3WG3A

Crystal structure of agrocybe cylindracea galectin with blood type a antigen tetraose
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
163
structure length
163
Chain Sequence
KHMTTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational change of a unique sequence in a fungal galectin from Agrocybe cylindracea controls glycan ligand-binding specificity.
pubmed doi rcsb
source organism Agrocybe cylindracea
molecule tags Sugar binding protein
molecule keywords Galactoside-binding lectin
total genus 40
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wg3A00
2P37A 2C9AA 2PHTA 3B3QE 1KDKA 5DXDA 3UK9A 5JOXA 1G7YA 2KM2A 3IPVA 2WT1A 4M3CE 1VAVA 3AZYA 5T50A 5CB7A 5GLWA 1I1EA 1W6MA 3FLRA 1YO8A 2WKKA 4XMIA 3N7KA 4Y20A 3USUB 2DTWA 3POWA 2ZA9A 2ZKNA 4ASMB 1GKBA 3ENRA 4XIKA 1V6LA 3DUIA 1LOEA 1UMZA 1Z0HA 4YW3A 1JYCA 2P3KA 1JYIA 3N7MA 1GV9A 3RS6A 4LBOA 4LBMA 4WVVA 2EALA 1IS6A 3T2TA 2A6YA 1FYUA 1PZ8A 1KJLA 2ZGKA 5GZDA 1LOBA 1LGBA 2VW0A 3N7JA 4Q8LA 1DFQA 1N1TA 3W59A 3WG2A 4AVTA 1N1SA 1KRIA 2XB6C 1LOGA 1LGCA 1FNZA 5GZGA 3MEPA 3POYA 1WLWA 5EYYA 1VIWB 1S0BA 3PVNA 4JC1A 3RSJA 3T1LA 1QNWA 5EXOA 1D0HA 3FBYA 3WG4A 1IKQA 2NYYA 5GLVA 3A4UA 5HCFA 1YIFA 4L8QA 2ZHLA 4XTPA 3CNAA 1Q8QA 5IK5A 4KBBA 1WW4A 1AX1A 1UZYA 2GMMA 4Y22A 1CJPA 4XJ9A 1LOCA 2GN3A 3GNEA 3V64A 1A3KA 1GNZA 1PZ7A 1S0JA 4AVSA 3FLPA 1QDOA 1LOFA 1F5FA 1W0OA 3AX4A 4PF5A 4GA9A 4WV8A 1BZWA 1G9AA 4P14A 5IK7A 1LHNA 2WSUA 4CRQA 5KXBA 1WW6A 2CL2A 1UAIA 4M01A 1DIWA 1JW6A 4BM8A 3FLTA 2D43A 2ERFA 3AYAA 4XXPA 4YM1A 1A8DA 2JD4A 1CPNA 4ATFA 1JXNA 3ZSMA 3ILNA 1JN2P 1SBEA 2ZGPA 2YROA 2DU1A 4IQPA 1WBFA 2DURA 5JDBA 1MACA 4Q8KA 2A7AA 1ONAA 2Z42A 4XBLA 4AWDA 4PBPA 3WDVA 1ULCA 4HANA 5T52A 1GICA 2CYFA 2A3XA 2DU0A 1Q8VA 2AENA 4HL0A 2UWCA 4Y1ZA 4BMEA 1HQLA 4UW4A 1MS1A 1VAMA 1LHVA 4WZFA 4FOWA 3WDWA 1C1LA 3ZPYA 1W6MB 4FPLA 3WHUA 1GZWB 5GM0A 2D6LX 5CA6A 1N1VA 3N35A 3WVJA 1GZCA 3O12A 4YM2A 3V0AA 1V6KA 1LEDA 3AZWA 3R4SA 2ZACA 2JKBA 1AJKA 1ULDA 2NN8A 3B9CA 4GKYA 2EXHA 3M3OA 5DUWA 3WOGA 1S0GA 3APBA 4XHXA 1AXZA 1QOTA 2GNDA 2JE9A 2Q5TA 2WT0A 2ZGUA 3H0OA 1AJOA 3V0BB 2ARXA 1R1ZA 2D6OX 3C2UA 1N3QA 3HR9A 3JU9A 1C57A 5IUQA 3WUDA 2AREA 2B7YA 2DVFA 2DV9A 1S0DA 2GMEA 1GSLA 1DYPA 2A6WA 2D3RA 2W08A 3WLUA 1LGNA 4OZXA 3WNXA 3IPVB 3AYDA 1GYKA 4XJAA 4K20A 1S0FA 2W39A 3IMNA 4PCRA 5F5QA 1CONA 1GNHA 5T55A 4DQAA 3ZSKA 3N7LA 3FUOA 4Y1UA 5H9QA 2XG3A 2UURA 3B69A 3INAA 4Y24A 4YGCA 2ZMNA 1DYKA 1XQNA 2AYHA 4DRRA 4XDQA 1JHNA 4W65A 5T5JA 3SLIA 3AP4A 1W6QA 1S0CA 2WQZC 3A0NA 3B00A 1V6OA 2DYCA 4LBJA 4P9WA 1ENQA 3GALA 3MW2A 1HKDA 4FOQA 2LTNA 1IS5A 1Y7BA 3AZVA 1DBNA 1X50A 4LBKA 1QU0A 1OKQA 1FV3A 2VH9A 1DGLA 1W6QB 3M2MA 3O0XA 3R05A 4D69A 1B09A 4DPNA 2D6PA 1VALA 4U2AA 3M3CA 2ZHNA 4GWMA 5GLUA 3WCSA 3TB0A 3IKWA 4ATEA 1NXD1 2D6MA 5E89A 4Q26A 4XJWA 5DZGA 2EXIA 4FQZA 4XJ8A 1HDKA 3AZZA 3WUCA 1AXKA 1G8WA 1LODA 1CVNA 3SH4A 3NV2A 1QGLA 2EAKA 2ZGQA 4BQ1A 2DVAA 2ES3A 3ZXLA 3FUQA 5IT6A 4MYEA 4M3CA 5GJ6A 2E7QA 5KXCA 2PHFA 1LU2A 1YRZA 4FPKA 4LBLA 2V5YA 4C1WA 1MR5A 4Q27A 3OYWA 3MW4A 1V6NA 2YV8A 3ILRA 4XBNA 2A6VA 4AYUA 2VU9A 1AF9A 3AP9A 3OJBA 1SCRA 2ZGMA 3AYEA 5CNAA 4NOTA 3V0AB 4FPFA 4XMAA 3AYCA 3VKFC 3AJZA 3DGTA 3SH3A 1V00A 4YZ4A 1LESA 5T5PA 2CWMA 1WW5A 5SV8A 4YG3A 3OY8B 2EIGA 2A6XA 4AGGA 1PZ9A 4NO4A 3T1MA 1DQ4A 1S0IA 4I30A 4CTEA 4PQ9A 4Y20B 1AVBA 2A3WA 4LBQA 5GLZA 4XXAA 3AZXA 3USUA 5GZCA 3AP5A 5FRAA 1MS4A 2NZ9A 1AXYA 4YW4A 4XZPA 4FOVA 4M3CF 5DUUA 1SLAA 2E51A 3PVOA 5IK8A 3VV1A 4P9YA 2JECA 3SH5A 4YM3A 5JOZA 1MZ5A 1UPSA 4YW1A 5FREA 1EPWA 1MVEA 5AVAA 1BJQA 3VKMA 1D2SA 1KITA 3PMEA 5GALA 1G86A 2EXKA 4K1ZA 4YG6A 3Q9OA 1ULGA 2VW1A 3BODA 2LALA 2JE7A 1APNA 4YW5A 3NV1A 1GANA 2AGSA 1C1FA 1W6NB 1JBCA 1IS4A 1WBLA 2P34A 1S1AA 1IS3A 2RHPA 4ISRA 3SNMA 4XBQA 2JJ6A 2ZMKA 4AVVA 3WDYA 1S0EA 5DZEA 3UL2A 1FAYA 1A78A 1MS3A 1V6JA 4XJUA 2CNAA 1MS8A 2EF6A 4F83A 1O4YA 2UU8A 1OQ1A 3U4XA 4FP2A 2GALA 5KXDA 2G4IA 4RL7A 2WSVA 3BIWE 4C1XA 1ULEA 4FPGA 5H9PA 1H30A 2H0BA 4FP3A 3W58A 2HYKA 3ILFA 1LECA 3M3QA 3AP6A 4FPEA 4PBOA 3QLQA 4XILA 2P3JA 2YXSA 2YZ4A 3WHTA 3HN1A 5H9RA 2P2KA 1SBFA 2GNMA 2DWRA 5DG2A 3POSA 3FFZA 2D3SA 2NP0A 4GALA 2E7TA 2PHUA 2WT2A 3TAYA 3L2YA 4Q1PA 4XTMA 1HLCA 4XIOA 1SLLA 2R49A 4GKXA 2VY0A 5BYNA 1LOAA 1Q8SA 4XYXA 2CTVA 1IOAA 2WNEA 4YW2A 2CY6A 2R0FA 2I2SA 3OGGA 3R4UA 4Y1YA 4Y1XA 5H9SA 4M00A 4R9BA 2UWBA 3AP7A 2ARBA 4U36A 1CIWA 2YMZA 3OY8A 3WG1A 2D7FA 1LULA 1KDMA 2A3YA 4R9AA 1JOJA 1WD3A 2ZABA 3M3EA 1WLCA 3ZXJA 3OPZA 1RITA 2W68A 4YZ5A 1F9KA 5EYXA 2FMDA 2ZGNA 2D3PA 2VXRA 1N3OA 1G9DA 3D6EA 1W6PB 3ZYRA 2DUQA 4BPZA 5JOWA 2GNBA 3LCPA 4RA0A 5E88A 1FATA 3MPPG 1DQ6A 1G9BA 1WW7A 2A6ZA 2C5DA 1GZWA 2E6VA 2R0HA 1H9WA 3IN9A 3KM5A 3N36A 4H55A 2ZHMA 4FPOB 1JUIA 2DUOA 5GZFA 1AX0A 1I3HA 4YM0A 3V0BA 2ZGSA 2EXJA 1SACA 4R9DA 3RMXA 2DTYA 1DQ0A 2ZZJA 1LCLA 1BYHA 1CN1A 4FVVA 5T54A 4BLJA 4UW3A 5GLTA 1LOFC 3VKNA 4K1YA 3OBTA 1W6PA 2OUHA 1SFYA 1WD4A 4R9CA 2D44A 2GNTA 3UJOA 1MS0A 5T5LA 2OUJA 2ZMLA 4CZSA 2JDZA 4XJZA 1MS9A 3WV6A 2DVDA 1O4ZA 2NMOA 1BKZA 4Y26A 1C4RA 1RINA 1MVQA 3OBRA 2ZGRA 4FPHA 1BQPA 1DQ1A 1KQRA 1N3PA 