5CZKA

Structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
603
structure length
600
Chain Sequence
b'SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucuronidase
publication title Structure and Inhibition of Microbiome beta-Glucuronidases Essential to the Alleviation of Cancer Drug Toxicity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 193
structure length 600
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czkA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5czkA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5czkA03
2FH8A 4W8JA 4IHOB 4P2YA 2ESVB 3MA9L 1LILA 3MFGB 4GSDH 3RY5A 4HF5H 4GMSL 2WBJD 4P2QE 1OB1B 3BT2H 4KROD 5EUOB 1VJSA 3P0VL 5GIRA 3B8SA 1AGDA 4N8VB 3WMSA 1GCYA 3D3VA 4H88L 5C7GA 2BOBA 3SKNA 2VRAA 3CFBA 1NC4D 1ODUA 3GKWH 4V27A 5F8QC 5IQ9A 5I19L 3QAZC 5TDOA 2FGWL 3ALFA 3W0WD 4H0HB 4YHLH 1NBQA 1AP2B 4ZXBD 5DUML 5GXBB 4X9HA 5DURD 3ZTJH 5HBFA 2I5YL 4DN3H 2ZPKL 1KCRH 3BUTA 3PV7A 2C1PB 5H2BB 4XNUL 3A6BL 3KDMB 5CEXA 4B15A 1VENA 3CZ8A 3H9SE 4OGZA 4DUWA 5L7XH 3QAZB 3ECQA 1AR1C 1KPVB 3OMZA 1XF4A 4ZZ5A 3FXYA 2F19L 3BSGA 3EJYD 1T03H 1K8IB 5EIQA 1JK8B 5GRJH 2WAGA 2VR5A 4LLQB 1CBVL 1FRGH 5T1DH 5I1HL 3P6BA 4N1EA 3QZWA 1XNTA 1RIUH 2VX7A 1MFCH 2CO7B 4XMLL 2PO6D 3O81A 5J3HC 4CVUA 4U1GC 4Z6AT 3FAXA 3FO9A 5BZWB 4HWZA 1NLDH 3DGCR 4YNYB 1T2XA 1E71M 5K33A 2WWDA 3HFMH 1F4YL 4EQ2A 2EIZB 4AXNA 4W5ZA 3SUSA 1HKKA 4JFEB 3Q5YA 2EYSA 4NNPL 4DGVL 4TOYH 5EOTA 3P4MA 1CTOA 3I6KB 5HI5C 1H3UA 1ZA6B 3PZNA 3CLEL 2ZUSA 4OD1L 4JZJC 4U1GB 3AMDA 2YPVL 1U8HA 4X6BA 1CDYA 1ZHNA 4X4XB 5CBAA 1FH7A 3DSNA 4QXUH 4DAGL 3KJ6L 2ZCKL 4GZ9A 1T6VN 5CZKA 2JEQA 1R3HB 4AL8H 3QOMA 5D1QD 1ZGLA 2H9GB 5AD0B 2IG2H 4HUMB 3B6SB 1ODAA 2NZ9D 3IJYB 1E70M 1C7SA 5I1EH 2X89D 5F6IC 5ICYA 1AQ0A 2RB8A 2XACC 4G8EB 4YDIL 1ZMYA 4JZJB 1D5BB 2UZIL 3GZKA 4QRPE 2P48B 3V0AC 1DL7L 5I1KL 2GUYA 1PVHA 4JZNA 3V0WL 3L2MA 4GAFB 1RZFL 3C8DA 5DD6B 1DEDA 4L8BB 2XY1A 1A4JA 1ZVSB 2I25N 1E3ZA 4Y5VA 4UFKA 4H8WH 4JJ5A 4PJEB 5LA1A 3TJHD 5CKAA 3RWJA 3TIEA 2YRPA 3C2AH 3LKRB 2J12B 4A6YL 4RX4A 5C0BD 3V7AE 5BXSA 3QUMA 4JM4L 5F6IB 2P8PA 5FCZA 3LPFA 1KC5L 1E4LA 1HJXA 3HNVL 4JN2B 2R0WL 4Q7NA 5KANG 3TT1H 3LKSA 2VC2H 5MENA 1T4KB 3A4XA 3F12B 5B38B 4XC3H 2DT0A 1W0VB 4KRNA 2VRKA 1NGPL 3PWPD 3T0AA 4GINA 2WHKA 4LRIC 1KBGH 3IDGB 2FJFA 1IGYA 5JBDA 3O3DB 1OTUC 1D6EA 1MRFH 4KTDH 5DD3L 4PJCA 2HTKD 4ODWA 2AV7A 4GQ9H 2WMHA 3H9HB 5FYJE 4ZFMA 2APXA 4ZFFA 3LN5A 5DD0L 3SGDI 1KEGL 2V7HB 1E28B 1ZT1B 1DLFL 5DT1H 4KMTL 4N5UA 1GU3A 4CCEA 5DQDL 3MFFA 5IW6B 1ZHKA 4L4VD 3RZWA 3WJLC 2WZIA 3E8UH 3L3HB 1G9MH 2CKBH 2QSVA 4AZ8A 4X7SL 3MCLL 3BPOC 3G5YB 3SDYH 1KLUA 4RE2A 3WS6C 1HKJA 4JZOB 5HHMB 4UTAL 4YO0B 1V7NH 1CVRA 1BLIA 1U8MA 2YC1B 2RR3A 3EB7A 4KTEL 4S3KA 5D6DC 3U46A 4PN2A 4OGXH 5D2LA 1KULA 5H35A 1BIIA 2AXJA 3HAEB 1CF8H 2YEZB 5KOVC 4XZUA 1CR9H 4AD3A 1E4WH 4S0SD 1ZLUH 3CUIA 1F4XL 4I4WB 5CJOL 6CGTA 4V1DA 4U5KA 3BPOB 1ZLVK 4UB0H 2DLFH 4UINL 5C8JB 2EIEA 1YJDH 5I6SA 4PBWD 5FF6B 3FB6A 3HB3D 3H2WA 1NCNA 3L3IB 4P8UA 1NFIB 3OHXA 3IKCB 3UBXB 5HHOE 3FQNB 3V5HB 5FOBB 3WKNA 4HS3B 3C9NB 3ZQ9A 3PL6C 1X5XA 1JMXA 2XFYA 4LASL 4N1HB 3PZOA 2IEPA 3C08L 1E4JA 1QFUH 3PUHA 5ENWA 2FX7L 3SDXE 3PWUA 3NCOA 3BP7A 1UJTA 3L3OB 3MODL 3P2TA 5ACZA 4TNVF 3VRJB 4FFWD 5CJQL 2VLRB 5JW4Q 4NKDB 4HZ6A 4MAUH 1AGFA 4MNQA 4MDIA 4Z18A 3L3JB 4OFVA 1IVLA 3NZHH 3E1F1 3MRHA 2RGLA 1ONQB 5CG0A 5EPMA 3HG1E 1Q0XH 4DXRA 2Z31C 1RI8A 2GJ6D 4WFGE 3QXTA 4XP4L 3PL6B 3BYYA 3WH7A 1P84K 2BHZA 1CLOH 2ATPA 3J8F7 2Q8XA 1N64L 4V2XA 1A9BA 4NYLB 2GK1A 3QIWD 2AEQH 1T1WB 1DUYB 3DI3B 1H3TA 2ED9A 4PRPD 3SJVA 5JR2A 3ARGD 1WFOA 2IANE 1YPZA 5CIPB 1V6UA 1UWWA 3QDJE 4H20L 2A9ML 3VFGH 4PMNA 1WNOA 2Z31B 1WBYB 2ZOLB 5DHYB 5L2KE 4FTVA 3ZTJG 4XVJL 4BQ9A 4J8RB 1E1FA 1RUAH 5DQ9B 1NGZA 4IEFB 3MV7D 4Z7VE 2CBJA 3QO1B 4Z9KB 4WNQB 3FO2A 4PJXA 5DN2A 2UY3A 5L2JA 4OI9A 5M5DA 5HI3D 4RGND 3OXSB 1D5IH 5KSBA 1JGVH 1C08B 1BD2A 5E9DE 2WCSA 4LPXA 5EA0H 3L3KA 5L6YH 3EDFA 3RPIA 4QXTA 3PABB 1GC1H 2FR4A 4RZCA 1IARB 2HT4D 1QSFB 4HHAA 1FVCB 2P5ED 3BKCH 2ARJQ 2ATKA 2FHBA 1T20A 2PYEB 1W3HA 4MYWB 4KK8C 2YC2A 1IRAY 3C60C 3MJGX 2XQBH 2FWOA 4NFBA 3D5HA 1MI5E 3WNLA 3CUHA 4JG0H 1FGNH 2B20A 3NPSC 5A16B 1GPFA 4M5ZH 4NZTL 1T1XA 2KZWA 2X4UA 5DRNB 4EQ3A 1R3IH 1DQQB 1KIPA 5HVFB 1NMBL 1B9ZA 3IDXL 4E8DA 1YEFH 3QWOB 5E24E 1CDHA 3HNMA 3O3UN 1UKOA 2HKHH 3QA3A 5C9JB 2X1QA 1JN6A 1I7ZA 3TA9A 3C60B 4OQTH 1JGDA 1NFDE 1S7QA 4PRIB 3UPAA 5I17A 5IB3A 5JHDA 3F4VA 5I1IH 4A42A 5E0FA 3WQ8A 2YD6A 4PUBH 4UV7L 1HXYA 4O2CB 3W38A 3CH8A 3GGWB 3NPSB 1FYTD 1J9CT 3EYQC 5HDQL 2F61A 3SE3C 4QB6A 4OAWB 4PY8J 1A7PL 3ACHA 4RN5A 4JKPL 4BFIA 4AYFA 3GEWB 3VXUA 4FMFA 4LLVB 4OZHF 2VXSL 4DGYL 4KZDL 1IKNC 5AYIA 1M03A 5A8PA 1EHNA 4ZE5A 2FNBA 4Y5YA 4ZS6C 3RFZC 4MZ3A 3UR7A 3HE7A 4WEBH 3QUXA 1MIEL 5JXIA 1CFNA 3V6FA 3DBXB 4KI5F 4Z76A 4R2GD 3N9GH 4X4YB 2NR6D 4TUJA 1IEAB 1V0NA 5D96C 4XNQB 1BVZA 1U3HA 2J5LC 2WINA 3EZ8A 5A2KH 1UGNA 1FH8A 4W86A 4P46C 4F2MB 5FYLD 3SCVA 3DVFA 4WI5A 3WIHH 2NQCA 3MXWL 4HK0B 5EZLB 3ABZA 2CUMA 2B0SH 1J18A 3ZMRA 5BW7A 2UZYB 3GUTB 4NBYB 4WFHE 3AYSA 4Q0XH 