3DCQA

Lecb (pa-lii) in complex with the synthetic ligand 2g0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Fucose-binding lectin PA-IIL
publication title Inhibition and dispersion of Pseudomonas aeruginosa biofilms by glycopeptide dendrimers targeting the fucose-specific lectin LecB.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 21
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 3dcqA00
5A6QA 4CE8A 2BP6A 2JDKA 1OVSA 2CHHA 1OXCA 1UQXA 1W8HA 5A6ZA 1W8FA 2WR9A 5A6YA 3DCQA 3ZDVA 2JDHA 2BV4A 2JDYA 1OUSA 2BOJA 2VNVA 5HCHA 1OUXA 2VUDA 2XR4A 2VUCA 2JDNA 5A3OA 2JDMA 2BOIA 5D2AA 4AOCA 2JDUA 4UT5A 5A6XA 1OURA 2WRAA 1GZTA 1OVPA 1UZVA 2JDPA 5A70A
chains in the Genus database with same CATH superfamily
4QAWA 3W59A 1VBA2 1WBFA 4YVWA 3ZYRA 2G9ZA 2WO2A 1F5FA 1MACA 3AZVA 5K4LA 3N9QA 3UYJA 1YO8A 3ILRA 4B7EA 3G7DA 4YW7A 1GYKA 4CCKA 4YFWA 1V9U2 2P3KA 4ZXKA 1W90A 3VDCA 5CFDB 3GZAA 4QGNA 4QPIA 3JBG1 2FCVA 4YYOA 2PHLA 1QQP1 2V4VA 2VUJA 4HZFA 3JQWA 2JDUA 5JOZA 1OLME 4GMP3 2WNEA 4OMCA 2ARBA 2K46A 3GALA 3LEKA 3MPPG 2ILMA 5DUVA 5HBAA 1YRZA 4CRQA 2DDUA 4XZPA 2DU1A 2RDNA 4CEWA 1HQNA 3QH6A 4YZ4A 4UWDA 2XJRA 2BU9A 1HXS2 1ND2B 2BP6A 4A3XA 3TEZA 3NMBA 4UFLA 4FPGA 4Q26A 3VBRB 2WSVA 3VBOB 3USSA 2CAUA 1DQ0A 1ZRIA 3RYPA 3PIJA 5F8PA 2Q1FA 5L9BA 3SH3A 2RS53 3I2DA 4IEOA 1UZ0A 3ZM8A 1LKNA 5EJ3A 4BQYA 1W04A 3EBRA 3IT8A 1W3VA 2VULA 3BKZA 1CAXA 1APNA 2BPA2 2BOIA 1X36A 1GZCA 1PGSA 5FYVA 2YBPA 4NOTA 5HCBA 3VD7A 3OGJA 2E7TA 4AVBA 3WQBA 3RQ0A 4ZKTB 3RSJA 3WW4A 3ZYIB 3S7EA 4CU6A 1AL0G 2G9GA 3VHPA 5IVYA 2QQNA 2VC9A 3GXUA 4MVTA 5FK8A 1VBE2 1TG7A 4Y3OA 2J22A 5A3MA 4DUXA 1NLRA 5AVAA 5IUQA 2YB7A 1GWLA 5CADA 4BQ5A 3DCQA 3WG2A 1PK6A 1J58A 2VO5A 1O3TA 4JDMA 3AP4A 3E6DA 4FTEA 5FZLA 4NIIA 2MEV1 4W65A 4WM8C 1RUH2 4E2QA 4E2SA 2UWAA 4U2AA 4HETA 2ZGUA 1UWWA 5FREA 1VBB1 2JKBA 5FYTA 3S57A 3ZOIA 2YPJA 2W0XA 4UXAA 5ACA2 3POFA 2SBAA 3BTAA 1MS5A 4YM2A 2GN3A 3B00A 1V6OA 2CGNA 2J1UA 2QQLA 5FV3A 4O9EA 2YBSA 1AZDA 3THCA 4KU8A 2QQWA 5CG8A 1W2TA 4HVRA 1J3QA 3KGZA 5SV5A 1XPWA 3DF0A 4E8DA 1RXGA 3BTYA 3CMGA 4N7UA 2X53S 3PIGA 2R042 3JXSA 3VBHB 3A0NA 4CEYC 4CDXB 1G9FA 3S30A 2OPWA 2A3YA 1HV1A 3E5UA 1C3HA 5C3QA 1N1TA 1TNFA 2JD4A 4TYSA 2R061 1ZRRA 3I2HA 5A7SA 2DTYA 1SBEA 4HPKA 4XFHA 4QQ2A 1ULGA 3VBOC 2OW4A 4CEYA 1UD1A 3ZVXA 1U0AA 1R082 4DXTA 1QDCA 3ZX7A 1ZRCA 1N3PA 4R9DA 2BFUL 1ENRA 1FPN2 1UL9A 2WUHA 4JGYB 4K8FA 5JMCA 3THPA 2PHWA 1W9WA 2PQSA 1ZYBA 4BQ2A 5FLHA 2DURA 2ZHKA 3O0WA 3H3LA 1IS5A 2YU1A 1SLAA 1QJEA 5IAVA 3T2TA 1D4M3 1OF4A 3UKVA 3WOGA 2W1UA 2HWD1 2C4XA 1DDLA 4BIFA 2VUDA 4QHZA 2HWB1 4KQ7A 1ASJ3 2DBNA 4XF4A 1GKBA 5AFEA 5LY2A 2UWCA 5LB6A 3UGHA 3FUQA 2ZABA 2HWC1 3JB4C 4RS5B 1CPMA 3W5MA 5FP3A 4AAPA 2ZMNA 3T08A 3HR9A 4CCEA 4L2NA 1JUHA 1LOEA 5E16A 5FR3A 4XUPA 4PQQA 3VB9A 5IK4A 2LTNA 1LULA 1HV0A 4C1XA 3NKGA 2P5BA 3OYWA 2DVAA 2XVLA 4K8RB 1XSRA 2NMNA 5FZKA 1DGLA 2JDZA 4QKNA 3TNPB 2XWBB 5L9RA 3GBWA 4XQ4A 5KC5A 1H2MA 1UYPA 3DPRA 5L7OB 4KNCA 3O0VA 4I2OA 5K0UB 2VMHA 4CUBA 2HWE2 1UOBA 3BIEA 1JYIA 3UL2A 4RN5A 3ACLA 4KL1A 2WINB 1QXPA 2QQMA 1GICA 1O4YA 3SHRA 3VBHC 3K3NA 4DOUA 1MR5A 2WQ8A 3FBYA 3N9OA 4MUVA 1FMD3 5EPAA 1UU4A 3PUQA 3SEPA 1U5IA 2YZ4A 4LBJA 4O65A 1MS4A 2VMGA 3I2GA 3MEPA 2A6YA 1W2UA 3SC7X 1YEWA 3BOPA 5KXCA 4KGGA 1NQJA 1VBA3 1XNBA 2MHFA 3DYMA 1DG6A 1OOPB 1PIV2 1H30A 4B4PA 5FYYA 4B7KA 1W9SA 4JGYC 3IMNA 4CCOA 3OUHA 2W08A 1QOTA 1IKPA 3V64A 1V9U3 2V5YA 1GFF2 1UZZA 2XJPA 5EYYA 3ZYGA 5C5UA 4IW3A 2R49A 5LA0A 3IIAA 4XOGA 2EVXA 4PF5A 1GP5A 2Y34A 1OH3A 1AR72 4XMIA 2KR2A 1DCSA 2W39A 1ZZ9A 1YFWA 4HL0A 1C4RA 4Z1VA 4V2WA 2V5DA 4MYEA 1OLMA 3QCWA 3VUOA 2WYSA 1BQPA 4YZ1A 5FO9B 3K75B 1BEV3 4FXKB 4B1MA 3ZXKA 1RUD2 1PGW2 2RDSA 1XOYA 3GM8A 1COV2 1HXS3 4NWWA 1X8EA 2RS32 4UW4A 5B4NA 3T09A 4EROA 2WBKA 4Q0VA 3JD73 5A3PA 4JRAA 5C9AA 2FZ1A 3MIDA 1UIJA 4FPJA 2EXJA 5BNOA 1R092 3PNAA 4ZU4A 2ZX2A 4W4ZA 1JOPA 1REFA 1ULDA 1RUE2 2PHFA 3LWCA 5L7OC 3MHZA 5GZFA 4IEYA 5FLJA 1CZTA 2AACA 4YW1A 3VBUB 1GQHA 1POV0 2A3WA 3GNEA 5D21A 1D2SA 1UAIA 1QNYA 4Z8BA 3TAYA 5JR2A 2OA2A 2RMU1 3HNYM 1YFXA 3FLPA 1XSQA 4D94A 1CR7A 2ZGRA 4XJUA 1HQWA 3IDBB 1HX6A 3OGSA 3KV9A 1GZWA 1LRHA 5A1AA 3T2QA 1VBE3 2VZRA 3GHNA 5FMBA 4E4SA 2ZGPA 4PDWB 5M0TA 4ES8A 3POGA 1XNDA 2GMMA 5IFTA 2VY0A 3AKTA 1SLBA 3AZWA 3WQ7A 3WSOA 3I2OA 3N9MA 1S0CA 2PHXA 1ZBA2 3KCYA 2AYHA 1RUH3 2YC2A 3CZJA 2W47A 5FZBA 2CNAA 1BBT2 3EO6A 2WLQA 3O1UA 2WJSA 1OOPC 1D0GA 3D8CA 1OD3A 1G86A 2WIIB 2PYTA 2WABA 4HN1A 4XPVA 1RITA 4OI2A 4FCAA 4QU2A 1XNCA 4XUNA 5ACA3 1VP6A 3GJBA 4E9KA 1JYXA 3AKPA 2GH2A 2BWAA 2VBDA 3AM2A 2P6HA 1WLDA 4IE6A 5HCHA 4CU7A 1S0IA 1ULCA 3A22A 1YI9A 4NHXA 4XF9A 1G6NA 2GAUA 2VZ1A 2WO7A 4NVPA 3M8LA 1VR3A 1MS1A 1OSGA 3POBA 2ET1A 2FMYA 3ZKUA 1EY2A 3O1SA 3HQUA 1ULPA 3PVNA 3D3AA 3WG4A 1UU6A 3JBG2 4L99A 1ASJ1 1QQP2 2V4AA 2R0FA 1H4HA 2HLEA 4BM8A 1S0JA 4ITCA 5A70A 3IM0A 1GNZA 2VD7A 3KQRA 3ZXGA 4DRVA 4YVSA 4OZXA 1CGPA 4CP9B 1GR3A 1PMIA 5A3LA 5JPNB 1AVBA 5LK7B 2VQTA 1R083 3WF4A 3H9AA 2DUPA 1BZWA 2B5HA 3W21A 4Q0UA 1FPN3 1U5YA 5EP9A 3Q8FA 2RM21 4A7YA 4YZ2A 1IQAA 4MADA 5FRAA 2JDMA 5I91A 1CVNA 3VBUC 3CQOA 1PMHX 3S7IA 2D40A 3CKHA 5LWBA 2ZGKA 2BBAA 3KWVA 4FPLA 1N3OA 2OS2A 5LRSA 1SQ4A 3I3BA 1VALA 5A1LA 2ARAA 1MQTC 3HMYA 2ZEYA 4HKWA 1R64A 1RVF2 1K3IA 1V6LA 4PDWC 1OXCA 2I74A 2XL9A 3KF5A 3NV4A 5LW9A 2AEYA 1W6QA 3NJZA 3OD4A 4M01A 4MX3A 4YWAA 2KA3A 5F5AA 4OUEA 3KGLA 1DIWA 4S2GA 3RMXA 3KMHA 4GH4B 2VW1A 2L9LA 4NPMA 4DRRA 4KWJA 1W8ZA 3AK0A 4IV1C 1BVP1 3E6BA 1I5PA 5FYCA 4YZ3A 3I2KA 2WKKA 4QX3A 5T5LA 1VBA1 1SMVA 2I07B 3NO8A 4IESA 3ACGA 4IEZA 1RUOA 3CIHA 4P14A 1YWKA 3ON7A 2W94A 1SPPB 1EUUA 4IV1A 1J59A 4LOTA 2HWE3 5T5PA 1CAUA 1YC61 3MLKA 2EA7A 3OGVA 2E63A 2GNDA 3VD9A 1E57A 2XJSA 1UYYA 2ZZQA 3RMYA 4LBQB 3I49A 2G4IA 2R6QA 3ZKYA 2XBO2 5FBZA 5J1XA 4GA9A 1NCRB 1RUI2 4JTOA 1DLCA 3WVJA 1GOFA 3L2HA 4OUSA 4FPCA 2WZPP 3B7MA 1OQ1A 3I4IA 1SLLA 5EZWA 2GC0A 4MGSA 2NP0A 1SLTA 2OKXA 3M3QA 4CXYA 2UURA 4R4XA 4LO5B 3WUCA 3H1MA 1EAH2 3ES4A 2QQPA 1NYWA 1VBC2 3LGRA 4FFFA 3OEBA 4LBKA 3GCWA 3IAQA 2JD9A 1UN1A 3VBFC 5FZOA 1ENSA 1W6MA 3LPGA 5IAXA 5FP8A 1A8DA 5JSOA 1AR73 2ERFA 5LCWL 3MIGA 5C3OA 4BMBA 5LZ6A 4OUMA 3P5BA 5FPXA 2YC4A 3ACIA 3SQOA 1UPSA 3ZXAC 2CGPA 1C5IA 2HWD2 2J1SA 2O8QA 3SCGA 3VBFA 1VBE1 3ABZA 5FZIA 1LB2A 1RUD3 1EPWA 1W6PB 2WQ4A 2HWB2 4JKKA 1COV3 2IVIB 4D7TA 2Z2SB 2RS33 3X29B 1R1A2 4JDOA 2HWC2 5IVJA 2QTWB 1J3RA 5EJ1B 5E89A 1RUH1 1FAYA 1JI6A 1IZ3A 4YRDA 3ZFFA 4PIYA 4TN7A 1R093 5FMOS 3HOBA 4LITA 2VMCA 3HAGA 4YZ5A 2RR12 1RUE3 3NNFA 5FXXA 3N4MA 1JW6A 5ACA1 3U4XA 2XUEA 1RYYA 3D0SA 1N3QA 3K77A 1YI7A 2FHRA 4RD7A 1I3HA 5CKNA 5JSRA 5CISA 2Y0OA 1V00A 5FZ8A 4A44A 2ZAAA 5FWEA 5GM0A 1DYOA 3SH4A 3OY8A 4CP0A 1JYCA 1LODA 2YBKA 4JDNA 2DFBA 2R041 2D6KA 4DY3A 2CYFA 2OX0A 4I3GA 4LE4A 2YG0A 4Y1XA 3DYPA 4LK6A 5LK5A 5APAA 4HLTA 5HV4A 5FMCA 4EWDA 1ZBA3 5KHJA 3BU0A 4FFIA 4YG6A 2JDAA 4A6SA 1K5JA 4QKFA 1PO12 1YCIA 1BBT3 1AR92 1EP0A 1T6GC 1C8M1 1LGBA 4COZA 5JZGC 1XXNA 4RA0A 4Q4Y2 2Y6HA 4QQLA 4WM7A 1UXXX 1XE7A 4Q0SA 3BTZA 1RJ8A 4K9SA 1I1EA 4MG2A 3AMMA 3MICA 1OQEA 4P9GA 5IW0A 4XTPA 3LPFA 1FPN1 2P3JA 3AZXA 3U07A 3BN6A 3VDBA 1OVPA 4ARXA 4ET7A 3B94A 5JZGA 4FI9A 2DCYA 2R16A 4XUTA 1S55A 1GV9A 1VPHA 1W8WA 4NIGA 3RZZA 4ATEA 5IK8A 2DTWA 2GP5A 5HI0A 1UOGA 3FN9A 4RR3C 1G9DA 1WW5A 5IK5A 3JBG3 1QQP3 4Q4X1 2EXHA 3ZFEB 1XNTA 2XB6C 1S0GA 5C8CC 1RUC2 2HBUA 3POYA 2NM1A 2CU5A 2LS6A 4CVUA 1UMIA 2R1BA 3TN92 4AHXA 5D8AB 3WX5A 3LEIA 1X9TA 1JYVA 3EB7A 3OBAA 4RR3A 5BV6A 2NMOA 4A6OA 3H3UA 1QEXA 2JXAA 2J1EA 4JGZA 3M3EA 1QU0A 4XBLA 2XJQA 2BGPA 5C8CA 5FQ0A 2BGOA 3KCXA 1NY71 4CDWA 4MXWB 1DGWA 2WT0A 3ZIWA 2Y60A 4AI2A 2BBVA 3IWZA 4A7ZA 4M3CB 1US3A 2WN2A 1W8HA 3PURA 2QBXA 1W9TA 3AP5A 2WNUB 4GWMA 5D1IA 2Q8EA 3WDVA 2J1RA 2XDVA 3RJ2X 2O0OA 3ZYBA 3ZYJB 3ZMOA 4GKXA 4FPKA 1V6KA 1O5UA 1QJY1 4W6WA 1RVF3 4R52A 2P4EA 4AEJA 2Z5WA 4BCUA 5FZMA 2RMU2 3E5QA 2BQPA 1O8SA 3D4KA 4XFFA 4Y20B 5DAVA 2VM9A 4AK3A 4BLIA 4ASMB 3I59B 2WRAA 3AX4A 5T5OA 4TLGA 2IXIA 5FWJA 4DMIA 2LROA 3WF2A 3DKQA 3N9LA 3BPZA 2D97A 5JDBA 3UGFA 2B9VA 3I8TA 4AI3A 3VZKA 2B8MA 1ZX5A 2RDRA 1RINA 4R9AA 1PIV1 4Y5SA 2QE3A 5J7MA 1UYXA 2EIBA 4D69A 1ONAA 3FFQA 4LA2A 4DXSA 2Y0IA 4JKMA 3ZN4A 3O1VA 1Z0HA 1CAVA 3HEIA 4UW5A 1NXMA 2DWRA 5JI7A 5F39A 3FC0A 2WS91 5IJRA 4D6SA 1CN1A 3CJIC 1GSLA 4ARYA 5JOXA 4CCMA 5DG1A 2XBO3 4I0AA 3U14A 4AGRA 4DPNA 1KRIA 4DB5A 5FZ4A 1XYNA 1L7QA 3OBTA 1WGPA 3PJYA 1RUI3 1DBNA 2X10A 4BISA 5L73A 4K40A 3DL3A 5D8AC 3CJIA 1RUD1 1PGW1 4NRPA 3LDBA 4RGGA 