4CDQC

Crystal structure of human enterovirus 71 in complex with the uncoating inhibitor gpp2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title More-Powerful Virus Inhibitors from Structure-Based Analysis of Hev71 Capsid-Binding Molecules
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
total genus 41
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cdqC00
1QQP1 1MQTB 1PO11 1RUI2 1ZBA3 1RUC3 3ZFGB 1VB2A 4IV1B 1ZBA1 2PLV2 5CFDB 2RM22 1RUC1 1VAKA 1FMD2 1GFF2 3VDDA 4RR3B 3VBOB 4CDXB 2RS32 1H8TA 4Q4Y3 3ZFGC 1R1A3 1PO22 1F2NA 1M06G 4GMP0 1F8VA 1NY72 5CFDC 1RB8G 1BEV3 4Q4Y1 1R1A1 4CDQB 3HAGA 1RHI3 4RR3C 3VBOC 1BEV1 1BMV1 4JGYA 5K0UB 4CDWB 2WS92 1EV12 5L7OA 3TN93 4CDQC 4Q4W2 2WLPA 3TN91 1R093 5AC92 3CJIA 3VBHB 5C4WC 3LOBA 1SMVA 5K0UC 1R091 4CEYC 1QJU2 5ACA2 1VBA2 5DDJ1 3VBSC 4RS5A 3JBG2 3VBFB 1HXS3 4LLFA 2BUKA 4YVSB 1V9U3 1DDLA 1HXS1 3DPRB 1AR93 3VBUC 5C9AC 1V9U1 5J96B 1NA1C 1AR91 1COV2 4Y4YA 1VBE2 1HRI2 5D8AC 3JD73 2WFF3 4YVSC 1RUJ3 4Z92B 1RUD3 1OOPA 2HWF2 3JD71 1AR73 3DPRC 2WFF1 5BNNB 4FTSA 3NAPB 1Z7S2 1RUD1 4RQPB 3IDEA 2ZTNA 1RUH2 1HQNA 1ZBE2 2RS12 4QPIA 4WM7A 1AR71 2RMU2 4CEWC 1AYM1 2RS52 1QJX3 2ZAHA 4IV3B 5C8CA 1NOVA 1RVF2 1RMU3 1QJU1 1AYN3 1RUE3 1PIV3 4RHV3 4RQPC 1AYN1 5ABJB 1RUE1 4YVWA 2HWD3 1NCRA 1PIV1 4N43B 1FOD3 2HWD1 1ZBA2 4IV3C 1NCQB 3ZFEA 1RUC2 1FOD1 2IZWA 1OPOA 1ND2C 2RR11 2XPJA 1TME1 1K5MB 2WZR3 1C8M3 1E57A 4CDUB 1D4M3 2WZR1 4WM8A 3M8LA 1NCQC 1D4M1 4Q4Y2 4GH4A 1R1A2 1CJDA 2R063 1BEV2 2HWB3 2R061 1BMV2 4CDUC 2HWB1 4JGZA 2XBO3 4N53B 1H8TC 1PGW1 1AL0G 4PDWA 2XBO1 2BFUS 3TN92 5BNPA 1X33A 2WWSA 1R092 4N53C 5DDJ2 4FTEA 1VBD3 1HXS2 1HX6A 1V9U2 1BBT3 4RS5B 1VBD1 1AR92 1X36A 1BBT1 3CJIC 4Q4V3 1RHI1 5C4WB 3J8F3 4CEYB 3JD72 2MEV3 2WFF2 3J8F1 1RUJ2 1RUD2 4RS5C 3VBSB 1AR72 1TMF3 5A33B 1AYM2 2QQPA 2VQ0A 1TMF1 3VBUB 5C9AB 4SBVA 4QPIB 1MQTA 1QJX2 1NA1B 4GB33 1RMU2 5D8AB 1AYN2 1RUE2 2BPA2 4IV1A 4GB31 1W39A 1MEC3 1PIV2 4RHV2 3JB8A 5CFDA 3ZFFA 1VB4A 2HWD2 1QJZA 1MEC1 4WM7C 4QPIC 1RUF3 5CFCA 1FOD2 4FSJA 3VBOA 4CDXA 4CEWB 1POV0 2RR12 1RUF1 1TME2 5A32B 1AR83 5C8CC 1AR63 1ND3A 1AR81 2WZR2 1FPN3 1RUJ1 4CDQA 3JB4C 4GMP3 4YVWC 1D4M2 1AR61 1NCRC 1FPN1 4GMP1 1CD3G 4Y5Z0 3ZFEC 5K0UA 2R062 3VBRA 5JZGB 4CDWA 1QJX1 1QJY3 2HWB2 1ND2B 1RMU1 2FZ2A 1PGW2 1QJY1 4QPGB 4RHV1 2XBO2 4WM8C 3VBHA 2GH8A 1VBC3 4GH4C 5JZGC 2R043 1PGL1 4NWVA 1B35A 2HWC3 1R083 1VBC1 5ACA3 1VBA3 2R041 3VBFA 4QPGC 4YVSA 2HWC1 1R081 3VDDB 4JGZC 1C8M1 1AUYA 5BNOA 1H8TB 3ZXAC 4PDWC 1VBD2 5BNPC 1BBT2 5FMOL 1NG0A 1RHI2 1AL23 3VDDC 1A6CA 2X5IA 5BNNA 3NAPA 1AL21 4RQPA 3J8F2 4JGYB 2FZ1A 2MEV2 5L7OB 1TMF2 2BBVA 1IHMA 1HRV3 1QQP3 5ABJA 1PO13 5FOJB 3CJIB 4JGYC 1HRV1 4N43A 1OHFA 4GB32 1EAH3 2HWE3 1NCQA 5L7OC 1VRH3 1EAH1 1MEC2 4AEDA 2HWE1 4Q4X3 4NWWA 1PVC3 1VRH1 1K5MA 2R073 3ZFFB 1RUF2 4Q4X1 4CDUA 1ASJ3 1PVC1 1MQTC 5CFCB 2R071 4Q4V1 1ASJ1 1AR82 1WCDJ 1RUG3 1AR62 4IV1C 1OOPB 2MEV1 1FPN2 1RUG1 1ND3B 3ZFFC 4EJRA 1VBB3 5CFCC 4WM7B 1VBB1 4CDXC 2GSYA 4N53A 1RUI3 5C8CB 1QJY2 3VBRB 3ZFGA 5FMOS 1OOPC 1RUI1 1ND3C 4RFT0 5LK7B 2PLV3 2RM23 4YVWB 1NCRB 1PGL2 1FMD3 4RR3A 2PLV1 1VBC2 2RM21 2R042 1FMD1 5DDJ3 5J98B 2RS33 3ZFEB 3VBRC 4CDWC 2HWC2 1R082 1B35B 2RS31 1PO23 1C8NA 1C8M2 4BCUA 1PO21 3S6PA 1NY71 3VBHC 4WM8B 5C4WA 5BNOB 4CEYA 4GH4B 1B35C 2WS93 1AL22 3VBSA 3VBFC 1EV13 2BFUL 4Q4W3 2WS91 5A33A 1EV11 3FBMA 2X5IB 1AYM3 4JGZB 3VBUA 5C9AA 4Q4W1 5BNOC 5AC93 1NA1A 4PDWB 1QJU3 5AC91 5D8AA 5BNPB 3JBG3 1HRV2 1QQP2 5ACA1 2X5IC 1PO12 1VBA1 5BNNC 2DF7A 3DPRA 3NAPC 4FTBA 3JBG1 2ZZQA 1EAH2 4CEWA 2Y26A 2HWE2 1COV3 1VRH2 5A32A 1VBE3 1HRI3 1POV3 2RR13 4Q4X2 1TME3 1PVC2 1COV1 1VBE1 1HRI1 4AEDB 2R072 1POV1 2HWF3 4Q4V2 1ASJ2 5ABJC 1Z7S3 5GKAC 2HWF1 1RUH3 1ZBE3 2RS13 4N43C 2RMU3 2TBVA 1RUG2 1Z7S1 2RS53 4IV3A 1RUH1 1ZBE1 2RS11 5JZGA 2RMU1 1RVF3 4AEDC 2RS51 1ND2A 1VBB2 1K5MC 1RVF1 4QPGA
chains in the Genus database with same CATH superfamily
4YW1A 4XIOA 2BGCA 1MQTB 1GWKA 1RUI2 3BPSA 1EY2A 1JODA 3OPZA 5J3UA 5FPVA 4FXKB 1DGRN 2ZGSA 4LOTA 1LHNA 3W21A 1KEXA 1SEFA 3WP4A 1RUC3 2PQSA 2R1BA 1S0FA 1RUC1 3ITQA 4FFGA 2LALA 4FPCA 3LF7A 4LBKA 3V65A 4BQ4A 1OQDA 3IN9A 4QDSA 4J25A 4FFHA 4UF0A 1UZ0A 5FPZA 3PJQA 3VBOB 3RZZA 4CDXB 4H3WA 1OKQA 2VU9A 4CU7A 2JDYA 3RYKA 4FPEA 5EWSA 2OKXA 3SCGA 1VAMA 2BOIA 3RMYA 2IVIB 4Q4Y3 3WDXA 1JUIA 4JTOA 3RGBA 3RWNA 2V4AA 5IYYA 4UFJA 4N7UA 1VJ2A 2ET1A 1NE6A 4Q4Y1 3OG2A 5FY9A 3HNMA 3VBOC 1BK0A 1NKGA 2V73A 1OD3A 4S2HA 2YB7A 2ZEWA 5AVAA 2CU5A 4TXWA 3CMGA 3RJRA 2J1SA 2WNVA 1LOFC 1UZYA 1K42A 1RXGA 3ACGA 1H9WA 4X6RB 5L7OA 1VR3A 2YGLA 3O0VA 1G9AA 3MIBA 5CKQA 2KXLA 2V72A 2RDNA 2WLPA 4YZ3A 1OVSA 2XLAA 2VNOA 2XXZA 1GNZA 4HZFA 5J36A 1QXJA 1W8FA 2AGSA 4N9IA 5LBEA 5GZFA 2A70A 1QJU2 5FK8A 1W2AX 2WC2A 1GP5A 2DCKA 4OI2A 3GCWA 3VBSC 1DYOA 4ZU4A 3MO4A 4YSFA 2A75A 4LLFA 2WZPP 5A1LA 2BUKA 5BY5A 1V9U3 2OQ6A 1LODA 2XH6A 4BK4A 2QQMA 2OUJA 1WW6A 5C9AC 1V9U1 4FQ4A 4A41A 4ASLA 4LHLA 3LOIA 5FZ1A 2OYZA 1COV2 4RN5A 4Y4YA 2Q8EA 1HRI2 1Q5OA 2QUOA 4J6GA 5J09A 4XFFA 4XE9A 4FFIA 2XJQA 3UETA 1CAWB 2WFF3 2JG9A 4Z92B 1VALA 4XQWA 