3DCQA

Lecb (pa-lii) in complex with the synthetic ligand 2g0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fucose-binding lectin PA-IIL
publication title Inhibition and dispersion of Pseudomonas aeruginosa biofilms by glycopeptide dendrimers targeting the fucose-specific lectin LecB.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 21
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 3dcqA00
4UT5A 5A6ZA 2JDNA 5HCHA 2WRAA 1OURA 1GZTA 5A70A 1OXCA 2JDKA 2JDUA 1W8HA 2BOJA 3DCQA 2JDPA 2JDYA 3ZDVA 2JDMA 4AOCA 5A6YA 2BOIA 5A6XA 2WR9A 1OUXA 2VUDA 1W8FA 2JDHA 2XR4A 5A3OA 4CE8A 2BP6A 2VNVA 1OVPA 2VUCA 1UZVA 5A6QA 2BV4A 1OVSA 1UQXA 5D2AA 1OUSA 2CHHA
chains in the Genus database with same CATH superfamily
3G7DA 1Q8SA 2WNVC 3JQWA 2ZKNA 2WDBA 5C9AC 4UW4A 3L2HA 3NJXA 1GYKA 3I2FA 3FL7A 4YW2A 4DS0A 2H0VA 3H3UA 1R082 4AVVA 1OLRA 1YQ6A 4LR4A 1I5PA 1QJX1 2W1UA 2Y26A 2JDKA 4JKKA 4Q0VA 3GF6A 4BH9A 1SLBA 3FC0A 3JB8A 3SKVA 4H2AA 4K8FA 2D3PA 2Z2SB 5FRAA 1EP0A 2WT0A 3U78A 4DEVA 1YWKA 3ZYFA 4MV2A 1C1FA 5A6YA 3D0SA 1MS3A 5LW9A 3UKVA 3QH7A 3VUOA 2ZGRA 2G9FA 1V00A 4PJYA 4B4RA 2A75A 3RPQA 1X9TA 3NMBA 1DGRA 1EAH1 1WZXA 2FDKA 1NCRB 1HN1A 3OEBA 4P02B 5JIUA 3HNMA 4KGQA 3TEWA 3GBWA 5J98B 3WP4A 1AR71 1OA3A 4XZUG 1US3A 4ZU7A 3TAYA 3ZN5A 1W6PB 4HETA 4MOAA 1UYPA 2ES3A 3PUQA 4WVVA 1VBB2 4A7YA 3LF7A 3O0XA 4LK6A 5E88A 3VD3A 3FWEA 5LRSA 3POIA 1QJZA 1UU4A 4HPKB 3WP3A 4AOCA 2B4KA 3O1SA 3I2OA 4M0NA 5IWFA 1UMHA 1JYXA 2BVBA 1H0BA 3BCWA 3V0AB 2RM23 3AP9A 2VZVA 3I49A 2BDRA 4NPMA 2VE1A 2VMCA 1FV2A 5I8TA 3WF4A 3VBSC 4A7KA 2EIGA 2VZTA 3ABZA 3TEXA 5ABJA 1W06A 1HB4A 1HX6A 4YW7A 4Y3OA 5FPBA 4I2OA 2VZUA 2D98A 4I09A 1ND3B 2ZZJA 1LHVA 2DVGA 5FYYA 4CUBA 4DXRA 4UW5A 2D97A 4XCBA 3WSOA 1CVNA 1JOBA 1SCSA 4KNCA 5L73A 4BB3A 1RUF3 1ENQA 3AYAA 5F3GA 4OQ9A 1AX0A 2GNTA 1N3PA 2W52A 3JD72 4GH4A 2Y33A 4PLOA 1SBDA 2A6VA 5LASA 3N36A 1LRHA 5BNNA 4N90A 5LZ6A 4BPZA 4MSVA 4J1XA 4XEZA 1LEMA 3DKWA 4PLMA 4ORFA 5L19A 5ANNA 4K40A 3VZJA 1OA4A 4XF9A 5FO8B 2VAUA 1QJU1 2P37A 1ZZ8A 5EYXA 5JZGB 2XUMA 4MXWB 3OBAA 2ZA9A 1WMFA 3IDBB 3U10A 2UWCA 1BQPA 2YC4A 1N1SA 1O4YA 3ACHA 4WV8A 4COZA 2VGDA 3ZFFB 4AGRA 1JYWA 2E6VA 2JG9C 1H1MA 5FP8A 4QB6A 2PELA 5FYMA 2OX0A 3JUUA 1QJFA 4ONUA 1DQ0A 4MVTA 2RJ2A 3ZSKA 5I0TA 4CDWA 1SPPA 2WJSA 1GNZA 2R0FA 3AP5A 4GD4A 5CB7A 2WLPA 3ZFEB 4CU9A 5IATA 1HRV1 1IS6A 2A3YA 2YU2A 4NROA 4YGCA 4WVZA 3F95A 2RR11 2BFUL 4HG6B 2WZR3 4LORA 4WM8C 4COWA 4QPIC 5FREA 1QNWA 3GHMA 1PNGA 3M70A 1OOPC 1V9U3 5F3IA 5FLHA 2Y6GA 4KBBA 2W47A 3ZIWA 4W65A 3PUHA 3TRSB 1JN2P 1W3VA 2SBAA 2ZACA 4OULA 1EUTA 3I97A 4FPLA 4R4XA 4XMIA 4P9WA 2X5IA 3BYWA 4QQLA 2IUWA 4FP2A 1PGSA 1GKBA 1VBD3 1OLQA 3HWJA 3GZEA 5C6CA 1FV3A 2HJIA 2RM21 4UFJA 3MHZA 4M3CE 4LLFA 3BTAA 2ZEZA 5D8AC 3BU0A 2JG8B 3ACIA 3HN1A 2ARBA 3B00A 4JX0A 4QKDA 4IV3C 5BNOA 5FMOL 4IETA 1J59A 5FCCA 1ENXA 4A6SA 1SHWB 4UT5A 2HWC3 1QXJA 5T5JA 3ZM8A 1RUF1 1CAVA 4E27A 1QNYA 1SLLA 2R0HA 3APBA 3KVBA 4EWEA 4Q4W2 2PHWA 5C33A 4RHV3 3T2PA 5BUVA 1O8PA 4JDOA 5FP3A 4PDWB 3P3NA 1ZBE1 4XF1A 2I45A 2H6CA 2VMHA 4K6BA 1Z7S3 2VM9A 3VBRB 3E6CC 5BNPC 4CP9B 2VW1A 1E5SA 2UWAA 3P1IA 4I0AA 2B9UA 1Q5OA 3WCRA 2D43A 1IPKA 2GC1A 4CUAA 4CRQA 1HV1A 4XBLA 2VQUA 2QQVA 4Y26A 3USUA 4DQAA 2VZPA 3R4DB 4FPGA 1VMHA 2XB6C 4TLFA 1QDOA 1PZ9A 2B9VA 4NHMA 2WNUA 5JSRA 1GOGA 1HB3A 4HKWA 4K1ZA 3U4SA 4XFGA 3ZXLA 5C8CB 1K45A 1WMDA 4BQ4A 4PIYA 5JOZA 2AENA 2GN3A 3H0OA 4NIGA 3J7MA 4AR2A 4Z92B 5DAPA 1F15A 3HQUA 3NQHA 3ILFA 4XXPA 1PHMA 3E5QA 2WBKA 1A6CA 2JD9A 2RS13 4LT5A 4N53B 1J3PA 1BEV2 4I3PA 5FZCA 1AJOA 3PVOA 1YFUA 4NIAA 4FXKB 3FFQA 1DGWA 2D44A 1LR5A 5CAZA 1QJEA 1QJY2 3GM8A 4Q26A 3TEYA 2Z69A 5T3NA 2XJTA 1W6PA 3PUIA 3ZN6B 5DABA 5JOWA 2PAKA 4C1XA 1NXD1 4UF0A 2WAOA 4Y1XA 3KV6A 1VBD1 4K9SA 2QQNA 3W58A 1IS5A 1S0EA 1QJX2 2KM2A 1VAMA 5F9TA 3V0BB 4D7TA 5JOYA 2W95A 3V56A 2W9XA 3DN7A 1KJRA 1YQ2A 1AYN3 1QDCA 4KWLA 2P3YA 3BOPA 4HLTA 1HRI2 5FPUA 2XWJB 4DO0A 1IQAA 1XNAA 2PFWA 3UT0A 4QQOA 1XE8A 4WM7C 5CBLA 1EAH2 1W6NA 3NJVA 3OD0A 5FZDA 2CSGA 2XVGA 5F39A 1HKDA 1V6NA 3DECA 4M3CA 4RHV1 2YPJA 2BTVC 4XJUA 1RUG3 2ZGLA 1OFSA 1PM7A 1TVGA 4XETA 4XQWA 4Q4V2 1W2TA 4C91A 4OCTA 4EROA 2JKBA 1AR72 5CG8A 3GZUC 2UYBA 1Z7S1 3MIDA 2EIDA 2MHFA 4F83A 4FPEA 2RVAA 4PLNA 3POFA 3TB0A 3IB3A 4S2FA 1S0JA 5A7OA 3BTYA 3AVRA 1WW5A 2EAKA 1SFYA 4BCUA 3D3AA 5FBJA 2QBXA 4K21A 5H9SA 1H2MA 3WX5A 2EIBA 1WMEA 4HL0A 1CGPA 5E8AA 4Q0PA 2XJPA 4JGYA 1HXS3 1W6MB 1YJLA 4XUOA 1OF4A 4YARA 3WG2A 3WP6A 5HCBA 3VBHC 4B8EA 2WRAA 5FP4A 3LDBA 5FZ8A 4ARYA 4BU2A 4R8HA 3N3HA 3FUOA 5JI9A 3NAPB 4IL7A 1EY2A 1XOYA 4YG6A 1NLRA 2C9AA 2RS11 3VKLA 3WNOA 4NPRA 4FFGA 4AFCA 4BQ5A 1H6YA 4YGDA 2D3RA 2A3WA 4GWIA 2PMWB 4LKFA 4MO3M 5D1IA 5FPVA 5FZOA 5FUPA 1GNYA 2VQAA 3MIHA 2ET7A 4O9EA 3WD5A 2WQ4A 1DU3D 3DXTA 2VL4A 1YI7A 2WYSA 3EHKA 3EQEA 2J22A 3PL0A 4PQ9A 3N9PA 2Q8CA 1GWLA 4PQQA 1W6QB 1QJU2 2YGMA 2WNVB 2RDQA 3MUY1 1QU0A 1CPNA 2Q1ZB 1G9FA 1ZRCA 5DN2A 3ZXEA 5C5TA 1OURA 2LS6A 4YNIA 2WLQA 3PU3A 3U1XA 4EWAA 3RZHA 4BIFA 2FMDA 3UV9A 1JYCA 1ZX5A 2VVDA 1TNFA 1DIWA 4M3CF 1UYZA 4EWDA 1O5LA 4IW3A 1AYN1 3ACLA 2FDHA 5BNQA 4HOOA 3T30A 4AAXA 1PNFA 4XJ9A 2F6BA 2XVLA 1RJ8A 1GQGA 3HOBA 2VZOA 1IHMA 1MS5A 1ULPA 2WWJA 4RA0A 1HRV2 4JHZA 2DWRA 2R16A 4CP0A 2UU8A 4KU8A 1JZ3A 1COV2 2RR12 1MZ5A 2NLRA 5CYYA 3RZZA 2WQ8A 3EBRA 3FZ3A 3A0KA 3AXEA 3WQ7A 5C3PA 1RUG1 5KHIA 3PLQA 3J8F2 1NX9A 2HWF3 1CD3G 1YLLA 2ZS6B 4XVHA 5J7MA 3S7EA 1UMZA 1JZ2A 3AKQA 4X8PA 4AXOA 2LUWA 1PM4A 4CDUB 3B7MA 3MLJA 3I59A 3WDVA 1XYNA 4YZ1A 4AGGA 2HWD1 4YVSA 3CO2A 3RS6A 3UESA 2VVFA 2RS32 2XL7A 4Y20A 1DGLA 3CQOA 2BYVE 3AVSA 3OY8B 3ZSMA 5JMCA 4P9IA 2IC1A 4Q4X3 4C0HA 4AEDC 3T1LA 5DUWA 3SITA 4N43C 4ATFA 2WSUA 4YFWA 1HLCA 2WT2A 4JTNA 4JAAA 4XJAA 5CKMA 4A6OA 2C26A 2WKKA 2DCJA 2R1DA 1NE6A 4XF4A 1H4GA 5F8PA 1SACA 2ZTNA 3O12A 2SLIA 1SLCA 2ZX1A 3MW3A 5AFEA 4XXAA 3D82A 4CEWC 2JB8A 1R083 5EPAA 4YGBA 1RUH3 1OKQA 2TEPA 3AKSA 4ZXEA 3IT8A 1FPN3 5C7GA 1ZNPA 1TNRA 4AFAA 4MHUA 2DV9A 3CJXA 4IE7A 4IV1B 1DQ4A 3PTYA 1QQP1 3ROUA 4CDXC 3R05A 1ASJ1 2ZXQA 3I3MA 1UO9A 3PIGA 2BGCA 4XFCA 4NIIA 1CAWB 1CJDA 3H42B 2D93A 4BHPA 2BWAA 2NPIA 4AG4A 2DBIA 2A3XA 1FMD3 1SFNA 2O8QA 2WN2A 5D21A 5I8YA 1FT9A 4XDOA 1FATA 1U0AA 1JI6A 2GC3A 2TNFA 3ZYPA 4AZZA 2VTXA 4ZZ8A 3ZSJA 2DU0A 2ZX4A 1BMV2 4Q8LA 1K5MB 1S2BA 1CIWA 3FN9A 2X29A 4YM0A 2FDGA 1LCLA 5FXZA 1LENA 2OT7A 3NVCA 2K2SA 4XABA 1J84A 1QH6A 1UNBA 3T08A 1PO22 5AC92 4CU7A 2XHNA 1MS4A 3MGUA 4MGTA 5T5PA 1UX7A 1A8DA 1B35C 1RUI3 4UW3A 3CJIB 2VCAA 1MPXA 3PUSA 3QOPA 4XYXA 5FZAA 2WO2A 4NRMA 2PHXA 5KC5A 1S55A 3VBUC 4ASMB 1OOPB 3LGRA 4OQ8A 3I3QA 1ZRFA 2WS92 1SBEA 5ISLA 2V5YA 2QQUA 1Y43B 1NCQC 1NUKA 1GU3A 3M8LA 3ZFGC 5ACA2 5L9RA 2AH2A 3VBFA 2X09A 5JUVA 4L92A 3RRDA 1ZZ9A 1AUYA 4XJZA 3OUIA 1HQNA 4QU2A 2E7TA 2IZWA 3B02A 3HQRA 4QXBA 5ERLA 1YCIA 3AKPA 3VBOC 4IEQA 4Q27A 4OZXA 4PI2A 3LFMA 1LHWA 3SXWA 4H7MA 4QT6A 3TN93 5C4WC 4N9HA 4XPVA 1ZRDA 5LBBA 3RYPA 3O1UA 4AVTA 4Z2WA 1WW6A 2VULA 3NV2A 3ZYIB 5IK5A 1RUJ3 3R6SA 3H9AA 4P9GA 5HXMA 1UAIA 4CEYC 5T5OA 2XPJA 4XCAA 1AL23 1GQPA 1MVQA 4XFIA 1W3XA 1RUH1 1DQ6A 4NWVA 5F7UA 5IAXA 2E63A 3T4HB 3U11A 4AVSA 4ZONA 4Q8KA 2JX9A 2A71A 2KD7A 1NG0A 3PU8A 3RYKA 1D4M2 3P6BA 5IK8A 3KMHA 1Q8VA 2UYAA 2OS2A 2JE7A 2UY8A 2WNVA 3VD5A 4AAPA 5C9AA 5J1XA 3POYA 2EICA 2I74A 1J3QA 1JH5A 4NAOA 1BVP1 1FMD1 2GAUA 2VU9A 3OB8A 3SH5A 5FR3A 4E4DX 2QVSB 2VW2A 3AFGA 5T54A 2LROA 1PZ7A 4EV0A 2OA2A 4YVWC 1EPZA 1NAEA 2PHTA 1STMA 4UFHA 2E33A 2XBO2 3T0BA 2ID4A 2J1RA 4BJ0A 3OPZA 4QXHA 2VZRA 1F5FA 2ORZA 4PIZA 1DYPA 1RUI1 1PIV2 3O1VA 1IS4A 4CZSA 4JHTA 3IDAA 4IQPA 4YYOA 1JYTA 2H6BA 4HVOA 4K3UA 4D7YA 2OQ6A 2OW4A 1GV9A 2YPDA 1C8M1 1Z78A 4P00B 1AZDA 1H1AA 2RJKA 3PUAA 1AXKA 4M0HA 4CCDA 2J1SA 3TYJA 2Z42A 1ZA4A 4CDUA 1RVF2 1POQA 2EXJA 3CNAA 3LSDA 3SEPA 5G04L 3V65A 1UL9A 5A32A 1LHOA 2GNBA 5FLIA 3OY8A 1AXZA 1W39A 1RUE3 2HKXA 5ABJB 1LESA 1U5YA 1UYYA 1W05A 2HWE3 3B3QE 5FPXA 3KQRA 3FLRA 1C5HA 3VBSA 3WUDA 3TN91 4BLIA 4E2QA 1RUD2 5B4NA 3BIEA 5FPLA 2X8KA 3ACFA 2YC2A 3M7AA 4V1PA 1K12A 3K3NA 4TYSA 1REEA 5EXOA 3MYXA 5FMCA 1AL21 1SMVA 3LCPA 4FAGA 5J36A 1MACA 4GH4B 5IYYA 1W9TA 4FO9A 1Q8QA 4AI9A 4DINB 1YC61 1NQDA 4YW4A 3UGGA 5BNNB 3O0WA 3DYPA 4CXYA 3UNPA 3KF5A 4EN0A 2YBPA 2N7GA 1PK6C 3AMMA 3CIHA 5CKQA 4MUVA 5E6HA 2ZX0A 1ULGA 2V4VA 3K48A 2DVDA 4IGQA 4K20A 3VKFC 2QKDA 3GJBA 1V6JA 5JIAA 1RC6A 1ZZ6A 1OD5A 1FYUA 4JC1A 3WEZA 3PVBB 2BP6A 4GB32 3UKNA 4Y5SA 1AR93 1PGW2 3IDCB 4LITA 3WNNA 1SPPB 2C0ZA 2YFZA 2JG9A 1GBGA 5JVVA 3JXSA 1DP0A 