4YVSB

Crystal structure of the virus-like particle of a c4 strain ev71
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
237
structure length
224
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
total genus 28
structure length 224
sequence length 237
chains with identical sequence E, H, K, N
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvsB00
1OOPB 1TMF3 1QQP1 5C4WC 2PLV3 4N53C 3ZFFA 4Q4Y2 1ND2B 5C4WA 4CDWB 1PGL1 1RUJ1 4RR3A 2WFF2 1VBE3 2ZZQA 1VAKA 1AYM1 1VBA1 4NWWA 4CDXC 2QQPA 5A33A 1COV2 2RS33 1H8TC 1RUI2 4CDXA 5D8AC 1AR72 5BNOC 1V9U3 5BNNC 3ZFEB 5D8AA 3NAPB 5BNOA 1C8M1 1AR91 1NA1A 1QJZA 1QJY1 1RMU1 1BEV1 2R073 2WWSA 1VBB1 4GMP3 3TN91 1SMVA 1VRH2 4WM7A 1C8NA 4CDQC 2WZR3 4GB32 1NY71 1R092 2WS92 4CDQA 1HRI1 2RS53 3VBUC 4Q4W3 4GH4C 2HWB1 1RUE3 2R062 4Q4V2 4RQPA 3ZXAC 1F2NA 4GH4A 1HRV1 1QJX1 3VBFC 1Z7S1 3VDDB 1NCRB 3JD71 1VBD2 1WCDJ 3VBFA 1POV3 1TME1 1ND3B 5DDJ3 1RUH2 1X33A 2BPA2 1R1A1 2HWD3 2RS13 5K0UC 1B35C 1BBT3 1K5MB 4GMP0 4RFT0 5ABJB 4CEYB 1B35A 4Q4V3 5A32A 4RHV2 2MEV2 1ASJ2 2HWE2 1AYN3 4WM8C 1ZBE1 2GSYA 1AR61 1GFF2 4WM8A 5AC93 3CJIB 3JBG1 1RMU2 1QQP3 1VBB2 1FMD1 4JGYB 1NG0A 1RUJ3 2IZWA 1OOPA 1PO12 1RUC1 1AL21 1POV0 1VB2A 2HWC1 1ND2A 1AYM3 2RM22 3VBRC 4CDWA 5GKAC 1FOD1 4LLFA 1TMF2 2PLV2 4IV3B 4PDWB 1BMV1 3VBHB 1VBE2 2X5IC 1HX6A 1C8M3 1AR93 5FOJB 1D4M1 1QJY3 1RMU3 1BEV3 1RUD1 1VBB3 1NCQC 3ZFEA 4FTEA 3TN93 1VBC1 1EV11 1VB4A 1FPN1 1V9U2 4IV1C 1NOVA 3ZFFC 5L7OB 4IV1A 1HRI3 1PO21 2R072 4RR3C 5ACA1 2XPJA 5C9AB 2HWB3 1RVF1 2WZR2 3VBSB 1RUG1 4YVWB 1HRV3 4CDUC 2ZAHA 2RS52 1Z7S3 1ZBA1 4CDUA 1QJU1 4Q4W2 3JD73 3VDDC 1TME3 1OPOA 1RUE2 1NA1C 2RR11 1ND3C 2HWF1 3VDDA 1R1A3 4N43B 1RHI1 1ND3A 2FZ2A 4WM7C 1MQTC 5CFCC 5FMOS 4CEWC 1AL22 2RMU1 1MQTA 5DDJ2 5CFCA 4CEWA 5ABJA 4CEYA 2HWD2 4BCUA 2RS12 1BBT2 1ZBE3 1HXS1 1R081 4RQPC 4FTSA 1AR63 5BNPB 3DPRC 4QPGB 1PGW2 3JBG3 3J8F1 1EAH1 3DPRA 3CJIC 1FMD3 1AYN2 3CJIA 2BFUL 4JGYC 1RUC3 1AL23 1PVC1 2HWC3 4JGYA 4N53B 4QPIB 5AC92 1FOD3 1QQP2 2BBVA 1AR81 1PGL2 5A33B 1RUJ2 4CDXB 2R041 1VBA2 1AYM2 1D4M3 1H8TB 4Q4X1 1CJDA 1RUD3 4JGZC 1PIV1 5BNOB 5BNNB 1RUF1 1MEC1 4JGZA 3VBOC 1VBC3 3ZFGC 1EV13 1FPN3 3JB4C 5C8CC 3VBOA 3ZFGA 4RS5B 1C8M2 1AR92 5C8CA 3M8LA 1QJY2 1BEV2 1PO23 4Q4Y1 3JB8A 1OOPC 5ACA3 3TN92 5CFDB 2WFF1 1HQNA 1ND2C 4FSJA 4CDWC 4YVSB 1NY72 1RUG3 1VBA3 3VBUB 5C9AA 1RB8G 1COV1 1HRI2 4SBVA 1ZBA3 4GH4B 1RUI1 1QJU3 1AR71 2HWB2 2RR13 1IHMA 2HWF3 3VBFB 1HRV2 1QJX2 1RHI3 3ZFEC 3NAPC 1Z7S2 3NAPA 1VRH1 3JD72 1TME2 4GB31 2RMU3 1X36A 4Y5Z0 1R091 5K0UB 1B35B 2WS91 1R1A2 5A32B 1HXS3 1R083 2R061 4FTBA 4AEDB 3J8F3 4WM8B 1EAH3 1QJX3 5BNPA 2BUKA 3HAGA 1ZBE2 1VBD1 1AL0G 2XBO1 1AR62 1PVC3 1NCRC 1RUH1 2ZTNA 3JBG2 1NCRA 4QPIC 2VQ0A 1W39A 1AR83 1FMD2 4N53A 4QPIA 2GH8A 3VBRB 1K5MC 1RUC2 5ABJC 1M06G 4RHV1 4CEYC 2HWC2 2R043 4Q4X3 1K5MA 1FOD2 4NWVA 2MEV1 1ASJ1 1PIV3 2FZ1A 2HWE1 5JZGB 1BMV2 1AUYA 2X5IB 1RUF3 1MEC3 1H8TA 5J98B 4Y4YA 4EJRA 5BNNA 5FMOL 1NCQB 1D4M2 4RS5C 1RUD2 3IDEA 4Q4Y3 4RS5A 2WFF3 4IV1B 1VBC2 1EV12 1PO11 1FPN2 5CFDC 3ZFFB 2RM21 5C4WB 4RR3B 4YVSC 5CFDA 2BFUS 1TMF1 1COV3 2PLV1 1PO22 1RUI3 4YVSA 2TBVA 5ACA2 1AR73 4IV3C 3VBUA 4PDWC 1VBE1 4CDUB 3VBHC 1RVF2 1CD3G 4IV3A 4PDWA 1RUG2 3VBHA 2RS31 1ZBA2 5D8AB 1QJU2 2XBO2 1NA1B 1VRH3 4GB33 1V9U1 1DDLA 3LOBA 2RR12 1R093 2HWF2 2WS93 4WM7B 1RHI2 1MQTB 2R071 5CFCB 4GMP1 4CEWB 5L7OC 1OHFA 5K0UA 4CDQB 4Z92B 2R063 5L7OA 2WZR1 2RMU2 1RVF3 5C9AC 4RQPB 3VBSC 2WLPA 4AEDC 2RS51 4YVWC 1HXS2 4Q4W1 1VBD3 1R082 2XBO3 3FBMA 3VBSA 4AEDA 2DF7A 3DPRB 4YVWA 1RUE1 2Y26A 1E57A 1RUH3 5J96B 3J8F2 1EAH2 4N43C 4N43A 1POV1 1PVC2 4RHV3 5DDJ1 3S6PA 3VBRA 5LK7B 2MEV3 2HWD1 1ASJ3 2HWE3 2RS11 1BBT1 1AR82 5JZGC 4Q4V1 5JZGA 1PGW1 4JGZB 2X5IA 2R042 5BNPC 1F8VA 4Q4X2 4QPGC 2RS32 3VBOB 3ZFGB 1PIV2 1AYN1 5C8CB 1A6CA 1RUF2 1MEC2 1NCQA 4QPGA 1PO13 2RM23 5AC91
chains in the Genus database with same CATH superfamily
1XU2A 2JDYA 2V09A 1TMF3 1UY3A 1NXD1 4BE3A 1WMXA 1FYUA 1UPIA 4PF5A 3A23A 3P5BA 2D7FA 2P6HA 4XDOA 2ZHKA 5I93A 4M0HA 2WFF2 4CCMA 4NRQA 4D69A 4CCKA 3J9SA 3H50A 3ZPOA 1GZWA 4GWMA 4R9CA 4CCCA 5CIRA 1X8MA 2VBBA 2WC2A 2WO2A 3HMYA 1H8TC 4E8DA 1RUI2 2VULA 3CLPA 4IQPA 2Q4SA 1ZZCA 1JYVA 1VIWB 3LFIA 1ZX5A 3ZYFA 2YYOA 4CYDA 2VNRA 1EPZA 2VVDA 1EY2A 3SCHA 3SH5A 1GNHA 2J1TA 3NAPB 1PZ7A 5K7PA 1SLLA 5GZCA 2ADDA 1CX1A 1BEV1 1UU5A 2GZWA 2R073 3H7YA 3O0WA 4Q0UA 2PQSA 5L19A 4ZS2A 3OYWA 1DFQA 1KFXL 3WSOA 4HVOA 4DS0A 2RE9A 3M4FA 1C8NA 4IE7A 5FQ0B 3ZM8A 4CDQC 4EN8B 2UWCA 3GM8A 5FZAA 5T3NA 2ZGLA 4WVVA 2WNUB 4PLOA 1O5UA 3S30A 2GP5A 3JUUA 3USSA 4BXFA 4XOGA 5F5AA 4CDQA 1WCUA 1N1VA 5KHJA 1P8JA 4DB5A 1HRI1 4W6XA 3SCGA 1TNFA 4AOCA 4I01A 3WP5A 1ST8A 4INDA 4OI0A 2R49A 2EICA 1R64A 4KG0A 2A70A 4Q4V2 1XYOA 4LUKA 4DNYA 1NE6A 1LOAA 1F2NA 1MS9A 3NNLA 1NLSA 3V0AB 2IXJA 2B45X 4C90A 4JV4A 1LHNA 4P08A 2LROA 3ZXKA 1GP5A 3N36A 3T0AA 4XEZA 1PK6B 4FT8A 3VDDB 1GYKA 1QNYA 3ILNA 1TE1B 1FX5A 2DURA 2D5FA 1RXGA 1POV3 4MV2A 1ND3B 2ZGMA 5JIAA 3NNMA 5BPXA 1X50A 2PHDA 4JKLA 1X33A 1O6UA 4GJZA 1G9AA 2BPA2 4M00A 2ZGUA 3QH7A 2VMFA 4QDRA 