4CDQC

Crystal structure of human enterovirus 71 in complex with the uncoating inhibitor gpp2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title More-Powerful Virus Inhibitors from Structure-Based Analysis of Hev71 Capsid-Binding Molecules
pubmed doi rcsb
source organism Enterovirus a71
total genus 41
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cdqC00
4Y5Z0 1NY72 5FOJB 1QJY1 1VBE2 1RUE2 4QPIC 1FOD3 3J8F3 4Q4Y2 1B35C 1RUD2 2RS32 1OOPB 3VBSB 2BBVA 4CDXC 2RS13 3JB8A 2FZ2A 1C8M3 2HWC1 3VBRB 3FBMA 1QJX3 1VBD2 4Q4V1 5J98B 5ACA2 2RS52 5D8AB 2R063 1PIV3 1HX6A 4CDQC 5AC91 4N43A 4Q4W2 4PDWA 4WM7C 1NOVA 1HXS3 2R041 2WLPA 1Z7S3 4N53C 3VBFA 3VBHA 4GH4C 4JGYC 4CDUB 1VRH2 2IZWA 4QPGA 4CEYB 1MQTA 3ZFFC 5ABJB 1VB2A 2XBO1 2BFUL 5A32A 2R073 2ZTNA 4FTBA 5C8CB 4RHV1 4Q4X3 4EJRA 4GB32 4AEDB 2QQPA 1R082 1ASJ2 1ND3B 1ZBA2 1HRI1 1RUI1 2HWF2 1BBT3 4GMP0 3VDDA 1QQP2 1BEV2 1EAH2 1QJY2 1QJZA 1RHI1 3VBOB 1HRV2 4IV1A 3JBG2 1EV11 1ZBE3 1AL0G 4GMP3 1R1A1 2WZR1 2RR11 4JGZA 1PO11 4IV3A 1VBC2 2HWC3 1E57A 1NY71 2RMU2 2WFF1 4RR3C 3ZFGA 3DPRC 1RUF2 5BNPB 1PVC2 1RB8G 4Q4Y1 4RQPA 3NAPB 1NA1C 1RUH2 4N43B 5AC93 4PDWB 5L7OC 1BMV2 1AL21 5DDJ2 2R043 1X33A 4YVSA 3VBFB 3CJIC 5CFCB 1VBD1 5CFDA 2HWD3 5ACA1 4QPGB 2RS51 1H8TA 2RM23 1MQTB 4Q4W1 2XBO2 1R092 1FMD2 1CD3G 1VRH1 5C9AB 1B35A 4RHV3 1VBA2 2BUKA 1HRI2 4CDXA 1ND2C 1RUI3 5BNNA 3VDDB 4FTSA 1POV3 1OPOA 5JZGC 2WS93 2PLV2 1RUC3 1RHI3 2ZAHA 4GB31 1QJU2 2X5IA 1R081 1ASJ1 1K5MB 1ZBA1 2HWF1 4CDQA 1MEC2 1M06G 1OOPC 3VBSC 2WZR3 1QQP1 4JGZB 1BEV1 1VBB2 1EAH1 1PO13 2RR13 3IDEA 2WFF2 5C4WA 4N53A 1D4M2 4GH4A 1AYN3 4JGYA 3VBRC 3ZFGB 1VBE3 1AR92 1RUE3 1AYM2 1HRV1 4Q4Y3 1COV2 3JBG1 1RUD3 2RS33 4FSJA 3VBUB 5D8AC 1AL22 1VBC1 2RMU1 1RUF1 1PVC1 1AR82 2GSYA 4CDUC 1VBD3 5CFDB 5ACA3 1H8TB 2GH8A 1RUH1 4CEYC 5A33B 5ABJC 1PO22 2HWB2 4Q4W3 1PGL2 1V9U2 1BMV1 1F2NA 5DDJ1 3TN93 4SBVA 1W39A 1NCRA 1RVF2 4RS5B 5C8CC 3JD72 5K0UB 4AEDC 1TME2 1X36A 2XPJA 1PIV2 1R091 1FMD1 5BNNB 1ND3C 1FPN2 4WM8A 5BNOB 1NA1A 1VBA1 4GB33 3VBOC 3ZFEB 2X5IB 2DF7A 1R083 1ZBA3 2HWF3 4NWWA 5L7OA 5C4WB 1BEV3 1EAH3 1QJY3 4JGYB 2PLV1 1VAKA 1HRV3 5BNPC 1QJU1 4Q4X2 3JBG3 4Z92B 1MEC1 3NAPC 1VBB1 4CDWA 1D4M1 1VBC3 2RMU3 4PDWC 1AR91 1RUF3 1PVC3 1AYM1 4Q4V3 3VBFC 1COV1 4CEWA 1ND2A 5CFCC 1A6CA 4QPGC 1RUH3 1MQTC 1ZBE2 3VBHB 4FTEA 1AR81 1AR72 1RUG2 1NCRB 1VB4A 1RUJ2 5C9AC 4NWVA 1NCQA 4YVWA 5J96B 1PO21 2HWB1 1PGL1 1V9U1 2XBO3 5FMOS 1R093 1POV0 5A32B 3VBRA 2HWE2 4QPIA 2MEV2 3VDDC 2Y26A 4WM8B 1RVF1 2HWD2 3JD71 1VBA3 1HRI3 1TME1 1PIV1 1TMF2 1K5MC 2VQ0A 1FPN1 4JGZC 1C8NA 2PLV3 4CDUA 4Y4YA 4IV1B 3ZFGC 1AR62 1EV13 4CEYA 1QJU3 4WM7A 5ABJA 1R1A3 1MEC3 4IV3B 3LOBA 1VBB3 2WFF3 3VBUC 4CDWB 1AR93 3ZFFA 1RMU2 4RQPB 1AYM3 1RUC2 4Q4X1 1COV3 4CEWB 4AEDA 1H8TC 1OHFA 1AL23 4YVSB 5LK7B 1AYN2 5FMOL 1AR83 1FOD2 3J8F2 2RS53 3VBOA 1NCQB 4RS5C 1ZBE1 4YVWB 2RS12 1PO23 2HWB3 4GMP1 5K0UC 1V9U3 1C8M2 4RFT0 5BNNC 4QPIB 1AR71 1B35B 1VRH3 1QJX2 5BNPA 1RUG1 1RUJ1 1RVF3 4CDXB 5BNOC 1PGW2 3NAPA 2R062 3JD73 4RR3A 4LLFA 1TME3 4BCUA 3ZFEC 2X5IC 1HXS2 2TBVA 3DPRA 2HWE1 1FPN3 2MEV1 1Z7S2 3ZXAC 5C4WC 3TN92 5CFCA 4CDQB 2HWD1 1ASJ3 2RM21 3M8LA 4WM7B 1QQP3 1TMF1 5GKAC 4N53B 3CJIA 4GH4B 2R072 3ZFFB 1AR61 1WCDJ 5C9AA 3S6PA 1F8VA 1GFF2 1BBT2 4N43C 3JB4C 1CJDA 1POV1 1RMU1 3VBHC 2WS91 1RUC1 3HAGA 1NCRC 1K5MA 2FZ1A 5DDJ3 5JZGA 2HWC2 1AYN1 1VBE1 1AR73 1FOD1 3J8F1 1RUE1 4WM8C 1RUG3 1OOPA 4Q4V2 2WWSA 3VBSA 1RUD1 1RUJ3 2RS31 1DDLA 2RS11 1NG0A 1FMD3 4RR3B 5AC92 1C8M1 3VBUA 3DPRB 2R042 2HWE3 2MEV3 1QJX1 1NA1B 2RM22 1PGW1 5D8AA 2R061 4IV1C 5L7OB 1HXS1 5A33A 1TMF3 1IHMA 1Z7S1 3CJIB 4IV3C 2BPA2 3TN91 4CDWC 4RHV2 1AR63 2ZZQA 4RQPC 4RS5A 5K0UA 1AUYA 1RUI2 4CEWC 1D4M3 2R071 4YVSC 2WS92 5C8CA 1RMU3 1RHI2 5BNOA 1ND2B 5CFDC 2BFUS 1HQNA 1EV12 1ND3A 1BBT1 3ZFEA 1R1A2 1SMVA 2WZR2 2RR12 1PO12 1NCQC 4YVWC 5JZGB
chains in the Genus database with same CATH superfamily
4Y5Z0 4QD2A 3I54A 4B4PA 1GOFA 1GZWA 4Y1XA 3NKTA 3M2MA 3NQHA 1UU5A 3ROUA 3OBZA 2W1WA 4P5YA 1O5UA 4E9KA 1D0GA 4LITA 3ZDSA 2W9XA 1OOPB 4AVSA 3J7MA 3E97A 4HK8A 4MXVA 5FLIA 4CDXC 3JB8A 5FZOB 2HKXA 3QOPA 3PU3A 1AX0A 3T2OA 5IAXA 2VW1A 2BW8A 2VMGA 4FXKB 4TSVA 1QJX3 5DAPA 3OD4A 1VBD2 2ARXA 4OULA 4Q4V1 3CHXA 3U14A 4A7ZA 4XF1A 5ACA2 2YC4A 4B29A 2R063 1FXZA 1HX6A 2WZEA 3R6SA 2H0VA 4M3CB 5JOXA 2BOJA 4Q4W2 3K4ZA 4OQ8A 4Q5OA 1OQ1A 1W90A 1WMDA 1H2MA 4QKDA 4L11A 3AJZA 2JDPA 4XAEA 1VIWB 1R64A 2JE8A 3RWNA 4CDUB 2EF6A 1VRH2 5JLVA 4IEXA 4OHXA 5CADA 1CIYA 1IPKA 3BTYA 1UMZA 3NKGA 4QX1A 2C5DA 1J58A 4AOCA 3NL1A 4MX3A 2XBO1 2VMDA 4LNVA 2BFUL 4Y1YA 3I2HA 5A32A 2VTFA 2F4PA 5FYCA 2ZTNA 2B9UA 5B4NA 2YMZA 4FTBA 4NOTA 3VKMA 1TE1B 5JMCA 2UWBA 2VCCA 3LD8A 1JOJA 4NO4A 4EJRA 4GB32 3POBA 4FXGB 1H1IA 5FP8A 1EYBA 1MR5A 2AACA 4MH0E 4FCAA 4GMP0 4OHYA 3WF3A 3V65A 3C7FA 4K1YA 1EAH2 2C9AA 3WF2A 1W05A 3WNMA 1SDWA 4CCOA 3OUHA 1S1AA 1W6NA 2VXRA 1XC6A 4DXZA 1QJZA 3R05A 2Q8EA 2A3WA 5T55A 1A8DA 2A6YA 2Q0AA 3T0BA 4I01A 4BQYA 1EV11 1Q43A 3RMXA 4P9XA 3WD5A 4QGLA 1AL0G 1OQEA 1WA6X 3QH7A 2V5YA 4QHBA 5CA6A 4I02A 4XVHA 1XE7A 4XFHA 