4YVSB

Crystal structure of the virus-like particle of a c4 strain ev71
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
237
structure length
224
Chain Sequence
b'GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
total genus 28
structure length 224
sequence length 237
chains with identical sequence E, H, K, N
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvsB00
5DDJ1 5BNNC 3VBHA 1RUC3 1AUYA 2IZWA 1HXS3 3M8LA 5CFCB 1VBD1 2WZR2 2RS51 1VBC1 1VBB1 3NAPA 1ZBE3 1AYN1 2HWB1 5GKAC 1QQP3 1QJU3 1RMU3 5ABJA 4GMP3 1R1A3 1C8M2 1FPN1 4RS5C 3VDDA 3TN93 1RUF3 4CEYC 5CFCC 1ZBA2 2TBVA 1ND2A 1AL22 3VBHC 5ABJB 1FOD3 3VDDB 5ACA1 1HRV3 2BUKA 1BBT3 1ND2B 1RUJ3 2RS32 2WWSA 1COV3 1VBE3 2HWD2 2GH8A 4Q4W2 4QPGA 4WM8A 2WFF3 4NWWA 2PLV1 1V9U3 2FZ1A 5ABJC 1R092 2RM21 3VDDC 4QPGB 1NCQA 1MEC3 1ND2C 4PDWA 1PO23 5A33A 3VBUA 1R082 1NCQB 1POV1 4PDWB 1AYN3 1ASJ2 2RMU1 1VBA1 5A33B 2RR12 3VBUB 1PGL1 1K5MA 2Y26A 1RUC1 4CDWB 4QPGC 5C4WA 2HWF2 4WM8C 1FMD3 1HXS1 2DF7A 1K5MB 1ZBA3 4N53A 4GB33 5C4WB 1NCQC 4GH4B 1ZBE1 4PDWC 3VBUC 4N53B 2RS33 5FMOL 1RUH2 2WS92 3CJIA 1QQP1 1QJU1 3ZFEA 1RMU1 4GMP1 1R1A1 4CDWC 3TN91 1RUF1 1POV0 2BFUL 1EAH3 1RUG1 1Z7S2 1K5MC 3CJIB 3ZFEB 2QQPA 4RHV2 1FOD1 1R093 4AEDA 5C4WC 2RM23 1NY71 1HRV1 1BBT1 3ZFFA 1COV1 1GFF2 1AYM2 1VBE1 4N53C 1BMV1 1W39A 5JZGA 1PGW2 1SMVA 3ZFFB 2HWC2 1AR82 1D4M3 1QJX2 1AR72 4Q4X2 2WFF1 3CJIC 3ZFEC 1V9U1 3VBRA 2XBO2 1MEC1 4GMP0 1PO21 1F2NA 3JD72 4AEDC 3VBRB 1TMF2 3ZFFC 4YVSA 2R073 4Z92B 4FTBA 3J8F2 5JZGC 1OHFA 1TME2 1AR62 1PIV3 2XPJA 1VAKA 4YVSB 1FMD1 1VB2A 4CDQB 1RUE3 1VRH2 1ZBA1 1RUG3 1AL21 1Z7S3 4QPIA 3VBRC 4SBVA 4GB31 2RS52 5AC93 1QJY2 1VBB2 4N43B 4CDUA 2VQ0A 2RS31 3HAGA 4QPIB 4CDXA 2RS13 4YVSC 4CDUB 2R063 1RVF2 1RUI3 5FOJB 1EAH1 4Q4W1 2ZTNA 4CDXB 1PVC2 1AR73 4Q4X3 1NA1A 1R091 1RHI2 5C8CB 4N43C 1E57A 1B35A 5ACA2 2XBO3 4QPIC 1NA1B 4Q4Y2 4CDUC 4YVWA 1B35B 2WZR3 1IHMA 4CDWA 1D4M1 4CDXC 4FTSA 1ASJ1 1QJZA 5FMOS 4Q4V2 2PLV2 4YVWB 3ZFGA 3J8F3 5C9AA 5C8CC 5J96B 1AR63 1TME3 1NCRA 2R042 4GH4A 1C8M3 2BFUS 1NA1C 3ZFGB 5C9AB 1VRH3 1AL23 1NCRB 1B35C 4RQPA 2MEV2 1QJY3 2R071 1BEV2 5D8AA 1AL0G 1PGL2 4YVWC 4RQPB 4JGZA 1PIV1 1RB8G 3VBFB 4CEWB 4RR3A 2HWD3 5D8AB 1RVF3 1RUE1 1NG0A 1OOPA 1F8VA 3JB8A 4Q4W3 3ZFGC 2ZAHA 1CD3G 4JGZB 1Z7S1 5C9AC 1PVC3 4RR3B 1NOVA 1NCRC 5AC91 4GH4C 1ZBE2 1OOPB 4JGYA 5L7OB 4RQPC 1EV12 1QQP2 4Q4Y3 3VBOA 2RS11 1R1A2 2R061 1R083 4JGYB 5D8AC 1RUI1 2HWE2 1AR92 1ASJ3 4JGZC 1AR71 4Q4X1 3VBOB 2RR13 4RR3C 1HQNA 4Q4V3 5BNPA 2ZZQA 3JBG2 1ND3A 5BNNB 1NY72 2XBO1 1OOPC 1BBT2 1H8TA 1RUJ2 2R043 2HWF3 1COV2 5BNPB 1ND3B 1PO12 2WZR1 4JGYC 4RFT0 1H8TB 1TMF1 1RUD2 5A32A 1BEV3 2WFF2 3VBOC 1X33A 4CDQA 1HRI2 3J8F1 5DDJ2 1AR61 1TME1 1RUH3 2X5IA 2WS93 5A32B 1MEC2 1C8M1 4N43A 4RS5B 3S6PA 4CEYB 1VBD2 1PO22 1VRH1 5BNPC 2X5IB 1ND3C 3VBHB 4RHV3 1VBC2 1H8TC 1QJY1 1AYN2 2HWB2 1M06G 5CFDA 1AYM3 3DPRA 1EV13 4IV3A 3NAPB 5LK7B 1CJDA 2HWD1 5C8CA 1RVF1 1FPN2 1FMD2 2HWE3 2HWC3 4CDQC 5CFDB 1AR83 1AR93 1PVC1 3DPRB 1QJX3 2X5IC 4IV3B 4Y5Z0 4GB32 4WM7A 1C8NA 1RHI1 3JBG3 4NWVA 4WM7B 3JD73 4Q4Y1 1X36A 3NAPC 1PO13 4BCUA 1R081 1TMF3 1RUD3 5CFDC 1EAH2 4IV1A 3DPRC 2RR11 1DDLA 4IV3C 1VB4A 4Q4V1 1HRI3 5DDJ3 2RM22 2R041 4IV1B 2HWF1 4WM8B 1MQTA 4WM7C 1VBD3 4FTEA 5K0UA 2RS53 1VBC3 2MEV1 3VBFA 4CEWA 4EJRA 1VBB3 1BEV1 1MQTB 1D4M2 2HWB3 2RMU2 1VBA2 4FSJA 5K0UB 1RUH1 2WS91 1RUC2 3VBSA 4IV1C 4LLFA 5BNOA 1FPN3 1HXS2 3IDEA 5L7OA 2BBVA 4RHV1 1RHI3 3VBSB 5BNOB 2R072 1MQTC 3LOBA 5ACA3 3ZXAC 2WLPA 1AYM1 5K0UC 1EV11 1PIV2 3VBFC 4CEWC 1QJU2 1RMU2 5BNNA 2BPA2 1PGW1 1A6CA 1RUF2 2HWC1 2HWE1 3TN92 1RUE2 1AR81 5J98B 1AR91 1RUG2 1QJX1 3FBMA 3JB4C 1FOD2 2PLV3 5AC92 3VBSC 5BNOC 3JBG1 1WCDJ 1HRV2 5L7OC 1RUJ1 4Y4YA 1VBE2 1BMV2 3JD71 4AEDB 2GSYA 1PO11 2RS12 2R062 2MEV3 1RUI2 1POV3 1RUD1 1OPOA 2RMU3 1HX6A 1VBA3 4RS5A 2FZ2A 1V9U2 4CEYA 1HRI1 5CFCA 5JZGB
chains in the Genus database with same CATH superfamily
3KVAA 5EYXA 1RGSA 5BNNC 5C71A 2D3SA 5C5TA 2WZPP 5IK4A 1AUYA 3VUOA 3RFRA 3ZX7A 4IGPA 1X7NA 1UY0A 2VJXA 1GOFA 1URXA 2Y33A 3EMRA 4JZRA 3JZVA 2J1RA 2PYTA 3IDBB 4WVZA 5T5JA 3H9AA 2RS51 1VBC1 4QDSA 4KBBA 2Y6JA 1ZBE3 4JC1A 5F3CA 1W8NA 5JOWA 1VR3A 3KT4A 5IHRA 1LAJA 3IWZA 1X9TA 4MHRA 4UOJA 5FDBA 1LODA 4TYSA 1ENXA 1YQ8A 3I49A 1O6UA 1V6KA 2XXZA 1UOFA 1KGYA 1AXZA 4ZZ8A 2O8QA 2OS2A 3D3AA 4R4ZA 3VDCA 1C8M2 2VL4A 4RS5C 1KFXL 1US2A 3DL3A 5CFCC 1W3VA 3H3UA 4LBOA 1ND2A 1ZREA 3JU9A 2D6LX 3UT0A 2PHWA 4K6BA 1TVGA 4GKYA 4S2FA 2OUHA 1FXZA 4IEOA 4YGDA 5ACA1 1HRV3 1ND2B 4FPGA 3KCCA 1WCUA 1W90A 1KRIA 4G4FA 5A6XA 2JG8A 1PMJX 2Q0AA 3LA3A 4YW2A 4FOYA 5CKNA 2VZQA 2JKXA 1W6OA 2P3JA 3CJXA 1JOPA 3CNAA 4BQ3A 2HWD2 1HV1A 1JZ7A 3ZMOA 3I2IA 5DG1A 2DCKA 2JG8B 3TYJA 4QPGA 2Z42A 3N7JA 4OZOA 4BQXA 4D7SA 4LPLA 3OGSA 3J9SA 1CR7A 1W6OB 2VMIA 2NQYA 3M3QA 2FZ1A 1R092 1ZZ9A 4LNVA 3ZIXA 5F37A 3AVRA 1O3TA 2GC1A 3ETQA 4KU8A 4WZCA 4UAPA 1UY2A 4QPGB 1NCQA 4M4RA 5EPAA 4S2HA 5IK7A 5KHJA 2K0GA 3CO2A 1UX6A 4QGMA 3ILNA 3LGRA 2FHRA 4TZDA 1W9FA 4CU6A 2ZA9A 2Y6HA 4BZ4A 1NCQB 2ZEZA 1POV1 2YC2A 2WR9A 4NE9A 1QJFA 3WF2A 4DS0A 