4Q8LA 3GCWA 3FWEA 2VOTA 4GMP0 2YPJA 5CYYA 4E4SA 3U75A 1OD5A 3I2DA 4Q4V3 5DUVA 3ACGA 1W2TA 2CWMA 4JHZA 3OG2A 3LSDA 1NLRA 1LECA 1WCSA 1GQPA 1W90A 2Y33A 1W8WA 4A42A 2MEV2 2D6MA 5J1XA 2QVSB 1DZRA 3LEKA 4WM8C 4Q29A 1NQDA 3KF5A 3P1IA 1ACCA 1AR61 5KXBA 4WM8A 2A6YA 4OMCA 1OLQA 3FHAA 4TLGA 5AC93 2VH9A 3CJIB 4UW5A 1OSGA 1JH5A 3FBYA 2JB8A 2G4IA 4LHNA 1YI7A 4CCOA 2QBXA 4IE0A 1SLCA 2VC9A 1AL21 3AKRA 2ZJCA 4AHWA 1Z78A 1ND2A 3SITA 3ETQA 5FPAA 3AMNA 1I3HA 4ISQA 3E6BA 5I8TA 1FOD1 2YGMA 4LLFA 1OF3A 3NJVA 3OF1A 2PLV2 1W04A 4IV3B 2GC3A 5EXOA 2UURA 1GWMA 2QE3A 2AEYA 1LU2A 3J7MA 5FMDA 1UKRA 2WNOA 5JSPA 1ODNA 4XE9A 5KHIA 1QY4A 2QQMA 4YW6A 2Q8OA 3U78A 5FP4A 1AR93 2Q8DA 4C1XA 5FOJB 4ZU5A 4Q1RA 1RUD1 4BWOA 1NYWA 4A7KA 4P9WA 4ZY9A 1F35A 1UPSA 3GGLA 4Q0VA 3MV11 3SEPA 3TN93 2QUOA 3AFGA 3RI9A 1WA4A 4AK3A 3ILRA 3UK9A 3TEWA 4IV1C 2WO3A 2YPDA 3V64A 1VPHA 1H9WA 4XCBA 4BIFA 4AHXA 3O1PA 1JYNA 4DUVA 1H2LA 3PUAA 1AX2A 4BB3A 4IV1A 4L11A 4WVZA 1PO21 4RR3C 4D3WA 1O7FA 5F3IA 5GLZA 5ACA1 4UI9L 3ZDVA 1JYCA 1FAYA 4S2FA 3AYDA 3FLRA 4MGSA 3VN4A 1LNSA 2WZR2 4A7ZA 1MS3A 3NO8A 4V2VA 3I59A 5IHRA 3O1VA 4CDUC 2OA2A 1UX7A 5CVRA 2VM9A 1ULCA 1Z7S3 3DUIA 3KD4A 4CDUA 2BVVA 5J48A 4Q4W2 5FY7A 2TNFA 1UN1A 2YMZA 5DXDA 5IVJA 1OPOA 1WGPA 2HLEA 1W8NA 2KD7A 5BV6A 2PFWA 1ZZBA 4NPRA 3WV6A 2UWAA 1UYXA 1QKQA 4XZUG 5FY4A 3O1UA 2K2SA 1V6NA 4WM7C 2VUAA 1MQTC 1U5IA 3HOBA 5CFCC 3V65A 3WNKA 1UX6A 4UFMA 5IJRA 1YHFA 1MQTA 5CFCA 2ILMA 3I3DA 3WP4A 4BK5A 5ABJA 3ZXEA 4Y1UA 3KT1A 4XFBA 3WF3A 1OLME 1N3PA 4QXBA 1U0AA 3N9LA 5FZ0A 1ZBE3 4D7YA 3BOWA 1DF0A 4RQPC 5FYTA 4HZFA 1KDMA 1XYNA 2W47A 2W91A 3MV01 2YY1A 3K4AA 3JBG3 2OS2A 2PHRA 2W08A 3KQ4B 4IGQA 4RD7A 3VZLA 1JU4A 5CB7A 5JAXA 1WW7A 2VQTA 3VHRA 3KCXA 3NVCA 1UCXA 1AYN2 3CKHA 4JDMA 3MI8A 4N9IA 1BVVA 4L9BA 3KWVA 1RUC3 3U07A 4QD2A 1V6LA 4D6RA 2K46A 1EPWA 1WLCA 1UY2A 3OD4A 1CN1A 1R1ZA 2JG9C 2BBVA 1YFUA 2RDSA 1GZWB 1OA2A 2YUEA 3IB3A 1AR81 3KVAA 3RYRA 2JG9A 5FXZA 2H0BA 2MPFA 3DECA 3SH4A 3D5OA 1UY1A 5FZOB 4GIQA 3A0KA 3T3YA 5A7NA 3VD9A 3S5QA 3MF9A 5JPNB 1VMJA 1TEIA 5FZDA 1H8TB 2D6PA 5LATA 3U37A 3ZLIA 3IDBB 5JWPA 2ZGTA 2ZMKA 4FFIA 2FDIA 4YZ5A 1KFUL 1IPKA 2D93A 4NOTA 4CU9A 4BMBA 1VBC3 4AE2A 3RZGA 4EV0A 1EV13 2C1FA 1FPN3 2FQPA 4XTPA 3L2YA 2FDJA 4X8PA 2PAEA 3RVHA 3RZZA 2VW0A 1T6GC 5FO7B 5FZKA 5TSWA 2O1QA 1CVNA 4Y3OA 1O4TA 5EWSA 5GZEA 4DMIA 4CU6A 1SCSA 1BEV2 4Q4Y1 4XQ4A 1GZTA 3JB8A 4GWNA 2B4KA 3WHTA 2X8KA 1OOPC 1XXNA 2ORXA 5A1FA 5I8YA 3E5XA 4MHUA 4LHLA 1HQNA 5GLVA 4D8MA 4XUNA 4AVCA 4YVSB 1DQ1A 1RUG3 4OZOA 3SKJE 4OHZA 3QBQA 5JIUA 5IVEA 1ZZ7A 4NHXA 3DGTA 1HRI2 5J3UA 1KITA 5BYNA 5FREA 4ZXEA 3ZKUA 2DBNA 3V0BB 4FPLA 1K42A 1NQJA 2RR13 1CAWA 4XFAA 4K1YA 2HWF3 4YZ3A 4GWIA 2VMDA 4YGDA 3IAQA 3ZFEC 4A2UA 3K75B 5CKQA 4XYXA 1NLQA 1W6PA 4UXAA 4I30A 4XFGA 1VRH1 4CP9A 4PBPA 4JAAA 3POEA 3I2GA 3OBTA 3UNPA 1X36A 3EHKA 2WS91 4QKDA 4YG6A 4ATEA 4CP1A 3OEAA 3WG4A 1R083 3FHIB 4W65A 4NHLA 1OVSA 1S0JA 4M3CA 1DHKB 4ZHNA 1DGLA 3H3UA 4K3UA 1Q56A 1W6QA 3N9OA 3TRSB 4AGGA 3M3CA 5F1RA 4WM8B 1OMIA 3N7KA 4ES8A 5BNPA 2J22A 5FZEA 5FZ7A 2WZEA 1GWLA 2JJ6A 3VD3A 5HCHA 2R7EB 4L97A 1VBD1 1XBFA 2ZS6B 3BIWE 1F5JA 2I45A 1AR62 1X8EA 1PVC3 1NCRC 2VXJA 3UGHA 1H9PA 4TWTA 3JXSA 1NCRA 2DCKA 4FCAA 4FOWA 1UXXX 4J1XA 2EXKA 4P9GA 2BNOA 4QPIC 2JDUA 1RITA 3WVJA 3ZYJB 1W39A 3LDBA 3ME2A 2W2IA 4N53A 3KLSA 4QPIA 5KC5A 1J3PA 2GH8A 2W46A 1SBDA 4YW7A 5HXMA 2D6NA 4QX1A 1GBGA 3K77A 1OH4A 1FOD2 2DDUA 1Y9QA 4B4RA 1W8HA 4YYOA 3DCQA 3MIHA 2D5HA 1O91A 1RUF3 4QU2A 2DTWA 4Q5OA 1C1FA 5FP7A 3WXPA 4B7EA 5J98B 1PZ9A 3O14A 3POGA 3Q8AA 1V6JA 4CRQA 4XQDA 1LOFC 4Y4YA 3DXUA 4P14A 5FMOL 2JEMA 4YRDA 5FZLA 3NV3A 1VMFA 3T0DA 1RUD2 1LOFA 4H55A 2YU1A 2V72A 3BPZA 4Z82A 3ZSJA 1DZQA 3VL9A 2YBKA 1XPWA 4OI1A 3POFA 1J1LA 3E5QA 1S4CA 2AC1A 4HG6B 4IV1B 1I5PA 1ENRA 1H6YA 4YNIA 4MYEA 5CFDC 2GN3A 4LBKA 4JC1A 1D7PM 2YB7A 5C4WB 3SC7X 3WF0A 4RR3B 5CFDA 4AWDA 2IXHA 3DV8A 1TMF1 1QOSA 4N8MA 3OJBA 3TWIA 1WCQA 2PN5A 1PO22 3M3IA 4V2WA 5F2SA 3I59B 1QNWA 1UU4A 3RSJA 1NUKA 5T50A 3VZOA 3WCSA 4ARXA 5ACA2 2CU5A 2CAVA 1AR73 1RJ7A 2BGOA 3I2JA 4O9EA 3LSEA 2D6LX 2ZGQA 4Y24A 4CDUB 2CHHA 5DZEA 1CAXB 4AI9A 1S0GA 2O14A 1O3TA 4B1MA 1XNDA 3PMEA 4NAMA 4WZFA 2WWUA 1H30A 1IPJA 2JG8C 4U2AA 2L9LA 2JECA 2SBAA 4UF0B 3WQBA 4WV8A 2YHJA 2MHFA 3PIJA 5APAA 3ZSMA 3T2QA 2JG8A 4AQ2A 1JYTA 4MGKE 4CZSA 4GB33 5B4XA 4COZA 3I2IA 4CU7A 1FNZA 1GICA 1W6OB 2JDMA 4LA2A 3KV5A 4COVA 4WM7B 5HCBA 5L9RA 2HYKA 4GULA 4I3PA 2X05A 5LZ6A 1MQTB 2R071 5CFCB 3LA3A 3WDTA 5L7OC 4FXGB 2E51A 4MGIE 2R063 4Y1YA 2W5FA 1MS4A 1RXFA 2BBAA 2P3IA 5L73A 3ZVXA 5L7OA 2J1VA 3VZKA 3TEYA 1SHWB 2HBTA 5C9AC 3ATGA 4RQPB 5FKBA 1K45A 2WLPA 4QXKA 2AZ5A 2QZ2A 2R0FA 4YVWC 2CGOA 3VBSC 2EIEA 3VBSA 4AEDA 1C5IA 4YVWA 1LR5A 4TZDA 2RJKA 1E57A 2PAMA 3MDPA 5C70A 2VY0A 4WVWA 3MZHA 4FBFA 3B9CA 1TNRA 1KGYA 2A6ZA 4QX5A 4META 4P00B 1MZ5A 1VR3A 2ZGSA 3AZVA 3LQCA 2E53A 1W99A 4CSWA 4N43C 2CGNA 3AJYA 2JDNA 1ZNPA 1V6KA 4FOYA 5JUVA 3HQUA 4NHKA 4N43A 1POV1 2WO7A 1L3JA 4AI8A 4IEZA 2JG9B 4YG0A 1F5FA 2VUDA 5LB6A 2VZ3A 2K0GA 2RJ2A 5L9BA 1H2NA 4NIIA 2VNVA 1SBFA 3B69A 