1RVF1

Fab complexed with intact human rhinovirus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 32
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf100
4RHV2 5C4WC 1VBE2 2PLV3 1RUJ1 3ZFGC 1Z7S2 3JB4C 3VBHC 5CFDB 1B35B 1RUE2 4Q4W2 3JBG2 1AR61 4YVWB 3VBOC 1QJY3 2BPA2 4IV1C 1ND2B 1BMV1 1HQNA 2IZWA 4GH4B 1MEC1 4CEWB 2BFUL 2RR11 5BNPA 2RM21 1NG0A 1A6CA 2HWF2 2RS32 3NAPC 5A32A 1RUF3 1D4M2 1VBB1 1QJU1 4PDWA 1R093 4QPGB 4JGZB 1HRV1 2GH8A 4JGYC 4Q4V2 1COV1 4Y5Z0 1AR82 1ND2C 1FOD1 1AR93 2MEV1 1ZBE1 4Q4X1 1ZBA1 2RR13 2RS13 1CD3G 3JB8A 4QPIC 2BBVA 5BNPB 2RM23 5K0UA 3VBSA 2X5IB 1AYN2 1H8TA 1SMVA 5DDJ3 3JBG1 1VBD2 1VBB3 2PLV2 4BCUA 4RR3A 1TMF1 2HWB3 4PDWB 4CDXA 1PO13 1RUD2 1HRV3 2WS93 3ZFEB 1OOPB 1C8M1 1NY72 2XBO2 1EV11 3J8F2 5LK7B 1PGL1 1ZBE3 3VBUA 1PIV1 5D8AA 4RHV3 2RS31 4Q4X3 1VBE3 5BNPC 1NCQA 1Z7S3 5JZGA 1BEV2 1RUE3 4RS5A 1HRI2 3JBG3 1AR81 4PDWC 3VDDB 1RUJ2 1TMF3 4RR3B 1M06G 1F8VA 4CDXB 4AEDB 1R1A1 3VBFA 1WCDJ 1MQTB 1AR62 1GFF2 1BMV2 1HXS1 1VB4A 2HWF3 2RS33 1R081 1MEC2 1D4M3 1NCQB 2RR12 3VBSC 5K0UC 1K5MA 4GMP3 1H8TC 2RM22 1AL0G 3VBHB 1RUG1 4Q4V3 1AR83 5C8CA 4CDXC 1QJU2 1RHI1 3VBOB 1W39A 5C9AA 4IV1B 1HRV2 2RS51 1COV2 2WFF1 4Y4YA 1PVC1 3DPRA 1FOD2 3VBUC 5A33A 5D8AC 1FPN1 2MEV2 1AYN3 1ZBE2 1FMD1 1NCQC 5JZGC 1VBD3 2WWSA 4Q4X2 1ZBA2 1BBT1 4RS5C 1K5MB 1RUD3 3NAPB 1QQP1 4GB31 5CFCA 1VBA1 1RUG3 4CDQA 2R041 2XBO3 4JGYB 2BFUS 3J8F3 1TMF2 4FTEA 1QJX1 3VBFC 4CDUA 2RS53 1C8M2 2WZR1 3IDEA 1POV3 1RVF1 1RMU1 1EV12 5A33B 1BEV3 1HRI3 1PGL2 4QPIB 2HWD1 1PIV2 1ASJ1 1VB2A 1K5MC 4RQPA 1RUJ3 4RFT0 1OPOA 1ND3A 1EAH1 1QQP3 5C8CC 1VBC1 4CDQB 4N53A 1AR63 2ZZQA 5C9AC 1QJX3 2HWC1 3DPRC 1R1A2 1AYM1 1MEC3 1RMU3 5L7OA 4Q4Y1 2R072 1HXS2 1R082 1VRH1 5CFCC 5A32B 4RQPB 1QJU3 1ND3B 4N43C 4CDQC 1VBC3 1RUG2 5BNNA 1COV3 4SBVA 1FOD3 1RUC1 4CDUC 4LLFA 1RHI2 2MEV3 3VBRC 2RS52 2WFF2 1ZBA3 2ZTNA 1PVC2 1AL21 5K0UB 3VBSB 1FPN2 4WM8C 4RQPC 1FMD2 1H8TB 2HWE1 1ND3C 1NCRA 4IV3A 2Y26A 1BBT2 4GB32 1QQP2 2FZ2A 2RMU1 4N53C 1VBA2 5BNNB 1C8M3 2R042 1EV13 1RUC3 5ACA1 2R071 4CEYA 1QJX2 3VBUB 1PIV3 3HAGA 3M8LA 5L7OC 5D8AB 2WZR2 1RVF2 4EJRA 1RMU2 5JZGB 5ABJA 3CJIA 4RS5B 5AC92 2HWD2 1ASJ2 3ZFFA 1RUI1 1X33A 1EAH2 5BNNC 1VBC2 1R1A3 3JD71 3VBFB 1TME1 4Z92B 1RUH1 1NA1A 2R073 1HXS3 2HWC2 5CFDA 3ZXAC 1B35A 1R083 1AYM2 1V9U1 2GSYA 1PGW1 4YVWA 4Q4Y2 1QJY1 1NCRC 4IV3C 4N43A 4CDWA 2TBVA 4GH4A 5C8CB 1VRH2 4CEWA 1RHI3 5C9AB 3JD73 1TME3 3VBRA 2WFF3 1PVC3 3DPRB 4CEYC 1RUC2 1AUYA 1RUF1 1FPN3 4QPGA 4JGZA 1R091 1FMD3 5AC91 4WM7A 4YVSA 1V9U3 4WM8A 5ABJC 1BBT3 3CJIC 4GB33 5CFCB 3FBMA 1AL22 1VBA3 3ZFFC 3TN91 4N43B 2FZ1A 2R043 4CDWB 2HWE2 1AR91 4GMP0 4NWWA 2RS11 2RMU2 4CDUB 1NA1C 1AR71 2X5IA 2WZR3 3VBRB 1RVF3 1PO21 5DDJ1 5CFDC 5J96B 5ACA2 1B35C 5AC93 2HWB1 2HWD3 1ASJ3 1PO11 4WM7B 4YVSB 4WM8B 1HX6A 2WS91 4YVWC 3ZFEA 1OOPA 1EAH3 4CDWC 1DDLA 3TN93 4GH4C 4N53B 4CEWC 1RUI2 2R062 4RHV1 1VBE1 5J98B 2HWC3 1Z7S1 1AR73 1IHMA 1VAKA 3JD72 1AYM3 1RUE1 1TME2 1PO23 1RUH2 5L7OB 4Q4W1 2QQPA 4QPGC 1RB8G 1C8NA 4JGZC 3VDDA 4WM7C 4Q4Y3 1POV0 4YVSC 4AEDA 2ZAHA 1VRH3 1F2NA 1V9U2 5FOJB 4FTSA 1MQTA 1PGW2 5BNOA 1QJY2 1E57A 2HWF1 1CJDA 1D4M1 2X5IC 4NWVA 5C4WA 4GMP1 3ZFGA 3VBHA 4FTBA 4Q4V1 2BUKA 4Q4W3 1AL23 1RUF2 3LOBA 1R092 3ZFEC 3VBOA 1OOPC 2HWE3 4IV1A 1NCRB 2R061 4IV3B 5BNOB 1X36A 2RMU3 3TN92 1AR92 1AYN1 1QJZA 5GKAC 1VBD1 2WLPA 5ACA3 2PLV1 2RS12 4CEYB 3NAPA 5C4WB 1RUD1 3ZFGB 1AR72 3VDDC 1PO22 1NOVA 1OHFA 4RR3C 5DDJ2 4JGYA 1NY71 2XBO1 4AEDC 3J8F1 5ABJB 1VBB2 1ND2A 2HWB2 3CJIB 5FMOS 4FSJA 1PO12 3ZFFB 1MQTC 1RUI3 2R063 5BNOC 2XPJA 2WS92 2DF7A 1POV1 3S6PA 5FMOL 1BEV1 1HRI1 4QPIA 1RUH3 2VQ0A 1NA1B
chains in the Genus database with same CATH superfamily
3PVBB 2LUWA 5LK5A 1JYCA 1VBE2 3JXSA 5A7NA 3GXUA 4X8PA 3ZDVA 3RZKA 3G7DA 3R05A 2QTWB 4XIKA 4HLTA 5FLJA 3T0AA 3VBHC 2A3XA 2VCCA 4O7XA 4CP0A 2ZGSA 4PBOA 3G6JB 4YZ2A 5FYZA 3ZXLA 1W6OA 1G8WA 2OQ6A 4QAWA 1AR61 1OH3A 3AP4A 3DGTA 3WQ0A 1QWRA 2YROA 2CGPA 1XE8A 1ND2B 4FP2A 4BDVB 4AEMA 3IBMA 2VUCA 5IK5A 5EYYA 2ZGMA 4CEWB 4D7TA 4YW7A 1JZ7A 1WMEA 1KFUL 2RR11 3I2HA 4FOVA 1I1EA 4BQ5A 5BNPA 1O7FA 1W6MA 3MI8A 4IL7A 1JXNA 4ZS3A 1NG0A 5B4XA 1GWKA 2QQMA 2HWF2 2DU1A 5JSOA 4H7LA 2GMPA 4OUEA 3MFCA 2QQOA 1NYWA 4XCAA 1D4M2 1GP5A 4JGZB 3H1YA 2UY9A 5D1IA 5FP8A 1JYIA 1JZ5A 1GR3A 4Y22A 1KITA 3B94A 1JYVA 4AVAA 1DGWA 3SNMA 2VL4A 1ND2C 2FDHA 4DPNA 3RZZA 4HN0A 1FOD1 1OVSA 3PJYA 2YYOA 4QX0A 4QB1A 3ZYBA 1CPNA 3Q8EA 1HKDA 3ZR5A 2J42A 3L2YA 1RYYA 3NVCA 1ZBE1 2QQJA 1RITA 1IGOA 4M0NA 4Q0QA 4XMIA 3VB9A 3U1XA 5CG8A 4K20A 1HB4A 3Q8BA 2WNEA 1ZBA1 3RGBA 2WSVA 3AFGA 4LORA 3MF6A 4QMAA 1V6IA 4LO4B 2WQZC 2ZHNA 5BNPB 1QEXA 4JDOA 2XKPA 2Z5WA 1BJQA 4B29A 1AYN2 2W3JA 3CLPA 3SH4A 1CX1A 1SMVA 2PHUA 2VJXA 2WNOA 1J3PA 3FHIB 1VBB3 4EN6B 1DQ2A 4I0WB 2HWB3 4CVUA 3K4DA 3KGZA 1PZ8A 4KU8A 1Z0HA 5E89A 4OI0A 3PTYA 1JMUB 2W94A 4KGQA 4QKNA 3ZFEB 4AFMA 3T0DA 1QH7A 2VCBA 3RJRA 4AZZA 4XF3A 1S0GA 2XBO2 2BV4A 3D8CA 3CIHA 1H9PA 2LRPA 4XBQA 2E51A 5HV4A 3VBUA 4QXCA 1RJ7A 1GKBA 4EN8B 4F3JA 5JAXA 5BNPC 3T0BA 1QMJA 2V5YA 2CAVA 