4YVSB

Crystal structure of the virus-like particle of a c4 strain ev71
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
237
structure length
224
Chain Sequence
b'GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
molecule tags Virus
source organism Enterovirus a71
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
total genus 28
structure length 224
sequence length 237
chains with identical sequence E, H, K, N
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvsB00
1RUF3 5BNNB 4GMP3 2RMU2 4RQPB 4FSJA 1POV3 3NAPB 4GH4A 3J8F1 4YVWA 1PVC1 1NA1B 1POV1 1VRH3 3VBSB 1AR81 5C4WB 4CEYC 1VBE3 1PO22 2XPJA 4EJRA 1X36A 4RR3C 1QJX1 4IV1B 4RS5A 2MEV1 1RUE3 3JD71 1A6CA 3ZFEA 5A33A 5BNOC 1QJY3 1HQNA 4WM8C 1VBD2 1K5MB 5CFCA 3ZFEC 3S6PA 5D8AA 4YVSC 3HAGA 4QPGB 3JD72 1AR62 1ND3C 1H8TB 1PVC3 2HWF1 1PGL1 1GFF2 1QJX2 3JB8A 3ZFGC 2MEV2 4JGZA 1SMVA 4Y5Z0 1PO13 1BBT3 1HRV1 3VBRA 1FMD2 1AYN1 5C9AC 5ACA2 1C8NA 5DDJ3 1DDLA 2RMU1 3NAPA 1AR93 5FMOS 3VBFA 1QJZA 4RQPA 1ASJ3 2BBVA 4NWVA 1RUJ3 1FOD3 1B35B 4Q4V2 2RS12 1PO11 2HWC2 4GB32 4LLFA 4CEWC 4RS5C 1Z7S1 4N53C 4GMP0 5JZGB 1VB4A 4Z92B 1POV0 1C8M3 1NCRC 1RMU2 3J8F3 2RR11 2X5IC 4RHV2 2HWF3 1TME1 3VDDC 2X5IA 1VBE2 2HWF2 5CFDC 1ZBA1 1AR61 5L7OB 2XBO3 1D4M1 3JB4C 4Y4YA 4WM7A 1NG0A 4RFT0 1ASJ2 3VBRB 2TBVA 1V9U2 1ZBE1 2WFF3 1AL21 1RUF2 4CDQA 2RS51 4WM7C 1BEV2 1FOD2 5ABJA 1EAH3 1VBA2 1AR91 4GB33 1NCQA 1VBB3 2WS93 4IV3C 5D8AC 4IV3A 1RVF2 2MEV3 1E57A 3CJIA 1HRV3 1C8M2 1FMD1 4N43C 1R1A3 5C4WA 5K0UC 5CFCC 1R082 2PLV1 5AC92 2HWC3 5BNPA 5BNNA 1ND2C 1RUC1 2XBO1 2R063 4RQPC 4Q4W1 1RUG3 3VBHA 1C8M1 5BNPC 4CEYB 5C8CC 1RVF1 5ACA3 1PIV1 1RUH1 1COV3 3VBFB 1QJU3 1AR73 4WM8A 1BBT2 1FOD1 1AYM2 1MQTB 1R083 4YVWC 4Q4Y1 1RUD2 5C9AA 3VBSA 1RUE1 2WZR3 1AL0G 1VBD3 4JGZB 2WLPA 4N53A 3DPRC 4RHV1 3ZFGA 1AR72 3NAPC 2RS11 1RUI1 1BMV1 3M8LA 2RM22 4NWWA 4GMP1 1EV11 3CJIB 1TMF1 5AC93 1HRI1 1ND2A 1VBC3 1OOPA 1HRV2 3FBMA 3VBOC 2HWD1 1TMF3 3VBUC 1RHI1 3VDDA 4CDQB 1QQP3 1VBA3 4CDUA 4CDWC 1AYM1 2BPA2 1PGL2 4CDUC 2HWE3 2DF7A 5BNNC 1OOPC 3JBG3 4CEYA 1PGW1 1NCRB 1AUYA 2RM23 4IV1C 4PDWB 1RMU3 1VBD1 1RHI2 1BEV3 2HWD2 2HWB2 3TN93 5A32B 5BNOB 4AEDC 4IV1A 1V9U3 4Q4V3 1VBC2 2R072 1HRI2 2R041 1EV12 2BFUS 2HWB1 1AR92 1MEC1 1PIV3 1W39A 4IV3B 5DDJ2 1BEV1 1ND3A 1QJY2 4GH4B 1H8TC 4WM8B 1FPN3 3ZFFC 1PGW2 1AR82 1RUG1 1K5MC 1PVC2 3VBSC 4Q4W3 3DPRA 4YVSA 4FTBA 5A32A 2R061 1NY72 4QPIB 1H8TA 4CDXC 1ND2B 4PDWA 4QPGC 4Q4X2 4QPGA 1OPOA 4FTSA 2X5IB 1NA1C 5K0UA 5C4WC 5BNPB 5CFDB 1WCDJ 5CFDA 1VRH2 2VQ0A 1QQP1 1MEC3 4GB31 4JGYB 1COV2 2QQPA 4QPIA 1FPN2 1IHMA 2ZTNA 3ZFEB 3VBHC 2WFF1 1RUH2 1RUG2 4CEWB 5ABJB 1QJU1 4YVSB 2R062 1RVF3 2IZWA 1AYN2 5ACA1 1AR63 1HX6A 1VBB2 2WS92 2ZZQA 1ND3B 1BMV2 4Q4W2 1RUI3 4N43B 1NCQC 1B35C 4N43A 1R1A2 2HWE1 1PO23 1VAKA 4Q4X3 4RR3B 1F8VA 1CJDA 1R1A1 1RUJ1 5BNOA 3LOBA 3VBOA 2FZ2A 5FMOL 1R093 1VBA1 5C8CB 1EAH2 1RUD1 3ZFGB 2HWB3 2HWD3 2WFF2 1BBT1 1NOVA 5CFCB 4BCUA 5C9AB 1COV1 1D4M3 5LK7B 1RMU1 1TME3 4AEDA 2RS13 3VDDB 1RB8G 2FZ1A 1RUJ2 5L7OC 4Q4X1 1PO21 1R092 2WWSA 5GKAC 2HWC1 1PO12 4SBVA 4FTEA 2PLV3 1TMF2 2BFUL 5JZGC 3J8F2 3ZXAC 5L7OA 4WM7B 1FMD3 4YVWB 2GH8A 1RUI2 1QJY1 3JD73 1VBB1 2WS91 5D8AB 4Q4Y3 1MEC2 1AYN3 1QJU2 5J96B 2R042 1AL23 1V9U1 1NCRA 4RS5B 1AR71 2WZR2 4RR3A 1RUH3 4N53B 4CDQC 1RUD3 1VBE1 1R091 1RUE2 4GH4C 4Q4Y2 1VRH1 1VB2A 3JBG1 1RUC3 4QPIC 1Z7S2 4CDUB 3CJIC 3VBFC 4CDXB 1Z7S3 1PIV2 1CD3G 1NY71 5FOJB 1AYM3 4CEWA 3IDEA 2RMU3 4JGYA 5DDJ1 4JGYC 1EAH1 4CDWB 1R081 2R043 5K0UB 2XBO2 1RUC2 5J98B 2R071 1HRI3 1VBC1 2PLV2 2GSYA 5AC91 1K5MA 4CDWA 1EV13 5A33B 2HWE2 1X33A 1M06G 1ZBA3 1AR83 4JGZC 2RM21 2RR13 4PDWC 3DPRB 1NCQB 3TN92 2ZAHA 1RUF1 1AL22 1ZBE2 1HXS2 3VBRC 3JBG2 4AEDB 4CDXA 1HXS3 2BUKA 1OOPB 2R073 2RS52 4RHV3 2RS31 1MQTC 1FPN1 1TME2 1MQTA 2RR12 1ASJ1 1NA1A 1D4M2 2WZR1 1ZBA2 1RHI3 2Y26A 1QQP2 2RS32 3VBUA 3ZFFB 1F2NA 2RS53 2RS33 5JZGA 4Q4V1 1QJX3 1OHFA 3VBHB 5C8CA 1ZBE3 1HXS1 3VBOB 5ABJC 3VBUB 1B35A 3TN91 3ZFFA
chains in the Genus database with same CATH superfamily
1GOHA 4NRQA 4OMDA 5T54A 5BNNB 1WLTA 2A3YA 2FBEA 3OUHA 4GMP3 4QQHA 4N9IA 3THDA 1POV3 2VUDA 5FPUA 2IFRA 4NR1A 4V2WA 3J8F1 3WP6A 5L36A 4QDQA 2L9LA 3O1PA 3FUQA 1AR81 1MS5A 2QQKA 4W65A 2VH9A 1PO22 3DGTA 4TYSA 1TG7A 2EAAA 3ES4A 5A1FA 3H8RA 1X36A 4RR3C 2Y6KA 1MS1A 3HJRA 3K2OA 5LA9A 4IETA 4S2HA 1IPSA 3R05A 1CQ9A 2ZHLA 4B7EA 4RS5A 2B5HA 2MEV1 5FRAA 4DS0A 1XB9A 2J1RA 2PHFA 3E6CC 2DU0A 1HN1A 4W50A 3GF6A 4LHLA 1CAVA 1HQNA 4JHZA 4MYEA 4R4XA 4AFAA 1W8UA 3V64A 2IVIB 4GIQA 2BVVA 3ORJA 3LPGA 3C7FA 3FJSA 3S6PA 5D8AA 1IS4A 4D7YA 4X6RB 3VZJA 2WFPA 4IGOA 2IFWA 2DCJA 4DEQA 2IXIA 1YNAA 1O91A 2VOVA 4OCTA 4LE4A 1O4ZA 4NIIA 3JD72 3UT0A 4XCBA 5J37A 3OEAA 1BXHA 1ND3C 1JW6A 5K8SA 2HWF1 1PGL1 1OQ1A 2DVGA 3SMHA 1GFF2 4XF4A 1MS8A 3NW4A 4ITCA 2D5HA 1UF2C 4QQOA 3PIGA 1ZRDA 3JB8A 3LIGA 4M0HA 2MEV2 4JGZA 4KU8A 3UL2A 4Y5Z0 2VL4A 2IXKA 1W8WA 5JWPA 2VZTA 4MHRA 4IEQA 1BBT3 2PHXA 3DV8A 2HEYF 1UCXA 1JZ5A 4HVOA 2ZPXA 3U10A 1VMFA 1CAXB 3M7AA 4AVAA 4L9BA 1NXMA 2CWSA 3RRDA 4EN9B 2VTFA 2DYCA 1DDLA 4MGZE 3B00A 2QQMA 