1RVF2

Fab complexed with intact human rhinovirus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/immune system
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
total genus 35
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf200
1AR62 1PO22 1NCQC 1RMU3 1PIV2 3HAGA 4YVWA 2RS52 5ACA1 1RHI3 1BEV1 2BPA2 5CFCB 2XPJA 1VBD2 1COV2 2WZR1 1PGW1 4IV1C 4RHV1 5BNPC 1RUD1 1VBA3 4GMP3 5K0UC 3JD73 1RMU1 1QQP2 5FMOL 1MEC3 1X36A 2RR12 1VAKA 1HX6A 1ASJ1 1AR72 4Q4X1 5AC92 5C8CC 4Q4W2 1EAH2 1RUJ3 1AYM3 4RFT0 3ZFGC 1VBA1 4JGZA 1D4M3 1RUC2 4GMP1 1EV11 2HWC3 4PDWC 3JD71 4GMP0 5C9AA 3IDEA 2WS93 4N53A 1B35B 4CEWA 5L7OB 2BBVA 1MEC1 1HRI3 1NCRA 1MQTA 2PLV2 1PGL2 1ND3C 1TMF3 1WCDJ 2HWE3 1R081 1RUJ1 1AYM1 4JGYB 5A32B 1D4M1 2HWC1 4CDQB 5BNOA 3VDDA 1QJY2 3NAPC 3TN93 2WS91 2RS13 2MEV3 4WM8A 1FPN3 4RS5C 5JZGA 4CDUB 1TMF1 2HWE1 4QPGC 3S6PA 4YVSC 1M06G 1NCQA 2HWF3 1H8TB 3TN91 1VBE3 1HRV3 2RS11 4Z92B 1FOD3 4WM7C 5BNNB 2ZAHA 4IV1A 4Q4V3 1FMD3 1FPN1 5BNPA 5J96B 4FTEA 3VBSC 5K0UA 3VBOC 3VBUC 2HWF1 1QJX3 2RMU3 1K5MB 1FOD1 5C8CA 1AYN2 1BBT3 3ZFEB 3JB8A 5CFCC 1AR92 4Q4V1 3FBMA 1FMD1 3ZFGA 1VBC3 1VBB2 1C8M3 4PDWA 2XBO3 1ND2B 1Z7S3 4NWWA 1PO12 1QJX1 4RQPB 1HXS2 1F2NA 5ACA3 2RMU1 2R072 2TBVA 1ND3A 2BFUS 3VBHB 1R1A2 1VBC1 1VRH3 1RUD3 1RUG2 4SBVA 1C8M1 2XBO1 3NAPA 5DDJ2 3VBRB 1AR63 2WFF2 1AL22 1Z7S1 1PIV3 2RS53 5L7OC 4Q4X3 1ASJ3 1BEV2 5CFDC 4QPGA 1CD3G 1VBD3 1COV3 4YVSA 4CDXB 1VRH1 2R042 1POV3 1EV13 4CDQC 1OOPB 1AR61 1PIV1 4WM7A 2RS51 1RMU2 2VQ0A 1QJZA 2RR13 2FZ1A 1AR73 1RHI2 3JBG2 3VBSA 5AC93 2FZ2A 3VBOA 1VBD1 1COV1 4Q4W3 4CDUC 4N53B 1AR83 3VBUA 1R083 1MQTB 1NA1B 1RUF2 1TME3 1POV1 5ABJC 1RUC3 4QPIA 1POV0 1H8TC 1QQP1 4CDWB 1IHMA 5GKAC 1SMVA 5CFCA 1QJU2 5BNNC 5C4WC 2RR11 3VDDB 3M8LA 5LK7B 1AR71 1MEC2 5AC91 2HWB3 4CEYB 4Q4W1 1AR81 1TME1 4WM8B 1RUC1 2RS32 4GH4B 4EJRA 2HWC2 5D8AB 1RUI3 4IV3B 1K5MC 3CJIB 1RUH2 2RM22 4AEDA 3ZFFB 1E57A 3ZFEC 2PLV1 1PGL1 1HRI2 1DDLA 2HWB1 3JB4C 2HWE2 3J8F2 5FMOS 1ND2C 1NOVA 2ZTNA 1GFF2 1QJY1 5L7OA 4RQPC 1RVF2 1RUI1 5CFDA 3TN92 1OHFA 2MEV2 3VBHC 3VBFB 4N43B 4RR3B 5A32A 4CDQA 2BUKA 4FTSA 3VBRC 3ZFGB 2BFUL 2R062 4Q4Y2 2X5IB 3DPRB 1ZBA2 1VBE2 1AYN3 1AL0G 1HRV2 1V9U3 4CDUA 1AR93 1RUE2 4CDXC 5ABJA 1FMD2 1VBB3 1W39A 1H8TA 1PVC3 1OOPC 3LOBA 1PO13 5C4WA 5BNNA 5A33B 1HXS3 1QJX2 2HWD2 1ZBE2 1AYN1 2RMU2 4LLFA 1V9U1 4GB32 2GSYA 1NY72 1AR91 4YVWB 1BBT2 1R093 1NA1C 1VBB1 1PVC1 5DDJ3 1C8M2 2WFF3 1AL23 1PO23 1K5MA 1PO11 4CDWC 5FOJB 1Z7S2 1HXS1 3ZFEA 1B35C 2ZZQA 4RS5A 5ACA2 1BMV1 4CEYC 1R091 1R1A1 1ND2A 2WZR2 2R043 1PGW2 4JGYC 4NWVA 4RHV2 4RQPA 3VBOB 1RUD2 4GH4C 5DDJ1 1PO21 1AL21 2WFF1 3VBUB 1QQP3 5D8AC 1F8VA 4IV3C 4JGZB 1VB4A 4Y5Z0 3CJIC 4QPIB 3VBHA 2WLPA 3ZFFC 3JBG3 5C9AB 4Q4X2 1ASJ2 1EAH3 4CEWB 3VBRA 1NCRB 1RUF3 2R041 1VBA2 1EV12 2WWSA 3JD72 1QJU3 5BNOB 1AUYA 4CDXA 2PLV3 3JBG1 1RHI1 4FSJA 3VBFC 4N43C 4RR3C 1EAH1 1OOPA 4AEDB 3ZXAC 1RUF1 1AR82 1R082 2RS33 1RUJ2 1AYM2 1A6CA 1TME2 5JZGB 1QJY3 1D4M2 1NG0A 2X5IC 1NCQB 3DPRC 1QJU1 1RUH3 2RM23 2WS92 1OPOA 1NA1A 5CFDB 2HWB2 2Y26A 1TMF2 3J8F3 4IV1B 4CDWA 2RS31 5BNPB 1CJDA 1B35A 5K0UB 4Y4YA 1RVF3 1RUH1 1RUI2 2IZWA 2RM21 4CEYA 2RS12 1HRI1 4YVWC 4JGYA 5C8CB 1FPN2 4GH4A 3J8F1 5D8AA 4IV3A 2R063 5ABJB 2HWF2 3CJIA 4FTBA 4Q4Y3 3ZFFA 1RVF1 2GH8A 4PDWB 1ZBA3 1C8NA 1FOD2 2MEV1 5C4WB 1RUE3 1RB8G 4Q4V2 1HQNA 1ND3B 5J98B 2R061 4Q4Y1 1X33A 4JGZC 4BCUA 4QPIC 3NAPB 2R073 2HWD3 1ZBA1 1ZBE3 1VBE1 1HRV1 4N43A 3VBFA 4RR3A 4GB33 5C9AC 1RUE1 1V9U2 4N53C 4CEWC 1R1A3 1NCRC 1MQTC 1VB2A 4RS5B 1RUG3 1VBC2 4QPGB 4YVSB 2X5IA 3DPRA 2XBO2 1PVC2 2R071 2HWD1 5BNOC 1ZBE1 3VDDC 1BEV3 4GB31 1NY71 4WM7B 2DF7A 1BMV2 1BBT1 2WZR3 4AEDC 1R092 2QQPA 1RUG1 4RHV3 4WM8C 3VBSB 1VRH2 5A33A 5JZGC
chains in the Genus database with same CATH superfamily
1UYZA 3PUIA 1E5RA 3WV6A 4XFHA 5KXEA 1PO22 4CUGA 1A34A 2ARCA 2Z69A 3CLPA 4OHVA 2DUPA 3PUAA 4YVWA 5FPLA 2DVBA 1QH7A 5LK5A 1GZCA 2WSUA 1DQ1A 1ZZCA 2RDNA 2DYCA 1N3QA 2YBSA 1UZ0A 5CVRA 2BPA2 5FCCA 1OVSA 3LIHA 4UF0B 1CZSA 5CFCB 4PQQA 1JOPA 5IYYA 5FYVA 2VZSA 4IV1C 3THDA 1ZZ6A 2DV9A 1ULCA 2R1DA 1RUNA 5FZHA 2BERA 4JAAA 5KR7A 1RUD1 3OBAA 4P9GA 4LHKA 4DNYA 5FPBA 5K0UC 5T5JA 2W3JA 3AKRA 1YIPA 4FPFA 5JIAA 4M0HA 2B7YA 5T54A 1APNA 1O59A 3TB0A 4ONUA 2DCJA 4MGZE 4COZA 4NHYA 2VVEA 4K21A 1UY3A 1LOAA 1HKDA 1ALYA 2CDPA 3HVDA 1DFQA 4K3UA 4P9JA 4ET7A 4CUCA 1VE0A 3CZUA 4HG6B 4HL0A 2AGSA 4HSJA 3N7LA 3RMYA 3PHMA 1AYM3 4Q0QA 2CWMA 1VBA1 5DAXA 4XCBA 2ZEZA 4PDWC 1YJKA 3E6BA 3TNQA 5C71A 3JD71 5C9AA 2XJQA 1O5UA 1QDCA 3IDEA 1PK6A 3C7GA 4JHZA 2WS93 3AMHA 3RZLA 1YLLA 3Q8CA 4FBFA 3ILNA 3OSDA 2AENA 2D6PA 3ZDSA 2HWE3 2WSVA 2WYFA 1W9YA 5CISA 4OHWA 1U12A 2A70A 1E5SA 2VZQA 3WZ1A 1BHGA 2JE9A 1D4M1 2OX0A 3FWEA 4CDQB 4PIZA 4B4RA 4D8MA 2Y8KA 3NAPC 1ST8A 2J1RA 4QHOA 3NQHA 1HV1A 3WF1A 2J22A 5C7GA 2VCMA 3ENRA 2F4PA 2YXSA 3HT1A 4WM8A 2YROA 1YCIA 4HSLA 4RS5C 2PHWA 4XJWA 2WNOA 4QPGC 4KNCA 3KM5A 4GKXA 5EJZB 4BQ2A 1QXJA 3ACGA 1OT5A 2JG8A 3PVOA 4EZHA 5IVVA 2VXJA 2DFBA 3R4UA 2CY6A 4HN0A 3TN91 3LPFA 4XETA 3ZR6A 4AEMA 2RS11 5A7OA 2D93A 