1Q8OA

Pterocartpus angolensis lectin pal in complex with the dimmanoside man(alpha1-2)man
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin
publication title Structural Basis of Oligomannose Recognition by the Pterocarpus angolensis Seed Lectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 53
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q8oA00
1PZ9A 3WZ1A 4YGBA 3OY8A 4XBNA 1CONA 1OKQA 4AYUA 1LOGA 1G9BA 1VAVA 4M01A 4WV8A 1N3QA 1G9AA 4YM0A 3OBRA 1WD3A 4F83A 1Z0HA 2EXKA 5T5JA 2R1DA 3SLIA 3AYDA 1V00A 2Q5TA 3W58A 1O4YA 4GWNA 4XHBA 1WBFA 5E8AA 2V73A 3V64A 5KXEA 4FPHA 2ARXA 1MVEA 3WCSA 4YFWA 4FPCA 5H9PA 1ENQA 3WDWA 1HQLA 1UPSA 4FOYA 4FPFA 1YI7A 3VKFC 5GJ6A 2ZHLA 3VKOA 4DRVA 1LEDA 5JDBA 4GA9A 4Y22B 4AVSA 2WKKA 1MZ6A 1FX5A 1LOCA 2ZAAA 1G8WA 4BLIA 2C9AA 2R0HA 1AX1A 4D69A 1WCSA 1CJPA 2DVDA 4XE9A 4YG3A 2DUQA 1KDMA 5KXBA 3WHTA 2AR6A 1QNWA 4FQZA 4LBQD 3PMEA 4FP2A 1CN1A 2DWRA 4DS0A 1U0AA 5EYYA 3WOGA 1SBEA 5DG1A 3FUOA 1WLWA 2NM1A 1LODA 2E53A 4DRRA 2GNMA 1LOFA 1LHWA 5DUXA 1GZ9A 3RMYA 3VV1A 3SH4A 1N1YA 2D3RA 4M00A 4P14A 4YZ3A 2DVFA 3AP5A 1APNA 4LBQA 3NWKA 1ONAA 5T5OA 3RSJA 5F9TA 1N1SA 1G9FA 2JD4A 4XTMA 4ATEA 5JOWA 3VUOA 3SH5A 2GDFA 2NMOA 1CIWA 1DQ0A 1AX0A 5DUVA 2D6MA 3OY8B 4ATFA 4CTEA 4ZKTB 4Y24A 1S0CA 3OGGA 2ZABA 2ZMLA 5GZGA 5JOYA 2E6VA 4BPZA 1MACA 1V6OA 3WDYA 3RG0A 2DVBA 4XTPA 4UW6A 1DQ1A 1QU0A 3ZXLA 3KQRA 1WW5A 5GLZA 1LECA 1LCLA 3BIWE 2ZGLA 3ZSJA 4U2AA 2GMEA 2EXHA 4ISRA 2P2KA 5T50A 1V6NA 2A6YA 1KJLA 4AVVA 1G9DA 3N7JA 3ZVXA 3MPPG 1AX2A 2D7FA 2BQPA 3M3CA 4GKYA 5T54A 1MS0A 2A6VA 1O4ZA 4YW3A 1QOOA 3POSA 1JYCA 2AYHA 3BODA 1QF3A 3AX4A 5CBLA 2OW4A 1W6PA 4UW4A 1SLIA 2VW0A 2DVGA 2VH9A 2ZGOA 1A8DA 5T5LA 1LENA 2ZMNA 1ULFA 2DV9A 1VALA 1BZWA 4ITCA 5JOZA 1W0PA 4YM3A 3ASIA 2NP0A 2EXJA 1DZQA 2DYCA 4K1YA 2D44A 1JUIA 3PVEA 3WG3A 3VKMA 4YFZA 1DQ2A 2P3KA 2CTVA 2WT1A 2PHTA 1V6JA 3O0XA 5BYNA 3N36A 1UKGA 3HN1A 3VKNA 2E7QA 3I4IA 3HMYA 1DIWA 2DU1A 1MS1A 2WSUA 2ZGRA 4I30A 1ULEA 1Q8PA 4R9BA 4HL0A 4XIOA 2R16A 1DHKB 4FPJA 4LBQB 1PZ7A 5HCBA 2GMMA 4BQ1A 4BMBA 1MZ5A 4WVWA 4Q2FA 2ZGNA 3LSEA 2A75A 5IK7A 3B3QE 4XILA 2ZGQA 4YM1A 4Y26A 4LBOA 1IKPA 2ZGSA 4FPLA 1VIWB 2ZGUA 3OPZA 1HDKA 2A6ZA 2ZHNA 4GKXA 2VW2A 3FFZA 1UMZA 4XJ9A 4YG6A 3RQ0A 2Z42A 1S0EA 2A3XA 2NYYA 4BM8A 5JVVA 1ZM1A 3T1MA 5IK5A 2VXRA 1GICA 3Q9OA 4FP3A 4XJAA 3R4UA 3T2TA 4XYXA 1BKZA 4PBOA 3B00A 2A5ZA 1SBFA 3T1LA 1MS5A 2PHXA 3B69A 1N1VA 2ZGTA 2RHPA 2R49A 2YV8A 4H55A 2UURA 2VUAA 3OYWA 4XDQA 1RIRA 1MS8A 2AH2A 3UJQA 1Q8SA 1UZYA 1J1TA 1W6PB 1YYNA 2W68A 1V6IA 4FOVA 4Q27A 4C1XA 1CVNA 1N3OA 2D3SA 2B7YA 1G7YA 4RL7A 3V65A 2AGSA 2D6NA 2DURA 3NV3A 3PVOA 3DGTA 3M1HA 4JRAA 1S0GA 3AXEA 3ZXJA 1LULA 1W6QA 5IK4A 2XG3A 1SFYA 5T52A 3A0KA 1KDKA 3HR9A 4YZ4A 3WDTA 2R1BA 2EIGA 4RA0A 1RITA 5IT6A 1C1LA 3AZZA 2OUHA 4XXPA 1D2SA 5EXOA 1W6MB 1WW7A 1DQ5A 4YW4A 3QLQA 1AJKA 1KJRA 1LGNA 2P34A 1VLNA 2WJSA 1W0OA 1W6NA 3ILFA 1C1FA 1YIFA 2V5YA 3ZSMA 1QMJA 4L8QA 1TEIA 3IPVA 5E88A 4Y1YA 1DQ6A 2W52A 4DPNA 1DLLA 3ZXEA 3ZYRA 4XHXA 1QDOA 1AZDA 1ULCA 2ZACA 3MEPA 1ZA4A 3AP6A 4BOWA 2H0BA 2DUOA 2GMPA 2NMNA 2ZHKA 3AZXA 1LGBA 1A3KA 4XBQA 3ZXKA 4XBLA 2EF6A 1CESA 4FOWA 5CAZA 1G9CA 5HCFA 1MS9A 1YO8A 1FNYA 1WLDA 2ZHMA 3POYA 4K1ZA 1DYPA 1G86A 1QNYA 2NZ9A 1GZWA 1BJQA 5HCAA 2P37A 2ZA9A 4FOQA 5DZFA 3BTAA 3UL2A 1QKQA 2ZBJA 3OYWB 3WCRA 1QDCA 5DXDA 2YXSA 5IK8A 1ENSA 2CY6A 1LHUA 1NXD1 3U4XA 4Q1RA 1UX6A 2UWAA 2FMDA 3MW2A 3D6EA 5LK5A 3R05A 4FPYA 4P9YA 1W6QB 3WNXA 2D3PA 1SBDA 3GALA 3FLRA 2A3WA 2LALA 4R9AA 1NLSA 1URXA 3SH3A 2EXIA 1LESA 1GYKA 5GZFA 5FREA 3O0WA 2EAKA 2A6WA 1H9WA 4FQ4A 1R1ZA 1SLTA 3AZWA 4LBMA 1UN1A 4HANA 1EPWA 5FRAA 4K21A 2C5DA 3AYCA 1IS5A 2WNEA 3NV2A 1GKBA 1W6NB 1WLCA 3DUIA 4Y1ZA 3WDVA 4W65A 1LTEA 3O5SA 2GN3A 3SISA 2JJ6A 1S0DA 1B09A 3IPVB 3AZYA 4XMAA 1SACA 4XOGA 2SBAA 4AVTA 2WT0A 3W59A 1OQ1A 4R9DA 2A70A 3WG4A 1ULDA 3PJQA 3B01A 2GNBA 1MR5A 3N7KA 1WW4A 4LBLA 4R9CA 2ZGPA 1W6MA 4UW3A 4YW1A 2NN8A 5JMCA 3D4KA 2PHUA 3WV6A 1FV3A 4FPKA 1CPMA 3USUA 1DGLA 5DZGA 1A78A 1SLBA 2DU0A 3ILRA 1GNZA 1C4RA 4C1WA 1SCRA 2ES3A 2JECA 4WZFA 2P3JA 3V0AA 1IS6A 3N35A 4FPGA 3PVNA 4Q1PA 1GNHA 4XJWA 4TYSA 3ZPYA 4CZSA 2XB6C 4NOTA 4P9WA 1GZWB 2CWSA 3RS6A 1S0IA 2EALA 2WLQA 1UAIA 2R0FA 4Y1VA 1N47A 5T5PA 5EYXA 2VW1A 3TAYA 4YZ2A 2JE7A 4XXAA 4ZXKA 4YGDA 4AGVA 1DBNA 1SLCA 2I2SA 4XJZA 4K20A 4YGEA 2VY0A 3FLPA 4YW5A 3WDXA 4TZDA 3CNAA 1YXWA 3QCWA 1I1EA 1BQPA 5GALA 1DQ4A 1LEMA 4YLZA 3M2MA 3TB0A 5GZEA 4XJUA 4YG0A 1GANA 5DUWA 2D43A 1KQRA 2GNTA 5F5QA 1V6MA 4Y1UA 1PZ8A 3M3EA 4ISQA 4M3CA 2D6OX 4MYEA 2JDZA 2A3YA 4Y20A 5H9QA 4SLIA 3I8TA 3AYAA 1LOBA 5JLVA 3RRDA 4M3CF 5GZCA 1S1AA 3H0OA 5E89A 1V6KA 4LBJA 2DTWA 1LU2A 1CR7A 3IKWA 3NV4A 4YM2A 3A0NA 1WBLA 3WG2A 1AXZA 2PHFA 4AGRA 2KM2A 2UWCA 4Q8LA 3WHUA 3LCPA 2CWMA 5JOXA 2W08A 3AXDA 3IM0A 2WT2A 4XJ8A 2YZ4A 3WLUA 2ERFA 3B9CA 3USUB 1VAMA 3AYEA 1F5FA 5GM0A 4U36A 1MVQA 1GV9A 3GNEA 1SLLA 1QOTA 5EWSA 3V0AB 1LGCA 3ENRA 2SLIA 2A71A 4XZPA 3OJBA 1FV2A 2YY1A 5DZEA 1DFQA 4Y1XA 5H9RA 2CNAA 2UU8A 1WW6A 2G4IA 3ATGA 4GALA 1H30A 4GXLA 4LBKA 1IS4A 1KITA 4Q26A 