5CZKA

Structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
603
structure length
600
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Inhibition of Microbiome beta-Glucuronidases Essential to the Alleviation of Cancer Drug Toxicity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-glucuronidase
total genus 193
structure length 600
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czkA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5czkA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5czkA03
2V2WA 4AC1X 2HJLB 1GVIA 1MCFA 5IP4A 4PJIE 3EGSA 5HHNA 1XF2B 1AC6A 4NFBA 1EHNA 5DS8B 3BZEB 3QDGD 1BYCA 2V5RA 1P6WA 3F62A 2GK2A 2JCCF 1CLYH 2C7UB 3EOTL 4JX0A 2NLJB 4ZZ8A 1WQVT 3WFLA 4OB5L 2W95A 4KRMB 4UAPA 4U2ZA 5EC2B 2HTLD 3KPSA 3X12B 2C26A 2YUXA 1INEL 4PSRA 2NY3D 4PTUB 1WKYA 4I0PC 3WENA 4R27A 4XGZA 1UEMA 3L3IA 3UC0L 2L9LA 3QDAA 3WS6A 3VIHA 2FEDD 2X89D 5AD0B 3BI9X 3T0VA 3P9LB 5HYSA 5DQDH 5H37G 3N1PC 1AHWB 2C9AA 2MSPA 1AFVH 4IOSD 1QRNB 2ZEXA 4KKAC 4YFEA 1YY8B 3B9KA 2QQOA 3QUZA 1ETZA 1OF2A 3HA0A 1WDSA 5DN2A 1PG7W 3UTSE 3LDBB 2VUOA 5ICXB 5C0BA 1DLHB 3MOBH 1MW1A 4OD2B 1OP5H 2FX9H 5FKYA 4JFOA 1FDLL 4IHOB 2X4UB 1PY4A 1ISVA 1FO0B 2ADFL 4NP4H 4QCFA 4WKAA 3OGRA 4ML4A 1PVHA 4BELD 2QADB 4Z5RB 4FZEL 3WHXA 1VEMA 4TSAL 4YFLF 3QIWD 3WO4B 3PV6B 3EAKA 1Y7VA 5EIQA 1YEEL 1VENA 2WQ8A 3QZWA 3L3HB 1GIGL 3MCLL 5DEGB 5AWNL 2XI9A 1C5DA 4FFVC 3T3ME 2IWGA 4Z7OE 1JNLL 2VLRE 4GS7C 4QCEA 4LCWA 4JAMA 5JPNB 3RWDB 4Z77A 3QISA 1AQ0A 3QDMA 1E27B 4S11A 4GW5B 4LAQH 2BRQA 4F7EB 3WSOA 1YEFH 3O2VH 3CXDH 2IAMA 4M7LT 3S34L 4QRRB 3HZVA 3D5HA 1GGYA 4I8DA 4ELMF 5LXGL 3NACL 4C56E 1TVHB 1ONQA 3K8LA 4QGYA 5HYQA 4M6OH 3S88H 1AIFA 3MJ6A 2J5LC 1MJJB 4KXZH 5I8OH 4PIRF 1HIZA 3PWJB 3O8XC 4E2OA 5GISL 5IFJA 1I1FB 1W1PA 1DQQB 4LK4A 1CE6B 1E6RA 3LPGA 3T4AB 3NPSB 3ZYZA 1D5IH 4PT6A 3VWJD 3Q3GB 3SEPA 4FQXD 3ZE1F 1S46A 4PEEA 2X9XA 3GH4A 1YNLH 2F53B 1FRGL 1KFAL 4WTWA 2PXYB 1NGXB 3QDJE 3LKOA 2DM2A 4JPVL 1WDPA 3VA6A 3QDMD 1EGZA 1TMQA 1AE6L 1Q1JL 4NC2B 2BVDA 1O0VA 4KJQC 3RWJA 5I19L 2D03L 2A74B 4XHJD 4MB1A 4WW1A 4JFVA 4L8BA 4WWKA 1SJHA 1UH4A 1BEYH 3U4BH 4EI5A 1JU4A 4ZAKC 1BIIB 4XPAH 5F9OH 3NMEA 5BV7L 3AAZB 4DGYL 1YEHL 4OIAA 4EN3D 3KL5A 2OJZH 3BUYA 3L5XL 5DO2D 3FT3B 3OAUH 3ESVF 1LO3H 4HJGA 5J12C 1QBLH 3T0EA 1W72A 3N1AA 3FB7B 2AERT 1HXYB 1UXZA 3CFCL 2D7PA 1LG1A 4NKDB 3TNMB 3U4AA 1QSEE 1WE5A 1IT9H 1R3IL 4FQHB 4Y5XA 1A1NB 5K9JL 1H8SA 3B9EA 4G7YL 3NBNA 3BCDA 1CDIA 3KHOA 2HVKA 4JFSA 5IR1A 3PWPA 4PJIB 3BSGA 1JRHI 3O2WH 3MC0A 1MQQA 1EO8H 5BWFA 2HRPH 1U92B 3L7EA 2EE3A 1A6WH 4JFYA 1E4XH 1NGQL 2A6JB 2E0PA 3A67H 4R4FH 3F4VA 1QNSA 3VIOA 3CQOA 1MCEA 4X7FC 5FUOH 3B5HA 4NZUL 4FN0A 2E9WA 4HDIA 2NX5E 3BWAB 2ARWA 3CFDA 1H15A 3BDYL 4HX1A 3N9GH 5TGBB 3VGFA 1JIBA 1FIGH 4D2NA 4JKPL 4HPYL 1VJSA 3T2NL 4PRID 4W4ZA 3F7PC 5KG9B 1J87A 1Y6MR 4BQ4A 4OLUL 4J1UA 4P4KC 2LE9A 3HI1B 1LNSA 3DXAB 4H1LH 5EUOA 2VRAA 5DDHA 4WCYL 1K6AA 1YEIL 4JFFA 4ZYKA 2Y24A 4L5FH 4FHBD 5F96L 3B3IB 3QI9B 3WJJA 4KQ4H 3U2SA 2W66A 4CVUA 4R97B 4H8HA 5D6CB 2V4VA 2CRZA 3I75B 4Y4KB 4TTDD 4Z7WF 2E32A 3FN9A 1CZ8H 4DKEL 5TDOA 3TVMC 3EJJX 5I2IB 5TE4H 4N1EA 4OFYA 2MNUA 1N3NB 1Q0XL 4F9LC 1QHPA 1HKFA 3TBVB 1WIUA 1HHKA 2B1AH 4EN3C 5GRWA 3NCJL 3BP7A 3GI9H 3DETC 1II4E 3F6IA 1L7RA 3QOKA 2BVOA 3JZ7A 4XNZB 1XF3A 1OAZL 2EYTA 3DX9A 2F19H 5F96H 4OI8A 5D2LB 3C6SA 5AZEL 2GIYA 5FA3A 1MXGA 1UYZA 3MRMB 4MDIB 1S9VA 3U0TB 2EBNA 3KYKH 1A4JA 4KU1A 1W8NA 3RWHB 4M80A 4UDTA 1V3LA 1I1YB 3UBXA 1E6ZA 3QQ4A 4FNLH 5FCZA 1QLFA 4JKPH 4BYHA 4FQXA 2ED9A 3U6RA 1J7VR 1XYZA 3BCFA 3WMCA 1DL7L 4P23C 3VXSB 2DPEA 4NO3A 1U3HB 5C0CE 1J1PH 3CJJA 4YXLL 5MHSD 1Q9LB 3WEOA 1F4XL 2BSTA 2ITCA 4CL7A 2WLZA 1A9EA 4HGWB 1JXJA 2WMKA 4U1MB 4MHHG 4MAUL 4EKXA 4JLRA 1HH9A 3LV3A 1FJ1A 3ILPA 5I78A 5EU4B 1K8DA 1FVDB 1EO8L 2R0WH 5GHWH 3SPVA 4E41D 4M5YL 5KJRH 2BNQE 4JM4H 2W94A 1OD8A 1TJIH 2WUBH 3QHTC 5A2KH 5C3LD 3IXTB 3VH8A 3LKSB 4LQRA 3WIJA 3TO4C 1NC4B 5D1XD 1NFIA 3A21A 3W38A 4LEOA 2UY3A 1WZ1H 3QCUH 5CKGA 4LPWA 4YDKL 2IXVA 3U46B 1V08A 1FL6A 2D4DA 2VL5B 1V6YA 5D7KE 2LV4A 2VDPL 2EDWA 5KSBF 1ZEAL 1NAEA 4L9LA 2OJZL 4H25A 2OTUA 4P5KB 1IAII 5DF0A 3G5XB 3MFFA 5GGUB 1YEHH 4PBVC 2J7DA 4U1IA 3IU3B 5EUOF 3TJHC 4JL2A 2GQHA 2XFYA 4U4BA 4PB0H 8FABB 1BEYL 2QSVA 4QWWD 4DVRL 2XV6B 4PTTA 3BAKA 2ZPKL 4ISVB 2NNAA 2D03H 3NJVA 1H3PL 2CSPA 1TZHA 1ZGLA 2UWEF 2GDUA 3PUCA 4OGAD 2VLLB 4WGWB 3UZVB 5B4NA 2V17L 3VNZA 4W93A 4YZFE 3AREB 1DANT 5E70A 1SDDB 2WINA 1V6WA 1FV1A 1FPTH 2G75B 3EZ8A 3VXOA 5H8DA 1D5IL 4W8JA 4NJ9H 4PF1A 2YXFA 5FL1A 5JO5A 2RAMA 5F9WB 1A7OH 5KSBE 3RZCA 1KTLA 3QHNA 3PE9A 4PJHA 4YDIL 2D20A 4K9EL 2CBUA 1D6EB 2UY5A 2Z91B 1L0XA 2F5AH 2R1XB 1YDPA 3IJ9A 3CZFA 2Q86B 4XNXL 1MNUH 3P2TA 3WFBL 1CF8L 4MD0B 3RKDD 1HHGA 4TUKL 2XVGA 3D3VE 2ZUMA 3NCYS 1OAYL 4M8VA 5TE7H 3TLRA 2GHWB 5IV2A 4Q9RH 4V28A 4JDTH 4Z0BH 3C2AL 3VDHA 4EQ3A 4HJ0D 2IAMB 5IESL 3I2GA 1NGWB 1PIGA 5EU3B 5I18H 1XR9B 1T5WB 5MENB 1KPUA 4YZFF 3X17A 2VM9A 1EQCA 1I7TA 2Y7QA 1F2XK 1QACA 2V7NA 3OZOA 3KPLA 4F9PA 2JIEA 4LKXB 4FZ8L 5EPMA 1ZBWA 4AZIA 4FLRA 3MCKB 2BJML 3QO1B 