2ENRA 2ZGLA 4TYSA 2OVUA 4AGVA 1CQ9A 3SITA 4Z8BA 4LBQD 4YG0A 3WDXA 2D6KA 1SLCA 3AFKA 1H9PA 2R1DA 3M1HA 2PHRA 3N3HA 2CWSA 1KJRA 1SBDA 3ZXKA 1URXA 2DUPA 2P3IA 4Q2FA 3A0KA 2R16A 4YGDA 4DS0A 1ULFA 1WCSA 2SBAA 2ZAAA 3NWKA 3OYWB 3ZYPA 4TZDA 2A5ZA 3O0VA 1DQ5A 5HCAA 4FOYA 3QCWA 5JVVA 2NM1A 4ISQA 1Q8OA 5DZFA 4YGEA 2WLQA 3UJQA 1CESA 4Y22B 1QDCA 1QOSA 4AGRA 1J1TA 1WLDA 1LEMA 2VW2A 1SLIA 2ZBJA 3WDUA 2UWAA 1U0AA 1LHOA 4YZ3A 1OFSA 1WUVA 1YI7A 5KXEA 1DZQA 1ZA4A 2YY1A 1N47A 3VUOA 1V6MA 3ATGA 2TEPA 1UN1A 3RRDA 1G9CA 1AZDA 4UW5A 3VKLA 1QOOA 1LJ7A 3AXEA 1ENSA 5DUVA 1GZ9A 3ZXEA 5L73A 1F31A 1ENRA 4YFWA 3JUUA 2ZGTA 4YGBA 1LTEA 3O0WA 2NMNA 1YXWA 3RMYA 3ZXFA 4DRVA 5DUXA 1LENA 4K21A 2BQPA 3PJQA 5JLVA 3ZSLA 1UKGA 3NV4A 3RQ0A 3SISA 2DVBA 1FX5A 1NLSA 2FHRA 4XE9A 3BTAA 5T5OA 2DVGA 2OW4A 4ITCA 3MW3A 1V6IA 1DLLA 3WDTA 2VUAA 4FPCA 4GWNA 3RG0A 3D5OA 4LBQB 1DHKB 3HMYA 2ZHKA 3NV3A 1HQWA 3O5SA 3VKOA 3WZ1A 4Q1RA 4ZKTB 2PHXA 3V65A 1MZ6A 3BOPA 1VLNA 5LK5A 1SLTA 1UX6A 4JCKA 2GMPA 2R1BA 4XHBA 1W6OB 3WG3A 4YLZA 3AK0A 1GLHA 2W52A 4SLIA 2AR6A 3AXDA 5IK4A 2PELA 2AH2A 4YZ2A 2E53A 3LSEA 2V73A 4FPYA 1G9FA 3WCRA 1W0PA 5HCBA 1N1YA 4LBNA 1IKPA 5E8AA 5GZEA 1Q8PA 1QNYA 4FPJA 5JOYA 1BXHA 1FV2A 3I4IA 4JRAA 2D6NA 3KQRA 1Q56A 4WVWA 4BOWA 1FNYA 1LHUA 3ZSJA 4UW6A 1QKQA 3I8TA 1QMJA 5DG1A 2GN7A 2WJSA 2ZGOA 1W6OA 4GXLA 3D4KA 1TEIA 1GBGA 1UL9A 4DFSA 4Y1VA 1W6NA 4P9XA 4BLIA 4YFZA 5F9TA 3ASIA 3PVEA 1UZZA 3AJYA 2GDFA 3ZVXA 2A70A 4ZXKA 1ZM1A 1Z78A 3B01A 5CAZA 1QF3A 2PHWA 4BMBA 2A75A 4YZ1A 4FQ4A 1LHWA 4XOGA 1DQ2A 1LU1A 1YYNA 1SCSA 3LSDA 3IM0A 2SLIA 1RIRA 2A71A 1AX2A 1CPMA 1CR7A 2AUYA 4M3CB 5CBLA 5EWSA 1MS5A 5JMCA 1SLBA
chains in the Genus database with same CATH superfamily
2HJIA 1KDKA 5I8YA 4IE5A 3GZAA 2CU5A 2KM2A 4M3CE 4NJ4A 5C4WB 3RWKX 5CB7A 4CE8A 5HCHA 1W90A 1I1EA 4K8FA 1QJEA 3E5QA 1YO8A 2WKKA 1AR71 4XVHA 4Y20A 3POWA 3WF3A 1OH3A 2JG8A 3NRUA 2LUWA 3ENRA 4XIKA 2TBVA 5FZKA 1UY1A 5FAXA 3N7MA 4CU7A 2WS92 4XF0A 1YQ2A 3AMQA 3NSTA 4LBOA 3I3BA 4LBMA 2OKXA 1R1A2 1JH5A 3T2TA 5ABJC 1FYUA 3E97A 2ZGKA 2DCYA 5DPNA 4JGYC 5GZDA 4BDVB 1W8FA 5BNOA 3S0MA 5ABJA 1XU2A 4RGAA 1DFQA 2FDJA 4Z2AA 1OA3A 4CDQB 3KSCA 1N1SA 2WO1A 1KRIA 1IQAA 1VBD2 1DGRA 1LOGA 1LGCA 5K7PA 1FNZA 2KR2A 5D2AA 2OX0A 3MEPA 2ZX3A 5A3WA 2OQ6A 2KD7A 5EYYA 1VIWB 1S0BA 3RSJA 2B9UA 2JB8A 2W3JA 1ST8A 2RM22 4L8QA 3LZZA 2XJUA 4DY5A 1POV0 4AE2A 3ROUA 2VNVA 3B9IA 4CDXC 1W8OA 4LOTA 1HXS2 4RR3B 3EJKA 3ZXDA 4Y22A 1DGWA 2ORXA 3THPA 5JXJA 4ZU7A 1VMJA 5BNPC 3GNEA 1V70A 1A3KA 5A6XA 1PZ7A 1S0JA 2C1FA 3C7OA 1RYYA 5FMBA 1JYNA 3BIEA 1QDOA 1HX6A 4XF9A 3NJXA 3C7FA 2GSYA 4PF1A 3J7MA 4PF5A 5LA0A 4WV8A 1F5JA 2PTMA 3I3EA 4QM9A 1LHNA 2BP6A 1U5XA 2WSUA 5KXBA 4G4FA 3HNBM 4LLFA 1UOFA 1ZBA3 2CL2A 1S55A 1LB2A 4E4SA 4M01A 5IHRA 4Y3OA 1O3SA 4D94A 3FLTA 4QX8A 1IG3A 2D43A 3MV01 1JXNA 1NLQA 2OA2A 4NRMA 1SBEA 2ZGPA 4IQPA 2XJVA 2E63A 2XJTA 2VTXJ 5FZCA 4XAAA 4DOUA 4XDPA 4RGGA 1YIPA 2VOTA 4Q8KA 2A7AA 2Q1FA 3KV5A 4YARA 2GC3A 4KQ7A 1ND3B 1ULCA 2BFUS 2VNGA 2JDNA 3EO6A 2ETEA 2V4VA 1QJX1 4H3WA 5JZGB 2AENA 4JX0A 4NPRA 1UPIA 2UWCA 4BA6A 4BMEA 2FZ1A 4UW4A 4W6YA 2VOVA 1VAMA 2JG8B 1BEV2 1ZBA1 5JIAA 2QQKA 3DXUA 2RS32 1C1LA 3SHRA 3WQ0A 3NNJA 4FPLA 4L92A 3AMPA 1N1VA 5FZ4A 5CA6A 1XNBA 2BGOA 2BYVE 1RUE2 2Y6LA 5C3QA 2VCAA 3CJIC 2VTXA 3ELNA 2ZACA 1AJKA 1ULDA 3KT7A 1Z7S1 1ASJ1 5FY0A 1KS5A 4WM7B 3THCA 2WN2A 2V72A 1UXZA 1VBA1 2HWD1 3ZFGB 3ACGA 4A7YA 3RVHA 2GNDA 2ZGUA 5J37A 4JQTA 2VQUA 4K40A 2D6OX 2IVIB 3ZN6B 2AC1A 4IESA 4CXXA 1RXGA 2B7YA 3I97A 1L7LA 4YNIA 5FYUA 5IVFA 2L9LA 4CUGA 1DYPA 3WLUA 1W06A 5J09A 1SHWB 1QIQA 3WNXA 1C8M2 3JBG2 4IEVA 4EROA 2JIJA 5F5QA 3T3YA 2XVGA 2W1QA 5ERLA 2BW8A 3FUOA 4Y1UA 3OF1A 4Q0VA 2XG3A 5FOJB 1OSGA 1W9FA 3INAA 3I2JA 2B42B 2X09A 3K4AA 3GXUA 4PJYA 1EV13 2WQZC 4JDNA 3GJBA 3B00A 2WFPA 5DDJ1 2GC0A 2XKOA 3LA3A 1KFXL 4P9WA 1RXFA 1HKDA 4M4RA 1J84A 2BWCA 2R042 3AZVA 4HVOA 4YYOA 4OI1A 1X50A 4OMCA 1HRV1 2VUCA 1FV3A 3IIIA 4NHYA 4GAZA 1OQDA 5AC93 5JZGC 3O0XA 1B09A 1B35C 4DPNA 3KGLA 4ASLA 3I7DA 4A41A 3WCSA 3T4HB 5L19A 2QDNA 5A7WA 4J25A 4GJYA 3WF4A 5FYMA 3VBFA 5ACA3 5E89A 1JI6A 3PU3A 2WZR2 3OGVA 4P9JA 4HK8A 1HDKA 4XJ8A 3WUCA 5LCWL 1RVF3 4RR3C 5KHJA 1O4TA 1UY0A 1LODA 1W39A 3SEEA 2ET1A 3SH4A 1QGLA 3RYRA 2EAKA 2J42A 3K48A 2HBTA 1OHFA 1RUD3 4MGKE 5IT6A 1IPKA 4MYEA 4M3CA 2HWF2 2XLGA 2YU1A 4RHV2 4YVWA 2FMYA 3LEMA 4FPKA 1Z7S2 3E5UA 4QXBA 4LBLA 2QTWB 4C1WA 3U37A 2B4KA 4J1WA 5FZEA 3O1PA 5ANQA 4OYUA 1RL3A 4KMQA 1IHMA 4XBNA 3VL9A 3ZOIA 3ZXAC 3WP3A 2RS31 3RI8A 4XMAA 3AYCA 3VKFC 1ULPA 1HRI1 4UBGA 3PUHA 3NO8A 2VPVA 5SV8A 3TRSB 4AVCA 3A23A 3VBUA 4BIFA 4AGGA 4P9LA 3MUY1 1PZ9A 4NO4A 2X05A 4CU6A 2ARCA 2R7EB 3CZUA 5FY7A 4LO4B 1QJY2 4XXAA 4E27A 2YGMA 4V2VA 1H8TC 3LQCA 1O59A 5FRAA 1MS4A 3C7GA 4XZPA 2GU9A 1UWWA 1B35B 4M3CF 3K3OA 2Q8OA 5C4WC 4CPBD 4OZOA 1X82A 3O1UA 4AZZA 5I8TA 4MHRA 1V9U1 5L7OA 4YW7A 4EN8B 1ZBE3 2HWC3 2RMU3 5K9YA 3BI3A 1RUOA 3ORJA 1HW5A 4I01A 5A33A 1ASJ3 4KNCA 1HRI3 1D2SA 2C24A 1G86A 5F39A 4E8CA 4YW5A 1QJZA 1I5ZA 1AR61 3ITQA 3E6CC 4NROA 1J3PA 3GZUC 4I0WB 4O61A 1JBCA 1X7NA 3CHXA 1WBLA 2P34A 4R4ZA 3W21A 1IS3A 