1MVEA 3H1WA 3ENRA 1W9WA 2RMU1 3NAPA 2OUJA 4NPLA 3NL1A 5FMOS 4PQQA 1QJZA 1ZZ9A 4FPLA 3RPQA 3GYDA 3FLPA 4DB5A 5F32A 2X10A 4UI9L 4NROA 2IXJA 4N9HA 5FBZA 3RYRA 4COYA 4RSUA 2P5BA 1UX6A 3E6DA 3POBA 4CP1A 4P9YA 4RFRB 1HV0A 3OJBA 4DY5A 4AE2A 1Z7S1 2X29A 1ACCA 3VKLA 4N53C 1X7NA 4GMP0 2Q4SA 2CYFA 5I8YA 1YFYA 1LOCA 5LBFA 3BN6A 1C8M3 2QQNA 3ACFA 2R0FA 1PM4A 3LFIA 4OZXA 2IXCA 2HWF3 4HKOA 4QQLA 3T2TA 5CEHA 3T1LA 1UW8A 4IEVA 3UETA 4RFT0 3MPPG 3I2DA 3VBRB 1S0JA 5F7UA 1ZBE1 1YWKA 2AR6A 1EUUA 2WFF3 5FXVA 2W3JA 2ZGLA 2JX9A 3W59A 1FOD2 2PAEA 2E26A 1VBA2 2DU1A 2J7MA 4EYUA 2WS93 4IV3C 3KGZA 4P5HA 4JVAA 4Y4RA 5FZ6A 4NUBA 4NHMA 1JS9A 5FXWA 4CPBD 3U78A 3F2ZA 1HRV3 4XFCA 3KHBA 3A21A 4LK7A 2P17A 5DPNA 4Y1YA 5A3UA 1GBGA 1ZRIA 1WWYA 5AC92 3U14A 4XABA 5BNPA 5BNNA 4ATFA 1XYNA 1Y9MA 1W03A 3D6EA 4Q4W1 1IOAA 4ZPIA 5T5PA 2JJ6A 1CAVB 1RUG3 1DLLA 2GP5A 3AZZA 4Y26A 4MGQA 1C8M1 3NKTA 3KT4A 1US3A 5JOXA 5C8CC 5D1IA 2R7EB 1H2LA 2HJIA 1IGOA 3SNMA 1COV3 1QJU3 1EPWA 4QXKA 1LRHA 1UMHA 2BTVC 4XFIA 1QH6A 5FZ8A 1KFUL 2DCYA 2XUEA 1BBT2 3ZXDA 2YFUA 3KCCA 2D3PA 3W21A 2NPIA 1XRUA 4EN7B 3PVOA 1ZZBA 2WT0A 4PQ9A 1WUVA 4Q4Y1 4QKFA 3FLRA 2WZR3 1O3QA 3C2UA 2AC1A 1CVNA 4AYUA 2VUAA 2DWRA 3LE0A 2WQZC 1VBD3 3POIA 1HN0A 2ZHMA 1RTVA 1W9TA 1W8OA 3OBZA 4RHV1 1J58A 3A0NA 4B7KA 3JQXA 3AVRA 2D98A 5IK7A 2BGPA 2ZHKA 5FQ0A 3I2OA 4YM2A 4BK4A 5JOYA 4OZOA 2WZ8A 3O0WA 3O0XA 3OTFA 4LULA 4P00B 4QDRA 4ZY9A 1OLME 4AOCA 4C0HA 4O9EA 2Z5WA 1RIRA 3M8LA 1C1LA 2XJPA 3H7JA 2GMEA 2VJXA 4Q1PA 5A7OA 3RVHA 1IPJA 3AYEA 4M0NA 3WCRA 1LU2A 3CJIB 5JXJA 3UJQA 2OA2A 5A7WA 5H9QA 2FMYA 1KXGA 4CPBA 1HKDA 4RN5A 2Y6GA 1HJGA 4YG0A 4AVVA 3NJXA 4ZU7A 4QU2A 4XMAA 3QH6A 3KF5A 4XF9A 3VBUC 1UOFA 2XLFA 1E5IA 1JU4A 3FHQA 4CDUA 1AYM1 4CU8A 3FX3A 1ZZ8A 2C1FA 2QFEA 2ZJCA 1QU0A 2XJVA 1JOJA 3MUZ1 1GICA 2V09A 3EMRA 3OGVA 5A3LA 4KNCA 3MV11 3K4DA 2X53S 4XETA 4MH0E 2XJTA 2BWCA 4CEYA 1NCRB 1U5ZA 3IT8A 2RM23 1MVQA 3D3AA 4PDWB 5IAVA 5CU1A 3KB5A 3C7GA 4D6QA 2Q1FA 4F83A 1WKYA 2EA7A 4XBQA 3TN93 3ZFFA 3WZ1A 2VVFA 5A32B 4XPVA 5BNOB 4LO6B 1PNFA 2BGOA 2J42A 1W6QB 2RVAA 4AW7A 4NPMA 1HRI2 5IYYA 2WUHA 3IIIA 4FPYA 4GJYA 5DABA 4ZU4A 2BFUS 2WAOA 3TNPB 1S0EA 3CEWA 3ZN6A 3ZR6A 2G9FA 1UD1A 4IERA 3WUDA 5JSOA 1ND3A 1QJY2 1S0GA 2QDNA 4I09A 1DYOA 3OGGA 1K5MC 3I4IA 5JOWA 4Z1VA 2J1EA 3DPRA 3JZVA 3THPA 4FTBA 2R061 3PU3A 1U12A 2B45X 4QPIB 3U11A 1SPPB 1T6GC 4FPHA 4I3PA 4B4QA 1H8TA 3TEYA 5FZFA 4CDXC 2DUQA 4EE2A 4WVMA 3H8XA 1RXFA 1ZZCA 3BU7A 3I2JA 4CU6A 5CISA 4COZA 3BU0A 2A73B 1KDKA 3AKTA 2X5IB 1K42A 2BERA 3MIFA 5IVVA 2OUHA 1WCDJ 4PT6A 3EB7A 1G7YA 3OF1A 4ZXEA 3AJYA 4YZ2A 1AZDA 4LKDA 3J9SA 4K1YA 1WMFA 2VC9A 2XHNA 4XFHA 4JGYB 4QPWA 4F8AA 4BXFA 3WF4A 2VZOA 4I01A 2JKXA 4A45A 4DUXA 2WT1A 2ZTNA 4NE9A 4XJ8A 2ZKLA 5FMDA 3Q8FA 1ZZ6A 2WFF1 1RUH2 1RUG2 3ZN4A 4CEWB 4LR4A 2WO1A 3NNGA 3A22A 4XFBA 3IZOA 1RVF3 1D7PM 4U36A 2HYKA 2A7AA 2ZGKA 3PMSA 2XONA 2ZGRA 1ND3B 5LASA 1ULOA 4Q4W2 2Y0OA 2FDHA 4N43B 1B35C 3AKRA 4GJZA 1R1A2 1GUIA 3WP3A 4A4AA 4FBFA 3FN9A 1YIFA 1XPWA 3M2MA 5F3EA 5C70A 5F39A 3ZSKA 2WN3A 3ZSMA 3N9MA 2WINB 5EWSA 4XIOA 5JLVA 2LRPA 1CJDA 4EN6B 5C6CA 1GMMA 1QJEA 2GMPA 2W95A 1GV9A 1QXJA 2DVDA 5FZHA 5BNOA 3LOBA 1UXZA 2OXBA 3W58A 2FZ2A 3B7MA 3N9LA 5DUXA 1VBA1 1OD3A 3I3DA 5FY1A 5FZGA 5FYHA 3ZFGB 1XJAA 2HWD3 1S0CA 2PHLA 2W0XA 4XILA 2PQSA 4UWDA 3OUJA 2RDSA 1V6KA 4XCAA 4C1XA 4AVBA 5IFTA 3WD5A 1BBT1 3WW1A 4D6SA 4EWAA 4IQPA 3WF0A 4Y5SA 1DG6A 4A2UA 4CP9B 1BVVA 5J7MA 3M3CA 3WNKA 3KQ4B 3BTZA 5CG8A 3KV6A 4QX5A 3E5QA 1X9PA 2O1QA 2O14A 5FREA 2PELA 4K8RB 4IE5A 5D21A 1ENSA 4AEMA 1RUJ2 4Y1UA 5L7OC 3BIEA 2WWSA 3AZYA 2HWC1 3OD0A 5H9PA 2PLV3 5JZGC 1ZREA 3ZKYA 1QWRA 1H9WA 2HKXA 3ZXAC 4PI2A 2VZ1A 5L7OA 4INDA 4QB6A 1FMD3 2C6SA 2VCBA 2TNFA 3EXUA 2GH8A 5DG1A 2H0VA 1QOSA 1UZVA 5FWEA 3S7IA 2JE9A 4XF3A 3JCIA 2OS2A 2NYYA 2V4AA 3AX4A 2RDRA 5HXMA 3WP5A 4OVEA 5DZFA 3SH3A 2XLAA 1QJU2 3PVBB 5F5QA 4AEKA 2E7AA 1V9U1 3ZR5A 5FK8A 5CKMA 2XJQA 2YPJA 3B3QE 4ZS2A 1AR71 1BCXA 4P5YA 3ZXFA 4ARXA 3IM0A 3ON7A 4JQTA 4GD4A 1LEDA 1R091 2ZEZA 3AKPA 4Q0UA 3V56A 3WINE 3ZYRA 5A3MA 4YZ4A 4RYDA 1VB2A 2WAAA 2CGPA 2QZ2A 1WD4A 2GNDA 1QH7A 2OQ7A 2OZJA 5JR2A 3CZUA 3T4HB 4QPIC 2VMHA 4QAWA 3VGIA 1N1SA 3VBFC 1BZWA 4CDXB 1Z7S3 1S0DA 2VVDA 4AI3A 5LBCA 1CD3G 3N9OA 2AZ5A 4QXBA 4AI2A 2YV8A 4OUSA 3AP4A 1O8PA 4M00A 4DQAA 2ILMA 5EIYB 2RMU3 4ZONA 1V6JA 2V72A 4JGYA 5DDJ1 4IUGA 1FX5A 4GWNA 4LA3A 5J1XA 4AF9A 2FDKA 5IWFA 5FZ4A 4BIFA 4IE4A 4FQ4A 1MS0A 1LR5A 2WYFA 3MPBA 3LZZA 2EIDA 5LW9A 4JDNA 2VBPA 3ZM8A 2BVBA 5JUVA 4UW3A 2PHRA 2R071 5FR3A 2YUEA 2KR2A 5FKBA 1HLCA 1JI6A 4CDWA 4LO8A 1W6MA 2JD4A 3SEPA 4DFSA 1ZBA3 3I54A 1ZYBA 2JG8A 3NNMA 3GJBA 4XBLA 4BJ0A 5FAXA 2ZGQA 1GNZA 2GC2A 2RM21 2WLQA 5C3SA 1H8VA 3KV9A 4OUMA 1NCQB 1OA2A 2I07B 3OGJA 3WQ1A 1GWLA 1NLSA 1X82A 3TN92 2CTVA 1AL22 1FI2A 1ZBE2 5ANNA 3MW3A 3VBRC 5T3NA 2ATFA 4CDXA 2WNOA 5J48A 4AG4A 1HIXA 2WZPP 2VXJA 5FZ1A 4EROA 1MQTC 1N3PA 3G7DA 3IN9A 4SLIA 3UK9A 1W0PA 4OHXA 1RC6A 1S2EA 2JG9B 1ZBA2 4LITA 4P9GA 4BM8A 4JC1A 2CAUA 3PVNA 1GZCA 4ATEA 4FAHA 1CAWB 1QQP2 1I3HA 3OOXA 2RS32 1PMHX 4HBNA 4E4HA 2RS53 1OA4A 1XBFA 4S2GA 