5CZKA

Structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
603
structure length
600
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-glucuronidase
publication title Structure and Inhibition of Microbiome beta-Glucuronidases Essential to the Alleviation of Cancer Drug Toxicity.
pubmed doi rcsb
source organism Escherichia coli
total genus 193
structure length 600
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czkA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5czkA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5czkA03
4LPCA 1J5OL 1PKQB 4QHLB 2WCAA 1RIHL 3C6SA 1E4KC 1JZ5A 5CJQL 2V72A 4AWEA 1RJYB 3BAJA 3SO5A 1GGIL 4Z8FL 4D9RE 4F7PB 4BQ2A 5CWSB 2FB4L 3DUUA 2I24N 1E27A 2VLRA 4GQ9H 3WUFA 1VPOL 4F8QA 4MAUH 5J89A 3RBSA 4P3WA 1OHQA 4CW1B 1NGYB 5EA0H 4MAVA 2D4DA 5CINL 4WWKD 2VUYA 4TPRL 4CN1A 3DO7B 4PY7B 3VD7A 3HAEA 4XPHH 3VXPA 5JXEC 5JXIA 43CAA 4HPYH 4TUOA 2ZEXA 3SDCC 1ZE3C 3U37A 2X89A 1CE1L 3UTOA 4E41A 1H3VA 3OGOE 4P2YA 1RFDL 2D0FA 3GMOB 1RK0B 3IDMA 5CGYD 4KKCD 3P0VL 4PJIB 4KJQD 3QQ9D 1HJXA 4KFZC 1XH3B 2C7FA 1MFBH 3HS0B 4QRRD 3PJSA 3QEQA 3VDAA 3STBA 5HYQA 4E0RA 4NM4L 4TOQA 1TITA 1VEOA 3WHE1 2OQJA 3D18A 1R3JA 4TQEL 5FO7A 5IVZA 1HVQA 1G7IB 3KNBA 1YY8B 4HGMA 3UNPA 3UR7A 1GC1C 4YHEA 3GBLA 1MWAL 5E5MA 3WUWB 2NXYD 3O9WC 3CFDA 3VIJA 3BPCB 1WISA 3L5WB 4L4VB 3GRWL 2GJRA 3WIHL 1ORSA 3VWKC 4C56D 4UTFA 4OD1H 3S3JA 1EVTC 3BPLC 4YHYB 3SCOA 3B2UC 3VFWB 4DEQA 3EO9L 4S1QH 1T83C 1NBYA 1IEBB 3QDAA 4PTTA 4YHKL 1H8NA 1B6UA 1QSED 3U7BA 2R0ZH 5GGVH 5DJ6A 4WDIB 3THMH 1PZ3A 2ZX5A 1A6UL 3O4LD 2FRGP 4HX1A 3BIAX 2IMNA 3VXRE 4PMVA 2H8PA 3RX7A 3KJ4C 4AIXA 1F58L 1RUAH 1U8OB 1C12A 1KCRL 2EXWC 3GIZH 4H0GA 4NQXB 5ID1A 5L8LB 4GAYA 4RGNB 2FCBA 3PWPB 3BSZL 2OJEB 4IOIA 2G3IA 1XIWA 5KVEL 4NFBA 5FFLA 4WFFD 2YR3A 4PJXA 1N6VA 5KS9A 4X98A 4MDIB 5BZWA 4NDMB 3PDGA 2V38A 3BP5B 3IB3A 3VWJB 4ZMAT 4TSAL 3WL1A 2VXSH 2P43B 1K2DA 4PB9H 1LL6A 3L4TA 1FO0B 4X4XB 1TZIB 1P4LA 3MBEA 1UZ4A 1IQWH 5ANME 4LU5H 3V6OC 1FH8A 3W0WB 5KZCD 1G84A 4JKPH 4MAZA 4U7SA 3RZCD 2NW3B 3V4PL 2FIKA 3BDXA 3DSFL 2AJUH 4UTBL 4UILL 1OSZA 4JN1H 5E00A 1WNOA 2B1AH 3LEVH 2A1WL 2AVGA 2VLJD 3EMCA 1FG9C 2X4UA 4NQSB 1KC5H 3O3EB 2VZQA 4UT9H 2KKQA 3Q5OA 2J88H 5HSFA 1J8HA 3P77B 2FX8H 3OKOB 4X6FA 4HIJA 1NFDA 1DQQA 3QIUC 5D1QA 2VLKD 1W72L 1OM0A 3MV9B 2NMSA 1CLZH 3GSNA 1HXMB 3PZGA 5D5MB 4WTZG 2V5SA 3ECQA 4APQA 5GS0H 2DOCA 4ZZ8A 4A6YA 3JV6A 2NX5B 4XPTH 4EKJA 1HEZA 2C1OB 5GGUB 5B4MD 1NDGB 1OAZH 1RK1A 1CXKA 4P8XA 5A2IH 3B8YA 4S2SA 3FCTB 4YBQC 1FZMA 3PDOB 5E6IB 3E3QC 3TIDA 3TNMB 4R2GC 1MRFL 4GKNB 4R7DA 3CUJA 3CZLA 5L7XL 4P59L 3GSRA 4DN4L 2XG5A 4XH2B 2IBBA 3C8HA 1CK0L 3OJMB 3NTCL 1BAFH 4XVJH 3GSUA 1YMME 4X4YA 3S35H 4WUUA 4PD4J 5DLML 1N26A 2IH3A 3SBWA 5F8RC 2VIRB 5H94B 1OF2B 3GNRA 1RPKA 2FJGA 4YPGA 4PRNB 7FABL 5ITFA 32C2B 4JR9L 1MLBA 3C08H 5L2KE 1GZPB 4P2QB 1UJ3A 1ZXQA 3IF1B 3KYNA 3RA7H 3RTQD 3O8XC 2CRYA 5CP3A 2F61A 4GI9A 4J1UA 2Y24A 3I2GA 1KACB 4OM1L 3VH8A 1MFDL 1CU4L 5IROA 4HOZA 2JJSA 1MPAH 3IGAA 4GIAA 3HI5L 1QLFA 4LKXB 3P4NA 1DQML 4J3TA 5D7JD 2Q6WB 2QQJA 4IUGA 2VXVL 3DHMA 3U0PB 5CMAA 3LEYH 4N1EA 3TTQA 3QFJD 3EUUA 4DQOL 3CC5B 4YHZL 5MENA 1N3NB 3LKQB 3DVFA 2DF3A 3WLBA 3U30C 1HHJA 2X4TA 5ID0B 4MXWL 1KGYA 3TTSA 1QR1A 5D7KD 5DMKA 5EU3B 1DQJB 2GK1B 1JZ6A 2E8YA 3FT3B 2NY1C 2CO6B 5I1AB 4NC1C 3FO9B 4PG2C 4Y19D 2C3VA 5HPMA 2J1UA 2ERJB 5C0FA 1C8PA 5GIRA 5IMKA 3PZIA 2YL9A 2Y5TA 4QHUB 1O7AA 2RVAA 1ZLSL 1QP1A 2O9PA 1I9RL 1S8DB 2HG5A 5EOTB 4CDGC 2IADA 1IMHC 2YSSA 1GQIA 3WQ6A 2YHGA 4UV7L 5I1IH 1KENL 4KQ4L 5I71C 4P8WA 4PRDA 1CENA 2EE9A 5CYYA 1T20B 5JQ6L 1W99A 3BO8A 1B0GB 3GSVB 2Z91A 4EOWL 3QA3A 1WZ1L 3NIGE 4MNMA 4O02L 1LO5B 2JK5A 1I7ZA 1O59A 2VQTA 2Q8AL 2APVA 3QDHA 1GH7A 2UUDK 1R5IA 1ZA6A 1T0MA 4YNYA 1YEGL 5J11B 1F4XL 2XFXA 1MRCH 4KUCD 4Y5YC 4ONOA 5I1LB 25C8L 2YLLA 4CDHA 1YEIH 4GXPA 3F5WB 1OGTA 1OP5K 3AM8A 2VQUA 1EZVX 4NHUA 4D0QA 4DGYL 2NXZD 4MQ7B 2GJZB 3WSQL 4OLUL 4IIQC 4ZXBB 5D1QC 2VZSA 1ZWIB 5HI5C 3NIGF 5DUBA 5JNYA 3HE7C 5FUZH 1GOWA 5BV7L 3TBTB 4FQ2L 4WI2A 1KCUL 3QP3A 15C8H 2HJFB 1LO4L 4WUKL 4ZFZA 1UD2A 5KVGL 2AGJL 5F9JB 4KI5D 5LG1A 4X6BB 4N8CH 3KXFA 4DTGH 5JLZA 4HUUB 2W3JA 2J3SA 3GMNB 2BNQD 2HT2C 3EGSB 2Z93B 2WW5A 4JRWA 4ZNEA 5IB4A 3REVA 2PYEE 5D93C 2ITDA 1A4KA 3QQNA 4TNVK 4X4ME 2W0PA 3PABB 2YD7A 5DC0A 3TA3D 4X7SH 5F6HJ 1E0OB 3BN6A 2HFEA 5C2BH 1J0ZA 5C9KA 1LP9E 3W2DH 4ODVL 4GZEA 3FQUB 1U58A 2AK4B 1ZGLB 1C90A 4R26H 1G9NL 1BWMA 3G04B 4XCFL 2Q8XA 1JK8B 1ZB5A 5JBEA 3U57A 1GC1H 1EBAA 1Z2KA 3CCHA 3DI3B 1IGYA 3KJ6L 3PWUA 4RX4D 4KRPC 2J1SA 1GL4B 3GXUA 2F58L 4G8FB 4RWYL 5TE4L 1CZ8H 2QPSA 1T1XA 3CX5J 2P7TB 3MRHB 4TYUA 4Z78B 4FQLH 3UZEA 4IMKA 4OKVA 4R0LB 3ISWA 5IFTA 5FB8B 4LSRL 2GSIB 3EZJB 3ARGD 3NIDE 4OCSL 5CJOH 5JORB 4OMCA 1JF1A 4L3EB 4UQ3B 3VXSA 4OV5A 3TH4T 3KLHD 1LP9F 1X1NA 1H6XA 2VB5A 4RYDA 3FN0L 3AXIA 4AD3A 1I1FA 2H32A 2HH0L 2QJDA 5TD4A 3X17A 4AYSA 2X1XR 2XTLA 4R4FH 2P5EE 3TYFA 1PKQA 2VL5B 4QHLA 2WN2A 3WEMA 5ICZA 1DLHB 3DMMC 5HDQH 4JQXC 4GG6E 3IANA 3WY1A 3GHEL 4WV1C 2E7BA 1F45A 4JHAL 1RJYA 3A67L 3MNVB 4CRPA 2A6DB 2J1KA 