5CZKA

Structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
603
structure length
600
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Inhibition of Microbiome beta-Glucuronidases Essential to the Alleviation of Cancer Drug Toxicity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-glucuronidase
total genus 193
structure length 600
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czkA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5czkA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5czkA03
2E9WA 3C5ZB 1GQIA 3B2VH 3A67L 4LCUB 3ZKND 2CHOA 2CR6A 5C0CD 4TX8A 3BFOA 2NX5A 3ZE0F 3GI8L 2YB7A 2GFBB 3QA3B 2V38A 5A3HA 2DL2A 3WS3B 5F7EH 1KPRA 1M04A 2CJUH 2FLBT 4DTGL 1JE6A 1UWEL 3HI5H 3UDWC 1VADB 5C0GA 1YEHL 3OX8B 2XN9A 2FHBA 4BFGA 3QG6B 4E5XA 5I73C 1KGWA 3WJLA 4RZCA 1GC1C 1MFAH 4P2CG 3RVUC 4ZYKA 4F80A 4IRSB 3D85A 3SN6N 5EPMB 3MKKA 3CFDA 4PTUB 2MQCA 3ULUL 1LE5A 1RJYA 3NH7H 3N1GC 3Q48A 4ZQKB 1A7RL 2IBZY 3B9DA 3LV3B 3V5HB 1DQML 1YUHB 5J11B 3BN9D 3B8SA 5ISZB 3UBXA 1PX8A 3SUUA 3SDCC 1E73M 2CPUA 1X5FA 3TBWB 5MI0B 1JHKL 2ATPB 4P5MB 4S10A 2YA0A 3RWCB 4QF1A 5ACZB 4MXWL 1KQYA 3D0LB 4LCWE 5I6XC 3ALGA 2DN7A 3LZFL 3ZTJH 4WDIB 4X6DF 5GSRB 3C60C 5LXGL 4YX2H 3FQWA 4JN1H 3DROB 7FABL 2ZWLT 5DEFB 3WO4B 3T2NL 5KSAB 3WO3B 1UADC 1K8IB 4HT1H 4FLOA 4B53A 5GGTL 2A3AA 1CBVH 4JANA 3I75B 2I27N 3OKMB 3Q5TA 1NC4B 5FHBH 3A6BH 3ZE1E 3T1WA 4BZ2L 1CICB 1Z3GH 1F45A 2GJJA 2CBIA 3R8QA 4DKDC 1NGWA 4QNPE 5E9DB 2JCCA 2KQMA 2HN7A 4FZ8H 4FQHB 3CLEL 1E6OH 1X5AA 2YPLD 5IVZA 5ICYA 1P6AB 5HHNA 4F37F 1XF2A 1ZSDA 2VAJA 4QRRA 1QNPA 5T3XL 2ZXQA 1RH9A 1R5IB 2P5WB 2VL5A 3MXVH 1JGDB 3C09C 1AGDB 5BXSA 1WLHA 4FG6C 4XNYH 3SDXF 3VD3A 2ENSA 1EEZB 3MZTA 1BGXH 1MCIA 4PRID 4J6RH 4NGHL 4AEEA 2BDNL 4M62L 3KL5A 5LCVL 2BVYA 3T0EE 4IHOA 3UG5A 1GCYA 2B8OT 2FZ3A 4M29A 3G6DH 2V2XA 3QB7C 2OK0L 1ZAGA 3OPZL 1CDJA 1YEEL 4YO0B 1S7TA 2P5EA 1MCBA 2RCSL 3D2UD 4KROC 1FP8A 4MNQE 1H3PH 4ODUA 4BQ8A 3ZL4H 1QRND 2D22A 1PX3A 1ZEAH 3K0WA 2W07A 3GMLA 1GONA 3NA4A 2JJSC 3BN3B 3B2VL 4U7SA 2BGOA 2ZEYA 3LN5A 5F1SA 2W61A 3EIFA 4O02L 3ZTNL 1R3JA 2YD9A 2D20A 4AAXA 4Y7MA 4LNRA 2YPLA 1PZ2A 1E43A 4DM2A 3AJ7A 3HUJE 1YEKL 3QO0B 4HIEA 4MNKA 3SE9H 4HPYH 4TX6A 3F7VB 4H04A 2F54A 2DSKA 3FHAA 3C5JB 2OYMA 3GHBL 2DQFA 3DX7B 2WANA 1QSFE 2FWOA 4PJ8A 5DD6B 5EIYB 5HI5D 2WQRA 3ULUH 3SGEI 4W89A 3E3QE 4RFNC 4ODVH 3DHJA 4JZNB 1UJ3B 4LARL 1HOCB 4NCC1 4HPOL 2IFFL 1EEYA 3QIBA 3QEQB 1DWHM 2G3JA 2JJSA 3QFJD 1CGTA 5ANMB 2EH8L 3HMXH 1LDPL 4RFEA 1NOWA 5HDBF 2YUWA 3V2AR 1CE6A 3VILA 2DTML 1TMCB 4APQA 1C16B 2WPGA 4F7CB 2NY0C 2X44D 2GHWB 5CBEB 3KPNB 4NNYA 1QZ1A 3DVGB 3TBTA 1D6VH 2YG0A 2HJLB 1U9KA 4O58L 5J56B 5FECA 2Y64A 4P4RB 5GGSY 3OZOA 3WQ8A 5IHUH 5D7JD 3AS0A 3QHZH 5HYFA 1DEEA 2IWGA 4S1SL 2V3FA 2DSWA 3MNVB 2VMFA 1JPGB 2CDOA 3IJSB 1EBPA 1MEXH 1OAUL 1RVFH 5B38A 4YFEA 4LU5L 2E6PA 2VXUH 5IOPB 3M6DA 3CDYA 3D85D 4QB1A 3WD4A 4YR6A 1SJVA 5DJ8B 1R86A 5FHBL 3A6BL 1MCJA 4S0TD 3CMGA 4YZFE 3II1A 4YAQA 5E4IA 3UETA 4PLJC 3TM6A 1KJ2L 3VPLA 3OKKB 3SDDC 3WUBA 3TFKD 4MD4B 3NJXA 3QIUD 3CFEB 3TJEL 1UY1A 2W65A 5D9NA 4U1NA 1OGAA 1E6OL 3REVA 3AIRA 4F33A 2G9HA 1S9VB 2W38A 3SDXA 1QI4A 1AKJD 3IJSA 3GRWL 3KPMB 3EDKA 4NQVA 1HNGA 3CZUA 3PP3H 2OJEB 3GSUA 3VIFA 3FFDB 5F9WB 2Y8VA 3RIFF 3S98A 5EORH 1EFXD 3C6LD 3C60A 4XNYL 3L4ZA 3F65A 1UXWB 1Y18A 1QNOA 4PR5B 4FQQB 4FNLH 5BRZD 4WV1C 5HVHC 1UJTA 3DGGA 4NO3A 4LLVA 2VLKE 3DGGB 4NO3B 5I1HL 2R0WH 4EOWH 2OSLB 1NL0L 3CZFB 25C8H 3OPZH 4GUPA 4OCSL 2WMGA 4HUWB 1G7IB 4U2ZA 2WC4A 1MQ8A 1HSAA 4AEIH 2FSEA 5DQ9B 5ERWA 1WB0A 4XMPH 2V7NB 4WLCA 2OQJB 2VISA 1DQDH 1K2DB 3SJVA 5ABFA 1RMFH 3U36B 3PABA 1YY9C 4QOKA 3UDWA 3M8OL 4LQFH 5DK0A 3C8KB 1XMWA 3FN9A 3GJFB 1JGEB 6FABH 2WO2A 1I1YA 2K9UA 5DMKB 5IW1B 1DSFL 4JFSA 2XZAL 2YUXA 1QA9B 3M45A 2VIRA 4G80B 5A2LH 1YEKH 3JV5A 1UA6H 4U7MA 4U5KA 4KRPD 3S7GA 2YFUA 1B0RB 1VDGA 2I9LA 3N85H 1KYOJ 3O4LD 4NC1C 3MO1A 4QWWD 4V1DD 3IDGB 4U6XA 4MXQD 4WFED 1Z2KA 3MV7D 1QI3A 1GOKA 3QPXH 3TTQA 3BPOC 1CLYH 4PRHB 3AXIA 3ME0A 2R56L 4XC3H 1LGVA 5ILTL 3AIVA 4W50A 1PBYA 5EULV 2G3MA 2A1WL 4YEEA 1S78C 2XIDA 1QEWA 3C08H 3T77B 3X12B 4A4AA 2O9TA 4QHKI 4TQEL 2Q86A 3QIUB 2IPUG 3EYOB 2R2EA 1QSEA 1QUNA 1MELA 4NQCA 3VCLB 3DHUA 5A6KA 4RMUA 4LKSA 3RWEA 3ARXA 1VACA 2AJYL 3C09B 5F1IB 3MLSL 4HTYA 1M05B 2VZVA 3QDAA 1XGZA 1ISWA 5E9DD 3EDFA 2A77L 1MQQA 4OF6A 1RUKH 1FL3B 4WWKA 2IAMB 4MXVE 1AY1L 5I1LA 5A16B 2PXYA 4ZG1A 4GO8A 4RAVA 2GVYA 1OB1B 5E2VL 4QB6A 1QBMH 4PJXB 3L5WA 2J22A 2JCCB 2IGFL 4NKIH 5E5MA 1RUAH 1W0NA 4LEXH 4B7IA 5INCA 1B1YA 2GDVA 4TUFA 3OKMA 4C56D 2VZTA 3EYFB 1K8IA 3OR7B 3LSOA 3I02B 2GJRA 2DEPA 3DIFB 1G01A 5JIKA 3W37A 3R06B 3BXWA 2G75A 3MOBL 1M7DB 1OWQA 4XUOA 1W3LA 3QXAB 2J7DA 1FYTB 2O9PA 2CESA 2CKSA 3RWCA 1HYRC 4JM4L 5LGKA 1HEZA 3GSRA 3EOTL 4JCLA 1KPUB 4JRYE 5DXWA 4WW2B 4LGSB 3UC0H 4OZIA 1U8LB 2F53B 2GI7A 3QYCA 3V5HA 1V7NL 3I2GA 1ZWIB 4RNRB 32C2A 3RJQB 1NEZG 4PJ8C 3O11B 4HK0A 1LL6A 5FUZH 3QJFB 4BF7A 3BDBA 4MTVA 4AEIL 4BUGA 4XMPL 1G6RA 2VRKA 1FBIL 2XG4A 5JXAL 5D1XD 2AI0H 4P59H 1SG3A 4M7JH 3QG6A 1ZSDB 1P4BH 3DWTA 4MOAA 