1RVF1

Fab complexed with intact human rhinovirus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 32
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf100
4N43A 1HRI3 1RVF3 5JZGC 3VBFA 2MEV1 1NY71 1POV0 5DDJ2 1HXS1 1AR82 2HWE3 1AYM2 2R041 4JGZC 1K5MB 1RUF1 4JGYC 1NG0A 5JZGA 2PLV3 4Q4X3 1NA1C 1ASJ3 4WM8A 4Y4YA 4JGZA 1BBT3 2X5IB 5BNOC 4JGYA 3DPRA 1R082 1NA1A 1QJY1 3VBRC 1NCRB 2FZ1A 3VBHC 4IV1C 2RMU1 1CJDA 2R061 1ZBA3 5BNOA 1AR62 1BMV2 3JD72 1QQP3 1QJU2 1VBD2 3VBRA 3VBOB 1VBE2 1D4M3 1QJX3 3VBHA 4IV1A 3S6PA 4QPIB 5AC92 3J8F3 2GSYA 3ZFFC 1HRI1 1HRV2 1K5MC 1RVF1 1HRV1 3VDDB 2HWB3 4GB31 2HWE1 4RHV3 2RS32 4N53B 4YVWB 2BPA2 1R093 3HAGA 1TME3 1VAKA 3ZFFA 1K5MA 1VBC2 2X5IC 1MEC1 2PLV1 4Q4X1 2WS93 1COV3 4AEDB 4CEYB 1AYN1 1B35B 1VBB2 4Q4Y2 1RUD3 4Q4Y1 1ASJ1 1ZBE2 1GFF2 4SBVA 4RS5B 5ACA3 1BBT1 2BBVA 4CDUB 1MQTB 2X5IA 1RUH1 1PO22 3ZFEB 2FZ2A 3VBOC 1FOD1 4QPIC 3NAPB 2XBO2 1PIV1 1QQP1 1EV13 3VBFB 1X36A 1D4M1 3VBOA 1C8M3 4YVWC 2WFF2 2TBVA 1TMF2 4QPIA 1PGW1 1DDLA 2QQPA 2RS51 4Q4V2 1BEV3 4IV3A 1VBA2 3ZFGC 4AEDC 4EJRA 1B35C 1R091 4Y5Z0 1H8TB 1TME1 4WM8B 4NWVA 4NWWA 1RUI2 4JGZB 1RUE3 2WS91 2HWF3 2RS12 1MQTC 4CDUC 3VBUC 2WLPA 3DPRB 2RM22 3ZFGA 1NA1B 2ZAHA 1B35A 3ZFEC 1AL22 1VRH2 5ACA1 3TN92 1AR83 4Q4W3 1PVC2 1OPOA 5BNOB 3NAPC 4CDUA 1MQTA 1PO13 4FTEA 3VBUA 4CEWC 3VBFC 3ZFEA 4FTSA 3VBHB 1RUC2 3NAPA 4CEWA 4CDWB 1WCDJ 2MEV2 1POV1 1R083 1C8M1 1NY72 1HXS2 5FMOS 1H8TC 5K0UC 4WM8C 2R042 3ZFFB 1RUF2 3DPRC 3JD73 1VBD3 3FBMA 1VBE3 1H8TA 5K0UA 4GH4C 1RUE1 2HWF1 2R073 4FSJA 2Y26A 1NCQB 4PDWA 1RUJ1 1QJY2 2BFUS 1FMD3 3JBG3 3VBSB 2WZR1 2RMU2 4Q4W1 4CDQC 1OOPB 4GMP1 2R062 4GH4A 1R1A3 1PO11 4GMP0 1VBC3 1EAH3 2HWC2 2HWC1 1RHI3 4CDWC 1RMU3 5C4WC 1VBB3 4CDQA 4RFT0 5GKAC 5BNNC 4BCUA 1HRI2 1RVF2 2HWD3 4IV3B 4CDWA 4GB32 2HWE2 5C4WA 1OHFA 5BNNA 5FMOL 1MEC2 1ND2C 1NCQC 2PLV2 4Q4X2 1AYN2 3ZFGB 2RR13 1FPN3 1ASJ2 4RR3C 3VBSC 2R071 1BBT2 1OOPC 1AR73 1TMF3 1RUH2 1ND2A 1NCQA 3VBUB 1FMD1 3JBG1 1Z7S3 1VBA3 4RR3A 3VBSA 5BNPC 1FOD2 2BFUL 1ND3C 1ZBA1 1OOPA 1V9U3 1AR93 1EAH1 1IHMA 1PIV2 1QQP2 1RHI1 2RS13 4CEWB 1RMU1 4IV3C 1D4M2 1QJX1 1X33A 3M8LA 5BNPA 5D8AB 1ND3A 3J8F1 1PGW2 3LOBA 3TN93 2HWD1 2RS52 2ZTNA 1F2NA 1VB2A 2HWB2 1CD3G 1PGL1 2HWB1 4RHV1 1R092 1TME2 1E57A 1RUG3 1W39A 5K0UB 5C8CB 2WS92 1RUC3 4PDWB 1COV1 2RR11 1FPN1 1RUD1 2XPJA 5ACA2 1AR71 4GH4B 5DDJ3 3CJIB 1AYM3 1Z7S1 4WM7B 2ZZQA 1AL0G 1NOVA 1V9U1 4CDQB 1AR91 5D8AC 5CFDB 5FOJB 1SMVA 1EV11 1VB4A 4YVSC 1C8M2 5C4WB 5ABJC 2BUKA 4CDXC 5D8AA 5BNNB 5C8CC 4LLFA 4PDWC 1BEV1 1AR63 4YVSA 1QJU3 1RUG1 5ABJA 4CDXA 1RUE2 1HQNA 1HX6A 5A33B 2HWF2 5C8CA 4QPGC 5AC93 3CJIC 1ND2B 1C8NA 4WM7C 1HRV3 1RUJ2 4GB33 4RR3B 2WZR2 4Q4W2 5DDJ1 1AR81 2RS33 1AYM1 5CFDC 5J98B 1PO12 5L7OB 4QPGA 1RB8G 3CJIA 4WM7A 1MEC3 1AYN3 5J96B 4Q4Y3 5BNPB 2GH8A 1ND3B 1ZBE3 5CFDA 5A32B 1RUH3 4RQPB 1R081 1PO23 1M06G 1FOD3 1AUYA 1A6CA 2WWSA 1AR61 1BMV1 1PIV3 3JD71 2XBO3 1QJU1 1VBD1 4FTBA 1VBE1 2R072 5AC91 2WFF3 5A33A 5L7OC 1FMD2 3JBG2 2RS53 3ZXAC 4Q4V3 1R1A2 2RS31 5LK7B 1R1A1 1ZBA2 3JB4C 5L7OA 1EAH2 1RUI3 1VBC1 1RHI2 5C9AB 1RMU2 3IDEA 4RQPC 1QJX2 2DF7A 1NCRC 1VBB1 2RM23 1ZBE1 5CFCB 3J8F2 1AL23 1VRH3 2HWD2 1PVC3 1PGL2 1PO21 4YVSB 5A32A 4RQPA 4RHV2 1NCRA 5ABJB 4CDXB 2VQ0A 2IZWA 4N43B 1F8VA 1COV2 2XBO1 2RR12 1FPN2 3VDDC 1RUD2 1POV3 2MEV3 4N53C 1AR72 2WFF1 1HXS3 1TMF1 4QPGB 2R043 1Z7S2 5JZGB 1RUF3 5C9AC 4Q4V1 3VDDA 4CEYC 1VBA1 4Z92B 4YVWA 4N53A 1V9U2 1AR92 5CFCC 4RS5C 1RUI1 1QJZA 4JGYB 2RS11 1EV12 5C9AA 4AEDA 4CEYA 2RM21 1RUJ3 1QJY3 1AL21 1VRH1 2WZR3 5CFCA 3TN91 4RS5A 2RMU3 4GMP3 2R063 1PVC1 4N43C 1BEV2 3VBRB 2HWC3 1RUG2 4IV1B 1RUC1 3JB8A
chains in the Genus database with same CATH superfamily
1DU3D 3WOGA 1K3IA 3K2OA 4A44A 1RVF3 5IK7A 1PK6B 3RYKA 3VBFA 2YBPA 1EP0A 3S5QA 3MIDA 2YYOA 5DN2A 4YWAA 2WNEA 2CAUA 3F95A 2XH6A 2R041 3OGVA 4N7UA 3WW3A 4E4DX 4JGYC 1FATA 3DXTA 1IS3A 1NG0A 4ISQA 2W5FA 1S55A 2VUCA 4HL0A 5HV4A 2WRAA 3KVAA 3WW1A 4BQWA 4NHMA 1PX3A 3HOBA 4JRLA 5F3CA 4Y4YA 2BWCA 1MZEA 1JH5A 1J3QA 4JGZA 4K1ZA 2FBEA 2QDRA 4NUBA 4S2FA 4DUVA 5A6XA 5LY1A 5CISA 2ET7A 3WNNA 5FR3A 1R082 4OCTA 1GQHA 1NA1A 4OYUA 5LBBA 3OGGA 2FZ1A 2GDFA 2VO5A 3M4FA 2ZEYA 3ZN6A 3K4ZA 2VBBA 2JDAA 1W8OA 5FZ0A 3ZDSA 4FPHA 3RMXA 3UESA 1IKQA 1GNHA 1XB9A 4FP2A 5AVAA 1W3XA 2YZ4A 4IQPA 5FJKA 3JD72 1QQP3 1QJU2 1H2LA 1VBD2 3VBRA 1UY2A 3T09A 2GU9A 3VBOB 2WWJA 1H8VA 1D4M3 3AL5A 1SBEA 3S6PA 3VHPA 4P5YA 4ZXEA 4AFBA 1WD4A 3ZSLA 5T52A 2V73A 5A1FA 5JUVA 5A7WB 2JXAA 1HDKA 1K5MC 1RVF1 5FZKA 4C0BA 5IVEA 1GSLA 2OPWA 2J1TA 4GB31 2CGOA 3U11A 4CU8A 3AJZA 4YVWB 4X8NA 2XONA 4F8AA 1MS5A 4QB1A 2Q8EA 2VNRA 1W2OA 4CCDA 4P14A 3ZFFA 4QX5A 3DGTA 3EBRA 1OLRA 2QZ3A 2YGLA 4DS0A 1HN1A 1UKGA 1SBFA 4DO0A 4CEYB 1AYN1 4P08A 4COVA 4Q4Y2 1UYZA 1VBB2 3H7YA 4RYDA 1FX5A 4Q4Y1 4MGKE 4SLIA 2JKBA 4MYEA 1ZBE2 2PN5A 4YW3A 1KS5A 5F5AA 1GQPA 3ME2A 2B9VA 4NHKA 2ES3A 4XBLA 2RVAA 5ACA3 5F8PA 5FZLA 1LHNA 1OC1A 3MFAA 4QX8A 2X5IA 4B4PA 2P17A 3D0SA 2WAOA 4F7ZA 1ZYBA 1L3JA 4YW2A 3ZFEB 1CWPA 1RYYA 3K4AA 4PLNA 4OI2A 4QXBA 4L11A 1FOD1 