1S0DA 2XHKA 5C3PA 4BK4A 3AP9A 4BXFA 2XB6C 2JD9A 4COZA 2JECA 1MS8A 1K5MA 2BNNA 2ZZJA 3RWKX 1RUC1 1AHSA 3FL7A 3PVEA 2CL2A 5G04L 5C4WA 1BXHA 1UY1A 2CV6A 4WM8C 1FMD3 4Y3OA 3ZPOA 3ZO0B 4PIZA 3UYJA 2EF6A 1W6MA 2ZGMA 1K5MB 1GQGA 4BMEA 3O5SA 3VKMA 2D3RA 4AVTA 1DGRA 1O4YA 2I2SA 5C4WB 1OF3A 4XDOA 3KS7A 1FV2A 4JRAA 4PDWC 5LEKA 2RG4A 1W6MB 1JUHA 4HONA 4KG0A 1UPIA 3LEGA 2RS33 1Q43A 3GGLA 3I2HA 2K46A 5FMOL 5I0SA 2AREA 2QQWA 4OI2A 3ZXLA 3HWJA 3KMHA 5KC6A 2LUWA 1QQP1 4W4ZA 4XAAA 1YHFA 1WKYA 3BALA 4NHYA 3DN7A 5FCCA 2KR2A 5FKBA 4CDWC 4M4PA 3LPGA 4HVRA 2VVEA 5A1AA 2BFUL 5I8SA 1UL9A 2QDRA 3ES4A 5JDBA 2QQPA 2JDNA 3H1YA 3N35A 5ISLA 2GC2A 1IPSA 2HBUA 2HLEA 3KB5A 4AEMA 3PJQA 5IVYA 5AFBA 2X53S 1F5JA 1BBT1 3BCWA 4JDOA 5G05L 1CX1A 1AYM2 1GQHA 1VBE1 1V6MA 2YHJA 4Q8LA 5DZEA 1GZTA 3B5LB 5GZDA 5HV4A 3N9NA 1JOBA 3HOBA 4H7LA 4JDMA 1W39A 1GZWA 3WQ1A 2PXJA 1W8WA 1MZFA 2VBPA 2A5ZA 1SMVA 2FMYA 4NRQA 4DY3A 5HBAA 4CU8A 1UNBA 2XVKA 1QJX2 2WFPA 1REFA 2WFF1 3ZFEC 4YZ3A 2W95A 1D0GA 1F15A 3BB6A 3T2TA 1WBLA 4QB1A 4A41A 3W21A 5BUVA 4LR4A 4LHLA 4QGLA 1F31A 1OVPA 1U12A 3OCPA 1W9WA 3VKOA 3H8XA 4AE2A 2VOKA 2XLFA 2JXAA 2QUOA 1PO21 4EN0A 1F2NA 3C3VA 2BYVE 1V6NA 4OYUA 2XJUA 1RYYA 2R073 1PNFA 4ES9A 2VOTA 2WQ4A 3PUQA 4FTBA 4KI5M 1REEA 5LBBA 5JZGC 1TME2 1PIV3 3AL5A 2F6BA 1GP6A 3GCXA 2WT0A 3A4UA 1IKQA 4B4QA 2DCYA 1I3HA 1VB2A 2RDSA 5FYYA 1W0NA 4CDQB 2P3IA 5FBJA 1VRH2 1ZBA1 4XF1A 2YGLA 3C8XA 5A3LA 3P6BA 1YNAA 2H6BA 4HOOA 4YZ4A 1YLLA 3VBRC 2RS52 2WSVA 2YYOA 3NL1A 1LRHA 1LHNA 1QJY2 2WQZC 4N43B 5JXGA 4CDUA 2FDIA 4O65A 5A6QA 3U1XA 1V0AA 2Q30A 1V6JA 5FYCA 5FREA 3H7YA 5FZFA 2PHUA 4HVOA 3LB9A 2IXKA 3KLSA 4A7YA 4CDUB 5JPMB 3M70A 2ZXQA 4EE2A 4WVMA 3WF0A 2CGOA 4NAOA 2VBDA 2W39A 1PZ7A 4AEJA 5C6CA 1IS4A 3RDIA 4Q4W1 2ZTNA 4MGYE 3U14A 1T2XA 3POJA 2YROA 1AR73 3EHKA 4Q4X3 2MPFA 5FZKA 3PUHA 3AZXA 5F39A 1LGBA 1JZ4A 1NA1A 4CU9A 1REDA 1RHI2 4RGAA 4WVMB 3WW3A 4NPMA 4FFGA 4A44A 3GHNA 5ACA2 5FXXA 1AXKA 2A3WA 2VXRA 3ZYIB 1O4ZA 1NA1B 2B46X 1G9AA 3D0SA 4Q4Y2 5A7SA 1OURA 4QHOA 2WZR3 4MGZE 1PX3A 5CAZA 4Q1PA 1S2EA 2G1MA 3IAQA 4CDWA 4FPHA 4BXSV 1D4M1 5B4XA 4CDXC 3Q8CA 1PM7A 4BHPA 2ZGQA 3LKJA 4AEKA 1IZ3A 3J8F3 4KU7A 1LESA 5A80A 4PLOA 3LZZA 3WQ0A 1NCRA 2QQJA 1S0IA 3VN4A 3ZVXA 2JG9B 4LXLA 1QJEA 3B9IA 1LJ7A 1C1FA 4UF0A 4BISA 2GMEA 3HMYA 3I3QA 4QM8A 2VG9A 1GWKA 2IUWA 4Z8BA 2H0BA 1OUSA 5FO7B 2W0XA 5FY5A 1NCRB 1B35C 1WMEA 2B39A 1OLME 2VR4A 2D6OX 2XJTA 4IXLA 5FLIA 4YYOA 2C26A 4XOGA 4UF0B 2LS6A 3W5MA 1Q5OA 3PMSA 3GALA 1YQ6A 1SLCA 1RB8G 4S2GA 5GZGA 3V64A 2DYCA 4RR3A 4CP1A 2VCAA 4Y33A 2A3YA 4BQYA 3MEPA 4QXCA 3MICA 3P3PA 2I07B 4CP0A 4E2GA 3O12A 4E8CA 4Q4W3 2OW4A 2ZHLA 4RR3B 5BV6A 2VULA 1NOVA 3ATGA 3F2ZA 2Y60A 4ZS2A 4GH4C 2E26A 5AC91 5GJ6A 3OGGA 1WW6A 5T55A 3LA2A 3ZMNA 1DZRA 5FQ0A 5IJRA 3POWA 4RQPC 4XTMA 2BWCA 2CWSA 1V6LA 1QQP2 3SH4A 1G9CA 4LBJA 5FP7A 4PI2A 2R061 3NQHA 3D0JA 1R083 1DG6A 1GMMA 2QQNA 2CWMA 2JIJA 3NKGA 4LIVA 3AFGA 4LEJA 5FQ0B 5H9PA 3T08A 1TG7A 4IGOA 3WNLA 1QMJA 2AYHA 3FMGA 1ZYBA 5CZKA 2Y6GA 3AJYA 4D7TA 2CYFA 3WF1A 3N9QA 1L7QA 3EB7A 1XNTA 4TLGA 1LEMA 3AP6A 3CF6E 2XBO1 3TB0A 1BBT2 4AFCA 1UIKA 1PNGA 4LBLA 2H0VA 4Q26A 2HWF3 1QDCA 5HXVA 1I9RA 2ID4A 1AXYA 4NUBA 1O5UA 1GNHA 5A7PA 2ZBJA 5D1IA 2RJ2A 4FPOB 3FLRA 4W8JA 5DG2A 2GP3A 5KR7A 2O1QA 4OCTA 4LKFA 5IAVA 4G3YC 3O1TA 4EYUA 2P6HA 2WFF2 3WNKA 3ZSEA 3IBMA 2R32A 4HKWA 1Q3EA 2YFUA 1HB3A 4IESA 3WV6A 4IDZA 2IXLA 4I09A 2WNUC 1GWMA 2XONA 3HNYM 4LITA 5FYSA 3S6PA 4CEYB 3HBKA 1PO22 2QQOA 4GZ9A 1YWKA 2BJSA 5FJKA 4D94A 4RHV3 4RN5A 3MIFA 4PF5A 2BW8A 3A0KA 3T0DA 2EXIA 4FPJA 2NN8A 5LATA 3WHTA 3MF9A 2OQ7A 4PI0A 1AYN2 1YIPA 2HWB2 1HQLA 2JIGA 1CIWA 1UD1A 2YPDA 3ABZA 4K20A 4OZXA 4Q27A 2RHPA 4MYEA 2OVUA 3DPRA 1EV13 2JDPA 3NAPB 1ULGA 1UOBA 4BDVB 1YQCA 3OYWA 4EWDA 5JSPA 3BTZA 4K3UA 1U5YA 3TBDA 3KWVA 4FOQA 1AR93 1PVC1 3AMQA 3DPRB 5HV0A 1APNA 1Y43B 4WVVA 3JBG3 4PJYA 4RSUA 3RYRA 1JW6A 2ES3A 2Q8OA 3ZXGA 1ONAA 5FZ3A 3C7GA 4NWVA 4C1XA 5KXEA 4LK7A 3ZN5A 3OBAA 5EZWA 5FXWA 2ZX3A 3JD73 1X36A 4OULA 4OVEA 1PO13 1H2KA 3NNMA 4I3PA 4OHXA 3EJKA 2ZGKA 3KF5A 4E2SA 3NJZA 3KHCA 4I30A 2GNMA 3ACFA 1RUD3 5JXJA 2W46A 5CFDC 2RE9A 2G4IA 4YG3A 5IK5A 2RR11 3ACHA 1U5XA 1VB4A 4Q4V1 1OH4A 4NHLA 4P00B 4Y22B 4CXWA 3MIHA 3H8OA 2AR6A 5DDJ3 1UXXX 3KVBA 4FFIA 2A1XA 2WABA 4QQPA 3VDAA 3O1VA 2JJ6A 3A22A 2YG0A 2R041 2W1QA 5L9VA 3ASIA 1CAVA 1XYNA 5FZ9A 2ZX4A 2BRTA 4P9JA 1GUIA 3LD8A 5FJHA 4E4DX 4FTEA 4FP3A 2JE9A 3IDAA 3Q8AA 4ZS3A 5K0UA 2VMFA 3UETA 5HPOA 3MO4A 1XOYA 1BEV1 1VAMA 1W9SA 2PQSA 1D4M2 3GCWA 3OOXA 2RMU2 4HL0A 4XHXA 4YGBA 4MGSA 4CU7A 3RZMA 5FZBA 5F9TA 1W06A 5LWBA 4Y26A 4C1WA 1S2KA 5K0UB 1RUH1 1UN1A 2WS91 3AJZA 3O1SA 3GBWA 1N1VA 2JDUA 3LFIA 1QXJA 4LLFA 5BNOA 5IATA 2UYAA 3LSDA 3IDEA 3NNLA 5JR7B 4GWIA 5L7OA 1TE1B 4CUBA 4HBNA 3ZXDA 3WD5A 3HQUA 4E2QA 1S0CA 4IQPA 1ZM1A 2B8MA 5BNOB 2WINB 1YUDA 2XUEA 3EQEA 4QQLA 3VB9A 3LOBA 2VVDA 3A0NA 2QZ3A 5JUVA 3C7EA 1F5FA 3PUAA 5FZ7A 2GALA 3B94A 3VBFC 4AQTA 1QJU2 4CEWC 2WT2A 3AB0A 5FY1A 1QEXA 5KHHA 3ZR6A 2BPA2 2WN2A 1RUF2 3TN92 1AR81 2A6VA 4K1ZA 3RZZA 1H6XA 1RUG2 3FBMA 4M3CB 2VUJA 