3WG3A

Crystal structure of agrocybe cylindracea galectin with blood type a antigen tetraose
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
163
structure length
163
Chain Sequence
KHMTTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational change of a unique sequence in a fungal galectin from Agrocybe cylindracea controls glycan ligand-binding specificity.
pubmed doi rcsb
source organism Agrocybe cylindracea
molecule tags Sugar binding protein
molecule keywords Galactoside-binding lectin
total genus 40
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wg3A00
1KRIA 4YM2A 3WDVA 3MW2A 4ZKTB 3VKNA 3AZXA 1AZDA 3FLRA 3QCWA 1IS5A 2WSVA 3AZYA 1N1YA 3BTAA 2ZGPA 1G9CA 3N7JA 4YM1A 3B69A 3N7LA 1I3HA 1GBGA 1OFSA 3AYCA 1JW6A 3IN9A 1BQPA 3ILNA 1CR7A 1YI7A 3ZSKA 1AJKA 2ZGMA 4YW4A 1ONAA 3A0KA 1LGCA 2A5ZA 1WD3A 4FPFA 3ZXLA 2GMMA 1S0GA 2VU9A 3WLUA 2CTVA 4FOYA 3T1LA 5GZFA 1C4RA 1UZYA 5JOWA 2XG3A 1YRZA 2DVAA 4ASMB 1MZ5A 3WG1A 4WVWA 2ZMLA 3POWA 2D3PA 1GZWB 2AR6A 5DXDA 3D6EA 4SLIA 2ZAAA 3LSDA 4DRVA 1WBLA 1AX2A 1N3PA 1DLLA 1W0OA 2EXIA 4PF5A 4Q27A 4R9AA 5GJ6A 4FPHA 1S0CA 3AJZA 4XE9A 2NM1A 4Y26A 5IT6A 2DU1A 2D3RA 4NO4A 1FAYA 2KM2A 1QDOA 4GKXA 2DVDA 4L8QA 4LBOA 1C1FA 4FPKA 3AXDA 4GWMA 3V0AB 2DVGA 1ZA4A 3RQ0A 3VUOA 2P34A 3OPZA 1GLHA 1ULEA 3B3QE 2A6ZA 1Q8SA 1V6LA 2E53A 1W6PA 4K1ZA 2JJ6A 4DS0A 4YGDA 1PZ9A 1LOFC 2A6WA 4FPEA 3T2TA 4K20A 1QU0A 1FATA 3N3HA 1PZ8A 3V65A 4XTPA 2EXHA 1CQ9A 4FOVA 1SLTA 4Y1UA 4JCKA 1IKQA 1F9KA 1MS8A 1SCRA 4WZFA 3ZYRA 2GDFA 1LENA 3TB0A 1WLCA 1SLAA 4YW5A 4K21A 4LBKA 1VLNA 2A6XA 2ENRA 1OQ1A 2DURA 4U36A 4Q8LA 1V6OA 2LALA 3AYEA 5CB7A 2ZGOA 1ULFA 3FLPA 1F5FA 3GALA 4Y22B 4YFWA 1S0EA 1ULCA 2D6PA 3KM5A 3O0XA 1IS6A 3DUIA 4GXLA 2JE9A 2SBAA 3SITA 1FYUA 1G86A 3O5SA 1QGLA 4YG3A 4K1YA 3WOGA 1IKPA 4CTEA 3O12A 3RSJA 4BLIA 5GLZA 5JOXA 1GNZA 1Z0HA 1HLCA 5JOYA 3AZZA 1YIFA 4AGGA 2AGSA 3C2UA 4YZ3A 2PHUA 4C1XA 2ZGNA 4FOQA 3B00A 1PZ7A 3RG0A 3I8TA 4XZPA 2NMOA 3PVNA 4U2AA 2GNMA 1BKZA 1CPNA 5T55A 4Y24A 1UX6A 4ZXKA 1QMJA 4FPLA 5IK5A 1DIWA 3I4IA 3M2MA 3AK0A 2PHXA 1DGLA 3HMYA 2ZGRA 1MR5A 4ITCA 5H9RA 5JDBA 3PJQA 1FV2A 2A7AA 2OUHA 4R9DA 1WLWA 5EWSA 5F5QA 3WUDA 1V6JA 3PVOA 4YGBA 5IUQA 1LGNA 1JYCA 3R4UA 5L73A 5BYNA 4UW3A 1H9PA 2XB6C 3AXEA 1JN2P 3WHTA 1URXA 2VH9A 3WV6A 1JBCA 4XHXA 5DZGA 5F9TA 2D6LX 3MW3A 1VALA 2C5DA 1VIWB 2Q5TA 2YY1A 5CAZA 2W68A 4IQPA 1UPSA 1AXKA 2G4IA 3FUOA 1WW4A 2DVFA 2UURA 2AUYA 2VY0A 5EYXA 1S0IA 3MW4A 2CYFA 3PMEA 3Q9OA 2D44A 1W6NA 3ILFA 2DTYA 3DGTA 1BYHA 1H30A 1GV9A 5JVVA 5T5PA 1LJ7A 2ZMNA 4LBJA 2WT0A 2R1DA 3AFKA 2A6VA 1LEMA 1GKBA 4TZDA 1AF9A 4XBNA 2P3JA 1D0HA 4W65A 4Y1XA 3ZYPA 1KITA 4XIOA 3R4SA 2DVBA 4LBQA 1RINA 5T52A 4LBLA 4XDQA 1F31A 2YXSA 1SBDA 1W6MA 5HCBA 4Y1YA 3UK9A 3USUB 4Y1VA 3WDXA 3WDYA 1VAVA 4Q1PA 1A3KA 4WVVA 1W6PB 3AZWA 3V0BA 2GNDA 3ILRA 4XBQA 1BJQA 5H9SA 3ZXJA 4LBMA 1QNYA 3OYWA 3ZSMA 1LESA 3VV1A 2P2KA 1ENRA 1Q8VA 4ATEA 1B09A 2CWSA 3WZ1A 2ZKNA 2D43A 3SISA 2DYCA 3ZVXA 1JYIA 1AXZA 1JHNA 5T5JA 3SH5A 4BQ1A 1FNYA 3IPVB 3RRDA 3VKMA 1Z78A 2V5YA 1W6MB 1N3QA 2R0HA 4LBNA 1U0AA 4YW3A 4MYEA 3RMYA 2OW4A 2ZGTA 3R05A 2AYHA 1S0DA 2ZHKA 4JC1A 3U4XA 2JE7A 3MPPG 2ZZJA 5GLTA 3PVEA 3HR9A 1SCSA 1DQ2A 1UAIA 1JXNA 3FUQA 1V6NA 1MACA 1RITA 2ZABA 4YZ5A 1MVEA 3H0OA 3OY8A 1V6IA 3WNXA 3W59A 1CVNA 4Z8BA 1ENSA 4XTMA 3M1HA 3FBYA 5DZFA 1W6NB 4YFZA 5JOZA 4XMIA 2DU0A 1WD4A 1WUVA 1DZQA 2CY6A 2ZBJA 3CNAA 4YG0A 4BOWA 2C9AA 4XJAA 1Y7BA 1RIRA 2B7YA 1XQNA 1LOEA 4GWNA 1WCSA 3WCRA 4F83A 1YYNA 3D5OA 4CZSA 2HYKA 1LCLA 1LU2A 3O0VA 3AP4A 3T1MA 3AP9A 5JLVA 1A8DA 2OVUA 3N7MA 1LHVA 3HN1A 1DQ6A 4YLZA 1G7YA 5IK4A 1N3OA 4FPGA 2H0BA 3V0BB 1OKQA 5GLUA 3IKWA 4C1WA 5JMCA 4FQZA 2PELA 1DYKA 2ZA9A 3AZVA 5SV8A 2CWMA 2NN8A 3VKOA 5KXDA 4YZ1A 4LBQD 5DUWA 5KXCA 2EXKA 2JECA 2YZ4A 1H9WA 1QF3A 2A3YA 1N1VA 2D7FA 3ATGA 1W6OB 2D3SA 3QLQA 2TEPA 1MZ6A 2ZHLA 1JOJA 4AVVA 4XXPA 3OY8B 4M3CF 1LHNA 4AGRA 1ULDA 1LHWA 1KQRA 2ES3A 1GANA 3ENRA 5FRAA 2E7QA 2GN3A 4RL7A 1DQ5A 4Y22A 3ZXKA 2I2SA 3SNMA 3MEPA 2WNEA 2JKBA 2ZMKA 3A0NA 3ZPYA 4XHBA 3ZXEA 3B01A 1HQLA 5T5LA 4FQ4A 4GALA 1GSLA 4FPYA 4UW6A 5GZEA 1O4YA 2D6MA 1O4ZA 2GMEA 3TAYA 2W39A 5DUUA 1LULA 2NYYA 5DZEA 1KJRA 4AVSA 1QKQA 5CBLA 3WDWA 1WBFA 1ENQA 3ASIA 2PHRA 4XXAA 4P9YA 2WSUA 2ZGUA 4BMBA 3OYWB 4YW2A 1LODA 1Q8OA 4Y20B 4XJ8A 4BPZA 1W6QA 1Q56A 1CJPA 1DQ4A 1S0JA 5DUVA 4M3CA 1DQ0A 3NV1A 3SH4A 3APBA 2DUPA 2AREA 3N7KA 2EAKA 1APNA 3WG4A 1ZM1A 4GKYA 4M3CB 1SLIA 3N35A 2UU8A 1W0PA 2PHTA 2YROA 3NV2A 4Y20A 5KXBA 3W58A 3BODA 4DFSA 1LU1A 2EALA 2AENA 2P37A 4FP3A 1YO8A 2GMPA 1SBFA 2VW0A 4YM0A 1KDMA 1AXYA 2DV9A 1CPMA 2FMDA 4YGEA 1LOBA 3NV4A 1FV3A 1UL9A 1D2SA 1MS1A 5EXOA 3SLIA 2D6KA 1V00A 1QOOA 1I1EA 2GN7A 2SLIA 1GZCA 1MS4A 1SBEA 4RA0A 2ZGKA 1HQWA 3OJBA 5GLVA 4XILA 1KJLA 4CRQA 2WKKA 4BMEA 1HDKA 1IS3A 3JUUA 1G9AA 1LOFA 3V64A 3ZSLA 4LBQB 5T5OA 4AWDA 3LSEA 4P9XA 1V6MA 1C1LA 2DWRA 2VW2A 2NP0A 1BXHA 1CN1A 2VUAA 2WT2A 2W08A 2R0FA 2ZACA 2R49A 4M00A 1S0BA 4WV8A 4ATFA 1SFYA 1LTEA 3ZSJA 3OBRA 4FOWA 1A78A 4ISQA 2PHFA 3WDTA 4Y1ZA 3RMXA 1UN1A 5HCAA 4H55A 4R9CA 2DTWA 4XJ9A 1GICA 2ZGLA 5IK8A 1DYPA 