3WG3A

Crystal structure of agrocybe cylindracea galectin with blood type a antigen tetraose
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
163
structure length
163
Chain Sequence
KHMTTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galactoside-binding lectin
publication title Conformational change of a unique sequence in a fungal galectin from Agrocybe cylindracea controls glycan ligand-binding specificity.
pubmed doi rcsb
source organism Agrocybe cylindracea
total genus 40
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wg3A00
1Q8SA 2UWCA 1MACA 1AX1A 3CNAA 1MZ5A 1V6KA 1W6MA 2ZGQA 4BOWA 1UN1A 1AX0A 5SV8A 1SLBA 1N3OA 1V6MA 1ULCA 5GALA 2R0FA 5LK5A 4XYXA 1LECA 2GNTA 4XJWA 5JMCA 1LTEA 2DTWA 2DVDA 3AXEA 3MW3A 3ZXJA 4YLZA 1W6QA 3VKOA 4UW6A 3V0BA 1UL9A 1CPMA 1WLWA 1IOAA 1DHKB 1GANA 1EPWA 1QNYA 1QOSA 1YO8A 1AXKA 1MS1A 2D3RA 1V6IA 1WW5A 2EALA 1JOJA 3VV1A 2JDZA 3BTAA 3O0XA 1DZQA 2DVAA 4PF5A 5GZDA 2YMZA 3WDXA 3WUCA 4XXPA 2Z42A 5IK7A 1S0DA 4Q8LA 1J1TA 1KRIA 1VLNA 1H30A 1SBEA 1S0EA 3T1MA 4Y26A 2AYHA 3UK9A 1DQ0A 3L2YA 1I3HA 3OY8A 4LBOA 4YFWA 4AYUA 1DQ6A 2D44A 4XJUA 2WT1A 3WUDA 4Y22A 5CAZA 1NLSA 2ZGPA 2DVFA 3VKNA 5T5PA 3SH5A 1FNZA 1H9WA 2NMOA 4FPKA 4R9BA 2BQPA 2DYCA 5GZFA 4AVSA 1GSLA 4WV8A 3WDWA 1V6LA 3U4XA 1N1VA 4AGVA 2UWBA 2GMEA 3O0VA 3WDUA 2D6NA 2R49A 2CTVA 4Y1XA 4AGRA 1JHNA 2DUOA 2D6LX 2DU1A 2ZGOA 3OYWA 1A78A 3ILFA 2DV9A 1UKGA 3POYA 4GWMA 3IMNA 4LBLA 2AR6A 3ZXKA 3RRDA 2E7TA 1YYNA 2A7AA 2ZHNA 1IS3A 1DGLA 4TYSA 1MVEA 1MS9A 1ZA4A 4ATFA 1G7YA 2UU8A 2D6PA 1UZZA 2RHPA 1YXWA 1GICA 3ILRA 4U36A 3SH4A 3ZSKA 1AF9A 4SLIA 1QF3A 1LOGA 3I4IA 3WCRA 1LOCA 5GLVA 1MS3A 2CWMA 1FYUA 3ENRA 4GALA 1KJLA 1W0PA 2GMPA 1SLAA 4FP3A 1Y7BA 2FMDA 2ZABA 4YW3A 4DRRA 3RS6A 1LU2A 1ENSA 4XIKA 2E7QA 3B3QE 2OUJA 4JRAA 2NYYA 5IK4A 4DPNA 1LOEA 3IPVA 1W6PA 4GWNA 3SNMA 2TEPA 1GKBA 2SLIA 1BXHA 1LOAA 4UW4A 4YM0A 3WVJA 4XTMA 1S0IA 2EIGA 3Q9OA 5H9SA 5JOZA 3FBYA 3WHUA 1G9DA 4DFSA 4W65A 3USUA 5CB7A 1AVBA 4Q1RA 2R16A 1I1EA 1GLHA 1QOTA 2XB6C 1WD4A 4WVVA 2A6YA 3A0NA 3WZ1A 1QU0A 3M1HA 2VW0A 3KM5A 4BMEA 4MYEA 1LCLA 5F5QA 1V6JA 1G86A 1MS0A 1LEDA 2ZGNA 4Q8KA 2E53A 5T54A 5L73A 1JYCA 2CY6A 4HL0A 3NV4A 2NN8A 2ZAAA 4FQZA 2D3SA 2DVBA 5E88A 1H9PA 4WVWA 1NXD1 5GLZA 1Q8OA 4LBNA 4XMAA 1GZWA 4PBOA 3WLUA 4YW5A 1SCRA 2P3IA 4DQAA 1C4RA 1QDOA 1W6NB 3AP6A 3ZPYA 4YGEA 3ZXLA 3RG0A 4YGCA 1LHWA 4YFZA 3RMXA 2P3JA 3VKLA 1HLCA 4XZPA 3AZWA 2ZMLA 2WQZC 1X50A 1V00A 2LALA 3SLIA 5GZEA 2A6XA 3A0KA 1PZ8A 3N7LA 5KXCA 1LHOA 2PHFA 3WV6A 4DS0A 4FVVA 4XBQA 4PCRA 5DUWA 4YM3A 2EXHA 4D69A 2ZKNA 4Y1ZA 1RITA 2JJ6A 5DG2A 4Y20B 2ZA9A 2G4IA 3AXDA 3AZYA 1Q8QA 4K21A 1GNZA 1ULGA 4YG3A 5CNAA 3AYAA 5EXOA 4TZDA 1W6MB 2JKBA 2ARBA 2D6OX 2ES3A 3M3OA 1APNA 1MS4A 3NV3A 5DZFA 4FPCA 1IKQA 1O4ZA 1CR7A 1S0JA 2A6WA 2PHTA 3RQ0A 2A3YA 2PHXA 1HDKA 1WLCA 3NV2A 5T50A 3UJOA 3WG2A 2ZGTA 3AP4A 1LGBA 3B00A 1W6QB 3B9CA 3C2UA 3KQRA 1N47A 4K20A 4Q27A 4YZ4A 2NP0A 3VKFC 2ARXA 3WNXA 2R1DA 1JBCA 1G8WA 2AUYA 1IKPA 3AK0A 3R4UA 4P9YA 3FLPA 2OUHA 4Y1VA 2VW1A 2A71A 2R0HA 3RMYA 4R9DA 4XOGA 1ULDA 4Y1YA 4Z8BA 2JE7A 4XJAA 1SLIA 1VIWB 2P34A 2JE9A 5DUVA 1CESA 4FOQA 3T1LA 3V65A 1GV9A 2Q5TA 2W39A 2HYKA 1SACA 4FPOB 1LHUA 2A5ZA 3AFKA 4Y1UA 1LODA 1URXA 3PJQA 1CN1A 1S0BA 4YZ1A 3ZSJA 4XJZA 1GNHA 1S1AA 3WDYA 2WSUA 2DUPA 3FFZA 4FQ4A 3FLRA 4LBQB 3OY8B 4C1XA 4FPEA 2ZMNA 4XTPA 5BYNA 3O0WA 2A75A 3BODA 4BQ1A 1Z0HA 4P9WA 2D6MA 1LULA 3JU9A 4M3CF 1CONA 1N1YA 4ATEA 3BOPA 1AX2A 1Q8PA 2FHRA 3N3HA 3ZSMA 4CTEA 1LHNA 3N7JA 4XXAA 1SBDA 5T5JA 3WDVA 3R4SA 4GKXA 3TAYA 4ASMB 1LENA 2DTYA 1SLLA 3SH3A 3TB0A 1D2SA 4YGBA 3H0OA 4F83A 3AJZA 1GYKA 4JC1A 5DZGA 3OYWB 5JOWA 1UPSA 3M3CA 1LGNA 2ENRA 4M3CE 1DFQA 3QCWA 4WZFA 1MS5A 2PELA 1ULEA 1YRZA 1MS8A 3JUUA 1JN2P 2DUQA 5IT6A 5DXDA 4M01A 1VALA 4NOTA 5H9QA 1KDMA 1WCSA 1SLTA 2DVGA 3NWKA 1O4YA 4IQPA 2WT2A 1UX6A 4YG6A 5FREA 2YY1A 1LOBA 1AXZA 4ISQA 1GZCA 2GN3A 5DUXA 4XMIA 1WBFA 4P14A 2D3PA 5GM0A 3O5SA 1DQ5A 4XHXA 1N1SA 2AREA 1QDCA 2EXKA 5JDBA 5T5OA 3POSA 4ISRA 3AP9A 1SFYA 1LU1A 3V0AA 3A4UA 1FV3A 1W6PB 3D4KA 2A3XA 1QMJA 1WW7A 3N35A 4R9CA 1ENRA 3WG1A 1MVQA 1G9BA 1F31A 1SLCA 4FPYA 1HQLA 2EF6A 4GXLA 2WJSA 2PHWA 4BMBA 4FOVA 4P9XA 4UW3A 3USUB 4BM8A 3T2TA 5T55A 2EXIA 2UURA 2VY0A 3AZXA 5E89A 3W59A 3LSEA 1ZM1A 4AVTA 1SCSA 5GLUA 2JD4A 4K1YA 4YM2A 1DQ2A 1VAVA 4M3CA 3ZSLA 5KXBA 3FUQA 4YZ2A 4FPJA 3DUIA 1N1TA 2VW2A 5T52A 1V6OA 3HMYA 5GLTA 3ZYRA 1LESA 1DQ4A 4DRVA 5EWSA 2CWSA 3IN9A 3WDTA 2GN7A 3FLTA 4YW4A 1W6OA 3ASIA 2DU0A 2D7FA 4XJ9A 4RA0A 2ZMKA 5H9PA 1GZWB 1BJQA 2YROA 1JUIA 1BKZA 1WW6A 3WOGA 1CPNA 2KM2A 3INAA 1RIRA 1RINA 2ZHLA 4OZXA 1AJKA 5JLVA 2AENA 2GDFA 3PMEA 4PQ9A 4U2AA 2YV8A 1WBLA 3R05A 4FPFA 3PVOA 4XIOA 4YGDA 3I8TA 2EXJA 5IK5A 4Q26A 2E6VA 3MW4A 3AX4A 5DZEA 2GNDA 3DGTA 4PBPA 4UW5A 4CZSA 4ZXKA 4C1WA 4YW2A 1Q8VA 2W68A 3PVNA 3W58A 2GMMA 3MPPG 2W08A 5H9RA 3ZYPA 4BLIA 4KBBA 1MR5A 1W0OA 3LSDA 4YZ5A 5JOYA 5FRAA 2W52A 1JYIA 1LHVA 3HR9A 5HCAA 4JCKA 4XJ8A 1GZ9A 3NV1A 5JOXA 1KJRA 1PZ9A 2SBAA 4LBQD 3WCSA 2ZGSA 3OBRA 3M3EA 5CA6A 3WG4A 1FNYA 1TEIA 1C1LA 1DQ1A 1IS5A 2P37A 1OQ1A 5DG1A 