2HWE3 5CADA 4DQAA 1AR82 1WWYA 5FP9A 5IK4A 5JZGC 5GZFA 5F6KA 5KXEA 4YFWA 3SISA 2OQ6A 3LPGA 3FHQA 1UZ0A 4G4FA 4Q4V1 2UWBA 5JZGA 1D0GA 4A6SA 1PGW1 2X5IA 2YXSA 1XNCA 4Q0PA 4XILA 4QPGC 1TG7A 2RS32 3B93A 1HW5A 4FP3A 4XIOA 2VU9A 4DZGA 2B42B 3NNFA 1E5SA 4H7MA 4QPGA 4CXXA 1PO13 1XOYA 2OIIA 4JDNA 2FCVA 1BCXA 3HEIA 4XJ8A 2XHNA 3RPQA 1W28A 5HCAA 3RZLA 5AC91 5K8SA 1ULDA 4YW4A 3WOGA 1OOPB 4WVMA 4KWUA 3D82A 4Q4Y2 5FPUA 3M3EA 4E2GA 4AFCA 4HPKA 2DVAA 1PGL1 4ZU4A 1IPSA 3HR9A 1VBE3 4KBBA 1VAKA 2Y64A 2J7MA 1VBA1 1CR7A 5A33A 1PMHX 2Y6LA 1ZM1A 5EQUA 1CAWB 2RS33 4O61A 4E8CA 3IBMA 1YO8A 4JTOA 2DUPA 3GHMA 3ZSEA 5D8AC 2BWAA 4AEMA 1HJGA 5B4NA 5FZCA 1V9U3 2XR4A 2Y6GA 3FZ3A 3PU3A 4AFDA 3ZFEB 4BYYA 1OURA 3A4UA 2FDKA 5D8AA 5FYCA 2VMGA 4RA0A 3AL6A 1AR91 3ZYIB 4CP9B 2DYCA 4IEVA 2D98A 5HXVA 3R0RA 4NMIA 3GXUA 3TN91 2E7QA 4FFGA 1UZZA 5A7WB 4BQ5A 1VRH2 5EFUA 3PIGA 2R1BA 2RG4A 1W0PA 2VZPA 3RMYA 2ZGKA 4K1ZA 3K2OA 1D2QA 2WABA 4AHYA 4XFIA 1S2BA 2EVXA 2WS92 1S0IA 2W1UA 3IZOA 5LWBA 5D21A 2WT2A 1W6QB 2EXHA 2WAOA 2RS53 2YGLA 4LULA 1YIFA 3P3PA 2BZDA 1CIWA 5FPVA 5SV8A 1QJEA 1O59A 5F5CA 2I74A 2XDVA 5LW9A 4QT6A 2I07B 1UYYA 2JE7A 4B8EA 2LW8A 1UYZA 1UKGA 1B09A 5A3NA 5FLIA 2WQZC 4KH9A 5EIYB 2C9AA 1WKYA 2YZ4A 3FJSA 4QDSA 2VTXJ 4R52A 3VBFC 1Z7S1 4E2SA 1LOCA 1XYPA 1VLNA 2QQNA 1NCRB 2DVBA 1VBD2 4NUBA 4EE2A 1Q3EA 4LJHA 3VBFA 2NP0A 4FPGA 5DDJ3 1SPPB 2Z79A 4FPCA 1LGCA 2PHXA 3IDCB 2QDNA 3ZXLA 1YQ5A 2GMPA 3FUQA 2HWD3 1IZ3A 4ORFA 3U4SA 2JD4A 3VLBB 5KR7A 5K0UC 1B35C 2VBDA 5H9RA 5CEHA 4QGNA 3IWZA 4IE5A 2D6KA 4I0AA 1B35A 3N7JA 2ATFA 1Q8VA 4UWDA 1CX4A 5FZ8A 2ZCWA 3Q8CA 3WR0A 5E88A 3KVBA 1BVP1 1JHNA 1W2UA 4BQYA 5HV4A 4MUVA 3J7NA 5J36A 4YZ4A 2EALA 2WO1A 1LB2A 3N7LA 1ZBE1 4AVTA 3J26N 5T52A 1SFNA 1YIPA 1VAMA 5FYIA 1WBLA 1ZRFA 4QQPA 5AVPA 4COYA 3LFMA 3NW4A 5JVVA 5EJ3A 3JBG1 5JLVA 1QQP3 3MIGA 5ISLA 1WMEA 1VBB2 4ET7A 4IE4A 5I0DA 3BODA 1WW4A 3AC0A 4A3ZA 4JGYB 5F7UA 2GC1A 4KWKA 2XQXA 3GCXA 1RUJ3 4CE8A 3OGGA 3M70A 1MS8A 4R9AA 1LAJA 1JU3A 1RUC1 3DL3A 1POV0 3VBRC 1AYM3 1ULPA 4IESA 4CDWA 3MLLA 1ZRRA 3KB5A 3PURA 1SLIA 1XNBA 5E1RA 3RZJA 4YPJA 4EN6B 1TMF2 4NRMA 3W9AA 2YFUA 1OQ1A 3I4IA 3N9MA 1L7QA 3R6SA 2P37A 1GP6A 2ZHLA 1UXZA 2X29A 1OLRA 5A7QA 4OI4A 4LXLA 3F2ZA 3LGRA 3U14A 2EAAA 2Z2SB 2ENRA 5FRAA 1WCKA 4XF3A 3H8XA 1C8M3 1OC1A 3N9PA 3ALQA 1UAIA 4K40A 1UY0A 2XKOA 3DN7A 1UOGA 1VBB3 1NCQC 2CYFA 3GDBA 1QMJA 3CHXA 3OPWA 3I2OA 4P9XA 3ZN5A 1VBC1 1EV11 1REFA 1FPN1 3MUY1 2XL9A 1WUVA 4DIQA 1CAVB 1OFNA 5F3GA 4PI2A 1NOVA 2RDNA 5L7OB 1S1AA 5J7MA 2WA3A 2NN8A 3E5UA 2R072 3IDAA 2BDRA 2NLRA 2WIIB 3AYCA 3K51A 4LE3A 4Y22A 5FK8A 3UKTA 5F3CA 2XPJA 1FV2A 4J6GA 3AP9A 1BHGA 5C9AB 5CNAA 3C7EA 2D6OX 2OPWA 2VGDA 4Z8BA 1DP0A 5IWFA 3I3QA 5AFBA 2ZX4A 4ITCA 4LBNA 1RUG1 5LA9A 3THPA 3VBSB 4YVWB 3W58A 1ZRDA 1SCRA 2DBIA 1WLDA 1I9RA 2A1XA 1W9YA 4JVAA 4UFIA 3AMHA 4XHBA 2AUYA 4NJ4A 5D1IA 4R8HA 1WD4A 5GJ6A 2ZA9A 2RR11 2HWF1 1R1A3 3M1HA 3MLJA 4N43B 4FFFA 2CDPA 3S7EA 2RV9A 4YZ2A 1ALYA 1DGWX 1HIXA 3DYMA 1UZVA 1OKOA 4A45A 3USUA 1UMZA 1KDKA 2UY9A 3H0OA 1JBCA 3ACFA 3NV4A 3CF6E 4DO0A 1LTEA 1ENXA 2ZGOA 1LCLA 5I0UA 4RGGA 4CEYA 1GR3A 4QDQA 4QQOA 1GP4A 4DINB 4E4DX 4BCUA 1LGNA 1W9FA 1VAVA 5C3OA 2QJVA 3HD8B 3LA7A 1R081 2W39A 4OCTA 2VZSA 3RJ2X 4FTSA 1N47A 2VCBA 4P9LA 4BM8A 1MS5A 5M0TA 3O1TA 2Q30A 4BPZA 4QPGB 1PGW2 3VDAA 1LOBA 4NR1A 5IW0A 3RI8A 4X6RB 3H8OA 1MR5A 1NXMA 3PUSA 1FMD3 1DYPA 2XLAA 5FLJA 3KS7A 5FIXA 1ULOA 4OMDA 2DCZA 4WVMB 3ON7A 1BLZA 3MYXA 4FPYA 1PVC1 3IT8A 4HPKB 4U36A 4H7LA 4DXZA 4HN0A 2QQOA 5AC92 4B29A 5LA2A 1PZ8A 3BN6A 2Q1ZB 5DPNA 2E31A 1OUXA 4ASMB 2GC0A 1F4AA 3DYOA 3B3QE 3MO4A 4M3CE 1PGL2 2NMNA 5A33B 4OUMA 1X9PA 2WQ8A 4PLMA 4XUQA 3VHOA 5JMCA 4QXHA 2E33A 2JKBA 3FC0A 2JE8A 2R16A 1VBA2 1D4M3 2WYSA 4R9DA 2ARCA 1CJDA 2LUWA 3PL0A 4KI5M 3OGJA 3SXWA 4DRVA 1W8FA 3OCPA 5LRSA 2ZEWA 3NNGA 4J1WA 1RUF1 2AEZA 5FFOC 2Y6HA 1G9DA 2E9QA 2VXRA 1XQNA 2DUOA 2GNTA 3X29B 2RVAA 3PVNA 2SLIA 4YW2A 2RDQA 4RS5B 4MO3M 1AR92 4RGAA 2VMCA 3VV1A 2C5DA 1POQA 4G9SB 4OUEA 3C3VA 3J4UH 2Q8CA 3VL8A 1Y3TA 1N3QA 2C26A 5IVYA 2J1SA 1V6OA 2C6SA 3TN92 3T09A 2W92A 3AK0A 2VVEA 3AVRA 3LCPA 2FD8A 1MZ6A 1ND2C 2AH2A 4AI3A 3O1SA 4XDPA 1MACA 1WZXA 4B3NA 4UW3A 2A71A 4QHZA 4XCAA 1VBA3 2Y60A 5DN2A 3SLIA 4JRLA 5JXIA 1CWPA 3MF6A 2H6BA 4SBVA 4NIGA 1QJU3 3FFZA 3TNPB 5FJKA 3BTXA 1JTZX 5GZDA 2XKPA 1AR71 2W87A 4F83A 1YEWA 3WZ1A 3IMNA 2WZ8A 5A3OA 5H9QA 3VBFB 5JSOA 1G9CA 3I7DA 1RHI3 3OY8A 3WF4A 3ZPYA 2VZRA 2W1SA 1V0AA 1LULA 1Z7S2 5DAWA 3AMPA 3UKNA 1CZSA 3IKWA 3INAA 5DG1A 2ZX3A 4BOWA 4LTAA 1W2NA 4GB31 4LIVA 5F8PA 2LS6A 1PMIA 4OQ8A 5LK5A 4EN0A 1O5LA 3SHRA 1B35B 3ZMNA 5K0UB 1JZ8A 2A3YA 3D8CA 4M3CF 2NPIA 3TB0A 4I09A 2ZOEB 4NVPA 5I0TA 4XDQA 3GHNA 3W5NA 4FPFA 2R061 3ES4A 5KC6A 4KU8A 3T2TA 1QOOA 2XLFA 4B4PA 5A3LA 1NKGA 2VVFA 1W9WA 3HT1A 3KZ4C 1LHOA 3J8F3 5AVAA 1YUDA 4LK6A 4O7XA 4UOJA 3WQ1A 3KQRA 2FBEA 5JCTA 2BUKA 3WX5A 3VDBA 1ZBE2 2P3YA 3AMMA 4AXOA 4UAPA 2DFCA 3UT0A 1DG6A 2C0ZA 3HQXA 3KGLA 3PNAA 1WD3A 4IEYA 2ZTNA 4A6OA 4MGZE 1EUUA 3HWJA 4XC9A 2C9KA 1XE7A 3JBG2 1SEFA 2K9ZA 3THCA 3CZUA 1LGBA 2XXZA 3I97A 