5CZKA

Structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
603
structure length
600
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucuronidase
publication title Structure and Inhibition of Microbiome beta-Glucuronidases Essential to the Alleviation of Cancer Drug Toxicity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 193
structure length 600
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czkA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5czkA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5czkA03
4POUB 4YHNA 2HT2C 3UBXI 1KXTA 1PG7L 4ODVH 4P4KC 5BS0D 2LVCA 4JG1H 4XPGH 5IVXB 3SCMB 4KTEH 2ZCLL 4WVRA 5DGRA 2BY3A 2IC2A 5I1JH 4QYOB 5JBDA 4MNGA 2ZSWB 1VFOA 1PZUB 2BNUB 2VITB 2Z31D 4I9WD 5B8CA 1J8HA 4OKVA 5CEZH 4DZ8B 1E73M 4Q9QL 2BSSA 3VXRD 4Z7NF 2CRMA 5GQBA 3CPUA 3PN8A 2EH7H 1CL7I 1P53A 3MMEA 1CGTA 2B5IB 3SDDB 3U7WL 4J3TA 3RKDD 4ZUVB 1C8YA 4XNUL 4LVEA 4MWFA 5CIPH 1SYSA 4M6NH 2G5BB 1ZGLP 1X5KA 4LSQH 1F58H 3TOPA 4XHQA 4XPAH 2GSGB 4U6VH 2DIBA 2XXCB 4WI5A 1QLRB 4PRBB 2ILLA 4YXKH 3NAAL 4OAWA 3UTTB 4S0SD 3HI5L 1KJ3L 1R5VB 3L7EB 5TQ2H 3NPSB 4Z7WF 1NBYA 4LCYB 3NJVA 3C6LC 2W62A 1VGKB 5F96L 1MRFL 2ZOLB 1S7QA 4FG6C 3RL2A 4HZ7A 5L88L 5E09A 1OLZA 1GL4B 4KROB 1JV5B 1AFVL 4EDWH 3I2IA 2E5EA 1YMMB 5DK0A 2YL9A 4Z7NE 2DT3A 1V02E 3QULB 4U1NB 1P7QA 4Y5XC 3QHZH 1U3HB 2CIIB 2WVUA 2WAAA 3REWA 4XCYA 4JAMA 2A3EA 1SHMA 3L5JA 1TFHA 5D7KD 4CD6A 3VXUB 3E2HC 4E41D 5J6GA 2DQEH 3NCMA 5DPNA 1KXVA 2FJHA 1RJYB 2YD5A 3ARDB 3HZYB 1JNEA 3ZZ1A 3QH3A 1NC4A 1KEML 4HP5A 4QGTA 4UR9A 1E6OL 5CD3B 3WMCA 1N64L 4EVNB 3PL6B 1GOMA 3WFCL 5E00B 3IANA 1R5IA 3B2UD 1MFEH 4AC1X 5G05L 4Z7WE 1EVTC 5DJ6A 2JJSA 3D25B 4W6XB 1LO4H 3IAQA 3BN6A 3MLRH 5GGUA 2ITCB 4O58L 2NZ9C 4I0PB 2ITDB 4DWSC 1FA2A 4DKFH 4DVRL 2X41A 2A6DB 4XXCC 1LO3L 1OAZL 4GRLC 5IBLC 2D0HA 2O9OA 3R1GL 1NCBL 2M8XA 4XBGB 4LOUD 5EUOB 1QHPA 1JUFB 3KWXA 1IL1A 4OIIH 1A6UL 2IUZA 4PP1D 1UCTA 1LEKB 4TQEH 5EOTA 3WN5B 1OGGA 3L3JA 2JDAA 2JIXB 5TFSL 3ALFA 4BUGA 2H2SC 4HQQH 3GXUA 1YNKL 4XTRD 3WH6A 4XCCL 4JFEB 5F1IA 3U7BA 1U2HA 4MNKA 4HH9A 1CBGA 2ZPKL 3IETB 2CBVA 4HAFA 4YR6A 4CVXA 1XGTB 3ARFA 3CD4A 3BT2H 3K2UL 1YNTA 3MZTA 3PHSA 1BAFH 1EXPA 3PUHA 3VM5A 3OXRB 2W5FA 3ZE0F 1TZGL 3ROLA 3TTYA 3OPZH 1C16A 3LQAH 3NBNA 4JY4A 1A7PL 1XFPA 2ICEA 2Y72A 3H3PH 2B1AL 2AJYL 3T77B 2J5LB 3D2UD 4W84A 3E6FA 4OMDA 3EMZA 1X5LA 5C9JA 3QWOA 5GJSL 4WJ5A 2X0YA 4D72A 1RK1A 4NQED 5D9SA 1MFCH 3I3BA 3II1A 1ZHLA 5GNXA 2ORBH 2VDQH 4P49A 4XAKE 1RUQH 3LHPH 3DX6A 4DFHA 3C87A 4WIQA 1HL8A 2YKLH 4BJLA 4WI6A 3TIEA 1X4YA 5LXGL 1AD9A 1LO2L 2X89A 1IC4H 4C4KO 5KSAD 2VB5A 2BGOA 4V2CB 1XNAA 1X44A 4KV5F 2XM2A 1YUHA 4U5IA 3C60B 5D2NB 2CDFA 3TN0A 4F15C 2GI7A 3ZKMD 4R3SA 1FN4B 3MJ7A 1WVZA 3F6IA 5DJ0B 5J13B 2VZQA 5SX4I 3T0EA 4G8IA 2P5EA 1HXYA 1MCBA 1HCFX 3FONB 3FOMB 4M7JH 3ZE0E 4RYDA 1LP9A 5IMLA 5A8PA 3RPIA 3X13B 3SCPA 3VM7A 2MPAL 1K8DA 4QXTA 5BZWB 4D0BB 4XPTH 4ONOA 1T5XA 2B39A 1MIML 2P5WE 1EDGA 3SKOB 5D7LA 4F8QA 5CPSA 1QFPA 2DT2A 1P6FA 3PZTA 1Z9SA 3QPQD 2EC8A 2BHZA 5BRZB 1F4WL 1UM6L 3FRPA 4PJ8D 5INCA 3SDDC 3BYTA 4LPVA 4S1QL 3T3MF 1MFBH 3VFRB 1ZT1B 1YPZB 2ADIB 4HPGA 4KJYA 4LEOA 3N9GL 4LSTL 3ARWA 4GW5B 4XCFH 5ILTH 1MW3A 3ME0A 5HVHB 4MJ2A 5J57B 4NQCE 5IDIA 4X8JB 3W39B 3WCYA 4O9HL 5AAWA 3PZIA 3CAFA 3A23A 4GRWB 4H0GA 1ZS8A 4KV5E 4PREB 5E9DD 4WW2C 5JDJA 5E56A 2CPUA 2HTKC 4U0RC 5L9DL 4X5WB 2ATKA 3QO0A 3ZO0A 1NQBA 3RA7H 3NPSC 2FHCA 1AQDB 1TITA 3IDIA 3WV0A 1UACL 2XTKA 3UJTL 4X6DA 1NMAL 5DD6B 3H3BC 2GDUA 1ZHKA 5KVDH 4KROC 1JF5A 2WIIB 4FFVC 4L1DA 3VFSB 4AD3A 4X9GA 3AIBA 4XNZB 1GC1L 2PO6A 2X2YA 4X98B 3V6BR 4Y4KA 3VI3F 3QQ4A 3BP6A 1U3HC 1H1NA 3GSUB 5GGTA 5HPOA 2VDRH 1K42A 1D5BB 4YFLI 5MHSE 1I7ZB 3V95A 3IK2A 4WY7H 4F9LA 4AMKH 3T3ME 1AR2A 3U0TA 3QUYB 5D1XD 4I3RH 3O2WL 1WKYA 4PG2A 3L4XA 3QR2A 4YXLH 3B9AA 1S8DB 2BHUA 4BZ1H 3R0MA 1YDPA 1C7SA 1Y7VA 5DRXA 3O8XB 1K9FA 3FRUA 3AIVA 1SYVB 3S8WA 4MJ5B 1RZKH 4JGMA 3WFDL 4F7CA 2ZEYA 2VABA 2OXHA 3O45A 4PT6A 2C3HA 9CGTA 4I0PC 4N5EC 2DWDA 3J8F7 5DDHB 4XBEL 4JZ5A 3EMQA 3V7AE 2Y06L 4ZOCA 3PWUA 1LWJA 3PWJB 3W5NA 5FECB 4MAYD 1EEZB 5LVEA 3EOTH 4U6YA 3BSHA 1TMCB 3IGAA 3VI3E 1UJ3B 2W1UA 1NFDA 4GQPH 3SBWC 1J9YA 4XWOD 4QLJA 1IKNC 4OQ1A 4AY1A 2C3VA 5AD0B 3DO7B 1GH7A 5CCKL 4TXEA 2PWHA 2VAJA 4P5KB 4OGYH 3WS6C 1IKFL 2YD3A 4XVUD 3WSQH 2GCYA 4NO0D 3WHE1 4XVSH 4I8DA 4BF7A 1VFAB 1E4WL 4A41A 1I1AD 3KYNB 2VL5A 3NCYP 4NKMB 3P4MA 1L4IA 3TJHC 4XNQB 4E9LA 5ADPH 1UKQA 4M62H 3W9EA 3GSOB 3FTGB 1T22B 1S7WA 1MRCH 2BC4B 3DROA 2ZG3A 4UNIA 3NCYS 3T2QA 1L6ZA 2ID4A 3PGDA 3S3PA 4XWGH 3KS0H 4UOW1 3D18B 2WMIA 2IALA 4G8GD 4ODVL 4XPGL 1UH2A 4EZMA 2L7UA 4MGQA 4PUEA 1RZJH 1CVSC 3VWKB 4IRJB 5E24E 2O92A 1FDLH 1GJIA 3UETA 3LMJH 4KK9D 5I1JL 1A1NA 5D7JB 2Y4SA 3OR7A 5L7XH 2ZXQA 2QQNA 2G3JA 3QEHA 1C8PA 5GNZA 1T3FB 3KXFB 5D5MA 4D6HA 2IMMA 3CMGA 4QT5B 2DJ4A 3QEQE 3FOLB 2R56H 2R1YA 5CEZL 1YYLH 1OGAE 3GNRA 2VKXA 2EH7L 5ID1A 4OOUA 5HVFB 2RGSA 3C60C 1NM9A 1DQJA 3NIGF 2ARJQ 3G08A 3G6AB 3ACIA 4N0UE 4M6NL 3WDIA 5J13C 4YHIB 1UD2A 1E4JA 4LSQL 1F58L 4XPAL 1QSZA 1S7SA 4U6VL 2OSLA 4UIMB 