2OUJA 3ETPA 1COV1 2BVVA 4Y1UA 1DHKB 3C7FA 4F8AA 3ZXEA 1ND3C 1H9WA 2VXRA 3N3HA 3H1YA 3LAGA 2D93A 1GOGA 1WMXA 1K45A 1YNAA 3NNLA 1EAH3 1STMA 4YNIA 5FZHA 5LY1A 1X82A 3I97A 1VBC3 2FDGA 1CIYA 4LO7A 2O8OA 4RYDA 1RUE1 3I2JA 5JPMB 5K8SA 3K4DA 1LNSA 4I3PA 1HQLA 1ND3A 1CZVA 2YDEA 2B4KA 4HVOA 1TEIA 2RM22 2RHPA 3IIIA 4FXGB 2XH6A 2VH9A 2VW0A 4Q4W1 3MIHA 4ZONA 3DEMA 4ONUA 1LOBA 3TOJA 5FUNA 1G9AA 5C3PA 2HWD3 3IN9A 3LSDA 1LGNA 4PLMA 3URFA 2YUEA 3ZR5A 2HWB3 2DV9A 1IHMA 1YJLA 5IK7A 1DYKA 1GQGA 1UOFA 1R1A3 1L3JA 4IQPA 3SCFA 2AUYA 1YJKA 2Y6LA 2HWC3 3M7AA 4L0PA 5FY7A 4BK5A 5BNPA 1QJZA 3BU7A 3J7LA 5H9PA 4AI8A 3TEWA 1KD7A 4IE7A 1KITA 1NA1C 1SZBA 2QKDA 3LOIA 4LMFA 5EJZB 1H9PA 2C9AA 2RR13 2OYZA 1SG3A 3C7EA 5BYNA 3WCRA 1PZ9A 4PI0A 2LUWA 4YG3A 3AKQA 3TEXA 3VDDA 1V6IA 5C4WB 5DUWA 3ZYHA 4PQ9A 1OLRA 3CL1A 3HQXA 2PAKA 4AEDB 2XLFA 3K4AA 4QX2A 3I2IA 1V6MA 3RZJA 1H1AA 1LOFC 5FOBB 3D6EA 4FOYA 4P9IA 1I5ZA 4S2HA 1O5LA 3AP7A 4Y5Z0 1OLQA 4QDRA 1US2A 4IEPA 5E1RA 3ZSEA 3MV11 4FBFA 1XJAA 2B9UA 5LBBA 4NIHA 4AQSA 1JODA 2IXLA 3OG2A 2GC2A 4OHWA 1AHSA 2IXKA 2QJVA 3WUDA 5FYIA 3VZOA 2WO1A 2Q30A 1PO13 1OF3A 1XC6A 3GJAA 4W6YA 4Q4Y3 4XJAA 3NWKA 1OBNA 1VRH2 1DGRA 3C7GA 5I8TA 4BQWA 3KVAA 2ADEA 3N7MA 1AXYA 4UYBA 4TWTA 5DXDA 3C2UA 1UMHA 1QH7A 3AFKA 2JE8A 5FXZA 3M4FA 4XACA 2YFUA 3UKTA 1MZ6A 5FZ0A 4Q0QA 2NPIA 2Z42A 5CKQA 3UJQA 5G05L 4KG8A 3KSCA 4DUVA 3NRUA 1TVGA 2IXJA 5EHDA 1B35B 3AMNA 3GHMA 3MW4A 3PTYA 4MGYE 4XBQA 4LIUA 1KFXL 1PVC1 1QJX1 4EN9B 3HBZA 2GMEA 3J7MA 1RVF1 4LO8A 4YG0A 1RUC3 5HPOA 4BQXA 1IKQA 1PX3A 4QWNA 3TN93 1V0AA 2G1MA 5JIAA 4R9BA 4IV3B 4WVMB 1K5MB 5G04L 5LATA 4C0BA 1WWYA 3I54A 2D6NA 2Q4SA 4NHYA 5J96B 3EXUA 5IVFA 3NAPB 4Y22A 3U75A 2QDRA 4XDOA 2QCSB 4DEVA 4DNYA 4DY5A 3N36A 5JMOA 2JWPA 2WA4A 3AYAA 4H55A 4PLOA 4UF0B 2E32A 4X8PA 1YXWA 5EQUA 5A32A 3KVBA 2B45X 4NUBA 3WZ1A 4AEDC 1PO21 1QWRA 4SLIA 4LK7A 3V65A 2RG4A 4RL7A 1ZREA 3O12A 1LEMA 2G9FA 4QKDA 3OUJA 4INDA 4YM0A 4TXWA 2FMDA 2QQKA 4KI5M 4WM8A 5I93A 1FI2A 5CFDC 2GN7A 3ZXDA 1Q8VA 2PHUA 1VJ2A 2RMU3 3OYWB 4QMAA 3VHNA 2XBO1 4G4FA 1F4AA 2JEMA 2ZCWA 1UQXA 1J3PA 2W1QA 1RUI1 4QB6A 4KMQA 3PMSA 2J1AA 4EZHA 3DPRB 4NAOA 1LAJA 1ZVFA 1LTEA 1FV2A 5GLVA 1BCXA 2GC3A 2WZR2 2UWBA 3JB8A 2ZZJA 4COUA 2PHRA 1ZRFA 1AXKA 1ND2C 2TBVA 3JZVA 4ISRA 3ZO0B 3D5OA 1EAH1 1T2XA 1JXNA 2VVDA 1C8M2 1DQ4A 2VL4A 1QY4A 5CB7A 1VBC1 5DZFA 5T3NA 3A23A 4XE9A 5DN2A 5DPNA 3E97A 1CZSA 3WV6A 4HFSA 3VD4A 3AMHA 4XHXA 3O1PA 2YGLA 1B35C 1MZEA 3RZGA 2WC2A 3DN7A 5FY4A 1UU5A 3VBRA 4PI2A 3VBOA 3WDTA 4UFKA 2VTXJ 3J4UH 3UJOA 4CDQB 5L19A 4H7MA 1A78A 2VNVA 3RZLA 4GKYA 3AYCA 3ZSMA 5F37A 4GJYA 3AP6A 1F2NA 3U1XA 4XJ8A 1OQDA 1UY3A 1DLLA 2XHKA 3H42B 4H7LA 5FZ6A 4Q4X2 2FBEA 2W87A 3WF0A 3OJBA 3AC0A 1R1A1 5FIXA 1BK1A 4P9YA 1VAMA 5A7WB 3MUZ1 1S4CA 5J98B 4JAAA 4RQPB 3ELNA 4A42A 5J48A 4AGVA 4DS0A 1CJPA 3PU3A 1H6YA 5DAQA 4CDUB 2RR11 3M3OA 1ACCA 2VJXA 2A6XA 4QPGB 1W0PA 2JIJA 3PUHA 3WP4A 4D3WA 1NXD1 2BW8A 1JZ6A 3ACFA 3PMEA 3QD6A 4A41A 4IEVA 2E7QA 5T5JA 1NY72 2W5FA 2Q5TA 2RM23 4COVA 2D3RA 5GKAC 5FZFA 1FXZA 2PFWA 4KBZA 3VD3A 2JDYA 5H9SA 3H50A 3AFGA 4CXWA 2HEYF 4FSJA 4ZS2A 1WCDJ 4K1YA 2OZ6A 1IQDC 4EN0A 1C1FA 1ZBE2 4KGQA 4KWKA 3ZMNA 1IPSA 1RJ7A 4OFGA 2DU0A 3K3OA 3NNJA 4NAMA 5KHIA 4BJ0A 1QJY2 2XLGA 5C33A 4AYUA 4RFT0 5LRRA 4B4QA 4CYDA 3A7QA 4CDXC 3IBMA 4XETA 5FPBA 4XIOA 1SEFA 1UCXA 3UESA 1PO11 4YGBA 1AR91 4KWLA 1C8NA 4XW3A 4H14A 4GWIA 2VU9A 4Q4Y1 5DAXA 1WMFA 4BDVB 1CIWA 3VBHA 3M2MA 3PUIA 3MIEA 2V73A 4META 5GZCA 1OUSA 2DCJA 4AXOA 4CDXA 1DQ2A 4LO6B 2Y26A 4NROA 4B3NA 1O3QA 3ETQA 1TME2 2D3SA 3EMRA 1W9FA 4AL9A 3PTRB 1QXJA 1DP0A 3NVCA 5FZ1A 4TSVA 1KDKA 4AHZA 5IWFA 2AGSA 2P17A 4X6RB 4N53B 1K42A 1W99A 3SKJE 5FBJA 3HN1A 1WLTA 4FPFA 4QXHA 4CDQC 3WDWA 2WS92 1YHFA 1HN0A 4HSLA 3ZSLA 4YFZA 5F1RA 1DQ1A 4DIQA 3B02A 4GWNA 4CCLA 4JGYA 4MGQA 4XABA 1AR82 3FMGA 1RUC1 3GBGA 4LHNA 1W8FA 4UW6A 1JOJA 4A45A 3TN91 2VZUA 3FZ3A 4OQ8A 4Q29A 4XJWA 2FDIA 3AJZA 2BYVE 2R072 3H8UA 1U12A 4WZCA 3WP5A 4RS5C 3ZN6B 4ZZ8A 2FZ2A 1QJU1 4MHUA 4ISQA 1VRH3 4LIVA 3E1F1 3ALQA 5A7QA 2NN8A 5T50A 2VAUA 3POJA 4CDUC 2C5DA 5FLIA 2BWCA 3LB9A 5L36A 5BXXA 4RS5A 5DAPA 3TRSB 4AFMA 5BNNB 1NX9A 4N9HA 4QGLA 1XRUA 5BY5A 3LFIA 2D6PA 4OZOA 3DGTA 1JHJA 3OPTA 4AVTA 1HIXA 5IYYA 4NIDA 2VMEA 5CEHA 2IXCA 5K0UC 4Q4V1 2CDPA 5GLZA 3KQ4B 4JTNA 3GF6A 3OGRA 2FD8A 2XONA 2B7YA 2Q1ZB 4FP3A 1CJDA 4Q4W2 3VBSB 4C1WA 2Z4FA 4FTBA 3B9IA 2AEZA 4YPJA 1F4HA 3KD4A 1ZM1A 1FX5A 3OEAA 5L7OA 3THTA 2B42B 2RV9A 1GZ9A 5K0UA 1MS9A 1GP4A 1P8JA 2ZEXA 3SISA 4BQ4A 2QQOA 1DZRA 1IS6A 1H1IA 1DZTA 1POV3 2TUNA 3VZLA 3VHOA 3LDRA 5FKCA 4NR1A 3PJQA 1IGOA 1SACA 1Z78A 1D7PM 3K2OA 1F9KA 2PAEA 3IPVB 5FJHA 3WF3A 3AVRA 1DU3D 3AXEA 5I0DA 4OCTA 1OVSA 2KM2A 1W6QB 3AL6A 3VZJA 2ZGOA 4EJRA 2HWF2 1W3XA 3QH7A 2X29A 3VKLA 4AI0A 4N53C 1QXRA 2Z69A 1VRBA 4LBQD 4P5HA 3WQ0A 2XPJA 4HN0A 1OC1A 1OOPA 4EN7B 2VZTA 4AF9A 3LCPA 3SH5A 1RB8G 2EF6A 2XJVA 5D2AA 3ZFGB 3NJYA 2R043 4FPYA 1VAVA 1EUTA 4AEMA 4P9JA 5F6KA 3APBA 2VZ3A 2WZR3 2WNVB 2IUWA 3H3ZA 4PT6A 2X5IB 4RGAA 1C57A 5ABJB 3RGBA 2VQAA 2P3IA 3GCXA 1HRV1 3RWNA 2C9KA 4H3WA 2JG8B 1SFYA 3SNMA 3MLJA 4XBNA 1C8M3 2PN5A 3O0XA 2P6CA 1IS3A 4BXFA 2W52A 1SFPA 2VQUA 3RI9A 1QJFA 5FJKA 3ZXLA 1TMF2 2FDHA 1URXA 4CTEA 4FOWA 2YYOA 4QQHA 1HB3A 4B4RA 3OOXA 4QX5A 4I09A 2DVDA 1S0DA 3R05A 4XURA 4JRLA 4A3ZA 4BWOA 4MV2A 3SXWA 4CCDA 1UZVA 1UZWA 4AQ2A 2G19A 5I0TA 2QDNA 4LUMA 5GLWA 3T30A 4OMDA 1W2NA 3FE5A 3H0OA 1PVC2 1QJX2 1EPZA 2CDOA 1W6NB 4Q4X3 4J1WA 4JZRA 2Q1MA 1W6OA 4LOSA 4M3CF 4AQTA 2BFUS 2D5HA 3VBUA 4OULA 3D82A 1C28A 3BOWA 2GH8A 5KXBA 1MZ5A 2ETEA 1YQ8A 4QX8A 3P3PA 1LR5A 4YW3A 1OH4A 4S2FA 4LBNA 1JZ8A 4B8EA 4KG0A 1TNRA 1MQTA 1IG0A 4FT8A 4XZUG 1GNHA 4PDWA 4HONA 4LLOA 1FNZA 4MZUA 1UYZA 1CONA 3IKWA 2K2SA 5A7NA 1VMHA 1OURA 3O1TA 2F6BA 5FZCA 1HJFA 4X6QB 3ZLIA 4JC1A 2YROA 1QKQA 3AKSA 4Y1VA 1AF9A 1PO22 2A71A 2D6LX 2WFF2 1AX1A 1PM7A 2Q0AA 3ORJA 3ENRA 3LIGA 1ZBE3 2R7EB 2GALA 1W05A 1RUJ2 2VZSA 2E53A 3ZFGC 1SLCA 3M3IA 1QJY3 2YY1A 3ZDVA 3O1RA 5F3EA 2X05A 4CXXA 1M4WA 1ZZ6A 4CSWA 5F3CA 2YPDA 4HANA 1MS0A 2UU8A 1PNGA 2WNVC 5JI9A 4DXZA 1QGLA 1ALYA 2N7GA 2WWUA 2PHTA 1NOVA 1D0HA 5FUIA 1WCSA 3VKMA 3J26N 2JG8C 1UKGA 1VRH1 1JU4A 2ZACA 3R4UA 4PJYA 1PNFA 2A3XA 3RPQA 4DFSA 4NWVA 2F17A 2YFZA 4LBOA 5DMYA 1OPMA 2OZJA 1XNAA 1PIV3 1TME3 3BIWE 3U10A 1UPIA 3W9AA 1HW5A 1Q8PA 2PLV1 3VKOA 5JSPA 1PGL2 1RXFA 1YIFA 1UO9A 4CP9A 2W95A 3HPNA 2D3PA 1HDKA 2ZX4A 3WNPA 2OT7A 2Y64A 2WS93 3HQRA 1Y9QA 4HG6B 4JQTA 5IATA 1RUG1 2BNNA 5IFPA 5E88A 2ZX1A 3ZN5A 1TE1B 5CFCB 3IDAA 1AR83 1NZIA 1WW6A 3PU8A 2LALA 1NE6A 1JUIA 2XKPA 4MXVA 4UFJA 1CAWB 3RYRA 2VGDA 2R073 4M3CE 4ZU5A 5C4WC 2ZX3A 4Q1PA 4DUWA 2Y6GA 4CZSA 1UW8A 2WWJA 3WG1A 4XF0A 2J7MA 4QHOA 5A6QA 3PL0A 2YMZA 4FVVA 4GH4C 1POV1 4Y5TA 3CLPA 1UF2C 2FCUA 2VBBA 3J8F2 3K51A 3OGGA 3NJVA 4ASLA 2CWSA 1UX7A 3H1WA 2B39A 3P3NA 3VL8A 1YYNA 3QBQA 5J3UA 4TZDA 1LU2A 3KT1A 2Y6KA 1SHWB 4HSJA 3USUB 3CEWA 3I3QA 1XU2A 3JUUA 4GH4A 1FYUA 1EV12 3W58A 2BTVC 3BYWA 4L9BA 2VZPA 4EWEA 4JGZB 4Q4W3 5DAWA 5HXMA 1OA4A 2WWSA 3LFMA 4N8MA 1CESA 4I02A 4EN6B 2ET7A 1E5SA 1D4VB 3A21A 1S1AA 4SBVA 4YLZA 2QFEA 1LU1A 1RHI2 2VCCA 1SPPA 1RGSA 5I8SA 5ISLA 3FWEA 1NUKA 1NCRC 4LR4A 2EAKA 5C71A 2ZMLA 4UBHA 2WZR1 1S0EA 4XVHA 3VKFC 4ZU7A 5H9QA 2XGXA 3FHAA 4LBQA 5A1FA 3NV2A 2E51A 2RJ2A 2ZMKA 4Q1RA 5IHRA 1RTVA 1X7NA 4NIAA 1KS4A 4XCBA 1NCRA 2QNKA 4AVVA 1O8PA 3BTXA 2D43A 4LBMA 1QH6A 2JICA 1H2KA 3AB0A 5CIRA 1E5IA 1RMU1 2HWF3 4QXKA 4ZXEA 1W0NA 1QNWA 3IZOA 2NZ9A 3VBRC 1XE8A 5FZ9A 2IVJA 4DZGA 1H2NA 3V56A 1W8NA 1NG0A 1K12A 5GALA 1AYN1 3W20A 1FNYA 5KHKA 2GC1A 1REDA 4JV4A 4MSVA 5A33B 4JHTA 4QPWA 5FK7A 3J7NA 4U36A 4XIKA 3HIFA 4K20A 1YFUA 5TSWA 2IZWA 3EHKA 4IE0A 3VL9A 4A2UA 1GWMA 1H2LA 1FATA 2QZ3A 2EIGA 4LO4B 5FYHA 1JU3A 2VCBA 2Y38A 3OPWA 4GIQA 4JKLA 3T4VA 5JIUA 2Q8OA 5EXOA 5E6HA 2Q8CA 4LEJA 5FY8A 2TEPA 3Q8BA 2WSUA 5A3OA 2RE9A 4D0QA 1QJU2 1S2BA 4QM8A 1Q43A 3UK9A 3WDXA 5DDJ2 1WZXA 1LGCA 4XJ9A 4UOJA 1OFSA 4FQZA 1TMF3 4N43B 4AHYA 4ATFA 5JXGA 1A3KA 1GP6A 2K9ZA 3OSDA 3Q8EA 2D44A 3WDUA 3S0MA 2JG9B 2JJ6A 1ODMA 4XXPA 4PLNA 2WN3A 3WT3A 1W9YA 1PHMA 4LA3A 2ZX0A 3PVBB 4QQOA 1NCQB 1WD4A 3LOBA 1GANA 2HEVF 4LNVA 2VNGA 4W50A 5AC91 1J84A 1W03A 1Y4WA 1RUNA 3R4DB 1ZBE1 5J36A 3N7LA 3V0AA 3ZPOA 5FZ7A 3JCIA 1ENQA 1PVC3 1QJX3 4Q4V2 2ZHNA 4AEKA 4FQ4A 4JQRA 1WLCA 2GZWA 1POQA 2VG9A 4Z2WA 1YQCA 2VZQA 2GDFA 2KD7A 4R8HA 4AOCA 2XMLA 3MIBA 1RL3A 2DCKA 2UYBA 5FPZA 1H8VA 5FPUA 3ZXFA 1WA6X 4LUKA 5FYZA 3HNBM 1NQDA 3KV4A 1PZ7A 1LOAA 4LT5A 