4R4ZA

Structure of pngf-ii in p21 space group
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
540
structure length
538
Chain Sequence
AQTYEITYQNSFEGKINPNQNHIISITNSDKTLLFNEKIKNKKADFPFEVNEINRKNNEVSQFAFLNNNEIVKTSDNTILAKQEFKPTSETGKILGYNVKKAVTSVNSNTIEVWYTNDLKVKGGPSILGQDLGLVLKTVRNGSSVVEATSVKKIKALDDQSLFNNITEKDALTYKDMIWKSRFITIPVFENETINFSDASKSDQVIQRFGNGTIILKKVKIPEIKQGNTIFVELKQKSNGDAYDRTGDVFIIPQERAISYYTGLTQGVKSLPVYQNGNGKSYQGVALTPDYLPFIELMRFFTPFGIGHFNEKIQLKGKNWHNNTPYRQDITELRPQLSGKEILIGAFIGNYDKGGHQISLELSIHPDQQKIVNNNFVLPVFNTTNVMEMAGQDYPTMFNSDKGVEVEFILTKDLKNAQLRYITTGHGGWGAGDEFVPKENSIYLDGKLAHAFTPWRTDCGSYRLFNPASGNFEDGLSSSDLSRSNWCPGTITNPVYINLGNLNAGKHTIQVKIPQGAPEGSSQSFWNVSGVLLGQEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PNGF-II
publication title Identification and Characterization of a Novel Prokaryotic Peptide: N-glycosidase from Elizabethkingia meningoseptica
rcsb
source organism Elizabethkingia meningoseptica
total genus 127
structure length 538
sequence length 540
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r4zA03
2.60.120.1570 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r4zA02
4R4XA 3MIGA 3MLKA 3MIEA 1YJLA 3MLLA 4R4ZA 1YJKA 3PMSA 1SDWA 3MLJA 1PHMA 1PNFA 1PNGA 4E4ZA 3KS7A 3PHMA 1YI9A 4QHBA 3MIFA 1PGSA 1OPMA 1YIPA 3MIBA 3MIDA 3MIHA 3MICA
chains in the Genus database with same CATH superfamily
2R061 4CPBA 1GZCA 4BISA 1QQP3 4M4RA 2WA4A 4QPGA 4PQQA 5CAZA 3WCRA 1A8DA 4O65A 2C5DA 3VDAA 4CYDA 1FAYA 3BPZA 2TUNA 1QJX1 2XJVA 3GBFA 5FY9A 3VDDA 2Y6KA 1UY2A 4QPGC 1NY72 4QDQA 1PIV2 3SKVA 1CZSA 4RHV1 3HQUA 4ARXA 1DZQA 1UOFA 1W9TA 4OUEA 3VBUB 5C8WA 5L73A 3BUCA 1XQNA 5FQ0B 4UF0B 1V9U1 3VBOA 2YB7A 1JOPA 1PK6A 4XIOA 2HWD1 5JPMB 3TN92 1F4HA 4Y4RA 3THPA 3NAPB 5EV7A 3H1YA 4MXWB 4IV3A 3HQRA 5L9RA 3GDBA 1OFSA 1AHSA 3DKWA 2JDHA 3MLKA 4K3UA 4PDWA 3T4VA 1PK6C 2V09A 4LO7A 4P5HA 1EPZA 1JH5A 4LEJA 2FHRA 2ZX2A 4ZZ5A 4IL7A 3RQ0A 2BV4A 1WMXA 2X10A 3WDXA 2BOIA 3THDA 3ZDVA 2OYZA 4IEUA 5L36A 2FDIA 1Z7S3 2ZGNA 4JTOA 3O1VA 3J7NA 1Q5OA 5BXXA 3WNLA 3ZKUA 2FBEA 3NNGA 3DEMA 4Q8LA 3RRDA 4DIQA 4FOQA 1NE6A 2MHFA 4QGLA 2HEVF 4NUBA 1X33A 1GUIA 3AMNA 4C91A 3J7MA 3LEKA 2A1XA 3B02A 3PTRB 4LITA 2R072 1B35B 3VBSB 3TEYA 2G1MA 5A3TA 4AQ6A 1RUI2 3SHRA 5KHJA 1W2OA 1UXXX 2WUHA 5LK5A 4P9GA 2P34A 5A7OA 3S5AA 5GLWA 5K7PA 1JHJA 5IVCA 2DUPA 1JUHA 5FY7A 3HBKA 1S0IA 4CUBA 3WX5A 1LENA 3M1HA 2ORZA 4DMIA 5T55A 4YW4A 1O3SA 2BVBA 1UF2C 3ZDSA 2QUOA 2R0HA 4Y22B 2VPVA 3JQXA 4Z82A 3E5XA 5FXVA 2Q8OA 4CSWA 3JZVA 2JIGA 3IMMA 5JOZA 4LBQA 2A5ZA 3Q8FA 2OA2A 3PL0A 2HWE1 1H9PA 2ZHKA 3OEAA 5FYZA 5A6XA 5LATA 3VBFC 1NYWA 3KMHA 2FDHA 3NV2A 4MZUA 2RMU1 1ZRFA 1Q43A 3C7EA 1NX9A 2WNEA 4HXCA 3VV1A 3ZPYA 3RZGA 1WW4A 1JOBA 1UNBA 1GQPA 1S0FA 2D98A 2W39A 2IC1A 2VZUA 1AR93 3M4FA 5IFPA 3GBWA 4Y5SA 1HXS1 4OHXA 2QZ2A 1W8FA 3JB4C 1H2NA 4XETA 2X5IA 3ZXAC 4CP9B 2WC2A 4LBJA 4MYEA 4FOWA 1TNRA 1QJY3 3I8TA 3WUCA 1L3JA 2YYOA 1Y9QA 5E88A 2ZKNA 3KVAA 1GYKA 4XOGA 2JDUA 2X5IC 4TYSA 2QVSB 1UPSA 1R64A 4QGNA 2O8OA 1OA4A 3S7EA 1HB1A 4KG0A 5E89A 1C8M1 1TMF1 3HNYM 2OIIA 4ITCA 2C9KA 4AGVA 3VD3A 1AR63 1HKDA 4E4ZA 4UAPA 3OJBA 1S2EA 3AYEA 4WV8A 5DDJ2 3WW3A 2YPJA 5E16A 2Y6FA 4OUSA 5CB7A 4AK3A 3KWVA 2V5YA 2XKPA 4BJ0A 4JKLA 4LBLA 2J1RA 2VMDA 1POV0 1LGCA 1S0JA 2GN3A 3DCQA 4OHZA 5ACA1 4CUAA 3VZLA 2VCMA 3BPSA 1XNCA 3FFQA 5KHGA 2Z2SB 1W39A 3T0AA 1MQTB 3EMRA 4YM0A 1MACA 4B3NA 5EQUA 3W58A 2G4IA 1PVC3 1QJU1 1OMIA 2GU9A 1FXZA 1H2MA 5EXOA 4AQSA 3ETQA 1J1TA 3H50A 1UY3A 5FLJA 2E7QA 2E7TA 5CKMA 3MZHA 3OSDA 4AW7A 4EN9B 4BIFA 3OEBA 1VMJA 5DAWA 4QKDA 5GALA 2LRPA 1VBE3 1RUH3 3PLQA 2LALA 3I3QA 4ZU5A 2VBDA 3B69A 3GXUA 5C4WA 3ZFEA 4WVWA 3WNMA 3PJYA 1F8VA 3ZFGA 3MIEA 1ND2A 1MPXA 4UFHA 1VALA 3I4IA 4LIUA 1JMUB 2JICA 2FZ2A 4XDPA 5C4WC 4IE7A 4DUWA 4JQRA 4FBFA 5DABA 5JMOA 2W68A 2YGLA 1SDDB 4ISQA 3ACFA 2ZGPA 4QAWA 3T1MA 3T2TA 2WKKA 5FP4A 1O4ZA 4FI9A 1KRIA 1OVSA 1K42A 2ADDA 5A6QA 4YZ4A 5FK7A 1FOD3 5A3NA 5C8CB 4LNVA 1F4AA 2WT0A 2NMOA 2XMLA 3BGAA 5FJKA 4EWEA 3NWKA 5IK4A 4AVBA 4GALA 4BQ2A 5EZWA 1MZ5A 5FAXA 4NIDA 1JN2P 4PQ9A 1YHFA 3BTXA 1WLTA 5AC93 4Y1UA 4FCAA 4W6WA 1LHVA 1UMZA 1ZBE1 2DBNA 2RDQA 3H7YA 4QX0A 5F8PA 1D7PM 3BALA 5C5TA 4I01A 4A42A 3NVCA 1PM7A 3USSA 4AEKA 3BN6A 4JAAA 5LWBA 2EF6A 2JX9A 4CU8A 4LORA 3AP5A 3V0BA 2XDVA 5DPNA 4HETA 3N36A 4FAGA 4IGPA 2EXJA 1VR3A 1S0CA 1XNKA 1NLSA 2A6XA 2YU2A 3U0ZA 3OGVA 2ATFA 2RR13 3HN3A 3RJ2X 1D4M2 3CL1A 5JOXA 3HQXA 1W6QA 3AP9A 1NLRA 2NYYA 1XE0A 1Q56A 4FFFA 4XAAA 2B4KA 4XZUG 1YNAA 3VZOA 5JZGB 1VP6A 4HKLA 2FMDA 3K48A 5C33A 4DOUA 3O1TA 1VRH3 1VBD3 1AYN2 2VNOA 1UIKA 2HWB1 3WW4A 5J98B 1W8NA 4BB3A 4EN7B 1QJEA 3ABZA 2O0OA 3DPRB 2OQ7A 4UFKA 4TLGA 1IKPA 3FBYA 4A3XA 4D7YA 5B4XA 2VZPA 5KXDA 4LBKA 1C1FA 5FY0A 4AVSA 4HZFA 1W99A 5LA2A 3ZXFA 1JXNA 3VD4A 5FZKA 2Y0OA 1HQNA 4LHLA 2YDEA 1QQP2 4DY3A 4Q4X3 1IG3A 1SLCA 1VLNA 2PHFA 2RM23 2ZHNA 2JDKA 2ZX1A 4JKMA 1LOBA 3ZPOA 1LECA 3ZYPA 3SISA 4FSJA 2OVUA 4GB33 2DVAA 4AFBA 1C1LA 3GZUC 4AHZA 3MFCA 1RJ7A 3M3CA 2EVXA 4MGYE 4R4ZA 4JGYA 2ZEXA 2WAAA 2VMHA 4CDQA 4PIYA 1V6MA 2VY0A 2AACA 3K75B 3LPFA 4KH9A 3GF6A 4V2VA 4MH0E 2HBUA 3U07A 1H9WA 5IYYA 3ZVXA 4JGYC 1PM4A 2VZ3A 1UYPA 4INDA 