3V0BB 5EYXA 1OKQA 5KXEA 1KQRA 2AGSA 3OBTA 4XE9A 4ITCA 2B7YA 1B09A 2GALA 2UWAA 1DYPA 3N7KA 1V6NA 2ZZJA 4AGGA 3UL2A 1N3PA 1DBNA 2VU9A 1S0GA 2C9AA 3ATGA 1MZ6A 3AYCA 1GBGA 4I30A 4XBLA 3PVEA 1C57A 4ZKTB 4FOWA 3O12A 4LBMA 1G9AA 5IUQA 3WHTA 1CVNA 3IM0A 2CYFA 3GNEA 2GNBA 3V64A 1CQ9A 4XHBA 2ZGUA 4LBKA 4Y22B 2ERFA 3AP5A 2P3KA 1KITA 1LOFC 2YZ4A 1LJ7A 1AXYA 1CJPA 1QKQA 2WSVA 1A3KA 3OPZA 4LBQA 3D5OA 3SITA 2WLQA 4R9AA 3POWA 1S0CA 3FUOA 4CRQA 1G9CA 3AYEA 1UAIA 2WNEA 4XBNA 1N3QA 1DLLA 1WD3A 4NO4A 4YG0A 5AVAA 2PHUA 2ZGMA 1HKDA 1YIFA 5GZCA 2LTNA 1PZ7A 3D6EA 4RL7A 1FV2A 2OVUA 3AYDA 5DUUA 2VUAA 1SBFA 1CIWA 1XQNA 2CNAA 3M2MA 2ZGKA 1G9FA 1QGLA 2JECA 1F5FA 4M00A 2DURA 1VAMA 2EAKA 2ZACA 3SISA 1WUVA 2CL2A 3GALA 3LCPA 1IS6A 3N36A 2ZGRA 1WLDA 2GNMA 2VXRA 2A3WA 4HANA 4XDQA 2NMNA 1LOFA 4GA9A 2XG3A 2C5DA 1DYKA 5GLWA 1OFSA 4GKYA 3OGGA 2ZHKA 2I2SA 1D0HA 1JXNA 4K1ZA 2NZ9A 4XILA 1U0AA 1WW4A 3ZXFA 3AZVA 1IS4A 3ZVXA 3VKMA 1ENQA 3MW2A 3IPVB 1BZWA 4FOYA 4Q2FA 2H0BA 5E8AA 5CBLA 2ZGLA 5HCBA 1BQPA 1UZYA 3ZXEA 1C1FA 4H55A 2V5YA 1JW6A 5F9TA 2V73A 2A70A 5T5LA 1FAYA 2WKKA 3V0AB 5KXDA 3VUOA 3ILNA 3MEPA 3OJBA 2NM1A 1LGCA 3N7MA 4FP2A 5IK8A 1A8DA 1QOOA 3UJQA 1S0FA 5GZGA 3B01A 1ULFA 2P2KA 4Q1PA 2OW4A 5GJ6A 2PHRA 5HCFA 1R1ZA 3B69A 1YI7A 1Z78A 4LBJA 2D6KA 3QLQA 3HN1A 1QNWA 4YZ3A 1FATA 1HQWA 4M3CB 1LEMA 1F9KA 1W6NA 2A6ZA 2YXSA 3WG3A 1DIWA 3AZZA 4FPGA 2D43A 2ZBJA 4AVVA 2R1BA 2AH2A 4YM1A 4FPHA 1UMZA 2WT0A 1FX5A 3BIWE 1BYHA 1KDKA 4L8QA 4FPLA 1W6OB 2ZHMA 5EYYA 3AP7A 3IKWA 1Q56A 2E51A 1AZDA 4AWDA 2VH9A 1AJOA 2A6VA 3AJYA 4BLJA 2DWRA 5JVVA 3M3QA 3RSJA 4BPZA 3APBA 4Y20A 1ONAA 4Y24A 4YW1A
chains in the Genus database with same CATH superfamily
2VTFA 5DDJ1 1MACA 1TG7A 3BCWA 5C7GA 2HEVF 2VM9A 2ZGQA 2B42B 2OZ6A 5A7OA 1R081 1UN1A 1IGOA 1PO21 1RMU3 2BGPA 4OI2A 1AX0A 4URTA 2CGOA 2E26A 2VMIA 1S55A 5B4NA 1F2NA 3NO8A 5FY8A 2QZ3A 5JCTA 1JH5A 1OQEA 1RXFA 3JQXA 1J83A 1W6QA 2YGMA 3I7DA 2YDEA 4AI8A 4UW6A 4HANA 1EPWA 4XFIA 1YO8A 3SH3A 1MS1A 2VZPA 3CDZB 1DZQA 2DVAA 3VZLA 1BEV2 3LKJA 2JDKA 4QPIB 5FMDA 4CDXA 1IG0A 4CPBD 4FXGB 5GZDA 2YC4A 5BNPA 4HK8A 1BVVA 1YNAA 1GQPA 3AL6A 3AM2A 2Z42A 3BIEA 2QE3A 1J1TA 4G3YC 5F2WA 1T6BX 3MI8A 4GB33 4HPKA 2AYHA 2RM23 5ANNA 3T2OA 3ZYBA 1HRI2 3L2YA 5APAA 1I3HA 2JDHA 4Q4V3 4YFWA 2MNGA 2WT1A 5HXMA 1W04A 5CAZA 3I3EA 3KCYA 1RYYA 4WM8C 5FZAA 4ZHNA 5DDJ3 5LA1A 5TSWA 3GBFA 3O1OA 2CU5A 1H1IA 4R9BA 5CYYA 5FY4A 5LBBA 3CKHA 1R083 3ZFGA 2R073 4AI2A 5GZFA 4TTGA 2HWF3 4XFHA 1RXGA 1V6LA 3IZOA 4O65A 4ZS3A 1N1VA 5EQUA 1ZBE1 4AGVA 2DFCA 3O0VA 1E5RA 2GMEA 2W1QA 3KZ4C 1UYYA 4MH0E 2D6NA 3KS7A 1QH6A 2VZOA 3WDUA 2BYVE 2D6LX 2DU1A 2ZGOA 4CU7A 3S30A 2Z4FA 3LDRA 4X6RB 4LKFA 1NQJA 3MDPA 2W92A 3HNBM 3IMNA 4LBLA 1O7FA 3RRDA 4RQPC 3WP4A 3NNGA 2A7AA 4PLOA 1W8NA 1IS3A 1DGLA 3T2PA 2JDYA 2LM3A 1ZZBA 1XU1A 1OOPC 5LY2A 1ZZ9A 2Z79A 4GIQA 2PQSA 3K4ZA 4TWTA 3SCHA 3RZLA 1ZNPA 3J9SA 4TN7A 4RD7A 5KHHA 4OI0A 2Y0IA 3SCFA 2VNOA 1ND3B 1UPIA 5GLVA 3PDQA 3ENRA 2V5DA 2E33A 4GALA 3S57A 1NCQA 1DGWA 3S6PA 2WZR3 1XXNA 1Y7BA 3E5QA 4EN0A 1ASJ2 4N43C 3I3MA 5CKNA 2WUHA 1EY2A 2BW8A 4PIXA 5IK4A 4DPNA 3IPVA 1W6PA 4NPRA 2TEPA 3Q8AA 1GKBA 2SLIA 4JKMA 4YM0A 1HB3A 2EIGA 3Q9OA 5K9YA 2KXLA 2BBVA 2I45A 1EV11 1X9TA 3ACIA 4COWA 1ZBE3 4FO9A 2IXKA 2VJXA 2R16A 1GWMA 4OUEA 3H8RA 1HV1A 2IXLA 1QOTA 4IEOA 1K5MC 3JB8A 1QU0A 2VW0A 2W0XA 1CAVB 3O14A 3TNQA 3MV11 2K2SA 1NE4A 3Q8BA 4R4ZA 1MS0A 5EFUA 4BK5A 4Q4Y1 5C8WA 3K77A 4IDZA 2EAAA 4LQRA 3IDBB 1X9PA 4CDUA 5FAXA 1ZYBA 1NXMA 4LPLA 4IEXA 4WVMB 4XW3A 2D3SA 1IQDC 1NCRC 5E88A 1H9PA 4QXCA 5EJ1B 2IC1A 3P3PA 1VRH1 1Q8OA 4B4RA 1PK6A 1GZWA 1C4RA 1PM7A 5A70A 1TVGA 3U1XA 5FR3A 1EUTA 4YGCA 1SFPA 1XE7A 1YFWA 2OPKA 2XL9A 3ME2A 1AL22 3AKTA 1GMMA 2WWUA 4MLOA 4B8EA 4AQTA 3WF1A 4XC9A 1HV0A 1W9FA 4FI9A 1UZWA 1RUJ2 2WQZC 3VD7A 2LALA 3SLIA 4NAMA 1SG3A 3N4MA 2C6SA 3I54A 3NMBA 3RYRA 1OUXA 5A32B 2D5HA 2ZTNA 5KXCA 1PX3A 2PHFA 3KQ4B 3WV6A 4DS0A 2ID4A 2BERA 1FPN1 1I9RA 2JDMA 3CL1A 4XBQA 5FBJA 4CXXA 4D69A 2ZKNA 4ES8A 4YM3A 5FP3A 1RITA 2G4IA 3AXDA 4JV4A 5ABJC 1PNFA 2FCTA 1XNDA 1RUG1 2K9ZA 1ZZ8A 2D6OX 1U5ZA 2ARBA 2WYSA 3NV3A 1MS4A 3RDIA 4IGQA 4N53B 2WL1A 4P02B 1CX1A 4QHOA 1VMHA 3AMHA 1UOJA 1PGL2 2PHTA 2F17A 5I8TA 3NV2A 4XFBA 3TNPB 3WG2A 2FDIA 2XGXA 3C7HA 1VRH3 1W6QB 3C2UA 1N47A 3HQXA 4OHWA 3VKFC 4P9YA 4I3PA 4NN0A 2VOVA 3OUIA 4FAHA 2XQRA 2A71A 2R0HA 1NUKA 1KEXA 3BN6A 1ULDA 1W8OA 2O8QA 2XOMA 2V4AA 4D6QA 1D7PM 1VIWB 2JE9A 5DUVA 1CESA 4FOQA 5F32A 5FYHA 3T1LA 3TEXA 3V65A 5BNOC 3D0SA 2Y60A 5E16A 1CX4A 1SACA 2HYKA 5K0UC 1RUH2 4BHPA 3AFKA 2CGPA 3PJQA 1S0BA 4FFHA 1HN1A 4GH4C 4PT6A 3X29B 1CAXA 2VVFA 4HPKB 1O4TA 2WSUA 4S2FA 4FQ4A 5L9VA 2ATFA 4EN9B 4LULA 5A7WB 3LPGA 5LCWL 1PX4A 2RMU1 3K2OA 1IZ3A 1GQGA 1W06A 3BALA 2CV6A 4QPWA 1LULA 4M3CF 4ATEA 4KWKA 2PMWB 4KG0A 2XLAA 1Q8PA 2FHRA 3MF6A 3OEAA 4MGYE 1QJZA 1RUG3 3ZSMA 3ZFGB 4Q4W1 5I8SA 4IUGA 1YJLA 3N7JA 5CVRA 5T5JA 1VBA1 4I0AA 4K40A 3TAYA 4AXOA 1LENA 1GOFA 2DTYA 1CIYA 2JB8A 3ZX7A 5FOJB 1GYKA 4GQ7A 4JC1A 4UOJA 5EPAA 4F7ZA 1QJY3 3C7EA 4QGLA 1XYOA 3OUHA 4HETA 4QD2A 1IHMA 4WZFA 1VBE1 4QB1A 1YRZA 1NYWA 4CXYA 1CGPA 