1X8MA 2EXIA 2IWGB 2IXHA 2ORZA 1VAKA 3E6CC 1BK0A 3AKRA 4B29A 1LESA 4CP2A 4JHZA 1TME1 4H2AA 4LTAA 4IGQA 2PQQA 4WZFA 1DQ5A 1PO23 4EYUA 2ZBJA 1H8TB 2VNOA 1ZRDA 3HWJA 1AL22 2B46X 2HYKA 2V09A 1BMV2 4MLOA 2VUAA 1XE0A 3WW1A 1RUJ3 4FO9A 2ARXA 3GGLA 4AG4A 3WHUA 3IDEA 5F3IA 1DF0A 5GLUA 5ANNA 1AR81 5CA6A 2JDPA 4JVAA 2D7FA 1LJ7A 3ZFEC 5KC6A 4MH0E 1BKZA 3HD8B 1O7FA 2R071 2BDRA 2BNOA 1UY2A 4QU1A 4YVWB 3RRDA 3UGGA 1AJKA 5DZGA 5FP7A 4XFIA 3H8RA 3L9JT 1LHOA 4RHV1 2JKXA 4O7XA 4NO4A 4O9GA 2WLPA 3WNKA 1W8UA 3O1MA 5A3TA 2XWJB 2OUHA 3ZFEA 1FT9A 1RC6A 2ORXA 2BOJA 1HRV2 2W9XA 4QPIB 5FY1A 5D8AA 2JG9C 1CQ9A 5FYSA 3OBZA 3V0BA 2VOVA 3OD0A 1HRI2 3CHXA 1RUF1 2BRTA 2VCMA 4K7JA 3Q8CA 4CA9A 2W1SA 2WNUC 1N1YA 3DV8A 3TBDA 3OUIA 4EZ4A 1J1LA 4CEWB 4MXWA 4UI9L 2MPFA 1HN1A 1XB9A 5T55A 3WP3A 3HN3A 1JYNA 4M3CA 2ZJCA 3U0ZA 3GBFA 2R30A 2BVBA 2HKXA 1HJGA 2WNUA 4W8JA 2HBTA 3LSEA 4GULA 4O61A 4P9LA 3A4UA 3NQHA 2A6VA 3Q9OA 5BPXA 3F95A 1H0BA 1NE4A 5FCCA 2LRPA 4URAA 3QOPA 4GB32 3J8F3 1CAXB 2C1FA 1V6NA 5EIYB 4Y20A 1O4ZA 1KGYA 3I59A 5FP4A 4ORFA 4MGZE 3HNMA 2ZAHA 2FDJA 3LA7A 2LW8A 2WZEA 2K0GA 1LHUA 3N7JA 4G3YC 1WKYA 2A6ZA 2HWF1 1HB2A 1QOOA 3ILFA 1H8TC 1I9RA 3TWIA 1QDOA 1GNYA 4FFHA 5H9RA 1NA1A 2VOTA 5LA9A 5F9TA 4IE4A 1PK6B 2W68A 2WT1A 3AMQA 4V1PA 3GZUC 3VDAA 1G8WA 3SMHA 5FKBA 1RHI3 3CO2A 3T3YA 2XR4A 2R1DA 3QLQA 3SKVA 2QQVA 5F5CA 1G7YA 1W8TA 4AI9A 3ST7A 4YGEA 5DZEA 1LOFA 5LBCA 1GZTA 4M00A 4QQPA 2A5ZA 1AR93 2IFRA 3DUIA 4QPIC 1GWKA 2DBIA 2ARCA 3UV9A 3PDQA 3B9CA 4FFGA 1NT0A 2UYAA 3FFZA 2VMDA 1CX1A 4GMP0 1TMF1 1SCSA 4BLJA 1NLSA 1W2OA 2WNOA 2XLAA 3DKWA 3OF1A 5I0RA 1AR62 4GWJA 4Y24A 3BCWA 2PLV2 4BIOA 4Y1ZA 3WW2A 1WCUA 4LE3A 4CEWC 3GYDA 4QM9A 4F7ZA 1BJQA 2BZDA 3B3QE 4PBPA 4UAPA 5GJ6A 1RUG2 4HPKB 4Q0PA 1T6BX 2DFCA 3MF9A 4UT5A 4CEYB 4I01A 4J25A 3M1HA 3POWA 1BEV2 3MUY1 1OKQA 3ZR6A 4QB1A 5B2GB 2VOXA 5A7OA 1S2KA 3HBKA 1JMUB 3VZMA 2H0BA 3H7JA 4FAGA 1QJU3 2DVGA 3R6SA 3WD5A 3EQEA 3JD72 3WR0A 5FZAA 3AZZA 2UY8A 2ZEZA 5DDJ3 1H6XA 4QXCA 4WBBA 4YGCA 3RFRA 5FOJB 1LOCA 1XQNA 4UFHA 2D6OX 2WA3A 3LKJA 2NLRA 2YC0A 4AFDA 1VIWB 3NKTA 4GALA 3C8XA 4DEQA 1VLNA 5CYYA 3FX3A 3S5QA 4M0NA 2WFF1 2VCAA 2BJSA 1PK6C 3MYXA 2IFWA 1M06G 3BUCA 4PCRA 3IAPA 1RUJ1 3HT2A 2VNRA 3LEMA 4Q4V3 2TNFA 1TQ5A 1VBD2 1SBDA 3HJRA 5C4WA 4AEDA 2R0HA 1BXHA 1ZZ7A 1O91A 5F5IA 4E4DX 1YUDA 4URTA 3TYJA 4L92A 4OI4A 5IVBA 4BA6A 1JS9A 3RDIA 5CFDA 2PXJA 5DABA 4YARA 1FOD1 1HLCA 1O6UA 5CAZA 4HK9A 4UBGA 1MPXA 3FL7A 4ZHNA 1AYM2 1JOBA 4IGPA 4NRQA 3I3DA 3LEGA 1UOJA 5LBFA 5T52A 4AI1A 4EE2A 1O59A 1PGL1 4AWDA 4QDQA 1ZNPA 3DYOA 4XCAA 3LF7A 2Y6FA 4QDSA 1Z7S1 1AL23 2QZ2A 1BHGA 1RMU2 1W8OA 2ZKLA 5A3NA 1GLHA 2VVEA 4BZ4A 4LKEA 4D6RA 5KXDA 2CHHA 3MDPA 1ND2A 2C6SA 2OVUA 3E5XA 2RJLA 2VXJA 4G9SB 4M0HA 4XDPA 2OXBA 3WNNA 2F4LA 1AYN2 2ZXQA 1CD3G 3UNPA 1TZOA 4BPZA 4RSUA 1MZFA 3MGUA 5EWSA 4F83A 5L9VA 3U78A 4RFRB 3FHIB 2HYXA 2OQ7A 4AZZA 1C1LA 5BNQA 4HK8A 1Y9GA 4IV3C 1B35A 3WNMA 3N9PA 3PUSA 1K5MC 1WW4A 2BGCA 4XAAA 1REEA 1OT5A 2CAVA 2ZOEB 4IL7A 5KHGA 1UZYA 4AVSA 5EYXA 1HRV3 3GDBA 4N90A 3J8F1 3OTFA 4A4AA 5KXEA 1MVQA 2GNTA 3NAPC 4OHVA 5E8AA 4IV3A 2E9QA 1OHFA 1OA3A 1HRI3 1Y3TA 1K5MA 4WVMA 5KR7A 3F2ZA 4HVQA 4E8CA 1N47A 1QIQA 4MGIE 5FFOC 1EV11 3WNXA 3W5NA 4Y4YA 1YIPA 2HJIA 2ZGTA 4XYXA 2IC1A 4FPOB 4HKOA 4I30A 2VR4A 3NAPA 3NW4A 1J83A 4PHZA 5C5TA 2CY6A 4BE3A 2ZGSA 3R4SA 5FUPA 1ULEA 2VBPA 4UF0A 2HEWF 2W91A 5AC92 5CBLA 5JWPA 5C9AB 1RHI1 3T0AA 3B69A 3H8OA 3INAA 4ZS3A 4NRMA 5BNOB 3U37A 4C90A 1V70A 4PIZA 5C70A 4LKDA 1QOSA 3NV3A 2W46A 3POSA 3DPRC 2GSYA 2RDQA 2XOMA 3KV5A 1EYBA 4GB33 4Y4RA 3C7HA 5F6LB 4XJZA 1F8VA 1HKDA 2WO3A 5CZKA 1UX6A 3GZTB 3D0JA 3H7YA 3NSTA 4LULA 1UXZA 3T4HB 2UY9A 2WAOA 2ZHMA 1NKGA 4YW5A 3T0BA 5F7UA 1GZWB 1OUXA 5DQ0A 5CG9A 3U11A 4AVCA 4B1LA 5FXWA 5C6CA 4Q27A 5FXVA 2VZOA 4IEWA 4XFAA 1G9BA 2ZS6B 4XFBA 4OYUA 3O5SA 5FPLA 4GMP1 3WXPA 4YGDA 4YM3A 2Y6JA 2ZGLA 5JUVA 3GZEA 1KEXA 2EALA 2ZPXA 4MGTA 3M3CA 4NE9A 2SLIA 1IG3A 1S0BA 3BVCA 4Y1YA 4KBBA 2CSGA 2A7AA 3SITA 4NHKA 5FZDA 3HVDA 1ZA7A 2ZGMA 2P34A 5FYBA 4XMAA 5FZGA 5SV8A 4CDQA 2WT2A 4MGKE 1OKOA 2O1QA 2JB8A 2Y33A 4RHV2 4RQPC 4YSFA 3CJXA 4OHXA 5AFBA 5DDJ1 4P00B 2RS51 4NHLA 1AXZA 2Y8KA 1PM4A 5GZEA 4QPGC 1AR63 2WYFA 3KT4A 5FMDA 2VZVA 4EN8B 4QKBA 2YXSA 5A3WA 2E7AA 2DUOA 2C0ZA 2PLV3 2RS12 3KT7A 3C3VA 3KM5A 5A7WA 3WQ1A 2H0VA 2VPVA 4RQPA 1LENA 4NJ4A 5FYUA 4ASKA 1UY4A 3N9NA 1S2EA 1RUF2 1QHDA 5FMOL 4CDUA 4YVSB 1MS8A 3KV6A 3NV1A 3OCPA 4QPGA 5FPVA 5JOYA 2DUQA 5A6ZA 1H1MA 1RUG3 3LD8A 3T1MA 5C9AC 2AC1A 3ES1A 4XF3A 2XG3A 3ZSKA 5BNOC 3LA3A 4LKSA 2VVFA 3G6JB 3B01A 4MOAA 5KHHA 3AL5A 2W1WA 1GOHA 4IETA 3SCHA 5JXJA 2VMIA 4CU9A 2CTVA 3UETA 2Z79A 4Z82A 5I0UA 4CP1A 2PELA 1SDDB 1X33A 4OHZA 5K9YA 5HV0A 3MFCA 4XQWA 1Q56A 3SLIA 1W6OB 4GAZA 4P5YA 4CPBD 3RZKA 1HB1A 4BK4A 2QQJA 5A80A 1LOGA 4QT6A 4CUCA 1BVVA 4D8MA 1AL21 2J42A 4CCNA 1BMV1 4BMEA 4X8NA 4A7KA 3CU7A 4YM1A 1E5RA 2BV4A 2PMWB 2ATFA 4P02B 4D7SA 2GP3A 4R4ZA 1MQTB 1VBD3 5IVVA 2EICA 1MEC2 4J1XA 3JQXA 4C0HA 1AUYA 2XXZA 3MW3A 2NQYA 1JZ2A 5F2WA 3ZSJA 5JLVA 1GUIA 4ZZ5A 1YQ6A 2MNGA 4N53A 3RJRA 2W2IA 4MO3M 3MFAA 4AGGA 4IV1B 4GJZA 2GNBA 1CAUB 1NZCA 1AYM3 3KB5A 4KU7A 1E5HA 4QPYA 3VZNA 4M4PA 4XC9A 3KF3A 1U5ZA 3ZYFA 1LECA 1MVEA 4LHKA 1KDMA 1XYOA 4IEQA 1HB4A 1YQ2A 2V72A 3PVOA 4MHRA 3ZN6A 1HRI1 5BNNC 3SEEA 4WVVA 4HT1T 5AVPA 4GD4A 1RMU3 5CU1A 2CGOA 3AVSA 3ZIXA 5J37A 4FPHA 2PA7A 4IEXA 3O1OA 1D4M1 4HKLA 4YVSC 2EIDA 4TTGA 1DGWX 1AYN3 2ZHLA 3T0DA 3FLRA 4P9XA 3O14A 5LA2A 5BNNA 1JYWA 2YHJA 3VBSC 1GBGA 3RYKA 4LHLA 3WP6A 2OQ6A 2D98A 3WHTA 3FHQA 4HMZA 1O3SA 5FY9A 1JZ7A 2GMPA 4E27A 3BB6A 1VB2A 1WA4A 2FDKA 3I3MA 5ANQA 1LHVA 5FZOB 1W6MB 3VBSA 1YQ5A 4GB31 4BB3A 4D6QA 3TNQA 2ES3A 2XJUA 4L97A 2ZGNA 2VECA 2KXLA 1LHNA 1YFYA 4QHBA 3T1LA 3OBRA 4BQ1A 2JECA 1RIRA 5FAXA 4XILA 3RI8A 3VBFB 4Z2AA 2JIGA 2JB4A 3FLTA 4PIXA 5FYMA 3WLUA 2J1TA 4NHMA 3ZYPA 4HBNA 3LQCA 4CCCA 3VN4A 5IVCA 1QF3A 4C8DA 3AJYA 1DZQA 3IPVA 2DVBA 2EXKA 3HT1A 2A6WA 2JE9A 5AC93 3TB0A 2WFPA 1FMD1 3ZFFB 4XHBA 2XL7A 3LE0A 4UFIA 4Q8LA 4CUAA 3U4SA 1YLLA 5JR7B 4LXLA 4IEUA 3DXUA 1JYTA 3MZHA 3I3EA 2JE7A 4FOQA 4IERA 2QVSB 2VOKA 2CWMA 4D7YA 4C91A 2JDNA 1WCKA 1OA2A 2X5IC 4AR2A 1W0OA 3NNMA 5ABJC 1KFUL 3AP9A 1QMJA 2MEV2 4LPLA 1S0FA 3ZFGA 1UY1A 5FZ3A 5KWRA 3OY8B 1FOD2 3EJKA 2P3YA 4LQRA 1VBB2 3WW3A 1IOAA 1BYHA 1KJLA 1UNBA 1V9U1 2WNVA 3ACHA 4K21A 1AR61 1GMMA 2X5IA 5ABJA 1W28A 4CU8A 1W06A 2AZ5A 3KZ4C 1JH5A 1WCQA 2JG8A 2NYYA 4BH9A 2XJTA 2DCTA 3CF6E 1Z7S2 4COYA 1LHWA 3CZUA 1ZZBA 3ECQA 5JVVA 3EYPA 2CV6A 3BODA 1DQ6A 2A73B 2WQZC 3MIFA 4OHYA 4Q5OA 4WM7B 3THDA 4QX7A 1BEV1 5JOWA 3BGAA 2WZ8A 3R0RA 4BOWA 1UIKA 4IXLA 1HXS1 4OLLA 4HOOA 4BXSV 4FAHA 5A6XA 3O7OA 5FO7B 1XU1A 1JZ3A 4BQ3A 3AYDA 3UT0A 5JZGB 2PHDA 2R062 3JD71 3LIHA 4RHV3 4WV8A 3ZDSA 5FDBA 3I7DA 3RVHA 4QX1A 4N7IA 4NMIA 4EQVA 4XXAA 4Y26A 1W6NA 2YU2A 1JTZX 3ZXJA 1LEDA 4R9CA 5JXHA 2RS13 2C26A 3M70A 2Q8DA 4BU2A 1GQPA 1H4GA 2XVKA 4CCJA 1OMIA 2JDHA 2PAMA 2RVAA 1RUF3 1SLIA 3NNGA 3LZZA 3WNLA 4L11A 4JCKA 4AFBA 1F35A 2WAAA 3B93A 4RR3B 5DUXA 2E31A 2ZEWA 1Q8OA 1AX0A 2ENRA 2E6VA 3CDZB 4I0BA 3ZFFC 4F3JA 1OFNA 1VBD1 4E4HA 3MF6A 4YW4A 3MPBA 4EWAA 5C8CB 5FQ0B 1CPNA 1U5XA 3VGIA 4CDWB 1KXGA 2HH9A 5FP9A 1PVXA 4XFCA 4J6GA 5F3GA 4CPBA 3AMPA 3K4ZA 4NPLA 4QGMA 2F4PA 3WINE 4DQAA 2H6CA 5DG2A 3NJXA 2W92A 1UKRA 1UY0A 2FQPA 2JX9A 4KWUA 4AAXA 2QUOA 5JAXA 1MS3A 1VMJA 2A70A 1WW7A 2E26A 4YW2A 1AYM1 2DF7A 2OPKA 2P2KA 3V0AB 3IDCB 5GZGA 1SFNA 1OPOA 3JU9A 4FTSA 1L7LA 1X9PA 4YW6A 2X8KA 4I0WB 1B09A 2EAAA 1NLQA 2DCZA 4P08A 1UMZA 3QACA 2VE1A 3AXDA 5LASA 3KCCA 1KS5A 3WDYA 4JX0A 1VMFA 2BEOA 2J1VA 2P1BA 5EFUA 5C8WA 1G9CA 1C5HA 2RJKA 3P1IA 4V2VA 3KHCA 2PTMA 4M4RA 1MEC3 1L7RA 2DVFA 4WM7C 4E2GA 5BUVA 5CFCC 5CVRA 1WMDA 1W39A 4IUGA 2WR9A 2XKOA 3MO4A 1A8MA 1ULFA 5A6YA 5K7PA 1Y43B 3N35A 2BERA 5JCTA 3S6PA 3I2FA 4LHSA 3T2PA 3CNAA 1CAVB 1Q8SA 1F31A 1Q8QA 1JZ4A 1V6JA 4QXBA 1R081 1ULOA 5FY0A 5CFCA 4ZY9A 1O4TA 3WNOA 3Q8AA 5KBFA 3ZPYA 1ZZ8A 1I6XA 3J9SA 1CAWA 2JENA 4XDQA 2E33A 3RS6A 1Y7BA 4PBOA 2P37A 5HXVA 4DINB 1CWPA 3ATGA 4PF1A 3T2OA 2I45A 1O3RA 4OQ9A 2XUMA 1W6PA 2RS52 1AX2A 1XYPA 3LDKA 5HCAA 3DXTA 3AZYA 3LA2A 2VQ0A 5LA1A 3CJIB 3UKNA 2A75A 2FCTA 1Q5OA 4Q8KA 2XHNA 3KLSA 2BNMA 3RWKX 3RNSA 1DFQA 4QB2A 4FOVA 1OD5A 4JGZC 3RG0A 5FPAA 4CUGA 4NN0A 3WG3A 5I8YA 1ST8A 4CDWC 3USUA 3DECA 1FV3A 2OIIA 3MI8A 4COWA 5A3UA 2VUCA 4QX0A 5F2SA 3ASIA 3ROUA 1IPKA 2VW2A 2EIEA 4ZPIA 5LEKA 2XQRA 3K46A 3PVEA 5I0SA 1ND3B 2A1XA 4LORA 3OPZA 3FBMA 2AR6A 3B5LB 