1UADC 4PJGE 5I1HL 1MRDH 5D8JH 4Z2KA 4GI8A 2EXWD 4UNUA 1NWSA 1M4KA 1EFXB 2DQIH 2XUCA 3MGAA 2NY1C 2XKUA 3NGBB 5I1IL 4AD1A 1RV6X 2JB6B 3NZHH 3UERA 5D2NE 2FX9L 3GKWH 3L4ZA 3VRIA 3N13A 1S9YA 5FKPA 1AR2A 1MJ8H 3EHBD 2X4NB 4KTYA 1FVCB 4HPOH 3EYFA 2XSBA 5IMLA 1WPCA 4KVNL 4S2SA 3DX6A 1N0XH 4ODXA 1UR0A 3SDXA 5EOCL 1KCRH 2XJ7A 3RWIA 1SJVA 4H8WH 4DEQA 1M71A 4F37K 1B0RB 3F7VA 1QVOA 1F8TL 2OZ4H 1J5OH 1P4LB 2Q7NA 5DQDL 3WFCH 4N9OB 4YDVA 3U79A 4GZIA 5D7LB 2A73B 3N9KA 3G5ZA 2VX7A 4ODTL 1F00I 4YHPA 4Z78A 3HMCA 5TE6H 4PJGF 1HT6A 2BVPA 3OKEB 5K59E 1UZ8A 2KH2B 1ZA6B 2QTEA 3RDTB 1EIBA 3ULVH 1I1AC 4KGLA 4RGOH 1N5YH 4OCXL 2DJUA 3TBSA 1KN2L 1LEIB 1W91A 5LAXB 3TNMA 3CU1A 4HXBH 5IM7B 3WLWC 1JWMB 1IKNC 1SYVB 2XNAA 3OJ2C 3N1FC 4P2OC 3STLA 3LKRA 4LVNC 1XIWA 2ZKHL 3MMUA 1TTUA 2IGFL 3FTGB 4MHHI 4NOFA 1ZLUK 4P7LA 3QUYD 5HHOD 4PJIA 4HK3N 1L7IL 3LAFA 5HD8D 1XF4B 2ZEZA 1NEZG 4PJAF 5J6GA 1MHHA 3WNNA 4HULB 4M8QB 2W9EH 4R4NC 4YLQT 1JRHL 3MLSH 2YC1B 5FHAL 3FN0H 3KWWA 3ZJ7A 5DZLA 2Y1VA 1R5WA 3I02A 3TTQA 1XCXA 3MACL 4ZXBB 1SJEB 3N1QC 4XHJC 3SJVB 4JFUA 3EBAA 4NKMA 3CUJA 4O4YH 1RJLA 2IADB 3OL2A 3RBSA 3GXUA 4U1NA 1ZTXL 3TNNA 1FYTB 3VFPA 2CKSA 1A7RH 4PUDA 1RIUH 1BFTA 1H8NA 5TFSH 2V3GA 3EYVA 4QLLA 3VFMA 5EO0B 1UM6H 4B3KA 4U5IA 4BQ9A 1B0IA 3VFUB 5KS9A 3QNYB 4HKZA 4KQ3L 5C6PB 1HVQA 3VFWA 4PJ9D 4MJIA 3RMEA 4HQQH 3PHOA 4HFUL 2OX5A 1LO5B 1UM5L 1LDPH 4HS6A 3C6LA 4Z2HA 1JWSA 5D6CA 2XVPA 4UQDA 4A6YA 5DZNA 2J4WL 1Y18A 4XMKH 1G7QB 4P8VA 3KLAB 2CCRA 2JCCA 4HXBL 1CFBA 1AXSB 5ERWB 5HDQL 4JFEA 4IRSC 4OCXH 3ULVL 3BAXA 3KPNA 4AW7A 4QEGA 4H88L 2Y4SA 3GSOA 3MMDA 3BXNB 4HKBB 3SDAB 3VDBA 5FV2A 5BXPA 3FFCE 4G8FA 3DUSA 4CVZA 4OIFA 1AHWC 3H42H 5JXHA 5BS0B 5D5MF 3M6DA 2VR4A 1Q9KA 3TJEH 3KL3A 4QFUA 1MCOL 5GS0C 5FOBA 3BIKB 5DFWH 1E1EA 3HUJE 1JV5A 2WMJA 4GRWB 4XRCA 2FB4L 3ALFA 1IGIH 2B4CC 1RJYB 2RJ2A 2AI0L 5L2KB 1MJ8L 5J89A 2HTLC 3I2CH 1AO7B 4NRSA 3WUBA 4ATWA 3IK2A 5I1IH 1IAIH 2A0LC 2DQIL 5D7SH 1DLFH 1ZWIA 4BFIA 1JYXA 2G3IA 2BJMH 5FGCE 5AYIA 4PV9A 3VIMA 3WFEL 1ED3A 1CD0A 1CD1A 3OKNA 4HUWA 5IFAH 2YXMA 4WFGE 4AENB 4PMRA 1P7KA 1E6OL 5MEND 4L4TD 1T22A 3ARBB 2FHBA 2YFUA 1FFOA 2X4PB 3IF1B 4OM0L 1FHGA 3MUIA 3BE1H 3I85A 5CHNB 4Z0BL 4C7FA 1L6ZA 4HIIA 1VHPA 3N1MC 4IIQA 5GSRA 3TBYA 2EXYD 3ZLQC 2NT1A 5J1AA 2XWDA 5ELIA 5E09A 3DV4A 2WN2A 3UROR 1YN7A 5I9QC 1VFFA 4BFEA 5GGTA 1U8OB 4PMZA 5CD5D 3QNXB 1KEGL 1UWSA 1NMAL 1LL6A 3ZTNH 3C09B 3L4YA 5D96B 5I71B 4L29B 3V5KB 4ZSOA 2QQJA 2WCAA 2BX5A 2VSDA 1LEKA 5FECA 1WWCA 1V05A 1TG7A 4Y4FB 3GSNA 3GTNA 1RZIA 3Q6FB 1UY3A 1LWJA 5IXEA 3GIZL 1UD4A 4UQAA 4XB3A 2CIPA 4QRTB 2OYLA 3GSVA 1GOIA 2K1MA 2YOCA 1DZBA 4Z95H 1CE1L 4FS0A 2Q8AL 5EIIB 3D0LB 4NFCA 3KYNA 1DLFL 2IJ0C 2FO4A 4XP1H 4H7VA 5DMJB 1IAIL 3MBWA 4NT6A 1ZU8A 3F58H 3ZHKA 4HOZA 3K2MC 5E8PB 4WO4C 5C08D 1G6RL 1UM4H 1SHWB 1KTDB 1PX4A 2JTDA 1PKQB 4MOAA 2FATL 2EC9T 3AVEA 1JNHB 3VRLF 1ZHBA 4AMKL 5JMOA 4RFNB 5DHXB 2NW0A 4XVUD 2EIZB 5D7JA 5IVXB 3TJEL 3OPZL 2E40A 2B0SL 4QHUB 1OF4A 5F6IC 4WI9A 4HV8A 5BRZD 3ULUH 2B4KA 1J05B 2QQNH 4BH8A 1RH9A 4J27A 4LVHC 1TIUA 3PP3K 2Y7QB 5EU5B 4P7OA 4RGNB 5J1TC 4K94H 5E4IA 1GCFA 4NQEE 4IS6B 3HRPA 4M5YH 3SJVD 2WAGA 2H26B 4Z7UA 1ZV5A 1UKTA 4QNPF 4WIQA 4ZAKD 1N4XH 3G04A 3UYPA 3D5OF 3MJ9A 4TPRH 4HFWA 4ZXEA 1GOOA 1YECL 5KSBB 4Z7QF 4S3JA 2UY6A 1WZLA 4JHBA 3IDAA 3FOLB 2GY5A 2NMSA 3VRLE 3PJSB 4UTFA 1HKLL 4M82A 3EGSB 1XF2A 3DX6B 1LDPL 5I66A 1TQBC 4ORZC 3V52H 4I0KA 4FNLL 5DD1H 4POUB 1B3WA 1E5JA 1H6YA 5E9DE 3AIVA 5DURB 5GGTH 4XAWH 3QJFA 3BKMH 1WC7B 2W62A 3VILA 1S7WA 1UM6L 3V2AR 4OAWB 3WUZA 5EO9B 3UTPE 4TOQA 4XX1G 2AEWA 5CINL 4PLOB 3E2HC 4ZAKA 1N6QL 3HJEA 2ITCB 1T6WA 4BQ2A 1ISZA 1B0WA 2GKIA 4XBEH 3VXPA 3PDOA 1AGFA 3WXVH 1ZTXH 2Y25A 4PTUA 1W3KA 5L7XH 5F7MC 2ZX5A 1AKJB 3SE9L 3RZCD 5SWSE 3ZSTA 2J8HA 1ZT4B 2L0DA 1VRXA 2NXZC 3D39A 1RVFH 1T6VN 4XPFL 5FYLH 5TE4L 3U83A 5CPSA 1PQZB 1NSNL 3PWVA 3U1SH 4CDHA 3T0DA 4Y16D 4OLXH 3MJ8A 1SEQL 2IC2A 2YFZA 3NH7L 4FQIH 1XGRA 3UTTA 3UNPA 4KQ4L 3QUYA 4LLMA 4GZ9A 1DBAL 2DYPD 3S6CA 1NUKA 4U3CA 2IGFH 5C0BB 4B5EA 1UX7A 4R0LB 1BGXL 1AQDA 1FNSH 1WCBB 3MJ9L 1ODAA 3GJFB 4JB9H 1YMMA 3LN4A 4ZUVA 5TF1L 2Y8KA 1Q6GA 3S37H 4HIXH 2QKIA 3LD8C 4FQ1L 2GTZB 3MLYH 2O61A 1N5YL 2IANE 1U30A 4Z7VF 4EOWL 3RM4A 1MFBL 4ZTPL 2NZ9D 2VDKL 1FYTA 2F8XC 3BQUC 5KVDH 1MRCH 5DEFA 3ULVE 1CDUA 5E56A 5JXAL 3UPRA 3MV8D 2BNQB 5E5MA 1MH5B 4U1KB 4XVSH 3WFCL 1RUQL 2YK1H 4UV7L 1FO0L 3B83A 3EHBC 4MJ6A 3BAJA 2NY7H 4UNTA 1RD6A 5JNYB 1JWSB 3NSXA 1SEBA 5CSYA 4KVNH 4XPGH 2ZICA 5EOQH 3QCTH 4F7CA 3RZCC 3TPKA 2FEEL 4L8CA 5CWSB 3FB8B 4JR9L 4OZOA 3PWJA 1G7QA 2I9TB 1NL0L 1MCNA 2FDBP 3GFUA 2XWJA 5ILTL 1CYGA 3A6BH 3AYSA 2B9VA 4ENEC 3SUUA 2J22A 2UUDK 1UZ1A 3WD2A 2BDNH 1ORSB 2XPGB 3L3KB 3OAUL 5EFIB 4IOIB 1TQCB 1DBBH 1U0QA 1VJZA 4FZ8H 4W50A 3ZYIA 3GM0A 4E8CA 1PFCA 4X99B 1KPUB 5J7CC 4CVZB 2VLJE 5JW4N 1CZTA 3KPLB 3QXAB 5IESH 3U4BL 1XGPA 2PO6D 4PJCA 5F9DC 3IFOA 2UYLA 2MWCA 4Q9RL 5FOBB 3S35X 3NIFE 2VXQL 4HS8L 4DM1A 3NNGA 2VLME 2VLKA 2WMIA 1DVFA 5I17A 4RGNE 7TAAA 3VWJC 1AE6H 1JZ6A 1WZAA 3BAEH 2HVJB 3NCCB 3PZIA 1QOXA 3VFSB 3I6LD 4X4XB 4UNVA 1PZ3A 