3THPA 4ES9A 2V09A 4META 3IZOA 3J26N 2WFF1 5H9SA 1Z7S2 5FZ4A 4RQPB 2HYXA 2ZTNA 1ENSA 4WM7A 4XW3A 4L9BA 2XQXA 4C1WA 4LA2A 2RMU2 3T1LA 4CEWC 1AJKA 1WA6X 2VOKA 1AYM1 2RS52 4LULA 1QJX3 5FP4A 3WR0A 1MS0A 2WT0A 1NOVA 3VZLA 1UIJA 3OGGA 4Q8LA 4Y22A 5LY1A 3Q9OA 1STMA 4HKWA 4E4HA 4RHV3 4RQPC 2O1QA 5FXWA 5ABJB 3WSOA 1YJKA 4QXHA 2HWD3 2WNEA 1RL3A 2VTXA 4R4ZA 2D6OX 3OYWB 2PHXA 1UY2A 1QGLA 2HWD1 4JV4A 4AW7A 2AEZA 3ZFEA 2WYSA 5SV5A 3BVCA 5APAA 3I59B 3S0MA 3EQEA 1OPOA 4E27A 2WN2A 4BWOA 4EQVA 5FCCA 4XCBA 1LOAA 4YG3A 2V5YA 5FXVA 1ZA7A 3N7LA 2FDFA 5DUUA 2W1WA 1UCXA 4WV8A 5BXXA 3OEBA 1LOCA 5F7UA 1O4TA 2JDUA 3CHXA 3K4ZA 4GH4A 1R1A2 2JE7A 3UT0A 1WLWA 4KG8A 4M3CA 2VMCA 2QQKA 1XU1A 1BEV2 4RFRB 4CCEA 2NP0A 2KA3A 1REEA 5EJ1B 4QKNA 2P3YA 1PZ7A 2RVAA 4XF1A 2H6BA 1YQ5A 5T54A 3B02A 2XBO3 1RC6A 4XDPA 1BVP1 1OF4A 2ID4A 4U36A 4YM0A 1LHUA 4PDWA 4A3ZA 2XBO1 2BWAA 3TN92 2WSVA 4CPBD 3U14A 5BNPA 1L7LA 5CBLA 1JOPA 1K3IA 4IW3A 5IFTA 4XF0A 2G19A 3RZJA 4TWTA 1DF0A 4AVAA 5DZEA 3MHZA 2YBSA 1V0AA 2BW8A 5IVEA 2C26A 4A2UA 2I2SA 3R4DB 3THCA 1QDOA 3RZKA 3ZYGA 2VE1A 3B3QE 3O12A 1KJRA 2H0BA 4M00A 1CZTA 2ARXA 4NE9A 2WDBA 4FAHA 3JQWA 1BBT3 3ON7A 1AR92 5FZOA 1ODMA 4W6XA 1BBT1 5EHDA 1RHI1 3HD8B 5FZAA 5C4WB 5IVBA 2Y6JA 1W0OA 4QGNA 1W8WA 4J1XA 5K9YA 2BZDA 3M3OA 5IK8A 1URXA 3VL8A 3JD72 2AEYA 3LEKA 3PUHA 1GOHA 2G4IA 3IAPA 2XJRA 2IXHA 1RUJ2 3KHBA 4BQXA 3WP3A 4INDA 4V2WA 1OC1A 4LBQD 1AR72 2HEVF 1TMF3 3ORJA 1PM4A 1C5HA 3ALQA 4GWMA 4DIQA 2DDUA 4FPGA 2VQ0A 4LHNA 2VPVA 1WBFA 2XVLA 1TMF1 4RYDA 2EXHA 3WHUA 3T08A 4EWAA 1MQTA 4XYXA 3A4UA 1JH5A 1NA1B 2WR9A 3AMNA 4K1ZA 1ZVFA 2XDVA 1O3TA 1K12A 4DXZA 3I2IA 4QXKA 2PAKA 1AYN2 2ARCA 5EP9A 2FCVA 4ASMB 2BTVC 1F4AA 1PIV2 3INAA 4S2DA 3JB8A 4Q5OA 3J4UH 3EXUA 3JCIA 1YJLA 3MDPA 3T2TA 1WCUA 2XHNA 1KDMA 2JDNA 2C9KA 4Q1RA 5CFCA 1FOD2 4ITCA 3S5QA 1RINA 1SLCA 3VBOA 4CDXA 4QX0A 1U5YA 4UXAA 5F6KA 2RR12 4Q8KA 4KWKA 1TME2 1AR83 4FOQA 4IL7A 3VLBB 1O8SA 5A3MA 3C7HA 1O3SA 5IJRA 4IDZA 4QPWA 2B7YA 1AR81 1W9SA 2BEOA 5FMBA 4FOVA 4AK3A 3JB4C 1Y3TA 1BQPA 4GMP3 4YVWC 1D4M2 1YQ2A 1LOBA 1YC61 4WVVA 3POBA 2WKKA 1W2TA 4OQ9A 2W9XA 1CAXA 4GMP1 3SITA 3WHTA 4AHYA 3CIHA 2WT2A 1UXXX 1OLME 2R062 1A78A 5DAQA 3C3VA 3CLPA 5BPXA 1SG3A 1QDCA 2K9ZA 3AMHA 5GZCA 1W8NA 1B09A 1RMU1 4CP9B 1RGSA 1PGW2 2PHUA 3ZXEA 5JSRA 4Y20B 1QMJA 1SLTA 1RJ7A 2ZACA 5IWFA 3B94A 3K3NA 3E6CC 5FV3A 1ZM1A 4HVRA 2WQ8A 4XJ9A 3WY6A 1ULEA 1UPIA 5EZWA 3TNQA 5LRSA 4PI2A 3RZHA 1MS5A 1MPXA 1T6BX 2R043 5FJKA 2WT1A 4AI0A 1PGL1 1V6OA 4FPKA 1XE7A 5EYYA 1JI6A 4K20A 1WLDA 1GNHA 2VVDA 2ZX0A 2R041 1Q56A 1S0DA 2XG3A 1Y4WA 4QGMA 1CZVA 4XFCA 5FZKA 3VDAA 4QX8A 1SLIA 4FPJA 4K3UA 1S2BA 3EMRA 4EN0A 4JGZC 3MW4A 5FYMA 5KWRA 1EPWA 2A6XA 2RE9A 3TAYA 4XF3A 2Y64A 1UOBA 3J9SA 5SV8A 1UMHA 5DG2A 2VULA 1XNCA 4XFHA 4WVWA 3C7OA 5FMOL 1CAWA 1IPSA 1MR5A 1NG0A 3G7DA 2BJSA 4FT8A 3W5NA 3CBNA 5FTTC 3I2OA 4UFKA 4LIUA 2GNBA 2UWCA 4E8DA 1NZCA 2ATFA 1A6CA 3FZ3A 1SPPB 2MPFA 5FMCA 1OMIA 4RQPA 2ZPXA 4ZKTB 1IS4A 5FPXA 1WA4A 2E33A 2BV4A 1CIYA 2DTYA 3B9IA 1NXMA 4YGDA 5IAXA 4M3CE 1UX6A 2CWMA 3WNPA 3U37A 2BBVA 1IS6A 2AZ5A 1GZTA 1W8ZA 4A7ZA 5J1XA 5DQ0A 4IEOA 2W3JA 1PO13 2XWJB 5ABJA 5FOJB 3DEMA 2DFBA 3AJYA 3CJIB 1FNYA 4PLOA 3OSDA 4UAPA 3OYWA 1OHFA 1DYPA 1EAH3 2ENRA 2P17A 3ELNA 2E31A 2TUNA 2JENA 3S30A 3I59A 3AX4A 1JYWA 1EAH1 4E8CA 1SBDA 4AEDA 3AP7A 4QGLA 4NWWA 4XUPA 4JHZA 3SQOA 4AOCA 4AWDA 5FO8B 5GLVA 4JX0A 2UWAA 1CX4A 1OXCA 3CJXA 5ANQA 3ZFFB 1E5SA 5FY4A 5B4NA 4KQ7A 4JC1A 4CXYA 3HBKA 5FYZA 4GZ9A 2P4EA 4Y1UA 5HCAA 4Q4V1 1CX1A 4QXBA 4U2AA 2YC0A 2YMZA 1RUG3 2VCAA 4FPHA 3PURA 3VV1A 5I0DA 2GC1A 4LMFA 2JJ6A 2MEV1 5K4LA 1RUG1 2DTWA 4NRQA 3WQ1A 1VBB3 5DUXA 1IQDC 1W8TA 2RDRA 4LTAA 3SH4A 3ZFFC 5C3PA 3RWKX 4KI5M 2ZKNA 2XQRA 5A6XA 2RDQA 1VBB1 1XB9A 2LTNA 1FT9A 2B45X 3I7DA 4CVUA 4IGOA 5K8SA 2YUEA 3IMNA 4I0BA 4LUKA 3ZPYA 1S0JA 1QF3A 5DUWA 4AE2A 4C8DA 4I30A 3VD5A 1S0BA 2WLQA 3BTZA 3WDYA 3MBWA 4BISA 1FMD3 5EFUA 3GJBA 3MW3A 4PIXA 3ZSJA 1VBC2 3LQCA 1HV1A 2GNTA 1RYYA 1FMD1 2OX0A 3KQRA 1K45A 2E7QA 3AKSA 4B7KA 2HWC2 3MFCA 5FQ0B 2P3JA 4BHPA 4NAOA 5TSWA 5ISLA 4YARA 1B35B 1WKYA 1C8NA 3SMHA 1BK1A 1S0GA 2IFRA 4F3JA 3D5OA 2JG8B 4N90A 3SHRA 2BRTA 2VNVA 2PELA 2VNGA 3LD8A 5ANNA 5FZ6A 3S6PA 2R32A 4WM8B 5C4WA 5DAWA 4QX7A 2C5DA 5FUIA 3WDTA 5H9PA 4AI3A 5KHIA 1UY3A 1I3HA 1DYKA 1ZZ8A 2OA2A 4MZUA 2VOVA 5FP3A 4COYA 2JB8A 2ZABA 3SNMA 3O1RA 2DU0A 1B35C 4Z2WA 1U12A 2WO2A 1G9FA 5JOYA 2AC1A 4FPLA 4DXRA 5LBCA 1EV13 1TVGA 2BFUL 3AKRA 4MGYE 2BNNA 5JPMB 1ZZ6A 5KHJA 3OPWA 5FY8A 1I5ZA 1EV11 2QQLA 4K40A 1OLRA 1PMJX 2W0XA 1UU6A 1Q8OA 2IFWA 5FKBA 3NVCA 4LE3A 4D7TA 4NRMA 1GANA 1NA1A 3NL1A 2FMYA 1IZ3A 2X29A 3LCPA 1MZ5A 3P3PA 4JTNA 4DY5A 5IVVA 5JXIA 1QJFA 3WLUA 1UNBA 1V00A 3ZXKA 4QB1A 4FI9A 3VKFC 4IGQA 1VBA1 5BNNC 3DPRA 3NAPC 1ENXA 2W1UA 1S2EA 3ES1A 1W6NB 4HLTA 4MOAA 4URAA 3LSEA 2Y26A 2HWE2 2D6NA 4HKLA 4L11A 2D5FA 4AI9A 2VOXA 1F5JA 1W2NA 3NQHA 5F32A 5GALA 4IXLA 3MICA 2RR13 2K46A 4YNIA 1TME3 2DCTA 2PHDA 4LK7A 3J7LA 4QT6A 3C7EA 3U4XA 1MZEA 2R072 4KU7A 3CU7A 3VD7A 4X8NA 3NNFA 1OI6A 3ZKYA 4AQSA 1U5ZA 4HPKB 1HN1A 1A8DA 1LGCA 