2WL1A 5F32A 3N7KA 4CE8A 4AFCA 4UW3A 1IS4A 5B4XA 5J09A 3C7OA 3PLQA 3RZHA 5A7PA 2YV8A 2DYCA 2HWE1 4XAEA 2FDFA 1AJOA 1X50A 1ODNA 1VB4A 3OB8A 1NAEA 4N9IA 4OI1A 4Z92B 1WBLA 4LJHA 1SBFA 1A34A 2VTXA 4GXLA 5BNPB 2CL2A 2WFF3 4GQ7A 3WF1A 3WY6A 3KS7A 2X09A 3BALA 1DYPA 4LLFA 2WDBA 3S5AA 2ZTNA 5JXIA 3VHRA 1GU3A 1WMEA 4HXCA 1DGRN 2C24A 3WEZA 4DO0A 2I2SA 4LBLA 1XBFA 3VDDB 5LBEA 5LEJA 5GLTA 5A33A 3FJSA 4AQ6A 2W3JA 5IVEA 2D6MA 3RZMA 3L2YA 1NA1B 1Y9MA 2MEV3 2ZA9A 5C3RA 2AENA 2QQIA 1PZ8A 5T54A 3AYEA 3VKNA 1FOD3 3P6BA 4TLFA 1VBB3 4AW7A 1JBCA 1F15A 4W6XA 3NL1A 4BHPA 4N43C 2RS11 5DUUA 1OI6A 4K6BA 5C7GA 4OI0A 2AREA 4Y33A 2AH2A 1N1SA 1AR71 2XVGA 4AE2A 1ZZCA 4P9WA 4FPEA 1WLWA 4KH9A 1Z7S3 3BPSA 4AFAA 1JZ5A 3MBWA 3ME2A 1NCQC 2LM3A 3VLBB 2BUKA 1IPJA 2YGMA 4QD2A 4XTMA 1D4M2 2GU9A 1W2AX 1SDWA 4N43A 5ERLA 4L8QA 2VTFA 4DXRA 2JG9A 2ID4A 2GNMA 2JDKA 1PMJX 1ASJ2 1J1TA 3PUAA 1Q3EA 1JHNA 2RS31 1NCQA 5IT6A 2VOWA 3KHBA 4K1ZA 3POEA 3MV01 4AHWA 2R063 3BI3A 1SCRA 4AVAA 1JN2P 4XQDA 4XF1A 5EV7A 2H6BA 2R32A 3ILNA 4IE5A 3FUOA 1R091 3VV1A 3H8XA 1LCLA 2D5FA 3IB3A 2XQXA 3IMMA 5FO8B 2QQUA 2ZKNA 4XFGA 3VD5A 4Z07A 5CNAA 3WCSA 3POIA 2O14A 1A6CA 5F5QA 5GZDA 3A0KA 3J7HA 1WD3A 2VMFA 3MLLA 5FTTC 4BYYA 4OVEA 4IDZA 4WVZA 5BNPC 1EV13 4EV0A 1F5JA 1CX4A 1ZA4A 4GZ9A 5FY5A 1R1ZA 4WVWA 5HCFA 1KQRA 2ZGQA 4IGOA 4E4ZA 1N1VA 3TEYA 1KJRA 1MEC1 1ENXA 4Y22B 1BLZA 5C3SA 1PX4A 4K3UA 1XNKA 4FP2A 1ZBA1 1FMD2 1H8TA 4S2DA 3ITQA 4Q2FA 4UFMA 5A32B 3VDDC 3V0BB 4YVWC 1BBT1 3K48A 4ES9A 1WUVA 1VE0A 4LKFA 5FZEA 1D2QA 4XUQA 4XUOA 5CKMA 4NPRA 4XEZA 2ADDA 4RGKA 4WM8B 3PHMA 3MW2A 3CBNA
chains in the Genus database with same CATH topology
5A6QA 4CE8A 2BP6A 2JDKA 1OVSA 2CHHA 1OXCA 1UQXA 1W8HA 5A6ZA 1W8FA 2WR9A 5A6YA 3DCQA 3ZDVA 2JDHA 2BV4A 2JDYA 1OUSA 2BOJA 2VNVA 5HCHA 1OUXA 2VUDA 2XR4A 2VUCA 2JDNA 5A3OA 2JDMA 2BOIA 5D2AA 4AOCA 2JDUA 4UT5A 5A6XA 1OURA 2WRAA 1GZTA 1OVPA 1UZVA 2JDPA 5A70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A6Q A;  4CE8 A;  2BP6 A;  2JDK A;  1OVS A;  2CHH A;  1OXC A;  1UQX A;  1W8H A;  5A6Z A;  1W8F A;  2WR9 A;  5A6Y A;  3DCQ A;  3ZDV A;  2JDH A;  2BV4 A;  2JDY A;  1OUS A;  2BOJ A;  2VNV A;  5HCH A;  1OUX A;  2VUD A;  2XR4 A;  2VUC A;  2JDN A;  5A3O A;  2JDM A;  2BOI A;  5D2A A;  4AOC A;  2JDU A;  4UT5 A;  5A6X A;  1OUR A;  2WRA A;  1GZT A;  1OVP A;  1UZV A;  2JDP A;  5A70 A; 
#chains in the Genus database with same CATH topology
 4QAW A;  3W59 A;  1VBA 2;  1WBF A;  4YVW A;  3ZYR A;  2G9Z A;  2WO2 A;  1F5F A;  1MAC A;  3AZV A;  5K4L A;  3N9Q A;  3UYJ A;  1YO8 A;  3ILR A;  4B7E A;  3G7D A;  4YW7 A;  1GYK A;  4CCK A;  4YFW A;  1V9U 2;  2P3K A;  4ZXK A;  1W90 A;  3VDC A;  5CFD B;  3GZA A;  4QGN A;  4QPI A;  3JBG 1;  2FCV A;  4YYO A;  2PHL A;  1QQP 1;  2V4V A;  2VUJ A;  4HZF A;  3JQW A;  2JDU A;  5JOZ A;  1OLM E;  4GMP 3;  2WNE A;  4OMC A;  2ARB A;  2K46 A;  3GAL A;  3LEK A;  3MPP G;  2ILM A;  5DUV A;  5HBA A;  1YRZ A;  4CRQ A;  2DDU A;  4XZP A;  2DU1 A;  2RDN A;  4CEW A;  1HQN A;  3QH6 A;  4YZ4 A;  4UWD A;  2XJR A;  2BU9 A;  1HXS 2;  1ND2 B;  2BP6 A;  4A3X A;  3TEZ A;  3NMB A;  4UFL A;  4FPG A;  4Q26 A;  3VBR B;  2WSV A;  3VBO B;  3USS A;  2CAU A;  1DQ0 A;  1ZRI A;  3RYP A;  3PIJ A;  5F8P A;  2Q1F A;  5L9B A;  3SH3 A;  2RS5 3;  3I2D A;  4IEO A;  1UZ0 A;  3ZM8 A;  1LKN A;  5EJ3 A;  4BQY A;  1W04 A;  3EBR A;  3IT8 A;  1W3V A;  2VUL A;  3BKZ A;  1CAX A;  1APN A;  2BPA 2;  2BOI A;  1X36 A;  1GZC A;  1PGS A;  5FYV A;  2YBP A;  4NOT A;  5HCB A;  3VD7 A;  3OGJ A;  2E7T A;  4AVB A;  3WQB A;  3RQ0 A;  4ZKT B;  3RSJ A;  3WW4 A;  3ZYI B;  3S7E A;  4CU6 A;  1AL0 G;  2G9G A;  3VHP A;  5IVY A;  2QQN A;  2VC9 A;  3GXU A;  4MVT A;  5FK8 A;  1VBE 2;  1TG7 A;  4Y3O A;  2J22 A;  5A3M A;  4DUX A;  1NLR A;  5AVA A;  5IUQ A;  2YB7 A;  1GWL A;  5CAD A;  4BQ5 A;  3DCQ A;  3WG2 A;  1PK6 A;  1J58 A;  2VO5 A;  1O3T A;  4JDM A;  3AP4 A;  3E6D A;  4FTE A;  5FZL A;  4NII A;  2MEV 1;  4W65 A;  4WM8 C;  1RUH 2;  4E2Q A;  4E2S A;  2UWA A;  4U2A A;  4HET A;  2ZGU A;  1UWW A;  5FRE A;  1VBB 1;  2JKB A;  5FYT A;  3S57 A;  3ZOI A;  2YPJ A;  2W0X A;  4UXA A;  5ACA 2;  3POF A;  2SBA A;  3BTA A;  1MS5 A;  4YM2 A;  2GN3 A;  3B00 A;  1V6O A;  2CGN A;  2J1U A;  2QQL A;  5FV3 A;  4O9E A;  2YBS A;  1AZD A;  3THC A;  4KU8 A;  2QQW A;  5CG8 A;  1W2T A;  4HVR A;  1J3Q A;  3KGZ A;  5SV5 A;  1XPW A;  3DF0 A;  4E8D A;  1RXG A;  3BTY A;  3CMG A;  4N7U A;  2X53 S;  3PIG A;  2R04 2;  3JXS A;  3VBH B;  3A0N A;  4CEY C;  4CDX B;  1G9F A;  3S30 A;  2OPW A;  2A3Y A;  1HV1 A;  3E5U A;  1C3H A;  5C3Q A;  1N1T A;  1TNF A;  2JD4 A;  4TYS A;  2R06 1;  1ZRR A;  3I2H A;  5A7S A;  2DTY A;  1SBE A;  4HPK A;  4XFH A;  4QQ2 A;  1ULG A;  3VBO C;  2OW4 A;  4CEY A;  1UD1 A;  3ZVX A;  1U0A A;  1R08 2;  4DXT A;  1QDC A;  3ZX7 A;  1ZRC A;  1N3P A;  4R9D A;  2BFU L;  1ENR A;  1FPN 2;  1UL9 A;  2WUH A;  4JGY B;  4K8F A;  5JMC A;  3THP A;  2PHW A;  1W9W A;  2PQS A;  1ZYB A;  4BQ2 A;  5FLH A;  2DUR A;  2ZHK A;  3O0W A;  3H3L A;  1IS5 A;  2YU1 A;  1SLA A;  1QJE A;  5IAV A;  3T2T A;  1D4M 3;  1OF4 A;  3UKV A;  3WOG A;  2W1U A;  2HWD 1;  2C4X A;  1DDL A;  4BIF A;  2VUD A;  4QHZ A;  2HWB 1;  4KQ7 A;  1ASJ 3;  2DBN A;  4XF4 A;  1GKB A;  5AFE A;  5LY2 A;  2UWC A;  5LB6 A;  3UGH A;  3FUQ A;  2ZAB A;  2HWC 1;  3JB4 C;  4RS5 B;  1CPM A;  3W5M A;  5FP3 A;  4AAP A;  2ZMN A;  3T08 A;  3HR9 A;  4CCE A;  4L2N A;  1JUH A;  1LOE A;  5E16 A;  5FR3 A;  4XUP A;  4PQQ A;  3VB9 A;  5IK4 A;  2LTN A;  1LUL A;  1HV0 A;  4C1X A;  3NKG A;  2P5B A;  3OYW A;  2DVA A;  2XVL A;  4K8R B;  1XSR A;  2NMN A;  5FZK A;  1DGL A;  2JDZ A;  4QKN A;  3TNP B;  2XWB B;  5L9R A;  3GBW A;  4XQ4 A;  5KC5 A;  1H2M A;  1UYP A;  3DPR A;  5L7O B;  4KNC A;  3O0V A;  4I2O A;  5K0U B;  2VMH A;  4CUB A;  2HWE 2;  1UOB A;  3BIE A;  1JYI A;  3UL2 A;  4RN5 A;  3ACL A;  4KL1 A;  2WIN B;  1QXP A;  2QQM A;  1GIC A;  1O4Y A;  3SHR A;  3VBH C;  3K3N A;  4DOU A;  1MR5 A;  2WQ8 A;  3FBY A;  3N9O A;  4MUV A;  1FMD 3;  5EPA A;  1UU4 A;  3PUQ A;  3SEP A;  1U5I A;  2YZ4 A;  4LBJ A;  4O65 A;  1MS4 A;  2VMG A;  3I2G A;  3MEP A;  2A6Y A;  1W2U A;  3SC7 X;  1YEW A;  3BOP A;  5KXC A;  4KGG A;  1NQJ A;  1VBA 3;  1XNB A;  2MHF A;  3DYM A;  1DG6 A;  1OOP B;  1PIV 2;  1H30 A;  4B4P A;  5FYY A;  4B7K A;  1W9S A;  4JGY C;  3IMN A;  4CCO A;  3OUH A;  2W08 A;  1QOT A;  1IKP A;  3V64 A;  1V9U 3;  2V5Y A;  1GFF 2;  1UZZ A;  2XJP A;  5EYY A;  3ZYG A;  5C5U A;  4IW3 A;  2R49 A;  5LA0 A;  3IIA A;  4XOG A;  2EVX A;  4PF5 A;  1GP5 A;  2Y34 A;  1OH3 A;  1AR7 2;  4XMI A;  2KR2 A;  1DCS A;  2W39 A;  1ZZ9 A;  1YFW A;  4HL0 A;  1C4R A;  4Z1V A;  4V2W A;  2V5D A;  4MYE A;  1OLM A;  3QCW A;  3VUO A;  2WYS A;  1BQP A;  4YZ1 A;  5FO9 B;  3K75 B;  1BEV 3;  4FXK B;  4B1M A;  3ZXK A;  1RUD 2;  1PGW 2;  2RDS A;  1XOY A;  3GM8 A;  1COV 2;  1HXS 3;  4NWW A;  1X8E A;  2RS3 2;  4UW4 A;  5B4N A;  3T09 A;  4ERO A;  2WBK A;  4Q0V A;  3JD7 3;  5A3P A;  4JRA A;  5C9A A;  2FZ1 A;  3MID A;  1UIJ A;  4FPJ A;  2EXJ A;  5BNO A;  1R09 2;  3PNA A;  4ZU4 A;  2ZX2 A;  4W4Z A;  1JOP A;  1REF A;  1ULD A;  1RUE 2;  2PHF A;  3LWC A;  5L7O C;  3MHZ A;  5GZF A;  4IEY A;  5FLJ A;  1CZT A;  2AAC A;  4YW1 A;  3VBU B;  1GQH A;  1POV 0;  2A3W A;  3GNE A;  5D21 A;  1D2S A;  1UAI A;  1QNY A;  4Z8B A;  3TAY A;  5JR2 A;  2OA2 A;  2RMU 1;  3HNY M;  1YFX A;  3FLP A;  1XSQ A;  4D94 A;  1CR7 A;  2ZGR A;  4XJU A;  1HQW A;  3IDB B;  1HX6 A;  3OGS A;  3KV9 A;  1GZW A;  1LRH A;  5A1A A;  3T2Q A;  1VBE 3;  2VZR A;  3GHN A;  5FMB A;  4E4S A;  2ZGP A;  4PDW B;  5M0T A;  4ES8 A;  3POG A;  1XND A;  2GMM A;  5IFT A;  2VY0 A;  3AKT A;  1SLB A;  3AZW A;  3WQ7 A;  3WSO A;  3I2O A;  3N9M A;  1S0C A;  2PHX A;  1ZBA 2;  3KCY A;  2AYH A;  1RUH 3;  2YC2 A;  3CZJ A;  2W47 A;  5FZB A;  2CNA A;  1BBT 2;  3EO6 A;  2WLQ A;  3O1U A;  2WJS A;  1OOP C;  1D0G A;  3D8C A;  1OD3 A;  1G86 A;  2WII B;  2PYT A;  2WAB A;  4HN1 A;  4XPV A;  1RIT A;  4OI2 A;  4FCA A;  4QU2 A;  1XNC A;  4XUN A;  5ACA 3;  1VP6 A;  3GJB A;  4E9K A;  1JYX A;  3AKP A;  2GH2 A;  2BWA A;  2VBD A;  3AM2 A;  2P6H A;  1WLD A;  4IE6 A;  5HCH A;  4CU7 A;  1S0I A;  1ULC A;  3A22 A;  1YI9 A;  4NHX A;  4XF9 A;  1G6N A;  2GAU A;  2VZ1 A;  2WO7 A;  4NVP A;  3M8L A;  1VR3 A;  1MS1 A;  1OSG A;  3POB A;  2ET1 A;  2FMY A;  3ZKU A;  1EY2 A;  3O1S A;  3HQU A;  1ULP A;  3PVN A;  3D3A A;  3WG4 A;  1UU6 