4YVSB

Crystal structure of the virus-like particle of a c4 strain ev71
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
237
structure length
224
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 28
structure length 224
sequence length 237
chains with identical sequence E, H, K, N
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvsB00
1PO21 1FOD1 1ZBE2 5A32B 3HAGA 1RUF3 4QPIA 5J96B 1BBT3 1RVF2 2RS32 4IV3C 2XBO3 4RFT0 4CDUC 4CEYB 1AL22 1NCQB 3VBFC 1RMU1 1HQNA 5FMOL 4Q4V2 1RUD2 2R041 2RMU3 1FOD2 4CEWC 1EAH1 2IZWA 1OOPA 3NAPB 1AR93 1AYN1 2GH8A 1FPN1 2X5IA 5CFCB 1RUJ1 1RUH1 4CDWB 1ZBA3 1EAH3 2DF7A 4IV1A 1BMV1 1BEV1 1HRV2 5BNPB 1B35C 4RHV1 4YVWC 4N43A 5AC92 1F8VA 1R1A2 5ABJB 5A32A 1VRH2 1C8NA 1AR62 2WS93 1RUE3 1NOVA 1BEV2 1QJX1 2HWB3 3JD73 1GFF2 2MEV1 1FMD1 1COV2 1AYM3 1RHI2 1QJX3 4PDWA 4N53A 5D8AC 4CDUA 5DDJ2 3VBSC 1PGW2 5C9AC 4QPIC 2X5IB 4Q4X2 4RQPA 1HXS2 4RR3C 1R1A1 1AR82 3ZFFA 1K5MB 5ACA2 5LK7B 1MQTC 1R083 2VQ0A 4FTBA 1SMVA 4IV1C 4CDWA 1Z7S1 4QPGC 3VBFA 1HXS1 3VBUB 2R072 1IHMA 2RS12 3JBG3 1PO11 2WFF2 5CFDB 5JZGC 1VBC2 3J8F2 2HWC1 1AL21 1QJY3 1X33A 1AUYA 4CDUB 1H8TB 1RUE1 2RR13 1FPN2 2MEV3 4YVSB 2HWC2 1TME3 1COV1 3ZFFB 4AEDB 4Q4W3 5AC91 1EV12 5BNPC 3JB8A 4QPGB 4GH4C 1RUF2 1NCQC 3VBFB 2WLPA 1VBA2 2RS33 1AYN2 4RQPC 1VBE2 1AR71 1R081 1VBD2 5ACA1 1ND3B 1RVF1 1F2NA 1AR92 2WZR1 3DPRC 1QJU1 1POV0 5CFCC 4GMP0 1AR72 1VBD1 4JGZA 5ABJC 2WZR3 4AEDA 1QJY1 3ZFFC 4QPIB 4WM8B 2HWE3 4YVWB 2HWF3 1RUH2 3CJIA 4Q4Y3 1R093 1VBA1 2HWE1 3ZFEA 1VB4A 2WWSA 2RS11 1COV3 5GKAC 1H8TC 5BNNC 1HRI3 3VBOC 1MEC1 1ASJ3 4N43C 5D8AB 1FMD2 5C9AB 4PDWC 1AR81 5DDJ3 4CDXC 1TMF3 1ASJ1 1Z7S3 1HXS3 1QQP3 4YVWA 1RB8G 4YVSC 2PLV2 1RMU2 1PGL1 2HWD1 1HX6A 2R063 5ACA3 4GH4B 2FZ2A 4Y5Z0 5K0UB 1R082 3VBUC 1PO12 2WFF1 4AEDC 1PVC1 2R061 1NCRB 1D4M2 4RS5B 2BFUS 1RUJ2 2XPJA 1VBB3 1RUF1 2Y26A 2WFF3 1POV3 3DPRA 1VBB1 1PVC2 4RQPB 1RUC2 1AR61 1DDLA 3TN93 1NA1B 4Q4W1 1FPN3 2PLV1 3LOBA 1RUI3 4GH4A 1RUG3 1ND2C 2R043 4RHV3 1OPOA 4Q4W2 1EV13 1D4M1 4CEYA 4WM8C 3ZFGB 1ZBA1 1C8M1 1CD3G 1AL23 1OOPB 3NAPA 5JZGA 1M06G 1PIV1 2RMU2 4JGYA 4CEYC 3DPRB 5BNNB 4CDXB 2RM23 2RS53 4N43B 1X36A 4Q4Y1 1MQTA 1VRH1 1V9U2 1HRV3 4GMP1 1POV1 3J8F1 5AC93 4CDWC 1R1A3 3VBUA 2XBO1 2HWE2 3VBSA 2HWD2 1VRH3 1HRI1 1RUH3 1RUE2 1V9U1 1ZBE3 4SBVA 1R092 5K0UC 1BBT2 5A33A 5CFDC 1PIV2 5JZGB 3VBOB 1H8TA 1RUI1 1ND3A 2XBO2 3JBG1 3VDDC 4RS5C 1HRI2 2ZZQA 2QQPA 4Q4V3 3ZFEC 1WCDJ 2BPA2 4Q4X1 2RS31 1ASJ2 5BNNA 4Y4YA 4Q4X3 1A6CA 2BUKA 1TMF2 5ABJA 4N53C 4CDXA 1QQP2 3VBSB 5CFCA 5FOJB 2R062 2RMU1 1VBC1 1MQTB 1B35A 2WS92 1OOPC 2HWB2 3JD72 2RS13 3JBG2 1TME1 4WM7B 1RUJ3 4CEWA 1VBB2 1C8M2 1VBC3 5K0UA 1AYM2 1RHI3 3J8F3 1VAKA 1QJY2 3VBHB 1ND3C 1NA1C 5CFDA 4Z92B 1TMF1 2RR12 1K5MA 4PDWB 3TN92 1MEC3 1ND2B 4NWWA 1CJDA 1OHFA 1AR83 1RUI2 2RR11 5C4WC 5C4WA 1VBE1 1PO23 1AYM1 2R073 1VBA3 4GB32 5C8CA 1AR91 1AYN3 3VBHA 1VBE3 4CDQA 1QJU2 3VBHC 2HWF1 1PGL2 2R071 3NAPC 2TBVA 2BBVA 2GSYA 2RM22 1ND2A 4GB31 2RS52 4WM8A 1AR73 1ZBE1 1V9U3 4RR3A 4QPGA 2ZTNA 3ZFGA 5C4WB 2HWD3 4Q4Y2 3FBMA 1RUC1 4FSJA 5J98B 1NG0A 1RVF3 2HWB1 3JD71 3VBRC 1NY72 1PIV3 3S6PA 3VDDB 3ZXAC 1RUD3 1FOD3 2FZ1A 4LLFA 4WM7C 2RM21 4CDQB 1W39A 1VBD3 5L7OA 4EJRA 5A33B 4N53B 1ZBA2 1EAH2 4RR3B 5D8AA 3TN91 5C9AA 3CJIB 2PLV3 5BNOB 2WZR2 5L7OC 1QJZA 4FTSA 4YVSA 1NCRA 2HWF2 4FTEA 1AR63 4JGZB 3VBOA 1PO13 1VB2A 4IV3B 1BEV3 3VBRA 1D4M3 1C8M3 1NCRC 4Q4V1 1QJX2 5DDJ1 1AL0G 4RS5A 1PGW1 1PVC3 1EV11 2ZAHA 1RUC3 1FMD3 4WM7A 4CEWB 4JGYC 3VDDA 1MEC2 2BFUL 2RS51 3CJIC 1Z7S2 5L7OB 1RUD1 2R042 2X5IC 4GMP3 1RMU3 4IV3A 4JGZC 1NCQA 5C8CC 1BMV2 5BNOA 1PO22 1HRV1 1RHI1 3M8LA 4GB33 3ZFGC 3JB4C 1NY71 1QQP1 3ZFEB 1QJU3 3VBRB 1E57A 1RUG1 4CDQC 2WS91 2MEV2 4JGYB 4NWVA 1K5MC 5FMOS 2HWC3 4BCUA 1TME2 5BNPA 3IDEA 4IV1B 1NA1A 1RUG2 1R091 1B35B 1BBT1 4RHV2 5BNOC 5C8CB
chains in the Genus database with same CATH superfamily
2EXIA 1FOD1 1NX9A 3K2OA 5FPAA 4UT5A 4MO3M 3WNXA 4D7YA 4IE5A 4C0HA 2ZKLA 5FXVA 1D2QA 1GWLA 2RS32 5FP4A 4RFT0 4CEYB 1CAVB 5IK4A 4YARA 4OHWA 3H42B 3BIEA 4E4SA 3VBFC 3H3UA 3I2HA 3PURA 5JI9A 3B02A 4IEVA 3FBYA 2EXKA 4D69A 1EAH1 5A7WA 5F1RA 1GWMA 1T6GC 1DGRN 1FPN1 3AX4A 1G9FA 4Z8BA 1LR5A 2GDFA 2X29A 3P3PA 4AVVA 2EF6A 1GICA 2O8OA 3ZN4A 5CFCB 4CDWB 1EAH3 2QQMA 1BEV1 3O1OA 3N35A 5BNPB 1B35C 4HN0A 4N8MA 3KCCA 4N43A 3NNFA 3Q8FA 4MGTA 1ZZ6A 2YFZA 1OA4A 1C8NA 5IVFA 4Q0QA 3U37A 1W0PA 5GZFA 1AXZA 1TNRA 2QQIA 4UW6A 3LZZA 1CAVA 1CAWA 4B7EA 1UMHA 3WP3A 2VZPA 4MH0E 4UXAA 1RHI2 1G9DA 3ME2A 3PU3A 4OZOA 3USUA 5IWFA 2PELA 1KJRA 3ZX7A 5JR7B 5FZ6A 4P9WA 5FO7B 3WQ0A 1CZSA 1UU5A 5IJRA 4CDUA 3DKQA 1JODA 3BYWA 3KCYA 4FOYA 1SBFA 2YGMA 4FPLA 4IEPA 3VBSC 4O9EA 2X5IB 3GHMA 4Q4X2 1SBDA 4P5YA 3MUY1 4Q1RA 4QPYA 1MS5A 1HLCA 2XJVA 2NMOA 1PZ9A 5LK7B 4IXLA 2VQ0A 4HMZA 4YYOA 2VMIA 5E6HA 3BKZA 1I5PA 4B4RA 4COYA 5JXJA 3IMNA 4XCBA 2WBKA 1HV1A 3I4IA 4HVOA 5FZ3A 1DQ6A 5F5AA 1W06A 5SV5A 1YYNA 2QQNA 3NWKA 2TEPA 1LEMA 2PYTA 4FFIA 4COZA 2BNMA 2WFF2 1SPPA 3KF5A 4P9YA 2XOMA 2VULA 4YG6A 1W04A 2R49A 2ZGSA 4WVZA 3ZMNA 3D3AA 1AJKA 2HWC1 1G6NA 