3DCQA

Lecb (pa-lii) in complex with the synthetic ligand 2g0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fucose-binding lectin PA-IIL
publication title Inhibition and dispersion of Pseudomonas aeruginosa biofilms by glycopeptide dendrimers targeting the fucose-specific lectin LecB.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 21
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 3dcqA00
2WR9A 2JDMA 1OURA 2JDPA 1UQXA 2BV4A 1OUXA 2CHHA 2BOIA 2WRAA 4UT5A 1OUSA 2JDKA 3DCQA 1OXCA 5A70A 1GZTA 5A3OA 3ZDVA 4CE8A 1UZVA 1W8FA 2JDUA 5A6XA 2JDYA 2XR4A 1OVPA 5A6YA 2VUCA 5D2AA 2VUDA 2BP6A 4AOCA 5HCHA 1W8HA 5A6QA 2BOJA 2JDHA 2VNVA 2JDNA 1OVSA 5A6ZA
chains in the Genus database with same CATH superfamily
4CCLA 3WHUA 4LT5A 1K42A 2W95A 4S2DA 4DXRA 5BUVA 3TEZA 3AMHA 4LITA 3E5UA 3MYXA 2UURA 4NRPA 5A3UA 3AM2A 2CV6A 4IV3C 5K8SA 4PT6A 4R4ZA 2JJ6A 3ZYHA 2XPJA 4RS5A 1S0BA 5A7PA 4CP1A 2VZTA 1OBNA 2WNVB 4GB31 5FXXA 5IVEA 1S1AA 1MACA 4QKFA 3IM0A 4P5YA 1RUF3 4NO4A 3JXSA 4LQRA 4KU8A 3ZFEB 4CUCA 3EXUA 2PMWB 5L73A 5BNNA 3VD9A 2BDRA 4B1MA 1JHNA 2P3IA 3C7EA 1AR82 3B94A 1XE7A 5JMOA 3FHAA 3N9LA 4GULA 1ZRFA 4KGGA 1OFSA 4AXOA 4ES9A 4EWAA 1YLLA 2C9KA 2W0XA 4CDWC 4XJUA 4J1XA 2E33A 4MH0E 4LIVA 1CZSA 5AVPA 3VBRC 2PAEA 3OBTA 1ZYBA 4HT1T 5AC93 1ZA7A 3KF5A 4MGTA 4JQRA 3M3EA 4JGZA 2HWB2 5IVFA 1CJPA 1V9U1 5FY0A 5IAXA 2E26A 4J1WA 4EYUA 4Q8KA 5KHJA 1PGSA 3N9PA 3UYJA 2W1UA 4BQ5A 3OOXA 1NXD1 1Q56A 3PVEA 4YM0A 2VOVA 5JZGB 4UFLA 3WUDA 1Y9MA 3AZXA 1OQEA 2W92A 4YPJA 2JG9B 1SCSA 1AYM1 2WQ8A 2D93A 4HN1A 2GMPA 1HIXA 1UKGA 1XU1A 4AI9A 2WO7A 4TTGA 3HVDA 2DFCA 2MPFA 4C1WA 4QAWA 2LW8A 4BQYA 1DQ4A 2D6LX 4GXLA 2GDFA 5LBFA 2YC2A 3IDBB 2ZTNA 3I54A 4XUTA 2P1BA 2Q1ZB 2VD7A 1LOFA 3E6BA 4DZGA 3GXUA 2C0ZA 5FXWA 1ULPA 1SFYA 3H1MA 3RYPA 1GICA 2BWCA 3APBA 5FZ8A 1BHGA 4CEYC 2R062 5CNAA 5A6QA 5ABJA 5BPXA 2RS33 4Y3OA 2W47A 3J8F3 1NCQC 4GMP1 4NAMA 3OUJA 1ASJ1 3MGUA 3BODA 5JPNB 2B46X 1TMF2 1PVC2 1SLAA 1WMEA 1YQ8A 4I01A 3BOPA 3W20A 3EQEA 5C71A 3ES1A 3UKVA 4A45A 4ARYA 3UKNA 1F8VA 4XZPA 1RMU2 2DVAA 5LY2A 3U07A 4BQ3A 3HT1A 5A7SA 2X5IC 2AENA 1X8MA 3MV11 1MVEA 2JE9A 1UZYA 5FOBB 4RN5A 3N9NA 2GNMA 2YFZA 4P9JA 2D5HA 1W6NB 1PM7A 3ITQA 3SITA 1FPN3 3R4UA 1JU4A 2JG8B 2RV9A 3KGZA 3SKJE 3VZLA 3B5LB 5FO8B 4CA9A 4ZU4A 4MXVA 4Y5TA 5FUNA 1VRBA 1AVBA 2DURA 5BNOB 4Y5SA 4Q29A 3BALA 4OI1A 1BMV2 4F7ZA 1W6MA 4AI8A 4IEXA 2P4EA 1RVF1 2R072 1K5MB 1S0FA 1UCXA 3IDAA 1JYVA 3POWA 2AH2A 5E89A 2ZABA 2VUDA 1H30A 1HW5A 5C3OA 4AI1A 3CO2A 3KVAA 3AYCA 4HN0A 4BDVB 4Q5OA 4COUA 3AYDA 2VH9A 1LGCA 1S0JA 1V6KA 5FRAA 5K7PA 5DUXA 2PYTA 2BU9A 2ZZQA 1F5JA 2NYYA 1O5UA 3JBG3 1KS5A 2P3YA 4LKFA 2BVBA 1FMD3 1NYWA 2JDAA 2A6ZA 4NHYA 5FCCA 1O91A 4XMAA 3Q8BA 1KJLA 3PUIA 4UW6A 5FQ0A 5KXBA 3W9AA 4NHMA 4YWAA 4D6QA 4I3GA 2R0FA 1B09A 5T50A 4NIAA 1FV2A 1RUF1 3CJIC 3TYJA 5L7OA 2A1XA 5FYVA 3FUQA 5EZWA 3IAQA 1HRI2 5BYNA 3DECA 4LBMA 1C57A 1BCXA 1N1VA 5BY5A 2Z5WA 4JTNA 1F15A 2GC1A 4ES8A 1JH5A 3BVCA 3WNMA 3OGSA 4FFHA 5FKCA 5J96B 1YUDA 4ZXEA 2ZKLA 3WV6A 3CMGA 1EPWA 4K3UA 4MXWA 1MQTA 2BOIA 2CSGA 2YYOA 1UY0A 5AC91 4IEOA 1UZ0A 3BOWA 2V4VA 4CDUA 1XNKA 5C3SA 4YG6A 3VBHC 1F2NA 4AHYA 1B35A 3H9AA 4NRMA 2VG9A 4GJZA 4P9IA 5IYYA 2EIGA 1FATA 3WNNA 1UPSA 3DPRC 1U5YA 2CL2A 1C1LA 2Q1FA 4FOWA 3NSTA 1WCUA 3HQRA 4WM8C 1UOFA 2G9FA 4S2FA 2WNVC 4GIQA 3ZMOA 2H6CA 3JUUA 5CBLA 2GN3A 4H14A 5FY7A 1W6OB 4KNCA 4QHBA 4JRLA 4YGCA 4H55A 4BA6A 3ACIA 2R063 4GWNA 1Y3TA 5FXVA 1ZM1A 3VHNA 1HRV3 3LOBA 1S55A 4XFGA 3I2OA 2G9ZA 1PVXA 1G9BA 2HH9A 2QFEA 2VVFA 3POSA 3NV4A 4AK3A 1RUNA 1PVC3 5T55A 5J09A 2EXJA 1Q5OA 2FDJA 4QB2A 3SEEA 5ERLA 4JRAA 1VMJA 1RMU3 2VNRA 2YPDA 5DUWA 4LOTA 5FY1A 1H9PA 2G1MA 2XLFA 2XJQA 1VBB2 3IDCB 3ZYRA 1OLME 4C0HA 1WBFA 2Y26A 2PFWA 3GYDA 2RS31 3C8XA 3N9QA 4MGYE 5LRSA 2PHDA 3J8F1 1V6NA 2VZOA 2HWE2 2DVGA 2JDNA 2IVIB 3R0RA 2C24A 3HMYA 1SPPB 3H3LA 1UWWA 3IKWA 1KEXA 1OA4A 4YW7A 1C8NA 5FP7A 4AEDA 5A80A 1HB3A 2AR6A 4ITCA 3GBWA 5CFDA 3M2MA 5IT6A 3S57A 2OW4A 3OBAA 4QT6A 2QJVA 1E57A 4Y4YA 4QX2A 4DO0A 1KFUL 1ZZ7A 3ZFFC 4AVTA 4QPGC 3W58A 1LGNA 2D98A 4NIIA 2JDUA 4CEWB 5F9TA 4N43C 1GNYA 1A8DA 4OLLA 4UBGA 1JZ7A 4A7ZA 1PIV2 1CX4A 1FYUA 3ME2A 2VR4A 2R6QA 4Y1YA 1LOBA 1J1TA 2VZVA 1FPN1 2RJLA 3HR9A 4IV1A 3VDDA 3MW2A 1L7QA 4CUGA 5JPMB 1QF3A 3NAPB 1ALYA 3OG2A 4N90A 3LIHA 4P00B 2GP5A 4UW4A 2TUNA 5JSRA 5I0UA 4YZ2A 1VBD2 2BEOA 1KJRA 4EN7B 1JN2P 2UY9A 3SH3A 3POEA 4XFCA 2Q8DA 2JDKA 3A21A 1DGRN 1YXWA 3RZMA 4KWLA 4BQXA 2EF6A 4NPMA 1DZRA 4R9CA 4QXCA 4XUOA 3ZSMA 4HVRA 4FI9A 1V6JA 4E2SA 2E7AA 4LUKA 4CCJA 4I2OA 4KMQA 4FVVA 1JBCA 2A71A 4MVTA 5FYUA 1COV3 4BHPA 1F4HA 4LR4A 1EY2A 1SQ4A 1XNAA 2Y6GA 2QQVA 2Y6LA 3AKTA 4JKMA 4QQHA 3T1MA 4J6GA 1ENXA 4LNVA 3JBG1 1IS4A 1W2NA 1M06G 4FPCA 1LU1A 1FMD1 4QX5A 1JOJA 2Q1MA 3FWEA 4FOQA 1PGW1 3MIGA 3NRUA 4IDZA 3AP5A 1VBE3 2XH6A 4YGDA 4AYUA 4IEWA 5JI7A 1YI9A 2ZGMA 4IGOA 4RQPA 5A70A 4XC9A 4NOTA 3HBKA 2XGXA 3INAA 2RVAA 2VBDA 2DBNA 2RS13 4O7XA 4PDWA 4X6RB 4ZZ5A 2VVDA 2D40A 3WG4A 4QPIB 5L9VA 1N3OA 1FNZA 1KQRA 1JYIA 5CKQA 2DFBA 2VNOA 1QJU3 1GOFA 4LORA 1CAXA 1ZZ6A 1XPWA 1ND3A 1N1TA 4IEZA 4CCMA 2P3JA 1C8M3 1K5MC 3AKSA 3J7MA 5DAQA 3IPVB 5FFOC 1UD1A 4H7MA 3VZKA 4B4RA 5DQ0A 4BISA 3JQXA 3GF6A 2ZX1A 3FL7A 1JOBA 2JWPA 1QJZA 4Y22B 1OFNA 4XQDA 1CZTA 5FZHA 3WP6A 5JDBA 4ASKA 5A7NA 1V6MA 3VB9A 1OXCA 1ACCA 3OYWB 1RTVA 4OVEA 3M3OA 4DS0A 5HXVA 2P3KA 2BNNA 3BU0A 3H3ZA 5A33A 1JUIA 1U5XA 3DYPA 3Q8EA 4A6SA 4IQPA 1UXXX 4AFAA 2YG0A 4OYUA 3MFAA 4IL7A 1BK0A 1AR92 3F95A 2OUHA 2WZR2 4Q0QA 2K46A 5F32A 1AX0A 1QJY3 3ZFGB 3N3HA 3QH6A 4JDNA 2AGSA 2WFPA 2JE7A 5B2GB 5DXDA 2R061 2QE3A 1X36A 2UWBA 5FMCA 4AR2A 4DY3A 2FCUA 1HRV1 3Q8CA 2FDKA 4QDQA 1YRZA 1DZTA 2Y0OA 1SLLA 2C6SA 1NE4A 4WVVA 3AP6A 3N36A 5DPNA 3ON7A 1PVC1 1LOEA 2JE8A 1W6QB 4LJHA 1QQP2 2WZEA 5FBZA 2P6HA 1ND2A 1PHMA 5DMYA 1RMU1 2QQNA 4Y4RA 3QOPA 1ZBA2 1QIQA 4N7UA 1BJQA 1VP6A 2HWD3 2V73A 3J26N 4OZXA 4Q4V3 1GV9A 2NPIA 4DUWA 1PMIA 3GJAA 5C4WB 4YW1A 4LLOA 1OF3A 4BM8A 3PVOA 3LEGA 3SHRA 5DDJ2 1Q8QA 1PIV3 3HN1A 1MEC2 3CKHA 4XJWA 1CR7A 5FPAA 3VL8A 1IQDC 4E4SA 4RGKA 4C8DA 4Q0UA 3FBYA 4B29A 2A5ZA 1H4HA 1OVSA 4JX0A 3VHPA 4Y1ZA 4AHXA 3VLBB 4EN9B 2HBTA 3LDRA 3M70A 4JKKA 1ZZBA 4GWMA 4FOVA 3KLSA 4QQOA 5LA1A 1CAWB 3VBFB 2ETEA 3O1VA 1V0AA 2VY0A 1RB8G 3N7MA 1T2XA 1O5LA 2OPKA 2W3JA 1VBC3 5F37A 1RUI2 1C28A 1FOD3 1PNGA 3RSJA 3WG1A 3ZSEA 4BMBA 2W1SA 1NT0A 5J1XA 5FK8A 1KS4A 2WYSA 2EA7A 4RS5C 5FYTA 2VO5A 2MHFA 2QTWB 3KSCA 4BIFA 2FDIA 3NKTA 4YG0A 1TME2 2OT7A 3GJBA 3FE5A 4YVSC 3V64A 2ZOEB 1SG3A 2YBSA 3ILFA 5HCBA 5FJKA 1RJ7A 3AKPA 1ZRIA 4IE0A 3WDUA 5BNNC 1AR63 4QB6A 3IT8A 3RZJA 4M3CA 3VBOB 2ARAA 4XJ8A 1LODA 2XLAA 3UL2A 1G9AA 3WNLA 5FP3A 5DAXA 1WLCA 1W03A 1DFQA 1K5JA 3ZYJB 5F6LB 4D8MA 3UJQA 4TZDA 4CP9B 1W0NA 1COV1 1VMFA 3WY6A 3AZVA 4KI5M 2CTVA 4ZY9A 1WD4A 5FZ6A 3UESA 2VUCA 1LHVA 3AZYA 1UYYA 1GOGA 5FMOL 4E9KA 5HCHA 1R64A 4JGZC 1C3HA 5F5IA 4NIGA 1DHKB 1W8HA 3KT1A 3L9JT 3ILRA 4ZONA 5SV5A 3BI3A 1GWKA 4HK8A 1EYBA 1PK6A 2DV9A 2QQMA 4D94A 4YM3A 1VBE1 3AYEA 2SBAA 1YO8A 1D0HA 4OFGA 2MEV2 4RHV3 4WM7A 1W6PB 1OH4A 1XYOA 4A41A 4CCCA 1H6YA 4XUPA 4KGQA 1KDKA 2XHKA 2RS11 1U5ZA 2W9XA 4DB5A 1UIJA 2ET7A 2HBUA 2X29A 2PLV2 2VGDA 4XURA 1XNBA 4XAEA 3O1OA 1DIWA 4R9AA 2ZGQA 5JOWA 1QJU1 4HBNA 4A7KA 4TYSA 2QQJA 2W68A 5JIAA 1C8M1 5D1IA 3IMNA 5JUVA 4BQ1A 1QOTA 2OPWA 2XL9A 4SBVA 2CYFA 1QXRA 2YY1A 3NV1A 3VBRB 2VECA 1C4RA 1LOFC 2RJ2A 4JV4A 5CAZA 3TWIA 2VBPA 3MIBA 5FYIA 3T2PA 4BYYA 3QLQA 1S0EA 1W9SA 1Y43B 5A32B 2P6CA 4XJZA 5I0DA 1N1YA 2X05A 2D3RA 2YROA 2RHPA 2YDEA 4CUAA 4ZS3A 5ABJC 4DY5A 1UYXA 2QKDA 2WQZC 1LJ7A 3JD72 4NN0A 4CCKA 1PO23 5GZGA 1W9WA 2KM2A 4F83A 1JW6A 3WLUA 5CU1A 2QUOA 2HJIA 4CDXA 1ZBA3 1QJY1 4EROA 3POFA 4PBOA 5E1RA 5JOXA 2VMHA 5C3QA 3OPWA 4N9HA 5JR7B 1D7PM 1VAMA 1ZRRA 2Q4SA 3EHKA 1UKRA 2C1FA 4V1PA 1UXZA 4JVAA 3ZPYA 1MS0A 2WA4A 1PZ7A 2PHWA 3RQ0A 2B4KA 4LHNA 2R043 1NUKA 5C8CA 3VZMA 4AFCA 2ARBA 2A6WA 2WUHA 1H2MA 2IXCA 2GZWA 3NQHA 1SZBA 1S0DA 3PVBB 1H9WA 1G8WA 2RS53 1V6OA 1CAVA 2YBPA 3AXEA 3MPBA 3MO4A 5J48A 1UZZA 2HWD1 4Q4V1 3I59A 5EFUA 1G9CA 1NOVA 2ARCA 4Q4X3 5I0SA 2O14A 2XQRA 3KT4A 4MHRA 4AFBA 1FX5A 2WWSA 4RL7A 3PVNA 3PUQA 3I3QA 4CEYB 2XKPA 1MZFA 2DYCA 4N53A 1PIV1 1RINA 3SNMA 1NCQB 3WNKA 3MF6A 1OKOA 4AF9A 5LEKA 3USUB 2Q5TA 2WABA 1H8TA 3SCGA 1EV12 5FZFA 3WDXA 2LROA 1TME3 5F39A 3HQUA 4U2AA 1OQ1A 5BNQA 2B39A 1JS9A 1JUHA 2IUWA 2XHNA 2PA7A 2R1BA 3H7JA 4MGIE 4D7YA 3O1MA 1DYPA 2X5IB 3ATGA 1DYKA 3H42B 4NUBA 1Y9QA 2OQ6A 3PJQA 3D0SA 3HWJA 