4XPGH 3VXRD 2YBRA 4ZFGL 1GUVA 2Y4SA 5LWYL 3AQUA 4JY6B 1YN7A 2OJEB 1HYSC 3R8QA 2FX9H 2BK8A 5D96B 1NCBL 5GJTH 4YBLC 3WN5C 4Y0GA 2J5LB 3IU4L 3ORJA 2C3XA 3EYVB 4ZUWA 1RK1B 3KYKL 4G6KL 4TRPH 5E0CA 4P46B 2BX5A 4Q58C 3D85B 2R0ZH 1YNTA 1OAZL 1XF3A 3FB7A 2CD0A 5DFTA 2YFUA 1V03A 3LMJH 1BWMA 2OR9H 1I8LC 4KHXH 4GOSA 1TLKA 3EMZA 2XZCH 4JFSA 1S7VA 5AYUH 3DUSB 3VG0H 3HI1B 5HGBB 5SWZA 1JXKA 4MJ4A 4Y19A 3CGTA 1IM3A 1LE9A 3M6DA 4YBLB 3WN5B 1K4DA 4YZFE 3CNKA 3HUJF 3HPLA 2ZWYA 3QYCA 2CDOA 1A7QL 2WBKA 3HKFA 1DQLL 4JGUA 3VTRA 2HT2D 4PJFA 3DRQB 4PR5A 4XP1H 5GS2D 3OZPA 2JB5H 3ZKQD 1MCLA 4NBXB 3S35L 3RHWF 1TG7A 5B4MC 2VISA 4DFHA 1REIA 4P2QD 1OINA 3FRPG 2JIXB 4GRLC 3O6KL 5EB9A 1MY5A 1F4WH 3SKMA 3BISA 4F57H 1MLCA 2LAAA 5F9OH 3O6FD 3U1SL 2VQUA 5EZIH 2JFEX 3VI4F 5BOZG 3K1KC 5EN2B 2E9JA 3TC9A 4MD4B 1OTSC 3FCTB 1IT0A 3T2OA 4ZD3H 4L4TE 1JBJA 5FL0A 2WBGA 1RIVH 1NP2A 3E6FA 3OL2A 4QCEA 5I1AB 4MNGE 1X5FA 1E15A 5ECUA 5SWSD 6FABH 3WSQH 4GRLB 4KDTA 3QDGD 3CSYB 4KJWD 3OJDB 4ARYA 3ZKMD 5T1LA 3IKKA 4F9PA 4UFHA 2O92A 2V9TA 3MUHL 1P9MA 4AIUA 4QHLA 4M1RA 3WD1A 1BX2B 2B1AH 2EKSA 2YPKB 3BP6A 2MMXA 3HLAA 4YK4C 2IMMA 3T8XA 4JREC 4HIHA 5LGJB 2YD7A 2XG4A 3NAAH 4OUUB 4EVNB 3VIKA 4P5TA 2O5XH 4M03A 3SKOA 3Q6FA 4C56B 4PYGA 4Y8AA 3MRJA 5DA0B 4MAVA 1NGWB 2WLYA 3DV4B 4NP4H 5C08B 4NKIL 3DVGA 1KPRB 1RZJL 4W8AA 5GSVB 1T5XB 4HMCA 1YY9C 1N59B 3VFRB 1KXVA 1CD1A 3MJ8A 1GSMA 1PZ2A 4YK4B 4LARL 4JREB 5I77A 1G1YA 1LO2L 1M4KA 4UT7L 2OQJA 3KR3L 4XBGB 1UD4A 1OAQL 2XPGA 3I3DA 1UADC 1QSVA 4Z7OE 5A6MA 1F90L 2W60B 4MXWL 1K4CA 4NO3A 2AMGA 5JZ7D 3S6TA 1ZLWH 4Z8FH 5L9DH 2H41A 3PWLA 2I9TA 3IDNA 1CLZL 5JIHA 4J27A 2P8LB 4D6EA 8CGTA 3EDDA 2KUTA 3OA5A 5CKGA 5DJAA 1J12A 1C8YA 3Q3GA 1U8OA 5IHLB 3HR6A 5C0CE 1BVNP 4D0CA 3L5XL 3MRBA 3P30L 4P7NA 2G8ZA 1U36A 5GS1C 4LVHC 3S96A 2DDXA 3AHTA 4PJ8A 4D9LH 5M03A 3MOBL 4X6EB 5HI4C 3S3SA 3ACGA 4AZBA 1FHDA 4DVRH 4BCEA 4NQXA 2G5BB 3CC5A 3QCUL 3W82A 2CDEA 5C0NC 1OPGL 1GGIH 2V2XA 3DNKA 5FV2A 4A6YB 3BW9A 3QUML 1HIMH 1ZA3B 4FQ1L 4GAYB 1NC2B 5C6TL 4DTGL 3NVQA 5KEZA 4HPYL 2NW3B 1WAAA 2MCPH 5GS1B 1WICA 4LVHB 4PJ7A 4ELMF 4LK4A 2APFA 3C5JA 5I1DB 1ZV5A 2JF6A 5DJCB 3I2IA 1EFXA 4HPHA 4WUUD 5EZJA 1MFAL 4YHKH 2MQCA 3MV8E 2BC4A 4ALAL 3TZVA 2ORBL 1AVAA 2NYYC 5DJYA 4PGCB 4WHTA 1BG4A 1F2XK 3DYMA 2VDNH 1RU9L 2FJGB 4P4KA 5A2LH 2EYTA 3TV3H 1R3JA 2OI9C 5FYJD 4MD5A 4P5MA 3VWKC 5DUPH 1CE1H 2GT9A 3L6FB 3UTSB 3G08A 4U1IB 2EDTA 2N7BA 4JJHA 1VFOA 2C3VA 1XIWD 3WUWA 2NTFA 4JHOA 5F6HI 1S5IL 3BH9B 2IAMD 4K2UL 3RDTA 1OD3A 1YEJH 2ENYA 4ZO9A 3UJJH 1NKOA 5CBEB 1LQ0A 4JDVA 3WFCH 2QKIA 3NA9L 2CK2A 1HQ4A 1WC7B 2OI9B 5TH2B 5IVXB 5I8KL 4Z7UB 3VWKB 4PB9L 5IP4A 3KLHD 1XMWA 3KLAA 1MFUA 1GQPA 3FQUB 1UKPA 4WKFA 5JXEA 3ZKND 5TFSH 4GRMA 3VFPA 5IM7B 4LCIH 3VGFA 5TQ0H 1OLLA 2FX8H 4DZ8B 2QQJA 1ZEAL 3DMMA 4D9RE 5T5FH 2QSTA 3D9AH 4FQIH 1WGOA 2X0HA 3MO1A 2FB4L 4WW2C 3WBAA 1QFWM 1XF5A 4HPOH 2F5AH 2BY3A 1VACA 4UQEA 2VZRA 1CICD 1D2KA 1GQIA 3RA7H 1HOCA 4R7DB 1WK0A 3LKPB 5HHNB 3REVB 2J8HA 4M93C 1B3WA 2DQIL 1RK0B 1XHGA 1A1NA 3RY6A 3RUGF 2H32B 1DTUA 4BJLA 2WN2A 2YC4A 3OJMB 4M6NL 1CL7H 3PDGA 1NEUA 2VJXA 4WW2B 2QPSA 3WDQA 1V05A 3U7BA 4XPFH 1KJMB 1BSIA 3K77A 4QWWD 1VHPA 3GXUA 1GZPB 3ARDC 1XFPA 4X6CA 1CL7I 2NPLX 3BIKA 1OD8A 2LV4A 5DJ8A 2AJVL 4WFGD 5J6HA 4M93B 1X6LA 1OQOA 2G2RA 4LMQE 2WCAA 2BNUB 5CZVL 1CGTA 4JPWH 1I7TA 5CILL 4M1GH 4WU7A 2JB6B 1R0AH 1ACYL 5ABFB 4ORGA 3BAEL 2IWGA 2VH5H 4ACYA 4NWUL 4GAGH 3QQ4A 2IFGA 1NANI 3VFVB 1CZTA 3PXJA 3M45A 3QUKA 5EWIL 3VDAA 1RULL 4NGHH 3ARDB 3SKVA 1KCUH 3CFKA 2DWDA 4EN3A 3DHMA 2NY5H 4LSRH 1HNGA 5IMLB 5FGCB 4XP6H 1MCOL 5L2KD 3QIBD 1HKIA 2HG5B 4S2SB 4OIIH 4XAWL 1FAIH 1WEJH 1FIGL 3TT3L 3KS0H 1J84A 1LG1A 3O8XC 1IGCH 3LPWA 3P4NA 3MRMA 3UX9B 3L95B 4W6XB 3LV3B 1HJUA 5CJXA 5IHRA 4PRHB 4GWIA 2J8GA 1J7VR 4JRYA 1MFVA 4KUZL 3C5SB 5GGVY 4QHMA 3FOLA 3S36X 3O2DH 4R90L 1EEZA 4OZ4B 2X9YA 3KL0A 2AI0L 3WF4A 3I3EA 4QRRE 2UWEE 5IJVA 4NQCA 5D71H 3VI3E 4F7TB 1BZ9B 3GSXB 4KWUA 4JDTH 3O8XB 1DN0A 5FDWA 4N90E 4M8QB 2VMFA 2J1AA 1FNEA 3ZDYE 1NWSA 2JIEA 4OZGB 5IT2H 2QSCH 4RGOH 1LP9F 3SGKC 2E9WA 4DEVA 4Z95L 1MYRA 5I8CB 4FQCL 1NGXA 2J25A 5TQ2H 5ABGA 1LO0L 2ZJSH 3B9KD 1A7OH 2ADIA 3G6JA 4MCYA 1H0IA 4Q6YA 3EYSL 1NL0H 1V3LA 3KWXA 3VIHA 2IBGA 1E43A 1CLCA 3G5VA 5C0FB 3EOBB 1T0PB 2ADGA 3OSKA 1XCTB 1DHKA 3EO1B 3ULUE 5FGRA 1L9MA 3PZVA 4DXTA 5E6IC 4PJBF 4CJ1A 2ESVD 1IM9B 2W0FB 4B3LA 1IQDC 4DGIL 1FLRL 2M1KA 2IJ0C 3HNSL 4G8GA 1A7NH 2XZAH 1TQCC 2CSPA 2X4OB 3QUYA 3RWFB 4P2RA 4U1KB 1PYWA 3WKML 4MQSB 1TMQA 3GSQA 5DI8B 1GOOA 1LJYA 1PX8A 2G75B 4ODTH 5FYLH 5E6IB 3OKNA 3F7QA 1UZ1A 1ZANH 4PGDB 1IQDB 1G7MA 5HBBA 4N9OB 5E1AA 2E7HA 4U1HA 1UD2A 3N1AA 1TQCB 3H9SB 3JWDC 1VFBA 2X4NB 3E3QE 4DKEH 1FVEA 5IJKA 1G7IB 1SYVA 1YEHL 5T1KB 3F5WB 4PJAE 4B0MM 4K8RH 4U1MB 1EH9A 1IQWH 4RL3A 2J3SA 2DWEA 3PP3H 1X5GA 3O11A 3GSUA 4LLAA 3ZJ6A 4WFHD 4LHJB 3AY4A 5EUOF 3LEXA 2YPLE 4F58H 2AXFB 3BHBB 5D1ZA 2A6JB 2XRAH 4QAWA 3V5DA 1IGJA 4RQQA 2X70A 2CXGA 2GCYA 3LIZL 3O2WL 5CP7A 2W65A 5EO9A 1AJ7L 4DZBB 2Q86A 1EHLH 3HOBA 2QSQA 1T2QH 1E5JA 1CFQA 4KVNL 1PDKA 1T0NB 2BSED 1JNLL 1UYZA 4U6HB 