3WG3A

Crystal structure of agrocybe cylindracea galectin with blood type a antigen tetraose
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
163
structure length
163
Chain Sequence
b'KHMTTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactoside-binding lectin
publication title Conformational change of a unique sequence in a fungal galectin from Agrocybe cylindracea controls glycan ligand-binding specificity.
pubmed doi rcsb
source organism Agrocybe cylindracea
molecule tags Sugar binding protein
total genus 40
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wg3A00
1LHUA 1DQ2A 1RITA 2WT0A 5KXCA 5GJ6A 1DBNA 2P34A 3O0WA 2DURA 4GWNA 2R0HA 4U36A 1VAMA 3N36A 1G9CA 1Q8VA 4WVWA 2JDZA 2EXIA 1AZDA 3NV4A 1JYIA 2PHTA 1SLLA 4FPKA 2A6WA 1KJLA 3PMEA 2CYFA 1MZ5A 1DGLA 1V6IA 4GKXA 4BLJA 1KRIA 1S0GA 1I1EA 1YXWA 2ZHKA 2VW0A 2AREA 4U2AA 4YGEA 3FBYA 4XOGA 5DZGA 4BQ1A 5KXBA 1JYCA 2UU8A 4PF5A 4DPNA 4PCRA 2G4IA 2EIGA 2SLIA 2D6LX 5IK7A 1F5FA 2Q5TA 5E88A 1OKQA 3SH5A 3ZVXA 3TAYA 1C1LA 2YV8A 4K20A 1W6NB 3A4UA 4Y22B 1Q56A 3N7LA 3DUIA 4XHBA 2A6VA 1Q8SA 1SACA 1QDOA 4OZXA 2I2SA 4BLIA 2P37A 2DVAA 3WOGA 2PELA 2PHRA 4FOYA 1I3HA 3OPZA 2UURA 1Q8QA 4LBQA 4XJAA 2WT1A 1AXZA 4XBLA 5GZFA 2DV9A 2CY6A 1HQLA 2ZABA 2XB6C 1LEDA 1VAVA 1FAYA 3H0OA 2JE7A 1AXYA 4YZ5A 1SCSA 1LGNA 1MS4A 1N47A 3AFKA 3ENRA 4YZ1A 1LULA 1AF9A 3B3QE 4XILA 2ZACA 4FPCA 1AJKA 2R1BA 3WG4A 4M01A 1VALA 4XBQA 4XJUA 1MS9A 1ZA4A 1IKPA 1W0PA 4YM1A 1MS8A 3AP4A 2PHUA 2PHXA 1MS3A 3ZXLA 4ISQA 4M3CA 1YRZA 3AZVA 1C4RA 1AVBA 1LOEA 1QU0A 5T5PA 4ISRA 1NXD1 3SNMA 3AP5A 1WLCA 1GANA 1C57A 1OFSA 1YI7A 3BOPA 3D6EA 1LECA 4YG3A 3AX4A 5EYYA 3V0BA 1JUIA 1LHOA 4Y26A 1APNA 1KITA 2ARBA 1LCLA 1SLBA 3VKMA 1UMZA 2TEPA 4LBQB 1GZWB 2B7YA 3WDWA 1BQPA 4FP3A 1S0BA 5EWSA 5F9TA 3MW3A 1KDKA 4WV8A 5E89A 2A6ZA 4GWMA 4I30A 4YZ4A 3JUUA 4FVVA 4YFZA 3WDTA 2ZGTA 2WT2A 1QKQA 3AK0A 4XTPA 2D43A 2AYHA 4Y20A 1SBFA 1OQ1A 4R9AA 2D6NA 3M3CA 2W39A 4UW5A 3T1LA 3T1MA 5IK5A 1FX5A 1LOAA 5DXDA 1GICA 1MR5A 2E7TA 3QCWA 3R05A 2D3RA 1F31A 4XBNA 1DZQA 1RINA 1WW4A 4C1WA 5AVAA 2A71A 2WLQA 1GSLA 3TB0A 3WDVA 4M3CB 4XDQA 1CIWA 1HLCA 1NLSA 2ES3A 3C2UA 4AGVA 1ULFA 4FPJA 3B9CA 3M3QA 3V0AB 1UAIA 3ASIA 1GV9A 2A75A 5H9SA 2UWCA 4K1ZA 1W6MA 5JVVA 2WSVA 3AYAA 5CB7A 3V0BB 1SLAA 4XHXA 3PVEA 2ENRA 2ZGPA 3RG0A 2VH9A 1WCSA 2YXSA 4PBOA 1QOSA 4CZSA 1WBLA 5GZCA 1PZ7A 3AP7A 2C5DA 3VKOA 2HYKA 5IUQA 4M00A 5T50A 2EXKA 2D6MA 2EXHA 2ZA9A 4DRRA 2YZ4A 2DVFA 3FLPA 4Y20B 1DLLA 2LALA 2DVDA 2Z42A 3AZYA 4XZPA 5DUXA 3VUOA 5IK8A 2GNTA 1Z0HA 2JKBA 1Y7BA 2SBAA 1W6NA 4Q2FA 4KBBA 4Y22A 5T55A 4AYUA 3AP9A 1SBEA 1Q8PA 2D3PA 3HR9A 1LOGA 1A78A 2NN8A 5HCFA 4XTMA 1ULDA 3FLTA 4PQ9A 4FQ4A 3ILRA 1W6MB 4YZ3A 1ULGA 5JDBA 1BJQA 2D7FA 2DUOA 1N1VA 1DQ5A 4YW2A 5T5JA 3SISA 2DTWA 4M3CF 2LTNA 1UZYA 4H55A 3B00A 4FP2A 2ARXA 1UX6A 1J1TA 2D6KA 3WDYA 2VW2A 3M1HA 4MYEA 1JW6A 5T5OA 1N1YA 5GZEA 1O4YA 5GLUA 4XYXA 3RRDA 2GN3A 2ZGMA 2JJ6A 4L8QA 4GKYA 5EXOA 2VY0A 1WD3A 2JECA 3WLUA 2A70A 2AGSA 3MPPG 1SBDA 2E51A 1AXKA 4RL7A 2ZMNA 1GNZA 2H0BA 1F9KA 2VXRA 1N1TA 4ATEA 1ONAA 3SH3A 3NV1A 3M2MA 3WZ1A 4UW6A 2JE9A 1V6OA 4YM2A 3ZXKA 1FV3A 1WD4A 3WV6A 1GZWA 1DQ0A 1Z78A 1CN1A 2C9AA 4HANA 5DZEA 5JOZA 5JOYA 3R4UA 1AX2A 2OUJA 4K1YA 4RA0A 3ZSMA 4FOWA 1QOOA 1FNYA 5BYNA 3N7JA 2V73A 2ZGRA 1MS0A 1FNZA 4XJ9A 5FRAA 5T52A 1U0AA 2R49A 3ILFA 1BYHA 4YLZA 3WG2A 3SITA 2A5ZA 4NO4A 1CPNA 4FPFA 4LBQD 3R4SA 3LSEA 1QF3A 1QMJA 1W6PA 2DTYA 3A0KA 4WVVA 1DFQA 1KJRA 4R9DA 4XXAA 5EYXA 1DHKB 2YROA 4F83A 1V6LA 2WNEA 1S0CA 3BIWE 4Z8BA 3AZXA 1LODA 2KM2A 2ZHNA 4HL0A 1YO8A 2EXJA 4AVSA 5JMCA 1IS3A 3V0AA 2W08A 1G9AA 4YFWA 1URXA 4YG0A 4AGGA 1LENA 2RHPA 4ITCA 4NOTA 3ZXFA 3MW4A 2A3XA 2P3JA 1AJOA 3UK9A 3WUCA 3OYWA 4XXPA 5CA6A 1UKGA 2NYYA 2ZMKA 2FMDA 1DQ1A 2ZZJA 4FPYA 1G9FA 2GN7A 5IT6A 2GNMA 4BPZA 1G8WA 5HCBA 1GZCA 2OVUA 4P14A 3SLIA 2EAKA 2GNBA 4Q8LA 2WJSA 5H9QA 3FUQA 4Y24A 4C1XA 1QOTA 2GDFA 3OBTA 5DUUA 1WW5A 1HKDA 3WG1A 2NMNA 1W6PB 4XIKA 1WLDA 1QGLA 3WCRA 1LU1A 5GM0A 3OJBA 4FPHA 3V64A 3PVOA 4W65A 3W58A 4DFSA 3RMXA 4BMBA 2AH2A 4Q27A 2FHRA 4GXLA 2ZGNA 1SFYA 1V00A 1V6KA 4Y1YA 3ZSKA 4D69A 2OUHA 3FLRA 3L2YA 5GLTA 5CBLA 3ILNA 2EALA 3VKNA 3VKLA 1FV2A 1GKBA 1ZM1A 1G86A 3OGGA 2E53A 2GALA 2GMEA 3I4IA 1VLNA 2DVBA 1A8DA 3OYWB 4XJWA 2ZGOA 4YW4A 5GZDA 3SH4A 3ZPYA 4Y1XA 1RIRA 1LHVA 3AJYA 1LOBA 5GALA 1FYUA 2CL2A 3IM0A 1G9BA 1CVNA 1H30A 4YW3A 1H9PA 1BZWA 3MEPA 5GLZA 5GLVA 1CPMA 1SLCA 3POWA 4FPEA 3AP6A 3RS6A 1LHWA 3ZSJA 1QNWA 1IS4A 2WSUA 4YW1A 1UPSA 4Q1RA 1AX0A 3MW2A 3N3HA 1LTEA 3FUOA 1SLTA 4M3CE 2NP0A 3IPVA 1N3OA 2ZGUA 1CESA 1LGCA 1LOCA 2AUYA 1CQ9A 2NZ9A 1ULCA 4LBMA 1CR7A 1ENSA 2P2KA 4DRVA 1DYKA 3IKWA 3O0VA 1HQWA 3D4KA 2ZHMA 5T5LA 1G7YA 3U4XA 4XJ8A 3AYEA 1GNHA 1V6MA 3O12A 5HCAA 1N3PA 1LGBA 2P3IA 3PJQA 4GA9A 3BODA 4YGDA 2E7QA 1LJ7A 1X50A 2AENA 4LBKA 4YZ2A 3OY8A 2CWMA 3WHUA 4FPLA 2E6VA 5SV8A 4Q26A 3UJQA 3UJOA 5T54A 1IKQA 1SCRA 3O0XA 1QDCA 2BQPA 1MACA 2R0FA 2R1DA 3DGTA 1UZZA 4DS0A 5LK5A 5JLVA 3RQ0A 3B01A 1D0HA 2DUQA 3APBA 1TEIA 3LCPA 1MVEA 3ZYRA 2ZBJA 4LBJA 1LHNA 2CWSA 2YMZA 2GMMA 2D6OX 1JBCA 1GYKA 2UWBA 