1S1AA 3AYDA 1C57A 2EIGA 4D69A 2A75A 5GZDA 3WHUA 2A3WA 1G9DA 2WJSA 1GNHA 4XYXA 4DQAA 4HL0A 4JRAA 3OGGA 5GLWA 1G9FA 4DRRA 1AX0A 5H9PA 2UWCA 1VAMA 2E51A 4HANA 3AP5A 4PBPA 4XBLA 5AVAA 4AVTA 2GALA 1MS9A 4YM3A 3UJQA 2WLQA 1GZWA 1AX1A 1UKGA 1YXWA 3USUA 2D6NA 4AYUA 5DG1A 3WCSA 1IOAA 2RHPA 1SLLA 4ISRA 2ZGSA 3RS6A 1LHUA 4YG6A 3VKLA 1ULGA 1MVQA 2A3XA 5GZGA 2CNAA 1WLDA 2R16A 1G8WA 3POYA 1KDKA 2FHRA 2ARXA 2VW1A 4FP2A 4DPNA 1TEIA 2WQZC 4XJWA 4BLJA 1MS0A 3OBTA 2UWBA 5H9QA 3AP7A 2V73A 2DUQA 1S0FA 3WUCA 3UJOA 3FLTA 1LOAA 2W52A 1WW6A 1G9BA 2D6OX 4M3CE 2YV8A 5DG2A 1DFQA 3AJYA 2AH2A 2VXRA 1UZZA 1Q8PA 1V6KA 3WG2A 1IS4A 1N47A 3M3OA 3NV3A 2EXJA 3IM0A 3KQRA 4YZ2A 1CONA 1SACA 1WW7A 1LECA 5HCFA 1W6OA 4NOTA 1DQ1A 2EF6A 1SLCA 2CL2A 3FFZA 1DHKB 1WW5A 4XJZA 4XOGA 5CNAA 3INAA 4FPOB 2LTNA 2PHWA 1LEDA 2A70A 3AX4A 2ZHMA 4XJUA 2NZ9A 4OZXA 3M3EA 4YGCA 4R9BA 5KXEA 2P3IA 1LOCA 5T50A 2E6VA 3M3QA 2Z42A 4GA9A 4I30A 1CESA 1N1SA 3BIWE 4Q26A 2R1BA 1CIWA 3V0AA 1LOGA 3O0WA 4AGVA 3ZXFA 4Q2FA 4FPJA 3WG3A 2A71A 3AP6A 1Q8QA 5CA6A 4M01A 1SLBA 1HKDA 2JD4A 1QOSA 2ERFA 1BZWA 4XIKA 1LGBA 5LK5A 1J1TA 4BM8A 3GNEA 4UW4A 4XMAA 1NLSA 2DUOA 5GM0A 2A6YA 3BOPA 1MS5A 2NMNA 4PBOA 4PCRA 1LHOA 1X50A 5IK7A 1DBNA 2UWAA 3A4UA 3JU9A 2OUJA 5E88A 4FPCA 1N1TA 2E7TA 2GNTA 1UMZA 2JDZA 5E8AA 2ZHNA 3SH3A 1NXD1 3WVJA 2GNBA 4P9WA 3WDUA 4Q8KA 4YZ4A 3D4KA 2P3KA 1JUIA 5GALA 5GZCA 4UW5A 1AJOA 5FREA 3AYAA 3UL2A 2ARBA 3N36A 5DUXA 3LCPA 1GZ9A 4TYSA 1AVBA 3VKFC 1FX5A 1MS3A 3IPVA 5E89A 1W6QB 2YMZA 3M3CA 1QDCA 4KBBA 1R1ZA 4YW1A 1QNWA 4FVVA 4P14A 4PQ9A 5T54A 4Q1RA 3IMNA 2BQPA 3B9CA 3POSA 1EPWA 5EYYA 1FNZA 2ZGQA 3L2YA 1GYKA 3NWKA 1QOTA 2WT1A
chains in the Genus database with same CATH superfamily
1QY4A 2HBUA 1KRIA 3URFA 2QBXA 4YM2A 1NT0A 3T0AA 3OB8A 2R042 2JB8A 4ZKTB 4HOOA 4BQWA 1QXJA 4B1LA 2YFUA 3QCWA 2Y6HA 3AZYA 1N1YA 2WFF3 4XF1A 4IE0A 1BVVA 3NRUA 2ZGPA 4IEWA 3K77A 4QT6A 5FYCA 3VBSC 3MDPA 3BCWA 4MV2A 1RB8G 4MGIE 4Q4Y2 1BQPA 1VBA3 2WINB 1U12A 3J8F2 1Y3TA 1CR7A 2E31A 4YW7A 2ZGMA 4YW4A 3TEXA 4Q4W3 5F8PA 2A5ZA 3ETPA 4HPKA 3THPA 2FZ1A 4KH9A 3CZJA 2GMMA 1YQ6A 4XF0A 2WZPP 3ZMNA 3ZN6B 3VBFA 1FPN1 5J37A 2VU9A 3D82A 5JZGA 2CTVA 4GMP1 2HLEA 1BEV3 2CV6A 5FYBA 1L7RA 5FY9A 3E6BA 3MFAA 2WABA 2XG3A 1MZ5A 2VUCA 5JAXA 4WVWA 1QJU3 2AR6A 3VZMA 4QM8A 4SLIA 4AHWA 3LSDA 4AVCA 5D8AC 2TBVA 3HBZA 2G1MA 1N3PA 1W0OA 2BNMA 2EXIA 2VCBA 5C4WA 4BQXA 2QCSB 4W6XA 4HKOA 1VP6A 4Y26A 5C70A 3NJVA 5FLJA 1BHGA 1J3QA 4GWMA 4JX0A 4NIHA 1DU3D 1ZA4A 1UNBA 2L9LA 2H6CA 5E6HA 3AC0A 1UY4A 3MLLA 4LE3A 4GB32 2A6ZA 4K1ZA 5F3EA 1W6PA 1PZ9A 3T2TA 3CJIA 2JB4A 1AYN1 1RUI2 1TE1B 3V65A 5A3UA 3GBFA 4ONUA 4COVA 1BBT3 4BWOA 5CADA 3ABZA 4WZCA 5FPAA 3ZX7A 5AC91 5ACA1 1F9KA 4QKDA 4Z07A 2OX0A 3WINE 4UOJA 3ZYRA 1R083 5LEJA 3NO8A 1RUD1 1LENA 4QX7A 1HN0A 3J26N 1RMU3 1SLAA 1O3TA 1R64A 4K21A 2Y0OA 2Y0IA 1VLNA 2A6XA 4AVBA 4MZUA 1ZBE2 3LWCA 1RUD2 2DURA 2XL7A 4KMQA 4Q8LA 3MHZA 3JBG3 1F15A 4Y22B 2MEV1 1S0EA 1ULCA 2D6PA 4QPWA 3KM5A 5LA1A 5LW9A 5BY5A 2SBAA 1PVC2 1G86A 5FUPA 3O5SA 1PMJX 3ZKUA 4CTEA 1FMD2 3RSJA 4E8DA 1HRV2 2CGNA 4QQLA 1GNZA 4EZ4A 1EPZA 1Z0HA 2HYXA 2VGDA 3AZZA 1POQA 1YIFA 2AGSA 4GH4B 2W1UA 4AGGA 5F39A 4FOQA 1JZ7A 1WCDJ 2JDUA 3IIAA 1CAUA 4Q5OA 1OHFA 1H4HA 1DIWA 3M2MA 3FWEA 2RM23 1NLQA 4ZU7A 2CU5A 2ZGRA 4HSJA 3F2ZA 5FP7A 2ZEWA 1C5HA 3CO2A 3GBWA 3RDIA 4DO0A 3DYOA 2A7AA 3IDBB 1NCRC 4EWEA 3VBOC 3WR0A 1WLWA 1HXS3 3PVOA 4AI8A 1QH6A 4RFRB 1LGNA 4Q4W1 5IUQA 4CCJA 1KFUL 4UW3A 2XB6C 5IVCA 1B35C 3AXEA 4UFKA 3H8XA 2VNOA 2YBSA 4NN0A 1GR3A 1URXA 2VH9A 3N9LA 3WV6A 1NCQB 2WLPA 1ODNA 3Q8BA 2C5DA 3TBDA 3WP5A 1AR71 4CUGA 3SEPA 5KC6A 3BTYA 1V70A 4P5YA 5L7OC 2G4IA 5A7SA 1YUDA 3VD3A 1CIYA 5JXHA 5DQ0A 3MPBA 1S2KA 3LEKA 1VJ2A 3PMEA 4L99A 1X9TA 3IZOA 3GGLA 1W6NA 3ILFA 4IESA 2VOTA 3DGTA 5T5PA 1H30A 1GV9A 4HZFA 4DINB 1XU1A 2ZMNA 3E5XA 2V72A 1GU3A 2XMLA 2OA2A 2R1DA 5I0SA 5AFEA 1BLZA 4FBFA 5FBZA 1AF9A 1D4M2 4HVOA 3LE0A 2DBIA 1O4TA 2YHJA 3TEYA 3ZYPA 5FZ3A 4XIOA 2UY9A 4LBQA 4CEWC 5T52A 2NPIA 1RGSA 2OIIA 1F31A 2YXSA 3MIBA 5HCBA 4F7ZA 4Y1YA 4FFIA 3WDYA 4KGGA 4L0PA 1A34A 1A3KA 4EZHA 1W6PB 2F17A 2RS32 3U1XA 3ME2A 1MEC2 1WMXA 3NNGA 1XE7A 1ZZ6A 1QH7A 3VZJA 1C5IA 3ZR5A 1Q8VA 2VXJA 4CU7A 4ATEA 1B09A 1O3QA 3ZIWA 3IIIA 2ZKNA 2ZX4A 2Y6JA 1OQEA 1FNYA 1OC1A 3RRDA 1OMIA 1E5RA 4LO4B 4LXLA 1K5MA 3J4UH 2XJSA 4LBNA 1N3QA 4BXSV 4E2QA 3LF7A 1W9WA 1ULPA 2QQVA 3ZSEA 2PLV2 2YC2A 2OW4A 2ZGTA 3AMPA 2AYHA 2ZHKA 3FJSA 2ZZJA 5GLTA 3PVEA 2WS93 3HR9A 4JGYA 1SCSA 4NAOA 4EN9B 5FY5A 3RWNA 4CDUB 5IFTA 4QHOA 1XRUA 4YZ5A 4CEWA 4EV0A 3W59A 1PO12 2JG9B 5FPZA 1ENSA 4YARA 3CKHA 3DPRA 1OF3A 4OLLA 1OD3A 1H1MA 3H50A 2ZJCA 4PJYA 4OI4A 3VBHA 2HWE1 1IG3A 3CNAA 3J7MA 4XUNA 3UKVA 2C9AA 1NUKA 1O5UA 2BTVC 1RIRA 5FK7A 3S5QA 1O8PA 2B7YA 1AL23 4XDPA 1WCSA 3BPSA 3LEGA 5FAXA 3WCRA 1D4M3 3HQRA 5D8AA 3OSDA 4XACA 1ZRIA 1LU2A 1ZRRA 3OEBA 3AP4A 2FDKA 5FQ0A 1A8DA 2JWPA 3HT1A 3N7MA 4PDWA 4TN7A 5IWFA 1G7YA 4KG0A 3T08A 1FMD1 2VECA 4FPGA 3V0BB 1W8FA 1KFXL 1RUF1 5JZGC 1MZFA 4QHBA 4LA2A 1NYWA 2PELA 3P3PA 5FZ8A 4AQ2A 4Z2AA 3VKOA 5L7OB 4YZ1A 5DUWA 5KXCA 3V0AA 2EXKA 1O6UA 1QF3A 2ET7A 