5FYMA 3PJYA 5FZLA 1OHFA 2PHTA 5FYZA 1ZBE3 4YM1A 1IKQA 3VBOB 4AGGA 3AZWA 4LHNA 1JZ8A 1XE8A 3C7OA 5J09A 4QKNA 1O59A 4XJAA 2W1SA 4I0BA 4MGYE 1RUF3 2HH9A 2WA4A 3ZXLA 5LA0A 4XVHA 1NX9A 3U0ZA 3WSOA 5LWBA 4FSJA 5FUIA 1YUDA 3GZUC 3NO8A 4XMIA 2B42B 1NA1B 3N4MA 2YC2A 5C4WB 3E97A 2H6CA 1NE4A 2WQ4A 4HXCA 5EHDA 4CEYC 2W5FA 4MGTA 2AGSA 3RMXA 3KD4A 4HETA 1ODMA 1MZ5A 2R1BA 3K4AA 4EJRA 1ULDA 3MO4A 2VZRA 3WX5A 1KJLA 2JENA 1N3OA 1C3HA 1QJX1 1UY3A 2CV6A 3D5OA 2VD7A 2VZUA 4CUCA 2YHJA 4MV2A 3FFZA 4MSVA 1IQAA 1XNDA 4GWIA 5GLWA 3VD5A 5CA6A 4AL9A 3T0BA 2QNKA 1F9KA 1LTEA 2VY0A 3FBYA 4HFSA 2VTXA 3ZFEA 3PL0A 3SH5A 2JG8B 3NSTA 3MFCA 1OKQA 3CL1A 5JXIA 3RMYA 3TEZA 4B8EA 1ZRFA 4WM8C 5BYNA 1VBD2 2BW8A 3D8CA 4LMFA 1PZ8A 2E31A 3HR9A 4IE6A 2VNVA 1W9SA 4KMQA 5E1RA 1YLLA 3ZFEC 3BGAA 4JTOA 3TB0A 5KXEA 1HB1A 1PM7A 4IEZA 4XOGA 4Z82A 4YVSC 2FD8A 2RDQA 1VLNA 3HAGA 5KHHA 3K75B 4UAPA 1TEIA 4QWNA 4XDOA 3RZZA 1CWPA 5EJ3A 5K7PA 1AR62 2DBIA 2UU8A 5JIAA 1H8TB 2BQPA 4IEYA 3V65A 4WVMB 4MO3M 4BQ5A 1SLAA 1UOBA 1NKGA 3M3QA 3N9QA 2GNTA 4YFWA 1OC1A 1UYXA 3CF6E 3DN7A 3RZMA 1ONAA 1KGYA 3H1YA 2A70A 1CESA 5FZIA 5GLTA 1SBFA 4JRLA 4YZ3A 4CTEA 5C9AC 1C8NA 3IIAA 3WCSA 4S2FA 1UQXA 3VD4A 2XL7A 2EIGA 4FPEA 4CP2A 4BQ4A 2FDIA 2JB4A 5FYVA 4NWVA 4LNVA 1RUJ3 1FOD3 1MS4A 3EQEA 4JDMA 3TEWA 4CU7A 4I0WB 5I8TA 5JMCA 4DXZA 1G9CA 3AJZA 2PYTA 4FXGB 1H2MA 1WMEA 4RS5C 5F3GA 4I02A 2ZX1A 3DXTA 4UFMA 3PTRB 5A3WA 5DAWA 3RYPA 1CAWA 1NCRC 1RMU2 1H9PA 2FDJA 3J8F3 3VUOA 2X5IC 4HONA 1D0GA 1YQ2A 1TME1 3AFKA 4FPJA 2X5IA 5E88A 5KWRA 4P9WA 3VHNA 1ZBA1 4XFFA 4XJ9A 3LWCA 1LHOA 2PTMA 3JB4C 3NJZA 4LHSA 4WM7A 1PZ9A 3I97A 1YO8A 5LK5A 1H1AA 4HN0A 3RDIA 4FT8A 2YGLA 4X8PA 5IVBA 5JXHA 3BVCA 2P6HA 2O0OA 4D6RA 2AYHA 1RYYA 2VG9A 3BTAA 4QGNA 1J84A 2ZX4A 2VAUA 3RZGA 4NMIA 1UPSA 2G9ZA 3NV4A 4GB33 1VBB3 3JUUA 4LA2A 4DXRA 4CE8A 4IV3A 4K8FA 3K46A 2VBBA 3RZHA 3KQRA 1CAUB 5T55A 2PAKA 2VW2A 4Y22A 2R30A 5F6LB 4CCLA 4Q8KA 2QZ3A 2YG0A 3LEMA 3RFRA 3OBAA 2ORZA 3O7OA 2Y60A 1OUSA 1DQ6A 3H0OA 4QX1A 1ND2C 2E51A 2XBO1 2ZXQA 3GM8A 3OUIA 2VMDA 4HOOA 3ELNA 3FLTA 1VMHA 2YB7A 4FP3A 3WHTA 2B8MA 3TWIA 3U75A 4PHZA 2BOJA 1PMJX 4BHPA 4NOTA 3KLSA 3ZDSA 3W9AA 2XVGA 4H2AA 2VR4A 2YBPA 1VAMA 5ACA3 1PIV1 3VBFB 1W28A 1AR73 5C71A 4WM8A 2HLEA 1LU1A 2JDHA 2ARXA 1FOD1 1AYM2 4XEZA 4Y5TA 5F5AA 1JYVA 3VZNA 4BPZA 2J1AA 1UU4A 2ZGPA 2VW1A 4QXHA 4HG6B 5GZDA 1RUD2 4QPYA 1RUE1 1T2XA 1A3KA 2A1XA 2CSGA 2W9XA 2WBKA 1OI6A 2D93A 3U4SA 1AL0G 4JHTA 4YARA 3AVSA 3P5BA 2WWJA 2H0BA 3GBFA 3LA7A 2DVAA 4E2QA 4XDPA 1XC6A 4FFGA 5C7GA 2EIBA 3DECA 3QOPA 1Q8QA 2CAVA 1E5RA 1S0IA 2PMWB 4QX8A 2W2IA 4YGEA 5FY7A 1AR72 1DCSA 3ZFGA 2GC0A 4Z8BA 1G9BA 4BZ4A 1GSLA 4EN8B 5IVFA 2BP6A 5FLIA 1RUI1 1LGNA 2RV9A 3D4KA 2GNMA 3OYWB 4J1XA 3INAA 3ZXGA 2R1DA 4GMP1 4HT1T 5F5CA 4YW5A 2YDEA 2ZHNA 3UKTA 4ASKA 5A1LA 4BDVB 1I6XA 4R9AA 4YPJA 4XUTA 4BWOA 3ZYHA 4CCNA 1T6BX 1UX7A 3KVBA 2DCTA 2W1UA 4LTAA 4G9SB 2UWAA 5FK7A 3ABZA 4XZUG 4ZXKA 4Y1VA 3T30A 4UFKA 4OQ9A 3ZX7A 4YFZA 1RJ7A 5FPAA 2PXJA 3HPNA 5DQ0A 1RHI1 3LKJA 2Q8CA 3MIEA 1SDDB 2DUOA 1RUNA 1H0BA 1NAEA 3IDCB 4LORA 1W04A 3Q9OA 1QJFA 3WG3A 3QBQA 3ZN6B 4A44A 1ULFA 5K9YA 3H8UA 4UW4A 3SCGA 3BOPA 1PX4A 5A3TA 1JUHA 3M70A 2FHRA 2JDAA 1PGL2 2CWMA 1U5IA 5KR7A 3PNAA 2E6VA 5FJKA 2B9UA 5F2WA 4O9GA 5HXVA 2WRAA 3I49A 3HIFA 2DF7A 1X9TA 3N7JA 1OOPC 2YC4A 4BB3A 3RQ0A 1OUXA 1AUYA 2H6BA 1BYHA 1GWKA 2JIGA 2ZMLA 4E4ZA 2VXRA 2C0ZA 4Y1ZA 5FZCA 4AQ6A 3B93A 1AX2A 2DFBA 3ZPYA 2HWD2 2YBKA 4PIYA 2HWB2 3NMBA 2VOXA 2P3JA 4UYBA 5JPMB 1UIKA 3MHZA 1EYBA 4IV1A 4DXTA 5JI9A 4KQ7A 3USUA 1V9U3 1UNBA 1AX1A 1FAYA 2R072 1QF3A 2P3KA 4NHYA 1K3IA 5I91A 1S4CA 1J59A 1ZRCA 1CAXA 3V0AA 5L73A 3GDBA 3U37A 1DQ0A 2ET7A 3L2HA 2HWB1 4XUPA 1AR92 5FYYA 1ZRRA 5F37A 3HD8B 4IV3B 3H42B 5CAZA 4YWAA 3ST7A 5I0TA 3I7DA 2RDNA 2C26A 2E53A 1XU1A 2ARCA 4WM8B 1W3VA 3ZXEA 1PGW2 1AR82 1SLLA 5FZ7A 5C5TA 2DUPA 3KF3A 3VBSC 4L8QA 3I2HA 4MXVA 1NY72 4Q29A 3ZIWA 4HPKA 3O12A 1Q8SA 3BYWA 1BK1A 2XQRA 3MF9A 4DOUA 4EWDA 4XJZA 1Y4WA 3POWA 3KCYA 3MW4A 1WW5A 4YG3A 2A3WA 1OPOA 2OW4A 1LCLA 1XQNA 1VRBA 1YYNA 4DNYA 3R6SA 3V0BA 1OKOA 2PA7A 4LKSA 2GMMA 1GWMA 3M3OA 1ULPA 3HQRA 5FYSA 2B39A 3H7YA 4XW3A 1HDKA 5FZEA 2A3XA 3ZOIA 4OHWA 3VD7A 1AF9A 4OUEA 5HCHA 1NLQA 3S57A 5KXDA 1FPN2 1IHMA 1XE7A 3VBHC 3PUAA 1W2TA 2AEYA 4LBOA 1QJU1 3KWVA 4PCRA 5IK5A 4YVSB 4ARYA 1VR3A 2UY9A 1HX6A 2W52A 2WS92 4V1PA 5FP4A 1F4AA 4A41A 2XH6A 2WNVC 1UXXX 2XL9A 5BNQA 4UW6A 1RUI3 3TEXA 3IPVB 4N43A 3I59B 5C3PA 4QM9A 3DKQA 3IMNA 3AB0A 5FPBA 5C3RA 4C90A 3N9NA 3Q8BA 5FYTA 2HEVF 1PO23 3USUB 2J1VA 3RJRA 2J1SA 1SACA 4UFLA 1CJPA 1LODA 4EN0A 4IESA 4YW3A 1R1A1 2AACA 5SV5A 1RUJ1 3WP4A 4AVTA 2W47A 5E8AA 4IW3A 3VBOA 2WJSA 2ZGUA 2XJUA 3R4SA 1U5XA 4ISRA 5H9SA 4R9CA 5F3CA 1I5PA 1EAH2 1RUD1 2QBXA 3M3EA 2Q8DA 3U1XA 2Z69A 2HWB3 4QX7A 4AAPA 4KG0A 4IGQA 1SG3A 1GNYA 5JI7A 5B4XA 1MS9A 2WFF2 2D3RA 1LEMA 3S5AA 2ZBJA 4XUQA 1ULCA 2VMIA 5IVEA 5C9AB 5JVVA 2XG3A 5B4NA 2G9GA 2GU9A 1SCSA 1D4M3 3E5UA 1H30A 1YQCA 3VKNA 2Z42A 5LK7B 1TQ5A 1RXGA 3IAPA 3HOBA 4DRRA 1WA4A 5AVAA 4AEDA 4HL0A 3VDDB 4DINB 2XMLA 5T5LA 2FZ1A 1GKBA 5F9TA 3B69A 4Q4X1 