1WMXA 2DFCA 4QHOA 3SCGA 1TG7A 3SLIA 1VAKA 2WFF2 2WYFA 2PLV2 4QPWA 3NNLA 1SG3A 1X7NA 3I2GA 1W9FA 4OHXA 4Z82A 5IAVA 4R4ZA 5F1RA 4RD7A 1BVVA 3VDBA 1RUOA 5DAVA 1GP4A 4RGKA 3UJQA 5H9PA 4AI8A 4E8DA 3A22A 3B94A 1WW4A 3U14A 1Q8OA 2VC9A 1LECA 1TME3 3DKQA 3H50A 4QPIA 4WM8A 2NZ9A 2XQXA 5GLWA 5JXJA 5H9RA 1OOPA 3JU9A 1QQP2 5FZBA 4I3GA 1WKYA 1IOAA 4A41A 4CCNA 1ASJ2 3UK9A 2Y38A 4OFGA 1ZZ7A 4GKXA 3O1MA 2E31A 2ZHLA 2FZ2A 3LZZA 3ETPA 2H0BA 5B2GB 3KM5A 4SLIA 1DQ5A 4FSJA 4Q4Y2 1PVC2 4DY5A 5FYZA 1RUE1 4S2GA 1NZIA 2PTMA 1Z0HA 3B69A 2HWE1 3KS7A 5D8AA 1LJ7A 1W99A 4A4AA 3ALQA 4FTBA 1IPSA 1GOFA 2W91A 1H1IA 4GMP3 4IV3A 1OT5A 1KEXA 5IJRA 1HB1A 4IEUA 4X6RB 1C5IA 3K4DA 1CAVB 5FZMA 5HV4A 4PIXA 1LTEA 4XAEA 1P8JA 3BUCA 5T55A 5JXIA 3FFZA 5FPAA 3WOGA 2A6WA 2X53S 1LU2A 5FZGA 1JW6A 1JUIA 2DVAA 1QGLA 2Y60A 3NV1A 5FPZA 4QXCA 3MW4A 1LULA 1AR63 3KGZA 2NP0A 1UPIA 3E6DA 3SEEA 2JDNA 4DNYA 3MF9A 4OHZA 1G8WA 3WVJA 1EPWA 1SEFA 5JCTA 4XOGA 3USUB 1Y4WA 4NJ4A 4ZS3A 1R093 1UZZA 2Z79A 4R9DA 4YW3A 1VBA2 2MEV3 4KQ7A 1J58A 4LBQD 4QKFA 4LO7A 4CUGA 2R042 2Y34A 4L0PA 4DUVA 1UOBA 4LE4A 5TSWA 1ENSA 1CWPA 3Q8FA 1U5IA 3WNKA 4P9LA 3AL6A 1A3KA 1D2SA 2WNUB 5FWEA 1JZ8A 1PZ8A 3T2TA 3D8CA 5ANQA 3ITQA 5C8WA 2BZDA 2PAEA 3VDCA 5IVYA 1H8VA 1LU1A 2C5DA 2OYZA 3ZR6A 5I93A 4AHYA 4C1WA 1S1AA 3IKWA 4AFBA 4NRPA 4Z8BA 4AFMA 3DPRC 4ES9A 2F4LA 4ES8A 3MPBA 1XNDA 3JCIA 4FFFA 4AI0A 4QB2A 3NKTA 5HCHA 1VRBA 4FPKA 1Y7BA 4OLLA 2ZBJA 2B8MA 3RYRA 1RHI3 4HK8A 2FBEA 1UY2A 1MEC1 1XYOA 2ZZQA 4KH9A 2XH6A 4M4PA 4MHRA 4UF0B 5F6LB 4BQWA 4XBQA 5BYNA 3NNMA 1ZM1A 3ON7A 3ZR5A 1Y3TA 4FFHA 1MS0A 2K46A 3KLSA 2IXLA 3FE5A 4PBPA 4YM1A 3AP6A 1TZOA 4AF9A 1OH4A 4D69A 2XDVA 5GZEA 2ZABA 4COUA 5A6QA 4RS5C 2K9ZA 2OUHA 4NOTA 1WW7A 1SDWA 3BGAA 3MUZ1 4XAAA 4W6YA 1AR83 5FAXA 5DDJ3 2OKXA 3HQXA 1UXZA 1LEDA 1VRH2 1WWYA 4JKLA 3WY6A 5EIYB 1OD3A 2R30A 1GZTA 4TXWA 1Q3EA 2A70A 4QWNA 4ARXA 3GBFA 3J7NA 1O4ZA 4MXVA 1W6NB 4FPYA 4XHXA 4FQZA 4M3CB 2HYXA 2OXBA 3M2MA 3IWZA 4URAA 4H55A 5C3RA 2WA3A 2IXHA 4YZ2A 1XQNA 4WM7A 1V6KA 4YFZA 4AGVA 4I0WB 5FYHA 1DCSA 4RSUA 3VD7A 4XIOA 2WFPA 3VZMA 4AEJA 2BEOA 3M3OA 1VBC2 1WLTA 2RJLA 1VBE2 2FZ1A 1BJQA 4AE2A 1DDLA 1WCDJ 1C8M2 1BLZA 3AZZA 3HAGA 1X50A 4IE0A 3AB0A 1LGNA 4LHNA 2VNRA 1QXRA 2YMZA 4LO5B 1NCQB 1R091 2AZ5A 4N7UA 5FY5A 3ZYRA 3RZKA 1O3TA 2XOMA 4L97A 1D7PM 4NMIA 2GC2A 1OH3A 1EV13 2X10A 4A3XA 4WBBA 5CKNA 2UY9A 2JENA 1W2UA 2PHUA 1V0AA 2VUJA 1CZTA 3OUJA 4EJRA 4JGYB 5FMDA 5EZWA 4BYYA 1CIYA 1Y9QA 1ZBA3 4LOSA 1LB2A 2R7EB 3MZHA 3KF3A 5F5CA 4B1LA 2QUOA 2RMU3 4QX3A 2VNVA 2ZHNA 4ZU4A 3VBHA 1O3QA 1NY72 1RINA 3WF3A 3WF0A 3THDA 3BPZA 1YXWA 2RDRA 5FZOB 1H8TC 4FPFA 1O4TA 2XLFA 1RHI1 2ZGMA 1JZ7A 5JR7B 2VG9A 2RV9A 4L99A 1JTZX 1PMJX 2IXCA 4Q29A 5LY1A 2FDIA 3BPSA 5DZFA 2CWMA 2HWB3 2JDPA 3ZDVA 4HFSA 5CFCC 2GSYA 3TNQA 2RS53 1D2QA 1ULCA 5AC93 1ZRIA 5C3OA 2ZEWA 1O8SA 2A6YA 2D6LX 5DUUA 2JDHA 1AR81 1YRZA 2ZGKA 5DDJ1 3Q8AA 3ZX7A 2Y0OA 3PDQA 4JKMA 2QQPA 1QXPA 1O5UA 2ZMKA 3E5XA 4V2WA 4FPJA 4XUTA 1XNTA 2A7AA 2Z5WA 2PAMA 1PO13 4UI9L 3RQ0A 2VY0A 3AC0A 4AEMA 3L9JT 3A4UA 4AWDA 3WDXA 3DEMA 5CEHA 2D6MA 2QQWA 4UW6A 2IVIB 3HNBM 2RDNA 5ACA3 4O7XA 1YIPA 1JHNA 3FHQA 1J1TA 3INAA 5FYCA 4UFMA 3ZVXA 1CX1A 4N8MA 1WCQA 2DUQA 1RMU2 2W0XA 4IEXA 3PNAA 4YW5A 5GJ6A 3V64A 1HDKA 1WCSA 1NT0A 2BERA 4HSLA 4IEVA 2ZGSA 5FDBA 1BBT2 5EFUA 4R9CA 3VB9A 2JXAA 4KL1A 3I59B 4A45A 2BNMA 1LOBA 2RHPA 5APAA 3OPWA 4YVSB 5C3QA 1JU3A 3JBG2 4Y20B 2QJVA 2YU1A 1GP5A 2Z4FA 1DGWX 2JDZA 4L11A 4CVUA 3MO4A 1C28A 4MGSA 2R073 4YW6A 1AYM3 3KCYA 5FY9A 4EZHA 3FLPA 2AGSA 4HT1T 1WBFA 4WVMA 3ETQA 3MV01 1ZBA1 4AEDA 4J6GA 3H3LA 5FV3A 4N43A 5CA6A 5EP9A 1GWKA 2QFEA 4AEKA 5IFPA 2RMU1 4Q1PA 5FKBA 1J1LA 2DURA 4OHWA 1W8OA 4BQ2A 4YWAA 1FXZA 2J1TA 2WZR1 2OZ6A 4GMP0 4QX8A 2VOWA 4F3JA 2Y6FA 5EJ3A 1W2NA 4LTAA 5GLVA 1D4M3 1F9KA 2P3IA 5CISA 5FO9B 5I0SA 1CAUA 1V9U1 2BV4A 4AFDA 4CEWA 1YO8A 3GZTB 4HVQA 4TTGA 5EHDA 1TMF2 1XE7A 4RR3C 1CPMA 2PN5A 5DG1A 4P5HA 2HBTA 4RQPC 1HQLA 5DAQA 4LUMA 1XPWA 2R6QA 3FUQA 3CEWA 4U2AA 2HWB1 4CDXA 2RS51 5F5AA 1UY1A 1YNAA 4N7IA 4XFAA 1POV3 2IXJA 4QMAA 4I30A 5I0UA 4QX1A 2Q4SA 5CFDC 1WA4A 3GBGA 5EV7A 1V6MA 4NHKA 1VP6A 1VR3A 3C7EA 3D5OA 1JXNA 1RB8G 3KV5A 1F4AA 2J7MA 5CZKA 3VD4A 3PMEA 1FOD3 1JODA 1T2XA 3H8UA 1PO11 3J9SA 2CGNA 2HWC1 1IG3A 3B9IA 4E2GA 1L3JA 2YFUA 3WNMA 4YPJA 5JMOA 2VBDA 5K0UC 1RVF3 2ETEA 2B5HA 2WSVA 4QKBA 4CCCA 1UU6A 3OBTA 5A7WB 1JMUB 1J3RA 1I5ZA 5L7OC 1B35A 3LB9A 1W04A 5AFBA 1W8ZA 3R4SA 4HXCA 1UXXX 4LBJA 1ZRRA 1UCXA 1MEC2 2R063 3IIIA 1JS9A 3AM2A 5FP7A 3VBUA 1WCKA 3U37A 4XJWA 4EN8B 2GH8A 3SH3A 1X8MA 3VBFB 4D3WA 3AYEA 1W8FA 1NCQA 1D0HA 3HNYM 3O1OA 3ZKUA 3ZFGA 3C7OA 4JDMA 2R071 4ISRA 4NVPA 5J48A 1F4HA 1RGSA 4URTA 2DU1A 2WZPP 3THPA 3WG4A 4DMIA 4GQ7A 1MS1A 3O1RA 4XACA 2CWSA 1NA1C 4B7KA 1GNHA 4AQSA 1FI2A 1KRIA 1ULOA 3NJYA 3OBZA 4IEZA 2EF6A 3VBOA 4TZDA 4AK3A 2CY6A 2OPKA 3VDDC 2WC2A 4PBOA 3EJKA 4B29A 3N9QA 4DY3A 4CUCA 1DQ1A 1ND2C 1YQ5A 3AL5A 3O5SA 5C4WA 3I54A 4YLZA 3SC7X 1RIRA 3LQCA 4QXKA 3P3PA 3POBA 1Q43A 1T6BX 1JZ4A 4CEYA 1BZWA 1X82A 5B4XA 1XNBA 2ZOEB 4KBZA 3LOBA 3IPVA 4CDWC 2QTWB 3ZO0B 5IT6A 3O1TA 2VXRA 2ZX3A 1MQTC 4LO6B 5FY1A 4NR1A 3SKJE 2YBSA 3B5LB 5C9AB 1UY0A 2NQYA 4RL7A 2A5ZA 4EZ4A 3T3YA 2XXZA 3MDPA 1HJGA 2G4IA 4IE5A 5FZ0A 3T0AA 4AVAA 1G86A 1QY4A 2V73A 1YIFA 2E51A 4BWOA 2YG0A 4PF5A 1UYXA 1QWRA 2PHDA 1JZ6A 4MGZE 3A23A 1IQDC 2X5IC 2ADEA 4M01A 3WG1A 5EWSA 4ZY9A 5GM0A 1XE0A 5A7PA 1R1ZA 2ILMA 3KZ4C 3DL3A 4ASLA 4E8CA 4Y1VA 4UYBA 4RGAA 2XVKA 3ZXFA 5D2AA 2HLEA 3DPRB 1O3SA 3PHMA 2VNGA 2BBAA 3DYMA 4QPGC 4YZ4A 5DPNA 3ACGA 1R1A3 2PYTA 3E5UA 4LBMA 2FD8A 4Q4Y3 5FJKA 1US2A 1DZQA 2JECA 2ZPXA 3M3IA 2C9KA 1H9WA 1JOJA 3I3DA 5FBZA 1RUC3 1HJFA 3VKNA 3CL1A 4E4SA 2VNOA 1W2OA 2YHJA 4R9BA 4AHWA 2V4AA 5LEJA 5A32B 2RM22 5IVVA 1G6NA 2BOIA 2CL2A 2Y6HA 2J1UA 3NNJA 4ATEA 2A73B 4XJ8A 5A7SA 2YB7A 3VL9A 1LAJA 3LEMA 1HXS1 3VBSB 3KD4A 2X05A 1ULEA 3BTXA 4QDSA 4HVRA 3KWVA 3C7HA 1XB9A 1UKRA 1XJAA 3D6EA 2LM3A 1UMIA 4XFFA 3AMQA 5LK5A 1ONAA 3RMYA 1RUF2 2OPWA 1OFNA 1VALA 2HBUA 1D4VB 4MG2A 3HVDA 4BLJA 4WVWA 2GALA 3B9CA 4JQRA 3MIBA 1UIKA 4V2VA 1C57A 1AHSA 1ZBE2 4BOWA 3WW1A 1C3HA 3Q8BA 3GDBA 1GQHA 2HEVF 3H1WA 2BRTA 3PIJA 1MZFA 2I07B 1CQ9A 1NKGA 3MLKA 3H7YA 2WN3A 3CZUA 2D6OX 1PK6A 1JOPA 1OVSA 3ZN4A 4PT6A 4NHLA 1HN0A 5GZDA 3HBZA 1NCRC 4FVVA 3AKRA 1LHNA 2G19A 3BIWE 3HT2A 4H7LA 4F8AA 3WXPA 2F4PA 5F2WA 3TNPB 2JG9B 3NSTA 4IE4A 4D7SA 4NHXA 3MICA 3J7HA 5JSPA 4NPLA 2D5HA 1OQDA 2W2IA 1LGBA 1VBB3 2RG4A 4XILA 3KT1A 1K5JA 4AW7A 1UPSA 5LEKA 2WZR2 3JZVA 5FYTA 3VDAA 1KD7A 2G9GA 4DXTA 1S0BA 3U0ZA 1UOGA 3BTZA 1AX2A 2GZWA 2W5FA 1OVPA 4WM8B 4QPIB 5FOBB 5F3CA 2HWF1 1V9U2 3DF0A 2K0GA 3H7JA 4X8NA 5A7WA 4BXFA 2XJQA 5LA0A 3CZJA 2DVFA 1CAXA 2LTNA 2XKOA 4QX7A 1GFF2 1UOFA 1N1TA 1UX6A 4XIKA 1ND3C 4CPBD 1VBD2 3EB7A 5KBFA 4Y22A 3THTA 4EQVA 4Q4X1 5LA1A 2Q1FA 1GSLA 5IK4A 4GWJA 1IKPA 2QCSB 3LKJA 1AVBA 5D8AB 3U4XA 2BWCA 1X36A 3IM0A 1DZTA 1POV0 2QZ3A 3WDUA 3JD73 3FHIB 4IESA 4IV3B 1SDDB 5EJZB 5LBCA 4WZFA 3VZOA 1VMFA 2ZGUA 4B4PA 4KWUA 2DF7A 3VHPA 3I2HA 1QH7A 2VECA 2HWC2 4LHKA 4XHBA 3SQOA 5C5UA 2OZJA 4GA9A 3N9OA 1KJLA 5JZGC 4DRRA 3VLBB 1H2KA 3N9LA 3R4UA 1R081 2D5FA 4RHV2 3POWA 3SCFA 3WUCA 3ZXDA 4C90A 3K46A 4MGYE 4RFRB 2ZMLA 3ZFFC 1HV0A 4LOTA 1JBCA 1BK0A 4NUBA 3WT3A 1FPN1 5J09A 1Z7S2 4YM3A 4JRAA 4QHBA 4OZOA 4DXZA 3C8XA 3C3VA 5BNPB 3ZFEC 3RWKX 2GP3A 2WZEA 1UZVA 3NV4A 1DYKA 1ACCA 1G9CA 3N7KA 3NO8A 3AP4A 5FTTC 5FQ0A 3LA7A 3K4AA 4LO4B 3I2KA 2YDEA 3WDYA 2ZEYA 3GJAA 4U36A 4QHZA 3LOIA 2FQPA 1UZWA 5KHKA 3KCCA 5DG2A 1HIXA 3GCXA 3ILRA 2RS12 3T0DA 1OA2A 4QQHA 3PMSA 1UF2C 1DYOA 2P3KA 3Q8CA 2Y6LA 1F2NA 3DPRA 5F2SA 2JIGA 3THCA 3W20A 3ZXKA 1G7YA 2JG8C 1XC6A 4FCAA 2YROA 3I2JA 4DOUA 2ZGNA 2YC0A 5FZLA 5JAXA 4GAZA 2VH9A 3I4IA 4DZGA 3K77A 4ZPIA 3MIEA 3T09A 2QQJA 1KDMA 2D6NA 3BU7A 4LBOA 4DIQA 4E2SA 1RITA 2Y6KA 2Q8DA 4RYDA 3AJZA 4CCEA 4GJZA 5F32A 2R32A 3LEKA 2QDRA 2P6CA 4PDWC 1AYN2 4Q4W3 4RS5A 3DCQA 2XLAA 2QQLA 2A6XA 2OVUA 2DVBA 3LD8A 3VBRC 2Q5TA 2GMEA 2VTFA 1M4WA 3OYWA 4XDQA 4YZ3A 1RUJ1 1SBFA 3ASIA 3CKHA 1GICA 1YI9A 3OGJA 1I9RA 4GWNA 1UOJA 2HEYF 5FUNA 4CPBA 4LHSA 2VOXA 2CGOA 3P5BA 3ZXGA 4B7EA 4XBNA 1LHUA 3QLQA 4WM7B 5K4LA 2AR6A 4WZCA 4UOJA 1RUG2 5BXXA 1CESA 5AVPA 5LY2A 3RJRA 4TN7A 1UW8A 3OTFA 2AYHA 3S7IA 1JYIA 5L7OB 3BB6A 1CONA 2BNOA 2QQOA 3ZYGA 3WHUA 3FHAA 1GZWA 5C8CC 5A3NA 2TBVA 4NWWA 1O91A 3ZPOA 4E4ZA 2QZ2A 2JB4A 4YRDA 3UETA 5LBEA 2HWD2 4L9BA 1ENRA 1U5XA 1UIJA 5A6XA 1JHJA 1OF3A 1PMIA 3WHTA 1GUIA 4IGPA 4B1MA 4LKEA 