2J8UE 2VDKH 1GVIA 5CEXB 3W2DH 4RDQF 4YXKL 5LGHH 3VFTB 5C0JB 8FABB 4B3KA 4HK3J 4UZGA 5TQ2L 3SOBH 4PUDA 1PBGA 4UOZA 3P0VH 3WJJC 4KJPC 3O11A 1F11B 4QY8A 1FNGB 1J1XH 2WINB 4GAJH 2ZG1A 3VXPB 5CBEB 4WCYH 2X7LA 5E03A 3WMSA 2FEEL 3PZQA 2VXVH 1EJ6A 5EH1A 3M45A 1RY7B 4EDWL 4QRPE 2RFXB 1W1VA 4UDTA 2QR0A 3QHZL 1S7XA 4GAGH 5CUSH 5HJ3B 5MERA 3HJRA 1YA5A 4ZUUB 3EO0B 1G7MB 1UXWB 3NIGE 3VXMD 3UG4A 2DQEL 1CZ8H 5IQ9A 2ERJC 4PLKD 4LHJB 1XCTB 1CDGA 3UCQA 2EDEA 5F89B 3O3BA 4X0KA 4HX1B 1BYAA 1RJCA 5GS2D 5MEPA 3MV9B 4TSAH 1PEWA 3U0PA 1MFEL 1XF4B 4NRSA 1OT2A 5ICXA 1LO4L 3WS3A 3OX8B 4PRHB 1BWWA 4JFYA 1W1PA 3MLRL 2EDFA 2E7LA 3ARUA 1ACYH 1NFIA 4KI1A 4LSRL 2XN9E 4OZFA 4FXGA 4DKFL 1AGEA 4MD5B 1SJEB 1CFQB 4WUUB 1KT2A 4NN6B 1BLIA 3F12A 4MNQD 5SWZB 1ZT7B 2F8XC 1CG9B 5I8EA 1JYXA 2H8PB 4L4JA 3O3DA 3RTQA 3NPZB 3LEVH 3QUXA 3LKRB 4OIIL 3BESR 2P4AB 4TQEL 3SJVE 2VIRA 2DS4A 5IBUB 5KANG 5A2BA 4HQQL 3L4YA 3BO8A 3WEOA 4H8UA 3HCVB 4JHAH 2XVKA 5DZOA 4M81A 3VRJA 4AWEA 3VRIA 3VFUA 3SDCB 1IAOB 2F54B 1OF3A 3GNMH 1FORH 1UJ3C 1FC2D 1K4DB 3DETD 3BT2L 3M1BA 3B9KB 4HC1H 4LX4A 4F9DA 1O0VA 1BAFL 4L4OA 3HUJB 1U8PA 4K3DH 5JIPA 1PFCA 3D69A 4PRPA 4LKCB 3OPZL 3LQAL 5GHWH 3HC0A 3GSQB 4L4VD 1NDMB 4JY5H 5BXRA 5MEQB 4X9YA 3H3PL 4CU9A 2SEBB 1T7VA 3DRTA 1A3RH 4PJCB 2YL5A 5EB9A 4MDPA 3LAFA 1EXUB 4Q0XH 1MFCL 2ORBL 2VDQL 4S2SA 3VO0A 2AJVH 2R15A 1ISYA 1CYGA 3CX5J 4OBRA 3VXSD 1RUQL 3LHPL 4YDVA 1A6ZA 2YKLL 3VDAA 1W3JA 4HFUH 3WLWD 1IC4L 4ODXA 3ILQD 5I30L 4GXVH 1GGYA 3VE0A 3FY1A 2XV6B 4ERSH 2O5YH 5IVXA 3CNKA 4LGXA 1QFWM 5KANI 4IRJC 3SCMA 1JPFB 1LLOA 1DBKH 2E27H 5D7JC 4QYOA 1E5NA 1OB0A 2WMFA 4M7JL 2M1KA 4JY6B 3BOVA 3R8QA 3SE3C 2VITA 1TETH 4YDIH 4XPTL 2OCFD 1I7TB 3PQYD 4Y16D 2AMGA 1ULOA 3E1F1 4DZ8A 5E7FA 1MQQA 2R69H 5IB4A 1EPFA 1V08A 1MCWM 3WQ6A 1GXEA 3H9SA 2LS6A 4G6KL 3KPSB 3WEMA 5EZJB 1F42A 4N0CC 3I2CH 2BNRE 3SDDA 4JVWA 4Y8DC 1BFOB 4U1MB 4ZUVA 1MFBL 3CSBA 5T3XD 3QXAB 2X9WA 4Z7QF 3L1OH 1RZKC 1KQZA 5ILTL 4XCFL 3I6LE 4P2RE 5BS0B 2LW8A 1QLRA 4MMXC 3W11C 2VLRD 1FV1B 4Y19D 3LEIA 3UTTA 4DGIH 4JPVL 1R5VA 3RA7L 4EI5D 5EN2A 3FQUB 2VLLB 3K4ZA 4LCYA 2LAGB 4NP4H 4KRPD 1S7VB 1RIHH 1VGKA 3QDJD 3QDGD 5HDOA 4JFFE 4L29B 2CYGA 4M6AA 2W9XA 5KVDL 1A02N 3GDBA 1JV5A 5C7GA 1YMMA 4Z76B 2HJKB 3C2AH 4PQQA 4Q7DA 5EO1B 3QULA 4U1NA 2APTA 2G60H 2CIIA 2VDRL 4PJFB 2YD1A 2CRZA 2OL3H 5E5UB 2OBGA 4WY7L 4AMKL 1X4XA 1JAEA 2NTSP 3VXUA 4OGZA 3CVHB 4EIGB 4I3RL 4Z7QE 3ARDA 3HZYA 1T6VN 3U79A 3HOBA 2DT0A 5DI8B 5CD3A 2HT3D 4ZTOH 1Z5LB 1PJ9A 3TBYB 4EVNA 5IMKB 3PL6A 1X6LA 4ZO9A 5J6HA 1JZ2A 2OYKA 1JGIA 5SWQB 4E0RB 2IANB 1P7HL 2NLJB 1OTSC 1R85A 2VISB 1JI2A 1XD1A 3D25A 1NAMB 5IFAH 2PWDA 5DLMH 1IM9D 1RZKL 2KQMA 4NF7A 2GAZB 3O4LE 3D1MC 1JWSA 2ITCA 2B4CC 3NABH 1A1OB 2ITDA 3AMCA 4JE4B 1RK0A 4D0QA 3VFVB 2A6DA 4NN6C 2Y1VA 3WNLA 1ZBVA 1K3IA 3EOTL 1XAUA 3PP4H 4GG6F 4DM1A 4OF7A 1Q6EA 3JWNC 3GEWB 4E41B 2XZZA 2ZXBA 3CPLB 1VESA 5EUOA 1ULPA 4ZOAA 3T2PA 2G9HB 5C0FB 4UOQA 5A6BA 5CSBA 2H1PL 4KI5D 3UESA 2ARJB 5GSVB 4UB0L 1ZK9A 1BG4A 3MCKA 1LEKA 3WN5A 5IFHH 3QP3A 4F8TA 1H3WM 1NL0H 2JIXA 5TPWH 1PZ5B 4NKIH 4X6CB 4OGYL 1BQHA 3WSQL 4PBGA 3ZM8A 4XVSL 3WYRA 2RR3A 1XF1A 1HL9A 4ZXLA 4K3JH 3BWAB 4F7PB 1H49A 3IETA 2YPVH 1BQSA 2IQ9H 2Y23A 5ADPL 1XGTA 4N8CH 1VF8A 1CGSH 3B9KC 3DVNB 4M62L 1BOYA 1MRCL 1GUVA 3OXRA 5CJXC 2D3LA 2JB5H 4ZUSB 4OZHE 4RWYH 4W50A 5E8NB 5ANMB 4BA8A 4XWGL 3GMPA 4QRRB 2R29H 1ODAA 3LPGA 3PHOB 4R7DB 3T77A 4GG6E 1RZJL 1JIBA 4NWTH 2X05A 1WE5A 1FDLL 1WK0A 1FQ9C 3PWNB 3LMJL 4J8RB 3DGCR 5FGBA 2JEPA 5L7XL 5FV1L 3STBA 1U42A 4MAUH 3GRWA 3SKUD 4HGKC 3U48A 2HTLC 1F3DH 3SCTA 1SMAA 3NGBB 3LEKA 2XZCH 2R56L 4RNRB 4HU0A 5BYWA 1YYLL 1TJGH 2XHNA 3KYAA 3U4AA 2I9TB 2YPLD 3TPUA 5GISH 3OLIA 3C60A 8A3HA 1GORA 5JHDB 4UINH 5D2NA 2AXGB 5F88B 1FN4A 1S9XB 5DJ0A 4G7YH 3MV8E 3MRNA 2XTJC 4XBPB 2VLJD 3FOMA 3GYCA 4L8CB 1G0DA 3OB0H 1IAMA 3X13A 1D9KC 2VDKL 2OKXA 3W2DL 5BZWA 4D0BA 3CHCA 1LK3H 1X7QA 5LGHL 4Z78B 2X4QB 4OQTA 5E2WH 2WVSA 1BG9A 1YMHB 2J78A 1MH5B 3SOBL 4N5UA 2DB8A 3P0VL 4NZJA 2QF8A 1JK8B 1HVXA 1QEWB 1RJLB 4RBPH 1J1XL 1KGCE 4ELMB 4GAJL 6TAAA 4WCYL 5BRZA 4PJEB 3VFRA 1ZT1A 1YPZA 1PYWB 2ADIA 5JMOC 5KSAB 4MNGE 3KPOB 3TCXA 3BEWB 5J06A 4JM2F 4X8JA 4GAGL 5CUSL 4TNWF 1AR1D 1J8HE 3GK8H 4PREA 1UYQA 2DICA 2AW2A 4WTZG 5FD0A 5HDBF 2OTWB 4PMUA 1CZ8L 2FO1A 1AQDA 2A77H 2Z31C 5JO5B 1NCUA 2XACC 4BQ9A 1JVKA 4LAJH 4C58B 1Q9OB 4TSAL 1R3JB 2V9QA 2WIIA 4AT6B 2X4PB 5HHPB 2F8OA 4X98A 1EDTA 3RKDC 2FBJH 3NIDF 3MU7A 4B3LA 2EE3A 4FQJH 5C3LD 1QHZA 1D5BA 1ACYL 5KTEH 1I7ZA 2ICCA 1L7TH 1WAWA 3FT4B 5IGXH 1OINA 1G7HB 2G4FA 3LQZB 3QIBB 5CZXD 3BISA 3QUYA 3N18A 4JFOB 1QSED 2ADGA 2G5RA 1E15A 1WIPA 1WDQA 1S8DA 3W0WD 1J7VR 2NY0D 1DQMH 1GGTA 2X42A 2VDLH 4W8LA 3O8XA 4DOHB 1CE1H 3LEVL 1D7PM 4ACPA 3EKCA 1WO2A 3G6JB 4JO3H 1SYVA 4MJ5A 1VDGA 4WENB 2YA1A 5IESH 2MANA 4WHYG 1TJIH 1T1ZB 1W3HA 3VMNA 5GGVH 5EA0H 4JHAL 2WMHA 3STZB 4NWUH 4Q9BA 5A2IH 5J89A 1XH2A 3P0YH 3QCTH 4MB1A 3PWJA 1EEZA 2BNJA 4TRPH 3GNML 5DA4A 1FORL 3TZVB 1XYFA 1UJ3A 5IROC 3ZR6A 4N8VG 4YHPB 4HC1L 1CDIA 4PR5A 3RNKB 4ML4A 4K3DL 3RILA 4L1HA 4HKJB 5AZ2H 2YUXA 4HZAA 3RY6A 