2A 3BIWE 3IWZA 2P1BA 2I2SA 4XFGA 3I97A 2DCYA 1UW8A 3K4DA 4FPHA 4DUXA 3SEPA 1R1A1 1IS4A 3E5UA 3OGGA 2WZR3 4L8QA 5FUPA 1P8JA 5JR7B 1YHFA 5FXWA 5L73A 5A7NA 2XVGA 3N4MA 4AHWA 3JD72 1RGSA 4BZ4A 1YEWA 4WVWA 1RC6A 4Q0VA 5FOJB 2OYZA 2DWRA 2RS32 3ZYHA 1VBC1 2PLV2 1UO9A 3DPRB 3P3NA 1S0JA 1ULDA 2CGPA 3ZFGC 1H2KA 4EQVA 5FJHA 3NV4A 5KC6A 4OHYA 4ARYA 1PM7A 1NYWA 2GAUA 2MEV3 3DYPA 3VBFB 3ZSLA 4GALA 2BFUL 4JKMA 5A3NA 2QQOA 3B7MA 2YFUA 2DVFA 4Q4V1 1NKGA 2OPKA 4HVOA 4MYEA 4IERA 4CDQC 2VY0A 1W8ZA 2ZGPA 3SNMA 3I8TA 1UY1A 2VCCA 1RUG3 2Y6LA 4GH4C 4UFHA 5A6QA 1M06G 2OZJA 2VO5A 1A6CA 5KWRA 3ETQA 3I3EA 3AKQA 2ZBJA 5FLJA 2IVIB 1W0OA 5SV5A 1A34A 2YG0A 1TEIA 3OD4A 1W6NA 2BRTA 5LA0A 3VL8A 3THCA 1CIWA 4FTBA 1W6PA 1JYWA 3HVDA 1VAVA 5C9AC 4NOTA 3NV2A 1IGOA 1AL0G 1VBE2 2JKBA 1RUE2 1RUC2 2VPVA 5JZGA 2B5HA 2GN7A 2WNUB 3O1UA 4IESA 5JUVA 3OBTA 3PUAA 4OZXA 2EAKA 4HPKA 1E57A 1QMJA 2OQ7A 1LU1A 1VB4A 4MH0E 1BEV2 2GH2A 1GZTA 2QCSB 2ZEWA 3K75B 3ZM8A 4A7KA 3TN92 3DEMA 4C1XA 5JAXA 3H3LA 1X50A 4CCEA 4IEWA 5FYYA 3HN1A 1IQAA 2VOKA 4EE2A 4O9EA 4F83A 1W04A 4XETA 2H0VA 1AR63 2WR9A 1WA6X 3N7KA 4WM7B 2QQKA 3SXWA 1W6QA 5C5TA 1IHMA 2WZR2 4QHOA 2C5DA 4FPYA 5B2GB 3PVEA 4FPGA 2JG8C 3MICA 4HETA 4BH9A 1EYBA 4XCAA 5C71A 4Q4X1 1W8WA 4GWIA 1UCXA 1NQDA 1W8HA 3S30A 2RDNA 1GZ9A 3G6JB 2JIJA 4JGYC 2XWBB 4QKFA 4UXAA 4LE3A 1X36A 1O7FA 1LHVA 2XJUA 1H6XA 2DVBA 3PTRB 5A7OA 4CDQA 1S0IA 3T09A 1G6NA 4IEQA 4NROA 2C1FA 2RR11 3T08A 3M3EA 2X10A 3J7LA 1J58A 2VULA 4JRAA 2G9GA 2RM21 2YROA 3H42B 2VOTA 2A5ZA 2YYOA 3HNBM 1GNYA 4U2AA 3T2PA 1JU3A 3U1XA 2DVDA 2WN3A 1HW5A 2J1SA 2WIIB 5IFTA 3NQHA 5IVVA 3LOBA 3VHOA 2PHTA 5C9AA 1N3OA 2XHKA 5FO9B 1XB9A 3LSEA 1YO8A 5EP9A 2XONA 1MPXA 2DBNA 4QD2A 5FYUA 3J8F1 4GMP1 4KWJA 1OVPA 1CJDA 1ZBA1 1NA1B 3P3PA 5FZBA 3N9LA 3IT8A 1X9TA 3CF6E 4ZS2A 5FMOL 2FCUA 4CCNA 3SC7X 5GLUA 2ZX4A 4P9LA 5DDJ1 2JDHA 1GSLA 3IN9A 3JB8A 3HIFA 2IXHA 1PGW1 2OUJA 2R30A 4AVTA 3MEPA 5C8CB 1WLTA 1XBFA 2AH2A 1RJ8A 3ZYPA 1V6KA 2QE3A 1H1AA 1RHI3 4HXCA 3I54A 4M3CF 1Q8QA 3Q8FA 4KBZA 4ZPIA 1AR62 1NLQA 2QFEA 2ARBA 4Q4W3 4A45A 3JB4C 1MEC1 2P5BA 1VBA2 4JGYA 5C3QA 2D6LX 5FZDA 2Y38A 4K8RB 5DAWA 4YW7A 3SCGA 5JLVA 4K7JA 2ZEZA 2WDBA 4WVMA 4DO0A 2WWSA 1DYKA 1COV3 1S2BA 1WBFA 4ZXKA 4L97A 1ALYA 2QQPA 1SBEA 3R0RA 1ZRFA 2BEOA 3B9CA 1XSRA 2WT1A 1RUI2 4XDPA 1RTVA 4LPLA 5CKQA 3VBOB 4IV3B 4XMAA 4YGEA 1W2UA 5FWEA 1MS8A 3UKNA 1RYYA 3WDXA 5IVFA 3RZMA 4E27A 1O59A 2JG9B 3GBWA 2Y60A 3WP4A 1QJY3 4GKYA 4MG2A 1GP6A 1H1IA 3VDBA 1ZRIA 1WBLA 4PIYA 4PBOA 4A4AA 3B5LB 4BQ1A 4IL7A 1FNYA 2NN8A 2XBO3 3M2MA 3BPZA 3WNOA 3VZKA 3EXUA 2I45A 3W5MA 5KHHA 3KVBA 3WDYA 1IKQA 2R042 4PJYA 2VG9A 4BQXA 1UOBA 1QDCA 4DXRA 3UK9A 1LHOA 3OD0A 5FMBA 1Q5OA 3WQ7A 4ASLA 2QKDA 3GCWA 1I5PA 1O5LA 4ARXA 4FOVA 2BU9A 3M4FA 5A7SA 1QOOA 4CP1A 1IS5A 1OH3A 4FPJA 1STMA 5LATA 4EN6B 3IMMA 3IIIA 1NOVA 2HBTA 3ZYFA 1RUJ3 2CGNA 1HN1A 1JODA 3EO6A 4KNCA 3OPZA 4RN5A 4AI2A 2BYVE 3KCXA 2GNBA 2ZAAA 4CP2A 4AAXA 1CVNA 2ORXA 3O1SA 3ES1A 4DIQA 5C8CA 1G9DA 2DURA 3W9AA 3GXUA 1RHI2 1Z7S3 2D6OX 5I0TA 1QXRA 3T30A 1A3KA 3MW2A 4IEZA 3C7OA 3VHNA 1D0HA 5FYZA 4H2AA 4GB33 3ZSKA 4Z82A 2MNGA 3WNNA 3U4SA 4GZ9A 1DQ6A 2IUWA 2ZX2A 2PELA 2YBPA 4DS0A 2D6MA 1UYZA 3WOGA 1C57A 1SFPA 3R4SA 3KV4A 5A70A 2P37A 4NRQA 4XJWA 4LO6B 1COV2 1GZCA 5FFOC 3Q8BA 4PF1A 4Q26A 4CTEA 1CJPA 1H8TB 5IJRA 2ZGLA 1GZWA 4K1YA 4GWMA 2B46X 2VZRA 3BCWA 1LULA 1WW7A 4HN1A 3T2OA 3PUQA 1XXNA 3VBOA 3TN91 1ZBE3 4IEPA 3I2IA 2WYFA 1E5RA 2VVEA 1LOAA 2B39A 5K0UB 2NMOA 2A73B 1HN0A 1OUXA 3KB5A 3RZGA 2WZR1 4AFAA 2J1UA 4K20A 3ELNA 4BB3A 1RUNA 4BQ5A 2JDAA 4QT6A 5IAVA 3UNPA 2ZTNA 1QH7A 2YMZA 3TAYA 4BK4A 2VNGA 3N9MA 1EUUA 1W8TA 3WQBA 2OS2A 1HDKA 3OF1A 2J1TA 3HNMA 2BVVA 1RUF1 5I0DA 4QDSA 4AEMA 1KS5A 2RJKA 1YFUA 2SLIA 3CNAA 3C3VA 4Y5SA 5BUVA 1OLRA 2E26A 2Y6HA 3H8XA 1CAWA 2GNDA 2ORZA 4XTPA 3PTYA 2P3JA 5ABJB 2WNVB 5F5AA 3OCPA 4LBMA 2MEV1 5FO7B 4ZZ8A 1QXJA 3K4ZA 1Y9GA 2CTVA 1CIYA 3TB0A 2VD7A 4QX5A 3NJXA 3OG2A 1TG7A 2LS6A 3MIHA 4YW3A 5JVVA 3LA7A 3RRDA 3MPPG 4QDRA 1POV0 1RUG1 1S0GA 4COWA 5FZ4A 3LDBA 1TNFA 4AFBA 5FZLA 4GB32 2GALA 4ET7A 1KFUL 4HZFA 1PMJX 1MQTB 2KM2A 2VXJA 1YJKA 1YI9A 4YW6A 4P08A 1UL9A 3UV9A 4XJUA 3ZSMA 1JZ7A 2N7GA 1S0DA 4URAA 1I3HA 2K2SA 4LBQB 1PO23 2ZGMA 4P02B 3WF2A 2WAOA 5HI0A 2O14A 2ZXQA 4FQ4A 3VBSC 5FREA 2FDHA 2BNMA 4IV1A 3BI3A 1WMEA 4MGSA 3RFRA 4NUBA 2WQ4A 4LHKA 4OI4A 1BZWA 2A1XA 1N1VA 4XJZA 1W2AX 1OQDA 5FZFA 1RUD1 2VU9A 2VUJA 2JDNA 3B94A 3AFKA 2OT7A 2HWC2 