2HFEA 1JGEB 4A45A 3RI5F 1EHXA 2E3ZA 2G5RA 1AR1D 2R56L 3FN0H 4OF3A 4YDLC 3WEXA 5EIIB 1PMJX 4HCRA 1QKZH 3IXTA 5DJDA 2EYRB 3MLPA 3THDA 2PW1A 4D3CH 2I26N 4N8CL 4JFED 3TN0A 4HQQL 4EKJA 4YBHA 5E03A 1LK3H 1AQDB 1P2CA 4RFEA 3CSBA 4OM0H 1PG7L 2OCFD 2QHRH 5EO1A 1QRKA 1CGXA 4Z7QE 1KNOA 2VDQL 3D3VB 4YDLB 2RGSA 4J2XA 1CD9B 3FQTA 1NGQH 2WV3A 1JYWA 2BOCA 3CFBB 3SE8H 3SCPA 2Q6WA 1FZMA 5HTSA 4KKLD 4XMKL 1WBXA 3HMXA 3DRTB 3DX9A 1GAFH 3CDFA 5TE6L 1CQKA 3OKKA 2R9HC 2P7TB 4G8FA 4LGXA 2P5WA 3NCFB 3HC3H 4URIA 4WENB 4XB7A 1HSAA 3UPCA 3QEGH 1FGVH 5E8NA 1EGJH 3LPGA 3VXSE 3GBNL 4PJ5E 5CEXB 1OAUL 1YMMB 6TAAA 3VGEA 3QIUD 4P3WA 4NWTL 5GISH 3AROA 1XF4B 1RZJC 4YFEA 3Q1SH 2FZ3A 3LH2H 2R69H 3QSKB 3P0GB 3ZE1F 5LCWL 1W8NA 4KY1H 3WF1A 2EE6A 4ORZC 2QL1A 3QZWB 1DLCA 2E31A 3TO4D 1JAEA 2YJQA 3QPQC 1NCWL 3MRQB 4PY7A 4U1JB 5C8BB 3FO9B 1UWRA 2ESCA 2X5PA 1FORH 1M7DA 1XV8A 4P2OD 3O6ML 5FGBC 4J23A 4KKAC 4JQIH 3BAXA 1UM5H 1H15A 4YE4H 1CGVA 5FUOL 4OLEA 2R0LL 1IZKA 2O26U 3GSWB 5KS9A 1YECL 5D7IA 1FL5A 4PJEF 4JY5H 5BXFB 2W87A 1SVZA 4ZYKB 3Q2CA 2PI6A 1NCUA 3FRPA 3UO1H 1U8QB 4PJDA 2HFFB 3CVHH 4ONFL 2D4FA 4H0GA 4HUWA 2FEDC 4GG6B 3OAZH 4PJGA 5ITBH 4FQXA 1DDHA 3WS3B 4CN6A 1OTUD 1BQLL 4MJ5A 3C7GA 2DL9A 2ZXAA 3FNDA 1WCBB 1QRND 2ZUNA 5JW4N 5I74C 2QF8A 1X4ZA 5F7EH 4NSKA 5TD4A 5D9SA 4WLCA 1QTYT 1I9EA 4IRJC 4ODSH 3JBG7 5EOCH 5KVEH 1RH9A 2Y06L 1PBGA 4L3EA 5GGUB 3T3PE 4YDVA 1AQKH 1PZ3A 5CP3H 3PWJA 4EE9A 3JUGA 2JLLA 2ZSVA 3HC4L 4XMPH 5IMKA 3ARED 3NCYP 1NGYB 4U6XA 4OZIE 2LTQC 3UAJC 5HHOB 2DQJL 1JWUA 1F45A 5I73C 1G7QA 4MA8L 4APQC 2J2ZA 5I74B 5E5UB 1YY8A 4GW1A 3L4WA 2HVKB 2RCSH 4ARXA 4IRJB 3RU8H 3EOAA 1LEGA 5K59E 5I9QC 2R29H 4PREB 3WFDL 4I8DA 3OLIA 2H2SC 3F6IA 4F37F 5HGDA 2X7LB 1E6XM 4P7QA 5DGQA 2K9UA 5IMMA 5MEOA 1NLBL 5A2CA 4PTVA 3O4LA 2OJZL 1AXIB 2LTQB 4JFVA 3MV01 4I77H 2IBZY 4OTXH 4GUPA 3QUZD 2IGFL 4APQB 4ZE4A 5FKPA 3IF1A 2FJFB 1MPAH 4W70A 1ED3A 5FO7B 5I9QB 5IHZA 1WB0A 4PJCB 3SEEA 4ODWB 1GONA 1OB0A 1BGGA 4GZEA 2EDFA 3BDXA 4ZFFB 5EU6A 4I3RH 4HKJB 5HDBE 5HPMA 4QB2A 3C6LA 4XPHH 2D9CA 2CR6A 2H45A 4MZ2A 4X6DA 4XCEA 2CRMA 2P46B 2V5CA 3RJXA 1ZHKB 1E4XL 3DUUB 2AW2A 1ZHLA 4OCYL 3PQYB 3BIAX 1BVLA 4JRXA 2BNQD 2ZUTA 1JAKA 2XHNA 2Z31D 5IUSA 4Y16D 1DVFC 2VAAA 5CINH 3ZT7A 1U8MB 1NWRA 3Q0HA 2YRZA 1B3XA 1U2YA 5A94A 5H35B 2NZIA 5E9DB 4D6CA 5CLWA 1JFQH 5E09A 3UDWA 5E2UH 2ITDA 1U8JB 1C91A 5KTEL 3SKJH 3OAYH 3G6LA 2ORXA 3EFFB 1NUGA 1MWAA 2LQRA 3UZVB 3KPOA 3KPPA 1U42A 4XHQA 3TYGL 3VFSA 3BZEA 4V1DB 1EK3A 4ONHA 2UY2A 1QA9B 5IXEA 4EXPX 3RPKA 1N82A 1DVFB 5MEQA 2LU7A 3P3YA 3FB6B 3S4SB 2JF7A 1FN4A 4WU5A 5GS0L 3CFEB 1XYFA 4WWID 4UNUA 3OF6D 4HWBA 5A2FA 3OHXB 4JFFE 3U9PH 2D0HA 3KG5A 3U4BL 1P6WA 1MJJB 1N4XH 4K55A 1CS6A 5A6LA 1NPUA 3ILQD 3QEQA 5CGYC 2R23B 4OCRH 4MLSA 3WFBL 4IDJL 4P8VA 1UA6L 1JE6A 3CU1A 3PWUB 3MV9A 5DO2C 5E2TL 5DC4B 4K68A 3QHMA 3BP7B 5SX5H 4KQ3H 4W8LA 4NUJB 1QVOA 3AS1A 1LG2A 3GB7B 5J89A 5I78A 2CRIA 3WIIH 1QFPA 4MDIB 5D93C 2G3JA 3VNZA 5KZ6A 1T1ZB 1R24A 3WDIA 1RJZA 1Q6CA 2X09A 2HA1A 1MW0A 4Y4HD 5GZOD 3C60D 3S3PA 1F6AA 5GGVH 2W62A 5GGRY 4YFDB 3L5HA 4WHCA 3CO4A 4LQFL 2XQYG 4JHAL 3MRLA 1JHKH 3SQOH 2MFNA 4MS8D 1A9BB 4TTDD 3NIDF 5SWQA 5LBSH 2GK1B 1L4IA 3KWWA 4MVBC 4F7EA 4HJ0C 1LDPH 1CVSC 2WBWB 1B0RA 3B5TA 4BH7A 3EJZD 3WIHA 2CPCA 5EO0A 2R4RL 4KV5E 5EBWB 1DQDH 3RIFF 5FYKL 5D93B 1YPZB 2JJTA 1UCTA 1WVZA 5ESAA 3CXHJ 1EERB 5DUBA 2P8MB 4BK5A 2FBJH 2E6PA 4U2ZA 3TO2A 1TVPA 2W0KA 4OLUL 4PRAA 4UTBH 5EBLA 1U3JA 1KIQB 3A6CL 1HJVA 1I9IL 5ICZA 2DM7A 1NGZB 3FT3A 15C8H 1QNRA 2Z4FA 4L3AA 5L2JB 2D03L 5DMYA 3W4RA 3MUY1 4DKDC 1TCMA 3WH5A 4OGAC 5KSBB 3I3BA 1T21B 12E8L 3FO1B 3T0EE 3K4AA 3AOFA 1OAYL 2ICWJ 3IFNL 4QXTB 1OY3B 4ZS6D 5HHQA 1RVFL 4HHAB 1IAMA 2ATKB 2EE2A 1QUNA 5KJRL 3MPCA 4HMEA 2DQGH 1YN6A 2J4WL 1C1EH 2YD9A 4QRRD 1RUKH 3AZRA 1X7QA 5I5RA 1BM3H 4LQRA 2FIKA 2DT3A 4PV8A 3QJFB 2FBOJ 4U1NB 1JPST 3KPTA 5FHBH 4YEEA 5HVGB 4PLJD 2NY7H 1UXSA 4YHPA 1GJUA 1HKLH 3OKMB 3BGMA 2E7LA 4IISA 3IJHA 5DR5H 1KIPB 4YPGA 1GH7A 5E5RB 5IBLC 3CX2A 5C0GB 3AJ7A 1D3CA 1HF6A 4YXHH 3SUUA 3BKJL 3OB0K 4ZENA 4JB9H 3C09C 1HDMA 4Y5YC 5I17B 1JWMA 1ZVYA 4PG2C 4HK3J 1C5BH 1KGUA 5JR1L 3CBWA 5ISZB 2VDLL 1EUTA 1BQUA 4RNRA 2GSGB 5CFHA 3EYFB 5CJ5A 3V4UL 2QLVB 3HCVA 4E42A 4UILH 4PUDA 4UQBA 3AXLB 4DVBA 3D0LB 5HD8D 3C09B 4J7RA 4Y5YB 1OT5A 4JFOB 4L9LC 3W28A 1XPWA 1VBRA 4L4TB 3BEWB 1TETH 3V6FB 2R39A 4Z76B 4LXFA 1QLEL 1BJMA 4TUJB 2PR4H 4HS8H 4ZOAA 3QULB 2VCBA 5B4MD 1V3HA 5F9JB 1AKJA 5AC4A 2NX5E 2AS5M 4FZEL 5I1CH 3AZTA 1I7UA 1SHMA 3AS0A 3AHVA 1IAIH 3BN9C 4L9LB 1HL9A 2WAOA 2Z35B 3OKOA 3WXVL 3I84A 5BS0B 2YBRB 5ABHA 1CIDA 1L7TL 5CQ1A 4BSWB 5CEYB 1YN7B 2G3NA 2CBIA 1OTSD 4ZUWB 1US3A 4NHUA 3VRIA 2YPLD 1TJGH 1YNTB 3WLBB 2V9RA 2QLYA 3LRGA 1XF3B 3FB7B 1W1YA 1QBBA 1ZBKA 2YKKA 4QHKJ 4Q9BA 4IMKA 1CENA 4JKLA 1QQDA 3D39E 1S7VB 4GRWB 2BSSB 2AV1B 1DBMH 5IJRA 2WMFA 2AGJH 4Y19B 1JG9A 1LE9B 4CU6A 3SHSA 1RSFA 4HCRL 4R4FL 2WWMD 2Y8KA 4HV8A 1AE6H 4OF6A 1I3RA 5FKYA 4Y8DC 3I75B 3BAWA 1F3DH 1FG2A 1OLZA 1UYWH 1JPFA 1RURL 4HXAH 1GOHA 1HHJA 4PR5B 3APGA 4QF1A 4OGYL 4W84A 3T3MF 4FQLL 5ILTL 3ULVL 2DCJA 