4MX3A 1PO21 4YW2A 5SV8A 4EQVA 3Q8EA 1PO12 4ZZ5A 2OX0A 2JD9A 1FNYA 2ZAAA 4NHXA 3LDRA 2V5DA 2R6QA 4QHZA 3VZKA 3J8F2 5IATA 4TN7A 5CYYA 2VMCA 3FFQA 3MW2A 4KU7A 1L7LA 3BODA 1JYXA 1URXA 3SLIA 2VULA 1QHDA 5FOBB 1CPMA 5JMOA 3B02A 2E32A 3I2FA 5D8AB 3UJOA 1QMJA 3ZYIB 1AYN3 1OH3A 5AFEA 1YQ6A 2F17A 3BTXA 2EICA 1UZWA 4LLOA 4K9SA 5J96B 1W0OA 1DYKA 1PMIA 1UY4A 1NCRA 1RL3A 4RS5B 3FE5A 4DY3A 2ZGSA 2D6NA 2WZR2 4RR3A 4Z07A 5GLVA 1JZ3A 1SFNA 3SCFA 3H9AA 2A5ZA 1Q43A 4E4DX 2WDBA 4Q2FA 5LRSA 3C3VA 3WDWA 2I2SA 4GH4C 1G8WA 1LOFA 1VRH1 1WA6X 2NMNA 2VOKA 1UIJA 2VMGA 2A6XA 2Q8EA 1CZVA 1SZBA 3WF2A 5A6ZA 3ZMOA 1AXKA 1OT5A 4GQ7A 3RJ2X 4QQPA 3JBG1 5FYIA 1W90A 4Q8LA 4QDSA 4CDUB 3CJIC 4JRAA 3E1F1 4LHKA 4Y20B 4UOJA 4A3XA 4AFDA 4GWJA 1KFXL 2EXIA 3ILNA 5FMBA 3KS7A 2HYXA 2R0HA 4RGAA 4A7YA 5IFPA 3N7KA 1JN2P 2MPFA 1BLZA 4XUOA 2B4KA 5FOJB 1NQJA 2IXHA 4XXPA 1KS5A 4XJWA 4AI1A 5BPXA 2ZCWA 3IDEA 1OBNA 4YW4A 2Y0IA 3P3NA 4FXKB 4OULA 4XZPA 1DZRA 1EAH1 3AYDA 2AEZA 4JGYC 4RD7A 1JTZX 3T2OA 1UWWA 3HBZA 4DPNA 1AVBA 5E6HA 5FLJA 1W6NA 3A0KA 1GR3A 3ZO0B 3KHCA 1HRI3 1VBC1 3ZDVA 5AC91 1OD5A 3PVEA 2EXJA 3QCWA 5IVYA 3LCPA 4E4SA 4XURA 3ZMNA 5FXXA 2HWE2 1X33A 2J1UA 2ZX3A 4JGZC 3AFGA 2YPDA 3RSJA 2NZ9A 4PI0A 1SFYA 4HANA 3ILFA 1N1TA 4ES9A 1QNYA 2BZDA 2VCAA 2JDNA 3N9PA 3O0VA 1HXS2 3OEBA 4MG2A 4JKMA 1NUKA 4AEDB 1LNSA 4X6QB 3AMHA 4Y20A 2VMFA 4CUGA 2R16A 3BKZA 2RS52 4K1ZA 2R073 4YSFA 1CR7A 2D5FA 4LKEA 2P4EA 4RHV3 3SQOA 2RS31 5FCCA 1BJQA 2ZEYA 1YCIA 1FPN1 1QXRA 3I3QA 4QB2A 4BQWA 4CCEA 1WGPA 4ZS3A 3HMYA 1UU6A 4CXWA 3E5XA 2GC3A 4LBQD 1TE1B 3VBUA 1IG3A 2XR4A 3AP5A 4LBMA 1AHSA 2RS33 1DP0A 3H1MA 5FMCA 4XHBA 4AHWA 1UY0A 4J6GA 3VBHB 1D4VB 3ROUA 1PGSA 3LPFA 4YNIA 5I0DA 4KG8A 4AVSA 5LB6A 4B1LA 4LBQB 4AR2A 4LUKA 4R9BA 1GQPA 4IL7A 2IUWA 3OPZA 1O3RA 4S2DA 3NAPB 2XWBB 2QUOA 4GH4A 1UO9A 1BVP1 4YVWA 1MPXA 3VBSB 4WVWA 4FI9A 4DIQA 1Y9GA 2BNNA 1FYUA 3W5MA 1VBE3 2Q1MA 2W87A 3WG2A 2GH2A 1YI7A 2XPJA 4CCOA 1GQGA 4DEVA 2YGMA 2VNGA 3PU8A 1EUTA 4IEPA 2C9AA 1DQ2A 1WCUA 1GOGA 2EALA 4M3CE 4IV1B 4R52A 1AX0A 2LUWA 3RYKA 4DUWA 3WR0A 5HPOA 3WG4A 1RUE3 1A6CA 1DGRN 4UFIA 1Z0HA 4PF1A 4C8DA 2OQ6A 5DZGA 2ADEA 1K5MB 3P3PA 4LPLA 3ZSJA 5CFCA 1XNTA 1N47A 3M3IA 2F6BA 3E6BA 4CP0A 4OFGA 1FV2A 2CHHA 2QE3A 4AFCA 3EBRA 4XHXA 4QQ2A 5FY8A 4TZDA 1CAUA 1S1AA 4FOWA 4K40A 4MGKE 4XQWA 3K77A 1Q8OA 1YEWA 3NV1A 3OB8A 1QJX2 5FO9B 3TN91 3ZFGC 1QKQA 1DQ4A 4ZZ8A 4XXAA 1SMVA 3GCWA 3ASIA 4EWEA 2ID4A 3H8OA 4M3CB 5I93A 2W92A 4AI0A 1UYZA 3ME2A 4K20A 1KITA 1W6OA 4FFIA 2ZGTA 2FCUA 2WL1A 1FMD2 5I8SA 1AYN1 5BUVA 1V6MA 3V0AB 4R8HA 5DDJ3 4LBNA 3OBRA 4XBNA 1S2KA 4MOAA 2CGOA 4R4ZA 1X50A 4RQPA 3VBFA 1ASJ3 5K4LA 4CCJA 1IKPA 4AQ2A 1DLCA 1UMZA 3KZ4C 4LBQA 5FFOC 4YG6A 4XYXA 3LOIA 4LT5A 3IMMA 1B35B 2WA3A 2JECA 4Q4V2 3BB6A 3AMPA 4E2SA 5C5UA 5DUWA 2D6PA 2HWC2 1OQDA 3R0RA 4GB32 4LLFA 2VBDA 3H3ZA 4A7KA 2B46X 3HN3A 4BIOA 4YZ5A 1OA3A 4FPOB 1PZ7A 1L3JA 2J1TA 4BQ2A 1IG0A 1YJKA 4E9KA 2VCMA 1V6OA 2RR11 2WNVA 2VNRA 2VQAA 3T0DA 3H3UA 3VDDC 2VGDA 3WDUA 1FATA 1VBE2 2HWF2 4LIUA 3N35A 4R9DA 3WDVA 2WR9A 2VE1A 2X09A 4GXLA 1D4M1 3IAQA 2D7FA 4Y4YA 1NG0A 5L7OB 2VTXJ 3AZVA 1ASJ2 2K9ZA 3FHAA 3UKNA 3H3LA 2Y6JA 2TBVA 3T1MA 1V9U2 5IT6A 2Q8OA 2V4VA 4M3CA 1AL21 1RUF2 3BUCA 4URTA 1OLQA 3T09A 3WQBA 2RS51 4PLMA 5LEKA 4Q27A 2W94A 1BEV2 1LULA 3ZXJA 2EIEA 5BXXA 1EAH3 3JXSA 3AMNA 4D7SA 5ABJA 2D6MA 5C8WA 5HCAA 1AR91 2K46A 2ZACA 1NCQA 1G9AA 3POFA 2VZQA 3NVCA 2WNUB 1OVSA 5D8AC 1RVF2 3WVJA 2MEV3 5JIUA 1E57A 1AXYA 1WCSA 3CJIA 2PAMA 2JDPA 3ES1A 4QD2A 5KXCA 1FMD1 3CO2A 1O3TA 4N43C 5FZAA 1R1A3 3O5SA 3ECQA 4AGVA 2C9KA 4N8MA 5FPLA 1CZSA 3BALA 4Y33A 5CFCC 1RUOA 4NHLA 3MZHA 4CZSA 1VMJA 2PLV1 3NKGA 2HWC3 1GZTA 1JODA 2HBTA 2VPVA 5FV3A 2QQOA 4P02B 2R063 4FPGA 4RQPC 3WLUA 4K7JA 2W1WA 2UYBA 2P6CA 3AP6A 3AXDA 1APNA 3GBWA 3CKHA 5DG2A 3VBHA 3O1VA 2D6LX 3ZYJB 5BNPC 5GZGA 4CEYB 3VKMA 1Q56A 2XVLA 1RINA 2WIIB 2Q30A 1RUH1 2Q5TA 1GP6A 1W05A 4AHXA 1C1FA 5EZWA 4UFHA 2HEWF 5IW0A 2SBAA 4KWJA 4ET7A 2VQTA 1MQTB 4GULA 5FZMA 4BMBA 4QM8A 4YVWC 1SBDA 3WG1A 1PK6B 2OIIA 5C9AA 5LEJA 2A6VA 2QQJA 2ERFA 3A23A 5EYYA 2NM1A 4G4FA 2P3IA 3C8XA 1WLWA 2WNVB 4JGZB 2WLPA 3M1HA 2XWJB 1WCKA 4RGKA 4BQ1A 3M4FA 2CY6A 4BISA 3CU7A 4FO9A 4FPCA 3MIDA 4N7UA 3WF3A 3LDBA 2LTNA 2W39A 3NQHA 1EP0A 1NXD1 2Y6LA 1NE6A 4HSJA 4KH9A 2RS11 5GZCA 1IPKA 4AQSA 1BMV1 2XLGA 1BQPA 1E5HA 1OURA 5FYUA 4Q1RA 5FZBA 2JG9A 1GANA 4J25A 4UXAA 1EV11 3D0SA 4O7XA 1TMF1 4BMEA 5AC93 2RG4A 2XGXA 3ZYBA 1HRI1 1VBC3 2WABA 5DAQA 1CN1A 2YROA 2ZKNA 3URFA 1G9DA 2PN5A 1M4WA 2DV9A 2GN3A 2J22A 1HRV2 1UZ0A 3LEIA 3PUQA 3BOWA 4WZFA 3VBOC 1GLHA 4HVQA 3KM5A 1IZ3A 1TMF3 3VDDA 1QQP3 1WLDA 1YFWA 2G1MA 4QB1A 1VAVA 1KJRA 3PTYA 3T4VA 4O65A 5A70A 4AWDA 4CU9A 4I0AA 3GHMA 4BH9A 2BV4A 4GZ9A 3CMGA 1Q8VA 4W6XA 5EYXA 4IXLA 5CKQA 1JBCA 3GBGA 4JAAA 3LGRA 4WZCA 1ULEA 1YJLA 1H4HA 3LDKA 2HWE3 3BPZA 1UKGA 3JBG3 5BNNC 3K3NA 4Q26A 4YGBA 1W6PA 3VV1A 5LY2A 4QU1A 2XOMA 1VBD1 5A1AA 2GAUA 2VM9A 2AH2A 5FLHA 4LO7A 5DUUA 5I0RA 3GZEA 1V0AA 2WWUA 4F7ZA 5IVCA 1SLCA 2CGNA 2E33A 3GALA 3ZLIA 5FYCA 4FAGA 2UYAA 1JHJA 3HT2A 3WNMA 3GCXA 1W2NA 1VBC2 