2OW4A 2CDOA 4W8JA 5LBCA 1ULFA 2UWAA 1R1ZA 2HWD3 3NV3A 1H4GA 3N9QA 2VZ1A 4LHNA 1PZ8A 1WUVA 3LDRA 5IVJA 1Q8OA 2YC0A 2BGPA 3BOWA 5DZEA 3ZSJA 2UURA 4YGCA 2QBXA 2W1QA 3RZHA 2EALA 5A3LA 1SCRA 1W0PA 5JPNB 1XU1A 2WS93 3SH5A 3P1IA 3HN3A 2QQLA 4GJYA 3KMHA 2R0HA 3I3BA 4AEDB 2VM9A 2RS53 2UYBA 1SLBA 2GMEA 1JI6A 3BIEA 2WZEA 5DN2A 5LRSA 3AJYA 4S2HA 2WJSA 1C3HA 4P9JA 5FKCA 1I1EA 4QWNA 1DCSA 1DLLA 3LCPA 4AVSA 2X53S 2XG3A 3A4UA 4NR1A 2YPJA 3K46A 1FXZA 3VD9A 4YM1A 2WT0A 3PNAA 2YGLA 5CVRA 4PIXA 3VHPA 4BQ3A 1W2TA 2CWMA 4NHKA 5L9BA 1SDDB 3GJAA 1AYN2 4NO4A 2JDZA 2W52A 3WCRA 4AEJA 3MLLA 1JYIA 3PMSA 1VMHA 4B4QA 2ZGNA 4GWNA 1NCQB 4QX7A 1ND3B 3VBSA 4S2FA 1PO22 4BDVB 3USSA 3PJQA 3IB3A 4YGBA 2KD7A 2Z79A 4XDOA 3NV1A 3UKVA 5KHIA 4BIFA 3T1MA 2V09A 1F9KA 1SLCA 2AEZA 4P5YA 4J6GA 1CZVA 2Y0OA 2XQRA 3GBFA 5CFDB 3GHNA 2R1BA 3QOPA 4Q8KA 1RHI1 3FJSA 5A3UA 2VNOA 4Q4W1 4N7IA 4Q4Y2 2CAVA 3FL7A 1DQ2A 3PL0A 1C1FA 3O1RA 1RMU3 4NHYA 4P9YA 1NLSA 2VW2A 2HWD2 4RGGA 4ZHNA 4KGQA 3V0AB 5BPXA 1LESA 2DTYA 1QF3A 4NPRA 2E9QA 1BCXA 4PF5A 4WM8C 1W99A 5L7OC 5FP7A 2PAMA 2WS92 3MV01 1XPWA 3WF4A 1YCIA 1V0AA 3R4UA 3U14A 2B9UA 3I2HA 2Y26A 4ASKA 4M3CE 4A2UA 2IXJA 2RS52 2Q30A 2JD4A 2RS12 1CPMA 3K3OA 5GM0A 1UU5A 1XNCA 5CYYA 5FKBA 3UGGA 1QJY1 3T2TA 1JU4A 2DUOA 4WVZA 5E88A 4RD7A 3AC0A 4HKOA 2ERFA 5EJ1B 5T5OA 5T54A 3ZIXA 3H3UA 1AJOA 3RQ0A 3WINE 4AQ2A 3K48A 3OY8B 5F3IA 3HD8B 2XBO1 2ILMA 1QJZA 5LBEA 3C7HA 3RYPA 3VBRC 2JX9A 1OOPC 1WGPA 4AVVA 4RR3B 2WNOA 4AG4A 4ZU5A 3AZYA 5CKNA 1W8NA 1IS6A 4M0NA 1O4YA 3KF5A 3DN7A 4Y22B 1OBNA 3H8OA 2D98A 4MZUA 5D8AC 2IWGB 4XFFA 3CJIC 1BVVA 3T0DA 1YQ2A 2R49A 5BNPB 2TEPA 3TNPB 5F32A 1N1YA 2VOVA 1RUJ1 4TWTA 4XABA 5DZGA 2FD8A 3U37A 1D4M2 1IS3A 1AYM3 4QPWA 2PHFA 2VTXA 3WDUA 3E6BA 4LO4B 3ZXEA 4EWEA 4FBFA 2PXJA 4EJRA 4KI5M 1GICA 1LNSA 2AYHA 5CFDA 1ZVFA 3D6EA 1NZCA 3AYAA 3NJVA 3LGRA 1Z7S1 2VR4A 5HCHA 4WBBA 1XU2A 3A0KA 3CHXA 1MVEA 1RUH3 2WSVA 4JX0A 2WA3A 3ZPOA 4DUWA 5FPUA 3NAPB 4BQWA 2GU9A 4WM8A 1KEXA 2HYKA 4LA2A 4CA9A 5BY5A 3H1WA 5L7OA 3BB6A 4COZA 1TZOA 3OBAA 1RUOA 4Y5Z0 2IFWA 4XQ4A 1LHUA 3ILNA 4O7XA 3B02A 1QKQA 2J7MA 1AL22 4RS5C 3ZN6B 5FZ3A 5JIUA 2B4KA 2IXKA 1NQJA 4AHZA 2XLFA 1OHFA 1VIWB 2QNKA 5CU1A 3WDTA 3O0VA 4D7SA 4CU7A 3D82A 3MF6A 1DQ1A 1HIXA 1ZBE1 2GNMA 4LO8A 2RDRA 1BMV2 5F3EA 4LQRA 1XRUA 5ANNA 5K9YA 5LA1A 2PHUA 1Q8PA 3VBRA 1NZIA 3BUCA 3V56A 2WO7A 3AKPA 2FDGA 1POQA 1H2NA 1U12A 2R061 3AVSA 1XE8A 2A6VA 5FYBA 4RSUA 4EWAA 4BU2A 3OY8A 4PI0A 2VW1A 4NIIA 1NXD1 4LOSA 3UJQA 1FMD3 2YC4A 3S6PA 3VUOA 4JRLA 2Q8DA 5FQ0A 5IATA 3E1F1 3FWEA 5ACA3 3CJIA 4FP2A 1J3QA 1LJ7A 2W3JA 3H3ZA 5KXEA 1PVXA 1DU3D 1EAH3 2JE7A 1DYOA 2ZMKA 3KT7A 2GC0A 1NXMA 4IEVA 1ST8A 1C8M2 2EF6A 2OUHA 3FE5A 3Q8EA 1GNZA 4Y22A 2NP0A 4Q0SA 5JSOA 1VBB3 2RVAA 2OKXA 1HKDA 5JOYA 1Y9MA 3VD7A 1OPMA 3OB8A 2JEMA 2A6WA 4DINB 4EN7B 1QWRA 4XF9A 2R0FA 2Z2SB 5CKMA 3WSOA 3OEAA 4N53B 1K5MC 4KU7A 5C4WA 4AFMA 5F5CA 5CFCB 1PVC2 1ND2C 3I2JA 2ATFA 1GU3A 5F39A 4AF9A 4YVWB 4LBKA 1QJX3 1HB3A 3FLTA 1UZ0A 2Y6FA 4HLTA 1ZZ8A 3EBRA 4FPLA 1RUH2 3WQ1A 1DIWA 5CNAA 5LK5A 1HQNA 3NAPA 4RL7A 3NKTA 4PI2A 1AR83 4K1ZA 4R8HA 2WSUA 4NJ4A 2VQTA 3OUIA 3O1OA 1N3QA 5F5IA 5BXXA 4OHVA 4QMAA 3KSCA 4RHV3 2ZX0A 2CHHA 3POIA 3ZFFB 2ID4A 3ZXJA 2A75A 3IDBB 4DNYA 5A7WA 2XL9A 3FLRA 2B42B 1AR72 4GIQA 5JSRA 4YGDA 3ECQA 1ZZCA 5FZGA 1IPSA 2G9FA 3PURA 1DZQA 1TME2 5D1IA 5EFUA 5FY9A 5FZAA 3W5NA 2WO2A 1DDLA 4HFSA 3KWVA 5FPVA 3KGLA 4F3JA 5C3PA 2B7YA 2O8OA 4XFCA 1AX2A 1D0GA 4YM0A 5FZOB 2D5HA 2V4VA 1CGPA 2WA4A 3H8RA 1SLTA 2WNEA 3A7QA 1FMD2 1K42A 2VZOA 1V6OA 2PLV3 3ACLA 5LA2A 5A32B 1KJLA 2R6QA 4LHSA 3TWIA 5IK4A 4OVEA 1UAIA 1HV1A 4JCKA 1UD1A 4M3CB 2VBPA 4PLMA 1AX0A 1FPN2 1ND2A 2BQPA 4XACA 1OXCA 4RGKA 1B35B 2QZ3A 2RS51 3H1YA 3NNLA 1GQGA 3G7DA 4MGZE 1CZSA 2NLRA 1S55A 5A1AA 3U75A 5FZ8A 4UWDA 4QPIB 3WW4A 4DRRA 1W6OB 1Q56A 4QGMA 3IPVA 3KD4A 4AL9A 3JXSA 1TNRA 4IDZA 4XXPA 4NIAA 1QIQA 1U5IA 4GD4A 5FYCA 2CU5A 4HK8A 2AENA 3FC0A 1AR82 3O12A 4CCCA 1G86A 1JH5A 1DGWX 2HEVF 1LRHA 1RUC3 1RUE3 2XJVA 1KD7A 1XNKA 4ORFA 4Q27A 1PIV2 5HBAA 5HXMA 4HKLA 3FLPA 2R072 3AP5A 3O1VA 1VRH2 3ZFEC 3MLJA 5H9QA 4BPZA 2D44A 3AL6A 2ZGUA 4PDWB 1BEV3 1US3A 2EIGA 4YZ5A 4C0HA 5JZGC 2W1UA 2JKXA 2FDKA 1W3XA 1N3PA 5CZKA 3P5BA 4LBJA 4DQAA 4XQDA 3UETA 3OBZA 4JDNA 4Y3OA 4NN0A 4PQQA 3OSDA 3VL9A 4CEYB 1ONAA 1X33A 1VJ2A 1W2OA 2BOIA 4MGKE 5FY0A 1WA4A 3VDDB 1G9CA 4XUPA 5JI7A 5FYIA 3O14A 4I2OA 3O1MA 2ET1A 4OI2A 1RMU1 4LKSA 1TMF3 5HV4A 3OYWB 