3IPVB 4YGBA 1ENRA 1ULEA 4XMIA 3ZYPA 3W59A 1WUVA 2P3KA 4AVTA 4UW4A 1UN1A 1IOAA 2DU1A 3V65A 1W0OA 3WG3A 3AYCA 3RMYA 2NMOA 1BKZA 1W6OB 2ZMLA 2JD4A 1QNYA 5GZGA 5IK4A 1HDKA 1PZ8A 4JC1A 4TZDA 1CONA 2GMPA 1XQNA 1LOFC 3ATGA 5H9RA 4YM3A 3N7KA 4YW5A 3ZXEA 3OY8B 1ENQA 1JN2P 2DYCA 1W6QA 3USUB 5E8AA 3WDUA 4BOWA 1JXNA 3M3EA 4YG6A 5DUVA 1H9WA 4XIOA 3WNXA 5CAZA 2ZGSA 1CJPA 4ASMB 3PVNA 1N1SA 4ATFA 1MS5A 3WCSA 1DQ4A 1YIFA 2CNAA 1N3QA 2ERFA 2ZGQA 4FPOB 5DUWA 3KM5A 3OBRA 3IN9A 3VKFC 4CTEA 1EPWA 4P9WA 2DVGA 1SLIA 4LBOA 3BTAA 4Y1UA 2WQZC 2PHFA 3NWKA 3AYDA 3NV2A 2DU0A 1G9DA 2D44A 1LEMA 3CNAA 1FATA 1KQRA 3HMYA 4XMAA 1WBFA 5KXDA 5DG1A 5JOXA 2R16A 2GNDA 4IQPA 1D2SA 2VU9A 4P9YA 2A6XA 3A0NA 3M3OA 1R1ZA 1W6QB 4WZFA 3WUDA 1LESA 2D3SA 5FREA 3AZWA 1JOJA 4FPGA 1GBGA 1GZ9A 3Q9OA 3JU9A 2ZGLA 3N7MA 3RSJA 4BMEA 4JCKA 3B69A 3KQRA 3N35A 3NV3A 4P9XA 1V6JA 2WKKA 3POSA 4Q8KA 3POYA 1S1AA 1S0EA 1WW7A 2CTVA 3INAA 4XE9A 4YGCA 3ZXJA 1DIWA 1LOFA 1WLWA 4LBLA 2A3YA 4PBPA 1Q8OA 1S0IA 2A7AA 4Q1PA 2AR6A 2ZKNA 4XJZA 5GLWA 1AX1A 1GLHA 1KDMA 2PHWA 2EF6A 2OW4A 1S0FA 5KXEA 3QLQA 1VIWB 4GALA 2W68A 4JRAA 3T2TA 4UW3A 2ZGKA 4AVVA 1YYNA 2YY1A 4YM0A 4AWDA 1UL9A 4FQZA 3WDXA 5F5QA 5JOWA 3GALA 4DQAA 1LU2A 3D5OA 5H9PA 4AGRA 4FOVA 1DYPA 2VW1A 4R9BA 4TYSA 1B09A 3AZZA 3FFZA 5CNAA 5DG2A 1A3KA 4Y1VA 4K21A 4LBNA 2DUPA 5L73A 3WVJA 1BXHA 3AJZA 3AXDA 4FOQA 1S0DA 3LSDA 3O5SA 4ZKTB 4R9CA 4ZXKA 2D6PA 2A6YA 2DWRA 2NM1A 2XG3A 1W6OA 2A3WA 1V6NA 1MVQA 3ZSLA 1O4ZA 1WW6A 3IMNA 3HN1A 3I8TA 1MS1A 1IS6A 2V5YA 4BM8A 4CRQA 2UWAA 4SLIA 1JHNA 2ZHLA 1C1FA 2W52A 1IS5A 3WHTA 2VUAA 2ZAAA 4Y1ZA 3UL2A 1S0JA 1MZ6A 1PZ9A 3USUA 1DQ6A 3AXEA 3VV1A 3GNEA 5DZFA
chains in the Genus database with same CATH superfamily
1FMD1 1QQP3 2J1VA 1T6BX 1JOPA 4QDSA 1CZVA 2XBO1 1DBNA 5GJ6A 1NQJA 2DURA 3LD8A 1DP0A 4LEJA 3F95A 5F2WA 5BUVA 1RUOA 1ZREA 3N36A 4AEKA 2K0GA 2J1TA 3KV6A 4IV1B 4MGKE 4WVWA 1JS9A 2DCJA 2JDZA 4Z82A 5HXVA 4CCMA 1JYIA 1KJLA 1V6IA 2PAEA 4BLJA 1I1EA 2VBPA 1X7NA 4S2HA 3POEA 3I97A 2R043 3CIHA 3A22A 5L19A 2UU8A 5DQ0A 3KCYA 3WNLA 2VQAA 4ASKA 3ZR5A 2GH2A 3HD8B 1POQA 4L2NA 5IVBA 3I3EA 2VD7A 2WZR1 4DUWA 4NIGA 3JB4C 1SHWB 3H8RA 2VMIA 2VCAA 4KGQA 5CKQA 4AF9A 5EJ3A 4MHUA 1W6NB 2GSYA 4IEVA 3N7LA 5LA1A 1E5IA 3NO8A 2BP6A 1BCXA 3PIGA 1OF3A 2FMYA 2XJQA 4Q4X2 4ET7A 4XJAA 2CDOA 2GC0A 5J96B 3ACHA 5IVJA 2Y0IA 4A7KA 1VAVA 1FAYA 4LIVA 1AXYA 1ZVFA 2XL7A 3ZFFB 5JAXA 5L36A 2Q30A 4BYYA 3EB7A 2ADDA 4XILA 4YVWC 3B3QE 4LULA 1KFXL 3ZFGB 1OKOA 3POBA 2R1BA 4LIUA 3KV4A 1W2OA 4O9EA 3ZXAC 1VALA 2JG8B 3UESA 3SEEA 4HVQA 5LZ6A 1IKPA 2XLAA 1U5IA 4X6QB 2D5HA 2Y6HA 1E5SA 4K6BA 4ONUA 5CZKA 3T2PA 2P1BA 4K8FA 2OX0A 1TME3 2VZSA 3AZVA 4DOUA 5C3PA 1RUD1 5HI0A 4BZ4A 2VOTA 2VUDA 3PU3A 1VBB3 3P3PA 4XDPA 5CFCC 4KI5M 1POV0 2CGNA 1WLCA 3NNMA 3SQOA 1RGSA 1YI7A 1GWMA 4YG3A 4WBBA 3USSA 3MYXA 4HKOA 4CCOA 3AX4A 5L9VA 1JUIA 3N9LA 3HQXA 2TEPA 4LBQB 1GZWB 3RZGA 1RVF1 3MW3A 4AVCA 1JZ5A 1V9U2 4XAAA 5FUPA 4DIQA 4COYA 3TYJA 1W3VA 3OGSA 1TE1B 5IW0A 4M4RA 1QKQA 2AYHA 1K45A 4G9SB 4Y20A 1ASJ3 1OQ1A 1LR5A 2D6NA 4UW5A 5FK8A 3T1LA 5I0DA 3J8F2 4D6SA 1LOAA 4EJRA 1KS4A 4BXFA 3R05A 4S2FA 1CZTA 5DDJ1 3ACFA 5FKCA 4ZXEA 4EN8B 5I8SA 4XUOA 4YARA 1OF4A 4XAEA 1GSLA 5D8AA 3WDVA 3WQBA 4AEJA 4HPKA 4XDQA 4AGVA 2ES3A 3ZFEA 1QJX1 4A2UA 4FXGB 2OYZA 2VMFA 1UAIA 3HJRA 5H9SA 3CEWA 3PUQA 2WSVA 2G9GA 4NHLA 1UY3A 1Y43B 1SLAA 1YJLA 2BV4A 4YVSA 1DGRN 1PM7A 1JZ2A 1H2KA 4PI2A 3U10A 4RGGA 2Z79A 2ZGPA 3WW3A 1GQGA 2YXSA 2VECA 4AFMA 3AP7A 4A6SA 3G6JB 4IE7A 3A21A 4JGYB 4AHWA 5IJRA 1RUE3 1Q43A 2MEV3 5IUQA 1Y9MA 1YQCA 2EXKA 2D6MA 2CHHA 2OIIA 2YZ4A 2B8MA 2DVFA 3AKTA 5DUXA 5FMBA 4DB5A 4XZPA 3GBFA 4QX0A 3NAPB 1WMDA 2GNTA 3O1VA 3MO4A 4PIXA 5KHIA 1XE0A 2VVEA 5TSWA 2RR13 3LIGA 3K51A 4GMP3 2JKBA 4CDWB 1Y7BA 4INDA 3K4DA 3KVBA 4META 3W5NA 4EQVA 3E6CC 4RS5B 4AZZA 4HSLA 1I9RA 3AMQA 3DYMA 2ZX2A 1HX6A 1XE7A 2XONA 3GZEA 4JQTA 1HRI1 4XTMA 1ULDA 2JD9A 4CDUC 4PQ9A 5JDBA 2Y33A 1W6MB 3ILRA 1X8MA 2X05A 3KCCA 1R082 2BNOA 2HWC2 3MUY1 2BPA2 1H2MA 2KXLA 3SISA 4N90A 4EZ4A 5A1LA 4M3CF 2CSGA 1YI9A 2QQKA 2LTNA 2ZEXA 1HJGA 2X29A 4PIZA 3RYRA 5B4NA 3B00A 4JGYC 4FP2A 3ZSEA 1B35C 1IGOA 2UY8A 4OQ9A 1PK6C 4MYEA 3RI8A 1JW6A 4XABA 1RUNA 1JZ8A 1H1MA 1RUF1 2WABA 4XYXA 2GN3A 2ZGMA 5EXOA 2YC2A 2WA3A 2J1SA 2WNVB 1DCSA 3ACGA 3LZZA 1FT9A 3WEZA 1UIKA 2ZMNA 3IIAA 3W5MA 2OA2A 1EV12 4QXBA 2HJIA 5FZCA 1CAUB 3NJYA 2FDKA 1WCQA 3VZLA 3I2HA 1V6OA 5JXHA 4QDQA 4Q4W1 3WNNA 4CVUA 3BVCA 5M0TA 2QCSB 4HANA 2VPVA 5DZEA 1XJAA 3SXWA 5L7OA 3ELNA 2PAKA 2XJPA 1U5YA 5FYSA 2VCBA 3NJVA 3DYOA 1EAH1 3B7MA 1QOOA 1XNTA 3RYPA 1O8SA 5FZAA 4W6XA 1MS0A 3SCGA 4EN6B 5T52A 1U0AA 4XDOA 3SCHA 1BYHA 1UY0A 4UYBA 4DMIA 2F6BA 1VBA1 5FV3A 2ZKLA 2XLGA 1QQP2 5BXXA 4P9LA 1PO11 1VB2A 1CAVB 1F4HA 1OBNA 2JE8A 3A0KA 3OF1A 3TEYA 1PM4A 3K75B 1KJRA 1S2EA 3ZYHA 2WNEA 3MICA 4B1MA 4QX5A 4DINB 3AZXA 3T0AA 3VHOA 4AFBA 4HL0A 4PT6A 3THCA 4AVSA 3V0AA 1IS3A 2W08A 1PGW1 1WMEA 3VBRA 1G9AA 1PMJX 4KG8A 5APAA 1Q5OA 4YG0A 1QH7A 4LO4B 1HB4A 4NHYA 4ITCA 2R042 4AGGA 1NY72 5KWRA 2YBPA 4TWTA 2WZPP 3AMHA 1GOFA 4XXPA 1DLCA 3ACLA 5FP4A 2CU5A 3CMGA 5FBZA 4D6RA 1ULOA 