4CDGC 4TVPD 2RQ8A 4AK1A 1NCBH 1WO2A 3MV7D 4PFEA 3BPOC 1F58H 3ULVD 5C09B 5DMGC 3SCMB 4N0YL 5ABFB 2FL5A 3QUXC 4XCYB 3QBTB 4EXKA 4FXKA 4F8TA 2OSLA 1T20A 1P69B 3TT3L 3BAEL 3X3FH 4PREA 3PXJA 3NACH 4I18B 4TUOB 5LXGH 4IISA 3JV4A 4YHZH 4G80B 4X5XB 3TIEB 3BGMA 1UYWH 1XGQA 4NO2A 5FKAA 3Q0HA 2HA1A 5ETUA 4H5SB 1U93B 5DQJB 5SX4I 1ZA6A 1IKNA 4E41B 5HVHC 4D6HA 4GSDH 2V72A 1IQDB 1T83A 1YEDA 4LGRB 4FABH 3WN5C 4R96A 3MCLH 3GJFK 2VDLL 3ARDD 4LPVA 1YEEH 2ILLA 3LKRB 3MJ7A 4WIWA 4UOQA 2DIAA 1GU3A 1PMJX 3GDBA 4AM0A 3KNBA 1VACA 3D25A 5ILTH 4XZBA 3G6AA 1FDLH 3KPRA 4MX7B 3BESR 3VXRA 2HTKC 2VX5A 3Q6FA 4NC0B 4CKQA 2PF0A 3TO4B 1MI5D 4X6DE 3V5DB 5DPNA 3IYLW 3VXRE 3VXNA 4JO2H 5DFVD 5C0EA 1D5MA 5KJRL 4XPGL 1JCKA 4U1HB 4HLZG 3GMNB 1UD6A 3I75A 1W9XA 5DC9B 2NY7L 2CGRL 4KXZI 4PJEF 4D0BA 2YK1L 2ADIB 2EE9A 3MLWH 4OSUL 3WNMA 2VT0A 2P5EA 2ZUYA 3IJYA 3LE0A 3RBGA 1W9TA 3UC0H 3U9PH 4CD7A 2XTJD 1KJVB 1RZGB 2WQRA 3E8UL 4LCWD 4JO1H 4M3JA 4MJIB 4UU9B 3ZZ1A 3CZEA 4GW4A 4ZDHB 3QRFM 3IDYB 2V9QA 3HZVB 2DQTL 3BEWB 4PRBB 4YWGH 3ACFA 4FQ1H 2D0GA 3MRMA 4HIXL 3OR6B 4M6MH 5TF1H 3RTQA 3MJ9H 3FQRA 4XVTL 4Y5XB 1M05A 4FFZH 4W70A 2VURA 1HINH 1EAPB 3CZKA 1DE4B 3RVWC 4NNYA 4E4PA 3DGGA 4D6EA 4M7JH 4WI3A 4NSKB 4QPWA 2WVVA 4PGEA 3X13A 4LSUH 1LP9B 1OSZB 3QHMA 1W9VA 5TH2A 3JV6A 3QCVL 3UX9B 4DGVL 1JN6B 5FB8B 4RAVA 2WXDM 4JPWH 3LY6A 1U36A 2XICA 3ARDC 4HHAA 3EYOA 1WGOA 1XGUB 4D72A 2OL3H 4HX1B 1DBKL 1Q9KB 1K8DB 5HNNA 3MRQA 1B9ZA 2QQQA 1DJSA 2HFGL 4D0CB 3O81A 4AD4A 1MOEA 4I0PA 4WCYH 4BSWB 2E7CA 3ARTA 2YD6A 4J1UB 3SKMA 4WUKH 2CITA 1R24B 1CFTB 5I1CH 2ESVD 4XNYH 5CJ5A 3OZPA 3LS5H 4KTEH 2W92A 3WMBA 4PRDA 5DD1L 2VCAA 3T2NH 3W5NA 1W72B 4JANA 5FO9A 3M17A 5GS1A 2ZUWA 1UWRA 1C12A 3CZGA 3O3DA 3HNSL 3PL6D 1BQHG 5EU6E 2R0KL 3FKUS 4S1RH 2Z8RA 1LK2B 4L4VA 5I2IA 1YECH 4DCQA 4AYSA 4G7VH 4R4FL 4AT6B 1N26A 3A67L 2VO5A 1R0AL 2YDQA 3WBEA 1OM3L 4ISVA 2J1VA 5D1XC 2CXKA 4Z77B 1KB5L 4HH9A 3QDMB 4DJMA 1XGRB 4I9WD 4WFHD 4R8WL 3UTTB 3ZR5A 3FZUD 4LSSH 3NTCH 3ULUD 3GSUA 5B39G 2G9HA 1W9WA 3HU7A 2F9BT 3OTTA 4DZ8B 1D6VH 2EIDA 5B4XA 1WZMA 3ABZA 4U1SB 5FUCE 3TWCL 1B3XA 4O02L 1U8OA 4CU6A 1RZFH 3QDJD 1XGZA 5CIPB 1MJ7H 4V1DE 4GRLB 4JZNB 2IPTL 4QHNB 3KPOA 1Q9OA 2ORZA 3FO0L 1P6FA 4MAYD 5JZ7C 2ZOXA 4GO9A 1YMHB 5C09D 5FECB 5FFLA 1BQCA 4PUEA 3ULUC 2OMBA 1BQHA 2C5DC 3S3JA 3KPPA 5BV7H 3ZTJH 3FFDB 3UJJL 5F9OL 1Q9LA 1JZ8A 3GSVB 4PG9B 4ZS7H 3BPNB 1JNEA 3MUY1 2BOBA 1MQRA 4XP1L 4HMCA 1L7TL 5I76A 5B3JE 3KYNB 1CK0L 2NY3B 1CE1H 2Q8AH 3ARFD 1MCLA 3WSQH 1T80A 1K6QL 3HZMB 4MDJB 4PJCE 4KKBD 4KV5F 1G9ML 5CZXC 2OP4H 3GGWB 4YBQD 4Z2LA 4LKCB 2DLHA 4PJ5B 4EI5B 3W9DB 4OBSA 2VCBA 4JQIL 4ZOEA 3RJQB 4WUUA 3FW6A 1KFAH 2DTMH 1PEZA 3B2UC 3ZTJG 1PPIA 1KTDA 4LDLB 4LVOB 3MRDB 4OLZL 3OAZH 5AYUL 3MRKA 1S7TB 2P24A 1UZ4A 1OGAB 1ZGLM 2XPGA 4K2UL 4LIQH 2EDRA 3S4SA 3ZTNL 5JIPA 4MDIA 4PV8B 2ESVA 2Z4QA 2X70B 3RM9A 1UCBH 4WEMB 4MJIE 1NBYA 3MMEB 3TZVC 2X0YA 2ZUSA 3S34H 4NWTL 1J8HE 4QLRA 1TVNA 3SGJA 2AXHA 8FABA 3CXDL 1MW3A 1Q9WB 4GQRA 4LSVH 5F1IB 4PJCF 4F37F 2HP4A 5DGQA 3UTQA 1KR1A 4E5XA 1CR9L 3MREA 3RNQB 4JZJB 5AWNH 1OW0A 4MCZB 1IJ9A 3KYMA 1TVBB 3OX8B 3FT4B 3LKQA 1KNOA 4QHMB 4WW2A 1GOFA 4KRNA 3SGEI 5CJXC 5FGRA 4W85A 1U8HA 1UZ8B 1RPQA 2DQFA 2R0ZH 3WLWD 1V03A 5HGBB 4M4RA 4X9BA 5BXRA 1TVPA 1CL7I 5D7SL 1XSKA 5A3ID 3K80A 4K3DL 3UTSD 4DQOH 1CT8A 1KB3A 3CLWA 1A1MB 1VKXA 1P7QD 5I15L 3IXTA 1EEQA 4LLAA 5KOVC 3KLHC 2VVNA 3W11D 2Z92B 2IAMC 2R2BB 4N9GB 5DYOA 3SCNA 4P2RE 1T21A 1BBJA 3G08B 1W72H 1K4DB 3OG2A 2X4RB 4YK4B 3OHXB 3RVUD 4MPKA 2Z1SA 2FD6L 1ZT1B 4O58H 3KWWB 2E6QA 2ZWYA 3OKMA 4RFNC 1KT2A 1ZK9A 1HNFA 1OIMA 2O9PA 2NPLX 2RR3A 3NN8A 1XR9A 1ZT7A 2BVTA 4ZXBA 4MADA 3SJVA 5BXFA 1RZJC 1D9KA 1RUKL 4P08A 3PWVB 3PWNB 2DDUA 3VWKB 2MQCA 3NJ3A 4H88H 5EZJA 3LQAL 3MCG1 1INEH 2I25N 4NBYB 5A16B 2DI9A 5K9OA 5EU6B 2ATPA 3LQZA 1QPXA 5IGXH 4F66A 2BV9A 1A7BA 1D5BA 3V0VA 4CUCA 5G04L 5EO0A 2ERJC 1H09A 2VN7A 3DETD 1KG0B 4ZFGL 3AJ7A 1YEJH 2VI0A 2IMMA 3KPRD 3HG1A 3PZNA 1T0NB 4E9LA 4PCTA 5IMLB 1KEMH 3MRHB 1I3GL 4RQQA 2XG4A 5TF0A 4H2CA 1EDQA 4A6YB 4U6HB 2BFVL 2J62A 1XR8A 4HS3A 1AH1A 4ORGA 4RWYH 3ORJA 2P4AB 1EV2E 2A77L 4KMQA 4AG4L 4A6OA 5KSAC 1A7QL 2VZUA 3U57A 5DD6A 4Y89A 5HYJE 1BREA 5EC1B 4ESKA 5HY9B 5ERWA 3VXMB 2OYMA 5BRZE 1N6VA 3LVEA 1HYRC 2YL6A 3C7EA 4MVBC 4PBGA 5F7UA 2YSSB 4BZ2L 3F65A 5JQ6L 4LP5A 3MRCA 4LVNB 4UTAL 4XGZB 2GVYA 4YQXL 1T7VA 3DO7B 4G6KL 1JYWA 2WWMC 1M53A 2HN7B 5AUMA 1LO4L 1KBGL 2ID5A 3RTQB 2BGPA 3X3GL 4L3ED 4ZUTB 1GC1C 4FI9A 3WBAA 2V7HB 5FHAH 4CKVX 3MCKA 3B9KD 4YN5A 4Q0XH 4PJDA 3DNKA 3W27A 1V5JA 2VISB 1XF4A 1HJVA 1RIHL 3B4NA 2W63A 1MHHB 3ZL4H 2P46B 2NY0C 1HKIA 1CPUA 2A0LD 4LCIL 4OD2A 2CLRB 5I9QB 1HHHB 3EYFB 4J4PA 4OLWL 2JF7A 2W0LA 3QSKB 3D87B 3OGCA 1CX1A 1DEDA 4C54A 4MNGE 3QIWA 2PO6C 4EUPG 4HHAB 3WQBA 2AV1B 2WZPD 4CVXA 4POYA 5MEPA 2XTLA 3F7VB 1OB1B 2QQIA 1JUFB 5TE6L 4QRSB 1HEZB 3G5ZB 3T0BA 3EYVB 3SIMA 1C5DB 3CSYA 1FFOB 1P4IH 2D4FA 1R24A 2BY1A 3CTTA 2EDLA 4WEUD 3QQ3A 5CHNA 5FHBL 4JFTA 2QHRH 1MCDA 4HBCH 3GSWB 4LHQB 3TO2A 4H8WL 3RDTA 2Q8BL 1CDYA 4G6JH 2DBLH 5CD5C 3ARGD 1LEIA 2BNJA 3VWKD 5CMAA 