3LA7A

Crystal structure of ntca in apo-form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
209
Chain Sequence
DKALANVFRQMATGAFPPVVETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
molecule keywords Global nitrogen regulator
total genus 65
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la7A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la7A01
3OTFA 4IESA 3PVBB 3QP5A 2QM3A 3I0TA 3DXJF 2PAMA 2XAHA 1R1UA 4IJAA 5DYMA 1FP2A 3BJAA 5AVPA 1T38A 3FHZA 3S7EA 3FZ3A 5DUIA 4MGYE 2DQLA 1GQHA 3FM5A 3M9AA 4LLLA 5T3NA 3IWFA 3WTVC 1IN4A 4BHBA 3G7DA 4A5MA 4MEXF 5A2QK 1JXSA 5DUKA 3DEUA 2P17A 1I6XA 3SXYA 2MH9A 3CUQA 2ZMEB 4S04A 1BI3A 3CO7C 1UPIA 1KU9A 1BOAA 3PQKA 3U9GA 2GH2A 3K1NA 2D40A 2PYTA 1SFEA 2K7LA 5D8KB 1IPKA 4QMAA 4BQAA 3KLOA 5F64A 3RYKA 3ML6A 3RYPA 3F6OA 1FBQA 3D0JA 1P4XA 1KA8A 5K5OA 4KUMA 4MX3A 2STTA 2CYYA 5K5QA 2P5LC 5LEKA 4HV6A 4ZU5A 2CO5A 3GVAA 1PMIA 3AAFA 2BYVE 2OQRA 4P9GA 3TO6A 4Z2YA 1YIOA 3GFJA 4JTOA 3RYRA 2D5HA 3NKTA 5D6FA 1F4KA 4X6RB 3O14A 1HSJA 2VE9A 1A04A 1Q43A 3MAJA 2UY8A 3ISPA 1XMKA 5E8IA 4XRFA 5HLGA 2E9QA 5E20A 4ESFA 3I64A 1H1MA 5L3EA 5F6FA 2IT0A 4EWDA 5CVRA 5K5RA 1ZRFA 4A2UA 4ZZDA 5DCMB 4RB1A 5E1XA 4KN4X 3WGHA 1OFNA 5TJJA 2L02A 2Y48A 4BAYA 1ZLKA 3H9AA 1SMYF 3H3ZA 1XSVA 2F5FA 4BXUA 3MZHA 1JHFA 5DV5A 2IA2A 1Z05A 5IT9Z 2H09A 3IKVA 3K9TA 4IEWA 1K7AA 1DUXC 1FXZA 1BBYA 3HOSA 3QRFF 1AWCA 1IRFA 3WGIA 3HQXA 3ES4A 2ACJA 2HKXA 3KEQA 3OOPA 1LEBA 1OD5A 1FP1D 1CAUB 4P9UA 5L3DA 2HS5A 1T6SA 1G3TA 3BB6A 2QWWA 4HLTA 4MZUA 1OKRA 2UY9A 5L3FA 5IT9K 1UW8A 2KIFA 3IHUA 3BCWA 4HSLA 3NEUA 2TDXA 3WE3A 4KWKA 4CICA 4EJUA 5D1IA 5I8SA 4L9JA 2GIVA 4BIFA 4PIYA 2Z5UA 3MZYA 1LEAA 2R7FA 4R8HA 4XLPF 1CAVA 3NSTA 2PQQA 5J6XA 5EFUA 3ZP5A 3V7CA 2IC1A 4G8XA 4ON0A 4D0PA 1EV7A 3OCPA 3I4PA 3L2CA 2PHDA 2BNNA 4WCGA 4XFIA 2FQ3A 3DPLC 3JW4A 2E1CA 4KWLA 4ASNA 2EV0A 5JSPA 1SD6A 4JTNA 4Y13A 2IA0A 3H8UA 4IEYA 3EHKA 1UIJA 4PIXA 1YTYA 4PIZA 2DAOA 2DPDA 4G94A 2FNPA 2RGVA 2FRHA 4EM0B 4META 2COMA 4HOBA 5H6QA 4A6EA 3GFIA 1ZRRA 1CAWA 5BQTA 2M87A 1HKQA 4B09A 1RNLA 3NRVA 1YS7A 3F23A 1REPC 1IN5A 5H6RA 2OU2A 3U0ZA 2D2WA 2YU3A 3D5LA 3C3VA 1ZGAA 2P7CB 3MFKA 2HYFA 1T39A 2HJIA 5TRDA 1FSEA 4G9YA 4HF1A 4BHCA 4FAGA 2KIUA 1LVAA 2GXGA 5BPDA 3IKTA 2XUBA 3ECOA 3GF2A 1B59A 1IXSB 4LD5A 4M6XA 2K02A 3MEXA 4R79A 4XF0A 3G3ZA 4FT8A 1H9TA 4MUVA 5LGNA 4G7HF 3EETA 2IPQX 4B8XA 1EH7A 2D1HA 4KN7X 4LUKA 4BHPA 1W7PA 3ZPLA 4N9IA 1FYKA 1YUDA 1VR3A 2O0YA 1U8RA 3R0JA 5LHGA 1Q1HA 4B29A 4J1WA 3WU0A 3WW3A 1FT9A 1R23A 1GQGA 5J8CA 2HOEA 1OR7A 5JFRA 1UHMA 3KEOA 1SMTA 2OPKA 3NQOA 3KZYA 1S3JA 5CYVA 4PJYA 4JVAA 4A0YA 1O3SA 1NHAA 2VE8A 1YHFA 2HQRA 4LA2A 3K69A 3RDIA 3BALA 3SCHA 4O9EA 3GLXA 1CAVB 5HI0A 5BOXA 1JUHA 4ENKA 3FZVA 4P55A 5LHIA 2R3SA 1RL3A 4EM2A 2Z2SB 3KGZA 2O1QA 2DLLA 4LLNA 4AVCA 3ZN1A 2QLZA 1B9MA 3VB2A 4A5NA 2JTVA 1TQMA 3B02A 2P6TA 2QBYA 1S6LA 2YX7A 5BUVA 1OYYA 3V7SA 1XSDA 5AIQA 5KVRA 1SFUA 2PAEA 2MLGA 2MH2A 5JCTA 3F8MA 1HKTA 2B0LA 1XGNA 4M9SA 4NHJA 2W24A 3KZZA 1EP0A 2N7GA 5FFXA 4WZCA 5D5XB 4HVQA 3ZMZA 2XLGA 2A3SA 1ZN2A 3BY6A 2LNBA 1R58A 