2A6XA 5IYYA 3NAPB 5F5QA 4CYDA 2XBO2 1QQP1 2P2KA 1V6OA 4S2GA 3VBFB 2G4IA 1D4M1 1UY0A 5EFUA 4YNIA 3RVHA 2QQIA 1GOGA 1MS9A 4A7YA 1OUXA 2TBVA 1TMF2 1PGW1 3DECA 4MHRA 4FPFA 5LCWL 4PCRA 1QOTA 4YZ3A 3UK9A 4IESA 4AL9A 1ZRFA 1BEV3 4IV3A 3PUQA 1JI6A 2PYTA 2QFEA 1JZ3A 1UX7A 1B35C 2A1XA 4LKFA 3U14A 2JDHA 1OPMA 3KHCA 3AP7A 4RGAA 3T2PA 4NROA 4JGZB 3PLQA 2QQWA 1LR5A 1J1TA 1UPIA 3GM8A 1CGPA 4TSVA 2WLPA 1NA1B 2GC1A 3P1IA 3LAGA 1W2AX 5IW0A 3O12A 3WDTA 4AFCA 2FCTA 2RE9A 4PQ9A 4D6RA 5ACA1 5EV7A 2JWPA 1AR83 3M3CA 4EZ4A 3ZVXA 5LATA 4BQ2A 1MQTA 1PO13 4A45A 1W99A 4LO8A 1X82A 2JJ6A 3VKFC 5F37A 1QJFA 3LIHA 4O7XA 1DGRA 2F4LA 2DURA 4FQ4A 3KVBA 1MS0A 4M01A 4FTSA 2QQMA 4UWDA 2C5DA 4HK9A 3LEIA 4LBLA 3I2OA 3U10A 3AMMA 1QOOA 1RUC2 3V65A 2ORZA 3U1XA 4Z1VA 1LGBA 4LKEA 2VMEA 3ELNA 3RI8A 1POV1 1TE1B 1NY72 2WINB 3OYWB 2NLRA 1YFUA 3LD8A 1W06A 2W46A 3CZJA 3AP9A 5K0UC 3D6EA 1NLSA 1L7RA 3VKNA 5KXEA 1HB3A 3ZFFB 1RUF2 2WNOA 3JZVA 4DPNA 1BLZA 5FPBA 2Y60A 3LQCA 2W52A 4KG8A 3ORJA 1LGCA 1YC61 5FZOA 2XLAA 5JCTA 2B5HA 3MW4A 3AJYA 2WN2A 2V09A 4JX0A 4E4HA 2VQAA 2PELA 3FBMA 3KZ4C 1W9TA 4XJAA 4ASKA 3TEYA 4R4ZA 1HQLA 2GH2A 1V6JA 2DVGA 2VCCA 4ZXKA 2IWGB 1FNZA 2C4XA 1D7PM 4BPZA 4CU6A 3AKTA 1WUVA 3M3QA 4AI3A 1GU3A 5FY4A 2AR6A 2PMWB 4FPJA 5A3MA 3I2JA 5JOZA 3AK0A 4MH0E 3AKSA 2WZR1 1W9FA 2RMU2 4N9IA 5F5CA 5KHKA 1PNGA 4GH4A 3IAQA 2JD9A 3RZZA 4LULA 1JW6A 3ZO0B 5I8TA 4BMEA 1CJPA 2WKKA 1PO11 2H0BA 2V4AA 4ZPIA 5FK8A 4A41A 3ZYFA 4MUVA 4Y1UA 2HWC2 3IWZA 2BZDA 1W8NA 2HWC1 3SISA 3ZR5A 2YC2A 1CIWA 3S0MA 2WJSA 4IW3A 5C4WC 3ABZA 5F6KA 4E9KA 5JSRA 3R4SA 4AYUA 4E27A 4YW1A 2QBXA 2KM2A 2YBSA 2FHRA 3OBTA 4OMCA 5FZFA 4LOSA 4K7JA 1N47A 4IV3B 2ARXA 2PQQA 3UKNA 3ON7A 4OVEA 1W3VA 4UW3A 5FUPA 3VHRA 3GZTB 3BI3A 3NO8A 4ZKTB 5ISLA 3WF4A 1I9RA 1LODA 4I0BA 2BNOA 1LTEA 1UU4A 4BQ5A 3SNMA 4E2GA 4MGIE 5IWFA 1CONA 1SPPB 4BLJA 2BGPA 1HKDA 1OD5A 2QDNA 5KHIA 1BK1A 3GBGA 4DZGA 4P9XA 1HN0A 1ULGA 1FPN3 4HSLA 4BXFA 1ASJ2 2WNVB 3POGA 2DCYA 5GLVA 2QNKA 1G6NA 2Z42A 3VBSC 3PUSA 4MADA 5DUUA 5IAXA 4AVSA 3GALA 1IOAA 2VE1A 1BXHA 5HI0A 1RUH2 1NCQA 2VNVA 1DG6A 4ZU4A 3OD0A 2VZTA 4META 3I2FA 4AQTA 3VDAA 3I3MA 3BN6A 5DAPA 2WDBA 3NV2A 4AOCA 2ZXQA 5BNPC 2BFUL 1ZBA1 2GP3A 3WNMA 3WHUA 2LS6A 4AR2A 2A5ZA 2BNNA 4AAXA 1ZZ8A 1CPNA 3SCFA 5JAXA 1ULOA 4MXWA 4X8PA 3WINE 1JOJA 3BUCA 2QKDA 4N8MA 4Q0SA 5D8AB 4XUQA 1UMIA 1HB2A 3H3LA 4IE7A 3NWKA 2QCSB 3WG1A 1JZ2A 1Q8OA 4CXWA 2VUAA 2VW2A 4NIAA 1F2NA 2IXKA 3ZXEA 4DRVA 4R9DA 1UXZA 3USUB 5C3QA 5D21A 1QJEA 3O0VA 3SH3A 2JDKA 3T1MA 1OUSA 5JPMB 2EALA 4QU1A 4WVWA 3FX3A 4XUPA 5HXVA 5C8CB 3AKPA 2WFPA 2WT1A 2VU9A 2ZGTA 3KHBA 3CBNA 2HYKA 3NVCA 1GZWA 2X29A 5ANNA 3VL9A 3QBQA 3C2UA 3U0ZA 5FP9A 1FPN1 1ULPA 4QXHA 1ZRRA 1OXCA 4GH4B 5DDJ3 1DYPA 5HCBA 5DZFA 1W0NA 1UQXA 3FHQA 3ROUA 1EPZA 1NAEA 3WEZA 5A3NA 1XNKA 3I2DA 1JOPA 4NHYA 3TNPB 3AYEA 1YQ5A 3AZVA 3CDZB 4IGOA 4J1XA 1W6MA 4GKYA 4OUSA 3D5OA 2D98A 5IT6A 1TNRA 3KB5A 1VB4A 5FFOC 1PMJX 1O8SA 4YVSC 4YG6A 5KWRA 2WZEA 3TEXA 5ABJC 1JZ4A 5CAZA 2QQVA 1QDOA 1MS3A 2WQ4A 1O7FA 2W95A 3ZSMA 3WCSA 5CNAA 2C9KA 4NHLA 5FWEA 3GJAA 3HT2A 4UBHA 5JI7A 3I54A 3ES4A 3N36A 4B8EA 1W90A 2IFRA 4FPYA 3WD5A 3H8RA 3W9AA 4JAAA 4QB6A 5A7PA 1JU3A 1AF9A 2VH9A 3Q8AA 4XZPA 3ZR6A 4EYUA 1RUE2 5A7QA 3BOPA 4P5HA 2NYYA 3HBKA 5FMBA 3CJIC 2CDPA 2OT7A 3JQXA 5CVRA 5KR7A 2ARBA 5FCCA 5JWPA 3FC0A 1RUJ2 1OSGA 1V6NA 4BZ4A 1RGSA 1PHMA 4EWDA 3O1TA 2V4VA 2WSUA 3OPZA 4Q4W2 5JLVA 5DDJ1 2DWRA 2X10A 5FMCA 4Y5SA 1Q8PA 1CAVA 4V2WA 5J98B 3SKVA 3Q8CA 4QPGA 2AGSA 2VZRA 3CNAA 3DKQA 4K3UA 4QD2A 5H9PA 4ZU7A 3O1RA 5LZ6A 2Q4SA 1MEC3 2FQPA 2YUEA 3OOXA 5LBFA 4MXWB 1JYIA 1DYOA 2TEPA 4RSUA 2OUJA 5T5OA 3WVJA 2PQSA 1MZFA 5H9SA 1ZZBA 5H9RA 2E53A 1DGLA 5FP3A 5CFDA 3N3HA 3GHMA 3U37A 1GBGA 4LKDA 1W9YA 4URTA 3HJRA 2VCMA 5FPAA 4BXSV 1LECA 3WDWA 1AVBA 1M06G 3AZZA 1YQ6A 2ZGPA 3H1YA 5FY1A 1NZIA 1GUIA 1AUYA 5M0TA 3AMNA 3CLPA 4GWMA 1WWYA 4PJYA 1GZWB 1XNAA 2VD7A 2WWSA 4FPLA 4NE9A 4UI9L 4C91A 1YIFA 1PIV3 1XXNA 3ZYJB 1KD7A 1LOGA 3J7HA 4HG6B 1UCXA 2WN3A 1OBNA 2W0XA 4NAOA 4YSFA 5SV8A 2E51A 2WFF3 1Z0HA 4L99A 1GKBA 3O0XA 3ZXGA 4TZDA 5FYVA 2VZPA 4IEOA 3ZYPA 4IE0A 4BYYA 1A78A 3I3QA 2O8OA 3I3BA 5FZEA 5L73A 1LHVA 3IAPA 5HBAA 5A3WA 1R1A2 1W6PA 4PIXA 4U36A 1R1A1 2CV6A 1EY2A 1ZZ6A 4JKMA 4P9GA 2BWAA 1W6MB 5CEHA 2CYFA 5L7OA 2XWBB 1VBC1 4QMAA 5FPZA 1RHI2 3W5NA 4Q27A 4Z82A 1PNFA 1RMU2 2XXZA 5C9AB 5FYUA 3IDEA 3WCRA 1OQDA 4FBFA 2IC1A 1QJX2 2W9XA 2AACA 2YROA 5HCFA 2WR9A 1UY3A 3J8F2 3VKLA 4R9CA 1WLTA 3ZXFA 2ZGMA 4WVMA 4EN8B 5JOWA 1PGL2 3T0AA 1GP5A 3KV6A 1M4WA 2EXJA 5FO8B 4BJ0A 3DEMA 4ZU5A 3V56A 5FPLA 3QLQA 3WNOA 3ZXKA 2BDRA 1GNYA 1EPWA 3FZ3A 3M3EA 1ODMA 4OHVA 2BV4A 5ERLA 4DINB 2C1FA 4W6XA 1COV2 1CN1A 4XFBA 3UJQA 2XKOA 3LSEA 4X6RB 2RR12 2P3JA 4LOTA 2Q0AA 3OPWA 5IVJA 2XG3A 1GMMA 2AEZA 2A3WA 1UNBA 2WFF1 4KU7A 3LA2A 1O3TA 4QPGB 4DY3A 1V0AA 1XU1A 1YFXA 3S7IA 3C7EA 1Y9QA 4CEYC 1VBA1 4R52A 1CQ9A 1RL3A 1S0EA 2Z5WA 1CAXA 3WV6A 4N53A 2GAUA 2YU1A 5CFCC 3POSA 3MF6A 3S57A 3T4VA 1Q8SA 5FY8A 2K0GA 2ZBJA 2OUHA 1S1AA 1VMFA 1EV12 2VCBA 4PQQA 3ZM8A 4ZS2A 5GLZA 