1GOHA 4U36A 5KWRA 4HPKA 1BYHA 4UAPA 1UNBA 4AEKA 4AI0A 4RS5A 1HRI2 5JVVA 4KG0A 3JBG3 4QHBA 1D7PM 1KFXL 2E7AA 3V0BA 3ZPOA 3UV9A 3RYRA 2XLAA 2Z2SB 3POEA 4MGZE 4CU6A 3ACHA 3GM8A 3LDRA 3SCFA 3WDXA 4YARA 1X7NA 1WCDJ 3AZWA 3USSA 1OQDA 2UWBA 4BQ2A 2AYHA 1GFF2 2ZS6B 4AVTA 5D2AA 3TWIA 2CDOA 3POJA 2ZMKA 3ZYIB 5CNAA 1WW5A 1BMV2 4BMBA 2BGPA 1UXXX 1VB4A 2VTXJ 1XBFA 2MNGA 2RS33 2PXJA 1MEC2 3OBRA 4W6XA 5AVPA 1LEDA 4IETA 1ZZ7A 3DV8A 4S2FA 5I0UA 3AMHA 1K5MA 1GWLA 4HPKB 5DUWA 2RM22 5M0TA 2OYZA 3SHRA 4Q4V3 1TZOA 2X53S 4BE3A 4K1ZA 5C8CA 5JPMB 4LBQA 4D0QA 3MO4A 5CEHA 1W2NA 2P6CA 2Y64A 3AMQA 3E5QA 3LA7A 3LZZA 1OI6A 4B4PA 4E4HA 4EWEA 1RHI1 1MS8A 3N9LA 4MO3M 1HRV2 2FMYA 2RS51 2VOVA 3MIDA 4UFKA 3KT4A 1Q43A 5LEJA 1OLQA 2D6LX 2WFF1 2Y60A 1PVC1 2JENA 4Q26A 3LA3A 4JDNA 1IQAA 4J1WA 4MYEA 3VBUC 5D21A 5ANNA 4ZPIA 1PMJX 3THCA 3AYCA 4YG3A 1U0AA 3NMBA 2RHPA 3IAQA 5DABA 1DZQA 3AP5A 4OMCA 4LA3A 2BU9A 1PM4A 4QPYA 4RS5C 1K5MB 3NAPB 5FUNA 1WGPA 4HN1A 2G9FA 4CDQA 1H0BA 1KDKA 2VBPA 4QDSA 3T2TA 2DCTA 3WNXA 1BCXA 4DXZA 3J8F3 3VZKA 4DUVA 3P5BA 4FPKA 5EV7A 5FMCA 5A3NA 1WBLA 1TMF2 3S7IA 2HLEA 3WD5A 4S2HA 1S1AA 4Z07A 4CDUA 4IW3A 3RDIA 3VKOA 2YFZA 3IDEA 3WQ7A 3R4SA 4PI2A 1WMDA 2Y0OA 3ILNA 5T54A 2RJ2A 4CCJA 3KCCA 1STMA 1EP0A 5A7QA 3FZ3A 4A42A 4QPIB 4NJ4A 5EFUA 2LALA 5FK7A 1GU3A 1LTEA 3H0OA 2IUWA 1K5MC 2WAOA 3Q8AA 4IEXA 4RQPA 1RUJ3 4RFT0 5CKNA 2OS2A 3B02A 2VMHA 5EJZB 3LDKA 2H6BA 2H0VA 5C8CC 2QE3A 2IC1A 3D6EA 1D2QA 1CN1A 3OBAA 2ZKLA 3OD4A 4CDQB 4N53A 4LJHA 4TWTA 4UOJA 4MH0E 1HN1A 1W6NA 2P3KA 3DXUA 3EB7A 2A75A 5E8AA 5KHHA 4R52A 2ZCWA 4G4FA 1CAUA 4QU2A 3AFKA 3KD4A 3AKQA 4PLOA 3SC7X 4AEJA 1RMU3 1G6NA 2D6PA 3NKGA 4W6YA 5L73A 1CGPA 4NHYA 1W0OA 1E5HA 4OVEA 3KB5A 1K3IA 2C9AA 4FXGB 2O1QA 2BJSA 2DVAA 1VRH1 2VZPA 3N7MA 3BALA 5A32B 4RQPB 4UFHA 1DQ4A 4LBOA 1SLTA 2AGSA 4MG2A 4CDQC 5F2SA 1I3HA 1CZSA 2DCJA 1X50A 4BU2A 4IGPA 3R4DB 1ENXA 1RUG2 1DZTA 1X9PA 4QGMA 4XDPA 1ZZ6A 3ACIA 3PDQA 5BXXA 3VDDB 2H6CA 4E8CA 3THPA 4HSJA 2R7EB 2UURA 4CDUC 1GLHA 1J1LA 2MEV3 2V5DA 3GGLA 3VBRC 1CAUB 2VZQA 4OULA 4Q1RA 5JXHA 4D7SA 5FYCA 2ZGKA 1MPXA 3LPFA 1LHVA 4E2SA 3FFZA 4LA2A 1JZ4A 1ZRRA 1JYNA 4TTGA 1FPN2 3POGA 5DAPA 4RQPC 1FMD2 1H8TB 3VZLA 3AZZA 1NCRA 2Y26A 3I3BA 1WBFA 1HQLA 5CIRA 3CL1A 1BBT2 5EQUA 1QQP2 3PUAA 2RMU1 4N53C 1OKOA 3MW4A 2VVFA 4M3CB 2BBAA 3H8UA 1C8M3 2YU2A 2RDNA 2QQNA 2MHFA 1EV13 5DZEA 2F4LA 2QDNA 3CJXA 1VAMA 2ETEA 2ZA9A 1DP0A 4FCAA 4CEYA 1QJX2 2JKXA 2Y6FA 1G9CA 5FZOA 1PZ7A 5FP7A 5EIYB 1RVF2 4XFIA 5IHRA 4LBQD 4LXLA 2XLFA 3UNPA 3BVCA 3POIA 5LCWL 3O1UA 2TUNA 3DYPA 3IKWA 2VW1A 2PN5A 4BXSV 4LO8A 1J3QA 2K0GA 5L9BA 2HWD2 2YMZA 1ASJ2 3ZFFA 1RUI1 2EIBA 4XXPA 4AQSA 1EAH2 1G9FA 3ZN6A 4PI0A 5FP4A 3DEMA 5AFEA 2D5FA 1SCRA 4PHZA 3ZXJA 1VBC2 2PHDA 4E4DX 3JD71 2EA7A 2D98A 1OLME 5FZKA 2NMOA 2ZPXA 2VTFA 5GZGA 1NA1A 2VW2A 1BHGA 2HKXA 3M7AA 5K7PA 5E1RA 2R073 1H1AA 1HXS3 2CL2A 3ST7A 1J84A 1LB2A 2HWC2 4C91A 4CXWA 1Q3EA 3P3PA 1CAVA 1R083 1LRHA 5FXXA 4LK6A 1V9U1 2DUQA 4W4ZA 4DRVA 4QGLA 5JPNB 4GALA 1RUOA 2W87A 4PIXA 4Q4Y2 2Q8OA 4OFGA 1NCRC 2BGCA 4N9IA 4CDWA 1VLNA 5H9SA 3ROUA 3KSCA 3SKJE 1DGLA 5T50A 1PVXA 2PA7A 3DYOA 3NRUA 4NIHA 1UZVA 2NZ9A 5FY9A 2NLRA 1LHNA 4XJWA 4IEQA 4I02A 3OYWA 4CEYC 1OA4A 1RUC2 1YJKA 4DOUA 1AUYA 2FCUA 3VL8A 1YQCA 5FO8B 2OPWA 4QPGA 3MUY1 2CU5A 2DV9A 1G9BA 3C3VA 4YVSA 4MZUA 4WM8A 1JZ6A 1F4HA 3VKMA 5CFCB 1XYPA 4L8QA 3DN7A 3UGFA 5C6CA 1AL22 4QU1A 3ZFFC 4AGRA 3K4ZA 4E2GA 2VOTA 3DL3A 3H7YA 4IEPA 3OBZA 4CDWB 4YM2A 4GMP0 1UY4A 1CAWB 5F9TA 5I0SA 2GALA 5KR7A 3BIWE 2W2IA 1UW8A 2VPVA 4FFFA 2EIDA 4QD2A 4R9CA 1NA1C 1AR71 1GICA 4HOOA 2X5IA 4JKLA 1PO21 3HPNA 4XAAA 2Y6LA 1I5ZA 3ITQA 3OYWB 2W91A 1NQJA 2DVBA 1XRUA 2X10A 3W20A 4BK5A 5C3SA 5CA6A 5AC93 5F1RA 2NQYA 2HWB1 2OUJA 4LTAA 3AKRA 5DPNA 1TQ5A 4DEVA 1N3QA 4YVSB 4DIQA 4WM8B 1OOPA 5KHGA 4BXFA 1QF3A 2FHRA 3EMRA 4CDWC 1FYUA 5FK8A 2Y34A 3KV6A 1OFNA 3TN93 3N35A 2CTVA 4A44A 2SBAA 4XHBA 1FNZA 3VZNA 2BERA 5SV5A 4AGVA 3NJXA 1ULEA 2R062 2A3WA 4D6RA 3GBWA 5AFBA 2BOJA 3O1TA 5BV6A 5FPLA 4QX7A 4UW5A 1QY4A 1LR5A 1VAKA 1AYM3 1IS5A 1TME2 1GUIA 3IPVA 4LMFA 2E31A 3WHTA 1DGWX 4BWOA 1U5YA 3AB0A 1X8MA 2WKKA 4Q4W1 4QPGC 1IZ3A 2DVDA 5T5PA 3VDDA 4EV0A 4HK8A 4LO6B 1BVP1 4N9HA 3ENRA 2C5DA 4TYSA 4YVSC 3WX5A 4XQ4A 2RVAA 4DNYA 4WZFA 3KV4A 4G3YC 4DZGA 4FPHA 4CYDA 5A7WA 2EVXA 2ZGNA 4JC1A 3M3EA 5CKQA 1US3A 2W1UA 4AVVA 1QJY2 4K1YA 3IDBB 2Y6GA 3WG1A 3HNMA 4ONUA 1UOBA 5IVFA 5JXJA 2RG4A 5H9PA 4HZFA 1H1MA 2VMEA 4TN7A 3U10A 1GZTA 1UZ0A 2ILMA 2X5IC 1DFQA 3LD8A 3Q8FA 4MOAA 4NWVA 5C4WA 1CZVA 3WG2A 3ZFGA 5C3OA 2PAMA 4AWDA 5BUVA 3IPVB 1VPHA 4IE7A 4B1LA 3LFIA 4Q4V1 1IQDC 2NP0A 4J6GA 2EICA 4OHWA 3SLIA 1A78A 4HVOA 1JOJA 2ZX4A 3QCWA 3KF3A 1YFUA 3UKNA 1RUNA 2OX0A 1RINA 1OOPC 2XVLA 2AUYA 2R061 5FWJA 3D0SA 4GWMA 1HN0A 4EN0A 2C9KA 1OD3A 1JZ2A 5FP9A 5LA0A 3UKVA 5A6XA 4OMDA 5JWPA 1YWKA 3HD8B 4HKOA 5ACA3 2PLV1 2W5FA 4NAMA 4B3NA 3POFA 5C4WB 4XW3A 1QGLA 3RYKA 3ZFGB 1TE1B 2KD7A 4IQPA 5FWEA 3VDDC 1CAXA 2VECA 3A21A 3CU7A 3CZUA 1LGBA 5DDJ2 4UF0B 5FPZA 4JGYA 1NY71 2YDEA 4LITA 3J8F1 1RL3A 3VD4A 