1RVF1

Fab complexed with intact human rhinovirus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 32
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf100
4SBVA 2HWF3 4AEDC 1RUC2 1RUI2 2RMU2 1MEC3 2RMU3 4RHV1 5D8AA 4CDQC 1RUF2 2WZR3 1ASJ1 3VBSA 1TME2 4YVWB 1ZBA1 5DDJ2 5DDJ3 3VDDB 5GKAC 5C9AB 4Q4X2 1FOD2 3JBG1 4CDXA 4QPIA 3ZFGC 3JD71 1QQP3 1AL0G 1EV12 5C4WA 5L7OB 1RUG1 1RUD1 3IDEA 4GH4C 4N53A 2GSYA 5BNNB 5AC93 2RM22 3VDDC 3J8F3 1X33A 4RS5B 4IV1B 1VRH2 1VRH3 1AR81 1QJX2 2BFUL 1FMD1 1IHMA 5A33A 2HWC2 3FBMA 1B35A 1BBT1 2HWC3 3VBRC 5ACA1 1AYN1 1RVF3 1AR73 1VBA2 4Y4YA 1NY72 3DPRC 4Q4Y3 1QJU2 5L7OC 1F2NA 5BNPB 1C8M2 3HAGA 4Q4W2 4Q4W3 1RUC1 1RUI1 4CEYB 4Q4V3 1RUF1 1D4M2 1TME1 2MEV3 1AR92 2ZTNA 5DDJ1 5C8CB 4CEWB 4Q4X1 1FOD1 2TBVA 1HXS2 4CDQA 1VAKA 5LK7B 1A6CA 2RS12 5CFCA 2HWB2 5JZGA 4CDXC 3ZXAC 1EV11 2RS52 1PGW1 2DF7A 5C8CC 4CEWC 2RM21 1AL22 4N53C 5BNOC 1VRH1 1R083 1QJX1 2HWC1 1NA1B 4YVWA 5FMOS 2PLV3 1VBA1 1NY71 1QJU1 3VDDA 1QJY1 4PDWB 5C9AA 1C8M1 1QJZA 1OPOA 4Q4W1 1RUE2 1RUE3 3VBOB 1D4M1 1HRI1 3ZFFB 2RS33 5L7OA 1RMU2 1AR91 1ND3B 1HXS1 5BNNA 4QPGB 2WLPA 4RS5A 2HWF2 4IV1A 4GB33 1MEC2 2RS11 2HWB1 5FMOL 2WZR2 2R063 1H8TB 3NAPB 3TN93 1ND2B 2XBO3 1V9U1 2RS51 5CFCC 5JZGC 2RR13 3VBFB 3ZFFC 4BCUA 2BFUS 3ZFEB 4EJRA 5K0UB 1ND3C 5BNPA 2FZ1A 2R072 1AL21 2HWE3 2R073 4CEYA 2XPJA 4YVSB 4RFT0 5FOJB 1Z7S1 3VBHB 1QQP2 1PGL2 1TMF3 1H8TC 2IZWA 3NAPC 5C8CA 4CDUB 1ZBE3 1VBD1 4CEWA 1RB8G 4IV3B 4NWVA 4YVWC 5BNOA 4JGYB 5AC92 1GFF2 1RUE1 3J8F2 2R041 1SMVA 5C9AC 1NOVA 3VBUB 1BEV3 4Z92B 1HRV3 4GMP3 1RMU1 1RHI2 3JB4C 3VBHC 1RHI3 1K5MB 1RVF2 1AR72 1OOPB 4Q4Y2 1AR62 1DDLA 1COV2 1AR63 3S6PA 1COV3 1PO13 2HWF1 2BPA2 1MEC1 2RMU1 4Q4V2 1PIV3 5BNNC 2WZR1 3LOBA 4RS5C 2Y26A 4IV1C 1R1A3 1X36A 2MEV2 1NA1A 1POV3 1NCRB 4PDWA 4N43B 3VBOA 2GH8A 1FPN2 1VBE3 1FPN3 1VBB2 5BNPC 1VBB3 1MQTB 3ZFFA 1QQP1 1RUH3 4CEYC 1WCDJ 1PGL1 1NCQB 4RR3B 2HWD3 1C8NA 1ND3A 4RQPB 1EAH2 1R093 1EAH3 1AUYA 1AYM3 2WWSA 3M8LA 5CFDB 2WS93 5AC91 4QPGA 1PVC2 3J8F1 1PVC3 4JGZB 1R082 1VBC3 1H8TA 3NAPA 1ND2A 1E57A 4RHV2 4RHV3 4Y5Z0 1MQTC 4LLFA 2PLV2 1RVF1 3VBFA 1AR71 5ABJB 1ASJ2 2ZAHA 4WM8B 1ASJ3 4Q4Y1 3ZFEA 5K0UA 3CJIB 1ZBA3 4Q4V1 3JBG3 3VBHA 4JGZC 2MEV1 2RS32 4CDUA 4IV3A 1NA1C 1RUG3 1RUD3 4JGYA 4WM8C 4FTSA 4AEDB 4PDWC 4GB32 3VBUA 4GMP0 2R062 3VBOC 2FZ2A 3TN92 5A32B 2XBO2 1AR82 1AR83 1K5MA 2RR12 1OOPA 1FMD3 1VB2A 1BBT3 5ACA3 1AYN3 1PVC1 2HWE2 4WM7B 1R081 3ZFGB 1POV0 4QPGC 4FSJA 1RUC3 1RUI3 1CJDA 1NCRA 1TMF2 1RUF3 2PLV1 1ZBE2 4GH4B 1ND2C 1TME3 4N43A 4CDWB 3VBFC 2X5IB 1BMV2 3ZFEC 5K0UC 4Q4X3 1FOD3 1BEV2 1MQTA 4WM7C 1HRV2 4YVSC 1NCQA 2RS31 4RR3A 1VB4A 4RQPA 3VBRB 1HX6A 1RUJ2 1RUJ3 5CFDA 3DPRB 1EV13 4CDUC 1PGW2 1PO12 2BBVA 4IV3C 4JGZA 4GB31 4CDWC 1M06G 2X5IC 1PIV2 4JGYC 2R061 2RM23 3TN91 1R1A2 2XBO1 3VBUC 5D8AB 5ABJA 2RR11 1HQNA 4WM8A 1OHFA 1QJX3 4FTEA 3VBSB 3CJIA 2WFF2 2WFF3 1K5MC 1VBA3 1OOPC 2HWE1 2R071 1QJY2 1QJU3 1QJY3 1VBE2 1C8M3 2QQPA 4CDXB 4QPIB 1RUH2 1TMF1 2HWD2 2VQ0A 1R092 1ZBE1 1HRI2 1D4M3 1HRI3 4NWWA 1AYM2 1W39A 5D8AC 2WS92 1NCRC 5C4WB 1AR93 3VBSC 1BMV1 4AEDA 4N43C 1PO22 4N53B 1PO23 5BNOB 1HXS3 1VBC2 1BEV1 5J96B 1HRV1 4GMP1 5A32A 2RS13 2HWB3 1RHI1 1RUJ1 4QPIC 2BUKA 1NCQC 1V9U2 4RR3C 5A33B 1V9U3 2RS53 1B35B 4RQPC 1ZBA2 1AR61 1COV1 1PO11 5CFDC 4WM7A 5C4WC 4YVSA 3ZFGA 1PIV1 3JBG2 1AL23 1R1A1 1POV1 1Z7S2 1Z7S3 3JB8A 4GH4A 3JD72 3JD73 2ZZQA 2WFF1 4CDWA 1RUG2 1RUD2 5ABJC 2X5IA 1VBD2 1VBD3 5J98B 1VBE1 3CJIC 1B35C 1FPN1 1VBB1 4CDQB 1F8VA 2R042 1RUH1 2R043 1NG0A 2HWD1 3VBRA 5CFCB 5JZGB 1R091 1EAH1 1CD3G 1AYM1 3DPRA 1FMD2 2WS91 1RMU3 1BBT2 5ACA2 4FTBA 1AYN2 1PO21 1VBC1
chains in the Genus database with same CATH superfamily
3L2HA 5FKCA 2XJQA 3WDXA 1W8TA 5IVJA 2OW4A 1AVBA 2PFWA 4CCEA 2JIGA 3NO8A 4BMEA 1W2AX 3B3QE 3SH3A 2BWAA 2VPVA 4XFFA 1F5FA 3MIEA 3GNEA 3LWCA 5FZEA 1ASJ1 3Q9OA 3UETA 3W59A 3V0AA 2MPFA 3JU9A 3H3UA 2JG9C 4NO4A 4Q26A 4Y26A 4PBPA 1ZNPA 5GLWA 1UAIA 3SH5A 5F32A 4GWNA 2Z69A 5EIYB 2OUJA 1FOD2 4Q4X2 4IEPA 3POIA 4AHWA 4CDXA 5L36A 3BTAA 2VUDA 5F37A 1HQWA 2QQIA 1IS6A 4HSJA 2Q1MA 1MVQA 4J25A 1PZ9A 2XLGA 2XB6C 3V64A 2NLRA 5C3SA 2XJVA 1OI6A 1HV0A 4HMZA 3OY8B 4XCBA 2FHRA 2QQKA 3CMGA 3E5QA 4ZU7A 1IPJA 4N53A 4RL7A 3RFRA 5IATA 3EHKA 3NNJA 2R16A 3T0DA 1ZZ9A 1YJLA 1KDKA 2WT2A 3LA3A 4QXCA 5FY5A 1YFWA 3U75A 3VDDC 1Q56A 1VRH2 1NX9A 3TNQA 5A6XA 1YI9A 1AR81 5FO7B 3PUQA 4LORA 2JKXA 1R1ZA 5FZ1A 2C5DA 2HWC2 1YIPA 3FBMA 1B35A 2XJTA 2Y64A 2ZGOA 3OTFA 5FYUA 5HCFA 3VBRC 3VDCA 3WP6A 5ACA1 4HK9A 5FLHA 2GNTA 1HV1A 4H7LA 3MI8A 1CPMA 3AMHA 3MO4A 5FY9A 3SKJE 3T09A 5FPUA 4JRLA 5FXZA 3HAGA 2YBPA 1TVGA 3BIEA 1RUI1 3GJBA 5C33A 5T5JA 1UMIA 2ZS6B 2ZEZA 3K3NA 4NHYA 2VCAA 2CU5A 4AFMA 2BV4A 4BISA 2B8MA 1ZRRA 1Q3EA 2XMLA 5KXCA 1UY3A 4GWIA 2K2SA 3VDBA 1JYWA 1TNFA 1Y7BA 2UY8A 5F5QA 5FXWA 2OZJA 3UGFA 3HQXA 4BQ5A 3LIHA 4NMIA 1HXS2 5DUUA 1VAKA 4JHTA 4NHMA 4YZ3A 5AVPA 4IEWA 1JYTA 4LIUA 4UT5A 1DLCA 1QJFA 2R0FA 4BWOA 5CFCA 5HCAA 4OHYA 4QQPA 2QDRA 3P5BA 2ZX0A 1XRUA 2Q8OA 3I2KA 1ULEA 3ZXKA 4P9YA 2YPJA 3HR9A 1FV2A 