1SQ4A 1X8EA 4N53C 2DTYA 2WO3A 3HR9A 4QKNA 4G3YC 2EA7A 1BEV3 2IXKA 1HXS2 3GCWA 5GLUA 3W9AA 1NA1B 5FMOS 2ZGQA 4BZ4A 1QJY3 1PX3A 5C71A 5GZGA 5A6ZA 3VBHB 1IPJA 4QX0A 3C7GA 1N3OA 4IGOA 5DAXA 1GP6A 2GMPA 3LDRA 4FPOB 1KDKA 4LBQB 4QX5A 2TUNA 1RTVA 3MLLA 4LKDA 4FBFA 3K75B 4AHXA 4KG0A 3DV8A 2D7FA 1QJX3 3IIAA 3JQXA 4GWMA 2W46A 5LATA 1W9WA 4HMZA 1H8TA 2WA4A 1OC1A 2P2KA 3I2DA 3RG0A 4XFHA 2NMNA 3WG3A 3MIFA 4JGZC 4FOYA 4OUSA 3TBDA 5J96B 1HRI3 1NOVA 2VXJA 1ZA7A 3ZIXA 4KWKA 4UFLA 2QNKA 5LA9A 3OCPA 4JRLA 2CAVA 3LEGA 2HEWF 3KT7A 3ZYBA 1EAH3 4SBVA 2IWGB 5CFCA 4L8QA 3VGIA 1EUUA 3ZSLA 3TEZA 4Z2AA 5FZ6A 2JE8A 1ST8A 3RZJA 4IEOA 5JLVA 4Q4V3 3GZAA 4QD2A 3NNGA 4QQPA 2FCTA 3SHRA 3VL8A 1AR73 4CU6A 1A8MA 3H1YA 4IUGA 2YYOA 3CU7A 1GLHA 3S30A 4BA6A 2P1BA 4XTPA 3H8OA 3DUIA 4P9XA 5FZ3A 2HH9A 3BN6A 3FBMA 3PVEA 3ILNA 5FZHA 4MADA 2HWF2 3AZVA 5KXBA 4OUEA 5FZFA 3HBKA 5JPNB 2WL1A 3LA2A 4FOVA 4FOWA 4IE6A 3TWIA 2VTXJ 4BK4A 1UN1A 1A34A 1MVEA 5CIRA 4NO4A 4IEYA 4LIUA 1VJ2A 1S0FA 1W0OA 3LPFA 2D6KA 5BNPA 4FTEA 3NAPC 3QH6A 3Q9OA 5C3SA 3IAPA 2GP5A 1WD4A 4Q4X2 1V6IA 1AL0G 1S2KA 3RDIA 1JYVA 3B93A 4WVMB 3UKTA 4LK7A 3WR0A 1H30A 1BEV1 1AR91 4AEDB 3WINE 4Z07A 3ZLIA 3POSA 4N43B 5FYUA 1ODNA 1LOFC 2ARAA 2F17A 1QJY1 4BIOA 4COVA 2XGXA 2WIIB 3IBMA 5AVAA 2E32A 1U12A 3O0VA 2V09A 5BY5A 2CHHA 2CNAA 2GC0A 3E6BA 2W92A 4CCLA 2W3JA 3S6PA 1QOOA 1W90A 1QJU3 3GGLA 2BQPA 1CAUB 1OKOA 3N7JA 4OMCA 4XUPA 4A2UA 3I2IA 4IDZA 1HB2A 1RUH2 1TME1 4CEWB 2EIEA 4OMDA 2BW8A 3MV11 4YW1A 1FPN2 5K7PA 1SLAA 2GNDA 1E5RA 2AC1A 4X6QB 2IVJA 3ZOIA 4BISA 4Q0SA 1KS5A 1O59A 1UD1A 1HRI1 1YFXA 4CDXB 1W8WA 4RR3A 1VB2A 4RQPA 1HRV3 2DCKA 4QAWA 1W03A 3K51A 1COV3 5FJHA 3UYJA 3LAGA 2RR13 1FMD2 1NQJA 1RYYA 3ZSEA 5IVEA 2Q8EA 3AP7A 3T4VA 3N9NA 2ZGOA 3OJBA 1YHFA 4COYA 3WNXA 4Q4V1 2O14A 3J8F3 2WNOA 5FY4A 3KVAA 2KR2A 5CFDA 1NYWA 1XNCA 4GMP1 2VZ3A 5F37A 4LA3A 2WWSA 2B7YA 5F5QA 5A70A 5K9YA 5A33A 4CDUC 3ZYHA 3WP5A 3PJYA 4EE2A 1NXMA 1L7LA 2B39A 3RMXA 4CP2A 3QD6A 1RUI2 4B4QA 4J25A 1LOGA 1OPOA 4AQ2A 1NZCA 4ZZ5A 2BNNA 4Y1UA 1B35B 2RE9A 2RS33 2DCYA 5CVRA 5K0UA 1F5JA 5C70A 5J3UA 2W68A 1AR61 4QU1A 2VQ0A 5EYYA 3UGHA 4FOQA 1BCXA 3IAQA 3VBUB 4A7ZA 1URXA 4FAHA 3QCWA 1APNA 1OMIA 2VBPA 3KCXA 5FMBA 4YSFA 1G9BA 2ADDA 4IEWA 3LIGA 3ES4A 3ZFGB 1S0IA 2MEV1 1QHDA 2YGLA 4JV4A 3OD4A 2VCBA 3FMGA 4HKLA 1CN1A 2B45X 1XSQA 1VAVA 4LEJA 5LB6A 4OI0A 4XUQA 1XRUA 5A1FA 1BKZA 2B42B 2DTWA 2JJ6A 2W39A 3KQ4B 3VBOB 1NLSA 4BQYA 3TN92 3A21A 1ZBE3 2WR9A 1NA1A 3J7LA 4IV1C 5IVBA 4DXSA 3SISA 2XR4A 2CYFA 4INDA 5C4WB 4ET7A 1RUJ2 3N4MA 1VE0A 4LJHA 4JDNA 4QDRA 2VJXA 4R52A 3VDDA 5IVFA 1AL22 4I01A 1F35A 1ND2A 5T52A 5L7OA 4XDPA 4LBQA 4CEYB 2D40A 4N9IA 3PTRB 2ZMNA 5JXHA 3J26N 2DBNA 3IPVB 2FCUA 1KFXL 5GLTA 3ZMOA 1DLCA 2ZX2A 1DGRN 2AEZA 2VOKA 4S2HA 5GLZA 1K5MC 5FZKA 4LPLA 1R64A 1WLDA 1PGL1 3VZNA 4GULA 4HZFA 3HEIA 5FY8A 1DBNA 1MQTA 2Y6JA 3VKMA 1YUDA 3WZ1A 2ATFA 2ZHMA 3K3OA 1COV1 1OHFA 3WNLA 5BV6A 2PXJA 1WLCA 1K42A 1PO23 2QQKA 3OEAA 4ZXKA 5A3OA 3W5MA 3CJIC 3DYOA 4F7ZA 3IDEA 4UBGA 4XF0A 4AVBA 3IN9A 1SFPA 2OUJA 4GALA 3RI9A 3J8F1 4ISQA 4Y1ZA 1MS8A 1REDA 3HT1A 1LGCA 4YVWB 5F5IA 2GU9A 3OSDA 1WGPA 3NV3A 4FXGB 4CCMA 3LEIA 2ERFA 2WS93 5I8SA 3AMPA 3ZMNA 4GZ9A 1C4RA 4RGGA 4J1WA 4AI1A 5LK7B 2VMFA 3NW4A 4FI9A 2RS31 2V5DA 2VMGA 2QDNA 1ZYBA 3RFRA 4QQ2A 4W4ZA 4P14A 3BODA 3OPTA 3W21A 5JXGA 3FJSA 2XJUA 2EXHA 2XLGA 1NE4A 5E16A 3OUHA 4QPGA 3U75A 3ELNA 2VR4A 1ZZCA 5DUXA 3OGSA 3WDWA 4CDQC 5IVJA 3RGBA 1S0CA 1SCRA 3S0MA 1Y9MA 2CU5A 1KGYA 3CMGA 1PVXA 4RFT0 4D8MA 5JR2A 5GZFA 4LULA 1QOSA 1W9YA 1EV11 2FDJA 1Q56A 3NRUA 4G4FA 5HCAA 2EALA 1XSRA 2Q1MA 1F31A 2IFWA 4I0BA 1TEIA 5FK8A 1RUE2 3U07A 1IS3A 2YXSA 3AMHA 1CR7A 2NYYA 2HWE2 3I3BA 4L2NA 3NWKA 1QKQA 1UU5A 2VZ1A 1W8HA 3AK0A 2Y8KA 4LO8A 5KHJA 1AJKA 1WA6X 2PHLA 2ZHKA 2C6SA 4QGNA 5H9QA 2CTVA 2XUEA 1SLIA 2AACA 2EVXA 4BQ3A 4EN7B 3S5QA 5JWPA 2WO1A 2PQSA 3WNPA 4LBLA 3D4KA 2VUAA 4UBHA 5FOJB 1T6GC 1DHKB 2BVVA 2WZ8A 3ME2A 4PHZA 2GDFA 4YZ5A 3VZLA 4KGGA 3OGRA 5A80A 1IGOA 3MIGA 4MX3A 3X29B 2P17A 4A3ZA 4OUMA 1O7FA 1PK6B 2ARCA 1BMV1 3O7OA 4HN1A 3AKTA 4W8JA 4OI2A 3ZDSA 2RDSA 2XBO3 4HONA 4BDVB 3HIFA 2BGOA 5KHGA 1PO21 2C24A 5AC91 1BK1A 2DYCA 2JDMA 2O1QA 2YUEA 1JU4A 4XQ4A 5J37A 3H3ZA 1PIV3 2OIIA 4IEPA 4BM8A 4C8DA 5HXVA 3UJOA 1AR92 1NCRA 1S0GA 2AREA 2ZJCA 3KSCA 1S0DA 5A1AA 4QX2A 1H9PA 1JZ5A 3GHNA 2ET1A 2CV6A 1WBLA 4LIVA 2VZQA 3GXUA 3WLUA 2WS91 5HV0A 1HQWA 1AX1A 3KB5A 5A1LA 5JOXA 5ACA1 4MGKE 1L7RA 5LA2A 2LRPA 3K4ZA 1WD3A 1B09A 2I2SA 3KGLA 3AX4A 4HPKA 3VHNA 4QDQA 5F6KA 1QOTA 1TME2 3V0AA 4JQTA 1GZ9A 3ECQA 3RWNA 3EO6A 1CAXB 2FMYA 1BYHA 2XONA 5ABJC 1H2NA 4OHYA 4Y4YA 4FT8A 2PHRA 3M4FA 1QMJA 3PJQA 2P6HA 1GWMA 3IZOA 1LOAA 4CCJA 4Y22B 2EXIA 3WW4A 1GR3A 1GZCA 1RUD3 4JGZB 5FO7B 2JIJA 3AZXA 4MH0E 1GMMA 4LNVA 1S2EA 3W59A 1ND3A 1W9SA 1AYM1 2XKPA 4GH4C 3AYCA 1W28A 2BU9A 4DB5A 5BNNC 2G1MA 3SCHA 1UZ0A 1OPMA 1W2AX 4MZUA 4YG0A 5FY0A 1ZVFA 3ZXAC 1N47A 4Q2FA 2ZEXA 3CHXA 3N7LA 5A3UA 3BKZA 2VW0A 4LBKA 1RXGA 3AZYA 3OF1A 1LNSA 2WT1A 2FDFA 3ENRA 3QBQA 3LSEA 4CTEA 1MR5A 1KS4A 1D4M1 3N9MA 1FNYA 2G9ZA 4Z1VA 1RUNA 1W8NA 4K1YA 2HWD3 5FWJA 1PMHX 4P9YA 5JZGA 4MXWA 5EQUA 4XZPA 5CNAA 1RXFA 5FYIA 4CA9A 1AR62 3ZYJB 4NIHA 3ZFFA 4OVEA 4MLOA 4GB33 4D94A 4GXLA 4D6QA 4NRQA 2D3SA 4B3NA 2P3JA 3S57A 1R092 4E4HA 2E7AA 4H3WA 2MEV2 1MZ6A 2XBO1 2DFBA 2W1SA 3ZFEA 3RZGA 1LOCA 5L9BA 1POV1 2WFF3 2PLV3 4KMQA 4PI0A 2J1EA 1ZREA 5FZEA 4XE9A 1PIV1 1XU2A 5E89A 5FK7A 5FQ0B 5KXCA 2XMLA 2AUYA 4P08A 1UZYA 5DAWA 1FOD1 4HK9A 3PURA 1XXNA 1KXGA 3VHRA 4D6SA 5HBAA 3EYPA 5SV5A 1ZZBA 5A7NA 4YVWA 4QB1A 4UFIA 2MPFA 2ZKLA 1W0NA 1QQP3 1DQ2A 2OQ7A 1ASJ3 1EYBA 3I3EA 1RVF1 2JICA 4O65A 3ORJA 2LW8A 4DUXA 2GH2A 1XNKA 1YFYA 3I8TA 4UAPA 5BNOC 1RHI2 3RNSA 1PVC3 2VCMA 3NKGA 3NNFA 4CCOA 2XJVA 2R061 3VKOA 2E7QA 2VOTA 2JG8A 4CXWA 4EN6B 3CLPA 3URFA 4PCRA 3VN4A 1RUD1 3MEPA 4W6XA 2XG3A 1ULFA 2ARXA 4C0BA 4NIDA 1E57A 4FPCA 5KWRA 3DGTA 1N1VA 4JVAA 1VB4A 2CDPA 1GANA 2BGPA 4QGMA 1WLWA 2VUCA 1CZVA 3OG2A 3VD9A 1AR82 1S4CA 4RS5B 5DDJ2 4G9SB 4XF3A 5HCFA 1OI6A 4Y24A 1DF0A 3HJRA 5E1RA 1OLME 2P4EA 3A0NA 4O9GA 1PX4A 1J83A 4PDWA 3OYWB 3RZMA 1IZ3A 1DG6A 1U5ZA 5BPXA 4YM2A 3VBRA 3WQ0A 4IERA 4CP9A 4BK5A 5FYSA 3BOWA 1Y9GA 1JUHA 1K3IA 1N1YA 2BPA2 3TOJA 2CDOA 4JZRA 1DZRA 3FBYA 4D0QA 1VBA3 2PA7A 3IMMA 2VVEA 4KG8A 2YV8A 1LKNA 2R043 3M3QA 2WNUC 1AXYA 1GZWB 2YY1A 4META 1V6LA 4GB31 1PGW1 1W6OB 2C4XA 2Q30A 3E97A 5FZ1A 2NM1A 1FX5A 4DFSA 1W8TA 1N3QA 2E53A 5C8CA 4H14A 2B46X 1BHGA 3H1MA 5FZ7A 2W08A 3O14A 2WFF1 4W6WA 1EV12 2PLV1 3LPGA 3QACA 5KHHA 1OBNA 5I91A 2ZGTA 4BXSV 4XURA 5A3MA 1RJ7A 1ZBA2 4N53A 1REFA 1W0PA 5HPOA 1VIWB 3HPNA 5DZEA 1ULDA 1G9AA 1YYNA 1SZBA 4QPYA 1MZEA 3IMNA 4Q0QA 1AF9A 2ORXA 5JPMB 1XYPA 4UXAA 1I1EA 1KQRA 2RMU2 3B01A 4KI5M 2A1XA 3AMNA 2VQTA 5IUQA 5HI0A 3ZN6A 4LLOA 2Q8OA 2Y0IA 1VMJA 3NJZA 1GOHA 2R49A 5L36A 3M3CA 2LALA 4E9KA 1OUSA 1R1A1 2GN7A 3BALA 3WF2A 1H8TB 1V6OA 1PVC1 4Q4Y1 3POEA 2WNEA 2XWBB 3WF1A 4YG3A 3V0BA 2KXLA 1W8UA 2J1VA 1RUC1 1Q8PA 4XC9A 4A42A 4M4RA 5KXDA 1VRH3 4OHVA 3F2ZA 2HWB2 3J4UH 4NAMA 4UWDA 4QM9A 3WV6A 4JGZA 2RS52 3MF6A 2GNMA 4GKYA 2DCTA 5L9VA 4AI2A 1LOEA 1QEXA 2Q0AA 4UFKA 5A3TA 5CFCB 4IXLA 4NE9A 2Y64A 1NLQA 5K8SA 4CE8A 1XBFA 2QE3A 3EMRA 2CAUA 2WINB 3OOXA 4QM8A 1PO12 5FFOC 2BBVA 1VBC3 1I3HA 1H6XA 1RL3A 2C1FA 5FIXA 1VBE3 3C2UA 5JDBA 4Y4RA 1C8M3 1L7QA 3WQBA 4OI1A 5G05L 5EJ1B 4K8RB 1YQ8A 5FP9A 3O1PA 4RN5A 1OQ1A 4TLGA 2XJSA 1CZSA 3M3EA 5LRRA 1VBA1 4ZKTB 1JYNA 4LKSA 2R041 4LHLA 2GMMA 2JKXA 5FZIA 4JGYC 5A3WA 3HN3A 4AI3A 5DUVA 2JWPA 1BXHA 2VMDA 1FNZA 1OLMA 2O0OA 1I6XA 2EXKA 5FXWA 4CXXA 2NMOA 3CF6E 3R0RA 4FTSA 3AJYA 1KITA 1W6MA 3T2QA 4ASKA 4CDQB 3PVNA 3T2OA 4MGIE 2VMIA 1VPHA 1UQXA 2R072 2E9QA 1AYM2 2BUKA 3MW2A 3NAPA 4GIQA 4EN9B 3Q8EA 2VPVA 4MGQA 1SLTA 1C8NA 3OGVA 5CG9A 2A6ZA 2VMEA 3MI8A 3KHCA 1OQEA 4D6RA 3FX3A 3GNEA 1YJKA 2WABA 2P34A 5IVCA 3T1MA 3MPPG 4JCKA 1OSGA 1VBB1 5IW0A 1LOFA 2VO5A 3N35A 1F8VA 3G6JB 2VD7A 3RVHA 2VOVA 3OGGA 1H4HA 4ITCA 1W6QA 4CP1A 2P5BA 1OUXA 3BVCA 1DLLA 5DQ0A 1HW5A 3VZKA 3HD8B 3LA3A 4DEQA 1TQ5A 5IFTA 4K7JA 5LCWL 2W1QA 5JSOA 1V70A 1WUVA 5DMYA 2XHKA 4BMBA 3EXUA 2JD4A 4TSVA 3WW3A 3GALA 3M1HA 2L9LA 3L2YA 5T50A 1VRH1 3AFKA 4FQ4A 4Q1RA 4RR3B 2J1AA 4PF1A 2MNGA 2WWUA 3FLTA 3DXUA 4RQPB 4NN0A 3RZLA 5FXVA 2HYKA 2ZCWA 4P5YA 3WW2A 5SV8A 2V72A 1OXCA 1CX4A 5FUIA 3GYDA 1C1LA 3VHOA 4ZS2A 2JEMA 3WDTA 1XU1A 3AZWA 4TWTA 5CFDB 4OI4A 3JD71 1RMU3 1FOD2 2QQMA 2VCCA 4P9JA 5FY7A 3RSJA 4CCKA 1VBC1 4LXLA 5A33B 1VBE1 