1AUYA 5IVJA 4CDUB 3N7KA 3KLSA 1H8TB 2WR9A 2XL7A 5CNAA 2A7AA 3RJRA 3AFKA 3ZXKA 1W9WA 3LAGA 4WZCA 2BVVA 3OBAA 3NVCA 3ZR5A 2L9LA 5D2AA 2VNOA 3OBZA 2VCBA 5H9QA 3ES4A 3DXTA 5FLHA 2WT0A 3FC0A 5CYYA 1BXHA 5C5TA 4KL1A 4NHYA 5FY4A 5CEHA 1GUIA 4FFGA 2H0VA 1JH5A 3HPNA 4XCAA 1A78A 2KM2A 1BKZA 4GH4C 3ZMOA 3T0BA 5DAQA 2QFEA 3VBFB 4TSVA 1V6KA 2ORZA 4UW3A 1WA6X 4WZFA 3WVJA 3WNMA 1ZVFA 4KU8A 1WUVA 3ZYBA 2R1BA 1HB1A 2DFCA 4KWLA 2E53A 4H7MA 2VZUA 2MNGA 2ZEWA 3G7DA 1ND3B 2A73B 4XETA 3K4DA 4L97A 3WP5A 2WZR1 3RSJA 5JDBA 3ETPA 1GV9A 1SCSA 1W2OA 1WA4A 1AJOA 2BP6A 2JDMA 4MXWA 1LKNA 4OUMA 5FP8A 1SZBA 1SLBA 2HEWF 4AWDA 3I2OA 3A7QA 1VBD1 4JGZA 2V5DA 2WZR3 3USSA 2O0OA 3AXEA 1CIYA 1CAXA 1QJY1 3ACLA 5FZKA 4UW4A 4CUCA 3WG4A 2NZ9A 4A7ZA 2DUQA 2J1RA 3D8CA 2E6VA 1OFSA 1OD3A 1V6IA 1W6QA 1XNKA 4ZXKA 4Q4Y3 4Z2AA 4DO0A 3UT0A 2DWRA 4FO9A 3I3QA 3LSDA 3B01A 3AXDA 4HK9A 4J6GA 4XF9A 1AX2A 1LHUA 2UY9A 1VB4A 2WWSA 1BCXA 1YI7A 2CGNA 4BQ3A 4YFZA 3OPTA 1JMUB 2RS11 1VAMA 4EN8B 2AUYA 4J1XA 4ZKTB 4DQAA 1FATA 3THDA 5JSOA 3PUQA 3SEPA 1OLMA 3N9LA 3I97A 1O4TA 4NHLA 2ZGNA 2P1BA 4JV4A 4LE4A 1FMD2 5FQ0B 1QOTA 1ENSA 3P5BA 1WCQA 1JYTA 1I1EA 4Y1YA 4OVEA 3AKQA 5LY2A 5DDJ3 4LBQD 3WF3A 4CDXC 3OF1A 5GALA 1TMF3 1JYIA 3ACHA 5FXZA 1Z7S3 2G9GA 3S5QA 2GN7A 4KI5M 4FVVA 1PGL1 1RMU2 5EJ1B 2HWD1 5APAA 1MS3A 2R063 3PNAA 1JYWA 2RJ2A 1R082 5K0UB 4DXSA 2ZZJA 5FZOB 1XXNA 4LBKA 3UNPA 4NIHA 3DL3A 4AEDC 3WDUA 2R061 4RS5B 1D4M2 4HK8A 3ES1A 4W8JA 1RUJ2 2Q8CA 2FCUA 4OCTA 2RV9A 3SH4A 4L9BA 4PF1A 4KBZA 4XF3A 1MACA 3AL6A 4QKBA 4CCEA 2H0BA 3DPRA 2EAAA 2UWAA 4R9DA 3AM2A 1JN2P 2HYXA 4B29A 4RQPB 5FPUA 1RUC2 4H14A 1DDLA 3PU8A 2VUDA 4LNVA 5ANNA 5IHRA 2UU8A 4Q4W1 4R9AA 2Q0AA 4LQRA 1FPN3 4NRMA 2BNNA 2YU2A 5A3TA 4E9KA 3LSEA 3FLPA 3LOBA 1W05A 3S7EA 3VKFC 1RUG3 1ND2C 2R043 4NVPA 5A7PA 1NXD1 4HONA 5LBCA 4FPOB 1OPOA 2VD7A 1QJEA 1D4M1 2GZWA 5I0UA 3I3EA 4CEYA 4JHZA 3C7GA 5FPBA 1IQDC 4Y1XA 3S5AA 4XBNA 3JU9A 3ZFGB 2XMLA 1C8M1 4BYYA 4AHYA 4LO5B 1SDWA 4FXKB 5FIXA 3CLPA 4LKDA 3RZLA 5A7WB 5FYBA 1CX4A 5JZGA 5F2SA 4RA0A 1W9FA 5BNQA 1TEIA 2VW2A 3ABZA 1BK1A 3U4SA 3DGTA 4UOJA 2DYCA 4CCOA 3WNOA 3IN9A 3DECA 1AX1A 4N43B 3VUOA 1X36A 3KCXA 5AVPA 3A22A 3RPQA 1V9U2 2QQWA 1HRV3 4AFMA 1CJPA 2PAMA 3DF0A 3E6BA 4FFFA 1W6MB 4YGEA 2VC9A 2BWAA 5AC93 3ZXJA 4FT8A 3T2QA 2W92A 2ZKNA 2Z69A 4CSWA 3WW1A 1D0HA 4PIYA 3B69A 4BU2A 2LM3A 3MW4A 4LIUA 1I3HA 2DCKA 4IE4A 1BBT2 5A33A 1UD1A 5JZGB 2J42A 4JAAA 1SDDB 4CCLA 4DOUA 3IM0A 2XBO2 1AX0A 3VDDC 3NNLA 3WOGA 1UY0A 3VKLA 2QQPA 4ATEA 4YZ1A 1UU4A 2GC1A 4IE0A 2AH2A 2VGDA 4QU1A 1W8UA 4DUWA 2CL2A 1S0GA 4OMDA 5EQUA 4NR1A 4AI3A 4DPNA 4M01A 2LRPA 5KXCA 4XF0A 5AVAA 1MS8A 3OG2A 3V0AB 2QQUA 2NMNA 5T50A 3WQBA 2CWSA 5A3MA 5EIYB 1JZ6A 1UZ0A 3O0VA 2JG8C 4CDXA 4NIAA 1QQP2 1DQ5A 1S4CA 4PQ9A 5DZGA 3HQUA 1PMJX 2W1UA 1CAUA 4L99A 1CX1A 4LT5A 3T08A 3CNAA 1PNFA 2P5BA 3GJBA 3VZKA 1H2NA 1G7YA 1CWPA 1OOPC 2K2SA 2GC0A 1PGSA 3L9JT 4KGGA 2VMHA 4B1LA 4EE2A 5LWBA 1QF3A 4WM7B 2DFBA 4DINB 1ST8A 4UFJA 3D5OA 4XFCA 3HEIA 4GQ7A 5DQ0A 5J09A 1D0GA 5FLIA 5LZ6A 1VAKA 2BGOA 2WO1A 2DCJA 3VBHB 1GMMA 4L2NA 2OUHA 4YZ2A 4PIZA 2FQPA 4OZXA 2JB8A 2QE3A 4CXYA 2JG9C 2E7TA 1K5MA 1REDA 2VU9A 2XKPA 3AZVA 3TB0A 2VJXA 1JYVA 1ND2B 2JG8B 1OQDA 4TTGA 3FLTA 4TLFA 4FAGA 4LBLA 2GAUA 2BOJA 1AR83 2TNFA 3POSA 3T09A 1RUI2 2X10A 1UOBA 3GJAA 1C57A 3IKWA 5JWPA 1LECA 1YO8A 3WDXA 2R1DA 3NNJA 2XJPA 2BOIA 2VNGA 2RDSA 3JUUA 1GZWB 3BALA 1WLDA 4ORFA 1PZ7A 4U36A 3ZYGA 4AW7A 5KHKA 1OPMA 5C8CA 2FHRA 3LEMA 2YPDA 1AYN3 5H9SA 2WZPP 3VBHA 4CDQA 2VPVA 4HOOA 3VBHC 4AEJA 5FZBA 5FMCA 1RC6A 1KS5A 3W5MA 2JD4A 2DV9A 3ASIA 5CG9A 2OUJA 3C7EA 1YCIA 5CKNA 4B4PA 4IL7A 1S2BA 1ND2A 1N1TA 2VCMA 2XWBB 1UY2A 4GB31 2AYHA 4D7SA 1YFXA 3WR0A 2YU1A 4A7KA 4Y26A 1ULFA 1W6QB 1F5JA 4KMQA 3NQHA 1O6UA 1W2UA 1YXWA 3BI3A 2ARAA 3TOJA 4UFLA 5F5IA 2J7MA 2ZTNA 3RZKA 2HWD3 1W9TA 3VLBB 2ATFA 3MF6A 4MG2A 2R0FA 2GMPA 3F95A 4JKMA 3LKJA 4KG0A 2OXBA 1W3XA 4PI2A 2Y8KA 1T6BX 2GALA 2DCZA 5FQ0A 4MX3A 2JECA 2AENA 4W50A 5JUVA 3VD5A 1CPNA 2Y64A 4F7ZA 2FZ1A 4LLFA 1VBD3 2AACA 5L7OA 5K7PA 2YV8A 1DQ0A 3VZJA 5JIAA 5FY5A 2D93A 3WNKA 4D3WA 1UMZA 4N90A 4ONUA 3NMBA 3WF0A 3ZYJB 5JAXA 1W03A 1EAH2 1NLQA 5D8AA 3FHIB 1XE8A 1ENRA 5C9AA 1WBFA 1K3IA 1W8HA 2J1EA 2WABA 1QEXA 5CU1A 4C90A 4AK3A 2WSUA 1FXZA 5JPMB 5GZGA 3WQ7A 5IVVA 1AR63 4GJYA 1GR3A 2DVDA 4QX3A 5EZWA 5FOBB 3HQRA 4UW5A 3VBRA 5C3SA 1FT9A 1D4M3 1G8WA 2E32A 3ZIXA 5GZDA 4Z1VA 3H1MA 2IXLA 3ZN5A 2WZEA 5SV8A 1IS5A 1C8M3 4Q4V1 5DDJ1 3MEPA 1YLLA 3JZVA 1PGW1 4KU7A 2PFWA 4Y1ZA 1T2XA 5BXXA 1EV11 5FREA 2ZAHA 1PX4A 1KDMA 2CSGA 1N1SA 3E6DA 1FNZA 3ZXGA 5CA6A 2C9KA 2ES3A 2WNUB 4JGYC 1MEC2 2LUWA 3WDTA 3R4DB 2QZ3A 2YUEA 1HJGA 2W9XA 3R4SA 1RUD1 4NAOA 1BLZA 4BK4A 4AZZA 3BPSA 2K0GA 1HV0A 1QH6A 3PTYA 3VV1A 1W6OA 3WG3A 3AYDA 1XSRA 5FK8A 4QGLA 5JSPA 5GJ6A 4HPKA 4AOCA 5BNOA 1PO22 3KB5A 2XHKA 5FYSA 1DU3D 1EYBA 1EUTA 3M8LA 1LRHA 4FCAA 1Z0HA 2YPJA 3WDWA 1QJU3 2ZGPA 4RGKA 3KT7A 2EIBA 1LHVA 1QMJA 1RUG1 2C1FA 4KQ7A 4D6SA 2R0HA 4BHPA 3N7LA 3RGBA 1L7QA 2GNBA 4CDQC 1O7FA 4X8NA 4JGYB 2MEV2 5IK5A 3MIFA 4TN7A 2WO2A 3PUSA 4FAHA 