3AYEA 3ZXAC 1DQ0A 1XPWA 1X9TA 3MIDA 4CYDA 5APAA 5F8PA 4L0PA 1GUIA 4IETA 1X7NA 2E7AA 1XQNA 2QZ3A 1C1LA 5FYIA 3RYPA 1SDDB 5C8CC 2RM21 2BGCA 4YLZA 5FBZA 2J1TA 3AZYA 5GZEA 4XIOA 5IVYA 1JYXA 1R083 3RZKA 2UYBA 2OPWA 4XETA 2Q4SA 1HJGA 4KWJA 1IQDC 4MZUA 4M0HA 5GLZA 4XEZA 1VJ2A 5FZMA 5FZOB 3USSA 5FXXA 1T6BX 5JDBA 1JUIA 3J7MA 1MS8A 3F95A 4LKDA 5D2AA 3BOPA 1W8OA 3WNOA 1Y9GA 1CN1A 1S0FA 4XHXA 2EXIA 3KHBA 5BUVA 1J1TA 3KS7A 3LF7A 4Q4W1 2WA3A 1RUE2 3EMRA 2JDZA 4QD2A 1YCIA 3MLKA 4IEYA 5HCHA 3I54A 4Q8LA 4XDQA 4CXWA 1GKBA 1NZCA 3BGAA 1D4M1 3VLBB 2VY0A 5I0UA 4AGGA 3X29B 2BWCA 4URTA 4M00A 1J3QA 3MPPG 3OY8A 4XYXA 1ND3B 4IUGA 3ZXEA 1W8FA 4BQWA 5A3OA 1SLBA 4JHZA 2WO7A 2E32A 4DEQA 3DECA 4AEMA 4D69A 2AC1A 3DXTA 4EWEA 1QOSA 4GB33 4BK4A 2RS11 1T2XA 2GP5A 2ZGNA 1JZ8A 3UJQA 1H8TB 1UXXX 1HIXA 5JMCA 2WWJA 3P6BA 4KG0A 3MGUA 3DEMA 3SQOA 3TN93 3ES1A 3N3HA 4WVVA 3CKHA 5EJ1B 1Q8OA 2RR13 2GN7A 2BTVC 3VBFB 3ZFFC 5I8TA 3ZSEA 4BCUA 3LDRA 4QKDA 5FQ0B 1PMHX 1UPIA 5A7OA 5A6QA 4YG6A 3WDUA 1XU1A 3FN9A 5C3OA 3CLPA 3PU3A 4K8FA 1UN1A 4BDVB 1ULFA 2ZGPA 1JMUB 1ULGA 4RFT0 2KXLA 1Z7S1 4NRMA 2WC2A 4Q0PA 2PHDA 1STMA 4XIKA 1PGL2 1MS9A 1TMF3 4YW6A 4S2FA 2OT7A 5KHKA 4CDUB 3K48A 4QT6A 3RPQA 1QWRA 4DINB 2D98A 3VHOA 1IZ3A 2Y0IA 2A5ZA 2FMYA 2I07B 3AP4A 1NQJA 4E9KA 1GFF2 1LU2A 2R1DA 2R041 1SHWB 4U36A 5C9AC 2XJPA 1MPXA 1NOVA 3E97A 1G86A 2B46X 4Q1PA 2I74A 1YJKA 1ULCA 2ETEA 4UFKA 3DGTA 4A6OA 2VUAA 2DCKA 1QEXA 3W58A 4AHYA 5B2GB 3CHXA 1OOPB 3S7IA 1D0GA 2A73B 4NOTA 5A3UA 4LKEA 4UFJA 4O61A 1PVXA 4AQTA 1ZA4A 2W91A 3IAQA 1COV2 2V73A 1DDLA 2NPIA 3WVJA 3I3BA 3MYXA 4Q27A 4QAWA 4TWTA 1GZ9A 3BI3A 4JC1A 2HYKA 4CXYA 3T2TA 2G9FA 3POSA 4IV1C 1R1A3 4C1WA 5FZOA 4Y4RA 3IDCB 2ZGRA 1L7QA 3AKQA 4FPGA 1CONA 3IMMA 2Q1FA 1IG3A 3WP3A 4IW3A 1A3KA 4XCAA 2RJLA 3CBNA 3PUAA 1H30A 4KG8A 1GWLA 4FP3A 2W92A 5E6HA 3LEMA 2DUOA 2VNGA 1GNYA 2O1QA 1D4VB 2ET1A 1VBE3 3WNMA 1CX4A 1VBB3 1NT0A 5EZWA 5CEHA 1QQP1 3KD4A 3AP9A 1CESA 2A6YA 2P3IA 5H9PA 2DBNA 3PUSA 1DQ2A 1ND3A 4HK8A 4YW5A 2QFEA 1R093 3AZVA 3NV2A 5JVVA 4PLMA 1AYM3 1LR5A 5CFDB 4FCAA 2OVUA 4UFHA 5AC91 2YG0A 1H2MA 1PVC3 3JQXA 4JTNA 3CL1A 4NPRA 3LE0A 2PQQA 4WVZA 2CYFA 1R082 3MLJA 3MIHA 4XUNA 4J6GA 3T4HB 4HVOA 1O6UA 3U4XA 1H8TA 2VNRA 3OEBA 4N90A 3MIFA 3HEIA 1E57A 4YRDA 2OQ6A 3WOGA 1W6PB 3O7OA 4LLFA 1BQPA 1RVF1 3LAGA 3PIGA 3VBFA 3ZM8A 5ABJB 1ASJ2 2LTNA 1K45A 1WW7A 3AZWA 2W0XA 2J1EA 4UW3A 5FQ0A 3TOJA 2JJ6A 1CIYA 2X53S 4EYUA 1XXNA 3ZXFA 4K21A 4XACA 2DU1A 1JU3A 3PJYA 4GIQA 2PHTA 2VQUA 4P9LA 2Q0AA 1HB3A 2FCTA 1AF9A 4LNVA 3HNYM 3KF3A 3T2PA 1D2QA 3WQ1A 3THDA 4JGZC 1OPMA 2MEV1 3K75B 4N7IA 2VQTA 3Q8AA 2XH6A 4CDUA 4YZ2A 4FFFA 2ES3A 2J22A 2J1SA 4I0AA 3IWZA 5DZEA 4BLJA 1RUG3 3N7MA 1RUD3 2VR4A 1UIKA 3NNLA 4A4AA 1W9WA 3C8XA 3O5SA 4FTSA 4BMBA 4GB32 4CCLA 1W9FA 5BYNA 2K0GA 5FLJA 3B00A 4AI1A 5LW9A 3I3DA 4B7EA 4PBOA 3VBOC 1YUDA 5SV5A 3TN92 4XJUA 1PX3A 1YFXA 4MYEA 4CCJA 1OA2A 2D5HA 4ZPIA 1U5ZA 1AR82 3WW2A 3K4AA 2RR12 2H0BA 1OOPA 2RE9A 1ZA7A 3C2UA 3FL7A 3NV4A 2YV8A 1BBT3 3RZGA 2P6HA 1AYN3 2FMDA 2IUWA 1NZIA 3FUQA 5FREA 2HH9A 1UOJA 2QVSB 3OD0A 5FP9A 4P5HA 3VKFC 4B7KA 4BQXA 1CWPA 4C0BA 1OKQA 4QQOA 3S30A 1RUC3 1DHKB 1UF2C 5F2SA 5DQ0A 1TMF2 3T08A 3D6EA 4UBGA 1ENQA 2BDRA 1QDCA 4XTMA 1TME3 4N7UA 2OPKA 2NZ9A 3LA7A 3CEWA 2WFPA 2CGPA 1XOYA 1O5UA 4NHXA 4CP0A 1ENSA 1FXZA 2O8QA 3ZFEC 4COZA 5K0UC 1L7LA 3LDBA 1W06A 1YQ2A 4YVSC 4HOOA 1C5IA 1Z78A 1W2TA 2W1SA 4HPKB 4PT6A 2DYCA 1RUJ3 3NJZA 2UY9A 3DKQA 5CFDA 5F3CA 3O1VA 1N1TA 2ZZJA 3ZYHA 1KEXA 3RWNA 1WWYA 2V09A 3OBAA 4CDWC 4DXSA 2BW8A 1VMHA 3ZN6B 3OPZA 1Q5OA 5FUPA 2QQNA 3FWEA 3GM8A 4JGYC 4LOSA 1KJRA 5FV3A 1R1A2 1W8ZA 2XBO1 1W6PA 5D8AB 5ABJA 2ZX4A 1RGSA 3I2HA 3O1RA 1QJX3 4O9EA 1I6XA 3VBSB 1WMEA 4FXGB 4KWKA 4LK7A 1LOAA 1CZVA 1SLLA 1VBA3 2P3JA 2WFF3 2W5FA 2ZEXA 3KMHA 3MW4A 5B4NA 5C8WA 4EZHA 2R071 1BZWA 3U0ZA 1V6KA 1VBE2 3AVRA 3LFMA 3MW2A 5L19A 1X8EA 4QB2A 4HONA 1W6QB 4IEQA 2W46A 3Q8BA 1JZ7A 1REFA 2GDFA 1IGOA 2VC9A 4G3YC 1R092 1SG3A 1ZBE1 4Y24A 3SISA 5FDBA 4DIQA 1AYM2 2NQYA 1W39A 3AYCA 4LO6B 1NCRC 4NPLA 5C5UA 3ZDSA 2Y6GA 2HYXA 3WP5A 4XJ9A 5FZCA 1N1VA 1R64A 4PCRA 1KGYA 2VNOA 2GC1A 3C7OA 1BEV1 2Z5WA 3LA2A 5IHRA 4Y22B 1DLLA 1H9PA 3N7KA 1RHI1 2NM1A 1FATA 2ZPXA 4I0WB 4EE2A 4BLIA 2BP6A 3I2OA 4YNIA 2LROA 4QKFA 1W3XA 3ZKYA 2EIEA 2RS53 2Q1ZB 3D3AA 1GP5A 2IFRA 4URAA 5A3PA 4MVTA 2R7EB 4TLGA 2D44A 5C6CA 4AI9A 2CWMA 3MPBA 2A3WA 4P14A 3ILRA 5FYMA 4OCTA 1IS5A 1Z7S2 2DCJA 3A4UA 4ZKTB 3GF6A 4FO9A 3T1LA 3LEKA 3JD72 3JQWA 1OA4A 5FZ3A 1RUG2 1SQ4A 1RUD2 3AMNA 2PYTA 4HSLA 4XHBA 3GBGA 4ASMB 3ZPYA 5J98B 1S0JA 3CJIC 5KR7A 1B35C 1FPN1 4HXCA 5JUVA 3O0WA 4CDQB 2R042 2CGNA 1RUH1 1IKQA 3A7QA 5DUWA 4KI5M 1UCXA 4D0QA 3C7HA 4LEJA 2G9GA 4HPKA 1WMFA 4DFSA 2W68A 3BPSA 3MF9A 5JZGB 2WINB 1EAH1 4QHBA 4BQ2A 1CD3G 3RYKA 3KV9A 4BHPA 1UOFA 5FMCA 1JN2P 2WS91 4WBBA 1RMU3 2B7YA 1AXKA 1BBT2 4KGGA 1IS3A 3HN1A 1OH3A 1AYN2 2GAUA 4FPKA 5F3EA 5T5LA 3T2QA 5IFPA 1GZCA 2W1UA 1PO21 3D5OA 4QB6A 1IOAA 1OLQA 3ZN6A 3M7AA 1Y43B 1VBC1 1C3HA 3THTA 2XG3A 5JIAA 5LA2A 4IGQA 4BB3A 1VPHA 2EXHA 2HWF3 