5GHWL 5L0QC 5AD0A 3DO7A 4JY5L 3CUGA 1U93B 3MYZA 2DTML 1A3RL 3B2UC 1QRNB 4P5KA 1Q6GA 1QFUH 4Q0XL 1UWUA 4EJ1C 1VFAA 3ZYZA 4JO2H 5HSFA 2AJVL 3KYNA 3U83A 4GZIA 3EYUH 4NKMA 1EHAA 3AZSA 4XNQA 3RX5A 4Z77B 3AOFA 2PETA 3FTGA 1T22A 2BC4A 5BO1H 4GXVL 2DDUA 4ERSL 2O5YL 4GXUM 4L8SC 2YDQA 3D18A 3EYSL 1KB3A 4LOUC 1AXIB 1KJ2B 3VWKA 1L0YA 1DBKL 4PP1C 4CKQA 2E27L 5D7JA 2NSXA 5J8OA 4QHLB 4XTRC 1T3FA 1TETL 2XRAH 4YDIL 5DUMH 1MVUB 4QT5A 3FOLA 3P9MA 2YRPA 1LP9F 3FB5B 4R4BB 4AAXA 1E6JH 2R69L 1WBZA 2VTFA 4NYLB 1V3IA 1GOIA 2DL9A 3I2CL 3PTMA 4Q6IC 4P57B 4M1DH 3VFNA 1AXSA 5CWSA 2ZUUA 1CICB 1TVDA 3G6AA 2MJWA 4YHIA 1V3JA 3L1OL 3V8CA 2Z4FA 4KTDL 4QPWA 2WLZA 4R0LC 2HH0L 4UIMA 3HZMA 3WQWA 4NUJA 5CEXA 3G5VB 6FABH 4L9LC 5C0JA 4DGIL 1I3UA 3NZHH 2Z92B 2ZUSA 3AFLA 4YXHH 5T1MB 5LAXB 2Z4QB 2BVEA 2OR9H 4PRIB 1NC2D 1RIHL 1S5HB 2ZUQC 4HG4J 1FNGA 5JW3H 2WINA 3VXPA 1YEFH 5DJAB 5E1AB 4N9OB 4OSUH 1WTGT 2CUHA 4Z7VA 3ZTJH 1AGFA 5DVMA 5KSAC 2P5EE 2YD9A 2D9QB 1S5IH 1LP9E 1HEZB 2HAZA 2RFXA 3E3QC 3BPCA 3C2AL 4EAMA 2VXSH 4Y4FB 1F3JA 1TFVA 2G60L 3ZKMC 4AK1A 4XT1C 1WICA 5T1LD 4PV9B 4RQQB 5HJ3A 5ISZB 1L7QA 2YN5A 4J4PA 3B5TA 2OL3L 4PV8B 5D7LE 4UFIA 3EO0A 1G7MA 1UXWA 4B0MM 5K9OA 1XCTA 4X6EB 5DTFB 3MMWA 2OTUB 2FHBA 4OI7A 3UROR 1CLYL 4ZNCD 1PMHX 3ARQA 4HX1A 4TULH 3CFDB 4LRIC 4ZTOL 4NQSB 3MV9A 4AIEA 1B9ZA 2P45B 3P9WB 3PP3H 4GS7B 4QRUA 5AYQA 1QACA 1JZ5A 1AO7E 1WCGA 3CLFH 1XF4A 3MCG1 3M6DA 5IFAL 1FCGA 5DLML 3OX8A 5IHBA 3W6MA 4PRHA 3SDXB 5F71A 2O5XH 2GITB 1PX4A 5EORH 1H2JA 3NABL 3QDMA 1FNLA 4CJ0A 3JBG7 3AHYA 4OZGA 4DXSA 4MD5A 4X6DE 1CFQA 4WUUA 5DFTA 3ZJ7A 4LK4A 5KS9A 4Z7UB 4UFKA 3PP4L 1A3HA 3L3KB 2Q76B 1ZT7A 5SWZA 3SO5A 1TVPA 1CG9A 1INDH 1JI1A 1WV7T 2C8NA 3E6HB 1DN0B 1UD3A 2XM1A 1HK6A 1NFDF 1UXZA 3MJGX 4HLZG 3BLPX 1FO0H 3MNZB 4AD5A 2Z8VC 1MUJA 5BQ7B 1TLKA 4M24A 1NL0L 5TPWL 3WIJA 4NKIL 4XH2B 1B2WH 3FT3B 1HHKB 5D4YA 4P9HH 3HCVA 5H37G 2AXFA 5FHBL 3IDNA 4RAVB 4K3JL 1KXHA 3SDCA 2YPVL 1IAOA 2F54A 3KLHD 1I7RB 2IQ9L 4YIQB 1K4DA 1UEYA 4N8CL 1CGSL 2GHWB 3B9KA 3IDYB 1IQWH 4CCEA 3HUJA 3LN5B 5D1XC 1J84A 5ID0B 2JB5L 3MNWB 4JFPB 4MNQB 4LKCA 4LQRA 5I71B 4X80H 2R29L 4NZRH 1NCDH 1NDMA 4Z0XB 5C3TA 5MEQA 2A73B 5DJDA 2SEBA 3MA9H 1KELH 1II4E 1QO3A 3B9EA 4PJCA 5C2UB 1YHTA 4NWTL 2ZX8A 4JFDD 5T3XH 3BZDA 4ODTH 3CO4A 1EXUA 4RL3A 4GKSB 2AV1B 2CUMA 4MAUL 4L8DB 3EJJX 1NFDE 4NRRA 12E8H 3DXAB 3OKKB 1CGVA 1C3FA 1W9PA 2XZCL 4AYSA 3KL0A 1WFNA 1SY6H 3QOMA 2YA0A 4O02L 1TJGL 3MUJA 4MAYC 4NC0B 5D5MF 4QTHB 5CPQA 4PJDB 1BLNA 1NSNH 5GISL 5C71A 3U46B 4XWOC 1DBBH 4UINL 5DD1H 1VHPA 2JIEA 2UZIH 3MUY1 4JFWA 4G7YL 4GRMB 1Q9KB 1QNRA 1ZJBA 3QHFH 5AYUH 1JHLH 5C0CB 1AQ0A 1LQSR 4RX4A 4JY6A 3CTTA 5DHYB 5ABFB 3CH9A 4GLRH 2P5WD 1LK3L 4V1DB 4XVUC 5E2WL 1I7TA 2H32B 3L7FB 1UWWA 2C3WA 1MFVA 2RJ2A 4NKQB 2VCCA 4HA4A 1OT1A 1I1AC 2OP4H 2DAVA 2CKBH 3HE6B 2FX9H 3KPSA 3EOAB 5EZJA 2Z8RA 4G6FD 2DQXA 2V17H 4M02A 1BFSA 3DGGA 1HSAB 3ZT6A 4PGBB 3QXAA 4R6UA 2VX7A 4CN1A 3IF1B 2F8VA 4NQCD 4EUPG 2R8SH 3N1AA 5D5ME 1D2KA 2G3MA 5K33A 3GK8L 4RBPK 2G2RB 2ID5A 1FV1A 1XF2B 5H35B 4A45A 1W9UA 1UWSA 3FQUA 2VLLA 1TENA 2A77L 1S7VA 3ARGB 3PQYB 4L29A 1CBVH 5D96C 4QHNB 2V2XB 2MWCA 2I9LB 2ZX9A 3MZGB 4XB8A 1L7RA 3CU1A 5A6MA 2HWZH 3CH8A 2IAMD 4Z76A 2HJKA 2BK8A 4JQXC 4Q22A 2FBJL 5EO1A 4NO2A 2QHAA 4FQJL 5JUVA 3LQCA 2YPKB 2R4SH 5KTEL 5EU4B 3BH4A 3PXJA 1L7TL 5IGXL 1GHFH 1M05A 1TZIB 1WF5A 4CU7A 3CVHA 3L5HA 2WB5A 1UWXH 5DI8A 3F5WB 2VKWA 3JWOH 1Z5LA 1DQML 3TBYA 3U30B 5IMKA 2VDLL 3UG5A 1CE1L 5SWQA 5EU5B 4E0RA 2IANA 1I1FB 2NLJA 4ZENA 2VISA 4JO3L 4PTVA 1NAMA 1LHZA 4H25B 4W7UA 3SKJE 5IESL 4JANB 1TJIL 5LG1A 4R96B 5GGVL 5EA0L 3VH8G 3UPRB 5JXHA 3W26A 4AISA 4OZIB 1A1OA 1RZGB 1YQ2A 4OMCA 5EBMB 4NWUL 1KB9K 3VFVA 3P0YL 3QCTL 1KFWA 4FMKA 2EDKA 3R4DA 2J7LA 3EIFA 4ORGA 2OMBA 2JJVA 4TRPL 5KAQF 1CFSB 1U91B 4E41A 4XURA 4PLKC 3CPLA 5AZ2L 1RUMH 1V6VA 4WRLA 5C0FA 2ARJA 5GSVA 4S0TD 2ZNXA 1NGWA 1MREH 4ZO8A 1Z9OA 1SG3A 3UYPA 1P7KB 1PZ5A 5A3HA 2W9EH 2FH8A 5SWSD 2EDRA 4X6CA 3WSOA 2RGMA 3PBGA 2DDXA 4CMMB 1QFUL 4JO2L 1P9MC 1RZ7H 3BWAA 4F7PA 3DTXB 3EYUL 1HWHB 4ZAKB 2WYSA 4JFUA 1EQPA 4HZ6A 4XVTH 3LEYL 4PJ5B 4R2GD 2BNQB 3DVNA 1DCLA 4BKLB 4U1KB 5BO1L 1NOWA 5DFAA 1UB5B 5E6ZA 4ZUSA 3QUKB 1T0MB 3CX5K 1PKQB 3JV0A 5E8NA 5F1NA 4UQBA 5ANMA 4QRRA 3MUGB 2V38A 4F7MB 4HWUA 5CSZB 2R0KH 3PHOA 1FIEA 4R7DA 3C08H 2EE9A 3HG1D 1RFDH 4MZ3A 3NSMA 5IJKC 3J7HA 3PWNA 4J8RA 4N8VB 4CBPA 4LSPH 2R2HA 3CJJA 2XRAL 5DUML 4RNRA 1OGAD 1E6JL 5CP7B 1B90A 2V9TA 3VFPA 4UQCA 4A6YH 2I9TA 1JRHH 4YPJA 1ES0B 3ZHLA 5A43C 1I3RB 5I16A 3DETC 4PMQA 3O2DL 2PB1A 4M1DL 5JHDA 3ULVL 1D5IH 1XGRA 2AXGA 5F88A 3QQ9D 1F97A 4XUTA 2OR8A 4XBPA 4AD2A 7TAAA 3WLBA 2PTUA 3HE7D 3IJ7A 2EECA 1WZKA 3C5ZD 6FABL 4YFEA 1ZLSH 4Z78A 1ZHNB 2X4QA 3EJZD 4AZ6A 1YMHA 3NZHL 4E8CA 1MH5A 1KLFA 4YXHL 2H3NB 4CJ1A 1JK8A 1IAKB 2UVFA 4WW2F 2OR9L 1RJLA 5JW3L 4ET7A 4ELMA 1HT6A 5IVXE 1YEFL 1T7YA 4KQ4H 4WFEE 2WZ8A 4M7LH 4U33A 2C1PB 4PJEA 4EEEA 3WLWC 4HZ8A 3ILQC 3LN4A 3QNZB 4HWEH 1PYWA 5FM5O 1S9KC 4OIFA 1S5IL 3KPOA 3RCNA 4OBSA 3BEWA 1ZGLB 2EDJA 1CE6B 2PR4H 1HIZA 2VXSL 1RJZB 1TPXB 3W29A 3QPXH 2E3ZA 