5JAXA 1IPSA 4BJ0A 3IDEA 3WP5A 1N1SA 1Q8OA 1VBC1 4EQVA 1CIWA 2WNUB 1FOD1 3VKOA 2OZ6A 5JXHA 4D7SA 2GNDA 3LOIA 3TEWA 1J83A 1W0OA 2B42B 3LB9A 2JIJA 3UK9A 1ULOA 2YUEA 3BN6A 4HMZA 2PHXA 3I2HA 2XJSA 2W52A 5FPZA 3U37A 5D2AA 1A8MA 1DQ5A 3K4ZA 4D69A 3KHCA 4FO9A 5L7OC 3LEKA 3SISA 2LALA 3I3DA 2D5FA 2FDHA 1XOYA 3T4VA 5C4WC 5JXJA 1AR61 4OQ9A 2VVEA 4DRVA 4AQSA 4S2HA 3VZOA 5BNPA 3LAGA 1YJKA 2BFUS 3IIAA 4XABA 3S0MA 4L9BA 3LSDA 3NNJA 5FAXA 3AL6A 4HZFA 3WF0A 2DVDA 3ELNA 5FZEA 1QEXA 1WMXA 3MLLA 2PHRA 1U5IA 4WV8A 4YVWA 5T3NA 2P34A 2ZJCA 1MQTC 2ZX0A 2A6VA 1DCSA 3NNLA 2VQAA 2RG4A 3GCWA 2W46A 1NY71 2PLV3 1R082 3SEPA 4CDUC 3D6EA 1GZCA 3OUIA 4YNIA 2W1QA 2DDUA 2FMDA 1POV3 3PU8A 2OZJA 5ISLA 4Q1PA 1W9TA 1B35C 4QKBA 1WW4A 4QQPA 4XETA 5FZGA 5JSPA 1C5HA 1W8OA 2CGPA 2AC1A 4K8RB 4YZ1A 2BUKA 3RZLA 4RHV1 3FX3A 1QJFA 2CWSA 2VXJA 4P9XA 4JGYA 1GUIA 4XCBA 4AVVA 2E32A 3LF7A 4I0AA 2K0GA 2OXBA 4TWTA 3CJIB 3NNMA 4JDMA 4H7LA 3V0AB 3AK0A 3FN9A 2ZEYA 4HETA 4OI4A 3J7NA 3ZYBA 4CU6A 2WFF3 3WQBA 1MZEA 1I6XA 2FMYA 1WA6X 1WCSA 1AL0G 2ZX4A 5A7QA 2AUYA 4RA0A 3GBFA 4HPKA 3O12A 2E31A 4GQ7A 4WVMA 4Y26A 3VBOC 2WO1A 5C6CA 2P17A 2PN5A 1G7YA 3JB4C 1M4WA 1IZ3A 4GWIA 4TSVA 4W50A 4DOUA 1NX9A 3MHZA 4BE3A 2Q30A 3HBZA 5IVJA 1LESA 4UFIA 1UO9A 2N7GA 4BCUA 2NLRA 3ZMNA 1YEWA 3I3EA 4LBNA 5FYBA 2OQ7A 5FPBA 2A73B 5F5QA 3KWVA 3RVHA 3GNEA 4GMP0 3VBHB 2FQPA 3ZR5A 1WZXA 2JKBA 4LA3A 3C2UA 5LZ6A 4XBLA 1SMVA 5EYXA 1PO21 4XHBA 1CD3G 3RDIA 1W8TA 5ACA2 1YIPA 2GC0A 3DPRB 1BEV2 4ASLA 3I2DA 4COWA 2ZHMA 5FUPA 1ZBA1 4NMIA 4WM8B 3ZN6A 2DCYA 5GZDA 4AEDC 1OOPA 2VOWA 3LCPA 2WAOA 4FAHA 5CFDC 1NG0A 3BU7A 1HB4A 3HNBM 1EAH2 1AYN2 2VUAA 2W08A 4HG6B 4ZHNA 3I3BA 3ZXFA 2ERFA 2R041 3OY8B 4R9BA 4A6OA 4BZ4A 4PF5A 4FPOB 2XJVA 1WCQA 2I45A 3VGIA 4F8AA 1H2NA 4XBQA 1SFPA 3ZX7A 2BERA 2PTMA 3KV6A 2D44A 4KG0A 3MLJA 1YFWA 3MBWA 2R32A 2RS51 1UOBA 3L2HA 2RM22 4HONA 4RR3A 3B9CA 2DBIA 4Y1UA 4Q4X1 1UY1A 1CAUA 1CQ9A 2ZHNA 3MDPA 1VBA2 2W39A 5IK5A 3PTRB 1ZRCA 4AGGA 1O4TA 4QHOA 4DXSA 1MS5A 3PDQA 2IXKA 3K4DA 4LHSA 3WF2A 4OI2A 3THDA 4OHVA 1SBFA 4RFRB 3I2JA 4Q0PA 3S7EA 1RUE3 3VBUA 2ZMLA 4GAZA 3PU3A 1TME1 4KWUA 1GYKA 1PZ8A 1WUVA 4M0NA 2RR12 1Z7S2 2PXJA 2WIIB 3FHIB 1AX2A 2D43A 2JDPA 4FPEA 1UIKA 2XDVA 3ZFFB 5J7MA 4QPGB 3I97A 3SQOA 5HPOA 4N43B 2XMLA 3RZKA 4XJ9A 4N7IA 2V09A 3BYWA 5EXOA 2QBXA 4NR1A 2PQQA 2ZMKA 2IWGB 4AAXA 4RFT0 2JDZA 1V70A 3AVSA 2QQUA 2QZ2A 2VPVA 4IETA 4NVPA 4Q27A 4MGQA 5IATA 1I1EA 3KCYA 1D2QA 2WS93 4D3WA 3WF1A 2WSVA 4O9GA 3ILNA 1RHI2 4RQPC 5CKNA 2XL7A 3RG0A 4PDWC 3UGFA 3N7LA 2WINB 2LRPA 1MR5A 5APAA 3WT3A 2D7FA 4AG4A 5KHKA 2RMU3 1Q8VA 1L3JA 2XVKA 4NPLA 5H9RA 1HJGA 5FWJA 4XF3A 5A3TA 1PM4A 4OHWA 3UNPA 1DGWA 4UI9L 2ORZA 3CJXA 2FDGA 3DF0A 2EALA 5CFCC 3POJA 4ASMB 3P3NA 2VE1A 4XFHA 4QDSA 2PLV1 5GLVA 5J36A 4Q26A 2P2KA 4HSLA 1POV1 4LBQA 1Q8PA 1ULFA 1US2A 1SHWB 5D8AB 2C5DA 1RUG3 2WNUC 3ZXDA 5FY8A 3S30A 4HVQA 1AXZA 2DCKA 1RUC2 2AEYA 2VW1A 3T3YA 4QU2A 2W91A 4PF1A 5EYYA 3H8OA 4Q4W3 3SH4A 4K8FA 4EWEA 2BBAA 2Z42A 2YGLA 3O5SA 2ZEWA 4NRQA 3BPZA 2WFF1 1UMHA 4LE4A 3S5AA 1ZX5A 1NE6A 1J3PA 2QNKA 4K20A 3UGHA 3WNXA 3RZGA 3AMPA 1X82A 4MGZE 3M3IA 1LR5A 1Q3EA 4IGQA 1XQNA 1T6BX 5K0UC 2WO3A 4YARA 4EZHA 4BH9A 1RC6A 1YQ6A 3O0XA 2EICA 1ND2C 4IUGA 4QQLA 4DPNA 3A7QA 1PO12 3LA7A 2ZEXA 3LFIA 5C9AA 2DCTA 1SACA 2ZX3A 3VN4A 5IK4A 4XF0A 3VHRA 3ZPOA 4W6XA 3C3VA 4Y22A 1OUXA 5FZLA 1MZ6A 1AR83 1W8ZA 1J1LA 3VD7A 2XWBB 3KZ4C 4A4AA 1GNZA 4UAPA 5IFPA 3NJVA 4Q2FA 3LGRA 1ENSA 3E97A 2VMGA 4P02B 3T30A 4NHKA 1X8EA 4HL0A 5T5JA 2ZHLA 1YQ5A 2J1AA 2JENA 4FPLA 3NL1A 5GKAC 3ZXJA 3ZFGA 1BLZA 2HWB3 2VTXJ 2XKOA 3ZKYA 3WINE 3CQOA 1BK1A 3U0ZA 4ZKTB 2ILMA 2BGCA 3SH5A 1JOPA 3KV5A 2Y0IA 2H0VA 3I2IA 1GQPA 2W1WA 3OGRA 3S7IA 5C5TA 2RR13 2XB6C 3FLRA 3GZEA 4LBJA 5F2SA 4COYA 1TE1B 5IAVA 5EP9A 1UX7A 5JCTA 2O1QA 4OUSA 5FREA 4P9YA 2WWUA 2V5YA 4L92A 1S0CA 3HPNA 4CDQC 4OQ8A 4BQWA 2A3YA 1HLCA 1RUE1 2ZAAA 4G9SB 4J25A 3EO6A 1H2KA 4N9IA 3ZIXA 5A6YA 1W2AX 5FYHA 2ZACA 3CLPA 3AMNA 5A3MA 2VZRA 3PIJA 4MG2A 1J84A 5I0RA 2WNEA 4JHZA 1RIRA 2HKXA 1RGSA 4TN7A 1MS9A 1T6GC 2EXKA 2VU9A 2VW2A 2WT2A 3M3QA 3OF1A 1AZDA 2I2SA 3C7FA 4P08A 4GH4C 1HB1A 5DABA 1UL9A 3MI8A 5FZOA 1AL22 4XDOA 1GZWB 5FYCA 1LB2A 3I3MA 4Q0VA 2TNFA 2A3XA 4RS5B 1TMF3 1PK6C 2B7YA 3C7HA 3VBSC 1NLSA 2ZGTA 3ZXAC 2WS91 4WM7C 4C91A 1JYWA 2I74A 1V6LA 3H8UA 1SEFA 2VCMA 1E5IA 2XBO2 1IS5A 4YVSB 5E88A 2A75A 3WDYA 4Z1VA 3PNAA 1DLLA 4AAPA 3A0KA 4YSFA 1VAVA 4ZXKA 4UW5A 4DQAA 5BNNB 4QX1A 2GAUA 2D3SA 4FXKB 4P5HA 3S6PA 2NQYA 1E5RA 1S4CA 2RMU1 3V65A 5F2WA 4LTAA 4H3WA 5LBBA 3O1RA 2BPA2 1YWKA 1DQ6A 4LIUA 3K75B 4QM8A 3VKFC 3ZYFA 4OHYA 3QD6A 2EXIA 5ANNA 3R6SA 4AZZA 4D0QA 4ORFA 4DFSA 5CVRA 5DZEA 4E4HA 2JD4A 5HCFA 1VIWB 4GKXA 2OYZA 2G9GA 4JGZB 1OC1A 4AEMA 3OSDA 3AZWA 2NMOA 1IHMA 1QOSA 3VUOA 4E4DX 4WZFA 5FPXA 3T2OA 3ZO0B 1AR72 1RUG1 4FPYA 5IW0A 3WF3A 2R073 1GP6A 1LOAA 3AMMA 1NA1A 2D6MA 4W4ZA 2IZWA 1NLQA 3DEMA 3I2GA 2FDFA 3G6JB 3H7YA 5FZKA 4Q4W1 3SCFA 3ST7A 4IV3A 5FKBA 5I8YA 1W8UA 4CDXC 3E5QA 2NN8A 2ZCWA 1JZ5A 3GZTB 1JZ2A 1UQXA 3H8XA 2VZPA 2A3WA 2CHHA 4M00A 3WQ0A 5AFBA 1QH6A 2KXLA 4LUMA 2EIDA 2P37A 2YZ4A 3GZAA 4XEZA 2JICA 4QM9A 5KR7A 1J59A 4CYDA 2BBVA 1QMJA 2C4XA 2BRTA 1GWLA 5F3IA 5FZ7A 5IJRA 1AJOA 3WCSA 4CCEA 4E27A 4L99A 4FBFA 5KXDA 5D21A 1D4M2 4XTMA 4B4PA 4IEPA 2NMNA 1ULEA 2VZSA 3ASIA 3BGAA 1UF2C 5SV8A 1ENQA 5GALA 2HEWF 1WKYA 3BTZA 1LKNA 4CDWA 1MS4A 2UY8A 5HV4A 3OB8A 5FPLA 2ATFA 1HRI3 4XFAA 4YZ3A 1CONA 4KL1A 1BQPA 1H4GA 5ABJB 1DU3D 1AR81 4N53C 4AI3A 5A32A 3VV1A 4FXGB 5D8AC 1S2BA 3NJYA 4AQTA 1VALA 5J98B 1H8TC 4HLTA 4R8HA 4PI2A 4XTPA 3Q9OA 1OA2A 1H1IA 3K48A 3M3CA 4P9GA 3V56A 3B02A 3NV2A 1JODA 4MV2A 3VDAA 1HXS2 3WG3A 2ZZJA 3EYPA 3CDZB 2HWB1 1QHDA 1RUD2 2WA3A 3WNOA 3LFMA 3ES4A 3OBRA 3WZ1A 2C26A 1O4ZA 2JEMA 1DQ2A 5BV6A 3JCIA 2YGMA 5FOJB 3NJXA 2UWAA 1QU0A 2BJSA 1ZBE2 1HV1A 4QD2A 4BLIA 3OPZA 4CXWA 1SDDB 1WCDJ 1O8PA 1UU6A 3MIDA 4JCKA 2RR11 3AP9A 3VZJA 3K4AA 2XVGA 3ZVXA 1H1AA 1X9PA 1UZWA 2WRAA 3KT7A 4BXSV 3WOGA 4WVZA 5JOYA 2ZX2A 4Z8BA 3Q8AA 4AVCA 4KBZA 5C3PA 1Y7BA 3WVJA 4NWVA 2IC1A 3KHBA 1W6MB 1XBFA 3PIGA 1UU4A 3RMYA 4NPRA 1GBGA 3QH7A 3JU9A 5BNPC 3AX4A 3M4FA 3RZZA 5T5OA 3U4XA 4JKLA 4YVWC 2VQUA 4AOCA 3OGVA 1AHSA 1RUOA 1D2SA 4Y20A 3TBDA 5K9YA 5KBFA 2VOTA 2XG3A 4HK9A 1GKBA 1VBB3 2AEZA 3LWCA 3M8LA 5A6ZA 4EJRA 2JIGA 3PMEA 2HWE3 1FNYA 3QCWA 1UPIA 3TN92 2NZ9A 2AREA 3HAGA 1SBDA 4PHZA 1TMF1 5DAPA 5JLVA 3GHNA 2D3PA 3F2ZA 1W2OA 4JGYC 3LE0A 4PJYA 1MPXA 2RDNA 1DGRA 2F6BA 3P5BA 3U4SA 1MZ5A 4BMEA 5A6XA 5L7OB 4Y33A 1S0GA 2ET1A 1CWPA 3CZUA 2BWAA 4FPHA 3LEIA 4A7YA 2IXLA 1R092 3WP3A 5LB6A 2RE9A 3THCA 3O1PA 2ZHKA 1RUC1 4XOGA 1VPHA 1TNFA 2EIEA 5FZBA 1AUYA 1A78A 1W99A 2FBEA 5A1LA 5JSOA 1YCIA 4XCAA 4MXWB 1MQTB 4KBBA 1JYCA 2D6NA 2LTNA 3K3NA 5F8PA 2J22A 4EN0A 4LK6A 2H0BA 3FBMA 4CDUB 1VBD3 1BMV1 4H2AA 1FAYA 2W94A 4GB32 4XYXA 3TNQA 2VOXA 2WL1A 4MGKE 1B35B 5LK5A 5IVYA 3H1WA 2R071 4NE9A 1REFA 3TOJA 4FFGA 1WD3A 2Y6JA 1D4M3 4MSVA 2CAUA 2OIIA 2VZUA 3V0BA 5K4LA 2K9ZA 4M01A 4HKLA 1YI7A 4XXAA 4KWJA 5LASA 1D0GA 1HKDA 4OHZA 3WW4A 4QKDA 3MW4A 1OOPC 4YG3A 5FZ3A 4QX8A 2Y64A 5DUUA 2R16A 2JECA 1HQWA 3V0AA 3VHOA 4OMCA 4HVOA 4Z2WA 2ADEA 2FD8A 1A6CA 1E5SA 5LA0A 1XE0A 2Z79A 4FFIA 4NHXA 4HXCA 1NCRA 4G3YC 4RR3C 5IVCA 5FY5A 1I3HA 1Y4WA 3B01A 4XFIA 1HRI1 1H8VA 3E5XA 3FC0A 3GDBA 4RSUA 1MS1A 1JZ6A 4AFMA 4GZ9A 1JTZX 4JAAA 4XIOA 4ZU7A 3M1HA 1PX3A 4FTEA 2BQPA 2CY6A 1AYM2 4LLFA 4IEYA 2WO2A 1UOGA 1WW6A 3VBUC 1GR3A 4AEDB 4JQTA 3O0VA 3OCPA 3D82A 1VRH2 5CFDB 1BYHA 3KD4A 1WMFA 4LHKA 2NM1A 2WNVA 3ZSKA 4FAGA 1VAKA 2QQLA 4IERA 4QX7A 3HIFA 2GN7A 4XBNA 2Q8OA 4WVWA 1LCLA 3OGJA 3ZFEA 1S2EA 3SC7X 3ZIWA 3OTFA 1N3PA 5CA6A 2W5FA 2BGOA 2EAKA 2F17A 2YU1A 4Q1RA 1U12A 4X6QB 5LK7B 2YC0A 1O59A 3MPPG 1AR93 4EWDA 2WZR3 4XAAA 2QQIA 1XB9A 1ASJ2 1ENRA 4QXBA 2GH8A 1MVQA 3RYKA 3WX5A 2ZGKA 3O1SA 3DYOA 3MV01 1D4VB 1QY4A 1CPMA 5FYMA 3I4IA 1R1ZA 2DCJA 2BW8A 1GQGA 3U10A 3J7LA 3ACHA 5LCWL 3WW2A 5CYYA 2VMDA 1QQP3 3PMSA 1VLNA 3POBA 5FZ9A 4GALA 3WDVA 4CP0A 1JMUB 5L9BA 3P3PA 4LHLA 4HOOA 4DMIA 5FZIA 1P8JA 1VBB1 1WLWA 4Y5Z0 3A22A 1UN1A 1R093 5JZGA 4W8JA 1OH3A 3M7AA 5DDJ3 1CX1A 2JG9A 5FYSA 4D6RA 2HWE1 2ZKNA 4CVUA 1MEC3 3ZFFA 2XUMA 4ET7A 2QZ3A 2PAKA 5F3EA 4EN6B 1SCRA 1LULA 1IPJA 4XFBA 3WQ1A 2P5BA 2YXSA 3O14A 5A7WB 3UGGA 5HBAA 4RQPB 2VCCA 1LRHA 1RITA 4XPVA 5E6HA 3OPTA 1RXGA 4PDWB 5FV3A 3SMHA 4NIDA 2B9VA 4GD4A 3DXUA 3FFZA 3JQWA 4XW3A 1LOCA 2J1SA 1FT9A 5FMBA 3WUCA 5GLUA 4C90A 2WBKA 1WBLA 4XDQA 1RUI3 2CDOA 2YPJA 1CAXB 2E6VA 