2P3IA 4BLJA 4Q8KA 2HYKA 1FNZA 1GZCA 4P9XA 4PBPA 4YW2A 1FAYA 4YGCA 1JN2P 1X50A 4DFSA 1GBGA 4CRQA 3M3QA 1W6OA 4UW5A 3AP9A 1AVBA 5GZDA 1AJOA 3ILNA 3V0BA 1OFSA 3A4UA 4PQ9A 1JXNA 1BXHA 1LHOA 1XQNA 3INAA 3UJOA 5DG2A 2ZZJA 3BOPA 2WQZC 2TEPA 2YROA 3ZSLA 2D6KA 1LOEA 1GSLA 1WUVA 1MS3A 1MS4A 3UK9A 1HQWA 2D6PA 5AVAA 3RMXA 3NV1A 5L73A 2OUJA 3O12A 4WVVA 4M3CB 2GN7A 2A7AA 4Y20B 2AREA 4FPEA 1AXYA 4ASMB 3ZYPA 5DUUA 2E51A 1F9KA 2D6LX 2W39A 2DTYA 5CA6A 1LJ7A 4KBBA 5KXDA 3IN9A 3WG1A 4XIKA 1JYIA 1N3PA 1Q8VA 2A6XA 3AP7A 4JC1A 3ZXFA 1DYKA 1LOFC 1V6LA 3KM5A 1YRZA 1QGLA 1S0FA 2FHRA 3N3HA 2ZMKA 1ULGA 4NO4A 3AK0A 1HKDA 3L2YA 2GALA 1JW6A 1FYUA 2LTNA 4XMIA 4Z8BA 2E7TA 3AJZA 5GLUA 1H9PA 2GNDA 1IS3A 3IMNA 3WUDA 4YZ5A 1C57A 2PHRA 4FPOB 2DVAA 1CQ9A 2VU9A 1SCSA 5GLWA 1IKQA 3N7LA 4IQPA 1Q8QA 3LSDA 1WD4A 1I3HA 1HLCA 2AENA 1UL9A 1Z78A 1BYHA 4AWDA 1AF9A 2CYFA 4OZXA 3M3OA 4PF5A 1IOAA 1KRIA 3AZVA 3MW4A 1D0HA 5KXCA 5SV8A 1GLHA 4LBNA 1LHNA 2WSVA 2DUPA 2ZKNA 1W6OB 2CL2A 3FLTA 3V0BB 2JKBA 3JU9A 5CNAA 1ENRA 2ZGKA 1QOSA 3D5OA 1S0BA 2UWBA 3APBA 3MW3A 1SLAA 2ARBA 3AJYA 3FUQA 2YMZA 4AGGA 1N1TA 1Q8OA 5GLTA 1S0JA 3WUCA 1RINA 3ZSKA 4Y22A 2PHWA 3N7MA 2JE9A 1UZZA 3WVJA 2OVUA 4JCKA 1LHVA 3SITA 1JOJA 3SNMA 3AP4A 1JBCA 3VKLA 1FATA 5GLVA 2PELA 1CPNA 4PCRA 3AFKA 4M3CE 3O0VA 5IUQA 5CB7A 5T55A 3POWA 2ZGMA 3R4SA 1LU1A 2ENRA 3FBYA 3OBTA 1LOAA 1AXKA 1JHNA 4FVVA 1Q56A 3JUUA 3C2UA 4GWMA 3WDUA 4DQAA 1Y7BA 4BMEA 5H9SA 2AUYA 4YZ1A 1F31A
chains in the Genus database with same CATH superfamily
2GZWA 2OPWA 3CBNA 4YGBA 4XBNA 1O4TA 2BNNA 3THCA 4HK8A 1G9BA 3EBRA 2JB4A 1QQP2 3HBZA 5FUIA 3U14A 3OBRA 1WD3A 3H3UA 3U78A 5C8WA 2F6BA 1RUC2 1V9U1 3MICA 1KS4A 5A1LA 1R093 3DXTA 5LBFA 2BEOA 2WZR3 4WBBA 4GULA 4XHBA 1WBFA 4LNVA 2V73A 5BUVA 3V64A 3G6JB 1UY0A 4RQPB 3QH6A 2VE1A 5KBFA 3WQBA 3WCSA 3JBG1 4YFWA 3ZYGA 1XNKA 1VJ2A 2Y33A 4CEYB 1MEC1 5FZ6A 3GBWA 2QZ3A 1YI7A 4I01A 1RMU1 1LEDA 4UFMA 4XURA 4Y22B 2GC2A 4AQSA 1TME2 4NPMA 3OGJA 1AX1A 3KT4A 3TNQA 1CJPA 4CDXA 5C4WC 3VBHC 4NRPA 1ND3C 3WHTA 5EIYB 2Y6HA 5J98B 2VZ1A 3VL8A 4FQZA 4HKOA 3P5BA 3AMPA 5LRSA 1K5MC 2JD9A 1ND2B 1SBEA 2TUNA 4IEOA 4UBGA 5DG1A 2ZEWA 1NAEA 2NM1A 2ATFA 1LODA 2Y6GA 2VMCA 3GCXA 4IEUA 4P5YA 4KWJA 3F95A 1FPN1 4MXWA 5D8AC 2D40A 5FPBA 3VV1A 1IQDC 4DIQA 1N1YA 4YZ3A 4BK4A 3JB8A 2DVFA 1XU2A 5FYUA 4HN1A 5LA9A 4AE2A 3NWKA 1ONAA 1BBT3 1XNAA 4PF1A 4FAGA 3TEWA 1N1SA 1G9FA 2JD4A 4ATEA 3LFIA 4IEYA 4Y5SA 1KD7A 3VUOA 1S2KA 2GDFA 1PIV2 4R4ZA 2E26A 2XVLA 1REFA 1DQ0A 5FPVA 4ARYA 5DAVA 5EJ1B 1RUI3 1VBC2 2D6MA 5IVFA 4CTEA 4HBNA 1EYBA 4Y24A 4KG0A 2WQ8A 3OUHA 5JMOA 4AEMA 4RFRB 1L3JA 1MACA 4XTPA 4UW6A 3B9IA 3R6SA 2VZUA 3KQRA 2IXCA 4MLOA 1WW5A 1W2TA 2VNOA 2DCZA 4U2AA 2GMEA 1NKGA 1CAWA 1UY3A 1FPN3 1D4M1 2QDNA 4JTNA 4CU7A 3BYWA 4I0WB 2A73B 5FY9A 2DCTA 3GHMA 3N7JA 3VDDC 1AX2A 1IZ3A 1H8TC 2D7FA 1HN1A 2ZPXA 4GKYA 2ADDA 2HWF2 4OULA 3USSA 3POSA 1JYCA 2AYHA 1QF3A 2OW4A 5FP3A 1W6PA 1H2LA 1R081 4UW4A 2VW0A 5LY1A 2XBO1 2ZGOA 5DDJ3 3U1XA 4HZFA 2IXJA 5T5LA 5C9AB 1EAH2 1BZWA 3GGLA 5JOZA 2NP0A 4B4RA 4K1YA 2D44A 3WG3A 1GP4A 2P3KA 3AKRA 3I3DA 5FOBB 1C8M1 3WW4A 5JZGB 2VMEA 4UBHA 5J7MA 3HN1A 2XONA 3S5AA 5ANQA 4CDUA 3CEWA 4QHOA 5L9BA 1DU3D 1MS1A 3BUCA 1FOD2 1D4M3 4HL0A 2OQ7A 3WQ1A 2VMGA 2YDEA 4N53A 2X8KA 4LBQB 1W9FA 1D0GA 2DFBA 2BFUS 2FCUA 2PTMA 4K6BA 3TN93 5AC92 3GZUC 1RUF2 2X5IC 2ZGNA 3LSEA 5FZKA 2A75A 4Q4V1 4WM7B 3K4AA 2ZGQA 4QPGC 5A1AA 2XBO3 4LBOA 1IKPA 4FPLA 4R8HA 3VBFB 2ZHNA 4LPLA 4AHYA 4BU2A 4GKXA 5K0UC 2VW2A 1UMZA 2QKDA 3KGLA 3KHCA 4DEVA 3ZSEA 3RQ0A 1S0EA 2NYYA 1OURA 2VMFA 1ZM1A 3T1MA 2CGOA 2WZ8A 1HB2A 1GOGA 3KZ4C 1ZBA1 3PHMA 4FP3A 4B1MA 1I5ZA 1UY4A 1OOPB 3KLSA 5A3NA 4RN5A 2A5ZA 1SBFA 2B9VA 1MS5A 2OT7A 4NHMA 3B69A 4TLGA 2WS92 1FMD1 4H55A 4R4XA 3J7HA 4HETA 2OKXA 2NQYA 2G9ZA 1AR82 1W8FA 3OGSA 3L2HA 2PYTA 3CJIA 3OYWA 4I0AA 4XDQA 1Q8SA 4V1PA 2JG8A 4MX3A 2GSYA 4IV1A 1V6IA 4Q4V3 2GP3A 3J7LA 1CVNA 4P02B 1C3HA 1V70A 3HNBM 4QKFA 1G7YA 4RL7A 3V65A 4AF9A 4BISA 5F3EA 1VMFA 1ZBE2 1NZCA 3AXEA 1CX4A 1X82A 4JZRA 2XG3A 1KDKA 4RR3C 1YC61 3CL1A 3WDTA 4FTSA 4CCKA 2IFWA 1AR73 2VVDA 4JKLA 4LITA 3T2OA 1KS5A 5JPMB 3HNMA 5JI7A 2OX0A 4MGIE 5EXOA 3ELNA 1NQDA 1VRH2 2J1VA 1W99A 4M0NA 3VL9A 1YFXA 5I93A 4MGKE 4QDSA 3ILFA 3ZYFA 3DKWA 5BNNB 2ILMA 1FMD3 3ZSMA 1AYM3 5L19A 5FO9B 1HJGA 1HRI2 2FBEA 4LO7A 4OHXA 3ZXEA 3K77A 2OA2A 1QDOA 2QE3A 2J1TA 2Y0OA 2ZACA 5FLIA 3THPA 3RZHA 3EB7A 5DMYA 3VB9A 1YI9A 4BOWA 1DZTA 5C3QA 1DGWA 3MLJA 4GIQA 1DYOA 2NMNA 1VE0A 4X6QB 1CZSA 2ZHKA 3AZXA 2VNGA 1EUTA 1LGBA 3ZXKA 4IXLA 2ZX0A 3VBOC 2NPIA 2C4XA 4FOWA 1MZEA 5CAZA 5KHIA 5HCFA 4CSWA 1CAVB 4DNYA 1UZWA 1WLDA 2RR12 3MFAA 2VNVA 1CAUA 4D7TA 1DYPA 2HWE3 3PU8A 4AXOA 5EZWA 1GZWA 4O9GA 1PHMA 5JR7B 3ORJA 3VD7A 3T0DA 4FOQA 4K7JA 4L92A 5FQ0A 3BTAA 3TNPB 1YJLA 2WDBA 4P9LA 4XF3A 4HXCA 3AKSA 4FFGA 1QDCA 5DXDA 2QBXA 3AKTA 5IK8A 4BE3A 4OI2A 4CUAA 1OUXA 2WQ4A 1LHUA 4MHUA 4TTGA 4YSFA 4PLMA 1VMJA 3D8CA 3D6EA 1QJX1 3R05A 2VCAA 3DYMA 3WNNA 4IV3B 1W6QB 4H3WA 4QDRA 3VBHB 5C4WB 1ND3B 1E5SA 3ES4A 2D3PA 4G3YC 1RUJ2 3FLRA 2A3WA 4I09A 1XE7A 4R9AA 5T3NA 4OI1A 3MI8A 