2QQIA 1BBT3 2ZAHA 5FXXA 4YVSC 4HSJA 3CDZB 2YBKA 3E1F1 2BFUS 1E5IA 4W50A 2CGPA 4I02A 2R1BA 3JBG3 3RJ2X 2KA3A 3OBRA 5K0UB 4A44A 4ZHNA 1IG0A 3AYDA 1QF3A 4LQRA 4LE3A 2O8OA 1ALYA 5CU1A 2R062 4JTOA 2WAAA 4YGEA 4Q5OA 2VBBA 3SNMA 5KXEA 2BOJA 1W6OA 3WCSA 2XJRA 5FZ4A 2EAAA 4FPHA 4CYDA 5I0DA 1UWWA 2WO7A 2JDAA 1A78A 1CJPA 2FCVA 4HBNA 2BJSA 4FP3A 5DZGA 1NY71 1LODA 3KV9A 1FAYA 5T5LA 3UGFA 4OYUA 5FZ9A 3A7QA 3SH4A 5A3LA 3JB4C 3LFIA 1DFQA 2UURA 4GJYA 2DDUA 2FHRA 2W87A 3I7DA 4AHZA 4NHYA 3LE0A 3ZKYA 1KFUL 2E26A 4XTMA 4Y5Z0 4AVCA 1TMF3 4BQ1A 5IK7A 2VZSA 1PGL2 5KR7A 3AXDA 1YEWA 3VDDB 3MFCA 2W94A 4IV1A 3H8RA 1ND2B 5FYBA 4XQDA 1G9DA 1WCUA 3NL1A 1CAWA 1YQCA 2XL9A 4HKOA 4ZU5A 3LDKA 3WQ1A 2NN8A 5GZCA 3CBNA 3MFAA 4M00A 3D0JA 1D0GA 2DCZA 3BI3A 5GALA 4FFIA 1IKQA 4XFBA 4CDWB 2XQRA 3VV1A 1MQTB 4MYEA 2VUDA 1K5MA 3KV4A 4CSWA 3POGA 4LUKA 2IXIA 4Y33A 3SMHA 2J42A 1H2LA 4LMFA 1UY4A 1VLNA 2WQZC 3LIHA 3KHBA 3W5NA 1TE1B 2AEYA 3POJA 1X33A 3USSA 4Q4W1 4BMEA 5F3EA 2JDUA 4LA2A 2JE9A 1RMU1 3CJIA 4Q0UA 4S2DA 4XUNA 1M06G 3ATGA 4AQTA 5M0TA 4AL9A 2JDYA 4DPNA 3C7FA 1BBT1 2ZAAA 3N7MA 5I0RA 2X5IB 3KT4A 2UWBA 4KU7A 1MEC3 5LBFA 1X9PA 3VBFC 5KC6A 3H8XA 4Y5TA 4O61A 4DRVA 3JBG1 5JI7A 5DXDA 2WUHA 1ODMA 1MS9A 1R1A2 2DUOA 4R9AA 5IHRA 4DUWA 4QPGB 4XW3A 5BNOB 3S5AA 5LWBA 5GKAC 3ES1A 4HANA 3UL2A 1RUC2 2DUPA 4BQXA 1E5HA 3RI8A 1UY3A 3K2OA 2PHFA 1QIQA 4QGLA 4CDQA 1O6UA 4KWJA 3HMYA 3ST7A 3MBWA 1O3RA 4AYUA 2IFRA 2W1WA 4LBNA 5FLJA 2ENRA 4Y1YA 5A7QA 4AQ6A 1YFWA 2D6PA 4BE3A 5CADA 3ZPYA 4CU8A 2YZ4A 4XMAA 4EYUA 1UKGA 5FKCA 5FYVA 2PQQA 3LWCA 4HN0A 1TMF1 2ZGPA 5A3PA 3ZXJA
chains in the Genus database with same CATH topology
4UT5A 5A6ZA 2JDNA 5HCHA 2WRAA 1OURA 1GZTA 5A70A 1OXCA 2JDKA 2JDUA 1W8HA 2BOJA 3DCQA 2JDPA 2JDYA 3ZDVA 2JDMA 4AOCA 5A6YA 2BOIA 5A6XA 2WR9A 1OUXA 2VUDA 1W8FA 2JDHA 2XR4A 5A3OA 4CE8A 2BP6A 2VNVA 1OVPA 2VUCA 1UZVA 5A6QA 2BV4A 1OVSA 1UQXA 5D2AA 1OUSA 2CHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UT5 A;  5A6Z A;  2JDN A;  5HCH A;  2WRA A;  1OUR A;  1GZT A;  5A70 A;  1OXC A;  2JDK A;  2JDU A;  1W8H A;  2BOJ A;  3DCQ A;  2JDP A;  2JDY A;  3ZDV A;  2JDM A;  4AOC A;  5A6Y A;  2BOI A;  5A6X A;  2WR9 A;  1OUX A;  2VUD A;  1W8F A;  2JDH A;  2XR4 A;  5A3O A;  4CE8 A;  2BP6 A;  2VNV A;  1OVP A;  2VUC A;  1UZV A;  5A6Q A;  2BV4 A;  1OVS A;  1UQX A;  5D2A A;  1OUS A;  2CHH A; 
#chains in the Genus database with same CATH topology
 3G7D A;  1Q8S A;  2WNV C;  3JQW A;  2ZKN A;  2WDB A;  5C9A C;  4UW4 A;  3L2H A;  3NJX A;  1GYK A;  3I2F A;  3FL7 A;  4YW2 A;  4DS0 A;  2H0V A;  3H3U A;  1R08 2;  4AVV A;  1OLR A;  1YQ6 A;  4LR4 A;  1I5P A;  1QJX 1;  2W1U A;  2Y26 A;  2JDK A;  4JKK A;  4Q0V A;  3GF6 A;  4BH9 A;  1SLB A;  3FC0 A;  3JB8 A;  3SKV A;  4H2A A;  4K8F A;  2D3P A;  2Z2S B;  5FRA A;  1EP0 A;  2WT0 A;  3U78 A;  4DEV A;  1YWK A;  3ZYF A;  4MV2 A;  1C1F A;  5A6Y A;  3D0S A;  1MS3 A;  5LW9 A;  3UKV A;  3QH7 A;  3VUO A;  2ZGR A;  2G9F A;  1V00 A;  4PJY A;  4B4R A;  2A75 A;  3RPQ A;  1X9T A;  3NMB A;  1DGR A;  1EAH 1;  1WZX A;  2FDK A;  1NCR B;  1HN1 A;  3OEB A;  4P02 B;  5JIU A;  3HNM A;  4KGQ A;  3TEW A;  3GBW A;  5J98 B;  3WP4 A;  1AR7 1;  1OA3 A;  4XZU G;  1US3 A;  4ZU7 A;  3TAY A;  3ZN5 A;  1W6P B;  4HET A;  4MOA A;  1UYP A;  2ES3 A;  3PUQ A;  4WVV A;  1VBB 2;  4A7Y A;  3LF7 A;  3O0X A;  4LK6 A;  5E88 A;  3VD3 A;  3FWE A;  5LRS A;  3POI A;  1QJZ A;  1UU4 A;  4HPK B;  3WP3 A;  4AOC A;  2B4K A;  3O1S A;  3I2O A;  4M0N A;  5IWF A;  1UMH A;  1JYX A;  2BVB A;  1H0B A;  3BCW A;  3V0A B;  2RM2 3;  3AP9 A;  2VZV A;  3I49 A;  2BDR A;  4NPM A;  2VE1 A;  2VMC A;  1FV2 A;  5I8T A;  3WF4 A;  3VBS C;  4A7K A;  2EIG A;  2VZT A;  3ABZ A;  3TEX A;  5ABJ A;  1W06 A;  1HB4 A;  1HX6 A;  4YW7 A;  4Y3O A;  5FPB A;  4I2O A;  2VZU A;  2D98 A;  4I09 A;  1ND3 B;  2ZZJ A;  1LHV A;  2DVG A;  5FYY A;  4CUB A;  4DXR A;  4UW5 A;  2D97 A;  4XCB A;  3WSO A;  1CVN A;  1JOB A;  1SCS A;  4KNC A;  5L73 A;  4BB3 A;  1RUF 3;  1ENQ A;  3AYA A;  5F3G A;  4OQ9 A;  1AX0 A;  2GNT A;  1N3P A;  2W52 A;  3JD7 2;  4GH4 A;  2Y33 A;  4PLO A;  1SBD A;  2A6V A;  5LAS A;  3N36 A;  1LRH A;  5BNN A;  4N90 A;  5LZ6 A;  4BPZ A;  4MSV A;  4J1X A;  4XEZ A;  1LEM A;  3DKW A;  4PLM A;  4ORF A;  5L19 A;  5ANN A;  4K40 A;  3VZJ A;  1OA4 A;  4XF9 A;  5FO8 B;  2VAU A;  1QJU 1;  2P37 A;  1ZZ8 A;  5EYX A;  5JZG B;  2XUM A;  4MXW B;  3OBA A;  2ZA9 A;  1WMF A;  3IDB B;  3U10 A;  2UWC A;  1BQP A;  2YC4 A;  1N1S A;  1O4Y A;  3ACH A;  4WV8 A;  4COZ A;  2VGD A;  3ZFF B;  4AGR A;  1JYW A;  2E6V A;  2JG9 C;  1H1M A;  5FP8 A;  4QB6 A;  2PEL A;  5FYM A;  2OX0 A;  3JUU A;  1QJF A;  4ONU A;  1DQ0 A;  4MVT A;  2RJ2 A;  3ZSK A;  5I0T A;  4CDW A;  1SPP A;  2WJS A;  1GNZ A;  2R0F A;  3AP5 A;  4GD4 A;  5CB7 A;  2WLP A;  3ZFE B;  4CU9 A;  5IAT A;  1HRV 1;  1IS6 A;  2A3Y A;  2YU2 A;  4NRO A;  4YGC A;  4WVZ A;  3F95 A;  2RR1 1;  2BFU L;  4HG6 B;  2WZR 3;  4LOR A;  4WM8 C;  4COW A;  4QPI C;  5FRE A;  1QNW A;  3GHM A;  1PNG A;  3M70 A;  1OOP C;  1V9U 3;  5F3I A;  5FLH A;  2Y6G A;  4KBB A;  2W47 A;  3ZIW A;  4W65 A;  3PUH A;  3TRS B;  1JN2 P;  1W3V A;  2SBA A;  2ZAC A;  4OUL A;  1EUT A;  3I97 A;  4FPL A;  4R4X A;  4XMI A;  4P9W A;  2X5I A;  3BYW A;  4QQL A;  2IUW A;  4FP2 A;  1PGS A;  1GKB A;  1VBD 3;  1OLQ A;  3HWJ A;  3GZE A;  5C6C A;  1FV3 A;  2HJI A;  2RM2 1;  4UFJ A;  3MHZ A;  4M3C E;  4LLF A;  3BTA A;  2ZEZ A;  5D8A C;  3BU0 A;  2JG8 B;  3ACI A;  3HN1 A;  2ARB A;  3B00 A;  4JX0 A;  4QKD A;  4IV3 C;  5BNO A;  5FMO L;  4IET A;  1J59 A;  5FCC A;  1ENX A;  4A6S A;  1SHW B;  4UT5 A;  2HWC 3;  1QXJ A;  5T5J A;  3ZM8 A;  1RUF 1;  1CAV A;  4E27 A;  1QNY A;  1SLL A;  2R0H A;  3APB A;  3KVB A;  4EWE A;  4Q4W 2;  2PHW A;  5C33 A;  4RHV 3;  3T2P A;  5BUV A;  1O8P A;  4JDO A;  5FP3 A;  4PDW B;  3P3N A;  1ZBE 1;  4XF1 A;  2I45 A;  2H6C A;  2VMH A;  4K6B A;  1Z7S 3;  2VM9 A;  3VBR B;  3E6C C;  5BNP C;  4CP9 B;  2VW1 A;  1E5S A;  2UWA A;  3P1I A;  4I0A A;  2B9U A;  1Q5O A;  3WCR A;  2D43 A;  1IPK A;  2GC1 A;  4CUA A;  4CRQ A;  1HV1 A;  4XBL A;  2VQU A;  2QQV A;  4Y26 A;  3USU A;  4DQA A;  2VZP A;  3R4D B;  4FPG A;  1VMH A;  2XB6 C;  4TLF A;  1QDO A;  1PZ9 A;  2B9V A;  4NHM A;  2WNU A;  5JSR A;  1GOG A;  1HB3 A;  4HKW A;  4K1Z A;  3U4S A;  4XFG A;  3ZXL A;  5C8C B;  1K45 A;  1WMD A;  4BQ4 A;  4PIY A;  5JOZ A;  2AEN A;  2GN3 A;  3H0O A;  4NIG A;  3J7M A;  4AR2 A;  4Z92 B;  5DAP A;  1F15 A;  3HQU A;  3NQH A;  3ILF A;  4XXP A;  1PHM A;  3E5Q A;  2WBK A;  1A6C A;  2JD9 A;  2RS1 3;  4LT5 A;  4N53 B;  1J3P A;  1BEV 2;  4I3P A;  5FZC A;  1AJO A;  3PVO A;  1YFU A;  4NIA A;  4FXK B;  3FFQ A;  1DGW A;  2D44 A;  1LR5 A;  5CAZ A;  1QJE A;  1QJY 2;  3GM8 A;  4Q26 A;  3TEY A;  2Z69 A;  5T3N A;  2XJT A;  1W6P A;  3PUI A;  3ZN6 B;  5DAB A;  5JOW A;  2PAK A;  4C1X A;  1NXD 1;  4UF0 A;  2WAO A;  4Y1X A;  3KV6 A;  1VBD 1;  4K9S A;  2QQN A;  3W58 A;  1IS5 A;  1S0E A;  1QJX 2;  2KM2 A;  1VAM A;  5F9T A;  3V0B B;  4D7T A;  5JOY A;  2W95 A;  3V56 A;  2W9X A;  3DN7 A;  1KJR A;  1YQ2 A;  1AYN 3;  1QDC A;  4KWL A;  2P3Y A;  3BOP A;  4HLT A;  1HRI 2;  5FPU A;  2XWJ B;  4DO0 A;  1IQA A;  1XNA A;  2PFW A;  3UT0 A;  4QQO A;  1XE8 A;  4WM7 C;  5CBL A;  1EAH 2;  1W6N A;  3NJV A;  3OD0 A;  5FZD A;  2CSG A;  2XVG A;  5F39 A;  1HKD A;  1V6N A;  3DEC A;  4M3C A;  4RHV 1;  2YPJ A;  2BTV C;  4XJU A;  1RUG 3;  2ZGL A;  1OFS A;  1PM7 A;  1TVG A;  4XET A;  4XQW A;  4Q4V 2;  1W2T A;  4C91 A;  4OCT A;  4ERO A;  2JKB A;  1AR7 2;  5CG8 A;  3GZU C;  2UYB A;  1Z7S 1;  3MID A;  2EID A;  2MHF A;  4F83 A;  4FPE A;  2RVA A;  4PLN A;  3POF A;  3TB0 A;  3IB3 A;  4S2F A;  1S0J A;  5A7O A;  3BTY A;  3AVR A;  1WW5 A;  2EAK A;  1SFY A;  4BCU A;  3D3A A;  5FBJ A;  2QBX A;  4K21 A;  5H9S A;  1H2M A;  3WX5 A;  2EIB A;  1WME A;  4HL0 A;  1CGP A;  5E8A A;  4Q0P A;  2XJP A;  4JGY A;  1HXS 3;  1W6M B;  1YJL A;  4XUO A;  1OF4 A;  4YAR A;  3WG2 A;  3WP6 A;  5HCB A;  3VBH C;  4B8E A;  2WRA A;  5FP4 A;  3LDB A;  5FZ8 A;  4ARY A;  4BU2 A;  4R8H A;  3N3H A;  3FUO A;  5JI9 A;  3NAP B;  4IL7 A;  1EY2 A;  1XOY A;  4YG6 A;  1NLR A;  2C9A A;  2RS1 1;  3VKL A;  3WNO A;  4NPR A;  4FFG A;  4AFC A;  4BQ5 A;  1H6Y A;  4YGD A;  2D3R A;  2A3W A;  4GWI A;  2PMW B;  4LKF A;  4MO3 M;  5D1I A;  5FPV A;  5FZO A;  5FUP A;  1GNY A;  2VQA A;  3MIH A;  2ET7 A;  4O9E A;  3WD5 A;  2WQ4 A;  1DU3 D;  3DXT