3U10A 4CXXA 5CAZA 2E7TA 5F3CA 2ZGSA 1E57A 1XRUA 1GUIA 1QOTA 2VZRA 4XF9A 1NT0A 3DPRC 1RUF2 3AZXA 4XUTA 3SNMA 3FMGA 3VKOA 3POJA 1H6XA 1UX7A 1UY4A 1ZRDA 4BDVB 2YHJA 3CKHA 2RDSA 2JE7A 3ZXFA 3RVHA 2WN3A 2E32A 3VDAA 1BMV2 1W9SA 3UETA 5DDJ2 4YVSA 4HVQA 3O14A 1H9WA 2A7AA 4AFAA 1LENA 5BYNA 1KQRA 4E2SA 2OA2A 5CFCB 1VBD1 5CFDA 2HWD3 4D94A 5ACA1 3GDBA 1NLSA 2RM23 4LO6B 4YARA 3OBRA 5C7GA 1XOYA 3SMHA 1UZ0A 3N9OA 3O1SA 1HV0A 1OURA 2NZ9A 4Q4W1 4QXHA 4QX2A 2VQAA 4ET7A 2JDZA 3SC7X 1NXD1 4XMIA 4HG6B 1R092 1FMD2 4LQRA 4X6RB 4AQ2A 3OG2A 4YSFA 3BI3A 2AEYA 2YZ4A 4TLFA 4WV8A 3KGLA 1N1VA 2LROA 5JUVA 2WIIB 1S0EA 1LGNA 1VRH1 5C9AB 3SEPA 4MVTA 4ISQA 4Y33A 2H6CA 2XGXA 4QB6A 1VBA2 2BUKA 1V6IA 2QCSB 2YBKA 5CU1A 2WKKA 5FZDA 2ZGMA 2ZEWA 4FAHA 4QQLA 2PHUA 4GXLA 2XVLA 5CB7A 3RYPA 1OLMA 2ZGPA 1HB2A 3CJXA 4O9EA 5FRAA 5JZGC 4DNYA 3ZSMA 4I2OA 3BIWE 1RUC3 1OVSA 4GB31 5F5IA 4M0HA 1GNHA 4BK5A 1K5MB 1W8HA 3AXDA 5H9QA 1MEC2 3LDKA 1OOPC 5C3QA 1GZCA 2GMMA 2YFZA 4FPKA 1X50A 1EAH1 3KM5A 2WFF2 3KT4A 2TNFA 4LIVA 5FPVA 3NNLA 4O65A 1U5IA 1PX3A 1QOOA 2D5FA 2IC1A 5FIXA 3TEZA 3AYAA 2IXHA 2VZUA 4JKKA 5APAA 5A7PA 4Q4Y3 4DEVA 1RUD3 2RS33 2W5FA 3VBUB 2ADDA 3ZXGA 2NPIA 4KMQA 5HV4A 1W6MA 1RUF1 3WDWA 1JMUB 1WA4A 3NV3A 5JOZA 1O3QA 5E88A 3M1HA 1LGCA 3ORJA 1SG3A 4GJZA 4CDUC 1UY3A 4QQ2A 5FXZA 1N1SA 2C4XA 1I5PA 2XWBB 1CR7A 4YZ2A 5CFDB 4XAAA 2ES3A 3B5LB 4G3YC 5FP3A 3MEPA 4KGGA 3S7IA 5A6YA 1CPMA 4GWMA 5FZFA 4CU8A 1BMV1 1W06A 1BCXA 2VZ1A 3GALA 4J1WA 5DDJ1 1V6KA 3POYA 3AKTA 4SBVA 4XTMA 1UMIA 1SLIA 2EXKA 5KBFA 4LO5B 1YIPA 3W9AA 3ZN5A 1CGPA 5DG1A 2UYAA 1SBDA 2WNOA 4CXYA 2Y6FA 1X36A 5FFOC 3ZMOA 1R091 1FMD1 1SLLA 1SDDB 2Y34A 5FP9A 1FPN2 2UWCA 5FUNA 5LBCA 4GKXA 4C90A 4HETA 3U0ZA 4P9LA 4OI2A 3ZN4A 4WM8A 4A7KA 2XR4A 4BMBA 3KV6A 3H1WA 2YB7A 1FV3A 4XABA 3H9AA 5T5JA 5IFTA 2GNTA 1KDMA 3WNNA 1NA1A 3LFMA 5A1LA 1VBA1 2ZKLA 5JR2A 2WQ8A 4NWWA 3JU9A 5DAWA 1TG7A 4Y22B 5LRRA 2WZ8A 3RZMA 1F31A 3ZXEA 1IG0A 4XMAA 3POIA 1UF2C 2IXJA 5FYHA 1Q3EA 2LTNA 3ZR5A 3DYPA 3LIGA 1LNSA 2ENRA 3LDBA 1HRV3 3VZLA 3U4SA 2BGPA 1WUVA 3I8TA 2X29A 1KFUL 4Q27A 1MEC1 4NPMA 5DAQA 2AENA 1ULDA 1FNYA 1YC61 2YU1A 3PUIA 4V1PA 3MHZA 1O3SA 1W9TA 2VW0A 4CDWA 2PHRA 3LCPA 4JDMA 4LE3A 1MZFA 1ENRA 1VBC3 3U37A 1DQ4A 3ZYFA 2VH9A 3WCRA 3ELNA 3H7JA 1KFXL 4BU2A 3OY8A 3AFGA 5CEHA 1S2EA 1MS5A 4YW5A 2ZPXA 4N9IA 1ND2A 5CFCC 3RZGA 4GWJA 3POGA 1A6CA 2IVIB 1ZBE2 4NPLA 3Q8BA 1DGRA 2Z69A 1DYOA 1ZRFA 3PMSA 2NMOA 4MGKE 5FY1A 4ATFA 3CO2A 1U5ZA 3AZZA 5DZFA 1I1EA 2VBDA 2P4EA 1JUIA 4HKLA 4U2AA 1VR3A 2ZZJA 3KV4A 4P14A 3RJRA 4TZDA 1VB4A 5C9AC 1RUJ2 4MGQA 1NCQA 2ZGLA 1JTZX 1H0BA 3ILRA 2J42A 4LLOA 4LPLA 4XETA 2ZEYA 5HBAA 5FO9B 2GNBA 4QPIA 1GANA 5FLJA 5JXJA 3MICA 3BTAA 4QQHA 4WM8B 1JYCA 4DXTA 2JG8A 4YWAA 3SH4A 4BQWA 1SZBA 5DAVA 1WW6A 1KDKA 2ARAA 2VOTA 5H9PA 5J48A 1O5LA 1S0DA 2Q8CA 4KWUA 1K5MC 2QNKA 1FPN1 3VHPA 2JG9A 2D6MA 2NMNA 2E31A 5A3PA 2WDBA 4L8QA 4ZXKA 1HQWA 2PLV3 2JDMA 1UZZA 5IATA 4IV1B 1RITA 5FKBA 2YC2A 3N7LA 4A6OA 3HWJA 3NJYA 4LKSA 4EZHA 1ULGA 1CQ9A 4RSUA 3WT3A 2WAAA 4YYOA 4LO4B 4IV3B 5B4XA 4XJWA 2J1TA 3VBUC 4CDWB 2QQNA 2QQUA 3POEA 3KCXA 5I8TA 1C57A 3LF7A 4AVVA 3EO6A 4L97A 4CCMA 2YXSA 1ZZ7A 5I0TA 4DXSA 4RFRB 5JSOA 1AYM3 1DGLA 1YFUA 3OY8B 2XHNA 1COV3 5K7PA 5L9VA 4K1ZA 3BPZA 1O4ZA 3NVCA 2Y6HA 4QPWA 4AEDA 5FZEA 2QDRA 1FNZA 2XUEA 2UWAA 1W28A 3M3OA 1AL23 3AYEA 2X05A 3V56A 3VGIA 2Y0OA 4UFKA 5FYTA 3K46A 2W91A 4L0PA 3CF6E 4GZ9A 3OB8A 1AYN2 2GNMA 3T2PA 2I2SA 3M3CA 1G9CA 4FPJA 2RS53 1DGRN 3VBOA 4DZGA 4LK6A 3ZDVA 1NCQB 1ZBE1 3NRUA 3I2KA 3OYWA 1QWRA 3LOIA 1SFPA 1W9YA 2PAKA 3C7GA 3MGUA 4OZXA 3T30A 3WW2A 1PMJX 3L9JT 2UY9A 4NMIA 5FZIA 2VCMA 4QPIB 2PMWB 1KD7A 1VMJA 1B35B 2G4IA 2W94A 3N3HA 5E16A 4D7SA 2Y33A 5A3WA 5BXXA 2OQ7A 1RUJ1 3WQ7A 3ZLIA 1SFNA 4KQ7A 4MHRA 2QTWB 3CZUA 1LAJA 3ACGA 3EHKA 4NHYA 4RR3A 3WXPA 4DB5A 2V73A 1JHNA 1YNAA 2XL7A 1W6QB 2EIDA 2W52A 2VZTA 3AYDA 1JZ3A 1P8JA 5F9TA 1JHJA 3VKFC 4G4FA 3LE0A 3OGVA 1FV2A 3IPVA 4ASLA 5IVJA 1CAVA 2A3XA 3J7NA 4UI9L 4EN7B 1XPWA 3WF4A 2IFRA 2ZABA 4Z82A 4YZ3A 5A3OA 4EYUA 1S0JA 2Q30A 3K3OA 5FXVA 4GH4B 4Y5SA 2D6OX 3NJVA 4UW3A 3T1MA 4CSWA 2BOIA 4MSVA 4PT6A 1DQ2A 1UY2A 3OJBA 5FAXA 4N7UA 3SCHA 4CUAA 3S6PA 5F5AA 2UU8A 2VMFA 2XQRA 1W8ZA 1NLRA 4JHZA 1XYPA 1URXA 2L9LA 4IGQA 4UFLA 3NJXA 2WO7A 3HN3A 1XNBA 4N43C 3W5MA 2VUAA 3JB4C 3TEXA 4FOWA 3PUHA 1J83A 1POV1 4TLGA 1CAWA 2AGSA 4K6BA 4QB2A 4RA0A 5A70A 5CBLA 1OA4A 5LWBA 1YI7A 2F4LA 5F39A 3GHMA 4EZ4A 3DYMA 5J7MA 5LRSA 1LB2A 1YLLA 3UK9A 3VV1A 4LBQD 5SV5A 3WZ1A 2CGPA 1LOBA 2N7GA 4W6WA 2RHPA 3OYWB 2DCTA 1XQNA 3GCWA 4NAMA 4AI0A 2QE3A 3BTZA 1SCSA 2FDHA 2P5BA 5KXDA 3MFCA 2HLEA 1AYN1 1IQDC 1D4VB 2V72A 5LY2A 3WW3A 2AR6A 2W3JA 2W46A 2VULA 1LHOA 4KH9A 5K9YA 1RUE1 3H50A 3OGJA 4WM8C 2CHHA 3IBMA 1W04A 3POSA 1JUHA 4RR3B 5AC92 2GP5A 4FPOB 4L92A 4I3GA 3NNMA 5FTTC 2W1QA 2EXJA 4I09A 2CDPA 1JH5A 1U5XA 5LASA 1PK6B 5D2AA 4QXKA 1YJKA 1DZTA 1GP5A 3IPVB 3OGGA 2VM9A 1CAVB 4IV1C 2JWPA 4KU8A 4XHBA 1TZOA 3W21A 4EQVA 2FDGA 2IXIA 3ZXDA 2A73B 1H2LA 3BB6A 3MUY1 2RVAA 1LOEA 2C9KA 4IV3C 4X8NA 3RZHA 2BPA2 1N1YA 4XIKA 3H8XA 4CDWC 