1GOWA 4P9HC 1H3PH 2K7QA 1M01A 2NCMA 1FHGA 3DSNA 3OGSA 2VLJB 4E5XB 4ZXBB 3BMVA 1LO0H 1WFOA 3O3AB 3V5KB 1H0IA 3ARGC 4Y16C 1SJHB 1P4LB 2J74A 4TULL 1U2YA 4LLAA 4JAWA 4UT6H 4Y5YB 1Q9OA 3OB8A 1R3JA 3DVGB 1XYZA 3IDAA 3CLFL 4AT6A 4KXZI 5HHPA 4M56A 4H26B 2E9LA 3R0NA 5CKAA 2O5XL 4QHUB 3UTTE 4Z8FH 1FPTH 5EORL 3NJXA 2XN9D 2VZTA 1BAGA 3FT4A 1QI3A 1VADB 3LQZA 3V4VH 3QIBA 4W7WA 5I73C 3AHXA 3IU3B 2E6QA 1V6YA 3IIIA 3RP1A 1INDL 1KIPB 2XA3A 5I1AA 1YMME 4KRPC 1IT9H 4PJXB 5I6SA 3HPLB 4FNLH 3AB0C 4PJHB 3SJVD 1FO0L 3G6JA 3QJHB 2IPKB 1Q8MA 4W8JA 4LSSH 2R9HD 5EUOF 2NT1A 1T1ZA 1B2WL 3VXUE 1RSFA 1LEIB 1NANI 4NKDB 1JHTB 4P9HL 3K81A 3STZA 2VVSA 4ZEPA 2C0HA 3MBWA 1J12A 3ARED 3MLVH 2XSAA 32C2A 1UD6A 3T04D 3TZVA 4YHPA 1IQWL 4I48B 2LTQC 2GK2A 3RNKA 5BXSA 4HKJA 2FX8H 2P46B 2PQSA 3QHOA 3WIFB 4X80L 3W0WB 4NZRL 1NCDL 4FABH 2HT3C 1BOGB 1JGEB 1U93A 4CD8A 3MA9L 4NPYB 1KELL 3L4TA 2WUBH 4NBXB 1QRNA 5EMYA 4QXWA 3OGVA 1VAHA 4IM8A 1XF5B 1OM3H 2HN7B 4ODTL 4OJFL 5B4XA 2BCKB 4OF8A 2DOCA 1LD9B 4AENB 3ZJ6A 3CFIC 3N0PB 4GQRA 12E8L 4ZAKC 3ZKSD 4HS8H 4PJIB 1SY6L 3GSXB 5EUOE 5MENB 2X1IA 5DMGC 4CD4A 4H0IA 2J7MA 3BUYB 5DJYB 4H7VA 2J4WH 2QSCH 4EUPH 1NSNL 3Q6GH 4N1CA 3UTZB 1OGTB 4PRNB 1ORQB 2PXYA 3MJ8A 1DBBL 5DD1L 5D9NA 6A3HA 1GU3A 1JDDA 1KJ2A 2UZIL 4JFEE 4JQIH 1FFRA 3GSNH 4KI5C 1YEIH 1A22B 1N8ZB 3QHFL 5AYUL 4ZE4A 1JHLL 2XG4A 3NCOA 3DMMD 4MA3B 3B9VA 1MVUA 1SVZA 2O9TA 3A4AA 3FB5A 4R4BA 1DWIM 1NMCC 2W0KA 2OP4L 1CFVH 1H8OA 2CKBL 2FX9L 3JWOC 2BNRD 1T21B 2V17L 1TTFA 3GMQB 4MNHB 4P57A 2DTSA 1OP5H 1CICA 4K7FB 1V8HA 4QLRA 3I6LD 1Q72H 3WNMA 4P8VA 5C09B 4G3YH 3GSWB 4P2RD 4HJJH 1J9CT 1TQCC 2ZOKB 4K3HA 5JXAH 2R8SL 3WUEA 2DLGA 2J1KA 5I9QB 4UILH 2KD7A 1T20B 1GOKA 4HV8B 4GZ9A 1KQYA 1FNAA 2Z92A 5HHMB 5T1MA 4GRWF 4XI5D 5LAXA 2Z4QA 1V7NH 3T08A 1CLOH 4PRIA 1S5HA 4JFFD 2GUYA 2VLME 3GMLA 4TPRH 5D2NE 2Q8XA 5DJAA 4GIAA 1CBVL 3DNKA 5E1AA 1YECH 3KHOA 1AC0A 2I07B 1ODUA 2HWZL 2WIMA 1HEZA 4KKNA 4C59B 1T83C 4Y4FA 1DVFB 3U5UA 4KH2A 4NRYB 1GRWA 5ISZA 4TXWA 1J1OH 2R4SL 4PV9A 1GNYA 3IS0X 3E0GA 4GMTH 4PV8A 4CGTA 1GOOA 3K46A 1E4XI 2VZVA 4ZXBC 1GHFL 5DTFA 3D6GA 5BRZE 3HC4H 1LE5B 2OTUA 3SURA 4QHKI 2DPEA 1YPZE 1YZZA 3CFDA 3JWOL 4NQSA 4ZXOA 4AMCA 2PYED 2EXWD 3CFBA 1AY1H 4BK5A 5MP6H 4M1RA 3MYJB 5C0GB 3OF6D 4GRWE 4M3KB 1QNOA 3L95B 1FSKB 3O4LD 3SDXA 1AGBB 2GITA 1DE4B 1WWCA 2EIDA 5EULV 2EYSA 3VD3A 5MI0B 4A2LA 4HS6B 3GTNA 4Z7UA 1XIWD 5SX5H 3L3KA 2KKQA 1VERA 2Q76A 3VG0H 1TCRB 1HJSA 1G7JB 4KUCD 3ZJKA 3SEPA 1IGIH 4XPHH 4OCNC 5DVNA 3LIZH 3H9HA 3IKKA 3E6HA 2CK0H 5E4IA 1DN0A 1RUML 5IB1B 2J7GA 3EJYD 3MNZA 2Z35B 5BQ7A 1DUYB 1IC5H 2E6PA 2W9EL 2WW5A 4BM7A 3FT3A 4U4BA 1HHKA 4GW4B 4PS4H 2Y6SD 4KRUA 3GIZH 3RDTD 1RZ7L 4RAVA 1CZ1A 1OP9A 4FOMA 1PD6A 1I7RA 4KRMB 4YIQA 1NCAH 4JRYA 4UUJA 4XVTL 2OYLA 4P2OB 4AZIA 1UXSB 3LN5A 5CZXC 4KXZH 2YD7A 3MNWA 3NJ3A 1GVYA 1HILB 3VILA 3WDHA 1FNSH 1X4ZA 1AJ7H 2NY0C 1DHKA 4HTYA 2R0KL 2A73A 5ENWB 3C08L 1RFDL 4OLXH 2EPOA 4LPWA 2QADB 2HVJB 3S35H 3GJEB 3RX8A 1UKPA 4GKSA 2AV1A 1FVEB 5ALBH 1ZVSB 3UTPD 4LSPL 3DXAA 3BGAA 3OKKA 3Q2CA 3FHAA 3INUH 3MFFB 5EU7C 1E0XA 2XKNB 3AXHA 4RMVA 5HHVH 5CP3A 3KPLB 6CGTA 4WHTB 5E8EA 4IMKC 4A6YL 2J1EA 1JRHL 2W63A 2AI0H 4QTHA 4D8PB 4PJDA 1TZ7A 5JNYB 2W3JA 3MLYH 4TUJB 4J12A 2FLBT 1NANH 3U46A 3WFEH 1D5IL 1A6VH 3MV8D 1JDCA 3EO9H 1C8XA 4GRMA 3QHMA 2W38A 1Q9KA 5JQHC 4NBZB 3VFMA 3BP7B 5C0CA 1QUNA 5EFDA 1SBSH 3DV4B 3MRKB 3CDCA 5DHYA 4JFDB 5ABFA 3P9LB 4V1DA 3PTKA 1ZLSL 3CZUA 4C7GA 5I78A 3L7FA 1JNNH 4PLJD 4U1SB 2PTTB 4LMQI 3QRGH 4WEMB 1OSEA 2NX5B 2XFYA 1I9JH 3VXOB 2BFVH 3HE6A 4RGNB 2QHLA 3SY0B 3EOAA 3IT8D 1A7QH 4P7NA 4KQ4L 2WDBA 4M7LL 1TNMA 2D7OA 1HSAA 4HWEL 1JWMB 4PGBA 4HG4K 4OD3H 1J86A 3FHQA 2PR4L 3QT2A 4NZDA 3SE9H 4RRPA 3QPXL 3KXFE 1J8HD 4ATWA 2EQDA 1H3PL 1T80A 4S11A 3KLSA 4Z18A 2VDNH 2UY5A 2ICWJ 1NMBH 3BPOC 1XF2A 5H35A 2WC3A 1GJWA 1LO0L 1EFXB 1D7FA 4PGDA 3KG5A 5EZIH 1GOGA 1PG7X 1UHVA 5AY7A 3ARGA 4PB9H 3MROA 1BVKB 1CTNA 2V2XA 3MQIA 4QHNA 1GMMA 3RWEB 1M71B 2I9LA 4O00A 3H9ZA 3QOKA 4PRDB 2J12B 3MRLA 3VIPA 3VWJB 3IFLH 3BHBB 1KR0A 1FVDB 2FZ3B 5CLWA 4Z8FL 1Y0LB 1OAQH 1FPTL 2YPKA 4DUVA 3WXVH 3REVB 4JR9H 2A74B 1UY2A 3OKYA 5I5RA 3V6ZB 1N26A 3V4VL 2ZP0T 3VD5A 2YC1A 4XPBH 3BYYA 1JNHB 2VQ1A 1A7NH 4IJ3B 4HBCH 3EMCA 1W8NA 3F5WA 1M7XA 5DURB 4MGXA 1UYWH 1P7QD 4FNLL 2W92A 5EU5A 2Y6JA 5IJRA 1I1FA 4LSSL 2H41A 4H25A 3MR9B 4ENED 3HNYM 1HXMB 4JANA 3S3JA 2MCPH 4HMCA 4UNTA 1GQIA 4R96A 3UPRA 1HI6A 3TTSA 4OZIA 4YH6A 1RZGA 3D39B 5MI0C 1NC4D 1MXDA 5F3HB 4ZZ8A 2XI9A 5I1LB 3SGJC 3GMRA 3MV9E 4ZUTB 4H5SB 1CFSA 1U91A 4LLQA 1VSCA 3DUHA 2FGZA 1MCWW 3NFPB 1A9EB 2FX8L 4P59L 2UV3A 3LPPA 1BZ7B 4PRHE 5JIKA 5IG7A 4FABL 3HUJF 1UEMA 2A6IA 5DZNA 1P7KA 5FM5M 2WUBL 4A3YA 5TGBB 4WUUE 3RKPA 5A16B 4W4ZA 1OM3L 5BV7B 4CMMA 3D85A 4M1GH 4PJCF 5SWZE 3O3UN 3WQVA 4H1LG 1S9WA 3DTXA 4ZAKA 1KTDB 4HS8L 1BF2A 3AM8C 4PJ5A 1U30A 2BNQA 5A6AA 4BKLA 5HDLA 4U1KA 1KIQB 1E3ZA 1UB5A 2J4WL 2QSCL 2UVEA 3UZVB 3QUKA 2P24A 1PKQA 3Q6GL 3MUGA 4IHOB 4F7MA 5CSZA 1KN4H 4TTGA 1OW0C 4OFVA 1MW1A 1UWQA 2CBUA 4P8XA 2FR4B 4JQIL 3GSNL 1YC7A 5FA3B 3NFSH 1YEIL 2DSUA 4L0PA 3AXLB 