4Y1VA 3OSDA 4E4HA 1QDCA 4IXLA 4BA6A 5C7GA 3MEPA 4IEXA 3WDYA 2IXLA 3VBRB 4FPEA 1A8MA 5FUIA 2V4VA 1RUC2 3LZZA 4IW3A 4XHXA 4DEQA 2HH9A 5ABJC 2Z42A 5DZFA 4CU8A 5IK7A 2J1UA 2YU2A 3BB6A 4Q4X3 1SQ4A 3KHBA 4HONA 4LO4B 1SDWA 3LWCA 2OKXA 1REEA 2HWE1 2FZ1A 3HN3A 4JKKA 1UF2C 3ZYBA 4AZZA 1FI2A 1MEC3 1LEMA 1RUNA 3DKWA 4PI0A 4MH0E 2Q1FA 1RC6A 3ZOIA 4PBOA 3AKSA 4OVEA 4EJRA 2Y0OA 5BNNA 1JUHA 1NCQB 1QOTA 1LENA 4XBQA 3ST7A 3WEZA 5JXGA 3IDEA 5FPZA 5LY1A 3HJRA 4LR4A 1A34A 1XSRA 3A0NA 5FTTC 1N1YA 1NT0A 3VKOA 5JI9A 1OPMA 1VBC2 3O5SA 1PGSA 1EV12 1PO11 1FPN2 1UOFA 4K7JA 4OFGA 4Y22B 2JDKA 2EXIA 4CUBA 3OB8A 4J25A 4CCDA 2J1EA 4OUSA 5CAZA 5FMCA 1DU3D 2P34A 1C4RA 3LF7A 4MSVA 3VDCA 1COV3 1H4HA 4Y1XA 3VZJA 3J7HA 1AXZA 4QX2A 1OA4A 1BQPA 1LKNA 4YM1A 3VBUA 1YJLA 3BVCA 3AZZA 4PDWC 1VBE1 3WINE 5LEJA 3BUCA 5JOYA 3RMXA 3MW2A 3EMRA 4NO4A 1RUG2 3ELNA 4PDWA 3WUCA 2J1AA 2WUHA 2VMHA 2WR9A 3EO6A 3K4ZA 3I2KA 4XJZA 2RS31 4KNCA 3PVOA 2XJPA 5A7SA 1W8TA 3ZXJA 3RZKA 1YQCA 1DBNA 1TQ5A 1V9U1 4IETA 4M4PA 3OYWB 2RR12 1R093 3C2UA 2DCYA 2HWF2 5G05L 1H6XA 3O7OA 5A7PA 5A3TA 2FHRA 2PHWA 1ENSA 3OUHA 4UW6A 5FUNA 4CPBD 4XJUA 5FYVA 2QQKA 3OGSA 3P6BA 1LODA 1OHFA 3QH6A 2A75A 4CDQB 1SLTA 4XW3A 4C0HA 5F6LB 3T1LA 1QH7A 1X7NA 2E6VA 3BTAA 4MXVA 3B00A 5JXJA 3M3OA 3C7FA 2RS51 4GKYA 4LPLA 4UW4A 3MUZ1 3ZN6A 5JSRA 1R082 3FBMA 3GBFA 2ZGPA 4FVVA 4M0NA 1ULEA 1RUH3 1U5ZA 2BQPA 2ZMNA 4PF1A 4GKXA 2VOXA 1JW6A 4AVBA 3THTA 4BXSV 3VD5A 5J96B 1O8PA 1N3OA 1CPMA 4LKEA 4COUA 1M4WA 1WW5A 1OKQA 2JKXA 3VD7A 1YXWA 4L2NA 3J7LA 4IGOA 4S2GA 4UFLA 3SH3A 1Q5OA 4AI2A 4LBQD 5L9VA 1PVC2 4RHV3 5DDJ1 2XG3A 3K4DA 3S6PA 1JZ3A 3NSTA 2CL2A 1RTVA 5LK7B 4F8AA 4OHWA 1W6MA 2A5ZA 1ASJ3 2HWD1 4X8NA 1UW8A 2YG0A 4P5YA 1UMIA 2ERFA 3WW3A 2WSVA 1ZA4A 3N35A 2DCTA 1GOGA 3B02A 3W5MA 5EYXA 5BNPC 3TOJA 5G04L 1F8VA 2ZEZA 4O9GA 2BOIA 5DAPA 4OHVA 1X9TA 1HN0A 1QH6A 1I5ZA 4BZ4A 2JB4A 2XVLA 3KV4A 3IPVA 1A6CA 4MVTA 1RUF2 2WRAA 5FV3A 2WWJA 3WNMA 3RWNA 4GQ7A 4B4QA 4ARYA 3ZYPA 1D4VB 1LHUA 2A6VA 2RM23 2Y6FA 5FXWA 1DZTA 2F17A 1RL3A 1O3SA 1JN2P 1IGOA 1KEXA 1QQP1 2UYAA 2PHUA 4N53C 4XJ9A 3ZFFA 1JYXA 4XUOA 1ND2B 1V00A 3VB9A 3AKPA 4AG4A 1RUJ1 2PHTA 4JQTA 5FP3A 3TNQA 1JUIA 2Y6JA 5CKMA 1IOAA 5CU1A 5T5PA 1ZYBA 4AL9A 3AL5A 4EWAA 5KXCA 4JHTA 1AYM1 1HQLA 4YW1A 1YQ2A 5JXHA 3W20A 2QQPA 4QQHA 5FZGA 5FWEA 4XBLA 5DUWA 1BXHA 2CV6A 3F95A 1US2A 3WNXA 2B5HA 2V5DA 1UO9A 1YFXA 2ZX0A 1AR72 3OY8B 4LBMA 1YQ8A 4IE6A 5LBBA 3OGVA 1C8M1 1NA1A 1IG0A 1U5YA 2G9GA 4LO8A 3WW4A 3WDUA 5E16A 5GZGA 3AYAA 2BJSA 1YFYA 2WWSA 3W59A 1VBB1 1NE4A 3GYDA 5FY0A 4QMAA 2LM3A 1PM7A 4PJYA 1W6NA 1SMVA 3WD5A 4B7KA 3JZVA 4GB32 3PMSA 5H9PA 3WHUA 1IQDC 3NKTA 3PTRB 4NE9A 1OQEA 3WG3A 4AVVA 4D7SA 5I91A 2BV4A 4D0QA 2VCAA 4FAGA 2I2SA 3LKJA 3VD4A 3JCIA 3AVSA 4OQ9A 5FBJA 2VZOA 1G8WA 1H0BA 1DQ5A 5C3QA 3NRUA 2PXJA 1RUE3 2R062 3L2HA 1W03A 5FOBB 1QXJA 1GZCA 1WW6A 2P2KA 3ACIA 3C7HA 2JDHA 3DYPA 4S2DA 4OULA 5LASA 3WP6A 2QQUA 1QJX1 2ZKLA 4K6BA 4CP2A 2X09A 1N1TA 4M01A 2QKDA 5FMBA 2EIDA 3SQOA 3ACLA 1WCDJ 5IFTA 1KJLA 2QQIA 4UFHA 5JOZA 4MZUA 1HKDA 4PIYA 5DZGA 5C71A 3HNYM 1SBEA 2F4PA 4HKWA 1R1A1 4E27A 3A7QA 2ARBA 4Q0SA 1FV3A 2RS13 1BBT3 5FYZA 3D0SA 4GJYA 5CISA 5FZHA 4RFT0 4AW7A 5ABJB 5IFPA 4AEKA 4K8FA 2H6CA 3ZSLA 5FY8A 4AR2A 2BRTA 5A32A 1W3VA 1QJFA 3K3OA 1AXKA 1YLLA 4YM2A 1C1LA 3A21A 4DXTA 4E2QA 4XAEA 2HWE2 5C33A 3M2MA 2ARXA 2GSYA 1X82A 3OBAA 4GALA 4EQVA 3E6CC 2BERA 5FO8B 2AR6A 3NJZA 4BQ1A 2Y34A 3CU7A 4IEWA 5DQ0A 4BQWA 1RMU2 3LOIA 4QAWA 3WNNA 5EZWA 2FCTA 1W8ZA 1UYPA 1FMD1 2LRPA 3I2HA 1NG0A 5JI7A 1IS5A 3UJQA 1IKQA 4K20A 3HBZA 1S0BA 3WLUA 1PO12 2KR2A 1CPNA 2JD9A 1VB2A 1YRZA 1Y9MA 3AXEA 5IK5A 3BYWA 3NMBA 4PDWB 1VE0A 2PA7A 2R0HA 2ZZJA 1RYYA 2QTWB 1VBE2 2X5IC 3WY6A 5F5QA 2WINB 1HX6A 3KF3A 1J58A 5CA6A 1D4M1 1QJY3 3LA2A 1RMU3 1V70A 3WDVA 1LEDA 5A6XA 4IERA 2JDZA 2XB6C 3CEWA 1TZOA 3FUOA 4RN5A 4FTEA 3CZJA 4QM9A 4BIOA 3BU0A 3WT3A 3UYJA 1L7LA 1VB4A 3ZR5A 4A4AA 5B2GB 1V9U2 1E5IA 3VKMA 4CCEA 3MW4A 3UGGA 1GQGA 4XJWA 2WZPP 3T08A 3T2OA 4LK7A 3EQEA 5A3WA 1UZWA 2NYYA 4HL0A 4W4ZA 2E32A 2WNUA 1XE0A 4DOUA 3LPFA 5LBFA 2HWB3 3WQ7A 2V4AA 3H8RA 1MS1A 2UYBA 4TLFA 3RJRA 1I6XA 1HRV3 2BU9A 5KXDA 2ZAHA 1GANA 2RS52 1QJU1 1H1IA 3JD73 1OD3A 1W2AX 4N7UA 3VDDC 2ZAAA 1TME3 1HV1A 1Y4WA 4CP0A 1W05A 1W6PB 2FDHA 5DAVA 1ND3C 3SCFA 3VDDA 4QPWA 3ZMOA 1J83A 5FP8A 4WZCA 1RHI1 1WLTA 3HNMA 1L7RA 3MFAA 1AZDA 3Q9OA 1ND3A 2ETEA 3WQ0A 4QX3A 2FZ2A 3FLPA 1Q8QA 3SKVA 5DAQA 4ZONA 1LOEA 1Q43A 2IC1A 5FMOS 3MBWA 3IAPA 1GKBA 2KM2A 4F3JA 1HDKA 2IXCA 4URTA 4HVRA 5DDJ2 2XJQA 1XJAA 1XNTA 5FY5A 2CNAA 2PHLA 3PDQA 4M3CB 3O0VA 1JZ7A 1JYIA 2HWD2 4HKOA 3AX4A 3AP7A 2B39A 5JPMB 4CXWA 5AFEA 2BTVC 3WF2A 2XJTA 5BXXA 1CGPA 5BNPB 1XE8A 4KG8A 2ZACA 2HYXA 4R4XA 3J8F1 4XJAA 2BVBA 3K48A 4BK4A 3MIBA 3CJIC 5EPAA 2B7YA 4GAZA 3K3NA 3GNEA 2DWRA 4Z2WA 4LEJA 1JZ2A 2H0VA 3CJIA 2JIGA 2A3WA 2PMWB 3AZWA 5A1LA 3G7DA 2HWC3 1J1TA 4N53B 1JOJA 4QPIB 2NQYA 4Y1ZA 1I1EA 4DXSA 4C1WA 1QQP2 2XONA 3NNJA 2DVDA 3WNLA 2EA7A 3EXUA 1RUJ2 2VNOA 2KA3A 3D0JA 4LUMA 4IL7A 4OHXA 3MLKA 1J3QA 1SLBA 3KV6A 3QOPA 4IDZA 1AYM2 4DUWA 4LQRA 