1Q8OA

Pterocartpus angolensis lectin pal in complex with the dimmanoside man(alpha1-2)man
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Oligomannose Recognition by the Pterocarpus angolensis Seed Lectin
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords lectin
total genus 53
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q8oA00
1GSLA 2D3SA 1Q56A 1Q8VA 2DUOA 4Z8BA 2GN3A 4ASMB 4FOYA 1Z0HA 4Y26A 4CZSA 1B09A 1GBGA 3HR9A 4XIOA 4YW1A 4Y20A 3AZXA 5IK8A 2AUYA 2B7YA 1W6PA 2NP0A 3AX4A 2WLQA 1LESA 1GZWA 2ARBA 1Z78A 3D5OA 4HANA 2SLIA 1FNZA 4FVVA 1V6NA 4KBBA 1WLDA 2ZABA 2AR6A 3WG4A 2VY0A 2ZMNA 2XG3A 3AYAA 1LHNA 3ZSKA 5HCBA 2D6KA 1SACA 3UJQA 3VUOA 2OW4A 1D0HA 1U0AA 5AVAA 1GNZA 1V6MA 5F5QA 4GWNA 4R9AA 5GZEA 3ZXJA 3ZSJA 1SCSA 3OY8A 3WNXA 3RQ0A 5DG2A 2PHXA 5E89A 3N3HA 4R9BA 4JCKA 1DIWA 5JOYA 3H0OA 3QCWA 4FPGA 4YM0A 1H30A 4YW3A 2Q5TA 4YGCA 2ZHMA 1S1AA 4Q27A 4XJ9A 1KJLA 2DVBA 3WLUA 1AZDA 2DVGA 5KXCA 5DZFA 4YZ3A 2ES3A 2H0BA 4Q1RA 1W6MB 2ZMKA 1RITA 4YZ1A 1JN2P 4D69A 2R1DA 1CQ9A 2D3PA 2W39A 4XJAA 5KXEA 5GLWA 2LALA 3AYDA 5EXOA 5LK5A 4AGVA 4YZ5A 1AVBA 1H9WA 1GANA 2GMPA 2LTNA 2D3RA 4M00A 3QLQA 1WLWA 1VALA 3R4UA 3V0AA 4W65A 1C57A 1MZ6A 3GALA 4NOTA 2A3YA 3PJQA 2EAKA 4Q1PA 1ENQA 1MS8A 2GNMA 3WVJA 1DFQA 2HYKA 1UZZA 2E7TA 2DTYA 1KDMA 5DUXA 5FREA 1CN1A 1N1YA 1DQ0A 4Y1XA 1TEIA 1S0EA 1Y7BA 4YZ2A 5DXDA 1G8WA 3LSEA 1AX2A 1GZ9A 1GZCA 1WBFA 4GA9A 2D6OX 5T5OA 1IS4A 1N1TA 4DFSA 3UJOA 1SCRA 2NZ9A 4UW3A 3AYEA 1PZ7A 3AJZA 2GMMA 2NMOA 3Q9OA 4PF5A 1CIWA 2PHWA 1LOBA 4K21A 1QGLA 4F83A 3FLPA 2P3JA 1N47A 1APNA 1MS1A 3SH4A 5GZDA 1IS3A 1R1ZA 1V00A 3AYCA 1QU0A 2OUJA 1ULDA 3M3CA 4GXLA 2A6XA 1A78A 1C1LA 1W0OA 3N7JA 4ITCA 3D6EA 1WLCA 3ZSLA 1G9DA 2ZZJA 1CONA 1UPSA 4FPEA 2GALA 1S0GA 1BZWA 4Y1YA 2DUPA 1S0BA 1MVEA 4LBJA 1V6OA 3WDVA 4LBKA 4YM1A 3A0NA 1IS5A 3SNMA 2E6VA 4UW6A 4XBNA 4Y22B 5EYYA 3SLIA 3ZYPA 2ZGQA 4I30A 1LJ7A 4DQAA 3BOPA 1ULCA 2DYCA 4XOGA 1BYHA 2NN8A 1N1SA 4Y20B 5KXBA 3ZXKA 1LOFA 3SISA 2C5DA 2E53A 3N7KA 3AZYA 3WDWA 1CR7A 3OPZA 4XHXA 2YV8A 3M3OA 2A71A 1DHKB 1UAIA 1WW5A 1EPWA 4FQZA 1V6JA 4XTMA 3B00A 2Z42A 3M1HA 2V5YA 1F9KA 3OYWB 1QOTA 1DQ6A 2EXIA 3SITA 1KITA 1I1EA 4YW5A 1GLHA 1FAYA 1J1TA 1JXNA 2GMEA 1WW6A 1GYKA 1SLAA 1ULFA 4YGEA 3AP5A 1G9CA 1BKZA 1DQ2A 3U4XA 2PHTA 3OY8B 4M3CB 4WZFA 5IK7A 1SBEA 1LOAA 4FPCA 3VV1A 1AX1A 3VKLA 3WZ1A 1O4ZA 5DZEA 2OUHA 5H9SA 1ZM1A 2EXHA 4Y1UA 1BQPA 5DUWA 2SBAA 4Q8LA 3DUIA 2C9AA 1W6QA 2RHPA 3B9CA 5JOWA 4LBOA 1WW7A 3ENRA 2D6MA 5H9PA 5GLUA 2VH9A 5GLZA 1MS4A 2A70A 2ZGPA 4XMIA 1DZQA 2ZACA 4DRRA 1ONAA 3B69A 1VAMA 4PBPA 3RRDA 5E8AA 1LOGA 1G86A 4YFWA 3WHTA 1LHOA 3O0WA 4P14A 2YXSA 1ULGA 3ILNA 4P9XA 1LTEA 2JKBA 5IK4A 2R1BA 2UU8A 2A6YA 3IKWA 3W58A 4FOQA 2D43A 2GNBA 1SLBA 3INAA 4LBQB 2KM2A 1QF3A 3MEPA 4U2AA 1FV2A 2DU0A 5T55A 2DU1A 1AXZA 2EXKA 1S0CA 2GNDA 1GNHA 3R4SA 1YIFA 1QOOA 3N36A 4AVSA 1G9BA 2WT0A 5GLTA 3AFKA 1JW6A 1KDKA 3PVOA 3RS6A 2PHFA 1I3HA 3T1MA 4DS0A 2ARXA 1LHUA 2ZGKA 3AXDA 2YY1A 4FQ4A 3AJYA 4JC1A 3WG2A 1SLCA 1F5FA 2P3KA 1JUIA 1LENA 1UX6A 4BLJA 1LCLA 2EF6A 1PZ8A 4ZKTB 3WCRA 3B3QE 3BIWE 2CNAA 1MS3A 4YGBA 4ISRA 2V73A 1MS9A 3ASIA 4L8QA 4NO4A 5T5PA 3WOGA 1GICA 1SFYA 1YI7A 2WKKA 3AZWA 3N7LA 3B01A 1OKQA 1QNYA 4ISQA 1IS6A 3APBA 3KQRA 2E51A 1D2SA 1GKBA 3A0KA 5JMCA 1G9FA 2WT1A 1V6IA 2AGSA 3M2MA 4YW4A 2TEPA 2VUAA 1JYCA 3OGGA 4XYXA 2D6PA 2VW1A 2UURA 5GZFA 4M01A 3FLRA 1LOCA 3FUOA 1AXYA 4LBMA 3ZVXA 2PHUA 1UMZA 2JE7A 2WSVA 4AYUA 2ZGSA 3HMYA 4LBLA 3BTAA 4FPFA 5T50A 2NM1A 1JHNA 4K20A 4XHBA 4R9DA 1AX0A 1IOAA 1G7YA 3V0AB 4BOWA 5CAZA 3AP7A 5T54A 1DQ1A 3VKOA 4TZDA 1LGNA 2D6NA 5H9RA 1MS5A 5T5JA 4DRVA 2ENRA 3DGTA 2DURA 2UWAA 4M3CA 5JVVA 2FMDA 1HDKA 2WSUA 3AP6A 3MPPG 3LSDA 2AREA 5EYXA 4AWDA 4FPJA 4AGGA 1DBNA 2GNTA 2OVUA 4XJUA 2AYHA 4CRQA 5GALA 4JRAA 2AH2A 4XJWA 2ZMLA 4YG0A 3ILRA 3V64A 3O0XA 3WHUA 1AJOA 1V6KA 3C2UA 4FOVA 4HL0A 4Y24A 5DG1A 4YW2A 1KRIA 5FRAA 5T5LA 3M3EA 4R9CA 3NV1A 2GDFA 1N3OA 5E88A 2ZGRA 4UW4A 2NYYA 1OQ1A 1QOSA 2JJ6A 1SLIA 1FYUA 4P9YA 2ZGNA 5GJ6A 5SV8A 4BLIA 3VKMA 1LHVA 1VAVA 1URXA 2ZGLA 3WDUA 1LEDA 5CNAA 3V0BA 2DV9A 2E7QA 3AP9A 3AXEA 2JD4A 4GALA 4YGDA 1O4YA 5IT6A 3NWKA 4ZXKA 1JYIA 1MZ5A 5GZGA 2A75A 2ZAAA 3A4UA 4AGRA 3FUQA 3O5SA 2WQZC 3POYA 4AVTA 1ULEA 1S0JA 4FP2A 1AJKA 4K1YA 5HCFA 3IPVB 1W6OB 3WG1A 4AVVA 1LGBA 1UL9A 4FOWA 3T1LA 2PELA 3R05A 1HQLA 4ATEA 3WV6A 1C1FA 2W08A 4YM3A 1W6QB 3TAYA 2ZGOA 3I8TA 4C1XA 3RG0A 2AENA 2YZ4A 3NV2A 3NV3A 1WW4A 3VKNA 3V0BB 1DYKA 1QKQA 2BQPA 1FATA 1F31A 1WCSA 1QDCA 3SH5A 4XJZA 1CESA 1KJRA 1LHWA 2NMNA 3FBYA 3OYWA 4OZXA 1QNWA 2P37A 4WVWA 4XIKA 4Y1ZA 3WG3A 1WBLA 1A8DA 2CWMA 2EIGA 2DVDA 1LGCA 2ZBJA 5L73A 1CPMA 1HLCA 1CPNA 1VLNA 1XQNA 2ZA9A 3IN9A 3ZXLA 2YROA 3I4IA 3JUUA 5DUVA 1NLSA 4FPYA 4LBNA 1S0IA 5T52A 3BODA 2WT2A 4YFZA 1CJPA 3HN1A 1HQWA 2CWSA 3WCSA 1GZWB 4DPNA 3IMNA 3AZVA 4XZPA 4LBQA 4XXPA 2W52A 5H9QA 1SBDA 3AZZA 3SH3A 2VW0A 3NV4A 3PVEA 2P3IA 2ERFA 1A3KA 1W6PB 3WDXA 2ZKNA 2ZHLA 1LOFC 1SBFA 2YMZA 1LODA 1LECA 4FPHA 1WUVA 3IM0A 4GKXA 1MS0A 1DYPA 3OBTA 2DTWA 4BM8A 3USUB 3OJBA 1S0FA 2CY6A 1H9PA 2VW2A 