2XPGA 3UG3A 3DTXB 1NCCH 2CR3A 2X4QA 1TUXA 4X4XB 2WYSA 3ZDXE 4LLWA 1L6ZA 2H41A 5F9JB 1T83C 4ZODA 3B9KD 3LDBB 4GINA 4WI4A 1P6FA 1SHMA 3MJ9L 4OCXL 5EZJA 2W1WA 4Z7QE 4WWKC 3CIQA 5ABEA 1MXGA 4M1GH 4LAQH 5FGBC 4I77L 3FTGA 4P2QB 2EDHA 1KBKA 1FNGB 4U3HA 3C8HA 5CKAA 5DZLA 1C5CH 1Q9OA 2CLRB 3ZKXB 5DUML 5FF6B 4UTFA 1OW0C 1JZ8A 1P7KB 5DFVD 4GS7C 4GLRH 1L7RA 3HHRB 3BN6A 2V5TA 3C08L 2E7BA 5D8ZA 2WM0A 1CGWA 1DQTA 4Z7OE 4MNHB 4PJBE 1T1XB 5CGYD 1A1NA 2UY6A 3PZMA 4CD4A 2A6KA 4U3CA 3TVMA 2WCAA 2YDRA 4ZUVB 3SCMA 1MNUL 3MRIB 4IMLB 1J8HA 2WVSA 3RAJL 2WMKA 3GMQB 1MJ7H 5C0ND 4N42A 3V5DB 4X6DE 4MSWA 1NM9A 2AERT 2ZG3A 1R7AA 2E9MA 4U1IB 2B4CL 4P5TC 1AY1H 4AD4A 1SY6H 5F1NA 5DD5H 1QBML 1J8HB 4XP6H 2G3IA 3WLWD 12E8L 2A9NL 3DMMA 4OZHE 5KBNC 2UY2A 1JG9A 4GSDH 1G7MB 3IS1X 5I8CA 2G41A 2XGIA 3WHE0 1T1XA 5DHXB 3IETB 4HMEA 3RIKA 4O4YL 4S0SD 4TTDD 3UJTH 4MMZC 3H9SD 4JDVB 5E08L 3WS3A 3TBYB 4UDUA 1A7QL 1RJLA 3BO8A 3K4ZA 3JUGA 1JVKA 4JO1L 4WU5A 2GT9B 2V3EA 3NIDF 4PMDA 4EUPB 4LRIA 2CLZB 5FHAH 1IC7H 1KXVC 4FHBD 4F9LC 3HMXA 1CFQB 5GRUL 2COQA 4D8PB 5IFJA 3BP7A 2XFYA 4TTUA 4OLWL 4XNXH 1T66C 2GJZB 2WWMD 3BCFA 4JO3H 5HI3C 4JM4H 3MV9E 5E2JA 5J89A 3SCPA 3P4MB 4WFHD 3QAZC 3VXRA 4HIXL 1EA9C 4W7VA 1JNHA 2X9WA 1A6ZB 1U6AH 1FGVH 1NLBH 2HWZH 4LOUD 3OAZH 3KPRE 2CUMA 3N18A 1QW8A 1NGPL 4WWID 2J1RA 2HVMA 2ZPKL 3BOVA 4K2UL 5C2BH 1QR1B 4X99A 1FZMA 3HLAB 3BX7C 1MCOL 5SWSB 2ICWI 1DUYB 2O5ZH 4QX3A 3BZ4B 2HG5A 2VX6A 5BMFL 2PTTA 2ZIDA 3APGA 1U92B 1NCWH 4LLAA 4Y5VC 4G3YL 3NFNA 1DBBH 4EXKA 3H9YA 1IGYB 1RZGA 2G5RA 4OCNC 2DL9A 3IGAA 1UR4A 1ZWIA 4RNRA 3MBEA 5IIEA 5IW6A 2HVJB 4MA1B 3MMEB 1KGCD 3I6GB 4PBVC 3CH9A 1MF2H 2FO4A 4OI7A 1HK6A 3PZQA 4J3SA 4LSSH 2BY3A 3V6OE 3CXHJ 2NYYC 3AM8A 1KTLB 3MRPB 3CVHA 2PTVA 4ZUUA 3QUYA 5B4MC 3SEEA 1CIDA 1EOMA 4K7PX 2LW8A 3VXMA 1H3TA 1YEFL 3CGTA 3RGVD 3VGBA 5EO9B 1NDMB 2EO1A 5F1KC 5FM5M 1T7WA 1WBZB 5EU6E 2OSXA 1AXIB 4ZENA 1ZGLB 4WKAA 4OD3H 3WQVA 3W25A 3WLBA 1OT2A 4KRMB 4PJIA 3D48R 1A0QL 1E6QM 3CU7A 2YXFA 3JWDH 3PZNA 4KKCC 2G5BB 4JHAH 1GGIH 3BEVA 4KK5C 3W11D 5ESAA 4XZUB 1G9EA 4PV8B 4P7OA 1XF3B 5CP3A 4Y4HA 5FYLE 5IFPA 3CMOH 4ZXBB 3UYPA 3P4OA 3DRTB 1ODZA 2EDBA 1P1ZA 1G84A 1EO8L 5GZNC 5FOJA 2HKFL 2GK1B 1UKQA 2X4TA 4UNVA 3NIFE 2I9TA 5LCWL 4K23H 3U0TA 1QNQA 4KRUA 2J7MA 1K6QH 3EAKA 1H3UA 2L7JA 3MRNB 4L9LB 3W6LA 3FONB 1AE6L 4XNZC 3QG7H 1E4LA 2V5DA 3GMOB 4H0GA 1CN4A 2ZG2A 4RAUB 3BQUA 4Q9RL 4CN4A 2DQIH 5CHNB 3WMCA 4XX1E 1CD0A 1RK0A 1IQWH 4NZCA 3TNMA 3MR9A 4LSTL 1ZHKA 4DFIA 1DN0B 1FC1A 4R7NA 3CX5J 3VXSA 2VABA 4UT6H 3HS0B 4QRRE 3IKKA 4JO1H 1XH3A 3KYOA 5H94B 1BFTA 3X3GH 4CU8A 1M01A 5ALCL 4M56A 5HDQH 5K9OA 1ZLVH 5DQ0A 3NACL 5IB1B 1WZKA 4CVZB 2V4VA 2ZUSA 3FXYA 1F6AA 4LPCA 3AGVA 3F5JA 2ZUYA 3BT2L 3PHOB 1U3HC 3ULSB 5GGQL 5DR5L 1P7QA 3FOLA 4Y4HD 2E4TA 3OB0H 4UIMB 2V5SA 3C8KA 3O6KL 4PRNA 5ETUA 1S7RA 5JIPA 1OT5A 3RNKB 4XCCH 2GSGB 2WMIA 3VXPB 1N6VA 1BBDL 1XGPA 1V5JA 2A73A 1EERB 3EFFB 3A3HA 4D6EA 1KLFA 3QWOB 2V17H 1PSKL 3O6FB 2X0YA 1H5BA 4P8VA 1TJIL 3TO2B 2JKXA 1E6XM 3SCTA 4JAMA 4L4VD 1NBVL 2W0FB 3GMMA 3QSKB 4GXUM 1VJSA 3HNYM 3WIJA 3DO7B 4W81A 1IM3A 4Y16B 4M61B 1IAIM 4N90D 4KTDL 4NQCE 4ZXBD 3DV4B 1QLFA 3NCJH 1FV1B 2EDWA 3VXRE 3JUYA 1JDCA 1U91A 5IUSA 3ARGA 1MHCA 1CD1A 2HRPL 4JFXA 3BAEL 4AY0A 3MJ8A 4P3CL 3SDYL 2ZSVA 3I84A 1X9QA 1KB9K 3PGCB 1PQZB 4YHGA 5I16A 3KHQA 4KK9C 1M1SA 4DKFH 4N68A 1PQZA 3ZYZA 2Z91A 3SDDA 4DOHB 5DK2B 4GKZA 2PO6C 1CZ8L 2BVPB 4OD3L 2UVEA 5FO7A 3GB7A 5GS0L 3KWWB 1I7ZA 1BVKB 1A0QH 5FO9B 1FG9C 1H0IA 3WD1A 1CD1B 3EMQA 4WNQA 2ZCLL 4ETQB 3RVWC 4YHOL 4W8JA 1GGIL 1XGQB 1MI5A 1MCLA 4Y16A 2EYTB 2UZXB 5LBSL 4OM1L 2ERJB 2FR4B 1ZHLB 1AGBA 4UQDA 1UWXK 1FFNA 4X6BA 1CYGA 1QR4A 4LMQI 4X0KB 3GMNA 4GFTB 2WWCA 1YPZB 4GG8A 1JGUL 3WNMA 2VLLA 2VXQL 1HHHA 4PJ5B 2EICA 3SKJH 1EO8H 1EOKA 3BP6B 1H8SA 4FMKA 2WZ8A 1QPKA 3VDHA 1B4JL 1JPGA 1MCWM 2FJGB 3AIQA 2ICEA 2R1XA 2C3VB 1KV3A 4YUEH 2Q7YA 3WL9A 5I75C 2DQEH 5JOFB 3ARFC 3QEUB 3KPPA 5EIIB 3WKML 4APQC 3MRMB 5IFHH 1RFDL 1LK2A 1C5DA 2DQCH 3GSOB 4TUJB 2J88L 4WW2C 4OLZL 5IBLD 1A3HA 5DA4A 4BQ4A 3VX0A 2DQIL 1MOEA 2ILLA 4G6ML 1MI5E 5AUMA 5JR1L 1OP3H 2E6QA 1FLRH 3ZYOA 2CJUL 4DTGH 3PBGA 2E7LA 5LWYH 5I24A 2J6EH 1KTRL 2J8OA 5DD6A 1YEIH 1WFUA 2OP4L 1BBJA 3AREB 3CH1A 2FIKA 1MFAL 4RL3A 3N13A 2GJPA 4FFWC 4AD2A 3NCYP 3P73A 3MREA 2NY4D 4PCSA 1J5OH 2OL3H 2D24A 4GXVL 4RWHA 3MJ9A 4OB5L 3VFWB 4HU8A 3JWOC 3SPVB 5DR5H 2EEDA 3GSXA 4YN5A 5GGVL 4IIQA 5IB3A 3N9GL 3RWHA 4WSJA 2YEZB 4L8SC 5TH2B 4Z7WA 1UD6A 4NQSB 3CUJA 1RZKL 1QVOB 3R4DA 1R3HB 5EZLB 4QRSB 3EHBC 1PD6A 4MXWH 3HB3D 4I48A 4JFUA 2ICEB 2R1XB 4JFDA 1HXYA 3KWXA 4YDJA 2Z31D 3KS0H 2FH8A 3KJ6H 2H9GA 2R15A 4Z7UA 1XF3A 5CBAA 4UU9B 5E4EC 3RA7L 1BZ7B 4JGJA 4Y4FA 2PBGA 4Z7QF 1JXKA 1AGBB 4WHTA 5E8DL 1WGOA 3UAJC 1NGXA 2HRPH 4B3KA 1YDPB 3QUYC 4YHYC 1DLHA 1YQVH 3ZJ6A 4YHPA 4JRXB 3SDYH 4WNQB 1Q9WB 3QUMA 1W9UA 4MNGA 3LEYH 4F7TB 4CD7A 1OARH 4DM1A 1KENH 4GKZB 3VXMB 3MMDA 1IFHH 2OXHA 3S36L 2R1WB 1CZVA 1FFQA 1HKMA 4HWZB 1MIEL 2DIAA 4WY7H 1KCVL 4L3CB 4L8DB 5KVDH 1MCKA 3EJYD 5C71A 1X3DA 1ZT4B 2FEEL 1FNFA 1NC2D 1B3XA 3BJ91 3C6SA 4I0KA 