3WNMA 1SMVA 4MX3A 5H9QA 3WSOA 4CUCA 4QKBA 2Q1ZB 3RI8A 5FO9B 3A21A 5JI7A 3NWKA 4RGAA 1O4YA 2WT2A 4BQ3A 4YG6A 4D7SA 2WRAA 1KFUL 2GAUA 5DAPA 3N9QA 4UYBA 5I91A 4KL1A 4OHZA 2WAOA 2W9XA 5DUXA 3BPZA 4XMIA 1CZTA 4RS5A 4LUMA 3WW2A 2JEMA 2QUOA 5LA9A 1K3IA 3NJVA 4XHXA 1N1SA 1QJX3 3VBHC 2XLGA 4ISRA 4I0WB 2VMCA 2UY8A 1SFYA 3J7HA 4LKEA 1LU1A 3V0AA 4NIDA 2Z5WA 1BVP1 1W6PB 3D4KA 1QMJA 2XH6A 2HWC1 1MVQA 1G9BA 1MQTA 3VBRC 3ZKYA 4KWJA 4TLGA 2WJSA 2PHWA 4BMBA 1UZ0A 4COUA 2QQJA 4UW3A 4W6WA 4BISA 1U5XA 1VE0A 5T55A 3CJXA 5E89A 1YUDA 1C5IA 1UXZA 4D3WA 3CZJA 3MO4A 1SCSA 2XJVA 4XF9A 2AACA 4CDWB 5JSOA 2ZAHA 4IEVA 2JD4A 1SHWB 4K1YA 1GWLA 3J26N 5FUPA 1YFYA 5KXBA 3FUQA 1SFNA 1XSQA 2Q1MA 4Q0PA 3NRUA 3WQ7A 1JYXA 1H6YA 3DUIA 2MPFA 4CDUB 1B35A 4AHXA 2RJKA 2EIEA 2VBPA 5ANQA 5GLTA 3ZYRA 3ZFEA 3PUSA 1LB2A 2ILMA 5A3NA 1AYM2 2VZTA 1OLME 2QNKA 4YW4A 1I6XA 1H8TC 2D7FA 4RA0A 5C3QA 4AHZA 3NJZA 3RFRA 2ZEXA 1GZWB 4HG6B 3E6CC 4B3NA 1VBC1 1T2XA 1WW6A 1UO9A 2K46A 4XUTA 1CPNA 2KM2A 3OD4A 2XJPA 4HXCA 2Q8EA 5FV3A 3MUY1 2AENA 2GDFA 2VL4A 3F2ZA 3BUCA 4FPFA 3R05A 2XBO1 4YGDA 2PAKA 5FZFA 4Q26A 4PBPA 3H7YA 1E57A 4UW5A 2HWC3 4ZXKA 2AEZA 3KCCA 4IV1C 3VGIA 5H9RA 3O1RA 4ZONA 3OGJA 1JZ3A 5F6KA 1JYIA 1VP6A 2HWD2 1XNAA 5FZ1A 2VZVA 4YVWC 2WZEA 1VJ2A 4JCKA 1VBB1 5HCAA 1GZ9A 3NV1A 2Y6KA 5J09A 4B1MA 2SBAA 4MVTA 1J59A 4NMIA 4KGQA 2VQUA 3KSCA 3VZNA 3WG4A 3IDAA 1DQ1A 2JB4A 2P37A 2D93A 1OKQA 2WZ8A 3KV4A 4MSVA 3WR0A 4DEVA 1QHDA 4EE2A 4CEYA 1UZVA 3OGSA 5I0DA 4IE6A 1C8NA 5D2AA 1DYPA 1V6NA 3S7IA 4LLOA 1N3PA 3FZ3A 3MFAA 1S0GA 4BQXA 4BQ4A 4A6SA 2C0ZA 4I30A 3PVEA 2EIBA 5IAVA 1VBC3 3ZDSA 3O12A 3GHNA 1QQP2 1BK0A 5JSRA 5IUQA 1RUF1 1CVNA 1AR81 1ZZCA 3GNEA 3EB7A 3HQUA 3J8F2 3ST7A 5IVVA 5L7OC 5I0TA 2GNBA 3PUIA 3V64A 4BWOA 2FCVA 4Y22B 2XBO3 3AP5A 1UYXA 1O6UA 3THDA 1AXYA 2BWAA 2WSVA 1NY72 1ZA7A 1NZCA 4RHV2 1GNYA 1UOBA 1CAXB 2WYFA 4HKOA 4P5YA 4QXHA 4R9AA 1NLRA 4XEZA 3POWA 5A7NA 1S0CA 4XFFA 3WY6A 3JCIA 3RI9A 4CRQA 3ZYFA 1YFXA 2RS32 3KT7A 2WNEA 1VBB3 2RR11 4L0PA 2B45X 2Q8DA 5FYUA 2PHUA 3GJBA 1E5HA 1PIV3 4KNCA 5CFCA 3OPTA 5LB6A 2LTNA 3ZYHA 2G19A 1JOPA 1D0GA 4RL7A 1KGYA 2OX0A 1H8VA 1OH4A 2VG9A 1ALYA 1POV3 1A34A 4C8DA 4YPJA 1HXS3 1RUC2 4IXLA 4M0NA 1QGLA 1LRHA 1PVC2 3ZFFC 4JVAA 4IETA 1OLRA 2ZACA 3SISA 4BU2A 3J7NA 4LIVA 4LHNA 4CDQC 5T3NA 1Y43B 1WLDA 2GNMA 5LK7B 4AHWA 2NMNA 2Z2SB 1LOFA 4LO8A 5FPLA 4Z1VA 1AR61 3H8OA 1OFSA 4GKYA 4NPLA 2E32A 3TN91 2FZ1A 4JHZA 4XUPA 2NZ9A 4XILA 4DZGA 1WW4A 5LEKA 5C71A 3KT4A 1R092 1IS4A 4XQDA 3VD9A 3VD5A 2EIDA 3B7MA 1ENQA 5EJ3A 5L9RA 3HD8B 4FOYA 2FQPA 4IEZA 4Q2FA 4Q4X3 3OSDA 5LBCA 3LIGA 3DPRA 4IE4A 2RDNA 3ZXEA 5HBAA 2V5YA 3A7QA 2RR13 1C8M3 2V73A 3T3YA 2JDNA 1W9YA 3V0AB 3PHMA 4CU8A 3OJBA 5IK8A 5KR7A 4IE0A 1XBFA 2IWGB 2OXBA 3VBSC 3IMMA 3UJQA 1MQTB 1UU5A 4Z82A 4ASKA 1S0FA 5BY5A 3B01A 1ULFA 4DXSA 4Q1PA 5JPMB 3GZUC 3JD72 2HWB3 4X8PA 3AVRA 3PNAA 4Q4V2 3B69A 4XACA 5L19A 1XE0A 3HT2A 1HRV1 2D6KA 4LBJA 2DDUA 2XHNA 4ARXA 3M7AA 1O3SA 3UT0A 5DDJ2 3WG3A 5ACA2 2RVAA 3HNYM 3BTXA 2Y8KA 1DIWA 1AR63 1QJU1 2X8KA 1DU3D 2R072 4JGZC 4FPHA 2HWF2 2V09A 3TN93 1UMZA 3VBOC 4BQYA 3NQHA 4XURA 3NKGA 3H3LA 4L8QA 2BZDA 2ZHMA 3H7JA 4HMZA 2QQWA 4QKNA 4CP1A 1UMHA 5EYYA 4KWLA 3U0ZA 2QBXA 4C91A 1UX7A 5JVVA 1HB2A 5FOBB 4QPGA 5FZ7A 1W39A 3RSJA 2JG8C 4LITA 1CAWA 2DVBA 5M0TA 5FZ6A 3P3NA 1UY1A 3EQEA 1AYN3 3KWVA 5IATA 1OA3A 1MZ5A 1V6KA 1W6MA 2VXJA 3ETQA 4P9JA 4ZU4A 4PI2A 2ARAA 2QKDA 5IWFA 1BMV2 5A3PA 3P6BA 1ZRCA 3LB9A 1VRBA 4RR3A 5D8AC 3H1MA 5GALA 2R0FA 5LK5A 2DCTA 2IXHA 1LECA 2W2IA 4H7MA 1VB2A 2DTWA 2DVDA 3AXEA 4HVOA 4MZUA 2WQ4A 5G04L 2WZR2 1HRV3 3RJ2X 2WFF1 3VKOA 3ZXJA 4XDPA 1CPMA 2YFZA 4MHRA 1YWKA 4Y1XA 1QOSA 3ZMOA 2D3RA 4XF3A 3VDDB 3O0XA 3K46A 5FYSA 1OI6A 1HB4A 3O1PA 3WUCA 1ZBE2 1JTZX 2BUKA 3LA7A 4XXPA 4LHLA 1IPSA 5F5IA 1JODA 2BNOA 1K45A 2Y6FA 3LWCA 5C8CA 4OMDA 3DECA 5HXVA 3QACA 1DF0A 1H30A 5BPXA 3T4VA 3GBWA 2CDOA 2P4EA 2WO7A 1X7NA 4LBOA 4AYUA 4XJUA 2D44A 1QXRA 5FK7A 3ZXDA 3U37A 1NLSA 2B39A 4HOOA 3VKNA 3SH5A 4XAEA 3U78A 3SC7X 4E4SA 2B4KA 5C6CA 4FPKA 3HBZA 2XPJA 1WMEA 5DAVA 4AVSA 4JDNA 1GSLA 3WDWA 4Y4RA 5K8SA 2BVBA 2UWBA 5IYYA 3AMQA 4ZY9A 3JZVA 5A1FA 4NHLA 4AGRA 1AL0G 4N7IA 2DUOA 4AVCA 4XCBA 2Y26A 4OHXA 4XUQA 2HJIA 1GR3A 3ILFA 4IEQA 4GWMA 3POYA 5FJHA 4Q0VA 2G9FA 2GC3A 3OOXA 4XF1A 3FHQA 1A6CA 3WNOA 5JZGC 1HJFA 4LMFA 1PVXA 5IFTA 1W3XA 4TYSA 4WVZA 5FFOC 4BK4A 2XVLA 4PLMA 4JDMA 2CGNA 1DCSA 1MS9A 1AR73 4XZUG 4OUSA 3KGZA 2IUWA 2UU8A 1UZZA 1GICA 5DMYA 1D2QA 5IVFA 4SLIA 1QF3A 2BRTA 4QX3A 4EN7B 2RS11 4QT6A 3WCRA 2VOWA 4PJYA 1MS3A 1FYUA 2C9KA 4WM8A 2X09A 5FP9A 1D4M1 2GMPA 3MIBA 3E97A 4CCCA 2RDSA 5A80A 1Y3TA 2IZWA 1LU2A 1ENSA 3I2OA 4XIKA 3AC0A 2OUJA 4JRAA 1H1MA 3S7EA 2UYAA 5JIUA 3SNMA 3ZIWA 4COZA 3VHOA 5IVJA 5JR2A 2VZ1A 5H9SA 1Q3EA 3WHUA 1VRH2 5JOZA 1RVF3 4DFSA 4A42A 4CA9A 5HI0A 5CB7A 3PU3A 2YYOA 4Q1RA 5B4XA 3DPRB 4MXWA 5FIXA 1RL3A 2XB6C 3OG2A 1WD4A 4WVVA 4RQPA 2A6YA 3A0NA 1ST8A 3URFA 1UCXA 2JG9C 3CZUA 5F5QA 1V6JA 3PTRB 4IEYA 2ZGNA 1V9U1 1EAH3 1XU2A 2R30A 3SQOA 1OOPA 4QHBA 5L73A 1JYCA 5T54A 4CSWA 5KHIA 1TNFA 4B7EA 4UFIA 4XPVA 1UNBA 4BXSV 3TOJA 4MOAA 