4FSJA 4HG6B 4B3NA 2W94A 2D6NA 2ZHLA 3AKTA 2VUDA 1HLCA 3PU8A 1LTEA 4C0BA 3SKJE 2RHPA 1HB4A 3N9NA 1WCUA 1LHNA 2JB4A 1UZWA 4BMBA 2QUOA 4IEXA 3RYKA 4IQPA 3POYA 4Q2FA 5F2WA 1ZM1A 3DPRC 1C8NA 2UU8A 5HPOA 1OPOA 1QJEA 2ZHKA 3POEA 3T2QA 2GN3A 5DAQA 4UFIA 4MGIE 1IPKA 4Y1ZA 4KU8A 4AI3A 3SITA 3KLSA 3VBFC 1UY2A 4BHPA 2X8KA 2BW8A 2YPDA 4MXWA 4UI9L 3LFMA 1HQWA 3UGHA 5I8TA 1W90A 5B4XA 1ULCA 2E32A 1W8FA 4JHTA 2CY6A 4QQHA 5FK8A 1WD3A 3MFCA 1AR93 2P2KA 3KT1A 3ZFEA 1YIPA 3THPA 3HT1A 4FFHA 1Z0HA 4OCTA 4GH4B 3MO4A 1JMUB 1G9AA 4W6YA 2RDSA 2ADDA 2DBIA 4XDQA 3W21A 1JZ8A 2WINB 5L9RA 4DUVA 3SQOA 2OIIA 3I2GA 3FBMA 1OF3A 4CDUB 5DUUA 1QGLA 4RFT0 2WNUC 3FHIB 3P6BA 2PMWB 3LPGA 4CDXB 4H7MA 1W6MB 1AYM1 3ZN4A 1LODA 1IPJA 5A7PA 4CU8A 3LEKA 3PIJA 5FXVA 1UU4A 4Q0UA 4CUCA 5CAZA 5A33B 1G9BA 1UIJA 2YHJA 3ZO0B 2JDUA 4XAEA 1VBA3 4J1WA 1RUH1 2WO3A 3RYRA 3SISA 2D43A 2EIDA 4WM7C 3PU3A 2AUYA 4P9WA 1S0EA 4FXKB 3WZ1A 1FATA 1TMF2 1QNYA 3WNMA 4HT1T 3FMGA 4CCOA 1IKPA 3CZUA 5J48A 4F8AA 5LW9A 1DG6A 1NX9A 1R093 2HWF3 3LSDA 4LIVA 1JZ2A 2PQSA 3DPRA 3GM8A 4YG0A 4NRMA 1RUI3 3HMYA 3HOBA 2JG8B 3O0WA 3CEWA 3WDVA 5JCTA 1C4RA 3VBHB 1SFYA 3VBFA 2FBEA 5AC92 3SKVA 1F4HA 1DZTA 3VDAA 5IFPA 2MHFA 2W92A 4UW4A 4OZOA 1F5FA 3RMYA 4XJ9A 2PHXA 4XHXA 3E6CC 3J7NA 5LZ6A 3ASIA 1FT9A 4AW7A 1OVSA 1JTZX 3WUDA 1FI2A 2QQMA 1WZXA 3WR0A 2J42A 2GC1A 2R043 2VE1A 5KHKA 4CXXA 3BODA 2VBBA 4RYDA 5I0RA 1FMD1 2B45X 3GZTB 1AR92 2Q0AA 2WUHA 5GLZA 2BGCA 5ACA1 3H8UA 3OOXA 4AK3A 2TUNA 3HQRA 1F2NA 1UY3A 4B7KA 5JXGA 1EAH1 1HRI2 2WNUA 3DL3A 2OQ6A 2I74A 2R7EB 1VBB1 1QDOA 1ULEA 3OGVA 4IE7A 4X6QB 2QQWA 1NA1C 3O0XA 5FP9A 5FZEA 4E4HA 1R081 3AP4A 2DF7A 4FFIA 4GXLA 4XJAA 3S0MA 3IMNA 2ZACA 3I3MA 3A21A 1NE4A 1V00A 1X9PA 2AZ5A 4N7UA 4AHXA 3JZVA 1BLZA 4CDXA 4NHLA 3T1LA 4D0QA 4PT6A 1VMJA 4N43B 4WM7A 4H7LA 3ABZA 1KS4A 2ENRA 2E31A 1F15A 1QJX1 1L7RA 5FZ0A 5C8CC 1OFSA 2XJSA 5F6LB 1NLRA 4W65A 1L3JA 1WD4A 2PQQA 3ORJA 3VB9A 1CESA 4Y1XA 1AR81 4EN0A 1CX1A 1LGBA 1OLQA 2X5IB 2WC2A 5H9SA 2VCBA 1MZ6A 1R092 2Z4FA 1XE7A 2HWF2 1XNDA 4RHV1 2AEYA 1K45A 5JOXA 1ODMA 1QOSA 1WW4A 4RA0A 4NHXA 1QQP2 2LUWA 3AFGA 5IVYA 3ZKUA 4MGTA 4MX3A 5LEJA 2DFCA 4K3UA 3LQCA 3TOJA 3VLBB 3GDBA 5GZGA 4CYDA 1XNTA 2RDQA 3HR9A 4DZGA 5E89A 3JUUA 1DQ0A 2E7TA 3VBOC 2ZZQA 4IV3C 2DCJA 5CIRA 4ATEA 4FTEA 3AX4A 3CBNA 4XFIA 1X7NA 1YJLA 2JG9C 1UWWA 4QXKA 3JD71 4K8FA 2EXKA 5FMDA 1N1SA 3ZMOA 1L7QA 1WKYA 2JIGA 4XBQA 1JW6A 1POV1 1BBT3 1XOYA 2RS31 2VVDA 4C90A 1O3SA 2PLV1 1JXNA 2EXHA 3MIEA 3PHMA 5KXCA 5GZFA 1NA1A 1WWYA 2JDKA 1OQ1A 2GP3A 2VZPA 2EIBA 1GWLA 3MYXA 3Q8CA 4FPOB 4XHBA 2DUQA 4YWAA 2WZ8A 3WP6A 1GOFA 3RZZA 4JZRA 5IHRA 5DABA 4XUNA 1YRZA 4NPMA 5DZFA 3N3HA 4YPJA 2WAAA 3K77A 1GOGA 3M8LA 3FHQA 2VZTA 2BTVC 4OUEA 1AF9A 4RQPB 1JOPA 4MHRA 5IK5A 2F4PA 3GZAA 2V5DA 3NVCA 5BNQA 4UFKA 3L2HA 2BBAA 1LEDA 3WT3A 5JWPA 2XHNA 1IQDC 2Q5TA 2ZGSA 1UZZA 2KR2A 4JV4A 3QD6A 4JKKA 3O7OA 5FY4A 4BYYA 5A6YA 3UJOA 1AJKA 1VBE1 1RUE1 1RUC1 4HVQA 2ZEYA 2X5IA 5JMCA 1ULOA 1FV2A 1FAYA 2NZ9A 3RPQA 4BM8A 3ZOIA 2XQXA 2ZKNA 2W1SA 1ODNA 3B01A 3R4DB 2ZPXA 1BEV1 3MPBA 4BOWA 4JQTA 3FUQA 1L7LA 2W91A 4FPEA 4IV3A 4MHUA 1W8OA 1H8TC 3WY6A 3O1TA 1V6IA 3H9AA 2JG9A 3B3QE 3WF3A 3BTXA 3K51A 2YDEA 4IV1C 4NMIA 3TRSB 1HXS3 1VAMA 4LLFA 4UFLA 3WX5A 4DEVA 3VBUB 5K4LA 2VUAA 3EMRA 2HWC3 1VE0A 2JDMA 2L9LA 3N7MA 4I0AA 3WHUA 3D4KA 2VL4A 5K0UC 2F6BA 4ITCA 3DUIA 5J98B 1LB2A 4XMIA 5IAXA 2J1RA 5FBZA 2GZWA 4I01A 2GH8A 1TMF1 1D7PM 1BBT2 1NY72 3PUIA 4KH9A 2JJ6A 2QJVA 3EJKA 3EQEA 1QJU3 2JDYA 5DAXA 5GKAC 3AMMA 4LO5B 3VGIA 3ZXAC 3POBA 5IUQA 3M3QA 1UY4A 3QCWA 2FDFA 5BNNB 2VZ3A 4YW2A 5L9VA 3WNLA 4HOOA 4E4DX 1NG0A 1SLAA 4P5HA 2D5FA 3DXTA 3POJA 3RMXA 4EWDA 4YSFA 2PN5A 1T6GC 5ABJC 3U4XA 2JB8A 1UX6A 4BA6A 4DPNA 3PVNA 3VZMA 4W6XA 4KWLA 3VZJA 1PGL2 1GR3A 2D6KA 1ZZ7A 1CAXB 1AYN3 1U5XA 4JVAA 1OC1A 2BWCA 1AR91 1O4TA 4KBBA 1UN1A 4JDMA 4SLIA 5EWSA 1H8TA 2YBKA 2VMFA 3S7EA 3NNJA 1ASJ2 5FZHA 1FOD2 5JDBA 3SHRA 1DGWA 4AR2A 4AFDA 4E8DA 1YQ8A 2RJ2A 1H0BA 2GMMA 2Q1MA 2VAUA 4HSJA 4XYXA 5FV3A 1JYNA 1F8VA 3ACHA 3VKFC 4M4PA 4LTAA 4ZZ5A 4RFRB 1AR61 1HXS2 5K0UA 4CCKA 2ZX1A 4UYBA 1J59A 4Q4Y3 3J7HA 3VBUA 5BNOB 4L2NA 2WLQA 4Z1VA 1VBA1 4MSVA 4SBVA 2WQ8A 4A3XA 4FAGA 1T6BX 4IGOA 2KA3A 1I9RA 4FI9A 4R9BA 1Y7BA 4NVPA 3GJBA 3OPTA 1JZ4A 1LOGA 3MLKA 4NAMA 5FPLA 5M0TA 4ATFA 2SBAA 2ZABA 4QHBA 1R091 2HWF1 1QJU2 4XBNA 1W28A 5F37A 1C5HA 4I0BA 1RUI1 3OPWA 4M0HA 2EXJA 1OD3A 2AREA 5ABJA 5IT6A 2WZPP 2WNVA 1KGYA 2RS13 