A;  2VL4 A;  1YI7 A;  2WYS A;  3EHK A;  3EQE A;  2J22 A;  3PL0 A;  4PQ9 A;  3N9P A;  2Q8C A;  1GWL A;  4PQQ A;  1W6Q B;  1QJU 2;  2YGM A;  2WNV B;  2RDQ A;  3MUY 1;  1QU0 A;  1CPN A;  2Q1Z B;  1G9F A;  1ZRC A;  5DN2 A;  3ZXE A;  5C5T A;  1OUR A;  2LS6 A;  4YNI A;  2WLQ A;  3PU3 A;  3U1X A;  4EWA A;  3RZH A;  4BIF A;  2FMD A;  3UV9 A;  1JYC A;  1ZX5 A;  2VVD A;  1TNF A;  1DIW A;  4M3C F;  1UYZ A;  4EWD A;  1O5L A;  4IW3 A;  1AYN 1;  3ACL A;  2FDH A;  5BNQ A;  4HOO A;  3T30 A;  4AAX A;  1PNF A;  4XJ9 A;  2F6B A;  2XVL A;  1RJ8 A;  1GQG A;  3HOB A;  2VZO A;  1IHM A;  1MS5 A;  1ULP A;  2WWJ A;  4RA0 A;  1HRV 2;  4JHZ A;  2DWR A;  2R16 A;  4CP0 A;  2UU8 A;  4KU8 A;  1JZ3 A;  1COV 2;  2RR1 2;  1MZ5 A;  2NLR A;  5CYY A;  3RZZ A;  2WQ8 A;  3EBR A;  3FZ3 A;  3A0K A;  3AXE A;  3WQ7 A;  5C3P A;  1RUG 1;  5KHI A;  3PLQ A;  3J8F 2;  1NX9 A;  2HWF 3;  1CD3 G;  1YLL A;  2ZS6 B;  4XVH A;  5J7M A;  3S7E A;  1UMZ A;  1JZ2 A;  3AKQ A;  4X8P A;  4AXO A;  2LUW A;  1PM4 A;  4CDU B;  3B7M A;  3MLJ A;  3I59 A;  3WDV A;  1XYN A;  4YZ1 A;  4AGG A;  2HWD 1;  4YVS A;  3CO2 A;  3RS6 A;  3UES A;  2VVF A;  2RS3 2;  2XL7 A;  4Y20 A;  1DGL A;  3CQO A;  2BYV E;  3AVS A;  3OY8 B;  3ZSM A;  5JMC A;  4P9I A;  2IC1 A;  4Q4X 3;  4C0H A;  4AED C;  3T1L A;  5DUW A;  3SIT A;  4N43 C;  4ATF A;  2WSU A;  4YFW A;  1HLC A;  2WT2 A;  4JTN A;  4JAA A;  4XJA A;  5CKM A;  4A6O A;  2C26 A;  2WKK A;  2DCJ A;  2R1D A;  1NE6 A;  4XF4 A;  1H4G A;  5F8P A;  1SAC A;  2ZTN A;  3O12 A;  2SLI A;  1SLC A;  2ZX1 A;  3MW3 A;  5AFE A;  4XXA A;  3D82 A;  4CEW C;  2JB8 A;  1R08 3;  5EPA A;  4YGB A;  1RUH 3;  1OKQ A;  2TEP A;  3AKS A;  4ZXE A;  3IT8 A;  1FPN 3;  5C7G A;  1ZNP A;  1TNR A;  4AFA A;  4MHU A;  2DV9 A;  3CJX A;  4IE7 A;  4IV1 B;  1DQ4 A;  3PTY A;  1QQP 1;  3ROU A;  4CDX C;  3R05 A;  1ASJ 1;  2ZXQ A;  3I3M A;  1UO9 A;  3PIG A;  2BGC A;  4XFC A;  4NII A;  1CAW B;  1CJD A;  3H42 B;  2D93 A;  4BHP A;  2BWA A;  2NPI A;  4AG4 A;  2DBI A;  2A3X A;  1FMD 3;  1SFN A;  2O8Q A;  2WN2 A;  5D21 A;  5I8Y A;  1FT9 A;  4XDO A;  1FAT A;  1U0A A;  1JI6 A;  2GC3 A;  2TNF A;  3ZYP A;  4AZZ A;  2VTX A;  4ZZ8 A;  3ZSJ A;  2DU0 A;  2ZX4 A;  1BMV 2;  4Q8L A;  1K5M B;  1S2B A;  1CIW A;  3FN9 A;  2X29 A;  4YM0 A;  2FDG A;  1LCL A;  5FXZ A;  1LEN A;  2OT7 A;  3NVC A;  2K2S A;  4XAB A;  1J84 A;  1QH6 A;  1UNB A;  3T08 A;  1PO2 2;  5AC9 2;  4CU7 A;  2XHN A;  1MS4 A;  3MGU A;  4MGT A;  5T5P A;  1UX7 A;  1A8D A;  1B35 C;  1RUI 3;  4UW3 A;  3CJI B;  2VCA A;  1MPX A;  3PUS A;  3QOP A;  4XYX A;  5FZA A;  2WO2 A;  4NRM A;  2PHX A;  5KC5 A;  1S55 A;  3VBU C;  4ASM B;  1OOP B;  3LGR A;  4OQ8 A;  3I3Q A;  1ZRF A;  2WS9 2;  1SBE A;  5ISL A;  2V5Y A;  2QQU A;  1Y43 B;  1NCQ C;  1NUK A;  1GU3 A;  3M8L A;  3ZFG C;  5ACA 2;  5L9R A;  2AH2 A;  3VBF A;  2X09 A;  5JUV A;  4L92 A;  3RRD A;  1ZZ9 A;  1AUY A;  4XJZ A;  3OUI A;  1HQN A;  4QU2 A;  2E7T A;  2IZW A;  3B02 A;  3HQR A;  4QXB A;  5ERL A;  1YCI A;  3AKP A;  3VBO C;  4IEQ A;  4Q27 A;  4OZX A;  4PI2 A;  3LFM A;  1LHW A;  3SXW A;  4H7M A;  4QT6 A;  3TN9 3;  5C4W C;  4N9H A;  4XPV A;  1ZRD A;  5LBB A;  3RYP A;  3O1U A;  4AVT A;  4Z2W A;  1WW6 A;  2VUL A;  3NV2 A;  3ZYI B;  5IK5 A;  1RUJ 3;  3R6S A;  3H9A A;  4P9G A;  5HXM A;  1UAI A;  4CEY C;  5T5O A;  2XPJ A;  4XCA A;  1AL2 3;  1GQP A;  1MVQ A;  4XFI A;  1W3X A;  1RUH 1;  1DQ6 A;  4NWV A;  5F7U A;  5IAX A;  2E63 A;  3T4H B;  3U11 A;  4AVS A;  4ZON A;  4Q8K A;  2JX9 A;  2A71 A;  2KD7 A;  1NG0 A;  3PU8 A;  3RYK A;  1D4M 2;  3P6B A;  5IK8 A;  3KMH A;  1Q8V A;  2UYA A;  2OS2 A;  2JE7 A;  2UY8 A;  2WNV A;  3VD5 A;  4AAP A;  5C9A A;  5J1X A;  3POY A;  2EIC A;  2I74 A;  1J3Q A;  1JH5 A;  4NAO A;  1BVP 1;  1FMD 1;  2GAU A;  2VU9 A;  3OB8 A;  3SH5 A;  5FR3 A;  4E4D X;  2QVS B;  2VW2 A;  3AFG A;  5T54 A;  2LRO A;  1PZ7 A;  4EV0 A;  2OA2 A;  4YVW C;  1EPZ A;  1NAE A;  2PHT A;  1STM A;  4UFH A;  2E33 A;  2XBO 2;  3T0B A;  2ID4 A;  2J1R A;  4BJ0 A;  3OPZ A;  4QXH A;  2VZR A;  1F5F A;  2ORZ A;  4PIZ A;  1DYP A;  1RUI 1;  1PIV 2;  3O1V A;  1IS4 A;  4CZS A;  4JHT A;  3IDA A;  4IQP A;  4YYO A;  1JYT A;  2H6B A;  4HVO A;  4K3U A;  4D7Y A;  2OQ6 A;  2OW4 A;  1GV9 A;  2YPD A;  1C8M 1;  1Z78 A;  4P00 B;  1AZD A;  1H1A A;  2RJK A;  3PUA A;  1AXK A;  4M0H A;  4CCD A;  2J1S A;  3TYJ A;  2Z42 A;  1ZA4 A;  4CDU A;  1RVF 2;  1POQ A;  2EXJ A;  3CNA A;  3LSD A;  3SEP A;  5G04 L;  3V65 A;  1UL9 A;  5A32 A;  1LHO A;  2GNB A;  5FLI A;  3OY8 A;  1AXZ A;  1W39 A;  1RUE 3;  2HKX A;  5ABJ B;  1LES A;  1U5Y A;  1UYY A;  1W05 A;  2HWE 3;  3B3Q E;  5FPX A;  3KQR A;  3FLR A;  1C5H A;  3VBS A;  3WUD A;  3TN9 1;  4BLI A;  4E2Q A;  1RUD 2;  5B4N A;  3BIE A;  5FPL A;  2X8K A;  3ACF A;  2YC2 A;  3M7A A;  4V1P A;  1K12 A;  3K3N A;  4TYS A;  1REE A;  5EXO A;  3MYX A;  5FMC A;  1AL2 1;  1SMV A;  3LCP A;  4FAG A;  5J36 A;  1MAC A;  4GH4 B;  5IYY A;  1W9T A;  4FO9 A;  1Q8Q A;  4AI9 A;  4DIN B;  1YC6 1;  1NQD A;  4YW4 A;  3UGG A;  5BNN B;  3O0W A;  3DYP A;  4CXY A;  3UNP A;  3KF5 A;  4EN0 A;  2YBP A;  2N7G A;  1PK6 C;  3AMM A;  3CIH A;  5CKQ A;  4MUV A;  5E6H A;  2ZX0 A;  1ULG A;  2V4V A;  3K48 A;  2DVD A;  4IGQ A;  4K20 A;  3VKF C;  2QKD A;  3GJB A;  1V6J A;  5JIA A;  1RC6 A;  1ZZ6 A;  1OD5 A;  1FYU A;  4JC1 A;  3WEZ A;  3PVB B;  2BP6 A;  4GB3 2;  3UKN A;  4Y5S A;  1AR9 3;  1PGW 2;  3IDC B;  4LIT A;  3WNN A;  1SPP B;  2C0Z A;  2YFZ A;  2JG9 A;  1GBG A;  5JVV A;  3JXS A;  1DP0 A;  1WMX A;  2DFC A;  4QHO A;  3SCG A;  1TG7 A;  3SLI A;  1VAK A;  2WFF 2;  2WYF A;  2PLV 2;  4QPW A;  3NNL A;  1SG3 A;  1X7N A;  3I2G A;  1W9F A;  4OHX A;  4Z82 A;  5IAV A;  4R4Z A;  5F1R A;  4RD7 A;  1BVV A;  3VDB A;  1RUO A;  5DAV A;  1GP4 A;  4RGK A;  3UJQ A;  5H9P A;  4AI8 A;  4E8D A;  3A22 A;  3B94 A;  1WW4 A;  3U14 A;  1Q8O A;  2VC9 A;  1LEC A;  1TME 3;  3DKQ A;  3H50 A;  4QPI A;  4WM8 A;  2NZ9 A;  2XQX A;  5GLW A;  5JXJ A;  5H9R A;  1OOP A;  3JU9 A;  1QQP 2;  5FZB A;  4I3G A;  1WKY A;  1IOA A;  4A41 A;  4CCN A;  1ASJ 2;  3UK9 A;  2Y38 A;  4OFG A;  1ZZ7 A;  4GKX A;  3O1M A;  2E31 A;  2ZHL A;  2FZ2 A;  3LZZ A;  3ETP A;  2H0B A;  5B2G B;  3KM5 A;  4SLI A;  1DQ5 A;  4FSJ A;  4Q4Y 2;  1PVC 2;  4DY5 A;  5FYZ A;  1RUE 1;  4S2G A;  1NZI A;  2PTM A;  1Z0H A;  3B69 A;  2HWE 1;  3KS7 A;  5D8A A;  1LJ7 A;  1W99 A;  4A4A A;  3ALQ A;  4FTB A;  1IPS A;  1GOF A;  2W91 A;  1H1I A;  4GMP 3;  4IV3 A;  1OT5 A;  1KEX A;  5IJR A;  1HB1 A;  4IEU A;  4X6R B;  1C5I A;  3K4D A;  1CAV B;  5FZM A;  5HV4 A;  4PIX A;  1LTE A;  4XAE A;  1P8J A;  3BUC A;  5T55 A;  5JXI A;  3FFZ A;  5FPA A;  3WOG A;  2A6W A;  2X53 S;  1LU2 A;  5FZG A;  1JW6 A;  1JUI A;  2DVA A;  1QGL A;  2Y60 A;  3NV1 A;  5FPZ A;  4QXC A;  3MW4 A;  1LUL A;  1AR6 3;  3KGZ A;  2NP0 A;  1UPI A;  3E6D A;  3SEE A;  2JDN A;  4DNY A;  3MF9 A;  4OHZ A;  1G8W A;  3WVJ A;  1EPW A;  1SEF A;  5JCT A;  4XOG A;  3USU B;  1Y4W A;  4NJ4 A;  4ZS3 A;  1R09 3;  1UZZ A;  2Z79 A;  4R9D A;  4YW3 A;  1VBA 2;  2MEV 3;  4KQ7 A;  1J58 A;  4LBQ D;  4QKF A;  4LO7 A;  4CUG A;  2R04 2;  2Y34 A;  4L0P A;  4DUV A;  1UOB A;  4LE4 A;  5TSW A;  1ENS A;  1CWP A;  3Q8F A;  1U5I A;  3WNK A;  4P9L A;  3AL6 A;  1A3K A;  1D2S A;  2WNU B;  5FWE A;  1JZ8 A;  1PZ8 A;  3T2T A;  3D8C A;  5ANQ A;  3ITQ A;  5C8W A;  2BZD A;  2PAE A;  3VDC A;  5IVY A;  1H8V A;  1LU1 A;  2C5D A;  2OYZ A;  3ZR6 A;  5I93 A;  4AHY A;  4C1W A;  1S1A A;  3IKW A;  4AFB A;  4NRP A;  4Z8B A;  4AFM A;  3DPR C;  4ES9 A;  2F4L A;  4ES8 A;  3MPB A;  1XND A;  3JCI A;  4FFF A;  4AI0 A;  4QB2 A;  3NKT A;  5HCH A;  1VRB A;  4FPK A;  1Y7B A;  4OLL A;  2ZBJ A;  2B8M A;  3RYR A;  1RHI 3;  4HK8 A;  2FBE A;  1UY2 A;  1MEC 1;  1XYO A;  2ZZQ A;  4KH9 A;  2XH6 A;  4M4P A;  4MHR A;  4UF0 B;  5F6L B;  4BQW A;  4XBQ A;  5BYN A;  3NNM A;  1ZM1 A;  3ON7 A;  3ZR5 A;  1Y3T A;  4FFH A;  1MS0 A;  2K46 A;  3KLS A;  2IXL A;  3FE5 A;  4PBP A;  4YM1 A;  3AP6 A;  1TZO A;  4AF9 A;  1OH4 A;  4D69 A;  2XDV A;  5GZE A;  2ZAB A;  4COU A;  5A6Q A;  4RS5 C;  2K9Z A;  2OUH A;  4NOT A;  1WW7 A;  1SDW A;  3BGA A;  3MUZ 1;  4XAA A;  4W6Y A;  1AR8 3;  5FAX A;  5DDJ 3;  2OKX A;  3HQX A;  1UXZ A;  1LED A;  1VRH 2;  1WWY A;  4JKL A;  3WY6 A;  5EIY B;  1OD3 A;  2R30 A;  1GZT A;  4TXW A;  1Q3E A;  2A70 A;  4QWN A;  4ARX A;  3GBF A;  3J7N A;  1O4Z A;  4MXV A;  1W6N B;  4FPY A;  4XHX A;  4FQZ A;  4M3C