4YVSB

Crystal structure of the virus-like particle of a c4 strain ev71
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
237
structure length
224
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein VP1
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
total genus 28
structure length 224
sequence length 237
chains with identical sequence E, H, K, N
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvsB00
4PDWC 5LK7B 1V9U2 4FTEA 1EV13 4GB31 1QJZA 1RUH2 1AR83 1RB8G 1NY72 1COV3 5DDJ3 1MEC3 4GMP3 3ZFEA 1VBE2 1VBB1 1ASJ2 1SMVA 1PO12 1RUG1 1NCQA 1RUE2 1H8TC 1AL0G 4FSJA 1NCQB 3ZFFB 1OOPC 4YVSB 4CEWA 5ACA3 4N43C 2RM21 4GH4A 4YVWA 2RS11 5K0UC 4CEWB 1NCRB 2X5IA 1HRV1 2XBO3 4Q4V2 4RHV1 1W39A 2RS32 2X5IB 1PVC2 3NAPC 3JBG2 1QJU3 1RUJ1 2WZR1 3VBRA 3VBUA 2FZ2A 1VRH3 1AYN3 1QQP3 2WS93 4CDUA 1ZBA2 1RMU1 3CJIC 1VBC1 3VBUB 5JZGC 1C8M2 2GH8A 5D8AC 1Z7S1 1PO21 2R061 1TMF3 1HXS3 2HWB2 1B35A 1RUD3 3J8F1 4IV1A 3VDDA 5C9AC 2BFUL 4Q4W3 5ABJA 1RUC1 4IV1B 5BNPA 4SBVA 4IV3C 1AYM2 1R083 1EV11 1K5MA 5ABJB 1WCDJ 4CEYA 5BNPB 5J96B 1VBA2 1FOD2 1POV0 1RVF1 1COV1 1F8VA 1EAH3 3JD73 5A32A 2RR13 3TN91 3ZFGC 1QJY2 1BBT2 5A32B 4RQPA 5CFDB 1RUI2 1AR62 1RUE1 2ZTNA 4JGZA 3VBHA 1AL22 2MEV3 2BUKA 1RHI2 4RQPB 5L7OC 2XBO1 3IDEA 4JGZB 3VBHB 3ZXAC 1TME2 3VBSC 4AEDA 1VBB3 3JB8A 4CDQA 2HWC1 1RUG3 1D4M1 4AEDB 1PVC1 1QJX2 4CDQB 1AYN1 3JBG1 5C8CC 2WS91 2RM23 4GMP0 1PIV2 1PGL2 2RS13 1R092 1HRV3 2ZZQA 1AR71 1ND3A 2HWF3 4RHV3 1VAKA 1FPN2 4QPGA 3DPRA 1R081 1R1A1 3LOBA 1VB4A 3ZFEC 1CJDA 2VQ0A 2RMU2 4QPGB 1NCQC 3DPRB 1AR92 4YVSC 1PO23 5AC93 1RUF1 2R063 3JD71 4CEWC 4WM7A 2FZ1A 3J8F3 2RS52 2PLV3 4WM7B 1A6CA 1QJY1 2X5IC 1C8NA 1RUC3 2MEV1 4Q4Y2 2BBVA 1RVF3 2WFF2 4Q4X2 3VBRC 3VBUC 4FTSA 1RUH3 4CDUC 1AUYA 3TN93 3ZFEB 1ASJ3 1PGW2 1PO13 4Y5Z0 1RUE3 2R042 2R072 1B35C 4GH4B 1AR82 1NOVA 1PIV1 4YVWB 1ZBE1 5DDJ2 1MEC2 2HWF1 4IV1C 2HWE2 5ABJC 2HWC3 1VBD2 4CDWA 5BNPC 1D4M3 2RS33 5ACA2 1PVC3 5FMOL 1MQTA 1FPN1 1K5MC 2BFUS 2HWD2 3JBG3 4N53A 4CDWB 3VBRB 1HRI2 4CDUB 1ZBA3 5AC91 5CFDC 1HX6A 3VBFA 1AR73 4RQPC 1FMD1 1X36A 1VRH2 4JGZC 3VBHC 1B35B 2PLV1 1QQP2 5FOJB 4CDXA 3VDDB 1R1A3 4AEDC 4CDQC 1AYM3 4CDXB 1HXS2 1V9U1 1K5MB 1RUD2 1RUF3 4CEYB 1RUH1 1VBA3 1FOD3 1NY71 2WFF1 1VBE1 1ASJ1 2TBVA 1PO11 4Z92B 1QJY3 5J98B 1NA1A 4QPIA 1BEV2 4WM8A 2R041 1EAH2 4RS5A 1DDLA 1BMV2 1NA1B 4QPIB 4WM8B 4Q4V1 1X33A 1TME3 1VB2A 2RS31 4QPGC 3DPRC 4JGYA 1QJX3 2HWD1 4JGYB 1ZBA1 4GB32 1C8M1 4WM7C 1PIV3 1ZBE3 1VBB2 1RUG2 1R093 2XPJA 1ND3B 2HWB1 2RM22 1FPN3 2RS12 2ZAHA 4RR3A 1HRV2 1AYM1 4RR3B 1VBA1 1FOD1 2RMU3 1F2NA 1M06G 1CD3G 1RUJ2 2WZR2 4GH4C 1FMD3 4YVWC 5BNOA 3M8LA 1RMU2 5BNNA 1BBT1 1VBC2 5BNOB 2RS53 1RUI1 3VBOA 1AR61 1Z7S2 5BNNB 1AL21 1RHI1 1NG0A 4CDWC 1V9U3 1MQTC 2DF7A 3J8F2 5C4WA 1TME1 2WFF3 4N53C 4Q4X3 1VBE3 5FMOS 5C4WB 1QJX1 1E57A 1EV12 3VBFC 5CFCA 1RVF2 1PGL1 1COV2 2R043 2R073 2QQPA 1ND2A 4BCUA 5CFCB 4FTBA 1R091 3VDDC 4Q4V3 3TN92 1ND2B 2IZWA 2HWE3 2Y26A 3ZFFA 4YVSA 4CDXC 1IHMA 1VBD3 4CEYC 1MQTB 1NCRA 2HWD3 2XBO2 4N53B 1HRI3 1C8M3 3S6PA 2RMU1 1AR91 2HWC2 1QJU2 4PDWA 4NWVA 1D4M2 2BPA2 3VBFB 2HWB3 1AYN2 1POV1 2WS92 4PDWB 1NA1C 4QPIC 4EJRA 4WM8C 2RS51 4RS5C 1OHFA 1H8TA 1TMF2 1OOPA 1AR72 4N43A 4Q4Y1 1H8TB 4JGYC 5K0UA 1OOPB 4Q4X1 4N43B 2WWSA 5K0UB 4Q4W2 3NAPA 1PGW1 1R082 1R1A2 1BBT3 1ND3C 1RUI3 1AR63 3HAGA 3NAPB 2R071 1AL23 1RUF2 1RHI3 3JD72 1AR81 2RR12 1BEV3 3CJIA 3JB4C 5DDJ1 5JZGA 1MEC1 4GMP1 4RS5B 5D8AA 2HWE1 3CJIB 5CFDA 5JZGB 1VBD1 4RR3C 5D8AB 5ACA1 2MEV2 1GFF2 1HRI1 5C9AA 4IV3A 4GB33 5BNOC 5C9AB 5BNNC 4IV3B 1QJU1 3VBOC 4Y4YA 1VRH1 1QQP1 3ZFGA 1ZBE2 5C4WC 2HWF2 4RHV2 3ZFGB 5A33A 5GKAC 1TMF1 1HXS1 1AR93 5L7OA 5A33B 1RUD1 4LLFA 1POV3 5L7OB 5CFCC 1RUJ3 3VBSA 2WZR3 3FBMA 2GSYA 4Q4W1 1ND2C 3VBSB 1RMU3 1PO22 1VBC3 4RFT0 5AC92 5C8CA 2R062 3VBOB 1BEV1 1HQNA 1Z7S3 4Q4Y3 3ZFFC 1EAH1 5C8CB 1BMV1 1FMD2 2RR11 2PLV2 1NCRC 2WLPA 1RUC2 4NWWA 1OPOA
chains in the Genus database with same CATH superfamily
2J42A 1UYPA 1WW6A 1GOFA 2DCJA 1V9U2 3PNAA 2ZBJA 4NE9A 4EN0A 5FKCA 1UOFA 2R16A 1RUH2 1NY72 1OPMA 2YC4A 5DDJ3 1MEC3 1D0GA 3LSDA 4EN9B 3VZKA 3T2TA 5SV5A 4Q0UA 5FV3A 1J58A 4CTEA 3HMYA 4MGSA 1PZ7A 4LK7A 3H1YA 3UV9A 2VUJA 3ON7A 3RS6A 1WD4A 1AL0G 4H2AA 1UCXA 3MF6A 1WGPA 4YVSB 3N35A 1YQCA 4AGGA 4CEWA 5ACA3 1G86A 4GWNA 3WR0A 4YVWA 5A1LA 2XH6A 4Y5TA 1SLAA 4CEWB 4QM9A 3VL8A 1HRV1 2TNFA 4AFBA 4IEPA 1FT9A 1UZWA 1W39A 2EIEA 3H8UA 1XYNA 3MDPA 5I0UA 5A7QA 1W6PA 2JDAA 2ZHKA 4YFZA 1G9DA 1SFPA 2WZR1 1RUNA 3FL7A 3ILRA 4LULA 1W6PB 2WS93 3WVJA 2WC2A 2Q1MA 4HXCA 4CDUA 5IFTA 4LJHA 5JZGC 3JQWA 4A7YA 1LOEA 4QGMA 2VH9A 3CL1A 3W20A 4PI2A 3AZYA 3IWZA 5C6CA 1AF9A 1PO21 1N3QA 1UIKA 2XR4A 4JHTA 3UK9A 1SBDA 1UIJA 2O14A 3FUOA 4YM0A 5IK7A 1S55A 1B35A 2ARAA 2NN8A 5DUVA 1RUD3 1ZRCA 4K7JA 1OC1A 1SQ4A 1YNAA 4BMEA 3LIGA 3OF1A 4XFAA 3VKMA 2E32A 2W87A 1W8WA 3SKVA 4D6SA 3ASIA 3RYRA 2R7EB 2PTMA 4YFWA 3IZOA 1XPWA 3PU3A 4Q4W3 1RUC1 3WDXA 2PAKA 3PVNA 4IV3C 3SEPA 3WNXA 1AYM2 2GMMA 1K5MA 4AVTA 1DP0A 1PK6A 2PHTA 1S0FA 4MGKE 1RVF1 1COV1 4FT8A 1HN1A 2F17A 4K8RB 1WUVA 5I93A 