4WM7C 2LS6A 2ZAHA 5ERLA 3MF9A 5SV5A 1J3RA 4AHWA 5KHKA 5F3GA 1D0HA 2VMEA 3VBSC 3I3QA 5JCTA 1FNYA 4DXTA 4TLFA 5I0RA 4JKLA 2HWF1 4I30A 3SCHA 4CCOA 1L7RA 2VR4A 1MACA 1VALA 4P14A 4V1PA 1YFWA 1CQ9A 1IQAA 4DEVA 4FO9A 1F5FA 4LO8A 2YYOA 4QX5A 5C8CA 1OD3A 4JRLA 4PCRA 3ZFEB 3ZPYA 4EE2A 1UX6A 5AVPA 1AR92 2Y6KA 4Q4V1 5M0TA 1FMD1 4MH0E 3ZFGA 2I74A 1GV9A 1VBC3 1TG7A 2BRTA 2CTVA 3H42B 2Q8OA 4IL7A 4XTMA 3HPNA 1C8M3 4AK3A 1WW5A 2OPWA 1LHOA 1ND2B 2ERFA 2XHKA 5FY7A 5CZKA 5CYYA 3VD7A 4CXWA 2VZPA 4ES8A 3PTYA 4FP3A 4XUQA 2VQTA 4CRQA 4YGBA 2NLRA 2OYZA 2B46X 2CAVA 2XLFA 1DBNA 3M3IA 4KWKA 4LBJA 4JVAA 4YGCA 4UOJA 1LOCA 3DN7A 4Q8LA 1R1A2 1IG0A 3V0BB 1VR3A 1RUG2 4OMDA 5FYBA 2ILMA 3NW4A 2A3XA 4XF0A 3OEBA 4BXSV 4Y1XA 1MS1A 1Z7S1 2E7AA 4IEZA 5F6LB 1JN2P 1VMFA 1YWKA 3EMRA 4YLZA 4I0BA 1VRBA 2WWUA 1Q56A 2OPKA 1YRZA 2Q8CA 3UETA 3WF3A 3K46A 4PQ9A 1SFNA 4GIQA 4Y22B 1XU2A 1ASJ3 1BEV2 1A78A 1DZQA 1EPZA 1URXA 3I2JA 1UY0A 1VBD3 1COV3 5CFDC 1BVP1 3O0XA 4QT6A 2PTMA 2ET1A 4HVRA 1DZTA 1XYPA 1VRH1 5KWRA 1GP6A 2W94A 3DGTA 5F37A 1OPMA 1MZFA 3BTXA 1VAMA 4HVOA 4QGMA 2XJUA 5HI0A 1W0NA 2UU8A 2RR13 2VAUA 4C1WA 5HXMA 2UYAA 4GZ9A 2FZ1A 5AC93 2VNRA 2XH6A 4IEUA 4LHSA 4PI2A 1X8MA 4N53B 2WFPA 2WLQA 1DLCA 1JU4A 1R083 4BE3A 3T4HB 1SACA 1RUF2 2OUHA 1N47A 4HLTA 4AHYA 3NJZA 5EZWA 5BYNA 3DYOA 1GNHA 1NX9A 2GZWA 2X10A 4W6WA 1IHMA 5C3QA 4F3JA 1SMVA 5FXVA 1C1FA 1LOGA 3ZYJB 4AEKA 5C4WC 4QQPA 5LK7B 3ACHA 1ZA7A 4OQ9A 1JW6A 2WC2A 3M4FA 4P9LA 4CEYB 5KC5A 2IC1A 1AR81 1AVBA 2A3WA 3VB9A 1TME1 5K9YA 1DQ5A 1GYKA 2VQUA 4KWJA 5FQ0B 5FY5A 4B7KA 5ANNA 2EAKA 3AMPA 4OI2A 1K3IA 3RSJA 3BTAA 1FX5A 4NROA 1BYHA 2XG3A 5GALA 1PNGA 2PFWA 3CJIB 1UZYA 3KB5A 4FOWA 1E57A 4FAHA 2XB6C 3M3EA 2X8KA 4LEJA 3CQOA 2HWB1 2WKKA 3NNMA 4CXYA 1FT9A 3M2MA 3OYWB 2WNUA 5DAVA 1VLNA 3MF6A 1N3OA 1YHFA 4Z2AA 3AP6A 3HQXA 2HWE2 2QUOA 1UPSA 3U37A 1N1TA 4KU8A 2XMLA 2ZHNA 5IW0A 1HQWA 1PVXA 2QTWB 4AR2A 2H0VA 1WCKA 4BQ3A 3NRUA 4X8PA 4AAXA 3IDBB 4QB2A 2C6SA 5LATA 5JOYA 2JG9B 5C3SA 1UMIA 3B9IA 3CEWA 1OLRA 2ZACA 4DOUA 4GWJA 3BVCA 2QVSB 5J36A 2CHHA 2YZ4A 1W2OA 4FVVA 3T09A 3HNYM 2VMGA 5GLZA 4YW7A 2EIDA 2VBBA 5CNAA 3ZN6B 3PVEA 5FMDA 2ID4A 3LDBA 1U5XA 3LDKA 1H6XA 2VUAA 3MV01 4EZ4A 1GU3A 2PA7A 3K2OA 4BPZA 4ISRA 2X5IB 4JTOA 3DPRB 2AACA 3P6BA 4DZGA 1AYN3 1IZ3A 1TQ5A 4J25A 3T4VA 2B5HA 1HJGA 4CDUA 3U4XA 2CGOA 5DQ0A 4IEPA 1MS8A 4S2FA 4FAGA 4AGGA 5A3LA 3KS7A 4Q8KA 2W46A 1W39A 2VJXA 4XFIA 1PVC3 1LHVA 1LR5A 3LOBA 1OQEA 4HOOA 4ZKTB 3UKVA 5FUIA 4BDVB 5FYSA 1O7FA 4Z07A 5BNNA 4FOQA 1HXS3 3AP5A 3WDYA 2CYFA 2OQ7A 2R0HA 3N7MA 4FXGB 5FAXA 2ADEA 1DQ0A 2E63A 4Q5OA 1JZ3A 1V9U1 4GB32 3WDVA 5EV7A 1NY72 4ARXA 1AR91 4HONA 4W65A 1KGYA 4M3CB 1NYWA 4XABA 4EWAA 4BK4A 1VAVA 4XACA 4RGAA 4S2DA 4UFJA 1YO8A 3J9SA 1AX1A 1C8M2 2WFF3 1AL23 1QJFA 2QQNA 5FYCA 1JZ8A 2D40A 3GNEA 5LCWL 2VTXJ 2P3JA 2HLEA 3NKTA 4GKYA 4RS5A 2QKDA 3I3DA 2JDPA 1WBFA 2GP3A 3ZKUA 3FLRA 3WQBA 3PJYA 3H8UA 2JIJA 1JBCA 5IT6A 1R1A1 1WUVA 3KZ4C 2A1XA 3ON7A 1PGW2 1D2QA 2J7MA 1XNDA 1U5ZA 5FZFA 4RQPA 4GH4C 1Z78A 1UOJA 3ZYGA 2EAAA 2FCVA 5LRSA 1F8VA 5DUWA 1VB4A 2A6YA 3MIFA 4Y5Z0 1W2NA 1S0CA 3ZFFC 1FV2A 1Q3EA 4FPGA 4DRVA 3GYDA 3NO8A 4LBMA 1ENXA 1ASJ2 5DG1A 3WP3A 1ZZBA 3VBRA 1BKZA 1XC6A 2WL1A 2ZZJA 5KXDA 1JODA 2C5DA 2IWGB 4Q26A 4NPMA 1GR3A 5DMYA 4I3GA 3N3HA 2J1TA 3M3CA 4CE8A 3EXUA 3PDQA 3VKMA 2ZGSA 5HV4A 3CDZB 3HQRA 5C5UA 5J7MA 3LPGA 3R6SA 4CDXA 5LA0A 3H9AA 4HPKA 4WVZA 5AVAA 4FSJA 3VBFC 4XE9A 2F17A 3OBZA 4RR3C 1W6QB 5K7PA 4P5HA 1WLDA 2AZ5A 1RUF1 4UI9L 2I07B 3AP4A 1R082 5FP9A 4YM1A 1RUJ2 3RWKX 3R0RA 4KU7A 4Y1UA 4RYDA 2VUDA 5JPNB 3AYDA 3VGIA 3W5MA 5FP7A 2VMIA 2W5FA 1H9WA 5A7WA 1W8OA 1NCQB 3LEGA 2C24A 4A7YA 3RPQA 1RUH3 2RM23 3TBDA 2QZ2A 2ZX3A 2ET7A 3LA3A 1V6KA 1XSQA 3ZVXA 4CTEA 5T5OA 3T0BA 5CFDB 2Y26A 4LXLA 1CAWB 2WA4A 1QXPA 3PU8A 3J8F3 3MUZ1 4K40A 4CDWA 3WHUA 1KDMA 3GCXA 4AVSA 5HBAA 4D69A 2B9UA 4J6GA 3W20A 2G9ZA 3WCRA 3WW3A 4Y4YA 1HN1A 3OGSA 2WQZC 1SPPA 2NP0A 4FPHA 2D7FA 2IZWA 3ETQA 1UD1A 4CVUA 2VOKA 4YVWC 1CAXA 4NHXA 4DY3A 1OF3A 1GNYA 4JGYA 1GQHA 2TNFA 1FPN2 1W6PA 1JYXA 1W8ZA 2A3YA 2Y6LA 4BM8A 4BA6A 5EWSA 3I3MA 3ZSKA 4IV3A 1CAVB 5LA9A 1W05A 2R063 4QB1A 4I01A 4RD7A 2O8QA 2VL4A 4EN0A 3OJBA 1CZTA 2RJ2A 4WVMB 3THPA 5FYTA 1QNYA 1W6OB 1ZBA3 3HD8B 4UFLA 5IFPA 5C4WB 2DCYA 2VGDA 2XOMA 5E89A 2ORZA 5EP9A 1RTVA 1RB8G 1YUDA 3GJAA 5CKQA 3LA2A 1CPMA 2AEYA 3NMBA 1G6NA 1S2KA 5FK8A 3J7MA 1YEWA 4NOTA 1E5HA 2VMCA 1F4AA 1LB2A 3O1TA 4CCLA 4EQVA 1TNRA 2VUJA 3INAA 3SCFA 3HWJA 2LM3A 2XJTA 4X6RB 4QPIC 4QM8A 3WR0A 1ZBE3 4N43A 2VH9A 5C9AC 3D8CA 4Y24A 1PK6C 2ZGKA 5JPMB 1PMJX 3DXUA 4H7LA 3I4IA 4UFMA 3ZKYA 4EWEA 5FP8A 5K8SA 5LY2A 3E97A 4FFIA 3C7FA 1YFXA 4Y3OA 4YVSB 4JQRA 1SG3A 2XBO2 1PVC2 2BVBA 1H1AA 3VD4A 3BU0A 4D6RA 3WG3A 1L3JA 1STMA 2CDOA 4HK8A 5FZEA 1JU3A 2PYTA 5DAWA 2N7GA 3I2FA 4YZ2A 2R071 2R30A 3ZDVA 4GB31 2D3RA 4Z2WA 5A70A 1NY71 3OY8B 3LSEA 2KD7A 2BDRA 2DF7A 1BK1A 2PXJA 4NJ4A 4XPVA 4AFBA 1I5ZA 2ZGMA 4XJ8A 3A0KA 2D5HA 4XQ4A 1W9WA 2WNVB 4LKSA 4NAMA 4RHV3 4WM8C 2QQPA 1X8EA 2UY9A 5LBCA 2PAMA 5A33A 1UMHA 5C3OA 2DVDA 4MSVA 5J3UA 2YC2A 