3H42B 2R041 4QGMA 1IPJA 1F35A 1NXD1 2F6BA 2WIIB 4XF4A 4OUMA 5BV6A 1GU3A 2BWCA 4LBNA 2H6CA 5L36A 4QDRA 2RS13 3WLUA 4N43A 1O8SA 1H2NA 4LXLA 4YW5A 4DQAA 1QDOA 3QBQA 3BTYA 5I8YA 4YGEA 2E63A 1LHWA 2J1AA 4YFZA 4AAPA 5J36A 2P3JA 2PAEA 1ZZ6A 3I2HA 1HLCA 2JX9A 4QPIC 3WW3A 5LW9A 4JGYC 4FBFA 1X50A 5FYVA 1JS9A 1V00A 5CFDB 4D0QA 3KHCA 1FOD1 5F2SA 1NAEA 4HBNA 3VN4A 1K5MA 1BHGA 3GM8A 1PZ8A 2P1BA 3B9IA 1QJY2 3S5AA 4PCRA 4QPGB 5DUWA 4XVHA 2EXHA 2XMLA 2XXZA 1GOHA 2Y38A 2JJ6A 4Y1ZA 3TYJA 2ZA9A 1CAWB 4NRPA 5LY1A 1Q8QA 1ULGA 2WINB 4PI0A 2GH8A 4YG3A 1W6MB 1NCRA 2ZX3A 3M3OA 2ES3A 2R061 4W8JA 1IKQA 4E27A 1R1A3 3ON7A 5FPAA 4RR3B 1UOFA 3K75B 5T50A 3IBMA 5C9AB 4Y5TA 1QJX2 1XC6A 4YZ4A 3KQRA 1O8PA 2B5HA 2F4PA 4D94A 2ARXA 3U14A 1JI6A 4M0HA 2VW1A 5K4LA 5K7PA 2XR4A 1YHFA 2BBAA 2J7MA 2LS6A 3KF3A 3WP3A 3MLLA 4XJAA 4G9SB 1UXXX 4L9BA 1COV1 4Z92B 4XUNA 3IIIA 5BNNB 4QMAA 5DPNA 1UY4A 5A3TA 1FOD3 1URXA 1Z7S1 4YZ1A 1GOGA 4XJZA 3UGHA 4HFSA 1S1AA 1KXGA 5ABJA 2DUPA 1PO23 2VMEA 3FLRA 4V2VA 5A1AA 4FPEA 1DGWX 1NE6A 1ND3C 2C1FA 2D5FA 1QWRA 2GSYA 3O0WA 5BYNA 2ADEA 1NZIA 2VQ0A 3BODA 2XHKA 1Z0HA 4META 2VAUA 3JU9A 3MUZ1 2VVEA 4QX8A 3EO6A 3TEWA 5F37A 1DZTA 3B93A 2Y6GA 5FCCA 3LGRA 1ULPA 4CTEA 2CDPA 2R063 1LHNA 2JDPA 3WDVA 4JTOA 4L92A 2ZOEB 4LORA 2BGCA 4ASMB 3PTYA 5A6XA 5FQ0A 1VBD1 4DMIA 1D2SA 3VHPA 5EV7A 4C90A 3QOPA 4ZZ5A 1QXJA 5C4WB 1RGSA 3M3CA 1K12A 5BNOA 1DFQA 2XJRA 3BGAA 4WM7C 3JUUA 3RVHA 1W9WA 3GF6A 4OCTA 4UFKA 2HWC2 2DUQA 5IT6A 4KQ7A 2RJ2A 4NOTA 4E2SA 4ES9A 1KDMA 4IEWA 3N9LA 4GH4A 4O9EA 5FXVA 1J3PA 3HAGA 2DVGA 3LDBA 4LNVA 4Z2WA 4EWAA 1UIJA 1Z7S3 2WO1A 3N9PA 5FREA 4FCAA 1OMIA 2YY1A 1YFUA 4N90A 1WLTA 5D21A 3LEGA 1AXZA 4NHYA 3ZSEA 3UNPA 1GZCA 1FT9A 2VGDA 1TMF2 1ZRFA 2WAAA 2D3PA 1XOYA 2OQ6A 4WM8B 5GM0A 2OYZA 2VNRA 2AREA 2RDRA 5KBFA 4DY5A 2G9ZA 4NIHA 5T5OA 2ARCA 3M3IA 3POSA 4BE3A 3PUAA 3VZMA 3OPWA 4AQSA 4YNIA 4LOSA 3W20A 2X5IB 4AR2A 4ZPIA 3HT1A 3D8CA 1WW7A 4R9CA 1ENRA 1BCXA 1F31A 1SLCA 1WGPA 1HQLA 4GXLA 4QQLA 3VZJA 1OVPA 4PDWC 2RS51 1OPMA 3HOBA 2D98A 4P9XA 4QX2A 5FYIA 3T2TA 5AC91 2P17A 2UURA 3AZXA 5FMCA 1Y9GA 3UKTA 3NNLA 3EMRA 4YM2A 4K6BA 2VULA 4Q5OA 4Z07A 3DEMA 3MLJA 5FP4A 1J1LA 2XBO2 1RHI1 2R32A 4EYUA 4YZ2A 3VZKA 1JZ2A 3SMHA 1SEFA 4MV2A 1I5PA 4Q0SA 3PUQA 3W5NA 4AE2A 1YQCA 3HMYA 1NLQA 5EWSA 4CCJA 5JXGA 2GZWA 4N53C 3CJIC 3Q8CA 4LTAA 4MXVA 2YUEA 3LE0A 1MEC1 3OB8A 4XJ9A 2ZMKA 4YSFA 4NAOA 3VBHA 1OLQA 2XLFA 5J48A 4LIUA 1BJQA 4N43B 3T0AA 1PIV2 4I02A 4CEWC 5FWJA 2H0VA 3GZAA 3MGUA 3WOGA 1EV13 2ETEA 3GDBA 4FFGA 4OZXA 2JDUA 5FZ8A 1OF3A 3PMEA 4XIOA 3VBRA 2B9UA 2EXJA 3USSA 1HXS2 2E6VA 5DZEA 1REDA 3DGTA 4CZSA 1OHFA 1YCIA 4CCLA 5FY1A 1K5MB 3QD6A 3LEMA 4Q4Y3 4JRLA 2W08A 3RZKA 5CG9A 2RS53 1AR92 1O5LA 3WNKA 4BLIA 1W8HA 1LNSA 1W0OA 2OA2A 4AOCA 2PHDA 3CF6E 1LHVA 3HR9A 3ORJA 5FYMA 5JOXA 1KJRA 2VBBA 2P6HA 2ZGSA 3OBRA 5CA6A 1FNYA 1TEIA 1OSGA 4IL7A 1BLZA 1RHI3 3WF3A 1JZ7A 1NCRB 1KQRA 1CD3G 1VPHA 3OBTA 3AB0A 2W1WA 4XABA 2B7YA 1H8TA 4XE9A 3WP6A 2QQMA 1GP4A 1OQDA 1B09A 2GALA 3K3NA 2I07B 3NW4A 4UFMA 3O1VA 2ZZJA 4Q4X2 4CDXB 1OLMA 1DBNA 4LO7A 4GULA 3ATGA 2HKXA 5BNPB 1MZ6A 2C26A 2OS2A 1GBGA 1C8M2 4QX0A 1F8VA 1ULOA 2WR9A 4ZKTB 1H4HA 4EQVA 5CADA 4F8AA 5LEJA 1G9AA 1DLCA 2ZEWA 3GBGA 2YPJA 3C7OA 5HV4A 1C5HA 2XUMA 3OF1A 1FPN3 3NNFA 4XHBA 3ZR6A 3AKPA 4IV1A 4R8HA 1KITA 2HWB2 2WNUC 4YVWA 4LBQA 3NAPC 4NE9A 4DIQA 1ZZ7A 2AC1A 1Q5OA 3KGLA 3KMHA 4KU7A 3AYEA 3KT1A 1UAIA 2CAVA 5A7QA 1NG0A 2JKXA 2VOTA 3Q8EA 5A6YA 3KV9A 4XBNA 4NO4A 4YG0A 5AVAA 3P1IA 3ZYIB 3POBA 3SCGA 2ZGMA 4BIOA 1G6NA 2QQPA 1JUHA 2FDGA 3AVSA 1PZ7A 3D6EA 2GP5A 4RYDA 2IFWA 3BU7A 1FV2A 1OKOA 2PFWA 4LA2A 3WT3A 5DUUA 4EWEA 2CNAA 1S4CA 2ZGKA 5FQ0B 3WX5A 1RTVA 1HRI1 2EA7A 1PHMA 2DURA 4MGTA 5FYBA 1VAMA 2EAKA 5L7OA 4W6YA 3ZIXA 3GALA 3LCPA 5LWBA 3FX3A 2JDAA 3OEBA 4CDWC 2ZGRA 1H2LA 4XAAA 1AYN2 3MZHA 5CISA 2QQLA 4MGQA 2C5DA 3IDEA 1DYKA 4PF1A 5GLWA 3N9NA 1NCQB 2ZHKA 5IJRA 2I2SA 5I0SA 1JXNA 2XVKA 4CDUC 1U0AA 3ZXFA 1YQ2A 2RMU3 3E1F1 5FO7B 3POFA 3UV9A 1UU4A 2ZX1A 3FHIB 2HWE1 3VKMA 1F15A 3IPVB 3VBFC 3EBRA 5C33A 4DXTA 3LF7A 4Q4W3 2X53S 3RZGA 1HN0A 1VBA3 2JWPA 4IEPA 4J1WA 2UY9A 5EZWA 3GJAA 5T5LA 1FAYA 2WKKA 2ET7A 4Q29A 5FDBA 1XPWA 5FZ4A 5KXDA 3VUOA 2Q30A 2ZZQA 4UBGA 2NM1A 3N7MA 4LR4A 4A6OA 1UY3A 5FY9A 2VECA 4NIAA 3HEIA 4LO6B 5HPOA 4AAXA 3ZFFA 1VBE3 2P2KA 2QCSB 2QQIA 5C5TA 1GP6A 2OQ7A 5FZKA 4CDQA 2PHRA 1W8FA 5HCFA 1R1ZA 4JKLA 1YI7A 1Z78A 5ISLA 3M70A 3HN1A 2J1EA 2W1UA 3CQOA 1ASJ1 3AMPA 4HONA 2A6ZA 1PK6B 1TQ5A 4V1PA 4AI9A 2XDVA 4EZ4A 3NVCA 1XE8A 4AVVA 4AEDC 1I5ZA 4LK6A 4E2GA 2AH2A 3I2FA 4JKKA 4YM1A 2FMYA 5FYYA 1KDKA 2PYTA 3MIDA 4AF9A 4HN1A 2HWE3 4MGIE 1LR5A 4QX7A 2E51A 3THPA 3WW1A 1AJOA 4L11A 3JBG1 2DWRA 2YB7A 4HT1T 2F4LA 3M3QA 3VBSA 3APBA 4Y20A 1ONAA 4Y24A 2CHHA 3POEA 4YW1A 1Q8SA 2XWBB 3RMXA 5LATA 5B2GB 1AR72 1AX1A 3CNAA 4XQ4A 2QQVA 3DKWA 3L9JT 1VMFA 2TNFA 5DAXA 4Q0UA 1L7QA 1ULCA 1V6MA 4A45A 4XYXA 3J7MA 1DDLA 1PGW1 2YBSA 4YLZA 5A3UA 1TME2 4DUWA 3V0BA 3O1TA 3FFQA 4JGZA 1WLWA 1DHKB 1GANA 1QNYA 3QH6A 3VBOA 4KI5M 2J1SA 3VV1A 5JXHA 1V6IA 1DGRA 3FMGA 1JOJA 2C4XA 5FZ3A 4EN6B 1RUJ1 4LE4A 1H8TB 