1GOHA 3ZIWA 5HV0A 1CAXA 1K5MB 2W1WA 3W5MA 3OGVA 2BW8A 3GM8A 3MIFA 1H2NA 2A6WA 1H9WA 1OLRA 1SLTA 1OF4A 5I8YA 1UN1A 5DN2A 1W28A 3ZYIB 5FK7A 4HANA 1RVF1 2WNEA 3NV2A 1GKBA 3DUIA 3ZR5A 1C8NA 4XF1A 4XF4A 4Z07A 3SKJE 4BYYA 3SISA 2XQXA 2JJ6A 3IPVB 1W9SA 4XMAA 1SACA 4FTEA 2SBAA 3CZUA 2WT0A 3NVCA 2P3YA 2XJRA 4UFIA 2A70A 3NNLA 3LA3A 1ULDA 2VZQA 2OXBA 5LBBA 2BERA 2LW8A 4YW1A 2QQUA 3DF0A 1NCRA 5C5UA 1BHGA 1QQP3 2DU0A 1Y43B 5I0UA 3UKVA 1RUC3 3IAPA 3IB3A 5IAVA 4J25A 2WINB 3PJYA 1UOFA 4XJWA 3ZPYA 4NOTA 3VZMA 1K12A 4IEPA 3ALQA 2Q8CA 4LA2A 3VDDB 3I54A 3FHIB 1H8TB 1UAIA 1PMHX 2HWB1 2R0FA 4HLTA 4CDWC 4NWVA 5JSOA 5EYXA 2VW1A 2JE7A 5ABJC 4H14A 4AGVA 4J6GA 1DBNA 1SLCA 4NROA 4E27A 2VXJA 4XJZA 1RUH2 3VZLA 3MZHA 5KHGA 3M70A 5F1RA 4QMAA 2W1UA 5L9RA 1OQEA 1TME3 2VY0A 2WRAA 3IAQA 3MUY1 1HX6A 2RV9A 4J1XA 1PM7A 1BQPA 5JUVA 4EN7B 1DQ4A 4UFLA 3IDEA 3TOJA 3AKQA 5CKMA 4XJUA 4YG0A 5DUWA 1IQAA 2ZX4A 4MGZE 5F5QA 1Y4WA 3I3EA 5FTTC 4AK3A 3M3EA 4ISQA 1QXJA 4MYEA 3ZFGC 1POV0 2A3YA 2JDZA 1GNYA 1Q3EA 3WNKA 2R041 2VOWA 3I8TA 5A3TA 4OHYA 3HN3A 3QH7A 4JGYC 4OZOA 3VZOA 5JLVA 1PO11 2MEV2 3RRDA 1CD3G 1GZTA 4GWJA 3LWCA 3PIJA 4QHBA 4INDA 2OYZA 4W6WA 4AHZA 4E2GA 4Z82A 2DTWA 2ZX2A 2CV6A 5I8SA 4GD4A 3A0NA 4AGRA 1PIV3 4QPGB 3NNFA 2ZOEB 4AEJA 2CWMA 2PAEA 1VBC3 2E7AA 4NPLA 1HQNA 2VCMA 4Q0PA 3IM0A 5EP9A 2VAUA 2WT2A 3DECA 4HFSA 2O1QA 1I9RA 4KGQA 5K0UB 3A21A 4XUTA 4HVOA 1W3XA 4PJYA 5F6LB 3UV9A 1ULOA 2XDVA 5K9YA 3VBRA 2ADEA 4XZPA 1GUIA 1REDA 4OMCA 3LIGA 1IPJA 3KCCA 3MLLA 4NHKA 4QPIA 3UGFA 5DZEA 1DFQA 2BGOA 4Y1XA 2QQOA 2K9ZA 1WW6A 2UU8A 3ATGA 5D1IA 4GALA 4N43C 2K2SA 5CFCC 4Q8KA 2HYKA 2WNVB 4PBPA 2VVFA 1OLQA 4YW2A 4CXWA 5K8SA 1GBGA 2O8OA 3JD71 3MLKA 4OUMA 3WINE 5ANNA 1A34A 3ILNA 3LEGA 4WVZA 1XC6A 1OFSA 4PQ9A 3V0BA 2LS6A 5IVJA 1BXHA 2JDHA 3NMBA 3INAA 3UJOA 2WAAA 1WMEA 1BCXA 3BOPA 5F8PA 2YROA 2YFUA 3ZSLA 5CFDC 1J58A 2JG9A 1EAH3 2WZR2 3OPWA 4ZS2A 2B8MA 4RR3B 5A32B 2HBTA 2WNUC 4META 3O1PA 5L73A 4XF9A 3O12A 3TRSB 1STMA 4Y20B 3OCPA 2FDJA 4CVUA 4YVSA 1JZ4A 5FP9A 3K3OA 3SC7X 1ZZ9A 4Q4X1 1HW5A 2W39A 3BTYA 2DTYA 1POV1 3D3AA 3HIFA 3P1IA 3WT3A 3TEYA 3IN9A 1FOD3 2P6CA 3WG1A 5I0TA 1J83A 1N3PA 1Q8VA 2VC9A 3AP7A 4G4FA 1OUSA 1W03A 3OOXA 4YPJA 1IHMA 3K2OA 1AYN1 1S0FA 4KWLA 3JD73 4LHKA 4NO4A 1ULGA 5AC93 5BY5A 4QPWA 1RUF3 4QPYA 2VZPA 2Q1MA 4XCAA 1RGSA 1RUOA 4AI0A 3URFA 2GALA 4GMP3 4AHXA 4PDWA 1O7FA 3DPRC 2R6QA 3AJZA 4HN0A 5GLUA 4LUMA 3VHNA 1XB9A 1V9U2 3NRUA 3UYJA 1YCIA 2R7EB 2W91A 3WUDA 5ISLA 2WO2A 5FYYA 5C3OA 1CQ9A 3N7LA 4IQPA 3VBSC 1CGPA 1JODA 5FBZA 5C33A 2CU5A 2W0XA 5F3GA 3VBOB 2Z2SB 2ZX1A 3JBG2 1G6NA 3BIEA 2FDFA 4LR4A 3RZZA 3MO4A 3HAGA 3POIA 1MEC2 3MIDA 5EFUA 4JQRA 4PF5A 3Q8AA 1L7RA 4LORA 5KXCA 2DCYA 2EAAA 1RMU2 1BK1A 1LHNA 2UY9A 2DUPA 2WSVA 2I45A 1DLCA 1U5YA 4QKNA 1JUHA 2B39A 3OSDA 2W94A 5FY7A 2WS93 3C7OA 3ZLIA 4NWWA 4ZONA 5LB6A 3FLTA 4C0HA 4F7ZA 1AR83 2JKBA 1W05A 2MPFA 2Y0IA 1HB1A 1O8SA 2RVAA 3MW3A 1S0BA 1W9WA 1XNBA 3PIGA 4CEYA 3DV8A 1O5LA 1E5RA 3AVSA 4AGGA 1ZBE3 3DKQA 4W6XA 4XC9A 2PAKA 4Y22A 1FPN2 1GWKA 5A7SA 1ULPA 2WA3A 2QQNA 4NRMA 1TNFA 2DBIA 1UZZA 4D6QA 4COVA 4A3XA 1KEXA 2C0ZA 1S4CA 5C6CA 1JOJA 3SNMA 3EJKA 3GXUA 5I0DA 3VBUB 1EV11 3AP4A 1VRH3 3M8LA 2XH6A 3N9NA 4LO5B 2PELA 5KC6A 2E63A 1TMF1 4QX0A 2JB8A 3AFKA 5KHHA 3POWA 5LA1A 4QDQA 1HRI3 4OHZA 4LO8A 3G7DA 3IBMA 5JAXA 4GZ9A 3OBTA 5A7QA 4AVBA 2JXAA 3JUUA 4KNCA 1LB2A 3MF9A 4GWMA 4OI4A 3FL7A 2RMU1 5CVRA 5BNOC 2PAMA 1RUE1 2RM21 3WZ1A 2VG9A 1CONA 1D4M2 1OKQA 1LOGA 4UFJA 1VAVA 4WM8C 3N9PA 3NJYA 3U07A 5F2SA 1XRUA 4B1LA 4FO9A 4WV8A 4EN0A 4Z1VA 2W92A 3ZOIA 2CDPA 1DG6A 4YM0A 1HV0A 1Z0HA 5T5JA 2RR13 4GJYA 3AYDA 4B4PA 2Q5TA 2JEMA 4R52A 1ZZ7A 2VOXA 4NVPA 1O4YA 2KA3A 3W58A 3I2IA 4QAWA 1R082 4GWNA 2Y6FA 2XBO2 4L11A 4CDWB 5E8AA 2QQKA 5KXEA 4FPHA 4KBZA 5ABJB 2MNGA 1MVEA 4LHNA 1F2NA 3O1VA 1HB4A 4QB1A 2BRTA 4FPCA 5H9PA 1ASJ1 5FYVA 1QH6A 4FOYA 4FPFA 1C8M2 4IEVA 1W9YA 2LUWA 4J1WA 5GJ6A 5C8CC 2Y60A 3VKOA 4DRVA 2QQWA 3BU0A 1OD5A 2WFF1 1RUJ3 2WKKA 4CEWC 1FX5A 1WCDJ 1OH3A 1LOCA 2RM23 4BLIA 1MQTC 4D69A 5KXBA 4XE9A 2DVDA 4YG3A 3KGZA 5FV3A 1KDMA 5FY4A 4CCDA 5C9AA 3F2ZA 3ZFGB 2IZWA 4LBQD 1ZZ8A 1X9PA 2ORXA 3PMEA 4A2UA 1CN1A 5BXXA 4E2SA 4JGYB 4DS0A 1U0AA 5EYYA 4TXWA 4Q4V2 3WOGA 5JZGA 3TBDA 2V5DA 1WLWA 2LM3A 3FUOA 1JYXA 3RZKA 3IIIA 3S7IA 4MADA 3ZM8A 5JWPA 1I5PA 3KCYA 5IVVA 2ARAA 3AMMA 1UU6A 2D3RA 3SH4A 3B94A 5LA2A 5TSWA 1APNA 4LBQA 1YQ2A 3RSJA 4KWKA 5F9TA 1DZRA 1XYNA 3NNJA 1W9TA 4MVTA 3SH5A 1W06A 3RZMA 5FO8B 4QM8A 5FMOL 4WM7A 1ZBA2 2AACA 2RS11 5A33B 1YHFA 3OY8B 5F7UA 4TN7A 2ZX3A 1S0CA 3KVBA 3OGGA 5J3UA 2XJTA 2ZABA 2ZMLA 4PHZA 4BXSV 5JOYA 2E6VA 4BPZA 1FMD2 5A6YA 1U5IA 3RG0A 2YUEA 2QJVA 5FYIA 1DQ1A 4X6RB 3ZXLA 3H3LA 5GLZA 1LECA 3BIWE 2WLPA 3NKGA 5CFCB 2EXHA 3IIAA 4ISRA 5T50A 3UKNA 3ROUA 1NCQC 4BDVB 2YPJA 1V6NA 1OOPA 2QDRA 1B35C 4AVVA 1KJLA 4XACA 3MPPG 4D94A 3MIBA 2DCJA 4CP9B 1XYPA 4PQQA 2BQPA 1GWMA 2IC1A 2Q1FA 3GZAA 1MS0A 3GBFA 3LEKA 1T6GC 1QOOA 2YB7A 4PLNA 1DGRA 2JIGA 1SLIA 1UD1A 2RS13 5FZ4A 2WNUB 4M4PA 1SPPB 3ZFFC 2J1SA 3RJRA 3WF1A 1XU1A 4FT8A 5FXVA 2EXJA 4AQ6A 2LRPA 