1RVF2

Fab complexed with intact human rhinovirus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 35
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf200
1FOD2 2HWB2 1QQP3 1HXS1 4WM8C 2HWE1 1FMD1 1MEC3 3JD71 5C9AB 4WM7A 1H8TC 1RUE2 1ZBE3 4Z92B 4Q4X3 5ACA1 1ND2B 1CJDA 2QQPA 2HWE3 2WZR3 1TMF3 5A32B 1RUF1 1FOD1 1ND3A 1BEV3 2HWB1 4CDQB 1M06G 2WS93 1X33A 1PIV3 1X36A 4AEDC 1RUE1 4WM8A 2GSYA 5J96B 1RUF3 1RUC2 1FOD3 2PLV2 4GMP1 1PGW1 3ZFGA 1F8VA 3VDDC 3JBG2 1OOPA 5ABJC 1QJU2 1RUE3 3FBMA 5CFCC 1OPOA 1R082 3VBHA 5LK7B 3VBRC 4CEWB 4GMP3 1BBT3 1VBA2 4RFT0 2GH8A 1ND3B 1NY72 1VB4A 2RS32 1PVC2 2XBO1 2WWSA 1COV2 1V9U3 5BNOC 3JBG1 5C8CC 1TME2 5K0UC 1NA1A 1VB2A 4IV1C 1QJU1 4GMP0 1ASJ2 4CDUA 3VDDA 1R081 4YVWB 5FOJB 2PLV3 1RUC3 3ZFGB 2RMU2 1OOPB 1VBA1 4Y4YA 3JBG3 4YVSC 4QPIC 5AC92 2X5IB 1NY71 2RS31 3VBHB 5C4WA 1DDLA 1COV1 1TME1 1B35B 1QQP2 3ZFFC 1NCRC 2FZ1A 1ASJ1 5BNOA 5C8CA 1VBE2 2HWD2 4CDXB 4IV1A 2RS33 2RMU1 1PVC3 2R073 1NA1B 3VBSA 1COV3 4Q4X2 1EV12 1A6CA 5AC91 4CDUB 1C8M2 1MQTB 5JZGC 1ASJ3 4N53B 5D8AB 4YVSA 4GB32 4QPIA 1RB8G 2Y26A 1QQP1 1HRV3 1RMU2 1RUG2 4LLFA 2RMU3 4CEYB 3VBFC 2WS92 3VBOA 2WLPA 1VBD2 1PIV2 1VBE1 2HWD1 4CDWC 5C4WB 5GKAC 2R042 3DPRC 3ZFFA 1NCRA 4Q4X1 1EV11 4RHV3 4N43C 2DF7A 1C8M1 1RUH3 2MEV3 2WZR1 1TMF1 2RS12 2RM22 1AL0G 1VBE3 2HWD3 1BEV1 4GB31 1RMU1 1RUG1 3VBSB 5BNNB 1IHMA 4GH4C 2WS91 1AR83 1RUI3 1EV13 1PIV1 4RS5C 5L7OC 3NAPC 5FMOS 1C8M3 2R041 1BBT2 3CJIB 4IV3B 2IZWA 2TBVA 3ZFEA 5CFDC 4GB33 2WFF2 3VBOB 2RS52 1RMU3 1RUG3 1EAH2 3DPRA 2VQ0A 4QPGC 4BCUA 1V9U2 4RQPC 1WCDJ 2RS11 2RM21 1VBD3 4JGYB 4N43A 2R043 5BNPC 1K5MC 1RVF2 1H8TA 1Z7S3 1AYM3 1BBT1 4GH4A 4NWWA 4WM7B 4FTSA 2RS13 2RM23 3S6PA 4RS5A 2WFF1 1R092 2RS51 1AR92 1V9U1 3LOBA 1AUYA 1QJY2 3ZFEB 2PLV1 1RUC1 1RVF1 2WFF3 3IDEA 4JGZC 4AEDA 2RS53 2BBVA 1EAH3 1QJX2 2R072 5BNPA 4WM8B 1PGL2 1BMV2 1R091 3VBUC 3ZXAC 1AR91 1E57A 1H8TB 2HWF2 5ABJA 1HRV2 1RVF3 4Q4V3 5CFCA 1W39A 4RR3C 1RUJ3 4PDWC 3VBRA 1ZBA2 1D4M3 1NCQC 1CD3G 1R093 1PVC1 2R071 5DDJ2 1AR93 1HRI2 1QJZA 4RHV2 4JGZA 1PGL1 5C9AC 1QJY3 2BUKA 1RUH2 2MEV2 5A33A 4AEDB 5K0UA 2HWF1 1AL22 1HRV1 1ND2C 2HWC2 3VBUA 1AR73 1QJX3 3HAGA 1AR82 1RUI2 5J98B 1ZBA1 3VDDB 1AYN2 4FTBA 5DDJ1 1PO22 4CDQC 1RUD3 5ABJB 1HRI1 4RR3A 1FPN2 5CFCB 2HWF3 3JB4C 4RHV1 1NCQA 1VBC2 3VBRB 1RUH1 2MEV1 1F2NA 3JB8A 1AL21 1ZBA3 5C9AA 2RR12 2HWC1 4Q4W2 5DDJ3 1AR81 1HRI3 1RUI1 2XPJA 1HXS2 1VAKA 1Z7S2 1NG0A 1AYM2 1ND2A 5A33B 5BNOB 5C8CB 1AYN1 5K0UB 1PO21 4IV1B 1FPN1 1AL23 2BFUS 1VBC1 4CEWC 5JZGA 2HWC3 4CDQA 1POV1 4Q4Y2 1ND3C 1VBD1 4Q4W1 1AYN3 4YVSB 3VBFA 4QPIB 1PO23 1R1A3 1FPN3 4CDWA 1Z7S1 1AYM1 1VBC3 1VRH2 1POV3 1VBB3 3ZFFB 1HQNA 1NCRB 4YVWC 2RR13 3ZFGC 4Q4W3 1OOPC 4Q4Y1 1RHI2 1HXS3 3TN92 4Q4V2 1PGW2 2X5IC 4CEWA 1FMD3 3VBHC 3JD73 1RUJ2 1POV0 5JZGB 1D4M2 1PO12 5L7OA 3NAPA 1B35C 1EAH1 1OHFA 1SMVA 1VRH1 5ACA3 4Q4Y3 5CFDA 3VBFB 1C8NA 2BFUL 4QPGA 4CDXC 3J8F2 4RQPA 4CDWB 1NA1C 3DPRB 2HWB3 1RHI1 4YVWA 2R062 3TN91 4Q4V1 2XBO2 1AR72 4CDUC 5FMOL 1MQTC 1K5MA 1VRH3 4N43B 1RUJ1 4N53C 5D8AC 1D4M1 2ZAHA 1PO11 2X5IA 1RUD2 4CEYC 3M8LA 2ZTNA 1RHI3 4GH4B 3TN93 1QJY1 1B35A 5C4WC 2ZZQA 3J8F1 4RS5B 5L7OB 3NAPB 1PO13 1AR62 2R061 4Y5Z0 4NWVA 1AR71 4CDXA 1QJX1 5CFDB 4QPGB 1BMV1 4RQPB 1HX6A 3VBSC 3J8F3 1MQTA 5BNNC 1RUD1 4N53A 5D8AA 2R063 5BNPB 1K5MB 2XBO3 3CJIC 4CEYA 4IV3C 1QJU3 1NOVA 1AR61 4SBVA 3VBOC 1R083 1R1A2 4PDWA 4JGYC 1VBA3 1MEC2 1VBB2 1AR63 1ZBE2 2BPA2 5BNNA 4JGZB 1TME3 4EJRA 4WM7C 2HWE2 1FMD2 2FZ2A 2WZR2 1TMF2 3CJIA 4IV3A 3JD72 1R1A1 1BEV2 3VBUB 5A32A 1GFF2 4FTEA 1MEC1 3ZFEC 5ACA2 1VBB1 5AC93 4JGYA 2RR11 4RR3B 4FSJA 1ZBE1 4PDWB 1NCQB 1RUF2
chains in the Genus database with same CATH superfamily
3U4SA 1WCUA 3QD6A 3ZPOA 2VTXJ 3LDKA 3S5QA 4UW5A 5FZ6A 5BNQA 2HWE1 2I45A 4HL0A 2JDMA 3B93A 5C3PA 3PLQA 4MSVA 5A3WA 4W4ZA 3OSDA 5JDBA 4ARXA 2DTWA 3WXPA 5T54A 4FPGA 2A1XA 2CNAA 2GC2A 2D3PA 4XDPA 2PAEA 3MZHA 3CQOA 3T30A 2D6KA 4ONUA 3ZOIA 1T6GC 2W3JA 5ACA1 2B46X 1WCKA 2IVIB 1PZ7A 1CJDA 4YARA 2V4AA 3IPVB 2C6SA 2QQPA 4ITCA 2HWE3 1QF3A 4RFRB 5GLZA 1O3QA 3TEZA 3WW4A 2WZR3 1TMF3 4FPKA 5A32B 5HV4A 4F7ZA 3MV11 1RUF1 4FOQA 5A3UA 2CGNA 2ZGKA 1AX2A 1DLLA 2HWB1 2YGMA 3E6BA 5F2SA 2JG9C 3U37A 4HVQA 5C3OA 1G9DA 4V2WA 5SV8A 1Y3TA 3LIGA 1YFXA 2WABA 2XJUA 3O7OA 4S2FA 2GP5A 1ZREA 1PIV3 2PN5A 4NMIA 4AYUA 1X36A 4B4QA 3OBZA 1LOBA 3I2DA 5FXVA 3UGGA 4BLIA 5LA9A 2ARBA 3W5NA 5F3EA 5IAVA 5FBZA 1WW6A 1LNSA 4MGSA 1RUF3 2B9UA 2J1TA 3WUCA 5HCAA 3HBKA 1S55A 5LBCA 3IDCB 3IDBB 3OY8A 3VDDC 4R9BA 2W39A 3FE5A 1OOPA 1OD3A 4D0QA 3N36A 3RRDA 1UKGA 3T1LA 3OCPA 4XJWA 4QKNA 2ARAA 4URAA 1J1TA 5A7OA 4QX7A 2VE1A 2O14A 2JKBA 5FWEA 4Y5TA 1LAJA 1H0BA 1WCSA 4ATFA 3VBRC 5LK7B 4CEWB 4XDOA 3I2JA 1S0CA 2JG9A 4QPWA 4GIQA 2ETEA 3ZPYA 5C5TA 3Q8CA 2XJTA 2GH8A 1UKRA 4YZ2A 4LKDA 3WQ7A 1X50A 4YZ3A 1VB4A 2ZBJA 3H1WA 3WDXA 4P9XA 2XBO1 3U1XA 1W6MA 4CVUA 5GM0A 3T1MA 3CDZB 2Y33A 3ILFA 3WR0A 3FFQA 2HBUA 2P2KA 5FYSA 3DKWA 3J4UH 3HT2A 4R9CA 4AQ6A 4IV1C 5FO9B 1MZ5A 2ADDA 4GMP0 5IYYA 2ERFA 2YV8A 2VZRA 3VDDA 4CDUA 1R081 1KXGA 