4BM7A 4MNJA 2W61A 5IM7A 4ZUSA 5FA4A 1AP2B 4PB9H 3BDBA 1SMDA 3R0NA 3GKWL 2J1RA 1KYOK 1H11A 3MRBB 2MCG1 3EMCA 2DQXA 3MLVL 3MROA 3T0AA 2DGAA 1AXSA 2VXTH 4JM2D 5JXJA 2YMXH 2ZSVA 1XNAA 1MRDL 4LCYA 5C2UB 4PBXA 4X7TB 1YNTB 5C1MB 2D2OA 3H8NA 1NFDA 4F7TB 4PMOA 1XH1A 3W9EA 3T65A 1U3HD 4S10A 1UKSA 5DUBA 1JHTB 1MI5B 5CEZH 2O9TA 1A21A 4FQ2L 3GNRA 1I75A 5C7XL 4P7QA 4JDTL 1CFQB 3FO9B 2EDOA 1RY7B 3RY6A 3RHWK 3LMYA 2BNUA 1FNEB 3L3JB 4X4ZA 1QSFD 3RVXD 1MNUL 5I8KH 5LCVL 2GK1B 3LN5B 3G6AB 3IDNA 2DSWA 1IEAB 1GZPB 3O41A 3O4LA 4NGHL 4NHUA 3OXRB 1V6UA 3R1GL 4X7CC 1DBMH 3VFRA 4XNUH 3FN3A 1UYXA 1UD3A 3VXNB 3LMJL 5GRZA 2AJUL 5F9WC 1A7OL 4S2SB 3WEMA 5CJOL 4ODXB 1IT0A 3FO2A 1LD9B 1LO0H 2Y6SD 1DSFL 3U82B 2H32A 5IHZA 4X7EC 5JORA 4WKFA 1B0RA 4U1LA 3UMTA 3MUGB 2NLJA 4KJPD 5A8NA 2H32H 5JPMA 2YRPA 2CK0H 1LE9A 1H2JA 2AGJH 4PJBF 3DJ9A 4MGSA 3KPSB 4WO4D 1CDBA 1GQPA 4QXUL 4OCYL 1LQ0A 3G04B 3KZSA 4IMLA 1YPZE 4A6YL 4L8DA 4ODHH 5GS0L 3LSOA 4PB0L 5IJKC 4WU5B 4ZFOB 4OBRA 2ZEYA 3HPJB 2JB5L 5AAWA 4N0RA 4WV1C 5LAXA 1BGGA 3PL6A 4NQED 4GJTB 1CLZH 3CK0L 1XMWA 2X42A 2V5CA 4NJAH 3GB7B 5JHDE 1IC1A 2H1PH 1PG7L 1URLA 2XIIA 5F21B 3CFEA 5DD5H 1ISWA 5HOSA 3LPFA 1BVNP 1GCYA 4MNQA 3MO1B 4G42A 2CHNA 4UI9L 2R1WB 1GAFL 2X44D 2H8PA 4O9HL 3BP6A 3W0WB 2XZAL 4MD4B 4N0FA 2D7TL 3MREB 3MBEA 5IBLC 3RO8A 4PGBA 5IVOA 4FQCH 3MV9A 1H4PA 4O2EA 3I02B 4OLVL 3WY1A 2WP3O 1J88A 5H2BB 3LD8B 5DJZA 3G6MA 1INQB 1OCWH 2PTVA 1BQLH 3HE6C 4S1SL 3ARUA 1NDMB 5D70L 1H0IA 1ZT4A 1C91A 2IAMD 4OM1H 4PJHE 2AABL 3D9AL 4K23H 2QF8A 5J1SC 3ROOB 4YXLH 4YEFA 2J8GA 1UY2A 5F7NC 4LPTA 2E9MA 1RHFA 1EVUA 2EYSB 1OHQA 3IJHA 1T21B 1J84A 3QDHA 3ECQA 3DVFA 5T3ZL 5CZVL 3K2UL 2VC9A 1E6XM 5IKCA 1HSBA 2WAAA 5A2FA 2HAZA 3BYTA 4R26H 2EKSB 4Q7DA 1IBGL 1U58B 5DTFA 3QEQA 1JI1A 5BO1L 4QHUA 1MIML 2C4FT 4X5LA 3VIFA 3RWHA 3N12A 1P1ZA 1GOMA 1OAKH 1QUNA 4OV5B 4PMYA 4LL9A 2F19L 4X9GA 4M1CC 3F5WA 1LEGA 2XGIA 1LQSR 4Z7UB 4ACYA 4OF7A 1JTTA 4OLYH 3MNWB 4MJ4A 3SDYL 1U3HA 1XPWA 1N5AB 3CFKA 3ETBF 2QSQA 1KACB 3W39A 3VXSD 3TBTA 5T3ZE 1MAKA 4KAQH 3I2KA 4G8IB 2V2TA 1NQ6A 2Y6KA 4CCCA 3WO3B 3RWJB 4DKEH 3LCYA 3KR3L 1NOUA 2DYPB 1E6PA 3L7FB 5ID0A 4Y5VB 2X40A 2HLEA 1M7XA 3RA7L 5EU4A 3SPVB 2DT3A 3GSNH 1CICC 4RMQA 5E9DB 5F71A 3KLHD 4OOZA 1K9EA 3DMMA 3IAGC 1AD9A 1RHHA 2UWEB 4PJIF 4F7CB 1OTSC 2WWKO 1JD7A 1IFHL 4KY1H 3RAJH 3VH8B 4XZUG 3HI5H 4HG4J 4P9MH 3TT1H 3BUYB 2XY1A 4NOBA 5HY9A 3LHPL 1JNHA 1WK0A 1IC5H 2VB5A 4WU7B 4JDVA 4ZPTB 3A7QA 4CU8A 5HHQB 3GHEL 5D9MA 4NKDA 4UZSA 5EU7E 1AGDB 4XAKD 1MWOA 3P9WB 2YL5A 3DO7A 1J05A 5E1AA 4EJ1C 1RZ8A 3CZ8A 1A64A 1KELL 4I5BA 1PQZA 5DD3L 5L2JA 5E8EA 4KDTC 5EA0H 5D4QA 2XN9D 4PJ8D 5KVGL 3QIBC 1UXXX 3QULB 4JFYB 3MRFA 3RGHA 4R0LC 3TPUA 2BGOA 1DEEB 4I4WA 5DRZB 5JIWA 2VISA 2A6JA 1RP8A 3EO9L 4WI2A 1S7TA 5DJXA 3EMZA 3I3DA 1LLOA 1NBVL 4D9QD 3CLFH 3CPUA 5EBMA 4NQEA 3VFSA 3CUIA 3FY1A 3NA4A 1NCCH 4WUUE 4G7YH 2FX7H 4MVBD 4GAGH 1S7QA 4KK8C 4YHEA 6FABH 3MXVL 1DUZA 1NC4D 1VGEH 3TTYA 4YHKH 5ENWA 1WB0A 1WUNT 3TFKD 2Y5TB 3ZE2E 1FP8A 1OGBA 3GSNB 1B88A 5EUOB 2GI7A 2VOTA 2X1XR 5FYKD 5I6XC 2VDRH 4PJ5E 5FM4A 4XPAL 3GXIA 3B3IA 4NRXB 4Z8FH 3HR6A 3TIEA 4PRPA 2CIKA 1AQKH 1A6AB 1UWXK 4KRTA 2FJFA 1LE5B 4A3YA 2NYYD 2EDQA 1YA5A 4BZ1H 2WBJB 4XX6A 5IBUG 4LF3B 5I19H 4AIXA 3QXTA 5BQ7A 2NX5A 1AI1H 3GZAA 4APQA 3G6JB 5F6HI 3E3QE 1SVCP 3A4XA 4FXGA 4L8SA 3MA7A 3IETB 1FRGH 2X7LA 3LIZL 2FGWL 3AQUA 3G08A 3HZKB 3UO1H 4HA4A 5EN2A 4NQVA 4O5LH 4ALAL 4WENB 4LCYB 1B4RA 5GISH 3V6FA 4JFFE 1AJ7L 1G7JA 5LGJB 4P2RD 1IAIM 3I6KA 4GQQA 2GK0A 2MJWA 4ZUUA 2AJZB 2J8UB 2YEZA 2RBLA 2CDEA 3RILA 5EOTA 3QQ4B 4BA0A 5F3BB 5M7QA 3CDZB 3QXAA 1I9JH 2ZOKB 3GK8L 3VWKA 1FFNA 2CR6A 3W6MA 1FZOA 2GJ6A 4LAQL 4PTWA 2HKHL 5ITFA 1CCZA 5C92A 5TQ2L 5DEFB 4G3YH 3LQZB 4UQ3B 5IHUH 4JVUA 4EANA 2DQUL 4QX2A 2EH7L 5BJTB 1NOFA 4YBLB 3V0VB 5I16A 3V4PH 3CC5B 4PMXA 1BFVH 3P6BA 4ZNCD 3RX5A 1MLCA 4XI5C 1W9PA 1BFOB 1DWJM 4CMHB 2YD2A 5AZ2L 3T77B 4D6CA 4YHOL 3TJHD 4C58B 4F15C 2A83B 4NP4L 4X6EB 5BZWB 3IKCA 1LD9A 3FO2B 1W0NA 5L0QC 3BW9B 3FRUB 4LRIC 5B39A 2J7LA 4YHMH 1EZVX 2DAVA 3R0MA 4KJWC 5D6DC 3FTGA 4Z7VA 3V6OE 4L3EB 1AXTL 4X8XA 3SOBH 1QI2A 3IDGA 5FYJD 4RN5A 2W5FA 1UKQA 3WD5L 2G3MA 4W7VA 1ZXQA 3L4TA 5HGGS 3V4VH 3P77A 5CQ1A 2UZIL 4JN1H 2PI6A 2VAAB 1NUNB 2YDSA 2CRIA 5F6IB 3I50L 3VDCA 4KROD 5EULV 4YR6A 3VG0H 4JRYA 5D1QD 1MFDH 4R4BB 4RAVB 1OPGL 1T2JA 4FRWA 5DXWA 1A3RL 1ZL1A 1WWBX 1MCBA 1XGUA 1CGWA 3O2DH 3WF0A 1FH7A 1MFCL 4M7KH 2VERN 3OKKA 5CP7B 2VE6B 1E55A 1N59B 3U5YA 3WLBB 4MMXC 1X5ZA 3BGAA 3MRIB 5J4MA 3VFMB 1VACB 5DQ9A 3BLKA 3QRGH 4OB5H 2AXFA 2NY3C 3FONB 2GYSA 4ETQB 3CH8A 1CLYL 3EOTH 2G60L 1I1AD 4LCCB 4C56B 2GAZA 1ZLUH 4OGXH 1LO5A 5IG7A 2ZE0A 2C3HA 2EPNA 4PMNA 1SY6H 3PGFH 3P4NA 2AV7A 2ZSWB 3WQ5A 5GZND 2APVA 3BMVA 5TPWH 4LPCA 1X7QA 4ZD3L 4NNPH 5I1GL 5LGHH 4NDMA 3IKKA 1YPZB 2BRRH 4L4VB 4E0RB 3OBAA 3HZYB 3QEHA 4UINH 5TDPA 4YC2B 5MP6L 3JV4B 2ITDB 2R0LH 3WUWA 5T3XE 5IF0A 5KBNC 5I5RA 3QWRA 3PV7A 4G9FB 2DDQL 5J8OA 1T2QH 2XT1B 2DH3A 4MCYA 3BXNA 4EEEA 4ELMB 1JFHA 3S36H 2VDQL 1QNRA 1X5FA 4WWKC 3O3BA 5A69A 4U1SA 1UXWA 1IM9D 5C9KA 2DF3A 2JCCE 