4R4ZA

Structure of pngf-ii in p21 space group
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
540
structure length
538
Chain Sequence
AQTYEITYQNSFEGKINPNQNHIISITNSDKTLLFNEKIKNKKADFPFEVNEINRKNNEVSQFAFLNNNEIVKTSDNTILAKQEFKPTSETGKILGYNVKKAVTSVNSNTIEVWYTNDLKVKGGPSILGQDLGLVLKTVRNGSSVVEATSVKKIKALDDQSLFNNITEKDALTYKDMIWKSRFITIPVFENETINFSDASKSDQVIQRFGNGTIILKKVKIPEIKQGNTIFVELKQKSNGDAYDRTGDVFIIPQERAISYYTGLTQGVKSLPVYQNGNGKSYQGVALTPDYLPFIELMRFFTPFGIGHFNEKIQLKGKNWHNNTPYRQDITELRPQLSGKEILIGAFIGNYDKGGHQISLELSIHPDQQKIVNNNFVLPVFNTTNVMEMAGQDYPTMFNSDKGVEVEFILTKDLKNAQLRYITTGHGGWGAGDEFVPKENSIYLDGKLAHAFTPWRTDCGSYRLFNPASGNFEDGLSSSDLSRSNWCPGTITNPVYINLGNLNAGKHTIQVKIPQGAPEGSSQSFWNVSGVLLGQEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification and Characterization of a Novel Prokaryotic Peptide: N-glycosidase from Elizabethkingia meningoseptica
rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
molecule keywords PNGF-II
total genus 127
structure length 538
sequence length 540
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r4zA03
2.60.120.1570 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r4zA02
3MLKA 4R4ZA 3PMSA 3MIGA 4R4XA 3MIHA 3PHMA 3KS7A 3MICA 1SDWA 1PNGA 1YIPA 3MIFA 1PHMA 3MIBA 1PGSA 3MLLA 1PNFA 1YJKA 3MIDA 1YI9A 4QHBA 3MLJA 1OPMA 3MIEA 1YJLA 4E4ZA
chains in the Genus database with same CATH superfamily
1W9SA 1D0HA 1ND2A 4AI3A 5FZ9A 2VULA 4HVQA 2GSYA 3BIWE 2NPIA 2XMLA 1RUI2 2ZPXA 2VQAA 1URXA 1UN1A 3HWJA 4FPEA 4QDQA 1QOOA 4DY3A 3KQ4B 3LAGA 4IEXA 3I2HA 4QXHA 3HMYA 2E53A 2OQ7A 4A41A 1SFPA 4BA6A 1VBB3 1KD7A 4HKOA 2D7FA 4AE2A 1WCDJ 4QPGB 3WR0A 1S0CA 3WNMA 3PDQA 3VKNA 1G8WA 1XNCA 2PLV3 2RS53 3DEMA 2WQ4A 5C4WA 5AFEA 1WA4A 1MR5A 2E26A 1OOPA 3K51A 3MEPA 5DAVA 4N9HA 3BI3A 3SEEA 1W9WA 2J1AA 4UW6A 4ASLA 1RUNA 4LBNA 5GZGA 3OEBA 5T5LA 5LCWL 3D8CA 1LHOA 4LBKA 2GAUA 2Y60A 4B1LA 1HJFA 2VNGA 4EYUA 5FRAA 1DBNA 3LD8A 3WF4A 1Y9QA 4CDXA 1XBFA 3DGTA 4INDA 4LHLA 1AR83 2Z79A 3HOBA 4YVWC 5CNAA 5JR7B 3WDXA 2ZZQA 3VZJA 1W03A 3DL3A 3H1WA 3I2KA 1BQPA 1BBT1 3E5XA 3N7JA 4L99A 4AWDA 3GHMA 5KXEA 3W5MA 1V6LA 1PM7A 1QQP3 2D5FA 3H7YA 5FPAA 3PMEA 5B2GB 1ASJ3 1C8M3 5IK5A 1LOAA 5J3UA 1I5ZA 1I9RA 1W0PA 2PELA 1D2QA 2WO1A 2A75A 2Y8KA 3AYAA 4GKYA 1OQDA 4LLOA 3B01A 1AUYA 3VBRC 2CGOA 2ZGKA 3PVOA 5F5AA 3I97A 1FV2A 1PGW1 3MHZA 4LUKA 3NW4A 4GWIA 2XJPA 3FMGA 4XUTA 4BWOA 4BQXA 4D8MA 2JDAA 1DG6A 1UAIA 3BB6A 4NPRA 5EP9A 2QZ2A 5IAXA 3AMNA 2OPKA 5H9SA 2W1UA 5K9YA 3PUQA 4OCTA 2ZHKA 3OBZA 3L2YA 4UFKA 2VMIA 5I8SA 2UWBA 2O14A 3H0OA 1KFXL 2JXAA 4PI0A 1I5PA 2RG4A 1CAWB 5ISLA 2YC0A 4S2GA 5C8CC 1VRH1 3N9LA 4PIXA 4QB6A 3URFA 1HB2A 5JXHA 2DFCA 2B46X 1UYYA 5H9QA 1XNAA 1WCUA 1RYYA 1W04A 1W6PA 2A6YA 4JQRA 1JODA 5KXCA 1GP6A 4R4XA 5CG8A 3OGJA 4Y24A 4HMZA 4PLMA 2VUDA 3TWIA 1OF3A 1WZXA 4HBNA 4EZ4A 5F5QA 1AR92 5DPNA 5ACA1 4A7KA 1UNBA 1GZTA 3CKHA 1XYOA 3T1LA 3K48A 4BH9A 2IVIB 2P1BA 5FV3A 2ZGNA 3HBKA 4XF3A 1J58A 4Y20B 3JB8A 1PGW2 1AL22 3MFAA 3OUHA 4GA9A 3WNLA 3LSDA 4TLFA 4UF0A 1ULFA 4AK3A 3C2UA 2X5IC 2XWBB 5J37A 3CJIB 1CZVA 3FL7A 2WNOA 1YHFA 1PVC2 1TVGA 5FYSA 4HKWA 3UGFA 5I93A 1RUC1 2R7EB 2RS13 2RV9A 3ZLIA 2FD8A 5EJ3A 3NAPC 1UPIA 4NHXA 3VDBA 2HWC2 2R041 2WA3A 3K2OA 4DXRA 2MHFA 4COWA 4DZGA 5CADA 2RS31 4IV3A 2CGPA 5FZKA 2AGSA 1XE7A 3ZYRA 4LBQA 5ABJB 2E9QA 4XJUA 2K0GA 3I2FA 5F3GA 1GBGA 2WZEA 2ZS6B 2BWCA 1JYNA 1W6NA 4YZ1A 5BNNB 3VKLA 4BQ1A 4NOTA 2RR13 1CZTA 1ULCA 1VBC2 3I2GA 3NJYA 4P9YA 4AAPA 4QU2A 4AVSA 3O1TA 1RUI3 3SH5A 1HJGA 3TB0A 5IK4A 4LJHA 4J1XA 5FYCA 4YYOA 2YBKA 2HWB3 3KGZA 4GULA 1BMV1 4X6QB 4HG6B 3ZFFA 4ZS3A 4WM8A 2P37A 1W2NA 2DTWA 1W8FA 3A23A 1UYPA 4RHV1 1VR3A 5C33A 4XDQA 3TOJA 1N47A 2FMYA 1C1LA 3GBFA 4OMDA 2FDJA 4GXLA 4ZPIA 2UY8A 1UXZA 1QJY1 4YZ3A 5LASA 3PU3A 3JD71 5HV4A 2GNBA 5K0UB 3WW3A 3VBHA 1XE0A 1C8NA 4K9SA 5FZOA 3I59B 1DQ6A 2ZA9A 4COVA 1JXNA 4MUVA 4F8AA 3T3YA 5LZ6A 3F95A 5LK5A 5EYYA 2JB8A 2PTMA 4UBHA 3POIA 1ZBA3 2JG9B 3WDVA 4I3PA 1VBD3 1I3HA 4YVSA 5DAXA 1QKQA 2W91A 2WT2A 3IZOA 3MF9A 4BMBA 3QD6A 3N7MA 4HVOA 1H8VA 1UZVA 4OI2A 1WCSA 3T4VA 3ZDVA 3LEMA 5EPAA 1YNAA 2CY6A 4RQPA 3VDCA 2VAUA 4TLGA 1NXMA 4CXYA 2HWD1 2IXCA 5IVEA 1Z7S3 4FXGB 4P9LA 4YARA 4OVEA 1S4CA 2XL9A 2Y38A 4G4FA 4WV8A 3RNSA 3AM2A 1AR73 2WIIB 3WF2A 4Q8KA 1B35B 1L7RA 3BALA 2PYTA 4LKSA 5CZKA 3UESA 1RUOA 1PVC3 2P6CA 3RDIA 3FUQA 1TME3 1WW5A 2YGLA 4XXPA 1QJZA 2XUMA 1RUH3 1WBFA 1RUC3 1YI7A 4N7IA 4Y3OA 4KG0A 2L9LA 4ET7A 3WNXA 5F1RA 2VU9A 2BGPA 4B4RA 4WM7B 3VD5A 1CIWA 3ZSKA 1OUSA 4GWJA 3UKTA 1WD4A 3ZXKA 4ITCA 1GKBA 1PO13 4UW3A 3JU9A 5I0TA 1RTVA 5A33B 4GH4B 4XYXA 4FPHA 1YFXA 2JJ6A 2CDOA 2VO5A 4QKBA 3EYPA 3RRDA 2PHLA 3AKTA 4LMFA 3V65A 4BXFA 4CCEA 5CA6A 3ON7A 2ZMKA 3LFMA 2CGNA 2BYVE 1BZWA 4UXAA 3UJQA 3U11A 1DYKA 2I45A 3DCQA 4IGPA 3C7OA 5A3OA 3INAA 4IV3C 1RUF3 4KBZA 5JSRA 1PVXA 4CDXB 3JBG2 1LHVA 3DYMA 4FTSA 4XFHA 5H9PA 2A6XA 4Y26A 3BTAA 1U5XA 1OVPA 1Y7BA 5FY5A 1W2OA 3H3ZA 3AX4A 4QQLA 3I2OA 4JKKA 2Q1FA 1G7YA 3JBG1 2KD7A 1TMF1 3GZTB 1IHMA 5FDBA 4R8HA 1W6OA 4CCNA 4AL9A 2ZABA 1ZBE2 4Y20A 2FDKA 1ASJ2 1C8M2 1N1YA 3W20A 2AEYA 1B09A 1GWMA 1DQ5A 2ETEA 4AZZA 1YO8A 3LE0A 4Q4V3 4KNCA 3WT3A 5I8TA 5JXJA 5JZGC 4AVVA 2W2IA 4NPMA 5CIRA 