4MX7B 5IB2A 2F54A 4OF0A 2O9OA 4XPAH 1KSRA 4BZ2L 4DXSA 1FNFA 5C0CB 4KDTC 1DBBH 4HIXH 4UDUB 3MJ7A 1BGAA 2D7TL 1MLCB 2WMIB 4ML4A 4QX3A 2WSPA 4ACPA 4WTWA 4E0RA 3PZTA 1P9MC 3PGFL 3HMXL 4NQEE 1J11A 2WLZA 4ERSH 1FOBA 4Z78A 2XFFA 5AY7A 1RZ7L 1Z9OA 3UTTE 3KHQA 4OCSL 1FFQA 2GFBA 3QISA 2VE6A 1UUQA 4KH2A 2HP4A 5I3DA 5HGAB 1KB3A 3E6FB 4FXLA 4L9DA 2FHCA 5ABEA 1C12A 3BUYB 4FMVA 4EI6A 1Y7VA 1INEL 4OFKA 2DQXA 5T1LB 3E0GA 4KZEH 3VRLF 1AQMA 3OX8A 3RNQA 2XWJA 2VVSA 4QTIL 1DQML 1NC2D 4QHLB 5MENE 4HIIB 1ZLSL 2EKSB 3BP6B 3ARFC 3G5ZB 2YDQA 3T8XB 2W1SA 4P8WA 4ZSOA 3QO0B 1R5IA 4JFTA 4WY7H 5HI4D 2B31A 1CU4H 3DX6A 2E27L 2Y9RT 2W5FA 1EMTH 4TXWA 3Q6FB 4HG6B 3ES6A 3MRJB 4NO2A 1NUNB 3LZFL 1V5JA 5DK2B 2AK1H 1JGIA 1A2YA 4QRSA 3DVGB 4G42A 1QR4A 4LRNH 2R8SH 1T66C 1PSKH 1CGYA 4X8JB 1H9VA 4M62L 3ARFB 1CD1B 1CE6A 4PV9A 4UBDD 4LNRA 3KHOA 4OQ1A 4CBPA 2BDNH 3WDPP 1TZIA 3QG6B 1A6ZB 4PJHE 4TNWK 1MXGA 3BH8A 4XPTL 4HW6A 1VDGA 2XPGB 4X5LA 3CJJA 4OLYL 3DSFL 3N1GC 4PJ8C 4KK9C 5GRUL 2DLFL 3TA3A 1K4CB 5EJ1B 2YDSA 1RP9A 5CPTA 2N7AA 2HLFC 3PWLB 2NYYD 3HAEH 1GNYA 3P9MA 1PZ5B 2DJ4A 5DJAB 3KEHA 4DM2A 3UXFA 7FABH 4ZZ8A 1G9EA 1D5XB 3HJRA 3Q3GB 2X1IA 5FOOA 3NH7L 4LLYB 5D1XC 4QX2A 3ALXA 2VUYA 4D0CB 3MRBB 1UWQA 4X4MA 4ZTPH 4HOZA 1EXUA 5FO8B 3CU7A 4PJ8B 3Q6GH 1R5VB 4FG6C 3VGHA 1OSEA 4HFUL 4ZO7A 2EIDA 5FUCE 2BHUA 1KGXA 1I1AA 4OF5A 4BKLA 1UWSA 2IPKA 1OT1A 2J88H 2VL4A 4IPLA 4M9PA 1BWWA 4TVCA 1I1FB 2DDQL 2V2XB 1Q0XL 1JNNL 3TZVC 3UBXI 2PC8A 4R7NA 5D7LA 2ZX7A 4L8DB 1H3PH 3V52H 3U79A 4Q9RH 2YL6A 1NFKA 5D1XB 5DD1L 2ED8A 4XPBL 3LQCA 2EBNA 4P8XA 2JCCF 1UZ6F 4KJYA 4P4KC 1UYQA 3GSRA 5DMIL 4BYHA 2NW2B 3NCYS 4POUB 1G7HB 2R4SL 4XCNB 5FAAA 5JMOA 1I3GH 3L5WA 3C5JB 5INDA 1MH5A 4MNQE 1BOYA 5T33H 4Z7UF 5GJSH 3VFWA 2XOMA 4HX1B 4M61A 2XI9A 2VDRL 3G6DL 4GW5A 3UJIL 2BC4B 4H25B 4OBRA 3TZVB 3WFHA 2FYYA 3TJEL 1H5BC 4GXUN 3RDTC 4N8VG 3FQWA 5DJYB 2J6EH 2DM2A 3QNYB 1ZT4B 4K3HA 4WHTB 4J28A 3MRIB 4CRPA 3LAFA 3WE6B 4P4KB 5IFAL 3LEKA 1TUXA 2DD8H 1UWGL 5KSAA 2EYTB 4ZOBA 2XFXB 2EDHA 4NHCH 1J05B 4MD5B 4P5MB 1V6YA 4GKZA 5CIPH 3IJ7A 3DO3A 2IADA 3G08B 2C3VB 5JXEC 3WUWB 3TVMD 2NTFB 3AFBA 3X3GL 4NKOB 3GYCA 4G8IA 2F58L 5CS7A 1H5BB 4G6ML 3RDTB 4FTVE 3MRCA 4DWSA 1XGRA 3X11A 2DLGA 4FQHA 2IPUK 2ZG2A 4KJPC 4OZHA 1C8QA 1S7TA 4JDVB 3WELA 2QKIB 1J5OL 3PDOB 5FECA 5GS0C 3RVXC 4JO2H 1HQ4B 1KN2H 2DQHH 1DWJM 4WW2F 1XR8A 2QHLA 4UUJA 3H0TB 1BD2E 4IRZH 1DP0A 4IM4A 4NZCA 4ZG1A 3BLPX 2BNRE 4GRMB 3WL9A 3EDEA 5DA4A 1MWAL 3VFPB 2F53A 2UWEB 2XN9B 2FGZA 2I60L 2WSKA 3RY6C 2XIBA 3D25B 4GKNA 2KH2B 1C5CH 4QPWA 3ARBA 4Y7EA 2HKHL 4KDVA 2D3VA 2VURA 1E6RA 3V5KA 1V3KA 5EORL 3GH7A 3S36L 4HWBL 1XF5B 3DTXB 1MCDA 3VD7A 5IGXL 2C7UA 4I18C 1FE8H 3KNBA 5HYSB 4JFFD 2AK4E 4DUVA 1XGQA 5D8ZA 3B9AA 5DVNA 2CMRL 3VJ6B 2B1HL 4LSPL 1A1NB 4Z0BL 2A6KA 4YHIB 4M00A 4GKOA 5C2UB 5BRZB 2WKGA 2PKDA 5EFIA 2OL3A 5F3HA 1KCVL 4TPRL 4M81A 3FL7A 4K3JL 3DXAA 3KAAA 8A3HA 2NXZC 1GVIA 4NUGH 4UV4H 5AAMA 1FO0A 3WXWH 1UCBH 1UM4H 4I18B 4X6CB 5DK3A 3S8WA 1A3LL 3FTGB 4K23L 2WVVB 1G1CA 3CZUA 5GSRA 1BMGA 1MHHB 2G2RB 4JN1H 3VFMB 8FABA 3HUJA 4FFVD 3NIGF 4MTVA 2UY6A 1IM9D 4XX6A 4WU7B 2OP4L 1VGEL 4ORGB 1QO3A 2VLJB 4LIQH 3QQ4B 3ZSSA 5KAQF 2HTLC 2NXZB 1P6FA 1F00I 3GKZA 3QUKB 4UDTB 4TQEL 4ZTOL 2CERA 2DWDB 2Y07L 4HUVB 1MW2A 4JG1L 4OLVH 3SBWA 2FX9L 1VA9A 1J88A 2PCPA 5MEPA 4JHBA 1ZTXH 1LWRA 2HMID 3MRMB 1Q1JH 4PJAB 4XCFL 1E6JL 1K5NA 2X4SB 1OBAA 4JRYB 5B38G 2LVCA 2BS9A 3CTTA 2ZUMA 5BMFH 3MSPA 5FEBA 3FOLB 4UZGA 5GGTA 2EDNA 3GNRA 4CVXB 5HSFA 5IJVB 4A2LA 2BSRA 2NY4D 5J9PA 2QEJA 4ZAKC 4DWHA 4K7PH 1DE4A 5FDWB 1SQ2N 4P9HL 3QG7L 5EFFA 2W1UA 1O0VA 5DZOA 4L8SC 5I8OH 1OW0A 1RZIB 1BJ1H 1UACH 1MAMH 2XONA 1PQZA 3CFIC 5SWZE 1HILB 5DXWA 3IXAB 4LU5L 2ADIB 5HYQB 3SCMC 4MCYB 3QUYC 2V2TA 4ZAKB 1NAEA 2BY0A 2RFXA 3U0PB 3G5VB 1G9HA 5E56A 1VF8A 2APBA 3MA9H 5DSCA 2ADGB 3KYMA 4KVCL 3QXWA 4GMSH 4L8SB 4X7TA 2GK2A 3P0VH 4WTXA 3HAEG 1RUML 1U41A 3STZA 3NIYA 4U3CA 1MQ8A 3CIHA 4H88H 1MQKL 3OGOE 1FQ9C 3SCMB 2X1OA 3QUYB 1D9KA 4QRQA 5I19H 1FHGA 5LXGL 4RISL 5IJKC 4U1SB 4U6VL 3GSQB 3DETD 3OLGA 4NKMB 1RZ8A 5DUMH 3NSXA 4MJIE 2WUHA 3UBXG 4K9EL 5T3XE 2I5YH 3PGDA 2ZPKH 1JHTA 3QCVL 3AIWA 5D1ZC 1S8DB 3MNZA 1G7MB 4UQ2A 3OPZL 4PJ5B 3JTSA 4XNUH 5T3ZL 3SDCA 4QHKI 2W63A 3M7SA 1YEKL 4KPHL 1FVEB 1SYVB 2F19H 5ID0A 2Z8SA 1LHZA 4CMMA 1FZJB 2Y23A 2XNAA 4PYHA 4WEUD 4LGPB 2DWEB 3O11B 1CBVH 3GSUB 4UIMA 2D20A 2EC9U 3VD3A 5I1HH 3SUTA 3LEXB 3X3FL 5D1ZB 4XMLH 4B7IA 3EO0A 4Y4FA 3V9FA 2ZX6A 3RWCA 4XNXL 1UWIA 4P4RA 1IGJB 5FYJU 1OIMA 3TN0C 2X70B 4PRNA 2GCYB 5EO9B 2Q86B 1U8IA 1TFVA 4Y1AA 3A0OA 3KPRA 4LYQA 5JO5B 4ELMA 1F4YH 3ULVC 1HJQA 3ARWA 2A2QT 3FY1A 4DGVH 4PTTA 4PGBA 3B2VL 5GRZA 4OD1H 2PW1B 2YPVH 5HYFA 3TPUA 3TN0B 1CXFA 5IB5A 1UZ8A 1A4KB 4DAGH 1IZJA 2Q7NA 2Z91A 5JLZA 3KJ6H 1P2CB 1EVTC 2ZCKH 3INUL 4NFCA 4W81A 3QPQD 2DTML 5FM5O 3D18B 1UR0A 1ROWA 3QQNA 1UVQA 4G9FA 5AYBA 4EAMA 5EO1B 1AGEB 1QFWI 1KNOB 3QFJB 4BQ2A 1D6VL 1BZQK 4KKAD 3HE6A 3CFCL 4YDIH 2BOCB 2UZIH 3SCQA 3VINA 1DL7H 5I1KH 3M07A 3V0WH 3F7VA 4R4NC 1JNHA 1WBXB 3B3IA 5FV1L 4H2CA 1NBYB 2H26B 4OZIB 1X5YA 1OTTC 1M6OA 2GJXA 