4JQRA 1OUXA 1GOGA 1JODA 2VOXA 4XFIA 2UU8A 5FYIA 3ZYPA 3AX4A 3NNMA 3POJA 1SG3A 3R0RA 1CVNA 5EP9A 4DEQA 5CFDB 3JZVA 5AVAA 5FWJA 5FY9A 3Q9OA 4NUBA 4FBFA 5FPBA 3NMBA 3B93A 1YJLA 2ZHMA 4PIXA 3LEKA 1SPPA 4TYSA 2JDNA 2P6HA 1Z0HA 3KD4A 3N9MA 3SMHA 4MGIE 4U36A 1JYTA 2ZGNA 3EMRA 3JB8A 4DY5A 1DYOA 1SPPB 1O8PA 1ULPA 4L2NA 3RPQA 4ARYA 5A1FA 4QQHA 3SC7X 4LKEA 4AHWA 3H8RA 1C4RA 1I9RA 2V5YA 3AP7A 4A4AA 2Y6GA 2ZX4A 1PGL2 2PQSA 2D6NA 4DUVA 1UO9A 2CDOA 5DAXA 3A23A 1ND3A 4CXXA 4RHV3 2VZ3A 1IG0A 3SCGA 5IHRA 2NMOA 3D3AA 3MIDA 2A6YA 2PMWB 2A6XA 2DBIA 1VMFA 1IS6A 5IYYA 1SFNA 2DCTA 1OD3A 3ORJA 4OMCA 2X8KA 4PHZA 4W50A 2FQPA 1DZQA 1H1AA 1EPZA 1WA4A 2ZEWA 3NSTA 2KD7A 4LIUA 4DMIA 3E5XA 5LCWL 1VB4A 1GWLA 1S0BA 4YVSC 2ZA9A 2ZHLA 5F6LB 4A3XA 4CCKA 1OKOA 5FLJA 2GAUA 3JD71 5CKQA 4LOSA 5IVEA 5JOYA 1SCRA 4CEWC 2W9XA 2Z42A 2WWJA 3ZXLA 5IFPA 1DLCA 2WRAA 1UN1A 2RS52 1A34A 2PLV3 1C1FA 3FWEA 1QJY1 1I5PA 2WL1A 3SLIA 1YQ8A 3K48A 3T2PA 4K20A 2VM9A 5BUVA 1FV2A 1X7NA 4AVAA 1IPJA 1HJGA 3FC0A 3KCCA 4B4PA 4JHZA 4R9BA 4DXTA 4Q4X2 3VKOA 3ZO0B 4KBZA 4EN7B 5D21A 3P1IA 5GALA 1LGNA 3D82A 1RUH3 2A75A 1GICA 1NT0A 4CDUC 3MHZA 3ZFEB 3F2ZA 3FLTA 4XILA 1EYBA 3WT3A 1UOJA 5A3PA 4IEXA 1HB1A 2Q8EA 3HWJA 4I0WB 1YYNA 2FD8A 2IXLA 2QNKA 2OZ6A 5JI7A 2R042 3SHRA 2YXSA 5BNQA 4Y3OA 3RMXA 2RDSA 4XHXA 4MLOA 4TN7A 1B35C 1AR82 1NOVA 2VD7A 3MV01 1ZBE1 4IE4A 1ZA4A 4QQLA 3ZIWA 1YHFA 2HWF1 4BIOA 4BMBA 2XQRA 1NLQA 4AK3A 2B4KA 2XL9A 3ETQA 5FLIA 1AXKA 2WSUA 1JS9A 4AI2A 2HWC3 3IAQA 2NZ9A 2VTFA 5A3NA 2GN7A 3AZVA 5FMOL 1MQTA 5CKNA 2MPFA 1K5MC 2QFEA 2IXHA 3OSDA 3OEBA 4N53A 3V64A 2WFPA 3VBRB 4MG2A 2VC9A 3B5LB 3U10A 1UYYA 3WNMA 2YUEA 1VAMA 4COWA 5CFDC 3WW3A 2G9GA 3PTYA 1WCSA 4Y33A 1XE8A 2CY6A 4XYXA 5GLWA 5DUUA 4QX2A 4ZONA 4M00A 1YLLA 2XJVA 4TWTA 5E8AA 2YMZA 2VG9A 2ADEA 3WNLA 2OS2A 4CDXA 1DQ2A 4GJYA 4BDVB 3WQ1A 4EQVA 3BALA 1LGBA 1PX3A 4QHOA 1FATA 1AYM3 4CDXB 1DGWX 4WVVA 1LEDA 2W39A 5JSOA 1AXYA 3DEMA 1NZIA 3MFCA 2BGCA 5K9YA 4CEYB 1NQJA 4Q27A 4JKMA 5DUXA 2WFF1 4NHYA 4GD4A 2Q1ZB 4Y1YA 4MUVA 4FXGB 5IATA 4QKNA 2D6KA 5KXDA 2DV9A 4Z92B 3PVBB 4Q0VA 1F15A 1H2NA 2WNEA 4P9WA 3ZR6A 3ALQA 3KQ4B 2J1EA 4FCAA 3E6CC 1H9PA 4E8CA 3VDAA 2XLFA 3OTFA 3KV5A 2BZDA 3OY8B 2UYAA 3KMHA 3O5SA 5A80A 4Q4V1 4A6SA 2UY9A 1X33A 4NRMA 1JZ8A 3HBZA 3H42B 5DAPA 2ZEZA 4P9LA 1AX1A 5KWRA 2R49A 3LF7A 1TZOA 5J3UA 4W8JA 1IQAA 5EIYB 4UF0A 5FY0A 2PN5A 4YSFA 1BCXA 4CP1A 2ZX0A 3WCRA 1C8M1 2FCTA 4HKLA 1JI6A 3AB0A 3B94A 2XGXA 3PHMA 4IESA 5L73A 5G04L 3S30A 4BISA 1LTEA 1RUG2 3WHTA 3D4KA 1XU2A 4XXAA 1ZZ9A 2YDEA 3IIIA 4L0PA 4XZUG 2BQPA 1SZBA 3BIEA 3USSA 2VW2A 1G9BA 3C2UA 4XCAA 3K2OA 1HV1A 2RS12 4XQ4A 2IWGB 2JE9A 1K3IA 2JKBA 2VU9A 2ZAHA 3FLPA 2O0OA 3AFKA 2GC0A 2WO1A 3RDIA 3UT0A 4ET7A 2JX9A 2VNOA 2D6OX 4CU6A 2W47A 2B9UA 2VNVA 4KI5M 1FOD1 2R1BA 3E97A 4L99A 1CD3G 3KGZA 4FO9A 4LT5A 5KHIA 1FMD3 1M4WA 1UXXX 1EUUA 2X05A 1ZZ7A 1JH5A 5BNOA 4Q1PA 2GMEA 1JW6A 2NPIA 4IDZA 3M8LA 5D1IA 4AVCA 4EN6B 5LWBA 5BNOB 2RS53 2RJKA 2A6WA 2VQAA 2Q0AA 1W8FA 4AQ6A 4YG0A 2VOVA 1GR3A 1BK0A 1C28A 1RHI1 2CYFA 4PIYA 5F5QA 1NG0A 2BYVE 4LBMA 4D69A 2F4PA 4XIOA 2RE9A 1MQTC 1HB2A 2B7YA 3J8F2 3OGGA 3QACA 4QHZA 4XQWA 4N53C 3GM8A 3KHBA 4Q4X3 2OPWA 5FMOS 5GLUA 2G9ZA 3ZXDA 3LWCA 1QJX1 2E26A 1WZXA 1E57A 3ZYJB 1US2A 4QXHA 5C3PA 2I07B 2V4VA 3DKWA 4FXKB 2C24A 1AVBA 3GJAA 2R043 3IM0A 2GALA 1DZTA 1R091 1VP6A 4XBLA 4PLNA 5FO7B 1OQDA 3IB3A 2X53S 1MS5A 3WDYA 2IZWA 3VB9A 4JDOA 3RZLA 2Q4SA 2Y26A 4OI2A 4QX5A 3VZJA 4CDXC 2D6MA 4CEYC 4LBQA 4A42A 3FUQA 4JCKA 3A4UA 1CIYA 2OQ7A 1OH4A 5IVBA 3E5UA 5C5UA 3C7OA 4LBQB 1NLRA 2GP3A 5CU1A 4UFLA 1OURA 4IUGA 2R0FA 3MBWA 1MZEA 2WSVA 2ZMNA 4OHVA 1AR91 2WN2A 3GZEA 1EPWA 3U4SA 1D4M2 1F4HA 1YWKA 1UU5A 4NMIA 4NIAA 3J4UH 3VBFB 3ZSLA 5JOXA 4L97A 1AYN2 2JECA 3B7MA 3OYWA 3OGRA 4K6BA 3TWIA 3CF6E 4Y1XA 5F37A 3NJVA 1GQHA 1RYYA 2W68A 2AR6A 4LEJA 3OYWB 5FYYA 2DVBA 1XQNA 3DCQA 3BTZA 1SLIA 4LXLA 4FP2A 2Y6LA 1OBNA 2JDKA 3PL0A 1AR72 4MGQA 4YW1A 4YARA 5ANQA 5HCAA 4ATFA 5K0UA 5FP7A 3WQBA 3NV1A 5K0UB 2C9KA 3C7GA 3G7DA 1JOJA 3WNKA 4CUCA 2VZOA 2W1SA 1PGW1 1R1A2 2BEOA 3A22A 1BBT3 5FP8A 3C8XA 1QNWA 1AR63 5JIAA 2WA4A 4ES9A 2R071 3C7EA 3AMPA 5JI9A 1RUF2 1H0BA 3LZZA 3ZN6A 1VMJA 3CJIA 3JB4C 1Q3EA 5DDJ1 1MEC1 3A0KA 5H9SA 5EJ1B 3ZN6B 5HI0A 3J7LA 2A70A 4LKSA 1ZZ8A 2JE7A 2A6VA 3CJIB 2QQJA 4FPYA 2QKDA 1LOGA 4E27A 3IDCB 5CB7A 5ACA1 4W4ZA 3ECQA 3MIFA 1LHNA 5LA1A 5GM0A 4ZS2A 1HB3A 3Q8CA 5FAXA 2I45A 1FXZA 3JUUA 2PA7A 4OI4A 5CBLA 3W5MA 5F3CA 2RDRA 5C9AA 3ZYIB 1O4YA 3ZXKA 1ZA7A 2YYOA 2YBKA 2ZGKA 4I01A 5BNOC 5C9AB 3T08A 3FFQA 3LDBA 1REEA 5JWPA 2XJTA 1YFYA 3UGGA 4UBGA 3NKTA 1MS3A 3C7HA 1HDKA 3KS7A 3AM2A 3D0JA 1LOFA 4D3WA 1JOPA 1NQDA 4XUOA 3WDVA 1BLZA 3N3HA 1N1TA 4JTNA 2P3YA 3U11A 1Q8PA 1W9YA 3NV4A 5A33A 4ASLA 1QNYA 3MPPG 1S2BA 1URXA 3CO2A 4AEKA 2LUWA 1D2QA 4QPYA 5EV7A 5A33B 1R1ZA 1RUD1 3L9JT 1RJ8A 4N9HA 4WZFA 3GCWA 1VPHA 3NNJA 3MYXA 3PUAA 5FJKA 5KHKA 1CZVA 1DU3D 2QQVA 1S2EA 1MZFA 4UT5A 4D6RA 4A3ZA 3BTYA 4DO0A 3UESA 4CA9A 4Q4W1 4CXYA 2FDIA 4IGOA 4PI0A 4CUAA 3VKFC 5FZMA 4EROA 1NX9A 4AF9A 5C8WA 4M4PA 4RFT0 5AC92 4PBPA 3KHCA 4NHKA 