4AVCA 5A3NA 3H42B 4FPYA 5FK8A 3LEKA 4DXTA 2WAOA 1PHMA 4BQ3A 2Y26A 4AFCA 3J7NA 4BOWA 3FHIB 4Y1YA 2ZGLA 1RUJ3 3W58A 1AJOA 1D0GA 2DVGA 5KC5A 2VZQA 2FCVA 1US2A 1QJY3 5FY7A 1LGCA 2HWD3 1CJPA 1KRIA 2ZCWA 2ZGUA 5LRRA 1UX7A 1BJQA 2VBBA 5LWBA 5FP8A 3VHOA 2R0HA 4LEJA 1FPN1 2WWSA 4UFHA 3ZN6A 3AP4A 2D97A 4TWTA 2B7YA 3MIEA 3TAYA 3GNEA 1F31A 2ZKLA 1PZ8A 1VBB2 4LO5B 3SCFA 1GZWB 2QBXA 3VBFB 3N9OA 1BEV2 3NWKA 1IPKA 2OIIA 1UY1A 2SLIA 4Z07A 1IZ3A 3ZSEA 2VTFA 2UYAA 3HPNA 3B93A 4YW3A 1I6XA 3VBUC 4KU7A 4Z92B 1JBCA 2DCKA 3E5QA 5FZIA 2WC2A 1IQAA 1E5SA 1GP4A 5DAQA 4PLNA 2YC4A 5A1FA 3CJIA 5F6LB 3ILFA 3PJQA 4JAAA 3I8TA 4GB31 2FDFA 4CDWC 3K4AA 1UIKA 1VBA2 2GN3A 5A3LA 3I3EA 2DWRA 5IT6A 4IEZA 3VN4A 4QB1A 2XLFA 3ZXEA 1W3XA 3K3NA 3PL0A 1E57A 5FMBA 4XJ9A 1NCRB 3RZMA 2E6VA 3ES1A 2UYBA 3GJAA 4N7UA 3VBOC 4AFAA 5IVCA 2LUWA 3IBMA 1W28A 3BTXA 2W47A 2J1VA 1MZ6A 4XTPA 5IK8A 4CP2A 3BTYA 4NAOA 1AXKA 1QJFA 2JB4A 3O7OA 4KL1A 5FLJA 2B8MA 1YC61 2AACA 3LQCA 5FZ0A 4AHWA 4ZY9A 5BNOC 3K4DA 4Y5SA 4HOOA 1RUC2 4FP2A 4L97A 4UT5A 5FKCA 3SHRA 3T2OA 3V56A 5TSWA 3BU7A 4IL7A 3AXDA 4L0PA 4RGKA 2E7QA 4CU8A 3ZOIA 1LEDA 1RVF2 4HONA 2ZTNA 1NE6A 2BU9A 2I07B 1X7NA 1KDMA 4Q29A 3THDA 2ZAHA 2Y34A 2VOXA 4Y22B 1AXZA 2HWB1 3HNYM 1JZ2A 3T30A 4LKEA 2DUQA 3P6BA 4CCKA 1T6BX 3O0XA 3BYWA 2WA4A 4META 3VB9A 3VL9A 1YIFA 4B3NA 2XUEA 4ZONA 2UU8A 1QNYA 4AEJA 4B29A 3MV01 4ZXKA 4IQPA 4IW3A 1L7LA 1VIWB 4Z2AA 2TNFA 4Q4X2 1RUG2 2MNGA 3IIAA 5EJ1B 2EICA 1MQTA 5JI9A 4LUMA 3AFKA 4BLIA 1XOYA 3NJXA 3TNPB 1ONAA 3LFIA 3S7IA 5F8PA 3BVCA 3T0DA 4O7XA 3JQXA 2JE8A 3N7LA 3AP5A 3SH4A 3ZFEC 4RQPB 2UURA 4LPLA 1QHDA 4YSFA 3O1PA 4GD4A 4L8QA 3POYA 3KS7A 3GM8A 3J7HA 3B7MA 2XKOA 4IEQA 3E5UA 1IS5A 3N9QA 2D5HA 1ZREA 4IEUA 4XBLA 1A6CA 4LBMA 2VW2A 3RZHA 4WM8C 1AYM2 1JI6A 1OH3A 1R1ZA 3WNPA 5T54A 1EAH1 2BUKA 2WT0A 4P5YA 4BZ4A 4PIYA 3OD0A 1UY3A 1RL3A 1S2EA 4MGQA 2MEV2 3AXEA 1FOD1 4LK6A 3ASIA 3R05A 1BK1A 2NYYA 4UBGA 5J36A 1NOVA 2CDPA 1H4HA 4XF0A 1Z78A 3VD3A 4AHYA 1G9AA 2K46A 3MLKA 1LU1A 4FT8A 4QKNA 5KHGA 2Q1ZB 3OCPA 4XMAA 1XNDA 3CMGA 3KVAA 4YPJA 5C5TA 2Z2SB 4PBPA 4P02B 3SXWA 3I54A 5FZHA 3WSOA 2NMOA 1HXS1 1NCRC 5T5OA 3LKJA 2BERA 2P5BA 3CJIC 3VBHC 4AYUA 1QJU1 1ND3C 3GDBA 3ZN5A 3FE5A 4NVPA 2VZSA 4FFIA 4L9BA 4BPZA 4DEQA 2RM23 4ZU7A 1F4AA 5HCFA 3RJ2X 4CVUA 3E1F1 3UT0A 4GH4C 1EV11 1V70A 4IEVA 2DUOA 3D4KA 4Q26A 4E9KA 5JSPA 4E2SA 5F37A 5FZOB 1VBD2 1OI6A 1LESA 1SBDA 2Q5TA 3USUA 5SV5A 1SCRA 2BOIA 4YM1A 4W4ZA 1AVBA 2WAAA 2XXZA 3POEA 5G05L 3RJRA 1ZZBA 4OYUA 1W8NA 1R1A2 2QQVA 2IC1A 2W68A 2BOJA 1W06A 3FLRA 5CVRA 5JSOA 4QD2A 1IKPA 5APAA 3THPA 2RDRA 4BYYA 1RUE3 1VAMA 3AB0A 1BK0A 2HYXA 4C1XA 1UOGA 3PURA 4MXWB 3ZYGA 3AP6A 4OHWA 1DDLA 4C1WA 5GZCA 5CKQA 3WHUA 3RZLA 2JDYA 3C7FA 2ATFA 2JDKA 4YVWB 5C9AC 2VD7A 5ANQA 3HQXA 4LE3A 4D3WA 3AKRA 4AFMA 3KD4A 1GWLA 1E5RA 5FJKA 2BPA2 5LBFA 1TG7A 2AREA 1C5IA 2ADEA 5FYBA 1H8TB 3KVBA 1WW6A 2RJKA 5KXBA 1GMMA 1WLTA 2FDIA 1O4YA 2A73B 1J3QA 2ZJCA 3VHRA 1V9U3 1KXGA 2GH8A 4Q4Y3 2D98A 4PF5A 2ARBA 2AEZA 2NQYA 4XIKA 4JZRA 2F17A 4PQ9A 4XHBA 5KHHA 4CTEA 1JZ5A 1LGNA 1OQ1A 4R9AA 1IS6A 3OGRA 4RHV2 4LT5A 4XCAA 2WDBA 1JYCA 1W2AX 3HN3A 2W1QA 5F32A 5A3PA 2PA7A 1UU4A 3ZFEA 1YRZA 4J25A 1CGPA 3N3HA 1I1EA 5LRSA 1RGSA 2PHUA 5JOXA 3KCXA 3POJA 1CD3G 4U36A 5FZBA 3RQ0A 1OSGA 4BLJA 5CKMA 1EAH2 1UIJA 4HXCA 1J83A 2ZKNA 1JYVA 3LWCA 1W2UA 4NRQA 5A3UA 2C1FA 3ILRA 3P3PA 5IFPA 2YFZA 1U0AA 3RYRA 4AI2A 3QACA 3H9AA 1SDWA 4OI0A 5FLHA 3LB9A 3MIFA 3SITA 1CAUB 5KC6A 5FZ3A 4QX1A 3R4UA 4IGOA 4D7SA 3ZYBA 1DLCA 5BNQA 1N3PA 1WKYA 3LOIA 5JZGA 4ZZ8A 1VP6A 1QJU3 2GDFA 5DZGA 2ZHLA 3DXTA 1PK6B 1RC6A 4N43B 4E4DX 1QOSA 2WKKA 2MEV3 4IXLA 2PHTA 1W6OB 2Y0OA 4LO6B 1COV2 2VTXA 1NG0A 3VBRA 3BUCA 1JTZX 1OPOA 1F4HA 4CP1A 3J7LA 1OKQA 4XF1A 4YWAA 5ANNA 4LQRA 5A6XA 1VPHA 2PQQA 3AMPA 3H1MA 4YFZA 4HT1T 2A6WA 4IESA 1JH5A 3S5QA 3MGUA 1Q8QA 2R072 2FBEA 4EJRA 3S6PA 1PGSA 3WVJA 2EIDA 2Q8DA 1DQ4A 1IKQA 5IW0A 4YM3A 3M1HA 3Q9OA 1UMHA 3B9CA 2F4LA 1PM4A 4HANA 5JPMB 2VOWA 4N53B 1RUH1 1K5MB 2D6LX 3D82A 4QX3A 5DG2A 1ZBE1 3OYWB 5L19A 3LA3A 4MH0E 5G04L 4QGMA 3DPRC 5JDBA 4Y22A 3KV5A 3CDZB 4YGDA 4D6RA 2HWE2 2WSVA 5BY5A 4WVVA 1H4GA 1JHJA 3ENRA 3OSDA 1GZWA 2F6BA 3PU8A 5CKNA 1OH4A 4KU8A 1OA4A 1U12A 2R071 2XVGA 3J8F1 4XFIA 5AC92 1ZZ6A 1RJ7A 1U5IA 3M2MA 1OHFA 3O14A 4LK7A 4XJ8A 2V5YA 3RZZA 1NXD1 1R1A3 3DKWA 1AR82 3IDEA 2VZ3A 4QM9A 3W21A 4C0HA 2JIGA 3C7HA 1PO11 2XJVA 3U4XA 2PN5A 1CONA 1REDA 2X8KA 4MV2A 3ZXFA 3T08A 2A70A 1UWWA 4ARYA 4QPGC 2ERFA 1QGLA 1XSRA 3Q8EA 5FOBB 3BODA 1NA1B 4Y1XA 2CAVA 1CIYA 4NRPA 3OGVA 4XUPA 5JPNB 3WQ7A 1O3RA 1HKDA 3JZVA 3NRUA 3MIGA 5GZEA 1GYKA 3ZMNA 4FAGA 4BIOA 5FP7A 5I0SA 5E88A 1UQXA 2WNEA 4FTEA 2C0ZA 4CUBA 1LULA 2JG8C 4Y5Z0 5EQUA 3WQ0A 4AI8A 2K2SA 2ADDA 5AVPA 4B4PA 1IS3A 1DYPA 1JW6A 2BGCA 3EO6A 5FYYA 3DXUA 3O1OA 1AF9A 2RVAA 3ACGA 3JUUA 1QNWA 5FMDA 3RI8A 2R043 1QIQA 2BNOA 2X29A 3AZWA 3ES4A 1PMHX 3H3UA 3I2IA 2G4IA 3M3QA 1OURA 5I0UA 4CE8A 2GMMA 1ENQA 5IFTA 4MG2A 1FMD1 2RDQA 3JB4C 4HL0A 1HV0A 2VUCA 4K6BA 4JDNA 5F5CA 1R081 1OT5A 3AZYA 1AYM3 1OXCA 2VQ0A 2MPFA 2D6PA 1CQ9A 3I59A 3KSCA 4YG6A 3WP3A 4OLLA 4CUGA 2QQNA 1C28A 3ZDSA 4Q0VA 3O1VA 4ZZ5A 2K9ZA 2EAAA 3K75B 3MLLA 1AR61 1W90A 