3SGEH 4N8VA 3ARFD 2F54E 4YAQB 1O7VA 3EO1B 2WABA 2VRAA 4HJ0D 5SWSB 2CMRH 3LN9A 3HUJE 4BJ0A 1JGDB 3BGFC 3WNKA 5FO8B 5CP7A 2VX5A 1CFVL 4MD4B 4OV6F 4HIHB 1ES0A 4RFOH 1I3RA 4PJAB 4LGPB 4XUYA 4PJCE 1B3VA 3CZEA 1Q1JH 2NY3B 3ARBB 5FB8B 4OT1H 4BFGA 5CSGA 1KUMA 2VLKB 4Y2OA 4GAFB 4NOFA 1Q72L 1K12A 2VI0A 4G3YL 3WUFA 4AH2A 4HJJL 3BAWA 5FYJE 5JXAL 4OF6A 1D5XA 5EBWA 1O59A 3HG1B 1HNGA 2X89D 4FQ2L 2F53B 1WFUA 1Q6FA 1ZHNA 4MD0A 5F7EH 3TO4A 3QUMB 1YYMH 1IAKA 1V7NL 5B39G 1CLOL 5HGGS 3TN0D 4YWGH 4J1UB 4TPRL 5C0RH 4HUVB 2AEPH 3KPNB 1ESWA 2ED9A 1YECL 1G0CA 2C1PA 2V3FA 3F8UB 3T0ED 3RVTD 2P5ED 2NXZD 4LVNB 1LF1A 1G6RH 1HKFA 1TQBB 4LSUH 1ZGLA 2WBJB 2PWGA 1CE6A 4M5YH 3UTSB 1DBAH 1JN6B 1RJZA 5T5NG 2VWEE 4PGEA 3CBWA 4YFLF 4M5ZH 1J1OL 3O6KH 5D7LD 4HK0B 1H6XA 5DEGB 1ZGLM 4GMTL 1CFNA 1H3XA 4I3GA 4ZXBA 1OIMA 2GIYA 3KPSE 4HHAB 4PJFF 3HC4L 1RUAH 3C2SA 3V5KA 3V9FA 4XV0A 2YK1H 1SJHA 5CGYD 1GJUA 1P4LA 1U2CA 3MRCA 3W28A 3H7BB 4XUQA 4Y5YA 3NSXA 4YDJB 3DVGA 4BSWB 5F97E 1AY1L 5BS0E 2D7QA 3VWJC 1WPCA 2XUCA 2J88H 5MP6L 5C07B 2VN7A 1G9NH 5DK3A 4WF7A 1E6PA 4H26A 3STLB 4QHUA 5FV2A 4TX8A 4XMKH 3C7FA 5CPTA 2DDQH 4NRXB 1FC1A 1VADA 2EE6A 1N6VA 4FQCH 4GH7B 4AG4A 2Y8VA 1XH3B 2QV2A 1K2DB 3IJYB 3F5KA 3IU3A 3ULSB 4NSBA 1I5PA 3GBNH 2PCPB 1JNDA 3VG0L 4HMDA 4I3SH 4JJ5B 1IGIL 4KGLA 1KIPA 4XPHL 3W82A 2PO6D 3LIZL 4Y4KD 5DUPH 3ESVF 4PJXA 3G5ZB 3HPLA 3EZJB 4NI3A 1HYSD 4OZ4B 2IPKA 4PJFE 1IC5L 5IR1B 4LASH 2QLYA 3VW3H 1ZT4B 1YY8B 2IAMC 5SX5K 1LEIA 4NKDA 1JHTA 1CFBA 4WDIA 1BYBA 2GJZB 4KKLD 5HY9B 3O2VH 3GIZL 4BYHA 2I26N 3L3IB 1R8LA 2E9MA 4NQXA 2R2EB 5DQJB 3V6OA 1NCAL 4G42B 3WIIH 4DGVH 1UJTA 1AGCB 4I48A 2IANE 4NQVB 5JBFA 1MELA 2F5AH 1B4RA 3WIFA 3LSOB 1I3GH 2A9MH 5I1HH 1FNSL 1AJ7L 1ITXA 1BOGA 4XP4H 2E9JA 3HRZB 1HP4A 5FUOH 3CCHB 4OLXL 3PTQA 3C09B 2HN7A 4KKBD 3S35L 2BCKA 4OCXH 3AMKA 5ALBL 3OQ3B 1LD9A 4AENA 5D7KE 2EIZB 2QL1A 4E41E 5ETUB 3INUL 1S7TA 4PJIA 3AIRA 3WD0A 4E42B 2J7DA 4JEGB 5GS1B 5F9OH 3WXWH 5MENA 1KB5H 1JI6A 5HHVL 5EU3B 3BUYA 3Q48A 3R06A 5DJYA 1DQDH 2AI0L 5IKCB 2WVVB 3C8HA 1E4NA 3A67H 3UTZA 1OGTA 2P49B 4PRNA 1ORQA 3KYMB 3MLYL 4Y5VC 5GJTH 3WFEL 2VR4A 4X6CE 2DH2A 1A6VL 1UY3A 2X4OB 3EO9L 1E6QM 5KVGH 1WDPA 5FO7B 3U0WH 1N8ZA 1FHDA 1SBSL 4MA3A 1PAMA 4KQ3H 4D9QE 3QRGL 1Y6KR 3ABZA 5ANME 1MJJA 1I9JL 3NNGA 2BFVL 4QRRE 2AKRA 1RV6X 2OQJB 1A7QL 3OTTA 4R2GC 1T21A 3MXWH 2B31A 3GMQA 4MNHA 3T8XB 5L2KB 4E8DA 2PBGA 3VINA 3QJFB 3OXSB 4ELMF 4OD3L 1P8JA 1X5XA 4ZE5A 1UY0A 5C09A 3GSWA 4BQ8A 2PW2B 3SE9L 2ZOKA 3QR3A 2A3AA 4H04A 1VFBA 4LYPA 3TNMB 3HB3D 1V6WA 3IAPA 1L0QA 5C0BB 5C0ND 3VA6A 2VDNL 1NMBL 3HMXA 4F57H 1R24B 4NHCH 5FCZA 1C5CH 3LZFH 3L2LA 5EZIL 4MTVA 2V5MA 1ZWIB 3TLRA 5LA2A 2GFTA 5F7FA 4GI8A 5AAMA 4LU5H 3WEXB 4LQFH 2CKRA 3HS0B 2I07A 1B0RB 1SJXA 1DP0A 4HU8A 3IFLL 1DVFA 3FRPG 5L6YH 3VFOB 1S9YB 3LKPA 1OAQL 3DX8A 1CVRA 3QQ9C 2YC4A 2CD0A 4HIXH 3WXVL 4QO1A 4EI6B 4O5LH 4B41A 4JR9L 1HE7A 4JZJC 3UCRA 4DCQB 2OSYA 3HE7C 4Q9RH 4ELME 4XPBL 3C5ZC 1CXFA 4W7VA 1LE5A 4XX6A 1A7NL 4HPHA 4PJEE 3EJZC 3MRQB 4HBCL 4I0CC 4ESKA 1DWHM 3CFCH 1UX7A 3ORJA 4W70A 1MNUH 3AIEA 1UYWL 2IH1B 2XFRA 1JJUA 1UCBH 3RL1A 3WUBA 2HRLA 1ZEAH 4WU5B 2W9DH 3MYJA 4D0CB 2DQFB 1AP2B 4YHMH 2ZUWA 1AGBA 1UXXX 1DE4A 2MCPL 4DKAA 3OEAA 1UY1A 3G6JF 2E3VA 3VGAB 3P1IA 4QX3A 1K6AA 4HS6A 3JV4B 1IGTB 1B3ZA 4S3KA 2GQHA 4EKJA 1TCRA 4LCCC 1G7JA 5A6LA 1EH9A 4AJ0A 1X5GA 4YGAB 1N3NA 5HTSA 5GGVY 3V0AC 5LQBH 5IB1A 3PZGA 1CK0H 1EBPA 3OHXB 4QAWA 1DWAM 4PEEA 4XNXH 2UWEB 1T04B 2ZIDA 2Z35A 4Z2LA 1MAJA 1DUYA 5GPRA 2PYEB 2BVQB 3K3QA 3I2FA 2OSWA 2CITA 4U2ZA 4M1GL 3UO1H 3QFJB 3OKLA 4OFIA 5CZKA 3VXTB 3BQUB 3RTQD 4OB5H 3Q1SH 3QUXD 4P2OA 3PWLB 4DOHE 1UXSA 3K4DA 3SO3B 5J7CC 2NTFB 3G6JE 3RNQB 2JCCA 4NKOB 3TH2T 1RYYA 1QA9A 1WZMA 1HILA 2WUCH 1O7AA 1KN4L 2C1OB 5B4MD 4JJHA 1CF8H 3NFSL 2EDWA 2HVJA 2R9HC 3GJEA 1IMHC 2DLEA 1SHWB 1ZVSA 2PTVA 1RP9A 1MAMH 2CMRL 4PRPD 5DC0A 3HI1B 3MFFA 4XX1G 3A6OA 1KLGB 4ZG1A 3AREC 4JFXB 4RFOL 3ROOB 4D8PA 1E1FA 2A83A 5JNYA 3GH7A 4TUJA 2FLRT 5EO9B 1H6YA 2CSPA 1Q1JL 1QRNE 1JF6A 5HYJA 3SDAB 4OT1L 1INQA 4H1LB 1G9NC 2Q86A 3BSGA 3F4VA 1E27A 3LKSB 5J9PB 4UBDD 3BP7A 4PTUB 3DV4A 1OLLA 3MRKA 4XNYH 1NLDH 2GFBA 4ETQB 4JFDA 1QSFB 4PF1A 3O4OB 5I75B 4U1SA 1J10A 4DKDC 5HVWA 2NX5A 5F7EL 5GRJH 1YYML 4N9GB 3VXOA 3WF3A 2HT4D 4ZSOA 4YWGL 1U8MB 4WFED 5C0RL 3BZFB 2W47A 5FHAL 2AEPL 3SCMD 4TYUA 3QHNA 4W4OA 5D2LB 4BH8B 1IGMH 5EC1B 4PCSA 1T7XA 1G6RL 4JCLA 1JWMA 4Y1AB 2Y5EA 4LSUL 3L4ZA 4M5YL 5DWUL 3RWFB 1DBAL 4C56B 1NH6A 3RIKA 5KJRH 5E08H 4M5ZL 1U92B 3O6KL 3VFWB 1I1CA 2X8RA 2GKIA 3IXTA 4HULB 4HUWB 3FB7B 5D6CA 3H9SD 1A7RH 1U6AH 2ADJB 1EFXA 3DMMC 4ODWB 3SDDD 4ZFFB 4I18B 1UOKA 2E40A 1RUAL 3DRQA 5TE4H 1AI1H 1MFAH 2YK1L 3BSZH 5TE7H 3CFEA 4NQTA 1BVKA 4N0YH 2W60B 1B0GB 1M71A 3AHTA 2RV9A 3T2NH 4HOZA 5DHVB 1MCEA 2DBJA 3VWJA 2J88L 1HH6B 5EBAA 1G9NL 3BHBA 4F80A 2WAGA 5CFHA 2AK1H 3UTTD 1FVDA 1FE8H 1Y0LA 3TYGH 5B39B 5F7DB 5FYLD 1QPXA 4XMKL 4GWIA 4ZFMA 2DDQL 4TTDD 3MUAA 4JDTH 2A74A 3QI9B 1IV8A 2YD8A 4FQCL 4PRIE 1QZ1A 3V6ZA 1JNHA 3GBNL 2CH8A 4KROD 4GT7A 1IFHH 2F58L 4I3SL 5IYYA 1YMMD 5HHOB 3BKCH 1MHPL 2CRYA 