1CQ9A 4COVA 3BU0A 3BYWA 3JQXA 4HG6B 4QX3A 4Y1UA 1PO12 3VN4A 3TOJA 3AMPA 1W8OA 2DF7A 5F5IA 2HJIA 4QKFA 2JDHA 1DYOA 3H1MA 2GC2A 4Y1XA 5EHDA 2GMMA 2UYAA 5FYVA 2D43A 1RUH3 2BVVA 4UFIA 3GCXA 5C4WC 1GNHA 1UN1A 4AYUA 3QLQA 1RUJ1 4WVZA 3ZFGC 5IVCA 4CXYA 1Z7S2 2ES3A 4PLMA 3PHMA 3ACFA 3MV01 5FZCA 5FZHA 3LGRA 3WQBA 1H30A 1W0PA 1ZZBA 2DUOA 4QM9A 2PYTA 3M4FA 5IFPA 3FLTA 5IVVA 1CAXB 4HKLA 1YQ6A 1GNZA 1CESA 1QDCA 1S2KA 3RZMA 5EJ1B 3OBTA 2W95A 4Q0VA 4YVWB 1XE0A 2A3YA 3EJKA 3BB6A 5LB6A 2AH2A 2GU9A 2IZWA 1VMJA 1HV0A 1W2TA 4YW5A 4QT6A 3VUOA 2RV9A 2KR2A 3WLUA 2VBBA 3A22A 1HIXA 3OG2A 3H8OA 2XL7A 3HN1A 4ES9A 1O3SA 2OZJA 1A6CA 3AXEA 2Q5TA 4RN5A 4JV4A 3ACGA 2XMLA 1SCSA 1BLZA 2EXJA 1R093 4URTA 3CO2A 1E5IA 1BQPA 4IUGA 4MUVA 4EWAA 3MLLA 2GH8A 4JGYC 2E32A 2IXHA 3LWCA 3PTRB 2W1SA 5LRRA 1AR82 2XL9A 2E7QA 4CUAA 2ZGLA 4DRRA 3SH3A 1UAIA 1BXHA 1AR93 2MEV1 3P1IA 2JB4A 2RDSA 4PIZA 4BOWA 4NIDA 3A0KA 4RSUA 3PURA 4Q4X1 1Y9GA 2RS13 4AG4A 4OUMA 5IJRA 4K21A 3BOWA 3M3IA 5IK7A 4XCBA 2JDAA 2RM23 2A5ZA 5L9RA 3DF0A 4ZXEA 5A80A 3VBSA 5J3UA 5J36A 1MS3A 3RWNA 4DFSA 2XJVA 3T3YA 1ENSA 4QDQA 3NV4A 1UY2A 1XXNA 3F95A 3MW2A 4BH9A 2D3RA 2P6HA 3JCIA 5FY0A 1UZWA 1HRV3 4P9WA 2XJQA 1WCUA 2JG9B 2WS93 1C8M1 4UW6A 1YFWA 4P9YA 1ALYA 1EV11 1YXWA 4QQ2A 3VKNA 1IKPA 4OHYA 3GBFA 5FFOC 1PGL1 1LGNA 1YIFA 2JE9A 2O0OA 4EROA 5D8AA 3M2MA 3ZIWA 4RHV3 3BTXA 1GSLA 5F3EA 5FZAA 5JZGA 4HANA 1JU3A 1W6QA 1BEV2 1RUE3 4XDOA 5ANQA 2P4EA 4O9EA 2SLIA 1AR81 2QQIA 1GZCA 1TMF3 2P2KA 1ZREA 5FYBA 1F8VA 3LFMA 1IOAA 4AEDB 3ZSJA 1YI9A 4H3WA 4UFLA 5G04L 3A7QA 4XUNA 1YEWA 4Y1ZA 4YNIA 4YW6A 3VBFA 4CZSA 4IESA 4DY3A 5JOZA 1AR62 3T4VA 1HJGA 5CBLA 1US2A 3O0WA 4JAAA 1HXS1 1K5JA 4Z82A 1N1VA 3PJQA 1MR5A 1R081 3VKFC 4TZDA 1REEA 3WW2A 2IXCA 1ONAA 2RR12 3OUHA 1JOBA 3DUIA 4ISQA 2VQTA 3VBSC 3WR0A 1VALA 3N9PA 4LUKA 2WR9A 4AVCA 4B7KA 3BPSA 5JI7A 3VBHB 4A3ZA 4CU9A 3RZLA 2J7MA 3AYEA 1MZ6A 5FO9B 1VIWB 3MICA 4YGBA 5C8WA 3KWVA 4CRQA 5C9AA 4D7YA 4CCMA 4A7ZA 3VHOA 5JR7B 2BTVC 4MGQA 3SCGA 2GDFA 1FOD2 3DKWA 5A33A 4OQ9A 5D8AC 3HQUA 4GXLA 5A3UA 2VZVA 4YW2A 4D3WA 1ZBE2 4CCOA 3RVHA 3U07A 3ALQA 5JZGC 1VBD3 2WWSA 1GYKA 1ZBA2 3KVBA 1PMIA 4LOSA 4TSVA 1LU2A 1XNCA 1RUD3 2A7AA 2WO3A 2ZAAA 2ZEXA 2ZGUA 3PMEA 4R9BA 5IAXA 4CCDA 1RUG3 4Y5SA 5IYYA 3GHMA 3N9OA 2YC2A 2BFUS 4NRPA 2XH6A 2XVGA 2OQ7A 5HCBA 4GKXA 1V70A 4FTEA 3VBFC 3VHRA 3LPGA 4XUQA 1ENQA 5APAA 1DYPA 1W8WA 3HT1A 3I3DA 3TBDA 1XOYA 5A6YA 3UL2A 2AENA 3WDTA 2B9VA 2GNBA 5FREA 2WL1A 2EIGA 5A33B 2C1FA 4Z1VA 4R9AA 3K48A 2C26A 5F2WA 5LY2A 1NLSA 3RMXA 1VB2A 4YYOA 3EQEA 4XIOA 1ND3A 5F32A 3ZSKA 5HPOA 1QQP3 4XFFA 2XJSA 3WP4A 1DQ0A 2WBKA 1WCKA 4CCEA 3SQOA 2Q4SA 4AFBA 1W6OB 5KXEA 5FCCA 1W03A 2HEYF 3H1WA 1SLLA 5LBCA 5LWBA 1OMIA 2V4VA 5C9AC 3KHBA 1W8NA 2NN8A 2WJSA 1QJX3 2XOMA 1AXYA 4XF4A 2BNNA 2XQXA 2D6KA 3IDCB 4QPWA 3K4AA 4DEQA 1NX9A 1AYM1 4L97A 3TNPB 5L7OA 3THDA 3PLQA 2W1WA 2R0FA 4RFRB 3CEWA 1W6MB 4ISRA 1N3OA 3C7EA 2JKBA 5DG1A 2VGDA 4XBLA 3VHPA 1ZYBA 1UZYA 3AMMA 2C0ZA 1QDOA 3CZJA 4JHTA 1QNYA 1QJU3 1CX4A 1ND3B 4K8RB 3SEPA 4A45A 4COYA 1I6XA 4F8AA 1EPWA 4O61A 1VBC3 1RGSA 3ES4A 3JQWA 3WG3A 3HT2A 4Y22B 3ZSEA 2HYKA 1COV3 3RI9A 4COUA 2ZEYA 4KU7A 3B9IA 4JHZA 4DMIA 3OGVA 4SBVA 4OLLA 4LE4A 5FZ6A 3RZHA 3KLSA 2FDFA 4LQRA 3ETQA 3WT3A 2YC0A 4LLFA 1RHI2 1V0AA 4YW4A 5JOYA 1BK0A 2RS52 3PIGA 5FXZA 1UCXA 2WFF2 3KCXA 4JKMA 1PVC2 2ID4A 3RYPA 4C0BA 4I30A 3DKQA 1WLDA 5FBZA 3GDBA 3S30A 4A7KA 3IZOA 5LY1A 1ND3C 2A70A 1JUIA 2Q0AA 4P00B 4LULA 5KC5A 2WNUA 2DBIA 3OOXA 3LEIA 3PNAA 5T52A 3AKPA 4O9GA 2XDVA 1SLIA 1OQEA 1AZDA 2GN3A 2D3SA 5CG9A 1FXZA 4IXLA 4LO7A 1BVVA 1RUC3 3DCQA 5ACA1 2D3PA 1Q8QA 3H42B 3VBUB 2A6VA 1PIV3 1S55A 4AAXA 5L7OC 1L7QA 1KGYA 1KJLA 4GKYA 4M3CE 1UOJA 4BQWA 1YO8A 2B7YA 1OT5A 1ULOA 4LKFA 3A4UA 2HBUA 5ABJA 3H8RA 4DUWA 4LBLA 2YBSA 2WWUA 3HQXA 4RS5B 3CHXA 2VMGA 3OB8A 1W90A 5L9VA 5FZ8A 3V0BB 4XF0A 4XHXA 5C70A 5K0UC 1Y4WA 3BI3A 3WF0A 4AXOA 4XF9A 4XACA 2EAAA 1JHJA 3ME2A 1R1A3 5CISA 4BQ4A 1RUH1 3T2OA 5A1AA 4Q2FA 4Q0SA 4QX1A 3M3OA 1FT9A 4FVVA 5F3CA 1UO9A 1BK1A 5CFDA 4NOTA 2D7FA 4R9DA 3UJOA 1B35A 2Q8EA 3U4XA 2VU9A 4P9LA 2R32A 3GCWA 2GH2A 2ORZA 1UZZA 4P02B 2QCSB 1AVBA 2IXLA 4NROA 1PGW1 1QU0A 2XHNA 5I0TA 3RWKX 3WW1A 1SDWA 2VOWA 2JE8A 3K75B 1OFSA 1EUTA 3S5QA 1NT0A 1HLCA 4ZY9A 4AE2A 1ZZCA 2WNUC 1UX7A 3EHKA 4GH4A 5C8CB 5J1XA 1VRH2 4LBQB 4ARYA 3MPBA 1KS4A 3N9MA 4LPLA 1QXPA 5C3RA 5HI0A 3JUUA 2VXJA 3LCPA 3LIGA 4RA0A 5KHKA 2DBNA 4XFAA 2YZ4A 2X29A 3UESA 3HN3A 1TME3 1WA4A 3VBRA 3K2OA 3P3NA 4LKDA 3K3OA 2H0BA 3ZIXA 1AF9A 3WDYA 4A3XA 3ZO0B 4FOQA 4XUOA 1R091 1SQ4A 3BTAA 3KM5A 1O5LA 1QIQA 3B69A 3N4MA 5ABJC 4XUTA 2XWBB 5FTTC 4FI9A 2Y6JA 2WA4A 4GB33 4ZU5A 3BIEA 4FXKB 2JE7A 1VBA3 1VP6A 4FPFA 1UY1A 3CQOA 3ES1A 1FI2A 2R043 3ZN4A 2VZSA 3MZHA 1AR91 3IIIA 3MLJA 4IEVA 4NWWA 3T2PA 3N9NA 3I2KA 5LBEA 2B46X 1W9TA 1C1FA 4IERA 4C0HA 3NJYA 2RS11 3U4SA 1O8SA 2LS6A 4J25A 2RMU2 5A3TA 5JMCA 4CDUB 5HXMA 1KEXA 2BWCA 2WZR3 3VBRB 1O3RA 3I97A 2EXKA 1H2NA 4Q8LA 1EUUA 2WZ8A 5CFDC 5I0RA 5J96B 2VO5A 1MS1A 1B35C 4UI9L 1V6KA 3FJSA 3I3QA 4QX2A 1PGSA 5SV8A 