4Q4X1 4XFHA 5FZIA 5JR2A 3I8TA 4CXYA 1ULGA 4JGZC 1EP0A 3LB9A 4KGGA 2NZ9A 2VPVA 1IG3A 2A73B 4QB2A 1MEC1 4JGZA 4Z1VA 4YLZA 1US3A 2OYZA 1AF9A 3ZFGC 3JB4C 4CTEA 2XQRA 5C8CC 1LU1A 1H2KA 3AM2A 5F32A 4EWEA 3ZFGA 3OUIA 1W6NB 4MXWA 1YNAA 1LRHA 3RGBA 1C8M2 1J3RA 1NZCA 2IWGB 3M8LA 5C8CA 4O65A 3ACHA 4P9JA 2CDOA 2G1MA 3S57A 2GALA 5CFDB 5FYHA 5HV0A 3SMHA 3RFRA 4UBGA 4FSJA 4BQ3A 4CDWC 2P4EA 1OUSA 2X10A 4B1LA 2B9VA 3Q8BA 1WLWA 4L99A 3DXTA 3CIHA 2OUJA 4NN0A 5KHKA 2QFEA 1RB8G 1COV1 3RNSA 1ZBA3 1W9TA 4DY5A 1CAUA 4LMFA 1LOGA 1UWWA 4P9YA 4PQ9A 3ZYGA 4GXLA 4N90A 2AENA 4HXCA 2AACA 3BGAA 5T54A 5LEKA 2XUEA 2JG8B 4QM8A 3ORJA 1QJX2 2BP6A 4IGPA 1LESA 5IAXA 4CUGA 1GNYA 5ANQA 1O4YA 2A3XA 4NRPA 4ZS3A 3QLQA 5BY5A 4FPJA 3RWKX 1BK0A 4PLNA 4CUCA 2WL1A 2RMU3 5FJHA 4BJ0A 1F31A 4Y5Z0 5LBCA 3ABZA 1R091 3PUHA 5A6QA 1UIJA 3E6DA 3KT7A 1R1A2 4Q0QA 2GDFA 1YYNA 5A32B 2QDRA 2CAUA 1HXS3 4BMEA 1S0FA 3HIFA 4PCRA 2VUCA 3POBA 2OXBA 4LNVA 1H4GA 3D4KA 3ZIWA 4AEDB 3TBDA 2BYVE 1EAH3 1PMJX 1QJX3 2ZGRA 4HSLA 5SV5A 5IVFA 2ORZA 2XHKA 3EJKA 4QXCA 4XABA 3T2PA 1JI6A 3KSCA 2GNBA 3D3AA 4LBJA 5EHDA 5FYYA 1AL0G 1YCIA 3NV2A 3UV9A 4FQ4A 4P9IA 2ID4A 1V6IA 1BYHA 1RUH1 2VZQA 2YFZA 3LEGA 4AHZA 1SFYA 1DYKA 4W50A 1K3IA 1SFPA 4YFZA 4PHZA 2VQ0A 5C3SA 1U5XA 2G19A 1W3XA 4ZZ8A 5C3PA 1HN1A 1GV9A 2VOKA 1FMD2 2D3PA 4XZPA 3POJA 2HBUA 4OLLA 2B46X 4FAHA 4FOQA 1K5MC 4JDOA 1C57A 1WBFA 1OBNA 1M06G 5D2AA 4RHV1 2E63A 4CEYC 2R043 3HVDA 2VTFA 4XIKA 1K5MA 1W2OA 4NWVA 1G86A 1GWKA 3LEIA 1LJ7A 3RYPA 1ASJ1 1PIV3 2ZEXA 5FZOA 3VHNA 5JZGB 3NV1A 1AUYA 2X5IB 2Y0IA 4ZZ5A 4ES9A 3LIGA 1H8TA 3W21A 3MHZA 3CDZB 1ONAA 4OI2A 4LT5A 5FWJA 2AREA 2WLQA 1D4M2 3ZXDA 3JQXA 2ZX1A 5F9TA 1S2KA 2WAAA 4UT5A 2OVUA 1CZVA 2WFF3 1Y7BA 1G9FA 2WNVC 3CO2A 5FYSA 2PELA 3CQOA 3WCRA 1S0DA 2RM21 4LIUA 4R9BA 2WNVA 3AKQA 4TN7A 4AVAA 4YVSC 1T2XA 2OPKA 1GSLA 5FPXA 2VW2A 3U10A 3UJOA 2ZBJA 3S5AA 3ECQA 1RUI3 4YVSA 4AQTA 2TBVA 5F3EA 3ITQA 1OI6A 4RL7A 1GLHA 1XU1A 4XMAA 4AEDC 4EYUA 3D6EA 5LBEA 3CL1A 3VBHC 1IS4A 1CD3G 3EBRA 4YM3A 2VOWA 4ATFA 3O0XA 1O3QA 1UIKA 3VBHA 2IFWA 3NKGA 4MGYE 1QHDA 4YW3A 1QU0A 5GLTA 2YV8A 3AXDA 3V0BA 4IUGA 3AJZA 3OBZA 1QJU2 2BGPA 2ET1A 2XBO2 1H2MA 5D8AB 1ZZ6A 1DCSA 1UNBA 2QQLA 5KHGA 4GWJA 1DDLA 4KWJA 4COWA 4Y5TA 5HCFA 3LOBA 4ASKA 5FZ3A 5IUQA 5LY2A 1NX9A 4TYSA 2XJRA 1JZ5A 1ODMA 1RHI2 5F39A 1SZBA 3VKLA 1O3RA 4AGRA 2OX0A 3A22A 2BEOA 3AFKA 1RJ8A 4W6WA 2FMYA 5IYYA 2VUJA 5KWRA 3AP4A 3VUOA 3FN9A 3AB0A 3BPSA 4FOVA 2YDEA 1GNZA 4E9KA 2W1QA 2PHFA 4HOOA 1TVGA 2VZVA 2O8QA 1JODA 2XBO3 2VJXA 2ZGNA 4L8QA 4X6QB 3B01A 4FPOB 4XTMA 1RUE1 2HEYF 3ZKYA 3KM5A 2Y8KA 3U1XA 2HKXA 5FY9A 1JZ4A 1ZREA 2D40A 1GZ9A 3J8F2 4QB6A 3RYKA 5A70A 4D94A 4JZRA 4PT6A 2XWBB 1T6BX 1XNKA 2VD7A 4YG3A 1RGSA 4CPBA 2ZHNA 5A3UA 3R4DB 5DUXA 5FBZA 4DXRA 3TAYA 1UZYA 4NIAA 4C91A 2PYTA 4YZ1A 1HJFA 2EIBA 2ZX2A 4EN7B 1KRIA 3H9AA 5FYBA 1PNGA 5A80A 2MEV3 4HFSA 1XB9A 2CWSA 2E7AA 2RS11 1BBT1 1BKZA 3C8XA 3O12A 3R05A 4NPMA 4ONUA 4JKMA 4LO5B 3ZDSA 2GH2A 4AFBA 1SDDB 2WQ4A 3FLTA 1HQWA 4N7IA 5FZ9A 1G6NA 2QCSB 4JGZB 3JQWA 2ZMLA 4Q4X2 3BKZA 2VTXA 4LKSA 4KMQA 3ZFGB 4MXWB 4ZU7A 4AQSA 1XSQA 4D7TA 2W0XA 5C8CB 3OPTA 2C24A 1MEC2 1SACA 2C4XA 2QQJA 4NIDA 5JR7B 4Z07A 2IXKA 2EXJA 2FDGA 3T4VA 4NHMA 3T0BA 4AI1A 4EN9B 1GUIA 1MVQA 1VRBA 3PUQA 4XF0A 5C4WC 2OZJA 4LBQA 3ILFA 2WN3A 2PLV3 4XQWA 4URAA 2XLGA 5IVCA 1XC6A 3I3MA 4NIHA 1JS9A 3OUJA 5C4WA 4CDWB 3H3LA 4CVUA 4RR3A 4JQRA 2ZZQA 1KQRA 2RHPA 2V73A 3IIAA 2QNKA 1AX1A 1CAUB 5DMYA 3IM0A 1Z0HA 4NWWA 3UKVA 3M7AA 5DABA 4CDXC 4MGQA 3K46A 4IEPA 1COV2 2OW4A 2Y38A 4HK8A 3GZEA 3B7MA 4XETA 5FZFA 4CDXA 1CAXA 4HT1T 3AZXA 3RG0A 3H3ZA 4QKBA 3FMGA 5BNOC 2IVJA 3NQHA 5C5UA 4BISA 5BNNC 4UF0A 5L36A 2ES3A 3OOXA 5BNOA 4A44A 1QJZA 2VO5A 5IK8A 3GBWA 1QJY1 1RMU1 2XL7A 3GBGA 5FZ4A 3B9IA 4GMP3 1DQ0A 1PX4A 1W6OA 5I0SA 3B94A 4XMIA 3H7JA 5LRRA 4WM7A 4KL1A 2WZR3 3CJXA 4KU7A 4YGCA 3E1F1 1NY71 4KWLA 1V6MA 3WG1A 1R092 4YSFA 4CCJA 1KS4A 3MGUA 2BWCA 4CUAA 1H8VA 3T1MA 3I3BA 4Q4W3 3VBUC 2O8OA 1DQ6A 5EJ1B 3WUDA 3AP6A 3ZYRA 4I2OA 2GAUA 1CIYA 4GH4C 2HWB1 3GF6A 2XUMA 4L92A 4RQPA 4XXPA 5FCCA 3THDA 3ZXAC 4HKLA 2VZTA 4GH4A 1HRV1 2GU9A 4FPHA 1MS0A 4N9HA 4LHSA 2P1BA 3S7IA 3T4HB 2WYFA 1GOHA 2R32A 2Y6KA 4Q1PA 3ETPA 3JD71 2YC2A 5T5OA 1GOFA 1TME1 5E8AA 1DQ4A 4AQ6A 1RUH2 4UFKA 5FK7A 1LHWA 3EB7A 2WN2A 4K21A 1PHMA 4QX8A 3RRDA 4QU1A 3USUB 1RINA 5A1AA 4UBHA 1K5MB 4HBNA 4Y33A 1CONA 2P3JA 3AYEA 4CEYB 1Q8PA 1A78A 4D6QA 2TUNA 2Z69A 4ISRA 2RDRA 4RHV2 2CGPA 4XBNA 3UETA 4KBZA 4H14A 4QGLA 5C8WA 2GMMA 1Q8OA 3PUIA 4HN1A 1BJQA 3URFA 3BIEA 3N7MA 1ASJ2 1QIQA 1SG3A 4FO9A 2JICA 1AYN3 1DGRN 3UGFA 3OD0A 1PNFA 1C3HA 1GFF2 1E5HA 2P5BA 4QPYA 5EYYA 1DLLA 1HV0A 3WF1A 4HVQA 3VZMA 3KT4A 3KCCA 2VQUA 5DAXA 3RZMA 1AXYA 1VALA 2W94A 3ZR6A 1QEXA 2WNVB 3HNBM 4R4ZA 4K9SA 2G9ZA 1JOPA 3B5LB 1KS5A 2IZWA 5CBLA 1OOPA 2P17A 2HWC1 3LE0A 1O4ZA 2BNNA 2DVGA 2LALA 2RM22 2XWJB 5GLWA 4FQZA 5GKAC 1CESA 4CCLA 3GZTB 1APNA 1KD7A 4RFRB 3HN1A 4QHBA 1BMV1 5E6HA 1IKPA 1C28A 1W0OA 2V5YA 3HQRA 3KV9A 3VBHB 2IFRA 3WG2A 4BH9A 2XJVA 4BHPA 4EROA 5IT6A 1S2EA 5K9YA 4XF9A 3O1OA 3BALA 5JOXA 