3WG3A

Crystal structure of agrocybe cylindracea galectin with blood type a antigen tetraose
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
163
structure length
163
Chain Sequence
KHMTTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactoside-binding lectin
publication title Conformational change of a unique sequence in a fungal galectin from Agrocybe cylindracea controls glycan ligand-binding specificity.
pubmed doi rcsb
source organism Agrocybe cylindracea
molecule tags Sugar binding protein
total genus 40
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wg3A00
2GNMA 2VY0A 2DVBA 1S0JA 4R9BA 5GZGA 2UU8A 2AH2A 1N1VA 2EXJA 2C5DA 4FPLA 3AYCA 3RSJA 1S1AA 3B00A 2DUQA 4OZXA 4XILA 1A8DA 1SLLA 3FUQA 1JOJA 3W59A 1H30A 3AJZA 5IK8A 1DBNA 3AYEA 2KM2A 3O12A 4ZXKA 1ENQA 1DQ4A 4P14A 3FUOA 3FFZA 2A6ZA 4YGDA 2R1DA 2CY6A 4XYXA 2PHWA 4BOWA 1HDKA 2ZGUA 4M00A 4XIKA 4ATFA 2D3SA 1G9AA 2A3YA 3IN9A 3BTAA 1A78A 4FQ4A 1G8WA 4XMIA 1CESA 5GLVA 1FATA 4YW3A 2ENRA 1HQWA 4LBQD 4XOGA 4AYUA 5IK7A 3RMXA 4YLZA 3GALA 3AZWA 4CTEA 3RQ0A 5GLUA 1JW6A 4FVVA 1ULEA 3JUUA 1C57A 2DUOA 1W6OA 5E8AA 2NMOA 2P2KA 1N1SA 4ATEA 3V0BB 5GZDA 2A6WA 2OUHA 4WZFA 1SCRA 2R49A 1JYIA 2ZGRA 5BYNA 1ZM1A 4YZ2A 1WD4A 3AP6A 3IPVA 3ZYPA 1SFYA 3HN1A 3HR9A 1G9DA 3M3CA 4WV8A 3PJQA 1QNYA 1VIWB 1Q8PA 3M3EA 1RITA 3RMYA 3FLPA 1W6QB 3WG4A 2W08A 1V6OA 1LHNA 3APBA 5DG2A 3AXDA 3WV6A 4FP2A 4BQ1A 1G7YA 3WG1A 2ZGSA 5H9RA 2EF6A 2P37A 4FOVA 4YW4A 2D3RA 4Y20A 2CYFA 3WUCA 1LOBA 1AX0A 1AX1A 2ZHLA 2ZHKA 5IK4A 2EAKA 1S0EA 4Z8BA 1EPWA 1UX6A 3AZVA 3N7KA 1CPNA 3B69A 1W0OA 3NV3A 1HKDA 4XJUA 1QOOA 1IS5A 2E7QA 3KQRA 1MS4A 3HMYA 4YG0A 3V0AA 3FLTA 3MW2A 2RHPA 4XBLA 1Q8SA 3AJYA 4FPOB 1HQLA 3C2UA 4Q8LA 3N7LA 1QDOA 4ISRA 3B3QE 4Q1PA 2CWSA 4R9AA 3A0KA 2A3XA 4IQPA 1GZCA 1S0IA 5KXDA 3IKWA 4GWMA 3T2TA 2A7AA 3M2MA 2W68A 3N3HA 1LHVA 1IKQA 1CONA 1RINA 1W6OB 2DUPA 2UWBA 3PMEA 4UW5A 4XTPA 5T5OA 3VV1A 4AGRA 1QGLA 4LBMA 1WCSA 2PHFA 4BPZA 4Q27A 1AXYA 3WDXA 3O5SA 2EXIA 1QU0A 2GNTA 2AYHA 3ZXJA 1W6PB 1WW7A 3IPVB 1NLSA 2GN7A 1V00A 4P9WA 1IS4A 1CN1A 2R0FA 1WW5A 1KJLA 4FOYA 5E89A 2JJ6A 5HCFA 3N7JA 4M3CE 5DXDA 1YXWA 1GNHA 3AZYA 1S0DA 3OGGA 1BZWA 3MW4A 4FPFA 5DZEA 5H9SA 4DS0A 1S0FA 2GNBA 2VXRA 5GZFA 4XJ9A 4GKYA 3PVNA 2ZAAA 3ZXLA 2NZ9A 4DRRA 2ARBA 3MW3A 4Y20B 2LALA 1LOGA 4FP3A 5JDBA 4LBNA 1WLDA 1S0CA 3BODA 5CA6A 4YGBA 4P9XA 3FLRA 4Y26A 1DIWA 1LGCA 2NMNA 4YW1A 1LEMA 4YZ1A 2V73A 1MS3A 3V0AB 4FPYA 3VKNA 2NP0A 2D6MA 2VH9A 1GBGA 1PZ9A 5DUVA 4AWDA 1UL9A 5GM0A 3LSDA 2D6OX 1I3HA 4KBBA 2EIGA 3LCPA 2ZHNA 4YFZA 1W6MB 3TB0A 3D5OA 2DURA 1FV2A 5T52A 3ILRA 1UKGA 3R05A 1G9CA 2P3JA 1D2SA 3POSA 3N35A 3WG3A 5KXBA 3ZSLA 2A71A 1H9WA 3MEPA 3A0NA 5T5PA 1CPMA 2WLQA 3R4SA 4K21A 4AVVA 2WT0A 1B09A 2D44A 5EWSA 2NYYA 2UWAA 1V6JA 3AZZA 1X50A 1SLBA 1YRZA 1PZ7A 1C4RA 1KQRA 1AXZA 1KDMA 2LTNA 2VW0A 3ATGA 5DZGA 2D6NA 1QNWA 4YZ4A 2DYCA 4FOWA 4LBQA 1DGLA 1SLIA 5JVVA 3V64A 1KDKA 2PHTA 2A6YA 1LOEA 1DZQA 2ZGNA 3WHUA 1GV9A 2VW2A 2FMDA 1MS5A 4YM0A 1BXHA 5AVAA 1GNZA 5T54A 3UJOA 2WSUA 3AP4A 3WOGA 1W0PA 1JHNA 4K1ZA 4C1XA 1NXD1 2XG3A 2YV8A 1DHKB 2ZMKA 4GWNA 1LTEA 1O4YA 1DLLA 2ERFA 1WLWA 1W6PA 1GKBA 3OY8A 4XJWA 1YYNA 4WVWA 2CNAA 5JOXA 2CTVA 2WT2A 1DYKA 2EALA 2JD4A 5L73A 1AJKA 4R9DA 1FV3A 3VKMA 1SCSA 2AR6A 1JYCA 4M01A 3N7MA 3AP7A 4Y1YA 2ZMNA 1IS3A 5CBLA 1MS8A 5H9QA 4UW4A 1I1EA 2HYKA 1QDCA 4LBKA 5HCBA 3ZSJA 3M3QA 1N1YA 4GKXA 1FNZA 4H55A 1DQ1A 1F5FA 3AYAA 1MS0A 5FREA 1DFQA 5HCAA 2PELA 2WSVA 3UK9A 4M3CB 5DG1A 4C1WA 2GDFA 4W65A 2P3KA 3VKLA 4K1YA 1V6KA 4MYEA 2JE7A 4Q2FA 3OBTA 3UJQA 1U0AA 4PF5A 4NO4A 3V65A 1W6MA 1Z78A 2E53A 2ZBJA 1N3QA 1OFSA 1ONAA 4LBJA 4M3CF 4XIOA 1DQ5A 2DTYA 1CVNA 4LBQB 1LEDA 2DVFA 1OKQA 4WVVA 1A3KA 4BLIA 3ZSMA 1MS9A 2G4IA 1J1TA 2WT1A 2ZGLA 2JECA 3Q9OA 1V6NA 1DYPA 1D0HA 2A5ZA 3OPZA 4PCRA 4ASMB 4PBOA 4R9CA 1SBEA 2GNDA 3AP9A 2ZACA 2A70A 2ES3A 2ZKNA 3AYDA 4YW2A 1KJRA 4U36A 4YZ3A 3ZVXA 1QOSA 5KXCA 1UZYA 4YGCA 2SLIA 3L2YA 1UN1A 3GNEA 4YG6A 1BQPA 1BKZA 3OY8B 4L8QA 3JU9A 4XJAA 3A4UA 4K20A 5JOZA 3O0WA 1LJ7A 3AZXA 2ARXA 2H0BA 2EXHA 4XDQA 5JLVA 3RG0A 3NV1A 4Y22A 4UW6A 2WNEA 3WCSA 3ZXFA 1QMJA 1CR7A 5CB7A 4CRQA 3DGTA 2GMEA 4XJZA 3SISA 3ASIA 4BM8A 2R0HA 5IT6A 4YGEA 2D3PA 4ITCA 3WDUA 1YIFA 5DZFA 1VALA 1PZ8A 3INAA 1AF9A 3WNXA 5E88A 4DPNA 1FX5A 1GLHA 1WUVA 3CNAA 5CNAA 5F5QA 1LU1A 2FHRA 3AK0A 1LOFC 1ZA4A 1IOAA 5LK5A 1IS6A 1WW4A 4YM3A 2NN8A 1DQ6A 3T1LA 2V5YA 2D6KA 2VW1A 2ZGQA 4RL7A 4BLJA 4LBLA 5DUXA 4PQ9A 3WDWA 4CZSA 3WHTA 1JUIA 5GZEA 1LHOA 4YW5A 1UMZA 2I2SA 1G9BA 1BJQA 1LULA 2OVUA 1HLCA 2ZGPA 1MVQA 1OQ1A 3FBYA 1SLCA 4FPGA 1WW6A 2ZZJA 5FRAA 1V6IA 3BIWE 4AGGA 1CQ9A 1WLCA 4M3CA 3AX4A 3AP5A 3B9CA 2EXKA 1Q8OA 4Y1XA 3M1HA 1JBCA 1N3PA 3WCRA 1XQNA 3SITA 2P34A 4I30A 1ULGA 4Q8KA 1APNA 1GANA 2PHUA 3H0OA 4FPEA 1LGNA 4BMBA 1FYUA 2W39A 2DVGA 1DQ2A 1ULCA 2D7FA 2OW4A 1GICA 3ILNA 2ZGTA 5DUWA 1IKPA 2TEPA 1VLNA 2YZ4A 4D69A 1TEIA 2AUYA 3USUA 1SLTA 4ISQA 2PHXA 2WKKA 3OYWB 4Y22B 2DU1A 2YXSA 4DFSA 3VKOA 1FNYA 3D4KA 1LECA 3BOPA 5T55A 2GALA 1LOAA 2GMMA 2E7TA 5GALA 2UWCA 1VAMA 3VKFC 3KM5A 5EYXA 1WBFA 3RS6A 3SNMA 3POWA 