4AEDC 1RUC2 3J7NA 1H2KA 5D8AA 3H7YA 2HBTA 4R8HA 4ONUA 3FHQA 1DYPA 4KBBA 4DUXA 2VW1A 3VBSA 1TME2 5IFTA 2R6QA 3GGLA 1KJLA 3CZUA 2JWPA 2WQ4A 1ZBA1 2BYVE 4FPFA 4PLNA 5H9QA 5DUXA 1AXYA 1UXZA 5DDJ2 4ARXA 3K3OA 4Z1VA 3NJYA 5AFEA 5JI7A 2OKXA 2BU9A 3UYJA 5BY5A 2ZBJA 2WRAA 1W6QA 3PUIA 3LQCA 1NLQA 4QHOA 1QGLA 1UX7A 4PF1A 4HVQA 1TNRA 2H0VA 1SLAA 4WVWA 3B93A 5K9YA 2LM3A 1AL0G 3N9OA 1ZZCA 3PIJA 4G9SB 1UW8A 1W0OA 1S0EA 4IESA 1GMMA 3UESA 1WA4A 2E51A 1V6JA 3PLQA 1LGBA 1O8SA 4MADA 2VNVA 2XHNA 4AEJA 2RDQA 3H3ZA 1KXGA 2QUOA 4R9CA 5BNNB 3VV1A 2W52A 2O8OA 1PX4A 2H6BA 4BQ4A 4RS5B 3V65A 4Y22A 4A7KA 3WSOA 3NV3A 4QGLA 1VRH3 1P8JA 3ZIXA 5JOWA 1QJX2 4QX0A 2BFUL 1FMD1 3DCQA 4JQTA 3BCWA 4NHLA 5EV7A 5FZDA 1PNGA 4OHZA 4GALA 3FC0A 2HWC3 4RGKA 3ME2A 4CCCA 1VBA2 2OQ7A 3IZOA 3M2MA 4PJYA 1O4TA 2VCBA 3UGGA 3ZXLA 3NKGA 4C0HA 5A7QA 5L9RA 3BB6A 5BNPB 4AAPA 1WBFA 3ETPA 3H1WA 3ALQA 3B02A 5JMOA 1A34A 1CIWA 4Q4V3 3QH7A 1RUF1 1DG6A 3SXWA 5FYSA 3CDZB 4CP9B 1MS3A 3FHIB 4K7JA 2WAOA 4PI2A 3WG4A 2RG4A 1QH7A 1YQ5A 3LFIA 4NIGA 1G8WA 3T3YA 2AENA 3CJXA 4CEWB 1MVEA 2J1RA 4YZ1A 3A22A 4RGGA 3H1MA 1AZDA 5F6KA 2TBVA 4Q1RA 4BQ1A 1H0BA 4CDQA 1GYKA 1VALA 1H4GA 4W65A 1JZ6A 2VMFA 2WT1A 1A6CA 3WNKA 1SFYA 5JZGA 4LLOA 4XQWA 5CG9A 3W5NA 3LPGA 3RRDA 3EQEA 1V6LA 1EV11 2ZGKA 4LOTA 1GICA 1OQEA 1UU6A 1NE6A 2RS52 4W6YA 1HN1A 3WEZA 1VIWB 1QXRA 2WSUA 1Q8SA 2DVFA 2TEPA 5ISLA 3H9AA 3RSJA 1DQ4A 4NUBA 1H8VA 4KU7A 4ZONA 4Z07A 2IVJA 5JOXA 2D40A 3POFA 2PHRA 2D97A 1UZ0A 3NJVA 4BPZA 3J9SA 2QBXA 3ON7A 1X50A 4FPOB 4IXLA 1YYNA 4AI2A 1NA1B 4F3JA 2SBAA 2JX9A 4AF9A 1FNZA 2MNGA 5JXHA 1NY71 3ABZA 2JXAA 5IJRA 5FAXA 1QJU1 2ARBA 2XJUA 3ACIA 4PDWB 2X05A 4PIXA 4ES9A 1S1AA 1C8M1 3TEXA 4AOCA 4DOUA 4A42A 2VQAA 1QJZA 1O91A 1UKRA 4NIIA 4MUVA 1UD1A 1RUE3 1W2OA 2ARCA 1PNFA 2BRTA 4CCMA 3I2IA 4IE4A 2CTVA 1CAXB 1WMXA 3R4DB 4YG0A 1HRI1 3MFAA 1REEA 3LSDA 2VXJA 5CBLA 5FPXA 2RS33 1RMU2 1AR91 3W20A 1S0DA 2X10A 1LESA 1XNDA 4AQ2A 3CQOA 2FDJA 3H1YA 1C57A 4UAPA 4YGEA 3SEPA 4F8AA 3QBQA 3LDKA 5BNNA 1OVPA 4XJ8A 2OIIA 1H2NA 2BVVA 1GWMA 4RS5A 2XONA 2HWF2 1Y9QA 4ARYA 1TZOA 2PXJA 2D6LX 1QY4A 2HWB1 4K3UA 3B7MA 1I9RA 2R063 4UI9L 2P17A 3ELNA 1WCKA 3R4UA 2CL2A 1UX6A 4AWDA 5JLVA 1J59A 3UL2A 1ZZ8A 3RQ0A 2JECA 3CNAA 3RS6A 4AE2A 4YM2A 2BERA 3VZJA 5IVBA 2MHFA 4FPLA 4EJRA 3WY6A 1ND3C 5BNPA 4XFGA 2JG8B 1W05A 3ZVXA 2FZ1A 2VTXA 2R072 1AL21 2ERFA 2HWE3 2X09A 2Y6LA 4K20A 2P34A 4P02B 5LBEA 4YFZA 1F35A 4LBLA 5I8SA 4UYBA 5J37A 4M0NA 1TE1B 5E88A 4OI4A 4CP9A 1WLWA 1W3VA 2KR2A 1H8TC 2C24A 2IZWA 5FZ7A 5BPXA 5HCBA 3ZYPA 1VBD1 4AVBA 4CEWA 1PK6C 1S2BA 1YI7A 1DU3D 3NV1A 3S0MA 4YVWC 1V6NA 5BNOA 2VZTA 3WG1A 4RSUA 1QHDA 3I2FA 4GKXA 4M01A 2YZ4A 2JE7A 3FJSA 2BGOA 3HBKA 3GBFA 4P9XA 2WYSA 4R9DA 4GMP3 3ENRA 1ZRCA 2FDGA 2Q8CA 4XZUG 1RHI2 2FDIA 4ISQA 2W87A 1K5MB 5KHHA 4FPCA 5C3RA 2VTFA 1SCRA 2YPDA 3EO6A 3FBYA 3I2DA 3DL3A 3S6PA 4ZU4A 1COV3 2DDUA 1Y3TA 1G9DA 3I2JA 5CIRA 1QMJA 1FYUA 2XKOA 4HETA 1MEC1 2RMU1 3V56A 4Q4V2 1RINA 3FFZA 1DGRA 2WZR1 2Y6HA 1OF4A 1OXCA 3AM2A 4KQ7A 5FUIA 3VD5A 1NA1A 1POV3 1GZTA 4B3NA 3SHRA 2EIGA 4LKSA 4BU2A 3HT2A 4PDWA 4N43B 1MZ5A 5DAXA 1TEIA 4UW4A 5LRRA 3WINE 3AB0A 3VB9A 1U5YA 3N35A 1FPN2 1GNZA 4ZU5A 1MS0A 4E4DX 1ZYBA 1CAXA 2GC3A 3MEPA 3ZYIB 4CVUA 1XSQA 4CEYC 1WCDJ 4RR3B 4CU9A 1C8NA 2ZX2A 3BIWE 1EAH2 1O59A 1ZREA 4LO7A 3NW4A 3BTZA 5FYBA 1ZX5A 2WWSA 5A7SA 4S2DA 4S2GA 1WCQA 4OHXA 4UFLA 3J8F1 1NXMA 4QQHA 1Q8QA 2AR6A 1GQHA 3DV8A 4CUBA 4C91A 4ZHNA 5F39A 5EJ3A 5E89A 1SLTA 1LJ7A 3BTXA 1CQ9A 4ZS2A 2C9AA 5FZ6A 3J4UH 2B45X 1JODA 1AR71 5FPVA 4QX3A 5FWEA 5FP3A 1ASJ3 4Q4Y1 3VL8A 1BVVA 3R05A 4OZOA 1OT5A 3U14A 2JG8A 4CPBD 5IVFA 3V0BB 2E53A 2VZVA 3PU8A 1RTVA 1T6GC 3T1MA 4NJ4A 5FP7A 3T30A 1G9AA 2WBKA 5JSOA 2CY6A 2VZOA 5FZ4A 5EYYA 4CU6A 1JBCA 2GMPA 3BN6A 2ADEA 2RS32 1H1AA 3ZMOA 4LHLA 5FZFA 2PAMA 3WDVA 2QJVA 4OMDA 5J1XA 4QDQA 2Q8DA 3DYPA 4LBNA 3RZHA 2WNOA 4EN6B 4LE4A 2WNEA 4OHWA 4XMIA 1RUOA 4IEUA 2XVLA 2ZMLA 3P3NA 4D6SA 1JS9A 1XE0A 4XILA 4EV0A 1JZ4A 2R062 3ACHA 2ZGLA 1YIFA 1TQ5A 5A32B 4R4XA 2YMZA 3R4SA 1CAUB 2WNVC 5C3PA 4WV8A 1AR83 1K5MA 3KM5A 1PHMA 2A75A 2O14A 3NJXA 4META 2LS6A 5FLIA 5F2WA 1S2EA 4GQ7A 5ACA3 1W8HA 3QOPA 1O5LA 1PVC1 3IT8A 2V4VA 3M3IA 2HWE2 2ZGSA 3NQHA 2YC4A 4MXVA 1BXHA 1VMFA 4LQRA 2VVFA 4QPGC 3TAYA 5L73A 1RUI3 4LKFA 1CJDA 1GWKA 1UZWA 4DXRA 2PLV1 1WMDA 3QCWA 3AKRA 1MZEA 4CU7A 1ND2C 2K9ZA 4N43A 3T2OA 1O3RA 1V00A 3C7GA 4LA3A 1N3PA 1APNA 4GWJA 2X5IB 3WLUA 4BA6A 4ZZ8A 1ACCA 2W95A 4BH9A 1BMV2 2WIIB 4DB5A 3OSDA 1V0AA 5T52A 4CRQA 3KF5A 2VO5A 2W08A 1NXD1 3TEWA 1O8PA 1D7PM 2KM2A 5E8AA 5LA9A 2OXBA 2UWBA 4O65A 3WQBA 1XYOA 4RR3A 3CIHA 3I8TA 4XFCA 2EF6A 4MHRA 4XABA 5AVAA 3VBRB 2AH2A 1GR3A 1SFNA 2Y0OA 4QKNA 5DPNA 4E2SA 4BIFA 3VD9A 1OH4A 3AMQA 5I93A 4UXAA 3THCA 3EBRA 4XW3A 5FXVA 5EHDA 1WW6A 1XNAA 4IV3C 5DZFA 4YWAA 2RDNA 3AXEA 1UIJA 2B5HA 2D93A 2AUYA 1DGLA 4B1MA 4DRVA 4A7YA 2VZRA 2RM23 1LULA 3FFQA 3GXUA 2XUMA 4KWUA 3WUDA 3VBUC 2WL1A 2ZGMA 1OURA 1XE7A 3UT0A 4WZFA 4UWDA 4FAGA 4XUPA 2DBIA 4NHKA 1VE0A 4FTEA 4I3PA 4BOWA 1JOPA 4Q8KA 4E4SA 3CO2A 1PZ8A 3GBWA 