4IV3A

Crystal structure of recombinant foot-and-mouth-disease virus a22-h2093c empty capsid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
199
structure length
178
Chain Sequence
TTTVENYGGETQVQRRQHTDVTFIMDRFVKIQNLNPTHVIDLMQTHQHGLVGALLRAATYYFSDLEIVVRHDGNLTWVPNGAPEAALSNTGNPTAYLKAPFTRLALPYTAPHRVLATVYNGTSAQLPASFNFGAIQATTIHELLVRMKRAELYCPRPLLAVEVSSQDRHKQKIIAPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Rational engineering of recombinant picornavirus capsids to produce safe, protective vaccine antigen.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type a
molecule tags Virus
total genus 32
structure length 178
sequence length 199
ec nomenclature
pdb deposition date 2013-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iv3A00
3ZFFA 1AYM2 2QQPA 1QJY1 4N53C 1B35C 2MEV1 3ZFGA 1D4M3 4AEDB 1RUC1 5L7OB 4BCUA 2HWF2 4Z92B 1QJU2 2WFF1 1AR63 5AC93 1COV3 4RR3C 4WM8B 2RS11 5CFCA 1AYN2 5K0UC 1QJZA 1RUJ2 1RVF1 2GH8A 1CJDA 4Q4W1 1EV13 1ZBA1 3ZFFB 1ND2A 4Q4Y1 3DPRC 5A33A 1EAH1 3ZFGB 2ZAHA 1RB8G 1HQNA 1PO12 1IHMA 1BEV2 4GB33 1RMU3 2RMU1 5GKAC 4EJRA 1W39A 3JB8A 5CFCB 5J96B 1AYN3 1R093 3TN91 2HWB2 1RUJ3 4YVSC 5ACA2 1ZBE2 5ABJA 5CFDC 1HXS3 5D8AC 1FPN2 2XBO3 2RR12 1NOVA 1COV1 1ND2B 1PGW2 5C8CA 5A33B 2R073 1PIV2 1R083 2WWSA 1MQTA 4IV3C 1BBT1 1BEV3 4RQPC 3JD73 3J8F3 3ZFEA 2BPA2 1RUE3 4CDXC 3VDDA 2IZWA 5FOJB 1GFF2 2MEV2 4QPIA 1RUG2 4LLFA 5ABJB 2RR13 4GB31 1RMU1 1V9U2 1X33A 2WFF2 4JGYA 5C8CB 3LOBA 5C4WA 2RM21 1NCQC 4JGZC 1HRV1 5BNOC 1MQTB 1RVF2 2XBO1 5BNPC 4GH4C 1FMD2 4Q4W2 3ZFEB 1DDLA 1NCRC 1VB2A 1ZBA2 4YVWA 3VBHC 4GMP0 1HX6A 4Q4Y2 1QJY3 3VDDB 2MEV3 2RS32 4QPIB 1VBD3 1RUD1 1RUC3 4N43A 3JD71 4Q4X1 5BNNC 3JBG1 2WLPA 4CDWC 4JGYB 2GSYA 2RS13 5C4WB 1D4M2 1RVF3 5C9AC 4Q4W3 3M8LA 4YVWB 4CEWC 5AC92 2XPJA 1COV2 3VBUA 1EAH3 1TME1 4WM7C 1VB4A 4N43B 1H8TC 1ND3A 1POV0 1QQP1 1EV12 2RMU3 2PLV3 1RUI1 1AUYA 3HAGA 4RHV1 1VBD1 3NAPA 5FMOL 3TN93 5LK7B 1VRH3 4CDUC 5JZGA 4GB32 1RMU2 1NA1A 1R1A3 4RS5C 3VBFA 3VBUB 1R092 2DF7A 1NG0A 2WZR1 1TMF3 1HRV2 1ND3B 1HXS2 3CJIA 1BBT3 2XBO2 1VBC1 1VBA1 4FSJA 4AEDC 2WS91 5L7OC 3VBRA 3NAPB 2R072 4CEYA 1R082 1RUD2 4IV3A 5JZGB 3JD72 4Q4X2 3J8F2 2PLV1 1NA1B 1AR91 1RUE2 3VBFB 5A32A 1OOPA 2RM23 1VRH1 1BMV1 1HRV3 3ZFFC 3CJIB 1ASJ1 1OHFA 5DDJ1 1R1A1 1FOD1 2BFUL 3VBRB 1AL23 4CEYB 1RUD3 1RUH3 1TMF1 1TME2 4CDQC 4IV3B 4QPGA 2HWD3 4RFT0 1VBB1 3VBOA 4Q4X3 3JBG3 1PGL1 1AR81 1QQP2 1RUI2 1QJY2 5A32B 1OOPB 4RHV2 1VBD2 3JB4C 4Y5Z0 1ND2C 1RUC2 2HWC1 1C8M1 1K5MA 1Z7S1 1AR73 2RS12 1RHI3 2BBVA 1TME3 1AYM1 1X36A 4PDWA 1QJX3 4QPGB 4IV1A 2R061 2WZR2 3VBOB 3VBSA 2R041 1QQP3 1F2NA 1RUI3 2HWF1 1AL21 4RHV3 1EAH2 1NY71 1RUH1 1M06G 2HWD1 5C8CC 2Y26A 1K5MB 2RMU2 1HRI1 2PLV2 4N53A 1B35A 3IDEA 1MQTC 4PDWB 3TN92 3ZFEC 1VRH2 2WZR3 4IV1B 3VBSB 4RR3A 4QPIC 1PO23 1VBC3 1VAKA 1VBA3 4RS5A 5DDJ2 2HWE1 1AR71 2WS93 1PO11 1R1A2 1RHI1 5K0UA 1A6CA 4Q4V1 1QJX1 2BUKA 4JGYC 1TMF2 2ZZQA 1E57A 1BBT2 2X5IC 5ACA1 5C4WC 1PGL2 4N53B 1B35B 1AR93 3DPRA 1FPN1 1PVC3 2TBVA 1PGW1 4YVWC 1AL0G 2HWC2 1SMVA 1C8M2 1PIV1 4RR3B 1ASJ3 2FZ1A 4RS5B 5DDJ3 1FOD3 5K0UB 1RUF1 1MEC1 4N43C 4YVSA 2RM22 3ZXAC 5CFDA 5D8AA 1VBB3 2R062 1F8VA 1RUG1 1PO21 2R042 1AR83 3DPRB 1V9U1 1AL22 1VBE1 1NY72 1RUH2 2VQ0A 4CDQA 4WM8C 2HWD2 2HWC3 4RQPA 1C8M3 3JBG2 3VBUC 4CDXA 1HRI2 1POV3 1Z7S3 2RS51 1PVC1 4YVSB 1ND3C 4GMP1 1FMD1 1AYM3 5CFDB 3FBMA 5D8AB 1OPOA 2R063 2RS31 2R043 3ZFGC 3NAPC 3S6PA 2HWF3 1AR72 1QJU3 1RHI2 2HWE2 1NCQA 4JGZA 5JZGC 4Q4V2 4CDQB 1CD3G 5BNOA 1QJX2 4FTSA 1NA1C 4RQPB 5CFCC 3VBFC 5BNPA 4GH4A 1D4M1 4Y4YA 1NCRA 3VBHA 4CDXB 1HRI3 3CJIC 1AR61 5AC91 5BNNA 4CDWA 3VBRC 1POV1 4CEYC 4NWVA 1PO13 2HWE3 1NCQB 1EV11 1RUF2 4JGZB 4Q4V3 1MEC2 5BNOB 5C9AA 5J98B 5BNPB 4GH4B 1C8NA 1NCRB 4CEWA 4FTEA 3VBHB 2HWB3 5ACA3 1OOPC 1PO22 1VBC2 1VBA2 1ZBE3 5FMOS 1QJU1 5ABJC 2WS92 1FPN3 4WM7A 1VBE2 4NWWA 5BNNB 1H8TA 4FTBA 1AYN1 4CDWB 1R091 2X5IA 1PIV3 1RUJ1 1AR92 1HXS1 4QPGC 1RUF3 3VBOC 2RS52 1MEC3 1PVC2 4CDUA 5C9AB 1BMV2 1WCDJ 3VDDC 4CEWB 2R071 1RUG3 1R081 1ASJ2 1FOD2 1BEV1 4WM7B 4SBVA 3J8F1 1V9U3 2WFF3 1VBE3 1K5MC 1H8TB 1RUE1 2ZTNA 1VBB2 2X5IB 2HWB1 1AR82 4AEDA 1ZBE1 4PDWC 5L7OA 2RR11 4IV1C 2RS53 3VBSC 4GMP3 1FMD3 4CDUB 1ZBA3 1AR62 4WM8A 4Q4Y3 2RS33 2BFUS 1Z7S2 2FZ2A
chains in the Genus database with same CATH superfamily
2VZUA 2ZS6B 5K4LA 5FPLA 5A80A 3ZFFA 2Z4FA 4PLNA 1OSGA 1ODMA 2WN2A 5F2WA 4A4AA 2QQPA 3KCXA 1OFSA 4AL9A 4H55A 3R4SA 1UMIA 3ZFGA 1O4ZA 1W9TA 2DV9A 2XUEA 1EUUA 4EQVA 1UKRA 2E63A 4AVAA 1C3HA 1GZCA 2WFF1 4IETA 1W2NA 2VMFA 4MLOA 3ZXKA 3K2OA 4WM8B 4FPEA 4EYUA 4OYUA 1AYN2 1XB9A 5F6LB 2EXJA 3E97A 1DHKB 2W87A 5FP3A 3V0BB 5A3PA 1RVF1 4J1WA 1ACCA 2RE9A 4ZS3A 1NX9A 4L0PA 4A41A 1N3OA 4I0BA 4YNIA 1W8FA 5FWJA 2L9LA 3MPBA 1UOFA 2VW2A 4HG6B 2WNVB 4Q4Y1 3ZR6A 5FZ1A 1RIRA 3A21A 3KGZA 1VAMA 4L9BA 3RDIA 1W6MA 4LPLA 4HL0A 3GDBA 3LCPA 2G9FA 2ZX4A 4DUWA 1O5UA 4RN5A 1SLIA 1OH3A 1PO12 5FYBA 1J3QA 3GM8A 1BEV2 5A7OA 4GB33 1HN1A 4ASMB 3K46A 4UFKA 2IXHA 3JB8A 5CYYA 5FMCA 4KBBA 1WWYA 4BK4A 3ATGA 2C9KA 1UAIA 3H8UA 5BYNA 5FPUA 2OA2A 3USSA 3VKFC 3KZ4C 4DY3A 1R093 2Q1ZB 2RDQA 3OSDA 