4K1ZA 1ND3B 1H6XA 5F5AA 1UAIA 2OUJA 2BOJA 2JDHA 3IZOA 5CIRA 3ZXKA 3LDKA 1JZ4A 5CFCB 2GU9A 2DU1A 4P9WA 5C9AC 1H2LA 1I9RA 2WYFA 1VBD1 4LK7A 2IFWA 4LKDA 2W2IA 4UBHA 3D8CA 4IE5A 4XQ4A 4R52A 2PHUA 2PHTA 4ZPIA 4XF4A 3ZXGA 5JWPA 3MUZ1 4HFSA 1RUF2 3RRDA 1L7LA 4UOJA 5A33B 1QJX2 2PHLA 1D4M1 1NKGA 3OD4A 1BBT2 2CAVA 2VTFA 5EJ3A 5GM0A 3TNPB 4CSWA 1OPMA 2R30A 2QQOA 4QGLA 1FXZA 3SXWA 2RDSA 1W6NA 2VAUA 4FQZA 2WN2A 4XFFA 4XVHA 2JG8A 1OD5A 3HN3A 3J7HA 4AE2A 1GFF2 2I07B 2WLPA 2JKXA 2VNGA 4YYOA 2E63A 2WR9A 4Y1VA 4IXLA 1DYOA 1DF0A 3B69A 3WW3A 1GOHA 3ETPA 3FMGA 4X8NA 5KHIA 2DVFA 5BNOA 2OA2A 4JDOA 5I8SA 5K0UB 2BZDA 2MEV3 3MF9A 4IGPA 1ND2B 3B3QE 5DG2A 2WSUA 1VRH3 1K5MA 1IG0A 1RUJ2 2QQWA 2YU2A 1Z0HA 2ZMNA 1ZRDA 2VZ3A 3U75A 3N4MA 4BPZA 4RGGA 5A3NA 1OVPA 1ULGA 2GMMA 2VUJA 2O8QA 4GKYA 3ABZA 3TAYA 4I02A 2D6PA 5GLTA 2ZEZA 4M3CF 4OUEA 1O3QA 2DF7A 4OCTA 1ZNPA 3NMBA 1ZA4A 5LRRA 3UJOA 3O1UA 1SLCA 2ZGSA 2VW0A 1F5FA 4MLOA 1XU2A 3WXPA 2UU8A 3K77A 1UY4A 5IWFA 1SDWA 3H0OA 2IVJA 4PIXA 1YJLA 2VXRA 4XF9A 1W3VA 4W65A 1N47A 3JD73 2CDPA 1REDA 1JU3A 5FO7B 2ADDA 5DUVA 3TEXA 3UV9A 3AB0A 1O4YA 2VM9A 1LHOA 4V2WA 2RS32 1AR91 2YHJA 2WZR1 3J8F2 1SLBA 1PNFA 2DUOA 3AYAA 4HANA 2XVLA 5DAVA 5LBEA 2AACA 4COVA 3PHMA 4FPGA 4CU7A 3E6DA 5A3LA 1J3RA 3B93A 3U1XA 5FTTC 1TG7A 1AF9A 1CESA 2HLEA 3MIHA 2BV4A 3ZXEA 1O6UA 4UT5A 2VZ1A 3T09A 4CDQB 5IUQA 4LA2A 4M4PA 4W6WA 4DUXA 1QQP1 1JI6A 5GLZA 1NQDA 2EVXA 1UW8A 4ZU5A 5G04L 2RDQA 5GLWA 3J4UH 2CWMA 2VCBA 2HEYF 3R05A 4RYDA 2L9LA 1POV0 1FPN2 5A1AA 1R091 4FPKA 1UX6A 1IQAA 4GH4B 4LXLA 1BZWA 3KV4A 1VE0A 4ISRA 5DDJ1 5FP4A 1OI6A 3Q8FA 3ZYGA 5FLIA 1MEC1 4COZA 1GANA 1OPOA 2VNVA 3J9SA 1W6OA 3NJZA 1STMA 2CGOA 3RJ2X 1PMJX 3TB0A 4AHWA 1PK6B 3ETQA 1EV13 1NA1C 3VBSB 4EZ4A 2IXJA 1CPNA 1OHFA 5FYYA 5B4NA 1GZWA 4WM7B 4IV1C 2WN3A 3VDDC 3AP4A 4CU8A 2A6YA 1X50A 1YQ2A 4B3NA 4NIHA 2GH2A 3JB8A 1YQCA 4R9DA 2E7QA 2LUWA 4YGBA 4IESA 1POQA 2VC9A 2VTXA 1U0AA 4LPLA 4PQQA 3VZNA 1DP0A 5JVVA 3KQRA 4YVSA 1UMZA 1RUI1 4XE9A 2D97A 1QJX3 3ROUA 1BBT3 5JOZA 3AJYA 5LATA 5CISA 2K2SA 4YM2A 1WLTA 5BXXA 3I2FA 3KCCA 2LS6A 3T0BA 3JBG2 4CTEA 4FP3A 1X9TA 1LHNA 1FMD2 2XWJB 5DZGA 2XJRA 1SPPA 1PGW2 3T08A 4KH9A 1UU5A 3LD8A 4GA9A 5DAWA 2GALA 2HEVF 3ZOIA 5I91A 5FBJA 3AXDA 3MLKA 2VMFA 4URAA 4DIQA 4SLIA 3KB5A 3SCHA 2Z69A 3KF3A 4LO8A 5LA9A 4CEWA 4XF1A 4CDXB 1IS6A 1I5ZA 1RUJ3 4U36A 1EPZA 2QVSB 2ORXA 2OKXA 4LBKA 1KD7A 1R083 3O1TA 1LEMA 1DBNA 3NAPA 1WWYA 1NZIA 2ZGLA 2V72A 2X10A 4XIKA 5FPVA 2ID4A 2ZXQA 4BLJA 5C8CB 5IFTA 2JDMA 4EE2A 4DUVA 5C8WA 2NP0A 1Q8SA 4UFHA 3PL0A 1HV0A 4CXXA 3WDTA 4META 2GNBA 3BTXA 2J1VA 1ND3C 2MEV1 4PBPA 4YZ4A 5F7UA 1O8SA 2YMZA 3VDBA 1LTEA 1VRH1 4OULA 2J1TA 1S0IA 1CAVB 1J3QA 3HT2A 1WW5A 5A1FA 3I59B 2A7AA 1QH7A 3KS7A 3AZZA 4P14A 5HI0A 5M0TA 1VB2A 4AL9A 1OLMA 2JX9A 3WSOA 1US3A 5CZKA 4O9EA 4N53B 2D6KA 1SLTA 4Q4Y2 2JD9A 2YBKA 3E6CC 3P1IA 4D6SA 1NAEA 1H8TB 2PQSA 3HOBA 4FFFA 3THPA 1HRV2 4LMFA 4CU9A 1PGL2 2BFUL 4YFWA 3FHQA 3FZ3A 3MW3A 3N7KA 4A42A 3LA3A 1OUSA 3U78A 3VKLA 1JZ3A 1CIYA 4P9LA 2GC2A 1YNAA 1N3QA 1QXJA 3WR0A 2VOKA 3KGLA 2PAMA 2BVVA 4MADA 3JD71 3EMRA 5KC6A 1F35A 1O3RA 4IEVA 4O65A 4PLMA 5EPAA 4BXFA 5ACA3 1BEV3 4QPIA 4K9SA 5IVVA 5LY1A 5FMDA 2ARXA 2VCAA 2YFUA 1LGBA 2R49A 4V2VA 4XUNA 4AQ6A 2FHRA 1ZZ8A 2VL4A 1DQ0A 1AYN3 1EAH3 3IPVA 1PZ9A 5EJZB 1W06A 1H0BA 2IXHA 4JC1A 4LBLA 5FP8A 2ES3A 2UYAA 1ODMA 5BNPB 3N9OA 4NWWA 5FXZA 1ZZ9A 3HJRA 1CZVA 4KQ7A 4L97A 3KM5A 3OYWA 2JB8A 2X53S 1BKZA 3LQCA 3VKNA 4W6YA 4YVWB 4MX3A 2RM23 3JZVA 4IW3A 4QGMA 5JR2A 2J1EA 3RWNA 5CADA 1VBA3 4LKEA 1XSRA 3ACGA 3ECQA 3CEWA 3POIA 3ZXLA 5C7GA 3ALQA 4UF0B 1RL3A 1W2TA 2C9AA 4O61A 1F4AA 2XLGA 1O3TA 1EV11 4R4XA 3WW1A 3H1YA 5A3OA 3WCRA 2XUEA 3AVRA 4JGYB 3N7JA 3DUIA 4WBBA 5GJ6A 1HJFA 1Z7S3 4Z82A 1REEA 2Y34A 4YW6A 1IPKA 2VMCA 3GALA 3UT0A 4D7TA 1W6QA 4DRRA 5I93A 2DU0A 3U11A 5T52A 3MICA 5L19A 3I8TA 4XACA 1COV2 1QJX1 1BBT1 4HPKB 1NQJA 4WVMB 5C4WA 4F3JA 3RWKX 3AFKA 4YW4A 1RYYA 1MS3A 1YFYA 4AQ2A 1RHI3 1NCRC 4I0WB 4CCOA 4INDA 1VBE2 5DG1A 1GLHA 4LKSA 4YW3A 1QNYA 2DWRA 3ZKUA 3VDCA 1QOOA 3KMHA 5JMCA 1DDLA 5A3PA 2RS12 3T0AA 2XJUA 1CAWA 3DN7A 4QPYA 3VBFA 1TZOA 3ZLIA 1DG6A 2ZGUA 2GP3A 2R1DA 4TLFA 1XXNA 3CHXA 4UXAA 4N8MA 5FY9A 2WJSA 1QNWA 1WA4A 5KWRA 1UZVA 2BNOA 1BVP1 4IEQA 4LEJA 3PUHA 5F5CA 3ZN6B 1RUJ1 3NKGA 1DGLA 2SLIA 4NJ4A 1QJU2 1OOPB 2HWF2 2XJTA 2EIBA 4MZUA 4TXWA 2TEPA 1C8M2 2VJXA 4PQ9A 1R081 5JXIA 1G6NA 2JB4A 4A2UA 2EXHA 3THTA 3ZYPA 3EBRA 4Z92B 3T2TA 4Q4Y3 4RGAA 1GQHA 2X8KA 1IKPA 1JXNA 3C7OA 3DL3A 3ZFEC 3BIEA 1BXHA 2VQTA 5EIYB 1RUC3 3VD4A 1OSGA 4XILA 3B7MA 3IIIA 1LHWA 4QKNA 3VBOA 5C5UA 1W05A 3HD8B 2BTVC 4RR3B 4CPBD 4EV0A 4OZOA 1CAUB 3AC0A 1GP4A 4QHZA 2Y6KA 4HKOA 4KU7A 4PLOA 4K6BA 3OJBA 3W21A 2CU5A 3AJZA 4CP9A 1QJY2 3CL1A 3DKQA 1OKQA 1YC61 4B1LA 3BB6A 3N35A 5CB7A 3NO8A 3H8RA 3VBUB 3I49A 2O0OA 4Q8LA 1UNBA 2XQXA 2IFRA 1F31A 1OMIA 3BTAA 1IGOA 1PO13 5AVAA 1UMIA 4YLZA 1Q43A 3ZSLA 5JZGC 1W6PA 4QPWA 1W04A 2KA3A 1K45A 4ISQA 2D6OX 2HWD2 2JG9C 4Q4V2 1W28A 4S2GA 3N9MA 1W9YA 3T2QA 4AVAA 5ACA1 1BEV1 2KR2A 2PELA 3WDWA 4QX3A 2VMIA 4B4QA 2QDNA 5EHDA 3OD0A 1KDMA 4ZS2A 1OF4A 5JIUA 1W0PA 5FZ1A 1EAH1 1AYN1 2R7EB 4M4RA 4YRDA 5FMOS 2DTYA 4WZCA 3OUHA 4DNYA 1OD3A 4FSJA 4AI0A 1URXA 3LA2A 1RUH2 4IE7A 1IKQA 3T1LA 1G86A 3VBRA 2V5DA 3CBNA 1XNDA 4FQ4A 3GCXA 1XE8A 1AJKA 4PIZA 1FV3A 4AI2A 1PMHX 2W87A 1Z78A 4JZRA 4IEUA 4DXTA 5CG8A 1GSLA 3MFCA 1VBC2 1G9FA 1XYNA 2RM21 5E8AA 1QDCA 2OVUA 4ZZ8A 4L2NA 1FOD2 5HCAA 4AGVA 3TRSB 1X33A 1VBA1 4B7EA 3K2OA 5FK7A 1J58A 1AXKA 3NNGA 3RMXA 1NLRA 2ZAHA 2HWC2 3CF6E 4LBQB 1W9FA 4AHZA 4QX0A 4DXZA 2XJPA 2E9QA 4FOYA 5JI9A 3S5QA 4OI0A 5T54A 3PJYA 3K46A 4AVBA 2MNGA 3ZN4A 3ACLA 1AR62 2VULA 1Z7S1 3D4KA 2QQKA 3G7DA 3A23A 5LW9A 5LBCA 5J3UA 5G05L 1DLCA 3A0NA 5A7WA 2JG8C 3R4SA 1V00A 5FR3A 1XNTA 2QDRA 1JHJA 2WAAA 3L2YA 1QKQA 2GC3A 4UFKA 1AL23 5IK7A 3OEBA 1F9KA 2RJKA 3KQ4B 3RNSA 4GWJA 1TVGA 4AVSA 1NY72 5BNOC 3LZZA 4CEYA 4AGRA 5ANQA 4CXYA 1NCQA 2B5HA 5DZFA 2J1RA 4BK4A 2HWF3 3O0WA 5KHGA 1RHI1 3USUA 3URFA 2XBO3 4OHXA 3ZYIB 2ZGOA 4JHTA 5C9AB 1KXGA 5I8TA 3DGTA 1UY2A 2DTWA 2XXZA 4RHV2 3RYRA 5CFCA 5T5LA 4M0HA 1IG3A 4YM1A 2ZA9A 1WW7A 2X5IA 1OLRA 2DVBA 3B00A 3WEZA 5J37A 1YFXA 4Y1XA 1ZREA 4XXPA 1I5PA 3POYA 2YC4A 1LU2A 1XSQA 3DYMA 5TSWA 5H9SA 2WNUA 5FQ0B 4QB1A 2F4LA 3RGBA 4ARXA 1W8FA 4LBOA 2FZ2A 2GMEA 4I09A 2JDYA 4QQ2A 5CKMA 5L9RA 1GNHA 1HX6A 3UKTA 4AWDA 4LOSA 1UOJA 1VMHA 3D5OA 3D0JA 4X8PA 3HQXA 3ZR6A 3BTYA 2VQ0A 2V4AA 2BP6A 1QDOA 4Q4Y1 4A3ZA 5FO9B 2WT1A 1APNA 1AR73 4LO5B 3DV8A 4UWDA 3VD5A 3WD5A 1R1A2 2PHFA 3HNMA 1SLIA 3R4DB 4NROA 1DQ1A 1PGL1 3BKZA 1VR3A 2WNOA 5DN2A 4L11A 1HQLA 4UFJA 1PO22 3IMMA 3SKVA 5K0UA 4ATFA 1BVVA 5FYZA 3PUAA 5FPUA 4C0BA 1ONAA 3IAPA 5FY4A 2Y8KA 3BUCA 3ZDVA 4Z07A 2WDBA 4ONUA 5FZAA 2ZS6B 2QQPA 4YFZA 5IHRA 1UYPA 3AMQA 5AFEA 4MOAA 5F3GA 2DUQA 3CIHA 2R042 3AFGA 4XHXA 2ZGPA 4OUMA 4LE3A 1PO11 5FWEA 4FCAA 4YW2A 1IS3A 3W5MA 3MIFA 2Q8EA 1RUH3 5GZFA 4IE4A 3EJKA 3RZHA 2RS52 4Y24A 3CJIA 3NWKA 2Z2SB 2J42A 1AXYA 2Q0AA 5FZOB 3IN9A 4Q4X2 3LDBA 3NV3A 5A3WA 5FZDA 3T4HB 1LHUA 4BK5A 2GNTA 1GZTA 3DKWA 1WCKA 2J1UA 2ZGRA 3KVBA 1C1FA 1HQNA 3ZSJA 3IWZA 1A34A 3W59A 3ORJA 2R0HA 1V9U2 3CZJA 4HKWA 1JYXA 5KXCA 3RI8A 4NHLA 1KITA 1HXS3 2ZBJA 2IXIA 3AP7A 1L7RA 5F1RA 3KCXA 1LECA 2YV8A 1ULCA 2HWC3 1O3SA 1LNSA 1RUD3 4UW3A 3CNAA 3QACA 4RD7A 3RJRA 5KXEA 2DUPA 4I3PA 2Y33A 1ZBE3 2B8MA 3AKQA 2WWJA 1YFUA 1W39A 3VBHA 1CVNA 5FZ4A 4URTA 4CDQA 4I0BA 1XNCA 4C1XA 4CPBA 3E1F1 1C5IA 5L36A 3WQ7A 1O7FA 5EV7A 4QGNA 1TQ5A 2AYHA 3DPRA 4G4FA 4Q0SA 4XDPA 3OEAA 1QGLA 4WM8A 4XQWA 3AKRA 1HN0A 2QCSB 3H3UA 1S2KA 4MGSA 4AEJA 4E8CA 4UFMA 1LOGA 3D3AA 3MZHA 5FJHA 4GH4A 5FUIA 1HN1A 1NA1B 1ZZCA 3BIWE 4BU2A 1YHFA 2YB7A 3OY8A 4IV1B 5T5PA 3VDDB 4CEWC 2WZPP 4IV3B 5HV0A 4CZSA 2J7MA 1G9DA 2ENRA 2UWCA 3VBSA 4XMIA 2EAAA 4BIOA 3LPGA 1HDKA 1OURA 4QWNA 3RPQA 3U14A 4KWKA 3I2KA 3NNFA 1RJ8A 2B9UA 3FLPA 3GBGA 2E51A 3H50A 4KG8A 4CUBA 3NAPC 1AL21 3DCQA 3HNYM 5A7OA 2HYXA 3IBMA 4MHUA 2Q8CA 1GP5A 3CU7A 2F4PA 3PURA 3TN93 2VZQA 3X29B 5HXMA 2ZPXA 3LIGA 5FLJA 1JZ8A 1OA3A 3AL5A 2OS2A 4E8DA 2HWF1 2HYKA 4AW7A 4PLNA 2Y6HA 1UY3A 1W8WA 1CJDA 1MS8A 2OX0A 2XBO1 4QDRA 5C3RA 1EP0A 2XOMA 4QXHA 4CDWB 2WKKA 5FDBA 4MO3M 5F3CA 1X7NA 1NXMA 4UYBA 1OLQA 3GM8A 1LEDA 5FZMA 3W5NA 2UYBA 4GJYA 1JYNA 5F6KA 1R1A3 2Y38A 2DCZA 2WFF2 4QPGA 2TBVA 2A70A 2BNMA 2FCTA 4FP2A 4N43A 4K21A 1W8NA 3K51A 5H9QA 3VKMA 1TEIA 3UETA 5C70A 1FI2A 1GU3A 4QU1A 3GGLA 1LENA 3BCWA 4A44A 1RVF2 1DZQA 3A4UA 1ULDA 