4ZKTB 1W6NB 4PBPA 1RIRA 2ZGOA 1GZWA 1KITA 1UPSA 2A6VA 2YY1A 2D6PA 2DVDA 2ZABA 3N36A 1ENSA 4FPCA 4XXAA 1MACA 4Y1VA 1YO8A 3MPPG 1AX2A 4GA9A 3ZPYA 2SBAA 1MS1A 5T50A 1LHUA 1GZ9A 1BYHA 3WDTA 2WJSA 3W58A 3WDVA 4DRVA 3PVEA 4DQAA 1JXNA 5JMCA 1ULDA 3ZXEA 4FPHA 4Y24A 1MZ6A 5GLZA 5T5LA 4HL0A 1N3OA 3QCWA 3LSEA 3WVJA 2Q5TA 3T1MA 4XBQA 3O0VA 2C9AA 3R4UA 1WBLA 4GALA 3WG2A 5SV8A 5DUUA 2XB6C 4XHXA 4BMEA 3NV4A 2AENA 1H9PA 1R1ZA 2VUAA 5EXOA 2JDZA 2A6XA 1S0GA 2DWRA 4UW3A 3DUIA 4JRAA 2D6LX 3ZYRA 2R16A 4AVSA 1QF3A 3NV2A 2ZMLA 3SH3A 2JKBA 1YI7A 4JC1A 3VUOA 5H9PA 2R1BA 1Q56A 1Q8VA 2NM1A 2ZGMA 3I4IA 1GSLA 1LODA 1UZZA 2BQPA 2E6VA 3USUB 5F9TA 2UURA 4YM1A 1DQ0A 1WD3A 1CIWA 2YROA 3WDYA 4YG3A 1C1FA 5GZCA 4XTMA 3IMNA 4YM2A 1Y7BA 2DVAA 1Z0HA 1N47A 4FPKA 4FPJA 4XBNA 1FAYA 1MZ5A 4Q1RA 3WLUA 3SH5A 4SLIA 3AFKA 1MVEA 5JOWA 1GZWB 3TAYA 5T5JA 2E51A 2JE9A 1KRIA 1AJOA 1UAIA 5EYYA 3SLIA 1V6MA 4U2AA 3O0XA 4AVTA 1GYKA 4XE9A 2PHRA 5KXEA 1LOFA 1CJPA 1SBFA 2B7YA 3OYWA 1LENA 1C1LA 1LHWA 3D6EA 4TZDA 3IM0A 4XXPA 2ZHMA 2CWMA 3WUDA 2GMPA 3PVOA 1SBDA 2VU9A 1JN2P 2A75A 3POYA 3ZSKA 2DTWA 3I8TA 1LU2A 2AREA 1LGBA 2ZGKA 3M3OA 1W6NA 2AGSA 5IK5A 4FQZA 2WQZC 3NWKA 1G86A 4XZPA 4XJ8A 4P9YA 5JOYA 3QLQA 4AGVA 3OBRA 1LOCA 4RA0A 3UL2A 2GN3A 1QOTA 1N1TA 1LESA 3U4XA 1ULFA 2W52A 1V6LA 1F31A 1G9FA 1MR5A 1Q8QA 1ENRA 1QKQA 3V0BA 3OJBA 2CL2A 1AZDA 4FOQA 4HANA 3WZ1A 5IUQA 4YZ5A 1F9KA 1URXA 1VAVA 4GXLA 1O4ZA 4Q26A 2YMZA 4TYSA 3RRDA 5GLWA 1AVBA 5GJ6A 2A3WA 3ENRA 5CAZA 4NOTA 3AXEA 2DV9A 4Y1ZA 2OUJA 2D43A 4Y1UA 4YFWA 5GLTA 3B01A 1LCLA 2Z42A 4JCKA 2P3IA 1AXKA 2ZA9A 1SLAA 3ZXKA 1W6QA 4F83A 1S0BA 4XMAA 4LBOA 4XHBA 3SH4A 1SACA 2DU0A 3ILFA
chains in the Genus database with same CATH superfamily
4K3UA 4KL1A 2DVBA 2BPA2 4RR3C 1R091 3CO2A 4XFFA 5KHHA 2C5DA 4B4RA 3LD8A 1EP0A 3AYCA 3TN93 3H9AA 4XILA 1HQNA 1A8DA 3H3LA 1RUOA 1BK1A 2E26A 3W59A 4LK6A 2Y0OA 3WP3A 3PU8A 2KM2A 4CEYC 3L9JT 1VBD3 3PJYA 3R4DB 2R30A 4QPIB 1GWLA 2H6BA 4P14A 5FP4A 1W3VA 2WN3A 3DECA 5FZAA 1GFF2 1UY3A 3FL7A 4W50A 3RZJA 1HDKA 4GD4A 4KBZA 1GZTA 1US2A 1VE0A 4LXLA 4OUSA 4E4ZA 3IN9A 4OI4A 2RM22 3CU7A 4FQ4A 4IEOA 2LM3A 4XMIA 5FPZA 1JZ5A 3RZGA 4HMZA 5GLVA 4YW3A 4XCAA 5C70A 5IK7A 2R7EB 5IVEA 1R082 3BIEA 1ZX5A 2P6HA 5FWJA 5D21A 3ZXAC 1JW6A 3NQHA 2JG8C 3JZVA 4HVRA 3WQ1A 2VTXJ 4QGMA 4DOUA 4BU2A 3UT0A 1PK6C 2E33A 4LMFA 1N1SA 2X5IB 5GZDA 2OUHA 4AEDA 4WZFA 2R49A 1ZNPA 4CSWA 2XWBB 4RR3B 1SDDB 3B9IA 3VHPA 2RS52 1BVVA 3AM2A 3AP6A 3ZYPA 1QWRA 3HR9A 1YJLA 5ABJA 1G9DA 2P3YA 3M3CA 4B29A 2AACA 3I54A 1Q8PA 2EICA 1YQ2A 4JAAA 4X8NA 3RMYA 4QM8A 2OZJA 1V6OA 1IQDC 2BERA 1RJ8A 3ETPA 3AXDA 3HAGA 5FQ0B 4BQ1A 4J6GA 1UF2C 1HIXA 2EF6A 2AZ5A 1TG7A 1RUE3 4AI8A 5FZ0A 3D0JA 4XETA 4I2OA 3T09A 5F37A 1LOBA 2ZHLA 1TMF3 2RDNA 4RYDA 1CZVA 1OD3A 3TN91 4BQXA 3GBFA 3AZVA 2OPKA 2XMLA 2E7AA 2WLPA 4H7LA 4AI2A 3B69A 1UOJA 3OUJA 4NUBA 1VBD1 2JG8B 1NXMA 4XJUA 2Y38A 3PTRB 4QPGB 2UY9A 4YG0A 3CKHA 3MW2A 3OGVA 1H8TC 5FV3A 5A1FA 1Q8SA 3TRSB 4AXOA 3KLSA 1VBA3 4FPOB 2F4PA 2G9FA 3C2UA 3N7LA 4ZS3A 3B3QE 3VDBA 4FCAA 4R9AA 1E5SA 3BN6A 3ZYIB 4ET7A 5J7MA 5J37A 1NCRB 2YFUA 4HONA 3ZFEA 1GZCA 4YVSA 1VR3A 5KXDA 5C3QA 2ZPXA 2A7AA 3M2MA 2D40A 2AC1A 2ZX1A 3PMEA 4UW5A 1RINA 4QKBA 3PHMA 5L9VA 2ORXA 4Y5TA 3KHBA 4BB3A 2PHFA 1J3PA 2QQIA 3M4FA 5D8AC 4N43C 3RZKA 5K7PA 5A7PA 1IPSA 1NLSA 5IJRA 2GN7A 3F95A 1YC61 1CN1A 5CKQA 2QQLA 1WW5A 3ZYJB 5E89A 4CPBA 3PNAA 1S2BA 5J3UA 2J1VA 1YXWA 1GNHA 2JEMA 2XUEA 3AZYA 1BZWA 1PM4A 1OUSA 3MW4A 4UF0A 4CEWA 4K9SA 4HPKA 4DS0A 1ND3C 1S0FA 3VN4A 1OSGA 3NL1A 2VXRA 5GZFA 4Z2AA 3EBRA 4WVMA 5KHJA 1P8JA 2R042 1W2TA 3AFGA 1JZ4A 1TMF1 3PDQA 5CISA 3TBDA 4XUOA 3ZO0B 5CA6A 5LEJA 3S5AA 1VRH3 3A23A 3I3EA 3T0DA 1OXCA 2RS32 4P9XA 2JDUA 4N7IA 1AYN3 2NMNA 1LGCA 1WMXA 3HBZA 1LEMA 2WNVC 4KG0A 1W9WA 3V0AB 3ETQA 1D7PM 4FPYA 2VH9A 4AWDA 1PZ9A 3MO4A 1UL9A 4EN6B 4Q0PA 1VBA1 3CJIA 4Y3OA 3TB0A 1ZA7A 2V09A 1PO12 2X53S 3K4ZA 4OULA 3JQXA 5BY5A 3ILRA 1NZIA 3R05A 1T2XA 4L92A 5LA9A 1CAWB 4A6SA 1RB8G 1PVC2 2QQJA 5KXBA 1JODA 3ACGA 3MEPA 4M0HA 1F15A 1ND3B 4FAHA 1MPXA 2B39A 3R4SA 4K21A 4COZA 1LAJA 4X8PA 1BEV3 1V6JA 3AZZA 3M8LA 1SLBA 1RMU3 1XNCA 1POV3 3U1XA 3C7GA 2LTNA 2HEVF 4NRQA 5LBEA 4LITA 4YZ4A 1JTZX 4J25A 4D94A 2ZCWA 1DGLA 2VMDA 4GJYA 5CU1A 1SLIA 5FZMA 2ZOEB 3V64A 2PHTA 4MGQA 1GWKA 1GP4A 3WHUA 2ZGNA 1R083 4HSLA 5AVAA 5T54A 1FOD3 2VNGA 4CP9A 4JGYC 3WOGA 1J3RA 1JHNA 5K4LA 3LEKA 1A34A 5K0UB 4I0BA 3LOBA 2C4XA 2XG3A 2IVIB 4X6RB 2VVDA 1XOYA 1YLLA 3OY8A 1VRH1 3VBHB 2Q1ZB 4EROA 2CNAA 1AYN1 4LA3A 1X9TA 1PMJX 4GB32 4YNIA 3ZFFC 2WT2A 3I2KA 3SEPA 2OX0A 2EALA 2VXJA 1WA6X 1EV12 1PO22 1VMFA 2DFBA 2X8KA 3U10A 1FV3A 3VKMA 4BYYA 1SCSA 1O6UA 3UKVA 1E5HA 4M01A 2VOXA 5KC5A 2ZMNA 1A8MA 1REDA 4Q4V3 1MS8A 2DCJA 2IXJA 1Y9GA 3OD4A 2HWF3 2JDPA 4NROA 1QDCA 3FBMA 4LBKA 1N1YA 3K48A 4JTNA 4PIXA 3ZYBA 1UYYA 5LCWL 1FNZA 5FREA 1NE4A 1F5FA 3FZ3A 4EN0A 4C8DA 1ND2A 4LUMA 1RUC2 2PELA 3UK9A 4NIGA 4JGYB 1UQXA 2YC2A 2PN5A 3LOIA 3MLKA 2G9GA 4QPYA 4K1YA 1BEV1 4LPLA 4MYEA 1JYWA 4PIZA 2JE7A 1RMU1 4M4RA 4OHXA 4NO4A 3BPZA 1POV1 1NA1B 1W6MA 4Y24A 3ZXLA 4HZFA 2OYZA 4E4DX 3WF3A 5C4WC 1YHFA 