2B8MA 3B9CA 3PLQA 2G9FA 1HB4A 1YQ6A 1WD3A 4QGNA 3OYWB 4BJ0A 1NA1A 1OLME 1N1YA 4IEXA 4JZRA 3THCA 1BBT1 3I59B 1VRBA 1PZ8A 1ENQA 3D0SA 1W90A 2A6ZA 1IS6A 4QX5A 1PO21 1JU4A 1H2KA 5F9TA 1AVBA 3HAGA 5A32B 5A3UA 4HKWA 4Q1PA 4BH9A 3I54A 4N7UA 4DUXA 3T2PA 2GMMA 1BBT3 1GWKA 1K45A 2ZHLA 1GZCA 3KT1A 4XTPA 4IV3C 1MZFA 4P9LA 4AQTA 2XBO3 4X6QB 4CDUC 1O8SA 1NCQB 5LA9A 4OI0A 1RMU1 2B39A 4HSJA 5CZKA 3V65A 1ZA4A 2F4PA 1RUD2 1LU1A 4CEWC 1RUNA 1HKDA 2W0XA 4Q27A 2KA3A 2IZWA 1OOPA 1YJKA 2B9UA 3FN9A 1KD7A 1GNYA 1HB2A 2LW8A 1WMDA 4CE8A 1Y43B 5C3RA 2D44A 3OD4A 3RWKX 4BB3A 1ZBA3 1BMV1 2D40A 3IB3A 1OFNA 2E9QA 2JDHA 4QQPA 2XQRA 5JI7A 4XOGA 4OHZA 3NL1A 4IQPA 4XE9A 5FZ7A 3T3YA 4GAZA 4YVWC 3KF3A 3MIBA 3MV11 3NNGA 3BU0A 5ABJB 5A32A 4OI2A 4M3CE 5F6LB 2PTMA 3CHXA 1CONA 4YSFA 2WS93 4C1XA 2A3YA 4QB6A 1BEV2 1QJX1 5F7UA 2IXJA 3PIJA 1I9RA 3E6CC 4AI0A 2CDPA 3GZAA 4CP2A 3BTYA 3RZHA 1D2SA 2MPFA 1DLLA 2ZBJA 1SQ4A 1LOEA 1CZVA 2DVAA 2XUMA 1WGPA 1QJX3 4AFBA 1CN1A 3H1WA 5D8AC 1WW4A 1QIQA 2VR4A 5HCHA 1UWWA 4I2OA 3KD4A 1W99A 3OBTA 4HXCA 4K7JA 2J22A 3QBQA 3SXWA 4XFHA 2AEYA 3UGHA 4HKLA 5BV6A 5GLVA 4RQPA 1H9PA 1LESA 3K4AA 3POGA 1ULEA 5KXDA 1PMHX 3J4UH 3KV4A 4JTNA 5JMOA 1LENA 4FTBA 4F8AA 4IV1C 2A6VA 2ET1A 4CDWA 3DXUA 4CPBD 1ZYBA 3V56A 4YZ5A 4WVWA 2Y6LA 1L3JA 4W4ZA 2RS12 3JBG3 2Z79A 4I0BA 4GWNA 2WA3A 3AP9A 1JOBA 4META 3VKMA 5L9BA 5CFDB 1VBC2 5JCTA 2DDUA 3I2DA 3J8F2 3NKGA 3TNQA 3ZDVA 2QBXA 3BODA 1PNGA 1QJY3 2W08A 2A6WA 4XHBA 5A80A 4EV0A 5JOXA 3F2ZA 5LATA 4PLOA 5FYYA 3GBWA 4E8CA 4MUVA 5H9RA 3BPZA 5GM0A 4FPJA 2HBTA 2YZ4A 3WCSA 1UX7A 2RDQA 2QJVA 1LNSA 3OUIA 4K1ZA 4B3NA 4LUKA 1IPKA 3AMNA 4GKXA 4QXCA 1KXGA 5GZEA 5AFBA 3H8RA 1QNWA 2P6CA 1TME3 3ALQA 4URAA 3DUIA 4H2AA 1LB2A 2Y6FA 5K4LA 1MR5A 1KQRA 5D1IA 3ZKYA 4AEDB 1GBGA 2PQQA 3NSTA 3JB8A 4LBJA 3BN6A 4CRQA 1HB3A 4LHLA 4CU6A 5JSRA 4DXZA 3FLRA 3SQOA 1NCQC 3BGAA 1MZ5A 4NHXA 1JOPA 5DUVA 5IUQA 1LOAA 4LIVA 1VBA2 2RS33 3SKJE 3HVDA 4RQPC 4LBOA 1VBE2 3O1RA 2R6QA 1SLTA 1VBD2 4LE3A 2FCVA 3A0KA 4R4XA 4YW7A 1X8EA 3CBNA 4QQOA 4CTEA 3MLLA 3AMPA 4YW1A 2CGOA 5DAXA 1F2NA 1OSGA 5I0SA 3DPRC 1Q8SA 3TWIA 2Z4FA 2Y60A 1POV0 3EXUA 2IWGB 4GMP0 1V6NA 4NUBA 4QQLA 4Y24A 3IDBB 5FZ8A 2D7FA 2O8QA 4QXHA 1WLWA 2Y6KA 4AEDA 5ABJC 1NXMA 2BJSA 4LO8A 5FTTC 4QPIB 2P3YA 4R8HA 2A6XA 2HWE3 3RG0A 2HWF3 3J26N 1WW6A 3WV6A 1LOGA 2D3RA 3M3CA 3S30A 1ONAA 2AR6A 1IKQA 1R093 3T2TA 4AXOA 3IBMA 2HWE1 1NE6A 3ZFEA 2JJ6A 3AFGA 4L8QA 3VZLA 1U0AA 1TVGA 2I2SA 5A3WA 4ASMB 3WY6A 3NKTA 2AREA 1HRI3 1J59A 1US3A 1H2LA 4IGQA 5E8AA 3HWJA 4XUOA 5DUWA 2WNUA 1MEC1 4A3XA 4DXRA 5I93A 1HIXA 4KG8A 4MGIE 3C7OA 4N43C 4XJZA 4XYXA 3ZPOA 1HN1A 4EZ4A 1H30A 3O1MA 4H55A 4PLNA 1RTVA 2BNOA 1ULDA 3NO8A 3TBDA 4MGQA 3UGFA 2VZQA 1NZIA 1OVPA 1QY4A 3P3NA 2JIGA 4AI9A 3W5NA 2R16A 1UO9A 4XPVA 1HXS3 3OGSA 4IEUA 4COUA 4FQ4A 4XMAA 2ENRA 4JHTA 1DZRA 1S2KA 1Y7BA 1ZZ7A 5FP7A 3R4UA 4HPKB 4QQHA 1HX6A 5ACA3 1VR3A 4PLMA 1JHNA 2ZX2A 2FMDA 5JXIA 2PA7A 4DNYA 4A41A 3AYAA 2WFF1 3OBRA 3VDCA 4OUEA 3ZPYA 1RL3A 5KXBA 3U1XA 1NCRB 1LCLA 2KD7A 2NPIA 2ZX1A 2XPJA 1VBB3 3I8TA 4Q0SA 1GZTA 2FCTA 1W0NA 1XC6A 2D6PA 3MFAA 2X09A 2WFF3 5FYMA 1IG3A 1W3VA 3KZ4C 2IXCA 4EYUA 3VD9A 1Q5OA 4JDOA 1VBB1 1PVC2 4X8PA 5GLTA 4XTMA 3KSCA 3BB6A 4CU9A 2Q1FA 1NA1B 4URTA 2B45X 2XVLA 3IAQA 4NHKA 2FBEA 2QDNA 2Z2SB 4NPRA 2UWBA 1V70A 3WLUA 3OGGA 3WNNA 4MGZE 1FAYA 5KHIA 2QZ2A 4MLOA 3ZKUA 2XL9A 5LY1A 2VZVA 3VHPA 1H4HA 1OVSA 2V5YA 3E1F1 3O0WA 4EZHA 5EV7A 3RI9A 4Q4W2 2CAVA 4B4QA 2CY6A 3K75B 3QH6A 1UPSA 2ZMNA 4GZ9A 3J7MA 2VVEA 2XR4A 4BQXA 3IT8A 5HCFA 2VMCA 3USUB 2FDJA 3K77A 4EN9B 3KV6A 1WWYA 3N9PA 4COVA 3L2YA 4P9XA 1OOPB 4K1YA 4CCDA 4DUVA 3EHKA 3FJSA 1QJFA 1OKQA 3M3QA 1P8JA 1PIV1 1IPJA 2DVBA 3PMSA 4P5HA 4V1PA 5BYNA 3O1SA 4CEYC 3DPRB 5EFUA 1S0CA 5BNNB 1JBCA 4UAPA 4I3GA 2RM23 2BU9A 5FKCA 2EIDA 3AC0A 2ID4A 4IEWA 5HCBA 1C1LA 3BIWE 1C5IA 3HN1A 2VCCA 3B5LB 2Y0IA 4NHMA 2WJSA 3J9SA 4QXKA 1VRH1 3INAA 2VECA 1POV1 2XVGA 3DCQA 1R64A 3K46A 4JX0A 4QGMA 2PHTA 4S2GA 4CDWC 2J1UA 5CB7A 4QXBA 5FJHA 1NT0A 2XBO1 4NOTA 3VBSA 2HWD2 1JU3A 1VRH3 3EBRA 5L9RA 3WP4A 2W46A 4EWEA 3EO6A 4DIQA 3OSDA 3RS6A 1RUE2 3RYKA 4LA2A 1ZBE3 4FPKA 4SBVA 1FV3A 1NLRA 4ISQA 3H8UA 3UGGA 4XZUG 2ZGUA 3MIEA 5CIRA 5FJKA 1PIV2 2VUCA 1H8TA 1WKYA 3JBG1 1TE1B 1ULOA 2IVJA 4OHXA 3AKPA 2ARCA 1WCDJ 2WO7A 1OA2A 3LWCA 3ZFEC 1YQ2A 1W8WA 1X8MA 2EAKA 1E5HA 3MIGA 4BISA 4Y5TA 3U11A 2OA2A 3M70A 5FZGA 5DG1A 3ON7A 5FYHA 1TMF2 4HG6B 1DQ4A 1L7LA 2IUWA 2UYAA 4FPHA 4JTOA 5DAVA 2H6CA 3ZYRA 1GQPA 3VBSB 4QHOA 4D7TA 3IPVB 4P9JA 4EN0A 4QAWA 5FZIA 2RMU1 2OPKA 4OMCA 2OS2A 2XQXA 2PXJA 4IE6A 1VBC1 4BXSV 5LBEA 1XNBA 5GZCA 1Y9MA 4UFMA 2RS13 3JBG2 3O5SA 5FPVA 1RUJ3 1LGCA 1W6OB 1C8M2 1MVQA 4K9SA 1VBC3 5DAWA 1RHI3 3J8F3 5KBFA 3ZSMA 1UNBA 1JZ7A 1QJY2 1TG7A 2W95A 4W6YA 2XJRA 3RMXA 5IYYA 3FFZA 5FO8B 1NA1C 4MYEA 4AFDA 1R1ZA 1KFUL 4QM8A 1TMF1 4AQSA 1VAVA 3SITA 4PDWB 3D82A 4KWKA 3TN92 2QQVA 3CEWA 1CJDA 1OHFA 4QD2A 1C1FA 3EQEA 4I0AA 1TQ5A 2RR11 3GHNA 3E5QA 5FUNA 5C4WC 5G05L 4YZ4A 4YW6A 5C4WA 4EQVA 2PMWB 1DFQA 1PHMA 5FKBA 4YM3A 3H3ZA 4LOSA 1PK6C 4GB32 4LHKA 4W6XA 1LULA 