5CZKA

Structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
603
structure length
600
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Inhibition of Microbiome beta-Glucuronidases Essential to the Alleviation of Cancer Drug Toxicity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-glucuronidase
total genus 193
structure length 600
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czkA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5czkA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5czkA03
3HE7A 4L8CB 2ADGA 5GRWA 1KEXA 3REVA 1W72B 3APGA 3MQIA 5DK3A 5F88A 4OD1L 3OLEA 4PJBF 3IFPB 3II1A 1CICC 3DRTA 4GBXA 3MUAA 4Y4HC 3X13A 5ISZD 1BOGA 4PJBA 4TSAL 4XGZB 4M5ZL 4UQAA 2WXDM 3ZR6A 3PV7A 4BK5A 1SJEB 4KJPD 4OJFL 4U1NB 3LEXB 4NN6B 3CFIC 3QFJE 4O00A 4KZDH 2VLJA 4Z5RA 4J1UB 1IGMH 5FKYA 3MFFB 4DAGH 5SWSA 2CLVA 3GRWA 2G2RA 5CZVH 4IRZH 4HK3J 1N4XL 4KDTA 2VLRE 4X98A 1FG9C 3IKKA 3S5LB 1MIMH 5JBEA 3VXOB 2W0KA 1NBVL 4L4TA 1DQLH 4NQSA 1UD2A 2VAAA 3TYFA 1Z0MA 5DT1L 4LARL 2YG0A 2UZXB 4IMKA 4YFLI 2AAAA 4MD5B 4MD0B 3WDHA 5H35B 4JFUA 3S4SA 4WFGE 1NLDL 3V0VB 4PGBA 4PTTA 4HUMB 3MV8D 1A7PH 5J13C 1UCTA 3WBEA 4OBSA 4YXKL 1HYSC 4HUUA 3MOQA 2WKGA 3UEZA 5B4NA 4U3HA 4RDQF 5EORH 4M4RA 3U79A 4WTZA 2WUCH 1AGEB 4JANB 2PW1A 4XNXH 5B4MC 4X7SL 4U5KA 1T0MB 5FGCB 4F2MB 2XIIA 1IGJB 1WSST 1PW3A 4LLUA 4ETYA 4UFLA 4OM1L 3FOMA 4XTRD 4PP2A 4OFYA 4YXLL 4J3VA 4Y8DC 1TE1A 1J0KA 1JF6A 3MROB 4HZLA 4QAWA 3ZM8A 1DWFM 2GJXB 2CKRA 1NLBH 4GKZA 4D0BB 1BPLB 1QFOA 3CX2A 3EOAA 3NIDF 5IJRA 2R8SL 3UESA 4LRIA 1WCGA 2EDJA 1HIZA 3TZVB 4LSDA 4W8LA 2ERJB 1RIHH 3JZ7A 3MLZL 4C4KO 5E5UB 2WWCA 5KVFL 1CDCA 4S2SB 1RQ5A 3LN5A 4OI7A 3HNTH 1NUGA 3GK8L 3SGEH 1M53A 4LLUB 3RTQA 2EO7A 3QR2A 3VFVB 3QI9A 1GGCL 1F90H 3CAFA 4PMZA 2CUHA 4OLUH 1QHZA 5GGTA 4JANA 3VGEA 4R8WH 3VWJD 3L3HA 5J1XA 1KELL 4KQ4L 5MEOA 2BC4A 3O0RH 4S0TD 2V5MA 5D2NB 3L95B 3GMPA 1MWAB 1XV8A 1TJIL 3VA6A 2H32H 1UR2A 4G7VL 3MV9A 4D9RE 1JFQL 5CINL 3S35L 2IPUG 1UQYA 3LHPL 4I0PA 3S4SB 2P8LA 4XP5L 4MD5A 4PJ9D 3EDKA 5E6YA 2NTFA 2XJ7A 1A7OL 4FLOA 4WVRA 4UFHA 3TYFB 5L8JB 1FGVL 4PGZA 1HCVA 3RX8A 5KVEL 1D5ZA 3GIVA 5DMIH 4X98B 5ANMA 3WD1A 1R6VA 2DT1A 1IC4H 1WIPA 4ZFGH 1RIHL 3LEYH 1EJ6A 5CGMA 3ZHKA 4KI5C 4LQRA 2BCKB 4Z5RB 5T3XD 4Z7UA 2BVQB 4Z76B 1ZANH 3DX9B 3TBWB 5IVXE 3EFDL 3TA3A 4D6GA 4MNGA 3U7VA 5F7WC 5E00B 3BZFA 4MB1A 1UXSB 1FV1B 3VE0A 3F7RA 4XGZA 4OZGF 5DFTA 3I6LE 4QRUA 4EXPX 1V3IA 3B3IA 3WELA 4F8TA 5DJ6A 4S1SH 1P1ZA 1PBGA 4BH7B 2IBZX 3IFPA 3RPIB 4U6HB 1KBBA 4JFEE 1D9KA 1TENA 1LEGA 3BP7B 1KCUH 2ADGB 3LN9A 4OIIL 5KTEH 4HUXB 4LLDB 3CZEA 1K5NA 2IGFH 4JFFD 2V7NA 5E4IA 3PL6B 5IFHH 1X5GA 4FXGA 3VXMA 2A6DA 1UGNA 1NP2A 4ZXBC 3D0VB 4LCWA 3U37A 1S7VB 1AQMA 1IAMA 1S9XB 1J10A 4NN7B 1FL6B 1W99A 3P11L 1XC6A 1IBGL 3NZHH 3T65A 4LLMA 1K9TA 2DIBA 4WW2C 5C0AD 1AO7A 5GSRB 1GU3A 1GW1A 4UIKL 5J1TC 3GSUB 3UR7A 3MRRB 5C0CD 2JJTA 5GQBA 2PF0A 2NY7L 3QUKA 2DGAA 5ADOL 1EZVX 1FGNH 3PHQA 2ID4A 4X5XA 2J5LC 4R6UA 4AD3A 2W0FB 2YD7A 1U8KB 3OLDA 1E0WA 1MH5B 3PBGA 5ERWB 4JN1L 1DBBL 4M6NH 1GGBH 4JKPH 2OR9H 3CH9A 3UYRL 1AGCB 4PMXA 4QOKA 4QTIL 1CL7H 4BQBA 4FRWA 5EJ1B 3MUHL 5I1EL 1MCEA 3AZRA 2ZEYA 3I9GH 5D1XA 3PN8A 1VACB 2GTWB 5E8EB 4PEEA 5BXSA 3RVWC 5CCKL 3VFUB 2HRPH 5DC0A 1KCLA 1OAZH 2QQNA 1S46A 5CS7A 5AZ2L 4C83B 1H0DB 3HAEH 4PJIB 5DUPH 4LU5H 4PQQA 5IXEA 4DKFL 5J0BA 3LKOA 5HI4C 4PMUA 4G80B 2IAND 2ZUVA 4F57L 2QQLL 1WNOA 2P47B 4WIWA 3EHBD 1UY3A 1RJLB 4N9GB 4X7TA 5E24E 1A9BB 3ARGB 5KSBF 4XBEL 1KFWA 3ARBB 4QXUL 1N5YH 3BZEA 5EFDA 1VKXA 5KS9B 4MADA 3ZIZA 1WV7T 4U3CA 4QPWA 2VISB 1HDMB 3WL9A 3HRZA 1IARB 4KUZL 3SURA 5IBUG 1EO5A 1LO3H 4Z0XB 5FGSA 1FQ9C 4JRXA 3EOTH 4WGVB 4R4ND 4UNVA 4L8BA 4OGAC 4OZHF 3MREB 4GRWE 3FRUB 5T5NG 4P2OA 1I7ZA 3NMEA 1KEGH 4PGDB 2W9EL 1XD1A 1XF4B 2WHMA 2MJWA 3GSOB 4P3DA 2RR3A 4HSQA 2C5DC 3QPXL 2EDWA 4WNQB 1JGUH 4M29A 1BLIA 2F54B 1HZHL 1E40A 2DDUA 2HKFH 3PXHA 5AZ2H 4KK8C 1BBJA 1IGCH 1LD9A 5T1MB 4K7PL 2AXGB 5F9WB 4HEME 2OYMA 4WO4A 1GOWA 4NQDB 5C08B 5DHYB 5J6HB 1BM3H 4P2OD 2ZEZA 5TH2B 3QG7L 3MYJA 4LVOB 2PO6B 1LJYA 1LK3H 1BLNB 1JDDA 3H7LA 2WAAA 4HF5H 3O9WA 2BVUA 2F15A 5EO0A 5ICXA 1MWAH 4HJJL 4YBLC 2FIKB 5SWSE 1ADQL 3UYPA 2IAMC 3IU4H 1NGPH 2GKIA 1XZ0B 4JFHD 3OXRB 1TITA 1UJ3B 4H5SB 4LYPA 2DQEL 5E4EC 1O8PA 4GKLA 5I16B 1W0WB 3PTMA 2BMKB 1YDPA 3IETA 3F12B 5TDPB 4PJIE 2WO1A 1X5JA 5E2UH 3GBML 3V6FB 3EAKA 3A47A 4R2GD 1IKNC 5FM5M 1BFOA 1ZSDA 3PWVA 5EU3B 5GJTH 2X4QB 4MA3A 4NCC1 1CZTA 2OJEA 2VZOA 4MJ5B 1RZKC 1BFNA 1E6NA 4NQUA 4QLKA 2XG5A 4I8DA 5DD6A 3SE4C 1Q6CA 4DUXA 5BV7H 1P7KA 1ZGLB 1GOGA 3HI1B 2JALA 1O5DT 3PXJA 5A2LH 1UYWL 4MDOA 3IDAA 2XZAL 3D2UD 4XMPL 3SE9L 3VFGL 3RGVB 3FB6A 2JCCB 4K94L 1M7DA 4PJHA 5HI5D 1UJTA 4YPGB 3WEXB 2J88H 3CUPA 5TE6H 2FDMA 4ONHA 4UIMA 3G6DL 2C8NA 3V4PH 4FNLH 5T33H 2GK0B 2KZ1B 3C5ZB 5A6LA 4ZXBB 4F3FB 3TN0A 2AJYL 3T8XA 4MCYB 1U42A 4MA8L 3C7OA 1A4JB 4QY8A 3I75A 1I1WA 1YEHL 4EK7A 4KGJA 1HXYA 3WDRA 3RM4A 3PNWB 2L9LA 3MGOB 3EGSB 5EA0L 1MYRA 3I6KB 3N85L 1T1WB 4FTVB 2GTZB 2YFZA 3EOTL 1QACA 5IK3B 1IAIL 3ETBF 4KWUA 1OB0A 3UTZA 1JHLH 1W9DM 