3M70A 1VRH1 1AYN1 2WAAA 3ES1A 4FPYA 5IT6A 1F2NA 1OOPC 1G8WA 4FXKB 1FMD3 4HOOA 3SLIA 4BPZA 1T2XA 2GNBA 4MOAA 3V65A 2JDPA 2D40A 2WJSA 2XBO3 2HEWF 3FUQA 3QD6A 3FMGA 5KC5A 3ITQA 1NOVA 3WF3A 4I2OA 1WW5A 4FFFA 1A6CA 4IEUA 1TMF1 1WLDA 1HB3A 4RYDA 2D5FA 1LU1A 4S2DA 5GM0A 3VZMA 2X53S 1R1A1 1R091 3GJBA 1RUI3 4RFRB 4HG6B 5EIYB 2R061 3ZSKA 4D69A 3RVHA 2OUHA 3FLRA 4R52A 1NXMA 3VKNA 3GZAA 1FV2A 2BGOA 4QPYA 4WVZA 4QKBA 5FFOC 4NR1A 5BY5A 5JWPA 3H9AA 2WZR3 3UGFA 5A7WA 3LA2A 1J3PA 3OYWB 2WFPA 3BALA 3ZYBA 5CFDB 3HT2A 3SH4A 4HK8A 4NRQA 1O3RA 3AJYA 1PO21 1TNFA 4YRDA 1OUSA 5F37A 1LKNA 1CVNA 5GLVA 2C0ZA 1H9PA 1VBB2 1UYYA 2ZS6B 2BVBA 1CPMA 5FBJA 5CKNA 2E31A 1ACCA 3VBFB 3C8XA 4M4PA 1LHWA 5F3EA 3BU0A 3VDBA 1C28A 2W91A 2BBAA 2AC1A 3HN3A 5JSPA 3MDPA 2RDSA 1CESA 2PYTA 2NZ9A 4FI9A 4AQ6A 3KF5A 5BNPA 1CR7A 4DRVA 1DYKA 4MXWA 3O0VA 1SG3A 1YCIA 3CU7A 3D4KA 1D0GA 3NVCA 4XJ8A 3GZTB 4L97A 1ZZBA 1JHJA 1PX4A 1GNHA 5C5TA 4OMCA 1V6MA 1ZBE1 2WYFA 3O12A 1XE8A 5AFEA 4QPGB 2AEYA 2JXAA 1RUD3 1SZBA 3PHMA 1O59A 2E7QA 2AENA 4EN7B 3VGIA 3POIA 2CWMA 4LO5B 3RZHA 3PTYA 2HBUA 3UJOA 4HN1A 2VC9A 4QKFA 3O0XA 2R0FA 1MACA 4BB3A 2EIEA 4OI1A 1POV1 5JLVA 2C9KA 3B01A 1RVF3 1YC61 1W9TA 1D4VB 1KGYA 1K5MA 4GWIA 4B29A 1NCRC 4LBJA 3PUIA 5FMOL 4GIQA 1X9PA 2E9QA 5I0RA 2GMMA 1OHFA 4OCTA 2VNGA 2GAUA 1KFUL 1K5JA 1RUH2 2PHLA 1RXGA 3IPVB 4R8HA 5EP9A 5C9AB 4N7IA 4N43B 2IXKA 3WW2A 2WN3A 3LF7A 2MEV2 4COWA 4EYUA 1JYWA 1JYTA 1UWWA 1QJU1 5DN2A 4AVTA 1UN1A 3FZ3A 2KD7A 1W0OA 3FN9A 1W99A 2JG9A 2QQLA 3HOBA 4UAPA 3A7QA 2NMOA 4UT5A 1BKZA 4CCJA 5I0TA 2ZMLA 1NCQB 1QNYA 5GZGA 2DDUA 1HDKA 1YQ6A 2RR12 5LASA 3CJIC 3ATGA 4Y33A 1QJX3 4L92A 3KD4A 5FZFA 1VMFA 5A7QA 3HWJA 1JN2P 2X10A 2JDKA 3K4ZA 4OI4A 1ZX5A 3PLQA 3E97A 4Q5OA 5E8AA 2VCCA 3WT3A 4PDWC 5K0UB 4J6GA 1JXNA 5LCWL 5C7GA 1H9WA 4Q4Y2 4CEYC 1RJ8A 3TEXA 3QACA 3WNXA 4Y4RA 3LOBA 2ZGSA 2VTXA 3PVNA 4IV3A 5FY7A 2BOJA 1TVGA 3LFMA 4K8RB 1MS5A 3WCSA 1H6YA 2FDGA 3MF9A 1YIFA 1HW5A 2Y6KA 1N3QA 1C3HA 1NLRA 1STMA 3KT1A 4JVAA 3MGUA 1BVVA 2VULA 1ZZ8A 5A3MA 1RMU1 3IN9A 4CTEA 1ZRFA 1AR61 4P9WA 4BE3A 3CBNA 3IWZA 3S7EA 1NLQA 1PNFA 3TNQA 4URAA 1XNCA 4WM7C 1U12A 5E16A 5F1RA 2VO5A 1GWLA 4FCAA 3EXUA 4NIDA 5FO9B 1KQRA 3HMYA 3R0RA 4FSJA 5FMOS 1HV1A 1NX9A 5LBCA 5C4WB 3ZYIB 3O1RA 1ALYA 1D2SA 2VU9A 4BXSV 5B4XA 1UMIA 3I2FA 4WZFA 1QWRA 2ARCA 1OMIA 4FAGA 5DAWA 3VBUA 1D7PM 4FTSA 2VNOA 1OQEA 3SMHA 1P8JA 1W28A 2JDYA 4COUA 3MIEA 1IPSA 3OEAA 1GZ9A 1DYOA 5DAQA 2KR2A 2ZGLA 4J25A 1XNDA 5FWEA 2WNOA 4AQ2A 2Y38A 4H3WA 1RUF3 5BNNB 4RR3A 3WNMA 4JCKA 3HNBM 3D0SA 4ZS3A 3TBDA 4E2SA 2VVFA 5F3CA 1Z7S1 3INAA 3J7HA 3M3IA 4QPWA 4YGCA 1LOFA 2GZWA 3RDIA 2YGMA 1PGSA 1Q8OA 4GH4B 4LKDA 4UFMA 2XVGA 2A7AA 2XH6A 2AR6A 3NQHA 5GLWA 1KDMA 4WVMA 4OMDA 4E4ZA 2Y6FA 2Q8EA 4Q4W3 4IEWA 3TN91 4K7JA 1RHI1 4YM0A 2IUWA 3K4AA 4FQZA 3WDXA 1WKYA 4DQAA 1LU2A 5H9PA 2F4PA 2PA7A 4IV1A 2O8QA 4R9BA 2P6CA 4QAWA 4PLNA 3TEWA 1B09A 3E6DA 1O4TA 2IVJA 2YDEA 5CNAA 4LLOA 2VMHA 4K21A 1WA6X 4Y1VA 3IIIA 1O3QA 1TME1 3VHPA 4B3NA 1QXJA 4FOQA 1VBA3 4ZXKA 1FMD2 2A6YA 2DWRA 1PO13 1W6OA 3IB3A 2XBO2 1X33A 4HN0A 3MIFA 1V6NA 1MVQA 4EN9B 3UGGA 3S0MA 3HN1A 3I8TA 2V5YA 2X5IB 2PMWB 1JHNA 3K2OA 1C1FA 1BLZA 3THDA 1IS5A 2Q1MA 3OUJA 3O7OA 5FY5A 3E6BA 1DQ6A 2XJVA 4N53C 4V2WA 5DZFA 2Y64A 1ASJ1 3VL8A 2V4VA 1DQ2A 5KXCA 4CU8A 1CAXA 3OB8A 1YQ8A 2R0HA 1NA1B 4XUQA 3WINE 1VRH3 1G9CA 5CYYA 1AYN3 1Q8VA 2YB7A 4LUKA 2IXJA 2HH9A 1SLLA 4L99A 3Q8BA 4ARXA 1ZA7A 5L9RA 3ZFGA 3NKTA 1YXWA 2WLPA 2ZHKA 5FY4A 1S55A 3FBYA 2JG8A 4XOGA 5F7UA 5KXBA 1MPXA 3J9SA 4NRPA 4XPVA 2QQPA 1IG0A 1TMF3 5FZ8A 1NYWA 3T0BA 1M4WA 4PCRA 5FZMA 3WP6A 1F5FA 4Q4V2 1OURA 1X8EA 2ZZQA 5E88A 1W2UA 2W95A 1PGL2 4K20A 3B02A 4AQSA 3I54A 2DCTA 4AEDC 3WW1A 1JYVA 2QJVA 4OZXA 2VZVA 2HKXA 4OUSA 4AOCA 4BLIA 1TNRA 2DVAA 4DZGA 1MQTB 4C90A 2FCTA 1H8TB 3SHRA 3OGJA 4A41A 3O1UA 2UURA 1WMFA 4LBQA 4LO7A 2HBTA 4XBLA 1US3A 1HQLA 2VVDA 3LE0A 5EFUA 2ZABA 4IEQA 3VB9A 1LEDA 2QZ3A 3JZVA 1YFYA 4YZ5A 2YGLA 1PO23 1QXPA 1SCSA 4B4RA 1RUD2 3LPFA 2HWE1 2IXLA 3ENRA 4B1LA 1LULA 1AF9A 2P4EA 3DYPA 1RUJ3 1W2NA 4RQPA 1AJKA 3O1PA 1UO9A 2YU2A 3BPZA 5FYBA 1UX7A 3FE5A 3GXUA 3WQ1A 2WFF2 1RVF2 4LMFA 1UYXA 1MS8A 1L7RA 3AP4A 2PHXA 2V4AA 3ZXLA 1YRZA 1C4RA 2BVVA 3MPBA 2WAOA 1LOEA 1QU0A 1CWPA 3VDAA 4ISRA 1GQPA 4FFGA 2FDIA 1C57A 1AR71 1ZBE3 4Y26A 5DDJ2 2ARBA 1SLBA 4QU1A 5FYYA 1UY1A 3HNMA 3N9NA 4FP3A 4LORA 4CDQB 2VUCA 2XHKA 1KDKA 2OT7A 2VR4A 4E2QA 3W20A 3HIFA 4GWMA 2PFWA 4XW3A 3JUUA 4D7YA 5C71A 3WDTA 1QJX2 4LHKA 1UOBA 2D43A 2JB8A 4AXOA 2WR9A 1SBFA 4LHSA 1POV3 2W39A 4DUXA 3LFIA 3NAPA 3T1MA 1FX5A 2PXJA 4AK3A 1CAWB 2X8KA 3NKGA 2D3RA 5EQUA 2IXCA 1IHMA 4XBNA 2OZJA 4IEZA 5AC91 1VBC1 2VTXJ 5AVAA 4OHYA 4UBGA 3RZMA 2O14A 1RC6A 4UFJA 1ZRCA 1VBE1 4RS5A 1CIWA 1HLCA 2VOXA 3C2UA 2OPWA 1PNGA 3RWKX 4MX3A 1QJU3 2O1QA 3B9CA 3ZOIA 4CCLA 4OFGA 1HQNA 2A75A 4PF1A 3ZYGA 4K1ZA 2XUEA 1W6MA 5FP9A 1YWKA 2A73B 3R6SA 2RS52 2BEOA 1QJZA 3BTZA 3EQEA 4CDXC 5IHRA 1G6NA 5ANNA 4PBOA 5C3QA 4CZSA 4HVOA 4CU7A 4JGZA 5GZCA 1VR3A 2C5DA 1COV1 2GC3A 5T50A 1S2KA 1W06A 4XC9A 2ZA9A 1HRI2 1OQDA 3DL3A 3VBHC 3BTYA 1VBD2 3FLPA 5LWBA 2Z42A 