4MHUA 1W8NA 4AVBA 2OW4A 3POJA 1IPKA 2JG8C 1HN0A 5B4XA 2RS52 3IDCB 3N9OA 3WNMA 1KFXL 3IMMA 1V70A 3UJQA 5IK7A 3BI3A 3F95A 4UFKA 2VZVA 4MO3M 5JMCA 4QXHA 3W9AA 5IK8A 4EROA 3ZYHA 3B7MA 2WWJA 2OZ6A 4MGSA 4OCTA 4AVVA 1QDOA 4CP9A 1GWMA 4XF1A 5IK4A 2PAEA 1PGW1 1S4CA 2YDEA 2GNMA 3KT1A 1WMEA 1NXMA 1O4YA 2VW1A 5JXJA 1NQJA 4I09A 3CL1A 3N9NA 1Y7BA 2A6WA 3CHXA 4GMP3 4CCJA 4IE5A 1F4HA 1RMU1 4NUBA 3RNSA 3DL3A 5FMOL 2DVFA 3BN6A 4YZ1A 1JYIA 1W2TA 2Q1MA 1MEC3 2ZHKA 1X36A 3WY6A 1VAKA 2WJSA 3JUUA 5KXBA 1ASJ1 4DMIA 4IUGA 5C8CC 3AJZA 3ACFA 3LD8A 2VW0A 3QACA 1GZWA 2KXLA 2ES3A 2A75A 3GJBA 4COUA 4RFT0 3ZFGC 3BPSA 2X29A 1QF3A 4LBQB 2OXBA 2ORXA 1HLCA 1DGLA 1VP6A 2P2KA 1V6NA 1DQ2A 4IGQA 2EVXA 2RHPA 2O0OA 4GMP0 1JYNA 5JVVA 3U11A 2UWCA 1YQ8A 2ZX2A 4ITCA 1YFYA 5L7OB 2DTWA 2BBVA 2JE8A 1NCRA 1MQTA 3L2YA 5GZGA 3IAQA 5LA1A 4O9GA 5CA6A 4MYEA 2EIEA 3DCQA 3VL8A 1DIWA 1NE4A 2WBKA 3URFA 1TMF3 3AL6A 1R081 3POWA 4BQ4A 1RUJ1 3VHNA 5HXVA 2YV8A 4K6BA 2WZEA 5FPAA 3H0OA 2HWC1 2ZBJA 1GMMA 3GZAA 3KHBA 5H9RA 4KG8A 1ZVFA 4M0NA 4MGKE 1JH5A 1YC61 5LY1A 2E33A 4MXWA 2J42A 2NMOA 4CSWA 5IVYA 5JOXA 5K4LA 3WDWA 4HMZA 1O3TA 1W3XA 4Y20B 2YGMA 4YFWA 2QQUA 3LE0A 3BCWA 5DPNA 5D21A 4XTPA 3KVAA 2GALA 2KR2A 1O6UA 3OB8A 1R64A 4IEYA 2GP5A 2EF6A 2VOWA 4QKNA 2SLIA 5IFTA 1ZA4A 5E8AA 5FP4A 1DGRA 4KBZA 2EXHA 1S0FA 1H8TB 3ZN5A 1JTZX 2GNTA 2PELA 3B69A 3T1LA 1QMJA 1FOD3 4AWDA 4Z92B 5JI9A 1WD4A 4KL1A 4IQPA 2P1BA 5FWJA 1HQLA 3T0DA 3B9CA 2FDFA 1DQ4A 4FI9A 4Q0SA 3VLBB 1MS3A 2Z2SB 2CGNA 1FPN1 2O14A 3B02A 4H3WA 3WSOA 3D6EA 3SMHA 5FZ9A 1XYOA 5BNPA 1HIXA 3MLJA 2I2SA 1FAYA 2PQSA 5F8PA 2VU9A 4AGRA 3O1SA 3UESA 5FLIA 3V64A 3WNLA 4FQ4A 4YW6A 5FIXA 1DGWA 1QJX3 3N4MA 2RG4A 2Y60A 3BB6A 3AP7A 3N7JA 4LK6A 4P5YA 1IGOA 4M00A 4QX1A 2WRAA 3NJYA 1I6XA 1K5MB 1PM7A 1WLTA 2P3IA 3BIEA 3S5AA 3V65A 5JIUA 1OUSA 1S1AA 4XFBA 4XUNA 3UV9A 2E51A 5ISLA 1LCLA 1MS5A 2A5ZA 4ASKA 1XE0A 3LF7A 1ZYBA 4I3PA 5JR2A 4OHZA 4ATFA 4ATEA 2FDHA 3QH7A 2P4EA 1GWLA 3A21A 4NWWA 4R9AA 3TNPB 2UWBA 3DYMA 5ACA3 3O1OA 2RMU1 1W6NA 5T5LA 1GZTA 1KS4A 1MR5A 1ND3A 3RYKA 3WP6A 3BU7A 5A6XA 1LOBA 4OYUA 2BFUS 1RIRA 2WABA 1OLQA 2DFCA 4HFSA 3VBHB 4BQXA 4NMIA 5C5TA 1HDKA 3AZYA 2C4XA 2GMEA 2BNMA 2WNUC 5CKMA 3GDBA 2XBO1 1PNFA 1WMDA 2IUWA 3FUQA 3LFMA 5DDJ2 1AR63 1LENA 3H1WA 3Q9OA 2GU9A 5FZMA 4DEQA 4EN7B 1PIV3 1LRHA 1YQ2A 4Q27A 2C1FA 2G9GA 3AKPA 4AI2A 1H9PA 5FREA 2EALA 3VZOA 1XNKA 3GALA 3GXUA 5FZ3A 3MW3A 1TE1B 2FQPA 4KWUA 5FZ1A 1REDA 3CJXA 3JXSA 1JXNA 1DHKB 2VZRA 2ARAA 3KV6A 3TEYA 1VMHA 5L36A 3FMGA 1BQPA 3K77A 3ZSLA 2R042 1POV3 2PHRA 3PTRB 5FZ0A 1DZRA 3ZXFA 4YM3A 1OOPB 3MIBA 4META 2GC3A 1Y43B 4LO4B 1NLQA 1MZ6A 2GNBA 2NM1A 2RS51 2VOTA 3DYPA 2WT2A 3AYCA 4M3CF 2DDUA 3H3LA 4U36A 2XJVA 2ZJCA 2VCCA 1AR73 2FZ2A 1JOJA 1PK6B 4Q4W3 4XBNA 1LTEA 5LWBA 4CDUC 4L9BA 3VBUA 2GH2A 1YFUA 1NA1B 3KCXA 3IM0A 4JQTA 5JXGA 1CESA 1GICA 1RUC3 1OQ1A 3BPZA 4LQRA 4MV2A 4QPIA 4RSUA 5D2AA 1S0JA 1POV0 2VZ1A 4BMEA 3T30A 4R9BA 1RINA 5GKAC 4UF0A 3NJVA 5CFCA 1S0GA 4W4ZA 4YW4A 5BNNC 1K12A 2V72A 3M8LA 3LSDA 4O65A 1MEC2 4NRMA 2ZXQA 4QKDA 4E4SA 3PJQA 4AE2A 3ZN4A 3KV4A 4LITA 2JDYA 4BISA 4B1MA 4FPLA 4IE4A 3RZMA 1ZRFA 1DF0A 4I2OA 5FZ4A 4WM8B 1RJ7A 2ZMKA 4CXXA 3O1VA 2OA2A 3IIIA 3WNOA 4CPBA 3KMHA 1UZZA 3PMSA 5D8AB 4M4RA 1RUI3 1GLHA 1VMJA 1FV3A 1V0AA 4AL9A 4C0BA 2V5DA 3RS6A 2NMNA 2FDKA 4XURA 1YQ5A 2BTVC 1WCQA 1REFA 3UT0A 5C6CA 1SDWA 1UX7A 3WW1A 3AZXA 3ST7A 1UMZA 1BLZA 2IVJA 4Q2FA 1ACCA 4R9CA 1CONA 2QCSB 3AJYA 5FMOS 1GP5A 5FY4A 1NOVA 4HT1T 4XJAA 4IE0A 4IDZA 2P6HA 4BQYA 4RQPC 2JD4A 4CYDA 3ZYBA 2PAKA 5DUVA 2EA7A 5FZOA 1UNBA 1OD5A 3SISA 4YYOA 5DZFA 3VL9A 4LORA 2BBAA 3KV5A 3HT2A 2FDJA 5FUNA 2QFEA 1PMHX 1HJFA 4PT6A 5H9SA 4CDQA 2BUKA 4GWMA 4AZZA 4LLOA 4RGGA 3VBRC 4O9EA 2W0XA 3ZFGB 3Q8BA 3VZKA 2R1BA 3I2DA 4ASMB 2VCBA 2HBUA 4OUEA 5G04L 3IN9A 1FYUA 3POEA 1P8JA 1T2XA 2JEMA 4WBBA 5JUVA 3POGA 1ZRRA 4E4HA 2DVGA 3E6CC 2QQLA 1GUIA 1RUE2 3JCIA 3ZSMA 2Z4FA 4CDXC 2RVAA 1SLCA 4P08A 1VBB3 4IEXA 4XUPA 2Z79A 1XU1A 4C1XA 3BODA 3O7OA 3AB0A 3ATGA 2XLGA 3GGLA 4QDQA 1JZ5A 5FY9A 3MPPG 4NRQA 1PO13 3UL2A 3PNAA 2YC4A 5FZCA 4A3ZA 4WVVA 2Q5TA 1T6BX 4JDNA 1QJX2 3LDRA 2RE9A 3C7EA 2HWD2 4V2WA 2R49A 5KXCA 1F9KA 3ZXEA 5IJRA 3I7DA 2AUYA 1R093 1LULA 4TXWA 4IW3A 4A2UA 3B94A 5BNQA 5BPXA 5A7PA 2AEZA 1SLAA 1W8UA 4YGDA 3POSA 3OPWA 4XDPA 5KHHA 3UGGA 2D97A 2C9AA 3TOJA 4CDWC 4CZSA 1A8MA 5C3PA 1PX4A 2W08A 2IXJA 3GZTB 3ZFEA 3T3YA 4S2HA 5F6KA 5ACA2 1BMV1 1N3PA 3GZEA 1YI9A 2B42B 1NLRA 5FO9B 3AZVA 5FZKA 1ND2A 2WZR2 4XFAA 3RJRA 2E53A 3VDCA 4CPBD 2VBDA 4JGYC 4NWVA 3ZLIA 1JZ6A 3PIGA 1I1EA 5F1RA 5DDJ1 3TRSB 2QDRA 1PO21 4UW6A 4JHTA 2DU0A 1QQP3 2AREA 1X7NA 5L9RA 3IDAA 4TTGA 3VHOA 1KDKA 2RDQA 4IV3C 3Q8EA 4JGZB 2DBIA 4TSVA 3FLTA 5JOZA 3KGLA 3NNLA 3JBG3 3VD5A 4CUAA 3O1MA 3V0BA 2P37A 3POFA 5KHJA 4Y4RA 3AFKA 3M7AA 4AI9A 1CGPA 3NNJA 1EAH3 3WEZA 3T2TA 4CEWB 4P9WA 4EWDA 3HR9A 3NV1A 3LA7A 4JKKA 5FBZA 3WVJA 2R041 4CCCA 4ZPIA 1OLME 3V0AA 4AVAA 3OOXA 3AFGA 4XILA 4Y22A 2WT0A 4BU2A 4UWDA 5CU1A 4DINB 1QJEA 4KG0A 3BUCA 5CBLA 1ENSA 1QJU3 4JDMA 4K20A 4LBOA 5T50A 5BNOB 1AUYA 