4W7WA 1DUZB 1WBYA 5KVDH 3B9KA 5EU4A 1TJGH 1KTLB 5BRZB 3O9WD 3PZQA 1IAKB 4PG9A 5I1JL 2ADIB 3PF2A 3W0WD 3HCVB 2I24N 2WV3A 3BZDA 2D0GA 2V5YA 3H0TB 4QKXB 1V8HA 3CXHJ 3UNPA 3U5YA 2HG5B 1VAHA 5HHPB 4TPRH 3ULSA 4DUWA 3MV01 1OP9A 3SGJA 3N1MC 1KT2A 2YC4A 1KLGB 1QSED 3D5HA 2ZX7A 2YKKA 3TO2B 4NZJA 1AD9B 1PG7L 2GJ6A 4PTMA 4WUUE 1A64A 3BMVA 4L4VD 3QQ4A 3HEIA 4Y4KA 3NA4A 3QEUA 1WFUA 1ZGLP 3FCTB 4PCSA 4AD4A 3LS4H 4OM0H 5CD3A 4U6XA 5C07B 4K94C 4M61A 3T0EC 4QYOB 5IMOA 4M1CC 1MHPH 4QWWD 3CK0L 4UMGA 4MHHG 3DVIA 5E70A 2X89D 5FDWA 4Q22A 4I18C 3FB7B 1A9EA 5E5MA 2QADB 3EUUA 3QJHB 4I2XA 1K9FA 5ALBH 2HVMA 4HKXA 3WJLC 3SE8L 2AQ3A 1OD9A 5JA9A 4XURA 3FW6A 4QRRA 4JFSA 1WCQA 1ONQA 1ZHBB 5K59E 4N5UA 3U7BA 1VHPA 1OLLA 3L5WA 3NPSB 1AQDA 4RBPH 4UAOC 5K93A 1S7WA 2P4AB 5ISZE 1CLVA 4UT7H 5CP7A 3RZWA 2DIEA 5FL0A 4RMSA 2Y8KA 4PS4H 1SR0A 1SYSA 4QRTA 3RVXC 1S8DB 2ZPKL 1AKJA 3IKCB 4GJTB 4XP9H 3LMJL 1IE5A 4TPRL 1JXJA 3S9DB 1A6ZA 3DUHA 1SYTA 3MNWA 4P0DA 3BUTA 4YDKL 1NCBH 1M71A 3KPMB 3D25A 3JV6A 1T0NB 4HWBL 4O51A 1TA3B 1A0QL 3OKYA 4GXUM 1D6VH 1X5HA 3DMMB 5JMOC 3RP1A 5HNNA 1SY6A 1RULH 2AI0L 2H6PA 3ACGA 4PSPA 1M1SA 2FJHB 1FJ1B 4CD6A 3SDAB 5DJXA 4JRYB 1OGBA 1T80A 3AUVA 4LFHG 3HE6B 1MJ8H 2JCCF 5INCA 3VH8G 1IC5L 5EB8A 4O2FA 5IF0A 4XMKH 2R9HD 4WHYH 3S4SG 3GSWB 5A2BA 1OB1B 4HUNB 2XQYK 3FO0H 2IXUA 3NTCH 4KROC 1H0IA 1QKZL 5DQDH 3BRFA 2J1EA 3QOMA 1JUFB 3IDIA 3GSVB 4GW1B 4GXVH 4PJGA 3ALXA 1BJMA 1T22A 3GB7A 4OFYD 2XQXA 4XUNA 5T5FL 4P8XA 2DT2A 2QTEA 4WSJA 4FQIH 3I6GB 4U2YA 2Z31B 4OLYH 1GVYA 3M7SA 3AHXA 4OJFH 3AY4A 2ICWJ 3SE3C 2UY6A 5DO8A 1BFTA 1PKQE 2RB8A 3CDGA 5D7SL 3TBTB 1F2QA 4W8JA 2DQDH 4TVUA 2VXTH 4GG6A 1JPTL 1Q94A 3VD7A 4HGWA 2Q6WA 1F5WA 5EZOL 1GQIA 2W67A 3VNYA 3QUZB 2VC2L 1O7SA 3TT3H 3IVKB 5J1AA 1W32A 2AJUL 2BSRB 2DKMA 1XPWA 1F3DJ 3HAEA 3PDGA 1DQLL 5FO8B 3QRFM 4AMKL 4LVHC 4MYWB 3A23A 2Y6SD 4X5WB 4PJHE 3CQOA 4L3CA 4XCYB 3WFCL 1UX7A 1UACL 1OGAA 3K2UH 1LL4A 3HMWH 1WDQA 3U9UB 1FH9A 3WD2A 3IXAA 2D7QA 3VWKD 1MY5A 1HHHB 1MY7A 4Y2OA 4L0PA 1XGRB 1BEYL 4PJXA 2XZQL 3VM7A 5K59F 3IDXH 2VZUA 3STBA 3PABB 5JMRA 1RUAL 1KIPA 4HFWB 1N59A 1AP2B 3K1DA 3WF0A 1E1FA 2CDGA 3H3KA 4QRPD 1NKGA 4J12A 4ZQKA 3QEQA 3LRSB 5DJAA 1B2WH 3QEQB 1HNYA 4EKJA 5KW9L 3HNSL 5BRPA 3MR9A 1NGQH 4IOFD 3BE1L 2VXSL 2XN9A 5C70A 5IB5B 2LS6A 2MWCA 2I9TA 2OP4L 4BDVB 3QFDB 4FQXD 4OGXH 7FABH 3HUJE 5IW6B 2VLKB 1P2CA 4Q9RH 4AEIH 3U0TA 3SJVD 1NM9A 3KPQA 4K23L 2YPKA 1N7ML 2DD8L 3LOWA 2IG2H 3N50A 4CU8A 3PWNA 2CJUL 2JCCE 1YNKH 3QQ3B 4FP8L 5I6XC 3WUZA 1BGGA 5FO8A 5C1MB 3VFRB 5FA3A 3E8UL 1IAOB 4MX7A 4NQVA 4LNRA 4H04A 1TZ7A 2ESVA 4HJ0C 5HOSA 2WK2A 1MIEH 4HBCH 2O9RA 3E6HB 4FZEL 1N4XH 2Q6WB 5IB4B 3N18A 4IIQC 5IR1B 4OUEA 1A14L 5C0FB 3HMWL 3GXUA 1ZVSB 3MLXH 3OQ3B 3GSNA 1JGVH 4FQ1L 3OAUH 1RPQA 1KXQA 2GK1A 4K3GA 3QUZC 1RUMH 2G3JA 2BVEA 2E5EA 3GJFK 3VFPA 2JELH 2DQIH 4XZUG 5JXEA 2E9MA 4W93A 3WDQA 2H2SC 1NLDH 3JUGA 5C0AB 4PJGB 4U1LB 1U58A 1KYOK 3GSVA 1A6WL 1G6VK 3WN5C 1RZ8A 2D0HA 5KG9B 5A6BD 4RFEA 4ODVH 3RBGA 5FOJA 2W61A 4M48H 1LO5B 1K6AA 3I9GL 4LLQB 2OTWA 1B3JA 4LVOC 4X5LA 4MVBC 2NY2C 5IEHA 4AEIL 1ZLVH 2PW2A 4U5IA 1OD8A 2XT1B 2IMMA 4JHWL 2QQMA 5HHQB 4OUOA 5DDHB 2V2WA 1KXQE 4XHJD 5TFSH 1LDSA 4J6RH 1E4MM 1BGAA 4UTBL 4HWEH 3SDAA 1V05A 4A45A 4YXLH 1B88A 4QXGH 1K12A 2J7BA 5FHAL 1H3PH 3HZMB 2G3MA 4APQB 3SN6N 4HWNA 1R3LA 4YFLF 4JL1A 1XGTA 3RY5A 1G9NH 1QHPA 2VR9A 3B8YA 3O2DA 4LKXA 1YY9D 2X7LA 1NFIA 5F1KC 5LQBH 2J8OA 3JV6B 4WUKH 4A6YB 1UD6A 1D5MA 5AG9A 3FOLB 4CD7A 2V2XA 1A6ZB 2DMKA 4LLVB 1R24A 4HWBA 3KPLB 4S1SL 1GOFA 3DGGB 3DX6A 5A6BA 4XNYH 4A6YH 3NIFE 5C0GB 1S7WB 4I0PC 5EU7E 3L5WB 1YNTB 1JNLH 4GO6B 3V8OA 2OZ4A 2NY1D 5I1GH 5F1NA 1S7RA 5IV2A 1KB5B 5A69A 2WM0A 1ZGLM 3MJ9H 2QSTA 3CC5B 3CFJA 1ND0B 2JJSC 3IDMB 4XP1H 1SVZA 3MMUA 2XWJA 5EPMA 2QQNH 2CUIA 2DDQL 4Y2DB 1FHDA 4HX1A 1FGVH 2CRYA 3G04B 4I3SH 4NO3B 3O6ML 1EFXB 3CUGA 3JVGA 3FZUD 3MCLL 4AWEA 4ODWA 5D5MF 1OINA 3QQ4B 1OSPL 4NZTL 4WEUD 2DAVA 1GHFH 2VXQH 3V6BR 4POYA 2V5CA 1RAMA 3KAAA 5IFJB 1VADB 1AD9A 5J1SC 1MQKL 1Y6NR 1FFNA 3P9MA 2ARJA 3PGDA 4YBLB 1JWMA 2NNAA 3Q3GA 2A3EA 2P5WA 3FFCE 4PRBB 3VI3E 4XPTL 2WPGA 1YYML 2BHUA 3TT1L 3MLSL 4UDTA 5D2LA 3CZJA 1KIRB 4ZPVB 3I3DA 4D1JA 3MJGX 5C7GA 1G7PB 2YXFA 1CVSC 4P59H 1IGFH 3HCVA 3MSGA 1EGZA 2QBWA 2FECI 3U0WH 4PP1D 2XWBA 4F79A 4QRPA 2DQGL 1H6XA 4A41A 3MA7A 3W11D 4Y88A 4ZSOB 3RWHA 1JNJA 2HA1A 6FABL 3VXQB 4P4RA 5E08L 4URIA 3RA7L 3VU2A 2NXYD 1D6EB 1J86A 1CEOA 3MGOA 2WABA 1RMFL 1U8HA 1X7QA 2HLFC 3A6CH 3FO1A 1DFBL 3G9VA 5I74B 3FFCA 4OZIA 1BX2B 2BSED 2I9LA 3T2QA 1K8DB 2W1SA 4P9ML 5D6DA 2XN9E 2Q3ZA 5IG7B 2QQLH 3CXHK 5DHXB 3P11H 2CIIA 4RFOH 1JI1A 3MRNB 3CUPB 5SWZE 3DI3B 4FQ2H 2MFNA 4TNVK 5C09A 3SDXB 4EDXB 1KN2L 1I75A 1X1NA 1N6VA 2JCCA 5J7CC 3HLAB 4NN5B 1YEHH 4JPVL 3F7PC 5I73C 4GAJH 3O2WH 4TTDD 1CTOA 1ED3A 1Z5LB 4KTDH 5DTFB 4ARXA 3HI1A 5IGXL 2BVOB 4K71C 2IQAB 3D0LB 3U0WL 2HN7B 1I1RA 2CK0L 2FNBA 4P7NA 4J4PD 1GUVA 3DURA 2V72A 4YIQA 2BSTB 4MQ7B 5GGVL 2WMHA 3T0DA 1MVYA 5CGYC 1K42A 4OZFG 1BFOB 1G9ML 1FZJB 4ERSL 1I3RB 4N8CL 1V6WA 2E7MA 5JZ7D 4YHKH 2XVKA 1HHKB 3GNMH 1E6RA 5F9OL 