2XUMA 3LA3A 1OT5A 3MIGA 5A3OA 5JR2A 3AK0A 1ZREA 4D7YA 1XNAA 3ZDVA 1LCLA 4AEDC 1LHWA 5LY2A 3CKHA 1JOJA 1KDKA 1F4AA 1YFYA 3JQWA 1HRV3 3LEMA 3USUB 3L2YA 4ES9A 5JSPA 1TVGA 5KC5A 1SG3A 4NWWA 1MQTA 2R041 3ZDSA 1V9U3 1NCRB 3Q9OA 4LBNA 1DYPA 4YVSB 3RNSA 2W0XA 1Y3TA 3BU7A 2E51A 4AEKA 3MIDA 3HEIA 1K5JA 2PHDA 2VW0A 4XIOA 4LBQA 2Y6KA 1PX3A 1KITA 1S0BA 3TEYA 1NCQC 1OLME 2EIEA 1D4M3 1ND3C 2VMHA 1DBNA 2W1WA 1W39A 2WQZC 4QQLA 1YQ5A 4OQ9A 5SV8A 4GJZA 1J1TA 1S2EA 3HBKA 1XQNA 1QNWA 3QBQA 4GQ7A 4XF0A 3CQOA 2HJIA 2Z42A 3R05A 1PMIA 3I2DA 1DQ5A 1SHWB 4LO7A 3BOPA 1J1LA 4K40A 5FYVA 2GP5A 1SACA 2DVGA 2NQYA 3AZZA 3WW3A 3E5QA 5CFDC 3ST7A 5I0SA 4ZONA 3S5AA 1YC61 4O9GA 4XAAA 1OA3A 1Y4WA 4HBNA 3N7JA 4Q29A 5DQ0A 4LNVA 1SCSA 4C1WA 4HKWA 4P9XA 1ZA7A 2NYYA 1GQHA 2QQIA 4NHMA 3CJXA 3MIFA 1COV1 4ZY9A 3RI9A 5HCAA 1LECA 2C24A 3IAQA 5I8SA 1AL23 4LOTA 4AI1A 4WZCA 5GALA 2XKOA 2BBVA 4PCRA 4GWJA 4AI9A 4YNIA 1S1AA 3KQ4B 3HAGA 2VXRA 1CONA 4QPGB 2HEYF 4AEDA 3W20A 3WF1A 3VN4A 4Z92B 3O5SA 5JXHA 5K7PA 3CMGA 5FZMA 5CG9A 1O6UA 2WFF2 4QXCA 3ALQA 2BP6A 2XWJB 3JQXA 1EV12 1HQLA 1VBC3 2CNAA 2ZX3A 3NJYA 5APAA 1LU2A 3WG1A 3ZIWA 3ZXKA 4DY5A 4QQPA 1HRV2 4URTA 3USUA 4TTGA 1JHJA 4CP9B 4BE3A 1V9U2 2Q1FA 4FOWA 1CAVB 2RMU2 3OBRA 2W08A 4F7ZA 5FR3A 4B7EA 1CWPA 3IIAA 3NNFA 1C8M3 2BOJA 1NCQA 1ND3A 1AZDA 4I0WB 1PK6B 3U07A 4RR3C 3FBYA 4DFSA 5EXOA 4XF4A 2QDRA 5LRRA 4B1LA 3CLPA 4XPVA 5CB7A 4ASMB 4IE0A 4YW4A 4A44A 2IVJA 3CL1A 5A3TA 2VQAA 3RSJA 1H2MA 3DECA 2DCZA 3AZXA 4XURA 5BNPC 1PVC3 3ZYJB 5EYYA 4CDWB 2A6YA 3MHZA 2W47A 3ZYGA 4FXGB 1W9WA 1K12A 4ISRA 5DUWA 1UZYA 3PUHA 4OMCA 4QB6A 5C4WC 2A3XA 3PDQA 2FMDA 3L9JT 3NW4A 3AB0A 4GB31 4QX3A 4FTSA 2VTXJ 3C7FA 5D2AA 4L99A 3K4AA 1XJAA 4X8NA 1SPPB 3ZXLA 2J1EA 4FT8A 4BMEA 1CAUB 4Q0PA 3V0AA 1XSQA 4UOJA 2O0OA 3NAPC 2ZGTA 3CO2A 4N8MA 1ULPA 3SCHA 2ET7A 5GLVA 4CCDA 3I59B 3I2OA 2IZWA 5LK7B 3IM0A 3LD8A 4EYUA 1AR73 3LDKA 4NAOA 4OUSA 1LOFC 5FZKA 5I93A 4QPGA 5C3SA 1V6MA 1WLCA 3B93A 1TME3 5E1RA 1HJGA 3D0SA 1DGRA 2C0ZA 5FPAA 5H9RA 2ARXA 4MGQA 2OXBA 4XVHA 1HXS1 2QQNA 3AYEA 3N9OA 1CR7A 1VBC2 3DCQA 2OVUA 1DHKB 2HWC1 2DDUA 4QXBA 5C7GA 1W2NA 1BKZA 1REFA 2VH9A 3H1MA 1T2XA 2YUEA 4BLJA 1H1MA 4RR3A 4QHZA 4HANA 4EZ4A 3C7EA 1KXGA 4B1MA 4DXTA 3MV11 5AVAA 1ZYBA 4Q4V2 2RM23 3I2FA 1KFXL 1BK0A 1MR5A 1REDA 4QX8A 5KXBA 5C3OA 3RJ2X 5BNPA 5A3MA 1UPSA 2ES3A 1OUSA 1FPN3 1UKRA 2PHLA 2VTFA 3I4IA 4LE4A 1OMIA 3C7GA 2FHRA 3LOIA 1UXZA 4OI0A 1C1LA 2D3PA 3EYPA 1KQRA 2BVBA 4FVVA 2E63A 5T52A 1GQPA 3V0BB 1K3IA 1LR5A 3ENRA 4Y33A 1HX6A 1WCKA 3DKQA 2V4AA 5FBJA 4ZXEA 3J8F3 3WV6A 4YFZA 4QPYA 3M3IA 4XFBA 3S5QA 2FZ1A 2VZQA 3POWA 4DMIA 1XYNA 1U0AA 2TBVA 5DUXA 3ACGA 5J1XA 4JGZB 4GULA 5H9PA 4J1XA 4JQRA 4MOAA 4YVWC 3I49A 1AYN1 3WXPA 5F2SA 4AVCA 2CYFA 4XUQA 1PIV3 3QH6A 1RVF3 3AXEA 2R073 5LWBA 1SMVA 1VRH3 3FZ3A 5FXXA 3VD4A 1LOFA 1PO21 5EZWA 1SDWA 5FZ1A 1UPIA 4IW3A 3VZNA 3ZN6A 5IVBA 3I59A 4ZU4A 3H50A 3KV9A 1O3RA 1OA2A 5DMYA 2HWE3 2LRPA 4PIZA 4KWUA 3INAA 5DUVA 4E2SA 2JICA 5K8SA 1SEFA 3KCYA 3CIHA 3ZFFC 1LOBA 4HONA 1QEXA 4ZU7A 2BPA2 4KL1A 1GFF2 3MUY1 4QAWA 5DG2A 2YV8A 4FP3A 1G7YA 4PLNA 4RGAA 2VZUA 1Q8VA 2PHWA 2WN2A 3HJRA 3UYJA 4AYUA 5JXJA 4Q4Y1 4L11A 3WUCA 2X09A 4NPLA 2W9XA 3ZX7A 2HWD1 5AVPA 2PAEA 4WZFA 2RR12 2VOXA 3KVAA 3UT0A 2WLPA 1H6YA 3JCIA 3H0OA 1YIFA 2RM22 1IG3A 5A6XA 2CSGA 2WS91 4LA3A 4Y1YA 2K9ZA 2P6CA 2D6PA 1UMZA 1UF2C 5KR7A 4QX0A 4K9SA 2Y64A 1E5SA 2R32A 2RS11 2IXIA 4CXYA 5GJ6A 4ES8A 4N53A 2EA7A 1SFNA 1DF0A 2W95A 1TE1B 1MS0A 5CFCA 1PM4A 4XJ8A 2VCMA 3V0BA 4U36A 2I07B 5L36A 1B35C 5FY7A 1JYXA 3J8F2 4YVWA 3DXUA 2XVLA 2DCTA 1ZBA2 4LR4A 5EHDA 1MZEA 4A7ZA 3OUJA 4LK6A 3OGSA 2Z5WA 1HRV1 4CE8A 4QPIC 1JZ6A 2ZOEB 5DDJ2 5EPAA 3PVBB 3HQXA 5FMCA 1V9U1 3RJRA 3J7MA 1UOJA 4QB1A 1GMMA 4YW1A 4AQSA 1PGW2 5A80A 1QJFA 2P4EA 1RVF2 1WLDA 3OGRA 5FY5A 2HEWF 3VKMA 4XF3A 4OQ8A 3U11A 2YC2A 3ZFFA 5B4NA 4UBHA 2ZJCA 5DAPA 3FFQA 3A23A 3CU7A 2Y0IA 4Q8LA 4Y20B 2HWE2 3ETPA 1NUKA 4HSLA 5T3NA 1MEC2 5J7MA 1D4M1 4LEJA 1W6NB 2PFWA 4PDWC 2XH6A 2H6CA 3IDCB 5LASA 4AVAA 1W6PB 3AYCA 3BGAA 5T55A 5C8WA 2AR6A 3LF7A 2WWUA 1UNBA 3J26N 5DPNA 4YW5A 3CZJA 4AE2A 2D40A 5FUIA 4CU9A 5CG8A 2LM3A 5FZOA 4HPKB 3RDIA 4ZKTB 1S0CA 3PUSA 4CEYC 3ROUA 3GZUC 4FFFA 3VDDC 4Z2AA 1FNZA 1UY0A 3AL5A 3AP6A 3SH3A 4CPBA 2XGXA 2J22A 4N90A 2D7FA 1UMIA 2HLEA 1J83A 3BPSA 2D3RA 4E4SA 2JXAA 3V65A 1AL21 1S4CA 1WCQA 4EN9B 1H30A 2DCKA 5A32A 1W6QB 4LITA 4R9DA 2OPWA 3DYOA 4PBPA 5AC93 4M3CA 4OMDA 3F95A 1F35A 