3HT1A 5F3EA 2PLV3 4XBQA 2E63A 5AC92 1EP0A 4KNCA 3VBSC 1UOGA 2F4PA 4QAWA 2ORXA 1ZA4A 2JE8A 3FUOA 3AP4A 1RUJ1 1Y9QA 2DTWA 3P5BA 3B3QE 5LY1A 2RVAA 1W05A 2ARXA 5DXDA 4GD4A 2DVFA 2R062 4QX5A 3M1HA 3C7HA 3X29B 3E6CC 3PTYA 4XUPA 2GH2A 1IQAA 1S2BA 4YPJA 1OKOA 5FPUA 4AVAA 5JCTA 1V9U2 5JIAA 3KV5A 4P9GA 3CDZB 4XURA 1ULEA 3VBHA 1LCLA 3LDRA 4LO6B 5KHGA 4OI1A 1WD4A 3CU7A 3S5QA 2X09A 3LE0A 5FZ4A 4KMQA 5KXCA 1HXS3 2GAUA 4PCRA 5I91A 1VBD1 1J3RA 5CIRA 2CU5A 4IEUA 2Y0OA 4Q29A 4I0AA 3RGBA 1JZ2A 5FZDA 2JENA 1K3IA 1WCQA 3U11A 5FUPA 2ZEXA 1Q56A 2ZGPA 1DGLA 5FXZA 2VBBA 2VMEA 2DU0A 2XOMA 1H30A 3GBGA 3E6BA 3KM5A 1RMU3 5ABJA 4GMP3 1ULFA 1K5JA 2ZEYA 5FPZA 4DNYA 5FV3A 4E4SA 1FPN1 3PDQA 2IWGB 1I1EA 4ZU5A 3I3EA 4IEQA 3SMHA 2DURA 2XR4A 5CBLA 2W52A 2PMWB 2WDBA 5FPLA 5GLWA 5ABJB 1FOD3 1MR5A 2YMZA 4ET7A 1KS4A 3I3BA 2PHDA 4EV0A 3WG1A 4QB6A 2BUKA 3THDA 1RUJ3 1H2LA 1COV3 1H1IA 1RIRA 1C1LA 1UMHA 2Q5TA 5JOXA 1PM4A 2FBEA 1FAYA 1XRUA 2FDHA 2OYZA 1UZVA 2DDUA 4LE4A 2O14A 4YNIA 3WQ7A 3WUDA 4BU2A 3POSA 4AXOA 4BQ2A 5KWRA 1S1AA 1KXGA 3ALQA 4KL1A 3UGGA 1RJ8A 5A7NA 1STMA 4HSLA 2XQXA 3BTAA 4GULA 3WNMA 4Y5SA 4UWDA 5F1RA 1W04A 5IVJA 4DUXA 1ND2C 1DQ2A 2BERA 2IFRA 3W20A 2KD7A 4QMAA 2AH2A 3AKQA 2VTXA 2K9ZA 3WZ1A 3VBUA 3TEZA 1XNCA 3I3MA 1SDWA 4AFBA 2UWCA 3S30A 4U2AA 2JG8C 1CAWA 2P6CA 3BOWA 1VBA1 1LOAA 4L92A 2ZS6B 2RR12 5FP4A 2EICA 5A7WB 3VBUB 4F7ZA 3HQRA 1XYOA 3U37A 1QOSA 1Q8OA 2W3JA 2A6WA 2Y26A 1JBCA 3EBRA 3OEAA 4R4XA 5K7PA 3ILRA 4RL7A 2J1SA 4QPGC 1CAWB 1AX2A 1W2TA 5FYBA 4AVBA 2DF7A 1HB1A 4OI4A 4BJ0A 3LF7A 3WHUA 4JV4A 4GB33 3LIGA 4LKEA 1MACA 1NCQC 3GZTB 3MGUA 1H1MA 1CAUA 1ZBE1 4YG6A 5FWJA 2VY0A 3ZYFA 4DEVA 1QDOA 2VMGA 2VUDA 3CEWA 3VLBB 3VDBA 4EN9B 3E5XA 1RUH2 1SFNA 2WS92 1CAUB 4NHMA 1NXD1 3JCIA 4XUTA 4JHTA 2BVBA 1XE0A 3ROUA 1POV0 3N3HA 4XJZA 1KFUL 4XILA 4HLTA 1NUKA 1Z7S2 1K5MC 4IERA 4NMIA 3SH3A 5LCWL 2C0ZA 1R093 4AEDA 5C4WC 1DIWA 5LW9A 1HRV1 3NJYA 5KC5A 4CTEA 3T4VA 3M4FA 3WVJA 3ZFFA 1BMV1 3KSCA 3LDKA 2QQLA 3OG2A 3WQBA 1PK6B 3K46A 5E8AA 2CNAA 2WO7A 4XFFA 4PIYA 2BEOA 3SC7X 4AVSA 2VC9A 2ZAAA 1O91A 2Y64A 4OQ9A 3SEPA 1JN2P 1GYKA 2B7YA 1AR82 3R0RA 3ZFFB 5FZOB 5H9QA 2PHFA 3ZXFA 3H42B 4AGVA 3KD4A 4AI9A 4N9IA 4IETA 4EWAA 4Z2WA 3PHMA 2XJQA 1LKNA 3R4SA 4AOCA 1UAIA 1FNYA 4L2NA 4OMCA 2OPWA 4EWEA 2DTYA 3AYCA 5CNAA 3ZDVA 4JHZA 5LA0A 3AVSA 5A70A 3IAPA 3LA7A 4CCKA 1WLWA 1GNYA 4IEYA 3CIHA 5FYIA 2HEYF 3OY8B 3U0ZA 3IT8A 2SLIA 1WMFA 1LEDA 1KDMA 1TMF2 1GWLA 1W2AX 2Y6FA 4HN1A 1JMUB 1WBFA 2AUYA 4AVCA 5LRRA 3RJ2X 3ST7A 2VZOA 3BU7A 4Q5OA 1X9PA 4Z92B 4XAEA 1Q8QA 3OGRA 2JDYA 5JSOA 1PVXA 4JKMA 3PUSA 3HN3A 1AR62 5A3UA 1VAKA 2P17A 3L2YA 4DQAA 4UW3A 1XB9A 3D8CA 3B7MA 1FMD1 4J6GA 1VRBA 3R4DB 1OXCA 3HN1A 1RUE3 2ET1A 4QD2A 4K1YA 4XETA 5IVEA 2J42A 1AL21 2A7AA 4QPIA 1NLSA 2VUCA 2LRPA 1O3RA 4NHXA 4P9IA 2DCTA 1WLCA 1UW8A 2GC3A 4IE6A 2MHFA 3FFQA 5EV7A 5IFTA 2RS31 4QPIB 4HPKA 2WA4A 1ZX5A 5F2SA 1ULCA 4Q8KA 2EIEA 2RS13 1YQ2A 2VTFA 1RVF2 1BYHA 3KCYA 3ILFA 2EXJA 3GXUA 3C7OA 3D6EA 4HPKB 1A3KA 2XKOA 3OUJA 2BOIA 5BY5A 3AK0A 1Y3TA 1YJKA 5DUUA 5F2WA 5T54A 2G9FA 5C8CB 5F5QA 4N43C 1E57A 4OHWA 5IT6A 1XU1A 4NIDA 1GANA 4XFHA 2DWRA 1Q8PA 2YZ4A 2Y0IA 5TSWA 1KS5A 2VZPA 4MVTA 4DXTA 5FUNA 3SCFA 4COVA 4CDUC 1JHJA 4YVWA 4DXRA 2WT1A 5ANQA 3UJOA 1CZTA 4P14A 4ORFA 4CA9A 1UZZA 5JWPA 4HZFA 1ASJ1 3LSEA 1QJZA 2A3XA 4UW6A 1JZ8A 3VZLA 4YARA 2YC0A 3JXSA 1RITA 4YVWB 1QF3A 1LOBA 3ZFGA 3VGIA 1AJOA 1TME3 2E7TA 2UU8A 3R05A 4HKLA 4LUKA 4XF9A 3T2QA 5APAA 3VZNA 3T2OA 4K40A 2Q4SA 2UWBA 4QX3A 2P1BA 1XNAA 1MZ5A 2CDPA 2VQTA 2GNTA 2ZPXA 1NA1C 2YDEA 3ELNA 3ZFGB 5FY8A 1VRH3 1AL23 2VE1A 3AM2A 3HVDA 1UF2C 1DHKB 2VQAA 4CSWA 3GZAA 2D6PA 3UK9A 1ODMA 1QJY3 1IOAA 2R071 4NVPA 2PHRA 2WAOA 5D8AA 2IVJA 3NO8A 4EN8B 1J1LA 3OPWA 1HIXA 3GJBA 3FHQA 4JGZA 1PIV1 2WN3A 4META 4Q0PA 3I2GA 5LY2A 4EQVA 1JYXA 1WMDA 4ISQA 2BNOA 3S57A 5D8AB 2D5HA 2IXHA 1OOPA 4J1XA 3D4KA 1J84A 1DZTA 4JGZB 4FFHA 2VZUA 4FPYA 1OH3A 5LB6A 1NCRC 2IXIA 5JR2A 4X6RB 5FY4A 3RNSA 4W65A 3RPQA 3TEYA 1ZBE2 2QQMA 1QH6A 5JVVA 3ZKYA 1HJGA 5IFPA 1OOPB 5E1RA 4BB3A 3W58A 2OIIA 1X8EA 3JUUA 1NE6A 2DVGA 2V09A 2VW0A 2BOJA 4FI9A 4J25A 4QT6A 5FYMA 5J7MA 4Q4Y3 1BQPA 5FXVA 1M4WA 1W8HA 3BTXA 1QIQA 2HWE2 3AZYA 2BGCA 5FOBB 3CBNA 2WBKA 3IN9A 3ZSLA 3AKRA 1ASJ3 1GZCA 3J7HA 1AR71 4Q4X1 3T09A 5GLVA 4RR3C 3IDCB 3W59A 4CCLA 1AZDA 2I74A 4KBZA 4OUSA 5BNPA 5BNNB 4NN0A 5JMCA 1S0EA 4FOVA 5LASA 4GAZA 2P34A 4MSVA 3UKTA 4QU1A 1FI2A 1H8TA 4DB5A 1DF0A 3F95A 3HNBM 1D2SA 4IEZA 2WO3A 4LBQA 1RJ7A 1UWWA 5LZ6A 2GDFA 3FN9A 1W6NB 1SLTA 5BNPB 2DCZA 4BM8A 3AL6A 2WZR1 2LM3A 1LOGA 1LOEA 3ORJA 3SXWA 4K8FA 1WD3A 1H8TB 1ZA7A 1NXMA 3BPZA 4HXCA 4JQTA 4LBQB 5T5PA 2Z79A 4MXWB 4AF9A 1LTEA 2VCBA 2BTVC 1X33A 2EXHA 3NRUA 1HRI2 2Y34A 5FAXA 4CDQA 1NT0A 3J8F1 2C6SA 3AKSA 2FQPA 2X5IA 3VL8A 1CJPA 1H0BA 1LOFA 4O9EA 1W8FA 5CKMA 4N43A 4RS5B 4MADA 1PX4A 5BYNA 3I59B 5FTTC 3ZYHA 1KD7A 3B00A 2YBKA 3H3LA 5LA9A 1VMFA 4XCAA 2X5IB 2FCVA 2Q1FA 2VW2A 3UKNA 3WX5A 4B4PA 2LTNA 4I3GA 1VBC2 1TZOA 3QH7A 4R9DA 4XEZA 5DAWA 1JOJA 5FYTA 3RMXA 4DINB 4LULA 3GJAA 4E4ZA 1M06G 1W0OA 4Y20B 4YW1A 1W8ZA 