15C8L 2EH7L 3RMEA 1UJ3A 3O9WC 3PP3H 1MFBH 1B0RA 3K8LA 1MF2H 3MO1A 4M1CD 4R4NC 5H8DA 4JFOA 4JZ5A 1JRHH 2HWZH 5F7MC 2IQ9L 4HUKB 2DQCH 2VLME 5D9SA 3O9WB 1QLFB 5DUPL 5FA4B 1I3UA 3RWIB 5DHVB 3QBTB 4Y8AA 1KJVB 2EYSB 1YY8B 4DEVA 3BC9A 3WUEA 4M5YL 1F58L 5FO9A 2D2OA 1AY1H 1H3TA 4K3EH 2RGMA 1ZHLA 2AXGA 5I75B 5D6CB 4Q6IC 3O6AA 4CCEA 2NPLX 4LIQL 5L7XL 2ZXAA 3WNOA 1YEEL 5M17A 5BXPA 1VFOA 3CVHB 4CVZA 4I3RL 3QDJB 5KOMC 3C5JB 1J0ZA 1W0VA 2GK2A 4XMLH 2PXYA 2XKUA 4PLJD 3RY6A 1A1NA 3AM8A 3OEBA 1I7ZB 4P2OB 2Y06L 2ZXQA 2W4XA 4UQCA 1CLCA 3FRUA 3EDEA 5C0AE 3TCLB 1CG9B 4HC1A 4L8BB 4QRRD 3V9FA 4M6AA 3ZKMD 4MO3M 4MXWH 2PWFA 1WISA 3WFDL 4K7FB 4ZUSB 4JRXB 5IMMA 3NCJL 3B2VH 3O2VL 4OOZA 4RFNB 5JXGA 3SE9H 3BKCL 4FZ8H 5HYJA 2YL9A 4HPHA 1DL7L 5KS9E 3PGFH 1CFSB 3THMH 1G6RA 3VWJC 3NACH 2SEBA 2CR6A 5DVKA 2MQCA 5D1ZD 2XYLA 4ISVB 3ZE2F 4APQC 2AI0H 4ZUUA 1T03L 3ILQD 3U57A 3EO0B 2DQFA 1FE8H 3VGGA 4LHUB 1MPAH 2ADJB 3EFFA 1RZIB 3RDKA 3OG2A 4ZFZB 3DV6B 3GGWA 4Z0BL 2F8QA 4LYRA 4E9LA 1F8TH 5ESAA 3CUFA 1UKSA 1RHHA 3BH9B 3WIIH 1HH9A 3TNNA 4F7MA 3BUYB 1TETL 5DR5H 3C87A 4QLLA 1RU9H 1C1EH 1UWRA 1FC1A 5JDSB 3MLWL 3A6BL 1GZPB 3W0WA 2J7HA 5F21B 1OQXA 4G3YH 2Y06H 4PY8I 3WUWA 4XNUL 4HFUL 1YC7A 5L88L 4S1QL 3ZDZF 1AGCA 2Y72A 1TUXA 3K2MC 1T5XA 5A2AA 3QHFH 5IM7A 1GPOH 2AEIT 2HFFB 4FFVD 3P9LB 4J3OC 4W84A 1C16B 4UQDA 1NFDB 4TQEL 5I1DB 5CEYB 3QUYA 1L0XA 1G7JB 2C3HA 1T5WA 2WUHA 1YMHB 1I4FA 2XN9D 3TVMD 4UU9A 1F4YL 4P2RA 1FLRH 1BQSA 3GSUA 4JDTH 3W9EB 1HNFA 1Q0YL 4D3CL 4D8PA 4YQXH 4JM2B 2FX7H 4UR9A 2DMCA 3RVTD 5EU6B 2ZSWA 4U1SA 4AL8L 3CHCA 5KJRL 4PMDA 2FD6L 4MQXD 2IPUK 2QMJA 3CMOL 2EO9A 3MA9H 3AYSA 3Q6FB 2EKSB 4O58H 5B38G 5D9NA 1XGYH 2Q76B 2Y36L 1PSKL 4PJDE 4S11A 4WDIA 4XCEB 1MOEA 2AAVA 4HT1H 4MJID 3CKHA 2J6EH 4C58B 2GJ6D 2WVUA 4TUKH 3IFOA 5C0BD 2KDGA 2YS4A 5IB1B 3VG9C 3KLAA 4MQSB 4FFZH 3QNYB 3B3IB 2LV4A 4NUGL 3C7HA 1I1FA 3JVGC 3MRMB 1PMJX 1G5AA 3MANA 1H9VA 2ZCKH 1NMCB 1S7UB 4E42A 2PBOA 3L6FA 3V0WH 1FV1A 1UXSA 3VE0B 4GG6E 1MCSA 2F8XC 1VCAA 2CDPA 2C26A 2G3NA 3DROB 3L5HA 3MACL 4TSBL 4XAKE 5LKNA 4MSWB 4Z76A 3CSYA 3QG6A 1A7RH 3VFMB 4JY5H 2GFBB 4K7PX 1X9QA 3KYMA 1ZT7B 1E55A 1LE9B 3I2IA 2EDQA 1KXTA 3AU1B 1D5ZB 1N5AB 3QQ9C 2X1QA 3LN4B 1DBJH 3PTQA 3CMOH 2W92A 3H9YA 1AQKH 1I3VA 3VGBA 5DA0B 4LCYA 2VLLA 3I2FA 4PBGA 3H9HA 4ZDHA 1JN6B 2NTFB 5EBWA 5JTWA 2VAJA 3BIAX 3GUTB 1JL8A 1H3XA 4L3ED 2PWGA 1BG9A 4DN3L 4I13B 3INUH 3HPLB 2B1HH 1MCLA 1AE6H 3L95A 4PJHF 5B38A 3FO9A 4A3ZA 1U8MA 3JBG7 3PTKA 3SCMA 2Q8XA 3GI9L 4Z7NF 3RDTD 1OIMA 3S34L 2J78A 4IHOB 2XXCB 3LMYA 3WIJA 1NP0A 1EBAA 4WJ5B 2CEQA 3ZSSA 3WNPA 5IFPA 1KB5H 1UQZA 4M1GH 4YHLL 3VCLB 1K3IA 1SEBB 3QI9B 4YWGH 3VFVA 5E8PA 4HJGB 3P0GB 1J1PH 3TNMB 5TDOB 5DJCA 4K3DH 1V0LA 2XZCL 1T66D 2CLZB 4Z78A 2DQJL 4BQ2A 1T7XA 5F9AC 1WTGT 5JOFB 1OTSD 4IMLB 4H1LH 5MP6L 5IJVB 2IALB 1EVTC 2X4NB 4N0UE 5IT2L 1ZT1B 5JHLH 4XP6H 3LB6D 2W60A 1IGYA 4YFDB 1T89C 5DFVC 1HQ4B 2VQ1A 2WW8A 3ECBB 5JA8B 2DSKA 5ISZB 4IMLA 4V1DB 1ZLWK 2X89A 3ILQC 4Y19E 4IM4A 3P77B 4HG4J 2G75A 3F5WA 1H09A 5CEZH 3VNZA 2EEAA 1NCCL 1PSKH 4O02H 5D96B 4HU0A 3F7YA 1SEBA 3EBAA 2OZ4H 3VCLA 3DYPA 3HI6H 3RHWK 1FO0B 1OF2A 3BJ91 3EOYG 5GRJH 3S96A 1MFUA 1SMAA 3SCMD 1BZ7A 2OJZL 1HQRB 1S7SA 3C7EA 2Y07H 4ETQB 1O59A 3L3OB 3IS1X 4RMUA 4IDLA 5HHNA 1I85C 3PZIA 4NM8H 3T77B 3ARDA 5I19L 1BREA 1I8LC 1M7IA 2FBJH 1HXMA 3ZT7A 4OGAD 4XZBA 4O2CB 4GRMA 3MRFA 4NQXA 2LE9A 1BP3B 4X6CF 43C9A 3GUTA 4U3AA 2EZ0C 1FBIH 3X3GH 5T3XL 5DLML 1L6XA 3VXME 1QI5A 1TVNA 1GGIH 5JW4N 1CE1H 3VDAA 4AG4L 2H41A 4QT5B 3PHAA 5BO1L 3OG6B 3T0BA 4OLXL 3S5LA 2KQNA 2NXZD 2F53B 2ATKB 2YRZA 4H25A 4LASH 5T3ZL 5KANG 3KYMB 4XNZB 4M82A 5I8OH 4MXQD 4PJEB 1QNQA 3OIHA 4UNTA 1DQJA 4QOKE 5GGRB 4UQEA 2QQQA 5I1IL 3MLXL 2XQYG 5T1LA 1T20B 4MSWA 4FA8A 3CLEL 3FHQA 5CHNA 3BPCB 4P08A 3LS5L 3WE6B 3UPAA 4Z2HA 1C8XA 1A6AB 1S7UA 4E42B 5DMYA 1RK0B 4KY1L 2BY3A 3KPOB 4P2QB 2XVLA 1E4KA 3AB0B 4GMTL 3FONA 4U1KB 1A3RL 3T3PE 3WQ5A 1RZJL 4QDSA 2DQHL 1KCRL 4OLVH 4NM8L 3GM0A 3MJ7B 3UCRA 3LDBB 1X3DA 4RWYH 1A3HA 4JG0H 2VRQA 4XCCH 1WFOA 5KW9H 3S35H 1IKFL 4PRIB 4IM8A 4CJ1A 2DH2A 2YN3A 4NSKA 4OLWL 5ID0B 5JW5A 2Q76A 1MLCA 3K80A 4WDIB 2X4OB 1CE1L 2R69L 1NFDE 1NC2D 5C6PB 4K7PH 4NKQB 1RMFH 3SO3C 4DK6A 4XZUB 3T2PA 1HJSA 1F3JB 3AHZA 4JJHA 3AICA 1DBAL 2W63A 3GMLA 5CD5D 4HP5A 3TTQA 4CVXA 5EU6A 1KC5L 3CX5K 1IT9H 1IEAA 2JB5H 1E4WH 5FYJH 1JWSB 2A77H 4EUPB 4JCMA 5J06A 1UZ8B 5DZOA 4R4BB 4KKAD 5FK9B 2BOBA 3WBDA 3V79C 1H3GA 3BVNB 3GMMB 1QLRB 5L2KE 3Q2CA 5ICZB 1CDHA 2XHNA 3Q5OA 4KY1H 2PR4H 5CEYA 4NZDA 1G6RL 1CD1A 4M1DH 2C9AA 1A3RH 2OSYA 3GSRA 2W3JA 5J12C 4ZO8A 3P9LA 1CGSL 5FEBA 1Z9OA 3KPNB 4QB2A 5IM7B 1WFNA 4Q58C 1T5XB 1BVLB 4HXBH 5JOPD 1Q72L 1KPUA 4DCQA 2YPLE 4GLRH 1YN7B 4D0DA 1B3XA 1GCYA 5AC4A 1ES0A 2VQTA 5IBTL 1K9DA 3VXRA 3C6SB 2VZRA 4XPBH 5JHDD 3TTSA 3Q0HA 1W0YT 5IYYA 4WO4D 1DN0B 1NANI 4DKEH 3H7BA 2GJJA 4PR5A 4XPHH 2X42A 4GQRA 2XYCA 1F00I 1BYBA 1HH9B 3TNNB 2Z1SA 3L4ZA 4M8VA 5ESAB 2LAGB 2R0KL 2HT3D 4HIEB 1HOCB 3HB3D 2DICA 3EFFB 4A42A 3N9GL 3ACIA 4KMTL 2Y1VA 4YHNB 1IBGH 3P6BA 4J3SA 4RCAA 4PJ7F 3TA3D 5D6DC 2VR4A 1CFSA 