4P9WA 1S0EA 3ZDSA 3ZXLA 3OOXA 2PLV3 1UX6A 1REEA 2WNOA 4HK8A 4XPVA 1AJKA 3DYMA 1DP0A 3VD9A 1A8DA 4QPIC 2WJSA 4D94A 3ACLA 1S0FA 3ATGA 2RS31 3ZXJA 1HJGA 1WW4A 2FCUA 3PUIA 4NHXA 5T52A 5L9VA 2DCJA 4JX0A 1PGSA 3C7HA 1TME1 1YYNA 3SH4A 3NV1A 3G7DA 1QQP2 2EXKA 4KU8A 4PJYA 3LPFA 2ZEYA 4UF0A 5CKQA 1NCRC 1DHKB 1UYPA 2R0HA 1CR7A 2YHJA 2X10A 2YXSA 3PUQA 4BH9A 1GANA 2VNGA 5FZOA 4CDXB 1TNRA 1Y9QA 2JIGA 4IV1A 3MIHA 1OH4A 2F4PA 2RMU1 2RS33 4LEJA 2BNOA 2D40A 3Q8BA 4XJZA 4L99A 3VBSA 1OT5A 4Q4X2 2ARXA 3O1TA 1A6CA 2XJRA 3IAPA 3WW2A 3OD4A 3GDBA 2JDNA 5JPNB 1MQTB 4XBLA 4YFZA 3T0BA 1DQ1A 2WNUA 2WN3A 1IGOA 5F6KA 2VZSA 5D8AB 1F9KA 3P6BA 2XJPA 2Y34A 1RB8G 4QPIA 1DCSA 3GF6A 1RUG2 4AHYA 3AYCA 2RMU3 1KJLA 2B7YA 3KT7A 2VMHA 1S0IA 2WINB 3AZZA 1MVEA 4OVEA 4XFFA 1W6OB 1VAMA 1UAIA 1EUTA 3OGSA 4XUTA 5GKAC 1MVQA 2DCYA 4PIYA 5KHJA 1NCRA 4AXOA 2ZCWA 3HWJA 3H8UA 3POEA 1EV11 2OXBA 2P3YA 2JDYA 1WGPA 4LIUA 5CZKA 4D3WA 4N43C 2DF7A 3WW3A 2WNVC 3RZZA 2Q1MA 2MEV3 3OEAA 5L36A 4XUNA 1AL0G 2WKKA 1HKDA 4XAEA 1RMU1 4OUEA 3AP4A 1Y9GA 1RUOA 4W50A 3UGHA 2QVSB 2D6PA 2WS91 4GH4C 4N7IA 3FLRA 1Q43A 5A7QA 1SBFA 5FK7A 1JYTA 5EYXA 1EV13 1VJ2A 2D6OX 3PMSA 4DY5A 2NN8A 1REFA 1O3TA 1VIWB 3FN9A 4LO8A 5FMOS 5L19A 5LZ6A 1BBT2 1PNGA 4IV3B 2LRPA 3MUY1 1W2UA 3ZYBA 4GD4A 2EXIA 2WO1A 3RS6A 2WFF2 4Y5SA 5EJ3A 1RMU3 4MVTA 4NRPA 2UU8A 2XMLA 4YG6A 1KDMA 4ZZ8A 2XWBB 1WCDJ 2YBSA 2RM21 3ITQA 3PTRB 4MGQA 2X05A 1LGNA 4N43A 3NNFA 2VUJA 1W6QB 3ZMNA 3IWZA 5AFBA 2GC3A 2A75A 3GZTB 1NQDA 3S5AA 2WBKA 3AMPA 5TSWA 1VPHA 1IQDC 1EPZA 1H8TA 2PHFA 1SQ4A 1WWYA 4Q29A 4JQRA 5JOXA 4GH4A 5JLVA 4UI9L 4LA2A 4BQ2A 1DGLA 3N7KA 2RM23 1QNYA 1WLCA 1GOGA 1ODNA 1RITA 3PURA 2J1RA 2RS51 1GQHA 2YDEA 4MO3M 2VM9A 4P14A 1V9U1 3WP3A 4IEWA 1GZCA 2P17A 4BQ4A 4I0AA 4ASKA 3GZUC 3GXUA 4JTOA 3J7HA 5H9SA 5A1LA 4FPFA 4I01A 1IS5A 3KVBA 1GP6A 3KCXA 3HNMA 1SEFA 4OYUA 5D21A 2NP0A 4JGZC 4U36A 4YNIA 4AEDA 2RS53 5FPXA 2BBVA 1QJX2 2R072 5KC6A 4PI2A 5EJ1B 4PQ9A 3J7LA 5CBLA 1XNBA 3E5XA 3I3QA 4GQ7A 2WDBA 1UNBA 1BMV2 3K4DA 4RN5A 1K42A 4YW1A 4DXZA 2WZPP 3UJQA 5DG2A 4KG8A 1ZA4A 2HWF2 1Y4WA 1HRV2 4FAGA 4YM1A 2HEVF 1FV2A 3JCIA 3ON7A 1PX4A 5FPLA 4DXTA 1W39A 2E6VA 2BWAA 4QX5A 4LHNA 5LBBA 4AVCA 4UWDA 3MHZA 3RFRA 3IAQA 1O4ZA 4QHZA 1WBFA 3D0JA 5IATA 4AQ2A 1CZVA 1UD1A 4WV8A 2ZZJA 1BZWA 4XCBA 2XQRA 4ES8A 2VVDA 2OQ6A 1UN1A 2JG9B 3GYDA 3I97A 3NV4A 4JGZA 5GZEA 5J1XA 5C9AC 2GNBA 1GQPA 2Z5WA 1RUH2 2ZHKA 1JTZX 5FYVA 3AXEA 5JIUA 2HLEA 2XONA 5FY5A 3WQ0A 2QFEA 3GBGA 1QXJA 5T50A 5FJKA 1D4VB 1ND2C 3WSOA 4L8QA 3NJVA 5LA2A 5C4WB 3MI8A 4HXCA 5FQ0A 4DY3A 1RUI2 1OC1A 2X29A 1NLRA 1JYCA 4Q5OA 3DV8A 4I02A 4Q2FA 4LT5A 3VDDB 3TB0A 3BPZA 5FPUA 1AYN2 1LEMA 2Q8CA 3PIJA 4FTBA 5DDJ1 1PO22 1OD5A 1HRI1 3CMGA 1VMHA 2JICA 4DINB 1T2XA 3FBYA 1LESA 4UAPA 4CU9A 4XCAA 1HN0A 2ZGPA 3I2HA 1W8NA 2WT0A 3CIHA 1PK6A 4IERA 3VBRB 2CAVA 2PA7A 2OYZA 3WV6A 1ULEA 3BB6A 4CU6A 5C9AA 1YJLA 2VTXA 2YPDA 4Q4W2 4YGEA 4XF9A 5FZ3A 5DDJ3 3WOGA 1HRI3 5DXDA 4UF0B 1HXS2 1VAKA 2Z4FA 3THTA 4LO4B 1GU3A 1QJFA 3R05A 5EFUA 1ND2A 2ZA9A 5FY8A 4Y33A 3BPSA 4LTAA 4IV1B 1SLIA 3LFIA 2VJXA 3RWNA 1YJKA 5I0DA 3WP6A 1PNFA 2ZEZA 5JZGA 4FOWA 1VMJA 4PF5A 1YI7A 2XKPA 3VUOA 3OJBA 1JUHA 2IUWA 1ND3C 3TYJA 1APNA 2Y60A 3AFGA 3C8XA 3H3ZA 4QPIB 2XXZA 4NHYA 2GMPA 4XTPA 3GJAA 3K46A 5L9RA 3B9CA 2E7QA 1Z7S1 2J1EA 3SQOA 4J1XA 3F95A 4QU1A 4AI1A 2P37A 3POSA 1XNTA 2VMIA 3GCWA 3KV4A 4DS0A 3T2TA 1BCXA 1NCRB 3VZNA 4PF1A 2ZX0A 2PHDA 3M3IA 3ABZA 1JH5A 1MZEA 1LHOA 1QDOA 2BGPA 2C5DA 2DYCA 2GZWA 4S2GA 2JB4A 3USSA 3VDBA 3M3EA 4H7MA 1UY0A 1AXKA 1IPKA 4XTMA 4HKWA 1J3PA 4A7KA 1IKPA 1VE0A 4CRQA 4Y22A 3D6EA 3PUHA 5CB7A 4MGIE 4NPMA 1OUSA 1SDDB 5FZMA 2P6CA 4OI1A 4Q8KA 4NIDA 4A6SA 2WRAA 3Q9OA 5HPOA 1DYKA 1UZYA 3NAPA 5L7OA 4R9DA 1QGLA 5E16A 2V5YA 1NQJA 2RJKA 5GLWA 1XYNA 2UYBA 3J7MA 2W91A 4AL9A 3POYA 1A34A 4MLOA 2BQPA 4K40A 5LY1A 4RSUA 2JDZA 3NL1A 4E4DX 1KS5A 1H2NA 3KS7A 1ZA7A 2LROA 3RZMA 2WIIB 1C8NA 3O1VA 1IG0A 5BV6A 4RQPA 2VQTA 5E89A 4AVTA 5KXCA 1NA1C 2QBXA 2ZAAA 3LEGA 2WN2A 1WW7A 4X8NA 3TN91 3D8CA 4AFCA 3ZIXA 4I2OA 3EB7A 1SHWB 5FMOL 1JOPA 5C8CA 2D5FA 1QOSA 4G4FA 4NOTA 5GLVA 4N43B 3WHTA 1K12A 4NAMA 4WVZA 4C1WA 4KWUA 2WNVB 1PO11 4QX8A 3VKLA 3EMRA 2VNVA 4IESA 4Y20A 2DVFA 2O1QA 1RUD2 3P3PA 4XEZA 5E8AA 4BQ5A 3MICA 5CG8A 3ILRA 2W68A 3WF1A 1YFYA 4CUGA 1AVBA 3GBFA 1IS3A 1QHDA 4GH4B 3TN93 3D0SA 4LO7A 4UBHA 4K8RB 3J8F1 1UY3A 3PU3A 4K8FA 4MHRA 1DGRN 1PO13 1AR62 2R061 3FUOA 3K4ZA 4CCKA 1QJX1 4XFHA 5IK7A 4LA3A 1DYPA 1AF9A 5FY0A 3I2FA 4NN0A 2V72A 5JCTA 2E51A 3A0KA 4QQ2A 1BMV1 4LR4A 3HBZA 1OF4A 5LEJA 3J8F3 3PDQA 5F5QA 3ETPA 5HCFA 2P6HA 3N9QA 2DUPA 3P3NA 2BYVE 4B4RA 4ES9A 2QCSB 1AXZA 2R063 2LW8A 4HG6B 4AFAA 3O1PA 3DN7A 3LWCA 2D7FA 3KZ4C 3ZYHA 2IXIA 1WMFA 2FMYA 1JN2P 2W52A 5FXWA 4JRLA 1QJU3 3WNNA 1NOVA 5FXZA 3UT0A 3ZSJA 3VBOC 2XR4A 3C2UA 4B29A 5L73A 4G9SB 1R1A2 1R1ZA 1S2EA 3MW4A 4KGGA 2P5BA 2VZ3A 2WWUA 3LSEA 5F39A 3RYKA 4M0NA 4XQDA 5FTTC 3LQCA 5FY7A 3FUQA 4U2AA 4P02B 5LCWL 4CCEA 2Y6LA 5DAVA 2WO7A 3AP9A 4AQSA 5J7MA 3VN4A 4OQ9A 5JMCA 5FZAA 4JGZB 3N9OA 4AR2A 4WM7C 