2CWMA 1RUJ3 2HWB2 3BGAA 5DG1A 1Q3EA 5E6HA 3UKVA 3L2HA 4E2QA 1ZBE2 4B4RA 2ET1A 5D8AC 3H7YA 5GALA 1LU2A 1VMFA 1COV1 1ND2B 2EA7A 2QQJA 2ZGUA 3S7IA 2WWUA 2WIIB 4QKBA 4FAHA 4QMAA 5IK5A 5A33B 4CPBA 3BKZA 4LTAA 4KQ7A 2QVSB 2R073 4WVVA 2Y64A 3ZYGA 5JVVA 1R083 5JMCA 5BXXA 4FPHA 1VJ2A 4Z2WA 1MQTA 1HN0A 1BBT1 5I0SA 3VD3A 1BKZA 2JG9A 3AYCA 5FZHA 4D94A 2VAUA 1UZZA 4NIHA 3H8OA 1RTVA 3ZSLA 4OHZA 4BQ2A 3VKMA 1NKGA 2BJSA 2IZWA 4NJ4A 1OPMA 3RZZA 5FOJB 1FNZA 4XETA 2J1SA 5E8AA 1H2LA 5FCCA 5ABJB 2B5HA 4CCKA 2VZOA 3GJBA 5JSPA 1V9U2 2WO7A 2RHPA 3ZXLA 3T2TA 2G1MA 1LEDA 1DGRN 5J36A 4A44A 1S2BA 5I8YA 4JGZC 1HRV1 2BZDA 2O8QA 1E5SA 1DGLA 4DEVA 4QB2A 5EJ1B 3LSDA 4BE3A 4BQ4A 1KRIA 2R7EB 1WW6A 4LEJA 3AX4A 1J58A 4YVWA 2QJVA 1A3KA 2HYKA 4FP3A 3VBHC 4PBPA 5J1XA 4A6SA 4FFFA 5F5CA 4OQ8A 4AI2A 1DLLA 1CESA 4QPIB 2QQWA 1RUD1 4WVZA 4XF3A 1PZ8A 4IL7A 2W47A 4FOWA 4HSJA 4MGIE 3WT3A 4N43A 3JD71 1JXNA 1DBNA 5FUNA 3BIWE 3KMHA 5I0DA 2ZGLA 1H9WA 2J7MA 4H14A 4P00B 5C4WB 5JXHA 3O5SA 2O8OA 2RJKA 4LO4B 1RVF3 1JZ6A 2FDGA 4UWDA 1ULDA 3FMGA 1OBNA 1UY3A 2IXCA 2VQTA 4M3CF 2D43A 3FN9A 1NE4A 5IJRA 2DCYA 5FMBA 3AVSA 3CJXA 4GXLA 3B7MA 1XNBA 4MO3M 3OD0A 1AXZA 1UOJA 1GP6A 1AZDA 1IKPA 4QHOA 1HB2A 3EJKA 3ON7A 3ACGA 1QU0A 1QOTA 2B8MA 4TXWA 3RS6A 1DZQA 4AR2A 5EP9A 1CQ9A 1BZWA 1ZX5A 3QH6A 3ACIA 4LBQA 4Y22A 3WR0A 2LUWA 4XXAA 1CPNA 4J25A 4CXYA 1NLSA 3WZ1A 2XVGA 2QZ3A 1BVVA 1QOSA 2ORZA 4QGLA 3HAGA 4Q5OA 1WUVA 1CZSA 1CAUB 3TRSB 4B1MA 3VD4A 3U4SA 4KWKA 2WT0A 3C7OA 3M70A 1FYUA 3IT8A 5LK7B 4MGTA 2ARXA 1VRH3 1GWKA 1UIJA 2FCVA 2ZGPA 3B00A 4Q2FA 4ZONA 5ANNA 2HH9A 3LDBA 4DQAA 3NV3A 5IVYA 2P3IA 3T2OA 2J42A 4GB32 4AFMA 3FLRA 1V6KA 1CN1A 1NA1A 1OLRA 4X6RB 2Y6LA 3KF3A 3RYRA 3D8CA 4AI3A 1R1A3 4HVRA 1JYIA 1UD1A 3VBUB 4IW3A 3WG4A 5FLIA 1D2QA 1R092 3MV11 2GNDA 4XABA 2VXRA 2NP0A 1NG0A 1YUDA 1BVP1 4BLIA 3AP4A 5HXVA 3SNMA 5A1LA 4B29A 5DG2A 1BBT3 4QKFA 4XJUA 1D4VB 1JHNA 1ZYBA 1C57A 3MV01 1VBA1 2VQUA 2H0BA 2GP3A 4Q26A 2CGPA 2WS91 2VZ3A 4FSJA 2X53S 3M3IA 2AREA 4FCAA 2YC0A 3NAPB 2R072 4JRLA 1U0AA 1ZNPA 1R082 4FXKB 5CB7A 1Y3TA 2DYCA 3PVNA 1A8MA 5JZGB 1UZ0A 5IHRA 4Q4X2 2PLV1 3I54A 1UU5A 2WSUA 2Z42A 4CCDA 1AR91 2ZGOA 4D69A 4HOOA 3LEMA 2XGXA 5A32A 3MICA 4GJZA 3KVBA 4HONA 4LKDA 1PHMA 4KNCA 1HRV3 4BWOA 3K3NA 1N1VA 3HNYM 1WCQA 5FZAA 3WNLA 5I8TA 4P9XA 1Q5OA 3CJIB 2WAAA 2VMCA 3MFCA 4ZS2A 4CP0A 2V5DA 3WV6A 3K4ZA 1W9FA 3OYWB 4CVUA 5AFBA 1N1YA 1FOD1 1HW5A 1LOEA 3IKWA 4XE9A 3S5AA 4FT8A 1RUD3 1TME2 1TMF1 3NO8A 4CDQC 5JSOA 5FZ7A 4QPGA 2VC9A 4R4ZA 4RFT0 3VBOA 1YLLA 2V73A 1PGL1 3CU7A 1LECA 2J1TA 4R52A 3ORJA 1QQP2 4FPLA 4CCEA 1SBDA 2VE1A 3H1YA 1RUI2 4DINB 5JR7B 4J6GA 1S4CA 3AYDA 3N9MA 1LHNA 1OOPB 4P9LA 3BB6A 3W5NA 2E31A 1UQXA 1SFPA 4QXHA 2BWAA 1XNDA 4GAZA 5C3QA 5LA2A 1K5MA 3OB8A 3K51A 4NPLA 3ZN5A 5CKNA 3B94A 2YGLA 1ZREA 3IMNA 4PLMA 3WLUA 1YQ2A 3I3MA 1JH5A 2ENRA 5CIRA 3RYPA 1W8WA 2BBVA 2XWBB 1YYNA 2VZSA 4JTNA 5FLHA 4MADA 3KHCA 2Z79A 4IV1A 2FDKA 2D40A 3VBSA 2CSGA 3MIDA 4E4DX 5FY7A 4TTGA 3AKRA 3MBWA 3OGRA 2E9QA 4NHLA 3ZYRA 4AAXA 4Y4RA 1AJKA 2DU0A 5I0TA 2HLEA 2PAMA 1Y9GA 4COUA 3PNAA 2X8KA 5C5UA 1QMJA 1RUH1 3OCPA 3H3ZA 4K1ZA 1TVGA 5FZBA 3I49A 3C7EA 3MLLA 4KGGA 4L99A 2YPDA 3T4VA 2Y60A 4FQ4A 2D6KA 1X8EA 4ARYA 4P9WA 1NT0A 1W6OA 2VVDA 3U07A 3WQ7A 3WNNA 2W68A 3NNMA 4KH9A 3M2MA 1K12A 2FQPA 4ONUA 1CX4A 2DFCA 3LB9A 5F37A 1OVSA 5FQ0A 4IEOA 1OF3A 1L3JA 3AP7A 3LZZA 4R8HA 3WW1A 3ZFEC 4CUAA 1VRH2 1FI2A 2EIDA 2ORXA 3CO2A 4LBLA 3ME2A 1D0HA 2IXJA 4LOTA 2Q8DA 4AZZA 4A45A 1MS1A 3NW4A 4HT1T 2PHLA 1VBA3 1R1A2 1RHI1 2WS93 3BODA 3LKJA 5IUQA 5FKBA 3ZMOA 4K20A 1QJX1 1EP0A 2BUKA 4JGYC 3GGLA 3U37A 3ES4A 2E7TA 2OPKA 5F1RA 3MIBA 4QM9A 1BBT2 4BLJA 5ACA1 3H1WA 3AZVA 2GN3A 4B3NA 1AR93 3WF1A 4BZ4A 4XC9A 2FMDA 2VTFA 4XUNA 4Z07A 2Y38A 2TBVA 3SH5A 4X6QB 2ZHLA 2W2IA 4AI1A 5CVRA 4QDRA 4XURA 4W8JA 4YGEA 4KWLA 1PK6C 3S5QA 2O1QA 1AL0G 3A0NA 3SISA 1GANA 3N3HA 4RR3B 5LBBA 4PLOA 4DXRA 1XXNA 2WFPA 3AMMA 1IPSA 1FOD3 1H1AA 3LWCA 5K0UB 3ZLIA 1UY0A 2ATFA 4AQ6A 4EN6B 5BY5A 2PTMA 4MHUA 2B9VA 3NVCA 3SCFA 2PHWA 2ZACA 2ARCA 4I0AA 5D8AA 5FIXA 5FO7B 1FT9A 2R062 4NR1A 2XB6C 3WF2A 3WUCA 1WKYA 1IG3A 5CG8A 3R05A 2R32A 3AMHA 2BGOA 3M3OA 3WDTA 2MNGA 3K3OA 1KITA 2JENA 2VU9A 3RG0A 1DZRA 3DN7A 1O8SA 5IVCA 2VQ0A 1K5JA 1CIYA 4RYDA 3GCXA 3TNQA 3LOIA 1JBCA 4NO4A 4NAMA 3UESA 2Y6KA 5LA1A 2AGSA 1VALA 2J1VA 2RS51 3DF0A 1ND3C 1FMD1 1VMJA 1W2AX 4Y5TA 1NQDA 3QACA 3FBMA 4E2GA 2R1BA 3LA7A 2EXIA 2RS31 1L7RA 4AEMA 5JR2A 3ZFGC 1J84A 1JOJA 1V6IA 5CKMA 1URXA 5LBCA 4IESA 3MZHA 4V1PA 1NZCA 3S6PA 5FZEA 5JMOA 1DQ5A 4ISQA 1QJU3 1YQ6A 3KT4A 3NRUA 3MUY1 3BU7A 4BQWA 5F8PA 4JGZA 5FP7A 5FZOA 4CDQB 1CD3G 4FFHA 1AX0A 3LF7A 3BPSA 4HVOA 4RQPB 1U5XA 3NWKA 4QX5A 4ZXKA 1D4M1 2JB4A 2WT1A 4R9AA 4Y4YA 3ZN6B 2Y6GA 1NE6A 2Y6JA 3VBHA 3SEEA 4BU2A 4NIGA 1AR62 4OI2A 3ACLA 2WUHA 2WQ4A 2DDUA 4Z2AA 5AC91 5BUVA 5K7PA 1V6OA 3LDKA 1CAWB 3PHMA 4KWUA 4ZU4A 1IZ3A 2XLFA 4XQWA 5GJ6A 3KV4A 4QGNA 1HLCA 2JG8B 4CE8A 4FBFA 2DUQA 3VBRC 3ZIXA 3T09A 5DZGA 2BNMA 4YW6A 2NMOA 5FMDA 3IZOA 2VW0A 4XBQA 4CEYC 1ULFA 3ENRA 2PELA 1RUF2 4XUOA 2VW1A 5BNOB 2Y34A 4CP9B 1VAVA 3W20A 2HBUA 1W2UA 3E6CC 1GYKA 4RGGA 3T08A 2ZX0A 