2EIDA 3HJRA 2W39A 1RUH3 2TNFA 3QH7A 1N3PA 1RIRA 1ZX5A 4NIGA 1AXYA 1RUH1 4OI4A 2P1BA 2EVXA 4KU8A 3ZSLA 1YO8A 4RL7A 2VH9A 1UD1A 2IXCA 3I2GA 5FP8A 4CP9A 5FREA 3KV9A 3FL7A 4LORA 4MH0E 4Y20A 3ROUA 5DZFA 5IHRA 4PBOA 1QQP1 4QWNA 4F83A 3GZAA 3MPBA 3P5BA 4LHSA 3LPGA 4LITA 1ZZ9A 4AYUA 2NMNA 1NT0A 2XWBB 4AVCA 3H0OA 1TG7A 1VMHA 3LSDA 4IV1B 2Q4SA 2VMEA 2YG0A 2VMDA 2PLV2 4OYUA 5CFDB 3U07A 1XQNA 4CCMA 4YG6A 3A0KA 4I3PA 1VAKA 4CUAA 4ZZ8A 4I3GA 1WWYA 3I3DA 4RR3B 2CGOA 3SC7X 3AXEA 4LKFA 2EXJA 4LBMA 4AG4A 3IDCB 4JHTA 3WEZA 4COVA 2WAAA 3FLRA 1PMIA 1QEXA 4OMCA 3D82A 4CTEA 4DXSA 4LO6B 1PK6C 5CFDC 1SCRA 4IEZA 1RB8G 1W3XA 4BJ0A 3VZJA 3PUAA 3ZX7A 3KZ4C 4XAAA 4CDQB 1XE8A 1VAVA 3HAGA 2WWJA 5EXOA 3T0AA 4RR3C 1SPPA 5A7QA 1OLQA 4J1WA 5A6ZA 2Y0IA 2XUMA 4H55A 5KXEA 3IBMA 4NIHA 3WUCA 3GNEA 3GCXA 4ZS3A 2YC4A 5K0UB 4CDWB 3WD5A 2WS92 5K7PA 1APNA 4L92A 4BQ3A 5JXJA 1W6QB 1YCIA 4DQAA 1O5UA 4CDQC 4Q4W2 3S57A 2CSGA 4P9YA 2R6QA 3ZMNA 1GQHA 1R093 2JDPA 5HXVA 4NIIA 1VE0A 3CJIA 1GQGA 5AC92 4XABA 1HB4A 1O3RA 3VL9A 1UN1A 4YW5A 5K0UC 1R091 3K46A 4CEYC 4CCDA 2VJXA 3T2OA 3ZYBA 2D98A 1XSRA 3PDQA 2FBEA 5T52A 3E5XA 3H3ZA 1NLQA 1DQ4A 1YIPA 1HXS3 4MXVA 2XKOA 3LAGA 1GP4A 3DYOA 3FHQA 3SXWA 3WF1A 4IEWA 1HB1A 4JRAA 2CL2A 2WNUB 1YQ6A 3GALA 4ARYA 1HXS1 4EN8B 1UYPA 5I8TA 1AJOA 5FOBB 5IATA 1WCQA 1UF2C 4XZPA 2BNOA 3GBFA 4X8PA 4AQ6A 4FOYA 2ZGKA 3MLLA 5D8AC 5A3TA 2ZCWA 3AZYA 4LBNA 1YIFA 2VMHA 3T1MA 1UOGA 3O1MA 3LDKA 1GBGA 1PX4A 5KBFA 1RUD3 3WF3A 2HWF2 4W50A 2R7EB 5FIXA 2WNUC 4LQRA 4BXFA 2JD9A 1XU2A 4R9AA 4C90A 4FTSA 1RUD1 1ZBE2 4BIOA 1HQNA 3K51A 3W59A 4ORFA 4G4FA 4NR1A 1AXZA 5E88A 3DECA 4A7KA 5CU1A 4YPJA 3VKOA 1MVQA 3LPFA 5GZGA 1RVF2 3HQXA 1A3KA 4EROA 2ZX2A 4B29A 5KC5A 4WZFA 1Z78A 1W6OB 1XRUA 1GUIA 1GZWB 2WBKA 4P9XA 4UOJA 3DV8A 3CO2A 1X8MA 4MXWB 3POFA 2W1SA 1TZOA 2VUJA 4JDNA 1LB2A 3NJYA 4N43B 4YM3A 1G9DA 3UGFA 1ZBA2 1CONA 1Q8SA 3CF6E 4CCKA 3BI3A 3UKTA 5IVYA 4YLZA 3PIGA 1J83A 1H0BA 3RI8A 3M70A 3T4HB 2IZWA 4KBZA 5ERLA 3FLPA 1ND2C 4ZZ5A 3MIGA 3ILRA 3OGJA 4OVEA 2WZR3 3I2HA 3M4FA 3PVOA 2OPWA 3CDZB 3ZXLA 2JG8A 2RHPA 4UFLA 4CDUB 2WYFA 1BLZA 2WZR1 4WM8A 3MLKA 1J59A 4P9LA 5JIAA 4Y33A 2G9GA 1BZWA 1QNWA 3LE0A 3V0BB 1CIWA 1CJDA 4LNVA 5JOXA 4OUEA 3NJXA 2A3XA 1G8WA 2IVJA 2JE8A 4EYUA 1BMV2 4CDUC 4ARXA 5F5AA 4YGEA 4M4PA 5DAPA 4Y24A 1JYTA 4MHUA 4DEVA 4H7MA 1VMJA 3FFZA 1LTEA 4MVTA 1SBFA 3D4KA 1H8TC 2Y34A 3A22A 1ZREA 4YM1A 1W2OA 3K48A 4EN7B 4Q0SA 5FPLA 4EZHA 3GBGA 3Q8CA 3OPTA 4LO4B 5M0TA 3OBAA 5EJ3A 5L36A 4XACA 2W68A 5I0TA 3I2FA 4XAEA 3PNAA 1GZCA 1LJ7A 1X33A 2WWSA 2AYHA 2UY9A 4KGQA 2WABA 2XGXA 1WZXA 3GBWA 1Q3EA 4W6WA 5DDJ2 4O9EA 5FUNA 4C91A 3LEIA 1CPMA 1SLAA 3HPNA 1EYBA 3AZXA 3WNLA 5FZGA 1IKQA 1W9TA 5HCBA 2ORXA 4FTEA 1VBD3 1OH4A 5A6QA 5JR7B 1XJAA 2PHRA 3AP5A 1KFUL 4RS5B 4BQ2A 4NHXA 1VBD1 3VN4A 2LW8A 4UW4A 5FZDA 1ZRDA 1ENQA 4QDQA 3TRSB 1OF3A 4HPKA 1WMEA 3JU9A 2ZGLA 2CV6A 1CAVB 1QNYA 1WUVA 2AACA 3GM8A 1CGPA 3E5QA 2VM9A 4RS5C 3VBSB 5LA1A 5T5OA 2P6HA 3VZNA 2DBNA 5B2GB 5IK7A 5F3IA 3WNOA 4XJWA 1GKBA 5A33B 2ZHLA 2D97A 3THTA 3WP6A 5E1RA 4E4SA 4ZU7A 2VZOA 1OQEA 2ET7A 5C9AB 1UU4A 3WCRA 1V6NA 2FCUA 4QPIB 5DZGA 2A7AA 4LE4A 2IXJA 5IVJA 1J84A 1RMU2 2XR4A 2SLIA 3FJSA 4FXGB 1RUE2 3P6BA 4XBLA 4YWAA 3LA7A 5F3CA 2BPA2 1ZYBA 4IV1A 3BGAA 4RGGA 3KV5A 1MEC3 3DUIA 3I4IA 4Z82A 2HH9A 3UGHA 3V64A 1DP0A 4EN9B 5CFDA 1VB4A 4L8QA 4BA6A 3RI9A 5FXXA 1QJZA 4IEPA 1MEC1 4QPIC 1RUF3 4XJZA 4FSJA 1YEWA 1XPWA 1POV0 4CEWB 4CUGA 4WZCA 3T30A 1RUF1 2XJPA 2EXKA 5C8CC 2JDAA 5C5TA 3R4SA 2D40A 4R52A 3WCSA 4M01A 3VKMA 4JZRA 1AR63 1ND3A 4I0AA 2CGNA 4ISQA 1S0EA 1I9RA 1FPN3 3NKTA 3FHAA 4E9KA 4CDQA 3DKWA 2W91A 1XNAA 1AR61 1NCRC 1W05A 5LY2A 4AEMA 1RTVA 2D3PA 2PHFA 1FPN1 2EF6A 5FP7A 4NHKA 1JU3A 1HQLA 2DVDA 3ST7A 2B39A 5JSPA 4MGKE 3CL1A 3H1YA 5K0UA 1E5RA 3VBRA 4CDWA 1QJX1 4UBGA 1QJY3 1W6QA 1VMFA 4FPYA 3WVJA 5A3WA 2HWB2 1SFPA 1XE0A 1QJY1 3FC0A 4PLNA 4BDVB 2QQNA 1UYZA 1V6JA 3LA2A 4RHV1 1OQ1A 4RSUA 3BKZA 4Q0QA 3VKLA 1EPZA 1HW5A 1FAYA 4HSJA 2IXKA 3WDUA 4HKOA 1OH3A 2VO5A 5CEHA 3S7IA 2FDHA 1UY4A 1KXGA 2P37A 4NRPA 4EWEA 3GZTB 4AVTA 2DCZA 4LPLA 1O91A 3PLQA 4B4RA 3FWEA 2BERA 2WNUA 3HEIA 2X05A 1KS5A 2WJSA 1AUYA 2E32A 2PHTA 3IKWA 4L99A 4AL9A 3H42B 1LOGA 1OUXA 2R49A 4HT1T 4XUOA 5C3SA 3TOJA 2OXBA 4ATFA 4DB5A 1DU3D 2WFPA 4XETA 4XTPA 3ZO0B 1UZZA 1Y7BA 4M4RA 2EXIA 3BIWE 2E7AA 1GZ9A 2YPJA 1HKDA 4BOWA 1BXHA 1YQCA 3F2ZA 1DZQA 5FP9A 3O1UA 2X5IA 4LT5A 1UKRA 2D6PA 4HONA 3DXUA 4NHYA 3TBDA 3J8F2 3BTYA 4JDOA 1VIWB 3IPVA 4JGYB 2B5HA 4ZHNA 2JDMA 3K3OA 2FZ1A 1U0AA 2JDZA 3CQOA 2MEV2 3UJOA 3M3EA 2XMLA 4GA9A 1NAEA 3RNSA 3EO6A 2G9FA 1UPSA 5A1AA 4MADA 1HJGA 2A71A 2EAAA 4GWJA 2VVEA 2F4LA 2JEMA 2GNMA 2WRAA 2ZGRA 5HPOA 1HRV3 1ULPA 3OB8A 1QKQA 5JDBA 1GZWA 4JGYC 3HWJA 1GP6A 1HRV1 1W9FA 1YFUA 4QX2A 4N43A 3WUDA 4D69A 4GB32 5HCHA 4DINB 5HCFA 1C1LA 3JXSA 3ZIWA 3OUHA 1C3HA 1JN2P 1VRH3 3MIFA 2VL4A 2XB6C 3BTXA 4GJYA 2ZGUA 4Q4X3 3GZEA 2EA7A 1WD3A 3QH6A 1N1VA 3KQ4B 4QPYA 5FK7A 1VRH1 1H9PA 2VVFA 3LEGA 5EIYB 1H1MA 4Q4X1 4CDUA 4BZ4A 3RFRA 2BQPA 4YW3A 3KT7A 1KS4A 4XVHA 2JXAA 3K4DA 5JCTA 2V5DA 3EBRA 