5FYBA 3KD4A 1LOFA 3ZXKA 4QKFA 1W2NA 4I3PA 2HWE2 3Q8AA 3H9AA 4LE3A 4RA0A 4LBQB 2WZR2 1TMF2 3IPVA 1TQ5A 2RJLA 4KG0A 5FUNA 5C8WA 4C8DA 4AHZA 3WDUA 5A32A 4OZOA 1WKYA 1WLDA 4HN1A 4FTEA 3LA2A 5LA1A 1UWWA 2ORXA 5ACA2 5BPXA 2E53A 1W8WA 3RYPA 2VPVA 4UW6A 5AC93 1XPWA 1Y9MA 4NVPA 3ZLIA 4TXWA 1F4AA 5F6LB 2P34A 2HYXA 5A6XA 5JWPA 5ISLA 3OGJA 3RGBA 4ISRA 1MS9A 1RUF2 2VMGA 2PHTA 4A45A 2HWB2 3WP5A 4AFMA 1HXS1 1LHUA 2Q0AA 3ZN4A 4WZFA 5FZBA 1GR3A 2W5FA 1FMD1 4E4ZA 4DMIA 3LCPA 5DAXA 3JD71 4XURA 5C9AB 2LS6A 2GU9A 2W92A 4WM7A 1UYYA 1TE1B 2ADEA 2VMFA 5FLIA 1JBCA 4YM0A 3I3DA 2EAKA 5JMOA 4FPLA 4TLFA 4KWKA 4Z92B 4BIFA 2W9XA 2VZVA 1ND2B 3D3AA 1UIJA 4XQ4A 4D8MA 1XXNA 1RC6A 3FFZA 2IC1A 4M3CE 4XMAA 2FBEA 3EHKA 1FOD1 1GYKA 4LBQD 3ACIA 2OS2A 3RMXA 2F6BA 1YLLA 3SCHA 5FO8B 2C4XA 3HR9A 5FPZA 2G19A 4CXWA 5K7PA 2BTVC 3WDTA 1QIQA 3S7EA 4LE4A 1RUE1 3CEWA 4META 4XZUG 5FP4A 4HVOA 1KS4A 1Q56A 2GSYA 4IL7A 1YEWA 3LAGA 2BWCA 3POWA 2YPJA 4WVMA 2PLV2 5T55A 1FOD3 1DGWA 2VZOA 3L2YA 4MH0E 5C3QA 2Q1FA 1PMHX 2J1VA 3AZYA 1J59A 1V00A 4I3GA 2YYOA 4R52A 1FXZA 3U10A 2XL7A 5ABJC 1UCXA 2CWSA 5K9YA 1RUE3 3FBMA 5CFCC 1GP4A 1YFWA 1H1MA 4K7JA 3RQ0A 3FHQA 1UZWA 1R082 2JDKA 5F32A 3THPA 3KF3A 1OVSA 2VH9A 4GZ9A 3RWKX 4HVRA 2ZHLA 2D6MA 5DZFA 5A3OA 1O5UA 2ZGTA 2QDRA 2VCCA 2VMDA 4Q26A 4Y22B 3T2PA 2VNOA 1S1AA 3E6DA 4CXXA 1MR5A 1ND3B 1GNZA 5CAZA 2RE9A 2XWJB 5DUVA 2XH6A 3ZKYA 3KT1A 3N9NA 2C9KA 3KHBA 4F3JA 2PAKA 4I0WB 1HJFA 2RS32 3I8TA 3PVOA 1N1TA 1N1SA 2VZQA 4YGCA 4A3XA 2FMDA 4DIQA 1TME2 2JB8A 4CCDA 2RV9A 4YRDA 4I0BA 4P9JA 4XUPA 4O9GA 5C3SA 2VW1A 3QH7A 1S2BA 2IWGB 3PIGA 1UXZA 5LW9A 3KM5A 3R4UA 1IPSA 1LU1A 2RMU2 4KWJA 3NNGA 4MXVA 5FYZA 1YUDA 1D0GA 4AI2A 1SBDA 1REDA 1VBA1 2PHUA 4JQTA 1UF2C 4YVSC 5B2GB 1OLMA 1XSQA 3I59B 1UIKA 4YW3A 4A6OA 2KM2A 4Y20B 1W6OA 1DGWX 5KXEA 4KMQA 1COV1 1GMMA 3ACGA 3OGRA 1YQ8A 3O5SA 2PYTA 4TN7A 2GC0A 2A6YA 4NO4A 3IIIA 2FZ1A 1T6BX 2A73B 2JE9A 2CDPA 1WMDA 4DRRA 2J1UA 3HQXA 3OUHA 2EA7A 2ORZA 2XGXA 3H42B 1WA4A 1HW5A 3D5OA 1SACA 1VMFA 3URFA 2VG9A 1AZDA 1IOAA 4LK7A 1NA1B 1COV3 1EV12 2D3RA 2V73A 2ZKLA 3AKQA 4OUSA 1NXD1 5FYYA 5GLTA 1ODMA 2UY8A 3AZVA 4NROA 4AEJA 1W2TA 4KL1A 1NAEA 4JKLA 2BU9A 5A3PA 5IFTA 1RXFA 2XDVA 4YVSA 3NRUA 2RDRA 3HNBM 2QKDA 3WF3A 1RMU2 1VAVA 2VO5A 4A2UA 1PZ9A 3J26N 3PVEA 1G6NA 3VBFC 2WS92 4IW3A 4C0HA 4LKEA 1MS1A 1C4RA 3H1YA 5ERLA 3T3YA 2B4KA 1BLZA 4QM9A 5IVFA 3ASIA 4K1YA 4PCRA 2K46A 2GN7A 2BVVA 3AC0A 3SH5A 1W6QA 3OEBA 1HDKA 4V1PA 4FBFA 4QT6A 4RHV3 1NT0A 2E33A 3GNEA 1W03A 3CNAA 2E32A 2WZR1 1TMF1 1DBNA 2XLFA 1JXNA 2RM22 2ZHNA 3POGA 4Y1VA 1S0GA 5IHRA 2IXLA 4GB31 2FDFA 3B5LB 4FFIA 4FOVA 1IHMA 1W8HA 2OIIA 4LOSA 4P08A 2YUEA 1AR83 3PTYA 3ZDVA 2E26A 1CAXA 4P9GA 1PIV1 4RS5C 2WFPA 2UWBA 1QOTA 3GGLA 5H9QA 4OMDA 3LSDA 5FYUA 3UL2A 4XF0A 2R16A 1W9TA 3O0WA 4IE0A 4GB33 1SFPA 4AFDA 3VBOB 2RS52 4D7SA 5GZFA 4QPGC 4BCUA 3R4DB 4BQYA 3TEYA 1WMXA 1V9U2 3OPTA 2VBBA 4BA6A 3E1F1 4DUWA 5A1AA 1DG6A 3T4VA 1VBD3 5FYTA 4ZHNA 3W9AA 5T5LA 2ZEXA 2BERA 2D97A 4A41A 2O8QA 2PFWA 4CPBD 4D7TA 3V64A 5BNPC 1JYVA 2VGDA 5JXIA 5FDBA 1V0AA 3DXUA 2KR2A 3RVHA 1AYM3 2EIBA 4CCMA 2DVAA 3ZYPA 4WM7B 4AVBA 5LRSA 1N1YA 1GWMA 4CCCA 4RS5A 4IEOA 5FUIA 3U0ZA 2FCVA 4NAOA 2DBNA 1XQNA 1UY4A 5FZLA 5M0TA 1ULGA 2YC0A 3VHNA 4XUOA 2XOMA 5HI0A 1KJRA 3AKSA 4M0HA 4XUQA 2HBTA 2CDOA 2Z79A 4CUCA 4HZFA 4LUKA 2DCZA 4B1MA 3RI8A 3DEMA 1H4HA 4LOTA 5EIYB 3LDRA 3C3VA 1D0HA 4EN9B 3E6CC 3A22A 1V6JA 1O5LA 1EUUA 4BE3A 5IVCA 3H7JA 5CISA 4W6XA 1UYZA 2PLV1 1CJPA 1EAH3 4YM2A 1FT9A 3GJBA 3NW4A 3S0MA 4L92A 5BNPA 4GWIA 1X8MA 4HPKA 4AI8A 1BVP1 4HOOA 3JQXA 1OPMA 4EWDA 1R091 2EIEA 2EXJA 3VBUC 1OFSA 4WVMB 1AR91 2JIJA 3LOIA 3B00A 1E57A 1W9YA 1YIFA 3POIA 3AL6A 4K3UA 4B7KA 5FO7B 5FFOC 5DUXA 4Q4V3 3EBRA 4E8DA 2OZJA 2V5DA 3MPBA 3X29B 1Q5OA 4RR3C 3KWVA 1DFQA 1RUJ3 5FMCA 4FPYA 4PDWC 5IWFA 1D4M3 5IJRA 1NCQC 5LY2A 3VBRA 1CD3G 1W9WA 1R093 4XQWA 1JS9A 1ENQA 5DDJ2 3AXDA 5FR3A 1AR93 1PZ8A 1HRI2 3NKTA 2P3JA 3WG4A 5BXXA 4ZS2A 3CLPA 3BTZA 1PGL1 3RDIA 1ALYA 1S2KA 2BUKA 4B1LA 4F8AA 1FATA 5JR2A 4I09A 2LM3A 4DO0A 5EXOA 5FY4A 4WBBA 1XJAA 2PXJA 2PHRA 4TTGA 3SMHA 3VBUA 1AR73 2C9AA 2GDFA 4RGKA 2BEOA 3OBRA 3FJSA 4JDOA 1J84A 5JI7A 1IQAA 3VLBB 1GZTA 3WDYA 4COZA 5J98B 1OA2A 5CEHA 4XIOA 2ZMNA 5FZKA 5FREA 1RTVA 1WA6X 4LQRA 4CDQC 5ABJB 4B4PA 4RR3A 1V6LA 1KITA 2XL9A 5FOBB 1FYUA 1WZXA 2UURA 5CFCB 2ZX3A 3JB4C 1W0NA 1NCQA 2XB6C 2NMOA 2A7AA 2MEV1 3EJKA 2VCAA 2YGLA 5A7SA 4BDVB 3CHXA 4MZUA 4JAAA 2WLQA 3V65A 3FMGA 3P1IA 1UY1A 1UL9A 1XBFA 2HWC1 5T3NA 1RUNA 4Y1YA 3SCGA 3A7QA 3AL5A 1EY2A 1UU6A 3A4UA 1Z7S2 2Y6JA 3SKVA 5A33B 5H9PA 5E1RA 1SLCA 2WWJA 4CZSA 2AR6A 3SEEA 3H1MA 2BBAA 3U78A 1OMIA 2CHHA 2QNKA 1XU1A 3I54A 5A70A 2IFRA 1ZZCA 1VBC1 1LKNA 2HWC3 3K48A 4CDQA 2QZ3A 4IE5A 1POV1 2GMEA 1RL3A 4UFHA 4XJAA 3AJYA 3BCWA 1XNKA 2VW0A 3BIWE 4ASLA 2AEZA 4YVSB 2YBPA 3VD4A 1H9WA 2D98A 3WG3A 4XIKA 2HH9A 4QWNA 4I30A 1GICA 2WYSA 3FL7A 2W1UA 5IVJA 3TEXA 5DPNA 1C57A 3BOPA 3M3CA 1VBC3 3N7MA 4DXSA 1CN1A 2GAUA 1POV3 3FWEA 1VBB3 1DLCA 2JDUA 3CZJA 5I0UA 3S30A 1HQNA 4XFGA 4YVWC 3GZAA 4ORFA 