2XJPA 4AHXA 3N9OA 2W9XA 1PX3A 3T09A 2JJ6A 4AVVA 3J7NA 4NAOA 3WDYA 2H6BA 3OPWA 4Q4X2 4BQ2A 1A78A 1MS3A 3RZMA 4M0HA 4N53A 2XHKA 2ADDA 1HV1A 2EF6A 4HKWA 3WNLA 1JZ6A 2FZ2A 2UU8A 1OQ1A 1W2NA 4NHMA 5B4NA 3I3MA 4HT1T 2JWPA 4FXGB 1YHFA 2G4IA 1AR73 2WSVA 3BIWE 4L97A 5AFBA 4IEWA 2VJXA 5CISA 2G19A 4XURA 3VBHB 2Q8EA 3U1XA 3ILFA 4W6WA 4BYYA 3AP6A 4FPEA 5D8AB 5LATA 4PBOA 4XILA 1WA4A 5H9RA 1CAWA 1SBFA 2MPFA 4GZ9A 4QAWA 1Y9GA 3OPTA 5FZFA 4XFHA 5IAVA 1ZBE2 5A7PA 1O91A 4GALA 5FY1A 2PHUA 5EIYB 4IV1C 4LO6B 2P6HA 3AVSA 3KLSA 1MQTB 4PQQA 5CFDA 3ZYGA 4CDUB 1XSRA 3QOPA 3CLPA 4WM8B 4GKXA 1YFWA 1LOAA 1Q8SA 2Z2SB 2CTVA 4AFCA 1K5MB 2CY6A 2E7AA 3R4UA 3HVDA 5C8CC 2UWBA 3AP7A 5FZGA 2Y64A 1CIWA 2YMZA 5FK8A 3WG1A 4LHNA 2VOWA 1LULA 1KDMA 2A3YA 4KBZA 4N8MA 2Q8CA 3HAGA 1JOJA 2ZABA 3ZXJA 2O14A 2WFF1 4YZ5A 3OG2A 2ZGNA 4AI3A 4DZGA 3LDKA 1W6PB 3HNMA 3ZYRA 4E2QA 5JOWA 3DYPA 2HWC2 2RMU2 4RA0A 3ACHA 1ACCA 2W46A 1DGRN 3N36A 3IN9A 2RVAA 2VR4A 5SV5A 2DUOA 1OPMA 2ZGSA 4AFBA 2O1QA 2YBPA 4CEWC 4QXHA 4R9DA 5A1FA 4CA9A 1R092 2YC2A 4NN0A 4BISA 2VZSA 1QJY3 3M70A 4FVVA 1BYHA 1GMMA 2Y0IA 2Y33A 1ZZ6A 5T54A 1H8VA 3C8XA 4B4QA 1LOFC 3VKNA 2BVBA 4DIQA 4WVMB 1W6PA 1MZFA 3VHPA 4C90A 5FCCA 1P8JA 5T5LA 2LROA 4AAXA 3LOBA 2WZR3 3RPQA 5ACA2 2J1SA 1VMFA 3CMGA 3WQ7A 4BU2A 4DY3A 1NCQB 2ZGRA 1RUG1 1DQ1A 2AZ5A 4MGYE 2ZGLA 1OF4A 2OVUA 5J3UA 3RNSA 2QQJA 4Y4YA 2D6KA 3WINE 3NQHA 1X8EA 1GNYA 2WFF3 3GF6A 1FOD1 1ODMA 3KQ4B 3M1HA 3OBZA 4Q29A 2WNUC 1SBDA 5FPXA 3ZR6A 1QJX3 1RHI2 2R043 4MGTA 4CEWA 4Q2FA 5FZLA 2XDVA 2R16A 4RHV3 1R64A 3DYOA 4YGDA 4D0QA 4DS0A 1ULFA 2ZAAA 4TZDA 2YBSA 5FZOA 1RUD2 4FOYA 1UMHA 3QCWA 5KHIA 5FYBA 1HB1A 3KMHA 3LFIA 2HKXA 1ODNA 4Y22B 4OUMA 4PI2A 1OUSA 2ZBJA 3WDUA 1UZWA 4UF0A 2FD8A 1QJFA 3WNPA 1WUVA 5KXEA 1DZQA 3W9AA 2ZEWA 4PT6A 2VD7A 3VUOA 1TE1B 2HWB2 5FYYA 1UN1A 4N7IA 3RRDA 1G9CA 2BUKA 4FI9A 3VBOA 4QHOA 3AXEA 1GZ9A 3BKZA 3CJIA 3EQEA 3RZLA 4YVSC 1CAVA 1NZIA 2J1AA 4RFRB 2BNNA 3JUUA 4HONA 3FHQA 2MHFA 1RUI1 3O0WA 5FBJA 1RUJ3 5FIXA 3IIAA 1GZTA 1YXWA 3I2FA 3LEKA 4OHVA 3OB8A 4RSUA 2BGCA 1X33A 2DCKA 1ZX5A 3Q8BA 3SISA 1UO9A 1AL22 4XE9A 4XCAA 4GWIA 3E1F1 4JV4A 2GZWA 2DVGA 1O7FA 3H9AA 2RV9A 4LK7A 4BJ0A 3MW3A 1XU1A 1V6IA 4Q4X3 4Q4Y2 3DV8A 3IDAA 3ES4A 3GM8A 2IFRA 3LWCA 3POFA 2JG9A 2ZJCA 4FPCA 1EYBA 3D5OA 1DHKB 3NV3A 5BNOB 3BVCA 4Q1RA 2WWSA 1ZBE1 5BNNB 2JG9C 3FHIB 2WNVA 5F7UA 1VLNA 1UIKA 1GWKA 1X36A 4JCKA 4YLZA 2XKPA 2YYOA 3VD9A 3HIFA 4PHZA 4HN0A 4N43A 4HFSA 4YZ2A 3LSEA 5EFUA 3MF6A 1PIV1 1RJ7A 4XAEA 4Q5OA 3RFRA 3WCRA 5HCBA 1POV1 2XLFA 2OYZA 4CXYA 5C5TA 5CG8A 3AL5A 3T0DA 3F2ZA 2OZJA 1RUJ1 1W28A 4LBNA 1JYTA 4E4DX 1GQHA 5GZEA 3ZN6A 4FPJA 4DEQA 5JOYA 3I4IA 4EN6B 3MHZA 1QKQA 4RS5A 1XPWA 4HXCA 4E2GA 5CU1A 1M4WA 3ZXGA 3WNMA 4HPKB 4F3JA 3I2DA 5A3NA 1W6NA 2GAUA 3MBWA 4P9XA 1L3JA 4XCBA 4QD2A 4Y33A 3PVEA 5FYVA 5AFEA 2GDFA 1COV3 4ZXKA 3U78A 1ZM1A 3I2GA 3VBUC 1QF3A 2PHWA 4QQPA 1V9U2 1RB8G 3BTYA 1H6YA 4FQ4A 4XOGA 1SFNA 2W0XA 3LKJA 1Q3EA 2A71A 1AX2A 2AUYA 5BUVA 5CBLA 1D7PM 1OA4A 1MS5A 1NA1C 2HWF3 4AFMA 2C9AA 4GH4C 3HPNA 4RHV1 3RWNA 1G7YA 3I2IA 3GBFA 1OF3A 2OPWA 3MGUA 1UY3A 3EMRA 3OGSA 4Z07A 5T50A 1O3TA 2CHHA 4P08A 4FO9A 1TMF1 1W6MA 2OIIA 2P6CA 3FLRA 3CJIB 4ASMB 3IAPA 1GKBA 4XQ4A 3KHBA 1V6LA 1DYOA 4DUWA 1UMZA 4YWAA 4XEZA 4YW3A 3SKJE 1JYCA 3GDBA 5F3CA 1JYIA 2E32A 1OI6A 3JQWA 3ES1A 2DCZA 4GB33 2WZR1 4PLNA 2YB7A 2EALA 3HD8B 5JCTA 1EY2A 1IS6A 4BZ4A 1ND2B 2X5IB 4GQ7A 4EWAA 1KJLA 2VMDA 3ACLA 2IXLA 2VM9A 2PLV3 3KV6A 1LOBA 1UKRA 3ZFFA 2QZ3A 2KXLA 2WNUA 2VGDA 3KZ4C 4AVTA 4CUBA 4I2OA 4CSWA 4WM8C 5FO8B 5A3UA 5GZGA 4CP2A 5LW9A 3BOWA 2RS12 2HEYF 3T1LA 5EPAA 5CKQA 2PQSA 1D0HA 3S30A 3WG4A 3GZEA 2ZEZA 1YIFA 4A3XA 4QT6A 2ZHLA 4WVMA 4KG0A 3CNAA 4CEYA 2LM3A 4EQVA 5JAXA 1OLMA 1PM4A 4CDWC 4KBBA 4F7ZA 2C0ZA 1U12A 3J8F3 1WW4A 1JTZX 1AX1A 2NPIA 4CP0A 4Z92B 5LA1A 1C8M3 2IWGB 4AFAA 1CJPA 4XJ9A 4NIHA 3JBG1 3TN93 1W05A 1UU5A 4QGMA 4URTA 2GN3A 1LOCA 4A7ZA 4AVSA 1US2A 2XOMA 3ZFEA 5JR2A 1E5SA 3FLPA 1LOFA 1PVC3 3NJVA 5EJ3A 4QX1A 3UETA 3GGLA 2BVVA 2W94A 3PJYA 1VRH3 3KD4A 1TMF2 1XNCA 5F3GA 1K3IA 3ACFA 5HV4A 5I0TA 4K6BA 1H4GA 1UAIA 1CWPA 2VTFA 3FBMA 5CVRA 5EQUA 4AQ6A 5FQ0B 3OD4A 3MO4A 2XUMA 5CIRA 1TQ5A 3AMHA 3AYAA 4N90A 1A8DA 1CAUB 3S5QA 4ATFA 3VN4A 1K5MA 4A6OA 2XHNA 3IWZA 4FFFA 1AR91 2VMCA 5FZOB 4LMFA 5G05L 3A22A 5C4WA 3AC0A 2G9GA 2VZPA 4XQDA 4QHBA 5CFDB 2Z42A 5LRRA 1RMU1 3WDVA 1CX4A 4ZHNA 1Y9QA 4HETA 3RJ2X 5JXHA 2A3XA 4LXLA 2OT7A 3LDRA 4Y1ZA 2Z69A 4JHZA 4A7KA 4FOWA 2J1RA 2Q1MA 3P6BA 3NJYA 3ZPYA 5C8WA 4LKFA 2RJLA 5GM0A 3DCQA 4Q4W3 1REFA 3N35A 3TOJA 1S2KA 3VBSA 1K45A 3WVJA 4BCUA 4CPBA 1ZBA2 2JKBA 2B9VA 3NNGA 4FTSA 3ZPOA 1OC1A 4F8AA 4UBHA 1WMDA 3WOGA 1S0GA 1WA6X 4QKBA 4DNYA 3B7MA 5A1LA 4XFBA 1HJFA 2JE9A 3H8OA 3H0OA 1ZNPA 3V0BB 1U5YA 4HLTA 3JU9A 1O5LA 1WCDJ 2R30A 3QBQA 3VDCA 4EE2A 5A6YA 2AREA 2D3RA 2W08A 5J98B 1LGNA 3T0AA 4CCMA 3VD4A 5APAA 1GYKA 3AMNA 4K20A 1S0FA 3OGJA 1NOVA 3MLJA 3I2KA 4DQAA 4XPVA 1KFUL 2BOJA 1PIV2 2GH8A 3BN6A 1YCIA 2UURA 3B69A 2ZMNA 4CCLA 4CCEA 1DYKA 5HXVA 2RM21 2VVFA 1RUI3 1XQNA 2AYHA 1PX4A 3ZKUA 4IXLA 4XDQA 1X8MA 1XC6A 3ETQA 3CU7A 1KD7A 1VB4A 