2ZEYA 5DG2A 5DUUA 1OXCA 3H1MA 4OYUA 1BEV3 5A3PA 1JXNA 1K12A 4XF1A 4XFFA 3ZFEA 2VZ1A 4DY3A 5FZBA 5LCWL 2D3RA 5GLUA 3C7GA 3BCWA 1UD1A 3FL7A 1Y43B 5FYMA 2F6BA 2R6QA 3WDXA 1J59A 4DPNA 3ZN4A 2BOJA 1QXRA 4AYUA 5BNQA 4JCKA 4HK9A 5FY1A 4LBOA 1ENQA 2OZ6A 2LTNA 3FE5A 3ZFFC 5A7WA 2ZKNA 1HRI3 4NPLA 5F2WA 1FNYA 4HMZA 3HBKA 1ZVFA 1G7YA 4AGVA 2ZHMA 4P5HA 5FR3A 3ENRA 5E89A 1RVF1 2PQQA 4LA3A 4BLIA 3TEZA 3KHCA 2BNMA 3POWA 3V56A 3WW2A 1S0EA 2JENA 2IVIB 4JTNA 1CZTA 3CNAA 3LDKA 4XFCA 1DGWA 1H1MA 3PU8A 3RZHA 1ZBA1 3AKTA 1MZFA 2CSGA 4QQ2A 1LHVA 3MIEA 5IVBA 5J09A 1Q8SA 1AHSA 1JYWA 4LO7A 2X53S 4EWDA 1RUE2 2WKKA 1NA1C 2AGSA 2DFBA 2VOVA 4OHYA 4AAPA 3QD6A 1GQHA 3HPNA 5EV7A 2WJSA 3C7OA 3Q8EA 1RUOA 3O1RA 2DCJA 2W68A 3GZUC 4Z2AA 1YJKA 3L9JT 3H1YA 4BQ2A 1SPPA 2VQAA 3TYJA 4L0PA 5ERLA 3G6JB 4JRAA 5GALA 1DIWA 4CEWC 1AL22 2RMU1 3MPBA 1WMFA 2HJIA 4EZHA 4CEWA 2W95A 1J84A 4OZXA 4ZXKA 1QWRA 1FATA 2RS12 1BBT2 1HXS1 1WMDA 4FFHA 4Q27A 2Q8EA 1S0CA 3UESA 4GZ9A 1AR63 3PTYA 3BU7A 4M4RA 1KXGA 2UY8A 2JX9A 2XGXA 1QDOA 1A8DA 3N9QA 1W8OA 2D97A 1REDA 2XH6A 2GC2A 3AMQA 2TEPA 3DPRC 1O8SA 5FZ6A 2VMIA 5JOWA 4Y20A 3AP5A 4DFSA 4QHOA 1EAH1 4C0BA 3DPRA 4BDVB 2CY6A 1XNAA 4LORA 2VCCA 2W1WA 1F9KA 2QZ3A 3FX3A 4KQ7A 4Y26A 4LBQB 4JGYC 2BFUL 2GMEA 4UYBA 4FXKB 2WSUA 1PVXA 4WBBA 2J1RA 2BGCA 4Y5SA 2EAKA 3ZYHA 1AL23 4F7ZA 3U0ZA 1E5RA 3GJAA 4H2AA 4JGYA 5IAVA 2E7TA 2XJUA 1FOD3 4D6SA 4XPVA 2FDFA 3POIA 5BUVA 2W52A 2A6WA 3O1MA 3BI3A 4BQXA 1PX3A 2QQVA 2EF6A 1W9SA 4UFJA 2D43A 2GNMA 3CMGA 3NL1A 3MFCA 1NAEA 4CDXB 4FPKA 5H9SA 4MGTA 1CQ9A 3POSA 2R041 1MZEA 1UL9A 1RUD3 2R1DA 2NMOA 3ASIA 4DEVA 1PIV1 2EIGA 4E4ZA 5BNOB 2XJSA 2VECA 4RGKA 3OEBA 4W6YA 3ZSKA 5BNNB 2P6CA 3TEXA 3R4UA 3VBOC 3ZXGA 4A41A 3BTZA 3PLQA 4TSVA 3NJYA 1W8UA 1OQDA 2YC0A 3M3QA 4P02B 1NZIA 2GN7A 3DEMA 3E97A 3VBOA 4ASLA 2WT1A 4G3YC 4NROA 3POYA 2DU1A 4NAOA 1QJY2 4XUPA 2XOMA 1PO23 3H8UA 2YBSA 1CAVA 1H1AA 5T55A 5ACA3 5I8SA 2WFF1 3MW3A 1BZWA 3T30A 2IUWA 2Q5TA 1K5JA 1NY72 2Q0AA 3OTFA 3GZAA 1ZZ9A 1ULFA 2CTVA 4Q8KA 1U12A 3VBUB 5C9AA 4Q26A 4YGBA 4GH4B 3N4MA 1RUI1 1OLMA 3GALA 5A7OA 2QQWA 3AZYA 3CBNA 1DLCA 5FKCA 1JHJA 2HWB2 4I0BA 2D3SA 2NM1A 5K4LA 1IHMA 1D0HA 3I3EA 3BTYA 1JMUB 1D2SA 1HRV2 2ZXQA 2YROA 1OFSA 4QX0A 3NAPC 3I2FA 4MHRA 2AYHA 4CA9A 4S2HA 4QB1A 5FYUA 3NAPA 3JD72 5FAXA 3VZNA 1SLAA 5CKNA 1AVBA 4ZPIA 1TME2 2A6XA 5EJZB 2WBKA 2VL4A 5A3MA 2UU8A 2GP3A 2WNUC 1YFWA 4PIZA 5FQ0A 1DQ2A 2F4LA 4YM0A 5A6ZA 2E26A 1OH3A 1XRUA 2HEVF 3DF0A 4H3WA 4XURA 1BK1A 4FTBA 4LLOA 3HT2A 4GA9A 3ZN6B 5FLHA 5A6YA 3U11A 3MPPG 1JZ6A 3OBRA 4LOSA 2FMDA 4K8RB 4PQQA 4XXAA 3UL2A 2YC4A 3HAGA 3JU9A 5ANNA 4NHYA 1VMHA 3PHMA 2ET7A 1OA3A 2XBO1 5C5TA 3V0AA 4LITA 5FDBA 2WT0A 5FZMA 1PK6C 5KBFA 5IATA 3WP3A 1UQXA 4RYDA 1CJPA 1YC61 1PK6A 3LDRA 4BLJA 1F4HA 2N7GA 2ARAA 4LE4A 4QQLA 1AR83 4XAAA 1OVPA 1AJKA 5GM0A 2BW8A 4A3XA 4DRRA 1HB1A 1N1SA 4AFAA 2JXAA 4MG2A 2DV9A 1W6MB 1UY4A 2KXLA 4TXWA 3I49A 1ZRCA 2GNDA 1HLCA 2HWC2 3OPZA 5HBAA 3LEMA 3PVBB 5F37A 2MEV1 3OGRA 1IS3A 1UMHA 2ADEA 5T5JA 1PM4A 3MICA 1DYOA 4QKNA 5T5LA 4EZ4A 1BMV2 5J37A 1EUTA 1YQ6A 3ES1A 5EP9A 5FXXA 1C5HA 3SNMA 3MIFA 2VG9A 1VP6A 2W9XA 5JMOA 1KJRA 4XUTA 3IPVB 4W8JA 3FFQA 4AVSA 4MOAA 3P3NA 4A7YA 5JDBA 3IIIA 1AJOA 4RS5C 4Q4Y3 1RIRA 2G9FA 4Q2FA 3QACA 4LOTA 4QGMA 4RS5A 3RDIA 2WA4A 2JIJA 1HB4A 3ZFFB 5FXVA 1MPXA 2VR4A 3PJYA 3ZO0B 4QWNA 1FT9A 2BFUS 3WNPA 5LA0A 2PLV1 2VW1A 2OUHA 2ZPXA 4GD4A 1AX0A 4BQ4A 2B9UA 4IV3C 3ZIXA 1WA6X 4FP2A 1RVF2 4MX3A 5HPOA 4IV3A 1HB2A 2FCUA 5IVVA 5FZ1A 2HEWF 4LO6B 5KHHA 3MIDA 1S55A 3U4XA 3SEEA 5HI0A 1GMMA 1JOBA 4LHKA 1ZBA2 1IQAA 1URXA 1W0NA 1NA1B 3LAGA 1VRH3 4V1PA 4HLTA 4XACA 1ZA7A 4AFMA 1QGLA 5I0RA 5CG8A 4MLOA 2DUQA 4SLIA 2B8MA 4YW5A 2JDAA 1IS6A 4ZKTB 4AI0A 2A7AA 1UOBA 2VZUA 2WS93 3IN9A 4I3GA 5C3RA 5C6CA 2JDPA 2Z4FA 3PVEA 2VMEA 4GMP1 1A3KA 2MNGA 2VAUA 3KMHA 3N3HA 4CEWB 3H1WA 5K0UA 3RQ0A 3LD8A 1YWKA 4Z92B 4AAXA 3DKQA 3RS6A 2Z5WA 2WZR1 1F15A 2DU0A 2RMU2 1RVF3 4RSUA 2PAKA 2W3JA 2JE9A 1QXPA 4Y4RA 2IXIA 3WW1A 4AEJA 1Y9GA 2PTMA 3WNOA 3QCWA 4QX7A 4I0WB 3VKFC 5LA1A 3R4SA 1HXS2 4LKFA 4Q4W1 4Y20B 1VBD3 1ZZ8A 2DF7A 3DPRB 5FPLA 1OT5A 4DUXA 2DVFA 4IEUA 4QKFA 2Y26A 4XVHA 4TTGA 4LKDA 3H42B 3BOPA 4LBLA 4HANA 2DTYA 1UU6A 2J42A 4IEQA 2VE1A 4KGQA 3ROUA 1QF3A 1W06A 5CZKA 2Q1MA 1EAH2 1GU3A 3VKNA 3VGIA 4HETA 3N9NA 1HB3A 1EYBA 1OF4A 1ZRIA 4YWAA 1UOJA 2XMLA 4XF4A 1FXZA 3ZX7A 2XVGA 5CG9A 4PIXA 2O0OA 4FI9A 3VBRA 1YI9A 3GJBA 3ZXFA 1G9BA 2YBPA 3APBA 1MVEA 5F5IA 2JWPA 3EYPA 4HSJA 1VJ2A 4AF9A 3S0MA 2VBPA 3LIHA 2OQ7A 5FUPA 2R042 5FO9B 2WDBA 4MADA 4JX0A 2R30A 3IMMA 2VCMA 3I54A 3Q8FA 3VBOB 1PIV2 1STMA 2WFPA 3NJXA 1AYN1 4I02A 5FPBA 2RJLA 1NCQA 2OT7A 2XVKA 3KCYA 4BU2A 4IEOA 4CCNA 2P3KA 3NWKA 1DGRA 3VHPA 4C8DA 3KGZA 2D44A 2ZABA 4YGEA 3PJQA 2VNGA 2WNEA 4YARA 3WDWA
chains in the Genus database with same CATH topology