4DB5A 5FZAA 3ZXKA 1GOFA 1X50A 2ZEWA 4TLGA 2JKBA 4XMIA 4FPEA 4CCKA 4AF9A 4N43C 1H1MA 3W5NA 3ZXAC 1KITA 3N7KA 3ECQA 1V6IA 2RS33 1AYM2 4PHZA 3IBMA 1C28A 3PL0A 5JZGB 1QJY3 1NG0A 5JSRA 1GKBA 3W58A 5EYYA 4AEJA 3AYEA 5JXHA 2PN5A 3HBKA 3KD4A 3PUSA 4MGTA 1DP0A 4N90A 2ZGUA 2WS92 5L9BA 4E27A 1OPOA 3EQEA 4NAOA 3A7QA 1XNAA 4BLJA 3POIA 2C26A 3HNBM 1D2SA 1ULDA 4AGVA 3FBYA 4IV1B 1AXKA 3VKLA 1W9TA 1WA4A 1DYOA 1IQDC 1B35A 4BH9A 5FOBB 5K0UB 1RVF3 2WA3A 3NV2A 1GP4A 2ZA9A 3EHKA 1RUI2 4CEYA 3D5OA 3VD9A 1PZ9A 5IUQA 2CV6A 4M4PA 1UXZA 5B4NA 3WQ7A 3ES1A 4OVEA 5FR3A 1ZM1A 5FQ0A 3RZGA 2VMDA 3L9JT 4QX3A 4LKEA 4MLOA 2E6VA 1QOTA 2B9VA 3CJIA 4Q4Y3 2W1SA 4C91A 4PDWB 2XJSA 4BMBA 1QHDA 4E2QA 1D0GA 4N7IA 2A6ZA 1XPWA 2TEPA 4BHPA 3E1F1 3OYWA 3LQCA 5FDBA 3ZX7A 4QDRA 4DXZA 5FO8B 2KM2A 3B5LB 3USSA 2BWCA 5T52A 2A73B 4LHLA 5IVEA 4LBNA 3H8OA 2V4AA 3O14A 5E6HA 5A6QA 4XFGA 1JMUB 3OUIA 1Q8PA 3RZKA 1T6GC 2DURA 2JG9A 2XQXA 4BCUA 4YW5A 3JZVA 3NAPB 1OKOA 2BOIA 3SH5A 5GZCA 4LNVA 2QE3A 1IKPA 1RUE1 3I3EA 4JDOA 2D6OX 1NCRC 1MQTC 1VB2A 4RS5B 3ZN6A 1VBC2 4AI8A 4QPGB 3AK0A 4K8FA 1NZCA 2X5IA 3DPRA 3IPVB 1LODA 4F7ZA 2EIBA 3MIEA 2G1MA 3WG1A 4L2NA 5KHIA 2VMFA 5JR7B 2HWD1 2JDKA 4GQ7A 2QNKA 3FN9A 4Y5SA 1JZ4A 4JV4A 4WM7B 2UWAA 4NIHA 2W1UA 5IAVA 3ZMOA 3J7NA 4AEDC 2F6BA 1R092 1RUG1 4FXKB 2DUOA 4AQSA 3VBSB 2CGPA 4ES9A 2OQ6A 4A44A 4XHBA 5GZFA 3PURA 3PUHA 3S7IA 4K8RB 4AFMA 4LBQD 3ZXGA 4V2VA 3BYWA 5F5CA 4AI3A 2OIIA 3SQOA 4XDQA 3QLQA 4Y26A 3HAGA 5EJ3A 3NWKA 4M3CA 3HN1A 5ACA1 1BEV1 3WF0A 3D4KA 2JDUA 3E5UA 1I3HA 3EYPA 5ANQA 1VBD2 3E5XA 1COV2 2RDRA 2WZR1 1VPHA 3FFZA 5GLVA 2W1WA 2P6CA 1JS9A 2VZUA 5H9PA 3RG0A 3O1PA 3FFQA 5T5PA 5BNPC 1VBA3 3LAGA 4YM2A 1FATA 4XAAA 4ZY9A 4ZXEA 5JI7A 4AOCA 3KHCA 2WAOA 5A3WA 3ACIA 3JD73 1QQP2 3FHAA 1C4RA 1Y9GA 1NXD1 1EPWA 4OUMA 4A3XA 3ME2A 2O8OA 2QQIA 3ZOIA 2RR12 4WV8A 3R4DB 5I0SA 2FMYA 1J59A 1KS5A 3AM2A 5AC92 1UCXA 1EAH2 5EFUA 5C3RA 3NNGA 4HXCA 3ETPA 1YNAA 1F5JA 1RJ8A 5JLVA 2WZ8A 1D4M3 1IG3A 3OD0A 2JX9A 3M3OA 5LASA 3ZIWA 3MHZA 2GC1A 2DVAA 2J1VA 4LOTA 2K0GA 1W6MA 1US3A 5C33A 4XF9A 1CIWA 4OI4A 1PHMA 3VZNA 2WZPP 1W06A 1OXCA 3HNMA 4OHXA 3I2OA 1SPPB 2OZJA 3I59B 4YZ4A 4QQOA 1ND3C 4W50A 4UFHA 1MVEA 3VHRA 5KC6A 4DXRA 1AYM1 3CNAA 5LW9A 3ZSJA 2VO5A 5LBEA 4JGYB 4P9YA 3HJRA 1U5IA 5A32B 2W2IA 1W6PB 4PJYA 4A7KA 3VDDA 4GD4A 1QJY2 4CP2A 2XKOA 3TN93 2OS2A 1J3QA 2XWJB 2YUEA 4ZZ5A 3WG4A 1ULPA 2WS91 1W6QA 2RS13 3ZO0B 3KGZA 1UZVA 3CMGA 2MEV3 3SEEA 4XFFA 3WUCA 4AHXA 2H0BA 4AG4A 4LIVA 1AXYA 4XVHA 2QZ3A 4MXVA 3IZOA 3KLSA 5IVJA 1ULOA 1DGWX 2HWE1 3S6PA 3X29B 3S0MA 3MICA 1M06G 1NCQA 2VVDA 2AC1A 2HWF3 2K9ZA 2QQMA 3HIFA 5AFEA 1G86A 4HKOA 4XJUA 5T55A 2VNGA 3LIGA 4DUWA 5A6ZA 2VZ3A 1KXGA 4NPRA 5I93A 2BZDA 5E1RA 1LU2A 2VQAA 1WLWA 1V6LA 2H6BA 3CBNA 4OZOA 4Q4V3 1PM4A 1VIWB 1FMD3 5I8YA 2Y34A 5DUUA 3AYAA 4YGEA 1ZZ8A 4FTEA 3G6JB 1N1SA 4QWNA 4CUBA 3USUB 2XJPA 3VBUC 3UNPA 4RA0A 4QX0A 4YRDA 1LHWA 1O4TA 3TAYA 3ZIXA 3MV11 1S0IA 1UPIA 2J1UA 1SBFA 4LO6B 5BV6A 2X53S 3K4ZA 1JZ7A 2PHDA 1QU0A 4LJHA 3OBRA 1AYN2 1BK0A 3K4AA 1WW7A 1BBT3 2ATFA 3BTZA 2Y6HA 5CFCC 1NAEA 5FRAA 4XJZA 4NIDA 3FBMA 3O5SA 3EJKA 1DQ6A 1OLMA 4OMCA 4ZZ8A 1CAVA 1OQDA 2ZAAA 4M01A 2E32A 1YI7A 2TUNA 2DCZA 3H1MA 4Q0PA 2XUEA 2AYHA 3K3NA 2V73A 1LGNA 1W6OA 4E2GA 4S2GA 1Z7S3 4OUSA 2P5BA 3I3BA 1WMFA 3QD6A 4DXSA 1HXS2 1F2NA 4QGLA 3HN3A 2D44A 1AX2A 4E9KA 1VJ2A 3RYRA 1UAIA 1UOGA 4XAEA 3W59A 4HVQA 3FC0A 4AVTA 3BKZA 5HCHA 2E9QA 3LGRA 2BV4A 4R4XA 2BOJA 4LA3A 1Q43A 4PLOA 1VBC1 1UZWA 1VRH3 3U4SA 2WN2A 1C8M1 4MOAA 3RQ0A 3H3UA 4PBOA 2Y6GA 2FDIA 3OPZA 2GAUA 1AL22 2WFF2 1UF2C 4FPOB 3I97A 2JENA 4UT5A 5FZLA 2VD7A 4DRRA 5J48A 3NV4A 4OZXA 2X05A 4NR1A 2AR6A 1OI6A 1UKGA 4AI1A 4QDSA 4CCMA 3SH4A 4Q4X3 1S0DA 4P9XA 5JSOA 4YVSA 2VOXA 1GNZA 3EO6A 3A23A 2VVFA 5FZGA 4Z1VA 2D43A 1EV13 4K1YA 3UKTA 1YYNA 4CDQC 1W28A 2BW8A 5J37A 4IE6A 4HK9A 5F3EA 4BQWA 5F3CA 4B4PA 2P34A 3I54A 3JQWA 1Y3TA 3OY8A 4G4FA 1XNCA 4HETA 5FPUA 1EY2A 1F31A 4A42A 3THTA 5CKNA 2ZKLA 4YZ5A 1LOFA 3H8RA 3LEIA 2WNVA 3ZYFA 2VG9A 3AL5A 1O4ZA 3VBOA 1VBD1 3OG2A 1COV1 1AR83 1J1TA 2ENRA 1K45A 1KJRA 1DG6A 1MQTB 1Q8SA 1TME3 1WW6A 2LROA 4BWOA 5A3NA 1UQXA 2ZX1A 4HBNA 4FCAA 5JWPA 1QQP1 1SEFA 5IVBA 3WD5A 5FLHA 3A4UA 4N9HA 4RGKA 1H0BA 5FBJA 2WO7A 2JXAA 4YM0A 5EYXA 5BXXA 2RR11 5FXXA 1UIKA 5AC91 2XL9A 4IGPA 4UW4A 2HWB3 4UW5A 1QIQA 1CPNA 2GMMA 4RFRB 3VZJA 1G9FA 3VZMA 4EYUA 1UOBA 4MADA 3ZYRA 4Y1VA 2ZHLA 2YB7A 4LOSA 4URTA 3SLIA 4GH4B 2JICA 2Y64A 3WINE 2JDMA 4BXFA 2GC0A 4QM9A 5FZ6A 3GHMA 4MGYE 1RC6A 4HN1A 4P9IA 3OGGA 1RUH2 2RM22 4AEDA 2YPJA 3ZFFB 3ZFEC 2NZ9A 1DDLA 1C1LA 2JWPA 2PHTA 4LBQA 5FY8A 3MFAA 5CEHA 1YXWA 2J1AA 1X82A 2RV9A 3B93A 2YBKA 5DZEA 4AFCA 4XIOA 3WNPA 3JB4C 3J8F2 4LTAA 1ND2C 4C90A 2WT1A 2O1QA 5I8SA 4BK5A 1RITA 4XQDA 3SEPA 4QQ2A 4B7EA 3AP9A 4A4AA 1GFF2 1QJY1 4NVPA 2RJKA 3AMQA 3OTFA 4X6QB 2VPVA 5L7OA 1OVPA 4ORFA 1NT0A 1AF9A 3TN92 1OHFA 2XL7A 5JXIA 1SCRA 3H7YA 2J1EA 2MEV2 1A8DA 1A3KA 1CAUB 1H2NA 2EXJA 2V09A 3J7HA 4PLNA 2ARXA 3H7JA 3VBFB 4CA9A 4FT8A 4RR3B 2GN3A 2L9LA 3AKQA 3AX4A 3S5QA 1H6YA 4XOGA 4H7MA 4FTSA 