1Q8QA 4MYEA 5GM0A 4YM2A 5BYNA 1Q8SA 3POSA 3O0VA 3RSJA 4GKYA 2CL2A 2DVAA 4U36A 1UZYA 3KM5A 2R0FA 1PZ9A 2A3WA 4XMAA 5DUUA 4M3CF 4XXAA 2A6ZA 1QDOA 2I2SA 4UW5A 4YLZA 3MW2A 1RINA 4PQ9A 5CB7A 2R16A 5JDBA 4PCRA 1ENSA 3IPVA 4FPKA 2W68A 4RA0A 4Q8KA 3WUDA 1BJQA 3ATGA 1DGLA 4YG6A 5KXDA 4LBQD 2JDZA 1DQ4A 2ZHKA 1YXWA 1G9AA 2D44A 2CTVA 1SLTA 4H55A 4FPLA 4XBQA 2EXJA 1JOJA 1N3QA 2ZGTA 2A7AA 5IUQA 3RMYA 3ZYRA 1C4RA 4XILA 3JU9A 1S0DA 1LULA 1Q8OA 4BMEA 1NXD1 2JECA 2R0HA 2WJSA 2UWBA 3CNAA 3L2YA 3N7MA 4IQPA 1W6NB 3WUCA 5CBLA 1YO8A 3ZPYA 1OFSA 1Q8PA 2CYFA 2VU9A 4PBOA 1GV9A 1LOEA 4K1ZA 5GLVA 5HCAA 4FPOB 2A6VA 1MR5A 2A6WA 3AK0A 3O12A 4FP3A 4Y1VA 2A3XA 4SLIA 2ZGUA 3RMXA 1FNYA 2ZGMA 3T2TA 4XTPA 1W6MA 3FFZA 1FX5A 2A5ZA 2FHRA 2P34A 5JOXA 2UWCA 4XJ8A 4WVVA 1FV3A 2WNEA 3MW3A 5JLVA 5CA6A 1WD4A 1SLLA 3ZXFA 2DUQA 3USUA 1LEMA 1AF9A 5EWSA 1YRZA 1VIWB 1UN1A 3FLTA 1ZA4A 1W6NA 4RL7A 1AXKA 2R49A 1V6LA 3VKFC 3ZSMA 2GN7A 4BPZA 1MACA 1BXHA 1LU1A 4CTEA 3AP4A 4Q26A 4XBLA 1DLLA 4Y22A 1QMJA 5GZCA 2DVFA 3M3QA 1KQRA 1N1VA 2XB6C 4XE9A 3ILFA 4YG3A 5DZGA 3ZXEA 2ZHNA 4YZ4A 2VXRA 4BMBA 1JBCA 4P9WA 4XDQA 4TYSA 2DWRA 1W0PA 4C1WA 1IKQA 3MW4A 3UK9A 4WV8A 2EALA 2D7FA 3N35A 5F9TA 1W6OA 2D6LX 3D4KA 4GWMA 2JE9A 3V65A 3UL2A 1N3PA 1MVQA 2PHRA 1ENRA 3PMEA 3OBRA 1X50A 5JOZA 1YYNA 4BQ1A 3TB0A 1IKPA 1RIRA 3WDYA 2G4IA 1CVNA 1DQ5A 3PVNA 4Q2FA 5IK5A 4M3CE 1UKGA 3W59A 3WDTA 1WD3A 2P2KA 3GNEA 4ATFA 3POWA 1LU2A 3LCPA 1HKDA
chains in the Genus database with same CATH superfamily
1OH3A 4CDQC 3KZ4C 1JOPA 1RUD1 5FZ0A 2DUOA 1L7RA 3B7MA 3M70A 3HQUA 2W3JA 4MGZE 4FOYA 4QPGB 5FZEA 3TN91 1RJ7A 4CZSA 1CX1A 3QH6A 1B09A 3RI9A 1AR72 4D8MA 3PUSA 4Y5SA 2ZJCA 5FYCA 3DPRA 2OXBA 5L9VA 2NP0A 4XFHA 1POQA 5J36A 1GZWA 3BTXA 2Y64A 1Z78A 4QGMA 2IC1A 1V6NA 4R8HA 3MUZ1 3QACA 2VZOA 4HOOA 1UU4A 2WLPA 2JB8A 2Q1MA 2ZX0A 3NJYA 1XNAA 2XG3A 3AYAA 1COV2 2ZS6B 4FI9A 4AEJA 1LHNA 2IZWA 2XR4A 4CA9A 1H6YA 5B2GB 3UJQA 3VUOA 1RTVA 2QQNA 1DZTA 1OF4A 2OW4A 3G7DA 1YJLA 3DYOA 3HBZA 5F5QA 1PO21 2PMWB 1RUJ2 3I2GA 2XVGA 4F3JA 5FZ9A 3IDBB 5FK8A 1X7NA 3X29B 2HEYF 5JOYA 1DIWA 4NN0A 5L7OA 4FPGA 1REDA 4D6RA 5C6CA 1U12A 2PLV1 3MFCA 3EYPA 3SCGA 2Q5TA 2ZHMA 2JDMA 4UFIA 3OUHA 4A6OA 5LZ6A 3A23A 2MPFA 1JN2P 3WW1A 2J7MA 1CQ9A 4QXHA 4XJAA 5EXOA 3AYDA 4AGVA 1R64A 3BN6A 3N4MA 2RR13 3QBQA 4PDWB 4QQPA 5CFCA 4IGQA 2LTNA 4Q4X3 5A6XA 3R4UA 1VALA 1PVC1 1C57A 1MZ6A 4NOTA 3W20A 2EAKA 4GJYA 4PLOA 1RHI3 4XW3A 2BJSA 1FPN1 1BBT1 1V9U3 4EJRA 2GNMA 4KWJA 3LA3A 2E7TA 1HRV2 5DUXA 3RZHA 1CN1A 1NQJA 2Z5WA 4YZ2A 3FX3A 5BNQA 1GZ9A 1WBFA 4J25A 4LNVA 4LLOA 1QEXA 3W5NA 1IS4A 3KLSA 1VB4A 4LO5B 3IDEA 3UJOA 2NZ9A 1RMU1 1PZ7A 3Q9OA 2GMMA 4WVMA 2W92A 3ZN6B 3DEMA 1VBD3 3CZJA 4RS5C 4AVCA 4ARXA 2P3JA 2YU2A 4XF9A 4DOUA 2P6HA 4E4SA 2RMU1 3MGUA 3SH4A 3VBOB 2HWF1 4KU8A 1IS3A 5ACA3 3M3CA 4GXLA 2OUJA 2AACA 1VJ2A 1AYM2 1NXMA 4FPEA 2B45X 1S0GA 2GALA 2JDHA 3AFGA 3MV11 4RQPB 3RI8A 5K0UB 2FDJA 3POJA 5C7GA 1U5XA 5LY1A 1UWWA 4LBKA 2BBVA 1NA1C 3VBRA 4UW6A 4Y22B 2JDNA 1PMHX 3P5BA 3KVAA 4I30A 1L3JA 3ZM8A 1ZBA1 2DYCA 3SXWA 1GU3A 1BYHA 5HPOA 2IXIA 4QPIA 3ZXKA 3SISA 2E53A 1XYNA 3WDWA 5TSWA 2FMYA 3I2DA 4LA2A 1BBT3 1V9U1 4DB5A 2A71A 3VZJA 1AYM3 1UAIA 2HBTA 2WNVC 3FHIB 2VZQA 2YPJA 2BU9A 1W3XA 3PUHA 3KV6A 1FT9A 2HWE3 3OYWB 4LUMA 2XMLA 2V5YA 5A3LA 1OLME 3CZUA 3WF4A 1DQ6A 2EXIA 2HWB3 4FXGB 3SITA 2RVAA 3TEXA 3Q8CA 3WQ0A 2ZOEB 5A3TA 1FAYA 4ARYA 3K3OA 2GMEA 3FWEA 1SLAA 3TOJA 4LUKA 5C8WA 1G9CA 1QJFA 2PHTA 3K2OA 4PIZA 3H8XA 1PMJX 3OY8B 3WD5A 3AKSA 4QPYA 1PM7A 2K9ZA 4Z1VA 1AX1A 3E5UA 1Q43A 3H3LA 4HBNA 1O4ZA 4O65A 4R52A 4SBVA 1QXJA 5DZEA 1XYOA 4CEWC 2EXHA 4AHZA 2RS31 5FZ6A 3DUIA 1W6QA 1UOJA 4IE4A 5JOWA 4YWAA 5IAVA 4QPGA 3RZKA 2JDAA 3NMBA 5H9PA 4CEYA 2PHDA 2BGOA 4OCTA 3EBRA 5FZLA 5GLZA 2ZGPA 4K9SA 1RUE3 4XMIA 1DZQA 3ZO0B 4DRRA 1HRI3 1ONAA 4QB2A 1B35C 4RYDA 1RVF3 4IV1C 1YNAA 5APAA 4CPBA 5E8AA 1O8SA 2O14A 1EP0A 4MVTA 1ZRDA 4GULA 4ASKA 3O0WA 4Q4Y2 1ULGA 2BW8A 3ILNA 4QD2A 2VMEA 5IVCA 2YU1A 3K3NA 4IXLA 4CCOA 1UW8A 2A6YA 5I93A 3A21A 1ZX5A 2QQOA 4QX1A 2D43A 4UI9L 3VDDC 3W58A 3ZKYA 4DXZA 1PNFA 1RUNA 4KGGA 1UCXA 3MEPA 3PJYA 4Q4W3 2DU0A 3GBGA 2K46A 2H0VA 4IEOA 4Q0VA 4MHRA 2RV9A 1QOOA 2Y38A 2WQ4A 2XJVA 4IEPA 4INDA 5GLTA 4Q0SA 1J3PA 1QQP2 2VBDA 4Y5TA 2PHFA 4DS0A 3T1MA 4MHUA 5A3OA 2ARXA 2WQ8A 2K2SA 1ASJ2 5FYYA 4JC1A 4YARA 3KSCA 2WO3A 2P3KA 1JUIA 4RR3C 4KWLA 5FZOA 5LK7B 1RUH1 1PZ8A 4AEDA 1CAVB 5FPUA 1PIV2 4G4FA 1BBT2 1HJFA 2CNAA 3HT1A 4CEWB 4ISRA 1YEWA 1RHI1 3ASIA 3IAQA 3KHCA 1ZZBA 2PFWA 2VCCA 2Z79A 5J09A 4N9IA 1GNYA 3WOGA 1YI7A 1SFYA 2D5FA 3AZWA 2LW8A 4DO0A 1HV0A 3LKJA 1XB9A 4AOCA 3FMGA 5K9YA 2HWD2 5FZDA 1W8FA 2GAUA 3A0KA 2WT1A 1HB4A 1V6IA 3LIGA 3M2MA 4QXKA 2YB7A 4KL1A 4TXWA 1MQTB 5FKCA 5LBBA 4CUBA 1GP6A 4I02A 5LA2A 4V2WA 5GZFA 3TBDA 3VBOA 5FZAA 3FLRA 4CU9A 5FZ4A 3FUOA 4LIVA 4XF3A 1WLTA 2XVLA 4MZUA 4LIUA 2ZGSA 3HMYA 3T2OA 1V0AA 4CDXC 5BV6A 5CYYA 2ZCWA 1OLMA 1JHNA 2NM1A 5F2WA 5A32B 3S5QA 4CP0A 3LB9A 1IOAA 1G7YA 3V0AB 3BOWA 2Q30A 1AYM1 4BOWA 2CGPA 4I3GA 2FCVA 1TNFA 5JUVA 5D2AA 2OQ7A 1O91A 1D4M1 1W06A 1C28A 2DURA 3RVHA 3C7HA 