4N9HA 3TB0A 2WZR2 1KJRA 4QKBA 2DURA 3I2DA 1DQ1A 2OW4A 4EWDA 1JYXA 1QXRA 3E6CC 1LEMA 3K46A 2W2IA 3O1OA 3P5BA 3CEWA 2RS53 3WEZA 2DUQA 2JDNA 1HB2A 2CDPA 4LR4A 4BQYA 1CWPA 3KF5A 2JDZA 3IAQA 2VBBA 4FAHA 1RHI3 5A3WA 1CD3G 3AXEA 5IATA 1LRHA 1ASJ1 3H3ZA 1RUC3 3WQ0A 1LODA 2VMFA 4IESA 4YSFA 2CU5A 1Z7S2 4CEWA 2E63A 1COV3 5KHIA 2BFUL 1JYTA 1REEA 1CQ9A 1S0BA 1XNAA 3ZSMA 2FMYA 1NUKA 4Y24A 1ZREA 5AFBA 3LFIA 1PK6B 1YO8A 2BTVC 3AVSA 1F35A 3ZFFC 4NWWA 2A3YA 5FBJA 5T5OA 4CEWC 5FZOA 3POBA 4CEYC 1XU1A 1ZZ8A 1UYYA 4FXGB 2XJQA 4B1LA 4DRRA 1LGBA 4XHBA 4IEZA 4RHV3 2B9UA 3LD8A 1R081 2BZDA 1BK1A 2D5FA 2JDAA 1ENXA 1X36A 2J1UA 4CDXC 2ET1A 2UWAA 3RYKA 1EV12 2BNMA 4WM7A 5C7GA 1AXKA 1ZZ9A 2XWBB 4S2HA 3ZXLA 5FZ7A 1ULDA 3AZXA 1AL0G 4LO5B 2QQKA 4XFHA 5GM0A 1Q8SA 4BE3A 2XWJB 3ZSKA 1ENSA 2TBVA 3AM2A 3IIIA 4G4FA 4PCRA 4RGKA 5J7MA 4OI0A 2A6YA 2I45A 3J9SA 5EFUA 4AEDC 5C71A 4PBOA 3MIHA 2GC3A 1H1MA 1KGYA 2O14A 4P9LA 4G9SB 3W9AA 2ZGTA 3OF1A 4HVQA 4BLJA 4XJZA 3JB8A 5HCHA 3QD6A 2YROA 2Q8EA 4LK7A 3WZ1A 4P02B 1AR92 5C3SA 3H42B 2MPFA 3AFGA 3INAA 1EYBA 1YUDA 4XFGA 2ZABA 2WYSA 5DXDA 4FT8A 1RGSA 2KA3A 1OQDA 1HN0A 1XYNA 1GWKA 4AZZA 1HJGA 3LDBA 4YG0A 5FV3A 4EN8B 3O1UA 1PIV3 4MVTA 3VBFB 2AEZA 2XOMA 1H8TA 2CWMA 3E6DA 2Y38A 3MV01 3NMBA 1UY4A 1K5MA 2V5DA 4LBQB 3GYDA 4XFAA 2BU9A 4R9AA 3MW4A 1LHWA 1U5ZA 3BOWA 1FV2A 2ZMKA 2R1DA 4GJZA 5CZKA 1DU3D 3N3HA 3TOJA 4ASKA 3PVNA 3T30A 2YU1A 1AR62 1GNHA 1VMHA 1K5MC 3ZIWA 1MS9A 1BJQA 3JBG2 4COUA 2DVGA 1HLCA 1GFF2 1Q8VA 1QGLA 2XBO1 3LZZA 3R0RA 4O9GA 4PF1A 1US3A 1VPHA 1E5HA 1VE0A 2X5IB 3CMGA 4LK6A 5EHDA 3R4UA 5FRAA 3ZYRA 4FTBA 3VZJA 4AVTA 1UOJA 4B4QA 5HV0A 1JZ4A 5GKAC 1I9RA 1O8PA 3P1IA 1QH7A 1XXNA 3SH4A 3WDUA 1QXJA 1WMFA 4RL7A 2RMU3 1SPPA 2I07B 1EP0A 5C5UA 1W6NA 3B9CA 3EO6A 5T5PA 3MI8A 1PVC2 2BWCA 1ZM1A 4B29A 5I0SA 1MZFA 4MGKE 3KB5A 1BVP1 4D3WA 2VCCA 2W47A 2RG4A 1PZ9A 2EICA 5DAPA 3OY8A 4CDUB 1QJFA 3GBGA 3RZLA 5FO8B 2ERFA 1RB8G 5FPVA 2GC1A 4AWDA 4DUXA 1RUI3 2NP0A 5EYYA 3FL7A 5BY5A 1LULA 1RUH2 1YQCA 1YEWA 2JE9A 3VHPA 3RI9A 3AP4A 4KWJA 3SC7X 1YFWA 4UBGA 4D0QA 1W6PB 3T4HB 3MICA 4AI1A 3WNPA 5FXXA 5C9AA 5LRSA 3J7LA 3W5NA 3CU7A 3A0NA 3P3PA 1YLLA 2GSYA 4XABA 4ZS3A 2PELA 5DUUA 3UKVA 3GZTB 5BV6A 5ANQA 4A7ZA 1UKRA 4YARA 4ZU4A 4BH9A 5D21A 4KGGA 3PUIA 5TSWA 1IG0A 3AMHA 3IKWA 4A4AA 2VUDA 1FOD2 1UQXA 1DQ0A 3ETPA 4XQ4A 5FPLA 2VW0A 3PTYA 1MS3A 4AFDA 2DTWA 3VBHC 5CNAA 2X09A 1ODMA 2H6CA 3PUAA 4D7SA 1W0NA 2ZEZA 2VCAA 4K1ZA 4AHYA 4YFZA 4N43A 5F9TA 5C4WB 1GP4A 1LB2A 4BIOA 1PO21 1W2AX 4XFFA 3T3YA 2RJLA 3Q8AA 5FWJA 2WABA 4IE5A 1QJU3 1YXWA 3BIWE 1GWLA 4IEPA 4WM8A 4CE8A 4GAZA 1QOOA 5G04L 1LOEA 2PQQA 3DXUA 5DUWA 4JQTA 1OOPB 1DGRN 2YG0A 1RINA 5CEHA 3H0OA 3HOBA 3LF7A 2ZGMA 4XPVA 1UMIA 4Q4V1 5CFCB 4X6QB 2R6QA 3N9LA 4WM8C 1ND3C 5HXMA 2G19A 2K9ZA 1UD1A 5KHKA 1W90A 3I2JA 3PHMA 3M2MA 2RR12 2BOJA 3UKNA 2DTYA 2YV8A 3RG0A 4D94A 4DFSA 3AK0A 3BTAA 3EBRA 4FPEA 2XUMA 3F2ZA 3OCPA 3F95A 3PJQA 3BTZA 2AZ5A 3LEIA 1E5SA 4PLMA 2KD7A 2UY9A 4QB1A 3VN4A 3MIGA 3FC0A 1VBD2 5FZFA 5D8AC 4AI0A 4DNYA 1XYPA 5F1RA 5I8YA 3K4AA 4ASLA 2F4PA 1RIRA 3HNBM 4QT6A 4QX2A 4H14A 4I30A 4YG6A 3V64A 5F3IA 1BBT2 1VBA2 5FZ8A 1UL9A 2BGOA 4Q4Y1 4Q26A 1AR71 2OPWA 2UU8A 4QDSA 4ZXKA 5JR7B 5IVFA 2Q30A 3KHCA 2W52A 4Q4X2 1OQ1A 1ULGA 1Z78A 2RM22 4O61A 1SQ4A 3ZN6A 4GKYA 2VVDA 4GB32 1SEFA 1XC6A 2BFUS 3IWZA 1RJ8A 2UY8A 5A1FA 3D3AA 1ULPA 1ZBE3 3E5QA 3OD4A 3ECQA 2VG9A 1S55A 1VBC1 2G9ZA 4CU7A 4A3ZA 1X8EA 3CZUA 1C57A 4NIIA 2VUCA 1PGW2 2CV6A 3RFRA 3ILRA 3K3NA 3ZIXA 3NO8A 1O6UA 3HT1A 1Y9MA 3C7GA 4Y3OA 1JZ7A 5A7WA 3FJSA 2XONA 3IM0A 1WGPA 4QPWA 3VHRA 1OQEA 4SLIA 4HT1T 4QKFA 2EA7A 2DVFA 5FTTC 2JECA 4CDWA 1I5PA 1R092 5JXJA 3UJQA 1RUE1 1SG3A 2ARXA 2QDRA 1NCRA 1KS4A 1DZTA 4Q0VA 4RGGA 2RS52 2XH6A 1OPMA 4A7KA 1MZEA 3AC0A 5I91A 5LA0A 1IPSA 5FYYA 5LASA 4EROA 4YZ1A 1HRV1 1TE1B 2QTWB 1RHI2 3M8LA 4UW4A 4CDWC 3OBTA 5FP8A 5JOYA 1W8ZA 4WZCA 4GQ7A 1RUC2 4JGYB 4HK8A 4YVWA 3PIGA 5FPAA 3CF6E 4EYUA 2D6OX 3O1SA 3H1WA 1COV2 4L99A 3IZOA 3PMSA 3GJAA 2BRTA 3WHTA 5K4LA 3UL2A 1O5LA 3POEA 5F7UA 4NHKA 4YVWC 4AG4A 1QKQA 2HKXA 5FOBB 1LOGA 5JXHA 5IFTA 1YWKA 1OLME 1S2KA 2FCUA 2ZGUA 3E1F1 3Q9OA 4JVAA 3ACHA 4Q5OA 1ZBA3 1QJX2 4E27A 1VIWB 4J6GA 4I3GA 2H6BA 2VE1A 1NCQC 2GP3A 4RHV2 1AF9A 2CGOA 4ZY9A 3I2HA 3ZYJB 1I6XA 3FWEA 1IS6A 3OUIA 1JYIA 5D1IA 2A73B 1V9U2 2JKBA 2WWSA 5F5IA 1HQLA 1YQ2A 3ZFFB 2HWD2 2QE3A 3LWCA 1QNWA 4IE6A 4CEWB 1PO11 5BNOB 1W0OA 5GLZA 3AZVA 1Q3EA 4LJHA 3VHNA 2GC0A 4AEMA 4CEYB 3NRUA 3HPNA 4A7YA 3TEWA 4C1XA 1PX3A 4XYXA 2QDNA 3J26N 1LKNA 3I54A 5GLTA 3VKOA 2DCYA 1RITA 1AYN3 1D2SA 1H1AA 4CCKA 4QPIA 4DXTA 1RVF3 5FZOB 4CDXB 1JS9A 2XR4A 2XHNA 2C9AA 1CAUB 1ASJ3 1OD5A 3AX4A 5CVRA 4NIHA 4EJRA 4Y1XA 5ANNA 2VC9A 1RMU1 2ZJCA 3FHQA 1O4YA 4JDNA 3WD5A 5FZ0A 1U0AA 2EIEA 3HIFA 4NR1A 4IEYA 5HCAA 5KC5A 3C7HA 4JGZC 1E5RA 2BDRA 2E26A 3JD71 3POSA 1NE4A 4GH4A 1XPWA 4LKFA 2XJPA 4GMP0 2ZHMA 5FMBA 4AEDB 1RXGA 2PMWB 5J96B 4OI2A 3H1MA 4M3CF 4ZZ8A 2OZ6A 4P08A 2A6VA 3KSCA 5K0UA 4DRVA 4N7UA 4HPKA 4AFCA 4BK4A 4AQ2A 3ORJA 5FZDA 3ZXDA 1DGRA 4IE4A 3FUOA 1LJ7A 4HFSA 2X05A 1YIPA 1D0GA 5FO7B 1W9YA 3VDDC 5IVBA 4COVA 5EPAA 3U14A 2BWAA 2WZR3 3FMGA 4R4XA 3RYRA 4HSLA 1AX2A 3OUJA 3AL5A 4AHXA 