5KSAC 5KN5B 3C7FA 3QXDB 4JO1H 3MLTA 3L3KA 1S9WB 4XPTH 1FNHA 4PJIF 4Z7VB 4PJ7E 1S9VB 3I50L 5HYJB 1EO8L 1LILA 4UNUA 3MJ6A 3TIDA 3FZUC 2AK4B 1RK1B 5EOCL 4QHMA 1U0QA 3KPTA 1RY7B 4ZUVB 3KWXA 4A3HA 4KRNA 2AK1H 4KXZH 3BH8B 1OQOA 4K07A 4LSUL 2JIXD 3GBLA 4AH2B 1QVBA 3IFNL 4Y5VA 1I1YA 4XPBL 5TQ0L 5JORA 3MV8A 4RE3A 5LJYH 6A3HA 4KMQA 5DMKA 3NGBB 4JCLA 3IAQA 1DBML 3MFGB 3WD4A 3MV9D 4PLKC 2XKSA 2WINB 5BOPA 3CVHA 4CVZB 1MFCL 1Q9OA 2AJZA 3TPUB 1H6YA 1FYTA 3ZT5A 2WHLA 1MHCB 3CVHL 1G01A 3QZWB 3FRPA 3WFEH 4BA8A 5LXGL 4HS6A 3DNKA 1ISVA 5CSYA 4K3JH 4JPWL 4BSVA 2AEPL 3FQWA 4OF5A 4BZ1L 4Z77A 5FUCE 3GMNB 1KFAL 5EZJA 2FJFB 5I30L 1A02N 3LEVH 5D1QB 1OT5A 1LVEA 4KQ3H 3RAJH 5DHVA 1O0VA 4FQQB 4F9JA 1YEGL 3BKJH 1UB5B 2VLJD 4XCNA 3OAZK 5ANME 1XHGA 5LA1A 3LS4L 2HT4C 3POHA 3CMGA 3HUJF 1AGBB 1KPRA 1JPFB 1K6QH 4LQFH 3VXPA 3CFKB 4ELME 1KGUA 3KXFD 1B9ZA 3EO9L 2LU4A 5B39B 4ZTOH 1CLZH 4M8QB 5DMGD 1DSFH 5D1ZB 1U9KA 1FZJA 1LG1A 4J4PA 3PHOA 2H3NA 3SCQA 4GUPA 4WEMB 2IC2A 1PQZA 1WBXB 2NZIA 5ADPH 3VMNA 3NFPB 4ZTPL 3GSNH 3BHBA 3QCTH 3DURB 1GQJA 4JRYE 3DUUA 4X9HA 4Y19D 4Y5YA 3FQRA 4MNQD 1CE6A 1KIQB 2X1XR 3VG9B 2A6KA 4DFIA 5HYFA 5HTSA 1W2VA 2Z91A 3VVGA 5TE7L 3GFUA 3SCTA 5CLWA 3VFWA 5F89A 4OIBA 4JFFA 3AMKA 4LAJH 2JJVA 1PPIA 4DQOL 1IGCL 4EDXA 4XT1C 3K75B 5EWIH 5C3LD 3NOIA 3WSOA 2Y6HA 2Q20A 3IDNB 4EBQH 1B31A 3DVNB 5J9PB 1UHVA 4PYSA 1ACYH 3LKQB 3QPQC 3AHVA 1NMAL 1XCTB 2F53E 4MA8H 4XNMA 2AKRA 5ETUA 2ZJSL 3QUMB 1WK0A 2UVFA 3O8XD 4PRHA 1VPOH 1FFPA 4J3WA 3ZMRA 3CIHA 4CVUA 1ODZA 2F54D 1UY2A 2GJRA 1EXUA 2E7BA 5FCUH 2A9ML 4UOW1 2ESVE 4YEEA 5FOBA 1F6AA 4E8CA 4R0LB 3TONA 3MTRA 4HU8A 3BIBX 3D39D 4GO9A 5IB2A 4LBEA 2C3GA 1E6JH 4LGPB 1LNUA 1AXTH 3U2SB 4HA3A 4WKAA 2EDFA 1HSBA 4JFZH 4AEHL 1CVRA 3VXUD 4OD2A 4GZJA 2BNRB 3ECQA 1T04B 1JGIA 1KCVH 5DRXB 3H2WA 3LPFA 3IGAA 2G3IA 2C9KA 2ZP0T 1PDKA 3O45B 4P2RE 2P49B 1NEUA 3MMEA 4PV9B 4BQ8A 1XGZA 4X6CA 1R5IA 4YHGA 1PAMA 5IW3A 5EO9B 1FFNB 2VX5A 1ZA3B 1MCIA 2Q1EA 4ODUB 2R0WH 2R7EB 2X9YA 1CZ8H 1FH5H 3ZDYE 2HWZL 3V4PL 1FORH 4GRWF 2DBLL 4JFTA 5CPSA 2GSJA 4PIRF 2Q3AA 4W4NA 4ZUTA 2V3FA 2ZSVA 2A73B 3WFLA 1BYAA 5BS0A 4XC1H 4WK9A 1GJWA 2DQUH 2YKLL 3BIKB 2AABH 3IJSB 3Q1SH 4G6FD 1EHAA 3BN9D 4MWFB 5E94B 3SCNA 1YPZB 1HHJA 1A6TB 1DWJM 3PIQA 3SE8H 5FV2A 4LAQH 4U1MA 4GLRI 2I26N 5JZ7C 1ULPA 2J8UE 2HJLB 4H0HB 3CXDH 1I8KB 2J4WL 3EYVB 4MJIE 3LIZH 1OP5K 1GCFA 2HLEA 1QFPA 1J1OL 3QEGL 5IP4A 3NUKA 1BZQK 5IHZA 1KGYA 5I78A 2H32A 5D9PA 1CK0H 1A8JH 3ESVF 4BF7A 4UI9L 4NYLA 4BS0A 3BQUD 5IJKC 1R3HB 4Q74A 3FOLA 4M9OA 3FY1A 4LGXA 4LCUA 4JN2A 4Q9RL 4KV5F 3WXVH 4X6DE 4TULL 4RDQG 1OGAE 2EKJA 1C5CL 1S7XB 3WS3B 2GJZB 2NLJA 2CIKA 1XGTB 1NWUA 5F1IB 3OGSA 3RFZC 3GJEA 3HZMA 1U2HA 1NQ6A 4MTVA 2EDOA 2F5BH 4N0YL 3I2HA 1W3HA 5JHLL 3QO0B 4DGIH 1FRGL 1DWIM 3R06A 5DQ0A 3BDYH 5SV4A 3BN6A 3CVIH 4KKCD 2YPLA 2F9BT 3POCA 5FCUL 1U8NB 3VFNB 2C7UA 1MW0A 3WHXB 3AHYA 3BEVB 2ORBH 2IBZY 3MXVL 3C60A 1NCTA 2V9TA 1L7IH 3RNKA 4MJ2A 5A16B 1R5VA 4OZFA 4PJ7B 2XA8H 1F2XK 2G9HB 2E3ZA 2B4KA 5HYQB 5E8OA 4FQHB 3TVMB 1LEKA 4FI9A 2D3NA 3UP1A 5K9OB 1RZ8B 5KG9A 2YUVA 2O26U 4GSDL 4L4VB 3WLWC 2GYSA 4WWKB 4P8UA 2Q8BL 1CLYH 4X6FB 2XY1A 1CD9B 1IM3B 4M48L 1UKOA 1JNNH 2R1WA 4J7RA 1SHMA 1ITBB 3UR8A 1OW0C 5K9JL 3QDMD 5ABDE 1RH9A 3MZTA 4CD5A 1NDGB 1S5HA 1ZVSA 1CDIA 3B4NA 4HH9A 5C0RH 4Y7MA 3G5XA 4NN5C 1A21A 5AUMB 1G7HA 3J8F7 1QSFE 4RL3A 2D23A 1KBGL 4HJ0D 3V7AG 1IL1A 3KNBB 3UO1H 1E4XH 2LQRA 3C5ZD 4WI4A 4G8GE 3SJVA 1ZL1A 3ZHLA 4UTFA 1W91A 3O8XB 1PG7W 1FNLA 2FX7L 4OCNC 5EU7C 5IB3A 3D9AH 1UWUA 5C9JB 1TTFA 5FHBH 2Y6SC 3LY6A 5TD4A 3ES6B 3P73B 1DZBA 5HHXH 4OLEA 5HI3C 3UG3A 1KLUA 4MDIA 4G6AC 3KHQA 3O4LB 3W24A 1P2CB 3VIIA 4AJ0A 2P8MA 3D39B 5D72H 3QFDA 2Z4QB 1OTTC 3OMZA 2I9TB 4Q9CA 4Y4HB 1FP9A 1Q9WB 3UTPD 4CKQA 4XWGL 2HT2C 4Q6IB 4ZS6C 3VXUB 1N59B 5ENWA 3FO2A 3SKNB 2W38A 2K1MA 4PJXB 3ZDXF 3V4VL 5C8JA 5H37G 4NC1C 1DDHA 1MI5D 3HS0B 1C5BH 4XNXL 5E03A 2NXYB 4FABL 3TH4T 1UM4L 1S7TA 1FZKA 2AV1A 5GISL 1TZIA 1NGWB 5GJSL 1ISXA 1KXVA 4W50A 1UWWA 5J1AB 4GWJA 2HMID 2Z93B 4DZBB 5D7JA 5CKGA 3BZ4B 2FGWL 2VKWA 1D5IH 4HEPG 5KSAD 1NAMB 3RWCB 1Q94B 2VDPH 1PYWB 3QUXC 3STLB 5ITBH 1PYWA 1J1XL 1PZ2A 4OCYL 1NAMA 3V5DB 5J13B 4LARH 4DZBA 3C09C 4XWOD 3TN0C 3G6JE 3QWRD 2B1HL 2VCAA 3WL0A 4R5EA 1C3FA 2VDRL 2HT3C 2YL8A 1PZ5B 3SKJL 5A40E 3UG5A 4P46B 4FMVA 5CYYA 4ELMA 3KPSD 4ACZA 1AE6L 2VZ1A 2FDBP 4P3WA 3EOBA 4HH8A 2NMSA 3SDCB 4PGCB 1JUFA 1PBYA 2Y7QB 4JKWA 4MA1B 1A7NL 3MBEB 3SOBL 3PGCA 4M62H 1PZUB 3OKEB 3TTYA 2ADFH 2BNUB 4YHYB 2GFTA 1MRFH 5D8JL 1DQDL 4L4JA 2MMXA 1ITCA 4Q6IA 5TF0A 3U36B 2D7PA 5HSFA 4ZXEA 1H3WM 4EZMA 3D39E 4AIXA 3WD5L 3DSFL 4JIEA 4YHZL 3OJMB 5E2TH 2ARWA 4B3KA 2DB8A 4XVTH 3RIAK 1JF1B 5C0CE 1LE5B 2AEQH 4AD0A 3VWKC 5DMIL 5T3ZE 1FCGA 2BY1A 3EYSH 4GXUN 2VM9A 3TH3T 5GSVA 4X4YB 1J1XH 3VFTA 4PJXE 1CR9L 3MSDA 4LLWA 3D25B 2IFFL 1H5BC 5IB3B 1IGTB 3BI9X 4PRPB 5CMAA 1JBJA 4NUJA 8A3HA 2FB4L 2A83A 5CJXC 5GRJL 1IL1B 1GOIA 1CF8H 3P0VH 3GNRA 3WLBA 3C6LC 4U1IB 2QPSA 4IISA 1ZXQA 4MCZA 1SYSB 3QDJD 4QRTB 4HH9B 5AY7A 1UKPA 2WUCL 1NGXB 2P5EB 5DWUH 2CO7B 2FBJL 4Z8FL 3UDWC 1HSAB 2C0HA 