4F7PA 5CWSA 1B3VA 1GJIA 4M24A 1HXJA 3NIDF 4MS8C 1WP6A 2PW2B 4OYUA 4MCYA 1T04B 3THDA 1IGIL 3BGMA 4U3HA 1MY7A 1DEDA 4JJ5B 4CW1A 1NGYA 3EO1B 5DHXB 5G04L 1NCBL 4GW5B 2CKBH 1QI3A 3DO7A 3C8KB 4MNQB 1J0JA 4JQIH 4M4RA 1RIUH 4PY7A 1WCBB 2D20A 5EOCH 3AMKA 1XT5A 1E4WL 2HKFL 5D6DA 4Q9QL 3EAKA 4I0PD 2HTKD 1E6XM 4GG6F 5DJAA 3KPLB 1RK0A 1MAJA 3O6FD 1O7SA 2WVUA 2J6EA 4PJIA 4X9BA 5EZIH 3HS0A 4M93C 4ACZB 1FL6B 4XPFL 4F7EA 4HXAL 2DN7A 2K7QA 1FP8A 2VKXA 2DQCH 1K9FA 1G7IA 3HJRA 1FRGH 5D7LD 1NBVH 4N0CD 5DJXA 1NGPL 4ODWB 3SGKC 3HLAA 4RQQA 3QSKB 1ZT1B 3QAZB 4XCCH 5INDB 4OZFB 4LIQL 1RZJL 2OTPA 3WNNA 5I17B 3BPCA 3SJVD 3AM8C 4L4VA 1HVXA 1CDUA 4JZOB 2NY4D 2AQ1A 4E2OA 2WN3A 4KKBD 3VFWA 4Z95L 5EUKB 4IRJD 2WWKT 1CZ1A 3G08B 5GRVL 5CIPH 4Q58C 1A7OL 3NOIA 3C60C 5CG0A 4YXHL 4HPGA 1MJ8H 1CICB 3HAEH 4PJ8C 4PRPA 2ICWA 2W60B 2MTPA 4F7MB 4HW6A 1CLCA 3RY5A 5J57B 4Y8DC 1OSEA 2UVEA 1R3KB 4W4OC 1EK3A 3A6BL 4NHCH 4NQXA 3X3FH 1EX0A 3BEVB 4PS4L 3N17A 1YC8A 2OJEA 3GMPB 8FABB 5E08H 2GEEA 3U2SB 2ATPB 4ODUB 5DD3L 1TVGA 4DGIL 1P2CB 1I1XA 4XUPA 4MDIA 1FFNB 1PG7L 1GQJA 3STZB 4NDMA 5SWQB 3ARDD 3BP5A 3VWJA 4C83B 5J1TC 1FYTE 4NPYB 4WTZA 2WUBL 1RPQA 2Y07L 4LL9A 3GO1L 4FP8L 1TZIA 5E1AA 3WH6A 1AO7D 2PO6D 1EO8L 4YXLL 5EIYB 3W0WA 1CBVH 2MQCA 2CUMA 1JE6A 3VINA 2NW3A 1QA9B 1Z32X 5C0ND 4LVHB 4UDUB 1AGDB 2IAMD 1E71M 4L1HA 3LQAL 4NQSA 2IC2A 4FFZH 3MUGB 4XMKH 1L0XA 4DGVH 5HYJE 2FX9H 5CS7A 3OKOA 4LLUB 1UUQA 3UC0L 3AXHA 1N0XH 3PWVB 4XAKE 2APWA 3R8BB 3MV9A 3DVGA 1AFVL 3B9VA 3INUL 2EIEA 2V9QA 2IFFL 4XP1H 5LA0A 1HXMA 4KMTL 5DGQA 5D5MA 7A3HA 1PW3A 1OAYH 2VZUA 3V6BR 4M1DL 2G3JA 1KLFA 1J1OH 3KYOB 1R5VB 2NX5A 4P23D 3FB6A 1WZAA 1XH2A 2C1OA 2E4TA 4TVPE 3TVMC 5GGUA 2IPUG 1NDGA 4R4NC 3GSXB 2F5AL 1RUKL 4QYOB 5C0CE 5JMRA 4J3OC 1UYYA 3FCTA 1PY9A 3QUYD 4TN9A 4OB5L 3BKYH 2NY2D 3PDOA 5E6IA 5ESQB 1I8IA 4B0MM 3TNMA 4PJCE 2ZXQA 4X7DC 4ZXOA 4PFEA 3WJLC 3W37A 4PJ7E 4GKNA 1TFHA 2VDNH 4XH2A 4WFED 3I50L 4HK3J 4FN0A 5D6DC 4R97C 1A47A 2Y5EA 4KTDL 3WMCA 4LNVA 5KVMC 2P44B 1BZ9A 4P5TB 2UY2A 1IBGL 1L0QA 4FFYH 5IVXA 2W87A 4QTIH 1E72M 2OJZH 1PKOA 4S0SD 1ZANH 4PRNA 1MYRA 4DEVA 5C3LD 4LLYB 5ANMB 5A6KA 1GZPA 4P2QA 2ZG1A 4EXPX 3IF1A 4PJCF 3SEPA 1DYOA 3FO2B 4ZSOA 1G0YR 3U48A 4JFHE 4PJ7F 5CBEB 4JVPA 2AERT 2V9RA 5EIVA 2CDFB 1VSCA 2AW2A 4KVNL 3NH7L 3ZJ7A 1QKZL 4RFEB 3BQUB 5FGBA 5CJXA 2OLHA 4JRXD 1E73M 4RAVB 2XYCA 4HBCL 4LKXA 2Q6WA 1U8QA 2VM9A 1QRKA 5DMIL 3LEGA 1SJHA 5GGRB 2WZIA 4GAFB 4RDQG 3BOVA 3VI4E 5GGTA 4RGOH 1N3NA 3LKQA 1J05A 5B8CC 3OF6D 2H1PH 3C8DA 1JZ8A 3DV4B 5ID0A 2PTVA 5EU3A 2DQFB 1DQJA 1HHGB 1C16B 4LGRB 4WI4A 2GK1A 3FT3A 1DQLL 3U46A 5I1AA 4HMCA 1WC7B 1NMAL 4LCCC 4RNRB 5BW7C 2B8OT 3GMQB 1FNHA 5CFHA 1UH4A 1WFNA 3FAWA 5B22A 5I8OH 1KB5H 5DFTA 4KROC 4HWNA 3K4ZA 3VIOA 12E8H 1CDHA 1EDQA 4P9ML 3ZT6A 1E6PA 1S8DA 2ZCLH 5EOTA 1XYFA 4XI5C 5D8JL 5C6PB 3VI4F 2XKSA 3IETB 1FH5H 4PP1C 2FBJL 1T20A 4WKAA 1C3FA 4KUZL 5SWSB 1B0GA 3GSVA 5E2WL 5CP3H 3B9KB 4A4AA 1T80A 2R39A 4FTVD 4M43L 1LO5A 4OGZA 5GS3A 1YMMB 5ABGA 1CL7I 1JRHL 1XSKA 5FKPB 2WUCH 5I1LA 1VEMA 4HDIB 1QYGL 4G80A 1CFQB 3DGCR 4ZOCA 1XGUB 3ZTNH 5L2KB 3IJ8A 4JG1H 2JEQA 3F5WA 2EYSB 4KWUA 3RY4A 5E2TL 1MCBA 4M48H 3UYPA 2Z8VC 4FFVC 4MQ7A 5TE6L 5IDIA 4NI3A 4U1MB 2YPVL 3NUKA 4CD6A 4ZXBA 5T3ZH 4Z2IA 2O5ZL 1JHLL 1ZWIA 5HGBA 3WUGA 3MJ9H 1I3GL 4XZWA 3TBTA 4YGAB 5GPRA 4CUAA 2LE9A 4R2GB 4HS8H 2EC9U 2FATH 3LB6C 2ZUWA 5FKAB 3MNWA 3SKJH 2F5BH 3AREB 3ILQC 4DEPC 2ZCKH 1LO0H 4G7YH 4GBXC 4L4TD 4UDTB 5K9JL 5F9JA 4X6BA 2VYRE 1YQVL 1EPFA 1NSNL 4HUUA 4OJFL 2DWEB 1IGFH 2BHUA 3GMNA 4OLZL 5T3XH 1JJUA 3RKPA 3EGSA 2Z93A 5FCUL 2JF1A 3ETPA 5CD5D 1U33A 1MIEL 3OB8A 4NOBA 3T04D 3CU7A 1AGFB 3SE4A 1P6AB 3N11A 3MZTA 4HIXH 4HLZH 5F9AC 4TRPL 3AXXA 3O8XB 1KCSH 4NC2B 1KBKA 3S3SA 3AMGA 5I76B 3FQUA 2AK4A 2QSQA 3TWCH 5A40E 3O4OC 2ICWI 4M1GH 5EU6B 4RMWA 3OAZK 3T0EC 1S9KC 5CZKA 2WIIA 3NCJH 4M6AA 1DUZB 4WJ5B 3WH5A 3Q1SL 3MRHA 2X40A 1LK2B 4KKNA 4W50A 3BKCH 4YC2B 1W0YT 2FEEI 4DK3A 5LWYH 3O6ML 4R0LA 4OFKA 5DD5L 1EFXB 1QSFE 2GSIA 2DYPD 5DGRA 5JORA 5CQ1A 4UQ3A 1YNKL 3BZ4B 5GRZA 5AD0A 1B2WH 3D39E 3CK0H 3LAFA 3RGVD 5H37G 5HHOD 1KB3A 3LOWA 3RVWD 1FORH 4G8GB 5FGBC 5JZ7C 1UB5A 1UQSB 1GU3A 1Q9LA 5JDSB 4AG4L 2ZWLT 2VL5A 1RU9H 1K85A 2UWEF 3QNXB 4HCRA 4MMXC 4NNXB 3MCG1 1RI8A 5EO9B 1NCWL 5JHDA 1UM6L 4M8QB 1I1AC 1SHMA 4PBVC 3MNVA 5I71B 2A6DA 1TVHB 4W7UA 5F89B 2FZ3B 3MFGB 2I9LB 2VX4A 1B88A 1JFXA 1C1EL 3GJFH 3DX9B 1X5ZA 1GHSA 4HMEA 4JJ5A 4Y5VB 2FHFA 2AI0H 1JD7A 3PZVA 4GW5A 4J3XA 3DYPA 4OFYA 4J4PC 1IC5L 1WCBA 1INEL 3EHBD 4XAWL 2PYEB 3N50A 5IXEA 3PIQA 4JPKL 4DXTA 1T22B 3HMWL 1QFUL 4G5ZL 3KPLA 1LP9B 2BY1A 3ROLB 4JY5H 3VRJB 4OQTA 4UNUA 4UOW0 3MCLL 3PP4L 2XM2A 5C0AE 1T0NB 2W62A 2R0KL 1AGBB 4NQCD 2H2PD 4LQRA 4IPLA 2H32H 1AI1H 3E2HB 5LKNA 4HAFA 1UWRA 2OR8A 2OR9H 5EULV 3EB7A 1X5HA 3RKDC 4ODWA 3DETC 1ZT1A 5L0QB 1IEAB 5INDA 3UAJD 1OD0A 4OZFA 3P6BA 4OZOA 1HIMH 4RCAA 5HY9A 1U3YA 3GXIA 2D4FA 5I17A 3GSWB 2BFVL 3OGRA 4Z7UF 1JYWA 3BDYL 5TH2B 4JZOA 4KC3B 3RFZC 3VFUB 3MRRB 5EUKA 2WINB 1CL7H 3WS3B 1V7MH 4PUBL 1MXGA 3KR3L 2PWFA 1MCPH 2P5EB 3Q6FB 4L9LB 4HLJA 3VMPA 