3WG2A 1ONAA 4K1YA 4AQ6A 2VOTA 4B4RA 3V0BA 3RWKX 1AXZA 2JDKA 4YYOA 5JPMB 4K8RB 3URFA 2IXHA 2CNAA 2PQSA 4HBNA 4Q5OA 2ENRA 2WDBA 2HBUA 2QQPA 4QPIB 2OYZA 4NROA 3GHMA 5K4LA 3RG0A 1Z0HA 1LHOA 3ZSJA 1HRI2 2ZGUA 1D4M3 3NWKA 4COWA 4ITCA 3PVBB 1RJ7A 3BALA 5D8AC 4Y5TA 4A7ZA 2FDHA 4GJYA 5FJHA 3WP4A 3H0OA 3VBSC 5IVEA 1LCLA 4ZY9A 1F9KA 4RN5A 1RXFA 2ZKLA 3FHAA 3HQRA 3KGLA 5K7PA 4QU2A 3HJRA 5J96B 1HRV1 4LT5A 3VKMA 5A32A 1WD3A 1CAUA 3WNNA 1JH5A 2RS13 4FT8A 4MX3A 1HDKA 1RUJ1 3N36A 3SKVA 2D3SA 2PAKA 1SBDA 1NCQC 2VE1A 2WWUA 2PHUA 3D0JA 2XR4A 2YXSA 3PMEA 4DS0A 4EN9B 4RQPC 1AR61 1L3JA 1PO11 2D6KA 2IXLA 4QGMA 5JAXA 3BVCA 1W90A 1YWKA 3OGGA 1EP0A 4D7SA 1PIV1 4K1ZA 3OEAA 1PMJX 2EICA 2Z2SB 5F5AA 3O0XA 3HPNA 3KV6A 1YO8A 4M4RA 4Z2AA 4BQ3A 1Z7S3 4AYUA 5LBCA 5C5TA 1YXWA 1HLCA 3MIGA 2YB7A 5SV8A 3JD73 4Y1XA 1OD5A 5CB7A 2WFF1 4N9IA 2X5IA 1VBD2 3G6JB 4P5YA 4XTPA 1CAWB 5FMBA 1RB8G 3ATGA 2D7FA 3ZLIA 3T0AA 1DGRN 1SBFA 3K46A 2AACA 4LUKA 5I91A 2JD4A 2H6CA 3KVAA 2OZ6A 2XVGA 4CE8A 2R043 1UKGA 3K51A 4AK3A 5KBFA 5A1LA 1NG0A 2HWD1 3VBRA 4U2AA 3W9AA 1M4WA 1YRZA 4H3WA 4XF3A 4JKLA 1C5HA 3BPZA 2VZUA 2VECA 2XUEA 1HN0A 2JEMA 2GNBA 4L97A 5JR7B 3S57A 1SLCA 2Y6KA 5DG1A 4RYDA 5LASA 3A21A 4CSWA 5ACA2 5LEKA 4L99A 3POWA 3CF6E 4H14A 1AX2A 5JSPA 3AL5A 5GZFA 2VZPA 5EJZB 1G9BA 5B4XA 2RMU2 1RUI2 4RHV1 5FY4A 5FZIA 4YM3A 2XL9A 4FXKB 3IBMA 3BYWA 4CDQC 2ZHLA 4S2HA 1IPSA 5LY2A 5BNQA 3H8OA 4H7MA 4ATFA 2JDNA 4MGIE 5ANQA 4A3XA 1FAYA 5CKMA 2D5FA 5LEJA 1AX1A 1OMIA 2G19A 4C1XA 2E63A 3KB5A 3I4IA 1CAVB 4XJWA 5DDJ3 4AAXA 2JDMA 1GSLA 1LRHA 3MUZ1 5C9AB 5FO9B 3W21A 3OPWA 2VOXA 3JBG1 4NAOA 1QH6A 2F4LA 4QPIA 5CAZA 3RI9A 3VGIA 5HBAA 2CHHA 2JICA 3ZFGC 2ZEWA 2VMIA 4YZ5A 1QQP3 4E27A 2C4XA 1S0GA 2W9XA 5C71A 1QIQA 2C1FA 1OVSA 3M4FA 2IXIA 5L7OB 3E5XA 2ZA9A 5GLTA 5LA0A 3E6BA 4GH4C 4AEKA 2WN2A 3AJZA 4COUA 2Q8EA 1SLIA 2Y6JA 3FUOA 1FNYA 3B01A 5AC93 3MZHA 2IXJA 2RM22 3NNFA 1X33A 3IDBB 3PVOA 4IV1B 1LGCA 2YC0A 1X82A 3LEGA 1GLHA 1UZVA 3PHMA 5LK5A 3WF0A 2IWGB 1JYCA 5FZKA 4MH0E 3AMMA 2FCUA 1LOFC 4OMCA 1RVF3 3SCFA 4Y4YA 1DBNA 1SDWA 3ZXDA 1W9SA 3DPRC 1PM4A 5EQUA 1F2NA 4B4QA 4BE3A 2QNKA 3KGZA 4UFIA 4YGDA 2GN3A 2JDHA 4Q4W2 4XPVA 1NAEA 2GZWA 1RIRA 3VD7A 2QQJA 3HBZA 4LBQB 5FYCA 2P2KA 4DXTA 2F4PA 2DUQA 3GYDA 3KT1A 4YW1A 5JXGA 4QXBA 3GZUC 1D4M2 4XOGA 2MEV3 2DVAA 1K42A 2WABA 4MLOA 1PZ7A 4HN0A 3T4VA 2QQOA 5JOZA 2ZTNA 1CAWA 1IQAA 5FPBA 2ZGTA 1KD7A 2GMMA 5FPAA 4AHZA 3VUOA 3LZZA 4NRPA 4Q4X1 1FOD1 3ILNA 3ZOIA 1XJAA 1GP4A 1MR5A 3LOIA 3KT4A 3PMSA 2NP0A 2FCVA 2D6OX 5E16A 2EIDA 2RS12 4C8DA 3PJQA 1UU5A 3IIIA 4IEZA 4Y33A 1UWWA 2A3XA 4Y20B 4CDXC 4XF1A 1OFSA 5A7PA 5FBJA 3WD5A 3H8RA 3MV01 5FMDA 4PI0A 4JDOA 2WR9A 4NRQA 1DZRA 3OF1A 2BNMA 2ZX3A 4XZPA 5A70A 1HKDA 3RMYA 4BYYA 4QM8A 4HFSA 1PGW1 5G04L 2JB8A 4NIAA 4AGVA 4ASLA 2DF7A 4FBFA 4DO0A 3ZDVA 2XXZA 1LKNA 4CEWC 2GALA 1US3A 3BUCA 1OLRA 4QKBA 1UU4A 5A3LA 4IE7A 4N53C 1QJEA 5BNOC 1BVP1 1VRH1 3AKTA 3L9JT 4A41A 1HW5A 3B69A 2D6NA 1UL9A 4MSVA 4P9IA 4CUAA 2A71A 2VW0A 3AL6A 3VHRA 5CG8A 1LHVA 2GU9A 2HWC1 1JI6A 3AJYA 2D6PA 5DAVA 3ST7A 4XJZA 5FZHA 2DCTA 3NNGA 5M0TA 3H42B 1CAVA 1CJPA 4QX5A 4XE9A 3VL9A 1QJY1 5C9AA 3G7DA 3RZLA 3AC0A 3DXUA 3VBOB 4K9SA 4OQ9A 4MG2A 4J1XA 5GLUA 1UYYA 2A70A 3ZXGA 4KGQA 5HI0A 3PVEA 4HL0A 4HN1A 3SLIA 4XDOA 4DZGA 3AZXA 5F3GA 5L7OA 1YNAA 2QDNA 4JQRA 5CNAA 1H9WA 4XQDA 3WF4A 3WT3A 4AVVA 2GP3A 3GHNA 1GOFA 4YM0A 1HB2A 2A6XA 1LOEA 1E5IA 2HLEA 2TNFA 1G6NA 2NYYA 2VULA 4W50A 4DUWA 1ZZBA 2UU8A 1HXS1 2WO2A 4ZS3A 4X6QB 4A45A 1V6MA 2WLPA 2VMHA 2QQMA 4IV1A 1DIWA 1SFPA 3ROUA 2Y38A 3AZZA 4NVPA 5FMOL 5A6YA 1YHFA 3RJRA 2ZXQA 4MV2A 3NAPB 1UZZA 3VHNA 3S7EA 1XYNA 2DVGA 5KC5A 2XBO3 2C6SA 1V9U1 2PHWA 4KL1A 4LIVA 5DN2A 5GM0A 2QQLA 5CFCC 5HPOA 2WNUB 5LY1A 3POEA 4MGQA 4TN7A 3HNBM 4X6RB 1W28A 3ZYBA 2E26A 2Y8KA 5FJKA 5FP8A 4FFHA 3ZFEB 3GZEA 1C4RA 1Q43A 5LBFA 3ZN5A 4CTEA 4CCDA 1CGPA 4IQPA 2RJ2A 2YU2A 4FOWA 4QMAA 4ET7A 2BNNA 2G9ZA 2R073 4X8PA 4LBQA 4YVSB 5IK8A 1JXNA 4QWNA 5IW0A 1AJOA 3KQRA 5A3MA 5KXBA 2BQPA 2LW8A 1MS1A 3VBHB 3UKVA 1QQP2 1GANA 1YQ6A 2I45A 2AYHA 2CDOA 1G7YA 3OCPA 1W2NA 5HXMA 3ZSLA 4YW3A 1ZBE3 3AP7A 4CU8A 5IUQA 4BIOA 1EUTA 4OI1A 4NWVA 4CP2A 2VJXA 4E2QA 4W4ZA 1HB1A 1JZ5A 3MICA 1CR7A 2JB4A 3KSCA 2B42B 2RVAA 3U78A 4JGYB 5AC92 1RUE1 2ZOEB 4HKWA 2VU9A 1S55A 1SMVA 2VG9A 5T5PA 1ZRDA 1J58A 1XNTA 2VH9A 2ZHNA 3LKJA 1BEV3 4Y20A 3M3EA 2Y6FA 5LRSA 2DTWA 5H9SA 1C28A 1S2KA 1RHI3 4MO3M 1RVF2 1Q8PA 4B4PA 4J1WA 3LIGA 4EROA 4R4ZA 3OG2A 3O1PA 2P4EA 3C7FA 5CYYA 1AR62 1HQLA 2E7QA 1F4AA 4RFRB 2A6VA 5FK8A 2BPA2 3D4KA 5FTTC 4AFBA 4JVAA 2WA4A 1RC6A 2ID4A 5FPLA 2PELA 2QTWB 5I0TA 4D6RA 2Y26A 1A8DA 2MEV2 1ENXA 1NCRB 4GAZA 2Y34A 3JUUA 1LAJA 2SLIA 1LENA 2PHFA 2B4KA 3MDPA 2JDPA 2DWRA 5IK7A 1PGSA 4LE3A 3OJBA 2ZMNA 1GOGA 4COVA 5K8SA 3VBOA 1N1SA 4LPLA 3ACGA 5T55A 1WCSA 4WZCA 3RZJA 2FDKA 1X9PA 2AGSA 1MACA 1FPN3 3ASIA 3E1F1 4OZXA 5IYYA 4JRAA 5KXEA 1DQ1A 5T5OA 3FE5A 1MQTB 4NN0A 2P3YA 1RUH3 3NL1A 5FY8A 1PGL1 4DNYA 4PQQA 2DCYA 3GCWA 4K6BA 1EAH3 1AUYA 4QQ2A 3FX3A 4DY3A 3MW3A 3M8LA 5D1IA 2A6ZA 5IK5A 1H1MA 