3D0JA 3OUIA 2ERFA 1FV2A 2FDIA 2OVUA 2ZZJA 2WS91 3ZKYA 4LR4A 3V0AA 1ZRIA 4N7UA 5FRAA 2JG8A 3NV1A 2HEVF 2UU8A 4GH4C 1Q8VA 1O3TA 2J22A 3ZYPA 1DLLA 1ZVFA 1GOFA 2VQAA 3IMNA 4N53B 1DG6A 1RUI2 5BNQA 1E5RA 1W6NB 2QUOA 4RHV1 3I2IA 5J98B 4KWKA 1CPMA 1KJRA 1UPSA 4AVSA 1F15A 1SLCA 4HVRA 2QNKA 1JI6A 3JD72 3O12A 1RUE1 1LHWA 2IXKA 5FZ1A 3WP3A 3LEGA 5FDBA 4NRMA 2HEWF 3H7JA 4L0PA 2XG3A 3PU8A 4Q0UA 4ATEA 3P6BA 1POV0 2ZAHA 4PQQA 3T09A 4IEYA 5FOJB 1V9U2 3ZXEA 1HQWA 1MQTA 3A23A 3V0AB 1MS0A 3J4UH 3S7EA 4ET7A 1O59A 1S0CA 2O8OA 2QKDA 2A6YA 3PVNA 1FV3A 2EAKA 4M0HA 1KXGA 2J1RA 4H7MA 3S0MA 4HXCA 1CJDA 3QACA 3FUOA 1S0DA 1XNTA 1SFYA 2VMCA 3KZ4C 2E53A 2J1SA 2E6VA 4ITCA 4YZ3A 5T5JA 3ATGA 3LA2A 1TVGA 3FHQA 3AP7A 3GZAA 3NJVA 3ASIA 1NXMA 4AHWA 5GZCA 4SLIA 4NPRA 1LESA 2W1QA 3USUA 4AR2A 5B4NA 3RS6A 2ZEZA 2O8QA 1OF3A 3VBOA 2HWE3 5E6HA 3VD7A 4IV1A 1QXJA 3AC0A 1NCRB 5LZ6A 2FCVA 2QZ3A 4AI8A 2QFEA 2JG8C 4C8DA 3E6CC 1WW6A 4Y3OA 1XJAA 1GP6A 2D6MA 5C5UA 4CU8A 5F3GA 1C5IA 2NM1A 2ET7A 4CUBA 4ZONA 5IVJA 2XJTA 1KDMA 2Y0IA 5FYTA 2VTXA 1VBD1 5I8YA 2WLPA 2J1AA 3MIBA 4INDA 4M01A 4XBNA 3D3AA 3N9QA 4NE9A 4WVMA 4CEYB 4AI9A 1RUD1 2JX9A 3E1F1 4KBBA 1AR72 1JOPA 3H3UA 3HOBA 5FZOB 3WNNA 1FAYA 2DFCA 5A1LA 1PO22 1NOVA 2QQVA 4FPLA 4RR3C 5FZFA 2DUPA 2XPJA 4BHPA 2TNFA 4NPMA 4ATFA 4CUCA 2A1XA 3VD9A 1VBB2 3W5MA 4RGKA 4FSJA 2HWB2 3RQ0A 1UU4A 4H55A 4RYDA 2PQSA 3ZFFB 1MQTC 3LQCA 3B3QE 4ORFA 1IG3A 4L11A 5T5OA 5B2GB 1UY0A 3W9AA 4DO0A 3B7MA 3E97A 4UW4A 1DCSA 3ZVXA 2B9UA 3ZN6B 3NWKA 4QKBA 5KBFA 3M70A 3FFQA 1SBFA 5FMOL 3WG4A 2D93A 4AF9A 3AJZA 3E6DA 2D44A 1F31A 1H6XA 1ZX5A 2VQ0A 1NA1B 4ASMB 2XQRA 2P5BA 3WF2A 1WLTA 2G9GA 3J7NA 3JB4C 4Y4RA 1F5JA 3ACLA 3LSDA 4E8DA 4XILA 5FZ9A 2P3IA 1CAVB 3BGAA 2VBDA 5FYHA 3UJQA 2YFUA 1UMIA 4Q4W2 2VAUA 3JBG2 5LBFA 1MVEA 4BQYA 3VBOC 5I93A 1V6NA 2VNOA 3OEAA 4IV1C 3RNSA 4KNCA 2PHLA 2CV6A 4MV2A 1XYOA 4I01A 3PMSA 2B5HA 2BFUL 2BYVE 1AXZA 3CDZB 1NZIA 2ARAA 3H3ZA 5FOBB 4DB5A 4OI2A 1ODMA 4DY5A 2UYBA 2WSUA 3POSA 2JICA 5HCAA 2WNVA 2VUJA 4YLZA 2RS32 5DAXA 1RUF3 1PNFA 1VBB1 1QJU1 4PDWA 1LECA 1GBGA 4QPGB 5DG2A 4MGTA 2E26A 5LASA 4YSFA 5FXVA 4Q4V2 4C1XA 4YG0A 1COV1 4XTPA 2E9QA 1Y7BA 4R4XA 2QBXA 2DVFA 3QBQA 5IUQA 3WV6A 5GZEA 2OKXA 1PM7A 5KXDA 3VL9A 1ZRFA 4D6SA 4DINB 5G05L 1GNYA 3IB3A 3MFAA 4M4RA 3ZR6A 2P34A 4U2AA 2RR13 3SCHA 4KWUA 1A3KA 2OZ6A 3JB8A 4AI2A 3VZOA 1Q8PA 1A8DA 1TNRA 3K3NA 5K0UA 4CU7A 2X5IB 3FX3A 4YW3A 1LHUA 1VMHA 2D6OX 1YIPA 3IIAA 2I2SA 3JBG1 4META 3WCSA 3WDVA 4NRQA 2PLV2 2VCMA 4V1PA 4BCUA 2XR4A 1XSRA 2Z4FA 3NSTA 2VC9A 4PDWB 5A1FA 1Z78A 3ZYFA 1GQHA 3KV9A 1D4VB 1SFPA 4Y33A 3MUZ1 1OOPB 1URXA 1UX6A 2WO1A 3LE0A 4RGGA 5KHJA 3L2HA 4UBHA 1NY72 1DGRA 3S57A 1YC61 3J8F2 4JRAA 5CKMA 1YNAA 3WXPA 4D94A 3AZVA 2G1MA 4IGOA 1ZBE3 2CWMA 1PIV1 2PHTA 5FZLA 3NNMA 4I0AA 2RS31 3SH5A 2W39A 1ULCA 1VBE3 1XU2A 2FCTA 3AP6A 1NCQA 1POQA 5FKBA 1VJ2A 1K42A 3I49A 4UT5A 1NQDA 2JD9A 2ZMNA 1ZM1A 2WNVC 3HVDA 1OLMA 2DTYA 4GWNA 3EYPA 4ASKA 1UKGA 1V6JA 2CYFA 2RJKA 1GWMA 2DYCA 2VE1A 2B8MA 2VZRA 3DYMA 4PDWC 4FP3A 1RUJ2 1W9FA 2DCKA 5TSWA 4NHKA 5A7OA 3UYJA 1Y9MA 2C24A 2PELA 2PHFA 4GA9A 1JZ8A 1M06G 1PX3A 1OC1A 2JDYA 1APNA 2WO7A 4BA6A 1R1A1 3AL6A 5A7WB 2JDPA 1W04A 4GJYA 2JDNA 1UD1A 3FHAA 5LA2A 3BKZA 2V4AA 1ULDA 4LEJA 3AKTA 5IVBA 2Q1FA 4LHKA 4GAZA 2HWF3 4RD7A 1DZRA 1F9KA 2R49A 3AXDA 1TEIA 1SPPA 1JUHA 2UY8A 2N7GA 1D4M3 2A6XA 2GNTA 2RJLA 1NCQB 1MZEA 2WABA 1OVPA 1PZ9A 4Q1PA 1HB2A 5LBBA 3RPQA 4GMP3 4E27A 1GANA 1AL0G 3ZXKA 2ENRA 4BISA 3MIGA 3ECQA 4C1WA 1LHOA 1E5SA 3FC0A 1XB9A 3N7JA 4D6QA 1T6GC 5CAZA 1YI7A 4G9SB 1AX0A 3WHUA 5H9QA 2HYXA 4Y4YA 3HNYM 3DPRA 4Y5TA 4QX8A 5DZFA 1JYXA 3CBNA 3TNQA 1WZXA 2BNMA 1VAVA 2MEV2 1AYN3 2OPKA 3J7LA 2VUAA 1NCQC 4KBZA 3WNMA 2UWAA 1G9AA 4Q4X2 1W6PA 2B4KA 2GAUA 2CWSA 1JU4A 4X6RB 3K46A 2VUDA 2K9ZA 2ZGOA 4COZA 4DXTA 4GB31 4ARXA 4FPJA 4AK3A 1VBA1 2BWAA 2OA2A 3CNAA 3ZYJB 1XNAA 1LCLA 2ZHLA 2R041 2NPIA 3GYDA 4LHNA 5LRSA 2XBO3 4JGYB 2WFPA 4YM1A 4A6SA 3RZGA 2GNMA 4P5YA 3I2DA 4IDZA 5IFTA 1F4AA 3N7KA 1XQNA 4QM8A 5I8TA 4JDMA 2RS53 2WZEA 1OD5A 4XZUG 5JXGA 4WVVA 1C8M2 2WZR1 3QH6A 3U11A 5GLVA 4ZZ8A 1RMU1 2YBKA 1EV12 5GZDA 1UOFA 2I45A 3LAGA 5FP3A 1JYWA 1WMFA 1HRI3 1PGL2 2OW4A 3NNFA 3PL0A 5J48A 1O3QA 4S2GA 1MACA 3I2FA 2JEMA 2ZHKA 4MVTA 1OPOA 2WC2A 3RG0A 4XZPA 1LJ7A 5T3NA 4DXRA 4HT1T 5F39A 3URFA 3DXTA 4FFGA 4B1MA 4KMQA 3O1PA 3I3MA 1AJKA 3MEPA 5GLWA 2R0HA 2ADDA 1UKRA 2WLQA 1TG7A 3MIFA 1D0GA 1WD3A 3BOPA 2DDUA 2VM9A 1U5ZA 2C4XA 1EYBA 4UYBA 5BPXA 1UQXA 3E5XA 3H9AA 3DPRC 5FUIA 1R1ZA 4BLIA 4B4QA 1MEC3 4Y20A 5JR2A 2R6QA 3VLBB 4KGGA 4XJUA 4AAPA 1G86A 3VV1A 3NNJA 2Y33A 2R072 1HXS2 2VR4A 1NKGA 3ZOIA 3I7DA 2LTNA 3TAYA 2WIIB 2YHJA 3DECA 1KRIA 5FUPA 3OJBA 1OUXA 4XJ9A 1R082 4GZ9A 4FPGA 5FQ0A 1N1SA 3GHNA 4PT6A 4JVAA 4N43C 4CCLA 4BJ0A 4QXBA 2FDKA 3T4HB 2PHWA 4MGIE 2RDQA 2PAKA 4CE8A 5A70A 1ULGA 2ZGTA 3WUDA 3B01A 1FATA 5HCHA 1XSQA 1X9TA 3INAA 3IM0A 1OA2A 3PUSA 4HBNA 1LAJA 3KCYA 2LW8A 3WDUA 4AQ6A 2R30A 3VBSB 1WLCA 1Q5OA 4PLNA 1YQ2A 4NO4A 2HWE1 1W3XA 3SXWA 2V09A 4IV3A 2YU1A 2L9LA 3I4IA 4PQ9A 4C90A 