2VZSA 4P9GA 2Y6LA 1DIWA 2HBTA 3EYPA 3RRDA 4Y1ZA 3KM5A 3AL6A 3ZXJA 3V0BA 4HG6B 4UBHA 3W20A 2PAMA 3A21A 1OOPB 1CN1A 2BVBA 4EJRA 5FZ9A 3HQRA 2P3KA 4Q29A 4K8FA 4LEJA 3SKJE 4EV0A 2GSYA 4ZPIA 1RUI3 4H14A 2A5ZA 1YHFA 2J1VA 3ACIA 3MUZ1 4FPOB 2CGPA 2PHWA 3TEWA 3NNMA 5FMOS 1OOPC 4QAWA 1RUI1 2YFZA 4RFT0 4PLMA 1OPMA 1XC6A 4V1PA 5KHHA 1LU2A 2UY8A 2VW1A 3AZZA 2ZGTA 4P9IA 5CKMA 4BXSV 3PTRB 2CDPA 2IXIA 3MIHA 5FXZA 4YVWB 2ZEZA 5F5IA 2E63A 3KVBA 4AGRA 4CU6A 3D8CA 1JOBA 2C4XA 3WG4A 3WX5A 1IS5A 4LA3A 3N7MA 5DDJ3 4XILA 2ERFA 2XJUA 4ZU5A 1PZ9A 1OFNA 4N8MA 1R082 2W94A 1LOFA 3WNKA 4QQHA 4ZY9A 1PNGA 1C8M2 1UIKA 3BYWA 4Q1PA 4QXCA 5A7SA 3N9PA 4XIKA 1X50A 3VD4A 3ABZA 2P3IA 3HNBM 3WZ1A 4KMQA 2Q8OA 2AUYA 3VBHC 4WVMB 4CU8A 3LFIA 3PU8A 2QVSB 2VBDA 3HBZA 3D6EA 2BOJA 3OBRA 5BNOB 1CAVA 2DUQA 2PTMA 1D2QA 4ZXEA 4BMEA 4UWDA 4Y5SA 3LFMA 3DXTA 1AL22 3VBSA 2H6CA 5FLJA 3VBFC 4AAXA 4CCOA 1G9CA 1JZ5A 5KXBA 4Q26A 5A33A 4OUMA 1ULGA 3FBMA 1D4VB 5A6YA 3AM2A 4AFDA 4JGZB 1HLCA 1NZIA 5C9AA 5BNOC 1F35A 1FX5A 4URTA 4XDQA 2NLRA 1QJU3 1W04A 2Z4FA 1GSLA 5EV7A 4GWNA 1DG6A 1JW6A 1IGOA 1BVVA 4KL1A 5DUVA 4Y26A 1M4WA 2GMEA 4CYDA 3VZMA 5FO7B 2ARBA 1QQP2 1ENRA 1PX3A 1X8EA 3H1WA 3I3QA 1D0HA 2DF7A 4Y1VA 2VNRA 2XL9A 3KV6A 1N1SA 1GQPA 3E5UA 2IXLA 1H6YA 2JDKA 4N7IA 4A6OA 3H8XA 4CEWA 3J7MA 5FZCA 1COV3 1JYNA 1HRI3 3ZSKA 1UYXA 3H7JA 1PVC2 2DVBA 1COV1 1HRI1 4Q0UA 4S2FA 1NLSA 1XYNA 3JZVA 4QMAA 5LBFA 1ASJ2 3FN9A 4COWA 4NIAA 4GULA 4UW5A 2D6KA 1LULA 3VD3A 4IEUA 4DS0A 1Z7S3 1JYXA 5FYHA 5FY7A 5C33A 3LDRA 5BV6A 2YPDA 3U4SA 3R0RA 5FY1A 2RMU3 2TBVA 5FR3A 3HR9A 1Z7S1 2YBKA 2RS53 3HVDA 4IE5A 3UK9A 4FCAA 1MS8A 2VZRA 2RMU1 2VZVA 1PZ8A 2DVAA 2ZOEB 2RS51 2RDSA 1DQ6A 4YGBA 3MFAA 4NAMA 1K5MC 1WMFA 5L9BA 1O7FA 4M0HA 3FUQA 5A7NA 4RA0A 1WLCA 1S0IA 1QJEA 3POEA 1PO11 3MI8A 4IERA 4IE0A 4AEJA 4XBNA 1VLNA 2O8QA 2ZGMA 4KNCA 1I5PA 4C1XA 1Q43A 4TLGA 1GYKA 2FDKA 4XHBA 1J1TA 3FLTA 3KF5A 3UESA 3ZFGB 1VB2A 2GN3A 1NLRA 3DL3A 3OJBA 1JBCA 2C6SA 3H7YA 2RM22 1BYHA 5HV0A 3O1VA 5JUVA 1IPJA 2OQ7A 1GFF2 4BLIA 2CWSA 1FV2A 1W6MB 3FX3A 4XOGA 1IOAA 2WL1A 4YZ2A 2EIEA 5DABA 3VDBA 3RZMA 2RS32 4LK6A 4XURA 1WW7A 1LGBA 3WT3A 1US2A 2ZX4A 5FZHA 3ZFGC 5C71A 1R1A3 3OGRA 1PO22 3K75B 1F2NA 1M06G 1UYYA 4A42A 1F8VA 2Q1MA 2XJSA 1NY72 1FNZA 5IUQA 1DBNA 4CE8A 3TEZA 1BEV3 2ZX1A 1R1A1 2C0ZA 2UWBA 1DCSA 2A6WA 4QB2A 1F5FA 1BEV1 1YI9A 2A3WA 4JGYA 1J1LA 1YI7A 2Y0OA 2YC2A 3MF6A 3W58A 1IQAA 5FZBA 3VGIA 2BWCA 4D6QA 2WZ8A 3NRUA 5JI7A 4PBPA 3WINE 4LBQB 2DBIA 3TN93 4QQPA 2W46A 2JD4A 2VZQA 4BU2A 1LEDA 2QQVA 4AI8A 5A3UA 2B42B 3TN91 4CUCA 2Q8DA 1BKZA 2NQYA 5KR7A 4DNYA 4OFGA 4K6BA 1D2SA 4OMDA 2KR2A 2NM1A 5ACA2 4BLJA 2V4VA 3TEXA 2UU8A 4K21A 2HBUA 4PI0A 3JBG2 1LENA 1WGPA 4XCAA 2VXRA 4FQZA 1EUTA 4YVSB 1LHOA 5IT6A 5G05L 4OHYA 1C1FA 1AR93 5FLIA 4A44A 3VBUC 1V6IA 4I09A 3B69A 1US3A 2HEWF 3GF6A 5FY0A 2Y6FA 1AR91 4XC9A 1WCSA 1VBE2 4YRDA 4LO7A 2W47A 1CZSA 3JD73 5GJ6A 2WZEA 1IG3A 2HLEA 5FKCA 3IMMA 5JLVA 4YVSC 1RUJ3 3PUQA 1OOPA 4TSVA 4AVSA 1NQDA 2FQPA 3JD71 1LHVA 3ZYIB 3HQUA 1AR73 4CU9A 4Y5TA 5BNNB 3NAPB 3EJKA 5CB7A 3IDEA 4G9SB 4AI1A 2RS12 4MGSA 3VHOA 1AR71 4TN7A 2N7GA 1UWWA 3O1SA 1UY0A 1DGWX 5F5QA 4IV3B 2EIGA 2GMMA 5G04L 2VCBA 5KXCA 4L97A 1AYN3 1JU4A 1JS9A 1VRBA 3LGRA 2ZHKA 2ADEA 3ENRA 4HOOA 4IEVA 1G86A 4QDRA 4JCKA 3NV4A 1PIV3 2YFUA 1AYN1 1EP0A 4I01A 2I74A 4HANA 2B46X 4YVWA 3BUCA 3T0BA 3AB0A 5FZMA 1SACA 4XHXA 5FZEA 1PIV1 5FYBA 4DFSA 1WBLA 2QDRA 1FOD3 2C24A 3NV3A 4HXCA 4QQLA 1ALYA 2PHLA 4YGCA 4EN6B 4IV3C 4XXPA 1QOTA 1RUC2 4P5HA 3CNAA 1FOD1 4MX3A 4PCRA 2Z79A 2GDFA 5LWBA 4O65A 4TZDA 2RR11 3ATGA 2XPJA 1TME1 1OURA 2FDIA 1C8M3 1E57A 3D0JA 1NUKA 3AMQA 4XUQA 4IQPA 3ECQA 5LASA 1D4M3 4BYYA 1ULFA 2DFCA 3NV1A 1Q8QA 4WVMA 5IW0A 1D4M1 4Q4Y2 1UKGA 3A7QA 1GU3A 2UURA 3ZPOA 2R063 2GU9A 5JOZA 1W06A 3C8XA 3M1HA 3KF3A 4XMIA 4BH9A 2R061 2MNGA 3HN1A 3LZZA 1OVPA 5T55A 2YGMA 4AFCA 1OSGA 4JGZA 4MGQA 2ORZA 4N53B 1PGW1 3MIEA 4C0BA 4NMIA 1OA3A 3Q8BA 3ZXGA 1PNFA 2D43A 3OEAA 1V6MA 2WA3A 3U78A 2GALA 2WNVB 4YYOA 3SEPA 5T5JA 3FBYA 3K4AA 4B1MA 1F31A 1PK6B 5H9QA 4LHKA 1KD7A 4XZUG 3KS7A 1R64A 1WW4A 3RZGA 5A3OA 4W8JA 3K2OA 4HVOA 1J3RA 2PQQA 4N53C 3ZKUA 2EAKA 2X53S 2J1RA 2ZJCA 3HN3A 2GC2A 4CCCA 5I93A 5KXDA 2WNVC 1JZ4A 3LIHA 1LESA 1OUSA 3IDBB 2VMFA 2GAUA 2WQZC 3D3AA 1HX6A 2XLFA 1V9U2 3H8UA 1C57A 2OT7A 2R0HA 1SCSA 5BUVA 4HVQA 2WN3A 4GALA 3ZDVA 3O5SA 3RZLA 2XOMA 1SLLA 3QLQA 1F4HA 3GDBA 3WG3A 3N9LA 4HK8A 4CEYB 4K8RB 2BYVE 2O14A 3ASIA 1LKNA 3QBQA 3T2PA 1KQRA 5FO9B 2WFF2 4AFAA 3WDWA 1E5IA 2VUAA 3PVNA 2ZAAA 2JG9B 4ES8A 3H50A 1LAJA 1QIQA 5I0UA 2B8MA 4MUVA 1AYM2 1O4YA 4OLLA 5CG8A 1U5IA 2VQAA 4LUMA 2ZMLA 4QHZA 5LRRA 3UKNA 3HT2A 4COUA 3B93A 4QHBA 2ZMNA 1QJX2 4R9DA 3O1PA 2HJIA 3ETPA 4D0QA 1S55A 4PIZA 5D8AB 4CPBA 4PF5A 2PN5A 2JG9C 4AGVA 1AZDA 1OA2A 4RHV2 3R05A 4E2GA 2GZWA 5KHKA 5C8WA 1J3QA 3ZFFA 2UYBA 4YW4A 2HWD2 1W90A 4DUWA 1GWLA 1ZRIA 5FWJA 1DGLA 1H8VA 4WM7C 3POGA 5IK5A 5HI0A 1W6MA 5L9RA 1H6XA 3IM0A 5FZ3A 1F15A 2WSUA 4FBFA 2HYKA 2I07B 3E1F1 1XBFA 1FV3A 3I8TA 5A32B 2W08A 5CADA 1D7PM 1X9TA 4UI9L 1G9BA 4QM9A 3BALA 4QX1A 2G9ZA 