2FQPA 3A22A 4E2GA 1B35A 5F6KA 4BWOA 1BMV1 2AC1A 2WRAA 2ZS6B 2O8QA 3BU0A 3BALA 3ZFGB 2ZKLA 3TYJA 4LBQD 2BDRA 4MV2A 3QH7A 5JMOA 1RUF3 4QPIA 2P3KA 4HN0A 1W6OA 1RINA 2ZGOA 3MF9A 3TEWA 4JKLA 5GZDA 3U0ZA 2ARCA 4XIKA 4CDQB 1E5HA 4LBOA 4CCLA 1DLCA 3DYMA 4GAZA 5FJKA 3UESA 1MZFA 4Y5TA 3WCSA 2DTWA 3ZXDA 1HRI3 2W39A 1J3RA 1C8M1 2UY9A 4UBGA 1A8DA 2DUPA 1YUDA 2P6HA 3AVRA 4C8DA 1PNFA 2JENA 1Q3EA 2BUKA 4UF0B 1SLLA 4PDWA 3C2UA 5A3PA 1RITA 4YFWA 3SMHA 3AM2A 5C9AB 4Y20A 4AAPA 4DOUA 1Q43A 2V72A 4O65A 5J3UA 1VAKA 4Y1UA 2YGMA 2FCTA 3NJZA 4Q0QA 3N9PA 4LXLA 1PVC1 1IOAA 4CDUC 5FY1A 4CEYA 2DFBA 4AOCA 2ZHMA 3OGJA 2ZGRA 3VDDA 4CDXC 5KHGA 1URXA 2W2IA 2X29A 4OFGA 2VNVA 5FYHA 3RI8A 2BGOA 2MPFA 4D94A 1HJFA 2B9VA 3J9SA 3KV6A 2ZA9A 5FP3A 4UT5A 1ZRRA 3OYWA 2HBUA 2XUEA 4K6BA 4D7TA 4DXSA 2XB6C 2EXIA 1W9FA 3H7JA 3ITQA 4JTNA 1QQP3 2EICA 3N35A 2E7QA 5JOWA 1RUD3 1BVP1 5BV6A 4QM9A 1AR71 5CISA 2K46A 5JXIA 5FDBA 2BJSA 5IK7A 4JGYB 1OQEA 3MBWA 5F7UA 3NNGA 2IFRA 3IBMA 2C26A 3APBA 1TME1 4XILA 3X29B 4LT5A 3ACFA 3LA2A 4WVMB 2IC1A 2VMDA 3VBHC 4IEOA 3J4UH 4Y26A 4KWKA 3ZFGA 2RJLA 1GLHA 1H9PA 2EAAA 3WNXA 1RUF2 3ZYBA 1GKBA 3GYDA 5C33A 2O1QA 2ZGQA 4CEWB 1UOFA 3LEIA 4XFHA 1LKNA 4IE4A 4TN7A 2VBDA 3RWNA 3S7IA 3I3DA 3SLIA 4R9CA 3TEXA 2MEV2 2NMNA 5CEHA 1BK1A 1ZA4A 2ZAHA 4GH4A 5FZ6A 1ENXA 4COVA 2ZCWA 1DFQA 2YU2A 3KHBA 5EYXA 4BK5A 2YZ4A 4D69A 4W6WA 2XDVA 2DVAA 1W8UA 5FLIA 2R16A 3LB9A 4QGNA 2TNFA 2VUCA 4UF0A 4V2WA 4CDUA 1RUG2 5T5LA 1FPN1 5J96B 3KGZA 5FIXA 3FN9A 4ISQA 1GUIA 1W6MA 2NM1A 2XVKA 4CEWC 1BQPA 1N1TA 3MFAA 1F31A 3W59A 3GCXA 3AZWA 5A33A 5CBLA 4YZ1A 4YLZA 1LOEA 1UU6A 2XLAA 1ZX5A 4R9AA 2FMYA 4YM3A 1CN1A 4G4FA 3POGA 4CCMA 4DY3A 3CDZB 4N43C 4BQYA 1BYHA 2PTMA 1PZ7A 3GF6A 5FRAA 1UYPA 4AFCA 1MS9A 1F5JA 1GP4A 2BWAA 1UQXA 3AKRA 3HQUA 1PIV1 2D97A 5GLTA 1RVF1 1VLNA 1Y43B 1CZTA 1WLWA 2BFUS 2R071 4LBLA 1VRH1 1SBFA 5FP4A 1PNGA 2JG8A 4YZ2A 3TEZA 5FAXA 2X5IC 1I5ZA 1RUD2 2QVSB 2OZ6A 3VBHA 2HWE1 2PAKA 3IZOA 2BV4A 5FUNA 1V6JA 3JU9A 4MO3M 2CL2A 2LW8A 4GKXA 3GNEA 3OTFA 3KM5A 3KS7A 2F17A 2P3YA 3T0BA 2GC2A 5F5QA 4HL0A 4QKBA 1AXKA 4I09A 3ZN5A 5A7QA 2UY8A 3BKZA 4FCAA 5T5PA 2XJPA 4HK9A 4MGYE 4CUGA 3RS6A 4YZ4A 3VKOA 1GZWB 2E53A 5FK7A 2XJTA 1C28A 1WMFA 2ADEA 2OA2A 1GP5A 1PGSA 2P34A 4L9BA 4KMQA 3O1PA 3MZHA 1A8MA 4V1PA 4BCUA 4XXAA 3KV5A 1YFXA 1DP0A 2UWCA 1E5IA 4XUOA 4Y4YA 4CUAA 4CU6A 5ISLA 1PO13 3A0NA 3POFA 5I0UA 2VGDA 3NMBA 1YFWA 3R6SA 1JN2P 1JYVA 1W9YA 4AHYA 4CSWA 5HXVA 2G19A 5JIAA 3AMHA 4CEWA 2XLGA 2JDPA 4LKEA 3ZXGA 3M7AA 4H55A 4L92A 3LZZA 3NL1A 4R4XA 3T3YA 3K3NA 4M4RA 4C91A 4G3YC 5CA6A 2WT2A 1WCSA 1WCDJ 4N43A 1UOGA 1FYUA 1PMHX 2H6BA 4FFGA 4O61A 1EPWA 5EV7A 4X6RB 4M00A 5JPMB 3UGFA 1NE6A 2NPIA 2UWBA 1GOHA 4OI1A 1N47A 1UX7A 1CAWB 4LHLA 4RQPC 2GMPA 3B69A 1ZRDA 4QDQA 5A3WA 1O8SA 2A6ZA 4PLOA 3OJBA 4PHZA 3RZKA 1ZZBA 4S2GA 3AKSA 1GANA 2XR4A 1I6XA 2Q4SA 2YB7A 1KDMA 2RE9A 4QGLA 2XMLA 2QQVA 2AGSA 5GLWA 1ASJ3 4XEZA 4DEQA 1FOD3 3LEGA 2IXCA 3BN6A 2LROA 4MADA 3WEZA 1FX5A 2XKPA 3GHMA 4GMP0 4Q4W2 4QQ2A 3MDPA 4W4ZA 5JI9A 5FO8B 2C9KA 3AXDA 2ZMLA 3FX3A 2ZHNA 3PVOA 1JBCA 1NT0A 1W9TA 5FWJA 5FZ9A 5HCFA 4XW3A 5CADA 2QZ2A 2XJRA 3VZOA 2CV6A 4TXWA 1JHNA 1S2KA 4IETA 5FMOS 1YQCA 3NSTA 3VBUC 3ZLIA 4IV1B 5FZ7A 3M3OA 2KXLA 1DGRN 3WG4A 1PO12 1HB2A 3NWKA 4A7YA 1VB2A 1QJY2 3ZMNA 3KZ4C 4A3ZA 3ZXFA 4AGRA 1ZZ9A 2VCAA 3THTA 3M70A 1D2SA 1H9WA 3HWJA 1CX4A 2XJQA 3POSA 4LJHA 4MXVA 2Q8OA 5AC91 1W3VA 2R063 1WMDA 2W46A 4LUKA 3WDWA 3DGTA 2XBO2 1EPZA 4DXZA 1UYYA 2WNVC 2BERA 5BNNC 2JWPA 4LULA 3DF0A 4A41A 3LIHA 3WG2A 5KXDA 3BTZA 3LIGA 5A1FA 4RQPA 3HNYM 2A3YA 4IUGA 2LALA 4TZDA 2BNNA 3ZR5A 4BISA 4CUBA 1Z78A 2JE8A 4Y24A 2A71A 1QH6A 5F1RA 1JYTA 1XYOA 4I30A 1CQ9A 4QKNA 4FPKA 3LE0A 4YYOA 4DB5A 5EIYB 2JD9A 4IEUA 1RUJ2 2GC3A 4TSVA 1ENRA 4JAAA 5FZCA 3BTYA 4XE9A 3WW2A 1MQTC 4E8CA 2YBSA 5GZCA 1HRI1 5LEKA 1AVBA 4BJ0A 1VBD3 4FO9A 3D8CA 4NIDA 2IXLA 4JTOA 1GBGA 1Z7S2 1GWKA 1G8WA 4NWVA 4W50A 5D21A 3ON7A 2VMIA 4A6OA 2VC9A 2WYSA 4H3WA 1LGNA 4CPBD 3WD5A 3WP5A 1YXWA 5DG1A 4WVVA 4AI0A 5FTTC 4HMZA 3VBSB 1VR3A 1YYNA 1BHGA 1W05A 4AGGA 3BVCA 2DYCA 3PMEA 2CGOA 1GV9A 4OHXA 3TNQA 1OI6A 1LEMA 5BNOC 1D2QA 4WV8A 4INDA 1ZBE2 3LPFA 2HWB3 4ONUA 4P00B 4J25A 2FCVA 5LB6A 5LA9A 1QQP1 4JDOA 1GWMA 4BIOA 5F9TA 5BNNA 5ANQA 2PYTA 1RXGA 2Y8KA 2VQ0A 3ZVXA 2R062 3OUHA 1MS3A 4COUA 2WFF3 4UAPA 2G4IA 3MGUA 4B4RA 5FPXA 3JBG3 1OF4A 4YM2A 3QACA 2JECA 1EV13 1A78A 1M4WA 1XC6A 3GZEA 3ZYIB 3VHRA 5IYYA 3ACIA