4PIZA 1KQRA 5FXWA 3K77A 5F39A 1YWKA 3WQBA 1MQTC 2BVBA 3J9SA 5F2WA 5J48A 2WZR1 2J1UA 4D7YA 2B39A 4WZCA 3T09A 1UYXA 4NJ4A 4I30A 1TMF2 4YG3A 2JKXA 4YVSC 1PZ9A 1VALA 2ZBJA 3AZVA 1JOJA 1OKOA 3KM5A 3LPGA 4AGVA 1TE1B 4W6XA 3WHTA 3FC0A 3U07A 1XSQA 3RSJA 3GJBA 2BW8A 2OA2A 4R9DA 4CUCA 5FZ8A 4ZXEA 4BIFA 4NIHA 3RG0A 1VLNA 2BJSA 4CEWA 3FHQA 2A6VA 3T1MA 1ZZ7A 4DY5A 5BUVA 4GALA 2PHFA 1SACA 1ULGA 4G3YC 3N35A 2HBTA 2HEWF 2VY0A 5BNNA 4NIGA 3NNJA 3HQRA 5FZLA 3HIFA 2FDGA 2X05A 5F9TA 1P8JA 2A3WA 3AL6A 1JYTA 5IYYA 4D94A 1GQGA 1SZBA 5L73A 4WM7A 2XG3A 1QXJA 2Q30A 1UO9A 4LKDA 4QPIA 2YBPA 4QQPA 4BQ2A 1V6MA 4Y1VA 1Q56A 1H8TA 2ET1A 3FBYA 4IV1B 5FPLA 4W6YA 1H1IA 5A7OA 1OA2A 5GLZA 4MHRA 1H2KA 4GWMA 2E63A 3IWZA 2J1RA 3VBRB 1UKGA 1V6KA 4PBOA 1UL9A 2GC0A 5LEJA 1K3IA 1B35C 5CFCB 3I7DA 3O1MA 1MVQA 3AFGA 4LXLA 2XDVA 3WEZA 5C3PA 1F35A 3AP9A 3BCWA 1ENRA 3E6BA 3P1IA 4H2AA 4JV4A 4L11A 4RA0A 4EN8B 2XOMA 5FP3A 3SKVA 3IMNA 1VBD1 3ATGA 1H2MA 3SISA 4CRQA 5DXDA 2JG8A 2YB7A 1RUE2 5D8AB 1FOD2 1AHSA 2W9XA 3LZZA 5JIAA 5FZMA 2MEV1 3VZLA 3B02A 4NAMA 2AZ5A 1J1TA 4MX3A 3ZR5A 2VCMA 3ZSLA 5LA9A 1HRV2 1W05A 3A22A 1NLRA 1RUD1 1JYXA 3MUZ1 4FOQA 2HEVF 2VZ1A 3NQHA 4B1MA 4IE0A 4A44A 4RL7A 4PJYA 2E7TA 3D0SA 1A8MA 5EHDA 1W9TA 3ZYJB 5JLVA 4AQ2A 1G9BA 1U5YA 4QDSA 2VNOA 1RUE1 4XHXA 2WZR3 5FYTA 3ACLA 1HRI3 2XBO2 3ACHA 2W3JA 1SBFA 5HV0A 1QJY2 4TYSA 3RWKX 4CCMA 3H1YA 1NA1A 1QEXA 4AEDA 4XE9A 1WW4A 4BU2A 4EN9B 4A2UA 1C4RA 3L9JT 3LIHA 1Q43A 3ZXDA 3HQUA 3ZPOA 4FPLA 3HT1A 2XWJB 1MS0A 3FLPA 5LY2A 1CX4A 3LEGA 3DYOA 5C8CB 3H7JA 3CEWA 4OHXA 1HN1A 1ODNA 4HETA 4OHVA 4OULA 1ZRDA 4MGZE 3VLBB 1F5JA 1W9YA 5EZWA 5H9RA 1RUF2 2P17A 1H0BA 3ECQA 2ZGPA 1OLME 3GXUA 2JKBA 1CN1A 2BP6A 1S2KA 4V1PA 1FOD3 2NM1A 3FBMA 3M7AA 3WDTA 3ABZA 4CEYB 5C5UA 5A70A 4JHTA 4MZUA 1JYIA 3S5AA 2WNUB 1ZBA1 2Q0AA 5GKAC 4ZS2A 4JRLA 1YYNA 2W1SA 3WOGA 3T4HB 5BNPA 1UD1A 4W65A 3BN6A 3OGSA 4AVBA 2VOVA 1PMJX 2DURA 4JGYC 4QPIC 3SC7X 2SBAA 2BFUS 3L2HA 1HXS3 1QQP1 1JZ3A 2DVDA 4IE5A 2QDNA 4C0BA 5CFCC 4YW6A 3WZ1A 3A21A 2XJQA 3PNAA 3I2JA 4BDVB 4E4SA 1UX6A 3G6JB 1AR71 4XFBA 2ZHMA 1AL21 3POGA 1XE8A 1VBA1 4QPWA 3CJXA 1GOHA 1U5ZA 1YCIA 2HWF3 4I0WB 4P9JA 4CCCA 1SMVA 5FYZA 3ZXJA 1QQP2 3D6EA 3PLQA 5I91A 1DCSA 1XC6A 3BPZA 1ENSA 1W8OA 2A7AA 1REFA 2WNVA 3OG2A 1N1VA 4WVMB 3ZSJA 1O4ZA 1WMDA 1X9TA 4M4RA 2P3IA 1LTEA 2VNVA 1RMU2 3GBWA 1JZ6A 4NO4A 2Y64A 3FFZA 4FSJA 3BOPA 3UKNA 5HXMA 1PIV1 2CNAA 2B5HA 1CPMA 1JOBA 4XXAA 4WZFA 2C4XA 2VMDA 1QDOA 3VZNA 1FNZA 4DEVA 1QY4A 3ST7A 4LHNA 2YU2A 5IWFA 3A4UA 2R1BA 3OYWA 1D4VB 3GGLA 3S7EA 5JOZA 3MPPG 2WN2A 2VMHA 2QQOA 2GNDA 2NMNA 3QCWA 4GB32 5A7WB 2YMZA 2JWPA 1G9FA 5EFUA 3AZZA 2VCBA 3VBOA 5BPXA 5C71A 1MQTB 1RVF3 5L9RA 5T50A 1DGRA 4D6SA 1GQPA 4QGLA 1W3VA 4O9EA 2EF6A 2FMDA 1V9U1 1S0FA 4Q4Y1 4DINB 2D93A 3KQRA 2Y33A 3VDDA 4Q1RA 4P00B 1BLZA 4I0BA 5HCBA 5IVYA 2OZ6A 2ZX2A 2XQXA 1XQNA 2XJSA 1Y3TA 1WLCA 1RXGA 5CFCA 3MW3A 3KT4A 5DUUA 1LJ7A 1JS9A 2QUOA 2WRAA 1JMUB 3IB3A 1H9PA 3TYJA 1UU6A 1CAXB 3HN1A 1LCLA 3O0VA 2ZMNA 3KLSA 4DXZA 5FY4A 3IPVA 5DZFA 3WXPA 4GQ7A 1IPJA 2JG9C 2VPVA 2VJXA 1C5HA 1SCSA 1R092 4WVZA 2ARCA 1PO22 1BEV3 4F3JA 4BXSV 1K42A 4LITA 3NJZA 4IDZA 4OZOA 3IAQA 2RS11 3POSA 4YGCA 3CLPA 3HD8B 5D21A 2WWJA 1LOCA 2XJRA 1SG3A 5FUNA 1SEFA 4P5HA 3SQOA 2WLPA 4J6GA 2RDNA 1FPN3 4CU6A 3FUOA 1AJKA 3A0NA 3FZ3A 2DFBA 5C6CA 3IT8A 1AYN3 4W6WA 4FP3A 2PAKA 1NYWA 5E1RA 3VHNA 5EIYB 4FQZA 1LB2A 1XU1A 1DIWA 2LROA 2G1MA 2EALA 2JECA 2O8QA 3AMMA 3AJYA 5FO9B 1WWYA 5GJ6A 4E27A 1MS1A 2XJTA 5D1IA 3AMQA 1NQDA 5JR2A 1DLLA 3AL5A 4Q4V2 1YUDA 2OPWA 2E51A 2JDMA 4COZA 3PUHA 1XPWA 2BWAA 1LOBA 3AYDA 3FFQA 4AQ6A 5BNOB 4L2NA 4XC9A 4RS5B 4KMQA 3GHNA 3U75A 2ZX4A 2D3SA 3BU0A 2Y6KA 1J3PA 2WJSA 3VD4A 2WO3A 1ZZ8A 4ORFA 3PUAA 2DU0A 2RM22 1SLIA 5HXVA 4Q0PA 1ZA4A 2P2KA 1S0EA 4Q27A 3UK9A 1POV0 1VMHA 3P5BA 1R082 2JENA 3LOBA 1W9FA 4I0AA 3Q8BA 2JICA 1ULOA 2VG9A 2XVKA 5FMOS 3VBSC 4QHOA 2VECA 3ZIXA 4AFDA 4EZHA 4I2OA 1H6YA 4CP9A 4P9IA 4UFJA 3MIDA 2HWF2 1H9WA 1UY4A 1ULPA 4Q8LA 5FZ4A 1GZCA 5A7QA 4XFFA 1SPPB 3NV1A 4LA2A 3ZO0B 4A3XA 4CCOA 3D3AA 3OF1A 1OFSA 2WR9A 2F4PA 1DU3D 2VM9A 3QH6A 3THTA 5JMCA 1J84A 4NHMA 4Q5OA 2XPJA 1NCQA 1O3TA 1XYNA 5FZFA 3AKSA 1HXS2 2VMGA 4IV1A 4HFSA 2LRPA 1O59A 1X36A 2ZGMA 4XBNA 1RHI3 4AGRA 4EQVA 2EAKA 2WL1A 4UW5A 2LS6A 3NAPA 2A5ZA 2Z42A 3WW1A 2V72A 1ZVFA 2RM21 5FYIA 1UZWA 5FMCA 3LDKA 3VZMA 2OT7A 2PHDA 2W39A 4WVMA 5LATA 3H8XA 4LHSA 4ES9A 4XBQA 3AYEA 2VZTA 1TME1 4FPFA 5BXXA 4HLTA 2CWSA 1Q8OA 2EXIA 5CBLA 5FP9A 3N7KA 4Q1PA 2QQWA 4KH9A 1GQHA 4A3ZA 4DS0A 1A34A 4E4ZA 5L36A 2R062 1HRI2 3LEIA 1M4WA 4IGQA 4CCJA 1SBEA 3LPFA 1WUVA 2A6ZA 3ZFGA 4X8NA 1CR7A 5FY0A 5C9AA 1W99A 2VNRA 1YFYA 3MW4A 1AR91 4KGQA 1LOGA 3BOWA 4CEYC 2E31A 3GYDA 1AL0G 4HPKA 4H55A 1VB2A 1KEXA 2VQUA 4CSWA 2XONA 1COV3 2WYFA 5E89A 4FAHA 4BHPA 3USSA 3IKWA 3PUIA 1PGL1 1KGYA 1OD3A 2AH2A 3SLIA 5FPXA 1VRH2 1XNKA 5BV6A 2KXLA 4AHZA 4LE4A 4UF0B 4N90A 4QDRA 2VZVA 2ZGSA 1TQ5A 1HN0A 4HN0A 2ORXA 4XAEA 4JGZB 2ZHNA 4COYA 1JZ8A 2GMPA 2WFPA 1RHI1 1ZX5A 3LDRA 3WQ1A 2P3YA 3OJBA 3IN9A 2WQZC 4U2AA 3OGGA 1DFQA 4XJAA 1W6MB 4QXCA 4YG0A 5LBCA 5JXGA 1GANA 3VKOA 5F7UA 3NKTA 3UETA 1W2TA 4IV1C 3B00A 3JQWA 1GU3A 1ALYA 4LBQB 3V0AB 