3AXEA 3LSDA 4QHOA 2WKKA 3A7QA 1F5JA 1EV12 4PIXA 1DF0A 3DYOA 4FFHA 4E8CA 1YC61 5ISLA 1MEC1 4GKYA 3CNAA 1W39A 2JEMA 1HV1A 1WZXA 5FZOA 2D44A 2FMDA 1WW6A 4M01A 5CKNA 3OPTA 4MXWB 4GH4B 1WBLA 1FPN3 3LF7A 1RUG1 2RJKA 1PVC2 3O1MA 4P9XA 4Q4W3 5EFUA 1QOTA 1HQWA 3IB3A 1WBFA 2JDUA 4FOQA 5GALA 5FY5A 3PURA 1C5IA 5FPVA 1Y3TA 3WUCA 4COWA 2FQPA 1ZM1A 3HN1A 5F5IA 4B1MA 1VALA 5JR7B 3EO6A 1ND2B 4K6BA 4GAZA 4KWKA 3WDXA 1W2OA 2P3YA 4K3UA 4CCCA 5A6YA 4Q4X2 4QPGA 1K45A 4BOWA 4FTSA 1XYOA 3OD4A 3S0MA 4UW5A 3I2IA 5K0UA 4H7MA 5BNPB 2CL2A 5C4WC 5CFDB 3KCXA 1VRH2 2ZS6B 3RG0A 2JDYA 1IS3A 1QQP1 2JG9C 3ZYGA 3TNQA 1JZ6A 1MZ6A 3C7HA 1OMIA 3DKWA 3FMGA 1OQEA 1Z78A 3VL9A 3J7HA 5DUVA 2QQPA 1WCQA 3T3YA 3A4UA 4TWTA 4KL1A 4BQYA 5F8PA 2OYZA 5ACA1 2NLRA 3U4XA 4YLZA 1VPHA 3LEKA 1VBB2 3UV9A 1HW5A 2ZZQA 1BMV2 4MZUA 2NMOA 4CVUA 3THTA 4Z2WA 1LGCA 5HI0A 1NCQC 5L19A 3CZJA 3MFAA 4M3CF 2KA3A 1U5YA 2VOTA 1DGLA 1ZZ7A 3MYXA 3PJQA 1SLIA 5JSPA 1VAKA 5L9RA 1W6QA 4D8MA 4JQRA 3PMEA 2QQUA 4C1WA 1F8VA 3AM2A 1JU3A 4YRDA 2XJRA 3MICA 4RA0A 4LOTA 2EAKA 3KT7A 2AENA 4LO5B 3W20A 3ACIA 2C24A 3ZYPA 1D0HA 1UKRA 1YHFA 5FPZA 1D2QA 3K4ZA 5C8CB 2DCZA 3MIBA 2DTWA 2YFZA 3GZTB 4OQ8A 4XJUA 1TZOA 1UZYA 3HT1A 4TLGA 5CVRA 3HQUA 1W0NA 1HB4A 2GN7A 5HBAA 3HNYM 5J3UA 1I5ZA 3IBMA 1NOVA 5CFCB 4Y1XA 5F3IA 1COV1 2C4XA 4MUVA 2YMZA 1LHWA 3SC7X 4CXXA 4QXCA 2BGCA 5A7PA 2WSUA 2JDZA 1W8NA 2WNUA 3GHNA 1CIWA 1O7FA 4E8DA 5LCWL 3ZKUA 1TME3 1F31A 1H4GA 3J26N 5FUNA 4XF0A 5KHKA 2R49A 1XYPA 1RB8G 4PJYA 2HBUA 3OSDA 2MHFA 1LECA 3AL5A 4P9LA 2A6YA 1R092 5IJRA 2QQVA 4SBVA 5DZEA 1QDOA 3EJKA 2NQYA 4I3GA 1H2NA 1TMF2 3MGUA 5TSWA 4DMIA 4HK8A 5FBJA 5KHJA 3RWKX 5IUQA 5GLZA 4DO0A 4W6WA 2WN2A 4TTGA 1G9FA 2IVJA 1DU3D 5EQUA 3BCWA 3PUIA 4JDOA 1JOBA 1IS5A 4Z2AA 3MIGA 4AI9A 2WS91 2WNUC 4LOSA 5FDBA 1XSRA 1O8SA 2VZPA 2PFWA 1CZTA 4ONUA 4CUBA 2ZEWA 4ASLA 2GNBA 2OZ6A 3AMQA 2R042 2GZWA 4P08A 4XQ4A 1AL23 2YYOA 4AHYA 1UYYA 5JXGA 2OPWA 4H7LA 3UESA 4HSLA 1CGPA 3GGLA 4N53B 3CLPA 4CDQC 1RUD3 1A8DA 3B01A 1D2SA 4YZ1A 2ADDA 1VBE1 1UPIA 3ITQA 1LOFC 3NJVA 5FO8B 2VOWA 5A3PA 2XVKA 4Q4Y2 4W6YA 5FZ0A 5T5OA 4J1WA 2WNEA 5LY1A 4L2NA 3UYJA 3AK0A 1K12A 2LW8A 4QX0A 3WOGA 5FP7A 1O5UA 1RUC3 1CPNA 3MV01 1Z7S2 1RGSA 2XUMA 2Z79A 5CNAA 1CX1A 5CZKA 1N3QA 3K51A 2DURA 1W8HA 2JDKA 1ALYA 4EZ4A 1NY71 2KXLA 5LBBA 4UF0B 5A7QA 4BA6A 3POEA 4IEXA 3J7NA 4CEWA 4IE0A 2TUNA 2G19A 3VZOA 3G6JB 1O4YA 3HEIA 4UFJA 1LENA 3B5LB 2DCKA 3UGHA 1LOBA 2Q0AA 3MLKA 2WO3A 1A8MA 3FZ3A 3MIHA 1YXWA 4IE7A 3RI9A 3WNXA 1PNGA 3I2GA 2XKOA 3LAGA 5K0UB 2XBO2 4Q5OA 1RUC2 3AZXA 5ERLA 5F6KA 3ILRA 5A80A 5DAPA 4CA9A 4LUMA 2DVBA 5KHIA 2GSYA 2FCVA 1XSQA 3VDAA 2WO7A 2Y6HA 2O8QA 3ZSLA 1QIQA 1O5LA 1M06G 5T50A 5FZDA 4IGPA 2YC0A 1YQ8A 5A6QA 4XTMA 1Q8PA 4QHBA 2XJSA 4V2VA 3AYAA 4FPFA 4UBHA 1REEA 5EP9A 3OBTA 5GZEA 1SLTA 2CNAA 1RUF1 3DEMA 2JIJA 2N7GA 5IVJA 5FP8A 1I9RA 1ZA7A 1JYTA 1HXS3 2BUKA 1OOPB 2VUCA 5GJ6A 5LRRA 3MLJA 1F4HA 1GU3A 2YU1A 4IDZA 5FUPA 3J7LA 1TVGA 1HQLA 2WZEA 3KV4A 4QMAA 2A71A 1MQTA 2EVXA 5A7WB 3VKFC 1GQHA 2RR12 2VUJA 3HQXA 4HMZA 4CP9A 4DRVA 5CADA 5FXZA 4B4RA 4CXYA 1JZ2A 4BLJA 3I2KA 4L99A 5FY9A 4CYDA 1W6NB 4A7ZA 1FT9A 4LO4B 3NNFA 1BHGA 4FOVA 1QXPA 1JMUB 3HNBM 3ZFFB 1F2NA 2Y6FA 5JZGA 4NIAA 1PHMA 1V00A 2Z2SB 2E7QA 4LIVA 4Q4V1 3SCHA 2D6KA 5C8CA 2VW0A 5KXBA 1HXS1 2VNOA 3CDZB 1N1VA 4HPKB 5FQ0B 1XE0A 5ABJC 5F1RA 3VHPA 1AXZA 4HVRA 3VBUB 4G3YC 3POSA 4LJHA 2QTWB 4QGLA 3JU9A 2BRTA 1REFA 1OSGA 4KGGA 5JPNB 2RMU2 4FOYA 4RQPB 1NQDA 2QDRA 2VO5A 3BIWE 3VKOA 1PVC1 1VRH3 1POV1 4GWMA 5FYBA 2UWCA 2ZEXA 3I59A 4D69A 4YGDA 3N7MA 5GM0A 3B9IA 3SHRA 3L2YA 1W06A 2VMEA 4ES8A 5CIRA 4CRQA 5A6XA 3AKSA 3I3BA 4I2OA 3RWNA 3LEGA 3H50A 2Y8KA 2AREA 5A3NA 3ZN5A 1LHNA 1YIPA 1OF4A 1V6NA 3KV5A 3TRSB 4GALA 1NZCA 2D40A 4TSVA 3JD71 2ZOEB 4I30A 2OPKA 5A33A 2BNOA 1J3RA 5BNOC 1QJY3 1KEXA 1N1YA 4OI1A 3SKVA 1C57A 3KGLA 3S7EA 1OFNA 2YXSA 4ZU5A 4YW1A 5FP3A 3T2QA 3TYJA 4D0QA 3GNEA 1QEXA 1SLBA 4PLOA 4UT5A 4AFMA 1H2KA 3ZSEA 4E2GA 5IHRA 3ALQA 2FDGA 3CBNA 4A6SA 4L92A 2BYVE 2WC2A 5FJHA 4HK9A 3RZLA 3SH4A 4HN1A 1C5HA 1DGWA 3MLLA 3LIHA 3PDQA 3T0AA 4QPGB 1KDMA 3VL8A 1SBEA 3EHKA 1PVC3 1SPPA 1O3SA 3W5NA 1QOOA 4XF1A 4ZHNA 4KBBA 1UOGA 3PHMA 2B7YA 3VHOA 4NAOA 2FDFA 3C7EA 5FZ9A 2JXAA 1Q3EA 1J83A 1PO13 2YBSA 3KT1A 2JDMA 2JWPA 5FZOB 4X8NA 3TBDA 2W1QA 1VP6A 4P14A 1Y43B 2ZMKA 1HRV1 2BOIA 5FY4A 3IWZA 4GA9A 1W6OB 4IEOA 4NRPA 3VBRA 1ZVFA 5LA1A 1DQ5A 5ACA2 2VZVA 5DXDA 4HKWA 2QCSB 2A6ZA 2QQLA 5KC5A 4WBBA 3ZIXA 1AR93 2JE7A 2VQUA 3NNJA 1JYCA 4A6OA 3OYWA 1Y9QA 2BWAA 4AK3A 4P9IA 1DGRA 1U0AA 4AFBA 3WDTA 3K3OA 3VZMA 4C91A 1UY1A 2BBVA 3NNLA 3PUSA 1S55A 5HCFA 2RS12 3MDPA 2ZGOA 1PO11 4CEWC 3Q8CA 1J3QA 5JOZA 4BU2A 5LA2A 5JZGB 3OPWA 2JB8A 1XNBA 1VB4A 4Z92B 1POV0 3MBWA 3RZJA 1XXNA 2W91A 4RHV2 4MGIE 3K48A 3AC0A 5F2SA 5L9BA 1AR61 3POYA 2MNGA 2XBO3 5A7NA 4AXOA 4D94A 4AGRA 1ZA4A 3PUHA 3VD3A 1OH4A 3LB9A 3NV2A 3GXUA 2WT2A 4H3WA 4L0PA 1W8FA 2BBAA 5DMYA 4CDQA 1NYWA 1KS4A 1P8JA 1QGLA 1GZ9A 4WM7C 4ASMB 4D7TA 5KBFA 1REDA 3SXWA 3NWKA 1GNHA 1W9YA 3OY8A 1S0BA 4URAA 2GALA 3L9JT 1FV3A 1SFPA 5C3QA 2X05A 1JUIA 1HB3A 5FTTC 1C8M2 