5FIXA 3W21A 1ENXA 3VKMA 4YFZA 2VBPA 4XAAA 4KU8A 1UXZA 5A6XA 3O0XA 1UKGA 2ID4A 1JU4A 2MEV3 5FZEA 2E7QA 3I4IA 4UT5A 1DIWA 3RNSA 5F6KA 2WSUA 2ZGRA 2FD8A 4I30A 3EHKA 1F35A 1Q8PA 4QT6A 4R9BA 4EV0A 4XIOA 3R4DB 2V09A 4XUOA 3H1WA 4EE2A 5FDBA 2R16A 1DHKB 2MHFA 4FPJA 1PZ7A 3DPRB 2GMMA 4NHXA 5BNNA 4BMBA 3SEPA 5F3CA 5FLJA 4O9EA 2JE8A 2VUDA 3MDPA 3OPTA 3B3QE 4AZZA 4JVAA 4XFCA 2J1RA 4Y26A 3NJVA 3VBSB 1XE8A 2JDMA 2VZSA 5BNOA 5FFOC 2WZEA 3GZEA 1XNTA 1JYNA 4D7SA 1KXGA 2IWGB 2WO7A 3ABZA 1O59A 4LLOA 2BGCA 4HVRA 5FMCA 2EIBA 4QKBA 1VBE1 5IK5A 4X8NA 3I97A 2VXRA 1Q43A 1GICA 1CAVA 5FP7A 1QJX2 5FJHA 5A7NA 3WF0A 4ZZ8A 5ACA1 1ZNPA 3TEXA 4PBOA 3T1LA 5CKNA 2QQPA 1X33A 3KCXA 3OEAA 2V72A 1H2KA 2YV8A 4W6YA 3ZX7A 4W8JA 1YNAA 1PMIA 1RIRA 5HV4A 3UJQA 4LT5A 2VVEA 1UZYA 2JIJA 1S2BA 3ES1A 3WY6A 1ZRIA 4FOVA 1WLTA 1AL0G 2B7YA 2YGMA 4JRAA 3NV3A 3PVOA 3DGTA 3EMRA 1RVF2 1AL21 1LULA 4IV3A 3AM2A 1W6QA 1XE0A 2Y34A 5C4WA 3VBHA 1ND3A 5IK4A 1O91A 4YZ4A 2QQMA 3SKVA 2FQPA 2R1BA 2XL7A 1K5MA 4O61A 4E8CA 4RA0A 4QX7A 3I49A 2G9GA 2XJQA 1C1LA 3PLQA 4XXPA 3J4UH 4MHRA 1W6MB 2QFEA 3QLQA 1COV1 2JWPA 1VLNA 2WFPA 1C1FA 2V5YA 4JGZC 1CX1A 1QMJA 2WIIB 4JHTA 1V9U3 3IPVA 2Z79A 3T30A 4I2OA 4DY5A 5BNPA 1DQ6A 2W52A 1LKNA 3CF6E 2Y26A 1WCQA 3S0MA 4TLFA 5KHJA 1LRHA 1RUD1 4WM8B 2YBKA 1CZTA 2H0BA 2HWB2 2GMPA 3IMMA 3JBG3 5HI0A 3J8F1 4QB6A 3HVDA 4BWOA 1MEC3 1A3KA 5FWJA 1I6XA 1GQPA 5DAQA 1RHI1 5BPXA 4GAZA 5FK8A 1RMU3 3U4SA 2OIIA 1LAJA 1YO8A 3IDBB 1FNYA 1BJQA 5HCAA 4GB31 5JXIA 1H8TA 2YHJA 3UL2A 1QKQA 3I2GA 1OFNA 3M3IA 1K42A 2RDSA 4Q1RA 4CEWB 2R042 3K51A 3MW2A 3OBZA 4JKKA 1ACCA 1OHFA 4Q0QA 1MQTB 1REEA 5F39A 1ST8A 1RUD3 4P9YA 3C3VA 4AVCA 1PO12 4EJRA 3WNXA 4Q0UA 2YC0A 1RUNA 4JKMA 4OHVA 1WCKA 4EWEA 1POQA 3SH3A 2K0GA 4K8FA 3ACIA 1LNSA 2EAKA 4I3GA 4L2NA 4B8EA 1O3RA 4HPKB 3VDCA 4AOCA 4CXYA 4D8MA 1QY4A 3BCWA 3HBKA 3RPQA 3W5NA 2G1MA 4K21A 1IS5A 4FFHA 2R061 1OLME 1PK6C 1ZYBA 4OHWA 4W65A 1LTEA 4XCBA 4FSJA 2CHHA 2GN3A 2B5HA 1S0DA 4KL1A 4BQ3A 3NJXA 1AR91 3QACA 3ZKYA 4EZ4A 3B02A 4OCTA 3PJQA 4QPGA 4AAPA 2GNBA 1MR5A 1YEWA 2QTWB 3FE5A 3KV9A 2ZGPA 3T2PA 3LE0A 3NSTA 5G05L 3WV6A 3BALA 3QOPA 5K0UA 2VBBA 1DGLA 4QX3A 1HXS1 3ILRA 1GNZA 3JD72 4C1WA 4LOTA 5A3LA 2VZTA 3GBGA 1KGYA 1MPXA 1JTZX 1Z7S1 3IDAA 1SCRA 2ES3A 4NE9A 4WZFA 4C0BA 3CLPA 4HT1T 4KMQA 4A6SA 4Q1PA 1R083 1GNHA 3N9LA 1RJ7A 4AI3A 1QH7A 1NCQB 2XJUA 4BIFA 5LK7B 5E16A 3MIGA 2XVGA 4P9WA 5KHKA 1PVXA 1B35B 3KVAA 1S0IA 2EALA 5A7PA 4E2QA 1H6XA 3O7OA 1VBB1 2XMLA 3I2FA 4CUBA 4Z2WA 1UOBA 2WNVA 4QX5A 4TSVA 1PNGA 4XXAA 1C8M3 4JAAA 4YGDA 4ONUA 2I2SA 1AR93 1SG3A 4JQTA 3VDAA 1W90A 2XGXA 4O7XA 3HQXA 2GC1A 4Q4X2 3ZFFB 4LO6B 3FLPA 3GJAA 4QX8A 3WDXA 1SEFA 2K46A 3QCWA 4B4QA 3JZVA 4LLFA 4EQVA 4XFFA 1W2NA 2HWC1 2JDAA 1AYN2 3ACHA 4RR3A 3OD4A 5A32A 1IG3A 1GANA 3NAPC 2ARCA 2VULA 3KQ4B 2D6OX 4Y20A 2O0OA 3SCFA 3ETQA 4YVWC 5LEJA 1LOBA 1HRV1 1V0AA 2VUJA 3AMNA 1P8JA 2RJKA 5E89A 2I07B 5FPAA 3WF2A 1V6KA 4OYUA 3RDIA 3KS7A 3WSOA 1CWPA 3NV4A 3VDBA 1UXXX 2PHFA 2KM2A 1ZBA3 4EWDA 5JOXA 3WNPA 2JDPA 3BU7A 4XJ8A 4RS5C 1RXGA 4P9GA 4ZU4A 2YZ4A 2ERFA 4ZU7A 2C26A 3AYEA 1HB3A 1A6CA 2VMIA 3PVBB 1MVQA 2FDHA 5EWSA 1SLLA 3V0AB 4NJ4A 3VBOA 1LGCA 4XFAA 1U5ZA 4I0BA 1OVSA 3H1YA 3H8UA 2W9XA 3FWEA 1ZRCA 5FZ3A 2CNAA 2OZ6A 4COZA 1OQDA 2G4IA 1OC1A 4GXLA 4IV1C 1KITA 5FXXA 3MYXA 1JYTA 2R071 1GZCA 1FAYA 3UESA 2RG4A 1JN2P 3WXPA 4DFSA 1XNCA 2H6BA 3M3QA 3OF1A 3WP6A 1AVBA 1GWLA 5IWFA 3WNMA 4I02A 3A4UA 3DYPA 4CXXA 4PIYA 4Z2AA 4A4AA 3LDRA 5FMBA 3VZKA 4IGQA 4LULA 5DG2A 4PI2A 5DPNA 2Q8DA 3FBMA 2TEPA 3D82A 3AVRA 2D6KA 4IESA 2QQIA 5FWEA 4OQ8A 5HPOA 1OA3A 1GSLA 4FCAA 4XUNA 1TMF2 2IFRA 4XFGA 2D6PA 2QUOA 4QU1A 1CIYA 1QWRA 4GQ7A 5AVAA 3RMXA 3RVHA 5C3PA 4WVVA 3P3NA 3E6BA 4M3CB 2A7AA 3H8RA 1J3QA 1AXYA 5FXZA 5D2AA 2E51A 1F9KA 2PLV1 2YPDA 3VBUA 5CA6A 5CKQA 5FZ0A 1PGL1 2RMU2 4XIKA 2A6XA 1WWYA 4JGZB 1RUE2 1LOFC 1V6LA 2RM22 5A7WB 1M06G 1YRZA 1QGLA 4K3UA 3KF3A 2ZMKA 3I2DA 2B42B 3OEBA 3BPSA 4OQ9A 4QX1A 1JW6A 1FYUA 2LTNA 1WMFA 1H9PA 1NYWA 2N7GA 3PUAA 5D8AB 1GP6A 4FPOB 5CG8A 3LKJA 1IKQA 2RJLA 4MO3M 1UY1A 1HLCA 4CCLA 4UF0B 2CSGA 4EN6B 1QJZA 4UOJA 5KR7A 2JDKA 3AB0A 1ASJ2 4Q0VA 4AFDA 3WP3A 1QJX3 3JCIA 2YGLA 3AZVA 4QX2A 1GLHA 2J1AA 2FCVA 5JSRA 2WFF2 2ZKNA 4K8RB 5FPZA 4KH9A 2ZTNA 5FCCA 5LBEA 4CDWA 3ZXAC 1W6OB 3I59A 5ABJA 3FMGA 3VD5A 3JU9A 3OUIA 5CNAA 3D5OA 4LIVA 2WN3A 3APBA 3I2HA 3FUQA 3ST7A 3BGAA 2ETEA 1O8PA 4LEJA 1Q8OA 4RD7A 1RVF3 1VBA1 4YWAA 1S0JA 5GLTA 3WUCA 3MGUA 3ZMNA 4AI8A 1WGPA 1Y9MA 1SMVA 3RYRA 2JE9A 3KT7A 2X29A 5GKAC 3BPZA 1F15A 4CP2A 2OVUA 3LB9A 2XL9A 4CYDA 4B29A 2XR4A 5FBJA 3SITA 3BKZA 3QD6A 4MGTA 2KR2A 3ZKUA 5L7OA 4JGYA 1JBCA 1PK6B 4TWTA 1FATA 2XLAA 2CGNA 1YQ8A 2RS12 3OUJA 5GLVA 2DBNA 1CPNA 1QIQA 3A7QA 5KC5A 3QBQA 1NLQA 3R4SA 1GQGA 5EJ3A 1LU1A 1NCRC 1QJU1 2ENRA 4FTBA 4M0HA 1LOAA 1AXKA 1GMMA 1DGWX 2P5BA 1F4AA 1Q56A 4F3JA 4C8DA 1OD3A 3E97A 3PUHA 3WDUA 5L36A 4LE3A 4F8AA 3ACLA 5A1FA 2HWB3 1F31A 1PZ9A 2W1SA 5A33A 3OY8A 2BOJA 2X5IB 1JYVA 4B7KA 3O14A 1EP0A 1U5XA 1ZRRA 3IWZA 3T08A 4XDPA 1N3QA 2RS51 4A45A 4NUBA 4JDMA 1AR61 5HXMA 2EXKA 4DOUA 4NHLA 