1RVF1

Fab complexed with intact human rhinovirus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/immune system
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
total genus 32
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf100
3CJIB 3VBHB 4Q4Y2 1R082 3NAPA 2ZAHA 1EAH1 1ASJ3 3VBFC 4CDQC 3ZFEC 1VBE2 5C8CC 2WFF3 1AR93 2RS53 2BFUS 3NAPB 1PGW2 1TMF1 1RUI1 1AYM1 1AYN3 1RHI3 4GMP1 4IV3C 4GB33 1HXS2 2RS32 4YVSA 4RFT0 3TN91 1COV1 1VBD1 2R073 2HWF1 4PDWC 4FSJA 1RUC1 4Q4V3 4WM8A 5J96B 1VBA3 4CDWC 2HWE3 4YVSB 1RUF2 1PO21 3FBMA 2Y26A 1AUYA 1BEV1 1RUD2 1AR62 3M8LA 5JZGA 1RVF2 4RQPC 2BFUL 2PLV1 4WM8B 5ACA1 1C8M3 1E57A 4RS5C 2GSYA 4LLFA 4RHV1 1NA1B 4CEYC 5JZGB 1BBT2 1VB4A 1OOPC 1FPN2 2RS12 5AC91 2R063 4Q4Y1 5CFCA 1QJY3 1PVC2 4Y4YA 1R1A3 2RMU3 4N43A 4QPGA 4JGZC 3VBRC 4Q4W2 4WM7C 1VBE1 1F2NA 5ABJC 5C9AA 1VBC1 2FZ2A 1AL23 1PGW1 4N43B 5BNOB 1RUG2 1HRI3 3JD73 1NCQA 5C9AB 1Z7S2 2X5IA 1HXS1 1NCRC 3ZFGC 5A33A 2R042 1NCQB 1MEC2 2X5IB 1ND2C 1IHMA 4CDXC 4AEDB 2WFF2 1RUF1 1AR92 1ZBA3 5A33B 1AR82 1AR61 1RVF1 1CD3G 3VBFA 4CDUA 3ZFEA 1AYN2 1ZBE3 1A6CA 3VBOC 1VBB3 1BBT1 3VDDA 2R072 2MEV3 1PO22 3VBFB 4CDQB 4FTBA 3ZFEB 5C8CB 3DPRC 3JBG2 1PVC1 4IV3A 1QQP1 2HWD3 5CFDA 3CJIA 4Q4W1 3VBUC 1PO13 1RUJ3 4RR3C 1VRH3 1D4M2 1EV12 2RM23 1WCDJ 4IV3B 1X33A 4CDWA 1SMVA 5CFDB 5AC92 3ZFFC 1RUH3 4PDWB 1VB2A 3S6PA 2XBO2 4RQPA 1Z7S1 2HWC3 2FZ1A 4JGYC 4CDWB 3JB8A 2WWSA 1QJY2 1VBC2 2R041 1ASJ1 4N53C 4RQPB 1MEC1 1OOPA 2IZWA 4NWVA 1EAH3 2WFF1 1AR91 1RMU3 1AR81 5K0UC 1AL22 4GH4A 5BNPC 4JGZA 1POV1 3VBRA 1R092 1HRI2 1TMF3 1OOPB 4WM7A 1RUE2 1AYN1 5ABJA 4BCUA 4GH4B 4GMP3 4JGZB 1OHFA 4IV1C 1FOD3 3VBRB 2R071 2RR12 1MQTC 2QQPA 2WZR2 1ND3A 4WM7B 1COV3 1NA1A 5ABJB 3JBG1 1V9U3 1RUC3 2HWB2 1NCRA 2HWE1 3ZFGA 1EV11 1D4M1 1ND3B 5DDJ3 1BEV3 4YVWC 1NG0A 2WS92 1ND2A 2ZTNA 1PIV3 5GKAC 1NCRB 2PLV3 3ZFGB 1QQP2 4EJRA 5D8AC 2XBO1 1VBB2 5BNOA 3VBSC 1ND2B 2DF7A 4CDXB 4QPIC 1QJY1 1R1A1 1C8NA 2RMU1 3VBOA 1R083 1HRV2 3JB4C 1GFF2 1H8TC 3DPRA 1AL21 1VBE3 3J8F3 3VBOB 1R091 4AEDA 1HRI1 3JD71 3VBUA 1RUH2 4RR3A 1RUE1 4NWWA 5L7OC 1ASJ2 3DPRB 1B35C 1QJX3 1TME3 2RR11 2RS52 3VBUB 3ZFFA 1HXS3 2RS33 2WZR1 4RR3B 2BUKA 4SBVA 2HWB1 4CDQA 5FOJB 1RMU2 5C8CA 1RHI2 3ZFFB 5LK7B 1RUF3 2VQ0A 4GB32 3IDEA 4N53A 1AR63 1RUD3 2WS91 1AR73 1RVF3 4CEWC 4Q4V2 1ZBE1 5K0UA 5BNPA 2WLPA 5CFCC 1VBA2 1VBB1 1FOD2 1RB8G 2HWE2 4N53B 4QPGC 4Q4X3 1QJU3 4PDWA 5C4WC 1FPN3 5K0UB 2RS13 1V9U2 5C9AC 5BNPB 2TBVA 1C8M2 1HRV1 1PVC3 3LOBA 1MQTA 1VRH1 4Q4W3 5A32A 1NCQC 1FMD3 4GMP0 1NY72 1W39A 2R062 1RUH1 1MQTB 4RS5A 1RUG3 1R1A2 2RMU2 5BNNC 5A32B 4CEYA 1K5MC 1DDLA 2RS51 4RS5B 5D8AA 2XPJA 4CEYB 3VBSA 2R043 4YVWB 3JD72 1RUI3 1RMU1 1MEC3 1RHI1 4CDUC 4QPIA 2ZZQA 1AYM3 3J8F2 4GB31 3HAGA 5D8AB 1AR83 3VBSB 1POV3 3VDDC 3TN93 1VBD3 4Q4V1 1H8TA 4QPIB 2HWF3 1QJX2 1VBA1 5FMOS 1FOD1 1TME2 1ZBA2 5CFDC 1OPOA 3CJIC 3VBHC 5L7OA 1PO23 1H8TB 1V9U1 1B35A 1HQNA 1C8M1 3JBG3 4CDXA 3ZXAC 5ACA3 1ZBE2 1X36A 5DDJ1 1BMV1 5L7OB 1D4M3 1EV13 3NAPC 1AR72 1B35B 4RHV3 1PIV1 1NY71 2MEV2 4Y5Z0 2R061 2HWD2 5AC93 4FTSA 4Q4Y3 5FMOL 1PO12 4Q4X2 1QJU2 2XBO3 1RUJ2 1VRH2 2RM22 4CEWA 1AL0G 1R081 1VBC3 4GH4C 2GH8A 4YVSC 5C4WA 4CEWB 1FMD2 2HWC2 3J8F1 5CFCB 1PGL2 4WM8C 4QPGB 1R093 1VAKA 1QJZA 5C4WB 1ND3C 1RUE3 2BPA2 1QJX1 1NA1C 5JZGC 4JGYA 1TME1 1EAH2 1ZBA1 2RS31 1M06G 5BNNA 2BBVA 2RR13 2WZR3 1K5MA 1TMF2 1RUI2 4JGYB 2HWB3 1AYM2 5BNNB 1RUD1 1AR71 4N43C 1K5MB 2MEV1 5BNOC 1CJDA 3TN92 1BBT3 1COV2 1VBD2 2WS93 2HWF2 4FTEA 2HWD1 1RUC2 4IV1A 1QQP3 1PO11 4Q4X1 1QJU1 1RUJ1 1NOVA 2RM21 5DDJ2 1BMV2 1FPN1 4CDUB 2RS11 4Z92B 1BEV2 1HX6A 1PIV2 2PLV2 2X5IC 4IV1B 1F8VA 1POV0 5ACA2 4AEDC 1HRV3 3VBHA 3VDDB 1FMD1 2HWC1 4YVWA 4RHV2 1PGL1 1Z7S3 5J98B 1RUG1
chains in the Genus database with same CATH superfamily
4LE3A 3POGA 4P02B 2XJPA 3VKNA 4COVA 4EZHA 1R082 3FMGA 3WQ1A 3O5SA 4UFHA 1EAH1 4ZZ8A 4AVSA 1ASJ3 3KHCA 4LOTA 4CDQC 1Q8QA 1N47A 2A6XA 3ILNA 1OQ1A 1YFXA 1YIPA 3BODA 4MGSA 2BFUS 3NAPB 4KU8A 1RUI1 1ZA7A 1GP5A 2WNVB 4YM3A 1ONAA 2ZOEB 4Q1RA 5IVEA 3KM5A 4QM8A 3L9JT 1HDKA 5IK8A 3MLLA 2VOXA 2XL7A 4GMP1 3OBZA 1D0HA 4BMBA 1H1IA 2C1FA 3POSA 3KF5A 3CEWA 1ZREA 2VBPA 2ZHMA 2C6SA 3ACLA 3M3IA 3NJXA 2ZX2A 1COV1 1VBD1 3PUAA 4J1XA 4LK6A 2R073 2WNUB 4QGLA 5C3QA 4PDWC 4HSJA 4FSJA 3C7FA 2Y64A 3OG2A 4R9AA 3KV4A 1D2SA 3PUSA 3S7IA 2D6LX 4M0NA 2ARCA 4NIHA 3BB6A 4AI0A 2XJRA 5F39A 3GGLA 3LKJA 2XOMA 4ET7A 1AUYA 1BEV1 1RUD2 1WLWA 3GZUC 3M8LA 5HCBA 5E1RA 3BIWE 1CAUB 2BFUL 1W28A 1QY4A 1H8VA 4K9SA 1UZVA 2D43A 5ACA1 2GMMA 1RIRA 3VN4A 1STMA 4E2QA 2G1MA 2CNAA 2WDBA 1RC6A 2XVGA 5FUNA 1HQWA 1JS9A 1NZCA 4CEYC 4LT5A 2VGDA 5CYYA 3OEAA 1UF2C 1VB4A 2VMFA 3WNLA 3MI8A 5JXGA 1SEFA 2QQOA 2D40A 1FPN2 2NPIA 2RS12 2Q8OA 2ZAAA 5AC91 2Q1FA 5KHGA 1NX9A 2EAAA 1W8FA 4LA2A 1ALYA 2VMHA 2WO1A 4FPGA 1R1A3 5FP3A 1OI6A 4LPLA 5JIAA 3VBRC 1GQPA 2VJXA 4Q4W2 1PGSA 4DS0A 1W2OA 3AVSA 5CKQA 3U37A 4FI9A 2J1AA 5CU1A 5A6QA 1O91A 2A6YA 5JXJA 2ZMNA 3LIGA 5BNOB 3O1PA 1L3JA 4AFAA 3WP5A 3WG1A 4ASKA 3MIHA 1H6XA 1BQPA 2D7FA 2E53A 2WUHA 1WGPA 3CQOA 3TOJA 4HBNA 