1WMXA 5IVCA 3B93A 2DUPA 4IV3A 1YO8A 2R0FA 3N9MA 5F5CA 4ITCA 1FMD2 5LEJA 4K8RB 1VIWB 2HWC3 5KHKA 4U36A 1NZCA 3THCA 2XMLA 1CQ9A 4IEXA 4XF3A 3POYA 1NLRA 4IV3B 3O1UA 3USUB 4V2WA 1J3PA 2ENRA 4P9XA 2KA3A 1FX5A 1UIJA 2XJPA 3QLQA 2AZ5A 1SPPA 4XXAA 2FCTA 1OD3A 3QBQA 2KM2A 4FQZA 5FZ8A 1HQWA 2QJVA 3NAPC 4XCBA 4XUOA 5FZHA 4AYUA 1R081 2F17A 4V1PA 4XQWA 1SPPB 4B1MA 4MOAA 4Y1UA 1F35A 5DAQA 2HEWF 2JG9A 1XYPA 2VMCA 3FHIB 3DPRC 3WUCA 4DRRA 3K75B 1DDLA 1ZRFA 2YUEA 3J26N 2E6VA 4LBKA 1DGWX 1J59A 3K4AA 4LKDA 1YFUA 3GDBA 1DP0A 4RD7A 2A75A 1J83A 1GSLA 3NVCA 4M3CF 2W92A 2HWF1 2R49A 4WM8B 3O0VA 5IVFA 1MQTA 1XSRA 1N3QA 1QNWA 3MZHA 2PAKA 3CKHA 4CP9A 1O5LA 2FMDA 3WW2A 4B3NA 2MEV1 2QKDA 2BQPA 2R6QA 4KGGA 4COWA 1VBB3 4EZHA 1W03A 1MQTB 2HWB3 4FSJA 2GMPA 4CP9B 1FV3A 1HB4A 2Y6LA 4QKNA 4DUWA 4JAAA 1ULOA 2Z2SB 1RUC2 1ULDA 3NNGA 4GWNA 2FDKA 4O7XA 4QHBA 3SEEA 3O0WA 2J1UA 1XNDA 2VOWA 1GOGA 1PMIA 3RZJA 3TEWA 3BU0A 4RHV1 3SCHA 1XC6A 1A78A 3DUIA 4XF4A 5E6HA 4F83A 3VHRA 2R072 5T5OA 2PHLA 1Y9MA 4MGQA 5ERLA 1ENSA 2B9UA 5DUXA 4FAGA 3HPNA 1I5PA 1QKQA 1SBEA 2P4EA 4YW6A 2VH9A 4ZONA 5FZMA 4UT5A 4AVVA 5K0UC 1EV11 1PIV2 3B02A 2OT7A 5FWEA 1D7PM 4XJWA 1YFYA 3MFCA 3U75A 4DZGA 2QVSB 4QB2A 2G19A 2OX0A 5FPVA 4HMZA 2GN3A 5SV5A 2IVIB 5ANNA 1O8PA 2BV4A 4EROA 4A4AA 1AR91 1YI7A 2ZCWA 1UMZA 4XUQA 4CP2A 5C7GA 3OUHA 5K4LA 4KWUA 4X6QB 4WVWA 1BK1A 3U4XA 2ZGNA 4OHYA 5BXXA 5BNOC 3JBG1 5FMBA 3WDTA 5FRAA 4QX1A 2B9VA 4BYYA 2L9LA 4MXVA 5L7OC 4GJYA 5HCBA 1XXNA 4Y4YA 3QD6A 1VBE2 1SG3A 4QKDA 2XJSA 3NNJA 4YGCA 5FMCA 4YZ1A 3JD71 5CEHA 1OPMA 3MIGA 1PO11 2A73B 4GIQA 1U0AA 2D97A 2Q1ZB 2MEV3 4NIGA 1RUD1 1SLIA 4A3ZA 4YFZA 1IPKA 1OPOA 1W8OA 2D3PA 1JYIA 3SKVA 2RMU3 2WIIB 3AFKA 5B2GB 2FZ2A 5FY0A 2ZGUA 4PQ9A 4CEYA 4IE5A 5JZGB 4AW7A 2BNMA 5DDJ1 2WO2A 3E1F1 4A2UA 1SBFA 3U78A 5FIXA 1WW5A 1JYWA 1C3HA 2EAAA 2PQQA 3AP7A 3SQOA 1JYTA 5F5IA 1UY4A 4H55A 3RQ0A 3WDYA 3J7MA 1EYBA 1XSQA 4FXKB 5DAXA 2WZR2 4AFDA 2X8KA 2Y6KA 3NAPA 4BE3A 2B45X 3WDVA 5FPAA 5KHIA 2V5DA 3BPSA 2A6XA 3OF1A 3T1MA 1UX7A 1AVBA 1H9WA 5CADA 5FO8B 1J1TA 1V70A 5GKAC 3ZYRA 3WSOA 4D3WA 1QJU3 3IIAA 4IEWA 4O9GA 4GWMA 4XMIA 1R1A3 4LMFA 3MPBA 1BLZA 1GICA 3VDDA 1G9FA 3LWCA 2DVBA 2Y8KA 1RUF3 5F6LB 1RC6A 1YFWA 1QWRA 2D7FA 5DAPA 3TN93 1ZBA2 1IS3A 2TBVA 5I0RA 2J1AA 3VBHC 2WA3A 4L0PA 5J1XA 1D2QA 4CCDA 1LENA 2D40A 3VDDB 3BVCA 5SV8A 5JI7A 5T3NA 1NQJA 1JU3A 2VZVA 4IEVA 4M0HA 2VNRA 4XIKA 3ZYPA 2WWSA 2VZRA 5EFUA 1UU6A 1OBNA 4D6QA 1JZ5A 2WUHA 2VW1A 1AX0A 5L9RA 4Y22A 1OQDA 4YM0A 1NKGA 4X8PA 4XE9A 2GH8A 5BNQA 1HV0A 1MZEA 4Y4RA 1E5SA 1YQ5A 4LHKA 3NSTA 4Q4W2 1T6BX 4HFSA 4NWWA 5IVVA 2PLV1 1V9U3 5ABJC 1DGWA 1IPJA 1D0HA 1T6GC 1AX1A 2RM21 4D69A 1I5ZA 1OD5A 1UCXA 4OMDA 3KT1A 1SACA 2WWJA 1KITA 1MEC3 3PIJA 1XE7A 4L11A 4OHVA 4UFHA 4AFAA 4AI2A 4A6SA 3KHBA 1HLCA 4L9BA 1YYNA 4XFBA 3OD0A 4I0WB 4YM3A 5DABA 1R082 2R7EB 5AVAA 1ZZ7A 5FO9B 3WNXA 2ADDA 2MNGA 3R6SA 4BWOA 3WINE 1YEWA 5HI0A 4NAMA 1XPWA 3T1LA 3DEMA 1JZ6A 4LK6A 3MLLA 5E89A 1H2NA 3L9JT 4FQ4A 4IEPA 4FPEA 1PGL1 5JIUA 1LECA 5LA1A 2W47A 3WXPA 2CHHA 2XL7A 1WGPA 2IFWA 5I0UA 2HWF2 2YFZA 1HXS1 5EXOA 3RWNA 4JTNA 3WP6A 1WA4A 5L36A 4GA9A 1R64A 1DZQA 3CMGA 4XJUA 4YW7A 1SEFA 2W68A 4N53A 3H1MA 5KXDA 2UWAA 4LHNA 5FY9A 3RZHA 1ZRCA 2BP6A 4GH4B 4RGKA 2XWJB 1UXZA 1GR3A 1LU1A 3MBWA 4GJZA 3I97A 3ZXEA 4CVUA 4NIAA 4PIXA 4FPCA 4N53B 2RV9A 4Z82A 3VBUC 4COUA 3ACLA 3POEA 3PUIA 4UFJA 4YLZA 3VZOA 2JDHA 1DQ5A 1H8VA 1W8UA 2D93A 2WRAA 3CJIA 1MS0A 4M3CA 3RVHA 1RMU1 1UKRA 2E32A 4GMP1 3KGZA 3FLPA 2DUOA 2E7AA 3VKNA 4CUCA 4A6OA 5JMOA 2VZTA 2SBAA 3GBFA 3JQXA 1EAH3 2FD8A 1OA3A 1UZ0A 4GQ7A 3CJIB 1CPNA 1JUIA 4HT1T 4QX8A 4RHV2 3KV9A 4I2OA 1FOD1 2HYKA 1X50A 3DKQA 2RM23 1IQDC 4Q0SA 1NY71 5EJ3A 4KG8A 1MS1A 1SHWB 2BDRA 3N36A 5C8WA 1COV1 1GFF2 3K4ZA 3W9AA 4Z1VA 1ZRDA 3P3NA 1RTVA 2HJIA 5T5LA 1ACCA 3G7DA 2ZGOA 4FPLA 5GLZA 3OSDA 4PHZA 3AMNA 1QH7A 5E88A 5IW0A 1DLCA 4RFRB 4QDRA 3HQXA 4QX7A 1RXGA 4TXWA 5HCAA 4P5YA 4IL7A 1E5IA 1OVSA 4XFAA 3BIEA 2E33A 3NNFA 1CPMA 4LBQD 2XBO2 3H3ZA 2ZGLA 2R1DA 4AR2A 2WNUB 1SCSA 2YBPA 4E9KA 4KQ7A 3O7OA 3BODA 1KJRA 1PK6C 3JD72 4AEDC 1W28A 5D2AA 3KZ4C 1OLMA 2WQ8A 5F8PA 3ZFFC 4YVSA 2PN5A 2JB8A 5B4NA 1R1ZA 3RS6A 4AHYA 2V5YA 2IXCA 1MS3A 4B4RA 2WSUA 1JYVA 1CX4A 5GM0A 1F9KA 3WP4A 4XYXA 5A3WA 4CRQA 4OUMA 4N7UA 5T50A 4GWJA 4INDA 2XPJA 4W6YA 4YVSB 3AZWA 5IWFA 3K48A 4UFMA 3LPFA 4ASKA 4YM1A 2CAUA 2W1WA 3E6DA 3DYMA 3CHXA 1Z7S3 2DV9A 4Z07A 4GB31 2E31A 2FCUA 2GNDA 1UZYA 3OBRA 1G9DA 1JI6A 1U5ZA 2VQ0A 1US3A 4BH9A 5CA6A 3APBA 4R9AA 4AGGA 3FUQA 1QXPA 4ZXEA 4LHSA 5EJZB 4UI9L 5DN2A 4XFIA 2YGMA 2ARCA 4EZ4A 3RZGA 1RUI3 2ZABA 4KWKA 3AYDA 5GZEA 2IXJA 2WL1A 1PVC2 3NV4A 4Q0VA 5CB7A 1R091 3HJRA 2VZ3A 5FZIA 4ZXKA 4Q0QA 2P3KA 3VD5A 1W2UA 1YXWA 2BGPA 2G9ZA 4HKOA 4QPIC 4XQDA 4LLOA 4A7ZA 3RI9A 2XLGA 1WCKA 5A7WA 2CAVA 4BIFA 3O1PA 2WZ8A 4LOSA 3T2PA 2RJKA 4NO4A 1OLRA 2PFWA 3SHRA 2GMMA 4AI3A 4LE3A 3LEIA 4L8QA 4NIIA 1A34A 1HB2A 4XPVA 4B7KA 1QOOA 1JYCA 1ALYA 3PVOA 3MUY1 4QPYA 2RDNA 1DQ0A 3ME2A 4Q4V2 2PLV2 1UZWA 3AP5A 4XACA 2VNGA 2VMDA 3I54A 4XXPA 3IB3A 1U5IA 2OKXA 3RG0A 5C8CC 1AR63 