1HHGA 2FEDD 4G8FB 2I9LA 2P5WB 2XTJE 2EEXA 4A6YH 1HSAB 4YHEA 5DEZA 4JM4H 4MAZA 3IDMA 5F1IA 1KC5H 3FB8A 3HNVH 4QYOA 1U8KA 5C09E 3U37A 1IGFL 5F8RC 3OB8A 4GG6F 4D72A 2A0LD 1WAAE 1NM9A 5DK0A 4PJ7E 4NPYB 1CE1L 1NGPH 3MACL 5MEND 1B88A 5D9OA 2K7PA 2UY4A 4NC1E 1WZKA 1TTGA 1MRCL 3L7FA 5DD3H 4TOQA 3AISA 4CJ0A 3MUIA 3RUGA 4FQXC 1UY0A 3V95A 2G60L 3IDJB 2F8XC 5DD0H 1KEGH 1S9VA 1H15B 4S1DC 5D70L 4HOWA 1DLFH 4HS6A 4KMTH 2P44B 4LCYA 5DQDH 5MP6L 2HN7A 5KS9B 5D7IB 1FL5B 5DT7A 3WDJA 3S2CA 3FFCA 3NCCB 3CUFA 1ZU8A 5DJ6A 4NQDA 4QOKA 1GOIA 3SDXF 2R2HA 3RKDD 3CUGA 1J0HA 4X7SH 3MCLH 4PJDB 5HOSA 1JJUA 3GRWL 3V6OC 2Z4QA 5DFVD 3GHBL 3RJQB 4UTAH 4FQXB 3OIHA 2BVTA 1DDHB 5FHAL 3SDAA 4KTEH 4NQUA 4Z7WE 2VO5A 4MJ5B 3K7UA 5JIIA 1FV1A 2B7DT 1N26A 3QEHB 1ZS2A 1M05B 3DYPA 3NZ8B 5D9SB 3TCLA 3RA7L 3BWUC 4TX8A 4Y7MA 1F4XH 1K9FA 4R96A 5CSUA 4P00B 3RILA 4L3EB 5D9PA 2F8QA 5BXRA 3GMOB 1FFPA 5C0AE 1TQBC 3AMLA 4OT1L 2FL5A 5BOPA 2ZSVB 2HVMA 5ACLA 5A3ID 4V1DD 2WC7A 1INQA 1TCRA 1JWUB 1G7QB 2Y25A 5MERB 4LASH 1AY1L 3C08H 1GIGL 1ZHBB 1WAWA 1YY8B 3EYUL 2YXMA 2Z0BA 1JFXA 1J0KA 2FX7H 4PLNC 3FN9A 2CIKB 3EOAB 3BDBA 1E6PA 3BJ91 4Q9QL 5M94B 3MU7A 1WQVT 2H32H 5CJQH 4Z7VF 4EI5C 1J83A 4PTUB 3PNWB 4JPWL 1TQBB 1ISYA 5IMMB 5MEOB 3MJ6A 1SM3H 1WWWX 2MPAL 4LL9A 2F74A 5KVGL 1LP9A 3U5UA 3IFOA 4QT5B 2BXYA 2IFFL 4XP4H 4GUPB 1JYXA 2Q1EA 4OLWL 5HYJA 1CZ8L 2IBBA 4MNQD 1CFBA 4HXBH 5FKPB 3IF1B 3OKYA 1V0KA 4WWKA 1ED3B 3G9AB 1N64H 2VZQA 5IHZB 2O93L 4EI5B 4MA7L 2JJWA 4ODHL 1XR9A 2WIIA 3GBML 1CFVL 5HPMB 1UMHA 2GKIA 1N3NA 3CDZB 1EV2E 2Z93B 4X6DB 3UDWC 4H20H 2A9MH 2DICA 5A2IH 1CQYA 4PJBA 4ZNCD 2AAAA 3SJVD 5CEZE 5D7JC 3I2CL 4XVJH 5D8JL 5J1AB 3LSOB 4ZODA 4JRXB 3VXTA 4DKAA 5ANMB 3BKML 2V38A 4FTVD 2AXGB 4F7MB 1W72A 1NFDF 5IOPA 4XNZC 3MRRB 5JXJA 2ITDB 1PZUB 1FSKC 1GZQA 4WKAA 2AJZA 4QRUA 5D7JB 1MWAB 1WV7T 4L5FL 3KPPB 1BD2D 3VFSB 3BZEB 4LLDA 4ONHB 3U7YL 2BNRD 1MW3A 2DPEA 1A1MA 1NH6A 2ZWLT 3C5ZC 4NQCE 3UEZA 3AM8A 2AJXL 4NQTA 4UIKL 5MEQB 2E9LA 3WIFA 1FN4B 5CGMA 1AO7E 4TSBL 4XNZB 4RMRA 5CPSA 3QEQB 4FZ8L 1FSKB 4QLJA 4Y2DD 1ZLUK 4BA0A 2L4OA 1RUQH 5EUOA 4XUPA 3C6SB 4H1LB 4OGAD 3MV9B 1NMBH 1KBKA 3IDXH 1ETZA 2VDOL 1WCQA 2A6DB 2OL3L 2DLTA 3C5ZB 3NJVA 4AZ6A 3GMQA 2JJTC 3WSOA 1I1WA 3NCBB 4UV7H 5KSBF 5ERWA 1RJZB 1AP2A 1FO0L 5HDQH 3WY1A 1ZE3C 5JHDD 1F6AB 2XOTA 2CK0L 2DT2A 1A7PH 1FJ1B 4P49A 3EYPA 4JKPH 2XGBA 3MRLB 4RAHA 2FJHA 2MOVA 4KZDH 4DGYH 2C1PA 2VXSH 5H2BA 3KWWB 4G8GE 4F7EB 4YEFA 1B0RB 3ZE0E 1DJSA 1YC7A 2VERN 3LS4L 5K9OB 3T0XA 1MIEH 3VXUD 1MFDL 4K7PX 4XWOC 1ES0B 1I9JL 4K8RL 2X6MA 5DHXB 4LLQA 1OGAE 5AZEL 1HHKB 3HE7D 1WZMA 3QUXD 1WDSA 1NCAL 4YZFF 3N15A 5ICZB 4JAWA 4KI1A 1QHZA 2XKNA 3RTQD 5I15L 5LQBL 1HHIA 4I2XE 4E41A 3MXWH 4GKLA 4P9HC 2DOCA 1U3HD 3TBTA 1YDPB 1JZ8A 4YNYA 4DW2L 2DQEL 3RKPA 3CHFA 2VLLA 4ZFGH 5LWYH 5I1JL 2MQ3A 4X9IA 5M95B 4H8VA 5GGTL 2BXZA 1NCBH 3N9KA 2QR0B 4D0DA 2AQ1A 3IU4H 3GO1L 3I6KA 1P84J 2QMKA 4G6KH 1ZA6A 1UWTA 1SEQL 3CZLA 1Q8MA 4LPYA 4Q7DA 1YN6B 5IROC 1JGUL 2DF3A 2A73A 4XCCL 1OAZH 3IRZA 2FIKB 3TF7C 1NOWA 1SMDA 4PV8B 1U30A 1QD0A 5EDXA 1Q0YL 5IBTL 2Y72A 1JP5A 1KIUA 2VTFA 1H6XA 4OM0L 2H9GA 4JM2F 4YHPB 4XUNA 3BGMB 5IV2B 3BJLA 3BN9D 3IJHB 3IJYA 3N50A 4J12A 4BQ8A 3VH8A 1JHLL 5JTWA 5SWZD 3QGVA 4JZJA 1D5BA 1SMOA 1A7QH 2D9QB 4Y19D 1A7RL 1ORQB 4KKBC 3GM8A 1DQLH 3HMWL 5GGQL 3VMPA 5DD6A 3CQOA 3QDME 4JDZB 3S35H 3GSNA 5DJXB 2BRRL 4K9EC 4I0PC 2C4FT 1K9TA 3W26A 2RV9A 5I76B 1RJLA 3D2UB 3HCVB 2XKUA 3O6KH 4E42B 3BMWA 5DWUL 5I30L 1BYBA 1A14L 3U1SH 4DVBB 2UY5A 1BZ7B 1EDTA 3BMVA 4NQEB 1OGBA 4HD9A 3F12A 4LCWB 5B38A 3RNKA 3BAJA 4I0PB 5KN5A 4GRWF 2QQLA 3IDUA 4MJID 1W0VA 1I1YA 1XF2A 3IDGA 1UB6A 2EDWA 1JYVA 4AZ5A 3O3DA 4Z7OF 4PG9B 1CPUA 1U8PA 4KMLB 2OYLA 3H9HA 2NNAA 4IMKC 2RVAA 1V0LA 5JBFA 3KPNB 3MBEA 1UWXH 4YE4L 3VMOA 1B6DA 1I3UA 4J3SA 4PT6A 4FQPA 1TZ7A 1J8HA 4OIFA 2O9RA 4JY5L 4LAQL 5EC1B 2VWEE 1FHLA 4LRIA 4NHUB 1X3DA 3VRIB 1UWUA 3N13A 3O6LL 4NKIH 3FAWA 1RZJH 4P5TD 2YC1A 3VGBA 1QQDB 1TTFA 4LARH 3F58L 1LO2H 2YEZA 4RMTA 2DQCL 4UT7H 3KR3H 3ZOAA 1OAQH 4HV8B 4F7PB 3GMRA 4GFTB 1I3RB 3W27A 4I4WA 4CNIA 4PLKC 4MB1A 4RMVA 1F90H 3WH9A 1FG2B 3WS6A 4R3SA 1JPFB 3RJDA 4PJGE 5C8JA 3L4UA 3UC0L 5JUVA 5FF6A 4QF1B 2GY7B 4XMPL 2B8OT 1CLZH 4EOWL 1KJ3L 3L3IA 1BBJB 1NFIA 3ARSA 3UBXA 4GQPH 3ISWA 4KTYA 2ZEYA 3V5HA 4HS3A 4PMDA 3C9NA 3ZLQC 4M82A 4JLRA 4QHNB 1ISXA 1G9NC 3L9RA 5HDRA 3GMPA 3MJ7B 3SCWA 2MKLC 3L5XH 3P30H 2NT0A 2R29L 1X4XA 2XQXA 3VRJA 2VABB 3LQZA 2AEPL 2VLRA 3MOBH 4E0RB 5HPCA 4NKDA 2PXYA 2E9IA 3QCUH 5EU5A 1V02A 2F9BT 4NDMB 3UCRA 2GFBB 1ONQA 3KPSB 4PJ8D 1IL1B 2ADJA 1QLFB 3PL6A 2HLFD 4X98B 2XTJD 1C12B 4FQ1H 4W7UA 2C3WA 3MLWL 2G9HA 4UU9A 1UFUA 2VVNA 4DTGH 4HPYH 1P4IL 1JUFB 4NYLA 3LB6D 2VLKA 2EO9A 1DUYA 3OX8B 2XWJB 3VXQB 1C92A 4LQ1A 2LW8A 1H8OA 2ZXBA 2R0KL 5B4XA 2YD4A 1MFAH 3LN9A 1R5IB 4ALAH 1WBYA 2ZOLA 2ORBH 4NJAL 2J22A 1NEZA 3ES6B 1EFXD 3H42L 4NO2B 2C4XA 5BXPA 1RU9H 5DEGB 4QDMA 1SJVA 5C07E 5CMAA 3TA3C 3TZVD 2NY0C 2W1NA 1W0NA 3GHEL 2BVQB 4RBPK 4TVDA 5EU6E 2PWGA 4IOFC 3OXSA 4XC1L 1HVXA 4P4KD 4PV9B 1CE6B 2WVTA 4LNRB 1C08A 3V0VA 1BOGB 4BFGA 4OKDA 4BZYA 