1DBKH 2FYYA 1H11A 2XUCA 3WE6A 5C6WH 5HGBA 2X8RA 3MMEA 5CD5C 1E4WH 3P0VH 1EAPA 3RO8A 2CDPA 2J47A 1OINA 1MJ8L 3N1PC 3HI6H 4M62H 4I9WE 1V02E 1SYSA 1GZQA 4FG6D 1TETL 5E2TH 2F19L 3TYGH 2FDMA 2XOMA 2OK0H 4YUEL 1OAQL 5IEKB 4S2SA 5JXHA 5DMIL 2EC9U 1DUYA 4OLUL 3WKMH 3HLAA 3QDMA 4ONOA 3BZFB 5SWQB 1GORA 4M5ZH 1LEKB 2EPOA 3QFJE 5F9OH 5DURB 4O2FA 4H26A 5IBUB 4JFVA 4M03A 4RGNE 4LLDB 1M7IA 4NRZB 3EDDA 5JOPD 5KSUB 3UBXG 3FB8A 1V6VA 2NR6C 4PJ7F 3SY0B 4OLZH 3ARBC 4PJ9D 3ZJ8A 3VFNB 2JIWA 5IFTA 4G6MH 4U33A 4F3FA 2VDLH 3FQTB 3IFOB 5HHME 3WD3A 2HLFD 4L3ED 5I9QB 2V5CA 3PNWB 3VIHA 2EEAA 4I18C 1JV5A 3CDCA 4P5TA 2QLVB 3KDMA 5K33A 3IDAA 2VLJE 3VXNA 5JPMB 1WK0A 2AAAA 1BM3H 3WEXB 4PMUA 3SJVE 4HZAA 3RL2A 1XT5A 3DMMC 3KG5A 2F58H 3M1BA 4R7NB 1ECEA 1IAKA 2A83A 5C8JA 4ZTPL 3QWRD 4DCQB 2XM2A 4NF7A 3OXRA 2V2WB 2DQDL 2PWDA 5IF0A 2QPSA 4FA8A 2CYGA 1T7YA 4KMTH 4X98A 2ZE0A 3NZ8A 4M1CC 2ZWZA 3BEWB 3EYSH 1XGUB 2LAAA 3LPWA 4XP4L 3O9WD 3ES6B 3G6JB 2BFGA 1ZBKA 1A6WH 5JO5A 3F5KA 3FONA 5I17A 4QHLA 3RWFB 1HSBA 1WBYA 4LP5A 5HJ3A 4AH2A 3DUUA 5JHDA 1DE4A 4MA3B 3UZVB 3QHZL 1QHZA 3LKRA 1ISVA 3UPRB 2VN7A 5C86A 5AYUL 1U93B 1S9WB 1VENA 5J13C 3BAJA 3O2DH 1BP3B 1MH5B 2XA3A 3BEWA 5CSGA 4M82A 5D7JC 5DMGC 3LKQB 1WPCA 2XN9E 3RA7H 2XWEA 1CWVA 4Q97A 4JVPA 2J3SA 2VXUL 3SE8L 1LO0H 4FXKA 4Y4KC 5D71H 5CEZD 5E8DH 2DRUA 5D2NA 4EVNA 2EDOA 5DUPH 1MCDA 2HT4C 3MPCA 3SBWA 4JM2B 4W8LA 2QQMA 4UDTA 2QL1A 1JL8A 2VERN 3BZEA 1XIWC 1G1CA 1ESWA 1EPFA 4QRPA 3RDTD 3TJEH 3MRDB 5KSAC 4BSWA 1MQKL 3SDDD 1JI1A 1KACB 2YK1H 3TZVC 1DFBL 2XG5A 1WZAA 2GDUA 1F4WL 3GRWH 5DRZA 3AIWA 5D6DA 1OGAE 1CCZA 3BUYB 4WY7L 3VG9B 2J8UF 3KYKH 1I5PA 4FFYL 3GKWH 4HW6A 3I3EA 2NT0A 2X1QA 3BUTA 2EO9A 3O6ML 4O2CA 3WNNA 4JHZA 3TA9A 4DVRL 3FB8B 3S37L 1NCNA 2J1TA 1E4WL 3P0VL 4HUUB 3VWJA 3QHMA 4PGBA 3C6LB 1T1ZA 5L2JA 4HC1A 1CBGA 3P3YA 3ZM8A 5FUOL 4HG4J 4H5SB 1GRWA 3BZDA 3FQUB 3W0WA 3I9GH 4LNVA 4N0UA 1T2XA 2RIKA 2CUHA 4L3EB 3VFRB 4U0RB 4F8QA 5E8PA 3QIWC 3NCYS 2F19H 2D1ZA 1QQDB 1BOGA 4KROB 5D5MA 1I3VA 3VWJC 4CVXB 5GISL 2Y7QB 1FH5L 1UB6A 4YBQC 1QSFA 2AP2A 2R1YA 2EDEA 3EDEA 4G7VH 4XNUL 4IRSC 4E0RB 1RMFL 4H5SA 4HJJL 1UZ6F 1WWAX 3W0WB 4OZIB 3POHA 3RUGF 5L2JB 4RISL 3SQOH 2OLHA 4A6YA 3QUXC 6FABL 5DJXB 3Q3GB 3IVKA 1C1EH 4OAWB 3EO9H 4XHQA 1WUNT 3FN0H 3PWPD 2ATKA 2NNAA 1NUDA 3WXVH 1EGJA 5HPMA 3GSNL 2HRLA 2ADFH 3H9HB 5LAXA 3K77A 5DRZB 3N85L 1SR0A 4CJ0A 4QHMB 2WIIB 2XWTA 3RY5A 1FYTE 4JGUA 1SFSA 4LCYB 2EC8A 4LLMA 4QRPB 4UOW0 1IAOA 4EJ1C 4H1LH 1CLYL 5JBEA 3RM4A 4PJBF 3DETC 3T0AA 1BQSA 3X3FH 2FB4L 2ZX9A 4FS0A 5EN2B 1U8MB 4PTTB 1YN6B 1IEAB 4MMXC 3ARPA 1WZ1L 1NEUA 3BH9B 5INDA 1T5XB 3EYSL 4CVWA 2APWA 5JNYB 4FLRA 1TQCB 4UR9A 4JFEA 5DDHB 1MCQA 1FNAA 5A94A 4TRPH 1A6WL 5F8RC 2XZCL 4E8CA 3PWNA 2DQUL 3QCTH 4Z0XB 1U93A 4F15B 5H37G 3ACHA 5EO1A 4DWSD 4GW1A 3T3ME 4NYLA 1WFOA 3HPNA 4QDRA 3O6FC 4YHMH 3WCYA 2F74B 4OM0L 1KF9B 4ZNCD 3DOSA 2E7MA 4MQXC 3L9RA 1FFPA 4ENED 3IDIB 1IAII 2F54D 3VD4A 4NHCL 4MX7B 2Y5EA 3MCLL 3L3KA 3WSQL 2C0HA 1U36A 5D71L 4HLZH 5MERA 4G6AD 2OL3A 3PHQB 4W93A 1WCBA 1RP9A 4PP1C 1NBZA 1CS6A 3N50A 5C6TH 4UBDC 2KUTA 3ZKSD 3L1OH 4PJIE 3TA3D 5I1GL 2RJ2A 2CITA 2FHFA 3WBAA 1RQ5A 4NFBA 4RGMB 5BVPL 4KI5C 1BVNP 1UB5B 3RWGA 1WV7T 3MRQB 2EE6A 2ZUVA 5EUKB 2W63A 2I9LB 4J8RB 1E56A 3GSNA 4ZS7L 1AD9A 2I5YH 2NXYD 1JV5B 2D0HA 4UNIA 2WABA 2NY3B 4I0PA 2A0LD 2IJ0C 2VR5A 4E42B 4IRJD 4L4TB 4ODHH 3EOTH 2BRRL 5KSBA 4NM8L 3GH7A 4N0YH 1CLOL 1G9NL 1G0CA 2DLFL 5JPNA 3SURA 2PW1A 4DWHA 2GQHA 4K9EH 3VG0H 1NWTA 5FOOA 2C3VA 3ARRA 1NCAL 4U6YA 3CDZB 3O0RL 4S2SB 1EVTC 1JCKA 3CZFA 5LQBH 3T1FB 1LLOA 3VFMB 3WN5A 5HXMA 3DUSB 4UUJA 2VRQA 2AI0L 4P59L 3WUWA 4HJJH 4O2EA 3VFUB 5MEOB 1Y18B 1GMMA 1AD0B 1ZA6B 1CXFA 4GBXA 4S1RL 5IFAH 2YBUA 1Y0LA 4XAKD 1NCCL 1K5NA 3MRGB 4YPGA 5KOMC 4Y2DA 3LMYA 2EDDA 2X4NA 3HR5B 1IGFL 3C8DA 2E33A 3O41B 4MZ2A 2X89A 2Y5TB 2NX5E 4L3CA 5FKYA 4HH9A 2QQNA 2MSPA 3KGRA 3KPMA 4NQXB 5D1QD 3NH7L 1YZZA 2XYCA 4FXGA 1CFNA 3VWKA 1QFOA 3CFEA 5JORA 2H8PA 5JLZA 3SGJC 4M6NH 3WHXB 4MNGB 4OYUA 5E6IC 3CXHK 2HJKA 4H25A 4OF8A 3X3FL 1OD7A 4KDVA 4PUEA 5JQ6H 3K8KA 3VU2A 4P9ML 3FY1A 4PGZA 3E8UH 1OD0A 3RTQC 3FB5A 3V8CA 5A8OA 4M6AA 5D6DC 5I76A 2DOCA 1BZ7A 3MV8D 1ULOA 4XCNB 3JSSA 2R4RL 1LK3L 1BQLL 4HJGA 4Z7NF 3AYSA 4TRPL 2MCPL 4HIJA 4IISA 2XZCH 4JN1L 4X9GA 2UY4A 1GZPA 1QNZL 2A6JB 4Q7NA 4A45A 3P0YL 5F7YC 1F02I 4M7KH 4HT1L 3WFZA 5GGTH 4OJFL 5HDLA 5IK3A 1CBVL 1G7PA 4X6DA 2NY6B 2J7GA 5DVLA 1T80A 3TBTB 2CETA 4JFFD 1LP9A 1AGEA 4M43L 4P23A 5TH2A 3OB0K 4BFIB 3A23A 5J3HD 3Q5OA 1VGEL 4GRMB 5I2IA 4KUCF 2V6HA 4W86A 4GSDL 2FH6A 2GTWA 1SBSH 1JF6A 4QY8B 2WZPD 1X7QA 1XGTB 2WC3A 5BXFA 3MRQA 5D2LF 3EGSB 3KLHD 4YGVA 2DYPB 3T0DA 5JIIA 5E08H 2YC4A 5BVPH 3MXVL 1BX2B 2AGJL 2X4UA 1QLRA 2MFNA 3P4NA 4TTDC 1BX2A 2X4UB 1UC6A 4LVHB 5EIQA 1MJJA 4TN9A 4V28A 3HC3H 1F11A 3F7VA 1I8IA 5FYKD 4IUGA 4KVCH 4M8VA 1PY4A 4LF3A 1CL7I 3T04D 2CD0A 4X7DC 4HHAA 4X80H 5HDOA 2A9ML 4JO3L 1U6AL 2HWZL 1NLBL 3U9PH 2BVEA 5C09A 1QI0A 1WSST 4HZLB 1FVEB 1PZUB 3CD4A 2WLYA 4X7CC 3OKLA 1XCXA 1DVFA 5HBFA 4JKLA 5GS0C 1Q0XL 4LOUC 5BQ7B 3DSFH 1NMAL 3O0RH 4GW4A 