1WA4A 3C7FA 3FHAA 1XJAA 2VNVA 2W1QA 4M3CF 4XPVA 2D5FA 3PUAA 4E4DX 1D0GA 3HWJA 1GANA 3ENRA 4OHWA 2B46X 1YFUA 5FRAA 2WC2A 1AR92 2W2IA 4OUEA 4Y22A 3VBRA 3TWIA 1HXS2 2QDNA 2ZMKA 3KCYA 5EP9A 4CCDA 5LA0A 3RZJA 4RHV3 5T5LA 4HONA 1GSLA 4FPYA 2FDFA 1ND3A 1Y4WA 3T4HB 2WNOA 2ZOEB 4QKFA 3TAYA 5DUUA 1KJRA 4PDWB 2FBEA 2KR2A 3SQOA 5CBLA 3NNJA 3WNLA 1ENQA 2BWCA 1GWKA 4Z82A 3FC0A 2ZGUA 4BMBA 2GP5A 4YW2A 4LKFA 5FZFA 3H1WA 5E16A 5BNOA 2RS52 3NV1A 2DUPA 3N7KA 2EAKA 3GZTB 1AR83 3MUZ1 3HBKA 1SLIA 3JB4C 2WN3A 5FZBA 2UY8A 1BEV1 4Y20A 2PHDA 5KXBA 3W58A 2KA3A 4ZS3A 1FOD2 2EALA 3AM2A 4MGKE 2AENA 1YO8A 4B1MA 3I59B 3MF9A 2RMU2 3PNAA 5C9AC 2B8MA 1UL9A 3PL0A 1F8VA 2P6CA 1D2SA 1NCQC 1MS1A 5EXOA 4ZXEA 3SLIA 2VOVA 5G04L 5C9AB 2ZGKA 4NE9A 4PIZA 4QKNA 3OJBA 5KBFA 4RN5A 1COV2 3ZPOA 3PVBB 1KJLA 5LK7B 4OHZA 1UKRA 1NCRB 3ZSLA 4LBQB 4A3ZA 1U5ZA 2LROA 3ZN6A 2YDEA 4UAPA 5JUVA 1RC6A 4N9HA 1QJEA 3LSEA 4H7MA 1A8MA 3R4DB 2LW8A 2VW2A 2Q4SA 3E5UA 2ZACA 4M00A 4E9KA 1SFYA 2PHFA 3KHCA 5C4WC 4IE7A 1UN1A 4XF3A 3KVAA 5BUVA 4BDVB 4R9CA 5FYYA 4HG6B 4CEYB 2PLV3 1REDA 2ZGLA 3OTFA 1OH4A 3SXWA 1AR63 4LULA 1C57A 3P5BA 2EIGA 4ZZ5A 1RXFA 1Q43A 2W87A 4LHSA 3KF3A 1YQ2A 4G3YC 2TNFA 1NKGA 1G9DA 3U0ZA 2IFWA 1GNHA 1ZRFA 3LA7A 4AXOA 4DQAA 5GLWA 3PLQA 2WUHA 2XPJA 1VAMA 4XBLA 1PO11 4AVTA 2JDYA 5AVAA 2GALA 1MS9A 3UJQA 4WM7B 5C8CC 2WZ8A 1OQDA 3I2HA 3WW2A 3VHNA 5C5UA 4W6YA 4IE6A 2D6NA 4AYUA 4JQRA 3THTA 3UESA 1IOAA 1VMJA 1IQAA 1SLLA 4IEYA 3GZAA 3NNLA 5F5CA 2ZGSA 1AR72 1LHUA 3RYKA 3B5LB 2DCJA 3THDA 2YC0A 4FAHA 1OVSA 1XYPA 2A3XA 3LPFA 5GKAC 4OZOA 2R30A 1OUSA 3POYA 1KDKA 5C4WB 4MX3A 4G9SB 2WQZC 4DEVA 2WYSA 1HB2A 5BNOC 2YBKA 1NX9A 3HD8B 4GD4A 1FOD3 4LOTA 3AP7A 5H9QA 2DUQA 1NXMA 3LEIA 2P4EA 3B02A 4XFBA 5AC92 3WUCA 2HWE3 3NJXA 1X82A 3GF6A 3UJOA 3N9MA 2W52A 4CDQA 1G9BA 5FJHA 1LKNA 3ZXAC 5FLHA 5DG2A 1RUJ3 5C71A 3AJYA 2JICA 3MIHA 1UZZA 2VNGA 5ABJC 4F3JA 3WG2A 1IS4A 4Q29A 4HKWA 4LLOA 5FZIA 3RZLA 1LECA 1AR81 2VUJA 4E4SA 1DQ1A 1ODMA 3O1PA 1XSRA 4RGKA 1WW5A 5CFCB 4OQ8A 4XOGA 1OH3A 2IUWA 3INAA 4FPOB 2D40A 2A70A 2ZX0A 1XNBA 4WM8A 2Y26A 4XJUA 3M3EA 2DF7A 4R9BA 3BN6A 3WSOA 4AFMA 1SG3A 5LY1A 1LOCA 2YFZA 3M7AA 4RYDA 3I7DA 5A7PA 1P8JA 3BUCA 2Q30A 4OHVA 2WR9A 3WF0A 1WA6X 1H6XA 5FWEA 4BIFA 3C7EA 1H1IA 1MQTC 4GULA 1R091 3BGAA 4Q2FA 5FJKA 4AI2A 2VG9A 1UIKA 3AP6A 4EWDA 4P02B 1SLBA 1HKDA 1QOSA 3WP4A 1L3JA 1CAVB 4B4RA 5FP4A 5A32A 4WBBA 3GNEA 4XMAA 1CAWB 2VMFA 3NW4A 4KNCA 4QGMA 1R092 2Q1FA 2W5FA 4AAPA 3BOPA 4NROA 4QPGC 4HLTA 2R32A 1U5IA 5FPXA 4LQRA 4AW7A 3M70A 2UWAA 1HIXA 3I2JA 4BIOA 4YSFA 4L92A 4QPGB 3HQXA 4ZHNA 1N1TA 1PGW2 5J1XA 1RUOA 2ZHNA 1CAXB 2YBPA 4P9WA 3LDBA 4N9IA 3ZYFA 1VMFA 4XURA 2P3KA 5GZCA 1OPMA 3KS7A 4UW5A 1RUF3 4I02A 4DEQA 2EIBA 3H3UA 1AL22 3N36A 3LCPA 1GZ9A 1FX5A 1C8M2 3IPVA 3I2FA 3VDDA 3BIEA 1UX7A 4QQOA 3CDZB 4XEZA 3VDDC 2WFPA 4GH4C 1ZBA2 2HWC2 4YW1A 4NIIA 4E2SA 1J1LA 1NZIA 1AL21 3HIFA 3IWZA 4MGTA 2RDSA 2R7EB 1ZBE1 2PXJA 3IBMA 3ORJA 1W9FA 3U10A 3LOIA 5F5AA 1C28A 4XCAA 4M4RA 1VBC3 5FZOA 1R082 1QOTA 2WT1A 4J25A 4CA9A 3D0JA 4MGQA 5CFDB 5CISA 3VLBB 2VNRA 3WDVA 4Q4V3 5IVEA 3MZHA 1H2NA 3SCHA 4N8MA 1RJ7A 1AZDA 5I8YA 2WSVA 1I6XA 3BTAA 5FLIA 5A6XA 1G9CA 3B69A 3ZFEA 3QH6A 3J7LA 5FYZA 4LUKA 4Y5Z0 3E1F1 3GCXA 2VZ1A 5LA9A 3RYRA 2YYOA 3SEEA 1H1AA 1PHMA 4LHKA 1ONAA 2H0VA 4QHZA 4NIDA 1WD3A 4FPFA 1UPIA 1GWLA 3M3IA 1VBC2 4LO5B 4AHYA 5I0UA 5BNNB 2IXCA 4UFIA 3K48A 5JOWA 1C4RA 3I97A 4H2AA 3UNPA 4ASMB 1YRZA 2DVAA 3LPGA 5FK8A 4AF9A 3AKPA 1LAJA 1RUJ1 2WNUA 3POWA 4D94A 5FIXA 4DXZA 1REEA 4COUA 3D6EA 1CD3G 5FZAA 1WBLA 4Q0QA 4KWLA 2JG9A 4UWDA 3VBUC 4PF5A 4OFGA 3AL6A 4QPIC 4QU1A 4FPHA 2LUWA 4XE9A 3FE5A 1VBB2 3AL5A 4MH0E 2DU1A 2D3RA 5IT6A 1UD1A 2KM2A 4L8QA 1QDOA 2VAUA 1ZVFA 2DVDA 2BRTA 4HT1T 2AEZA 1QJY2 3VUOA 2P34A 4JTNA 1OVPA 3POFA 3K4ZA 1ULEA 5CEHA 1GWMA 3B3QE 3J8F3 3ZKYA 1UY2A 3MGUA 4DS0A 1LOFC 1BK0A 1CAVA 1ENXA 1QU0A 3OBZA 4IETA 1PZ8A 4XTPA 2VZQA 2WFF2 2E32A 2Z4FA 1MPXA 2RR11 3A23A 4JCKA 5I0RA 3BTZA 4XC9A 1MS8A 4C8DA 2VVFA 4RR3A 1X8MA 3GM8A 3I3QA 1QJZA 3NSTA 4QD2A 3I2DA 4S2GA 5AFBA 1AHSA 1H8TB 1YWKA 2UYBA 2ZXQA 1RVF3 1OA2A 3POGA 2JDAA 4YW5A 5HI0A 1JUHA 5JXIA 4W4ZA 4GQ7A 3BALA 5FMDA 2AZ5A 5F37A 1ZZ9A 2WA3A 1KD7A 1JOBA 3K46A 3MO4A 4I09A 3GZUC 2PLV1 1V6OA 4PIXA 2LALA 4U36A 3AYEA 4NUBA 4P9IA 4C0BA 4CCLA 1F5FA 4YFWA 2WA4A 1I5ZA 3O0XA 2EAAA 2EICA 4JGYB 3S57A 2XOMA 1ASJ2 4FTSA 1YIPA 1Y9MA 2BFUL 2GAUA 2JE9A 3QACA 2RM22 3K75B 4OMDA 5FZMA 5LB6A 3ZO0B 4ZONA 4YG3A 3I3BA 3WOGA 5F3GA 4HFSA 3K4AA 5JOXA 5IW0A 1FXZA 1W0NA 5JOYA 4YVWA 4CE8A 3WW3A 2PHUA 3VL8A 3WF1A 2RS31 3L2HA 3ZYHA 3H7YA 1DYOA 3MUY1 1Z7S3 3PVNA 2E33A 1BKZA 5CVRA 3CJXA 4M0HA 1UX6A 5IK5A 3I4IA 1WCUA 1VBA1 2OZ6A 2Y6GA 2JX9A 2PHXA 1CZVA 1YLLA 3AK0A 3HMYA 3S0MA 1OPOA 4URTA 3ZDSA 1W8UA 5JDBA 3PJQA 1FV2A 3BTXA 1K5JA 2HH9A 4A7YA 3AB0A 5EWSA 1CJDA 3WUDA 2VQUA 4YGBA 5J3UA 2HWE2 2WWSA 3T0DA 2VPVA 1JYCA 4R52A 4X6RB 5L73A 3JD71 3NAPC 3ON7A 5BNPC 1JN2P 3WHTA 4YVSC 2BBAA 4XHXA 2CAUA 3JD73 1RMU2 2GC3A 4IW3A 2DCZA 3MICA 1VIWB 2WDBA 2QJVA 3WF3A 2B4KA 5D2AA 2GU9A 1HB3A 3C7GA 3OEAA 4GJZA 5KHJA 1OA4A 1DGWX 3FUOA 1WW4A 1W90A 