1XU2A 2V09A 1TMF3 1NXD1 4BE3A 1FYUA 1UPIA 4PF5A 2D7FA 2ZHKA 5I93A 4M0HA 2WFF2 4D69A 3J9SA 3H50A 1GZWA 4GWMA 4R9CA 5CIRA 1X8MA 2WC2A 3HMYA 1H8TC 1RUI2 2VULA 3CLPA 4IQPA 2Q4SA 1ZZCA 1VIWB 1ZX5A 2YYOA 4CYDA 2VNRA 1EPZA 2VVDA 1EY2A 3SCHA 3SH5A 1GNHA 3NAPB 1PZ7A 5K7PA 1SLLA 5GZCA 1BEV1 1UU5A 2GZWA 2R073 3H7YA 3O0WA 4Q0UA 5L19A 3OYWA 1DFQA 1KFXL 4HVOA 4DS0A 2RE9A 3M4FA 1C8NA 5FQ0B 4CDQC 4EN8B 2UWCA 5T3NA 3S30A 3USSA 2ZGLA 4WVVA 2WNUB 4PLOA 1O5UA 3JUUA 4XOGA 4CDQA 1N1VA 5KHJA 4DB5A 1HRI1 4W6XA 3SCGA 1TNFA 4I01A 3WP5A 4INDA 4OI0A 2R49A 4KG0A 2A70A 4Q4V2 1XYOA 4LUKA 4DNYA 1NE6A 1LOAA 1F2NA 1MS9A 1NLSA 3V0AB 2IXJA 2B45X 4C90A 4JV4A 1LHNA 3ZXKA 3N36A 4XEZA 1PK6B 4FT8A 3VDDB 1GYKA 1QNYA 3ILNA 1TE1B 1FX5A 2DURA 2D5FA 4MV2A 1POV3 5JIAA 1ND3B 2ZGMA 5BPXA 1X50A 2PHDA 1G9AA 1X33A 2BPA2 4M00A 2ZGUA 3QH7A 4Q8LA 3FWEA 4GMP0 2YPJA 4E4SA 1OD5A 3I2DA 4Q4V3 5DUVA 2CWMA 3LSDA 1NLRA 1LECA 1WCSA 2MEV2 2D6MA 2QVSB 1DZRA 4WM8C 4Q29A 1NQDA 1AR61 5KXBA 4WM8A 2A6YA 1OLQA 5AC93 2VH9A 3CJIB 4UW5A 1OSGA 1JH5A 3FBYA 2G4IA 4LHNA 1YI7A 1SLCA 1AL21 3AKRA 2ZJCA 4AHWA 1Z78A 1ND2A 3SITA 3ETQA 5I8TA 3AMNA 1I3HA 4ISQA 3E6BA 1FOD1 2YGMA 4LLFA 3OF1A 2PLV2 4IV3B 5EXOA 2GC3A 2UURA 2QE3A 1LU2A 1UKRA 5JSPA 4XE9A 5KHIA 1QY4A 2Q8OA 1AR93 4C1XA 5FOJB 4ZU5A 4Q1RA 1RUD1 4BWOA 1NYWA 4A7KA 4P9WA 1UPSA 4Q0VA 3TN93 2QUOA 3AFGA 3RI9A 1WA4A 4AK3A 3ILRA 3UK9A 4IV1C 3V64A 4BIFA 1H9WA 4AHXA 1H2LA 1AX2A 4IV1A 4L11A 4WVZA 1PO21 4RR3C 4D3WA 1O7FA 5GLZA 5ACA1 1JYCA 1FAYA 4S2FA 3AYDA 3FLRA 3VN4A 2WZR2 4A7ZA 1MS3A 3NO8A 3I59A 4CDUC 2OA2A 5CVRA 1ULCA 1Z7S3 3DUIA 3KD4A 4CDUA 2BVVA 5J48A 4Q4W2 2TNFA 1UN1A 2YMZA 5DXDA 1OPOA 1WGPA 5BV6A 2PFWA 1ZZBA 4NPRA 3WV6A 2UWAA 1QKQA 2K2SA 1V6NA 4WM7C 2VUAA 1MQTC 1U5IA 5CFCC 3V65A 1UX6A 1YHFA 1MQTA 5CFCA 2ILMA 3WP4A 5ABJA 3ZXEA 4Y1UA 3KT1A 4XFBA 1N3PA 1U0AA 1ZBE3 4D7YA 3BOWA 1DF0A 4RQPC 4HZFA 1KDMA 1XYNA 2YY1A 3JBG3 2PHRA 2W08A 4RD7A 3VZLA 5CB7A 5JAXA 1WW7A 3VHRA 3KCXA 3NVCA 1UCXA 1AYN2 4JDMA 3MI8A 4N9IA 1BVVA 4L9BA 1RUC3 3U07A 4QD2A 1V6LA 1EPWA 1WLCA 3OD4A 1CN1A 1R1ZA 2JG9C 2BBVA 1YFUA 1GZWB 1OA2A 2YUEA 1AR81 3RYRA 2JG9A 2H0BA 2MPFA 3SH4A 3D5OA 4GIQA 3A0KA 5JPNB 3MF9A 1TEIA 1H8TB 2D6PA 5JWPA 3IDBB 2ZGTA 2ZMKA 4YZ5A 1KFUL 1IPKA 2D93A 4NOTA 4BMBA 1VBC3 4AE2A 4EV0A 1EV13 2C1FA 1FPN3 2FQPA 4XTPA 3L2YA 4X8PA 2PAEA 3RZZA 2VW0A 1T6GC 5FO7B 5TSWA 2O1QA 1CVNA 1O4TA 5EWSA 5GZEA 4DMIA 1SCSA 1BEV2 4Q4Y1 4XQ4A 3JB8A 4GWNA 3WHTA 2X8KA 1OOPC 1XXNA 5I8YA 3E5XA 4LHLA 1HQNA 5GLVA 4AVCA 4YVSB 1DQ1A 1RUG3 4OHZA 3QBQA 5JIUA 1ZZ7A 3DGTA 1HRI2 5J3UA 1KITA 5BYNA 5FREA 3V0BB 4FPLA 1NQJA 2RR13 1CAWA 4XFAA 4K1YA 2HWF3 4YZ3A 4YGDA 3ZFEC 4A2UA 4XYXA 1W6PA 4UXAA 4I30A 4XFGA 1VRH1 4PBPA 4JAAA 3OBTA 1X36A 3EHKA 2WS91 4YG6A 4ATEA 4CP1A 3WG4A 1R083 3FHIB 4W65A 4NHLA 4M3CA 1S0JA 1DHKB 1DGLA 3H3UA 4K3UA 1Q56A 1W6QA 3TRSB 4AGGA 3M3CA 5F1RA 4WM8B 1OMIA 3N7KA 4ES8A 5BNPA 2JJ6A 4L97A 1VBD1 2ZS6B 3BIWE 1F5JA 2I45A 1AR62 1X8EA 1PVC3 1NCRC 1H9PA 4TWTA 1NCRA 2DCKA 4FCAA 4FOWA 4J1XA 4P9GA 2EXKA 4QPIC 2BNOA 3WVJA 3ZYJB 1RITA 1W39A 3ME2A 4N53A 3KLSA 4QPIA 5KC5A 1J3PA 2GH8A 1SBDA 2D6NA 1GBGA 1FOD2 1Y9QA 4B4RA 4YYOA 3MIHA 2D5HA 1O91A 1RUF3 4QU2A 2DTWA 1C1FA 3WXPA 4B7EA 5J98B 1PZ9A 3O14A 4CRQA 1V6JA 4XQDA 1LOFC 4Y4YA 4P14A 5FMOL 2JEMA 4YRDA 3NV3A 1RUD2 1LOFA 4H55A 3ZSJA 4Z82A 3BPZA 1DZQA 3VL9A 4OI1A 1J1LA 3E5QA 4IV1B 1ENRA 4YNIA 4MYEA 5CFDC 2GN3A 4LBKA 4JC1A 5C4WB 4RR3B 5CFDA 4AWDA 2IXHA 3DV8A 1TMF1 1QOSA 3OJBA 3TWIA 2PN5A 1PO22 3M3IA 3RSJA 3I59B 1QNWA 1UU4A 3WCSA 3VZOA 5T50A 5ACA2 1AR73 1RJ7A 2CAVA 4O9EA 3LSEA 2D6LX 2ZGQA 4Y24A 4CDUB 5DZEA 1CAXB 1S0GA 1O3TA 1XNDA 3PMEA 4WZFA 1H30A 1IPJA 2JG8C 4U2AA 2JECA 2SBAA 4WV8A 2YHJA 2MHFA 3ZSMA 2JG8A 4AQ2A 4MGKE 4CZSA 4GB33 4COZA 1FNZA 1GICA 1W6OB 4LA2A 4COVA 4WM7B 5HCBA 2HYKA 4GULA 4I3PA 1MQTB 2R071 5CFCB 3LA3A 3WDTA 5L7OC 4FXGB 2E51A 4MGIE 2R063 4Y1YA 1MS4A 5L73A 2P3IA 3ZVXA 5L7OA 3VZKA 5C9AC 3ATGA 4RQPB 3VBSC 2WLPA 4AEDC 4QXKA 2AZ5A 2QZ2A 2R0FA 4YVWC 2CGOA 3VBSA 4AEDA 1C5IA 4YVWA 1LR5A 4TZDA 2RJKA 1E57A 2PAMA 3MDPA 3MZHA 2VY0A 4WVWA 4FBFA 3B9CA 1TNRA 2A6ZA 4QX5A 4META 1MZ5A 1VR3A 2ZGSA 3AZVA 2E53A 4N43C 2CGNA 3AJYA 1ZNPA 1V6KA 4FOYA 4NHKA 4N43A 1POV1 4AI8A 1L3JA 4IEZA 2JG9B 4YG0A 1F5FA 2K0GA 1H2NA 1SBFA 3B69A 2HWE3 5CADA 4DQAA 1AR82 5IK4A 5JZGC 5GZFA 5F6KA 5KXEA 4YFWA 3SISA 4G4FA 4Q4V1 2UWBA 5JZGA 1D0GA 1PGW1 2X5IA 2YXSA 1XNCA 4Q0PA 4XILA 4QPGC 2RS32 4FP3A 3B93A 1HW5A 4XIOA 4DZGA 2VU9A 2B42B 4H7MA 4QPGA 1PO13 2OIIA 4JDNA 1BCXA 4XJ8A 3RPQA 5HCAA 5AC91 5K8SA 1ULDA 4YW4A 3WOGA 1OOPB 4WVMA 3D82A 4Q4Y2 3M3EA 4E2GA 4AFCA 4HPKA 2DVAA 1PGL1 4ZU4A 3HR9A 1VBE3 4KBBA 1VAKA 1VBA1 1CR7A 5A33A 1ZM1A 1CAWB 2RS33 3IBMA 1YO8A 4JTOA 2DUPA 3GHMA 3ZSEA 5D8AC 2BWAA 4AEMA 1V9U3 4BYYA 3FZ3A 4AFDA 3ZFEB 3A4UA 5D8AA 2VMGA 4RA0A 3ZYIB 1AR91 2DYCA 4IEVA 2D98A 5HXVA 3R0RA 3TN91 2E7QA 1UZZA 1VRH2 5EFUA 3RMYA 2R1BA 1W0PA 2ZGKA 4K1ZA 1D2QA 4AHYA 4XFIA 1S2BA 2EVXA 2WS92 1S0IA 2WT2A 1W6QB 2EXHA 2YGLA 2RS53 4LULA 1YIFA 3P3PA 1CIWA 5SV8A 2I74A 4QT6A 2I07B 2JE7A 4B8EA 1UKGA 1B09A 5FLIA 2WQZC 4KH9A 2C9AA 3FJSA 2YZ4A 4R52A 3VBFC 4E2SA 1Z7S1 1LOCA 1XYPA 1VLNA 1NCRB 2DVBA 1VBD2 1Q3EA 3VBFA 2NP0A 4FPGA 5DDJ3 2Z79A 4FPCA 1LGCA 2PHXA 3IDCB 2QDNA 3ZXLA 2GMPA 3FUQA 2HWD3 1IZ3A 4ORFA 2JD4A 3VLBB 5K0UC 1B35C 5H9RA 4QGNA 3IWZA 