4HVRA 2XVCA 2K0GA 1P4WA 1FLIA 5KK1A 1U6GA 1XGSA 2KJBA 4HW0A 4LB6B 4E2GA 4LK1F 4HBNA 3LA7A 4PZJA 4RB0A 3BZ6A 2XAFA 2MA3A 4I0BA 2IXLA 2NRAC 2FQPA 3SHFA 1O5LA 4HLXA 1PDNC 4XFAA 3LQRA 1QQIA 1UCRA 5F1RA 2Q0OA 3KSCA 3U10A 1MKMA 4P96A 3LA3A 2VBXA 5FLXZ 1FYMA 2C6YA 1X8EA 4H0EA 4QLCU 4I2OA 2STWA 3FFQA 3DV8A 3P7NA 4HDUA 2VODA 3QACA 3HT2A 1O7FA 4YFNF 2A07F 4UXNA 3REOA 1F9NA 4OU0A 4LGWA 4PDKA 3ZMUA 5JI6A 3GYDA 1BI1A 1H0MA 4YARA 3PNAA 1QWRA 1XB4A 4UV9A 4HQEA 2Q4SA 1KGSA 3TDUC 2GQQA 4MQVA 1WQ2A 4OIRF 1FI2A 3M1EA 2XAJA 4XSZF 3IDCB 1P6RA 1JGSA 2EA2A 4Z82A 4EGYA 3GWZA 2OZJA 4QX5A 2BNOA 1TQIA 5HDGA 1OMIA 4HN0A 2Y0MA 3BP8A 1ZVFA 2RN7A 1ULYA 2XGXA 1WLTA 2E1NA 5DD4A 3J81Z 3WTYC 4IPAA 3ACLA 4LK0F 4ZU4A 3HIFA 5BPXA 4G6QA 2CQKA 4A12A 2EAAA 2CG4A 3LSTA 4A0ZA 1KYWA 1VJ2A 1ZZ7A 4KWJA 4AQ6A 4PGHA 2OA2A 3QU6A 1ZRDA 2ISYA 4S05A 4K8FA 3ZMTA 2PMUA 2QVOA 4PCQA 2V1DA 5J3UA 1T98A 4Q5SF 5FLXK 3IDBB 5I0SA 5FLJA 5C8WA 2H0VA 1ODDA 1XN7A 2ISZA 1ZG5A 1QO0D 3FX3A 3K1PA 3E97A 2RKHA 4HMZA 3PFIA 4IEVA 3KLNA 4ZYHA 5LGUA 1CAXA 2QCSB 4UHTA 2FBIA 2WTEA 3K0LA 5AONA 2OZ6A 1FSHA 2EFPA 2GWRA 2JRTA 1USTA 4LLOA 2C0ZA 4LG0B 2B9UA 2IXCA 2W85A 5FLHA 1BJAA 3TO7A 5H20A 3H1YA 1U3EM 1SD4A 3H7YA 3EQLF 1RI7A 3IC7A 2L54A 1K79A 1EY2A 5KHKA 2L3DA 2FBHA 2XAQA 1RIOH 2FE3A 5CADA 4QM9A 1TNTA 3U2RA 4F7ZA 3OGJA 4E2SA 3I54A 3F6VA 4FX4A 4YSFA 3HSFA 4FX0A 4IF4A 1SD7A 1S7OA 1OYIA 3GO5A 2CFXA 3ZQ7A 2QZ8A 3WODF 2W57A 1LDJA 2QJVA 4CGZA 1RZ4A 2LSOA 3SHRA 1PM7A 3D0SA 2IW5A 1K6OA 3DL3A 5I8YA 3W6KB 2VBWA 3J80K 1IXCA 1Y0UA 2HWVA 5E1ZB 2UWMA 1VTNC 1CAWB 1Y3TA 4HF2A 3N4MA 1QGPA 4AVAA 3HOTA 2OYZA 1D5VA 3IBMA 4O3MA 1MJBA 3HTSB 1XCVA 4RB3C 2UXXA 5J48A 1C0WA 3GEZA 4OLLA 2MD5A 2IA1A 4ENNA 4O5VA 1O7LA 3J80Z 5E1RA 1XDSA 4QWQA 2ZJ2A 3HHGA 1B9NA 4KYWA 3DP7A 1KYZA 1DGRA 1JE8A 3FF5A 4WF2A 2PJPA 3RNSA 2VOOA 3W6JB 2IP2A 4A6DA 5FQ0A 3KMHA 5KHIA 5BV6A 1YQAA 5FO5A 5BS6A 2E7XA 4XFHA 2G7HA 1X8MA 1TNSA 3LQQA 5JR3A 4M9XA 2OBPA 2VC0A 3H92A 1J75A 1P92A 3WG9A 2O8QA 3GFLA 3RI4A 2BNMA 1FX7A 4LULA 2F2EA 2EFWA 1TBXA 1LJ9A 4Q47A 4ZU7A 1MGTA 1NE4A 3F21A 3FMSA 2AS5F 4WXHA 4ESBA 1D8JA 5ED4A 3J7AO 1CAUA 4Y15A 2IXJA 3TO9A 4BNCA 2KRFA 4LB5A 3HT1A 4EMSA 4AQ2A 2KJCA 1FBSA 1HKSA 3V7RA 2EFQA 5I0TA 2HZTA 3H7JA 3JTHA 3QAHA 4P9FA 1H1IA 3C3WA 4RAYA 4YFKF 1GXPA 1XMAA 1G4DA 2VOPA 1L0OC 3KGLA 3E3VA 4Q0PA 2P4WA 4I09A 3WTUC 2XROA 3EDPA 4U7BA 3ZDSA 4RAZA 1CF7B 4MGIE 2ADUA 2GC0A 3EQEA 1XD7A 2QBYB 5FPZA 2CSOA 1WA4A 5EZWA 5ICCA 1DZTA 2BBYA 2M45A 2DBBA 3MPBA 4IRHA 5HVQC 2FA5A 1EH6A 1YS6A 2ZBKA 1TW2A 4EGZA 1QZZA 3JTGA 1LQ1A 1HW1A 2QQAA 2UYAA 4UUVA 3CEWA 3I59B 1FBUA 4EROA 1ZZ8A 4HX4A 2V9VA 1R5GA 4HSJA 2X0LA 3V4GA 5LRSA 1LDKB 4UBHA 1R7JA 3IRRA 3F8BA 3FM3A 3ECHA 1R36A 2JPBA 3SXWA 4Q0SA 1KQ8A 1SQ4A 3NVCA 3WTWC 2VPVA 2IJLA 4ENMA 3D82A 4IEPA 2PFBA 1RTVA 2F5EA 1LRHA 3LZZA 3T1BA 3E5QA 5ICGA 3I53A 2L4MA 1Z6RA 3WW4A 2EWNA 3FWEA 2BE5F 4ZYEA 2ET7A 2IXHA 1YO5C 2Z33A 1ZZBA 5AIPA 4KA4A 2VONA 3GUDA 2EFNA 1XE7A 2A6HF 2Z3YA 1SEFA 2RVCA 3KE2A 4OIPF 3QPHA 4N9HA 1G6NA 3T0YA 3KP4A 4IHSA 3F72A 3CUQC 2DW4A 3P9IA 1BIAA 4AXOA 1Z9CA 1LNWA 