1CIWA 1DQ4A 2QQNA 1J1LA 3VBOC 1VAKA 3UV9A 1SACA 1BVVA 2ETEA 3SLIA 2WT1A 1OD3A 3O5SA 4IV3C 2VJXA 1FMD1 2GNBA 2PTMA 3Q8BA 4PDWC 5C3QA 1GZWA 4DEVA 1C3HA 1G9AA 2HJIA 2HWE2 3WP3A 2GALA 2YPDA 5JMCA 2CGNA 1UZVA 5GZFA 4Q27A 2RMU2 1BKZA 4I09A 1GSLA 4BQWA 4E9KA 4YZ3A 1K5MB 1XNDA 1UW8A 4HKWA 4Q4W1 4ZPIA 3RZJA 5ABJA 1K45A 3IDCB 3BB6A 3THTA 3AMMA 1AL21 1ST8A 3L2HA 5KHHA 3W21A 5HXVA 1AYM1 4DXZA 4QQ2A 4YGBA 2ADEA 3QCWA 3SKJE 4RFRB 2FCVA 3DKQA 5ABJC 1DQ5A 3L9JT 3L2YA 4CCEA 3NNMA 5A7NA 3UESA 3AVRA 4K6BA 2XVLA 2MEV1 4QB6A 4RS5A 2BUKA 3TRSB 2IXJA 2XG3A 1EV13 2ZPXA 5C3RA 4KWLA 1H2LA 1DG6A 1NXMA 5DZFA 2PHWA 3N35A 3MW3A 4IUGA 1C8M2 3RMYA 5T5JA 4AGGA 4HKOA 3UETA 1UKGA 5LBFA 2XJUA 4B7EA 4HG6B 5KXBA 4OQ8A 4QWNA 1AXZA 2BVVA 1JOJA 2GAUA 2WNOA 4NAMA 5M0TA 1MR5A 3VBRA 5JXIA 1CESA 4N9IA 1YI7A 2XBO3 4KMQA 2RS11 3WF4A 5A1AA 2WFF1 1AJOA 1RTVA 3OYWA 4XF4A 2PHDA 1DLLA 2R30A 5FZLA 1REDA 2A71A 5E8AA 4IEXA 3JUUA 1WWYA 5I0TA 3MFAA 2VVFA 3VBRC 3IB3A 3D6EA 2WZPP 4BMEA 3ZYHA 4E8DA 2R49A 1MEC1 2AR6A 1FX5A 3G6JB 1H4GA 1SFYA 1QJU2 3C2UA 1JHNA 2VUAA 5KXEA 4JKKA 4YVSA 1RYYA 1WKYA 1Y7BA 3KF3A 4H2AA 5L7OA 5F3EA 1N47A 3WQBA 4GWIA 2C0ZA 3VBHB 3MUZ1 2WFPA 5A7PA 3K51A 3I2OA 4YWAA 2YC2A 2GH8A 5EJ3A 5FZHA 5L7OC 1W8HA 4OHWA 3NKTA 1CGPA 2EALA 1N3PA 3CJIA 1VB2A 4H7LA 5DAVA 1SBFA 1VBB1 2WQZC 4NN0A 2Q1MA 2P3YA 3USUA 4MGQA 2EXKA 2OUHA 3JBG3 1KDKA 2WRAA 4NHYA 3ALQA 2PAMA 5FYCA 4YNIA 3THCA 5CA6A 2R071 4MOAA 3WDVA 1T2XA 4NWVA 5FPXA 4WM8B 5J3UA 3NV4A 1ND3B 3IN9A 5FXWA 5FFOC 1WW6A 2D6NA 1TG7A 5FDBA 2CYFA 4BYYA 3ILNA 2R0FA 4G3YC 5A6YA 5EJZB 3PMEA 4IV1A 4L8QA 4KBBA 3WDYA 1JU3A 1CAWA 2VBPA 1UN1A 2C4XA 2ENRA 4LHNA 4M4PA 2PAKA 2IXHA 1OKQA 1PO23 1BQPA 2W1QA 5LZ6A 5D8AB 4MGIE 3OGGA 1ZA7A 1ZBE2 1PGSA 3ZMOA 1HB4A 2FQPA 2WINB 1X7NA 3N9PA 3J8F1 1GP6A 2VQTA 4CVUA 4QXHA 3KT7A 3T0BA 4XTPA 5A33A 3LOBA 2WNVA 1H1IA 3JCIA 4LUMA 4IXLA 4XZPA 1VMFA 2IUWA 3I59A 4AI2A 5FYUA 5LBCA 3ACIA 4UBHA 1E5IA 1ENRA 3N9MA 5DG1A 4XQDA 1I3HA 4BQ4A 4FOYA 1PZ8A 3S30A 1JUIA 3B01A 4LUKA 4JDOA 1OF3A 2WNVC 5E1RA 5C3OA 5EIYB 1S0DA 4Y1ZA 3ZFEC 1O5UA 3IAPA 4KG8A 5T3NA 2B7YA 1H8VA 3ZFGC 1RUG1 4IEWA 1NOVA 2BGCA 1HV0A 1ND2C 2HWC1 1O3TA 3EJKA 1UOGA 1PVXA 2GNDA 3KT1A 5D2AA 5FJHA 3WOGA 1X9TA 4FO9A 1CX4A 4BQ3A 4URAA 1F31A 2JD4A 3M3EA 4V1PA 4TN7A 3VGIA 3AP6A 2IVJA 3ASIA 2HBTA 1UPIA 5GJ6A 3SCFA 3ZKYA 1UZWA 1AR73 4NHMA 1UU4A 2JG9A 3J4UH 4GJYA 5DDJ1 3SCHA 5F37A 3ELNA 4K20A 2JJ6A 1F15A 1IHMA 4FQZA 5IVYA 4CXYA 2HWF1 5KXCA 1W6MA 1NA1A 2ES3A 4CDWB 4AYUA 5HCFA 5FLHA 4P9XA 2Y6GA 3URFA 2D6LX 1ZBA2 2JG9C 4BPZA 1TME1 4LIVA 1GQHA 1IOAA 1UU6A 2Z5WA 5AVPA 1CVNA 1CZTA 3S5QA 5H9RA 2R32A 2WDBA 1NA1C 1KITA 2ZGKA 1W04A 2VW1A 2ZMNA 5FYIA 3Q8CA 4HOOA 4M00A 4QXKA 4YVWB 1LAJA 5FZ4A 4D7TA 2O8QA 4KL1A 2P6CA 3TNPB 3V56A 1QXPA 5BNQA 1O3QA 2VQ0A 1LU2A 1RUE3 3HEIA 5FYTA 3BU0A 5FR3A 3GGLA 3RPQA 1NCQB 1WW7A 2WLPA 2QZ3A 1EY2A 3KV6A 1X8MA 1AUYA 1KFUL 1W8WA 5EJ1B 1BMV1 1RVF2 2D3SA 2XB6C 1ASJ2 4XTMA 1J3RA 3A22A 1W6OB 1BBT3 1N3OA 2D7FA 1D2QA 4XJ9A 5SV8A 2C6SA 1H30A 3U37A 4Y5Z0 3ZYGA 1VBA3 4GULA 1RUJ1 1CAVA 4AHWA 2AYHA 1BEV1 1D0HA 1NQDA 4MXVA 3N4MA 1CZVA 4PHZA 2W95A 4NMIA 4FQ4A 4QHZA 2Y8KA 5L19A 3PNAA 2VD7A 1W9SA 2ZTNA 4WVZA 4ES8A 3I7DA 1POV3 4KNCA 1W05A 1JZ6A 4UT5A 3SEEA 4O9EA 2WN2A 2JG8A 2ZGLA 4LKEA 3RJRA 2SBAA 4WVMB 3U4XA 1R082 1O91A 4JHTA 4W50A 2J42A 1BHGA 2VTFA 5F6KA 4JGZB 1KFXL 2JG8C 4OZXA 4CDQC 5B4NA 5LY1A 2EIGA 1Y9GA 4Q1RA 1RL3A 5BNNA 1R093 2WT2A 1K3IA 1PO13 4AVCA 2FDFA 4NRMA 3D0SA 5GZEA 3AYDA 2JENA 1GNZA 3NKGA 4QPGB 5F32A 3R05A 4L0PA 2D97A 4LO4B 5FP7A 3FLTA 1WUVA 4Z8BA 4P9JA 2AC1A 4BXFA 2JWPA 5BNNC 3BU7A 2VOKA 3CKHA 1MS8A 2QQLA 3VDDB 2HLEA 5FY4A 3N7JA 3M70A 2I2SA 1PNFA 4IDZA 4DUVA 5JOWA 4LTAA 4IETA 5HI0A 3B93A 1J59A 2BGPA 3KV9A 2ZXQA 3OG2A 4I0AA 3LA3A 1PGL1 3VBOB 2EIDA 5EWSA 2R063 1QDOA 4XMIA 2YC0A 5FMOL 2VR4A 4JCKA 3G7DA 2W08A 3JD73 5IVJA 1BXHA 5EP9A 4IV3B 2OPKA 5CFDA 4XUNA 1O8SA 2ZGRA 4PDWB 4FP2A 2CL2A 4LXLA 2Q5TA 2WO1A 1QJX3 4Y1YA 2JXAA 4Z92B 4XC9A 2PLV1 3S57A 2BNNA 1IS4A 4CPBD 5L9BA 5T52A 2PHTA 5CFDC 3ME2A 4K9SA 1V9U3 1UX7A 3HWJA 5J48A 2W9XA 2HWD3 2TNFA 4Z2WA 3GCXA 3EQEA 4A41A 4B7KA 1H0BA 1POQA 2VUJA 3DXTA 4P5YA 4YLZA 3O1MA 3I2KA 2C1FA 4BU2A 3V0AA 5FZIA 3VZMA 1IGOA 1A8MA 1JZ8A 4WM7C 3VZNA 2W0XA 2XL7A 5FYMA 2VOVA 3ZXKA 2XBO2 2ZGOA 4OYUA 2HH9A 2YZ4A 2WL1A 3GZEA 1B09A 5A1LA 4MLOA 4QX3A 2JE8A 4C90A 4W6YA 3MF6A 2VO5A 4OCTA 2FDKA 4GA9A 1F9KA 1W0PA 3T2OA 2DBIA 3FUQA 4XW3A 5FZGA 3K3OA 4AOCA 1WA6X 4N53A 1ZZ7A 1OUSA 2DCZA 2AH2A 3DGTA 3AKRA 3MPPG 3NSTA 5I0DA 3HJRA 1ZZCA 2AEYA 3WF1A 1FNYA 1ZRIA 3VBUA 3WF3A 2VMGA 5FQ0A 4UF0A 1JODA 1ULEA 3LB9A 1UYXA 3OPTA 4N53C 4EN6B 2NZ9A 3VBRB 3FX3A 1IPKA 2D40A 1REFA 3DV8A 1GKBA 1QDCA 2QQUA 3DUIA 3CIHA 3NAPA 4H7MA 4QQOA 2RE9A 1SZBA 2WZ8A 4DB5A 2H0BA 4D8MA 2CY6A 1O59A 4XJWA 2VM9A 3MBWA 4C1WA 2VULA 3H8OA 1NLQA 1W03A 1XRUA 3VUOA 1H8TC 2VCBA 4DZGA 1XBFA 4WZFA 3IIAA 4QDRA 3NJXA 3BVCA 4XF9A 3BKZA 1RUD1 3CZJA 1URXA 4BZ4A 1CJPA 3ACGA 3SCGA 1CAXA 2JDMA 4HLTA 4JTNA 4XE9A 3MHZA 2P3IA 1PMHX 4RFT0 4Q0SA 1U5XA 1GMMA 2RS13 2WYFA 2XVKA 4CCJA 2LM3A 2UYAA 2WS91 2YMZA 3U4SA 3WW2A 2HWE3 4M3CA 1HRI1 2DFBA 3FHIB 3ZX7A 4UFJA 3KGZA 2CSGA 2NMNA 2QJVA 4CP2A 