3VBOB 5IVVA 4KL1A 4CCLA 1YJKA 3SH3A 1BMV1 5BYNA 1ACCA 1O8SA 5CIRA 1O4TA 1XNCA 5FBJA 2X09A 4UW3A 2WLPA 4NIDA 4NWWA 4YW3A 2VOKA 2XWBB 1OPOA 1JUHA 3CDZB 3ES4A 5JLVA 2AGSA 3T2QA 5FPXA 2IC1A 3EXUA 4UFIA 1X9PA 4DPNA 1EP0A 1CAVB 4FTEA 4LO4B 4GB31 2WKKA 4NPMA 3EJKA 1V6OA 5JMCA 1W0PA 1RB8G 2JDUA 4QXKA 3SKJE 3CLPA 3D0SA 4GALA 1VBE2 4GMP3 2NP0A 4MVTA 1SMVA 1PO12 5H9PA 1NCQA 4DOUA 1STMA 4TXWA 3ES1A 1RUE2 3DF0A 2LTNA 4XUPA 4LO7A 1NCQB 1WW4A 5IAVA 2DVAA 3FLRA 3ZFFB 3WOGA 4CP9A 2BTVC 3POBA 1T2XA 2VUCA 2JXAA 5FK8A 5K0UC 2WABA 1PM4A 5KHHA 4WVWA 5FUPA 1NCRB 1LAJA 3ZKYA 5EHDA 2VW1A 2XONA 4RHV1 4EZHA 4GKXA 3RI9A 1VE0A 4AHXA 2RS32 1PVC2 4YPJA 1QDOA 5APAA 4CCDA 5M0TA 3HOBA 1UZ0A 1XNDA 2D40A 3E6DA 4HBNA 3VBUA 2FZ2A 4JV4A 1DG6A 1VRH3 3WLUA 1AYN3 1WWYA 3K3NA 5L9VA 2LALA 4K21A 4LQRA 3CJIC 3HNBM 3VBUB 2GH8A 3X29B 2D3PA 5FYBA 4PT6A 4K3UA 3GDBA 3NJZA 4ZZ8A 4JDMA 3TEZA 4P9GA 1HXS3 2HWB2 4YM1A 5ANNA 3ZSEA 3LD8A 3Q8EA 5JIUA 4LUKA 3IMNA 3ZX7A 1H30A 1E5RA 2QQLA 4HKOA 5CAZA 1DQ5A 5KHJA 1HB4A 1MVQA 4KGQA 3MW3A 3VDDA 5C9AC 4EYUA 1DIWA 1FAYA 2BFUL 2WZ8A 3PJQA 5LA0A 2YV8A 2W92A 3RVHA 5CADA 4XFCA 1EV11 1UZZA 3N9QA 2DTYA 4QXBA 1VBA2 1F8VA 1S0IA 4LOTA 1EUTA 1EAH3 4ITCA 1OXCA 3VGIA 5A32A 3BPSA 2D3RA 1LOFC 1ZZBA 3DXTA 1S4CA 2PHLA 5A32B 1UWWA 2XJSA 4RQPA 1RUI2 3L2HA 2WAOA 4P9XA 3I49A 3LGRA 4URAA 2XVGA 5LA9A 4JGZA 2WNVA 4F3JA 1AL22 3UL2A 4RQPB 3BI3A 1RGSA 4AWDA 5FQ0A 1ZZ6A 2XBO1 4OZXA 2ZGLA 4JGZB 2WNVB 5LY1A 4LHKA 5F39A 2C1FA 3WF1A 3OBZA 3HN3A 4FOQA 1WKYA 1PNGA 5FQ0B 4AEDA 1HQLA 1VBB3 4CDQA 1DHKB 2HWC1 3WDWA 4FQZA 1H4GA 4K1ZA 2HJIA 3AJYA 3HPNA 4RYDA 4AEDB 1PGSA 5L36A 2PHXA 2XG3A 1W3XA 4CDQB 3AKRA 3INAA 3H0OA 5IUQA 1H4HA 2HBTA 4P9JA 3O1MA 2GNTA 2PYTA 4GXLA 5FIXA 3W9AA 2RM23 4O9GA 3TNPB 4OULA 3POWA 1PIV2 2Q1FA 1IGOA 1TNRA 1GV9A 2QQIA 3AMHA 4FFIA 5FPZA 4CCMA 5FPUA 1QY4A 1S0DA 4CU8A 4I30A 2P34A 3H1WA 4AI3A 1VAKA 2DFCA 3M1HA 1FPN2 5FTTC 5GZEA 5HPOA 1KEXA 5T55A 4AVBA 4DZGA 3PIGA 1R081 4MHUA 1PMIA 1QDCA 1VAVA 1W90A 5JSRA 5T5PA 3HT1A 1FNZA 4S2FA 3VKLA 2JD9A 5F5AA 1NCQC 3LE0A 4FPOB 3I2IA 1GU3A 5AC93 1N47A 2EXHA 3O1TA 4YZ3A 3AZWA 3GBWA 1YUDA 2WT0A 4GAZA 1E5HA 4XABA 1IS5A 3RZGA 2EXKA 2FZ1A 2ZX2A 3N9PA 2YHJA 3BU7A 2UWBA 4Y1ZA 1LHOA 3S5QA 2C26A 3ACLA 2IFRA 3R4DB 1C8NA 1O5LA 1N1YA 1OH3A 2MEV1 2WO3A 5LZ6A 3MGUA 3OEAA 1LNSA 4LR4A 4YYOA 3AC0A 4Q4Y2 4Q8KA 1FNYA 2CGNA 2CL2A 3B3QE 4CSWA 2RJLA 1UW8A 1RL3A 3FFZA 1NYWA 3VBUC 1UU6A 2D6LX 3HN1A 2VO5A 4NVPA 4A6OA 1AUYA 5A70A 4Y26A 3TN93 2PHWA 4EWEA 1PO13 4BLJA 3KB5A 5FMCA 5DQ0A 1H2LA 1Q8VA 2VZUA 2AEZA 1K42A 1NUKA 1RUE3 2BJSA 3U75A 3LFIA 5KR7A 2ZGTA 2VY0A 3LOIA 4YVWB 2OVUA 3B9IA 1CX1A 3MLKA 1ZRFA 2BNMA 4YG6A 2HBUA 5EJ3A 4XAEA 4EV0A 3H8OA 1QOOA 3I2HA 5GLVA 2GMPA 2VCAA 1LULA 3JU9A 4Z8BA 2DYCA 1W6NA 3ELNA 3OJBA 4XBQA 5FZLA 3RZKA 2RS33 1PVC3 3N9NA 1ODMA 2JIGA 2XJRA 3ZMNA 2BFUS 1W6NB 1JZ5A 1Y9MA 3V0BA 4LKFA 1IPSA 2W1UA 2DU1A 1HRI2 4N8MA 1MPXA 3O1OA 2QBXA 2ZJCA 3M70A 4C1XA 3WSOA 1DYPA 2OUHA 5B4XA 4CDUB 3VL9A 3BOWA 4H7LA 2GN3A 4CCNA 3I3MA 1OLME 4YGDA 3ACIA 1EY2A 3KV4A 4HKWA 5H9RA 2ARCA 4XDOA 3TAYA 4RQPC 5HXVA 5CZKA 2VQUA 3MIGA 2ZKNA 1FMD1 1DQ1A 4XTPA 4JGZC 2WNVC 1B35B 4XBNA 1QQP2 1W8NA 3APBA 2D6PA 4QAWA 5T5LA 3BVCA 5DUWA 4XJZA 3T0AA 5LRSA 3FHAA 2VBDA 3TYJA 4AEDC 3W5NA 3EB7A 4CDQC 4FAHA 1CGPA 5JMOA 1MR5A 2XLAA 4OHWA 1NE4A 3VUOA 4J6GA 1K5MB 1OT5A 2VJXA 5F3GA 4LNVA 1PK6B 1XE7A 1VBA3 1ENXA 4OQ8A 4MSVA 1NXD1 2BVVA 5FCCA 5BV6A 1ASJ1 1UPSA 2W3JA 4NPRA 2E7QA 5CG8A 4XETA 2VZSA 1J83A 4UYBA 1XNAA 5J98B 4BQ4A 4XZPA 3VZMA 3N4MA 2FDFA 4MZUA 5H9QA 2YPDA 1BEV2 2EALA 4Q8LA 2R041 1PNFA 2XUMA 4ZS3A 4RS5A 4P9YA 1DDLA 1IZ3A 4TSVA 4Z82A 2QE3A 2AENA 2X29A 3VD4A 1XRUA 3VV1A 1RJ7A 1VB2A 1JMUB 4QD2A 5FZBA 3H3ZA 2Z4FA 3WW1A 1KITA 5TSWA 1U12A 1V6IA 2W08A 1GBGA 5CEHA 3BKZA 4HMZA 1ZNPA 1ZBA1 1W9WA 1UOBA 4OMDA 1S0JA 1YQ6A 3FMGA 3U4XA 2WA3A 4JAAA 2CAUA 1PIV3 1RC6A 1U0AA 3I2FA 5FP9A 3OUHA 2OXBA 3WHUA 3POSA 2ZGMA 1OFSA 4LITA 3ZLIA 1YEWA 1DGWA 3POGA 3RZHA 1ND3B 3WNNA 1DCSA 2GDFA 1E5SA 4YW7A 1OSGA 2XHNA 4A7ZA 1XOYA 1FPN3 3D8CA 3CU7A 5BPXA 1HRV2 1CN1A 5FY4A 3GBFA 2PHDA 3GYDA 2VVDA 5F32A 2VPVA 2ZGOA 3DYMA 1JYIA 3AMNA 4DRRA 3H7YA 1M06G 3WF2A 3K4AA 3I3DA 2WZR2 1UQXA 4BK4A 3IPVA 4XURA 4YVWC 5FWEA 4IERA 2SLIA 1ZVFA 1ZYBA 4LE3A 4BQYA 3MZHA 3BOPA 3HR9A 1BBT1 1VMHA 2P5BA 3IMMA 3PUIA 1N3OA 1AR61 3AP4A 5JAXA 2VXRA 1D2SA 4I0BA 4R4XA 3EYPA 4XHBA 4HZFA 4M4RA 4QT6A 3VLBB 1V9U3 5FY5A 1W8ZA 3SEEA 2DF7A 5FYHA 4Y5SA 4LHLA 1TME1 2OZJA 2GP5A 4QB2A 1O6UA 2VBBA 5I8TA 1F5JA 3M3QA 4P00B 3K51A 1MS1A 1GMMA 1WLDA 5B4NA 1XB9A 2K46A 1QMJA 4A2UA 1H8VA 3SCHA 3W59A 5F2WA 3IDAA 3S57A 1SFYA 3PJYA 2C4XA 4AE2A 1UZVA 1RVF2 2LROA 4CXWA 1COV2 2YZ4A 1ND2A 3WNOA 2DVGA 3T2OA 3H8XA 1TVGA 2VOWA 1UNBA 1HN0A 1GWMA 4FFFA 2W52A 1UMHA 5GJ6A 3NKGA 1ND2B 1LU2A 4ZY9A 1AX0A 5JDBA 4ISRA 4J25A 4I2OA 2BBAA 4C0BA 1PK6C 5CA6A 3NNFA 2E31A 2QQUA 4HG6B 4Q0SA 1MQTB 2ZOEB 2YPJA 4QQOA 2WZPP 3WUCA 3ACFA 4LLOA 4N53B 3VHRA 2Y0IA 1HRI3 2IVJA 4YNIA 2Y6KA 4MO3M 2WT1A 5LRRA 2E53A 2ZGUA 4XXPA 3S6PA 1VIWB 2RMU1 1LENA 3AVRA 2OYZA 3RYKA 3A7QA 2FBEA 4PF5A 