3U07A 2G1MA 5KXEA 1UAIA 1BVVA 2QDNA 1AR63 1FX5A 3OGSA 3GJBA 5FUPA 1NZCA 4NJ4A 1CVNA 2KM2A 4DMIA 3C7OA 5K0UA 4HSJA 1RUI2 4XXPA 4FOYA 2SBAA 5AFBA 2B39A 2BNOA 2GMPA 1H4GA 1OT5A 3KD4A 4QB1A 4AFDA 2WS92 2VZ3A 2VOWA 1RMU3 4XTPA 5HCFA 3WP6A 1LHUA 1RHI2 5BNOA 3FHIB 4EE2A 3WW1A 1W8OA 3EB7A 2VC9A 1LHWA 3ITQA 5DZEA 2D3PA 2E6VA 1ZRCA 2CNAA 1OFNA 1YQ8A 5CZKA 2ZGNA 3TWIA 3J26N 2RR12 1G9BA 3P3PA 4PI2A 1NCQC 3HMYA 3T1LA 3ZN6B 4MGTA 4LBQB 3KV9A 4Q1RA 5FOJB 4HLTA 2OZ6A 1QJY1 1VBE2 3CEWA 3ES4A 2ILMA 3NV2A 2YY1A 2WNVA 4UFJA 4WBBA 5FJHA 4QPIC 1UY1A 3J8F3 1B35C 5C33A 4IESA 1ULPA 2J1AA 2VOVA 3FL7A 4FPGA 5FY7A 3ZSEA 3DGTA 3INAA 1LECA 1JZ6A 2BBVA 1DGWX 2WYFA 4B1MA 4KWLA 4YG3A 2Q8DA 3NWKA 5LEKA 1C8M3 1CZSA 2VMIA 3VBRB 2XKPA 2W87A 4D69A 3HD8B 4IDZA 1JU4A 2X10A 3WQBA 1L7RA 1QH6A 1UIJA 5T50A 3IKWA 4JDOA 5FYZA 2ZGKA 3MIFA 3RZLA 1GQHA 3ZYJB 1XBFA 5LEJA 2VZPA 4AHZA 1PMIA 4M4RA 1ONAA 5D21A 5GLWA 5FZ8A 5AC91 3LSDA 4PDWA 4AF9A 3S7EA 3H8RA 4AW7A 1L3JA 2B7YA 2C6SA 2WO3A 3LDRA 2IXCA 3N7JA 4FOQA 3VBHA 1O4YA 2D6PA 4GH4C 4QQOA 1JYIA 4M01A 4QPGA 5K4LA 5ABJB 1GWKA 2WNUA 2PAEA 2WA4A 3I59B 2Q8OA 5T3NA 4DOUA 3LIHA 1ZRRA 3MV11 5K8SA 3N36A 4FT8A 3DXTA 3USSA 4P9GA 3N4MA 4Q0UA 3IMNA 2R073 1SBFA 1AXKA 3LA3A 4HL0A 4OFGA 4AEJA 2DU0A 4U36A 3I3QA 2XL9A 3ECQA 2JB8A 4AI1A 2PQQA 1ZBA2 1ASJ2 2HWF2 2DUQA 1HRI1 1RUI1 3VUOA 4KU7A 1I6XA 2IXKA 1BEV2 2C26A 2I45A 2P17A 3K4DA 2WYSA 4V2VA 2H6BA 2GN7A 2UYBA 1ULEA 2WNVB 1RHI1 2RE9A 1ZREA 4URTA 4AVCA 5CIRA 2WSUA 2R1DA 1O4TA 1F5JA 3JBG2 3BIEA 5A3MA 3MPPG 2B8MA 5LBFA 4QX3A 3D82A 4A6SA 3GHNA 4OMDA 2RR11 5LATA 2JE9A 4P08A 4LBNA 2BYVE 2DFCA 2JJ6A 1EY2A 2P3JA 2PELA 4RR3C 3FE5A 5B2GB 2EIGA 2G9ZA 3RFRA 1IZ3A 5FV3A 2XVGA 3I2FA 4UAPA 4RGGA 2JD4A 5EYYA 4BISA 4ZHNA 2XLGA 1AXZA 4RQPA 2W2IA 4LK7A 4CP2A 1PK6C 3AMQA 3NAPB 2FDKA 2VY0A 1BHGA 2PHLA 5CG8A 2ZA9A 4DY5A 3WQ0A 1QY4A 3AP5A 1DZQA 1J3PA 4PDWB 2R0HA 3KVAA 4XC9A 3I4IA 5KXCA 4CCLA 2QJVA 3PJYA 3NJZA 4XF3A 4YZ4A 2LALA 2WWJA 3P6BA 3AL6A 3I97A 1DG6A 1GNYA 5FBZA 1GNZA 2BTVC 1XU1A 4E4DX 1UKRA 3UNPA 4ZONA 3WINE 4QPGB 1H8TA 5FPBA 4YM2A 4BHPA 3RQ0A 2WNUB 2BQPA 4XQDA 5LY1A 4HOOA 2QQOA 2XBO2 4XACA 1RXFA 2RJKA 4IETA 5FY4A 3WDUA 5IK8A 1GYKA 2JECA 1PZ7A 3DN7A 1G7YA 2MNGA 1VLNA 2A5ZA 5EV7A 1W99A 4EWAA 1S2KA 4HXCA 2VOKA 4FFGA 4IEUA 3ETQA 4P9JA 1LHVA 2C24A 4W65A 3VHRA 3FHAA 4K7JA 3WUCA 3SITA 1J1LA 3UJQA 3NSTA 5CNAA 3OD0A 2IUWA 1UKGA 2YBSA 3H1MA 4QHZA 5BNNA 4HSLA 4E2GA 1HLCA 1OVPA 1F4AA 1KEXA 4LBLA 4QXCA 1OPOA 5F6KA 4HN1A 2A6VA 1W0OA 1V6MA 2D3RA 3MI8A 4CCKA 1BJQA 1JYNA 1AJOA 2CAVA 5FZGA 2ZAHA 2VNVA 2E63A 1C5IA 1V0AA 2X5IA 3MW2A 1ZBA1 1ASJ1 1XU2A 2HWF1 3GZTB 4XF0A 1FYUA 3AMPA 1Q8QA 4CDQA 1M06G 4P9WA 2XDVA 1BEV1 4LBMA 5F8PA 3X29B 4OUSA 5J37A 4N53A 5F2WA 2V4AA 4JGYA 4P00B 5E89A 3VBRC 1AR92 2ZXQA 1CX1A 4O9GA 2VVEA 3ZXLA 1YWKA 5AVPA 3WY6A 1JZ7A 4UFIA 3ZO0B 3JBG1 4XBQA 4QU1A 5A80A 3D6EA 4FSJA 3TEYA 1OLRA 3D3AA 3MO4A 1YRZA 4HPKA 4CZSA 1OKOA 1QEXA 2YYOA 1ENXA 1IOAA 4I0AA 1M4WA 4PIXA 1UIKA 5FZCA 4PLMA 2VPVA 3PUSA 3AKQA 5IJRA 1VBD3 4XFBA 4ARXA 1KJLA 1H8TB 4ZS3A 5ACA3 3MIHA 4A4AA 4YW3A 1CAXA 5EIYB 5ABJC 2VTXJ 3WVJA 3JXSA 2XJSA 3WDVA 1WZXA 4Q4W3 1V9U2 3VDCA 4AGRA 4D7TA 5I8YA 1PGL2 3MUZ1 4IUGA 4PF5A 4IE5A 3TN93 5FDBA 3IAQA 4Y1VA 2RV9A 1W0PA 2FQPA 2LRPA 2W47A 3N9MA 4LTAA 1I3HA 1VALA 2BWAA 1NCRA 1RVF2 2ZGRA 4GJYA 2ET1A 4LA3A 1UX6A 4CU6A 4HT1T 4NHKA 3PVNA 1WKYA 3OF1A 5BNNB 4FVVA 1CN1A 3WHTA 5FMBA 4H55A 5JSRA 1W9WA 1Y9QA 3K48A 1UOFA 5JWPA 2Y6GA 3KVBA 3R0RA 2Y6JA 4CTEA 4QDQA 2YROA 2WNVC 4GB33 3ZFEB 2X5IB 2VTXA 3IDAA 5A3TA 1O6UA 1QNYA 4YRDA 1FAYA 5I91A 3PIGA 5L7OA 1XYOA 4P5HA 1MACA 4CU7A 1F9KA 1EAH3 5CKQA 4E8DA 1GZWB 3IM0A 4JGYB 5D1IA 4NPRA 5DPNA 3MF6A 4IE6A 4AG4A 5BY5A 3OGRA 5BUVA 3B7MA 2P3KA 2HEVF 5C70A 3M70A 5F5QA 3E5QA 4KBZA 2VMHA 4Z92B 5HI0A 2OIIA 1S4CA 3M3EA 3NAPC 1QF3A 2A70A 2ZX0A 1OH3A 2Q4SA 1AZDA 3VKLA 3ACHA 4BQXA 3ASIA 4INDA 4PDWC 3GZUC 1AR91 1A78A 2Z79A 1RUF3 3DKQA 3E6BA 1O7FA 1LULA 3NV4A 4N9HA 2BNMA 4OUEA 4Q26A 2OZJA 3GXUA 4B8EA 4OUMA 3BTXA 2GN3A 4IEWA 4CEWA 1JN2P 4QPGC 3PUAA 3LEMA 4AHWA 2WNUC 2DFBA 3A7QA 2CL2A 4B7EA 4PJYA 2JDUA 5E1RA 1MS4A 3KHCA 2P37A 2XONA 4HVRA 4FP3A 4LHLA 1RYYA 4X8PA 1TVGA 4AVAA 4FTEA 5DXDA 2BV4A 4F83A 3UKNA 1ZVFA 2XJRA 1JI6A 1YQ6A 1NCRB 1IPJA 2W1SA 3BALA 4M00A 4NWVA 4EN8B 1PGSA 1NUKA 2J1RA 2R0FA 1QXRA 1UYZA 1ZZ6A 2XUMA 4IEVA 3WF0A 4OI0A 1PGL1 1V9U1 3ACLA 4B4QA 3VDBA 3ABZA 3T0DA 1ZM1A 2ZOEB 3I2GA 1R093 5JI7A 5A32B 4DUWA 1DQ5A 5FK7A 1R1ZA 2HWE2 4CXWA 1K3IA 4YPJA 2J22A 5DQ0A 5FLHA 2A75A 3ACFA 5KR7A 5FYIA 3T2QA 1RVF1 1GOHA 1S0CA 1OQDA 2HWD2 1IS4A 4PQ9A 1NLQA 1VBA3 4NIDA 5ISLA 1W2UA 3KGZA 1TMF2 1RJ8A 3OEBA 2ZKNA 5G04L 5JXHA 2ZACA 1W6NB 2D6LX 4L9BA 4YW2A 3SH5A 4RGAA 4JKMA 4COUA 2XJQA 4FPYA 3WNKA 3VD9A 3ETPA 3OEAA 5SV8A 2P6HA 4Y4YA 4AE2A 4NRQA 3LA2A 4CEYA 5JCTA 4EV0A 4WM7A 4UW5A 2Z42A 1R1A3 1XNCA 2VCAA 5EXOA 5T5LA 2HH9A 1MEC3 2NM1A 4W8JA 3ZYBA 1G8WA 3LOBA 4AFCA 2WFF3 3UKTA 3O0VA 4LJHA 3I2OA 5C3PA 4H3WA 2VZVA 4FPCA 3KS7A 3ZFFA 1UOGA 3AXEA 2ZX1A 3E5XA 3D8CA 4W6XA 4CU9A 1RUC2 1Y9MA 3UL2A 3PJQA 4CEWB 1GWLA 1H8TC 