3P9CA 4XFCA 5FGMA 3S2WA 2JPCA 5D5UB 5I8TA 3T5XA 2PFWA 1Z1DA 1L3JA 3C18A 1OYWA 5K8SA 3FXQA 2P8TA 1B4AA 1E2XA 1ZH5A 1IRGA 1O5UA 3Q9VA 5BY5A 2V79A 3RJPA 2GA1A 2ETEA 1K78B 5HLIA 4F8AA 3LA2A 1GHCA 3LOIA 3L7WA 2IXIA 2Q0AA 2H6BA 4WVZA 4GYIA 2OQGA 1HW5A 4XFGA 2ELHA 2B8MA 4L9NA 5DD8A 4MTEA 1IN6A 2QYOA 4YRDA 3ABUA 1SD5A 2VQAA 5I0UA 4HN1A 1NZCA 4YYOA 4UVAA 3DPTA 5L3BA 1HXDA 4XEZA 1EPZA 1D8KA 2A69F 3Q9SA 2H6CA 4L9TA 3HYIA 1R1VA 4EJWA 2J5PA 2QNKA 3RTRA 3N97A 3PQJA 4D7SA 5DDGA 4UBGA 4HQMA 1ZLJA 4GO1A 1PP8F 4RD7A 2JZYA 1LB2A 4LA3A 4EM1A 1GXQA 5L3GA 4WX9A 4IEQA 1W5TA 1GVJA 4XETA 1LKNA 3F3XA 2NAZA 1QBJA 1FPQA 4M73A 2D1VA 4HAMA 1BN5A 4I98B 2LKPA 1OPCA 3RIRA 2RNJA 1YWKA 4U0WA 4M6YA 4XLNF 2HQNA 4ZZLA 4QXKA 4GCVA 3GBFA 4ONUA 4LJZF 1TW3A 2O03A 1S29A 1FWZA 3RKWA 6PAXA 1CF7A 1W4MA 2V1UA 3QOPA 2DT5A 3C1DA 1YFXA 1S7AA 3I71A 3TDZC 4U88A 4ZH4F 1J3QA 2OD5A 1J58A 3MDPA 1D3YA 1U5TA 4Q29A 4KIGA 2PQ8A 1UHWA 4ZYGA 3OD0A 2EV6A 2M5WA 1ONVA 4YFXF 4KFCA 1SFXA 2KXLA 5HLHA 4XFBA 1V3FA 4GYGA 5JVTA 1J9IA 4WBBA 2QDRA 3EYIA 1UD1A 1WSUA 1P2FA 1YLFA 2HR3A 2OAZA 3TNPB 4RB2C 2V09A 1F1ZA 2XASA 4J1XA 1TQPA 2MBFA 4CDGA 2DFIA 5FLIA 2X4HA 2XKOA 1AOYA 2QVSB 2ESHA 5CU1A 4IHTA 2NS0A 2XLFA 2A6EF 4MTDA 4ETSA 3WTZA 3I7DA 2O3FA 2DI3A 3TKYA 2Y0OA 3ZMVA 2FMLA 5FPXA 2F5CA 2O8XA 2CAVA 1XSXA 4FBFA 2F5DA 4LG0A 2VT3A 1EH8A 2EA4A 2DK8A 1KQ0A 5HOOA 2XL7A 1KU7A 4KIFA 5D6EA 4YIFA 2HTSA 4Q48A 2V6CA 1R1TA 1UCXA 3CUQB 5LHHA 4HX7A 3GW2A 4I3PA 5FDBA 4JV4A 1PP7U 3F8FA 1ON2A 4M9ZA 4XF9A 4R52A 3L2HA 2VT2A 1BC7C 4IEXA 3CTAA 2EJRA 2UYBA 3TNQA 3ES1A 1DP7P 4HF0A 4YNIA 4HVOA 4Q0VA 3V8JA 2MPFA 5FCCA 3R6SA 3S7IA 1BC8C 2DU9A 3OV8A 4U0YA 4IRGA 1YW8A 4UVBA 4RGXA 1STZA 3I59A 1U12A 3DF8A 3T8TA 1G3SA 2QENA 4HA8A 2EA7A 3I58A 3FJSA 2BV6A 1J7KA 2K4JA 2B5HA 4JQFA 4O6JA 4E70A 4OIOF 2WFPA 5CVUA 4ZYDA 3M3IA 1U2WA 2RDPA 3IL2A 3O6BB 4Q4ZF 2FEZA 3ZN0A 5FB2A 1T2KA 4KL1A 1QXRA 1PUEE 2CGPA 4XBFA 1RUNA 3TQNA 1YFHA 1ZYRF 4OMZA 2YSRA 1NXMA 1J1LA 2EV5A 2VN2A 4MQ9F 1I1GA 4IEUA 3U1DA 2FXAA 3LWCA 2M30A 1HW2A 5FQ0B 1DDNA 3VODA 4NB5A 1DPUA 4PGGA 3IWZA 2P6SA 1KQ9A 2PBIA 3EYYA 2Q1ZB 3ELNA 1XGMA 3CL1A 2ZKZA 4EJVA 1ZZCA 1VP6A 4G7OF 3UKTA 1O4TA 3HRTA 1CGPA 3L09A 3VEPA 1K78A 4IERA 2FF4A 4BYYA 3HRSA 2K27A 1QZYA 3BJ6A 5HS8A 4KDPA 2CV6A 4M74A 3KFWX 4CHUA 3GXOA 5D4SA 3FHIB 1R5HA 3KP2A 3P9KA 3QP6A 3ERED 3JAMK 3HRMA 3GFMA 3R61A 2GC3A 1KU3A 3GX4X 1R22A 5LLQA 1J2XA 3KP7A 4L5JA 1X3UA 2V1XA 1Q5OA 3IIAA 5E17F 5EEHA 2O6GE 3V8KA 5D4RA 3R4KA 1ZREA 4OMYA 3BPZA 1FZPB 2D5FA 1ZAOA 1IN7A 1I5ZA 3F22A 2GU9A 1FC3A 2EK5A 4DNCA 1UB9A 5JSRA 1QPMA 2HGCA 3H1MA 2A68F 2XHKA 3NW4A 4I7HA 5CLSA 1TQ5A 4Q0UA 3PLQA 2LF8A 5HDNA 4N0BA 4TV7A 4U7DA 4JK1X 4EQQA 3ZMDA 4LLGF 1X82A 1SAXA 4EV0A 2FOKA 1DPRA 3JSPA 2FMYA 4EVIA 2VC1A 3BJOA 2ZMEA 1MDMA 1MZBA 2YPRA 1CX4A 2QQ9A 3CJXA 5JSOA 3EUHA 2MNGA 3CUOA 2P7VB 4CYDA 5CVIA 4OFGA 4ENJA 2K86A 3L9FA 5BMZA 3O2PE 1BI2A 5ICEA 1Q3EA 5L3CA 1XCBA 1USSA 2L01A 3SCGA 2D93A 1BM9A 3FMRA 5HS7A 5DCFA 1FOKA 4Q0QA 3LAJA 1ZRCA 2KIMA 3HRUA 5KBFA 3COAC 1O3QA 3RPQA 3S0MA 4O9GA 3CLPA 2RC4A 2XV4S 4HZFA 4QGLA 3K1MA 