1FYUA 1CR7A 2OX0A 4AL9A 4AXOA 4D6RA 3RSJA 2VQAA 1XYOA 2RDSA 1JZ2A 1HN1A 1PO22 4F7ZA 4QMAA 1HXS3 2ZGQA 4FFGA 2VZ1A 4LBQD 3VBSA 4YZ5A 1VAVA 1XSQA 4PBPA 3WF2A 2Z4FA 3D4KA 5FUNA 3AKSA 2PFWA 3S7IA 4MADA 4BLIA 2YFUA 1PZ7A 2D43A 1J58A 4J1XA 4J25A 4K21A 4IGOA 1EAH1 4IERA 1DF0A 2A75A 4Q4V2 3ZMNA 2WO3A 1QNYA 2CTVA 3VD5A 3HT2A 2YY1A 4E4HA 1WBFA 4LKSA 4LHSA 2NPIA 5ISLA 1PMIA 1BYHA 1DQ6A 4GMP1 4DPNA 1WCSA 3GCWA 5HBAA 4Y22A 2RVAA 4S2FA 1C8M3 1TMF3 3PUQA 1DYKA 1U5IA 2UWCA 3D82A 4M3CE 1CAWB 4H55A 1QJY1 1UZYA 1YJKA 2LROA 2ZX0A 3AXDA 4QX7A 3O0XA 2JDPA 1UO9A 2GH2A 2OXBA 3ZYIB 1ULFA 5C9AC 1OF4A 4YGEA 1AR81 4R9CA 1GBGA 3O12A 1OHFA 4O7XA 4NPMA 3BIEA 2F17A 3H3LA 2HYXA 5ACA3 2D6MA 3CBNA 4UW3A 5IVEA 1W2NA 3EHKA 2DVBA 5BUVA 1AR61 3RWKX 3VL9A 3ENRA 3ON7A 4CP9A 1AR72 3LEMA 2XKOA 4IQPA 4LQRA 5DZEA 3WCSA 3ZFEB 3BTYA 4IEOA 4A45A 2JB4A 3KZ4C 3ZFGB 2A6ZA 2PYTA 2VXRA 1ND2B 3QBQA 3B94A 4NPRA 3VKNA 1DYPA 1OA2A 4YW6A 4DY5A 3MUY1 2ET7A 4N43C 2PHUA 3OPWA 4X8PA 4M0NA 4YW2A 4ATEA 1G9DA 1ACCA 2R1BA 3MLJA 4LULA 1YFYA 1VBC2 4Y4YA 4Y26A 1LOAA 4W6XA 1ZZ6A 2GZWA 3BCWA 3OD0A 3CDZB 4BQ1A 4OI4A 1LGNA 2B46X 1FI2A 4YYOA 5L9VA 2VGDA 4RN5A 4E4SA 4EQVA 4NRPA 2ZA9A 4FPHA 2D5HA 1H6XA 3DL3A 4DEQA 4KI5M 1SCSA 2A7AA 5G05L 1C8NA 1S4CA 2HYKA 2Y60A 5FZCA 3O0VA 1W8UA 1RUE2 2JG9B 2XJTA 5FP9A 3SXWA 4AAXA 4E2SA 2XQXA 3H8XA 2LTNA 5KWRA 2YFZA 2PHXA 4LO8A 3WW1A 1MQTA 1RUG3 1DGLA 1STMA 1NA1B 1HRV2 1TQ5A 1X50A 1VBE1 1W6MB 2QQOA 2XXZA 4UWDA 3W20A 2VNVA 4QM9A 5LY2A 2VNRA 4BK5A 3T0DA 2ZS6B 1KD7A 2O1QA 3KV4A 4ISRA 5LBEA 1H6YA 1JTZX 3V0BB 3WNNA 1VB4A 1YFUA 1LHUA 1DQ2A 2WZEA 1RUF1 3M7AA 4ZKTB 4GZ9A 3DYPA 2QBXA 2ARAA 1R1A1 5FIXA 3WHUA 4FPYA 1V6OA 2J1VA 1QIQA 1W6QB 5F39A 1LEDA 2D93A 2JB8A 3LIHA 5FZAA 3WLUA 2GNTA 5KR7A 1UU5A 2HWF3 4DXRA 4IW3A 1SBEA 2QKDA 1ONAA 4J1WA 2Q1FA 1DGWA 3UKTA 4A2UA 2V4VA 5FMOS 2OT7A 2P17A 2A70A 4CP0A 3J7HA 2OS2A 1TME3 5K8SA 3U78A 3ZSLA 1XOYA 2BP6A 2E33A 2AREA 5JR2A 1JW6A 1EUUA 4Q0PA 4AVAA 4TLFA 4BA6A 1O4TA 1JYNA 5AC91 3SMHA 3OUHA 4FXKB 4QQLA 5CG8A 3VB9A 1PO12 2CDOA 5IAVA 3LA2A 1Y4WA 2KR2A 3A7QA 1CN1A 4FFHA 2Q8CA 1LNSA 4LE3A 3GHNA 2ZX3A 5FK8A 3RZHA 4YW1A 2VZSA 3PU3A 4YRDA 1WCDJ 2VQUA 2HWB3 4RD7A 2B39A 5FYBA 1NCRC 2OZJA 3AKPA 2JG8B 4CDQB 4XJUA 1Y43B 1FNZA 2P5BA 3ZN5A 3NV3A 1HV1A 1WZXA 3K77A 1YIFA 4XFBA 1RMU2 2JEMA 5J36A 4HVOA 1RUNA 3R6SA 2R062 1BEV3 4XACA 1V70A 1SLIA 3POIA 3W5MA 1VRH1 2DWRA 2XQRA 3JD72 4MGSA 3AL6A 3S0MA 1W3XA 3RS6A 5BNNB 1J84A 1L7QA 2EAAA 5B2GB 2ZACA 5LRRA 4L97A 1WCKA 1HX6A 2RS31 4LMFA 4CCDA 4EZHA 3D8CA 2V4AA 3KM5A 5CIRA 1LOFA 5J37A 4PJYA 5FOJB 3CO2A 2D6PA 4Z07A 4HMZA 1IS5A 3I97A 5JZGA 1LESA 1AVBA 1V6IA 1X9PA 2WN3A 2X29A 5FO9B 3FLRA 4V2WA 2RM21 3PIJA 3QOPA 4ARYA 1LOFC 5FY5A 3KCXA 1SDWA 1YQ6A 4GB31 1DBNA 1ZYBA 3PURA 3LDKA 1J3PA 1DCSA 2YGMA 3WY6A 4PIXA 3C7FA 2EAKA 4OVEA 3ES4A 3AFKA 3I2GA 1EUTA 4FPJA 3RWNA 1DIWA 2KM2A 4QB2A 3DPRA 2GMPA 2E9QA 4JHZA 3WSOA 1TEIA 1KQRA 1XB9A 2ZOEB 1X82A 3C3VA 5IJRA 4BMBA 3EB7A 1ODNA 5CFDB 1JI6A 2R16A 1S1AA 3POYA 5DG2A 3VD7A 1OBNA 2WNUA 1QY4A 2IVIB 2VMEA 1DDLA 4QPIC 1YJLA 4Q4W2 5IVVA 4WM7B 2VMIA 3SQOA 1AL22 3N9OA 5LK7B 4TXWA 3LOIA 4JDMA 1AYM2 2WNUC 3AJZA 3RYPA 3CHXA 1ZVFA 4LHKA 3SITA 1OVPA 2XUEA 3WP4A 3V0AB 4AVVA 2FDGA 4HN1A 4GH4C 1SCRA 1M06G 4PI2A 1WA4A 5FPBA 3H7JA 1AX0A 4YFWA 2VOWA 1R083 4Z2AA 2MEV2 4CXWA 5CU1A 2GP5A 2JD9A 4IGQA 2VZTA 1GV9A 4AGRA 1UYZA 5K0UC 4DO0A 1VRBA 2TEPA 3WF0A 2D6KA 4C8DA 1OT5A 4GWMA 1QMJA 4I0BA 4XMAA 1CPNA 5GZDA 4ZS2A 1W8TA 3WG2A 4B8EA 5IT6A 1WD4A 4N53B 4F83A 5JSRA 1KEXA 3ZSJA 4GWNA 2WR9A 2BPA2 1KXGA 2RS12 1FPN1 2WFF2 4TTGA 4QHBA 1LR5A 4DQAA 4NIAA 3CJXA 2Z69A 4UFLA 5GLUA 4F8AA 1YQ8A 1H8TB 3M3QA 5F5AA 3M3IA 4A6SA 4ES9A 2QQWA 3T2QA 2R041 4E2GA 1HJFA 3E5UA 3AMQA 4L92A 2ILMA 2DCKA 3SH5A 3B00A 5JPNB 4QX5A 1WMDA 3E97A 1MEC2 5BYNA 5FMDA 3W59A 3POWA 4EV0A 1SMVA 3AP7A 1HXS2 2BYVE 5BNPA 2WLQA 4NRQA 2ZAHA 4IEVA 2CGPA 4XEZA 3IMNA 4CUGA 2Y64A 1CAXB 2VZQA 1S0EA 3OBZA 5BNPC 4A44A 5FYVA 4B4RA 1RC6A 4AI9A 1W9FA 3VDCA 5JSPA 3BYWA 4XXPA 4L9BA 4M3CB 2RV9A 1BLZA 1ULOA 1TMF2 2QNKA 4NVPA 3QLQA 4RS5C 2XGXA 1IPJA 5C70A 1SPPB 2GDFA 3I49A 1VBB2 4X8NA 4XIKA 5FWEA 1W6NB 3I2FA 1RUD3 4XFCA 2DV9A 1NY71 4QKNA 1PIV1 5DAQA 4OI1A 4MHUA 1XU2A 2WJSA 3HBZA 4R9DA 1A3KA 1C28A 1APNA 1BZWA 4ASMB 1MS4A 2W3JA 3OY8B 3RVHA 3HR9A 1OXCA 3GJBA 3MW2A 4NAOA 4CCCA 5ACA2 2CWSA 4Y5TA 4QHOA 2WS93 3TN91 1DLCA 3WXPA 2P3KA 1HRI3 3SNMA 3AZWA 4AI3A 4PI0A 1HQWA 4A6OA 5DQ0A 4S2DA 2C26A 5DUVA 2E7AA 2NN8A 2YUEA 3R4SA 3LIGA 1SLAA 2W1WA 1W2UA 1ZRRA 4DINB 5JWPA 2ZHLA 1ZRDA 3OB8A 4GXLA 4MG2A 3A21A 3VBFA 4AF9A 3ZYFA 5C9AB 2A3XA 5I93A 2QQPA 2VOTA 2W46A 3LSEA 5T54A 2BBVA 1Q8QA 3VKFC 1L7LA 1YYNA 3AKQA 4LLFA 2HEYF 2B42B 3J8F2 4PLNA 3MLLA 3UGFA 1JYVA 1EAH3 2XHKA 2KXLA 3AZZA 4LBMA 1M4WA 4YVSC 1W8OA 1MVEA 4XCBA 3N9QA 2WQ4A 1CIYA 1HW5A 1ZZBA 3OBRA 3RMXA 1SHWB 5A6ZA 3T1LA 3MYXA 5IW0A 1CONA 4BDVB 2WWJA 1LU1A 4GMP3 1XNBA 5DZGA 3IDBB 2VNGA 3IDAA 1QWRA 3MIFA 4WVVA 3RDIA 4N43B 1GLHA 2DU0A 4COWA 3HVDA 3KVBA 5IK5A 3CJIC 4BOWA 1GWMA 1RUI1 2B5HA 1AZDA 2E53A 2WSVA 1LHOA 3KQRA 1RUG2 1L7RA 2P1BA 4RSUA 2HWC2 2Q0AA 4I3PA 2Y34A 2EIBA 3VDBA 1AR83 4RR3A 1H2KA 5F6LB 1FV3A 3POGA 1F5FA 2VMCA 