3FJSA 1CZVA 2LRPA 5LA0A 2DFCA 2VG9A 3RWNA 2D6PA 1UU5A 3FMGA 5A3TA 3TN91 2VVEA 4LE4A 1QKQA 4GMP3 3BALA 1W2TA 1H1IA 4EWEA 1OLME 4ATFA 3NSTA 3V0BA 3N7MA 4OI1A 2X8KA 1GWMA 2BOIA 1E5SA 1A8MA 4ARYA 1CESA 1AZDA 1NX9A 1LB2A 1JYWA 4YW5A 1HV1A 1XNCA 3N7JA 5C3RA 5JDBA 4QDRA 3VLBB 4A42A 1RJ7A 1HRI3 1C4RA 1STMA 2BQPA 2LM3A 5IVFA 2Q1MA 1JYNA 2VCAA 3MICA 4M3CE 3POEA 4JVAA 1N3OA 1W6PB 2FDKA 2GZWA 2VZUA 2C6SA 2DFBA 3RG0A 1G7YA 1AJOA 4JGZC 2Y38A 2IUWA 3AFGA 3HMYA 4JDMA 4G9SB 1UIKA 4XACA 4HKWA 5JZGA 1WA6X 2R0HA 1NA1C 1ZRIA 3IBMA 3MUZ1 2Y6HA 4CRQA 1JHNA 4CU7A 2DVFA 2B39A 2W1UA 1PZ7A 4LLOA 4WM8A 2BGCA 3IMNA 5FKBA 5FXXA 4OI4A 4WVMB 3ACIA 3I59A 1BBT3 1NLQA 4AG4A 4EN9B 1H0BA 1XOYA 3DPRA 3D3AA 4GULA 4KNCA 4FQZA 3VBRC 2XJUA 5JSPA 1KFXL 4HVOA 5BNQA 1UYPA 4RN5A 3QOPA 5E1RA 3AMPA 1WCKA 4PF5A 4CUCA 2GP5A 2BOJA 3E1F1 5FZIA 1YCIA 4PIZA 5EWSA 5FP8A 5FXVA 5BNOA 1AXYA 4JKKA 3J4UH 1WW4A 2B8MA 2UWAA 3WUCA 2CAVA 4P02B 3ACLA 5BYNA 5C5TA 1W8TA 1VBE2 3HD8B 3PJYA 1H30A 4IV1A 4OFGA 5E88A 3H8OA 4QPIB 2L9LA 2VZSA 4LK6A 1RJ8A 5AC92 3OUHA 3ZFFC 1W6NA 1HRI1 2O8QA 1CVNA 2EIEA 2JG8A 2XJVA 2HBTA 4HETA 3GXUA 3T2OA 3UKTA 1S0BA 2HWB3 4DOUA 4RHV3 2QQOA 4N53B 4NIHA 3EQEA 1TME3 4WZCA 5FY5A 2DUPA 1UZ0A 3ACFA 5DPNA 4A4AA 2X5IC 3MDPA 4YM2A 1H4HA 2XJQA 1UZVA 3L9JT 4UT5A 1SZBA 1YWKA 1LCLA 5LA1A 4FCAA 3OD4A 1YJKA 1RUD3 1DLCA 4ORFA 5LEKA 1PZ9A 3BTXA 3AC0A 1RXGA 3MUY1 4Y5TA 1U12A 3NV3A 3MHZA 4SBVA 4DB5A 5LEJA 4LNVA 1BBT1 3LPGA 4IE5A 2VBPA 4XJ8A 2BBVA 2X09A 3DYOA 3V0BB 4EWAA 1FT9A 1DQ4A 4CDUB 2NPIA 4LORA 4UYBA 3JUUA 4O61A 4JC1A 1PO22 3KCYA 2QQUA 2WLQA 4X6QB 5LBEA 1KS4A 4AVTA 2NP0A 1SCSA 2D3PA 4W50A 4AHWA 1S0CA 1SQ4A 2CY6A 2W1SA 1TZOA 4Q0PA 2H6CA 5EYXA 4IEYA 2HLEA 2DCJA 2B42B 1SDDB 3LOIA 5JOYA 1OLQA 3MIGA 1V6IA 4CVUA 2PHXA 2PFWA 2UURA 2DCKA 2RJLA 3AZYA 1UOFA 3C8XA 3LDBA 3KMHA 5FZ6A 1X36A 5EHDA 4TN7A 3VBOA 1GQGA 1WCUA 4OULA 4COYA 2ATFA 1JN2P 2X53S 3MI8A 4O65A 5A7WA 5FY0A 2QQPA 5DZGA 1MACA 3LIGA 5LW9A 2RS51 3MGUA 1G9BA 1F5JA 2ZGKA 4AEDC 2WT0A 2D5FA 4LXLA 2JDMA 2GALA 2P3YA 3CIHA 4IEXA 4FVVA 3GZUC 1H8TB 1TME1 1QXRA 4WM8B 3SCGA 1NXD1 3SMHA 1NYWA 3I59B 1MPXA 3KT7A 1FV3A 2HWF3 2RS12 1MQTC 3WDYA 5FZAA 5CZKA 4ASLA 3RWKX 3DPRB 2PHWA 4Q8LA 4L2NA 5EJZB 3DYPA 1W0OA 3FL7A 1AL22 2O0OA 1C1FA 2WNUB 2ZGRA 1R1ZA 3LCPA 1DYKA 4XXAA 1PVC2 2YC0A 1OPOA 5BNOB 2R30A 2UYBA 1WW7A 1F4HA 2DBIA 4E4SA 1UIJA 2DVDA 4I01A 5F3GA 3EJKA 3ZFEA 4MO3M 4QHOA 5C33A 4CUAA 4UOJA 3AYAA 2VVDA 3LKJA 1BCXA 1C28A 1H2KA 4MHUA 3B94A 3NJVA 2Y34A 3NAPA 2JG8B 4KWJA 3K3NA 4CDWB 2F6BA 2VPVA 3CL1A 1R083 3T3YA 2IVIB 3VZMA 4NPMA 3X29B 4HT1T 4YGCA 2R042 4K1YA 3RZMA 4OZOA 4OQ8A 4UW6A 5DXDA 5FYZA 3NJXA 3O1SA 4XOGA 3DUIA 3JD73 1CPMA 3HIFA 1VBD3 5FP7A 1O5UA 1IS4A 5LRRA 4GH4C 1SACA 1ULDA 2HWF1 2R073 3Q9OA 5FUNA 2FDGA 1MVQA 2ZEWA 4PDWA 1T6BX 4JTNA 2GMEA 1FMD3 1YO8A 3JBG3 3LB9A 3PTRB 3KV4A 4GJYA 3NJZA 1SLBA 4MGYE 2XJRA 3K48A 2CSGA 3NNLA 1OOPB 4FPKA 4LBQB 4YZ2A 3I49A 4Y20B 3TOJA 3OG2A 1XJAA 3QD6A 4LKSA 2JDNA 3B02A 2WA3A 2UY8A 1LKNA 3GNEA 4UFJA 4QM9A 3LA7A 3GF6A 1J1LA 4PI2A 2P3KA 1VBB3 4Q29A 3ZXLA 1SBDA 4ZZ8A 1SLAA 1LAJA 5GKAC 1F31A 1RVF2 5F7UA 3WXPA 1I3HA 1YLLA 3EYPA 3KF3A 3KGZA 5FREA 4XIOA 5G05L 3UL2A 4ES9A 4AI9A 5A6ZA 5I0RA 3DF0A 4GB32 3HN3A 2R6QA 4EROA 1ODNA 2C9AA 3OYWA 5EIYB 2VTFA 2WQZC 3WG4A 1N1VA 3PMEA 4HMZA 4QX7A 2VOTA 2BVVA 1NCQC 1Y9MA 5T5LA 3A0KA 4AFDA 3WQ7A 5A3LA 1AYN2 1IZ3A 3AYDA 3R4DB 4FFHA 2XUEA 3HT1A 4XF1A 3ACHA 2GC3A 2J1VA 2R071 5EPAA 1TMF3 1LU2A 2W08A 3FBYA 1Q5OA 5DAVA 1ND2A 3ILFA 4BWOA 1FMD1 3JBG1 1W9SA 1Z7S3 2UYAA 3P3NA 2CWSA 1YNAA 3U4SA 5KXCA 1MS4A 1TEIA 4YG0A 1JMUB 2GNDA 2RDSA 1FOD2 2W87A 1V9U3 1FV2A 1IGOA 3PUAA 4AFAA 5HV0A 3ACGA 3T0DA 1QQP2 3EB7A 3HN1A 3GYDA 1D4M2 4DRRA 1RINA 1GP6A 3PURA 1UO9A 3JU9A 2P34A 2CTVA 3AKRA 1X33A 1ZNPA 5A7NA 2BGOA 1X8EA 5TSWA 1ND3A 3W59A 1PGW2 4XVHA 1V6LA 5A70A 3H8XA 1RXFA 5FTTC 3WW4A 1NE6A 2QJVA 3WX5A 2ZTNA 4FOWA 1JU4A 2ZS6B 3IDCB 1WW5A 4BDVB 5IVCA 4IGQA 5I0UA 1CX4A 4FOQA 5L9BA 4YZ5A 1RUG3 1W39A 2GN7A 5FIXA 4R8HA 1KJLA 4UF0B 2Y6KA 4AK3A 3ETQA 1RUC3 4PDWB 5JXGA 4G4FA 1SPPA 3RYRA 5JOXA 5FZ4A 1VMHA 2J1UA 2D6MA 3LF7A 2WNVA 2EXHA 1N1YA 4DMIA 5ACA2 2QQNA 3FFZA 2W1QA 3OSDA 4D7SA 2VY0A 3THPA 3C3VA 4A3ZA 1AYM3 4BQ3A 1JUHA 1Z7S1 4NMIA 4WM7B 4W6YA 1PM4A 5K7PA 3I2HA 4KU8A 4QHZA 2B7YA 5CA6A 1WW6A 1NOVA 2G9ZA 3WF2A 3LSDA 1D4VB 1V9U1 4LHKA 2D44A 3WR0A 1GV9A 2BBAA 3USSA 5LY2A 3KQ4B 2XJTA 1C3HA 3VD3A 3AL6A 2IXJA 4NHXA 1SMVA 3ATGA 3IMMA 5JVVA 1OA2A 1J3PA 4E2SA 5C3PA 4AI2A 5JR7B 4F3JA 3RZLA 1CAWA 4OLLA 2BTVC 3E5QA 2VECA 5JMOA 5L36A 2BUKA 2Z69A 2ZX1A 4XIKA 4AGGA 1XNTA 1JYXA 4U2AA 4CP9A 5LRSA 5D8AA 1GYKA 1DQ6A 4NAMA 4CCCA 2D6NA 3Q8BA 1IPSA 2GC2A 3ES1A 4NR1A 3P5BA 5IAVA 1BEV1 4QKBA 3WF1A 3ZKYA 1AR63 4L9BA 1DBNA 1OF4A 3USUA 5FQ0A 4LEJA 2B45X 1RUG1 5A3PA 4D0QA 5IVYA 2QE3A 1HQNA 1HX6A 1TVGA 3H8UA 4Y4RA 5C8CA 4QPGC 5FZ8A 2Q1FA 4AI1A 4I2OA 1ND2B 1C8NA 3SHRA 1HRV3 4R9BA 1LRHA 1QEXA 2JG9B 2VOKA 1YI9A 2ZEXA 3MPPG 3N9MA 4YG3A 4ZY9A 2WZR2 4YLZA 3BODA 5FZMA 1AR81 2KD7A 2RS33 1AYM1 5BPXA 2D3RA 2BVBA 1PO12 2JE9A 