5F2SA 1DGWX 4R4ZA 4P00B 3VLBB 1IQAA 2HYXA 3N9PA 2JICA 2V72A 1H8VA 1AR92 4Y22A 4AYUA 2QQUA 1RMU3 4ZU7A 1Q8PA 1AR63 2P17A 2ZTNA 1QEXA 3WF2A 2NN8A 5KHKA 1AL21 3OBZA 4D7TA 1IQDC 4YZ3A 1BJQA 2D7FA 2DUOA 2YFZA 2ZX1A 3QH6A 1VB4A 4X8PA 2DTWA 3H42B 5ACA1 2VUJA 2XQXA 3NJZA 2QUOA 4KQ7A 4YVWB 3S5QA 3CZUA 3FC0A 4BQ4A 1RUI1 2VOWA 4NRMA 1H4HA 2D6KA 3M1HA 4YWAA 5A70A 5IVEA 1YQ5A 2FCVA 5GLUA 4AI0A 4AI1A 3J7MA 3M8LA 3WLUA 3SKVA 1OH4A 4L8QA 3VD9A 3EJKA 4BQ5A 1EAH2 1SBDA 1PIV1 2E51A 4BK4A 5JMOA 4AHZA 4PLOA 1GNZA 3J7NA 5CFCB 2VXRA 2P6HA 3SH3A 3M2MA 2WUHA 4YM2A 3VDDC 1VBA2 1H0BA 3W9AA 2WO7A 4BQ3A 1FV3A 1Z7S3 2VMDA 3WV6A 1PO12 4A45A 4KU8A 2C9AA 3GBGA 5JOZA 4LO6B 1AX2A 1SFNA 1SPPB 4K1YA 2BNMA 1L3JA 4UOJA 4FOWA 4IE5A 4OHVA 3VL9A 3TN93 1FNZA 2KA3A 2H6CA 1RHI3 3VBOC 3AVSA 5C8CA 5F32A 2WNUC 3ILFA 5BNOC 2GC1A 4IE6A 3ZN6B 5DABA 1WZXA 5IVVA 1CPNA 4TLFA 2WS91 4FPFA 4D0QA 3R4SA 2ZX3A 3N9QA 4WVVA 2WN2A 1DFQA 2Y6GA 1VRH2 2V09A 4BQ2A 4LHNA 1S0CA 4IW3A 1BK1A 1W9FA 2KM2A 2ZHNA 4CPBA 4OLLA 4H7LA 1RUG2 3PDQA 2HEVF 2VQTA 4O9GA 4QDRA 4YFWA 3U75A 1MEC1 4CP0A 3ZXFA 4Y3OA 1O5UA 1XB9A 2HWD2 1TMF2 3OYWA 4ORFA 2E26A 3WUCA 5JZGB 5JCTA 2ZEZA 2HWF1 4G4FA 1R1A2 4GZ9A 1R092 2ZZJA 3A23A 1G9FA 3VZKA 2R062 3KCXA 5HCBA 4N8MA 1GZCA 4P14A 4Q8LA 2DF7A 5H9QA 2WDBA 2GH8A 3VBFA 3WNPA 1BEV3 5ABJB 2GDFA 3OBTA 5FPUA 4ZU4A 1HKDA 2RM23 4KBZA 2Y34A 2NMNA 1W6PB 3LGRA 4KWUA 3C7GA 2JIGA 2W94A 5HBAA 2W47A 3WCRA 3VBSC 2IC1A 3PVOA 3UYJA 3H7JA 4DFSA 1PO22 5FLIA 4CDUB 2ZGNA 1V6KA 5LEJA 4Y1YA 3KSCA 3ETQA 3IBMA 5CBLA 2EALA 4QXHA 5EJ1B 1G86A 3WX5A 5FR3A 3AKPA 4RFT0 2GALA 3W21A 4WM8A 4QPGA 2DVBA 1A8DA 1YQ2A 5JZGC 1GMMA 1JZ6A 2ZGOA 5FUNA 2QQJA 2DFBA 3LEGA 1B35B 5JUVA 1PK6B 1LOBA 3KZ4C 1FYUA 3WSOA 1XC6A 4AI9A 1J3RA 4QHZA 4YW3A 3MEPA 5A7OA 1OXCA 4UWDA 3LDRA 3ROUA 3RS6A 3WR0A 5I91A 5ABJC 1QNWA 1IS4A 2OZ6A 3RI9A 1ND2C 1JU4A 2WSUA 4QMAA 4XQ4A 1LTEA 1SLTA 4UFHA 4RSUA 2NP0A 2HWE3 4CU9A 3IPVA 3PURA 4N43A 1LGCA 2AUYA 5I8TA 1CQ9A 4P9GA 4QT6A 1ULCA 4AAPA 3J7LA 1ENSA 2P2KA 4CE8A 3IKWA 4LA3A 1HQWA 1W2AX 2ZX4A 3U4XA 3U11A 3NNFA 3AYEA 2RS12 4RQPC 3DPRC 3WNOA 4QM8A 1NCQA 4DXSA 3MLJA 5HCAA 1QIQA 2R072 2WWJA 1LGBA 1W0NA 1O7FA 2P3IA 5ANQA 3BODA 4YGDA 2FDJA 4BH9A 4E2GA 1LB2A 1BBT3 1LJ7A 2XOMA 4QHBA 4YZ2A 5IVFA 3VZJA 4QB6A 3WHUA 4DY5A 5SV8A 4W6WA 4PI0A 1AR73 5EV7A 5FK7A 1REFA 1IKQA 4HT1T 5K0UA 5FJHA 1SCRA 4TTGA 1AHSA 4XCBA 3ORJA 4Q0VA 1UZZA 3CO2A 4KNCA 2YC0A 4L0PA 1D0HA 2DUQA 3TWIA 4EZHA 4AQTA 4KMQA 2LM3A 1D4M3 2ZBJA 1W2TA 4XF3A 5JXGA 2G19A 1Y3TA 2D6OX 1GP4A 3U0ZA 3ZDSA 3NSTA 2GP5A 2VZ3A 1ULEA 4CEWC 3W59A 4BIOA 1WUVA 4UW4A 4JRLA 2VGDA 5AC93 1NAEA 1VBC3 2XUMA 3FX3A 4IDZA 3R4DB 3RMYA 4WZCA 5JXJA 4JAAA 2RMU3 2IXIA 1DU3D 5C70A 5J48A 3B9IA 1VBE3 4CXYA 1DDLA 5C4WA 5HV0A 2GMPA 1OOPB 1UOJA 4YM3A 2G1MA 3N7KA 3E5XA 4EE2A 1UZ0A 4JKMA 3ZN5A 5IVCA 1RMU2 2OS2A 3OY8B 4PQQA 1AR62 4XFAA 3USUB 1DGWA 2QKDA 4RD7A 3M3EA 4GD4A 3DF0A 3GM8A 1YNAA 5DUVA 1YHFA 4XIOA 5FZGA 3U1XA 4BQYA 2WO2A 2Y26A 3PNAA 4S2GA 1CJPA 3OCPA 2IXHA 4YYOA 2LW8A 3U4SA 4C0HA 1COV3 4ATFA 2MNGA 4GJZA 2XJRA 1W8ZA 4NHXA 5KBFA 2ERFA 2CNAA 3S30A 5FXWA 2ZGQA 4FPOB 1QY4A 3KM5A 3OBRA 2W0XA 1DZRA 4NJ4A 4OVEA 3VKFC 1EPWA 5J09A 4P9JA 3NWKA 4GB31 3AYDA 1LEMA 1OPOA 1YFXA 3CNAA 4F3JA 1ST8A 2YBKA 5LW9A 3WY6A 4GH4A 4JHZA 2VNRA 1RUC1 3T2OA 1ZZ9A 4COZA 2QQMA 1GOHA 1AL23 3CZJA 5FXZA 5LRRA 1H1IA 1GOGA 1CGPA 2A6XA 3AMMA 1KXGA 1R1ZA 2RDRA 5F6KA 4TN7A 5I0UA 1MZEA 1OUXA 1Z7S2 2QZ2A 4G3YC 3WUDA 4B4PA 2FBEA 4NVPA 5ACA3 4YSFA 3ECQA 4Q0PA 4FFIA 2QQWA 3EYPA 3Q9OA 3TN92 1EYBA 5FQ0A 1UF2C 4OHXA 3AL5A 5BPXA 3LEMA 5IAVA 5B2GB 4BMEA 5IATA 4BQWA 2BZDA 3WP3A 3KQRA 4P9XA 4QHOA 5EZWA 3WF0A 4KG0A 1S1AA 1S0EA 1WW7A 2X5IA 1PIV3 4LO8A 4XE9A 4MO3M 5DDJ3 5IFTA 3GCXA 4LBLA 4LR4A 4QPIA 4Q1PA 1TME2 3I2IA 3OD4A 2PHWA 1GLHA 2ZOEB 4CCCA 4BDVB 2DFCA 1V9U1 1VIWB 4GALA 4JRAA 1RUJ1 1UD1A 1XYNA 2VOKA 1ZRIA 2FD8A 5F5QA 3D5OA 3MUZ1 1O3TA 1ULPA 3PJYA 1NA1A 1NCRB 1MZFA 4FOVA 4N9HA 5FZ3A 4E4HA 2B42B 2B45X 3I2KA 4CUCA 3GZUC 3AZZA 5FY0A 1PVC1 1A3KA 4HONA 5L73A 3WVJA 4XFBA 1BXHA 4NHMA 1J83A 4BHPA 3ACIA 3T30A 4CP2A 4XCAA 5CISA 3O5SA 2NLRA 2WS93 1REDA 3AC0A 4ZKTB 2XG3A 1ASJ2 4A7ZA 1E5RA 2A3WA 1J59A 2W5FA 1WW6A 4QD2A 1TG7A 1MS1A 2IZWA 2HLEA 3AM2A 1DGRA 3CJIB 2IFWA 3Q8EA 4HK9A 4BM8A 2UWAA 3J26N 2YUEA 2ZHLA 3GF6A 3WHTA 2QQNA 1CX4A 2LUWA 3UL2A 1MEC3 1PZ9A 2Y0OA 3HAGA 3AXEA 3WQ0A 4PDWB 3GNEA 4O61A 1SQ4A 3KVAA 5LEKA 3U37A 1MQTA 1LHUA 3N9MA 1H8TA 5A32B 3WXPA 2WT0A 5FP7A 4CEYB 3O0WA 4GWNA 5G04L 5C3OA 3KLSA 2HWF3 2VZPA 3ALQA 2F17A 4LQRA 2ZXQA 2EXIA 5KHJA 3BU7A 1O5LA 2PHTA 3NV4A 4LA2A 4P5HA 4FPKA 2A6WA 4UFLA 1YLLA 2CYFA 1MZ5A 1DGLA 1W05A 4DY3A 1RUE2 4NHKA 2VW0A 1PMIA 3PUAA 4WM7B 4YGEA 1JYCA 4OULA 2J1RA 5FY9A 3SKJE 4AHYA 4DPNA 2HWB1 4OHWA 5FWJA 2G4IA 1R081 2SLIA 2HWC1 2D6LX 2WC2A 4CSWA 1NT0A 4QXKA 1T6GC 1W9YA 3MLLA 1OKQA 3ZVXA 2RDNA 2HWE2 3A4UA 1Q56A 5FJKA 4GWJA 1FI2A 5D8AC 1Q8SA 2R30A 3JBG3 4LJHA 5JI7A 4ZONA 3T2QA 1ZZ7A 5T3NA 2Y60A 2Z2SB 1W3XA 3ZFEC 3BI3A 2PHRA 4D6QA 3GGLA 4HLTA 1ND3A 4BJ0A 4CDQA 5JR2A 1WGPA 5A7SA 2LS6A 4QQHA 2XB6C 1YEWA 3T08A 2Y6JA 3WNKA 3UNPA 4YVSC 