chains in the Genus database with same CATH topology
3KT4A 3SCFA 3WHTA 3DKWA 1G9FA 4FAHA 4XBLA 2ETEA 1CAXA 2RMU3 4Q1PA 4N9IA 2ZMNA 2BNOA 1MACA 2R1DA 4KG0A 3EHKA 1TQ5A 3LAGA 4META 4Q1RA 3VV1A 4EV0A 1NCRC 4QM8A 4TYSA 1OD5A 3AMPA 4YVSC 3NNMA 1D4VB 1VBD2 4LUMA 5HV0A 2V5YA 3PLQA 2FZ2A 1YWKA 1J3PA 2ZGKA 4QU2A 1ZZ6A 4AQ6A 2P3IA 3AMNA 1V6NA 4OULA 3VKNA 5J36A 3DV8A 3ZSEA 2LTNA 3WLUA 2C9AA 5AFBA 1MZ5A 4GA9A 4KG8A 4CRQA 1IZ3A 2GNTA 5BNOA 1ENSA 1AX1A 4Z8BA 4Z2WA 5LBFA 5FOBB 3SH4A 2G1MA 1S0FA 2PHRA 2VNRA 1GNHA 1O4ZA 1WW5A 2W68A 2DU1A 2HWB2 1R1A3 5E8AA 4AGVA 3GALA 3I7DA 4JC1A 2GSYA 5JOZA 1PHMA 2A70A 1SLIA 4XFAA 3MW4A 1X8EA 2UYAA 3H7YA 4I3PA 1QU0A 4AWDA 4WM8B 1UKGA 2VVFA 3HBZA 5L7OB 4B4PA 3B00A 3ZYRA 1MS1A 3FUOA 3JBG2 4QPGC 4PQ9A 1AHSA 2V73A 2Q1ZB 1LOCA 1H2LA 2A7AA 2DV9A 2PA7A 3MIBA 3KCCA 3ES4A 4E4ZA 1U5YA 4OUMA 1NCRA 2GDFA 2QDNA 4R52A 4YVSA 3LWCA 1BBT1 1NY71 2Y34A 4Q4V3 4UW3A 2RG4A 5EJ3A 1PO11 4XF1A 5LBBA 1U5ZA 4XZPA 3VBRB 3WVJA 1O5UA 1OOPB 4P9IA 1RJ7A 2CAUA 2VECA 1PK6C 1FV3A 4XTMA 1RIRA 3ILFA 3MW3A 5D8AB 3FFZA 2WFPA 5FQ0B 4DRVA 1KRIA 3CJIB 3D0JA 1X8MA 5J09A 3AP7A 1WW6A 3QLQA 4G9SB 1GYKA 1PGL1 3VZLA 4CDWC 4EN8B 4I3GA 1LENA 1LGCA 3IDEA 4YRDA 1B09A 2EVXA 4CP0A 2YY1A 2YXSA 1RB8G 3AYDA 3KQRA 5C4WB 1QXPA 1R1A2 1QOTA 1ASJ1 1SQ4A 5FPZA 1OKQA 1FOD1 4YARA 4MUVA 4TLFA 5GZEA 3E5XA 3MI8A 5T50A 4Q4X3 3PJYA 4E2QA 4KGGA 1RMU2 1DGLA 4RS5B 2A3WA 4AQTA 1DQ4A 1C5IA 1VP6A 1JUHA 1ENQA 3D5OA 3LKJA 3AJZA 3W58A 5DAVA 4Q5OA 4UW6A 5FLHA 4YG3A 5BYNA 2RR13 1EP0A 1CAVA 1REEA 4XQWA 2VOWA 4COYA 3NO8A 3WG3A 1QJU1 1PK6A 1XYPA 4FOYA 3E97A 4CZSA 1OOPA 2P17A 5I8YA 1JUIA 1V6LA 4AXOA 5T5JA 2A6XA 2HKXA 2E7AA 4BLIA 1MS5A 1AUYA 3NKGA 5D8AA 4OHWA 4GMP3 4CDWA 3B9IA 4XC9A 1ZBA3 2B8MA 4N53C 2VMGA 3UKTA 3ATGA 5CFCC 5ERLA 3N36A 1OSGA 1K5MB 5DDJ3 1JYCA 3WP3A 5C6CA 1ND2B 4HVRA 1CAUA 1R083 2CWSA 3AP9A 4JGZC 5L19A 1BXHA 1AYM2 4P9GA 1VBD1 5FCCA 3HT2A 1MEC3 1Q8SA 3IPVB 1HV0A 5I91A 4P14A 4M01A 1H4HA 4Q4X2 4X8PA 4B8EA 3E6DA 4RS5A 3BTAA 1OA4A 1PZ9A 1V70A 3WQ0A 2D3SA 4H14A 3URFA 4E9KA 1QY4A 4K21A 4FPFA 3M1HA 4MVTA 4S2DA 2Y33A 1YLLA 4YG6A 1KJRA 2Z69A 5KBFA 1MS4A 2K0GA 1Y9QA 1QHDA 4AVBA 5IK8A 2HWB1 5AFEA 3GBGA 1CD3G 1AXYA 1APNA 1ULGA 3M3CA 1ZRCA 2H0BA 3AZVA 2XL7A 2WKKA 5E16A 4QQOA 4N9HA 1UIKA 2XPJA 4IXLA 3JD73 5DXDA 1SBDA 1YNAA 2WL1A 5J37A 3U10A 1H8VA 2WFF1 1XNBA 1POV3 4R4ZA 3JBG1 4XOGA 1CPNA 2RS33 3WW1A 1EY2A 5ACA2 1EV11 1X82A 1EAH2 4FOQA 3ZPYA 1MVQA 3AMQA 4LLOA 1BJQA 4JGZA 4Y1VA 3ILRA 1O91A 4YZ3A 4AI8A 1K5MA 1VBB2 3RG0A 2RMU1 4EROA 4IEYA 5C5UA 3V64A 1R082 1RL3A 3VKLA 4FQZA 3UL2A 3IKWA 4FPCA 2DU0A 5TSWA 1O3TA 4XCBA 5HCBA 4MXWB 1YI7A 3N7LA 5KHJA 1DZRA 1QJX2 5EQUA 2D93A 2ZZJA 1AXZA 4UW5A 4B29A 4MLOA 3ZFEB 1VALA 4I02A 1VBE3 1OFNA 3ME2A 5JZGB 4KQ7A 4D3WA 4RHV2 1ZNPA 4OHZA 1O3QA 2E6VA 3TBDA 2JE9A 4Z07A 3TN93 4OLLA 3BIWE 3IWZA 2I2SA 4XFGA 2DCYA 1UW8A 1R1A1 1IS4A 3E5UA 3OGGA 2WZR3 4L8QA 5JR7B 1YHFA 5L73A 3N4MA 2XVGA 4AHWA 3JD72 1RGSA 4BZ4A 4WVWA 1RC6A 4Q0VA 5FOJB 2OYZA 2DWRA 2RS32 1VBC1 2PLV2 3DPRB 3P3NA 1S0JA 1ULDA 2CGPA 3ZFGC 1H2KA 5KC6A 4OHYA 3NV4A 1PM7A 1NYWA 2GAUA 2MEV3 3VBFB 3ZSLA 4GALA 2BFUL 3B7MA 2DVFA 4Q4V1 2OPKA 4HVOA 4MYEA 4IERA 4CDQC 2VY0A 2ZGPA 3SNMA 3I8TA 4GH4C 1RUG3 1M06G 2OZJA 1A6CA 5KWRA 3ETQA 3AKQA 2ZBJA 5FLJA 1W0OA 5SV5A 1TEIA 3OD4A 1W6NA 3VL8A 4FTBA 1CIWA 1W6PA 1VAVA 5C9AC 4NOTA 3NV2A 1IGOA 1AL0G 2JKBA 1VBE2 1RUE2 1RUC2 2VPVA 5JZGA 2B5HA 2GN7A 2WNUB 4IESA 3OBTA 4OZXA 2EAKA 4HPKA 1E57A 1QMJA 1LU1A 1VB4A 4MH0E 1BEV2 2GH2A 2QCSB 4A7KA 3TN92 4C1XA 5JAXA 1X50A 4IEWA 3HN1A 1IQAA 2VOKA 4F83A 4O9EA 4XETA 2H0VA 1AR63 3N7KA 4WM7B 3SXWA 1W6QA 5C5TA 1IHMA 2WZR2 2C5DA 4FPYA 5B2GB 3PVEA 4FPGA 2JG8C 3MICA 4HETA 4BH9A 4XCAA 1EYBA 4Q4X1 1UCXA 1NQDA 3S30A 2RDNA 1GZ9A 3G6JB 2JIJA 4JGYC 2XWBB 4UXAA 4LE3A 1X36A 1O7FA 1LHVA 2XJUA 2DVBA 4CDQA 1S0IA 1G6NA 4IEQA 2C1FA 2RR11 3M3EA 1J58A 2VULA 4JRAA 2G9GA 2RM21 2YROA 2A5ZA 2YYOA 4U2AA 2DVDA 1HW5A 2WIIB 3LOBA 3VHOA 2PHTA 5C9AA 1N3OA 2XHKA 5FO9B 3LSEA 1YO8A 5EP9A 4QD2A 3J8F1 4GMP1 4KWJA 1CJDA 1ZBA1 1NA1B 3P3PA 3IT8A 3CF6E 5FMOL 2FCUA 5GLUA 2ZX4A 4P9LA 5DDJ1 1GSLA 3IN9A 3JB8A 3HIFA 2IXHA 1PGW1 2OUJA 2R30A 4AVTA 3MEPA 5C8CB 1WLTA 2AH2A 1RJ8A 3ZYPA 1V6KA 2QE3A 1H1AA 1RHI3 4M3CF 4ZPIA 3I54A 1Q8QA 4KBZA 4M00A 1AR62 2QFEA 2ARBA 4Q4W3 3JB4C 1MEC1 1VBA2 4JGYA 2D6LX 2Y38A 5DAWA 5JLVA 3SCGA 4K7JA 4WVMA 2WWSA 1DYKA 1COV3 1S2BA 1WBFA 4ZXKA 4L97A 1ALYA 2QQPA 1SBEA 3R0RA 1ZRFA 2BEOA 3B9CA 