2MNGA 4QPYA 5FZMA 5CG9A 3ZOIA 4CXXA 1GU3A 1TZOA 1SLBA 4BXSV 4MHRA 1C5HA 5AVAA 3WNXA 1TNFA 4QD2A 4NOTA 4RR3C 1T6GC 5A3OA 2QQJA 5FPUA 2ZX4A 2H0VA 4CDUA 1GICA 2BNOA 3PVEA 4R9BA 4DXSA 2DCTA 1HIXA 1W2TA 2HWF2 3O14A 4IV1C 1MS0A 4KU8A 4Q8KA 1QHDA 1WW5A 2Y26A 3A0KA 4XURA 5IHRA 4AQTA 4GD4A 4Q4V3 4CDUC 3UGHA 5GZGA 1V0AA 4YGDA 1YFXA 2VTXJ 1W6PA 1TME2 4LKDA 5A32A 1F2NA 3VZKA 1NZCA 3WP6A 4FVVA 4NHXA 4UI9L 5F3GA 5HCBA 4OULA 1A34A 4AR2A 3BODA 3CLPA 5GLVA 4CCOA 4LPLA 5CKNA 4XCAA 1PHMA 3MGUA 3O1RA 3OGJA 5FLIA 3MDPA 4AEJA 3HNMA 1IS3A 2VZVA 5J09A 3N7MA 1GQGA 3VL8A 1FATA 5IUQA 3ZN6B 2F6BA 5JAXA 1SLLA 1DFQA 2HWB2 1UXZA 4MGTA 1BMV2 2J7MA 1XE8A 3RGBA 3LE0A 5HPOA 4QGMA 4I2OA 4ZONA 3FHAA 3KV5A 3RI8A 2VU9A 4XJ8A 3QH6A 4FPLA 2IXCA 2ARBA 1V6KA 4P9WA 3D0JA 3AKTA 2PQSA 4Q4Y3 5A70A 1RUJ2 5FZ3A 3UK9A 3VBUC 1BEV2 1RUF3 1OOPA 1S2BA 2VL4A 3WG1A 5A7WB 1WLWA 3NJYA 1R1A3 5LB6A 5CYYA 5CFCA 2VZRA 3ZYBA 5KBFA 4E8CA 4Q1PA 1IKQA 4QQPA 4OZOA 5FCCA 2Y6HA 2NQYA 3AMPA 3OTFA 1NCRB 4NO4A 3T2PA 1OOPC 3N9NA 3KLSA 4JRLA 1VBC3 1SLTA 1NZIA 2JDYA 3MPBA 4LT5A 5CFCC 2VAUA 3GHMA 4JX0A 4XBNA 4FTEA 4YPJA 4CU9A 3H3UA 5FP3A 4FPGA 1ALYA 3QACA 2P2KA 1CX1A 3IPVA 4RQPA 2BERA 4FPOB 4XUOA 5LA1A 4LO6B 4XF1A 3HMYA 5IWFA 1G8WA 3TNQA 2WA3A 2WO2A 3T08A 5H9PA 3QH7A 5FYSA 4AFMA 1OI6A 2GC2A 3TAYA 2V73A 3ZXEA 3C7OA 4P9YA 4RQPC 1W06A 1DHKB 5F5QA 1HRV3 4P00B 3WINE 2Q1ZB 2W91A 1GR3A 5JVVA 2OKXA 4YW5A 3RZZA 4QQHA 3UT0A 4NPLA 1Q8OA 2ZEWA 4M0HA 2JIJA 3VD9A 1G9CA 4K1YA 3ZSEA 1HDKA 1JU4A 1DP0A 4P14A 1PGL2 1MS1A 3OOXA 2LS6A 3IBMA 4XAEA 4YG3A 1UWWA 4OUMA 3LAGA 3CNAA 4NHLA 4LBOA 1GANA 2B9VA 1GZTA 4OHYA 2W92A 4MUVA 4CZSA 2RS33 2UWBA 2DFCA 4LOTA 2PLV2 2K0GA 1F5JA 2VTXA 4XHXA 1XE7A 5DAXA 1US2A 1YI9A 4QPIB 1N1VA 1AXYA 4U2AA 4RGAA 3JU9A 3NNFA 4KQ7A 4ZHNA 3N7KA 3H9AA 4D6QA 2WNUB 2L9LA 2RHPA 1JYWA 3NL1A 4YW7A 4BM8A 1UY1A 4IE0A 4P9IA 5J1XA 1N1TA 1ZBA1 4GH4B 4JV4A 4L11A 3WG4A 2DYCA 3E6BA 3HAGA 5LEJA 2C24A 4HVRA 5JXGA 1OH3A 2Y33A 4M01A 4YZ2A 5FZ9A 5K0UB 4XUQA 1PNGA 1CPMA 1D4M1 4HPKB 4XBQA 1W28A 1ENQA 4K8RB 2DUOA 2FCTA 1NKGA 1HB3A 1RMU3 4Y20A 2BQPA 1DZRA 4Q2FA 5JIUA 1W9WA 3O0WA 3MF9A 3MEPA 4LA2A 1ZX5A 5LCWL 1AYN1 1MS5A 3GZAA 3KT4A 5A3LA 1RVF1 1E57A 1UZ0A 1VJ2A 2RJ2A 4URTA 5KC6A 2Y6JA 2RDRA 3WVJA 1OPOA 4XILA 5LW9A 3AYAA 4UXAA 4TZDA 3N7LA 1N3QA 4YGCA 3ZFFA 1T6BX 2G9GA 2VH9A 2R7EB 4XVHA 4Y33A 5BNOA 5K9YA 1AJKA 1QEXA 2W1UA 3PVOA 4EZ4A 1GZWB 2X53S 4CEYA 1QQP1 2IXLA 4D69A 1D4VB 3H8UA 3WUDA 3DYMA 3NNLA 1IQDC 2ID4A 2YC4A 2XLFA 3CQOA 4OHVA 4UW6A 4FOVA 2OUJA 3LEGA 3P6BA 3ROUA 5BNOC 4CCLA 2W94A 5ABJB 1H4HA 3ES1A 1RUD2 2QQIA 4CDXA 2Y0IA 4MSVA 3SEPA 2ZAAA 1CAUA 2ZEYA 1A78A 3GNEA 4LA3A 2VECA 5BNPB 3FN9A 1PMJX 3P3NA 4UFIA 4CP1A 5C6CA 1FMD3 2F4LA 1FPN3 3O1PA 5AFEA 1GZ9A 2WS92 3KQ4B 3LA7A 4CA9A 1HRI2 1J83A 4EN0A 2WZR1 4RS5B 5A7QA 2IFRA 3UGGA 1V6NA 4C0HA 2R043 3GALA 2GMEA 4AEDA 1QH6A 1QOTA 1YCIA 4Q4W3 3TEZA 3WNKA 3WT3A 2WSUA 3KS7A 2IZWA 4NJ4A 4PT6A 3FBMA 1AL23 2BEOA 3FZ3A 3OBAA 1AYM3 2PHLA 3WDTA 3TEXA 2Z79A 3B3QE 3ST7A 1YC61 2JKXA 2QFEA 2BJSA 5A3MA 4Q0QA 1EAH2 2EXIA 1Z7S1 4FPKA 3RZMA 5A3PA 1DYOA 3S6PA 4MXWA 4KWUA 2MEV3 2VOXA 3OYWB 2DVDA 3HN1A 1MVQA 4Q29A 2FDJA 3NNJA 3LPGA 3AJYA 5FREA 1NAEA 5IK8A 4META 4COZA 4X6RB 4CU6A 3NAPC 4K40A 2ORXA 3MO4A 4ZXEA 2PAEA 4LBNA 3A23A 1QJY2 4AFAA 3WR0A 2FZ1A 4R52A 3AYCA 5LBBA 4YVSB 4EE2A 4HANA 2VZOA 1VAMA 2LUWA 1AR82 2WFF3 4GIQA 4KWKA 2YXSA 1LCLA 1AX1A 3PDQA 4HK9A 4XF0A 4UYBA 5L7OB 1G9BA 1EV11 5JI9A 3LQCA 3WV6A 3TN93 2WQ8A 4BQXA 3ZLIA 2CNAA 3FFZA 3B7MA 3I3MA 3T09A 4EWAA 1FT9A 5LEKA 3AB0A 1MEC3 1OLQA 2V72A 1XNTA 3RZKA 4MV2A 5A3UA 3CJIB 5CKQA 1IQAA 1B35A 1YRZA 4W65A 4Y1VA 5T50A 1RUOA 4RYDA 4C0BA 4CUCA 3USUB 3U75A 4QX8A 4OMDA 4LOSA 4MGZE 5FY8A 5A7SA 1OLRA 1ULCA 4BHPA 3IDEA 5T5LA 3BOPA 3EXUA 1G7YA 1UOBA 1GP5A 3VBSC 1B35C 4FPCA 3WP5A 1GNYA 3DYOA 3KHBA 2XJSA 2WBKA 1KS5A 1LOCA 2BW8A 4RR3B 2J22A 4WBBA 1AR91 2IXKA 3ZXGA 1I5ZA 2P4EA 3KD4A 1UX6A 4MX3A 4I02A 1OKOA 3NJVA 1NG0A 3HD8B 4IV1B 4ONUA 1VBB3 4YM1A 2PA7A 3BI3A 2LW8A 2RJKA 4LE4A 4KGQA 2J1TA 4K7JA 4FFIA 3M3OA 2R073 1WCUA 1YQ5A 2W5FA 2GN7A 5FZ6A 2XVGA 2DCJA 1VBE2 2XJRA 2ZMLA 3ZR5A 1GOHA 5F2SA 2VVEA 5JLVA 2N7GA 1OURA 3WQ1A 5GZCA 2Y6LA 1KDMA 2PXJA 3OPZA 4XUPA 5A32B 5A33B 5CISA 2WNVB 2IFWA 4Q4Y2 4XF3A 4D6SA 1RUF2 3I59B 3JBG1 4ET7A 1U5YA 1OUXA 1NQJA 2WO7A 5IAXA 5ERLA 1R1A2 5I8TA 4YM3A 3ZXJA 1WMEA 3UJOA 3WNOA 3VBHA 3D5OA 2NLRA 5F5CA 4Z1VA 3I3BA 3K2OA 2QQVA 5IK7A 3PU8A 1G9FA 4LLOA 1JBCA 3J8F3 3KCYA 3VKLA 2A3WA 3B5LB 2W87A 4KU7A 3ATGA 3APBA 3ITQA 1JZ5A 5FKCA 2GNMA 3DN7A 4QM8A 2AGSA 4DS0A 3WQ7A 1PVC1 5BPXA 1UZZA 1V00A 5DUXA 3NW4A 2K46A 5C3PA 5AC92 4ATFA 4FTSA 1N1SA 4OFGA 3I3EA 1UCXA 1ZNPA 1ND3A 4GWJA 3ZM8A 3GM8A 4B4PA 1R1ZA 4W4ZA 1GOGA 4MO3M 3K4DA 4JRAA 4XBLA 3FE5A 2HWC3 1RUH1 1SFNA 2ZBJA 3UYJA 5JDBA 2J1EA 1G86A 3TWIA 1V6JA 3POFA 3POJA 3TBDA 4BQ5A 5SV5A 1C4RA 4S2GA 5FBZA 3VLBB 1IZ3A 5D8AA 1MQTC 1OA3A 2K2SA 3KCCA 1DGWX 4JZRA 2VXJA 4NROA 5EYXA 5FKBA 3VKMA 4N7IA 4YM2A 5DDJ3 1V6LA 3IPVB 4Q0UA 2I74A 2G9FA 2J1SA 3ZN4A 4E4DX 4QXBA 4RQPB 5APAA 1VRH2 2CAUA 5H9QA 4CCNA 3O7OA 2BBAA 4HBNA 3PUSA 2QQMA 3SH3A 2GMMA 2SLIA 4HL0A 2RDNA 4IEQA 3VHOA 4RA0A 3FLPA 4NE9A 5H9SA 2YBKA 