4LTAA 3T1LA 5CFDC 1RB8G 1YYNA 4QQ2A 4QKDA 1IPKA 4Q0QA 3GZAA 3FUOA 4Q26A 4E8DA 2IXHA 3MIHA 1WD3A 2J22A 4HONA 2A6ZA 2Z4FA 4IXLA 1L7QA 1ND3B 3OGRA 2Y64A 3AXEA 3IB3A 1GLHA 4AF9A 1LNSA 5A32B 1RUH3 4RQPB 4CCLA 5L9VA 3B9CA 3E5XA 4IL7A 4JHZA 3I4IA 1JZ8A 4W65A 1JTZX 1VAVA 2JEMA 3KV5A 2Y6FA 3CHXA 4BH9A 2XQRA 2UU8A 3F2ZA 3UT0A 4XBQA 2KA3A 1AR61 5EJ1B 1D2QA 1BQPA 2XHNA 1BMV1 1WCSA 2ZA9A 4LBNA 2EF6A 4FTBA 5FY9A 1K5JA 3BCWA 4YW4A 1SFNA 2OIIA 5T54A 2ZX2A 4EN6B 2EIDA 4NPLA 1W8WA 5L7OC 1REDA 2E9QA 2OXBA 4AW7A 2W2IA 1UOGA 3WDXA 3MV01 4QDSA 3AVSA 4Q4V3 2OQ6A 5GZDA 2ZGLA 1US3A 3T30A 5L9RA 2RS31 5DABA 5F3EA 4K6BA 4PBOA 1ZBA2 5LK7B 5E6HA 1YI7A 4FPOB 4XEZA 4GAZA 4Y3OA 2VL4A 3J7NA 3WP3A 4A3XA 1RUI3 5F5IA 3WDVA 5A3UA 1CAWB 2W39A 2XWJB 2VC9A 2RM23 4LO6B 1ENXA 3NKGA 4S2HA 3D4KA 4CP9B 1DLLA 1VRH3 4UFIA 3Q8EA 3OGSA 1LOAA 2CL2A 2PHUA 2VJXA 4LBQD 4XYXA 4ISRA 4IEVA 1ZA4A 1SEFA 4XAAA 2PHFA 4OUMA 5FV3A 4CP0A 1N3PA 2D40A 4HVRA 5FQ0B 3AKQA 4QAWA 5FRAA 2OQ7A 2RDRA 2VNGA 4BISA 1ULEA 1F5FA 1HIXA 2MHFA 2DCTA 4FP3A 4LA3A 3PDQA 4XILA 1X7NA 2QQLA 2FMDA 1RC6A 4QU2A 5IATA 4Y1ZA 4N43B 3WW2A 1F8VA 1D0HA 1DZRA 2VMFA 3MF9A 4O9GA 2V5DA 1BKZA 3O1MA 4H14A 1FPN2 1W6QA 2B4KA 5FZBA 2BP6A 2MEV3 4N53C 4EQVA 1Y43B 5ANQA 5I8YA 5HPOA 5CG9A 1HXS3 4D7TA 2KXLA 5C71A 1CX1A 2I45A 4FOVA 1O91A 5GLWA 1UMHA 4Q4V1 4R9AA 3FWEA 1SHWB 4AVAA 2JDZA 2OZJA 2XVKA 4NN0A 1ULCA 4Z07A 3SH5A 4BQ1A 1W0PA 1A8DA 1Q8VA 4I02A 2TUNA 1I6XA 1RUI1 4L92A 3ZYGA 1QJZA 4JGYB 2ZGNA 1DQ2A 4FAHA 4HN0A 4KWKA 4Y24A 3VD4A 4BMBA 2AUYA 2HEYF 5C9AA 2J1SA 2RM21 1RUJ3 2PXJA 3RRDA 4MOAA 1QJY3 4KG0A 1LGNA 3SCHA 3UYJA 3C7OA 1VRH1 1Y7BA 3E6DA 1KITA 2WAAA 2Q8CA 4PLMA 2OVUA 4XXPA 2R063 4AZZA 5K9YA 4JDOA 2VQUA 3VDBA 1O59A 1UN1A 4PI0A 3QACA 1ULFA 3KM5A 3LWCA 1OI6A 1MZ5A 5C3OA 1NE4A 1REFA 3MYXA 4JHTA 1Z78A 1W2NA 3N7LA 3MIFA 3JB8A 4XQDA 2ZEZA 4CTEA 1S0IA 4QWNA 5JZGC 3NQHA 4EN0A 2MEV1 4AEJA 1Y4WA 3POFA 4I0WB 5DDJ2 1HXS1 3VZNA 2HWE3 4BK4A 2PHLA 2ERFA 1S2KA 4C8DA 4LR4A 3LFMA 4J6GA 1K5MB 4D8MA 4KBZA 5FWJA 2PLV3 4Q4X3 3LZZA 1YEWA 1EUTA 1XSRA 4BIOA 2BJSA 3AMQA 1OFSA 1X50A 1W28A 1GR3A 2WSVA 3O14A 3IM0A 3POYA 3J7MA 5BNOC 4IEZA 4XF4A 3O1PA 5D2AA 4LITA 4C90A 1QMJA 5F39A 4B4QA 2WWUA 1QJY1 1DZTA 1KJRA 3EHKA 5F3IA 3E6CC 4IV1C 5KC6A 2XMLA 3KT4A 2XHKA 2R061 1YXWA 1ONAA 3RGBA 3APBA 3IPVA 2VTXJ 3CQOA 4LT5A 2B9UA 4MGSA 5F6LB 2AH2A 4TLFA 1W6QB 3HQUA 1PK6C 2DYCA 1WMEA 4N90A 3RJRA 3WY6A 1QJX3 3I97A 5DZEA 4I0AA 3VBHA 3CMGA 2LROA 3PHMA 5A1AA 4Y1YA 3J8F3 3PU3A 2E63A 3CF6E 3KQRA 2VOVA 2ZGUA 3KSCA 2A71A 1Y3TA 4QGLA 3WNKA 5APAA 5FPVA 2HWE1 5EXOA 4LA2A 2VMCA 1R093 2BPA2 2Z79A 3HAGA 3THTA 4HSJA 1WCQA 4XHXA 1C5IA 2KR2A 1LJ7A 3ITQA 5C70A 1VBC2 1VPHA 2FDIA 1MEC1 2PLV1 4Q4X1 2WS93 4Y22A 1COV3 1GOFA 5HXMA 2P37A 1B35B 5FZHA 2RDNA 4CUBA 4CUGA 1OQEA 4J25A 1GFF2 2ZMNA 4HN1A 5DG1A 2DUQA 1W8ZA 1XYPA 3IZOA 1JYVA 4N9HA 1NUKA 4XJUA 1OT5A 5DQ0A 2E7QA 4AHXA 3TRSB 3LPFA 3VBOC 1N3QA 4NRPA 1GICA 5KHGA 3NNGA 4V2VA 5FYCA 1G86A 5FZ3A 5IHRA 5E16A 5FO9B 5LA2A 3K4DA 5CBLA 3FN9A 1F9KA 1OKQA 1PIV1 1GZCA 2CU5A 4XW3A 1G9DA 4NJ4A 1EV13 2D6KA 3LGRA 2EIGA 3MPBA 4XMAA 2E33A 1C8M3 4YVWC 2WFF2 3PJQA 4QGNA 2DUOA 4QX0A 2ZX3A 5DAQA 4QPIA 4J1WA 1FNYA 2VOWA 4P9LA 1UF2C 2VMIA 3RZKA 4CCNA 2E7AA 3EXUA 3MIEA 3QH7A 1VBA2 3TWIA 4AHZA 5C6CA 1R091 2C24A 1G9AA 3I7DA 4Y1VA 2A6YA 2YBKA 1HJFA 1WA4A 5FYIA 4NWWA 1KDMA 1OH4A 2RV9A 2WS91 1WKYA 4GA9A 4B1LA 1RIRA 3NRUA 4M4RA 3VHNA 3ZFGA 4QPWA 5T5JA 1XPWA 4XUOA 3ZFEC 1XNBA 4BQYA 1JHJA 1J84A 4FFIA 4AWDA 4K20A 3TN92 2Y8KA 1GNZA 2BERA 5F9TA 1BK0A 4B7KA 2ZX4A 3IPVB 1YRZA 3NAPC 4CDUA 5AFEA 3B93A 3VBUA 3IIIA 4I3GA 1P8JA 4Q1PA 3VBFC 2A3YA 2R32A 1PZ8A 3ZIWA 5C7GA 3VBHB 3OB8A 3RSJA 4QPYA 3ZX7A 2H6BA 2VM9A 2W68A 2WO3A 2VULA 1W05A 1LOEA 1AHSA 4CEWA 2QZ2A 1H2NA 4KWUA 3PU8A 4ONUA 1BHGA 3OF1A 1C8M1 1O3QA 1A3KA 1DFQA 2PAKA 3MIBA 5FMOS 3N9LA 4CCJA 2ZOEB 2J42A 4G3YC 3IIAA 4YFZA 3A22A 5IK5A 1ZRCA 3NKTA 1LHOA 1Q8QA 2BEOA 1S0GA 1UXXX 1S2BA 4Y22B 4LO5B 4H55A 4H7LA 1C5HA 5FP4A 2XL7A 1VBE3 1H8TA 2O1QA 4PHZA 5J7MA 3MV11 4FSJA 3SQOA 2Y26A 3WF3A 2VBDA 1H6XA 3BU7A 4P9YA 5LK5A 2TNFA 3SC7X 3ZDVA 3VBSB 5A80A 3CEWA 4PLOA 2Q5TA 1ZM1A 2WNUA 3K51A 4GMP1 4XJZA 4LBJA 4ZHNA 3KT1A 4GMP0 2IVJA 4GIQA 4HKOA 3ILRA 4NIIA 3VL8A 1EAH3 5FLIA 1QY4A 2W47A 3NNMA 4IDZA 2WO7A 2VUJA 4UW4A 4E4ZA 4V1PA 2P4EA 3WT3A 2D93A 1UKRA 3A0NA 4CDQA 3KGLA 2R49A 2FDJA 1HRI2 2BW8A 2HWD3 1JYTA 2XLGA 3RNSA 4K21A 2YGMA 4AHYA 2Y0IA 3KS7A 4YW7A 5FMDA 4CDWA 1J59A 4CE8A 2VXRA 3BPZA 4OUEA 4RGKA 4GALA 4YPJA 2FDFA 1F35A 2YXSA 3TBDA 3HVDA 2Y33A 2PHTA 5BNNA 2AENA 3HNMA 4IEWA 1WBFA 1ND2C 3FLPA 1VRBA 4AEMA 3ZFGB 1OVPA 4I3PA 3JQWA 3V0AB 3NMBA 3GBFA 3DL3A 3BOWA 3MBWA 1ENQA 3KLSA 2UWCA 1KDKA 2ZJCA 3Q8FA 3TB0A 5GALA 5A6QA 4FFGA 4M4PA 1BBT2 5FYSA 4OHWA 4C1XA 1AR73 5A1LA 5LB6A 2QQJA 3I2KA 3PL0A 3TEWA 1OVSA 4I30A 3PVOA 2WBKA 4LIVA 1QIQA 3ILNA 4MGQA 3VBUB 3BU0A 4JKLA 1FYUA 4QQOA 1W03A 4AI8A 1V6KA 4RR3A 1IQDC 5FAXA 3INAA 1ND3C 2EXKA 1OOPA 4LBQA 4OQ9A 4DFSA 4Y20A 1AR93 4JQTA 4A6SA 1O4ZA 2DV9A 1EAH1 3POWA 1IHMA 4XABA 1EUUA 3N9QA 