B;  2HYX A;  2OXB A;  3M2M A;  3IWZ A;  4URA A;  4H55 A;  5C3R A;  2WA3 A;  2IXH A;  4YZ2 A;  1XQN A;  4WM7 A;  1V6K A;  4YFZ A;  4AGV A;  4I0W B;  5FYH A;  1DCS A;  4RSU A;  3VD7 A;  4XIO A;  2WFP A;  3VZM A;  4AEJ A;  2BEO A;  3M3O A;  1VBC 2;  1WLT A;  2RJL A;  1VBE 2;  2FZ1 A;  1BJQ A;  4AE2 A;  1DDL A;  1WCD J;  1C8M 2;  1BLZ A;  3AZZ A;  3HAG A;  1X50 A;  4IE0 A;  3AB0 A;  1LGN A;  4LHN A;  2VNR A;  1QXR A;  2YMZ A;  4LO5 B;  1NCQ B;  1R09 1;  2AZ5 A;  4N7U A;  5FY5 A;  3ZYR A;  3RZK A;  1O3T A;  2XOM A;  4L97 A;  1D7P M;  4NMI A;  2GC2 A;  1OH3 A;  1EV1 3;  2X10 A;  4A3X A;  4WBB A;  5CKN A;  2UY9 A;  2JEN A;  1W2U A;  2PHU A;  1V0A A;  2VUJ A;  1CZT A;  3OUJ A;  4EJR A;  4JGY B;  5FMD A;  5EZW A;  4BYY A;  1CIY A;  1Y9Q A;  1ZBA 3;  4LOS A;  1LB2 A;  2R7E B;  3MZH A;  3KF3 A;  5F5C A;  4B1L A;  2QUO A;  2RMU 3;  4QX3 A;  2VNV A;  2ZHN A;  4ZU4 A;  3VBH A;  1O3Q A;  1NY7 2;  1RIN A;  3WF3 A;  3WF0 A;  3THD A;  3BPZ A;  1YXW A;  2RDR A;  5FZO B;  1H8T C;  4FPF A;  1O4T A;  2XLF A;  1RHI 1;  2ZGM A;  1JZ7 A;  5JR7 B;  2VG9 A;  2RV9 A;  4L99 A;  1JTZ X;  1PMJ X;  2IXC A;  4Q29 A;  5LY1 A;  2FDI A;  3BPS A;  5DZF A;  2CWM A;  2HWB 3;  2JDP A;  3ZDV A;  4HFS A;  5CFC C;  2GSY A;  3TNQ A;  2RS5 3;  1D2Q A;  1ULC A;  5AC9 3;  1ZRI A;  5C3O A;  2ZEW A;  1O8S A;  2A6Y A;  2D6L X;  5DUU A;  2JDH A;  1AR8 1;  1YRZ A;  2ZGK A;  5DDJ 1;  3Q8A A;  3ZX7 A;  2Y0O A;  3PDQ A;  4JKM A;  2QQP A;  1QXP A;  1O5U A;  2ZMK A;  3E5X A;  4V2W A;  4FPJ A;  4XUT A;  1XNT A;  2A7A A;  2Z5W A;  2PAM A;  1PO1 3;  4UI9 L;  3RQ0 A;  2VY0 A;  3AC0 A;  4AEM A;  3L9J T;  3A4U A;  4AWD A;  3WDX A;  3DEM A;  5CEH A;  2D6M A;  2QQW A;  4UW6 A;  2IVI B;  3HNB M;  2RDN A;  5ACA 3;  4O7X A;  1YIP A;  1JHN A;  3FHQ A;  1J1T A;  3INA A;  5FYC A;  4UFM A;  3ZVX A;  1CX1 A;  4N8M A;  1WCQ A;  2DUQ A;  1RMU 2;  2W0X A;  4IEX A;  3PNA A;  4YW5 A;  5GJ6 A;  3V64 A;  1HDK A;  1WCS A;  1NT0 A;  2BER A;  4HSL A;  4IEV A;  2ZGS A;  5FDB A;  1BBT 2;  5EFU A;  4R9C A;  3VB9 A;  2JXA A;  4KL1 A;  3I59 B;  4A45 A;  2BNM A;  1LOB A;  2RHP A;  5APA A;  3OPW A;  4YVS B;  5C3Q A;  1JU3 A;  3JBG 2;  4Y20 B;  2QJV A;  2YU1 A;  1GP5 A;  2Z4F A;  1DGW X;  2JDZ A;  4L11 A;  4CVU A;  3MO4 A;  1C28 A;  4MGS A;  2R07 3;  4YW6 A;  1AYM 3;  3KCY A;  5FY9 A;  4EZH A;  3FLP A;  2AGS A;  4HT1 T;  1WBF A;  4WVM A;  3ETQ A;  3MV0 1;  1ZBA 1;  4AED A;  4J6G A;  3H3L A;  5FV3 A;  4N43 A;  5CA6 A;  5EP9 A;  1GWK A;  2QFE A;  4AEK A;  5IFP A;  2RMU 1;  4Q1P A;  5FKB A;  1J1L A;  2DUR A;  4OHW A;  1W8O A;  4BQ2 A;  4YWA A;  1FXZ A;  2J1T A;  2WZR 1;  2OZ6 A;  4GMP 0;  4QX8 A;  2VOW A;  4F3J A;  2Y6F A;  5EJ3 A;  1W2N A;  4LTA A;  5GLV A;  1D4M 3;  1F9K A;  2P3I A;  5CIS A;  5FO9 B;  5I0S A;  1CAU A;  1V9U 1;  2BV4 A;  4AFD A;  4CEW A;  1YO8 A;  3GZT B;  4HVQ A;  4TTG A;  5EHD A;  1TMF 2;  1XE7 A;  4RR3 C;  1CPM A;  2PN5 A;  5DG1 A;  4P5H A;  2HBT A;  4RQP C;  1HQL A;  5DAQ A;  4LUM A;  1XPW A;  2R6Q A;  3FUQ A;  3CEW A;  4U2A A;  2HWB 1;  4CDX A;  2RS5 1;  5F5A A;  1UY1 A;  1YNA A;  4N7I A;  4XFA A;  1POV 3;  2IXJ A;  4QMA A;  4I30 A;  5I0U A;  4QX1 A;  2Q4S A;  5CFD C;  1WA4 A;  3GBG A;  5EV7 A;  1V6M A;  4NHK A;  1VP6 A;  1VR3 A;  3C7E A;  3D5O A;  1JXN A;  1RB8 G;  3KV5 A;  1F4A A;  2J7M A;  5CZK A;  3VD4 A;  3PME A;  1FOD 3;  1JOD A;  1T2X A;  3H8U A;  1PO1 1;  3J9S A;  2CGN A;  2HWC 1;  1IG3 A;  3B9I A;  4E2G A;  1L3J A;  2YFU A;  3WNM A;  4YPJ A;  5JMO A;  2VBD A;  5K0U C;  1RVF 3;  2ETE A;  2B5H A;  2WSV A;  4QKB A;  4CCC A;  1UU6 A;  3OBT A;  5A7W B;  1JMU B;  1J3R A;  1I5Z A;  5L7O C;  1B35 A;  3LB9 A;  1W04 A;  5AFB A;  1W8Z A;  3R4S A;  4HXC A;  1UXX X;  4LBJ A;  1ZRR A;  1UCX A;  1MEC 2;  2R06 3;  3III A;  1JS9 A;  3AM2 A;  5FP7 A;  3VBU A;  1WCK A;  3U37 A;  4XJW A;  4EN8 B;  2GH8 A;  3SH3 A;  1X8M A;  3VBF B;  4D3W A;  3AYE A;  1W8F A;  1NCQ A;  1D0H A;  3HNY M;  3O1O A;  3ZKU A;  3ZFG A;  3C7O A;  4JDM A;  2R07 1;  4ISR A;  4NVP A;  5J48 A;  1F4H A;  1RGS A;  4URT A;  2DU1 A;  2WZP P;  3THP A;  3WG4 A;  4DMI A;  4GQ7 A;  1MS1 A;  3O1R A;  4XAC A;  2CWS A;  1NA1 C;  4B7K A;  1GNH A;  4AQS A;  1FI2 A;  1KRI A;  1ULO A;  3NJY A;  3OBZ A;  4IEZ A;  2EF6 A;  3VBO A;  4TZD A;  4AK3 A;  2CY6 A;  2OPK A;  3VDD C;  2WC2 A;  4PBO A;  3EJK A;  4B29 A;  3N9Q A;  4DY3 A;  4CUC A;  1DQ1 A;  1ND2 C;  1YQ5 A;  3AL5 A;  3O5S A;  5C4W A;  3I54 A;  4YLZ A;  3SC7 X;  1RIR A;  3LQC A;  4QXK A;  3P3P A;  3POB A;  1Q43 A;  1T6B X;  1JZ4 A;  4CEY A;  1BZW A;  1X82 A;  5B4X A;  1XNB A;  2ZOE B;  4KBZ A;  3LOB A;  3IPV A;  4CDW C;  2QTW B;  3ZO0 B;  5IT6 A;  3O1T A;  2VXR A;  2ZX3 A;  1MQT C;  4LO6 B;  5FY1 A;  4NR1 A;  3SKJ E;  2YBS A;  3B5L B;  5C9A B;  1UY0 A;  2NQY A;  4RL7 A;  2A5Z A;  4EZ4 A;  3T3Y A;  2XXZ A;  3MDP A;  1HJG A;  2G4I A;  4IE5 A;  5FZ0 A;  3T0A A;  4AVA A;  1G86 A;  1QY4 A;  2V73 A;  1YIF A;  2E51 A;  4BWO A;  2YG0 A;  4PF5 A;  1UYX A;  1QWR A;  2PHD A;  1JZ6 A;  4MGZ E;  3A23 A;  1IQD C;  2X5I C;  2ADE A;  4M01 A;  3WG1 A;  5EWS A;  4ZY9 A;  5GM0 A;  1XE0 A;  5A7P A;  1R1Z A;  2ILM A;  3KZ4 C;  3DL3 A;  4ASL A;  4E8C A;  4Y1V A;  4UYB A;  4RGA A;  2XVK A;  3ZXF A;  5D2A A;  2HLE A;  3DPR B;  1O3S A;  3PHM A;  2VNG A;  2BBA A;  3DYM A;  4QPG C;  4YZ4 A;  5DPN A;  3ACG A;  1R1A 3;  2PYT A;  3E5U A;  4LBM A;  2FD8 A;  4Q4Y 3;  5FJK A;  1US2 A;  1DZQ A;  2JEC A;  2ZPX A;  3M3I A;  2C9K A;  1H9W A;  1JOJ A;  3I3D A;  5FBZ A;  1RUC 3;  1HJF A;  3VKN A;  3CL1 A;  4E4S A;  2VNO A;  1W2O A;  2YHJ A;  4R9B A;  4AHW A;  2V4A A;  5LEJ A;  5A32 B;  2RM2 2;  5IVV A;  1G6N A;  2BOI A;  2CL2 A;  2Y6H A;  2J1U A;  3NNJ A;  4ATE A;  2A73 B;  4XJ8 A;  5A7S A;  2YB7 A;  3VL9 A;  1LAJ A;  3LEM A;  1HXS 1;  3VBS B;  3KD4 A;  2X05 A;  1ULE A;  3BTX A;  4QDS A;  4HVR A;  3KWV A;  3C7H A;  1XB9 A;  1UKR A;  1XJA A;  3D6E A;  2LM3 A;  1UMI A;  4XFF A;  3AMQ A;  5LK5 A;  1ONA A;  3RMY A;  1RUF 2;  2OPW A;  1OFN A;  1VAL A;  2HBU A;  1D4V B;  4MG2 A;  3HVD A;  4BLJ A;  4WVW A;  2GAL A;  3B9C A;  4JQR A;  3MIB A;  1UIK A;  4V2V A;  1C57 A;  1AHS A;  1ZBE 2;  4BOW A;  3WW1 A;  1C3H A;  3Q8B A;  3GDB A;  1GQH A;  2HEV F;  3H1W A;  2BRT A;  3PIJ A;  1MZF A;  2I07 B;  1CQ9 A;  1NKG A;  3MLK A;  3H7Y A;  2WN3 A;  3CZU A;  2D6O X;  1PK6 A;  1JOP A;  1OVS A;  3ZN4 A;  4PT6 A;  4NHL A;  1HN0 A;  5GZD A;  3HBZ A;  1NCR C;  4FVV A;  3AKR A;  1LHN A;  2G19 A;  3BIW E;  3HT2 A;  4H7L A;  4F8A A;  3WXP A;  2F4P A;  5F2W A;  3TNP B;  2JG9 B;  3NST A;  4IE4 A;  4D7S A;  4NHX A;  3MIC A;  3J7H A;  5JSP A;  4NPL A;  2D5H A;  1OQD A;  2W2I A;  1LGB A;  1VBB 3;  2RG4 A;  4XIL A;  3KT1 A;  1K5J A;  4AW7 A;  1UPS A;  5LEK A;  2WZR 2;  3JZV A;  5FYT A;  3VDA A;  1KD7 A;  2G9G A;  4DXT A;  1S0B A;  3U0Z A;  1UOG A;  3BTZ A;  1AX2 A;  2GZW A;  2W5F A;  1OVP A;  4WM8 B;  4QPI B;  5FOB B;  5F3C A;  2HWF 1;  1V9U 2;  3DF0 A;  2K0G A;  3H7J A;  4X8N A;  5A7W A;  4BXF A;  2XJQ A;  5LA0 A;  3CZJ A;  2DVF A;  1CAX A;  2LTN A;  2XKO A;  4QX7 A;  1GFF 2;  1UOF A;  1N1T A;  1UX6 A;  4XIK A;  1ND3 C;  4CPB D;  1VBD 2;  3EB7 A;  5KBF A;  4Y22 A;  3THT A;  4EQV A;  4Q4X 1;  5LA1 A;  2Q1F A;  1GSL A;  5IK4 A;  4GWJ A;  1IKP A;  2QCS B;  3LKJ A;  1AVB A;  5D8A B;  3U4X A;  2BWC A;  1X36 A;  3IM0 A;  1DZT A;  1POV 0;  2QZ3 A;  3WDU A;  3JD7 3;  3FHI B;  4IES A;  4IV3 B;  1SDD B;  5EJZ B;  5LBC A;  4WZF A;  3VZO A;  1VMF A;  2ZGU A;  4B4P A;  4KWU A;  2DF7 A;  3VHP A;  3I2H A;  1QH7 A;  2VEC A;  2HWC 2;  4LHK A;  4XHB A;  3SQO A;  5C5U A;  2OZJ A;  4GA9 A;  3N9O A;  1KJL A;  5JZG C;  4DRR A;  3VLB B;  1H2K A;  3N9L A;  3R4U A;  1R08 1;  2D5F A;  4RHV 2;  3POW A;  3SCF A;  3WUC A;  3ZXD A;  4C90 A;  3K46 A;  4MGY E;  4RFR B;  2ZML A;  3ZFF C;  1HV0 A;  4LOT A;  1JBC A;  1BK0 A;  4NUB A;  3WT3 A;  1FPN 1;  5J09 A;  1Z7S 2;  4YM3 A;  4JRA A;  4QHB A;  4OZO A;  4DXZ A;  3C8X A;  3C3V A;  5BNP B;  3ZFE C;  3RWK X;  2GP3 A;  2WZE A;  1UZV A;  3NV4 A;  1DYK A;  1ACC A;  1G9C A;  3N7K A;  3NO8 A;  3AP4 A;  5FTT C;  5FQ0 A;  3LA7 A;  3K4A A;  4LO4 B;  3I2K A;  2YDE A;  3WDY A;  2ZEY A;  3GJA A;  4U36 A;  4QHZ A;  3LOI A;  2FQP A;  1UZW A;  5KHK A;  3KCC A;  5DG2 A;  1HIX A;  3GCX A;  3ILR A;  2RS1 2;  3T0D A;  1OA2 A;  4QQH A;  3PMS A;  1UF2 C;  1DYO A;  2P3K A;  3Q8C A;  2Y6L A;  1F2N