2QZ3A 2K0GA 5L9RA 5FYUA 2BWCA 1JHNA 3PVEA 1UX6A 4XIKA 1N1SA 5KXEA 1TQ5A 3B02A 4RS5C 3WY6A 1GKBA 2PHFA 1AZDA 1OHFA 1PZ9A 4A7KA 4E8DA 2YY1A 4CCJA 4A41A 1OOPA 2VXJA 5IK5A 2J22A 4AR2A 3H3UA 2UURA 1OOPB 2JDYA 4V2WA 2IUWA 1DGRN 3I8TA 2WWSA 1L7QA 4AGVA 5DN2A 2KR2A 2C6SA 3NAPA 4E2SA 5F5IA 3QCWA 2E33A 2GH2A 2V09A 2B42B 1ND3C 4META 5BXXA 4Q5OA 3JXSA 3HAGA 2XWJB 3MEPA 3NAPB 3BYWA 2BGPA 1LOCA 1UOGA 4LHSA 3AYEA 3JD72 4CUGA 4BA6A 2RR12 1VRBA 1BEV3 2OT7A 1QKQA 4GMP1 3ZVXA 5D8AA 3UJOA 2HWE1 3ZXEA 1LECA 3CQOA 1H1IA 2XOMA 3OGSA 1VBD1 4WVMA 5D8AB 4LBLA 4B7KA 2HEWF 4D7TA 4F83A 4Z07A 1U5YA 2YG0A 3LKJA 2VECA 1GP6A 5CKMA 4DXZA 5IVFA 3WZ1A 1OI6A 3K4DA 3J9SA 4DUWA 2VCBA 4UF0B 3RRDA 4ASKA 1A78A 2ID4A 3K77A 3MIHA 2EA7A 2OQ6A 2VNGA 5FZ8A 4Z1VA 1Q8QA 1YRZA 4FPFA 5A7NA 3GJBA 5DAWA 4B4QA 1KFUL 3UYJA 4HVRA 4AI8A 4QQPA 1GZWA 1VRH1 3N7KA 4COZA 1UX7A 3MF9A 5FZAA 4YM3A 4X8PA 3ZFGA 3M3CA 1LCLA 3QH7A 1GZWB 2GC1A 3GZUC 2P3IA 1ZBE2 1HV0A 3RG0A 4DB5A 2HWF2 3WF0A 3ZFGB 1DF0A 2YFZA 1X9TA 3WP6A 5FJHA 5CVRA 4OQ9A 3WP4A 2XB6C 1HXS1 3AKQA 1O7FA 5FPLA 2AEYA 3LEMA 1OLQA 4Y1VA 4ZU4A 1XE0A 3K4ZA 1POV3 3VBSA 5CG9A 2WZR3 1QJFA 2VUDA 4GQ7A 5JCTA 2XKOA 1LRHA 4CE8A 1ND2C 1J84A 4GA9A 3VBSB 4O65A 3ZN4A 1DFQA 5FZEA 2Y60A 4FPCA 2JENA 2R062 2KM2A 2DU0A 2NLRA 1UZYA 3AMMA 2PELA 3H50A 1HQNA 2OX0A 1JUIA 2G1MA 1EAH1 5ERLA 3AP6A 1YFXA 3O1VA 4E2GA 2CU5A 5A3LA 3PMSA 3POEA 1CZTA 1REFA 3RMYA 1RXFA 2P3JA 4QX3A 5I0TA 2UY8A 1JU4A 4CUBA 4IE0A 3TOJA 1ZRRA 1TEIA 2Y34A 5JOZA 1JOBA 2Q30A 1IOAA 3GNEA 5LK7B 3PUQA 4FPHA 2P17A 3OUJA 1RINA 1AR83 4XDQA 1COV3 4Q0PA 4ZHNA 1MS9A 2WBKA 3B01A 1VBB1 1UMIA 1IS3A 5LASA 1JBCA 2XVLA 3J26N 3AMQA 4B3NA 4LPLA 5DXDA 1RUOA 5F7UA 4OYUA 2BRTA 4OI0A 3UKNA 4FSJA 1OOPC 4XFHA 2BP6A 2RM21 3FN9A 3PTRB 1QIQA 2VZRA 4GH4A 4E4HA 2O8OA 1YQ2A 3KV6A 5LEJA 1GZTA 4HONA 3QBQA 4XPVA 2GNBA 4I3GA 1V6KA 4BE3A 2VZ1A 4KG0A 4LA3A 4Q4V2 1O3SA 2WLQA 5EZWA 4AFCA 1RIRA 2QQKA 1U5IA 3MUZ1 4MGYE 3V0AA 2P1BA 3AJZA 3NAPC 3ZKUA 3JBG2 2XMLA 1RUJ1 3OGVA 3V0AB 3E1F1 1V6JA 2VL4A 1SEFA 1ZM1A 2R30A 1OQ1A 1LHWA 2J1SA 2XLGA 2BV4A 3J7NA 4K1YA 5FOBB 1JN2P 4IW3A 3N9OA 1Q56A 4IEOA 1RMU1 4OZOA 1UU4A 1VBC1 1C8M2 5D8AC 4M3CE 3NJYA 3UETA 1Z7S1 4FQ4A 3LA7A 2A6ZA 4R8HA 3MW4A 5FLHA 4XJAA 5FZ1A 4UXAA 2EIDA 4N9IA 4HT1T 5EPAA 4ASMB 3NW4A 3AZXA 3NV3A 2A3XA 2LM3A 4XJ9A 3QLQA 4TZDA 5HXMA 3O1RA 2H0BA 1UY3A 3PU8A 4GWIA 4PQQA 2J1TA 5FRAA 1LKNA 2H6BA 3DKQA 5ABJA 1YO8A 4QPWA 4CCEA 5T54A 3CJXA 3MV11 1GLHA 4ZXKA 5ABJB 3A0NA 5A3UA 5J96B 2JB4A 1W0NA 3VN4A 1FOD2 1ONAA 5ISLA 4NRQA 2XL7A 1ZREA 5FUNA 3ZXFA 5J7MA 3JD73 3DL3A 5JOWA 2RR13 4JZRA 4DRVA 5A7PA 1WCUA 1W2OA 3TN91 3ZFGC 1YXWA 3RI8A 5FZHA 1UY0A 1SDWA 4YM2A 5E16A 5LA2A 1SLCA 4ZPIA 1LB2A 2P37A 4Q0QA 2ENRA 1RUE1 4J1WA 4PLMA 3AYAA 1CAWA 2WAAA 3AFGA 3RQ0A 1RHI2 1X8MA 3WXPA 1KS5A 4NIIA 2GNDA 3IDEA 3FJSA 4JX0A 1JU3A 1O59A 1V6MA 3VBSC 3B00A 1QJEA 4IEQA 4XQDA 3I2DA 1ULCA 1PMHX 1RUG3 1W9FA 1QGLA 4XMAA 1PVC1 1QJX2 4UOJA 3ZXGA 3NWKA 2R32A 5A6XA 1MS8A 2WS91 1GP4A 4JRAA 1ENRA 1UY1A 4AAXA 2BGOA 4GMP0 2RS13 4HL0A 4NAMA 3ROUA 1TNFA 1PMJX 2EF6A 2FDGA 1R092 2XUEA 1RTVA 4P08A 2VCCA 3WG4A 2BWAA 2HWF3 5E88A 1SBFA 4IEWA 2AYHA 3OUIA 4DXRA 1AXZA 4DFSA 1QXPA 1Y9QA 1W28A 3AXDA 5L19A 5C3RA 1JYXA 1P8JA 2WQZC 3KT7A 2P6CA 3GALA 2B39A 3FBYA 5FBZA 3HVDA 3WDTA 2EXIA 4GWMA 3JCIA 3WINE 4XE9A 3P3PA 4PIZA 1OA4A 4BJ0A 1CJDA 4WBBA 3ACHA 1AR92 2A71A 3FE5A 3K75B 2QZ2A 5F8PA 3VD3A 5A6YA 2R063 4FPGA 2D7FA 3M3IA 1OQEA 3KZ4C 5FZ4A 1Q8SA 3J8F3 1O3TA 1ZRDA 4V2VA 3I7DA 2FDKA 4COYA 1IG3A 4RD7A 1S0CA 3RZJA 3ILFA 1A6CA 2D3SA 2V4AA 2XJQA 2MHFA 1MS0A 1V00A 2E9QA 3VD5A 3ZYBA 4DQAA 4ZZ5A 5LEKA 3WEZA 2SBAA 3KSCA 4MHRA 2BBVA 5IVYA 4LBJA 2A73B 4M3CF 4N90A 3THCA 4IETA 5A6QA 5LW9A 1Z78A 1LESA 3ACGA 1QHDA 5JPMB 1L3JA 1WLTA 2B45X 1PGW2 1VJ2A 2G4IA 3BCWA 3EQEA 3IAPA 4COVA 2VZTA 2WYSA 3UKTA 5FYZA 2R072 3MI8A 5EQUA 4AHYA 3Q8FA 3URFA 1U5XA 4CP9B 3VD9A 1PZ8A 1PIV1 3I4IA 5BY5A 5DDJ2 1LHUA 1KFXL 1MEC2 1VR3A 2HEYF 3I3EA 4Z2WA 1ENQA 5I0RA 3PDQA 3LDKA 4QGLA 5LY2A 1D0HA 3ZYHA 4BM8A 4YLZA 3RSJA 5ABJC 5KC6A 2E6VA 4Y20A 4KWUA 1D4M3 1QWRA 2Y8KA 1LJ7A 5T52A 2GZWA 4ZU5A 5ACA2 1FPN1 2HWD2 3JBG3 1GNZA 4N7UA 4XFBA 2ORZA 1PVXA 4Y20B 3ZIXA 3VHOA 2BDRA 4JQTA 4XW3A 1BXHA 3USUA 2VMGA 1W9TA 3AL6A 5LATA 3I2OA 5FXVA 3DGTA 5EWSA 1J3RA 1HX6A 3FHQA 5GZDA 2PXJA 5F3EA 5FZIA 4A44A 1AJOA 1CIWA 1AR73 1GSLA 5FYMA 4COUA 1CONA 2J1VA 4B7EA 5A6ZA 2Y64A 2DVFA 2XVKA 3WG2A 1NAEA 1W2TA 4B8EA 1QXJA 1X36A 2AH2A 3SISA 2PLV1 2Z79A 2V73A 3VHPA 1W05A 2QTWB 4GKYA 4W65A 3CZJA 3SQOA 3JQXA 2VCMA 4MOAA 1C3HA 1HIXA 3KF3A 5FOJB 2OA2A 1R1A3 2VMHA 2RJ2A 4NJ4A 3VDDB 3WQ0A 1F9KA 3KCYA 4NIGA 5J48A 2VE1A 4NRPA 5FY8A 4FPKA 4P02B 4P14A 4YW4A 3LEGA 1V9U1 5DMYA 1JZ7A 1RUD2 1RUF3 3NNLA 3T1LA 5C7GA 5JPNB 1RUH1 4Y22A 2YU1A 1FOD3 1NY71 2ZGSA 4PCRA 3THPA 4CPBD 4M01A 4GIQA 4XUNA 5JXGA 4Y22B 2O1QA 3T0BA 1DQ6A 4IE5A 1CAUA 1RITA 2PFWA 3RZZA 3BTXA 3OBAA 3AKPA 5K8SA 1BVVA 1TE1B 1G6NA 3AP5A 2Y38A 2JD4A 3AVSA 3H1MA 1L7RA 1NA1A 5EFUA 2ERFA 3HT2A 1BVP1 4LIVA 1BMV2 1NA1B 2BNNA 2VZQA 3MIBA 4HK9A 4GULA 4XEZA 2ARBA 3RGBA 4AI9A 