4MCZA 3HCVA 2V2XB 1U8QB 1MJUL 5AZ2L 4KQ3L 3X13A 4D9LL 1UXZA 3T2QA 3CPLA 1A02N 4HFWB 1NANH 4D6DA 3CMJA 2AK1L 2H6PA 4XPHH 5FA3B 4ZOAA 1HHHB 3VOCA 3NOIA 4HPYL 3DSNA 4PF1A 4HPHA 3WELA 5FYLD 1NKGA 3H6JA 1OP5H 4MJ4A 2ZNWA 4DW2H 1A1MB 1JPSL 2PTUA 3F12B 4OZGA 4XPTH 2NLJB 3SKOB 1XIWB 3UEQA 1VPOH 4JREC 2HT2C 1NWRA 3GBEA 1MW1A 3KXFE 2EEXA 5CJOL 3CAFA 1BG4A 5JORB 3GB7B 4F37K 3OQ3B 4HIIA 3RHWK 4D0CA 4PREB 1I7RB 2D7NA 3O3AA 4M6NL 2AK4A 2ESVB 2SEBA 5D9SA 3CCHA 5KANI 2CO6B 3VFOB 1IEBA 3NAAH 4QRTB 4X7FC 3D25A 1KN2L 5I78A 1O5DT 4JANB 5DJAB 4JL1A 4P8XA 3RP1A 2TAAA 4UT9H 3VFUA 5GZOC 4LVNC 3S35L 4LP4A 4MJIA 1FH8A 2MCPH 3S96A 4HXBL 5D9OA 1RVFL 3FO0L 2PTTB 4JZ5A 3QEQE 3P0YH 1JNNH 5CMAA 3U6RA 5F44A 4TUKH 4K23L 1G9HA 5HYSB 2PW2B 2GSGA 2WMIB 1S5HA 4HBQA 5EG6C 3P9LA 1M6OB 4E41A 3RNKA 2RHEA 4KRPB 1VGKB 3GO1H 1WAWA 2AXFA 5KSBB 3QG7L 4ZO9A 1F5WA 3PJSA 3GBMH 3V6FA 1UCBH 5DA0B 5K9QI 4RN5A 1XCQB 2IH1A 1GJWA 4WKFA 4NC2B 4K3DH 5AWNH 3NJVA 1J05B 4D71A 3O2VL 5K9JL 2J7FA 4P3DA 4M48L 2J4WL 1R5VA 3JBG7 4JCMA 3ARBB 3SE4C 1UGNA 2F61A 4B5EA 1NBZB 4FOMA 4NKMB 4KVCL 3LOWA 5IMOA 5LGJB 2CBUA 4ELMB 8FABB 2R0WL 4PS4H 4X80L 3RQ3A 1QFUL 3QA3A 1JPFA 5BV7H 1OH4A 3KPRA 5IB5A 25C8L 4PJ9B 1ZVYA 4XHJC 4MX7A 3T0EB 5FKAA 5CEZH 3FO2A 1IZJA 1EGJL 1AFVL 3GXFA 5MEPA 4MNJA 3C5ZA 1MWAB 2W9LA 4X7SL 3FO9A 2ZSWA 4OZOA 2JD9A 1A6VH 3HZMA 4Y2DD 5I17B 4R3SA 1E6SM 1HHKA 4L1DA 4HUVA 5B4NA 3VX1A 2XZAH 4P4KD 1PSKH 5F9WC 4RGMC 4QKXB 4X6FB 1IGJB 1TJIH 1HHJA 1UA6L 2VLKB 2V2WA 3EO1B 1A1NB 2CKNA 4L8CB 4RGND 3QUZD 3FFCE 4FFVD 3BEVB 4XPTL 5HHPB 3VMNA 3WEXA 5LKNA 4ZO8A 3VXUA 5SWZB 2Z35A 4IJ3C 4LLMB 1XF2B 1ORSA 1P4IL 1NDMA 2VQTA 2D31A 4OGAC 3UJIH 2EPKX 3BRGC 4WO4A 4Z8FL 4WFFD 3VI3E 3QEHB 4BXSV 3RPIB 3EYQC 5DLML 2C8NA 1W72B 4H8WH 5KSUA 3IJ7A 3BKJL 4N0FA 2OTUA 4KJWC 2AJYH 1MAMH 1HNFA 4QT5B 2L9LA 5T3ZD 2X5PA 5CSUA 1I8LC 3DX9A 3T0VA 3NIFF 4A6YB 2A77H 5EJ1B 2MWCA 1QBAA 3AMDA 1RUKL 3G5YA 1NKRA 2B1HH 4QHNA 3X14B 4EUPH 3U7VA 4LYPA 1MLBB 3GXIA 4XPBH 1QFPA 4HUMB 3QOMA 5DSCB 1S7VB 3SKJL 3VH8A 1U8JA 1FYHB 3IJ8A 3THDA 5B4XA 3PHSA 1QOKA 2J7CA 1RUAL 3UYRH 3X11A 4LEXL 4BKLA 4TUKL 3NCEB 5J1XA 1HNYA 5I30L 1J84A 2K1MA 1NANI 4M7LH 1OGSA 4EI5A 3AMLA 5TDPB 5I66B 3G5YB 1CK0H 4AMCA 3BRDA 1F3JA 1RFDH 1BIHA 5D93B 5AAMA 2OYPA 3BSZH 1T1ZB 2DQCL 3ARFD 3HPJA 8A3HA 4JQIH 4ALAL 4APQD 4WW1B 1JXJA 4M80A 1BYDA 2IANE 4LQ1A 4XH2A 2YA2A 5I8EB 1DCLA 1R3KB 3GSVB 3K8MA 3U79A 3BXNA 4ACZB 3BP7B 5A6BA 3Q1SH 1FLRL 1KJ3H 1TQBC 4G6JH 3H3KA 3V0AC 3O2VH 5K9JH 1WZMA 3QUKB 1T0NB 1H3XA 4HV8B 3BP5B 3QUZB 1YEIL 5IQ7H 1YN7A 5JW4Q 3ETBF 1YDPA 4FQ1H 1HVQA 2MJWA 4BJ0A 5BWFA 5E00B 2FJFB 4OD2A 1VADA 2EKJA 3BE1L 2C4XA 4MNQD 3TV3H 5C0GB 4PS4L 1UYXA 1J5OL 5BV7L 1W2VA 5CEZL 4EDWL 4OB5H 1LDSA 1XF5A 1EGJH 4MA7H 4PJXA 3MV7E 1HXYB 3EFDL 5B39A 5DYOB 4MB4A 2ID4A 1N2RA 1B2WL 5JXAH 1J01A 4X7SH 5A16A 1I8MA 3EJZD 3BAIA 1MH5A 2IEPA 4PJDA 4GRLA 1PAMA 5F1NB 1SVCP 1U8PB 4A2LA 1UD2A 5C7GA 5TDNB 3LEVL 2NY0D 3D2UA 4R90L 3PQYD 2GJ6D 5FD0A 3D2UB 4HIHA 1W8OA 1R6VA 3DVIA 2EC9T 2VZ1A 3ARYA 3OAYH 2WBWB 3H2WA 5D7SH 2E27H 3MJ9H 4OCXH 4PJEE 4AD0A 1W1YA 3EHBD 1XGUA 4M1GL 4LAQL 1OAYL 1JPTH 2CUIA 2XSAA 3BGMB 3HZYA 2J1VA 5LGJA 4XWGL 3PN8A 3U7YL 3JV4B 3V6BR 4LPYA 5KS9E 4AD1A 3O8XB 3SKMA 4D0DB 4HGWA 4HH8A 4BELD 3HJRA 3IDGA 4U6XB 4YC2B 2BSTA 3MGTB 1KIRB 1U8NA 2ZOLB 2R23A 1A7PL 1Q9OB 1FFRA 1N0LA 3IK2A 4PJAB 1CDBA 4Z8FH 4QX2A 1FNGA 1ZMYA 3MA7B 3PNWA 4R97B 5DLMH 3TPKA 1I8KB 2MPAL 2QSTA 1XCWA 5GGSB 1DWGM 3OBAA 4XH2B 5K9KA 3D69A 3ZO0A 5JXJA 3CSYB 1I85C 2B4CH 1JZ7A 2B1HL 4BQCA 5JXIA 1SY6L 2ED7A 2QJDA 4P9HH 3TP4A 5DD5L 1FRGH 4OCYL 1RK1A 5SWQA 4QPWA 1LEKA 4UMGA 2FSEB 5DQ9A 1MLCB 1G7IA 4XP6L 5CSZB 4QTIL 4HAGA 3QEGH 2RFXA 5E2TL 3ILQC 2QADD 2Q1EA 4ZFOL 2VYRE 4JRYD 2YR3A 3AM8C 5I30H 3BC9A 5E1AA 3IFNL 4X5WB 4Z7WE 2G60L 3VRLE 1CK0L 32C2B 4M5ZL 4F7PA 1FZOA 5KVEH 2IBGA 3C60B 3O9NA 1IRAY 4GH7B 4K3EL 2CKRA 1MPAL 1CXKA 4GAFB 4XP1L 1VA9A 2DM3A 1JF1A 1B4RA 5D7LE 3UERA 2EDXA 1UZ8B 5FHAL 2BVDA 5GRUH 1V3MA 3MUZ1 4L9DA 5HD8D 3Q1SL 3SDXB 5I16B 4PV9A 4GAGH 5BRZE 3FQNA 1B88A 3QULB 3IDJB 1J9CT 1KEMH 1G7LB 1P2CB 2WK2A 4ZAKB 1O8PA 4LASH 1BM3L 1G7HB 4YLQT 1Q9WA 2C7FA 3CUPA 4IPLA 2XFXB 2XV6B 3V6OC 1ORQB 5SWZA 4JRYB 4CUBA 2IADB 1SYTA 1LNUB 4MA7L 5IESH 2DQDH 5FO8B 1NCWL 5F6HI 5DEGB 2KDGA 3WEZA 4N5ED 4XP4H 1TCRB 4KK6D 4J23A 3EO1A 5I1IH 1F97A 3X17A 2WBJA 4DGIH 3JWDC 4H41A 4M1CD 1QBBA 4Y4KA 1TE1A 4UIKH 4NUGH 3O9WC 3MLWL 3VRIB 3IFLH 4QRSA 4IOSD 3IRPX 5M7QA 1ONQA 3DVGA 5IMLB 5C0BD 1FPTH 1WQVT 4JFHE 1AGFA 3N1AA 2YD8A 5IB3B 4U1MA 4GG6F 2R2EB 4L9LC 3PZVA 5IB1A 1LO3H 1AXTL 4OZFA 1H15A 2WKLA 5AC4A 4WI7A 4N8CL 4Z78B 1PZ5B 4L4JA 1BBJB 2UY7A 2XZZA 2R2BA 4L1HA 2ED9A 1WISA 2BOBA 3UTSD 1F58L 1MFVA 3U0WL 2ZICA 5FDWA 1JNLH 1MQKH 4OF3A 3J8F7 4RE3A 1ITCA 3CK0H 1XIWD 1F4WH 3W39A 4OKVA 4XCFL 1EEUA 1LD9A 4UOJA 3QHFH 5GGRY 3TZVD 3CZEA 4I9WD 5JIHA 4J2XA 7CGTA 4UZGA 3LN5B 5BZWA 1AQKL 1UQSB 5FYKU 2PO6A 2CLVA 4UB0L 1AHWC 1UJ3C 3ZSSA 4OIFA 3FRUA 1MWAL 1FRGL 4OCYH 3OB8A 5FUOH 5EIIA 3POCA 4FQXD 1G5AA 1A5FL 5C07B 1CZTA 4LRIC 3RIAK 5HYSA 4KC3B 1YA5A 3EYUH 1CL7L 