2HWB1 1HDKA 4TSVA 5C4WC 3AP6A 3MPPG 4WM8B 2W94A 3LSDA 4DIQA 4AAXA 3AKPA 1VBC3 2XBO2 3C7EA 1HRV3 4AGGA 1DBNA 2GNTA 5FDBA 1AL22 2QBXA 4NRPA 5JR2A 1W9WA 2AYHA 2VMGA 4CRQA 3LAGA 1HIXA 4LT5A 4QPIB 1HW5A 5FUIA 4YG0A 3ILRA 5DAPA 5BNPB 1F15A 4HL0A 4IEWA 5DG1A 5A3NA 3O1TA 4HZFA 1NZIA 1J3QA 4JTOA 5A32A 4H2AA 4IEYA 3S57A 1OQ1A 5GJ6A 2ZGNA 5CIRA 1LHVA 1PK6C 1VAVA 4JGYC 4XACA 4WM7C 4BQXA 1LB2A 2QFEA 3AP9A 3TN92 2WWJA 2ZPXA 5EIYB 5JZGC 3GHMA 4OHXA 3KV9A 4XCAA 4ZXKA 5GZGA 1VRH3 2ORZA 2KXLA 3ZFGC 4J6GA 3WR0A 4AGRA 5DDJ2 3TYJA 1EAH2 1AYN1 3H1YA 4AFAA 2UY9A 1ULEA 1S0JA 4UBGA 1PO12 1UY0A 2J1AA 3HIFA 3WG1A 4AI3A 1W03A 4AVVA 3CLPA 5BNNB 2Y0IA 3R05A 1HQLA 3MBWA 1C1FA 1R093 2JX9A 3KT7A 4GH4B 4ZS3A 4QQLA 4LOTA 2R062 3ZLIA 5FYVA 1WCSA 2BQPA 4DEQA 5I0SA 4QGNA 1PO22 4NPRA 4P00B 4WM7A 1CESA 4GWJA 4XJZA 3SH5A 4CEYB 1BK1A 2P37A 1U5YA 2ZXQA 2PYTA 4KU7A 4XIKA 4Y1ZA 3VHRA 1A8DA 1U5IA 3LE0A 1HLCA 3PMSA 1XQNA 5F8PA 2Y34A 1RUD3 5T3NA 1BEV1 1QIQA 1GR3A 3CKHA 3I4IA 3NNJA 2K0GA 5FLIA 2WT2A 1CJPA 2CWSA 3L2HA 2IFWA 3BYWA 4DPNA 1V9U2 3AZVA 5CU1A 1TME2 4FSJA 1RUD2 4FFIA 4XZPA 1J1LA 1KXGA 1ZZ7A 1PIV3 2B39A 2W47A 1UNBA 1VBA2 4HN0A 4DXSA 2VW0A 2BOIA 1A3KA 2O1QA 1XC6A 1LECA 1OFNA 1OH4A 3W9AA 2R042 4JGZC 5FXXA 1EY2A 5FYIA 3S7IA 3EHKA 1YFXA 2YFZA 2FDKA 1Q8QA 1QQP3 1VBD2 1Y9MA 4YM2A 4K40A 5FY7A 1W8TA 2YFUA 5BYNA 3H1MA 1Q8SA 3POSA 3IZOA 5A7PA 3O0VA 2XHKA 1NE6A 5B4XA 4BB3A 1W39A 3KM5A 4AG4A 1REEA 2RS32 2XVKA 4MXWA 2VZVA 4QKNA 4LO4B 5A6QA 1W8NA 1DLCA 3DL3A 1RINA 4CCKA 4PCRA 1ENSA 3JD72 5C70A 5IFTA 1XNBA 4RA0A 2W68A 3PIJA 3LZZA 1XSQA 4QHZA 5A70A 1DGLA 4EWEA 4IETA 2D97A 2WFF2 1DQ4A 2J22A 1G9AA 4QKDA 5CADA 1W9TA 1RUC3 3WQBA 2FDIA 5E1RA 4AF9A 4H55A 5ANQA 4FPLA 1HJGA 1JOJA 3JXSA 4XUQA 1OLRA 1C8M1 2B46X 1C4RA 4XILA 4XQ4A 4BJ0A 4Y4RA 3THDA 1LULA 1NY71 3VB9A 1IPJA 3TRSB 3Q8AA 5FJKA 3VBRB 4IQPA 1W6NB 1XU1A 2IXKA 1YO8A 3ZPYA 4AEDC 5LBFA 1REFA 1OFSA 1Q8PA 4ET7A 5FPLA 1GV9A 3KV5A 1GWLA 4AZZA 4K1ZA 1AR83 5GLVA 3UESA 1R1A3 2X09A 3SMHA 4RN5A 4BK5A 1V70A 2A3XA 2XJUA 3JZVA 2Y6GA 3IT8A 3POEA 4KBZA 4MXVA 4P9JA 5D21A 3S30A 3TWIA 1DDLA 4TLGA 4XTPA 2JICA 3TN93 3FFZA 1FX5A 3MYXA 3JQWA 3H7YA 1K5MB 4FFGA 1UU6A 5EPAA 4LO7A 3CBNA 4K3UA 4L11A 4UYBA 3HNMA 5FO9B 2QVSB 2R6QA 3KD4A 4V1PA 5JLVA 4NIAA 3USUA 4FFFA 2CAUA 5C8CA 4NIHA 1YRZA 4EN8B 5FY0A 3NVCA 3POFA 4RL7A 3ZFFC 3C3VA 1DGWA 3AKRA 1COV1 2F6BA 1CAUB 1RMU2 1LRHA 5I8SA 4IEUA 1DLLA 1GQGA 1VRH1 3NNGA 1QMJA 4W4ZA 1O3RA 1ENXA 2B5HA 2DVFA 1VBE1 2XB6C 4XE9A 5ABJB 4YG3A 4YZ4A 2VXRA 4ZY9A 2VGDA 3I2IA 1JBCA 4P9WA 4QGLA 2D5HA 3MIEA 1IKQA 3MW4A 1W3VA 2RM22 4AFDA 1O59A 1NYWA 2C26A 1OA2A 1UX7A 1GP5A 2EALA 3N35A 5FP3A 5A7OA 3VBRC 3FFQA 1JODA 2RE9A 1DGWX 2VTXA 4MX3A 2JE9A 5EJ3A 5JAXA 4RGAA 4NR1A 1W2TA 1N3PA 1MVQA 3PMEA 4I2OA 3DYPA 2FCUA 4PDWA 1YYNA 4BQ1A 3TB0A 2RM23 2YC4A 4XUPA 5CKNA 4NAMA 5KC6A 1UZWA 1UD1A 2P2KA 4GIQA 1AR92 1LU2A 1RUG2 2QQJA 3ZOIA 5FY8A 2VCBA 1Q56A 5A3WA 4AVBA 4HK8A 1Q8VA 2OS2A 4N43C 3M3IA 4QX5A 3VBSA 4IE7A 4CCJA 4CP9A 3POGA 4ASMB 2FDHA 4IESA 1Z0HA 1YFUA 1JYXA 1RHI2 4XIOA 3HR9A 3KV4A 4KI5M 2BWAA 3AZXA 2D40A 2AUYA 2B7YA 5FXVA 5FWEA 5LW9A 3AMMA 3RPQA 2WLQA 2XPJA 2ARBA 4PLNA 4CCMA 4IV3A 2RJ2A 4DNYA 2R073 4FVVA 4KBBA 3HOBA 2DBNA 1JMUB 1STMA 3WG4A 1K3IA 2VOWA 4MUVA 4DZGA 3KGZA 4CP1A 3H8UA 1RUI3 2RMU3 2OA2A 2XLAA 5I8YA 5LCWL 2WZR2 3KHBA 5GZEA 3N9QA 1V6MA 5FZIA 3MLJA 3ZSJA 1J59A 2HWC3 1JU4A 2PHXA 1SFNA 4LTAA 3N9OA 4R9BA 4JCKA 4RD7A 3THTA 4UXAA 3QCWA 4RQPC 5K0UC 4FAGA 1PGL1 2RDRA 2VUJA 4XAAA 2WNUC 2BTVC 4YGCA 4Q27A 3LA7A 1KJLA 2DVBA 4IV3C 2D93A 2DVGA 4XJ9A 5FP7A 3WLUA 5DZFA 2R32A 1E5HA 2V4VA 3Q8BA 1VMJA 5JXIA 2QDNA 4YVSC 3NNMA 2H6CA 2R1DA 2PQSA 3F2ZA 2D3PA 3PU3A 5KXEA 3DXTA 2BEOA 3VBFC 5BNOC 4FTBA 3VBUC 4DEVA 2NLRA 5F5CA 5FKBA 4XFCA 1GP4A 5J96B 1CAXA 3V0AA 4OI4A 1KGYA 1ZZ6A 1OOPA 4Q1PA 4JHZA 4Q4X1 3MICA 1JZ8A 2BV4A 2EICA 1N1YA 4Y1XA 1TME1 3UT0A 2YYOA 5IVVA 1Y7BA 1FPN3 2VZSA 4PF1A 3LEIA 1GZCA 3PUAA 2PA7A 5AVPA 2O8OA 1GZTA 1HB1A 5C4WB 1UYPA 4BK4A 1Y43B 1RUH2 4AEMA 3AJZA 4IE0A 1CIWA 1XNCA 4K21A 4AHWA 1JYNA 1MQTA 4C8DA 3OGRA 4XUNA 4KGQA 3FLPA 1N47A 5FZCA 3GZAA 1YQ2A 3KMHA 5F3IA 3ES4A 5GZDA 3WW3A 1X33A 3OB8A 4YPJA 2PHLA 5CFDB 1V00A 4CU7A 4QU2A 2A6XA 1A78A 1OD3A 3N7JA 4ITCA 3NW4A 1WLCA 4IERA 3VBHB 4GJZA 1AYN2 5A6ZA 5I8TA 2BFUS 4BQ2A 1HQNA 4Y1YA 2DUPA 4Q4Y1 2VOVA 1F8VA 2X8KA 4R4ZA 3WDVA 4YM1A 4UT5A 2CGOA 1IS5A 2XGXA 2WFPA 5FYZA 4AI1A 2UYAA 5EYYA 3ZYPA 4JQRA 2DDUA 1LJ7A 2KR2A 5IVFA 2G9FA 1I5PA 4XOGA 5LBCA 2NN8A 1LOFA 4C91A 5BXXA 1XNTA 1YQ5A 2HBUA 3LD8A 1CR7A 3OPZA 4OULA 4E8CA 4OUSA 2WIIB 1X8EA 5JIUA 1WW5A 2EIDA 3FN9A 5FMCA 1PGSA 1GMMA 3Q8FA 4XTMA 5KHHA 3M1HA 2XQXA 3WP3A 4M0NA 1QOTA 3VZMA 4ASLA 5LEJA 4KH9A 3T2QA 4HKWA 1E5IA 4OI2A 2XBO1 1KITA 3I7DA 4LULA 3AMQA 5F37A 1XE0A 4LO8A 3LDBA 1I1EA 3UNPA 4I09A 1JXNA 2C4XA 1VBB3 5KC5A 3HJRA 1BKZA 1DQ2A 1GOFA 1YFYA 3U4XA 4P9LA 5IVBA 3IAPA 3J8F1 4O7XA 4P9IA 4M3CB 4WZFA 5F3GA 3VV1A 3FZ3A 3VKLA 2PQQA 3H1WA 4ZPIA 1K45A 4EN7B 2OUHA 1OURA 4CP9B 5ISLA 3JBG1 1BQPA 4Y1UA 2SBAA 3GDBA 4LLFA 3B9CA 4GB32 4EZHA 4QM8A 2WABA 2VH9A 