1AXYA 3MW4A 2O0OA 1RXGA 3PUQA 4LHKA 4Y24A 5ACA3 1DGWX 3O0WA 1VBA2 1S2EA 4PI2A 2WS92 3PUIA 5T54A 4O65A 2UY8A 1X9TA 2XVLA 1YFXA 3Q9OA 2BRTA 5L9RA 5A7WB 4BYYA 4FTBA 1AYN1 1W06A 1H30A 2Z69A 3N36A 3UJOA 5JWPA 1JHJA 2CDOA 1XPWA 5FO8B 2WO3A 1AR92 3DYMA 4KG8A 1SEFA 4LO6B 2Z2SB 1LGCA 4YSFA 1H0BA 1F15A 1XQNA 2BGPA 4M0HA 2RDSA 1J3PA 2J1RA 2QQVA 1DQ6A 3ZPYA 3MIEA 4ARXA 1DQ4A 2BBAA 1C1FA 3VV1A 4Y1UA 4DY5A 1YIPA 4QWNA 1W6QB 1DLCA 1Y9QA 3K48A 2D3SA 2V09A 1JYNA 4PJYA 3RMXA 3VZMA 4C1WA 1V6JA 1FOD2 5C7GA 1BEV1 2ET7A 2VZ1A 4WM7B 3RZLA 1LODA 4QPYA 5JIAA 1V70A 4S2DA 4DMIA 3O14A 2W1UA 1ZZ9A 1H8TB 3GCWA 4GULA 5BV6A 3AZYA 2HWB1 5LASA 3T30A 4LHSA 1ZBE1 1HB1A 3D0SA 4XUQA 4M01A 2RS53 2ZHKA 2H6BA 5FPXA 2W3JA 3WP3A 1FMD3 3MUZ1 5H9PA 1S2KA 1W04A 4NAOA 4M3CB 2W39A 5FJHA 2DURA 1SPPB 1JZ3A 3B3QE 4O9EA 2RS33 1MZFA 4IXLA 4QQLA 5FZ6A 1KXGA 3W9AA 2ZGQA 3DGTA 1GP4A 4R4XA 1WLWA 2WC2A 3U4XA 3IBMA 3AL5A 4LNVA 5GLTA 5JOYA 4LA3A 5F3IA 5F5AA 5GLUA 3FL7A 4EZHA 2D6LX 5HCAA 2VGDA 4N53C 1H9PA 1BYHA 2WA3A 1LOBA 1Q56A 1TE1B 5FZFA 2Z5WA 1D4M3 4NIDA 2K0GA 3PJYA 2DCJA 3RZGA 5L7OB 2Q8EA 1MPXA 4BCUA 1QJU2 1UMZA 1ONAA 1NLQA 1US3A 5IATA 4AQ2A 2JE7A 2IWGB 5AC93 3WY6A 1W28A 5FZ3A 1JZ7A 2I45A 3GZAA 3I8TA 1XNAA 1Y43B 2Q1FA 2RS11 3KB5A 1ALYA 3V0AA 4UBGA 1CWPA 2YPJA 3BVCA 4ZZ8A 2G9ZA 4R9BA 1YIFA 5F6KA 4AI8A 5HXMA 1CJDA 3HQRA 3SITA 5FYZA 2EXKA 3CZJA 3ZFFB 2UYBA 1SFYA 5EWSA 4AG4A 3FX3A 3BYWA 4A7KA 2ZXQA 4YW1A 2JE9A 1JN2P 1S0BA 1ODNA 1H2KA 2BOJA 3DPRC 1EAH1 1ENQA 1O7FA 1QJFA 1YC61 3A22A 3ZFGB 3NSTA 2ZAHA 3N7LA 4LITA 5FY8A 1A8DA 3X29B 1HQNA 4META 3SH3A 2UWCA 1W3VA 1DYOA 3T1MA 4EV0A 5FZCA 4AVTA 3NV2A 2VNGA 5LB6A 2RMU1 3AB0A 4LE3A 2RV9A 3ZVXA 2BOIA 2PAKA 3KS7A 1S55A 3JUUA 2GMEA 3MF9A 1UPIA 1AYN3 4NUBA 4DFSA 3ZKYA 3FHQA 3UGFA 1RITA 4BM8A 3TN91 2ES3A 4OHVA 4YVSC 5ACA2 1V6NA 2VCMA 4MZUA 4CSWA 2QQKA 5CFDC 4UFMA 4F83A 4MUVA 2A6YA 3LDRA 4A2UA 2RR12 4KWJA 4CCMA 5CKQA 4D0QA 4OI0A 1YRZA 2YHJA 4WVMA 3O1OA 1QNWA 3O7OA 1LOFC 4PF1A 5FZIA 1LGNA 2CTVA 2XL9A 3H3LA 1W6MB 4TWTA 3K75B 1ULCA 4FPJA 4H2AA 3WP4A 2R0HA 1JW6A 2WWSA 2PHUA 1YWKA 2XUMA 3WP6A 2ZKNA 5C6CA 1H4GA 4BIOA 1HB3A 5JSRA 4IEQA 1BEV3 2XWJB 3O12A 2VCBA 4XCBA 1C5IA 3ZFEA 2BPA2 2CDPA 4XDPA 2ZOEB 4NRMA 1KS5A 3I2KA 1S0CA 4YWAA 1REFA 1GFF2 2MEV2 2A73B 2OT7A 4JHZA 2XQRA 4LLFA 4C8DA 3WG2A 3S7EA 4RL7A 3ZSJA 1D7PM 1GKBA 4GB31 2ZMLA 2VY0A 3AKPA 3PIJA 3POYA 4JGYA 5GZFA 4B1LA 5IT6A 3HT1A 4BDVB 3LOBA 4QU1A 4URAA 3FLPA 3AP6A 5GM0A 4QKNA 2BTVC 2YY1A 4QDSA 3UT0A 4QM8A 5IK7A 1MQTB 1RL3A 3OGVA 3WNKA 4AEJA 2VVEA 3VGIA 2P6HA 1KDKA 2O14A 2JG9B 3ZIWA 2NYYA 1FMD2 4BOWA 5BNPC 1DDLA 1NCRC 3NJXA 1PK6A 4GMP0 2KM2A 5CU1A 4AFDA 1OUXA 3PUSA 1UW8A 2RS32 1BJQA 3A4UA 2K9ZA 4XTMA 2WRAA 5IW0A 3SC7X 3GZTB 3ZXJA 5FYTA 3C7GA 4Q4X1 1JS9A 4YW2A 3SMHA 2WLPA 1ULEA 2WZEA 4OI4A 1I1EA 1VE0A 2XKPA 2WNEA 5CADA 1IPKA 1W9WA 5D21A 4YM0A 5JAXA 1W8TA 2RS13 3QBQA 3VDCA 3I3BA 5FJKA 1UN1A 1D4M2 4MXWA 2NLRA 3WD5A 3LA2A 5DZEA 5I0RA 1X8MA 1GMMA 1F31A 3OPZA 5C9AC 1GWMA 2FBEA 3CBNA 5FY5A 3EMRA 2OVUA 4YVWB 1N47A 3WG1A 3BN6A 5AC92 2B46X 2OQ7A 2XPJA 3SH4A 1KS4A 1WCUA 2E26A 5FPZA 4BXSV 3J7LA 4RSUA 1EAH3 1TME1 4K6BA 2A6VA 2LTNA 3V64A 4IE4A 1U5IA 2XHKA 3VL8A 2ZA9A 5GLWA 3VZKA 4C0BA 4BIFA 4BQXA 4CCJA 1ENXA 4N43B 2VUCA 3LEKA 1ND3A 2C26A 4I2OA 3DV8A 3NQHA 1QQP1 1XU1A 2YROA 4Q0QA 2RMU3 2P3YA 3AFKA 4BISA 4E9KA 4CRQA 1RUI1 5DQ0A 1GP5A 4N7UA 3P5BA 3A23A 1JOBA 1WMEA 4XMIA 5FPBA 3TN93 1XYNA 3U10A 4F3JA 5B4NA 5JLVA 2PYTA 1AF9A 1BK1A 3POFA 5FK7A 1DU3D 1K42A 4CCCA 1H6YA 5IWFA 3S57A 3MHZA 5FP8A 3KCCA 4CCNA 5C3SA 3AKQA 4M0NA 3WW3A 1W9YA 4EWDA 1HKDA 4LBQB 3VKNA 2J1EA 4Y22B 2JDZA 2XJRA 4PCRA 1AX1A 3WNXA 3POGA 4M4PA 5A3NA 4R9DA 4I01A 4JVAA 5K8SA 2VVFA 3ILFA 4AEDC 1UX6A 4PF5A 5FZKA 3E1F1 5A1AA 3VBRA 3AMQA 5DUVA 2WA4A 4CEYA 4KL1A 1REDA 2P37A 4IV3A 1I5ZA 1QXJA 2VNOA 4LQRA 3OGGA 2R1DA 3F95A 3THDA 3VB9A 4RA0A 5ANQA 1NA1B 1YFYA 1SDWA 4DXSA 5LEJA 4LHLA 4O61A 2G4IA 3W58A 1F5JA 1VIWB 1VRH1 4LKSA 3C8XA 3AFGA 3OOXA 1OH4A 1QOOA 1SG3A 3HWJA 4YFZA 1ASJ1 4XW3A 1OHFA 2VBPA 2ARBA 4IE6A 5EYYA 1R1A1 2FDFA 2UWBA 4GALA 3VZOA 1KFUL 1AL23 2QQNA 4Y3OA 4LO8A 2E6VA 4OLLA 1MS3A 1ZZ6A 3I3EA 2HWD3 4UXAA 3CZUA 2A6XA 2A5ZA 2GNMA 3I2GA 4Q4X3 2R6QA 3WHTA 2WO2A 3RRDA 3OEBA 3OJBA 5LBFA 3WVJA 2GDFA 4FQZA 3U11A 4YM3A 2B42B 5JOZA 2F4LA 5A32B 2CYFA 5FK8A 1CX1A 3IM0A 2R49A 5FYIA 4LE4A 4E4SA 4MGZE 4LBMA 1YQ8A 2WO1A 2JXAA 3NJVA 3PU8A 4LOSA 3WF0A 3TEXA 3UKTA 2VZTA 2IXIA 4I3GA 1QH7A 1Z7S1 4IEWA 2RS12 4PHZA 5CISA 1TME3 1AYM1 2RVAA 2ADEA 2VMDA 1IOAA 3WNPA 5JOXA 2F17A 2WLQA 4QPGB 2BYVE 2R061 3VBOB 4A42A 1N1SA 4QPWA 4BH9A 1PGSA 4DUXA 3HPNA 1XU2A 3CLPA 1RJ7A 1QQP3 5GZEA 1DIWA 3M3QA 1SBFA 1MS9A 4KGQA 4QGMA 4ZZ5A 5KHJA 1RUI3 3GJAA 2E53A 2HWF1 1PZ9A 4JTOA 4W6YA 1EAH2 5E88A 3O1UA 1AX2A 3KHBA 4GKXA 4KMQA 3D82A 3MFAA 4PQ9A 5C8CC 4DZGA 2YBPA 4XJZA 3GBGA 1K5MB 2GZWA 3D6EA 4BB3A 3E5QA 1G7YA 2VMIA 3N35A 2RMU2 2BQPA 2W5FA 1LAJA 4QT6A 4XIKA 4N53A 2VPVA 3VHOA 2NMNA 5EPAA 1SHWB 3TN92 2DCKA 4IV1B 4NN0A 3RWNA 3VBSB 1UOBA 1X82A 1XNKA 2C9AA 2ZJCA 3R4DB 2WABA 4K8FA 1PO23 1W8ZA 4YG3A 3THCA 1JZ4A 5IVJA 2P3KA 1IG0A 3MIFA 4COYA 3BI3A 2JIGA 