2FZ3B 3FB7B 1BLNA 1E28A 5EFIA 3E1F1 1FH5H 1J7VR 2G60H 2QKIA 5DJ6B 2XTJB 4PJ5A 1ZHBB 4J4PC 1MW3A 4LSTH 4AZ6A 1XF4A 4PYHA 1T89C 2NTFB 2ZOXA 5CJXC 1LE9B 3RBSA 3GSUB 3QUXD 5JW5B 2BVPA 5K93A 4A42A 1EZVX 2MNUA 1IV8A 2ADFL 3QDGB 3VFTA 3UX9B 3V7AG 1NAMH 5C0EA 1H3WM 1HILA 5BZDA 4F33B 1I7RA 1VFMA 3O3AB 5ITBL 5F7WC 3D3AA 2EDTA 1MCHA 4AZIA 4D9QE 1HDMB 3PZOA 1OTUC 3VGEA 1JHJA 3LPGA 4NN6C 1S3KL 4XUQA 2X10A 5EUOA 1BBDH 2EDRA 4X9IA 3V8OA 5J4MA 1U8OB 5GGRB 5DN2A 4Z7NE 3MX0A 1NCDL 3MMUA 4KGLA 3VDCA 4ZSOB 5DJ0A 2W0FA 1D5BB 4JFYB 2A3BA 3TTSA 5B38B 6A3HA 3BZ4A 4KDTC 1BLIA 5CGYC 4DGIL 1NAMB 3ZQ9A 4U6YB 1WP6A 1C5BL 3IFLL 3O2WH 1FNHA 5ADOH 4HLZG 1B6DA 2PW1B 1R5WA 3WDHA 4OM0H 4HMCA 5FB8A 4TVCA 3L3GB 4KI1A 5C0NC 2J7EA 1CEOA 4OIAA 5EC1A 4DWSC 2X70A 4P3CH 5IVXA 5F6IB 4ZFFA 3F7YA 4HPGA 1C16A 2ADIA 5CZVH 4NHCH 5EOCL 1ZT7A 1VFAA 4ENEC 1CZ8H 4PTUA 2BC4A 4PYGA 1I85A 4HDIB 4AENB 1BF8A 3NRUA 6TAAA 4OKVB 1LHZA 4WU5B 4N8CH 3MACH 1V3IA 1QFWI 3MRRB 5ICZA 5I2UA 4CVUA 3OGCB 1QHPA 4QFUA 4IIQC 1KIRA 2YDSA 5I1GH 3MLZH 1JNLL 3O45A 1KJ2A 2C9KA 2OMBA 3D9AH 1OIMA 1SEQL 1A6UH 3CHCA 2CIKA 3ARWA 3Q5YA 3F58H 3V6OA 1OTSC 1FFOA 3GM0A 2ZXDA 2OTWB 1T21B 3WL0A 4AIEA 4JFOA 1WAAE 4W7WA 2LVEA 3SHSA 1E5JA 1FFPB 1AQKH 2J8UB 3IDIA 5HHQB 3QO1B 4XVJH 2DQEL 4XBGB 1MCPH 1CLOH 4U6TA 1MWAH 1BPLB 1V0NA 1LEGA 5ABHA 3VWKC 4WUKH 3LKPB 4D72A 5IMLA 4D0BA 5EO1B 3VG0L 4PRDB 3ZKQD 4NYLB 4W5UA 1E4KA 1UQYA 2X4TB 3CHDA 4X8JA 3A4AA 2JE8A 1I8MB 2NT1A 5LQBL 1BGAA 4XP9H 2GIYA 4XVTL 5E9AA 1R3LA 1NFIB 4PG2C 1KT2A 3JVGC 5LWYL 2VC2H 4NN6B 5EN2A 4D6JA 4S1RH 1S8DA 1XF1A 3OJMB 2BNJA 3OWEA 43CAB 2QF8A 3VIGA 1S9XB 4MAYB 4L8BA 5BXRA 5KVGL 1ORQA 4LVEA 4JZOB 1QFWL 4QRRB 2HJKB 3MQIA 4C56E 1OCWL 1GOOA 4EK7A 3QUKA 4QHMA 4JFTA 3HFML 4ODVL 1DL7L 4GXVH 1K3IA 4LARH 4QLRA 2NY6C 4HPOH 5A6SA 5ITBH 1E0OB 1NKOA 2PBOA 3AHTA 3HMXL 1LDPH 4CMMA 1VEMA 3TO4A 5IMKB 4NQEA 3RUGB 3IVKB 3NPSC 2K7PA 2BVTA 1XEDA 3HPJB 3W81A 4FQXB 2ZUQB 2C1PB 5KW9L 4QRUA 1KG0B 1K4CA 3SO3B 1X5IA 3O4OB 5IHUL 3AISA 2Y2WA 3MBEB 1HQ4B 3LKNA 4KMQA 3RWJB 4CUCA 1NEZB 2BS9A 3KL3A 1ES0A 2XQBL 2EJ1A 1BQLH 4X4ZA 2DAVA 1OAUH 1ZS8A 4EUPG 2XVKA 3OGSA 5EJZB 5A95A 1OW0A 1FA2A 1E0VA 1C5BH 3DO3A 2W60B 1JU3A 5IW3A 5E8PB 5JOEA 5L0QC 5ANME 4IBLT 2ZKHH 4KGJA 3WV0A 1B9ZA 1TPXB 1XSJA 3QQ4B 2C1PA 4OQ1A 5GZND 3VRJB 3BW9A 3I2CH 3MBXH 4OCMC 1JDAA 4M43H 4ETYA 2CBJA 2CK0L 3L3IA 5D1ZC 1KENL 2JK5B 5DGRA 4GZ9A 5GGSA 5D7IE 1NUGA 1E6NA 3TPUB 1H3GA 5SX5H 3MACL 1U8IA 4ODWB 5BJTA 4A3ZA 1KCVH 1KUMA 1X6LA 1UWIA 1L7IH 4IRSA 1DQLH 5J1SC 4Y89A 4YXHH 3OR7A 3MLZL 1A47A 1DBKL 1MUJB 4MQ7A 5EORL 5C0BB 4JHBA 4TNVF 1UWQA 2JTDA 3U2SB 1SEQH 3MRJA 4U1HA 3K80A 5HHPA 3U82B 1CD9B 4QYOB 1B90A 1E4XH 5GHWH 3QDMD 4FNLL 1EZVY 1R0AL 2Q3ZA 2W9EH 5CILH 1OT1A 5JR2A 5A3ID 3ECBA 2ID5A 2A9MH 4JL2A 3BPOB 4JPWH 4PJ5E 2J62A 43C9B 1B6UA 3DMMB 3ARUA 4X8JB 5ADPH 4J3OC 3O9WB 3PGFH 3QHOA 3V5KB 2XIIA 4QHKJ 2LFGA 1U3HD 3HRPA 1LVEA 1MFDL 4TNVK 3M8OH 4LQFL 2HVKB 1NMAH 4WTZA 4KY1L 5BW7C 3P1IA 2Z8SA 4R4NC 4XP9L 2EKSA 2OWWA 3S5LB 1A6AA 3BPCB 3ALPA 4UQCA 4UQBA 3FO2B 3NABL 3LKOB 4XPHL 1TXKA 3ARDC 1MHEA 5H8DA 4GG6A 3QJHA 5DYOA 1AR1D 2H3NA 4ZEPA 2EIZB 2IPUK 1ZA3A 3LN4A 2HMID 5D93C 2Q20A 4XPGL 5KVGH 4I3RH 3G5ZB 4EANA 4OD2B 3QUMH 1KULA 3VXSD 1OCWH 5HYJE 4HK3J 3FW6A 2R56H 4XC3L 4ZTPH 1OSZB 1ZT1B 4P5TB 4D2NA 2C7UA 1FO0A 2DM4A 1LQ0A 3G6MA 3VXUE 2QMJA 4TQEH 5GGVY 2P46B 4KMTL 1E1FA 3BLKA 3IAGC 5LA1A 3BWUC 3I2FA 3SGKC 2E8YA 4KDTA 1GPOH 5H2BA 1WT5A 3GNOA 5F9JA 1JZ4A 3UROR 4LLDA 4NRZA 4ELKA 4X4XA 4H26B 1HIZA 5HI4C 5AYUH 4LCCA 3QQ4A 5TJWK 3BZFA 3RVWD 2XQBH 4JO4L 1JUFB 1BVLB 2K3TA 2H32B 5C0IB 1ZHNB 5E2VH 3QR2A 4C56A 4WGVB 3WJJA 2JIXB 4FQJH 4P49A 1LO0L 4CU7A 1CIYA 4OZ4B 1EUUA 2ZUNA 3RWJA 2FX8H 3FFCB 1UG6A 2EXYD 2WO1A 2X1IA 1KTDA 3IF1B 3I2CL 1FVDA 4DEPB 4P2OA 3MBXL 3RVVD 1W1VA 3WN5C 3P9MB 3PXHA 4Y2OA 4FQLH 3GBML 5HVWA 1ZT4A 4RDQF 4LGRB 4F66A 4QT5A 1DFBH 1I1AA 2CMRL 4LLQB 2ICES 1C91A 1AQDA 1AVAA 3KPLA 4RFOL 3GMPB 1TTUA 4RBPH 3O6MH 3U0PA 1DQLL 4WU7B 2N4IA 2DI8A 5F7NC 4K9EC 4PJGF 3MUJA 1LE9A 2NCMA 2J4WH 3OKKA 3MUIA 4QCIA 5HY9A 3MRDA 1CLVA 4I0PC 1CXEA 5E8NB 5IJKC 1R0AH 1JWUB 2W9EL 4NQTA 2PUQT 1V7NH 2AV1A 2XRAH 2WV3A 1QFUH 2Z93A 3QWQB 3P30L 4UU9A 5DUBA 3CFCL 1A7OL 3SDCA 1C7TA 2Y06L 1AFVH 2YMXL 5ADPL 1R3LB 3T65B 1ROWA 1FBIH 1FNEB 2ZUMA 4XNUH 4MZ3A 3BHBA 1ZBWA 5F3HA 4EDXB 3N04A 1FL3A 4N9GB 1TIUA 3UESA 1R3HA 4KY1H 4PRDA 5EZLA 5E94A 2P8LB 3IFPB 2W9DL 4R97C 5ACLA 4P46D 4LFHD 3KJ4B 2B20A 4HJ0D 5MENA 1LEGB 4PD4K 4U3AA 4PTVA 3WF2A 4FLQA 3A4XA 1W9SA 4P4KC 2FNBA 2C3HA 3HB3C 3PDDA 3WUFA 4X98B 1W0YT 2D9CA 4JFOB 4Z5RA 3NNGA 2R9HC 1UM4L 4BH8B 4URIA 3F7RA 4HXAL 1Z6JT 1A3RL 2Z31C 1ZBCA 4PRBA 3BAXA 1T3FB 2UVFA 3OXRB 5DJYA 4R27A 5DUMH 4OGYL 3IJ9A 3VKKA 3QUZC 3P4NB 5C9KA 1SMDA 4U1KB 3UYOD 2FB4H 3F62A 4GI8A 4OF7A 4GI6A 1U8KA 4JM2D 2C9AA 1N59B 2MANA 1B0RA 5JW3L 5D4QA 1K3ZA 4W6XB 3CDFA 5A8NA 3EYPA 1GPOL 1PLGH 1BQCA 5HHXH 1G0XA 4H8WL 5I2IB 2UZIH 4W8AA 4PRPD 2ADIB 3B3IB 5JBFA 1MVFA 4MDJB 4Z76B 4YC2C 1MHPH 1YPZE 3A0OA 3U30B 2AEQL 4YHML 5DT5A 3T4YB 1ETZB 5ID1A 4V2XA 1INQA 3PQYA 3MBWA 