3DN7A 4PF5A 1RVF2 1SPPA 5EJZB 3N9OA 4N9IA 2QVSB 3T0DA 5LA2A 2BFUS 1F5JA 1NA1C 1S0DA 3LA3A 4Q8LA 5FLHA 2BTVC 2NQYA 1VLNA 1RUE2 2P6CA 1SBEA 1S0EA 2JG8A 2NLRA 1PO11 4Y26A 1DQ0A 1U5YA 2BJSA 2DCJA 2WNOA 3OY8A 3JBG3 5IW0A 1DQ6A 1CZVA 2G9GA 3WUDA 1EAH2 5FKCA 1U5IA 2A73B 5FXZA 4IE5A 4KG8A 1H9WA 2NMOA 1BBT1 1R64A 4IV1B 4JDOA 5D8AA 5FLIA 4EV0A 5KC5A 3POGA 3PURA 1PGL1 2XVGA 4YVWB 2WNVA 3KV6A 1XB9A 1W2OA 4LT5A 3U4XA 4HKWA 4CP2A 3ZPOA 4S2HA 2R49A 2VNVA 5F5CA 1JHNA 1CZSA 2G1MA 2Y0OA 2GC0A 4H2AA 3DF0A 3MPBA 4IESA 4M4RA 4V2WA 1H4GA 1VAKA 2DV9A 3VHRA 2O0OA 1BK1A 3OTFA 1AUYA 4COYA 3ZXKA 5E6HA 1HW5A 1RUJ3 1YYNA 3LZZA 2ZHNA 4NHXA 1RUH1 2Q8CA 2E31A 1MVEA 1RUF3 1ZA4A 1AR83 3DXUA 3JXSA 4AI3A 4NIIA 1RMU2 4YWAA 1G7YA 4XUOA 1STMA 5J98B 4WZCA 4ZXEA 2PLV1 3SH4A 1AF9A 1W9SA 3NL1A 3RZZA 1LOGA 4A3ZA 5L7OB 5FZ0A 2GC2A 4P9LA 1LOCA 3MICA 3RZMA 1PO13 1OBNA 2CWMA 3ES1A 5EHDA 4QQPA 1KJLA 2PQQA 3NJXA 4HZFA 1KS4A 3OD0A 2RG4A 1SLAA 4INDA 4FP3A 5F3IA 5A3LA 4RS5B 2ZABA 3R4DB 4NUBA 2QZ2A 5FMBA 4DRRA 3D82A 1PMIA 1R1A2 3PIGA 3RS6A 2E7QA 1BBT3 3B3QE 3J7LA 1K5JA 2NYYA 5JWPA 1LOEA 4J6GA 3PU8A 5FZMA 4A41A 4UW4A 4XTMA 4DO0A 3FBYA 4LK7A 1G9DA 1M4WA 4LOTA 3USUA 2IFRA 1AVBA 1I1EA 3NNJA 4HVRA 1REEA 4Q0QA 1GLHA 2D97A 4GB32 3WZ1A 2RM22 1W28A 2BVVA 2VE1A 3LFMA 5JZGA 4AI0A 4BMEA 4AZZA 1LCLA 2QDNA 1FMD1 1CAUA 2J1UA 4Q8KA 2E53A 1FOD2 2CY6A 4BA6A 3G6JB 2LROA 3W21A 2AZ5A 3NV4A 4UI9L 4AI1A 5FUIA 1B35B 1R082 1PO22 3ZFEB 4WVWA 5EP9A 2PLV3 2WWJA 2WABA 3FN9A 5FK8A 2VCMA 5A6ZA 4P08A 3ZLIA 1ENXA 3EYPA 2P3IA 1W2AX 3W5MA 4LUKA 2KD7A 3AP6A 3PLQA 4MGKE 2XONA 3ZXLA 4F3JA 3RG0A 4ET7A 3VDDC 2IXIA 1X33A 3WQBA 3AZWA 2ZMLA 2J1RA 3GHMA 5DN2A 4AEJA 4FTSA 5JPNB 3TWIA 3H1WA 4UF0A 5C4WC 3THTA 5FLJA 4AFMA 1UYZA 2A6XA 3SEPA 3U10A 3ZDVA 1TNRA 1HQNA 2JG9A 1LHOA 2IXCA 3ACLA 1XNTA 3LFIA 3N7LA 2WO2A 2YG0A 3PJYA 4FVVA 4RFT0 3HBKA 3R6SA 5F39A 3AL5A 1RUI1 3VBSB 1FXZA 3MIEA 4Y20B 4HSLA 3K4AA 5JXIA 2R6QA 4K21A 1GNZA 5EXOA 4E8DA 3TEYA 1FMD3 1ND2C 2VZQA 2BDRA 4TZDA 5A33A 5DZFA 1AYM1 4DXRA 3VD4A 1QXPA 5FP8A 3VDBA 3BPSA 1CR7A 3ROUA 4MGSA 3LA2A 1QJU3 2IVJA 4JTNA 4YVSA 4MUVA 2A3YA 1HX6A 3RQ0A 4UFHA 4CEYB 2ZGTA 3AP4A 1LGBA 3BOWA 4LEJA 5FKBA 2NP0A 4Q27A 4GWIA 4IGPA 5AFBA 4JGZB 3BB6A 3R4UA 2AUYA 5IVYA 2Y6LA 3AK0A 4IV3C 1JZ6A 3FLPA 4JGYA 2X29A 2YU1A 3UKNA 3RMYA 1RJ7A 4XOGA 4Y1YA 4D6SA 4QWNA 3VBUC 2JE7A 1SLIA 2ZPXA 3D3AA 4QQOA 1SPPB 2WC2A 5DAQA 1GV9A 2Q5TA 2XJQA 3ZMNA 1ZRDA 2V4VA 4FPOB 4A7YA 2A5ZA 2HWD1 1JYWA 1L7LA 2ZXQA 3EHKA 1GNHA 4X6QB 2WS91 3WDYA 3FFZA 3OY8B 4C1XA 4Z2AA 1W2UA 2ZMNA 3MBWA 3D0JA 3I2GA 4XTPA 4AQ2A 2FD8A 1OURA 3NSTA 3LD8A 1RUI3 4O7XA 3ABZA 4UT5A 4L97A 3I49A 4BQ1A 4P9WA 4S2DA 1RC6A 2VMDA 2YBKA 3BOPA 1AX2A 1EYBA 2L9LA 2WFF3 5D8AB 1AHSA 5CFCB 4LA3A 1WMXA 2WNVB 2VZSA 3HJRA 3ACFA 3R4SA 4GKXA 4TSVA 2CSGA 4OULA 5C70A 3TB0A 2GP3A 4YGBA 5A3OA 1EV12 4AFAA 4AQ6A 1QQP1 3DPRC 4QAWA 5DZGA 2Y33A 3UGFA 4M3CE 1WKYA 3HQRA 3I2IA 3QCWA 1XYNA 2LUWA 3ZO0B 1MS5A 1ULEA 4AW7A 1QJFA 4JAAA 4M01A 5DXDA 1PMHX 1NY71 4Q4Y2 4HN0A 4QX5A 4RHV1 2FCUA 4AVAA 5FUNA 3MHZA 4UBHA 1W8ZA 4IQPA 1ND3A 5FPVA 3LAGA 5CZKA 2VQAA 4ISQA 2P3YA 2WS93 4HVQA 4P14A 4HKLA 5IVBA 1JYVA 3O5SA 4ZU5A 2OT7A 3OGRA 1RHI2 1W8WA 5F3GA 5JDBA 2EXKA 2TUNA 2VUJA 3HPNA 1X36A 2OZJA 4ZU7A 1JZ4A 2VNGA 4IGOA 1UY0A 1FV3A 2E7AA 2A3XA 3N35A 1RUC1 2VO5A 4AK3A 5CFDC 2EF6A 1PVC1 4FAGA 3USUB 2EICA 3FBMA 5JMOA 3MYXA 4NROA 2EXIA 4JQTA 3O7OA 2VY0A 1TE1B 3T0BA 2QQKA 1DGRN 1W8UA 3T2QA 3W59A 1ZM1A 4WM7A 3THCA 5JZGB 5AVPA 5GLUA 4DUVA 1FPN2 2H6BA 4WBBA 1J3RA 3KF5A 3E5UA 2EVXA 3T09A 4FXKB 2VW2A 5T52A 4E4DX 1PNGA 4WVMA 1POQA 2GU9A 1R091 1UY2A 4XFAA 1DQ4A 1D4M3 1UD1A 1RUG2 3A22A 4P9GA 3WDTA 2GN7A 4M4PA 4JHTA 4EJRA 4QHZA 5FY0A 4BZ4A 1W6OA 3ASIA 2XUEA 3RZJA 2DU0A 3MFCA 3ZM8A 1YI9A 1GP5A 1V0AA 5H9PA 3UESA 2YROA 2GC1A 3GCWA 4UXAA 2ZEZA 1RIRA 4GWJA 1ZBA1 3J4UH 4U2AA 4ONUA 4PQ9A 1WBLA 4PDWA 4EROA 2PN5A 5A32A 5BNNC 4KBZA 4UF0B 2N7GA 3JD71 4OI4A 4I2OA 1RUD1 3R0RA 4NR1A 4C1WA 1T6GC 1Q8VA 3PVNA 4XQWA 4ZS2A 1PVC3 1V9U3 2GMMA 2JG9B 4PIZA 3A23A 3VL8A 1EP0A 1MR5A 3LSDA 4YZ5A 5JOYA 1Y4WA 2W52A 4OZOA 5FMOS 2HH9A 4XJ8A 5FPZA 2WA4A 5ACA1 5I93A 1P8JA 4DY3A 2QDRA 4LBQD 4YYOA 2R043 5FO8B 5KHJA 1GUIA 4NVPA 2R071 2HBTA 2HWF1 4N53A 1OQ1A 2DBNA 2RMU2 2VCAA 3CJIA 5EYXA 2AGSA 2OKXA 5A33B 4OVEA 4JX0A 1R093 5CKMA 5FMOL 2UWAA 1X8EA 2HLEA 3N7KA 4AGGA 4YVSB 3AKSA 3UL2A 4YARA 1H2MA 4Q4W2 2VU9A 5FZOA 4CEWA 4ZZ8A 2C9AA 1VBA2 4AFDA 2HEWF 3AYCA 2FBEA 4E8CA 4XBLA 5C8CB 4S2GA 3OUJA 4NRMA 5FZ9A 3M4FA 3T4HB 4FOWA 4JGYB 3I97A 2IXJA 2VUDA 2W87A 2PXJA 3IM0A 2Y6JA 4PQQA 4XFGA 1BMV1 4K7JA 1ZBA3 2ZGUA 3H1YA 4GAZA 1VBE2 2P3KA 1LKNA 1CJPA 2RE9A 1A3KA 3JD73 2JD9A 3OPZA 4CU6A 1RUD3 3S0MA 3D5OA 3U07A 3UETA 5F1RA 4LO4B 4CCNA 2WZR1 4KH9A 4NJ4A 3BU0A 5A7WA 3FUOA 1KFXL 2XJSA 5KWRA 4DEQA 5ACA3 1YEWA 2WN3A 2VC9A 3I3DA 1YIFA 1YLLA 3KVAA 5GZCA 2X10A 5BXXA 1W2TA 2PHLA 1YC61 1ZRIA 2QTWB 2X5IC 2FDKA 2VMGA 3ACGA 1TZOA 2HWE2 2OVUA 3AYDA 4ARYA 2VUAA 5K0UA 4TXWA 3TEZA 1XQNA 1RUOA 1VMJA 2WN2A 3P5BA 1HJGA 2R7EB 5IVCA 2JIGA 3BYWA 3EXUA 3GZTB 4M00A 1COV3 4Y5Z0 3JB4C 2O1QA 1ODNA 1WUVA 