1S5IH 3PABA 1QPPA 4K2UH 1KJVB 1QSFA 4KQ4L 5BROA 4LX4A 1FVCA 4DFIA 4X9BA 1FAKT 2PYEA 4P57A 3IB3A 1KLGA 3TA3B 5ICXB 3A23A 2NY0B 4N8PA 3RDTD 4I48B 5I8KH 1I1AC 4PB9H 5F97E 1R64A 3SCRA 3P9MB 3WJJA 1PY9A 2E4TA 1NUKA 1AC0A 1N4XL 3W6LA 1GGBL 1GHFL 5JUEL 2LAGB 2WMPA 2WYSA 2GDVA 3SDDA 4YGAB 1W1PA 1ZEAH 5IBUB 4ZUUA 5A2JH 2JELL 3QWOA 3WUFA 2VQ1B 1L7QA 1ZLWK 1DFBL 3MOAL 1VADA 35C8L 5JMOC 4XVSL 3N1QC 2FB4H 4LKCA 2VYRE 4PRIA 3DMMD 1I1AB 4BKLB 4KK6D 4KJPD 5F7YC 1W99A 4KC3B 4X7EC 4M1CC 4O2CA 4A3ZA 2APWA 3GGWA 3RVXD 1JHJA 5D7LB 3NA4A 4OAWA 2DQIH 5I1LB 4PQQA 4OCXL 4TVUA 1QNOA 4LLVA 2ICWA 3VXME 1A22B 2H2PD 4M6NH 1UX7A 4A6OA 2DI7A 3HC0B 3L5WB 1AH1A 3OWEA 4HOXA 1DQDL 4IDLA 2XVLA 1IC4L 4NCC1 4M61B 4GW5B 4X4YA 3RVTC 3FKUS 2AJVH 4D1JA 5EBMB 2R1YA 4XNQA 1VFMA 3FQWB 4DWSC 1RHFA 4GO6B 2UWEF 3ARTA 5CZVH 5F1KC 3HRZA 2NXYC 4HAGA 5CILH 3VI3F 3NFNA 4LDLB 1ACYH 4K94L 15C8L 4LPLA 3BAEH 1L7IL 1IKNA 1MQPA 4NWUH 3OLEA 4PJIE 3ZO0A 1CFTB 4NZDA 1I4FB 3GUTA 1RULH 3PZ9A 2A6IA 1T7WA 3D48R 3GNML 1XSJA 1BYDA 5FYKD 2YZ1A 4XI5D 4G8IB 5F7DA 2NXZD 1MCOH 1M7XA 3MRCB 4DWSB 1XGRB 3X11B 4XAWH 3TT3H 1FIGH 1S7TB 3QXDB 2NXYB 1FCCA 4P46A 4EN3D 3O3BB 5IG7B 1W9XA 3D85A 4D6DA 1W72L 3A22A 1EAPA 1KXQA 4WI2A 4LCCA 2FCBA 3ULUF 5FO9B 3O9WC 1A0QL 2M8XA 1NCCH 4UUJB 4CCDA 4KUZH 2YHGA 3OR7B 2MQ0A 5E94A 3DUSA 4R90H 3HI1A 4ELKA 2F53B 3WLWD 1HKLL 2AI0H 3QZWG 5IF0A 2ZG3A 3WN5A 1AI1L 4GKNB 4CU8A 1MUJA 5CZXD 2DJSA 1EBPA 4W93A 4NQCD 3SOBL 2CJUH 1AXTL 2RIKA 3O9WB 4Z95H 1I8LA 2DYPB 1OARL 4FQCH 2DQDL 3ARVA 1AO7D 3KNBB 3VFNB 1H1NA 4LSSL 3NIFE 3OAUL 5E6YA 1LO0H 5DMGC 5C9KA 1CDIA 3JXAA 1V7ML 1SBBA 4B9YA 3MLXL 3HI6L 5F44A 3EYSH 1YA5A 2WQRA 4M80A 1UY2A 1Z2KA 4OCWL 2OL3B 3TTSA 3W0WE 3F6LA 1CWYA 3QOKA 3DXAB 2GJZB 2Z8RA 4ZNEA 2ZKHL 4LPCA 5EN2A 4PJAF 4MADA 4OFDA 1FO0B 3FCTA 3CHDA 1H0DA 2EH8L 2FO4A 4KUCF 1XEDA 3SBWC 4FQJL 3SE4C 4DGIH 4P7LA 1TR1A 4HS8L 2WHMA 3HNSH 3GSOA 3KXFA 5I1AA 3OR6B 3HUJB 4OKVA 1PW3A 2VZTA 4GRLA 3OJVC 1KT2B 4OJFL 3VILA 3WKMH 1XGUB 1GQLA 5I1CL 4G8GD 4LBEB 4W4ZA 1W0WB 3EHBD 4X7DC 4X6FB 3QUYD 4QXWA 2VX4A 2BY2A 1XGYL 4QHUA 3E6HA 4P2RD 3PTQA 5E5MA 1JZ6A 3CMOL 3O2VL 4JFYB 1L8NA 4F9LA 5LGJA 3REWA 5TE4L 2PCPB 3FQXB 4OUUA 5MEPB 2X05A 4L8CA 2GDUA 4N0UE 3FB5A 1O6IA 1FA2A 4MB5A 1Z9MA 1YEHH 1N8ZA 1ADQA 3ZHLA 1HEZA 1K5NB 3II1A 5C08A 1B3ZA 1KPRA 5GSVA 1QBAA 1OW0C 3VFRA 4BZ1L 4JFUA 4OFYD 3T4YA 4RAUB 3S35X 3WQBA 1W2VA 3TTOA 3TOPA 3O2WH 1AJ7H 4XBGA 4XP5L 1DE4B 3Q5OA 4PP1D 4PMYA 4KVNH 4GT7A 1JNLH 1GL4B 4LF3A 1OGSA 2WB5A 5KSVA 3F65A 4GRWH 4M5YL 4A44A 1PEZA 3SCOA 2R56H 3MSDA 1TJIL 1LWJA 2P8LA 1PQZB 4XNYL 1I7RB 1I8MA 2APTA 1GHSA 3CKHA 2Y8VA 3UCQA 4RWHA 4N8CH 5T5NG 5M3WA 4HQQH 1D9KC 4G3YL 5I66A 1X5JA 5ALBL 1I1RA 4NN5C 2GHWB 5J0BA 3BYTA 3D87B 4CD6A 2NY6C 5DSCB 3KYMB 2DSVA 3GSNL 4X6EA 1PG7H 3QDMD 2G5BA 3MLVL 2MANA 5KZCB 4W5UA 5IFHL 5C0BE 3POHA 5DJ2A 4XX1E 2VDQH 3STZB 5HY9A 1KB9K 2Y5TB 1YYML 4L3CA 3DO7A 3ULVD 3SDCC 1ULPA 5C3LD 1D9KB 3QH3A 4GAYA 4QRQB 4XMKH 3NN8B 2W9DL 4FN0A 3N85L 4NN5B 4P99A 2NW3A 1TDQA 3C8XA 2NY6B 4U2YA 5GS1A 2CCRA 3S4SG 2J78A 2DM3A 4D9QE 5TE6H 3FQRB 4N9GB 5FA3B 1IC7L 3PWPE 5I1DA 2QQLL 3EMQA 4XNMA 2ZXQA 2OLHA 5DJCA 2JTDA 2XXMB 3CUJA 4UQ2B 5JIPA 3QHZL 3GBNH 4XCYB 3SDCB 5C09B 5E8PB 1FNLA 1OAUH 5FCUL 3LQAL 3U36A 1OF3A 4NWTH 4PGCA 4YBQD 3PWNA 4MHHI 3RIKA 2AK1L 3MSGA 2DIJA 5ID0B 4XZWA 2P49B 4CMMB 3L4XA 2XNAB 3ZHKA 2NY3C 1QOKA 2EXWD 3TH4T 5GNYA 1C7TA 3UTSA 1MXDA 1FYHB 1HQRA 2XA8L 1RHHB 4U1IA 1HCFX 4WGWB 1NCWH 2ZUVA 3GM0A 4PRNB 3BH9A 1V3IA 2JCCA 1U3ZA 1U8IB 3T3PF 2WNGA 1I5PA 1KENL 3O6MH 1U91A 3KPRB 3VCLB 3AGVA 3PP3K 4DN4L 4M6ML 5E8OA 5B21A 4OZIF 1CG9B 5FUOH 1WC7A 5TH2A 1BF2A 4JVPA 2R0LH 2NY3B 4Z7UA 3CH1B 4MPKA 1YECH 2ARJB 5A8OA 2CIIB 4PGBB 4EBQL 1WSST 4LHUA 1KXHA 4QTHB 1G01A 5K59F 4ONFH 5IR1B 2ZICA 3TPUB 4P59L 3VIIA 1UZ8B 4JQVC 4DZ8A 3KYAA 2ZOXA 2Z91B 5JLZB 4Z7WB 4ZTPL 1BQLH 2Y6SC 4XB8A 5CD5D 5E7FA 5ADOH 1N6VA 4NZRL 2WM0A 1UVQB 4G9FB 4FQXD 5ESQB 2JKXA 3NFSL 3MGOA 1QBLL 4YWGL 2WO2A 4R7DA 3LKPA 3REVA 2Y06H 4AEHL 2H6PB 2YUXA 3B2UD 1DWFM 1RK0A 1JNHB 3M8OL 2PYFA 1EQCA 1H3VA 2A38A 4WF7A 3HC4H 4NRXA 3BX7C 4WI8A 1OGGA 1M6OB 1QPXA 2LE9A 3BGFC 1UD8A 2DMKA 2DQJH 4L3ED 2WW8A 4J6RH 2GJXB 4WW2A 2GJ6E 1HHGB 3SCSA 1E4IA 4TXEA 2I9LB 4MA8H 3GJEA 1KJMA 5T33L 1UH3A 4NRYA 2QADC 1MF2L 1NDGA 3RL2B 4FQ2L 2XTKA 3BZDA 2CETA 5F1IB 3FB8B 3ZO9A 1B6UA 5JW4M 1U8KB 1NWTA 3PWVB 4CD4A 1Q94A 2J1UA 2BNUA 1NLBH 2VMDA 2JB6A 5A6JA 2Z9TA 5I0DA 3BGFB 1BLNB 3VWJA 1VEPA 1INDL 3QHFL 5DLML 1JRHL 3WMBA 2IGFH 2W47A 3ARDA 2LFGA 2QADB 3O4LD 3ACIA 1K9EA 3L7FB 4NJ9H 1N5YL 2OTUB 3MV7E 5A2BA 1YUHA 5IMLA 1PKQE 3WHXA 3RUGB 4S2SA 1X5AA 2J7BA 2GQHA 3ROLB 3SDAC 2KD7A 5C07D 2YWZA 4LCYB 3L95A 5I2IB 3LV3A 4EK7A 1KN2L 4GMTH 4V2CB 4PRHA 2VX5A 5EU6D 1A6UL 1WT5A 1E4XH 1MJUL 3FFCB 3M17A 3C6LD 4M8UA 2P5EE 5C2BL 4OCYH 3PV6A 3NCEB 5DJ6B 1R8LA 4IJ3C 1CLVA 1Z9SA 2R2HB 4N5ED 1E4XI 5BXTA 4OZ4A 1GGTA 2Q8AL 2VR9A 2YD3A 4MMXC 3UYPA 3SE9L 4OZHE 3SDAB 3GSXA 3O8XA 5GGSB 4EJ1C 1G5AA 4M8QA 1TVBA 1FDLL 4NCDA 1FV1B 5HJ3B 4G6FB 2Q8BH 1DANU 5KTEH 1OP5H 5I8CA 2YBUA 2AABL 3TYGH 4IJ3B 5CWSB 