4XI5C 3SQOH 2C9KA 5HI4D 5DUPL 4Z7UF 5LA1A 3ARRA 1FH7A 1NBVL 5I76A 1WAAA 1RD6A 3MR9A 4LASL 3S37H 3VXUD 3VW3L 1OF4A 1HXMA 3LS4H 3VGAC 2XOMA 3ARDD 3MRRB 1H3GA 3THCA 4OAWB 3D39A 2WBGA 4HGWB 1PEZA 5F3HA 4YGVB 4EXPX 3AS0A 2F2HA 4K07A 3PL6D 3DX7A 3ZKXB 5I1LA 1MHEA 2Y5TB 2AK4B 5FXCH 4ZS6C 3WIIL 4H5SA 4DGVL 3CZGA 4OZFG 4AZ5A 3RL2B 4QCIB 2D3VA 3NFPA 2F5AL 1A9EA 5FCUH 3LH2H 1IJ9A 1O7SA 3FW6A 4WV1A 1IGCH 4KRTA 1BZ7A 1I3GL 4WWID 4CN4A 2A9ML 3KLAB 5I1HL 3HNBM 4PPTA 4XP4L 2JF1A 2EXWC 5DJCB 1P7QB 3O6FB 4G8EB 3ZIZA 5FUOL 4URIA 1FGVH 3MRDB 5A16A 4LKSA 2R0LH 4OCXL 4Z7UE 1E9LA 2QQLA 1TE1A 1FL3B 5GGQH 2DWEB 4LFHD 4HXBH 3WL9B 2PWFA 4U2YA 1KTDA 1QG3A 2DQCH 4FFYH 3VFGH 5F9OL 3WXWL 5A6BD 1KB5L 2IFFL 4XVHA 2FIKB 1KIQA 3V52H 1DQDL 1XIWC 2JIXD 4KHXH 3TT1H 4P3CH 2DYPB 4Q74A 3A67L 4EQ3A 3GBLA 5GJTL 3GHEL 4IHOA 1MJ7H 5BOPA 4GINA 3O81A 1UQSB 4PJDF 2FR4A 5FA3A 3WDQA 3MOBH 5GGUB 3EJYC 5KVGL 4XUPA 1MPAH 2AQ3A 2GEEA 3AXLA 5KSVA 3U0WL 1U8OB 4FMFA 4YAQA 2VH5H 2FYYB 1CLXA 4HD9A 3EO1A 1CWYA 4MNJA 4LL9A 4KQ3L 3ULUC 1JGDA 2Y6SC 4MNQE 3L4VA 1I85A 2OXGA 4GQ9H 4MB5A 3RDTC 1J18A 4MD4A 3WELA 3ALPA 4HIHA 1RMFH 2QKIB 3MXWL 4YEEA 4L3EB 1R3HB 1MCFA 2LU4A 3ARBA 5EOTB 5FB8A 2X44D 2VLKA 4I77H 2APWA 1KV3A 5CJ5A 5E95B 2QSVA 2J7BA 3DXAE 5LCWL 2J1RA 3VIOA 1QBMH 2IQAB 5BW7A 1FHLA 5DC9B 1EOMA 1CDUA 3BPLB 4CAGA 4A3ZA 2F53A 3GM8A 4CVXB 1JGLH 4F57L 4NHCL 2J8FA 1C5CL 3C60D 1WT5A 4PJDE 3LZFL 5E2JA 2VLMD 1UA6H 2WMPA 1BHGA 4HUVA 2N56A 3KPNA 4P5TB 3ZKND 1RZIB 4DAGH 4QDMA 2Z1KA 4JY4B 4LU5L 2BOCB 4LQFL 4NFCA 2J7HA 5I1EH 1A4KA 1J05B 2LU3A 4ZFOB 1J0IA 4FQXB 5C0CE 3T0XA 3QWOB 2WBJA 4R4FH 4PLNC 4GWJA 3FAXA 1KCVH 5IK3A 4ZUWB 3UTSA 3D87B 1JN6A 3ZSSA 5L6YL 3H8NA 4IOSD 4V1DE 4WK9A 2Q3ZA 2OSXA 2FWOB 4HEME 2QMJA 4HK0A 4RGMB 5DEGA 4HIXL 4K8RD 4O5LL 1RURH 1UD4A 3GH4A 2WMGA 3CUJA 2JEQA 4Q9RL 5DRNB 5BRZD 4HHAA 4I18C 4M03A 3K74B 3NMEA 1KIUA 3OWEA 4MJ4A 4PLJC 5D4QA 5JQ6H 4G9FB 1K5NA 3CFCL 3S4SG 4ISVB 3H7BA 1MNUL 3HR5B 4JKMA 3TN0B 4BSWA 4ZZ5A 1UCBL 3T1WA 1QFWI 4A2MA 1IM3A 1ZEAL 4NDMB 2W9DL 5C07A 2W87A 3T0EB 4G8IB 5DS8B 3QIWB 4YHML 2CGRH 1VRXA 3W38A 4NC1E 3STLA 3RPIB 4AZ7A 4HS3A 1PW3A 5I6XC 1K8DB 2VZSA 5HGBA 3FAWA 4I2XB 5B8CC 3ZDZE 3K80A 1V0NA 1XH3A 1DYOA 1N7MH 2LVEA 3PQYE 4DTGH 3IJYA 5DRWB 3H3KA 3ULSA 2B2XH 1F8TH 2PCPA 5GGRY 5F6HJ 1EEQA 2CDGB 3QBTB 35C8H 1ERNA 3BP5B 4JJ5A 3GGLA 1KJVA 1QP1A 4DFIA 5LQBL 3G5ZA 1CK0L 2MQCA 4KJYB 4OZ4A 4XNXL 3HEIA 5JIWA 2W0FB 3VGHA 1BVLB 5IR1A 1ZT4A 4M8VA 3QUYD 3BMWA 2GY7B 4D3CH 1P6WA 1G9MC 4WNQB 3UO1L 5HY9A 3L3IA 15C8H 4QDQA 4ODSH 5FGCB 3N1PC 3O8XD 5JXEA 4OB5L 3Q1SL 4G42A 2HMID 2XYLA 1AGCA 4FK9A 2V2TA 1T4KB 1F2QA 1VENA 2FCBA 3CXHJ 5CG0A 1H11A 3LSOA 5G04L 2B0SH 4HKZA 2WUCL 1K85A 1NUGA 1IC7H 4GPNA 5J11B 1PZ2A 1D6EB 4OZIE 4LFHG 4L3CB 4MDOA 2GK0A 3GZKA 3CCHA 4YE4H 3L2MA 4IIQB 2QQNH 2NY6D 4UV7H 5KBNC 2V5TA 3QRFM 3IJ8A 1OPGH 2EIZA 1KXVC 1MAML 5ETUA 4PRAB 2E9WA 4U0QB 3D0LB 5ALCH 4FTVB 1BQHG 5GS1A 3MOAH 5EU3A 2YR3A 2DJUA 1NKOA 5IKCA 5DVLA 2WVVA 2NY2B 2V7NA 3ARXA 2D4DA 4UQ3B 3TV3H 2JJSC 3CFKB 3PWVA 3MLZH 4NGHL 4ZS7H 2X4OA 4MXVF 2VABB 3O9WB 4JRXB 1V0KA 5DK2B 1BGAA 1IQDB 5FO7A 1UMIA 8CGTA 4F37F 1TVBB 4FLSA 2JTDA 3PZNA 4XNYL 4AEIH 4PJ5E 1NLDL 4WI2A 1W9TA 1ZHBB 1E0WA 3KJ4B 2E6JA 1TDQA 3IGAB 2VXUH 1PKQE 4QOKB 2COQA 5GRJL 4YDLB 1IGJA 1E40A 4HA3A 3WBEA 4H0HB 1JFQH 3K2MC 1K3ZA 5EO0B 3UR8A 3VWKD 2OQJA 4MZ2A 3DSFH 4M7LT 3T8XA 4L3AA 4I5BB 1IGML 5EIQA 5L2KA 1HKLH 1EA9C 5D7JD 3QJFA 1LMKA 4JN1H 4V28A 1B30A 3MGOA 3N13A 3CC5A 4PIRF 4WI7A 2PW2A 1MJUH 3TNMA 3K8KA 2R0ZH 5E08L 3RVUD 1HHGB 3SKJH 3BPLC 1U58B 4U1LB 1FFQA 4OFYA 5C0BA 1YJDL 1KENH 1A7RL 1R24A 3ARFC 1U6AL 3W9EB 4HJ0C 3WFBH 2XIBA 2P47B 1ZWIA 5TE4L 1AI1L 1MFAL 5TE7L 3BSZL 1W91A 3V8OA 4DEQA 3VIGA 4N0YL 2RQ8A 3TYFB 3WEXA 5CS7A 3T2NL 2LV4A 3MO4A 3HS0A 5J1XA 1B0RA 1JU3A 1W3LA 2XWEA 1G01A 2AK1L 4D2NA 1S9YA 5FOJA 3TYGL 3C7GA 3UJIH 4OZFH 1R86A 3BKMH 3QEHB 4EI6A 3UZEA 1UM4H 4JDTL 3LMYA 3I6GB 4DCQA 3X11B 2H45A 1E4LA 4DKEH 2QQQA 1E55A 2DI9A 1CIYA 1HJQA 4RCAA 1IFHL 2JLLA 4E2OA 3O6AA 1MCPH 4TVPD 4JGJA 1JF1B 1ZTXH 3BKCL 4J6RH 3ILPB 3SQOL 1Q4NX 3TN0C 1OGBA 1I1XA 5HYSB 3JUZA 5JW4Q 1C93A 1UWGH 4UQAA 2ARWA 2E31A 4J4PD 4P7RA 2NPLX 3T0EC 3RVTC 4D0CA 2DQFA 3QIWC 2NXZC 3C8DA 1AP2A 4PJXF 3S37L 3BAXA 2UY4A 2VLJE 4M4RA 3S6TA 4AD4A 1Q0XH 4PJHF 1E0OB 3LS4L 4XZBA 4RZCB 1NGPH 3GSNB 2DQDH 3U4BL 5IWLA 4LLWB 5CYYA 3KWWB 3JV4A 3MV9D 1Z6JT 3MRPA 1IGTA 1MCDA 43C9B 3BAIA 2XVNA 1MFDH 1NEUA 5FCUL 5K9KA 3LH2L 2MSPA 2BRRH 4PRHD 4CW1A 1IGCL 5CGYC 3OHXA 3RY5A 2EXYC 5JZ7D 3GO1H 5B4NA 2UWEA 3RGVB 1NUNB 1T04A 3A47A 4FF5A 4JDVB 3O2DA 3QDMD 4ZO6A 2GJXA 1HN1A 1S7XB 4WUUD 3BCDA 1UUQA 4CU6A 1FGVL 4M8QA 2R0LL 5TDNA 3VXNB 5SWZD 1Q9WB 3HJEA 3B8SA 3QFJA 2VE6A 4Z7WB 3U6RB 5GGQL 5HHXL 3BQUA 4HXBL 2JJTA 2DQCL 4FFYL 3VFGL 1CGXA 1DFBH 2BXYA 4PJXE 3PWLA 1QFWH 2L7JA 1KF9B 3BN9C 4PJHE 5EFIB 2NTFA 3RNQA 4CMHB 5IQ7H 4KHXL 5HGAB 3TT1L 5A8NA 4P3CL 3BVNB 3W24A 2DI7A 4ZQKB 1MJ7L 1LG1A 2PO6C 1OTTD 5KZCD 5ICXB 3WF0A 3EFDH 3WS3B 2AEWA 4JFYB 4MDIA 5DQ9B 1F3RB 3MOBL 1HYSC 2OJZH 4CVWA 3WO4B 3SDCD 4UCFA 1NFIB 1MPAL 