4HFSA 2DU0A 2F4PA 3N7LA 3B9CA 4RL7A 5FYIA 1QNWA 2Y6HA 3TEZA 3W58A 1VMFA 3W21A 4GWJA 3OY8A 1DF0A 4CXXA 2ZHMA 4OYUA 3WUCA 1C57A 2EALA 1PK6A 2YPDA 4GWIA 3PVEA 2R071 5DUVA 2AREA 4E4SA 4IEWA 1W8ZA 1Y9QA 3HAGA 4MGYE 5D8AB 1G7YA 2YB7A 5JIUA 5A3MA 3ZLIA 4EJRA 2ORXA 3MF9A 2JDZA 5JZGB 3PUIA 4IEOA 2VNGA 1W6QB 3AZYA 5FAXA 3CJIA 5AC92 4LBMA 1LNSA 4NHMA 3PU3A 1J59A 1UU5A 1OXCA 1UU6A 1LENA 2W52A 3BUCA 1OPMA 2VOKA 1J1TA 2ZX2A 4PBPA 4NUBA 1X33A 2W9XA 4JX0A 4M00A 2VZOA 4JKKA 5IK4A 1L7RA 1NE6A 3OY8B 3BODA 3VBFB 4Z92B 1UF2C 3ZPYA 2JDKA 2JECA 1K45A 4XOGA 2G19A 3ORJA 3OPZA 4LK7A 3ZXDA 1YFXA 5DAQA 2WN2A 5GZFA 1JS9A 3FN9A 4PF1A 3J7MA 5A6QA 5FPAA 1AYM2 2QJVA 3T08A 5FZIA 4MHUA 4LBJA 1UYYA 3IDAA 4UWDA 5F8PA 3TB0A 2X8KA 1UMZA 3O1MA 4BYYA 1S0FA 4R4ZA 4JQTA 4IV3C 4AGGA 3RRDA 4EZHA 2X05A 3BU7A 1NUKA 1UIKA 3FBYA 3I54A 3OGRA 1GZWA 1DQ1A 4CEWA 5F5CA 4P08A 5C9AB 4FQZA 4BQ1A 3JD73 2EF6A 2VVDA 3LIHA 1HDKA 2OUHA 1PK6C 1W8FA 2ZGQA 3HIFA 3MBWA 2LROA 5FIXA 4OHZA 1KQRA 1DGRN 2WT0A 3OD0A 2QZ2A 4XJ8A 1RUF1 5LW9A 1FPN3 3FMGA 4UFJA 1ULPA 5L19A 4JGZA 3LB9A 1FMD3 4KG8A 5AC91 4WM7A 2XJUA 4F7ZA 2XONA 4E9KA 3C8XA 1V9U3 3HBKA 4URAA 1W28A 4I2OA 4D69A 1SFNA 1BBT3 3ZMNA 1OURA 3CJIC 3TN91 1GOGA 2FZ1A 3AP9A 4Q5OA 2IXJA 3U37A 5FR3A 3AK0A 2WUHA 2BQPA 1GQGA 3UK9A 3M3CA 5CU1A 4DXSA 1GZWB 4TLFA 1X8EA 3OSDA 5FPVA 4K9SA 4IGQA 1OQ1A 3O7OA 1LOGA 2CGNA 1YCIA 3CF6E 4FFIA 1TNFA 1HV1A 4QB2A 1IG0A 4QQLA 3ZYHA 4AOCA 2VMIA 5K4LA 4BMEA 5DZGA 1RVF3 4QHZA 4MHRA 4A2UA 4OQ8A 4P9IA 4HKWA 1ZRCA 5DAVA 1W99A 1CJPA 5ACA2 3KQ4B 1JBCA 4S2DA 4AI3A 2W0XA 2HWD3 3UT0A 1ASJ3 2DCZA 2BVBA 4WM7B 1HJFA 1A8MA 1N1TA 4EZ4A 4HVQA 1HX6A 4QWNA 3ZFEA 4XETA 1JN2P 1SG3A 3RJ2X 3O0VA 1IPKA 1EAH3 4KWLA 5GLZA 2QQWA 1MZ5A 2R1DA 3VDCA 1DDLA 3AYDA 3U14A 1NLQA 5F5AA 4CPBA 1RJ8A 3ELNA 4OUSA 3I2GA 4CEWC 2QQUA 5LA1A 4BLJA 1MVQA 3WEZA 4CP9A 1H8VA 2CNAA 1VBE1 1OLRA 5HCFA 2HWC3 2WYSA 2KA3A 1W8UA 5I0DA 1AR73 2WT2A 3SMHA 1W0NA 1ZA4A 1PO23 1RUH2 3ZN5A 5L7OB 1Y43B 2GNDA 2QQPA 2WO2A 3E6BA 4JGZC 2P3JA 4WM7C 4Q4Y3 3I59A 3MIHA 3LEKA 4RGAA 4MSVA 4NN0A 1W9WA 3EBRA 3WOGA 5FMBA 5JSPA 5DMYA 1JODA 1N47A 5CVRA 4FTSA 1PGW2 4KL1A 4BIOA 2F6BA 1B09A 3A0NA 1QH6A 4LE3A 1Q8SA 4XVHA 1Q8OA 4KWJA 2HWF1 4AFCA 4BM8A 2P17A 4CP9B 4YM0A 1UYXA 1D4M1 3HJRA 3OEBA 4YWAA 4XF1A 4BQ3A 4GMP1 2XUMA 1UIJA 5FLHA 1AXKA 4AQ2A 4LHSA 5E88A 2FD8A 4Q4W3 2DFBA 4FOYA 4IE0A 3GBGA 1PHMA 1IS3A 5JUVA 1AL23 2JIJA 3C7FA 4CCCA 1R092 5GALA 3ZFEC 4Q8KA 1O6UA 2XXZA 3EXUA 4JTNA 2Q8CA 1OA3A 4YZ5A 2QDRA 2WNUB 3R0RA 3D4KA 4W50A 4ZXKA 1X36A 1HB3A 3AX4A 4K7JA 3LSEA 4EWDA 2VVEA 1YHFA 3WVJA 1NZCA 1QKQA 1AR92 1AYN1 4P9JA 1QJZA 5GKAC 2CHHA 3PUQA 4KI5M 4M4PA 3UETA 2K46A 2Z69A 4LHLA 2RS12 1D2SA 3AVSA 4O65A 3WDWA 3ZKUA 4AHXA 3NAPA 4WBBA 3V65A 3AMNA 1XNKA 3EO6A 3ZYGA 3OCPA 3VGIA 1REDA 3T1LA 2XBO1 5ABJB 2WRAA 3H50A 3QD6A 1WA6X 3UKTA 5FBJA 2W92A 2CDPA 1JH5A 5IWFA 5A3OA 2D5HA 3WSOA 4AVBA 5JCTA 4NAOA 2J1VA 2R063 2D6NA 3WINE 5KXCA 3TYJA 2WS92 2GC0A 1WW7A 3POYA 4K3UA 2WDBA 5CADA 4LOTA 1Q56A 4LBNA 2ADEA 3B93A 2OT7A 4GULA 4J1XA 2XWJB 2YXSA 1SDDB 4XYXA 3WW4A 1H4HA 1HRI1 4QPIA 1GMMA 4FPCA 4XFCA 4RHV2 2IWGB 1KD7A 2PLV3 5CFDB 5CB7A 4I3GA 2VNVA 1W2AX 1B35B 5DQ0A 1RUE2 1DLCA 4LKEA 4FAHA 4MGKE 3OF1A 2B39A 4MX3A 3BCWA 1VRBA 1QJY3 2BGOA 2J1EA 2Z42A 3MPPG 3PUHA 4ZZ5A 4QDRA 2WQ4A 5FPXA 4ZHNA 2BPA2 1BMV1 1HQNA 4YGDA 1SLAA 1H4GA 3O1VA 2VG9A 4GH4B 1ZNPA 4ES8A 3LKJA 1MEC1 4NVPA 2BEOA 5EZWA 1XE7A 5FYUA 3FL7A 2RM21 2E33A 1C1LA 3F2ZA 4YGCA 1LOCA 3M1HA 2W46A 3NAPC 2W68A 5A32A 3FWEA 3POWA 1OSGA 4JTOA 5FLIA 1A34A 3AKSA 1WCSA 3VDBA 3NW4A 4CPBD 4HK9A 4N8MA 1T2XA 2YY1A 4QXKA 1HRV1 4IE6A 4Y1VA 3ZXFA 5C5TA 1O5UA 2K2SA 4Y5Z0 3FE5A 3WNLA 5FZ3A 4LT5A 2HH9A 4QX5A 2ZOEB 1ULFA 5FYSA 2D40A 3VZJA 2PHXA 4ZKTB 5JI9A 1QOTA 1I9RA 1W05A 4OHVA 2YGLA 1UYPA 4XURA 2CSGA 4AHZA 4TLGA 4EN7B 4AL9A 4LO5B 2VOXA 1CD3G 4A6OA 4QPIC 2CY6A 2BBVA 3AJYA 2C6SA 2AACA 3BTYA 3I8TA 2Q30A 1H8TA 3R6SA 2UWCA 3MHZA 5HBAA 5DDJ3 1VBD2 2D97A 3MW3A 5DAWA 1C4RA 5KXBA 2EXIA 4RR3A 1TMF1 2I74A 3FLRA 1PO13 1RUD2 1MS5A 2BW8A 4JQRA 1LOAA 2A71A 4CDXA 2YGMA 3D82A 4M3CA 3GZTB 3HQRA 1S2EA 2KM2A 1DIWA 5FZEA 4JCKA 4CA9A 3U75A 5LK7B 3HBZA 1CZTA 2JG8B 2ZX1A 4NIIA 3LF7A 2NYYA 1L3JA 3VZMA 4XDQA 1ZA7A 1YRZA 5E16A 3U0ZA 4Q4X3 5JDBA 3NL1A 3AVRA 4NPLA 4YW1A 5FZ7A 4XAEA 1Z7S3 4KH9A 4P5HA 5IAVA 4NIAA 3W59A 1VR3A 5FPUA 1DU3D 3KF5A 4PCRA 1W8HA 3B00A 1SBEA 4YZ4A 1JTZX 3ZSLA 1NLRA 2XB6C 1J58A 3VKLA 2FBEA 3SKVA 1LOFA 3HWJA 4CP1A 2ZX0A 1NAEA 1RC6A 1ST8A 1V6OA 2BNOA 5IVEA 4RR3B 1UWWA 3KVAA 3OPTA 2ZEWA 4WV8A 4ZU4A 4AFDA 4CDXB 4OI1A 3VD3A 2YG0A 4FO9A 3KHCA 2XKOA 2CGOA 4Q0PA 2A73B 4W65A 1MQTB 5A3LA 5H9RA 5BY5A 1AJOA 2VD7A 2WAAA 4XJZA 2VZ1A 5FJKA 2OXBA 1WKYA 4QQOA 2PHRA 3O0XA 2KXLA 4X6QB 4YFZA 2W47A 4OI4A 4KQ7A 4YG6A 3B5LB 4DUXA 4CUGA 1RTVA 2P1BA 2XHKA 1SHWB 4GQ7A 4I3PA 1WLWA 1S0EA 1OKQA 1H9WA 3ILFA 1H8TC 4A4AA 2WYFA 3H3LA 3KT7A 3LEMA 1RUG1 4L92A 1LEMA 1AR83 1LODA 3FLPA 1N3PA 1H1IA 3WNPA 3USUB 4CCKA 4CDXC 5DUUA 1UPIA 3U78A 3BTZA 4XXAA 1QJU2 3T1MA 3VBOB 1IS6A 2RDRA 3FUQA 1W39A 3WNKA 