1FOD1 3LDRA 5FMCA 2DDUA 2RS32 4TWTA 4XDOA 1BK0A 5JUVA 1OC1A 2E6VA 2EXHA 4OMCA 3K4ZA 4XXAA 3U1XA 2DU1A 1J3QA 1WCQA 1WD3A 2IXIA 4QX1A 4FPFA 1Y3TA 1CAVB 2QCSB 1K5JA 1W3VA 3KGLA 1NT0A 2XL9A 2UURA 2YBSA 5FXZA 1QOSA 3U10A 3ZR6A 4QXCA 2J1AA 3RNSA 3MIDA 4I0WB 3C8XA 5JSOA 2P3JA 4PF5A 5C8CA 5F2WA 2AENA 1LTEA 1A6CA 3EYPA 2WIIB 4B1MA 1OFNA 4ZU7A 3ZO0B 1MZ6A 2CHHA 2P37A 2RR11 2PHRA 3NJZA 1K12A 1OLMA 5A80A 3Q8EA 1XJAA 5FZEA 4TSVA 4PLOA 2YBPA 4HN0A 5C8CC 3X29B 5FUIA 2E31A 1JZ3A 3PVBB 2AUYA 1OSGA 1RUJ3 1Z0HA 4L2NA 5FPZA 2D44A 4QU1A 2W1SA 5I0UA 2XPJA 2HEWF 3WG3A 3A4UA 2ZZQA 3B9IA 1VBD1 1S0GA 2A6WA 2NM1A 3LSDA 4HSJA 3H8RA 3DECA 2VW2A 4GKXA 2X8KA 4R8HA 5DN2A 1WLCA 2YHJA 1Q8PA 4XJAA 3MIBA 5CADA 4F3JA 4U36A 3JQWA 2WAOA 4ORFA 1BBT1 3PUHA 5FYHA 4AE2A 5FZBA 1KJLA 1VBA1 4CTEA 2Z42A 3R4DB 4AAPA 5CBLA 4SBVA 4AI8A 2ZKLA 4Q4X1 2Q4SA 2P6HA 1TVGA 4K8FA 2PN5A 5F3CA 5FUPA 1NCQA 4BCUA 4N8MA 3LKJA 5FZ1A 5LA9A 1POV1 5JZGC 5E6HA 1EPWA 4UFMA 1JYCA 4Y20B 2Q8DA 2CAVA 4OLLA 4N90A 1UIJA 3V65A 4UW5A 4COYA 3UNPA 2XLGA 3LFMA 4CCMA 3LCPA 3U11A 1W6OA 5I8SA 4XQWA 1PGW1 2D3PA 3DF0A 3IT8A 3JXSA 2XLAA 2D3RA 4UOJA 3WDWA 1FMD2 3NQHA 4QU2A 1C5IA 1FPN2 4YW3A 3AZYA 1ZA4A 1QJZA 2ARCA 1UMHA 2IWGB 3TYJA 1QF3A 3DPRC 1SBDA 1BCXA 5I0RA 1D4M3 2E32A 2WWUA 1GOFA 4XDQA 5JI7A 4JC1A 5DMYA 1R091 1P8JA 2R042 4BWOA 4H3WA 1SFPA 3OGRA 1WLDA 1U12A 2RS51 2UYBA 2B8MA 1I1EA 1WBLA 3ILFA 5JCTA 4NIGA 1PX4A 4CRQA 2B45X 1NXD1 2ZZJA 4HONA 5JIAA 1RHI1 3LGRA 4WVMA 4W8JA 1XSRA 1OH4A 2JE7A 3MV11 5FY1A 3ACLA 1RXFA 4E2QA 1LHNA 1CJDA 2ZCWA 4XFIA 4FP3A 1RUC1 4XUTA 3I2IA 5HV4A 4KBZA 2FD8A 1UAIA 4JGZA 3NV1A 4PIZA 1G6NA 2PLV3 1COV1 2E51A 1O3RA 3I3DA 1QU0A 1N1YA 2OQ6A 2ZGSA 3OGSA 1ZRCA 1O7FA 1UY0A 4OQ9A 2DF7A
chains in the Genus database with same CATH topology
2R061 1GZCA 1QQP3 4QPGA 2WA4A 5CAZA 3WCRA 1A8DA 2C5DA 4CYDA 1FAYA 3BPZA 2TUNA 1QJX1 2XJVA 3GBFA 3VDDA 4QPGC 1NY72 1PIV2 4RHV1 1DZQA 3VBUB 5C8WA 5L73A 1XQNA 5FQ0B 1V9U1 3VBOA 4XIOA 1PK6A 2HWD1 5JPMB 3TN92 3THPA 3NAPB 5EV7A 3H1YA 4MXWB 4IV3A 1OFSA 1AHSA 3DKWA 4PDWA 3MLKA 4K3UA 1PK6C 2V09A 4LO7A 4P5HA 1EPZA 1JH5A 4LEJA 2FHRA 2ZX2A 4IL7A 3RQ0A 3WDXA 2OYZA 4IEUA 5L36A 1Z7S3 2ZGNA 4JTOA 1Q5OA 5BXXA 2FBEA 4Q8LA 3RRDA 4FOQA 1NE6A 2MHFA 4QGLA 2HEVF 1X33A 3AMNA 4C91A 3B02A 2R072 1B35B 3VBSB 4AQ6A 1RUI2 3SHRA 5KHJA 5LK5A 4P9GA 2P34A 5GLWA 5K7PA 2DUPA 1JUHA 1S0IA 3WX5A 1LENA 3M1HA 4DMIA 5T55A 4YW4A 1O3SA 2BVBA 1UF2C 3ZDSA 2QUOA 2R0HA 4Y22B 2VPVA 3JQXA 4Z82A 3E5XA 2Q8OA 3JZVA 5JOZA 4LBQA 2A5ZA 2OA2A 2HWE1 1H9PA 2ZHKA 3VBFC 1NYWA 3KMHA 3NV2A 4MZUA 2RMU1 1ZRFA 1Q43A 2WNEA 3VV1A 3ZPYA 1WW4A 2D98A 1S0FA 2W39A 2IC1A 1AR93 3M4FA 3GBWA 1HXS1 4OHXA 2QZ2A 3JB4C 1H2NA 4XETA 2X5IA 3ZXAC 2WC2A 4LBJA 4MYEA 4FOWA 1TNRA 1QJY3 3I8TA 3WUCA 1L3JA 2YYOA 1Y9QA 5E88A 2ZKNA 1GYKA 4XOGA 2X5IC 4TYSA 2QVSB 1UPSA 4QGNA 2O8OA 1OA4A 3S7EA 4KG0A 5E89A 1C8M1 1TMF1 2OIIA 4ITCA 4AGVA 1AR63 1HKDA 4E4ZA 3OJBA 3AYEA 4WV8A 5DDJ2 3WW3A 2YPJA 5E16A 4OUSA 5CB7A 4AK3A 2V5YA 2XKPA 4LBLA 1POV0 1LGCA 1S0JA 2GN3A 4OHZA 5ACA1 3VZLA 1XNCA 3FFQA 5KHGA 2Z2SB 1W39A 1MQTB 4YM0A 1MACA 4B3NA 3W58A 2G4IA 1PVC3 1QJU1 1OMIA 2GU9A 1FXZA 1H2MA 5EXOA 4AQSA 3ETQA 1J1TA 3H50A 5FLJA 2E7QA 2E7TA 3MZHA 4AW7A 4EN9B 4BIFA 5GALA 1VBE3 1RUH3 3PLQA 2LALA 4ZU5A 3B69A 5C4WA 3ZFEA 4WVWA 3PJYA 1F8VA 3ZFGA 3MIEA 1ND2A 1VALA 3I4IA 2JICA 2FZ2A 5C4WC 4JQRA 4FBFA 2W68A 2YGLA 4ISQA 2ZGPA 3T1MA 3T2TA 2WKKA 1O4ZA 1KRIA 4YZ4A 1FOD3 5C8CB 4LNVA 2WT0A 2NMOA 3NWKA 5IK4A 4AVBA 4GALA 5EZWA 1MZ5A 5FAXA 1JN2P 4PQ9A 1YHFA 1WLTA 5AC93 4Y1UA 4FCAA 4W6WA 1LHVA 1UMZA 1ZBE1 3H7YA 3BALA 4I01A 3NVCA 1PM7A 3USSA 4AEKA 4JAAA 3V0BA 2EF6A 2JX9A 3AP5A 4HETA 3N36A 4FAGA 3U0ZA 2EXJA 1VR3A 1S0CA 1XNKA 1NLSA 2A6XA 2ATFA 2RR13 1D4M2 3CL1A 5JOXA 3HQXA 1W6QA 3AP9A 1NLRA 2NYYA 3VZOA 1Q56A 5JZGB 4Z92B 1YNAA 1VP6A 4HKLA 2FMDA 3K48A 5C33A 4DOUA 1VRH3 1VBD3 1AYN2 2VNOA 1UIKA 2HWB1 3WW4A 5J98B 4EN7B 2O0OA 3DPRB 1IKPA 3FBYA 4A3XA 4D7YA 5KXDA 4LBKA 1C1FA 4AVSA 4HZFA 3ZXFA 1JXNA 2Y0OA 1HQNA 4LHLA 2YDEA 1QQP2 4DY3A 4Q4X3 1SLCA 1VLNA 2PHFA 2RM23 2ZHNA 2ZX1A 1LOBA 1LECA 3ZYPA 3SISA 4FSJA 2OVUA 4GB33 2DVAA 4AFBA 1C1LA 3GZUC 4AHZA 3MFCA 1RJ7A 3M3CA 2EVXA 4MGYE 4R4ZA 4JGYA 4CDQA 2VMHA 4PIYA 1V6MA 2VY0A 4KH9A 3GF6A 4MH0E 3U07A 1H9WA 3ZVXA 4JGYC 4INDA 4N9HA 3TB0A 2WZR2 1KJRA 2DURA 3I2DA 1DQ1A 2OW4A 4EWDA 3E6CC 1QXRA 1LEMA 3CEWA 2RS53 2DUQA 4LR4A 2JDZA 4FAHA 1RHI3 1CD3G 3AXEA 1LRHA 1ASJ1 3H3ZA 1RUC3 3WQ0A 1LODA 4IESA 4YSFA 1Z7S2 4CEWA 2E63A 1COV3 5KHIA 2BFUL 1REEA 1CQ9A 1S0BA 3ZSMA 2FMYA 4Y24A 1ZREA 5AFBA 1PK6B 1YO8A 2BTVC 3ZFFC 4NWWA 2A3YA 5T5OA 4CEWC 4CEYC 1XU1A 1ZZ8A 4FXGB 2XJQA 4DRRA 1LGBA 4XHBA 4IEZA 4RHV3 2B9UA 1R081 1BK1A 2D5FA 1ENXA 1X36A 4CDXC 2ET1A 2UWAA 3RYKA 1EV12 2BNMA 4WM7A 1AXKA 1ZZ9A 2XWBB 4S2HA 3ZXLA 1ULDA 3AZXA 1AL0G 4LO5B 4XFHA 5GM0A 1Q8SA 4BE3A 2XWJB 3ZSKA 1ENSA 2TBVA 3AM2A 4G4FA 4PCRA 5J7MA 4OI0A 2A6YA 2I45A 3J9SA 5EFUA 4AEDC 4PBOA 3MIHA 2GC3A 1H1MA 4P9LA 4G9SB 3W9AA 2ZGTA 3OF1A 4HVQA 4BLJA 4XJZA 3JB8A 3QD6A 2YROA 3WZ1A 1AR92 2MPFA 3AFGA 3INAA 1EYBA 1YUDA 4XFGA 2ZABA 5DXDA 4FT8A 1RGSA 2KA3A 1OQDA 1XYNA 4YG0A 4EN8B 1PIV3 4MVTA 3VBFB 1H8TA 2CWMA 3E6DA 2Y38A 1K5MA 