5J3UA 1R1A1 1W2OA 4W50A 4PBPA 4XDPA 3MZHA 4P5HA 2XWJB 2R072 4PJYA 1IG0A 2TNFA 4YYOA 1BVVA 3T0DA 4UWDA 1J3RA 1M06G 2H6BA 2JKBA 1HN1A 5FLHA 5IK4A 5AC91 2JWPA 2GNBA 5F6KA 2WS93 1SLBA 4LBQB 4XF0A 5FZGA 3N9PA 4PIYA 4WM8A 4U2AA 5ERLA 4AK3A 1FV2A 5T55A 1PIV1 2GNDA 5J48A 1KD7A 1YIFA 1H2LA 2QE3A 2E31A 1VPHA 2BNMA 1NLQA 3PVOA 5FYHA 3WF3A 5BNPA 3RS6A 4AQSA 1EV13 3BB6A 1D2QA 3AVSA 5IJRA 2WDBA 3LEKA 5JSRA 3CDZB 3I2KA 3AXDA 2YY1A 4IE5A 4NJ4A 4GD4A 4AQ6A 4DUWA 1UX6A 1LENA 1UF2C 4XQWA 1LAJA 2YBPA 4XETA 1LCLA 4P9GA 1VBA3 1W8ZA 4NUBA 4C0BA 1S4CA 4YGBA 4CXYA 1RUH3 4IV1B 4E4HA 2V73A 3ST7A 2Z4FA 1XOYA 2CSGA 1W28A 3RZLA 1UY3A 2IWGB 2GSYA 4NO4A 1UY1A 4UFHA 4H7LA 4E2GA 2WUHA 4PHZA 2LM3A 3B01A 4MGIE 3N9NA 5EV7A 4ISQA 1IS6A 1WCDJ 1QXRA 3APBA 4CYDA 3KQRA 1TVGA 3RWNA 2E51A 4I3PA 1G9FA 1UYYA 4YW4A 2AGSA 1UZVA 2VUAA 1JYCA 3J7MA 4XYXA 4XF4A 5L9RA 1AYN3 3ZDSA 1AR81 3ACFA 1O3TA 4C90A 4M01A 2GC2A 5BUVA 1BLZA 1QJY3 2PHUA 4XCBA 4OHVA 4I0WB 4AYUA 3NAPA 1ND3C 3VBHA 2RR11 4LBLA 3BTAA 2J1RA 4GB33 3ITQA 3VD7A 5T50A 5L7OC 4K20A 4A7YA 1NCQC 4R9DA 1AX0A 4FXKB 1R092 1YC61 4UFKA 5F32A 5JI7A 1FI2A 2VNOA 4XFBA 4MO3M 3D0JA 1MEC3 3VDDB 3ETQA 5T5JA 3B94A 4E4ZA 3DGTA 5A1LA 3ACLA 4RFRB 2XJSA 5EYXA 4F8AA 1GOGA 4GQ7A 1Y9GA 1NZCA 5FMOS 4HK9A 3PIGA 2OVUA 2O8QA 2CHHA 1VBC1 4XJWA 3V64A 2MEV2 1GFF2 1V6KA 2FCTA 3C2UA 4Y24A 4YW2A 3MLKA 3RZZA 3B93A 1VR3A 2QNKA 3M3EA 3HEIA 4N9HA 3AKQA 1Z7S1 2XL7A 5E88A 3THPA 5KHJA 2ZGRA 2YGMA 4GH4A 2NYYA 4UW4A 2WINB 3RNSA 2G1MA 4P9YA 5C5UA 2F17A 2MEV3 3C7GA 3O1MA 1B35B 5CNAA 4B3NA 2W1UA 2F4LA 3VHNA 4CUCA 3AXEA 5FZ7A 5I0RA 1PVC2 2VBPA 1XU2A 4FTSA 2XDVA 4EE2A 4OQ9A 2RJKA 1ND2B 3J8F3 4QMAA 2B9UA 2A75A 3CIHA 3A4UA 2CAVA 3FUQA 1UIKA 1DZRA 3NSTA 2Q1ZB 3POYA 4A3ZA 4AR2A 1RB8G 1RUG3 4WZCA 4AE2A 2IVJA 4GB31 1H1AA 1QY4A 1W6OB 2Y6LA 3ZFGA 3I3EA 3OOXA 5JPNB 3JQXA 3LIHA 3UKNA 3WV6A 4ATEA 4YM3A 1W6QB 2RMU2 3TAYA 1FOD2 2VE1A 3GZEA 2YZ4A 3RG0A 5IAXA 5IATA 3NV3A 1I5ZA 4LKSA 2HWE2 2G9ZA 3WQ7A 1DYKA 2RM21 1FATA 1F31A 1C8M2 1K42A 4META 4UFMA 3JBG2 5FAXA 1TZOA 4OZXA 1QNWA 4QDRA 4WVWA 3VBUA 4QX0A 4QHOA 2P6CA 4XF1A 4B4QA 5L73A 4LORA 1EUUA 1LNSA 3KQ4B 2BPA2 1CPNA 1UY4A 1JZ4A 1ZBE3 5IFPA 2Y60A 2VM9A 3S0MA 4V2VA 1FMD1 1Z7S3 5FMBA 3VGIA 4OUEA 2X10A 3LOIA 1HQWA 3PHMA 1SPPA 5LBEA 3WCSA 3E5XA 3PU8A 5DAWA 2HWE1 3IMNA 4OHZA 1AR93 1OKOA 5FFOC 3SKVA 1AR62 4LBQA 4XXPA 1US3A 3NAPC 3HAGA 5C3QA 1OUSA 4URAA 4PQQA 5KWRA 1GOHA 1YQ6A 4QQHA 3GCWA 5FQ0A 3HPNA 4LO6B 1KS4A 1LODA 5AFBA 1WUVA 4JDMA 3IM0A 2V4AA 1IGOA 1RXFA 1DYPA 2A73B 3USUB 2R043 2ZAHA 3OJBA 1JUHA 1H9PA 1UXZA 2XKOA 5F7UA 1F5JA 2VBBA 1E57A 4BXSV 1BEV3 5I0UA 4JQTA 5LASA 5DABA 4U36A 3NL1A 2R0FA 1AR63 4XMAA 1D7PM 1ODMA 5DUUA 2WC2A 5FZFA 3K75B 2HWC2 1PX3A 3ZXDA 2Y8KA 3P6BA 5FP4A 1PX4A 2WR9A 2WZ8A 3MW2A 4PQ9A 4EROA 3E1F1 5JDBA 2WZR3 5FZMA 1F2NA 5L19A 2J1VA 4FPKA 2VMHA 1YLLA 4Q8KA 2ATFA 2TBVA 1SG3A 3KT4A 5F39A 5FMDA 4CVUA 2UYBA 2WNVB 3WQ1A 1ZRCA 2ZX3A 1DGRN 2ZHKA 5G04L 5FYMA 1RUE2 1XNDA 4TLFA 4YW6A 5LY2A 4IEXA 2WNUB 2JDYA 2Y6JA 3ZDVA 5IUQA 5FYTA 3RMYA 3E6BA 3RJ2X 1RUC1 2DCYA 3ZYRA 3JU9A 3E6CC 3VZOA 4BMEA 1PO11 3RYPA 1H2KA 3LPGA 1NXD1 2JECA 1OOPB 4CU8A 3WUCA 2AC1A 5FZ1A 2Q0AA 5I0DA 1VMFA 4NPMA 5A80A 4PBOA 2D98A 5DAQA 5HCAA 5D8AC 1VBB2 1MR5A 1GQPA 2ARAA 2FBEA 4AAPA 1PNGA 1O3SA 2YGLA 2ZGUA 3RMXA 3I2OA 3I3BA 5BNNA 3W21A 5B4NA 3T2TA 3K4AA 1W6MA 2YG0A 2A5ZA 2CDOA 2VUDA 5FMOL 2VG9A 1H1IA 5C5TA 2UWCA 4XFGA 5JOXA 2JG9B 1JZ5A 2GH8A 2WNEA 3MW3A 4XZUG 1WMFA 1XSRA 1WD4A 2JIJA 3DYMA 2ZEYA 4JGZA 4QB1A 3VDCA 1OC1A 4IEVA 4O9GA 3O1SA 2QJVA 2WAAA 3VDBA 3BALA 1UKRA 3RGBA 3FLTA 1UN1A 1EYBA 2HKXA 4A3XA 1UY2A 2ZKLA 1AXKA 4BPZA 1UMIA 2GN7A 4P02B 4D3WA 1BXHA 2W1QA 2W9XA 2HWF2 3LDKA 2HJIA 4QB6A 1H4HA 3ZFEB 2QQLA 1OPOA 3ZYFA 1RUI1 2JG8C 2VULA 4XPVA 1CZTA 1ND2A 5GZCA 5KBFA 3LDRA 1R081 4Q0QA 1WCUA 4IEQA 4Q4V2 3ALQA 3ILFA 1AL21 1WCKA 4YVSA 5LEKA 4A4AA 3KCYA 4A6SA 3DKWA 3TEWA 2HWC1 2LRPA 1W0PA 3A7QA 4C1WA 2JXAA 3AM2A 4X8NA 1SMVA 4J1WA 3ZN4A 3EJKA 2VZTA 2D7FA 1W6OA 2P17A 2QDRA 3UGGA 3D4KA 4GWMA 4AQ2A 2E26A 1W8WA 5KHGA 4W6XA 1ENRA 1YCIA 4NROA 5F3EA 4IV3B 4BIFA 2VMIA 3MO4A 1ASJ3 1UYXA 1Y4WA 3PURA 5D8AB 1IKPA 3WNMA 4QPWA 4Q2FA 3PUIA 5IK5A 4M3CE 1CX4A 5C71A 4GAZA 1WD3A 4YVSB 3ZX7A 1MPXA 3POWA 5FO7B 2VD7A 1SQ4A 4QKBA 3WG2A 4IUGA 3MHZA 1GSLA 2C0ZA 3HNYM 2D3SA 5KHIA 5EP9A 3AMPA 2B8MA 3VD4A 2DCJA 2HWF3 4Y20A 5FY1A 5FUNA 2XQRA 2BERA 4HN1A 5IK8A 3AX4A 1AR61 2DCKA 1VBE2 3D5OA 4A2UA 3RJRA 4HANA 1E5RA 2SLIA 2VOXA 3PNAA 5FP9A 5HI0A 4I01A 3ECQA 4BYYA 2ZABA 2WWUA 2AR6A 2FQPA 2BVBA 2VTXJ 2WFF3 3FE5A 2ZMNA 1ND3A 2R30A 3N9LA 4K7JA 5HCBA 1EV12 5FXZA 4EN0A 3ZR6A 2GC1A 1TMF1 4R9AA 3ZXJA 1AL0G 2VC9A 2ADDA 3DCQA 4COWA 3CL1A 5DG2A 3FJSA 2X05A 1H8TC 3OF1A 5E89A 5F5IA 3N3HA 3AL5A 4QU1A 3BUCA 1R091 3G6JB 1Q3EA 2C24A 1H2NA 4YM0A 4YW3A 4EN6B 3AB0A 1JZ7A 4HLTA 1S1AA 5FOBB 2W2IA 5KXCA 1AZDA 1SEFA 1ZVFA 2H0BA 4YZ3A 1DYOA 1QJX1 3KF3A 1M4WA 1S55A 3WSOA 3I3QA 3OPWA 4YZ1A 4D69A 1SDWA 1UYZA 4OFGA 3K46A 4NWWA 3EB7A 4QAWA 3I54A 2LALA 3GBWA 5GLWA 3RZGA 4IV1A 2VMFA 1AVBA 5JCTA 3JCIA 4COVA 1GANA 4QXBA 