5ERLA 2D93A 1V00A 5G04L 3N4MA 1W04A 3OG2A 3PUQA 3PTRB 5JSPA 3KWVA 5CFCA 4HG6B 4QKDA 1T6BX 1YWKA 2ARXA 3A23A 1JH5A 1UZVA 3ZFEC 1E5HA 3H8OA 1XJAA 1ENQA 1ALYA 1HQLA 1LR5A 1UCXA 3WDWA 4CP9A 2R043 3ZPOA 3VKFC 1WKYA 5FP4A 2GU9A 5JXHA 2ZHLA 3E5QA 4OI0A 1H4HA 1PO13 2OZJA 4AVSA 1S55A 2WNUA 1YFUA 2ZAAA 3C7GA 1G8WA 3NAPB 4DY3A 1H8VA 1SPPA 1O6UA 2CAVA 1ZZBA 2RS53 4AEDC 1W8TA 1VB2A 3I3QA 2DWRA 3RI8A 4YVWB 4HVQA 3HQUA 5DABA 1BEV1 4LKSA 4DRRA 4K9SA 2GNMA 1RXFA 2R32A 4PT6A 4NAMA 3O1TA 3RMYA 5IVEA 2O8QA 4JTOA 2VTXA 5FAXA 2QVSB 2BU9A 3AP5A 5JPNB 2YU2A 5T5OA 5FZFA 3DPRA 4EZHA 1VBE2 1VP6A 1WA6X 4RS5B 1OPMA 1CIWA 3VBRC 4S2DA 5DUVA 4RYDA 2A1XA 1UF2C 4KI5M 4Q29A 4B7EA 4ZKTB 5ACA2 3M4FA 4LXLA 4A44A 5GZGA 2Y6KA 3PUSA 4JX0A 2ZAHA 1V6OA 3WDYA 4ET7A 3GF6A 1E5IA 1QU0A 1GOFA 2XJPA 1W8ZA 2DFCA 4O65A 1LCLA 4ASKA 5CG9A 2ZKLA 4QWNA 2P2KA 1UOGA 5A3OA 4FXKB 5IVCA 1T2XA 2XKOA 1AL22 1Y3TA 2A6YA 3AKPA 4Y5Z0 2ZJCA 3M3CA 4XDOA 1XYOA 1QXRA 4H7MA 5B4XA 1PO21 5T54A 5L9VA 1NE4A 2D98A 1QXPA 4Q4X3 1POV3 1QHDA 4MUVA 3ON7A 3MPBA 3UKTA 5CBLA 2Q8EA 4QGMA 4YVSC 1TE1B 2DVGA 1F4HA 2VOTA 1A8DA 1AYN3 4YRDA 4RQPA 1COV2 2ZMNA 1ULFA 1O3QA 4BQWA 2FMYA 2BNOA 4DINB 1DZQA 1UU5A 2DYCA 1JUIA 2BVBA 3PVEA 2WWUA 4XAEA 2FDIA 2CTVA 2PHTA 1V6JA 2W95A 5FY1A 3P6BA 3ZN5A 3TWIA 4L97A 2DU1A 4IE7A 4OMDA 4KWUA 1RUD2 3FZ3A 4CU6A 1NY71 1ULEA 2P4EA 3VGIA 5F5AA 5FYCA 1SFNA 2PMWB 3J8F2 3POGA 3MV01 5HCBA 2VCBA 1MZ5A 1QJFA 2E32A 4YYOA 1EUUA 4Q2FA 1RHI2 5K7PA 5IK7A 4A42A 1ND2A 3VHRA 4XILA 4DEQA 4YM1A 4IDZA 3FJSA 2YC2A 5FMOS 5FZ9A 2F4PA 2ZGSA 5M0TA 2IXLA 3WW1A 4WM8A 5FQ0B 4GB32 1L7QA 4E9KA 4YW7A 5JIUA 2A3XA 4FFIA 4BM8A 5IFTA 1PVC1 2JX9A 3UETA 1W2OA 4QB2A 1X7NA 4GWIA 3Q9OA 4WZCA 1RJ8A 2D97A 1BKZA 4IE4A 3B00A 4N9HA 4XYXA 2FDKA 3WR0A 3WW2A 1WZXA 5C3SA 1OMIA 2AEYA 3I7DA 2RHPA 2R49A 2EIDA 4AR2A 2UURA 4OUSA 1EV13 1MS8A 2AH2A 2JDUA 2E31A 1J1TA 1SFPA 1YYNA 2W68A 4QD2A 4XPVA 5FY0A 5KWRA 1BVVA 3K46A 4LTAA 3C8XA 3LD8A 3OBAA 5FYHA 5FZOB 2W5FA 1X8MA 1TMF3 2AGSA 1JOPA 2D6NA 2DURA 1AHSA 4CEWA 3M1HA 3NNGA 1S0GA 3O1RA 3JQXA 1MQTA 2R062 3KV6A 1UWWA 1YUDA 3ZXJA 5T52A 1NA1C 1VB4A 2QQLA 2XUEA 2GC0A 3HR9A 4S2FA 4A7KA 1AR92 2EIGA 1RITA 5C7GA 4CCMA 1GU3A 2RMU3 1C28A 4HPKA 2QCSB 1RUE3 1WW7A 1DQ5A 4QM9A 4YW4A 3PNAA 5IW0A 1AJKA 1LGNA 2P34A 3CKHA 1NCRB 1W0OA 2CDOA 2W1QA 1VR3A 1HXS2 1YIPA 4L8QA 1Z7S2 1TEIA 4E4HA 5E88A 4Q4Y1 1X36A 4Y1YA 4DPNA 1NOVA 4OVEA 4UI9L 4V2WA 3PURA 1JOBA 1DLLA 4N7UA 3O1SA 4XHXA 2JKXA 1W0NA 4C91A 1ZA4A 2G19A 2RS31 3AP6A 1TVGA 5F2WA 1VBB2 2W47A 4CU9A 2Q8OA 2VJXA 1ZZ6A 1ASJ3 4XBQA 1ZX5A 3M7AA 4L9BA 4Q4W1 4AAXA 1CESA 2VZRA 1PGW1 1NXMA 2BDRA 3I2KA 3E6DA 3SXWA 4DXZA 4FFFA 5JI9A 1MS9A 2WFF3 2ZHMA 4BA6A 1HV1A 3POYA 1NCQA 4K1ZA 1JZ2A 1DGRN 1G86A 4LKEA 1B35A 1Y9QA 3ZFEB 2ZA9A 4QQ2A 5DZFA 3VBFA 2WYSA 5I8TA 3Q8EA 1VBD1 2HWC2 2HWD1 1ZVFA 3A22A 3B93A 2W2IA 5LZ6A 3WCRA 5JXJA 4G9SB 2YXSA 4N43B 4CCCA 2J22A 4Q4Y3 4EN9B 2CY6A 4ZS3A 3U4XA 3NNMA 4EYUA 2UWAA 3WP5A 5LK5A 3AMQA 3MV11 1XOYA 1H2MA 4Y33A 4FPYA 1HRV2 5FLHA 3UNPA 1R1A1 1OBNA 4AEDB 2LALA 5CEHA 1OA4A 2XVKA 3LEMA 2EXIA 4KGGA 2HH9A 5GZFA 1SHWB 1QJY1 1OVPA 5CFDB 3HOBA 3AFGA 1R1ZA 4LBMA 3BOWA 1OA2A 5BNQA 4MGQA 1HJFA 2VMDA 1GP5A 5J1XA 2OPKA 5HCHA 3NKTA 1W6NB 3WDVA 2VGDA 4XQDA 5IHRA 3BTXA 4IGOA 1VBD3 5JXGA 4AVTA 1B09A 1OLMA 3AZYA 4XOGA 4ORFA 3W59A 1IGOA 3VBRB 4CP0A 4BQ5A 4R9DA 4E4SA 4WVMB 3WG4A 5A70A 4R9CA 1UYYA 3D4KA 3LOBA 1FV3A 2RDNA 2L9LA 3ZYHA 1GQHA 2R072 4FPKA 1CPMA 5DZGA 1A78A 1IG0A 3CQOA 2VTXJ 4V2VA 5A7OA 4CUCA 3VD4A 1C4RA 3AMHA 3SCHA 1PNFA 4E8DA 3V0AA 2P3JA 2J7MA 1IS6A 3EQEA 3N9MA 3N35A 4FPGA 4CZSA 4TYSA 2VD7A 5JIAA 5J48A 4YW6A 2O14A 4LHSA 1N47A 3TAYA 4ARXA 4YZ2A 5A3WA 4NIIA 4S2GA 4ZHNA 5FZBA 3B5LB 1PGSA 5E1RA 3H8XA 4YGEA 4BJ0A 2PLV2 4GH4C 2YU1A 1R091 3D0JA 3HT2A 3CNAA 5FOJB 1YXWA 1PGL2 1L7LA 2BBAA 4AEKA 4D0QA 1I1EA 1UO9A 4DXSA 2H0VA 4QU2A 1LEMA 4MXVA 3RI9A 3M2MA 2W3JA 5FO7B 4KU7A 5GZEA 2GH8A 3ZN6B 2VPVA 1NUKA 5LATA 1ZREA 2D43A 1KQRA 1V6MA 1PZ8A 4M3CA 2GC3A 1NT0A 5FZ7A 1ZRFA 3HEIA 1O3TA 3JQWA 4SLIA 4RSUA 3AYAA 5IVYA 1JHJA 4NMIA 5GZCA 5DAWA 2VUCA 4LBJA 4JGZA 2BWAA 5A7WA 3LAGA 1LU2A 3IKWA 1VBE3 2BPA2 4OLLA 4AQTA 1WBLA 2FZ1A 5K4LA 1AXZA 4CDQC 4BQ2A 2UWCA 3WHUA 2WBKA 2W08A 1JI6A 3AXDA 5D8AA 5ACA3 5CADA 5A6QA 4H2AA 3WLUA 4NIGA 3B9CA 1A8MA 1VAMA 3JB4C 4Q5OA 5EHDA 3USUB 1F5FA 2XHKA 5A3PA 2QZ2A 1UIJA 1GV9A 3EXUA 3ZO0B 2CAUA 1JZ3A 4E4DX 4UF0A 2OS2A 2SLIA 1GR3A 3ENRA 3T3YA 3OJBA 1BBT1 1FV2A 1KFXL 2XHNA 2XKPA 2YY1A 5CU1A 4XZUG 2JDYA 1VBA2 1AL23 1IS4A 2BVVA 3LZZA 4ES9A 1R64A 4BLJA 1RUI1 2HYXA 2XWJB 4P9XA 4Y5TA 4CRQA 1X9TA 1W6OA 4IEZA 4IV3C 3VD3A 3EO6A 4DUWA 1SDDB 3ECQA 3ZDVA 4AG4A 4MOAA 5FZ8A 2ZZJA 1UOJA 2GP5A 2GH2A 4COUA 1H6YA 3FFQA 1COV3 1NA1B 3ACGA 3VDDA 1MS3A 3UK9A 2X10A 3BTZA 5FP8A 2WZPP 4XABA 4CDXC 5C8CB 4QGLA 5LY2A 1QJU2 2GAUA 2GN7A 5F32A 1OKOA 2AREA 1F8VA 2G9FA 5FZMA 3ZYPA 5DUUA 3BVCA 3I3BA 1LJ7A 4XUQA 4IETA 5BNPC 2BP6A 1PK6A 4JC1A 5FYMA 1JYIA 1RUG1 5DDJ1 3ZXFA 1DYKA 3J8F3 4W4ZA 2YG0A 4AI9A 3GZTB 4A7ZA 1JZ8A 3N3HA 4DMIA 3AK0A 1HKDA 1JU3A 1SDWA 1RHI3 2TBVA 4RGGA 1Y9GA 