4IV3A 4ZZ8A 3AP4A 1XOYA 3AB0A 1S0CA 2CGOA 3D0SA 4TXWA 2DYCA 3MW2A 3VZNA 4FOQA 1VBD1 4I0BA 2XQRA 1Y7BA 3TEZA 4YVSA 2UYAA 3D0JA 1U5ZA 1PM7A 1OKQA 2Z4FA 1AR82 3NW4A 4JGYA 2Y0OA 1JZ8A 1H1MA 3R05A 4AHWA 1W8ZA 2FDKA 4U2AA 1YNAA 3MV11 1BBT1 1UMIA 2ZHNA 4KWUA 5GLUA 3VBRB 3TB0A 3IKWA 1WWYA 4ATEA 1PGW1 4MGSA 1UYZA 2RR12 5D1IA 5D8AA 3MIGA 2RDRA 2EXIA 4FQZA 1D2QA 4XF1A 2WINB 3VBHA 2JB4A 1G8WA 1T6GC 3QH7A 1W8WA 2XBO3 3M3IA 3NNMA 3WP4A 3HT1A 1CVNA 3LAGA 1PK6C 2ES3A 3ZXLA 3WSOA 4CCNA 5GJ6A 1QQP3 4LHLA 3L2HA 1H2KA 4D6SA 2IZWA 1RUC1 2WLPA 2Q0AA 3GYDA 3VZMA 1BHGA 4QU2A 4QPYA 4Q27A 3KS7A 2VVEA 3MW4A 1V6NA 4INDA 2YV8A 3ILRA 4BHPA 4DUVA 2WZPP 5GKAC 2ET7A 3AYEA 4XUTA 1OPOA 2ZEXA 4LO7A 1DF0A 4TSVA 5DAWA 3DGTA 1V00A 4BK4A 1LESA 1IGOA 3G7DA 3FFQA 3E5XA 4Q0SA 3WP6A 2B46X 3OY8B 5DN2A 1J58A 3NJZA 2WAAA 3T1MA 3SKVA 4RQPC 4I30A 4QPIC 3IZOA 1JOPA 1OOPA 3T0BA 1AVBA 2A3WA 5GLZA 5GZCA 3AZXA 4PLOA 4XUOA 4IE0A 4QWNA 3USUA 1A34A 1RHI1 2NZ9A 1AXYA 4KWJA 4YW4A 2BERA 4COWA 4NIIA 3VD5A 5DUUA 1SLAA 2E51A 3PVOA 3N9MA 3SH5A 1LNSA 5JOZA 1MZ5A 4IL7A 3JZVA 5JSRA 2FDFA 3O7OA 1RUF3 1DDLA 2HWB3 5L36A 4RD7A 1W99A 3MIEA 4QKDA 3ZYJB 3PMEA 4YG6A 1OMIA 1W04A 1D4VB 2LALA 2JE7A 1APNA 3EXUA 3HQUA 5IJRA 2AGSA 3M7AA 1W6NB 2I45A 3MPBA 1IS4A 2RHPA 3BU7A 2QUOA 2P5BA 2ZTNA 2VZOA 3KVBA 4JGZB 5DZEA 1V6JA 3AVRA 2FCVA 4FP2A 5BNPA 2P4EA 3DKQA 3M8LA 2JDYA 3RDIA 1VJ2A 1ULEA 5H9PA 2H0BA 2E33A 2J22A 1QH7A 2HYKA 4A2UA 3ABZA 1AR93 5FJHA 3SCGA 3WHTA 3BGAA 5FMDA 2YXSA 2YZ4A 2WFF2 3ZFEB 5CFDC 2AACA 5FZAA 4E9KA 1NLRA 4AHZA 3LD8A 3POSA 1JZ3A 2B45X 4AG4A 3FFZA 2D3SA 4IGOA 2NP0A 4P9GA 2X29A 3TAYA 1HJGA 3X29B 3L2YA 2RR11 4XTMA 1HLCA 4XIOA 5HI0A 1W8HA 4LORA 5DAQA 1UU4A 1HQNA 1XE8A 3GBGA 2R49A 5C3OA 3DF0A 4IW3A 4B3NA 3VZOA 5BNOC 2VUJA 4XF4A 1PVC1 3K2OA 4Y1YA 1XE7A 2ZPXA 1FMD2 2A1XA 2UY8A 4M00A 4QB6A 3UV9A 3PVBB 2ARBA 4U36A 2WNUB 2Y6KA 4HMZA 3ZYBA 5KR7A 1JOBA 4AEMA 2R063 2QCSB 4FTEA 1WCQA 2DFBA 2TUNA 3OCPA 3WNKA 4R52A 4QU1A 1POV3 1G9DA 4QB2A 3SCFA 2BPA2 2DUQA 2ARAA 4MV2A 1MEC2 3U10A 3WQ1A 1DQ6A 1H2LA 4M0NA 2A6ZA 1AYM3 3PUAA 3TEXA 2R0HA 2Y26A 1HB2A 2ZHMA 4UFIA 5C3RA 1AX0A 1CJDA 2WNVC 2AEYA 5FY8A 1AR83 5IVEA 2O8QA 4KL1A 3TNQA 4A45A 2VZ1A 2DTYA 3RMXA 5I0RA 5E1RA 4AL9A 1REEA 1ZZ9A 1E5RA 2JIGA 2NLRA 3GHMA 4QM8A 4UW3A 5GLTA 4CEWB 3RZKA 1O8SA 1VBA3 4XDOA 2GNTA 2WO3A 1MS0A 2ZZQA 2OUJA 4A44A 4CU8A 3WNNA 5CKNA 4CZSA 4XJZA 1CZVA 2RJKA 2DVDA 2NMOA 2G9FA 3M4FA 4LOSA 1RINA 4RQPA 1PO13 4P02B 3NAPC 3ZMNA 1KQRA 1UOBA 5IFTA 3LIHA 2QQMA 4QQ2A 4TYSA 5C7GA 4GJZA 5F5AA 3SITA 3WY6A 4Z8BA 5CFCB 3PTYA 1EUUA 3AFKA 2R1DA 4AQ2A 3HBZA 4XFAA 2XWBB 4E2SA 4GMP1 4K8RB 5C70A 4MVTA 2DUPA 4AHYA 1JZ4A 1HIXA 3KHCA 2SBAA 3JB4C 4MZUA 2D5HA 3OYWB 4BE3A 3S7EA 3ZYPA 4LT5A 5HCAA 2HEWF 2HWE2 4RS5B 3DPRA 1DLCA 3H8UA 4AF9A 4I3PA 5DZFA 1DGWX 4OHXA 2WLQA 1W9TA 1NCQA 2CGNA 4S2HA 4UWDA 1UCXA 1QDCA 2YG0A 1XJAA 4LITA 3CL1A 4LUKA 1E5IA 4AOCA 4AGRA 1J1TA 1BBT3 2VW2A 3ZFFB 2JDMA 2UWAA 4O9EA 2GP5A 5DQ0A 4FBFA 1OFSA 1YI7A 1ZA4A 4QPIA 3VL8A 1D4M2 2MNGA 2O8OA 4OCTA 5IVJA 1QXRA 2CAVA 1GWMA 1F8VA 1AYN3 3ATGA 2TEPA 2VECA 4META 1YWKA 3VKLA 4WM7C 4E4ZA 1QOOA 2XVKA 3CBNA 1J3RA 4UYBA 4ZS2A 3GBWA 5K8SA 2ATFA 3IT8A 5IVBA 1R081 2ADEA 3GJAA 4MADA 2WO7A 1J59A 2HLEA 1Y9MA 1RUH2 4ES8A 2R072 5DAPA 4DRVA 3J8F1 1UZVA 2LW8A 4XUPA 2YUEA 2ZCWA 1ZVFA 4HSLA 3RQ0A 1RUG3 2DVBA 1KGYA 1OT5A 2JDHA 2W1WA 3WW2A 4CDXA 1YJLA 3CJXA 2VQTA 4PIZA 5T5OA 2VE1A 2OW4A 4ITCA 5F5IA 1C3HA 3WDTA 3HT2A 4K9SA 2VUAA 1NA1B 2WIIB 2K46A 3B94A 2YBKA 2R071 1J83A 3HMYA 1HQWA 4S2DA 5F1RA 3WZ1A 1MQTA 4IE4A 2BNOA 2B8MA 2PHXA 1QY4A 1MZ6A 5LK5A 1SLTA 4A42A 1UX6A 2GMPA 4IEOA 5BPXA 5A80A 3BYWA 2Q8DA 3O1SA 1UY4A 2GP3A 4PDWC 4EV0A 2W52A 4SLIA 2AR6A 5IK4A 3HNYM 1UW8A 1V0AA 1TG7A 2E53A 2VBPA 2VCMA 3PIGA 2JDAA 1SMVA 2JEMA 1N1YA 5LY1A 4COVA 2OQ7A 1OD5A 5DABA 2JXAA 3VD7A 2EIEA 1IKPA 1CIYA 1Q8PA 2VZVA 4JKKA 4JRAA 5FLIA 2YC4A 4WVWA 4CUCA 3LB9A 2J1TA 4EWEA 5LB6A 1QHDA 3BTXA 5C8CB 1LHUA 1O8PA 2VCBA 1RMU3 1IQDC 1QMJA 1SPPA 1UYPA 3PUSA 1POQA 4JKMA 2ZGOA 5EP9A 5E16A 5T3NA 4GXLA 2J1EA 5LA9A 3UNPA 1UL9A 4GMP3 3SQOA 5CG9A 3WR0A 4OI4A 2HWD2 4BLIA 4O65A 2PLV2 3WEZA 4YFZA 3BUCA 1OBNA 3JB8A 5I8SA 3FC0A 2A70A 3WW1A 4AQSA 1IPJA 4XZUG 1Z78A 1NXMA 4MXWA 4JZRA 1ULOA 1UYYA 4HKOA 1YYNA 1LU1A 3LSDA 4J1XA 1EV12 1HN0A 4NE9A 1CR7A 1CPMA 4D6QA 4PIXA 2XJSA 5FP7A 4QGNA 5FYCA 3O1TA 5JMCA 3VDBA 2A73B 1BEV1 4Y5Z0 3J7HA 3URFA 1A8MA 5JOXA 1U5IA 4OLLA 1CAWB 3IPVA 1NYWA 2WT1A 1LRHA 3AZYA 5GLWA 1FOD3 1HRV2 4LKEA 3JBG3 4NMIA 2DCJA 2WA3A 4XMIA 1OOPB 3W5MA 3DECA 2ZA9A 1CAVB 4CDUA 4LKSA 1H8TA 1LOEA 3POJA 1W2OA 3U75A 3OUHA 5FKBA 1OFNA 1OOPC 1K12A 5FUPA 1R082 1GR3A 2XQXA 1DP0A 2EICA 2EVXA 4IE6A 5FZ1A 4P00B 2GC2A 2A6YA 5FYIA 4QPWA 2KA3A 1PZ8A 1COV2 3UT0A 1AR63 4Q4V1 4MHUA 3N7JA 2VW0A 4QPGA 4AI9A 4EN9B 2G1MA 2G9ZA 4AEDA 1N1TA 4HG6B 3ZDVA 3FX3A 1C8M1 4M4PA 1EAH3 4ZY9A 1WLWA 3PVNA 5HPOA 3FBYA 4QDRA 2NYYA 3A4UA 5FXZA 5LEJA 1GQGA 2VNOA 4GULA 1FI2A 1X9TA 1Q8QA 1ZZBA 3CEWA 5BXXA 4XFIA 3N4MA 3HQXA 1D4M1 1AL21 1UZYA 1HN1A 2GMMA 2VC9A 4HVQA 1R1A1 1KS4A 1BVP1 4QQLA 1T6BX 2R061 5I0SA 5LBFA 2BBAA 5FO9B 