5FYUA 2GNMA 3GBGA 3J8F2 1CAVB 1ND2C 1YQ8A 4GMP3 1JOPA 4LNVA 4SLIA 2RS33 2VH9A 4BQ5A 4OZXA 3KV9A 2ZEYA 3WDUA 1RVF1 4GZ9A 4AVTA 3ZIWA 4FOYA 1M06G 3UNPA 1BYHA 2GU9A 2BDRA 2WO2A 2R042 1E5HA 2HWC1 4DPNA 5IATA 2W1WA 2VXRA 3JXSA 4HN1A 2ZXQA 4MSVA 2ZGQA 2D6OX 5GZDA 4AEKA 5DUVA 1V9U2 4Q4Y2 4K20A 4AOCA 3P3NA 3FJSA 2HLEA 1NA1C 2BZDA 2IXKA 1FAYA 2V5DA 3EXUA 4KBBA 1EP0A 2O0OA 2P6HA 4LBJA 3TNQA 1KFUL 3TBDA 4CP0A 4RN5A 2JX9A 3KHBA 5I8YA 2HJIA 1RUJ1 1OVSA 2BNMA 3UJOA 5L9BA 3BPSA 3GZEA 1TEIA 1PNFA 4K8FA 3VBHB 2BEOA 3DN7A 4D0QA 3LCPA 1FXZA 1DZRA 2A3YA 4NRMA 3WV6A 5IVFA 3C8XA 5DN2A 3MDPA 4XCBA 2E7AA 5FY1A 5L7OB 1Y9MA 3KZ4C 3WNNA 1APNA 4DRVA 1VMFA 1OLQA 3A7QA 1QDCA 1W8UA 3NO8A 4CDUA 3APBA 4CCDA 1GNHA 4NIIA 3RMYA 4C90A 1KDKA 3OPTA 5FWEA 4XEZA 2O1QA 4RR3A 4BQYA 2GH2A 4E4HA 2DBIA 4XZUG 5T55A 4NPLA 1MZFA 4AXOA 3CIHA 2X5IB 1FMD2 3DPRA 2QZ3A 2EIBA 2CL2A 5EJZB 4WM8B 5A1AA 4IEYA 1BVP1 4JX0A 2JEMA 1QXPA 5ABJA 3M4FA 1S0JA 4N53A 2ORZA 3Q8AA 4DO0A 5BYNA 1OOPC 4MADA 4MXVA 1DGWA 1QWRA 1BBT3 1O8PA 5AC93 2DDUA 2P4EA 5E6HA 1WW7A 1PIV2 4YFWA 4QPYA 2IWGB 4DXSA 5CFDB 4UW4A 5LA0A 3H8RA 1PMIA 4OHYA 2J22A 2R073 2ARAA 2VMCA 1NX9A 5A6ZA 3WDYA 1V0AA 4GMP0 4CDUC 3PUSA 3WP4A 5J7MA 5J96B 1S0DA 3KV6A 5IVJA 4NMIA 2Z4FA 1NCQB 2Q8CA 5DAWA 1RXFA 4AI1A 4ZKTB 1SQ4A 2QVSB 1SLBA 4OUSA 1H1AA 4CU9A 1YXWA 2JG9A 1J1LA 1LECA 4JDOA 2VZOA 5JOYA 5B4XA 2ARXA 4DB5A 1REEA 2VMFA 4CEWB 1UW8A 2UWAA 3QH7A 3NJVA 2ZZJA 4XFCA 2PHXA 1O6UA 3POBA 4R4ZA 2R32A 4CDQC 5I0RA 3OOXA 4EWAA 2P3KA 5T52A 1C57A 2AENA 5JUVA 3VDDC 4NWVA 1N3QA 1UZ0A 3UGHA 1FMD3 2YROA 4KWKA 5C3OA 3MI8A 3WG2A 1B35A 3MV11 1UKRA 1XB9A 5GALA 3TN93 3FX3A 5FJHA 4FPJA 3R6SA 2NN8A 3H3LA 3U14A 1VBE2 4R9BA 2AC1A 4AR2A 2FQPA 1BXHA 2XHNA 4XF9A 1BEV1 2HBUA 4TSVA 5JWPA 4OQ9A 1UU5A 1G86A 1N1TA 4MGYE 4NROA 4XIOA 5T5JA 1H8TC 2JE9A 2OX0A 3NKGA 4ZHNA 3E6CC 2DVFA 3QOPA 2EXHA 2IVJA 4MLOA 3TEWA 1MEC1 3ME2A 3RYPA 3ZXAC 5F6KA 4N43C 1QJX1 2YG0A 4YGEA 1R64A 2JDZA 2QQKA 3NAPB 2OS2A 1RUD2 3HT2A 4N53C 3HAGA 2LTNA 1OA3A 4O65A 1VBA3 3RWNA 3PJYA 2VUJA 3BTZA 2N7GA 2Y6GA 1XU2A 3MFCA 5J98B 3H8UA 1Y9GA 1JUIA 5HCHA 5A32A 1G9DA 1W6MA 5CEHA 4HKLA 2JG8B 4RFT0 5LY1A 4P9WA 1YLLA 2VW1A 2BFUL 3K3OA 2A3XA 1LHNA 2W0XA 3V0AA 5FKBA 2NLRA 3ZKUA 4E2QA 3BKZA 4KWUA 2WBKA 4DRRA 2RR11 3EBRA 3NMBA 4YW2A 5LB6A 1XNBA 3B5LB 4DUWA 5LW9A 3WINE 3D0JA 1VBE1 1MACA 2XB6C 3AKQA 3NNFA 4N8MA 5JIUA 2QE3A 4LR4A 3F2ZA 1V6JA 2DVAA 3O12A 4RSUA 2C5DA 4AEDC 4YM0A 4KI5M 4W8JA 4AI9A 4CDWA 2RE9A 4PI2A 5FZAA 3HJRA 1K5MA 4ASKA 3I3BA 4KWJA 3HR9A 2VL4A 1ODMA 3ACIA 2Q4SA 4IEPA 1YQCA 2VZPA 4KQ7A 3ZM8A 1LEMA 3CL1A 5CYYA 2Y6FA 3O0WA 4CUAA 1EV13 3ORJA 3WCSA 4LBQD 5FZEA 1LRHA 3FN9A 4DNYA 3MW2A 3I3DA 1XXNA 1RITA 4QPIB 1KJLA 1OC1A 3LGRA 5HBAA 4A6SA 4EROA 4BB3A 1LU2A 1UOJA 2YBSA 3NV3A 1D4M3 4QX2A 3NL1A 3WY6A 4ES8A 4HSLA 1DHKB 1CESA 2EXJA 1NCRA 5FY9A 5FQ0A 1TNFA 3W9AA 5L7OA 1CAVA 4AGGA 4LO8A 4RGGA 4IE7A 4Y4RA 4CA9A 5JI7A 1NE4A 3ZN6B 1T6GC 3ZPYA 3EB7A 3B69A 1AR63 2Q8EA 1RB8G 5FO7B 3CBNA 4Y33A 5FYMA 2ENRA 3VBSA 4F83A 4XOGA 3UKVA 3CF6E 4CEYA 5JAXA 1WMXA 3JD73 3N9NA 3HBZA 2R30A 5LA2A 3EHKA 3NV2A 1RHI2 3PVBB 5M0TA 1L7QA 1GP5A 1KS4A 4LBLA 2QFEA 3A0KA 2XR4A 1UY0A 3KHCA 4IUGA 1QOTA 1SLCA 2EXKA 2ZX3A 2J1TA 3B9IA 4Q4W1 3VKFC 5FPBA 4ATFA 1AL23 3ZFGB 1Q3EA 1HRV3 2GMEA 1LOFC 1ZZ9A 3M3OA 4JQTA 1Y43B 4HPKB 4PF1A 2KM2A 4NE9A 3MUY1 3WW2A 2EA7A 1YFUA 2LW8A 5FZCA 3OPWA 4HK9A 2JDUA 4I01A 3LA2A 2C9KA 3O1SA 1ND2B 3SNMA 3VKMA 1H6XA 4A45A 4AEMA 5HI0A 4OHZA 3ZFGC 3CHXA 4JVAA 1TME2 3CO2A 4YNIA 2R16A 4RR3B 3WX5A 3MBWA 3RZJA 4GJYA 2FHRA 2EIEA 4PDWA 2ZX0A 4LA3A 3KT1A 3AMHA 3MICA 4R52A 4QX0A 1PX4A 1RMU1 4JTNA 1UXXX 2QTWB 3DPRB 3NNGA 3E6DA 2HWE1 1XRUA 3MO4A 3KMHA 1STMA 5C4WB 2ID4A 1W39A 1ST8A 4QKDA 5BNPC 2ZEZA 1CX1A 1FNYA 4UFMA 5JCTA 1GOGA 1KITA 1SFYA 3AVSA 3DECA 4LKFA 3VGIA 1FATA 2YY1A 2W94A 2ZGOA 4IERA 5F3IA 1MS8A 1OPMA 1AYN2 2WFF1 1DZTA 1DGWX 2OUHA 4LLFA 1D4M2 5AVAA 2OYZA 3OD4A 3SCHA 5FZDA 3VBOB 1ND3A 1R083 3VHPA 1NQJA 5GLWA 5I0DA 5FOJB 2WNUA 5FTTC 1X8MA 1K5MC 1VBC1 2GC1A 1K5JA 4W50A 3KB5A 1ZM1A 2RJLA 4XDOA 3R4DB 3GALA 3ZSMA 1PO21 2OXBA 4MGKE 3ETPA 1S55A 5AC91 2DTYA 2JDPA 4LO4B 5EV7A 1FT9A 2DCTA 2QQMA 2WN3A 2YYOA 3H50A 3RGBA 1UOBA 3C3VA 1N3OA 4EN6B 1JZ4A 1QU0A 2D40A 2E33A 2ZACA 4MHUA 4F7ZA 3SH3A 1PK6C 4YLZA 2B45X 5F2SA 1BCXA 2DBNA 1XNTA 1WLWA 3B94A 4XF4A 1V6NA 2GP5A 4FBFA 4XQDA 1A78A 1UZZA 5A6YA 5CISA 4H3WA 2O8OA 3RPQA 5A3TA 1YJLA 1AX0A 2ET7A 3FHAA 2YUEA 3ITQA 4UWDA 5FWJA 1YQ6A 2Y6HA 2WS92 4PT6A 4MVTA 1MEC3 4ARXA 3O1RA 4DFSA 4DIQA 1O91A 2OW4A 3NSTA 4URAA 5D8AA 1PNGA 2IXHA 5CAZA 1UF2C 4Q4X3 3TRSB 5AFBA 3WLUA 4Q0SA 4TTGA 1Q8SA 1KJRA 1NLQA 1EPWA 1MVEA 1OQEA 2PFWA 3DYPA 3HVDA 4MGSA 5T3NA 3WF1A 4AF9A 5KHJA 1W8TA 3EMRA 3RZKA 1N1SA 5KXDA 1COV1 2X5IA 3T0BA 3V0BA 1LNSA 4H7LA 3TN91 4EE2A 2FCTA 4BK4A 1DZQA 4Q0UA 1DGRN 4NHLA 4NWWA 4GB33 1BBT2 1VBC3 2X10A 3MZHA 4QXBA 4FPKA 3S30A 4CXWA 2R1DA 5DG1A 1R093 3GF6A 5C7GA 1XJAA 1DYOA 4M3CB 5FPVA 3PMSA 3PTRB 3SEPA 4JKMA 3VV1A 5IK7A 1X82A 3U0ZA 1ZZCA 4YM2A 4M4PA 2AR6A 2DCYA 2G9GA 4RR3C 1YEWA 3KCYA 1D7PM 3HNBM 2DYCA 1YQ2A 5JOWA 1POV3 3M3EA 1LOEA 4OUMA 1C3HA 5IUQA 4OQ8A 5FQ0B 4IE6A 1Q8PA 1HRV1 1IGOA 5FXZA 2J42A 