1UMZA 4YGDA 2RS13 4CEWB 1XE8A 4IV3C 4FFFA 1MZ6A 2YHJA 3A7QA 1EYBA 3UGFA 3NV1A 1YQ2A 4JRAA 4DEVA 2PA7A 3M8LA 2G1MA 2DCZA 1AXZA 1NQDA 4NPRA 4F83A 2AYHA 3IKWA 1IKPA 2HWD1 3LOBA 2DTWA 3WQ0A 2NMNA 2RS52 3CKHA 4RD7A 4DIQA 1PM7A 2HWB2 2C0ZA 4EN7B 2HWB1 4QGMA 3WF0A 5E89A 1WMDA 4XTMA 3J26N 4RHV1 2RJ2A 3W21A 4FPCA 1TME2 2WNVC 5CADA 1K12A 2WIIB 4NRQA 1YFYA 5J48A 3M70A 5T50A 2Q8DA 4XUTA 2ETEA 4AI0A 2ZCWA 2Y6GA 4CU9A 2N7GA 4GWIA 3UJOA 1LESA 2OS2A 3ZPOA 1RUD1 3IDBB 1Q3EA 1ZRDA 1UW8A 3PIJA 4WV8A 4KGGA 1AR71 5I8SA 3BIEA 3PNAA 1W8HA 5FYTA 1S0JA 2ORXA 3CJIB 3ECQA 2JB8A 4XJ9A 2ZZQA 1XQNA 1D0GA 1CZTA 5GLUA 2YFUA 3N35A 5I91A 2JDYA 2D43A 4GQ7A 4KGQA 1US2A 3H3UA 4CDQB 5IFPA 2XQXA 4CCEA 1AR91 5D8AC 5FOJB 4RFRB 1J58A 3ZXJA 2IXLA 1QF3A 3IT8A 2W1WA 1CIYA 2OPKA 2NQYA 4XZUG 4LBOA 1W8FA 4QXCA 2A7AA 3DXUA 5BNNB 3M7AA 1UOJA 5C8CC 3NV4A 5HCAA 1VE0A 2VR4A 2CGNA 3C7GA 4GKXA 4IGPA 2VOXA 5A7OA 2GMMA 3S7EA 4IERA 3OUIA 1NLRA 2VAUA 1UAIA 1QJU3 5KXBA 3H0OA 1VR3A 4CDXA 2YFZA 5B4XA 5A33B 3OBAA 2HWF2 3SKJE 4UF0A 2ZHKA 3VN4A 1OURA 1UY1A 1LULA 2DVAA 2VZOA 4MGZE 3TEZA 4Q2FA 4XDQA 1VIWB 3WZ1A 4GB33 4RR3B 4B29A 3FLTA 1G9FA 2VVFA 1BJQA 3N9OA 1CAUB 2DU1A 4XE9A 1W04A 1YQ8A 1JYCA 1VJ2A 4XFIA 4WM7A 3LDRA 4QX2A 4C0HA 1QDCA 5D1IA 1QH7A 1I5PA 1AYN3 3TAYA 4K9SA 3RS6A 4OHZA 4DY5A 4NVPA 4Q4Y3 5DAXA 2GH8A 5FXZA 5LA9A 5CG8A 1HQWA 1ZBE3 2WUHA 1HB1A 1I5ZA 1N1TA 3C7FA 2ZHMA 3MLLA 4XF3A 5T55A 4TLGA 3DKWA 2A6VA 1VLNA 4LBKA 1R081 3U78A 2ZHNA 4URAA 4S2DA 2PAEA 3N4MA 2GNBA 2MNGA 1V00A 3WQBA 1XE7A 1FOD3 4FPGA 3ZSKA 2W91A 2YU2A 4DXZA 4A7ZA 3JD71 2XBO3 3OBRA 4GXLA 1QJU1 4GZ9A 1VBD1 3B69A 3ALQA 4PF1A 4BK5A 1JXNA 3UV9A 3AP4A 2R072 5GZEA 2XJSA 5CB7A 4YM3A 3ETPA 3OEAA 3BVCA 2YG0A 2VMDA 1FMD2 3BB6A 3JBG2 4GWNA 4ATEA 2D7FA 4COUA 3B00A 2WABA 5FY7A 3U4XA 2JG9A 3R4UA 1UZWA 4TXWA 4WBBA 3UNPA 5JXJA 3ZSJA 5FKCA 2JENA 3VDDA 2WO2A 3VV1A 1GP4A 3JB4C 4BB3A 4AVVA 2WQ8A 2ZGSA 1KGYA 3AXDA 3B01A 3ZYIB 2HEWF 1JUIA 3K3OA 2A6WA 2QQKA 1UL9A 1VBB1 2A70A 3O7OA 5A6YA 4B1MA 5FZGA 1ZBE1 2HKXA 5CFCB 2E6VA 2BU9A 2OA2A 4FOYA 4NO4A 4Q1RA 2EICA 4ET7A 3D0JA 4DUWA 1ACCA 2NN8A 4Q5OA 1SCRA 3RI9A 5A32A 1OD3A 1WBLA 2DBNA 4RQPA 4Y1XA 4XQWA 1VALA 1NCRA 2AREA 2BNMA 2E32A 4CDXB 3G7DA 2EAAA 2VQ0A 2IZWA 4JZRA 2VMGA 2PTMA 4LPLA 1DQ0A 2FCVA 2YDEA 1KQRA 1UZZA 3K77A 2XBO1 5FUIA 3U75A 4XCBA 2JD4A 5FZ7A 1REEA 1XE0A 1WMXA 1QNYA 2ARCA 3MEPA 2E26A 1POV3 4BHPA 1F4AA 1H2MA 1XYNA 3ZMNA 4QQHA 3URFA 1TMF1 4AQSA 4MGTA 4L0PA 1DP0A 2I2SA 3ZKUA 4RGGA 1Z7S2 3I2IA 2A75A 4P9WA 4XQ4A 1RUF3 4UFHA 1JZ5A 5C9AC 2BRTA 2W3JA 4Y33A 4YM1A 5FYHA 4XCAA 1ZA7A 2HEVF 2VGDA 3FHIB 3K75B 4K8RB 5JI9A 4Z92B 2ZABA 3N9PA 5A7SA 1V9U2 4AFMA 3BYWA 1H1MA 1QWRA 3QCWA 4AQ2A 3NNJA 4W4ZA 3ZXDA 1UWWA 4XDOA 4ES8A 4CA9A 3RZJA 3OJBA 2RHPA 4IEQA 1LOFA 3JXSA 4AEDA 1E5IA 3ZLIA 3IDAA 4JTOA 1B09A 1CZSA 4K40A 2ZGOA 3ZN6B 2JKXA 2WZR3 3WNPA 5FJHA 3WSOA 2XGXA 1GWKA 2F4PA 2RMU3 4H7MA 4HZFA 4RS5A 1QXPA 4QT6A 1UYYA 2EIBA 3P6BA 4PT6A 4MX3A 1BEV2 1WZXA 4MSVA 2ZACA 1BZWA 1SFPA 5G04L 4CCKA 5IVVA 1OQ1A 3VBRB 1MS8A 4QDQA 2Q30A 5BXXA 2HWC3 4EV0A 4XDPA 1RUG2 3TYJA 3BGAA 4NIDA 2GN3A 4LHSA 2YV8A 4UFKA 5KHJA 1FAYA 2EVXA 2VZQA 1XYOA 2XJPA 1RUC1 3UETA 4CP1A 4N43A 3SEPA 2ARAA 3RZGA 1RUNA 3HNBM 5FZCA 1H6YA 4HBNA 3GCWA 3BKZA 3OGJA 4XF0A 1NY71 1OA4A 4BM8A 1POV0 2MPFA 1AR82 2R1BA 4AGVA 4D6QA 1AYM2 4CSWA 3ZMOA 3RQ0A 2FD8A 3GCXA 4ZS3A 3E5UA 1RUF1 5I0DA 2VZ1A 3ENRA 2ZPXA 1H9WA 3MFCA 5IK4A 3H1WA 1V70A 1ZREA 5GZFA 2YC4A 3A23A 2IXIA 3PUHA 3A4UA 1ASJ3 1PMHX 5JPNB 3O1VA 2P3IA 2DTYA 2X5IB 1WLCA 2VZ3A 4JGYA 5CIRA 4KBBA 4L8QA 2F17A 3H7JA 2BYVE 2HH9A 2GMPA 2E31A 3AYCA 1NCRB 4XURA 4COWA 1O3RA 2YB7A 3VBHC 3CU7A 4MG2A 1ALYA 2RMU1 3B7MA 4PIYA 4B4RA 1CJDA 2AEYA 1WGPA 4XC9A 1ZBA3 5DG2A 3SLIA 5H9QA 2P1BA 5IVBA 1AR62 1BMV2 5HCHA 5DUXA 3BIWE 3T4HB 5DUVA 1GANA 1H9PA 1H4GA 3AVRA 4QM8A 2D5HA 1C57A 4D94A 4HPKA 2HBUA 4HOOA 4XFGA 4XAEA 3BPSA 3ZYHA 4A7KA 2OZ6A 5EQUA 2Z2SB 2GSYA 5CKMA 5FYMA 1XSQA 1HRV2 2SLIA 1QH6A 2NZ9A 3PIGA 4CPBD 1HRV1 2JECA 1MS1A 3VDDB 3UKVA 2P6HA 1NXMA 5CKNA 5I0SA 2RS32 3GJBA 1S2EA 1ENRA 1XC6A 3THDA 1U5YA 4O9EA 2ZAAA 2I07B 1VAKA 5A3OA 1WLWA 1K5MA 3MLJA 1SDWA 1PMIA 2IXCA 4XJWA 2FMYA 3ZN4A 4AEDB 4K8FA 3C7HA 4LBMA 1C1LA 3VHOA 1X9TA 1ASJ1 1DGRN 4INDA 1DGWX 2XOMA 1XNDA 2LW8A 5C5UA 2JE8A 2XB6C 3CZUA 3OTFA 4RS5B 1LHUA 1D2SA 1E5RA 3IN9A 3L2HA 1MQTB 1RUH1 3DN7A 4GD4A 1FXZA 1W8UA 3AMHA 1KRIA 3WNXA 5FDBA 4NIGA 2FZ2A 2WT2A 2K9ZA 4D3WA 4AGRA 1W2UA 3HPNA 4QPIC 3HQRA 3CJXA 4D7YA 3QH6A 4BU2A 1DZQA 3JCIA 1CR7A 5IUQA 1O3SA 1VAMA 3U07A 1FI2A 3ZIXA 2WO1A 3AP5A 5C8WA 4DXTA 4OZXA 3WQ1A 2CWMA 4AE2A 1KXGA 4YFWA 3D82A 1DDLA 4C1WA 5KHHA 5FZOB 2YY1A 4BE3A 1Y9GA 3HR9A 4UBGA 4Q4V2 3ZFGC 4E2QA 4EJRA 1O5LA 1OF3A 4Y5Z0 3NJYA 3MLKA 4Y26A 4NWVA 3LE0A 1RUI2 2VW0A 1ZZ7A 3AZWA 3AFKA 1RUE3 2PHRA 3T0BA 2VZVA 1O6UA 4IEPA 3VKMA 4CDUC 5BV6A 3VBUC 1NQJA 5IK8A 4LK7A 2FDHA 2LALA 4BA6A 2RM22 1PGSA 2ZAHA 4HVQA 2J1AA 2PAMA 3AB0A 1B35A 3HQXA 1VMJA 1JS9A 4HKLA 4XBNA 4XMIA 1RTVA 1VRH2 3LDKA 2AC1A 2VTXA 3ZYRA 3GZEA 5FLJA 4Q4W3 4FPEA 1NKGA 2IFWA 