2F54D 4F9LC 1MQKH 2AJ3B 1R3IH 3HRPA 2BS9A 4MXWL 2DIAA 2VH5L 3B9KD 1AGEB 1KG0B 1KT2B 1C90A 5IJVB 2V6HA 4PG2C 4KJWD 1IEBB 5EPMB 3HI1A 1NOUA 2PW1B 1H9VA 3O3EB 2WNWA 4KKLC 3N17A 4GQ9L 5I8EB 1KLGA 3W0WE 2ENSA 1OM0A 1RMFL 3RTQB 4JFXA 3ROOA 2NY2C 3LCYA 5L8JB 4DGYH 3P4OB 5K9QI 4PYSA 3WNOA 3SDAA 3HHRB 2VIRB 4K71B 2FNBA 5KOMC 4I77L 3O9WC 2WP3O 5FYJD 1E1EA 1MQPA 2AP2A 3BO8B 2NW2B 1HJVA 3LKSA 5D1ZB 3GB7B 4QP0A 5J9PA 1QBML 3SCVA 4PJIE 1IAII 4PTUA 5EU7E 5MENE 1JYVA 4HH8A 4ETQA 3WIHH 4R97B 5IIEA 1QSFA 3MLTA 4NN5B 1JGLL 4KKBC 3RRQA 1KFAH 1IRAY 1DQQB 4PFEA 4X4XB 4V2XA 4N9GA 1FYHB 3G6LA 1XZ0B 1UA6L 4AZCB 3F7YB 5LBSH 1U8MA 2XICA 3BZFA 1CENA 3L4WA 2BERA 4DAGL 4GKZB 4XB3A 1WIUA 4QF1B 5D2LA 2K7PA 5EC1A 2VRQA 5I1EL 2WHKA 3NOIA 3KPPB 2AOSA 3DRTB 4RX4D 4BK4A 4Y1AA 3EUUA 4NZUH 5F72S 5KEZA 4R4FL 3VTRA 5IFJB 1KCVL 3RWFA 4C56A 1FO0A 1MCKA 4XNMB 4N8PA 1Q9LB 5IHUH 4LKXB 4S2SB 2EDLA 2XZAH 4YBLB 3KVQA 4PYHA 3VGFA 1RURL 4HUWA 3FB7A 2FSEB 4KUZH 3KPSD 1WIOA 2ADJA 4ODWA 5IM7B 1K8IB 4I18A 3SCWA 3ARZA 1UR1A 3D48R 1BYCA 5JQ6L 4QKXB 4FQLH 4P3DB 1OT5A 4XP9H 5C0DA 1T2QH 2W60A 3PV6B 2GJ6B 5C09E 1B0GA 2FRGP 2XQYK 5DHVA 2UY7A 3RPMA 1HH6A 4EN3A 5CGMA 2XVPA 2CGRL 2O5ZH 5JIIA 5B39A 5F7DA 2YG0A 1L0PA 2D9CA 1UR4A 5HHME 3D9AH 1BJMA 3QI9A 3HB3C 4QRTB 4LF3A 1N7ML 5D1QA 5ESQB 4DTGL 2V5DA 5C0NC 2B2XL 5TQ0H 1F8TL 5IB4B 1AGDB 1DANT 3H9SB 3A21A 35C8L 5HHOA 3H6JA 5ABDE 1BFVH 3BIBX 1A3QA 2XKSA 3NZ8B 4PY7B 1GGIH 2UUDK 2FIRT 5TDOB 1R3LB 2B1HH 4KY1H 3ELAT 3RWJB 2WZPD 1XRVA 3WD3A 4D3CL 2YEZB 3ALGA 3MRRA 5HGHB 3CDZB 4P46A 5E4EB 3S4SB 3CSGA 4HGWA 1G84A 4YGVA 5EN2B 15C8L 3GBMH 1PKOA 4ODSL 1A6PA 5EZOH 5IB5B 2Y5TA 2AK4A 2YHGA 1GPFA 4LYQA 4AD0A 1ZLWK 2IAND 5A1AA 2JELH 3EDJA 2Q7YB 4QCIA 5FM4A 1EIBA 4JM4H 1XR8B 4D6JA 2B0SL 5BRQA 4P08A 3KLAA 4OI8A 1N0XH 2F8QA 1IC7L 2GYSA 4MSWA 5DMIH 2BDNH 5DJCA 1KSRA 3O6FA 4G8EA 2YL8A 3DVFA 4YE4L 3MRDA 3GRWH 2QQNL 2GT9B 4UV7L 4DJMA 5B3JE 1FL3A 1BIIB 1OPGL 5IBUG 4U6HB 2DWEA 3NA4A 3WL9A 2EDBA 1DUZB 3DUUB 5ALCL 4OM0H 1TUXA 1NGZB 4ZODA 2NY5H 2FIKA 1Z9LA 1F4HA 5J6HB 2FX7H 4IMLB 4CMHC 1JZ6A 2ZJSH 1CXEA 4ZD3H 2DYPA 3QG6A 5ACZB 4G6JH 1WBYB 4F8XA 2CCRA 3TV3L 1MCIA 3G9VA 4ARYA 3MMUA 3QDHA 3MLZL 1CT8B 1UQSA 1M53A 2E7LC 1FZMB 1JWSB 2J6EL 3VVGA 1BTCA 4HIIB 2HVKB 3HN3A 1OWQA 1U8OA 4NM4H 1CDCA 1RK0B 2FYYA 4LCIH 4OQTH 4AEIL 1OH4A 2P7TB 1QPPA 4U1GC 4D9QD 5AYBA 4HK3N 2DCJA 3BRDA 4K8RH 2VXUL 1RHFA 4Q7NA 4K9EH 4QRRD 4RGOL 5D8ZA 5FYKE 2QSQA 5J1SC 1NWRA 3RTQC 1JFQL 5JLZB 3N1GC 2QKIA 5J3HD 3WL1A 3QUXC 3JTSA 3OV6A 3DSFL 4L3EA 2Q7NA 1R3HA 3I9GH 1HKLL 3MCKB 3QA3B 5GS0D 4TTUA 3S88H 4JN1L 4WTWA 3JTTB 1WB0A 3C7EA 5D1ZC 1BQHB 3RMEA 4LP5A 1MJUL 4GRWH 2IPTH 5B4MC 2E0PA 1A9BB 2IQAA 2R0ZL 3KPTA 4YNYB 3SKJL 4C57C 2OYMA 3TBSB 3GXMA 4U49A 4OLWL 2D7TH 5DD0H 2FH6A 2XFXB 5JHDD 4JVPA 5F6IC 3WFBL 2ZOXA 5ACLA 2Y9RT 4K68A 4P5TA 1RZIA 1S7UB 4YHGA 3GMPB 1LG2A 2J7CA 4G43A 2BOCA 5HYEA 1J05A 2ORXA 1YY9D 3L5IA 3BKYH 4ZFOA 3D3VB 1G0XA 4Z9KB 5DFWH 3WO3B 4FQXA 3A7QA 3AS3A 3VIFA 4Y4HA 2HJFB 3CZFB 3RWHB 1BJ1J 4ZUWA 4JFDE 1QLEH 3G6MA 2FWOA 3UJIL 3DI3B 4HUNB 4MJIA 4YBLC 2ZKHH 3BKML 3RPKA 5IB2B 2NX5E 1UM4L 3GSRA 4D6CA 3LD8B 4RGNE 4UBDC 4DKEL 3S36H 5DRNA 4Z2GA 4ZFGH 2CKSA 2A38A 4LLDB 2EDQA 1MCPL 3TPUB 4WIWA 1FP5A 5CBAB 4G9FA 5CD5D 1ZTXL 4J6RL 2A0LD 4ISVA 2HT4C 4YO0B 1MI5B 3HR5A 1YEDB 3JSSA 3SCMC 4H8WH 1UWGL 2QQJA 1BGGA 4JHBA 4NDMA 5BXFB 3MRNB 5DS8A 3QIWA 3OGCB 4APQB 1GAFH 5KSBB 3CK0H 1BEYH 4L4TB 5AZEH 3PDOB 1ZU8A 3QWRA 1Q0XL 1DANU 1IVLA 3FT2B 4C54A 1NGPL 4I2XA 1X7QB 1LK2A 2N7BA 4OCYH 2DQDL 4AM0B 4N68A 2YFZA 5DRWA 4A6OA 2Z8SA 2AEQH 5A2CA 2CDGA 3I75B 2B4KA 5M94B 1EERB 3BP5A 2B5IC 1LWRA 3RIFK 1XCWA 1VCAA 3V4UH 1UZ0A 2Q1EA 1OCWH 1R64A 1CIDA 1CXHA 3GO1L 3U2SB 2W0FA 3ARVA 1BVLA 3BJ91 2DJSA 3QIBD 4XMLH 5I24A 2J75A 3T1FA 3A4WA 1BJ8A 4WNQA 3QHTC 5DUBB 4ZNEA 3H42H 3LEXB 1PZ3A 4TTDC 2VN4A 3OR6B 3P11H 3RFZC 3I97A 1DFBL 1Q94B 1S9VB 1T4KA 1OD3A 5JOPE 2XY1A 4OLUH 3DVIA 5IQ7L 3ECQA 1WAAE 4QWWD 4X7DC 1JPTH 3VD7A 2E7MA 1W99A 5HI4C 3EFDL 1D6EA 4L3CA 3D39E 4EXKA 2HG5A 4LVHB 4ODUB 3FQWB 2OJZL 2HISA 2ZUXA 1FGNH 4IIQA 4PJ7F 4YC2B 4TSCH 1MQKL 3TZVD 1R3IL 3ZYIA 5JR1H 3VRLE 1EV2E 5M17A 1GPOH 1CL7H 2UY3A 1NFKA 4G6MH 3I02B 3ARDC 4QCFA 4PRAA 1XEDA 2ADGB 3D0LA 1WTLA 4FTVA 1F6AB 4R4ND 4PJGB 5DJ8B 3MRMB 5TH2B 3CIQA 3PL6C 1N2RB 3EFFB 1U0QA 4DGYL 1QRND 1BFTA 4UQ3A 5EIIB 5C7XH 1ZA6A 2E7CA 3CFKA 1QOXA 2VOTA 5LCVH 4PJAF 3O9WA 5C86A 1VIWA 4JRXA 5DK2A 5IF0B 1IQDA 4P23B 4GAYB 3OLDA 1GZQB 2WWKO 1B3XA 3LQMA 1TVBA 3PV7A 2D1ZA 3DHJA 2EDOA 3WIHL 1ZHBA 1J0JA 3O6LH 2NY6B 4K7PH 1KFAL 2D03H 4AXNA 4QOKA 2PXYD 4PBWD 1OOAA 1BREA 4PR5B 3MBEB 3AZRA 4JFZH 2GTWB 4PJ7E 5EO0A 4JZNB 3UXFA 1HJUA 1VEPA 4KGJA 3DC0A 4I5BA 3ZE2F 4DEPB 3WN5C 2BY1A 2BVDA 5E94B 5T1DH 4HWZB 4U1HB 4NZUL 2X1OA 1ZA3B 5SWSE 2IBBA 3CVIH 1JZ8A 1O6IA 5HVGB 4LLMB 4GO9A 1HHGA 3MV7B 5IHUL 1U58A 4U1LA 4CUAA 2B9VA 4ONGH 3GUTB 2W66A 4RAHA 4KUZL 2WKLA 3I3EA 4PJAE 1R0AH 3U37A 4P8UA 3O0RH 1CICD 2J8UF 3B2VH 2VLKE 4FQLL 4FP8H 4XP9L 4JFSA 1I8IB 1T2QL 3TYFA 2MMXA 1FNEB 4JG1L 5I1GH 2J5LC 2BVPA 1TVNA 4KTEL 1XSKA 3HG1E 1LGVA 