1UIJA 2W9XA 5LZ6A 1OA3A 1JUIA 1PMIA 1CZVA 1SQ4A 2R062 1KQRA 1ZZ7A 4KGQA 5KBFA 1GOHA 3CF6E 4Y20A 1WZXA 2YU1A 2LW8A 1IKQA 3SITA 1ZBA2 2YC0A 5EHDA 1AL0G 1IOAA 1ODNA 5IAXA 3DF0A 1V9U3 3LZZA 1CWPA 1AR93 4NIGA 1BJQA 2YFUA 1XNTA 5FYIA 3NL1A 4YPJA 4AFDA 1JUHA 4XMAA 1FMD2 1G7YA 5A3MA 5ABJA 5I91A 1QNWA 1Y4WA 1W03A 3SCGA 3WOGA 2WO2A 3R4SA 3WDXA 1H8TA 1O8SA 1OF4A 4FPCA 2VMHA 1H2MA 2ZEXA 3QOPA 2OT7A 3T2QA 2XVGA 2WNEA 1XOYA 2MNGA 4B29A 4D94A 4EN8B 3ACLA 1LOEA 3AZWA 5A80A 4CP0A 1ZBE2 4PBPA 1AYN1 4PIYA 3OBTA 4LLFA 4YW1A 2OKXA 2GSYA 3U07A 3P3NA 4I0WB 4YVWB 1BBT2 2Y6JA 3MDPA 1BZWA 2NYYA 3D3AA 3I49A 2BU9A 3VD3A 2W52A 3N35A 1WA6X 1PVC1 3VUOA 3NSTA 5L19A 2ZMNA 3TEZA 4W6YA 1K5MA 1ENQA 3MLLA 2VOVA 2YFZA 4UBHA 3THCA 4BYYA 1Z7S2 5FOJB 3U0ZA 1HXS1 1B35C 2Z5WA 2ZZQA 3C8XA 4N8MA 5FY0A 3U1XA 1ZZ9A 4C8DA 3FUOA 4XFCA 4CP1A 1UYXA 2BEOA 4CEYC 1Q8VA 3IAPA 1BVVA 3LKJA 3IMNA 2VC9A 3T0AA 1SDDB 2PHUA 3Q8AA 4P02B 3A0NA 1LECA 3RZHA 2RDSA 4TWTA 4RHV2 5A1AA 1QY4A 2ZX4A 2C9KA 3N9MA 2K2SA 4FPJA 1SCSA 1PZ8A 5APAA 4CCEA 2WFF1 1AL21 4ZU7A 4DY5A 3M1HA 3VBUB 4A6SA 5FZIA 2DU1A 1O3RA 1UYPA 5FP3A 3ZXJA 4F83A 1GZ9A 1SHWB 2XR4A 4LMFA 5A1FA 3CJIC 2R32A 4QPIB 2QJVA 3VBHA 5HV0A 5IVCA 4BJ0A 3KVBA 1HB3A 1C5IA 4BQ1A 5C9AB 1SLBA 1Z0HA 2DTYA 5CADA 2VNOA 1OC1A 1JYCA 4Q4X2 1OBNA 3RDIA 5FPXA 5J1XA 1J3PA 2HKXA 3UGFA 1DLLA 1RUF3 1LGCA 3DUIA 3GF6A 2CU5A 1OA4A 3KCCA 1GQGA 4A41A 1EV12 1KEXA 3WNKA 1XBFA 4OHYA 3KSCA 1LEDA 3H3ZA 4AQ6A 2D3PA 1PX3A 2JG9C 1O3SA 2PLV3 4XXAA 2JECA 3KQRA 1W8FA 3HOBA 2VXRA 1Y9MA 3AKSA 1S0BA 4COYA 2ZEYA 3K3OA 1OOPA 4YWAA 4AAPA 4AI0A 4B8EA 1AR82 4MG2A 3WUDA 1YJLA 2IXHA 2PMWB 1A6CA 1TME2 2Y38A 3KF3A 3MLKA 4GJZA 5L73A 3RI8A 4ARYA 5BUVA 4NO4A 4LULA 5B2GB 1RUOA 2X5IC 3DPRC 2UY8A 4QXBA 1OUXA 2JG8B 1ZREA 1XB9A 4LE4A 1YQ6A 4QKBA 4CU9A 4M3CE 3VHPA 1NA1A 1W3VA 4IERA 3T08A 4DIQA 4L0PA 4LE3A 5FZOB 3RI9A 4AVCA 3M70A 1LESA 2HWB2 5GLTA 4AQ2A 4ZU5A 3RFRA 1JHNA 2Y0OA 1NUKA 1TMF2 3K51A 5KHGA 4R9DA 1Q5OA 2UURA 3MIDA 4D7YA 5EJ1B 3DKQA 2D5FA 3NJXA 3ORJA 3MIGA 2WQ8A 4A7ZA 4J1XA 1UKRA 4I0AA 3RGBA 3WF4A 3WQ0A 1KFUL 1POQA 1RUH1 2RM21 3OPTA 4YG6A 3MBWA 5LEKA 5CIRA 4MGQA 3RRDA 4K7JA 4F8AA 4UBGA 4D6QA 1QWRA 2XVKA 4GXLA 4D3WA 4CU7A 5C8CB 2W1QA 1AHSA 3ES4A 1DYPA 3J8F1 2BGPA 4WZCA 2BGCA 5D8AA 4KH9A 2X09A 2Q1FA 2ZGLA 4QGNA 2WAAA 2ZGQA 4H2AA 3VKNA 2GH8A 3K75B 2D6MA 3WDTA 2EIGA 2W92A 3CO2A 3I2HA 3MW2A 1B09A 1C8NA 3FE5A 2ZABA 2HH9A 5F3IA 1FOD2 4ISQA 4XQWA 2MEV1 4HANA 2JE7A 1OURA 1HQNA 5FK7A 1LGBA 1ZNPA 4CU8A 1MVQA 5EQUA 1UY1A 2JDHA 5FYMA 1J84A 1W2AX 2WO3A 5JOWA 3KF5A 3WW4A 4QPYA 5IATA 2R061 4NIIA 2ZX0A 3GBGA 1R1ZA 2VTFA 5F5AA 3MZHA 1Q8OA 2FHRA 2R073 2VY0A 1ZBA1 3CIHA 5FZBA 2KA3A 1E5IA 5LBBA 3U10A 4LK7A 1WLCA 4GB33 4MVTA 4JTNA 2R0FA 4JRAA 1F35A 4QD2A 4FOVA 5GJ6A 2D6LX 1V9U2 4QAWA 4XZPA 2OVUA 3PIJA 1G9DA 4Q29A 5I0TA 4RN5A 1UU5A 2DCKA 4J1WA 3UGHA 1V6MA 3A22A 3ZSEA 3EBRA 5A3TA 1QOSA 2XLAA 1NE6A 4OFGA 3ZMNA 3O1RA 1MS4A 5HCAA 1ZRCA 2H6CA 2BP6A 4XJ9A 2XKPA 5FKBA 1I9RA 1IS6A 3M3QA 1ZBE1 3VDDC 4A45A 4Y1YA 4GA9A 3TEWA 4DUXA 2P3YA 5FFOC 2LRPA 2LTNA 3PVNA 1BCXA 2ZGPA 5DXDA 1BBT1 4Z8BA 4LHNA 2WN3A 3HMYA 4NHLA 4IEVA 4G3YC 2K46A 1WD3A 3B3QE 4E8CA 5T3NA 4IEWA 3VV1A 2D3SA 1UU6A 4XHXA 1W0PA 1XRUA 2XGXA 2ZGRA 4QX8A 2WINB 3ILFA 3J7LA 4LKDA 4PI0A 4XXPA 3U78A 2NQYA 4XCAA 4LUMA 4Q1PA 4MZUA 1S0EA 2YHJA 4MGIE 1NCQC 1UW8A 1RMU3 1AR62 3KT4A 1PIV2 3V0AB 2GN7A 4QMAA 2XXZA 2DCTA 1RXGA 2WIIB 1G8WA 1OA2A 1SLTA 1RHI3 3ELNA 1OKQA 2V4VA 3LOIA 4C0HA 2R7EB 4GWNA 3UKNA 5DUXA 2VTXA 2XPJA 3ALQA 1H2LA 1UWWA 2R16A 1GANA 4RHV1 5A3OA 3SKJE 1IS4A 1WWYA 3WNXA 5A3UA 4JZRA 1FNZA 1HB2A 2FMDA 4GWIA 4IXLA 5I0DA 3MUY1 2I45A 4L99A 4HZFA 2FCTA 1WMXA 4D6SA 2E26A 4Q0UA 5I0UA 4ZS3A 3H1YA 5LRRA 1CX1A 2C0ZA 5H9QA 5F9TA 2JB8A 4E4ZA 4PIXA 4I02A 4YARA 1HX6A 1AR72 4Q4X1 5EIYB 1OH4A 4Q4W2 4KGGA 4BQ5A 2IXKA 2VE1A 1RXFA 2NN8A 1MS0A 1RUJ3 1U0AA 4N9IA 5DN2A 4FFGA 2XONA 4GALA 2HYKA 5E16A 1S2BA 2W87A 1RUC2 2WNUB 4GMP1 1EV11 4JGZA 4ZU4A 2HWC3 2HEVF 4JKMA 3RZJA 2QBXA 4XBLA 2F4LA 2IXIA 3PU3A 4N53A 4Z82A 1B35B 2ZKNA 4CEWA 1MEC1 1HRI3 4XIKA 4UFIA 5FY1A 2WR9A 3PVBB 2PLV2 3KT7A 1PGL2 3BIWE 3MPBA 4MHRA 4A6OA 4AHZA 1W9SA 1WKYA 1WCDJ 3CU7A 1HB4A 3WG2A 5JAXA 5C8WA 2VZTA 5F7UA 1H2KA 5BNOA 3AC0A 2QQKA 4GJYA 3S7EA 1ODMA 5D1IA 2A7AA 1DCSA 4UXAA 5I8TA 3NKGA 3S30A 3SHRA 2YBPA 3FJSA 4EV0A 2HJIA 3OEAA 3ABZA 3SC7X 1O5LA 2YGLA 2A6VA 1FPN3 3FL7A 4Y1ZA 5JZGA 1S2EA 3MO4A 4CDUB 1TMF1 4EN6B 5GZDA 4YVSC 3E5QA 3D0SA 4Y5TA 3ZXDA 1W90A 3CZJA 3FHIB 4LIUA 5FLJA 3ROUA 4ZONA 1UY2A 1VBE3 1HRV3 3OF1A 2VM9A 4W8JA 5BNNB 3U75A 2Q1ZB 4QXKA 4IV1A 1ZRDA 1LOFC 3FZ3A 3AZZA 3R05A 4KBBA 3MEPA 2WNVC 3BALA 4XZUG 4OI1A 5DZGA 5J96B 3IKWA 1SZBA 3T2PA 1KRIA 1KJLA 1NKGA 2ETEA 2PHLA 2PQQA 5K0UA 3VBOC 3D82A 1O91A 1C57A 4XUTA 1UY4A 4XF4A 3P3PA 3SNMA 4PF5A 4NHKA 1L7QA 5HPOA 5F32A 1XYNA 5FYUA 4Q0VA 2YMZA 2ZGOA 3TWIA 2RMU3 3H8XA 1FOD1 1S55A 1LEMA 5CG9A 2P3KA 3JB8A 5JDBA 4URAA 2CL2A 3VDBA 1W04A 1OH3A 4YG3A 1N1YA 1W8HA 5A7QA 1VBB2 2IXCA 3LEMA 4FPKA 2ARBA 4PDWA 3EB7A 1UYYA 4LO5B 2XBO3 3WF2A 4AW7A 2G4IA 2B39A 