1SACA 1AHSA 2WS93 4DQAA 4PQ9A 5A1AA 4LHSA 2PHLA 4H55A 1KQRA 5A3WA 1QU0A 3RYRA 3OPTA 2V5YA 1UPSA 3Q8FA 4FFGA 3KV4A 4MGSA 3MF6A 4BZ4A 1QNYA 1MS4A 1VBC3 1GBGA 3B9CA 2VGDA 3WCRA 3UK9A 3NAPA 1IKPA 3OBRA 4PIZA 2WO1A 4RHV2 4QU1A 4D7TA 3FMGA 4Y5Z0 2DVBA 2WNUA 4WM8B 2JE9A 1E5SA 1BCXA 1SEFA 3ZFEA 2A1XA 5K0UA 5A3TA 3CJIB 4OUEA 4EWDA 1H6YA 1LB2A 1BJQA 1BYHA 1KS4A 1ZBA3 1H6XA 2DCZA 3R6SA 4E8CA 2W1WA 1O4ZA 3NMBA 2LRPA 1DYOA 3TBDA 3WZ1A 1W99A 4FQZA 4Y1YA 3VBHA 5GJ6A 4Y1ZA 3WNLA 4K40A 3U4SA 4YG3A 5CISA 5JXIA 3WHTA 3E6DA 4LR4A 4XURA 4I2OA 2FQPA 3RMXA 5T54A 1GQPA 3TRSB 3IMNA 1W2UA 2Z42A 2IFWA 1DP0A 1NUKA 3KV5A 3N9NA 5J7MA 4JGYA 1VRBA 2VTXJ 4QQLA 3VD4A 5FOBB 3VD3A 4AEDB 2BZDA 4JZRA 4Y1UA 4GMP0 1WD4A 3VDAA 3DYOA 3WQ7A 5DAPA 3UV9A 3N7LA 3FLRA 5E1RA 2XBO2 4PIYA 4MXWB 2B9VA 1U5XA 2E33A 3ES4A 4LITA 3ZR5A 4COYA 1UY1A 1REDA 1XSRA 4P9JA 1FMD3 1VLNA 1GQGA 1ZM1A 3HT1A 2WYFA 4CCKA 4NIDA 3O1TA 2VZ1A 1HJFA 2FD8A 1N47A 4LULA 4L2NA 3AVSA 2R1BA 3IN9A 2X29A 4Q0QA 2DUPA 1ODMA 4WM7B 4XBQA 1R081 3ECQA 1VR3A 1POV0 1ZRIA 4DUVA 3M3OA 1US2A 3KLSA 4ES8A 2ORZA 3TWIA 4FSJA 1UNBA 3BTYA 1NCRA 1RUF3 1XB9A 3Q8EA 4OULA 5EP9A 4I01A 1DGWX 1ZBE2 3M3QA 3HIFA 1U5IA 4XXAA 4YM1A 3RI8A 2DVDA 5JWPA 2IC1A 4CZSA 4G4FA 3U07A 2E9QA 3PDQA 4FP2A 3VBFC 4PLOA 4Y1VA 5GZDA 3ZSMA 4WVMB 1LGNA 4FOVA 1NLSA 1UYPA 4O9GA 4XFBA 5J36A 4M3CE 1GZWB 3OOXA 1BEV2 1MQTA 1OLME 3ETQA 2PAEA 1VMJA 2OA2A 1CPNA 4W6WA 3VZOA 5KWRA 3WV6A 1O3TA 2ZKNA 1GU3A 2EIBA 1J84A 3HN3A 1J83A 1HX6A 2W47A 2XL7A 3MBWA 5LA1A 3MIBA 3BU7A 2VCMA 1EV13 3RVHA 2GNMA 4XMAA 5D21A 4XJAA 2BEOA 1ULOA 1PGW2 2VOKA 4CDUC 1W6NB 1NQDA 5HV4A 4QXKA 4GB31 4UW6A 3APBA 2YBSA 3WW3A 1A8MA 2X5IC 2VBPA 2JIJA 3FZ3A 2ZEYA 2WJSA 1UQXA 2P3KA 1JTZX 3L2YA 3TN91 2EXJA 1F5JA 2WAAA 4FPHA 1ZZ7A 4UW5A 2RR11 3N4MA 1HQNA 4CCOA 3JZVA 3EJKA 4WM8A 1QOOA 2DU0A 5FZ0A 1DQ5A 3CJIA 4L11A 2HEVF 2YROA 4FVVA 4R9BA 4OHVA 3PVNA 5J09A 2VZ3A 3ACFA 1OOPC 2YHJA 3O1OA 1IS4A 4BXSV 3WF1A 1QJY2 1QJU3 1RUNA 4LO4B 3AKPA 1LOGA 1IPKA 3OYWB 1C8M3 1K3IA 1OQDA 5FYVA 4LO5B 1LNSA 5CKNA 1RUH2 1LECA 4XFHA 2KD7A 1H4HA 2E6VA 4BK5A 1TMF1 4TXWA 5CVRA 3N9QA 4IL7A 4P9WA 1HRI3 3HVDA 3J7HA 3JCIA 4AVAA 2WSVA 2WS92 4NR1A 3M1HA 2A3YA 1AR93 3J26N 5C4WB 3AKSA 2BGPA 3N9PA 4KNCA 5BXXA 1FT9A 1JZ2A 4XUTA 4AEDA 2J1UA 4MGKE 4A6SA 4CXXA 1UYXA 1PO22 2WN3A 4QX7A 4LUMA 4AR2A 1VBC2 2PA7A 5TSWA 2YU1A 3WCSA 1NKGA 5GZCA 3ZO0B 4LXLA 3U37A 1OC1A 1UY0A 4MXWA 2HWB3 1XC6A 3TB0A 3ZIWA 4M4PA 2OUHA 4QPIC 5DZGA 5GLVA 2BUKA 3A23A 5IT6A 3JXSA 3DUIA 4KU8A 4NIHA 1DZTA 3BU0A 1V9U2 4IERA 3BOWA 3IDAA 3GCXA 1C1FA 5A33B 4TZDA 1ZBA2 1JOBA 4AI3A 5CFDC 4WM7A 4IEXA 3LPFA 5FZBA 3AFGA 4Z8BA 2P6CA 2G4IA 1I5ZA 1KDMA 1SCSA 2ZMKA 2W39A 4QPWA 4D94A 1AL23 2EAKA 4M3CB 1R1A1 2P5BA 4XF0A 3WW1A 3SCHA 3VKLA 4YGCA 2UYAA 3JB8A 1UY4A 1W8NA 2WZ8A 2RDRA 2ZZQA 3S5AA 2XKPA 1QDOA 4YZ4A 3VZMA 2HJIA 5T50A 3WF2A 5F1RA 5ABJC 1OA3A 2QCSB 2XJSA 4WVMA 2V4AA 1VBD3 4RA0A 4JX0A 5DXDA 3DF0A 1DF0A 5F5CA 3VZKA 5KXDA 1VBE1 5CKQA 1GZWA 1VBB1 3TEZA 3F2ZA 5EFUA 4H2AA 1F8VA 4Q29A 5HV0A 2XWBB 4CCNA 5I8YA 1R091 2JG9B 3WDTA 3FLPA 5A7NA 1AYM1 4LK6A 1FMD2 2OX0A 4OI0A 2Z4FA 4ORFA 4F7ZA 1W6NA 1ZRFA 2EA7A 3SEEA 3KCYA 4IEVA 4Q0SA 3WXPA 4FPEA 4HZFA 2VMDA 2ILMA 3M70A 4SBVA 3RNSA 4IDZA 4DY5A 1YFYA 2XLFA 1JYVA 1O4YA 1RL3A 2ZCWA 1MEC3 2RMU3 4JDMA 2ET7A 4R52A 3H8UA 1RUF2 2WZR3 5FFOC 1RITA 1W9TA 3N9MA 4ZZ5A 4V2VA 5IAXA 1PK6B 3ZR6A 4HKOA 4QX8A 1UO9A 1D0HA 3OGSA 4YVWB 4BJ0A 5LWBA 4GD4A 4Z82A 1V70A 3NNMA 3AXDA 4IE6A 5FZ9A 1YEWA 2AREA 2ZHKA 1LEDA 2BJSA 2PHXA 5GKAC 3U10A 1BK1A 3OYWA 1N3OA 4XBNA 1EY2A 4XC9A 1JW6A 3DN7A 3HNMA 2W2IA 4OFGA 2CSGA 2VAUA 4XFIA 4D8MA 3IAPA 1PM7A 4L8QA 4AVTA 4YFWA 1LU1A 5DAQA 2VW2A 2IXCA 3JD71 4Q2FA 3RGBA 3SC7X 3HMYA 2O0OA 1EV12 3ZSKA 4QHZA 5C4WA 1RUG1 1RUD1 3IDEA 4E4ZA 4RGAA 4PF5A 4XAAA 4AFDA 3PL0A 5KHGA 5KHJA 2GMEA 2Y33A 4V1PA 4AGRA 1RYYA 5EWSA 3WG3A 4LBQD 2JDAA 3K2OA 1W8UA 2JKBA 3O0VA 2GSYA 5FKBA 4BM8A 1XNKA 2JENA 5IWFA 3J8F3 4LHNA 4XDPA 2VOVA 2HKXA 4TYSA 2DV9A 3EXUA 5AFBA 2F17A 3IKWA 4Q0UA 1O3QA 2XJRA 1H1IA 3KWVA 4QX1A 5FY0A 3VHPA 3OBZA 3WW4A 4QB1A 1IHMA 5ERLA 5A33A 4HKLA 1UZYA 1BBT1 5C70A 2P37A 1AYN1 3CU7A 1AR73 1UYZA 2A7AA 2YDEA 1NY72 3H7JA 3OD4A 4JKMA 5KC6A 4Q4Y3 1QJU2 5L7OC 3UJOA 1CX1A 1WKYA 2UURA 1N1YA 4YARA 1C8M2 3RZMA 5I0RA 2N7GA 1FX5A 1NLRA 2J7MA 1SBEA 3H50A 4M3CA 4GKYA 1RUC1 4Q4W3 4ZXKA 4CEYB 3KQ4B 1OLMA 2R49A 2AEYA 2V72A 4AI8A 1AX0A 1Y9MA 2L9LA 5G05L 5JOYA 2EALA 1KFUL 1GV9A 1TME1 1UMZA 2VVDA 1CZTA 3K77A 4OYUA 3B5LB 5FRAA 3KHCA 2GC0A 4B29A 5JSRA 1AR92 4HLTA 3ZX7A 4NPMA 5I0DA 5DDJ1 5C8CB 2R0HA 5JCTA 3AP6A 3NRUA 1DCSA 1OFNA 1TG7A 2YBKA 5LBBA 4ISRA 4EN0A 5JR2A 3W5MA 5LK7B 3OUHA 3M3CA 2GH2A 5GALA 4XFAA 4YW4A 2HWB2 2JG9A 1LODA 2TUNA 4AFAA 5FY1A 5I0SA 1N3QA 3ACLA 3SNMA 2JD9A 3WNPA 4A2UA 2XLAA 1V6OA 2YUEA 1EYBA 4FAHA 4GXLA 2YFZA 4AZZA 4PHZA 4AFCA 2CAVA 1E5RA 1YFUA 3EYPA 3GALA 3B94A 3N7JA 4B8EA 2UWAA 5K0UB 4YW2A 2W3JA 5DUVA 1AL22 1ZZ6A 4GJZA 3OGVA 2A6WA 1LHNA 2PTMA 3I59B 1WW4A 4N9HA 1QJX1 1PK6A 1JHNA 1UMHA 3BODA 4LBMA 4XBLA 5L9BA 2XOMA 2DFBA 2JDUA 