2BZDA 2F5BL 2VN4A 2RHEA 3GBML 5BS0D 3QUKA 4Z7UE 1JZ2A 1TZ7A 1UR8A 2GEEA 4AM0B 4HF5H 3WV0A 1E6JH 3T0EC 4MX7A 5E00B 4M8UA 1TA3A 3EO0A 2BSSA 5FKPB 3S3SA 5BVPL 1G9NH 3GBLA 2MKWA 2YL9A 4MA3B 1I4FA 1D5MB 1RZKH 4GINA 4UT7L 2V2TB 1YN6B 1I8IB 4HC1A 3WDHA 3BZDA 1A5FL 1OL0A 3W53A 3L7FA 2B8OT 1LK3H 4CCEA 2GITA 1X4XA 2ADIA 2CKBB 2QLYA 3GGWA 3QT2A 1MCPH 1RHHB 5E2WL 4Q9BA 2VZRA 4MGQA 4H41A 5SWZD 2DQDL 1D5ZA 1C16B 4Y4HA 3QHZH 5E2UH 2BHZA 5L88H 4A3HA 3LN5A 2XOMA 2HLFD 5IMKA 4FFVD 4UILL 1ITBB 3ZDYF 1Y0LB 4J3VA 2KKQA 4Y4KD 2NTFA 1FA2A 3WFDH 1JGEA 5DMIH 1JL8A 1IARB 1ZLWH 3WJLC 1MXDA 1V0NA 2XFRA 1FSKB 1VBUA 2GCYB 1XGYH 4AEFA 3H6JA 5IMMB 3U37A 3G9VA 2VLRD 1X5AA 1KC5H 1DQLL 4FXKB 3P4LA 5CXPA 2HFEA 3RPKA 4DCQB 3B9VA 5T3XL 3VDAA 1WDRA 4Z7VE 1A6PA 5FM5M 5C0GB 2WVVB 4C56D 3RU8H 4NN5B 5AC4A 4NRYB 1BD2E 4P5TA 1UG9A 3LSOB 1CQYA 1FP5A 4MJ5B 5L9DL 2JALA 1RAMA 3KGRA 3SKOB 2CIIA 5KSUB 1PZ5A 5F1OB 1I1RA 2WHKA 5E4EB 5T1MB 5HBFA 3P0YL 5DJ0B 4FTVB 4Y16C 3VFNB 3HMXL 5BYWA 3VFPB 4RNRB 1OP5K 3PTMA 1KXVC 1UHVA 4D0CA 3WF1A 2Y5EA 2ZWZA 3WH9A 2NXZB 1YJDL 1YQVL 1OOAA 3W0WA 3QWQB 4P3DB 4HKZB 3HNVH 4ZNEA 1CD9B 2AK1H 5DJCB 4DTGH 1DFBH 5JMRA 2HH0H 2E7BA 4B16A 4FQLL 4L4JA 2Q20A 4U1HA 3KS0H 4QP0A 2ICEB 3P4MA 2NY0B 4K7FA 2WMHA 4YUEL 2IALA 4JFDA 4N1CA 3APGA 5D72L 5E8OB 2FJHB 2BSRA 4X4ME 4URTB 2XIDA 4UT9H 2EJ1A 3KXFB 5DJDA 3CUFA 4ODSH 4Z7OF 3QPQC 4UT9L 3PWNA 2DQGH 1M7IB 3WHE1 2EEAA 4MLIA 1NCUA 5DUML 2E7HA 4U1GB 5EU6A 3SUVA 1TJHH 3U7WL 4HZAA 4TRPH 2HJFB 4G6FD 1YC8A 3DECA 5E1HB 2LQRA 3FT2B 5DT7A 4GFTB 3CX2A 1I1WA 2JD9A 2A1WH 1U58A 3HG1B 1FORH 1X5GA 3U36B 3Q1SL 2PYFA 3TH2T 1UYYA 3ZJ6A 4D9LL 4ZZ5A 1J18A 2J8OA 4HWEH 1C1EH 3NIYA 1FGVL 1CLOL 1JDAA 4LSQH 4NN6C 2ZJSH 1MRFL 1N0LA 3PP4L 3WELA 2EIEA 5DD6B 2Y23A 2Z93B 2E6JA 3D2UA 1DDHB 4XI5D 5CYYA 1IGYB 4OKDA 4RDQG 4MGXA 3ZO9A 5CG0A 2DLFH 3SE4C 1JGDA 3WD4A 4NO0D 1S9XA 1QI4A 5HVWA 3QR3A 5K9QI 3RU8L 1REIA 2JIXA 5B8CC 5F3HA 5E5RB 1SBSH 1GZQB 5EBLB 3S97C 5IB1A 3KWXA 4QLKA 1CQKA 3D69A 2I5YH 3Q48A 3HE7A 2GUOA 2VZPA 2KQNA 3WKZA 3IT8D 4JCMA 2E31A 5DMIL 2AJYL 3GMMB 3WD1A 3PGDB 3IAQA 4OD3H 4L3CA 3E0GA 4XP4H 4AIZB 1ZT1A 1LL7A 4IRJA 2ZCKH 4JJ5A 4PRHA 1RUPL 2WP3T 4C7GA 1NPUA 5GRUH 2V38A 2YPLB 1PMHX 2J12B 2AXGA 1BM3H 4K7PX 4HWBH 4PRHE 4BXSV 3H9ZA 5E2UL 5IOPB 3E6FA 3EYSL 2HKFH 3FQNA 3P9LA 5HYSB 3KPSD 4EQ2A 2Q7YA 3MLTB 1EUTA 1KIRA 1U8PB 2BNRA 4M1DH 5ADPH 5I8CA 5C0AD 3HN3A 1H3UA 2OK0L 1M01A 4W4OC 3RL1B 3ILQC 3OMZA 1JUFA 4UAOC 3GH5A 1RZIB 1FGNL 4X9YA 1JE6A 2MCPH 3UPRB 1UWEH 4HH8A 1TUXA 5KAQF 3P40A 2NY4D 3KDMA 2DMBA 3F8UB 2JK5B 5IVXF 3MV8B 2YUZA 5F97E 2ED8A 4N5EC 1D7PM 2FBOJ 3EDFA 2YKLL 2AQ2A 4MNHA 4MJ6B 4PJGA 5I1KL 1C5CH 1T0NA 2UY7A 3L95B 1VFMA 1T2XA 5F9JB 1UACL 1X4YA 1GH7A 5D7IF 2ZXAA 2C4XA 1W2VA 1WEJH 2UWFA 3TCXA 4FK9A 4GT7A 4NRRA 5CILH 3VFTA 4QTIL 3UCRA 3TYFA 2VDMH 3ZE0E 2APFA 3SDXF 5A6MA 1K4DA 1EBPA 3SE3C 4L4OA 1QSVA 3RDTD 5LA0A 4APQC 1PAMA 2QV4A 3BAWA 1DWIM 3QWRD 4OTXH 4M1GL 5I76B 2R69L 2LABA 3FQUB 1EEUA 1A3HA 4UIKH 4LF3A 1MI5A 4BH8B 3O3BB 1HL8A 2ZCLL 3O6LH 4PP2B 3ARGB 1E56A 3RUGB 5EDXA 5K9KA 4DEVA 3TN0D 3DSFL 4QHKI 3MA7B 4NNPL 1T0PB 5I1GH 2NQCA 1MCWW 1CTOA 4GG6F 1N64H 2YDRA 2IH3A 3KXFE 3LH2H 2VVSA 2ADGB 2H9GA 4HWBA 4PGCA 1EERB 2VX6A 4PJFF 1ZBCA 2VXSL 3VU2A 3EO0B 3P30L 2Z4QB 2CLRA 2YRLA 5EUOE 3TONA 5T1DH 3UJIH 1P7QB 4QOKB 1MCQA 3LOWA 5INCA 5JUVA 1BVKB 4W6XB 1T03H 5E2TH 3EJYD 3KE0A 5ABFA 1TFHA 4Y4FD 3SCVA 2DL2A 3V8CA 2WBWB 3CMOH 1FZOB 4HG4K 4X4YB 1M04A 3UAJC 3BT2L 4ODWB 1QNZL 4UT6L 5EC1A 3VD7A 4ENED 5E99L 1HZHH 4NZCA 5CGYD 3WH7A 3VXPB 1J1OL 1UWIA 5F7KC 5B3NA 2J1UA 4U05A 4FFYL 3INUH 4GMSL 2UZIH 4QGTA 4B9YA 2ZX8A 3IU4H 3LEYL 5HI3C 1MW0A 3WIFA 1GGCH 1US2A 1BZQK 1V3IA 2NY6B 1F6FB 3EOBB 4EN3A 1GPOL 4ZUTA 1GQLA 2R2BA 1CVRA 3MX0A 1I8MA 1OF3A 1TQBB 3WN5A 2DN7A 4JKLA 1GOQA 4M5ZL 3SQOL 1BBJB 2J1KA 4LNRB 2QMKA 3QQ9D 4OZIA 2CDGB 1FL3B 5FYJU 5KAQG 1B6DA 3SDAD 3VGHA 4K3GA 2WC7A 4GAFB 4X83A 5ESQB 3IDMA 2EH7H 2A6KB 1ZLSH 5C2BH 2OR9L 4OUEA 4HUNB 1INQA 1D9KB 4PJ8B 2DEPA 5MEPB 1S9WA 5I6SA 2BP3A 4D0QA 1CGTA 4KMTL 5H94B 3VIKA 4F33B 2WC3A 1ZLSL 4ZTOL 1HCVA 2V3FA 4IRZL 4HBQA 4MA1B 2GJPA 1KG0A 3SO3B 4DEPC 3IJHB 4NWUL 3SGEH 1W2PA 3A47A 2ORBH 1BYBA 3KPQA 4OJFL 4QRRD 1UGNA 5HDLA 2PWHA 5JBEA 4O5LL 1IZKA 1HI6A 3B6SB 3RTQD 7CGTA 1MHCB 1MQKH 3IJSA 4OZFG 4I3GA 4OZFA 2AV7B 2EKSA 4MA7H 4Y19B 1XH2A 3P4MB 4G6AC 1XZ0A 2X4TB 4O2FB 3VXQA 4L0PA 2F15A 4NC1C 4TVDA 1I5PA 2XPKA 4GKZA 4V2BA 5DVNA 3BZFB 3DARA 1GGCL 1U8NA 1X5KA 2P5WE 1WBXA 3WUWG 4P7RA 3TBVA 4RDQF 2FLRT 4NSKA 4P2QD 5C0JB 2P5WA 2Y07L 4S1DD 2ARJA 1R3HA 2LU7A 2BMKA 3WKMH 2BCKB 4ZUWA 3GMOA 1J1OH 1NUFA 2HT4C 5ITBH 2VITB 3MRNA 4B15A 1KCUL 3T04D 1JN6A 4JN2A 5JHDB 1GHFH 5I6XB 2VLRA 4JREC 3DLQR 5CAYB 1QNZH 3MSDA 4HUKB 1AQMA 4DGIL 3WNPA 1R5VA 3FFCA 4XZWA 2P8LA 4UDTB 1EHXA 1JFQH 4TNWF 1UVQA 3BC9A 1MREH 3PGCB 5HHVH 3TYGL 2OSXA 4K55A 2DD8L 2R23A 2AQ1A 4I0PB 1ND0B 4BSWA 4HP5A 3SKMB 1A6TB 3IDNB 4DN4H 3SDAC 4KWUA 4CD6A 4NPYB 1S7VB 1FN4A 5FUZH 2DT1A 5E94A 4NRZA 1BX2B 1XF1A 4WGVB 1MF2H 3QUML 1NBVH 4ZPTA 1KV3A 4HT1L 2J7EA 3VXME 5H2BA 2NT0A 1OD0A 