A;  3JBG 2;  4L99 A;  1ASJ 1;  1QQP 2;  2V4A A;  2R0F A;  1H4H A;  2HLE A;  4BM8 A;  1S0J A;  4ITC A;  5A70 A;  3IM0 A;  1GNZ A;  2VD7 A;  3KQR A;  3ZXG A;  4DRV A;  4YVS A;  4OZX A;  1CGP A;  4CP9 B;  1GR3 A;  1PMI A;  5A3L A;  5JPN B;  1AVB A;  5LK7 B;  2VQT A;  1R08 3;  3WF4 A;  3H9A A;  2DUP A;  1BZW A;  2B5H A;  3W21 A;  4Q0U A;  1FPN 3;  1U5Y A;  5EP9 A;  3Q8F A;  2RM2 1;  4A7Y A;  4YZ2 A;  1IQA A;  4MAD A;  5FRA A;  2JDM A;  5I91 A;  1CVN A;  3VBU C;  3CQO A;  1PMH X;  3S7I A;  2D40 A;  3CKH A;  5LWB A;  2ZGK A;  2BBA A;  3KWV A;  4FPL A;  1N3O A;  2OS2 A;  5LRS A;  1SQ4 A;  3I3B A;  1VAL A;  5A1L A;  2ARA A;  1MQT C;  3HMY A;  2ZEY A;  4HKW A;  1R64 A;  1RVF 2;  1K3I A;  1V6L A;  4PDW C;  1OXC A;  2I74 A;  2XL9 A;  3KF5 A;  3NV4 A;  5LW9 A;  2AEY A;  1W6Q A;  3NJZ A;  3OD4 A;  4M01 A;  4MX3 A;  4YWA A;  2KA3 A;  5F5A A;  4OUE A;  3KGL A;  1DIW A;  4S2G A;  3RMX A;  3KMH A;  4GH4 B;  2VW1 A;  2L9L A;  4NPM A;  4DRR A;  4KWJ A;  1W8Z A;  3AK0 A;  4IV1 C;  1BVP 1;  3E6B A;  1I5P A;  5FYC A;  4YZ3 A;  3I2K A;  2WKK A;  4QX3 A;  5T5L A;  1VBA 1;  1SMV A;  2I07 B;  3NO8 A;  4IES A;  3ACG A;  4IEZ A;  1RUO A;  3CIH A;  4P14 A;  1YWK A;  3ON7 A;  2W94 A;  1SPP B;  1EUU A;  4IV1 A;  1J59 A;  4LOT A;  2HWE 3;  5T5P A;  1CAU A;  1YC6 1;  3MLK A;  2EA7 A;  3OGV A;  2E63 A;  2GND A;  3VD9 A;  1E57 A;  2XJS A;  1UYY A;  2ZZQ A;  3RMY A;  4LBQ B;  3I49 A;  2G4I A;  2R6Q A;  3ZKY A;  2XBO 2;  5FBZ A;  5J1X A;  4GA9 A;  1NCR B;  1RUI 2;  4JTO A;  1DLC A;  3WVJ A;  1GOF A;  3L2H A;  4OUS A;  4FPC A;  2WZP P;  3B7M A;  1OQ1 A;  3I4I A;  1SLL A;  5EZW A;  2GC0 A;  4MGS A;  2NP0 A;  1SLT A;  2OKX A;  3M3Q A;  4CXY A;  2UUR A;  4R4X A;  4LO5 B;  3WUC A;  3H1M A;  1EAH 2;  3ES4 A;  2QQP A;  1NYW A;  1VBC 2;  3LGR A;  4FFF A;  3OEB A;  4LBK A;  3GCW A;  3IAQ A;  2JD9 A;  1UN1 A;  3VBF C;  5FZO A;  1ENS A;  1W6M A;  3LPG A;  5IAX A;  5FP8 A;  1A8D A;  5JSO A;  1AR7 3;  2ERF A;  5LCW L;  3MIG A;  5C3O A;  4BMB A;  5LZ6 A;  4OUM A;  3P5B A;  5FPX A;  2YC4 A;  3ACI A;  3SQO A;  1UPS A;  3ZXA C;  2CGP A;  1C5I A;  2HWD 2;  2J1S A;  2O8Q A;  3SCG A;  3VBF A;  1VBE 1;  3ABZ A;  5FZI A;  1LB2 A;  1RUD 3;  1EPW A;  1W6P B;  2WQ4 A;  2HWB 2;  4JKK A;  1COV 3;  2IVI B;  4D7T A;  2Z2S B;  2RS3 3;  3X29 B;  1R1A 2;  4JDO A;  2HWC 2;  5IVJ A;  2QTW B;  1J3R A;  5EJ1 B;  5E89 A;  1RUH 1;  1FAY A;  1JI6 A;  1IZ3 A;  4YRD A;  3ZFF A;  4PIY A;  4TN7 A;  1R09 3;  5FMO S;  3HOB A;  4LIT A;  2VMC A;  3HAG A;  4YZ5 A;  2RR1 2;  1RUE 3;  3NNF A;  5FXX A;  3N4M A;  1JW6 A;  5ACA 1;  3U4X A;  2XUE A;  1RYY A;  3D0S A;  1N3Q A;  3K77 A;  1YI7 A;  2FHR A;  4RD7 A;  1I3H A;  5CKN A;  5JSR A;  5CIS A;  2Y0O A;  1V00 A;  5FZ8 A;  4A44 A;  2ZAA A;  5FWE A;  5GM0 A;  1DYO A;  3SH4 A;  3OY8 A;  4CP0 A;  1JYC A;  1LOD A;  2YBK A;  4JDN A;  2DFB A;  2R04 1;  2D6K A;  4DY3 A;  2CYF A;  2OX0 A;  4I3G A;  4LE4 A;  2YG0 A;  4Y1X A;  3DYP A;  4LK6 A;  5LK5 A;  5APA A;  4HLT A;  5HV4 A;  5FMC A;  4EWD A;  1ZBA 3;  5KHJ A;  3BU0 A;  4FFI A;  4YG6 A;  2JDA A;  4A6S A;  1K5J A;  4QKF A;  1PO1 2;  1YCI A;  1BBT 3;  1AR9 2;  1EP0 A;  1T6G C;  1C8M 1;  1LGB A;  4COZ A;  5JZG C;  1XXN A;  4RA0 A;  4Q4Y 2;  2Y6H A;  4QQL A;  4WM7 A;  1UXX X;  1XE7 A;  4Q0S A;  3BTZ A;  1RJ8 A;  4K9S A;  1I1E A;  4MG2 A;  3AMM A;  3MIC A;  1OQE A;  4P9G A;  5IW0 A;  4XTP A;  3LPF A;  1FPN 1;  2P3J A;  3AZX A;  3U07 A;  3BN6 A;  3VDB A;  1OVP A;  4ARX A;  4ET7 A;  3B94 A;  5JZG A;  4FI9 A;  2DCY A;  2R16 A;  4XUT A;  1S55 A;  1GV9 A;  1VPH A;  1W8W A;  4NIG A;  3RZZ A;  4ATE A;  5IK8 A;  2DTW A;  2GP5 A;  5HI0 A;  1UOG A;  3FN9 A;  4RR3 C;  1G9D A;  1WW5 A;  5IK5 A;  3JBG 3;  1QQP 3;  4Q4X 1;  2EXH A;  3ZFE B;  1XNT A;  2XB6 C;  1S0G A;  5C8C C;  1RUC 2;  2HBU A;  3POY A;  2NM1 A;  2CU5 A;  2LS6 A;  4CVU A;  1UMI A;  2R1B A;  3TN9 2;  4AHX A;  5D8A B;  3WX5 A;  3LEI A;  1X9T A;  1JYV A;  3EB7 A;  3OBA A;  4RR3 A;  5BV6 A;  2NMO A;  4A6O A;  3H3U A;  1QEX A;  2JXA A;  2J1E A;  4JGZ A;  3M3E A;  1QU0 A;  4XBL A;  2XJQ A;  2BGP A;  5C8C A;  5FQ0 A;  2BGO A;  3KCX A;  1NY7 1;  4CDW A;  4MXW B;  1DGW A;  2WT0 A;  3ZIW A;  2Y60 A;  4AI2 A;  2BBV A;  3IWZ A;  4A7Z A;  4M3C B;  1US3 A;  2WN2 A;  1W8H A;  3PUR A;  2QBX A;  1W9T A;  3AP5 A;  2WNU B;  4GWM A;  5D1I A;  2Q8E A;  3WDV A;  2J1R A;  2XDV A;  3RJ2 X;  2O0O A;  3ZYB A;  3ZYJ B;  3ZMO A;  4GKX A;  4FPK A;  1V6K A;  1O5U A;  1QJY 1;  4W6W A;  1RVF 3;  4R52 A;  2P4E A;  4AEJ A;  2Z5W A;  4BCU A;  5FZM A;  2RMU 2;  3E5Q A;  2BQP A;  1O8S A;  3D4K A;  4XFF A;  4Y20 B;  5DAV A;  2VM9 A;  4AK3 A;  4BLI A;  4ASM B;  3I59 B;  2WRA A;  3AX4 A;  5T5O A;  4TLG A;  2IXI A;  5FWJ A;  4DMI A;  2LRO A;  3WF2 A;  3DKQ A;  3N9L A;  3BPZ A;  2D97 A;  5JDB A;  3UGF A;  2B9V A;  3I8T A;  4AI3 A;  3VZK A;  2B8M A;  1ZX5 A;  2RDR A;  1RIN A;  4R9A A;  1PIV 1;  4Y5S A;  2QE3 A;  5J7M A;  1UYX A;  2EIB A;  4D69 A;  1ONA A;  3FFQ A;  4LA2 A;  4DXS A;  2Y0I A;  4JKM A;  3ZN4 A;  3O1V A;  1Z0H A;  1CAV A;  3HEI A;  4UW5 A;  1NXM A;  2DWR A;  5JI7 A;  5F39 A;  3FC0 A;  2WS9 1;  5IJR A;  4D6S A;  1CN1 A;  3CJI C;  1GSL A;  4ARY A;  5JOX A;  4CCM A;  5DG1 A;  2XBO 3;  4I0A A;  3U14 A;  4AGR A;  4DPN A;  1KRI A;  4DB5 A;  5FZ4 A;  1XYN A;  1L7Q A;  3OBT A;  1WGP A;  3PJY A;  1RUI 3;  1DBN A;  2X10 A;  4BIS A;  5L73 A;  4K40 A;  3DL3 A;  5D8A C;  3CJI A;  1RUD 1;  1PGW 1;  4NRP A;  3LDB A;  4RGG A;  2OUJ A;  3ETP A;  1COV 1;  2BVV A;  4Y1U A;  1DHK B;  3C7F A;  4F8A A;  3ZXE A;  1ND3 C;  1H9W A;  2VXR A;  3N3H A;  3H1Y A;  3LAG A;  2D93 A;  1GOG A;  1WMX A;  1K45 A;  1YNA A;  3NNL A;  1EAH 3;  1STM A;  4YNI A;  5FZH A;  5LY1 A;  1X82 A;  3I97 A;  1VBC 3;  2FDG A;  1CIY A;  4LO7 A;  2O8O A;  4RYD A;  1RUE 1;  3I2J A;  5JPM B;  5K8S A;  3K4D A;  1LNS A;  4I3P A;  1HQL A;  1ND3 A;  1CZV A;  2YDE A;  2B4K A;  4HVO A;  1TEI A;  2RM2 2;  2RHP A;  3III A;  4FXG B;  2XH6 A;  2VH9 A;  2VW0 A;  4Q4W 1;  3MIH A;  4ZON A;  3DEM A;  4ONU A;  1LOB A;  3TOJ A;  5FUN A;  1G9A A;  5C3P A;  2HWD 3;  3IN9 A;  3LSD A;  1LGN A;  4PLM A;  3URF A;  2YUE A;  3ZR5 A;  2HWB 3;  2DV9 A;  1IHM A;  1YJL A;  5IK7 A;  1DYK A;  1GQG A;  1UOF A;  1R1A 3;  1L3J A;  4IQP A;  3SCF A;  2AUY A;  1YJK A;  2Y6L A;  2HWC 3;  3M7A A;  4L0P A;  5FY7 A;  4BK5 A;  5BNP A;  1QJZ A;  3BU7 A;  3J7L A;  5H9P A;  4AI8 A;  3TEW A;  1KD7 A;  4IE7 A;  1KIT A;  1NA1 C;  1SZB A;  2QKD A;  3LOI A;  4LMF A;  5EJZ B;  1H9P A;  2C9A A;  2RR1 3;  2OYZ A;  1SG3 A;  3C7E A;  5BYN A;  3WCR A;  1PZ9 A;  4PI0 A;  2LUW A;  4YG3 A;  3AKQ A;  3TEX A;  3VDD A;  1V6I A;  5C4W B;  5DUW A;  3ZYH A;  4PQ9 A;  1OLR A;  3CL1 A;  3HQX A;  2PAK A;  4AED B;  2XLF A;  3K4A A;  4QX2 A;  3I2I A;  1V6M A;  3RZJ A;  1H1A A;  1LOF C;  5FOB B;  3D6E A;  4FOY A;  4P9I A;  1I5Z A;  4S2H A;  1O5L A;  3AP7 A;  4Y5Z 0;  1OLQ A;  4QDR A;  1US2 A;  4IEP A;  5E1R A;  3ZSE A;  3MV1 1;  4FBF A;  1XJA A;  2B9U A;  5LBB A;  4NIH A;  4AQS A;  1JOD A;  2IXL A;  3OG2 A;  2GC2 A;  4OHW A;  1AHS A;  2IXK A;  2QJV A;  3WUD A;  5FYI A;  3VZO A;  2WO1 A;  2Q30 A;  1PO1 3;  1OF3 A;  1XC6 A;  3GJA A;  4W6Y A;  4Q4Y 3;  4XJA A;  3NWK A;  1OBN A;  1VRH 2;  1DGR A;  3C7G A;  5I8T A;  4BQW A;  3KVA A;  2ADE A;  3N7M A;  1AXY A;  4UYB A;  4TWT A;  5DXD A;  3C2U A;  1UMH A;  1QH7 A;  3AFK A;  2JE8 A;  5FXZ A;  3M4F A;  4XAC A;  2YFU A;  3UKT A;  1MZ6 A;  5FZ0 A;  4Q0Q A;  2NPI A;  2Z42 A;  5CKQ A;  3UJQ A;  5G05 L;  4KG8 A;  3KSC A;  4DUV A;  3NRU A;  1TVG A;  2IXJ A;  5EHD A;  1B35 B;  3AMN A;  3GHM A;  3MW4 A;  3PTY A;  4MGY E;  4XBQ A;  4LIU A;  1KFX L;  1PVC 1;  1QJX 1;  4EN9 B;  3HBZ A;  2GME A;  3J7M A;  1RVF 1;  4LO8 A;  4YG0 A;  1RUC 3;  5HPO A;  4BQX A;  1IKQ A;  1PX3 A;  4QWN A;  3TN9 3;  1V0A A;  2G1M A;  5JIA A;  4R9B A;  4IV3 B;  4WVM B;  1K5M B;  5G04 L;  5LAT A;  4C0B A;  1WWY A;  3I54 A;  2D6N A;  2Q4S A;  4NHY A;  5J96 B;  3EXU A;  5IVF A;  3NAP B;  4Y22 A;  3U75 A;  2QDR A;  4XDO A;  2QCS B;  4DEV A;  4DNY A;  4DY5 A;  3N36 A;  5JMO A;  2JWP A;  2WA4 A;  3AYA A;  4H55 A;  4PLO A;  4UF0 B;  2E32 A;  4X8P A;  1YXW A;  5EQU A;  5A32 A;  3KVB A;  2B45 X;  4NUB A;  3WZ1 A;  4AED C;  1PO2 1;  1QWR A;  4SLI A;  4LK7 A;  3V65 A;  2RG4 A;  4RL7 A;  1ZRE A;  3O12 A;  1LEM A;  2G9F A;  4QKD A;  3OUJ A;  4IND A;  4YM0 