3WD5A 1JMUB 2DVFA 3S0MA 3ZFFB 5APAA 4OFGA 2VBBA 3LEIA 2J42A 1D0HA 4NMIA 1FOD1 2PHDA 1T6GC 3AP9A 3MIHA 1H4GA 2R073 5FZOB 5EQUA 2AEZA 5IHRA 1SG3A 1E5IA 3VBRB 2VAUA 4XCBA 2SLIA 3CJXA 1FPN3 1VB2A 4YW6A 1ZZ7A 2YG0A 3DEMA 3T08A 4MXWA 1UYPA 2HH9A 4BHPA 4FTSA 4K20A 1XNKA 3GBGA 1EY2A 2Q1FA 2ARXA 3POBA 4NHKA 5B4XA 4IETA 3NV1A 4OMCA 4CRQA 2WNEA 3RZZA 3ZXFA 1QMJA 4FTBA 4Q4V1 4N90A 3DGTA 4L0PA 3SISA 1IHMA 4BM8A 2WIIB 3W21A 2R0HA 2R043 1BBT2 2HWF1 4EN7B 5CG8A 1NY72 2D3PA 3OGJA 2B8MA 2LW8A 3POFA 5C4WB 2R32A 1YIFA 4KQ7A 1VALA 1PZ8A 1UCXA 5J96B 2HWD2 3INAA 3BU0A 4UFJA 3WNXA 2RS33 3FN9A 5F3EA 5E88A 1GOHA 1US3A 4DPNA 1SHWB 5FPXA 2YBPA 4QKNA 4AK3A 2VZQA 2XHKA 1UIJA 2JX9A 1IOAA 1WA4A 2YC4A 1OUXA 2G9ZA 1OF3A 5BPXA 1B35A 2CAUA 3DL3A 4BH9A 2ARAA 3RVHA 2FZ2A 3BB6A 4BLJA 1BVP1 1CX4A 1WCUA 3I2IA 2YYOA 3IDAA 5FZLA 1FMD2 2RDSA 4CDXA 1OQDA 3CMGA 5F6LB 5LY1A 1UMZA 1W0NA 2I2SA 1S4CA 4RGGA 1HLCA 5FP9A 4Q8KA 1SLCA 3IBMA 3PVBB 1DG6A 3D8CA 4JQTA 4DXRA 2R071 1WLCA 2GH8A 1HV0A 3OBZA 4L2NA 4WM8B 4AFAA 3B9CA 4HG6B 1J3QA 1Q8OA 2EXKA 4PDWA 2FCUA 1JBCA 2HWE2 2ZJCA 4ES9A 5BNNC 2VZRA 3PTYA 1FPN1 1ULGA 1VBB2 3DPRA 2DCYA 2WO3A 1AR63 3K75B 4KH9A 5DABA 3L2HA 4P00B 5A80A 2PHUA 3H0OA 4FPEA 1LGNA 4BMBA 5C3PA 3LQCA 4XUQA 2WZR3 2D7FA 5EZWA 1IKPA 3QACA 3OD0A 3ORJA 3DXTA 3USUA 1SLTA 3POIA 3W20A 4GWIA 3VKOA 2VZUA 3K2OA 2VNVA 1LOAA 2GMMA 1NUKA 1FT9A 4RQPC 1DP0A 3WNLA 1YFWA 3E6DA 1PVXA 1RL3A 2Z69A 3KM5A 1WBFA 2J1EA 3Q8FA 3ZFGA 1D2QA 3IMMA 4OI2A 4AVAA 4IE6A 3VDDA 5C8CC 4TTGA 1W8UA 1RUG2 2ZGOA 1PNGA 4AAPA 2RS31 2B9UA 1Q43A 2YY1A 5EFUA 2D6PA 4Y1VA 3N9LA 4GB33 1SFNA 4RFT0 4XXAA 1MACA 4CCLA 5JPNB 3KF3A 2IZWA 1RHI3 4LT5A 5LK7B 5BNNB 2RJLA 1JXNA 5JMCA 1ULDA 3C7OA 4FPHA 5DN2A 2WN2A 2FDKA 1O5UA 1D4M3 4W6XA 2E63A 2CGPA 2WA3A 2Y26A 2BJSA 3VD9A 2I74A 1W2AX 4YW7A 1D0GA 2BOJA 2Q5TA 1V9U3 1MEC2 1O3SA 4CUBA 3NJVA 3R4UA 4META 4TLFA 3RPQA 2XB6C 3BTXA 2BBVA 2WC2A 3T2OA 2W94A 4Q4Y2 1RUC3 1L7LA 3CEWA 1RYYA 1R1ZA 3NNLA 3BTYA 2JDZA 4QB2A 1QJU2 3OSDA 3SEEA 3O14A 1OLQA 1AR61 1REEA 5DQ0A 5AFBA 1GMMA 1YNAA 2E31A 5FZFA 4AEDC 5IFTA 1DLCA 3NV2A 1ZBA3 5CFDC 2WZR1 4IV1A 2ZMLA 4L11A 3LIGA 1CAUA 1F2NA 4NE9A 3VUOA 4QDQA 4E2SA 5F5IA 1UZZA 5IVJA 2OKXA 1DCSA 5ABJC 2JDHA 1DQ0A 2ETEA 5FWEA 1OLME 3H50A 4B1MA 4XTMA 5FJHA 2P17A 3N9PA 1TVGA 2FDHA 1Z0HA 3A21A 3PUHA 2Y64A 1EUUA 1ZRCA 5FAXA 4LUKA 3SH5A 2WDBA 2ZXQA 3SHRA 5A3NA 4XF9A 2ARCA 2E51A 2JE9A 3A22A 3MI8A 4GB31 4AFDA 1UAIA 1R092 1HB1A 5AVPA 1SQ4A 5EHDA 3SLIA 1RHI1 4C91A 5LWBA 2JDNA 4AVTA 2WR9A 2C6SA 1YUDA 4GQ7A 4COWA 5JXJA 4KWLA 1SBFA 1CJPA 2B7YA 4C0HA 4TZDA 3FHAA 3KHCA 2ZHMA 1D4M1 1YEWA 2CWMA 3B93A 4BDVB 3KS7A 4E4SA 1BBT3 2VU9A 1JN2P 2YGMA 1UY1A 3POYA 4AEDB 3I8TA 3K51A 1V9U1 4S2HA 4Z1VA 5CFDB 2ZZQA 5L19A 2AREA 1LGBA 2X09A 3M3OA 2AGSA 3TEZA 2WQZC 4I0WB 2VGDA 2J1SA 1G86A 3ZFEC 4HFSA 4YVSC 1MZEA 1UYXA 3QLQA 4QD2A 5JOYA 1KEXA 4JKMA 4R52A 3UL2A 5JSRA 4PLMA 1QOTA 4LJHA 4RHV3 4GULA 4CP1A 1N1TA 4CDQB 4A6OA 4QU2A 5CZKA 1GQPA 4IE0A 1MR5A 1ZBA1 1ENRA 1UX7A 1QKQA 4FOQA 3WQ7A 4IDZA 4ZZ5A 1NYWA 1X8MA 3GJAA 5IUQA 4TXWA 4NVPA 2J1RA 1ZRDA 4PJYA 3THPA 3O1TA 3F2ZA 1AVBA 5FY8A 5GLWA 2A3WA 3ENRA 1W06A 5FYMA 3IAQA 1NCQC 3P5BA 4CEWC 4LQRA 5GLTA 2BGOA 2BRTA 2Z42A 1J1LA 4JCKA 1TE1B 4IEWA 3C7FA 2FQPA 2ZA9A 3NJZA 1SLAA 2YFZA 4FI9A 1PX3A 4XHBA 1GNYA 4A44A 5D2AA 1H1IA 2VY0A 1VMJA 4OVEA 5GZGA 5FZ3A 3PUAA 2UU8A 3KT4A 3EHKA 4B1LA 3TN92 5JZGA 1EUTA 1S1AA 4QT6A 1JOJA 1H30A 4TWTA 4LOSA 4IW3A 3NKTA 2XBO3 5IK8A 1VBD2 1QXRA 2JB4A 3O12A 4LKDA 4DUVA 1BBT1 1LKNA 3FUOA 2A6ZA 3WNMA 3OB8A 3SCHA 2BEOA 3CJIC 1OI6A 2P4EA 4ATFA 4M00A 4PQQA 5G05L 5HXMA 2VBDA 1XYNA 1PX4A 2D3SA 2W95A 3ECQA 3KCXA 1A78A 3WQBA 5FZ4A 4J1WA 2BWCA 3J26N 1CESA 3UGGA 1FATA 4A41A 4XOGA 1HQWA 3CIHA 2UY8A 5FJKA 3RMXA 1NCQB 4MGKE 4IEPA 4KGGA 4COVA 3BU7A 2Y6GA 4RHV1 1AR83 1ZRIA 3JUUA 1C57A 4MG2A 2DUOA 2P2KA 1H2KA 1AR73 1SFPA 3AKPA 1YIPA 5LATA 4A45A 1JYIA 1ZREA 3KGZA 2VM9A 3SXWA 4D6RA 4E4HA 3IPVA 1OH4A 3IB3A 2Y33A 1UZWA 3I3MA 3N4MA 1RUNA 1GQGA 2XJRA 4LKFA 4LO6B 1VIWB 4WV8A 2PQSA 5C8CA 3RWNA 3P3PA 3MFAA 4QHBA 4EWAA 5FZEA 4CDWA 2YU1A 4HN0A 5B2GB 3IIIA 4FP2A 1G7YA 2C1FA 3FFQA 4FOVA 4IEYA 2D3RA 4Y20A 5C9AB 1RUD3 2I07B 2MPFA 5C5TA 1TMF2 2EAKA 2RDRA 1S0EA 2XQRA 1EPWA 4EWEA 4K7JA 4ZXEA 3HIFA 2XBO1 3KF5A 1W0OA 3O1VA 1YCIA 3NNJA 5LBFA 1QOOA 1IS5A 2E7QA 1RUI3 2HJIA 2Y6FA 1H6XA 1DGRN 3ITQA 3KQRA 1OD5A 4OHZA 4QMAA 2RHPA 5E6HA 1WZXA 4YSFA 2H6CA 5FMDA 4LIVA 1VBA2 2J7MA 3QH6A 5C33A 3PIJA 4HLTA 4S2GA 1CZTA 5G04L 4PI0A 3SC7X 4IGOA 3IDEA 3I59A 4XFBA 2A3XA 3JD73 4OUMA 4JKLA 1ZRRA 1CGPA 5DPNA 1ND2C 4GWMA 1AR81 4MV2A 2W68A 2W1UA 2EAAA 1CONA 1W05A 1W6OB 2VMEA 2UWBA 5F3IA 1UYZA 1H6YA 5JIAA 3RFRA 3SCGA 3VV1A 2FDIA 3PIGA 1AR71 2PFWA 4NHYA 2ILMA 2JDAA 3WDXA 2N7GA 2EXIA 1J58A 3O5SA 2E32A 2GNTA 5I8YA 3UGHA 1UU6A 1V00A 1ZZ9A 1IS4A 2XQXA 5IW0A 1VRBA 2D5HA 3G7DA 4CCEA 3N7JA 4M3CE 2RJKA 4EE2A 4W4ZA 4N53C 1S0DA 4E2QA 2VCCA 2ZEYA 5H9SA 4ZS2A 4UT5A 1X7NA 4Y5Z0 5EJ1B 5BNQA 2VG9A 4Q4W1 2MEV3 3PVNA 2BFUL 4CVUA 4IV3A 4XACA 2NZ9A 3TWIA 4I09A 2ARBA 3JXSA 3MW3A 2VQUA 1RUD1 1LOGA 2VECA 3C3VA 4YVWB 4QPWA 1PIV1 