1US2A 5FXXA 4CP9A 4QB2A 1IS6A 3N36A 3I59A 1XSRA 2A3WA 2W3JA 4AFCA 2WZPP 4AEKA 2XG3A 2WNUA 4QDSA 3BTZA 3OGGA 5LA0A 1D0HA 3NAPA 3FE5A 2IVIB 5FY7A 4A2UA 1WA4A 3AZVA 4QKFA 3O1SA 3CU7A 5L9BA 4NHMA 4GZ9A 5A3MA 1RJ8A 5E8AA 4UAPA 5CBLA 5HCBA 3DYOA 5KHGA 1PGSA 1C1FA 3UGGA 2BU9A 1JW6A 5F9TA 4DXZA 1VBC2 4MXWB 1VBD3 3VZOA 3E5XA 4GMP0 4RQPB 4Y5SA 3WF4A 3ILNA 3MEPA 1W3VA 1A8DA 4XDOA 1EUUA 3T30A 4RSUA 4BB3A 4EN8B 3IB3A 3ECQA 4IE7A 3OBZA 1OOPB 4I0BA 4GMP1 4BDVB 1HB1A 2Y6HA 4D6RA 4CDWA 4FSJA 3IT8A 3JBG2 4A44A 5FZEA 1QJEA 2NPIA 4D8MA 4WM7B 3QLQA 4N7UA 1QNWA 4Y4YA 2BOJA 4XFCA 1LEMA 1YQ5A 1VBB2 2B46X 4QXKA 1W6NA 4BIFA 1W99A 2JIJA 1ZX5A 3AZZA 2V72A 3LDKA 2D43A 4FPGA 1O3TA 1OH3A 3WW4A 5KC6A 3VBFA 2WT0A 1FX5A 1BYHA 4FPLA 1W6OB 2K0GA 2MEV1 4LHKA 4ORFA 4CDXC 1PGW2 3IKWA 1AZDA 2WWSA 3I2KA 4AWDA 4K8FA 5FZIA 4URAA 5BNPC 2VH9A 1WMDA 3L2HA 2A6VA 3AJYA 4P5HA 2WLPA 1UWWA 2Y34A 1D4VB 1OA2A 5AC93 3KD4A 5FPBA 1O3RA 5FP7A 5HV0A 4NIGA 2XJTA 1W90A 2WQ8A 3IAQA 2UWCA 4UFJA 1RUF2 4PDWB 1AR82 4QX1A 3RNSA 4BOWA 5F3CA 1NKGA 4IERA 1OD3A 5FBZA 5SV8A 1SLBA 2XKPA 4H14A 5CIRA 1N3OA 1Q43A 1JZ8A 1OF4A 4CCOA 4GMP3 3SXWA 1PO12 2JENA 2GNTA 3M8LA 1IPKA 1H0BA 1LTEA 2J1VA 4RGGA 3MW3A 4XJWA 3ZFGC 5C5UA 4NWWA 5JMCA 5FZLA 4A7ZA 4AEDA 1UL9A 3POJA 4X8NA 1MEC3 1IOAA 2ADDA 3M2MA 1BBT2 1OT5A 2RR12 2RV9A 1AXKA 4K9SA 2EALA 1WW5A 3CJIB 4YW3A 5IHRA 5JUVA 2JDZA 3BTAA 1OC1A 3F95A 3FHAA 1O59A 1CWPA 5JR7B 4B4PA 2BP6A 2YMZA 1ODMA 3WDXA 2XKOA 5FZOB 4CEWB 3H3UA 1QJY1 2MEV3 5IK7A 3FC0A 3BKZA 2FDHA 1VR3A 1KRIA 1NQDA 4AL9A 3T1MA 4B29A 3UK9A 5CEHA 2VD7A 4DINB 4CE8A 4Y22A 3RYPA 5ABJB 2ZGPA 2BEOA 2DVFA 3C7FA 5T5PA 1JMUB 1FNZA 1MZFA 2B9VA 3H3ZA 2VMFA 5J3UA 1NCQC 3RGBA 1AR62 3HNMA 3VB9A 1BEV1 2BQPA 2DYCA 2ZX2A 3MIFA 3TN92 4RN5A 4QU1A 2PLV2 4WV8A 1QJX1 4AEMA 2OPWA 3MIHA 4RFRB 5J7MA 1X82A 1IG3A 3ZXGA 3H9AA 3VHNA 1K42A 2CTVA 4UWDA 5F5AA 5FXWA 3I2DA 3LIHA 4KMQA 3RWKX 4AFBA 3OYWA 3ZYGA 3IIAA 4CPBA 1A78A 4QGNA 1UKGA 3CBNA 3NKTA 2VZ3A 2AR6A 4XF0A 5G05L 1GQHA 1H6XA 2E7TA 1NA1A 2VVDA 5BNOB 4TLFA 3K3OA 3RZHA 2JXAA 1WWYA 3GXUA 5K0UB 3RPQA 4ATFA 5FJKA 2D6PA 2RHPA 1YXWA 3ILRA 1GZTA 2ZX0A 4GH4B 4U36A 5FTTC 5A7PA 3ETPA 3ZSKA 2ZS6B 3H50A 3NNMA 1LAJA 2CAUA 3I4IA 3AKQA 1O3QA 4CP9B 2DBIA 4E4HA 3I59B 1GWKA 1HRV2 1FMD2 4QM8A 1SQ4A 1W0PA 5JAXA 2WNUB 1PK6C 2FMDA 4P9IA 4BH9A 2KA3A 2RDQA 3NAPB 3SKVA 4FTBA 3POIA 4CCEA 4A7KA 3H8UA 1QJU2 4GWNA 4LO5B 3DYPA 3ZXAC 3WVJA 1BXHA 1LOAA 2BPA2 1BEV3 1WCKA 3UYJA 1S0IA 4LHSA 1M06G 4BJ0A 3MF9A 2A1XA 4W65A 4CUGA 1H1AA 4BQ2A 1QY4A 3ITQA 4H3WA 3BI3A 2O8OA 2JE8A 3C8XA 3M1HA 2BNNA 4QPYA 3KM5A 3PUHA 4MYEA 1HRI3 1Y9MA 1G86A 3WQ1A 1LEDA 3LOIA 3HN3A 3DXTA 4OMCA 5IFPA 1XJAA 3DCQA 4HL0A 4HK9A 1E5IA 2NN8A 2ZAAA 3VDCA 1RB8G 3IAPA 4FQZA 4AHYA 1IQAA 5LBFA 1SDDB 1TMF1 2WBKA 5GLZA 4K8RB 1RUI2 4XMAA 1J3QA 4PBOA 5C3SA 1SCRA 3VBHB 4RGKA 1W6NB 4LE3A 2HBUA 2WFF2 3ZPYA 5FPXA 2UYBA 2W46A 2HEYF 3PL0A 4YW6A 3WXPA 4IEUA 5I0UA 3VBFB 3VKLA 2ZCWA 3KHBA 4XZPA 4MO3M 2Q4SA 4PLNA 4QKDA 3TBDA 3VBRB 2J1TA 3SKJE 4Y33A 2W95A 4JQRA 4E2QA 5GZEA 3A0KA 2YHJA 2Y64A 5FZCA 1WMFA 4A3XA 5BUVA 2VUCA 5I0RA 1JYNA 1NT0A 3OBAA 4QQHA 3WF0A 3ZN6A 5DG2A 3ZKUA 2B8MA 4QXBA 3AZYA 5CNAA 3AYAA 4BCUA 3U11A 4QU2A 1L3JA 2JKBA 1APNA 1SDWA 1PMJX 1AL21 1ASJ3 4FPCA 3HWJA 1O4ZA 1QIQA 1UQXA 4CCKA 1W2NA 1S0JA 2A6WA 2WS92 4H7LA 5KHKA 4E4ZA 2PHXA 1HDKA 1WLCA 1POV0 2WDBA 1PIV1 1TMF3 3DKQA 3MV01 1WCDJ 2J42A 3B00A 4K20A 3B9CA 3GZEA 4AEDB 1YJKA 3BVCA 2YU2A 3ALQA 3VDDA 3WNXA 2R1DA 1JBCA 1G8WA 4Y1VA 1IKPA 5DABA 2ORZA 2OUHA 1W05A 4BYYA 1POV1 4OFGA 4R9DA 2LW8A 4LKDA 1HXS1 2MHFA 3G7DA 3LPFA 5C4WA 4Z8BA 5E1RA 4OQ9A 2P34A 5IVEA 4GD4A 5IAXA 1JHJA 1MZEA 2W39A 2VCCA 4PIYA 3S5QA 3KCXA 2YBPA 5C3RA 2VZUA 2BFUL 2P5BA 1LHUA 1AR91 2Q0AA 1VB4A 4Y1UA 1LODA 1YQ6A 2WO3A 1CN1A 1S2KA 3DV8A 5JI9A 3ZSJA 1WA6X 2I74A 3HIFA 3VD3A 4BQ5A 4CCDA 4LBQB 3Q8FA 2KR2A 4FTEA 3HVDA 1ND2A 2RS12 2A75A 3K4DA 1FI2A 2AEYA 2D6MA 3KV5A 1ZVFA 3B5LB 1CONA 1D4M2 1N1YA 2VR4A 4HSJA 1S2EA 4RS5C 5JIAA 3N3HA 1SZBA 2XQXA 4Q4X1 1ZRRA 4NPMA 1AL23 4O61A 4XXAA 4YRDA 5A6QA 1SBDA 2DF7A 1C8M1 1SLLA 5J1XA 4QM9A 3MLKA 1C28A 1H2KA 4IV3A 1MQTC 5FZDA 3H0OA 4F83A 3AJZA 4DUXA 5EIYB 4C0BA 3OYWB 2QQUA 3VBUA 5JOWA 1UPSA 2GH2A 1UOGA 1L7RA 4FFIA 1LGNA 2ENRA 4A4AA 1US3A 4GJZA 4FT8A 2PELA 3GYDA 1MS8A 1NA1B 1S2BA 1JN2P 3AFGA 3DYMA 5FYZA 2HWB1 2FDFA 1VALA 2BOIA 4BXFA 1V9U2 1DG6A 1WCSA 1O5UA 1SLTA 4MG2A 2HYXA 1AR93 1B35C 1UX6A 3ZYJB 2FDJA 4UFLA 1LOBA 5LASA 3ZFEC 3WNLA 2J22A 3T08A 2GN3A 2R042 2ZJCA 1WBFA 3E6BA 4XCAA 4W6XA 5DAWA 3WP5A 5LZ6A 1DQ5A 3ZN5A 5D1IA 3H8XA 5DQ0A 1QDCA 3VLBB 3ZOIA 4LJHA 3C3VA 3AP9A 4NRQA 3RJRA 1W8TA 2W47A 1DP0A 2ET1A 3A4UA 3WEZA 3WG1A 4COVA 1XYPA 2ZKLA 2QFEA 4NHKA 4FPYA 1XNCA 3CMGA 2VCBA 3N9MA 4FOVA 3B02A 1RUNA 4BM8A 2W5FA 1RUH3 3ZFFB 4MHUA 4OHYA 3LSEA 1OXCA 1AYN1 2DCYA 3SEEA 4AVTA 5FZBA 4CDQB 1GFF2 4OHVA 4R4XA 2WA3A 3I2JA 1DQ2A 1VAVA 1ZBA2 4M3CA 2Q1FA 5CU1A 5SV5A 1J58A 3ZSLA 4C0HA 5JSPA 4FPJA 2Q8OA 4K3UA 1N1TA 5FWEA 2BNMA 1V6OA 3UJOA 4YW7A 5A1LA 3NJYA 4IW3A 1UF2C 1RUD2 1LESA 3ELNA 3LQCA 4DRVA 2CWSA 3IN9A 2R062 2PAMA 2PTMA 4CEYC 3O1MA 