3WDXA 4BIOA 4P9WA 5FP8A 2XONA 2V09A 1CIWA 5C9AB 1CWPA 5GALA 5C71A 2VUCA 4QB6A 4IEUA 1NCRC 4QB2A 2DV9A 4FBFA 4ARXA 2BOIA 1L7RA 1TG7A 3D6EA 3C8XA 3FFZA 4GKXA 2R042 4L97A 4LQRA 3VHRA 3S5QA 1UZWA 1LOFA 1LOBA 3FX3A 3T2QA 2ZX1A 2YC4A 4L9BA 3RZGA 4AEDB 2WFF2 3GJAA 3H0OA 1AR92 1OA2A 1ZBA3 4FQ4A 4IEVA 4X8PA 2VMEA 4K7JA 3OGSA 2YYOA 3RFRA 1J3QA 2OUHA 1XU2A 2Z79A 3VBFA 3R0RA 4XTPA 5L36A 4MX3A 3O1VA 2JD4A 2VAUA 3CF6E 3VB9A 1A6CA 1S4CA 3CKHA 5FZ8A 3OY8A 1FATA 4Y1UA 2XMLA 3NQHA 1PO22 3SKVA 4FTBA 1VPHA 4MV2A 5IWFA 1D4VB 5KHHA 3AP9A 4IV3A 2ARXA 3POBA 5JMOA 2ET1A 2UYAA 4LHSA 5CFDA 4UXAA 3CJIA 4Q4W1 2X29A 5G05L 3FLRA 5FYYA 4RR3C 5DUXA 2PHTA 2VNRA 3JXSA 1D4M2 4LBKA 3WHUA 3BU0A 2BERA 2QNKA 1NQJA 1X8EA 2VVFA 5JR7B 2VW0A 1ST8A 2BGOA 3SH3A 2AC1A 2A5ZA 4K40A 4CDWA 1W2UA 4N7UA 5T5JA 4NHXA 1X8MA 1RUH3 2NP0A 3GXUA 3W9AA 1H1MA 2GNTA 3ZSLA 3V56A 2XBO2 4RQPA 1DHKB 3T4HB 3ZDSA 4JGYC 5FYHA 3N4MA 5L73A 4NRQA 3QOPA 3O1OA 3JB8A 3KV5A 2QQLA 4H3WA 5LCWL 2IWGB 3SNMA 1SLLA 2R041 3ATGA 3E6CC 3MIBA 1F4HA 2Y8KA 1QWRA 2DVBA 4AGVA 1EAH3 1A3KA 2WFF1 1LOAA 1AR91 2ES3A 1TQ5A 1UD1A 2JENA 3FHQA 2Q4SA 4JGZA 1R092 2VXRA 1LB2A 1RJ7A 5CEHA 4AW7A 3AMQA 2Z42A 4WM7A 2V73A 2IXHA 1W6NA 4UFLA 3WP3A 4IQPA 2I07B 2P5BA 5AVPA 3UKTA 2Y6JA 3LEKA 3ZXEA 3ZXFA 1OC1A 1UOGA 4KWKA 4GH4B 3H3UA 5FYZA 4COZA 4GMP3 5J09A 1XYPA 3RJRA 1VP6A 2OXBA 3WG4A 4MGYE 2QQVA 5JPNB 4OUSA 1COV3 2VNOA 2XLFA 5ABJB 3SH5A 2EIDA 2ID4A 1CVNA 1UKRA 1UU6A 2RE9A 3GBWA 4OYUA 4X6QB 2HWB2 2HWE1 3ZFGA 1MZFA 4LHLA 3CLPA 4XIKA 2J1SA 4FPCA 1D4M1 2VMDA 4Q29A 2N7GA 4QX2A 5DDJ3 1MVQA 5FO9B 3PIGA 1YQ8A 3WNKA 1ULEA 1BEV3 4YVWC 1NG0A 1D7PM 1ND2A 4LJHA 2RG4A 1H4GA 5DUWA 5FP4A 5FZOB 2GP3A 3ZN6A 5CAZA 2XBO1 1VBB2 3JCIA 3OCPA 4DRVA 2JX9A 5JMCA 4V2VA 1CZTA 2DVFA 1RXFA 1VMFA 2QUOA 1UO9A 4I0BA 4CDXB 4ZONA 3BUCA 4LBQA 3ECQA 5A3LA 5FLIA 4KU7A 3WW2A 3DXTA 1C8NA 1QHDA 2YDEA 4NO4A 3LEMA 3GM8A 1Q8SA 5KXCA 1JYWA 4B8EA 1R083 2X09A 5A7SA 1XNAA 2J1EA 2VBDA 3UL2A 2RJ2A 1ZZ8A 4C0BA 2HYKA 3U78A 4D7TA 3WINE 1GFF2 1W0NA 1KGYA 2W47A 4D0QA 2AR6A 3VBOB 1QOTA 4AVBA 3RRDA 1R091 2VG9A 3DYOA 3OBAA 4XF9A 2I2SA 2VVDA 3TAYA 3LB9A 4ASMB 3HN3A 2XB6C 3E5XA 4M0HA 2FDGA 4HPKB 3DPRB 2PTMA 4BK5A 1XNDA 3PHMA 5F37A 4QKBA 3RPQA 1QDCA 4UFIA 4IEPA 1V6LA 2VTXA 2VU9A 2G9ZA 3EBRA 1XQNA 3VBUB 4LHNA 1IPSA 4QXHA 4Z07A 4XFFA 1I3HA 2WSVA 1WBLA 1A8DA 3AJYA 2HWB1 5FOJB 5C7GA 3EB7A 2NMOA 4L99A 4LUMA 5C8CA 2HEYF 1RHI2 1VMHA 4XZPA 3ZFFB 2ZGPA 2UWAA 4DB5A 1UOBA 4XXPA 2LROA 2JKBA 2XJVA 1CONA 4GB32 4XJZA 3VGIA 2GZWA 3NNJA 1RUD3 3WCSA 4LIVA 1AR73 2D6OX 3KHBA 5FJKA 4Q4V2 3OJBA 4DPNA 1C57A 1O3TA 1YO8A 1U5XA 2P3KA 3ORJA 1VBB1 5EPAA 3IDCB 4E8CA 2JB4A 2B9UA 2PELA 4HKOA 1OD3A 4Q4X3 1QJU3 2DU1A 1MS9A 5HV4A 4XUPA 4CXXA 4RL7A 3NV1A 5A6XA 2VUAA 1FPN3 4R4XA 2RS13 3H1WA 2E7AA 5K0UB 2ARBA 3B7MA 4PIXA 2TBVA 1Y9QA 4LIUA 2B5HA 2XHKA 2XVLA 1V6IA 1WD4A 5LB6A 4UW4A 2MNGA 5EQUA 4Q4W3 2DU0A 4YZ3A 4FPHA 2KR2A 4W6WA 3LA3A 3K4DA 3H1MA 4CP9B 3O0XA 3QACA 3T0DA 2G4IA 1NKGA 4YGCA 4AOCA 2R062 3WDVA 1VMJA 1MQTB 2QQIA 4OI2A 4RS5A 3S30A 4EWAA 2RMU2 5I0SA 1HLCA 1OKQA 1GZ9A 5A32B 3AL5A 3G6JB 4IESA 1OFSA 1AXKA 3A21A 3LA7A 3GBGA 4S2GA 3ZPYA 3N9LA 1TEIA 2WN2A 3MIEA 3PTYA 2OT7A 4HOOA 4ZHNA 4CCDA 1GMMA 5EFUA 1OF3A 4AI1A 4YSFA 1UNBA 4JV4A 5D8AA 1WA6X 3M3OA 3NNGA 5KR7A 3MZHA 5HV0A 3HN1A 1AHSA 1I5PA 3CU7A 2WJSA 3RZMA 2R043 1OH3A 3JD72 2YROA 5EWSA 3I2DA 2GNDA 1RHI1 3N9QA 4QPIA 1RYYA 2ZZQA 3U07A 4Q26A 3I4IA 5IVJA 4I2OA 1AYM3 4GB31 1W6PA 3HAGA 3X29B 4BXFA 1O5LA 3VBSB 4Y22A 4LBOA 4BMEA 3K4ZA 3K2OA 3LPGA 3TN93 2F17A 4Q4V1 1H8TA 1PNFA 2HWF3 2BDRA 4M01A 1LGBA 5FMOS 3POEA 4O61A 4R9CA 3SISA 1TME2 1ULPA 2Q0AA 3VDCA 2QE3A 2BGPA 1PM4A 5CFDC 3FE5A 1OPOA 4CP1A 1CAVA 5F3CA 3CJIC 1REDA 3KS7A 3VBHC 4KG8A 2DCJA 1LTEA 1PO23 3E6DA 2BV4A 1SQ4A 4JQTA 4IEYA 4WVVA 1PK6B 3AMMA 3O1TA 1LODA 3A7QA 1ZBE2 4XJUA 1KS5A 1AX1A 1MZEA 1KRIA 1D4M3 3USUA 3ETPA 1B35B 3MHZA 2I74A 5EJ1B 2XR4A 4WBBA 1NUKA 2R061 5G04L 1GWLA 3EO6A 3TEZA 3BN6A 3WF3A 3I2JA 4XFGA 3E1F1 5FOBB 4Q4Y3 5GM0A 3J7MA 2PHLA 2CHHA 2VE1A 1G7YA 3WNNA 5FMOL 1PO12 5FAXA 4ARYA 2XBO3 1VRH2 2HBTA 3CO2A 2RM22 3GCWA 3KWVA 3VL9A 3VZOA 4CEWA 4NIAA 5T3NA 4GIQA 4BISA 5FZ0A 2VW1A 1VJ2A 5F3GA 2P2KA 5IHRA 4NJ4A 3L2HA 3AKRA 4YVSC 4EN7B 4AYUA 2C4XA 3KMHA 1FMD2 1Y3TA 4URAA 2QQWA 1QMJA 4ORFA 5CFCB 2W2IA 2VH9A 1GOGA 3J7NA 3ZXKA 4FPKA 4WM8C 3HIFA 2AENA 3URFA 1R093 3MEPA 3ACFA 3LWCA 4S2HA 2ZMKA 1SCSA 4CRQA 4LK7A 3ZX7A 4DUVA 1YJLA 1TME1 1ENQA 2VW2A 3O14A 4XOGA 5CADA 2VM9A 5AFEA 2LW8A 2D6PA 3NNLA 5C5UA 5JXIA 3MBWA 2BBVA 3THTA 4C0HA 1CZSA 5I91A 1C4RA 1KS4A 5T54A 4ZU4A 3CMGA 5A7PA 2HWB3 1C1FA 5FY4A 1IZ3A 4QHOA 1WKYA 4HVQA 2WFPA 2CYFA 4AK3A 3WF2A 4HT1T 4N43C 5GZCA 1K5MB 3DECA 1KEXA 2ZEWA 4FPOB 3CL1A 4LR4A 4XQWA 1AVBA 1EPZA 4Z2WA 3ZYRA 2JDKA 3OUJA 4XC9A 2EXHA 2PHUA 2WT0A 4FTEA 4FQZA 1RUC2 4FOWA 2XLAA 4BQ1A 4OI0A 1JXNA 2WC2A 2OA2A 5FO7B 4QKFA 5BPXA 1LHVA 1PO11 2ZACA 2A71A 2EXJA 3PL0A 2G9FA 5A7WA 5I8YA 1W3VA 2RM21 3T09A 1BMV2 5ERLA 3AZVA 3ACIA 1S0BA 3HNMA 1NLRA 1HX6A 1PIV2 3I8TA 3MIDA 2JDAA 1F8VA 2VD7A 1POV0 4E8DA 