3OPTA 5T3NA 1AJKA 1YFWA 2G9FA 2RDQA 4JCKA 4FTEA 1O4TA 4CEWC 1W6OA 2XVLA 3N7KA 3OBZA 4R4XA 5CU1A 3R6SA 4QX1A 1WMFA 4YGBA 2VXJA 3ZPYA 4HPKB 2ADEA 1GZ9A 2HYXA 3VKOA 5LBCA 1UZYA 4BLIA 4GWJA 3HBZA 3MW2A 1LU1A 2A73B 3VZJA 2ENRA 4QX3A 5JXIA 2D6OX 4WVZA 1NZCA 1F15A 1WCDJ 2MEV2 3ZOIA 3KCXA 3POIA 1HXS2 1GOHA 1H8TC 3MW3A 4DEQA 4WM8C 1J83A 2P6CA 4UFLA 4N7IA 3RJ2X 4FT8A 5F1RA 2EA7A 1U0AA 1XU2A 2SBAA 3VZKA 3T08A 1IG0A 3DPRC 4DQAA 4AAPA 3WG3A 2OW4A 2WNUC 4KH9A 5K0UA 5EP9A 1RUE1 2ZMKA 4AQ6A 4UXAA 4OHYA 3W5MA 1NCQB 4LIUA 3GGLA 5FO7B 4IUGA 2ZMLA 5AVPA 4E8CA 1BVVA 3DYMA 3H3ZA 1RUJ1 1QJY2 2BFUS 1DIWA 4HXCA 5FLHA 3NL1A 1O8PA 3FHAA 4Q4W1 4CDQC 2R062 1R1A3 2DVBA 1QHDA 2WYSA 3GHNA 4LUMA 5C3SA 2JIJA 4A6OA 3RPQA 4Q0VA 5FYYA 1VBC3 2JG8C 2R16A 4JV4A 4M00A 3S30A 5LWBA 1OMIA 3H50A 1RHI3 4B7EA 4CDWC 1RMU3 4XHBA 5FPUA 3KV9A 1U5XA 4L97A 4RFT0 2J1RA 1OLMA 1QXJA 5I0TA 2Y0OA 5BNNC 2P5BA 4BCUA 2ILMA 1AX1A 3J7LA 2R1DA 4DUXA 3B3QE 2ADDA 3OUJA 3DCQA 3RDIA 3S5AA 2VW1A 2ZHLA 4I09A 3RFRA 5KC5A 3FLRA 1LEDA 1QU0A 2HWE2 3HWJA 2O14A 2VUDA 5C4WA 1UYXA 2XL9A 2XLFA 3HNYM 4JDNA 1OHFA 2G19A 2G9GA 4ITCA 3ZYBA 4BIFA 1MVEA 4BQXA 2K2SA 1PVXA 2JB4A 5E8AA 1ZX5A 5FMOL 3VUOA 4IE4A 3EMRA 1MEC2 1ST8A 2GC0A 2PLV2 4Q4X2 1HV0A 3VZLA 1JZ6A 2W92A 3KD4A 4MLOA 3KWVA 1DQ1A 4M3CA 4HK8A 2RR13 1SLLA 4RR3C 3VD5A 4MVTA 3WDUA 1OOPC 2A3XA 5CKQA 2JICA 3WP5A 2YPDA 1AXKA 1DQ5A 4YARA 2CHHA 3RMYA 1W6OB 1E5HA 5FZDA 5BUVA 1S4CA 1VBA3 3OCPA 4LHNA 4MV2A 4YYOA 3VBSA 2V5YA 1H1AA 2GNMA 1A34A 2DDUA 1SFYA 2X05A 4LO7A 5F32A 5F2WA 3O0WA 3WHTA 4QXKA 2ID4A 5FZ9A 1YJLA 1PIV2 4OMDA 1RHI1 4EE2A 1RMU1 3T2TA 5JIAA 1L7LA 1QJX1 2R7EB 5T5PA 2D3SA 2NM1A 3KCCA 1JZ7A 5BNPA 3J8F1 3D8CA 4LUKA 2D97A 3TN93 4FAGA 2RJKA 1R64A 4OHXA 2WA4A 1VB2A 2CGPA 1CD3G 1UPSA 4CCOA 1PGL1 1AX2A 4UAPA 1BYHA 3ZSEA 1R092 2GNTA 2B46X 5JMCA 5JXHA 4KMQA 5LASA 3VZOA 1E57A 4EZHA 5K0UB 5F2SA 4FXKB 5FPXA 1RITA 5DUWA 2D6LX 2LTNA 2WS92 2JE7A 3WP6A 1OA3A 1YUDA 1COV1 1UOBA 4Z2AA 1HW5A 2Q8OA 2RR11 3LFIA 4CXXA 5EJ3A 4KL1A 3M3IA 5JSOA 3V0AA 3DV8A 3J9SA 2XPJA 1JBCA 2YPJA 2AZ5A 4Q8KA 1CAVB 3M1HA 3MO4A 3SITA 3OEBA 4YM0A 3AP6A 2Y6JA 1V6MA 1J3RA 4P00B 1YQCA 1O4YA 3NW4A 2OKXA 1RUOA 4LQRA 1AL0G 3WG2A 3BTZA 4XFFA 5AFBA 3R05A 4YRDA 2C26A 2EAKA 3NNFA 1DF0A 3ZN5A 5J09A 5FBJA 5CFDB 4COZA 3GDBA 2VQTA 4W8JA 1EV11 1AX0A 3I3DA 4IEUA 3LEKA 4RL7A 2WZ8A 4Z2WA 4Z8BA 1C8M2 5FYBA 3WP4A 4HFSA 2QTWB 3O5SA 3FFQA 3OY8A 3H9AA 5C4WB 4AVBA 4CDXC 5CYYA 1U5ZA 4TWTA 1XBFA 2UY9A 5FZ1A 4LLFA 4QKFA 4QQPA 2FCUA 3K46A 4PDWC 1URXA 4YVSA 1IS5A 4M3CB 3VDCA 4M0HA 3I2GA 4A2UA 2PHDA 5ABJA 3R0RA 1HB4A 1TNFA 2NMOA 2R0FA 4LMFA 1W9WA 2DU0A 3W20A 1T6GC 1TG7A 5AC93 3BTAA 1K45A 4QHBA 4WM7C 4QKNA 3ST7A 1YIPA 3SEEA 3A21A 1IG3A 3VD9A 1QOSA 1DHKB 4HLTA 3SXWA 2J7MA 4AEKA 5KBFA 1BVP1 4YW6A 5L7OB 4OI0A 5FBZA 5GZGA 3CJIA 2WYFA 4WVVA 2H0VA 3O1OA 1K42A 1X9PA 3G6JB 4W6WA 1UX6A 2ET1A 4NOTA 4P9JA 1ENSA 3PVEA 2Q1ZB 3POJA 5J96B 1LHWA 5J1XA 4MXVA 5K4LA 4D69A 2LUWA 5BNPB 3L2YA 4IE6A 5EYYA 5SV5A 3POBA 5KXDA 2JIGA 2I74A 2XVGA 1SG3A 4ZONA 3N9NA 1VP6A 1T2XA 2XKPA 5GZCA 1PO23 2WL1A 3CO2A 1ZZ9A 4RA0A 4HANA 4PBPA 3PUIA 4CPBA 2OX0A 2ZGQA 4DXSA 5FK7A 4XFAA 4XETA 3VB9A 5IFTA 1A6CA 1XRUA 2ZKLA 4H3WA 2WC2A 5DMYA 3PTYA 1LEMA 2JX9A 3T2QA 1OKOA 2JG9C 1S0FA 1VBE1 3MZHA 1QNWA 3UGHA 1UY4A 1ZZCA 5AC91 5IJRA 5A33A 4CZSA 5B2GB 4GJZA 1G9CA 2V72A 5K8SA 5L19A 3THCA 2WZPP 1PK6A 2RS53 3ZXAC 2QUOA 4DXRA 5GJ6A 1I1EA 4NRMA 1CAXB 5J3UA 4TTGA 2CNAA 1Q43A 4ARXA 4JQRA 1KEXA 3PMSA 3B9IA 4AVCA 1EAH2 1CAUA 3AX4A 2JDPA 3LEGA 2UWBA 4IETA 4KWLA 4P9IA 3RYPA 1DCSA 4QQLA 5FOBB 4RQPC 3TNQA 2QVSB 2DF7A 1NCRC 2W94A 3GBWA 3OY8B 5JIUA 4XFHA 3M2MA 4LE3A 1AL23 3M3OA 2RG4A 2HWD2 2J1EA 2XDVA 1Q56A 1S0DA 4FI9A 4XTPA 1IQAA 3PVBB 5BY5A 1PVC3 4YZ4A 1HJGA 1PO21 4YVSB 5J36A 3O1UA 4RHV2 1G8WA 4FXGB 4QB2A 1POQA 5ABJB 3ASIA 3PVNA 4LHLA 2JDUA 2YMZA 2ZZJA 4XFCA 5J37A 3VGIA 3P3PA 3FUQA 4H2AA 2VMHA 4CCMA 4UFMA 3LEMA 4AXOA 3B5LB 1IS6A 4B3NA 5B4NA 3VDDC 4LO4B 1RUD2 1DGWA 1ZVFA 1APNA 4M0NA 1LOCA 3WLUA 2HJIA 1LOBA 3VD7A 5GLTA 1JOBA 4ZZ5A 2ZKNA 4Q0UA 3WNLA 1AR72 4CP2A 1LENA 1X8MA 2VNOA 5DAWA 3UGGA 3I3EA 4YZ1A 2R043 3E97A 5JZGB 1SLIA 1YHFA 1LOFC 1NT0A 1TQ5A 4ASMB 1N1SA 3AZXA 4FO9A 3H42B 1U5IA 4YVWA 5JR2A 4TYSA 1KFUL 4KQ7A 1AR92 3W58A 3LA3A 1SLCA 4RS5C 1GWLA 2EXIA 5GM0A 2RS11 1UU6A 4XUNA 3AM2A 4CXYA 3WUDA 4YGEA 4CEYA 3RZHA 4D6SA 1IPJA 3HEIA 1JODA 3KF5A 4KI5M 1AL21 3V64A 2ZX0A 5FXWA 5CFCA 3SH4A 1HLCA 4XF9A 4XPVA 2CDOA 5EZWA 3FE5A 1OFNA 1PVC1 3BTYA 4M3CF 3I8TA 4N43C 2XUMA 4DNYA 4MZUA 1OH3A 2OYZA 2K46A 1QGLA 2XR4A 1WLDA 4LJHA 5I93A 1PX4A 4BQ4A 1GZTA 4WZFA 3E6BA 1SLTA 3H1MA 1MR5A 4IV1B 1UD1A 2E7TA 4UW5A 2Y6LA 1W6NB 4BOWA 3EO6A
chains in the Genus database with same CATH topology