3L2YA 1RTVA 2RS52 4XMIA 4A6OA 1J1LA 3CIHA 1AR62 2E7TA 5DAPA 2ZCWA 2GNDA 2FCTA 3IMNA 2PHRA 2QNKA 4AFCA 3WQ7A 5LRRA 1HN0A 1TZOA 2KXLA 2X53S 4GB33 4P9JA 2ZEYA 4ZXEA 1UKRA 5BNOB 4IEXA 5LASA 2WO3A 1I3HA 3POEA 2AENA 4BQ4A 1UL9A 1Z78A 2X5IA 4ZU5A 1BYHA 3U0ZA 5JCTA 4AWDA 1AF9A 2CYFA 4N9IA 4LKDA 3TN91 2XWBB 4XQ4A 3ZR6A 4XF0A 3MW4A 1D0HA 3K75B 1NE6A 1YJKA 2Q30A 1RUG3 1ZZCA 2XUMA 2ZEZA 1ENRA 1QOSA 1YFWA 1DP0A 2UWBA 4ES8A 3O1MA 3W9AA 1QEXA 3AJYA 2ARBA 2PQQA 1K5JA 4ZZ5A 1D2QA 5EQUA 3PMSA 1UIKA 5B4NA 1VRBA 1SQ4A 2DF7A 2R063 1BEV2 3VHOA 1RINA 3ZSKA 5APAA 1BMV1 2Y6LA 3IT8A 2PHWA 3N7MA 2D5HA 1F5JA 2HJIA 4MH0E 3KV4A 3GHNA 2BNMA 3NAPA 3TEZA 3WVJA 3C7EA 2H6CA 2YYOA 5DQ0A 4XUPA 4CA9A 3BB6A 3PU3A 4E4ZA 3T2QA 5C5TA 3UGHA 3ETPA 2PHDA 4YVWA 5FZDA 2Y8KA 4KG8A 4CDUC 1W2UA 1WMXA 3NJZA 4M3CE 1W2AX 1HXS3 5T55A 4BHPA 2AC1A 2ZGMA 3PDQA 1Z7S3 2BYVE 2OQ6A 4N53C 1XSRA 4IE5A 5FJKA 3FBYA 3E1F1 2WNOA 4URAA 4JDNA 4AFMA 1OXCA 1AR71 2BZDA 1DCSA 4RS5A 2IXKA 3H42B 4BMEA 5H9SA 1VBB3 2WR9A 3ZYJB 1H4GA 4LK7A 4XFBA 4W50A 5CIRA 4AYUA 1SZBA 3RJ2X 4M01A 4DXRA 2V4AA 5LEKA 1G9AA 2WNVC 4F83A 1AYM1 1PO22 4BH9A 3IZOA 4PI0A 2R1DA 2VQAA 3SLIA 3T4VA 4D6SA 3R0RA 1W8NA 4DB5A 3LQCA 2HWC3 2I74A 3FX3A 4HSJA 3LA7A 1K3IA 4IERA 3LIHA 1K45A 2EA7A 3FC0A 1YFYA 5B2GB 5IATA 1ZA7A 3U75A 1UPSA 4GH4B 3CJIC 1C5HA 1FXZA 3RZGA 2JG8C 1HRV3 4QGNA 5AFBA 5JDBA 4GA9A 1UZ0A 4LKFA 3SMHA 4CP1A 1MZ6A 2B9UA 2PXJA 4XFHA 4ZPIA 3RWNA 4EROA 2HWE1 1NY72 5E6HA 2C9AA 2R0HA 1DDLA 1H1AA 1WCSA 2ZZQA 2DUQA 5I91A 3POJA 4FXGB 2AR6A 4M4RA 3S6PA 1QNWA 1W8UA 4IEWA 4BCUA 1EV12 4FP2A 4XQWA 1UYZA 3WF3A 5FZIA 2E53A 3WNLA 1LOFA 2VBDA 1LHWA 5DUXA 1GZ9A 4HK9A 3BN6A 1YLLA 3CMGA 4CDQB 4M00A 4P14A 2BFUL 2ET1A 2E33A 2HBUA 4XTMA 5JOWA 1PVC2 2P1BA 2DCKA 1U12A 2P6HA 2X05A 3THTA 4BB3A 2NMOA 4YNIA 4XETA 1AX0A 4LK6A 2F4LA 4I3PA 1BK0A 2R073 5AFEA 4C90A 4ATFA 2XPJA 4CU8A 1AUYA 1WA4A 4NIAA 4QHZA 5HXVA 5J37A 3Q8BA 4MGSA 2VQUA 3E6CC 2DVBA 3J26N 4RHV1 5LBCA 1UW8A 1DF0A 2J1EA 3OTFA 4CE8A 3ZSJA 3KT1A 1MZFA 5FZAA 1RB8G 1XPWA 2ZGLA 3W20A 3WNOA 1VMHA 4DUXA 3WP4A 4COWA 1WCUA 1UMIA 3FHQA 3GYDA 5FKBA 3POBA 4YARA 3SEEA 3ZVXA 3KSCA 1G9DA 3RGBA 2PFWA 1QQP1 1W8HA 3H7JA 4P5HA 3RZLA 3PUIA 2A6VA 1O4ZA 4YW3A 2PLV3 1RUC1 3POFA 1EY2A 4BQYA 1HIXA 4BQXA 3BODA 3AX4A 4Y4YA 5FZ1A 4IEQA 2VH9A 5FZOA 3VBUC 4CDXB 4HKWA 1IPSA 1LENA 2B46X 2DV9A 1VALA 4ITCA 1W0PA 4YM3A 3ASIA 1ZRDA 1OH4A 1J84A 2FZ2A 4QXBA 1DQ2A 2W87A 5EJZB 3ME2A 4RHV3 3O1UA 2WT1A 4OFGA 3SQOA 5BNPB 4Q4Y2 5BYNA 3N36A 3WEZA 4LQRA 3VKNA 4XVHA 2Z5WA 3HMYA 2BTVC 4MXWB 3ZMOA 1TME1 2RS32 3NQHA 3AL5A 3HJRA 4KQ7A 2ZXQA 4BQ1A 3KMHA 3ZFGA 3J7MA 4HONA 5FZGA 2FDGA 2V4VA 4Q4W2 4WVWA 4CCNA 1TNRA 1PGW2 2XQRA 1RC6A 2TNFA 5D21A 4Y3OA 1VIWB 2ZGUA 3OPZA 3LGRA 3MBWA 2YBPA 1HDKA 2A6ZA 3CDZB 3LDBA 3FFZA 1VBD2 2C1FA 2HWD2 4XJ9A 4YG6A 2Z42A 1S2EA 3GDBA 4NR1A 5FYBA 4GMP0 1JZ6A 5JVVA 1PIV1 1VBA3 4AHWA 5A6ZA 3RZJA 4XJAA 1UMHA 1X8EA 3R4UA 1CAWB 1VBC1 5FKCA 3NO8A 3T2TA 3U11A 4PLOA 1R1A2 1WMDA 3CHXA 2HEWF 2PHXA 5J09A 1N1VA 2ZGTA 3CJXA 3ZFEA 5JR2A 2VOKA 2ZEXA 2D5FA 4QXHA 4COYA 2VUAA 2RJ2A 1O5UA 4OUEA 1J3RA 4HKLA 1QJY2 4LO4B 5BV6A 3VN4A 1W6PB 4N43A 1CZVA 4P9IA 4Q27A 2BV4A 4C1XA 1W8WA 3J7NA 4LHLA 3WF4A 2D3SA 1N3OA 3OB8A 4HMZA 1XNDA 3ZN4A 5L7OC 4SBVA 3U10A 5IFPA 3WD5A 4HSLA 1SFYA 1UY2A 1QJU3 2B4KA 3A0KA 2Q4SA 1NQJA 3TYJA 3GCWA 4AEDA 4UYBA 4XW3A 3FN9A 2HWF1 2XJVA 5F3IA 3GJBA 5LW9A 5CFDA 4CDUB 5IT6A 1O3SA 3AZZA 4MV2A 2OUHA 3I2OA 3LPGA 1D2SA 1W39A 3LOIA 2VZ3A 4N90A 4B3NA 4BK5A 3J9SA 1YQCA 4AI2A 1PX3A 4QQLA 1VPHA 4LA3A 1J59A 1KJRA 2RE9A 2WJSA 3K4DA 1EAH1 4N53B 1W6NA 3ITQA 3HQRA 1YIFA 1XSQA 3ZIXA 5J36A 1AR63 4IE0A 3RYKA 3CU7A 2HKXA 3EYPA 4QXCA 4WVMA 3ZYRA 1ULCA 1AZDA 5F37A 5FPXA 2PQSA 3DCQA 3MEPA 1FOD1 3I3MA 1UX7A 1XXNA 2AEZA 2DUOA 2YBSA 4JV4A 2HEYF 5AC91 3P3PA 5IVBA 2HWF3 2XLGA 1RUF1 1VAKA 2EF6A 3L9JT 4URTA 1CJDA 1OPOA 4XBLA 1G9CA 4GMP1 2VO5A 4QPIC 4CCJA 4Y4RA 4LUKA 3VBSA 3DN7A 1UNBA 2IVIB 4H7LA 2VZVA 4IGPA 1QNYA 2NZ9A 1R092 2WC2A 4NHYA 3LFMA 2AZ5A 2P37A 2WL1A 2YC4A 1PX4A 3S7EA 2JDNA 3RWKX 3RYPA 3CO2A 5FYZA 3VZJA 2ZBJA 3OYWB 3CJIB 2BJSA 4MSVA 5C70A 2VOVA 2JG8B 3C7FA 4IV1B 1ENSA 3DEMA 2J1UA 2QQJA 2WYFA 1NXD1 1BEV3 1UX6A 3KD4A 2FMDA 1JZ7A 4UFHA 4IL7A 2B45X 2E9QA 4AFAA 5CYYA 2JG9C 3KF5A 1Q5OA 1SBDA 3GALA 2Q0AA 4RGAA 4D6RA 1UQXA 2WS91 2IVJA 3LF7A 1NLSA 1URXA 1LESA 1AR81 1GYKA 2WWJA 5FREA 4NRQA 2XLFA 3ZN6A 3O0WA 4DUVA 1C5IA 4FQ4A 4DXTA 3AZWA 2BGPA 1W8OA 4LMFA 4BXFA 3VHPA 3HNYM 4L99A 5FRAA 1EPWA 4MZUA 1UU4A 2C5DA 1ZBE1 1BLZA 1OF3A 3AYCA 1WLCA 4Y1ZA 2R30A 2BUKA 3K48A 3DL3A 3O5SA 3ZDSA 5LA0A 4NN0A 3Q8FA 4P00B 4A7YA 2QQVA 3E5UA 5FPUA 3KV5A 1RL3A 1OQ1A 3H9AA 1UYXA 1UPIA 4A41A 4PDWC 1BBT2 1TG7A 2W46A 4CCEA 3B01A 3N7KA 1WW4A 4LBLA 5JMCA 1VRH1 1W6MA 4UW3A 2NN8A 5FMDA 2PHUA 2VTFA 2VQ0A 1NG0A 1RUI2 3H3ZA 4UXAA 5FYTA 5CZKA 3USUA 1SLBA 5SV8A 1PO23 5I0SA 3H1MA 4JRLA 3PL0A 1HRI1 2JECA 4UFKA 2Z69A 5FZCA 1D4VB 3PVNA 3SHRA 1CAUB 4HOOA 2XB6C 5FZLA 1GZWB 2CWSA 2LROA 4UAPA 3RS6A 5IAXA 2UYBA 2WLQA 3CZJA 3DXUA 5FY8A 3MFCA 4S2HA 4Y1VA 2YFZA 5T5PA 3ZXDA 4ZXKA 4RQPC 3T4HB 