1WLDA 4F3JA 1S0CA 1VRH2 1COV3 2QQUA 4YGBA 4UAPA 1WMEA 4COUA 1S55A 1AYN2 1HN1A 5FMOS 5JCTA 1F35A 3LIHA 3OGSA 1ND2B 1HB2A 3SMHA 1RUI1 1OMIA 3S7IA 3H1YA 3KVAA 5DUVA 2KR2A 4ONUA 5C5UA 2DBIA 5FO9B 2J1TA 1I3HA 1RC6A 2EIGA 2IXHA 2JB8A 4CU7A 2VQAA 1OOPB 3AMNA 1QHDA 1W6MB 3J7MA 4JVAA 1UZ0A 2O1QA 4YFZA 1DZRA 1FV2A 4PLNA 5FUIA 1V0AA 3MZHA 3JD71 4DO0A 1D2SA 3C7EA 4OHYA 2QZ2A 2OT7A 4INDA 4N53B 2A71A 2B9VA 2HWC3 3A0NA 5T5PA 3AMPA 1Q3EA 1BK0A 4XAAA 4ORFA 1OLRA 1HW5A 3VBOB 3WSOA 4AVVA 5EIYB 2QDRA 2NYYA 4QX8A 1B35C 1BEV2 4S2DA 5BNOA 4CDUA 3NNMA 4AHXA 1RMU2 5FP3A 1YRZA 3I97A 1C4RA 1XBFA 4CU8A 2B46X 1ACCA 1KDMA 2FBEA 4CDXC 3ATGA 4QQLA 1HRI3 2DYCA 2OQ6A 1C5IA 2O0OA 2Y0IA 3MUY1 4GH4B 2QQWA 4A42A 3UNPA 1KDKA 1W2OA 3VDCA 2VW2A 5FY9A 1MS5A 4YM0A 4F7ZA 1FOD2 4HKOA 1W04A 2MEV1 3AP4A 1W0PA 4PDWC 4C1XA 1NXD1 4RS5B 1RXFA 3O1RA 5FYVA 1H2NA 3DPRC 4UBHA 4GWNA 1LTEA 4L99A 1O4YA 1YQ5A 4NRMA 1W6PA 2L9LA 1COV1 1YYNA 4WVWA 1W9SA 2XL7A 4D7SA 3P6BA 1DYKA 3AVRA 5CG9A 4BQ2A 4CEYB 5JI9A 2W1SA 4QM9A 1BHGA 4Q4X3 4PI2A 4R9DA 3MV01 1JYCA 2XUMA 3POJA 3ZN6B 4C90A 3M3IA 3N7MA 4Q4V2 5CBLA 1O4TA 2K0GA 5H9QA 1JZ3A 2XHNA 2HWF2 3NNFA 2BWAA 3ZFGC 2QDNA 3O1SA 2A73B 4OHVA 2UYBA 1TNFA 5HCBA 4LOTA 4Q29A 4HVQA 1RJ7A 5FZCA 2HWC1 3OPWA 4H55A 3B02A 4WVZA 4HOOA 3WX5A 1U5XA 1WKYA 1XXNA 2GDFA 1QH7A 1PK6B 2QVSB 4M0NA 2MHFA 4R4ZA 4XPVA 2YPDA 2VTFA 3DPRB 3OBTA 3NRUA 3UJQA 4AVBA 3LA2A 4DY5A 3O7OA 4BA6A 4Q0VA 3V65A 2E53A 2BU9A 1OFSA 4WM7A 5KWRA 3G6JB 1HRI1 4QX0A 3RJ2X 3WNOA 3O1UA 4NAOA 5F3CA 4LBQB 2Q8DA 4BLIA 1OKQA 3MICA 2W46A 2VOTA 2ZX0A 3ZSMA 4JDNA 3VZLA 3VZKA 2ZGLA 4CP2A 2JECA 3Q9OA 5I8SA 4W6WA 1SMVA 1I9RA 4HETA 4ZONA 3POGA 4PBOA 5F2SA 4CCJA 4UBGA 1POV0 1J83A 2HKXA 5EP9A 2R072 5IVFA 2QQVA 2A70A 4KNCA 5FZ1A 5L9RA 1KJRA 1VBE3 4U36A 1IZ3A 2D93A 2W47A 3MPBA 2KXLA 4IERA 4YGCA 2WL1A 3ZFGB 1FPN2 4YG6A 1BQPA 4UFHA 4IV1C 4QU1A 5FOBB 3JU9A 4XJAA 3PU3A 2NLRA 5JOZA 5J1XA 3JCIA 3O0WA 1O3QA 4H14A 1R64A 3H1WA 4AG4A 5JR2A 4Q4X1 1FXZA 4JQRA 3RGBA 1H8TB 1C3HA 4JTOA 4Y22A 5FYSA 3RG0A 4UW6A 4A7KA 1PGSA 3WCSA 3GHMA 3EB7A 1CIYA 3U4SA 2BVBA 2GC0A 1HN0A 3ASIA 5IT6A 3K77A 4YGEA 4ITCA 1T6BX 2ORZA 4D7TA 3RZMA 4CCCA 1X36A 1O7FA 2Y6LA 1O91A 4XVHA 5F5QA 1KS4A 4AHZA 1S2KA 2YHJA 1ZA4A 3DN7A 3HNBM 3MYXA 3MV11 4JDMA 5JXIA 5FY5A 5I91A 4F8AA 5A3PA 3WNPA 2D6KA 2ZGQA 4LKSA 3Q8CA 4N43B 2PYTA 5D8AB 4OYUA 4PQ9A 4JHZA 4NAMA 4NPMA 5GZEA 1CAUB 2VUCA 5LA0A 3UKNA 2LRPA 2VJXA 5FP7A 1LULA 3BGAA 4RGKA 3OEBA 5EPAA 4FPGA 3H7JA 5A1AA 2D5FA 2ZZJA 1SPPB 1WMFA 2W87A 2WWUA 2VPVA 3NW4A 3AX4A 3AP5A 3VBSA 1VBE1 5F7UA 4AW7A 1XQNA 1W9FA 4I30A 4XZUG 1APNA 4Y33A 4ASKA 1AR62 5I93A 5J36A 3N9QA 1CAXB 1HX6A 4FTEA 4PIYA 2PAKA 2WZR2 3WF4A 2CSGA 1ULCA 1F8VA 4DUWA 1GICA 2ZGTA 3HT1A 1PHMA 3NNGA 4MZUA 2JDMA 1O59A 2YZ4A 4DB5A 1I6XA 2AUYA 1U5YA 2WNVB 3J7HA 4LK7A 4E2GA 2JICA 2QFEA 3VD4A 2WKKA 5A33A 2DU1A 4IL7A 3BOPA 5T55A 1YFXA 1JYXA 2UWCA 4A3ZA 1IPKA 2V72A 4HK9A 4NHMA 5FYIA 1PGL2 1JU3A 3O1OA 4XQDA 2P5BA 3GZAA 3SQOA 2GC1A 3VBFA 4NPRA 4EZ4A 5ACA3 4IEQA 2VUDA 4JKKA 1GZWA 1HXS3 1L7QA 4NJ4A 4WBBA 1UPSA 4FFHA 3TNQA 2ZABA 1AUYA 1XE8A 1ENSA 4UFMA 3CZUA 4LORA 4KGQA 5JZGC 5E16A 1MS1A 1RHI2 3PLQA 4AFMA 1LHUA 1PGW1 3MDPA 3WDTA 1IQAA 3WDVA 2DCTA 2JWPA 3S6PA 4NHLA 3ZYGA 3ZXEA 2WAOA 1D4M2 1CAVA 5T5LA 2XJVA 3U37A 3ACFA 1OVPA 2PLV3 2XJUA 2QJVA 1JZ7A 1V9U2 2Y6HA 1SZBA 4ASLA 4XBQA 4XDPA 4MX3A 4N7UA 2ADDA 4PLOA 3WG2A 5C8WA 5FO7B 5DUUA 2HLEA 4GZ9A 3NV4A 4PT6A 3LFMA 4FBFA 1QH6A 2JG9A 2PMWB 1H9PA 3H3ZA 3HPNA 4V1PA 4AR2A 1E57A 2FCVA 2WO2A 1TNRA 2B5HA 3I2GA 4AI9A 2X29A 2TUNA 2Y60A 3ZYRA 2WNUA 3FJSA 1ZBA2 1QF3A 3HWJA 1YI7A 2QBXA 1Q56A 2NM1A 3VD5A 4CE8A 4XF3A 1IG0A 4IGQA 4LULA 5FYYA 4AEKA 2Q0AA 3WDYA 3ZKYA 4YG3A 2XLAA 1C1FA 5GZCA 3IMNA 3N9MA 1N47A 1PNFA 4Q0UA 4FPJA 1FAYA 1QJY3 1ZVFA 3K4DA 2CGOA 4KI5M 5ACA1 5FZ6A 2G19A 1HXS1 1TZOA 2VZVA 5T5JA 3TAYA 5FMBA 5FLJA 4AHYA 1VP6A 5M0TA 1KRIA 1GOFA 4H2AA 1E5RA 2YGLA 5EYYA 1V6MA 5IFPA 4U2AA 1UZVA 1XYPA 1GYKA 2JXAA 3DCQA 4XE9A 4XUNA 5KXEA 4AOCA 1LOFA 1TME3 1C1LA 4P9JA 4QPIA 3WUDA 2GMPA 2PLV1 4I02A 3KV6A 3ZSKA 2DTWA 5JXHA 5A7OA 2ZGKA 1W6NA 2HEWF 1JZ8A 3M7AA 4KG8A 4MHRA 2HBTA 5F39A 2F4LA 3ZM8A 2ADEA 1BLZA 3SKVA 4QQHA 1JHJA 1JZ2A 4P9YA 3LAGA 1LOCA 3OBRA 4RA0A 4BQ5A 3E1F1 1V70A 4RHV2 5ERLA 4P5YA 2W1QA 5A6QA 2W52A 4QXKA 4QHOA 1F31A 4DUXA 4D7YA 1XE7A 1G9FA 4LR4A 1LRHA 4KWKA 2JD9A 1AZDA 2ZX4A 2CGNA 1F9KA 3C8XA 2IWGB 4GXLA 5KBFA 5FYBA 2YMZA 3I3DA 4TYSA 5JWPA 2BP6A 3QH7A 5GJ6A 3VD7A 2YC0A 1HB4A 1ZBE3 2DBNA 3GJBA 2J22A 3GYDA 5CAZA 5JSOA 4OLLA 4Y1UA 5K8SA 2D43A 1J84A 3WP6A 3WY6A 4D6SA 2OPWA 1LCLA 3B01A 1K5JA 3D0SA 1UY0A 1QJY1 3ZXKA 2WFF2 1S0BA 4IV3C 5FYHA 4LBOA 4DNYA 1STMA 2DU0A 1QEXA 3WCRA 5LW9A 2XWJB 3ILFA 1YWKA 2GNMA 3GZTB 5FLHA 4D6QA 3CDZB 5C6CA 1S0JA 5I0DA 5JPMB 4OZOA 4Y5SA 2EXJA 3U75A 2WZPP 2X05A 1L7RA 5C3SA 4OZXA 4QWNA 1O8SA 3VHRA 1TME1 3AJZA 2XBO2 1DBNA 2HYXA 3WP5A 2JG8A 1DQ4A 2WQ4A 3FC0A 3PL0A 4QPGA 3FFZA 5A7WB 2R1DA 2R063 2CY6A 4BOWA 1CZSA 5A1LA 2ZGUA 3O1MA 3J8F1 1F5JA 1G9AA 3ZKUA 2A3YA 2XKOA 3BTAA 3WF2A 1G8WA 2F17A 3CBNA 3GDBA 2Q30A 4FXKB 5CADA 4AYUA 3ZLIA 3WR0A 