A;  3DPR A;  5F2S A;  2JIG A;  3THC A;  3W20 A;  3ZXK A;  1G7Y A;  2JG8 C;  1XC6 A;  4FCA A;  2YRO A;  3I2J A;  4DOU A;  2ZGN A;  2YC0 A;  5FZL A;  5JAX A;  4GAZ A;  2VH9 A;  3I4I A;  4DZG A;  3K77 A;  4ZPI A;  3MIE A;  3T09 A;  2QQJ A;  1KDM A;  2D6N A;  3BU7 A;  4LBO A;  4DIQ A;  4E2S A;  1RIT A;  2Y6K A;  2Q8D A;  4RYD A;  3AJZ A;  4CCE A;  4GJZ A;  5F32 A;  2R32 A;  3LEK A;  2QDR A;  2P6C A;  4PDW C;  1AYN 2;  4Q4W 3;  4RS5 A;  3DCQ A;  2XLA A;  2QQL A;  2A6X A;  2OVU A;  2DVB A;  3LD8 A;  3VBR C;  2Q5T A;  2GME A;  2VTF A;  1M4W A;  3OYW A;  4XDQ A;  4YZ3 A;  1RUJ 1;  1SBF A;  3ASI A;  3CKH A;  1GIC A;  1YI9 A;  3OGJ A;  1I9R A;  4GWN A;  1UOJ A;  2HEY F;  5FUN A;  4CPB A;  4LHS A;  2VOX A;  2CGO A;  3P5B A;  3ZXG A;  4B7E A;  4XBN A;  1LHU A;  3QLQ A;  4WM7 B;  5K4L A;  2AR6 A;  4WZC A;  4UOJ A;  1RUG 2;  5BXX A;  1CES A;  5AVP A;  5LY2 A;  3RJR A;  4TN7 A;  1UW8 A;  3OTF A;  2AYH A;  3S7I A;  1JYI A;  5L7O B;  3BB6 A;  1CON A;  2BNO A;  2QQO A;  3ZYG A;  3WHU A;  3FHA A;  1GZW A;  5C8C C;  5A3N A;  2TBV A;  4NWW A;  1O91 A;  3ZPO A;  4E4Z A;  2QZ2 A;  2JB4 A;  4YRD A;  3UET A;  5LBE A;  2HWD 2;  4L9B A;  1ENR A;  1U5X A;  1UIJ A;  5A6X A;  1JHJ A;  1OF3 A;  1PMI A;  3WHT A;  1GUI A;  4IGP A;  4B1M A;  4LKE A;  1SQ4 A;  1X8E A;  4N53 C;  2DTY A;  2WO3 A;  3HR9 A;  4QKN A;  4G3Y C;  2EA7 A;  1BEV 3;  2IXK A;  1HXS 2;  3GCW A;  5GLU A;  3W9A A;  1NA1 B;  5FMO S;  2ZGQ A;  4BZ4 A;  1QJY 3;  1PX3 A;  5C71 A;  5GZG A;  5A6Z A;  3VBH B;  1IPJ A;  4QX0 A;  3C7G A;  1N3O A;  4IGO A;  5DAX A;  1GP6 A;  2GMP A;  3LDR A;  4FPO B;  1KDK A;  4LBQ B;  4QX5 A;  2TUN A;  1RTV A;  3MLL A;  4LKD A;  4FBF A;  3K75 B;  4AHX A;  4KG0 A;  3DV8 A;  2D7F A;  1QJX 3;  3IIA A;  3JQX A;  4GWM A;  2W46 A;  5LAT A;  1W9W A;  4HMZ A;  1H8T A;  2WA4 A;  1OC1 A;  2P2K A;  3I2D A;  3RG0 A;  4XFH A;  2NMN A;  3WG3 A;  3MIF A;  4JGZ C;  4FOY A;  4OUS A;  3TBD A;  5J96 B;  1HRI 3;  1NOV A;  2VXJ A;  1ZA7 A;  3ZIX A;  4KWK A;  4UFL A;  2QNK A;  5LA9 A;  3OCP A;  4JRL A;  2CAV A;  3LEG A;  2HEW F;  3KT7 A;  3ZYB A;  1EAH 3;  4SBV A;  2IWG B;  5CFC A;  4L8Q A;  3VGI A;  1EUU A;  3ZSL A;  3TEZ A;  4Z2A A;  5FZ6 A;  2JE8 A;  1ST8 A;  3RZJ A;  4IEO A;  5JLV A;  4Q4V 3;  3GZA A;  4QD2 A;  3NNG A;  4QQP A;  2FCT A;  3SHR A;  3VL8 A;  1AR7 3;  4CU6 A;  1A8M A;  3H1Y A;  4IUG A;  2YYO A;  3CU7 A;  1GLH A;  3S30 A;  4BA6 A;  2P1B A;  4XTP A;  3H8O A;  3DUI A;  4P9X A;  5FZ3 A;  2HH9 A;  3BN6 A;  3FBM A;  3PVE A;  3ILN A;  5FZH A;  4MAD A;  2HWF 2;  3AZV A;  5KXB A;  4OUE A;  5FZF A;  3HBK A;  5JPN B;  2WL1 A;  3LA2 A;  4FOV A;  4FOW A;  4IE6 A;  3TWI A;  2VTX J;  4BK4 A;  1UN1 A;  1A34 A;  1MVE A;  5CIR A;  4NO4 A;  4IEY A;  4LIU A;  1VJ2 A;  1S0F A;  1W0O A;  3LPF A;  2D6K A;  5BNP A;  4FTE A;  3NAP C;  3QH6 A;  3Q9O A;  5C3S A;  3IAP A;  2GP5 A;  1WD4 A;  4Q4X 2;  1V6I A;  1AL0 G;  1S2K A;  3RDI A;  1JYV A;  3B93 A;  4WVM B;  3UKT A;  4LK7 A;  3WR0 A;  1H30 A;  1BEV 1;  1AR9 1;  4AED B;  3WIN E;  4Z07 A;  3ZLI A;  3POS A;  4N43 B;  5FYU A;  1ODN A;  1LOF C;  2ARA A;  2F17 A;  1QJY 1;  4BIO A;  4COV A;  2XGX A;  2WII B;  3IBM A;  5AVA A;  2E32 A;  1U12 A;  3O0V A;  2V09 A;  5BY5 A;  2CHH A;  2CNA A;  2GC0 A;  3E6B A;  2W92 A;  4CCL A;  2W3J A;  3S6P A;  1QOO A;  1W90 A;  1QJU 3;  3GGL A;  2BQP A;  1CAU B;  1OKO A;  3N7J A;  4OMC A;  4XUP A;  4A2U A;  3I2I A;  4IDZ A;  1HB2 A;  1RUH 2;  1TME 1;  4CEW B;  2EIE A;  4OMD A;  2BW8 A;  3MV1 1;  4YW1 A;  1FPN 2;  5K7P A;  1SLA A;  2GND A;  1E5R A;  2AC1 A;  4X6Q B;  2IVJ A;  3ZOI A;  4BIS A;  4Q0S A;  1KS5 A;  1O59 A;  1UD1 A;  1HRI 1;  1YFX A;  4CDX B;  1W8W A;  4RR3 A;  1VB2 A;  4RQP A;  1HRV 3;  2DCK A;  4QAW A;  1W03 A;  3K51 A;  1COV 3;  5FJH A;  3UYJ A;  3LAG A;  2RR1 3;  1FMD 2;  1NQJ A;  1RYY A;  3ZSE A;  5IVE A;  2Q8E A;  3AP7 A;  3T4V A;  3N9N A;  2ZGO A;  3OJB A;  1YHF A;  4COY A;  3WNX A;  4Q4V 1;  2O14 A;  3J8F 3;  2WNO A;  5FY4 A;  3KVA A;  2KR2 A;  5CFD A;  1NYW A;  1XNC A;  4GMP 1;  2VZ3 A;  5F37 A;  4LA3 A;  2WWS A;  2B7Y A;  5F5Q A;  5A70 A;  5K9Y A;  5A33 A;  4CDU C;  3ZYH A;  3WP5 A;  3PJY A;  4EE2 A;  1NXM A;  1L7L A;  2B39 A;  3RMX A;  4CP2 A;  3QD6 A;  1RUI 2;  4B4Q A;  4J25 A;  1LOG A;  1OPO A;  4AQ2 A;  1NZC A;  4ZZ5 A;  2BNN A;  4Y1U A;  1B35 B;  2RE9 A;  2RS3 3;  2DCY A;  5CVR A;  5K0U A;  1F5J A;  5C70 A;  5J3U A;  2W68 A;  1AR6 1;  4QU1 A;  2VQ0 A;  5EYY A;  3UGH A;  4FOQ A;  1BCX A;  3IAQ A;  3VBU B;  4A7Z A;  1URX A;  4FAH A;  3QCW A;  1APN A;  1OMI A;  2VBP A;  3KCX A;  5FMB A;  4YSF A;  1G9B A;  2ADD A;  4IEW A;  3LIG A;  3ES4 A;  3ZFG B;  1S0I A;  2MEV 1;  1QHD A;  2YGL A;  4JV4 A;  3OD4 A;  2VCB A;  3FMG A;  4HKL A;  1CN1 A;  2B45 X;  1XSQ A;  1VAV A;  4LEJ A;  5LB6 A;  4OI0 A;  4XUQ A;  1XRU A;  5A1F A;  1BKZ A;  2B42 B;  2DTW A;  2JJ6 A;  2W39 A;  3KQ4 B;  3VBO B;  1NLS A;  4BQY A;  3TN9 2;  3A21 A;  1ZBE 3;  2WR9 A;  1NA1 A;  3J7L A;  4IV1 C;  5IVB A;  4DXS A;  3SIS A;  2XR4 A;  2CYF A;  4IND A;  5C4W B;  4ET7 A;  1RUJ 2;  3N4M A;  1VE0 A;  4LJH A;  4JDN A;  4QDR A;  2VJX A;  4R52 A;  3VDD A;  5IVF A;  1AL2 2;  4I01 A;  1F35 A;  1ND2 A;  5T52 A;  5L7O A;  4XDP A;  4LBQ A;  4CEY B;  2D40 A;  4N9I A;  3PTR B;  2ZMN A;  5JXH A;  3J26 N;  2DBN A;  3IPV B;  2FCU A;  1KFX L;  5GLT A;  3ZMO A;  1DLC A;  2ZX2 A;  1DGR N;  2AEZ A;  2VOK A;  4S2H A;  5GLZ A;  1K5M C;  5FZK A;  4LPL A;  1R64 A;  1WLD A;  1PGL 1;  3VZN A;  4GUL A;  4HZF A;  3HEI A;  5FY8 A;  1DBN A;  1MQT A;  2Y6J A;  3VKM A;  1YUD A;  3WZ1 A;  2ATF A;  2ZHM A;  3K3O A;  1COV 1;  1OHF A;  3WNL A;  5BV6 A;  2PXJ A;  1WLC A;  1K42 A;  1PO2 3;  2QQK A;  3OEA A;  4ZXK A;  5A3O A;  3W5M A;  3CJI C;  3DYO A;  4F7Z A;  3IDE A;  4UBG A;  4XF0 A;  4AVB A;  3IN9 A;  1SFP A;  2OUJ A;  4GAL A;  3RI9 A;  3J8F 1;  4ISQ A;  4Y1Z A;  1MS8 A;  1RED A;  3HT1 A;  1LGC A;  4YVW B;  5F5I A;  2GU9 A;  3OSD A;  1WGP A;  3NV3 A;  4FXG B;  4CCM A;  3LEI A;  2ERF A;  2WS9 3;  5I8S A;  3AMP A;  3ZMN A;  4GZ9 A;  1C4R A;  4RGG A;  4J1W A;  4AI1 A;  5LK7 B;  2VMF A;  3NW4 A;  4FI9 A;  2RS3 1;  2V5D A;  2VMG A;  2QDN A;  1ZYB A;  3RFR A;  4QQ2 A;  4W4Z A;  4P14 A;  3BOD A;  3OPT A;  3W21 A;  5JXG A;  3FJS A;  2XJU A;  2EXH A;  2XLG A;  1NE4 A;  5E16 A;  3OUH A;  4QPG A;  3U75 A;  3ELN A;  2VR4 A;  1ZZC A;  5DUX A;  3OGS A;  3WDW A;  4CDQ C;  5IVJ A;  3RGB A;  1S0C A;  1SCR A;  3S0M A;  1Y9M A;  2CU5 A;  1KGY A;  3CMG A;  1PVX A;  4RFT 0;  4D8M A;  5JR2 A;  5GZF A;  4LUL A;  1QOS A;  1W9Y A;  1EV1 1;  2FDJ A;  1Q56 A;  3NRU A;  4G4F A;  5HCA A;  2EAL A;  1XSR A;  2Q1M A;  1F31 A;  2IFW A;  4I0B A;  1TEI A;  5FK8 A;  1RUE 2;  3U07 A;  1IS3 A;  2YXS A;  3AMH A;  1CR7 A;  2NYY A;  2HWE 2;  3I3B A;  4L2N A;  3NWK A;  1QKQ A;  1UU5 A;  2VZ1 A;  1W8H A;  3AK0 A;  2Y8K A;  4LO8 A;  5KHJ A;  1AJK A;  1WA6 X;  2PHL A;  2ZHK A;  2C6S A;  4QGN A;  5H9Q A;  2CTV A;  2XUE A;  1SLI A;  2AAC A;  2EVX A;  4BQ3 A;  4EN7 B;  3S5Q A;  5JWP A;  2WO1 A;  2PQS A;  3WNP A;  4LBL A;  3D4K A;  2VUA A;  4UBH A;  5FOJ B;  1T6G C;  1DHK B;  2BVV A;  2WZ8 A;  3ME2 A;  4PHZ A;  2GDF A;  4YZ5 A;  3VZL A;  4KGG A;  3OGR A;  5A80 A;  1IGO A;  3MIG A;  4MX3 A;  3X29 B;  2P17 A;  4A3Z A;  4OUM A;  1O7F A;  1PK6 B;  2ARC A;  1BMV 1;  3O7O A;  4HN1 A;  3AKT A;  4W8J A;  4OI2 A;  3ZDS A;  2RDS A;  2XBO 3;  4HON A;  4BDV B;  3HIF A;  2BGO A;  5KHG A;  1PO2 1;  2C24 A;  5AC9 1;  1BK1 A;  2DYC A;  2JDM A;  2O1Q A;  2YUE A;  1JU4 A;  4XQ4 A;  5J37 A;  3H3Z A;  1PIV 3;  2OII A;  4IEP A;  4BM8 A;  4C8D A;  5HXV A;  3UJO A;  1AR9 2;  1NCR A;  1S0G A;  2ARE A;  2ZJC A;  3KSC A;  1S0D A;  5A1A A;  4QX2 A;  1H9P A;  1JZ5 A;  3GHN A;  2ET1 A;  2CV6 A;  1WBL A;  4LIV A;  2VZQ A;  3GXU A;  3WLU A;  2WS9 1;  5HV0 A;  1HQW A;  1AX1 A;  3KB5 A;  5A1L A;  5JOX A;  5ACA 1;  4MGK E;  1L7R A;  5LA2 A;  2LRP A;  3K4Z A;  1WD3 A;  1B09 A;  2I2S A;  3KGL A;  3AX4 A;  4HPK A;  3VHN A;  4QDQ A;  5F6K A;  1QOT A;  1TME 2;  3V0A A;  4JQT A;  1GZ9 A;  3ECQ A;  3RWN A;  3EO6 A;  1CAX B;  2FMY A;  1BYH A;  2XON A;  5ABJ C;  1H2N A;  4OHY A;  4Y4Y A;  4FT8 A;  2PHR A;  3M4F A;  1QMJ A;  3PJQ A;  2P6H A;  1GWM A;  3IZO A;  1LOA A;  4CCJ A;  4Y22 B;  2EXI A;  3WW4 A;  1GR3 A;  1GZC A;  1RUD 3;  4JGZ B;  5FO7 B;  2JIJ A;  3AZX A;  4MH0 E;  1GMM A;  4LNV