4QXKA 2EICA 2WWSA 4K20A 4CEYC 2X09A 3N9QA 2RR11 3WX5A 3U37A 4YW5A 4Q0SA 3HPNA 2BBVA 4TZDA 1OT5A 3LEIA 4FBFA 1RUG2 2WN2A 1NA1A 5DDJ2 1CAXB 2VNRA 2NLRA 3K4ZA 5GALA 4YLZA 3UGGA 1OI6A 3TB0A 2EVXA 4LJHA 5FUNA 2UY8A 5C8CA 4IW3A 2GNTA 2Y6JA 4EWAA 4Y1UA 5A3UA 1ODMA 1YQ5A 2Y64A 1JZ5A 5H9QA 5LWBA 3JXSA 2Z4FA 2RDRA 1ND2C 1JS9A 2XJSA 4CPBD 2IXIA 4M3CF 4MG2A 3B7MA 1RUJ1 1S1AA 3H0OA 4DZGA 4LIUA 5J96B 1E57A 1JYWA 1NX9A 4N7IA 3MIHA 3SCGA 1CR7A 1PVC3 2VZOA 4YM2A 3WG2A 4D7YA 1D7PM 3ACFA 2VR4A 4GJZA 4Q8LA 3LCPA 3TN92 2ET7A 3LPFA 3NW4A 4AL9A 4ZY9A 4AQ2A 5DAXA 5SV5A 4CPBA 2C9KA 2VQTA 1M4WA 2PHLA 2JICA 5GM0A 4LOSA 4U36A 1EPZA 3I59B 1BVP1 2RDQA 4Z92B 3GNEA 1QOTA 2IUWA 2A71A 5FZHA 2C6SA 5EV7A 4QQOA 5H9RA 1ODNA 3HT1A 2C24A 4FI9A 1H30A 4LBKA 1H1IA 3RFRA 4NIDA 4Q26A 2P3IA 1BMV2 4NIHA 1FNZA 5FY5A 1FI2A 4YGCA 1X50A 4UW5A 3AP9A 5GZDA 1FT9A 1AJOA 3VZNA 1JXNA 2JENA 1LHOA 4A3ZA 3O1OA 1XQNA 4QQPA 1KFUL 2WA4A 3PTYA 2WQZC 4UWDA 5L7OB 5AVPA 4L0PA 3S57A 1LOEA 1QJEA 1WUVA 1MS4A 5CISA 1HQWA 4AVAA 4XFIA 3E5XA 1YQ6A 3NV1A 2OUJA 2XOMA 3FHAA 2VMHA 1IPKA 4ASLA 5C9AC 4PIXA 1RUH1 4FPEA 1W3VA 4ASMB 5FPLA 3T09A 2D6LX 1AR72 3BI3A 4AFBA 5EPAA 4KBBA 4NPRA 3ZFFA 5JZGC 5KXDA 2P17A 2RS33 2PN5A 4RFT0 3V56A 2ORZA 3KHBA 2KD7A 1H0BA 2VECA 3KM5A 3MUZ1 2FHRA 3S5QA 3H50A 4D3WA 4CCOA 4Q4W3 1PM4A 1GFF2 5IJRA 4AI1A 4FAHA 3Q8CA 1AYM2 3HD8B 4Z8BA 3NL1A 3VLBB 3HWJA 4N8MA 4BZ4A 1IS3A 1JMUB 1NZIA 3X29B 1C57A 4YZ5A 5I0RA 3T0AA 2DVAA 2Y38A 2MEV1 4RGKA 4WM7C 2VU9A 5A3MA 1SCSA 5GLWA 5HBAA 3H7YA 1Q8QA 3LSDA 1US2A 2HWD3 1WD4A 1TQ5A 3ZYBA 3IDCB 2UYAA 2F17A 3VBFC 2PA7A 4QPIB 3MF6A 3AC0A 1RUH3 3S30A 4OZXA 3M3OA 1XBFA 3OGRA 1IOAA 1OSGA 1KRIA 3WW3A 4LBNA 5LCWL 1R1A3 1RYYA 2WUHA 2BOIA 3K3NA 2HWE2 2CL2A 1OOPC 3N9OA 3V0BB 3KB5A 2CGPA 1NLRA 1QJY3 4K40A 2ZGKA 1J3PA 3DYOA 3LA2A 4XEZA 1SLAA 1UYPA 4PIZA 4GH4A 5C3RA 2YMZA 3OD0A 2Q1ZB 2WABA 2WAOA 1N1TA 2JG9B 4IE6A 4X8PA 3ZXGA 4EN8B 2IXHA 5IYYA 5F5CA 2DDUA 5C71A 4LE4A 4JHZA 1PMJX 2EIEA 2VCCA 3T0BA 5FR3A 2HLEA 4JCKA 4YVSB 3VD9A 4MGYE 1LHVA 3MHZA 5FUPA 3THDA 2VL4A 4QQHA 2ZS6B 4DO0A 3VKLA 3LDKA 2WZR1 2XXZA 2WO1A 2J42A 4AW7A 4PCRA 5CB7A 5FYSA 3O0VA 5F5IA 5IUQA 3I2JA 4BIOA 1H1MA 2BWCA 5FXWA 4NAOA 3WQ0A 3MIEA 3AL6A 4CDQA 4PDWB 4CUGA 5BNNC 5A80A 4IUGA 4FVVA 4RHV2 1JHNA 3C7HA 4JDOA 4P08A 2VM9A 3C2UA 3UT0A 4DQAA 1Y7BA 3D0SA 1US3A 2AUYA 4YZ1A 2HEVF
chains in the Genus database with same CATH topology
2GZWA 4YGBA 4XBNA 1O4TA 2BNNA 4HK8A 1G9BA 3EBRA 1QQP2 3HBZA 3OBRA 1WD3A 3H3UA 5C8WA 2F6BA 1RUC2 1V9U1 3MICA 1KS4A 1R093 2BEOA 2WZR3 4WBBA 4GULA 4XHBA 1WBFA 4LNVA 2V73A 5BUVA 3V64A 3G6JB 4RQPB 3QH6A 5KBFA 3WCSA 3JBG1 4YFWA 3ZYGA 1XNKA 1VJ2A 4CEYB 1MEC1 3GBWA 2QZ3A 1YI7A 4I01A 1RMU1 1LEDA 4Y22B 2GC2A 4AQSA 1TME2 3OGJA 1AX1A 3KT4A 3TNQA 1CJPA 4CDXA 5C4WC 3VBHC 1ND3C 3WHTA 5J98B 3VL8A 4FQZA 4HKOA 3AMPA 5LRSA 1K5MC 1ND2B 1SBEA 2TUNA 4IEOA 4UBGA 5DG1A 3TWIA 2NM1A 4IEUA 2ATFA 1LODA 4KWJA 1FPN1 4MXWA 5D8AC 2D40A 3VV1A 1N1YA 4YZ3A 3JB8A 2DVFA 1XU2A 4AE2A 4HN1A 4DINB 3NWKA 1ONAA 1BBT3 4FAGA 1N1SA 1G9FA 2JD4A 4ATEA 3VUOA 4IEYA 1KD7A 1S2KA 2GDFA 1PIV2 4R4ZA 2XVLA 1REFA 1DQ0A 1RUI3 1VBC2 2D6MA 4CTEA 4HBNA 1EYBA 4Y24A 4KG0A 4AEMA 1L3JA 1MACA 4XTPA 4UW6A 3B9IA 3R6SA 3KQRA 2IXCA 4MLOA 1WW5A 2VNOA 2DCZA 4U2AA 2GMEA 1CAWA 1FPN3 1D4M1 2QDNA 4JTNA 4I0WB 2A73B 2DCTA 3GHMA 3N7JA 3VDDC 1AX2A 1IZ3A 1H8TC 2D7FA 2ZPXA 4GKYA 2HWF2 4OULA 3USSA 3POSA 1JYCA 2AYHA 1QF3A 2OW4A 1W6PA 1H2LA 1R081 4UW4A 2VW0A 2XBO1 2ZGOA 5DDJ3 4HZFA 2IXJA 5T5LA 5C9AB 1EAH2 1BZWA 5JOZA 2NP0A 4B4RA 4K1YA 2D44A 3WG3A 2P3KA 3AKRA 5FOBB 1C8M1 3WW4A 5JZGB 4UBHA 5J7MA 3HN1A 4CDUA 3CEWA 1DU3D 1MS1A 1FOD2 1D4M3 4HL0A 2VMGA 2YDEA 4N53A 2X8KA 4LBQB 1D0GA 2DFBA 2BFUS 2PTMA 4K6BA 5AC92 3TN93 3GZUC 1RUF2 2X5IC 2ZGNA 3LSEA 2A75A 4Q4V1 4WM7B 2ZGQA 4QPGC 2XBO3 4LBOA 1IKPA 4FPLA 4R8HA 3VBFB 2ZHNA 4AHYA 5K0UC 4GKXA 2VW2A 1UMZA 2QKDA 3KGLA 3ZSEA 3RQ0A 1S0EA 2NYYA 1ZM1A 3T1MA 2CGOA 3KZ4C 1ZBA1 3PHMA 4FP3A 1I5ZA 3KLSA 1OOPB 2A5ZA 1SBFA 1MS5A 4NHMA 3B69A 2WS92 1FMD1 4H55A 4R4XA 4HETA 2NQYA 1AR82 3L2HA 2PYTA 3CJIA 3OYWA 4I0AA 4XDQA 1Q8SA 4V1PA 2JG8A 4MX3A 2GSYA 4IV1A 1V6IA 4Q4V3 1CVNA 1C3HA 1V70A 4RL7A 1G7YA 3V65A 4AF9A 1ZBE2 1NZCA 3AXEA 1CX4A 1X82A 2XG3A 1KDKA 4RR3C 3CL1A 3WDTA 4FTSA 2IFWA 1AR73 2VVDA 1KS5A 5JPMB 5JI7A 4MGIE 5EXOA 3ELNA 1NQDA 1VRH2 4M0NA 3VL9A 1YFXA 5I93A 4MGKE 3ILFA 5BNNB 3DKWA 2ILMA 1FMD3 3ZSMA 1AYM3 5L19A 5FO9B 1HRI2 2FBEA 4LO7A 4OHXA 3ZXEA 3THPA 2OA2A 1QDOA 2QE3A 2Y0OA 5FLIA 2ZACA 5BNOB 1YI9A 4BOWA 1DZTA 1DGWA 3MLJA 4GIQA 2NMNA 4X6QB 2ZHKA 3AZXA 2VNGA 1LGBA 3ZXKA 4IXLA 2ZX0A 3VBOC 2NPIA 4FOWA 5CAZA 1MZEA 5KHIA 5HCFA 1CAVB 4DNYA 4D7TA 1WLDA 2RR12 3MFAA 1CAUA 1DYPA 2HWE3 4AXOA 5EZWA 1GZWA 4O9GA 1PHMA 5JR7B 4FOQA 4K7JA 4L92A 5FQ0A 3BTAA 3TNPB 1YJLA 4XF3A 4P9LA 3AKSA 1QDCA 5DXDA 5IK8A 3AKTA 4BE3A 4OI2A 2WQ4A 1LHUA 4YSFA 4PLMA 3D8CA 3D6EA 1QJX1 3R05A 4IV3B 1W6QB 4H3WA 3VBHB 5C4WB 1ND3B 3ES4A 2D3PA 4G3YC 1RUJ2 3FLRA 2A3WA 4I09A 1XE7A 4R9AA 5T3NA 4OI1A 3MI8A 3ZIWA 1CAXA 1K5MB 2BW8A 3MIFA 1H2NA 2A6WA 1H9WA 1OLRA 1SLTA 5I8YA 