1R083 4NAMA 3VDAA 5K0UA 4NRQA 1F5FA 1W0OA 5FWEA 3KGZA 5FYTA 3AX4A 3KCXA 4I09A 3HOBA 5IVCA 1BZWA 4P14A 1K5MC 2HWE1 1WLTA 3NL1A 1WW6A 4FAHA 1RUC3 1NCQC 4IETA 4CP1A 3AKQA 4MXWB 4Q4Y3 3ZYHA 3KB5A 4DXSA 1O5UA 3A21A 3HJRA 2VZ3A 4EN0A 4XXPA 4KWLA 4AEKA 4HKLA 1QQP1 4IV1B 3VHRA 5FZ3A 3ZSMA 2BU9A 2R6QA 1JN2P 1W2AX 4RYDA 2PA7A 1OD3A 2UY9A 1ZZCA 1T2XA 2ZEYA 3UKTA 1RUJ2 2V4AA 2JKXA 1HV0A 3GZTB 4XBLA 4AWDA 2VL4A 4PBPA 4NHXA 2FDGA 1GICA 2CYFA 4CEYC 3MYXA 4QX5A 4YVWC 2DU0A 3EB7A 4HL0A 1RJ8A 4COZA 3DN7A 3MLLA 1MS1A 1LHVA 4KU7A 2W95A 3MF9A 3WDWA 5FR3A 1YQ5A 4PLMA 2PN5A 3Q8CA 3H1MA 1FOD2 1HRV3 1VBD3 1ZRIA 1AUYA 1ZRRA 2D6LX 2QBXA 4KU8A 4RS5C 5C3PA 5HBAA 1GZCA 3O12A 1V6KA 1LEDA 3AZWA 3R4SA 4QKFA 4UT5A 5C71A 5D21A 4GMP0 5EV7A 4R4XA 3S57A 5DUWA 1SQ4A 4XF3A 3APBA 3DYMA 4UFLA 3TN91 5FDBA 1AXZA 1R1A3 1QOTA 2JENA 2LRPA 2WT0A 3FL7A 5LA2A 1H1AA 5BNNC 1AJOA 2ARXA 4FFIA 3RZZA 1H1IA 2WS93 1N3QA 3C2UA 1C57A 2YFZA 3Q8FA 4NVPA 5IUQA 2QQWA 3VBHC 2DV9A 1S0DA 1RHI3 3ZX7A 2GMEA 1GSLA 4L0PA 4XC9A 4DB5A 4XACA 1K42A 4HSJA 3CO2A 3LOIA 4OZXA 4ZONA 3IPVB 3AYDA 4CEYB 4BQ5A 2VAUA 2W39A 3IMNA 4LK6A 1CONA 1EAH1 1GNHA 4Z2WA 5T55A 2OZ6A 5H9QA 3CKHA 2F4PA 1NKGA 2Y8KA 4YGCA 4K3UA 4TN7A 4S2FA 4QGLA 5CZKA 4AVAA 2ID4A 3ZIWA 3LPFA 4CCCA 1XB9A 2PAEA 4FT8A 2VZQA 4O9GA 1NQJA 2BJSA 3D8CA 4LNVA 1W6QA 3JD71 1VMHA 5HXMA 3TBDA 4NHLA 2VBBA 1YQCA 2YFUA 2WA4A 4LBJA 1LR5A 1ENQA 2IXHA 3GALA 5L9VA 4BXSV 2LTNA 5JIUA 1IS5A 5ISLA 5DMYA 1R093 2WYSA 3OEBA 2VQAA 5BY5A 5C33A 3IDCB 3JD72 2XONA 2VH9A 1DGLA 1PGW2 1J3QA 1PMIA 2YC0A 1RUD1 2I07B 3KWVA 1D0GA 3M3CA 5C9AA 1VAKA 4GWMA 4X6QB 2IVJA 1H8TB 4OHYA 2QQOA 1US3A 2DFCA 1CAXB 5F2WA 5FPBA 3VHOA 4DO0A 2D6MA 5FQ0A 3W5NA 2IXJA 4B1MA 2VZUA 4QKNA 5DZGA 4LULA 4ONUA 1STMA 3LEIA 1AXKA 2VUDA 5A7NA 3VBFC 2Y6GA 5JWPA 3TEYA 1RTVA 2WAOA 3NV2A 4HPKA 1LKNA 2H6CA 2ZGQA 2RDNA 4BQ1A 2DVAA 1W3XA 1RUG2 3WF2A 2E7QA 3PDQA 4IEUA 5KXCA 2PHFA 5FOBB 1JYWA 4JQRA 1RGSA 4MGIE 2N7GA 4OQ8A 1XNKA 3NNFA 4OI0A 1PMJX 2HWE3 4MX3A 2V5YA 5JZGA 5IAXA 3OYWA 5F32A 2Q4SA 2Y38A 4AYUA 2BWAA 2VU9A 1AF9A 1TVGA 1VRH1 3AP9A 3RYPA 1SCRA 4LE4A 4NOTA 1IPSA 4FPFA 3V0AB 1PNFA 1NY71 3T2OA 3AJZA 1PMHX 4YZ4A 4IEZA 1GWLA 4H7LA 4EJRA 2CWMA 1WW5A 5J48A 4AI2A 1D4M3 2EIGA 2A6XA 2HWC1 2RMU1 3Q8EA 2QZ2A 4JGZC 4COYA 1DQ4A 1OLME 3NNLA 5FYZA 5JR7B 1NZCA 4NUBA 3PU8A 3S7IA 4UFHA 4UFJA 3ZN4A 4TLFA 5A3OA 3I54A 3K75B 3S6PA 3SCHA 4Z1VA 4IEYA 1NCRA 2VMFA 1ND2A 2X5IA 2W87A 1FT9A 1HB4A 3VV1A 4D6RA 5A6ZA 1Q5OA 4B29A 5KHGA 4OFGA 4P9YA 2JECA 1TME3 1VBB2 1ZYBA 5A32A 5FREA 3LFMA 1EPWA 1H2MA 4JDOA 1F15A 1MVEA 5AVAA 4BH9A 3VKMA 4CXWA 5EJZB 3RI9A 5GALA 3USUB 5FXXA 4K1ZA 3VLBB 4CDQA 4DINB 4EWDA 1AR81 1SDDB 3BODA 3KF5A 3RZHA 1PHMA 1CZTA 2WC2A 1I9RA 4QB1A 1NUKA 4Q4W1 5K0UC 5I91A 4AI0A 1S1AA 1Y4WA 1BCXA 2WDBA 4URAA 2YU2A 1OLRA 4GWJA 5J7MA 2WZEA 2MEV1 2R062 2ZMKA 2V09A 2ORZA 3K77A 3KCCA 4RQPB 1FAYA 2W1UA 4XJUA 5FZ7A 3UL2A 4B1LA 4BIOA 2CNAA 3ACIA 1MS8A 3ZR5A 1O4YA 4H2AA 4NHKA 2JG8C 3FJSA 4IDZA 3WW4A 4RL7A 3NAPA 1VBE3 2WWJA 2GH2A 4PDWB 1O6UA 1H30A 4FP3A 3SXWA 5IFPA 1E57A 3KT1A 2HEVF 3H8XA 2R32A 2W47A 3HN1A 3CZJA 3P5BA 2Y6HA 4LEJA 2LS6A 4DMIA 1YFYA 2BBVA 1XBFA 2X53S 4LR4A 5A1AA 3Q8AA 3ZFGA 4DXTA 1GOFA 1I5PA 4WM7A 5JUVA 1VBE2 3KV4A 4Q4V2 3IDEA 4QPIB 4UF0B 4A6SA 4FFHA 3BALA 2JICA 2ZXQA 4IEPA 5BYNA 1JYXA 1QXPA 2DDUA 1IOAA 1C8NA 4CCDA 2R0FA 5FZ6A 2I2SA 4CCKA 4MOAA 5H9SA 5IVYA 4C0HA 4H14A 2UYBA 3LGRA 2RG4A 1QJU2 3SEPA 3VBRC 2D7FA 4Z82A 4DXZA 1H6XA 3M3EA 3POIA 1WLCA 1RITA 2W68A 5L9RA 1F9KA 2FMDA 3GCWA 1OUXA 3R4DB 4DXRA 4MXVA 3G6JB 4BPZA 5J96B 3LCPA 1UNBA 3H42B 5E88A 4ES9A 4IUGA 3MPPG 1VBB3 4WZCA 5JI9A 1WW7A 2C5DA 2DF7A 3KM5A 3O1OA 5B4XA 2XH6A 5FKCA 4LPLA 1VBC2 5CFCA 2XUEA 1I3HA 2F17A 5GZFA 1NCRB 1PO23 3ON7A 1AR92 1SACA 1DQ0A 3N9QA 2ZZJA 2WNOA 1LCLA 1CN1A 1GFF2 4LHSA 1NT0A 1QJY1 4K1YA 1Q43A 1KEXA 1SFYA 1WD4A 4R9CA 2D44A 4ASKA 2JE8A 1NG0A 5A32B 4IEQA 2ZMLA 5C6CA 4LKDA 1QWRA 2W91A 3I59B 5FPAA 5K4LA 1O4ZA 4D7YA 1GQPA 1C4RA 1PGSA 4FPHA 4EN7B 2ENRA 3H3LA 5L9BA 3S5AA 1CQ9A 5FYSA 1PO22 4LBQD 3K51A 3WDXA 5CFCC 1JU4A 2CWSA 2ZAHA 1KJRA 1VBC1 5FZIA 1URXA 2Q1ZB 5BNPB 4HVRA 4BB3A 2IC1A 3A0KA 3KT4A 1SDWA 5IW0A 1W9SA 3CF6E 3JQXA 3NWKA 5J36A 3AKSA 2W92A 2HWF1 2K2SA 2HYXA 1VE0A 1JYVA 5JVVA 3WT3A 2BV4A 2NM1A 1X9PA 5A3TA 1Q8OA 5FY5A 4YGEA 5FMOS 2IXKA 3MUZ1 1RUNA 3UJQA 1QJU3 3HBKA 3UGHA 3W20A 2Y6FA 4JGYB 1NQDA 1W2UA 2CGPA 1SZBA 1BVVA 1NE6A 1SLIA 5ABJB 1CAXA 1LHOA 4YZ3A 2XBO2 1TNRA 2YY1A 3LDBA 5C9AB 5FK7A 5C5UA 4EZHA 2C9KA 1OA2A 2VMGA 2D97A 5LASA 3OSDA 5JSOA 3IMMA 3NKGA 5JXGA 3ZSEA 1NE4A 3BU0A 3TYJA 4AR2A 1AZDA 4UW5A 3ZKYA 2VMHA 4AXOA 2VMEA 2I74A 5L73A 4JRLA 1L7RA 3J8F2 1ENRA 1VBE1 2R041 4YFWA 4BQ4A 2EIDA 1UF2C 4YGBA 1TNFA 3WQBA 3BPZA 4C91A 3VZLA 3I3QA 4NIDA 3IB3A 1M06G 5DUXA 5TSWA 1LENA 4K21A 2BQPA 3PJQA 1W9WA 5FMOL 4CCOA 3N9LA 1WZXA 4IE7A 1PGL1 1UX7A 1BLZA 2WN3A 1FX5A 1OXCA 3KCYA 4LTAA 1HXS1 3BTAA 2XWJB 4B7EA 4NWVA 3O1VA 2QQVA 2CV6A 5JPMB 2Z5WA 1XNTA 5LWBA 2OXBA 1DLLA 2QQLA 2D40A 4LO5B 3O1MA 1PK6A 2ZHKA 4KG8A 1F2NA 2ZX4A 3NMBA 3C7EA 4GB32 3V65A 3BOPA 1PO21 4IERA 4LLOA 2V5DA 3MLKA 