1ENSA 5A7PA 4Z8BA 3AXEA 3ASIA 3IDBB 5A3UA 5FTTC 3H42B 1E57A 2VZVA 4NHKA 2D97A 3BTZA 2W9XA 2D6MA 1W6OB 4Z1VA 3MW3A 3ALQA 2D5HA 3DPRA 5ISLA 1FPN1 5F7UA 1PVC3 3LAGA 5FQ0B 3QOPA 1PGW1 3WCSA 2LS6A 1GZWA 2YUEA 4UFHA 4ASLA 3B93A 3HQUA 3PURA 2HWC2 1SMVA 3URFA 1C8M2 2W1WA 4JKMA 3P6BA 3USUA 3ZYFA 1ASJ3 1U12A 4E8DA 1OQEA 3FHAA 1W0NA 1QDOA 1MS0A 2JJ6A 1E5IA 3MPPG 1RUF1 4DB5A 3IPVA 4YVSA 2Y6FA 1E5RA 1IS5A 2ARAA 1YQCA 4ES8A 1FV2A 1C5HA 1GUIA 5CFDA 2QBXA 4UOJA 5FYVA 5FYUA 1A78A 5GZGA 1F8VA 1I5PA 3T0BA 4I3PA 5HBAA 4QX8A 1AHSA 1XNTA 4IEVA 4YGBA 1LOFA 3MYXA 4FPGA 4N7IA 1QXRA 3J7MA 3C7HA 3RWKX 1AL22 4QD2A 3K4DA 1UIKA 5EJ3A 3WP5A 4CU8A 1KJRA 1U5ZA 2D44A 2YG0A 2JD9A 4RGAA 2JDPA 2ILMA 2HWD2 4XF9A 2WNUC 4CCLA 2IC1A 3WHUA 5HV4A 2CAUA 3UK9A 3WW4A 1HRI2 5CEHA 3J4UH 1Z7S3 2YGMA 3RJRA 1W03A 4GMP1 3POSA 5D1IA 3JZVA 4P5HA 5DUUA 3T4HB 4FPYA 1AYM3 3WEZA 3MO4A 5D8AB 4MOAA 2SBAA 2PXJA 2R063 5FXXA 2XR4A 5A7SA 4N8MA 5T52A 2XQXA 3I7DA 3H3UA 1YCIA 4FVVA 4C1XA 4DRRA 5IAXA 4PI0A 1W6NA 2WQZC 2HWF3 1UZWA 4N9IA 2HWE2 3ILNA 3U14A 3UYJA 4A6OA 4Q4V2 3NMBA 5F5IA 2Q8OA 3QCWA 1CZVA 3E6BA 4LA2A 5J48A 1O3TA 3VBFC 1JOPA 2QQUA 5DAWA 5BNPA 4XFBA 1X7NA 1NCRA 5FXVA 3BTXA 3DKWA 2XDVA 4LK6A 3NV1A 2YFUA 3PVEA 4IDZA 4HXCA 2WWJA 4ZXEA 5JIUA 2VUAA 1X50A 4QQPA 3TEZA 1V00A 4A3XA 2DUOA 1UU6A 1LHVA 4K8RB 1UY1A 3ZSKA 1R64A 4QX1A 2AACA 2EIBA 3FZ3A 4FPCA 5KHIA 3W5MA 1LENA 2TNFA 4G9SB 4NWVA 4S2HA 5I93A 4AE2A 3O0VA 2NPIA 2YV8A 4ATFA 1G9CA 1DQ0A 1EV11 4JGZB 3N7KA 4PIZA 1MEC2 5FZMA 5FZOB 1WA6X 5C9AA 1C4RA 4Q0VA 5KHHA 2Q30A 1DZTA 2DFBA 4P02B 1OLME 4IGOA 4AHYA 2VZRA 5JI7A 1C8NA 1QWRA 3VBHB 2VECA 2DBIA 2Q8CA 5KXEA 2WBKA 1PO22 3RGBA 3ABZA 3HBKA 4CXXA 1QJU1 2X29A 4M4RA 1FPN3 3U78A 5LZ6A 3KT7A 4UW5A 2XH6A 4MYEA 1O4YA 3E5UA 3SLIA 1SCSA 4JV4A 1SLAA 4OUEA 5FYMA 4K7JA 3K4AA 3BPZA 2X5IA 2OQ6A 2QFEA 1W2OA 1WA4A 3L2YA 2DTYA 2VOWA 5A6ZA 5LCWL 3RZMA 1HXS1 1QEXA 3I3DA 5ERLA 1RUF3 3FFZA 1PVC2 4Y1YA 4XFHA 1UZVA 2FCUA 4LKFA 3VKOA 4COVA 4GZ9A 5FR3A 1MS8A 2GMPA 2W1QA 1O4TA 3C2UA 3J9SA 5LBEA 4XUTA 1TQ5A 4QKDA 1ASJ2 3ZXGA 2XJVA 5L73A 5KXDA 2G9GA 4AHXA 3J8F1 3JU9A 4PIYA 3S0MA 4YYOA 1V6LA 2C24A 4QXCA 3VHPA 1BCXA 2YFZA 2ZTNA 2CNAA 4KU8A 2GC3A 4AEDA 1WD3A 4A7YA 2OXBA 4PDWC 2RR11 5LK5A 4A3ZA 1LGBA 1V0AA 2YC2A 4GMP3 4CUBA 1ZBA3 1ZM1A 1UYYA 4XHBA 1QDCA 3WSOA 1W8HA 2XONA 3R0RA 3HN1A 4AHZA 4JX0A 1RGSA 2DCZA 3D5OA 1RUNA 4QHBA 1U5YA 2A1XA 4QAWA 2GMMA 1SLBA 4HPKA 4MG2A 5FOBB 1Z7S2 4XF0A 3OUJA 1H2MA 3OUHA 5EYXA 1OA4A 2R16A 1AYM2 1SLTA 1JUIA 1ZA4A 5FBZA 3PIGA 1QJY1 3M3EA 3POBA 4GA9A 1B35C 3OTFA 4MX3A 2FD8A 2MEV1 4GWJA 5KXBA 3WDUA 3HEIA 3F2ZA 4XAEA 4CP1A 2JDMA 5HCBA 1RUC1 1O8PA 3FHIB 5A3TA 1E5HA 1H1IA 3C7FA 2NM1A 2HWF2 3GBFA 1YI9A 1HQWA 1UYZA 1GWLA 3ZO0B 1CONA 5FKCA 1S0EA 4M00A 4LXLA 4WZCA 1G9DA 5CFCA 2P34A 2XG3A 4GJYA 2VOTA 3UGGA 3SKVA 4YZ5A 3H1MA 1Q8VA 2JECA 2ZX2A 3NV4A 2GH8A 1MS4A 1UWWA 1CAXA 4JC1A 2VZQA 5FRAA 4P9GA 2QTWB 2CAVA 2ZGNA 1EV13 5FAXA 2DTWA 3T2QA 1YNAA 1MZEA 2YZ4A 4Y33A 4FAGA 5T5LA 2LM3A 2VOKA 5JOWA 3LFMA 2Y33A 4LORA 1QY4A 2BV4A 3RYKA 2C6SA 1RB8G 2TUNA 2V72A 1SDDB 1W6PA 1WW7A 2QQLA 2ZMKA 3D0JA 2PHTA 2I07B 4MGYE 5A6XA 1IHMA 4IERA 1RMU3 4Y26A 5GKAC 4Y20A 4EJRA 1W39A 2C1FA 3HD8B 1WZXA 2B45X 2JDAA 3N9OA 4GWNA 3GXUA 1PNGA 3HT2A 2XJSA 5C71A 3V0AB 5DAPA 3I3QA 3PDQA 5EV7A 2HKXA 5CNAA 4AFBA 3V56A 1ZRFA 1HXS3 2IXLA 1FPN2 2XBO3 4UYBA 1PGW2 4GD4A 5FBJA 5FFOC 5C8CA 1JZ5A 1S1AA 4HLTA 3P3PA 4EWAA 1ZZCA 2H6CA 3J7NA 3AMNA 2OS2A 4CU7A 4XIOA 1EUTA 3H7JA 4IV3C 4L11A 1Q8SA 3GHNA 3DXTA 3J8F3 3OEAA 2VUJA 5CA6A 5T50A 4YG0A 4CDXC 2X09A 1AXKA 3VDDA 1S0GA 1EYBA 2PHRA 3DL3A 5KWRA 3VHRA 3EBRA 1YHFA 4ITCA 4B8EA 3GHMA 3POEA 1PMHX 4FOQA 2RR13 4QQOA 4W4ZA 1X33A 4HMZA 4SLIA 2RG4A 3KVAA 3LPGA 2D93A 4WVMB 3RQ0A 3THPA 3Q8AA 4XJAA 1DGWA 1X9PA 2P6CA 3OD4A 3BU0A 1JI6A 3P1IA 1NCQC 4Q0SA 3KV5A 4K3UA 3TBDA 3HNMA 3QLQA 2KR2A 2RJ2A 3KM5A 3KSCA 2PHDA 4TLFA 4GH4C 4Q4W2 3ZFEB 1ZBA2 1GR3A 3IDCB 4XACA 3JCIA 3ILRA 1QJY3 4YARA 2MEV3 1VBD3 4ES9A 2P2KA 3ZYIB 1LJ7A 4OUSA 3E6DA 4AWDA 3G6JB 1O3SA 1RUC3 2CHHA 4I09A 5BNNC 1EY2A 3JBG1 3A7QA 2J1UA 4CDWC 3EXUA 2ZGMA 3I2FA 4JGYB 1WMFA 2GSYA 3HBZA 3LE0A 5FP4A 4K21A 3ELNA 3UKNA 3T0DA 4S2GA 5L36A 1OD3A 3ZOIA 2HEWF 4MVTA 2VBBA 2QNKA 1UL9A 2ZX3A 4NIAA 5EZWA 4XCAA 4P9YA 4HZFA 2HEYF 1NLRA 1OC1A 3FJSA 5TSWA 4CEWC 1PK6B 1V6MA 4DUVA 2WNUA 1GV9A 3ZXFA 1I6XA 2R30A 3NNJA 2I2SA 2VZPA 2AR6A 5FY9A 1VB4A 4Q1RA 3I59A 3NL1A 4XZPA 2X05A 1LNSA 4K1YA 3OY8A 2DCTA 1HJFA 4EN7B 4NHXA 1EV12 5FZ0A 3I2IA 5FXZA 4CU9A 1TEIA 3IDAA 4C91A 4IEPA 4KI5M 1OQDA 3VZLA 4MXWB 2P5BA 5FMOL 3OGJA 3N9LA 5FZ8A 4CDUC 2PHFA 1NXMA 1I3HA 2YDEA 1OKOA 2F4PA 4AVCA 2TEPA 1UCXA 1O59A 1RMU2 2LRPA 2SLIA 4YM2A 4C90A 1SBEA 4DXZA 3NNGA 3VBFA 4XDQA 3WQ0A 2DF7A 4AW7A 3VD7A 4UI9L 2LROA 3UJQA 1KD7A 2ZEXA 1GU3A 1ND3B 1HXS2 2AEYA 4MSVA 5A1FA 2XBO2 4LKEA 1VP6A 1GZ9A 4Q8LA 4XF1A 2WNOA 3SCGA 1VBC1 2EVXA 3FE5A 5LA0A 4C0HA 3O1PA 4G3YC 4E4HA 1LCLA 5KHKA 3MIHA 3WF3A 2W95A 1R1ZA 4TSVA 1BK0A 1H2NA 2IFRA 2EAAA 3LPFA 2KA3A 4FXGB 3EQEA 2VXJA 4JZRA 4U2AA 5LEKA 3BIEA 2D98A 3U75A 3J8F2 4ORFA 2Y0IA 3H50A 2ID4A 4AF9A 4BPZA 5KHGA 5DAQA 4W6XA 2ZABA 5L19A 