2XVPA 5FD0A 2QV2A 4R96B 3L3DB 3BDYL 1B0WA 1EEYB 2FL5B 4NOBA 5GS0H 4KV5F 4U6YA 1TCRB 2VZVA 3U4BH 5C0FA 3BQUA 1FYTE 1XCTA 1TNMA 1QSEB 4P2QA 4UFLA 3BP4A 1UKSA 4UV4L 4TULL 3RVUC 3WFBH 4IDJH 1UA6H 2VXQL 5E2TH 4P3DA 2BFVL 3V8OA 25C8L 2DQFB 5E00A 1BYCA 3L4VA 3QEQD 2LVEA 3AXXA 1J1XL 1HZHL 4AEIH 2UWFA 3RWFA 3FN3A 1H3WM 3MV9D 3WNNA 3VXMD 2P47B 3IFOB 4DOHE 5JQ6L 4DEQA 4L4OA 2G75A 3KLSA 5E6IA 1F2QA 4LQFH 5FK9B 5FYLE 4GI6A 4PGDA 2DMBA 4JFHD 1AC6A 1S9WB 1MRDL 2V3FA 1YQ2A 3H9SA 2WIIB 3G9VA 3RVVD 4YAQB 2YS4A 5FYKH 1N3NB 4AEFA 2VQTA 4ZUVA 4IRSD 5T1KA 3S97C 3VXRE 3KZSA 1IC5L 2HRPL 4N0CC 3IAPA 4WI4A 4M02A 4OLUH 4TVPL 2E26A 43CAA 2VIRA 3A6CH 3K2MC 3VXTB 1BPLB 1I9IH 3BHBA 3EYOB 4OD3L 1AFVL 4XRCA 3R06B 4AIZB 3FW6A 3DIFB 4FXGB 5BJTB 1K3ZA 4MHHG 3R0MA 3AM8C 5H37H 4DZBA 1B4JL 3RZCC 2D03H 2HJLA 3MJ9A 3GIZL 1G7PA 1GOWA 1HNYA 12E8H 2YK1H 4LCUA 4AY0A 1UG9A 1WZAA 3LE0A 4WI3A 1JGEA 3BD4A 1OAYH 2ED7A 3IFNH 2Z92B 2N4IA 3TNMB 5A6BA 1F4AA 1RVFH 4Z7NF 5KJRH 3RCNA 5EIIA 4LLDB 2XTLA 2OWXA 2EYRA 2J4WH 1XD1A 3RM9A 1KR0A 2W46A 2GY5A 4Y5XA 3RZCB 3WIFB 1AQDA 5I8EB 5F3BB 5GRXG 4ENEC 3SCTA 3S5LB 3OAYK 3CZEA 1FFOA 3RBGA 1R86A 1MQQA 3D6GA 4P23C 5JW5A 2PW2B 3PHOB 4XUQA 3HI5H 1NJ9A 1ETZB 3BKJH 3QPXL 4QRPA 4XGZA 1LWHA 4UZSA 1A3RL 5AAWA 2XIIA 3FT4B 5EU7C 3TWCL 3K2UL 4EEEA 1NARA 3IVKB 1I1XA 3GMQB 4D8MA 5ERWB 1XH0A 3ARQA 4LSTL 4MQXC 3DRTA 5JR1H 5B8CA 5AZ2L 2VDLH 2P7TA 4P23B 5SX5K 5SWSE 3V4UH 3QDGE 1CGUA 2FJHB 5AUMB 5HGHB 3MLUL 3ILPB 2MJWA 1YMMA 1XCXA 1W3JA 1YNKL 5DPNA 2W94A 3WD4A 1GXEA 1QLEH 2AQ3A 4LAJH 2VWEC 2NY2D 2R2CA 5DGRA 2HJFB 3GMMA 3LQMA 2BVPB 3LKOB 1FVDB 2XKNB 4YPJA 4C58B 1G9MC 1HHIB 3MRQA 4E41B 4G6JH 1ZWIB 4FZEH 4U1JA 3UTQA 2FATL 1RZGB 5EUKA 1Q38A 3TBTB 4D8PA 1QI2A 4Y4KD 5JPNB 3BRFA 1ADQL 2CKNA 5T3ZD 3QR2A 1W3KA 2IPTL 4YXKL 3WXVH 2VLLB 3NQHA 1AKJD 2ZNXA 2WMJA 1OOAA 1L7TH 1U95A 2OTWB 4NF7A 1RY7B 3GSWA 1S9XB 3WNMA 4D0DB 4JZ5A 5BXFA 5GZNC 4ZYKA 1QR1A 1PG7X 2Z8VC 2QPUA 1SBSL 3VA2C 1U8QA 1T89C 2HFFA 2CKBB 1U8LB 2A73B 1MNUL 4WSKA 4GG6A 3BI9X 4O58L 4B5EA 3WS3A 1YJDC 5FGBA 2EPLX 1XT5A 4YC2C 1QFWL 1HI6B 4MAYA 4LSVL 3JUZA 1WCBA 5K9JL 4NI3A 5JORB 3GI8L 4HCRH 4R4FH 3WUWG 4PMRA 3VH8B 5DRXA 3BPLC 2XYCA 1K6QL 1NSNH 4XH2A 5A8MA 1FCGA 4J3UA 5BQ7A 5GGUA 1EZVY 1RURH 3GNPA 1S9YA 4OGYH 2D7OA 3GSNB 2MTPA 4FQLH 4YC2B 3ULVH 5ILTH 1NGYA 1RFDL 3JV4B 5HHOA 3SUVA 3TBYB 5KSUB 4BZ2H 5JXAL 43C9A 3S88L 1RJLB 2FECL 3SDXA 4LFHG 2HVKA 2F54D 4IRJA 1O5DT 3CSGA 1B90A 2D7TH 3BPLB 3LQAC 4JY4B 1T6WA 1YEIL 4PREA 4CUAA 1G7JB 2X7LA 4WK9A 3PGFH 3HMXH 1OF4A 5HDOA 3MBEC 5FCSH 2ZWZA 1RZ7H 4ODXB 4OSUH 2VXVL 3RNKB 4OCSH 4WUUE 4PLKD 5BZDB 2CUHA 5KN5B 3HG1A 1S7UB 1UEMA 4D9QD 4YH6A 2MNUA 4U05A 2Y6LA 1I1YB 5HYSG 4APQA 2FEEL 1XF2B 1QVBA 4PJHF 2OZ4L 4HWEL 4M4RA 3TTQA 1UB6B 3D5OF 1HWGB 2ZUXA 1INEH 4RCAA 5FO7A 3SGDH 1U8PB 3SUWA 2NNAB 1GPOL 3WO3B 3OKEB 4QTIH 1DQMH 3MANA 4HKJA 1ZLSH 3MBEB 2IANA 3CFDA 5KBNC 3QDJA 4LYRA 1J8HB 5EC2A 3DUUA 1MVUA 2E27H 2XG9A 3PQYA 3HEIA 3HZMA 5IEHA 3LZFH 3GSVB 4Z7VA 1CDBA 3Q48A 2WANA 4ATWA 1FP5A 5DQJA 4ZS7L 1ODZA 1G84A 4YHGA 4C54A 1MSPA 4M62H 3UEQA 4MB3A 1I75A 5E9DA 4WV1C 2P24B 5H94A 1KN4L 4UOW1 1U8JA 4OI8A 2WKLA 4EXKA 3IAQA 3WUGA 4XPTH 1GGCL 1T5WA 3EFFA 1G6RA 3GMRB 2C7FA 3SKJE 4NQDE 5DHVA 4CNIB 4OLYH 1HH6A 3DSFH 1QA9A 1FBIH 3AMKA 5GRUH 4R3SB 5H37G 1MI5A 1DVFA 2PXYC 3S4SA 4DK6A 3CFEA 4XVUC 4WV1B 3CXDL 3TA3D 1MJJA 5JA9A 3V6ZB 2ZSWA 1ULVA 2JD9A 4JKMA 2DCKA 4JLRB 2R23A 3NH7H 3L9RB 3O2LA 3EKCA 3GMPB 1L0QA 3W9EB 2EO1A 1BG9A 3VFTB 1UXWB 4NUJA 3LQZB 3ZHDA 3ZSTA 4HFUH 2YUWA 3I85A 1NFDA 2Q3ZA 3GB7A 4TTGA 4ZUTB 2YKLL 1Y0LA 2PXYB 4S1RL 5EU5B 1SM3L 1T1ZA 4LGRB 2DDQH 3F5KA 3I50L 1JNNH 2ADJB 1WIOA 5EU4B 4JKKA 3HA0A 5D2NE 4WEMB 4U1LA 1BEYL 1I1AD 2G9HB 4HXBL 4UU9B 3FT2A 5DD1H 2GUOB 3H3PL 4XPBH 2CNCA 3C7FA 3HR5A 5DMIH 1UM6L 1E56A 5D7LD 3AIEA 5D5MB 2VLKB 3A4AA 4CAGA 2R4SH 1HSBA 4XURA 2PBGA 2IH3A 4DKFL 5EBWA 1IC1A 1LLOA 1MEXL 1UQYA 4W88A 4MNLA 3O0RL 2VDRH 3G6DH 3UJIH 5BV7C 2P8MA 2D31B 3ET9F 1MJ8L 3TJEH 3VDCA 4ZY9A 1P4LB 1IAOA 5HYJE 1RAMA 2BNJA 4U7MA 4AQOA 1NEZB 3WCYA 1KIQA 32C2A 3DHUA 5IFAH 3R1GL 4M1CD 1OP3K 1UWGH 3GMNB 3NSNA 4GAJL 5CMAB 1E6ZA 4RDQG 4PJIB 4YUEL 2EDBA 5DJZB 4F8QA 3TLRA 3DV6B 3WJJC 1T21A 4PD4K 5KSAD 1YYLL 3FO1A 1YC8A 1Z32X 3JV6A 3V0VB 4JCMA 5BV7B 4MJ2A 2OR7A 3X3GH 4JPIB 2F58H 5CCKL 1T7YA 4G6MH 3SDDC 2EJ1A 2M2DA 3VO0A 4B50A 3DYOA 3P1IA 4P57B 1J5OH 4OMCA 1KLGB 2BVYA 2ILLA 3NDYA 2IQAB 1HX0A 2WBJC 4JFDE 4KROC 3QJFA 1V8HA 3DURA 4U1NA 4HKXA 4M6OL 4FOMA 1V3MA 1GZJA 1DQJB 3IDIA 3BAYA 1ZJAA 1MWAH 4BQ3A 2VXTL 3OKMA 1U0QA 1RUQL 2I60H 3GTNA 3SDDB 1NOFA 4MA3B 5EBAA 1URLA 1ERNA 1MCQA 4KI5D 5C0GA 4Q97A 3CZJA 4ZUUB 2D0GA 1FNAA 2OS7A 2UVEA 1VADB 2F53D 4LKCB 5EORH 3ZE2E 2WBJB 4NNYB 3WNKA 3S36H 4HWBH 4ATLA 4KROB 4RGMC 5IGXH 3H7BA 4R8WL 2EXYD 2ESVE 3ARBD 3WNOA 3QQ3B 5LAXB 1MFEL 3DX7B 5ISZA 4H1LH 1NC4B 4PIRF 3GH4A 2CMRH 4EDXB 2B1HH 2GSGA 3EYFA 4LSPH 4Z0BH 4G80B 1C90A 4QP0A 2KQMA 2EDOA 5IQ7L 5C1MB 2ITCA 3EJYC 1KCVH 3DECA 1MHEB 1ND0A 3AXLA 2VC9A 2ICWB 4TPRH 3OEAA 2WVSA 3AZSA 1OCWL 4K3JH 4L29A 3D0LA 1LL7A 4TNWF 2V4VA 4JFOA 