4Z8BA 2XL7A 4Z82A 3VBUB 3USUB 2FDHA 1H2NA 3THCA 3AJZA 1F2NA 4QPGA 1VRH3 5J1XA 1SLLA 4P9GA 4XQ4A 5CB7A 3ZFEB 4IE4A 1Z0HA 4H7MA 4ATEA 3DF0A 1VJ2A 2XVLA 4IV3B 4S2HA 1HQLA 4NIDA 4QU1A 3ZFFC 4MOAA 4CYDA 4FPOB 1WA6X 4KG8A 2VVDA 4UFLA 4Q4X1 2WFF3 4WVWA 1ULEA 3NNMA 1WLDA 2LALA 5A6QA 1R1A1 2RHPA 4KWLA 4XABA 1W6NB 5DDJ3 3VBFC 1QF3A 1V6IA 2VVEA 1MZEA 4GIQA 4IEOA 2G9FA 4S2FA 4A7ZA 4I02A 2ZMLA 3J26N 4FPGA 2YFUA 5C3SA 4XACA 3WG4A 1EY2A 1Z7S1 3VBUA 4ISQA 2W46A 1HX6A 5ERLA 2DV9A 1HRI1 3KCCA 4V2VA 1VRBA 1FI2A 5GM0A 4DQAA 1K45A 1O3SA 1O5UA 2HYKA 2HWF1 3ZYFA 4QKFA 1AR93 5K4LA 3UGGA 3MPBA 1HV1A 3VL8A 3IAPA 3PTYA 3AVRA 4O9GA 4TXWA 1ZRRA 1S1AA 2FZ1A 4QM8A 2XGXA 4M3CE 2C26A 4XVHA 2QQIA 2RS32 5DDJ2 4QX7A 4DMIA 2Y6LA 4YGBA 2HWD2 3WP6A 4ZU4A 4XMIA 3WDWA 3WF0A 4BJ0A 1UY2A 4CXXA 3WUDA 2ZX1A 1DQ2A 3KF5A 5D2AA 4LBOA 1QJEA 2TBVA 2AYHA 2XHKA 1CJDA 4FO9A 1IQDC 4MGIE 4COUA 3SKJE 3ZX7A 1HQWA 4NR1A 1PO12 3ACFA 4GAZA 2W5FA 5DMYA 2VC9A 1RINA 1F9KA 4XDPA 3VZOA 5JXIA 1BVVA 2V4VA 1GLHA 1LHUA 2WZR2 4CDXC 1R091 5KBFA 2WQ8A 4QQHA 2P34A 1BHGA 4CEWC 1ZBE3 5LEKA 3ZXLA 4OFGA 3Q8CA 5E8AA 1WCQA 4M01A 1W0NA 1OLMA 1NKGA 4RYDA 2QQLA 3MIBA 4NIAA 2QDRA 2JD9A 1MZ5A 1ZBA2 2VZUA 3OBRA 1YJKA 5A7SA 5FREA 1YI9A 2EIGA 2YV8A 1VBB1 5FK7A 3JBG3 3E97A 2VOKA 5FXXA 4JKLA 1CAUA 2DUPA 1WGPA 1GR3A 4S2DA 1S0IA 4HVRA 1RJ8A 3TEXA 5JZGB 1AYM1 5FPUA 1O5LA 4YW4A 2BV4A 4ONUA 5FUPA 1MS9A 2PHRA 1HDKA 3U78A 1AR81 3U1XA 4GH4A 4N43A 1HB4A 2XBO3 1UZYA 3LIGA 5FLIA 3UV9A 4DUVA 4B7KA 1X50A 5C3QA 3VUOA 2JD4A 3Q8FA 1VAVA 2D44A 2BRTA 1JYWA 1EUUA 3IIIA 2YDEA 1H30A 3VBSB 2VZRA 2B42B 4Z2WA 1ACCA 4JGYB 1POQA 3J7MA 4QQ2A 2DF7A 1ZA7A 1ND3B 4AW7A 2OVUA 1QJX3 2Y6JA 4AQTA 4IETA 2TEPA 4QHZA 1CVNA 5FR3A 3OUJA 1OUXA 4FVVA 2Q1MA 4XUQA 5L7OC 3AZXA 2IXLA 2RMU1 4Y1ZA 3IDAA 4RD7A 5FBJA 2D43A 3GCWA 2HWB2 2XJUA 3WF3A 5K8SA 5GLUA 2HWC3 4XURA 2OKXA 2W08A 4UYBA 1RUG3 2BVVA 4Y4YA 2DVBA 4CDUB 2WFF2 4LOTA 1FYUA 2CWMA 4K3UA 4FFGA 1DQ0A 1W6QB 1MS4A 4J1WA 2YPDA 3ETQA 5HCAA 5BNOA 4XZPA 4BK5A 5DAPA 4O61A 4B7EA 4DOUA 4A4AA 1RUD3 3VDAA 3NV4A 2UWCA 5E16A 1LODA 4YW7A 1HB3A 4OI4A 4OMCA 4EN7B 4OUEA 1WMFA 5FBZA 2R49A 4FPCA 1CWPA 1S0GA 2ZEWA 4TN7A 2IZWA 5KWRA 1F15A 2PLV1 2RS51 4URTA 1SFNA 3CNAA 1AZDA 4XUOA 4D6QA 5FPZA 4CZSA 4XW3A 4GWNA 5GZFA 3FLTA 4MO3M 5CFDA 1LHWA 1Q5OA 3OBTA 1POV1 1QJX2 1GSLA 3OBAA 2CAUA 2VMEA 4LHKA 4Y1UA 2Q8OA 4LIUA 3PVEA 2ZAAA 4AQSA 5DQ0A 1VMJA 2QKDA 3G7DA 1D4M1 4XFGA 4Y5TA 3C7EA 1TMF3 1NUKA 2WNUC 3OY8B 4M00A 4PLOA 4XETA 3AK0A 4B8EA 4G9SB 4EV0A 4QQOA 2X53S 4JGZC 2CHHA 1LOFA 2DU1A 5IVBA 5FAXA 1SPPA 1HIXA 3RVHA 2IFRA 2VW0A 1VE0A 5FZGA 1PO23 5FCCA 5A7NA 5J09A 1GFF2 2FZ2A 1W8HA 3UL2A 5DDJ1 4A6OA 1RUI1 1NAEA 4RS5C 5A33A 5IHRA 2GZWA 2VE1A 4YZ5A 5LK7B 5CG9A 4LORA 3MLJA 4X8PA 3I3MA 1JZ7A 3CU7A 2WZPP 1NLSA 4JDMA 1QMJA 1US3A 2G9ZA 1KS5A 5K0UA 1UOFA 2J1EA 3LSEA 4RQPC 3K4ZA 1X33A 3T2PA 3V64A 1F5FA 3M3CA 2GN7A 2WS93 3M70A 4XILA 2VCAA 1ULDA 3OEAA 4BQ4A 4CDQA 2D3RA 1G6NA 2JIJA 2VUAA 1S2BA 4AG4A 3N4MA 3UYJA 2B9VA 5FXVA 2V73A 3ROUA 2QQUA 4UOJA 4PQQA 1W0OA 4OI1A 2JDHA 2W52A 2XBO1 2D6KA 1ZYBA 2ZGRA 3JCIA 5IJRA 4JHZA 3I2DA 5DZEA 1GNZA 2CU5A 1O8SA 2DCJA 2RS12 5DABA 4YRDA 4FQ4A 5DUWA 5A32B 1DF0A 1FPN2 3PVNA 1QH6A 3W59A 5T5PA 1YQ5A 1BKZA 1VBE3 2J1SA 2VGDA 2HH9A 5GLTA 4JGZA 4QB2A 3K46A 1OBNA 2OUJA 2VQTA 2CYFA 4XQWA 4BMEA 4QXKA 4BQWA 4E8CA 3WNKA 2XKPA 4YZ4A 1DGLA 5FZ6A 3ZYPA 3TEZA 4QGNA 3T2TA 3GZAA 1GWKA 3HNMA 4IEWA 1HB1A 1NT0A 1UMZA 4UFIA 5C8CA 4B4QA 2HWE3 1HW5A 4FOVA 1HQNA 1PX3A 2IXIA 4GJZA 4M0NA 1JUHA 1WD3A 2VBPA 4YW1A 2YGMA 2IUWA 2PXJA 2W95A 4NHKA 3ZVXA 2UY9A 5L9VA 1MS3A 4K1ZA 4N9IA 3WW4A 1O4TA 2TUNA 1H2LA 3KGLA 4E2GA 4E8DA 4JGYA 4HK8A 2GC3A 2C9AA 4EN0A 2VCCA 2YHJA 3VBFA 4EWEA 3OB8A 4Q2FA 2Y0IA 1F8VA 3WD5A 5GLVA 1QJU2 5JMOA 2W87A 2VVFA 4FI9A 3O1UA 1IPSA 5FP4A 1RIRA 1J59A 3NVCA 2WUHA 1EYBA 1FX5A 1SHWB 1T2XA 3BGAA 3I4IA 2VOTA 3DUIA 4XJZA 3WCRA 4TZDA 4FTBA 3IDCB 5FZ7A 2C6SA 5LBEA 2BBVA 4QX8A 2QCSB 4AEDB 4AFBA 4FCAA 5EYXA 4FFFA 4HSJA 3CZUA 4Q4W3 3PIGA 1O7FA 4XJWA 4AVAA 1ZRCA 2CV6A 3DKQA 2CSGA 5KHIA 3JD72 4A42A 3TN92 1V00A 2J7MA 2ZGTA 4D69A 3WP5A 5F3CA 1L3JA 4C91A 1J3RA 1A8DA 4RGAA 3RS6A 3ILNA 1IG3A 4YW5A 5IVVA 2PQSA 1DQ1A 4BE3A 2YC2A 4XAAA 4CPBA 4D7TA 1RMU3 2BBAA 3QLQA 1BMV2 3N9MA 4QAWA 3KV4A 3RI9A 1AR72 2G19A 5C8WA 3WNOA 1SLTA 4XPVA 1GICA 2D6MA 1OF4A 1EAH3 1W6PB 1UMIA 1ENXA 4HZFA 3N36A 4LO7A 3SMHA 5DUXA 2B9UA 2ILMA 4CPBD 4SBVA 2RJ2A 1ZRIA 2RDSA 2PLV2 2RS52 3B3QE 2BQPA 3KWVA 3POWA 4P08A 2R6QA 1OOPB 3WG1A 2WZ8A 1VB4A 2A1XA 3PHMA 3RYKA 3I49A 2PAMA 4JCKA 5F5IA 1H1MA 1SLAA 2R063 2V09A 1LR5A 3I3QA 3VD9A 1IG0A 4Q4W2 3EJKA 1UPSA 1AX2A 2AUYA 4V2WA 3M8LA 2ZOEB 1PIV3 2PHWA 3O5SA 5FIXA 3SCGA 3J8F3 3KF3A 3R0RA 4P9XA 3IMMA 1NZIA 4R9CA 3NNLA 1D2SA 5BNPB 3AKPA 1NY71 5F3EA 5IAVA 1AX1A 1DP0A 3DV8A 2WNVB 3U4SA 1OFNA 3W5NA 4KGGA 2VBDA 5EXOA 5C70A 1CAXA 3HEIA 2C24A 3IM0A 3U37A 3ZYHA 5ACA2 2QQPA 1C1FA 2YXSA 1UYZA 2QJVA 2QNKA 2H0VA 2RMU2 2PAEA 2VR4A 2Z69A 1YIPA 1TZOA 1X8EA 2LM3A 2JDNA 2OZJA 2WINB 4FFHA 3RMXA 2P3JA 5B4NA 2XH6A 4CCLA 4NHYA 4YZ2A 4K40A 2WLQA 4BM8A 3ZYIB 5LBBA 5A3MA 1ASJ1 1C8M1 1WMEA 2WO7A 3EQEA 4L92A 3VZKA 1PVC1 3FWEA 3M3IA 4ZU5A 3ZKYA 1UCXA 