1NCRA 3GALA 3AZWA 2BYVE 2YPJA 1JOBA 4QDRA 5GLUA 1AR82 4FVVA 1ULEA 3ZPOA 4UXAA 5E8AA 5BNOC 2Z79A 4CDUC 5L7OA 1XB9A 4LIUA 1WCKA 3V0BB 1AR72 1RUH3 3KB5A 3ZX7A 1DGWA 1IGOA 2ZGRA 1ZM1A 1M4WA 1U5ZA 1ZBE1 3HN1A 4N8MA 5FYUA 3LE0A 1XNDA 3X29B 2QQPA 3H1MA 1UXXX 3PJQA 4ARXA 1IG3A 4RQPB 3FLPA 4L9BA 1W6QB 2PAMA 2W08A 1YI9A 4Q4W2 5C8CB 2WZ8A 4MH0E 2P37A 5H9RA 1ZZCA 3MF9A 4YW4A 1RUD2 4EYUA 2UYAA 3R6SA 5A3OA 1PIV2 1AX1A 2GH2A 2ZHKA 3CHXA 3PUSA 3PUQA 4CU6A 3BUCA 4TLGA 1UX6A 4XF0A 3N7KA 4XC9A 5IVVA 1CPNA 1UWWA 3KGLA 1Y4WA 3NV3A 2GAUA 4EZHA 1HKDA 3FHIB 1RUI2 2BOIA 3V0AA 3LA3A 1UKRA 1PGL1 4CDUB 2R061 1ZZBA 1DZTA 1YJKA 2Y6KA 2VO5A 3OOXA 4XBLA 2Q8CA 3I49A 4MGSA 4BXFA 5FXWA 4MOAA 4NIHA 2WRAA 2HWB3 3HOBA 4XW3A 1JZ6A 3J4UH 3VGIA 2WO7A 4RFRB 2R6QA 3Q8AA 2CWSA 5JXGA 3JD72 3A0KA 1CAWA 5FPBA 5CKNA 2QE3A 4BQ3A 3MGUA 1S0IA 2G1MA 3OTFA 3T2TA 2GC2A 3VB9A 1QJFA 1XE0A 3LGRA 4XTPA 1IKQA 1U5IA 2VUJA 3S5QA 4DMIA 2VMCA 5FZDA 1RUH1 1WCSA 3NO8A 5A6XA 1AXYA 2YBSA 4EQVA 2JENA 2AYHA 3R0RA 1W6PB 3Q8BA 4P9WA 5BV6A 1QJX3 2R0FA 5FUNA 5ABJB 1KJLA 2X10A 4FOYA 4LNVA 2JJ6A 1JYNA 1WWYA 5DXDA 4XFHA 3ZR5A 4HBNA 5FYTA 5DZEA 4FPFA 3T2PA 3UESA 3ZN4A 1OLMA 2MEV2 2ZEXA 2ZAAA 4WZCA 4BQ4A 4OMDA 5K0UA 4Z2WA 2BNNA 5KHKA 4UI9L 1GU3A 3H8UA 1COV2 5BUVA 2RVAA 4O7XA 4XUTA 3VBHA 1XNAA 1SEFA 3FLRA 5C3RA 4Y26A 1DIWA 2JIJA 4YW1A 3RYPA 2GSYA 2RMU3 4YZ1A 1LNSA 2V73A 1MS3A 2VMIA 1K42A 2NP0A 2B45X 3UGFA 2RR13 5GM0A 2QQNA 2D6OX 2ET1A 2WFF3 3HJRA 3LCPA 2XXZA 5FYZA 2HWB1 4XDOA 5F5CA 4AI3A 4AZZA 3D5OA 4CP0A 1REFA 1WLTA 3GZUC 4K8FA 1G9CA 3EMRA 5BNPA 3HNMA 3U14A 5J98B 3ZFEB 2Y8KA 3POSA 4YVSB 5HCHA 4Y4RA 5A7NA 5DAXA 5I8TA 2HWC2 4MXVA 3ZSLA 5FY1A 1OT5A 2WLQA 5A3WA 2W2IA 5F8PA 2WT0A 2D44A 5EWSA 4MUVA 2UWAA 4OHWA 5AC91 5CKMA 2EVXA 2GZWA 4CCDA 2XKPA 2ZTNA 4HK8A 1PZ7A 3QD6A 4P08A 3THCA 2BUKA 3HBKA 1KQRA 1LB2A 1QJX1 2EA7A 1NA1A 2CDPA 3VZNA 4E27A 1RUJ1 5DZGA 1HRI2 3B94A 1QNWA 4QX5A 4R4XA 3AMQA 4AQ6A 4YARA 2BDRA 4FOWA 2AEYA 4HSJA 5JVVA 3HNYM 4UF0B 4CEWB 2A6YA 1LOEA 1DZQA 4HPKB 4JX0A 4JGZA 2FMDA 5FXVA 4AHWA 1DF0A 1BXHA 4UYBA 1GNZA 1QJEA 3BALA 3UJOA 4CUCA 5A32A 1UY2A 4E9KA 4WVMB 2IC1A 3AL6A 1ALYA 3E5UA 2VD7A 3BKZA 1XC6A 5FZOA 2YV8A 4V2WA 3E6CC 3VBRA 4CYDA 1W2NA 1H8VA 1DLLA 1JH5A 4XJWA 5A7QA 3TEXA 1W9TA 1Z7S3 1C8M1 5JOXA 1AR93 2CTVA 3J9SA 2IXKA 2RMU1 4YYOA 2VMFA 5L73A 5FBJA 2QKDA 1KFXL 2RR11 4Q4X2 4QAWA 2QQMA 2WFF1 3ZMOA 3OGRA 2BTVC 5L36A 1OA3A 2ZX2A 3CJIB 5FXXA 1H0BA 4Q4W3 4Y1YA 2C9KA 3KWVA 5I0TA 1IS3A 3S7EA 2JDYA 3NMBA 4AQTA 2HYKA 4IEZA 1NQJA 1W8TA 1PIV3 3ZSJA 2XR4A 1WGPA 4SBVA 3BTZA 4XFGA 1O8PA 3T3YA 5HCAA 2GP3A 2FDGA 4LO5B 4XF1A 4BJ0A 5IVBA 2P3KA 3VKLA 1OH3A 4QKFA 1UXZA 1V6KA 3VHOA 3LB9A 4Q2FA 1DDLA 3EXUA 3SCFA 2DCKA 3HD8B 4K8RB 1UY4A 4XIOA 5CYYA 1R1A3 2DTYA 5DAPA 2LS6A 4WVVA 1UNBA 4XFCA 2D98A 1U12A 3AB0A 1MS9A 3VHNA 2WT1A 1ENXA 2WWSA 1DYPA 2A5ZA 4ASMB 4GMP0 2JG9C 4CP9B 2GNDA 2ES3A 3AYDA 2ZKNA 4RGAA 1MZFA 1VBE2 4WM8A 5FR3A 4YZ3A 4P02B 1QOSA 5KXCA 3K3NA 1UD1A 2VE1A 1VMHA 3NJYA 3L2YA 1UN1A 4L8QA 1BKZA 3OY8B 2DFCA 3N9OA 1ZZ6A 4QX3A 1H1AA 1Z7S1 1AR91 2XLFA 3S30A 3A4UA 3DYMA 1D4VB 2VCBA 1LJ7A 2BBAA 2C24A 2H0BA 2EXHA 3LWCA 5FZKA 3JBG1 5JLVA 1RXGA 1DYOA 3GHNA 4KMQA 2VZTA 3WNNA 5DAWA 3IIAA 3ACIA 3WQ0A 5FP8A 3QOPA 1HV1A 4UOJA 3RI9A 1CAVB 1UW8A 2RE9A 2IXIA 1W8OA 3HT2A 4TN7A 4O65A 3LPGA 4IEUA 1X9PA 4OI1A 5EJ3A 1I5PA 1W39A 4CCKA 4CPBD 3GZEA 2XH6A 1WUVA 5FMCA 1LU1A 4GJZA 1W8FA 2FHRA 1LOFC 4EN9B 2VQTA 2KD7A 1PGW2 4QGLA 1IS6A 1WW4A 4ZY9A 5LK5A 4CCMA 1UMHA 2PA7A 4A4AA 2NN8A 5IWFA 5C7GA 3ROUA 3T1LA 4EJRA 5A3UA 2V5YA 1EAH3 1HRV3 4AE2A 2VW1A 4RL7A 4LBLA 5SV5A 5DUXA 5D1IA 1M06G 4CZSA 2QCSB 1R1A1 1JUIA 2Q1MA 4OI0A 1LHOA 4URAA 4YW5A 2WYFA 1MVQA 1OQ1A 3FBYA 4RD7A 5ISLA 2CU5A 3CF6E 1CX1A 5FRAA 2YDEA 3BIWE 2ID4A 4AI1A 4AGGA 1CQ9A 3IWZA 3CZJA 4M3CA 1NLQA 2YBKA 1GR3A 4Y1XA 3VZJA 3M1HA 5KC6A 4KU7A 4Z92B 5FIXA 3NJXA 1GANA 4GMP3 2DDUA 4MXWB 1FYUA 1BMV1 2DVGA 2EIEA 3VZMA 4O61A 2OW4A 3ILNA 5DUWA 2J1AA 2TEPA 4DINB 5HV0A 3AKRA 3ZXGA 4ISQA 1K45A 2C0ZA 2OIIA 3MLLA 1ODNA 4MGYE 5F6KA 2YXSA 3E6BA 3VL8A 3MBWA 4DFSA 3D4KA 1LECA 5LA1A 2GALA 3OF1A 2XJSA 4P9IA 2E7TA 2HEYF 1YQCA 5EYXA 3SNMA 3RS6A 2XDVA 4ZKTB 1W6NB 5ACA2 1RIRA 2V5DA 1HXS2 4N9IA 2A6VA 5LRRA 1S2EA 2DVDA 4FPCA 4XAEA 2VCMA 4CXWA 3RZHA 4O9EA 3RZLA 2A1XA 3MPPG 3P3NA 4XURA 2SBAA 5T50A 4OQ9A 2FCTA 2XL9A 3MIEA 5CIRA 4EN8B 2WJSA 5HXVA 3W58A 1GWMA 4DRVA 3PVEA 3W9AA 4ZZ8A 1B35B 3K3OA 1AYM3 5FY7A 5LB6A 5DDJ3 1EAH1 1HRV1 2RS11 4QPGC 3DXUA 1OQEA 1VB4A 1QXPA 3U07A 2PLV2 4I01A 4HL0A 1N3OA 1SDWA 3QCWA 1WCDJ 3LSEA 2E9QA 3KV5A 3USSA 2WYSA 3T1MA 3VDDC 4CDXB 5CFDA 5HPOA 4S2FA 4B4QA 3O0VA 4JZRA 4LO7A 1WBLA 4GALA 3VLBB 5BXXA 3N9NA 5SV8A 2F6BA 5FBZA 4GIQA 4BMEA 1NCRC 2AENA 2O8QA 1XJAA 2VMGA 3I2FA 3MLJA 5A3LA 3JB8A 4MGTA 4PDWB 2RDQA 2WS93 2VUAA 4CA9A 1ASJ3 2A6XA 1S0GA 4QB1A 1ULOA 2DWRA 3DUIA 4JRAA 4GMP1 4CDQA 5L7OC 5AFEA 4D0QA 4AVSA 1W3XA 3SH3A 3NAPA 5F32A 2R1BA 1Q8VA 2ZGMA 1NX9A 1UOGA 1GSLA 1LODA 3IAPA 2E6VA 2XVLA 4HKWA 3USUB 2YUEA 2UURA 3K46A 3P1IA 3GF6A 2EIDA 1WD3A 4YM1A 2YROA 5HV4A 5JR7B 3D82A 5CFCA 4IUGA 1VJ2A 2W91A 4YM2A 1Y7BA 