5C9AA 1CN1A 5I8TA 2VTXJ 4QQ2A 1F4HA 1CIYA 2OZJA 2ILMA 3LAGA 2R042 3NWKA 3POGA 1RXFA 3RZKA 1C8M3 2XJRA 3WNOA 5FZ0A 3DF0A 2NPIA 4SLIA 4C0BA 2V72A 5FZAA 1DLLA 5C9AB 4W6WA 2DBNA 4J1WA 3EYPA 3MIBA 4XBNA 1BCXA 4HSJA 2D98A 4CCNA 1EUUA 1BEV2 1BHGA 3ZXKA 1PZ9A 1W9TA 4B7EA 1JS9A 4AHWA 2XWBB 1PGL2 2JDZA 2JEMA 2W91A 4YVWC 3MPPG 3VBFB 2W94A 4B1LA 4CEWB 3ZYGA 3PNAA 2WNVA 3IZOA 1LU2A 2HWD3 2VVFA 1XNBA 1RVF3 2JE7A 4HETA 1RUE1 1NG0A 3LIHA 3ACIA 4XTPA 1F8VA 2QNKA 2ZAHA 1CD3G 3ZFGC 4UXAA 3POIA 3VD4A 3NKTA 2XUMA 2WNVB 3B01A 1PK6A 4KWLA 3WDWA 4UW4A 4JGYA 3ACGA 3WP3A 2J1EA 2WKKA 4YG0A 4AWDA 1GLHA 2OZ6A 1MVQA 5FZOA 1CVNA 1SFPA 3KQRA 1G8WA 3I3DA 4WBBA 3VBOA 2RS11 4KWJA 4RGGA 4NR1A 2C5DA 1UMIA 1YRZA 2IC1A 2V4VA 1FYUA 2B4KA 3K3NA 3DECA 4IGQA 4JGYB 5D8AC 3AC0A 5FZ6A 3K4DA 2EVXA 2PHXA 1Y7BA 4CXYA 4JGZC 1Y9GA 5A7OA 5FLHA 3VBOB 4QU2A 2QBXA 1N1TA 1HQNA 3SISA 3ZM8A 2TNFA 1H4GA 2EALA 1ND3A 2TEPA 2ZZQA 5HCFA 1NY72 3OY8A 1OOPC 4QXKA 1NE4A 3ZSKA 1RUJ2 3IKWA 1COV2 1KQRA 3C7FA 3DYOA 2FDGA 1WW7A 4LO8A 3AZZA 2NM1A 1ND3B 3ZYJB 4QKBA 1UYPA 1NYWA 2VQUA 5GLUA 2QCSB 2OQ6A 2VOVA 2XG3A 3FFZA 4MLOA 5A32A 4QGNA 4HN0A 4XFCA 1DYKA 3MW4A 5I8YA 4URAA 1A8MA 1LR5A 1BVP1 1GU3A 1TME1 2J22A 2VZ1A 1S0BA 4PF1A 3VV1A 3ZSMA 4BIOA 4TSVA 5A32B 1SZBA 2JKBA 4AHXA 1L3JA 3VKLA 3VHOA 1HN0A 1A8DA 2UY8A 1OA4A 3POFA 3OBTA 1VBD2 5C5UA 4BLIA 1VRH1 3GNEA 2Q8EA 5CU1A 2VZSA 4LTAA 5BNPC 2ZHNA 5JXHA 1S0JA 4JKKA 3AMPA 3N9LA 1SLLA 3WEZA 1TQ5A 1H8TC 3H8UA 4DXZA 1QJY1 3N7KA 4RYDA 3UJQA 5EQUA 4F3JA 1DQ1A 4YW5A 4Y1VA 3LOIA 5LA2A 5A3MA 1AYM3 1VJ2A 4MHUA 2ADEA 3OPZA 1OA2A 1W6QA 4FO9A 4HVQA 4N9HA 1CJDA 4CPBA 4QM9A 3DKWA 1H2MA 3KV4A 5C8CA 3O1RA 1FPN2 3A7QA 2HWE3 3Q8BA 1N3PA 4CDQC 2C4XA 3AKTA 2W2IA 1QJX3 2X5IC 1W6QB 4LUMA 4Y5Z0 1RL3A 3M3IA 4GB32 1BZWA 1LOFC 4WM7A 2VMHA 1RHI1 1GV9A 2YU1A 3MV01 2D44A 3IM0A 4MV2A 4P5HA 3WF3A 2XH6A 4DO0A 5KBFA 3WF4A 2GP5A 3NW4A 1S55A 1ULPA 2VOXA 5DZGA 3UESA 1ZNPA 2F4LA 4CCJA 4N90A 2H6CA 5L73A 4E8DA 4WM7B 5CG9A 1DFQA 3OUIA 4Q4Y1 4AZZA 1G9BA 1OT5A 4XBLA 1UYZA 4NOTA 5AVPA 4AQ2A 5IYYA 3DXUA 4ZPIA 5FK8A 4IV1A 5FBZA 4DFSA 4P02B 4IV3C 5FZGA 1HRI3 2BBAA 4AAPA 2TUNA 3M2MA 3MF6A 5F7UA 4P08A 1LHWA 3P1IA 3PU3A 1W2NA 1DYPA 3I2FA 2VO5A 2HBTA 4IV1B 2WJSA 5DPNA 2OA2A 1LGNA 2EIBA 2R30A 1GP5A 2B5HA 1BJQA 4NHKA 4YW3A 1GZ9A 5F32A 3VHPA 1QGLA 4QX2A 2NLRA 4GKXA 5CYYA 4HG6B 1DU3D 4UFLA 4XJ9A 5JXIA 2GU9A 1VBC3 2RS53 4UBGA 4C0HA 3Q8EA 1MVEA 3WG2A 3WNPA 5IK8A 1G86A 1W3XA 3SLIA 1VBA2 5GALA 2NYYA 2ZX0A 2GC0A 3AMHA 2FDJA 4OUEA 5T52A 4YZ2A 2JG9C 5J3UA 3FJSA 3KCXA 5H9RA 3WY6A 2YY1A 5K9YA 2GNBA 2VCMA 2W87A 4FBFA 2DFCA 5I93A 4F8AA 2C9AA 2A70A 1RHI3 1C28A 2WWUA 4XABA 5DQ0A 3WNNA 2XVLA 4HK9A 3HD8B 4N7IA 1MQTC 3SITA 4ATEA 2R16A 4E4HA 5ACA3 5C33A 1IKPA 3ZXAC 3L2HA 1EPZA 1OQEA 3NJVA 4JVAA 1DYOA 1YI9A 1S4CA 1NAEA 5JLVA 4PLNA 2JB4A 5LBEA 2X05A 5AFEA 1S0FA 3H7JA 2YU2A 4IUGA 4ES8A 1AF9A 4LO7A 3J4UH 1X8MA 3AYEA 5D21A 2AEZA 4EN6B 5BNNA 2NMOA 1PGW1 1A6CA 5A1LA 2DVDA 2HWC1 3HIFA 1RUE2 3OEBA 4LIUA 4R9BA 4WV8A 4XC9A 2QQVA 4D6SA 2JICA 1O59A 1EY2A 1UPSA 3JB4C 1ENRA 3RYPA 4GALA 1W6NA 1IS6A 4NIHA 4Q0UA 3URFA 1WCDJ 3RYKA 1HRV2 1UYYA 4BQWA 4S2DA 2CSGA 5DZFA 3Q8FA 1BMV2 4PLMA 4MXWA 4H14A 1BVVA 2RS12 3AXEA 3WP5A 3VKFC 5KXBA 2N7GA 3E97A 1POV3 1SDDB 5A6YA 1C4RA 1GOHA 3M3OA 5EHDA 4DY5A 3NMBA 4RS5A 3UGFA 3I59A 3LQCA 5FR3A 5CFCA 4D6RA 1OKQA 1GZWB 3BYWA 3SNMA 3TOJA 2P3YA 3I2OA 3WR0A 1RUC3 3C2UA 2WC2A 2IZWA 4UW5A 1POQA 1WLDA 1RINA 2AEYA 2NMNA 4CE8A 1XJAA 3M8LA 4N8MA 5CFCB 2XGXA 4Y20A 2EIDA 4R52A 2A71A 3ZDSA 2EIGA 5A1FA 1N47A 1X82A 1E5RA 4AQSA 4BQ5A 1VBB1 4YZ5A 2GN7A 4UFKA 2YXSA 5F6KA 1AYN1 2HWB1 2AACA 5LRSA 1UYXA 5FP3A 5GZCA 3QCWA 4LORA 3K51A 1DGRN 1OC1A 4QQOA 3MW3A 4LO4B 1DQ6A 1QQP3 3IPVA 3M3EA 3USUA 2A6ZA 2E9QA 3GM8A 3MI8A 3BTYA 1QU0A 2I45A 1C5IA 2OPKA 4CCCA 2ZMKA 4CYDA 2C9KA 2YBSA 3OTFA 4DXSA 1VP6A 1OMIA 4CEYC 4XF0A 4FCAA 2VUAA 1AL22 1OI6A 5DUWA 3IPVB 2QQKA 2ZHMA 3GF6A 4XHBA 4QWNA 1HN1A 1ST8A 2HH9A 1W9YA 2Z5WA 2ZMLA 3RMYA 3AKPA 2CGPA 1BBT3 2RS32 1CZVA 4D0QA 1VBE3 5H9SA 4AG4A 3K3OA 1QOTA 1PHMA 2JDKA 4M3CE 5F3GA 3MV11 5EP9A 4M00A 3QOPA 3PMEA 3ETPA 3OJBA 1GKBA 1J58A 4QQHA 4YW4A 2DFBA 1UQXA 2YB7A 3CZJA 4AAXA 4DMIA 4C90A 2ARBA 3VD3A 1N3OA 2WAAA 2WYFA 2ZGTA 3MUZ1 4UFIA 5CKQA 4WM8A 1ZRIA 3T30A 5EYYA 2WFF3 4NROA 1OF4A 5DAVA 1H4HA 3UKVA 2NZ9A 4CCEA 3VDDC 5FFOC 4ARYA 3N9OA 4XFGA 4XDPA 3BOPA 4FFFA 1IG0A 2K2SA 4PDWA 1PO23 5A33A 2D6KA 2ZX1A 4CCOA 4ARXA 2W08A 2PTMA 1VLNA 4DOUA 1RUNA 3LEKA 2DVAA 3FWEA 3M7AA 5EWSA 1VMHA 4OLLA 4Y24A 4PDWB 4TLFA 1AYN3 4ASLA 1ASJ2 1OLQA 1K12A 1TNRA 2RMU1 5E16A 4B29A 5A33B 5JSRA 2QQIA 2AENA 5F3IA 4XZUG 5JI9A 2NP0A 2ZHKA 3WLUA 1ZZCA 5EIYB 4CDWB 2DBIA 2Z69A 4PBPA 2VXJA 1YIFA 2WNOA 5FP8A 4XZPA 1UY3A 3A21A 3FX3A 3UGHA 2ZGSA 5JAXA 4YWAA 1YC61 2VCCA 1V00A 2CGNA 1ZBA3 3HEIA 3VZKA 2OXBA 3TNPB 1GP4A 3NV1A 3K2OA 5A3NA 1MS4A 3O1OA 3TAYA 3PU8A 3ITQA 3PLQA 1SFYA 1B09A 3MIDA 4HANA 4P9WA 3V0BA 3AZVA 3BUCA 2P37A 1XNKA 4Z2AA 3ZFEA 4QDQA 1QJU1 1SBDA 4W6XA 2BZDA 1R1A1 4FPKA 5FPBA 4AFMA 4YSFA 4TN7A 2ET7A 3HT2A 3S7EA 3MHZA 5FZEA 3V0BB 