5FZLA 1UZVA 1MS4A 2JDUA 4WM8C 5FYTA 4CUGA 4MSVA 4YZ1A 1EV11 2ZACA 4FPCA 5A1FA 3HBKA 1L7LA 1AR72 2E33A 1CAWA 3WG4A 4MGYE 5JXIA 2J7MA 1W90A 3KWVA 4XBQA 4XJUA 1MS9A 2XJSA 1JODA 1W0PA 3BYWA 3LPGA 3POGA 3WP4A 4YM1A 1H4GA 3FHIB 1EY2A 1XNKA 2PHUA 1QXRA 1MS3A 1CZSA 4R4XA 2YYOA 3NNLA 1H6XA 3K46A 1YUDA 4EWDA 1JYNA 3EBRA 5T5PA 2QE3A 1NXD1 1O91A 4MZUA 3SNMA 3AP5A 5C3RA 1GANA 5EYYA 1LECA 5GKAC 3VHRA 1LHOA 3WQ7A 1APNA 3BB6A 1LCLA 3BOWA 3JD71 1OD3A 1UU5A 4MXVA 4ZS2A 3WDWA 5DMYA 1S0BA 2B46X 2GP3A 1BHGA 4JKLA 4KWKA 5F9TA 3KGLA 1VBE2 2BGPA 5FO8B 4FVVA 2Z4FA 1ODMA 4YFZA 1W8NA 2BWCA 2ZGTA 1VP6A 4DXTA 5FDBA 3M4FA 3ZYFA 3M3CA 2WZ8A 5DAPA 1GICA 1MR5A 1X9TA 2BFUL 2BOIA 2E7TA 2ID4A 4Z07A 3Q8AA 1DZQA 1RINA 2VCMA 4JDNA 2VNVA 3H50A 2WLQA 2H6BA 2K9ZA 2BYVE 2XWJB 4M3CB 5A3OA 3ZYJB 4N53B 1A34A 1ULFA 3T3YA 3M3QA 3V0AB 1GV9A 4PLMA 2UWCA 1QHDA 2R6QA 1HRV1 3AYAA 5CB7A 3CQOA 5KHGA 3V0BB 4XHXA 2Y6LA 3PVEA 1HB1A 2O8OA 5FOJB 3RG0A 2VH9A 5L7OC 5FYMA 4XUPA 1PZ7A 4YVWA 1W9WA 3VKOA 2HYKA 2JDAA 2DBNA 4HETA 2PTMA 5ERLA 4M00A 1AL22 2EXHA 3CJXA 2XWBB 4DRRA 3ZMOA 4DXZA 3ES4A 3FL7A 5FPXA 1DLLA 2LALA 1ZRDA 3AZYA 4NE9A 4AI2A 2E7AA 1HXS1 2IFRA 5JIAA 1W8TA 2TNFA 4MGSA 3I59B 1Z0HA 2SBAA 1W6NA 4KBBA 5T55A 4AEDB 4BK5A 5CFCA 4EV0A 1UMHA 3AP9A 2WQ4A 4YNIA 1RUI2 3HR9A 3HQUA 2PAMA 5KR7A 1C8M1 1SMVA 4GB33 4XF9A 5AVPA 2UYAA 3FLTA 1H2NA 4ZHNA 4FQ4A 1OVPA 4Q4X3 3VBRC 1BEV1 2BFUS 3POFA 4LITA 3ZO0B 2WZR2 4YW2A 2RM21 1RUC3 4LXLA 5T5JA 4BIFA 3ZFFA 1PIV2 1XNBA 2JDNA 3FHQA 3BUCA 5A7WB 3PTRB 3VD4A 3ZDVA 4H55A 4M0NA 4TLGA 5FYZA 4XFIA 5LBFA 5A3NA 5I8YA 2ARXA 4IL7A 1J1TA 3WDYA 2VW2A 4SBVA 4KH9A 4AW7A 2YFUA 3PUSA 2CAVA 4AEMA 5LBBA 5JIUA 4LTAA 5FAXA 3UKVA 1N1YA 3H3LA 4MUVA 1O4YA 4V2VA 4BU2A 4CCDA 2VY0A 1WD3A 2JECA 4JKKA 2A70A 2AGSA 4LHLA 1HN1A 1WMXA 3MPPG 1AXKA 1TZOA 3IAQA 4RL7A 4AFCA 4QX2A 4JTNA 5IVYA 2H0BA 1F9KA 3CDZB 4ATEA 1N1TA 1ONAA 3TNPB 3T4VA 4QGLA 3DEMA 5FYVA 4UW6A 3V56A 5FZ9A 2G9FA 2BW8A 2WS92 1W04A 1UPIA 3ZXKA 3UKNA 1K3IA 1AYM1 1DQ0A 1GZWA 4MXWB 3DXTA 3VD5A 1W03A 4HSJA 2CV6A 2OUJA 4RA0A 2XPJA 3AKQA 4I09A 3ZSMA 1UKRA 3H8XA 1GQHA 1FNYA 4DO0A 3JQWA 4F8AA 1V9U3 2HEYF 3N7JA 2JWPA 1W8OA 2ZGRA 2ZAHA 1D2QA 3D8CA 3JXSA 3QOPA 2ARAA 5LY1A 3AKSA 1RUH1 5HV4A 4YLZA 4A4AA 2K2SA 1J58A 3F2ZA 3RYKA 4NO4A 4B7EA 2XHNA 3J8F3 5A7NA 4LBQD 2DTYA 1QMJA 1W6PA 4Y5Z0 2FZ2A 3WP5A 2XJUA 4RHV1 1PVC3 5FKBA 5EYXA 4XXAA 4XURA 5LA9A 5IYYA 1S2BA 3OPWA 4F83A 4Z8BA 3KT4A 4Q0SA 3T4HB 1BBT1 2EXJA 4HFSA 4XACA 2BERA 1URXA 2W3JA 2Z5WA 3CKHA 4AR2A 4JQRA 3O1OA 1LENA 4NOTA 2CGOA 3MW4A 4CDXB 2A3XA 1PVXA 5BNPC 1AJOA 3UK9A 5FIXA 5CA6A 3WF1A 1GP6A 2VTFA 2F4LA 4K3UA 4Q4Y1 3POJA 4ZZ8A 4JGYA 2W1SA 4QQLA 1D4M1 2ET7A 2ZMKA 4D7SA 1B35A 3I3DA 4CCNA 1PK6A 1DQ1A 2Q8DA 4CUAA 3VBHB 2GNMA 2XQRA 2OVUA 2V5DA 1HJFA 5F39A 3I3QA 1JTZX 4DNYA 3P5BA 1XYOA 4Y24A 4C1XA 3GBWA 1QOTA 5LBEA 3I2GA 2O0OA 5JSRA 3WG1A 4LT5A 2W9XA 1OT5A 4CDWA 2VXJA 2RMU1 3LAGA 4Q0UA 4GQ7A 4FPHA 3V64A 1K5MC 4W65A 3WF4A 2Y8KA 4N9IA 4BCUA 2AH2A 4Q27A 2FHRA 1QJFA 4E8CA 1V00A 3S57A 2EAAA 2PQQA 5FPLA 4BA6A 1UY2A 2PQSA 1J1LA 5F5AA 4X8NA 1GZTA 2HWB3 2QDNA 4LPLA 5FZEA 3IZOA 3LDBA 2BNNA 3OGGA 1R083 2E53A 2HWC3 2VJXA 2GMEA 3MIHA 3OSDA 3I4IA 1VLNA 1VAKA 2JG9C 3B5LB 2B4KA 3AMNA 4YW4A 2VZUA 4QQOA 1US2A 2CL2A 3I3BA 3NNGA 3GHMA 3KV5A 5JI9A 3AP6A 4XEZA 2BUKA 2WNVA 3ZSJA 3MF6A 2RJKA 4YW1A 3U07A 4Q1RA 1AX0A 3PMSA 5FMCA 2B9UA 2CAUA 2JX9A 3ME2A 1CAUA 1ND3C 4M3CE 4A7YA 5J36A 1EV13 3DECA 1JYXA 1Q3EA 4W50A 3VDDB 4IV3C 4A3ZA 4LBMA 2VBBA 3ZLIA 1RUF2 2XKPA 3KS7A 2ZHMA 5T5LA 1G7YA 2J42A 1GNYA 2XGXA 3CHXA 1PHMA 3H3UA 4MADA 2B39A 3PJQA 4GA9A 1OOPA 3VBOB 3UGHA 3ZIXA 4Z92B 1X50A 2WNUB 2WRAA 5BNOB 4LBKA 3THTA 3OY8A 1UYPA 1S4CA 3ZR6A 2QVSB 4Q4W2 2W2IA 2DCKA 3UJQA 3IDEA 5F5IA 4CXXA 5KC6A 1CAVA 1QDCA 2CGPA 2R1DA 3JD73 5LK5A 4OHZA 2RS31 1IG3A 3MIBA 3OBAA 5FPVA 3APBA 3SCFA 4E4SA 1NE6A 3EHKA 2QDRA 3ON7A 3CF6E 4XFFA 1LNSA 3MIDA 3VBUC 1UW8A 1WWYA 3HQRA 2ILMA 1GYKA 3IAPA 2QQIA 4QX1A 4YGBA 2AZ5A 4OI2A 1NZCA 2E32A 3Q8CA 1OA2A 1NQDA 3ZYPA 3JB8A 2P3KA 1HV0A 1IOAA 2DU1A 3FFQA 3WG3A 5A3TA 4IUGA 1W6OB 4RR3C 4DEVA 4UFKA 4XF0A 2Q1ZB 5IK4A 4IEOA 4JC1A 1PZ8A 1K12A 1OSGA 4TZDA 1LOFC 5H9RA 1PGW2 4N7UA 1UU6A 1XU2A 1M06G 1UZWA 1HRV3 2XLFA 4GB32 3AFGA 4BOWA 1W8WA 3NRUA 1CAXB 4EWEA 4ASMB 3AMPA 1AYN2 3VBSB 1RUC2 4CU6A 1N1SA 5FZKA 5L9BA 4AFAA 4IV1C 3LKJA 2PLV1 3UV9A 5DUWA 3ZMNA 5D21A 4E8DA 4Q4V1 1PGL1 3KHCA 3LEKA 1HN0A 1Y9GA 3UETA 1SLIA 4A6OA 3BTAA 1HXS3 3DN7A 5CIRA 3NV2A 2DU0A 2ZEWA 1G9DA 5CFDA 1YIPA 5A6ZA 4P02B 4V1PA 1U5ZA 4IEXA 1QJY1 4MH0E 2Q0AA 5DG1A 2C1FA 4EROA 4CPBD 1C8M3 4MGQA 3OG2A 4NAOA 1DF0A 1C5HA 2XVLA 3M3OA 4KWLA 3THPA 1W6QB 1ND2B 4NIIA 1NCRA 3LB9A 4XETA 5A3PA 4AL9A 1LESA 4BQXA 4W6YA 3O14A 1DG6A 2WFF1 5DAXA 3AZWA 1W39A 4FPGA 5DAVA 1GBGA 3GDBA 2RE9A 4YPJA 3ZFFC 1OLQA 1XSQA 3JU9A 5J7MA 1RUJ2 3N7MA 3RSJA 3JBG1 1JI6A 4RQPB 3D3AA 3DPRB 5FZ6A 2TBVA 2W1UA 1OA4A 3ZFGC 3ZKUA 3POSA 2WKKA 4Q8KA 4ZPIA 3BIEA 3CJIA 2JG8C 1DIWA 3E1F1 4CP9B 4COVA 2A3YA 1PVC2 4PBPA 2I45A 1LRHA 2ZKNA 3MFCA 2EF6A 4TSVA 5FYUA 3ST7A 2OW4A 1S0FA 4PDWA 3ZIWA 1JUHA 1OFNA 1UYZA 3H1MA 2W68A 