2RR13 3ZFGC 3N9PA 5FIXA 2WNVA 4BIOA 5FZEA 2FDGA 2JKXA 4UFMA 3IZOA 4Q4Y1 1HV0A 4FFFA 4BXSV 4CUBA 3TN92 3N35A 4C0BA 1C1FA 5F5IA 5FMBA 5FYIA 3ZYFA 2X5IC 3O1MA 3RZJA 1HN1A 5DABA 1G8WA 3VBHC 1LHNA 1OA4A 3LB9A 5FKBA 2Y0OA 1PO12 4LJHA 1PVXA 2DURA 3WT3A 1B35C 1CAXB 2WZEA 2VVFA 1OHFA 2Y6FA 3NNLA 4FPHA 1O4YA 2EF6A 4XJ9A 5B4XA 4Q4Y3 5T5OA 3LEIA 4HSJA 5DMYA 1VR3A 3VBFB 2Q4SA 2BFUL 4HK9A 2B42B 3J8F2 2FDIA 1ZX5A 4A3ZA 1Q8VA 3WQ1A 5DAPA 4JDNA 2Q8OA 3MO4A 5T5PA 1RHI1 1F5FA 4YVWA 5I8TA 2R062 3RSJA 4XW3A 5DAQA 5J3UA 1QNWA 2AENA 2ES3A 4XZPA 1OKOA 2JX9A 1OLQA 2Q30A 4N53C 1ZRFA 1WMEA 4FXKB 5A3TA 4JHZA 4UYBA 3SXWA 2X5IA 4L2NA 4EE2A 2XUEA 4PLNA 2YB7A 4CEYC 1FI2A 1WW5A 4E2QA 4NIIA 4NIHA 2Y0IA 1RHI3 1XNCA 2VVEA 4HMZA 1B35A 5C4WC 1YNAA 3WNXA 2WZ8A 4RS5B 2DDUA 1LOAA 4UFLA 4IEPA 2Q1ZB 3LGRA 3M1HA 4PHZA 4Y5Z0 1DQ6A 1W8UA 4BOWA 3BKZA 2Z69A 1SBEA 3H3UA 4PIXA 3SHRA 3VL9A 1X9TA 4QPGB 5EHDA 3NO8A 1C1LA 1D2SA 3RZGA 4O9EA 4XETA 2PHWA 4AVSA 2DUQA 3WG1A 3RZKA 2UY9A 5BNNC 1OH3A 4CP2A 1UO9A 5APAA 4LBQA 4N53A 2D43A 3MDPA 5FY9A 4AVVA 1D2QA 1UOJA 4HPKB 2J1AA 3RYRA 3KCYA 4Z2WA 5BNPB 4K9SA 2A6XA 3CJIC 4CEYA 3HNYM 4RD7A 1QDCA 1LOCA 4OLLA 4QXBA 5IVVA 2NQYA 2YMZA 1ZRDA 2VY0A 4UFIA 4D69A 5C71A 1URXA 2X8KA 2HYKA 2VL4A 1UY2A 2VXJA 2SBAA 4FPJA 2VMEA 1NKGA 3O1RA 1BVVA 4Z07A 1UPIA 2DBIA 5DUWA 1YI9A 4CE8A 1JZ5A 3I2KA 1W9SA 1XE7A 1Y7BA 2NMNA 4YYOA 1NZIA 1UMZA 1NLQA 3R0RA 1R64A 1JU3A 2VUCA 3U07A 2VZ1A 3MW2A 5BNNA 3I2OA 3B94A 4EJRA 4Q0PA 3UESA 1E5RA 3MYXA 4QXHA 1SLLA 4QAWA 4XXAA 4YZ4A 5AVAA 2Q8DA 5JXJA 1FMD2 3I4IA 3CJIA 3H7YA 1H4GA 3JD72 4LBMA 3WF2A 2ATFA 3ZKUA 5F9TA 5IK8A 3VBUB 3AB0A 2C26A 4B3NA 4NUBA 2QQWA 3N4MA 3UV9A 1MEC1 2I2SA 3ZFEC 1S0BA 4QQLA 4S2DA 2JD9A 5JIAA 3PL0A 4IUGA 2AUYA 2DFBA 3WHUA 3KB5A 4RR3B 1ZBE1 1H2KA 4PDWB 1GWKA 5GLUA 1NCQB 1LULA 1QXRA 2WYFA 1FOD2 3HIFA 1DZQA 4JC1A 4YG0A 1CAUA 1QQP3 2D93A 4WM8C 4PLOA 3HQRA 3KLSA 1MEC3 4XMIA 3BU7A 1SCSA 4HKOA 2H0BA 4IGQA 4AF9A 2ZHMA 1RUE2 1W04A 3BGAA 3SKJE 1JZ7A 3M7AA 1ZBE3 3HN3A 3AMNA 5BNOA 4Q4X3 2DU1A 1US2A 5F3GA 2CY6A 1DQ2A 3UJOA 3EQEA 4O7XA 2YBKA 2GP3A 3OUJA 1K5JA 5E88A 2EIGA 4M4RA 4HONA 3O12A 3ZN6B 3KMHA 5FYHA 1ND3A 1BEV3 5CIRA 4YGBA 4CDQB 4QKDA 4MUVA 4L9BA 4MHUA 2W1QA 4JKMA 5FZ9A 3WY6A 4ARYA 1RIRA 4NIGA 2P4EA 2AGSA 3MFAA 4N7UA 4O65A 4E4HA 4LKSA 1LHVA 2V09A 4WM8A 1G7YA 2R6QA 4EN0A 4BQWA 3BU0A 2W46A 1AJOA 1MS0A 5FLJA 4XF1A 5J96B 2YC2A 4GWNA 4GMP1 2GC1A 1V6MA 1FNZA 4YW7A 1U12A 3H0OA 4BHPA 4JKKA 1W2AX 3D4KA 2R7EB 3UETA 3VD3A 2B45X 4XE9A 2ZX2A 5FP9A 2HEWF 2YC4A 2ZJCA 2VUAA 3AZXA 4XFIA 3ZXEA 3I59A 2YU2A 1LGBA 2OUHA 2AH2A 1PX3A 2SLIA 3K3NA 3AKRA 4FXGB 1OQ1A 4GMP3 3S7IA 1BBT3 1VBA2 4GKYA 4RFT0 4FP3A 3KV9A 4LO6B 3RZLA 4BQXA 1CESA 3AP5A 3AVSA 3OGVA 4HFSA 5ANQA 5J09A 1H6XA 5DQ0A 1N1VA 5C33A 3LPGA 2D6NA 1LOGA 2FDJA 1COV2 5FXXA 5JUVA 3JBG1 3CBNA 2OPKA 1GKBA 4IEXA 4AEMA 1NA1A 2BRTA 4Q8LA 5K0UC 1TNFA 2BNMA 3BI3A 4XFAA 1QJU1 3GALA 3PVBB 1UW8A 3ZXGA 5JPMB 3VZMA 2BNNA 3NJXA 3IT8A 4YVWB 1OLRA 4IEQA 4LHLA 4MGKE 3ZFGB 1RUC3 4CP1A 2ZPXA 4QDRA 1JZ6A 2QTWB 2WQ4A 3K75B 1N3OA 2WNEA 3VGIA 3JBG3 2XJSA 5KHGA 1MS8A 2X5IB 1FAYA 1NY71 2ZGMA 4CPBA 3VBHB 4LBLA 4R4XA 2J42A 4EN7B 3MF6A 1YCIA 3MIEA 1POQA 1B35B 3OBTA 4NHLA 5A7NA 1CX1A 3MGUA 1W8OA 4Q27A 1GZWB 1ASJ1 1NX9A 3NV2A 2J1SA 5EQUA 3VZLA 2TNFA 2CTVA 5FPBA 3ZM8A 2X53S 4NPLA 5A6YA 1ZM1A 1UX7A 1PVC3 2R073 1NE4A 2P3KA 4KWLA 3VDCA 5JVVA 4Z8BA 5BUVA 1ZYBA 3UGFA 3V56A 4AWDA 5AC91 3A21A 1DYOA 1HIXA 1ZZ8A 3UKVA 2QJVA 3AYDA 1U5YA 1ASJ3 4N53B 1E5IA 1C28A 4Z1VA 5HCHA 2YY1A 4GB32 1Q8PA 4ASMB 2Y26A 4IE4A 5D2AA 1HRV3 1S0DA 1Z0HA 4UOJA 1LGCA 2W95A 3THDA 5FKCA 4CEYB 3F2ZA 3VBOA 3NSTA 5G04L 5KHKA 1VBD2 3EXUA 5LRRA 3MIGA 1PIV2 1VBE1 2HWD1 3RG0A 2PTMA 2ILMA 3W20A 4CDWC 4RGGA 2MNGA 1Q8SA 3DPRC 3K3OA 4N8MA 4PLMA 2WQZC 2ZMLA 3QBQA 4CTEA 1ULFA 4LK6A 3U14A 5L9BA 4XHXA 2ZMKA 3RMYA 1HB1A 1GOHA 5CNAA 1C8M1 1W2OA 2ZKNA 3ME2A 2VR4A 5FZHA 4NE9A 4DNYA 1KEXA 1MZFA 1RUH3 3DL3A 4QD2A 3LD8A 3J9SA 3M70A 1VBE3 1V6OA 2HWD3 1XYOA 4P9IA 2XVGA 3IMMA 4DUVA 3MBWA 4MGYE 1A78A 2VAUA 4YZ5A 5BNNB 3ELNA 3N7JA 3J7NA 1RUI3 1O3RA 2IVJA 4HANA 5FP3A 3WNPA 4MGZE 3E5UA 1SLAA 4QM8A 2RDQA 5FP8A 1FNYA 1C8M3 2R041 4FPOB 5F2WA 3CJIB 4AI9A 5CYYA 4DFSA 3HOBA 1OI6A 2B39A 5C6CA 1UQXA 2AACA 2TBVA 4M3CB 5CFDC 3H8XA 3E5QA 4V2VA 4AOCA 3W59A 4OHVA 3A0NA 5EV7A 5A3LA 5F7UA 1I6XA 3DPRA 1EAH2 1QKQA 2A71A 1HB4A 4LHSA 2EIDA 1CWPA 1GLHA 3H50A 2GALA 1E5SA 3VB9A 2RS11 1J1LA 3HJRA 2WA3A 4M3CF 2VD7A 3HT1A 2R043 3OF1A 2JDAA 1SG3A 4QX0A 1K5MC 3DXTA 5F5CA 1CAUB 5FAXA 1GNYA 4AI3A 5HV0A 1X9PA 3ZYGA 1W99A 2JJ6A 2PQQA 2W47A 3C7GA 4AAXA 2WA4A 1CGPA 3WCSA 2ET7A 3JQWA 5FMDA 2NM1A 4AEKA 1SDWA 4AI0A 1OFNA 2NLRA 3POJA 5FPVA 2FHRA 2RS13 5KHHA 4XILA 3S6PA 2UYAA 2XLAA 3Q8EA 4H7LA 1R092 5F5AA 1QWRA 3SITA 2N7GA 2FDKA 4QQHA 1AR92 2QUOA 1O4TA 4COVA 3GCXA 4CP9B 2DUOA 1X82A 2C24A 1ZZ6A 2NZ9A 3ZFEB 1QMJA 2JDHA 2W08A 2XVLA 1H9PA 3D82A 5I0TA 4IE6A 4R9AA 4CXYA 1RVF1 3IDEA 2E31A 2DCKA 2JDPA 2OUJA 4N9IA 4W65A 3LZZA 4YW4A 3WNMA 5IVYA 4H2AA 2OT7A 2QE3A 2Q8EA 5EYYA 3ROUA 4GA9A 