4LR4A 1QJU2 2ZS6B 3E5UA 4RD7A 1PGL2 4XJWA 3WW2A 2YBPA 3LCPA 5FXWA 3CO2A 1VMFA 2ILMA 2TBVA 3A21A 4GXLA 4LK7A 3TEWA 2YBKA 2GSYA 3EJKA 2HYKA 3A0NA 3PIGA 2PHRA 1OURA 3ZXLA 2VOXA 1F15A 1QDCA 1J83A 5T54A 3THPA 4DB5A 1V9U3 4QDSA 5I0TA 3ZN6B 2VQTA 4QPGA 2W2IA 1SLCA 4ARYA 3QLQA 4YG3A 4DY5A 2J1TA 3M7AA 3VHRA 1OH3A 4XURA 5C4WB 5JOYA 1WMFA 2IXIA 3AK0A 4MGYE 5F32A 3FBMA 4DXTA 1VALA 2QVSB 4Y4RA 1S1AA 3APBA 3MHZA 1GZ9A 1JUHA 5J98B 4NN0A 5HBAA 1WW5A 4INDA 1O8PA 1MZEA 3ELNA 4QKNA 2HWB1 3JD71 4AG4A 2BTVC 1JS9A 1LEDA 1NY72 4WVMB 3GNEA 2IFWA 1LJ7A 1F9KA 2DUOA 2ADDA 2YBSA 1RUD3 4XIOA 1FOD3 2V72A 4UF0A 2X05A 5CKMA 4CDQB 3FHAA 4S2FA 2ZCWA 3VZOA 2DCTA 3DEMA 3MW3A 4EJRA 5CAZA 4MHRA 2R30A 3HMYA 4NPLA 2JDZA 1WMEA 3KS7A 1V6MA 5EWSA 2VBBA 3ZN6A 2XLAA 4M4RA 3MF9A 4AL9A 3CJIB 4XUTA 3VB9A 3N7MA 2WZR2 5L7OC 3MO4A 4YVSA 1NCRA 4XFBA 3K51A 3UYJA 4FTEA 3WG1A 4I01A 1IG0A 2BYVE 2BEOA 3VBOA 1VB2A 2VTFA 4IV3B 1VPHA 1BEV3 2YROA 3DYOA 3QH7A 4RGGA 5FZHA 3RFRA 5KXEA 3K3NA 1Q8QA 3ZLIA 2BV4A 4HT1T 3O12A 2X8KA 2J1VA 4IEYA 4A3ZA 3U0ZA 4AGVA 5K8SA 4W6WA 5DAPA 2BGPA 4PJYA 4RS5A 3PUAA 5CKQA 1OQ1A 2ZGOA 1BK0A 4M0NA 1PVC3 4QDRA 2PHUA 2OW4A 2VZOA 4QB1A 1F5FA 1UOGA 4O7XA 4QM9A 2WWJA 4JRAA 5EJ3A 1S0IA 1XRUA 4CEWB 3KHCA 1I5ZA 3I3DA 4LHSA 2EIEA 4XEZA 1RINA 2GC3A 2VVFA 3CJIC 4UFIA 1Z7S2 3BTZA 2EIGA 3GZEA 5L7OB 3WF2A 1RMU3 2WLQA 5DXDA 4S2DA 4PF5A 4IV3A 1WLCA 5FZEA 3U75A 4IGOA 1UY3A 4Q8KA 1N3OA 3H8OA 3URFA 1IPSA 2DURA 3AZYA 2LS6A 3AVRA 3PJQA 1UL9A 1HRV1 1BZWA 2ZHKA 3ACIA 3RDIA 2NQYA 4ZU4A 3WF1A 4QX0A 2XHNA 3OTFA 3ZFGC 1QQP1 4XXAA 1PK6A 5I91A 2VL4A 2NM1A 4IEQA 1V6LA 3VBRB 4BIFA 1XYOA 2G4IA 2WAOA 3POYA 4CVUA 4RSUA 2YFUA 1G9BA 1GKBA 3GBGA 3ENRA 2WS91 4AHWA 3SH5A 2VZSA 4XFFA 2HWC3 1GSLA 1LOFC 4ZXEA 1TME2 4CZSA 2PHXA 1LOFA 1N3PA 1XNCA 4R9CA 4OHVA 4LHNA 1C5HA 1W6NB 4IV1B 3H8XA 4OHYA 3AMQA 4XDOA 1XE7A 4Z07A 4RHV2 1PVXA 4XAEA 4XJUA 2VOWA 1AXYA 1DZQA 1EPWA 1ZBE2 4NIGA 2A6YA 3I7DA 5FCCA 1RUF3 1WLTA 2WDBA 3I2GA 4QPIA 2JKXA 5B4XA 3ZYFA 5J96B 1W2TA 2OYZA 1O3TA 4JKLA 4X6RB 3WHTA 1OF3A 4XHXA 1DG6A 1LODA 4Q4V2 5FMDA 1YI9A 3H50A 4BA6A 3LDRA 2OT7A 3KM5A 2VW1A 4AAPA 4AI8A 3O1TA 2BGCA 3NAPB 1AR93 3A23A 5I8TA 3IPVA 2PN5A 3UESA 1WD4A 1W6NA 4IV1A 2JE9A 3VZNA 2JWPA 1EPZA 1HRV2 5JOWA 1POQA 2D6KA 1XYPA 2VVDA 3DN7A 4RHV1 1ULCA 3B3QE 4CUAA 4EWAA 4R52A 1Y9GA 1YIFA 4OUSA 5AC92 1F8VA 1R1A2 2YDEA 1GANA 5CISA 2WIIB 1AR62 3LPFA 2JE7A 1NOVA 4HN1A 3J7NA 4YZ3A 5IVCA 1HJFA 3UETA 5I0DA 1FMD1 4AE2A 1S0EA 2W3JA 3W9AA 3H0OA 1APNA 4GA9A 3VGIA 2CAUA 3KQRA 3O1VA 4LKSA 3MDPA 2C5DA 2VNRA 4PDWA 3O14A 1U5ZA 5FZMA 2D6LX 4NPMA 3W59A 2XJTA 2E7AA 1ZM1A 2ORXA 3AMHA 3FE5A 4YW5A 5A6YA 2H6BA 2RHPA 5JPNB 4QPIC 1L7RA 2VW0A 1HXS2 4RR3C 1R1A1 2W91A 3TRSB 3W58A 3ZFFA 2PHWA 5DUUA 1K5MB 1MVEA 3GDBA 5ACA2 5J7MA 1MQTC 1YRZA 3OUJA 3H7JA 1B09A 3OY8B 3TEYA 4AVTA 3IIAA 5FZ9A 2SLIA 1K5JA 1Z7S1 3S7IA 2GNDA 4CU8A 2FDKA 2W47A 3VBUB 2ZGLA 4Q8LA 1XNTA 3LPGA 2R072 3UJOA 1DGRA 1IHMA 4M3CB 3RVHA 1PO11 2VTXA 3JQWA 1FNYA 2ZGKA 5LRRA 5JZGC 1CPMA 4Y3OA 3G6JB 1AL21 1DQ2A 1X33A 4E2SA 1K12A 3K3OA 2BBAA 1SCRA 2ZX0A 1A34A 1RUE1 5LA2A 2VUJA 2WQ8A 2RR13 3MGUA 2MEV3 1NKGA 1OH4A 3FHQA 4ARXA 1C4RA 5FYUA 4MGSA 3HN3A 4M4PA 1S55A 2JB4A 2WT1A 3HBKA 2DBIA 4Q4W3 3UL2A 1J3RA 5J36A 1EV12 1RJ7A 2BWCA 1SHWB 3SMHA 1HN0A 1W0OA 4MVTA 4WVMA 3ZSLA 4Q0VA 1W8FA 3GBFA 4HKOA 4BK5A 3OGVA 4YM0A 3LOIA 4UF0B 5EXOA 4TXWA 5F3EA 1ODNA 4NJ4A 3NV4A 4OI4A 4IGPA 4A2UA 4Y22A 5F5QA 5IVEA 2V4VA 1AYN2 5BPXA 1U5XA 3LA2A 4XDPA 1R081 1UOJA 1UX6A 4XUPA 2RE9A 4YPJA 5ACA1 1S0BA 2OQ7A 4XF1A 1SFYA 1XNAA 4YGBA 2FDHA 1DYOA 2JICA 5CFCC 1LOCA 4FQZA 1AR72 3UKTA 1XOYA 4G9SB 5IK7A 3ATGA 1QXPA 4MHUA 3M3IA 4A6OA 4QX1A 4FPGA 1XSQA 2R32A 3UKNA 4E2QA 4DY3A 4DMIA 3VN4A 3S57A 2WFPA 4LEJA 3ZSKA 1NQJA 4M00A 1DCSA 2VZ3A 2ZX3A 1VE0A 5LBFA 1LHOA 2JEMA 2VOVA 1FI2A 1COV3 3NV2A 3PDQA 5GKAC 5BNNC 3ORJA 5LW9A 3V0AA 2IXKA 3IMMA 3POFA 4FOWA 4R4ZA 3VBOC 3MICA 4Y5SA 3CQOA 4AFAA 3FUQA 1JXNA 4XBQA 3T4VA 1SEFA 3HJRA 1M4WA 4YM1A 4PDWC 4GKYA 1AR81 1CAUB 2XONA 1XE0A 2OZJA 1QKQA 2OPWA 1JZ5A 4IDZA 5BUVA 1YNAA 4YM2A 2ET7A 1YFWA 3DYPA 3BUCA 2ZABA 2WNUC 4YVSC 2PLV2 3T30A 3PMEA 3FX3A 2VMFA 4Q0UA 2P2KA 3VBUC 3FL7A 3DYMA 5A7SA 3I3BA 4XQWA 3U4XA 5EPAA 2E7QA 1PVC1 1BVVA 1PK6B 2RJLA 4CCJA 1RUF1 3LEKA 4BIOA 5IAVA 3O1PA 2Y26A 5L36A 4HL0A 5BY5A 1POV3 2GP3A 4QMAA 3ZOIA 2GH2A 3ITQA 1O3QA 3PVBB 1H6YA 1QOSA 5A70A 4BE3A 2WSVA 2WQ4A 5ERLA 4XJ9A 3TN93 3RYRA 1GOGA 1Q56A 3IWZA 4OQ9A 4LO6B 2VCAA 3AKSA 1G9CA 3RRDA 4AVCA 1UXZA 2WYSA 3HNMA 2PLV1 2VY0A 1AHSA 4LK6A 3TEXA 1KJLA 3OB8A 4AQ2A 1GZWA 1CR7A 3AVSA 5HXVA 1JZ4A 2QNKA 4XC9A 4AVBA 4KGQA 4RHV3 2P17A 3VHNA 1ZZBA 4WM8C 2V09A 4XBLA 1ZBA1 1UZVA 4XMIA 4D6QA 5J3UA 1CD3G 5K9YA 1H8VA 1SG3A 4FFHA 1RXFA 3NAPA 5FYZA 4BZ4A 5A1FA 2PAKA 1Q8PA 3OJBA 4IEOA 4BQ4A 3RYPA 1M06G 2W94A 2SBAA 4JCKA 2EXJA 2VH9A 2D6OX 2XGXA 3D4KA 3WZ1A 4CP1A 4M3CF 1JHJA 2VQUA 4BXFA 1CVNA 1DLCA 3BOPA 4WVVA 1X9PA 4LBNA 2CU5A 5DN2A 1WCUA 4LULA 2JIJA 3OCPA 4Q4Y1 1MQTA 4Z2WA 2FDFA 3TAYA 3THTA 4K6BA 2JKBA 2QDRA 3SISA 3J8F1 4N9HA 2WAAA 3ILFA 1UYPA 1W8NA 1A8DA 