1S2BA 1OKQA 4BE3A 4YVSB 1SLTA 3QACA 5L9RA 3H3UA 5IUQA 5LK7B 3B94A 1E5RA 4CPBA 3AJYA 1YFYA 3VZKA 4LOSA 1FOD2 4PLNA 1HV1A 5M0TA 3HT2A 2JIGA 3FFQA 3IT8A 4BMEA 1GP4A 4QDSA 2RS12 1UN1A 4IE0A 3A21A 3ZYPA 4AR2A 3HOBA 2YPJA 4C0BA 3C2UA 2WNEA 3LA7A 3M4FA 4M3CE 4YGBA 5BNNC 1A8MA 4XFCA 3RSJA 4EWDA 3SHRA 3B93A 3A22A 3ES1A 3RWKX 3H3LA 4ZS2A 3VD5A 5BNPA 2RDRA 4A45A 3T2TA 2C1FA 5JVVA 1DCSA 2WUHA 5FY0A 2HBTA 4AK3A 4JVAA 4XJ8A 1W8UA 3I2DA 4A3XA 4BCUA 3ZFEC 2X5IC 3KQ4B 4ZZ5A 1HXS2 3KLSA 1SBEA 1U12A 2PHWA 2HWE1 1FPN3 4UBGA 1Z7S2 2ZEXA 2JXAA 2F17A 4K3UA 5FQ0A 5I0RA 2WWUA 4PBPA 3ZKUA 1GWMA 2HWD1 5FWJA 1HKDA 4XJ9A 2DWRA 2RM21 3M8LA 4OLLA 4WM7B 3ZPYA 1JOPA 2NLRA 1QQP3 1TMF1 1WLDA 2V5DA 1V70A 3LWCA 4RGKA 1JZ2A 2AC1A 5LB6A 3GCXA 4UW6A 4XZPA 3ZFFB 1PZ9A 2HYXA 4AFBA 2XOMA 1V00A 3AP6A 4MGIE 1RL3A 5FXWA 5J09A 4YW4A 1BBT2 3E5UA 3O12A 5CVRA 2O1QA 2EICA 5T52A 1W6MB 1BKZA 4HKWA 5ANQA 2JEMA 4BLJA 1CJDA 2VUDA 1GICA 3UV9A 5FY8A 3LAGA 3ZM8A 4CCNA 3RI9A 5C8WA 2I07B 5FYVA 3EMRA 1LTEA 1EPWA 1RUC1 5KC6A 3HAGA 1JOBA 1WBLA 5E6HA 5IK7A 1HJGA 4ONUA 2R16A 3RZKA 4N7IA 2QZ3A 1DIWA 4CVUA 5IK4A 1NCRC 3N9NA 1UWWA 3B02A 3B9IA 4PHZA 5GJ6A 2E51A 3CQOA 2ADEA 4M0NA 2HWC2 4UT5A 1W3XA 5FP4A 1O8PA 1PNFA 3JCIA 3BCWA 4R9AA 3ZPOA 1FOD1 2DVAA 3FLPA 4FPFA 1JYXA 1WCSA 3DECA 2WWSA 3VBSA 1RUD1 1RUJ3 2RS31 5IVYA 5FZKA 4YLZA 1X8MA 2BGOA 2GALA 2RS11 5GZFA 4GA9A 5T5OA 1DDLA 4ZPIA 5HXVA 3H42B 4IQPA 4ARYA 1W8WA 4LHNA 2O14A 2R042 4BQ4A 5A7QA 4NIIA 3KZ4C 1IPSA 5FZHA 1UU4A 4QX7A 5GZEA 4E27A 1NA1B 2JDYA 1QKQA 3EBRA 2FCVA 1GU3A 3NV1A 2DYCA 1APNA 1W2NA 3SQOA 1J59A 1HXS1 5A33A 3UKVA 2FD8A 2GC0A 1Z7S1 3ENRA 3URFA 2GC3A 2P1BA 1CJPA 1LOFA 2GNDA 3KB5A 3M3QA 5DABA 4P02B 1BXHA 4RHV2 4XBNA 2VUJA 4FQZA 2QBXA 3RNSA 3TBDA 1NXMA 2YDEA 2PHFA 3GZEA 4RS5A 3THDA 3OPWA 3V0BA 4AEMA 4CEWC 4ZXEA 1V6NA 1SPPA 4XJAA 5FO7B 1D4M3 2FHRA 2W92A 4MUVA 3TNPB 4DPNA 4H2AA 4Y20A 1JBCA 1UOJA 2EAAA 4YVSC 4CRQA 1LKNA 5JI9A 1QH7A 1MS9A 1ND2B 5CFDC 4XFGA 4Q1PA 1BBT1 4ZU5A 3WNXA 2WZR2 1PO12 1NQJA 5GZGA 4UBHA 5DAXA 2A1XA 4H14A 5EQUA 3JZVA 1ZZ9A 2D6KA 3WV6A 5FPLA 1O91A 1RUE2 4CP0A 4LULA 3EXUA 5IK5A 1E5IA 3AVSA 1Y9GA 4FPLA 3VBSB 4KL1A 3MLJA 4HFSA 1QU0A 4R4XA 1QIQA 4DUVA 2BERA 4PIZA 5GLUA 2HWC1 3ME2A 5JPNB 2WT1A 4UF0A 4IE4A 5A7NA 3TYJA 2JG8B 3NMBA 3E1F1 3WG3A 1OA3A 1BK1A 2JB4A 5J98B 1YI9A 2VO5A 1WBFA 2RS52 1AJKA 4K40A 4NROA 1PIV3 3UYJA 2DCKA 5FPAA 5BNQA 4WM7C 1NOVA 3P3NA 1T2XA 2JG9B 2R041 1ULFA 1JW6A 2VJXA 2WLPA 4EN9B 4XHXA 2WSVA 3T08A 2JKBA 2BP6A 5FYUA 3Q9OA 4HKOA 5EFUA 3K3NA 3KCCA 1GLHA 3SCFA 4JAAA 2AEZA 4LA2A 4D6RA 4OYUA 2ZGOA 3ZFFC 3H1YA 4S2DA 1VB2A 4XFIA 3V0BB 4YM3A 4BWOA 5JDBA 1DHKB 4IEYA 4QGNA 3C3VA 4UOJA 4QU2A 3RGBA 2ATFA 2EIEA 1VAMA 3AC0A 4UFHA 3PL0A 1Q8SA 4Z2WA 4RHV1 3TRSB 4K8RB 4Q4X3 2ZX4A 1OPMA 2BGCA 2A6WA 1QOSA 4AEDB 3OOXA 3RYRA 1R082 4BA6A 1C28A 4ITCA 5FZ6A 5IVVA 3VDDA 1I9RA 1BK0A 3IDBB 5J36A 1K45A 3MIGA 1QJY2 1V6OA 1WMEA 2YUEA 1RIRA 4AL9A 1RJ7A 3EJKA 4QDRA 4JDNA 2HBUA 3BN6A 3VBOB 3HQRA 5HCAA 5FR3A 4OI4A 2E7AA 2VXJA 3L2HA 3ZYHA 4GMP3 2WBKA 2WZR1 1PX4A 1PO11 4WVWA 1Z78A 2VW2A 4BOWA 3VL8A 3WG1A 1KGYA 4NHMA 2RMU2 2GZWA 1GOGA 3HT1A 2XLAA 3ZFGA 3WNOA 3T09A 1QNWA 1GZTA 2OS2A 1PVC2 2G19A 2XXZA 5A7WA 4Z8BA 2ZAAA 4LO7A 4XE9A 3S0MA 4BYYA 5JPMB 1ZNPA 2EXIA 3NNGA 3BPSA 1NA1C 2ORXA 4JTOA 1OFSA 4R9BA 3OCPA 1RUH2 4HONA 3WSOA 5AC93 1EP0A 5FUIA 1AL21 4OVEA 2IVJA 1W3VA 1OLQA 2DTYA 3HIFA 3SH3A 2CSGA 3LQCA 5CKMA 4HBNA 4EWEA 2XJPA 2RS51 4PF1A 4LKFA 4C8DA 3QBQA 3RS6A 5FPZA 2VE1A 1PMHX 1H30A 1YQCA 5GALA 3MZHA 2B4KA 4AAXA 1CD3G 3K2OA 1SFYA 2QQWA 3PU8A 4DY3A 2WO2A 1OD3A 3BODA 4KWKA 2IFWA 1ZYBA 3GZAA 3QD6A 1C1LA 1MZ5A 2FCTA 5FZ7A 4JV4A 1UO9A 3ZR6A 1HB3A 1HRI2 2E33A 4CDXA 3BU7A 4FFFA 1ND2C 3SISA 3VZNA 1RUI3 4XDPA 3WR0A 2VVDA 1CESA 4HZFA 3VDDB 4FTSA 1CAWB 1NAEA 5F7UA 3HQXA 1UYXA 2VNRA 1PM7A 2WS93 4I0BA 3B00A 2BDRA 4Y26A 4FP2A 1RHI3 3TEWA 1YEWA 1QJU2 1X9PA 1Y43B 1R081 2JENA 4FOVA 1DF0A 1C5HA 4FPEA 2OKXA 3VBSC 5GLVA 2RR13 1VBB2 5C4WA 4OI1A 3W58A 5KHJA 4ZKTB 2K46A 4NHLA 3TOJA 3M7AA 1G86A 3ZFGB 1VBE3 2QQIA 3BOWA 3CNAA 2HEYF 1GV9A 5A7WB 1JZ5A 1PVXA 2JG8C 1MS3A 1GQGA 1NQDA 4GWNA 1ACCA 3APBA 2XHKA 3MW4A 2BZDA 5KHGA 3KMHA 5I0DA 2RMU1 5FO8B 4WZCA 4KNCA 5GZCA 1ALYA 4BIFA 1IQAA 2JG9C 2WABA 1PVC1 3SKVA 1AR82 1SHWB 4V2WA 1STMA 3MV01 2MHFA 1LOFC 3ILFA 2O8QA 3IN9A 2PYTA 2G9FA 5F5CA 3AK0A 2GH8A 4N8MA 4Y24A 3VZMA 1RUH1 3CBNA 3DF0A 3V0AA 3AKPA 2B42B 1PO22 2B46X 2HWB2 4UW4A 1QJFA 4LUMA 4Q2FA 4LHKA 1KJRA 2PA7A 2Y6KA 4KBBA 1XE8A 2Q1FA 5F3IA 5IVFA 3NW4A 3RZJA 3KQRA 2PFWA 5I0UA 4DS0A 1W39A 2A6ZA 4AQTA 1BVP1 3LEIA 3H8OA 4J6GA 4RD7A 1T6GC 3KCYA 3JD72 5K0UB 3WDYA 1WCQA 2P3YA 1BYHA 1TME2 3HVDA 4AEDC 1SLAA 2E26A 4TN7A 2OVUA 4XUQA 2H0BA 4DFSA 4R4ZA 2ZHMA 1DZRA 4NUBA 1O3RA 2JDNA 1XXNA 4AI9A 4GALA 4QM8A 4ASMB 5BNOB 3HBZA 1PZ8A 3ILNA 4LIUA 1C3HA 2BJSA 2DCYA 4DEQA 4YG0A 3VBOC 3IWZA 2DF7A 1ZBA3 2HWF3 1X82A 1CZTA 2KR2A 1QHDA 4XCAA 1ZZ8A 4FI9A 4NIAA 3TAYA 3VKNA 1BEV3 5C4WB 5KWRA 4CUGA 1LU2A 1XYNA 3MFAA 2FDIA 3VD3A 2PHTA 3FBYA 2P34A 2XMLA 1D2SA 3F2ZA 1AHSA 1JYTA 1VAKA 4A3ZA 4LEJA 1J3RA 