4YVWA 3WX5A 5FMOS 5FZAA 2PLV3 1VBA1 3UGHA 2ZHMA 3VDDA 2VUCA 1EPWA 3SMHA 4YGBA 2ZABA 2QKDA 2QZ2A 3LB9A 1OPOA 5CU1A 2G1MA 4E4HA 2KA3A 1KRIA 4QXHA 4QDSA 3O1SA 2C9KA 1W6OB 2P1BA 2Q30A 2VCCA 2WNVB 4DEVA 5F9TA 1DQ6A 2XGXA 1XU2A 3ZFFB 1ENRA 1XE8A 3NVCA 2CGOA 2ZJCA 2ARXA 2XQRA 2VM9A 3SH4A 4AVCA 4LA2A 4HANA 4XUOA 5FZLA 1LTEA 5H9RA 2NN8A 3NSTA 1OQ1A 3TEYA 3QD6A 4OI2A 3K4ZA 1I5PA 4QPGB 4EN8B 1W9YA 1MEC2 4FI9A 5FYTA 4IE0A 4MOAA 4YSFA 5FO8B 3POYA 2IXKA 2YC2A 5LZ6A 5DABA 2WZR2 4IGOA 5LCWL 4KWLA 1ND2B 1RXGA 1L7RA 1URXA 3POBA 5ANNA 5LB6A 3LEIA 3HWJA 4L92A 2RS51 2HEWF 5JZGC 3AYAA 1NE4A 3Q8CA 5FUNA 2HEYF 3D0SA 5FP4A 3GZAA 2BFUS 4XQ4A 2ZGQA 3H3LA 2WZEA 1S0IA 2EAAA 4CEYA 2XPJA 3R0RA 3VN4A 1X8MA 1XBFA 4CUCA 5FOJB 4UFMA 4A3ZA 1KS5A 5F6LB 4JAAA 3LCPA 4F83A 1DGWA 4FFIA 4UF0B 4I0BA 3NAPC 5C8CA 1ODNA 4SLIA 2QE3A 3HOBA 1K12A 5FIXA 4KMQA 1G9CA 3CZJA 4IV3B 4AL9A 1V6IA 2RHPA 2WNUC 5JXJA 1SZBA 4MHUA 4DRRA 3I49A 5EPAA 1NYWA 3J8F2 2BOIA 3VBUB 3AP5A 4P9GA 2OS2A 1MS5A 4QPYA 4Z92B 4YPJA 1HRV3 2CWSA 1W8WA 4LHKA 4TLFA 2V5DA 1QF3A 1RMU1 3I3EA 5HXVA 4INDA 2VMCA 1A78A 3MUY1 3OGRA 3JB4C 3VBHC 4BQYA 3UNPA 5FK7A 4CP1A 1AR72 2QQWA 2FBEA 4QGNA 2UWCA 4OVEA 3POGA 3KT7A 4Q4Y2 1ALYA 5IK4A 2Q5TA 3HQUA 3ORJA 3OB8A 1AR63 1O7FA 1U0AA 1PO13 1EUUA 2B39A 2HWF1 3UKNA 3O1MA 3I3QA 1W0PA 1YLLA 4E2GA 4E8DA 5C7GA 1UOGA 3I59A 1B09A 1PIV3 2WQ8A 2XHKA 4GZ9A 5BNNC 4M3CF 3S5QA 3QACA 4RS5C 1W03A 2PN5A 3LOBA 3B9IA 1X36A 1ULDA 1MZ6A 1HB4A 4JDNA 4OUSA 4GA9A 1CZSA 2WKKA 4Q0VA 2D3PA 2XDVA 2ADDA 4P08A 4ATEA 3ILFA 1CVNA 4NAMA 1QNWA 1W6MB 2ARAA 2LUWA 4LMFA 2C26A 3USUB 4QM9A 4RD7A 2GH8A 5JPNB 1ULPA 1W04A 1W6OA 4GWMA 3WDYA 1VBB2 2B9UA 2WNVA 2XWJB 5BNPC 1LOBA 2QQUA 4GULA 1WLCA 3ZFFA 3H8XA 4CA9A 3WF3A 3IM0A 3LSEA 1NCQB 2HWD3 2VMEA 4RQPB 1XYPA 3LD8A 4MGZE 3VKOA 4XVHA 1LHUA 4FPJA 2GC2A 3MHZA 4Y3OA 3AMPA 1SPPB 2WZPP 2RDSA 4W6XA 4A44A 4AI0A 5C3QA 1GNHA 4QPGA 5FY7A 5FYYA 1PVC2 1UOBA 1D2SA 2QQVA 5A3NA 1AJKA 2EVXA 4JGZB 4CPBA 3RZZA 4V2WA 4MGYE 1S4CA 4OQ8A 1I1EA 5GZGA 1ND2A 2E31A 2D43A 1H2LA 3GZTB 2C0ZA 4RHV3 3IB3A 1MQTC 3A0NA 2PLV2 2WO3A 2ZAHA 3KCXA 3AX4A 4I30A 4XF9A 5F7UA 3VZNA 1W0NA 2DFCA 3WUCA 5FZ8A 1J3PA 4Q4V1 3P3PA 1YQCA 4XF4A 3ZYFA 2I2SA 1QOTA 3JBG3 5DAWA 4D7YA 4MGTA 5LATA 1VAVA 5CA6A 2XVKA 3ZYGA 3KCCA 4LO8A 2EXKA 4UF0A 3SITA 3K4DA 3U1XA 1WLDA 4IV3A 3RJ2X 2DTYA 5IVCA 2AEZA 1NA1C 2RV9A 3QH6A 2IVIB 4OLLA 4WM8C 2YY1A 1WUVA 2VL4A 4PDWC 1U12A 3VBUA 1OKOA 1VP6A 3OUIA 1JYIA 3I2GA 1FI2A 4AXOA 4IGPA 5FR3A 2FZ2A 1S0BA 3PUHA 4YW7A 3E6CC 5T3NA 3IPVB 2BBAA 1BK0A 4UBHA 4QDRA 3OGJA 2WLQA 3WDWA 3OBTA 4N8MA 2X8KA 1MZFA 1KFXL 1VB2A 2VD7A 5FWJA 4W8JA 3O14A 4LJHA 3PNAA 4C90A 3ZPOA 3T0BA 2CV6A 1LOCA 1JZ3A 3ZFGB 2VBDA 3ZXJA 1WZXA 5FYHA 2YGLA 1OD3A 1S0CA 4QX2A 4XAEA 5CADA 1I3HA 1OUXA 2ZACA 4GH4B 1W6MA 4L9BA 5FCCA 2GNDA 5A7WB 3ZKUA 4CDWB 2W94A 5DG2A 3USUA 4EZ4A 4AVSA 5EYXA 3MFCA 3FLTA 4Q4X3 1FOD3 2BVBA 2JG8C 4KH9A 4CUGA 2Z79A 3IIAA 4WM7C 1HRV2 4Z2WA 1NCQA 2RS31 2W1QA 3VZLA 1YQ8A 5J48A 1VB4A 1QXPA 1K5JA 4FPYA 4RQPA 1RUJ2 2XQXA 1RJ8A 3TNPB 1WGPA 1XNBA 2AZ5A 3DPRB 3MV11 3THPA 1BKZA 4TSVA 1SPPA 4NE9A 3DKWA 1JOJA 2BNOA 3ZYRA 4AG4A 4TTGA 1PO12 2NMOA 5BV6A 2BBVA 3PTYA 4JGZA 4DPNA 1OF3A 3QLQA 1M06G 3SCGA 1PIV2 1PMIA 2R30A 2R061 3ITQA 4JV4A 3UKTA 2YYOA 1O3SA 5IAVA 4AQSA 3C7EA 3WNXA 3ZYJB 2F6BA 4R9AA 1GOHA 3A0KA 5A6ZA 1QKQA 2ATFA 2VXRA 3I7DA 1OHFA 1DYKA 2RJKA 1J1LA 2D6MA 3V0AB 4JCKA 3E5UA 3BKZA 2WFF2 1Y4WA 1E5HA 1Q8VA 1K5MC 2YGMA 1F31A 4HT1T 2Y60A 5F5IA 1KITA 2CDPA 3I3MA 4FQ4A 2HWE1 4FOYA 4IE5A 1QJY3 2ZAAA 4DXZA 3EB7A 1UY2A 2JDYA 2JE8A 1WLTA 4EN7B 4CDXB 5A80A 2WT0A 4LBKA 4UOJA 3GJAA 5J3UA 2HWD2 2YFUA 1LHWA 2VQ0A 1J3RA 1OSGA 3PURA 4XXPA 2VOWA 4NWWA 3POJA 2K46A 2VVEA 1JYNA 4IEOA 4X8NA 4I09A 4HG6B 4EWAA 1XNCA 3OUJA 1BMV1 4HVRA 4I3GA 4N43C 3O12A 3ZMNA 4N53B 4JTOA 1PO23 4XUQA 4AW7A 4BXFA 5BNOB 3WHUA 1HXS3 1IG0A 2DURA 5EXOA 5IVVA 4GMP1 1FV3A 2VMGA 3D8CA 4AHXA 2J1VA 2J42A 4JKKA 1F4HA 3IPVA 3WQ0A 1WW5A 2VZSA 3P1IA 4ZXEA 4EQVA 1OUSA 1EPZA 3RDIA 4LBOA 3DYMA 2NMNA 5JI9A 4LBJA 1POQA 4RR3C 5A1FA 1V9U3 1B35B 4Y5SA 5L9VA 1COV1 5KHIA 2VBBA 3KVBA 1DFQA 1LEMA 4FOQA 5FZGA 3KZ4C 3U11A 5DMYA 1JHJA 5C4WC 3MLLA 4YVSA 3ZFGA 3PTRB 1BLZA 3JBG2 3VKNA 1WA6X 5CZKA 2ORXA 3NKTA 3VDDB 1POV1 2LALA 2VZQA 1YC61 1DZQA 4GH4A 4DMIA 3J7LA 1BHGA 3D82A 1JU4A 3TYJA 5A7WA 2D3RA 3N9LA 1ST8A 3HD8B 4CDWA 4LTAA 3GDBA 4D6QA 3AK0A 3O1UA 2R32A 2J1AA 4B1LA 1F15A 5FYZA 1JUHA 1WBLA 3C3VA 2CAUA 4I02A 4D3WA 2FDFA 2VUJA 2E7TA 2WQZC 4P00B 1GP6A 1VAMA 4ASKA 1LOFA 1WCUA 5CFCB 4OUMA 1G9FA 1OBNA 3LGRA 5FPZA 3I97A 5JIUA 3DPRA 3INAA 3ZN4A 2ZX1A 5F3IA 3AYDA 1QXJA 4KBZA 2PMWB 4O7XA 4FTBA 2BOJA 1ZVFA 3WR0A 3AFKA 2WUHA
chains in the Genus database with same CATH topology