1IN8A 2PI0A 5D5VB 3FMQA 3R0AA 4UXAA 3FXUA 2EB7A 1DGWA 5FD6A 2CWEA 3HTUA 3WU1B 2PHLA 4R1HA 1LDDA 3ABTA 2IRFG 2MC3A 4EWEA 1HBXG 1IXRC 3SZTA 4IEOA 5J7MA 3WW1A 1IZ1A 2D45A 1HSTA 5I0RA 3E5XA 4QM8A 4JBAA 2NNNA 1YFYA 2ESNA 2W25A 2J5OA 3NJZA 4MGZE 3K2ZA 1P4AA 4KU8A 3SFZA 1RC6A 4CZZA 3TOBA 4WXCA 1YG2A 4A0XA 3M70A 1UFMA 3RPUA 4G6DA 5D5WB 3ROUA 3WGGA 2HYGD 5ERIA 1Y9QA 3BOQA 4I02A 2IVMA 5LBQA 2XAGA 3CDHA 3HUGA 4RGSA 5JR7B 1FNNA 2KKOA 4GULA 3GYHX 3SZPA 3FXRA 3GZ5A 5J8FA 3ST7A 5HDKA 2CAUA 1YW9A 1XGOA 2PN6A 4KT5C 2ZKLA 4M72A 3E6CC 4UV8A 4NVPA 4LUMA 3CO2A 3USSA 3UKNA 4Z07A 4KNYA 4L18B 1O3TA 4CO8A 2FSWA 2G7UA 4L5IA 4L2NA 5EEGA 3M8EA 3R60A 3FE5A 1ZZ6A 3WW2A 3VOEA 2PEXA 3WTXC 3EBRA 5E18F 4HLYA 1JHHA 2GAUA 4HBLA 2ET1A 1V70A 3QPTA 2W84A 1W7PD 5ILUA 2PA7A 5DCMA 3LAGA 3OF1A 4E2QA 1RGSA 2WV0A 5FD5A 3LWFA 4CXFA 2DK5A 5E1WA 4ORFA 4AIJA 2ZO4A 3RZZA 3ULQB 3WE2A 4QGMA 2MLKA 5E16A 4I01A 1SFNA 2HKOA 4FHTA 1J3RA 1XDUA 2GC2A 3ELKA 2I45A 3B73A 2XIGA 2XL9A 3E5UA 4OOIA 4TLFA 5FFZA 1J59A 2ATFA 2BGCA 2DTRA 2NYXA 4WWCA 2CW0F 1OI6A 1ZGJA 2DQRA 5KHHA 3CF6E 1F5TA 4FAHA 4IRIA 1Z91A 4GXOA 4KU7A 2YR2A 3TOAA 3VHRA 3IRQA 2M8EA 5C6CA 1IF1A 1FY7A 4X6QB 2UXNA 3JSOA 4L9VA 1I1SA 3HHHA 4G7ZF 2GXBA 5DEQA 3QU3A 1ZHFA 1E17A 1WWXA 3Q5FA 2DO7A 3T8RA 2FBKA 4MNUA 4DQ2A 1O57A 1MJ9A 2EVXA 4KMUX 2WWYA 3MCZA 2ETHA 4EJOA 4L0YB 3H50A 3J81K 5K1YA 3CO6C 1WRJA 1TTYA 4I0AA 2OA4A 2Q2EA 2Q30A 3LAPA 5JHUA 1ZZ9A 1Z6TA 3BU7A 2Y75A 2PTMA 2VECA 2ZFWA 1LR5A 5E8GA 1FYLA 4WXDA 1V4RA 5LEJA 1HQCA 4YIIA 1QXJA 4OIQF 4RS8A 2H27A 3GZ6A 5BXXA 3KETA 1ON1A 3M8FA 4L0ZB 2LF7A 1MJAA 4K2EA 3ETQA 3M7GA 2HDCA 4UNOA 3BDDA 4XF3A 2IXKA 2RQPA 3RKYA 3VFZA 5A2QZ 3WTTC 5ICFA 4MGKE 3KP5A 3G73A 3CLOA 3U11A 2FU4A 2ZCWA 4MH0E 2EFOA 3CJNA 3DQVC 2NNYA 3BPXA 3TGNA 1U5TB 3SQNA 2PLYA 1BI0A 1XRUA 3H3UA 4XF1A 4XF4A 1G3YA 4EWAA 4AVPA 3BROA 4IEZA 1QY4A 1J5YA 4D7TA 5ILSA 2HTJA 3KCCA 4HV5A 1L3LA 2DCTA 1MD0A 1RUOA 4EJTA 2LDUA 5KHGA 2H94A 3E6BA 5CVJA 3EO6A 3ZMSA 3DFGA 2FNAA 1CAXB 1DZRA 2RV8A 5ILVA 4AIHA 3F8NA 3JAMZ 1G3WA 2K4BA 5LRRA 2WC2A 3F8CA 4QGNA 3E6MA 4L11A 1IW7F 4LTAA 5CVVA 3HSRA 1QNTA 4BH9A 2BEOA 3LFKA 3UKVA 2OZUA 3RKXA 4H7LA 3L00A 3MQ0A 4M71A 4IXAA 1IPJA 2ZNYA 4UVCA 1YYVA 2K9ZA 2R7DA 1U5TC 4HDVA 1O3RA 1H9GA 2JSCA 1X7NA 3JZVA 4AD9A 1IUYA 1WI9A 5JAXA 1ZG3A 4MV2A 2VBZA 2MHFA 4DINB 1IAWA 2ZXJA 1XE8A 3O3KA 4XFFA 5I91A 2E7WA 1S8NA 4XSXF 4AVBA 2M1BA 2VXZA 5IT3A 2A5YB 2A61A 5KHJA 1W7PB 3BWGA 1UIKA 4KICA 3DN7A 1ZARA 3EJKA 2UZKA 1MDMB 1ZNPA 2XLAA 3KP3A 2PG4A 2Q8KA 4AWXB 1EYBA 3I5UA 1Z7UA 2GC1A 2XKPA 4HYEA 3MWMA 4KIBA 2XRNA 2O61A 2Z69A 4IVNA 4LMYA 4IETA 2PMHA 3NL1A 2JT1A 2QQBA 4MHGA 4AIKA 4KMFA 2GZWA 4LFUA 1KU2A 4NQWA 1YFUA 3KP6A 2AXLA 1U78A 4P5OA 4RGUA 3SCFA 4YG2F 2P5KA 4OINF 2VBYA 3DKWA 1WKMA 2P5VA 1I27A 4GGGA 5LGTA 3WTSC 1TLHB 1J0RA 1B6AA 4MEYF 1ZG1A 1BIBA 2HFHA 4U0VA 2QUFA 4LEJA 5HS9A 2HEOA 2F4PA 1B1BA 3E6DA 3H1WA 3V8LA 5CJ9A 1T0FA 1J3PA 3SMHA 2Z99A 2PAKA 5BPIA 4HX8A 1NYWA 4ESJA 1ZX5A 1YFWA 1WGPA 4Y17A 5I93A 5D8LB 2Z9OA 1YLLA 4WK8F 4MGRA 2ZNZA 2DPUA 2GA2A 3HSEA 2L4AA 4RGRA 1R00A 1NE6A 2G9WA 1YW7A 3BPVA 1W5SA 2YX4A 3C7JA 3MYXA