5CZKA 4E2SA 5LA0A 4W65A 3GALA 2A3YA 3U37A 3PJQA 3MIHA 1OQDA 1X82A 3BTZA 1ENQA 1W8OA 3ZFEA 4YVWB 2QQMA 1W05A 5FREA 1KDMA 4ONUA 3BI3A 1VBC2 2XBO3 1DQ0A 1RUE1 1TEIA 2IFRA 4IE6A 1G8WA 3LSEA 3WY6A 2YBKA 3PDQA 4GA9A 4N43A 4ZU4A 3VHPA 2PAMA 5A3UA 5T5OA 5J1XA 2WWSA 5FBJA 4DFSA 5HV0A 1YHFA 1SDDB 3AYEA 3R6SA 1ZNPA 4COZA 4XAEA 4Z2AA 5HV4A 1LOBA 4F83A 2ZTNA 4RS5B 5FIXA 4RHV3 4BWOA 4ZZ5A 5CG9A 5LWBA 3ACIA 3GGLA 3HNBM 3EMRA 3R0RA 4RFT0 2Y0OA 1R1ZA 3AYCA 2RJLA 4E27A 1ULDA 5A1FA 1W0OA 1C1LA 1VP6A 3DKQA 3RYRA 1FOD1 4B4RA 2ZZJA 1UPSA 2IXHA 5DDJ1 4JX0A 4LE3A 1TQ5A 1QJZA 1Y9QA 4B7EA 1V6OA 5C3PA 5F3CA 1IPKA 2C1FA 4PI0A 2GP5A 3SNMA 2XKPA 4ZU5A 5FPBA 4MH0E 5L7OB 3BOPA 1ULCA 3ABZA 2QCSB 3HD8B 5JIAA 4H3WA 2PTMA 5KXBA 4LHLA 4NHYA 2DFBA 1EUTA 1WZXA 2G19A 3N7KA 5C3OA 1YWKA 4OMCA 4H14A 4XHXA 3NO8A 2VR4A 5FYSA 4B1MA 3M3OA 2XJPA 4QQOA 4GH4C 1HB2A 3ZYJB 3URFA 3ZYBA 5JSPA 2WZR1 1V6JA 2MEV1 2PLV3 3B00A 1F9KA 3T0BA 3H3ZA 3GM8A 3VDAA 4OI1A 4JRLA 4Q29A 1J83A 1U5ZA 4O9EA 3O14A 4Y5Z0 3C7OA 5I91A 2WN2A 1ND3B 3CQOA 1RJ8A 4YW5A 1F4HA 3VZKA 4A44A 4AXOA 2WZPP 1IZ3A 3OGSA 1WW6A 1GYKA 1ULFA 2KA3A 4LHKA 4M4PA 5FZHA 1JYTA 2AEYA 4LPLA 2QQWA 1WA4A 1SZBA 3LPFA 4Q0UA 3VD9A 3H3UA 5FYUA 1HXS3 1BCXA 4LITA 3S6PA 4GMP3 3WZ1A 2WRAA 3S5AA 5H9SA 1JHJA 1ZM1A 3OEAA 3J7NA 3MDPA 2BYVE 1JU3A 4NHXA 1PVC3 4HMZA 4Q8LA 4DINB 1NA1B 3GHNA 2JG8A 3ROUA 5FOJB 1TMF3 4LBOA 3ENRA 1ND2C 1X9PA 5FQ0B 5GLUA 3WINE 2J1EA 3ZFGB 1EAH1 4L92A 1YJKA 1AUYA 1COV3 4JTNA 5JPMB 3KB5A 1AR91 4OHYA 4Q4X2 4AVAA 2ZACA 2HEVF 2YUEA 4L2NA 2RR12 3M8LA 4XVHA 3WT3A 1OQEA 5EJZB 4A7ZA 2JDKA 4HSLA 3WXPA 1G86A 4YFWA 2CU5A 3WHTA 3H8OA 4P14A 4MGYE 1ZBE1 3AMHA 4L99A 4LKDA 3FHQA 3J4UH 3VBUB 4P08A 4CDQB 3B5LB 3TNQA 2R041 2R1BA 2UU8A 4FAHA 4AI9A 3WNPA 2BNOA 5FR3A 3JD73 3ZXGA 2RS13 5ACA1 3VZNA 1QF3A 3SHRA 2DU1A 1AXZA 1GNHA 2WNOA 1BEV2 3N36A 4N53A 4AVSA 3AFKA 1JW6A 2W0XA 1XNKA 2VVFA 1JH5A 4LXLA 4AFBA 2EA7A 1RUOA 3POIA 4BCUA 2ZGKA 3ZMNA 3AJYA 3ZIWA 3JB4C 1I9RA 3PLQA 1SLCA 2DCTA 1F5FA 1OXCA 4KNCA 4UBHA 4BLJA 4RR3B 2I74A 3VBSC 4COUA 4ZKTB 3WCRA 3B3QE 4KG0A 1B35A 1G6NA 1CIYA 4HVOA 5AC93 1QHDA 4TWTA 4RHV1 3IDAA 1SFPA 1W99A 1QJU1 1UU5A 3QD6A 3VBOC 2RS53 3ES1A 4HPKA 1W04A 1GICA 2WKKA 3N7LA 2HEWF 3NNLA 3WNKA 3R4DB 1OKQA 2JE8A 2Z2SB 2FD8A 1KS5A 4URTA 3ZYGA 1GKBA 2DF7A 1HB3A 2YHJA 2XXZA 4NRQA 4Z92B 3I49A 4HETA 1NLRA 2QZ3A 5AC92 3ACHA 3HQXA 1K5JA 2VOKA 2VMCA 3GYDA 1RUG1 2BGPA 1K12A 3IIAA 5KHKA 1HRI2 1LOCA 1BHGA 1XRUA 1AXYA 2JDPA 4LBMA 3GXUA 3ZVXA 3O1PA 3U07A 3MIGA 3VZLA 2JE7A 2YC2A 4IGPA 2OPKA 2CGNA 2O0OA 1TMF2 3MFAA 3RZJA 2XJQA 4FPFA 4XHBA 1FOD3 4BQWA 2BWCA 1GWKA 1W8HA 3SC7X 3CJIA 1OBNA 2VXJA 2VZ3A 3OD0A 5T54A 3UGHA 4HVQA 2ZX4A 3UKVA 4COYA 1PMIA 1DQ1A 3CU7A 3VKOA 1LGNA 4DRVA 5H9RA 1MS5A 1CWPA 4FCAA 2ENRA 4DY3A 5A1AA 2UWAA 1LKNA 4G9SB 1NCQA 2FMDA 4M3CA 2WSUA 3BPZA 5JVVA 4S2HA 2BUKA 4QX3A 2AREA 4AWDA 4BU2A 1J84A 4FPJA 4WM8C 3J8F2 2F4PA 2JG9A 3OUJA 3J7LA 1AHSA 3GF6A 4NHKA 2TUNA 5GALA 4B29A 4CDXA 1BK0A 1T6GC 3WHUA 2G9GA 2ZMLA 3RDIA 3O0XA 1AJOA 5L36A 4FOVA 3SEPA 3T2PA 3U10A 1KRIA 5T5LA 1W2UA 2VZ1A 3MF9A 2A1XA 5CVRA 4NIIA 3USSA 3K4ZA 4ZS2A 3NV1A 1N3OA 3WP5A 5IVJA 5D8AA 3VLBB 4TN7A 5SV8A 1QOSA 2JJ6A 1SLIA 2E7AA 3VD3A 3VKMA 1OF3A 1UOBA 3VBFB 5BNOB 2ZGLA 5AFEA 1PHMA 1LEDA 2JENA 2VQTA 2JD4A 3TEZA 4AEKA 3CJXA 1RYYA 3IB3A 3OGJA 4YGDA 5IT6A 3NWKA 3OBZA 3LOBA 2WAOA 1TG7A 4QWNA 2XHNA 2ZAAA 1JS9A 1OOPC 3QH7A 5JMOA 4XDOA 3ZXAC 1D4VB 3O5SA 2WQZC 3JB8A 3S7EA 3ZN5A 4AVTA 3U0ZA 3P3NA 4NAOA 2L9LA 1Q5OA 1AJKA 4K1YA 5HCFA 4DUXA 1DGRA 4NIGA 3T1LA 2PELA 4AL9A 4CDWA 4JHTA 4GMP0 2W08A 4UFLA 4EZ4A 2ZGOA 5JSOA 1FMD2 4C1XA 4BXFA 3KCCA 4Q5OA 5JZGA 4XURA 4X6QB 3V0BB 4M4RA 1QKQA 1CAVA 3WNOA 1UQXA 1RUC2 1QH7A 5G05L 1KJRA 3FBYA 1CD3G 2J1UA 3P1IA 1LR5A 1NX9A 3WG3A 1WBLA 2ZBJA 2EIGA 3ETPA 1CPMA 1VLNA 4Y33A 3IN9A 5BY5A 4LK6A 5DQ0A 2YROA 3MLLA 4D7SA 4ZXEA 4AHXA 2VQAA 4FPYA 1FPN2 1S0IA 4LBNA 5T52A 3RWKX 2HWD3 4CU6A 4YFZA 3O1UA 1CZVA 3BVCA 3MIBA 4QM9A 3K51A 4D7YA 2V5DA 3LFMA 2RS52 3FL7A 5H9QA 1SBDA 1JZ2A 2HYXA 1W8UA 3K4DA 3NV4A 3PVEA 2ERFA 1JZ6A 3WDXA 2VL4A 2ZKNA 2ZHLA 1LOFC 4AHYA 4BH9A 4BQYA 5FJHA 1D0GA 3BTYA 2EAAA 4QT6A 3OBTA 1VBD1 4BM8A 3TEYA 1POV1 4AFMA 4M0HA 3O1VA 3NAPB 2CY6A 2RDQA 2VW2A 4MOAA 4MYEA 4AI8A 1C5IA 1FMD3 1CGPA 1NCRA 3GZTB 5FPVA 3I2JA 5FCCA 5FP8A 3LFIA 4GKYA 1CAWB 2DVAA 1NE4A 2JG9C 2BGCA 2ET7A 1GUIA 1PZ9A 3CHXA 2I45A 2B42B 3D0SA 1RUJ3 4M3CF 4XXAA 1MEC1 3ZYIB 2B9VA 2A6ZA 4Q4W2 5C4WA 2Y6KA 2YC0A 4YLZA 1E5SA 4LA3A 1XYPA 1Z7S2 3VBSB 1RUF2 1R082 2VZPA 4Q4V1 3IPVA 5CFCC 4RSUA 2IXJA 3HWJA 4LEJA 4CDXB 3PL0A 3LGRA 2PAKA 2Q1FA 4YG6A 4CDUB 1PVXA 1EV11 4CXXA 2PN5A 2VCMA 4LBQD 2JDZA 2ARCA 4Q0PA 1MZEA 1YXWA 1ZA7A 2CTVA 4NMIA 1RXGA 5LATA 5FYBA 1F4AA 1O4TA 4QPIC 1KFXL 5JXGA 2EXJA 2XLGA 2C9KA 1N3QA 1PK6A 2ZGTA 4JGYA 4CSWA 1GQHA 2QKDA 3CJIB 5JR7B 2WS91 3H50A 4JDNA 4E2QA 3ME2A 3LQCA 1S0DA 5FV3A 4JGZB 4CXWA 2RDNA 1ZZCA 4L9BA 4YW7A 5A3PA 1RUF3 4LE4A 4CEWA 2R0HA 2UWBA 5BNPC 5CBLA 4UAPA 3HT2A 3E97A 2CYFA 2VU9A 4YVWA 3O7OA 4MGKE 2E33A 2JDUA 2FDGA 5JXJA 5EFUA 4FPOB 4QPGC 4FP3A 2W1WA 5F1RA 