3POWA 2PHWA 2RDSA 3VDDB 2BTVC 4M3CE 2J7MA 4A7KA 3MF9A 3ZYHA 1FMD1 2JG9A 1MACA 2UY9A 2WR9A 3N3HA 4RHV2 1CR7A 1W9FA 4GKYA 1MS5A 1XNKA 3V0AA 2Y6KA 5BV6A 1LCLA 1S2BA 3KV6A 4MGZE 1RUG1 4IEQA 1GZTA 1GWMA 3LAGA 2P1BA 3KVAA 3WUDA 4MHUA 2RHPA 2YC0A 3NAPA 1H0BA 3P6BA 4W4ZA 3N9MA 2WNVA 1HJGA 3HT1A 3EHKA 1SACA 3M70A 1DYOA 4I0AA 1I5ZA 4PBOA 3TWIA 5LBCA 3H7YA 3ZFEC 5C8CC 1JZ7A 3T2PA 4R4ZA 4MO3M 2D3PA 4QPWA 3RMXA 5GLVA 1AZDA 4NIIA 1BVVA 2WNUA 4XMIA 4D7SA 5LY2A 3VUOA 3NV3A 4E2SA 1GZCA 1AYN3 1RHI3 3MFCA 1LENA 4Y4RA 4GB33 5EV7A 2YV8A 5HCFA 1WW5A 1HXS2 2RS32 2QKDA 3K48A 2ADDA 1S55A 3NW4A 2GN7A 1FXZA 2HEWF 3DXUA 3HQUA 1SFNA 1UYZA 3KV9A 5FK8A 5L9VA 4HL0A 1OLRA 5IK5A 5DXDA 1CAUA 1DGWX 1RUC1 4Q4V3 3WG2A 1PNGA 4M3CB 4XJAA 1Q8PA 4MOAA 2PHFA 1OBNA 1OPMA 1UU5A 2HKXA 5APAA 3T1LA 2ZKLA 4ZPIA 1RUF2 3AYEA 4W8JA 1YFYA 2Y26A 3AZXA 5GLWA 1RVF2 2DURA 2VOVA 2ZGMA 4LLOA 5CNAA 5JSRA 2E63A 2YBPA 2LTNA 3LEGA 3IAPA 3O7OA 4AEKA 1E57A 1SBFA 1GNZA 4NN0A 3WF4A 1AX0A 4CXWA 4PT6A 4RS5C 1OVSA 3WNXA 2FDIA 3VZMA 4RHV1 1NA1B 4P14A 1KFXL 2X8KA 5JZGB 2GP5A 1BBT2 5FY9A 1MS4A 3I2IA 1OOPC 2GMPA 3D0SA 3MUZ1 4YW1A 4MYEA 2FDFA 4JKMA 2R063 2EA7A 5FR3A 1QJY3 1PVC2 2RMU3 3O0WA 4QPGA 1ODMA 4YWAA 4HETA 2VZOA 1OA4A 2R7EB 4BPZA 4P00B 2DCZA 1QH6A 4IE5A 1F2NA 3D4KA 3J26N 2JG8B 5C9AA 2VQTA 2YPDA 3B9IA 1JOJA 4IXLA 1AL23 5C3PA 4F3JA 5GZDA 5FLHA 4CU9A 2Y6HA 3JD73 2VOKA 1J83A 3ES4A 2ZS6B 1W8UA 3RQ0A 1O6UA 4RYDA 3H8OA 1HXS1 3ZN4A 3RVHA 4LEJA 2VO5A 3IB3A 3BPZA 5HCHA 1W8TA 1NCQB 2YY1A 3WT3A 5IVVA 2O1QA 4PIYA 4K21A 2GMEA 2X5IB 5GLTA 1IHMA 4LKSA 5A3WA 4AHXA 4JHZA 3WHTA 1WW7A 1GICA 1RUF1 3K46A 4FO9A 5M0TA 4FPEA 5A33B 2GC0A 3S5AA 1JN2P 3HMYA 4XF0A 1W8NA 1O8SA 5A7NA 1RVF1 4TWTA 1CD3G 4PQ9A 3UT0A 3BOWA 4ATFA 1V70A 4M3CF 4CDUA 1UCXA 4XBLA 4H2AA 3ME2A 2JDUA 3Q8AA 4LBQD 4YM0A 1YI7A 1ZBE3 1QXPA 4HXCA 5F3IA 2P17A 3VZJA 2A70A 2VTXJ 3ZIWA 1WW6A 1BBT1 1OD5A 3H3LA 4P9GA 2QTWB 4CDQB 3C7EA 1IS6A 4F8AA 5IYYA 3P1IA 1PVC1 4CCKA 1N1SA 1N1VA 2R0FA 2NMNA 2VCCA 3NWKA 4PIZA 1PO13 1UY4A 4LBMA 3RGBA 2FMYA 1MS0A 1VRH3 2D6KA 1Y9GA 2RM23 3PMEA 4O9EA 2UYBA 3B94A 1DQ1A 4GJZA 4KL1A 1DCSA 3ZYGA 1H2MA 5C3RA 4NPMA 4AVVA 5JVVA 4DFSA 1SMVA 3NV4A 3BCWA 4FFHA 4N9IA 3THDA 5E89A 5AC92 2GC2A 3NVCA 4PJYA 4B4QA 1ENRA 4PDWB 1VB2A 2FDKA 3S6PA 3PJQA 3WW4A 1MPXA 4IERA 4XCAA 2FZ1A 1UOJA 1CX4A 5EYXA 4BQ3A 1D2QA 1SCRA 2VZVA 4UF0B 3T0BA 2C24A 2WWSA 3VHOA 3O1UA 2VUJA 4WZFA 3GJBA 1SBEA 2QVSB 3BU7A 3R4UA 4IL7A 4D8MA 4XHXA 1W8HA 4N53C 1U12A 2OIIA 5CKMA 1ZRFA 4NROA 4NOTA 3PU3A 2BBAA 1RMU3 3J7HA 4CXYA 1LOGA 3H7JA 4DOUA 2VNVA 4Y5SA 3OYWB 4GH4A 4XDQA 5BNPC 5C70A 1POV1 5DZGA 3VZNA 1HRI2 2VY0A 1NXMA 2FDHA 4L8QA 1G86A 4UBHA 5ABJA 3AJZA 4AEJA 2BRTA 4A44A 2VNGA 1W9YA 3NRUA 5JI7A 1BHGA 1JU3A 1OHFA 3OPZA 1FOD3 1YJKA 3VBRB 2LUWA 2OZ6A 3AK0A 3NNFA 3I49A 2WZR2 5I0DA 3KCCA 4EWEA 2D5HA 2VZUA 2IFWA 4HFSA 3RSJA 1RUC3 4ZS2A 2VC9A 5GJ6A 3H50A 1SLIA 2P3JA 5DG1A 3LA2A 5FMCA 4GJYA 3UESA 2I45A 5FZOA 2ZGNA 2XJSA 4YFZA 2OQ7A 5TSWA 4CCOA 5IVCA 2JG9C 2WQZC 5J3UA 2ORXA 1JW6A 1YQ5A 2WS92 1PIV3 5GKAC 1NCRB 1SZBA 2XJQA 3WR0A 4E27A 3ZYPA 2QQMA 1DQ6A 2QCSB 1WCSA 2KA3A 2YXSA 4XXAA 4PCRA 3IIIA 5FK7A 5IK4A 3W58A 2E9QA 1RITA 3J7LA 3FL7A 4J6GA 4M00A 2RDRA 1N1TA 3VBOA 5JUVA 4E4SA 4ES9A 4CCJA 2W94A 2W46A 2W39A 3I2FA 3WEZA 2ZGUA 5F32A 3DF0A 3A0KA 1W6QA 3FLPA 3WOGA 2W92A 1JYVA 2WIIB 4HPKA 3DPRA 2K0GA 3T08A 4R9DA 2OPWA 5FY5A 2VCBA 3CHXA 1SDDB 4NAMA 3I3BA 3BGAA 4Y26A 3T1MA 2YFUA 1H2LA 1VIWB 3WQ0A 1HRI1 3VBUA 1LEMA 3DL3A 4TSVA 1UYYA 2JEMA 1REEA 5L7OC 1NLQA 1OUXA 1RINA 3TBDA 1DZRA 1U5ZA 2CGOA 2YBSA 4QT6A 4IGOA 2LS6A 3N36A 1M4WA 3HVDA 2QFEA 4QMAA 4ZKTB 1FNYA 3ALQA 3HPNA 3ZFFA 1YXWA 1HXS3 2RS33 2WZR1 5D1IA 3PUQA 4RR3B 4Q0VA 4DO0A 4HN0A 2BUKA 4GQ7A 4A45A 2W1UA 2QZ2A 3OEBA 3GDBA 5CG9A 1GR3A 1SFPA 4QPYA 4PBPA 4CU6A 2Q30A 4QDQA 4D3WA 5LBBA 4P9YA 1G8WA 1F31A 2BU9A 2EIBA 3T3YA 3ZOIA 1UYPA 3BPSA 4HONA 1RUF3 2VQ0A 5AVAA 3IDEA 4QGMA 5FZHA 3WLUA 2CWMA 3AKTA 1T2XA 4W6XA 3AFKA 5FXZA 3MW4A 3JZVA 4NMIA 2WS91 4DUXA 2VZ1A 4UWDA 2E6VA 1RVF3 1H9WA 2VZQA 1IG3A 2DUPA 5F3EA 5FZCA 5K0UA 2J1VA 1N1YA 2ZEZA 1CAXA 3NKGA 4H55A 4K20A 1FI2A 3FWEA 1RB8G 2HWE2 3BYWA 1HIXA 4QPGC 3MUY1 4AI2A 4D6SA 1S0IA 3PU8A 4OLLA 5FJHA 3J9SA 2D6MA 1IQAA 4CP0A 1JZ8A 5C4WC 1DP0A 2ZX0A 2EIEA 3AMHA 2ZEYA 4XVHA 3WP6A 4CP9A 1V9U2 1GZWB 1V00A 5C9AC 2QQNA 1C8M2 3VDBA 1PVC3 1V6MA 4EQVA 5I8TA 3ZKUA 1MQTA 2YUEA 2H6BA 3C7OA 3AP6A 3EYPA 3ZN5A 5F1RA 1F9KA 4OZXA 4YG0A 3UJQA 2ZHNA 1JH5A 5A32A 3ZXGA 4QM9A 3PJYA 3W59A 1W39A 2DCTA 5F5AA 4BQ2A 4CTEA 3BTZA 1UY3A 2AREA 2IXKA 3I54A 2A6ZA 3DYPA 5GZFA 5BNNC 2A73B 2TEPA 1JOPA 3ILRA 4FPJA 4XFBA 1K3IA 1RUNA 5JXHA 4GWNA 1DDLA 1SLBA 4NRMA 1CX1A 1UOFA 5JLVA 3OGVA 2YU2A 2FCTA 1CPMA 1Z0HA 5A6ZA 2JXAA 1ULCA 1QU0A 3GYDA 5FZFA 3VBSA 4NHLA 4FP2A 2JDNA 4YVWB 5A1FA 4IETA 1RUI3 2MHFA 2ILMA 3PVOA 5E88A 1PM7A 4PF1A 3WDTA 4CDUC 2B42B 2Y6GA 4A2UA 5FYMA 3J8F2 3I3EA 2VMCA 4P08A 3B69A 2XG3A 1OA3A 3JU9A 3V65A 3VLBB 5IAXA 3DEMA 3KT7A 1JZ6A 1POV3 1W9SA 4N8MA 1LECA 4LE4A 4WVMA 2CV6A 1VBD3 3MYXA 1YQ2A 2WAAA 4FP3A 1QJX2 1NLSA 