4XQWA 1EUTA 2AUYA 1XE8A 2YGLA 3EQEA 1S0IA 2WN2A 3IDEA 5FWJA 3MW4A 5A6ZA 5C33A 2BPA2 4BU2A 2DTYA 2QNKA 1BYHA 4OHXA 2YGMA 5JVVA 1WCQA 3DPRB 1LJ7A 5K9YA 2R071 1V0AA 4X6QB 1JH5A 2PAEA 2C1FA 4RQPB 1GKBA 4TZDA 4N43C 1ALYA 5C3RA 5I0TA 1PMIA 2FQPA 2IVJA 4YVWC 4G4FA 3R4SA 1VB4A 2DVBA 5LCWL 4IV1B 1H4GA 5BNPB 1PIV2 5IYYA 3C3VA 1X8EA 1CAWA 4Y1VA 4C0HA 2V5DA 1PVC1 1WWYA 4Q1PA 5CIRA 2O1QA 3AZWA 5FKBA 2Y6FA 4S2FA 3V0BA 3S5AA 5FZOB 2K0GA 3KV9A 1BEV2 3ZXJA 1NA1B 4E4HA 4LBMA 2A1XA 2V4AA 3OYWA 4QQ2A 3ZSMA 3HJRA 3VV1A 2P2KA 1RHI2 2B9UA 2CGOA 3WZ1A 1JYNA 1JYIA 2XJQA 1AXZA 1JHNA 3PUSA 5T5JA 1GQHA 3VDAA 4XVHA 4DXSA 1YNAA 3Q8AA 4NWVA 4CCKA 1IHMA 1C8NA 3VKMA 1XC6A 5I0DA 1U0AA 1SPPB 1VBD3 2VUDA 1CZTA 2PHLA 3VBRB 4OCTA 1S0DA 4JC1A 4LHLA 4XF9A 3U4XA 4FI9A 2YU2A 1H2MA 2G19A 2WAAA 4FFFA 4P5HA 4UFMA 1UW8A 2W46A 2WRAA 3D8CA 3POEA 4GWJA 4XQDA 4FAGA 2VVDA 1V6NA 1MACA 1RITA 2WWJA 4PQQA 2ZX1A 5CYYA 3H0OA 3EHKA 4EROA 3WNXA 4B8EA 2O8OA 5FO7B 1VBC1 1L7QA 3ACFA 2R063 3FBYA 3U4SA 2JD9A 2W0XA 4ZU4A 2TUNA 5DZFA 1AR61 4YNIA 1BMV1 4N53B 1L7LA 2CY6A 2LS6A 1D4M1 4IEQA 3T09A 4YWAA 3A22A 4BOWA 4WVZA 1Y7BA 1NY71 1TME3 3KV6A 4GWNA 3RI8A 4JGZC 2HYKA 1W2UA 1LCLA 3KVBA 3O0VA 4FFGA 2FDHA 1JI6A 1OLMA 5FUNA 3T1MA 5JLVA 3DPRC 3QD6A 1QQP2 2BYVE 4XUPA 3HN1A 1DQ6A 4AZZA 5FZKA 1N3OA 4AFCA 4UYBA 4RD7A 2H0BA 3SHRA 3MI8A 4NHXA 3WF2A 2Q8DA 3RGBA 3IKWA 3ZYGA 1W8NA 2ZA9A 5SV8A 2CWMA 2YPJA 1ACCA 2C4XA 5IJRA 1W06A 1EV13 4LBQD 4Q4X3 5BNPA 4CDXC 2BERA 2A3YA 2QQNA 1N1VA 2D7FA 2PN5A 2XONA 1PNFA 1W6OB 2D3SA 3DKWA 1HRV1 4PF1A 4Z2WA 1TMF1 1MZ6A 4NHYA 4A2UA 1JOJA 3ZFEC 3ZN4A 4AEDB 2FZ2A 1NG0A 1UQXA 1RVF2 3VD7A 4J6GA 1LHWA 1KQRA 4LEJA 4Y5SA 3GJAA 4QU2A 1IGOA 5K7PA 1UU5A 4Y3OA 4LT5A 1IPJA 2GN3A 5SV5A 3OGJA 4PT6A 2I2SA 3ZXKA 3SNMA 5C6CA 3MEPA 2WNEA 2JKBA 3J8F1 5B4XA 2X09A 2RM21 4XHBA 1UY0A 2VMGA 2R073 4FQ4A 3I3DA 3LIGA 4UW6A 3W9AA 1O4YA 2D6MA 4XETA 4CXYA 1GP6A 2W39A 4W50A 4B29A 1OKOA 2YUEA 1UYPA 3LD8A 4IV3B 3WDWA 1QJY3 1WBFA 2GC1A 2PHRA 3ES1A 5EQUA 4P9YA 1CAUB 3AKTA 3OYWB 2WO7A 4DY5A 1J3PA 3PU3A 3U07A 1Q8OA 5L19A 1UIJA 4LMFA 1CJPA 2PYTA 1DQ4A 5DUVA 1IZ3A 4BQ5A 5A7WA 3H3ZA 4GAZA 2XJUA 4O65A 3SH4A 5LEKA 2AREA 2HEYF 5JXJA 4QMAA 3TNQA 4CPBD 4JDNA 2HEWF 2PHTA 3I49A 2MEV3 4IEUA 1XB9A 2RDRA 3PTYA 2WL1A 3BODA 4TXWA 1A6CA 2XJPA 4FP3A 4CU6A 2GMPA 1SBFA 4QPGA 2DV9A 1CPMA 3CEWA 2K2SA 3EMRA 3POIA 2GZWA 2J1EA 2OKXA 4RR3C 5DAVA 3VD9A 4HK8A 4P9LA 5DAQA 4RA0A 1VRBA 5A32B 4YW6A 4A6SA 1HQWA 1KS5A 1M4WA 2VCAA 2J7MA 4CRQA 3O1VA 4Q0UA 3RZZA 3JUUA 4H3WA 1G9AA 2EIDA 1D2QA 1LOFA 1FPN2 1ZBA3 5T5OA 4EE2A 5C3OA 4P9XA 4UBGA 1IPKA 1DF0A 2DWRA 3ACGA 1Q5OA 2NP0A 5FKCA 1BXHA 4IL7A 2WT2A 2R0FA 4WM8C 2Z2SB 1DDLA 1LTEA 3ZSJA 3KCCA 4Y5TA 4MVTA 2VO5A 1YC61 1O5LA 1SFPA 4QPIA 1UXXX 3TN93 3AKRA 4QKBA 2Y34A 2BBVA 3H9AA 4LE4A 1RUC3 1PK6B 4DOUA 1LR5A 4Q4Y3 2E63A 5GZDA 3WHUA 2A3WA 4XYXA 2VZSA 4QQPA 4HL0A 4XFGA 3OGGA 4AI9A 1PNGA 4DRRA 2JENA 1HN1A 2UWCA 4HANA 1O59A 1Y9GA 4H7LA 2YB7A 3ZYBA 2WLQA 1GZWA 4NWWA 1HJFA 1EV11 2CHHA 3KT7A 3WNKA 4AI3A 1M06G 1U5YA 3WNOA 3VDBA 3IDCB 4MADA 3RS6A 4IGQA 3VKLA 4YG6A 1ULGA 1J58A 1ZBA1 2CNAA 1W8TA 5GZGA 3UV9A 2J1UA 4WM7C 1EV12 2D93A 2ARXA 2FHRA 3HOBA 4OMCA 4AEDA 2P6HA 2OQ7A 2VW1A 4FP2A 1OF4A 2Y33A 1ASJ3 1COV1 4B3NA 4XJWA 3OBTA 3MBWA 4RHV2 5A7NA 1JZ3A 2I74A 3MYXA 3NNMA 5C8CA 4GH4A 1LOAA 1JMUB 2VM9A 5FPVA 4BJ0A 2D6OX 4NIGA 2YV8A 3FHQA 3O14A 4YYOA 5FXZA 1RL3A 5T3NA 1K45A 4AVAA 4KI5M 5D1IA 4MXVA 4XUQA 3ZFGA 3M3OA 1K12A 3WP3A 3NV3A 5J96B 4RR3B 5A7QA 3LA3A 1T6GC 4N90A 1SLCA 3FFZA 5A3TA 1RTVA 2OPWA 1UOGA 3POBA 1RUNA 2VOWA 4KU8A 3TEWA 3AX4A 5HCFA 5HV4A 1SDWA 2NZ9A 4YGCA 4TLGA 3OBAA 3TEZA 3PMSA 4KG8A 5J98B 2EVXA 2JDPA 5G05L 4AQ6A 1HRV3 2Z42A 2VQAA 4GA9A 4I30A 1LB2A 2DFBA 1CIWA 2C9KA 4META 4CEWB 4Q0PA 2JKXA 3I59A 3SCGA 1WLTA 5FXWA 3BVCA 3O0WA 4AGVA 4BA6A 3CU7A 2OPKA 1H6YA 1OOPB 3KT4A 3FX3A 4FPJA 3VBFC 3WG3A 3DN7A 4BXFA 4M01A 3D0SA 4XAAA 1UY1A 5C3SA 3LFMA 4XIKA 1LGBA 4DUWA 2W91A 2FCTA 5FZ7A 1J1TA 4IV3C 3UGHA 4BM8A 1EYBA 1HX6A 1NLSA 2F4LA 4IERA 2DUOA 3H3LA 3VHRA 2JG8C 3MIFA 4JZRA 3VBSA 4PBOA 4LK7A 1F35A 3VN4A 3B9IA 4E8CA 4XFIA 2JG8B 5E88A 3VZOA 1UMZA 3P3NA 4GB33 4IEZA 3VZNA 2ZKLA 1OLRA 3ITQA 4OI1A 1PMHX 2GNBA 5A33A 3WVJA 4AR2A 4IXLA 4E2GA 3D4KA 3HN3A 3FL7A 5GALA 4XUOA 4QDRA 3AYAA 3QH7A 5DUXA 4AAXA 5FO8B 3VKFC 4UI9L 1MS3A 4AQTA 2YMZA 3AVRA 2EA7A 4CDQC 4OULA 1QDCA 1UXZA 4KBBA 4PQ9A 1ST8A 3VL9A 3WW1A 3QOPA 2VZTA 3EB7A 2PMWB 3POSA 2ADEA 1CZSA 4LTAA 3PTRB 4FT8A 4UFLA 3UT0A 5EYYA 1FNZA 2HEVF 3L2YA 1GQPA 1GYKA 3NWKA 5I8SA 4A6OA 4E4ZA 5HBAA 5EYXA 2QQPA 3J9SA 2BJSA 3WNPA 1DG6A 4HK9A 1EAH3 3MW2A 2JDKA 2WNVB 4DXTA 3AZXA 3FLRA 4JGZB 5F3CA 4QXCA 3JD72 4JHZA 1O3SA 2QQJA 2ZX3A 2ORXA 3N7JA 4YM1A 4Q4X1 2BNOA 3N7LA 1JODA 5FBJA 1GBGA 1VBE1 3AYCA 1JW6A 3IN9A 5KHKA 1JU4A 3MIDA 1UYYA 3CIHA 4IV3A 4EN8B 1OLME 1UOFA 1YI7A 3ZSKA 4FXKB 3A0KA 4HN1A 1VBA2 1AR82 1LGCA 2ZAHA 4LKEA 3ZXLA 1OA3A 3D3AA 2OS2A 1PO21 3O1SA 3T1LA 2JIJA 1UZYA 1YI9A 4CUCA 5C8WA 5C8CB 2W3JA 1E57A 3WG1A 4N43A 4AI1A 2ZMLA 2D3PA 2BVBA 5F2WA 4ASLA 3SC7X 3U14A 3VB9A 4CCOA 5LWBA 2J1AA 2FMYA 5FR3A 1UOJA 3WF4A 