4XHBA 1ZRFA 2R1BA 2ILMA 3AK0A 3FZ3A 4I3GA 1GLHA 2VULA 4RGKA 3AXDA 4YRDA 2JDUA 4RN5A 2PELA 2DBNA 1TME2 1HXS3 2AH2A 1WCUA 2W2IA 1G9FA 2PHLA 4HN1A 4XFCA 1VBB1 4ZZ5A 3UGGA 3OTFA 1PVXA 4OUEA 4W4ZA 4TTGA 1WCKA 5LY2A 2PAMA 4MH0E 4QHZA 4BK5A 3AFGA 3N9PA 2WL1A 1BXHA 5FP3A 3LPGA 2D6NA 1Q56A 4OUSA 4BOWA 1REDA 3ZSJA 3B5LB 4UW6A 3I8TA 3JXSA 4Q4W2 5KHKA 3AKPA 1I6XA 3PIJA 1W6OA 3WF0A 2PFWA 3D4KA 1TEIA 4DFSA 2WO2A 1DG6A 4QPGC 3POGA 2E31A 5IYYA 5JXIA 3I3DA 5F9TA 1JHJA 3ASIA 4PI0A 2O0OA 3VDDB 1W3VA 1OURA 1YUDA 3AJYA 3OEAA 3ZVXA 3RZJA 3B01A 3H3ZA 5CAZA 1SEFA 2RDQA 3FN9A 3PLQA 5BNNA 5A3PA 2A75A 4YZ1A 1HB3A 1FPN2 2QFEA 4XFGA 4IEXA 4IV1A 1QJU1 3CQOA 3FE5A 2SLIA 3IM0A 4M3CB 2EA7A 2BNMA 2VXJA 4FTBA 4L11A 4TLGA 3OOXA 4EZ4A 2P37A 2PHTA 2QDRA 4L9BA 3B3QE 5DXDA 4OHZA 4R8HA 3UK9A 2CSGA 1C5IA 3ZM8A 5JPNB 1YQ8A 5ACA1 4E8DA 1QH6A 1UQXA 3MFCA 1MEC1 1VAVA 5FWJA 4AEDB 3DEMA 3AL6A 5KHHA 1MZEA 3ZYIB 2ZKLA 3LA7A 3N7KA 2DTWA 3K3NA 4TWTA 5A6QA 4AI1A 2ZKNA 5CADA 1NY72 2H0VA 3DUIA 1Z0HA 4QX0A 4CDXB 2RS53 2P3KA 2P17A 2YPJA 2YGLA 4OHWA 4NR1A 1GV9A 1MQTC 1PVC2 3RS6A 1XRUA 1FMD1 4IGPA 4WVVA 3TWIA 2ZS6B 3LE0A 4FCAA 2DCTA 1DZRA 4QX7A 1W8UA 3ZFFC 2B5HA 2VVDA 2F6BA 3JD73 4HOOA 3WF1A 1S2EA 3VBSB 5FTTC 3NVCA 4W50A 2HWB1 5F3IA 2QNKA 5JI7A 1LGBA 1NA1A 4XQWA 2CAUA 1PK6B 4Q8LA 2QQPA 3W59A 3OD0A 3WG2A 3WNOA 5EZWA 4JVAA 4B4RA 1AL23 1SFPA 2XB6C 5DAVA 2MEV2 2E26A 2VCCA 1RC6A 3POYA 3L9JT 4OULA 1W0NA 4JC1A 1QNWA 5EXOA 5LRSA 3H7JA 2WNVB 5FZMA 1IKQA 2X10A 5FXWA 5GLVA 5HCFA 2VNRA 5CKMA 4XTPA 2RJ2A 3P1IA 5F6LB 1YEWA 2ZOEB 5IK5A 1PNGA 2VO5A 2IXCA 4N53B 4YSFA 4PDWA 3THDA 2TNFA 3NAPB 2HWD3 2EIBA 1ENXA 3UKNA 5LK7B 3V64A 4COUA 1IZ3A 1OLQA 1GNZA 3EHKA 4YVWB 4ARXA 1ND2C 2HBUA 2X5IC 5KC6A 4QQHA 3THTA 2C6SA 2QQIA 4NPLA 5C8CA 4GA9A 1G9AA 5FP8A 5IK7A 2JD9A 2WQ8A 4CRQA 4S2GA 3PNAA 1GUIA 1JMUB 1DIWA 1JW6A 1UIJA 4BM8A 1UZ0A 2ERFA 2Y6JA 4YM1A 4ZXEA 2Z79A 5A7WB 2JD4A 5FXVA 1CPNA 4FFGA 1G6NA 1WKYA 3MZHA 4G9SB 3ILNA 2YROA 2DU1A 4GD4A 4CCJA 1WBFA 2DURA 1UOJA 4X8NA 5JDBA 1MACA 5A7SA 4Q0UA 5A70A 4AW7A 4LA3A 1ONAA 5FPLA 3ZFEC 2WYFA 4IV3C 5C9AC 4HANA 5G04L 5T52A 2VBDA 3AM2A 1OVPA 4XW3A 1NX9A 1Q8VA 1H0BA 1UU6A 5AC91 1HQLA 2WWUA 4FAGA 4WZFA 1F4AA 3GCXA 4JDMA 3POBA 4JHTA 3FWEA 3VDDC 4CP9A 1R091 5FV3A 1W6MB 3LEGA 3WHUA 2MEV3 1GZWB 2VOKA 2XL7A 3LIGA 4D7SA 4ORFA 4YW6A 1YFXA 2VOXA 1FPN1 1C5HA 3WXPA 4YM2A 3V0AA 5FP4A 4KH9A 3DPRC 1OH4A 4KWKA 1WMEA 3ZMOA 4BQ3A 2NN8A 4MG2A 3B9CA 2BOIA 2PAKA 1RUC2 2D93A 5F2SA 4GKYA 2XR4A 1JU3A 2EXHA 3M3OA 3MICA 4LIUA 2OPKA 2W1SA 4C8DA 4A4AA 3BTZA 4XHXA 2XGXA 4CP9B 4UOJA 3ST7A 1TME1 2Q5TA 1RUF1 4LIVA 2D5FA 2FDHA 4JTOA 5LEKA 1R1ZA 3HR9A 5FBZA 3WUDA 1V9U3 2DVFA 5L7OC 1GP4A 3I59A 2YDEA 3VGIA 2A6WA 3DL3A 4AI8A 4P5YA 4XJAA 2WR9A 4P5HA 4PCRA 1OQEA 2ZX2A 2CDPA 4PIYA 3ZSKA 3N7LA 1BBT2 3GHNA 5E6HA 1EP0A 2JG9B 3UYJA 3P3NA 5FY9A 4Y24A 3ETPA 4QXCA 4AEJA 2IXIA 2J1UA 3HN3A 2XPJA 2XJQA 3H1YA 2R073 4DRRA 1LAJA 1JHNA 3K4ZA 4JAAA 1EAH2 4W65A 5T5JA 3SLIA 1XNAA 3DPRB 3MIHA 5IATA 5FZ8A 3ZLIA 3A0NA 4Q4X1 1V6OA 1W8NA 1FPN3 4QXKA 3ZO0B 2JX9A 4GB31 1W2TA 3SC7X 2F4LA 1DBNA 3IDBB 2FCUA 1CGPA 4LBKA 1AR62 1QU0A 4MGQA 1GP5A 1H2NA 4N43C 2QQNA 2P3YA 1AYN2 4MGZE 4JGZA 4O7XA 1W6QB 3M2MA 4I0AA 4HK9A 4D69A 2D6PA 1VALA 2K9ZA 5F37A 5FMCA 4OQ9A 1GOGA 1XYPA 2JDKA 2XMLA 5A3LA 4B7KA 2C26A 1PGL2 1NXD1 1OKOA 4DEVA 3HWJA 5FZ9A 4Q26A 4XJWA 1YQ6A 3WX5A 3AZZA 3KF3A 1DU3D 2XBO1 1ZRDA 2BZDA 4N53C 5FPZA 1VR3A 3UGFA 3F95A 3H50A 5BV6A 3HEIA 5F3EA 3FUQA 3RZGA 4N7UA 3IBMA 4KI5M 2D98A 2GC1A 4N9IA 4K7JA 4ET7A 4BWOA 4LJHA 1LU2A 1YRZA 1COV1 2OS2A 1SG3A 1AL0G 1L7QA 5FUNA 1MR5A 1UYXA 1HRI2 4BQWA 2BEOA 3PHMA 1W03A 1PO11 3VZKA 2A6VA 1DCSA 3EBRA 5DDJ3 4Q0PA 4UI9L 3ZFGC 3OJBA 2ZGMA 5CNAA 4DUXA 3VBSC 2CDOA 5FJKA 1ALYA 4XETA 3SH3A 2QVSB 5T5PA 4UFMA 4QQOA 1ZREA 3N9NA 3NKTA 4YG3A 3PL0A 3ZN5A 1GU3A 1YC61 4Y5SA 1VBA2 1S0IA 2PQQA 1RMU2 1KXGA 3J4UH 4CTEA 4PQ9A 4Y20B 5EJ1B 3T30A 4LBQA 2VZTA 3AP5A 1GOHA 3MFAA 4V1PA 3P3PA 5FPUA 3RJRA 1AYM1 1C28A 4G3YC 1JZ2A 4FOVA 3MI8A 2WUHA 5KWRA 5IK8A 2J1VA 3DKWA 3FHAA 4N43B 4L2NA 1AYM2 4YM3A 5B2GB 4JTNA 5D8AC 4AFDA 1UPSA 4QX2A 4YW1A 2C4XA 1BMV2 1YI9A 2VZRA 4N9HA 5LBCA 4MLOA 1WMFA 2PLV1 4W6XA 4QMAA 1QJX2 1BJQA 5EHDA 5FP9A 5FPVA 3CIHA 5IWFA 1KITA 4EYUA 1O3QA 1GP6A 4HBNA 2EXKA 3Q9OA 1ULGA 2VW1A 1Z7S3 3NV1A 1GANA 1C1FA 3PURA 3OGRA 4ISRA 3WP5A 4V2WA 3SNMA 4SBVA 2VQ0A 1FMD3 1XE0A 4XBQA 3T4VA 1BK1A 5CEHA 5I93A 4NIGA 3VB9A 4NIAA 1S0EA 1VPHA 3J26N 5K0UB 4RR3A 4F83A 5J1XA 3D3AA 2IFWA 3U4XA 4AEDC 2GALA 5KXDA 1YLLA 2NQYA 3I2HA 2AEZA 3TNPB 4C1XA 1NAEA 4FPGA 2XJRA 5ANNA 5LBEA 3AMMA 3MIFA 3U4SA 3W58A 2XVLA 4X8PA 4MSVA 1RUH3 4HZFA 4OVEA 1LECA 3M3QA 4LHKA 3TEWA 1JUHA 3QLQA 2P3JA 5FZ0A 1RUH1 3QD6A 2P2KA 4JKLA 2GNMA 2DWRA 2BTVC 2RS11 3B93A 5DG2A 3E6BA 4CDUC 3D82A 1UXXX 4CUAA 4RFT0 2E7TA 2WT2A 5DDJ2 4Q1PA 4E4HA 4MUVA 1ZRCA 1F35A 2XLAA 1VRBA 1A6CA 4ZU5A 1JZ7A 1SLLA 4LE3A 5JSPA 4QDSA 4CU9A 4IGQA 4WBBA 3T08A 4BQXA 2VY0A 3UKVA 3WD5A 4AAPA 2BDRA 4XYXA 2WNEA 2P1BA 2PMWB 4Q0QA 3OGGA 1F4HA 4YW2A 4Y1XA 1UD1A 4KGQA 5F5CA 5IVVA 4R9BA 1RUE1 4WVZA 3IAQA 3K4DA 1EV11 2WQ4A 3VBOB 