1DU3D 3WOGA 1RVF3 5IK7A 1PK6B 3RYKA 3VBFA 1EP0A 3MIDA 2YYOA 2WNEA 2CAUA 2XH6A 2R041 4N7UA 3WW3A 4E4DX 4JGYC 1FATA 1IS3A 1NG0A 4ISQA 1S55A 4HL0A 3WW1A 4NHMA 4JRLA 4Y4YA 2BWCA 1MZEA 1JH5A 1J3QA 4JGZA 4K1ZA 2FBEA 2QDRA 4S2FA 2ET7A 1R082 1GQHA 1NA1A 3OGGA 2FZ1A 2GDFA 3M4FA 3ZN6A 3ZDSA 4FPHA 3RMXA 1IKQA 1GNHA 4FP2A 5AVAA 2YZ4A 4IQPA 3JD72 1QQP3 1QJU2 1H2LA 1VBD2 3VBRA 3VBOB 2GU9A 1H8VA 1D4M3 1SBEA 3S6PA 3VHPA 4AFBA 1WD4A 3ZSLA 5T52A 2V73A 2JXAA 1HDKA 1K5MC 1RVF1 4C0BA 1GSLA 3U11A 4GB31 2CGOA 3AJZA 4YVWB 4X8NA 4F8AA 1MS5A 2VNRA 4P14A 3ZFFA 4QX5A 3DGTA 3EBRA 1OLRA 2QZ3A 2YGLA 4DS0A 1UKGA 1SBFA 4CEYB 1AYN1 4COVA 4Q4Y2 1VBB2 3H7YA 4SLIA 1FX5A 4Q4Y1 4MGKE 2JKBA 4MYEA 1ZBE2 2PN5A 4YW3A 1KS5A 3ME2A 4XBLA 4NHKA 2ES3A 5ACA3 1LHNA 3MFAA 2X5IA 4B4PA 2P17A 3D0SA 4F7ZA 1ZYBA 1L3JA 4YW2A 3ZFEB 4PLNA 4OI2A 4L11A 1FOD1 2A6XA 3NAPB 5F5QA 4CYDA 2XBO2 1QQP1 2P2KA 1V6OA 4S2GA 3VBFB 2G4IA 1D4M1 5EFUA 4YNIA 1MS9A 4A7YA 2TBVA 1TMF2 1PGW1 4FPFA 4PCRA 1QOTA 4YZ3A 3UK9A 4IESA 1ZRFA 1BEV3 4IV3A 2PYTA 2QFEA 1B35C 1OPMA 3AP7A 4RGAA 4JGZB 3PLQA 1LR5A 1J1TA 1UPIA 1CGPA 4TSVA 2WLPA 1NA1B 2GC1A 3LAGA 3O12A 3WDTA 4AFCA 4PQ9A 2RE9A 5ACA1 5EV7A 1AR83 3M3CA 3ZVXA 1MQTA 1PO13 4LO8A 1X82A 2JJ6A 3VKFC 1DGRA 2DURA 4FQ4A 4M01A 1MS0A 4FTSA 2C5DA 4HK9A 4LBLA 3U10A 3AMMA 1QOOA 1RUC2 3V65A 1LGBA 3ELNA 3RI8A 1POV1 1TE1B 1NY72 2WINB 3OYWB 2NLRA 1YFUA 5K0UC 3AP9A 3D6EA 1NLSA 3VKNA 5KXEA 3ZFFB 1RUF2 3JZVA 4DPNA 4C1WA 4OHZA 4KG8A 2W52A 1LGCA 5JCTA 2XLAA 2B5HA 3MW4A 3AJYA 2V09A 2VQAA 2PELA 3FBMA 3KZ4C 4XJAA 4R4ZA 1HQLA 2GH2A 1V6JA 2DVGA 4ZXKA 2IWGB 1FNZA 4BPZA 3AKTA 1WUVA 3M3QA 4AI3A 2AR6A 4FPJA 5A3MA 5JOZA 3AK0A 4MH0E 3AKSA 2WZR1 2RMU2 4N9IA 5KHKA 1PNGA 4GH4A 3RZZA 4LULA 1JW6A 3ZO0B 5I8TA 4BMEA 1CJPA 2WKKA 1PO11 2H0BA 4MUVA 4Y1UA 2HWC2 3IWZA 2HWC1 3SISA 3S0MA 1CIWA 2WJSA 5C4WC 5JSRA 5F6KA 4E9KA 3R4SA 4AYUA 4E27A 4YW1A 2KM2A 2FHRA 3OBTA 4K7JA 1N47A 4IV3B 2ARXA 2PQQA 3UKNA 4OVEA 4UW3A 3VHRA 3GZTB 3NO8A 4ZKTB 1I9RA 1LODA 4I0BA 2BNOA 1LTEA 1UU4A 3SNMA 4E2GA 4MGIE 1CONA 4BLJA 5KHIA 1HKDA 1OD5A 2QDNA 1BK1A 3GBGA 4DZGA 4P9XA 1ULGA 4HSLA 1FPN3 1ASJ2 2WNVB 5GLVA 2DCYA 3VBSC 2QNKA 1G6NA 2Z42A 5DUUA 4AVSA 3GALA 1IOAA 1BXHA 5HI0A 1RUH2 1NCQA 4ZU4A 1DG6A 3OD0A 4META 4AQTA 3NV2A 5BNPC 2BFUL 1ZBA1 3WHUA 2A5ZA 2BNNA 1ZZ8A 1CPNA 3SCFA 5JAXA 4MXWA 4X8PA 3WINE 1JOJA 2QKDA 4Q0SA 5D8AB 3NWKA 2QCSB 3WG1A 1Q8OA 2VUAA 2VW2A 3ZXEA 1F2NA 2IXKA 4DRVA 4R9DA 3USUB 3O0VA 3SH3A 3T1MA 5JPMB 2EALA 4WVWA 5HXVA 3FX3A 5C8CB 3AKPA 2WFPA 2WT1A 2VU9A 2ZGTA 3NVCA 2HYKA 1GZWA 2X29A 3VL9A 3QBQA 3C2UA 3U0ZA 1FPN1 1ZRRA 4GH4B 5DDJ3 1DYPA 5HCBA 5DZFA 3ROUA 1EPZA 1XNKA 3I2DA 3TNPB 3AYEA 4J1XA 3AZVA 4OUSA 5EXOA 1W6MA 4GKYA 3D5OA 2D98A 5IT6A 1TNRA 3KB5A 1VB4A 5FFOC 4YVSC 4YG6A 5KWRA 5ABJC 5CAZA 2WQ4A 1QDOA 1MS3A 1O7FA 3ZSMA 3WCSA 5CNAA 4NHLA 3HT2A 4UBHA 5JI7A 3I54A 3ES4A 3N36A 4B8EA 2IFRA 4FPYA 3WD5A 3W9AA 4JAAA 1AF9A 2VH9A 4XZPA 1RUE2 3BOPA 4P5HA 2NYYA 3CJIC 3JQXA 5CVRA 2ARBA 5FCCA 5JWPA 3FC0A 1RUJ2 1OSGA 1V6NA 4BZ4A 1RGSA 1PHMA 4EWDA 2WSUA 3OPZA 4Q4W2 5JLVA 5DDJ1 2DWRA 1Q8PA 1CAVA 5J98B 4QPGA 2AGSA 3CNAA 4K3UA 4QD2A 5H9PA 4ZU7A 2Q4SA 1MEC3 2FQPA 2YUEA 4MXWB 1JYIA 2TEPA 5T5OA 4RSUA 2OUJA 3WVJA 1MZFA 5H9SA 1ZZBA 5H9RA 2E53A 1DGLA 5CFDA 3N3HA 3GHMA 1GBGA 4URTA 1LECA 3WDWA 1AVBA 1M06G 3AZZA 2ZGPA 3H1YA 1AUYA 3AMNA 3CLPA 4GWMA 4PJYA 1GZWB 2WWSA 4FPLA 4C91A 1YIFA 1PIV3 1XXNA 3ZYJB 1KD7A 1LOGA 1UCXA 2W0XA 4YSFA 5SV8A 2E51A 2WFF3 1Z0HA 4L99A 1GKBA 3O0XA 3ZXGA 4TZDA 4IEOA 3ZYPA 4BYYA 1A78A 2O8OA 5L73A 1LHVA 5HBAA 1R1A2 1W6PA 4PIXA 4U36A 1R1A1 2CV6A 1EY2A 1ZZ6A 4P9GA 2BWAA 1W6MB 5L7OA 2CYFA 2XWBB 1VBC1 4QMAA 5FPZA 1RHI2 4Q27A 4Z82A 1PNFA 1RMU2 5C9AB 3IDEA 3WCRA 1OQDA 4FBFA 2IC1A 1QJX2 2YROA 5HCFA 3J8F2 3VKLA 4R9CA 1WLTA 3ZXFA 2ZGMA 4WVMA 4EN8B 5JOWA 1PGL2 1M4WA 2EXJA 5FO8B 3V56A 4ZU5A 3QLQA 3ZXKA 1EPWA 3FZ3A 3M3EA 4OHVA 4DINB 2C1FA 4W6XA 1COV2 1CN1A 4XFBA 3UJQA 2XKOA 3LSEA 4X6RB 2RR12 2P3JA 2Q0AA 2XG3A 2A3WA 2WFF1 4KU7A 3LA2A 1O3TA 4QPGB 4DY3A 1XU1A 1YFXA 3S7IA 1Y9QA 4CEYC 1VBA1 4R52A 1CQ9A 1RL3A 1S0EA 2Z5WA 1CAXA 3WV6A 4N53A 2GAUA 5CFCC 3POSA 3MF6A 1Q8SA 2K0GA 2ZBJA 2OUHA 1S1AA 1EV12 5GLZA 3FJSA 2DFCA 2VG9A 3RWNA 2D6PA 1UU5A 3FMGA 3TN91 2VVEA 4LE4A 1QKQA 4GMP3 3BALA 1H1IA 4EWEA 4ATFA 3NSTA 3V0BA 3N7MA 4OI1A 2X8KA 1A8MA 1CESA 1AZDA 1LB2A 4YW5A 1HV1A 1XNCA 3N7JA 5JDBA 3VLBB 1RJ7A 1HRI3 1C4RA 2BQPA 2LM3A 2Q1MA 3MICA 4M3CE 4JVAA 1N3OA 1W6PB 2GZWA 2DFBA 3RG0A 1G7YA 1AJOA 4JGZC 2Y38A 3AFGA 3HMYA 4JDMA 4G9SB 1UIKA 5JZGA 4HKWA 2R0HA 1NA1C 3IBMA 4CRQA 1JHNA 2DVFA 2B39A 4LLOA 1PZ7A 4WM8A 2BGCA 3IMNA 4OI4A 4WVMB 3I59A 1BBT3 4AG4A 4EN9B 1H0BA 3DPRA 4KNCA 4GULA 4FQZA 3VBRC 2XJUA 5JSPA 1KFXL 4HVOA 5BNQA 3QOPA 5E1RA 3AMPA 1WCKA 4PF5A 1YCIA 4PIZA 5EWSA 5BNOA 1AXYA 3J4UH 1WW4A 2B8MA 2UWAA 3WUCA 2CAVA 3ACLA 5BYNA 1VBE2 3HD8B 3PJYA 1H30A 4IV1A 4OFGA 5E88A 4QPIB 1RJ8A 5AC92 3ZFFC 1W6NA 1HRI1 2O8QA 1CVNA 2XJVA 2JG8A 4HETA 3UKTA 1S0BA 2HWB3 4DOUA 4RHV3 4N53B 3EQEA 1TME3 4WZCA 2DUPA 2X5IC 3MDPA 4YM2A 1H4HA 2XJQA 3L9JT 1YWKA 1LCLA 4FCAA 3OD4A 1YJKA 1RUD3 4ORFA 5LEKA 1PZ9A 4DB5A 5LEJA 1U12A 3NV3A 4SBVA 4LNVA 1BBT1 4XJ8A 2BBVA 3V0BB 4EWAA 1FT9A 1DQ4A 4CDUB 2NPIA 4X6QB 3JUUA 4JC1A 1PO22 3KCYA 4AVTA 2WLQA 1KS4A 2NP0A 1SCSA 2D3PA 4AHWA 1S0CA 1SQ4A 2CY6A 4Q0PA 2H6CA 5EYXA 4IEYA 2DCJA 2B42B 3LOIA 5JOYA 1OLQA 3MIGA 1V6IA 