4Q27A 5GJ6A 4UT5A 3ZFFB 4V1PA 4A41A 3PIGA 4A4AA 2NM1A 3OGVA 4NO4A 4OUMA 1FAYA 2WO2A 2WZR3 2XWBB 4GKXA 4QGLA 5FP8A 4LBOA 4B4PA 4D8MA 3AXDA 3LDRA 1JU3A 2DVGA 3LQCA 3V0AB 4RHV1 3VD4A 1QQP3 1ZZCA 1CX4A 3ACHA 1VMHA 3K51A 4K40A 3R0RA 2C6SA 2E53A 1Q8SA 1V6LA 4GMP0 2X8KA 3SMHA 2JJ6A 2VULA 2Y8KA 4IEOA 3VBUB 2A6WA 4FPEA 2O0OA 5FZ1A 4BYYA 4JGYC 5LZ6A 1AL0G 4FOVA 1QIQA 1VBE2 4N7IA 3K4DA 1H8TA 1ZZBA 2I07B 2JDNA 2VZPA 2XLGA 5C3PA 1LRHA 3OUIA 4WZFA 1ZRCA 4RGGA 2DCYA 3OOXA 2ARCA 3Q8CA 1K5MC 4OYUA 3I2GA 5DDJ1 1E5IA 1WMFA 3C7HA 2OT7A 4JKMA 3ZXDA 2B5HA 1JZ5A 1DGRN 2XKPA 3GBGA 3VHPA 4AL9A 2ENRA 4AK3A 5HXMA 5KHIA 1OQ1A 2HWD3 2IWGB 3DV8A 4OQ9A 2PQSA 1SZBA 4FSJA 3OGSA 5LATA 1GMMA 1ZZ8A 1PM4A 2VZVA 2Z79A 3FLPA 4O9GA 4YPJA 5AC93 1R1A3 1AR91 1GOHA 2ZEYA 1W03A 1IS6A 2XJTA 4AFDA 3PDQA 4KWKA 4LKSA 1FYUA 4PHZA 3LB9A 1QGLA 1IKPA 4OI0A 3TN92 1NE6A 1YQCA 2BUKA 4NPMA 5F2SA 5JXGA 1LNSA 1OFNA 2ARAA 2QQUA 3M8LA 1W3VA 1PO13 4YZ3A 4C1XA 1F2NA 4X8PA 2ZGNA 3B00A 4COZA 2YG0A 2H6BA 1PZ7A 4LO6B 2JEMA 3I8TA 4XZPA 2BVVA 5T55A 1CPNA 1POV0 4FO9A 4KL1A 1HV1A 2VR4A 1BBT2 4ZXKA 1PIV3 2ZCWA 3VDCA 5F32A 2C24A 5FYTA 1DGLA 5JSRA 1X36A 4ITCA 5H9RA 1POV3 5A3PA 4LOSA 2OUHA 4JAAA 4LORA 1UOBA 4R9DA 1QHDA 2JIGA 2HWD1 1V6JA 4NVPA 1OOPC 2BOJA 2BGPA 1Q3EA 2WNVA 3L9JT 3R4UA 3S7EA 3CBNA 3BYWA 4A44A 5BYNA 1H9PA 4Y4YA 1HJGA 2AACA 1W2NA 5JIUA 2RDNA 5DZGA 3ZFGB 1NZCA 1UU4A 2HKXA 1VALA 3MW3A 5CAZA 2YY1A 2X05A 2W68A 4YRDA 4QPYA 3J7HA 5IAVA 3OG2A 4MHUA 4A42A 4R4ZA 2UURA 4EN6B 4MHRA 1ZNPA 1RUE1 3THCA 3Q9OA 1RXGA 2RS33 4DMIA 3B94A 4K9SA 4MOAA 4EN7B 1E5HA 2VZ3A 1GFF2 2IXLA 2WT0A 1C3HA 1EUUA 3AFKA 1BMV2 1DLCA 4NPRA 4XBNA 3U37A 2P3JA 1D0HA 5A6QA 3OGRA 2B42B 4XAEA 2AEYA 4Y1XA 5KC5A 2WO1A 1JS9A 3VZLA 3RWKX 3ZXGA 3ZDVA 2BU9A 1B35B 1W05A 2QQOA 4LBLA 1YFYA 4XDQA 3WY6A 1JOPA 3WDXA 1RVF1 2VJXA 3FN9A 1Z7S2 2LM3A 4DB5A 4WVVA 4H14A 2P5BA 4EQVA 1RUG1 5F7UA 1JHJA 2RS53 4MUVA 4NHKA 2VTXJ 2GNDA 3ILRA 4BZ4A 4GMP3 3NNFA 5CFCA 1CAXA 1QNYA 2O14A 3NJYA 3DXUA 5F5IA 4UFHA 2RG4A 4KWUA 2RS12 3PURA 1HB1A 5FYMA 4LITA 3NL1A 3SISA 5FMBA 4LPLA 3SH5A 3K3OA 3IPVB 3TYJA 1HW5A 2HWF3 4N53A 1ZREA 3FBMA 1S2BA 2ZEZA 5EHDA 1W6MB 4YW3A 1JZ6A 4RFT0 1Y9QA 2QE3A 1V9U3 4INDA 4MYEA 4P9GA 3O1OA 3R05A 1QJX1 3HVDA 4LO7A 3GCWA 1JXNA 2XHNA 3U78A 4P00B 2ZABA 4CDWB 5A3MA 5FZEA 2BOIA 4I2OA 3OY8A 1V6IA 2XBO3 3HNMA 5LBFA 5B2GB 1WCKA 4W6WA 1K42A 3O1MA 1VE0A 5A80A 4QX1A 3VGIA 1JTZX 1W6NB 4ES9A 4YFZA 1FMD3 5L9VA 4XMIA 4WM8B 4JGZA 1WD4A 4XFAA 1DZQA 2ZBJA 4YG0A 3OPWA 4CU9A 4L9BA 1H8VA 1DCSA 1MEC1 4NHMA 1LOEA 4F83A 1YYNA 3D5OA 3LEMA 4PLNA 4CZSA 2GC0A 1UWWA 1W2TA 4JTOA 2WZEA 4EWAA 2OVUA 3POJA 2WYFA 4MGZE 4QXKA 1OI6A 2ID4A 1NAEA 1D4VB 2GC2A 3DEMA 5KWRA 1SEFA 2VMCA 2ADDA 3IB3A 5GLUA 1AR73 2E7AA 1TVGA 5LBBA 2E26A 4FQZA 3USSA 4C1WA 1DYKA 4GB31 1JYXA 5BNOB 1ASJ1 3I2IA 2NN8A 5KXDA 1MQTA 3WW4A 4LA3A 4PLMA 3JB8A 2YZ4A 2OYZA 1VPHA 3VBFB 4K8RB 1ZBE3 2HBTA 2WNVC 3QLQA 5A6YA 2TEPA 3KWVA 2MNGA 3E5QA 5A3OA 3VBOA 4AVVA 4XXPA 3OY8B 1OSGA 1LHNA 3GXUA 1YQ8A 2IC1A 2ES3A 1REFA 2VL4A 2YU1A 3PIJA 1BK1A 3IT8A 2J1RA 5F6LB 2WS92 1AYN3 3P1IA 5J48A 3GDBA 2E7QA 2R6QA 5FY0A 4ORFA 4CSWA 4CCCA 1U5XA 3LKJA 3VBHB 5A3LA 4QDQA 5A1AA 4IE5A 3ZXEA 2D97A 1HQLA 3WD5A 3I2KA 1W8HA 4X8NA 2X29A 4GALA 5GZEA 5DMYA 2MEV2 4QX8A 4LIVA 4WVMB 3RJ2X 2ZX2A 2WQ4A 4AVSA 1QKQA 1ND2C 4Q4V2 4N7UA 3MLJA 3FFQA 1AYN2 1RUI1 2WSUA 1UF2C 4K7JA 4SBVA 4IEVA 3CHXA 4NRQA 4BQYA 2RV9A 1LODA 2OQ6A 1QXRA 3H8UA 4XFHA 4Y20B 1W6QA 5DPNA 1S0JA 5IVYA 1DQ0A 2CGPA 2HWC3 2QQWA 1APNA 1QJU2 3WG4A 1ZM1A 4GKYA 4M3CB 3FZ3A 4Q4W2 5M0TA 3B7MA 1WMEA 3NV2A 3CL1A 2QQMA 4IEXA 4Y33A 1YCIA 2FDJA 5FQ0B 3T30A 2BV4A 1LU1A 5JSPA 2P37A 3IDAA 4XZUG 2VD7A 5I8TA 2JG8A 2VW0A 1KDMA 1X9PA 4YGEA 4CDXB 1LOBA 3NV4A 1GP5A 1O8SA 3OUJA 5FYVA 4AE2A 1SDDB 5LBCA 1XYOA 2K9ZA 1I1EA 2GN7A 4KWJA 1J59A 1GZCA 1MS4A 2RMU3 3KGLA 1W2OA 4KQ7A 2ORZA 3SKVA 3MF6A 4AQSA 5GLVA 4XILA 1RUE2 1O3RA 4JDOA 2EIEA 2WKKA 1HDKA 4B7EA 4K3UA 4EYUA 2R043 2K46A 1C1LA 1CX1A 1PK6C 4AEJA 1CN1A 2VUAA 4WV8A 3VBSB 4ATFA 2I45A 3OBRA 2G9FA 1A78A 2IFRA 4FOWA 4ISQA 4Q4Y1 5FCCA 3E97A 2ZEXA 2VMHA 4Y1ZA 3RMXA 4GJYA 1XPWA 5CKMA 5C5TA 2DTWA 3ES4A 4XJ9A 2XUEA 4CVUA 1W8WA 5IK8A 1NY72 2IXKA 3RZHA 2VE1A 1DYPA 1S1AA 3AYDA 3ZN5A 1OURA 2A75A 4LLFA 5JIAA 3E6DA 4AI0A 2WJSA 5LY2A 4XF4A 1TME2 2BGCA 2HWF2 1CGPA 3N9PA 5H9PA 3VBOB 3AP5A 1US3A 2XL9A 4YM3A 2C26A 1AR93 3HPNA 2VTFA 3CJIB 2R062 4PIYA 1YJLA 1UKGA 1HQNA 5DABA 1YXWA 1X33A 5CKQA 5DG1A 2NLRA 3WCSA 2Y6KA 1O91A 3DF0A 4O9EA 1MZEA 4ISRA 4RS5A 2HWB2 3Q8EA 4QPIB 4AEMA 1H2LA 4WM7A 1MVQA 3PJYA 4NIAA 1WLDA 2CSGA 2PQQA 1TMF2 2ZPXA 3BU7A 1RJ8A 1W2AX 2J42A 4NAMA 4P08A 1TEIA 2WAOA 5FY4A 3WNNA 5FO9B 4CPBA 1ZA7A 2Y6LA 4BLJA 1MS0A 4JDMA 1QJY1 3H42B 4HXCA 5JI9A 1RUC2 4D6QA 2X5IA 2V73A 1GUIA 2WZR1 5IATA 4YVWB 5IVFA 5J09A 1W04A 1QQP1 1OBNA 1I9RA 4M3CE 3X29B 1DFQA 3G7DA 1XNAA 4XQ4A 1VBB3 4CUBA 3MIGA 1ND3C 3GHNA 4I0WB 3DCQA 3AKSA 2QFEA 1N47A 4QM9A 3ST7A 4CDUA 2EXJA 1BCXA 3KQRA 1CONA 1VRH3 5K8SA 1W6OA 5EJZB 1D7PM 4NOTA 5ANNA 5D21A 2CL2A 4JKKA 1NA1C 4NRMA 1FPN3 1DHKB 3EXUA 3LGRA 4OVEA 3WT3A 3ZFFC 3RNSA 