3EO9H 2ARJQ 5IB3A 3IFLL 1MUJB 1X5YA 1EFQA 3DSFH 4AY0A 2WUHA 2JJVA 5T1LB 1QG3A 4J3SA 1BIIA 2ZCLH 1GUVA 4LEXH 4P46B 1NP0A 3O4OB 1QRNE 5CZKA 1CWVA 4B53A 3NFPB 3MRFB 1I7UA 2FWOA 3MPCA 1X5IA 3GHEH 1OT2A 1TZIB 4E41A 1U8KB 4EVNA 4D8MA 4M7LL 2X89A 5A6KA 1VFOA 1IKFH 5LWYH 3MRLA 3BKJL 1IEBA 3K3QA 4PRHB 4D6IA 2B1HL 3SCOA 3VXUA 4ZUSB 4P9ML 3TT1L 1YNKH 5DTFB 3MLUH 3HI5L 2PBOA 1J12A 2FYYA 3HS0A 4HWZB 5CPTA 4PY7A 5GJSL 4KY1L 1WEJL 4X6CB 3KL0A 4M7LH 1OBAA 1UACH 5CJBA 4X5WB 2R1WA 2H6PB 3C8HA 3DX7B 3QG6A 4NCDA 3GNMH 1GJUA 5C0DB 2CBVA 1MCWM 5ICZB 3BP4A 2CO6B 2Y2WA 3CFKB 4F7TA 3QUZC 4K71C 3KPMB 5FF6A 3HI6H 5MEQA 2CIKB 5CJ8A 3REWB 2CIIB 4KK5D 1UQZA 4RMWA 2MCPL 3HRZA 2WINB 2JEPA 1FV1B 1K12A 1T5XA 5I74B 3SDYH 5ID0B 4JY4A 1KB9K 2J1SA 5T1MA 2WBJA 2DT2A 1ACYL 1NAKH 3AY4C 5E6ZA 3HUJF 2C3GA 2NXZD 4WHDA 4APQB 1GC1L 3L3JA 1KXVA 3EYSH 4HGKC 1MF2L 1F11B 3VI3E 3ZT5A 5FUZL 1HOCB 1JNDA 3VFTB 2YC4A 2X5PA 3OXRA 2C3VB 5HBBA 4UU9A 2Q86A 2D31B 3OJVC 5C6TH 1BYAA 2CESA 3EZJB 4WU7A 3WIIL 1QEWA 3K2UH 1MREL 5HHVL 3SCUA 5CZVH 2AJYH 5T3ZH 1KXHA 5IV2B 2W1UA 2NY5C 2QMJA 2VLJA 4UUJB 1P1ZB 4Z9KB 1W1YA 4JPKL 1MLBB 4PP2A 1LE9B 3ZT7A 3MRPB 4OIIL 5B8CB 1F4AA 1SHMA 4G9FD 5FYJH 3K81A 4Y2DC 3BP7B 4UAOB 4XP5L 3GH7A 3CFJB 2ZP0T 4FTVE 5TH2B 1EFXA 1IM3A 3IDXH 2E4TA 1YC7A 3W39B 1B2YA 2H9GB 1OAQH 3LEVH 2WSPA 3SUWA 3KLDA 2D7NA 2XQYG 2XZQL 4D6JA 4KGJA 2DLTA 1FC1A 3BKYH 4HK0B 4MA7L 4M93B 5EWIH 1CLOH 1G6VK 3CFEB 2XZCL 4JFQB 4ZO6A 2DLIA 3LEKA 4UQEA 1MHPL 2W0PA 4D9LH 2IBZY 3FMGL 4F57H 5DD5L 2AJ3B 4I0CC 1DWGM 2J4GA 1CFTA 4NJAL 3AREC 4FFWD 5HDOA 4PJ7B 3QIUA 4IRZH 5JR1H 5D4YA 3F7YB 5D7LA 3SDDA 5MEOB 2XACC 2CKBL 4YGAB 4JQXC 4Z78B 4KMTH 3TESA 4U6XB 1UR9A 2JJTA 4A6YH 4LAJH 3DI2B 2OL3B 3O45A 5ACMA 2B2XH 5DUMH 2XXCB 2KQMA 4ZY9A 1R7AA 1NDMA 4PYGA 3K7UA 2OR9H 4F9DA 1BQUA 1KJ2B 3BDXA 4LRNL 5KN5B 4GMTH 3VA2C 2XKNB 5HI5C 1T04B 3BGFB 3DTXB 3L9RB 5D9NA 5IUSA 4FP8L 3FQXA 4JFDD 4NYLA 3MYJB 5CJOH 5EBGA 5D7JD 5SWQA 2UY4A 3JTTB 4X98B 1QBML 2IH1A 5INDB 3C7FA 5DK2A 3S5LG 4DUXA 5DO8A 1NCWL 3MLZH 4LHUB 3R1GH 1MAJA 3HNVL 2E3VA 2GJ6E 3MFFB 5GGUA 2NY1B 1IAKA 3NGBC 5LCVH 2P42B 3P4NB 4UV4H 2A2QT 1QBAA 2DJSA 3EKCA 3DYMA 4M3KB 5D1QB 1KFWA 2AK4E 4FFYH 1QLRB 4NKIH 4IM4A 4ONGL 1FVEB 1I1AA 2AVGA 3HZYA 5H94A 4GBXB 3AHXA 4MDPA 2CPUA 1S7UB 3WDPP 4Q74A 3CDGB 2WHLA 2X4OB 1T3FB 4N8VA 4ONOA 4TVUA 4RX4A 3BH8A 1LMKA 5F7DA 2YMXL 4OGYH 3ROLA 2BS9A 4YK4C 1IC4H 1M6OB 3N18A 4P3CL 3DMMB 2CBIA 1G6RA 3I6GA 5F7EL 1SR0A 3MV7A 3MNZB 3B2VL 3QHOA 4DVBA 4D1JA 4XPBH 2ATKB 2V7HA 5D1ZD 3QUXA 1G9MC 4IRSD 2FCBA 4PJXF 2VXSH 3QUKB 2YB7A 2NXYD 1H0GA 1WBXB 3HR5B 4Q6IA 4ZO7A 1FIEA 2J88H 3IDIB 3WFDL 4P8XA 43C9B 4WHYG 1ULVA 1SMOA 3IVKB 4PJAE 2EPLX 3SN6N 4ZUWB 3WIHL 2W38A 1YYLL 1HQ4A 1NWRA 1HHHA 3ET9F 4BZYA 4Q2ZA 3OGCB 1VB9A 1YN6A 4DWSB 5IW3A 4M02A 2DCKA 5DQ0A 3W2DH 4YBHA 3DROB 3HE6A 3W82A 4JZ5A 2X4QB 3UTTD 3N15A 5GQBA 1L0PA 4PMQA 4ZNEE 4JO3H 3ZDZF 2Q87A 4MWFA 4LNVA 3IJ7A 4Y8DC 4PJXA 2VQTA 1WT5C 4OGAC 3LQCA 3MRIA 1JGVH 3LB6D 1CD8A 5C0BD 7FABH 4E41E 4JRXA 5IJVA 4NPYA 4PJXE 4KZEL 3T0WA 5J56B 4KHXH 4WF7A 1FH5L 4IDJH 5GGQH 1U8HB 3GMRA 1JGLH 3WUGA 4UFMA 4QHKJ 1EOMA 2C0HA 2A83A 5E2VH 2DQEH 3DHPA 3OKDB 1A3LL 1EDTA 3K4AA 1MUJA 3RWIB 3L4VA 1V6XA 1BOGB 4QYOA 1BPLB 5T1LA 4PMUA 1KBGH 3PWPB 4N5UA 4OGZA 2PYED 1HKMA 4U0RC 7FABL 1WTGT 3C8XA 4XUPA 5TDPB 4S1DC 1NCDL 2DQCH 4QRPA 5JQ6H 2OK0H 2HLFC 5ADPL 2NY4C 2J7HA 3TA3C 4UFIA 1NFDB 4MCYB 2Q3ZA 3VMNA 3W2DL 2R0LL 4NQCD 4X0NA 4TVCA 2XYLA 4UINL 4HWBL 3DV6B 1A7QH 1BM3L 2DTSA 5DJ2B 1CL7H 2D3NA 1FYTD 1YYLH 5HYQB 4X6CE 2IFGA 2CUIA 3OKKB 5DJ0A 4F7MB 5TPWL 3SY0B 1G0XA 4OD3L 4X6CA 5K9OB 3QZWG 4L29A 3V5KA 2J88L 3UAJD 4O00A 4WTZA 1KCSL 1QBBA 2H6PA 3HI1A 4TVPL 4Z2IA 1TVGA 3EFFA 4QRPD 5C0DA 3TA3D 2XRAH 2YIHA 1A2YA 3T08A 5DRWB 2EEBA 2OXHA 3PIQA 3QRGL 3IDMB 4IHOA 5F7EH 2ID4A 2BVYA 4NZJA 5DJ8B 3U2SB 5DRNA 2GFTA 2O26U 3SGDI 4WNQB 4Y4KA 5EIIA 1NKGA 4PJ7F 3NCOA 1KPRB 1JWUA 3QPQD 3RX8A 2GJ6B 5E4EC 1A7PH 2DQHL 3C6LC 3KJ6L 3QO0B 4TUJB 3N85L 1R6VA 3FB6B 2VTFA 1D5ZB 5JA9A 1HKKA 2R15A 4OQ1A 3ZKND 3VG0L 4JY5L 1PGRB 3F2ZA 2FR4B 4P5MA 1MLCB 4YPGA 4AMCA 3TH3T 4NKIL 3ZKXC 2WZEA 4AIUA 4JN1L 1C1EL 3ARBC 5D2LA 3VINA 5FA3B 5D7JB 3WD5H 5A40E 4X6EA 1S5HB 2YD1A 5C0ND 5DMYA 3WKNA 1TFVA 1AXTH 1A8JH 1BJ1H 1ONQB 1OTTD 3DUUA 3O11A 3JWOL 4TTDC 1MAMH 2A1WL 4R2GC 4GPNA 5DT1H 4MNQD 2X2YA 4OZHA 1KPVA 4R2GB 4Z7VB 1P84J 3GMPB 1HXMB 1QBMH 3DX8A 1C5BH 2D7OA 2HISA 4K3DH 3O2DA 2RFXB 3BP6B 4L3AA 1N2RB 4LLWB 4X80L 5I1EL 3QUZD 3ZIZA 3PUHA 2PN5A 3UJTH 2VAAA 3ZE1E 2AKRB 4P46C 2DQGL 2UVEA 3LEXB 4BFBD 3ZM8A 2R2HB 2NW2B 1E4KA 3D1MC 3UP1A 3PDDA 4WTXA 2PYEA 4LRNH 3CMJA 2QPUA 3H9SB 4O2CB 5C0FA 2UVFA 2GITB 2ZX7A 1QVBA 4W89A 4WWKB 1OB1A 3WNLA 3CMGA 3BIKA 2WYSA 4YHNB 2OMNA 5MHSE 1YY8A 5KG9A 1WSST 3AAZA 2F8VA 2W07A 3CZJA 3NAAH 4PRPE 1AJ7H 4JQVA 2EPKX 1VSCA 2EYRA 3HUJA 4HJGB 4IRSB 3T0EB 1QRKA 4NSBA 1MHPH 2Q76B 2XFFA 5IWLC 2XSAA 4ODUA 3UO1L 4PRNB 3OWEA 1EHAA 2E3ZA 2FGWH 4RGMB 3RHWF 3BKYL 1ZWIB 3AM8A 4JRYE 4KKBC 5CZXD 3VGAC 4BFIB 4BQCA 1OGTB 4NHCL 2FJGB 4RGMC 1OGGA 1S7SB 4JQIH 2Y6SC 2VRKA 1CD1B 3OXSB 