4LBQB 3GYDA 4XFAA 4R9AA 3MW4A 1LHWA 1U5ZA 3BOWA 1FV2A 2ZMKA 2R1DA 3TOJA 1DU3D 3N3HA 3PVNA 1AR62 1GNHA 1K5MC 3ZIWA 1MS9A 1BJQA 3JBG2 4COUA 2DVGA 1HLCA 1GFF2 1Q8VA 1QGLA 2XBO1 3LZZA 3R0RA 4O9GA 2X5IB 3R4UA 5FRAA 3ZYRA 4FTBA 3VZJA 4AVTA 4B4QA 5GKAC 1I9RA 1QH7A 1XXNA 3SH4A 3WDUA 1QXJA 1WMFA 4RL7A 2RMU3 2I07B 1EP0A 1W6NA 3B9CA 3EO6A 5T5PA 3MI8A 1PVC2 2BWCA 1ZM1A 4B29A 5I0SA 1MZFA 4MGKE 3KB5A 1BVP1 4D3WA 1PZ9A 3OY8A 4CDUB 3GBGA 1RB8G 5FO8B 2ERFA 2GC1A 4AWDA 1RUI3 2NP0A 5EYYA 5BY5A 1LULA 1RUH2 2JE9A 3VHPA 3RI9A 3AP4A 4KWJA 1YFWA 4UBGA 1W6PB 3MICA 4AI1A 5LRSA 5C9AA 3CU7A 3A0NA 3P3PA 1YLLA 2GSYA 2PELA 5DUUA 3UKVA 3GZTB 5BV6A 4A7ZA 1UKRA 4YARA 4ZU4A 4BH9A 4KGGA 5TSWA 3AMHA 3IKWA 1FOD2 4AFDA 1DQ0A 4XQ4A 2VW0A 3PTYA 1MS3A 2DTWA 3VBHC 5CNAA 2H6CA 4D7SA 4K1ZA 4AHYA 4YFZA 4N43A 5F9TA 5C4WB 1LB2A 4BIOA 1PO21 4XFFA 2RJLA 1QJU3 1YXWA 3BIWE 4IEPA 4WM8A 1QOOA 1LOEA 2PQQA 5DUWA 1OOPB 1DGRN 5JOWA 1RINA 3H0OA 4XPVA 2ZGMA 4Q4V1 5CFCB 4X6QB 2R6QA 4WM8C 1ND3C 2K9ZA 1UD1A 5KHKA 3PHMA 3M2MA 2RR12 3UKNA 2DTYA 2YV8A 3RG0A 4D94A 4DFSA 3AK0A 3BTAA 3EBRA 4FPEA 2XUMA 3OCPA 3PJQA 2AZ5A 4PLMA 2UY9A 3VN4A 3MIGA 3FC0A 1VBD2 4AI0A 5D8AC 4DNYA 5F1RA 1XYPA 5I8YA 4ASLA 2F4PA 1RIRA 4QT6A 4H14A 4I30A 4YG6A 3V64A 1BBT2 1VBA2 1UL9A 4Q4Y1 4Q26A 4ZXKA 1AR71 2UU8A 5JR7B 2Q30A 2W52A 4Q4X2 1OQ1A 1ULGA 1Z78A 2RM22 1SQ4A 3ZN6A 4GKYA 2VVDA 4GB32 1SEFA 2BFUS 3IWZA 1RJ8A 2UY8A 3E5QA 1ZBE3 3OD4A 3ECQA 2VG9A 1S55A 1VBC1 1X8EA 1C57A 1PGW2 2CV6A 3ILRA 3ZIXA 3NO8A 3HT1A 3FJSA 3IM0A 1WGPA 3VHRA 1OQEA 4SLIA 4HT1T 2EA7A 2DVFA 5FTTC 2JECA 4CDWA 1R092 3UJQA 1RUE1 2ARXA 2QDRA 1NCRA 1KS4A 1DZTA 4Q0VA 4RGGA 2RS52 2XH6A 1OPMA 4A7KA 1MZEA 5I91A 4EROA 4YZ1A 1HRV1 1TE1B 1RHI2 3M8LA 4UW4A 4CDWC 3OBTA 5JOYA 4WZCA 4GQ7A 1RUC2 4JGYB 4HK8A 4YVWA 3CF6E 2D6OX 3H1WA 1COV2 4L99A 3PMSA 3WHTA 3UL2A 1O5LA 4NHKA 4YVWC 4AG4A 1QKQA 2HKXA 5FOBB 1LOGA 1YWKA 1S2KA 2ZGUA 3Q9OA 4JVAA 1ZBA3 1QJX2 4E27A 1VIWB 4J6GA 4I3GA 2H6BA 1NCQC 4RHV2 1AF9A 2CGOA 3ZYJB 1I6XA 3FWEA 1IS6A 1JYIA 5D1IA 2A73B 1V9U2 2JKBA 2WWSA 1HQLA 3ZFFB 2HWD2 2QE3A 3LWCA 1QNWA 4CEWB 1PO11 5BNOB 1W0OA 5GLZA 3AZVA 1Q3EA 3VHNA 2GC0A 4AEMA 4CEYB 4A7YA 4C1XA 4XYXA 2QDNA 3J26N 1LKNA 3I54A 5GLTA 3VKOA 2DCYA 1RITA 1AYN3 1D2SA 1H1AA 4QPIA 1RVF3 4CDXB 2C9AA 1CAUB 1ASJ3 1OD5A 3AX4A 5CVRA 4EJRA 4Y1XA 2ZJCA 1RMU1 1O4YA 4JDNA 3WD5A 1U0AA 4NR1A 3HIFA 5HCAA 4IEYA 5KC5A 4JGZC 3JD71 3POSA 4GH4A 1NE4A 2XJPA 4GMP0 2ZHMA 4AEDB 5J96B 4OI2A 3H1MA 4M3CF 2OZ6A 2A6VA 3KSCA 5K0UA 4DRVA 4N7UA 4HPKA 4AFCA 4AQ2A 3ZXDA 1DGRA 3FUOA 1LJ7A 4HFSA 1YIPA 1D0GA 5FO7B 3VDDC 4COVA 2BWAA 2WZR3 3FMGA 4R4XA 3RYRA 4HSLA 1AX2A 4AHXA 1CIWA 1DQ4A 1J1LA 3VBOC 1VAKA 3UV9A 1SACA 1BVVA 2ETEA 3SLIA 2WT1A 3O5SA 4IV3C 1FMD1 2GNBA 2PTMA 4PDWC 1GZWA 1C3HA 1G9AA 2HJIA 2HWE2 3WP3A 2GALA 5JMCA 2CGNA 5GZFA 4Q27A 2RMU2 1BKZA 4I09A 1GSLA 4E9KA 4YZ3A 1K5MB 1XNDA 1UW8A 4HKWA 4Q4W1 5ABJA 3IDCB 3BB6A 3THTA 3AMMA 1AL21 5KHHA 3L2HA 5HXVA 1AYM1 4DXZA 4QQ2A 4YGBA 3QCWA 5ABJC 1DQ5A 3L9JT 3L2YA 4K6BA 2XVLA 2MEV1 4RS5A 2BUKA 3TRSB 2IXJA 2XG3A 1EV13 2ZPXA 4KWLA 1H2LA 1DG6A 1NXMA 5DZFA 2PHWA 3N35A 3MW3A 1C8M2 3RMYA 5T5JA 4AGGA 4HKOA 1UKGA 2XJUA 4B7EA 5KXBA 1AXZA 2BVVA 1JOJA 2GAUA 1MR5A 3VBRA 1CESA 4N9IA 1YI7A 2XBO3 2RS11 2WFF1 1AJOA 1RTVA 3OYWA 4XF4A 2PHDA 1DLLA 2R30A 1REDA 2A71A 5E8AA 4IEXA 3JUUA 5I0TA 3MFAA 2VVFA 3VBRC 3D6EA 2WZPP 4BMEA 2R49A 1MEC1 2AR6A 1FX5A 3G6JB 1H4GA 1SFYA 1QJU2 3C2UA 1JHNA 2VUAA 5KXEA 4YVSA 1Y7BA 5L7OA 1N47A 2C0ZA 3VBHB 2WFPA 3K51A 2GH8A 5EJ3A 5L7OC 4OHWA 3NKTA 1CGPA 2EALA 1N3PA 3CJIA 1VB2A 4H7LA 1SBFA 1VBB1 2WQZC 4NN0A 2Q1MA 3USUA 2EXKA 2OUHA 3JBG3 1KDKA 3ALQA 2PAMA 5CA6A 4YNIA 2R071 3WDVA 4NWVA 5FPXA 4WM8B 5J3UA 3NV4A 1ND3B 3IN9A 5FFOC 1WW6A 2D6NA 5FDBA 2CYFA 4BYYA 3ILNA 2R0FA 4G3YC 3WDYA 3PMEA 4IV1A 4L8QA 4KBBA 1CAWA 1UN1A 2ENRA 4LHNA 2PAKA 2IXHA 1OKQA 1PO23 1BQPA 5D8AB 4MGIE 3OGGA 1ZBE2 1PGSA 3ZMOA 2FQPA 2WINB 1X7NA 3J8F1 3KT7A 4XTPA 5A33A 3LOBA 2WNVA 1H1IA 3JCIA 4LUMA 4IXLA 4XZPA 3I59A 4AI2A 4UBHA 1ENRA 5DG1A 4XQDA 1I3HA 4FOYA 1PZ8A 3S30A 1JUIA 3B01A 4LUKA 4JDOA 2WNVC 5E1RA 1S0DA 4Y1ZA 3ZFEC 1O5UA 4KG8A 5T3NA 2B7YA 1H8VA 3ZFGC 1RUG1 4IEWA 1NOVA 2BGCA 1HV0A 1ND2C 2HWC1 1O3TA 3EJKA 2GNDA 1PVXA 3KT1A 3WOGA 4FO9A 1CX4A 1F31A 2JD4A 3M3EA 4V1PA 3VGIA 3AP6A 3ASIA 1UPIA 5GJ6A 3SCFA 4NHMA 1AR73 1UU4A 2JG9A 3J4UH 5DDJ1 3SCHA 3ELNA 4K20A 2JJ6A 1IHMA 4FQZA 2HWF1 5KXCA 1W6MA 1NA1A 2ES3A 4CDWB 4AYUA 5HCFA 5FLHA 4P9XA 3URFA 2D6LX 1ZBA2 2JG9C 4BPZA 1TME1 1GQHA 1IOAA 1UU6A 2Z5WA 5AVPA 1CVNA 5H9RA 2R32A 1NA1C 1KITA 2ZGKA 2VW1A 2ZMNA 4M00A 4QXKA 4YVWB 4D7TA 2O8QA 4KL1A 3TNPB 3V56A 1QXPA 5BNQA 1O3QA 2VQ0A 1LU2A 1RUE3 3RPQA 1NCQB 1WW7A 2WLPA 2QZ3A 1EY2A 1X8MA 1AUYA 1KFUL 1BMV1 1RVF2 2D3SA 2XB6C 1ASJ2 4XTMA 1J3RA 1W6OB 1BBT3 1N3OA 2D7FA 1D2QA 4XJ9A 5SV8A 1H30A 3ZYGA 4Y5Z0 1VBA3 4GULA 1RUJ1 1CAVA 4AHWA 2AYHA 1BEV1 1D0HA 1NQDA 4MXVA 3N4MA 4FQ4A 5L19A 3PNAA 4WVZA 2ZTNA 4ES8A 3I7DA 1POV3 4KNCA 4O9EA 2JG8A 2ZGLA 3RJRA 2SBAA 4WVMB 3U4XA 1R082 1O91A 5F6KA 4JGZB 1KFXL 2JG8C 4OZXA 4CDQC 2EIGA 4Q1RA 1RL3A 5BNNA 1R093 2WT2A 1PO13 4AVCA 3D0SA 5GZEA 3AYDA 2JENA 1GNZA 3NKGA 4QPGB 3R05A 2D97A 4LO4B 3FLTA 1WUVA 