4RGMB 1EPFA 4PG2A 1Q9LB 1F3JB 1MHCA 3BEWA 4L4TA 4OZFB 3CIQA 1A3LH 2E7CA 4JM2A 1WDPA 4K23H 1IT9L 2ZE0A 2DRUA 2R1YB 5E08L 3N04A 4UNIA 3QULA 4MNGA 4GZJA 4Q74A 3HRZB 3S37X 4PJ9D 1BFTA 1G6VK 4CN1A 2K1MA 3NFNB 3T2NL 4S1SL 2OP4H 1VGEH 2V6HA 5F9JA 3OXRB 5DMGD 4LCCC 5HHVH 3VGAC 1M71A 4OLXL 1B0GA 4WFEE 3F7RA 4HJGB 4DEPC 4HZ8A 4L9LA 1ZS8A 2A6IB 2Z35A 4TQEH 2VSCA 4ZTOH 5BS0A 3TO4A 1ZVHA 2Y07H 4U7KA 4BSWA 5CEYA 1LL6A 4JG1H 1U6AL 1FL6B 5F7DB 4WRLA 3MMUA 3PTKA 5J13C 3ARRA 4K8RD 2EEDA 3T77B 2JK5A 3JWDL 5D1QC 3MJ9L 3WLBA 1EAPB 4XCFH 4F8XA 1E6JH 4LCCB 2NZ9C 3VGAB 1NUFA 4DEPB 3HZVA 2VMEA 3D3AA 1V6VA 1Z5LB 4KKNA 1QACA 5E94B 2BSSA 4ELKB 2AV1A 2V9QA 3OQ3B 3L4TA 4JFEE 5IF0B 1IGML 3T09A 5J13B 2RJMA 1MUJB 4P9HH 3QG7H 1H41A 3I75A 1TMCB 5D1QB 3TJHC 4GG8A 1E9LA 1G94A 1SMAA 3JUYA 2E40A 1KYOK 5F1NA 4XUTA 3C8KB 4MX7A 4W4OC 1B3VA 1QLRA 1LD9A 5F96L 1D5ZB 4LU5H 1DWGM 1SJHB 1JF1B 3AHYA 4JANA 3EAKA 4HBCH 1DBAL 5C0CA 5F1OB 4UDUA 2WMIA 2VZUA 2OX5A 3VD4A 4KVCH 2X44D 5J12C 4C7FA 3RWGB 3QR3A 1E40A 1RUMH 3SPVA 3DUHA 1Z9LA 1H0DB 2FO4B 1MQKH 4F9LC 2HTKC 5HGAA 4PJEE 3GSOB 3KXFB 1AGBB 1H3GA 4OKVB 3BUYA 2O61B 2MSPA 2AJ3A 5KZCD 5F9AC 5LXGH 4RISH 4U6VH 2VRQA 5DQ0A 3U4EB 1UY4A 1D9KD 3K4ZA 3PWPB 4QHUB 3F8UB 3E6HB 5CJBA 5J12B 4HIIA 3UERA 5E5MB 4K9EH 4YHOL 3G5ZA 3QCVH 3SO5A 3MV8A 3OPZH 2Y36L 3QO0A 4S11A 1JCKA 2F5BH 3REWB 5T3ZH 4L8CB 3MKKA 3FB5B 1YEKH 4KPHH 4R26L 1W32A 3FHAA 5FYJL 5DK2A 1TZHA 5A6AA 1N8ZB 1R85A 1HEZB 4YIQB 1Q6FA 1NAKL 3RM8A 5JIKA 1T7VA 1MCCA 1A5FL 2JE8A 4L4VB 1EGZA 4X8JA 3ARFA 1RV6X 1RZKC 3X3FH 4C4KT 3T4YB 3ZDXF 1CBGA 3ETBF 4XNXH 2BBAA 4QLKA 4R4BA 3QG6A 1A6ZA 4Y16A 3V7MA 1P5VA 2GJJA 1X44A 1GW1A 4G43A 1I1CA 3H6JA 3HB3C 3W2DL 3F7YB 5HHXL 3AHXA 4Y4FD 4LF3B 4AY1A 1QRNE 3MGTB 5KSVB 4Y1AD 1WKYA 4AZIA 3B2VH 1W3LA 3KPRD 4PB0L 2VL5B 3MLRL 1PZ5A 1BPVA 4UNVA 1I8MB 1EVUA 5DYOA 2YG0A 2HYMA 5ETUA 2G41A 3PUCA 4FFWC 1D5XA 4D0BB 4XT1C 3TBWA 3ZZ1A 4Z2LA 4LLYA 5I66B 5E99L 4BQ6A 4P5KB 5I6XC 3INUH 3C2SA 4J3VA 2DTMH 2L7UA 5FO8A 1R5VA 4X83A 1C93A 5K9KB 4ONOA 3OB0H 2AJSL 5DJ2B 1D6VH 4AG4L 5EH1A 5HY9B 3CFCH 1I1FA 1BP3B 4L3CB 1Q6EA 3DO7B 4B9ZA 2XIDA 3QIWC 2E5EA 4XHJD 4L8DA 3MS8A 4G9FD 2ARWA 3QH3B 5LG1A 5D1XA 3WMCA 3HE6D 5I6XB 2VOTA 3S3JA 3I6GA 2NW2A 3ZDZE 2GJ6B 1G7HA 4XCNA 3L7EB 4XNMB 4QO1A 4HX1A 2BGPA 2Y6SD 3OGRA 2WDBA 4AMKL 4H25A 3QIWB 4H1LG 2WWKT 2J8UE 1IGFH 3U36B 5HI3C 3QNYA 4PRPB 4RGNC 1ZT4A 4PRDA 4HEPG 4NNXA 5M7QA 3MRIA 4LOUC 3PWNB 2D24A 3WE6A 1N0XL 4HG4K 3HPJB 3IJSB 2XFXA 4Z7WF 3PGCB 1SEBA 1J05A 3ECBA 3HZKB 3WO4C 4CDHA 1WUNT 4CW1A 3BN3B 2HT4C 3MUZ1 1BBDH 2BCKB 3MACH 3BO8B 1HQRB 4BUHA 4I5BB 3BEVA 4PP2B 3ARXA 5GS3A 2DEPA 2BNQE 2OYKA 1MRCH 3MV7B 5CHNA 4NKOA 4PGEA 1H5BA 1X5ZA 3RIAK 1I8IB 2ORZA 1M04A 3IRPX 2JCCB 4RGNB 4GS7C 2VN7A 2G60H 1U91B 2AEWA 2O5ZL 3EFDL 3FRUA 4WIQA 4PRBA 3EO9L 3PDOA 3I9GL 2LABA 5E8OB 5D70H 3MGAA 1X5IA 4WO4A 3WO4B 2BVUA 5MP6H 3MYJA 5HHPB 2NW0A 5B39B 4LHUB 3H0TA 4EANA 1VIWA 1G6RL 2COQA 3GRWH 5BVPL 1VPOL 2ICES 2AJUL 2UWEA 1JPTL 2XN9A 3GHBH 4O4YL 3N06B 4N0FA 3D25A 1UD5A 4GS7B 5FHAH 2A3BA 4NQDD 4QOKD 1CZSA 2K7QA 2WW5A 4NSBA 2PETA 2PTTB 1NKRA 3DTXA 2HYXA 3SDAD 4DQOH 3PE9A 3MGOB 5HYSA 5JHLH 3LPOA 1H8NA 4MDJA 1U33A 4LEXL 1NBVL 2ZIDA 4JE4B 3K80A 3UG4A 2Y7QA 3DVIA 3RVWD 1HXMB 4KRPD 4FFZL 3VJ6A 4PFEA 4YHIA 2PYFB 5BRZA 4OT1H 4YXLL 4HTYA 4NRXB 2WWCA 3QXAA 3KYNB 5D4QA 4MNMA 2Q76A 4R2GC 1W1VA 2NR6C 4U5IA 4QX1A 3VWJC 6A3HA 1S46A 2GTZA 3SY0A 3GJEB 2WO1A 1AY1H 3NCJL 4NRYB 1GIGH 3EYUH 4I18A 1NDGB 5IKCB 3TIDB 3TFKC 3NTCL 2XWDA 3V2AR 3QQ9D 3POCA 3FTGA 2WVVA 3WBEA 4R0LA 4Q9QH 2WVUA 1Q94B 1MHHA 3VFMA 4JPVL 3WL1A 1CDJA 1E5NA 1NANH 3THCA 1CFSA 1KQZA 3M46A 1RIHL 2VLJA 4R2GB 1EFQA 2MPAH 2IF7A 1XD0A 5KVGH 3VWJB 1CZ1A 3MLZL 2IFFH 3L1OL 1WT5C 5JW4R 4LIQE 3X14B 4UDTA 4OLWH 1CZ8H 2VKWA 2A3AA 2GK0B 2PWEA 3PP4L 2XJ7A 1JGLL 1K8DA 2CGRL 3ARUA 3MA7B 4HUVA 1AMYA 3RWIA 3HNYM 1YUHB 3WHXB 5HYJD 3NACL 5DJ0B 4MA7H 3IAGC 4ODHH 2K3TA 3GBMH 1CFVH 4W4NA 2W4XA 2L7JA 4P7OA 4WWKD 1SVCP 1NQBA 1A6AB 1VB9A 2R1XA 4PJAA 2ZOKA 3ZR6A 2KQNA 3U57A 2OBGA 2X4SA 4QGYA 3M17B 1NCCL 3I2CH 3PV6B 5D8JH 5GRVK 4UOW0 1T22A 4CVXA 4PEEA 5G05L 3PJSA 2HT2C 3BKMH 5F9WC 1KXTA 4PMUA 3DLQR 3FOMA 4ISVB 1DZBA 3M1BB 1TVBB 3BQUC 1KXQE 1BQHB 4JFDD 1BFOB 2CJUL 1H5VA 5JPMB 4PY8I 3CPLB 4MSWA 1ZBCA 4LLMA 1RZIA 2ZCHL 4L5FH 1EDGA 3O41B 3UNPA 3U7YH 1HILA 3IXAA 5HYQA 1N0LA 3CMJA 1DN2A 1BFSA 1CD8A 5F9WB 2AJXH 4ZAKA 4UIKH 1JIBA 4L1HA 4M7LL 3IYLW 4YX2L 3IS0X 3U0PA 4U6YB 2JJSC 1DBKL 4TSBH 4YHYC 2D0FA 1TJHL 3BQUB 1X4YA 2EEBA 4FZ8H 4P2QB 3BP4B 4L8SA 2UZXB 2GAZA 4P3DB 1J86A 2X4RA 4AYSA 2VDOH 4KJWC 5E00B 1NDMA 3WF2A 1Y6MR 2OL3H 3SCMA 4F33A 2WNWA 5KVDL 1S78D 2B9VA 3QWRA 4U1SA 3IT8D 4NKMA 4YHYB 1ZSDB 1FO0H 4WUKL 4ZNEE 1L0PA 1NCDL 2IALA 2J7LA 2CK0H 2VZOA 1TITA 5SWSB 3BZFA 4JFZL 4ENED 4HGWA 3VXSA 1S8DA 3WH6A 1MLBB 3B9DA 4HH9A 4PJ5A 1XH3B 1FH5L 5GNXA 2MHAB 3LS4H 1RQ5A 4ZUVB 2V5DA 5CUSH 1MFDH 2VSDA 1I9JH 1FZJA 3RX8A 5AZEH 1DBJL 4WFED 1ZGLP 1W9BM 2UUDH 43CAB 1NCAH 2VIRB 2GW5A 4C55A 2WZ8A 1HINL 4MQXD 2KL6A 4XRCB 5I15H 5LQBH 4Y5XC 4LDEB 4Z0XA 5LKNA 2HJLB 4C56E 4JPKL