1WW5A 1QJU1 3JBG3 2VCBA 3R4SA 4JHTA 1W8NA 5IW0A 4C1XA 3H0OA 2ZHNA 4CCEA 4AAPA 1VBB1 2TEPA 4F8AA 3BU0A 2DUPA 3F95A 3B9CA 3Q8CA 3J9SA 4NE9A 4AVBA 3MW3A 4Q4V3 5G05L 2DBNA 4BQ1A 4QHOA 1DYPA 2WINB 4C91A 4UYBA 1DBNA 1V6LA 2GC2A 5IAVA 4NIGA 2PHXA 4AXOA 2Z4FA 4JC1A 4YFZA 2BEOA 2HYKA 4COVA 4LMFA 3VBHB 3RMYA 2J1EA 3CL1A 2E9QA 1AR81 1AR72 3UESA 1RUG2 4CCDA 1LJ7A 5C71A 1FT9A 4YVWA 5J96B 1PO21 2HWB1 2XBO3 5FMOS 5T5PA 5A3NA 1POV0 2ZMLA 4XJUA 2MEV2 3WEZA 3VD4A 3VDDC 1W8TA 4KG8A 3AZWA 5FXXA 2Y26A 1Q56A 1XNTA 4X6QB 4C0HA 2ZJCA 2ZHKA 3WP3A 3JD71 2CGNA 4EROA 5L73A 3AZYA 1TME1 4P9IA 5EJZB 1DQ0A 3FWEA 4D6SA 2B9VA 2WFPA 4JX0A 4M3CA 4OHWA 3THPA 1CAUA 2BBAA 4FPHA 2ERFA 4CDUA 4QM9A 3DKWA 3ZFGC 4IL7A 1XE0A 1EV13 2ORZA 5FY5A 3O1OA 3E6DA 4COWA 1S55A 3KHBA 3TB0A 2F6BA 4AQSA 4QGMA 1IS5A 4DIQA 3P1IA 4C1WA 1DQ6A 5A1FA 2VMEA 4XUNA 4JCKA 2D5HA 4UWDA 4YNIA 4DXRA 5LBEA 3VL9A 2KA3A 4OHZA 3B01A 4XCBA 1AR93 4Z07A 2OX0A 4Y1UA 5J1XA 5IWFA 4OCTA 4RQPB 3GJAA 4QXBA 4NHXA 1RTVA 3D0JA 4HVOA 2YG0A 3AM2A 3PVBB 3ZYIB 4MGSA 3S5QA 2QVSB 1REDA 2PQSA 1X9TA 1WLWA 1DFQA 1XNDA 3PMEA 2NQYA 4GQ7A 1L7LA 4FO9A 4ZZ8A 1N47A 5FPXA 5FMOL 4ZY9A 4BXSV 4AQ6A 3AP9A 3HQUA 1YFXA 1L7QA 4LXLA 4QX5A 5DZGA 5A7SA 3UGHA 3C8XA 4YVWB 4Q0SA 3U11A 1V9U3 1POQA 5K0UC 1WW4A 4RFT0 4BZ4A 3OUJA 4Y5TA 5KHHA 4D0QA 2ETEA 3LB9A 4NRMA 1HQLA 1LODA 1AR71 1PHMA 1VRH3 2PXJA 2RDQA 3FX3A 3PVOA 3O0WA 1QJX2 1DQ1A 1OF3A 4LKDA 5EP9A 5HV0A 1RUG1 2ET7A 1RVF3 5BNOC 2YFUA 1PGW2 2CYFA 2AZ5A 3T3YA 5HPOA 3PNAA 2R062 4IW3A 5FY9A 4JQTA 2WN2A 2DV9A 4LLFA 1YIFA 2AREA 1UCXA 3PLQA 3AP7A 4MGZE 4R9DA 3RDIA 4FBFA 5I0SA 5GLTA 5EHDA 2MEV1 4BQ3A 4A42A 1W8FA 1CAUB 2EA7A 1ENSA 1N3OA 5C4WC 3T4HB 3B3QE 3TN92 1TNRA 3AMHA 4DRRA 5BV6A 4IGPA 5IVCA 1WD4A 4KG0A 4NIHA 2OUHA 1RGSA 2XWJB 2JKXA 2W68A 5CFCA 4CDQB 5A1AA 4XPVA 4AYUA 5EZWA 1VPHA 1N3QA 2Y0IA 3FZ3A 1KXGA 2HEWF 1QMJA 1W6PA 4N53B 3I3EA 3CJIA 4XDQA 1W2TA 4JRAA 4YGEA 3MPBA 4BH9A 1OXCA 2GDFA 4IEZA 4MLOA 3WF1A 1WCDJ 5C9AA 4FFIA 4FFHA 3ZIWA 2OYZA 1F8VA 1REEA 2Q5TA 5DMYA 4HPKB 4Y1ZA 2VOXA 4ISRA 1LEMA 2LM3A 3SEEA 3DEMA 3SKJE 3VBHC 4IXLA 5FMDA 4CYDA 2C0ZA 3U75A 5GLZA 1JS9A 1CX4A 1LR5A 1SLCA 4LT5A 1AX1A 1C4RA 4KI5M 1LEDA 1CAXB 1HDKA 3LFIA 3CIHA 3O7OA 2D43A 4AEKA 1K5MA 1QGLA 1O3TA 5FPUA 3RJ2X 5DDJ3 2W95A 2OXBA 4HANA 1DU3D 1IG3A 1CIWA 2BNNA 3SXWA 3W5NA 1ODNA 1ULOA 3PTRB 4K8FA 3USUA 3O1MA 1AVBA 2RG4A 4L99A 4MHUA 4CUCA 5LCWL 3UGGA 4TWTA 4ORFA 2R30A 2ARBA 4AVTA 3BKZA 1HB1A 1GSLA 1FMD3 1NG0A 1UNBA 4PI0A 2ZX2A 3VBUA 3A23A 3H3ZA 4MG2A 2JX9A 3ZXJA 2Q1ZB 2HWE3 2FMDA 2JDHA 1VP6A 2X8KA 5A7OA 1MVEA 1QJX1 2OPWA 2VZQA 1JYVA 3OBAA 5FZLA 2RM22 1PGW1 3RZZA 4AFMA 5D8AA 4MZUA 2R061 3OBTA 2P2KA 1IS6A 1O59A 1ODMA 3IZOA 5L7OB 1E5HA 4XOGA 5GM0A 1TMF3 1G9AA 1S0GA 1W6PB 1IHMA 4YW6A 4YM0A 3CJIB 5L36A 2AH2A 4WVMA 3WUDA 3TN91 3VZOA 4B4RA 4Q29A 4S2HA 2WLQA 2G9GA 1KITA 1EPZA 4OZOA 2XG3A 1NX9A 2ZZQA 2WAOA 1QDOA 4RQPC 2ZMKA 4Z2AA 3BGAA 2QZ2A 1IGOA 1OD5A 5L9BA 2DCJA 3IMMA 1UZYA 2CTVA 5JMOA 2VGDA 3N9LA 2E53A 3IIIA 2WL1A 2ZX3A 3DUIA 5FK8A 4JQRA 4OQ9A 3N9QA 4NN0A 5C8CA 3O1PA 4YZ1A 3O1RA 1IS3A 3BOPA 5DUUA 3GM8A 5FYSA 2K9ZA 3GBGA 5H9SA 1GBGA 1HQNA 3AFKA 4QMAA 1ND3A 2AYHA 4CPBD 1GZ9A 1H6YA 1LESA 1R1A2 1SMVA 5FMCA 3I3MA 3POWA 4Y22A 4YVWC 1S0BA 1UD1A 2YBPA 4QKFA 2FBEA 3H7YA 1NY72 1WGPA 3K75B 1VAVA 1RINA 3ZX7A 2YC0A 1JXNA 3ZOIA 5FKCA 3USUB 1FOD3 4Q4Y2 3K77A 3TNQA 4MV2A 1RUD2 4A44A 2RS32 5CISA 1LRHA 3BUCA 1RUOA 1W03A 4WVZA 2CWMA 2J1SA 4XYXA 2ZS6B 1MPXA 2DUOA 3VHNA 1NYWA 3WDXA 2RS13 5A6ZA 2FZ2A 1H2KA 5CKNA 3A0NA 4AWDA 2WC2A 3KV5A 3GBFA 3R4UA 5FBJA 4D8MA 4CA9A 5E8AA 3FUOA 4IE7A 5ANNA 5KC5A 3FBMA 4I30A 4J25A 3GNEA 5KHKA 1OSGA 1XNKA 4IEPA 1N1TA 4QQPA 5C5UA 2LS6A 3M3IA 1QJEA 1UQXA 3HEIA 3SCGA 5D8AB 1JZ4A 2J7MA 2CV6A 4XDOA 1QXPA 3THTA 4CDQC 2X09A 2Y64A 3AKRA 3ATGA 4N43A 4N90A 1Q8OA 1TEIA 3BVCA 1HXS3 3LGRA 3UJOA 2VAUA 2VNGA 3IDCB 1LOCA 1Z7S3 4N53C 3QH6A 4WVMB 3VBFA 3RPQA 4JGYC 1BLZA 1DLCA 3FJSA 3T4VA 5JOWA 2O8OA 4R52A 3U1XA 4QKNA 2IZWA 2QUOA 2YGMA 4CEYB 1MQTA 3OTFA 3G7DA 1PNGA 5EJ3A 4COYA 4FQ4A 4AI3A 4BXFA 3GF6A 2JD9A 3HNBM 3J7HA 2VD7A 3AMMA 3AB0A 4LORA 5C3OA 3OSDA 4CCCA 2YGLA 1E5SA 3KT7A 5FWEA 2VQTA 4Q8LA 3FFZA 3D4KA 2ZBJA 3PURA 1D7PM 5C8CB 2EALA 4HMZA 1H8VA 2R7EB 5FZ0A 1YXWA 3GYDA 3KSCA 5LA1A 5LZ6A 3I49A 3ZIXA 2BVBA 1YFWA 5FYMA 1J1TA 1ND3B 3C7HA 3O1TA 2QQPA 1BBT3 2TUNA 3BYWA 1QQP2 3FLRA 2ZHLA 4XQ4A 3WQ1A 2VBPA 3WNLA 1YYNA 4QPYA 3ZSKA 1LHNA 1HRV2 2VL4A 2YV8A 4IV1A 4XQWA 4ES8A 5I93A 2ZMNA 2IXLA 1ZBE3 1WCKA 4J1XA 5EJ1B 1R1A1 4QKBA 4JGZA 5ERLA 5DN2A 4YM1A 2EXHA 2CAUA 1NKGA 4IV3A 1VBC2 1WW7A 2HWC3 1NY71 3VB9A 2WFF1 4D7YA 3AX4A 3D5OA 1OMIA 5LA2A 5BNPB 4GIQA 4A7YA 3HJRA 1RB8G 1SACA 1ZA4A 3AZVA 4Q4Y1 2V09A 3UGFA 3RYKA 3VLBB 5FZMA 1LOGA 3THCA 4W6YA 3WCSA 5HXMA 4YGDA 3ZSJA 2CGOA 2KXLA 1W2OA 2GMEA 2Y38A 4N43B 5L7OC 2EIBA 5FYBA 3CMGA 2R043 1JZ8A 1X33A 5FQ0B 3VBFB 3O1VA 4LO8A 5IHRA 3CJIC 3IIAA 1GQPA 4PCRA 1DYKA 3GGLA 3IB3A 4XILA 1MQTB 3AL5A 3LPGA 3RI8A 4A41A 1SQ4A 3W59A 4CCJA 5AFEA 5F3EA 4EN6B 5H9RA 3ZVXA 3HPNA 3U78A 4BK4A 3GBWA 5DUXA 3MLKA 4W4ZA 2ARCA 3S30A 