5F1RA 3WV6A 4JKKA 5EYXA 4LO6B 3ZSKA 2ZX3A 1K12A 1QJX3 3FX3A 1OVPA 3U14A 2OUJA 4FFHA 3V56A 5JVVA 4LBQD 2GC3A 4XUTA 3GGLA 1H2MA 1BKZA 3O7OA 4GB32 2CNAA 5A3MA 2FCUA 4DINB 5A3WA 3NVCA 2WNOA 3T0DA 3R4SA 1DZRA 2WIIB 3M7AA 1R093 4HLTA 5CISA 2KXLA 1UY2A 4A45A 2PAMA 1SACA 2CWMA 2Y6FA 4QDSA 4C8DA 3IDBB 4AQTA 2YGLA 2CAVA 4OHXA 4RN5A 2WN3A 4UAPA 3WX5A 3O1UA 5D2AA 1GNHA 3AZZA 4NHMA 2VNRA 3ZOIA 3EHKA 5C3OA 3OG2A 1HLCA 4C1WA 1LEMA 1CZSA 3CZUA 3ZDVA 4YZ5A 3BN6A 4AAPA 2B5HA 1LHVA 2ET7A 3ZR5A 2DCZA 4N7IA 1AYM1 4FAGA 2D98A 4X6QB 4G4FA 3T3YA 2ZPXA 2JJ6A 4I0AA 1H6XA 4H14A 3SCFA 4AFDA 1KJRA 1L7LA 3RJRA 4BXFA 1WD3A 1XBFA 4B1LA 4UBHA 5DZFA 1AJKA 3KWVA 4XC9A 2CGPA 2ZCWA 4MADA 1D7PM 1S0GA 1VLNA 1KGYA 4AHZA 3A21A 5J1XA 3ST7A 4P5YA 2R6QA 3F95A 5HBAA 1AHSA 4R4ZA 3WG1A 3LFMA 4B1MA 4W6XA 1WCQA 5FY1A 2JWPA 1I3HA 1D4VB 4QKBA 4OHZA 2Z2SB 2G19A 2V72A 1GZ9A 1H6YA 2F6BA 4KWJA 1VBE3 4BQWA 3IKWA 4LBNA 2ZMKA 4ZU7A 2QCSB 4Q1RA 5FZ0A 4KG8A 4CCCA 1J59A 4UFKA 3ZN5A 2VOTA 3KF5A 3MLJA 4RA0A 4XJWA 2YGMA 2GC2A 3G6JB 1EV12 1DLLA 3PURA 4NROA 1C1LA 3UJQA 1PGL1 2C9AA 3O1SA 1I1EA 2R073 2JEMA 2QQPA 2JDHA 2BOJA 4BCUA 2I74A 3S0MA 4FTBA 1TG7A 2VZVA 4LBKA 1KQRA 2XXZA 3OPTA 4QXCA 3U1XA 3VDDC 3CEWA 2DWRA 2WUHA 4S2HA 3DN7A 5A3TA 4HSJA 4YVSA 3GBGA 1LOAA 2ILMA 3KLSA 4BYYA 5JXJA 4AQSA 2BW8A 3H3LA 3QD6A 4AEJA 2XJUA 1YI9A 2VMEA 2VUAA 3ME2A 3UGHA 2HWD3 3V0BB 2XBO2 4YW2A 1DGLA 2J1AA 2VR4A 4E4ZA 4HFSA 3U07A 3WP5A 2PQQA 2XDVA 5E6HA 4AFMA 1UD1A 4CP0A 4SLIA 2HWC2 1QJU2 4ZKTB 4PDWA 4M0HA 3VZLA 2BPA2 2VVEA 4PBOA 4ORFA 1CJPA 2HWB3 2ZABA 3BODA 3CIHA 1POV1 4YRDA 4XAAA 2DCKA 2IXKA 4KBBA 4NOTA 1NA1C 3HIFA 4FI9A 4PDWB 5FYCA 4C90A 5T5OA 2C0ZA 2RS51 3LPFA 4B29A 4F7ZA 2R0HA 4KGGA 2FMDA 5IWFA 2Q8DA 2DDUA 2CHHA 1CESA 1US3A 2HLEA 5FFOC 5HCHA 1H8TA 1TMF2 2WYFA 5FPAA 3GHNA 3GXUA 3ZPYA 1YCIA 4N43A 4Y1UA 4AVVA 1H8TB 5F5CA 5FYVA 4Q4X1 4N43B 3N7JA 4QDRA 4YGBA 2DCYA 1N1VA 2YU2A 3H7JA 3N9LA 2WR9A 1IKPA 4NHLA 1W0OA 1R082 2VMCA 1RUI3 5B2GB 5I8SA 3VD7A 1WW5A 2ATFA 4EZ4A 1OD5A 4XCBA 1C5IA 1AL23 3N36A 5LBFA 4BOWA 3CBNA 2D43A 1AR81 3ILNA 2NMNA 3KT4A 5FZKA 3NO8A 2ZZJA 2QDRA 1YC61 2Q5TA 3NL1A 4GWJA 4RS5B 2KA3A 3S7EA 3AKSA 4LUMA 5CFDA 1ULFA 4MGZE 1J3QA 3T4VA 4EWDA 1OLMA 2W94A 2MEV2 3KVBA 3LIHA 5GZFA 4G3YC 1SHWB 2LW8A 4RL7A 5F6KA 3S7IA 5SV8A 5AVPA 4E2QA 5KBFA 1G9CA 2JIJA 4IEUA 3WF4A 1V0AA 3R6SA 5I91A 2ZAAA 2FMYA 4HETA 5FP4A 2WZEA 3IN9A 3OD4A 4GB33 2RDQA 1CQ9A 1NZCA 1SLBA 2E51A 5LB6A 1GQGA 2G9FA 4K8FA 1JYVA 1JXNA 2Y6HA 4Y4YA 2RDNA 1QEXA 2OW4A 3AXEA 3VZNA 2ZEYA 5IW0A 3B9CA 2VW0A 2CGOA 1VALA 3O0XA 4AL9A 4M0NA 2ET1A 4G9SB 4LBOA 3D5OA 1C5HA 2TUNA 1K5JA 5FP3A 1UYXA 4YZ4A 1WMFA 5FZ7A 4DUXA 5JUVA 4CVUA 4J1XA 4Q2FA 5L7OA 1S2KA 5KC5A 4QGNA 5FZFA 4QHBA 2A1XA 4KH9A 4AOCA 5I0SA 5L7OB 1JYNA 2J1UA 3SH5A 3FBMA 3RWKX 1XYPA 2W2IA 1ZX5A 3IPVB 1ALYA 4Y4RA 1SLTA 3VDCA 1O4ZA 5EYYA 2XQXA 2CTVA 2ZXQA 3B69A 1PO22 5C8CA 2FHRA 5FZ6A 3RYPA 4MYEA 3CNAA 4QX7A 5EJZB 2VMFA 1CWPA 1UAIA 5DPNA 4Q4Y3 1C57A 5CYYA 4TTGA 4UI9L 1WMEA 1GOHA 1KXGA 5C8CB 2JB8A 3DUIA 1JZ2A 1FMD2 1T6GC 2RR11 4AG4A 4OFGA 4HOOA 5JXIA 4JC1A 3WQ7A 1O3RA 4KQ7A 5LK5A 4UW5A 5IVCA 1RUC2 2CV6A 1XSRA 1BZWA 2E7AA 3GF6A 4Q29A 2HYKA 2Q8OA 3ETPA 1G9AA 2YC0A 4PDWC 3NQHA 5FDBA 3WG3A 1EV13 1WLCA 2QQOA 4I09A 3WDUA 1QJZA 1CPNA 4XTMA 2RG4A 5IAXA 3CKHA 3MUY1 5DZEA 2E63A 3ZFEA 1NLSA 1ASJ2 1YIPA 1XNBA 1RUG1 4NO4A 2CSGA 3K3OA 4OVEA 1LODA 2BVBA 4L9BA 2B9VA 2BU9A 2JDZA 4RGAA 1H8TC 4QB6A 4JVAA 4AVSA 4N43C 1N3PA 3T30A 1V70A 1KDKA 3MW2A 5HV0A 2WWUA 3ZPOA 2RS11 4D0QA 2OKXA 2X5IA 1OKQA 1ODNA 2XBO3 4LO5B 3SXWA 2WO2A 5A7SA 3WP3A 3PUHA 4AI0A 3U37A 2X5IB 1UXZA 1QJU3 3W58A 5J09A 5E1RA 3ZDSA 3AKTA 4QM8A 3VBRA 1W6QA 3FHIB 2QVSB 5HV4A 2W91A 1QQP3 3BIWE 2W1QA 3RZMA 1QOSA 1ZBA2 4XOGA 3MICA 3KCXA 1W6QB 4WVZA 1W8OA 1OF3A 1Q8OA 4I02A 4UW6A 4LHNA 3Q8BA 3PUSA 1UL9A 2WO7A 3SITA 2A3WA 1OUSA 1TMF3 2HEVF 2R061 1CX4A 2VZPA 3O0VA 2NM1A 5T5JA 4V1PA 4IL7A 5FZDA 3LQCA 4JDNA 2XJPA 3E6BA 4QX8A 4JRLA 3J8F1 3NNGA 3EO6A 4HVQA 5A7OA 3I3BA 4IV1A 4BK5A 1IKQA 5F9TA 1RXGA 4AZZA 1LOBA 5FK7A 4OCTA 5BNPA 4IV1B 4NIHA 3MIEA 4SBVA 1O91A 4ZXEA 4HVOA 4R52A 4JTOA 1R083 2I2SA 2A5ZA 1WCDJ 4CEYA 4HN0A 3DV8A 5BNPB 4NAOA 1POV0 2YFUA 3WF3A 2AACA 1J3PA 1W6OA 2E7TA 3LPGA 1O5UA 5DZGA 1DQ4A 2MNGA 4PQ9A 4URTA 1JYCA 1ULDA 1KS4A 2ZKLA 4QMAA 1W6OB 1W8UA 3TB0A 3R05A 4DIQA 3TEYA 1QJY2 2V5DA 2YC2A 3LA3A 1BBT2 5FXXA 3VZOA 1GQPA 5FXZA 1NXMA 2PHUA 1S0EA 4FP3A 4MXVA 4XFFA 4WVMB 1AR62 2ZTNA 3VBHA 3D6EA 2MEV3 2BUKA 4O7XA 2YB7A 3OY8A 4RSUA 4AYUA 5L7OC 1JHJA 5IK4A 4ISQA 1XNKA 3VBHB 5GZGA 4QX1A 4BWOA 3HEIA 4HSLA 1W6MA 3T1MA 3ZXAC 1TME2 5HCFA 4XACA 3WW4A 3VDBA 2DVDA 4EE2A 1WMDA 1W6MB 1XC6A 3KM5A 1D4M1 3OGJA 3ZXJA 1ULEA 3LCPA 1AYN1 3JBG1 5C8CC 2EICA 4AW7A 2A3YA 2VBPA 1XSQA 2HYXA 3BPZA 2Y0OA 4LK6A 5DABA 1E5IA 2QJVA 4MX3A 4XF0A 5GLTA 1W06A 2UWCA 1IS4A 1Q5OA 3CHXA 1FV3A 4H3WA 1U5ZA 5FREA 3R4UA 5I0DA 4B4RA 1HRV3 1Y4WA 2ZZQA 3O0WA 1AR71 2B46X 3WNPA 5JXHA 5C5TA 3ZM8A 1Q43A 3CMGA 4LTAA 5KXCA 4BLIA 3HQUA 4S2DA 1ULGA 5A7WA 4XJUA 1APNA 1JZ3A 3HJRA 4HPKA 4HK8A 3S5AA 3ZMOA 2FDHA 1S1AA 5A7WB 4QPGA 