3WP4A 4BOWA 4GB33 3VD3A 4LO7A 2WC2A 1CGPA 1AR71 1WLDA 2CNAA 4HSJA 3RFRA 1TNRA 1WGPA 3FJSA 2H6BA 1CN1A 1VB4A 4PCRA 4QPIC 1EUUA 3WF4A 3LSEA 1GZ9A 3P6BA 2GSYA 2KD7A 4Z2AA 1W2UA 2E53A 3FUOA 1XJAA 4LO6B 3MUY1 1GMMA 4E2QA 1XC6A 3O7OA 2WLQA 2Y6FA 4K7JA 4YZ5A 3VL9A 4MUVA 3TEYA 1LAJA 5IK8A 1NZCA 5E16A 4B8EA 3EB7A 5LEJA 4K1YA 3QBQA 1RXFA 4YGEA 4EN8B 5GZEA 1ODNA 3B9IA 1V9U3 1W3XA 2AZ5A 3NW4A 1QXPA 4LBQD 4PI0A 5D8AA 4LULA 2Z4FA 3LPFA 3SLIA 5EQUA 3WNPA 4NAOA 4Y20B 1XRUA 1UYZA 2LM3A 1OT5A 1HB2A 2Y60A 1A3KA 1IOAA 1RUH1 1KFXL 3POGA 3USSA 3ZDSA 1K12A 1E5HA 4XJAA 4BWOA 3ZFGC 5I0TA 4DEVA 1AYM3 5AC92 3OBZA 1QJEA 3PTYA 4TLGA 4XUQA 4DEQA 3GZUC 1WMDA 2RDRA 1KRIA 5LWBA 4CE8A 1HXS1 4A3XA 4M3CE 1DGWX 3K3OA 1RUE2 2HWC1 4BB3A 1RUD1 4LO4B 3ENRA 4XZUG 2BYVE 4E4ZA 2G19A 1SFNA 5EWSA 4JTOA 3RI9A 2WQ4A 1Y9GA 4CCDA 5GZCA 1ZBE1 5FIXA 2XONA 3KV9A 2BGPA 3LEMA 3RS6A 1K3IA 3BPSA 3FLTA 4GMP3 3WHTA 1H1MA 1ASJ3 3FFQA 2B45X 2O8OA 3OGGA 3NVCA 4CCNA 2X09A 2WS92 1ZVFA 3MEPA 1OQDA 5FLHA 4BQ2A 1AX1A 2ZGNA 4L8QA 4OMDA 5B4XA 3VBFC 1GWMA 4IE6A 1VJ2A 3HEIA 5FP9A 5C8CC 3C7GA 3V0BB 3T0DA 5CG9A 4UF0A 4FTSA 1XYPA 1SBEA 1ST8A 5IVBA 2RMU2 2E7TA 4FPFA 5H9PA 1JYTA 1EUTA 4FT8A 2A6XA 4CP2A 3ACFA 3GHMA 2JXAA 3MIEA 2CGNA 4FPJA 4K40A 4B7KA 3ZN5A 4CRQA 4DINB 2FCVA 4PIYA 4YW5A 2VMEA 1YIFA 1QWRA 5KHHA 4E2GA 1YYNA 5FZCA 1PX4A 4MYEA 3TN91 2G4IA 4M3CB 5C33A 5JXGA 1W90A 5CEHA 5EJ1B 4I30A 4BQ4A 5KC5A 5LA2A 5FZ0A 3ZM8A 1RUG2 2WT0A 1NCRB 4QMAA 3WG2A 1RVF3 2XR4A 2VBBA 4FTBA 4L0PA 4QXKA 3LKJA 4ATEA 3PLQA 2FZ1A 3PUSA 4Q4W2 1V6IA 4AFDA 4AEKA 1KGYA 3I7DA 1R1A1 3DXTA 3IB3A 2WZ8A
chains in the Genus database with same CATH topology
2WR9A 2JDMA 1OURA 2JDPA 1UQXA 2BV4A 1OUXA 2CHHA 2BOIA 2WRAA 4UT5A 1OUSA 2JDKA 3DCQA 1OXCA 5A70A 1GZTA 5A3OA 3ZDVA 4CE8A 1UZVA 1W8FA 2JDUA 5A6XA 2JDYA 2XR4A 1OVPA 5A6YA 2VUCA 5D2AA 2VUDA 2BP6A 4AOCA 5HCHA 1W8HA 5A6QA 2BOJA 2JDHA 2VNVA 2JDNA 1OVSA 5A6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WR9 A;  2JDM A;  1OUR A;  2JDP A;  1UQX A;  2BV4 A;  1OUX A;  2CHH A;  2BOI A;  2WRA A;  4UT5 A;  1OUS A;  2JDK A;  3DCQ A;  1OXC A;  5A70 A;  1GZT A;  5A3O A;  3ZDV A;  4CE8 A;  1UZV A;  1W8F A;  2JDU A;  5A6X A;  2JDY A;  2XR4 A;  1OVP A;  5A6Y A;  2VUC A;  5D2A A;  2VUD A;  2BP6 A;  4AOC A;  5HCH A;  1W8H A;  5A6Q A;  2BOJ A;  2JDH A;  2VNV A;  2JDN A;  1OVS A;  5A6Z A; 
#chains in the Genus database with same CATH topology
 4CCL A;  3WHU A;  4LT5 A;  1K42 A;  2W95 A;  4S2D A;  4DXR A;  5BUV A;  3TEZ A;  3AMH A;  4LIT A;  3E5U A;  3MYX A;  2UUR A;  4NRP A;  5A3U A;  3AM2 A;  2CV6 A;  4IV3 C;  5K8S A;  4PT6 A;  4R4Z A;  2JJ6 A;  3ZYH A;  2XPJ A;  4RS5 A;  1S0B A;  5A7P A;  4CP1 A;  2VZT A;  1OBN A;  2WNV B;  4GB3 1;  5FXX A;  5IVE A;  1S1A A;  1MAC A;  4QKF A;  3IM0 A;  4P5Y A;  1RUF 3;  4NO4 A;  3JXS A;  4LQR A;  4KU8 A;  3ZFE B;  4CUC A;  3EXU A;  2PMW B;  5L73 A;  5BNN A;  3VD9 A;  2BDR A;  4B1M A;  1JHN A;  2P3I A;  3C7E A;  1AR8 2;  3B94 A;  1XE7 A;  5JMO A;  3FHA A;  3N9L A;  4GUL A;  1ZRF A;  4KGG A;  1OFS A;  4AXO A;  4ES9 A;  4EWA A;  1YLL A;  2C9K A;  2W0X A;  4CDW C;  4XJU A;  4J1X A;  2E33 A;  4MH0 E;  4LIV A;  1CZS A;  5AVP A;  3VBR C;  2PAE A;  3OBT A;  1ZYB A;  4HT1 T;  5AC9 3;  1ZA7 A;  3KF5 A;  4MGT A;  4JQR A;  3M3E A;  4JGZ A;  2HWB 2;  5IVF A;  1CJP A;  1V9U 1;  5FY0 A;  5IAX A;  2E26 A;  4J1W A;  4EYU A;  4Q8K A;  5KHJ A;  1PGS A;  3N9P A;  3UYJ A;  2W1U A;  4BQ5 A;  3OOX A;  1NXD 1;  1Q56 A;  3PVE A;  4YM0 A;  2VOV A;  5JZG B;  4UFL A;  3WUD A;  1Y9M A;  3AZX A;  1OQE A;  2W92 A;  4YPJ A;  2JG9 B;  1SCS A;  1AYM 1;  2WQ8 A;  2D93 A;  4HN1 A;  2GMP A;  1HIX A;  1UKG A;  1XU1 A;  4AI9 A;  2WO7 A;  4TTG A;  3HVD A;  2DFC A;  2MPF A;  4C1W A;  4QAW A;  2LW8 A;  4BQY A;  1DQ4 A;  2D6L X;  4GXL A;  2GDF A;  5LBF A;  2YC2 A;  3IDB B;  2ZTN A;  3I54 A;  4XUT A;  2P1B A;  2Q1Z B;  2VD7 A;  1LOF A;  3E6B A;  4DZG A;  3GXU A;  2C0Z A;  5FXW A;  1ULP A;  1SFY A;  3H1M A;  3RYP A;  1GIC A;  2BWC A;  3APB A;  5FZ8 A;  1BHG A;  4CEY C;  2R06 2;  5CNA A;  5A6Q A;  5ABJ A;  5BPX A;  2RS3 3;  4Y3O A;  2W47 A;  3J8F 3;  1NCQ C;  4GMP 1;  4NAM A;  3OUJ A;  1ASJ 1;  3MGU A;  3BOD A;  5JPN B;  2B46 X;  1TMF 2;  1PVC 2;  1SLA A;  1WME A;  1YQ8 A;  4I01 A;  3BOP A;  3W20 A;  3EQE A;  5C71 A;  3ES1 A;  3UKV A;  4A45 A;  4ARY A;  3UKN A;  1F8V A;  4XZP A;  1RMU 2;  2DVA A;  5LY2 A;  3U07 A;  4BQ3 A;  3HT1 A;  5A7S A;  2X5I C;  2AEN A;  1X8M A;  3MV1 1;  1MVE A;  2JE9 A;  1UZY A;  5FOB B;  4RN5 A;  3N9N A;  2GNM A;  2YFZ A;  4P9J A;  2D5H A;  1W6N B;  1PM7 A;  3ITQ A;  3SIT A;  1FPN 3;  3R4U A;  1JU4 A;  2JG8 B;  2RV9 A;  3KGZ A;  3SKJ E;  3VZL A;  3B5L B;  5FO8 B;  4CA9 A;  4ZU4 A;  4MXV A;  4Y5T A;  5FUN A;  1VRB A;  1AVB A;  2DUR A;  5BNO B;  4Y5S A;  4Q29 A;  3BAL A;  4OI1 A;  1BMV 2;  4F7Z A;  1W6M A;  4AI8 A;  4IEX A;  2P4E A;  1RVF 1;  2R07 2;  1K5M B;  1S0F A;  1UCX A;  3IDA A;  1JYV A;  3POW A;  2AH2 A;  5E89 A;  2ZAB A;  2VUD A;  1H30 A;  1HW5 A;  5C3O A;  4AI1 A;  3CO2 A;  3KVA A;  3AYC A;  4HN0 A;  4BDV B;  4Q5O A;  4COU A;  3AYD A;  2VH9 A;  1LGC A;  1S0J A;  1V6K A;  5FRA A;  5K7P A;  5DUX A;  2PYT A;  2BU9 A;  2ZZQ A;  1F5J A;  2NYY A;  1O5U A;  3JBG 3;  1KS5 A;  2P3Y A;  4LKF A;  2BVB A;  1FMD 3;  1NYW A;  2JDA A;  2A6Z A;  4NHY A;  5FCC A;  1O91 A;  4XMA A;  3Q8B A;  1KJL A;  3PUI A;  4UW6 A;  5FQ0 A;  5KXB A;  3W9A A;  4NHM A;  4YWA A;  4D6Q A;  4I3G A;  2R0F A;  1B09 A;  5T50 A;  4NIA A;  1FV2 A;  1RUF 1;  3CJI C;  3TYJ A;  5L7O A;  2A1X A;  5FYV A;  3FUQ A;  5EZW A;  3IAQ A;  1HRI 2;  5BYN A;  3DEC A;  4LBM A;  1C57 A;  1BCX A;  1N1V A;  5BY5 A;  2Z5W A;  4JTN A;  1F15 A;  2GC1 A;  4ES8 A;  1JH5 A;  3BVC A;  3WNM A;  3OGS A;  4FFH A;  5FKC A;  5J96 B;  1YUD A;  4ZXE A;  2ZKL A;  3WV6 A;  3CMG A;  1EPW A;  4K3U A;  4MXW A;  1MQT A;  2BOI A;  2CSG A;  2YYO A;  1UY0 A;  5AC9 1;  4IEO A;  1UZ0 A;  3BOW A;  2V4V A;  4CDU A;  1XNK A;  5C3S A;  4YG6 A;  3VBH C;  1F2N A;  4AHY A;  1B35 A;  3H9A A;  4NRM A;  2VG9 A;  4GJZ A;  4P9I A;  5IYY A;  2EIG A;  1FAT A;  3WNN A;  1UPS A;  3DPR C;  1U5Y A;  2CL2 A;  1C1L A;  2Q1F A;  4FOW A;  3NST A;  1WCU A;  3HQR A;  4WM8 C;  1UOF A;  2G9F A;  4S2F A;  2WNV C;  4GIQ A;  3ZMO A;  2H6C A;  3JUU A;  5CBL A;  2GN3 A;  4H14 A;  5FY7 A;  1W6O B;  4KNC A;  4QHB A;  4JRL A;  4YGC A;  4H55 A;  4BA6 A;  3ACI A;  2R06 3;  4GWN A;  1Y3T A;  5FXV A;  1ZM1 A;  3VHN A;  1HRV 3;  3LOB A;  1S55 A;  4XFG A;  3I2O A;  2G9Z A;  1PVX A;  1G9B A;  2HH9 A;  2QFE A;  2VVF A;  3POS A;  3NV4 A;  4AK3 A;  1RUN A;  1PVC 3;  5T55 A;  5J09 A;  2EXJ A;  1Q5O A;  2FDJ A;  4QB2 A;  3SEE A;  5ERL A;  4JRA A;  1VMJ A;  1RMU 3;  2VNR A;  2YPD A;  5DUW A;  4LOT A;  5FY1 A;  1H9P A;  2G1M A;  2XLF A;  2XJQ A;  1VBB 2;  3IDC B;  3ZYR A;  1OLM E;  4C0H A;  1WBF A;  2Y26 A;  2PFW A;  3GYD A;  2RS3 1;  3C8X A;  3N9Q A;  4MGY E;  5LRS A;  2PHD A;  3J8F 1;  1V6N A;  2VZO A;  2HWE 2;  2DVG A;  2JDN A;  2IVI B;  3R0R A;  2C24 A;  3HMY A;  1SPP B;  3H3L A;  1UWW A;  3IKW A;  1KEX A;  1OA4 A;  4YW7 A;  1C8N A;  5FP7 A;  4AED A;  5A80 A;  1HB3 A;  2AR6 A;  4ITC A;  3GBW A;  5CFD A;  3M2M A;  5IT6 A;  3S57 A;  2OW4 A;  3OBA A;  4QT6 A;  2QJV A;  1E57 A;  4Y4Y A;  4QX2 A;  4DO0 A;  1KFU L;  1ZZ7 A;  3ZFF C;  4AVT A;  4QPG C;  3W58 A;  1LGN A;  2D98 A;  4NII A;  2JDU A;  4CEW B;  5F9T A;  4N43 C;  1GNY A;  1A8D A;  4OLL A;  4UBG A;  1JZ7 A;  4A7Z A;  1PIV 2;  1CX4 A;  1FYU A;  3ME2 A;  2VR4 A;  2R6Q A;  4Y1Y A;  1LOB A;  1J1T A;  2VZV A;  1FPN 1;  2RJL A;  3HR9 A;  4IV1 A;  3VDD A;  3MW2 A;  1L7Q A;  4CUG A;  5JPM B;  1QF3 A;  3NAP B;  1ALY A;  3OG2 A;  4N90 A;  3LIH A;  4P00 B;  2GP5 A;  4UW4 A;  2TUN A;  5JSR A;  5I0U A;  4YZ2 A;  1VBD 2;  2BEO A;  1KJR A;  4EN7 B;  1JN2 P;  2UY9 A;  3SH3 A;  3POE A;  4XFC A;  2Q8D A;  2JDK A;  3A21 A;  1DGR N;  1YXW A;  3RZM A;  4KWL A;  4BQX A;  2EF6 A;  4NPM A;  1DZR A;  4R9C A;  4QXC A;  4XUO A;  3ZSM A;  4HVR A;  4FI9 A;  1V6J A;  4E2S A;  2E7A A;  4LUK A;  4CCJ A;  4I2O A;  4KMQ A;  4FVV A;  1JBC A;  2A71 A;  4MVT A;  5FYU A;  1COV 3;  4BHP A;  1F4H A;  4LR4 A;  1EY2 A;  1SQ4 A;  1XNA A;  2Y6G A;  2QQV A;  2Y6L A;  3AKT A;  4JKM A;  4QQH A;  3T1M A;  4J6G A;  1ENX A;  4LNV A;  3JBG 1;  1IS4 A;  1W2N A;  1M06 G;  4FPC A;  1LU1 A;  1FMD 1;  4QX5 A;  1JOJ A;  2Q1M A;  3FWE