3UT0A 4F3JA 1D2QA 4IEOA 3ZYRA 5FZ3A 1AF9A 2PAMA 3C7EA 1UPIA 4PQQA 2D7FA 5EPAA 1B35A 3V64A 1F5FA 3PHMA 4RHV3 2P3IA 4R8HA 2XQXA 1Q5OA 5GZDA 2DTWA 4YZ5A 1BQPA 4DINB 3FHQA 1GMMA 3HBKA 3MYXA 1KS5A 2D98A 3RRDA 1YHFA 1POV3 2QQVA 4BLIA 4K9SA 4CP1A 3WW4A 1Q8PA 1HJFA 1W6QA 2PLV2 2R32A 4D3WA 1REFA 1LGBA 3POFA 3WG2A 2W1UA 4PLOA 4NVPA 4COZA 4RN5A 3O5SA 4BPZA 1GP6A 2WZR3 1QQP1 4JGZB 1NZIA 5DUVA 2EVXA 1PO13 3IDEA 5FP7A 4YGCA 1D4M2 1OA2A 1AYN3 1U0AA 2WT2A 4GH4A 4E8CA 4B1LA 3AMNA 1RUE3 1CONA 4MXWA 1AYM2 1HRV1 2NYYA 2WJSA 4AI8A 4YW1A 2Y6LA 1COV2 2ID4A 3K4AA 2J1UA 3VN4A 2D3SA 4O61A 3MLLA 2DBIA 3AVRA 3ZMNA 1VRBA 5D8AC 3SLIA 1AL22 4KWJA 1VBC1 1K5JA 2V4VA 1XSQA 3CDZB 5C3SA 2Y8KA 2RDNA 5LA9A 4ASKA 3I3DA 1S0FA 2A6XA 4R9CA 4RL7A 2GSYA 3ALQA 5FCCA 3CLPA 4RYDA 4WZFA 5F32A 1K12A 1UXXX 4K20A 3J4UH 4MYEA 4CEYC 1J84A 3QCWA 2K0GA 5A33B 4LBOA 2CDOA 4TTGA 2Z2SB 2Q1MA 1F2NA 5F1RA 5A6XA 3ZYGA 3WP5A 4NAOA 3D0SA 4BIOA 1U5YA 1XB9A 5CYYA 2ZGUA 3DYOA 1OLME 3VZJA 2QFEA 1MVQA 1KS4A 4RS5B 1X8EA 5C8CC 1UZVA 1JODA 1LCLA 1Y3TA 2MPFA 4DQAA 1SPPB 1Y7BA 1PIV2 4L2NA 2XPJA 1MS1A 1XJAA 1ZZCA 1TNFA 1ND3C 1Z0HA 4K21A 4QT6A 3WP4A 5FOBB 5CG9A 4MGYE 4Y20B 2JDAA 1C1FA 4XXAA 4GKYA 1TQ5A 2DCZA 3HNMA 2OPKA 1ULCA 1PK6A 1OBNA 5IVBA 2D93A 3ZKYA 1YQ5A 3WNPA 2ZGTA 3NO8A 5IVEA 1DLLA 3PUQA 1R083 1YUDA 1WMFA 1UYPA 3JQXA 1QJY3 1LOAA 5T54A 2VU9A 2D6NA 2PTMA 2PLV1 5JAXA 4MXWB 1UY0A 5BNPC 2QQJA 2JDKA 1MS8A 4Q4X2 3T0AA 4LHSA 1O8SA 2ZGQA 3KF3A 1A3KA 1H4HA 2PHDA 4OHVA 2OT7A 2IWGB 1Q8VA 3B69A 2XH6A 3MIDA 1CPNA 3HNYM 5FZ4A 3O0XA 4GULA 3DV8A 4XJZA 1D4M1 4D6QA 2RMU3 4UF0B 3WHUA 2VUCA 2CY6A 1VE0A 4CUBA 5IFPA 4URAA 1PVC3 1AYM1 1WLTA 4ZU7A 4XW3A 3VBFC 1COV1 1V6JA 3WG4A 4FAGA 4XBLA 5IYYA 5JIAA 2DVBA 3VD7A 2A3YA 1H2NA 1RUH3 4QX0A 1MQTC 2OUJA 1HN1A 1UMHA 2FDFA 2O0OA 5FZAA 2DVFA 1J3QA 2UY8A 1PM4A 3ZN6A 3N35A 5JXGA 4LBQA 4YW7A 1OUSA 4EN0A 2QQMA 1CWPA 4IERA 3K51A 1D0HA 5F2SA 4M3CF 3MBWA 3LEGA 2DDUA 4GWIA 1MZ6A 1ZA7A 4AHXA 2XJTA 4W50A 4E4ZA 4XFAA 4S2FA 3WOGA 5LA0A 3VBRA 2JIJA 1US2A 1W9FA 2QQKA 2YPDA 5F6LB 1ZRIA 2EAKA 5DG2A 3LSEA 4DO0A 1S0IA 1UW8A 2LUWA 4LKEA 1F4HA 4AHYA 3N9PA 4AI2A 1EUUA 2NP0A 1WMXA 3A4UA 4XEZA 1HRI3 1BZWA 1W2AX 3FC0A 4META 1PIV1 2D97A 3AYCA 2DVGA 4OMCA 3OUIA 2VQ0A 4Q0PA 2HJIA 2SLIA 4JGZC 4JRLA 1C8NA 4HK9A 3IAPA 1WCUA 2UURA 3I2JA 4BJ0A 1OI6A 1AR62 4XIOA 1NE4A 3AP4A 1QJU3 5JR7B 4IGOA 5ABJA 5HCHA 1IKQA 3I59A 1UXZA 4BM8A 5A3LA 1UU6A 4XURA 3P5BA 2RJLA 4GAZA 5C6CA 1VBB3 5I8SA 3KF5A 3HN1A 5TSWA 1OUXA 2VG9A 4AGVA 2ZCWA 2D44A 2QQLA 4BB3A 3G6JB 1RMU2 3OPZA 3WLUA 2B45X 2R1BA 3ZXKA 4LOTA 4Q4X1 4BQ5A 4Y4RA 2CU5A 3Q8FA 4XFFA 4IEQA 5FZ9A 1GR3A 2P6CA 4TYSA 4WVVA 3O1UA 1A34A 1OHFA 3DL3A 2J1VA 2D40A 1AXYA 4XF4A 1QXJA 2GU9A 3QLQA 4B7KA 4E4SA 4LR4A 3N7MA 4Z1VA 1HW5A 4H7LA 4QX8A 4Q0VA 1AR83 3OPTA 2VMCA 3J8F2 3H8UA 1HB4A 1FI2A 4RS5C 5FJKA 5LW9A 3FN9A 1PO23 2HWB3 4GMP1 1FATA 3MDPA 1T6BX 1C8M2 4JKLA 4CP9A 5A3UA 3LKJA 2E7QA 4KGQA 4PBOA 4E4HA 4Q0QA 4PIYA 1NE6A 4LBKA 3ZSLA 3CU7A 2VQUA 3ON7A 3I3BA 5DUWA 2WZPP 3MIEA 4CDXB 2DURA 3NAPA 1HN0A 1X7NA 1RC6A 3JD73 4MO3M 2GAUA 2GH2A 1TME3 3ST7A 4DRVA 2TBVA 5J3UA 1XNAA 2WR9A 3DPRA 3HR9A 4JTNA 1WLCA 4UXAA 3S57A 5JOYA 3U4XA 3ZXAC 1RUNA 4G9SB 3DXUA 1ST8A 5C5TA 4LE4A 1YCIA 2BU9A 1ASJ3 5EWSA 2BVVA 3FLTA 2VECA 2ZEZA 1SCRA 3I2IA 3S5AA 5GKAC 2OW4A 2W0XA 4XUOA 1OH4A 4H7MA 2R072 3MF9A 1SLBA 4ATEA 1CZVA 1QDCA 2XJVA 3NNJA 3Q8EA 2W08A 4A2UA 5FZBA 1G9FA 2WA3A 1AR61 4NR1A 1DP0A 1GKBA 1UPSA 1US3A 1Y4WA 1ZX5A 1W6OA 1GFF2 3A0KA 3EQEA 2GP3A 3ACIA 3N7KA 2PN5A 2A71A 4XUPA 1WD3A 3W20A 4F7ZA 2WQZC 2BWCA 5JXIA 1ENQA 1H1AA 3PDQA 3KWVA 4BQ2A 2B5HA 3PIJA 4JZRA 2WRAA 5FZ1A 2AUYA 1RMU1 3DCQA 2WS91 1W0NA 2FCUA 3Q8AA 3V0AB 1VJ2A 2R49A 2RJ2A 2W39A 3MIBA 2FZ1A 2WT0A 4M4PA 1MZEA 5EYXA 1UL9A 1F15A 1AX2A 1UZWA 5JZGA 4CP9B 4Q8KA 3FUQA 2Y60A 3LZZA 3PTYA 4LUKA 2K2SA 3VHOA 1VBE1 1AR73 2NN8A 3WDTA 3J8F1 1KRIA 1JYWA 1RUG3 1OOPA 2YU2A 4Q4V2 5JSPA 2XLFA 2XKOA 2CWSA 4ZU4A 4MADA 5KXBA 4O7XA 5FZOA 1YJLA 1C8M1 1G6NA 2FMYA 2XB6C 3I7DA 3DPRB 5HCBA 2VZOA 2OQ6A 1YQ2A 3LPFA 2MEV3 1H1MA 2GC1A 1LU1A 2WO1A 4XZUG 3L2YA 5AVAA 1I5ZA 4HN0A 2VVFA 1OF4A 2X53S 2R6QA 4NRPA 4YG6A 4SLIA 5F3GA 1UYYA 5C3RA 1SEFA 4DUXA 4GD4A 1F35A 1VMFA 2DVDA 4QWNA 1RXGA 4CE8A 1MS0A 3WX5A 3LEKA 4UFMA 2LW8A 1OC1A 2VZSA 1DGWA 4Y3OA 1G9DA 1K42A 1JU3A 2VBBA 5BPXA 5A6QA 5KHIA 1H9PA 2VNOA 3EYPA 4S2GA 4I3PA 2VR4A 4E2QA 1HIXA 4ES9A 3NNFA 3PVEA 5LBBA 3R4DB 1XSRA 5IT6A 1IKPA 5F37A 1ZZBA 5FYYA 1W6OB 5JIUA 4I0WB 2KD7A 1AUYA 2BRTA 2XJUA 3AKSA 4P9YA 4AGGA 2WQ4A 1UOBA 1VMHA 2I74A 3RG0A 5L19A 2R071 4YFWA 1N3PA 2DU1A 2FDJA 2XVKA 5FREA 4B3NA 3E6CC 4TXWA 2BFUS 2Z5WA 1WWYA 1B09A 1EV12 3J7LA 4LBJA 1YO8A 4QAWA 5LK5A 3KT1A 3ZFEA 3JQWA 3JUUA 4AZZA 2QKDA 2JICA 1EUTA 4MOAA 3CZJA 5JZGB
chains in the Genus database with same CATH topology