2NY6C 2GAZA 2K7QA 4HMDA 1UD5A 1Q9LA 1IM3A 1OTUD 4WFHE 5F7KC 4LP4A 5GRVK 2D0FA 3ARFC 3JTSA 1X5YA 4V1DE 2WBGA 2NQCA 3H42H 4LK4A 5C07A 3QDAA 2VL5A 3HC0A 3MLVL 5CD3B 3WS6A 1JWUA 5GISH 4D6CA 4P2QD 1KC5H 4FQHA 4YDJB 3CUJA 4IJ3B 3ALWA 5HYQA 5IVXA 5EBLB 2FHFA 5A16A 2WMIA 4P5TA 4X0KB 1QSEA 2CBJA 3GMOB 3LQZA 1W0NA 4J8RA 2GHWB 3BSHA 5I1IH 1CFVH 2BXZA 5BVJB 1SMDA 3O81A 2Y25A 1R0AL 1TZGH 2N4IA 3MLYH 5GGUB 4RGMB 2NT1A 5DJYB 5DK0B 3OTTA 2VLRB 5D7JC 1FIGH 5FYJD 3GMRB 5JIHA 1R3KB 5KAQF 4LVEA 1J8HE 5I1HH 1W9VA 2ZOLB 4FXKB 4PTUA 1NBZA 3O3UN 2FJGB 3T0EA 2FO1A 1AR1C 1T21A 3S36X 4ZNEE 1CD0A 1T2XA 3MBWA 4OLVL 2IMNA 1SJVA 2EEXA 3PDDA 1S7XA 3AXLA 2ADIA 5C71A 4M93C 5BRZA 5EIVA 5BYWA 4QNPE 4ZOAA 1FYTE 3PL6C 5L8LB 1BF2A 1OP3K 2A6JB 4W8BA 3SCWA 1HZHH 2YD3A 4YGVB 1OAUL 2GTZA 4PB0L 2APXA 5I1GL 3MLPA 5CZKA 2ZWLT 4ZO7A 1AR1D 4QB6A 4OQTH 1GXEA 4WU7A 4YN5A 4AC1X 3WENA 3BQUA 1OWQA 1QNOA 3TN0D 1DEEA 3MLVH 35C8H 5GGRY 2E6QA 5J4MA 4B3LA 1DJSA 1P84K 3VRLF 5FFLA 1KGCE 1I8KA 2O5XH 1A4JA 4B0MM 4RQQB 4MCYA 4PMOA 3N15A 3ROOA 5FYJL 4PV8B 3O3DB 1YEIL 4JM2D 4XX6A 1HHJB 4DW2H 5KSAB 5E94A 4Z2AA 4YBHA 4AYFA 5F71A 3WIHH 2CLRB 3IJSA 1EIBA 4LSSH 3WEXA 5AZEL 3PE9A 1FPTL 2IADB 4PJHB 5L9DL 5J6GA 2PETA 4KZEH 4OCRL 4R90L 3WIIL 3K0WA 2DBJA 4GRLD 4BSJA 3DUSA 5B22A 4HK0A 3VFSA 4PCTA 2XFXB 1RUKH 2HRLA 4POZD 1M05B 4JZNB 5H94B 1ZLSH 3VFOA 4CDHA 4WHTA 1CGUA 1EUTA 3TIEA 1JTOA 3NFNA 5DGQA 5JIPA 5HGBB 4PJ8D 3HR5B 3DECA 4KAQH 2NR6C 4POZC 5JW3H 3HUJB 1HSBB 4H5SA 5FV1L 2OL3L 1AHWC 1E0XA 4QWWC 3RZCA 1CXIA 2YDSA 4LLAA 1UFUA 3EYOB 1XZ0A 2DQCL 5I6XB 1NGZB 2OM5A 3U2SA 5DJ2A 4P23D 1QR1A 2VZPA 5FIPA 2FLRT 2N7AA 3X3FH 2CRMA 4PUDA 5ACLA 1F6AB 4HF5L 1GC1L 1UUQA 1OAXH 4HCRL 4KKBC 4TVPH 3DHMA 1U8QA 4FQJH 3SDAC 2HH0L 1S9YB 1NAKH 5KSUB 4HPOH 1D5BB 3AAZB 5DZNA 4NQDA 5C08A 1F13A 4RE4A 3QUMA 3SCPA 3EO9H 1I3GH 1KJ3H 5D96C 4Z7OF 2F54A 1I9EA 5LAXB 3CFDB 5GNYA 3L5XH 2YD6A 1BPVA 2R4SH 3TP4A 4P3DB 3I84A 1C7TA 2ZX8A 4XXCC 4PUBL 1ULOA 3IJHB 2Z0BA 4JFFB 3ZYJA 4F33B 4XUPA 2M1KA 3DYOA 1XF1A 1OP5H 4JGMA 4YO0B 4G5ZH 5IQ9B 5D5MB 1M4KA 4UV4L 4XCFL 4NUGH 1DLFH 1KF9B 3SDDB 2QADD 2I07A 3NA9L 3NZ8B 4K8RL 1RJCA 2B0SH 4YHOH 5FO7A 1FNFA 4Z7VE 1WBXA 3GIZH 4TXWA 2NW3B 2C4XA 2BVPB 4N9GA 4X7TB 3SCMC 4AAXA 4KKNA 1W1YA 4X4XB 5DD3H 2EPMX 2OSLA 4W7VA 3W29A 2NZ9C 2VDLL 4KHTH 5DT5A 1GQPA 3W2DH 5B39A 5T33L 3K77A 4PRDA 5EJZB 3N12A 5IFAL 5I1AB 5TE6L 1ZKAA 4RGNB 5I77A 1MFEL 1EO7A 2Z31C 3AYRA 4MA7H 1QNPA 4PJIA 4UV7L 1XYZA 1H0DA 3KXFA 1B4JH 5AYUH 4JM4H 4RGNC 5HHOA 1A6UL 1UT9A 4PGEB 2X4PB 1CENA 3VFUA 4XPFL 2W65B 3FN3A 5E8EA 5EA0H 4LIQH 4M4PA 3GMNA 3H9SA 4E0RB 1TLKA 2OWXA 3E6FA 3WJJC 1A4KB 2P7TA 2XQBH 3BWUC 1RZGB 5DQJA 1KGWA 1CFTA 3ARQA 4HS6B 4X4ZA 4PMVA 3BD3A 3LAFA 4LLYB 3TJEH 2R2BB 3NCJH 2EIZB 4JO3H 2HLAB 4TQEH 1U93A 1MH5A 3QO1A 5C0CA 5JOEA 2BDNL 3LRGA 4LIQE 4Q0XH 1I1YB 2DLGA 5JORB 2VXUL 5DUBA 2EDNA 1PKQA 4XMPH 3NCOA 1G9NC 1HKLH 2F8OA 3SDXF 1CX1A 1FORL 4QDRA 1AMYA 1I1AA 1NMAH 3UJJL 4F58H 3TIDB 4XPAH 4I18A 5JXHA 1LWRA 5E9AA 4Z2GA 3T65B 2XPGA 1ZU8A 4PYHA 4O9HL 2Z31D 1IC5H 4FFYL 3VINA 1SEQH 3MLTB 3QCVH 1FE8L 3D9AL 1F8TL 3RIAF 3LKNB 4MXQC 3D0VA 5I6SA 2FGLA 4MGQA 1NCAL 5LCVH 5F9JA 1ACZA 2BERA 4FXGB 4LPVA 4I4WB 3VXMB 5C0JB 4UQ3A 3THDA 1MRDH 1IC7H 3JXAA 3OGVA 1JGEA 3N0PB 4TVSa 4XXDA 3PP4L 3WFHA 1FL3A 4S1QH 1OL0A 3UTOA 5T3ZD 1ECEA 2HTLC 2IANE 1KOAA 1VGKB 4PUEA 3CD4A 4NQCA 5DMJB 2A0LD 1R3JB 2ZNWA 2BFGA 1WZKA 4PR5B 4X7SH 3FQTB 1CZVA 1MCHA 5HDBE 1DN0A 5F8QC 3IDGB 4UB0H 2XI9A 2CGRH 2OL3B 3CZLA 3EYUL 5I8EB 2CESA 4OZ4A 1XF2B 3N1PC 1QP1A 2CITA 4EJ1C 1QPXA 4D0DB 4ZG1A 4NJ9L 4X7CC 4PBVC 3T2OA 4NT6A 3KPNA 3KYNA 3GSRB 4P23A 1H3VA 4ALAH 5F7NC 5ANMB 4AL8H 1IEHA 2VNCA 3MBXH 3QRGH 1P7QA 3O6KL 2XSAA 5CJQH 3NH7L 5FKAA 3X12A 5EU5A 5GGSA 3GMMA 4KTEH 4QRRE 3SEPA 3BVNA 4QNPF 3ROLA 2YZ1A 1VEOA 1JZ3A 3QB7C 4EUPA 4B9YA 4OAWA 3BRDA 3HG1A 1XGYL 1KJMB 4NCC2 3G08B 5F96H 1GGTA 4JDZB 4GW5A 2J6EL 3L7EA 3WN6A 3G6AA 2XFFA 2FR4B 1B0IA 2OLDA 3IDJA 5E0CA 2GUOB 1C5DB 5F3HA 3FFDA 4AIZA 1ZLVK 4G7VH 2QSQA 1KB9J 3K1KC 3NCYS 4XCCL 2O5ZL 5CGTA 1VESA 4ZAKD 3GHBL 4YDIH 4MB4A 4MNJA 3M6DA 4YHEA 2NTSP 4XX1G 3BAJA 3LQAC 2BNQA 4Z6AT 2BX5A 2QQKH 4LPWA 1S5IH 3D3VB 4MZ3A 4GAFB 6TAAA 1QRNA 3LN5B 1YNKL 3M45A 1GVIA 4YAQA 2I27N 1E6ZA 4AZCB 5I2UA 4DWSD 3V6OA 5I1LB 4OZIF 3F58L 3C8XA 3ARBC 2OTUA 1JCKA 4M7LT 3EOAB 1KUMA 3M8OH 4AXNA 1RK0A 1L7QA 2IANB 3WE6A 3T3ME 5KVFH 5HJ3B 4Y5XA 1Q4NX 1G7MA 3O6FD 4LPTA 1T20A 5T1LB 1NCCH 4NRYB 3KEHA 2AXJA 1FNEA 1AQKL 1TQBB 3HI6L 1T6VN 2P48B 1I7TB 3RUGE 4AQ1B 4F2MA 5MHSD 3JUYA 2PWEA 1SY6H 1Y18A 3LKRA 1JZ8A 2PW1B 4IJ3C 3U82B 5IOPA 2HJKA 2EC9T 4P3CL 1UEMA 3VXSE 4DGVL 1LQ0A 4QCEA 3KWWB 3IJYA 4HPYL 1TVBB 3LKPB 3D85D 3CDZB 1W2PA 3DOSA 4WUUA 1KEML 4YWGL 3TGXA 2IF7A 5BZDA 2OP4H 1KB5L 1BIIA 1T1YA 3ARDB 1KJ2A 2IAMA 1B2YA 4U0QB 2XPKA 1T7VA 1QLEH 2AJSL 2GIYA 3IAGC 4F66A 2DS4A 4OFDA 3VH8A 5HGDA 4E41B 3KS0H 3N9GH 1OM0A 3HRPA 4GI8A 3WF3A 3IRZA 1JAKA 1LL7A 4BQ5A 1DEDA 2QR0A 3U7WH 3PZGA 4MAVA 4S3KA 3CLEH 3QPQD 2VLJB 1OM3H 4V1DA 4YFEA 3CTTA 5ISZA 4HS3A 3LEXA 4U1NA 4Y5XB 3I02A 1SJEA 5HY9A 3OHXB 