3O0XA 2NZ9A 4NPLA 1MS1A 1SDWA 3M7AA 3ES4A 5F2WA 4DRRA 5A3PA 3BCWA 4MGZE 1L7RA 4PJYA 3E97A 1CD3G 4Y5Z0 3ZFEC 3VZKA 1SFYA 4S2GA 3TEYA 3DN7A 4IUGA 1TEIA 5JZGB 4IETA 3IIAA 4LBQA 1ND2B 1KDKA 3MV01 2HEYF 4Z1VA 2FZ2A 2VBBA 2CNAA 3SH5A 2P5BA 4QPGB 3U75A 5JMCA 5DAXA 2IC1A 1N1TA 4ZXKA 2XBO2 4DPNA 2DVGA 3RYRA 2GH8A 2XJTA 1VBC3 3PUSA 4GH4C 5JZGC 4LIVA 5FZFA 5FQ0A 2DVFA 1ZRCA 1ODNA 2VTFA 2W87A 4NWVA 2GH2A 1GNYA 3POSA 1B35A 2HWC3 2K2SA 1VBC1 5ACA3 4QQOA 4QPGC 1JHJA 4YVSA 4MGIE 3UYJA 1A8MA 2HWC1 1X9PA 1HDKA 5FYCA 3KCCA 3U11A 4BQYA 3VDDB 5CYYA 1L7QA 3A0NA 1OD5A 4I2OA 2F4PA 5FYVA 1H8TB 2OZJA 3AZVA 3I2DA 4JDMA 4MLOA 3ZXAC 4PDWC 4KWJA 5FDBA 5F9TA 3KHCA 1QU0A 3KT1A 3N9OA 5BNPC 2D6LX 3F95A 1LR5A 2SBAA 3AP6A 1BBT2 4XFBA 5A7WB 3VHRA 2D93A 5LCWL 1RHI2 4BQ1A 5FZ8A 2OVUA 1W8UA 1ULDA 3VDDC 4EWDA 4K1YA 5BNNA 4IEYA 3NAPA 3NNJA 3H1MA 4LKSA 5EPAA 1DZTA 3UNPA 1H4HA 2ADDA 1ACCA 3AMPA 4KGGA 1AX1A 4LXLA 4Q2FA 5IFPA 4A6SA 3IWZA 3THDA 4ATEA 2P6CA 2B4KA 1QXPA 1CAUB 5IAVA 5DMYA 2WUHA 4LBJA 1OFSA 1UAIA 4B8EA 1MZ6A 1TMF2 3BODA 3H3UA 3AL5A 2PAEA 2KM2A 1MS3A 1IHMA 2R1DA 3ZLIA 5LW9A 3B01A 2ZBJA 3DGTA 3OCPA 5JWPA 4OQ8A 1W6NA 3C7GA 5JSOA 1YFYA 3UKVA 4IGPA 4XFAA 3G6JB 5F1RA 3RMXA 1XNKA 5FYYA 3RPQA 3QOPA 2HWE3 1ZRRA 4RGKA 1AXKA 1XSQA 5C3OA 3LWCA 2VECA 5I91A 3CZUA 2ZHNA 2L9LA 2HWE1 1YFXA 2AR6A 3NJVA 2GN7A 4A3XA 1UZVA 1O8PA 2R073 3ZDSA 4D7YA 3V0AB 1NYWA 3LKJA 4HETA 1MQTC 5CA6A 5CFCB 3FUOA 2R071 4AVVA 1AR82 2RJLA 1RITA 2HKXA 2VBPA 4B4QA 2JIJA 2NYYA 3OOXA 2GP5A 3PIJA 1PM7A 4AVBA 2DUPA 1FYUA 2YU2A 3PMEA 4FPFA 4RGAA 1ZRFA 4DXTA 4AQTA 2JDHA 3CEWA 3ILNA 4XFIA 4A7YA 1QOSA 4CP2A 4CP0A 2BVVA 2ZS6B 1N3QA 3ZXFA 1POQA 1H1IA 5CFCC 2OUHA 2W2IA 3HIFA 4UFHA 4CCLA 4CDXC 4P14A 5GM0A 4BQ5A 1CAXB 4N53A 5LEKA 1A34A 2VCMA 3H8RA 4XJ8A 5CIRA 1AX2A 5C8CB 4BE3A 3BIEA 1VP6A 1JOJA 2X10A 5DN2A 3C7FA 3D0SA 3O14A 3ME2A 4CA9A 4FO9A 1PK6A 2W52A 2LRPA 4JKMA 3WW2A 1GOFA 4CCNA 2PLV3 1N47A 1REFA 1L3JA 2WIIB 1NCRB 1PGL2 4RR3A 4SLIA 2VOWA 2J7MA 4UW6A 1CPNA 1GLHA 2O0OA 2PLV1 4LOSA 2C9AA 3BTAA 2R042 5J98B 3AFKA 5FZ7A 3RJ2X 1CJPA 1SLBA 3NV2A 1W0PA 1F9KA 4W65A 5EYXA 3O0WA 1WW5A 3LEMA 3ZMOA 5FZIA 4YM2A 5L19A 2YBPA 4PIYA 2B9UA 2VMGA 2CAVA 4BCUA 4PQQA 5FYTA 1JYIA 4OZOA 4HBNA 5F5CA 1JZ7A 1UOFA 3TNPB 1DQ5A 1W3VA 2VAUA 3N9MA 5LZ6A 2F17A 4NHLA 2ZZJA 3WF2A 3PU3A 4B7EA 4CEYA 3RYPA 3ZM8A 1OLMA 2WS93 2QZ2A 3ZN5A 5C3QA 4D7SA 5F39A 2ZKLA 1C28A 4Q4W3 1JXNA 1WMDA 2WS91 2EICA 1HQWA 5F3GA 1OKOA 1DFQA 3IAQA 5D1IA 2BBAA 1AYM3 4Q4W1 4B3NA 5AC93 3WXPA 2YXSA 2G1MA 3JQXA 5FYSA 5LB6A 3POIA 3ACHA 4Q0PA 4CXXA 3OF1A 1Y43B 2FHRA 5D8AA 4AR2A 5AC91 1YYNA 5JIUA 2R16A 4Z07A 4QU1A 4OI0A 5LK5A 3MLJA 3GHMA 4P5YA 1PO12 1BJQA 1CQ9A 5GLTA 4MV2A 4XXAA 3WDVA 2WO3A 2D5HA 4QD2A 5J37A 5A7OA 3WQBA 2LROA 4BMBA 5DG1A 4UYBA 1ZNPA 2JB4A 1EAH2 2ZZQA 4ZONA 1NQJA 1Q8PA 2YZ4A 5FJHA 3ACFA 3VDCA 5A32A 4OHZA 1SZBA 4XTMA 1POV3 2DURA 5A80A 1W03A 4IE7A 2VZ1A 1W2UA 4AEDB 3OY8B 1POV1 2HWF3 4Q4V2 4COZA 5C5UA 5H9RA 1J3PA 3AKTA 5ABJC 3ZYHA 3SKVA 2HWF1 2VZUA 1ZBE3 3SISA 2ZGQA 1RUG2 1S1AA 3ZSEA 4A45A 1MVEA 1ZBE1 2CYFA 3MPPG 5JZGA 1N1YA 5E16A 4FVVA 1SFNA 1H2KA 2QFEA 4GIQA 1RVF3 3LA3A 4AEDC 3IT8A 1ND2A 1VBB2 1SBEA 2AENA 3AJZA 1J58A 5LATA 1W6OA 4BK5A 1RVF1 4QPGA 3AYEA 1BCXA 1W0NA 4MXWA 1H4GA 1SDDB 3BN6A 3I2KA 4DO0A 4DUVA 4RD7A 2WO7A 4YZ5A 4TTGA 4XJAA 2D3SA 5FPBA 4LR4A 4Z8BA 3OBTA 3DKQA 3T09A 1ZBA3 4LO5B 5E6HA 4IE6A 1YFWA 2FCTA 1W9YA 5LA0A 3U10A 4MGTA 1ZBA1 3DF0A 1V6KA 5D21A 5EQUA 4P9WA 3ZYFA 2Q0AA 1FMD2 2D3RA 3ZSMA 1IPKA 1QXRA 3CZJA 4H2AA 3VDDA 1QY4A 5CVRA 4R4XA 3MUY1 3WW3A 4MG2A 3WNMA 1H8TA 2ZHMA 5B4XA 3U1XA 2E9QA 1RUOA 3VD9A 1JZ6A 1DLLA 4B4PA 4YG0A 1PMHX 1MS9A 3KT4A 4GMP0 4LBOA 5A7WA 5GLWA 3PJYA 4XDOA 3GYDA 5FUPA 4AI2A 1RHI3 2YROA 2ZGNA 4QKDA 5L73A 2W5FA 5FBZA 4BB3A 2CTVA 3NO8A 1DLCA 4MHRA 2JE9A 2VXJA 4K7JA 4WVZA 1ONAA 4PQ9A 4DUXA 2PA7A 3ACLA 5E89A 4QKFA 2J42A 3WQ7A 3T2QA 1BMV1 1VPHA 3VKNA 4CP1A 1QWRA 1H2NA 2OW4A 4ISRA 3ZR5A 4A4AA 1CAUA 3ZIXA 4DMIA 1S2KA 3RS6A 4AEKA 1EV12 3UL2A 2W1QA 3WW4A 2ILMA 2O8OA 4GJZA 5F2SA 1O59A 4FP3A 2NN8A 1ULOA 2JX9A 5J7MA 4TLFA 1W28A 2ARAA 5A70A 5IVCA 5BNQA 3N9NA 4P02B 1WD4A 1CVNA 2LUWA 5C4WC 3VBHB 4FOWA 2AH2A 4QKBA 3LOBA 1SMVA 3MGUA 1Y9MA 3USUB 1YNAA 5JAXA 3I3BA 4GAZA 1VBA2 2Y6GA 5DDJ1 4QX3A 2A73B 4RS5A 3VBFB 1KRIA 1DQ2A 1LHWA 3VHPA 4MSVA 1V6LA 2I45A 4LKDA 4HK9A 1DDLA 2QDNA 1RJ8A 2NPIA 4JAAA 3DPRB 4GD4A 3V0AA 4NJ4A 4Y1XA 5LA9A 5J96B 3T3YA 3KB5A 1MACA 1NA1C 5T3NA 2QQUA 4LO8A 4Z2AA 1G6NA 4Y1YA 5GZDA 3BOPA 3GJAA 4AXOA 4KBBA 3MIDA 5AFBA 1K5JA 1JHNA 4D3WA 3KGZA 3QACA 3PVBB 3M3CA 4OHXA 4XJUA 2J1UA 2RG4A 3KV4A 5JXGA 2EIBA 3DPRC 3ETQA 4XUNA 3SEEA 2F6BA 1CWPA 4YW7A 3AXDA 4BIFA 1RUH2 3KD4A 1LGNA 4QPIA 2A6YA 1W99A 1DZRA 3N36A 4DOUA 5DXDA 1Y9QA 2DU1A 3BU7A 1YQ8A 3PTYA 2ZAHA 3WG2A 2DV9A 3AFGA 5A3LA 3I3MA 5C8CA 2IUWA 3HOBA 3N7JA 1RUNA 5C70A 1RMU3 3AC0A 4YFWA 1QJU1 3AYAA 3KVAA 1NXD1 1RUE3 4QU2A 2XLGA 1MS4A 2Z5WA 1OT5A 1UY1A 4D8MA 1RUE1 1G7YA 2UYAA 4AHXA 1NCRA 3AYDA 4N9HA 4R9CA 1C5IA 3ZN6B 5FLHA 2LM3A 5LBBA 5D2AA 2WO1A 1LCLA 2JICA 1XOYA 3BB6A 3NSTA 1FATA 1NCQB 