3L2HA 2XJQA 3WDXA 2OW4A 1AVBA 2PFWA 3NO8A 4BMEA 3B3QE 3SH3A 2BWAA 2VPVA 4XFFA 1F5FA 3MIEA 3GNEA 3LWCA 1ASJ1 3Q9OA 3W59A 3V0AA 2MPFA 3JU9A 3H3UA 2JG9C 4NO4A 4Q26A 4Y26A 4PBPA 1ZNPA 5GLWA 1UAIA 3SH5A 4GWNA 2Z69A 2OUJA 1FOD2 4Q4X2 4IEPA 4AHWA 4CDXA 5L36A 3BTAA 1HQWA 4HSJA 1IS6A 2Q1MA 1MVQA 1PZ9A 2XLGA 2XB6C 3V64A 2NLRA 2XJVA 1OI6A 1HV0A 4HMZA 3OY8B 2FHRA 4ZU7A 3E5QA 1IPJA 4N53A 4RL7A 3EHKA 2R16A 1ZZ9A 1YJLA 1KDKA 2WT2A 3LA3A 3VDDC 1YFWA 1Q56A 1VRH2 3TNQA 1YI9A 1AR81 5FO7B 1R1ZA 2C5DA 2HWC2 1YIPA 3FBMA 1B35A 2XJTA 2ZGOA 3OTFA 5HCFA 3VBRC 5ACA1 3WP6A 4HK9A 5FLHA 2GNTA 1HV1A 4H7LA 3MI8A 1CPMA 3AMHA 4JRLA 3HAGA 1RUI1 5C33A 5T5JA 2ZS6B 4AFMA 2B8MA 1ZRRA 1Q3EA 5KXCA 2K2SA 1TNFA 1Y7BA 2UY8A 5F5QA 2OZJA 3HQXA 1HXS2 5DUUA 1VAKA 5AVPA 4NHMA 4YZ3A 4IEWA 4BWOA 2R0FA 4OHYA 5CFCA 5HCAA 4QQPA 2QDRA 2ZX0A 1XRUA 2Q8OA 1ULEA 3ZXKA 4P9YA 2YPJA 3HR9A 1FV2A 3AYEA 3ZXAC 1DQ0A 3MIDA 4CYDA 4IETA 1X7NA 2E7AA 1XQNA 2QZ3A 1C1LA 3RYPA 5C8CC 2RM21 2BGCA 4YLZA 5FBZA 5GZEA 3AZYA 4XIOA 1R083 2UYBA 4XETA 2Q4SA 4KWJA 5GLZA 4MZUA 4M0HA 4XEZA 1VJ2A 3USSA 5JDBA 1JUIA 1MS8A 3BOPA 1CN1A 1S0FA 4XHXA 2EXIA 5BUVA 1J1TA 3KS7A 4Q4W1 4QD2A 2WA3A 1RUE2 2JDZA 1YCIA 3MLKA 4IEYA 3I54A 4Q8LA 4XDQA 1GKBA 1NZCA 3VLBB 1D4M1 2VY0A 5I0UA 4AGGA 3X29B 2BWCA 4URTA 4M00A 1J3QA 3MPPG 3OY8A 4XYXA 1ND3B 3ZXEA 1SLBA 4AEMA 4D69A 4EWEA 1QOSA 4GB33 2RS11 2ZGNA 3UJQA 1H8TB 1HIXA 5JMCA 3TN93 4KG0A 3MGUA 3ES1A 3N3HA 4WVVA 1Q8OA 2RR13 2GN7A 2BTVC 3VBFB 3ZFFC 5I8TA 3ZSEA 4BCUA 5FQ0B 1UPIA 4YG6A 3WDUA 1XU1A 3CLPA 4K8FA 1UN1A 1ULFA 2ZGPA 1ULGA 4RFT0 2KXLA 1Z7S1 2WC2A 4Q0PA 2PHDA 4XIKA 1PGL2 1MS9A 1TMF3 4S2FA 5KHKA 4CDUB 3K48A 4QT6A 3RPQA 1QWRA 4DINB 2D98A 3VHOA 1IZ3A 2Y0IA 2A5ZA 2FMYA 2I07B 3AP4A 1NQJA 4E9KA 1GFF2 1LU2A 2R1DA 2R041 4U36A 5C9AC 2XJPA 1NOVA 3E97A 4Q1PA 1G86A 2B46X 2I74A 1YJKA 1ULCA 2ETEA 3DGTA 2VUAA 2DCKA 3W58A 4AHYA 5B2GB 1OOPB 3S7IA 1D0GA 2A73B 4NOTA 1PVXA 4AQTA 1ZA4A 1DDLA 1COV2 2V73A 2NPIA 3WVJA 3MYXA 4Q27A 4TWTA 1GZ9A 4JC1A 2HYKA 3T2TA 2G9FA 3POSA 4IV1C 1R1A3 4C1WA 3IDCB 2ZGRA 3AKQA 4FPGA 1CONA 3WP3A 1A3KA 2RJLA 1H30A 4KG8A 4FP3A 2DUOA 2VNGA 2O1QA 1D4VB 2ET1A 1VBE3 1CX4A 1VBB3 5EZWA 1QQP1 3KD4A 3AP9A 1CESA 2A6YA 2P3IA 5H9PA 1DQ2A 1ND3A 4HK8A 4YW5A 2QFEA 1R093 3AZVA 3NV2A 5JVVA 4PLMA 1AYM3 1LR5A 5CFDB 4FCAA 2OVUA 5AC91 1H2MA 1PVC3 3JQXA 4JTNA 3CL1A 4NPRA 4WVZA 2PQQA 4BIFA 2CYFA 1R082 3MLJA 3MIHA 4J6GA 4HVOA 3U4XA 1H8TA 2VNRA 4N90A 3MIFA 1E57A 4YRDA 3WOGA 1W6PB 3O7OA 4LLFA 1BQPA 1RVF1 3LAGA 3VBFA 5ABJB 1ASJ2 2LTNA 4UW3A 1WW7A 3AZWA 2W0XA 5FQ0A 3TOJA 2JJ6A 2X53S 1XXNA 3ZXFA 4K21A 2DU1A 3PJYA 4GIQA 2PHTA 4P9LA 2Q0AA 1AF9A 4LNVA 3WQ1A 1D2QA 4JGZC 1OPMA 2MEV1 4N7IA 2XH6A 4CDUA 4YZ2A 2ES3A 4I0AA 3IWZA 5DZEA 4BLJA 1RUG3 3N7MA 1RUD3 1UIKA 4FTSA 3O5SA 4BMBA 4GB32 5BYNA 2K0GA 5FLJA 3B00A 4AI1A 4B7EA 4PBOA 3VBOC 1YUDA 5SV5A 3TN92 4XJUA 1YFXA 4MYEA 1OA2A 2D5HA 1U5ZA 1AR82 3WW2A 2RR12 2H0BA 1OOPA 2RE9A 3C2UA 3NV4A 2YV8A 1BBT3 1AYN3 2FMDA 3FUQA 5FREA 2QVSB 3OD0A 4B7KA 4P5HA 4C0BA 1OKQA 4QQOA 3S30A 1RUC3 1DHKB 1UF2C 1TMF2 3D6EA 4UBGA 1ENQA 1QDCA 4XTMA 1TME3 4N7UA 2OPKA 2NZ9A 3LA7A 3CEWA 2WFPA 1O5UA 4CP0A 4COZA 1ENSA 1FXZA 2O8QA 3ZFEC 5K0UC 4YVSC 1C5IA 1Z78A 4HPKB 2DYCA 1RUJ3 3NJZA 2UY9A 5CFDA 1N1TA 2ZZJA 3RWNA 2V09A 4CDWC 2BW8A 3ZN6B 3OPZA 1Q5OA 3FWEA 4JGYC 1KJRA 1R1A2 2XBO1 1W6PA 5D8AB 5ABJA 2ZX4A 1RGSA 1QJX3 4O9EA 1I6XA 3VBSB 1WMEA 4FXGB 4KWKA 1LOAA 1SLLA 2P3JA 1VBA3 2WFF3 3MW4A 3KMHA 5C8WA 2R071 1BZWA 3U0ZA 1V6KA 1VBE2 3MW2A 5L19A 1X8EA 1W6QB 4IEQA 1REFA 2GDFA 1IGOA 4Y24A 4G3YC 1R092 1ZBE1 3SISA 5FDBA 1AYM2 2NQYA 1W39A 3AYCA 4LO6B 1NCRC 3ZDSA 3WP5A 4XJ9A 1N1VA 4PCRA 2VNOA 2GC1A 1BEV1 2Z5WA 3LA2A 4Y22B 1DLLA 1H9PA 3N7KA 1RHI1 2NM1A 1FATA 2ZPXA 4I0WB 4BLIA 4YNIA 2RS53 2Q1ZB 2IFRA 4MVTA 5C6CA 2D44A 2CWMA 3MPBA 2A3WA 4P14A 3ILRA 1IS5A 1Z7S2 2DCJA 3A4UA 4ZKTB 3GF6A 4FO9A 3T1LA 3JD72 3JQWA 1OA4A 1RUG2 1SQ4A 1RUD2 3AMNA 2PYTA 4HSLA 4XHBA 3GBGA 4ASMB 3ZPYA 5J98B 1S0JA 3CJIC 1B35C 1FPN1 3O0WA 4CDQB 2R042 2CGNA 1RUH1 1IKQA 5DUWA 1UCXA 4LEJA 4DFSA 2G9GA 4HPKA 1WMFA 2W68A 3MF9A 5JZGB 2WINB 1EAH1 4QHBA 1CD3G 3RYKA 4BHPA 1JN2P 2WS91 4WBBA 1RMU3 2B7YA 1AXKA 1BBT2 4KGGA 1IS3A 3HN1A 2GAUA 1AYN2 4FPKA 5T5LA 1GZCA 3D5OA 1PO21 1IOAA 1OLQA 3ZN6A 3M7AA 1Y43B 1VBC1 1C3HA 3THTA 2XG3A 5JIAA 2EXHA 2HWF3 4AEDC 1RUC2 1H2KA 5D8AA 3H7YA 4R8HA 4ONUA 1DYPA 4KBBA 2VW1A 3VBSA 1TME2 2R6QA 1KJLA 2WQ4A 1ZBA1 2BYVE 4FPFA 4PLNA 5H9QA 5DUXA 1AXYA 5DDJ2 4Z1VA 5AFEA 5JI7A 5BY5A 2ZBJA 1W6QA 1QGLA 4HVQA 1TNRA 2H0VA 1SLAA 4WVWA 3B93A 5K9YA 2LM3A 1AL0G 1ZZCA 4G9SB 1UW8A 1W0OA 1S0EA 4IESA 1WA4A 2E51A 1V6JA 3PLQA 1LGBA 4AEJA 3H3ZA 1KXGA 2QUOA 4R9CA 5BNNB 3VV1A 2W52A 2O8OA 2H6BA 4RS5B 3V65A 4Y22A 4A7KA 3NV3A 4QGLA 1VRH3 3ZIXA 5JOWA 1QJX2 2BFUL 1FMD1 4NHLA 5EV7A 3BCWA 1PNGA 4OHZA 4GALA 3FC0A 2HWC3 3ME2A 1VBA2 3M2MA 4PJYA 1O4TA 3ZXLA 3NKGA 4C0HA 3BB6A 5BNPB 1WBFA 3H1WA 3ALQA 3B02A 1CIWA 4Q4V3 3QH7A 1RUF1 1DG6A 3SXWA 1MS3A 3FHIB 4K7JA 3WG4A 1QH7A 1G8WA 4CEWB 2AENA 3CJXA 1MVEA 4YZ1A 4RGGA 3H1MA 1AZDA 5F6KA 2TBVA 4Q1RA 4BQ1A 1H0BA 4CDQA 1GYKA 1VALA 1H4GA 4W65A 2WT1A 1A6CA 1SFYA 5JZGA 4LLOA 4XQWA 5CG9A 3RRDA 3EQEA 1V6LA 1EV11 2ZGKA 1GICA 1OQEA 1UU6A 1NE6A 2RS52 4W6YA 1VIWB 1QXRA 2WSUA 1Q8SA 2DVFA 2TEPA 3H9AA 3RSJA 1DQ4A 1H8VA 4KU7A 4Z07A 5JOXA 2D40A 2PHRA 2D97A 4BPZA 3J9SA 4AI2A 1X50A 4FPOB 4IXLA 1YYNA 4F3JA 