5F6KA 1KD7A 1PK6A 4CSWA 4EYUA 5C3OA 4BWOA 4YRDA 2CAVA 4OFGA 3WQBA 4QXBA 5JOZA 3ROUA 2Q1MA 4KWLA 1V9U1 1B35A 2C5DA 1U5YA 3MLKA 5FPLA 3RZZA 3ZSKA 1C8M1 5FYUA 3HEIA 2Q8CA 1DG6A 4NHYA 3ZXAC 2ZGKA 5ACA3 1X36A 2J22A 2FBEA 3SHRA 2XJUA 3D3AA 2JE7A 2R30A 2NM1A 4HG6B 2W08A 4ONUA 2WO7A 4QX0A 1QF3A 4Y5Z0 5LK5A 4BDVB 1DZQA 1LHWA 2RJKA 1JODA 3GNEA 2HWD2 5AC93 1O4YA 1S0DA 1OQDA 1DIWA 3WZ1A 4I01A 1O4ZA 4GZ9A 4PI2A 5H9PA 2IFRA 2RV9A 4H14A 3H8XA 4HVOA 1X50A 4BYYA 3S7EA 3ZM8A 1UZ0A 4GH4C 2BNMA 1V6KA 1C5IA 2GH8A 2JDYA 2Q5TA 2XKOA 2DDUA 4IEWA 3QH7A 1LAJA 3NV2A 2LM3A 3LD8A 2VPVA 2EALA 4NVPA 3KQ4B 5H9QA 1YUDA 5EIYB 2HWC2 3J8F1 5FPVA 2Z2SB 5FXVA 2JJ6A 2GNMA 1GKBA 1PGL2 5K4LA 2ZZJA 1JUHA 4DUWA 1XE8A 2PYTA 2VBBA 3HWJA 5KWRA 3SKJE 1PMHX 1VAKA 4UFJA 3AZWA 4UT5A 1XYNA 4BB3A 2XL9A 1QJEA 4N9HA 1QJX1 4E4HA 4TXWA 4LULA 3JUUA 2ZEXA 5FY0A 1H6YA 4MSVA 3KGZA 3ZIXA 1YEWA 3VDAA 3NJYA 2WZR3 2E33A 3IM0A 5CG8A 2IVIB 4B4RA 1K5MA 4ZS3A 5FPBA 1ENSA 5LA0A 1X82A 2WABA 4TTGA 1YQ6A 1BK1A 4I30A 2VOWA 3KCYA 1SLCA 5FZAA 5AFBA 4OI1A 5D21A 3WDUA 2EF6A 3TEWA 4YM1A 2WT2A 5KHIA 2ARAA 1ZZBA 3B3QE 5JIUA 3U0ZA 4IDZA 2GH2A 2BZDA 1DQ2A 1G9FA 1WLDA 3WUCA 2BWAA 2WS93 4KWUA 3SCFA 1W06A 2HWD1 2DVAA 2DCKA 4XILA 2P3YA 2C9AA 1NOVA 2P37A 4LKDA 3I3DA 4RFRB 4Z92B 1GU3A 5FKCA 5T5LA 5IK7A 2ATFA 2HYXA 1GBGA 1OLME 3IDAA 2PLV2 2D98A 3EJKA 2Y38A 3IT8A 4IV1B 3HR9A 4Y20A 3GHMA 5F5QA 2KD7A 1XPWA 4LA3A 3OY8B 3PTRB 1CGPA 1MS1A 4MVTA 2JKXA 1OSGA 2HWC1 3CNAA 2WN3A 2WA3A 3CZUA 3KD4A 4UBGA 1Y9MA 3CDZB 2PQSA 3E6BA 4L0PA 3UKNA 4MADA 5C8WA 1PGL1 1LOFC 5FPAA 4YW7A 1K45A 1O3SA 1V6OA 1HB2A 1HQLA 1HJFA 1Q3EA 3CJIB 3GHNA 3T2OA 3VBHB 4EV0A 2DVDA 2HJIA 4C90A 4OCTA 5SV8A 2HBUA 5FMBA 1W3XA 2IUWA 2SLIA 3H9AA 4GA9A 1IPKA 3IBMA 1CIYA 3VBFC 5EJ3A 2AH2A 2XKPA 2WFF3 1AR93 4WVZA 3FLTA 5KXDA 2Y34A 1NZIA 3LSEA 1PGW2 1OH4A 4FXGB 1OT5A 1UPSA 5JDBA 3DYMA 2ZX4A 3DCQA 4JQRA 2WQ8A 4Q27A 4AAPA 4NPLA 1ACCA 2ORZA 4JTOA 3U1XA 3MV01 4FOYA 4M3CA 1NYWA 2O8QA 3KSCA 1R64A 4IV3C 3BTAA 3N35A 4P9LA 2PXJA 1SPPB 3VZKA 4LKFA 3CIHA 4RFT0 1VRBA 2B9VA 3QH6A 5HBAA 4ES8A 1OLQA 4LOSA 4HLTA 5F5CA 1JZ2A 2F4PA 3LDBA 4PLMA 3M4FA 4YG6A 2JE9A 2PAEA 2BYVE 1SFYA 5F5IA 5I0UA 5J96B 2JDPA 4CDWC 1LOCA 2HWE3 4L11A 4YVSB 2O14A 2JD9A 1JZ4A 3RWNA 4CUAA 1UXZA 1BXHA 4MGIE 1AR62 2A6VA 4FPYA 2RJLA 3C7HA 4MGQA 5JZGA 4RQPC 3D82A 4K8RB 2PLV1 3T0AA 2YGMA 3UJOA 4WM8B 4Z1VA 1C8M3 3NJVA 2WO3A 5C5TA 4Q2FA 4FCAA 3NL1A 4FVVA 4HKWA 2B39A 2ZKNA 5LWBA 4CE8A 4A7YA 4LLFA 1DF0A 3ZR5A 3RYRA 2OPKA 2W87A 3PMSA 4QXKA 2D44A 5FXWA 3E5UA 4Y1ZA 4JAAA 4DXSA 1O3QA 1F5FA 1WCKA 1RUOA 2GAUA 4BQ5A 4E4ZA 4CVUA 5DZEA 5J7MA 5CVRA 4Y4YA 2WQ4A 2AYHA 3PVNA 1DQ0A 4JGZC 1OURA 4UOJA 4CCEA 3WCRA 3IDBB 1SLAA 4FFFA 4AXOA 4BOWA 2VOTA 4WM7C 1UY0A 1CESA 4AR2A 1VBC1 3MIFA 2FZ2A 3PLQA 3UGHA 4B7KA 3QLQA 3TB0A 3ZN6B 1PGW1 4N43B 2P6CA 3AMNA 3I97A 5F6LB 1ZRRA 5LRRA 4AQ6A 5E16A 1RUG2 5J36A 1H1AA 2NQYA 4JCKA 5FBJA 3K3OA 5FZIA 1NCQA 3LCPA 4CA9A 4DY3A 5JOWA 1ZVFA 4NIGA 1Z7S2 2X5IA 2R49A 4ISRA 3MICA 3ZFGC 5A33A 5LBEA 4EN9B 5EZWA 5FRAA 4LXLA 2R16A 1ZRCA 1DZTA 2GC1A 3NKTA 5E8AA 5DAVA 2SBAA 1QGLA 4F83A 5FYTA 1RXGA 5A1LA 1MEC2 4QXCA 1EY2A 1ND2C 1SLTA 3ZXDA 4ZXKA 5IVYA 4I3PA 5FUPA 3WF0A 3OBRA 4EE2A 1HW5A 2A3WA 1YWKA 2EVXA 1AR61 2JE8A 2W68A 5L9RA 4XE9A 1XE0A 1Y43B 4P5YA 4HN1A 3HJRA 1VAMA 5SV5A 3IMNA 3WNMA 3VKMA 5JAXA 4AFCA 4EZ4A 4NHKA 4XHBA 2DFCA 5L19A 1XSRA 2JWPA 1Z78A 2A1XA 4UYBA 2OYZA 4AL9A 1JYTA 2VZRA 5C6CA 5LA1A 1IS5A 2ZBJA 3WSOA 2Y6LA 3ZYBA 2W52A 1KDMA 1VBB3 3M2MA 1CZVA 2R072 1KITA 4AI9A 1I1EA 2CDPA 4XUTA 1KFUL 1AX2A 3OUHA 2UU8A 3ZFEB 1C28A 5A6YA 5C8CB 1W9WA 2E31A 4LBLA 1H30A 1QQP1 2HWD3 3I2OA 3MPPG 3K3NA 4LO7A 4XUQA 5KHKA 2QBXA 3WD5A 1RL3A 1EV12 3U10A 2QQUA 4S2DA 1WCDJ 3U4SA 1J1TA 2GALA 3ILFA 2XWJB 1X33A 4O7XA 4UW5A 4UF0A 4CCNA 2J1TA 3NNMA 3KZ4C 3LPFA 3RNSA 1W2AX 3M7AA 1EUUA 4R52A 5K8SA 4XF1A 2OX0A 5FUIA 1Z7S1 2HWC3 1GNYA 4EN8B 1UYXA 1ZYBA 4YW3A 1JZ5A 3GBFA 2KM2A 2YB7A 1YC61 2H6CA 2VVEA 4GWIA 1KQRA 2BWCA 3OYWA 2QZ3A 4E9KA 4K1ZA 1ASJ1 1UX6A 4XABA 1E5HA 4C1XA 5FZGA 1MEC1 2IZWA 2VZSA 2YMZA 5HI0A 1QNWA 3VKLA 1YLLA 4YZ2A 2B8MA 4RD7A 5CISA 3KLSA 2FCVA 1VAVA 3VBRA 3H42B 3HQXA 3B01A 1DGWA 1WD3A 1DLLA 2JDHA 4Y33A 5A70A 4RGGA 1OOPB 4LO8A 3IZOA 4XUNA 4YZ4A 4ZZ5A 4XW3A 2A3YA 4V2WA 1XYOA 1N3OA 3ST7A 4BCUA 4CCMA 3P3PA 3V0BB 1S1AA 5FO8B 5KHJA 1O7FA 1DYPA 2D97A 2E51A 3I59B 2R071 2QQPA 2V4AA 3M3CA 3H1YA 1S0GA 3ZVXA 2PHXA 4IEOA 3WNPA 1OMIA 1IOAA 1W6PB 2A75A 5EXOA 5F2SA 1NCRA 3KB5A 3TNQA 3S57A 5DAWA 1H2NA 4F7ZA 1GV9A 4GALA 1EV11 4NR1A 1WA4A 4BK4A 1ND3B 1QOSA 4A4AA 5B4NA 5DUVA 4HK8A 3ZO0B 4CUBA 2CGPA 2PLV3 2D5FA 3R4SA 2F4LA 4DINB 2BQPA 1CAVB 1IGOA 2VECA 1PZ8A 4EJRA 5D8AC 1VR3A 3FBYA 5BNOA 1S2KA 2IXLA 3AKSA 4XBQA 4UFMA 2X10A 4JTNA 5L9BA 4QPIC 1TNFA 4MZUA 5IFTA 2Z4FA 1R1A1 1J1LA 2C26A 4NIDA 1W03A 4JHTA 3JB4C 3USUB 1SHWB 4BQWA 2H0VA 1LHUA 2WO2A 1DQ4A 4D6QA 3ZMNA 2VTFA 1W99A 2XUEA 1H8TC 2VUDA 1DBNA 2YGLA 3MF6A 4LNVA 3SCGA 4QDRA 4AQ2A 3FFQA 1A34A 1F4AA 3KVBA 4AEDA 2EXIA 5FZ3A 1RUH2 4JDNA 4RR3A 4XJ9A 4YGEA 4RN5A 3OGGA 5DZFA 3ACGA 