3P3NA 4HMZA 3RQ0A 4AZZA 3NNGA 1YXWA 4CCJA 3M3QA 4LKEA 2XVGA 4BQWA 3BU0A 1K5MB 3Q8AA 3I49A 1DQ1A 1I6XA 3L2HA 3S5AA 1DGWA 4NVPA 4O7XA 5FYUA 4JKKA 4QX5A 4ASKA 3ZVXA 3FFQA 1TE1B 4FP2A 2A6ZA 3M8LA 1NCQC 1HV0A 2YU1A 4OHWA 5AFEA 3GXUA 5J48A 3RVHA 1DQ0A 5JI9A 4KG0A 3APBA 4NIDA 3E6BA 4OULA 3WF4A 1W6PB 3IIIA 5JPNB 1AF9A 1UL9A 4GQ7A 3S7EA 1CESA 1HB2A 3SCHA 4AHZA 4YW2A 1U5XA 2HWB3 1GOGA 4HSLA 5GLZA 4BPZA 1SHWB 5A3NA 4ZS2A 4YZ4A 1P8JA 1QH6A 1HN0A 3DCQA 1CR7A 2DCJA 2HWB1 3POWA 2IWGB 1XNBA 5F8PA 2P34A 1AL0G 2OS2A 3KGLA 4XMAA 5LA2A 5FRAA 1UOJA 4X6QB 2BFUS 2FMDA 4PF1A 2LS6A 3URFA 1FXZA 2RJKA 1H1AA 3PHMA 2VQTA 2W92A 1R092 2E53A 3TWIA 2R30A 3FMGA 1OA4A 2E26A 5F37A 3AK0A 2OZ6A 4M3CF 2Z42A 3AYCA 5FFOC 4OI1A 3SLIA 3ILFA 1KJLA 2D7FA 4HN1A 1HJFA 3MV11 5FMDA 1HXS2 2GNDA 3IDAA 3GHNA 1FI2A 4XQ4A 4OUSA 1YUDA 3OY8A 4GWIA 2B9VA 1ZZ7A 1X36A 1UW8A 3CJIC 4Q4V3 4F7ZA 1IS3A 3EB7A 4KWUA 3J8F3 1T6GC 2BDRA 2MHFA 4NO4A 3O1OA 3ZYRA 4D94A 4O61A 3QCWA 2MEV3 3J8F1 2PMWB 2CHHA 1RUD2 3JUUA 2VTXJ 5I8YA 2QE3A 4PHZA 1UZWA 5HXMA 2DWRA 5IVFA 2QQPA 3H8OA 4QB6A 1LEMA 3VBUB 2WWUA 2CY6A 4SBVA 2E6VA 1JYVA 5JXHA 4NHMA 4XF4A 3GGLA 3NWKA 5F6LB 5FPUA 4GB33 3WQ0A 5JVVA 4DY3A 4OHVA 1X82A 3N9QA 4XBQA 4IEXA 4KH9A 1UXZA 1XYOA 2GP3A 2Q5TA 1W39A 2Y33A 4GB31 3ZXDA 4AHWA 3POJA 3KMHA 2DCYA 2X8KA 4YFZA 4OCTA 5IK4A 4E2QA 4F8AA 4UFMA 1EUUA 4Q27A 4YZ1A 2YHJA 4P00B 4XEZA 3T4VA 2P2KA 2ZEYA 3ZYJB 2Y8KA 3OUIA 3P1IA 3VB9A 2VZ3A 2XKPA 3FE5A 3SH3A 5CG9A 5T5LA 5JMOA 3OUJA 2WAOA 4XPVA 2WZR2 2XVKA 2QBXA 5FY5A 1RUJ1 5EJZB 3K77A 1YRZA 1ST8A 1O5LA 2VC9A 1PGSA 3Q8EA 3MEPA 4XFGA 4AFMA 4K9SA 4NPMA 5JR2A 2A6VA 2BP6A 3PL0A 4AQ2A 2QKDA 2Y6KA 2VOTA 2VZPA 2ZMKA 5AVPA 5HBAA 2PXJA 3WV6A 2Y38A 1D0GA 2QQJA 4LBLA 2WINB 5T50A 2J1EA 4ONUA 4E2SA 2C1FA 2E51A 3MF9A 1WLTA 2W95A 4NUBA 1W9WA 4HFSA 2VQUA 2JWPA 3TYJA 2JG8C 1JUHA 1GV9A 3I54A 4WM8C 1W8HA 3VBHA 1WCKA 1GWMA 4MO3M 3M3IA 4I02A 3OD0A 3USUA 1O4ZA 5T5PA 3W9AA 4EZ4A 4DZGA 1TNRA 4OZXA 3ZYPA 1R083 4G3YC 1IKPA 1VBA3 3VBFA 3MZHA 5FYIA 3KSCA 1Q8VA 2X09A 1R081 1JMUB 3NKGA 4CZSA 3E6DA 4UF0B 5DAVA 2QQIA 3ZN4A 1C8M1 3QD6A 4CSWA 2QTWB 4HN0A 3RG0A 3B7MA 5BNOA 1KITA 5CNAA 2GC3A 3WNXA 5KHGA 4QHOA 4LJHA 4DRVA 2BGPA 2GMPA 5I0RA 5I0SA 1ZA4A 3ZR6A 1VBD2 4WBBA 5CAZA 2BGOA 2VGDA 4HL0A 3AKQA 4AGGA 2JIGA 2RV9A 1AL23 2WNOA 3PMSA 4D6RA 1HIXA 3AP9A 4UW3A 1REDA 2XL7A 3KCYA 1XYPA 1AL21 1RXFA 2ZXQA 4CXWA 1UU5A 2R0FA 3IB3A 2TEPA 4IEQA 4W4ZA 3ZOIA 3J7NA 4AF9A 1UQXA 3C2UA 4QQ2A 1E5HA 1QHDA 4AFBA 3WNNA 5L7OB 3DYMA 2VR4A 2GC0A 1AHSA 2Q30A 4KWLA 3WOGA 2EALA 3NW4A 2BU9A 3UJQA 1QQP3 2Q1ZB 3O7OA 2E7TA 3T0DA 4NOTA 3N3HA 2QQWA 3R4UA 3ZN6A 3DYPA 5L9VA 4NROA 1NCQA 2OPKA 5L7OC 1V70A 2OIIA 1H30A 1JZ2A 4IESA 1MEC2 2VD7A 3N35A 1PVC3 1HB3A 4XQDA 3BOWA 1K5MA 2Z2SB 3A23A 2J1TA 4ET7A 4P08A 1RUF2 1XNTA 3MW2A 4BM8A 2Q1FA 1ASJ3 1PVC1 2KD7A 3TB0A 1LOEA 1TQ5A 1ULCA 1ASJ1 5CISA 1H2LA 1WCDJ 2QQOA 1AR62 2ZX3A 2JECA 1W6PA 1Z0HA 3AZWA 3OGSA 4IV1C 4Q0VA 1FPN2 4XUTA 1ND3B 4PT6A 1XNDA 3X29B 4L2NA 4B1LA 3U0ZA 4M0NA 2QCSB 1SQ4A 4O9GA 4AAPA 4WM7B 4YW6A 1T2XA 1TNFA 1YWKA 2A1XA 3N4MA 3I3EA 1S4CA 1LU1A 5LEJA 2VY0A 3UV9A 3H3LA 3GZUC 4IE4A 1LRHA 1UX7A 3OD4A 2VW2A 5C6CA 1R1ZA 3OGVA 5JOWA 5A1FA 3VHNA 1QJY2 4H7LA 2XUEA 3VBRB 1QH7A 2BNMA 5CZKA 3ZFGA 3AVRA 1ND3C 4Y22B 3FHIB 2VG9A 4NN0A 2Y60A 5LK7B 2XJVA 1LECA 2ZEXA 2RM23 1IG0A 2YDEA 1DHKB 3I97A 2J1AA 1JZ3A 2FD8A 1Y9GA 5FZLA 2DUOA 3MYXA 4W6YA 4I0WB 2JKXA 2RM21 1AVBA 3BPZA 4GKXA 1NX9A 4TYSA 2YYOA 2Q8CA 4JRLA 2JKBA 2RS33 4FFFA 2K0GA 3B00A 2CAUA 3VBRC 3ZFEB 4CDWC 4CRQA 2ES3A 1ZZBA 4GKYA 3SCFA 5C3RA 2PYTA 2ZGOA 3H9AA 3EHKA 2RS31 1PO23 3WF0A 1GMMA 4NPRA 3R6SA 4LLOA 3KCXA 3LDBA 5FWEA 4UFIA 3B9CA 3USSA 4D6SA 1PO21 2ZGPA 3NNLA 4Y3OA 5HV4A 1NY71 4QM8A 5E8AA 4JQRA 4FAGA 1W8OA 5FZ0A 5GLUA 5A7PA 3KWVA 1DGRA 4GH4B 3LB9A 5KC6A 3N7KA 2WA4A 2XHKA 1UO9A 4V2VA 3L9JT 3RSJA 3V56A 4M3CB 1JYCA 2YY1A 1I1EA 4JKLA 3NJZA 2VMIA 1QOOA 3J7HA 1GICA 3B5LB 1JZ8A 2X5IB 2D44A 2CDOA 3VBUA 4EE2A 2NMOA 3WG1A 3IPVB 4L0PA 1LNSA 4PDWB 1O3QA 3L2YA 5F3EA 2H0VA 2QJVA 2QZ3A 5BNPB 2ETEA 3NMBA 1AX0A 2VZTA 5BYNA 2Y6HA 3JBG3 4GXLA 1HRV2 1ZZCA 2J22A 1S0CA 5ACA1 5CKNA 2X5IC 5FBJA 3O1TA 2PFWA 4FTBA 5DPNA 4E4DX 1WMXA 1PHMA 4DEQA 4C0HA 5C7GA 3JBG1 3WP5A 3AP4A 4CUBA 1H2MA 1JTZX 2D6MA 2VUDA 4MYEA 1GR3A 1UMIA 4UT5A 4XF9A 1N3OA 4R9BA 2DYCA 1VRH2 1VBE3 1BHGA 4Y4RA 2VUCA 3RDIA 5GZEA 3I2JA 4Q4X2 3W5MA 1MZFA 3POYA 3M2MA 1VBE1 5FAXA 2VCCA 2Z69A 3PUIA 1KFXL 3LIGA 3HT1A 1KGYA 2YV8A 1C4RA 2AREA 1PVXA 2VW0A 5FPAA 5FZOB 3AVSA 2RJ2A 5GKAC 2A3YA 1YLLA 3AKPA 2RS13 1OBNA 4N43C 3VZOA 3UGGA 3WW1A 2ZA9A 3Q8FA 5I8SA 4R8HA 4IV3A 1XXNA 2WQ4A 2RS11 3CKHA 3OBZA 4JVAA 4JQTA 4P9JA 3AMMA 3OTFA 1NE4A 2XONA 1UMZA 3HNYM 4E4ZA 2FDJA 3HMYA 3PVEA 3VUOA 1X7NA 2QNKA 2FDGA 1O6UA 3KLSA
chains in the Genus database with same CATH topology