2JENA 3GYDA 3T2TA 4A3XA 4AVVA 4AVAA 1AYM3 1YYNA 1TQ5A 4CEYA 5A32A 1UL9A 3BKZA 2BDRA 2PHDA 3GALA 3ZX7A 1ZBE2 3E5QA 4AGRA 5A6YA 3D82A 1DYPA 2VW1A 4TYSA 4PHZA 4KGGA 5C6CA 2C26A 5DG2A 1BMV1 2IVIB 5C9AA 2YPDA 4LBNA 2DUPA 5CU1A 1RUH3 2BBVA 3AJZA 1KD7A 3OGRA 4CEWB 2XL9A 3AXDA 3O1SA 1FPN1 1S0DA 3LSDA 2RJ2A 4WM7A 2NM1A 4XFCA 4AHXA 5LA2A 4LE3A 1RJ7A 5A33B 5G05L 5ISLA 4RHV3 3ZSLA 4C8DA 1O4ZA 1ZZCA 2RS51 5FUIA 4LLFA 1SEFA 1J84A 3VDCA 4SLIA 3FWEA 2PN5A 4AVBA 2W52A 1XOYA 4IERA 4XFGA 4CCEA 4Y1ZA 1W9SA 4FBFA 1MZ6A 2WWSA 1ZBA1 3VV1A 1QJU2 1EPZA 2ET1A 4UXAA 4FTEA 4QQPA 1RITA 1F15A 1RTVA 5FTTC 1FOD1 1VBD1 2P34A 3TEZA 2YBSA 4Q4Y3 2HWB2 3LA7A 4U36A 1VAMA 2G9ZA 3DXUA 2W46A 4LKFA 3I2DA 5A3WA 4UF0B 1AZDA 3LWCA 3PMEA 2VOVA 1AR91 4GKXA 2RVAA 4JGZB 1S0GA 1KRIA 4D94A 3ZPOA 5BNQA 1AR81 4QQ2A 2AREA 4U2AA 2UY9A 5DZGA 4BQ1A 2YPJA 3KGZA 4PF5A 2W87A 4JDMA 3NAPC 2EIGA 2JKXA 5FLHA 5FZ0A 4NIAA 4QXCA 4ZZ5A 5IK7A 2Q5TA 3SH5A 3TAYA 1C1LA 2YV8A 1VPHA 4CDWC 5FZOB 4Y22B 1AL0G 4ES9A 3H1YA 1UNBA 3DUIA 4XHBA 2A6VA 5D2AA 3MZHA 1SACA 1QDOA 2VBDA 1UY4A 2I2SA 2L9LA 4RS5C 2P37A 3LA3A 4ES8A 2VAUA 3WOGA 2PELA 5FY1A 4CUBA 4OUMA 2W92A 4FOYA 4Y4YA 2BWAA 4NMIA 1I3HA 5JPMB 3OPZA 4IE4A 1Q8QA 5FP3A 5GZFA 2WT1A 1AXZA 4AFDA 4CP1A 5I93A 2DV9A 5CADA 2CY6A 5FLJA 4NN0A 2CDPA 4Q29A 1UOFA 3H0OA 2JE7A 5CEHA 1LGNA 1N47A 3AFKA 3N4MA 5BNNA 1XSRA 4JGZC 1WA4A 1BK0A 4QM9A 3UKTA 3PVBB 4PJYA 4W4ZA 1XNAA 4M01A 4E9KA 5A3LA 1ZA4A 2RG4A 2K46A 3JD72 4H7MA 4LK7A 4MGIE 4Q4X1 3HNYM 4XF1A 3OOXA 4Q0QA 4ISQA 2WNVC 4M3CA 3RNSA 4N53A 4UI9L 4QGMA 1AVBA 4QU2A 2XR4A 4MVTA 5A80A 5IAXA 2ZEYA 3CL1A 2WL1A 3KHBA 1OFSA 3D6EA 3BOPA 3V0BA 4EN0A 5EJZB 3I49A 2YC4A 3OGVA 1KITA 3VKMA 1UMZA 2B7YA 1BQPA 4B7KA 1ZZ6A 3DKWA 3LEIA 5EWSA 4KWJA 5J3UA 3FBMA 4WV8A 4QWNA 3KQ4B 4HXCA 2A6ZA 2B9VA 3IDAA 3OD0A 4I30A 4YZ4A 5E89A 1RHI2 2WT2A 4XTPA 3AK0A 3JCIA 4QX3A 1RUG1 5C8CB 4R9AA 4I01A 2VMEA 4LKSA 4A44A 1UCXA 5FZ7A 1RXFA 5IK5A 2WINB 2QTWB 2RS33 1HRV2 5E6HA 5DXDA 1PMHX 1EUTA 2VQ0A 3QCWA 4MGTA 2FZ1A 1F31A 3I59A 1WW4A 4XVHA 4C1WA 4AG4A 2HWD1 4DEQA 2A71A 4I0AA 4AEDA 4CA9A 3HVDA 3TB0A 3NNJA 1OI6A 4IEPA 3JQXA 1NLSA 2Q8CA 1VRBA 1WLTA 1Y4WA 4FPJA 3URFA 3VZOA 3Q8FA 3ASIA 3IDBB 4HKWA 4XUTA 4BWOA 4M0HA 5JVVA 3J8F1 1HXS2 2AEZA 2EIDA 2ORZA 2X09A 4ZU5A 4OQ8A 3QBQA 1VMHA 2ENRA 2I07B 5I0SA 4GMP0 1O8PA 1U5XA 1SDDB 1WCSA 3I7DA 1QOSA 3KF3A 1OD5A 1WBLA 2P5BA 3C7HA 3OPTA 2E63A 4HBNA 1C8M2 3GJAA 2BRTA 5A6QA 1HIXA 5A3UA 3RWNA 3BN6A 4W8JA 1JZ7A 1NG0A 3T0DA 2FCUA 4IESA 4IE0A 3MBWA 4J1WA 4Y20B 5C8CC 2DVDA 3VUOA 3PL0A 5IK8A 1BEV2 3P6BA 2W1QA 2EVXA 5EPAA 2J1UA 2RM22 3RJ2X 1F35A 1GUIA 2PLV3 1C5IA 4Q4V3 5JSOA 3LQCA 3H7YA 4JX0A 4I3PA 4Q2FA 5D8AB 1SBEA 2EA7A 2D3PA 4HPKB 4NWWA 3M7AA 1LOGA 1A78A 2J1EA 1OLME 3ZFEB 5E1RA 5HCFA 3P1IA 4Z2WA 2WQ8A 4YW6A 1ULGA 4E27A 1N1VA 1DQ5A 4IEYA 1QJY3 4YVSB 2XVKA 1XPWA 3K3OA 4FT8A 3VZNA 1CJDA 4WM8B 4B8EA 5CFDC 1JH5A 1UZYA 3T09A 1JZ3A 4DUVA 3PIJA 4IETA 1UX6A 1ENXA 3AVRA 3RZKA 2Q1FA 2XDVA 4OZOA 1F4AA 3WW4A 5T5OA 1AYM2 2D97A 5GZEA 4PIYA 2DBIA 2QQVA 3EO6A 3RZJA 3U14A 1OC1A 3RRDA 2JJ6A 2WFF3 3BGAA 4GKYA 5FZHA 3VBFC 2RS11 2WO3A 5IWFA 4QGNA 1UXZA 2VMGA 2VZQA 1JZ4A 2ADEA 2ZCWA 1IPKA 5C8WA 2R071 4ZY9A 3HPNA 5LK7B 4C0BA 2IWGB 1XBFA 1QJEA 4HMZA 3NV1A 5J37A 3WZ1A 3OUHA 2JE9A 1GR3A 2OPKA 4P5YA 1GU3A 3GHNA 4NPLA 3VD3A 4CDXA 1WD4A 1IPJA 1CIYA 5DPNA 1E57A 1Z78A 1CN1A 3NMBA 2WA4A 4NAMA 3RFRA 1R64A 1XU1A 3HEIA 4JTOA 5AFBA 4RHV2 2VZOA 3R4UA 5C33A 5JOYA 3DKQA 4P9IA 4HKLA 2R7EB 1J3QA 5EHDA 4XZUG 4QPGC 4URTA 1BBT2 2V73A 5FRAA 4XJ9A 3VBHA 2LRPA 3NL1A 2R49A 1UIJA 4E4DX 4NUBA 3WG2A 3SITA 1I5ZA 2A5ZA 1BVP1 2R32A 3O1MA 5A6XA 4L9BA 3LSEA 1QF3A 2UYBA 2RJLA 4I02A 4LUMA 3IMMA 2C4XA 1W8UA 4R9DA 1D4M2 1DHKB 2YROA 2RV9A 1VE0A 2QQOA 1V6LA 2BTVC 5CG9A 3BIWE 1FPN3 1LODA 1YO8A 5JMCA 4JZRA 2W1WA 3PUHA 4GJYA 1GWKA 3IT8A 4GULA 1CD3G 4FAHA 5C9AC 5HCHA 2EIBA 4N43C 2RHPA 4CYDA 4A42A 5AC92 1OVSA 2P3JA 2RS53 1QQP1 1VBC2 2J1AA 2XJTA 3UT0A 1WCUA 2B5HA 5F3IA 4AAXA 4BISA 2A1XA 2LROA 1EUUA 2RMU2 3RZZA 5L7OB 1UKGA 2NYYA 3IDCB 1NCQC 1X36A 2ETEA 1ZBA3 2FMDA 1O6UA 4O65A 4QKDA 5F6LB 2GN7A 3BCWA 4Z1VA 3C3VA 4XQWA 2ZJCA 1KEXA 2EAKA 1HRI3 3C7EA 1FOD3 1VBD3 3ZXGA 3H3ZA 4OYUA 3ETPA 3H8UA 4IGOA 2R041 5FXXA 1NY71 4Z2AA 5DUUA 5K0UC 3KT7A 4AI8A 1PX3A 4XIKA 5F3GA 1OA3A 1COV2 1QGLA 2MPFA 3TOJA 3OJBA 1AR93 3VDDA 2ATFA 4P08A 4QX7A 3RMXA 3W58A 4BMBA 1AR83 1ZYBA 2VMCA 4GXLA 1SFYA 2XKOA 3ZXDA 5GLTA 3L2YA 3VBRB 4HVRA 2VZ1A 1V0AA 3E5UA 3ILNA 1OLRA 3P3NA 3QH7A 4H2AA 3VKLA 1GKBA 4C91A 1ZM1A 5FPAA 3C7FA 2BU9A 5FZIA 4LE4A 1L7QA 2JDHA 4KU7A 5LA0A 4QKNA 3VBOA 4MLOA 4XJWA 4QB2A 2VZRA 2DCYA 2WNUA 5BNOA 5GZDA 3ZPYA 3DV8A 4LOTA 4Y1XA 4CCKA 1RIRA 1LHVA 3RJRA 5GALA 4XF4A 3IM0A 1H2LA 1ZRRA 1G9BA 5C4WC 4D3WA 1JU3A 1H30A 4ASLA 1BZWA 1UOGA 5GLZA 1ODNA 1I6XA 5FCCA 5FMDA 4DXRA 1SLCA 3CLPA 3POWA 4FPEA 3S5AA 4FTBA 1GP5A 3G7DA 3VD7A 4F7ZA 3MFAA 1UPSA 3MW2A 3N3HA 3B94A 2N7GA 1EAH3 1JOBA 5ACA2 3FUOA 2JB4A 2MHFA 4NPRA 5JR7B 5HPOA 5K8SA 5FY8A 1N3OA 2ZGUA 4MGZE 2XMLA 1LOCA 1GFF2 2DCZA 3NW4A 1ZNPA 4J1XA 1E5HA 4IGPA 3D0JA 5FQ0B 3WD5A 3AKRA 1VBB1 5FZDA 4IXLA 