4V2VA 3H9AA 3CF6E 2WNVC 4XJWA 1JYXA 1WD4A 1STMA 2WT2A 3CEWA 4UF0A 4QX2A 5JUVA 1WW5A 2JDNA 1SFNA 5H9SA 1MS5A 1RYYA 2BFUL 2DVGA 1RXFA 5A3WA 1YEWA 4IEXA 5J7MA 1UPSA 4CCOA 3VBRB 1NXD1 4UT5A 4CEYB 5FUIA 2A75A 2YBSA 4IV3B 2YBKA 3GNEA 2UU8A 3K77A 5T55A 3JBG3 5GLVA 4D6SA 3FUOA 3ZXEA 1ULGA 1H4HA 2VJXA 3WINE 4PBOA 5IFTA 3RNSA 1QJY2 4LBNA 3QD6A 5LW9A 4RHV2 1W8OA 5FP9A 1VBD2 1AVBA 3DYOA 1JZ2A 3JB4C 3EHKA 3VKLA 1IQDC 1ND2C 1RUC2 2HWC1 3SXWA 1C8M1 4UW3A 2YYOA 1UY4A 4HK9A 4WV8A 3POJA 4AI9A 2BERA 4P14A 1UZYA 5C33A 1YJKA 2V4VA 1AR73 2WAOA 3CIHA 3HR9A 4ZU7A 1LRHA 1MACA 5C70A 2K46A 1PMIA 1X36A 3M7AA 1CIWA 3MEPA 4PDWA 5EXOA 3O1MA 2RJLA 5FLJA 2WZR2 1FV3A 4B7EA 4KU7A 4MGQA 4AOCA 3IN9A 4NE9A 2W92A 1B09A 1YQ5A 2QCSB 3U1XA 4XDOA 1WMDA 1TNFA 5KXCA 2VD7A 4FFGA 3I2DA 1AL21 4DS0A 3L9JT 3ACFA 4JCKA 2E7QA 5LRSA 4EE2A 1XC6A 3BCWA 3GZEA 1UXZA 4XBNA 2HWD1 4YM1A 5EQUA 5M0TA 1M06G 3OUIA 4YRDA 5H9QA 5LA9A 4ZU5A 2Y26A 2DUPA 2VNRA 4FOVA 1TG7A 4O9GA 5DABA 2CL2A 1HRI1 2ERFA 1G8WA 4M3CE 3WF4A 1B35A 1FXZA 4YZ2A 4Q29A 3IDEA 4XFIA 2GU9A 3PL0A 3WG3A 2GALA 2OZ6A 2DVFA 4W6WA 4BK5A 5F3CA 5E89A 1F9KA 4U36A 3PTYA 1Y4WA 5LY2A 4QPIC 1GICA 1VBC3 3BTAA 4RS5A 1WW4A 5DDJ2 2HWE1 2NZ9A 1A6CA 2Y8KA 1PNFA 3HQXA 4Q4V1 2AEZA 3UV9A 1ZZ8A 4OFGA 3AMPA 2JICA 3GF6A 5FREA 3ZPOA 4JDOA 5JXGA 3N7JA 1CGPA 5DPNA 1WLTA 2X5IC 4UFIA 5C4WC 3RFRA 2CWSA 3M1HA 1O91A 4LBJA 4N53B 1NZIA 5HI0A 1OUSA 2JE8A 5GZCA 3CNAA 1UXXX 3OBZA 2W94A 5IVVA 1CR7A 1N1TA 3DYPA 3RZHA 1G9FA 2VNVA 1F5FA 2VG9A 3PVBB 1PIV1 2DBNA 2VCCA 2VQAA 4JQTA 1VRBA 2QDNA 4BQ5A 3FBYA 1WBFA 2I74A 4ZPIA 5GLZA 2LW8A 1MEC1 1REEA 4OMCA 4XFGA 4RD7A 4E4ZA 2ZHNA 1HV1A 1PM4A 1SLCA 3B69A 1YJLA 2CGNA 1W99A 1RUG1 3WOGA 2W52A 1PO21 2R042 4OMDA 5AVAA 1O3QA 3DPRB 4LUKA 4L8QA 3ZSEA 4XVHA 1A34A 3ETPA 4ASKA 4LIUA 1NY72 1OF4A 1GZWB 2HWC3 1C8M3 3Q8FA 2PN5A 2WZPP 3JBG2 4IE5A 4Y1XA 3USUB 3VBUC 2D6NA 2ZX1A 4HKWA 5FZGA 3CHXA 4CDXA 2DU1A 2JD4A 3VD5A 1POV3 3ZR5A 2XHNA 2VBDA 4JKLA 1JU3A 1ZZBA 3EB7A 1PVC1 1W3XA 4DIQA 3IPVB 1W8UA 4YVSB 3ZDVA 4LIVA 4AXOA 5LY1A 2D5FA 2FHRA 5IK8A 4NHYA 5CFDB 5JI9A 1OPOA 1NUKA 1QF3A 4AI0A 1KGYA 4H3WA 1C1LA 2XLAA 3NAPC 4JDNA 2GP5A 2PQQA 5LWBA 4XJ9A 1HV0A 4COZA 2JIJA 1AR72 3IIIA 1UKGA 3LFIA 1NCQA 4MXVA 2IXKA 4D7SA 5JZGC 3RJ2X 1BHGA 4FTSA 1BLZA 4CP2A 3NNLA 1W2TA 5F3GA 1XYPA 1NAEA 5CFCC 2NN8A 1SLLA 4GH4A 4R9CA 4V2WA 4QB1A 5A7QA 4CPBD 5FDBA 5HCHA 4JDMA 3KD4A 1HRI3 2GNTA 2XLGA 1S0FA 1XNCA 4OZOA 5LATA 2MPFA 3VN4A 4IEYA 1YO8A 4XF4A 5DUXA 3CJIC 1Z78A 1AR61 2UYAA 3AVRA 3NKTA 5F39A 5FUPA 3VLBB 5J3UA 1IKQA 2EF6A 1JODA 5BNNA 5DAVA 5KBFA 4CDWA 2PHXA 4LO7A 4O7XA 2IUWA 3UETA 3RZKA 3ECQA 1IS3A 3HIFA 4NRQA 1W6NB 3R6SA 4AQSA 2VCAA 5A6QA 2HWE3 3LGRA 3VDAA 2DVAA 3PVOA 4GQ7A 1W9SA 4Q4V3 5T5PA 4AFAA 1JYVA 4NHMA 1OKQA 3OGSA 5FZ4A 5F9TA 1H6XA 2HJIA 2J1AA 3MIGA 5BNPB 3UGHA 1S0IA 3T2PA 1Q8PA 1NCRB 3B9IA 3ZSMA 1WLDA 4CEWA 5FZ9A 2OW4A 1OOPC 1XRUA 1VBC2 3EYPA 4YW4A 1WGPA 5FMOS 2VL4A 2BDRA 4EWEA 4JHTA 4QDQA 4E8CA 3N9NA 1XE8A 1VBE2 1GNYA 3THTA 3WW2A 1HDKA 5EFUA 3BOPA 4CXWA 3AJYA 2C0ZA 2IVIB 4XQDA 3T0AA 3OG2A 1PIV3 4LJHA 5IFPA 3H8XA 2R0FA 1J59A 2DVBA 5F3EA 3S30A 2WYSA 1MEC3 4LBOA 1DG6A 1O6UA 2E7AA 2ZZJA 1VMHA 4QB6A 4CDUA 5C9AB 1UYXA 3INAA 2EXHA 5FZDA 4FFIA 3VDDC 1NQJA 3WX5A 1RUG3 3DCQA 3RMYA 2ZGRA 1QNYA 5A70A 1CAVA 1OLQA 2J22A 4Z82A 3AZZA 5FO9B 3KLSA 4L92A 4SBVA 4XEZA 1ZRCA 4F7ZA 2WFF3 3VUOA 3AKSA 3PJQA 2YU2A 3ZYBA 1RUE1 3PUHA 3WQ1A 1Y9MA 4LO5B 4AVSA 2PFWA 2AENA 1PX4A 2X5IB 3FUQA 4HSLA 4EROA 5HPOA 3CMGA 5E1RA 3WDXA 5JDBA 2ZEZA 4IEUA 1T6BX 3E5XA 4IE7A 2WR9A 4LBQD 4OULA 1OD5A 4BMBA 2AYHA 4RFRB 2BP6A 2OPWA 3G7DA 4UFJA 3HNBM 3MLKA 4JQRA 3WCRA 1XE7A 1GQGA 4WM8A 4NIIA 4Q4Y3 5C3OA 2A6WA 4UFLA 2BFUS 5FV3A 4GWMA 1G86A 4AHWA 1LHWA 3SQOA 3N9QA 3V0BA 5FYHA 3KCYA 3DEMA 2A7AA 2LALA 4YZ1A 4XMAA 1WLCA 3LA3A 5G05L 3WUDA 1OFNA 4B4QA 4I30A 2WNVA 5CG9A 2ZGTA 4UAPA 3KQRA 4QU2A 5JCTA 2UURA 1VLNA 4MGKE 4AEDB 1ULPA 2D3RA 1ZZ7A 2IVJA 2WQ8A 4NMIA 3P3NA 3ZM8A 4Z92B 3N4MA 2YC4A 3FC0A 3V65A 2VULA 2DVDA 4IUGA 1G9AA 1AR63 3BALA 1COV3 4RR3C 4WBBA 4J1XA 2FCTA 5K0UC 1QJZA 1XBFA 1KEXA 1TZOA 2PAEA 3CKHA 5T3NA 3VDBA 1RUJ2 3UL2A 4HPKB 5FZLA 5K9YA 1LR5A 1W8NA 4Q0UA 4Q4W1 1ZBA1 4PT6A 3CDZB 4OHYA 4Q27A 1ND2A 3DKQA 5A3MA 1DQ1A 4RGKA 5A33A 4CZSA 3O0XA 2IFWA 4AGGA 2PMWB 4Y5SA 5KC5A 4UW6A 3AXDA 2C5DA 3POIA 4W50A 4YW7A 1K3IA 3KF5A 3TB0A 5EHDA 2PA7A 2ZKLA 1HIXA 3AZWA 1KQRA 1CVNA 1XE0A 5A3OA 3SHRA 4GIQA 3AM2A 5C8WA 3M3CA 3AKTA 2Q4SA 5CFCB 5J96B 3RZJA 4LLOA 1YXWA 3RI8A 5IVEA 1GLHA 2OYZA 5ABJA 1W90A 1CAXB 3LEIA 2X10A 4FO9A 2VR4A 4GKYA 4QHZA 1AJOA 1NOVA 4B7KA 4OVEA 3BTYA 1N3QA 2VTXJ 3AP9A 5I8SA 5DMYA 2KD7A 4TLGA 2VMHA 3OBTA 2P4EA 1ZVFA 4DNYA 1PVXA 4DPNA 1PIV2 2ZHMA 5C3RA 1W6PB 4YFWA 4NROA 1LHOA 2NQYA 3VHNA 4D7YA 3IIAA 3JD73 2A3WA 2JDYA 4RQPC 4Y20B 3KGLA 3MLJA 2AH2A 1OMIA 3FFQA 1RUE3 4CYDA 2EICA 1N3PA 3IWZA 1ST8A 2WDBA 2XJTA 3A0KA 4P08A 4S2FA 4QPIA 1RUG2 4YW3A 1S0DA 4KG0A 2W1SA 4DXTA 2ZAAA 1CPMA 1I9RA 1OLMA 1RMU1 2YMZA 2WFF2 3D4KA 2JG8C 5C8CB 5IVFA 1NYWA 1QIQA 3LQCA 4AFCA 1MZ5A 1CZTA 1BXHA 2OUJA 5C4WA 2RM21 1W0OA 1SZBA 4XZUG 2QQIA 1IPJA 3LIGA 5G04L 5BNOC 1T2XA 1RVF2 2XBO1 