A;  4TXW A;  2FMD A;  2QQK A;  4KI5 M;  4WM8 A;  5I93 A;  1FI2 A;  5CFD C;  2GN7 A;  3ZXD A;  1Q8V A;  2PHU A;  1VJ2 A;  2RMU 3;  3OYW B;  4QMA A;  3VHN A;  2XBO 1;  4G4F A;  1F4A A;  2JEM A;  2ZCW A;  1UQX A;  1J3P A;  2W1Q A;  1RUI 1;  4QB6 A;  4KMQ A;  3PMS A;  2J1A A;  4EZH A;  3DPR B;  4NAO A;  1LAJ A;  1ZVF A;  1LTE A;  1FV2 A;  5GLV A;  1BCX A;  2GC3 A;  2WZR 2;  2UWB A;  3JB8 A;  2ZZJ A;  4COU A;  2PHR A;  1ZRF A;  1AXK A;  1ND2 C;  2TBV A;  3JZV A;  4ISR A;  3ZO0 B;  3D5O A;  1EAH 1;  1T2X A;  1JXN A;  2VVD A;  1C8M 2;  1DQ4 A;  2VL4 A;  1QY4 A;  5CB7 A;  1VBC 1;  5DZF A;  5T3N A;  3A23 A;  4XE9 A;  5DN2 A;  5DPN A;  3E97 A;  1CZS A;  3WV6 A;  4HFS A;  3VD4 A;  3AMH A;  4XHX A;  3O1P A;  2YGL A;  1B35 C;  1MZE A;  3RZG A;  2WC2 A;  3DN7 A;  5FY4 A;  1UU5 A;  3VBR A;  4PI2 A;  3VBO A;  3WDT A;  4UFK A;  2VTX J;  3J4U H;  3UJO A;  4CDQ B;  5L19 A;  4H7M A;  1A78 A;  2VNV A;  3RZL A;  4GKY A;  3AYC A;  3ZSM A;  5F37 A;  4GJY A;  3AP6 A;  1F2N A;  3U1X A;  4XJ8 A;  1OQD A;  1UY3 A;  1DLL A;  2XHK A;  3H42 B;  4H7L A;  5FZ6 A;  4Q4X 2;  2FBE A;  2W87 A;  3WF0 A;  3OJB A;  3AC0 A;  1R1A 1;  5FIX A;  1BK1 A;  4P9Y A;  1VAM A;  5A7W B;  3MUZ 1;  1S4C A;  5J98 B;  4JAA A;  4RQP B;  3ELN A;  4A42 A;  5J48 A;  4AGV A;  4DS0 A;  1CJP A;  3PU3 A;  1H6Y A;  5DAQ A;  4CDU B;  2RR1 1;  3M3O A;  1ACC A;  2VJX A;  2A6X A;  4QPG B;  1W0P A;  2JIJ A;  3PUH A;  3WP4 A;  4D3W A;  1NXD 1;  2BW8 A;  1JZ6 A;  3ACF A;  3PME A;  3QD6 A;  4A41 A;  4IEV A;  2E7Q A;  5T5J A;  1NY7 2;  2W5F A;  2Q5T A;  2RM2 3;  4COV A;  2D3R A;  5GKA C;  5FZF A;  1FXZ A;  2PFW A;  4KBZ A;  3VD3 A;  2JDY A;  5H9S A;  3H50 A;  3AFG A;  4CXW A;  2HEY F;  4FSJ A;  4ZS2 A;  1WCD J;  4K1Y A;  2OZ6 A;  1IQD C;  4EN0 A;  1C1F A;  1ZBE 2;  4KGQ A;  4KWK A;  3ZMN A;  1IPS A;  1RJ7 A;  4OFG A;  2DU0 A;  3K3O A;  3NNJ A;  4NAM A;  5KHI A;  4BJ0 A;  1QJY 2;  2XLG A;  5C33 A;  4AYU A;  4RFT 0;  5LRR A;  4B4Q A;  4CYD A;  3A7Q A;  4CDX C;  3IBM A;  4XET A;  5FPB A;  4XIO A;  1SEF A;  1UCX A;  3UES A;  1PO1 1;  4YGB A;  1AR9 1;  4KWL A;  1C8N A;  4XW3 A;  4H14 A;  4GWI A;  2VU9 A;  4Q4Y 1;  5DAX A;  1WMF A;  4BDV B;  1CIW A;  3VBH A;  3M2M A;  3PUI A;  3MIE A;  2V73 A;  4MET A;  5GZC A;  1OUS A;  2DCJ A;  4AXO A;  4CDX A;  1DQ2 A;  4LO6 B;  2Y26 A;  4NRO A;  4B3N A;  1O3Q A;  3ETQ A;  1TME 2;  2D3S A;  3EMR A;  1W9F A;  4AL9 A;  3PTR B;  1QXJ A;  1DP0 A;  3NVC A;  5FZ1 A;  4TSV A;  1KDK A;  4AHZ A;  5IWF A;  2AGS A;  2P17 A;  4X6R B;  4N53 B;  1K42 A;  1W99 A;  3SKJ E;  5FBJ A;  3HN1 A;  1WLT A;  4FPF A;  4QXH A;  4CDQ C;  3WDW A;  2WS9 2;  1YHF A;  1HN0 A;  4HSL A;  3ZSL A;  4YFZ A;  5F1R A;  1DQ1 A;  4DIQ A;  3B02 A;  4GWN A;  4CCL A;  4JGY A;  4MGQ A;  4XAB A;  1AR8 2;  3FMG A;  1RUC 1;  3GBG A;  4LHN A;  1W8F A;  4UW6 A;  1JOJ A;  4A45 A;  3TN9 1;  2VZU A;  3FZ3 A;  4OQ8 A;  4Q29 A;  4XJW A;  2FDI A;  3AJZ A;  2BYV E;  2R07 2;  3H8U A;  1U12 A;  4WZC A;  3WP5 A;  4RS5 C;  3ZN6 B;  4ZZ8 A;  2FZ2 A;  1QJU 1;  4MHU A;  4ISQ A;  1VRH 3;  4LIV A;  3E1F 1;  3ALQ A;  5A7Q A;  2NN8 A;  5T50 A;  2VAU A;  3POJ A;  4CDU C;  2C5D A;  5FLI A;  2BWC A;  3LB9 A;  5L36 A;  5BXX A;  4RS5 A;  5DAP A;  3TRS B;  4AFM A;  5BNN B;  1NX9 A;  4N9H A;  4QGL A;  1XRU A;  5BY5 A;  3LFI A;  2D6P A;  4OZO A;  3DGT A;  1JHJ A;  3OPT A;  4AVT A;  1HIX A;  5IYY A;  4NID A;  2VME A;  5CEH A;  2IXC A;  5K0U C;  4Q4V 1;  2CDP A;  5GLZ A;  3KQ4 B;  4JTN A;  3GF6 A;  3OGR A;  2FD8 A;  2XON A;  2B7Y A;  2Q1Z B;  4FP3 A;  1CJD A;  4Q4W 2;  3VBS B;  4C1W A;  2Z4F A;  4FTB A;  3B9I A;  2AEZ A;  4YPJ A;  1F4H A;  3KD4 A;  1ZM1 A;  1FX5 A;  3OEA A;  5L7O A;  3THT A;  2B42 B;  2RV9 A;  1GZ9 A;  5K0U A;  1MS9 A;  1GP4 A;  1P8J A;  2ZEX A;  3SIS A;  4BQ4 A;  2QQO A;  1DZR A;  1IS6 A;  1H1I A;  1DZT A;  1POV 3;  2TUN A;  3VZL A;  3VHO A;  3LDR A;  5FKC A;  4NR1 A;  3PJQ A;  1IGO A;  1SAC A;  1Z78 A;  1D7P M;  3K2O A;  1F9K A;  2PAE A;  3IPV B;  5FJH A;  3WF3 A;  3AVR A;  1DU3 D;  3AXE A;  5I0D A;  4OCT A;  1OVS A;  2KM2 A;  1W6Q B;  3AL6 A;  3VZJ A;  2ZGO A;  4EJR A;  2HWF 2;  1W3X A;  3QH7 A;  2X29 A;  3VKL A;  4AI0 A;  4N53 C;  1QXR A;  2Z69 A;  1VRB A;  4LBQ D;  4P5H A;  3WQ0 A;  2XPJ A;  4HN0 A;  1OC1 A;  1OOP A;  4EN7 B;  2VZT A;  4AF9 A;  3LCP A;  3SH5 A;  1RB8 G;  2EF6 A;  2XJV A;  5D2A A;  3ZFG B;  3NJY A;  2R04 3;  4FPY A;  1VAV A;  1EUT A;  4AEM A;  4P9J A;  5F6K A;  3APB A;  2VZ3 A;  2WZR 3;  2WNV B;  2IUW A;  3H3Z A;  4PT6 A;  2X5I B;  4RGA A;  1C57 A;  5ABJ B;  3RGB A;  2VQA A;  2P3I A;  3GCX A;  1HRV 1;  3RWN A;  2C9K A;  4H3W A;  2JG8 B;  1SFY A;  3SNM A;  3MLJ A;  4XBN A;  1C8M 3;  2PN5 A;  3O0X A;  2P6C A;  1IS3 A;  4BXF A;  2W52 A;  1SFP A;  2VQU A;  3RI9 A;  1QJF A;  5FJK A;  3ZXL A;  1TMF 2;  2FDH A;  1URX A;  4CTE A;  4FOW A;  2YYO A;  4QQH A;  1HB3 A;  4B4R A;  3OOX A;  4QX5 A;  4I09 A;  2DVD A;  1S0D A;  3R05 A;  4XUR A;  4JRL A;  4A3Z A;  4BWO A;  4MV2 A;  3SXW A;  4CCD A;  1UZV A;  1UZW A;  4AQ2 A;  2G19 A;  5I0T A;  2QDN A;  4LUM A;  5GLW A;  3T30 A;  4OMD A;  1W2N A;  3FE5 A;  3H0O A;  1PVC 2;  1QJX 2;  1EPZ A;  2CDO A;  1W6N B;  4Q4X 3;  4J1W A;  4JZR A;  2Q1M A;  1W6O A;  4LOS A;  4M3C F;  4AQT A;  2BFU S;  2D5H A;  3VBU A;  4OUL A;  3D82 A;  1C28 A;  3BOW A;  2GH8 A;  5KXB A;  1MZ5 A;  2ETE A;  1YQ8 A;  4QX8 A;  3P3P A;  1LR5 A;  4YW3 A;  1OH4 A;  4S2F A;  4LBN A;  1JZ8 A;  4B8E A;  4KG0 A;  1TNR A;  1MQT A;  1IG0 A;  4FT8 A;  4XZU G;  1GNH A;  4PDW A;  4HON A;  4LLO A;  1FNZ A;  4MZU A;  1UYZ A;  1CON A;  3IKW A;  2K2S A;  5A7N A;  1VMH A;  1OUR A;  3O1T A;  2F6B A;  5FZC A;  1HJF A;  4X6Q B;  3ZLI A;  4JC1 A;  2YRO A;  1QKQ A;  3AKS A;  4Y1V A;  1AF9 A;  1PO2 2;  2A71 A;  2D6L X;  2WFF 2;  1AX1 A;  1PM7 A;  2Q0A A;  3ORJ A;  3ENR A;  3LIG A;  1ZBE 3;  2R7E B;  2GAL A;  1W05 A;  1RUJ 2;  2VZS A;  2E53 A;  3ZFG C;  1SLC A;  3M3I A;  1QJY 3;  2YY1 A;  3ZDV A;  3O1R A;  5F3E A;  2X05 A;  4CXX A;  1M4W A;  1ZZ6 A;  4CSW A;  5F3C A;  2YPD A;  4HAN A;  1MS0 A;  2UU8 A;  1PNG A;  2WNV C;  5JI9 A;  4DXZ A;  1QGL A;  1ALY A;  2N7G A;  2WWU A;  2PHT A;  1NOV A;  1D0H A;  5FUI A;  1WCS A;  3VKM A;  3J26 N;  2JG8 C;  1UKG A;  1VRH 1;  1JU4 A;  2ZAC A;  3R4U A;  4PJY A;  1PNF A;  2A3X A;  3RPQ A;  4DFS A;  4NWV A;  2F17 A;  2YFZ A;  4LBO A;  5DMY A;  1OPM A;  2OZJ A;  1XNA A;  1PIV 3;  1TME 3;  3BIW E;  3U10 A;  1UPI A;  3W9A A;  1HW5 A;  1Q8P A;  2PLV 1;  3VKO A;  5JSP A;  1PGL 2;  1RXF A;  1YIF A;  1UO9 A;  4CP9 A;  2W95 A;  3HPN A;  2D3P A;  1HDK A;  2ZX4 A;  3WNP A;  2OT7 A;  2Y64 A;  2WS9 3;  3HQR A;  1Y9Q A;  4HG6 B;  4JQT A;  5IAT A;  1RUG 1;  2BNN A;  5IFP A;  5E88 A;  2ZX1 A;  3ZN5 A;  1TE1 B;  5CFC B;  3IDA A;  1AR8 3;  1NZI A;  1WW6 A;  3PU8 A;  2LAL A;  1NE6 A;  1JUI A;  2XKP A;  4MXV A;  4UFJ A;  1CAW B;  3RYR A;  2VGD A;  2R07 3;  4M3C E;  4ZU5 A;  5C4W C;  2ZX3 A;  4Q1P A;  4DUW A;  2Y6G A;  4CZS A;  1UW8 A;  2WWJ A;  3WG1 A;  4XF0 A;  2J7M A;  4QHO A;  5A6Q A;  3PL0 A;  2YMZ A;  4FVV A;  4GH4 C;  1POV 1;  4Y5T A;  3CLP A;  1UF2 C;  2FCU A;  2VBB A;  3J8F 2;  3K51 A;  3OGG A;  3NJV A;  4ASL A;  2CWS A;  1UX7 A;  3H1W A;  2B39 A;  3P3N A;  3VL8 A;  1YYN A;  3QBQ A;  5J3U A;  4TZD A;  1LU2 A;  3KT1 A;  2Y6K A;  1SHW B;  4HSJ A;  3USU B;  3CEW A;  3I3Q A;  1XU2 A;  3JUU A;  4GH4 A;  1FYU A;  1EV1 2;  3W58 A;  2BTV C;  3BYW A;  4L9B A;  2VZP A;  4EWE A;  4JGZ B;  4Q4W 3;  5DAW A;  5HXM A;  1OA4 A;  2WWS A;  3LFM A;  4N8M A;  1CES A;  4I02 A;  4EN6 B;  2ET7 A;  1E5S A;  1D4V B;  3A21 A;  1S1A A;  4SBV A;  4YLZ A;  2QFE A;  1LU1 A;  1RHI 2;  2VCC A;  1SPP A;  1RGS A;  5I8S A;  5ISL A;  3FWE A;  1NUK A;  1NCR C;  4LR4 A;  2EAK A;  5C71 A;  2ZML A;  4UBH A;  2WZR 1;  1S0E A;  4XVH A;  3VKF C;  4ZU7 A;  5H9Q A;  2XGX A;  3FHA A;  4LBQ A;  5A1F A;  3NV2 A;  2E51 A;  2RJ2 A;  2ZMK A;  4Q1R A;  5IHR A;  1RTV A;  1X7N A;  4NIA A;  1KS4 A;  4XCB A;  1NCR A;  2QNK A;  4AVV A;  1O8P A;  3BTX A;  2D43 A;  4LBM A;  1QH6 A;  2JIC A;  1H2K A;  3AB0 A;  5CIR A;  1E5I A;  1RMU 1;  2HWF 3;  4QXK A;  4ZXE A;  1W0N A;  1QNW A;  3IZO A;  2NZ9 A;  3VBR C;  1XE8 A;  5FZ9 A;  2IVJ A;  4DZG A;  1H2N A;  3V56 A;  1W8N A;  1NG0 A;  1K12 A;  5GAL A;  1AYN 1;  3W20 A;  1FNY A;  5KHK A;  2GC1 A;  1RED A;  4JV4 A;  4MSV A;  5A33 B;  4JHT A;  4QPW