5FGBC 2F53E 3IDMB 2XGBA 2B4CH 2O5ZL 2DRUA 4IRSB 3F7VB 1P4IH 3D9AL 4PRID 1HHIA 5H8DA 3I6GA 3LD8C 3ZE2E 3X11A 3P9MB 5LA0A 3FO2B 4PJ9B 1WBZB 4PGCA 3RQ3A 5TQ0L 2DLIA 4GO8A 2NY5C 1SEQH 5ECUA 1ISXA 4LLVB 2QBWA 1JF1A 3ILPA 1BFVL 5D2NC 1AXSB 3VFNB 1EZVX 4Y4FD 5BXPA 5CWSB 2DM4A 1GGIL 3UTSE 1BZQK 5HYSA 3ZKNC 5ISZD 5EC2B 1BQCA 3K4AA 3GHBH 4XP6H 3BEVA 1QI5A 2B1HL 4KY1L 5GGSY 2GW5A 2EO9A 5C8BB 2QJDA 3HZMB 5IEHB 4B16A 4NUJB 4X7SH 2DM2A 1NKRA 4RZCA 3GSNA 1EGJA 1AC6A 3TA3A 1T7ZA 5DQDH 4NNYB 5FIEA 3AXXA 3GBML 1UYXA 4D6EA 4LLWA 4GKOA 3KWWA 4K8RC 5EZOL 3TT3H 1IZJA 4K9EC 1XGYH 43C9A 3VX0A 3EOYG 2JELL 5GRZA 1BQLH 5C08B 1DSFH 1KCLA 5C07E 4Z7VB 4JM4L 1JHKH 4Q97A 3GJFB 4XUNA 1AGFB 1YEEH 3BAEH 1WITA 3TVMA 1CXKA 1FJ1B 2J1UA 3QQNA 1N0XL 3RGVA 3BPCB 1JMZA 3JWDH 5HVHC 1UKTA 2VYRE 4JDVA 2DSKA 5DMIL 2BDNL 1F3JB 4UFJA 3CXHK 1EHNA 3WFLA 4JCMA 2HRPH 1T0NB 1WDSA 4K55A 5FYJH 3VXNA 1Q9WA 2DT1A 5HI5D 4RA3A 3B8YA 4Z7WA 3U6RA 1A5FH 5K9OB 1RVFH 2C26A 4ODBD 1KYOJ 4OM0L 5HHQB 5FKPB 4OLVH 1FYTB 4GKNB 5EFIA 5SX4H 3RWIB 3AMGA 2FX7L 4PSRA 2ZJSL 5HGAA 4ZD3L 4QRUB 4PUBH 1IEHA 4J3WA 3BVNA 4G6JL 5D72H 4XNZC 3HAEG 1W0VA 4ZQKA 3QXDB 1KIRB 5JR2A 1HNFA 4ZFZB 4LVHC 5DQ9A 4UDUA 1WP6A 1UZ6F 2H9GA 2J3SA 4YC2C 4P9MH 1VKXA 2AJ3A 3QDMB 4JRYD 4NM4L 4S1DC 1KG0A 4LCIL 4OZGB 1AKJA 3GMMB 4OQTL 4A42A 2WHMA 3QUYC 5HI3D 5IJVA 1NCNA 4G6AD 1Q6CA 5EPMA 1NCTA 1IEBA 1CU4H 5KS9B 4WJXA 3CUIA 2PW1A 3O3EA 4K8RL 3G5YB 4K9EL 1S46A 4BUHA 2AABH 1KPVB 2BVTA 5KOVC 1X9QA 2G8ZA 2LU7A 1RI8A 3O8XC 5D9OA 2JKXA 1C91A 2HMIC 4M00A 5JDSB 3P4OA 2AVGA 3BDBA 4PTXA 3I9GL 4X7TA 4H8WC 1MUJB 1U3YA 5FDYA 1KB9J 3UDWA 3S88L 3DO3A 1A0QH 2NW2A 3DXAD 1QTYT 1E43A 1CZSA 5D1ZA 3GB7A 2AXFB 4PG9B 2IPTL 5KZCB 1NWUA 4I1NB 3IDNB 4R26H 1Z0NA 4ETYA 2BY2A 4OLEA 2IEPA 4F7TA 2A3CA 3ET9F 2X09A 4GG6B 1ZXQA 2NY6C 3AHZA 5HXMA 2D7TL 1NARA 5DD0L 1DQQA 1OL0A 4X4XA 1QNQA 1UR2A 2OZ4A 2IH3B 1KXQE 1MCJA 3DI2B 1B6UA 1UZ6E 1XZ0A 2FB4H 1ACZA 4AZCA 3F7YA 1WWWX 1CXIA 3OAUH 3RY6C 5I66B 5BWFA 5CILH 3PGFH 4GKZA 1BF8A 4QF1A 1BJ1H 5GZND 4AZGA 2N1KA 1JL8A 3KPPA 3BKYL 5DJDB 4LMQE 5C0CD 1AVAA 1QO3B 3U9UB 2XVGA 4W4NA 5IFJA 2HLFD 4V1DD 4WFGE 4M48H 4PTWA 2LFGA 3O6MH 1QLEL 4XNMA 1Q9LA 3QWQB 4RE4A 4LKXA 2ZKHL 3SPVB 3ZKQD 4M7ZB 3HE6D 4KMTH 2ZWZA 3M46A 3CVHH 2FSEA 4CN6A 3S36L 3CFJB 2EH8H 5IM7A 1K8IA 2YA2A 4ZFGL 1IGYB 3TFKD 2JALA 3O2LA 3RJXA 5L2KE 1P84J 1BLNB 2VAAB 4P3DA 4LGRB 2RHEA 3PV6A 2GJ6A 2W4XA 4ZMAT 3VWKC 4H8WL 1NAMH 4DZBB 1ISZA 1WSST 2XQBH 1XC6A 5C0BE 2Z9TA 4L8BA 1GAFL 3OKMB 3CK0L 1BEYL 4XHJD 4KK5C 1T89A 2BXZA 3BDYH 5BMFH 3HMCA 4NZCA 3KJ6H 3LB6C 4NSKA 5TJWK 1HZHH 4BXSV 3WL0A 3ARGD 4HKXB 1GZPA 4QRTA 3RVUC 5ESQA 4DN4H 2Q8BH 3WEZA 2AEQL 2J77A 3UG3A 1AGDA 3P40A 5BVPH 2M2DA 3DGGB 1KNOB 3OKOB 3V4UL 3NZ8A 4PY7A 2NY4B 4X4ZA 1ZANH 1OCWL 2WC4A 2DQIH 1DLCA 5TDOA 4WWKA 5B22A 1R3LA 3RWJA 4WO4B 1ECEA 4NJ9H 4D0DB 1JCKA 4F66A 2WBWB 3MCLH 1FAKT 4XMLL 3TIDA 4UZSA 1UENA 2DKMA 2YEZA 2UWEF 5I1CH 2B8OT 4MCYB 5HGHA 3S4SA 1I4FB 3H42L 4WKHA 1FBIH 5TDPA 4ORZC 4B50A 5IB5A 4E4PA 1YEHH 3P11L 4JKKA 1UT9A 2BRQA 1ORSB 2Q7YA 4OLUL 1FVCB 1XR8A 3BD3A 4TVDA 3ARYA 5FK9B 3UYOD 4ELKB 3C7HA 1URLA 4GO6B 1AIFB 3OJVC 1YEKH 2BVYA 4JM2B 5F44A 4NO2B 2MKWA 3DJ9A 3BIKB 3TGXA 4KUCF 2NY1D 2VURA 1FGNL 4J4PC 4LSDA 4TSCL 1A6TA 2GT9A 4U6TA 5JR1L 3QNXB 1GPOL 1CL7L 1M05B 3WH5A 5DC4B 1BIIA 1MHHB 5C1MB 4U6HA 4G6ML 4OZOA 7A3HA 3QUZB 1DUZA 3WUGA 5CEZD 3DUUA 3VJ6A 4NHUB 4YXLL 5FKAB 1XGUB 1NGZA 3WY1A 4BZ1L 3L3HA 1MYRA 1IEAB 5DSCA 1Y18B 3AAZB 4IMLA 3T09A 2FJGB 2UWEE 3ULUF 2Q87A 5F7MC 1BMGA 5ACZA 2PYEE 1WBYA 4J3UA 4KMLB 5C7XL 4GOSA 4UAOB 5C2BH 2WV3A 3D85D 1CT8A 5LCVL 4ODHH 4F2MA 2HP4A 1FZMA 5IVZB 3QFJE 5JZ7C 3VGBA 4ZAKD 4B5EA 1NDGB 4HIIA 4OZHF 4BELD 1QQDB 2HVKA 3LEGA 1QBAA 4PJ5D 2BNQD 5EIVA 5DMGD 2W0PA 1KTKE 1PDKA 2EXOA 2P7TA 5J1AB 3IFPB 3MGTB 3ZOAA 4QCEA 1BGXH 4ORGB 3D0VB 3O6LL 4K7PL 3RHWF 2D03L 3VCLB 2XZQH 4WFFE 4WGWB 5LKNA 3I2GA 4JFZL 5FCSH 4JKWA 5JLZA 2VZ1A 5F9WB 2A6JB 1OCQA 3QA3A 1NGWB 4DXTA 1OARH 5T1DL 3PWPB 3RZCB 3JTTA 1VGEH 5D2LF 5JW4M 1DLFH 4X5XB 1OTTC 3CVIL 3SKMA 5ABGA 1A9BA 1MHCB 4XCEB 1WZLA 5F9DC 3AC0A 1CDHA 3WFHB 4YNYA 3ULUE 3BD4A 2VERN 3TBSA 3SDCC 4ONGL 4KMQA 1EMTH 3TBWB 3VDCA 5FA4B 2XVLA 4RISH 1YQVH 5J12B 2XFXA 3I2KA 1R0AL 1F90H 3AIWA 3VG9B 4KJWC 2X4UB 4QXUH 3OGOE 5FL1A 4M93B 3NQHA 5F1NB 5J0BA 1T5WA 3P4LA 1S7UA 1R3KB 3B2VL 3U7AA 4FP8L 3KGRA 2WUHA 4ATLA 4QRQB 3QEQA 2VDPH 2DD8H 3V0VB 3JWDC 3D3VA 1HJXA 2ZUNA 2HFEB 3ISWA 2HJFA 3CZFA 3RWHA 2Y24A 4WI9A 3MV11 2V3DA 4LDOB 1QSFE 2B4CL 3UTOA 3TO4D 5JOEA 5E2TH 5DJ2A 5IB2A 5A95A 2YUZA 4M7ZC 1FZJB 2R2HB 3FB6B 1P4IL 1EGZA 3UTPE 3QIUB 1TVHB 4KRLB 4RIRB 1E28A 3ACFA 4RRPG 3UP1A 1G7QA 4NO3B 2R7EB 3JV6A 3VFPB 5D2LE 4OFKA 4LLDA 1SEQL 5I16B 1CD9B 3QB7C 5CBAA 1MWOA 3SQBA 4YO0A 1MI5A 1YEDA 1XGRB 5CJOH 3WFZA 1V3KA 4C56E 5DYOA 1QVOB 5C70A 3OKEB 5AYIA 3VDHA 4FZEH 3GHBL 4XP6L 5BXFA 5T5NF 1PG7H 5DGQA 4APQA 3OGCA 5C8JB 4ZXBD 5KSBA 1WCBB 3WLBB 4L4TA 3PDOA 3CMOH 1H8NA 1CFTA 4X7SL 2DMKA 3FT2A 2VMCA 4JG0H 2VWEC 4QRPA 5DQDL 2JK5B 3MUHL 4AM0A 1MWAB 2EDDA 4WKFA 4Z6AT 2L9LA 3TT3L 1BPVA 1XGYL <