chains in the Genus database with same CATH superfamily
3OTFA 4HPKA 1FEXA 1DDLA 3S2HJ 5HV4A 3RZKA 4XNFA 1S55A 4BUPA 2CUEA 2DN0A 1JUMA 4P9YA 1Y7BA 2JA6J 2R062 3LSEA 3V0AA 2L2OA 2AREA 3AP4A 2IVIB 1G59A 3FZ3A 2VNGA 4D69A 5B2GB 2WS92 1VI0A 4CCKA 4LHSA 3ZYHA 3WG4A 5T3NA 3IWFA 5JOWA 5K7ZA 4BHBA 1RUD2 1VPHA 4Y1XA 5LB6A 1MBJA 4BU2A 1F43A 1WCQA 5B5EC 3SXYA 4NIAA 1GP4A 1UPIA 1KU9A 3I3QA 4D94A 3JD73 4Y5Z0 3U9GA 3K1NA 3J7LA 2XC7A 4GQ7A 2WSVA 3ML6A 4PFPA 4R4ZA 3CCVI 3D0JA 1P4XA 4ET7A 1KA8A 3ECQA 2STTA 3FXKA 1XPXA 5F2WA 3QYBA 2CYYA 4TSVA 3VZLA 5JWPA 2CO5A 2NPIA 4MXVA 3AAFA 5IOZA 2IUWA 3TO6A 4Z2YA 1YIOA 4YGEA 3K4CA 4I0WB 1I6HJ 1WA6X 2D5HA 1CPMA 3IP4B 2RS51 4QB6A 3O14A 3DKYA 4C0BA 4LIVA 1Q43A 1VBB2 5FPVA 3ISPA 5E8IA 3OIPA 5E79C 1SLBA 1I3QJ 1DQ0A 5E20A 4CCCA 4JDOA 3O1SA 4A3CJ 2DA4A 5FJ8J 5FY9A 4Q4W2 1BEV3 3K48A 4Q4V1 5TJJA 1Q56A 1W9TA 2WY7Q 2JSPA 5A32B 4BDVB 1XB9A 5IAXA 3MZHA 3KF3A 1JHFA 5DV5A 3RRDA 1CZTA 3K9TA 2K9NA 1FXZA 2VMGA 3HQXA 4FQ4A 2OUMA 1NLRA 2DVBA 3KEQA 1LEBA 3VZJA 4P9UA 1KS5A 5C44J 1G3TA 3BB6A 1TEIA 4HLTA 4BY1J 5DABA 3ZFGA 1YO8A 4D3WA 5L3FA 3PUHA 4MFDA 3IHUA 3Q8AA 2XQXA 2JA7J 1EV13 3KYDB 4NNJA 1UU4A 4NIGA 5CEHA 3MZYA 4B44A 3NSTA 4AF9A 4AG4A 2EPFA 3I4PA 3MIFA 4SBVA 2K46A 3IDEA 3WHBA 2R5YA 1AR71 2EV0A 1T08B 2BHZA 1HN1A 4CP9B 1FIAA 2IA0A 3OS1A 3H8UA 4DEQA 2FD5A 3ZXSA 2CV0A 3JCIA 4Y4RA 4META 1XJAA 1ZRRA 2M0CA 2XGCA 1LE8A 3OY8B 3R4DB 4KH9A 4B09A 4LIUA 1RNLA 3NRVA 3CJIC 3F23A 2DTWA 4QB2A 3S93A 1QOTA 1R4NB 1VRH3 3C3VA 1ZGAA 2P7CB 5FXVA 1DLLA 1T39A 1FSEA 4NC6A 3CC7I 4FFGA 3ZLIA 3O12A 3LSKA 2XUBA 1IXSB 1RMU3 2ZJPF 4LD5A 4ZHNA 1WH5A 1DYOA 2R7RA 1S0EA 2B42B 3K3OA 4ATEA 5J4YA 3K70C 1TME2 1H9TA 3HPGA 4DEVA 5GLTA 2HWD1 2R071 4LUKA 3OYCA 4N9IA 2RM23 3W20A 1XNDA 3R0JA 3VKOA 2M4GA 5CQGA 1PK6B 3CCUI 3MFAA 5A33B 2HOEA 1Y0NA 2QQPA 1OR7A 1K12A 4DJAA 1LU2A 3A7QA 1WJCA 2E19A 2ZSIB 1O3SA 1RUJ1 2HQRA 1V55H 2OUHA 1G9AA 4AGVA 3SCHA 1GNYA 5HI0A 2HWC2 1DYKA 3S5QA 5A7SA 5LHIA 2QQ8A 4YW2A 1LEMA 2AENA 3SFIA 2DLLA 1RUG3 3IN9A 2FZ2A 3ZN1A 4LBNA 1B9MA 2JTVA 2JDHA 4FTSA 3VDCA 1TQMA 2O7OA 1GUUA 2HWE2 4IUGA 2QBYA 1S6LA 3FMGA 1OYYA 1SFOJ 3U37A 3BKZA 1LHOA 1L7QA 1XSDA 5AIQA 4C0HA 4BE2A 5KVRA 2WNUB 3MBWA 4RAGA 1SFUA 1VQ9I 4JGYA 1ASJ1 1MBHA 4PF1A 4M9SA 2RNGA 4NHJA 2DA3A 2DDAA 3KZZA 2Y30A 2HNHA 1EP0A 1GOHA 4WZCA 1JYXA 3CLQA 4LO8A 2R93J 2R7SA 4JX6A 3BY6A 4NC7A 4FSJA 3OG2A 1FYUA 4QX8A 3MPPG 4HW0A 4QDQA 1H9PA 4UYBA 4HBNA 3LA7A 4PZJA 3BZ6A 4KWUA 2UWBA 2IXLA 4E6KG 2ES3A 4XXAA 4ASMB 1G7YA 1ETVA 2VQLA 4HLXA 1O5LA 4XFAA 2JG8C 2H0BA 1HRI2 1S0BA 1UCRA 5F1RA 2MG4A 4RS5B 4CRQA 3LA3A 3CMMA 5FP9A 3ZQCA 4ZDOA 4JKLA 3DEMA 1FMD1 3PUAA 1E5RA 3OYMA 2XJUA 3A2KA 5B3SH 1LULA 1T6GC 2WADA 3DV8A 4AUXA 5L9RA 3P7NA 3RI9A 3ITQA 1Z7LA 1MNEA 4ARYA 3ASOH 3C2HA 3AZYA 2KL4A 3ZMUA 3JB4C 1WMDA 1H0MA 4DY3A 4MIMA 1PIV1 3PNAA 4OI1A 3B01A 3PVOA 2GQQA 1Z0XA 2MW8A 2QKMB 2XAJA 3CESA 5EPAA 1P6RA 1WUVA 3G2BA 3GWZA 2OZJA 4QX5A 2BNOA 4HN0A 1YXWA 1H9WA 5EJ3A 2RVAA 5C4JJ 1ZVFA 2X6XA 3AP6A 1TZOA 1WLTA 2E1NA 4RGKA 4N4OB 3I2IA 4QPQA 