3ALQA 1GNYA 5FO8B 1FV3A 2WSUA 5A7PA 2D3PA 1GUIA 1RUF1 2EVXA 3IDBB 4JC1A 5FUIA 3OUIA 4WM7C 4ASMB 2YPJA 5EWSA 2DCZA 1Z7S2 4DUXA 2FCUA 3ZN4A 4MGTA 1NY72 1Y4WA 3GCXA 3MIHA 1E5IA 1GV9A 3TEYA 4GMP1 1RUJ2 4ISRA 3H8OA 1QXRA 2NZ9A 1Q8VA 4PDWC 4LIVA 4AHXA 3S57A 1PK6A 3R4SA 2PMWB 4QX5A 2WS91 3T2QA 5LA1A 1NZCA 1A3KA 4Z1VA 2XQRA 2OQ6A 2BTVC 2ES3A 4H14A 1LKNA 4K7JA 4PCRA 4FXKB 3RFRA 3AC0A 2W92A 3WG3A 1W8WA 2YU1A 4RS5A 1MS5A 1RUG1 4I09A 1OD5A 1W6QA 4UAPA 2R0FA 3LF7A 3VDDB 4LOSA 4PDWB 2WWUA 2HKXA 4CDQB 1LENA 5ACA3 2HEYF 5D8AC 3C7GA 2BGOA 3J4UH 3V0BB 1QH7A 1V6OA 4Q4V1 3RZGA 4AI0A 3ZR6A 4NN0A 2E32A 2ZEXA 5KR7A 4CU7A 2BNNA 1EUTA 1LAJA 1CAWA 2JE7A 4P14A 4CDWB 4EWDA 4K1YA 1ZNPA 2XLGA 2I74A 1JU4A 3WUCA 2WYSA 3CQOA 4M3CA 4NUBA 4AAXA 4CP9B 1OMIA 1S0BA 4LTAA 5FZ1A 4QHBA 1NCQC 2CTVA 4MXWA 3S0MA 4M0HA 1JU3A 2B4KA 1G9CA 5A3WA 2RR12 1ZRFA 1RUH2 1WCKA 4YVWA 2KA3A 1X9PA 1PZ7A 3N9PA 3VD7A 2WNVC 3ZMOA 4JTOA 4QWNA 1PGL2 3OY8A 4X6RB 5A7WA 4BCUA 4FOWA 2NP0A 4UI9L 1WBLA 2WT1A 4XFAA 4QT6A 3ZFFB 4LULA 5FYHA 4A7YA 5CFDC 4RFRB 2D6NA 2X09A 2H6BA 3OPZA 2H0BA 2WABA 3GZUC 1MPXA 5K0UC 3QBQA 2IXJA 2QQJA 3MF6A 5C3RA 3X29B 1SDDB 2R061 3CZJA 5A1LA 2IFWA 1IOAA 5FMOL 2GNTA 4M3CF 1W8ZA 4BISA 2GC2A 5C4WC 5FY8A 4Q0QA 4MYEA 4XTMA 4I3GA 4C8DA 4WBBA 3ZXGA 1GOFA 2VTXJ 1AR62 4XUNA 3BIEA 1EPZA 2A71A 2VXJA 4RHV3 3IPVB 1IS4A 5FYVA 3LA7A 2GALA 3AYCA 2YZ4A 5C9AB 1TNRA 3MYXA 4YVSB 3PIJA 1K12A 4K21A 3D5OA 4PHZA 3AP7A 5BNNC 4GKXA 3POFA 1LGBA 1XYPA 3OTFA 1VAKA 1JHNA 2RMU3 5HPOA 2GP3A 1CZSA 2I2SA 4K8RB 5ABJC 1HLCA 5SV8A 1JN2P 2KR2A 5FFOC 5JVVA 3T0AA 2XLAA 5A80A 4QMAA 1EV12 5KHKA 1AXYA 3KT7A 4JRAA 3U10A 2Z5WA 5K7PA 1AYN1 5CU1A 1O3QA 1MEC2 1YFWA 1GZ9A 2V4AA 1OLRA 3ELNA 3LDBA 1CPNA 2H6CA
chains in the Genus database with same CATH topology
1D0HA 1ND2A 4AI3A 2VULA 4HVQA 2GSYA 3BIWE 2NPIA 2ZPXA 1RUI2 2VQAA 1URXA 1UN1A 3HWJA 4FPEA 4DY3A 1QOOA 3LAGA 4IEXA 3HMYA 2E53A 4BA6A 1VBB3 1KD7A 4HKOA 2D7FA 4AE2A 1WCDJ 4QPGB 3WR0A 1S0CA 3VKNA 1G8WA 1XNCA 2PLV3 2RS53 2WQ4A 5C4WA 5AFEA 1WA4A 1MR5A 1OOPA 3K51A 3MEPA 4N9HA 4UW6A 4ASLA 1RUNA 4LBNA 5GZGA 5T5LA 3D8CA 1LHOA 4LBKA 2GAUA 2VNGA 5FRAA 1DBNA 1Y9QA 4CDXA 4LHLA 3DGTA 4INDA 1AR83 2Z79A 4YVWC 5CNAA 5JR7B 3WDXA 2ZZQA 3VZJA 3DL3A 3H1WA 1BQPA 1BBT1 3E5XA 3N7JA 4L99A 4AWDA 3GHMA 5KXEA 1V6LA 1PM7A 1QQP3 2D5FA 3H7YA 5B2GB 3PMEA 1C8M3 1ASJ3 5IK5A 1LOAA 5J3UA 1I5ZA 1I9RA 1W0PA 2PELA 1D2QA 3AYAA 2A75A 4GKYA 4LLOA 3VBRC 1OQDA 3B01A 1AUYA 2CGOA 2ZGKA 3PVOA 1FV2A 1PGW1 4LUKA 3NW4A 2XJPA 3FMGA 4BWOA 3BB6A 1DG6A 1UAIA 4NPRA 2QZ2A 3AMNA 2OPKA 5H9SA 5K9YA 2ZHKA 3L2YA 2VMIA 5I8SA 2UWBA 3H0OA 1KFXL 2JXAA 1CAWB 2YC0A 4S2GA 5C8CC 1VRH1 4PIXA 3URFA 2DFCA 2B46X 5H9QA 4JQRA 1W6PA 2A6YA 5KXCA 4R4XA 5CG8A 3OGJA 4Y24A 4HMZA 4PLMA 3TWIA 4HBNA 5F5QA 1AR92 5ACA1 4A7KA 3T1LA 1XYOA 3K48A 4BH9A 2ZGNA 4XF3A 4Y20B 1J58A 3JB8A 1PGW2 1AL22 3MFAA 4GA9A 3LSDA 4TLFA 1ULFA 4AK3A 3C2UA 2X5IC 2XWBB 5J37A 3CJIB 1YHFA 1PVC2 4HKWA 5I93A 1RUC1 2RS13 5EJ3A 3NAPC 1UPIA 2HWC2 2R041 2WA3A 2MHFA 4COWA 4DZGA 5CADA 2RS31 4IV3A 2CGPA 2AGSA 1XE7A 3ZYRA 4LBQA 5ABJB 2E9QA 4XJUA 2K0GA 1GBGA 2ZS6B 2BWCA 1W6NA 4YZ1A 5BNNB 3VKLA 4BQ1A 4NOTA 2RR13 1ULCA 1VBC2 4P9YA 4AVSA 4QU2A 1RUI3 3SH5A 3TB0A 5IK4A 4J1XA 4YYOA 2HWB3 3KGZA 4GULA 1BMV1 4X6QB 3ZFFA 4WM8A 2P37A 2DTWA 4RHV1 1VR3A 5C33A 4XDQA 3TOJA 1N47A 2FMYA 1C1LA 3GBFA 4GXLA 2UY8A 1QJY1 4YZ3A 3JD71 2GNBA 5K0UB 3WW3A 3VBHA 1C8NA 4K9SA 3I59B 1DQ6A 2ZA9A 4COVA 1JXNA 4MUVA 4F8AA 5LK5A 5EYYA 2PTMA 4UBHA 1ZBA3 2JG9B 3WDVA 4I3PA 1VBD3 1I3HA 4YVSA 1QKQA 2WT2A 4BMBA 3MF9A 3QD6A 3N7MA 4HVOA 1H8VA 4OI2A 1WCSA 1YNAA 2CY6A 4RQPA 1NXMA 2HWD1 2IXCA 1Z7S3 4FXGB 4P9LA 4YARA 4OVEA 2XL9A 4G4FA 2Y38A 4WV8A 3RNSA 3AM2A 1AR73 2WIIB 4Q8KA 1B35B 3BALA 2PYTA 1RUOA 1PVC3 3RDIA 3FUQA 1TME3 1WW5A 2YGLA 4XXPA 1QJZA 2XUMA 1RUH3 1WBFA 1RUC3 1YI7A 4N7IA 4KG0A 3WNXA 5F1RA 2VU9A 4B4RA 4WM7B 3ZSKA 1CIWA 3UKTA 1WD4A 3ZXKA 4ITCA 1GKBA 1PO13 4UW3A 3JU9A 5I0TA 1RTVA 5A33B 4GH4B 4XYXA 4FPHA 1YFXA 2JJ6A 3RRDA 2PHLA 3AKTA 3V65A 5CA6A 2ZMKA 4UXAA 2CGNA 2BYVE 1BZWA 3UJQA 3U11A 1DYKA 2I45A 3INAA 4IV3C 1RUF3 5JSRA 1PVXA 4CDXB 3JBG2 1LHVA 4FTSA 4XFHA 5H9PA 2A6XA 4Y26A 3BTAA 1U5XA 1Y7BA 3H3ZA 3AX4A 4QQLA 1G7YA 3JBG1 1TMF1 3GZTB 1IHMA 5FDBA 4R8HA 1W6OA 2ZABA 1ZBE2 4Y20A 1ASJ2 1C8M2 1N1YA 1B09A 1DQ5A 2ETEA 1YO8A 4Q4V3 4KNCA 3WT3A 5I8TA 5JZGC 4AVVA 5CIRA 4AVCA 4FPYA 1PHMA 2Y26A 4AFCA 4BOWA 3FHIB 4Y1YA 2ZGLA 1RUJ3 3W58A 1AJOA 1D0GA 2DVGA 5KC5A 1QJY3 1KRIA 1LGCA 2HWD3 1CJPA 2ZCWA 2ZGUA 5LRRA 1BJQA 3VHOA 2R0HA 4LEJA 1FPN1 2WWSA 3ZN6A 3AP4A 2D97A 4TWTA 2B7YA 3MIEA 3TAYA 3GNEA 1F31A 2ZKLA 1PZ8A 1VBB2 4LO5B 3SCFA 1GZWB 3VBFB 1BEV2 3NWKA 1IPKA 2OIIA 2SLIA 4Z07A 1IZ3A 3ZSEA 2UYAA 3B93A 4YW3A 1I6XA 3VBUC 4KU7A 4Z92B 1JBCA 2DCKA 3E5QA 2WC2A 1IQAA 4PLNA 3CJIA 5F6LB 3ILFA 3PJQA 4JAAA 3I8TA 4GB31 4CDWC 1UIKA 1VBA2 2GN3A 5A3LA 2DWRA 5IT6A 4IEZA 2XLFA 3ZXEA 1E57A 4XJ9A 1NCRB 2E6VA 3ES1A 2UYBA 4N7UA 3VBOC 4AFAA 2LUWA 3IBMA 1MZ6A 4XTPA 5IK8A 4CP2A 1AXKA 3O7OA 4KL1A 5FLJA 2B8MA 5BNOC 4AHWA 1RUC2 4FP2A 4L97A 3SHRA 3V56A 5TSWA 3BU7A 4IL7A 3AXDA 2E7QA 1LEDA 1RVF2 2ZTNA 1NE6A 2I07B 1X7NA 1KDMA 4Q29A 2ZAHA 4Y22B 2VOXA 1AXZA 2HWB1 