2YBPA 3DPRA 1KRIA 3MFAA 1R1A1 3LOBA 4D6QA 3LDRA 4HPKB 2Y6JA 4IQPA 3ZFEC 1BK1A 2W5FA 2VQ0A 2D5HA 2RMU2 3OB8A 3DPRB 4QPGB 5DG1A 3RJ2X 1PO23 1RUF1 2VTXA 1MACA 3WUDA 2ZGPA 4XDPA 1MS4A 2RHPA 2W1WA 4WM7A 3AYCA 4FPLA 4UW4A 1NE6A 3PLQA 4FOYA 4FPJA 2IFWA 4O61A 1HQWA 4FOWA 1JTZX 1WLWA 3OD0A 2D5FA 2D44A 4P5HA 3T09A 3ITQA 2H0VA 4WM7B 2ZACA 2X5IC 5FUIA 1RUC3 2DFBA 4W6YA 5FR3A 4C91A 3LB9A 3MLLA 1YFWA 1WCKA 2LRPA 3RNSA 3K46A 2YROA 5E89A 1RVF3 2PHRA 2WFF2 2VQTA 3BU0A 3U0ZA 1YI7A 3VBRC 4CPBA 1HW5A 5GZCA 1W9SA 1KDMA 4FTSA 5FPVA 2VAUA 5FXWA 1BYHA 1ZRIA 5FZOA 1ASJ3 1CPMA 1QOTA 4GZ9A 3BUCA 1BQPA 3ZYGA 2OPKA 4Y5Z0 4HANA 5FZOB 5FZ9A 5G05L 4NN0A 2W46A 3L2YA 4UWDA 1B09A 2QQNA 4LE4A 4ONUA 4P9IA 4YW6A 4E4DX 5KHGA 1FYUA 3E5QA 4GH4B 4RGKA 2WINB 2WNUA 1UKGA 3I54A 2TEPA 4R9CA 3QOPA 3TNQA 4IV1C 4F8AA 2HWE2 2WNUB 5F3IA 2Q8CA 2ORXA 1A3KA 1K45A 1VBD2 1X8EA 3P3NA 4CDWA 4DXSA 5BNPC 4L92A 4LKDA 4XF9A 4AEMA 2L9LA 2UYBA 2X10A 4ATEA 5DG2A 3KQRA 4CDWB 4DNYA 3P5BA 1PM7A 2D93A 1UY4A 2ZGRA 3GZAA 1G7YA 2B8MA 1ZBA3 3O1PA 5AC91 4IEZA 4QB1A 1Y43B 4IE7A 3VBFA 4I3PA 4INDA 4U2AA 2ZEXA 3DYOA 5FKBA 5AFEA 3SNMA 5C70A 3U78A 2IXIA 1VRH2 3VBHC 1OLRA 2EAKA 4H55A 4YZ1A 1ZZCA 1J1TA 4EN8B 1YIFA 2R1DA 1BJQA 1QXRA 1SDDB 4XVHA 4H7MA 4D7SA 4DY3A 1HXS2 4YZ2A 2VMDA 1IQDC 1XXNA 1A8DA 4LORA 5AFBA 3BTAA 1VBE1 2DUPA 2A7AA 2TBVA 4IXLA 1PO11 1UYZA 1OA2A 3SH4A 1F31A 5CNAA 3TEWA 2DBNA 3ZYFA 3M3EA 4BPZA 4MXWA 3RWNA 1QJY3 4OLLA 5L9BA 2ZHNA 5HCBA 2AC1A 4E9KA 4MXWB 2IXCA 2BNOA 4FVVA 2JG9A 4QPIA 4WZCA 4D94A 4WM8A 2VULA 1CAWB 1EAH2 3ZSMA 2AUYA 2P3KA 2JG9B 4QPIB 4WM8B 1I5ZA 3HBKA 1MVEA 5C3QA 1TME3 2RS31 4QPGC 3DPRC 4M3CA 3V65A 4JGYA 3I3QA 4ARXA 1IPKA 3IT8A 3POIA 4W6WA 2QQMA 3OBRA 3UKVA 1SBEA 2ETEA 3HQRA 4M3CB 3RFRA 2HWD1 4D7YA 4JGYB 3C3VA 2ZGQA 2XHKA 4FFGA 2P2KA 3AP9A 3NRUA 3KV9A 4AFAA 4WM7C 1ZBE3 3AK0A 3KGLA 4HN1A 1CAXA 1VBB2 1W99A 3OPWA 4KU7A 2EXJA 4QQ2A 4YGEA 2DURA 3WW2A 4BQ5A 4BQXA 4K9SA 4KNCA 2F4LA 4NR1A 5FYSA 4TLGA 2XPJA 1CAXB 3WCSA 2HWB1 5C71A 3POYA 3N7LA 4BH9A 2H6CA 2J1RA 1REDA 4LMFA 2RM22 5A3OA 5GLZA 4YW5A 1X50A 2N7GA 4MGTA 1UKRA 4RR3A 4X6RB 4LO8A 1W2UA 2Y33A 3I2JA 1GZCA 3MO4A 5JR2A 2ZX1A 1QH7A 4YWAA 1DGRA 5J36A 1WBFA 1WW7A 3Q8AA 5KXBA 2JG8A 4L11A 4RR3B 1Y7BA 4IGPA 1VBA1 3VKNA 2RMU3 3GHMA 1F2NA 4CCOA 1RUJ2 2O8QA 4BQ1A 3OBTA 2JG8B 4GH4C 2RV9A 4CP2A 4DS0A 4RFRB 2ADDA 2NYYA 1KJLA 4KU8A 4GJZA 4X8NA 4XMIA 1RMU2 4BHPA 5IK8A 5BNNA 1VBC2 2WNUC 3AL5A 3N7MA 4E4SA 4R9AA 1OF4A 1W8TA 1RUI1 3KVAA 4QWNA 5FZCA 4YGCA 3VBOA 5LBEA 5J37A 1Z7S2 5LBCA 4XJ8A 5BNNB 1UMZA 1AL21 1XU1A 1GP5A 4CDWC 3H9AA 1MZ6A 3O12A 4Z2AA 2JICA 1G8WA 4OHYA 5C4WA 1FI2A 2WFF3 4MV2A 3DYPA 4KMQA 1W8HA 1YQ5A 4XF1A 1X82A 3LEIA 4KWLA 5C4WB 2J7MA 2HH9A 5FYTA 1BHGA 1CAVA 4PF1A 1JYWA 3VBFC 4IEVA 5CFCA 4EWAA 1JZ4A 3KT1A 2QUOA 1DQ0A 1WMXA 3HD8B 2GU9A 5CFCB 4OUSA 1GUIA 1I6XA 2EIBA 5C33A 4Q4V3 2GNMA 3TN92 2NQYA 2WQ4A 3NJXA 2HWE3 2JDMA 3ZFFA 5FO9B 1GYKA 1IHMA 4LA2A 1F5FA 1VBD3 1R64A 2JDPA 3M3OA 3QH6A 4CU7A 4IE6A 2VVFA 3P6BA 5IT6A 1NCRA 1PX4A 1W04A 1J1LA 5FMDA 1W03A 1C8M3 1H2KA 3USUB 4QKFA 5JR7B 5FZ3A 1XYOA 5A1AA 4XF3A 2Z5WA 2ZS6B 4IGQA 1SLLA 1OMIA 1OVSA 3LA2A 4NWVA 3THDA 1QF3A 3DECA 2EVXA 2WS92 3IBMA 4S2GA 4OI1A 4CRQA 2JG9C 4QPIC 4EJRA 4NHXA 4WM8C 2PAEA 2DTWA 4QU2A 4RGGA 1LR5A 2OIIA 1V6NA 4CZSA 4Y24A 4AGRA 4BB3A 3ABZA 3I2GA 4AI1A 4BQ2A 3M2MA 2CWSA 2CDPA 2UWAA 4Q4Y1 4XUQA 3NV2A 1Y3TA 4IEYA 4JGYC 4UFHA 1POQA 2EIGA 3VHNA 4C0HA 2BOIA 4BQ3A 4Q4W2 3OCPA 5T3NA 3EBRA 5JSPA 2P4EA 4MH0E 1W3VA 1A8MA 3I59A 5C3SA 3O14A 2ARXA 3I97A 1CAUB 4WV8A 1Y9GA 3BB6A 3I59B 5IVJA 1O3QA 1F35A 2IXJA 3J7HA 1RHI3 5FMBA 5K4LA 2RVAA 1ST8A 2VTXJ 5K7PA 1G9FA 1H9WA 3HNMA 4BIFA 5JZGA 1W2NA 4YG3A 2JE8A 3TRSB 5IJRA 3FZ3A 1XJAA 3WD5A 5JZGB 1MZ5A 2DUOA 2LS6A 3DXUA 4QKDA 4RR3C 4TLFA 1NKGA 3AYDA 2IVIB 4JKLA 3GZTB 1QH6A 3OOXA 3I2KA 1GFF2 3UGFA 5FO8B 2JG8C 3MPBA 3GCXA 4K40A 1GWKA 1HRI1 4UFMA 4Q26A 5DAQA 1UPIA 3PMEA 4QDQA 1V6LA 1H1MA 1OA3A 3THTA 1GANA 4FPEA 3IIAA 2EAAA 4IV3A 4BU2A 2FCVA 2FDJA 4KWKA 1OFNA 3OPZA 2WT2A 1W2AX 2Z69A 4QX0A 5DAVA 5BNNC 1WBLA 1JZ6A 2QDNA 4IV3B 1QJU1 2XKPA 3VBOC 3W21A 4CU9A 2AREA 5FZGA 1ENSA 2ZMLA 1SCSA 3LSEA 2QQWA 1QQP1 4R9DA 3TBDA 3UNPA 2C5DA 4ES8A 3J7MA 1DYKA 2K9ZA 4XFGA 1PHMA 5FY7A 5T50A 3HQXA 2VGDA 1KD7A 5C4WC 1XNTA 4RHV2 3ZYRA 4BZ4A 3M4FA 1CR7A 5GKAC 1TMF1 1DBNA 1ULOA 1AR93 3TEXA 1UF2C 5F2SA 4LLFA 1AX2A 2DUQA 3PVOA 4O9EA 4OUMA 5LBBA 4AQ2A 2YBSA 4OUEA 3POFA 1HJFA 1RUJ3 1LU1A 2K2SA 2VMIA 5CFCC 1GNYA 2GSYA 4UFJA 4XF4A 2W0XA 2WDBA 4FOVA 1QU0A 1T6BX 2JKXA 3PIJA 2AZ5A 2WJSA 2BERA 3LAGA 1RMU3 1VBC3 1WA6X 5I8YA 2ES3A 5EXOA 2W95A 4PJYA 1BEV1 1Z7S3 3ZFFC 3C7FA 4CYDA 4QU1A 4DEVA 2D97A 3ENRA 4NPLA 3T4HB 2PLV2 4BXSV 4AXOA 3BGAA 1YFUA 1NCRC 2HKXA 3ATGA 3ZSJA 2WQ8A 4D8MA 1LGCA 1HKDA 4L8QA 4PLOA 1F4AA 3HNYM 1FX5A
chains in the Genus database with same CATH topology