1J3RA 4OHZA 2XWBB 4OMDA 5IUQA 2PA7A 1TME3 3F2ZA 2OZJA 2GDFA 2O0OA 2WWJA 5ISLA 2RS52 1W2TA 2JIJA 2IXIA 4IEZA 4D7YA 3RYKA 2PHRA 3WQ7A 2E32A 3U4XA 2WZ8A 3CJXA 4YPJA 3POYA 1REFA 3GZTB 5FWEA 3C7GA 2CSGA 5FY7A 5FMDA 4EN0A 3A0NA 1Q56A 5JPMB 3D8CA 3T30A 4EWDA 4QHBA 3MLJA 3RI8A 2G19A 1U0AA 4QQHA 1AR63 4XZUG 4AAXA 1GP4A 5HXVA 1NE6A 3THPA 5FPXA 1CJPA 4CEWC 3A22A 4COYA 4B7EA 5J48A 2WLPA 3GCXA 1VBA2 1W6OB 3CBNA 1NAEA 3VD9A 4N53B 5DUUA 5LA2A 2YZ4A 1YQCA 2DBNA 2BJSA 4DXZA 1Q8OA 5FV3A 3BI3A 2HH9A 4RA0A 1OFNA 3BALA 4YGDA 1XU1A 5A3PA 1W0PA 1PVXA 4MXVA 3K4AA 3VV1A 2R0HA 3GZAA 3T2TA 5BNPB 1JYXA 2V5DA 4GULA 1G9AA 3UNPA 2VZTA 3H8RA 4QU2A 4AWDA 2K9ZA 3TEYA 1CAWB 3LE0A 2WRAA 1ENXA 2AUYA 3A23A 3H8UA 5T52A 1NCQC 2DTYA 1FMD3 2BW8A 4I0WB 5FZ9A 3AXEA 3DN7A 2HEVF 4KMQA 1FV3A 2X05A 5A7QA 4H7LA 1RUH1 3RS6A 4DQAA 1IQDC 1YFUA 3V64A 1RUG3 1AXZA 3PVBB 4YLZA 1B09A 4BU2A 4QDSA 1I6XA 1A78A 1PMJX 1FNZA 1Y4WA 2IC1A 1QKQA 4DXTA 5JOYA 3SC7X 3U75A 2D6NA 4KI5M 3B02A 2EXKA 2RS51 3UGGA 3USSA 4PHZA 1JI6A 4GWJA 4AVCA 4FAHA 5CKNA 1H9PA 3WF1A 1GUIA 2XH6A 1IKQA 2WWUA 2XPJA 2XVKA 3LSDA 2JG9B 4CEYB 3SITA 4AI8A 1QNYA 1RJ8A 1J84A 1MEC3 1JHNA 4Q5OA 3V0AB 5H9RA 2KXLA 1OVPA 4Q1PA 4YFWA 3I2KA 4QQ2A 3MFAA 3P5BA 1JOBA 3ZMOA 3AFGA 5LY1A 2Z5WA 2WA4A 4LTAA 3WP4A 1WBFA 3DKQA 1XNBA 2W91A 4JRAA 3I2HA 5LATA 1O59A 4ASLA 3ZKYA 4Z8BA 3VHNA 1VBA1 4OVEA 1LOEA 4QU1A 4AHYA 2Y60A 4Q8KA 4IW3A 3OPWA 4YW5A 1WUVA 1S0FA 4U2AA 4G3YC 1X9PA 3POJA 5LEKA 4Q0PA 3VKFC 5K7PA 2JICA 4XURA 5IW0A 4YZ5A 2P34A 4XJWA 4CDXA 4BIFA 4Z82A 2XUMA 3BVCA 5FBZA 4C8DA 1HN1A 2UURA 4JDMA 1FT9A 5H9SA 2JECA 4B4PA 5DDJ1 4QQLA 3Q8CA 2DBIA 1AJKA 2HLEA 3C2UA 5L7OB 4OHYA 3FC0A 3JQXA 1E5IA 2V4VA 1EV13 2C9KA 3NAPC 1XSQA 4XAEA 1AR72 2RVAA 1ZZ6A 2WNVC 2MEV2 3POIA 4IUGA 4QQPA 4RHV3 4XQDA 5EHDA 3WNOA 4PQQA 1R1ZA 3E97A 4XTMA 4DXRA 4Y24A 3NO8A 5IFPA 1PMIA 1UMHA 3HNYM 2DCYA 5C3SA 4AFBA 4Q4X2 1V6JA 1QJU2 1HV0A 1RUJ2 4J1WA 1W90A 3LZZA 2WNUC 3JQWA 2AACA 4Y1YA 2A7AA 1O8PA 1R081 1QXJA 3UKVA 3N9OA 1GYKA 4ZY9A 3LDRA 4ITCA 4AGGA 2ZX3A 4U36A 3U14A 3TNPB 4TLFA 2DUOA 3AKPA 5FLJA 4D6RA 3OPTA 3F95A 2ET7A 2OKXA 1E5RA 4QPGB 2FMDA 1JHJA 2UWBA 5T5OA 4CU8A 4ISQA 1XBFA 3TYJA 1QJZA 5C4WB 3IPVB 2CGNA 2MPFA 3B5LB 4P9JA 3HQRA 3K51A 1L7QA 1K42A 1W6MB 4FXKB 4AF9A 1QH7A 1T6GC 1NQDA 4LHKA 3AL6A 1POQA 3PVEA 1HN0A 1OXCA 4R9BA 5E6HA 2R32A 5FFOC 1O4TA 4XAAA 4G4FA 1TMF2 3S0MA 1AJOA 4V1PA 4JGYB 4XEZA 3MW2A 3WG3A 1DFQA 5A3NA 4DNYA 1US3A 3RI9A 1AYM2 4N90A 1SDWA 3RMYA 3N7JA 3R05A 1WMFA 5BNNB 2CAUA 1LJ7A 3W5NA 4IGPA 1RUD1 4DY5A 1AR71 4BH9A 2MEV1 4MXWB 5BNOC 1WLTA 5JCTA 1CJDA 3TN92 1BBT3 4Q8LA 1KJRA 1US2A 4P9IA 1DGRN 2HWF2 4TN7A 1RGSA 4JRLA 2ZGLA 3I2GA 2WNOA 3AVRA 4IV1A 2AEZA 4Q4X1 1QJU1 5FZ6A 2FCUA 1RUJ1 3GALA 3M1HA 3K77A 2ZPXA 3PURA 4FPLA 4HVRA 3ZDVA 4QD2A 1ZX5A 3O1MA 1C3HA 1H4HA 1FPN1 3KGLA 2RS11 2TNFA 4CDUB 1BKZA 4A3ZA 3FN9A 2W1QA 4CP2A 4XQ4A 4XUOA 4OHWA 5FZEA 1ZA4A 2UWCA 4AEDC 2NYYA 3VBHA 2J1RA 1VLNA 2R1DA 2X53S 4I09A 3AP4A 3LF7A 1IG0A 4QAWA 5ANNA 3KT1A 2BGCA 2YPJA 4X6RB 2Q8DA 1PHMA 5FQ0B 5J98B 1UKGA 3POFA 3D5OA 4K8FA 4YW2A 3AXDA 3RWKX 3UETA 1AXYA 1BJQA 4Q4Y2 3G7DA 2W3JA 4TZDA 1GANA 2Y0OA 2ENRA 2ZAHA 1SBDA 4LORA 5I93A 4BLJA 2EIGA 2WAOA 1W8ZA 5FZLA 2V5YA 5BY5A 5FYCA 3SH4A 2B4KA 2VZ3A 1VBE2 5GZEA 2WL1A 2RS53 5FPZA 5HPOA 1UWWA 1SPPA 1K5JA 5FYIA 1Q8VA 5LA9A 1TMF1 2GC3A 1YHFA 4K6BA 3UYJA 2C0ZA 1OLMA 2A6WA 3BTXA 3OB8A 4XF3A 4K3UA 3IKWA 1AYM1 5T5PA 2ZHLA 3K75B 4BLIA 1EYBA 2ZCWA 5J37A 4AFDA 3HD8B 4AGRA 4XBNA 4YVSA 2B45X 2O8OA 1ZRIA 5DAPA 3TN91 5FZ1A 4L2NA 2HWF1 4XJ8A 3EMRA 1QEXA 3QCWA 3QD6A 4FOQA 2GN3A 1UY2A 1W04A 4WM8A 3RJ2X 5JWPA 5B4XA 4MGTA 1VBA3 1BYHA 1UL9A 3KF3A 2D3SA 2VXJA 2PQQA 2ZGQA 1PO21 4YGBA 5DG2A 4QX5A 2Y33A 3FBMA 1XB9A 2W1WA 3W5MA 3VKOA 2ZGRA 2D3RA 2VR4A 5FTTC 1YI9A 2B46X 2CL2A 2WZPP 5FZBA 3NJZA 3UV9A 4A3XA 1G9CA 1NT0A 4XPVA 3OOXA 3FUOA 1KDKA 2P6HA 3LQCA 4YG3A 4JX0A 2GU9A 4LMFA 2GSYA 1JYCA 5A80A 4M4PA 1HB3A 2IXCA 4MUVA 4N7IA 5JOXA 3AZZA 3R4DB 1NXD1 4JKLA 3AX4A 3B00A 1WCUA 1S0CA 1V0AA 2BNNA 5DAQA 3UK9A 3LEIA 3WW1A 2W95A 4BE3A 4CYDA 4Q4Y1 5CFCA 5FZMA 5LASA 3PIJA 2OS2A 4N43A 2WYFA 1ZZ7A 4R8HA 4XFAA 1ULOA 3FJSA 4BQYA 4CZSA 1XOYA 1WLCA 5B2GB 5BUVA 3H3ZA 1VBE1 5ABJC 1OKOA 4O9GA 4W50A 2XHNA 4XETA 4BXSV 4CPBD 4IE7A 4JDOA 4Q0SA 1YCIA 1HRI3 4BZ4A 3D0JA 1HB4A 2ZXQA 2OUJA 5FYVA 3KCXA 2XLGA 4I02A 2DVGA 4COWA 5GLZA 2PAMA 4A41A 3LGRA 3RG0A 5HCAA 4LBJA 5EP9A 1IS4A 4YW4A 4BJ0A 5FYSA 2WINB 5KXBA 1Q43A 1JBCA 2WNEA 5IT6A 1O3RA 1W6QB 4E2GA 5A3MA 1ULFA 5FZ7A 2TUNA 3A4UA 3ABZA 3WY6A 4DEQA 1RTVA 4UW6A 3CZJA 1QOOA 1BK0A 1W9TA 4TYSA 3SEEA 4CDXC 4COUA 4IGQA 1AR82 2OQ6A 1XRUA 3KQRA 4O65A 4BQ4A 2VMGA 5JSOA 2DFBA 4D69A 2OW4A 5FIXA 1WMXA 3OF1A 1MS8A 2ZGSA 4KQ7A 3ZFEA 2WYSA 4QX8A 1AYN2 3C3VA 5FXXA 4AI3A 3VBOC 2R6QA 3N7MA 4X8NA 1GQHA 2CU5A 3M3EA 4JVAA 3VDDA 2J42A 4FFGA 4OUMA 3WVJA 2MEV3 3VBFB 1J58A 2Q8EA 2AEYA 4KNCA 3OD0A 1XNCA 5EJZB 2VMIA 4HKLA 5DMYA 2R1BA 3DPRC 3JBG2 2E7QA 4BA6A 1PZ9A 4KH9A 4P9XA 1EPWA 5JSPA 1IKPA 2PN5A 4LKEA 5FP7A 3VBUC 5C33A 5ANQA 1VALA 1MVEA 1KJLA 1RUJ3 4CUGA 