2DUQA 3O0XA 2WA4A 4META 3VL9A 4B3NA 1YIFA 2UU8A 1QNYA 4AEJA 4B29A 4ZXKA 4IQPA 1VIWB 2TNFA 4Q4X2 1RUG2 2MNGA 3IIAA 1MQTA 5JI9A 4LUMA 3AFKA 4BLIA 3TNPB 1ONAA 3S7IA 3JQXA 3N7LA 3AP5A 3SH4A 3ZFEC 4RQPB 2UURA 4YSFA 1QHDA 4L8QA 3POYA 3KS7A 3B7MA 2XKOA 4IEQA 3E5UA 1IS5A 2D5HA 1ZREA 4IEUA 4XBLA 1A6CA 4LBMA 2VW2A 4WM8C 1AYM2 1R1ZA 5T54A 1EAH1 2BUKA 2WT0A 4BZ4A 4PIYA 3OD0A 1RL3A 2MEV2 3AXEA 1FOD1 3ASIA 3R05A 1BK1A 2NYYA 4UBGA 5J36A 1NOVA 1H4HA 4XF0A 1Z78A 4AHYA 1G9AA 3MLKA 1LU1A 4FT8A 5KHGA 2Q1ZB 3OCPA 4XMAA 1XNDA 2Z2SB 4PBPA 3SXWA 3I54A 1HXS1 2NMOA 1NCRC 5T5OA 3LKJA 3VBHC 3CJIC 4AYUA 1QJU1 1ND3C 3ZN5A 3FE5A 4NVPA 4L9BA 4BPZA 2RM23 4ZU7A 5HCFA 3RJ2X 4GH4C 1EV11 1V70A 4IEVA 2DUOA 3D4KA 4Q26A 4E9KA 5JSPA 4E2SA 1VBD2 1OI6A 1LESA 1SBDA 2Q5TA 3USUA 5SV5A 1SCRA 3RJRA 4YM1A 3VBUA 1AVBA 1ZZBA 1R1A2 2IC1A 2W68A 3FLRA 5CVRA 5JSOA 4QD2A 1IKPA 3THPA 4BYYA 1RUE3 1VAMA 3AB0A 4C1XA 4MXWB 3ZYGA 3AP6A 4OHWA 1DDLA 4C1WA 5GZCA 3WHUA 2ATFA 4YVWB 5C9AC 3HQXA 4LE3A 3AKRA 4AFMA 3KD4A 2BPA2 2AREA 1C5IA 1H8TB 1WW6A 2RJKA 5KXBA 1WLTA 1O4YA 2A73B 1J3QA 2ZJCA 3VHRA 1V9U3 1KXGA 2GH8A 4Q4Y3 2D98A 4PF5A 2ARBA 2NQYA 4XIKA 4PQ9A 4XHBA 5KHHA 4CTEA 1LGNA 1OQ1A 4R9AA 1IS6A 4RHV2 4LT5A 1JYCA 2PA7A 1UU4A 3ZFEA 1YRZA 1CGPA 3N3HA 1I1EA 5LRSA 1RGSA 2PHUA 5JOXA 3KCXA 1CD3G 4U36A 3RQ0A 1OSGA 4BLJA 1EAH2 1UIJA 2ZKNA 3LWCA 1W2UA 2C1FA 3ILRA 3P3PA 1U0AA 3RYRA 4AI2A 3QACA 3H9AA 1SDWA 4OI0A 5FLHA 3LB9A 3MIFA 3SITA 1CAUB 5KC6A 3R4UA 4D7SA 5BNQA 1N3PA 3LOIA 5JZGA 1VP6A 1QJU3 2GDFA 5DZGA 2ZHLA 1PK6B 1RC6A 4N43B 4E4DX 1QOSA 2WKKA 2MEV3 4IXLA 2PHTA 1W6OB 2Y0OA 4LO6B 1COV2 3VBRA 1NG0A 1JTZX 1OPOA 4CP1A 1OKQA 4XF1A 3AMPA 2PQQA 3H1MA 4YFZA 4HT1T 2A6WA 4IESA 1JH5A 3MGUA 1Q8QA 2R072 2FBEA 4EJRA 3S6PA 1PGSA 3WVJA 1DQ4A 1IKQA 4YM3A 3M1HA 3Q9OA 3B9CA 4HANA 5JPMB 2VOWA 4N53B 1RUH1 1K5MB 2D6LX 3D82A 5DG2A 5L19A 1ZBE1 3OYWB 3LA3A 4MH0E 4QGMA 3DPRC 5JDBA 4Y22A 4YGDA 5BY5A 2HWE2 2WSVA 4WVVA 1H4GA 3ENRA 1GZWA 2F6BA 4KU8A 1OA4A 1U12A 2R071 2XVGA 3J8F1 4XFIA 5AC92 1ZZ6A 1RJ7A 1U5IA 3M2MA 1OHFA 3O14A 4XJ8A 2V5YA 3RZZA 1NXD1 1R1A3 3DKWA 1AR82 3IDEA 4QM9A 4D3WA 4C0HA 1PO11 2XJVA 3U4XA 2PN5A 1CONA 1REDA 2X8KA 4MV2A 3ZXFA 2A70A 4QPGC 2ERFA 1QGLA 5FOBB 3BODA 1NA1B 4Y1XA 2CAVA 5JPNB 3WQ7A 1O3RA 1HKDA 3JZVA 3MIGA 5GZEA 1GYKA 3ZMNA 4FAGA 4BIOA 5I0SA 5E88A 2WNEA 4FTEA 2C0ZA 1LULA 2JG8C 4Y5Z0 3WQ0A 4AI8A 2K2SA 5AVPA 4B4PA 1IS3A 1DYPA 1JW6A 2BGCA 3EO6A 1AF9A 3JUUA 1QNWA 3RI8A 2R043 2BNOA 2X29A 3AZWA 3ES4A 3H3UA 2G4IA 3M3QA 5I0UA 2GMMA 1ENQA 1FMD1 3JB4C 4HL0A 1HV0A 4K6BA 4JDNA 1R081 3AZYA 1AYM3 2VQ0A 2MPFA 2D6PA 1CQ9A 3I59A 3KSCA 4YG6A 3WP3A 4OLLA 3ZDSA 1C28A 4Q0VA 2K9ZA 2EAAA 3MLLA 1AR61 4PIZA 1KQRA 1YWKA 1MQTC 2BVBA 3J9SA 5J48A 2WZR1 4D7YA 2B39A 4WZCA 4I30A 1TMF2 4YG3A 4YVSC 1PZ9A 1VALA 2ZBJA 3AZVA 1JOJA 3KM5A 4AGVA 1TE1B 4W6XA 3WHTA 3FC0A 3U07A 3RSJA 2BW8A 2OA2A 4R9DA 4BIFA 3RG0A 1VLNA 4CEWA 3T1MA 2A6VA 1ZZ7A 5BUVA 4GALA 2PHFA 1SACA 1ULGA 4G3YC 3N35A 2HEWF 5BNNA 2VY0A 3HIFA 5F9TA 2A3WA 4D94A 1GQGA 5L73A 4WM7A 2XG3A 1QXJA 2Q30A 4QPIA 4QQPA 1V6MA 4Y1VA 1Q56A 1H8TA 2ET1A 3FBYA 4IV1B 4W6YA 1H1IA 1OA2A 5GLZA 1H2KA 4GWMA 2E63A 3IWZA 3VBRB 1UKGA 1V6KA 4PBOA 1UL9A 2GC0A 5LEJA 1B35C 5CFCB 3I7DA 1MVQA 3AFGA 3AP9A 3BCWA 1ENRA 3E6BA 4RA0A 4EN8B 4JV4A 4L11A 3IMNA 1VBD1 3ATGA 1H2MA 3SISA 4CRQA 5DXDA 2JG8A 1RUE2 5D8AB 1FOD2 1AHSA 3LZZA 5JIAA 2MEV1 3VZLA 3B02A 2AZ5A 1J1TA 4MX3A 3ZSLA 1HRV2 1NLRA 1RUD1 4FOQA 2HEVF 4RL7A 4PJYA 2E7TA 3D0SA 1A8MA 3ZYJB 5JLVA 4AQ2A 1G9BA 1U5YA 2VNOA 1RUE1 4XHXA 2WZR3 3ACLA 1HRI3 2XBO2 1SBFA 1QJY2 4TYSA 3H1YA 1NA1A 4AEDA 4XE9A 1WW4A 4EN9B 4A2UA 1C4RA 3L9JT 1Q43A 3ZXDA 4FPLA 3HT1A 2XWJB 1MS0A 3FLPA 1CX4A 5C8CB 3H7JA 3CEWA 4OHXA 4HETA 4OHVA 4OULA 1ZRDA 4MGZE 3VLBB 1F5JA 5EZWA 5H9RA 1RUF2 2P17A 1H0BA 3ECQA 2ZGPA 2JKBA 1CN1A 1S2KA 4V1PA 1FOD3 2NM1A 3FBMA 3M7AA 3WDTA 4CEYB 4MZUA 1JYIA 2WNUB 1ZBA1 2Q0AA 5GKAC 4JRLA 1YYNA 3WOGA 5BNPA 1UD1A 4W65A 4AVBA 2VOVA 2DURA 4JGYC 4QPIC 2SBAA 2BFUS 3L2HA 1HXS3 1QQP1 2DVDA 4C0BA 2QDNA 5CFCC 3WZ1A 2XJQA 3PNAA 4E4SA 1UX6A 3G6JB 1AR71 4XFBA 2ZHMA 1AL21 1XE8A 1VBA1 3CJXA 1U5ZA 1YCIA 2HWF3 4I0WB 4P9JA 4DY5A 1SMVA 3ZXJA 5I91A 1QQP2 3D6EA 3PLQA 3BPZA 1ENSA 2A7AA 4WVMB 1REFA 2WNVA 3ZSJA 1N1VA 1O4ZA 1WMDA 2P3IA 1LTEA 1RMU2 3GBWA 4NO4A 3FFZA 4FSJA 3BOPA 3UKNA 1PIV1 2CNAA 2B5HA 1CPMA 4XXAA 3VZNA 4WZFA 1QDOA 1FNZA 1QY4A 3ST7A 4LHNA 3A4UA 2R1BA 3OYWA 1D4VB 3S7EA 5JOZA 3MPPG 2VMHA 3QCWA 2GNDA 2NMNA 4GB32 2YMZA 1G9FA 5EFUA 3AZZA 3VBOA 5BPXA 1MQTB 1RVF3 5T50A 1DGRA 4QGLA 4O9EA 2EF6A 2FMDA 1V9U1 1S0FA 4Q4Y1 4DINB 2D93A 3KQRA 3VDDA 4Q1RA 4I0BA 5HCBA 2OZ6A 2ZX2A 1XQNA 2XJSA 1Y3TA 1WLCA 5CFCA 3MW3A 3KT4A 5DUUA 1LJ7A 2QUOA 1H9PA 3TYJA 1UU6A 1CAXB 3HN1A 1LCLA 3O0VA 2ZMNA 3KLSA 4DXZA 3IPVA 5DZFA 3WXPA 4GQ7A 1IPJA 2JG9C 2VPVA 1C5HA 1SCSA 1R092 4WVZA 1PO22 1BEV3 4F3JA 3NJZA 2RS11 3POSA 4YGCA 3CLPA 3HD8B 1LOCA 2XJRA 1SEFA 4P5HA 2WLPA 4J6GA 1FPN3 3FUOA 1AJKA 3A0NA 3FZ3A 2DFBA 5C6CA 3IT8A 1AYN3 4W6WA 4FP3A 2PAKA 1NYWA 5E1RA 3VHNA 4FQZA 1LB2A 1XU1A 3AMMA 1DIWA 2EALA 2JECA 2O8QA 5FO9B 3AJYA 4E27A 5GJ6A 1MS1A 2XJTA 5D1IA 3AMQA 1NQDA 1DLLA 4Q4V2 1YUDA 2E51A 4COZA 2BWAA 3AYDA 1LOBA 3FFQA 