1WW6A 2DCJA 4EN0A 1V9U2 3PNAA 2ZBJA 2R16A 1RUH2 1NY72 1OPMA 5DDJ3 4EN9B 1MEC3 1D0GA 3LSDA 3VZKA 3T2TA 5SV5A 4Q0UA 1J58A 3HMYA 1PZ7A 3H1YA 3UV9A 2VUJA 3RS6A 1WD4A 1AL0G 1UCXA 3MF6A 1WGPA 4YVSB 3N35A 4AGGA 4CEWA 5ACA3 1G86A 4GWNA 3WR0A 4YVWA 2XH6A 1SLAA 4CEWB 4QM9A 3VL8A 1HRV1 2TNFA 4AFBA 4IEPA 1FT9A 1W39A 3H8UA 1XYNA 3MDPA 5I0UA 1W6PA 2ZHKA 4YFZA 1G9DA 2WZR1 1RUNA 3ILRA 4LULA 1W6PB 2WS93 3WVJA 2WC2A 2Q1MA 4CDUA 5JZGC 3JQWA 4A7YA 1LOEA 4QGMA 2VH9A 3CL1A 3AZYA 3IWZA 5C6CA 1AF9A 1PO21 1N3QA 1UIKA 3UK9A 1SBDA 1UIJA 3FUOA 4YM0A 5IK7A 1S55A 1B35A 5DUVA 2NN8A 1ZRCA 1RUD3 4K7JA 1SQ4A 1YNAA 4BMEA 3OF1A 4XFAA 3VKMA 3ASIA 3RYRA 2PTMA 4YFWA 4Q4W3 3WDXA 1RUC1 2PAKA 3PVNA 4IV3C 3WNXA 1AYM2 2GMMA 1K5MA 4AVTA 1PK6A 2PHTA 1S0FA 4MGKE 1RVF1 1COV1 4FT8A 1WUVA 5I93A 4JQRA 2VOXA 4XFIA 2UU8A 3ZYPA 3AX4A 3R0RA 1CVNA 5CFDB 3JZVA 5AVAA 3Q9OA 4FBFA 3B93A 1YJLA 2ZHMA 4PIXA 4TYSA 1Z0HA 3KD4A 3SMHA 4MGIE 4U36A 2ZGNA 3JB8A 4DY5A 4L2NA 3RPQA 4QQHA 4AHWA 1C4RA 1I9RA 2V5YA 3AP7A 2ZX4A 1PGL2 2D6NA 1ND3A 4RHV3 3SCGA 2NMOA 3MIDA 2A6YA 2A6XA 1IS6A 1SFNA 2DCTA 2X8KA 2FQPA 1DZQA 1H1AA 1EPZA 1WA4A 3NSTA 4DMIA 3E5XA 1VB4A 1S0BA 4YVSC 2ZA9A 2ZHLA 5F6LB 4A3XA 5FLJA 2GAUA 3JD71 5JOYA 1SCRA 4CEWC 3ZXLA 2Z42A 1UN1A 2RS52 2PLV3 1C1FA 3FWEA 1QJY1 2WL1A 3SLIA 3K48A 4K20A 5BUVA 1FV2A 1X7NA 4AVAA 1IPJA 3FC0A 3KCCA 4B4PA 4R9BA 4Q4X2 3VKOA 3ZO0B 4EN7B 5GALA 1LGNA 3D82A 1RUH3 2A75A 1GICA 4CDUC 3ZFEB 3FLTA 4XILA 1EYBA 3WT3A 4IEXA 3HWJA 4I0WB 1YYNA 2IXLA 2QNKA 2OZ6A 5JI7A 2R042 3SHRA 2YXSA 5BNQA 3RMXA 4XHXA 4MLOA 1B35C 1AR82 1NOVA 4DPNA 1ZBE1 1ZA4A 4QQLA 3ZIWA 1YHFA 2HWF1 4BIOA 4BMBA 4AK3A 2XL9A 3ETQA 5FLIA 1AXKA 2WSUA 4AI2A 2HWC3 2NZ9A 2GN7A 3AZVA 5FMOL 1MQTA 2MPFA 1K5MC 2QFEA 2IXHA 3V64A 4N53A 2WFPA 3VBRB 3B5LB 3U10A 2YUEA 1VAMA 4COWA 5CFDC 3WW3A 2G9GA 3PTYA 1WCSA 1XE8A 2CY6A 4XYXA 5GLWA 5DUUA 4M00A 1YLLA 2XJVA 4TWTA 5E8AA 2YMZA 2VG9A 4CDXA 1DQ2A 3WQ1A 3BALA 1LGBA 1FATA 1AYM3 4CDXB 1DGWX 4WVVA 1LEDA 2W39A 5JSOA 1AXYA 3MFCA 5K9YA 2BGCA 4CEYB 1NQJA 4Q27A 5DUXA 2WFF1 2Q1ZB 4Y1YA 4MUVA 4FXGB 2D6KA 5KXDA 2DV9A 4Z92B 3PVBB 4Q0VA 4P9WA 1H2NA 2WNEA 3ALQA 3E6CC 4FCAA 1H9PA 2XLFA 3OTFA 3OY8B 2UYAA 3KMHA 3O5SA 4Q4V1 2UY9A 1X33A 3HBZA 4P9LA 1AX1A 5KWRA 2R49A 5J3UA 1IQAA 2PN5A 4YSFA 1BCXA 4CP1A 2ZX0A 3WCRA 1C8M1 4HKLA 3AB0A 3B94A 2XGXA 3PHMA 4IESA 5L73A 3S30A 1LTEA 1RUG2 3WHTA 3D4KA 1XU2A 4XXAA 1ZZ9A 2YDEA 2BQPA 3USSA 2VW2A 1G9BA 3C2UA 1HV1A 2RS12 4XQ4A 2IWGB 2JE9A 2JKBA 2VU9A 2ZAHA 3FLPA 3RDIA 2O0OA 3AFKA 2GC0A 2JX9A 2VNOA 2D6OX 2B9UA 1FOD1 2R1BA 3E97A 4L99A 1CD3G 3KGZA 4FO9A 4LT5A 5KHIA 1FMD3 1M4WA 5BNOA 1ZZ7A 1JH5A 4Q1PA 2GMEA 1JW6A 2NPIA 3M8LA 5D1IA 4AVCA 4EN6B 5BNOB 2RS53 2RJKA 2A6WA 2VQAA 2Q0AA 4AQ6A 4YG0A 2VOVA 1GR3A 1C28A 1RHI1 2CYFA 4PIYA 5F5QA 1NG0A 2BYVE 4LBMA 4D69A 2F4PA 4XIOA 2RE9A 1MQTC 2B7YA 3J8F2 3OGGA 3QACA 4XQWA 4N53C 4Q4X3 5FMOS 5GLUA 3ZXDA 3LWCA 1QJX1 1E57A 3ZYJB 2I07B 3DKWA 4FXKB 1AVBA 2R043 3IM0A 2GALA 1DZTA 1R091 1VP6A 4XBLA 4PLNA 5FO7B 1OQDA 2X53S 1MS5A 3WDYA 2IZWA 4JDOA 2Q4SA 2Y26A 4OI2A 4QX5A 3VZJA 4CDXC 2D6MA 4CEYC 4LBQA 3FUQA 4JCKA 3A4UA 3E5UA 4LBQB 1NLRA 5CU1A 2R0FA 1MZEA 2WSVA 2ZMNA 4OHVA 1AR91 1EPWA 1D4M2 1YWKA 1UU5A 3ZSLA 3VBFB 3J4UH 5JOXA 4L97A 1AYN2 2JECA 3B7MA 3OYWA 4K6BA 3TWIA 3CF6E 4Y1XA 1GQHA 2W68A 2AR6A 4LEJA 3OYWB 2DVBA 1XQNA 1SLIA 4FP2A 1AR72 4YW1A 4YARA 5HCAA 4ATFA 5K0UA 3NV1A 5K0UB 3G7DA 1JOJA 1PGW1 1R1A2 2BEOA 1BBT3 1QNWA 1AR63 5JIAA 2WA4A 4ES9A 2R071 3AMPA 5JI9A 1RUF2 1H0BA 3LZZA 3ZN6A 3CJIA 3JB4C 1Q3EA 5DDJ1 1MEC1 3A0KA 5H9SA 3ZN6B 5HI0A 2A70A 1ZZ8A 2JE7A 2A6VA 3CJIB 4FPYA 2QKDA 1LOGA 4E27A 3IDCB 5CB7A 5ACA1 3ECQA 3MIFA 1LHNA 5GM0A 5CBLA 5FAXA 2I45A 1FXZA 3JUUA 2PA7A 4OI4A 5C9AA 3ZYIB 1O4YA 3ZXKA 2YYOA 2ZGKA 4I01A 5BNOC 5C9AB 3FFQA 1REEA 5JWPA 2XJTA 1YFYA 4UBGA 3NKTA 1MS3A 1HDKA 3KS7A 3AM2A 3D0JA 1LOFA 4D3WA 1NQDA 3WDVA 4JTNA 3N3HA 1N1TA 3U11A 1Q8PA 3NV4A 4ASLA 5A33A 1QNYA 3MPPG 1S2BA 1URXA 3CO2A 4AEKA 2LUWA 1D2QA 4QPYA 5EV7A 5A33B 1R1ZA 1RUD1 3L9JT 1RJ8A 4N9HA 4WZFA 5KHKA 3MYXA 1DU3D 1MZFA 4Q4W1 3VKFC 4EROA 4AF9A 5C8WA 4RFT0 5AC92 4PBPA 4NHKA 3VBOB 4KL1A 1YJKA 3SH3A 1BMV1 5BYNA 5CIRA 1O4TA 1XNCA 4UW3A 2WLPA 4NWWA 4YW3A 2VOKA 2XWBB 1OPOA 1JUHA 3ES4A 5JLVA 2AGSA 5FPXA 2IC1A 3EXUA 1EP0A 1CAVB 4FTEA 4LO4B 4GB31 2WKKA 3EJKA 1V6OA 5JMCA 1W0PA 1RB8G 4QXKA 3CLPA 3D0SA 4GALA 1VBE2 4GMP3 2NP0A 4MVTA 1SMVA 1PO12 5H9PA 1NCQA 4DOUA 3ES1A 1RUE2 3DF0A 2LTNA 4LO7A 1NCQB 1WW4A 3ZFFB 2DVAA 3FLRA 3WOGA 2BTVC 2JXAA 5K0UC 5KHHA 4WVWA 1NCRB 2VW1A 4RHV1 4GKXA 3RI9A 4AHXA 2RS32 1PVC2 1QDOA 1XNDA 2D40A 3E6DA 4HBNA 3VBUA 2FZ2A 4JV4A 1DG6A 1VRH3 3WLUA 1AYN3 2LALA 4K21A 3CJIC 3VBUB 2GH8A 3X29B 2D3PA 4K3UA 3NJZA 4JDMA 4P9GA 1HXS3 2HWB2 4YM1A 3ZSEA 5JIUA 4LUKA 3IMNA 3ZX7A 1H30A 4HKOA 5CAZA 1DQ5A 5KHJA 1MVQA 4KGQA 3MW3A 3VDDA 5C9AC 1DIWA 1FAYA 2BFUL 3PJQA 2YV8A 5CADA 4XFCA 1EV11 1UZZA 2DTYA 1VBA2 1F8VA 1S0IA 1EAH3 4ITCA 3VGIA 5A32A 2D3RA 1LOFC 1ZZBA 2PHLA 5A32B 2XJSA 4RQPA 1RUI2 3L2HA 4P9XA 3LGRA 2XVGA 4JGZA 2WNVA 4F3JA 1AL22 3UL2A 4RQPB 1RGSA 4AWDA 5FQ0A 1ZZ6A 2XBO1 4OZXA 2ZGLA 4JGZB 2WNVB 4LHKA 2C1FA 5FQ0B 4FOQA 4AEDA 1PNGA 1HQLA 1VBB3 4CDQA 1DHKB 2HWC1 3WDWA 4FQZA 1H4GA 4K1ZA 2HJIA 3AJYA 5L36A 4AEDB 1PGSA 2PHXA 2XG3A 4CDQB 3AKRA 3INAA 3H0OA 5IUQA 1H4HA 4P9JA 2GNTA 2PYTA 4GXLA 3W9AA 