4Z2WA 4IV1B 4UXAA 4Y26A 1QXRA 1WMXA 1COV2 1D0HA 3SITA 2BOIA 3QOPA 5C3QA 3R4UA 4W8JA 1FPN1 1O4TA 2P37A 4Q27A 2VZ3A 1CWPA 1FMD1 4GIQA 4IEZA 1I5PA 5FZGA 3THTA 1BBT1 3MV11 4WVMB 2AC1A 5CFCA 5JMOA 1MS9A 1QQP1 3N3HA 4UFMA 4DS0A 1LOFC 2NMNA 5FJHA 5FY7A 1QOOA 3ABZA 4P14A 2Q1MA 1CR7A 1CAWA 1L7LA 4N90A 2R1BA 4TXWA 1REFA 2GC1A 3ZXGA 4XFGA 1GQPA 4Y1YA 3HR9A 1UOGA 2GC3A 1QJX1 4XUPA 5EXOA 5JXIA 4YFWA 1UY3A 2VNRA 5FV3A 5FYMA 1S0JA 1POV3 1RVF1 3AZXA 3LOIA 1U5XA 4L99A 3WCRA 2MPFA 1DQ6A 4D8MA 3TEXA 2E63A 4BZ4A 5HV0A 4E2QA 2XGXA 1BEV3 3Q8CA 5CYYA 2Q1ZB 2DVGA 5I8SA 4NR1A 2HWD1 1PIV2 1ASJ1 4I0BA 1V00A 3MYXA 1H2MA 3LDBA 3MLKA 2OIIA 3ZYRA 1IKQA 1EAH1 5T55A 1DYKA 2WZPP 2LM3A 1H2KA 3AYAA 1VBC1 2WN3A 4XEZA 1XPWA 1BKZA 1UMHA 3NNLA 5FY5A 3TRSB 1AR63 2ZZQA 5T5LA 1MS4A 1SBDA 2BZDA 5FYYA 1CIWA 1S4CA 1C5HA 4DQAA 2HWC1 2Z79A 5BYNA 2Y38A 1R1A2 4NHLA 5JOWA 1K12A 3KGLA 2RE9A 4XFBA 5ERLA 3S5AA 1T6BX 2GMEA 2ZGPA 2J1TA 2VXRA 2ZJCA 3K77A 1GV9A 1BZWA 1U12A 1ODNA 4X8NA 4XTMA 4Q4Y1 2HBTA 3RFRA 4CTEA 1IPJA 1M4WA 3SEEA 4FFHA 4ZS2A 1GP4A 3OUJA 2WNVB 3IN9A 4B4RA 5CFCC 4QKDA 2DWRA 3GNEA 4HMZA 2JDMA 3WZ1A 3KMHA 4YGEA 5EP9A 1XNBA 5ISLA 2CAUA 4HSLA 5LEKA 5BNNA 2GP5A 2E7TA 2VMFA 5FXWA 3WP5A 1U5IA 4HONA 2J1UA 5GM0A 1UYZA 2YV8A 3M3QA 1YQ8A 3WNOA 1FOD3 1RUC1 4XQWA 1W06A 4AFAA 1UL9A 1PNGA 3IWZA 4XJAA 3ON7A 4LIUA 4CP2A 4UW3A 4BQXA 1ZBA3 2ZTNA 3POBA 4BB3A 2XJRA 4LIVA 2JB8A 1NE4A 1GZ9A 4LBKA 1AL21 1O8PA 1JHNA 2AEZA 1WCQA 2DTWA 3I2JA 4PIYA 1F35A 4WM8C 5K0UB 1WD4A 1WUVA 5CZKA 4OCTA 2IXIA 2ET1A 1YFYA 2O14A 3APBA 1FX5A 1LU1A 2YPJA 3GF6A 4FPOB 4GB32 2FZ2A 4K6BA 1VBA2 3MGUA 4BPZA 4L2NA 5FZBA 1F5FA 5BNNB 2R042 4FT8A 3V56A 3KV5A 4P9GA 3TEYA 1HB1A 3OGGA 4YM3A 4MADA 4QB6A 4EN9B 1G9DA 1C28A 4PF5A 4Y24A 2X09A 2I07B 3M8LA 4LUMA 4MLOA 2A6WA 2WZR2 2P3YA 2V73A 1XC6A 3UGHA 4AW7A 1RMU2 2PMWB 3WF4A 4UF0A 2XLGA 2EXHA 4MXVA 1O91A 3RI8A 3J7HA 2QVSB 5GJ6A 1IS4A 1XU1A 2FQPA 3GZEA 3ZM8A 3HMYA 2ZACA 2ARBA 2JDUA 2YUEA 1ACCA 3NKTA 2XJPA 5IT6A 4Q29A 4E4ZA 3CMGA 5FZMA 2JIGA 1DHKB 5BNNC 1C3HA 5A6ZA 3OPWA 3ZDSA 3ZSMA 5C71A 3MDPA 5A3WA 3W5NA 3D5OA 1TME1 5FZDA 2JXAA 3RMYA 2W08A 1LOBA 2FDJA 3IT8A 4EYUA 4FAGA 5C7GA 3WP6A 2B45X 3ZXAC 2IFWA 4FBFA 4QHOA 1SLBA 1H6YA 4XQDA 1SPPB 5LATA 2WQ8A 2AZ5A 3I59B 2GSYA 3IAPA 4IEUA 1JYTA 3OGSA 4ASLA 2VZTA 4XE9A 4Z2AA 4WZCA 5IATA 3C2UA 2IVIB 4YVWA 4I09A 1O4YA 2R16A 1QJY1 4B8EA 2ZXQA 2ZMLA 1LKNA 1W3VA 4N43A 3UGGA 4FPYA 2ZBJA 3KS7A 2TBVA 4QQHA 4UBGA 5F6KA 2TEPA 3RSJA 2QQLA 5LA9A 1RHI3 5F7UA 3MIEA 1QJEA 1RXFA 5HXVA 4GJZA 3O1OA 2ZX3A 3HEIA 4IE5A 4OZOA 4PJYA 1YQ5A 2WFF3 3WF3A 4IE4A 5A3PA 3H8XA 1PVC3 2VMDA 2ZGRA 3DPRB 4MGSA 2BP6A 3SISA 4YZ1A 5FY1A 2ZKNA 2YC4A 2ARXA 3OTFA 2Y6KA 3VHNA 3ZX7A 3ETPA 5C33A 1RXGA 2WT1A 4K40A 1W6PB 2G9ZA 4QQPA 5GLTA 1QOSA 4JRLA 4YRDA 1KS5A 3TEWA 3FBMA 4N43B 3E5UA 2HWE2 3J26N 3VD5A 3WY6A 1JZ3A 1Y3TA 4GD4A 4A7YA 4L9BA 5C3PA 2VZUA 1ENRA 3L9JT 2B42B 5EPAA 3ILRA 5FO7B 3ZMOA 1OF4A 4B7EA 1OH4A 1AHSA 5I91A 1R64A 5FY4A 2PFWA 1CONA 5J37A 5DDJ1 4EQVA 3T2QA 5KHIA 5GLUA 1LGCA 1QHDA 2VW0A 2BRTA 2XUEA 4XABA 5K8SA 1EY2A 2ZABA 1PO11 3BN6A 3JZVA 4W6WA 1XYNA 1SEFA 2DURA 2JG9A 2WA3A 5F37A 1HW5A 3AL5A 1AX1A 3Q9OA 4YVWC 4XFHA 1ZZ9A 1J83A 5JSRA 4A41A 4CSWA 4EE2A 2WWJA 2EIEA 3NO8A 2Y8KA 5L36A 3RZJA 5FKCA 1SACA 3C7OA 3I3EA 1J3RA 3WF1A 4BIFA 4NIGA 4WVWA 1VE0A 2YBPA 3X29B 2PAEA 1Z7S1 3OGJA 3NNGA 3J9SA 4BK4A 3GALA 4YPJA 5FMDA 1IHMA 2ATFA 1AX2A 3T30A 4Y20B 4H14A 1YUDA 1QJFA 4H2AA 1RB8G 1C8NA 3O14A 5FY8A 4FOWA 5FZ0A 2V72A 5A7SA 2FDGA 2VCAA 2F17A 5K9YA 4HETA 4M3CF 4AEDA 4Z8BA 1WWYA 5F6LB 2QQKA 1VRH3 1W9YA 3PIJA 4JZRA 1F2NA 1SZBA 5FQ0B 3WQ1A 5EYXA 1ZRDA 5BNOA 1FNYA 1V6LA 4COWA 1E57A 1YYNA 3AM2A 3GJAA 3LOBA 1S0IA 1O4ZA 3VDAA 2VY0A 4K8FA 3NV2A 2IFRA 1XNDA 4FQ4A 2VULA 3JU9A 4AHYA 1PMHX 1MZFA 5JOXA 3NQHA 1S2BA 3NV3A 1H2LA 3HNBM 4CCNA 5IW0A 3KQRA 3VBHA 4FTBA 1PX4A 2ARCA 2BUKA 3QH7A 3O5SA 5F3IA 5DXDA 2XVKA 1V6MA 1DQ5A 4V2VA 1RUF2 5FZ4A 1CIYA 1DBNA 1X82A 2JG9C 2VQUA 3GZUC 4HL0A 4V2WA 5DN2A 5DUXA 5EWSA 3CKHA 3GJBA 1NXD1 1W2OA 1OUSA 2A6ZA 4IV3B 4MXWA 3IMMA 4NHXA 5J09A 1P8JA 1RIRA 1ZZ8A 1W8TA 4LNVA 4AI1A 1S0BA 5BNOB 2PQQA 1YJLA 2RMU3 4P9XA 5AVAA 4ZU7A 3TN92 2GZWA 4LKSA 1N1YA 1EPZA 4OHXA 2FMDA 2GN7A 2GP3A 2PTMA 4QGNA 3BPZA 2JJ6A 5J7MA 1OBNA 1PK6B 1W9SA 1UXZA 1IPSA 4R8HA 4XPVA 2AR6A 4F83A 3WW3A 5F5QA 3KT1A 1CVNA 3I2OA 2JWPA 1OHFA 5KC6A 1YLLA 2G4IA 4AEDC 3PVOA 1LULA 1WW4A 2Q8DA 1ND2A 3CJIB 2BDRA 4LLOA 5FMOS 1W2UA 3NJZA 1LOEA 3V64A 5IK8A 3O1RA 2DCYA 1RUI3 3C7GA 4FPEA 4XC9A 2AEYA 3N36A 4AQTA 2IVJA 4MXWB 5BNOC 5FPBA 5JLVA 5JIAA 1POV1 3K51A 4N7IA 4QXHA 4XMAA 4OZXA 3S6PA 2WINB 1JW6A 2VH9A 4NMIA 5IVYA 1BEV1 3O1SA 5A7PA 5EJ3A 2JD4A 3C7HA
chains in the Genus database with same CATH topology