1R1A3 2Q1MA 4G3YC 3ZVXA 2GNTA 2HWE2 3ZYHA 1UQXA 1RUH3 2WINB 4A4AA 5GLUA 1OXCA 3P6BA 2K9ZA 1R092 2A1XA 5FP3A 5T55A 3T1LA 4E2GA 4DEQA 4IW3A 3R05A 1CAXB 2B5HA 4MZUA 1AZDA 2XB6C 4EROA 1IKPA 3VBOB 4NIDA 1RUI1 4YG0A 3WSOA 1YQ8A 1J1LA 1REEA 2B9VA 3FWEA 5JR2A 1HRI2 2C26A 2JXAA 4GULA 4A44A 4XXPA 3H3LA 4GWJA 4IESA 4Q4X1 2BPA2 1ASJ2 3WF4A 4LA3A 2OX0A 1MS0A 2HJIA 2W1WA 5BNNA 2A75A 3ZYPA 3LIGA 4OULA 4Y4YA 5T5PA 4ZZ5A 1MS4A 2DVFA 4Q4X3 3AZWA 1A6CA 2QKDA 4AFCA 1J58A 2KXLA 4NROA 4E4DX 3KV5A 4ZU5A 4OQ8A 3OGRA 4C0BA 3RZGA 5FOJB 4I0WB 3BOWA 1DBNA 1N47A 1QOOA 1XNDA 4YW2A 1OMIA 4RL7A 1RIRA 3WNPA 5IT6A 4BWOA 1B35A 2WS92 1X82A 2HWB2 3JD72 4CP9B 3GXUA 1DYKA 5IFPA 1TME1 2E33A 4Q0PA 4AEKA 2W5FA 4QHZA 1VBB2 1IZ3A 1H9WA 5KHHA 4CUBA 1UPIA 2A5ZA 1AYM2 3LB9A 5K0UA 3TYJA 3UK9A 2D6NA 2VNVA 1GP6A 1F31A 3KQ4B 1EP0A 5L73A 3RMYA 2BVBA 1ZRDA 4EN7B 1ND3C 3QACA 3T0DA 2P3KA 5CFDA 2LROA 5FZCA 2HBUA 3D6EA 4JVAA 5ANQA 4Z92B 5FYVA 2RR12 2WZ8A 4AQ6A 5KWRA 1YWKA 1CESA 4UFHA 3ZO0B 1AF9A 4MGKE 3HNYM 1Y9QA 2W52A 3B93A 4C91A 4DZGA 4XUNA 2YXSA 2VMGA 1QH7A 4XQ4A 5F39A 2ERFA 4RGAA 1YEWA 3VD7A 3ZR6A 2VZ1A 2ZX4A 1UU6A 4OLLA 1O5LA 4Q5OA 4LBMA 3QD6A 4QX2A 1GLHA 2K46A 4MV2A 1IS4A 1AYM1 4LMFA 3U14A 5JOZA 1UN1A 2NLRA 2AC1A 3RZJA 3MV01 3AP6A 5FDBA 5FPLA 2XLGA 5FY7A 4TYSA 1ACCA 2HWF1 1KS4A 2Y6HA 3KV9A 1G9AA 3CKHA 4D0QA 1BJQA 5JMCA 2Y6GA 2JG9A 1S0JA 3NAPC 1OBNA 1J84A 3WP6A 2E51A 2EXHA 1YC61 2JENA 2XDVA 3N36A 5FRAA 1ZRFA 4FP2A 1DHKB 2RM22 1OD5A 4Y20B 5A1AA 4JQTA 1REFA 3UV9A 3FMGA 2RS52 4GJZA 4AEMA 5JIUA 1H1IA 4KWUA 2RDNA 5FZDA 1AR73 2ZHMA 3VD4A 1NAEA 3ZSJA 2VO5A 3C8XA 4RR3A 3MW2A 3RWNA 1NLSA 1ZX5A 2QQJA 1UZWA 3Q9OA 1X50A 3GCXA 1UCXA 3CF6E 3B7MA 3KVBA 4R9BA 3U10A 2FDGA 3RNSA 2C0ZA 2VZTA 3NJVA 3Q8BA 5I0RA 4Q4Y2 2JDYA 1ZRIA 4E4ZA 1BHGA 3H7YA 3NW4A 4Q26A 3AJZA 1PX3A 1WW7A 3SH3A 4BQYA 1YHFA 1Q8VA 1W6MA 2XH6A 5E88A 4BM8A 4PHZA 1KGYA 3VBRC 1PIV3 2P3IA 3S6PA 2JDNA 4AGRA 3VDDB 2XJQA 2RM21 4HLTA 4NRQA 4HSLA 3GF6A 4UFKA 5ISLA 4LUMA 4LORA 5A33B 4LBQB 1UIJA 3MBWA 4CCCA 1JYCA 1GQGA 2O14A 4HETA 4L92A 1VMJA 3PJYA 5FPZA 1IQAA 3HT2A 3SKVA 4RR3B 5C33A 5FAXA 2VG9A 3TN91 1E5RA 4RN5A 2PLV3 2ZOEB 2YC2A 4FTSA 5GLWA 3RQ0A 2WNEA 5KHGA 3VKOA 2HWF2 1W8OA 4QKDA 3CJXA 4KBBA 4ZONA 2Z5WA 2Y38A 1VMHA 3MIDA 3VDAA 2CHHA 2N7GA 2Q5TA 3WD5A 3DV8A 2Z42A 4CUGA 2ARXA 4YGCA 4D6RA 1YJLA 4LXLA 4L0PA 4NE9A 4AAXA 4B1MA 1WZXA 3OEAA 4ET7A 2Y6JA 5J48A 1NCRC 4D8MA 2E26A 5C8CB 4JDMA 2WN3A 2UURA 2YY1A 5DPNA 3CZUA 4N9IA 5KC5A 2YGLA 3LA7A 1RUC3 4FXGB 4WM7A 2EALA 5FZ0A 2FDIA 5FUPA 3KWVA 1IOAA 5DMYA 5T5JA 3LDBA 4XJ8A 5AFEA 2VXJA 5FYTA 3VL9A 2Y34A 4BMEA 2R042 3GGLA 1FYUA 2VBPA 2LALA 5FY0A 3U78A 2DU0A 1UYZA 2ZGMA 3WCRA 5T3NA 5A3NA 1KITA 5J1XA 3L2HA 2WC2A 3KGZA 3MLJA 2Q8DA 1UIKA 3MZHA 1BMV2 4YRDA 3AYEA 1RHI1 5I8YA 3CZJA 2CNAA 4FI9A 4BDVB 3PVOA 5HI0A 4GB33 5FZ4A 3SCFA 3JB4C 1XPWA 2ZPXA 3POWA 4ZS2A 2C9AA 1NY71 4DRRA 5LEJA 1LGNA 1U5YA 3MPBA 3X29B 3C7HA 1QXJA 4GWIA 4CCMA 4Y22B 2WRAA 5L9VA 4P9IA 2WYFA 1H1AA 3AJYA 2D6MA 3RJ2X 4DFSA 2VOTA 4XUQA 2YC0A 1K5MC 2ZEZA 1TZOA 3N9NA 4UWDA 5C3PA 5BNPA 5CBLA 2IXHA 2A3WA 3LD8A 2KR2A 3IDEA 4IERA 2WNVA 3E97A 4BQ2A 4LLOA 1R091 3LEIA 2RDRA 1D7PM 4FOQA 4UBGA 4XILA 4Y33A 3ECQA 2OKXA 2W68A 2XVKA 3LEGA 4ZZ8A 2GC2A 4UBHA 4QX7A 2GP5A 2C24A 3ETQA 5BNOC 4DRVA 4HZFA 1CAWB 1A3KA 2P4EA 1ULPA 3WXPA 3ACFA 4M0HA 2WNOA 1RVF2 4QX8A 2JDPA 2VMDA 5FZOA 2IVIB 3MFCA 2NYYA 1JYNA 5CADA 1AL22 2XKOA 4XVHA 2LTNA 4IEZA 1HQNA 4OI1A 3KT4A 5FMOL 2JDAA 2R041 2RMU3 5IVBA 1FOD2 4AVSA 4F83A 1PMIA 5F37A 1BYHA 2CYFA 1AYN1 2GH8A 3WQ1A 1LOBA 2ZGTA 4XFGA 3VZMA 1ODMA 1UY4A 2X5IA 3AMMA 2VMEA 1IGOA 1RUJ1 1OLRA 2ZACA 3NJYA 1RUH1 5FUIA 4BMBA 4ZU7A 2DF7A 2W1SA 2HH9A 3M3OA 4UI9L 2B7YA 5T5OA 2UYBA 2WQZC 4CP9A 4RFRB 3WW3A 4C8DA 1MPXA 1VRH2 2ARBA 2J1AA 4QQ2A 1VIWB 4O61A 1O91A 1SFPA 2ZJCA 1RUE3 2G9ZA 2HWB3 3JD73 4MOAA 2DTYA 4JDNA 2R7EB 1GFF2 4AF9A 5A6ZA 2IFRA 1RITA 2MEV1 5FBZA 1COV2 1W8ZA 3DKWA 4BOWA 1AYM3 3I2KA 4K21A 4QPWA 5TSWA 1X7NA 2DTWA 1FX5A 4A7YA 2ZEXA 4XFIA 1W6PA 4JKKA 2A71A 4N53A 1U12A 3N4MA 1E5SA 1W2NA 2GU9A 4KWJA 4PBPA 3NV3A 5EP9A 5GLZA 2DCYA 5FPXA 2D3SA 5DDJ2 5LRSA 3SLIA 1Q3EA 1PGW2 1W28A 5C9AC 2P6HA 4U2AA 1OQEA 2YMZA 5LB6A 2XUEA 1AR82 1UYYA 1WCSA 4YWAA 1ULGA 2WL1A 3AP7A 4B8EA 1NUKA 1O3RA 3M1HA 2WA4A 4L11A 1R083 3TNPB 4LJHA 1US2A 1HDKA 3AP4A 1SMVA 1MZ6A 3C2UA 1H1MA 1XU1A 5HV0A 3I2IA 1S0FA 1GP4A 3GYDA 1GNHA 3N9MA 3MUZ1 4QB2A 4QPGC 1HXS1 5FP9A 3OUHA 4YW3A 3VBFA 2D3PA 3BCWA 4KH9A 5CG8A 5DZFA 4HBNA 2FD8A 1U5IA 2B46X 2F4LA 4AI2A 1J3PA 3B00A 1F4HA 2WUHA 3EMRA 4MXWB 2W1QA 4I30A 2MHFA 1QDOA 2QQLA 5JLVA 2BQPA 2QQKA 3HT1A 4D94A 1PM4A 3LIHA 3POIA 1A8MA 1OA3A 2Q30A 1JYXA 1FPN2 1KDKA 4YVSB 2GMEA 4ES8A 5IVYA 4CYDA 2VZRA 2HWC2 3TEZA 5C8WA 3SNMA 1COV1 1QGLA 2D43A 3R6SA 5B2GB 5G04L 2OQ6A 5C5UA 3ROUA 3ZFFB 4AHXA 1XQNA 5AC91 5LK5A 5BNPC 4GIQA 4QPGB 3HQXA 5E16A 2VAUA 1WMXA 5E1RA 4AI1A 3ZXEA 2ZAAA 1RUF2 4IETA 3JQXA 2WLPA 3LF7A 5F2WA 3B9IA 5LBBA 2HEYF 5A7NA 2ZMKA 2CGPA 2Q1ZB 1AXKA 5T52A 1JI6A 1GP5A 3GCWA 1AR71 1H4GA 2C4XA 3GZTB 2BZDA 4MXVA 5A3LA 4DEVA 1X9TA 2A70A 