4Y4KB 4KKNA 4P08A 2OQJA 1X1NA 2VISB 2PKDA 5CD5D 2ZEXA 1QRNE 3MBED 2BVQB 4GKSB 4G5ZH 4PJEB 12E8H 2XSBA 3UYRL 1CX1A 1A64A 3RKPA 3QH3A 1YPZA 4R2GB 3AB0C 2O26U 2VLLB 1ND0A 4JRXD 3KXFD 1FFNB 4EKJA 5CIPH 2JJTA 4ZSOA 2P8MB 3WDQA 1WEJL 2D2OA 4PUBH 4RDQG 4V2BA 3UJTL 1W91A 4R7DB 1ZLSL 1IM9B 1EAPB 4BH7A 4JQIL 3D0VA 2B1AL 1BVKA 3NGBC 3TNNA 1J1XH 2JF6A 3VXRD 3ARVA 3NCOA 4ZS7H 1OM0A 2P43B 5AYBA 1FGNH 4FQHA 4CDHA 2NR6D 2WINA 1XYFA 4YNYB 3BYTA 1EFXB 1JNEA 1ZLUK 4Y19A 1OGAB 3T3PE 2W87A 4ATDA 1F2QA 3B9KA 4ODHL 3O41A 2W65B 4CKVX 4MVBC 1G9NH 1NAKL 1MQRA 3BKYL 3LPOA 4PCTA 3TV3L 1IGMH 1HWHB 4WV1B 5HVHB 3UPAA 2XRAL 2QLYA 3DROA 4TSCL 1MCOH 3B6SB 4QNPF 4WHTB 1A7OH 5CSYA 3O3DB 2OYKA 4UUJB 4UINL 3TH2T 4M24A 2YMXH 3TO2A 4G3YH 5CJXA 1W0VB 4HX1B 1BLNB 1E28B 2PYED 4Z7VE 4F9JA 5B8CA 3AIEA 1RHHA 3UTSA 2E8ZA 1T20A 2X7LB 2BY1A 1A9EB 3HRZA 4MAYD 2O5YL 3DECA 4P4RA 4DEPC 3MUGA 1OPGL 3BVNB 4PTWA 1IGFH 1UKPA 1I7UA 4LSSL 3CKHA 5C09B 5GJSL 4ZQKA 4Y5XA 4OKDA 1SJEB 1JPTL 3OKNA 4UQ9A 1UM4H 4HXAH 1CLZL 1A3RH 5DMGD 4PJAA 3TN0B 5GS3A 4LSQL 4RA3A 5FKPA 2YD2A 4M6OL 3HNVL 4QRQA 4DEVA 4Y4KD 1RIHL 2JCCE 2FECL 4P9MH 4KJQD 1BJ1H 4JHAL 4G8GE 2HT4D 5TGBA 2VZRA 5IBUG 2WVVA 4AIUA 1KCKA 1NGYB 1LK3H 4ZPTB 5GRVK 2XWDA 1MHHA 1QO3A 1WC7A 1PLGL 5HHXL 2ZX5A 1GC1H 3T0XA 3EB7A 1CF8H 3FQXA 4CCCA 4M7KL 5C9JB 1QSVA 1R3JB 5E6YA 4DKEL 2Z8WC 1EUTA 1FZKB 3MCKA 4P4KA 5EU6B 5A1AA 3IDXH 2P49B 2GSIB 5TPWH 4ZUSA 2YL6A 2A2QT 5C70A 1LK2B 3U0TB 2DMBA 4ZO7A 1N7MH 3DBXB 1WDSA 3PXJA 1S7TB 1I1FB 4WI2A 3QFJB 1RJZB 2FJGA 2B5IB 4KZEL 1XH1A 2BV9A 3MNZB 2X41A 4KMLB 3OG4B 2MQ0A 4Y4HB 1IQWL 4XVHA 4R96A 3RZWA 3QDHA 3VE0A 3VGAC 2AXJA 5KVEL 1ZJBA 4FF5A 4WJ5A 1A8JH 3RKDC 4UT6L 3ZDYE 2B1AH 4PJIB 3X3GL 1EXPA 4G9DB 5C0JA 1J0KA 3I6KB 5C0RL 4R0LB 5IMMB 3CFJA 2V3DA 5IJKA 1YNKL 2B7DT 2XWTB 4B15A 3BPLC 4WU7A 1WWCA 5JDSA 3W9EB 3W53A 4TUOB 3E0GA 5LAXB 3RIFK 4Z6AT 3QXWA 1T03H 1P9MA 3MGOB 1NFDE 1W2PA 2X1XR 4LLYB 4GO6B 4U1SB 3QNZB 1I3GH 1NAKH 2FGWL 3AREC 4HH9B 4MHHI 3VXTA 3VIOA 1WZLA 1PYWB 2BBAA 1PZ3A 1B0GB 2NTSP 2UWFA 2AJUL 3LQAL 3GTNA 4AM0B 4OV6F 5T3ZL 3WKZA 3I6GA 1Z9LA 2WBKA 3WH7A 1B0IA 1KBGH 5IESL 2YN5A 1MJUH 4GBXD 4ZPVB 5FFLA 4P57B 3X11B 4BKLB 3RGHA 2AK1H 2BNQE 4LDLB 4P02B 3OJDA 1K9FA 4JAMB 4P0DA 2O9OA 5CJQL 1BVLA 3TOPA 3PHAA 3QWOA 3MLWH 1QR1A 3MYJA 1ZV5A 1OPGH 3C6LA 1DN2A 5EOTB 1ZBVA 1A6ZA 3ARZA 1Y6MR 5GJSH 1V03A 2W0LA 3F4VA 5L0QB 1GCFA 3ARQA 2HTKD 5I74C 1W9TA 5DO2C 1F90L 4PJ7E 3SUWA 2BERA 3OJVC 4D8PA 1E0WA 3AY4C 1HL9A 3WNKA 1UR1A 1AXTH 4H8HA 5JZ7C 3B83A 4G43B 2GJ6A 2WMJA 1EGZA 5GS0H 3CVHL 3BWAB 4P2RA 3HNVH 2M1KA 4MHHG 3ZT6A 2CPCA 2KPNA 3RWGB 1G7QB 2VDOL 4G6AC 2BSTB 4PGDB 4YHOH 1D5ZA 3U0WH 4OFKA 4ARXA 1AP2A 1OB0A 2HT3C 1X4YA 5CP7B 1FN4A 1T2QL 5LBSH 4HWEH 1UD3A 3IETA 2GY5A 1OOAA 3CK0L 5F1OB 3FRPA 4NQDB 3DXAE 1E3ZA 4HXBH 1BZ9B 3CFKB 2VXQH 4QXTB 2W62A 1GC1L 2GUYA 4WI3A 3TIDB 5I1DA 3QGVA 4JIEA 5DHYA 4AMKH 4WRLA 5B39G 2W66A 1IT9H 1L0XA 3DYPA 3IDXL 1A4KA 5CAYB 4WI6A 4U49A 2QR0A 4DN4H 1VBUA 4LYQA 4TYUA 1G1YA 3TIEB 4QHLB 3RWFA 4GRLB 2J88H 4RYDA 2N56A 2RQ8A 3W0WE 2VURA 4OUOA 3LRSB 1OVZA 3QIBD 2VR9A 1HI6A 3MRKA 2YKLH 5AWNL 1TA3B 4NBXB 4OLXL 5DJZA 1QFHA 4GKNA 2J6EL 4GRLC 1R8LA 3C5SA 5HDBE 4Q6YA 2QSCL 1PJ9A 3EMZA 4Z2GA 5DJCB 4U1HB 2CIPA 2G5BA 3RHWF 3RL2B 2AABL 4KJPD 4PY8I 4CMHB 2H32H 1YNKH 4EQ2A 4P2QE 5G05L 3PIQB 4LSRH 4GZJA 2I60H 3Q6FA 5GRYA 2Y1VA 5TFSH 4AM0A 2OL3L 4BQBA 1B0GA 1X5XA 2CRYA 1VEOA 2R0KH 3OG6B 1CGXA 1I3GL 3GSVA 5GGVH 4PIRF 2PXYD 4GRWB 5D1QC 2AJUH 3LQAH 2NNAB 4ZUUB 1UM5H 1T2JA 4QCEA 1R24A 4NSBA 2DQGL 4TUOA 2GKIA 1JAKA 5M03A 2X4QB 4BSVA 5SV3A 2X2YA 4U6HB 4BM7A 4YHIA 5E6ID 5CPQA 3NQHA 1YEDB 3SCUA 5DJ2A 3LE0A 1JWMB 4JRWA 1ISXA 3BWAA 4RAHA 1CTOA 5IIEB 4KKBC 1IGTB 5EIVA 3P11H 2UUDH 2R29H 3VE0B 4DQOL 3A6CL 4W68A 1JHTB 3HZVA 2HG5B 4WGWB 1TG7A 7TAAA 3MRHB 4B9ZA 2UWEF 1J8HE 2VZOA 2NY5C 5F7DB 1VF8A 2V9TA 4WW2A 4EN3A 4HA1A 3ISWA 1YQVL 4QRTA 1HINL 4NRSA 3KPQB 3VFOA 4ERSH 1SMOA 1F90H 4NQEB 2BXYA 1P4IH 4XI5C 1OARL 1VFFA 5IMKA 1EHLL 3C2SA 2YPKB 1CFSA 3CIHA 2IAMC 1UY2A 1IFHL 5TD4A 1RZKC 5MEQA 4QDMA 3FQRB 5JHDE 2Z9TA 4HIIB 3QBTB 4JFFA 2W95A 1DWJM 5KVDL 3BKJH 1MAML 4P2QD 2VLJA 1P53A 3OAZK 4ARYA 2UY5A 3W24A 5C0AB 5DO8A 4QRPD 3RDTA 4C58B 5KSVA 3KLHC 4UV4L 1E4JA 1RJLB 3BO8B 4S1QL 1UZ1A 5TGBB 1UWGL 1A6UL 2DSUA 5SWZE 3HI6L 4FTVB 3MROB 5KAQG 4UAOC 2APBA 4Y1AE 3LVEA 5I8KL 4GOSA 5FK9B 4JFFE 4JG0L 4AMKL 3JXSA 5HHOB 1JDDA 1IT9L 3L2LA 4RAVB 1OB1A 1B3JA 5DMIH 4ZFOA 4PLKD 2XFRA 4X6FA 2PXYB 5HVGB 3WHE1 1XGRB 4O51B 3BSZL 2WSPA 3OKLB 4RE4A 5F3BB 5FYJD 3N1QC 5I23A 4V1DE 3LKPA 1SY6A 3T3MF 5FYKH 4NPYB 2UZYB 1A2YA 4PGCB 1IE5A 4A2MA 2O92A 3IDNA 3ZKNC 1AQMA 5EWIL 3ZE1F 4UFHA 3VFWA 1OF4A 4G6JL 1KJ3L 1BQUA 1MCNA 3MRIA 3SKVA 1UENA 3CFBA 2EE9A 3PTMA 1FSKB 2XXMB 1FFOB 3OXSB 3AC0A 1QW9A 1F11B 3HN3A 5IQ7L 4Z7VA 4E41D 3BAYA 2Q6WA 4FQIH 5EU4A 4K55A 2C1OA 4G42B 4HA3A 4ZFMA 2GSIA 4XZUG 2X4OA 2BSED 4WK9A 1A14L 3HG1A 5DRXB 4RMWA 3RVUD 2WXDM 1W99A 3GNPA 2XACC 2R0KL 4HKXA 1CQKA 4YFLF 1VFUA 2GTWB 3EFDH 1NGQL 2CIIA 4U1LA 1B2WH 4EAMA 1W32A 1T1WB 4KK8C 5KN5B 4LEOB 1FAIL 4F15C 1DDHB 