1UN1A 3ZYIB 4HANA 1RVF1 2WNEA 3NV2A 1GKBA 3DUIA 1C8NA 4XF1A 4XF4A 4Z07A 4BYYA 3SISA 2JJ6A 3IPVB 4XMAA 4FTEA 1SACA 2SBAA 2WT0A 3NVCA 2XJRA 2A70A 3LA3A 1ULDA 4YW1A 3DF0A 1NCRA 1QQP3 2DU0A 1Y43B 5I0UA 3UKVA 1RUC3 2WINB 3PJYA 4XJWA 3ZPYA 4NOTA 3VZMA 4IEPA 3ALQA 4LA2A 3VDDB 3I54A 3FHIB 1H8TB 1UAIA 2HWB1 2R0FA 4HLTA 4CDWC 5JSOA 4NWVA 5EYXA 2VW1A 2JE7A 5ABJC 4H14A 4AGVA 4J6GA 1DBNA 1SLCA 4E27A 4XJZA 1RUH2 3VZLA 3MZHA 5KHGA 3M70A 5F1RA 4QMAA 1OQEA 1TME3 2VY0A 1HX6A 4J1XA 1PM7A 1BQPA 4EN7B 1DQ4A 3IDEA 3TOJA 3AKQA 4XJUA 4YG0A 5DUWA 1IQAA 2ZX4A 4MGZE 5F5QA 4AK3A 5FTTC 3M3EA 4ISQA 1QXJA 4MYEA 3ZFGC 1POV0 2A3YA 2JDZA 1Q3EA 2R041 2VOWA 3I8TA 4OHYA 3QH7A 4JGYC 3VZOA 5JLVA 1PO11 2MEV2 3RRDA 1CD3G 2OYZA 4AHZA 3LWCA 4QHBA 4INDA 4W6WA 4E2GA 4Z82A 2DTWA 2ZX2A 2CV6A 5I8SA 3A0NA 4AGRA 1PIV3 4QPGB 4AEJA 2ZOEB 2CWMA 2PAEA 1VBC3 2E7AA 4DB5A 1HQNA 4Q0PA 3IM0A 4HFSA 2WT2A 2O1QA 1I9RA 4KGQA 5K0UB 4HVOA 4PJYA 5F6LB 3UV9A 5K9YA 3VBRA 4XZPA 1REDA 4QPIA 4NHKA 1IPJA 3KCCA 3MLLA 5DZEA 1DFQA 4Y1XA 5D1IA 2K9ZA 1WW6A 2UU8A 3ATGA 4GALA 4N43C 2K2SA 5CFCC 4Q8KA 2HYKA 2WNVB 4PBPA 2VVFA 1OLQA 4YW2A 5K8SA 1GBGA 2O8OA 3JD71 3MLKA 4OUMA 3WINE 3ILNA 3V0BA 4WVZA 1OFSA 4PQ9A 1BXHA 3INAA 3UJOA 1WMEA 1BCXA 3BOPA 2YROA 3ZSLA 5CFDC 1J58A 2JG9A 1EAH3 2WZR2 2B8MA 4RR3B 5A32B 2WNUC 4META 5L73A 4XF9A 3O12A 3TRSB 4Y20B 3OCPA 4YVSA 1ZZ9A 4Q4X1 1HW5A 2W39A 2DTYA 1POV1 3HIFA 3WT3A 3IN9A 1FOD3 3WG1A 5I0TA 1N3PA 1Q8VA 3AP7A 4G4FA 1IHMA 1AYN1 1S0FA 4KWLA 3JD73 4LHKA 4NO4A 1ULGA 5AC93 5BY5A 1RUF3 4QPYA 2Q1MA 1RGSA 1RUOA 4AI0A 3URFA 2GALA 4GMP3 4AHXA 4PDWA 1O7FA 3DPRC 2R6QA 3AJZA 4HN0A 5GLUA 4LUMA 3VHNA 1V9U2 1YCIA 3WUDA 1CQ9A 3N7LA 4IQPA 3VBSC 1CGPA 5FBZA 5C33A 2W0XA 3VBOB 2Z2SB 2ZX1A 3JBG2 1G6NA 4LR4A 3RZZA 3HAGA 1MEC2 3MIDA 5EFUA 4JQRA 4PF5A 5KXCA 2UY9A 2DCYA 2EAAA 1BK1A 2WSVA 1LHNA 1RMU2 2DUPA 1U5YA 2I45A 5SV8A 1JUHA 2B39A 2WS93 4NWWA 3FLTA 4C0HA 4F7ZA 1AR83 2JKBA 2MPFA 2Y0IA 3MW3A 1S0BA 1XNBA 4CEYA 3DV8A 1O5LA 4AGGA 1ZBE3 4W6XA 2PAKA 4Y22A 1FPN2 2WA3A 1TNFA 1UZZA 4COVA 4A3XA 2C0ZA 5C6CA 1JOJA 3SNMA 3EJKA 3VBUB 1EV11 3AP4A 1VRH3 3M8LA 2XH6A 4LO5B 2PELA 5KC6A 2E63A 1TMF1 3AFKA 5KHHA 3POWA 1HRI3 4OHZA 4LO8A 3G7DA 3IBMA 5JAXA 3OBTA 4AVBA 2JXAA 3JUUA 4KNCA 1LB2A 3MF9A 4GWMA 4OI4A 2RMU1 5CVRA 5BNOC 2PAMA 2RM21 1RUE1 3WZ1A 2VG9A 1CONA 1D4M2 1OKQA 1LOGA 1VAVA 4WM8C 3U07A 4EN0A 1XRUA 4FO9A 4WV8A 4Z1VA 1DG6A 4YM0A 1HV0A 1Z0HA 5T5JA 2RR13 3AYDA 4B4PA 2Q5TA 2JEMA 4R52A 1ZZ7A 2VOXA 4NVPA 1O4YA 2KA3A 3W58A 1R082 4GWNA 4CDWB 2XBO2 4L11A 5E8AA 5KXEA 4FPHA 5ABJB 2MNGA 1MVEA 4LHNA 1F2NA 4FPCA 5H9PA 1ASJ1 1QH6A 4FOYA 4FPFA 1C8M2 4IEVA 2LUWA 4J1WA 5GJ6A 5C8CC 3VKOA 4DRVA 1OD5A 2WFF1 1RUJ3 2WKKA 4CEWC 1FX5A 1WCDJ 2RM23 1LOCA 4BLIA 1MQTC 4D69A 5KXBA 4XE9A 2DVDA 4YG3A 3KGZA 5C9AA 1KDMA 3ZFGB 2IZWA 4LBQD 1ZZ8A 3PMEA 4A2UA 1CN1A 5BXXA 4E2SA 4JGYB 4DS0A 1U0AA 5EYYA 4Q4V2 3WOGA 5JZGA 3TBDA 3FUOA 1WLWA 2LM3A 3S7IA 5JWPA 3KCYA 3SH4A 3AMMA 1UU6A 2D3RA 3B94A 5TSWA 1APNA 4LBQA 3RSJA 4KWKA 5F9TA 1DZRA 1XYNA 4MVTA 3SH5A 5FO8B 4QM8A 5FMOL 4WM7A 1ZBA2 2RS11 5A33B 1YHFA 3OY8B 2ZX3A 1S0CA 3OGGA 5J3UA 2XJTA 2ZABA 2ZMLA 5JOYA 2E6VA 4BPZA 1FMD2 1U5IA 3RG0A 2YUEA 2QJVA 1DQ1A 4X6RB 3ZXLA 5GLZA 1LECA 3BIWE 2WLPA 3NKGA 5CFCB 2EXHA 3IIAA 4ISRA 5T50A 3UKNA 3ROUA 1NCQC 2YPJA 1V6NA 1OOPA 2QDRA 1B35C 4AVVA 1KJLA 4D94A 3MPPG 3MIBA 2DCJA 1XYPA 2BQPA 2IC1A 3GZAA 1MS0A 3GBFA 1T6GC 1QOOA 4PLNA 1DGRA 1SLIA 1UD1A 2RS13 2WNUB 3ZFFC 3RJRA 1XU1A 4FT8A 2EXJA 4AQ6A 1ENXA 3VKMA 4YFZA 4KU8A 3O0XA 1UKGA 2MEV3 2E7QA 3I4IA 3RNSA 1DIWA 5F6KA 2WSUA 2ZGRA 4I30A 3EHKA 1Q8PA 4QT6A 4R9BA 4EV0A 4XIOA 3R4DB 2V09A 3H1WA 5FDBA 2R16A 1DHKB 2MHFA 4FPJA 1PZ7A 3DPRB 2GMMA 5BNNA 4BMBA 5FLJA 4O9EA 3MDPA 3B3QE 4JVAA 4XFCA 3VBSB 4Y26A 1XE8A 5BNOA 5FFOC 4D7SA 1KXGA 2IWGB 4LLOA 2BGCA 4HVRA 1VBE1 5IK5A 4X8NA 2VXRA 1Q43A 1GICA 1CAVA 1QJX2 5ACA1 2QQPA 1ZNPA 4PBOA 3T1LA 1X33A 3KCXA 1H2KA 2YV8A 4W6YA 3ZX7A 1YNAA 1PMIA 1RIRA 4LT5A 3UJQA 2VVEA 1UZYA 3ES1A 1S2BA 3WY6A 4FOVA 1WLTA 1AL0G 2B7YA 2YGMA 4JRAA 3NV3A 3PVOA 3DGTA 1RVF2 1AL21 1LULA 4IV3A 3AM2A 1W6QA 5C4WA 3VBHA 5IK4A 1ND3A 1O91A 4YZ4A 2FQPA 2R1BA 2XL7A 1K5MA 4RA0A 2G9GA 2XJQA 1C1LA 3PLQA 4XXPA 3J4UH 1W6MB 2QFEA 3QLQA 1COV1 1VLNA 2WFPA 1C1FA 2V5YA 4JGZC 1QMJA 2WIIB 1V9U3 3IPVA 2Z79A 4I2OA 4DY5A 5BNPA 1DQ6A 2W52A 1LKNA 3CF6E 2Y26A 3S0MA 4TLFA 5KHJA 1LRHA 1RUD1 4WM8B 3JBG3 2H0BA 2HWB2 2GMPA 5HI0A 3J8F1 4BWOA 1MEC3 1A3KA 1I6XA 1RHI1 5BPXA 1RMU3 2OIIA 1YO8A 3IDBB 1FNYA 1BJQA 5HCAA 4GB31 1H8TA 2YHJA 3UL2A 1QKQA 1OFNA 3M3IA 4Q1RA 4CEWB 2R042 3K51A 3MW2A 4Q0QA 3WQ1A 1OHFA 4AVCA 1MQTB 1REEA 4P9YA 1RUD3 3C3VA 1PO12 4EJRA 3WNXA 4Q0UA 2YC0A 1RUNA 4OHVA 1WCKA 4EWEA 3SH3A 2K0GA 4K8FA 2EAKA 4I3GA 4L2NA 4B8EA 1O3RA 4HPKB 1QY4A 3BCWA 3RPQA 4K21A 1IS5A 2R061 1PK6C 1ZYBA 4OHWA 4W65A 1LTEA 4FSJA 2GN3A 2B5HA 1S0DA 4KL1A 1AR91 3QACA 3B02A 3PJQA 4QPGA 2GNBA 1MR5A 3FE5A 2ZGPA 3NSTA 3WV6A 3BALA 3QOPA 5K0UA 1DGLA 1HXS1 3ILRA 1GNZA 3JD72 4C1WA 5A3LA 3GBGA 1Z7S1 1JTZX 1SCRA 2ES3A 4WZFA 4C0BA 3CLPA 4HT1T 4Q1PA 1R083 1GNHA 4AI3A 1RJ7A 4BIFA