A;  5FK7 A;  3J7N A;  4U36 A;  4XIK A;  3HIF A;  4K20 A;  1YFU A;  5TSW A;  2IZW A;  3EHK A;  4IE0 A;  3VL9 A;  4A2U A;  1GWM A;  1H2L A;  1FAT A;  2QZ3 A;  2EIG A;  4LO4 B;  5FYH A;  1JU3 A;  2VCB A;  2Y38 A;  3OPW A;  4GIQ A;  4JKL A;  3T4V A;  5JIU A;  2Q8O A;  5EXO A;  5E6H A;  2Q8C A;  4LEJ A;  5FY8 A;  2TEP A;  3Q8B A;  2WSU A;  5A3O A;  2RE9 A;  4D0Q A;  1QJU 2;  1S2B A;  4QM8 A;  1Q43 A;  3UK9 A;  3WDX A;  5DDJ 2;  1WZX A;  1LGC A;  4XJ9 A;  4UOJ A;  1OFS A;  4FQZ A;  1TMF 3;  4N43 B;  4AHY A;  4ATF A;  5JXG A;  1A3K A;  1GP6 A;  2K9Z A;  3OSD A;  3Q8E A;  2D44 A;  3WDU A;  3S0M A;  2JG9 B;  2JJ6 A;  1ODM A;  4XXP A;  4PLN A;  2WN3 A;  3WT3 A;  1W9Y A;  1PHM A;  4LA3 A;  2ZX0 A;  3PVB B;  4QQO A;  1NCQ B;  1WD4 A;  3LOB A;  1GAN A;  2HEV F;  4LNV A;  2VNG A;  4W50 A;  5AC9 1;  1J84 A;  1W03 A;  1Y4W A;  1RUN A;  3R4D B;  1ZBE 1;  5J36 A;  3N7L A;  3V0A A;  3ZPO A;  5FZ7 A;  3JCI A;  1ENQ A;  1PVC 3;  1QJX 3;  4Q4V 2;  2ZHN A;  4AEK A;  4FQ4 A;  4JQR A;  1WLC A;  2GZW A;  1POQ A;  2VG9 A;  4Z2W A;  1YQC A;  2VZQ A;  2GDF A;  2KD7 A;  4R8H A;  4AOC A;  2XML A;  3MIB A;  1RL3 A;  2DCK A;  2UYB A;  5FPZ A;  1H8V A;  5FPU A;  3ZXF A;  1WA6 X;  4LUK A;  5FYZ A;  3HNB M;  1NQD A;  3KV4 A;  1PZ7 A;  1LOA A;  4LT5 A;  1X8M A;  2EXI A;  2IWG B;  2IXH A;  2ORZ A;  1VAK A;  3E6C C;  1BK0 A;  3AKR A;  4B29 A;  1LES A;  4CP2 A;  4JHZ A;  1TME 1;  4H2A A;  4LTA A;  4IGQ A;  2PQQ A;  4WZF A;  1DQ5 A;  1PO2 3;  4EYU A;  2ZBJ A;  1H8T B;  2VNO A;  1ZRD A;  3HWJ A;  1AL2 2;  2B46 X;  2HYK A;  2V09 A;  1BMV 2;  4MLO A;  2VUA A;  1XE0 A;  3WW1 A;  1RUJ 3;  4FO9 A;  2ARX A;  3GGL A;  4AG4 A;  3WHU A;  3IDE A;  5F3I A;  1DF0 A;  5GLU A;  5ANN A;  1AR8 1;  5CA6 A;  2JDP A;  4JVA A;  2D7F A;  1LJ7 A;  3ZFE C;  5KC6 A;  4MH0 E;  1BKZ A;  3HD8 B;  1O7F A;  2R07 1;  2BDR A;  2BNO A;  1UY2 A;  4QU1 A;  4YVW B;  3RRD A;  3UGG A;  1AJK A;  5DZG A;  5FP7 A;  4XFI A;  3H8R A;  3L9J T;  1LHO A;  4RHV 1;  2JKX A;  4O7X A;  4NO4 A;  4O9G A;  2WLP A;  3WNK A;  1W8U A;  3O1M A;  5A3T A;  2XWJ B;  2OUH A;  3ZFE A;  1FT9 A;  1RC6 A;  2ORX A;  2BOJ A;  1HRV 2;  2W9X A;  4QPI B;  5FY1 A;  5D8A A;  2JG9 C;  1CQ9 A;  5FYS A;  3OBZ A;  3V0B A;  2VOV A;  3OD0 A;  1HRI 2;  3CHX A;  1RUF 1;  2BRT A;  2VCM A;  4K7J A;  3Q8C A;  4CA9 A;  2W1S A;  2WNU C;  1N1Y A;  3DV8 A;  3TBD A;  3OUI A;  4EZ4 A;  1J1L A;  4CEW B;  4MXW A;  4UI9 L;  2MPF A;  1HN1 A;  1XB9 A;  5T55 A;  3WP3 A;  3HN3 A;  1JYN A;  4M3C A;  2ZJC A;  3U0Z A;  3GBF A;  2R30 A;  2BVB A;  2HKX A;  1HJG A;  2WNU A;  4W8J A;  2HBT A;  3LSE A;  4GUL A;  4O61 A;  4P9L A;  3A4U A;  3NQH A;  2A6V A;  3Q9O A;  5BPX A;  3F95 A;  1H0B A;  1NE4 A;  5FCC A;  2LRP A;  4URA A;  3QOP A;  4GB3 2;  3J8F 3;  1CAX B;  2C1F A;  1V6N A;  5EIY B;  4Y20 A;  1O4Z A;  1KGY A;  3I59 A;  5FP4 A;  4ORF A;  4MGZ E;  3HNM A;  2ZAH A;  2FDJ A;  3LA7 A;  2LW8 A;  2WZE A;  2K0G A;  1LHU A;  3N7J A;  4G3Y C;  1WKY A;  2A6Z A;  2HWF 1;  1HB2 A;  1QOO A;  3ILF A;  1H8T C;  1I9R A;  3TWI A;  1QDO A;  1GNY A;  4FFH A;  5H9R A;  1NA1 A;  2VOT A;  5LA9 A;  5F9T A;  4IE4 A;  1PK6 B;  2W68 A;  2WT1 A;  3AMQ A;  4V1P A;  3GZU C;  3VDA A;  1G8W A;  3SMH A;  5FKB A;  1RHI 3;  3CO2 A;  3T3Y A;  2XR4 A;  2R1D A;  3QLQ A;  3SKV A;  2QQV A;  5F5C A;  1G7Y A;  1W8T A;  4AI9 A;  3ST7 A;  4YGE A;  5DZE A;  1LOF A;  5LBC A;  1GZT A;  4M00 A;  4QQP A;  2A5Z A;  1AR9 3;  2IFR A;  3DUI A;  4QPI C;  1GWK A;  2DBI A;  2ARC A;  3UV9 A;  3PDQ A;  3B9C A;  4FFG A;  1NT0 A;  2UYA A;  3FFZ A;  2VMD A;  1CX1 A;  4GMP 0;  1TMF 1;  1SCS A;  4BLJ A;  1NLS A;  1W2O A;  2WNO A;  2XLA A;  3DKW A;  3OF1 A;  5I0R A;  1AR6 2;  4GWJ A;  4Y24 A;  3BCW A;  2PLV 2;  4BIO A;  4Y1Z A;  3WW2 A;  1WCU A;  4LE3 A;  4CEW C;  3GYD A;  4QM9 A;  4F7Z A;  1BJQ A;  2BZD A;  3B3Q E;  4PBP A;  4UAP A;  5GJ6 A;  1RUG 2;  4HPK B;  4Q0P A;  1T6B X;  2DFC A;  3MF9 A;  4UT5 A;  4CEY B;  4I01 A;  4J25 A;  3M1H A;  3POW A;  1BEV 2;  3MUY 1;  1OKQ A;  3ZR6 A;  4QB1 A;  5B2G B;  2VOX A;  5A7O A;  1S2K A;  3HBK A;  1JMU B;  3VZM A;  2H0B A;  3H7J A;  4FAG A;  1QJU 3;  2DVG A;  3R6S A;  3WD5 A;  3EQE A;  3JD7 2;  3WR0 A;  5FZA A;  3AZZ A;  2UY8 A;  2ZEZ A;  5DDJ 3;  1H6X A;  4QXC A;  4WBB A;  4YGC A;  3RFR A;  5FOJ B;  1LOC A;  1XQN A;  4UFH A;  2D6O X;  2WA3 A;  3LKJ A;  2NLR A;  2YC0 A;  4AFD A;  1VIW B;  3NKT A;  4GAL A;  3C8X A;  4DEQ A;  1VLN A;  5CYY A;  3FX3 A;  3S5Q A;  4M0N A;  2WFF 1;  2VCA A;  2BJS A;  1PK6 C;  3MYX A;  2IFW A;  1M06 G;  3BUC A;  4PCR A;  3IAP A;  1RUJ 1;  3HT2 A;  2VNR A;  3LEM A;  4Q4V 3;  2TNF A;  1TQ5 A;  1VBD 2;  1SBD A;  3HJR A;  5C4W A;  4AED A;  2R0H A;  1BXH A;  1ZZ7 A;  1O91 A;  5F5I A;  4E4D X;  1YUD A;  4URT A;  3TYJ A;  4L92 A;  4OI4 A;  5IVB A;  4BA6 A;  1JS9 A;  3RDI A;  5CFD A;  2PXJ A;  5DAB A;  4YAR A;  1FOD 1;  1HLC A;  1O6U A;  5CAZ A;  4HK9 A;  4UBG A;  1MPX A;  3FL7 A;  4ZHN A;  1AYM 2;  1JOB A;  4IGP A;  4NRQ A;  3I3D A;  3LEG A;  1UOJ A;  5LBF A;  5T52 A;  4AI1 A;  4EE2 A;  1O59 A;  1PGL 1;  4AWD A;  4QDQ A;  1ZNP A;  3DYO A;  4XCA A;  3LF7 A;  2Y6F A;  4QDS A;  1Z7S 1;  1AL2 3;  2QZ2 A;  1BHG A;  1RMU 2;  1W8O A;  2ZKL A;  5A3N A;  1GLH A;  2VVE A;  4BZ4 A;  4LKE A;  4D6R A;  5KXD A;  2CHH A;  3MDP A;  1ND2 A;  2C6S A;  2OVU A;  3E5X A;  2RJL A;  2VXJ A;  4G9S B;  4M0H A;  4XDP A;  2OXB A;  3WNN A;  2F4L A;  1AYN 2;  2ZXQ A;  1CD3 G;  3UNP A;  1TZO A;  4BPZ A;  4RSU A;  1MZF A;  3MGU A;  5EWS A;  4F83 A;  5L9V A;  3U78 A;  4RFR B;  3FHI B;  2HYX A;  2OQ7 A;  4AZZ A;  1C1L A;  5BNQ A;  4HK8 A;  1Y9G A;  4IV3 C;  1B35 A;  3WNM A;  3N9P A;  3PUS A;  1K5M C;  1WW4 A;  2BGC A;  4XAA A;  1REE A;  1OT5 A;  2CAV A;  2ZOE B;  4IL7 A;  5KHG A;  1UZY A;  4AVS A;  5EYX A;  1HRV 3;  3GDB A;  4N90 A;  3J8F 1;  3OTF A;  4A4A A;  5KXE A;  1MVQ A;  2GNT A;  3NAP C;  4OHV A;  5E8A A;  4IV3 A;  2E9Q A;  1OHF A;  1OA3 A;  1HRI 3;  1Y3T A;  1K5M A;  4WVM A;  5KR7 A;  3F2Z A;  4HVQ A;  4E8C A;  1N47 A;  1QIQ A;  4MGI E;  5FFO C;  1EV1 1;  3WNX A;  3W5N A;  4Y4Y A;  1YIP A;  2HJI A;  2ZGT A;  4XYX A;  2IC1 A;  4FPO B;  4HKO A;  4I30 A;  2VR4 A;  3NAP A;  3NW4 A;  1J83 A;  4PHZ A;  5C5T A;  2CY6 A;  4BE3 A;  2ZGS A;  3R4S A;  5FUP A;  1ULE A;  2VBP A;  4UF0 A;  2HEW F;  2W91 A;  5AC9 2;  5CBL A;  5JWP A;  5C9A B;  1RHI 1;  3T0A A;  3B69 A;  3H8O A;  3INA A;  4ZS3 A;  4NRM A;  5BNO B;  3U37 A;  4C90 A;  1V70 A;  4PIZ A;  5C70 A;  4LKD A;  1QOS A;  3NV3 A;  2W46 A;  3POS A;  3DPR C;  2GSY A;  2RDQ A;  2XOM A;  3KV5 A;  1EYB A;  4GB3 3;  4Y4R A;  3C7H A;  5F6L B;  4XJZ A;  1F8V A;  1HKD A;  2WO3 A;  5CZK A;  1UX6 A;  3GZT B;  3D0J A;  3H7Y A;  3NST A;  4LUL A;  1UXZ A;  3T4H B;  2UY9 A;  2WAO A;  2ZHM A;  1NKG A;  4YW5 A;  3T0B A;  5F7U A;  1GZW B;  1OUX A;  5DQ0 A;  5CG9 A;  3U11 A;  4AVC A;  4B1L A;  5FXW A;  5C6C A;  4Q27 A;  5FXV A;  2VZO A;  4IEW A;  4XFA A;  1G9B A;  2ZS6 B;  4XFB A;  4OYU A;  3O5S A;  5FPL A;  4GMP 1;  3WXP A;  4YGD A;  4YM3 A;  2Y6J A;  2ZGL A;  5JUV A;  3GZE A;  1KEX A;  2EAL A;  2ZPX A;  4MGT A;  3M3C A;  4NE9 A;  2SLI A;  1IG3 A;  1S0B A;  3BVC A;  4Y1Y A;  4KBB A;  2CSG A;  2A7A A;  3SIT A;  4NHK A;  5FZD A;  3HVD A;  1ZA7 A;  2ZGM A;  2P34 A;  5FYB A;  4XMA A;  5FZG A;  5SV8 A;  4CDQ A;  2WT2 A;  4MGK E;  1OKO A;  2O1Q A;  2JB8 A;  2Y33 A;  4RHV 2;  4RQP C;  4YSF A;  3CJX A;  4OHX A;  5AFB A;  5DDJ 1;  4P00 B;  2RS5 1;  4NHL A;  1AXZ A;  2Y8K A;  1PM4 A;  5GZE A;  4QPG C;  1AR6 3;  2WYF A;  3KT4 A;  5FMD A;  2VZV A;  4EN8 B;  4QKB A;  2YXS A;  5A3W A;  2E7A A;  2DUO A;  2C0Z A;  2PLV 3;  2RS1 2;  3KT7 A;  3C3V A;  3KM5 A;  5A7W A;  3WQ1 A;  2H0V A;  2VPV A;  4RQP A;  1LEN A;  4NJ4 A;  5FYU A;  4ASK A;  1UY4 A;  3N9N A;  1S2E A;  1RUF 2;  1QHD A;  5FMO L;  4CDU A;  4YVS B;  1MS8 A;  3KV6 A;  3NV1 A;  3OCP A;  4QPG A;  5FPV A;  5JOY A;  2DUQ A;  5A6Z A;  1H1M A;  1RUG 3;  3LD8 A;  3T1M A;  5C9A C;  2AC1 A;  3ES1 A;  4XF3 A;  2XG3 A;  3ZSK A;  5BNO C;  3LA3 A;  4LKS A;  2VVF A;  3G6J B;  3B01 A;  4MOA A;  5KHH A;  3AL5 A;  2W1W A;  1GOH A;  4IET A;  3SCH A;  5JXJ A;  2VMI A;  4CU9 A;  2CTV A;  3UET A;  2Z79 A;  4Z82 A;  5I0U A;  4CP1 A;  2PEL A;  1SDD B;  1X33 A;  4OHZ A;  5K9Y A;  5HV0 A;  3MFC A;  4XQW A;  1Q56 A;  3SLI A;  1W6O B;  4GAZ A;  4P5Y A;  4CPB D;  3RZK A;  1HB1 