3I3BA 3PMSA 5J96B 1XNKA 1JUIA 1BKZA 4B1LA 1OFNA 3INAA 5JLVA 1RINA 2ZHLA 3K48A 1AJKA 1YIPA 5FYTA 5FY5A 5CFDA 2VTXA 2YV8A 3KB5A 3B94A 3PVOA 1JYTA 3FL7A 3I8TA 5IK5A 3MW4A 3AX4A 3KVBA 2GNDA 3LEIA 1JU4A 1COV2 4LLFA 1O91A 4YW2A 4LKSA 2QJVA 2W68A 3W58A 3MPPG 3ZYPA 2YPDA 4KBBA 1Z7S2 5FRAA 1XNBA 1WZXA 1MPXA 3ES4A 2DFBA 5F8PA 3ZN6B 5FZGA 3V56A 1OPOA 1DYOA 1PZ9A 5C9AA 1X8MA 5AFEA 3WCSA 3M3EA 2FZ2A 1C1LA 4D7YA 1IS5A 2E9QA 1OD5A 5DG1A 3V0BB 5KXEA 1JU3A 4JZRA 3E6DA 4QQ2A 4I09A 1W0NA 2C24A 4ITCA 3VBOB 4QPIA 5CFCC 5J37A 2WNVC 1J84A 2XL7A 2W1SA 4D7TA 3K51A 1WCUA 2YFUA 1F4AA 5F3EA 4AVBA 1VBD2 1C57A 1XRUA 1QEXA 1Y9QA 2VOKA 3WNNA 3QH7A 4LBMA 3WHTA 2JG8B 2BGOA 1AR71 2CYFA 2D40A 3ZR5A 5BNNA 3WF2A 3VL9A 4R52A 1CQ9A 4EZHA 3LEKA 4LBKA 2ERFA 1W9TA 3UKVA 1LOFC 2YZ4A 1LJ7A 4DNYA 3AMMA 1QKQA 1UU6A 4HLTA 3WNPA 4FFFA 4CVUA 1HIXA 1UYPA 2ZEYA 5A3WA 3SITA 2WLQA 3W9AA 1TME1 1AYM3 3KLSA 4W50A 1G9CA 4CCMA 2WFPA 1OVSA 1C3HA 1ND2B 4O9GA 3TRSB 4CUAA 1N3QA 1DLLA 1WD3A 2YGLA 2LRPA 1HKDA 3WINE 4B4QA 1EPZA 1W03A 1RVF1 1JOBA 3J8F1 4MGZE 3O1UA 3U4SA 2PA7A 2YC0A 4J1XA 4ASLA 4MADA 2W94A 1SBFA 4E9KA 1CIWA 1RUE1 3EJKA 1UKRA 4L2NA 4DB5A 5JXJA 1G9FA 4IV3B 2JECA 1F5FA 3VDAA 2RS52 4KWUA 3VBUB 5AC92 1EAH1 2CL2A 4GJYA 4CXWA 4AG4A 2HWD3 2ORXA 1DZRA 2RS31 2VXRA 2RJLA 4SBVA 4XDQA 1JZ5A 1ZREA 4EWDA 4GA9A 3IDCB 5LRSA 5CKQA 3LOBA 2VBDA 3IWZA 5ERLA 3CHXA 3OGVA 4K1ZA 4PHZA 4KU8A 4DOUA 2VQTA 3CEWA 4G4FA 3RWNA 1OUSA 3U75A 1KS5A 2VOXA 1F4HA 3ZVXA 2ZX4A 3MW2A 5C3OA 5C3PA 1BZWA 1V70A 1TME3 2H0BA 3DL3A 2OIIA 1MEC2 2TBVA 2ZGLA 1BQPA 1UZYA 3CO2A 3OCPA 4H55A 1NX9A 2X5IA 3ZN4A 1YQ8A 2A70A 2VPVA 3ACHA 4QDQA 3I3QA 5FPUA 1CAVA 4I01A 4OYUA 1KD7A 1CJDA 1QQP3 4QPGC 2W91A 3CIHA 1LGCA 3FJSA 3GGLA 4FP2A 5A7SA 3J8F3 3SHRA 2Z69A 1QOOA 1RMU1 2MEV2 4N9HA 2O14A 4QB6A 1CAUB 5F7UA 5GZGA 2VZRA 4Y3OA 4KGGA 2OW4A 4XETA 2DCZA 5FZHA 5GJ6A 3WD5A 4CU9A 1RUE3 4B7KA 4CYDA 1REFA 4P00B 3PIJA 5LRRA 2QQOA 1UW8A 4RHV3 4OI1A 4N8MA 4RR3C 3AKRA 4J25A 3RYKA 3PVBB 4YZ3A 1FATA 1HQWA 4M3CB 4W4ZA 1NOVA 1E5SA 1F9KA 3AMNA 1R1A1 2RS33 2YXSA 3CLPA 3MIGA 4I3GA 1PM4A 4NWVA 5C9AC 3FWEA 2VMHA 2ZBJA 2JICA 2R1BA 1WCQA 5GKAC 3BIWE 1UIKA 2BV4A 3WQ0A 5F6LB 3GCXA 5HCHA 5LBEA 1QH7A 3C7GA 1A8MA 4YVSC 4CP0A 3AP7A 2XJUA 3JQWA 4CUBA 4L99A 1Q56A 2XWJB 2DCKA 2YC2A 4OQ8A 4GB31 2QQNA 5FYCA 1RUC3 2RM21 5CG8A 4BLJA 1ACCA 1U12A 4Q4V1 5BNQA 5C8CC 4OLLA 2X05A 4BQWA 4BPZA 2VTXJ 1UMIA 1OA4A 3FLTA
chains in the Genus database with same CATH topology
5DDJ1 1MACA 3BCWA 2HEVF 2ZGQA 2B42B 2OZ6A 1R081 1UN1A 1IGOA 1PO21 1RMU3 4OI2A 1AX0A 4URTA 2CGOA 2VMIA 1S55A 1F2NA 3NO8A 2QZ3A 5JCTA 1JH5A 1OQEA 3JQXA 1W6QA 2YGMA 3I7DA 2YDEA 4AI8A 4UW6A 4HANA 1EPWA 4XFIA 1YO8A 3SH3A 1MS1A 1DZQA 2DVAA 3VZLA 1BEV2 3LKJA 4QPIB 4CDXA 4FXGB 5GZDA 5BNPA 4HK8A 1BVVA 1YNAA 3AM2A 2Z42A 2QE3A 1J1TA 4G3YC 3MI8A 4GB33 4HPKA 2AYHA 2RM23 1HRI2 3L2YA 1I3HA 4Q4V3 4YFWA 2MNGA 2WT1A 5CAZA 3KCYA 4WM8C 5DDJ3 5TSWA 3GBFA 1H1IA 4R9BA 3ZFGA 1R083 2R073 4AI2A 5GZFA 2HWF3 4XFHA 1V6LA 1N1VA 4AGVA 1ZBE1 2DFCA 3O0VA 2GMEA 4MH0E 3KZ4C 3WDUA 2D6NA 3KS7A 1QH6A 2BYVE 2D6LX 2DU1A 2ZGOA 3S30A 4X6RB 1NQJA 3MDPA 3IMNA 4LBLA 1O7FA 3RRDA 4RQPC 3WP4A 4PLOA 2A7AA 1IS3A 1DGLA 2LM3A 1ZZBA 1XU1A 1OOPC 1ZZ9A 2Z79A 4GIQA 4TWTA 3SCHA 1ZNPA 3J9SA 5KHHA 4RD7A 4OI0A 2Y0IA 3SCFA 2VNOA 1ND3B 1UPIA 5GLVA 3ENRA 4GALA 1NCQA 1DGWA 3S6PA 2WZR3 1XXNA 1Y7BA 3E5QA 4EN0A 1ASJ2 4N43C 1EY2A 2BW8A 4PIXA 5IK4A 4DPNA 3IPVA 1W6PA 4NPRA 2TEPA 1GKBA 2SLIA 4YM0A 2EIGA 3Q9OA 5K9YA 2KXLA 2BBVA 2I45A 1EV11 4COWA 1ZBE3 4FO9A 2IXKA 2R16A 1HV1A 2IXLA 1QOTA 4IEOA 1K5MC 3JB8A 1QU0A 2VW0A 2W0XA 1CAVB 3O14A 3TNQA 2K2SA 1NE4A 5EFUA 4R4ZA 1MS0A 5C8WA 4Q4Y1 2EAAA 3IDBB 4CDUA 5FAXA 1ZYBA 1NXMA 4IEXA 4WVMB 4XW3A 2D3SA 1NCRC 5E88A 1H9PA 2IC1A 3P3PA 1VRH1 1Q8OA 4B4RA 1PK6A 1GZWA 1C4RA 1PM7A 4YGCA 1XE7A 1YFWA 2OPKA 2XL9A 3ME2A 4MLOA 1AL22 3AKTA 4P9JA 4B8EA 4AQTA 1HV0A 1RUJ2 2WQZC 2LALA 3SLIA 3N4MA 3I54A 3RYRA 5A32B 2D5HA 2ZTNA 5KXCA 2PHFA 3WV6A 4DS0A 4XBQA 1FPN1 1I9RA 3CL1A 4YM3A 4ES8A 4D69A 2ZKNA 1RITA 2G4IA 3AXDA 4JV4A 5ABJC 1PNFA 1XNDA 2K9ZA 1RUG1 1ZZ8A 1U5ZA 2ARBA 2D6OX 3RDIA 3NV3A 1MS4A 4N53B 2WL1A 3AMHA 1PGL2 2PHTA 5I8TA 3NV2A 4XFBA 3TNPB 3WG2A 2XGXA 1VRH3 1W6QB 3C2UA 1N47A 3HQXA 4OHWA 3VKFC 4P9YA 4I3PA 4NN0A 2VOVA 4FAHA 2A71A 2R0HA 1ULDA 2O8QA 1VIWB 2JE9A 5DUVA 1CESA 4FOQA 3T1LA 3V65A 5BNOC 3D0SA 5E16A 1CX4A 1SACA 2HYKA 5K0UC 1RUH2 4BHPA 3AFKA 2CGPA 3PJQA 1S0BA 4GH4C 3X29B 1CAXA 2VVFA 4HPKB 1O4TA 2WSUA 4S2FA 4FQ4A 2ATFA 4EN9B 4LULA 2RMU1 1IZ3A 1GQGA 3BALA 2CV6A 1LULA 4M3CF 4ATEA 4KWKA 4KG0A 2XLAA 1Q8PA 2FHRA 3MF6A 4MGYE 1QJZA 1RUG3 3ZSMA 3ZFGB 4Q4W1 5I8SA 5CVRA 1YJLA 3N7JA 5T5JA 1VBA1 4I0AA 3TAYA 4AXOA 1LENA 2DTYA 3ZX7A 5FOJB 1GYKA 4GQ7A 4JC1A 4F7ZA 1QJY3 4QGLA 1XYOA 4HETA 4QD2A 1IHMA 4WZFA 1VBE1 1YRZA 1NYWA 1CGPA 1SMVA 4MX3A 5H9QA 2Q1ZB 3RI8A 5FO9B 5JI7A 3NWKA 4RGAA 1O4YA 2WT2A 4YG6A 4D7SA 1KFUL 2GAUA 5I91A 4KL1A 4OHZA 5DUXA 3BPZA 4XMIA 4RS5A 4LUMA 3WW2A 2JEMA 2QUOA 4XHXA 1N1SA 1QJX3 3VBHC 2XLGA 4ISRA 4I0WB 2UY8A 1SFYA 1LU1A 3V0AA 2Z5WA 1BVP1 1W6PB 3D4KA 1QMJA 2XH6A 2HWC1 1MVQA 