3IWZA 1JZ3A 1MZ5A 3I7DA 3GF6A 4AVAA 3OBTA 4KGQA 2YFZA 3FHAA 3AYDA 3O1SA 1IS3A 4IV3B 4L92A 1CAXB 1LKNA 4RGAA 5CFDB 4FOVA 2DYCA 2PAKA 1HV1A 3AKQA 4IE6A 3ZFFC 1ODNA 2JDZA 2PMWB 2XXZA 4FT8A 2QJVA 3I3MA 4AQSA 1FX5A 2ZMLA 1ZZCA 2ETEA 4YZ1A 3RZHA 2ZABA 2GNBA 4BHPA 4CDWB 2P4EA 3AYCA 2YHJA 1QJY2 4HSLA 2B7YA 1VBC2 4LO5B 4SLIA 5DN2A 3N7LA 4OHVA 3WDWA 2WLQA 3FHIB 4G9SB 4E4DX 5FCCA 4RQPB 1APNA 3ZSJA 4EROA 4KBZA 5KXEA 3IMMA 1OOPA 2K2SA 4NWVA 3DUIA 1N3PA 5DQ0A 4CCCA 1DYKA 4CUCA 2Z69A 5D2AA 3V0BA 3IAQA 1AR81 1CN1A 5K0UC 3RZJA 1AL22 2ZGOA 3MIGA 3VD5A 3AYAA 1T6BX 1LU1A 4WVWA 4OQ9A 1QIQA 3I59A 3DV8A 3MDPA 1U5IA 1TMF3 3P3NA 4GD4A 4C1WA 1RUE2 1LULA 3E5QA 4LO4B 3SQOA 1AYN1 2NN8A 4ZU7A 3FUQA 1J59A 1GQGA 1SG3A 2XGXA 4YM2A 2PHDA 1S0JA 4PF5A 4GXLA 5GLUA 3ENRA 5T50A 1FV2A 4JGZB 4IV1C 1DU3D 1G9BA 1F5JA 2A3XA 4Q0QA 1QXRA 4QGNA 2RR12 1MQTC 3EXUA 3LDKA 3M3QA 5FZKA 1ND3A 4WM7B 4M4RA 1CQ9A 3VD4A 1NA1A 4XDOA 1W6NB 3JBG1 3OGRA 1F35A 3HOBA 4DEVA 5IATA 5JI9A 1V9U3 1N3QA 4OHXA 4XFIA 5EYYA 3TEXA 4S2FA 1YFWA 3Q8FA 4AQTA 4NHMA 3LIHA 2FQPA 3ES1A 2BVVA 5FWJA 2NZ9A 3T4VA 4OZOA 3UGFA 2RDQA 4WVMB 3NSTA 4MHRA 3PDQA 2FHRA 3ZLIA 4LO6B 4AG4A 1E5SA 2J1UA 4JKKA 2ZTNA 4ATEA 2JDMA 1VE0A 2AZ5A 2Y6FA 3ZFGB 1UPIA 2JG8A 4D94A 2ZHKA 4AZZA 4A6OA 3OD4A 5BYNA 3GZEA 5IJRA 5LRSA 4BQXA 1QQP2 3WDYA 1KXGA 3IIAA 4DRRA 1X7NA 1JTZX 4TLGA 3VBSC 1A8MA 1UZYA 1ND2B 2VULA 4KG0A 2DF7A 1LESA 4QKDA 1Q5OA 4B1LA 4XDPA 1GNHA 1QJY1 4KGGA 3ETQA 4LBNA 2RMU1 1YRZA 3MW3A 4XFHA 5F2WA 2VCMA 4QB1A 1HRV2 2DTWA 3O12A 4EN6B 1GWKA 3LOIA 3INAA 3AM2A 3ON7A 3RYPA 4AVTA 2XQRA 1UW8A 4XACA 2DUQA 1URXA 4B1MA 3IN9A 2WT1A 4LBQB 4XF4A 2BVBA 3SXWA 1AL21 1VBE3 4AE2A 3J8F3 3VL8A 3Q9OA 3PNAA 1PK6C 4FFIA 1C1LA 3N9PA 3RZKA 3JD71 4QKNA 4XCBA 1DGRA 1RUE1 4NWWA 2W5FA 2YC2A 4PLOA 5FP9A 4PI0A 1UXXX 1W0OA 2FD8A 2OVUA 1ASJ2 3B93A 3ZYIB 1B35C 1QJX3 3U11A 4B29A 2JB8A 4J25A 2RR11 3ZXJA 4A6SA 2Y0IA 2L9LA 2LRPA 4W65A 1G6NA 5LZ6A 2E7TA 2ERFA 3ZSEA 1UY1A 4WZCA 5DPNA 4SBVA 1XC6A 3N9NA 4IE4A 4CDQA 1RMU2 2VQAA 3KT4A 1OF4A 5FZDA 2BNOA 4H7MA 5LK7B 1L7LA 1W6OA 1GOFA 2UY8A 2E26A 5T55A 4N53A 5DABA 4DZGA 3OSDA 4K1YA 4HANA 2XQXA 1HB1A 3HBKA 5FDBA 1ZBE1 2ADEA 3L2YA 1LEDA 2ZGTA 1X9TA 1UMIA 2RDNA 4Y3OA 4AHZA 5BNPA 1ZRDA 5CFCC 1I9RA 1FOD2 5FREA 1WWYA 1JYIA 1CAWA 3AP5A 1PZ7A 4PDWA 1LRHA 1W8OA 4Y1XA 2P3IA 1IPJA 1UN1A 2BEOA 4HZFA 4I3GA 2BP6A 3I3QA 1WCQA 1Y7BA 1HRV1 4OMCA 4Z2AA 3LOBA 1WZXA 1LHNA 1MS3A 3MO4A 5LBFA 1VRH1 4OUEA 2AGSA 1CPNA 2CDOA 4MGKE 1DQ5A 1O5UA 1YNAA 3OUIA 1GLHA 3AB0A 4GMP0 4NPRA 1NY72 3SEPA 2QQJA 2W0XA 4GAZA 3VD7A 1AF9A 3ASIA 4NAOA 5JR2A 3PUIA 1R1A2 2WZEA 5FY8A 2CY6A 5FPUA 4CEYA 4P5HA 1K5MC 1LU2A 4CU7A 3ZSMA 1S2EA 2VL4A 1ULDA 1W8WA 3VZLA 1OUSA 4Y20B 2FDJA 4QX3A 3HNBM 4IEXA 4Y5TA 3SMHA 4RS5B 2VZPA 3Q8EA 1D0GA 1UAIA 1XNTA 2CTVA 4NE9A 1JYNA 1JMUB 3DGTA 5BXXA 3O1RA 1WMDA 1RMU1 1YIFA 4BM8A 3LFMA 1QJFA 3DKWA 4QWNA 5F9TA 4CPBA 2IVJA 3N7KA 2XJTA 1GP6A 1P8JA 1AR83 4XFCA 5D8AB 4AEMA 4IE0A 1UU4A 1ZZ9A 5I0TA 3VDDC 4MLOA 4AFMA 3WV6A 4META 4QPIB 1UIJA 4Q0UA 4HK9A 3EQEA 5FZ4A 3W20A 5FKBA 5LW9A 2YBKA 2WSUA 4LITA 1FOD1 4QHZA 2DWRA 3HT2A 5FYBA 1ZBA2 3FZ3A 5J1XA 3ZR6A 4A42A 4NRPA 4HMZA 3ZYFA 4KBBA 4RGKA 3OGJA 3PUHA 4Y22B 4A7ZA 5CA6A 5L7OA 4QX7A 3TRSB 3WW3A 3RZLA 5CB7A 1BCXA 1MR5A 1H8TB 1BLZA 3ITQA 5A3OA 2WKKA 1HQNA 3J4UH 3JBG3 4XMAA 1DLCA 5F8PA 1WMEA 1UZZA 3B9CA 1UX7A 3R6SA 1BMV1 2WBKA 4UAPA 2EAKA 4UI9L 5CZKA 1PIV1 1NY71 3Q8BA 1XXNA 5HXMA 1LGNA 1FYUA 1MZ6A 3W21A 5A1AA 3RDIA 1BZWA 1TNRA 1XJAA 4LUKA 4WV8A 4FTSA 4QQOA 3WXPA 2W1SA 4OI4A 2H0BA 1YYNA 2VCAA 1LGCA 3HBZA 4YYOA 2IXJA 3BOPA 2PFWA 1AL0G 1G9DA 1DGLA 1PX4A 1FAYA 1VBC3 2F6BA 4GWMA 4YARA 3LFIA 4OULA 5A3UA 4FPFA 5I8SA 4ZXEA 2QDNA 5C4WA 3IPVA 3WX5A 4CEWB 5LEJA 2W9XA 4MG2A 5F7UA 2ZJCA 4Y1VA 4FAGA 1UQXA 5GZGA 4PLNA 1JU4A 1W6MA 2NLRA 1HKDA 4UW3A 3SLIA 4QX1A 2VQUA 5IVFA 1ZM1A 1K12A 3NMBA 5BNQA 1ND3C 1RUE3 2D93A 3MPBA 3ZXLA 2BPA2 1NA1C 4INDA 1F15A 5JZGC 4JGYA 1EAH2 1OQEA 1ZBA1 3ELNA 1W2NA 2RS31 4UFKA 1JUIA 4DMIA 1M06G 5BNNA 1TZOA 1XE7A 2RR13 1TE1B 2ZA9A 5FY1A 5IVBA 5K9YA 3ZPOA 4MXWA 2LALA 4AHWA 4YW6A 1RUI2 4B3NA 2JIGA 1H2KA 1TVGA 2BOJA 1UMZA 4C91A 4W6YA 5CIRA 5IAVA 3AMPA 1GZWA 1QDOA 1EUTA 2CWSA 2JG8C 2QDRA 4NUBA 1UIKA 4XIOA 4URTA 5KC5A 3AZYA 2Q1ZB 3OTFA 4RSUA 3BIEA 2QQKA 4YNIA 3APBA 4CCLA 1COV2 1VBD2 3AP7A 5DAXA 1ZNPA 3SCHA 3AC0A 1EP0A 4DIQA 4KWJA 1WW4A 1LNSA 2YU1A 3VD3A 1S0EA 1NE4A 1LHOA 1QQP3 1J3PA 5I0RA 5KC6A 3O0VA 5KBFA 5DDJ2 1V6NA 4JZRA 5A7OA 2EICA 5CBLA 4OQ8A 3ACHA 2YG0A 1BEV2 1W05A 4ZU5A 5FQ0A 2K46A 1BVP1 2X5IC 2G9GA 1LR5A 2XDVA 3MV11 3MGUA 4MH0E 5A7WB 1HRV3 5ACA2 2V72A 4JC1A 3BKZA 3BTYA 3THCA 3QBQA 3VHPA 4YVWA 1ULGA 5A3TA 1GSLA 1Z7S3 1GOHA 3ZYJB 1C5HA 1PX3A 4XYXA
chains in the Genus database with same CATH topology