4AQ6A 5BNOB 4L2NA 4RS5B 3GHNA 2ZX4A 2D3SA 1J3PA 2WJSA 1ZZ8A 4ORFA 2DU0A 2RM22 1SLIA 5HXVA 4Q0PA 1ZA4A 2P2KA 1S0EA 4Q27A 3UK9A 1POV0 1R082 2JENA 3LOBA 4I0AA 2JICA 2VG9A 5FMOS 2XVKA 3VBSC 2VECA 3ZIXA 4AFDA 4I2OA 3MIDA 2HWF2 1H9WA 4Q8LA 1GZCA 4XFFA 3NV1A 4LA2A 3ZO0B 4A3XA 3OF1A 3QH6A 1OFSA 5JMCA 2F4PA 1DU3D 3THTA 4NHMA 1O3TA 2XPJA 1NCQA 1XYNA 3AKSA 1HXS2 2VMGA 4IV1A 4HFSA 4AGRA 1X36A 2ZGMA 4XBNA 1RHI3 2EAKA 2WL1A 4UW5A 3NAPA 2A5ZA 2Z42A 3WW1A 1ZVFA 2RM21 3VZMA 2PHDA 2W39A 4WVMA 4ES9A 4XBQA 3AYEA 1TME1 4FPFA 5BXXA 4HLTA 2CWSA 1Q8OA 2EXIA 5CBLA 3N7KA 4Q1PA 4DS0A 4KH9A 1GQHA 4E4ZA 5L36A 2R062 1HRI2 1M4WA 1SBEA 3ZFGA 1WUVA 2A6ZA 4X8NA 1CR7A 5C9AA 2VNRA 1YFYA 3MW4A 1AR91 4KGQA 1LOGA 3BOWA 4CEYC 3GYDA 4HPKA 1AL0G 4H55A 1VB2A 4FAHA 1COV3 5E89A 4BHPA 3USSA 3IKWA 1PGL1 5FPXA 2AH2A 3SLIA 1VRH2 1XNKA 5BV6A 2KXLA 4AHZA 4LE4A 4N90A 2ZGSA 1TQ5A 4HN0A 4JGZB 2ZHNA 4COYA 2GMPA 2WFPA 1RHI1 1ZX5A 3WQ1A 3OJBA 3IN9A 2WQZC 4U2AA 3OGGA 1DFQA 4XJAA 1W6MB 4YG0A 1GANA 3VKOA 3NKTA 4IV1C 3B00A 3JQWA 3V0AB 1ALYA 4LBQB 2GNMA 3GBGA 3J8F2 1CAVB 1ND2C 4GMP3 4LNVA 4SLIA 2RS33 2VH9A 4OZXA 3WDUA 1RVF1 4AVTA 3ZIWA 4FOYA 1M06G 1BYHA 2GU9A 2R042 2HWC1 4DPNA 2VXRA 4HN1A 4MSVA 2ZGQA 2D6OX 5GZDA 4AEKA 5DUVA 1V9U2 4Q4Y2 4K20A 3P3NA 3FJSA 3EXUA 1NA1C 2IXKA 1FAYA 4KBBA 1EP0A 2O0OA 4LBJA 3TNQA 1KFUL 3TBDA 4CP0A 2JX9A 5I8YA 2HJIA 1RUJ1 2BNMA 3UJOA 1TEIA 1PNFA 4K8FA 3VBHB 2BEOA 3DN7A 3LCPA 1FXZA 1DZRA 2A3YA 3WV6A 3MDPA 2E7AA 5L7OB 3KZ4C 1APNA 4DRVA 1OLQA 1QDCA 4CDUA 3NO8A 3APBA 1GNHA 3RMYA 4C90A 1KDKA 4XEZA 2O1QA 4RR3A 2GH2A 5T55A 1MZFA 4AXOA 2X5IB 1FMD2 3DPRA 2QZ3A 2CL2A 4WM8B 4IEYA 1BVP1 2JEMA 1QXPA 5ABJA 3M4FA 1S0JA 4N53A 5BYNA 1OOPC 4MXVA 1DGWA 1QWRA 1BBT3 5AC93 1WW7A 1PIV2 4YFWA 4QPYA 2IWGB 5CFDB 4UW4A 1PMIA 4OHYA 2R073 3WDYA 4GMP0 4CDUC 3WP4A 5J96B 5J7MA 1S0DA 1NCQB 4AI1A 4ZKTB 1SQ4A 2QVSB 1SLBA 4OUSA 1H1AA 1YXWA 2JG9A 1J1LA 1LECA 4JDOA 5JOYA 2ARXA 4DB5A 1REEA 4CEWB 1UW8A 2UWAA 3QH7A 2ZZJA 4XFCA 2PHXA 4CDQC 4R4ZA 2R32A 5I0RA 4EWAA 2P3KA 5T52A 1C57A 2AENA 3VDDC 4NWVA 1N3QA 1FMD3 2YROA 4KWKA 3MI8A 3WG2A 1B35A 1UKRA 5GALA 3TN93 3FX3A 4FPJA 3R6SA 2NN8A 1VBE2 4R9BA 2FQPA 1BXHA 4XF9A 1BEV1 4TSVA 5JWPA 1UU5A 1G86A 1N1TA 4MGYE 4XIOA 5T5JA 1H8TC 2JE9A 3NKGA 3E6CC 2DVFA 3QOPA 2EXHA 4MLOA 1MEC1 3ME2A 3RYPA 3ZXAC 5F6KA 4N43C 1QJX1 4YGEA 2JDZA 3NAPB 1RUD2 3HT2A 4N53C 3HAGA 2LTNA 1OA3A 3RWNA 1VBA3 3PJYA 2VUJA 2N7GA 1XU2A 3MFCA 5J98B 3H8UA 1JUIA 5A32A 1G9DA 1W6MA 4HKLA 2JG8B 4RFT0 4P9WA 1YLLA 2VW1A 2BFUL 2A3XA 1LHNA 2W0XA 3V0AA 2NLRA 4E2QA 4DRRA 2RR11 3EBRA 4YW2A 1XNBA 3B5LB 3WINE 3D0JA 1VBE1 1MACA 2XB6C 3AKQA 5JIUA 2QE3A 4LR4A 1V6JA 2DVAA 3O12A 4RSUA 2C5DA 4AEDC 4YM0A 4CDWA 2RE9A 1K5MA 4KWJA 3HR9A 2Q4SA 4IEPA 4KQ7A 1LEMA 3CL1A 3O0WA 1EV13 3WCSA 4LBQD 1LRHA 4DNYA 3MW2A 1XXNA 1RITA 4QPIB 1KJLA 3LGRA 5HBAA 4EROA 1LU2A 3NV3A 1D4M3 3NL1A 3WY6A 4ES8A 4HSLA 1DHKB 1CESA 2EXJA 1NCRA 5FQ0A 1TNFA 3W9AA 5L7OA 1CAVA 4AGGA 4LO8A 4RGGA 5JI7A 1NE4A 3ZN6B 1T6GC 3ZPYA 3B69A 1AR63 1RB8G 5FO7B 4F83A 3VBSA 2ENRA 4XOGA 3UKVA 3CF6E 4CEYA 5JAXA 3JD73 3HBZA 2R30A 3EHKA 3NV2A 1RHI2 3PVBB 1KS4A 4LBLA 2QFEA 3A0KA 1QOTA 1SLCA 2EXKA 2ZX3A 3B9IA 4Q4W1 3VKFC 4ATFA 1AL23 3ZFGB 1Q3EA 1HRV3 2GMEA 1LOFC 1ZZ9A 3M3OA 1Y43B 4HPKB 2KM2A 3WW2A 2EA7A 1YFUA 4HK9A 4I01A 3LA2A 1ND2B 3SNMA 3VKMA 4AEMA 5HI0A 4OHZA 3ZFGC 4JVAA 1TME2 3CO2A 4YNIA 2R16A 4RR3B 3WX5A 2FHRA 4PDWA 2ZX0A 4LA3A 3KT1A 3AMHA 3MICA 4R52A 4JTNA 1RMU1 3DPRB 3E6DA 2HWE1 1XRUA 3KMHA 5C4WB 1W39A 5BNPC 1FNYA 5JCTA 1KITA 1SFYA 3VGIA 1FATA 2YY1A 2ZGOA 4IERA 1MS8A 1OPMA 1AYN2 2WFF1 1DZTA 1DGWX 2OUHA 4LLFA 1D4M2 5AVAA 2OYZA 3OD4A 3SCHA 3VBOB 1ND3A 1R083 3VHPA 1NQJA 5GLWA 5FOJB 2WNUA 5FTTC 1X8MA 1K5MC 1VBC1 2GC1A 3ZSMA 3KB5A 1ZM1A 2RJLA 3R4DB 3GALA 1PO21 4MGKE 1S55A 5AC91 2DTYA 4LO4B 5EV7A 1FT9A 2DCTA 2YYOA 3H50A 3C3VA 1N3OA 4EN6B 1QU0A 2D40A 2ZACA 4F7ZA 3SH3A 1PK6C 4YLZA 2B45X 1BCXA 1WLWA 3B94A 4XF4A 1V6NA 4FBFA 4XQDA 1A78A 1UZZA 4H3WA 2O8OA 3RPQA 1YJLA 1AX0A 2ET7A 2YUEA 2WS92 4MVTA 1MEC3 4DFSA 1O91A 2OW4A 3NSTA 5D8AA 1PNGA 2IXHA 5CAZA 1UF2C 4Q4X3 3TRSB 5AFBA 3WLUA 4Q0SA 1Q8SA 1KJRA 2PFWA 1EPWA 1MVEA 1OQEA 5T3NA 4AF9A 5KHJA 1N1SA 5KXDA 1COV1 2X5IA 3V0BA 4H7LA 3TN91 1DZQA 4Q0UA 1DGRN 4NHLA 4NWWA 4GB33 1BBT2 1VBC3 3MZHA 3S30A 4FPKA 2R1DA 5DG1A 1R093 3GF6A 4M3CB 3VV1A 3PMSA 5IK7A 1X82A 3U0ZA 1ZZCA 4YM2A 2AR6A 2DCYA 2G9GA 4RR3C 3KCYA 2DYCA 5JOWA 1POV3 3M3EA 1LOEA 4OUMA 1C3HA 5IUQA 5FQ0B 1Q8PA 1HRV1 1IGOA 4Z8BA 2XL7A 4Z82A 3VBUB 3USUB 1H2NA 3AJZA 1F2NA 4QPGA 1VRH3 1SLLA 4P9GA 4XQ4A 5CB7A 3ZFEB 4ATEA 1Z0HA 4H7MA 3DF0A 1VJ2A 2XVLA 4IV3B 4S2HA 1HQLA 3ZFFC 4CYDA 4FPOB 4KG8A 2VVDA 4Q4X1 2WFF3 4WVWA 1ULEA 1WLDA 2LALA 1R1A1 2RHPA 4KWLA 1W6NB 5DDJ3 3VBFC 1QF3A 1V6IA 2VVEA 1MZEA 4GIQA 4IEOA 2G9FA 4S2FA 4A7ZA 4I02A 2ZMLA 3J26N 4FPGA 3WG4A 1EY2A 1Z7S1 4ISQA 1HX6A 5GM0A 2DV9A 1HRI1 3KCCA 4DQAA 1O3SA 1FI2A 1O5UA 2HYKA 2HWF1 1AR93 3MPBA 1HV1A 3VL8A 3PTYA 4O9GA 1ZRRA 1S1AA 2FZ1A 4QM8A 2XGXA 4M3CE 5DDJ2 4DMIA 2RS32 4YGBA 2HWD2 3WP6A 4ZU4A 4XMIA 3WDWA 3WUDA 2ZX1A 1DQ2A 4LBOA 2TBVA 2AYHA 2XHKA 1CJDA 4FO9A 4MGIE 4COUA 3ZX7A 1HQWA 4NR1A 1PO12 1RINA 1F9KA 3VZOA 1BVVA 4CDXC 1GLHA