3SO3B 3UROR 1CICA 1DN0B 4PGDB 1ZT4A 1Q0YH 4GG6B 2W60A 1M05B 1PLGH 1V3MA 3DVNB 3EDDA 3EYVB 4F7MA 1KEGL 5GHWH 3I2IA 3H3PL 4I0CC 3TPKA 1R3KA 2IPTL 4YDIL 2CRMA 1E5NA 3BEVA 2LTQB 4ZFOL 4HZAA 4KRPB 3GMPA 3LRHA 3ARTA 5D9SA 8FABA 1U2YA 3EYPA 4ODUA 2IBZX 2W38A 1P2CA 2BXYA 2G75B 1FFNA 3VFNB 2R56H 5IW3A 5SWQA 5JHLL 4KRNA 3QOMA 1TR1A 4QGYA 2VX5A 1QW8A 2ZG3A 3S96B 4D9LH 5IGXH 4XBPA 4KK9D 5C09E 4K23L 5M5DA 2FEDD 1MFVA 1G01A 1S5IH 2E27H 4M8UA 5E24E 2DIBA 1V6XA 5ERWB 3WLWD 2Y6SD 3GKZA 4BZ2L 1CX1A 2PXYC 3BIBX 4UDUA 3NA9H 2X42A 1AGDA 3GB7B 1GSMA 4IDJL 5C07E 4HPHA 1AR2A 1GW1A 1EEQA 3MUGA 3BGAA 4AEEA 4NN5B 4ZFFB 1W3HA 4KJWD 4LLUA 4PJHF 1EHLL 3ZHLA 1BBJB 1W1VA 1E4JA 3S97C 4Y8AA 3NNGA 3O9NA 4NQVB 1F02I 1JGVH 4PJ9A 4DW2H 4I13B 2YFUA 2K3TA 3OEBA 1E3ZA 1QLEL 2DPEA 5SV3A 4HT1L 4LASL 2XZAL 1ACYL 3QIBA 5FDYA 4OV6F 4U7MA 5I19H 2DQTL 1JN6A 3GSXA 3P30L 5GRVK 1X9QA 3VXRA 4JPIB 5LQBH 4KZDH 5MP6H 2Z31B 3FFCD 4EN3A 1E55A 4M93B 1AXSA 1KCVL 1OGSA 4WW2C 4TSBL 3SCUA 1B3XA 3UYRH 3WD1A 1IFHH 3FW6A 1LL4A 3DNKA 3V52L 4EDWH 4M29A 1ITCA 3PHQB 4H1LB 4LAJH 4FQXC 3NYDA 4MJID 2VZOA 4POYA 4H8WH 1P7QD 3JTSB 1O5DT 3L5IA 3HNSH 2WWDA 3O11B 3QIWC 2VN4A 5F72S 4P5TA 1MCHA 5C3TA 5CEZD 3PZQA 2TAAA 2HWZL 3ZO0A 4JHBA 1FYTB 4I9WE 1DUYB 1KXHA 4O00A 2CRZA 4P4KD 3L4VA 3V8CA 4LLYA 5ANMA 3VD5A 4XBGB 5C0DB 4DUVA 4XVSH 3DYOA 3FO2A 1JV5B 1O0VA 1OTUC 5CBEA 4HEPG 1KJ2L 2OZ4L 1Q1JL 3KLAB 4XBEH 4U1LB 4Y16B 3ECBB 2V2WB 3QDJE 2XSBA 2WO2A 3BQUA 5D8WA 2DQHL 3N06B 3H7BB 1ZU8A 3VM7A 4NJ9H 4RAVA 3MLRH 3RAJL 4A45A 1I8KB 3MACH 1JD9A 2YDQA 1NCAL 5HYJB 3G6DL 5GGRA 2V2TB 4NQEB 4H1LG 2E7LC 5HYIA 5ESAB 4LVOB 4YDKH 3QPQD 5GS2H 5BVPH 1FZOA 3RVXC 3BH9B 4ATWA 3DV4A 4OFDA 5IEHB 5B4XA 2JFEX 2DQFA 1HHGA 3PV7A 1UWSA 1KB9K 4HHAB 3U83A 4RNRA 2C3WA 3MR9B 5DD0H 3GMQA 5J3HD 1K4CB 2DL9A 4DOHB 1IAIM 4OFIA 1INDL 1F3RB 5F9WB 4GMTL 1HCVA 2DMBA 2GY5A 1HP4A 3IJYA 3ZR6A 3ULUC 4AQOA 4UCFA 4JO2H 4N1CA 1RH9A 4YPJA 1FE8H 1OSPH 1JPTH 4XP9L 1GOIA 4GKLA 1UA3A 4K94C 1BYDA 2CBIA 5J6HB 4PJCB 5I1DB 1VEPA 5I1JL 1OD3A 5IEKA 3RMEA 4PMZA 1AC0A 3C7FA 1G1CA 1G7JB 1A6TB 4X8XA 4H41A 1NDMB 4ZG1A 4PJAE 2BOCB 2VZ1A 3DIFB 3VIIA 3BPOC 4XVTL 3VFVB 1SEQL 3B9KA 4UBDC 4D72A 3NCYP 2AEQH 4OGYH 1DVFB 4QXWA 4UB0H 2LS6A 5HYSB 1YMMA 1UKPA 2MQ0A 2O5YH 1OP3H 3WV0A 2CSPA 4Z2LA 4NGHL 1NUGA 4NP4L 5FKPA 4WFGD 2Y6LA 1GZQB 4JO1L 2BNRE 1EGJA 4ZPVB 4LDOB 1CFQA 1XGUA 5L2KA 1UY4A 5BS0D 3PL6B 3X3GL 4I1NB 4PB0L 4JFTA 5F6IB 4HPOL 5T5FL 1U8MB 3ARXA 5JXJA 1CLYL 1DL7H 3TVMB 2V7HB 2A6IA 3G6LA 3TN0D 1IC1A 4B50A 1TE1A 2BJMH 2IMMA 5BRZB 3EYSL 3TO2B 3JVGA 1KIUA 4NKDB 4WFHD 4XP5H 5A6AA 4LK4A 4PLJD 3PZMA 4XC3H 2A73A 1GUVA 4QCFA 4ZTPL 1FNAA 5D71L 5DK0B 4PJ9C 1TMCB 5F9DC 3KWWB 3AREA 4PRIE 5LCVH 5FDWB 4U3CA 4UDTA 3IKKA 1Q0XH 4PG9B 4NRXA 3BZDA 2DWEA 1U91B 5FOBB 2NY3C 1GJUA 1ZVYA 4XMPH 5A2BA 4PLNC 3I2KA 3BVNA 5C0RH 1XD1A 1JFHA 4Q97A 5DI8B 3D87B 2LW8A 4RFOH 1KGCE 3R06B 3PHSA 3OKLB 3TCXA 5I76A 3VD9A 5TGBB 4LLVA 1TDQA 1DWHM 4RISH 2W0FB 5EU6A 2ZEZA 2CD0A 1QVOB 3DURA 2J78A 3O41B 1QPKA 4MAYA 1DUZA 4WJ5A 2E32A 1OGAD 4BJLA 1LK2A 5JOFB 1QG3A 4NM8H 1H5BB 1DR9A 4DZBB 1X5GA 5B8CB 3C2AH 3P11H 4N0RA 1WIUA 4NKIL 3HG1E 2RCSH 4LSSL 1MW3A 4N8PA 3FOLB 4NBYB 1IM3B 5GSVB 4Z7WF 1NCNA 1MQKH 2O9OA 1CVRA 3ULVE 3K2UH 3DRTB 4LCCB 3FZUD 3BMWA 2C9KA 4AZ7A 1HYSC 4GW4B 1B31A 1UQSA 5EU4B 4HIIB 5B39B 1MH5B 4MZ2A 4NYLB 2WM0A 4JO4L 2Y8KA 5JDSA 5EJ1B 3V0WL 2E7MA 1ZJBA 4U1HA 4NNXA 3EDEA 5MEQB 2OKXA 4MA1B 2R8SH 4ZOEA 5EO9A 5FK9B 4ZZ5A 3QQ4B 4M8QA 4JZJB 4AK1A 2FLRT 2DT2A 1BZQK 1TVHA 1UOKA 2A83B 3QRGH 4OBSA 2FZ3A 2I9LA 4Y4KD 2LAGB 3CLEL 2OL3A 3VFMB 4MQSB 4Y5VA 4NUJA 4Z5RB 5BWFA 3MRIA 2YIHA 4RFNB 2HFFB 3MUHL 3BAKA 1PG7W 1HKLH 1UGNA 5IMLB 1MI5D 4K3JH 2W65B 1SG3A 4PMRA 1CXIA 2Q7YB 2PYEA 3EOTH 4X4MA 5CCKH 4G6JL 2WVVB 3DXAE 4AL8L 3QCUH 2VZPA 1RJCA 2YC4A 1BOYA 3T1WA 2GY7B 3NGBB 4P5MA 1LP9A 2F53E 5FUOL 3MLUH 4XCEB 3VD3A 4MSWB 2ESVE 3SHSA 4CJ1A 1BJMA 4MJ2A 1DLCA 2C0HA 2WC3A 1T0NA 3JTTB 5EBMB 1AGBA 5LBSL 1NCCL 4M7JH 2UWEB 4PMUA 4U3AA 3QUKB 2EXYD 5I1KH 2E7HA 3AY4C 1IEAA 2IBGA 2DDQH 2Z4FA 5BOPA 1UM5L 3EOAB 5I1HH 4S3JA 2DQGH 2NY0D 4WI3A 3D39B 1H0GA 1EJ6A 5TH2A 5GS0D 3IDJB 1TA3B 3U0WH 1UWXK 2V17H 3LH2H 3MRRA 1P84K 3VFUA 4EBQL 5KG9A 3SCRA 5E99H 1G0XA 2WINA 2MCG1 3UBXG 3WS3A 2CKNA 2F15A 3OAUH 2J22A 3MRFB 4KDTA 2GHWB 2P5EA 2XWBB 4MNHA 3Q6FA 1AE6H 2NYYC 2D0GA 1H4PA 4BH7A 4HKBB 3VXMD 4YHMH 1DN0A 4PGDA 1JYXA 4GG6A 3V4UL 2H3NB 3P9LB 1M05A 3EYVA 3DVNA 4HWEL 4P2OA 3MO4A 4ODHH 2BOBA 3RDKA 4W85A 2KQMA 3SKMB 2VXTL 1QI0A 5B38B 2P24B 2UZYB 2OS7A 4HWBA 3DLQR 5I75C 1BF2A 5KBNC 5CJBA 5EZOL 1Q38A 3T0EB 2NY5L 4K7FB 5J12B 1F97A 1RAMA 2R7EB 1LO3H 4Q6IC 1WDPA 3V0VB 5JBDA 2X2YA 3A6CH 4C7FA 1NANI 2DMCA 1JHKL 1U3ZA 4H0HB 2LAAA 4KKLD 4QHMB 1SJXA 3VFNA 5E4EB 3OLEA 4C7DA 1FVEB 3MREB 1TZGL 1FFPA 3OLIA 1YECH 4Z76B 5IVNA 2XOMA 3QUXD 4P02B 4Z7UB 4GMSH 4DWSC 3HNYM 2DTMH 2W47A 4FK9A 3PE9A 3NFSL 1CWVA 5ERWA 3TA9A 4MAYC 4P46D 4Y4FC 3EMQA 1I9IH 1MJUH 4QY8B 5AZ2L 1RUMH 1K6QH 1E4XL 4MJ5A 4KPHH 3RL1B 1A3RH 3ZIZA 5EBWB 4D6FA 1CD9B 1KIQB 1NL0L 3VGDA 2JJWA 3O2DL 2FDMA 1HH6B 1YN7B 4ZFFA 