1PO12 2W91A 3HEIA 1QJX1 2VZOA 4RQPB 4EN9B 4B4QA 4JX0A 4XBQA 2R072 2LALA 3VKFC 4AYUA 1O8PA 1J1LA 2TBVA 3MYXA 3WP4A 1OMIA 3POBA 5G05L 5FZ7A 3AMNA 2ZOEB 4IEOA 4DO0A 4LA2A 1U5YA 1RUD3 4SBVA 4XEZA 1H30A 3G7DA 4D7SA 3NAPA 4JC1A 4ZXKA 5IHRA 3VBRB 1AJKA 3H50A 3IT8A 2BYVE 1J83A 3HBZA 4MX3A 2RS53 2Q30A 3T1MA 1CIYA 3MIHA 4P00B 4O61A 1XNBA 1WBLA 3UK9A 2ZGNA 5L7OC 4IETA 3MI8A 3GM8A 4LT5A 5FXZA 2VULA 2GNDA 2DWRA 1GQPA 1CD3G 4QPGA 2Q4SA 4HKLA 1YQCA 3FLPA 2P17A 1D4VB 3IPVA 3O0VA 5TSWA 4HPKB 3SKVA 4CDXB 4YW2A 3WX5A 2PHFA 5F5IA 4H14A 3APBA 4H55A 3KCYA 5CAZA 3LB9A 1AR61 3V56A 1QGLA 4FP2A 2LUWA 2XVLA 1PIV1 3GBFA 4WM7A 5FV3A 3P1IA 1RMU2 4XF3A 4ZS2A 1OSGA 1JYWA 2VQ0A 1QJZA 2JDAA 5EXOA 2EXKA 1N1VA 1W8WA 2JDNA 5A7WB 1W6MB 1FXZA 1RHI2 3JBG2 3VBSA 5JMOA 4XDOA 3IWZA 2WQ4A 1AJOA 4LPLA 3S57A 2A6XA 2CWSA 2JD9A 2ZS6B 2QQVA 4IE7A 1W9FA 4QXCA 1POV1 4XC9A 5ABJC 1V00A 1W8TA 1XSRA 2V5YA 3GHNA 5A7NA 1H8TC 4CDWB 3OD4A 2GDFA 3DKWA 3C2UA 1ULFA 3WT3A 1QJU2 3SXWA 3VDDB 3RWNA 4YSFA 1LKNA 1AR71 2E7TA 3U14A 4JCKA 1UO9A 2VBPA 4Q4W1 4Y33A 1LNSA 2YY1A 1QOOA 1TZOA 3W21A 2CNAA 2BNOA 1CAXB 1W99A 2JDZA 2G9FA 3AKTA 2EXIA 1TNFA 1D7PM 4CCNA 1JYTA 1H4GA 1RUC1 2RS32 4COVA 4QB6A 4MUVA 4EJRA 2ZHMA 5GZEA 1MS9A 1CVNA 2HWC2 2FDGA 4FFFA 3DXTA 4HKWA 4IV3B 1K5MC 3QBQA 3ZYIB 4KQ7A 3I2KA 4KI5M 2Y6FA 1QKQA 2PLV1 4OULA 1PGL1 1HRI2 1O3QA 3L2HA 5IK5A 3O1UA 5F39A 4OI0A 3O12A 4D7TA 1OFNA 1QXRA 2Q0AA 3E6DA 1WCUA 2E7QA 3D0JA 5DG2A 5FXWA 4NHMA 3UYJA 1DU3D 2ZTNA 4DPNA 5HCFA 2XUMA 1EUTA 2Q8EA 1TEIA 1RVF2 3WDUA 1RUI1 3PLQA 2B45X 2XQRA 3RYPA 5CFDA 1W0OA 1REEA 2RJLA 3I59A 1DGRN 3J26N 4E4DX 1CAWA 5J09A 5FYZA 3WLUA 3MFCA 2BVVA 3VBHC 1W2UA 4B1LA 4UAPA 1AXZA 2GC2A 4N43B 4DQAA 3N9PA 3J4UH 5A32A 3WW2A 4QPWA 1Q8QA 5BY5A 4LBLA 1WW4A 2FCUA 2BFUL 3NVCA 3NV3A 2ZPXA 4AFAA 4QQLA 3VZLA 4Q4Y2 3VKOA 2BGOA 1OFSA 1ONAA 4U2AA 4QU1A 1VBE2 2Z42A 2D6KA 4NN0A 1HRV2 4LUKA 1H1IA 1GSLA 1UXXX 4Q1RA 2QQWA 2BJSA 4KWLA 1QEXA 3QCWA 3ZR5A 2G19A 3LFIA 1EP0A 3ITQA 2Y0IA 4XW3A 2CAUA 3OUHA 3F2ZA 5EPAA 5FKCA 3AVRA 3AXEA 4WVMA 5DABA 1LU1A 1OOPC 2A71A 2W68A 2JKXA 2W95A 3I8TA 4FFHA 5C4WA 2FD8A 4B3NA 5A33B 4FOYA 3GCWA 1WGPA 3BOWA 4DFSA 3OCPA 2WDBA 5FMCA 5LBFA 4LKFA 3ZPOA 3I2GA 1LHNA 2RMU2 1XE8A 2HEYF 4IEQA 2XJRA 4INDA 1XE7A 3USUA 4GULA 3PUQA 3RMXA 1EUUA 2GMPA 4OLLA 2UYBA 1G9AA 1AX0A 4E2SA 4R8HA 1NA1C 1VBB1 5A1LA 5A6YA 1C3HA 3IB3A 4NRPA 4UW3A 4FPYA 3OUJA 1GBGA 4SLIA 1HV0A 2VNVA 3JU9A 5DAQA 5DDJ3 3SH3A 1PO23 3KV9A 4CP9B 4L8QA 4WZFA 3TYJA 5AFBA 1HW5A 1PO11 1SLIA 2DBNA 5FYHA 5FZ8A 2ADDA 3P5BA 5LB6A 1XQNA 2E31A 2DUQA 4CCDA 3N36A 3T2OA 4L97A 2ZGTA 2WUHA 2NPIA 3RJ2X 1R091 4QHZA 4D0QA 2R043 2EICA 4KMQA 2JJ6A 4W6XA 1V6OA 3VBOB 1RUD2 2B8MA 1ZRIA 1EYBA 1GZWB 3FHQA 1Y9QA 3ZM8A 5D8AC 4QX2A 4LR4A 2QQJA 3WHTA 1SBDA 2SBAA 1QH6A 2CSGA 2WLPA 2MPFA 4K9SA 1KD7A 1MZ5A 3ASIA 3C7OA 5IVFA 2ZMLA 3WP5A 1NCRB 2QDNA 1JOBA 1C5HA 1TVGA 4L11A 3GBWA 5GLWA 4DUVA 1VBA2 4X8NA 5FZDA 4DS0A 2FBEA 2WWSA 1NLSA 1SLLA 2D98A 3JD72 4OQ8A 1H4HA 1UOFA 5F2SA 4E8DA 4YW3A 1ZX5A 1LAJA 5FPZA 1PGSA 3DEMA 3JBG1 1RHI1 5FMBA 1XJAA 1SFPA 2AH2A 2Y33A 3O0WA 4QHBA 1AZDA 2OUJA 2W47A 1EAH1 1JI6A 3OGRA 2BNNA 4MXWB 4TYSA 2XWBB 1RGSA 4AEDB 4QX7A 1DYKA 2VCAA 4YZ3A 5GLUA 4YNIA 3B00A 2IVIB 3WQ1A 5C70A 1GWKA 1HB1A 1D4M2 1CJPA 5FO7B 3HQUA 1F15A 4IGOA 1QJU1 5SV8A 2W39A 5FJKA 5HCBA 3VN4A 4AXOA 3MGUA 1RL3A 5FTTC 1JHJA 4TZDA 3C3VA 2R6QA 1X9TA 4COWA 4XUOA 2RS31 2VW2A 3JQXA 5BNPB 5FWEA 1JZ2A 1CJDA 3BOPA 3C7HA 2YU2A 1M4WA 2MHFA 2Q8DA 1MPXA 1UN1A 3AVSA 1IPJA 2HYXA 1K5JA 1NQDA 1US2A 1IS3A 3CKHA 3ZYPA 1SBEA 1UL9A 4ZHNA 1PZ7A 2RS12 2IXLA 3DECA 5A3PA 5JSPA 5LEJA 2XHNA 1HRI1 3LCPA 1RYYA 1G9BA 3N9LA 4NE9A 5FJHA 2JIGA 3RVHA 3NNFA 4GH4A 3KQ4B 4PLMA 1ULEA 4R52A 5IWFA 4UYBA 1XXNA 2PHXA 4NPLA 4PF1A 4BOWA 3POYA 3LEKA 5LA2A 5ABJB 2HWF2 4FTBA 5F5QA 4LO7A 4XYXA 3WCSA 4NIAA 3ZFFA 1RVF1 4BB3A 4L92A 2WYSA 2VECA 3AMMA 3AXDA 4QQHA 5FPVA 5F2WA 3WXPA 1YIFA 1RUE3 3QH6A 2YG0A 3K48A 4R4ZA 5A7SA 2B4KA 4Q4V2 1W6NB 1FI2A 2QQOA 5FUPA 1CN1A 1WCSA 3BGAA 3BTYA 3LWCA 1ND3B 3UJOA 3B01A 1ENRA 2J1SA 5E88A 4RL7A 3ZXLA 5CB7A 5J98B 3MW4A 3VDAA 1X9PA 4Q4Y1 4WVWA 1X33A 4JGZC 1CAUA 2HWD3 1IS5A 2ZCWA 4FQZA 1VBE1 5DAPA 5FYYA 1H8VA 1HRV1 2WO1A 3VBFA 4RR3A 3K4DA 4BZ4A 3DV8A 4BLIA 4N7UA 2HBTA 4GAZA 3WNNA 2BQPA 4N53C 4CEWC 1R1A3 3TEXA 1MZEA 2HEWF 2YPDA 1J58A 1GOGA 1RUG3 3N9QA 4TN7A 4LBKA 3IIAA 4K1ZA 4IESA 4YG0A 4ASLA 1V6JA 2XDVA 1I5PA 4BIFA 1LHUA 4AQTA 1IPSA 3GZUC 1L7LA 1SFYA 3KWVA 2VUCA 1G9CA 2IFWA 2IFRA 4BIOA 1CR7A 2BWAA 5GM0A 5BNOC 4CU6A 1JYVA 3OGJA 3ILRA 1K42A 1UU4A 3OGVA 1LJ7A 3Q8FA 4QU2A 1BEV3 3FX3A 4YFZA 3RZZA 1BMV2 1BXHA 2JB4A 5L9VA 2D6NA 2WZR3 3PMEA 1CX4A 1NZIA 5CG8A 4G9SB 3I2IA 1VRH2 4O7XA 4QKFA 5JZGC 1ULGA
chains in the Genus database with same CATH topology