4OI2A 5AVPA 4COVA 5C4WA 3LFMA 4TXWA 1J1LA 3CHXA 3AL6A 3D82A 3WEZA 4CCDA 5K0UC 4COUA 1JYNA 1PX3A 2NP0A 1MZEA 1R082 4Q0QA 2X8KA 1R1ZA 2ZGMA 3V0BB 1BK0A 4C0BA 1W99A 4JTNA 1RUC1 3RNSA 4OI0A 1LHUA 3WNNA 1LAJA 3WF1A 2QQIA 4OMCA 1IS6A 4XE9A 2BEOA 3ZXKA 4BQ3A 3AMMA 4OHYA 1Y7BA 3FWEA 3UNPA 1DIWA 2CDPA 3I8TA 1SQ4A 3BPSA 1FNZA 1RVF1 2F4PA 3LA2A 5M0TA 4FCAA 2LALA 2O8OA 3NV3A 4NIDA 2KD7A 2QJVA 3PLQA 1FXZA 1R083 5DN2A 4BLIA 1PVXA 1JOPA 2UWBA 3VBSA 2CU5A 1ENRA 1W3XA 4A3ZA 2DTYA 2Y38A 3LSEA 1STMA 4BYYA 5CG9A 1UOJA 3DF0A 4E27A 3RS6A 2P37A 4N53A 1JXNA 3ACLA 1ENXA 1H1IA 1NT0A 3DPRC 2KM2A 4KWLA 4DXSA 4DUVA 5EPAA 1O6UA 2DDUA 2PHUA 4ORFA 1UN1A 1C28A 1J1TA 3LQCA 4N90A 2XKPA 1HJFA 1NZIA 4YW7A 4Q0SA 1WLCA 4JCKA 5DAXA 3SKJE 1SHWB 5L9VA 3NAPC 3ACGA 2G4IA 4A42A 2RM22 2ETEA 2ZZJA 2QKDA 4NWWA 4AI8A 5AFBA 3F95A 1ST8A 4JZRA 1JH5A 3TOJA 5BV6A 5EJZB 3B9CA 4MVTA 4Y22B 1LGBA 1V70A 2IXLA 2K2SA 1ND2A 2V73A 5HV4A 2I74A 3O1SA 2YY1A 1OOPA 2BU9A 1OPMA 3ACHA 3FBMA 2ES3A 4YW6A 3U07A 3RI8A 2HWD1 1C4RA 1DFQA 1YQ5A 4CDQB 4LXLA 3HBKA 1VBA3 3FC0A 4QKBA 4LQRA 4CDWC 1MZFA 3WQ0A 4XQDA 4BQXA 1DQ1A 3VDBA 4AQTA 4QGMA 1W2UA 4F3JA 2BPA2 5IK4A 1XNKA 3JQWA 1A78A 1ODNA 4FVVA 3OGRA 4FQZA 4GKXA 3SEEA 2ENRA 4CDUC 3WT3A 2GDFA 4XAAA 3HWJA 5KHGA 3GZAA 4OHZA 4AZZA 1KQRA 1UU5A 3CJXA 3QACA 3NRUA 1MACA 2XB6C 3WY6A 1PGW1 1EY2A 3QLQA 4IV1C 5I0SA 1H6XA 1RMU3 3ETQA 2A6WA 1RHI2 1SCRA 1QY4A 3LD8A 1BEV3 3ZPOA 4LE3A 3J4UH 1E5SA 4AEDC 4BK5A 4META 2B9VA 2ZA9A 4Q4V3 3T2PA 2R041 1W8ZA 2PHWA 4UBGA 4D3WA 2C5DA 5I0UA 4QX2A 3EYPA 3SITA 4HLTA 4OI4A 5E89A 1PIV3 3VD9A 5DDJ2 1BEV1 2JG8C 3USSA 1W8TA 1WW4A 4B29A 1YFUA 1H8TC 3ZFFC 4EZHA 2JICA 5D2AA 3UKVA 4H55A 4HZFA 4YVSA 3VLBB 2EXKA 2TEPA 1MS3A 3WNOA 5A32A 4NIGA 4BXSV 1YI9A 4WVZA 3POJA 2ZX0A 2IC1A 1CONA 2ZMNA 2RE9A 5JSRA 4FFFA 4AHZA 3FUOA 4PDWA 2XHKA 4QPGC 5EV7A 3MF6A 1S0FA 3R4DB 2WYSA 5G04L 3RGBA 3MUY1 4ZKTB 4PBOA 3S5QA 1F5FA 5FIXA 1NA1C 1WMXA 5G05L 1NLRA 2CDOA 2OT7A 5CFDA 2VQ0A 3QD6A 1JYWA 3KSCA 3AKQA 1MEC3 2P34A 1H1MA 4GB31 2Z4FA 4H14A 2Y33A 5JDBA 1RJ8A 3WHUA 1COV2 1G86A 4NO4A 5A7SA 3APBA 5BY5A 1XU2A 4L97A 1LJ7A 1S2BA 3KVAA 1Q5OA 4QPIA 5CFDC 3MI8A 3ZFEB 2ARBA 3IDAA 2VU9A 3OCPA 4NPRA 5FO7B 1LOEA 4YM0A 3DXUA 4CCMA 2EF6A 1GP5A 5ABJB 4DZGA 1XNCA 2IZWA 2R062 1AYN2 3O14A 2XXZA 3CIHA 2E9QA 1AR63 4IEWA 4NN0A 1DGWX 2GP3A 1AJKA 1KD7A 1UY2A 2I45A 5KC6A 3CQOA 2RJLA 5JCTA 5C33A 5GZFA 1OVPA 4FPKA 4KWUA 2YU2A 3ETPA 3DYMA 2WO2A 4XFGA 2OKXA 5FPXA 2HWE1 1DZTA 1US2A 2W08A 3QH7A 5J36A 4YGCA 4Q4X3 5T5JA 4RR3B 3X29B 4NIHA 3WQ7A 3Q8AA 1L7RA 3WV6A 3P6BA 4XFAA 1LOAA 1ZNPA 5FMOL 3WNPA 3DCQA 1GZWA 1R093 2ET1A 3AP7A 1LHVA 4WV8A 3VZLA 3WNLA 1X8EA 4RGGA 1GP4A 1ZX5A 1R64A 2JE8A 4KBZA 3BI3A 1OF3A 2Q1ZB 3HVDA 4Y24A 3J7MA 5A3OA 4NHKA 4JKKA 5CBLA 5LZ6A 2AUYA 3TAYA 5LBEA 2PQQA 1OLRA 2LROA 3MEPA 1SDWA 3BTYA 4QKDA 1GYKA 1HB2A 2UY8A 1IQDC 4BCUA 2D97A 3FHIB 4LKFA 4XIKA 2F4LA 4XACA 5DAVA 1PK6A 3IPVA 2VZ3A 5C3OA 2VECA 2EXHA 1YRZA 4JX0A 4KI5M 1W9FA 3OY8B 4OHVA 1MR5A 4AAXA 3AP9A 1RMU1 4IEUA 3N7LA 1POQA 1SEFA 5GLUA 4O61A 1LOGA 2RS13 5APAA 4JV4A 1QNWA 2D3SA 1JYIA 3IKWA 3I3MA 3GJAA 3KMHA 5GKAC 1TNFA 1DHKB 2DFCA 3VN4A 2YZ4A 2BFUL 1JZ4A 4FTEA 5FP9A 2V5YA 2VZSA 3T08A 2RJ2A 4ISQA 4WM7B 4YM3A 1I1EA 2D6OX 4W4ZA 3ATGA 3O1OA 4YVWB 1OLMA 2P1BA 4PIZA 1RUI2 4RL7A 1PK6C 1AJOA 1QJY1 2P2KA 4P9JA 2QQWA 1LESA 1VBB1 3D0JA 3JD73 1UZZA 5IK8A 4Q4Y3 4OYUA 2GC1A 1MEC2 3I3EA 4Y3OA 5EJ1B 3SISA 4CCKA 5H9RA 2VVEA 4M4PA 3WW3A 2WQ8A 2Y34A 5JAXA 4HKLA 4XUNA 2ZABA 1K5JA 1W6PB 1H6YA 1CX4A 4MADA 3DUIA 2DBNA 2D43A 4UF0A 5T52A 3WW2A 1RUH3 3R4UA 5FZ3A 3VB9A 4CSWA 2QVSB 4TLFA 3DYPA 1RUE2 1GOFA 4NVPA 1L7QA 3IDBB 4XDQA 4QX3A 3P1IA 1UL9A 2UURA 1YFXA 2WSVA 2PHDA 3WXPA 4Q0PA 2LM3A 4KGQA 2A75A 1EPZA 1PIV2 1V6LA 3POGA 4XTPA 3THCA 5LATA 4OLLA 4CUAA 4MLOA 1KRIA 4LBKA 2ARAA 2ZX2A 1AYM3 3ZYFA 2ZGNA 5HCBA 2DVFA 2W46A 4B4PA 3ZVXA 1G6NA 3WDYA 2W68A 3UGFA 3N3HA 3HNMA 2XQXA 2NN8A 1DBNA 1VIWB 1RITA 5EXOA 1QDCA 1UMIA 4CDWB 5IAXA 4FP2A 3WW4A 2BDRA 1R081 1OXCA 4U2AA 3B94A 2R043 1ENQA 1VE0A 3N36A 4LBLA 1CIYA 1BKZA 2JKBA 3VHRA 5J98B 1WD3A 1XOYA 4EV0A 1WW7A 2PLV2 3S30A 1K5MA 1EV13 1F35A 2VCCA 4PF5A 1WMDA 4MGSA 2FCTA 2ORXA 5A33B 3PIJA 1F15A 3UGGA 1JZ7A 1AR83 1JHNA 5E16A 1X8MA 4N7IA 2IWGB 2RR13 4LEJA 5FWJA 4PDWC 3DPRB 5FZKA 5B2GB 2E63A 3DL3A 4XAEA 3LA3A 3O1TA 2ZAHA 2RHPA 4PBPA 4NRMA 1A34A 4MXWA 4XC9A 2BJSA 1TNRA 5FY0A 4BE3A 3JBG2 4QT6A 3OGSA 1O4TA 4JKLA 1OFSA 1ULGA 3NJYA 4LBJA 4WVVA 3FL7A 2SLIA 4NAMA 1W2AX 1DYPA 2K0GA 1UAIA 1TME2 4AEJA 4MHUA 1XNAA 4B3NA 2R32A 1W6MB 4NJ4A 1ASJ1 1NA1A 2Y64A 5CB7A 4K21A 3O1UA 1D4M2 2E7TA 2WZR1 4Q0VA 4W8JA 5FKCA 1RHI3 4AVCA 2Y26A 2XDVA 2LS6A 1DZQA 3O1RA 2OVUA 2BNMA 1J3PA 1VJ2A 3OG2A 3RZKA 4L11A 1GZWB 1QJX3 5ANQA 3VDCA 1LB2A 1UYPA 4PLNA 4YYOA 1LKNA 4LK6A 3AYCA 5HV0A 1B09A 1B35A 4M4RA 1V6IA
chains in the Genus database with same CATH topology