4LE3A 2XJPA 3VKNA 4COVA 1R082 3FMGA 3WQ1A 3O5SA 1EAH1 4AVSA 1ASJ3 4CDQC 1Q8QA 1N47A 2A6XA 3ILNA 1OQ1A 1YFXA 1YIPA 3BODA 2BFUS 3NAPB 4KU8A 1RUI1 2WNVB 4YM3A 1ONAA 2ZOEB 4Q1RA 3KM5A 4QM8A 3L9JT 1HDKA 5IK8A 3MLLA 2VOXA 2XL7A 4GMP1 1D0HA 4BMBA 1H1IA 2C1FA 3POSA 3CEWA 1ZREA 2ZHMA 4COWA 3ACLA 3M3IA 2ZX2A 1COV1 1VBD1 4J1XA 2R073 2WNUB 4QGLA 4PDWC 4HSJA 4FSJA 4R9AA 1D2SA 3S7IA 2D6LX 4M0NA 3BB6A 4AI0A 2XJRA 3LKJA 1AUYA 1BEV1 1RUD2 1WLWA 3GZUC 3M8LA 5HCBA 5E1RA 3BIWE 1CAUB 2BFUL 1QY4A 1H8VA 4K9SA 5ACA1 2D43A 2GMMA 1RIRA 3VN4A 4E2QA 2CNAA 1RC6A 2XVGA 1HQWA 1NZCA 4CEYC 4LT5A 2VGDA 1UF2C 1VB4A 3MI8A 1SEFA 2D40A 1FPN2 2NPIA 2RS12 2Q8OA 2ZAAA 5AC91 5KHGA 2EAAA 4LA2A 1ALYA 2VMHA 4FPGA 1R1A3 1OI6A 5JIAA 3VBRC 4Q4W2 1PGSA 4DS0A 5CU1A 1O91A 2A6YA 2ZMNA 5BNOB 1L3JA 4AFAA 3WP5A 3WG1A 3MIHA 1BQPA 2D7FA 2E53A 3TOJA 1WGPA 3WDXA 4HBNA 4BIOA 4P9WA 2V09A 1CIWA 5C9AB 5GALA 4IEUA 1NCRC 2DV9A 4FBFA 3D6EA 3FFZA 3VHRA 4GKXA 2R042 4L97A 1LOFA 1LOBA 3FX3A 2ZX1A 4L9BA 4AEDB 2WFF2 3H0OA 4FQ4A 1AR92 1OA2A 1ZBA3 4IEVA 4X8PA 4K7JA 2YYOA 1J3QA 2OUHA 1XU2A 2Z79A 3VBFA 3R0RA 4XTPA 5L36A 4MX3A 2JD4A 3CF6E 1A6CA 3OY8A 1FATA 4Y1UA 1PO22 4FTBA 4MV2A 1D4VB 5KHHA 3AP9A 4IV3A 2ARXA 2ET1A 2UYAA 5CFDA 4UXAA 3CJIA 4Q4W1 2X29A 3FLRA 4RR3C 5DUXA 2PHTA 2VNRA 1D4M2 4LBKA 3WHUA 2QNKA 1NQJA 1X8EA 2VVFA 5JR7B 2VW0A 3SH3A 2A5ZA 4K40A 4CDWA 1W2UA 4N7UA 5T5JA 1X8MA 1RUH3 2NP0A 3W9AA 1H1MA 2GNTA 3ZSLA 3V56A 2XBO2 4RQPA 1DHKB 3ZDSA 4JGYC 3N4MA 5L73A 3QOPA 3JB8A 4H3WA 2IWGB 3SNMA 1SLLA 2R041 3ATGA 3E6CC 3MIBA 1QWRA 2DVBA 4AGVA 1EAH3 1A3KA 2WFF1 1LOAA 1AR91 2ES3A 1TQ5A 1UD1A 2JENA 2Q4SA 4JGZA 1R092 2VXRA 1LB2A 1RJ7A 4AW7A 3AMQA 2Z42A 4WM7A 2V73A 2IXHA 1W6NA 3WP3A 4IQPA 2I07B 5AVPA 3UKTA 3ZXEA 3ZXFA 4KWKA 4GH4B 3H3UA 4COZA 5J09A 4GMP3 1XYPA 3RJRA 1VP6A 3WG4A 4MGYE 5JPNB 4OUSA 1COV3 2VNOA 2XLFA 5ABJB 3SH5A 1CVNA 1UKRA 1UU6A 2RE9A 3GBWA 4X6QB 2HWB2 2HWE1 3ZFGA 1MZFA 4LHLA 3CLPA 4XIKA 4FPCA 1D4M1 4Q29A 2N7GA 5DDJ3 1MVQA 5FO9B 1ULEA 1BEV3 4YVWC 1NG0A 1ND2A 1H4GA 5DUWA 3ZN6A 5CAZA 2XBO1 1VBB2 3JCIA 3OCPA 4DRVA 2JX9A 5JMCA 2DVFA 2QUOA 4I0BA 4CDXB 4LBQA 3ECQA 5A3LA 5FLIA 4KU7A 3WW2A 1C8NA 1QHDA 2YDEA 4NO4A 5KXCA 1Q8SA 4B8EA 1R083 3UL2A 1ZZ8A 4C0BA 2HYKA 4D7TA 3WINE 1GFF2 2AR6A 3VBOB 1QOTA 4AVBA 3RRDA 1R091 2VG9A 4XF9A 2I2SA 2VVDA 3TAYA 3LB9A 4ASMB 2XB6C 3E5XA 4M0HA 4HPKB 3DPRB 2PTMA 1XNDA 3PHMA 3RPQA 1QDCA 4IEPA 1V6LA 2VU9A 3EBRA 1XQNA 3VBUB 4LHNA 4Z07A 4XFFA 1I3HA 2WSVA 1WBLA 1A8DA 3AJYA 2HWB1 5FOJB 2NMOA 4L99A 4LUMA 5C8CA 2HEYF 1RHI2 4XZPA 3ZFFB 2ZGPA 2UWAA 4DB5A 4XXPA 4GB32 2JKBA 2XJVA 1CONA 4XJZA 3VGIA 2GZWA 1RUD3 3WCSA 1AR73 2D6OX 4Q4V2 3OJBA 4DPNA 1C57A 1O3TA 1YO8A 2P3KA 1U5XA 1VBB1 3IDCB 2B9UA 2PELA 4HKOA 4Q4X3 1QJU3 2DU1A 1MS9A 4RL7A 3NV1A 2VUAA 1FPN3 4R4XA 2RS13 3H1WA 2E7AA 5K0UB 2ARBA 3B7MA 4PIXA 2TBVA 1Y9QA 2B5HA 2XHKA 2XVLA 1V6IA 1WD4A 4UW4A 2MNGA 4Q4W3 2DU0A 4YZ3A 4FPHA 4W6WA 3LA3A 3H1MA 3O0XA 3QACA 2G4IA 4YGCA 2R062 3WDVA 1MQTB 4OI2A 4RS5A 3S30A 4EWAA 2RMU2 5I0SA 1HLCA 1OKQA 1GZ9A 5A32B 3G6JB 4IESA 1OFSA 1AXKA 3LA7A 4S2GA 3GBGA 3ZPYA 3PTYA 1TEIA 3MIEA 5EFUA 4AI1A 4YSFA 4JV4A 5D8AA 3M3OA 3MZHA 3HN1A 1AHSA 3CU7A 2WJSA 2R043 5EWSA 3JD72 2YROA 3I2DA 2GNDA 1RHI1 4QPIA 2ZZQA 3U07A 4Q26A 3I4IA 4I2OA 1AYM3 4GB31 1W6PA 3HAGA 3X29B 1O5LA 3VBSB 4Y22A 4LBOA 4BMEA 3TN93 4Q4V1 1H8TA 1PNFA 2HWF3 4M01A 1LGBA 5FMOS 3SISA 4R9CA 1TME2 2Q0AA 2QE3A 5CFDC 3FE5A 1OPOA 4CP1A 1CAVA 3CJIC 1REDA 3KS7A 3VBHC 4KG8A 2DCJA 1LTEA 1PO23 3E6DA 4WVVA 1SQ4A 4IEYA 1PK6B 3AMMA 1LODA 4XJUA 1ZBE2 1KS5A 1AX1A 1MZEA 1D4M3 3USUA 1B35B 2I74A 4WBBA 2R061 3EO6A 4XFGA 5FOBB 4Q4Y3 5GM0A 2PHLA 1G7YA 5FMOL 1PO12 5FAXA 2XBO3 1VRH2 3CO2A 3VL9A 2RM22 3VZOA 4CEWA 5T3NA 4GIQA 2VW1A 1VJ2A 2P2KA 3L2HA 3AKRA 4YVSC 4EN7B 4AYUA 3KMHA 1FMD2 1Y3TA 1QMJA 4ORFA 5CFCB 2VH9A 3ZXKA 4FPKA 4WM8C 3HIFA 2AENA 3URFA 1R093 3MEPA 3LWCA 4S2HA 2ZMKA 1SCSA 4CRQA 3ZX7A 1YJLA 1TME1 1ENQA 2VW2A 3O14A 4XOGA 5CADA 5AFEA 2D6PA 2BBVA 3THTA 4C0HA 5I91A 1C4RA 1KS4A 5T54A 4ZU4A 2HWB3 1C1FA 1IZ3A 4HVQA 2WFPA 2CYFA 4AK3A 4HT1T 4N43C 5GZCA 1K5MB 4LR4A 4XQWA 4FPOB 3CL1A 1AVBA 1EPZA 4Z2WA 3ZYRA 2EXHA 2PHUA 2WT0A 4FTEA 4FQZA 1RUC2 4FOWA 2XLAA 4BQ1A 4OI0A 1JXNA 2WC2A 2OA2A 5FO7B 5BPXA 1LHVA 1PO11 2ZACA 2A71A 2EXJA 5I8YA 2G9FA 2RM21 1BMV2 3AZVA 1S0BA 1NLRA 1HX6A 1PIV2 3I8TA 3MIDA 1F8VA 1POV0 3POWA 2PHWA 3VDDB 2BTVC 4M3CE 4A7KA 3MF9A 1FMD1 2JG9A 1MACA 2UY9A 3N3HA 4RHV2 1CR7A 4GKYA 1MS5A 1XNKA 3V0AA 5BV6A 1LCLA 1S2BA 4MGZE 1RUG1 4IEQA 3LAGA 3WUDA 2RHPA 2YC0A 3NAPA 1H0BA 2WNVA 3HT1A 3EHKA 1SACA 3M70A 4I0AA 1I5ZA 4PBOA 3TWIA 3ZFEC 3H7YA 5C8CC 4R4ZA 2D3PA 3RMXA 5GLVA 1AZDA 1BVVA 2WNUA 4XMIA 4D7SA 3VUOA 3NV3A 4E2SA 1GZCA 1AYN3 1RHI3 3MFCA 1LENA 4GB33 5EV7A 2YV8A 5HCFA 1WW5A 1HXS2 2RS32 2QKDA 3K48A 1S55A 3NW4A 2GN7A 1FXZA 2HEWF 1SFNA 5IK5A 4HL0A 1OLRA 5DXDA 1CAUA 1DGWX 1RUC1 4Q4V3 3WG2A 1PNGA 4M3CB 4XJAA 1Q8PA 2PHFA 1OPMA 1UU5A 2HKXA 3T1LA 2ZKLA 1RUF2 3AYEA 1YFYA 2Y26A 3AZXA 5GLWA 1RVF2 2DURA 2VOVA 2ZGMA 4LLOA 5CNAA 5JSRA 2E63A 2LTNA 4AEKA 3O7OA 1E57A 1SBFA 1GNZA 4NN0A 1AX0A 4RS5C 3WNXA 3VZMA 4RHV1 1NA1B 4P14A 1KFXL 2X8KA 5JZGB 1BBT2 1MS4A 4YW1A 1OOPC 2GMPA 3D0SA 4MYEA 2R063 2EA7A 1QJY3 1PVC2 2RMU3 3O0WA 4QPGA 4HETA 1OA4A 4BPZA 2DCZA 1QH6A 1F2NA 3D4KA 3J26N 2JG8B 5C9AA 3B9IA 1JOJA 4IXLA 1AL23 4F3JA 5GZDA 5FLHA 3JD73 2VOKA 3ES4A 2ZS6B 