2P3JA 2RDNA 1VB2A 3PU3A 1L7QA 1P8JA 4MHRA 2EIGA 1C28A 4P9JA 1HX6A 4Q4Y2 3KT1A 3VDDB 1ULOA 2VO5A 1ZRIA 1POQA 2PQSA 4QX7A 1UY2A 1RUOA 1LEMA 2GC1A 1D0GA 1FX5A 1Y7BA 4IGPA 4BXFA 2OUHA 2CU5A 3ZYPA 2W08A 1M4WA 3TWIA 3I4IA 2OX0A 2XMLA 3TEYA 5F32A 4K9SA 1CAUA 2VUDA 2UY9A 2BU9A 4CA9A 1OXCA 3ZDSA 4AVBA 5SV5A 2QUOA 1UYPA 4HANA 1W0PA 4Q4W3 2E32A 1S0JA 3M8LA 2FMYA 4D3WA 4DOUA 2VMEA 4INDA 1COV2 2ZEYA 1YI7A 1XOYA 3VBUA 1PX3A 4HN1A 4WM7C 4L2NA 4OI1A 5FYCA 3W59A 3TOJA 4BHPA 3BUCA 4YLZA 3RVHA 1H8TC 5C3PA 1POV0 3NJZA 4LMFA 1Q8QA 3M4FA 4FOYA 2PLV3 3Q8BA 1AUYA 3O1TA 2JDKA 3VZNA 2XVKA 1J83A 4IEZA 4RHV1 1VBD1 1K45A 5EIYB 1OVPA 3NAPA 2BVVA 1LU1A 3HJRA 2V5YA 5JXJA 2VTXA 5EJZB 4H7LA 1F4AA 3I97A 2ZMNA 4YW5A 5JZGA 2JWPA 3AYEA 4LULA 1DP0A 2WNUB 1JYWA 4RS5C 2YU1A 4H7MA 3C3VA 3KQ4B 1JUHA 3B5LB 2ADDA 3LD8A 3GZUC 1JMUB 2WN3A 2WZR1 1TMF3 1HRV2 3I59B 3NJYA 4P5YA 2WL1A 5CBLA 3MF6A 3OY8B 4LUMA 3CJIA 1F4HA 4YZ3A 5GZDA 3J26N 4AVVA 4Q0PA 1L7LA 3OYWA 4QXBA 4XFFA 2D6OX 4XFCA 4DEQA 4AGVA 3JQXA 1DCSA 5L7OC 2A6ZA 2B9UA 3BOWA 2VM9A 4BMEA 1FAYA 3QH7A 2GAUA 3POWA 4N9HA 1RUD2 4EN8B 3MDPA 4FPKA 3O1VA 5FWEA 2ZPXA 1DGRA 3ZXDA 5FY0A 1APNA 2QQMA 3ITQA 3JD72 3DECA 5IVBA 1GQPA 1GBGA 4Q1PA 5T5OA 1RUE2 3VBFB 2FDIA 4MV2A 4QXKA 3TEWA 1DYPA 1WMXA 1OOPA 2K2SA 2RM23 4XOGA 4WZFA 1YFWA 4NPMA 3AC0A 3ZFFC 1BMV1 1OA2A 1IS4A 3WNOA 4D8MA 5C5TA 3AYAA 3LEGA 4UW4A 2OZJA 2ZBJA 4E27A 4ZKTB 2GC2A 1IQAA 5DDJ1 3HMYA 5D2AA 1DFQA 3VL9A 4CUCA 2W0XA 5JPNB 5DXDA 1RUH3 3HVDA 4Y1VA 2CV6A 1MVQA 1VBB1 2JDUA 4ZY9A 4PQQA 1AR81 1WCKA 3OF1A 3N9PA 4OUMA 1J1TA 2D6PA 2VOXA 4XILA 3DUIA 2BNOA 3SEPA 3H8RA 3I2HA 2EALA 3O1RA 3I2OA 3JQWA 2QZ2A 1H8VA 4BQ1A 2Q1MA 1SCRA 4Y5Z0 3AP5A 2HYXA 5B2GB 1DYKA 4DO0A 3PMSA 3IMMA 4TN7A 1ENRA 3IAPA 4UF0B 1MR5A 1IGOA 5L9VA 2BNNA 1F35A 2HBTA 2P17A 1RHI3 4HN0A 3ZKUA 1ZRRA 3DXUA 1WCSA 3HOBA 1QJX3 4HETA 5DN2A 3RPQA 5J37A 2C4XA 1WBLA 4D7TA 2R041 2WINB 1F2NA 2E33A 2XOMA 4L97A 5H9RA 3O1SA 5IAVA 3OPTA 4XTPA 2JX9A 4RHV3 3R4UA 4XPVA 4YG6A 1NY71 4AK3A 3CL1A 2WYFA 3JXSA 1LULA 2N7GA 3MI8A 4COWA 5AVPA 2QDRA 3AK0A 2P1BA 2EAKA 3WDYA 3ST7A 2YXSA 2PLV2 1UMHA 1G9BA 2H0VA 1CJPA 4HVQA 1QXPA 4EZ4A 1MQTC 2OKXA 1LTEA 3WDWA 2VOVA 4BQ3A 1QKQA 4XJ8A 2YB7A 4PDWB 2A3XA 2JG9C 2Q5TA 3I2JA 4QX0A 2WZR3 3ETQA 5CZKA 2GNBA 4A7ZA 1SQ4A 2A3YA 4DRVA 1HJGA 1LOAA 2JKBA 4OHWA 5APAA 4OHXA 1XSQA 5DZFA 1EPZA 4RR3A 2XJQA 5FY4A 1VAKA 1Z0HA 1RC6A 1RJ8A 3ZYJB 1AR71 1PO11 4XFAA 4AYUA 1RINA 4LK7A 5K0UA 5A6YA 3B02A 2XXZA 3WNMA 4XYXA 5L9BA 2F6BA 5I0UA 1TMF2 4W65A 3AL6A 2ZZQA 4FPOB 3FLTA 1OURA 1PGL2 2WZ8A 5IK4A 3WDVA 3MW2A 1B35B 4N90A 3KV6A 1ZRDA 4MGSA 4XHXA 4LHNA 4XUPA 1TNRA 5BNQA 1J1LA 1GOGA 1JTZX 2Y6HA 2ZCWA 3WXPA 4YVWC 1PZ7A 1MVEA 4I02A 1UU4A 4P9IA 1O5LA 4NRPA 1QHDA 1QH6A 5FY1A 3IAQA 2FZ1A 4RS5B 2G19A 3PUAA 5DDJ3 3ZX7A 4N43C 1IS6A 1UX7A 2RM22 3ROUA 3ZXAC 1LKNA 1JU4A 4TZDA 1VBB3 5FXWA 5JXIA 1XSRA 2VH9A 1D2SA 3GBWA 1AR83 1PMJX 3APBA 3FWEA 4ZHNA 3U0ZA 2JKXA 2XJPA 2UWAA 1V9U1 1VBE1 2RDRA 3GYDA 3HN3A 4CDQA 1RUH2 1JZ8A 5HCFA 4URTA 4WM8C 4RQPA 3KWVA 2BEOA 1UO9A 5BPXA 2ZGSA 4OCTA 3ZN6A 4D6RA 5F5QA 5FPVA 4BJ0A 3AZXA 2D3PA 1OA3A 3PMEA 3D3AA 4NPRA 4B4PA 5I91A 2ZGKA 1CAWA 5F2SA 1OQ1A 3ZMNA 2KXLA 2HEVF 5B4XA 3KV9A 2R043 5DUWA 2JG8A 4JAAA 3MGUA 1T6GC 2QKDA 2CGOA 4XXPA 5SV8A 4X8NA 1RHI2 4CUGA 4FI9A 3PLQA 2B4KA 1GOHA 4ISRA 3LIHA 4CTEA 4CU6A 4ET7A 4CP9A 5BNOA 3OBAA 1QJX2 4EN0A 2GN7A 4PIXA 3TAYA 1BQPA 1GNHA 1NA1C 4YGDA 1XJAA 2FDJA 1YFUA 2B7YA 1PM7A 4JKKA 4GWIA 4QQHA 3OBRA 1OT5A 3EO6A 4CDXB 3J7HA 4I0WB 1J3RA 3B9CA 1KDMA 1QGLA 2QE3A 1GQHA 5JPMB 4EN9B 4LT5A 2AUYA 2E51A 2JDHA 1G6NA 3RI9A 2D7FA 4HK8A 4HKOA 1JYTA 5A7WA 1LOGA 1ZA7A 3AJZA 4Q8KA 5IYYA 3Q8CA 4Y1ZA 2AC1A 3ACHA 1POV1 4F8AA 3NNFA 3OPWA 2Q0AA 1PO13 1QJEA 1NCQB 2QQOA 2WKKA 3SKJE 2MHFA 3TNPB 4KBZA 4XBLA 3CQOA 5J98B 1SACA 4AEKA 4D6QA 1KJLA 4AAPA 2Y0OA 3VZJA 1OI6A 2BVBA 4GH4B 2A71A 1LHUA 1Q43A 1W6QA 1UOGA 4FTEA 2HWB3 2W46A 1ZBE3 4LBKA 3W21A 4IGQA 5ABJC 1HQLA 3WQBA 1GOFA 1DF0A 3H0OA 2DWRA 4WM7A 4YZ4A 3ZN4A 3VD9A 1GSLA 1US2A 2W91A 1KFXL 4IQPA 5FPAA 5J09A 4NWWA 5BNNB 1H8TA 1XYOA 4MH0E 5A3LA 2BW8A 3LSEA 4FPFA 4CDWB 1R091 4WVWA 2JB8A 2XKOA 2OIIA 2CY6A 1RUJ1 4E2SA 4NOTA 3RSJA 4QPGC 3VBOC 2RS52 5HV0A 2VMGA 4YPJA 4K40A 3ZYHA 3GALA 1BMV2 1UNBA 2WJSA 4M3CA 1WCDJ 2EIEA 1JYCA 1EPWA 1SPPA 2V4AA 3IB3A 4XQ4A 1FNYA 5FYYA 2R071 4IE0A 4CEWB 4HKLA 1Q8OA 1R081 4HFSA 5KC6A 3SCHA 1GZTA 1FATA 5DAXA 4FP2A 1V9U3 3UNPA 1VBE3 1K5MC 3TYJA 1LOCA 4ATEA 5AFEA 2ZEWA 3B01A 2B39A 3PTRB 2BGCA 4TYSA 1VBB2 2BWCA 4BQYA 5FYSA 2A70A 4BA6A 4AQTA 1AR82 4OZXA 4G4FA 3Q8EA 4QQ2A 3NKGA 4X8PA 4OQ9A 4AGRA 5L7OA 4XAAA 1LB2A 3T3YA 4IV1C 3VBSC 5E16A 2XL7A 1MZ6A 2AZ5A 2XJUA 4CDUB 5CAZA 1VPHA 4HBNA 5T5JA 4UBHA 5LRRA 2WSVA 3ES1A 4NVPA 5KR7A 4LR4A 1VR3A 4QX3A 3T1LA 2JEMA 1LESA 1GNZA 5A7NA 4YGCA 1DQ2A 1O3RA 1CAVB 1W05A 3N7MA 2ETEA 2FDHA 2FZ2A 1UF2C 2GH2A 2GC0A 1HB4A 1H1MA 4JRAA
chains in the Genus database with same CATH topology