3PVBB 2LUWA 5LK5A 1JYCA 1VBE2 4X8PA 3G7DA 3R05A 4XIKA 5FLJA 4HLTA 3VBHC 2A3XA 4CP0A 4YZ2A 2ZGSA 4PBOA 3G6JB 3ZXLA 1W6OA 1G8WA 1AR61 3AP4A 3DGTA 3WQ0A 1QWRA 2YROA 2CGPA 1XE8A 1ND2B 4FP2A 4AEMA 3IBMA 5IK5A 5EYYA 2ZGMA 4CEWB 4D7TA 1WMEA 1KFUL 2RR11 4FOVA 1I1EA 5BNPA 1O7FA 1W6MA 3MI8A 4IL7A 1JXNA 1NG0A 2HWF2 2DU1A 5JSOA 4H7LA 2GMPA 3MFCA 1NYWA 1D4M2 4JGZB 3H1YA 2UY9A 5D1IA 1JYIA 1GR3A 4Y22A 1KITA 3B94A 4AVAA 1DGWA 3SNMA 1ND2C 4DPNA 3RZZA 4HN0A 1FOD1 3PJYA 2YYOA 1CPNA 1HKDA 3L2YA 3NVCA 4Q0QA 1ZBE1 1RITA 1IGOA 4M0NA 4XMIA 5CG8A 4K20A 2WNEA 1ZBA1 2WSVA 3AFGA 3MF6A 4QMAA 1V6IA 4LO4B 2WQZC 2ZHNA 5BNPB 4JDOA 2XKPA 2Z5WA 1BJQA 4B29A 1AYN2 3CLPA 3SH4A 1SMVA 2PHUA 1J3PA 3FHIB 1VBB3 4EN6B 1DQ2A 4I0WB 2HWB3 3KGZA 4KU8A 1PZ8A 5E89A 1Z0HA 4OI0A 3PTYA 4AFMA 4KGQA 3ZFEB 1QH7A 3RJRA 4XF3A 1S0GA 2XBO2 3D8CA 1H9PA 4XBQA 2E51A 3VBUA 4EN8B 1RJ7A 1GKBA 4F3JA 5JAXA 5BNPC 1QMJA 2V5YA 2CAVA 4U36A 5KWRA 4HPKA 1BYHA 4AEKA 4AI0A 4RS5A 1HRI2 5JVVA 4KG0A 3JBG3 4QHBA 1KFXL 2E7AA 3V0BA 3UV9A 3RYRA 2XLAA 2Z2SB 4MGZE 3SCFA 3WDXA 1X7NA 1WCDJ 3AZWA 3USSA 1OQDA 2UWBA 2AYHA 1GFF2 2ZS6B 4AVTA 3TWIA 3ZYIB 2ZMKA 5CNAA 1WW5A 1BMV2 4BMBA 1VB4A 2MNGA 2RS33 1MEC2 3OBRA 4W6XA 5AVPA 1LEDA 4IETA 1ZZ7A 3DV8A 4S2FA 5I0UA 3AMHA 1K5MA 4HPKB 5DUWA 2RM22 2OYZA 3SHRA 4Q4V3 2X53S 4BE3A 4K1ZA 5C8CA 5JPMB 4LBQA 3AMQA 3LA7A 3LZZA 4B4PA 3E5QA 4EWEA 1OI6A 1RHI1 1MS8A 1HRV2 2FMYA 2RS51 2VOVA 3MIDA 5LEJA 3KT4A 1Q43A 1OLQA 2D6LX 2WFF1 1PVC1 2JENA 4Q26A 3LA3A 4JDNA 1IQAA 4J1WA 4MYEA 3VBUC 3AYCA 4YG3A 1U0AA 2RHPA 1DZQA 3AP5A 4LA3A 4QPYA 4RS5C 1K5MB 3NAPB 1WGPA 4HN1A 2G9FA 4CDQA 1H0BA 1KDKA 2DCTA 3WNXA 1BCXA 4DXZA 3J8F3 3VZKA 4FPKA 5EV7A 1WBLA 1TMF2 3S7IA 3WD5A 4S2HA 1S1AA 4Z07A 4CDUA 3RDIA 3VKOA 3IDEA 3WQ7A 3R4SA 1WMDA 2Y0OA 3ILNA 5T54A 3KCCA 1EP0A 3FZ3A 4QPIB 5EFUA 2LALA 1LTEA 3H0OA 4IEXA 1K5MC 4RQPA 1RUJ3 4RFT0 3B02A 2VMHA 2H6BA 2H0VA 5C8CC 2QE3A 2IC1A 3D6EA 1D2QA 1CN1A 2ZKLA 3OD4A 4CDQB 4N53A 4TWTA 4MH0E 1W6NA 2P3KA 2A75A 5E8AA 5KHHA 4R52A 2ZCWA 4G4FA 1CAUA 4QU2A 3AFKA 3KD4A 3AKQA 4PLOA 4AEJA 1RMU3 1G6NA 2D6PA 3NKGA 4W6YA 5L73A 1CGPA 1W0OA 4OVEA 3KB5A 2C9AA 4FXGB 2O1QA 2DVAA 1VRH1 3N7MA 3BALA 5A32B 4RQPB 1DQ4A 4LBOA 1SLTA 2AGSA 4CDQC 1I3HA 2DCJA 1X50A 3R4DB 1ENXA 1RUG2 1DZTA 4QGMA 5BXXA 1ZZ6A 2H6CA 3THPA 4HSJA 2UURA 4CDUC 1GLHA 1J1LA 2MEV3 3VBRC 1CAUB 4OULA 4Q1RA 4D7SA 2ZGKA 1LHVA 4E2SA 3FFZA 4LA2A 1ZRRA 1FPN2 4RQPC 1FMD2 1H8TB 3VZLA 3AZZA 1NCRA 2Y26A 1WBFA 1HQLA 5CIRA 3CL1A 1BBT2 1QQP2 2RMU1 4N53C 3MW4A 2VVFA 4M3CB 3H8UA 1C8M3 2MHFA 1EV13 5DZEA 2QDNA 3CJXA 1VAMA 2ETEA 2ZA9A 4FCAA 4CEYA 1QJX2 1G9CA 1PZ7A 1RVF2 4XFIA 4LBQD 2XLFA 2TUNA 3IKWA 2VW1A 2PN5A 4LO8A 1J3QA 2K0GA 2HWD2 2YMZA 1ASJ2 3ZFFA 1RUI1 4XXPA 4AQSA 1EAH2 1G9FA 3ZN6A 5AFEA 2D5FA 1SCRA 3ZXJA 1VBC2 2PHDA 4E4DX 3JD71 2EA7A 2D98A 2NMOA 2ZPXA 5GZGA 1NA1A 2VW2A 2HKXA 3M7AA 5K7PA 5E1RA 2R073 1H1AA 1HXS3 2CL2A 3ST7A 1LB2A 2HWC2 4C91A 1Q3EA 3P3PA 1CAVA 1R083 1LRHA 1V9U1 2DUQA 4DRVA 4QGLA 5JPNB 4GALA 1RUOA 4PIXA 4Q4Y2 2Q8OA 4OFGA 1NCRC 2BGCA 4N9IA 4CDWA 1VLNA 5H9SA 3ROUA 3KSCA 1DGLA 5T50A 1PVXA 2PA7A 2NZ9A 2NLRA 1LHNA 4XJWA 4IEQA 4I02A 3OYWA 4CEYC 1OA4A 1RUC2 1YJKA 4DOUA 1AUYA 3VL8A 5FO8B 4QPGA 2DV9A 1G9BA 3C3VA 4YVSA 4MZUA 4WM8A 3VKMA 5CFCB 1XYPA 4L8QA 3DN7A 5C6CA 1AL22 3ZFFC 4AGRA 4E2GA 3DL3A 3H7YA 4IEPA 4CDWB 4YM2A 4GMP0 1CAWB 5F9TA 5I0SA 2GALA 3BIWE 1UW8A 2VPVA 4QD2A 4R9CA 1NA1C 1AR71 1GICA 2X5IA 1PO21 1I5ZA 3OYWB 1NQJA 2DVBA 1XRUA 5CA6A 5F1RA 5AC93 2NQYA 2HWB1 2OUJA 4LTAA 3AKRA 1TQ5A 1N3QA 4YVSB 4WM8B 1OOPA 5KHGA 1QF3A 2FHRA 4CDWC 1FYUA 3TN93 1OFNA 3N35A 2CTVA 2SBAA 4XHBA 1FNZA 3VZNA 5SV5A 4AGVA 1ULEA 2R062 2A3WA 3GBWA 5AFBA 5BV6A 4UW5A 1QY4A 1LR5A 1VAKA 1AYM3 1IS5A 1TME2 3IPVA 3WHTA 4BWOA 5KC6A 1J59A 1DGWX 1U5YA 3AB0A 1X8MA 2WKKA 4Q4W1 4QPGC 1IZ3A 2DVDA 5T5PA 3VDDA 4EV0A 4HK8A 4LO6B 1BVP1 4N9HA 3WX5A 2C5DA 4TYSA 4YVSC 4XQ4A 4DNYA 4WZFA 4G3YC 4DZGA 4FPHA 4CYDA 2EVXA 2ZGNA 4JC1A 3M3EA 4AVVA 1QJY2 4K1YA 3IDBB 3WG1A 4ONUA 5H9PA 4HZFA 1H1MA 3U10A 2ILMA 2X5IC 4ASLA 1DFQA 4NWVA 5C4WA 3WG2A 3ZFGA 2PAMA 4AWDA 5BUVA 3IPVB 4Q4V1 2NP0A 4J6GA 4OHWA 3SLIA 1A78A 4HVOA 1JOJA 2ZX4A 3QCWA 3UKNA 1YFUA 1RUNA 1RINA 1OOPC 2XVLA 2AUYA 2R061 3D0SA 4GWMA 4EN0A 3UKVA 5JWPA 1YWKA 3HD8B 4HKOA 5ACA3 2PLV1 4B3NA 5C4WB 4XW3A 1QGLA 3RYKA 3ZFGB 1TE1B 4IQPA 3VDDC 1CAXA 2VECA 3CU7A 5FPZA 1LGBA 5DDJ2 4JGYA 1NY71 2YDEA 3J8F1 1RL3A 1CQ9A 4COVA 3JQXA 4Y1UA 1PO12 3VN4A 3TOJA 3AMPA 2DF7A 2HJIA 3H1MA 2GC2A 4Y1XA 2GMMA 2UYAA 2D43A 1RUH3 2BVVA 5C4WC 1GNHA 1UN1A 4AYUA 3QLQA 1RUJ1 4WVZA 3ZFGC 1Z7S2 2ES3A 4PLMA 3PHMA 3LGRA 1H30A 1W0PA 1ZZBA 2DUOA 4QM9A 2PYTA 3M4FA 3FLTA 1CAXB 4HKLA 1GNZA 1CESA 1QDCA 1S2KA 3OBTA 4Q0VA 4YVWB 2A3YA 3EJKA 3BB6A 2AH2A 2GU9A 2IZWA 1HV0A 4YW5A 4QT6A 3VUOA 3WLUA 1HIXA 2XL7A 3HN1A 4ES9A 1O3SA 2OZJA 1A6CA 3AXEA 2Q5TA 4JV4A 1SCSA 2EXJA 1R093 4URTA 3CO2A 4EWAA 1BQPA 4MUVA 3MLLA 2GH8A 4JGYC 2IXHA 3LWCA 5LRRA 1AR82 2XL9A 2E7QA 2ZGLA 4DRRA 3SH3A 1UAIA 1BXHA 1AR93 2MEV1 4PIZA 4BOWA 3A0KA 4RSUA 4Q4X1 2RS13 4AG4A 4OUMA 4K21A 3BOWA 3M3IA 5IK7A 2RM23 2A5ZA 5J3UA 3DF0A 3VBSA 5J36A 1MS3A 3RWNA 4DFSA 2XJVA 1ENSA 3NV4A 1XXNA 3MW2A 4BH9A 2D3RA 3JCIA 1HRV3 4P9WA 2XJQA 2JG9B 2WS93 1C8M1 4UW6A 1YFWA 4P9YA 1ALYA 1EV11 1YXWA 4QQ2A 3VKNA 1IKPA 4OHYA 3GBFA 5FFOC 1PGL1 1LGNA 1YIFA 2JE9A 2O0OA 4EROA 5D8AA 3M2MA 3ZIWA 4RHV3 1GSLA 5JZGA 