4YW1A 4XIOA 2BGCA 1MQTB 1RUI2 1EY2A 3OPZA 5J3UA 4FXKB 1DGRN 2ZGSA 1LHNA 1SEFA 3WP4A 1RUC3 2R1BA 1S0FA 1RUC1 4FPCA 3V65A 2LALA 4LBKA 5GZCA 1OQDA 3IN9A 5FPZA 3PJQA 3VBOB 3RZZA 4CDXB 4H3WA 1OKQA 2VU9A 3RYKA 4FPEA 5EWSA 3SCGA 1VAMA 3RMYA 4Q4Y3 3WDXA 1JUIA 4JTOA 3RWNA 4N7UA 1VJ2A 2ET1A 1NE6A 4Q4Y1 3VBOC 2V73A 4S2HA 5AVAA 3RJRA 2WNVA 1LOFC 1UZYA 4X6RB 1H9WA 5L7OA 1VR3A 2YGLA 3O0VA 1G9AA 3MIBA 2KXLA 2WLPA 4YZ3A 2XLAA 2VNOA 1GNZA 4HZFA 5J36A 1QXJA 2AGSA 4N9IA 5GZFA 2A70A 1QJU2 2WC2A 2DCKA 4OI2A 3VBSC 4ZU4A 4YSFA 2A75A 4LLFA 2WZPP 2BUKA 5BY5A 1V9U3 1LODA 2XH6A 2OUJA 1WW6A 5C9AC 1V9U1 4FQ4A 4ASLA 4LHLA 3LOIA 2OYZA 1COV2 4Y4YA 1HRI2 1Q5OA 2QUOA 4J6GA 5J09A 4XFFA 4XE9A 2XJQA 1CAWB 2WFF3 2JG9A 4Z92B 1VALA 4XQWA 3THPA 4ES9A 2V09A 4META 3J26N 2WFF1 5H9SA 1Z7S2 4RQPB 2ZTNA 1ENSA 4WM7A 4XW3A 4L9BA 4C1WA 4LA2A 2RMU2 3T1LA 4CEWC 1AJKA 2VOKA 4LULA 1AYM1 2RS52 1QJX3 3WR0A 1MS0A 2WT0A 1NOVA 3VZLA 1UIJA 3OGGA 4Q8LA 4Y22A 3Q9OA 4HKWA 4RHV3 4RQPC 2O1QA 5ABJB 1YJKA 2HWD3 2WNEA 1RL3A 4R4ZA 2D6OX 3OYWB 2PHXA 1QGLA 2HWD1 4JV4A 4AW7A 3ZFEA 5SV5A 3I59B 3S0MA 3EQEA 1OPOA 4E27A 4BWOA 5FCCA 1LOAA 4YG3A 2V5YA 3N7LA 5DUUA 1UCXA 4WV8A 5BXXA 1LOCA 1O4TA 4GH4A 1R1A2 2JE7A 1WLWA 4KG8A 4M3CA 1XU1A 1BEV2 2NP0A 2KA3A 1REEA 1PZ7A 4XF1A 2H6BA 5T54A 3B02A 2XBO3 1RC6A 1BVP1 4U36A 4YM0A 1LHUA 4PDWA 2XBO1 2BWAA 3TN92 2WSVA 5BNPA 5CBLA 4XF0A 4TWTA 1DF0A 4AVAA 5DZEA 2BW8A 4A2UA 2I2SA 3R4DB 1QDOA 3ZYGA 3B3QE 3O12A 1KJRA 2H0BA 4M00A 2ARXA 4FAHA 3JQWA 1BBT3 1AR92 4W6XA 1BBT1 1RHI1 3HD8B 5C4WB 1W0OA 4QGNA 4J1XA 5K9YA 3M3OA 5IK8A 1URXA 3VL8A 3JD72 2G4IA 2XJRA 2IXHA 1RUJ2 3WP3A 4INDA 4LBQD 1AR72 2HEVF 1TMF3 1C5HA 3ALQA 4GWMA 4FPGA 2VQ0A 4LHNA 2VPVA 1WBFA 2XVLA 1TMF1 2EXHA 3WHUA 4EWAA 1MQTA 4XYXA 3A4UA 1JH5A 1NA1B 3AMNA 4K1ZA 1ZVFA 1O3TA 4DXZA 4QXKA 2PAKA 1AYN2 4ASMB 2BTVC 1PIV2 3INAA 4S2DA 3JB8A 3J4UH 3EXUA 3JCIA 1YJLA 3MDPA 3T2TA 1KDMA 4Q1RA 5CFCA 1FOD2 4ITCA 1RINA 1SLCA 3VBOA 4CDXA 4UXAA 1U5YA 5F6KA 2RR12 4Q8KA 4KWKA 1TME2 1AR83 4FOQA 4IL7A 3VLBB 5A3MA 1O3SA 2B7YA 1AR81 2BEOA 4FOVA 4AK3A 3JB4C 1Y3TA 1BQPA 4GMP3 4YVWC 1D4M2 1LOBA 4WVVA 2WKKA 3SITA 1CAXA 4GMP1 4AHYA 3WHTA 2WT2A 2R062 1A78A 3C3VA 3CLPA 5BPXA 1QDCA 2K9ZA 3AMHA 1B09A 1RMU1 1RGSA 1PGW2 2PHUA 3ZXEA 5JSRA 4Y20B 1QMJA 1SLTA 1RJ7A 2ZACA 3B94A 3E6CC 1ZM1A 4HVRA 4XJ9A 3WY6A 1ULEA 1UPIA 5EZWA 3TNQA 5LRSA 1MS5A 2R043 4AI0A 1PGL1 2WT1A 1V6OA 4FPKA 1XE7A 5EYYA 4K20A 1WLDA 1GNHA 2VVDA 2ZX0A 2R041 1Q56A 1S0DA 2XG3A 4QGMA 4XFCA 1SLIA 4FPJA 4K3UA 1S2BA 4EN0A 4JGZC 3MW4A 5KWRA 1EPWA 2A6XA 2RE9A 3TAYA 4XF3A 3J9SA 5SV8A 5DG2A 2VULA 1XNCA 4XFHA 4WVWA 5FMOL 1CAWA 1NG0A 1MR5A 3G7DA 4FT8A 5FTTC 2GNBA 2UWCA 1NZCA 2ATFA 1A6CA 3FZ3A 2MPFA 1OMIA 4RQPA 2ZPXA 4ZKTB 1IS4A 5FPXA 1WA4A 2DTYA 3B9IA 1NXMA 4YGDA 4M3CE 1UX6A 2CWMA 2BBVA 1IS6A 2AZ5A 4A7ZA 4IEOA 2XWJB 1PO13 5ABJA 5FOJB 2DFBA 3AJYA 3CJIB 1FNYA 4PLOA 3OYWA 1OHFA 1DYPA 1EAH3 2ENRA 2P17A 3ELNA 2TUNA 3S30A 2JENA 3I59A 3AX4A 1EAH1 1SBDA 4AEDA 3AP7A 4QGLA 4NWWA 4AWDA 5FO8B 5GLVA 2UWAA 1CX4A 3CJXA 3ZFFB 4KQ7A 4JC1A 4Y1UA 5HCAA 4Q4V1 4U2AA 2YC0A 2YMZA 1RUG3 4FPHA 3VV1A 2GC1A 2JJ6A 2MEV1 1RUG1 2DTWA 3ZFFC 3WQ1A 1VBB3 5DUXA 3SH4A 4LTAA 2ZKNA 1VBB1 2LTNA 1FT9A 2B45X 3I7DA 5K8SA 2YUEA 3IMNA 4I0BA 4LUKA 3ZPYA 1S0JA 1QF3A 5DUWA 4AE2A 4I30A 1S0BA 2WLQA 3WDYA 1FMD3 5EFUA 3MW3A 4PIXA 3ZSJA 1VBC2 1HV1A 2GNTA 3KQRA 1FMD1 2E7QA 3AKSA 4B7KA 2HWC2 3MFCA 5FQ0B 2P3JA 4BHPA 5TSWA 4YARA 1B35B 1C8NA 3SMHA 1BK1A 1S0GA 2IFRA 4F3JA 3D5OA 2JG8B 4N90A 3SHRA 2PELA 2VNGA 3S6PA 2R32A 4WM8B 5C4WA 4AI3A 3WDTA 2C5DA 5KHIA 5H9PA 1I3HA 1DYKA 1ZZ8A 2OA2A 4MZUA 2VOVA 4COYA 2ZABA 3SNMA 2DU0A 1B35C 4Z2WA 1U12A 1G9FA 5JOYA 4FPLA 1EV13 2BFUL 3AKRA 4MGYE 2BNNA 5JPMB 1ZZ6A 5KHJA 1I5ZA 1EV11 4K40A 1OLRA 2W0XA 1UU6A 1Q8OA 2IFWA 3NVCA 4LE3A 4D7TA 1GANA 1NA1A 3NL1A 2FMYA 1IZ3A 2X29A 3LCPA 1MZ5A 3P3PA 4JTNA 4DY5A 3WLUA 1V00A 3ZXKA 3VKFC 1VBA1 5BNNC 3DPRA 3NAPC 1ENXA 4HLTA 3ES1A 1W6NB 3LSEA 2Y26A 2HWE2 2D6NA 4HKLA 4L11A 2D5FA 2VOXA 1F5JA 5GALA 4IXLA 3MICA 2RR13 4YNIA 1TME3 2DCTA 2PHDA 4QT6A 3U4XA 1MZEA 2R072 4KU7A 3CU7A 4X8NA 1OI6A 4AQSA 1U5ZA 4HPKB 1LGCA 1A8DA 3QH7A 4EN9B 2W39A 1RUH3 2TNFA 1N3PA 1RIRA 1ZX5A 1AXYA 1RUH1 4OI4A 4KU8A 2EVXA 3ZSLA 1YO8A 4RL7A 2VH9A 1UD1A 2IXCA 5FREA 4MH0E 4Y20A 3ROUA 5DZFA 4PBOA 1QQP1 4F83A 3GZAA 3MPBA 4AYUA 1ZZ9A 2NMNA 2XWBB 4AVCA 3H0OA 3LSDA 4IV1B 2Q4SA 2PLV2 5CFDB 3U07A 1XQNA 4YG6A 3A0KA 4I3PA 1VAKA 4I3GA 4RR3B 2CGOA 3AXEA 4AG4A 2EXJA 4LBMA 3IDCB 4COVA 3FLRA 1PMIA 3D82A 4CTEA 4LO6B 1PK6C 5CFDC 1SCRA 4IEZA 1RB8G 3VZJA 3ZX7A 3KZ4C 4CDQB 1XE8A 1VAVA 3HAGA 5EXOA 4RR3C 1OLQA 4J1WA 2Y0IA 2XUMA 4H55A 5KXEA 3IBMA 3WUCA 3GNEA 5K0UB 4CDWB 3WD5A 2WS92 5K7PA 1APNA 4L92A 1W6QB 1YCIA 4DQAA 1O5UA 4CDQC 4Q4W2 4P9YA 2R6QA 3ZMNA 1GQHA 1R093 5HXVA 5AC92 3CJIA 1GQGA 1O3RA 3VL9A 1UN1A 4YW5A 5K0UC 1R091 4CEYC 2D98A 2FBEA 5T52A 3E5XA 3H3ZA 1DQ4A 1YIPA 1HXS3 4MXVA 2XKOA 3LAGA 3SXWA 4IEWA 4JRAA 2CL2A 2WNUB 3GALA 4EN8B 1HXS1 5I8TA 1AJOA 5FOBB 1UF2C 4XZPA 2BNOA 3GBFA 4X8PA 4AQ6A 4FOYA 2ZGKA 3MLLA 5D8AC 2ZCWA 3AZYA 4LBNA 1YIFA 2VMHA 3T1MA 1GBGA 5KBFA 1RUD3 2HWF2 2WNUC 1XU2A 4R9AA 4C90A 4FTSA 1RUD1 1ZBE2 4BIOA 1HQNA 3K51A 3W59A 4ORFA 4G4FA 4NR1A 1AXZA 5E88A 4A7KA 5CU1A 3VKOA 1MVQA 5GZGA 1RVF2 3HQXA 1A3KA 4EROA 2ZX2A 4B29A 5KC5A 4WZFA 1Z78A 1W6OB 1XRUA 4P9XA 1GZWB 3DV8A 