2PAMA 1RUF1 3TN91 4ZKTB 3D82A 4CZSA 1VPHA 2ERFA 1RUG1 1WA6X 3HR9A 3KF3A 3ZFEB 1LB2A 3AYAA 4QPWA 2RDQA 4Y1XA 1FNZA 2ZGRA 1V6OA 3O14A 5C3OA 4H3WA 1JTZX 5FKCA 3SH5A 4Q1RA 4FOWA 3DXTA 1O7FA 3H50A 2G9GA 4QXHA 5JOYA 4Q2FA 3FHAA 4N53C 3S5AA 1H9PA 2AGSA 1WCSA 2YPJA 2ZKNA 2DCJA 3VL9A 3ZSJA 1BK0A 5JZGA 2QE3A 3JQWA 1PGW2 2HWC2 4OQ8A 3BIWE 1D4M3 1AR72 4Q4X2 1N1YA 2UY9A 2ZKLA 3CJIC 3ZR5A 1V9U1 4C8DA 2LW8A 4Y1YA 3FLTA 1GBGA 3T4HB 3RRDA 3VBRA 2C24A 4W50A 3WT3A 3ZXJA 4A42A 3Q9OA 1MEC1 1CWPA 4GMP0 1G7YA 2VAUA 1CGPA 3MLKA 3NJXA 2J1VA 1SQ4A 2D43A 3OPTA 3VBRB 2W9XA 5FMDA 2LALA 3I7DA 5A3TA 3I4IA 1F4AA 2PAEA 3CQOA 1UU5A 5LK5A 1N1SA 4R8HA 5J09A 3O0XA 1LHOA 2P2KA 4QHZA 3J8F2 2D5FA 3O1MA 1EPWA 1OHFA 1VAVA 3ZYBA 2WO1A 3ECQA 1XBFA 3OB8A 2HKXA 3QACA 1JH5A 4JQRA 1ODNA 1Z78A 3W5NA 2E7QA 4JDNA 4JCKA 5A3OA 4ASMB 3I2JA 1LHUA 1RUG3 3I2KA 5A7QA 3B9CA 4AI1A 3ZKUA 1NQDA 2QZ2A 4SBVA 1CZSA 5AC93 4AI8A 1VBB2 1MZ6A 3FC0A 4AI0A 2O0OA 3WCRA 4I01A 4KGQA 4RA0A 1NX9A 4TTGA 4LOTA 1P8JA 1D4VB 3HAGA 4CPBD 2VECA 2Z4FA 4CDXA 4BPZA 4H2AA 1LOCA 4I0BA 3N7LA 4YVSC 2R063 1CONA 5FOJB 5A6ZA 1XQNA 3UNPA 1EAH1 3OGJA 4CDXB 1WLTA 1IG3A 4K9SA 4NPLA 2JDAA 4V2VA 5C3SA 2J1TA 3DYPA 1LNSA 2ATFA 4LJHA 3OYWB 4GXLA 4FPFA 4XMAA 3INAA 4ZU4A 1B35A 4FAHA 2XBO3 4PBOA 2QFEA 4XVHA 4K21A 3H8RA 2VGDA 1DQ4A 1WUVA 4PT6A 3V0AA 1QHDA 1OFSA 3MW2A 3A23A 3GZUC 1DCSA 5HXMA 1B35B 1LHVA 1O3QA 1Z0HA 4ISRA 5FYUA 3AXDA 1IHMA 4QX0A 3V0AB 1MS5A 4LKSA 3NV3A 1HW5A 4FTSA 2KXLA 2CDOA 3H1WA 1W6PA 3BN6A 2UURA 4NRMA 5FMOS 2DU1A 3ZN6A 4ZY9A 4WZFA 2X10A 4AHZA 1VALA 4JX0A 1HJFA 1E5HA 4LQRA 3N4MA 1W99A 1WZXA 2WZEA 3LDBA 4GH4A 5FUIA 3RZLA 5DMYA 1W6PB 2BFUS 4TWTA 3ZN6B 5I0TA 5FK7A 3MFAA 3ZIWA 2JWPA 1ZZ6A 1FATA 2D6MA 4RQPA 3B69A 3PVBB 2MEV2 5F5AA 4NJ4A 4IE4A 4P9YA 5C70A 1TEIA 5IUQA 1CAVB 3THTA 3CLPA 3DV8A 3LCPA 3POBA 4MGIE 1J3QA 4C91A 2VM9A 1AL0G 3E5QA 4DIQA 2HEVF 4RQPB 5J36A 3S7IA 1V6IA 2D6NA 2OUJA 2WLQA 4BK5A 3U10A 4M0NA 3K77A 2XKPA 4D7YA 5IAXA 5DUVA 2QDNA 4L97A 5I0DA 3JB8A 3FE5A 2Y38A 2VD7A 4NPRA 1Z7S1 2V4AA 1PVC3 4XW3A 5C9AC 2J7MA 1YFXA 4XJ8A 3DCQA 1ZZ8A 2R1BA 4AGRA 4COYA 5L7OB 5FZLA 1UOJA 1SLAA 4MX3A 4DPNA 2LROA 4XIOA 3TWIA 4IW3A 3WW4A 2BU9A 1EV12 2QQUA 3BKZA 1ENQA 2B42B 2ZACA 1R1A2 1JODA 2CY6A 1HDKA 5FYZA 4CCMA 1EUTA 1RUI1 4LBMA 5JPNB 2JD4A 1OFNA 3IMMA 5HCHA 5L19A 4H7MA 1VE0A 1AR92 2C1FA 4YM2A 1UO9A 2WNUA 2RR13 2O8OA 3QH6A 4Q4V3 3GHMA 2WNVC 1QY4A 4HK8A 4AL9A 3JBG2 1XU2A 3SKJE 1MPXA 5IVBA 1PZ8A 1CAXA 1JHNA 2R043 3G6JB 4DEQA 3PTRB 4YFWA 2YV8A 2W1SA 3TRSB 2AC1A 1PO12 2RJLA 2W5FA 3GYDA 3N7MA 4ZU7A 4JGYC 4JTOA 1CAXB 4ZHNA 4RFT0 4BLJA 1TMF1 5GZFA 5C3QA 3LEMA 1RUD2 3WDUA 1NLQA 4ZZ5A 1BEV3 4JKLA 2ORZA 4BQ1A 1K42A 3NV2A 5CISA 3VBOC 1XE8A 3VD7A 2XHNA 3PURA 5DDJ2 1AR61 1RUH3 2WS93 4OHZA 1W8TA 1Y4WA 3PVNA 3MDPA 5FZ1A 3D5OA 3KV6A 1MEC2 3TNQA 1C8M1 1LULA 1S0GA 1IS5A 5FYVA 2RDRA 4O61A 3WW1A 4P9LA 1ND3C 4Y1ZA 1W2OA 1K45A 4G9SB 3VBHB 1QXRA 3ZOIA 2ZOEB 3AMMA 1PGSA 5FZCA 1MS9A 5FYHA 2XVGA 1NZIA 2ZJCA 1WW4A 2ETEA 2PA7A 3HNMA 4D8MA 5CFDA 2FDFA 3DGTA 1AJKA 2W1UA 3S0MA 3WDXA 1VMJA 4BA6A 3LFMA 2GZWA 5M0TA 5C3RA 2BGOA 5LK7B 2HWD1 1L7RA 1RVF1 4FXGB 3UV9A 4XUNA 3WOGA 3KQ4B 5CFDB 3ZPYA 1AR83 1UU4A 2VNOA 2EXKA 5A3PA 5LBCA 1C8NA 2EA7A 1I6XA 4X8NA 3ZN4A 5CG8A 3OBZA 5J96B 1SLBA 1G6NA 2P5BA 3KT7A 3WG3A 2DUQA 1W0PA 4ONUA 3RJRA 1OUXA 1SCRA 3I2DA 3V56A 4LBNA 1H1AA 5FPXA 1OSGA 5EJ1B 4BCUA 4IE0A 4BOWA 4A7KA 4CUGA 2VU9A 3T3YA 1TMF3 2BWAA 4MG2A 3ON7A 5J37A 1EAH2 1C57A 2XQRA 4QXBA 3VD9A 2XL9A 2WYSA 4URTA 2VNVA 1BKZA 4CUAA 3BGAA 5J48A 2Q8DA 2QTWB 4JRLA 4MO3M 2RM22 4MZUA 2PHTA 1LGCA 2UYBA 3GZEA 3EXUA 3KGLA 2XJVA 2JDMA 3ENRA 3WG4A 1ZVFA 4FP2A 1C5HA 3WCSA 4YRDA 4WM7C 1KEXA 1VBD3 2XDVA 3J7NA 4BQ4A 3IIIA 1ZRRA 3HBZA 4UYBA 3THPA 2ZX2A 3FZ3A 3V65A 1O4TA 3U07A 5K8SA 3VZMA 3VBFA 4OFGA 4QKFA 4CEWA 4NRPA 4EJRA 3H0OA 3N9PA 3AX4A 1YJLA 1YCIA 3VHNA 2YC4A 4XQ4A 4MUVA 3T0AA 2Q8CA 4AK3A 4LT5A 1O8SA 4XDQA 2BVVA 2CTVA 4YGEA 5FLJA 3TEXA 4IV1C 3VBSA 4MGTA 3E5UA 1FPN3 1L7LA 3ES1A 1HXS2 2JX9A 5GLTA 3ZLIA 4OI0A 2ARAA 4MH0E 4MGKE 3FBYA 5JOZA 2V73A 3R4UA 4ATFA 4AQ6A 2BBVA 1Q8SA 4K7JA 4LA2A 4DUVA 2E53A 1ZZBA 3VBSB 3VZJA 3CL1A 3UL2A 4R9CA 2WLPA 1UKGA 3PJYA 4PQQA 1AYM1 1JZ3A 3CZUA 1GNZA 1JU4A 1JYNA 2PELA 2WNEA 2ZMNA 2X29A 1RMU2 2E51A 4LA3A 4E27A 3OD4A 4FT8A 4FVVA 4XJAA 4Y5TA 3J7LA 2HWE1 4EN7B 3T0BA 1FT9A 3EO6A 3BI3A 1OQ1A 5J98B 1Q8VA 3U4SA 3OGVA 1QJX1 4BMBA 2XLAA 1JXNA 1RUOA 1KDKA 1O3SA 1FOD2 4KH9A 3MLJA 3RSJA 4CXXA 4L99A 5CVRA 3M3CA 3SCGA 5FP9A 1QNYA 2Q1MA 3IMNA 2VPVA 1TNFA 3I8TA 1CESA 4DRVA 1H6YA 3USSA 2A6YA 2R0HA 2ZEWA 3RI8A 4AEDB 2GSYA 1KJLA 3PIGA 2HYXA 1DBNA 5FY7A 1PMHX 1IGOA 4UBHA 1RUI2 1HKDA 3MYXA 3PL0A 1GQPA 4LO5B 2EAKA 4M01A 4IE7A 1WWYA 5L9BA 4A3XA 4B8EA 5LBFA 1HX6A 1VBA3 4A45A 3MIEA 4I02A 1HRI1 5BPXA
chains in the Genus database with same CATH topology