4GALA 1RVF1 3VKNA 2E31A 2GN3A 1AR92 4J25A 4M3CA 1QJU1 3J7LA 4YFWA 5LCWL 4IUGA 4XAAA 3I2FA 4BQWA 4LTAA 4COWA 5FZFA 2DU1A 3I3MA 1KRIA 4ZHNA 2GNMA 5JVVA 4ZPIA 3KVAA 1RJ8A 3ZFFC 3MYXA 2HLEA 4WM8B 4YVWB 5E89A 4LO7A 3HIFA 2D97A 4RYDA 3VD3A 3WX5A 1RUH2 3CJIA 3I49A 3FFQA 4PT6A 3WW4A 3M4FA 3ILNA 3NRUA 1VBA1 4HANA 4P14A 2PHFA 2YHJA 4TWTA 3QOPA 1OUXA 1F4AA 3IDAA 5FK7A 5KR7A 4LKFA 2JD9A 2ETEA 5DUXA 5LA0A 1H8TC 4XABA 5F3GA 3BTXA 4ZY9A 3KMHA 1V00A 1XJAA 4A42A 2Y0OA 4NO4A 5C71A 5B4NA 1ASJ3 1O59A 1YIPA 2EA7A 2IC1A 5D8AB 1ALYA 4F3JA 5C9AB 5I8SA 3ZXFA 2G1MA 1QWRA 3R0RA 1DZTA 4JRLA 1HQWA 4HVQA 1ASJ1 2QUOA 1WBLA 4ATFA 1JZ2A 1BQPA 4XZPA 1QQP3 4YVWA 1RB8G 2VBDA 5A3OA 3WT3A 2Q4SA 1W9YA 1URXA 2OVUA 1OC1A 2XG3A 1DF0A 3HR9A 4GH4B 4Y5Z0 2EVXA 3ZXDA 3WEZA 2FZ2A 4FPFA 2V73A 1UF2C 1PO12 3MI8A 1SACA 1I6XA 1MS9A 1XU2A 4MADA 2BFUS 3H1YA 1J1TA 2X53S 2Q8OA 1HW5A 5FMBA 1CZTA 1UW8A 3AYCA 3AL5A 1SLIA 3MLKA 2W39A 3MPPG 4ZS3A 4A6SA 4ISRA 3Q8EA 2ZGRA 2XJSA 1JOJA 2BRTA 5FY9A 5LEKA 1IS3A 3WUDA 4QT6A 2HEVF 4BLJA 1UZYA 1UOFA 3UJQA 5C7GA 1AR61 1W8TA 1OF4A 3P1IA 3IDCB 5D21A 3K4ZA 5C6CA 2YYOA 1DQ1A 1OUSA 3D0JA 5HCAA 4YLZA 3CL1A 4A45A 1Y3TA 1SLAA 3HBZA 1RUI3 4GH4A 4UYBA 4Q29A 1GOFA 2AEZA 3IAPA 1XB9A 5H9PA 3LDKA 5F5CA 3POJA 2PAEA 3O0XA 1DYPA 1EV13 4AVAA 2B42B 4FBFA 1GU3A 4WBBA 1UXXX 3SCGA 1DP0A 5FO9B 1CGPA 1YFYA 4Y1UA 1O4ZA 5F3IA 5IFTA 2WNVC 1YQ5A 5EYYA 2DBNA 4E27A 4AGGA 4P08A 1AL23 1ENXA 2AZ5A 5CVRA 1EUUA 2RMU2 4JGYA 4KNCA 4LITA 1JZ8A 4EN6B 3LE0A 4CDXB 1K42A 1HQLA 5C3OA 5L19A 4TZDA 2RS53 5DABA 3PHMA 3U07A 2VQAA 4XIKA 4E8DA 5LA1A 1RYYA 2RG4A 1OLQA 3OY8A 4GMP1 4LBQA 1ZZ8A 3AP5A 4PQQA 3NV1A 3SEEA 5FLJA 3VBUA 3Q8CA 1NYWA 5A1LA 5FV3A 2XXZA 3ILRA 3ST7A 3HNBM 1HRI1 4QU2A 4TLGA 1UY1A 1UZZA 1N1VA 1V9U1 4JC1A 1LHNA 5K0UC 4FP3A 2C6SA 1W6PB 3O1UA 3LFMA 2OIIA 2YC4A 2ZXQA 3IIIA 3PL0A 5CFDC 5A6XA 5F3CA 1W9SA 1ND3A 3KGLA 4RS5C 2JG8A 2ZZQA 3PUIA 3UKVA 1VP6A 5C3QA 2VUAA 4Q4V3 1O3SA 5IAXA 1TNFA 2JDUA 4BPZA 1OKOA 2RS31 5FZ1A 1Q43A 4G4FA 1J3QA 2BW8A 4C1WA 3FUOA 2E63A 4FPCA 2UY8A 1CQ9A 3NJXA 4XJAA 3ZIWA 2NN8A 2XLFA 4FPYA 1DGLA 2A3XA 5IW0A 2BUKA 5ABJA 4MSVA 4ASKA 4CA9A 4Q2FA 4N53C 4HVRA 1GYKA 2P37A 1MS1A 4K20A 2PQSA 5CFCA 2Y33A 2WN2A 5HXMA 2R062 2J1SA 1SBEA 3ZYIB 1BVP1 2I07B 2PHLA 1MQTB 5F6KA 1QHDA 4YNIA 2FMYA 3B94A 5F8PA 3WG2A 4W65A 1Q8OA 3GM8A 5A6QA 4QDQA 5FR3A 5FWEA 2G19A 4CEWA 1ZZ9A 3SC7X 5EHDA 4CCKA 1NZCA 4PCRA 2VM9A 4K8FA 3N7JA 1QXRA 5DG2A 1PM7A 4XDQA 5C70A 5FY1A 2YB7A 2Q8EA 1VLNA 2CDOA 1V6JA 3GZUC 2RJKA 4XFAA 3AZZA 1KFXL 1H2MA 1EY2A 2DUPA 1YUDA 4NMIA 5EJZB 3SCHA 1S0DA 1QU0A 3JCIA 4BLIA 3T2OA 1MEC3 2ZA9A 4FPEA 4I02A 1H6XA 1FV2A 3HD8B 4NWWA 3WDYA 3A4UA 4XF4A 2BDRA 2VXRA 2XJUA 1RGSA 5HPOA 3J7HA 2O1QA 3POEA 4K40A 3ZSEA 1O5UA 5T5LA 2WNVB 3EB7A 4PBOA 1VBE1 3WNLA 4YGDA 4GD4A 3T4HB 1PO23 3MIHA 2QQOA 2ZEYA 3C3VA 5EYXA 4QKFA 4NIIA 2R073 4PIXA 1VBA3 2WWUA 3C7FA 4LPLA 4AR2A 5FXXA 4OFGA 1AR91 1LTEA 1VBE3 4BQ1A 1ZRCA 3W20A 1O4YA 2VOKA 4H3WA 4CXXA 1GQHA 2AGSA 4IE7A 2R071 2RVAA 1YQCA 3AZXA 3K48A 3E5XA 4J1WA 2ZGQA 3RZZA 1SPPB 1QNYA 2BBVA 3NNMA 3BU7A 3FZ3A 2W87A 5FYIA 4H7LA 3M3EA 3KHBA 1GNZA 2DVGA 3O7OA 3VL8A 1Y4WA 4WM8A 5A3PA 5FZLA 4WV8A 1N3QA 4O9GA 1ZBE1 2WKKA 3PVEA 3NJZA 1YFUA 2VE1A 3VHOA 1OT5A 3CDZB 1ZA7A 3V64A 5IATA 3WUCA 1GOHA 5HV4A 3ACGA 3ZFGA 1UAIA 5FY8A 2D5FA 4QWNA 1ZZCA 4S2HA 4DS0A 5FWJA 1H0BA 3AKRA 3CIHA 4PI0A 1RUC1 3Q8AA 4GWMA 1LU2A 3PUHA 4FSJA 5FYCA 4O65A 1DGWA 1NG0A 2OZ6A 1RVF3 2PHDA 4K3UA 4QHBA 3ZDSA 4LOTA 3POBA 2UWCA 2D5HA 3OPZA 3PVNA 1S2EA 3ZXAC 3W21A 4WM7C 1JW6A 2P3JA 2ZHNA 4CP0A 1W39A 3N3HA 3WINE 2WO3A 3M2MA 3LGRA 3IZOA 5J37A 1SFNA 4V2VA 1DIWA 2XWJB 2WT2A 4N53B 5A7QA 4ES9A 1OI6A 1ZBA2 4NAMA 5DZEA 3GALA 3VDBA 2CWMA 2JG9B 3EYPA 2EICA 2P34A 5BNOB 1JZ3A 3H9AA 1QJZA 4XQDA 3WHUA 4ASLA 1W2AX 5JXGA 1ZREA 4Y20A 5IK8A 1XYNA 3LQCA 2QTWB 1LAJA 4JGZB 3S0MA 1PO13 4HFSA 4BQ5A 4XACA 1CIWA 5LASA 2TUNA 1STMA 5FZAA 1UKRA 4YW4A 3RZMA 4P02B 2QCSB 1C3HA 2ADEA 3V0BA 1JUIA 1QJX2 1AL0G 2HKXA 3BTAA 4N7IA 1F35A 1ZRRA 3BVCA 3QCWA 3N9QA 2JDKA 1KEXA 2VTXJ 3HOBA 1FMD3 4CU7A 3LA3A 3I59A 4B7KA 4NRPA 1ZNPA 2I45A 3WDVA 5M0TA 2B4KA 3VDDA 1RXGA 2BFUL 3OYWA 2RS51 4I09A 4AYUA 4CCNA 2CTVA 1V0AA 4P9GA 2F6BA 2X5IC 4GMP3 4EWDA 4Z82A 3AB0A 2JE8A 3OOXA 2YG0A 3OGJA 1NCQA 4JGZC 4I3PA 4JQRA 2BERA 2F17A 3OD0A 5FFOC 2I74A 3PTRB 4K8RB 4V2WA 5C8CC 4Y1VA 5KC6A 2NP0A 4CPBA 3ZM8A 4SLIA 1G86A 1LHWA 3V0BB 2CV6A 1E5IA 1RUOA 1UKGA 5KHJA 3OPWA 1NE4A 1D4VB 4LO4B 2JX9A 3ZFEB 2V4AA 1JTZX 1V6OA 1LGBA 3T1MA 3T0AA 1E57A 1C28A 1NQDA 3CU7A 4FOVA 4P00B 3N9OA 3OEBA 5FBJA 1Z78A 3JXSA 4NWVA 4E4HA 5FMOS 4AHZA 4BCUA 1UMIA 3I2JA 4CXWA 3CMGA 5JXHA 4OYUA 2ZMLA 4LKEA 1DGWX 1XBFA 1RUG2 3RI8A 4ITCA 1SLLA 1B35B 1UYXA 1WCKA 5A7OA 3SHRA 3AKTA 1VJ2A 3LFIA 4XW3A 2D98A
chains in the Genus database with same CATH topology