4YW6A 4NJ4A 4WM8B 1W6NA 2KA3A 3W5MA 1PGL2 1VALA 3C7FA 4QB6A 1GQGA 2EXHA 2OVUA 3LEMA 4QX2A 1KFXL 2RDSA 4QGNA 2NYYA 2VC9A 3RJRA 4CU8A 2PHXA 2QQIA 4N9HA 5ABJA 4FAHA 1RVF3 4K6BA 3UYJA 5CFCA 1CIWA 3MIFA 4Q1RA 1HV1A 1QU0A 4EZ4A 1V6NA 2FD8A 3T0AA 4AGGA 4BM8A 4CSWA 3TOJA 1XSRA 2ZX4A 3FZ3A 4IEYA 3LFMA 5LBEA 2W2IA 3WZ1A 5DG1A 1DGRA 2A6WA 1QJY3 4LBJA 5AVPA 4X6RB 4C90A 2MEV2 5A33A 1W06A 2BOIA 4XJUA 1S4CA 4MXWB 3AJZA 2HWC2 2AZ5A 3ENRA 5E6HA 4QQOA 2W94A 3HAGA 5CKMA 1IS6A 2ZGQA 1IPJA 1SFYA 2H0VA 2QQKA 1CPNA 2WSVA 3NNJA 4E8CA 4TWTA 1ZBA1 1GOFA 1O59A 3CKHA 4FO9A 2A6VA 2DWRA 1M4WA 4K1ZA 4K20A 1ZRIA 5HXMA 1OQDA 1DQ5A 3WINE 1RUD3 3SLIA 5C3RA 5FZ7A 3NJZA 2CWMA 1J58A 2RDNA 4RHV1 1VBC2 4TSVA 3PJYA 1SCRA 2JXAA 1DIWA 4L11A 1TG7A 3QCWA 3N3HA 1F2NA 2O8OA 3JB8A 3HMYA 4H55A 1UOBA 1AL21 1ZBA3 4K21A 3B9IA 1JOJA 2RR12 5CG9A 3NV3A 1X8EA 4GWJA 1UMHA 2ZGSA 2KD7A 1W8FA 1AR81 4TZDA 3ORJA 5FZIA 3BOWA 2XPJA 2BW8A 3LDBA 3MLLA 1NG0A 1XYPA 1JODA 2KXLA 4Y26A 3ALQA 5K0UB 4QB2A 1I5PA 1ZRCA 1YIPA 4DUXA 1FPN1 1AL23 4LBOA 2BFUS 2VW2A 4KU7A 1U5XA 4DZGA 4ZPIA 2QZ2A 1ULPA 4Q4Y2 3ES1A 1VBD1 2WT1A 2XUMA 2W87A 1NLSA 3DF0A 1YHFA 3N7LA 3PHMA 3OB8A 4MG2A 5KXDA 5JI9A 4XYXA 5F1RA 3VBFA 4FQZA 2OA2A 5FLHA 3BUCA 2J7MA 4ZXEA 5A3NA 4LKFA 2W0XA 1R1A3 4YG3A 1HQWA 3RJ2X 1UPSA 1C3HA 1FPN3 1LJ7A 3T2QA 4OCTA 3WQBA 4DQAA 4F83A 1UZVA 5CADA 1AYM1 1H2MA 4EV0A 2ZX1A 2EAAA 2AREA 5DAWA 4OULA 2P1BA 3AP7A 2BV4A 5DN2A 2PQSA 1WD4A 4OFGA 5C70A 1ZRRA 4LULA 5I0RA 2BGCA 3FHIB 2QQOA 3AYEA 1OQEA 2BP6A 3TAYA 1RJ7A 1JYIA 2VOVA 4IEVA 4AE2A 4GULA 1OOPC 1I5ZA 4XFBA 4QMAA 5FWJA 2Q5TA 1RHI2 5IUQA 2GNDA 1O6UA 1PGW2 2D3SA 2CYFA 4AAPA 4BYYA 4ZU5A 4BXFA 4D7YA 2CSGA 2VULA 3T4HB 4W8JA 3ZR6A 1JYNA 2RHPA 2OX0A 5JAXA 5FZGA 1EAH1 4FFHA 4QDQA 2VMCA 4FFGA 2OKXA 3BTXA 1D7PM 1NE6A 5BYNA 4OQ8A 1VRH1 2TEPA 3N9MA 4LNVA 5ACA3 4MGTA 2OQ7A 4M00A 1ZNPA 4NRMA 5IK5A 2BZDA 2J22A 3NJYA 3LEKA 4QPGA 3T0DA 4CDWB 2IXJA 1LU2A 4JTNA 1RXGA 4Y3OA 1LECA 1DF0A 3DPRB 4YZ1A 2HJIA 4LO5B 1XNAA 3WX5A 2HWB3 4A7ZA 5AFEA 1ULDA 3FHAA 1JYWA 4Q4V1 2YROA 2A3XA 4CDUC 3ZYRA 4BK4A 4BPZA 4E2SA 5I91A 5K8SA 3H3LA 3RPQA 1LRHA 1VRH3 3FX3A 3HPNA 3VKMA 1RUJ1 4W6YA 1D4M1 5FYCA 1BQPA 1W6PB 2ZACA 3APBA 1AX1A 3ECQA 4FQ4A 4Y1XA 3R4SA 4Y4RA 4Z2AA 5LASA 3POBA 3M8LA 5EP9A 3VDAA 3AMHA 1CPMA 5F3IA 4Q0SA 5FCCA 3O0VA 4ATEA 3OPZA 2MHFA 4DEVA 1J3QA 4P00B 1CAVA 5HXVA 3ZXFA 4A44A 4LPLA 1WLWA 2GNTA 3MW3A 4YLZA 4NWVA 2PMWB 2WC2A 1AR71 3I2GA 1H1AA 4XC9A 4E27A 5CFDB 2AEYA 4XBQA 3USUA 1DZRA 3AZWA 1YFUA 4FT8A 5A6ZA 2JEMA 2WUHA 3IDAA 2GNMA 3K77A 1HX6A 4MADA 2WR9A 3HD8B 3ZO0B 3O1SA 3VBSC 2W1SA 1BYHA 1MS5A 1NYWA 3ZSMA 3I3EA 1QJEA 5CU1A 3ZMOA 4CA9A 3QACA 4YPJA 2I74A 1N3QA 1LOEA 4URTA 5K4LA 5C7GA 3VKOA 3AM2A 1K5MB 2WL1A 2XBO3 2WNUC 5A7WB 5EZWA 1NUKA 1W9FA 3KV5A 3WEZA 1W6NB 2ARCA 4ZZ5A 3KSCA 2BOJA 1W90A 3LA7A 4GXLA 3LIHA 1SFNA 4IQPA 5JSOA 2CV6A 4ZXKA 4OHZA 1R083 1QH7A 1F31A 4HETA 4KI5M 1JUIA 1SPPA 5JOZA 5FV3A 2X09A 4PDWA 5FK8A 4D6RA 4JGYC 4MV2A 1VP6A 1MEC2 2JG8C 1GV9A 2QDNA 4OI0A 4OMCA 3GZEA 4OHYA 1QOOA 1L3JA 1SZBA 1Y43B 5FY1A 5LK5A 2ZGOA 5J36A 1ZBE2 2OPWA 1TME3 3ZYJB 1H30A 3BODA 1V70A 4Q0UA 5FYMA 1BK1A 1LTEA 4RL7A 2FZ2A 2BGOA 4P9LA 5KBFA 3KQRA 1BEV2 1TVGA 1CVNA 4FI9A 4QHBA 1WLTA 3LE0A 3THCA 4AW7A 3CO2A 3ZN6A 1OLME 3W21A 4M4PA 2VUDA 1VBB1 1W28A 1BK0A 1DZTA 1LR5A 5KXBA 1WCQA 4JGYA 2RR11 4FSJA 1IG3A 2D5HA 2JG8A 3B3QE 1UZ0A 2VZPA 1ENSA 2JWPA 1UU4A 3PU8A 5ANNA 3MV01 4WVVA 3O14A 5HBAA 3UKTA 4J1WA 4BJ0A 1OVPA 4LBKA 2K0GA 3WNOA 2ZGNA 3AK0A 3U75A 1H8TC 1RJ8A 1ZZ9A 4CCJA 3B01A 3NNMA 3WG2A 4AHWA 2WQ8A 4XABA 3O1UA 2YFZA 3KHCA 5FZFA 4BMEA 5I8YA 2DV9A 1GUIA 4Y24A 1WBLA 3AMQA 5A6QA 3WCRA 3KVAA 1I1EA 3AP6A 3M3OA 5CKNA 1XE8A 2GH2A 3IBMA 3WUDA 3HEIA 4HBNA 1JZ3A 1O8SA 1M06G 2EALA 1CQ9A 3DKQA 2VTFA 1DQ0A 2WS93 3QLQA 4MX3A 1OKQA 1X33A 3GBWA 2QQNA 3PUAA 4QU2A 4UBGA 2G9GA 4ZONA 3C7EA 1UXXX 2PELA 4KH9A 5FUPA 4AEDC 1A3KA 1XRUA 3WF0A 1I9RA 2AC1A 2O0OA 2YZ4A 3JU9A 1KGYA 5DZGA 5KC5A 4CCNA 4L0PA 1RUC2 4NHKA 2VECA 4B8EA 5CVRA 1PGW1 3ZFGA 1F8VA 3PVNA 2Y38A 3JBG2 4EROA 2DVDA 1LENA 4CU7A 1JZ4A 1G9FA 1DQ4A 1AXYA 1BHGA 1GBGA 1H8VA 1QJU2 5GZDA 4XFCA 3W58A 5FZ1A 5H9RA 1YWKA 4GALA 1OPOA 3M3QA 3RZHA 2E7TA 3BTAA 2G4IA 4LMFA 3VBHA 4PI0A 1XOYA 2HKXA 2OZ6A 2XJQA 1HQLA 2VQUA 4HLTA 4O61A 1STMA 4J25A 2VU9A 2XVKA 3NVCA 3R6SA 4KBBA 1GZWA 4UT5A 1F5JA 1NY72 3ZSEA 5JXGA 1PVC2 3PJQA 2WWSA 4XBNA 3BTYA 1V9U3 5BNOC 2VQAA 5C8CC 2A3WA 1VB2A 2YU1A 2BJSA 4JZRA 4UW3A 4WVWA 3HVDA 1ASJ2 2FCTA 1NXMA 4HKLA 4LLOA 3M4FA 1PHMA 5FOJB 3OY8B 4M01A 2RVAA 1OOPB 1KFUL 4Y4YA 4WZCA 4YGDA 3K4AA 2EICA 5AC92 1US3A 1W3XA 3U11A 2BDRA 3I3MA 3NKGA 4QXKA 5C4WA 1PK6C 1XU2A 2E9QA 3TNPB 4ZKTB 1HB3A 3DUIA 1DDLA 1MS4A 3QOPA 3ZYIB 3N9LA 1UU5A 3ZFFC 1YC61 1YRZA 1ENXA 1KD7A 4JVAA 1CAVB 2E63A 2B9VA 2ET1A 3KGZA 4AHXA 2VXRA 2QQUA 4QPYA 4EYUA 1VBE2 2A3YA 2HWD2 1FV3A 4P9YA 5FBJA 4E9KA 4S2HA 1W6MB 3E97A 2G9FA 3USUB 4CCLA 1VLNA 1PMJX 3V0AA 1O91A 4ZY9A 1XNDA 4XF3A 3VL8A 2LALA 3IIAA 3VD5A 4XJ8A 3G6JB 5IW0A 5GALA 1C8M2 4CDUB 5JZGC 1EYBA 3ZSKA 4CUAA 1MACA 1VRBA 