2RM23 4O9GA 3TNPB 4OULA 3POWA 1PIV2 1IGOA 1TNRA 1GV9A 3AMHA 5FPZA 1QY4A 1S0DA 4I30A 2P34A 3H1WA 4AI3A 1VAKA 2DFCA 3M1HA 1FPN2 5FTTC 5GZEA 5T55A 4AVBA 4DZGA 1R081 1PMIA 1QDCA 1VAVA 5JSRA 5T5PA 3HT1A 1FNZA 4S2FA 3VKLA 1NCQC 4FPOB 5AC93 1N47A 2EXHA 4YZ3A 3AZWA 3GBWA 1YUDA 2WT0A 1IS5A 2EXKA 2FZ1A 2ZX2A 2YHJA 3BU7A 2UWBA 4Y1ZA 1LHOA 3ACLA 2IFRA 3R4DB 1C8NA 1O5LA 1N1YA 2MEV1 3MGUA 4LR4A 4YYOA 4Q8KA 4Q4Y2 1FNYA 2CGNA 2CL2A 3B3QE 2RJLA 1UW8A 1RL3A 3FFZA 1NYWA 3VBUC 1UU6A 2D6LX 3HN1A 4NVPA 1AUYA 4Y26A 3TN93 2PHWA 4EWEA 1PO13 4BLJA 3KB5A 1H2LA 1Q8VA 1RUE3 2ZGTA 2VY0A 3LOIA 4YVWB 2OVUA 3B9IA 3MLKA 1ZRFA 2BNMA 4YG6A 5EJ3A 4EV0A 1QOOA 4Z8BA 5GLVA 2GMPA 3JU9A 1LULA 2DYCA 1W6NA 3ELNA 3OJBA 4XBQA 2RS33 1PVC3 2XJRA 3ZMNA 2BFUS 1W6NB 3V0BA 2DU1A 1HRI2 2ZJCA 4C1XA 3M70A 1DYPA 2OUHA 4CDUB 3VL9A 3BOWA 4H7LA 2GN3A 4YGDA 1EY2A 4HKWA 5H9RA 3TAYA 4RQPC 5HXVA 3MIGA 2ZKNA 1FMD1 1DQ1A 4XTPA 4JGZC 2WNVC 1B35B 4XBNA 1QQP2 3APBA 2D6PA 5T5LA 5DUWA 4XJZA 5LRSA 3TYJA 4AEDC 4CDQC 4FAHA 1CGPA 1MR5A 2XLAA 4OHWA 1NE4A 3VUOA 4J6GA 1K5MB 4LNVA 1PK6B 1XE7A 1VBA3 1ENXA 4MSVA 1NXD1 2BVVA 5FCCA 5BV6A 1ASJ1 1UPSA 4NPRA 2E7QA 5CG8A 4XETA 5J98B 4XZPA 3VZMA 3N4MA 4MZUA 5H9QA 1BEV2 2EALA 4Q8LA 2R041 1PNFA 2XUMA 4RS5A 4P9YA 1DDLA 1IZ3A 4TSVA 4Z82A 2QE3A 2AENA 2X29A 1XRUA 3VV1A 1RJ7A 1VB2A 4QD2A 3H3ZA 3WW1A 1KITA 5TSWA 1U12A 1V6IA 2W08A 1GBGA 4HMZA 1ZNPA 1ZBA1 1S0JA 3FMGA 3U4XA 2WA3A 4JAAA 2CAUA 1PIV3 1RC6A 1U0AA 3WHUA 3POSA 2ZGMA 1OFSA 1DGWA 1ND3B 2GDFA 1OSGA 4A7ZA 1FPN3 3D8CA 3CU7A 5BPXA 1HRV2 1CN1A 3GBFA 2PHDA 3GYDA 2VVDA 2VPVA 2ZGOA 1JYIA 3AMNA 4DRRA 3H7YA 1M06G 2WZR2 3IPVA 4YVWC 4IERA 2SLIA 1ZVFA 1ZYBA 4LE3A 3MZHA 3BOPA 3HR9A 1BBT1 1N3OA 1AR61 3AP4A 5JAXA 2VXRA 1D2SA 4I0BA 4R4XA 4XHBA 4HZFA 4QT6A 3VLBB 1V9U3 2DF7A 4LHLA 1TME1 2OZJA 5I8TA 1F5JA 3M3QA 3K51A 1MS1A 1WLDA 4A2UA 1QMJA 1H8VA 3SCHA 3W59A 1SFYA 3PJYA 4AE2A 1RVF2 1COV2 2YZ4A 1ND2A 2DVGA 2VOWA 2W52A 5GJ6A 3NKGA 1ND2B 1LU2A 1AX0A 5JDBA 4ISRA 4I2OA 4C0BA 1PK6C 5CA6A 4Q0SA 4QQOA 1MQTB 2ZOEB 2YPJA 2WZPP 3WUCA 4N53B 4LLOA 3VHRA 2Y0IA 1HRI3 4YNIA 2WT1A 5LRRA 2E53A 2ZGUA 4XXPA 3S6PA 1VIWB 2RMU1 1LENA 2OYZA 3RYKA 2FBEA 4PF5A 2QZ3A 2K0GA 2BWCA 1JHNA 3PVEA 1UX6A 4XIKA 1N1SA 5KXEA 1TQ5A 3B02A 4RS5C 3WY6A 1GKBA 2PHFA 1AZDA 1OHFA 1PZ9A 4A7KA 2YY1A 1OOPA 5IK5A 3H3UA 2UURA 1OOPB 1DGRN 3I8TA 2WWSA 4AGVA 3NAPA 4E2SA 3QCWA 2GH2A 2V09A 2B42B 1ND3C 4META 5BXXA 3HAGA 2XWJB 3MEPA 3NAPB 1LOCA 3AYEA 3JD72 4BA6A 2RR12 1BEV3 1QKQA 4GMP1 3ZVXA 5D8AA 3UJOA 2HWE1 3ZXEA 1LECA 1H1IA 4D7TA 1VBD1 4WVMA 5D8AB 4LBLA 4B7KA 2HEWF 4F83A 4Z07A 1U5YA 3LKJA 2VECA 4DXZA 3WZ1A 1OI6A 3J9SA 3RRDA 1A78A 3MIHA 2EA7A 2VNGA 4Z1VA 1Q8QA 1YRZA 4FPFA 4B4QA 1KFUL 4HVRA 4AI8A 4QQPA 1GZWA 1VRH1 3N7KA 4COZA 3MF9A 4YM3A 4X8PA 3ZFGA 3M3CA 1LCLA 3QH7A 1GZWB 2GC1A 3GZUC 2P3IA 1ZBE2 1HV0A 3RG0A 4DB5A 2HWF2 3ZFGB 1DF0A 3WP6A 5CVRA 3WP4A 2XB6C 1HXS1 3AKQA 1O7FA 1OLQA 4Y1VA 4ZU4A 1POV3 3VBSA 5CG9A 2WZR3 4GQ7A 5JCTA 2XKOA 1LRHA 1ND2C 4GA9A 3VBSB 3ZN4A 1DFQA 4FPCA 2JENA 2R062 2KM2A 2DU0A 2NLRA 1UZYA 3AMMA 2PELA 3H50A 1HQNA 1JUIA 1EAH1 3AP6A 1YFXA 4E2GA 5A3LA 3PMSA 1REFA 3RMYA 2P3JA 5I0TA 2UY8A 3TOJA 1ZRRA 1TEIA 5JOZA 2Q30A 1IOAA 3GNEA 5LK7B 4FPHA 2P17A 1RINA 1AR83 4XDQA 1COV3 4Q0PA 1MS9A 3B01A 1VBB1 1IS3A 1JBCA 2XVLA 3J26N 3AMQA 4B3NA 5DXDA 1RUOA 4OI0A 4FSJA 3UKNA 1OOPC 4XFHA 2RM21 4GH4A 2O8OA 5LEJA 3QBQA 4XPVA 2GNBA 4I3GA 1V6KA 4BE3A 4KG0A 4LA3A 4Q4V2 1O3SA 2WLQA 5EZWA 4AFCA 1RIRA 1U5IA 3V0AA 4MGYE 3AJZA 3NAPC 3JBG2 1RUJ1 3V0AB 1V6JA 1SEFA 1ZM1A 2R30A 1OQ1A 1LHWA 2XLGA 5FOBB 4K1YA 1JN2P 1Q56A 4IEOA 1RMU1 1UU4A 1VBC1 1C8M2 5D8AC 4M3CE 1Z7S1 4FQ4A 3LA7A 2A6ZA 4R8HA 3MW4A 5FLHA 4XJAA 4UXAA 4N9IA 4HT1T 4ASMB 3NW4A 3AZXA 3NV3A 2A3XA 2LM3A 4XJ9A 3QLQA 4TZDA 2H0BA 5FRAA 1LKNA 2H6BA 5ABJA 1YO8A 5T54A 3CJXA 1GLHA 4ZXKA 5ABJB 3A0NA 5J96B 3VN4A 1FOD2 1ONAA 2XL7A 1ZREA 3ZXFA 5J7MA 3JD73 3DL3A 5JOWA 2RR13 4DRVA 3TN91 3ZFGC 1YXWA 3RI8A 1SDWA 4YM2A 5E16A 1SLCA 1LB2A 2P37A 4Q0QA 2ENRA 1RUE1 4J1WA 4PLMA 3AYAA 1CAWA 3RQ0A 3AFGA 1RHI2 1X8MA 3WXPA 1KS5A 2GNDA 3IDEA 3FJSA 1V6MA 3VBSC 3B00A 4IEQA 4XQDA 3I2DA 1ULCA 1RUG3 1QGLA 4XMAA 1PVC1 1QJX2 3ZXGA 3NWKA 2R32A 1MS8A 2WS91 4JRAA 1ENRA 4GMP0 2RS13 4HL0A 3ROUA 1TNFA 2EF6A 1R092 1RTVA 3WG4A 2BWAA 2HWF3 5E88A 1SBFA 4IEWA 2AYHA 1AXZA 4DFSA 1QXPA 1Y9QA 3AXDA 5L19A 2WQZC 3KT7A 3GALA 2B39A 3FBYA 5FBZA 3WDTA 2EXIA 4GWMA 3JCIA 3WINE 4XE9A 3P3PA 4PIZA 1OA4A 1CJDA 4WBBA 1AR92 2A71A 3FE5A 2QZ2A 2R063 4FPGA 2D7FA 3M3IA 1OQEA 3KZ4C 1Q8SA 3J8F3 1O3TA 1ZRDA 3I7DA 4COYA 4RD7A 1S0CA 3ILFA 1A6CA 2D3SA 2XJQA 2MHFA 1MS0A 1V00A 2E9QA 4DQAA 5LEKA 2SBAA 3KSCA 2BBVA 4LBJA 2A73B 4M3CF 4N90A 4IETA 1Z78A 1LESA 1QHDA 5JPMB 1L3JA 1WLTA 2B45X 1PGW2 1VJ2A 2G4IA 3BCWA 3EQEA 4COVA 3UKTA 2R072 3MI8A 4AHYA 3URFA 1U5XA 1PZ8A 1PIV1 3I4IA 5BY5A 5DDJ2 1LHUA 1KFXL 1MEC2 1VR3A 2HEYF 4Z2WA 1ENQA 5I0RA 4QGLA 1D0HA 4BM8A 4YLZA 3RSJA 5ABJC 5KC6A 2E6VA 4Y20A 1D4M3 1QWRA 5T52A 1LJ7A 5ACA2 2GZWA 4ZU5A 1FPN1 2HWD2 3JBG3 1GNZA 4N7UA 4XFBA 3ZIXA 1PVXA 4Y20B 3VHOA 4XW3A 1BXHA 3USUA 2VMGA 3DGTA