4Y5Z0 4QD2A 3I54A 4B4PA 4Y1XA 1GZWA 3NKTA 3M2MA 3ROUA 1UU5A 1O5UA 4E9KA 1D0GA 3ZDSA 1OOPB 4AVSA 3E97A 4HK8A 4MXVA 5FLIA 4CDXC 3JB8A 2HKXA 3QOPA 1AX0A 2VW1A 2BW8A 2VMGA 4FXKB 4TSVA 1QJX3 3OD4A 1VBD2 2ARXA 4OULA 4Q4V1 5ACA2 4A7ZA 4XF1A 4B29A 2R063 1FXZA 1HX6A 3R6SA 2H0VA 4M3CB 5JOXA 4Q4W2 1OQ1A 1WMDA 1H2MA 4L11A 3AJZA 1VIWB 4CDUB 3RWNA 2EF6A 1VRH2 5JLVA 4IEXA 4OHXA 5CADA 1IPKA 1UMZA 3NKGA 2C5DA 1J58A 3NL1A 4MX3A 2XBO1 4LNVA 2BFUL 4Y1YA 5A32A 2F4PA 2ZTNA 2B9UA 2YMZA 4FTBA 4NOTA 3VKMA 1TE1B 5JMCA 2UWBA 1JOJA 4NO4A 4EJRA 4GB32 4FXGB 1H1IA 1EYBA 1MR5A 4MH0E 4FCAA 4GMP0 4OHYA 3V65A 4K1YA 1EAH2 2C9AA 1SDWA 1S1AA 1W6NA 2VXRA 4DXZA 1QJZA 3R05A 2A3WA 5T55A 1A8DA 2A6YA 2Q0AA 4I01A 1EV11 1Q43A 3RMXA 4P9XA 3WD5A 4QGLA 1AL0G 1OQEA 3QH7A 5CA6A 2V5YA 4QHBA 4I02A 3U10A 1XE7A 4XFHA 5CAZA 2E7TA 2ZGSA 1E57A 1XRUA 1QOTA 4XF9A 3SNMA 3DPRC 1RUF2 3AZXA 3VKOA 3FMGA 1ZRDA 2YHJA 2JE7A 3ZXFA 1BMV2 5DDJ2 4YVSA 4HVQA 3O14A 1H9WA 2A7AA 4AFAA 1LENA 5BYNA 1KQRA 4E2SA 2OA2A 5CFCB 1VBD1 5CFDA 2HWD3 4D94A 5ACA1 4LO6B 1NLSA 2RM23 4YARA 3OBRA 3SMHA 1HV0A 4Q4W1 2NZ9A 2VQAA 2JDZA 4EWEA 1NXD1 4XMIA 4AQ2A 1R092 1FMD2 4YSFA 4X6RB 2YZ4A 4TLFA 4WV8A 3KGLA 1N1VA 2WIIB 1S0EA 1LGNA 1VRH1 5C9AB 4MVTA 4ISQA 2H6CA 2XGXA 1VBA2 2BUKA 1V6IA 2QCSB 5CU1A 2WKKA 2ZGMA 4FAHA 4QQLA 2PHUA 4GXLA 2XVLA 5CB7A 3RYPA 2ZGPA 3CJXA 4O9EA 5FRAA 5JZGC 4I2OA 4DNYA 3ZSMA 3BIWE 1RUC3 4GB31 4M0HA 1GNHA 1K5MB 3AXDA 5H9QA 1MEC2 1OOPC 1GZCA 2GMMA 4FPKA 1X50A 1EAH1 3KM5A 2WFF2 3KT4A 2TNFA 1U5IA 2D5FA 1QOOA 2IC1A 3AYAA 2IXHA 4Q4Y3 1RUD3 2RS33 3VBUB 3ZXGA 2NPIA 1W6MA 1RUF1 3WDWA 1WA4A 5JOZA 3NV3A 1O3QA 5E88A 3M1HA 1LGCA 4CDUC 5CFDB 4QQ2A 4YZ2A 1N1SA 2XWBB 1CR7A 2ES3A 3B5LB 4G3YC 3MEPA 4KGGA 3S7IA 1CPMA 4GWMA 1BMV1 1BCXA 4J1WA 3GALA 5DDJ1 1V6KA 3POYA 3AKTA 4SBVA 4XTMA 1SLIA 2EXKA 5KBFA 4LO5B 1YIPA 3W9AA 3ZN5A 1CGPA 5DG1A 2UYAA 1SBDA 1X36A 5FFOC 3ZMOA 1R091 1FMD1 1SLLA 1FPN2 2UWCA 4GKXA 4C90A 4HETA 3U0ZA 4P9LA 4OI2A 3ZN4A 4WM8A 4A7KA 4BMBA 3H1WA 5T5JA 1FV3A 3H9AA 2GNTA 1KDMA 1NA1A 1VBA1 2ZKLA 4NWWA 3JU9A 4Y22B 5LRRA 1F31A 3ZXEA 4XMAA 1UF2C 2IXJA 1Q3EA 2LTNA 2ENRA 1HRV3 3VZLA 1WUVA 3I8TA 2X29A 1KFUL 4Q27A 1MEC1 2AENA 1ULDA 1FNYA 4V1PA 1O3SA 2VW0A 4CDWA 2PHRA 3LCPA 4JDMA 4LE3A 1MZFA 1ENRA 1VBC3 1DQ4A 2VH9A 3WCRA 3ELNA 3H7JA 1KFXL 3OY8A 3AFGA 1MS5A 4YW5A 2ZPXA 4N9IA 1ND2A 5CFCC 1A6CA 1ZBE2 1DGRA 2Z69A 1ZRFA 3PMSA 2NMOA 4MGKE 4ATFA 3CO2A 1U5ZA 3AZZA 5DZFA 1I1EA 1JUIA 4HKLA 4U2AA 1VR3A 2ZZJA 4P14A 3RJRA 4TZDA 1VB4A 5C9AC 1RUJ2 1NCQA 2ZGLA 1JTZX 1H0BA 3ILRA 4LLOA 4XETA 5HBAA 5FO9B 2GNBA 4QPIA 1GANA 5FLJA 3MICA 3BTAA 4QQHA 4WM8B 1JYCA 2JG8A 3SH4A 1WW6A 1KDKA 5H9PA 5J48A 1O5LA 1S0DA 1K5MC 2QNKA 1FPN1 3VHPA 2JG9A 2D6MA 2NMNA 4L8QA 4ZXKA 1HQWA 2PLV3 1UZZA 4IV1B 1RITA 3N7LA 3HWJA 1ULGA 1CQ9A 4RSUA 3WT3A 4YYOA 4LO4B 4IV3B 4XJWA 4CDWB 3VBUC 5I8TA 3KCXA 1C57A 4AVVA 3EO6A 4L97A 2YXSA 1ZZ7A 5I0TA 5JSOA 1AYM3 1DGLA 1YFUA 3OY8B 1COV3 5K7PA 4K1ZA 3BPZA 1O4ZA 3NVCA 4AEDA 2QDRA 1FNZA 2UWAA 3M3OA 1AL23 3AYEA 3V56A 3VGIA 2Y0OA 3CF6E 1AYN2 2GNMA 2I2SA 3M3CA 1G9CA 4FPJA 2RS53 1DGRN 3VBOA 4DZGA 1NCQB 1ZBE1 3OYWA 1QWRA 3LOIA 3MGUA 2PAKA 4OZXA 3WW2A 3L9JT 2UY9A 4QPIB 1KD7A 4D7SA 1B35B 2G4IA 3N3HA 5E16A 5BXXA 1RUJ1 3WQ7A 1SFNA 4KQ7A 3EHKA 4RR3A 3WXPA 4DB5A 2V73A 1JHNA 1YNAA 2XL7A 1W6QB 2W52A 3AYDA 5F9TA 3VKFC 4G4FA 1FV2A 3IPVA 4ASLA 1CAVA 2A3XA 4EN7B 2IFRA 2ZABA 4Z82A 4YZ3A 1S0JA 2Q30A 4GH4B 2D6OX 3T1MA 4UW3A 4MSVA 1DQ2A 3SCHA 3OJBA 5FAXA 4N7UA 3S6PA 2UU8A 1NLRA 1XYPA 1URXA 1XNBA 4N43C 2VUAA 3JB4C 4FOWA 1POV1 1CAWA 2AGSA 4K6BA 4RA0A 5CBLA 1OA4A 1YI7A 3GHMA 5J7MA 5LRSA 1LB2A 1YLLA 3UK9A 3VV1A 4LBQD 5SV5A 3WZ1A 2CGPA 1LOBA 2N7GA 4W6WA 2RHPA 3OYWB 2DCTA 1XQNA 4AI0A 2QE3A 1SCSA 5KXDA 3MFCA 1AYN1 1D4VB 3WW3A 5K9YA 2AR6A 4KH9A 2VULA 1LHOA 1RUE1 3H50A 3OGJA 4WM8C 3IBMA 3POSA 1JUHA 4RR3B 5AC92 4FPOB 4L92A 4I3GA 5FTTC 2EXJA 4I09A 1JH5A 1U5XA 1PK6B 4QXKA 1YJKA 1DZTA 3IPVB 3OGGA 1CAVB 4IV1C 4KU8A 4XHBA 2IXIA 3ZXDA 2A73B 1H2LA 3BB6A 1LOEA 4IV3C 4X8NA 2BPA2 1N1YA 4XIKA 4CDWC 3U07A 5KXEA 1UAIA 1BVVA 2QDNA 1AR63 1FX5A 1NZCA 1CVNA 2KM2A 4DMIA 5K0UA 4HSJA 1RUI2 4XXPA 4FOYA 2SBAA 5AFBA 2B39A 2BNOA 2GMPA 1H4GA 4AFDA 3KD4A 2WS92 2VOWA 1RMU3 4XTPA 5HCFA 3WP6A 1LHUA 1RHI2 5BNOA 3FHIB 3WW1A 1ZRCA 1LHWA 5DZEA 2D3PA 2E6VA 2CNAA 1OFNA 3TWIA 2ZGNA 3J26N 2RR12 1G9BA 3P3PA 1NCQC 3HMYA 3T1LA 3ZN6B 4LBQB 4Q1RA 5FOJB 4HLTA 2OZ6A 1QJY1 1VBE2 3CEWA 3ES4A 2ILMA 3NV2A 2YY1A 2WNVA 4WBBA 4QPIC 3J8F3 1B35C 5C33A 4IESA 2VOVA 4FPGA 3ZSEA 3DGTA 3INAA 1LECA 2BBVA 1DGWX 4KWLA 4YG3A 5LEKA 3NWKA 1C8M3 2VMIA 3VBRB 2XKPA 4D69A 3HD8B 1UIJA 1QH6A 5T50A 3IKWA 4JDOA 2ZGKA 3MIFA 1GQHA 3ZYJB 5LEJA 4AHZA 1PMIA 5GLWA 1ONAA 5AC91 3LSDA 4PDWA 4AF9A 3S7EA 4AW7A 1L3JA 2B7YA 3N7JA 4FOQA 1JYIA 2IXCA 3VBHA 1O4YA 2D6PA 4GH4C 4QQOA 4M01A 4QPGA 5ABJB 3I59B 2WNUA 2PAEA 2WA4A 2Q8OA 5T3NA 4DOUA 1ZRRA 5K8SA 3N36A 4FT8A 3USSA 4P9GA 4Q0UA 3IMNA 2R073 1SBFA 1AXKA 3LA3A 4HL0A 4OFGA 4AEJA 2DU0A 4U36A 2XL9A 3ECQA 4AI1A 2PQQA 1ZBA2 1ASJ2 2HWF2 2DUQA 1HRI1 1RUI1 3VUOA 4KU7A 1I6XA 2IXKA 1BEV2 2P17A 2I45A 2H6BA 2GN7A 2UYBA 1ULEA 2WNVB 1RHI1 2RE9A 1ZREA 4URTA 4AVCA 5CIRA 2WSUA 2R1DA 1O4TA 1F5JA 3JBG2 5A3MA 3MPPG 2B8MA 3D82A 3GHNA 2RR11 2JE9A 4LBNA 2BYVE 2DFCA 2JJ6A 1EY2A 2P3JA 2PELA 4RR3C 3FE5A 5B2GB 2EIGA 1IZ3A 2XVGA 4RGGA 2JD4A 5EYYA 2XLGA 1AXZA 