3HN1A 4OI2A 2XHKA 4FOYA 3OG2A 1RINA 1QEXA 2VOKA 4OI4A 5GJ6A 4XDQA 2VOWA 4SLIA 5HCBA 4BZ4A 1YQ5A 1QQP1 2EVXA 2WAOA 3INAA 4LLFA 4M3CA 3WVJA 1LODA 4AGRA 4DOUA 3VKFC 2WLPA 2W1WA 3NQHA 5GZCA 4KNCA 4MYEA 3LKJA 3M2MA 4TLGA 3WD5A 5FPAA 2D6LX 2R042 3ZFFA 1V6IA 4YFWA 4C91A 4ZS3A 1SPPB 3JUUA 3KGLA 4INDA 4Q4X1 2JD4A 3WW1A 1IKQA 1CZSA 1I3HA 4Q1PA 3ILNA 3PUSA 5KWRA 4QKBA 4PT6A 4B7EA 3CL1A 1H1IA 2H6CA 2E7AA 5FZOB 5LWBA 4C1XA 2QQVA 2RS12 3B02A 5J37A 1BEV1 2R1BA 3TRSB 5I0SA 1RUG1 4HN0A 3VBSB 3AMMA 1CX4A 4AVAA 5IFPA 4LUMA 2RJ2A 4CP0A 1FX5A 4XHBA 5JR7B 3NAPC 5L7OC 3V0BA 2WNUB 2MPFA 3AX4A 3CF6E 4CP9A 3BIEA 3EO6A 3OPWA 2ZGUA 1OBNA 2IZWA 4TYSA 3ZFEA 5J48A 3BVCA 1WD3A 3L2HA 1RUG3 2G1MA 4UFJA 5LB6A 2I07B 2VQ0A 4IEUA 4LORA 4Q0VA 1BJQA 3SNMA 3SISA 4A7YA 4RQPC 1CAWA 2WO2A 4QB1A 3EYPA 1ZZ7A 4JGYB 1EPWA 2ZOEB 2JG8B 4YWAA 4IETA 2C1FA 1G9CA 1F35A 3WDVA 5KR7A 4DPNA 3IB3A 1F15A 1RVF2 3CJXA 1Z7S3 5I93A 3OBAA 1JMUB 3ACFA 1BBT1 3NMBA 4DB5A 4NWWA 2UWCA 4FTSA 1N3PA 1UZZA 4X6QB 2IFWA 3JXSA 4YW2A 2R1DA 2WFF1 3U4XA 1UMIA 3BYWA 5IT6A 3OGGA 3FC0A 3AVRA 4KGQA 5JXHA 3SH3A 3MFCA 4EN8B 5FZCA 2VOTA 3LOBA 1WUVA 1AUYA 1RGSA 1QJY2 3AYAA 3PMEA 4XOGA 4BQ1A 4AG4A 2VBDA 3KCCA 3VV1A 1LB2A 1QH6A 4XAAA 1B09A 1J3RA 3AFKA 4JRAA 2YG0A 4QDSA 1RUC1 2WFF3 4YSFA 2RG4A 4FP2A 3MUZ1 4MXWA 3QH6A 1L7LA 2WT2A 2VBPA 3I7DA 4Q0QA 4KQ7A 4BWOA 3VZKA 4IE7A 2Y8KA 2QQMA 5F37A 3ZXAC 4L97A 3T2OA 4LHKA 2WO3A 3A23A 1H8TB 1LCLA 3DECA 3L9JT 2XHNA 3ST7A 2UWAA 3B69A 4NHMA 2CL2A 4UXAA 4LXLA 3KV6A 4EZHA 4NPRA 4E2GA 4X8PA 1ZBA2 5LBFA 1XC6A 1UOGA 4DEQA 4YM3A 4NRQA 5LEKA 3MF9A 5JOYA 2A70A 2FQPA 1PVC1 2R071 3DYOA 5A80A 1ENRA 3ZSLA 2VNRA 2DTYA 1QJZA 3TEWA 4PIZA 4P5HA 4RHV2 2IXHA 4ISQA 1YXWA 2OW4A 3ES4A 2HEYF 2VZTA 3BALA 3GHMA 1GNHA 4GJZA 2LTNA 1H2LA 1OURA 3ZN5A 4AEDB 1MZ6A 1PM4A 4FCAA 5K0UA 2B8MA 1AL22 2HWF1 4AGVA 1LOFC 1Q8QA 1HRV1 1U5ZA 2JENA 3Q8FA 1YQ2A 3OYWA 4G3YC 4J6GA 2FDHA 1G86A 1QJX3 3VHPA 1G9BA 5EJZB 1AR82 4COUA 2CAUA 3C7OA 5I8SA 2GMMA 4BMBA 1JOBA 3SEPA 1IS4A 1C5HA 1C5IA 4BK5A 3DGTA 5DZEA 1CZTA 1XB9A 1JU4A 2QQLA 4QQPA 1SLBA 3MEPA 2NPIA 3T09A 1FPN2 2HWF3 5FRAA 3VKNA 2CGOA 2F17A 1G9AA 3MIBA 5EWSA 4QXCA 2AYHA 1OF3A 4EWEA 1YO8A 1ZVFA 1X7NA 3K2OA 1RUH1 4H14A 4AK3A 5B4NA 2WAAA 1U0AA 3WNLA 2Y6KA 3GM8A 5T5JA 4FPEA 1OSGA 4YW5A 2R32A 1MS3A 1BKZA 5FP7A 4GWMA 2R0FA 4RYDA 5FZ8A 3WF4A 4IGPA 1GZ9A 1RUI1 4KBZA 3VZOA 1RYYA 4PBOA 5IVEA 2XG3A 1AYM2 5BNOB 1ZZBA 5C8CB 1AYN1 2ZGLA 1SLTA 4OHWA 1PO21 1N47A 1Z78A 2GN3A 4PQQA 4RGAA 5D1IA 2P3IA 2XJVA 4PBPA 4AFBA 1W8TA 1DU3D 1J83A 2R30A 5FQ0B 1KQRA 4CEWC 3V0AB 4MOAA 2ENRA 4DRVA 4A42A 3P5BA 3WLUA 2ZGRA 4JHTA 5IAXA 5FZ4A 1YQCA 1AYN3 2Y64A 4Q4W1 1JW6A 1PO23 3FLPA 2DVBA 4Z82A 4HT1T 3IMNA 5KHIA 3KF5A 3CZUA 4CDWA 2XLGA 1PK6B 1L7QA 2BVBA 3VHRA 5F3CA 4EN6B 2A6ZA 3POFA 5GZGA 4OUMA 1VRH2 5A1FA 3ZFFB 1JZ8A 3OD0A 3OTFA 4BU2A 3UNPA 4E4SA 4Q4W3 3LF7A 3TNQA 3IM0A 3RI9A 1W6PA 2H6BA 5IVBA 3I49A 2IXCA 2CU5A 2XKOA 1HXS3 3DYPA 3ZIWA 4LITA 4Q4V2 2D44A 3S57A 4CEWA 3B7MA 4BB3A 1ONAA 1FMD3 1Q3EA 3SCFA 1H6YA 4LBNA 2DCTA 3KT4A 3JD73 3IN9A 1RUJ2 4DXRA 1POV0 5JZGB 1D4M2 4D6QA 4JV4A 3VD7A 1YQ6A 3TBDA 1SMVA 2XQXA 1JYXA 3V0BB 4QX1A 5CFDA 1A8MA 1PM7A 1ACCA 4IGOA 4R8HA 2C0ZA 3JZVA 1MPXA 5SV5A 1QXPA 4FPCA 4OZXA 4CDXC 1ST8A 5FZDA 1U5IA 3ZVXA 4COWA 3OUIA 1HLCA 4UFKA 5JOWA 4CCOA 3RNSA 4A4AA 1ULCA 1W0OA 2PHLA 3O0XA 4ET7A 2DVGA 2XBO2 1AR72 1CAWB 2VOXA 3O1OA 1GP5A 3AKPA 1MQTC 2ID4A 2ZEWA 1K5MA 3ACHA 5A7WA 5D8AC 2ZAHA 5C5UA 3UKNA 1L7RA 2VZUA 5A7PA 4NIAA 2DU0A 2ZTNA 1EP0A 3H8OA 1O8PA 2F4LA 3SC7X 2V4VA 4P5YA 4AZZA 1QJY1 2ZS6B 4QX3A 3WNKA 2ZZQA 2A5ZA 1F4HA 4COYA 4ZU4A 1BXHA 3ETQA 3NAPB 4CYDA 3FLTA 5FJHA 5BY5A 5L7OB 4Y1UA 3K51A 3VHOA 3ZXDA 4AQTA 4N90A 3I2IA 2R49A 1O7FA 5LA0A 4CDXA 2B5HA 1GWLA 2VCMA 4EWAA 3DCQA 3MLKA 3UK9A 3AKTA 1AHSA 4R4ZA 3IKWA 4UW4A 3ZR5A 2Y6GA 3ZX7A 2Y6HA 3I3BA 2YFUA 4QGLA 4RQPB 1JI6A 2ZABA 1UOFA 4FVVA 4JCKA 3T08A 1MQTA 1RUD1 4LIVA 1HB2A 5IK4A 1JZ2A 2QQJA 4GJYA 4XVHA 1S0JA 1UYXA 4OHXA 5D8AA 1JHJA 2VCBA 2G9ZA 3GHNA 2IXKA 2LUWA 1ULOA 1OA3A 2CGPA 4IV3C 4ZU7A 5G05L 5DUUA 2ZXQA 1TEIA 2WSUA 3CU7A 3VZJA 1CIYA 4JDMA 4IEZA 4XACA 1AR61 4XXPA 3WDWA 3LA3A 3MLJA 4SBVA 5FZ0A 4IDZA 3MIDA 1K45A 3HQUA 4HSLA 1W0PA 4XF4A 3TWIA 1VBA3 1V6KA 1VBB2 4QHOA 1O3SA 1TZOA 4EQVA 4GAZA 4W6WA 1E5HA 1AR63 5LATA 1KRIA 1KDKA 1GSLA 1OXCA 2BPA2 2PAMA 2JE8A 1Q8OA 1IZ3A 1K3IA 3PNAA 1NZCA 4Y1ZA 4BISA 3KQ4B 4D6SA 4IV3A 2JE7A 5F8PA 5CA6A 1R1A1 3OYWB 1QY4A 4H3WA 3WP4A 2JECA 1GFF2 1P8JA 4QGMA 4BLJA 2K9ZA 5EPAA 5JSPA 1LEDA 5A3MA 3MPPG 4GKXA 1LHWA 1W8ZA 4NR1A 1PMIA 5JSRA 2Z42A 1XE0A 2TUNA 2Z2SB 1JHNA 3BN6A 1OUXA 3NWKA 2K2SA 4BQ3A 3H8RA 1CONA 4IXLA 2L9LA 2DFCA 1AX0A 1W3VA 1W05A
chains in the Genus database with same CATH topology