3KNBA 4XB3A 4IDJH 5IVXB 1JTOA 5FYJU 1B30A 5DTFA 4QOKB 4HKBB 4R90H 4L4PA 4Z2IA 3SJVB 2I07B 3TNNB 3UO1H 2P7TA 3H7BB 4WFHE 3U4AA 2APVA 1YMMB 3V0WH 3RWIB 1LO2L 3TN0C 4NO0D 3W27A 4KUCD 4W70A 5KG9A 3QFDA 1ZVSA 2R4SH 3P9WB 4KKAD 1HX0A 4OUUB 3ROOA 3U7YH 1UWWA 2J7HA 4JY4B 2ZKHL 1OBAA 4DXRA 3IIIA 2E31A 3NGBB 3GJEA 1KGYA 1EBAA 4ERSL 4MS8C 3WE6B 4LKCB 4YHZL 1EHLH 3U57A 4Z7UF 1I7ZB 2OJEA 1TZIA 2XWJB 1T22A 2YK1L 5HGHA 1R7OA 5F88A 3BISA 3KYKL 3GKWL 3QXAA 1A4JA 4FFYH 4UTAL 2J7LA 2BMKB 1CDYA 1T1WA 4YXHL 5I1EL 4DVRH 3S37H 3JTSB 4ZDHB 4WSKA 3HEIA 4F7TA 1JMXA 4MJ6B 5TF1H 1WICA 4I13B 4NQUA 4S1QH 4Y8AA 2ZZUT 1FLTX 5CCKH 5L8JB 1FAKT 1DLHB 4P9HL 4YR6B 3QIWB 3I9GL 5TF0A 1SJHB 3ULVE 2R69H 3QEGL 3GMMB 3DUSA 1HQRB 2BMKA 4JG0H 1UD8A 2WCSA 4GW5A 1BD2A 4QXGL 4Z7UB 5GISH 1Z0NA 2VX5A 4G7VL 4NWUL 2J12B 3CLFH 5HHMD 2R0LL 3WBDA 4FQ2H 1MPAH 4W6WB 4XRCA 5J6GB 4XP1H 2YWZA 3IDNB 2BOCB 5FYKL 5HNNA 2HJLA 1FVEA 5FYJL 4H1LA 3FOMA 1UQSA 4I8DA 5K59F 3O2LA 2VITA 4N90E 4YK4B 3C7GA 3WD2A 3B5TA 3QNXB 3WNLA 3NABH 3VFPB 3WXVL 2OZ4L 5E5UB 3S97C 1KXHA 3OA5A 4TVPH 2YUVA 3ACIA 1HYSC 4G8EB 4KVNL 2YKKA 4LASL 4FQCH 4ZNEA 1YMMA 4FQIL 2HISA 4UCFA 3P73B 1WBXA 4JEGB 4XPGH 2DT2A 4PJAF 5FGCE 2DQFB 3DX7A 4S11A 1PMJX 3QUML 4GKOA 4PMXA 1Z9SA 2BNUA 3FT2A 2VABB 3NFPA 2FEEI 4OFVA 2Q7NA 4I0CC 3KE0A 2H2SD 1L7TL 1VIWA 4N8VA 2IC2A 4KQ4L 2NXZD 4BJLA 5D2NE 2CXGA 4HUKB 2FCBA 4OTXH 4LNRB 5IGXL 1E4NA 2YPLB 5I1IL 4OSUH 1XFPA 1WFTA 2DQUH 4NUGL 1QA9A 2GSJA 2VDPL 1UFUA 4LLUB 3GSOA 2AW2A 3S8WA 4QX0A 2B4KA 5AD0A 5EBMA 2XT1B 4IS6A 4MWFA 2I9TB 1FPTL 3O4LB 4JO4H 2AKRA 4YBHA 5C0AD 2GK1A 1AC0A 5DC4B 1KC5H 1FCCA 3WH6A 4PRBB 5D8JL 1UCTA 3NIDE 5ERWB 1CDHA 3MCLH 4N1EA 1W3JA 1LO3L 1A1OA 4LCIL 4MNLA 1KNOA 1N4XH 5KSBE 4I3SH 1BIIA 3B43A 1RP8A 1YN6A 4XZUA 4JZJA 3H42L 3LQMA 1KJMB 1UXSA 1XPWA 5K59E 2EIDA 1XRVA 1JGDA 4XVUC 5C6TL 4Y1AD 2EYTA 1Q6EA 1F58H 1MI5B 4YHZH 4FQLL 1QOXA 3S35X 4PLJD 3UR8A 3P6BA 3WLBB 3AAZA 3L5XH 2CMRH 4OGXH 4YIQA 2XNAA 4DZ8B 3QIUC 1NUKA 3GJFK 2CHNA 4HKBA 5FYJE 2DKMA 5A2AA 5FO7B 3RNQB 4UTAH 1YQ2A 3SDCB 5F7HA 3QUYB 2WN2A 3RJDA 1MAKA 2VE6A 2MQ3A 1RZJL 2BRRH 3O2DA 1PG7W 4NM8H 5IB4B 1I4FA 3QIWA 1KLUA 5KZCD 3FL7A 3U7BA 4X83A 4M1DH 4M8UA 1AI1L 1UZ6E 1Y0LB 3V4VH 3STLB 3AICA 5FV2A 1NCAH 5LA0A 3EYUL 1E27B 1CL7H 4QXGH 2L7UA 2WCGA 2Y06H 2X4PA 3C5SB 3RPMA 1JD7A 1DBJH 4PJGB 2DI9A 1U92A 3KPLB 4UILL 2MKWA 4NWUH 5E09A 4JKPL 4LLQA 2KL6A 1T7ZA 4MB5A 3RIAF 1NOUA 2XIBA 4MD0B 3TA3A 4AWEA 4LHUD 4HMDA 4POYA 3VUPA 2W9DH 1UA7A 4N8PA 3WQ6A 4EI5D 1WDQA 4PGCA 3QNYB 5E2WL 2V5RA 4GQPH 4TVPL 3BKMH 4HJ0C 2B4CC 4XVSH 3BUYA 1C93A 1RJYB 3A21A 1Q38A 1CDCA 5IJVB 4PMVA 1PKQE 2X4SA 1KJVB 4CVZA 1CTNA 5F96L 1UWSA 4OGYH 1DVFD 5GJTH 3MUHL 4R2GD 5JA8B 4NDMB 4A44A 1AMYA 1BREA 2YLLA 3VXME 3ESVF 2XN9B 1KCSH 3PWLA 5JQ6L 5H35A 1MCFA 4KRTA 4JKKA 5EUOE 4KQ4H 2HH0L 1D5ZB 3C5JA 5C0BA 3LB6D 2R4RH 5MERB 3PZ9A 2CDFB 1G7JB 2NX5B 5BOZG 5J6HA 5T1KA 1IARB 3QDGE 2R8SH 2GJ6B 4G43A 1Q6DA 4ET7A 2R0ZH 1U30A 1ZS2A 2Z31A 4IJ3B 2VDPH 1ODAA 2ZCKL 4X6EA 2JFEX 2ARJA 5ADOL 1TZ7A 4OJFH 5C1MB 1V7MH 3NMEA 2YPKA 5CINL 2HJFB 1OTTC 1TVHB 3CU1A 3MRBB 3S36X 3S6TA 2C1OB 1KC5L 4XNMA 2A6IB 4D9QD 5D8JH 5EOCH 5CZVL 1VGEH 5EOTA 2XKSA 1TJHH 4K7FB 3QI9B 1S7UA 4LCIH 4XBPA 4ZSOE 2V7HA 2QV2A 1N4XL 1KIQA 1SBSL 1CGYA 5B39B 2H3NB 2V7HB 4JPKL 1T5XA 4IHOB 3ILQD 1MCEA 2EEBA 1A6AB 2KBGA 3W0KA 5E2UH 4L3EE 1ZS8B 3HC4L 5IEHB 1BFVL 1E27A 5L2KB 4I5BA 2ZG1A 4DKAA 2AGJH 4NN7B 3ZYIA 3D9AL 3L5XL 2QR0B 1JWMA 1T6WA 1J1XL 5E0CA 3HC3L 2Y6LA 3NA9H 2LTQC 4PRPA 1KG0A 4XURA 5C08A 1XGRA 4OGZA 2C5DC 2D7PA 5TDOA 5C0CA 1FGNL 1EV2E 1PYWA 5G04L 2VE6B 4PJFE 4QXTA 5I8EA 3ECBB 5HD8C 1X4ZA 2VLME 3S9DB 1MCPL 1EQCA 1C12A 1KTLA 4WW1A 3NJ3A 3U9PL 4FTVA 3L3JA 5AEAA 1SQ2N 3HPLA 2XNAB 1ED3B 4XBEL 3I2HA 5A8PA 1IGML 3DTXA 4MVBD 5C0CB 3O4OC 5IMMA 4PGDA 1CFTB 3DSFL 3HAEA 1NUNB 2XPKA 2DBJA 3GK8H 2M26A 4K3JL 4UINH 4DZBB 5D96B 2R1YB 3P0GB 5BYWA 4PBWD 5AZ2H 4KQ3H 2DWEA 1IC1A 3QJFA 2VC2L 4NRXA 1OY3B 1A21A 5DD1H 2DQHL 5F7MC 3VIIA 1I75A 3MRKB 3L3IB 3RX8A 4KJYA 1K85A 1C90A 4QF1B 3QI9A 1KPUA 2ATPA 5E1HB 1KELL 4BDVB 1VPOL 3E6FB 1IKNA 4WUUE 3GSRB 1NCUA 4MAYC 4NJ9H 5E2WH 1UYZA 3BKML 5EBMB 1EJ6A 2OWXA 3PZGA 4QX1A 3NVQA 3HFMH 3AHZA 1CICC 3QEHA 4XXCC 9CGTA 3PV6A 2P1YA 4ZZ5A 1CLZH 1MPXA 5E70A 5FYLH 1NPUA 1WTLA 2ZCHH 1U41A 3BDXA 4LVHC 4LSQH 3GRWA 4LPWA 3DIFA 3NAAL 4M9PA 3D85B 3HKFA 2Y72A 4CD6A 1RIHH 1CD8A 3CIVA 3TBSB 1KN2H 4LCCC 4KXZH 5A2JH 2ZUQC 1BZ9A 3HJEA 3MJ6A 1EIBA 1E6ZA 1MW2A 4UT9L 2BNUB 1HN1A 2ZX6A 4Y4FB 1KJ2B 3RUGA 2YC2A 5GRVL 4XZBA 1MVUB 4PTXA 4UTBL 4WI5A 1L6XA 1OD8A 1MXDA 2D0GA 4LGXA 2R0ZL 2BNQB 1G7MA 1ZLVK 1CF8L 2WAAA 1I1AD 3IDYB 5T5FL 4KU1A 4DKEH 2VX4A 3ULUE 2J5LB 3OKNB 3V52H 3S3SA 3ZKXC 2FIRT 4HCRH 3LEGA 3DUUB 4MAYA 3GO1L 5EBLA 3ELAT 3S5LG 2CK0H 5J8OA 1GOGA 4W85A 1MCCA 1MWAA 5A2IH 3C7HA 4IIQB 3AMKA 1R5WB 3V95A 5ISZD 4UI2A 2G8ZA 4OZIE 2W59A 2KZWA 3CZKA 2W1NA 3IU3B 5DS8B 3SCMD 1H8OA 1MYRA 3HE6C 3MO4A 2YLAA 5D7KE 4Q22A 5I0ZA 5C6PB 4PRHA 1WIUA 3SOBH 3O3DA 1GGCL 1UEYA 1V6UA 1SJHA 4YDIH 1E4XL 4G9FE 4YWGL 5GHWL 1R5VB 3FHQA 5KS9A 5CILL 4P3DB 