4LLFA 1C8NA 4FPKA 2OQ7A 3OBAA 1QJY2 4XBNA 3WLUA 1MZ5A 5IYYA 5DAVA 1MVEA 5ANNA 3VDDB 5JOWA 3EQEA 5JSPA 4LKEA 4MADA 3LDRA 1EPZA 1O3RA 1AJOA 2XLGA 5FK7A 4LA2A 3MUZ1 3PURA 2FZ1A 3Q8EA 1FI2A 4RSUA 1XNTA 1X82A 5A6YA 5K9YA 2PHRA 3HN3A 3AL5A 4BQWA 1TME2 1UU5A 1AYM1 3OYWA 1LENA 5DDJ1 4GAZA 4XQWA 3RYRA 1W90A 4ZU7A 4IE4A 3HVDA 3VDAA 3NVCA 4B7KA 3PVOA 2VMHA 5FZIA 5L7OB 4FFFA 3TEWA 5FZHA 3EYPA 2BFUS 4CCNA 1LU2A 2VQ0A 1VBC3 3J8F2 1K5MA 4JV4A 2W92A 3U0ZA 1ULPA 3TEYA 3CL1A 1POQA 3GCWA 3KD4A 5DAQA 4FQZA 3ACLA 5IK5A 5B4NA 5FPAA 5KR7A 5T3NA 1NCQA 1JI6A 2PAEA 3RNSA 4AGVA 4BISA 2WS91 1ASJ1 3UKTA 4GWJA 3WP4A 1OPMA 5LASA 1RUF3 2PXJA 5HI0A 3U4XA 4UFKA 1ULFA 1V6LA 4A7ZA 4UFIA 1Q8QA 3I2OA 1RUE1 4IV1B 5LEKA 3OJBA 4HANA 3BVCA 2WAAA 3WZ1A 3ZYFA 3HQUA 3ZR6A 4YZ5A 4A7YA 1O4ZA 2Y34A 2D97A 4KU8A 4NPLA 1ZBE2 5KHGA 1XSRA 4LEJA 5LY2A 2DCZA 4NOTA 3AXEA 2DV9A 4H3WA 2O8OA 2OUJA 4LHKA 4Y1ZA 3GGLA 3AVSA 2JIGA 3WEZA 3WW3A 1JYTA 3LFIA 1CD3G 4AF9A 2P3IA 2LUWA 1OC1A 4XMAA 1NQDA 3UETA 2Z2SB 1UKGA 1W2UA 1SACA 2JDKA 3ALQA 5K0UC 3LDKA 3MFCA 5FCCA 3DF0A 4R9BA 3TOJA 3KQ4B 5FYCA 5C9AA 2AH2A 1A6CA 5FOJB 1N1VA 4FPLA 4HN1A 2JKXA 4XUPA 3C7HA 4OCTA 5F2WA 3VBHC 3RSJA 3ZMNA 4D3WA 3B00A 2DUQA 2Q8EA 3W5NA 3FUQA 1DGWX 1SLLA 5JMOA 2XGXA 3K4AA 3AYEA 4ZXKA 4B7EA 1Y9QA 1ENQA 5HBAA 4PHZA 5I0SA 3BCWA 4YGDA 4Z82A 4OQ8A 2R062 3UYJA 4QXCA 4XYXA 2PHWA 3FMGA 5GKAC 1VBC1 4XIKA 3T0AA 3GXUA 2J1UA 3RYKA 2RM23 5BNPC 3LEGA 2ENRA 4LBQD 3ACHA 3A7QA 1H4HA 4YLZA 4V2VA 2NQYA 4CTEA 3KSCA 3RQ0A 2XOMA 3TNPB 2XPJA 1RUF1 4ZHNA 4G3YC 3D3AA 1W6OA 4XFAA 1OFNA 2NMOA 4ATEA 5EV7A 1QY4A 1RUH2 2A6WA 1SCRA 5FLIA 5BYNA 2VR4A 4LLOA 1NA1C 4YZ2A 2KA3A 1C5HA 1WD4A 2RS53 1JU4A 1AL22 1SFYA 4JRLA 1NZCA 4BZ4A 1Y9MA 4BK4A 2ATFA 2VZOA 4QHZA 3VBUA 5JIUA 1QNYA 5LRSA 2W0XA 4JGZC 3M3EA 1UIKA 2EIBA 1RITA 1BCXA 1Q5OA 1W8WA 4HXCA 1AL0G 5FUPA 3WG4A 3WW4A 1LHNA 2YB7A 3APBA 3OUHA 2ZKLA 5DG2A 1MQTA 3WV6A 3ZDVA 4ZU5A 3POEA 3WG1A 4BIOA 2XVKA 2ZGSA 4CUAA 3VBRC 3GBWA 2CYFA 2P6CA 3WUCA 3FX3A 5BNPB 4YVWA 2BV4A 1AX0A 2WQ8A 5IK4A 5JZGB 4FO9A 5FFOC 4Z8BA 1OVSA 2VZSA 4IEXA 4AEJA 2XJPA 3WF0A 1HJGA 4AL9A 1MS4A 2WBKA 3HMYA 5FZ9A 3FLTA 1RTVA 4Z07A 4CDWC 1QQP2 5IATA 2FDJA 4P9GA 3AJYA 3ME2A 1KD7A 3W5MA 3WINE 2HWB2 1OOPA 1HQLA 2RM21 5CEHA 4Q8LA 4ISRA 1DU3D 1QDOA 3KVBA 4LTAA 2BW8A 3H8XA 4Q1PA 1OBNA 4FFIA 4NIDA 1W8HA 2VBPA 1R081 4IQPA 1I5ZA 4JGZB 2VVFA 5FKCA 4N53A 5FO8B 2GU9A 3IKWA 1DGRA 2BNMA 1OKOA 1LR5A 3N3HA 5A32B 1LHVA 2DUPA 4AQ2A 5CVRA 5T5OA 4AGRA 1OF4A 3VBOA 4QXBA 1QGLA 4LBMA 4AEMA 1YFUA 1TQ5A 4BPZA 5AC92 4FFGA 4Q27A 1QU0A 1ZRFA 3ZXJA 3J8F3 1WW7A 3IDBB 3IPVB 2RS51 3NKGA 1QJX2 4YPJA 1YFYA 3T4HB 1RUJ2 2W3JA 4DXSA 4X6QB 3LZZA 5HCFA 2ZEWA 1HJFA 4GH4A 4IE7A 1NE6A 4XF4A 3OGGA 2GP5A 2VL4A 3ZDSA 4I3GA 4AVCA 2GNBA 1YQ8A 4CDWB 4WM8C 4XJ9A 4GKYA 3ES4A 2H0VA 1KFUL 4DRRA 4RS5A 1GUIA 2BNOA 2X5IA 2Z5WA 4Y20B 4CXXA 1UMIA 2LALA 5JDBA 4FP3A 4DEQA 3WXPA 4MGZE 4NRPA 1UOFA 2RG4A 4LBNA 4IGPA 4RR3A 3BODA 2DF7A 4ZPIA 3PUIA 2K9ZA 1C8M2 4BXSV 1H2MA 1KS5A 1EYBA 1GOGA 2I45A 2RMU2 3IZOA 2FMYA 4LE3A 4QXHA 2MNGA 3VKNA 2V4VA 2D6MA 2Z4FA 1GBGA 4NIAA 2RR12 4R8HA 4CEYA 3LSDA 3ZN6A 4KBBA 3LPFA 2JE8A 4FSJA 2ZHNA 4AFCA 5FQ0A 2ZX3A 2DURA 1KXGA 1PO13 2O14A 5T52A 5A7SA 4DXTA 1JUHA 3TYJA 3I59B 3MIDA 2P3JA 1ST8A 1X33A 3HQRA 3I7DA 2VZPA 3N35A 3WG3A 1PVC3 1JOPA 2OZ6A 3T4VA 1H9WA 1VAKA 3ZOIA 1O5LA 1XYOA 1CPMA 1JYVA 3J7NA 1B09A 4CCOA 1PK6A 2OXBA 4KWJA 1X50A 4ES8A 4MSVA 4JHTA 1X8EA 3ZN5A 1AXZA 3GCXA 3I2DA 2VW0A 3KZ4C 2D6NA 4MVTA 1H2LA 3KV4A 2CV6A 5LBBA 4LBQA 2C26A 2W5FA 2FDFA 3THDA 1GV9A 4G4FA 3H7YA 1XU1A 2XONA 1RVF2 2WSUA 4IV3B 4K1ZA 4P5HA 4YRDA 2IUWA 2R041 4J1XA 4DXZA 1XSQA 1DHKB 3BI3A 2WWJA 1RGSA 1WCQA 2ZMKA 4C0BA 5DMYA 1C28A 5A6ZA 4XFIA 4L97A 2ERFA 3RJRA 1WLWA 1GKBA 3AKQA 4HKLA 3MHZA 2IVJA 4ARYA 1Z7S2 3B7MA 1AL23 3S57A 1AR92 2ZS6B 2BGCA 2JD4A 4LHLA 4I3PA 1AJKA 3DYPA 4IESA 1EV13 1PO23 3JBG2 4BIFA 3LDBA 2AR6A 5FZ8A 1NLRA 3KCYA 1QJZA 1J59A 1H8TA 3O1PA 3AP7A 3QBQA 3J7LA 3ZYHA 3MIFA 3OEAA 1PO11 5FDBA 3ES1A 4D8MA 3U11A 4UW4A 1I1EA 1OPOA 4QQOA 1W03A 4QKDA 5ANQA 4ZU4A 3WT3A 3KMHA 3M3QA 4GKXA 3T30A 3ZIWA 1PVC1 5TSWA 2IFRA 2WO1A 2W9XA 1DQ1A 3AYAA 1MS0A 1DFQA 2VC9A 3VZOA 1XRUA 3KT1A 3GM8A 2WA4A 2BVVA 2WSVA 4M3CB 5DG1A 4C1WA 4CUGA 3AMMA 2VZ3A 1H1MA 1Y3TA 3H42B 4W65A 5BNOB 1QQP3 5FPUA 2PQQA 1OHFA 3MF6A 1U0AA 2NPIA 4PF5A 4P9LA 5F5AA 3JB4C 1UOBA 3MIBA 4N43A 5D8AA 5FK8A 1Z78A 2ZBJA 3BPSA 1N3QA 1ONAA 2QZ3A 4LBJA 1R1A2 4M3CF 1DQ5A 4QX7A 3VD3A 1CVNA 4AQSA 1LEDA 5LA2A 1A3KA 5I0RA 4BCUA 4G9SB 1PM7A 4URTA 3ZSEA 2G4IA 2V4AA 1J1TA 4BE3A 4OUEA 1V6NA 4QGNA 4QB6A 4BQYA 3OPZA 4PCRA 2VOKA 4R9CA 5FXZA 1SBEA 2Q4SA 1ND3A 1SPPA 2VOVA 5FPLA 3SKJE 4B4PA 2LROA 2ZACA 5J48A 4YW2A 2TNFA 2WFPA 3ZVXA 3AKSA 1W28A 5AC93 2CHHA 3URFA 1UZYA 4NR1A 4CDQC 4K40A 3GNEA 2GC3A 2VCAA 4W6YA 5FY0A 4LO8A 2K46A 4WM7C 5A70A 1CAXA 1PMIA 1AL21 3LKJA 3ZXDA 5FZ7A 1RUJ3 3NAPC 4Q5OA 3DKWA 1BMV2 3VBFC 3I2HA 4O9GA 5A3TA 1F4HA 1NAEA 1NOVA 3AZXA 2YU2A 3BOWA 3H3UA 1EV11 1PO21 3IDCB 4Q0QA 2WNVA 4XDQA 5CFCC 4I0AA 1NKGA 3EO6A 5CB7A 1CR7A 4QDSA 2GMEA 4XJZA 4DZGA 3I2JA 3FHQA 3WDUA 2XJTA 