A;  4FOQ A;  1PGW 1;  3MIG A;  3NRU A;  4IDZ A;  3AP5 A;  1VBE 3;  2XH6 A;  4YGD A;  4AYU A;  4IEW A;  5JI7 A;  1YI9 A;  2ZGM A;  4IGO A;  4RQP A;  5A70 A;  4XC9 A;  4NOT A;  3HBK A;  2XGX A;  3INA A;  2RVA A;  2VBD A;  2DBN A;  2RS1 3;  4O7X A;  4PDW A;  4X6R B;  4ZZ5 A;  2VVD A;  2D40 A;  3WG4 A;  4QPI B;  5L9V A;  1N3O A;  1FNZ A;  1KQR A;  1JYI A;  5CKQ A;  2DFB A;  2VNO A;  1QJU 3;  1GOF A;  4LOR A;  1CAX A;  1ZZ6 A;  1XPW A;  1ND3 A;  1N1T A;  4IEZ A;  4CCM A;  2P3J A;  1C8M 3;  1K5M C;  3AKS A;  3J7M A;  5DAQ A;  3IPV B;  5FFO C;  1UD1 A;  4H7M A;  3VZK A;  4B4R A;  5DQ0 A;  4BIS A;  3JQX A;  3GF6 A;  2ZX1 A;  3FL7 A;  1JOB A;  2JWP A;  1QJZ A;  4Y22 B;  1OFN A;  4XQD A;  1CZT A;  5FZH A;  3WP6 A;  5JDB A;  4ASK A;  5A7N A;  1V6M A;  3VB9 A;  1OXC A;  1ACC A;  3OYW B;  1RTV A;  4OVE A;  3M3O A;  4DS0 A;  5HXV A;  2P3K A;  2BNN A;  3BU0 A;  3H3Z A;  5A33 A;  1JUI A;  1U5X A;  3DYP A;  3Q8E A;  4A6S A;  4IQP A;  1UXX X;  4AFA A;  2YG0 A;  4OYU A;  3MFA A;  4IL7 A;  1BK0 A;  1AR9 2;  3F95 A;  2OUH A;  2WZR 2;  4Q0Q A;  2K46 A;  5F32 A;  1AX0 A;  1QJY 3;  3ZFG B;  3N3H A;  3QH6 A;  4JDN A;  2AGS A;  2WFP A;  2JE7 A;  5B2G B;  5DXD A;  2R06 1;  2QE3 A;  1X36 A;  2UWB A;  5FMC A;  4AR2 A;  4DY3 A;  2FCU A;  1HRV 1;  3Q8C A;  2FDK A;  4QDQ A;  1YRZ A;  1DZT A;  2Y0O A;  1SLL A;  2C6S A;  1NE4 A;  4WVV A;  3AP6 A;  3N36 A;  5DPN A;  3ON7 A;  1PVC 1;  1LOE A;  2JE8 A;  1W6Q B;  4LJH A;  1QQP 2;  2WZE A;  5FBZ A;  2P6H A;  1ND2 A;  1PHM A;  5DMY A;  1RMU 1;  2QQN A;  4Y4R A;  3QOP A;  1ZBA 2;  1QIQ A;  4N7U A;  1BJQ A;  1VP6 A;  2HWD 3;  2V73 A;  3J26 N;  4OZX A;  4Q4V 3;  1GV9 A;  2NPI A;  4DUW A;  1PMI A;  3GJA A;  5C4W B;  4YW1 A;  4LLO A;  1OF3 A;  4BM8 A;  3PVO A;  3LEG A;  3SHR A;  5DDJ 2;  1Q8Q A;  1PIV 3;  3HN1 A;  1MEC 2;  3CKH A;  4XJW A;  1CR7 A;  5FPA A;  3VL8 A;  1IQD C;  4E4S A;  4RGK A;  4C8D A;  4Q0U A;  3FBY A;  4B29 A;  2A5Z A;  1H4H A;  1OVS A;  4JX0 A;  3VHP A;  4Y1Z A;  4AHX A;  3VLB B;  4EN9 B;  2HBT A;  3LDR A;  3M70 A;  4JKK A;  1ZZB A;  4GWM A;  4FOV A;  3KLS A;  4QQO A;  5LA1 A;  1CAW B;  3VBF B;  2ETE A;  3O1V A;  1V0A A;  2VY0 A;  1RB8 G;  3N7M A;  1T2X A;  1O5L A;  2OPK A;  2W3J A;  1VBC 3;  5F37 A;  1RUI 2;  1C28 A;  1FOD 3;  1PNG A;  3RSJ A;  3WG1 A;  3ZSE A;  4BMB A;  2W1S A;  1NT0 A;  5J1X A;  5FK8 A;  1KS4 A;  2WYS A;  2EA7 A;  4RS5 C;  5FYT A;  2VO5 A;  2MHF A;  2QTW B;  3KSC A;  4BIF A;  2FDI A;  3NKT A;  4YG0 A;  1TME 2;  2OT7 A;  3GJB A;  3FE5 A;  4YVS C;  3V64 A;  2ZOE B;  1SG3 A;  2YBS A;  3ILF A;  5HCB A;  5FJK A;  1RJ7 A;  3AKP A;  1ZRI A;  4IE0 A;  3WDU A;  5BNN C;  1AR6 3;  4QB6 A;  3IT8 A;  3RZJ A;  4M3C A;  3VBO B;  2ARA A;  4XJ8 A;  1LOD A;  2XLA A;  3UL2 A;  1G9A A;  3WNL A;  5FP3 A;  5DAX A;  1WLC A;  1W03 A;  1DFQ A;  1K5J A;  3ZYJ B;  5F6L B;  4D8M A;  3UJQ A;  4TZD A;  4CP9 B;  1W0N A;  1COV 1;  1VMF A;  3WY6 A;  3AZV A;  4KI5 M;  2CTV A;  4ZY9 A;  1WD4 A;  5FZ6 A;  3UES A;  2VUC A;  1LHV A;  3AZY A;  1UYY A;  1GOG A;  5FMO L;  4E9K A;  5HCH A;  1R64 A;  4JGZ C;  1C3H A;  5F5I A;  4NIG A;  1DHK B;  1W8H A;  3KT1 A;  3L9J T;  3ILR A;  4ZON A;  5SV5 A;  3BI3 A;  1GWK A;  4HK8 A;  1EYB A;  1PK6 A;  2DV9 A;  2QQM A;  4D94 A;  4YM3 A;  1VBE 1;  3AYE A;  2SBA A;  1YO8 A;  1D0H A;  4OFG A;  2MEV 2;  4RHV 3;  4WM7 A;  1W6P B;  1OH4 A;  1XYO A;  4A41 A;  4CCC A;  1H6Y A;  4XUP A;  4KGQ A;  1KDK A;  2XHK A;  2RS1 1;  1U5Z A;  2W9X A;  4DB5 A;  1UIJ A;  2ET7 A;  2HBU A;  2X29 A;  2PLV 2;  2VGD A;  4XUR A;  1XNB A;  4XAE A;  3O1O A;  1DIW A;  4R9A A;  2ZGQ A;  5JOW A;  1QJU 1;  4HBN A;  4A7K A;  4TYS A;  2QQJ A;  2W68 A;  5JIA A;  1C8M 1;  5D1I A;  3IMN A;  5JUV A;  4BQ1 A;  1QOT A;  2OPW A;  2XL9 A;  4SBV A;  2CYF A;  1QXR A;  2YY1 A;  3NV1 A;  3VBR B;  2VEC A;  1C4R A;  1LOF C;  2RJ2 A;  4JV4 A;  5CAZ A;  3TWI A;  2VBP A;  3MIB A;  5FYI A;  3T2P A;  4BYY A;  3QLQ A;  1S0E A;  1W9S A;  1Y43 B;  5A32 B;  2P6C A;  4XJZ A;  5I0D A;  1N1Y A;  2X05 A;  2D3R A;  2YRO A;  2RHP A;  2YDE A;  4CUA A;  4ZS3 A;  5ABJ C;  4DY5 A;  1UYX A;  2QKD A;  2WQZ C;  1LJ7 A;  3JD7 2;  4NN0 A;  4CCK A;  1PO2 3;  5GZG A;  1W9W A;  2KM2 A;  4F83 A;  1JW6 A;  3WLU A;  5CU1 A;  2QUO A;  2HJI A;  4CDX A;  1ZBA 3;  1QJY 1;  4ERO A;  3POF A;  4PBO A;  5E1R A;  5JOX A;  2VMH A;  5C3Q A;  3OPW A;  4N9H A;  5JR7 B;  1D7P M;  1VAM A;  1ZRR A;  2Q4S A;  3EHK A;  1UKR A;  2C1F A;  4V1P A;  1UXZ A;  4JVA A;  3ZPY A;  1MS0 A;  2WA4 A;  1PZ7 A;  2PHW A;  3RQ0 A;  2B4K A;  4LHN A;  2R04 3;  1NUK A;  5C8C A;  3VZM A;  4AFC A;  2ARB A;  2A6W A;  2WUH A;  1H2M A;  2IXC A;  2GZW A;  3NQH A;  1SZB A;  1S0D A;  3PVB B;  1H9W A;  1G8W A;  2RS5 3;  1V6O A;  1CAV A;  2YBP A;  3AXE A;  3MPB A;  3MO4 A;  5J48 A;  1UZZ A;  2HWD 1;  4Q4V 1;  3I59 A;  5EFU A;  1G9C A;  1NOV A;  2ARC A;  4Q4X 3;  5I0S A;  2O14 A;  2XQR A;  3KT4 A;  4MHR A;  4AFB A;  1FX5 A;  2WWS A;  4RL7 A;  3PVN A;  3PUQ A;  3I3Q A;  4CEY B;  2XKP A;  1MZF A;  2DYC A;  4N53 A;  1PIV 1;  1RIN A;  3SNM A;  1NCQ B;  3WNK A;  3MF6 A;  1OKO A;  4AF9 A;  5LEK A;  3USU B;  2Q5T A;  2WAB A;  1H8T A;  3SCG A;  1EV1 2;  5FZF A;  3WDX A;  2LRO A;  1TME 3;  5F39 A;  3HQU A;  4U2A A;  1OQ1 A;  5BNQ A;  2B39 A;  1JS9 A;  1JUH A;  2IUW A;  2XHN A;  2PA7 A;  2R1B A;  3H7J A;  4MGI E;  4D7Y A;  3O1M A;  1DYP A;  2X5I B;  3ATG A;  1DYK A;  3H42 B;  4NUB A;  1Y9Q A;  2OQ6 A;  3PJQ A;  3D0S A;  3HWJ A;  5JAX A;  1IPS A;  4BJ0 A;  3IDE A;  3WP5 A;  1N1S A;  1Q8O A;  1VBC 1;  4EQV A;  1CIW A;  2WNU B;  1FOD 1;  3VKO A;  2OZ6 A;  5JXH A;  4D7S A;  2GND A;  3LOI A;  3TEW A;  1J83 A;  1W0O A;  2B42 B;  3LB9 A;  2JIJ A;  3UK9 A;  1ULO A;  2YUE A;  3BN6 A;  4HMZ A;  2PHX A;  3I2H A;  2XJS A;  2W52 A;  5FPZ A;  3U37 A;  5D2A A;  1A8M A;  1DQ5 A;  3K4Z A;  4D69 A;  3KHC A;  4FO9 A;  5L7O C;  3LEK A;  3SIS A;  2LAL A;  3I3D A;  2D5F A;  2FDH A;  1XOY A;  3T4V A;  5C4W C;  5JXJ A;  1AR6 1;  4OQ9 A;  2VVE A;  4DRV A;  4AQS A;  4S2H A;  3VZO A;  5BNP A;  3LAG A;  1YJK A;  2BFU S;  3IIA A;  4XAB A;  3S0M A;  4L9B A;  3LSD A;  3NNJ A;  5FAX A;  3AL6 A;  4HZF A;  3WF0 A;  2DVD A;  3ELN A;  5FZE A;  1QEX A;  1WMX A;  3MLL A;  2PHR A;  1U5I A;  4WV8 A;  4YVW A;  5T3N A;  2P34 A;  2ZJC A;  1MQT C;  2ZX0 A;  2A6V A;  1DCS A;  3NNL A;  2VQA A;  2RG4 A;  3GCW A;  2W46 A;  1NY7 1;  2PLV 3;  1R08 2;  3SEP A;  4CDU C;  3D6E A;  1GZC A;  3OUI A;  4YNI A;  2W1Q A;  2DDU A;  2FMD A;  1POV 3;  3PU8 A;  2OZJ A;  5ISL A;  4Q1P A;  1W9T A;  1B35 C;  4QKB A;  1WW4 A;  4QQP A;  4XET A;  5FZG A;  5JSP A;  1C5H A;  1W8O A;  2CGP A;  2AC1 A;  4K8R B;  4YZ1 A;  2BUK A;  3RZL A;  4RHV 1;  3FX3 A;  1QJF A;  2CWS A;  2VXJ A;  4P9X A;  4JGY A;  1GUI A;  4XCB A;  4AVV A;  2E32 A;  3LF7 A;  4I0A A;  2K0G A;  2OXB A;  4TWT A;  3CJI B;  3NNM A;  4JDM A;  4H7L A;  3V0A B;  3AK0 A;  3FN9 A;  2ZEY A;  4HET A;  4OI4 A;  3J7N A;  3ZYB A;  4CU6 A;  2WFF 3;  3WQB A;  1MZE A;  1I6X A;  2FMY A;  1WA6 X;  1WCS A;  1AL0 G;  2ZX4 A;  5A7Q A;  2AUY A;  4RA0 A;  3GBF A;  4HPK A;  3O12 A;  2E31 A;  4GQ7 A;  4WVM A;  4Y26 A;  3VBO C;  2WO1 A;  5C6C A;  2P17 A;  2PN5 A;  1G7Y A;  3JB4 C;  1M4W A;  1IZ3 A;  4GWI A;  4TSV A;  4W50 A;  4DOU A;  1NX9 A;  3MHZ A;  4BE3 A;  2Q30 A;  3HBZ A;  5IVJ A;  1LES A;  4UFI A;  1UO9 A;  2N7G A;  4BCU A;  2NLR A;  3ZMN A;  1YEW A;  3I3E A;  4LBN A;  5FYB A;  2OQ7 A;  5FPB A;  2A73 B;  5F5Q A;  3KWV A;  3RVH A;  3GNE A;  4GMP 0;  3VBH B;  2FQP A;  3ZR5 A;  1WZX A;  2JKB A;  4LA3 A;  3C2U A;  5LZ6 A;  4XBL A;  1SMV A;  5EYX A;  1PO2 1;  4XHB A;  1CD3 G;  3RDI A;  1W8T A;  5ACA 2;  1YIP A;  2GC0 A;  3DPR B;  1BEV 2;  4ASL A;  3I2D A;  4COW A;  2ZHM A;  5FUP A;  1ZBA 1;  4NMI A;  4WM8 B;  3ZN6 A;  2DCY A;  5GZD A;  4AED C;  1OOP A;  2VOW A;  3LCP A;  2WAO A;  4FAH A;  5CFD C;  1NG0 A;  3BU7 A;  1HB4 A;  3HNB M;  1EAH 2;  1AYN 2;  2VUA A;  2W08 A;  4HG6 B;  4ZHN A;  3I3B A;  3ZXF A;  2ERF A;  2R04 1;  3OY8 B;  4R9B A;  4A6O A;  4BZ4 A;  4PF5 A;  4FPO B;  2XJV A;  1WCQ A;  2I45 A;  3VGI A;  4F8A A;  1H2N A;  4XBQ A;  1SFP A;  3ZX7 A;  2BER A;  2PTM A;  3KV6 A;  2D44 A;  4KG0 A;  3MLJ A;  1YFW A;  3MBW A;  2R32 A;  2RS5 1;  1UOB A;  3L2H A;  2RM2 2;  4HON A;  4RR3 A;  3B9C A;  2DBI A;  4Y1U A;  4Q4X 1;  1UY1 A;  1CAU A;  1CQ9 A;  2ZHN A;  3MDP A;  1VBA 