5LG1A 2Y8KA 2PWEA 2CLRA 4O5LH 3ZHDA 2V3GA 3CSGA 1ADQA 3LEXB 4MQSB 5CZKA 4P7QA 1S7XA 1VERA 1T03L 2VL4A 4ELMF 4JPWL 2PYFB 5D7IB 1MHHB 2WB5A 4KUZL 1V08A 1T66D 2WWMC 2B31A 4TVDA 4ACYA 2E26A 1QRKA 1KTKE 3NDZA 2EDKA 2ICWJ 1QNSA 1MFDH 1A6VL 4L29B 3MRMA 1FN4B 3J7HA 5E5RB 3RRQA 5A8QA 1J88A 2VOTA 1K2DA 3ZKMC 5ABFB 1QLEL 5CEYB 1OTUD 1UKSA 1WBXB 5D2LE 1VCAA 3RM8A 1J0YA 4NO2A 3QDMB 3KXFA 3DURA 5HGDB 1KB5A 1KXQE 1PIFA 3VIMA 5CMAB 2OYLA 5CZXC 1P7HL 4GBXC 4XTRD 1P69B 4NN5C 1UR0A 4RA0C 5DD1L 3NSNA 2P8PB 3D18A 3JTTA 1ZVSB 3PGDB 5AC5A 2FEDC 2RR3A 3BIKB 3FMGH 4IOFC 3FOMB 5KG9B 2PB1A 3GFUA 1I7UB 4I3RL 1MRDL 1JU4A 1TNNA 4FLSA 3BVNA 4HA4A 2EDYA 2Y36L 1JZ5A 4R0LC 3L5JA 3D25B 4M02A 3N17A 2ZEZA 2Z8RA 4N8VG 3FCTA 3T4YA 4F57L 3L4VA 2IF7A 2DQTL 3UJIL 6CGTA 5D4YA 3WFDH 1N64L 1UMHA 1V3JA 4F79A 5SX4H 1BGGA 5T3XD 3CVHH 2KZ1B 5CLWA 1M7DA 2JB6A 3RGVC 5FUIA 4MD4A 2B5IC 3WMBA 1T6VN 3VD7A 1DQQA 3STLA 2VT0A 2WHKA 5GGRA 3RUGE 4JRXA 3IANA 1F4XL 2NLJA 4HWEL 1IGCL 4XMLH 2WVVB 2BZDA 3FZUD 4MJ6A 3W11C 1TVBA 3B9VA 4XPBL 5DPNA 3UTZA 2DH3A 1OAKL 3QNZA 5D1QA 5F88B 2H6PB 5CJ5A 4N0CD 5C0EB 5T5FH 2IPKA 3H3BC 1KR1A 5GNZA 2FX8L 3AHVA 4MCZB 4NT6A 5ECJE 5JXGA 4N0UE 5IB4A 3UTTB 4I2XA 2X4RB 4D9RE 2VVSA 2FL5B 2PYEA 1M05A 4HC1L 2VLMD 4ALAH 3FT3B 1FHLA 1U95A 3MLTB 4XAKE 3U5UA 3KPSD 2QEJA 1P5VA 2YEZA 1NX9A 4NQEE 1OM3H 2XTJC 4RFOH 5ANMA 1F3DJ 1UD4A 4UQAA 2YKLL 4Y7EA 1F3RB 4ZFOB 2F53D 3AZSA 2HFFB 4LF3B 3D3VD 3FB7A 1B31A 1LG2A 2DGAA 1I8IB 3VA6A 1W0WB 3HE7B 4PJCE 1I1FA 3HS0A 4GRLD 2AABH 4NI3A 4M7LT 5BVJB 4LKXB 2Z4QA 3D3VA 4LSUH 4WI8A 4D3CL 4O5LL 4BK4A 4JKMA 4KXZI 2AJVL 1DDHA 1YC7A 2I60L 5TFSL 4H8VA 1GIGL 3MO1B 4LEOA 5FGSA 4FTVE 3CFCH 3WF4A 3ZDXF 2IANB 4KUZH 4Q74A 1GOIA 5CGTA 5I3DA 5D70L 4JFFB 4E9LA 2CNCA 4JY5L 1TENA 3W39B 1UM5L 4PB9H 4F8TA 5A2FA 2ADJA 3OAUH 2W0PA 4PJIF 1GYAA 4UT7H 2QBWA 3IKCA 3FT2B 3NFPB 4ISVA 3WKNA 5A2BA 1HKIA 5D7SL 4GI9A 3U5YA 5E95B 1Q72H 3S3PA 3P11L 3DUHA 5BRQA 3VFSB 1HSAB 4UV7H 1JFQL 2E40A 3A6CH 4NRXB 3QZWA 1L9MA 4B7LA 1ZJAA 1JWSA 5T1LD 3ARFA 3DHMA 3MLTA 2Y36H 1FCGA 3ZHLA 4PR5A 2ZJSL 1UXWA 5BV7C 4HK3N 2CH8A 5HDRA 1XGQA 1HINH 3BN9C 4N9OB 3H0TB 3CHEA 2BOCA 4LCCB 3GH4A 3RJXA 1JK8A 3VG9C 5EMYA 1WBZA 5JMOC 4HAFA 2PI6A 4S1DC 3SCVA 4QCFA 1WT5C 2VAAA 3WFDL 4JFED 3QR3A 2YUZA 2EIBA 1NWSA 2J1EA 1CFNB 4MLIA 1C12B 4GMSH 2QQJA 1NCTA 3KYNB 3WIFA 2ZEWA 5FUCE 4BUHA 3CVHB 2G9HB 4F58L 1I8KA 1CT8B 1DZBA 3MV8B 3O3EB 3M07A 1KCLA 4KI5E 3TJHD 2AEQH 1CICA 5IVXE 3B6SA 5TDOB 4WHYG 1IGCH 3HUJA 3LH2L 1JGIA 3RZCC 2AV7B 3WF1A 4JG1H 3RDTB 5KSVB 5KS9B 1IKNC 4LYRA 5FL0A 3UTPD 5HVFB 4Z2KA 3B9EA 2VLRD 1KEGH 2VKWA 2NXZB 1IGYA 4Q2ZB 2EYSA 4C7FA 3GMPA 4AZHA 3PL6C 2XM1A 4AEFA 3B9AA 1AQDB 3ILPA 1T3FA 1B3WA 5DS8A 3V9FA 4HS3A 1RSFA 3QEQD 1WEJH 1T22B 5JXEC 1GZJA 4ELME 4K3EH 2Z92A 1A6PA 1WO2A 2A38A 2Q8AH 3CSBA 4JPVL 4P2OB 4AXNA 4MJ2A 1KN4L 3DYMA 2AJSL 1JGLH 2ZP0T 3H9ZA 1P8JA 4AYSA 3UXFA 4EXPX 3MGAA 5JXEA 2WVUA 1HH6A 5I1KL 1EDTA 5GSVA 5C0FA 4BQ6A 3FKUS 4JVUA 3QRGH 2E7HA 1C8XA 3ZR5A 1UUQA 1N2RB 2OR8A 3D39E 3BKYH 2FWOB 1QI5A 1MVUA 1XHGA 4JDVA 3B5GA 3TCLA 1INQB 2AJVH 4L29A 5AZEL 2CSPA 1TQBB 2D7TH 4FFWD 2ESVE 1LF1A 1G7QA 2F54B 1QACA 2CRIA 1ZANL 4JY5H 4KI5M 1MFUA 1RZ8A 1XH2A 4Z7UE 1URLA 1XGYL 4PG9B 5C08B 3TYFB 4IDJL 4ODXB 4RRPG 4ODSH 4P2OD 3U0PB 1S7SA 4CNIA 4JFDE 1KIUA 4UIKL 4M5YH 4U1GC 2O5YH 3MRNA 4L9LA 5CYYA 1BPVA 3ZOAA 5IM7A 3PUCA 4D8MA 4GW1B 3SKMB 3HA0A 1N6QH 4ZS6D 1Q72L 3LMJH 1JN6B 4ZO6A 1TZHA 1UYWL 1W9BM 1N0XL 1OAZL 4ZUVA 2R4SL 1HJUA 3PTKA 5D7JB 1HP4A 4YBLC 4Y88A 2GK0A 3T8XA 3STBA 4K7PY 4KKAC 2HFGL 1YJDL 4OI8A 1CECA 1NEZA 5FGCB 5EU7C 4AZBA 2E9JA 5ENWB 3EBAA 1N5AB 3BGFB 5C0IA 1T83A 5TDNA 5HYQB 1HKJA 3VDBA 3O9WA 4OCWH 1ULPA 4NKDA 5EB9A 3S37X 3K3QA 4MS8D 1J1OH 5C09E 1YNLH 5J6HB 4XCFH 1B0WA 4OFYD 3TT1L 3T0BA 3ROLB 3CFKA 2CDGA 4RGNB 4KRLB 1OSPL 2E9IA 5E9DA 4X4YB 4Y16D 5TF1L 3WSUA 3CLWA 1INDH 3TVMC 4DUXA 4UB0H 3WFCH 1A9BA 4W4ZA 2X1OA 3I6KA 5T3ZE 1N7ML 3T3PF 1MFBH 2R69L 1L0YA 5ENWA 3MLRH 2VLJB 3G08B 3TFKC 4URTB 4KZEH 3FB6A 2MCG1 3T2OA 4HOXA 1KJMA 1UXSB 4EQ3A 1E40A 2DT1A 1GOFA 4ESKA 1I9RH 2ORBH 3AYRA 4YBLB 1G6RL 3EZJB 1TVDA 3CLFL 5EOQH 4DVBA 3WN6A 4NSKA 5EO0A 1MHEB 3IJHA 4PFEA 2Q87A 4L8SB 2Q8AL 1ISYA 3O4LA 3MUAA 4LHUB 4IS6B 4MWFB 3GJFH 5FOBB 2AJSH 4G8FB 2PYEE 1JGLL 3VW3H 3W26A 1F3JB 5TE7L 1X4XA 2AAVA 5TQ0H 2WBJD 1Q6FA 5DVNA 5TDPA 4M3JA 4AW7A 15C8L 5DRWB 1CE1L 4P46C 3G6JE 3IXTB 1FIGH 4LRNL 3OJDB 3VIJA 1NAML 2HLFC 4KVNH 4M9OA 1KLGA 4FQCL 1MSPA 3VH8B 2LV4A 2FGWH 5KAQF 1X6NA 1UOKA 4M93C 4XB7A 2NY5L 4DK6A 1NQ6A 2CDFA 2R9HD 4QHNB 3X14A 5T3ZH 1S3KH 1L4IA 4MXQC 4QRUB 1JBJA 2P24B 2VMDA 1N5YH 1ITXA 3CDGB 1EO7A 5IT2L 5GGTA 1NCDH 1BHGA 4NZUH 1LWHA 2Z1SA 1ZANH 2J4GA 1OIFA 2WBGA 4O9HH 3U9UB 2DBLL 4OSUL 2MOVA 4ZD3H 5B21A 2IAMA 1X5HA 1FO0B 4KRPC 5IR1B 3PUHA 4WCYL 1DWFM 3O2WL 1UACH 1VFAB 4YHYB 1AKJB 1TPXC 4G7YH 4L8BB 4UAOB 1N6QL 5LGHL 1E55A 3BCDA 3Q0HA 3U30C 4UOQA 1BQHG 1UEMA 1UYWH 2Y6GA 3HNSL 4ZUWB 4U1GB 1VGKA 1FNSL 5F89A 2GK0B 3WIHA 1V0KA 4W6YB 5H37H 4ZMAT 4AD3A 4LVNB 2ERJC 4ONHB 3MBEC 3QFJA 1EHXA 4CCDA 2EXWD 3GIZH 3H42H 3LKOA