5DZFA 1CJDA 4XQ4A 2HWD3 3H8OA 1AF9A 1C8M3 1QIQA 2OA2A 1FX5A 1GLHA 3CNAA 5CNAA 4CXYA 1RUC1 1XPWA 1VPHA 3AK0A 1QQP1 4YM3A 3V56A 3RDIA 1DQ6A 1OA4A 1EAH2 1HRV2 2RS12 3E5XA 4UWDA 4KWUA 4TSVA 4WM7B 2PHLA 4NHXA 3WDWA 2HBUA 1PMHX 3WHTA 3FE5A 1FMD3 3OUIA 1K5MC 2RV9A 3NAPB 5FMOL 5I0UA 1K12A 3T2QA 1UO9A 2QQOA 3VBFB 1G9BA 1BJQA 2OVUA 2ZGPA 2ZEZA 5A3MA 4BK5A 4E8CA 1WW6A 5CFCB 1V6IA 1XNBA 4JGYA 4JDOA 2CAVA 5FKBA 1N3PA 2HWE3 3SITA 2IFWA 2P34A 3NSTA 3AMHA 5FZBA 5LBCA 3WW1A 1VBB3 3HQXA 2W39A 1DQ2A 3FWEA 1ZZ8A 4A2UA 3LEMA 3ZFFA 1VLNA 4NN0A 4M4PA 1W99A 4D69A 1TEIA 2PHXA 3OG2A 3OYWB 1RVF3 4IE5A 4QQ2A 4Y22B 1FNYA 2QUOA 3VBSC 2QNKA 4EV0A 5GALA 1VAMA 2ET7A 3DKQA 3VKFC 4AFBA 1NY71 3BYWA 2CDOA 3POWA 3AKTA 1K5MB 4PBPA 4Q0SA 4N9HA 2HWD1 1RUG3 4QQPA 5EJZB 1KITA 2QTWB 5C71A 5C9AC 1O3TA 3N36A 5JI7A 3KV9A 1YO8A 1AX2A 4GA9A 3ZPYA 3KT7A 1JS9A 3T0BA 1OURA 1GZ9A 2B4KA 1BYHA 3JBG3 5C3OA 1OA2A 2W1WA 4DQAA 1AYM2 2Y6JA 5DDJ2 3ZIXA 4MO3M 2PTMA 1MZ6A 3CLPA 5GLZA 4IXLA 4PF1A 4LHSA 4K6BA 3VL9A 3WVJA 1FMD1 5JUVA 4IEVA 5IAXA 4QX1A 5C4WA 2Q8OA 1MEC3 4B3NA 2TBVA 1QXJA 2C9AA 2VTXA 3LA7A 4HT1T 4MGIE 3RI8A 4XHXA 3H8RA 4UFLA 2WABA 4Q4Y3 4FXGB 2B42B 2WNOA 3VBSB 5J09A 2WS92 2HWE1 5EXOA 1ASJ2 3LF7A 4EWDA 2BZDA 1AHSA 1QJU3 2XVGA 4BWOA 4UW3A 1VBB1 3OPTA 2IXCA 2D6LX 3WW2A 1NG0A 3DYOA 1UPIA 2R16A 4DIQA 1RUE2 5IVCA 2JKBA 4DY3A 4JC1A 5H9PA 3I4IA 2BQPA 5F9TA 2WINB 5IAVA 4CU9A 2WZEA 4A3XA 3VBUC 1CIWA 1RVF1 4HVOA 4RN5A 5A33B 3ELNA 1W9YA 1WMDA 3E97A 5FTTC 2DVAA 3DV8A 5FPVA 4MLOA 4MHUA 4Q1RA 1MQTC 4SLIA 3AFKA 3I3QA 2WNUC 1RUG1 1GZWB 4B8EA 3CQOA 1L3JA 1NT0A 4YVWC 5JAXA 2ZAHA 4AAXA 1R093 1IPJA 1YQ6A 5FY4A 3O0XA 4QX2A 3WNKA 2VULA 1UU4A 1LHWA 2RJ2A 2VNOA 3D6EA 1W8ZA 3IM0A 4XXPA 2K2SA 2OS2A 4NWVA 3E5QA 5IVYA 1SBDA 2A75A 2VOWA 5F3GA 4E8DA 1F4AA 5A7WA 5KHIA 1MEC1 1G6NA 1OOPC 1VBC2 3MIGA 4NWWA 3THTA 3PMSA 3I3BA 4LHNA 4XABA 4W8JA 5F1RA 3KCCA 3ON7A 4COYA 3EJKA 3VBUB 3JQWA 3NWKA 1GQHA 1GP5A 2JG9B 1W8NA 2VZ1A 1KGYA 4Q4Y1 4XJ8A 4XZPA 3B5LB 4AI0A 2FD8A 2VVEA 5L9BA 2BGPA 1QJU1 2GN3A 3ABZA 5BNNA 1RUF2 4QPIC 3OCPA 1MQTB 1LESA 2RS13 3VBOC 1CWPA 2IXLA 2WNUB 4XEZA 3V0BA 2CL2A 3WF1A 2P1BA 4FT8A 4NIIA 5LZ6A 4FAGA 1URXA 1VAVA 1ODMA 4Q26A 4YWAA 3IT8A 3RRDA 2QQKA 1HB3A 3AC0A 4GH4C 2WUHA 5FZGA 3HEIA 3UV9A 4LE4A 4YFWA 1Y43B 3RWKX 1AXKA 1GP6A 4RQPA 1ZYBA 3U78A 1W6QA 2VNRA 4F83A 3ST7A 4LO4B 3M70A 1XU2A 4H7MA 1K3IA 4RS5C 3SH4A 2X5IC 4DEVA 4Y4YA 2XJQA 5E1RA
chains in the Genus database with same CATH topology
4K3UA 4KL1A 2DVBA 2BPA2 4RR3C 1R091 3CO2A 4XFFA 5KHHA 2C5DA 4B4RA 1EP0A 3AYCA 3TN93 3H9AA 4XILA 1HQNA 1A8DA 1RUOA 1BK1A 3W59A 2Y0OA 3WP3A 2KM2A 4CEYC 3L9JT 1VBD3 3PJYA 3R4DB 2R30A 4QPIB 2H6BA 4P14A 1GFF2 1HDKA 4E4ZA 4OUSA 3IN9A 4OI4A 2RM22 3CU7A 4FQ4A 4IEOA 2LM3A 4XMIA 5FPZA 4HMZA 5GLVA 4YW3A 5IK7A 1R082 1ZX5A 3ZXAC 1JW6A 4HVRA 2JG8C 3JZVA 3WQ1A 4QGMA 4DOUA 1PK6C 1N1SA 2X5IB 5GZDA 2OUHA 4AEDA 4WZFA 2R49A 1ZNPA 2XWBB 4RR3B 3B9IA 3VHPA 2RS52 1BVVA 3AM2A 3AP6A 3ZYPA 1QWRA 3HR9A 1YJLA 5ABJA 1G9DA 3M3CA 4B29A 3I54A 1Q8PA 4JAAA 3RMYA 4X8NA 4QM8A 2OZJA 1V6OA 1RJ8A 3AXDA 3HAGA 5FQ0B 4BQ1A 4J6GA 1UF2C 1HIXA 2EF6A 2AZ5A 4AI8A 1RUE3 3D0JA 4XETA 4I2OA 1LOBA 2ZHLA 1TMF3 3TN91 3GBFA 3AZVA 2OPKA 2E7AA 2WLPA 4H7LA 4AI2A 3B69A 2JG8B 1VBD1 1NXMA 4XJUA 2Y38A 4QPGB 2UY9A 4YG0A 3MW2A 1H8TC 1Q8SA 3TRSB 4AXOA 3KLSA 1VBA3 4FPOB 2F4PA 2G9FA 3C2UA 3N7LA 3B3QE 4FCAA 4R9AA 3ZYIB 5J7MA 5J37A 1NCRB 3ZFEA 1GZCA 4YVSA 1VR3A 5KXDA 2ZPXA 2A7AA 3M2MA 2D40A 2ZX1A 3PMEA 4UW5A 1RINA 3PHMA 2PHFA 1J3PA 3M4FA 5D8AC 4N43C 5K7PA 1NLSA 2GN7A 1CN1A 3ZYJB 1WW5A 5E89A 3PNAA 1S2BA 5J3UA 1YXWA 1GNHA 2JEMA 3AZYA 1BZWA 3MW4A 4CEWA 4K9SA 4HPKA 4DS0A 1ND3C 1S0FA 3VN4A 1OSGA 3NL1A 2VXRA 5GZFA 3EBRA 4WVMA 5KHJA 2R042 3AFGA 1TMF1 3TBDA 3ZO0B 5CA6A 5LEJA 1VRH3 2RS32 4P9XA 4N7IA 1AYN3 2NMNA 1LGCA 3HBZA 1LEMA 2WNVC 4KG0A 3V0AB 3ETQA 4FPYA 2VH9A 4AWDA 1PZ9A 1UL9A 4EN6B 4Q0PA 1VBA1 3CJIA 3TB0A 2V09A 1PO12 2X53S 4OULA 3JQXA 5BY5A 3ILRA 4L92A 3R05A 1CAWB 1RB8G 1PVC2 5KXBA 3MEPA 4M0HA 1ND3B 4FAHA 2B39A 3R4SA 4K21A 4X8PA 1BEV3 1V6JA 3AZZA 3M8LA 1SLBA 1RMU3 1XNCA 1POV3 2LTNA 2HEVF 4YZ4A 1JTZX 4D94A 2ZCWA 1DGLA 5CU1A 1SLIA 2ZOEB 3V64A 2PHTA 3WHUA 2ZGNA 1R083 4HSLA 5AVAA 5T54A 1FOD3 2VNGA 4JGYC 3WOGA 1J3RA 1JHNA 5K0UB 4I0BA 3LOBA 2XG3A 4X6RB 2VVDA 1YLLA 3OY8A 1VRH1 3VBHB 2Q1ZB 4EROA 2CNAA 1AYN1 4LA3A 4GB32 4YNIA 3ZFFC 2WT2A 2EALA 1EV12 1PO22 4BYYA 2DFBA 2X8KA 3U10A 1FV3A 3VKMA 1SCSA 3UKVA 4M01A 2VOXA 5KC5A 2ZMNA 1A8MA 1REDA 4Q4V3 1MS8A 2DCJA 2IXJA 3OD4A 2HWF3 1QDCA 3FBMA 4LBKA 1N1YA 3K48A 4JTNA 4PIXA 1FNZA 5FREA 1NE4A 1F5FA 3FZ3A 4EN0A 1ND2A 4LUMA 1RUC2 2PELA 3UK9A 4JGYB 2PN5A 3LOIA 3MLKA 2G9GA 4QPYA 4K1YA 1BEV1 4MYEA 4PIZA 2JE7A 1RMU1 4OHXA 4NO4A 3BPZA 1POV1 1NA1B 1W6MA 4Y24A 3ZXLA 4HZFA 2OYZA 4E4DX 5C4WC 1YHFA 3WD5A 2DVFA 3S0MA 3ZFFB 4OFGA 1D0HA 1FOD1 2PHDA 1T6GC 3AP9A 3MIHA 1H4GA 2R073 3VBRB 2SLIA 3CJXA 1FPN3 1VB2A 1ZZ7A 4MXWA 4BHPA 4FTSA 4K20A 1XNKA 3GBGA 1EY2A 2ARXA 4NHKA 4IETA 3NV1A 4CRQA 2WNEA 3RZZA 3ZXFA 1QMJA 4FTBA 4Q4V1 4N90A 3DGTA 3SISA 1IHMA 4BM8A 2WIIB 4EN7B 2R0HA 2R043 1BBT2 2HWF1 