3QD6A 4UW5A 5BNQA 2HWE1 2I45A 4HL0A 3B93A 3PLQA 4MSVA 5JDBA 2DTWA 3WXPA 5T54A 4FPGA 2CNAA 2GC2A 2D3PA 2PAEA 3MZHA 2D6KA 4ONUA 1T6GC 5ACA1 2B46X 1WCKA 1PZ7A 1CJDA 4YARA 3IPVB 2QQPA 4ITCA 2HWE3 1QF3A 5GLZA 1O3QA 3WW4A 2WZR3 1TMF3 4FPKA 5A32B 4F7ZA 1RUF1 4FOQA 2CGNA 2ZGKA 1AX2A 1DLLA 2HWB1 2YGMA 3E6BA 4HVQA 2JG9C 1G9DA 5SV8A 1Y3TA 1YFXA 2XJUA 3O7OA 4S2FA 1ZREA 1PIV3 2PN5A 4B4QA 4AYUA 1X36A 4BLIA 1LOBA 3I2DA 2ARBA 5FBZA 1WW6A 1RUF3 2B9UA 3WUCA 5HCAA 1S55A 3IDCB 3IDBB 3OY8A 3VDDC 4R9BA 2W39A 3FE5A 1OOPA 3N36A 3RRDA 1UKGA 3T1LA 3OCPA 4XJWA 1J1TA 2JKBA 1H0BA 1WCSA 4ATFA 3VBRC 5LK7B 4CEWB 1S0CA 2JG9A 4GIQA 2ETEA 3ZPYA 2XJTA 2GH8A 1UKRA 4YZ2A 3WQ7A 1X50A 4YZ3A 1VB4A 2ZBJA 3H1WA 3WDXA 4P9XA 2XBO1 1W6MA 5GM0A 3T1MA 3WR0A 3ILFA 3FFQA 2P2KA 3DKWA 3J4UH 3HT2A 4R9CA 4AQ6A 4IV1C 5FO9B 1MZ5A 4GMP0 2ERFA 2YV8A 4CDUA 3VDDA 1R081 1KXGA 4P9WA 1S0EA 3ZDSA 3ZXLA 2PLV3 1UX6A 1REEA 4HK8A 4XPVA 1AJKA 1A8DA 4QPIC 2WJSA 4D94A 3ACLA 1S0FA 3ATGA 2RS31 3ZXJA 1WW4A 5T52A 2DCJA 1PGSA 1TME1 1YYNA 3SH4A 3NV1A 3G7DA 1QQP2 2EXKA 4KU8A 4PJYA 1NCRC 1DHKB 2R0HA 1CR7A 2YHJA 2YXSA 4BH9A 1GANA 2VNGA 4CDXB 1TNRA 1Y9QA 4IV1A 4LEJA 3MIHA 2RS33 2F4PA 2RMU1 4XJZA 5F6LB 2BNOA 2D40A 4L99A 3VBSA 4Q4X2 2ARXA 1A6CA 2XJRA 3WW2A 3OD4A 5JPNB 1MQTB 4XBLA 4YFZA 1DQ1A 2WNUA 1IGOA 5F6KA 5D8AB 1F9KA 2XJPA 1RB8G 4QPIA 3GF6A 1RUG2 4AHYA 3AYCA 2RMU3 1KJLA 2B7YA 3KT7A 2VMHA 1S0IA 2WINB 3AZZA 1MVEA 4OVEA 4XFFA 1W6OB 1VAMA 1UAIA 5GKAC 1MVQA 2DCYA 4PIYA 5KHJA 1NCRA 4AXOA 2ZCWA 3HWJA 3H8UA 1EV11 1WGPA 4D3WA 4N43C 2DF7A 3WW3A 2WNVC 3RZZA 2Q1MA 2MEV3 5L36A 1AL0G 2WKKA 1HKDA 1RMU1 3AP4A 1RUOA 2QVSB 2D6PA 2WS91 4GH4C 4N7IA 3FLRA 1Q43A 1SBFA 5EYXA 1EV13 1VJ2A 2D6OX 3PMSA 4DY5A 2NN8A 1REFA 1O3TA 1VIWB 4LO8A 5FMOS 5L19A 1BBT2 1PNGA 4IV3B 1W2UA 2EXIA 3RS6A 2WFF2 5EJ3A 1RMU3 4MVTA 2UU8A 4YG6A 1KDMA 2XWBB 1WCDJ 2RM21 1LGNA 4N43A 2VUJA 1W6QB 3ZMNA 3IWZA 5AFBA 2GC3A 2A75A 3GZTB 1NQDA 3AMPA 5TSWA 2PHFA 1EPZA 1H8TA 1SQ4A 4Q29A 4JQRA 5JOXA 4GH4A 5JLVA 4LA2A 1DGLA 3N7KA 2RM23 1QNYA 1WLCA 1RITA 2RS51 1GQHA 2YDEA 4P14A 1V9U1 3WP3A 4IEWA 1GZCA 2P17A 4I0AA 3GZUC 4JTOA 5H9SA 4FPFA 4I01A 1IS5A 2NP0A 3KCXA 1SEFA 4JGZC 4U36A 4YNIA 4AEDA 2RS53 5FPXA 2BBVA 1QJX2 2R072 5KC6A 4PQ9A 5CBLA 1XNBA 3E5XA 4GQ7A 1BMV2 4YW1A 4DXZA 2WZPP 3UJQA 5DG2A 4KG8A 1ZA4A 2HWF2 1HRV2 4FAGA 4YM1A 2HEVF 1FV2A 3JCIA 1W39A 2E6VA 2BWAA 4QX5A 4LHNA 4AVCA 1O4ZA 1WBFA 3D0JA 4AQ2A 1UD1A 4WV8A 2ZZJA 1BZWA 4ES8A 2VVDA 1UN1A 2JG9B 3GYDA 3NV4A 5GZEA 4JGZA 5C9AC 2GNBA 2Z5WA 1RUH2 2ZHKA 1JTZX 5JIUA 3AXEA 3WQ0A 2QFEA 3GBGA 1QXJA 5T50A 1D4VB 1ND2C 4L8QA 3MI8A 5FQ0A 4DY3A 1RUI2 2X29A 1NLRA 1JYCA 3DV8A 4I02A 4Q2FA 4LT5A 3VDDB 3TB0A 3BPZA 1AYN2 1LEMA 4FTBA 5DDJ1 1PO22 1OD5A 1HRI1 2JICA 4DINB 3FBYA 1LESA 2ZGPA 2WT0A 1PK6A 4IERA 3VBRB 2CAVA 2PA7A 2OYZA 3WV6A 1ULEA 3BB6A 5C9AA 1YJLA 4Q4W2 4YGEA 4XF9A 5DDJ3 3WOGA 1HRI3 5DXDA 1HXS2 1VAKA 3THTA 4LO4B 3R05A 5EFUA 1ND2A 2ZA9A 4LTAA 4IV1B 1SLIA 3RWNA 1YJKA 3WP6A 1PNFA 5JZGA 4FOWA 4PF5A 1YI7A 2XKPA 3VUOA 3OJBA 1JUHA 1ND3C 3TYJA 1APNA 3AFGA 3H3ZA 4QPIB 4XTPA 2GMPA 3B9CA 2E7QA 1Z7S1 4J1XA 4AI1A 2P37A 3POSA 2VMIA 4DS0A 3T2TA 1BCXA 1NCRB 3VZNA 2ZX0A 2PHDA 3M3IA 1JH5A 1MZEA 1LHOA 1QDOA 2DYCA 2C5DA 2GZWA 4S2GA 3USSA 3M3EA 4H7MA 4XTMA 1AXKA 1IPKA 4HKWA 1J3PA 4A7KA 1IKPA 4CRQA 4Y22A 3D6EA 5CB7A 4MGIE 4OI1A 4Q8KA 3Q9OA 1DYKA 1UZYA 3NAPA 5L7OA 4R9DA 1QGLA 5E16A 2V5YA 1NQJA 2RJKA 5GLWA 1XYNA 2UYBA 3POYA 4MLOA 2BQPA 4K40A 4RSUA 2JDZA 3NL1A 4E4DX 1KS5A 1H2NA 3KS7A 2WIIB 1C8NA 5BV6A 4RQPA 5E89A 4AVTA 5KXCA 1NA1C 2ZAAA 1WW7A 4X8NA 3TN91 3D8CA 4AFCA 3ZIXA 4I2OA 5FMOL 2D5FA 1QOSA 4G4FA 4NOTA 5GLVA 4N43B 3WHTA 4WVZA 4C1WA 2WNVB 1PO11 3VKLA 4IESA 4Y20A 2DVFA 2O1QA 1RUD2 3P3PA 4XEZA 5E8AA 3MICA 5CG8A 3ILRA 2W68A 1YFYA 1AVBA 3GBFA 1IS3A 1QHDA 4GH4B 3TN93 3D0SA 4LO7A 4UBHA 3J8F1 4K8FA 1DGRN 1PO13 1AR62 2R061 3FUOA 1QJX1 4XFHA 5IK7A 4LA3A 1DYPA 1AF9A 4NN0A 5JCTA 2E51A 3A0KA 4QQ2A 1BMV1 4LR4A 3HBZA 5LEJA 3J8F3 5F5QA 5HCFA 3P3NA 2DUPA 2BYVE 4B4RA 4ES9A 2QCSB 1AXZA 2R063 4AFAA 3DN7A 3LWCA 2D7FA 3KZ4C 2IXIA 1WMFA 2FMYA 1JN2P 2W52A 4JRLA 1QJU3 1NOVA 3ZSJA 3VBOC 3C2UA 4B29A 5L73A 4G9SB 1R1A2 1R1ZA 3MW4A 4KGGA 3LSEA 3RYKA 4M0NA 4XQDA 5FTTC 3FUQA 4U2AA 3AP9A 5J7MA 4AQSA 3VN4A 5JMCA 4JGZB 4WM7C 3KD4A 1LOFA 3ZXKA 4LE3A 4I3PA 2HWE2 3H9AA 4RA0A 4LBQB 2WZR2 1TMF2 3IPVA 1TQ5A 2RJLA 4KG0A 5C8WA 4AHZA 3WDUA 5A32A 1WLDA 4HN1A 4FTEA 3LA2A 5ACA2 5BPXA 2E53A 3RYPA 2VPVA 4UW6A 5AC93 4NVPA 5JWPA 2P34A 3OGJA 4ISRA 1MS9A 2VMGA 1RUF2 2PHTA 2HWB2 3WP5A 4AFMA 1HXS1 1LHUA 2Q0AA 3ZN4A 4WZFA 1GR3A 1FMD1 4E4ZA 4DMIA 3LCPA 3JD71 5C9AB 4WM7A 2GU9A 1TE1B 5FLIA 1JBCA 4YM0A 4Z92B 2EAKA 4FPLA 4TLFA 4KWKA 4BIFA 1ND2B 1UIJA 4XQ4A 1XXNA 1RC6A 3FFZA 2IC1A 4M3CE 4XMAA 2FBEA 3EHKA 1FOD1 1GYKA 4LBQD 3RMXA 2F6BA 1YLLA 3SCHA 5FO8B 3HR9A 5FPZA 5K7PA 2BTVC 3WDTA 3S7EA 4LE4A 1RUE1 3CEWA 4META 4HVOA 1KS4A 1Q56A 2GSYA 4IL7A 3POWA 3LAGA 2BWCA 4WVMA 2YPJA 5T55A 2PLV2 1FOD3 1DGWA 3L2YA 4MH0E 3AZYA 1J59A 1V00A 4I3GA 2YYOA 4R52A 1FXZA 3U10A 2XL7A 5ABJC 1UCXA 2CWSA 5K9YA 1RUE3 3FBMA 5CFCC 1YFWA 1H1MA 4K7JA 3RQ0A 3THPA 1R082 2VH9A 4HVRA 2ZHLA 2D6MA 5DZFA 1O5UA 2ZGTA 2QDRA 4Y22B 4Q26A 2VNOA 1S1AA 3E6DA 1MR5A 1ND3B 1GNZA 5CAZA 2RE9A 2XWJB 5DUVA 2XH6A 3KT1A 4F3JA 2PAKA 4I0WB 2RS32 3I8TA 3PVOA 1N1TA 1N1SA 4YGCA 4A3XA 2FMDA 1TME2 4YRDA 4I0BA 4P9JA 4O9GA 2VW1A 