3ME2A 3B02A 1YJKA 3OY8A 4B4PA 3O1RA 1Y3TA 1UOGA 1EUTA 1VBC3 4R9AA 1WD3A 5M0TA 3OPZA 4UXAA 3LF7A 1QEXA 5EYXA 5F8PA 1JS9A 2D3PA 2VXRA 1N3OA 3D6EA 4GH4A 2QE3A 2GNBA 3MIBA 4FXKB 2ZX1A 1FATA 4ZPIA 1G9BA 4MO3M 1BMV1 1GZWA 2E6VA 1H9WA 2W5FA 3AKTA 3BPSA 4H55A 4FPOB 1JUIA 3V0BA 1ASJ2 4YM0A 1CX1A 2QKDA 1S2BA 2EXJA 3C3VA 1S4CA 4XUQA 3ZDSA 1BK0A 1VP6A 3CDZB 3E6DA 3R6SA 3AKRA 5L7OB 1CZSA 3PMSA 1PO12 4J6GA 4BLJA 4CYDA 4Y4RA 2PXJA 1AR72 1NCRC 3OBTA 2OUHA 1W9YA 2PYTA 4YPJA 3UJOA 4OI2A 2RS33 4XFFA 3ALQA 3JCIA 2JDZA 4Q4V3 1MS9A 3VBOC 3WV6A 3ZIXA 1BKZA 1IG0A 2QQUA 2Q30A 4Y26A 1MVQA 3OBRA 4A3ZA 1BQPA 1E5HA 1N3PA 5BNQA 1XXNA 4AGVA 2VMIA 4X6RB 3PUQA 2BRTA 5FY4A 4YG0A 4BXFA 4CDWB 2RS51 1W8TA 4ARYA 1SLCA 1H9PA 1ZZ7A 2PHRA 3N3HA 2YHJA 1WGPA 3ZXKA 1MEC3 1UY2A 4YVSB 2YPDA 2WZ8A 5FZDA 2P3IA 4W8JA 5FYHA 2QJVA 1WCSA 3EYPA 2A5ZA 3O0VA 1DQ5A 3OUIA 3USSA 4CDWA 1H4HA 4IV3B 1AYN1 5FO7B 4ISQA 1CAUA 2IUWA 1JODA 4OMDA 5LBBA 1CESA 5C3SA 1QOSA 3QACA 1FXZA 3FMGA 3U0ZA 5FUIA 1ZA7A 1LEMA 1WLDA 1ND3A 2RR13 4QX3A 5LZ6A 3H1WA 1U0AA 4WM8A 4ZU4A 2FBEA 2RE9A 4NPMA 2Y60A 4D3WA 3VBRA 2FCTA 1ND3C 1XYNA 1AHSA 4Q4Y1 1N47A 4LQRA 4ZS3A 4I02A 2WBKA 3RYKA 3T2QA 3VBUB 1CD3G 3DXTA 5KC5A 1V6MA 3VBFB 1LJ7A 5DUVA 1ENSA 1QXJA 2PHDA 3ZXEA 3H3UA 2EAAA 1F31A 3J9SA 3RGBA 2ZGTA 1LTEA 2RM23 3H7YA 3MDPA 3VHNA 2NMNA 2HH9A 4GH4B 1O3RA 2JDPA 4UAPA 3A7QA 3RMYA 3ZXFA 4BQYA 1RUI2 1XNDA 5JLVA 3ZSLA 3HQRA 1UKGA 3NV4A 3QH6A 1TZOA 3H8RA 1PIV3 2FQPA 5CYYA 2B39A 1NLSA 2FHRA 2WABA 3PTRB 3U14A 2Y34A 4CVUA 3I2OA 1RVF2 3MIDA 5FFOC 4D8MA 4GWNA 2WS91 3RG0A 1YFUA 3C7HA 4LBQB 1XYOA 1K5JA 5F6KA 3V56A 3O5SA 3VKOA 4ZKTB 3BB6A 4QPGB 2BGPA 5JMOA 5KBFA 1WMXA 1VB2A 4XUNA 1EPZA 3KVAA 3ECQA 3WG3A 1W6OB 5AC92 1RUF2 5I0UA 1SPPB 3OUJA 3PUIA 2XL9A 1OVSA 1ZZ8A 2RDSA 2BFUL 2E9QA 2V73A 4FPYA 2K0GA 2WRAA 1B35A 1W0PA 5DAXA 3BCWA 4H7MA 3LA2A 3WW3A 4XABA 4NRPA 3O14A 4B8EA 4NWWA 4D7TA 4GIQA 5E8AA 1QNYA 4LO8A 1FV2A 2DBIA 1TMF3 4UFKA 3KQRA 3VDDA 1VRH2 3OBAA 3VZJA 1J1LA 1FNYA 3UESA 1RUE3 5A33B 3I49A 4AQTA 1JZ5A 2J7MA 5DG1A 1XSQA 4L99A 2GN7A 2WJSA 5A7QA 2VG9A 4Y5TA 3K46A 1GBGA 3R0RA 1BEV3 5A7OA 1DZTA 5A3MA 4Y1VA 4FSJA 3U07A 4LA2A 1Y43B 3TN92 1UZZA 5FLJA 2FDIA 3POEA 3U11A 5FZBA 3VD3A 4BMBA 2XXZA 4C0BA 1MPXA 5AVPA 4AK3A 3T2PA 4P9IA 1LHWA 1DQ2A 1SCSA 2X8KA 2ZX0A 1RIRA 3KV9A 2RS52 4KGGA 3J7LA 4LUMA 4QDQA 5FLHA 3SMHA 5I0DA 5FZHA 5EWSA 3ZYFA 4CDQC 2RS13 5HV0A 4AVBA 1RVF1 1SLBA 1QQP2
chains in the Genus database with same CATH topology
2HJIA 1KDKA 5I8YA 3GZAA 2KM2A 4M3CE 5C4WB 5CB7A 1I1EA 4K8FA 3E5QA 1YO8A 2WKKA 1AR71 4Y20A 3POWA 2JG8A 2LUWA 3ENRA 4XIKA 2TBVA 5FAXA 3N7MA 2WS92 4XF0A 3AMQA 3NSTA 4LBOA 4LBMA 1R1A2 1JH5A 3T2TA 5ABJC 1FYUA 3E97A 2ZGKA 2DCYA 4JGYC 5GZDA 5BNOA 3S0MA 5ABJA 1XU2A 4RGAA 1DFQA 1OA3A 4CDQB 3KSCA 1N1SA 1KRIA 1IQAA 1VBD2 1DGRA 1LOGA 1LGCA 5K7PA 1FNZA 3MEPA 2ZX3A 5EYYA 1VIWB 1S0BA 3RSJA 2B9UA 2RM22 4L8QA 3LZZA 2XJUA 4DY5A 1POV0 4AE2A 3ROUA 3B9IA 4CDXC 1HXS2 4RR3B 3EJKA 3ZXDA 4Y22A 1DGWA 3THPA 4ZU7A 5BNPC 3GNEA 1V70A 1A3KA 1PZ7A 1S0JA 2C1FA 1QDOA 1HX6A 4XF9A 2GSYA 4PF5A 4WV8A 1F5JA 2PTMA 4QM9A 1LHNA 2WSUA 1U5XA 5KXBA 4G4FA 4LLFA 1ZBA3 2CL2A 1S55A 1LB2A 4E4SA 4M01A 1O3SA 4D94A 3FLTA 2D43A 1JXNA 2OA2A 1SBEA 2ZGPA 4IQPA 2XJVA 2E63A 2XJTA 4DOUA 4RGGA 1YIPA 4Q8KA 2A7AA 4YARA 2GC3A 4KQ7A 1ND3B 1ULCA 2BFUS 2VNGA 3EO6A 2ETEA 1QJX1 4H3WA 5JZGB 2AENA 4NPRA 1UPIA 2UWCA 4BA6A 4BMEA 2FZ1A 4UW4A 4W6YA 2VOVA 1VAMA 2JG8B 1BEV2 1ZBA1 5JIAA 2RS32 1C1LA 3SHRA 3WQ0A 4FPLA 4L92A 3AMPA 1N1VA 5CA6A 1XNBA 2BYVE 1RUE2 3CJIC 3ELNA 2ZACA 1AJKA 1ULDA 3KT7A 1Z7S1 1ASJ1 1KS5A 4WM7B 2HWD1 1VBA1 3ZFGB 4A7YA 5J37A 2GNDA 2ZGUA 4K40A 2D6OX 3ZN6B 4IESA 2B7YA 4YNIA 1DYPA 3WLUA 5J09A 3WNXA 1C8M2 3JBG2 4IEVA 4EROA 5F5QA 2XVGA 2BW8A 3FUOA 4Y1UA 3OF1A 4Q0VA 2XG3A 5FOJB 1OSGA 3INAA 2B42B 4PJYA 1EV13 2WQZC 4JDNA 5DDJ1 3B00A 2WFPA 2GC0A 2XKOA 3LA3A 1KFXL 4P9WA 1HKDA 2BWCA 2R042 3AZVA 4HVOA 4YYOA 4OI1A 1X50A 1HRV1 1FV3A 5AC93 1OQDA 5JZGC 3O0XA 1B09A 1B35C 4DPNA 3KGLA 4ASLA 3I7DA 3WCSA 5L19A 2QDNA 3VBFA 5ACA3 5E89A 2WZR2 4P9JA 4HK8A 1HDKA 4XJ8A 3WUCA 1RVF3 4RR3C 5KHJA 1O4TA 1W39A 1LODA 2ET1A 3SH4A 1QGLA 3RYRA 2EAKA 3K48A 1OHFA 1RUD3 4MGKE 5IT6A 1IPKA 4MYEA 4M3CA 2HWF2 2XLGA 4RHV2 4YVWA 2FMYA 4FPKA 1Z7S2 3E5UA 4LBLA 4C1WA 4J1WA 1RL3A 3ZXAC 1IHMA 4XBNA 3VL9A 3WP3A 2RS31 3RI8A 4XMAA 3AYCA 3VKFC 1HRI1 4UBGA 3NO8A 2VPVA 5SV8A 3TRSB 4AVCA 3VBUA 4BIFA 4AGGA 4P9LA 1PZ9A 4NO4A 4LO4B 1QJY2 4XXAA 4E27A 2YGMA 1H8TC 5FRAA 1MS4A 4XZPA 2GU9A 1B35B 4M3CF 2Q8OA 5C4WC 1X82A 5I8TA 1V9U1 5L7OA 4EN8B 1ZBE3 2HWC3 2RMU3 1RUOA 1HW5A 4I01A 5A33A 1ASJ3 4KNCA 1HRI3 1D2SA 1G86A 4YW5A 1QJZA 1I5ZA 1AR61 3E6CC 1J3PA 3GZUC 4I0WB 4EWDA 1JBCA 1X7NA 4R4ZA 1WBLA 2P34A 1IS3A 2XJPA 4AHXA 2JJ6A 4AVVA 3WDYA 2H6BA 4Q4X2 1A78A 1MS3A 4M0HA 4N53A 2XHKA 1HV1A 2EF6A 4HKWA 2FZ2A 2UU8A 1OQ1A 4NHMA 4HT1T 4FXGB 1YHFA 2G4IA 1AR73 2WSVA 3BIWE 4L97A 5AFBA 4IEWA 3VBHB 3ILFA 4W6WA 4BYYA 3AP6A 4FPEA 5D8AB 4PBOA 4XILA 1WA4A 5H9RA 1CAWA 1SBFA 2MPFA 4XFHA 1ZBE2 1O91A 4GALA 2PHUA 4IV1C 4LO6B 4CDUB 3KLSA 1MQTB 5CFDA 3ZYGA 3QOPA 3CLPA 4WM8B 4GKXA 