4F9JA 3TO4D 1UA6L 5GRUL 4QOKB 1IAII 1MFCL 2CK2A 1BBJA 3EW3B 4PV8B 3CPUA 3QI9D 1RZGB 1B4JH 1W9DM 3IDXH 4NQVA 3ULUH 3WIIL 1HQ4B 4FFWD 1CGSH 5CUSL 5BMFH 4JO3H 4K94H 4HGWB 2LQRA 4HZ6A 1BGAA 1A7QL 4DVRL 2GDVA 1AQ0A 1BF8A 1JDDA 2AJXL 5SWZE 1GJWA 2GSGB 2BSSB 5HXMA 5ETUA 2Z31A 1GAFL 3I6KA 1R0AL 1EMTH 3L5HA 2V6HA 1OOAA 2DLHA 4JDVA 3NFNB 1KYOK 1P53A 5HHPB 3RDTD 5GJTH 4BQ6A 1UEYA 4QCEA 3PHQA 4OZ4B 3I02B 3QWRD 1GOKA 4H1LA 4F9PA 2VWEE 3C7GA 2WBJD 3UTTE 3TEUA 3PN8A 5ELIA 4ZAKC 4PJHB 1FYTA 2AABL 4XPGH 3T2OA 1FFRA 4OSUL 1OD9A 1DUYA 1K8IA 1XGTB 2GT9B 5E2VL 4WO4B 3MLZH 4YHIB 3I6GB 3V4VL 1D5MA 4XBGA 2EDHA 2CIPA 4ZS7L 2B2XL 3U7VA 3D9AH 1JV5A 3I3EA 1TVNA 4MA3A 5IHSA 5JR2A 5DQ9A 3RM9A 3KLAA 3L6FB 2EPNA 1F3JB 4U1LA 4KDWA 4Y16A 1I1WA 5C07B 3SCMC 3ECBA 2V2WA 3NCEB 5FM5M 3UERA 1U8HB 3AHXA 2J7BA 1OAQH 1UKSA 5C9JB 3LKNB 3LPFA 1I8KA 2BVPA 3U6RA 5HYJA 2JEPA 1MWAB 3TNNB 2V2TA 5JXED 5TDPB 4I3RL 1E6JL 3AS2A 4G6ML 2QKIB 2W9EH 3GXMA 5DEFB 1S7SB 3SDCD 5C8JA 1BFTA 2OYKA 1QQDB 2BZDA 5GJSH 3WD0A 3QJHB 5IEHA 2XZQH 1TNMA 4KDTC 4DZ8B 5J0BA 1UR2A 2VQ1A 4DKEL 3AXLB 3WH7A 3WD4A 3MR9A 1M7XA 3FQWB 3CVHL 4G3YH 2QTEA 4X6CE 4XNXL 5ESVB 3UO1L 4HH8A 3UTSE 4DUXA 2BV9A 1OARL 4P2OC 4X8JB 3BUYA 5C0CA 4X5XB 5IB5B 5EPMB 2ENSA 4TUKL 3SIMA 3VRLE 4OLWH 4GPNA 5J6HA 4PJCA 5I1DA 4U1SB 3C2SA 5ADOH 1WAAE 1MAMH 4PJ7A 2P49B 3QHMA 2FR4A 1G7JA 4R3SB 3O9WD 1HHHA 3K77A 1NDMA 3VKKA 4NN7C 1ES0B 3VWKD 2QQQA 4YBLC 4QRRE 5CPTA 1SYVB 4M5ZL 1DVFA 1BQUA 1NLBH 4JZNB 3CXHK 1UYWL 4PTXA 4X6CF 1MHCB 4HFWB 1T6WA 1ZOXA 4PJGE 5F9OH 2VMDA 2UVFA 3EFDH 1JTOA 1K9DA 4UMGA 2R2HA 4OD2A 4BQ5A 1EIBA 3IS1X 1ZTXL 3G5VB 4ZPVA 4LSQL 5F96H 1NAKL 3VRLF 2JF6A 1YNLL 4K7PL 4U49A 3PL6A 2RHEA 4YFEA 1NANH 2DLFH 1L7TH 3U9UB 1M7DA 1WBZB 1U8MA 1WAAF 2EXWD 5A8PA 5E56A 4C56E 1YEDB 2HT3C 4GXVH 1GOOA 2IF7A 3QDJB 1ND0B 3RZCC 2Z8WC 2ZPKL 3SGJA 1V0NA 3TO2A 4NKDA 1UYXA 1QSEE 1FZJB 3MJ6A 1C5BL 4PJGF 4WW2B 1HNFA 1W72B 5E2UL 2Q76B 3W5MA 1BGGA 4QXUH 5DPNA 5TQ2L 4JX0A 3O6KH 3KWWA 2FD6L 4K9EL 5D7SL 5FDWA 2X1PA 2O93L 4PG9A 1B3YA 5IHZB 1E15A 3QIWB 5FOBA 5I18L 4UZSA 5E0QA 1NC2B 4EZMA 1IAIH 1NJ9B 4FQQB 1T2QH 2L9LA 3CDFA 3G9VA 4A44A 3LN4B 5LGKA 4WI8A 5DI8A 1G9ML 3NCFB 3WFBH 3R06A 3OKLA 1FIGL 5CEZL 1A6PA 5TGBA 4QXGH 1QFWL 2DJSA 3QIUD 1GQPA 4O2CB 3I85A 2W0FA 1NOFA 3LEIA 5HYFA 1HWHB 3O41A 1MCNA 1AH1A 2MQ3A 5TE7H 1R6VA 5IESH 5JOFA 2NLJB 2R1XB 2BC4B 2Z35B 2EYTB 4WCYL 4DZBA 4OQ1A 4A3YA 1VF8A 2FX7H 3C9NB 1VADA 5DURB 2AAVA 3P73A 1YMHB 4WI9A 2BNRB 2D7NA 1IM3A 2FHBA 2VLRD 5GSVA 5KW9L 4HZ7A 4YBQD 3QCVL 2VLKE 4LF3B 3DRTA 5K9OA 1CLOL 3QUZB 4GAGL 5ACZA 3TPUA 4LDLB 1ZHNB 3WKMH 5EU4A 4HIIA 4FMVA 4L8CB 2A77L 1PSKL 4NYLA 4F9LC 5EJZB 4WGWB 2O9RA 4XPAL 1T7WA 1O6IA 1REIA 5MEQA 1CDJA 5F7UA 4WK9A 1IJ9A 3QQ4A 1L9NA 3DGGB 4JZJA 1JZ3A 3OXSB 4POUB 3M07A 3QRFM 2A83A 1VFUA 4S3KA 4PRIB 2YZ1A 4OLYL 3VFMA 3CFIC 1YC7A 2NPLX 5EH1A 5ACMA 3KYMB 1MQ8A 2HFFA 3PGCA 1FP9A 3LN5B 4YR6B 3IKCB 4GUPB 1J11A 5IMLA 2WO1A 1JGEA 3T2QA 5KJRH 5D9NA 3BH8B 2BDNL 1US3A 3BX7C 2ZSVB 2PR4H 4KI1A 2WVVA 3MZGB 4X5WB 2RJMA 3UBXA 4LBEB 1A6ZB 4Z7WB 3IDAA 1WT5A 5E8EA 1UY0A 3B9DA 4XCEA 4MSWA 4JM2C 4OCRL 3JTTA 5EBMA 1IZKA 1TG7A 1N2RB 2W9DH 4Y2DC 5HVHC 1R3IL 2UWEA 1GOGA 4BFEA 2NY1D 3QUKA 1NUDA 1W3JA 1HWGB 4UINH 2GCYB 1JU4A 2HLEA 4PJ5D 1PJ9A 3HG1B 3HUJE 3C5JB 1T7YA 3D39A 2W0LA 3T08A 5IHRA 1TA3A 1B6DA 1XIWD 2MWCA 4GQ9L 4TVDA 4Z2JA 1OIFA 4Y1AE 3UESA 4MAUL 5EA0L 2OL3H 2XY1A 2QBWA 4FABH 4Z7VE 3D85B 5D7KE 3S4SB 5HJ3A 4G9FD 2XWBA 3ZMRA 4EE9A 1T7XA 3P1IA 4XPHL 4HKBA 4HPYL 2D9QB 4L8SB 4Y19E 2H3NA 3P9LA 3ARFB 5BV7B 1W8NA 1ACZA 1MCOH 3CH1B 3W82A 1YA5A 5F88B 4UT7H 3FRPG 3T09A 2YC2A 4YXKH 5T1KD 3HUJF 3GEWB 2P24A 5B38A 4BUGA 3QH3B 4OT1H 4K7FA 1X4YA 1MFBL 3V0VA 2NTSP 4XURA 3ZE1E 1HJWA 1JGDB 4HEME 3UTQB 4NCC1 2XHNA 5EU7E 4Z7VF 1FVEA 3MREA 3IFOB 3UCRA 1J8HD 2IGFH 5F7WC 5D1QD 3DXAB 4Z76A 3BGFB 4HA3A 5IF0B 5A95A 3OL2A 5HI5D 3S4SG 5KSAA 3HE7D 4M8VA 2F53B 2EICA 4UU9B 2ESVB 3QWQB 5C0AA 4MNGE 4OD1L 2DQJH 2PWDA 5AYBA 1ETZB 1WBYB 5E8DH 2O61B 3RL1A 1U95B 4S1QL 3ZE1F 3M8OH 4HG4K 3OKKB 4D8PA 3VRIB 1N6UA 2NCMA 2R0ZL 5GGVL 1ROWA 3RIAF 3QEGH 1LNUB 3THML 1HH6A 4V1DB 1OT5A 2HT2D 1W0WB 1V3HA 1UD6A 4ESKA 4G6AC 4QOKA 1A4JA 4UI2A 2CXGA 4L29B 1RUAL 2EDWA 3GIZL 3FQXB 4PY8I 1RZGA 4IRSB 4LQFH 4NZDA 2X4QB 4LHJB 1T66D 4DN3H 1J86A 2JIEA 4KUCF 5F71A 4BQCA 3ZOAA 1JNLH 4HGWA 4HH9B 3OQ3B 4PMYA 4BZ1H 1VFAB 4KRPD 4KI5E 2JELH 5IK3B 3U1SH 3BUTA 4OD3H 4YJZL 1MFNA 3LPOA 2BNQE 2GSGA 5D1ZB 3WUBA 1PQZB 1T3FB 2VXSL 4Q0XH 4GLRI 3PUHA 4MJ6A 4PB9L 4D94A 1XF5B 1IQWL 3NFNA 4LU5L 2IPKB 4PRAA 4G6FD 5KOVC 4JKPL 5HHPA 5L2JB 2HYMA 3MJGX 4OZ4A 3I02A 4I0KA 4JLRA 3UPAA 5IHUH 4JN1L 2AXFB 2B1AL 3PP3H 3LEVL 3MV8D 2FWOB 2EC8A 1MCJA 3ULSB 3WN5B 2YKLH 4BQ9A 3KWXA 1IVLA 1OH4A 1KC5L 3T65A 3QFDA 4UT9L 4PJHA 4KI5F 3IB4A 2FIRT 2J88L 3KS0H 2YL8A 5C09A 4MA8H 3WEOA 2FX8L 4B9ZA 1XGTA 1BFOA 4EVNB 4WO4A 3DMMD 4HD9A 2Y36H 3SDDC 1C7SA 5D2LE 1CLZL 2E7CA 5F97E 1RMFH 4BZYA 1FC1A 4MS8D 1BJ1H 5T3ZD 4J8RB 4M9PA 2GVYA 4RE3A 1E1EA 1FHDA 1F3JA 1JGIA 5GS0L 4LLWA 3KPMA 3L1OH 5C07A 4XPTL 2PUQT 2J77A 3ZR5A 4HJGB 1CWYA 