4O61A 4IPAA 4YM3A 4JGYC 2F4MB 4RDUA 1RXGA 1AZDA 1XU2A 3EUKL 1YX3A 4A12A 3LPFA 1LOFA 3LEIA 1YIJI 2RS53 3CJIB 1NH3A 1SHWB 4PGHA 1W36D 2OCEA 1ZRDA 1OQEA 4D5FA 3OYKA 4K8FA 2LLKA 2QVOA 2BOLA 4BPZA 1AUYA 3BTAA 5FLJA 3K7AJ 1ODDA 4QXHA 4DZGA 1UOGA 2BVBA 1YJNI 3FX3A 1HCRA 4S0HB 1TWGJ 3E97A 1X1PA 1GV5A 2KPMA 2ZGKA 4ZYHA 3G6EI 4JCKA 4YZ1A 5LGUA 1R71A 2QCSB 1GZ9A 2ZA9A 2WTEA 4HKLA 5JMCA 2H8RA 4UFJA 1USTA 1IDZA 4ZTJA 3K10A 2ZAAA 2C0ZA 4LLOA 5FY8A 2WUHA 1T33A 3FBIB 2P3KA 3PDQA 1RKWA 3WDWA 2UV1A 4FFIA 4D7NA 2L54A 5KHKA 1V5GA 5CADA 4QM9A 2CYFA 3OGJA 3WV6A 3F6VA 4FX4A 4YSFA 4IF4A 5K0UA 1R1A2 2W48A 1VMJA 1VQLI 2VCAA 1QJFA 1LDJA 2QJVA 2EZHA 5J1XA 3PIOF 2LBFB 4ANJA 2M7BA 5L36A 2ORXA 1K6OA 2IW5A 3BU0A 3DL3A 3AM2A 4PUSA 1GLHA 5GZDA 3QPSA 3J80K 1GICA 1S9HA 3RKQA 4HF2A 3N4MA 2XVLA 5ACA3 1QGPA 2OYZA 2M9HA 5JLWA 2KIQA 3NV2A 4O3MA 5JOXA 3KIOA 4RB3C 4HG6B 3GEZA 3N05A 3SLIA 3VBUB 3V0BB 2QCOA 3HHGA 4LQRA 1KYZA 3WQBA 3OYIA 1MSFC 2WWJA 4H4KC 1R083 2IP2A 4YGDA 1AR92 4WM7B 5FQ0A 3NAPA 2VQTA 5FO5A 2E32A 3B6CA 5FMOS 5JR3A 3PSFA 2Y0SN 3CDLA 1JI8A 4LBKA 2Y60A 1J75A 4M3CF 2O8QA 1K83J 2P4EA 3OSDA 1LJ9A 2GOMA 2V9KA 5DDJ3 4ZU7A 1NOVA 3OYGA 4N53C 3VD3A 3SQOA 2K40A 3F21A 3TP0A 4WXHA 1S2EA 2JDAA 2JG9B 3O8HA 3PUBA 3IMNA 3Q8FA 4UFMA 4P1WA 1CAUA 2WQZC 5DTDA 4TWTA 5A3UA 1D1CA 2KRFA 1OKOA 4LB5A 3H8OA 3HT1A 1SZBA 5DZFA 3MKLA 1IQDC 4E7ZA 1POV0 3WP3A 3ZYFA 3C7HA 3DGTA 2EFQA 4QWNA 3J26N 3H7JA 3JTHA 3VV1A 1XMAA 3PMSA 4XHXA 4OHWA 3KGLA 3AL0C 3OGSA 2GXAA 5K7FA 4CU8A 3WD5A 2O0OA 4FTEA 4IHXA 3AKRA 1VBE3 2ADUA 3B9CA 5DN2A 2LBFA 3C2BA 4FPYA 5EZWA 5FKBA 4NWWA 5FY4A 5ICCA 3BR3A 1DZTA 4FXGB 4FE4A 5CFDC 4D9JA 2DBBA 4AGGA 4OAZA 3MPBA 5FKOA 4XORA 4AI8A 4X1EA 4II2A 4BQ1A 3PHMA 1TW2A 1YI7A 1X9TA 3TW7A 2DUPA 5DQ0A 1W8UA 3HBKA 2DJNA 1Y9MA 3I59B 1RJ7A 3OL3A 1R5GA 2X0LA 4PFOA 1GZTA 3VUOA 5LBEA 2E53A 3FM3A 4XE9A 3ECHA 3SXWA 4Q0SA 4OUSA 3EMRA 2GP3A 3KWVA 1SQ4A 1DQ4A 1J09A 5JPMB 5J1YA 2VPVA 5F3EA 4ENMA 2PFBA 5M0TA 2WFF2 4N7UA 2WO2A 1TWFJ 2ZGMA 1X9PA 5FOBB 4M0NA 5JXIA 2W46A 1X1DA 5EGOB 2XBO2 1MMGA 4QQPA 1DGWX 1AR61 2EWNA 4ZYEA 2BE5F 5EIYB 2IXHA 1YO5C 2Z33A 4IHVA 2TCTA 3GUDA 4HSRA 2BFUS 2A6HF 2Z3YA 5F5CA 5CZKA 3WUCA 3BI3A 3QPHA 1IPSA 3T0YA 2R7WA 3WX5A 1WMEA 4Y1ZA 3P9IA 1BIAA 2DTZA 2A6XA 4XFCA 2IS1A 3HNMA 2W1UA 2WZPP 5I8TA 2PFWA 1VBA2 2EIJH 1W3VA 1FMD2 1GWMA 1IHMA 1E2XA 2P3IA 3UESA 4QTRA 1IRGA 3Q9VA 4AFDA 2ENRA 3LSGA 2H8WA 1K78B 5HLIA 2IWGB 1UN1A 3D8CA 4XONA 5FYCA 4COWA 1RYYA 1KJRA 4IV1A 1SCRA 2Q0AA 4GYIA 2BY1A 2OS2A 2HDWA 1AR63 2R7ZJ 2ELHA 5DG1A 4QDSA 5AFEA 1IN6A 3FDYA 1VQKI 5D8AA 4XOGA 1SACA 2WZ8A 2P81A 1NCQA 1YJLA 4XIKA 4FOWA 3WP4A 4QX7A 3ZFFC 1QOSA 3BR1A 4FI9A 4XEZA 1MZEA 1D8KA 2A69F 1OCRH 5LA1A 4PBPA 4P9IA 4L9TA 2VOWA 4QQLA 4A7KA 3GNEA 4HQMA 3POGA 1PP8F 1IKPA 5GJ6A 2OUJA 4WVWA 5FFOC 4IEQA 4XKVA 1GVJA 2WRAA 4HETA 3F3XA 3CCQI 3I8TA 4M3GA 3MF6A 3S30A 1N3OA 4M73A 2GMPA 1UYPA 3OMYA 4I98B 4LMFA 1CN1A 2M8GX 2ZMLA 4NAMA 4U0WA 1RC9A 4M6YA 3HPNA 4XLNF 4ZZLA 3O1OA 3NNLA 1JKOC 1S0DA 3RWKX 2DFEA 2QE3A 1S29A 1VAVA 3W6VA 4NR1A 1UKGA 2VOKA 5GPCA 4U88A 2OD5A 4BDZA 