2WT1A 1RUI2 1RTVA 3VBOB 4IV3B 4XMAA 4YGEA 1W2UA 1MS8A 3WDXA 4E27A 3GBWA 2JG9B 3WP4A 1QJY3 4GKYA 1H1IA 4PIYA 1WBLA 4PBOA 3B5LB 4BQ1A 4IL7A 2NN8A 1FNYA 2XBO3 3M2MA 3BPZA 3VZKA 3EXUA 2I45A 5KHHA 3WDYA 1IKQA 2R042 4PJYA 4BQXA 2VG9A 1QDCA 3UK9A 1LHOA 3OD0A 1Q5OA 3WQ7A 4ASLA 2QKDA 1O5LA 4FOVA 3M4FA 1QOOA 4CP1A 1IS5A 4FPJA 5LATA 4EN6B 1NOVA 2HBTA 1RUJ3 2CGNA 3EO6A 4KNCA 3OPZA 4AI2A 2BYVE 3KCXA 2GNBA 2ZAAA 4CP2A 1CVNA 3ES1A 5C8CA 1G9DA 2DURA 3W9AA 1RHI2 1Z7S3 2D6OX 5I0TA 1QXRA 1A3KA 3MW2A 4IEZA 3VHNA 1D0HA 4GB33 3ZSKA 4Z82A 2MNGA 1DQ6A 2ZX2A 2PELA 4DS0A 2D6MA 3WOGA 1C57A 3R4SA 2P37A 4XJWA 4LO6B 1COV2 1GZCA 5FFOC 4Q26A 4CTEA 1CJPA 1H8TB 2ZGLA 1GZWA 4K1YA 4GWMA 2B46X 3BCWA 1LULA 1WW7A 4HN1A 1XXNA 3VBOA 3TN91 1ZBE3 4IEPA 2VVEA 1LOAA 2B39A 5K0UB 2NMOA 2A73B 3KB5A 2WZR1 4AFAA 4K20A 3ELNA 1RUNA 4QT6A 5IAVA 2ZTNA 1QH7A 2YMZA 3TAYA 2VNGA 1HDKA 3OF1A 2BVVA 1RUF1 4AEMA 1KS5A 2RJKA 1YFUA 2SLIA 4Y5SA 3C3VA 3CNAA 5BUVA 1OLRA 1CAWA 2GNDA 4XTPA 3PTYA 2P3JA 5ABJB 2WNVB 3OCPA 4LBMA 2MEV1 5FO7B 1QXJA 2CTVA 3TB0A 4QX5A 3MIHA 4YW3A 5JVVA 3LA7A 3RRDA 3MPPG 1POV0 1RUG1 1S0GA 4COWA 4AFBA 1TNFA 4GB32 2GALA 1KFUL 4HZFA 1MQTB 2KM2A 1YJKA 1YI9A 1UL9A 3UV9A 4XJUA 3ZSMA 2N7GA 1S0DA 1I3HA 2K2SA 4LBQB 1PO23 2ZGMA 5HI0A 4FQ4A 3VBSC 5FREA 2BNMA 4IV1A 1WMEA 2WQ4A 4LHKA 4OI4A 1BZWA 2A1XA 1N1VA 4XJZA 1OQDA 1RUD1 2VU9A 2VUJA 3B94A 3AFKA 2OW4A 2HWC2 5LBCA 1ULFA 2UWAA 1R1ZA 2HWD3 3NV3A 1H4GA 4LHNA 1PZ8A 1WUVA 1Q8OA 2YC0A 3BOWA 5DZEA 3ZSJA 2UURA 4YGCA 2EALA 5A3LA 1SCRA 1W0PA 5JPNB 1XU1A 2WS93 3KMHA 2R0HA 4AEDB 2UYBA 2RS53 1SLBA 2GMEA 5LRSA 3AJYA 4S2HA 2WJSA 1C3HA 4P9JA 1I1EA 1DLLA 3LCPA 4AVSA 2X53S 2XG3A 3A4UA 4NR1A 2YPJA 1FXZA 4YM1A 2WT0A 3PNAA 2YGLA 5CVRA 4PIXA 3VHPA 4NHKA 2CWMA 5L9BA 3GJAA 4NO4A 1AYN2 3WCRA 2JDZA 2W52A 4AEJA 3MLLA 1JYIA 3PMSA 4B4QA 2ZGNA 4GWNA 1NCQB 1ND3B 3VBSA 4S2FA 1PO22 3USSA 3PJQA 4YGBA 2Z79A 3NV1A 3UKVA 5KHIA 4BIFA 3T1MA 2V09A 1F9KA 1SLCA 4J6GA 2Y0OA 5CFDB 3GBFA 3GHNA 2R1BA 3QOPA 4Q8KA 1RHI1 5A3UA 3FJSA 2VNOA 4Q4W1 4N7IA 4Q4Y2 2CAVA 3PL0A 1DQ2A 1C1FA 1RMU3 4NHYA 4P9YA 1NLSA 2VW2A 2HWD2 4RGGA 4KGQA 3V0AB 5BPXA 1LESA 2DTYA 1QF3A 4NPRA 2E9QA 1BCXA 4PF5A 4WM8C 5L7OC 2PAMA 2WS92 1YCIA 3R4UA 2B9UA 2Y26A 4M3CE 4A2UA 2IXJA 2RS52 2Q30A 2JD4A 2RS12 1CPMA 5GM0A 1UU5A 1XNCA 1QJY1 3T2TA 2DUOA 4WVZA 5E88A 4RD7A 4HKOA 2ERFA 5T5OA 3ZIXA 5T54A 3H3UA 1AJOA 3RQ0A 3WINE 4AQ2A 3K48A 3OY8B 3HD8B 2XBO1 5LBEA 1QJZA 2ILMA 3RYPA 3VBRC 2JX9A 1OOPC 1WGPA 4AVVA 4RR3B 4AG4A 4ZU5A 3AZYA 1IS6A 4M0NA 1O4YA 3DN7A 4Y22B 2D98A 4MZUA 5D8AC 2IWGB 4XFFA 3CJIC 1BVVA 2R49A 5BNPB 2TEPA 3TNPB 1N1YA 2VOVA 1RUJ1 4TWTA 4XABA 5DZGA 1D4M2 1IS3A 1AYM3 2PHFA 3WDUA 3ZXEA 3E6BA 4LO4B 4EWEA 4FBFA 4EJRA 1GICA 2AYHA 5CFDA 1ZVFA 3D6EA 1NZCA 3AYAA 3LGRA 1Z7S1 4WBBA 1XU2A 3A0KA 1MVEA 1RUH3 2WSVA 2WA3A 3NAPB 4BQWA 2GU9A 4WM8A 2HYKA 4LA2A 5BY5A 3H1WA 5L7OA 3BB6A 4COZA 1RUOA 4Y5Z0 2IFWA 4XQ4A 1LHUA 3ILNA 3B02A 1QKQA 1AL22 4RS5C 3ZN6B 5JIUA 2IXKA 1NQJA 4AHZA 2XLFA 1OHFA 1VIWB 2QNKA 5CU1A 3WDTA 3O0VA 4D7SA 3D82A 3MF6A 1DQ1A 1HIXA 1ZBE1 2GNMA 4LO8A 2RDRA 1BMV2 1XRUA 5K9YA 2PHUA 1Q8PA 3VBRA 3V56A 3AKPA 1H2NA 1U12A 2R061 1XE8A 2A6VA 4RSUA 4EWAA 3OY8A 2VW1A 1NXD1 3UJQA 1FMD3 3VUOA 3S6PA 4JRLA 5IATA 5FQ0A 3FWEA 5ACA3 3CJIA 4FP2A 1J3QA 1LJ7A 3H3ZA 5KXEA 1PVXA 1DU3D 1EAH3 2JE7A 2ZMKA 3KT7A 1NXMA 2GC0A 4IEVA 2EF6A 1C8M2 4Y22A 2OUHA 3FE5A 2NP0A 1GNZA 4Q0SA 5JSOA 1VBB3 1HKDA 5JOYA 1OPMA 2JEMA 2A6WA 4DINB 4EN7B 1QWRA 4XF9A 2R0FA 2Z2SB 4N53B 1K5MC 4KU7A 5C4WA 4AFMA 5CFCB 1PVC2 1ND2C 2ATFA 4AF9A 4YVWB 4LBKA 1QJX3 3FLTA 4HLTA 1ZZ8A 3EBRA 4FPLA 1RUH2 3WQ1A 1DIWA 5CNAA 5LK5A 1HQNA 3NAPA 4RL7A 3NKTA 1AR83 4K1ZA 4R8HA 2WSUA 3OUIA 1N3QA 5BXXA 4OHVA 4QMAA 3KSCA 4RHV3 2ZX0A 3ZFFB 3ZXJA 2A75A 3IDBB 4DNYA 2XL9A 3FLRA 2B42B 1AR72 4GIQA 5JSRA 4YGDA 3ECQA 1ZZCA 2G9FA 1DZQA 1TME2 5D1IA 5EFUA 1DDLA 4HFSA 4F3JA 3KGLA 2B7YA 2O8OA 4XFCA 1AX2A 1D0GA 4YM0A 2D5HA 1CGPA 2WA4A 1SLTA 2WNEA 1FMD2 1V6OA 2PLV3 3ACLA 5A32B 1KJLA 2R6QA 3TWIA 5IK4A 4OVEA 1UAIA 1HV1A 4JCKA 1UD1A 4M3CB 4PLMA 1AX0A 4XACA 1FPN2 1ND2A 2BQPA 1B35B 2QZ3A 2RS51 3NNLA 3H1YA 1GQGA 3G7DA 4MGZE 2NLRA 1S55A 4UWDA 4QPIB 3WW4A 4DRRA 1W6OB 1Q56A 4QGMA 3IPVA 3KD4A 1TNRA 4XXPA 1U5IA 4HK8A 2AENA 3FC0A 1AR82 3O12A 1G86A 1JH5A 1DGWX 2HEVF 1LRHA 1RUC3 1RUE3 2XJVA 1KD7A 1XNKA 4ORFA 4Q27A 1PIV2 5HBAA 4HKLA 3FLPA 2R072 3AP5A 1VRH2 3ZFEC 3MLJA 5H9QA 4BPZA 2D44A 4PDWB 2ZGUA 4YZ5A 1BEV3 2EIGA 4C0HA 