5EYXA 5BNNC 1RGSA 2D3SA 2WZPP 5IK4A 1AUYA 3VUOA 3ZX7A 1X7NA 1URXA 3JZVA 2PYTA 3IDBB 4WVZA 5T5JA 3H9AA 2RS51 1VBC1 4KBBA 1ZBE3 4JC1A 5JOWA 1VR3A 3KT4A 3IWZA 5FDBA 1LODA 4TYSA 1ENXA 1V6KA 1AXZA 2O8QA 4R4ZA 1C8M2 4RS5C 1KFXL 3DL3A 5CFCC 3H3UA 4LBOA 1ND2A 1ZREA 3JU9A 2D6LX 2PHWA 4K6BA 4GKYA 4S2FA 2OUHA 1FXZA 4IEOA 4YGDA 5ACA1 1HRV3 1ND2B 4FPGA 3KCCA 1KRIA 4G4FA 2JG8A 2Q0AA 3LA3A 4YW2A 4FOYA 1W6OA 2P3JA 3CJXA 3CNAA 2HWD2 1HV1A 3ZMOA 5DG1A 2DCKA 2JG8B 3TYJA 4QPGA 2Z42A 3N7JA 4D7SA 3J9SA 1CR7A 1W6OB 2VMIA 2NQYA 3M3QA 2FZ1A 1R092 1ZZ9A 4LNVA 3ZIXA 1O3TA 2GC1A 3ETQA 4KU8A 4WZCA 4QPGB 1NCQA 4S2HA 5IK7A 5KHJA 2K0GA 3CO2A 1UX6A 4QGMA 3ILNA 3LGRA 2FHRA 4TZDA 2ZA9A 4BZ4A 1NCQB 1POV1 4DS0A 1S0DA 2XHKA 3AP9A 2XB6C 2JECA 1MS8A 1K5MA 2BNNA 2ZZJA 1RUC1 1AHSA 3PVEA 2CL2A 5C4WA 1BXHA 2CV6A 4WM8C 1FMD3 3ZO0B 4PIZA 2EF6A 1W6MA 2ZGMA 1K5MB 1GQGA 4BMEA 3O5SA 3VKMA 2D3RA 4AVTA 1DGRA 1O4YA 2I2SA 5C4WB 3KS7A 1FV2A 4JRAA 4PDWC 5LEKA 1W6MB 1JUHA 4KG0A 1UPIA 5FMOL 2RS33 1Q43A 5I0SA 2AREA 4OI2A 3ZXLA 3HWJA 3KMHA 5KC6A 2LUWA 1QQP1 1YHFA 3BALA 5FCCA 4CDWC 3DN7A 4HVRA 2VVEA 2BFUL 5I8SA 1UL9A 2QDRA 3ES4A 5JDBA 2QQPA 3H1YA 3N35A 2GC2A 4AEMA 3KB5A 3PJQA 5AFBA 2X53S 1F5JA 1BBT1 3BCWA 4JDOA 1AYM2 1GQHA 1VBE1 1V6MA 2YHJA 4Q8LA 5DZEA 3B5LB 5GZDA 4H7LA 4JDMA 1W39A 1GZWA 3WQ1A 1MZFA 2A5ZA 1SMVA 2FMYA 4DY3A 5HBAA 2XVKA 1QJX2 2WFPA 1REFA 2WFF1 3ZFEC 4YZ3A 1D0GA 3BB6A 3T2TA 1WBLA 5BUVA 4LR4A 4LHLA 4QGLA 1F31A 1U12A 3OCPA 3VKOA 4AE2A 2VOKA 2XLFA 2JXAA 2QUOA 1PO21 4EN0A 1F2NA 3C3VA 2BYVE 1V6NA 2XJUA 2R073 4ES9A 1PNFA 2WQ4A 4FTBA 1REEA 5JZGC 1TME2 1PIV3 2F6BA 2WT0A 3A4UA 1IKQA 4B4QA 2DCYA 1I3HA 1VB2A 4CDQB 2P3IA 1VRH2 1ZBA1 4XF1A 2YGLA 5A3LA 4YZ4A 1YNAA 2H6BA 3VBRC 1YLLA 2RS52 2WSVA 2YYOA 3NL1A 2WQZC 1LRHA 1LHNA 1QJY2 4N43B 4CDUA 2Q30A 1V6JA 5FREA 3H7YA 2PHUA 4HVOA 3LB9A 2IXKA 3KLSA 4A7YA 4CDUB 5JPMB 3M70A 4WVMA 2CGOA 2W39A 1PZ7A 4AEJA 5C6CA 1IS4A 3RDIA 4Q4W1 2ZTNA 4MGYE 2YROA 1AR73 3EHKA 4Q4X3 2MPFA 3AZXA 1LGBA 1NA1A 1REDA 1RHI2 4RGAA 4WVMB 3WW3A 3GHNA 5ACA2 1AXKA 2A3WA 2VXRA 3ZYIB 1O4ZA 1NA1B 2B46X 1G9AA 3D0SA 4Q4Y2 2WZR3 4MGZE 5CAZA 4Q1PA 4CDWA 4FPHA 1D4M1 4CDXC 1PM7A 4BHPA 2ZGQA 3LKJA 4AEKA 1IZ3A 3J8F3 4KU7A 1LESA 4PLOA 3LZZA 3WQ0A 1NCRA 1S0IA 3VN4A 3ZVXA 2JG9B 3B9IA 1LJ7A 1C1FA 2GMEA 3HMYA 4QM8A 2VG9A 4Z8BA 2H0BA 5FO7B 2W0XA 4YYOA 1NCRB 1B35C 1WMEA 2B39A 2XJTA 4IXLA 2D6OX 5FLIA 4XOGA 1Q5OA 3PMSA 3GALA 1SLCA 1RB8G 4S2GA 5GZGA 3V64A 2DYCA 4RR3A 4CP1A 2A3YA 3MEPA 3MICA 3P3PA 2I07B 4CP0A 4E2GA 3O12A 4Q4W3 2OW4A 2ZHLA 4RR3B 5BV6A 2VULA 1NOVA 3ATGA 5AC91 4GH4C 5GJ6A 3OGGA 1WW6A 5T55A 3LA2A 3ZMNA 1DZRA 5FQ0A 3POWA 4RQPC 4XTMA 2BWCA 2CWSA 1V6LA 1QQP2 3SH4A 1G9CA 4LBJA 2R061 3D0JA 1R083 1DG6A 4LEJA 2CWMA 3NKGA 3AFGA 5FQ0B 5H9PA 1QMJA 2AYHA 3FMGA 1ZYBA 3AJYA 4D7TA 2CYFA 1LEMA 3AP6A 3CF6E 2XBO1 3TB0A 1BBT2 4AFCA 1UIKA 1PNGA 4LBLA 2H0VA 4Q26A 2HWF3 1QDCA 5HXVA 1I9RA 1AXYA 1O5UA 1GNHA 2ZBJA 5D1IA 4FPOB 3FLRA 5DG2A 2O1QA 4G3YC 2WFF2 3ZSEA 3IBMA 2R32A 4HKWA 1Q3EA 4IESA 3WV6A 2IXLA 4I09A 2WNUC 3S6PA 4CEYB 1PO22 1YWKA 4D94A 4RHV3 3MIFA 4PF5A 2BW8A 3A0KA 2EXIA 4FPJA 2NN8A 3WHTA 3MF9A 1AYN2 1YIPA 2HWB2 1HQLA 4OZXA 1CIWA 1UD1A 4K20A 4Q27A 2RHPA 4MYEA 2OVUA 3DPRA 1EV13 3NAPB 1ULGA 3OYWA 4EWDA 5JSPA 4K3UA 1U5YA 3TBDA 4FOQA 1AR93 1PVC1 3AMQA 3DPRB 1APNA 1Y43B 4WVVA 3JBG3 4PJYA 4RSUA 3RYRA 1JW6A 2ES3A 2Q8OA 3ZXGA 1ONAA 4NWVA 4C1XA 5KXEA 3ZN5A 5EZWA 2ZX3A 3JD73 1X36A 4OULA 4OVEA 1PO13 1H2KA 4I3PA 4OHXA 3EJKA 2ZGKA 4E2SA 3NJZA 4I30A 2GNMA 1RUD3 5CFDC 2RE9A 2G4IA 4YG3A 5IK5A 2RR11 1U5XA 1VB4A 4Q4V1 4Y22B 4NHLA 3MIHA 2AR6A 5DDJ3 4QQPA 2JJ6A 2R041 3ASIA 1CAVA 1XYNA 2ZX4A 4P9JA 4E4DX 4FTEA 4FP3A 2JE9A 5K0UA 1BEV1 1VAMA 4HL0A 4YGBA 1D4M2 2RMU2 4XHXA 5F9TA 4Y26A 4C1WA 1S2KA 5K0UB 1RUH1 1UN1A 2WS91 3AJZA 3GBWA 1N1VA 1QXJA 4LLFA 5BNOA 2UYAA 3LSDA 3IDEA 5JR7B 5L7OA 1TE1B 4HBNA 3ZXDA 3WD5A 4E2QA 1S0CA 4IQPA 1ZM1A 2B8MA 5BNOB 2WINB 1YUDA 3EQEA 4QQLA 3LOBA 2VVDA 3A0NA 2QZ3A 1F5FA 2GALA 3B94A 3VBFC 4AQTA 1QJU2 4CEWC 2WT2A 3AB0A 5KHHA 2BPA2 3TN92 1RUF2 1AR81 2A6VA 4K1ZA 3RZZA 1RUG2 3FBMA 4M3CB 2VUJA 3HT1A 2PLV3 4XBQA 2E63A 5AC92 1EP0A 4KNCA 3VBSC 2F4PA 1ZA4A 3FUOA 3AP4A 1RUJ1 1Y9QA 2DTWA 3B3QE 2ARXA 5DXDA 2DVFA 2R062 4QX5A 3M1HA 3X29B 3E6CC 3PTYA 1IQAA 1S2BA 2GH2A 4AVAA 5JCTA 1V9U2 5JIAA 4P9GA 1ULEA 3VBHA 1LCLA 4LO6B 5KHGA 4OI1A 1WD4A 3CU7A 5KXCA 1HXS3 2GAUA 4PCRA 5I91A 1VBD1 1J3RA 5CIRA 4IEUA 2Y0OA 4Q29A 4I0AA 2JENA 3U11A 1Q56A 2ZGPA 1DGLA 2DU0A 1H30A 3GBGA 3E6BA 3KM5A 1RMU3 5ABJA 4GMP3 1ULFA 4DNYA 5FPZA 4E4SA 1FPN1 2IWGB 1I1EA 4ZU5A 4IEQA 3SMHA 2DURA 5CBLA 2W52A 5GLWA 5ABJB 1FOD3 1MR5A 2YMZA 1KS4A 4EV0A 2PHDA 3WG1A 2BUKA 1RUJ3 1H2LA 1COV3 1H1IA 1RIRA 1C1LA 2Q5TA 5JOXA 2FBEA 1FAYA 1XRUA 2OYZA 4YNIA 3WQ7A 4LE4A 3WUDA 5KWRA 3POSA 4AXOA 1S1AA 1KXGA 3ALQA 4KL1A 1RJ8A 4HSLA 3BTAA 4GULA 5F1RA 1ND2C 1DQ2A 2IFRA 4QMAA 2AH2A 3AKQA 3WZ1A 2K9ZA 3VBUA 1XNCA 1SDWA 4AFBA 2UWCA 3S30A 4U2AA 2JG8C 1CAWA 3BOWA 1VBA1 1LOAA 4L92A 2ZS6B 2RR12 3VBUB 4F7ZA 1XYOA 1QOSA 1Q8OA 2A6WA 2Y26A 1JBCA 3EBRA 4R4XA 5K7PA 3ILRA 4RL7A 4QPGC 1CAWB 1AX2A 4AVBA 2DF7A 4OI4A 3WHUA 4JV4A 4GB33 1MACA 1NCQC 3GZTB 3MGUA 1H1MA 1CAUA 1ZBE1 4YG6A 2VY0A 1QDOA 2VMGA 3CEWA 3VLBB 4EN9B 3E5XA 1RUH2 1SFNA 2WS92 1CAUB 4NHMA 1NXD1 3JCIA 2BVBA 3ROUA 1POV0 3N3HA 4XJZA 1KFUL 