4YN5A 1U8HA 1UQYA 3WD2A 3C6LA 1B1YA 2XA8H 4JFFE 1MWAA 1OAZL 1SJEB 3O6LL 4JFDB 4OGXH 3TNNA 1P84J 3AS1A 5FEBA 5TDPA 1R87A 1KR0A 1RJZB 4LGPB 4QNPE 2QKIA 5DEFA 1S7SA 5I75B 3ZKMC 1OPGH 1QQDA 2E5EA 2YB7A 3GRWA 1FPTH 4Y7MA 3QJHA 3WIHA 4DKFL 4AZCB 5T3XD 3ZKXB 5D2LF 1U8JA 4DZ8A 3A4AA 2LV4A 3HZVB 4K71C 3VVGA 3AXLA 4AENB 4HQQH 3LMYA 1CE6B 4XZUB 3W4RA 3NQHA 3FQWA 5JW4M 5DHYB 1HNGA 5ESVA 3QHOA 3WBDA 1BAFL 2AJZB 1DBKH 3C5ZC 4XVJL 1FAIH 2YRZA 4X8JA 2E33A 4KKBC 3MLWH 3S35L 2GJ6D 2ZXDA 5IB5A 5EPMA 1DBBH 3AHYA 1KXQE 3FFDA 3VU2A 3W29A 4JJHA 1CLXA 4JCMA 1XNTA 4QNPF 1BIIA 5KVFH 4U1SA 2D3VA 2EH8H 3C08L 5AUMB 5CD3B 4LGSB 3NZHH 4R3SA 4NQDB 5FYJL 4RA3A 4I48B 3RA7L 1R24B 1ES0A 3IJSB 2QBXA 2PYFB 4Y4HB 2CK0H 4PR5A 1HJUA 3CFBB 3BP4B 1JF5A 3WHXB 3B4NA 1SYVA 3DJ9A 3UTTB 2C3HA 4N5ED 1MPAL 4D9QD 3O3UN 4ZO7A 5I73C 3EFFA 4XZUG 3C60D 3TP4A 5DJDA 5D7LE 2AMGA 3G5VA 3LEYL 4PJ8D 4EI6B 1AP2B 5IHLB 1N8ZA 4B7IA 3U9UA 2ADIB 4F7TB 3BW9B 1WBZA 2WAAA 2XVNA 5K93A 4NQED 3UX9B 1A21A 4ZXEA 4Y5XC 3UBXI 2BERA 4PUDA 3BLKA 4OOZA 3ALWA 3PG2A 1YEDA 1E0VA 3CZFB 3VG9C 3QDJA 5IJVA 4DFHA 2IALB 2MANA 3IDNB 4R4BB 3U7WH 5J1SC 4B7LA 4YHLH 4M1RA 1FZJA 1DCLA 3UR8A 4CUBA 4JQVC 1W72A 4GW1B 2IAMC 4RRPA 2Q76A 3VXUE 1U8IA 2HJKB 2JIXA 2KUTA 4A2LA 5I1IL 3T3ME 3L3GB 1NGXB 1KBBA 3SUUA 3IJHB 3KAAA 1M7IA 1TCRB 3HZMB 5T1DH 3RPMA 3RZWA 3QUMA 1ZV5A 1NC2A 2PF6A 2I9TB 2CLRB 3PQYD 3AIQA 3C8XA 1CXLA 1D9KA 1NJ9A 3NCBB 4WWKB 3RWGB 4OZHE 4Z2HA 2WMPA 1MVFA 3LN4A 5FUCC 1AD9B 3DX7B 3VXSD 4QLKA 3AIEA 1MRCL 2N56A 4NSKB 2R2BB 2XQYK 4I4WB 3KPNB 1T1ZB 4XTRC 3LVEA 1PGRB 1YEIL 4ZUWB 2XTJD 3LD8B 4WKHA 1EXPA 4FXKB 4GRLC 1RUQH 4HIEB 4HKZA 1LILA 3CZKA 5JIPA 2E26A 4QRRB 1R7AA 4ZO8A 5KSUB 3GSOB 2R1XA 2QR0B 2VXQH 2VL4A 2Z35A 2EYTA 4GLRH 2OSLA 5L8KB 3C9NA 4PUEA 1F6LL 3GMLB 4OZHF 2R1WB 5FUZL 3ZE0E 1YMHA 2X05A 2BNRA 3AC0A 4R4ND 4ZEPA 5JPMB 4KMLB 1XHGA 5HDLA 5I66B 2DT3A 5FA3B 15C8L 2GITB 4LF3A 2NXYB 4D0CB 5HGHB 1F4WH 2EDJA 1GGTA 3QUZA 1N4XH 5GNZA 1KNOB 3C6LC 1BM3H 3ZJ6A 4L8CA 1I8LA 4C56B 4N8CL 3GBMH 4DTGL 5C0GB 4V28A 4H0IA 3GYCA 2XXMB 3QR3A 1QSEB 3OXSA 2P1YA 3CHCA 2IQAB 4QF1A 4X7SL 3O4LB 5C2BL 3OPZH 1NCDH 2IAND 2N7BA 3P4LA 3D69B 3W2DL 4PRIA 1ZA3B 4NN7B 1US2A 5D96B 3TT1L 2NR6C 4R26L 1AR1C 4NO3B 2ZKHH 3GKWH 1DSFH 1GC1L 3B5TA 3I9GH 3AROA 1YYMH 3LN5A 3CZUA 3IKCA 5E70A 5I2IB 4OZGE 1CZ8L 1OL0A 3PWLA 4WFEE 1HSBA 2UUDH 4HUNB 1P6FA 4FQLL 4AH2B 2ZSVA 5HNNA 4ZUTB 4P99A 4UUJB 4JE4B 1V6WA 4LBEA 1A6ZA 5CJOL 2EH7H 5FOOA 1UHVA 4NQUA 2EIZB 2X1QA 3CXHJ 3B83A 1W9UA 3WFHB 1XPWA 1AHWB 5DMGC 3TCLA 5KZCB 1XF2B 3WO4C 3RZCB 2QMKA 3FRPA 5F8QC 1UCBH 3HC4H 3N9KA 4JY6B 3E1F1 4R4FL 4FI9A 4OZGF 2VLJB 4QRUA 2GCYA 4PRPD 2G3NA 5DT1H 5HDQL 4DKAA 1BX2B 4W84A 3HG1A 4PN2A 4KROD 3C5JA 3BPNC 1C8YA 4HOWA 3WIFB 3ZT7A 5I8KH 4WLCA 4P5KB 4PIRF 2VLKB 1LD9B 4XI5D 2GIYA 1C8QA 2CKBL 1T1WB 3S4SA 1D6VH 5HHVL 1WFOA 4JQIL 1RIUL 4KK8C 4L8SA 3MNZB 5EOCL 3ARFA 3VNZA 4FZ8L 5M03A 2WV3A 3F7PC 3PUIA 3CH1A 3PNWA 2B1HH 4XP6H 5F88A 1MCSA 2ENYA 2DLIA 2H41A 2HVJB 5JTWA 5EBLB 5E0FA 3F6LA 2MSPA 5EZIL 4NN6C 4QRPD 5GRXG 1D9KC 3RPIB 4QTHB 1S7VB 1M71B 5DZLA 3QEUB 2DQCL 4Y89A 3IFOA 1E56A 1UZ0A 4Q9RH 4FFVD 1FRGL 4OI8A 1NBVL 2D2OA 3DXAA 4FTVE 5IF0A 3M45A 2CYGA 3H9SE 4XCCL 2G8ZA 4F3FB 3GZKA 5IG7A 2F53A 3N1QC 5E5UB 1S7XB 1N7MH 3ZDXE 4MO3M 4UU9A 2D9CA 4KRMB 3RY6C 2ESVA 2VLMD 2WVTA 2OMNA 3LB6D 2XY2A 1WBYA 2O61A 1OTTC 4GBXD 3JWDC 3EYOA 4U4BA 2Y7QB 3OJDA 3RTQB 2WKLA 4F79A 4XZBA 2V2XA 3F4VA 1LNUA 1RZKC 2KZ1B 5GS2D 4OBRA 1W0WA 4HJJH 1KELH 1MJ8L 1DN2A 4KJYB 3OB0H 4PJEB 3HUJB 3EDJA 1TXKA 4L29A 5HI3C 1KTDB 4LSUH 4X9GA 2LU7A 3FQXA 4NHCL 5D7JB 3X3FL 3JXSA 4IRSA 3S6CA 3HMXA 2X4QA 1JZ2A 4LHUG 1ZKAA 3QFJB 2E40A 2YD3A 1U42A 3H6JA 3ZDXF 1MW1A 3H9HA 1LLOA 5E08L 3W11C 4D1JA 3GBDA 2RR3A 4L4TE 1KLGB 4Z7VB 3TH3T 2L7JA 3WYRA 4D6DA 5DFVC 1LMKA 4HH9A 1RY7B 1U3HC 3NN8B 3P40A 1VFAA 4LSVH 4OZIE 4MYWB 4XXDB 5BRPA 1QD0A 4Y19B 4ONFH 1UB6A 3QULB 5D1ZA 2P5WD 1PQZA 1DWAM 3UJIH 4GSDH 1UCTA 2VAAB 4XUOA 5ICYB 4MA7H 1W9TA 1C5DB 2R29L 2EJ1A 3S7GA 2YXFA 5JOEA 3L4UA 2IPKA 4X0KA 1CBVL 3TZVA 3FOMB 1XRVA 3L3KB 2DD8H 2AXFA 3D0LB 4YBHA 2FWOA 3ILPA 3ULSA 5CEXA 3WN5A 2WBGA 5JZ7D 2WAOA 2CHNA 3TBSB 4FFZL 2D7TH 4XMKL 4OZIF 1Z6JT 3VDBA 5DSCA 4DGVL 4H26B 2FX9L 4X7FC 4EVNA 4Z0BH 3HNVH 1N0XL 2PCPA 3GJEB 1VBRA 1I1AD 3RNQB 1PX8A 4XP1L 4AD0A 4HZ8A 1HX0A 3IU3A 4MNGB 3LS5H 1OAYL 4J8RA 3AZRA 2H6PB 3G6AA 2WKGA 4M80A 3I3DA 3KPOA 2NZIA 3IDUA 5ACLA 4YDJB 1P4BH 4HJGA 1FSKB 2GI7A 4LHQB 2J7GA 2ZX7A 2NXZB 1MF2H 1SJEA 1WWCA 1I7TB 1ZHLB 5DHVH 3ULVC 2UZXB 1E43A 2YS4A 1UA7A 5IM7B 3BKYL 1GGIH 4NF7A 4YQXH 4ONGH 3F7VB 4AZCA 2WB5A 3PZUA 4YHOH 3M7SA 5C0IB 3HZVA 2Y06H 5A8MA 1CE6A 2VDNL 4XZUA 4MPKA 5JIHA 3DC0A 2AJZA 2P47B 1RHHA 3EZ8A 4OM0H 3LKSB 5GS1B 5SWZA 4KTEH 2BNQB 4FFYL 3H42H 2QSCH 3FQNB 4U6VH 4QTIL 2ZUQC 2OJZL 1S7UB 3QXTA 1DFBH 3THCA 5EO0B 3GM0A 3RKDD 3DETD 1E9LA 1HF6A 1GGBH 1HSAA 1ZANL 3OKMB 4HUWB 4ZFOB 5A2LH 1J1XH 3TA3B 5AUMA 2RV9A 5CD3A 8A3HA 4QLLA 3X13B 1XYZA 1UENA 1X5XA 5KVDH 1TCMA 4I48A 3UZQA 4MX7A 3GUTB 5I2UA 4Y4HA 1MREL 4IJ3C 3CFBA 3PTQA 3WHXA 3NA4A 4EANA 3WNLA 3K46A 