1YFWA 1LOAA 1Q8SA 2Z2SB 2CTVA 4AFCA 1K5MB 2CY6A 2E7AA 3R4UA 5C8CC 2UWBA 3AP7A 1CIWA 2YMZA 3WG1A 4LHNA 2VOWA 1LULA 1KDMA 2A3YA 3HAGA 1JOJA 2ZABA 3ZXJA 2WFF1 4YZ5A 2ZGNA 4AI3A 4DZGA 1W6PB 4E2QA 3ZYRA 5JOWA 2HWC2 2RMU2 4RA0A 1DGRN 3N36A 3IN9A 5SV5A 2DUOA 1OPMA 2ZGSA 4AFBA 2O1QA 4CEWC 4R9DA 1R092 4NN0A 1QJY3 3M70A 4FVVA 2Y0IA 1BYHA 5T54A 4B4QA 1ZZ6A 1H8VA 1LOFC 3VKNA 2BVBA 4WVMB 1W6PA 1MZFA 3VHPA 4C90A 5FCCA 5T5LA 3LOBA 2WZR3 3RPQA 5ACA2 3WQ7A 4DY3A 1NCQB 2ZGRA 1RUG1 1DQ1A 2AZ5A 4MGYE 2ZGLA 2OVUA 5J3UA 3RNSA 4Y4YA 2D6KA 3WINE 1X8EA 3GF6A 2WFF3 1FOD1 3M1HA 4Q29A 2WNUC 1SBDA 5FPXA 1QJX3 1RHI2 2R043 4CEWA 4Q2FA 2R16A 4RHV3 4YGDA 4DS0A 1ULFA 2ZAAA 4TZDA 1RUD2 4FOYA 3QCWA 5KHIA 3KMHA 2HKXA 4Y22B 4OUMA 2ZBJA 3WDUA 1WUVA 5KXEA 1DZQA 3W9AA 3VUOA 1TE1B 2HWB2 1UN1A 4N7IA 3RRDA 1G9CA 2BUKA 3VBOA 3AXEA 1GZ9A 3CJIA 3EQEA 4YVSC 1CAVA 2BNNA 3JUUA 2MHFA 1RUI1 3O0WA 1RUJ3 3IIAA 1YXWA 4OHVA 4RSUA 2BGCA 1X33A 2DCKA 1ZX5A 3SISA 1AL22 4XE9A 4JV4A 2GZWA 2DVGA 1O7FA 3H9AA 3MW3A 1XU1A 1V6IA 4Q4X3 4Q4Y2 3DV8A 5K9YA 3ES4A 2IFRA 3LWCA 4FPCA 2JG9A 2ZJCA 1EYBA 3D5OA 1DHKB 3NV3A 5BNOB 4Q1RA 2WWSA 1ZBE1 5BNNB 2JG9C 3FHIB 2WNVA 1VLNA 1UIKA 4JCKA 1X36A 4YLZA 2XKPA 2YYOA 3HIFA 4HN0A 4N43A 4HFSA 4YZ2A 3LSEA 5EFUA 3MF6A 1PIV1 1RJ7A 3WCRA 5BNNA 5HCBA 1POV1 2XLFA 2OYZA 5CG8A 2OZJA 1RUJ1 4LBNA 4E4DX 1GQHA 5GZEA 3ZN6A 4FPJA 5JOYA 3I4IA 4EN6B 1QKQA 4RS5A 4E2GA 5CU1A 1M4WA 3ZXGA 4HPKB 4F3JA 3I2DA 1W6NA 2GAUA 4P9XA 1L3JA 4QD2A 3PVEA 5AFEA 2GDFA 1COV3 4ZXKA 1ZM1A 3VBUC 1QF3A 2PHWA 4QQPA 1V9U2 1RB8G 4FQ4A 4XOGA 2W0XA 1SFNA 3LKJA 1Q3EA 2A71A 1AX2A 2AUYA 5BUVA 5CBLA 1OA4A 1MS5A 1NA1C 2HWF3 4AFMA 2C9AA 4GH4C 4RHV1 3RWNA 1G7YA 3GBFA 3MGUA 1O3TA 4Z07A 5T50A 4FO9A 1TMF1 1W6MA 2OIIA 3FLRA 3CJIB 4ASMB 1GKBA 4XQ4A 1V6LA 1UMZA 4XEZA 4YW3A 1JYCA 1JYIA 1OI6A 3JQWA 3ES1A 2DCZA 4GB33 2WZR1 4PLNA 2EALA 3HD8B 5JCTA 1EY2A 1IS6A 4BZ4A 1ND2B 2X5IB 4GQ7A 4EWAA 1KJLA 3ACLA 2IXLA 2PLV3 1LOBA 1UKRA 3ZFFA 2QZ3A 2KXLA 2WNUA 2VGDA 3KZ4C 4AVTA 4I2OA 4WM8C 5FO8B 5GZGA 4CP2A 3BOWA 2RS12 2HEYF 3T1LA 3S30A 3WG4A 1D0HA 1YIFA 4A3XA 4QT6A 2ZHLA 4WVMA 4KG0A 3CNAA 4CEYA 2LM3A 5JAXA 4CDWC 4KBBA 4F7ZA 2C0ZA 1U12A 3J8F3 1WW4A 1JTZX 1AX1A 2NPIA 4CP0A 4Z92B 1C8M3 2IWGB 4AFAA 1CJPA 4XJ9A 3JBG1 3TN93 4A7ZA 1UU5A 4QGMA 4URTA 1LOCA 2GN3A 4AVSA 3ZFEA 3FLPA 1LOFA 1PVC3 5EJ3A 2BVVA 3PJYA 1VRH3 3KD4A 1TMF2 1XNCA 5I0TA 4K6BA 1H4GA 1UAIA 3FBMA 5CVRA 4AQ6A 5FQ0B 3OD4A 2XUMA 5CIRA 1TQ5A 3AMHA 3AYAA 4N90A 1A8DA 1CAUB 4ATFA 3VN4A 1K5MA 3IWZA 1AR91 5C4WA 2G9GA 4XQDA 4QHBA 5CFDB 2Z42A 5LRRA 1RMU1 3WDVA 1CX4A 1Y9QA 4HETA 3RJ2X 2A3XA 4Y1ZA 2Z69A 4A7KA 4FOWA 2Q1MA 3ZPYA 5C8WA 2RJLA 5GM0A 4Q4W3 1REFA 3N35A 3TOJA 1S2KA 3VBSA 3WVJA 4BCUA 1ZBA2 2JKBA 4FTSA 4F8AA 4UBHA 1WMDA 3WOGA 1S0GA 4DNYA 3B7MA 4XFBA 2JE9A 3H0OA 1ZNPA 3V0BB 1U5YA 4HLTA 3JU9A 1O5LA 1WCDJ 2R30A 3QBQA 2AREA 2D3RA 2W08A 5J98B 1LGNA 1GYKA 3AMNA 4K20A 1S0FA 3OGJA 1NOVA 3MLJA 4DQAA 4XPVA 1KFUL 1PIV2 2GH8A 1YCIA 2UURA 3B69A 2ZMNA 1DYKA 5HXVA 2RM21 2VVFA 1RUI3 1XQNA 2AYHA 4IXLA 4XDQA 1X8MA 3ETQA 3CU7A 1KD7A 1VB4A 4IV3A 3AP4A 3AB0A 1S0CA 2CGOA 3D0SA 2DYCA 3MW2A 3VZNA 4FOQA 1VBD1 4I0BA 1Y7BA 4YVSA 2UYAA 3D0JA 1U5ZA 1PM7A 1OKQA 1AR82 3NW4A 4JGYA 2Y0OA 1H1MA 3R05A 4AHWA 4U2AA 1YNAA 1BBT1 2ZHNA 5GLUA 3VBRB 3TB0A 3IKWA 4ATEA 1PGW1 2RR12 5D1IA 5D8AA 3MIGA 2EXIA 4FQZA 1D2QA 4XF1A 2WINB 3VBHA 1G8WA 1T6GC 3QH7A 2XBO3 3M3IA 3WP4A 3HT1A 1CVNA 3LAGA 1PK6C 2ES3A 3ZXLA 5GJ6A 1QQP3 4LHLA 3L2HA 1H2KA 2IZWA 1RUC1 2WLPA 2Q0AA 3GYDA 3VZMA 4QU2A 4QPYA 4Q27A 3KS7A 2VVEA 3MW4A 1V6NA 4INDA 2YV8A 3ILRA 4BHPA 2WZPP 5GKAC 2ET7A 3AYEA 1OPOA 4LO7A 1DF0A 4TSVA 3DGTA 1V00A 1LESA 1IGOA 3G7DA 3FFQA 3E5XA 4Q0SA 3WP6A 2B46X 3OY8B 1J58A 3NJZA 3T1MA 4RQPC 4I30A 4QPIC 1OOPA 1AVBA 2A3WA 5GLZA 5GZCA 3AZXA 4PLOA 3USUA 1RHI1 2NZ9A 1AXYA 4KWJA 4YW4A 4COWA 5DUUA 1SLAA 2E51A 3PVOA 3SH5A 5JOZA 1MZ5A 4IL7A 3JZVA 5JSRA 3O7OA 1RUF3 1DDLA 2HWB3 5L36A 4RD7A 3MIEA 3ZYJB 3PMEA 4YG6A 1OMIA 1D4VB 2LALA 2JE7A 1APNA 3EXUA 2AGSA 3M7AA 1W6NB 2I45A 3MPBA 1IS4A 2RHPA 3BU7A 2QUOA 2ZTNA 4JGZB 5DZEA 1V6JA 5BNPA 4FP2A 3M8LA 3RDIA 1VJ2A 1ULEA 5H9PA 2H0BA 1QH7A 2HYKA 4A2UA 1AR93 3SCGA 3WHTA 3ZFEB 2YXSA 2YZ4A 2WFF2 5CFDC 4E9KA 1NLRA 4AHZA 3POSA 2B45X 4AG4A 3FFZA 2D3SA 2NP0A 4P9GA 2X29A 3TAYA 3X29B 3L2YA 2RR11 4XTMA 1HLCA 4XIOA 5HI0A 1UU4A 1HQNA 1XE8A 3GBGA 2R49A 3DF0A 4B3NA 3VZOA 5BNOC 2VUJA 4XF4A 1PVC1 4Y1YA 1XE7A 2ZPXA 1FMD2 2UY8A 4M00A 3UV9A 3PVBB 2ARBA 4U36A 2WNUB 4HMZA 4AEMA 2R063 2QCSB 4FTEA 2DFBA 2TUNA 3OCPA 4R52A 1POV3 1G9DA 3SCFA 2BPA2 2DUQA 4MV2A 1MEC2 3U10A 3WQ1A 1DQ6A 1H2LA 4M0NA 2A6ZA 1AYM3 2R0HA 2Y26A 2ZHMA 1AX0A 1CJDA 2WNVC 1AR83 2O8QA 4KL1A 3TNQA 3RMXA 2DTYA 5I0RA 5E1RA 1REEA 1ZZ9A 4UW3A 2NLRA 3GHMA 4QM8A 5GLTA 4CEWB 1VBA3 2GNTA 1MS0A 2ZZQA 2OUJA 4CZSA 4XJZA 2RJKA 2DVDA 2NMOA 2G9FA 3M4FA 1RINA 4RQPA 1PO13 3NAPC 3ZMNA 1KQRA 4TYSA 4QQ2A 3SITA 3WY6A 4Z8BA 5CFCB 3PTYA 3AFKA 2R1DA 4AQ2A 3HBZA 4XFAA 2XWBB 4E2SA 4GMP1 4MVTA 2DUPA 4AHYA 1HIXA 2SBAA 3JB4C 4MZUA 2D5HA 3OYWB 4BE3A 3S7EA 3ZYPA 4LT5A 5HCAA 2HEWF 2HWE2 4RS5B 3DPRA 3H8UA 4AF9A 4I3PA 5DZFA