2ZS6B 3ZFFA 4PLNA 1OSGA 2QQPA 3KCXA 1OFSA 4H55A 3R4SA 3ZFGA 1O4ZA 2DV9A 1UKRA 2E63A 4AVAA 1C3HA 1GZCA 2WFF1 4IETA 4MLOA 3ZXKA 4WM8B 4FPEA 1AYN2 5F6LB 2EXJA 3E97A 1DHKB 3V0BB 1RVF1 4J1WA 2RE9A 1N3OA 4I0BA 4YNIA 3MPBA 2VW2A 2WNVB 4Q4Y1 1RIRA 4L9BA 3KGZA 1VAMA 3RDIA 1W6MA 4HL0A 3LCPA 2G9FA 2ZX4A 1O5UA 1SLIA 1PO12 1J3QA 1BEV2 4GB33 4ASMB 2IXHA 3JB8A 4KBBA 3ATGA 1UAIA 3H8UA 5BYNA 2OA2A 3USSA 3VKFC 3KZ4C 4DY3A 1R093 2Q1ZB 2CWMA 1RUJ3 2HWB2 5DG1A 1Q3EA 3UKVA 3L2HA 4E2QA 1ZBE2 4B4RA 2ET1A 5D8AC 3H7YA 5GALA 1LU2A 1COV1 1ND2B 2EA7A 2ZGUA 3S7IA 2WIIB 4FAHA 4QMAA 5IK5A 5A33B 4LTAA 4KQ7A 2QVSB 2R073 4WVVA 3ZYGA 5JVVA 1R083 5JMCA 5BXXA 4FPHA 1VJ2A 4Z2WA 1MQTA 1BBT1 5I0SA 1BKZA 2JG9A 3AYCA 4D94A 1UZZA 1RTVA 3ZSLA 4OHZA 3VKMA 2IZWA 5FOJB 1OPMA 3RZZA 1FNZA 4XETA 5E8AA 1H2LA 5FCCA 5ABJB 2B5HA 5JSPA 1V9U2 2RHPA 3ZXLA 3T2TA 1LEDA 1DGRN 5J36A 1S2BA 5I8YA 4JGZC 1HRV1 2O8QA 1DGLA 4BE3A 3LSDA 1KRIA 1WW6A 4LEJA 3AX4A 1J58A 4YVWA 2QJVA 1A3KA 2HYKA 4FP3A 3VBHC 4PBPA 4AI2A 1DLLA 1CESA 4QPIB 1RUD1 4WVZA 4XF3A 1PZ8A 4IL7A 4FOWA 4HSJA 4MGIE 3WT3A 4N43A 3JD71 1JXNA 1DBNA 3BIWE 3KMHA 2ZGLA 1H9WA 4H14A 5C4WB 3O5SA 2O8OA 2RJKA 4LO4B 1RVF3 1ULDA 3FMGA 2IXCA 4M3CF 2D43A 1NE4A 2DCYA 3CJXA 4GXLA 3B7MA 1XNBA 3OD0A 1AXZA 1AZDA 1IKPA 3EJKA 1QU0A 1QOTA 2B8MA 3RS6A 1DZQA 1CQ9A 1BZWA 1ZX5A 3QH6A 4LBQA 3WR0A 4Y22A 2LUWA 4XXAA 1CPNA 1NLSA 3WZ1A 2XVGA 2QZ3A 1BVVA 1QOSA 4QGLA 3HAGA 1WUVA 1CAUB 3TRSB 4KWKA 2WT0A 3M70A 1FYUA 3IT8A 2ARXA 1VRH3 1UIJA 5LK7B 2ZGPA 4Q2FA 3B00A 4DQAA 3NV3A 2P3IA 4GB32 4AFMA 3FLRA 1V6KA 1CN1A 1NA1A 1OLRA 4X6RB 3RYRA 3D8CA 4AI3A 1R1A3 4HVRA 1JYIA 1UD1A 3VBUB 3WG4A 5FLIA 1D2QA 1R092 2GNDA 2VXRA 2NP0A 1NG0A 1YUDA 1BVP1 4BLIA 3AP4A 5HXVA 3SNMA 4B29A 5DG2A 1BBT3 4XJUA 1D4VB 1JHNA 1ZYBA 1C57A 1VBA1 4FSJA 2H0BA 4Q26A 2CGPA 2WS91 2X53S 3M3IA 2AREA 4FCAA 2YC0A 3NAPB 2R072 4JRLA 1U0AA 1ZNPA 1R082 4FXKB 5CB7A 1Y3TA 2DYCA 3PVNA 1A8MA 5JZGB 4Q4X2 2PLV1 3I54A 1UU5A 2WSUA 2Z42A 4D69A 1AR91 2ZGOA 2XGXA 5A32A 3MICA 1PHMA 4KNCA 1HRV3 4BWOA 5I8TA 1N1VA 4P9XA 1Q5OA 3CJIB 4CP0A 3MFCA 3WV6A 3OYWB 5AFBA 1N1YA 1FOD1 1HW5A 1LOEA 3IKWA 4XE9A 4FT8A 1RUD3 1TME2 1TMF1 3NO8A 4CDQC 5JSOA 4QPGA 4RFT0 4R4ZA 3VBOA 1YLLA 2V73A 1PGL1 3CU7A 1LECA 4R52A 1QQP2 4FPLA 1SBDA 3H1YA 1RUI2 4DINB 5JR7B 4J6GA 3AYDA 4P9LA 1LHNA 1OOPB 3BB6A 2BWAA 1XNDA 1K5MA 3K51A 3ZN5A 3B94A 2YGLA 1ZREA 3IMNA 4PLMA 3WLUA 1JH5A 2ENRA 5CIRA 3RYPA 2BBVA 2XWBB 1YYNA 4JTNA 5FLHA 2Z79A 4IV1A 2D40A 3VBSA 3MIDA 4E4DX 3AKRA 2E9QA 4NHLA 3ZYRA 1AJKA 2DU0A 5I0TA 2PAMA 4COUA 3PNAA 2X8KA 1QMJA 1RUH1 3OCPA 3H3ZA 4K1ZA 3MLLA 4KGGA 4L99A 4FQ4A 2D6KA 1X8EA 4P9WA 1W6OA 2VVDA 3U07A 3WQ7A 2W68A 4KH9A 3M2MA 2FQPA 4ONUA 1CX4A 2DFCA 3LB9A 5FQ0A 4IEOA 3LZZA 1L3JA 3AP7A 4R8HA 3WW1A 3ZFEC 1VRH2 1FI2A 3CO2A 4LBLA 3ME2A 1D0HA 2IXJA 1MS1A 3NW4A 4HT1T 2PHLA 1VBA3 1R1A2 1RHI1 2WS93 3BODA 3LKJA 5IUQA 3ZMOA 4K20A 1QJX1 1EP0A 2BUKA 4JGYC 3ES4A 2E7TA 2OPKA 5F1RA 3MIBA 4QM9A 1BBT2 4BLJA 5ACA1 3H1WA 3AZVA 2GN3A 4B3NA 1AR93 4BZ4A 2FMDA 4Z07A 2Y38A 2TBVA 3SH5A 4X6QB 2ZHLA 4AI1A 5CVRA 4YGEA 4KWLA 1PK6C 2O1QA 1AL0G 3A0NA 3SISA 1GANA 3N3HA 4RR3B 4PLOA 1XXNA 2WFPA 3AMMA 1FOD3 1H1AA 3LWCA 5K0UB 2ATFA 4AQ6A 4EN6B 5BY5A 2PTMA 3SCFA 3NVCA 2PHWA 2ZACA 4I0AA 5D8AA 5FO7B 1FT9A 2R062 4NR1A 2XB6C 3WUCA 5CG8A 3R05A 2R32A 3AMHA 3M3OA 3WDTA 2MNGA 1KITA 2JENA 2VU9A 3RG0A 1DZRA 3DN7A 2VQ0A 3TNQA 3LOIA 1JBCA 4NO4A 2AGSA 1VALA 2RS51 3DF0A 1ND3C 1FMD1 1NQDA 3QACA 3FBMA 4E2GA 2R1BA 3LA7A 2EXIA 2RS31 4AEMA 3ZFGC 1JOJA 1V6IA 1URXA 4IESA 3MZHA 4V1PA 1NZCA 3S6PA 1DQ5A 4ISQA 1QJU3 3KT4A 3BU7A 4JGZA 4CDQB 1CD3G 1AX0A 4RQPB 4HVOA 1U5XA 3NWKA 4QX5A 4ZXKA 1D4M1 4R9AA 2WT1A 4Y4YA 3ZN6B 1NE6A 3VBHA 4OI2A 3ACLA 2WQ4A 5AC91 5BUVA 5K7PA 1V6OA 1CAWB 3PHMA 4ZU4A 1IZ3A 2XLFA 4XQWA 5GJ6A 4QGNA 1HLCA 2JG8B 4FBFA 2DUQA 3VBRC 3ZIXA 5DZGA 2BNMA 4CEYC 2NMOA 2VW0A 4XBQA 1ULFA 3ENRA 2PELA 1RUF2 2VW1A 5BNOB 1VAVA 1W2UA 3E6CC 1GYKA 4RGGA 2ZX0A 1AXYA 3MW4A 2O0OA 4LHKA 4Y24A 5ACA3 1DGWX 3O0WA 1VBA2 2WS92 5T54A 2UY8A 2XVLA 1YFXA 3Q9OA 4BYYA 4FTBA 1AYN1 1H30A 2Z69A 3N36A 3UJOA 5JWPA 5FO8B 4KG8A 1AR92 4LO6B 1SEFA 2Z2SB 1LGCA 4YSFA 1H0BA 1XQNA 4M0HA 1J3PA 1DQ6A 3ZPYA 3MIEA 1DQ4A 3VV1A 1C1FA 4Y1UA 4DY5A 1YIPA 1W6QB 1Y9QA 3K48A 2D3SA 2V09A 4PJYA 3RMXA 3VZMA 4C1WA 1V6JA 1FOD2 1BEV1 2ET7A 4WM7B 1LODA 4QPYA 5JIAA 1V70A 4S2DA 4DMIA 3O14A 1ZZ9A 1H8TB 4GULA 5BV6A 3AZYA 2HWB1 1ZBE1 3D0SA 4M01A 2RS53 2ZHKA 2H6BA 5FPXA 3WP3A 1FMD3 5H9PA 1S2KA 4M3CB 2W39A 2DURA 3B3QE 4O9EA 2RS33 1MZFA 4IXLA 4QQLA 1KXGA 3W9AA 2ZGQA 3DGTA 4R4XA 1WLWA 2WC2A 3U4XA 3IBMA 4LNVA 5GLTA 5JOYA 4LA3A 5GLUA 5HCAA 2D6LX 2VGDA 4N53C 1H9PA 1BYHA 2WA3A 1LOBA 1Q56A 1TE1B 2Z5WA 1D4M3 2K0GA 3PJYA 2DCJA 5L7OB 4BCUA 1QJU2 1UMZA 1ONAA 4AQ2A 2JE7A 2IWGB 5AC93 3WY6A 2I45A 3GZAA 3I8TA 1Y43B 2RS11 3KB5A 1ALYA 3V0AA 4UBGA 2YPJA 4R9BA 1YIFA 5F6KA 4AI8A 1CJDA 3SITA 2EXKA 3ZFFB 2UYBA 1SFYA 5EWSA 4AG4A 3FX3A 4A7KA 4YW1A 2JE9A 1JN2P 1S0BA 1H2KA 3DPRC 1EAH1 1ENQA 1O7FA 3ZFGB 3NSTA 2ZAHA 3N7LA 1A8DA 3X29B 1HQNA 4META 3SH3A 2UWCA 3T1MA 4EV0A 4AVTA 3NV2A 2VNGA 2RMU1 3AB0A 4LE3A 3ZVXA 2PAKA 3KS7A 1S55A 3JUUA 2GMEA 3MF9A 1UPIA 1AYN3 4DFSA 1RITA 4BM8A 3TN91 2ES3A 4OHVA 4YVSC 5ACA2 1V6NA 4MZUA 5CFDC 4F83A 4MUVA 2A6YA 4A2UA 4OI0A 2RR12 4KWJA 1YRZA 2YHJA 4WVMA 1QNWA 3O7OA 1LOFC 1LGNA 2CTVA 