4Z8BA 4P9JA 5BNNC 3BU7A 2VOKA 1MS8A 3VDDB 3N7JA 3M70A 2I2SA 1PNFA 4LTAA 4IETA 5HI0A 3B93A 1J59A 4I0AA 3LA3A 1PGL1 3VBOB 5EWSA 2R063 1QDOA 4XMIA 2YC0A 5FMOL 4JCKA 3G7DA 2W08A 3JD73 1BXHA 4IV3B 2OPKA 5CFDA 2ZGRA 4PDWB 4FP2A 2CL2A 2Q5TA 4Y1YA 1QJX3 2JXAA 2PLV1 2BNNA 1IS4A 5T52A 2PHTA 5CFDC 3ME2A 4K9SA 1V9U3 3HWJA 5J48A 2HWD3 2TNFA 4Z2WA 4B7KA 3EQEA 1H0BA 2VUJA 4YLZA 2C1FA 3V0AA 3VZMA 1IGOA 1A8MA 4WM7C 3VZNA 2W0XA 2XL7A 2VOVA 3ZXKA 2XBO2 2ZGOA 2YZ4A 2WL1A 1B09A 4MLOA 4C90A 4W6YA 3MF6A 4GA9A 1F9KA 1W0PA 3FUQA 4XW3A 4N53A 1ZZ7A 2DCZA 2AH2A 3DGTA 3AKRA 3MPPG 3NSTA 1ZZCA 1FNYA 3VBUA 2VMGA 5FQ0A 1ULEA 4N53C 3LB9A 4EN6B 2NZ9A 3VBRB 3FX3A 1IPKA 2D40A 1REFA 3DV8A 1GKBA 1QDCA 3DUIA 3NAPA 4H7MA 4QQOA 2RE9A 4DB5A 2H0BA 2CY6A 4XJWA 4C1WA 2VULA 1XRUA 3VUOA 1H8TC 4DZGA 4WZFA 3IIAA 4XF9A 1RUD1 1URXA 4BZ4A 1CJPA 3SCGA 1CAXA 4HLTA 4JTNA 4XE9A 2P3IA 4RFT0 4Q0SA 1U5XA 2RS13 2XVKA 2LM3A 2UYAA 2WS91 2YMZA 3WW2A 2HWE3 4M3CA 1HRI1 2DFBA 3FHIB 3ZX7A 3KGZA 2QJVA 2NMNA 4CP2A 1FYUA 1CR7A 4AXOA 3RSJA 2VQAA 1XYOA 1PO22 4F7ZA 4QMAA 1HXS3 2ZGQA 3VBSA 4LBQD 4YZ5A 1VAVA 4PBPA 3D4KA 3AKSA 2PFWA 3S7IA 4BLIA 1PZ7A 2D43A 1J58A 4J1XA 4K21A 1EAH1 4IERA 1DF0A 2A75A 4Q4V2 3ZMNA 1QNYA 2CTVA 3HT2A 2YY1A 1WBFA 2NPIA 1PMIA 1BYHA 1DQ6A 4GMP1 4DPNA 1WCSA 5HBAA 4Y22A 4S2FA 1C8M3 1TMF3 1DYKA 1U5IA 2UWCA 3D82A 4M3CE 1CAWB 4H55A 1QJY1 1UZYA 1YJKA 2ZX0A 3AXDA 3O0XA 2GH2A 3ZYIB 1ULFA 5C9AC 4YGEA 1AR81 4R9CA 1GBGA 3O12A 1OHFA 5ACA3 2D6MA 4UW3A 3EHKA 2DVBA 5BUVA 1AR61 3VL9A 3ENRA 1AR72 4IQPA 2XKOA 3WCSA 3ZFEB 5DZEA 4IEOA 3KZ4C 3ZFGB 2A6ZA 2PYTA 2VXRA 1ND2B 3QBQA 3B94A 4NPRA 3VKNA 1DYPA 1OA2A 4DY5A 2ET7A 4N43C 2PHUA 4X8PA 4ATEA 4M0NA 4YW2A 1G9DA 2R1BA 3MLJA 4LULA 1YFYA 1VBC2 4Y4YA 4Y26A 1LOAA 4W6XA 1ZZ6A 2GZWA 3BCWA 3OD0A 4OI4A 1LGNA 2B46X 1FI2A 4YYOA 2VGDA 4E4SA 2ZA9A 4FPHA 2D5HA 3DL3A 1SCSA 2A7AA 1C8NA 2HYKA 3O0VA 1RUE2 2JG9B 2XJTA 3SXWA 4E2SA 2LTNA 5KWRA 2PHXA 4LO8A 3WW1A 1MQTA 1RUG3 1DGLA 1TQ5A 1NA1B 1HRV2 1VBE1 1X50A 1W6MB 4QM9A 2VNRA 2ZS6B 1KD7A 2O1QA 4ISRA 1JTZX 3V0BB 1VB4A 1YFUA 1LHUA 1DQ2A 1RUF1 3M7AA 4ZKTB 1R1A1 3WHUA 4FPYA 1V6OA 1W6QB 1LEDA 2D93A 3WLUA 2GNTA 1UU5A 2HWF3 1SBEA 2QKDA 1ONAA 4J1WA 1DGWA 3UKTA 4A2UA 5FMOS 2P17A 2A70A 4CP0A 1TME3 5K8SA 3ZSLA 2AREA 1JW6A 4Q0PA 4AVAA 4TLFA 4BA6A 1O4TA 5AC91 3SMHA 4FXKB 4QQLA 5CG8A 1PO12 3LA2A 1CN1A 4LE3A 3GHNA 2ZX3A 4YW1A 4YRDA 1WCDJ 2HWB3 4RD7A 2B39A 1NCRC 2OZJA 3AKPA 2JG8B 4CDQB 4XJUA 1Y43B 1FNZA 3ZN5A 3NV3A 1HV1A 1YIFA 4XFBA 1RMU2 2JEMA 5J36A 4HVOA 1RUNA 3R6SA 2R062 1BEV3 1V70A 1SLIA 1VRH1 2DWRA 3JD72 3S0MA 3RS6A 5BNNB 2EAAA 5B2GB 2ZACA 5LRRA 4L97A 1WCKA 1HX6A 2RS31 3D8CA 5CIRA 3KM5A 5J37A 1LOFA 4PJYA 5FOJB 3CO2A 2D6PA 4Z07A 4HMZA 1IS5A 5JZGA 1LESA 1AVBA 1V6IA 2X29A 5FO9B 3FLRA 2RM21 3QOPA 1LOFC 3KCXA 1SDWA 4GB31 1DBNA 1ZYBA 1J3PA 2YGMA 3WY6A 4PIXA 2EAKA 4OVEA 3ES4A 3AFKA 4FPJA 3RWNA 1DIWA 2KM2A 3DPRA 2GMPA 2E9QA 4BQ1A 1TEIA 1KQRA 2ZOEB 3C3VA 1X82A 4BMBA 5CFDB 2R16A 1S1AA 3POYA 5DG2A 2WNUA 1QY4A 1DDLA 4QPIC 1YJLA 4Q4W2 4WM7B 2VMIA 1AL22 5LK7B 3LOIA 4JDMA 1AYM2 2WNUC 3AJZA 3RYPA 1ZVFA 4LHKA 3SITA 3WP4A 3V0AB 4AVVA 4HN1A 4GH4C 1SCRA 1M06G 1WA4A 3H7JA 1AX0A 4YFWA 2VOWA 1R083 2MEV2 5CU1A 1GV9A 4AGRA 5K0UC 2TEPA 2D6KA 4GWMA 1QMJA 4I0BA 4XMAA 1CPNA 5GZDA 3WG2A 4B8EA 5IT6A 1WD4A 4N53B 4F83A 5JSRA 3ZSJA 4GWNA 2BPA2 1KXGA 2RS12 1FPN1 2WFF2 4QHBA 1LR5A 4DQAA 3CJXA 2Z69A 5GLUA 4F8AA 1H8TB 3M3QA 4ES9A 3M3IA 2R041 4E2GA 3E5UA 3AMQA 4L92A 2ILMA 2DCKA 3SH5A 3B00A 5JPNB 4QX5A 1WMDA 3E97A 1MEC2 5BYNA 3W59A 3POWA 4EV0A 1SMVA 3AP7A 1HXS2 2BYVE 5BNPA 2WLQA 2ZAHA 4IEVA 2CGPA 4XEZA 3IMNA 1CAXB 1S0EA 5BNPC 4B4RA 1RC6A 5JSPA 4XXPA 4L9BA 4M3CB 2QNKA 1TMF2 4NVPA 3QLQA 4RS5C 2XGXA 1IPJA 2GDFA 1VBB2 4X8NA 4XIKA 1W6NB 1RUD3 4XFCA 2DV9A 1NY71 1PIV1 4OI1A 1XU2A 2WJSA 3HBZA 4R9DA 1A3KA 1C28A 1APNA 1BZWA 4ASMB 1MS4A 3OY8B 3HR9A 3MW2A 5ACA2 2CWSA 2WS93 3TN91 3WXPA 2P3KA 1HRI3 3SNMA 3AZWA 4AI3A 1HQWA 4S2DA 5DUVA 2E7AA 2NN8A 2YUEA 3R4SA 1SLAA 1W2UA 1ZRRA 4DINB 5JWPA 2ZHLA 1ZRDA 4GXLA 3VBFA 4AF9A 5C9AB 2QQPA 2A3XA 5I93A 3LSEA 5T54A 2BBVA 1Q8QA 3VKFC 1YYNA 3AKQA 4LLFA 2HEYF 2B42B 3J8F2 4PLNA 3MLLA 1EAH3 2XHKA 2KXLA 3AZZA 4LBMA 1M4WA 4YVSC 3RMXA 1MVEA 2WQ4A 1HW5A 1ZZBA 3OBRA 3T1LA 3MYXA 1CONA 1LU1A 4GMP3 1XNBA 5DZGA 3IDBB 2VNGA 3MIFA 1QWRA 4WVVA 3RDIA 4N43B 1GLHA 2DU0A 4COWA 5IK5A 3CJIC 4BOWA 1RUI1 1AZDA 2B5HA 2E53A 2WSVA 1LHOA 3KQRA 1RUG2 4RSUA 2HWC2 2Q0AA 4I3PA 1AR83 4RR3A 1H2KA 5F6LB 1FV3A 1F5FA 2MNGA 4QPYA 5CG9A 1SLBA 1C5HA 5AVAA 3WNXA 1TNFA 4QD2A 4NOTA 4RR3C 1T6GC 2ZX4A 2H0VA 4CDUA 1GICA 2BNOA 3PVEA 4R9BA 2DCTA 1HIXA 3O14A 2HWF2 4KU8A 4IV1C 1MS0A 4Q8KA 1QHDA 1WW5A 2Y26A 3A0KA 4AQTA 5GZGA 4Q4V3 4CDUC 4YGDA 1YFXA 1W6PA 1TME2 5A32A 1F2NA 3VZKA 1NZCA 3WP6A 4FVVA 5HCBA 4OULA 3BODA 3CLPA 5GLVA 1PHMA 3MGUA 3OGJA 5FLIA 3MDPA 4AEJA 1IS3A 5J09A 3N7MA 1GQGA 3VL8A 1FATA 5IUQA 3ZN6B 2F6BA 5JAXA 1SLLA 1DFQA 2HWB2 1BMV2 1XE8A 4QGMA 4I2OA 3RI8A 2VU9A 4XJ8A 3QH6A 4FPLA 2IXCA 2ARBA 1V6KA 4P9WA 3D0JA 3AKTA 4Q4Y3 1RUJ2 3UK9A 1BEV2 1RUF3 1OOPA 1S2BA 3WG1A 1WLWA 1R1A3 5CFCA 5KBFA 4Q1PA 1IKQA 4QQPA 5FCCA 2NQYA 3AMPA 3OTFA 1NCRB 4NO4A 1OOPC 3KLSA 4JRLA 1VBC3 1SLTA 3MPBA <