2BJSA 5BNNC 1SPPA 2RS32 2JDMA 3ZN4A 3SC7X 4FFHA 5FPBA 1N3PA 5K9YA 4B4QA 4UFIA 4JHTA 2EICA 3S7IA 2OKXA 5F5CA 4QPIB 3ZM8A 4LK6A 1LAJA 4GH4C 2D98A 1RL3A 3ZN6A 4NIHA 4FPLA 2E6VA 4Q26A 4H14A 5T54A 5CVRA 2QBXA 5FO7B 4LKEA 4XFHA 2BQPA 2FQPA 3DGTA 3I3MA 4DS0A 3VHNA 1O3SA 3RQ0A 3OEBA 3RZLA 2VG9A 4K9SA 3VBSA 1TEIA 3LCPA 1MVEA 4CXWA 5HXMA 3C7OA 4L11A 3ZYRA 1UU4A 3K3NA 3ZKYA 1LHNA 2CWSA 1DZTA 2YMZA 2ORXA 4QB1A 4UBHA 1JBCA 2QNKA 2UWBA 1RUG3 1ENRA 4XMIA 1VJ2A 1F5JA 3B93A 2GC2A 5BNPB 1A8MA 5CG8A 3MV11 3LOIA 1HB2A 2QFEA 1X82A 5JZGA 2YU1A 3AYCA 5FXVA 3AB0A 3U78A 3TRSB 2HWD3 2RDQA 3DCQA 2JD4A 1H1AA 1SFPA 4MHRA 3KB5A 4MV2A 4AE2A 1OPMA 1YFUA 3J4UH 1R1A3 2PLV2 1CONA 2X5IC 3MV01 1KS5A 1R093 1XQNA 5F8PA 4ARYA 3I2OA 2ZPXA 4QPIC 2R063 4YW5A 5FYCA 3ZXEA 1MEC2 1W8HA 1OH3A 3H8OA 4JDOA 1ENQA 2DYCA 1RUE1 3N9OA 2MEV1 4NPMA 1W6QA 5ABJA 3WDUA 1ND2A 4GAZA 4FO9A 4TXWA 4YG6A 3S6PA 1IZ3A 5LATA 1CX1A 2HWF2 5CAZA 1K5MB 3VN4A 1QJY2 1NA1C 3L2HA 2RR11 2TUNA 4CDUA 1DQ4A 4GMP1 4AI3A 3HT1A 4X6RB 5IFPA 1NE4A 5FZ4A 4D8MA 5FYIA 1C8NA 2DVGA 3DPRA 4JV4A 4LBOA 4Y1UA 2WQZC 5JPNB 3KV9A 2PHFA 2Z69A 2ZX0A 1W8FA 2VL4A 2YG0A 3LDKA 2D44A 3K48A 2JG9B 4XUNA 3I2JA 1RB8G 2I74A 4CP9A 1JMUB 3X29B 1FATA 4XMAA 1WBFA 5KXDA 3RGBA 3FHAA 5KHHA 5JOXA 3BTXA 2R16A 5K7PA 5C3SA 1EP0A 4RGAA 2GNDA 1XXNA 3LIHA 4IQPA 1OLMA 3JBG2 2C6SA 4P9YA 3A0NA 2OQ7A 3GCWA 2WZEA 5CKMA 2VE1A 3OTFA 1Y9QA 4RN5A 1MQTC 1XYPA 1H8TC 2D3SA 2D93A 3H1WA 1ND3B 2NQYA 2YHJA 5FREA 4NWVA 2VZTA 4IV3B 3SEPA 1JOJA 1I5PA 1F8VA 2Q4SA 4CEWA 2FDHA 2VM9A 2C24A 2J22A 2Q8OA 3AL6A 2WYSA 3MHZA 2BGCA 5A33A 2WBKA 3ABZA 3HBZA 3B69A 3N35A 3NV3A 3MLKA 4IGQA 4NROA 4O7XA 1V6JA 2RS13 5J1XA 3POYA 4Y5TA 2CTVA 5A7PA 3ZXJA 3MI8A 4EWAA 1QH6A 2R073 2OXBA 1WLWA 1RYYA 1BMV2 3EMRA 5LY2A 1S0IA 5C5UA 4XJZA 5FYHA 1AX1A 1NZIA 3O1TA 3K77A 1NKGA 1FPN2 4Y5SA 4YW7A 5FOBB 3QLQA 4I0BA 5KXEA 5FZBA 3OUIA 4I3GA 3RPQA 4UW3A 2ZGKA 1NUKA 2YY1A 4AWDA 2JEMA 5FP8A 2NPIA 2AACA 2WO1A 2WIIB 5JOWA 3KMHA 4K40A 2JIJA 4OUEA 5J98B 3BPSA 3VBUB 4UF0A 1VMJA 4HZFA 1UQXA 5BV6A 3PU8A 3FFZA 3NJXA 5BYNA 1AUYA 5LB6A 4CDQC 4LNVA 1FXZA 4KL1A 5A1AA 2FDFA 1ZBA2 4RGKA 4I0WB 1YFWA 4QX8A 4OI0A 4R9CA 2D6PA 1V70A 2H0VA 1FOD2 4RR3B 3FJSA 4XQDA 1YJKA 2WWUA 4LOSA 5K4LA 3IMNA 5LRSA 1XRUA 1IS6A 1WCKA 5FZ1A 4CRQA 1UXXX 2GU9A 2P3YA 2OQ6A 2VQUA 1REEA 5D1IA 5FZOA 5SV5A 4MG2A 2VUAA 2ZAAA 2XXZA 3MIGA 1S0JA 4WVMB 3USUA 3L9JT 1AR82 1SDWA 1WCDJ 5FPZA 1K42A
chains in the Genus database with same CATH topology
1FMD1 1QQP3 2XBO1 5GJ6A 1DBNA 1NQJA 2DURA 4LEJA 5BUVA 1RUOA 1ZREA 3N36A 4AEKA 2K0GA 4MGKE 4IV1B 5HXVA 4WVWA 2DCJA 2JDZA 4Z82A 1JYIA 1KJLA 1V6IA 2PAEA 4BLJA 1I1EA 4S2HA 1X7NA 2R043 2UU8A 3KCYA 2VQAA 2GH2A 3HD8B 4L2NA 2WZR1 3JB4C 2VMIA 4KGQA 4AF9A 5EJ3A 1W6NB 2GSYA 4IEVA 3N7LA 3NO8A 1BCXA 2FMYA 2XJQA 4Q4X2 4XJAA 2GC0A 5J96B 2Y0IA 4A7KA 1VAVA 1FAYA 1AXYA 1ZVFA 2XL7A 3ZFFB 5JAXA 5L36A 2Q30A 4BYYA 4XILA 4YVWC 3B3QE 4LULA 1KFXL 3ZFGB 2R1BA 4O9EA 3ZXAC 1VALA 2JG8B 4HVQA 1IKPA 2XLAA 1U5IA 4X6QB 2D5HA 4K6BA 4ONUA 4K8FA 1TME3 3AZVA 4DOUA 1RUD1 5HI0A 4BZ4A 1VBB3 3P3PA 5CFCC 1POV0 2CGNA 1WLCA 1RGSA 1YI7A 3USSA 4YG3A 4WBBA 3MYXA 4HKOA 3AX4A 1JUIA 3HQXA 2TEPA 4LBQB 1GZWB 1RVF1 3MW3A 4AVCA 1V9U2 4COYA 3TYJA 1TE1B 1QKQA 2AYHA 4G9SB 4Y20A 1ASJ3 1OQ1A 1LR5A 2D6NA 4UW5A 3T1LA 3J8F2 1LOAA 4EJRA 1KS4A 3R05A 4S2FA 5DDJ1 4EN8B 5I8SA 4YARA 1GSLA 5D8AA 3WDVA 4AEJA 4HPKA 4XDQA 4AGVA 2ES3A 3ZFEA 1QJX1 4A2UA 4FXGB 2OYZA 1UAIA 5H9SA 3CEWA 2WSVA 2G9GA 4NHLA 1Y43B 1SLAA 1YJLA 4YVSA 1DGRN 1PM7A 1H2KA 3U10A 4RGGA 2Z79A 2ZGPA 3WW3A 1GQGA 2YXSA 2VECA 4AFMA 3AP7A 3G6JB 4JGYB 4AHWA 1RUE3 1Q43A 2MEV3 5IUQA 2EXKA 2D6MA 2OIIA 2YZ4A 2B8MA 2DVFA 3AKTA 5DUXA 4DB5A 4XZPA 3GBFA 3NAPB 1WMDA 2GNTA 4PIXA 5KHIA 2VVEA 5TSWA 2RR13 3K51A 4GMP3 2JKBA 4CDWB 1Y7BA 4INDA 4META 3E6CC 4RS5B 4HSLA 1I9RA 3AMQA 2ZX2A 1HX6A 1XE7A 4CDUC 1HRI1 4XTMA 1ULDA 4PQ9A 5JDBA 3ILRA 1W6MB 1X8MA 3KCCA 1R082 2BNOA 2HWC2 2BPA2 1H2MA 2KXLA 3SISA 4N90A 4M3CF 1YI9A 2LTNA 2X29A 3RYRA 4PIZA 3B00A 4JGYC 4FP2A 3ZSEA 1B35C 1IGOA 2UY8A 1PK6C 4MYEA 3RI8A 1JW6A 1RUNA 1H1MA 1RUF1 4XYXA 2GN3A 2ZGMA 5EXOA 2WA3A 2WNVB 3LZZA 1FT9A 1UIKA 2ZMNA 3IIAA 2OA2A 1EV12 2HJIA 1CAUB 3VZLA 1V6OA 4Q4W1 2QCSB 4HANA 2VPVA 5DZEA 3SXWA 5L7OA 3ELNA 2PAKA 2XJPA 1U5YA 1EAH1 3B7MA 1QOOA 3RYPA 4W6XA 1MS0A 3SCGA 4EN6B 5T52A 1U0AA 3SCHA 1BYHA 4DMIA 2F6BA 1VBA1 2ZKLA 2XLGA 1QQP2 5BXXA 4P9LA 1PO11 1VB2A 1CAVB 3A0KA 3OF1A 1KJRA 2WNEA 3MICA 4QX5A 4DINB 3AZXA 3VHOA 4AFBA 4HL0A 3V0AA 4AVSA 1IS3A 2W08A 1PGW1 1WMEA 3VBRA 1G9AA 4KG8A 1Q5OA 4YG0A 1QH7A 4LO4B 4AGGA 4ITCA 2R042 5KWRA 1NY72 4TWTA 2WZPP 3AMHA 4XXPA 3ACLA 5FBZA 3M70A 1VRH1 1AYN1 3ES1A 4FPYA 5IT6A 1F2NA 1OOPC 1G8WA 4FXKB 1FMD3 3SLIA 4BPZA 2GNBA 2D40A 2WJSA 2XBO3 2HEWF 3FUQA 3QD6A 3FMGA 5KC5A 1NOVA 4I2OA 1WW5A 1A6CA 4IEUA 1TMF1 1WLDA 2D5FA 1LU1A 4S2DA 5GM0A 3VZMA 2X53S 1R1A1 1R091 1RUI3 2R061 3ZSKA 4D69A 2OUHA 3FLRA 4R52A 1NXMA 3VKNA 3GZAA 1FV2A 4QPYA 4WVZA 5FFOC 5BY5A 4NR1A 5JWPA 3H9AA 2WZR3 3LA2A 1J3PA 3OYWB 2WFPA 3BALA 5CFDB 3HT2A 3SH4A 4HK8A 1O3RA 3AJYA 1PO21 1TNFA 4YRDA 1LKNA 1CVNA 5GLVA 