2XL9A 1W6MB 4TWTA 1ULCA 4FPJA 3WP4A 2R0HA 1JW6A 2WWSA 2PHUA 1YWKA 2XUMA 3WP6A 2ZKNA 5C6CA 1H4GA 4BIOA 5JSRA 4IEQA 1BEV3 2XWJB 3O12A 1C5IA 3ZFEA 2BPA2 2ZOEB 1KS5A 1S0CA 1REFA 1GFF2 2MEV2 2A73B 4LLFA 3WG2A 3S7EA 4RL7A 3ZSJA 1GKBA 4GB31 2ZMLA 2VY0A 3AKPA 3POYA 5GZFA 4JGYA 5IT6A 3HT1A 3LOBA 3FLPA 3AP6A 5GM0A 2BTVC 2YY1A 4QM8A 5IK7A 1MQTB 1RL3A 4AEJA 2VVEA 3VGIA 1KDKA 2JG9B 3ZIWA 2NYYA 1FMD2 4BOWA 5BNPC 1DDLA 1NCRC 1PK6A 4GMP0 2KM2A 5CU1A 4AFDA 1UW8A 2RS32 1BJQA 3A4UA 2K9ZA 4XTMA 3GZTB 3ZXJA 4Q4X1 4YW2A 3SMHA 2WLPA 1ULEA 4OI4A 1I1EA 2XKPA 2WNEA 5CADA 1IPKA 5JAXA 4YM0A 2RS13 3QBQA 1UN1A 1D4M2 4MXWA 2NLRA 3WD5A 3LA2A 5DZEA 5I0RA 1X8MA 1F31A 3OPZA 5C9AC 2FBEA 2OVUA 4YVWB 1N47A 3WG1A 5AC92 2XPJA 2B46X 3SH4A 1KS4A 5FPZA 4RSUA 1EAH3 1TME1 4K6BA 2A6VA 2LTNA 3V64A 3VL8A 1U5IA 2XHKA 2ZA9A 5GLWA 3VZKA 4C0BA 4BIFA 1ENXA 4N43B 1ND3A 4I2OA 3DV8A 1QQP1 1XU1A 2YROA 4Q0QA 2RMU3 3AFKA 4E9KA 4CRQA 1RUI1 4N7UA 4XMIA 1WMEA 3TN93 1XYNA 3U10A 4F3JA 5JLVA 2PYTA 1AF9A 1BK1A 1DU3D 3KCCA 3AKQA 4M0NA 3WW3A 4EWDA 1HKDA 4LBQB 3VKNA 4Y22B 2JDZA 2XJRA 4PCRA 1AX1A 3WNXA 4R9DA 4I01A 4JVAA 5K8SA 2VVFA 3ILFA 4AEDC 1UX6A 4PF5A 3VBRA 3AMQA 5DUVA 2WA4A 4CEYA 4KL1A 1REDA 2P37A 4IV3A 1I5ZA 1QXJA 2VNOA 3OGGA 2R1DA 4RA0A 1NA1B 1YFYA 1SDWA 5LEJA 4LHLA 2G4IA 3W58A 1F5JA 1VIWB 1VRH1 3AFGA 1QOOA 3HWJA 4YFZA 1ASJ1 4XW3A 1OHFA 2ARBA 5EYYA 1R1A1 2UWBA 4GALA 3VZOA 1KFUL 1AL23 4LO8A 2E6VA 4OLLA 1MS3A 1ZZ6A 2HWD3 4UXAA 2A6XA 2A5ZA 2GNMA 4Q4X3 2R6QA 3WHTA 3RRDA 3OJBA 3WVJA 2GDFA 4FQZA 3U11A 4YM3A 2B42B 5JOZA 5A32B 2CYFA 3IM0A 2R49A 4LE4A 4E4SA 4MGZE 4LBMA 2JXAA 3UKTA 2IXIA 4I3GA 1QH7A 1Z7S1 4IEWA 2RS12 1TME3 1AYM1 5JOXA 1IOAA 2WLQA 4QPGB 2BYVE 2R061 3VBOB 4BH9A 1N1SA 1PGSA 1XU2A 3CLPA 1RJ7A 1QQP3 5GZEA 1DIWA 3M3QA 1SBFA 1MS9A 4KGQA 4QGMA 5KHJA 1RUI3 2E53A 2HWF1 1PZ9A 4JTOA 4W6YA 1EAH2 5E88A 1AX2A 4GKXA 3D82A 3MFAA 4PQ9A 5C8CC 4DZGA 4XJZA 3GBGA 1K5MB 2GZWA 3D6EA 3E5QA 1G7YA 2VMIA 3N35A 2RMU2 2BQPA 4QT6A 4XIKA 4N53A 2VPVA 3VHOA 2NMNA 3TN92 2DCKA 4IV1B 4NN0A 3RWNA 3VBSB 1XNKA 1X82A 2C9AA 2ZJCA 3R4DB 4K8FA 1PO23 4YG3A 2P3KA 3MIFA 4COYA 1ENSA 4Z8BA 3AXEA 3ASIA 3IDBB 5FTTC 4NHKA 1E57A 2D97A 2D6MA 1W6OB 4Z1VA 3MW3A 3ALQA 2D5HA 3DPRA 1FPN1 1PVC3 3LAGA 5FQ0B 3QOPA 1PGW1 3WCSA 1GZWA 2YUEA 4ASLA 3B93A 2HWC2 1SMVA 3URFA 1C8M2 3USUA 1ASJ3 1U12A 1OQEA 1QDOA 1MS0A 2JJ6A 3MPPG 1RUF1 4DB5A 3IPVA 4YVSA 1IS5A 4ES8A 1FV2A 1C5HA 5CFDA 1A78A 5GZGA 1F8VA 4I3PA 5HBAA 1AHSA 4YGBA 4IEVA 1LOFA 3MYXA 4FPGA 4N7IA 1QXRA 1AL22 4QD2A 1UIKA 5EJ3A 3WP5A 1KJRA 1U5ZA 2D44A 4RGAA 2ILMA 2HWD2 4XF9A 2WNUC 2IC1A 3WHUA 2CAUA 3UK9A 3WW4A 1HRI2 3J4UH 1Z7S3 2YGMA 3RJRA 4GMP1 3POSA 5D1IA 3JZVA 4P5HA 5DUUA 4FPYA 1AYM3 5D8AB 2SBAA 2R063 5T52A 3I7DA 3H3UA 1YCIA 4FVVA 4C1XA 4DRRA 1W6NA 2WQZC 2HWF3 4N9IA 2HWE2 3ILNA 4Q4V2 2Q8OA 3QCWA 3E6BA 4LA2A 5J48A 1O3TA 3VBFC 5BNPA 4XFBA 1X7NA 1NCRA 3DKWA 3NV1A 3PVEA 5JIUA 2VUAA 1X50A 4QQPA 1V00A 4A3XA 2DUOA 1UU6A 1LHVA 3ZSKA 3FZ3A 4FPCA 5KHIA 1LENA 2TNFA 4G9SB 4NWVA 4S2HA 5I93A 4AE2A 3O0VA 2NPIA 2YV8A 4ATFA 1G9CA 1DQ0A 1EV11 4JGZB 3N7KA 4PIZA 1MEC2 5C9AA 1C4RA 4Q0VA 5KHHA 2Q30A 1DZTA 2DFBA 4AHYA 5JI7A 1C8NA 1QWRA 3VBHB 2VECA 5KXEA 1PO22 1QJU1 2X29A 1FPN3 3KT7A 4UW5A 2XH6A 4MYEA 1O4YA 3E5UA 3SLIA 1SCSA 4JV4A 1SLAA 4K7JA 3BPZA 2X5IA 2QFEA 1WA4A 3L2YA 2DTYA 2VOWA 1HXS1 1RUF3 3FFZA 1PVC2 4Y1YA 4XFHA 3VKOA 4COVA 1MS8A 2GMPA 1O4TA 3C2UA 3J9SA 1TQ5A 1ASJ2 3ZXGA 2XJVA 5L73A 5KXDA 2G9GA 4AHXA 3J8F1 3JU9A 4PIYA 3S0MA 4YYOA 1V6LA 3VHPA 1BCXA 2ZTNA 2CNAA 4KU8A 2GC3A 4AEDA 1WD3A 4A7YA 4PDWC 2RR11 5LK5A 1LGBA 4GMP3 1ZBA3 1ZM1A 4XHBA 4AHZA 1QDCA 1AR62 3R0RA 3HN1A 1RGSA 2DCZA 3D5OA 1RUNA 4QHBA 1U5YA 2GMMA 1SLBA 4HPKA 5FOBB 1Z7S2 4XF0A 1H2MA 5EYXA 2R16A 1OA4A 1AYM2 1SLTA 1JUIA 1ZA4A 5FBZA 1QJY1 3M3EA 4GA9A 4MX3A 1B35C 3OTFA 2MEV1 5KXBA 3WDUA 4CP1A 5HCBA 1RUC1 3FHIB 1H1IA 2NM1A 2HWF2 3GBFA 1YI9A 1HQWA 3ZO0B 1CONA 1S0EA 4M00A 4WZCA 1G9DA 5CFCA 2P34A 2XG3A 4YZ5A 3H1MA 1Q8VA 2JECA 2ZX2A 3NV4A 2GH8A 1MS4A 1CAXA 4JC1A 5FRAA 4P9GA 2CAVA 2ZGNA 1EV13 5FAXA 2DTWA 1YNAA 1MZEA 2YZ4A 4FAGA 5T5LA 2LM3A 2VOKA 5JOWA 1QY4A 3RYKA 1RB8G 2TUNA 1W6PA 1WW7A 2ZMKA 3D0JA 2PHTA 2I07B 4MGYE 1IHMA 4IERA 1RMU3 4Y26A 5GKAC 4Y20A 4EJRA 1W39A 2C1FA 3HD8B 2B45X 4GWNA 1PNGA 3HT2A 2XJSA 3V0AB 5EV7A 2HKXA 5CNAA 4AFBA 3V56A 1ZRFA 1HXS3 2IXLA 1FPN2 2XBO3 1PGW2 5FFOC 5C8CA 1S1AA 4HLTA 3P3PA 4EWAA 1ZZCA 2H6CA 3AMNA 4XIOA 3H7JA 4IV3C 4L11A 1Q8SA 3GHNA 3J8F3 2VUJA 5CA6A 5T50A 4YG0A 4CDXC 1AXKA 3VDDA 1S0GA 1EYBA 2PHRA 3DL3A 5KWRA 3VHRA 3EBRA 1YHFA 4ITCA 4B8EA 3GHMA 4FOQA 2RR13 4QQOA 1X33A 4HMZA 4SLIA 4WVMB 3RQ0A 2D93A 3THPA 4XJAA 1DGWA 3OD4A 4Q0SA 3TBDA 1NCQC 4K3UA 3QLQA 3KSCA 3KM5A 2PHDA 4TLFA 4GH4C 4Q4W2 3ZFEB 1ZBA2 1GR3A 3IDCB 3JCIA 3ILRA 1QJY3 4YARA 2MEV3 1VBD3 4ES9A 2P2KA 3ZYIB 1LJ7A 4OUSA 4AWDA 3G6JB 1O3SA 1RUC3 4I09A 5BNNC 1EY2A 3JBG1 4CDWC 3EXUA 2ZGMA 4JGYB 1WMFA 2GSYA 3HBZA 4K21A 3ELNA 3UKNA 4S2GA 5L36A 2HEWF 4MVTA 2QNKA 1UL9A 2ZX3A 5EZWA 4P9YA 4HZFA 2HEYF 1NLRA 3FJSA 5TSWA 4CEWC 1PK6B 1V6MA 2WNUA 1GV9A 3ZXFA 1I6XA 2R30A 2I2SA 2AR6A 1VB4A 4Q1RA 3I59A 3NL1A 4XZPA 4K1YA 3OY8A 2DCTA