A;  4BK4 A;  2QQJ A;  5A80 A;  1LOG A;  4QT6 A;  4CUC A;  1BVV A;  4D8M A;  1AL2 1;  2J42 A;  4CCN A;  1BMV 1;  4BME A;  4X8N A;  4A7K A;  3CU7 A;  4YM1 A;  1E5R A;  2BV4 A;  2PMW B;  2ATF A;  4P02 B;  4D7S A;  2GP3 A;  4R4Z A;  1MQT B;  1VBD 3;  5IVV A;  2EIC A;  1MEC 2;  4J1X A;  3JQX A;  4C0H A;  1AUY A;  2XXZ A;  3MW3 A;  2NQY A;  1JZ2 A;  5F2W A;  3ZSJ A;  5JLV A;  1GUI A;  4ZZ5 A;  1YQ6 A;  2MNG A;  4N53 A;  3RJR A;  2W2I A;  4MO3 M;  3MFA A;  4AGG A;  4IV1 B;  4GJZ A;  2GNB A;  1CAU B;  1NZC A;  1AYM 3;  3KB5 A;  4KU7 A;  1E5H A;  4QPY A;  3VZN A;  4M4P A;  4XC9 A;  3KF3 A;  1U5Z A;  3ZYF A;  1LEC A;  1MVE A;  4LHK A;  1KDM A;  1XYO A;  4IEQ A;  1HB4 A;  1YQ2 A;  2V72 A;  3PVO A;  4MHR A;  3ZN6 A;  1HRI 1;  5BNN C;  3SEE A;  4WVV A;  4HT1 T;  5AVP A;  4GD4 A;  1RMU 3;  5CU1 A;  2CGO A;  3AVS A;  3ZIX A;  5J37 A;  4FPH A;  2PA7 A;  4IEX A;  3O1O A;  1D4M 1;  4HKL A;  4YVS C;  2EID A;  4TTG A;  1DGW X;  1AYN 3;  2ZHL A;  3T0D A;  3FLR A;  4P9X A;  3O14 A;  5LA2 A;  5BNN A;  1JYW A;  2YHJ A;  3VBS C;  1GBG A;  3RYK A;  4LHL A;  3WP6 A;  2OQ6 A;  2D98 A;  3WHT A;  3FHQ A;  4HMZ A;  1O3S A;  5FY9 A;  1JZ7 A;  2GMP A;  4E27 A;  3BB6 A;  1VB2 A;  1WA4 A;  2FDK A;  3I3M A;  5ANQ A;  1LHV A;  5FZO B;  1W6M B;  3VBS A;  1YQ5 A;  4GB3 1;  4BB3 A;  4D6Q A;  3TNQ A;  2ES3 A;  2XJU A;  4L97 A;  2ZGN A;  2VEC A;  2KXL A;  1LHN A;  1YFY A;  4QHB A;  3T1L A;  3OBR A;  4BQ1 A;  2JEC A;  1RIR A;  5FAX A;  4XIL A;  3RI8 A;  3VBF B;  4Z2A A;  2JIG A;  2JB4 A;  3FLT A;  4PIX A;  5FYM A;  3WLU A;  2J1T A;  4NHM A;  3ZYP A;  4HBN A;  3LQC A;  4CCC A;  3VN4 A;  5IVC A;  1QF3 A;  4C8D A;  3AJY A;  1DZQ A;  3IPV A;  2DVB A;  2EXK A;  3HT1 A;  2A6W A;  2JE9 A;  5AC9 3;  3TB0 A;  2WFP A;  1FMD 1;  3ZFF B;  4XHB A;  2XL7 A;  3LE0 A;  4UFI A;  4Q8L A;  4CUA A;  3U4S A;  1YLL A;  5JR7 B;  4LXL A;  4IEU A;  3DXU A;  1JYT A;  3MZH A;  3I3E A;  2JE7 A;  4FOQ A;  4IER A;  2QVS B;  2VOK A;  2CWM A;  4D7Y A;  4C91 A;  2JDN A;  1WCK A;  1OA2 A;  2X5I C;  4AR2 A;  1W0O A;  3NNM A;  5ABJ C;  1KFU L;  3AP9 A;  1QMJ A;  2MEV 2;  4LPL A;  1S0F A;  3ZFG A;  1UY1 A;  5FZ3 A;  5KWR A;  3OY8 B;  1FOD 2;  3EJK A;  2P3Y A;  4LQR A;  1VBB 2;  3WW3 A;  1IOA A;  1BYH A;  1KJL A;  1UNB A;  1V9U 1;  2WNV A;  3ACH A;  4K21 A;  1AR6 1;  1GMM A;  2X5I A;  5ABJ A;  1W28 A;  4CU8 A;  1W06 A;  2AZ5 A;  3KZ4 C;  1JH5 A;  1WCQ A;  2JG8 A;  2NYY A;  4BH9 A;  2XJT A;  2DCT A;  3CF6 E;  1Z7S 2;  4COY A;  1LHW A;  3CZU A;  1ZZB A;  3ECQ A;  5JVV A;  3EYP A;  2CV6 A;  3BOD A;  1DQ6 A;  2A73 B;  2WQZ C;  3MIF A;  4OHY A;  4Q5O A;  4WM7 B;  3THD A;  4QX7 A;  1BEV 1;  5JOW A;  3BGA A;  2WZ8 A;  3R0R A;  4BOW A;  1UIK A;  4IXL A;  1HXS 1;  4OLL A;  4HOO A;  4BXS V;  4FAH A;  5A6X A;  3O7O A;  5FO7 B;  1XU1 A;  1JZ3 A;  4BQ3 A;  3AYD A;  3UT0 A;  5JZG B;  2PHD A;  2R06 2;  3JD7 1;  3LIH A;  4RHV 3;  4WV8 A;  3ZDS A;  5FDB A;  3I7D A;  3RVH A;  4QX1 A;  4N7I A;  4NMI A;  4EQV A;  4XXA A;  4Y26 A;  1W6N A;  2YU2 A;  1JTZ X;  3ZXJ A;  1LED A;  4R9C A;  5JXH A;  2RS1 3;  2C26 A;  3M70 A;  2Q8D A;  4BU2 A;  1GQP A;  1H4G A;  2XVK A;  4CCJ A;  1OMI A;  2JDH A;  2PAM A;  2RVA A;  1RUF 3;  1SLI A;  3NNG A;  3LZZ A;  3WNL A;  4L11 A;  4JCK A;  4AFB A;  1F35 A;  2WAA A;  3B93 A;  4RR3 B;  5DUX A;  2E31 A;  2ZEW A;  1Q8O A;  1AX0 A;  2ENR A;  2E6V A;  3CDZ B;  4I0B A;  3ZFF C;  4F3J A;  1OFN A;  1VBD 1;  4E4H A;  3MF6 A;  4YW4 A;  3MPB A;  4EWA A;  5C8C B;  5FQ0 B;  1CPN A;  1U5X A;  3VGI A;  4CDW B;  1KXG A;  2HH9 A;  5FP9 A;  1PVX A;  4XFC A;  4J6G A;  5F3G A;  4CPB A;  3AMP A;  3K4Z A;  4NPL A;  4QGM A;  2F4P A;  3WIN E;  4DQA A;  2H6C A;  5DG2 A;  3NJX A;  2W92 A;  1UKR A;  1UY0 A;  2FQP A;  2JX9 A;  4KWU A;  4AAX A;  2QUO A;  5JAX A;  1MS3 A;  1VMJ A;  2A70 A;  1WW7 A;  2E26 A;  4YW2 A;  1AYM 1;  2DF7 A;  2OPK A;  2P2K A;  3V0A B;  3IDC B;  5GZG A;  1SFN A;  1OPO A;  3JU9 A;  4FTS A;  1L7L A;  1X9P A;  4YW6 A;  2X8K A;  4I0W B;  1B09 A;  2EAA A;  1NLQ A;  2DCZ A;  4P08 A;  1UMZ A;  3QAC A;  2VE1 A;  3AXD A;  5LAS A;  3KCC A;  1KS5 A;  3WDY A;  4JX0 A;  1VMF A;  2BEO A;  2J1V A;  2P1B A;  5EFU A;  5C8W A;  1G9C A;  1C5H A;  2RJK A;  3P1I A;  4V2V A;  3KHC A;  2PTM A;  4M4R A;  1MEC 3;  1L7R A;  2DVF A;  4WM7 C;  4E2G A;  5BUV A;  5CFC C;  5CVR A;  1WMD A;  1W39 A;  4IUG A;  2WR9 A;  2XKO A;  3MO4 A;  1A8M A;  1ULF A;  5A6Y A;  5K7P A;  1Y43 B;  3N35 A;  2BER A;  5JCT A;  3S6P A;  3I2F A;  4LHS A;  3T2P A;  3CNA A;  1CAV B;  1Q8S A;  1F31 A;  1Q8Q A;  1JZ4 A;  1V6J A;  4QXB A;  1R08 1;  1ULO A;  5FY0 A;  5CFC A;  4ZY9 A;  1O4T A;  3WNO A;  3Q8A A;  5KBF A;  3ZPY A;  1ZZ8 A;  1I6X A;  3J9S A;  1CAW A;  2JEN A;  4XDQ A;  2E33 A;  3RS6 A;  1Y7B A;  4PBO A;  2P37 A;  5HXV A;  4DIN B;  1CWP A;  3ATG A;  4PF1 A;  3T2O A;  2I45 A;  1O3R A;  4OQ9 A;  2XUM A;  1W6P A;  2RS5 2;  1AX2 A;  1XYP A;  3LDK A;  5HCA A;  3DXT A;  3AZY A;  3LA2 A;  2VQ0 A;  5LA1 A;  3CJI B;  3UKN A;  2A75 A;  2FCT A;  1Q5O A;  4Q8K A;  2XHN A;  3KLS A;  2BNM A;  3RWK X;  3RNS A;  1DFQ A;  4QB2 A;  4FOV A;  1OD5 A;  4JGZ C;  3RG0 A;  5FPA A;  4CUG A;  4NN0 A;  3WG3 A;  5I8Y A;  1ST8 A;  4CDW C;  3USU A;  3DEC A;  1FV3 A;  2OII A;  3MI8 A;  4COW A;  5A3U A;  2VUC A;  4QX0 A;  5F2S A;  3ASI A;  3ROU A;  1IPK A;  2VW2 A;  2EIE A;  4ZPI A;  5LEK A;  2XQR A;  3K46 A;  3PVE A;  5I0S A;  1ND3 B;  2A1X A;  4LOR A;  3OPZ A;  3FBM A;  2AR6 A;  3B5L B;  2WL1 A;  5F32 A;  3N7K A;  4CE8 A;  4AFC A;  4UW3 A;  1IS4 A;  5B4X A;  5J09 A;  3C7O A;  3PLQ A;  3RZH A;  5A7P A;  2YV8 A;  2DYC A;  2HWE 1;  4XAE A;  2FDF A;  1AJO A;  1X50 A;  1ODN A;  1VB4 A;  3OB8 A;  1NAE A;  4N9I A;  4OI1 A;  4Z92 B;  1WBL A;  4LJH A;  1SBF A;  1A34 A;  2VTX A;  4GXL A;  5BNP B;  2CL2 A;  2WFF 3;  4GQ7 A;  3WF1 A;  3WY6 A;  3KS7 A;  2X09 A;  3BAL A;  1DYP A;  4LLF A;  2WDB A;  3S5A A;  2ZTN A;  5JXI A;  3VHR A;  1GU3 A;  1WME A;  4HXC A;  1DGR N;  2C24 A;  3WEZ A;  4DO0 A;  2I2S A;  4LBL A;  1XBF A;  3VDD B;  5LBE A;  5LEJ A;  5GLT A;  5A33 A;  3FJS A;  4AQ6 A;  2W3J A;  5IVE A;  2D6M A;  3RZM A;  3L2Y A;  1NA1 B;  1Y9M A;  2MEV 3;  2ZA9 A;  5C3R A;  2AEN A;  2QQI A;  1PZ8 A;  5T54 A;  3AYE A;  3VKN A;  1FOD 3;  3P6B A;  4TLF A;  1VBB 3;  4AW7 A;  1JBC A;  1F15 A;  4W6X A;  3NL1 A;  4BHP A;  4N43 C;  2RS1 1;  5DUU A;  1OI6 A;  4K6B A;  5C7G A;  4OI0 A;  2ARE A;  4Y33 A;  2AH2 A;  1N1S A;  1AR7 1;  2XVG A;  4AE2 A;  1ZZC A;  4P9W A;  4FPE A;  1WLW A;  4KH9 A;  1Z7S 3;  3BPS A;  4AFA A;  1JZ5 A;  3MBW A;  3ME2 A;  1NCQ C;  2LM3 A;  3VLB B;  2BUK A;  1IPJ A;  2YGM A;  4QD2 A;  4XTM A;  1D4M 2;  2GU9 A;  1W2A X;  1SDW A;  4N43 A;  5ERL A;  4L8Q A;  2VTF A;  4DXR A;  2JG9 A;  2ID4 A;  2GNM A;  2JDK A;  1PMJ X;  1ASJ 2;  1J1T A;  3PUA A;  1Q3E A;  1JHN A;  2RS3 1;  1NCQ A;  5IT6 A;  2VOW A;  3KHB A;  4K1Z A;  3POE A;  3MV0 1;  4AHW A;  2R06 3;  3BI3 A;  1SCR A;  4AVA A;  1JN2 P;  4XQD A;  4XF1 A;  5EV7 A;  2H6B A;  2R32 A;  3ILN A;  4IE5 A;  3FUO A;  1R09 1;  3VV1 A;  3H8X A;  1LCL A;  2D5F A;  3IB3 A;  2XQX A;  3IMM A;  5FO8 B;  2QQU A;  2ZKN A;  4XFG A;  3VD5 A;  4Z07 A;  5CNA A;  3WCS A;  3POI A;  2O14 A;  1A6C A;  5F5Q A;  5GZD A;  3A0K A;  3J7H A;  1WD3 A;  2VMF A;  3MLL A;  5FTT C;  4BYY A;  4OVE A;  4IDZ A;  4WVZ A;  5BNP C;  1EV1 3;  4EV0 A;  1F5J A;  1CX4 A;  1ZA4 A;  4GZ9 A;  5FY5 A;  1R1Z A;  4WVW A;  5HCF A;  1KQR A;  2ZGQ A;  4IGO A;  4E4Z A;  1N1V A;  3TEY A;  1KJR A;  1MEC 1;  1ENX A;  4Y22 B;  1BLZ A;  5C3S A;  1PX4 A;  4K3U A;  1XNK A;  4FP2 A;  1ZBA 1;  1FMD 2;  1H8T A;  4S2D A;  3ITQ A;  4Q2F A;  4UFM A;  5A32 B;  3VDD C;  3V0B B;  4YVW C;  1BBT 1;  3K48 A;  4ES9 A;  1WUV A;  1VE0 A;  4LKF A;  5FZE A;  1D2Q A;  4XUQ A;  4XUO A;  5CKM A;  4NPR A;  4XEZ A;  2ADD A;  4RGK A;  4WM8 B;  3PHM A;  3MW2 A;  3CBN A; 
#chains in the Genus database with same CATH homology
 5A6Q A;  4CE8 A;  2BP6 A;  2JDK A;  1OVS A;  2CHH A;  1OXC A;  1UQX A;  1W8H A;  5A6Z A;  1W8F A;  2WR9 A;  5A6Y A;  3DCQ A;  3ZDV A;  2JDH A;  2BV4 A;  2JDY A;  1OUS A;  2BOJ A;  2VNV A;  5HCH A;  1OUX A;  2VUD A;  2XR4 A;  2VUC A;  2JDN A;  5A3O A;  2JDM A;  2BOI A;  5D2A A;  4AOC A;  2JDU A;  4UT5 A;  5A6X A;  1OUR A;  2WRA A;  1GZT A;  1OVP A;  1UZV A;  2JDP A;  5A70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...