5CG8A 1NY72 2D3PA 3OGJA 2B8MA 5C4WB 2R32A 1YIFA 4KQ7A 1VALA 1PZ8A 1UCXA 5J96B 2HWD2 3INAA 3WNXA 2RS33 5E88A 4DPNA 5FPXA 4AK3A 2XHKA 1UIJA 2JX9A 1IOAA 1WA4A 5BPXA 1B35A 2CAUA 3DL3A 4BH9A 2FZ2A 3BB6A 4BLJA 1BVP1 1CX4A 2YYOA 1FMD2 4CDXA 1OQDA 5F6LB 1UMZA 2I2SA 4RGGA 1HLCA 1SLCA 3IBMA 3PVBB 1DG6A 3D8CA 2R071 1WLCA 2GH8A 1HV0A 4L2NA 4WM8B 4AFAA 3B9CA 1J3QA 1Q8OA 2EXKA 4PDWA 2HWE2 1JBCA 2ZJCA 4ES9A 5BNNC 3PTYA 1FPN1 1ULGA 1VBB2 3DPRA 2DCYA 4KH9A 1AR63 4Q8KA 3L2HA 2PHUA 3H0OA 4FPEA 1LGNA 4BMBA 2WZR3 2D7FA 5EZWA 1IKPA 3QACA 3OD0A 3USUA 1SLTA 3VKOA 1LOAA 2GMMA 1FT9A 4RQPC 1YFWA 3E6DA 1PVXA 1RL3A 2Z69A 3KM5A 1WBFA 3ZFGA 1D2QA 4OI2A 4AVAA 5C8CC 3VDDA 1RUG2 2ZGOA 1PNGA 2RS31 2B9UA 1Q43A 2YY1A 5EFUA 2D6PA 4Y1VA 4GB33 4XXAA 1SFNA 4RFT0 1MACA 5JPNB 2IZWA 1RHI3 4LT5A 5LK7B 5BNNB 2RJLA 1JXNA 5JMCA 1ULDA 4FPHA 1O5UA 1D4M3 4W6XA 2E63A 2CGPA 2WA3A 2Y26A 2I74A 1D0GA 2Q5TA 1V9U3 1MEC2 1O3SA 3R4UA 4META 4TLFA 3RPQA 2XB6C 2BBVA 2WC2A 4Q4Y2 1RUC3 3CEWA 1R1ZA 2JDZA 1QJU2 3O14A 1OLQA 1AR61 1REEA 5AFBA 1YNAA 4AEDC 3NV2A 1ZBA3 5CFDC 2WZR1 4IV1A 2ZMLA 4L11A 1CAUA 1F2NA 3VUOA 4E2SA 1UZZA 5ABJC 1DQ0A 2ETEA 3H50A 4XTMA 2P17A 1Z0HA 1ZRCA 5FAXA 4LUKA 3SH5A 3SHRA 4XF9A 2E51A 2JE9A 4GB31 3MI8A 4AFDA 1UAIA 1R092 5AVPA 1SQ4A 3SLIA 1RHI1 4C91A 4AVTA 1YUDA 4GQ7A 4COWA 4KWLA 1SBFA 1CJPA 2B7YA 4C0HA 4TZDA 2ZHMA 1D4M1 2CWMA 3B93A 3KS7A 4E4SA 1BBT3 2VU9A 1JN2P 2YGMA 3POYA 4AEDB 3I8TA 3K51A 1V9U1 4S2HA 4Z1VA 5CFDB 2ZZQA 5L19A 2AREA 1LGBA 3M3OA 2AGSA 2WQZC 4I0WB 2VGDA 3ZFEC 1G86A 4HFSA 4YVSC 1MZEA 3QLQA 5JOYA 4QD2A 4R52A 3UL2A 5JSRA 4PLMA 1QOTA 4RHV3 4GULA 4CP1A 1N1TA 4CDQB 4QU2A 1MR5A 1ZBA1 1ENRA 1QKQA 4FOQA 3WQ7A 1NYWA 1X8MA 5IUQA 4NVPA 1ZRDA 4PJYA 3THPA 5GLWA 1AVBA 2A3WA 3ENRA 1NCQC 4CEWC 5GLTA 2Z42A 1J1LA 4JCKA 1TE1B 4IEWA 3NJZA 2FQPA 2ZA9A 1SLAA 4XHBA 1H1IA 2VY0A 4OVEA 5GZGA 2UU8A 3KT4A 3EHKA 3TN92 5JZGA 1S1AA 4QT6A 1JOJA 1H30A 4TWTA 5IK8A 3NKTA 2XBO3 1VBD2 1QXRA 3O12A 1BBT1 1LKNA 3FUOA 2A6ZA 3SCHA 2BEOA 3CJIC 1OI6A 4ATFA 4M00A 1XYNA 2D3SA 3KCXA 3ECQA 1A78A 4J1WA 2BWCA 3J26N 1CESA 1FATA 4XOGA 1HQWA 2UY8A 3RMXA 1NCQB 4MGKE 4IEPA 4KGGA 4COVA 3BU7A 4RHV1 1AR83 3JUUA 1C57A 2DUOA 2P2KA 1H2KA 1AR73 3AKPA 1YIPA 1JYIA 1ZREA 3KGZA 3SXWA 3IPVA 3N4MA 1RUNA 1GQGA 2XJRA 4WV8A 4LO6B 1VIWB 5C8CA 3RWNA 3P3PA 3MFAA 4QHBA 4EWAA 4CDWA 4HN0A 5B2GB 4FP2A 1G7YA 2C1FA 3FFQA 4FOVA 4IEYA 2D3RA 4Y20A 5C9AB 1RUD3 2I07B 2MPFA 1TMF2 2EAKA 1S0EA 1EPWA 4EWEA 4K7JA 3HIFA 2XBO1 1W0OA 1YCIA 1QOOA 1IS5A 2E7QA 1RUI3 2HJIA 3KQRA 1DGRN 4OHZA 1OD5A 4QMAA 2RHPA 2H6CA 1VBA2 3QH6A 5C33A 4HLTA 4S2GA 3IDEA 3I59A 4XFBA 2A3XA 3JD73 4OUMA 1ZRRA 1CGPA 1ND2C 4GWMA 1AR81 4MV2A 2W68A 2EAAA 1CONA 1W6OB 3SCGA 2UWBA 5JIAA 3VV1A 1AR71 2PFWA 2ILMA 3WDXA 5I8YA 2N7GA 2EXIA 1J58A 3O5SA 2GNTA 1UU6A 1V00A 1ZZ9A 1IS4A 2D5HA 3G7DA 3N7JA 4M3CE 2RJKA 4N53C 1S0DA 4E2QA 5H9SA 4Y5Z0 1X7NA 5BNQA 2VG9A 4Q4W1 2MEV3 3PVNA 2BFUL 4IV3A 2NZ9A 3TWIA 4I09A 2ARBA 3MW3A 1RUD1 1LOGA 2VECA 3C3VA 4YVWB 1PIV1 1WLDA 4F3JA 1S0CA 1VRH2 1COV3 4YGBA 1WMEA 4COUA 1S55A 1AYN2 5FMOS 5JCTA 1ND2B 3SMHA 1RUI1 1OMIA 3S7IA 3H1YA 5DUVA 4ONUA 1I3HA 1RC6A 2EIGA 2IXHA 2VQAA 1OOPB 3AMNA 1QHDA 1W6MB 4JVAA 4YFZA 2O1QA 1DZRA 1FV2A 4PLNA 3MZHA 3JD71 1D2SA 4OHYA 2QZ2A 4INDA 4N53B 2A71A 2HWC3 3A0NA 5T5PA 3AMPA 1Q3EA 4ORFA 1OLRA 1HW5A 3VBOB 4AVVA 2QDRA 2NYYA 1B35C 1BEV2 4S2DA 5BNOA 4CDUA 4AHXA 1RMU2 1YRZA 1C4RA 2B46X 1KDMA 2FBEA 4CDXC 3ATGA 4QQLA 1HRI3 2DYCA 1C5IA 2O0OA 2Y0IA 4GH4B 1KDKA 2VW2A 1MS5A 4YM0A 4F7ZA 1FOD2 4HKOA 2MEV1 3AP4A 1W0PA 4PDWC 4C1XA 1NXD1 4RS5B 1H2NA 3DPRC 4UBHA 4GWNA 1LTEA 4L99A 1O4YA 1W6PA 1COV1 1YYNA 4WVWA 2XL7A 1DYKA 5CG9A 4CEYB 5JI9A 4QM9A 4Q4X3 4R9DA 1JYCA 2XUMA 3ZN6B 4C90A 3M3IA 3N7MA 4Q4V2 5CBLA 1O4TA 2K0GA 5H9QA 2HWF2 2BWAA 3ZFGC 2QDNA 2A73B 4OHVA 2UYBA 1TNFA 5HCBA 4Q29A 4HVQA 1RJ7A 2HWC1 4H55A 3B02A 4WVZA 3WX5A 1U5XA 1XXNA 2GDFA 1QH7A 1PK6B 2QVSB 4M0NA 2MHFA 4R4ZA 4XPVA 3DPRB 3OBTA 3UJQA 4AVBA 3LA2A 4DY5A 3O7OA 4BA6A 4Q0VA 3V65A 2E53A 5KWRA 1OFSA 4WM7A 3G6JB 1HRI1 3RJ2X 4LBQB 4BLIA 1OKQA 3MICA 2ZX0A 3ZSMA 4JDNA 3VZLA 3VZKA 2ZGLA 4CP2A 2JECA 3Q9OA 5I8SA 4W6WA 1SMVA 1I9RA 4HETA 4PBOA 4UBGA 1POV0 2HKXA 2R072 2A70A 4KNCA 1KJRA 1VBE3 4U36A 1IZ3A 2D93A 3MPBA 2KXLA 4IERA 4YGCA 2WL1A 3ZFGB 1FPN2 4YG6A 1BQPA 5FOBB 4IV1C 3JU9A 4XJAA 2NLRA 5JOZA 1O3QA 3JCIA 3O0WA 4H14A 3H1WA 4AG4A 4Q4X1 1FXZA 4JQRA 1H8TB 1C3HA 4JTOA 4Y22A 3RG0A 4A7KA 4UW6A 1PGSA 3WCSA 3GHMA 2BVBA 2GC0A 3ASIA 5IT6A 4YGEA 4ITCA 4D7TA 1X36A 1O7FA 1O91A 5F5QA 1KS4A 4AHZA 1S2KA 2YHJA 1ZA4A 3DN7A 4JDMA 3MYXA 5I91A 4F8AA 2D6KA 2ZGQA 4N43B 5D8AB 2PYTA 4PQ9A 5GZEA 1CAUB 3UKNA 1LULA 4FPGA 3H7JA 2D5FA 2ZZJA 1WMFA 2VPVA 3NW4A 3AX4A 3AP5A 3VBSA 1VBE1 4AW7A 1XQNA 4I30A 1APNA 1AR62 5I93A 5J36A 1CAXB 1HX6A 4FTEA 4PIYA 2PAKA 2WZR2 1ULCA 1F8VA 1GICA 2ZGTA 3HT1A 1PHMA 4MZUA 4DB5A 2YZ4A 1I6XA 2AUYA 1U5YA 2WNVB 4E2GA 2JICA 2QFEA 2WKKA 5A33A 2DU1A 4IL7A 3BOPA 5T55A 1YFXA 2UWCA 1IPKA 4HK9A 4NHMA 1PGL2 4XQDA 3GZAA 2GC1A 4NPRA 5ACA3 4IEQA 1GZWA 1HXS3 4COZA 4WBBA 1UPSA 3TNQA 2ZABA 1AUYA 1XE8A 1ENSA 4KGQA 5JZGC 5E16A 1MS1A 1RHI2