3CO2A 1X8MA 4MXWB 4JDNA 2VUJA 1LB2A 4YM3A 4N43B 1G9DA 1ZBA2 1CONA 1Q8SA 3CF6E 3UKTA 4YLZA 1H0BA 3RI8A 3M70A 2IZWA 3FLPA 1ND2C 3MIGA 3ILRA 3OGJA 4OVEA 2WZR3 3M4FA 3PVOA 3ZXLA 4CDUB 2JG8A 2RHPA 2WZR1 4WM8A 3MLKA 1J59A 4P9LA 5JIAA 2G9GA 1BZWA 1QNWA 3V0BB 1CIWA 1CJDA 4LNVA 5JOXA 2A3XA 1G8WA 1BMV2 4CDUC 4YGEA 4Y24A 4H7MA 3FFZA 1LTEA 4MVTA 1SBFA 3D4KA 1H8TC 1ZREA 4YM1A 3K48A 4EN7B 4Q0SA 3GBGA 4LO4B 5EJ3A 5L36A 5I0TA 2W68A 3PNAA 1GZCA 1LJ7A 1X33A 2WWSA 2AYHA 2UY9A 4KGQA 2XGXA 3GBWA 1Q3EA 4W6WA 5DDJ2 4O9EA 4C91A 1CPMA 1SLAA 1EYBA 3AZXA 1IKQA 5HCBA 4FTEA 1VBD3 5JR7B 2PHRA 3AP5A 1KFUL 4RS5B 1VBD1 3VN4A 4UW4A 1ZRDA 1ENQA 3TRSB 4HPKA 1WMEA 3JU9A 2ZGLA 2CV6A 1CAVB 1QNYA 1WUVA 1CGPA 3E5QA 4RS5C 3VBSB 5T5OA 3VZNA 5B2GB 5IK7A 4XJWA 1GKBA 5A33B 2ZHLA 2D97A 3THTA 3WP6A 5E1RA 4E4SA 4ZU7A 1OQEA 2ET7A 5C9AB 1UU4A 3WCRA 1V6NA 4QPIB 5DZGA 2A7AA 4LE4A 2IXJA 1RMU2 2SLIA 3FJSA 4FXGB 1RUE2 4XBLA 3LA7A 2BPA2 1ZYBA 4IV1A 4RGGA 1MEC3 3DUIA 3I4IA 4Z82A 3V64A 5CFDA 1VB4A 4L8QA 4BA6A 3RI9A 1QJZA 4IEPA 1MEC1 4QPIC 1RUF3 4XJZA 4FSJA 4CEWB 1POV0 4WZCA 1RUF1 2XJPA 2EXKA 5C8CC 3R4SA 2D40A 4R52A 3WCSA 4M01A 3VKMA 1AR63 1ND3A 4I0AA 2CGNA 4ISQA 1S0EA 1I9RA 1FPN3 3NKTA 4E9KA 4CDQA 3DKWA 1AR61 1NCRC 4AEMA 1RTVA 2D3PA 2PHFA 1FPN1 2EF6A 4NHKA 1HQLA 2DVDA 3ST7A 2B39A 5JSPA 4MGKE 3CL1A 3H1YA 5K0UA 3VBRA 4CDWA 1QJX1 4UBGA 1QJY3 1W6QA 4FPYA 3WVJA 2HWB2 1QJY1 3FC0A 4PLNA 1V6JA 3LA2A 4RHV1 1OQ1A 4RSUA 4Q0QA 3VKLA 1EPZA 1HW5A 1FAYA 4HSJA 2IXKA 3WDUA 4HKOA 3S7IA 1KXGA 2P37A 4EWEA 3GZTB 4AVTA 2DCZA 1O91A 3PLQA 4B4RA 3FWEA 2WNUA 1KS5A 2WJSA 1AUYA 2PHTA 3IKWA 4L99A 1LOGA 2R49A 4HT1T 3TOJA 4ATFA 4DB5A 1DU3D 2WFPA 4XETA 4XTPA 3ZO0B 1UZZA 1Y7BA 2EXIA 3BIWE 2E7AA 1GZ9A 2YPJA 1HKDA 4BOWA 1BXHA 4LT5A 1DZQA 2X5IA 1UKRA 2D6PA 3TBDA 3J8F2 4JDOA 1VIWB 3IPVA 4JGYB 2B5HA 2FZ1A 1U0AA 2JDZA 2MEV2 3UJOA 3M3EA 4GA9A 3RNSA 3EO6A 2G9FA 1UPSA 2A71A 2EAAA 2VVEA 2JEMA 2GNMA 2ZGRA 1HRV3 1QKQA 5JDBA 1GZWA 4JGYC 3HWJA 1HRV1 1YFUA 3WUDA 4D69A 4N43A 4GB32 4DINB 5HCFA 1C1LA 3ZIWA 1C3HA 1JN2P 1VRH3 3MIFA 2XB6C 2ZGUA 4Q4X3 2EA7A 1WD3A 3QH6A 1N1VA 4QPYA 1VRH1 1H9PA 2VVFA 1H1MA 4Q4X1 4CDUA 4BZ4A 2BQPA 4YW3A 3KT7A 1KS4A 2JXAA 5JCTA 3EBRA 4P9GA 1DIWA 3RRDA 3V0BA 4Y1ZA 3KM5A 3ZXJA 4UBHA 2PAMA 1OOPB 1CN1A 2BVBA 4EJRA 2P3KA 4Q29A 4K8FA 4LEJA 4EV0A 2GSYA 1RUI3 4H14A 2A5ZA 1YHFA 2CGPA 4FPOB 2PHWA 5FMOS 1OOPC 1RUI1 4RFT0 4PLMA 1OPMA 4V1PA 5KHHA 1LU2A 2UY8A 2VW1A 3AZZA 2ZGTA 4P9IA 2IXIA 3MIHA 4YVWB 2E63A 4AGRA 3D8CA 3WG4A 3WX5A 1IS5A 4LA3A 3N7MA 5DDJ3 4XILA 2ERFA 2XJUA 4ZU5A 1PZ9A 1OFNA 1R082 1LOFA 4QQHA 1PNGA 1C8M2 1UIKA 4Q1PA 4XIKA 1X50A 2P3IA 3WZ1A 2Q8OA 2AUYA 3VBHC 4WVMB 2QVSB 3HBZA 3D6EA 3OBRA 5BNOB 1CAVA 2DUQA 2PTMA 1D2QA 4BMEA 1G9CA 1AL22 3VBSA 2H6CA 5FLJA 3VBFC 5KXBA 4Q26A 5A33A 4OUMA 1ULGA 3FBMA 1D4VB 3AM2A 4AFDA 4JGZB 1HLCA 5C9AA 5BNOC 1FX5A 4URTA 4XDQA 2NLRA 1QJU3 5EV7A 1GSLA 4GWNA 1DG6A 1JW6A 1IGOA 1BVVA 4KL1A 5DUVA 4Y26A 1M4WA 2GMEA 4CYDA 3VZMA 5FO7B 2ARBA 1QQP2 1ENRA 1X8EA 3H1WA 4Y1VA 1D0HA 2DF7A 2VNRA 2XL9A 1N1SA 3E5UA 2IXLA 4N7IA 4CEWA 1COV3 1HRI3 3ZSKA 3H7JA 1PVC2 2DVBA 1COV1 1HRI1 4Q0UA 4S2FA 1NLSA 1XYNA 3JZVA 4QMAA 1ASJ2 4COWA 4GULA 4UW5A 2D6KA 1LULA 4DS0A 4IEUA 1Z7S3 5C33A 5BV6A 3R0RA 2RMU3 2TBVA 3HR9A 1Z7S1 2RS53 3UK9A 4FCAA 1MS8A 2RMU1 1PZ8A 2DVAA 2ZOEB 2RS51 1DQ6A 4YGBA 3MFAA 1K5MC 1WMFA 1O7FA 4M0HA 3FUQA 4RA0A 1WLCA 1S0IA 4IERA 1PO11 3MI8A 4AEJA 4XBNA 1VLNA 2O8QA 2ZGMA 4KNCA 4C1XA 1Q43A 1GYKA 4XHBA 1J1TA 3FLTA 3ZFGB 1VB2A 2GN3A 1NLRA 3DL3A 3OJBA 1JBCA 3H7YA 2RM22 1BYHA 1IPJA 1GFF2 4BLIA 2CWSA 1FV2A 1W6MB 3FX3A 4XOGA 1IOAA 2WL1A 4YZ2A 2RS32 1WW7A 1LGBA 3WT3A 2ZX4A 3ZFGC 1R1A3 1PO22 1F2NA 1M06G 1F8VA 2Q1MA 2XJSA 1NY72 1FNZA 5IUQA 1DBNA 1BEV3 2ZX1A 1R1A1 2C0ZA 2UWBA 2A6WA 1F5FA 1BEV1 1YI9A 2A3WA 4JGYA 1J1LA 1YI7A 2Y0OA 3MF6A 3W58A 1IQAA 3VGIA 2BWCA 5JI7A 4PBPA 3WINE 4LBQB 3TN93 4QQPA 2JD4A 1LEDA 4AI8A 2B42B 3TN91 1BKZA 2NQYA 4DNYA 4OFGA 4K6BA 1D2SA 2NM1A 5ACA2 4BLJA 2UU8A 4K21A 3JBG2 1LENA 1WGPA 4YVSB 2VXRA 4FQZA 1LHOA 5IT6A 4OHYA 1C1FA 1AR93 5FLIA 3VBUC 1V6IA 4I09A 3B69A 2HEWF 3GF6A 1AR91 4YRDA 1WCSA 1VBE2 4LO7A 3JD73 5GJ6A 5JLVA 4YVSC 1RUJ3 4TSVA 1OOPA 4AVSA 1NQDA 2FQPA 3JD71 1LHVA 3ZYIB 1AR73 5BNNB 3NAPB 3EJKA 5CB7A 3IDEA 4G9SB 4AI1A 2RS12 3VHOA 1AR71 2N7GA 1DGWX 5F5QA 4IV3B 2EIGA 2GMMA 5KXCA 4L97A 1AYN3 3LGRA 2ZHKA 3ENRA 4IEVA 1G86A 4JCKA 3NV4A 1PIV3 1AYN1 1EP0A 4I01A 2I74A 4HANA 2B46X 4YVWA 3AB0A 1SACA 4XHXA 1PIV1 4DFSA 1WBLA 2QDRA 1FOD3 4QQLA 3NV3A 4EN6B 1ALYA 2PHLA 4YGCA 4IV3C 4XXPA 1QOTA 1RUC2 4P5HA 3CNAA 1FOD1 4MX3A 4PCRA 2Z79A 2GDFA 4TZDA 2RR11 3ATGA 2XPJA 1TME1 1C8M3 1E57A 3D0JA 3AMQA 4IQPA 3ECQA 1D4M3 4BYYA 1ULFA 2DFCA 3NV1A 1Q8QA 4WVMA 1D4M1 4Q4Y2 1UKGA 2UURA 2R063 2GU9A 5JOZA 3M1HA 4XMIA 4BH9A 2R061 2MNGA 3HN1A 3LZZA 5T55A 2YGMA 4AFCA 1OSGA 4JGZA 4N53B 1PGW1 3MIEA 4C0BA 1OA3A 3ZXGA 1PNFA 2D43A 1V6MA 2WA3A 2GALA 2WNVB 4YYOA 5T5JA 3FBYA 1F31A 1PK6B 5H9QA 4LHKA 1KD7A 3KS7A 1WW4A 4N53C 4HVOA 1J3RA 2PQQA 2EAKA 2X53S 5I93A 2ZJCA 5KXDA 2GC2A 2WNVC 1LESA 3IDBB 3H8UA 2GAUA 2WQZC 1HX6A