4X9IA 1J83A 2FGLA 4OCWL 2OP4L 5FM8A 4JO4H 5HYEA 3D3VB 3GRWL 4LCWB 4MJID 3S3PA 1CG9A 1R3JB 3OV6A 4TX8A 3QEUA 1RZJH 1ZGLB 2QQLL 5D9PA 5LBSH 5J1AB 2HTKD 2QQNA 5KSAA 2D3LA 3HG1E 1HL9A 1P4BL 1T1WA 2Z8WC 4JQVC 2F74B 3BWAA 3M07A 3D85D 3TZVD 1JZ4A 4TYUA 1ZA3B 2EC9U 2PCPB 4PJGB 1WP6A 4RRPG 5IROA 1W8OA 4J8RB 2B5IC 1V7MH 4YHKL 4TSBH 5EUKA 5C08B 2R8SL 1V3HA 4V1DA 5D2NB 3ECBA 1LL4A 4UILH 2JE8A 1RZFL 1Z3GH 4HOXA 3O3EA 4KH2A 3TYFB 4H1LG 4HA3A 3VXTA 1FFPA 4JFFB 4ZYKB 5E08L 4K8RC 1JF6A 15C8L 4KKLC 3REVB 3RVUC 2JJUA 2CHOA 5A95A 2CXGA 3PXHA 3O8XA 2APTA 3DIFB 5DLML 3BP5B 3MLXH 5EO1B 1KIPB 4F2MA 4X0KA 3STZB 1OM3H 5KVGH 4XXDA 3W11C 1H49A 5JMOC 5CSGA 1RZKL 3NA9L 4LDOB 4S1RL 5BVPH 5TJWK 5SV3A 2OTPA 2GY7B 1E6JL 1K4CB 2EECA 5EU7C 3M1BB 4D9RD 1KXQE 5BMFH 3D48R 1GHSA 4QB6A 2ICWI 5ANME 5IHSA 2Y72A 4U6YA 1P9MC 3LHPH 1S9YB 3PL6B 2X1OA 5DVKA 3D18B 4FLOA 4KDVA 35C8L 1S7QB 5D2LE 5I1CL 4JVWA 4LMQE 4XP6H 1MJUH 3TA3B 1R64A 2PWFA 3B9DA 1OWWA 4WY7H 4S3KA 5IOPA 1TPXB 4JM2B 2COQA 4LLUA 4UNIA 4GO6B 4PJCB 5ENWB 2I60H 4OZHE 3RWFA 3GSNL 1AD0A 2M8XA 3K4ZA 2BOCB 1OARH 4ODWA 1G94A 3ALPA 2EO7A 4JFZL 4MWFB 2Y36L 3QNZB 4GBXC 3UBXG 1DDHA 1BTCA 3W0KA 3SJVE 2DOCA 3QCVH 2BRRL 4JGJA 1CIDA 4K3JL 2IBGA 3P0VL 2YD7A 2J5LB 4XT1C 2BVPB 3OKEA 3C5ZB 4ZD3H 3HTLX 1FG9C 4LU5H 4QB2A 1FVDA 5HHMB 1SY6L 3Q5OA 4G8GD 4HT1H 3ISWA 3G6JA 3JBG7 4BSJA 3QUMH 2XHYA 1OAKL 1XIWB 2P47B 2QJDA 1BOGA 4QYOB 4MXQC 4R26L 5DDHB 3HNTL 1ADQH 1MPAL 2C1PB 4OZHF 2AJSH 1E0VA 1NFDE 1FH9A 1BD2A 4H5SA 5DQJA 2ICEA 3MRGB 2XTJB 3U9PL 2I07A 1A3RH 4D1IA 3MYZA 5HGDA 1MFDL 4GWIA 1SYSA 1T5WA 3RUGE 3NRUA 2A6DA 3GBNH 5IHBA 1E72M 4HPGA 4M6AA 4D9RE 4K23L 2X1IA 4OJYA 5ITBL 2FRGP 4LKXA 3ARGA 1N3NA 4PTXA 1FH8A 2KPNA 1H5VA 2RIKA 3RUGA 1T04A 1HJUA 4KUCF 3OJMB 1OCWL 4KFZC 3TNNB 4MAVA 5JXEC 4GAJH 5C86A 4Y4HC 1D5XB 3MV01 4GO8A 3SOBL 4OLVH 3WEXB 3K74B 4ELME 2J2ZA 3QNYA 4C57C 5K93A 3MMWA 4YHML 4MNHB 4HD9A 5KVFL 2HG5B 4K7PY 2BY3A 3FRPA 5BOPA 5L8JB 2E9LA 3C6LD 3D0VB 4FQXB 4JRXE 4P48A 5GZNC 4LQFL 2R2CA 1BVLB 2PTUA 4OJFH 4NWUH 3GSXB 3BPOB 3S2CA 4NKOA 4NO3B 4ZTOH 3CZFB 2A73A 2YD5A 4DUWA 1CNVA 2J1EA 1VEOA 5HHQA 5J11B 1A9EB 3KPNB 1JGDB 1KJVA 1RZGA 1S9XB 1DQML 4U49A 3GK8H 4U1JB 4MNGB 4CGTA 2B20A 3ARXA 3DBXA 4YHZL 3BX7C 2YD4A 4P4RA 4HUXA 2AGJL 5EBLA 3MNZA 3TT3H 4Y5VC 1J9CT 3E6HB 5CWSA 1NMCC 2XNAB 3STLB 5FOJA 5E95B 1HJSA 5I1AB 5J9PA 3OQ3B 1QR4A 4OZGF 4GG6A 1LO0L 3WN5B 3HR5A 4EUPA 5F70A 2ADGA 2YA1A 3SQOH 4PJDE 1QSFA 4MS8D 4TTGA 4KKCD 3UTZA 1SM3H 1S7VA 2CDFA 1RI8A 3BWUC 3P3YA 1ECEA 5EFDA 3CZLA 4P4KA 4X6DF 5IG7B 4X99A 1BF8A 3IB4A 3IU4L 2E6PA 3V6BR 4BZ1L 3HHRB 5C0AA 1G1CA 1JGUL 3NFNA 3INUL 1X7QB 5MI0B 1JK8A 3VRJB 5HI4D 1KIUA 4NDMB 2YJQA 1ZVSA 3QDJB 1I9IL 1ROWA 2R1YB 2XQXA 1UKPA 4OCRL 1P6AB 3GJFH 4FMVA 5E99H 1CEOA 2F2HA 4UT6H 1IV8A 5FIEA 4HCRH 1ZS2A 5F88B 3AREA 3O0RH 2AW2A 3CMOL 5CJQH 5CFHA 1IAOA 2CLVB 4H20H 2BDNL 4WFFE 5A6BA 5C0BE 5CCKH 2V6HA 3VMOA 3WXWL 5FO7A 1OAXH 2ZUUA 5DMGD 4Y7MA 5EBWB 4CUAA 3NSNA 3QUMB 3MXVH 4XP9H 1BVZA 1KTLB 1YN7B 4K7PL 1E28B 5IB4A 1VADA 4OZFH 4TQEH 3PWPD 2FX7L 3SGDH 4M7ZB 4PB9L 4TNVF 4NNXB 3AXHA 1I1FA 3GNPA 2Q6WB 3QCTL 1T7XA 3OKOA 4I3RL 3LH2L 4QRUB 3K0WA 4XZUA 5E03A 4G6JL 1BMGA 2OI9B 3H9SE 2Q8BH 5E00A 1H9VA 4RMSA 1HIML 2QHRL 5ICZA 3OAYH 4XHQA 4WEBH 5JW5B 4PRIA 4DK6A 4OZIE 5JXAH 4YXHL 1OGAD 1BG9A 4UIKL 1K8IB 1MCIA 3MV8E 1S78D 2PF6A 2VDKH 4L4VD 4HUMB 1MFBH 1HSAB 3GM8A 3TF7C 4DOHB 4EOWH 2IPKA 3P9MA 3IANA 3F7QA 1DN2A 3MLYL 4U3AA 2CQVA 4LCCC 3BAYA 1C16A 4Y4HB 2V5MA 2W9DH 5AEAA 4HMEA 1LNUA 1B3JA 5CBAA 3JTSA 3U9UA 1CFNA 3ULSB 3ARFB 3PDGA 3VXTB 2D3VA 2DH2A 3NDYA 5GSVB 3O4OC 2VL4A 2IXUA 1HI6B 1CXKA 1E0OB 1HXYA 3B6SA 4M93C 1QI5A 5DA4A 2M26A 2NY6D 4CD4A 3AZRA 1E1FA 1H0DB 1SFSA 1X1NA 4NM8L 4GW1A 2ZOLB 5HVGB 1OIFA 1MI5E 5D1XA 1NKRA 4FQHA 4YE4L 1PBGA 2WC4A 2E9BA 5JUEH 4OLXL 4X0VA 3DXAE 3NPSC 4LSRH 1EDGA 2H3NB 3VWJB 1NSNH 3H9HB 4Y4FC 3IDGB 4PUBL 4RISH 2XY2A 1G7PA 1OP3H 3C08L 3HNYM 4RMUA 3TP4A 3QXDB 4UTAH 4MA1C 4OF5A 4NRYA 1RZ7H 2RB8A 1E4WL 1FZKA 4P5TB 4ATLA 3QFDA 4HAGA 2ZNXA 5L8KB 2KBGA 3D2UD 3C87A 4ZFOL 1N6QH 1E40A 1PG7X 4LOUD 5J57B 4PV8A 1B6UA 2EC8A 2QQMA 5L0QB 1R5VB 3FFCB 5GGVY 1IBGH 4XAWL 3K1DA 3HS0B 2WMGA 5T3ZD 4OZHB 2KZWA 4CU9A 3S35H 5I66B 2WABA 4JM2A 1FAIH 2YN5A 4KI5F 1ZHKB 3TIDB 3QUZB 1ND0A 1KEML 4PGEB 5CSUA 1YY9C 3C5ZD 5EZIL 2AXFB 4R90L 4Y4FA 4E5XB 5ICXA 2DM4A 4YJZL 3AU1B 3V7AE 1JJUA 3KYMB 4RFEB 4XWGH 4NBZB 3KPMA 2R29H 5L2KE 1A47A 1KNOB 4TPRL 5D70H 3N04A 4AEIL 3H3PL 5IB3B 1N4XL 3FQTB 4O51A 3D0LA 2OS7A 1S9WB 3LQAH 2RCSH 3VWKC 1PW3A 3NIFF 1OB0A 5DJYB 3D39B 4K94L 3VI3F 1RUKH 3SGKA 2IQAB 2O93L 5GS1C 4FQCL 1MHEB 2VDNL 5E8PA 3DTXA 2X4PA 3IF1A 1EX0A 1ZLWK 5IF0B 3WUWB 2GJZA 3HPLB 3ULUL 1GZJA 3ZDYE 5DYOB 2WN3A 3RWDA 3HC0B 2BNRD 2W9LA 2ZG3A 3CFIC 4O9HH 2AAVA 4XBGB 4B41A 4KI5E 2WWDA 2WHJA 4XURA 4EVNB 3CKHA 3KPTA 4AMKH 1CXHA 4JANB 3IJSB 5D71L 4OZFB 1JZ3A 3Q1SH 1BAFL 4KRPC 1S9VB 3U0TA 3PZOA 1FORL 1OGTA 1B2WL 3O3DB 3LN4B 4EI6A 4YNYA 1ZT7B 2JB5H 3QAZC 1U95B 5AAMA 2EZ0C 2BERA 3A23A 1U8NB 3F58L 1UD5A 5IFTA 4TRPL 1UA6H 1MCRA 1NP2A 4QWWC 3GUTB 1GGTA 