4RQPA 4CP2A 1PK6C 3AMQA 3NAPB 2VY0A 2PHLA 5CG8A 2ZA9A 4DY5A 3WQ0A 1QY4A 3AP5A 1DZQA 1J3PA 4PDWB 2R0HA 3I4IA 5KXCA 2QJVA 3PJYA 3NJZA 4XF3A 4YZ4A 2LALA 5FBZA 1DG6A 1GNZA 2BTVC 1XU1A 4E4DX 1UKRA 3WINE 4QPGB 1H8TA 4YM2A 4BHPA 3RQ0A 2WNUB 2BQPA 4XQDA 2XBO2 2RJKA 4IETA 5IK8A 3WDUA 1GYKA 2JECA 1PZ7A 3DN7A 1G7YA 2MNGA 1VLNA 2A5ZA 5EV7A 4EWAA 1S2KA 2VOKA 4IEUA 3ETQA 4P9JA 1LHVA 4W65A 3WUCA 3VHRA 4K7JA 3SITA 1J1LA 3UJQA 3NSTA 5CNAA 3OD0A 1UKGA 3H1MA 5BNNA 4HSLA 4E2GA 1HLCA 4LBLA 1OPOA 5F6KA 4HN1A 2A6VA 1W0OA 1V6MA 2D3RA 3MI8A 1BJQA 1AJOA 2CAVA 2ZAHA 2E63A 1C5IA 2X5IA 3MW2A 1ZBA1 1ASJ1 1XU2A 2HWF1 3GZTB 4XF0A 1FYUA 3AMPA 1Q8QA 4CDQA 1M06G 4P9WA 1BEV1 4LBMA 3X29B 4OUSA 5J37A 4N53A 4JGYA 5E89A 3VBRC 1AR92 4O9GA 2VVEA 3ZXLA 1YWKA 5AVPA 3WY6A 3ZO0B 3JBG1 4XBQA 3D6EA 4FSJA 1OLRA 1YRZA 4HPKA 4CZSA 2YYOA 1ENXA 1IOAA 4I0AA 1M4WA 4PIXA 1UIKA 4PLMA 2VPVA 3AKQA 1VBD3 4XFBA 1KJLA 1H8TB 5ACA3 3MIHA 4YW3A 1CAXA 5ABJC 3WVJA 2XJSA 3WDVA 4Q4W3 1PGL2 1V9U2 4AGRA 4D7TA 5I8YA 4PF5A 3TN93 5FDBA 4Y1VA 1W0PA 2FQPA 4LTAA 1I3HA 1VALA 2BWAA 1NCRA 1RVF2 2ZGRA 2ET1A 4LA3A 1UX6A 4HT1T 4NHKA 3PVNA 3OF1A 5BNNB 4FVVA 1CN1A 3WHTA 4H55A 5JSRA 1Y9QA 3K48A 5JWPA 3R0RA 4CTEA 2YROA 2WNVC 4GB33 3ZFEB 2X5IB 1QNYA 4YRDA 1FAYA 5I91A 5L7OA 1XYOA 4P5HA 1MACA 1F9KA 1EAH3 1GZWB 3IM0A 4JGYB 5D1IA 4NPRA 3MF6A 4AG4A 5BY5A 5BUVA 3B7MA 2P3KA 2HEVF 3M70A 5F5QA 3E5QA 2VMHA 4Z92B 5HI0A 2OIIA 3M3EA 3NAPC 1QF3A 2A70A 2ZX0A 2Q4SA 1AZDA 3VKLA 3ASIA 4INDA 4PDWC 3GZUC 1AR91 1A78A 2Z79A 1RUF3 3E6BA 4P9YA 1O7FA 1LULA 3NV4A 4N9HA 2BNMA 4Q26A 4B8EA 2OZJA 4OUMA 2GN3A 4IEWA 4CEWA 1JN2P 4QPGC 4AHWA 2WNUC 2DFBA 4B7EA 2CL2A 4PJYA 5E1RA 1MS4A 2P37A 4HVRA 4LHLA 4FP3A 4X8PA 4AVAA 4FTEA 5DXDA 4F83A 3UKNA 1ZVFA 2XJRA 1NCRB 1IPJA 3BALA 4M00A 4EN8B 4NWVA 1PGSA 2R0FA 1QXRA 2XUMA 1ZZ6A 4IEVA 4OI0A 1PGL1 1V9U1 3ACLA 4B4QA 1ZM1A 2ZOEB 1R093 5JI7A 5A32B 1DQ5A 1R1ZA 2HWE2 5FLHA 2A75A 1RVF1 1S0CA 1OQDA 2HWD2 1IS4A 4PQ9A 1VBA3 1W2UA 3KGZA 1TMF2 1RJ8A 2ZKNA 2ZACA 1W6NB 2D6LX 4L9BA 4YW2A 3SH5A 4RGAA 4COUA 2XJQA 4FPYA 4AE2A 5SV8A 4Y4YA 3LA2A 4CEYA 5JCTA 4EV0A 4WM7A 4UW5A 2Z42A 1R1A3 1XNCA 5EXOA 5T5LA 1MEC3 2NM1A 1G8WA 3LOBA 4AFCA 2WFF3 3UKTA 3O0VA 4H3WA 4FPCA 3KS7A 3ZFFA 3AXEA 2ZX1A 3E5XA 3D8CA 4W6XA 1RUC2 3UL2A 3PJQA 4CEWB 1H8TC 1S2BA 1OKQA 4BE3A 4YVSB 1SLTA 3QACA 3H3UA 5IUQA 5LK7B 3B94A 3AJYA 1YFYA 3VZKA 4PLNA 1FOD2 1HV1A 3HT2A 3FFQA 3IT8A 4BMEA 2RS12 1UN1A 3ZYPA 2YPJA 4C0BA 3C2UA 2WNEA 3LA7A 3M4FA 4M3CE 4YGBA 5BNNC 1A8MA 4XFCA 3RSJA 4EWDA 3SHRA 3B93A 3ES1A 5BNPA 3T2TA 2C1FA 5JVVA 4AK3A 4JVAA 4XJ8A 3I2DA 4A3XA 4BCUA 3ZFEC 2X5IC 1HXS2 3KLSA 1SBEA 1U12A 2PHWA 2HWE1 1FPN3 4UBGA 1Z7S2 2JXAA 4K3UA 5FQ0A 5I0RA 4PBPA 2HWD1 1HKDA 4XJ9A 2DWRA 2RM21 3M8LA 4OLLA 4WM7B 3ZPYA 2NLRA 1QQP3 1TMF1 1WLDA 1V70A 3LWCA 4UW6A 4XZPA 3ZFFB 1PZ9A 4AFBA 1V00A 3AP6A 4MGIE 1RL3A 5J09A 4YW4A 1BBT2 3E5UA 3O12A 5CVRA 2O1QA 5T52A 1W6MB 1BKZA 4HKWA 4BLJA 2JEMA 1CJDA 1GICA 3UV9A 5C8WA 3LAGA 3RI9A 2I07B 1LTEA 1EPWA 1RUC1 5KC6A 3HAGA 1WBLA 5IK7A 4ONUA 2R16A 4N7IA 2QZ3A 1DIWA 5IK4A 1NCRC 3B02A 3B9IA 5GJ6A 2E51A 4M0NA 2HWC2 1PNFA 3JCIA 3BCWA 4R9AA 1FOD1 2DVAA 3FLPA 4FPFA 1WCSA 2WWSA 3VBSA 1RUD1 1RUJ3 2RS31 4YLZA 1X8MA 2GALA 5T5OA 2RS11 5GZFA 4GA9A 1DDLA 5HXVA 4IQPA 4LHNA 2R042 3KZ4C 1UU4A 5GZEA 4E27A 1NA1B 1QKQA 3EBRA 3NV1A 2DYCA 1APNA 1J59A 1HXS1 5A33A 3UKVA 2GC0A 1Z7S1 3ENRA 3URFA 2GC3A 1CJPA 1LOFA 2GNDA 3KB5A 3M3QA 1BXHA 4RHV2 4XBNA 2VUJA 4FQZA 3RNSA 3TBDA 1NXMA 2YDEA 2PHFA 4RS5A 3V0BA 4AEMA 4CEWC 1V6NA 4XJAA 5FO7B 1D4M3 2FHRA 4MUVA 3TNPB 4DPNA 4Y20A 1JBCA 2EAAA 4YVSC 4CRQA 1LKNA 5JI9A 1QH7A 1MS9A 1ND2B 5CFDC 4XFGA 4Q1PA 1BBT1 4ZU5A 3WNXA 2WZR2 1PO12 1NQJA 5GZGA 4UBHA 4H14A 3JZVA 1ZZ9A 2D6KA 3WV6A 4CP0A 1O91A 1RUE2 4LULA 3EXUA 5IK5A 4FPLA 3VBSB 4KL1A 3MLJA 4HFSA 1QU0A 4R4XA 4PIZA 5GLUA 2HWC1 3ME2A 5JPNB 2WT1A 3TYJA 2JG8B 3WG3A 1OA3A 1BK1A 5J98B 1YI9A 1WBFA 2RS52 1AJKA 4K40A 1PIV3 2DCKA 5BNQA 4WM7C 1NOVA 3P3NA 2R041 2JG9B 1ULFA 1JW6A 2WLPA 4EN9B 4XHXA 2WSVA 2JKBA 3Q9OA 4HKOA 5EFUA 3SCFA 3KCCA 1GLHA 4JAAA 4LA2A 2ZGOA 3ZFFC 3H1YA 4S2DA 1VB2A 4XFIA 3V0BB 4YM3A 4BWOA 5JDBA 1DHKB 4IEYA 4QGNA 3C3VA 4QU2A 2ATFA 1VAMA 1Q8SA 4Z2WA 4RHV1 3TRSB 4Q4X3 2ZX4A 1OPMA 2BGCA 2A6WA 1QOSA 4AEDB 3RYRA 1R082 4BA6A 1C28A 4ITCA 3VDDA 1I9RA 3IDBB 5J36A 3MIGA 1QJY2 1V6OA 1WMEA 2YUEA 1RIRA 1RJ7A 3EJKA 4JDNA 3VBOB 5HCAA 4OI4A 2E7AA 3L2HA 4GMP3 2WZR1 1PO11 4WVWA 1Z78A 2VW2A 4BOWA 3VL8A 3WG1A 4NHMA 2RMU2 2GZWA 3HT1A 2XLAA 3ZFGA 1QNWA 1PVC2 4Z8BA 2ZAAA 4LO7A 4XE9A 3S0MA 4BYYA 5JPMB 1ZNPA 2EXIA 1NA1C 4JTOA 1OFSA 4R9BA 3OCPA 1RUH2 5AC93 1EP0A 1AL21 4OVEA 1OLQA 2DTYA 3HIFA 3SH3A 4HBNA 2XJPA 2RS51 3QBQA 3RS6A 5FPZA 1H30A 5GALA 3MZHA 1CD3G 1SFYA 4DY3A 3BODA 4KWKA 2IFWA 1ZYBA 3GZAA 3QD6A 1C1LA 1MZ5A 4JV4A 1HRI2 4CDXA 3BU7A 1ND2C 3SISA 3VZNA 1RUI3 3WR0A 2VVDA 1CESA 4HZFA 3VDDB 4FTSA 1CAWB 3HQXA 2VNRA 1PM7A 2WS93 4I0BA 3B00A 4Y26A 4FP2A 1RHI3 1QJU2 1Y43B 2JENA 1R081 4FOVA 1DF0A 1C5HA 4FPEA 3VBSC 5GLVA 2RR13 1VBB2 5C4WA 4OI1A 3W58A 5KHJA 4ZKTB 3TOJA 4NHLA 3M7AA 1G86A 3ZFGB 1VBE3 3BOWA