4XILA 4HLTA 1Z7S2 1K5MC 4IERA 3SH3A 2C0ZA 1R093 4AEDA 5C4WC 1DIWA 1HRV1 4CTEA 3M4FA 3WVJA 3ZFFA 1BMV1 3KSCA 1PK6B 5E8AA 2CNAA 4XFFA 4PIYA 2BEOA 4AVSA 2ZAAA 1O91A 3ZFFB 1JN2P 1GYKA 2B7YA 1AR82 3R0RA 3ZXFA 5H9QA 2PHFA 4AGVA 4EWAA 3KD4A 4N9IA 4IETA 4Z2WA 3PHMA 2XJQA 1LKNA 3R4SA 1UAIA 1FNYA 4L2NA 4EWEA 2DTYA 3AYCA 5CNAA 3LA7A 1WLWA 4IEYA 3U0ZA 2HEYF 3OY8B 3IT8A 2SLIA 1WMFA 1LEDA 1KDMA 1TMF2 4HN1A 2AUYA 1WBFA 4AVCA 5LRRA 3RJ2X 3ST7A 3BU7A 4Z92B 1Q8QA 5JSOA 1PVXA 1AR62 1VAKA 2P17A 3L2YA 4DQAA 4UW3A 3D8CA 3B7MA 1FMD1 4J6GA 3R4DB 3HN1A 1RUE3 2ET1A 4QD2A 4K1YA 4XETA 1AL21 2A7AA 4QPIA 1NLSA 1O3RA 4P9IA 2DCTA 1WLCA 1UW8A 2GC3A 2MHFA 3FFQA 5EV7A 2RS31 4QPIB 4HPKA 2WA4A 1ZX5A 1ULCA 4Q8KA 2RS13 1RVF2 1BYHA 3KCYA 3ILFA 2EXJA 3D6EA 4HPKB 1A3KA 2XKOA 5BY5A 3AK0A 1Y3TA 1YJKA 5DUUA 5T54A 2G9FA 5C8CB 5F5QA 4N43C 1E57A 4OHWA 5IT6A 1XU1A 1GANA 4XFHA 2DWRA 1Q8PA 2YZ4A 2Y0IA 5TSWA 1KS5A 4MVTA 3SCFA 4COVA 4CDUC 4YVWA 2WT1A 3UJOA 4P14A 4ORFA 1UZZA 5JWPA 4HZFA 1ASJ1 3LSEA 1QJZA 2A3XA 4UW6A 3VZLA 4YARA 2YC0A 1RITA 4YVWB 1QF3A 1LOBA 3ZFGA 3VGIA 1AJOA 1TME3 2E7TA 2UU8A 3R05A 4HKLA 4LUKA 4XF9A 5J96B 3VZNA 4K40A 2Q4SA 2UWBA 1MZ5A 2GNTA 2ZPXA 1NA1C 2YDEA 3ELNA 3ZFGB 1VRH3 1AL23 3AM2A 1UF2C 1DHKB 2VQAA 3GZAA 2D6PA 3UK9A 1QJY3 1IOAA 2R071 4NVPA 2PHRA 5D8AA 3NO8A 4EN8B 1J1LA 1HIXA 4JGZA 1PIV1 4META 4Q0PA 1WMDA 4ISQA 2BNOA 5D8AB 2D5HA 2IXHA 1OOPA 4J1XA 3D4KA 1DZTA 4JGZB 4FPYA 1NCRC 2IXIA 4X6RB 3RNSA 4W65A 3RPQA 1ZBE2 1QH6A 5JVVA 1OOPB 5E1RA 3W58A 2OIIA 1X8EA 3JUUA 1NE6A 2DVGA 2V09A 2VW0A 5J7MA 4QT6A 4Q4Y3 1BQPA 1M4WA 2HWE2 3AZYA 5FOBB 2BGCA 3IN9A 3ZSLA 3AKRA 1ASJ3 1GZCA 1AR71 4Q4X1 5GLVA 4RR3C 3IDCB 3W59A 1AZDA 2I74A 4OUSA 5BNPA 5BNNB 4NN0A 5JMCA 1S0EA 4FOVA 2P34A 4MSVA 3UKTA 1FI2A 1H8TA 4DB5A 1DF0A 4IEZA 1D2SA 4LBQA 1RJ7A 2GDFA 1W6NB 1SLTA 5BNPB 2DCZA 4BM8A 2WZR1 2LM3A 1LOGA 1LOEA 3SXWA 4K8FA 1WD3A 1H8TB 1NXMA 3BPZA 4LBQB 5T5PA 2Z79A 4MXWB 4AF9A 1LTEA 2BTVC 1X33A 2EXHA 4CDQA 1HRI2 5FAXA 3J8F1 3AKSA 2FQPA 2X5IA 3VL8A 1CJPA 1H0BA 1LOFA 4O9EA 4N43A 4RS5B 5BYNA 3I59B 5FTTC 1KD7A 3B00A 2X5IB 4B4PA 2VW2A 3UKNA 3WX5A 2LTNA 4I3GA 1VBC2 3QH7A 4R9DA 4XEZA 3UV9A 1JOJA 3RMXA 4DINB 4LULA 4E4ZA 1M06G 1W0OA 4Y20B 4YW1A 3B93A 2DUPA 4IV3A 1YO8A 2R0FA 4ITCA 1FMD2 5LEJA 1VIWB 2HWC3 4U36A 1NZCA 1CQ9A 4IEXA 4XF3A 3POYA 1NLRA 4IV3B 3USUB 1J3PA 2ENRA 4P9XA 2KA3A 1FX5A 1UIJA 2XJPA 3QLQA 2AZ5A 4XXAA 3QBQA 2KM2A 4FQZA 1HQWA 2QJVA 3NAPC 4AYUA 1R081 4V1PA 4Y1UA 2HEWF 2JG9A 1XYPA 3FHIB 3WUCA 3DPRC 4DRRA 1DDLA 1ZRFA 2YUEA 3J26N 2E6VA 4LBKA 1DGWX 1J59A 1YFUA 4RD7A 2A75A 1GSLA 4M3CF 3NVCA 2HWF1 2R49A 4WM8B 3O0VA 1MQTA 1N3QA 1QNWA 3MZHA 2PAKA 1O5LA 2FMDA 3WW2A 4B3NA 2MEV1 2QKDA 2BQPA 2R6QA 4KGGA 4COWA 1VBB3 1MQTB 2HWB3 4FSJA 2GMPA 1FV3A 4JAAA 2Z2SB 1RUC2 1ULDA 4GWNA 4QHBA 3O0WA 1XNDA 2VOWA 1PMIA 4RHV1 3SCHA 4XF4A 1A78A 3DUIA 4F83A 3VHRA 2R072 5T5OA 2PHLA 1ENSA 2B9UA 5DUXA 4FAGA 1QKQA 1SBEA 2VH9A 4AVVA 5K0UC 1EV11 1PIV2 3B02A 4XJWA 1YFYA 3MFCA 4DZGA 2QVSB 4HMZA 2GN3A 5SV5A 4EROA 1AR91 1YI7A 2ZCWA 1UMZA 4CP2A 4X6QB 4WVWA 1BK1A 3U4XA 2ZGNA 4OHYA 5BXXA 5BNOC 3JBG1 3WDTA 5FRAA 4BYYA 4MXVA 5L7OC 5HCBA 1XXNA 4Y4YA 3QD6A 1VBE2 4YGCA 2XJSA 4YZ1A 3JD71 1OPMA 3MIGA 1PO11 2A73B 4GIQA 1U0AA 2D97A 2Q1ZB 2MEV3 1RUD1 1SLIA 4YFZA 1IPKA 1OPOA 2D3PA 1JYIA 2RMU3 2WIIB 3AFKA 5B2GB 2FZ2A 2ZGUA 4PQ9A 4CEYA 5JZGB 4AW7A 2BNMA 5DDJ1 4A2UA 1SBFA 1WW5A 1C3HA 2EAAA 2PQQA 3AP7A 4H55A 3RQ0A 3WDYA 1EYBA 4FXKB 2WZR2 4AFDA 2X8KA 3NAPA 4BE3A 2B45X 3WDVA 5KHIA 2A6XA 3OF1A 3T1MA 1AVBA 1H9WA 5CADA 5FO8B 1J1TA 1V70A 5GKAC 3ZYRA 4D3WA 1QJU3 3IIAA 4IEWA 4O9GA 4GWMA 4XMIA 1R1A3 3MPBA 3VDDA 1GICA 1G9FA 3LWCA 2DVBA 5F6LB 1RUF3 3TN93 1RC6A 1YFWA 1QWRA 2D7FA 1ZBA2 1IS3A 2TBVA 5I0RA 3VBHC 2WA3A 1D2QA 1LENA 2D40A 3VDDB 5SV8A 5JI7A 5T3NA 1NQJA 4IEVA 3ZYPA 4M0HA 4XIKA 2VNRA 2WWSA 5EFUA 1UU6A 2VW1A 1AX0A 4Y22A 1OQDA 4YM0A 4X8PA 4XE9A 2GH8A 5BNQA 1HV0A 1MZEA 4Q4W2 4LHKA 3NSTA 4HFSA 4NWWA 2PLV1 1V9U3 5ABJC 1DGWA 1IPJA 1D0HA 1T6GC 1AX1A 2RM21 4D69A 1I5ZA 1OD5A 1UCXA 3KT1A 1SACA 1KITA 1MEC3 1XE7A 4L11A 4OHVA 4AFAA 4AI2A 1HLCA 4L9BA 1YYNA 4XFBA 3OD0A 4I0WB 4YM3A 1R082 5AVAA 1ZZ7A 5FO9B 3WNXA 2MNGA 3R6SA 4BWOA 3WINE 5HI0A 3T1LA 3MLLA 5E89A 1H2NA 3L9JT 4FQ4A 4IEPA 4FPEA 1PGL1 5JIUA 1LECA 3WXPA 2XL7A 1WGPA 2IFWA 5I0UA 2HWF2 1HXS1 5EXOA 3RWNA 4JTNA 3WP6A 1WA4A 5L36A 4GA9A 4XJUA 1DZQA 1SEFA 2W68A 4N53A 3H1MA 5KXDA 2UWAA 4LHNA 1ZRCA 4GH4B 2XWJB 1GR3A 1LU1A 3ZXEA 4PIXA 4FPCA 4N53B 4Z82A 3VBUC 4DXZA 4COUA 3ACLA 4YLZA 3VZOA 1DQ5A 1H8VA 2D93A 4M3CA 3CJIA 1MS0A 1RMU1 1UKRA 4GMP1 3KGZA 3FLPA 2DUOA 2E7AA 3VKNA 2SBAA 3GBFA 3JQXA 1EAH3 1OA3A 4GQ7A 3CJIB 1CPNA 1JUIA 4HT1T 4RHV2 4I2OA 1FOD1 2HYKA 1X50A 2RM23 4Q0SA 1NY71 5EJ3A 4KG8A 1MS1A 3N36A 5C8WA 1COV1 1GFF2 3W9AA 4Z1VA 1ZRDA 3P3NA 1RTVA 2HJIA 5T5LA 3G7DA 2ZGOA 4FPLA 5GLZA 3AMNA 1QH7A 5E88A 3HQXA 5HCAA 4IL7A 4XFAA 1CPMA 4LBQD 2XBO2 3H3ZA 2ZGLA 2R1DA 2WNUB 1SCSA 4E9KA 4KQ7A 3O7OA 3BODA 1KJRA 1PK6C 3JD72 4AEDC 3KZ4C 3ZFFC 4YVSA 2PN5A 1R1ZA 3RS6A 4AHYA 2V5YA 2IXCA 1MS3A 4B4RA 2WSUA 1CX4A 5GM0A 1F9KA 3WP4A