1A9BB 3UTTA 1NH6A 3SGEI 3N13A 4D6IA 3RWDB 3VPLA 2NW0A 3W9DB 3AGVA 5TPWH 4NO5A 1H49A 2XIIA 3NCCB 4RGOL 4EI6A 5D2LB 4ZODA 1WGOA 2H1PL 3ARGB 2OLDA 2ADIA 3MBXH 4PP2B 4UIKH 1IE5A 2YUXA 2BMKB 4YDVA 3DARA 3CFEB 3IDNA 4R4BA 1JBJA 2BBAA 2QQLA 1KB5L 5E7BA 4NRZB 2F8QA 4UOQA 4H88H 2Y6SC 3WLWC 1T5WB 3WDPP 1CS6A 3MOQA 1KPVB 3RO8A 4GW1A 3S36H 2CQVA 12E8L 2J1RA 2ZCLL 5GZNC 1CVSC 2HJKA 1NP0A 1FH5L 1MSPA 3L3GA 1VGEH 2XGIA 3HI6H 1ZEAH 1FV1B 2OXHA 3C09B 4QHNB 4P9HC 4PGCB 2V5DA 1XCTB 3PWNB 4X6CA 2Y9RT 2I9TA 2R2EA 4YWGH 1G9HA 2CLRA 2PXYD 1ZS8A 4WWKA 2CIKA 1B3WA 4P3CL 1TQCC 1OQOA 2WIMA 1AD9A 3U9PL 3WNOA 3TZVC 4HG6B 2PI6A 5M3WA 5EFFA 3MGTB 4NSKA 2R2BA 2WUCL 4WU7B 4I0PB 1WAAA 1AGEB 3ZTNL 3KPNA 1T1ZA 4JG1L 2Y1VA 2IWGA 4ZUWA 3O6FB 3WFEH 1NAMH 1FL5B 3EMZA 4M48L 3RWCB 3TTYA 2QSTA 4QRRA 3MMDA 4MGXA 5KSUA 2NNAB 2WQ8A 5T3ZL 3O3BA 5JHDD 4PJGA 3MJ9L 3GMLA 1HHIB 4HKXB 4ZQKA 2R1WA 5DJYB 1QI4A 4QRQB 1HKJA 5D7LB 1BVNP 4HS8L 5JPMA 4W8LA 4CCCA 5I66A 4KVCH 2FATL 1Q9OB 2GITA 3SKJL 1I7RA 1T03H 2DQEH 2GKIA 2ZCKL 4G7YL 3WFLA 1KJ2B 1WWBX 3SJVB 1KNOA 3EDKA 4OFYD 4C56A 2NY4B 4IRZH 5C0GA 5T3XL 1IGFL 1C91A 2EKSA 4PTUB 5FM4A 1QACA 2V3FA 3QUMH 4IRJB 1EEYB 4FQXD 1AJ7H 4ET7A 1QSEA 4F58L 3F8UB 2IQAA 3PWPE 4HIXL 3KEHA 3RWIB 5F93C 5GRYA 3D69A 2CBJA 1KCSL 1ZA3A 4YIQB 4KGJA 4GAJH 2FECI 1OCWH 3TWCL 1HIZA 2XWEA 4NO3A 4GZJA 1MRFH 1M1SA 4M1GL 4XUQA 4FG6C 5I2IA 4L8BB 3NCJL 4R96A 2OSWA 5D8ZA 4TTUA 3BJLA 1YEFH 1U93B 1MAKA 1X7QB 3BKCL 3ARWA 4OZHB 3VIHA 4AH2A 5LWYL 4ZUTA 4A2MA 4UUJA 1I85A 2W9XA 2NT1A 2F2HA 2YN3A 2W0KA 3S5LG 5IV2B 1TZ7A 3ARDB 3JWDH 1IQDB 5CEZE 5J13B 5L6YH 1B2WL 1BBDH 4WY7H 3CK0L 2EIZA 7FABH 4LCUA 5I6SA 2XIDA 4JR9H 1RZKH 3TBYB 3WF4A 2AQ2A 4JREB 1LQ0A 2SEBB 3RVXD 1AHWA 1AO7B 2PO6B 3I3BA 1FORL 5I9QB 1RJLB 3GTNA 3BHBA 5E4IA 2HFTA 1QHOA 2J2ZA 3MRMB 4JY6A 2D31A 3MRJB 3VFOA 1CLVA 4CVWA 2IAMB 4X80H 1BX2A 4LPLA 2YEZA 1TMQA 3ULUD 4JHZA 1IGCH 1NFIA 4PREB 3T1FA 1ZLWK 1BLNB 2GUOA 2NX5E 2VLKA 3MJ7B 1LD9A 5DRXA 1CFSB 1UD8A 4KZEH 2AXGB 5D6CA 1QO3A 2AI0L 1T1WA 4QDQA 3HI1A 1GORA 5A3IC 3P2TA 1H1NA 1YEHL 4QDSA 1OAUH 1UR9A 3MNZA 4UBDD 1Y18B 4OFVA 4P23B 1NMCB 2DI8A 4X5LA 4CVZB 3PV6B 3K2MC 2VE6B 5EBLA 1MVUB 5FAAA 1TZHB 3CGTA 1UH2A 4XXCC 4JGJA 4BSWA 3N0PB 3K3QA 1F4AA 3OJVC 5ALCH 3QUYB 3ACFA 4MQXC 4O51B 2NY2B 4L0PA 1SY6H 5BXFB 3MRCA 3RPIA 4QTHA 1CIYA 1S7VA 1LE9B 3S34H 1M71A 5F7DB 3F5LA 4LPYA 3LSOB 2YD9A 4HFUH 5GRJH 2D23A 1AI1L 4ZD3H 3BZFB 4LHUA 2OR9L 3V7MA 5A16B 5CZVH 3IFLL 4QCIB 1QBMH 4J23A 4F3FA 1HIML 4M5YH 3GNMH 1S7XA 4HJ0C 4KRLB 4KHTH 2PTTA 5DVOA 2NY6C 4PJ9D 5EDXA 4F37K 1DBMH 3DUHA 5BS0E 3RNKB 3ULVH 3HTLX 3RTQA 3QIBD 4URIA 1V7ML 3ORJA 1MCPL 1ZAGA 3BKMH 5MI0B 3BD4A 8CGTA 3VX1A 2NY3D 3VXRD 1W2VA 4K3GA 3IK2A 1Q0YL 1FG2B 3POCA 4KJYA 2X7LB 1VBUA 1PLGL 4EN3D 3HUJA 4JRXB 5GHWL 4YEFA 4W8AA 2H26A 4FQ2H 3VA2C 1KTDA 3HC3H 5D7JA 3FMGH 3U5YA 1BQHB 1VJSA 3QDMD 4MGQA 1P69B 3LDBB 4MD4B 4MLIA 4Y1AA 3S36X 2GTZB 3WBAA 1DTUA 1WJ3A 4J27A 1T21B 3I2FA 3K7UA 4Z7VA 3BKJH 1NGZA 4AG4A 3NN8A 1KUMA 2MKLC 3OR6B 1KXTA 1C5CL 4XXDA 2R56L 4Y19A 5C86A 2WZHA 3L4ZA 1KV3A 4D9LL 3MV11 3R8QA 1NC4D 2VAAA 3RBGA 2GSJA 4JB9H 1C5DA 1S5IL 2E27L 4LPVA 5BO1H 4UFHA 1X5AA 1XD0A 3FOMA 3WO4B 3L3KA 3SDAC 3ZJKA 5DRWB 2CLZA 2JF7A 1D5BB 5EO1B 1NQBA 3NA9L 3CUGA 4IEFB 1G7HB 5EC2B 1AD0A 2KBGA 3KJ6H 4KMQA 2VDQH 2VC2H 1BQHG 4XHJC 1HYSD 1UG6A 3TBSA 3UTZB 3CX5K 4GQPH 2X4NA 1SYTA 4GOSA 1OGAE 4H26A 2PKDA 4FTVB 3ZL4H 3WEXA 2C4XA 3MA9H 4YHPB 5J06A 5CLTA 3RNQA 4UR9A 35C8H 3AFLA 4NZRH 1HINH 4MNGA 2M26A 2H6PA 1JGVL 3HMXH 4DW2L 4U1IB 3SDYH 4C7GA 4LHSA 1KJMB 4V2BA 4YDJA 1F2QA 3LEXA 2K1MA 1B0RB 4R7NB 1NP2A 1G6RH 4PJBE 2HA1A 1CD1B 5I19L 4KI5M 5E9DD 1ZHLA 1I7TA 3DRQA 1A7RH 1NUKA 1I3VA 4P9HH 3ZJ8A 4YLQT 4OFPA 5LQBL 1LEGB 4KZDL 4JHAH 5MP6L 2VRJA 5IM7A 3PUCA 2OX5A 3LKRB 3U36A 1YEEH 4BFIB 3AHTA 2EXYC 3MXVH 1MRDH 1TPXC 3ET9F 3VD4A 5C0IA 2YOCA 4AEFA 3KLDA 3UYRL 3VGAB 1IFHL 4UQBA 4GO6B 3DBXB 4EDWL 5AWNH 1IGJB 4L4TB 1R64A 5JMOC 5I74C 1CI5A 3HNSL 2MNUA 5GS1A 1ZBVA 4PJBF 2BNQA 1MI5E 4D6EA 1I75A 1BD2D 1S7UA 5EO0A 1X6NA 3EJYC 5ECJE 3N9GH 1JTTA 3OKMA 4HUWA 4U0RB 3TA3A 4Z7NE 4ZFOA 3X13A 1U41A 4H7VA 4XVSL 5DQDH 4JFUA 1LGVA 1A1OB 5IMMA 1D6EB 2EO1A 4TNWK 1HKMA 4XBEL 2ICEB 3LZFH 4D0BB 4M56A 5TQ0H 5JW3H 2CDOA 2YD1A 4HS3B 3F12A 4L3EE 4RX4A 4TSCH 3MLRL 1B0WA 3MACL 3W9DA 2E6QA 3K74B 4BKLA 4EUPB 1JG9A 2NYYD 3SOBH 3T77B 1JUFB 3QHTC 1DANU 4YDKL 1XGRB 4KKLC 5EN2B 5D2LA 4NCDA 1V7NH 5BVPL 2DYPB 3ARGA 3LIZH 1GGCH 4I77H 3HC0B 4Z7NF 2XT1B 4XPBH 1X6LA 5DZNA 3RGVB 2BNUA 2JJTA 1UXSB 5HHOB 2BMKA 2VVSA 3MLTB 4HC1H 1XGYL 5DD0L 1GHRA 3WD5H 3CFEA 1T1YA 4HA1A 5K33A 4JFFA 5M17A 1MEXH 1KPVA 4JO2L 4YDLB 1FE8L 4KK5D 1OSPL 1JPTL 1BVKB 3VXME 4JG0H 4MB1A 3NIYA 3W26A 4B15A 1QFPA 1JRHI 5D2NE 1KXVA 1FZKB 4PBWD 3X12B 4MNQE 4XUYA 3W6MA 2A6KB 4DWSD 2ICCA 5DD6B 1FV1A 1CD0A 4QHNA 3MUJA 3PWNA 4MAYD 4Y4FD 4UAPA 2MJWA 1BTCA 3SQBA 2AEQL 4OGYL 4UB0L 5LYRA 1FC2D 2DI9A 2O5YL 4QRTB 1XCQB 1KXQA 4HU0A 3MGTA 2DIEA 3W9EA 4QT5B 3CUPA 4GZ9A 1XR8B 3MRLA 4I0PA 4Z18A 1AGEA 4NZJA 5FYJE 5A2KH 1N6QH 5DC4B 1EAPB 1FL5A 3RWCA 5C71A 1DL7L 