4KMQA 2QQVA 3A22A 4SLIA 3NJZA 4HFSA 1FNYA 5FPZA 5IHRA 2OX0A 2ZEZA 5IWFA 4MSVA 4OMDA 5DAVA 1JYWA 5JZGB 4WVVA 1FV3A 4EYUA 4RS5A 5BNNC 3ZXFA 3WW4A 2DUQA 2VVEA 1YQ8A 1AF9A 3LA2A 4ES9A 3O1RA 5EWSA 3I97A 4LKFA 1QXPA 2R49A 3VKFC 3ZSMA 1X9TA 4D0QA 2WFF1 1LU1A 3DECA 4CTEA 2ETEA 1F35A 3AP4A 5C3RA 1VE0A 4OVEA 2XLFA 4I0BA 4EWAA 3M3QA 3POBA 1KQRA 5FPAA 5DMYA 1SPPB 4LJHA 1NA1A 1RMU3 3NKTA 4JV4A 3SCFA 4EQVA 4XDQA 4TYSA 4L97A 2DWRA 3DN7A 3PTYA 5ACA2 2X5IA 5A33B 3LWCA 1RUF1 4XEZA 4CDWB 5A7WA 4PLMA 2VTFA 4QDQA 3NNFA 2EVXA 2X53S 3BKZA 1YUDA 3V65A 3WX5A 3UL2A 3CO2A 5LB6A 3MPBA 3OBRA 1UPIA 3SQOA 2ZX1A 4XABA 3WDYA 4CDQA 3DV8A 2G4IA 5HCHA 3EO6A 1MZFA 2OT7A 2EIBA 1W90A 4J1XA 1UOFA 4MXWB 3WDTA 5C8CC 1WA6X 1R1A2 1HXS1 5EHDA 1CAWA 1ZBA2 4B7KA 2MNGA 1G9DA 4NPLA 1PGW1 3PTRB 5FY9A 5FUPA 4Z8BA 2GN3A 3C8XA 4Y26A 4QXCA 1GBGA 2Y26A 4XFIA 1TNRA 2ZZQA 4YW1A 3B02A 1X36A 1BMV2 1W6PA 2PXJA 2I07B 1LESA 2XL9A 3OG2A 4Q4Y3 4CDUA 5GKAC 2Q8OA 5FK7A 1UMHA 1FNZA 1JI6A 1US2A 2XONA 4FO9A 1WLDA 4L0PA 4N8MA 1ASJ1 2VNVA 2ET1A 1S2BA 3J26N 2VY0A 1C3HA 5JWPA 4S2DA 3ZSKA 2D6KA 4OHWA 1J58A 1SACA 5FLJA 3HQRA 5FY5A 2VQ0A 1D0HA 3NKGA 1U0AA 5AVAA 1GNZA 2FDFA 4GWNA 1XBFA 2VVDA 3GJBA 3UKTA 1SCSA 1S2KA 3OY8A 4WVZA 2Y33A 4GZ9A 3RQ0A 3WNXA 1OT5A 5FTTC 2GP3A 5DDJ3 2RS33 5FZ8A 3H0OA 3OSDA 4OLLA 1MEC2 1H30A 3PVBB 1H2MA 3VDDA 4Z82A 3WW2A 4KG8A 4N43B 1T2XA 2ES3A 4Q1RA 5CKMA 1S2EA 1VBB1 1W6MB 2ZMKA 3WNLA 4BDVB 4BQ5A 1RITA 3HBKA 2NQYA 2WNVA 4DXTA 5FPXA 1NKGA 2XUEA 2GC3A 1IQAA 4UOJA 5D1IA 2W39A 3GJAA 5C8CB 5LK5A 1PK6B 4JGYB 4CCNA 5E6HA 4YZ5A 1VBE3 1RVF2 1H9WA 3E5QA 5A7QA 1IPSA 2GMPA 2Y6HA 2D3RA 2V72A 3KS7A 1EPZA 1L7QA 1WLWA 1L7LA 3QLQA 4M00A 4N53C 5EJ1B 4RR3A 3ZMOA 5HXVA 4BA6A 4BE3A 1MS8A 3WVJA 1DFQA 2HYKA 1UZZA 5DPNA 2DTYA 5F6LB 3RZMA 4NIDA 4B1LA 2HH9A 1S0EA 5K8SA 5DXDA 5IYYA 2QZ2A 1DF0A 1AX2A 5CISA 1NAEA 1OUXA 2J1TA 2AZ5A 2D6OX 1ALYA 1N1TA 2QTWB 5CG8A 1SCRA 3ORJA 4UW3A 5A7NA 2Q8EA 2NMOA 1H8TB 4PF5A 2PHWA 2WO7A 3J7HA 5DN2A 4Z2WA 1QGLA 3O1OA 3T4HB 1APNA 1MS1A 2R063 2HWB2 3GZUC 1OD5A 3ELNA 4QX7A 2LS6A 5JI9A 4XFFA 4RGKA 4XUOA 1ZREA 1UO9A 4IW3A 3DPRC 1C5HA 1QU0A 3OBAA 5FY4A 4A7KA 5CFDC 2BBAA 5J98B 4XQDA 3D6EA 3ZSLA 1CONA 2ID4A 2WO1A 3SEEA 3MF6A 1OMIA 1BZWA 1PO13 5FZ3A 3WNNA 4AEDB 1S0BA 4WBBA 1MVEA 3OD4A 1IHMA 4LBJA 3U75A 1W2NA 3NQHA 3A0NA 3U4SA 1MQTC 2GH2A 3T4VA 2P3YA 4CCDA 5CKQA 2E6VA 4XBNA 3SLIA 2ZGQA 1H8TA 1DG6A 3LEGA 3LF7A 3MI8A 4BQ3A 4DQAA 1NCQB 4W6YA 3D82A 1VBA1 1PM4A 1N1SA 1O7FA 4Y20B 1HV1A 2C5DA 1YI9A 1YFWA 2P4EA 1NUKA 2BZDA 3AZYA 2IXLA 1IG3A 3W5MA 2ILMA 2ZX2A 3OPTA 1QJU2 2XOMA 2XH6A 2YV8A 1DHKB 4MV2A 2OZ6A 4KQ7A 1EPWA 5A7WB 4FQZA 2CDPA 2Z42A 2NPIA 2VNRA 5CFCB 4JZRA 2YPDA 1W9SA 1CAXB 4RHV2 4ZZ8A 1GLHA 3DF0A 3K77A 1J1TA 4YGEA 4HXCA 3AP5A 5FO8B 1QQP1 3KWVA 2R061 1O6UA 5IK7A 2Q8DA 1SBEA 1LOAA 2DBIA 4FPCA 5K4LA 1HRV1 4MGSA 2IXCA 2EIEA 1QJY1 2J1SA 5ABJA 4LR4A 4GMP1 5DUWA 5LA9A 2C9AA 2VMDA 2RHPA 4PIXA 2W5FA 1WW7A 5IVYA 4JKKA 2D6MA 4W6WA 4Q4W1 1HRI1 1O5LA 3OGVA 3RFRA 2XUMA 1MS4A 2A70A 3BCWA 3B69A 3FC0A 4WM7B 1VAMA 3RRDA 1W9FA 2VJXA 2BNNA 3VN4A 1LOGA 3T08A 3T30A 3WP6A 1XJAA 4R4XA 3T0AA 1LHOA 4F7ZA 4ZU7A 2YXSA 5C33A 1BVP1 1R083 4P9XA 1PGL2 1LTEA 1AL23 3NJXA 4LOSA 3F95A 3IKWA 4FOQA 2KD7A 3INAA 4BQ4A 3ZIXA 2KM2A 1C8NA 4D94A 1OSGA 4EWDA 3T3YA 4D6SA 2EXKA 3I2HA 1S0CA 1OA3A 1UOGA 3ZR5A 3R4SA 1G9BA 1NG0A 4IGOA 2WT0A 3BU7A 3KT1A 1YQCA 1KDKA 3KVBA 4ZONA 1JTZX 4E9KA 1I3HA 4QKFA 1P8JA 3PUQA 1TE1B 2W46A 1LHUA 3M4FA 1ST8A 4FQ4A 1WMDA 2P5BA 4N7UA 2OZJA 3MIDA 4YSFA 3H8RA 5HXMA 3NRUA 5LRSA 3EQEA 4AFCA 2EF6A 4EV0A 4QQ2A 1XPWA 2ORXA 1OVPA 1QJEA 3BIWE 1JZ3A 2FZ2A 4QHBA 1MS3A 4Y3OA 1WMXA 1MS9A 1DCSA 4L8QA 2B4KA 4NE9A 4K6BA 4CDWC 5T5PA 4JKMA 4JKLA 4AQTA 3L9JT 4FFHA 4FT8A 3V56A 3MUY1 1POV0 1W0NA 1ZZ9A 5FXWA 1QNYA 5IW0A 4Q4V3 3WF1A 3ZKUA 1BMV1 1ZBE2 1H8VA 3M7AA 2IVIB 5LRRA 1D2SA 1W2AX 3OCPA 5JMCA 3RYKA 2TEPA 4MGQA 1QJX2 3OGGA 4B8EA 5C9AC 2D6PA 1ZRFA 3LCPA 3ZPOA 5JXHA 1WWYA 4CUAA 2VW1A 2UURA 5E16A 2YDEA 4DMIA 3I59A 1VB2A 1NOVA 5IVEA 5FBZA 3EXUA 3JBG3 4LKEA 1UMZA 3I3DA 2HLEA 2WSVA 4MLOA 4IDZA 4CP2A 1IQDC 3ACGA 4HKOA 5KR7A 5HBAA 4RGGA 2QUOA 2JKXA 1JYVA 4OQ8A 3VL8A 2RS51 1UXXX 4LMFA 4X8PA 5CAZA 3AP7A 5ABJC 4Z07A 4FBFA 2BRTA 1K5MC 1ZZ8A 2AEZA 4TZDA 2D6NA 4YNIA 1VRH2 2GC0A 1RC6A 1ZRIA 2VCAA 4P5YA 3CJIC 2GZWA 1HN0A 5C9AA 1ODNA 4XJUA 2WYFA 2FZ1A 3BGAA 1DU3D 4JRAA 2AH2A 3BIEA 1RUI2 3LEMA 4HG6B 3I3MA 1NCRC 2VNGA 5FRAA 5CEHA 1AR71 3IIIA 3MV01 2V09A 4CDUC 3HN3A 4HONA 4R9CA 2GDFA 2JEMA 5FZOB 1O5UA 4I0AA 1FYUA 1O8PA 4BLIA 2WN3A 4HKLA 1URXA 2J42A 3H7JA 3WDUA 3V0BA 2DV9A 2E7QA 2WA3A 4A42A 5DAXA 4D7TA 3B9IA 1POV3 4GALA 1ULPA 5A3MA 1OVSA 1O4YA 2LUWA 2W91A 4TTGA 4RQPA 5K0UA 1JYIA 1MZ5A 3ZYHA 5C9AB 4OI0A 1CZSA 2MHFA 3IDCB 3AC0A 4OYUA 4MG2A 4IEZA 1WMEA 2VOTA 4FP2A 4PDWC 3IPVB 2JIGA 2OQ6A 1CJDA 1RUJ1 1LGBA 1OI6A 1UL9A 2E32A 2Z69A 4FOWA 4N53B 4N7IA 1H0BA 2WO2A 5EZWA 1KFUL 1WGPA 4N90A 2JG8B 2BDRA 3I8TA 5I0TA 5L9BA 4H7MA 3BU0A 2AENA 3GCXA 3NV2A 1WW4A 3T09A 3ZFFB 1X8MA 2P1BA 3VKNA 4QX8A 4NVPA 2WNUA 1QDCA 3AL6A 3U1XA 1QJY2 1LHWA 2E63A 