5T54A 5BNNB 1WLTA 2A3YA 2FBEA 4GMP3 4QQHA 4N9IA 1POV3 2IFRA 4NR1A 3J8F1 3WP6A 5L36A 3FUQA 1AR81 1MS5A 4W65A 2VH9A 1PO22 3DGTA 4TYSA 2EAAA 3ES4A 1X36A 4RR3C 1MS1A 4IETA 4S2HA 3R05A 1CQ9A 2ZHLA 4B7EA 4RS5A 2B5HA 2MEV1 5FRAA 4DS0A 2PHFA 3E6CC 2DU0A 3GF6A 4LHLA 1CAVA 1HQNA 4MYEA 4R4XA 4AFAA 3V64A 4GIQA 2BVVA 3FJSA 3S6PA 5D8AA 1IS4A 4D7YA 4X6RB 3VZJA 2WFPA 2IFWA 2DCJA 2IXIA 1YNAA 1O91A 2VOVA 4LE4A 1O4ZA 3JD72 5J37A 1BXHA 1ND3C 1JW6A 5K8SA 2HWF1 1PGL1 1OQ1A 2DVGA 3SMHA 1GFF2 4XF4A 1MS8A 3NW4A 4ITCA 2D5HA 1UF2C 4QQOA 1ZRDA 3JB8A 4M0HA 2MEV2 4JGZA 4KU8A 3UL2A 4Y5Z0 2IXKA 5JWPA 4IEQA 1BBT3 2PHXA 3DV8A 2HEYF 1UCXA 4HVOA 2ZPXA 3U10A 4AVAA 1CAXB 3M7AA 4L9BA 1NXMA 2CWSA 3RRDA 4EN9B 2DYCA 4MGZE 3B00A 1MVEA 3H1WA 3ENRA 2RMU1 1DDLA 3NAPA 2OUJA 3NL1A 5FMOS 1QJZA 1ZZ9A 4FPLA 3RPQA 3GYDA 3FLPA 4DB5A 4COYA 2IXJA 4N9HA 5FBZA 3RYRA 4RSUA 1UX6A 3E6DA 4CP1A 4P9YA 1HV0A 3OJBA 4DY5A 4AE2A 1Z7S1 2X29A 3VKLA 4N53C 1X7NA 4GMP0 2Q4SA 2CYFA 5I8YA 1YFYA 1LOCA 1C8M3 2R0FA 4OZXA 2IXCA 2HWF3 4HKOA 4QQLA 3T2TA 3T1LA 1UW8A 4IEVA 4RFT0 3MPPG 3I2DA 3VBRB 1S0JA 1ZBE1 1YWKA 2AR6A 2WFF3 2ZGLA 2JX9A 3W59A 1FOD2 2PAEA 1VBA2 2DU1A 2WS93 4IV3C 3KGZA 4P5HA 4JVAA 4NHMA 1HRV3 4XFCA 2P17A 4Y1YA 1GBGA 5AC92 5BNPA 5BNNA 4ATFA 1XYNA 3D6EA 4Q4W1 1IOAA 5T5PA 2JJ6A 1CAVB 1RUG3 1DLLA 3AZZA 4Y26A 1C8M1 3NKTA 3KT4A 5JOXA 5C8CC 5D1IA 1H2LA 2HJIA 1IGOA 3SNMA 1COV3 1QJU3 1EPWA 4QXKA 1LRHA 2BTVC 5HXVA 4XFIA 1QH6A 4AFDA 1KFUL 2DCYA 1BBT2 3ZXDA 3KCCA 2D3PA 2NPIA 1XRUA 4EN7B 3PVOA 1ZZBA 2WT0A 4PQ9A 1WUVA 4Q4Y1 3FLRA 2WZR3 1O3QA 3C2UA 4AYUA 1CVNA 2VUAA 2DWRA 2WQZC 1VBD3 2ZHMA 1RTVA 4RHV1 1J58A 3A0NA 4B7KA 3JQXA 5IK7A 2D98A 2ZHKA 5FQ0A 4YM2A 5JOYA 3O0WA 3O0XA 3OTFA 4LULA 4C0HA 4O9EA 2Z5WA 1RIRA 3M8LA 1C1LA 2XJPA 3H7JA 2GMEA 4Q1PA 1IPJA 3AYEA 4M0NA 3WCRA 1LU2A 3CJIB 3UJQA 2OA2A 5H9QA 2FMYA 1KXGA 1HKDA 4YG0A 4AVVA 4ZU7A 4QU2A 4XMAA 3QH6A 4XF9A 3VBUC 2XLFA 4CDUA 1AYM1 3FX3A 1ZZ8A 2C1FA 2QFEA 2ZJCA 1QU0A 2XJVA 1JOJA 1GICA 2V09A 5A3LA 4KNCA 2X53S 4XETA 4MH0E 2XJTA 2BWCA 4CEYA 1NCRB 1U5ZA 3IT8A 2RM23 1MVQA 4PDWB 5CU1A 3KB5A 4F83A 2EA7A 4XBQA 3TN93 3ZFFA 3WZ1A 2VVFA 5A32B 4XPVA 5BNOB 4LO6B 1PNFA 1W6QB 4AW7A 1HRI2 4FPYA 4ZU4A 2BFUS 3TNPB 1S0EA 3CEWA 3ZN6A 2G9FA 1UD1A 4IERA 3WUDA 5JSOA 1ND3A 1QJY2 1S0GA 2QDNA 4I09A 3OGGA 1K5MC 3I4IA 5JOWA 4Z1VA 3DPRA 3JZVA 3THPA 4FTBA 2R061 1U12A 2B45X 4QPIB 3U11A 4B4QA 1T6GC 4FPHA 4I3PA 1H8TA 4CDXC 2DUQA 4WVMA 1ZZCA 3BU7A 4COZA 2A73B 1KDKA 3AKTA 2X5IB 3MIFA 2OUHA 1WCDJ 1G7YA 3OF1A 4YZ2A 3AJYA 1AZDA 4XFHA 3J9SA 4K1YA 1WMFA 4JGYB 4F8AA 4I01A 2WT1A 2ZTNA 4XJ8A 2ZKLA 1ZZ6A 2WFF1 1RUH2 1RUG2 3ZN4A 4CEWB 4LR4A 4XFBA 4U36A 1RVF3 2HYKA 2A7AA 2ZGKA 3PMSA 2ZGRA 1ND3B 4Q4W2 2Y0OA 4N43B 1B35C 3AKRA 1R1A2 3WP3A 4FBFA 1YIFA 3M2MA 3ZSKA 3ZSMA 2WINB 5EWSA 4XIOA 5JLVA 1CJDA 4EN6B 5C6CA 2GMPA 1GV9A 1QXJA 2DVDA 5BNOA 3LOBA 3W58A 2FZ2A 3B7MA 5DUXA 1VBA1 3ZFGB 2HWD3 1S0CA 2PHLA 2W0XA 4XILA 4C1XA 1V6KA 4AVBA 3WD5A 1BBT1 3WW1A 4EWAA 4IQPA 1DG6A 4A2UA 1BVVA 5J7MA 3M3CA 5CG8A 4QX5A 3E5QA 2O1QA 5FREA 2PELA 1ENSA 4AEMA 1RUJ2 4Y1UA 5L7OC 2WWSA 3AZYA 2HWC1 3OD0A 5H9PA 2PLV3 5JZGC 1ZREA 1QWRA 1H9WA 2HKXA 3ZXAC 5L7OA 4INDA 1FMD3 2TNFA 3EXUA 2GH8A 5DG1A 2H0VA 1QOSA 3S7IA 2JE9A 4XF3A 3JCIA 2NYYA 3AX4A 3WP5A 4OVEA 5DZFA 3SH3A 2XLAA 1QJU2 3PVBB 5F5QA 4AEKA 2E7AA 1V9U1 2XJQA 2YPJA 3B3QE 1AR71 1BCXA 3ZXFA 3IM0A 1LEDA 1R091 3AKPA 4Q0UA 3WINE 3V56A 3ZYRA 5A3MA 4YZ4A 1VB2A 2CGPA 2QZ2A 1WD4A 2GNDA 1QH7A 2OZJA 4QPIC 2VMHA 3VGIA 1N1SA 3VBFC 1BZWA 4CDXB 1Z7S3 1S0DA 2VVDA 4AI3A 1CD3G 2AZ5A 4AI2A 2YV8A 4OUSA 3AP4A 4M00A 4DQAA 2ILMA 2RMU3 1V6JA 4JGYA 5DDJ1 1FX5A 4GWNA 4LA3A 4AF9A 4BIFA 4FQ4A 1MS0A 1LR5A 3MPBA 3LZZA 4JDNA 2BVBA 4UW3A 2PHRA 2R071 2YUEA 1HLCA 4CDWA 4LO8A 1W6MA 2JD4A 4DFSA 1ZBA3 3I54A 1ZYBA 2JG8A 4XBLA 5FAXA 2ZGQA 1GNZA 2GC2A 2RM21 2WLQA 1H8VA 4OUMA 1NCQB 1OA2A 2I07B 3OGJA 3WQ1A 1NLSA 1X82A 3TN92 2CTVA 1AL22 1FI2A 1ZBE2 3MW3A 3VBRC 5T3NA 2ATFA 4CDXA 5J48A 4AG4A 1HIXA 2WZPP 4EROA 1MQTC 1N3PA 3G7DA 3IN9A 4SLIA 3UK9A 1W0PA 4OHXA 1RC6A 4P9GA 2JG9B 1ZBA2 4BM8A 4JC1A 2CAUA 3PVNA 1GZCA 4ATEA 4FAHA 1CAWB 1QQP2 1I3HA 2RS32 4HBNA 2RS53 1OA4A 4S2GA 3PJYA 1OHFA 2PHTA 1ZBE3 4YM1A 1IKQA 3VBOB 4AGGA 3AZWA 4LHNA 1XE8A 5J09A 4XJAA 4I0BA 4MGYE 1RUF3 2WA4A 3ZXLA 3U0ZA 4FSJA 1YUDA 3GZUC 3NO8A 4XMIA 2B42B 1NA1B 3N4MA 5C4WB 3E97A 2H6CA 1NE4A 2WQ4A 4CEYC 2AGSA 3RMXA 3KD4A 4HETA 1MZ5A 2R1BA 4EJRA 1ULDA 3WX5A 1KJLA 2JENA 1N3OA 1C3HA 1QJX1 2CV6A 3D5OA 2YHJA 4MV2A 3FFZA 4MSVA 1IQAA 1XNDA 5GLWA 5CA6A 2QNKA 1F9KA 1LTEA 2VY0A 3FBYA 4HFSA 3ZFEA 3SH5A 2JG8B 3NSTA 3MFCA 1OKQA 3CL1A 3RMYA 1ZRFA 4B8EA 4WM8C 5BYNA 1VBD2 2BW8A 3D8CA 1PZ8A 3HR9A 5E1RA 4HVQA 3ZFEC 1YLLA 4JTOA 3TB0A 5KXEA 1PM7A 4IEZA 4XOGA 4Z82A 4YVSC 3HAGA 1VLNA 5KHHA 1TEIA 3RZZA 5EJ3A 5K7PA 1AR62 2UU8A 5JIAA 1H8TB 2BQPA 4IEYA 3V65A 4WVMB 1SLAA 3M3QA 2GNTA 4YFWA 3CF6E 3DN7A 1ONAA 3H1YA 2A70A 1CESA 5GLTA 1SBFA 4JRLA 4YZ3A 4CTEA 5C9AC 1C8NA 3IIAA 3WCSA 4S2FA 2XL7A 2EIGA 4FPEA 4CP2A 4NWVA 4LNVA 1RUJ3 1FOD3 1MS4A 3EQEA 4JDMA 4I0WB 5I8TA 5JMCA 4DXZA 1G9CA 3AJZA 2PYTA 4FXGB 1H2MA 1WMEA 4RS5C 4I02A 2ZX1A 3RYPA 1CAWA 1NCRC 1RMU2 1H9PA 3J8F3 3VUOA 2X5IC 1D0GA 4FPJA 1TME1 3AFKA 5E88A 2X5IA 5KWRA 4P9WA 3VHNA 1ZBA1 4XFFA 4XJ9A 3LWCA 1LHOA 2PTMA 3JB4C 3NJZA 4WM7A 1PZ9A 5LK5A 1YO8A 