2D6KA 4I0AA 1B35A 3N7JA 2ATFA 1Q8VA 1CX4A 3WR0A 2ZCWA 5E88A 1BVP1 1JHNA 1W2UA 5J36A 4MUVA 4YZ4A 2EALA 1LB2A 3N7LA 1ZBE1 4AVTA 3J26N 5T52A 1SFNA 1YIPA 1VAMA 1WBLA 1ZRFA 4QQPA 5AVPA 4COYA 3NW4A 5JVVA 5EJ3A 3JBG1 5JLVA 1QQP3 3MIGA 1WMEA 1VBB2 3BODA 1WW4A 4JGYB 2GC1A 4KWKA 1RUJ3 3OGGA 3M70A 1MS8A 4R9AA 1RUC1 3DL3A 1POV0 3VBRC 1AYM3 4IESA 4CDWA 3MLLA 1ZRRA 3KB5A 1SLIA 1XNBA 5E1RA 4EN6B 5BNQA 1TMF2 3W9AA 1OQ1A 3I4IA 3R6SA 2P37A 2ZHLA 2X29A 1OLRA 4OI4A 3LGRA 2EAAA 2Z2SB 2ENRA 5FRAA 1WCKA 4XF3A 1C8M3 3ALQA 1UAIA 4K40A 2XKOA 3DN7A 1VBB3 1NCQC 2CYFA 1QMJA 4P9XA 3ZN5A 1VBC1 1EV11 1REFA 1FPN1 2XL9A 1WUVA 1CAVB 1OFNA 1NOVA 5L7OB 1S1AA 5J7MA 2WA3A 2NN8A 3E5UA 2R072 2NLRA 2WIIB 3AYCA 3K51A 4LE3A 4Y22A 3UKTA 2XPJA 1FV2A 4J6GA 3AP9A 5C9AB 5CNAA 2D6OX 2VGDA 4Z8BA 5AFBA 2ZX4A 4ITCA 4LBNA 1RUG1 3THPA 3VBSB 3W58A 4YVWB 1ZRDA 1SCRA 1WLDA 1I9RA 4JVAA 3AMHA 4XHBA 2AUYA 5D1IA 4R8HA 1WD4A 5GJ6A 2ZA9A 2RR11 2HWF1 1R1A3 3M1HA 3MLJA 4N43B 3S7EA 4YZ2A 1ALYA 1DGWX 1HIXA 3USUA 1UMZA 1KDKA 2UY9A 3H0OA 1JBCA 3NV4A 3CF6E 1LTEA 1ENXA 2ZGOA 1LCLA 5I0UA 4RGGA 4CEYA 1GR3A 4QQOA 4DINB 4E4DX 4BCUA 1LGNA 1VAVA 2QJVA 3HD8B 3LA7A 1R081 2W39A 3RJ2X 4FTSA 1N47A 4P9LA 4BM8A 1MS5A 2Q30A 4BPZA 4QPGB 1PGW2 1LOBA 4NR1A 3RI8A 4X6RB 1MR5A 1NXMA 1FMD3 1DYPA 2XLAA 5FLJA 3KS7A 2DCZA 4WVMB 3MYXA 4FPYA 1PVC1 3IT8A 4HPKB 4U36A 4H7LA 4DXZA 4HN0A 5AC92 4B29A 1PZ8A 2Q1ZB 4ASMB 2GC0A 3B3QE 4M3CE 1PGL2 2NMNA 5A33B 4OUMA 3VHOA 5JMCA 4PLMA 2JKBA 3FC0A 2R16A 1VBA2 1D4M3 4R9DA 1CJDA 2LUWA 3SXWA 4DRVA 3OGJA 3OCPA 5LRSA 4J1WA 1RUF1 5FFOC 1G9DA 2E9QA 2VXRA 1XQNA 2DUOA 2GNTA 3X29B 3PVNA 2SLIA 4YW2A 4RS5B 1AR92 4RGAA 3VV1A 2C5DA 4G9SB 3C3VA 3J4UH 3VL8A 1Y3TA 1N3QA 1V6OA 3TN92 3AK0A 2VVEA 3LCPA 1MZ6A 1ND2C 2AH2A 4AI3A 1MACA 4B3NA 4UW3A 2A71A 1VBA3 3SLIA 4JRLA 3MF6A 2H6BA 4SBVA 1QJU3 3FFZA 3TNPB 1JTZX 5GZDA 2XKPA 1AR71 4F83A 3WZ1A 3IMNA 5H9QA 3VBFB 5JSOA 1G9CA 3I7DA 1RHI3 3OY8A 3ZPYA 1LULA 1Z7S2 3AMPA 3UKNA 3INAA 3IKWA 5DG1A 4BOWA 2ZX3A 4LTAA 4GB31 1PMIA 5LK5A 4EN0A 1O5LA 3SHRA 1B35B 3ZMNA 5K0UB 2A3YA 3D8CA 4M3CF 2NPIA 3TB0A 4I09A 2ZOEB 4NVPA 5I0TA 4XDQA 3GHNA 4FPFA 2R061 3ES4A 5KC6A 4KU8A 3T2TA 1QOOA 2XLFA 4B4PA 5A3LA 2VVFA 3HT1A 3KZ4C 1LHOA 3J8F3 5AVAA 1YUDA 3WQ1A 3KQRA 2FBEA 5JCTA 2BUKA 3WX5A 1ZBE2 4AXOA 3AMMA 2DFCA 1DG6A 2C0ZA 3HQXA 3KGLA 3PNAA 1WD3A 4IEYA 2ZTNA 4MGZE 3HWJA 1XE7A 3JBG2 1SEFA 2K9ZA 1LGBA 4Y1VA 1QDCA 4IXLA 4BA6A 3MEPA 4IEXA 3WDYA 2IXLA 3VBRB 4FPEA 1A8MA 3LZZA 1RUC2 4XHXA 5ABJC 5IK7A 2Z42A 5DZFA 3BB6A 4Q4X3 1SQ4A 4LO4B 1SDWA 3LWCA 1REEA 2HWE1 2FZ1A 1UF2C 1FI2A 1MEC3 1LEMA 1RUNA 3DKWA 4MH0E 1RC6A 4PBOA 3AKSA 4OVEA 4EJRA 2Y0OA 5BNNA 1JUHA 1NCQB 1QOTA 1LENA 4XBQA 3ST7A 3IDEA 5FPZA 4LR4A 3A0NA 5FTTC 1N1YA 3VKOA 5JI9A 1OPMA 1VBC2 3O5SA 1PGSA 1EV12 1PO11 1FPN2 4Y22B 4K7JA 4OFGA 2EXIA 4OUSA 5CAZA 1DU3D 2P34A 1C4RA 4MSVA 1COV3 1H4HA 4Y1XA 3VZJA 1AXZA 1OA4A 1BQPA 1LKNA 4YM1A 3VBUA 1YJLA 4PDWC 3AZZA 3WINE 1VBE1 5LEJA 5JOYA 3RMXA 3MW2A 4PDWA 4NO4A 1RUG2 3ELNA 3WUCA 2VMHA 3EO6A 4XJZA 2RS31 4KNCA 3PVOA 2XJPA 3ZXJA 1DBNA 1TQ5A 1V9U1 4IETA 3OYWB 2RR12 1R093 3C2UA 2DCYA 2HWF2 3O7OA 2FHRA 2PHWA 1ENSA 4UW6A 4XJUA 1LODA 1OHFA 3QH6A 2A75A 4CDQB 1SLTA 4XW3A 4C0HA 5F6LB 3T1LA 1QH7A 1X7NA 2E6VA 3BTAA 4MXVA 3B00A 3M3OA 2RS51 4GKYA 4UW4A 3ZN6A 5JSRA 1R082 3FBMA 3GBFA 2ZGPA 4FVVA 4M0NA 1ULEA 1RUH3 1U5ZA 2BQPA 2ZMNA 4GKXA 2VOXA 1JW6A 4AVBA 3THTA 5J96B 1N3OA 1CPMA 4COUA 1M4WA 1WW5A 1OKQA 1YXWA 4L2NA 4S2GA 3SH3A 1Q5OA 4AI2A 4LBQD 1PVC2 4RHV3 5DDJ1 2XG3A 3S6PA 3NSTA 2CL2A 1RTVA 5LK7B 4F8AA 4OHWA 1W6MA 2A5ZA 1ASJ3 2HWD1 4X8NA 1UW8A 2ERFA 3WW3A 2WSVA 1ZA4A 3N35A 2DCTA 3B02A 5EYXA 5BNPC 3TOJA 1F8VA 4O9GA 4OHVA 1QH6A 4BZ4A 1I5ZA 2XVLA 3IPVA 1A6CA 4MVTA 1RUF2 3RWNA 4GQ7A 4B4QA 3ZYPA 1D4VB 1LHUA 2A6VA 2RM23 1DZTA 1RL3A 1O3SA 1JN2P 1IGOA 1QQP1 4XJ9A 2UYAA 2PHUA 4N53C 3ZFFA 1ND2B 1V00A 3AKPA 4AG4A 1RUJ1 2PHTA 3TNQA 1JUIA 1IOAA 5CU1A 5T5PA 1ZYBA 5KXCA 4EWAA 1AYM1 1HQLA 4YW1A 2QQPA 4QQHA 4XBLA 5DUWA 1BXHA 2CV6A 3WNXA 2B5HA 3OY8B 1YFXA 2ZX0A 1AR72 4LBMA 1C8M1 1NA1A 1U5YA 2G9GA 4LO8A 3WW4A 5GZGA 3WDUA 5E16A 3AYAA 1YFYA 2WWSA 3W59A 1VBB1 1NE4A 3GYDA 4QMAA 2LM3A 1PM7A 4PJYA 1W6NA 1SMVA 3WD5A 4B7KA 3JZVA 4GB32 3PMSA 5H9PA 3WHUA 3NKTA 1OQEA 3WG3A 4AVVA 4D7SA 5I91A 4FAGA 2I2SA 3LKJA 3JCIA 1G8WA 1H0BA 1DQ5A 1RUE3 2R062 3L2HA 5FOBB 1QXJA 1GZCA 1WW6A 2P2KA 4S2DA 4OULA 3WP6A 4CP2A 1QJX1 2ZKLA 4K6BA 1N1TA 4M01A 2QKDA 3ACLA 1WCDJ 1KJLA 5JOZA 4MZUA 1HKDA 4PIYA 5DZGA 1SBEA 2F4PA 4HKWA 1R1A1 4E27A 2ARBA 4Q0SA 1FV3A 2RS13 1BBT3 3D0SA 4RFT0 4AW7A 5ABJB 4AEKA 4K8FA 2H6CA 3ZSLA 5A32A 1AXKA 1YLLA 4YM2A 1C1LA 4E2QA 2HWE2 5C33A 3M2MA 2ARXA 2GSYA 1X82A 4GALA 3E6CC 5FO8B 2AR6A 3NJZA 4BQ1A 3CU7A 4IEWA 1RMU2 3LOIA 5EZWA 5JI7A 1FMD1 1NG0A 3UJQA 1IS5A 1IKQA 4K20A 3HBZA 1S0BA 3WLUA 1PO12 1CPNA 1VB2A 1YRZA 3AXEA 5IK5A 4PDWB 2PA7A 2R0HA 2ZZJA 1VBE2 2X5IC 3WY6A 5F5QA 2WINB 1HX6A 1J58A 5CA6A 1D4M1 1QJY3 3LA2A 1RMU3 1V70A 3WDVA 1LEDA 4IERA 2JDZA 2XB6C 3CEWA 3FUOA 4FTEA 4QM9A 4BIOA 3WT3A 1VB4A 5B2GB 1V9U2 3VKMA 3MW4A 1GQGA 4XJWA 2WZPP 3EQEA