5JZGC 1N3PA 4LBJA 4DQAA 4XQDA 3OBZA 4JDNA 4NN0A 3VL9A 4CEYB 1ONAA 1X33A 1VJ2A 4MGKE 1WA4A 3VDDB 1G9CA 5JI7A 4I2OA 3O14A 2ET1A 4OI2A 1RMU1 5HV4A 1TMF3 3OYWB 4FSJA 4B3NA 2D6NA 2ZHLA 3AKTA 1HLCA 1LTEA 4C0BA 2RHPA 1LHNA 4BMBA 2QUOA 4IEXA 3RYKA 4IQPA 3POYA 4Q2FA 1ZM1A 3DPRC 2UU8A 1C8NA 1OPOA 2ZHKA 5DAQA 2GN3A 4MGIE 1IPKA 4Y1ZA 4KU8A 4AI3A 3SITA 3KLSA 3VBFC 4BHPA 2X8KA 2BW8A 4MXWA 1HQWA 5I8TA 1ULCA 2CY6A 4QQHA 1WD3A 3MFCA 1AR93 2P2KA 3KT1A 3ZFEA 1YIPA 3THPA 3HT1A 1Z0HA 4GH4B 1G9AA 4W6YA 2RDSA 4XDQA 3W21A 5L9RA 2WINB 2OIIA 3FBMA 4CDUB 5DUUA 1QGLA 4RFT0 2WNUC 3FHIB 4CDXB 4H7MA 1W6MB 1AYM1 3ZN4A 1LODA 1IPJA 1UU4A 4Q0UA 5CAZA 5A33B 1G9BA 1UIJA 2YHJA 3ZO0B 1VBA3 4J1WA 1RUH1 3RYRA 3SISA 2D43A 4WM7C 2AUYA 4P9WA 1S0EA 4FXKB 3WZ1A 1FATA 1TMF2 1QNYA 4HT1T 3FMGA 1IKPA 5J48A 4F8AA 1DG6A 1R093 3LSDA 2HWF3 3DPRA 4YG0A 1RUI3 3HMYA 3O0WA 2JG8B 3CEWA 3WDVA 5JCTA 1C4RA 3VBHB 1SFYA 3VBFA 2FBEA 5AC92 1DZTA 2MHFA 4UW4A 1F5FA 3RMYA 4XJ9A 2PHXA 4XHXA 3E6CC 3ASIA 1FT9A 4AW7A 1JTZX 3WUDA 1FI2A 3WR0A 2GC1A 2R043 5KHKA 3BODA 5I0RA 1FMD1 2B45X 3GZTB 1AR92 2Q0AA 5GLZA 2BGCA 5ACA1 3H8UA 4AK3A 3HQRA 2TUNA 1F2NA 4B7KA 1EAH1 1HRI2 2WNUA 3DL3A 2I74A 1VBB1 1QDOA 1ULEA 4X6QB 4CEWB 3O0XA 1NA1C 1R081 3AP4A 2DF7A 4GXLA 4XJAA 3S0MA 3IMNA 2ZACA 1NE4A 1V00A 2AZ5A 4N7UA 4AHXA 4CDXA 3JZVA 4NHLA 3T1LA 4N43B 4WM7A 4H7LA 1KS4A 2ENRA 1QJX1 5C8CC 1OFSA 2XJSA 5F6LB 1NLRA 4W65A 1L3JA 1WD4A 2PQQA 1CESA 4Y1XA 1AR81 4EN0A 1LGBA 1OLQA 2X5IB 2WC2A 5H9SA 1MZ6A 1R092 1XE7A 2HWF2 1XNDA 4RHV1 5JOXA 1QOSA 1WW4A 4RA0A 4NHXA 1QQP2 2LUWA 3AFGA 4MX3A 5LEJA 2DFCA 4K3UA 3TOJA 3VLBB 5GZGA 4CYDA 2RDQA 3HR9A 4DZGA 5E89A 3JUUA 1DQ0A 2E7TA 3VBOC 2ZZQA 4IV3C 2DCJA 5CIRA 4ATEA 4FTEA 3AX4A 4XFIA 1X7NA 1YJLA 2JG9C 4QXKA 3JD71 4K8FA 2EXKA 1N1SA 3ZMOA 2JIGA 4XBQA 1JW6A 1POV1 1BBT3 2VVDA 2RS31 4C90A 1O3SA 2PLV1 1JXNA 2EXHA 3MIEA 3PHMA 5KXCA 5GZFA 1NA1A 4XHBA 1OQ1A 3UKNA 3MYXA 4FPOB 2DUQA 3WP6A 3RZZA 4JZRA 1YRZA 5DZFA 3N3HA 3M8LA 2BTVC 4RQPB 1AF9A 5IK5A 4MHRA 2F4PA 3GZAA 3NVCA 5BNQA 3L2HA 1LEDA 3WT3A 5JWPA 2Q5TA 2ZGSA 1UZZA 4JV4A 3QD6A 4BYYA 3O7OA 3UJOA 1AJKA 1VBE1 1RUE1 1RUC1 4HVQA 5JMCA 2X5IA 1FV2A 1FAYA 2NZ9A 3RPQA 4BM8A 2ZKNA 3R4DB 3B01A 2ZPXA 1BEV1 3MPBA 4BOWA 3FUQA 4FPEA 4IV3A 4MHUA 3WY6A 1H8TC 1V6IA 3H9AA 2JG9A 3B3QE 3K51A 2YDEA 4NMIA 4IV1C 3TRSB 1HXS3 1VAMA 4LLFA 3WX5A 3VBUB 3EMRA 2VUAA 2HWC3 3N7MA 4I0AA 3WHUA 3D4KA 5K0UC 2F6BA 4ITCA 3DUIA 5J98B 1LB2A 4XMIA 5IAXA 5FBZA 2GZWA 4I01A 2GH8A 1TMF1 1BBT2 1NY72 4KH9A 2JJ6A 2QJVA 3EJKA 5DAXA 1QJU3 3EQEA 5GKAC 3VGIA 3AMMA 4LO5B 3ZXAC 5IUQA 3M3QA 3QCWA 5BNNB 4YW2A 5L9VA 4E4DX 1NG0A 1SLAA 4P5HA 2D5FA 5ABJC 3RMXA 4EWDA 4YSFA 2PN5A 1T6GC 3U4XA 1UX6A 4BA6A 4DPNA 3PVNA 3VZMA 4W6XA 4KWLA 3VZJA 1PGL2 1GR3A 2D6KA 1ZZ7A 1CAXB 1AYN3 1U5XA 4JVAA 2BWCA 1AR91 1O4TA 4KBBA 1UN1A 4JDMA 4SLIA 5EWSA 1H8TA 3S7EA 3NNJA 1ASJ2 1FOD2 5JDBA 3SHRA 1DGWA 4AFDA 1H0BA 2GMMA 2Q1MA 4HSJA 4XYXA 1F8VA 3VKFC 4LTAA 1AR61 1HXS2 5K0UA 2ZX1A 1J59A 4Q4Y3 3VBUA 5BNOB 4L2NA 2WLQA 4Z1VA 1VBA1 4MSVA 4SBVA 4A3XA 4FAGA 2KA3A 1I9RA 4R9BA 1Y7BA 4NVPA 3GJBA 5M0TA 1LOGA 3MLKA 4ATFA 2SBAA 2ZABA 4QHBA 1R091 2HWF1 1QJU2 4XBNA 1C5HA 4I0BA 1RUI1 4M0HA 2EXJA 2AREA 5ABJA 5IT6A 2WZPP 2WNVA 2RS13 2XUMA 3LA3A 3MIGA 3AK0A 1ZREA 4D7YA 1LCLA 4AEDC 1LHWA 1JOJA 1KDKA 1YFYA 3USUB 3JQWA 1HRV3 4ES9A 5JSPA 3L2YA 5KC5A 4NWWA 1MQTA 2R041 3ZDSA 1V9U3 1NCRB 3Q9OA 4LBNA 1DYPA 4YVSB 3RNSA 2W0XA 1Y3TA 3BU7A 2E51A 4AEKA 3MIDA 2PHDA 2VW0A 4XIOA 4LBQA 1KITA 1S0BA 1NCQC 1D4M3 1ND3C 2VMHA 1DBNA 1W39A 2WQZC 4QQLA 5SV8A 1J1TA 4XF0A 3QBQA 1XQNA 1QNWA 4GQ7A 2HJIA 2Z42A 3R05A 1PMIA 3I2DA 1DQ5A 4LO7A 3BOPA 1J1LA 4K40A 1SACA 2DVGA 2NQYA 3AZZA 3WW3A 3E5QA 5CFDC 3ST7A 5I0SA 4ZONA 4O9GA 4XAAA 1OA3A 4HBNA 4Q29A 3N7JA 4LNVA 1SCSA 4C1WA 4HKWA 4P9XA 2NYYA 1GQHA 4NHMA 3CJXA 3MIFA 1COV1 3RI9A 5HCAA 1LECA 4AI1A 5I8SA 1AL23 4WZCA 5GALA 2XKOA 4PCRA 4YNIA 1S1AA 3HAGA 2VXRA 1CONA 4QPGB 2HEYF 4AEDA 3W20A 3VN4A 4Z92B 3O5SA 5K7PA 5CG9A 2WFF2 3ALQA 2XWJB 3JQXA 1EV12 1HQLA 1VBC3 2CNAA 2ZX3A 3ZIWA 3ZXKA 1LU2A 3WG1A 4DY5A 4QQPA 1HRV2 4URTA 3USUA 4BE3A 1V9U2 4FOWA 1CAVB 2RMU2 3OBRA 2W08A 4F7ZA 4B7EA 3IIAA 3NNFA 1C8M3 1NCQA 1ND3A 1AZDA 4I0WB 1PK6B 3U07A 4RR3C 3FBYA 4DFSA 5EXOA 4XF4A 2QDRA 5LRRA 3CLPA 4XPVA 5CB7A 4ASMB 4YW4A 3CL1A 2VQAA 3RSJA 1H2MA 2DCZA 3AZXA 5BNPC 1PVC3 3ZYJB 5EYYA 4CDWB 2A6YA 3ZYGA 4FXGB 5DUWA 4ISRA 1UZYA 5C4WC 2A3XA 2FMDA 3L9JT 3NW4A 3AB0A 4GB31 4FTSA