1G9BA 1MQTA 3VBRC 4KWJA 2WJSA 2PHWA 4BMBA 4COUA 4UW3A 4W6WA 1U5XA 5T55A 3CJXA 5E89A 1YUDA 1C5IA 4D3WA 1SCSA 2XJVA 4XF9A 4CDWB 5JSOA 2ZAHA 4IEVA 2JD4A 4K1YA 3J26N 1YFYA 5KXBA 3FUQA 1SFNA 2Q1MA 4Q0PA 3WQ7A 3DUIA 2MPFA 4CDUB 1B35A 4AHXA 2RJKA 5GLTA 3ZYRA 3ZFEA 1LB2A 2ILMA 1AYM2 4YW4A 2QNKA 1I6XA 1H8TC 2D7FA 4RA0A 4AHZA 3NJZA 3E6CC 1GZWB 4B3NA 1VBC1 1WW6A 1CPNA 2KM2A 3OD4A 2XJPA 2AENA 2GDFA 4FPFA 3R05A 2XBO1 4YGDA 2PAKA 4Q26A 4PBPA 3H7YA 1E57A 4UW5A 2HWC3 4ZXKA 3KCCA 4IV1C 3VGIA 5H9RA 3OGJA 5F6KA 1JYIA 1VP6A 2HWD2 4YVWC 5HCAA 1VJ2A 4JCKA 1VBB1 1GZ9A 3NV1A 5J09A 2SBAA 4MVTA 1J59A 4KGQA 3KSCA 3VZNA 3WG4A 1DQ1A 2P37A 2D93A 1OKQA 4MSVA 3WR0A 1QHDA 4CEYA 1C8NA 1DYPA 1V6NA 3S7IA 4LLOA 1N3PA 3FZ3A 3MFAA 1S0GA 2C0ZA 4I30A 3PVEA 1VBC3 3ZDSA 3O12A 3GHNA 1QQP2 5JSRA 5IUQA 1RUF1 1CVNA 1AR81 1ZZCA 3GNEA 3J8F2 3ST7A 5L7OC 5I0TA 2GNBA 3V64A 4BWOA 4Y22B 2XBO3 3AP5A 1AXYA 2BWAA 2WSVA 1NY72 1NZCA 4RHV2 4HKOA 1CAXB 4XEZA 4R9AA 1NLRA 3POWA 1S0CA 4XFFA 3WY6A 3JCIA 3RI9A 4CRQA 1YFXA 2RS32 3KT7A 2WNEA 1VBB3 2RR11 2B45X 2PHUA 5CFCA 1PIV3 4KNCA 2LTNA 1D0GA 4RL7A 1H8VA 2VG9A 1ALYA 1POV3 1HXS3 1RUC2 4IXLA 4M0NA 1QGLA 1LRHA 1PVC2 3ZFFC 4JVAA 4IETA 1OLRA 2ZACA 3SISA 4LHNA 4CDQC 5T3NA 1Y43B 1WLDA 2GNMA 5LK7B 4AHWA 2NMNA 2Z2SB 1LOFA 4LO8A 4Z1VA 1AR61 1OFSA 4GKYA 3TN91 2FZ1A 2NZ9A 4XILA 4DZGA 1WW4A 5LEKA 3KT4A 1R092 1IS4A 4XQDA 3B7MA 1ENQA 5EJ3A 3HD8B 4FOYA 2FQPA 4IEZA 4Q2FA 4Q4X3 3DPRA 3ZXEA 5HBAA 2V5YA 2RR13 1C8M3 2V73A 3V0AB 3PHMA 3OJBA 5IK8A 2IWGB 3VBSC 3UJQA 1MQTB 1UU5A 4Z82A 1S0FA 5BY5A 3B01A 1ULFA 4Q1PA 5JPMB 3GZUC 3JD72 2HWB3 4X8PA 3PNAA 4Q4V2 3B69A 5L19A 3HT2A 1HRV1 2D6KA 4LBJA 3M7AA 1O3SA 5DDJ2 3WG3A 5ACA2 1DIWA 1AR63 1QJU1 2X8KA 1DU3D 2R072 4JGZC 4FPHA 2HWF2 2V09A 3TN93 1UMZA 3VBOC 3NKGA 4L8QA 2ZHMA 3H7JA 4CP1A 4HMZA 5EYYA 4KWLA 3U0ZA 4C91A 5JVVA 5FOBB 4QPGA 1W39A 3RSJA 2JG8C 1CAWA 2DVBA 3P3NA 3EQEA 1AYN3 1OA3A 1MZ5A 1V6KA 1W6MA 4ZU4A 3ETQA 1BMV2 2QKDA 1ZRCA 3LB9A 4RR3A 5D8AC 3H1MA 5GALA 2R0FA 5LK5A 2DCTA 2IXHA 1LECA 4H7MA 1VB2A 2DTWA 2DVDA 3AXEA 4HVOA 4MZUA 2WQ4A 3RJ2X 2WZR2 1HRV3 3ZXJA 2WFF1 3VKOA 1CPMA 1YWKA 4Y1XA 1QOSA 3ZMOA 2D3RA 4XF3A 3VDDB 3O0XA 1OI6A 3WUCA 1ZBE2 1JTZX 2BUKA 3LA7A 4XXPA 4LHLA 5C4WB 2BNOA 5C8CA 3LWCA 5HXVA 3QACA 1DF0A 1H30A 5BPXA 3GBWA 1X7NA 4LBOA 4AYUA 4XJUA 2D44A 1QXRA 3ZXDA 1NLSA 2B39A 3VKNA 3SH5A 4E4SA 5C6CA 4FPKA 3HBZA 2XPJA 1WMEA 4AVSA 4JDNA 1GSLA 3WDWA 5K8SA 2BVBA 2UWBA 3AMQA 3JZVA 4NHLA 4AGRA 1AL0G 4N7IA 2DUOA 4AVCA 2Y26A 4OHXA 2HJIA 1GR3A 3ILFA 4IEQA 4GWMA 3POYA 4Q0VA 2G9FA 2GC3A 4XF1A 1A6CA 5JZGC 1PVXA 4TYSA 4WVZA 5FFOC 2XVLA 4PLMA 4JDMA 2CGNA 1MS9A 1AR73 4OUSA 3KGZA 2UU8A 1UZZA 1GICA 1D2QA 4SLIA 1QF3A 4EN7B 2RS11 4QT6A 3WCRA 2VOWA 4PJYA 1MS3A 1FYUA 4WM8A 1D4M1 2GMPA 3MIBA 3E97A 1Y3TA 2IZWA 1LU2A 1ENSA 4XIKA 2OUJA 4JRAA 1H1MA 3S7EA 2UYAA 5JIUA 3SNMA 3ZIWA 4COZA 3VHOA 5H9SA 1Q3EA 3WHUA 1VRH2 5JOZA 1RVF3 4DFSA 5HI0A 5CB7A 2YYOA 4Q1RA 3DPRB 4MXWA 1RL3A 2XB6C 1WD4A 4WVVA 4RQPA 2A6YA 3A0NA 3URFA 1UCXA 2JG9C 5F5QA 1V6JA 4IEYA 2ZGNA 1V9U1 1EAH3 1XU2A 2R30A 1OOPA 4QHBA 5L73A 1JYCA 5T54A 5KHIA 1TNFA 4B7EA 4XPVA 3TOJA 4QGMA 2R041 4XF4A 1IPJA 1NXD1 2F6BA 2WIIB 4OUMA 5BV6A 2BWCA 4LBNA 2H6CA 5L36A 2RS13 3WLUA 4N43A 4YW5A 1H2NA 4DQAA 1QDOA 3QBQA 5I8YA 4YGEA 2E63A 1LHWA 4YFZA 5J36A 2P3JA 2PAEA 1ZZ6A 1HLCA 2JX9A 4QPIC 3WW3A 4JGYC 4FBFA 1X50A 1V00A 5CFDB 1FOD1 4HBNA 3VN4A 1K5MA 1PZ8A 3B9IA 1QJY2 4PCRA 4QPGB 5DUWA 2EXHA 4Y1ZA 2Y38A 2JJ6A 3TYJA 2ZA9A 1CAWB 1Q8QA 1ULGA 2WINB 4YG3A 2GH8A 1W6MB 1NCRA 2ZX3A 3M3OA 2ES3A 2R061 1IKQA 4E27A 1R1A3 4RR3B 5T50A 3IBMA 5C9AB 1QJX2 4YZ4A 3KQRA 2B5HA 2F4PA 4D94A 2ARXA 4M0HA 2VW1A 5K7PA 1YHFA 3WP3A 3MLLA 4XJAA 4G9SB 4L9BA 4Z92B 1COV1 5BNNB 4QMAA 1FOD3 1URXA 1Z7S1 4YZ1A 4XJZA 4HFSA 1S1AA 1KXGA 5ABJA 2DUPA 1PO23 3FLRA 4FPEA 1DGWX 1NE6A 1ND3C 2C1FA 2D5FA 1QWRA 2GSYA 3O0WA 5BYNA 2VQ0A 3BODA 2XHKA 1Z0HA 4META 3JU9A 2VVEA 3EO6A 1DZTA 3B93A 5FCCA 3LGRA 4CTEA 2R063 1LHNA 3WDVA 4JTOA 4L92A 2ZOEB 4ASMB 2BGCA 3PTYA 5FQ0A 1VBD1 4DMIA 1D2SA 3VHPA 5EV7A 4C90A 3QOPA 1QXJA 1RGSA 3M3CA 5BNOA 1DFQA 2XJRA 4WM7C 3JUUA 3GF6A 2HWC2 2DUQA 5IT6A 4KQ7A 4E2SA 4NOTA 4ES9A 1KDMA 4IEWA 4GH4A 4O9EA 1J3PA 3HAGA 2DVGA 4LNVA 4Z2WA 4EWAA 1UIJA 1Z7S3 5FREA 4FCAA 1OMIA 2YY1A 1YFUA 4N90A 1WLTA 3ZSEA 1AXZA 1GZCA 1FT9A 2VGDA 1TMF2 1ZRFA 2D3PA 4WM8B 5GM0A 2OYZA 2VNRA 2AREA 5KBFA 4DY5A 5T5OA 3POSA 3M3IA 4BE3A 3VZMA 4AQSA 4YNIA 2X5IB 3HT1A 3D8CA 1WW7A 4R9CA 1ENRA 1BCXA 1F31A 1SLCA 1WGPA 1HQLA 4GXLA 4QQLA 3VZJA 4PDWC 2RS51 1OPMA 4P9XA 2D98A 5AC91 3T2TA 2P17A 2UURA 3AZXA 3UKTA 4YM2A 4K6BA 2VULA 4Z07A 3MLJA 4YZ2A 1J1LA 2XBO2 1RHI1 2R32A 3VZKA 3SMHA 1SEFA 4MV2A 4Q0SA 4AE2A 3HMYA 5EWSA 2GZWA 4N53C 3CJIC 4LTAA 4MXVA 2YUEA 1MEC1 4XJ9A 4YSFA 2ZMKA 3VBHA 1OLQA 2XLFA 5J48A 1BJQA 4N43B 1PIV2 4I02A 4CEWC 2H0VA 3GZAA 3MGUA 3WOGA 1EV13 2ETEA 4OZXA 3PMEA 4XIOA 3VBRA 2B9UA 2EXJA 3USSA 1HXS2 2E6VA 5DZEA 1REDA 3DGTA 4CZSA 1OHFA 1YCIA 1K5MB 3QD6A 4Q4Y3 4JRLA 2W08A 5CG9A 2RS53 1AR92 1O5LA 4BLIA 1W0OA 2OA2A 2PHDA 3CF6E 1LHVA 3HR9A 5JOXA 1KJRA 2ZGSA 3OBRA 5CA6A 1FNYA 1TEIA