3QH7A 1S2BA 2IWGB 3KM5A 3R4UA 1LU1A 2RMU2 4KWJA 4MXVA 1YUDA 1D0GA 4AI2A 1SBDA 1REDA 1VBA1 2PHUA 1UF2C 4YVSC 5B2GB 3I59B 1UIKA 4YW3A 2KM2A 4Y20B 1W6OA 1DGWX 5KXEA 1COV1 3O5SA 2PYTA 2GC0A 2A6YA 4NO4A 2FZ1A 4DRRA 2A73B 2JE9A 1WMDA 3HQXA 2EA7A 2XGXA 1WA4A 1HW5A 3D5OA 1SACA 3URFA 2VG9A 1AZDA 1IOAA 1NA1B 1COV3 1EV12 2D3RA 2V73A 2ZKLA 3AKQA 4OUSA 1NXD1 5GLTA 2UY8A 3AZVA 4AEJA 4KL1A 4YVSA 2QKDA 1RMU2 1VAVA 4A2UA 1PZ9A 3J26N 3PVEA 1G6NA 3VBFC 2WS92 4C0HA 1MS1A 1C4RA 3H1YA 4QM9A 3ASIA 4K1YA 4PCRA 2GN7A 2BVVA 3SH5A 1W6QA 1HDKA 4V1PA 4FBFA 4QT6A 4RHV3 3GNEA 3CNAA 2WZR1 1TMF1 1DBNA 2XLFA 1JXNA 2RM22 2ZHNA 4Y1VA 1S0GA 2IXLA 4GB31 3B5LB 4FOVA 1IHMA 2OIIA 2YUEA 1AR83 3PTYA 4P9GA 1CAXA 1PIV1 4RS5C 2WFPA 2UWBA 1QOTA 5H9QA 3LSDA 3UL2A 4XF0A 2R16A 3O0WA 4GB33 4AFDA 3VBOB 2RS52 4D7SA 5GZFA 4QPGC 4BCUA 3R4DB 1V9U2 4BA6A 1DG6A 1VBD3 3W9AA 5T5LA 2D97A 2O8QA 2PFWA 4D7TA 3V64A 5BNPC 2VGDA 5FDBA 1AYM3 2DVAA 3ZYPA 4WM7B 4AVBA 5LRSA 1N1YA 4RS5A 4IEOA 3U0ZA 1XQNA 1ULGA 2YC0A 3VHNA 5HI0A 1KJRA 3AKSA 4M0HA 2Z79A 4HZFA 4LUKA 2DCZA 3RI8A 1H4HA 3C3VA 1D0HA 4EN9B 3E6CC 1V6JA 1O5LA 4BE3A 3H7JA 4W6XA 2PLV1 1CJPA 1EAH3 4YM2A 1FT9A 3S0MA 3NW4A 4L92A 5BNPA 4HPKA 1X8MA 4AI8A 1BVP1 3JQXA 1OPMA 4EWDA 1R091 2EXJA 3VBUC 1OFSA 4WVMB 1AR91 3LOIA 3B00A 1E57A 4K3UA 1YIFA 4B7KA 5FO7B 5FFOC 5DUXA 4Q4V3 3EBRA 2OZJA 3MPBA 3X29B 1Q5OA 4RR3C 1DFQA 1RUJ3 4FPYA 4PDWC 3VBRA 1D4M3 1NCQC 1CD3G 1R093 4XQWA 5DDJ2 1ENQA 3AXDA 1AR93 1PZ8A 1HRI2 3NKTA 2P3JA 3WG4A 5BXXA 1PGL1 3CLPA 3RDIA 1ALYA 1S2KA 2BUKA 4F8AA 1FATA 4I09A 2LM3A 5EXOA 4WBBA 2PHRA 3SMHA 3VBUA 1AR73 2C9AA 2GDFA 2BEOA 3OBRA 3FJSA 4JDOA 5JI7A 1IQAA 3VLBB 3WDYA 4COZA 5J98B 1OA2A 4XIOA 2ZMNA 5FREA 1RTVA 4CDQC 5ABJB 4B4PA 4RR3A 1V6LA 1KITA 2XL9A 5FOBB 1FYUA 2UURA 5CFCB 2ZX3A 3JB4C 1NCQA 2XB6C 2NMOA 2A7AA 2MEV1 3EJKA 2YGLA 4MZUA 4JAAA 2WLQA 3V65A 3FMGA 1UL9A 2HWC1 1RUNA 5T3NA 4Y1YA 3SCGA 1EY2A 1UU6A 3A4UA 1Z7S2 5A33B 5H9PA 5E1RA 1SLCA 4CZSA 2AR6A 3H1MA 1OMIA 2QNKA 1XU1A 3I54A 2IFRA 1ZZCA 1VBC1 1LKNA 2HWC3 3K48A 4CDQA 2QZ3A 1POV1 2GMEA 1RL3A 4XJAA 3AJYA 3BCWA 1XNKA 2VW0A 3BIWE 4ASLA 4YVSB 1H9WA 2D98A 3WG3A 4XIKA 4I30A 1GICA 1C57A 3BOPA 3M3CA 1VBC3 3N7MA 1CN1A 2GAUA 1POV3 3FWEA 1VBB3 5I0UA 3S30A 1HQNA 4XFGA 4YVWC 3GZAA 4ORFA 2RR13 3ZFGC 4BIOA 2WNVA 4Q4Y1 1HV0A 3TN92 3N35A 4C0BA 1C1FA 2X5IC 1G8WA 3VBHC 1LHNA 1OA4A 3LB9A 2Y0OA 1PO12 1PVXA 2DURA 3WT3A 1B35C 1CAXB 2VVFA 1OHFA 4FPHA 1O4YA 2EF6A 4XJ9A 4Q4Y3 5T5OA 4HSJA 1VR3A 3VBFB 2Q4SA 2BFUL 4HK9A 2B42B 3J8F2 1ZX5A 1Q8VA 3WQ1A 4JDNA 2Q8OA 5T5PA 1RHI1 1F5FA 4YVWA 5I8TA 2R062 3RSJA 4XW3A 5J3UA 1QNWA 2AENA 2ES3A 4XZPA 2JX9A 1OLQA 2Q30A 4N53C 1ZRFA 1WMEA 4FXKB 3SXWA 2X5IA 4L2NA 4PLNA 4CEYC 1FI2A 1WW5A 4E2QA 2Y0IA 1RHI3 1XNCA 2VVEA 4HMZA 1B35A 5C4WC 1YNAA 3WNXA 4RS5B 1LOAA 4IEPA 2Q1ZB 3LGRA 3M1HA 4Y5Z0 1DQ6A 4BOWA 2Z69A 1SBEA 3H3UA 4PIXA 3SHRA 3VL9A 4QPGB 3NO8A 1C1LA 1D2SA 4O9EA 4XETA 2PHWA 4AVSA 2DUQA 3WG1A 2UY9A 5BNNC 4CP2A 4LBQA 4N53A 2D43A 3MDPA 4AVVA 1D2QA 5BNPB 4HPKB 3RYRA 4Z2WA 3KCYA 4K9SA 2A6XA 3CJIC 4CEYA 4RD7A 1QDCA 1LOCA 4OLLA 1ZRDA 2NQYA 2YMZA 2VY0A 4D69A 1URXA 2X8KA 2HYKA 4FPJA 2SBAA 1BVVA 4Z07A 1UPIA 5DUWA 1YI9A 1XE7A 1Y7BA 2NMNA 4YYOA 1UMZA 3R0RA 3U07A 3MW2A 5BNNA 3B94A 4EJRA 4Q0PA 3MYXA 4XXAA 1SLLA 5AVAA 4YZ4A 1FMD2 3I4IA 3CJIA 3H7YA 1H4GA 3JD72 4LBMA 5F9TA 2ATFA 5IK8A 3VBUB 3AB0A 4B3NA 3N4MA 3UV9A 1MEC1 2I2SA 3ZFEC 1S0BA 4QQLA 4S2DA 5JIAA 2AUYA 2DFBA 3WHUA 3KB5A 4RR3B 1ZBE1 1H2KA 4PDWB 5GLUA 1NCQB 1LULA 1QXRA 1FOD2 3HIFA 1DZQA 4JC1A 4YG0A 1CAUA 1QQP3 2D93A 4WM8C 4PLOA 3KLSA 1MEC3 4XMIA 3BU7A 1SCSA 4HKOA 2H0BA 4AF9A 2ZHMA 1RUE2 3M7AA 1ZBE3 3AMNA 4Q4X3 2DU1A 2CY6A 1DQ2A 3UJOA 3EQEA 5E88A 2EIGA 3O12A 3ZN6B 3KMHA 1ND3A 1BEV3 5CIRA 4YGBA 4CDQB 4MUVA 4L9BA 3WY6A 1RIRA 2AGSA 3MFAA 4N7UA 1LHVA 2V09A 4WM8A 1G7YA 2R6QA 4EN0A 1AJOA 1MS0A 5FLJA 4XF1A 5J96B 4GWNA 4GMP1 2GC1A 1V6MA 1FNZA 1U12A 3H0OA 4BHPA 3D4KA 2B45X 4XE9A 2ZX2A 2HEWF 2ZJCA 2VUAA 3AZXA 4XFIA 3ZXEA 3I59A 1LGBA 2OUHA 2AH2A 2SLIA 3AKRA 4FXGB 1OQ1A 4GMP3 3S7IA 1BBT3 1VBA2 4GKYA 4RFT0 4FP3A 4LO6B 1CESA 3AP5A 4HFSA 5J09A 1N1VA 5C33A 2D6NA 1LOGA 1COV2 3JBG1 2OPKA 1GKBA 4IEXA 4AEMA 1NA1A 4Q8LA 5K0UC 1TNFA 2BNMA 4XFAA 1QJU1 3GALA 3PVBB 1UW8A 3ZXGA 5JPMB 3VZMA 2BNNA 3IT8A 4YVWB 1OLRA 4IEQA 4LHLA 4MGKE 3ZFGB 1RUC3 4CP1A 2ZPXA 2WQ4A 3VGIA 1N3OA 2WNEA 3JBG3 2XJSA 5KHGA 1MS8A 2X5IB 1FAYA 1NY71 2ZGMA 3VBHB 4LBLA 4R4XA 4EN7B 3MF6A 1YCIA 3MIEA 1B35B 3OBTA 4NHLA 3MGUA 4Q27A 1GZWB 1ASJ1 3NV2A 3VZLA 2TNFA 2CTVA 2X53S 1ZM1A 1PVC3 2R073 1NE4A 2P3KA 4KWLA 5JVVA 4Z8BA 5BUVA 1ZYBA 3V56A 4AWDA 5AC91 1HIXA 1ZZ8A 3UKVA 2QJVA 3AYDA 1U5YA 1ASJ3 4N53B 1C28A 4Z1VA 2YY1A 4GB32 1Q8PA 4ASMB 2Y26A 1HRV3 1S0DA 1Z0HA 1LGCA 4CEYB 3VBOA 3NSTA 5KHKA 1VBD2 3EXUA 5LRRA 3MIGA 1PIV2 1VBE1 2HWD1 3RG0A 2PTMA 2ILMA 4CDWC 5C4WB 4RGGA 2MNGA 1Q8SA 3DPRC 4PLMA 2WQZC 2ZMLA 3QBQA 4CTEA 1ULFA 4XHXA 2ZMKA 3RMYA 5CNAA 1C8M1 2ZKNA 3ME2A 1RUH3 1MZFA 3DL3A 4QD2A 3J9SA 3M70A 1VBE3 1V6OA 2HWD3 1XYOA 4P9IA 2XVGA 4YZ5A 4MGYE 1A78A 5BNNB 3ELNA 3N7JA 1RUI3