3RDIA 1H1AA 4HN0A 4FT8A 2YGLA 4X8PA 2O0OA 2AYHA 4QGNA 2VG9A 3BTAA 2ZX4A 1UPSA 4GB33 3NV4A 1VBB3 3JUUA 4LA2A 4IV3A 4K8FA 3KQRA 1CAUB 5T55A 2PAKA 2VW2A 4Y22A 2R30A 5F6LB 4Q8KA 2QZ3A 3O7OA 3H0OA 1DQ6A 1ND2C 2E51A 2XBO1 3WHTA 3ELNA 3FLTA 4FP3A 2B8MA 3TWIA 4BHPA 4NOTA 3KLSA 3ZDSA 3W9AA 2XVGA 1VAMA 5ACA3 1PIV1 3VBFB 1AR73 4WM8A 1LU1A 2ARXA 1FOD1 1AYM2 4XEZA 3VZNA 4BPZA 2ZGPA 1UU4A 5GZDA 2VW1A 1RUD2 4QPYA 1RUE1 1A3KA 1OI6A 2D93A 1AL0G 4YARA 2H0BA 3GBFA 3LA7A 2DVAA 4E2QA 3QOPA 4YGEA 1Q8QA 2CAVA 1S0IA 3ZFGA 1G9BA 1AR72 2GC0A 4Z8BA 4BZ4A 1GSLA 4EN8B 5FLIA 1RUI1 1LGNA 3D4KA 2GNMA 3OYWB 4J1XA 3INAA 3ZXGA 2R1DA 4GMP1 4HT1T 4YW5A 2YDEA 2ZHNA 3UKTA 1I6XA 4R9AA 4BWOA 4LTAA 2DCTA 4G9SB 2UWAA 4ZXKA 4Y1VA 3ZX7A 4YFZA 1RJ7A 1RHI1 3LKJA 3MIEA 1RUNA 2DUOA 1H0BA 3WG3A 3IDCB 3Q9OA 3QBQA 3ZN6B 1ULFA 5K9YA 3H8UA 4UW4A 3SCGA 3BOPA 1JUHA 3M70A 2FHRA 1PGL2 2CWMA 1U5IA 3PNAA 2E6VA 2B9UA 4O9GA 3HIFA 2DF7A 3N7JA 1OOPC 3RQ0A 1AUYA 2H6BA 1BYHA 2ZMLA 4E4ZA 2VXRA 2C0ZA 4Y1ZA 4AQ6A 3B93A 1AX2A 2DFBA 3ZPYA 2HWD2 4PIYA 2HWB2 2VOXA 2P3JA 5JPMB 1UIKA 1EYBA 4IV1A 5JI9A 4KQ7A 3USUA 1V9U3 1AX1A 1FAYA 2R072 1QF3A 2P3KA 5I91A 1J59A 1ZRCA 1CAXA 3V0AA 5L73A 1DQ0A 2ET7A 3L2HA 2HWB1 1AR92 1ZRRA 3HD8B 4IV3B 5CAZA 3ST7A 5I0TA 3I7DA 1XU1A 2E53A 4WM8B 3ZXEA 1PGW2 1AR82 1SLLA 2DUPA 3VBSC 4L8QA 4MXVA 1NY72 4Q29A 3ZIWA 4HPKA 3O12A 1Q8SA 1BK1A 3MF9A 4EWDA 4DOUA 4XJZA 3POWA 3KCYA 3MW4A 1WW5A 4YG3A 2A3WA 1OPOA 2OW4A 1LCLA 1XQNA 1YYNA 4DNYA 3R6SA 3V0BA 2PA7A 2GMMA 3M3OA 2B39A 3H7YA 4XW3A 1HDKA 2A3XA 4OHWA 1AF9A 5KXDA 1FPN2 1IHMA 1XE7A 3VBHC 4LBOA 1QJU1 4PCRA 5IK5A 4YVSB 1VR3A 2UY9A 1HX6A 2W52A 2WS92 4V1PA 2XH6A 2WNVC 2XL9A 5BNQA 4UW6A 1RUI3 3IPVB 4N43A 3I59B 4QM9A 3IMNA 3AB0A 4C90A 2HEVF 1PO23 3USUB 3RJRA 1SACA 4EN0A 1CJPA 1LODA 4IESA 4YW3A 1R1A1 5SV5A 3WP4A 1RUJ1 4AVTA 5E8AA 3VBOA 2WJSA 2ZGUA 2XJUA 3R4SA 1U5XA 4ISRA 5H9SA 4R9CA 1EAH2 1RUD1 3M3EA 2Z69A 2HWB3 4KG0A 5JI7A 1MS9A 2WFF2 2D3RA 1LEMA 2ZBJA 1ULCA 2VMIA 5C9AB 5JVVA 2XG3A 2G9GA 2GU9A 1SCSA 1D4M3 3E5UA 1H30A 3VKNA 2Z42A 5LK7B 1TQ5A 4DRRA 1WA4A 5AVAA 4AEDA 4HL0A 3VDDB 4DINB 5T5LA 2FZ1A 1GKBA 5F9TA 3B69A 4Q4X1 4MX3A 1PO21 4YW2A 5SV8A 1PO12 1FNYA 2ZAAA 2R6QA 3VZKA 3J8F2 3FFQA 3MW2A 4KU7A 3BODA 1URXA 3SLIA 2VULA 1QHDA 5FOBB 1CPMA 3B02A 3UJOA 5D8AB 1QMJA 3ZYIB 1AYN3 5AFEA 4LLOA 4K9SA 5J96B 1W0OA 1DYKA 1PMIA 1NCRA 1RL3A 4RS5B 3FE5A 4DY3A 2ZGSA 2D6NA 2WZR2 4RR3A 4Z07A 5GLVA 1SFNA 3SCFA 3H9AA 2A5ZA 1Q43A 4E4DX 4Q2FA 5LRSA 3C3VA 3WDWA 2I2SA 4GH4C 1G8WA 1LOFA 1VRH1 2NMNA 2VOKA 1UIJA 2VMGA 2A6XA 3ZMOA 1AXKA 3RJ2X 4GQ7A 4QQPA 3JBG1 4Q8LA 4CDUB 3CJIC 4JRAA 4LHKA 4Y20B 4A3XA 1KFXL 2EXIA 3ILNA 3KS7A 2R0HA 4RGAA 4A7YA 3N7KA 1JN2P 2MPFA 5FOJB 1NQJA 2IXHA 4XXPA 1KS5A 4XJWA 4AI1A 5BPXA 2ZCWA 3IDEA 4YW4A 2Y0IA 3P3NA 4FXKB 4OULA 4XZPA 1DZRA 1EAH1 3AYDA 4JGYC 4RD7A 1JTZX 3HBZA 4DPNA 1AVBA 5FLJA 1W6NA 3A0KA 1GR3A 3ZO0B 1HRI3 1VBC1 5AC91 1OD5A 3PVEA 2EXJA 3QCWA 3LCPA 4E4SA 3ZMNA 2HWE2 1X33A 2ZX3A 4JGZC 3AFGA 3RSJA 2NZ9A 4ES9A 1SFYA 4HANA 3ILFA 1N1TA 1QNYA 3O0VA 1HXS2 4AEDB 4X6QB 3AMHA 4Y20A 2R16A 2RS52 4K1ZA 2R073 4YSFA 1CR7A 2D5FA 4RHV3 2RS31 5FCCA 1BJQA 1YCIA 1FPN1 1QXRA 1WGPA 3HMYA 1UU6A 3E5XA 2GC3A 4LBQD 1TE1B 3VBUA 3AP5A 4LBMA 1AHSA 2RS33 3H1MA 4AHWA 4XHBA 4J6GA 3VBHB 1D4VB 3ROUA 1PGSA 4YNIA 4KG8A 4AVSA 4LBQB 4LUKA 4R9BA 4IL7A 3OPZA 1O3RA 4S2DA 3NAPB 2XWBB 2QUOA 4GH4A 1BVP1 4YVWA 3VBSB 4WVWA 2BNNA 1FYUA 1VBE3 2Q1MA 3WG2A 2GH2A 1YI7A 2XPJA 1GQGA 2YGMA 2VNGA 4IEPA 2C9AA 1DQ2A 2EALA 4M3CE 4IV1B 4R52A 1AX0A 2LUWA 3RYKA 3WR0A 3WG4A 1RUE3 1A6CA 1DGRN 1Z0HA 5DZGA 1K5MB 3P3PA 3ZSJA 5CFCA 1N47A 3M3IA 2F6BA 3E6BA 4CP0A 4OFGA 1FV2A 2QE3A 4AFCA 3EBRA 4XHXA 4QQ2A 4TZDA 1CAUA 1S1AA 4FOWA 4K40A 4MGKE 4XQWA 1Q8OA 3NV1A 1QJX2 5FO9B 3ZFGC 1QKQA 1DQ4A 4XXAA 1SMVA 3ASIA 4EWEA 4M3CB 5I93A 4AI0A 3ME2A 4K20A 1KITA 1W6OA 2ZGTA 2WL1A 1FMD2 5I8SA 1AYN1 5BUVA 1V6MA 3V0AB 4R8HA 5DDJ3 4LBNA 3OBRA 4XBNA 1S2KA 2CGOA 4R4ZA 1X50A 4RQPA 3VBFA 1ASJ3 1IKPA 4AQ2A 1UMZA 3KZ4C 4LBQA 5FFOC 4YG6A 4XYXA 3LOIA 4LT5A 4E2SA 1B35B 2WA3A 2JECA 4Q4V2 3BB6A 3AMPA 5DUWA 2D6PA 2HWC2 1OQDA 3R0RA 4GB32 4LLFA 3H3ZA 4A7KA 4BIOA 2B46X 4YZ5A 1OA3A 4FPOB 1PZ7A 1L3JA 1YJKA 4E9KA 2WNVA 1V6OA 2RR11 2VNRA 2VQAA 3H3UA 3VDDC 2VGDA 3WDUA 1FATA 1VBE2 2HWF2 4R9DA 3N35A 3WDVA 5CFDC 5L7OB 4GXLA 1D4M1 2D7FA 4Y4YA 1NG0A 3AZVA 1ASJ2 2K9ZA 3UKNA 3T1MA 2TBVA 1V9U2 5IT6A 2Q8OA 4M3CA 1AL21 1RUF2 4URTA 1OLQA 2RS51 4PLMA 5LEKA 4Q27A 1BEV2 1LULA 3ZXJA 5BXXA 4D7SA 1EAH3 5ABJA 1G9AA 5C8WA 2D6MA 5HCAA 1AR91 2ZACA 1NCQA 3NVCA 2WNUB 5D8AC 1RVF2 3WVJA 2MEV3 5JIUA 1E57A 1AXYA 1WCSA 3CJIA 2PAMA 3ES1A 5KXCA 4QD2A 1O3TA 1FMD1 3CO2A 4N43C 1R1A3 3O5SA 3ECQA 4AGVA 1RUOA 3BALA 5CFCC 4NHLA 3MZHA 4CZSA 2PLV1 3NKGA 2HWC3 2VPVA 2R063 4FPGA 4RQPC 3WLUA 4K7JA 2UYBA 3AP6A 5DG2A 3AXDA 1APNA 3GBWA 3VBHA 2D6LX 3ZYJB 5BNPC 5GZGA 4CEYB 3VKMA 2XVLA 1Q56A 1RINA 2WIIB 2Q30A 1RUH1 2Q5TA 4AHXA 1C1FA 5EZWA 2HEWF 2SBAA 4KWJA 1MQTB 4GULA 4QM8A 4YVWC 1SBDA 3WG1A 1PK6B 2OIIA 5C9AA 5LEJA 2A6VA 2ERFA 5EYYA 2NM1A 4G4FA 2P3IA 1WLWA 2WNVB 4JGZB 2WLPA 3M1HA 2XWJB 1WCKA