2NMNA 3OYWA 4OUMA 1WCQA 2E9QA 3HVDA 2CWMA 1D4M3 4LK7A 2DVDA 1HX6A 1LGCA 1I6XA 4S2FA 3VHOA 4BISA 3D3AA 4HT1T 2ZA9A 2CV6A 4BHPA 1O3QA 3I2FA 3ZXLA 1YIPA 1NCRB 2QQIA 3JUUA 1NLSA 5DUVA 3BODA 1H4GA 2OPWA 1JOBA 2Q8CA 3HN1A 4MADA 3ZSEA 3BPSA 1GZWB 2JD9A 2VAUA 1UZ0A 4GWIA 3THCA 3DPRB 2VZRA 3UGFA 1XE7A 2W52A 3P3PA 4ES8A 3AZZA 3SH3A 4NWVA 2P3IA 4XFAA 1VRBA 1W6PB 1XE8A 5FZKA 1SBFA 1OA4A 2WBKA 2YMZA 3H42B 4FPHA 4K8FA 2RG4A 3SCHA 4GKXA 2WA4A 1KEXA 1MS0A 4PT6A 5J7MA 2DTWA 2ADEA 5C3SA 3VBHC 5J37A 4ZHNA 2W87A 1S0FA 2YBSA 4CCLA 3D8CA 2OYZA 1OPMA 1NQDA 1WKYA 2JB4A 5GM0A 3RSJA 2CL2A 2X29A 3UYJA 5EQUA 4XUTA 1UZYA 2HWD1 4DXRA 4JDOA 4LHSA 1VAKA 1TME3 2A3WA 4JVAA 2RS12 2X5IC 4HVRA 4ORFA 2XJTA 1EAH3 4HPKB 1OLQA 1QDOA 2I2SA 2WZEA 4UW5A 5CB7A 4CPBD 3IMMA 3IBMA 4NHMA 2R16A 2N7GA 2WS92 1T6BX 4IL7A 1W9YA 2VUCA 3CMGA 3WUDA 2BVVA 3CEWA 3WP4A 4AI0A 4AW7A 4CEYC 4KWKA 1BJQA 4EN9B 2X5IB 3ATGA 5A33A 4UF0A 5KXDA 4BZ4A 2OKXA 3U11A 2QQKA 2D44A 4OZOA 1SHWB 2WYSA 1PO23 1OHFA 3I59B 1C8M3 3TNPB 4BIOA 4QDSA 1SLTA 2WL1A 3OTFA 2RS11 3GBFA 4XBQA 3KCXA 4YRDA 4QX2A 2A7AA 4CCCA 3QOPA 4LHNA 3VBFA 5BNOA 3WF0A 3JD71 1UIJA 4A41A 2XWBB 1AR73 1Q8OA 3KF5A 3OEBA 4AI2A 3CNAA 2WJSA 3N7MA 3L2YA 5F5AA 2DFCA 2GU9A 4C0HA 1HXS2 1AR82 1H6XA 1QWRA 3Q8EA 3E6DA 4E8DA 1LOEA 5A7SA 1A8MA 1ZYBA 2A6VA 2A6WA 3AK0A 3O12A 4UF0B 1RVF1 1VMHA 3CF6E 4WVMB 2Y6FA 4Y1VA 3ZN6A 4DUVA 1A34A 2VZUA 2PAEA 3SKJE 4A45A 2ZGMA 4YVWC 2XJRA 1GWMA 5SV5A 4O61A 3MIFA 4DY5A 1XXNA 2FHRA 1NY72 2P34A 1RL3A 4XJ8A 1ACCA 3NJVA 3U14A 3ZFFA 5CA6A 3FBMA 2BFUL 4K8RB 4X6RB 1SLLA 5CFDA 1QJU3 2PLV2 1LEMA 3AKTA 3OUIA 4CE8A 4G3YC 2C6SA 5F2SA 1VIWB 1W6NA 1ZA4A 3DXUA 2RDSA 2BP6A 2OIIA 1V6LA 3K48A 5BPXA 3WEZA 1A6CA 2ZEWA 1MACA 2W95A 1QJX3 3KGLA 3AVRA 4CCEA 4Q26A 4XBLA 3UV9A 3ZFEC 1RGSA 2BOJA 3FHAA 4Y22A 5FWJA 3H9AA 1QH6A 4UFJA 4NRMA 3N9MA 4B4PA 4FTEA 1H1MA 2ZEXA 3C7FA 1N1VA 5DZGA 3ZXEA 2ZHNA 4BMBA 2QQPA 1ZBA3 2R7EB 2LROA 3IWZA 1K5MA 5K7PA 2VECA 5ANNA 3VL9A 4CUGA 2UY8A 3J9SA 3U78A 2VO5A 1D4M2 2W1SA 4E4DX 4NHLA 4Y4YA 4HSJA 2DCZA 5FZBA 3UK9A 4WV8A 2Q4SA 1PGW2 5F9TA 2D6LX 2VPVA 3AMNA 4MGTA 4XC9A 1Y3TA 2PHRA 3VD5A 4D6QA 1CAUA 4W8JA 1X50A 5JOZA 1DP0A 2IUWA 1RIRA 4S2GA 4PI2A 2R071 3ON7A 3WF2A 1CVNA 1DQ5A 3PVNA 5A6YA 5M0TA 3UETA 1ULOA 2QQUA 1UKGA 4JAAA 3W59A 4ATFA 1NT0A 3GNEA 4LQRA 5LA1A 4KWUA 2VQUA 1FXZA 1ZRRA 1HKDA
chains in the Genus database with same CATH topology
4CDQC 3KZ4C 1RUD1 2DUOA 3M70A 3B7MA 4MGZE 4FOYA 4QPGB 3TN91 1RJ7A 4CZSA 3QH6A 1B09A 3RI9A 1AR72 2ZJCA 3DPRA 2NP0A 4XFHA 5J36A 1GZWA 1Z78A 4QGMA 2IC1A 1V6NA 4R8HA 3QACA 1UU4A 2WLPA 2Q1MA 4MV2A 2ZX0A 2XG3A 3AYAA 1COV2 2ZS6B 4AEJA 1LHNA 2IZWA 5B2GB 3UJQA 3VUOA 1RTVA 1DZTA 2OW4A 3G7DA 1YJLA 5F5QA 3HBZA 1PO21 1RUJ2 2XVGA 4F3JA 3IDBB 1X7NA 3X29B 2HEYF 5JOYA 1DIWA 4NN0A 5L7OA 4FPGA 1REDA 5C6CA 1U12A 2PLV1 3MFCA 3SCGA 2Q5TA 2ZHMA 2MPFA 1JN2P 3WW1A 1CQ9A 4XJAA 5EXOA 3AYDA 4AGVA 3N4MA 2RR13 3QBQA 4PDWB 4QQPA 5CFCA 2LTNA 4Q4X3 3R4UA 1VALA 1PVC1 1C57A 1MZ6A 4NOTA 2EAKA 4PLOA 1RHI3 4XW3A 1FPN1 1BBT1 1V9U3 4EJRA 2GNMA 4KWJA 3LA3A 2E7TA 1HRV2 5DUXA 1CN1A 1NQJA 2Z5WA 4YZ2A 3FX3A 5BNQA 1GZ9A 1WBFA 4LNVA 4LLOA 1IS4A 3KLSA 1VB4A 4LO5B 3IDEA 3UJOA 2NZ9A 1RMU1 1PZ7A 3Q9OA 2GMMA 4WVMA 3ZN6B 1VBD3 4RS5C 4AVCA 2P3JA 4XF9A 4E4SA 2RMU1 3MGUA 3SH4A 3VBOB 2HWF1 4KU8A 1IS3A 5ACA3 3M3CA 4GXLA 2OUJA 1VJ2A 1AYM2 1NXMA 4FPEA 2B45X 1S0GA 2GALA 3AFGA 4RQPB 3RI8A 5K0UB 1U5XA 4LBKA 2BBVA 1NA1C 3VBRA 4UW6A 4Y22B 4I30A 1L3JA 1ZBA1 2DYCA 3SXWA 1BYHA 2IXIA 4QPIA 3ZXKA 3SISA 2E53A 1XYNA 3WDWA 5TSWA 2FMYA 3I2DA 4LA2A 1BBT3 1V9U1 4DB5A 2A71A 3VZJA 1AYM3 1UAIA 3FHIB 2WNVC 2YPJA 4LUMA 1FT9A 2HWE3 3OYWB 5A3LA 2V5YA 1DQ6A 2EXIA 2HWB3 4FXGB 3SITA 3WQ0A 2ZOEB 1FAYA 2GMEA 3FWEA 1SLAA 3TOJA 4LUKA 5C8WA 1G9CA 2PHTA 4PIZA 3OY8B 3WD5A 3AKSA 4QPYA 1PM7A 2K9ZA 4Z1VA 1AX1A 3E5UA 1Q43A 4HBNA 3VDDA 1O4ZA 4R52A 4SBVA 5DZEA 1QXJA 4CEWC 1XYOA 2EXHA 4AHZA 2RS31 3DUIA 1W6QA 5JOWA 4QPGA 5H9PA 4CEYA 2PHDA 3EBRA 5GLZA 2ZGPA 4K9SA 1RUE3 4XMIA 1DZQA 3ZO0B 4DRRA 1HRI3 1ONAA 1B35C 1RVF3 4IV1C 1YNAA 5E8AA 1EP0A 4MVTA 1ZRDA 4GULA 3O0WA 4Q4Y2 1ULGA 2BW8A 3ILNA 4QD2A 4IXLA 1UW8A 2A6YA 5I93A 1ZX5A 3W58A 3VDDC 2D43A 4DXZA 1PNFA 1RUNA 4KGGA 1UCXA 3MEPA 3PJYA 4Q4W3 2DU0A 3GBGA 4Q0VA 2H0VA 4IEOA 1QOOA 2Y38A 2WQ4A 2XJVA 4IEPA 4INDA 5GLTA 4Q0SA 1J3PA 1QQP2 2PHFA 4DS0A 3T1MA 2ARXA 2K2SA 1ASJ2 4JC1A 4YARA 3KSCA 2P3KA 1JUIA 4RR3C 4KWLA 5LK7B 1RUH1 1PZ8A 4AEDA 1CAVB 1PIV2 4G4FA 1BBT2 2CNAA 3HT1A 4CEWB 4ISRA 1RHI1 3ASIA 1ZZBA 2PFWA 2Z79A 5J09A 4N9IA 3WOGA 1YI7A 1SFYA 2D5FA 3AZWA 1HV0A 3LKJA 3FMGA 5K9YA 2HWD2 2GAUA 3A0KA 2WT1A 1V6IA 3M2MA 4QXKA 4KL1A 1MQTB 4I02A 5GZFA 3TBDA 3VBOA 3FLRA 3FUOA 4XF3A 1WLTA 2XVLA 4MZUA 2ZGSA 3HMYA 4CDXC 5BV6A 2ZCWA 2NM1A 1JHNA 5A32B 4CP0A 3LB9A 1IOAA 1G7YA 3V0AB 3BOWA 2Q30A 1AYM1 4BOWA 2CGPA 4I3GA 1TNFA 1O91A 1D4M1 1C28A 2DURA 2HWB1 1HDKA 4TSVA 5C4WC 3AP6A 3MPPG 4WM8B 3LSDA 3AKPA 1VBC3 2XBO2 1HRV3 4AGGA 1DBNA 2GNTA 5FDBA 1AL22 2VMGA 2AYHA 4CRQA 3LAGA 1HIXA 4LT5A 4QPIB 1HW5A 4YG0A 3ILRA 5BNPB 4HL0A 4IEWA 5DG1A 4HZFA 1J3QA 4JTOA 5A32A 