2PHXA 2PFWA 2UURA 2DCKA 2RJLA 3AZYA 3KMHA 1X36A 3VBOA 1GQGA 4OULA 4COYA 2ATFA 1JN2P 2X53S 3MI8A 2QQPA 5DZGA 1MACA 2RS51 3MGUA 1G9BA 1F5JA 2ZGKA 4AEDC 2WT0A 2D5FA 2GALA 4IEXA 4FVVA 3GZUC 1H8TB 1TME1 1QXRA 4WM8B 3SCGA 1NXD1 3SMHA 1NYWA 3I59B 3KT7A 1FV3A 2HWF3 2RS12 1MQTC 3WDYA 4ASLA 3DPRB 2PHWA 4Q8LA 4L2NA 1W0OA 1AL22 2O0OA 1C1FA 2WNUB 2ZGRA 1R1ZA 3LCPA 1DYKA 4XXAA 1PVC2 2YC0A 1OPOA 5BNOB 2R30A 2UYBA 1WW7A 4E4SA 1UIJA 2DVDA 4I01A 3EJKA 3ZFEA 5C33A 3AYAA 2VVDA 3LKJA 1BCXA 1C28A 1H2KA 3B94A 3NAPA 2JG8B 4KWJA 4CDWB 2F6BA 2VPVA 3CL1A 1R083 3VZMA 3X29B 4HT1T 4YGCA 2R042 4K1YA 4UW6A 5DXDA 4XOGA 3DUIA 3JD73 1CPMA 3HIFA 1VBD3 1O5UA 1IS4A 5LRRA 4GH4C 1SACA 1ULDA 2HWF1 2R073 3Q9OA 1MVQA 4PDWA 4JTNA 2GMEA 1FMD3 1YO8A 3JBG3 3LB9A 3NJZA 1SLBA 4MGYE 2XJRA 3K48A 4FPKA 1OOPB 4LBQB 4YZ2A 4Y20B 3TOJA 3QD6A 3B02A 2WA3A 2UY8A 1LKNA 3GNEA 4QM9A 3LA7A 3GF6A 1J1LA 2P3KA 1VBB3 4Q29A 3ZXLA 1SBDA 1SLAA 5GKAC 1F31A 1RVF2 3WXPA 1I3HA 1YLLA 4ES9A 3KGZA 5FREA 4XIOA 3UL2A 5I0RA 3DF0A 4GB32 2R6QA 4EROA 2C9AA 3OYWA 2WQZC 3WG4A 1N1VA 3PMEA 4HMZA 2BVVA 1NCQC 5T5LA 3A0KA 4AFDA 3WQ7A 5A3LA 1AYN2 1IZ3A 3AYDA 3R4DB 3HT1A 4XF1A 2GC3A 2R071 1TMF3 1LU2A 2W08A 3FBYA 1Q5OA 1ND2A 3ILFA 4BWOA 1FMD1 3JBG1 1Z7S3 2UYAA 3P3NA 2CWSA 1YNAA 5KXCA 1MS4A 1TEIA 4YG0A 2GNDA 1FOD2 1V9U3 1FV2A 1IGOA 4AFAA 1QQP2 3HN1A 3GYDA 1D4M2 4DRRA 1RINA 3JU9A 2P34A 2CTVA 3AKRA 1X33A 1ZNPA 5TSWA 1X8EA 1ND3A 3W59A 1PGW2 1V6LA 5FTTC 3WW4A 1NE6A 2QJVA 3WX5A 2ZTNA 4FOWA 2ZS6B 3IDCB 1WW5A 5I0UA 1CX4A 4FOQA 4YZ5A 1RUG3 1W39A 2GN7A 4R8HA 1KJLA 4AK3A 3ETQA 1RUC3 4PDWB 4G4FA 3RYRA 5JOXA 2D6MA 2WNVA 2EXHA 1N1YA 4DMIA 5ACA2 3FFZA 4D7SA 2VY0A 3THPA 3C3VA 1AYM3 1JUHA 1Z7S1 4WM7B 4W6YA 5K7PA 4KU8A 2B7YA 5CA6A 1WW6A 1NOVA 3LSDA 1D4VB 1V9U1 4LHKA 2D44A 3WR0A 1GV9A 1RUNA 3USSA 2XJTA 1C3HA 2IXJA 1SMVA 3ATGA 5JVVA 1OA2A 1J3PA 4E2SA 4AI2A 5JR7B 4F3JA 1CAWA 4OLLA 2BTVC 3E5QA 2VECA 5L36A 2BUKA 2Z69A 2ZX1A 4XIKA 4AGGA 4U2AA 5LRSA 5D8AA 1GYKA 1DQ6A 2D6NA 2GC2A 3ES1A 4NR1A 1BEV1 1AR63 4L9BA 1DBNA 3USUA 5FQ0A 4LEJA 2B45X 1RUG1 2QE3A 1HQNA 1HX6A 3H8UA 5C8CA 4QPGC 4AI1A 4I2OA 1ND2B 1C8NA 3SHRA 1HRV3 4R9BA 1LRHA 2VOKA 2JG9B 3MPPG 1YI9A 4YG3A 2WZR2 4YLZA 3BODA 1AR81 2RS33 1AYM1 5BPXA 2D3RA 2BVBA 1PO12 2JE9A 4LTAA 3T1LA 5CFDC 1RB8G 1YYNA 4QQ2A 1IPKA 4Q0QA 3GZAA 3FUOA 4Q26A 2IXHA 3MIHA 1WD3A 2A6ZA 4IXLA 1ND3B 3AXEA 1GLHA 4AF9A 5A32B 1RUH3 4RQPB 3B9CA 3E5XA 4IL7A 3I4IA 4W65A 1JTZX 1VAVA 2JEMA 4BH9A 2UU8A 4XBQA 2KA3A 1AR61 1D2QA 1BQPA 1BMV1 1WCSA 2ZA9A 4LBNA 2EF6A 4FTBA 3BCWA 4YW4A 1SFNA 2OIIA 5T54A 2ZX2A 4EN6B 5L7OC 1REDA 2E9QA 4AW7A 3WDXA 4Q4V3 5GZDA 2ZGLA 2RS31 4K6BA 4PBOA 1ZBA2 5LK7B 1YI7A 4FPOB 4XEZA 3WP3A 4A3XA 1RUI3 3WDVA 1CAWB 2W39A 2XWJB 2RM23 4LO6B 1ENXA 3NKGA 4S2HA 3D4KA 1DLLA 1VRH3 1LOAA 2CL2A 2PHUA 4LBQD 4XYXA 4ISRA 4IEVA 1ZA4A 1SEFA 4CP0A 2PHFA 4OUMA 1N3PA 2D40A 4HVRA 5FQ0B 3AKQA 5FRAA 2VNGA 1ULEA 1F5FA 1HIXA 2MHFA 2DCTA 4FP3A 4LA3A 4XILA 1X7NA 2FMDA 1RC6A 4QU2A 4Y1ZA 4N43B 3WW2A 1F8VA 1D0HA 1DZRA 3MF9A 4O9GA 1BKZA 4H14A 1FPN2 1W6QA 2MEV3 4N53C 5I8YA 1Y43B 5CG9A 1HXS3 4D7TA 2KXLA 2I45A 4FOVA 1O91A 5GLWA 4Q4V1 4R9AA 3FWEA 4AVAA 2JDZA 2OZJA 2XVKA 4NN0A 1ULCA 4Z07A 3SH5A 4BQ1A 1W0PA 1A8DA 1Q8VA 4I02A 2TUNA 1I6XA 1RUI1 4L92A 3ZYGA 1QJZA 4JGYB 2ZGNA 1DQ2A 4FAHA 4HN0A 4KWKA 4Y24A 4BMBA 2AUYA 2HEYF 5C9AA 2RM21 1RUJ3 3RRDA 1QJY3 4KG0A 1LGNA 3SCHA 1VRH1 1Y7BA 3E6DA 1KITA 4PLMA 2OVUA 4XXPA 2R063 5K9YA 4JDOA 1UN1A 3QACA 1ULFA 3KM5A 3LWCA 1OI6A 1MZ5A 1NE4A 1REFA 3MYXA 1Z78A 3N7LA 3MIFA 3JB8A 4XQDA 4CTEA 1S0IA 5JZGC 4EN0A 2MEV1 4AEJA 4I0WB 5DDJ2 1HXS1 3VZNA 2HWE3 2PHLA 2ERFA 1S2KA 4LR4A 4J6GA 1K5MB 2PLV3 4Q4X3 3LZZA 4BIOA 3AMQA 1OFSA 1X50A 1GR3A 2WSVA 3O14A 3IM0A 3POYA 5BNOC 4IEZA 4XF4A 4C90A 1QMJA 4B4QA 1QJY1 1DZTA 1KJRA 3EHKA 3E6CC 4IV1C 5KC6A 3KT4A 2XHKA 2R061 1YXWA 1ONAA 3APBA 3IPVA 4LT5A 2B9UA 5F6LB 2AH2A 4TLFA 1W6QB 1PK6C 2DYCA 1WMEA 4N90A 3RJRA 3WY6A 1QJX3 3VBHA 5DZEA 4I0AA 3PHMA 4Y1YA 3J8F3 2E63A 3CF6E 3KQRA 2VOVA 2ZGUA 3KSCA 2A71A 1Y3TA 4QGLA 2HWE1 4LA2A 2BPA2 1R093 2Z79A 3HAGA 3THTA 4HSJA 4XHXA 1C5IA 1LJ7A 1VBC2 1MEC1 2PLV1 4Q4X1 2WS93 4Y22A 1COV3 2P37A 1B35B 1OQEA 1GFF2 2ZMNA 4HN1A 5DG1A 2DUQA 1XYPA 4N9HA 4XJUA 2E7QA 4AHXA 3TRSB 3VBOC 1N3QA 1GICA 5KHGA 1G86A 5E16A 5FO9B 5CBLA 1F9KA 1OKQA 1PIV1 1GZCA 4XW3A 1G9DA 4XMAA 1EV13 2D6KA 3LGRA 2EIGA 3MPBA 1C8M3 4YVWC 2WFF2 3PJQA 4QGNA 2DUOA 2ZX3A 4QPIA 4J1WA 1FNYA 2VOWA 4P9LA 1UF2C 2VMIA 2E7AA 3EXUA 3MIEA 3QH7A 1VBA2 3TWIA 4AHZA 5C6CA 1R091 1G9AA 3I7DA 4Y1VA 2A6YA 1WA4A 4NWWA 1KDMA 2WS91 4GA9A 1RIRA 3ZFGA 3VHNA 5T5JA 3ZFEC 1XNBA 4AWDA 4K20A 3TN92 1GNZA 5F9TA 4B7KA 2ZX4A 3IPVB 1YRZA 3NAPC 4CDUA 5AFEA 3B93A 3VBUA 4I3GA 3VBFC 4Q1PA 2A3YA 2R32A 1PZ8A 3ZIWA 3VBHB 3RSJA 4QPYA 3ZX7A 2H6BA 2W68A 2VULA 1LOEA 1AHSA 4CEWA 2QZ2A 1H2NA 4ONUA 3OF1A 1C8M1 1O3QA 1A3KA 1DFQA 2PAKA 3MIBA 5FMOS 4YFZA 2ZOEB 4G3YC 5IK5A 3IIAA 1ZRCA 3NKTA 1LHOA 1Q8QA 2BEOA 1S0GA 1S2BA 4Y22B 4LO5B 4H55A 4H7LA 1C5HA 2XL7A 1VBE3 1H8TA 2O1QA 5J7MA 4FSJA 2Y26A 5LK5A 3BU7A 4P9YA 2TNFA 3VBSB