3ZM8A 3ZIXA 4AFAA 5B4NA 5LRSA 2VOKA 5CNAA 1LEDA 4OZXA 5KXEA 5T50A 4QB1A 5APAA 1FT9A 2E6VA 1XOYA 2BDRA 5J36A 3M3QA 3BOWA 4AHZA 1V9U1 1CESA 2BZDA 4PI0A 4Q26A 2E9QA 2R1BA 4IV1A 4QB6A 3N9OA 4K6BA 4LNVA 3O1UA 3K2OA 2J1VA 3KV5A 4RQPA 3GYDA 1DP0A 1TZOA 3ELNA 1S4CA 2A71A 1HRI1 1Q8QA 2V4VA 3BPZA 4XW3A 3RJRA 5CA6A 1R081 3RVHA 2WS91 4D7TA 2JD4A 1SPPA 2ERFA 4E27A 5FY7A 3SCFA 5HPOA 3TRSB 3T0BA 3GZEA 3T2QA 1X7NA 1VRH2 4PDWC 3LOBA 3UGFA 5GM0A 1W9SA 1MS5A 2FDGA 2J22A 3EYPA 4PCRA 1LHOA 5FPBA 1MEC3 1DBNA 3A4UA 4UXAA 5KR7A 3C8XA 4DUXA 3JU9A 3JCIA 1VRH1 3OCPA 4FPCA 2E7TA 2GNTA 2JDZA 5E8AA 4TTGA 1Y43B 4QQHA 2XDVA 3RFRA 1NOVA 3WDUA 4Q8KA 1C8M3 3KT1A 4YZ4A 4YVSB 1US2A 4Z92B 1JUIA 1XNCA 3PUQA 3TN91 1UMIA 1AJOA 2R072 4CP2A 4CDQB 3J7NA 3UL2A 4JHTA 1F4AA 4TYSA 2BNNA 4CXXA 1F4HA 1MQTB 5E89A 1AYM3 3WQ1A 3WQ0A 3KMHA 3KZ4C 1AYM1 1T2XA 1S2EA 1STMA 4HPKB 4Q1RA 5A7OA 4J1XA 4A7KA 2BQPA 3B9CA 1EPWA 5BNNC 2ET1A 2XBO2 1HRI3 5HV0A 2VQ0A 4ZZ8A 2X53S 4NJ4A 1JYWA 4AEDC 1FOD1 3HNBM 5DDJ2 4IGOA 2JXAA 2CDOA 4N43B 3VKNA 5FPLA 1VBE3 3RZGA 1IS5A 2XBO1 3A7QA 3SKJE 1NQJA 3OUHA 4PLOA 2XJRA 5L9RA 3T4VA 1JZ8A 1SQ4A 4I0BA 5K4LA 1I3HA 1OFSA 3AFGA 4GWIA 3UKNA 3WEZA 3ZOIA 3ILNA 4BH9A 5IVJA 2D5HA 3NQHA 4I0AA 1AJKA 2IVIB 4KGQA 5DN2A 5D8AB 2VOXA 4HETA 5CZKA 1S0GA 2XVGA 4K8FA 3WLUA 4FOYA 2ILMA 3IAQA 3KSCA 1S55A 5EZWA 5GZFA 1DGRA 2WBKA 2Z5WA 4IV1C 3WP6A 2XLAA 1GZWB 4D6SA 5DXDA 4LO8A 4LHNA 2ZAAA 4QX2A 1W28A 4DRVA 1YFXA 3JQXA 1AX2A 2W47A 3ALQA 4NRPA 1AYM2 1DLLA 1KXGA 1RUH3 3KHBA 1PVC3 4R9AA 1XNTA 1S0CA 3AJZA 4UF0B 1UZ0A 4A7ZA 1RUE3 2RS51 4QX0A 1RUJ2 1ZZ7A 1DZRA 3ZFEB 1C1FA 1QJU1 4FPKA 3ZR6A 3RQ0A 3MV01 3VZKA 2DFCA 2WO3A 3OPZA 1GLHA 2XR4A 3CZUA 3HAGA 5C7GA 5KHHA 5L7OA 2P1BA 5JWPA 4BK4A 4DUVA 4YGDA 4C90A 4JQTA 4K20A 2P3YA 1FATA 3N3HA 4PI2A 1YQ5A 2EXHA 3NVCA 1CQ9A 4QB2A 2BGOA 3JBG2 1SLTA 2JE8A 4Y1UA 3S6PA 5FMOS 1IKQA 4CEYC 1QEXA 4M0NA 2X5IC 1SCRA 2XGXA 3W21A 5FZDA 2GDFA 1RUG3 4QX5A 4AFBA 2GP3A 5FZ9A 1NCRA 3TB0A 4FXGB 1WLCA 2VC9A 2QVSB 4LKDA 5EJ3A 4QGNA 5HXVA 2QZ3A 4LBKA 2VCMA 5FDBA 1SMVA 1OT5A 5A7WB 2B9VA 4A45A 3H8RA 2VMDA 1W8ZA 5CB7A 2XLFA 2ZGOA 1ULFA 4RS5C 1RUC1 3GALA 4FFHA 3ROUA 4TSVA 3T3YA 1OUXA 3ZYIB 4DY3A 5LBEA 4ZY9A 4D7SA 1VR3A 3TOJA 3DUIA 4GXLA 3SITA 1UYZA 4TLFA 1Z7S1 4CP1A 4UBHA 5FZ4A 5HCHA 1QJFA 4K1YA 3O12A 1GOFA 4BLIA 3O1RA 5GLZA 3M4FA 3LZZA 4IE4A 4AEKA 1JZ2A 1TME1 2WNUB 2XHKA 1HLCA 2J1TA 3UKTA 3C2UA 1VAKA 5FPUA 3K3NA 1RUG2 3RG0A 3HQUA 4Y4RA 5JCTA 5K0UC 3G6JB 2NMOA 4U2AA 3T2PA 2GNMA 2ZS6B 4MLOA 4Y24A 4DIQA 5IAXA 1QMJA 4FPLA 1T6BX 2WIIB 5EPAA 1COV3 1MR5A 2RDQA 3LIHA 1RUF2 3DYMA 1PK6A 4GIQA 1R1A2 3UGGA 3W5NA 2YPDA 5F5QA 1SFNA 1TMF3 4W8JA 5FZ0A 1XE0A 1H8TC 2BEOA 4ASKA 5FXVA 5F3IA 2ZZQA 2Y64A 3I3EA 2XJVA 4BQ4A 4YVSA 2CAVA 1JBCA 5TSWA 5F9TA 5FV3A 2D6LX 1RUH2 2B45X 3CJIC 3BU0A 3OPTA 2Q5TA 4Q0SA 3HNYM 5F6KA 1NCQA 2D98A 1UPSA 4IQPA 1AXKA 3VHOA 3E6CC 4FTEA 4CCMA 3CMGA 3CLPA 5F1RA 2DVFA 3BI3A 3N4MA 5EIYB 5K0UB 1RUH1 2VY0A 3WX5A 3R6SA 2MPFA 2CYFA 3LAGA 1PGSA 1J3RA 2D44A 1IQDC 3ZYJB 4P9JA 5FP3A 1EY2A 2F6BA 5JMOA 2Q0AA 1F5JA 4LBJA 1EAH1 3PUIA 2A6VA 1I5PA 2HWC1 3H1YA 3LA2A 2R041 5EFUA 1LEMA 3C7OA 3GJBA 3EBRA 4R8HA 2J1SA 4W65A 5BV6A 1PGL1 3RPQA 1UYXA 4Z1VA 1KITA 5FTTC 2VZRA 1RINA 2MHFA 1PX3A 2VBDA 4XFCA 4NPLA 5I93A 1ND2A 3UK9A 1SBDA 1W6MA 3USUB 1H2KA 4MXWB 5DDJ3 1VAVA 2XQRA 4FTBA 5FYHA 1KS4A 1DGWA 1PGL2 5FYUA 5LA2A 1DZTA 4XBQA 1BJQA 3CQOA 5H9SA 2W94A 3GHMA 4EJRA 4I3GA 1LESA 5FOJB 4OHYA 1ENRA 3VBRC 2CWSA 5BXXA 5L9BA 1GOGA 2D43A 2RMU1 2DYCA 3ZVXA 1G6NA 4MG2A 1IPSA 1YEWA 1HB4A 1NQDA 5IFPA 3WNMA 4BQ1A 3TNPB 4D6RA 1XSQA 3KQ4B 3OF1A 5A3NA 4BK5A 5ISLA 1Z78A 1BBT1 3ETQA 2VQTA 4CCEA 2V5YA 4BCUA 5FZCA 4A3XA 2R0HA 3S7IA 5ERLA 1W99A 5EJ1B 3RMYA 3AMHA 1EAH2 1RUD3 3NKGA 2W95A 2JE7A 2FCVA 2ZTNA 4CDWA 3MPPG 3B93A 1DQ2A 1UAIA 1QXPA 3FUQA 4JRLA 1C8M1 3MIEA 5CG8A 1MVEA 2W1SA 2VMEA 2XVLA 3JQWA 1CVNA 2C0ZA 4Z8BA 4XTMA 3M1HA 1BVP1 2QTWB 4RGAA 4D0QA 3U11A 5LASA 5LRRA 4COWA 4IDZA 4NMIA 3NKTA 2Q1ZB 5JOZA 2GH2A 3FMGA 2DU0A 4V2VA 1WUVA 3AKQA 3ZLIA 2Q8EA 4XJAA 4CP9A 1XQNA 4HVQA 3I54A 5CFDA 4ES8A 1UMHA 3W5MA 3H7JA 3VBHC 3W20A 1AR62 4D7YA 5FMOL 5FMCA 2QQLA 4UF0A 2P17A 3AP9A 4IEPA 4XDOA 4C91A 1LHVA 1UZWA 5FOBB 4YLZA 5IK4A 1VB2A 1OKQA 4AG4A 1UU6A 3KGZA 4I01A 4JKLA 5IHRA 5JMCA 5FY8A 3AZVA 5BPXA 3RZMA 3BB6A 2PAKA 1JYTA 2JECA 3NAPA 1PO23 3O7OA 1H9WA 2RE9A 2VCCA 4I3PA 3ATGA 2WFF1 5C3QA 3AVSA 1XNKA 2OXBA 5A70A 2ZHLA 2Q1MA 4BQ3A 3DKQA 4AGRA 4N53C 1ULDA 4BISA 3S30A 3UYJA 2XQXA 4LJHA 2VMIA 2PTMA 2LRPA 4RL7A 1DQ5A 1W3XA 3WQ7A 4MO3M 3A0NA 1AUYA 2WQ8A 5JPNB 2KD7A 4NHLA 1VBB1 5K0UA 3ZPYA 3UETA 5CFCC 3RZKA 3B01A 3PHMA 5BNNA 3OD4A 3ZFGC 5FUIA 1GNYA 2KXLA 4OI2A 3I2OA 1O4ZA 3WXPA 2GMEA 1JYVA 2DDUA 3KF5A 2PFWA 4BQ2A 1LULA 2NYYA 5DZEA 4R4XA 2XWJB 3MLKA 2HWD2 5DAPA 4CP0A 1OLQA 2RS11 3ASIA 1TNFA 1E5SA 4IGPA 4XXAA 5J7MA 4QXBA 2HWB3 1WMDA 1YFWA 2VZOA 2YC4A 3JBG1 3MV11 2RVAA 4XJ8A 1Q56A 4BPZA 2HWF1 2UYAA 3FHIB 2Z69A 4M3CA 4UFJA 2RJLA 4LK6A 3APBA 3QBQA 3BKZA 2FD8A 1W9YA 4M4PA 2XKOA 4MXWA 4MGYE 2HJIA 3N35A 1VBD1 2UU8A 1W0PA 3Q8FA 4Q4X2 1V9U2 2YROA 4ZU5A 1QJX3 2IXHA 