3WV6A 4XFHA 5KXEA 1PO22 2Z69A 3CLPA 4OHVA 2DUPA 4YVWA 2DVBA 1QH7A 5LK5A 1GZCA 2WSUA 1DQ1A 1ZZCA 2BPA2 2DYCA 1N3QA 5CVRA 5FCCA 5CFCB 4IV1C 1ZZ6A 2DV9A 1ULCA 2R1DA 1RUNA 4JAAA 1RUD1 4P9GA 4LHKA 4DNYA 5K0UC 5T5JA 3AKRA 1YIPA 4FPFA 5JIAA 4M0HA 2B7YA 5T54A 1APNA 3TB0A 4ONUA 2DCJA 4MGZE 4COZA 2VVEA 4K21A 1LOAA 1HKDA 1ALYA 4K3UA 4P9JA 1DFQA 4HL0A 2AGSA 4HSJA 3N7LA 3RMYA 3PHMA 1AYM3 4Q0QA 2CWMA 1VBA1 4PDWC 1YJKA 3E6BA 3TNQA 3JD71 5C9AA 2XJQA 1O5UA 1QDCA 3IDEA 1PK6A 2WS93 3AMHA 1YLLA 4FBFA 3ILNA 2AENA 2D6PA 3ZDSA 2HWE3 2WSVA 4OHWA 1U12A 2A70A 3WZ1A 2JE9A 1D4M1 3FWEA 4CDQB 4PIZA 4B4RA 3NAPC 1HV1A 3ENRA 2F4PA 2YXSA 3HT1A 4WM8A 2YROA 1YCIA 4HSLA 4RS5C 2PHWA 4XJWA 4QPGC 4KNCA 3KM5A 4GKXA 1QXJA 2JG8A 3PVOA 2DFBA 3R4UA 2CY6A 4HN0A 3TN91 4XETA 4AEMA 2RS11 2D93A 4WM7C 2ZAHA 3MF9A 5SV5A 1J3RA 4AHWA 5KHKA 1D0HA 3VBSC 5JCTA 1FNYA 4TLFA 5I0RA 2HWF1 4I30A 3SCHA 1MACA 1VALA 4P14A 4V1PA 1YFWA 1CQ9A 1IQAA 4FO9A 1F5FA 4LO8A 2YYOA 4QX5A 5C8CA 4JRLA 4PCRA 3ZFEB 3ZPYA 1UX6A 5AVPA 1AR92 4Q4V1 1FMD1 4MH0E 3ZFGA 2I74A 1GV9A 1VBC3 2CTVA 2Q8OA 4IL7A 4XTMA 1C8M3 4AK3A 1WW5A 1LHOA 1ND2B 2ERFA 2XHKA 4ES8A 3PTYA 4FP3A 4CRQA 4YGBA 2NLRA 2OYZA 2B46X 2CAVA 2XLFA 1DBNA 3M3IA 4KWKA 4LBJA 4JVAA 4YGCA 1LOCA 3DN7A 4Q8LA 1R1A2 3V0BB 1VR3A 1RUG2 2ILMA 3NW4A 2A3XA 4XF0A 4Y1XA 1MS1A 1Z7S1 2E7AA 4IEZA 5F6LB 1JN2P 1YWKA 4YLZA 4I0BA 1Q56A 2OPKA 1YRZA 4PQ9A 1SFNA 4GIQA 4Y22B 1XU2A 1ASJ3 1BEV2 1A78A 1DZQA 1EPZA 1URXA 5CFDC 1VBD3 1COV3 1BVP1 3O0XA 4QT6A 2PTMA 2ET1A 4HVRA 1DZTA 1XYPA 1VRH1 5KWRA 3DGTA 1OPMA 1MZFA 1VAMA 4HVOA 4QGMA 2XJUA 5HI0A 2UU8A 2RR13 4C1WA 2UYAA 2FZ1A 5AC93 2VNRA 2XH6A 4IEUA 1X8MA 4N53B 2WFPA 2WLQA 1R083 4BE3A 1SACA 1RUF2 2OUHA 1N47A 4HLTA 4AHYA 3NJZA 5EZWA 5BYNA 1GNHA 2GZWA 4W6WA 1IHMA 4F3JA 1SMVA 1C1FA 1LOGA 3ZYJB 4AEKA 5C4WC 4QQPA 5LK7B 1JW6A 2WC2A 3M4FA 4P9LA 4CEYB 5KC5A 2IC1A 1AR81 1AVBA 2A3WA 1TME1 5K9YA 1DQ5A 1GYKA 4KWJA 5FQ0B 4B7KA 2EAKA 3AMPA 4OI2A 3RSJA 3BTAA 1FX5A 1BYHA 2XG3A 5GALA 1PNGA 2PFWA 3CJIB 1UZYA 3KB5A 4FOWA 1E57A 4FAHA 2XB6C 3M3EA 2X8KA 4LEJA 2HWB1 2WKKA 1FT9A 3M2MA 3OYWB 2WNUA 1VLNA 3MF6A 1N3OA 1YHFA 3AP6A 3HQXA 2HWE2 2QUOA 1UPSA 1N1TA 4KU8A 2ZHNA 1HQWA 1PVXA 2H0VA 1WCKA 4X8PA 3IDBB 5JOYA 2JG9B 3B9IA 3CEWA 1OLRA 2ZACA 4DOUA 2QVSB 5J36A 2YZ4A 4FVVA 2VMGA 5GLZA 5CNAA 3ZN6B 3PVEA 1U5XA 2VUAA 2PA7A 4BPZA 4ISRA 2X5IB 4JTOA 3DPRB 4DZGA 1AYN3 1IZ3A 1TQ5A 2B5HA 4CDUA 3U4XA 2CGOA 4IEPA 1MS8A 4S2FA 4FAGA 4AGGA 5A3LA 3KS7A 4Q8KA 1W39A 4XFIA 1PVC3 1LHVA 1LR5A 3LOBA 1OQEA 4ZKTB 3UKVA 1O7FA 4Z07A 5BNNA 4FOQA 1HXS3 3AP5A 3WDYA 2CYFA 2R0HA 3N7MA 4FXGB 5FAXA 1DQ0A 2E63A 1V9U1 4GB32 3WDVA 5EV7A 1NY72 1AR91 4W65A 4M3CB 1NYWA 4EWAA 1VAVA 4RGAA 4S2DA 1YO8A 3J9SA 1AX1A 1C8M2 2WFF3 1AL23 2D40A 3GNEA 2P3JA 3NKTA 4GKYA 4RS5A 2QKDA 1WBFA 3FLRA 3PJYA 3H8UA 5IT6A 1JBCA 1R1A1 1WUVA 3KZ4C 1PGW2 1D2QA 1XNDA 1U5ZA 4RQPA 4GH4C 1Z78A 3ZYGA 2EAAA 5LRSA 1F8VA 5DUWA 1VB4A 2A6YA 3MIFA 4Y5Z0 1S0CA 3ZFFC 1FV2A 1Q3EA 4FPGA 4DRVA 3GYDA 3NO8A 4LBMA 1ENXA 1ASJ2 5DG1A 3WP3A 1ZZBA 3VBRA 1BKZA 2WL1A 2ZZJA 5KXDA 2C5DA 2IWGB 4Q26A 1GR3A 4I3GA 3N3HA 3M3CA 3EXUA 3VKMA 2ZGSA 5J7MA 3R6SA 4CDXA 3H9AA 4HPKA 4WVZA 5AVAA 4FSJA 3VBFC 4XE9A 4RR3C 5K7PA 1W6QB 4P5HA 1WLDA 2AZ5A 1RUF1 2I07B 3AP4A 1R082 4YM1A 1RUJ2 3R0RA 4KU7A 4Y1UA 5JPNB 3AYDA 3VGIA 2VMIA 1H9WA 1NCQB 4A7YA 3RPQA 1RUH3 2RM23 3TBDA 2QZ2A 2ZX3A 2ET7A 3LA3A 1V6KA 3ZVXA 4CTEA 5T5OA 5CFDB 2Y26A 1CAWB 2WA4A 1QXPA 3J8F3 4K40A 4CDWA 3WHUA 1KDMA 4AVSA 5HBAA 4D69A 2B9UA 4J6GA 3WW3A 3WCRA 4Y4YA 2WQZC 2NP0A 4FPHA 2D7FA 2IZWA 3ETQA 1UD1A 2VOKA 4YVWC 1CAXA 4DY3A 4JGYA 1GQHA 2TNFA 1FPN2 1W6PA 2A3YA 4BM8A 4BA6A 5EWSA 3ZSKA 4IV3A 1CAVB 2R063 4I01A 4RD7A 2O8QA 4EN0A 3OJBA 4WVMB 3THPA 1QNYA 1W6OB 1ZBA3 3HD8B 5C4WB 2DCYA 2VGDA 5E89A 1RB8G 1RTVA 1YUDA 3LA2A 1CPMA 1G6NA 1S2KA 4NOTA 1LB2A 1TNRA 2VUJA 3INAA 3SCFA 3HWJA 2LM3A 2XJTA 4X6RB 4QPIC 4QM8A 3WR0A 1ZBE3 4N43A 2VH9A 5C9AC 3D8CA 4Y24A 1PK6C 2ZGKA 5JPMB 4H7LA 5K8SA 3I4IA 4EWEA 3E97A 1YFXA 4YVSB 4JQRA 2XBO2 1PVC2 2BVBA 1H1AA 3WG3A 1L3JA 4HK8A 2PYTA 2N7GA 4YZ2A 2R071 2R30A 4GB31 2D3RA 4Z2WA 1NY71 3OY8B 3LSEA 4XPVA 2DF7A 1BK1A 4AFBA 1I5ZA 2ZGMA 4XJ8A 3A0KA 2D5HA 4XQ4A 2WNVB 2QQPA 4RHV3 4WM8C 1X8EA 2UY9A 2PAMA 5A33A 2DVDA 4MSVA 5J3UA 4AVBA 2OW4A 1IPKA 2JG8C 2RS52 3IDCB 5IK7A 1KFXL 3UJQA 1V70A 5JMCA 5IK8A 3W9AA 4EROA 3B7MA 2OZ6A 4AVVA 1QDOA 5IK4A 4XF1A 2PAEA 1PGW1 2YDEA 2GNMA 3KT1A 1WMEA 1NXMA 1O4YA 2VW1A 1NQJA 4I09A 3CL1A 1Y7BA 2A6WA 4GMP3 1RMU1 3RNSA 3DL3A 5FMOL 2DVFA 4YZ1A 1JYIA 2Q1MA 1MEC3 2ZHKA 1X36A 3WY6A 1VAKA 2WJSA 3JUUA 5KXBA 1ASJ1 4DMIA 5C8CC 3AJZA 2VW0A 3QACA 1GZWA 2KXLA 2ES3A 2A75A 4COUA 4RFT0 3ZFGC 2X29A 1QF3A 4LBQB 1HLCA 1DGLA 1VP6A 2P2KA 1V6NA 1DQ2A 2EVXA 2RHPA 2O0OA 4GMP0 5JVVA 3U11A 2UWCA 2ZX2A 4ITCA 1YFYA 5L7OB 2DTWA 2BBVA 1NCRA 1MQTA 3L2YA 5GZGA 4O9GA 5CA6A 4MYEA 3VL8A 1DIWA 1NE4A 3URFA 1TMF3 1R081 3POWA 1RUJ1 3VHNA 5HXVA 2YV8A 4K6BA 3H0OA 2HWC1 2ZBJA 3GZAA 5H9RA 4KG8A 1ZVFA 4M0NA 4MGKE 1JH5A 4MXWA 2NMOA 5JOXA 3WDWA 4HMZA 1O3TA 4Y20B 2YGMA 4YFWA 3BCWA 4XTPA 2GALA 4IEYA 2EF6A 2VOWA 2SLIA 1ZA4A 5E8AA 1DGRA 2EXHA 1S0FA 1H8TB 3ZN5A 1JTZX 2GNTA 2PELA 3B69A 3T1LA 1QMJA 1FOD3 4AWDA 4Z92B 5JI9A 1WD4A 4KL1A 4IQPA 1HQLA 3B9CA 1DQ4A 4Q0SA 3VLBB 1MS3A 2Z2SB 2CGNA 1FPN1 3B02A 4H3WA 5BNPA 3D6EA 3SMHA 1XYOA 1HIXA 3MLJA 2I2SA 1FAYA 2VU9A 4AGRA 5FLIA 3V64A 