1H2JA 2WAGA 1IGYB 5CFHA 4Y7EA 1JGVL 4PJBB 2R0ZH 1EJOH 4M02A 2GQHA 4L1DA 3DRTB 5C07E 2QEJA 5IJVA 1YN6A 1U41A 2OXHA 25C8H 2D03H 4JY6A 4Z78B 3D3VA 3P4MB 2BNQB 5E8PB 3QHNA 3ZYZA 2FL5B 3NDYA 1AI1H 5IHRA 1A6WH 3UTTD 4XV0A 4MNQB 4OZFH 4KJYA 3WEMA 2EXYC 4JKLA 4XP1L 2WMGA 1XCWA 4JO4H 4WJ5A 2VMCA 3PZTA 2VXTL 1L8NA 4Z2JA 3KJ6L 4NJAL 1C5DA 2EO1A 5D9MA 3NAAH 3BP4A 1N8ZA 4BH8A 5DJ8B 3O11A 3G6AB 5B38B 3VDCA 2AEPH 2W0LA 4U1HA 1E28B 1I5PA 4KKBD 4WF7A 5EIYB 3HG1B 4C59B 3TO4B 5A8OA 4HIXH 3MRGA 3QNZB 3U7WL 1I8IB 1SHWB 4AT6B 1DQML 2HJFA 1U30A 4UINH 1NOWA 5TPWH 4ZDHB 3H9HB 4QXUH 1QBMH 1N5YL 4MLSA 3W53A 4UILH 4LCYB 5ADOH 4OLUL 2WCAA 2XWEA 4LPXA 4L3EA 3HAEG 1OT2A 4HWZB 4YNYA 2O61A 5KBNC 1RUAH 3AU1A 4NC0B 5DVLA 1LE9A 5GHWH 2KUTA 4LSTH 1FHGA 1FNSH 1GQKA 4NT6B 1YZZA 3EJYD 1L7TL 1KEGL 3M1BA 4DWSB 1HIMH 5I1CL 3ULUL 2CYGA 2HFEA 1QOKA 12E8H 4JG0L 3ZYOA 5C0IA 3RDTB 4PY7A 3A4AA 3MRIB 3L6FB 5CSUA 1JK8B 5D7LD 5CCKH 5GXBB 1ODAA 3DO3A 1I1FB 3MRMA 3LE0A 2PO6C 1ZEAH 1R3JA 2I25N 1HJUA 4N90D 3KLAB 3TLRA 4HV8B 3QJFB 5KVEH 2A3HA 2H2SD 5AD0B 1NUFA 2FYYA 4Q2ZB 1MRFL 5D8JH 2NY3D 3W0KA 4Y16B 1VFMA 4XXDB 3IFOB 3NN8A 2R69H 4H8HA 2FBOJ 1EGJA 4IRJB 5EOQH 1AFVH 3DIFA 2R56H 1EOMA 2XM2A 1HJQA 5DC4B 3NCCB 4AEEA 4DKFH 1VJSA 3IJ9A 3RIFK 4XCEA 1E4KC 1ADQH 2BNQE 4G9FA 4M8UA 5AC5A 2EKSA 4JO1L 4FQJL 4PLOB 4EI5A 1PLGL 4NNYB 3JWOH 3VILA 2P44B 4RE2A 4QRSB 1IQDC 1QBLL 4DZ8B 3AZTA 2NY7H 2E31A 1FAIL 3NPZB 1CLXA 1CI5A 1YYMH 2QLVB 1A7QH 4K8RC 3QEHA 1BBDL 4A2LA 1BVZA 4LEOB 5GGQL 2XOMA 4LDEB 3VXNA 1V6VA 1KWKA 4TRPH 1EEZB 5KS9F 4FQXB 1D5XB 1G94A 4RAVB 2J7CA 3RUGA 5H37H 4JY4B 4S1RL 1J5OL 1NFDA 2MKWA 2UZIL 1UVQA 3QIUA 5GPRA 5C0CB 5CJ8A 1U93B 4URTB 3ARZA 4PJAA 5J57B 2XVGA 2F61A 2J7MA 3GNOA 5IIEA 4LLYA 3SEEA 5DQ9A 3HFMH 2WBJB 3L3IB 4EN3B 4ZMAT 1CFTB 3ZTJG 1CZ1A 4HC1H 4KJWD 4QX2A 3HNVL 2P7TB 3CFCH 4Y4FD 2D7NA 1EVUA 2WMPA 3CSBA 3G6DH 2XV6B 5EBAA 3O6FC 1AHWA 1BM3L 5D93B 3DMMD 4X0VA 4KHTL 1GOMA 5ESVA 1GIGH 3BUYA 4PGEA 4LSSL 4W4OA 1QBBA 5FGCE 5I2IA 5HHOB 2VDKL 1E0OB 4CMHC 2ZXDA 3HJRA 3EDDA 1NMBL 4GFTB 2O9PA 2N1KA 3O3BA 4LHUA 2E27H 1X4ZA 2R1XA 3G6JB 5I71B 1YEEH 5ILTL 1CQKA 1SYVA 1A7QL 5I1AA 3WHE1 4HQQL 4ISVA 3L3JB 1RD6A 4G9FD 4PD4K 2ED7A 2VYRE 2WIIA 4U7KA 3SHSA 2VURA 4L4TE 3QFJB 4NP4L 5TQ0H 1KJ2H 1WWWX 2WNWA 4KK6D 4LHUD 1A3QA 5FO7B 4Y1AB 5FUOL 3RX7A 2CDFA 3KPSA 1VGEH 4WWKD 4NZRH 3FXYA 3CLFL 5IQ7L 4U6YA 2DWDB 5F1OB 1BSIA 1V7MH 4NKOA 3PL6D 3WH5A 15C8H 5SWZB 1VEPA 5IDIA 2X05A 3FQNA 2UYLA 2J22A 1MF2L 4F37F 1WTLA 1BQUA 1MWOA 4GO8A 1XGUA 2ZUUA 5CEXB 4TULH 4JREB 3OKLA 2WN2A 4IIQA 35C8L 2YSSB 5GRZA 3C5JA 1BQHB 4JLRA 4PJDB 5DJZB 1Z9LA 3CMJA 2ZX6A 4HMEA 3U4EB 1JDAA 4DEPC 2EPOA 4R7NA 2A1WL 5GRVL 2V2TA 4MZ2A 5D7JD 4M5YH 3NCMA 1QRNE 1P4IL 2VDML 1WP6A 4K3EL 3AMDA 4EUPG 4IMKC 5JW4R 3T4YB 3PJSB 1RZFL 2QQIA 3GXFA 1NGPL 1YY8A 1KJVA 2VMDA 4K9EC 4XNQB 1J0JA 4U1JA 5A2IH 4DM1A 1TVGA 1C8PA 2BBAA 5DJ2B 4WKFA 2NW0A 3VI4F 4M43H 4D0CB 3LSOB 1FDLL 4JFOB 5DZLA 3KR3H 3X17A 5D2LE 3HZKA 5D7LE 3WFZA 3OPZH 3KPRB 4PP1C 3WFDH 1KBKA 2XRAH 4L5FL 4ZFOB 1CLYL 1QFWM 3LD8C 4M5ZH 1UWGL 2FH8A 2H2PD 4FFWD 3NA9H 5ABFB 3NFNB 4LOUC 5CQ1A 1KPVB 4X8JA 4R2GC 2ZXBA 1JPST 4Z7UF 1YPZF 3M17B 3ARUA 4FQLH 4XI5C 1XIWA 2HN7A 2XFXA 4W68A 2ITDB 4ORGB 3GSQA 5JHDE 1PJ9A 5DD5L 4NM4L 3K8KA 1U8JA 5FYJE 2I5YL 4WV1B 2J79A 5CIPH 5JPNB 1R85A 1CLOL 3HLAA 3S37H 1T3FA 2AGJH 3OKNA 4PJAF 5J3HC 3QXAB 3TEUA 5E8NB 3ARBD 5FHBL 3T09A 4KROB 3IB4A 3BLKA 2PB1A 2CLRA 3QDGB 4RN5A 1QI4A 3MRNA 1T1ZA 2E32A 4BJLA 2ZOKB 3CNKA 3QDMA 4NOBA 3RWEB 4IPNB 1CL7I 3D3AA 3QIWA 4TUOB 4U6VH 2WUBL 4PJ8C 1K8DA 2VN7A 2NY6D 1KR0A 1ZLUK 3FFCB 4ATDA 2DI8A 1U8HB 1X7QB 3MV9E 2A6IA 3WO3B 3VIGA 1UR1A 1C08A 1D6EA 4JO3L 2ZWZA 1JGLL 3OAYK 3MC0A 2R2HA 4I9WD 4GG6F 1E70M 1TJHL 1G9HA 1WFTA 1QHOA 4A4AA 1XCQA 2EE3A 3NYDA 1P84J 4LCIL 4GBXC 4WUUD 4YXHH 4OFKA 1RFDH 1ESWA 2FH6A 2YPLD 3MRDB 3ZL4L 1T21B 3O6LH 2QSVA 4BQCA 3ZE1F 5D1QD 3L9RA 3V6ZB 5D2LB 4AD5A 1FG2A 3K81A 1BTCA 3G5YB 4OTXH 5EIQA 4N1CA 3MLZH 1NFDF 1MLBB 2ZNXA 4PRBA 1WB0A 1OHQA 4NBYB 4WFFE 1K2DB 5ABEA 2ARJB 2CBUA 3SGKC 3T1FA 3O3AA 1WJ3A 1A1OA 1U8LA 4XC1L 5DO2D 4UV7H 4J8RB 1U3HB 1AIFA 1QSEB 4J27A 3O6FA 3NDZA 3IT8D 4U6VL 1BJ8A 5EC2B 5T1KB 3RU8H 3DHJA 1KLFA 1AQ0A 2X4RB 4AZIA 3GKZA 1HHGB 1V6YA 3EZ8A 4YXKH 3JTSB 3U1SL 5FL1A 1J0YA 4GPNA 3CFJB 2DSZA 2PWDA 3CCHB 3MUJA 4GAYB 4I2XE 1XR9B 2O5YH 1PZ3A 1KV3A 3MRPA 2L7JA 1U3YA 3GKWL 2P5EA 1NGXA 5C0GA 1ZHKA 4HKJB 1PKOA 2Q7YA 5IMKB 2VC2H 4MCZB 2VX4A 5TGBB 4N90E 2P8PB 2MQ3A 5DYOB 4IOIB 3TBYA 3KLDA 3OXSB 2YBRB 4R26L 1D5MB 1UWIA 1YMMB 1T4KA 1AGDB 4XPAL 4OGYL 4LLWB 1BG4A 3D85A 1MJ7L 5GNZA 1XGQB 4LKCA 2VVSA 1U8IA 3E3QE 4DWSC 3AI0A 3CIQA 3ZKXC 4XC3H 3MNZB 4CKVX 1KNOA 1FVDB 1QSVA 4JG1L 2YD8A 4Y4FC 1FH8A 4XI5D 3ALGA 1BVNP 1JU4A 2NYYC 3C9NA 4M6OL 2F8VA 1IZKA 1P5VA 4HAGA 1IZJA 2V2WB 1H8NA 1EMTH 5LGHL 5EN2B 4N8VA 4MPKA 4PLNC 2YZ8A 1MRCH 1E4JA 5GS0L 3GHBH 4YDIL 1HP5A 4MNHA 4F80A 5F7LB 1OSZB 5MERA 1T2JA 1YNLL 2Y23A 3RGVC 3NABH 2VCBA 1N7MH 2DD8H 1C7SA 1ZHNB 3PZOA 4FF5A 3V52H 3K4AA 4UT6L 4ZFMA 2DT0A 1RULL 3BD5A 1IQWH 4NZUL 4OKVA 3FQXB 2E7LC 4LNVA 