3ACIA 1R1A1 5KHGA 4LIUA 4Q0VA 4DFSA 2BFUS 2W1WA 4EN0A 4YM0A 1AXYA 4XFFA 2FMDA 5ACA3 4QWNA 3N9QA 4CXWA 1JZ4A 1FV3A 5FZLA 4MGSA 2G9GA 1ZRDA 3VDDB 2IZWA 2IXJA 2OZJA 2D6KA 1V00A 1QOOA 4CEYA 4OUSA 1J83A 1RMU1 1SBEA 2SLIA 4QDSA 5ACA2 5FYSA 3JZVA 1W39A 1W9TA 2RR13 4QX3A 4RQPC 4LR4A 5AVPA 4BE3A 3V56A 4BMEA 1B35A 2RJ2A 1IS3A 1QJX2 2X5IB 3EO6A 1CWPA 3V64A 1OOPA 1YHFA 2DBNA 1W8OA 1XYNA 3DYPA 5FZHA 4AWDA 1PVXA 2RS13 2XH6A 1V6MA 3CF6E 3N9NA 4IUGA 4S2HA 5DAWA 1PX4A 1OD5A 2G9ZA 4ARXA 5A1FA 4F8AA 1SHWB 1YJKA 2W08A 1HRI2 3P6BA 2R49A 1EP0A 1S0BA 5A3WA 3WDTA 1K5MB 1PIV1 1XXNA 1GP4A 5CG9A 3JXSA 5HCAA 2JG9C 4H55A 3VBUA 4DZGA 3ECQA 4CCNA 5FP9A 4DNYA 1GICA 1H0BA 1UY3A 5I91A 2QUOA 2W92A 4CDUC 1VBD2 4ZPIA 5JZGB 2WNUC 4D69A 5ABJA 4B7KA 2BW8A 5IVVA 3PU8A 1UCXA 4JRAA 2BP6A 5JSOA 1G9FA 1AX0A 2VBBA 4PBPA 5BNQA 2E51A 5IVBA 5FZGA 5FY1A 1RHI3 4L11A 5JI7A 1PO22 2VZUA 4QXHA 1AX1A 1OXCA 5E1RA 4RS5B 1J84A 1UZVA 3I3MA 3H8OA 1ND2B 3USUA 1PGW1 1RHI1 4D3WA 2RHPA 2Y60A 2Y38A 4FCAA 4KU7A 2XUMA 4CYDA 5JR7B 1K3IA 4NR1A 2R16A 1G8WA 3T2OA 4ARYA 3U75A 3DXTA 1QWRA 4MSVA 4DPNA 2DCTA 2NQYA 1RUI3 1ND3B 4HBNA 2VVEA 2QQKA 3LFIA 2UWBA 2Q8CA 4CP9B 4BB3A 3RI9A 1S0FA 2GH8A 1HXS1 4HSLA 1FI2A 1TNRA 3FLTA 4ZS2A 3KB5A 4S2DA 2RJKA 1WW6A 1HV0A 3EJKA 2VBPA 2CDPA 2PAMA 4KBZA 1TG7A 2QDRA 2JDMA 2AH2A 2VXRA 1Q8PA 2IXIA 2ETEA 1V6KA 4O7XA 2Q8OA 5ANQA 1KEXA 1NLRA 2VTXA 4YZ2A 3IM0A 3KV4A 1SACA 1WW7A 2W9XA 4HKLA 4TWTA 3ZMOA 1ZYBA 4HVRA 2EF6A 1GQGA 3NAPB 3ACLA 4XJZA 4B4QA 2X10A 2O8QA 4V2WA 3OD0A 3DECA 2PA7A 4COYA 2LTNA 2PHWA 3KCXA 2WWUA 2ZHMA 5JR2A 3NJZA 3F95A 4QAWA 2P3IA 2XVKA 2QKDA 4JVAA 1RYYA 2B39A 3H1MA 5CU1A 4JV4A 1WGPA 1WZXA 1N1SA 3BIWE 2V09A 5A33B 1GZTA 3A21A 2QZ2A 5FYIA 3KLSA 4O61A 2R061 4AHXA 1LOGA 4AOCA 4XABA 5EV7A 5FZ6A 4CDXA 4CUAA 4XCBA 3AMNA 1NE4A 1XNDA 3ZXFA 5ABJB 3KD4A 3HEIA 3WQBA 3RYPA 4RSUA 3O1TA 3VD5A 1BZWA 1R093 2A73B 5LK5A 1O7FA 5CKNA 5C9AA 2DCKA 4Q4V1 4UW4A 2A6YA 5JPMB 4XUTA 3AMMA 4HMZA 5FFOC 3AMQA 5FXXA 2NMNA 3PUHA 5A1LA 1X50A 5IK7A 5CFDC 1POV1 1WKYA 2RR12 4URAA 2OUJA 1PM7A 1IG0A 2FCUA 4GZ9A 1NA1A 1NXD1 2HWB1 4HN0A 5DAXA 3SH3A 3ZFFA 3IAPA 2F4PA 1XU2A 4DXRA 2BWAA 3HT2A 3LDKA 5FREA 4CU8A 2ARBA 4J1WA 5L36A 3DL3A 1XBFA 1AVBA 4LUMA 1W6QB 3NMBA 2QQIA 1ULOA 2XXZA 3IMMA 3M3CA 3MFCA 4CDWC 2AC1A 1ZX5A 1R1ZA 2GSYA 1QNWA 4P14A 5T54A 2WZR2 2FDIA 3IMNA 2ATFA 1KGYA 4L2NA 4L97A 2N7GA 4WVMA 4BHPA 1TQ5A 2ZGQA 4ET7A 4FVVA 2JDHA 1UO9A
chains in the Genus database with same CATH topology
1QY4A 1KRIA 3URFA 4YM2A 2R042 4ZKTB 1QXJA 3QCWA 4XF1A 3AZYA 1N1YA 2WFF3 1BVVA 2ZGPA 4IEWA 4QT6A 3VBSC 3MDPA 3BCWA 4MV2A 1RB8G 4MGIE 4Q4Y2 1BQPA 1VBA3 2WINB 1U12A 3J8F2 1Y3TA 1CR7A 2ZGMA 4YW4A 4Q4W3 2A5ZA 4HPKA 3THPA 2FZ1A 4KH9A 2GMMA 4XF0A 2WZPP 3ZMNA 3ZN6B 3VBFA 1FPN1 5J37A 2VU9A 3D82A 5JZGA 2CTVA 4GMP1 1BEV3 2CV6A 3E6BA 3MFAA 2XG3A 1MZ5A 4WVWA 1QJU3 2AR6A 3VZMA 4QM8A 4SLIA 4AHWA 3LSDA 5D8AC 2TBVA 3HBZA 1N3PA 1W0OA 2BNMA 2EXIA 5C4WA 2QCSB 4W6XA 4HKOA 1VP6A 4Y26A 5FLJA 1J3QA 4GWMA 1DU3D 1ZA4A 2H6CA 3MLLA 4LE3A 4GB32 2A6ZA 4K1ZA 1W6PA 1PZ9A 3T2TA 3CJIA 1AYN1 1RUI2 1TE1B 3V65A 3GBFA 4ONUA 4COVA 1BBT3 4BWOA 5CADA 4WZCA 3ZX7A 5ACA1 5AC91 1F9KA 4Z07A 3WINE 3ZYRA 1R083 5LEJA 3NO8A 1RUD1 1LENA 3J26N 1RMU3 1SLAA 1O3TA 4K21A 2Y0OA 2Y0IA 1VLNA 2A6XA 4AVBA 4MZUA 1ZBE2 3LWCA 1RUD2 2DURA 2XL7A 4Q8LA 3JBG3 4Y22B 2MEV1 1S0EA 1ULCA 2D6PA 3KM5A 5BY5A 2SBAA 1PVC2 1G86A 3O5SA 4CTEA 1FMD2 3RSJA 1HRV2 2CGNA 4QQLA 1GNZA 1EPZA 1Z0HA 2VGDA 3AZZA 1YIFA 4GH4B 2AGSA 4AGGA 4FOQA 1WCDJ 3IIAA 1CAUA 1OHFA 1H4HA 1DIWA 3M2MA 3FWEA 2RM23 4ZU7A 2ZGRA 4HSJA 1C5HA 3CO2A 3GBWA 3RDIA 2A7AA 3IDBB 1NCRC 4EWEA 3VBOC 3WR0A 1WLWA 1HXS3 3PVOA 4AI8A 1QH6A 5IUQA 1LGNA 4Q4W1 1KFUL 4UW3A 2XB6C 1B35C 3AXEA 2VNOA 4NN0A 1GR3A 1URXA 2VH9A 3WV6A 1NCQB 2WLPA 2C5DA 3TBDA 3WP5A 1AR71 5KC6A 1V70A 5L7OC 2G4IA 1YUDA 3MPBA 1S2KA 1VJ2A 3PMEA 4L99A 1W6NA 3ILFA 4IESA 3DGTA 5T5PA 1H30A 1GV9A 4HZFA 4DINB 1XU1A 2ZMNA 3E5XA 2OA2A 2R1DA 5I0SA 5AFEA 4FBFA 5FBZA 1AF9A 1D4M2 4HVOA 1O4TA 2YHJA 3ZYPA 4XIOA 2UY9A 4LBQA 4CEWC 5T52A 2NPIA 1RGSA 2OIIA 1F31A 2YXSA 3MIBA 5HCBA 4F7ZA 4Y1YA 3WDYA 4KGGA 1A3KA 1W6PB 2RS32 3ME2A 1MEC2 1XE7A 1ZZ6A 1QH7A 3VZJA 1C5IA 1Q8VA 4ATEA 1B09A 1O3QA 3ZIWA 2ZKNA 2ZX4A 1OQEA 1FNYA 3RRDA 1OMIA 4LO4B 1K5MA 3J4UH 2XJSA 4LBNA 1N3QA 4E2QA 3ZSEA 2PLV2 2OW4A 2ZGTA 3AMPA 2AYHA 2ZHKA 3FJSA 2ZZJA 5GLTA 3PVEA 2WS93 3HR9A 4JGYA 1SCSA 4EN9B 3RWNA 4CDUB 1XRUA 4YZ5A 4CEWA 4EV0A 3W59A 1PO12 2JG9B 5FPZA 1ENSA 4YARA 3DPRA 4OLLA 1H1MA 3H50A 2ZJCA 4PJYA 4OI4A 3VBHA 2HWE1 3CNAA 3UKVA 1O5UA 2BTVC 2C9AA 1RIRA 2B7YA 1AL23 5FAXA 1WCSA 3WCRA 1D4M3 5D8AA 1ZRRA 1LU2A 3AP4A 5FQ0A 1A8DA 3N7MA 3HT1A 4PDWA 1G7YA 4KG0A 1FMD1 2VECA 4FPGA 3V0BB 1KFXL 1RUF1 5JZGC 1MZFA 4QHBA 4LA2A 1NYWA 2PELA 3P3PA 4AQ2A 3VKOA 5L7OB 4YZ1A 5DUWA 5KXCA 2EXKA 1QF3A 2ET7A 1WA4A 4XPVA 4M3CF 2D5FA 4E4DX 1D0GA 3HWJA 1GANA 3ENRA 4OHWA 2B46X 1YFUA 5FRAA 2WC2A 1AR92 4Y22A 3VBRA 3TWIA 1HXS2 2QDNA 2ZMKA 3KCYA 4RHV3 5T5LA 1GSLA 4FPYA 1ND3A 2ZOEB 3TAYA 5DUUA 1KJRA 4PDWB 2FBEA 5CBLA 1ENQA 2BWCA 4Z82A 3FC0A 2ZGUA 4BMBA 4YW2A 3H1WA 5E16A 5BNOA 