4FQ4A 1DGWA 1QJX3 3N4MA 3BB6A 3N7JA 3AP7A 1IGOA 4M00A 1I6XA 1K5MB 1PM7A 1WLTA 2P3IA 3V65A 5JIUA 1S1AA 3UV9A 4XFBA 2E51A 1LCLA 1MS5A 2A5ZA 1ZYBA 4I3PA 4OHZA 4ATFA 4ATEA 3QH7A 4NWWA 4R9AA 3TNPB 2UWBA 5ACA3 2RMU1 1W6NA 5T5LA 1KS4A 1MR5A 1ND3A 3RYKA 3WP6A 3BU7A 1LOBA 2BFUS 1RIRA 4HFSA 1OLQA 2DFCA 3VBHB 1HDKA 3AZYA 2GMEA 2BNMA 2WNUC 2XBO1 1PNFA 1WMDA 3FUQA 5DDJ2 1AR63 1LENA 3H1WA 3Q9OA 2GU9A 4EN7B 1PIV3 1LRHA 4Q27A 2C1FA 2G9GA 3AKPA 4AI2A 1H9PA 5FREA 2EALA 3VZOA 1XNKA 3GALA 3MW3A 1TE1B 2FQPA 1REDA 3CJXA 1JXNA 1DHKB 5L36A 3FMGA 1BQPA 3ZSLA 2R042 1POV3 2PHRA 1DZRA 3ZXFA 4YM3A 1OOPB 3MIBA 4META 2GC3A 1Y43B 4LO4B 1MZ6A 2GNBA 2NM1A 2RS51 2WT2A 3AYCA 4M3CF 4U36A 2XJVA 2ZJCA 1AR73 2FZ2A 1JOJA 1PK6B 4Q4W3 4XBNA 1LTEA 4CDUC 4L9BA 3VBUA 2GH2A 1YFUA 1NA1B 3KCXA 3IM0A 1CESA 1GICA 1RUC3 1OQ1A 3BPZA 4MV2A 4QPIA 4RSUA 1S0JA 1POV0 4BMEA 4R9BA 1RINA 5GKAC 5CFCA 1S0GA 4YW4A 5BNNC 3M8LA 3LSDA 1MEC2 4E4SA 3PJQA 4AE2A 3ZN4A 4FPLA 4I2OA 1ZRFA 1DF0A 4WM8B 1RJ7A 2ZMKA 2OA2A 3KMHA 1UZZA 3PMSA 5D8AB 1RUI3 1GLHA 1FV3A 4C0BA 3RS6A 2NMNA 2BTVC 1REFA 5C6CA 1SDWA 3WW1A 3AZXA 3ST7A 1UMZA 4Q2FA 4R9CA 1CONA 2QCSB 3AJYA 5FMOS 1NOVA 4HT1T 4XJAA 4RQPC 2JD4A 4CYDA 2PAKA 5DUVA 2EA7A 1OD5A 3SISA 4YYOA 5DZFA 3VL9A 3HT2A 2QFEA 4CDQA 5H9SA 2BUKA 4GWMA 4LLOA 4RGGA 3VBRC 4O9EA 2W0XA 3ZFGB 3VZKA 2R1BA 3I2DA 4ASMB 3IN9A 1FYUA 2JEMA 4WBBA 1ZRRA 2DVGA 3E6CC 1RUE2 3JCIA 3ZSMA 4CDXC 1SLCA 1VBB3 4IEXA 2Z79A 1XU1A 4C1XA 3BODA 3O7OA 3AB0A 3ATGA 2XLGA 3MPPG 1PO13 3UL2A 3PNAA 4WVVA 2Q5TA 4JDNA 1QJX2 5KXCA 2RE9A 2HWD2 2R49A 1F9KA 3ZXEA 3I7DA 2AUYA 1R093 1LULA 4A2UA 3B94A 5BNQA 5BPXA 1SLAA 4YGDA 3POSA 5KHHA 2D97A 2C9AA 3TOJA 4CDWC 4CZSA 1A8MA 2W08A 2IXJA 3GZTB 3ZFEA 4S2HA 5F6KA 5ACA2 1BMV1 1N3PA 1YI9A 2B42B 1NLRA 5FO9B 3AZVA 1ND2A 2WZR2 4XFAA 3RJRA 2E53A 4JGYC 4NWVA 1I1EA 5F1RA 5DDJ1 3TRSB 2QDRA 1PO21 4UW6A 2DU0A 1QQP3 2AREA 1X7NA 3VHOA 1KDKA 4IV3C 4JGZB 4TSVA 3FLTA 5JOZA 3KGLA 3JBG3 3V0BA 2P37A 5KHJA 3AFKA 3M7AA 1CGPA 1EAH3 3T2TA 4CEWB 4P9WA 4EWDA 3HR9A 3NV1A 3LA7A 5FBZA 3WVJA 3V0AA 2R041 4AVAA 3AFGA 4XILA 4Y22A 2WT0A 4DINB 5CU1A 4KG0A 5CBLA 1ENSA 1QJU3 4JDMA 4K20A 4LBOA 5T50A 5BNOB 1AUYA 4DB5A 3ZXKA 1X50A 2JKBA 4XMIA 4FPEA 4AF9A 4N43C 1H1MA 3ZXAC 1KITA 3N7KA 3ECQA 1V6IA 2RS33 1AYM2 3IBMA 1C28A 5JZGB 1QJY3 1NG0A 5JSRA 1GKBA 3W58A 5EYYA 4AEJA 3AYEA 2PN5A 3KD4A 4N90A 2ZGUA 2WS92 4E27A 1OPOA 3EQEA 4BLJA 1D2SA 1ULDA 4AGVA 3FBYA 4IV1B 1AXKA 3VKLA 1WA4A 1B35A 4BH9A 5FOBB 5K0UB 1RVF3 2WA3A 3NV2A 2ZA9A 3EHKA 1RUI2 4CEYA 3D5OA 1PZ9A 5IUQA 2CV6A 3WQ7A 3ES1A 4OVEA 1ZM1A 5FQ0A 3L9JT 4MLOA 2E6VA 1QOTA 3CJIA 4Q4Y3 4C91A 4PDWB 2XJSA 4BMBA 1QHDA 4E2QA 1D0GA 4N7IA 2A6ZA 2TEPA 4BHPA 3OYWA 5FDBA 3ZX7A 5FO8B 4DXZA 2KM2A 3B5LB 3USSA 2BWCA 5T52A 2A73B 4LHLA 4LBNA 3O14A 4XFGA 1Q8PA 1T6GC 2DURA 2JG9A 4BCUA 4YW5A 3JZVA 3NAPB 3SH5A 5GZCA 4LNVA 2QE3A 1IKPA 1RUE1 4JDOA 2D6OX 1NCRC 1MQTC 1VB2A 4RS5B 3ZN6A 1VBC2 4AI8A 4QPGB 3AK0A 4K8FA 1NZCA 2X5IA 3DPRA 3IPVB 1LODA 4F7ZA 3MIEA 3WG1A 4L2NA 5KHIA 5JR7B 2HWD1 4GQ7A 2QNKA 4JV4A 4WM7B 2UWAA 3ZMOA 4AEDC 2F6BA 1R092 1RUG1 4FXKB 2DUOA 4AQSA 3VBSB 2CGPA 4ES9A 4XHBA 5GZFA 3S7IA 4AFMA 4LBQD 3ZXGA 4AI3A 2OIIA 4XDQA 3QLQA 4Y26A 3HAGA 5EJ3A 3NWKA 4M3CA 3HN1A 5ACA1 1BEV1 3D4KA 3E5UA 1I3HA 5GLVA 1VBD2 3E5XA 1COV2 2WZR1 3FFZA 5H9PA 3RG0A 3FFQA 5T5PA 5BNPC 1VBA3 3LAGA 4YM2A 1FATA 5JI7A 3JD73 1QQP2 1C4RA 1NXD1 1EPWA 4OUMA 4A3XA 3ME2A 2O8OA 2RR12 4WV8A 3R4DB 5I0SA 2FMYA 1J59A 1KS5A 3AM2A 5AC92 1UCXA 1EAH2 5EFUA 1YNAA 1F5JA 1RJ8A 5JLVA 1D4M3 3OD0A 2JX9A 3M3OA 3ZIWA 2GC1A 2DVAA 2K0GA 1W6MA 5C33A 4XF9A 1CIWA 4OI4A 1PHMA 3VZNA 2WZPP 4OHXA 2OZJA 3I59B 4YZ4A 4QQOA 1ND3C 1MVEA 3VHRA 5KC6A 1AYM1 3CNAA 3ZSJA 4JGYB 4P9YA 1U5IA 5A32B 1W6PB 4PJYA 4A7KA 3VDDA 4CP2A 1QJY2 2XKOA 3TN93 2XWJB 1J3QA 2YUEA 3WG4A 2WS91 3ZO0B 1W6QA 2RS13 3KGZA 4AHXA 2MEV3 4XFFA 3WUCA 2H0BA 4AG4A 1AXYA 2QZ3A 4MXVA 3KLSA 1DGWX 2HWE1 3S6PA 3X29B 3S0MA 3MICA 1M06G 1NCQA 2VVDA 2HWF3 2K9ZA 3HIFA 5AFEA 1G86A 4HKOA 4XJUA 5T55A 2VNGA 1KXGA 4NPRA 5I93A 5E1RA 1LU2A 2VQAA 1WLWA 1V6LA 2H6BA 4Q4V3 5I8YA 1VIWB 1FMD3 5DUUA 3AYAA 4YGEA 1ZZ8A 4FTEA 3G6JB 1N1SA 3USUB 2XJPA 3VBUC 4RA0A 4YRDA 1LHWA 1O4TA 3TAYA 3ZIXA 1S0IA 1UPIA 1SBFA 4LO6B 5BV6A 2X53S 2PHDA 1QU0A 3OBRA 1AYN2 1WW7A 1BBT3 2ATFA 5CFCC 5FRAA 4XJZA 3FBMA 3O5SA 3EJKA 1DQ6A 1CAVA 1OQDA 2ZAAA 4M01A 3H1MA 1YI7A 2TUNA 2DCZA 4Q0PA 2AYHA 2V73A 1LGNA 1W6OA 4E2GA 4S2GA 1Z7S3 4OUSA 1WMFA 3QD6A 1HXS2 1F2NA 4QGLA 2D44A 1AX2A 4E9KA 1VJ2A 3RYRA 1UAIA 3W59A 4HVQA 3FC0A 4AVTA 2E9QA 3LGRA 4R4XA 4LA3A 1Q43A 4PLOA 1VBC1 1VRH3 1C8M1 3RQ0A 3H3UA 4PBOA 3OPZA 2GAUA 1AL22 2WFF2 1UF2C 4FPOB 2JENA 4DRRA 5J48A 3NV4A 4OZXA 4NR1A 2AR6A 1OI6A 1UKGA 4AI1A 3SH4A 4Q4X3 1S0DA 4P9XA 5JSOA 4YVSA 2VOXA 1GNZA 3EO6A 2VVFA 4Z1VA 2D43A 1EV13 4K1YA 3UKTA 1YYNA 4CDQC 5J37A 2BW8A 4HK9A 4B4PA 2P34A 3I54A 3JQWA 1Y3TA 3OY8A 4G4FA 1XNCA 4HETA 1EY2A 1F31A 3THTA 2ZKLA 4YZ5A 1LOFA 2WNVA 2VG9A 1O4ZA 3VBOA 1VBD1 1COV1 1AR83 1J1TA 2ENRA 1KJRA 1DG6A 1WW6A 1MQTB 1Q8SA 1TME3 4BWOA 2ZX1A 4HBNA 4FCAA 5JWPA 1QQP1