4IEYA 1OQ1A 5GJ6A 2ZGNA 5CIRA 1LHVA 1PK6C 1VAVA 4JGYC 4WM7C 1LB2A 2QFEA 3AP9A 3TN92 2ZPXA 5JZGC 3GHMA 4OHXA 4ZXKA 5GZGA 1VRH3 2KXLA 3ZFGC 4J6GA 3WR0A 4AGRA 5DDJ2 3TYJA 1EAH2 1AYN1 3H1YA 4AFAA 2UY9A 1ULEA 1S0JA 4UBGA 1PO12 4AI3A 3HIFA 3WG1A 4AVVA 5BNNB 3CLPA 2Y0IA 3R05A 1HQLA 1C1FA 1R093 2JX9A 3KT7A 4GH4B 4QQLA 2R062 1WCSA 2BQPA 5I0SA 4QGNA 1PO22 4NPRA 4WM7A 4XJZA 1CESA 3SH5A 4CEYB 1BK1A 2P37A 1U5YA 4KU7A 2PYTA 4XIKA 4Y1ZA 3VHRA 1A8DA 1U5IA 1HLCA 3PMSA 1XQNA 5T3NA 1RUD3 1BEV1 1GR3A 3I4IA 2K0GA 5FLIA 2WT2A 1CJPA 2CWSA 3L2HA 2IFWA 4DPNA 1V9U2 3AZVA 5CU1A 1TME2 4FSJA 1RUD2 4XZPA 1J1LA 1KXGA 1ZZ7A 1PIV3 2B39A 1VBA2 4HN0A 2VW0A 1A3KA 2O1QA 1LECA 1OFNA 3W9AA 2R042 4JGZC 1EY2A 3S7IA 3EHKA 1YFXA 1Q8QA 1QQP3 1VBD2 4YM2A 4K40A 5BYNA 3H1MA 1Q8SA 3POSA 3O0VA 2XHKA 1NE6A 1W39A 3KM5A 4AG4A 2XVKA 1REEA 2RS32 4MXWA 4LO4B 3DL3A 1RINA 4PCRA 1ENSA 3JD72 1XNBA 4RA0A 2W68A 3LZZA 1DGLA 4EWEA 4IETA 2D97A 2WFF2 1DQ4A 1G9AA 5CADA 1RUC3 5E1RA 4AF9A 4H55A 4FPLA 1JOJA 1OLRA 1C8M1 2B46X 1C4RA 4XILA 4XQ4A 1LULA 1NY71 1IPJA 3TRSB 3VBRB 4IQPA 1W6NB 1XU1A 2IXKA 1YO8A 3ZPYA 4AEDC 1REFA 1OFSA 1Q8PA 1GV9A 4K1ZA 1AR83 5GLVA 1R1A3 3SMHA 1V70A 2A3XA 2XJUA 3JZVA 3IT8A 4P9JA 3TWIA 4MXVA 4F7ZA 3S30A 1DDLA 4XTPA 2JICA 3TN93 3FFZA 1FX5A 3MYXA 3JQWA 3H7YA 1K5MB 1UU6A 4LO7A 4K3UA 4L11A 5JLVA 5FO9B 2QVSB 2R6QA 3KD4A 4V1PA 3USUA 2CAUA 5C8CA 1YRZA 4EN8B 3NVCA 4RL7A 3ZFFC 3C3VA 1DGWA 3AKRA 1COV1 1CAUB 2F6BA 1RMU2 1LRHA 5I8SA 4IEUA 1DLLA 1GQGA 1VRH1 1QMJA 1O3RA 1ENXA 2B5HA 2DVFA 1VBE1 2XB6C 4XE9A 5ABJB 4YG3A 4YZ4A 2VXRA 2VGDA 1JBCA 4P9WA 4QGLA 2D5HA 3MIEA 1IKQA 3MW4A 2RM22 4AFDA 1NYWA 1OA2A 2EALA 3N35A 3VBRC 3FFQA 2RE9A 4MX3A 1DGWX 5EJ3A 5JAXA 2JE9A 4RGAA 4NR1A 1N3PA 1MVQA 3PMEA 4I2OA 4PDWA 1YYNA 4BQ1A 3TB0A 2RM23 5KC6A 1UD1A 2P2KA 4GIQA 1AR92 1LU2A 1RUG2 1Q56A 4AVBA 4HK8A 1Q8VA 4N43C 3VBSA 3M3IA 4QX5A 4ASMB 4IESA 1Z0HA 1YFUA 1RHI2 4XIOA 3HR9A 2BWAA 3AZXA 2D40A 2AUYA 2B7YA 3AMMA 3RPQA 2WLQA 2XPJA 2ARBA 4PLNA 4IV3A 4DNYA 2R073 4FVVA 4KBBA 3WG4A 2VOWA 4MUVA 4DZGA 3KGZA 4CP1A 3H8UA 1RUI3 2RMU3 2OA2A 2XLAA 5I8YA 2WZR2 5GZEA 1V6MA 3MLJA 3ZSJA 1J59A 2HWC3 2PHXA 1SFNA 4LTAA 4R9BA 4JCKA 4RD7A 3THTA 4UXAA 3QCWA 4RQPC 5K0UC 4FAGA 1PGL1 2VUJA 2WNUC 2BTVC 4YGCA 4Q27A 3LA7A 1KJLA 2DVBA 4IV3C 2D93A 2DVGA 4XJ9A 3WLUA 5DZFA 2R32A 2QDNA 4YVSC 2H6CA 2R1DA 2D3PA 5KXEA 3VBFC 2BEOA 5BNOC 4FTBA 3VBUC 2NLRA 4XFCA 5J96B 1CAXA 3V0AA 4OI4A 1ZZ6A 1OOPA 4Q1PA 4Q4X1 3MICA 1N1YA 4Y1XA 1TME1 2YYOA 1Y7BA 1FPN3 1GZCA 2PA7A 5AVPA 2O8OA 5C4WB 1Y43B 1RUH2 4AEMA 3AJZA 1CIWA 1XNCA 4K21A 4AHWA 1MQTA 4KGQA 3FLPA 1N47A 3GZAA 3KMHA 3ES4A 5GZDA 3WW3A 1X33A 2PHLA 5CFDB 1V00A 4QU2A 2A6XA 1A78A 3N7JA 4ITCA 3NW4A 1WLCA 4IERA 3VBHB 1AYN2 5I8TA 2BFUS 1HQNA 4Y1YA 2DUPA 4Q4Y1 2VOVA 1F8VA 2X8KA 4R4ZA 3WDVA 4YM1A 2CGOA 1IS5A 2XGXA 2WFPA 4AI1A 2UYAA 5EYYA 3ZYPA 4JQRA 1LJ7A 2G9FA 4XOGA 2NN8A 1LOFA 4C91A 5BXXA 1CR7A 3OPZA 4OULA 4OUSA 2WIIB 1X8EA 5JIUA 1WW5A 1PGSA 4XTMA 5KHHA 3M1HA 3WP3A 4M0NA 1QOTA 3VZMA 4ASLA 5LEJA 4KH9A 4HKWA 4OI2A 2XBO1 1KITA 3I7DA 4LULA 3AMQA 1I1EA 4LO8A 4I09A 1JXNA 1VBB3 5KC5A 1BKZA 1DQ2A 3U4XA 1YFYA 4P9LA 3J8F1 4P9IA 4M3CB 4WZFA 3VV1A 3FZ3A 3VKLA 2PQQA 3H1WA 4EN7B 2OUHA 3JBG1 1BQPA 4Y1UA 2SBAA 4LLFA 3B9CA 4GB32 4QM8A 2VH9A 5J3UA 1R1A1 4PBPA 3MZHA 4P5HA 2XWJB 2R072 4PJYA 2TNFA 4YYOA 1BVVA 1J3RA 1M06G 2H6BA 2JKBA 5FLHA 5IK4A 5AC91 2GNBA 5F6KA 2WS93 1SLBA 4LBQB 4XF0A 4PIYA 4WM8A 4U2AA 4AK3A 1FV2A 5T55A 1PIV1 2GNDA 5J48A 1KD7A 1YIFA 1H2LA 2QE3A 2BNMA 3PVOA 5BNPA 3RS6A 4AQSA 1EV13 3BB6A 1D2QA 5JSRA 3AXDA 2YY1A 4AQ6A 1UX6A 1LENA 1UF2C 4XQWA 4XETA 1LCLA 4P9GA 1VBA3 4C0BA 4YGBA 1RUH3 4IV1B 2V73A 3ST7A 2IWGB 2GSYA 4NO4A 4H7LA 4E2GA 2LM3A 3B01A 4MGIE 5EV7A 4ISQA 1IS6A 1WCDJ 1QXRA 3APBA 4CYDA 3KQRA 3RWNA 2E51A 4I3PA 1G9FA 4YW4A 2AGSA 2VUAA 1JYCA 4XYXA 4XF4A 1AYN3 3ZDSA 1AR81 1O3TA 4C90A 4M01A 2GC2A 5BUVA 1QJY3 2PHUA 4OHVA 4I0WB 4AYUA 3NAPA 1ND3C 3VBHA 2RR11 4LBLA 3BTAA 4GB33 5L7OC 5T50A 4K20A 4A7YA 1NCQC 4R9DA 1AX0A 4FXKB 1R092 5JI7A 1FI2A 2VNOA 4XFBA 3D0JA 1MEC3 3VDDB 3ETQA 5T5JA 3B94A 4E4ZA 3DGTA 3ACLA 2XJSA 5EYXA 4F8AA 4GQ7A 1NZCA 5FMOS 4HK9A 2OVUA 2O8QA 1VBC1 4XJWA 3V64A 2MEV2 1GFF2 1V6KA 3C2UA 4Y24A 4YW2A 3RZZA 3MLKA 3B93A 1VR3A 2QNKA 3M3EA 4N9HA 3AKQA 1Z7S1 2XL7A 5E88A 3THPA 5KHJA 2ZGRA 2YGMA 4GH4A 2NYYA 4UW4A 2WINB 3RNSA 4P9YA 2MEV3 1B35B 5CNAA 4B3NA 3VHNA 3AXEA 5I0RA 1PVC2 1XU2A 4FTSA 2RJKA 1ND2B 3J8F3 4QMAA 2B9UA 2A75A 3A4UA 2CAVA 3FUQA 1UIKA 1DZRA 3NSTA 2Q1ZB 3POYA 1RB8G 1RUG3 4WZCA 4AE2A 4GB31 1H1AA 1QY4A 1W6OB 3ZFGA 5JPNB 3JQXA 3UKNA 3WV6A 4ATEA 4YM3A 1W6QB 2RMU2 3TAYA 1FOD2 3RG0A 2YZ4A 3NV3A 1I5ZA 3WQ7A 2HWE2 1DYKA 2RM21 1FATA 1F31A 1C8M2 4META 3JBG2 5FAXA 4OZXA 3VBUA 1QNWA 4WVWA 4XF1A 4B4QA 5L73A 2BPA2 1CPNA 1ZBE3 3S0MA 1FMD1 1Z7S3 3VGIA 3LOIA 1HQWA 3PHMA 3WCSA 3E5XA 2HWE1 3IMNA 4OHZA 1AR93 5FFOC 1AR62 4LBQA 4XXPA 3NAPC 3HAGA 5KWRA 4QQHA 5FQ0A 4LO6B 1KS4A 1LODA 5AFBA 1WUVA 4JDMA 3IM0A 1IGOA 1DYPA 2A73B 3USUB 2R043 2ZAHA 3OJBA 1JUHA 1H9PA 2XKOA 1F5JA 1E57A 1BEV3 5I0UA 4U36A 3NL1A 2R0FA 1AR63