3RQ0A 1HXS1 3ZN4A 4LEJA 3BPZA 1NCQB 2YY1A 3WT3A 2O1QA 4PIYA 4K21A 2GMEA 2X5IB 5GLTA 1IHMA 4AHXA 1KRIA 3WHTA 1WW7A 1GICA 1RUF1 4FO9A 4FPEA 5A33B 2GC0A 1JN2P 3HMYA 4XF0A 1RVF1 4TWTA 1CD3G 4PQ9A 3BOWA 4ATFA 1V70A 4M3CF 4CDUA 1UCXA 4XBLA 3ME2A 4LBQD 4YM0A 1YI7A 1ZBE3 1QXPA 2P17A 3VZJA 2A70A 3ZIWA 1WW6A 1BBT1 1OD5A 4P9GA 4CDQB 1IS6A 4F8AA 1PVC1 1N1SA 1N1VA 2R0FA 2NMNA 3NWKA 4PIZA 1PO13 4LBMA 2FMYA 1MS0A 1VRH3 2D6KA 2RM23 3PMEA 4O9EA 2UYBA 3B94A 1DQ1A 4KL1A 3ZYGA 1H2MA 4AVVA 5JVVA 4DFSA 1SMVA 3NV4A 3BCWA 4N9IA 5E89A 5AC92 2GC2A 3NVCA 4PJYA 4B4QA 1ENRA 4PDWB 1VB2A 3S6PA 3PJQA 3WW4A 4IERA 2FZ1A 1CX4A 5EYXA 1D2QA 1SCRA 2WWSA 3VHOA 2VUJA 4WZFA 3R4UA 1SBEA 2QVSB 3BU7A 4IL7A 4XHXA 4N53C 1U12A 2OIIA 1ZRFA 4NOTA 1RMU3 1LOGA 3H7JA 4DOUA 3OYWB 4GH4A 4XDQA 5BNPC 1POV1 5DZGA 3VZNA 1HRI2 2VY0A 1NXMA 4L8QA 1G86A 4UBHA 5ABJA 3AJZA 4AEJA 2VNGA 5JI7A 1OHFA 3OPZA 1FOD3 1YJKA 3VBRB 2LUWA 2OZ6A 3AK0A 2WZR2 3KCCA 4EWEA 2D5HA 2IFWA 4HFSA 3RSJA 1RUC3 5GJ6A 3H50A 1SLIA 2P3JA 5DG1A 3LA2A 2I45A 2ZGNA 2XJSA 4YFZA 5TSWA 2JG9C 2WQZC 5J3UA 1JW6A 2WS92 1PIV3 5GKAC 1NCRB 2XJQA 3WR0A 4E27A 3ZYPA 1DQ6A 2QCSB 1WCSA 2KA3A 2YXSA 4XXAA 4PCRA 5IK4A 3W58A 2E9QA 1RITA 4J6GA 4M00A 1N1TA 3VBOA 4E4SA 4ES9A 2W39A 2ZGUA 3DF0A 3A0KA 1W6QA 3FLPA 3WOGA 2WIIB 4HPKA 3DPRA 2K0GA 4R9DA 3WQ0A 4Y26A 3T1MA 1H2LA 1VIWB 1HRI1 3VBUA 1LEMA 3DL3A 4TSVA 2JEMA 1REEA 5L7OC 1RINA 3TBDA 1DZRA 1U5ZA 2CGOA 4QT6A 3N36A 1M4WA 2QFEA 4QMAA 4ZKTB 1FNYA 3ALQA 3ZFFA 1YXWA 1HXS3 2RS33 2WZR1 5D1IA 4RR3B 4Q0VA 4HN0A 2BUKA 4GQ7A 2QZ2A 5CG9A 1GR3A 4QPYA 4PBPA 2Q30A 4D3WA 4P9YA 1G8WA 1F31A 1RUF3 2VQ0A 5AVAA 3IDEA 4QGMA 3WLUA 2CWMA 3AKTA 4W6XA 3AFKA 3MW4A 3JZVA 2WS91 2E6VA 1RVF3 1H9WA 2DUPA 5K0UA 1N1YA 3NKGA 1CAXA 4H55A 4K20A 1FI2A 3FWEA 1RB8G 2HWE2 4QPGC 1HIXA 4AI2A 1S0IA 4OLLA 3J9SA 2D6MA 1IQAA 4CP0A 5C4WC 2ZX0A 3AMHA 3WP6A 1V9U2 1GZWB 1V00A 5C9AC 1C8M2 1PVC3 1V6MA 5I8TA 1MQTA 2YUEA 2H6BA 3AP6A 5F1RA 3ZN5A 1F9KA 4OZXA 4YG0A 3UJQA 2ZHNA 1JH5A 5A32A 3ZXGA 4QM9A 3PJYA 3W59A 1W39A 2DCTA 4CTEA 2AREA 2IXKA 3I54A 2A6ZA 5GZFA 5BNNC 2A73B 2TEPA 1RUNA 3ILRA 4FPJA 4XFBA 4GWNA 1DDLA 1SLBA 5JLVA 1CPMA 1Z0HA 2JXAA 1ULCA 1QU0A 3GYDA 3VBSA 4NHLA 4FP2A 4YVWB 4IETA 1RUI3 2MHFA 2ILMA 3PVOA 5E88A 1PM7A 3WDTA 4CDUC 2B42B 4A2UA 3J8F2 3B69A 2XG3A 1OA3A 3JU9A 3V65A 3VLBB 3KT7A 1POV3 1LECA 4LE4A 4WVMA 2CV6A 1VBD3 3MYXA 4FP3A 1QJX2 1NLSA 5F6KA 1KD7A 1PK6A 4YRDA 2CAVA 4OFGA 5JOZA 3ROUA 2Q1MA 4KWLA 1V9U1 1B35A 2C5DA 1U5YA 3MLKA 3RZZA 3ZSKA 1C8M1 1DG6A 3ZXAC 2ZGKA 5ACA3 1X36A 2FBEA 3SHRA 2XJUA 2JE7A 2R30A 2NM1A 2W08A 4ONUA 1QF3A 4Y5Z0 5LK5A 1DZQA 1LHWA 2RJKA 3GNEA 2HWD2 5AC93 1O4YA 1S0DA 1OQDA 1DIWA 3WZ1A 4I01A 1O4ZA 5H9PA 2IFRA 4H14A 4HVOA 1X50A 4BYYA 3S7EA 4GH4C 2BNMA 1V6KA 1C5IA 2GH8A 2Q5TA 2XKOA 4IEWA 3QH7A 3NV2A 2LM3A 2VPVA 2EALA 4NVPA 5H9QA 1YUDA 2HWC2 3J8F1 2Z2SB 2JJ6A 2GNMA 1GKBA 1PGL2 2ZZJA 1JUHA 1XE8A 2PYTA 3HWJA 5KWRA 1VAKA 3AZWA 1XYNA 2XL9A 4N9HA 1QJX1 4LULA 3JUUA 4MSVA 3KGZA 3ZIXA 2WZR3 3IM0A 5CG8A 4B4RA 1K5MA 1ENSA 1X82A 1BK1A 4I30A 2VOWA 3KCYA 1SLCA 5AFBA 4OI1A 3WDUA 2EF6A 4YM1A 2WT2A 5KHIA 1ZZBA 3B3QE 5JIUA 3U0ZA 2GH2A 1DQ2A 1G9FA 1WLDA 3WUCA 2BWAA 2WS93 3SCFA 2HWD1 2DVAA 2DCKA 4XILA 2C9AA 1NOVA 2P37A 4Z92B 5T5LA 5IK7A 2ATFA 1GBGA 2PLV2 2D98A 3EJKA 2Y38A 3IT8A 4IV1B 3HR9A 4Y20A 3GHMA 5F5QA 4LA3A 3OY8B 1CGPA 1MS1A 4MVTA 1OSGA 2HWC1 3CNAA 2WA3A 3KD4A 4UBGA 1PGL1 3E6BA 3UKNA 5C8WA 1LOFC 1O3SA 1V6OA 1HQLA 1Q3EA 3CJIB 3GHNA 3VBHB 4EV0A 2DVDA 2HJIA 4C90A 5SV8A 2SLIA 3H9AA 4GA9A 1IPKA 3IBMA 3VBFC 5EJ3A 2AH2A 2XKPA 2WFF3 1AR93 4WVZA 3FLTA 5KXDA 3LSEA 1PGW2 4FXGB 1UPSA 5JDBA 2ZX4A 4JQRA 4Q27A 4JTOA 4FOYA 4M3CA 1NYWA 2O8QA 3KSCA 4IV3C 3BTAA 3N35A 4P9LA 3VZKA 4RFT0 3QH6A 5HBAA 4ES8A 1OLQA 4HLTA 2F4PA 4PLMA 3M4FA 4YG6A 2JE9A 2PAEA 2BYVE 1SFYA 5I0UA 5J96B 4CDWC 1LOCA 2HWE3 4L11A 4YVSB 3RWNA 1BXHA 4MGIE 1AR62 2A6VA 4FPYA 2RJLA 5JZGA 4RQPC 3D82A 2PLV1 2YGMA 3UJOA 4WM8B 4Z1VA 1C8M3 4Q2FA 4FCAA 3NL1A 4FVVA 4HKWA 2B39A 2ZKNA 4A7YA 4LLFA 1DF0A 3RYRA 2OPKA 3PMSA 4QXKA 2D44A 3E5UA 4Y1ZA 4JAAA 1O3QA 1F5FA 1WCKA 1RUOA 2GAUA 4E4ZA 5DZEA 5J7MA 5CVRA 4Y4YA 2WQ4A 2AYHA 3PVNA 1DQ0A 4JGZC 3WCRA 3IDBB 1SLAA 4AXOA 4BOWA 4WM7C 1CESA 1VBC1 3MIFA 2FZ2A 3PLQA 4B7KA 3QLQA 3TB0A 3ZN6B 1PGW1 4N43B 5LRRA 3AMNA 5F6LB 1ZRRA 4AQ6A 5E16A 1RUG2 5J36A 1H1AA 2NQYA 4JCKA 1NCQA 3LCPA 4DY3A 5JOWA 1ZVFA 1Z7S2 2X5IA 2R49A 4ISRA 3MICA 3ZFGC 5A33A 4EN9B 5EZWA 5FRAA 2R16A 1ZRCA 1DZTA 2GC1A 3NKTA 5E8AA 2SBAA 1QGLA 4F83A 1MEC2 1EY2A 1ND2C 1SLTA 3ZXDA 4ZXKA 4I3PA 3OBRA 1HW5A 2A3WA 1YWKA 2EVXA 1AR61 2W68A 4XE9A 1Y43B 4HN1A 1VAMA 5SV5A 3IMNA 3VKMA 5JAXA 4AFCA 5L19A 4NHKA 4XHBA 2DFCA 2OYZA 1Z78A 5C6CA 1IS5A 2ZBJA 2W52A 1KDMA 1VBB3 3M2MA 2R072 1KITA 1I1EA 1KFUL 1AX2A 2UU8A 3ZFEB 1C28A 5C8CB 4LBLA 1H30A 1QQP1 2HWD3 3MPPG 5KHKA 4LO7A 3WD5A 1RL3A 1EV12 3U10A 4S2DA 1WCDJ 1J1TA 2GALA 3ILFA 2XWJB 1X33A 4UW5A 3KZ4C 3RNSA 3M7AA 4R52A 5K8SA 4XF1A 1Z7S1 2HWC3 4EN8B 1ZYBA 4YW3A 3GBFA 2KM2A 2H6CA 2VVEA 1KQRA 2BWCA 3OYWA 2QZ3A 4E9KA 4K1ZA 1ASJ1 1UX6A 4C1XA 1MEC1 2IZWA