2VITB 1K8DB 3TBVB 2J8FA 4NQCB 3WCYA 1W91A 3MRGB 3RDTC 1U8LB 1A7PL 1HHIA 2BJML 4HKXA 5DJYA 2QQLH 4DAGH 2R4SH 4W7WA 4KH2A 4QRQA 4XP5L 5D7LA 4M03A 4XC3L 3NCMA 1Q9OA 2FGZA 2W92A 3MS8A 4PV9A 5LCVL 2HTLC 4YAQA 1KJ2A 4JDZB 2OZ4A 4PLKC 1Q0XL 2OMBA 2C1PB 3IRZA 2BVUA 2XWJB 3S5LA 1NWSA 4ZTOH 1QNRA 2G60H 2QHAA 1DHKA 4XMLH 1Z5LB 3FB7B 1OB0A 4PTUA 1ONQB 3HE6A 1FLTX 3I75B 4IRJA 4XMPL 1TNNA 5IR1B 1Q94A 3Q5TA 4GXUN 5FL0A 5C0RL 3VXUA 1NBZB 1RUKH 3II1A 3QBTB 1WUNT 4ZAKD 3RWIA 3CDGB 2CHOA 4RFOL 4AM0B 5MEOB 4QRSB 3G5YB 1F11B 4YIQA 4PTVA 2YBUA 4Q74A 3WQ4A 4PQQA 1K3ZA 4YGVA 4M6OH 4RISL 4NRRA 2AV7B 2X9WA 3CVHB 4N0YH 3CHFA 3L4YA 4L8BA 2DM4A 1MFAH 3JV4B 3IDGB 4IOFC 4QHKI 2VJXA 4OZHA 4NM8L 3WNMA 1QNPA 3SCMD 3O2WH 3DHPA 3NAAH 3A7QA 3C2AL 3P11L 5IV2A 4GQRA 5FD0A 3ARDA 2RCSL 2A9NH 4KXZH 1JWMB 1L7RA 3TBYA 4QKXB 4LEOA 1MQKL 5H2BA 1UFUA 2SEBA 3K2UL 3O81A 4QPWA 2PO6A 3AYRA 3RI5K 4K8RC 1J0YA 2VLLB 3OBAA 2VX7A 3CMJA 1AQDB 2F54D 3RM4A 1PZ2A 1RZIB 4ARXA 1CN4A 3L9RB 2R8SL 4GQQA 1F3DH 3UTPE 4P2OD 4AD2A 2VCCA 1BFVH 1H0DB 4EI5A 1B3ZA 3DX8A 3QRGL 3GZAA 4PREA 1BLNA 1QNOA 1V8HA 3MJ7A 2XQYG 1Y6KR 1T0PB 5BRQA 4U1GB 4IHOB 4HZLB 1RVFH 1TJIH 1R3LB 5GGQH 2JE8A 4K3JL 3K8LA 2OYMA 1Y18A 1VFFA 4P23A 4XB3A 2G3MA 3EOTL 3PV6A 5CCKL 5HGDB 4ZS6C 2CCRA 3QCUL 2ARJQ 2VE6A 1MVUA 4P2RD 2QV2A 3WUWG 3WF2A 5AY7A 4AIEA 2CLVB 3QUYA 4W8BA 1S3KL 3BC9A 3FFCB 4O51A 2WWCA 1Y0LB 3MLUL 2QLYA 3IU4H 5HVFB 4ODBD 2ARJB 1VFBA 4N5UA 4NO0D 1IT9H 2XIBA 1E6RA 3LSOA 4OZGA 4M7JL 1ZBWA 2QMJA 1JI2A 4I18B 3SCTA 2EZ0C 1BFSA 3BZFA 5A94A 4MXQC 1ZK9A 5I1KL 2HT3D 4MJIB 3TIEB 3SKOB 4QCIA 1P7QB 4NRSA 2XN9D 1VGKB 4CVUA 2X09A 2DDQL 1VACB 2EDEA 2VUOA 5I1HL 5ITBH 2DQGL 5D1XC 3VILA 4PRBB 3G5ZA 2DDUA 1DLFH 1ZBKA 4UV4H 3U0WL 4P4KB 2V17L 3LH2L 2YC1B 3BAYA 3MO1B 4HIHB 4XNYH 5E99L 2WCSA 4O9HH 1H3PH 5L88L 3OAUL 4LP4A 1DWJM 4W87A 4AIOA 1AE6L 5C6TH 3UEZA 5FYJU 2W95A 3D5OF 3SE8H 4YHML 1ZSDB 1FG2A 5MEPA 3GSQB 2CDPA 4KGLA 3VIPA 1JFQH 4JFPB 1ULVA 4L4PA 4ODHL 4F37F 1LEIB 3FT4B 1BQHA 1CFVH 2LFGA 5FUIA 1H41A 1P9MA 4YEEA 3IAQA 4Z6AT 2GTZA 2YA0A 3CXDH 3OF6A 2R69H 1LO3L 1R3HB 1T21A 3EDFA 3HE6C 1FIEA 3A6CL 3GXFA 5CJ5A 1YQVH 3A23A 1BQLH 4OLZH 3OR6A 1MHHB 1SBSH 3V6OE 3IFNH 1FN4B 5EOQH 1KJVB 5IQ9B 1YECL 1JDCA 5C0BD 2DRUA 2YA1A 3T2NH 2EEDA 1CFNA 5A6MA 4U1JB 5DS8B 5SWSE 4GMSL 1CDGA 1PG7X 4U33A 2DTML 1K12A 2ADJA 2CPCA 2J8OA 1A6VH 3NPSC 4NO2A 1MVYA 1I9IL 1MJUL 1FHGA 3D3VD 4O2EB 6TAAA 1RUML 1K6QL 1MLCB 5BVJB 1D5BA 4KPHL 2R4RH 4LKCA 1TLKA 1G7HA 5EC2A 2EDRA 4A41A 1A3RL 5IHBA 4AZHA 2DLEA 2DJ4A 1E1FA 4ATDA 3DV6A 3UTZA 3CPLB 3TF7C 2I5YH 4FTVA 3H9SA 4XAKD 1A2YB 3UP1A 3LY6A 4YHPA 3IFPB 4RL3A 3EO0B 3RJQB 1A3LH 4J6RH 4F33B 3WKNA 1B4JL 1MPXA 3IDXL 1HKIA 3Q6GH 1KBGH 3ULUL 1FLRH 3G6JB 1JPSH 3K8MA 3K80A 5BS0B 1CGSL 1HK6A 1KJMA 2MHAB 3EYFA 1CGWA 1NGQH 4JO3L 5BMFL 4K94L 3A3HA 1CFTB 1U0QA 5C08D 2QQKA 1B0RA 1UT9A 3E3QE 2MMXA 4R7NA 1BLIA 1W9VA 1S46A 4EI5C 5C0CD 3MRKB 4AZBA 3TN0B 1DQTA 4PTWA 1T7VA 3VM5A 1LEGA 1F6FB 2VDKH 1IT0A 2VR5A 1J87A 4M82A 3LKRA 3OGVA 1OD7A 2BNJA 3H0TB 4BFIA 5DRNA 1CTNA 2ZP0T 5JXAH 3GHBH 4ZFGH 1D5XB 3IDIB 5GJTL 3DBXA 3MQIA 2F8XC 5TDNA 4UQAA 1IGJA 1URLA 4L4TA 4JM2D 1QBLH 2DT0A 1L6ZA 3KPSD 4JFQB 3BMVA 2APTA 4OZIA 3SE3A 1XIWC 2R9HC 4Y2DD 3ARBA 3CZEA 5ENWB 4OF3A 2KPNA 2M1KA 1LE5A 4CD8A 4XPGL 3OGSA 3KL5A 5DUPH 3V95A 4GS7B 3IDYB 5CSUA 4XNZB 2ZJSL 3MLZL 1GRWA 4L3CB 1UWUA 5EU6E 1ITBB 1A1NB 4LEXH 5L9DH 4JFHD 1A1OA 3D9AL 1D6EA 1EJOH 2WMJA 2V7NB 1JF6A 5IQ7L 2ICEA 4D0BA 3MBEC 4WHYH 4PEEA 4YK4B 4HS3A 3AB0C 3ZHDA 1U8PB 1FHLA 3MUAA 3VFPA 4LOUC 1OAQL 1KTLB 4EUPA 1OGAB 3PWJB 1C92A 3T77A 4NC1E 2W9EL 4S1DC 1LEKB 3QEHB 1XGRA 1FJ1B 4G8GE 5IJKA 1R85A 1IM9D 2DCKA 2DYPA 4PJ5E 2ZUMA 5GJSL 3W6LA 4ZE4A 4BQ3A 3OR7B 3HC0A 2EDYA 4TNWF 1UXZA 2XZQL 3RGVA 5F7LB 1T2XA 1G7MB 1MY5A 2GTWB 3DO3A 1UXSA 4PMOA 1KPRB 2X0HA 2PBGA 3MLTA 1GQKA 3W25A 5FKYA 4G3YL 5CILH 1QSVA 4PJBB 5HHNB 3O2DA 2ADGB 3P9WB 3HR6A 2VMCA 4ODSH 4APQC 1J88A 4G9FE 4Y7EA 5DK2B 2X70B 2BY0A 1BVKA 4LVNB 3T0DA 4HTYA 3VGBA 5I5RA 2B5IC 4OCLC 4OLWL 1OBAA 3CX2A 4DXRA 4RE4A 1FZKA 2IPTH 1YY9C 5ADOL 2F19H 1MAML 1WEJH 2A6KA 2HLFC 3QISA 4AISA 5DD6A 1MW0A 1KG0A 1CGUA 3N1GC 4Y4KB 2J5LB 4NNPH 5F7KC 5EOCJ 1MQQA 1PZ5B 1AMYA 1WV7T 2QHLA 1NLBL 2GUYA 1LDSA 1T66C 3MLPA 2PN5A 1RD6A 3U4BH 1MUJB 1XCQA 4QRTA 5F9OL 1MI5B 4PJXF 3EFDL 4S0TD 4XWOC 4K8RH 3WJJA 1KIPB 2D3NA 2J8GA 4W5UA 2JKXA 4OF0A 3S3PA 4QT5A 6FABH 4G42A 1KPUB 1XR8A 3OKYA 3HR5B 3MV7D 5F96L 2PQSA 4G6AD 1WITA 5I0ZA 3MRNB 2DLFL 1L7TL 5IWLA 3SBWC 1UY3A 3T0WA 5KSVB 1EAPA 2XFRA 4BZ2H 3EYUH 1K8DA 4F7CA 3OKDB 1XGPB 1UVQB 3TBVA 1UJ3C 5IB1B 4GXVL 5EU5B 3TJHC 2Y25A 3MRGA 4OUEA 1XMWA 5FCSH 1U8LA 2YRLA 3MOBH 2HFGH 3SDXE 2HRPH 1KTRL 4UQEA 3L7EA 4Z2GA 1H9VA 5IROC 2JJSC 4BQ8A 4D3CH 4QXUL 3KHOA 4X7TB 3X11A 5DRZB 1CTOA 2G5RA 3SY0A 4JDZA 2NY0B 2HMIC 1Y6NR 1Z0MA 2W59A 1KR1A 2C1PA 3S9DB 2DJUA 3D5HA 4S10A 3FB7A 1ONQA 3I75A 5IR1A 2WMKA 2J8UE 3VDCA 1IAIL 1QOXA 2L4OA 1IKFH 1T2QL 5GGRY 3ZHKA 5D4QA 1BOGB 3BT2H 1NBZA 3SDXF 3V2AR 3VXMB 3CDGA 3WFBL 1ADQH 5IW6B 5MEOA 5D2NB 1NFKA 3OKEB 1F11A 4TTDC 4QXGL 1NBQA 4AEIH 