2C0ZA 1H9PA 1VBB2 2ZS6B 2BVBA 1CPMA 3VBFB 1LHWA 1C28A 5JSPA 3MDPA 1CESA 2PYTA 2NZ9A 4AQ6A 5BNPA 1CR7A 4DRVA 1DYKA 4MXWA 3O0VA 1YCIA 3CU7A 3D4KA 1D0GA 3NVCA 4XJ8A 3GZTB 4L97A 1ZZBA 1GNHA 1V6MA 1ZBE1 3O12A 5AFEA 1XE8A 4QPGB 2JXAA 1RUD3 3PHMA 2E7QA 2AENA 4EN7B 3VGIA 2CWMA 4LO5B 3PTYA 3UJOA 4HN1A 3O0XA 2R0FA 1MACA 4OI1A 1POV1 5JLVA 3B01A 1RVF3 1D4VB 1K5MA 4B29A 1NCRC 4LBJA 5FMOL 4GIQA 2E9QA 5I0RA 2GMMA 1OHFA 2VNGA 2GAUA 1KFUL 1RUH2 2PHLA 3IPVB 4R8HA 5C9AB 4N7IA 4N43B 2IXKA 3WW2A 4COWA 2MEV2 1QJU1 4AVTA 1UN1A 3FZ3A 3V65A 1W0OA 5DDJ3 2JG9A 2NMOA 1BKZA 5I0TA 2ZMLA 1NCQB 1QNYA 5GZGA 1HDKA 2RR12 3CJIC 3ATGA 1QJX3 4L92A 3KD4A 3HWJA 1JN2P 4OI4A 1ZX5A 3PLQA 3E97A 5E8AA 3MZHA 3WT3A 4PDWC 5K0UB 4J6GA 1JXNA 1H9WA 4Q4Y2 4CEYC 1RJ8A 3QACA 3WNXA 3LOBA 2ZGSA 3PVNA 4IV3A 1MS5A 3WCSA 3MF9A 1YIFA 1HW5A 4JVAA 1N3QA 1C3HA 1NLRA 3KT1A 3MGUA 1BVVA 2VULA 1ZZ8A 5A3MA 1RMU1 3IN9A 4CTEA 1ZRFA 1AR61 4P9WA 4BE3A 3IWZA 3S7EA 3TNQA 1PNFA 1XNCA 4WM7C 1U12A 5E16A 5F1RA 4FCAA 3EXUA 5FO9B 1KQRA 3HMYA 3R0RA 4FSJA 5FMOS 1HV1A 5C4WB 3ZYIB 1ALYA 1D2SA 2VU9A 4WZFA 1QWRA 1OMIA 4FAGA 3VBUA 4FTSA 2VNOA 1OQEA 3SMHA 4COUA 3MIEA 1GZ9A 2ZGLA 4AQ2A 1XNDA 2Y38A 4H3WA 1RUF3 5BNNB 4RR3A 4JCKA 3D0SA 3TBDA 4E2SA 2VVFA 1Z7S1 3INAA 3M3IA 4YGCA 1LOFA 2GZWA 3RDIA 2YGMA 1PGSA 1Q8OA 4GH4B 2XVGA 2A7AA 2XH6A 2AR6A 5GLWA 1KDMA 4WVMA 4E4ZA 4Q4W3 4IEWA 3TN91 4K7JA 1RHI1 4YM0A 4FQZA 3WDXA 4DQAA 1LU2A 5H9PA 2F4PA 2PA7A 4IV1A 2O8QA 4R9BA 4PLNA 1B09A 3E6DA 1O4TA 2YDEA 5CNAA 4LLOA 2VMHA 4K21A 4Y1VA 1O3QA 1TME1 3VHPA 4B3NA 1QXJA 4FOQA 1VBA3 4ZXKA 1FMD2 2A6YA 2DWRA 1PO13 1W6OA 2XBO2 1X33A 4HN0A 3MIFA 1V6NA 1MVQA 4EN9B 3S0MA 3HN1A 3I8TA 2V5YA 2X5IB 1JHNA 1C1FA 1IS5A 2Q1MA 3O7OA 3E6BA 1DQ6A 2XJVA 4N53C 5DZFA 1ASJ1 3VL8A 1DQ2A 5KXCA 1CAXA 2R0HA 1NA1B 3WINE 1G9CA 1VRH3 1AYN3 1Q8VA 4LUKA 2IXJA 1SLLA 4L99A 3ZFGA 3NKTA 1YXWA 2WLPA 2ZHKA 1S55A 3FBYA 2JG8A 4XOGA 5KXBA 2QQPA 3J9SA 4XPVA 1TMF3 1NYWA 1M4WA 4PCRA 3WP6A 1F5FA 4Q4V2 1X8EA 2ZZQA 5E88A 1W2UA 1PGL2 4K20A 3B02A 4AQSA 3I54A 2DCTA 4AEDC 3WW1A 2QJVA 4OZXA 4BLIA 2HKXA 4OUSA 1TNRA 2DVAA 4DZGA 1MQTB 4C90A 3SHRA 1H8TB 3OGJA 2UURA 1WMFA 4LBQA 4LO7A 4XBLA 5EFUA 1HQLA 2VVDA 2ZABA 4IEQA 1LEDA 2QZ3A 3JZVA 1YFYA 4YZ5A 2YGLA 1PO23 1QXPA 1SCSA 4B4RA 1RUD2 2HWE1 2IXLA 3ENRA 1LULA 1AF9A 4RQPA 1RUJ3 1AJKA 3BPZA 3FE5A 3WQ1A 2WFF2 1RVF2 1MS8A 3AP4A 2PHXA 3ZXLA 1YRZA 1C4RA 2BVVA 3MPBA 1LOEA 1QU0A 4ISRA 1C57A 1AR71 1ZBE3 4Y26A 5DDJ2 2ARBA 1SLBA 4FP3A 4CDQB 2XHKA 1KDKA 4E2QA 3HIFA 4GWMA 2PFWA 4XW3A 3JUUA 4D7YA 3WDTA 1QJX2 4LHKA 2D43A 4AXOA 1SBFA 1POV3 2W39A 3T1MA 3NAPA 4AK3A 1FX5A 1CAWB 2X8KA 3NKGA 2D3RA 2IXCA 1IHMA 4XBNA 2OZJA 4IEZA 5AC91 1VBC1 5AVAA 4OHYA 4UBGA 1RC6A 1ZRCA 1VBE1 4RS5A 1CIWA 1HLCA 2VOXA 3C2UA 1PNGA 4MX3A 1QJU3 2O1QA 3B9CA 4OFGA 1HQNA 2A75A 3ZYGA 4K1ZA 1W6MA 1YWKA 2A73B 3R6SA 2RS52 2BEOA 1QJZA 3EQEA 4CDXC 1G6NA 4PBOA 4CZSA 4HVOA 5GZCA 4JGZA 1VR3A 2C5DA 1COV1 2GC3A 5T50A 1S2KA 2ZA9A 1HRI2 1OQDA 3DL3A 3VBHC 1VBD2 3FLPA 2Z42A 1DGWX 4R4ZA 1IQAA 2JICA 1H8VA 1AR92 4Y22A 4AYUA 1RMU3 4ZU7A 1Q8PA 1AR63 2P17A 2ZTNA 2NN8A 5KHKA 1AL21 4D7TA 4YZ3A 1BJQA 2D7FA 2DUOA 2ZX1A 3QH6A 1VB4A 4X8PA 2DTWA 5ACA1 2VUJA 3NJZA 4YVWB 2QUOA 4KQ7A 3FC0A 1RUI1 2VOWA 1H4HA 2D6KA 3M1HA 5GLUA 4AI0A 4AI1A 3M8LA 3WLUA 4L8QA 3EJKA 1EAH2 1SBDA 1PIV1 2E51A 4AHZA 4PLOA 1GNZA 5CFCB 2VXRA 3SH3A 3M2MA 4YM2A 3VDDC 1VBA2 1H0BA 3W9AA 1FV3A 1Z7S3 3WV6A 1PO12 4KU8A 2C9AA 3GBGA 5JOZA 4LO6B 1AX2A 1SFNA 4K1YA 2BNMA 1L3JA 4FOWA 4OHVA 3VL9A 3TN93 1FNZA 2KA3A 2H6CA 1RHI3 3VBOC 5C8CA 2WNUC 3ILFA 5BNOC 2GC1A 3ZN6B 1CPNA 4TLFA 2WS91 4FPFA 3R4SA 2ZX3A 4WVVA 1DFQA 1VRH2 2V09A 4LHNA 1S0CA 1BK1A 2ZHNA 2KM2A 4OLLA 4H7LA 1RUG2 2HEVF 4O9GA 4YFWA 1MEC1 4CP0A 3ZXFA 1O5UA 2HWD2 1TMF2 3OYWA 4ORFA 3WUCA 5JZGB 5JCTA 2HWF1 4G4FA 1R1A2 1R092 2ZZJA 1G9FA 3VZKA 2R062 3KCXA 5HCBA 1GZCA 4P14A 4Q8LA 2DF7A 5H9QA 2GH8A 3VBFA 1BEV3 5ABJB 2GDFA 3OBTA 4ZU4A 1HKDA 2RM23 2NMNA 1W6PB 3LGRA 5HBAA 3WCRA 3VBSC 2IC1A 3PVOA 3H7JA 4DFSA 1PO22 5FLIA 4CDUB 2ZGNA 1V6KA 5LEJA 4Y1YA 3KSCA 3ETQA 3IBMA 5CBLA 2EALA 1G86A 3WX5A 3AKPA 4RFT0 2GALA 4WM8A 4QPGA 2DVBA 1A8DA 5JZGC 2ZGOA 2DFBA 1B35B 1PK6B 1LOBA 3KZ4C 1FYUA 1J3RA 4YW3A 3MEPA 3ROUA 3RS6A 3WR0A 5I91A 5ABJC 1QNWA 1IS4A 2OZ6A 3RI9A 1ND2C 2WSUA 4QMAA 4XQ4A 1LTEA 1SLTA 4RSUA 2NP0A 2HWE3 3IPVA 4N43A 1LGCA 2AUYA 5I8TA 1CQ9A 4P9GA 4QT6A 1ULCA 1ENSA 2P2KA 3IKWA 4LA3A 1HQWA 2ZX4A 3U4XA 3U11A 3AYEA 2RS12 4RQPC 3DPRC 4QM8A 1NCQA 3MLJA 5HCAA 2R072 1LGBA 2P3IA 1O7FA 3BODA 4YGDA 4E2GA 4BH9A 1LB2A 1BBT3 1LJ7A 4QHBA 4YZ2A 3VZJA 3WHUA 4DY5A 5SV8A 4W6WA 5EV7A 1AR73 1REFA 1IKQA 4HT1T 5K0UA 1SCRA 1AHSA 4Q0VA 1UZZA 3CO2A 4KNCA 2YC0A 1D0HA 2DUQA 3TWIA 4AQTA 2LM3A 1D4M3 2ZBJA 4XF3A 1Y3TA 2D6OX 3U0ZA 3ZDSA 3NSTA 1ULEA 4CEWC 3W59A 4BIOA 1WUVA 4UW4A 4JRLA 2VGDA 5AC93 3RMYA 1VBC3 2XUMA 3FX3A 3R4DB 4WZCA 4JAAA 2RMU3 2IXIA 1DU3D 5J48A 3B9IA 1VBE3 1DDLA 5C4WA 1OOPB 2GMPA 4YM3A 3N7KA 3E5XA 3ZN5A 1RMU2 3OY8B 1AR62 4XFAA 3USUB 1DGWA 2QKDA 4RD7A 3M3EA 3DF0A 5DUVA 1YNAA 1YHFA 4XIOA 3PNAA 2Y26A 4S2GA 4YYOA 1CJPA 3OCPA 2IXHA 4C0HA 1COV3 4ATFA 2MNGA