A;  1S2E A;  3W59 A;  1ND3 A;  1W9S A;  1AYM 1;  2XKP A;  4GH4 C;  3AYC A;  1W28 A;  2BU9 A;  4DB5 A;  5BNN C;  2G1M A;  3SCH A;  1UZ0 A;  1OPM A;  1W2A X;  4MZU A;  4YG0 A;  5FY0 A;  1ZVF A;  3ZXA C;  1N47 A;  4Q2F A;  2ZEX A;  3CHX A;  3N7L A;  5A3U A;  3BKZ A;  2VW0 A;  4LBK A;  1RXG A;  3AZY A;  3OF1 A;  1LNS A;  2WT1 A;  2FDF A;  3ENR A;  3QBQ A;  3LSE A;  4CTE A;  1MR5 A;  1KS4 A;  1D4M 1;  3N9M A;  1FNY A;  2G9Z A;  4Z1V A;  1RUN A;  1W8N A;  4K1Y A;  2HWD 3;  5FWJ A;  1PMH X;  4P9Y A;  5JZG A;  4MXW A;  5EQU A;  4XZP A;  5CNA A;  1RXF A;  5FYI A;  4CA9 A;  1AR6 2;  3ZYJ B;  4NIH A;  3ZFF A;  4OVE A;  4MLO A;  4GB3 3;  4D94 A;  4GXL A;  4D6Q A;  4NRQ A;  2D3S A;  4B3N A;  2P3J A;  3S57 A;  1R09 2;  4E4H A;  2E7A A;  4H3W A;  2MEV 2;  1MZ6 A;  2XBO 1;  2DFB A;  2W1S A;  3ZFE A;  3RZG A;  1LOC A;  5L9B A;  1POV 1;  2WFF 3;  2PLV 3;  4KMQ A;  4PI0 A;  2J1E A;  1ZRE A;  5FZE A;  4XE9 A;  1PIV 1;  1XU2 A;  5E89 A;  5FK7 A;  5FQ0 B;  5KXC A;  2XML A;  2AUY A;  4P08 A;  1UZY A;  5DAW A;  1FOD 1;  4HK9 A;  3PUR A;  1XXN A;  1KXG A;  3VHR A;  4D6S A;  5HBA A;  3EYP A;  5SV5 A;  1ZZB A;  5A7N A;  4YVW A;  4QB1 A;  4UFI A;  2MPF A;  2ZKL A;  1W0N A;  1QQP 3;  1DQ2 A;  2OQ7 A;  1ASJ 3;  1EYB A;  3I3E A;  1RVF 1;  2JIC A;  4O65 A;  3ORJ A;  2LW8 A;  4DUX A;  2GH2 A;  1XNK A;  1YFY A;  3I8T A;  4UAP A;  5BNO C;  1RHI 2;  3RNS A;  1PVC 3;  2VCM A;  3NKG A;  3NNF A;  4CCO A;  2XJV A;  2R06 1;  3VKO A;  2E7Q A;  2VOT A;  2JG8 A;  4CXW A;  4EN6 B;  3CLP A;  3URF A;  4PCR A;  3VN4 A;  1RUD 1;  3MEP A;  4W6X A;  2XG3 A;  1ULF A;  2ARX A;  4C0B A;  4NID A;  1E57 A;  4FPC A;  5KWR A;  3DGT A;  1N1V A;  4JVA A;  1VB4 A;  2CDP A;  1GAN A;  2BGP A;  4QGM A;  1WLW A;  2VUC A;  1CZV A;  3OG2 A;  3VD9 A;  1AR8 2;  1S4C A;  4RS5 B;  5DDJ 2;  4G9S B;  4XF3 A;  5HCF A;  1OI6 A;  4Y24 A;  1DF0 A;  3HJR A;  5E1R A;  1OLM E;  2P4E A;  3A0N A;  4O9G A;  1PX4 A;  1J83 A;  4PDW A;  3OYW B;  3RZM A;  1IZ3 A;  1DG6 A;  1U5Z A;  5BPX A;  4YM2 A;  3VBR A;  3WQ0 A;  4IER A;  4CP9 A;  4BK5 A;  5FYS A;  3BOW A;  1Y9G A;  1JUH A;  1K3I A;  1N1Y A;  2BPA 2;  3TOJ A;  2CDO A;  4JZR A;  1DZR A;  3FBY A;  4D0Q A;  1VBA 3;  2PA7 A;  3IMM A;  2VVE A;  4KG8 A;  2YV8 A;  1LKN A;  2R04 3;  3M3Q A;  2WNU C;  1AXY A;  1GZW B;  2YY1 A;  4MET A;  1V6L A;  4GB3 1;  1PGW 1;  1W6O B;  2C4X A;  2Q30 A;  3E97 A;  5FZ1 A;  2NM1 A;  1FX5 A;  4DFS A;  1W8T A;  1N3Q A;  2E53 A;  5C8C A;  4H14 A;  2B46 X;  1BHG A;  3H1M A;  5FZ7 A;  2W08 A;  3O14 A;  2WFF 1;  4W6W A;  1EV1 2;  2PLV 1;  3LPG A;  3QAC A;  5KHH A;  1OBN A;  5I91 A;  2ZGT A;  4BXS V;  4XUR A;  5A3M A;  1RJ7 A;  1ZBA 2;  4N53 A;  1REF A;  1W0P A;  5HPO A;  1VIW B;  3HPN A;  5DZE A;  1ULD A;  1G9A A;  1YYN A;  1SZB A;  4QPY A;  1MZE A;  3IMN A;  4Q0Q A;  1AF9 A;  2ORX A;  5JPM B;  1XYP A;  4UXA A;  1I1E A;  1KQR A;  2RMU 2;  3B01 A;  4KI5 M;  2A1X A;  3AMN A;  2VQT A;  5IUQ A;  5HI0 A;  3ZN6 A;  4LLO A;  2Q8O A;  2Y0I A;  1VMJ A;  3NJZ A;  1GOH A;  2R49 A;  5L36 A;  3M3C A;  2LAL A;  4E9K A;  1OUS A;  1R1A 1;  2GN7 A;  3BAL A;  3WF2 A;  1H8T B;  1V6O A;  1PVC 1;  4Q4Y 1;  3POE A;  2WNE A;  2XWB B;  3WF1 A;  4YG3 A;  3V0B A;  2KXL A;  1W8U A;  2J1V A;  1RUC 1;  1Q8P A;  4XC9 A;  4A42 A;  4M4R A;  5KXD A;  1VRH 3;  4OHV A;  3F2Z A;  2HWB 2;  3J4U H;  4NAM A;  4UWD A;  4QM9 A;  3WV6 A;  4JGZ A;  2RS5 2;  3MF6 A;  2GNM A;  4GKY A;  2DCT A;  5L9V A;  4AI2 A;  1LOE A;  1QEX A;  2Q0A A;  4UFK A;  5A3T A;  5CFC B;  4IXL A;  4NE9 A;  2Y64 A;  1NLQ A;  5K8S A;  4CE8 A;  1XBF A;  2QE3 A;  3EMR A;  2CAU A;  2WIN B;  3OOX A;  4QM8 A;  1PO1 2;  5FFO C;  2BBV A;  1VBC 3;  1I3H A;  1H6X A;  1RL3 A;  2C1F A;  5FIX A;  1VBE 3;  3C2U A;  5JDB A;  4Y4R A;  1C8M 3;  1L7Q A;  3WQB A;  4OI1 A;  5G05 L;  5EJ1 B;  4K8R B;  1YQ8 A;  5FP9 A;  3O1P A;  4RN5 A;  1OQ1 A;  4TLG A;  2XJS A;  1CZS A;  3M3E A;  5LRR A;  1VBA 1;  4ZKT B;  1JYN A;  4LKS A;  2R04 1;  4LHL A;  2GMM A;  2JKX A;  5FZI A;  4JGY C;  5A3W A;  3HN3 A;  4AI3 A;  5DUV A;  2JWP A;  1BXH A;  2VMD A;  1FNZ A;  1OLM A;  2O0O A;  1I6X A;  2EXK A;  5FXW A;  4CXX A;  2NMO A;  3CF6 E;  3R0R A;  4FTS A;  3AJY A;  1KIT A;  1W6M A;  3T2Q A;  4ASK A;  4CDQ B;  3PVN A;  3T2O A;  4MGI E;  2VMI A;  1VPH A;  1UQX A;  2R07 2;  2E9Q A;  1AYM 2;  2BUK A;  3MW2 A;  3NAP A;  4GIQ A;  4EN9 B;  3Q8E A;  2VPV A;  4MGQ A;  1SLT A;  1C8N A;  3OGV A;  5CG9 A;  2A6Z A;  2VME A;  3MI8 A;  3KHC A;  1OQE A;  4D6R A;  3FX3 A;  3GNE A;  1YJK A;  2WAB A;  2P34 A;  5IVC A;  3T1M A;  3MPP G;  4JCK A;  1OSG A;  1VBB 1;  5IW0 A;  1LOF A;  2VO5 A;  3N35 A;  1F8V A;  3G6J B;  2VD7 A;  3RVH A;  2VOV A;  3OGG A;  1H4H A;  4ITC A;  1W6Q A;  4CP1 A;  2P5B A;  1OUX A;  3BVC A;  1DLL A;  5DQ0 A;  1HW5 A;  3VZK A;  3HD8 B;  3LA3 A;  4DEQ A;  1TQ5 A;  5IFT A;  4K7J A;  5LCW L;  2W1Q A;  5JSO A;  1V70 A;  1WUV A;  5DMY A;  2XHK A;  4BMB A;  3EXU A;  2JD4 A;  4TSV A;  3WW3 A;  3GAL A;  3M1H A;  2L9L A;  3L2Y A;  5T50 A;  1VRH 1;  3AFK A;  4FQ4 A;  4Q1R A;  4RR3 B;  2J1A A;  4PF1 A;  2MNG A;  2WWU A;  3FLT A;  3DXU A;  4RQP B;  4NN0 A;  3RZL A;  5FXV A;  2HYK A;  2ZCW A;  4P5Y A;  3WW2 A;  5SV8 A;  2V72 A;  1OXC A;  1CX4 A;  5FUI A;  3GYD A;  1C1L A;  3VHO A;  4ZS2 A;  2JEM A;  3WDT A;  1XU1 A;  3AZW A;  4TWT A;  5CFD B;  4OI4 A;  3JD7 1;  1RMU 3;  1FOD 2;  2QQM A;  2VCC A;  4P9J A;  5FY7 A;  3RSJ A;  4CCK A;  1VBC 1;  4LXL A;  5A33 B;  1VBE 1;  2QQI A;  1BBT 3;  2ZAH A;  5FXX A;  4YVS C;  4HSJ A;  3CDZ B;  2YBK A;  3E1F 1;  2BFU S;  1E5I A;  4W50 A;  2CGP A;  4I02 A;  2R1B A;  3JBG 3;  3RJ2 X;  2KA3 A;  3OBR A;  5K0U B;  4A44 A;  4ZHN A;  1IG0 A;  3AYD A;  1QF3 A;  4LQR A;  4LE3 A;  2O8O A;  1ALY A;  5CU1 A;  2R06 2;  4JTO A;  2WAA A;  4YGE A;  4Q5O A;  2VBB A;  3SNM A;  5KXE A;  2BOJ A;  1W6O A;  3WCS A;  2XJR A;  5FZ4 A;  2EAA A;  4FPH A;  4CYD A;  5I0D A;  1UWW A;  2WO7 A;  2JDA A;  1A78 A;  1CJP A;  2FCV A;  4HBN A;  2BJS A;  4FP3 A;  5DZG A;  1NY7 1;  1LOD A;  3KV9 A;  1FAY A;  5T5L A;  3UGF A;  4OYU A;  5FZ9 A;  3A7Q A;  3SH4 A;  5A3L A;  3JB4 C;  3LFI A;  1DFQ A;  2UUR A;  4GJY A;  2DDU A;  2FHR A;  2W87 A;  3I7D A;  4AHZ A;  4NHY A;  3LE0 A;  3ZKY A;  1KFU L;  2E26 A;  4XTM A;  4Y5Z 0;  4AVC A;  1TMF 3;  4BQ1 A;  5IK7 A;  2VZS A;  1PGL 2;  5KR7 A;  3AXD A;  1YEW A;  3VDD B;  3MFC A;  2W94 A;  4IV1 A;  3H8R A;  1ND2 B;  5FYB A;  4XQD A;  1G9D A;  1WCU A;  3NL1 A;  1CAW A;  1YQC A;  2XL9 A;  4HKO A;  4ZU5 A;  3LDK A;  3WQ1 A;  2NN8 A;  5GZC A;  3CBN A;  3MFA A;  4M00 A;  3D0J A;  1D0G A;  2DCZ A;  3BI3 A;  5GAL A;  4FFI A;  1IKQ A;  4XFB A;  4CDW B;  2XQR A;  3VV1 A;  1MQT B;  4MYE A;  2VUD A;  1K5M A;  3KV4 A;  4CSW A;  3POG A;  4LUK A;  2IXI A;  4Y33 A;  3SMH A;  2J42 A;  1H2L A;  4LMF A;  1UY4 A;  1VLN A;  2WQZ C;  3LIH A;  3KHB A;  3W5N A;  1TE1 B;  2AEY A;  3POJ A;  1X33 A;  3USS A;  4Q4W 1;  4BME A;  5F3E A;  2JDU A;  4LA2 A;  2JE9 A;  1RMU 1;  3CJI A;  4Q0U A;  4S2D A;  4XUN A;  1M06 G;  3ATG A;  4AQT A;  5M0T A;  4AL9 A;  2JDY A;  4DPN A;  3C7F A;  1BBT 1;  2ZAA A;  3N7M A;  5I0R A;  2X5I B;  3KT4 A;  2UWB A;  4KU7 A;  1MEC 3;  5LBF A;  1X9P A;  3VBF C;  5KC6 A;  3H8X A;  4Y5T A;  4O61 A;  4DRV A;  3JBG 1;  5JI7 A;  5DXD A;  2WUH A;  1ODM A;  1MS9 A;  1R1A 2;  2DUO A;  4R9A A;  5IHR A;  4DUW A;  4QPG B;  4XW3 A;  5BNO B;  3S5A A;  5LWB A;  5GKA C;  3ES1 A;  4HAN A;  3UL2 A;  1RUC 2;  2DUP A;  4BQX A;  1E5H A;  3RI8 A;  1UY3 A;  3K2O A;  2PHF A;  1QIQ A;  4QGL A;  4CDQ A;  1O6U A;  4KWJ A;  3HMY A;  3ST7 A;  3MBW A;  1O3R A;  4AYU A;  2IFR A;  2W1W A;  4LBN A;  5FLJ A;  2ENR A;  4Y1Y A;  5A7Q A;  4AQ6 A;  1YFW A;  2D6P A;  4BE3 A;  5CAD A;  3ZPY A;  4CU8 A;  2YZ4 A;  4XMA A;  4EYU A;  1UKG A;  5FKC A;  5FYV A;  2PQQ A;  3LWC A;  4HN0 A;  1TMF 1;  2ZGP A;  5A3P A;  3ZXJ A; 
#chains in the Genus database with same CATH homology
 4UT5 A;  5A6Z A;  2JDN A;  5HCH A;  2WRA A;  1OUR A;  1GZT A;  5A70 A;  1OXC A;  2JDK A;  2JDU A;  1W8H A;  2BOJ A;  3DCQ A;  2JDP A;  2JDY A;  3ZDV A;  2JDM A;  4AOC A;  5A6Y A;  2BOI A;  5A6X A;  2WR9 A;  1OUX A;  2VUD A;  1W8F A;  2JDH A;  2XR4 A;  5A3O A;  4CE8 A;  2BP6 A;  2VNV A;  1OVP A;  2VUC A;  1UZV A;  5A6Q A;  2BV4 A;  1OVS A;  1UQX A;  5D2A A;  1OUS A;  2CHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...