1NA1B 2SBAA 2JX9A 4AF9A 1FNZA 2MNGA 1NY71 2JXAA 5FAXA 1QJU1 2ARBA 2XJUA 4PDWB 4PIXA 4ES9A 1S1AA 1C8M1 4DOUA 2VQAA 1QJZA 1O91A 1UKRA 4MUVA 1UD1A 1RUE3 1PNFA 2CTVA 1CAXB 3R4DB 4YG0A 1HRI1 3MFAA 1REEA 3LSDA 5CBLA 5FPXA 2RS33 1RMU2 1AR91 1S0DA 1LESA 1XNDA 4AQ2A 3H1YA 1C57A 4F8AA 4YGEA 3QBQA 5BNNA 4XJ8A 2OIIA 1H2NA 2BVVA 4RS5A 2HWF2 1Y9QA 2D6LX 1QY4A 2HWB1 4K3UA 3B7MA 1I9RA 2R063 2P17A 3ELNA 1WCKA 3R4UA 2CL2A 1UX6A 4AWDA 5JLVA 1J59A 3UL2A 1ZZ8A 3RQ0A 2JECA 3CNAA 3RS6A 4AE2A 4YM2A 3VZJA 2MHFA 4FPLA 4EJRA 3WY6A 1ND3C 5BNPA 4XFGA 2JG8B 3ZVXA 2FZ1A 2R072 1AL21 2ERFA 2HWE3 4K20A 4YFZA 2P34A 4LBLA 5I8SA 5J37A 4M0NA 1TE1B 5E88A 4OI4A 1WLWA 1H8TC 2IZWA 5BPXA 5HCBA 3ZYPA 1VBD1 4AVBA 4CEWA 1PK6C 1S2BA 1YI7A 1DU3D 3NV1A 3S0MA 4YVWC 1V6NA 5BNOA 3WG1A 4RSUA 1QHDA 4GKXA 4M01A 2YZ4A 2JE7A 3FJSA 4P9XA 3GBFA 4R9DA 4GMP3 3ENRA 1ZRCA 1RHI2 4ISQA 1K5MB 5KHHA 4FPCA 1SCRA 3EO6A 3FBYA 3I2DA 3DL3A 3S6PA 4ZU4A 1COV3 1G9DA 1Y3TA 5CIRA 1QMJA 1FYUA 2XKOA 4HETA 1MEC1 2RMU1 3V56A 4Q4V2 1RINA 3FFZA 1DGRA 2WZR1 3AM2A 4KQ7A 1NA1A 1POV3 4B3NA 3SHRA 2EIGA 3HT2A 4PDWA 4N43B 1MZ5A 1TEIA 4UW4A 5LRRA 3WINE 3AB0A 1U5YA 3N35A 1FPN2 1GNZA 4ZU5A 1MS0A 4E4DX 1ZYBA 1CAXA 2GC3A 3MEPA 3ZYIB 4CEYC 1WCDJ 4RR3B 1C8NA 2ZX2A 3BIWE 1EAH2 1ZREA 4LO7A 3NW4A 1ZX5A 2WWSA 4S2DA 4S2GA 4OHXA 3J8F1 1NXMA 4QQHA 1Q8QA 2AR6A 1GQHA 3DV8A 4C91A 5EJ3A 5E89A 1SLTA 1LJ7A 1CQ9A 2C9AA 3J4UH 2B45X 1AR71 1ASJ3 4Q4Y1 3VL8A 1BVVA 3R05A 2JG8A 3V0BB 2E53A 3T1MA 1RTVA 1T6GC 1G9AA 5JSOA 2CY6A 5EYYA 1JBCA 2GMPA 2RS32 1H1AA 3ZMOA 4LHLA 2PAMA 3WDVA 2QJVA 4LBNA 4EN6B 4LE4A 2WNEA 4OHWA 4XMIA 1RUOA 4IEUA 2XVLA 2ZMLA 3P3NA 4EV0A 4XILA 2R062 2ZGLA 1YIFA 1TQ5A 5A32B 4R4XA 2YMZA 3R4SA 1CAUB 2WNVC 4WV8A 1AR83 1K5MA 3KM5A 1PHMA 2A75A 4META 5FLIA 4GQ7A 5ACA3 3QOPA 1O5LA 1PVC1 3IT8A 3M3IA 2HWE2 2ZGSA 4MXVA 1BXHA 2VVFA 4QPGC 3TAYA 5L73A 1RUI3 1CJDA 2PLV1 1WMDA 3QCWA 3AKRA 1MZEA 1ND2C 2K9ZA 4N43A 1O3RA 1V00A 4LA3A 1N3PA 1APNA 2X5IB 3WLUA 4BA6A 1BMV2 4BH9A 2WIIB 4DB5A 5T52A 4CRQA 2W08A 1NXD1 2KM2A 5E8AA 2UWBA 1XYOA 4RR3A 3I8TA 4XFCA 2EF6A 5AVAA 3VBRB 2AH2A 1GR3A 1SFNA 2Y0OA 4E2SA 3AMQA 5I93A 4UXAA 3EBRA 4XW3A 1WW6A 4IV3C 5DZFA 3AXEA 1UIJA 2B5HA 2D93A 2AUYA 1DGLA 4DRVA 4A7YA 2RM23 1LULA 3FFQA 2XUMA 3WUDA 3VBUC 2WL1A 2ZGMA 1XE7A 4WZFA 4FAGA 4NHKA 4FTEA 4I3PA 4BOWA 4Q8KA 4E4SA 3CO2A 1PZ8A 3GBWA 3WG2A 1ONAA 4K1YA 4AQ6A 4B4RA 3V0BA 1AXZA 4YYOA 5JPMB 3URFA 2IXHA 2CNAA 4HBNA 2QQPA 2ENRA 4QPIB 2OYZA 3GHMA 3RG0A 1Z0HA 1LHOA 3ZSJA 1HRI2 2ZGUA 1D4M3 3NWKA 4COWA 4ITCA 3PVBB 1RJ7A 3BALA 5D8AC 4A7ZA 3WP4A 3H0OA 3VBSC 1LCLA 1F9KA 2ZKLA 3KGLA 5K7PA 4QU2A 5J96B 1HRV1 4LT5A 3VKMA 5A32A 1WD3A 1CAUA 1JH5A 2RS13 4FT8A 4MX3A 1HDKA 1RUJ1 3N36A 2D3SA 2PAKA 1SBDA 1NCQC 3PMEA 3D0JA 2PHUA 2YXSA 4DS0A 4EN9B 4RQPC 1AR61 1L3JA 1PO11 2D6KA 2IXLA 4QGMA 5JAXA 1YWKA 3OGGA 1EP0A 4D7SA 1PIV1 4K1ZA 2Z2SB 3O0XA 1YO8A 1Z7S3 4AYUA 1YXWA 1HLCA 3MIGA 5SV8A 3JD73 4Y1XA 1OD5A 5CB7A 2WFF1 4N9IA 2X5IA 1VBD2 3G6JB 4XTPA 1CAWB 3ATGA 2D7FA 1DGRN 1SBFA 4LUKA 5I91A 2JD4A 2H6CA 2OZ6A 2XVGA 2R043 1UKGA 3K51A 4AK3A 5KBFA 1NG0A 2HWD1 3VBRA 4U2AA 3W9AA 1M4WA 1YRZA 4H3WA 4XF3A 1C5HA 3BPZA 2VECA 4L97A 2JEMA 2GNBA 5JR7B 1SLCA 5DG1A 5ACA2 5LEKA 4L99A 3POWA 3CF6E 4H14A 1AX2A 5JSPA 5GZFA 1G9BA 2RMU2 1RUI2 4RHV1 4YM3A 2XL9A 4FXKB 3IBMA 4CDQC 2ZHLA 4S2HA 5BNQA 4H7MA 4ATFA 4MGIE 4A3XA 1FAYA 2D5FA 5LEJA 1AX1A 1OMIA 4C1XA 2E63A 3KB5A 3I4IA 1CAVB 4XJWA 5DDJ3 1GSLA 1LRHA 5C9AB 5FO9B 2VOXA 3JBG1 1QH6A 5CAZA 4QPIA 3RI9A 3VGIA 5HBAA 2JICA 3ZFGC 2VMIA 4YZ5A 1QQP3 4E27A 1S0GA 2C1FA 3M4FA 2IXIA 5L7OB 3E5XA 2ZA9A 5GLTA 3E6BA 4GH4C 4AEKA 3AJZA 4COUA 1SLIA 3FUOA 1FNYA 3B01A 5AC93 3MZHA 2IXJA 2RM22 1X33A 3IDBB 3PVOA 4IV1B 1LGCA 2YC0A 1X82A 1GLHA 3PHMA 5LK5A 2IWGB 1JYCA 4MH0E 3AMMA 1LOFC 1RVF3 3SCFA 4Y4YA 1DBNA 1SDWA 3ZXDA 3DPRC 1F2NA 4B4QA 4BE3A 2QNKA 3KGZA 4YGDA 2GN3A 4Q4W2 4XPVA 2GZWA 1RIRA 3HBZA 4LBQB 2P2KA 2F4PA 2DUQA 3GYDA 3KT1A 4YW1A 3GZUC 1D4M2 4XOGA 2MEV3 2DVAA 4MLOA 1PZ7A 4HN0A 5JOZA 2ZTNA 1CAWA 1IQAA 2ZGTA 1KD7A 2GMMA 4AHZA 3VUOA 3LZZA 4Q4X1 1FOD1 3ILNA 3LOIA 1MR5A 3KT4A 3PMSA 2NP0A 2D6OX 5E16A 2RS12 3PJQA 1UU5A 4IEZA 2A3XA 4Y20B 4CDXC 4XF1A 1OFSA 3WD5A 4JDOA 1DZRA 3OF1A 2BNMA 2ZX3A 4XZPA 1HKDA 3RMYA 4BYYA 4QM8A 4HFSA 1PGW1 4AGVA 4ASLA 2DF7A 4FBFA 4CEWC 1LKNA 2GALA 1OLRA 1UU4A 5A3LA 4N53C 5BNOC 1BVP1 1VRH1 3AKTA 3L9JT 1HW5A 3B69A 2D6NA 1UL9A 4MSVA 4P9IA 2A71A 2VW0A 3VHRA 5CG8A 1LHVA 2GU9A 2HWC1 3AJYA 2D6PA 3ST7A 4XJZA 2DCTA 1CAVA 1CJPA 4QX5A 4XE9A 3VL9A 1QJY1 5C9AA 3G7DA 3VBOB 4K9SA 4J1XA 5GLUA 2A70A 3ZXGA 5HI0A 4KGQA 3PVEA 4HL0A 4HN1A 3SLIA 4DZGA 3AZXA 5L7OA 1YNAA 2QDNA 4JQRA 5CNAA 1H9WA 4XQDA 3WT3A 4AVVA 3GHNA 4YM0A 2A6XA 1LOEA 2TNFA 2NYYA 1G6NA 2VULA 1ZZBA 2UU8A 1HXS1 4X6QB 1V6MA 2WLPA 2VMHA 4IV1A 1DIWA 3ROUA 2Y38A 3AZZA 4NVPA 5FMOL 1YHFA 3RJRA 4MV2A 3VHNA 3NAPB 1UZZA 3S7EA 1XYNA 2DVGA 5KC5A 2XBO3 2PHWA 1V9U1 4KL1A 5GM0A 5CFCC 2WNUB 4X6RB 3ZFEB 5K0UB 4CTEA 1C4RA 1Q43A 3ZN5A 1CGPA 4IQPA 4FOWA 4QMAA 2BNNA 2R073 4X8PA 4LBQA 4YVSB 5IK8A 1JXNA 1AJOA 3KQRA <