3DECA 4UUSA 3DBLB 2YROA 3CP8A 2L9SA 4KIGA 2AQEA 2RS11 1X3ZB 2VGDA 4B4QA 1UZCA 4XQ4A 3AP9A 1ONVA 1LOCA 2XVGA 4PI0A 2YG0A 5EEAA 2BQPA 3LNQA 3DKQA 1WBLA 3JRCA 5HLHA 4CUCA 1P2FA 2HXOA 1JI6A 3GTLJ 2W94A 2I07B 2OAZA 2V09A 5FKMA 1PHMA 3ZOBA 2MBFA 4BQ5A 5FLIA 2CV2A 3QYEA 2QVSB 2ESHA 5CU1A 4IHTA 3VGIA 2VXJA 5FMCA 2KP6A 4YELA 2ELJA 1W8WA 2Y26A 3I7DA 2VASA 3ZMVA 1YI2I 1EF4A 3PURA 3U1XA 5FPXA 5LCWL 4J25A 4A3KJ 4LG0A 1HQWA 4P9WA 5FYYA 1U0AA 5D6EA 3WNLA 2HTSA 4GD4A 4Q48A 3QCWA 5LHHA 3USUB 4JV4A 1PP7U 5FYIA 3EXUA 4CPBA 2VT2A 3ZQQA 3OSGA 4IEXA 2EJRA 4ARXA 5CAZA 2UYBA 4MG2A 3S1MJ 3BIEA 4CDXC 4K20A 2OKXA 5EYRA 3O1MA 4DB5A 2FCUA 4U0YA 4UVBA 1STZA 3I59A 2LW8A 2RMU1 4XACA 3PO3J 3V64A 4HOOA 4UW6A 4D7MA 4XBQA 3K75B 4NRPA 1UZYA 1G3SA 3DYMA 1N25A 2QENA 5FAXA 1V54H 4MFEA 1XPWA 2K4JA 1QDCA 2X1DA 2W1WA 1RUJ3 3MF9A 2WFPA 4ZYDA 2LUWA 1UY1A 1XTAA 2DA1A 2TUNA 1F31A 4X8NA 4Q4ZF 2NVQJ 4OMDA 5K0UC 4L5EA 1PUEE 2CGPA 1YQ5A 3VD4A 3ATGA 3TQNA 4TZDA 1ZYRF 4OMZA 5DPNA 1SVLA 2E2JJ 2Y8KA 4LJHA 5ABJC 1J1LA 4LE4A 1I1GA 5C33A 3U1DA 5CFCC 3JRHA 5EDNA 1DPUA 2V1NA 4PGGA 3QYFA 3IWZA 2P6SA 2RAEA 2EIBA 5H9PA 1KQ9A 4L0PA 4XDPA 1S72I 3SJMA 3BG7A 2VZUA 4ISQA 4LHKA 3C7OA 4AE2A 3UKTA 2XJVA 2NVTJ 3P3NA 2DT6A 3L09A 5GALA 2FF4A 2XWJB 2E5NA 4KDPA 4M74A 4GWIA 3KFWX 4CHUA 3GXOA 1GUIA 3KP2A 4KQ7A 3JAMK 2IGNA 1ETYA 3GX4X 4COVA 5LLQA 1J2XA 3KP7A 3OOXA 4Z1VA 3J7HA 4A69C 3ZYBA 5ERLA 2VUJA 4W50A 1U9OA 1ZR4A 5C3QA 3R4KA 5GLWA 3WP5A 4BZ4A 2AEZA 4QPGC 1FZPB 2PHRA 1IN7A 2WL1A 4A93J 1VQ5I 2YBKA 2HGCA 2X48A 3ZSJA 3H1MA 2A68F 4S2HA 2JDUA 4EQQA 1R5ID 5IP6A 2WV1A 1MS9A 3B3QE 4LLGF 3VBFA 5FYMA 3JSPA 4DFSA 1OOPB 2CWMA 1EV11 2VC1A 5M3FJ 4JC1A 1MZBA 3EUHA 2D6NA 3CUOA 4B1MA 2P7VB 4CYDA 5M5WJ 5CVIA 1QA6A 1Q8QA 1ZELA 2L7KA 2L5QA 3O2PE 4CDXB 2DFBA 2D93A 4CDUC 5DCFA 5J4VA 4Q4V2 3WZ1A 2JQ7A 1ND2A 3H0DA 1KDKA 3BZCA 2KIMA 2EILH 3COAC 3AG3H 1O3QA 2BWAA 4BQ4A 2ZACA 3CDIA 1RJ8A 3O1UA 2LC2A 4Y22B 4QGLA 5LY2A 2DFCA 4Z8BA 3FMQA 3R0AA 3WNMA 1ULPA 2D6MA 1WVRA 2EB7A 2ZEXA 3ILRA 3HTUA 4MOAA 3LFUA 4R1HA 1EUUA 2O14A 3LSDA 2VZTA 4Q4X3 3HOZJ 5FIXA 1POV3 1HBXG 5E89A 5KXEA 1X1BA 1IXRC 1W0NA 1PZ8A 1EKEA 2BZTA 2WIIB 1IZ1A 3WW1A 5H9RA 1HSTA 1CIWA 2QQIA 1NG7A 1YFYA 3P1IA 2DCYA 1TMF1 3MEPA 4K9SA 4MGZE 4CZZA 1UFMA 3RPUA 2RJLA 1AR81 2VAUA 3HQUA 2JVGA 3AL5A 1Y9QA 4UW3A 5FYBA 5LA0A 5LBQA 5FKNA 4LBJA 1IG3A 3HUGA 4RGSA 3L2WA 1UX7A 1ULFA 5EJZB 1NA1B 4LHLA 3GYHX 4HPKB 1OLTA 3FXRA 1NKGA 5FZLA 3IUOA 2W52A 3JRFA 2ZABA 3W21A 5F32A 2Z4FA 4ABZA 5FUPA 1XE0A 4CUAA 4NIDA 3UKNA 5K7PA 4L18B 2FSWA 4XDQA 4L2NA 1VQOI 2P3YA 2ZHNA 4E4HA 2R5YB 4GJYA 4F93B 1RHI1 1JHHA 2GAUA 3K70D 4GJZA 1BOBA 5ILUA 4E2QA 1RGSA 1P7JA 3LWFA 4QXBA 2DK5A 3SH3A 4XRSG 2XQRA 1SVMA 2MLKA 1XDUA 1DU0A 2GC2A 2XB6C 1P8JA 1MBEA 2I45A 2HWD3 2R073 5F04A 4XQWA 2XL9A 3E5UA 5IYCJ 3MIGA 4TLFA 1QJX3 4N43A 2PHFA 3B7MA 1O4ZA 1ZGJA 4BJ0A 2A71A 1NUKA 4FAHA 4IRIA 4GXOA 2YR2A 3TOAA 3S6PA 2M8EA 1ZBE1 1JYCA 1D0HA 1BCXA 2UXNA 3JSOA 4L9VA 2XPUA 2R043 1B35A 4PQ9A 3ETPA 1ZHFA 2M3AA 1QPIA 1ZQ3P 3T8RA 2FBKA 4MNUA 2J7MA 3LDRA 2WT0A 5ANQA 2YB7A 2ETHA 1VMFA 