4TUFA 3S88H 3SDDD 4J3SA 3L3HB 2QV4A 1QBBA 1PY4A 3ARBC 2ITCB 4G8EB 3WKZA 5JW5B 3UYOD 3JV4A 3IDGA 5TE7L 3VFSB 1CXFA 5IESL 1Z0NA 3GMOA 1QSFD 2RB8A 3MV8E 1ECEA 1XEDA 2FX7L 2J8UF 2KZWA 4UZGA 1XH3A 5I8EB 3K1DA 1OP3K 4MD5B 3V5DB 3WS6A 5C0JB 3QUXB 3ZKMD 5T1LD 3ZSTA 1YY8A 1E28B 4RMUA 2VLLA 4P46B 3WKML 1C93A 1IRAY 2YN5A 1AQDA 4LCIH 5T3ZE 1I3RB 4LVEA 1WIPA 3WUWA 3CSPA 5A8QA 1RZIA 4XX6A 5JXGA 4NFDA 2ZUVA 4HWUA 2DKMA 3L5WA 4V27A 2GQHA 3C5ZD 4TVSa 1JPGB 1OWQA 1AIFB 4LARH 4QO1A 3RUGE 1H0DA 5DJCB 3TO4B 3SKJE 2BSED 4N5EC 3KL3A 3RI5F 1IEBA 3MYJB 1PMJX 4PSPA 4AJ0A 5ISZD 4P4RB 1FNSH 4WDIA 5IB2B 3QI9B 3NJVA 3NABH 3RHWF 5T3XE 2XI9A 4ZOBA 4KU1A 4M62L 4NKOB 4N9GB 3TYGH 5EUOB 1W3LA 5KJRL 1U8OA 1TUXA 4G6KH 2YDSA 1MJJB 1OINA 3OHXB 3PWPA 2PR4L 3V6FB 2X4PB 4F2MB 5KSAD 4KAQH 3ZYIA 3SQOH 4OZFG 4Z7QE 2GJ6E 3RUGF 1ISYA 2CLVA 3UG5A 3HOBA 1XF1A 3H3KA 4OIIH 1QFWM 1F6AB 3MJ8B 5C0AD 4QDMA 1HQRB 1Y0LA 2XGBA 3A4WA 2ARJA 4CCEA 2Z92B 4UNIA 3U82B 3R1GH 4GJTB 2Z9TA 2W9DL 3VNYA 3RDTB 1SMOA 1F5WA 4XVTH 4I18A 1SEQH 2J74A 3VXNB 1FO0A 4X4XA 3WE6B 3MUIA 4UINL 4XC1H 3SKOA 1P7QA 2WBJB 3HZKB 4NGHH 4RGMB 2WNGA 1VACA 3LHPL 4XNQB 4IMKC 3DTXB 4Z7QF 3J7HA 5EWIH 2XV6B 3BH4A 1KQYA 1KWGA 4P4KA 2YC1A 3GGLA 1OT2A 3O3EA 3MO1A 4ISVB 3T8XB 3WXWH 4NBXB 1L7IH 1XF3B 5JW4R 2OL3L 1TFVA 4BF7A 3P77A 4FABL 4KY1H 1PIFA 4NQEE 5IW1B 3V0AC 5F1SA 5E03A 2W9LA 4XWGH 2L7UA 2XTJC 1ZSDA 5SX5K 2D7OA 1DWGM 3GSQA 1MCOL 1SYSB 5LGJB 3LPPA 1S7WB 1RUPH 3MOAH 2VZRA 4JFPA 5A2FA 2UY6A 4UT7L 5DTFB 4GG8B 2J1TA 4JY4B 3SCNA 4YXKL 1LEIA 3CMOH 4OT1L 3SDCB 4DOHE 2CDGB 1R3HA 4MHHG 3F58H 4WU5B 3UPCA 2HYXA 1JPST 3L3IB 4GO9A 3CFJB 3WQ5A 4XTRD 5C7XH 2B4CC 2EQDA 3E8UH 3VG0H 1TJGH 3V5KB 4LRNL 1MHHA 4GRLD 5IBLC 1FN4A 2UYLB 3BXWA 2EDDA 1KJVA 5IBTH 1OQXA 1U6AH 4ENEC 2AKRB 2IGFL 3PQYE 4HV8B 2EDXA 3SUVA 4E42B 5DS8A 1UWIA 3BRGC 1OVZA 2F8OA 4O2EA 2P48B 4OIBA 1MLCA 5IVOA 2DQJL 5BVJA 2D0HA 4IPNB 5E8DL 2ID5A 3Q3GB 3O9WB 1D3CA 3ARUA 3M8OL 2VIRA 5H94A 1OF2A 4AY0A 3C6LD 1A0QH 3QQ3B 3CPLA 7TAAA 4JHWH 3VWKB 4UFIA 3U5UA 4ZPTB 3QEGL 32C2A 3BPLB 4JDTH 4JANB 4NBZB 1A2YA 1FAKT 3IFPA 4CAGA 3GSNH 4KRUA 3EO0A 1WO2A 1MCKA 4LQFL 4DN3L 1JP5A 4A6YH 5BS0A 1XFPA 5EZLB 2MHAA 3KJ4B 1CFTA 2NR6D 5BRZE 4QXTB 4LX4A 1AR1D 3VCLB 3U0PA 3NMEA 3N18A 4L5FH 3CBWA 1HI6B 4BZ1L 3CC5A 4YHYC 4TOYH 3U1SL 3FONB 4RZCB 4X6DB 2E31A 1V05A 3MRKA 4OD3L 1SBBA 3TN0A 1IL1B 3HRPA 2E9LA 5CBAB 3NACL 1S7RB 1UY1A 4Q0XL 3FB5B 3H0TA 2VDLH 4WW1B 4R9HA 4WHTB 5A1AA 3AFBA 3FO9A 5IMOB 3CVIH 1I1RA 1D5XA 1ZHKB 2IANE 3IDIA 4RBPK 4EJ1C 2CKBB 2E6JA 4QHUA 5IHUL 4AMKH 2WAGA 2OM5A 4RGNC 1KCKA 4JFQA 4BYHA 2DIAA 5DMGD 5BJTB 4I2XE 1AKJD 2YKLL 3KDMB 2CESA 4M7KH 5ENWA 2DSUA 3LPWA 5TFSH 4I9WD 1NEZB 4P49A 5E2JA 5CHNB 4PMXA 5C0EB 4MA8L 4G6JH 2VDOH 4NT6B 4AL8H 3OZOA 3M1BB 4L3CA 2VXUH 1Q6DA 2Y36L 1A1NA 4IM4A 1X5IA 3VWJC 1RMFL 2V7NA 5JIWA 3QIUB 1WTGT 2XICA 2VC9A 1W2PA 4AZGA 1WZKA 1U8PA 4HBQA 1XAUA 2QQKH 4H8WC 2XA8L 1OGAA 4AZ8A 3CZJA 4OGXL 3C6SB 4KK8D 4DWHA 3AMDA 3QEHA 2DICA 1FJ1A 1J18A 3ZTJH 2JIXD 4X0VA 1OPGL 1FPTL 3FO0H 3OR7A 1DBJH 1HXYB 2GJZA 4ORGB 5A2CA 1E27B 2ZUUA 1ODUA 2VLRB 4NIKB 2GTWA 2XVPA 1KPRA 2IJ0C 1QNQA 2YDRA 4PCTA 5CIPB 2AS5M 5HHNA 4PJBA 1D9KD 1EH9A 3D0VB 1DBKL 2ADGA 1WKYA 4B3KA 3HFMH 2CKSA 1SMDA 1FAIL 3HAEB 2XRAH 5AYUH 2HJFA 3DWTA 3MLWL 4GWIA 4TUOB 5DK2A 1DBBL 5FHAH 4NJAH 2Y6KA 1ZGLM 2WW8A 3QO1B 1NEUA 1NCUA 4ML4A 5KVFL 2BRQA 3MPCA 3MUY1 3AS0A 3HHRB 3IDMB 1MWOA 2BVDA 4HU8A 3NZHL 1UXWB 3RJYA 2J25A 5IT2H 4ZDHB 4Y4KA 5FYKH 5E6IC 1YNTB 2CK0L 4FS0A 3PABA 1PZ5A 1HJQA 4AXNA 1Q9WB 4QRPE 2DH2A 1OTTD 2OQJB 1XF4B 3D18B 1R3JB 1MI5A 5IVZB 1TZGH 4GRWH 1KIPA 1ZGLA 4W88A 1CGVA 2X1OA 3G04A 1JK8A 1KPUA 3HR5A 3ROOB 3MRNA 4G8FA 1G7PB 2J79A 3MROB 2UWEE 5HI3D 1YEJH 3CFDB 4OLVH 5KSVA 2P7TA 4OCXH 4HUVB 4DFIA 4Z78A 3H7LA 1OGBA 1ORSB 3MC0A 4OUOA 4JEGB 1W1YA 3OKDA 2XFYA 1SM3H 2KQNA 5FB8A 1PMHX 1S9XB 3U30B 1CPUA 1NKGA 4L3EA 3W11D 2FH6A 1JIBA 3U7WL 4BFBD 3CZGA 5DFVD 1U3HD 2VSCA 5I6XC 2NY1B 5DJ6B 4YHLL 4F8TA 1UZ8B 2JB6B 2C3GA 4DVBB 3W53A 5CJXC 4PJ5B 2H8PB 5DRZA 3CJJA 1QTYT 1JHTB 4JFXB 1NCTA 4Z77B 1HJVA 3O3DB 1AQHA 3TV3H 1FFOB 1DLHA 1XIWB 5T1DL 1UR4A 3MANA 4XT1C 5T33H 1HCFX 4MNKA 2BX5A 3V8OA 1YPZE 1YHTA 4PJXB 5KS9B 2RFXB 4X98B 2PW2A 4JM4H 5FM5O 2ZSWB 4G9FB 1T04A 5DFWH 1AY1H 1BOGA 5BZWB 1OM3H 4JGMA 3T0EE 2ERJC 3VXMA 4AIZB 3BN9D 3EO1A 5HBBA 5D2NA 2P5WE 4N90D 2WXDM 3OKEA 1V3JA 3C8KA 4MNQA 1XSJA 2VAJA 3MBEB 2XACC 5T1KB 4G8IB 5B4NA 4CCDA 1YN6B 3ESUF 3L3HA 3AB0B 4Y5YB 1RUQL 2ITCA 4JFED 2M2DA 1OSZB 4M3JA 5I0DA 3VFSA 1WZLA 4BUHA 3IVKB 2RJ2A 4Z7UE 2VXQL 1I9EA 2VSDA 2X4UB 1YPZF 3F5KA 3GXDA 1FFQA 1SDDB 3AAZB 4ACZA 1EEUA 1UD3A 3H3BC 1J8HB 5IB3B 4MD5A 3V5DA 1FL6A 4IIQB 1DJSA 4K3DH 5IVXF 5D1QB 1NFDB 1DQQB 3ULVD 3QUXA 1NM9A 4L9DA 4LCWD 2BRRH 3HE7B 1F4WL 5J11C 4JN2B 1N4XL 5I1GH 1E28A 1BM3L 3GDBA 4P46A 5J8OA 4AIUA 1JNNH 2XKNB 3GBML 4KKAC 5JDJA 2X1IA 3JV6B 4QOKE 4JPWH 3HZYB 2W66A 2ZUYA 5DXWA 1QOKA 1KEMH 3SDXB 2EIDA 1JPGA 2ICWJ 4JPVH 3WQWA 1AIFA 2DGAA 3L95B 5J7CC 4HUKB 4ZXBC 2BVYA 2D7MA 3FNDA 2B4CH 3OG2A 5KEZA 3P9MB 3CUHA 1Z3GH 2VDPH 3OPZL 1NCDL 4S2SB