4P46A 4L8DA 4NHUA 5IWLA 3BPNB 4WEBH 1S78D 4RGNE 3QH3A 7A3HA 2FATL 4OMCA 2V5RA 4AG4A 3QQ9D 2CDEB 2CCRA 2IH1B 5GS1A 4O58L 5JXED 4TVCA 2WWMD 3GSNB 4OCYH 2WZ8A 4UILL 5E9DE 3RWCA 2DM3A 2CDEA 2BVDA 3ULVL 4PRNB 3W37A 2ESVB 3JV0A 3MV7E 1XGPA 1A7PL 2ICCA 2Z93A 3WCYA 1II4E 3ZYIA 5JHDA 1MCKA 1CBGA 4HA4A 4B16A 4DTGH 1RYYA 2NY2D 3V8CA 2C4FU 3VFRA 3HB3C 1QFWL 1W2KT 1K45A 3WS6C 1P4LA 3GSXA 5D72L 2NY6B 1BD2B 4OKVB 3QXVA 4L8SB 3W11C 2NY4D 4OLZL 3OGCB 3RVWD 3OSKA 4WIQA 2QJDA 4OCSH 1YMME 1UM5L 3BXNB 5LWYL 2VLKA 1K4CA 2VI0A 4H1LG 1F3RB 1ZMYA 4HPGA 2H9GB 4FG6D 1D2KA 3MR9B 4V1DD 2FEEI 3GDBA 3QIBB 3VXUA 5EN2A 3LHPH 4YJZL 3RL1A 4M81A 2X2YA 4HXAH 3G6LA 2GCYA 4OLXH 2YMXH 5JXIA 4J6RL 1B4RA 3VD9A 5DRWA 5CJXA 1CDYA 3JWOC 3GRWH 1FVDA 4NRXB 1H5BA 3VA2C 1SG3A 3IXAB 1E5NA 3MRKA 3ETPA 3S5LG 5C0ND 2EYRB 4PJ5B 1FNGB 1DR9A 1IC4L 2XTJC 1RP9A 2KKQA 1OGTB 3LPPA 4Z2KA 1U8OA 1AGDA 3O8XA 1FO0H 1UWXH 2KZWA 3RNQB 2YBRA 3OXSA 1HX0A 1JV5A 2NY0D 4MAUL 5CJOH 3IVKA 4H7VA 2V17H 3H3PL 4P46C 2J1VA 3GI9H 4MA1C 1G7HB 4D9LL 5BQ7B 4G43B 4ODHH 4EIZC 4A6YL 2FIRT 5I0DA 5IHLB 2WSPA 3C09B 1CIDA 2WQ8A 1S5HB 1Z3GL 3AIUA 4QTIH 4JHZA 1HWHB 3NJXA 4BA0A 5E95B 4M62L 1JIBA 2D9QB 2Z31A 5DMGC 5ID1B 5KTEL 5I15H 3U7YH 1CXHA 3VGAC 3AJ7A 5DFWH 2L4OA 5DK2A 1MFNA 4MHHI 3N04A 3SPVB 3DVGA 4OZHA 2DDQH 1QW9A 3ARDC 2ZEXA 5JMOA 4ZOBA 2OL3H 4HKZB 4P9MH 4WEBL 2JIXB 5E4EB 4EVNB 2F5AL 5E2WL 4O2EA 1Q6FA 4DXTA 2Y5TA 1GGUA 5JPMA 2YEZB 1AIFB 4AD1A 4OCLC 3HTLX 3UROR 2E40A 1A3LL 5TE4H 5DURB 4F57H 2CETA 1A1OB 2EE2A 4O2FB 3WHXA 1YEFL 1DBKL 3EYSL 3T1FB 3VI3F 4N5ED 3I50H 1RP8A 3S37X 3ULVH 4G8GA 1A7BA 4JHBA 1FAKT 5DJXB 1US2A 5HGAB 3O4LD 3KLHD 3GBMH 5JBDA 3LS5H 2WYSA 4KI5E 4DK3A 4OZHE 1NC2B 2CIKB 3UG4A 2R4SL 5L8KB 3SO5A 4O51B 2WVTA 2CKSA 2X4TB 1FZOA 5GNXA 1U91A 1OAYH 4PT6A 1M71B 3PWPE 3CZFA 4WW2B 3E1F1 4QXWA 3OKMA 4D1IA 3S3PA 2NW2B 3C08H 4ODSL 4AG4H 3VFGH 2J47A 1QFHA 3IDYB 3LQAH 5IHZB 3UBXA 2A6IB 1P9MA 1ZE3C 1SJXA 2EDRA 2EYTB 2XNAB 1AKJD 1ZHBA 2RCSH 1XR8B 3BT2L 1LK2A 4WRLA 4U1MB 3TZVD 3U4BL 4QB1A 1B3YA 3L2MA 2VT0A 2W07A 3RJDA 3QP3A 4M80A 4TXEA 4XVJL 3TM6A 1EERB 2HMIC 5EU6D 4MMXC 3BIKA 3UYOD 3RVUD 1JYWA 3PUIA 4ODBD 2AJ3B 3U4AA 4TNVF 2FECL 2VH5L 4PJGF 1T3FB 3RHWF 1B4JL 5HGHB 3WUGA 4D6JA 4F7TB 1C90A 3O4LE 4NO0B 3UTTE 1RZKH 2NY2B 4YHML 3TVMC 1N2RA 4XPGL 5LA2A 4NSBA 1CU4H 5ICYA 4OIIH 1QI2A 5I1HL 2BRQA 3FTGA 5TDNB 2HFGL 1KQZA 5EO9A 4ZXBD 4BZ2L 2UUDK 1I9RH 1KT2B 4J28A 4X8JB 4ACYA 4OLWH 1YYLH 3ET9F 3ULSB 1QRKA 5IROC 1BAFH 4ZYKA 2UY3A 3RJYA 5ABFA 3BP5A 3HNYM 3LEIA 1CDBA 1E6XM 4EOWL 1GJUA 3QWOA 3VPLA 4OD2B 1JJUA 4JZOA 4ODXB 2D31A 4DEPB 3KYAA 5IBUB 3NZHL 1WC7A 2HT4D 4HKBA 1JZ5A 3LSOA 2D9CA 1G0YR 1LO4L 1TQBC 2X1OA 5A95A 1ACYL 5JIWA 4CCDA 4C57C 5F97E 1MFAL 3KPRD 4WFEE 1WE5A 1ZAGA 4XHQA 4R0LA 3HI5H 5FOBB 1VFUA 1WC7B 5MENE 4R97C 3AVEA 4RFOL 2AJYH 1DLCA 3LKSB 4P2YA 4UOW0 1P6WA 3I75B 1PMHX 3PJSA 3VD3A 3A3HA 4PRHB 2VVNA 4KJWC 1KCSL 4OCRH 4R90H 4I77L 4CBPA 2AKRB 1G0DA 2ZX5A 4PREA 4KDTC 1MQRA 3CLWA 4P5MB 4KK5D 2VJXA 2R4RL 3REWB 3T0VA 1NDMA 5ADPL 2YSSA 4X6BB 4WFGD 3OKLB 2W0PA 1RIVL 2YLLA 5ICYB 3EYPA 5M95B 3RGVA 4MNQE 3FMGL 3F7VA 3ULUD 4MJIA 3AIBA 5GGVH 2UYLB 4NO0A 2VERN 4F7TA 5MHSE 3VXSB 4X4MA 2A6KB 5TE7H 3KL0A 4W6XB 1Z9MA 5IHSA 3FQRB 5DD6B 3BHBB 1OCWL 4G6JL 2V9QA 4X9IA 4MA3B 2X4QA 3PWJB 4G8FB 5JXJA 4LPLA 4GUPB 5LYRA 1EFXD 4DGYH 3V6FA 4GKOA 5IFTA 3B5HA 1YDPB 1X5XA 3TWCH 3PWLA 1SYVB 1UADC 5D70L 3W38A 3MMWA 2EYTA 2J77A 1MUJB 3KG5A 3AROA 3DRQA 3A67L 4HUWB 4U05A 1KCSH 5HVHC 4KRLB 4OF0A 5MI0B 2J25A 2XGIA 1YJDH 1CECA 5EZLA 1UENA 2ZZUT 1V7NH 3MYJB 4UFIA 5TH2A 1EH9A 1Q6EA 4Z77B 3UAJC 1CZSA 5DHYA 5J6HA 2DTML 4PJCB 3MJ8A 3W5MA 5I66B 1FP8A 5A2KH 5FYKD 5BW7C 5B4MD 4U7MA 1BBJB 1LD9B 5DQ9B 4JFQB 1Q1JL 3BEWA 4XRCA 3MRCB 3I6LD 4G42B 4G5ZL 3DSNA 3VW3H 4BQ3A 3ULUF 4G8GB 3BWAA 3QA3B 4POUB 3MCKA 5FYLD 3OGRA 4JY4A 4OSUH 3RUGB 4U7SA 3IJ7A 1EEZA 1T2QL 3CGTA 4AIOA 1N0LA 4ODTH 4P5YA 5EZOH 4HIJB 4OI9A 4F58L 1F58H 3BN3B 4GRWH 1A1MB 5LG1A 1YECL 3ZOAA 4E41D 2YRLA 4F7EB 4E2OA 3ACFA 4XVUD 3CZ8A 2VDLH 4NNXB 2A9NL 4H88H 3T04D 2VISA 1HK6A 4NRZB 3DMMC 5KS9A 4JR9L 3L3KB 2IWGA 3ARBA 5IVZA 3BZEB 3UTSD 2JB6A 2X4UB 4OGYH 5KN5A 4Z2LA 1ZT4B 3EO1B 2GY5A 1MJJA 3HG1E 2B1AH 3WFBL 1WQVT 1UZ1A 3MRLB 4IDJL 1ORSB 2WUBH 2XXMB 2YBTA 3DIFB 5FYLL 4C55A 3ZQ9A 2W59A 3PWUA 3MLUH 1LO2H 2Z92A 1NGYA 4BYHA 5AD0A 4OCXH 5EUOF 1GZQA 2DLHA 2DYPD 1CIUA 1E72M 3MLRH 1U3ZA 2VLJE 2FHCA 7FABL 5T5FH 1UZ4A 3VDBA 5D1XB 5LBSH 4K23H 4ZD3L 1ETZA 1XF5A 4P4KB 4PY7B 1ES0B 1CWYA 1OGGA 1LGVA 4XB8A 1JHTA 3GJFA 5EH1A 1YN7A 4LSRL 1P8JA 1GOHA 4RAUB 4FNLL 3M1BB 2VXUH 1IKNA 3W39B 3U46A 1QD0A 3UERA 5HHOE 4HS8H 3TBVA 2W0FA 4Z0BH 2CMRL 2G60L 5C3TA 4NFCA 1UWXK 1BAGA 1J7VR 3THCA 1CWVA 1I8LA 3CH1A 1K8IB 5KJRH 1C91A 2WC4A 4LHQB 5HI5C 4AT6A 4R4BA 1B30A 4AK1A 4MDPA 3LB6C 3AMLA 1AO7B 4KK9C 3QNZA 3TO4A 1YEKL 4JFDD 3RWGA 4AQOA 4L8SA 5JUVA 3B83A 5E2VL 1UY0A 3IDYC 1S9XA 3O11B 1BD2A 2LU3A 4HUVB 3BP4B 4OCWH 4XZUA 4PYGA 3AHTA 1V0MA 2WANA 4TUKL 2EXWD 2KH2B 2X4OA 2C3XA 2JIEA 3VIFA 2YR3A 2IH3A 3BP6A 1EQPA 3OX8A 5LA0A 1DQTA 1J1OH 1GH7A 4MD4A 