2;  2W39 A;  5IK5 A;  3PTR B;  1ZRC A;  4AGG A;  1O4T A;  4QHO A;  4DXS A;  1MS5 A;  3PDQ A;  2IXK A;  3K4D A;  4LHS A;  3WF2 A;  4OI2 A;  3THD A;  4OHV A;  1SBF A;  4RFR B;  3I2J A;  4Q0P A;  3S7E A;  1RUE 3;  3VBU A;  2ZML A;  4GAZ A;  3PU3 A;  1TME 1;  4KWU A;  1GYK A;  1PZ8 A;  1WUV A;  4M0N A;  2RR1 2;  1Z7S 2;  2PXJ A;  2WII B;  3FHI B;  1AX2 A;  2D43 A;  2JDP A;  4FPE A;  1UIK A;  2XDV A;  3ZFF B;  5J7M A;  4QPG B;  3I97 A;  3SQO A;  5HPO A;  4N43 B;  2XML A;  3RZK A;  4XJ9 A;  4N7I A;  2V09 A;  3BYW A;  5EXO A;  2QBX A;  4NR1 A;  2PQQ A;  2ZMK A;  2IWG B;  4AAX A;  4RFT 0;  2JDZ A;  1V70 A;  3AVS A;  2QQU A;  2QZ2 A;  2VPV A;  4IET A;  4NVP A;  4Q27 A;  4MGQ A;  5IAT A;  1I1E A;  3KCY A;  1D2Q A;  2WS9 3;  4D3W A;  3WF1 A;  2WSV A;  4O9G A;  3ILN A;  1RHI 2;  4RQP C;  5CKN A;  2XL7 A;  3RG0 A;  4PDW C;  3UGF A;  3N7L A;  2WIN B;  2LRP A;  1MR5 A;  5APA A;  3WT3 A;  2D7F A;  4AG4 A;  5KHK A;  2RMU 3;  1Q8V A;  1L3J A;  2XVK A;  4NPL A;  5H9R A;  1HJG A;  5FWJ A;  4XF3 A;  5A3T A;  1PM4 A;  4OHW A;  3UNP A;  1DGW A;  4UI9 L;  2ORZ A;  3CJX A;  2FDG A;  3DF0 A;  2EAL A;  5CFC C;  3POJ A;  4ASM B;  3P3N A;  2VE1 A;  4XFH A;  4QDS A;  2PLV 1;  5GLV A;  5J36 A;  4Q26 A;  2P2K A;  4HSL A;  1POV 1;  4LBQ A;  1Q8P A;  1ULF A;  1US2 A;  1SHW B;  5D8A B;  2C5D A;  1RUG 3;  2WNU C;  3ZXD A;  5FY8 A;  3S30 A;  4HVQ A;  1AXZ A;  2DCK A;  1RUC 2;  2AEY A;  2VW1 A;  3T3Y A;  4QU2 A;  2W91 A;  4PF1 A;  5EYY A;  3H8O A;  4Q4W 3;  3SH4 A;  4K8F A;  4EWE A;  2BBA A;  2Z42 A;  2YGL A;  3O5S A;  2ZEW A;  4NRQ A;  3BPZ A;  2WFF 1;  1UMH A;  4LE4 A;  3S5A A;  1ZX5 A;  1NE6 A;  1J3P A;  2QNK A;  4K20 A;  3UGH A;  3WNX A;  3RZG A;  3AMP A;  1X82 A;  4MGZ E;  3M3I A;  1LR5 A;  1Q3E A;  4IGQ A;  1XQN A;  1T6B X;  5K0U C;  2WO3 A;  4YAR A;  4EZH A;  4BH9 A;  1RC6 A;  1YQ6 A;  3O0X A;  2EIC A;  1ND2 C;  4IUG A;  4QQL A;  4DPN A;  3A7Q A;  1PO1 2;  3LA7 A;  2ZEX A;  3LFI A;  5C9A A;  2DCT A;  1SAC A;  2ZX3 A;  3VN4 A;  5IK4 A;  4XF0 A;  3VHR A;  3ZPO A;  4W6X A;  3C3V A;  4Y22 A;  1OUX A;  5FZL A;  1MZ6 A;  1AR8 3;  1W8Z A;  1J1L A;  3VD7 A;  2XWB B;  3KZ4 C;  4A4A A;  1GNZ A;  4UAP A;  5IFP A;  3NJV A;  4Q2F A;  3LGR A;  1ENS A;  3E97 A;  2VMG A;  4P02 B;  3T30 A;  4NHK A;  1X8E A;  4HL0 A;  5T5J A;  2ZHL A;  1YQ5 A;  2J1A A;  2JEN A;  4FPL A;  3NL1 A;  5GKA C;  3ZXJ A;  3ZFG A;  1BLZ A;  2HWB 3;  2VTX J;  2XKO A;  3ZKY A;  3WIN E;  3CQO A;  1BK1 A;  3U0Z A;  4ZKT B;  2ILM A;  2BGC A;  3SH5 A;  1JOP A;  3KV5 A;  2Y0I A;  2H0V A;  3I2I A;  1GQP A;  2W1W A;  3OGR A;  3S7I A;  5C5T A;  2RR1 3;  2XB6 C;  3FLR A;  3GZE A;  4LBJ A;  5F2S A;  4COY A;  1TE1 B;  5IAV A;  5EP9 A;  1UX7 A;  5JCT A;  2O1Q A;  4OUS A;  5FRE A;  4P9Y A;  2WWU A;  2V5Y A;  4L92 A;  1S0C A;  3HPN A;  4CDQ C;  4OQ8 A;  4BQW A;  2A3Y A;  1HLC A;  1RUE 1;  2ZAA A;  4G9S B;  4J25 A;  3EO6 A;  1H2K A;  4N9I A;  3ZIX A;  5A6Y A;  1W2A X;  5FYH A;  2ZAC A;  3CLP A;  3AMN A;  5A3M A;  2VZR A;  3PIJ A;  4MG2 A;  1J84 A;  5I0R A;  2WNE A;  4JHZ A;  1RIR A;  2HKX A;  1RGS A;  4TN7 A;  1MS9 A;  1T6G C;  2EXK A;  2VU9 A;  2VW2 A;  2WT2 A;  3M3Q A;  3OF1 A;  1AZD A;  2I2S A;  3C7F A;  4P08 A;  4GH4 C;  1HB1 A;  5DAB A;  1UL9 A;  3MI8 A;  5FZO A;  1AL2 2;  4XDO A;  1GZW B;  5FYC A;  1LB2 A;  3I3M A;  4Q0V A;  2TNF A;  2A3X A;  4RS5 B;  1TMF 3;  1PK6 C;  2B7Y A;  3C7H A;  3VBS C;  1NLS A;  2ZGT A;  3ZXA C;  2WS9 1;  4WM7 C;  4C91 A;  1JYW A;  2I74 A;  1V6L A;  3H8U A;  1SEF A;  2VCM A;  1E5I A;  2XBO 2;  1IS5 A;  4YVS B;  5E88 A;  2A75 A;  3WDY A;  4Z1V A;  3PNA A;  1DLL A;  4AAP A;  3A0K A;  4YSF A;  1VAV A;  4ZXK A;  4UW5 A;  4DQA A;  5BNN B;  4QX1 A;  2GAU A;  2D3S A;  4FXK B;  4P5H A;  3S6P A;  2NQY A;  1E5R A;  1S4C A;  2RMU 1;  3V65 A;  5F2W A;  4LTA A;  4H3W A;  5LBB A;  3O1R A;  2BPA 2;  1YWK A;  1DQ6 A;  4LIU A;  3K75 B;  4QM8 A;  3VKF C;  3ZYF A;  4OHY A;  3QD6 A;  2EXI A;  5ANN A;  3R6S A;  4AZZ A;  4D0Q A;  4ORF A;  4DFS A;  5CVR A;  5DZE A;  4E4H A;  2JD4 A;  5HCF A;  1VIW B;  4GKX A;  2OYZ A;  2G9G A;  4JGZ B;  1OC1 A;  4AEM A;  3OSD A;  3AZW A;  2NMO A;  1IHM A;  1QOS A;  3VUO A;  4E4D X;  4WZF A;  5FPX A;  3T2O A;  3ZO0 B;  1AR7 2;  1RUG 1;  4FPY A;  5IW0 A;  3WF3 A;  2R07 3;  1GP6 A;  1LOA A;  3AMM A;  1NA1 A;  2D6M A;  4W4Z A;  2IZW A;  1NLQ A;  3DEM A;  3I2G A;  2FDF A;  3G6J B;  3H7Y A;  5FZK A;  4Q4W 1;  3SCF A;  3ST7 A;  4IV3 A;  5FKB A;  5I8Y A;  1W8U A;  4CDX C;  3E5Q A;  2NN8 A;  2ZCW A;  1JZ5 A;  3GZT B;  1JZ2 A;  1UQX A;  3H8X A;  2VZP A;  2A3W A;  2CHH A;  4M00 A;  3WQ0 A;  5AFB A;  1QH6 A;  2KXL A;  4LUM A;  2EID A;  2P37 A;  2YZ4 A;  3GZA A;  4XEZ A;  2JIC A;  4QM9 A;  5KR7 A;  1J59 A;  4CYD A;  2BBV A;  1QMJ A;  2C4X A;  2BRT A;  1GWL A;  5F3I A;  5FZ7 A;  5IJR A;  1AJO A;  3WCS A;  4CCE A;  4E27 A;  4L99 A;  4FBF A;  5KXD A;  5D21 A;  1D4M 2;  4XTM A;  4B4P A;  4IEP A;  2NMN A;  1ULE A;  2VZS A;  3ASI A;  3BGA A;  1UF2 C;  5SV8 A;  1ENQ A;  5GAL A;  2HEW F;  1WKY A;  3BTZ A;  1LKN A;  4CDW A;  1MS4 A;  2UY8 A;  5HV4 A;  3OB8 A;  5FPL A;  2ATF A;  1HRI 3;  4XFA A;  4YZ3 A;  1CON A;  4KL1 A;  1BQP A;  1H4G A;  5ABJ B;  1DU3 D;  1AR8 1;  4N53 C;  4AI3 A;  5A32 A;  3VV1 A;  4FXG B;  5D8A C;  1S2B A;  3NJY A;  4AQT A;  1VAL A;  5J98 B;  1H8T C;  4HLT A;  4R8H A;  4PI2 A;  4XTP A;  3Q9O A;  1OA2 A;  1H1I A;  3K48 A;  3M3C A;  4P9G A;  3V56 A;  3B02 A;  3NV2 A;  1JOD A;  4MV2 A;  3VDA A;  1HXS 2;  3WG3 A;  2ZZJ A;  3EYP A;  3CDZ B;  2HWB 1;  1QHD A;  1RUD 2;  2WA3 A;  3WNO A;  3LFM A;  3ES4 A;  3OBR A;  3WZ1 A;  2C26 A;  1O4Z A;  2JEM A;  1DQ2 A;  5BV6 A;  3JCI A;  2YGM A;  5FOJ B;  3NJX A;  2UWA A;  1QU0 A;  2BJS A;  1ZBE 2;  1HV1 A;  4QD2 A;  4BLI A;  3OPZ A;  4CXW A;  1SDD B;  1WCD J;  1O8P A;  1UU6 A;  3MID A;  4JCK A;  2RR1 1;  3AP9 A;  3VZJ A;  3K4A A;  2XVG A;  3ZVX A;  1H1A A;  1X9P A;  1UZW A;  2WRA A;  3KT7 A;  4BXS V;  3WOG A;  4WVZ A;  5JOY A;  2ZX2 A;  4Z8B A;  3Q8A A;  4AVC A;  4KBZ A;  5C3P A;  1Y7B A;  3WVJ A;  4NWV A;  2IC1 A;  3KHB A;  1W6M B;  1XBF A;  3PIG A;  1UU4 A;  3RMY A;  4NPR A;  1GBG A;  3QH7 A;  3JU9 A;  5BNP C;  3AX4 A;  3M4F A;  3RZZ A;  5T5O A;  3U4X A;  4JKL A;  4YVW C;  2VQU A;  4AOC A;  3OGV A;  1AHS A;  1RUO A;  1D2S A;  4Y20 A;  3TBD A;  5K9Y A;  5KBF A;  2VOT A;  2XG3 A;  4HK9 A;  1GKB A;  1VBB 3;  2AEZ A;  3LWC A;  3M8L A;  5A6Z A;  4EJR A;  2JIG A;  3PME A;  2HWE 3;  1FNY A;  3QCW A;  1UPI A;  3TN9 2;  2NZ9 A;  2ARE A;  3HAG A;  1SBD A;  4PHZ A;  1TMF 1;  5DAP A;  5JLV A;  3GHN A;  2D3P A;  3F2Z A;  1W2O A;  4JGY C;  3LE0 A;  4PJY A;  1MPX A;  2RDN A;  1DGR A;  2F6B A;  3P5B A;  3U4S A;  1MZ5 A;  4BME A;  5A6X A;  5L7O B;  4Y33 A;  1S0G A;  2ET1 A;  1CWP A;  3CZU A;  2BWA A;  4FPH A;  3LEI A;  4A7Y A;  2IXL A;  1R09 2;  3WP3 A;  5LB6 A;  2RE9 A;  3THC A;  3O1P A;  2ZHK A;  1RUC 1;  4XOG A;  1VPH A;  1TNF A;  2EIE A;  5FZB A;  1AUY A;  1A78 A;  1W99 A;  2FBE A;  5A1L A;  5JSO A;  1YCI A;  4XCA A;  4MXW B;  1MQT B;  4KBB A;  1JYC A;  2D6N A;  2LTN A;  3K3N A;  5F8P A;  2J22 A;  4EN0 A;  4LK6 A;  2H0B A;  3FBM A;  4CDU B;  1VBD 3;  1BMV 1;  4H2A A;  1FAY A;  2W94 A;  4GB3 2;  4XYX A;  3TNQ A;  2VOX A;  2WL1 A;  4MGK E;  1B35 B;  5LK5 A;  5IVY A;  3H1W A;  2R07 1;  4NE9 A;  1REF A;  3TOJ A;  4FFG A;  1WD3 A;  2Y6J A;  1D4M 3;  4MSV A;  2CAU A;  2OII A;  2VZU A;  3V0B A;  5K4L A;  2K9Z A;  4M01 A;  4HKL A;  1YI7 A;  4XXA A;  4KWJ A;  5LAS A;  1D0G A;  1HKD A;  4OHZ A;  3WW4 A;  4QKD A;  3MW4 A;  1OOP C;  4YG3 A;  5FZ3 A;  4QX8 A;  2Y64 A;  5DUU A;  2R16 A;  2JEC A;  1HQW A;  3V0A A;  3VHO A;  4OMC A;  4HVO A;  4Z2W A;  2ADE A;  2FD8 A;  1A6C A;  1E5S A;  5LA0 A;  1XE0 A;  2Z79 A;  4FFI A;  4NHX A;  4HXC A;  1NCR A;  4G3Y C;  4RR3 C;  5IVC A;  5FY5 A;  1I3H A;  1Y4W A;  3B01 A;  4XFI A;  1HRI 1;  1H8V A;  3E5X A;  3FC0 A;  3GDB A;  4RSU A;  1MS1 A;  1JZ6 A;  4AFM A;  4GZ9 A;  1JTZ X;  4JAA A;  4XIO A;  4ZU7 A;  3M1H A;  1PX3 A;  4FTE A;  2BQP A;  2CY6 A;  1AYM 2;  4LLF A;  4IEY A;  2WO2 A;  1UOG A;  1WW6 A;  3VBU C;  1GR3 A;  4AED B;  4JQT A;  3O0V A;  3OCP A;  3D82 A;  1VRH 2;  5CFD B;  1BYH A;  3KD4 A;  1WMF A;  4LHK A;  2NM1 A;  2WNV A;  3ZSK A;  4FAG A;  1VAK A;  2QQL A;  4IER A;  4QX7 A;  3HIF A;  2GN7 A;  4XBN A;  2Q8O A;  4WVW A;  1LCL A;  3OGJ A;  3ZFE