2EXIA 1FOD1 4D7YA 3WNXA 4C0HA 2ZKLA 1D2QA 2RS32 4RFT0 4CEYB 1CAVB 5IK4A 4YARA 4OHWA 4E4SA 3VBFC 3H3UA 5JI9A 3B02A 4IEVA 3FBYA 2EXKA 4D69A 1EAH1 5F1RA 1T6GC 1DGRN 1FPN1 3AX4A 1G9FA 4Z8BA 1LR5A 2GDFA 2X29A 3P3PA 4AVVA 2EF6A 1GICA 2O8OA 3ZN4A 5CFCB 4CDWB 1EAH3 1BEV1 3N35A 5BNPB 1B35C 4HN0A 3KCCA 4N43A 1ZZ6A 1OA4A 1C8NA 4Q0QA 1W0PA 5GZFA 1AXZA 1TNRA 4UW6A 3LZZA 1CAVA 1CAWA 4B7EA 3WP3A 4MH0E 4UXAA 1RHI2 1G9DA 3ME2A 3USUA 2PELA 1KJRA 3ZX7A 5JR7B 4P9WA 5FO7B 3WQ0A 1UU5A 4CDUA 3KCYA 4FOYA 1SBFA 2YGMA 4FPLA 4IEPA 3VBSC 4O9EA 2X5IB 3GHMA 4Q4X2 1SBDA 4Q1RA 4QPYA 1MS5A 1HLCA 2XJVA 2NMOA 1PZ9A 5LK7B 4IXLA 2VQ0A 4HMZA 4YYOA 2VMIA 4COYA 4B4RA 3IMNA 1HV1A 3I4IA 4HVOA 1DQ6A 5SV5A 1YYNA 3NWKA 2TEPA 1LEMA 2PYTA 4COZA 2BNMA 2WFF2 4P9YA 2VULA 4YG6A 2R49A 2ZGSA 4WVZA 3ZMNA 1AJKA 2HWC1 1G6NA 1AUYA 4CDUB 3N7KA 3KLSA 1H8TB 5CNAA 2XL7A 2A7AA 3RJRA 3AFKA 3ZXKA 3LAGA 4WZCA 2BVVA 3NVCA 2VNOA 5H9QA 3ES4A 5FLHA 2WT0A 3FC0A 1BXHA 4KL1A 2H0VA 1JH5A 1A78A 2KM2A 1BKZA 4GH4C 3ZMOA 2QFEA 3VBFB 4TSVA 1V6KA 4UW3A 4WZFA 3WVJA 1ZVFA 4KU8A 1WUVA 2R1BA 2DFCA 4KWLA 2E53A 4H7MA 2MNGA 3G7DA 1ND3B 2A73B 4XETA 4L97A 3WP5A 2WZR1 3RSJA 5JDBA 1GV9A 1SCSA 1WA4A 1AJOA 4OUMA 4MXWA 1LKNA 2HEWF 1SLBA 4AWDA 1VBD1 4JGZA 2WZR3 3USSA 2O0OA 3AXEA 1QJY1 1CAXA 3ACLA 4UW4A 3WG4A 2NZ9A 4A7ZA 2DUQA 3D8CA 2E6VA 1OFSA 1V6IA 1W6QA 1XNKA 4ZXKA 4Q4Y3 2DWRA 4FO9A 3LSDA 3B01A 3AXDA 4HK9A 4J6GA 4XF9A 1AX2A 1LHUA 2UY9A 1VB4A 2WWSA 1BCXA 1YI7A 2CGNA 4YFZA 2RS11 1VAMA 4EN8B 2AUYA 4J1XA 4ZKTB 4DQAA 1FATA 5JSOA 1O4TA 4NHLA 2ZGNA 4JV4A 4LE4A 1FMD2 5FQ0B 1QOTA 1ENSA 1I1EA 4Y1YA 4OVEA 3AKQA 5DDJ3 4LBQD 4CDXC 1JYIA 3OF1A 5GALA 1TMF3 1Z7S3 2G9GA 2GN7A 4FVVA 1PGL1 1RMU2 2HWD1 1MS3A 2R063 3PNAA 5K0UB 1R082 2ZZJA 1XXNA 4LBKA 3DL3A 4AEDC 3WDUA 2R061 4RS5B 1D4M2 4HK8A 3ES1A 1RUJ2 3SH4A 4L9BA 4XF3A 1MACA 2H0BA 3DPRA 2EAAA 2UWAA 4R9DA 3AM2A 1JN2P 4B29A 4RQPB 1RUC2 4H14A 1DDLA 4LNVA 2UU8A 4Q4W1 4R9AA 2Q0AA 1FPN3 2BNNA 4E9KA 3LSEA 3FLPA 3LOBA 3S7EA 3VKFC 1RUG3 1ND2C 2R043 4NVPA 1NXD1 4FPOB 1OPOA 1D4M1 2GZWA 5I0UA 4CEYA 4Y1XA 4XBNA 3JU9A 3ZFGB 1C8M1 4BYYA 4AHYA 4LO5B 1SDWA 4FXKB 3CLPA 1CX4A 5JZGA 4RA0A 5BNQA 1TEIA 2VW2A 1BK1A 3DGTA 2DYCA 3IN9A 1AX1A 4N43B 3VUOA 1X36A 3KCXA 5AVPA 3RPQA 1V9U2 1HRV3 4AFMA 1CJPA 2PAMA 3DF0A 3E6BA 1W6MB 4YGEA 2BWAA 5AC93 3ZXJA 4FT8A 2ZKNA 2Z69A 3WW1A 1D0HA 4PIYA 3B69A 2LM3A 3MW4A 1I3HA 2DCKA 1BBT2 5A33A 1UD1A 5JZGB 4JAAA 4DOUA 3IM0A 2XBO2 1AX0A 3VDDC 3WOGA 3VKLA 2QQPA 4ATEA 4YZ1A 1UU4A 2GC1A 2AH2A 2VGDA 2CL2A 1S0GA 4NR1A 4AI3A 4DPNA 4M01A 5KXCA 4XF0A 5AVAA 1MS8A 3V0AB 5T50A 2NMNA 5A3MA 2CWSA 3O0VA 2JG8C 4CDXA 1QQP2 1DQ5A 4PQ9A 5DZGA 1CAUA 4L99A 4LT5A 3CNAA 1PNFA 3VZKA 1H2NA 1G7YA 1OOPC 2K2SA 2GC0A 1PGSA 3L9JT 4KGGA 2VMHA 1QF3A 4WM7B 2DFBA 4DINB 3D5OA 4XFCA 4GQ7A 5J09A 1D0GA 5FLIA 1VAKA 2DCJA 3VBHB 4L2NA 2OUHA 4YZ2A 4PIZA 2FQPA 4OZXA 2QE3A 2JG9C 2E7TA 1K5MA 1REDA 2VU9A 2XKPA 3AZVA 3TB0A 1ND2B 2JG8B 1OQDA 3FLTA 4TLFA 4FAGA 4LBLA 2GAUA 2TNFA 1AR83 3POSA 1RUI2 1C57A 3IKWA 5JWPA 1LECA 1YO8A 3WDXA 2R1DA 2XJPA 2VNGA 3JUUA 1GZWB 3BALA 1WLDA 4ORFA 1PZ7A 4U36A 3ZYGA 4AW7A 5KHKA 1OPMA 5C8CA 2FHRA 1AYN3 5H9SA 2WZPP 3VBHA 4CDQA 2VPVA 3VBHC 4AEJA 1RC6A 1KS5A 2JD4A 2DV9A 3ASIA 5CG9A 2OUJA 1YCIA 4B4PA 4IL7A 1S2BA 1ND2A 1N1TA 2XWBB 4GB31 2AYHA 4D7SA 1YFXA 3WR0A 4A7KA 4Y26A 1ULFA 1W6QB 1F5JA 1W2UA 1YXWA 3TOJA 2ZTNA 2HWD3 3VLBB 2ATFA 3MF6A 2R0FA 2GMPA 3LKJA 4KG0A 2GALA 2DCZA 5FQ0A 4MX3A 2JECA 2AENA 1CPNA 4F7ZA 2FZ1A 4LLFA 1VBD3 5L7OA 5K7PA 2YV8A 1DQ0A 3VZJA 5JIAA 2D93A 4D3WA 1UMZA 4N90A 4ONUA 5JAXA 3ZYJB 1EAH2 5D8AA 3FHIB 1XE8A 1ENRA 5C9AA 1WBFA 5CU1A 4C90A 4AK3A 2WSUA 1FXZA 5JPMB 5GZGA 3WQ7A 1AR63 1GR3A 2DVDA 5EZWA 5FOBB 4UW5A 3VBRA 1FT9A 1D4M3 1G8WA 3ZIXA 5GZDA 4Z1VA 3H1MA 2IXLA 3ZN5A 5SV8A 1IS5A 1C8M3 4Q4V1 5DDJ1 3MEPA 1YLLA 3JZVA 1PGW1 4KU7A 2PFWA 4Y1ZA 5BXXA 1EV11 5FREA 2ZAHA 1KDMA 3E6DA 1N1SA 3ZXGA 1FNZA 5CA6A 2ES3A 2WNUB 4JGYC 1MEC2 2LUWA 3WDTA 3R4DB 2QZ3A 2YUEA 3R4SA 1RUD1 2K0GA 1HV0A 1QH6A 3PTYA 3VV1A 1W6OA 3WG3A 3AYDA 4QGLA 5JSPA 5GJ6A 4HPKA 5BNOA 1PO22 3KB5A 2XHKA 1DU3D 1EYBA 3M8LA 1LRHA 4FCAA 1Z0HA 2YPJA 3WDWA 1QJU3 2ZGPA 3KT7A 1LHVA 1QMJA 1RUG1 2C1FA 4KQ7A 2R0HA 4BHPA 3N7LA 2GNBA 4CDQC 1O7FA 4X8NA 4JGYB 2MEV2 5IK5A 3MIFA 4FAHA 2B8MA 3B9CA 3PLQA 2G9FA 1WD3A 4QGNA 3OYWB 1NA1A 1N1YA 4IEXA 1BBT1 3I59B 1PZ8A 1ENQA 3D0SA 2A6ZA 1IS6A 4QX5A 1PO21 1H2KA 5F9TA 1AVBA 3HAGA 5A32B 4HKWA 4Q1PA 4BH9A 3I54A 4N7UA 2GMMA 1BBT3 2ZHLA 3KT1A 1GZCA 4XTPA 4IV3C 1MZFA 4P9LA 4AQTA 2XBO3 4X6QB 4CDUC 1NCQB 4OI0A 1RMU1 2B39A 4HSJA 3V65A 1ZA4A 2F4PA 1RUD2 1LU1A 4CEWC 1RUNA 1HKDA 2W0XA 4Q27A 2KA3A 2IZWA 1OOPA 1YJKA 2B9UA 1KD7A 1WMDA 1Y43B 2D44A 3OD4A 1ZBA3 1BMV1 2D40A 1OFNA 2E9QA 4QQPA 5JI7A 4OHZA 4XOGA 3NL1A 4IQPA 4XE9A 4YVWC 3MIBA 5ABJB 5A32A 4OI2A 4M3CE 5F6LB 2PTMA 1CONA 4YSFA 2WS93 4C1XA 2A3YA 1BEV2 1QJX1 2IXJA 1I9RA 3E6CC 4AI0A 3GZAA 4CP2A 1D2SA 2MPFA 1DLLA 2ZBJA 1SQ4A 1LOEA 2DVAA 2XUMA 1WGPA 1QJX3 4AFBA 1CN1A 3H1WA 5D8AC 1WW4A 4I2OA 3KD4A 3OBTA 4K7JA 3QBQA 3SXWA 4XFHA 4HKLA 5BV6A 5GLVA 4RQPA 1H9PA 1LESA 1ULEA 5KXDA 3J4UH 4JTNA 1LENA 4FTBA 4F8AA 4IV1C 2A6VA 2ET1A 4CDWA 1ZYBA 3V56A 4YZ5A 4WVWA 1L3JA 2RS12 3JBG3 2Z79A 4I0BA 4GWNA 2WA3A 3AP9A 4META 3VKMA 5CFDB 1VBC2 5JCTA 3I2DA 3J8F2 3NKGA 3TNQA 3BODA 1PNGA 1QJY3 2W08A 2A6WA 4XHBA 4EV0A 5JOXA 