1TJHL 5GPRA 2R0ZL 4PS4H 4PLKD 3WCYA 3EO1B 4Y5XC 2HRLA 1QNPA 1NGXA 5JA8B 3GSUB 4EIZC 2W65B 4DZ8A 1BPVA 1KLUB 1UJ3C 1CIYA 4RSVA 1ZVYA 4X7SH 2FECL 5GGSY 5DR5H 3BH8B 3FOLA 1K85A 4NKQB 4R7NA 3T1FA 1B0GA 4J8RA 5F6HJ 1PSKH 1SJHB 1LP9F 5LQBH 1NANH 2PTTA 3CDYA 2MQ0A 3AS3A 3VXMD 3LMJH 5JW4Q 4LCUB 5CEXA 5JXGA 4P2QA 4DTGL 2BBAA 5EZOL 1KEGH 1GXEA 1J0ZA 3HE7B 1ZLVH 4NGHH 5BRQA 4E8DA 4RFOL 4OAWA 1YJDH 1YQVH 4NC1E 4K2UH 4P00B 4K71B 1ZHBB 3GMQA 3PGDA 4PG9A 5EFFA 1IQWL 2OTWA 5FV1L 4MNMA 1CICB 4QOKE 4X6FB 5SV4A 1OP3K 1UR4A 4BDVB 4OM0H 2DTML 1XYFA 4MLSA 1WV7T 2WW5A 1E6OH 4L4TB 1V8HA 1QOKA 1T7YA 5AUMB 1U8IB 3KS0J 2VIRA 3UXFA 5L9DH 2W1QA 5IVNA 4IS6A 5TD4A 3WSQL 3NIDE 1W3LA 2QEJA 3L7EB 5DVMA 1FYHB 4L9LC 1NJ9B 1L7TH 4PJEB 4IIQB 4QNPE 3U7YH 3MLVH 3D6GA 2F54E 4CD5A 1KXTA 4D8PB 2I27N 2EPOA 1SQ2N 4UTBL 1JHLL 2WMFA 5HHOE 2LS6A 3GMRB 1CLCA 3CD4A 3L1OH 4YXKH 1BZ9A 1MFAH 2OM5A 1TCRA 5HHMD 1RU9L 4HZ7A 5J1XA 4XMPL 1MCOH 3QDGB 2XGBA 3WO4C 1DQJB 5FHBH 1OT1A 1KSRA 5FDWB 4JG1H 2AS5M 3TWCH 1HP5A 4NI3A 4WJ5A 4XC1H 4TVSa 1ORQB 3I9GH 3AIEA 2WIIA 2FIKA 2P8PA 5ABGA 2WSKA 4IPLA 4LSSL 3THML 1UZ6F 4QTHA 3OG4B 2CLVA 4L1HA 3FQUA 3Q6GH 1XH3A 2W91A 3MKKA 1ZE3C 5HDQH 3HAEH 1IGTA 5FGBA 3RWCB 1TDQA 5JNYA 1R0AH 4R96B 1BSIA 4XNQA 3QA3A 3SKJL 4DXRA 3P4OA 1QYGL 1CBGA 2UZXB 4LCIH 4M48L 5K9KB 2NR6C 5C07B 1OD9A 3AOFA 3HNSH 4ONFH 4R6UA 3MO4A 1GVYA 3SY0A 1U6AH 3ZL4L 4N8PA 4HF5L 1GJIA 5DI8A 3GSQB 1K45A 4PGCB 1IGMH 1SY6A 4QHLB 1E6QM 2MKLC 4HQQL 5DK2B 5I73B 2J8UF 3EFFB 3RL2A 3LS5L 4KTEL 4WHYH 5LKNA 3SCWA 2BY0A 3TO4A 3OKMB 1JHJA 3OF6D 4OUOA 1F4WH 2XA3A 4N68A 4XNYL 1MCSA 1IAKB 4WUKL 1JPFA 4HPHA 5GS2D 2CO7B 1UZ6E 1FZJB 3WS6C 2QQKH 3C7HA 2W0FB 5A8MA 1EMTH 1MCJA 3MLRH 3HC3L 4AQ1B 3W81A 5E8DH 5DJ6A 4TUJA 3O6FB 4GQ9L 4NQSA 4Z6AT 5FUCC 3QIBB 4JPWL 1G7LA 3MACH 4CW1A 4PJXB 4JHAL 3VH8G 4F80A 1O5DT 2Z35B 3BN9C 1OLZA 4DGVH 1UD8A 1DANU 1LNUB 4OCLC 3ZDXF 4LPXA 1R3KB 1EEZB 3FN0L 1X9QA 3JWDL 5CBAB 4K8RL 1UYQA 3ARFA 5DMKB 3VFRB 4RWYL 3ROLB 4JFPA 3KG5A 2J8UE 1I3GH 4W86A 4W6YB 4GW1B 1UA7A 3FQRB 1JWMA 4LSDA 1RPKA 1HINL 4H8UA 1P53A 5JOEA 3MUGA 2XWBB 3SDXE 1KPVB 2H3NA 3VWJA 5DK0B 3H9HA 5F7YC 3WH8A 4E42A 2DS4A 2QL1A 3QPXH 4OZIB 3BFOA 5F7HA 3T1WA 1Q6EA 1IZJA 2XA8H 4JJ5B 3QEQE 1U93A 4X8JB 4GLRI 5HYJD 1E6SM 2J74A 3DBXB 5A8PA 1ES0B 3RGVD 1ITXA 3RVTC 3TVMA 1WVZA 3FQNB 3E6HA 4UB0L 3MLWL 3IFOB 1LO2L 3DROA 2IADA 3HE6B 3QDME 2CGRH 1TQCC 3MRQB 5EOCH 5I1JL 4G6FB 3VG9C 3W4RA 5FO8A 4PLJC 4L3EE 4JO2L 2NTSP 3O9WB 3MV8A 4U6VL 2HT3C 1R7OA 7A3HA 3WF2A 4F9LA 1A14L 3MBEB 4JFED 3CUPA 1Q4NX 5IB2A 1WBZA 4D71A 3V5DA 5I15H 1HN1A 3ESUF 3BRFA 3CZUA 3RVTD 5H37H 2ZUVA 4DQOL 1UWTA 4YHOH 3OKDA 1U2HA 5D8JL 5I1HH 2FL5B 5F7LB 4P59L 5EIYB 1JK8B 3CPLB 4XCYA 2DI8A 1LVEA 2MHAA 3EJYC 5DJYA 4MSWB 3GRWA 2E8ZA 3V4PL 4JGMA 5I73C 1GNYA 4PY8I 1VFAA 5M94B 2DQUH 1N7ML 1FFRA 3QWOB 4FF5A 4U33A 2EYSA 3BGMB 1TZGH 5ETUB 4N8VB 2IG2H 4W8BA 5FCSH 2VABB 2OQJB 2WCSA 4CD8A 4JN2B 4XNXH 3WFBH 3TC9A 4HGMA 4ET7A 1UG6A 3VNYA 4KDTA 1XCQA 3MV7B 1UCBL 2LAGB 5IEHA 3U7BA 4L8CB 4CJ1A 4CN4A 1CZSA 1EGJL 1M05B 1IL1B 1EJOL 4JKWA 2J7FA 2IANA 4HIHA 4N0YH 2FNBA 3GMPA 3BSZH 4P0DA 1NLBL 2OYPA 4HUVA 3T3PF 3LKPB 4NO0A 4J23A 1A6TA 3TH4T 4LHJB 2P5EE 3L3KA 4RX4D 3IVKA 5HHPB 3VRIB 5C07E 4OQTL 3OG6B 5M3WA 3P0GB 1YNTA 3WF3A 5BRZB 2GSIA 4ARXA 4FQQA 4L1DA 3JV6B 3OGVA 1RUAL 4R4ND 3HFML 1RYYA 3CHFA 3T3MF 2V17H 4Y19D 3RTQC 5DUBB 5ESVA 1GSMA 1BAGA 4D3CL 1EAJA 3EDJA 3PZGA 2FSEB 3CCHB 1K6QH 1KBKA 3FCTA 3DIFA 4CMMB 4KZDH 1CGVA 4B0MM 4GKNA 1LHZA 4KTDH 3BMWA 3FO9A 1SVZA 5E9DA 3FAXA 4DVRH 4NQDE 5IEKA 1AQKL 5DZOA 4Z8FL 3FB6A 3HC4H 4YX2L 2PQSA 2VDOL 3VFGH 3DVGB 4W8LA 4QX1A 2YC2A 2XTJC 5ISZE 1KGUA 3BUTA 1DN0B 3WQ8A 1A7NH 1BWMA 4DFIA 2V9TA 1TZIA 2QLVB 2ZCHL 1KTKE 4P23B 2HJKA 5I8EA 2CBJA 3TBSB 1O7VA 5IHRA 4ODUB 1WZ1L 2Z8VC 5DRXB 1E0XA 4Y16A 1MJ7L 2X70A 4LYQA 4W84A 1Q94A 1W0WA 3V7MA 5BROA 1J10A 4PD4K 4QDQA 4HWZA 4A3ZA 4CUBA 2OSLB 1H3GA 4LLYA 4XBPA 1A02N 1NC2A 4LLUB 5BV7B 5E24E 2M2DA 3L3OA 5E7BA 2EIBA 2R0WL 3IDYC 2UZYB 1ZHLA 1MWAB 5B4MD 4XH2A 3RVXC 1FO0H 3S9DB 2XOTA 4DOHE 3WMSA 3BP4B 1U8JA 1HHIA 3CGTA 3E3QC 3FZUC 2CUMA 5FF6B 3IGAB 1F4XH 5IJKA 2FX8L 4DAGH 1W0VA 4PY8J 1YEDB 1HILB 5CD3B 4Q9QL 2ZX9A 2VMEA 2H41A 4JY4B 4JFHD 2LAAA 3O8XD 4AD3A 2YPLD 1DUYA 4TOYH 1O8PA 2F53D 5C8JA 2R9HD 3SKNB 4QX3A 1V3JA 3V79C 2ZIDA 1JNNH 5CSZB 3BPCB 4I18C 5T33L 1TITA 3MBEC 3RAJL 3HUJB 3PWPE 2HFGH 3BHBA 1DBAH 2JEQA 4MD5A 1QEWB 3ZKMD 2WVSA 3CVIH 1BD2B 1T4KA 3QHFH 3LRHA 2XONA 1T0MB 32C2B 3GI9L 2EE6A 2B1AL 1SYSB 3RWCA 3QO0A 2APXA 3QA3B 2R2EA 1WCQA 1H5BC 1RVFL 2F54B 5FYLL 3PTKA 1RJZA 4OZGB 3MRPA 4X6BB 4WLCA 1S9KC 2VQUA 3OKLB 2M1KA 1QFWI 4LSUL 3P11H 1J0IA 4X9FA 5A16A 5L7XL 2ARJB 4YHYB 3OGSA 4HFWB 1AGCB 4DK3A 3WQ4A 1OAUL 4XBEL 5I0ZA 1YHTA 3ZHDA 1HQRA 5T33H 2VLRB 1UMHA 2AP2A 4ZUUB 4XVTH 3D18A 1ZA3A 4PR5A 1DWHM 4M6ML 5CIPA 1CGYA 3T2OA 4Y7EA 2P8LB 2WK2A 2A38A 1WNOA 4HPYH 4U6HA 3NIGF 4JO1L 1FIGL 3RWFB 3R4DA 1JYNA 4BCEA 2HMID 3N9GL 3MNWA 5IQ9A 3C60C 1I7RB 4OKVB 5E94B 1FFPB 1W1VA 5FUOL 4KI5M 1TVBA 2FX8H 5HHXH 3VE0B 3CVHB 4R3SB 3ES6B 4OM1L 4N0UA