1XGPB 3HNSH 5JHDB 3PL6A 1HP4A 5BRQA 4LHJB 3HPJA 2CGRL 1AQHA 2AXFB 2HVJA 2J8UA 4HUXA 4LLDA 3TV3H 1JTPA 3SIMA 5MP6H 3C8KB 4RX4D 4OQ1A 4TVPE 2LTQC 3HZVB 5C0BA 3WKNA 4QXGL 4JB9L 1AD0A 1FNAA 2ATPB 4X99B 3CUIA 3ZL4H 4HBCL 1MI5A 5HVFB 1JGDA 2PYFA 4FXLA 2HYXA 3PUCA 4MQTB 4XNZC 5F44A 3RUGF 2AVGA 3MRBA 5CD5C 4WY7H 4KTEL 1GYAA 4FZEH 1SBSH 2BVQA 3WMBA 3HMXH 5BMFL 3VRLE 4GXPA 3JV4B 4QP0A 2QR0B 1DQJB 4MNHB 5GRUL 4CU7A 4R3SB 1UWEH 1WZLA 5FF6A 1ZVHA 4ZAKC 3RILA 3FN0H 4H25B 1MFDH 5IBLD 4M6OH 1MQPA 2PTUA 2Y64A 3D18A 3VGAB 1OH4A 2EBNA 1WDRA 1HIML 3AXHA 3T0AA 2ZCHH 2PXYD 3VIJA 4I5BA 5JDJA 5FYLE 4NQXB 4OM1H 5BV7C 3BSGA 3RWDB 4WW2F 4V2BA 4HIIA 1REIA 4I5BB 1TVBA 2D7OA 3LKPA 5DLMH 4MMZC 3V4VH 4ACPA 3T77A 5EZIH 4M3KB 4WHCA 3RGHA 2DN7A 4B41A 5MEOB 3WO4B 4AENB 5F6IC 2P8PA 5DYOA 1E73M 2HJKB 3SO3B 3L3HB 1GOOA 5IOPB 3S96B 1QR4A 1OF2B 1FO0A 5ALCH 1NCWH 1D5IL 4Y89A 1Y18B 2NY1B 3GK8H 5CXPA 3SKVA 3TC9A 4OT1H 3M8OL 3MXVH 5JXEC 3JV4A 3P77A 1WKYA 3NSXA 2PYEE 5HJ3A 1XR9A 1JGDB 4UFMA 2W60B 1QBLH 3RL2B 2CRIA 4NRRA 3OKDA 1MI5B 4HULB 4JFWA 3SKMA 1Q38A 4HW6A 3QXTA 4DJMA 1HHGA 2VUOA 1T89A 1C8YA 3MROA 1AD0B 2GJXA 3ZKMC 3KPPB 3HZVA 5C0BB 4AZCA 3BQUC 5DWUL 4U49A 2BOCA 1P9MC 2OR9L 4YAQB 1LMKA 2CLZA 4HK3N 3C8KA 3W82A 3TNMA 4PTVA 1NBQA 1CL7L 3OKKB 1IGJA 4DKEL 5AG8A 4LSVL 1H1NA 5JO5B 2HVJB 2AXFA 2J8UB 1U3HA 4JVPA 2VDOL 2QHRL 4R96A 1U8LB 1CPUA 4MD4B 1OAQH 3AIQA 2IH3B 2MHAB 3ULUE 4NQEE 2GUOA 4YUEH 1MCCA 1YUHB 1MREH 1MLBA 1U8MB 4Z95H 5KSVB 4EAMA 3VGFA 2WWKT 1MIEL 4PTTB 1AXSA 3SDAD 1CXFA 1VEMA 2AEQL 5IKCA 3QUYC 4NO2A 4LRNH 5B3NA 1NFKA 1EEUA 4PF1A 1QA9B 5H35A 1MQKH 4JQXC 3C2SA 4BQ6A 2EH8H 5E7FA 4W88A 3ROLB 2XTJD 3T3PF 1K8IA 2QF8A 3PWPA 1RUML 4RSVA 1UA7A 5A6MA 2BP3A 5JQ6L 3O2WL 1LLOA 2AJVH 4FQCL 1SFSA 5KSBE 1BFVL 2XGBA 1FGNL 5EC1A 1JF5A 1R3IL 3JSSA 2G2RB 4MNGE 4GMSH 2GFBA 5DS8A 1Q72H 2ITCB 2Y5EA 5DRZB 3W39A 1HL8A 1VENA 2APFA 1OP3H 1G9MH 4KJPC 5F8RC 1VF8A 5HPCA 5FUOH 2J1UA 1I9RL 4UDUA 2R29L 43CAB 3RY6C 1CTNA 1JNLL 3QDGA 3I2JA 3ZKSD 1MJUL 4YLQT 3U0PA 4V27A 4PJAE 2GJ6E 3KGRA 4D0QA 5EBMB 3SCVA 1NGYB 2IJ0C 2H45A 1OWRM 4Y19A 4GZ9A 3IU3A 1ZK9A 3BGAA 3GNPA 1JU3A 1JGEB 5E2WH 4JX0A 2ZCLL 3KYKH 4ORGA 3HMCA 2E9IA 1OAKL 1DBAH 1UXXX 1XIWB 2XWTB 1NKRA 4F15C 5F9JB 3QI9C 3UC0H 1P4IH 2VDMH 4NKDB 1MJJB 2W9XA 1ZT4A 4QLRA 1QSFB 2C1PA 5IVZB 4CN6A 5HHVH 3VXTB 4U1SB 2ZSWB 3OZOA 2QADC 2JJUA 2NT0A 4I18B 2IFFH 3BFOA 3SCRA 5I71C 2C4FT 1JPSL 1LP9B 1A1MA 4LVNB 3F6LA 4MXVE 8FABA 4HIJA 4JPIB 4D0CA 2EDKA 4KHXH 1B3WA 2YD2A 1QYGL 4HXBL 5GIRA 5GJTL 4Z7VF 2HRPL 1G7JA 1RZ7L 1UXWA 3LH2H 2E9LA 1OVZA 4HLZG 1IFHL 2HLAA 3NCFB 2FEDC 4ZENA 5IW1A 4N0FA 3T4YA 2VOTA 3BD4A 3C5SA 1RJZA 4Z95L 2Z35A 4ZZ8A 5F9DC 3SKUD 1I7RB 4P4KC 3BO8B 2IFGA 4M7KH 1FL5A 4KDWA 2VDQL 4N8VG 5JDSA 5E1AA 4JL2A 1FVCA 4M3JA 2X4PA 3QUXB 1W9XA 1BJ1J 4E5XB 4WUKL 1XGUB 1LG2A 2Q7NA 4CU9A 1PEZA 3RTQC 2FWOA 4X6DA 5EUOB 4HUWA 1LO3L 1ZLUH 2CPUA 2Z9TA 1INQA 1L0YA 4QHLB 3SY0B 1K6QL 4LQFL 1MUJA 1KULA 1W1PA 1RU9L 3EO0A 1T66C 1E6PA 1LQSR 5B8CB 5DVOA 1NMCC 5CP3H 1HILB 4GQ9L 1IAIH 4BUHA 4DUVA 3ILPB 4WW1B 1KIUA 4Y1AA 5CG0A 3I2CL 1BFSA 1FVEA 3W6MA 3GHEH 2NW3A 2HLFD 2K9UA 1JHLL 3PWJA 4TRPL 4PG2A 5E08H 4HG4K 1XH3B 2UZIH 3LEGA 1HILA 2D7MA 4RISL 1J83A 3ARGD 3I3EA 4EOWH 5IQ9A 4YE4L 1R8LA 2WBWB 3SUTA 3SY0A 4U33A 4JJ5B 3O3BB 5FAAA 2V3DA 4CRPA 1CG9A 3TCLA 3CIVA 3BH4A 3Q6GL 4P02B 1D3CA 5I2IB 4KK9D 5FB8A 5HPMA 4FQPA 5A6AA 1R5WB 1LP9E 1EXPA 1IM9D 1NDMB 4LDLB 5ESVB 2B4CH 1ADQA 1AHWB 3REWA 1KB9K 4Z7UE 2OK0L 1NSNL 1K3ZA 5LAXA 4XBEH 4JM2C 4P5MA 1I7RA 1IEBA 4W6WB 4NQEA 1RJZB 1ZHLB 2WBJA 3L3IA 5I76B 4N0FB 4HLJA 2J1AA 1D5BA 3AAZA 2DLFH 4I77H 3K74B 1O7AA 2YXMA 4PJDF 4EN3D 5FO9B 1C92A 4LSQH 1UKQA 1IGFL 3STZB 5C7XL 3O41A 3T3MF 3L5XL 3RWIA 1TETH 4FQXA 1RUQL 3CPUA 3S3SA 2H1PL 3GBDA 5CPTA 5FUZL 1XEDA 3QEGH 1P4BL 2PO6D 4C4KT 4CMMA 1LP9A 2BK8A 1QNZL 1V3MA 3QHFL 3WHE0 2CRZA 3WY1A 2D31B 3HUJA 5GGVY 3SGDH 2W5FA 3CZUA 3V5KB 4WWKC 3HR5A 3IS0X 4DZ8A 4YDVA 4DN4H 4P00B 4Q0XL 1JRHL 4C56D 3SUUA 1O7VA 5DI8B 2J1KA 3MODH 1IGML 1JAEA 4Y4KD 2C3VA 3S6TA 2DM2A 3OAYH 1HYRC 4JFXB 4CAGA 5CSBA 2Z4FA 1JZ7A 1VJZA 1LL6A 2OK0H 3VFSB 2BVOA 3DTXB 4L9LA 3QULB 1MAKA 3WKMH 2H8PB 4NNPH 1CLOH 1U8PB 2X1PA 3IU3B 2ZWYA 5C8BB 2FYYB 4Q2ZA 5M5DA 5J3HD 1DUYA 2J8FA 3AC0A 2XM1A 5J6GB 2Y6KA 3SDXA 3T4AA 4NRSA 1AJ7L 1F97A 1I1XA 3C5ZC 1ROWA 1G7IA 2ORXA 5C2BL 1D7FA 5AYUL 1R64A 2ESVD 2EDTA 3MZGB 4UDUB 43CAA 3OLGA 3O3DA 4PV8A 3UPCA 1DVFB 2N7BA 3D6GA 3GH7A 1LK2B 2HFEB 3LIZL 4PPTA 1MCQA 1MQ8A 4CUAA 2DQTL 1BD2D 5CSZB 2XNAA 1CXEA 4HBQA 2ITCA 3NRUA 2BXYA 4JFYB 3JXSA 4WU7B 3GJFH 4JFDA 5EC1B 3OPZL 3WXWH 2NW2A 5I18H 4K94H 1GJIA 2J7DA 4YGVA 2BHYA 3RWHB 2HTKC 5A3IC 3MA7B 4W5ZA 3JV5A 3CZFB 4WW2A 3ULVD 1XNAA 2QKIB 2HJFB 4GKSB 1U91B 3X3FL 4QRQB 5JNYA 2DRUA 3MRGB 3DHUA 1IQWL 4NKMA 1J12A 4NO2B 1NC2A 3V4UH 2Q8AL 4OTXL 4LCCC 4U1HB 2A9NH 4UDTB 4QHNB 4EQ2A 1DBJL 3WNKA 3L4UA 3UJTH 1MAMH 1VRXA 5SX4H 5HGAA 5HHOD 2P5WB 3CK0H 2NNAB 2MHAA 1ZOXA 3P9MB 1RJYA 4DVRL 1NBVH 1EDQA 1PFCA 5B3JF 2JDAA 2ILLA 1SEQL 1F90L 1UQSA 3QCVL 1KYOJ 5HGGS 2JIWA 4OCMC 2XA8L 2YEZA 4X0KA