4HANA 1W6QA 1BEV2 1RUE3 4O9EA 2SLIA 1AR81 1GZCA 1TMF3 2P2KA 1ZREA 1F8VA 1IOAA 4AEDB 3ZSJA 1YI9A 4H3WA 4Y1ZA 4YNIA 3VBFA 4CZSA 4IESA 4DY3A 5JOZA 1AR62 5CBLA 3O0WA 4JAAA 1HXS1 4Z82A 1N1VA 3PJQA 1MR5A 1R081 3VKFC 4TZDA 1REEA 3WW2A 2IXCA 1ONAA 2RR12 4ISQA 3VBSC 3DUIA 3WR0A 1VALA 4LUKA 4AVCA 4B7KA 5JI7A 3VBHB 3AYEA 1MZ6A 5FO9B 1VIWB 3MICA 4YGBA 5C8WA 4CRQA 5C9AA 4D7YA 4A7ZA 3VHOA 5JR7B 2BTVC 3SCGA 2GDFA 1FOD2 3DKWA 5A33A 5D8AC 4GXLA 4YW2A 4D3WA 1ZBE2 3U07A 3ALQA 5JZGC 1VBD3 2WWSA 1GYKA 1ZBA2 1PMIA 4TSVA 1LU2A 1XNCA 1RUD3 2A7AA 2ZAAA 2ZGUA 3PMEA 4R9BA 1RUG3 3GHMA 2BFUS 2XH6A 2XVGA 5HCBA 4GKXA 1V70A 4FTEA 3VBFC 3VHRA 1ENQA 1DYPA 3HT1A 3TBDA 3UL2A 2AENA 3WDTA 2GNBA 5FREA 2WL1A 2EIGA 5A33B 2C1FA 4Z1VA 4R9AA 3K48A 1NLSA 3RMXA 1VB2A 4YYOA 3EQEA 4XIOA 1ND3A 3ZSKA 1QQP3 4XFFA 2XJSA 3WP4A 1DQ0A 1WCKA 2Q4SA 4AFBA 1W6OB 5KXEA 5FCCA 2HEYF 3H1WA 1SLLA 1OMIA 5C9AC 2NN8A 2WJSA 4XF4A 1QJX3 1AXYA 2BNNA 2D6KA 3IDCB 1AYM1 4L97A 3TNPB 5L7OA 3PLQA 2R0FA 3CEWA 1W6MB 4ISRA 1N3OA 2JKBA 5DG1A 2VGDA 4XBLA 3VHPA 1ZYBA 1UZYA 2C0ZA 1QDOA 1QNYA 1QJU3 1CX4A 1ND3B 4COYA 1I6XA 4F8AA 1EPWA 1VBC3 1RGSA 3ES4A 3JQWA 3WG3A 3HT2A 4Y22B 3ZSEA 2HYKA 1COV3 3RI9A 4COUA 4KU7A 3B9IA 4DMIA 4SBVA 4OLLA 4LE4A 3KLSA 3WT3A 3ETQA 2YC0A 4LLFA 1RHI2 4YW4A 2RS52 1UCXA 2WFF2 3KCXA 1PVC2 3RYPA 4C0BA 4I30A 1WLDA 5FBZA 3S30A 4A7KA 1ND3C 2A70A 1JUIA 2Q0AA 4LULA 5KC5A 2WNUA 3PNAA 5T52A 3AKPA 4O9GA 1SLIA 1OQEA 1AZDA 2GN3A 2D3SA 5CG9A 1FXZA 4IXLA 4LO7A 1BVVA 1RUC3 5ACA1 2D3PA 1Q8QA 3VBUB 2A6VA 1PIV3 1S55A 5L7OC 1KJLA 4M3CE 4GKYA 1YO8A 2B7YA 3A4UA 5ABJA 4LBLA 3HQXA 4RS5B 2VMGA 3V0BB 4XF0A 4XHXA 4AXOA 4XF9A 2EAAA 3ME2A 1R1A3 1RUH1 4Q2FA 4Q0SA 3M3OA 1FT9A 4FVVA 1BK1A 5CFDA 4NOTA 2D7FA 4R9DA 3UJOA 1B35A 3U4XA 2VU9A 4P9LA 2R32A 2GH2A 1UZZA 5I0TA 2QCSB 1AVBA 2IXLA 1PGW1 1QU0A 3WW1A 1SDWA 2VOWA 1OFSA 1HLCA 4AE2A 1ZZCA 2WNUC 3EHKA 4GH4A 5C8CB 1VRH2 4LBQB 3MPBA 1KS4A 5HI0A 1QXPA 3JUUA 3LCPA 4RA0A 5KHKA 4XFAA 2YZ4A 2X29A 1TME3 1WA4A 3VBRA 3P3NA 2H0BA 3ZIXA 1AF9A 3WDYA 4A3XA 3ZO0B 4FOQA 1R091 1SQ4A 3BTAA 3KM5A 1O5LA 3N4MA 3B69A 5ABJC 2XWBB 5FTTC 4GB33 2WA4A 4ZU5A 4FXKB 2JE7A 1VBA3 1VP6A 4FPFA 3ES1A 1FI2A 2R043 3ZN4A 3MZHA 1AR91 3MLJA 4IEVA 4NWWA 2B46X 1C1FA 4IERA 4C0HA 2RS11 2RMU2 5JMCA 4CDUB 1O3RA 2BWCA 2WZR3 3VBRB 2EXKA 1H2NA 4Q8LA 5CFDC 5I0RA 5J96B 1MS1A 1B35C 1V6KA 3FJSA 1PGSA 5SV8A 3D0JA 2ERFA 1FV2A 2OVUA 2ZZJA 2WS91 4LR4A 3V0AA 4N7UA 5FRAA 2JG8A 3NV1A 2HEVF 2UU8A 4GH4C 1Q8VA 1O3TA 3ZYPA 1DLLA 1ZVFA 2VQAA 3IMNA 4N53B 1DG6A 1RUI2 5BNQA 4RHV1 1W6NB 2QUOA 5J98B 4KWKA 1CPMA 1KJRA 1UPSA 4AVSA 1SLCA 4HVRA 2QNKA 3O12A 3JD72 1RUE1 1LHWA 2IXKA 3WP3A 5FDBA 2HEWF 3H7JA 2XG3A 4Q0UA 4ATEA 1POV0 2ZAHA 4IEYA 5FOJB 1V9U2 3ZXEA 1HQWA 1MQTA 3V0AB 1MS0A 3J4UH 3S7EA 1S0CA 2O8OA 2QKDA 2A6YA 3PVNA 1FV3A 2EAKA 4M0HA 1KXGA 4H7MA 3S0MA 1CJDA 3QACA 3FUOA 1S0DA 1SFYA 3KZ4C 2E53A 4YZ3A 2E6VA 4ITCA 5T5JA 3ATGA 3LA2A 3GZAA 3AP7A 3ASIA 1NXMA 4AHWA 5GZCA 4SLIA 4NPRA 1LESA 3USUA 3RS6A 2O8QA 3VBOA 2HWE3 4IV1A 1QXJA 1NCRB 2QZ3A 4AI8A 2QFEA 2JG8C 3E6CC 1WW6A 2D6MA 1C5IA 2NM1A 2ET7A 2XJTA 1KDMA 2Y0IA 1VBD1 5I8YA 2WLPA 3MIBA 4INDA 4M01A 4XBNA 4CEYB 4WVMA 1RUD1 2JX9A 4KBBA 1AR72 3H3UA 1FAYA 2DFCA 1PO22 1NOVA 4FPLA 4RR3C 2DUPA 4BHPA 2TNFA 4ATFA 1VBB2 2HWB2 3RQ0A 1UU4A 4H55A 3ZFFB 1MQTC 3B3QE 4ORFA 5B2GB 4L11A 5T5OA 3W9AA 3B7MA 3E97A 4UW4A 3ZVXA 2B9UA 3ZN6B 3NWKA 5KBFA 3M70A 3FFQA 1SBFA 5FMOL 3WG4A 2D93A 4AF9A 3AJZA 3E6DA 2D44A 1F31A 2VQ0A 1ZX5A 1NA1B 4ASMB 1WLTA 2G9GA 3JB4C 1F5JA 3ACLA 3LSDA 4XILA 2P3IA 1CAVB 3UJQA 4Q4W2 3JBG2 1MVEA 3VBOC 5I93A 1V6NA 2VNOA 4IV1C 3RNSA 4KNCA 2PHLA 2CV6A 4MV2A 1XYOA 4I01A 3PMSA 2B5HA 2BFUL 2BYVE 1AXZA 3H3ZA 5FOBB 4DB5A 4OI2A 4DY5A 2UYBA 2WSUA 3POSA 2JICA 5HCAA 2WNVA 2VUJA 4YLZA 2RS32 1RUF3 1PNFA 1VBB1 1QJU1 4PDWA 1LECA 1GBGA 4QPGB 5DG2A 4YSFA 4C1XA 4Q4V2 4YG0A 1COV1 4XTPA 2E9QA 1Y7BA 4R4XA 3QBQA 2DVFA 5IUQA 3WV6A 5GZEA 1PM7A 5KXDA 3VL9A 1ZRFA 4DINB 3MFAA 2P34A 4U2AA 2RR13 3SCHA 1A3KA 2OZ6A 3JB8A 4AI2A 3VZOA 1Q8PA 1A8DA 1TNRA 5K0UA 2X5IB 3FX3A 4YW3A 1LHUA 2D6OX 1YIPA 3IIAA 2I2SA 3JBG1 4META 3WCSA 3WDVA 2PLV2 4BCUA 4V1PA 3NSTA 4PDWB 1Z78A 1GQHA 1D4VB 1OOPB 1URXA 1UX6A 5KHJA 4RGGA 3L2HA 4UBHA 1NY72 1DGRA 3J8F2 4JRAA 1YNAA 3WXPA 4D94A 3AZVA 1ZBE3 2CWMA 1PIV1 2PHTA 4I0AA 3SH5A 2RS31 2W39A 1ULCA 1VBE3 1XU2A 3AP6A 1NCQA 1VJ2A 1NQDA 2ZMNA 1ZM1A 2WNVC 2DTYA 4GWNA 1UKGA 1V6JA 2CYFA 2RJKA 2DYCA 4PDWC 3T2TA 2B8MA 3VDDB 4YARA 4FP3A 1RUJ2 2DCKA 5TSWA 5JOYA 4NHKA 1M06G 2PELA 2PHFA 4GA9A 1APNA 4BA6A 1R1A1 1UD1A 1ULDA 4LEJA 3AKTA 4LHKA 2HWF3 4RD7A 1DZRA 1F9KA 2R49A 3AXDA 1TEIA 1JUHA 2UY8A 2N7GA 1D4M3 2A6XA 2GNTA 2RJLA 1NCQB 1MZEA 3AMMA 3ENRA 1PZ9A 4Q1PA 4E27A 3RPQA 5K0UC 4GMP3 1GANA 1AL0G 3ZXKA 2ENRA 3MIGA 3ECQA 4C1WA 1LHOA 3FC0A 3N7JA 1T6GC 5CAZA 1YI7A 4G9SB 1AX0A 3WHUA 5H9QA 4Y4YA 3DPRA 5DZFA 3TNQA 2BNMA 1VAVA 2MEV2 1AYN3 2OPKA 2VUAA 1NCQC 2UWAA 1G9AA 4Q4X2 1W6PA 2GAUA 4X6RB 2CWSA 2ZGOA 2K9ZA 4COZA 4GB31 4FPJA 4AK3A 1VBA1 2BWAA 2OA2A 3CNAA 3ZYJB 1LCLA 2ZHLA 2R041 2NPIA 3GYDA 4LHNA 5LRSA