2RS52 3NV1A 2DUPA 3N7KA 2EAKA 3GZTB 1AR83 1SLIA 3JB4C 2UY8A 1BEV1 4Y20A 2PHDA 5KXBA 3W58A 2KA3A 1FOD2 2EALA 3AM2A 4MGKE 2AENA 1YO8A 3I59B 3MF9A 2RMU2 3PNAA 5C9AC 2B8MA 1UL9A 1F8VA 1D2SA 1NCQC 1MS1A 5EXOA 3SLIA 2VOVA 5C9AB 2ZGKA 5KBFA 4PIZA 3OJBA 1COV2 3PVBB 1KJLA 5LK7B 4OHZA 1UKRA 1NCRB 3ZSLA 4LBQB 1U5ZA 3ZN6A 2YDEA 1RC6A 4N9HA 3LSEA 4H7MA 1A8MA 3R4DB 2VW2A 2Q4SA 3E5UA 2ZACA 4M00A 4E9KA 1SFYA 2PHFA 5C4WC 1UN1A 4XF3A 5BUVA 4R9CA 4CEYB 2PLV3 1REDA 2ZGLA 3OTFA 3SXWA 1AR63 4LULA 1C57A 2EIGA 1Q43A 4G3YC 3U0ZA 2TNFA 1G9DA 2IFWA 1GNHA 1ZRFA 3LA7A 4AXOA 4DQAA 5GLWA 3PLQA 2XPJA 1VAMA 4XBLA 1PO11 4AVTA 5AVAA 2GALA 1MS9A 3UJQA 4WM7B 5C8CC 1OQDA 3WW2A 3VHNA 4W6YA 4AYUA 2D6NA 4JQRA 3THTA 1IOAA 1IQAA 1SLLA 4IEYA 3GZAA 3RYKA 2ZGSA 1AR72 1LHUA 3B5LB 2DCJA 4FAHA 2YC0A 1XYPA 2A3XA 5GKAC 2R30A 3POYA 1KDKA 5C4WB 4MX3A 4G9SB 2WQZC 5BNOC 3HD8B 1FOD3 5H9QA 3AP7A 2DUQA 1NXMA 3B02A 4XFBA 5AC92 3WUCA 2HWE3 1X82A 3GF6A 3UJOA 2W52A 4CDQA 1G9BA 3ZXAC 1LKNA 5FLHA 5DG2A 1RUJ3 3AJYA 2JICA 3MIHA 1UZZA 2VNGA 5ABJC 4F3JA 3WG2A 1IS4A 4Q29A 4HKWA 4LLOA 1LECA 1AR81 2VUJA 4E4SA 1DQ1A 1WW5A 5CFCB 4XOGA 3INAA 4FPOB 2D40A 2A70A 2ZX0A 1XNBA 4WM8A 2Y26A 4XJUA 3M3EA 2DF7A 4R9BA 4AFMA 1LOCA 3M7AA 3I7DA 2Q30A 4OHVA 4BIFA 1H1IA 1MQTC 4GULA 1R091 4Q2FA 4AI2A 2VG9A 1UIKA 3AP6A 4EWDA 1SLBA 1HKDA 1QOSA 3WP4A 1L3JA 1CAVB 4B4RA 5A32A 4WBBA 3GNEA 4XMAA 1CAWB 3NW4A 4KNCA 4QGMA 1R092 3BOPA 4QPGC 5FPXA 4HLTA 2R32A 1U5IA 4AW7A 3M70A 2UWAA 1HIXA 4BIOA 4YSFA 4L92A 4QPGB 3HQXA 1N1TA 1PGW2 1RUOA 2ZHNA 1CAXB 4P9WA 4N9IA 2P3KA 5GZCA 1OPMA 3KS7A 4UW5A 1RUF3 4I02A 3H3UA 1AL22 3N36A 3LCPA 1GZ9A 1FX5A 1C8M2 3IPVA 3VDDA 4QQOA 4XEZA 3VDDC 2WFPA 4GH4C 1ZBA2 2HWC2 4YW1A 4E2SA 1J1LA 3IWZA 1AL21 3HIFA 1ZBE1 3IBMA 3U10A 3LOIA 1C28A 1VBC3 1R082 1QOTA 2WT1A 3D0JA 5CFDB 3MZHA 3VLBB 2VNRA 3WDVA 4Q4V3 1H2NA 3SCHA 1RJ7A 1AZDA 5I8YA 2WSVA 1I6XA 3BTAA 5FLIA 1G9CA 3B69A 3ZFEA 3QH6A 4LUKA 4Y5Z0 3RYRA 2YYOA 1H1AA 1PHMA 4LHKA 1ONAA 2H0VA 1WD3A 4FPFA 1UPIA 3M3IA 1VBC2 4LO5B 4AHYA 5I0UA 5BNNB 2IXCA 3K48A 5JOWA 1C4RA 4ASMB 1YRZA 2DVAA 4AF9A 3AKPA 1RUJ1 2WNUA 3POWA 4D94A 4DXZA 1REEA 4COUA 3D6EA 1CD3G 1WBLA 4Q0QA 4KWLA 2JG9A 3VBUC 4PF5A 4OFGA 4QPIC 4FPHA 2LUWA 4XE9A 3FE5A 1VBB2 4MH0E 5IT6A 2DU1A 2D3RA 1UD1A 2KM2A 4L8QA 1QDOA 1ZVFA 2DVDA 4HT1T 1QJY2 3VUOA 2P34A 4JTNA 1ULEA 3B3QE 3J8F3 3MGUA 4DS0A 1LOFC 1CAVA 1ENXA 1QU0A 4IETA 1PZ8A 4XTPA 2WFF2 5I0RA 2RR11 4JCKA 1MS8A 2VVFA 4RR3A 1X8MA 5AFBA 3NSTA 1QJZA 4QD2A 4S2GA 3I2DA 1AHSA 1H8TB 1YWKA 2UYBA 1RVF3 1OA2A 4YW5A 5HI0A 1JUHA 4GQ7A 3BALA 2AZ5A 1ZZ9A 2WA3A 1KD7A 4PIXA 4U36A 4I09A 3GZUC 2PLV1 1V6OA 2LALA 3AYEA 4P9IA 4C0BA 1F5FA 4YFWA 2WA4A 1I5ZA 3O0XA 2EAAA 4JGYB 4FTSA 1ASJ2 1YIPA 2BFUL 2JE9A 2GAUA 3QACA 3ZO0B 2RM22 4YG3A 3WOGA 4HFSA 5JOXA 1FXZA 5JOYA 4YVWA 3WW3A 2PHUA 3VL8A 2RS31 3L2HA 3H7YA 1Z7S3 3PVNA 1BKZA 5CVRA 3CJXA 4M0HA 1UX6A 5IK5A 3I4IA 2OZ6A 1VBA1 3AK0A 2JX9A 2PHXA 1YLLA 3HMYA 3S0MA 1OPOA 4URTA 3ZDSA 5JDBA 3PJQA 1FV2A 4A7YA 3AB0A 5EWSA 1CJDA 3WUDA 4YGBA 5J3UA 2HWE2 2WWSA 2VPVA 1JYCA 4R52A 4X6RB 5L73A 3JD71 3NAPC 5BNPC 1JN2P 3WHTA 4YVSC 4XHXA 2CAUA 3JD73 1RMU2 2GC3A 2DCZA 3MICA 1VIWB 2QJVA 2GU9A 5KHJA 1OA4A 1DGWX 3FUOA 1WW4A 4XQWA 2AUYA 1XE8A 2YGLA 3EQEA 1S0IA 3IDEA 3MW4A 5C33A 2BPA2 2DTYA 2QNKA 1BYHA 4OHXA 2YGMA 5JVVA 3DPRB 1LJ7A 5K9YA 2R071 4X6QB 1JH5A 2PAEA 2C1FA 4RQPB 1GKBA 4TZDA 4N43C 1ALYA 5I0TA 1PMIA 2FQPA 4YVWC 4G4FA 3R4SA 1VB4A 2DVBA 4IV1B 1H4GA 5BNPB 1PIV2 3C3VA 1X8EA 1CAWA 4Y1VA 4C0HA 1PVC1 4Q1PA 5CIRA 2O1QA 3AZWA 3V0BA 4S2FA 2K0GA 1BEV2 3ZXJA 1NA1B 4LBMA 3OYWA 4QQ2A 3ZSMA 3VV1A 2P2KA 1RHI2 2B9UA 2CGOA 3WZ1A 1JYIA 2XJQA 1AXZA 1JHNA 5T5JA 1GQHA 1YNAA 4NWVA 1IHMA 1C8NA 3VKMA 1U0AA 1VBD3 2PHLA 3VBRB 1S0DA 4JC1A 4LHLA 4XF9A 3U4XA 4P5HA 1H2MA 4XQDA 1UW8A 3D8CA 4FAGA 2VVDA 1V6NA 1MACA 1RITA 2ZX1A 3H0OA 3EHKA 4EROA 3WNXA 4B8EA 2O8OA 5FO7B 1VBC1 2R063 3FBYA 2W0XA 4ZU4A 2TUNA 5DZFA 1AR61 4YNIA 1BMV1 4N53B 2CY6A 1D4M1 4IEQA 4BOWA 4WVZA 1Y7BA 1NY71 1TME3 4GWNA 3RI8A 4JGZC 2HYKA 1W2UA 1LCLA 3O0VA 3T1MA 5JLVA 3DPRC 3QD6A 1QQP2 2BYVE 3HN1A 1DQ6A 1N3OA 4AFCA 4RD7A 2H0BA 3SHRA 3MI8A 3IKWA 3ZYGA 2ZA9A 5SV8A 2CWMA 2YPJA 4Q4X3 1EV13 4LBQD 5BNPA 4CDXC 2A3YA 3DKWA 1N1VA 2D7FA 2PN5A 1PNFA 1W6OB 2D3SA 1HRV1 4Z2WA 1TMF1 1MZ6A 4A2UA 1JOJA 3ZFEC 3ZN4A 4AEDB 2FZ2A 1NG0A 1RVF2 4J6GA 1LHWA 1KQRA 4LEJA 5K7PA 4QU2A 1IGOA 1UU5A 4LT5A 1IPJA 2GN3A 5SV5A 3OGJA 3ZXKA 2I2SA 3SNMA 5C6CA 3MEPA 2WNEA 2JKBA 3J8F1 2RM21 4XHBA 2VMGA 2R073 4FQ4A 4UW6A 3W9AA 1O4YA 2D6MA 4XETA 2W39A 4B29A 2YUEA 4IV3B 3WDWA 1QJY3 1WBFA 2GC1A 2PHRA 3ES1A 4P9YA 1CAUB 3AKTA 3OYWB 4DY5A 1J3PA 3U07A 1Q8OA 5L19A 1UIJA 1CJPA 2PYTA 1DQ4A 5DUVA 1IZ3A 3H3ZA 3SH4A 2XJUA 5LEKA 2AREA 2HEYF 4QMAA 3TNQA 4JDNA 2HEWF 2PHTA 2MEV3 4IEUA 3PTYA 2WL1A 3BODA 1A6CA 2XJPA 4FP3A 2GMPA 1SBFA 4QPGA 2DV9A 1CPMA 3CEWA 2K2SA 2GZWA 4RR3C 4HK8A 4P9LA 4RA0A 5A32B 1HQWA 1KS5A 1M4WA 4CRQA 4Q0UA 3RZZA 3JUUA 4H3WA 1G9AA 1D2QA 1LOFA 1FPN2 1ZBA3 5T5OA 4P9XA 4UBGA 1IPKA 1DF0A 2DWRA 1Q5OA 2NP0A 1BXHA 4IL7A 2WT2A 2R0FA 4WM8C 2Z2SB 1DDLA 1LTEA 3ZSJA 3KCCA 4MVTA 1O5LA 4QPIA