4PLOA 3GBWA 4MUVA 5H9RA 3BPZA 5GM0A 4FPJA 2YZ4A 3WCSA 4B3NA 2QJVA 4K1ZA 4LUKA 1IPKA 3AMNA 4GKXA 1KXGA 5GZEA 5AFBA 1QNWA 1TME3 3ALQA 3DUIA 1LB2A 1MR5A 1KQRA 5D1IA 4AEDB 1GBGA 2PQQA 3NSTA 3JB8A 4LBJA 4CRQA 4LHLA 5JSRA 4DXZA 3FLRA 1NCQC 1MZ5A 5DUVA 5IUQA 1LOAA 1VBA2 2RS33 4RQPC 4LBOA 1VBE2 2R6QA 1SLTA 1VBD2 4LE3A 3A0KA 4R4XA 1X8EA 4QQOA 4CTEA 3MLLA 3AMPA 4YW1A 2CGOA 1F2NA 1OSGA 5I0SA 3DPRC 1Q8SA 3TWIA 3EXUA 1POV0 2IWGB 4GMP0 1V6NA 4QQLA 4Y24A 3IDBB 2D7FA 2O8QA 1WLWA 5ABJC 4AEDA 1NXMA 4LO8A 5FTTC 4QPIB 4R8HA 2A6XA 2HWE3 3RG0A 2HWF3 3J26N 1WW6A 3WV6A 1LOGA 2D3RA 3M3CA 3S30A 1ONAA 2AR6A 1IKQA 1R093 3T2TA 4AXOA 3IBMA 2HWE1 1NE6A 3ZFEA 2JJ6A 3AFGA 4L8QA 3VZLA 1U0AA 2I2SA 4ASMB 3WY6A 3NKTA 2AREA 1HRI3 1J59A 1H2LA 5E8AA 3HWJA 5DUWA 2WNUA 1MEC1 4A3XA 5I93A 1HIXA 4KG8A 4MGIE 4N43C 4XJZA 4XYXA 1H30A 4H55A 4PLNA 1RTVA 2BNOA 1ULDA 3NO8A 3TBDA 1QY4A 3P3NA 2R16A 4XPVA 1HXS3 4IEUA 4COUA 4FQ4A 4XMAA 2ENRA 1DZRA 1S2KA 1Y7BA 1ZZ7A 3R4UA 4HPKB 4QQHA 1HX6A 5ACA3 1VR3A 4PLMA 1JHNA 2ZX2A 2FMDA 2PA7A 4DNYA 3AYAA 2WFF1 3OBRA 3ZPYA 1RL3A 5KXBA 1NCRB 1LCLA 2ZX1A 2NPIA 2XPJA 1VBB3 3I8TA 4Q0SA 2D6PA 3MFAA 2WFF3 3KZ4C 2IXCA 1Q5OA 4JDOA 1VBB1 1PVC2 4X8PA 5GLTA 4XTMA 3KSCA 3BB6A 1NA1B 4URTA 2B45X 2XVLA 4NHKA 2FBEA 2QDNA 2Z2SB 4NPRA 2UWBA 1V70A 3WLUA 3OGGA 4MGZE 1FAYA 5KHIA 2QZ2A 4MLOA 2XL9A 3VHPA 1H4HA 2V5YA 3O0WA 5EV7A 3RI9A 4Q4W2 2CAVA 4B4QA 2CY6A 3QH6A 1UPSA 2ZMNA 2VVEA 3IT8A 5HCFA 4EN9B 3USUB 4COVA 3L2YA 4P9XA 1OOPB 4K1YA 3EHKA 3FJSA 1OKQA 3M3QA 1PIV1 3PMSA 1IPJA 2DVBA 4P5HA 4V1PA 5BYNA 4CEYC 3DPRB 5EFUA 1S0CA 5BNNB 1JBCA 4I3GA 2RM23 4IEWA 5HCBA 1C1LA 3BIWE 1C5IA 3HN1A 3B5LB 2Y0IA 4NHMA 2WJSA 3J9SA 4QXKA 1VRH1 3INAA 2VECA 1POV1 2XVGA 4QGMA 2PHTA 4S2GA 4CDWC 5CB7A 2XBO1 4NOTA 3VBSA 2HWD2 3WP4A 1VRH3 3EBRA 4EWEA 3EO6A 3RS6A 3RYKA 1RUE2 4LA2A 1ZBE3 4FPKA 4SBVA 1FV3A 1NLRA 4ISQA 3H8UA 2ZGUA 3MIEA 5CIRA 1PIV2 1H8TA 3JBG1 1TE1B 4OHXA 3AKPA 3ZFEC 1WCDJ 1OA2A 3LWCA 1X8MA 2EAKA 3MIGA 3U11A 2OA2A 3M70A 5DG1A 1TMF2 1DQ4A 4JTOA 4FPHA 2UYAA 3ZYRA 2H6CA 3VBSB 4D7TA 3IPVB 4P9JA 4EN0A 2RMU1 2OPKA 1VBC1 1XNBA 5GZCA 2RS13 3JBG2 3O5SA 1RUJ3 1LGCA 1W6OB 1C8M2 1MVQA 4K9SA 1VBC3 1RHI3 3J8F3 5KBFA 3ZSMA 1QJY2 4W6YA 2XJRA 3RMXA 3FFZA 5FO8B 1NA1C 4MYEA 4AFDA 1R1ZA 1KFUL 4QM8A 1TMF1 4AQSA 1VAVA 3SITA 4PDWB 3D82A 4KWKA 3TN92 3CEWA 1CJDA 1OHFA 4QD2A 1C1FA 3EQEA 4I0AA 1TQ5A 2RR11 3GHNA 3E5QA 5C4WC 4YZ4A 5C4WA 1DFQA 1PHMA 4YM3A 3H3ZA 1PK6C 4GB32 4LHKA 4W6XA 1LULA 4LR4A 1QJU2 2ZS6B 3E5UA 4RD7A 1PGL2 4XJWA 3WW2A 3LCPA 3CO2A 2ILMA 4GXLA 2TBVA 2GSYA 3EJKA 2HYKA 3A0NA 2PHRA 3ZXLA 2VOXA 1QDCA 5T54A 3THPA 4DB5A 1V9U3 5I0TA 3ZN6B 4QPGA 1SLCA 3QLQA 4YG3A 4DY5A 3M7AA 3VHRA 5C4WB 5JOYA 1WMFA 2IXIA 3AK0A 4MGYE 3FBMA 1VALA 2QVSB 1S1AA 3APBA 1GZ9A 1JUHA 5J98B 4NN0A 5HBAA 1WW5A 4INDA 1MZEA 3ELNA 2HWB1 3JD71 4AG4A 2BTVC 1LEDA 1NY72 4WVMB 3GNEA 2IFWA 1LJ7A 1F9KA 2DUOA 4XIOA 1RUD3 1FOD3 4CDQB 4S2FA 2ZCWA 3VZOA 2DCTA 3MW3A 4EJRA 5CAZA 2R30A 3HMYA 2JDZA 1WMEA 3KS7A 1V6MA 5EWSA 3ZN6A 2XLAA 3MF9A 3CJIB 3N7MA 2WZR2 5L7OC 4YVSA 1NCRA 4XFBA 3K51A 4FTEA 3WG1A 4I01A 2BYVE 2BEOA 3VBOA 1VB2A 4IV3B 1BEV3 2YROA 3QH7A 4RGGA 5KXEA 1Q8QA 4HT1T 3O12A 2X8KA 3U0ZA 4IEYA 4AGVA 5K8SA 4W6WA 4PJYA 4RS5A 1OQ1A 2ZGOA 4M0NA 1PVC3 2PHUA 2OW4A 1F5FA 4QM9A 4JRAA 5EJ3A 4CEWB 1S0IA 1XRUA 1I5ZA 4XEZA 1RINA 2GC3A 2VVFA 3CJIC 1Z7S2 2EIGA 5L7OB 1RMU3 2WLQA 5DXDA 4S2DA 4PF5A 4IV3A 1WLCA 4Q8KA 1N3OA 3URFA 2DURA 3AZYA 3PJQA 1UL9A 1HRV1 1BZWA 2ZHKA 3RDIA 3ZFGC 2NQYA 4ZU4A 3OTFA 1QQP1 4XXAA 1PK6A 5I91A 2NM1A 4IEQA 1V6LA 3VBRB 4BIFA 1XYOA 2G4IA 3POYA 1G9BA 4RSUA 1GKBA 3GBGA 3ENRA 2WS91 4AHWA 3SH5A 4XFFA 2HWC3 1GSLA 1LOFC 1TME2 4CZSA 2PHXA 1LOFA 1N3PA 1XNCA 4R9CA 4OHVA 4LHNA 1C5HA 1W6NB 4IV1B 4OHYA 3AMQA 4Z07A 1XE7A 4RHV2 1PVXA 4XJUA 2VOWA 1AXYA 1DZQA 1EPWA 1ZBE2 2A6YA 3I7DA 5FCCA 1RUF3 1WLTA 4QPIA 5J96B 2OYZA 1O3TA 3WHTA 4X6RB 4XHXA 1DG6A 1LODA 4Q4V2 1YI9A 3H50A 4BA6A 3KM5A 2VW1A 4AI8A 2BGCA 3NAPB 1AR93 5I8TA 3IPVA 2PN5A 1WD4A 1W6NA 4IV1A 2JE9A 3VZNA 5JOWA 1EPZA 1HRV2 2VVDA 2D6KA 1XYPA 3DN7A 4RHV1 1ULCA 3B3QE 4EWAA 4R52A 1YIFA 4OUSA 5AC92 1F8VA 1R1A2 2YDEA 1GANA 2WIIB 1AR62 2JE7A 1NOVA 4HN1A 4YZ3A 1FMD1 4AE2A 1S0EA 3W9AA 3H0OA 1APNA 4GA9A 3VGIA 2CAUA 3KQRA 3MDPA 2C5DA 2VNRA 4PDWA 3O14A 1U5ZA 2D6LX 3W59A 2XJTA 2E7AA 1ZM1A 3AMHA 3FE5A 4YW5A 2H6BA 2RHPA 5JPNB 4QPIC 2VW0A 1HXS2 4RR3C 1R1A1 3TRSB 3W58A 3ZFFA 2PHWA 5DUUA 1K5MB 1MVEA 5ACA2 5J7MA 1MQTC 1YRZA 3H7JA 1B09A 3OY8B 4AVTA 3IIAA 2SLIA 1Z7S1 3S7IA 2GNDA 3VBUB 2ZGLA 4Q8LA 2R072 3UJOA 1DGRA 1IHMA 4M3CB 1PO11 3JQWA 1FNYA 2ZGKA 5LRRA 5JZGC 1CPMA 3G6JB 1AL21 1DQ2A 1X33A 4E2SA 1SCRA 2ZX0A 1RUE1 2VUJA 2RR13 3MGUA 2MEV3 1C4RA 1S55A 2WT1A 4Q4W3 3UL2A 1J3RA 5J36A 1EV12 1RJ7A 2BWCA 3SMHA 1W0OA 4MVTA 4WVMA 3ZSLA 4Q0VA 3GBFA 4HKOA 4YM0A 3LOIA 5EXOA 3NV4A 4OI4A 4A2UA 4Y22A 5F5QA 1AYN2 5BPXA 1U5XA 3LA2A 1R081 1UX6A 2RE9A 5ACA1 1S0BA 4XF1A 1SFYA 4YGBA 2JICA 5CFCC 1LOCA 4FQZA 1AR72 3UKTA 4G9SB 5IK7A 3ATGA 1QXPA 3M3IA 4FPGA 2R32A 3UKNA 4E2QA 4DY3A 4DMIA 3VN4A 2WFPA 4LEJA 3ZSKA 1NQJA 4M00A 2ZX3