A;  1S2E A;  3SC7 X;  3ZIW A;  3OTF A;  1N3P A;  5CA6 A;  2W5F A;  2BGO A;  2EAK A;  2F17 A;  2YU1 A;  4Q1R A;  1U12 A;  4X6Q B;  5LK7 B;  2YC0 A;  1O59 A;  3MPP G;  1AR9 3;  4EWD A;  2WZR 3;  4XAA A;  2QQI A;  1XB9 A;  1ASJ 2;  1ENR A;  4QXB A;  2GH8 A;  1MVQ A;  3RYK A;  3WX5 A;  2ZGK A;  3O1S A;  3DYO A;  3MV0 1;  1D4V B;  1QY4 A;  1CPM A;  5FYM A;  3I4I A;  1R1Z A;  2DCJ A;  2BW8 A;  1GQG A;  3U10 A;  3J7L A;  3ACH A;  5LCW L;  3WW2 A;  5CYY A;  2VMD A;  1QQP 3;  3PMS A;  1VLN A;  3POB A;  5FZ9 A;  4GAL A;  3WDV A;  4CP0 A;  1JMU B;  5L9B A;  3P3P A;  4LHL A;  4HOO A;  4DMI A;  5FZI A;  1P8J A;  1VBB 1;  1WLW A;  4Y5Z 0;  3A22 A;  1UN1 A;  1R09 3;  5JZG A;  4W8J A;  1OH3 A;  3M7A A;  5DDJ 3;  1CX1 A;  2JG9 A;  5FYS A;  4D6R A;  2HWE 1;  2ZKN A;  4CVU A;  1MEC 3;  3ZFF A;  2XUM A;  4ET7 A;  2QZ3 A;  2PAK A;  5F3E A;  4EN6 B;  1SCR A;  1LUL A;  1IPJ A;  4XFB A;  3WQ1 A;  2P5B A;  2YXS A;  3O14 A;  5A7W B;  3UGG A;  5HBA A;  4RQP B;  2VCC A;  1LRH A;  1RIT A;  4XPV A;  5E6H A;  3OPT A;  1RXG A;  4PDW B;  5FV3 A;  3SMH A;  4NID A;  2B9V A;  4GD4 A;  3DXU A;  3FFZ A;  3JQW A;  4XW3 A;  1LOC A;  2J1S A;  1FT9 A;  5FMB A;  3WUC A;  5GLU A;  4C90 A;  2WBK A;  1WBL A;  4XDQ A;  1RUI 3;  2CDO A;  2YPJ A;  1CAX B;  2E6V A;  4K1Z A;  1ND3 B;  1H6X A;  5F5A A;  1UAI A;  2OUJ A;  2BOJ A;  2JDH A;  3IZO A;  5CIR A;  3ZXK A;  3LDK A;  1JZ4 A;  5CFC B;  2GU9 A;  2DU1 A;  4P9W A;  5C9A C;  1H2L A;  1I9R A;  2WYF A;  1VBD 1;  4LK7 A;  2IFW A;  4LKD A;  2W2I A;  4UBH A;  3D8C A;  4IE5 A;  4XQ4 A;  4R52 A;  2PHU A;  2PHT A;  4ZPI A;  4XF4 A;  3ZXG A;  5JWP A;  3MUZ 1;  4HFS A;  1RUF 2;  3RRD A;  1L7L A;  4UOJ A;  5A33 B;  1QJX 2;  2PHL A;  1D4M 1;  1NKG A;  3OD4 A;  1BBT 2;  2CAV A;  2VTF A;  5EJ3 A;  5GM0 A;  3TNP B;  4CSW A;  1OPM A;  2R30 A;  2QQO A;  4QGL A;  1FXZ A;  3SXW A;  2RDS A;  1W6N A;  2VAU A;  4FQZ A;  2WN2 A;  4XFF A;  4XVH A;  2JG8 A;  1OD5 A;  3HN3 A;  3J7H A;  4AE2 A;  1GFF 2;  2I07 B;  2WLP A;  2JKX A;  2VNG A;  4YYO A;  2E63 A;  2WR9 A;  4Y1V A;  4IXL A;  1DYO A;  1DF0 A;  3B69 A;  3WW3 A;  1GOH A;  3ETP A;  3FMG A;  4X8N A;  5KHI A;  2DVF A;  5BNO A;  2OA2 A;  4JDO A;  5I8S A;  5K0U B;  2BZD A;  2MEV 3;  3MF9 A;  4IGP A;  1ND2 B;  3B3Q E;  5DG2 A;  2WSU A;  1VRH 3;  1K5M A;  1IG0 A;  1RUJ 2;  2QQW A;  2YU2 A;  1Z0H A;  2ZMN A;  1ZRD A;  2VZ3 A;  3U75 A;  3N4M A;  4BPZ A;  4RGG A;  5A3N A;  1OVP A;  1ULG A;  2GMM A;  2VUJ A;  2O8Q A;  4GKY A;  3ABZ A;  3TAY A;  4I02 A;  2D6P A;  5GLT A;  2ZEZ A;  4M3C F;  4OUE A;  1O3Q A;  2DF7 A;  4OCT A;  1ZNP A;  3NMB A;  1ZA4 A;  5LRR A;  3UJO A;  3O1U A;  1SLC A;  2ZGS A;  2VW0 A;  1F5F A;  4MLO A;  1XU2 A;  3WXP A;  2UU8 A;  3K77 A;  1UY4 A;  5IWF A;  1SDW A;  3H0O A;  2IVJ A;  4PIX A;  1YJL A;  2VXR A;  4XF9 A;  1W3V A;  4W65 A;  1N47 A;  3JD7 3;  2CDP A;  1RED A;  1JU3 A;  5FO7 B;  2ADD A;  5DUV A;  3TEX A;  3UV9 A;  3AB0 A;  1O4Y A;  2VM9 A;  1LHO A;  4V2W A;  2RS3 2;  1AR9 1;  2YHJ A;  2WZR 1;  3J8F 2;  1SLB A;  1PNF A;  2DUO A;  3AYA A;  4HAN A;  2XVL A;  5DAV A;  5LBE A;  2AAC A;  4COV A;  3PHM A;  4FPG A;  4CU7 A;  3E6D A;  5A3L A;  1J3R A;  3B93 A;  3U1X A;  5FTT C;  1TG7 A;  1AF9 A;  1CES A;  2HLE A;  3MIH A;  2BV4 A;  3ZXE A;  1O6U A;  4UT5 A;  2VZ1 A;  3T09 A;  4CDQ B;  5IUQ A;  4LA2 A;  4M4P A;  4W6W A;  4DUX A;  1QQP 1;  1JI6 A;  5GLZ A;  1NQD A;  2EVX A;  1UW8 A;  4ZU5 A;  5G04 L;  2RDQ A;  5GLW A;  3J4U H;  2CWM A;  2VCB A;  2HEY F;  3R05 A;  4RYD A;  2L9L A;  1POV 0;  1FPN 2;  5A1A A;  1R09 1;  4FPK A;  1UX6 A;  1IQA A;  4GH4 B;  4LXL A;  1BZW A;  3KV4 A;  1VE0 A;  4ISR A;  5DDJ 1;  5FP4 A;  1OI6 A;  3Q8F A;  3ZYG A;  5FLI A;  1MEC 1;  4COZ A;  1GAN A;  1OPO A;  2VNV A;  3J9S A;  1W6O A;  3NJZ A;  1STM A;  2CGO A;  3RJ2 X;  1PMJ X;  3TB0 A;  4AHW A;  1PK6 B;  3ETQ A;  1EV1 3;  1NA1 C;  3VBS B;  4EZ4 A;  2IXJ A;  1CPN A;  1OHF A;  5FYY A;  5B4N A;  1GZW A;  4WM7 B;  4IV1 C;  2WN3 A;  3VDD C;  3AP4 A;  4CU8 A;  2A6Y A;  1X50 A;  1YQ2 A;  4B3N A;  4NIH A;  2GH2 A;  3JB8 A;  1YQC A;  4R9D A;  2E7Q A;  2LUW A;  4YGB A;  4IES A;  1POQ A;  2VC9 A;  2VTX A;  1U0A A;  4LPL A;  4PQQ A;  3VZN A;  1DP0 A;  5JVV A;  3KQR A;  4YVS A;  1UMZ A;  1RUI 1;  4XE9 A;  2D97 A;  1QJX 3;  3ROU A;  1BBT 3;  5JOZ A;  3AJY A;  5LAT A;  5CIS A;  2K2S A;  4YM2 A;  1WLT A;  5BXX A;  3I2F A;  3KCC A;  2LS6 A;  3T0B A;  3JBG 2;  4CTE A;  4FP3 A;  1X9T A;  1LHN A;  1FMD 2;  2XWJ B;  5DZG A;  2XJR A;  1SPP A;  1PGW 2;  3T08 A;  4KH9 A;  1UU5 A;  3LD8 A;  4GA9 A;  5DAW A;  2GAL A;  2HEV F;  3ZOI A;  5I91 A;  5FBJ A;  3AXD A;  3MLK A;  2VMF A;  4URA A;  4DIQ A;  4SLI A;  3KB5 A;  3SCH A;  2Z69 A;  3KF3 A;  4LO8 A;  5LA9 A;  4CEW A;  4XF1 A;  4CDX B;  1IS6 A;  1I5Z A;  1RUJ 3;  4U36 A;  1EPZ A;  2QVS B;  2ORX A;  2OKX A;  4LBK A;  1KD7 A;  1R08 3;  3O1T A;  1LEM A;  1DBN A;  3NAP A;  1WWY A;  1NZI A;  2ZGL A;  2V72 A;  2X10 A;  4XIK A;  5FPV A;  2ID4 A;  2ZXQ A;  4BLJ A;  5C8C B;  5IFT A;  2JDM A;  4EE2 A;  4DUV A;  5C8W A;  2NP0 A;  1Q8S A;  4UFH A;  3PL0 A;  1HV0 A;  4CXX A;  3WDT A;  4MET A;  2GNB A;  3BTX A;  2J1V A;  1ND3 C;  2MEV 1;  4PBP A;  4YZ4 A;  5F7U A;  1O8S A;  2YMZ A;  3VDB A;  1LTE A;  1VRH 1;  4OUL A;  2J1T A;  1S0I A;  1CAV B;  1J3Q A;  3HT2 A;  1WW5 A;  5A1F A;  3I59 B;  2A7A A;  1QH7 A;  3KS7 A;  3AZZ A;  4P14 A;  5HI0 A;  5M0T A;  1VB2 A;  4AL9 A;  1OLM A;  2JX9 A;  3WSO A;  1US3 A;  5CZK A;  4O9E A;  4N53 B;  2D6K A;  1SLT A;  4Q4Y 2;  2JD9 A;  2YBK A;  3E6C C;  3P1I A;  4D6S A;  1NAE A;  1H8T B;  2PQS A;  3HOB A;  4FFF A;  3THP A;  1HRV 2;  4LMF A;  4CU9 A;  1PGL 2;  2BFU L;  4YFW A;  3FHQ A;  3FZ3 A;  3MW3 A;  3N7K A;  4A42 A;  3LA3 A;  1OUS A;  3U78 A;  3VKL A;  1JZ3 A;  1CIY A;  4P9L A;  2GC2 A;  1YNA A;  1N3Q A;  1QXJ A;  3WR0 A;  2VOK A;  3KGL A;  2PAM A;  2BVV A;  4MAD A;  3JD7 1;  3EMR A;  5KC6 A;  1F35 A;  1O3R A;  4IEV A;  4O65 A;  4PLM A;  5EPA A;  4BXF A;  5ACA 3;  1BEV 3;  4QPI A;  4K9S A;  5IVV A;  5LY1 A;  5FMD A;  2ARX A;  2VCA A;  2YFU A;  1LGB A;  2R49 A;  4V2V A;  4XUN A;  4AQ6 A;  2FHR A;  1ZZ8 A;  2VL4 A;  1DQ0 A;  1AYN 3;  1EAH 3;  3IPV A;  1PZ9 A;  5EJZ B;  1W06 A;  1H0B A;  2IXH A;  4JC1 A;  4LBL A;  5FP8 A;  2ES3 A;  2UYA A;  1ODM A;  5BNP B;  3N9O A;  4NWW A;  5FXZ A;  1ZZ9 A;  3HJR A;  1CZV A;  4KQ7 A;  4L97 A;  3KM5 A;  3OYW A;  2JB8 A;  2X53 S;  1BKZ A;  3LQC A;  3VKN A;  4W6Y A;  4YVW B;  4MX3 A;  2RM2 3;  3JZV A;  4IW3 A;  4QGM A;  5JR2 A;  2J1E A;  3RWN A;  5CAD A;  1VBA 3;  4LKE A;  1XSR A;  3ACG A;  3ECQ A;  3CEW A;  3POI A;  3ZXL A;  5C7G A;  3ALQ A;  4UF0 B;  1RL3 A;  1W2T A;  2C9A A;  4O61 A;  1F4A A;  2XLG A;  1O3T A;  1EV1 1;  4R4X A;  3WW1 A;  3H1Y A;  5A3O A;  3WCR A;  2XUE A;  3AVR A;  4JGY B;  3N7J A;  3DUI A;  4WBB A;  5GJ6 A;  1HJF A;  1Z7S 3;  4Z82 A;  1REE A;  2Y34 A;  4YW6 A;  1IPK A;  2VMC A;  3GAL A;  3UT0 A;  4D7T A;  1W6Q A;  4DRR A;  5I93 A;  2DU0 A;  3U11 A;  5T52 A;  3MIC A;  5L19 A;  3I8T A;  4XAC A;  1COV 2;  1QJX 1;  1BBT 1;  4HPK B;  1NQJ A;  4WVM B;  5C4W A;  4F3J A;  3RWK X;  3AFK A;  4YW4 A;  1RYY A;  1MS3 A;  1YFY A;  4AQ2 A;  1RHI 3;  1NCR C;  4I0W B;  4CCO A;  4IND A;  1VBE 2;  5DG1 A;  1GLH A;  4LKS A;  4YW3 A;  1QNY A;  2DWR A;  3ZKU A;  3VDC A;  1QOO A;  3KMH A;  5JMC A;  1DDL A;  5A3P A;  2RS1 2;  3T0A A;  2XJU A;  1CAW A;  3DN7 A;  4QPY A;  3VBF A;  1TZO A;  3ZLI A;  1DG6 A;  2ZGU A;  2GP3 A;  2R1D A;  4TLF A;  1XXN A;  3CHX A;  4UXA A;  4N8M A;  5FY9 A;  2WJS A;  1QNW A;  1WA4 A;  5KWR A;  1UZV A;  2BNO A;  1BVP 1;  4IEQ A;  4LEJ A;  3PUH A;  5F5C A;  3ZN6 B;  1RUJ 1;  3NKG A;  1DGL A;  2SLI A;  4NJ4 A;  1QJU 2;  1OOP B;  2HWF 2;  2XJT A;  2EIB A;  4MZU A;  4TXW A;  2TEP A;  1C8M 2;  2VJX A;  4PQ9 A;  1R08 1;  5JXI A;  1G6N A;  2JB4 A;  4A2U A;  2EXH A;  3THT A;  3ZYP A;  3EBR A;  4Z92 B;  3T2T A;  4Q4Y 3;  4RGA A;  1GQH A;  2X8K A;  1IKP A;  1JXN A;  3C7O A;  3DL3 A;  3ZFE C;  3BIE A;  1BXH A;  2VQT A;  5EIY B;  1RUC 3;  3VD4 A;  1OSG A;  4XIL A;  3B7M A;  3III A;  1LHW A;  4QKN A;  3VBO A;  5C5U A;  1W05 A;  3HD8 B;  2BTV C;  4RR3 B;  4CPB D;  4EV0 A;  4OZO A;  1CAU B;  3AC0 A;  1GP4 A;  4QHZ A;  2Y6K A;  4HKO A;  4KU7 A;  4PLO A;  4K6B A;  3OJB A;  3W21 A;  2CU5 A;  3AJZ A;  4CP9 A;  1QJY 2;  3CL1 A;  3DKQ A;  1OKQ A;  1YC6 1;  4B1L A;  3BB6 A;  3N35 A;  5CB7 A;  3NO8 A;  3H8R A;  3VBU B;  3I49 A;  2O0O A;  4Q8L A;  1UNB A;  2XQX A;  2IFR A;  1F31 A;  1OMI A;  3BTA A;  1IGO A;  1PO1 3;  5AVA A;  1UMI A;  4YLZ A;  1Q43 A;  3ZSL A;  5JZG C;  1W6P A;  4QPW A;  1W04 A;  2KA3 A;  1K45 A;  4ISQ A;  2D6O X;  2HWD 2;  2JG9 C;  4Q4V 2;  1W28 A;  4S2G A;  3N9M A;  1W9Y A;  3T2Q A;  4AVA A;  5ACA 1;  1BEV 1;  2KR2 A;  2PEL A;  3WDW A;  4QX3 A;  2VMI A;  4B4Q A;  2QDN A;  5EHD A;  3OD0 A;  1KDM A;  4ZS2 A;  1OF4 A;  5JIU A;  1W0P A;  5FZ1 A;  1EAH 1;  1AYN 1;  2R7E B;  4M4R A;  4YRD A;  5FMO S;  2DTY A;  4WZC A;  3OUH A;  4DNY A;  1OD3 A;  4FSJ A;  4AI0 A;  1URX A;  3LA2 A;  1RUH 2;  4IE7 A;  1IKQ A;  3T1L A;  1G86 A;  3VBR A;  2V5D A;  3CBN A;  1XND A;  4FQ4 A;  3GCX A;  1XE8 A;  1AJK A;  4PIZ A;  1FV3 A;  4AI2 A;  1PMH X;  2W87 A;  1Z78 A;  4JZR A;  4IEU A;  4DXT A;  5CG8 A;  1GSL A;  3MFC A;  1VBC 2;  1G9F A;  1XYN A;  2RM2 1;  5E8A A;  1QDC A;  2OVU A;  4ZZ8 A;  4L2N A;  1FOD 2;  5HCA A;  4AGV A;  3TRS B;  1X33 A;  1VBA 1;  4B7E A;  3K2O A;  5FK7 A;  1J58 A;  1AXK A;  3NNG A;  3RMX A;  1NLR A;  2ZAH A;  2HWC 2;  3CF6 E;  4LBQ B;  1W9F A;  4AHZ A;  4QX0 A;  4DXZ A;  2XJP A;  2E9Q A;  4FOY A;  5JI9 A;  3S5Q A;  4OI0 A;  5T54 A;  3PJY A;  3K46 A;  4AVB A;  2MNG A;  3ZN4 A;  3ACL A;  1AR6 2;  2VUL A;  1Z7S 1;  3D4K A;  2QQK A;  3G7D A;  3A23 A;  5LW9 A;  5LBC A;  5J3U A;  5G05 L;  1DLC A;  3A0N A;  5A7W A;  2JG8 C;  3R4S A;  1V00 A;  5FR3 A;  1XNT A;  2QDR A;  1JHJ A;  2WAA A;  3L2Y A;  1QKQ A;  2GC3 A;  4UFK A;  1AL2 3;  5IK7 A;  3OEB A;  1F9K A;  2RJK A;  3KQ4 B;  3RNS A;  4GWJ A;  1TVG A;  4AVS A;  1NY7 2;  5BNO C;  3LZZ A;  4CEY A;  4AGR A;  5ANQ A;  4CXY A;  1NCQ A;  2B5H A;  5DZF A;  2J1R A;  4BK4 A;  2HWF 3;  3O0W A;  5KHG A;  1RHI 1;  3USU A;  3URF A;  2XBO 3;  4OHX A;  3ZYI B;  2ZGO A;  4JHT A;  5C9A B;  1KXG A;  5I8T A;  3DGT A;  1UY2 A;  2DTW A;  2XXZ A;  4RHV 2;  3RYR A;  5CFC A;  5T5L A;  4M0H A;  1IG3 A;  4YM1 A;  2ZA9 A;  1WW7 A;  2X5I A;  1OLR A;  2DVB A;  3B00 A;  3WEZ A;  5J37 A;  1YFX A;  4Y1X A;  1ZRE A;  4XXP A;  1I5P A;  3POY A;  2YC4 A;  1LU2 A;  1XSQ A;  3DYM A;  5TSW A;  5H9S A;  2WNU A;  5FQ0 B;  4QB1 A;  2F4L A;  3RGB A;  4ARX A;  1W8F A;  4LBO A;  2FZ2 A;  2GME A;  4I09 A;  2JDY A;  4QQ2 A;  5CKM A;  5L9R A;  1GNH A;  1HX6 A;  3UKT A;  4AWD A;  4LOS A;  1UOJ A;  1VMH A;  3D5O A;  3D0J A;  4X8P A;  3HQX A;  3ZR6 A;  3BTY A;  2VQ0 A;  2V4A A;  2BP6 A;  1QDO A;  4Q4Y 1;  4A3Z A;  5FO9 B;  2WT1 A;  1APN A;  1AR7 3;  4LO5 B;  3DV8 A;  4UWD A;  3VD5 A;  3WD5 A;  1R1A 2;  2PHF A;  3HNM A;  1SLI A;  3R4D B;  4NRO A;  1DQ1 A;  1PGL 1;  3BKZ A;  1VR3 A;  2WNO A;  5DN2 A;  4L11 A;  1HQL A;  4UFJ A;  1PO2 2;  3IMM A;  3SKV A;  5K0U A;  4ATF A;  1BVV A;  5FYZ A;  3PUA A;  5FPU A;  4C0B A;  1ONA A;  3IAP A;  5FY4 A;  2Y8K A;  3BUC A;  3ZDV A;  4Z07 A;  2WDB A;  4ONU A;  5FZA A;  2ZS6 B;  2QQP A;  4YFZ A;  5IHR A;  1UYP A;  3AMQ A;  5AFE A;  4MOA A;  5F3G A;  2DUQ A;  3CIH A;  2R04 2;  3AFG A;  4XHX A;  2ZGP A;  4OUM A;  4LE3 A;  1PO1 1;  5FWE A;  4FCA A;  4YW2 A;  1IS3 A;  3W5M A;  3MIF A;  2Q8E A;  1RUH 3;  5GZF A;  4IE4 A;  3EJK A;  3RZH A;  2RS5 2;  4Y24 A;  3CJI A;  3NWK A;  2Z2S B;  2J42 A;  1AXY A;  2Q0A A;  5FZO B;  3IN9 A;  4Q4X 2;  3LDB A;  3NV3 A;  5A3W A;  5FZD A;  3T4H B;  1LHU A;  4BK5 A;  2GNT A;  1GZT A;  3DKW A;  1WCK A;  2J1U A;  2ZGR A;  3KVB A;  1C1F A;  1HQN A;  3ZSJ A;  3IWZ A;  1A34 A;  3W59 A;  3ORJ A;  2R0H A;  1V9U 2;  3CZJ A;  4HKW A;  1JYX A;  5KXC A;  3RI8 A;  4NHL A;  1KIT A;  1HXS 3;  2ZBJ A;  2IXI A;  3AP7 A;  1L7R A;  5F1R A;  3KCX A;  1LEC A;  2YV8 A;  1ULC A;  2HWC 3;  1O3S A;  1LNS A;  1RUD 3;  4UW3 A;  3CNA A;  3QAC A;  4RD7 A;  3RJR A;  5KXE A;  2DUP A;  4I3P A;  2Y33 A;  1ZBE 3;  2B8M A;  3AKQ A;  2WWJ A;  1YFU A;  1W39 A;  3VBH A;  1CVN A;  5FZ4 A;  4URT A;  4CDQ A;  4I0B A;  1XNC A;  4C1X A;  4CPB A;  3E1F 1;  1C5I A;  5L36 A;  3WQ7 A;  1O7F A;  5EV7 A;  4QGN A;  1TQ5 A;  2AYH A;  3DPR A;  4G4F A;  4Q0S A;  4XDP A;  3OEA A;  1QGL A;  4WM8 A;  4XQW A;  3AKR A;  1HN0 A;  2QCS B;  3H3U A;  1S2K A;  4MGS A;  4AEJ A;  4E8C A;  4UFM A;  1LOG A;  3D3A A;  3MZH A;  5FJH A;  4GH4 A;  5FUI A;  1HN1 A;  1NA1 B;  1ZZC A;  3BIW E;  4BU2 A;  1YHF A;  2YB7 A;  3OY8 A;  4IV1 B;  5T5P A;  3VDD B;  4CEW C;  2WZP P;  4IV3 B;  5HV0 A;  4CZS A;  2J7M A;  1G9D A;  2ENR A;  2UWC A;  3VBS A;  4XMI A;  2EAA A;  4BIO A;  3LPG A;  1HDK A;  1OUR A;  4QWN A;  3RPQ A;  3U14 A;  4KWK A;  3I2K A;  3NNF A;  1RJ8 A;  2B9U A;  3FLP A;  3GBG A;  2E51 A;  3H50 A;  4KG8 A;  4CUB A;  3NAP C;  1AL2 1;  3DCQ A;  3HNY M;  5A7O A;  2HYX A;  3IBM A;  4MHU A;  2Q8C A;  1GP5 A;  3CU7 A;  2F4P A;  3PUR A;  3TN9 3;  2VZQ A;  3X29 B;  5HXM A;  2ZPX A;  3LIG A;  5FLJ A;  1JZ8 A;  1OA3 A;  3AL5 A;  2OS2 A;  4E8D A;  2HWF 1;  2HYK A;  4AW7 A;  4PLN A;  2Y6H A;  1UY3 A;  1W8W A;  1CJD A;  1MS8 A;  2OX0 A;  2XBO 1;  4QDR A;  5C3R A;  1EP0 A;  2XOM A;  4QXH A;  4CDW B;  2WKK A;  5FDB A;  4MO3 M;  5F3C A;  1X7N A;  1NXM A;  4UYB A;  1OLQ A;  3GM8 A;  1LED A;  5FZM A;  3W5N A;  2UYB A;  4GJY A;  1JYN A;  5F6K A;  1R1A 3;  2Y38 A;  2DCZ A;  2WFF 2;  4QPG A;  2TBV A;  2A70 A;  2BNM A;  2FCT A;  4FP2 A;  4N43 A;  4K21 A;  1W8N A;  3K51 A;  5H9Q A;  3VKM A;  1TEI A;  3UET A;  5C70 A;  1FI2 A;  1GU3 A;  4QU1 A;  3GGL A;  1LEN A;  3BCW A;  4A44 A;  1RVF 2;  1DZQ A;  3A4U A;  1ULD A;  3WP4 A;  4BOW A;  4GB3 3;  3VD3 A;  4LO7 A;  2WC2 A;  1CGP A;  1AR7 1;  1WLD A;  2CNA A;  4HSJ A;  3RFR A;  1TNR A;  1WGP A;  3FJS A;  2H6B A;  1CN1 A;  1VB4 A;  4PCR A;  4QPI C;  1EUU A;  3WF4 A;  3LSE A;  1GZ9 A;  3P6B A;  2GSY A;  2KD7 A;  4Z2A A;  1W2U A;  2E53 A;  3FUO A;  1XJA A;  4LO6 B;  3MUY 1;  1GMM A;  4E2Q A;  1XC6 A;  3O7O A;  2WLQ A;  2Y6F A;  4K7J A;  4YZ5 A;  3VL9 A;  4MUV A;  3TEY A;  1LAJ A;  5IK8 A;  1NZC A;  5E16 A;  4B8E A;  3EB7 A;  5LEJ A;  4K1Y A;  3QBQ A;  1RXF A;  4YGE A;  4EN8 B;  5GZE A;  1ODN A;  3B9I A;  1V9U 3;  1W3X A;  2AZ5 A;  3NW4 A;  1QXP A;  4LBQ D;  4PI0 A;  5D8A A;  4LUL A;  2Z4F A;  3LPF A;  3SLI A;  5EQU A;  3WNP A;  4NAO A;  4Y20 B;  1XRU A;  1UYZ A;  2LM3 A;  1OT5 A;  1HB2 A;  2Y60 A;  1A3K A;  1IOA A;  1RUH 1;  1KFX L;  3POG A;  3USS A;  3ZDS A;  1K12 A;  1E5H A;  4XJA A;  4BWO A;  3ZFG C;  5I0T A;  4DEV A;  1AYM 3;  5AC9 2;  3OBZ A;  1QJE A;  3PTY A;  4TLG A;  4XUQ A;  4DEQ A;  3GZU C;  1WMD A;  2RDR A;  1KRI A;  5LWB A;  4CE8 A;  1HXS 1;  4A3X A;  4M3C E;  1DGW X;  3K3O A;  1RUE 2;  2HWC 1;  4BB3 A;  1RUD 1;  4LO4 B;  3ENR A;  4XZU G;  2BYV E;  4E4Z A;  2G19 A;  1SFN A;  5EWS A;  4JTO A;  3RI9 A;  2WQ4 A;  1Y9G A;  4CCD A;  5GZC A;  1ZBE 1;  5FIX A;  2XON A;  3KV9 A;  2BGP A;  3LEM A;  3RS6 A;  1K3I A;  3BPS A;  3FLT A;  4GMP 3;  3WHT A;  1H1M A;  1ASJ 3;  3FFQ A;  2B45 X;  2O8O A;  3OGG A;  3NVC A;  4CCN A;  2X09 A;  2WS9 2;  1ZVF A;  3MEP A;  1OQD A;  5FLH A;  4BQ2 A;  1AX1 A;  2ZGN A;  4L8Q A;  4OMD A;  5B4X A;  3VBF C;  1GWM A;  4IE6 A;  1VJ2 A;  3HEI A;  5FP9 A;  5C8C C;  3C7G A;  3V0B B;  3T0D A;  5CG9 A;  4UF0 A;  4FTS A;  1XYP A;  1SBE A;  1ST8 A;  5IVB A;  2RMU 2;  2E7T A;  4FPF A;  5H9P A;  1JYT A;  1EUT A;  4FT8 A;  2A6X A;  4CP2 A;  3ACF A;  3GHM A;  2JXA A;  3MIE A;  2CGN A;  4FPJ A;  4K40 A;  4B7K A;  3ZN5 A;  4CRQ A;  4DIN B;  2FCV A;  4PIY A;  4YW5 A;  2VME A;  1YIF A;  1QWR A;  5KHH A;  4E2G A;  1YYN A;  5FZC A;  1PX4 A;  4MYE A;  3TN9 1;  2G4I A;  4M3C B;  5C33 A;  5JXG A;  1W90 A;  5CEH A;  5EJ1 B;  4I30 A;  4BQ4 A;  5KC5 A;  5LA2 A;  5FZ0 A;  3ZM8 A;  1RUG 2;  2WT0 A;  1NCR B;  4QMA A;  3WG2 A;  1RVF 3;  2XR4 A;  2VBB A;  4FTB A;  4L0P A;  4QXK A;  3LKJ A;  4ATE A;  3PLQ A;  2FZ1 A;  3PUS A;  4Q4W 2;  1V6I A;  4AFD A;  4AEK A;  1KGY A;  3I7D A;  1R1A 1;  3DXT A;  3IB3 A;  2WZ8 A; 
#chains in the Genus database with same CATH homology
 2WR9 A;  2JDM A;  1OUR A;  2JDP A;  1UQX A;  2BV4 A;  1OUX A;  2CHH A;  2BOI A;  2WRA A;  4UT5 A;  1OUS A;  2JDK A;  3DCQ A;  1OXC A;  5A70 A;  1GZT A;  5A3O A;  3ZDV A;  4CE8 A;  1UZV A;  1W8F A;  2JDU A;  5A6X A;  2JDY A;  2XR4 A;  1OVP A;  5A6Y A;  2VUC A;  5D2A A;  2VUD A;  2BP6 A;  4AOC A;  5HCH A;  1W8H A;  5A6Q A;  2BOJ A;  2JDH A;  2VNV A;  2JDN A;  1OVS A;  5A6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...