4EJOA 4L0YB 4YVWB 3M4OJ 2LH9A 1J83A 5AFBA 3LAPA 1C8M1 1ZZ9A 3BU7A 1KDMA 3KQRA 3WQ1A 1FYLA 4WXDA 2HEYF 1E3PA 3NQHA 5FMOL 3I4MJ 2YDEA 1TVGA 1QXJA 4RS8A 3WHCA 3GLLA 4L0ZB 4XUTA 5JR2A 3OBZA 5FRMA 1W6PA 3HOYJ 3M7GA 2HDCA 1JH5A 4XF3A 2LTPA 3VBRB 3S57A 3A03A 1I5PA 5A2QZ 2G9GA 4BKXA 3AL0B 3AMNA 2MEV2 3CLOA 1NAEA 1W6QB 4MH0E 2KM2A 1W0PA 3B00A 2RM21 1LHUA 3VDXA 4A3DJ 3O0VA 1RUC3 5JOZA 3SQNA 2PLYA 1XRUA 4XF1A 1QVUA 4ZY9A 4EN8B 4AVPA 4L92A 1QY4A 2Y64A 2KRHA 5ILSA 4HEA2 2MC4A 3DEWA 5IVCA 4HV5A 1L3LA 1MD0A 4RLQA 4I76A 3PO2J 4QX0A 4WM7A 2NVXJ 4JDMA 2H94A 3JRIA 1PGW1 4W6YA 3LCPA 1CAXB 1R081 4AIHA 4SLIA 2K4BA 3GHNA 1DFQA 1Q8VA 1PNGA 5F2SA 3E6MA 3THCA 4BH9A 1DQ1A 5JIUA 4DIQA 2OZUA 5A7NA 4H7LA 2WAQA 3L00A 4WVMB 3GALA 2BY3A 3WG7H 5DAQA 1Y6IA 1U5TC 3QLQA 1YNAA 4ES8A 4MV2A 3AJZA 2MHFA 5FPLA 2ARXA 1XE8A 4EQVA 5CFCA 4HRIA 2E7WA 1ND3C 2JDNA 1WW7A 4IHWA 4XSXF 4AVBA 4ITVA 2VL8A 4EN0A 1LOAA 4KI5M 4XUOA 3BWGA 1QH6A 2L9NA 1W06A 3EJKA 4WM8B 1JTZX 3K4AA 3TAYA 4XJZA 1QJU2 2PG4A 2K3FA 1KXGA 4AWXB 4BE3A 3I5UA 4PJNA 3ZMOA 1NK3P 3RJ2X 2GC1A 5A32A 3PL0A 3PFYA 1HDPA 2XRNA 3HNYM 1Q1VA 1M4WA 1V00A 1I1EA 2Z69A 4IETA 5CB7A 3N9PA 2QQBA 4MHGA 3L2QA 5IK8A 2C4XA 2X05A 1W9SA 2BVVA 1QGLA 4MGSA 3SCFA 4OINF 2BBVA 3TEWA 3AKTA 2LY2A 3G1MA 4CDQA 4B1RA 5F27A 2XUEA 4W4ZA 5LGTA 2CDPA 1TLHB 5FBJA 4MEYF 1ZG1A 2HFHA 3NWSA 4UOJA 4LEJA 2VJJA 1F4HA 4XMAA 3H1WA 1J3PA 1ULCA 1LGBA 1ETKA 2DV9A 2ZGRA 3BPSA 4Y3OA 2FUG2 1HJFA 1YFWA 3RSJA 1IUFA 4Q4Y3 4B47A 3UNGC 5FMDA 2DPUA 1OQYA 4N43B 1QJY3 4RGRA 4FASD 2G9WA 4EN6B 1K42A 3APBA 1EAH2 1U5YA 2JD4A 4IESA 1FAYA 1CZVA 1U5XA 3I0TA 3TL4X 3HUGB 2E51A 2BRTA 2XAHA 2ZXIA 3GTOJ 3BCBA 1V9U1 4HPQA 5AVPA 2XH6A 1IV6A 5EXOA 2Z1DA 4KG0A 2GLOA 3S7EA 2Y69H 5DUIA 3UR3C 1PO23 3I4IA 5FWEA 4QX1A 2MEV3 1RB8G 3ZSLA 1QNYA 1VBA1 3QD6A 1IN4A 5FLVA 4A5MA 2OTLI 3IM0A 5FXWA 4CEWB 3HWJA 1UMHA 3DEUA 2P17A 3LEKA 3L9JT 3RVHA 1I6XA 2WWUA 3OPWA 3CMYA 3SISA 1BOAA 1RUD3 2PYTA 4TN7A 1K5MA 5FO7B 5F64A 4EATA 3POEA 1VBE2 3VBRC 2IFWA 1FBQA 4RA0A 1W2TA 5K5OA 2B7EA 4KUMA 5LD2C 5D8AB 5LFAA 2YFUA 2W7NA 3JRBA 1PO12 2Z5WA 1F5JA 5LBCA 3PVNA 1D0XA 5LK7B 1PMIA 2YPDA 4PF5A 1HB2A 1XMXA 2OQRA 3GFJA 2X1CA 4LBLA 4MO7A 4UY8I 3PUSA 3H8RA 1F4KA 2Y6KA 5CKMA 1A04A 5CYYA 4M01A 5HLGA 3ZYPA 4ESFA 5L3EA 3CJIA 2IT0A 2TNFA 3CHXA 2QKLB 2RDSA 4EWDA 5CVRA 5K5RA 1C8NA 1O4XA 1ZRFA 4ZZDA 2FQ4A 4B3AA 4RB1A 5E1XA 2BWCA 4RR3B 1H89C 4CU6A 1DU3D 5ANNA 4FPFA 3H3ZA 4UI9L 4XM3A 1XSVA 2F5FA 1CVNA 4BK5A 2IA2A 2EICA 4L9BA 1E3OC 2H09A 4IEWA 1OXCA 1K7AA 3G6JB 3GTGJ 3RI8A 4RR3A 4G12A 3ES4A 4A45A 3VBUC 2XHNA 3J8F1 4CDXA 1YEWA 1UZVA 1VMHA 4B1LA 3OYEA 1RUH3 5L7OB 2QWWA 4UWDA 3D4KA 3CKHA 3IB3A 2IVJA 5IT9K 5IYDJ 2SLIA 2ZZJA 2X5IB 1OJLA 4XHBA 1UG0A 2DMPA 3WDTA 4HSLA 3DTIA 3AYAA 3WG3A 4A3GJ 4KWKA 1VB2A 4CICA 5FKLA 4KGGA 5D1IA 4OHZA 2GIVA 4XN3A 4PIYA 4R8HA 5BNOA 4QQHA 4IV3C 1SLIA 5EFUA 2IC1A 4ON0A 2WLQA 2PHDA 4MGQA 3C2GA 4KWLA 4RS5A 4ASNA 5JSPA 1F8VA 1SD6A 1VQMI 1YX5A 4JTNA 1PJRA 2ID4A 2VZQA 2HH9A 3AZXA 4EEFG 1UIJA 5CQEA 3I97A 4ASLA 4PIZA 4G94A 5JZGA 2FRHA 1NXD1 5BQTA 4XC9A 2M87A 1WGXA 1RKTA 3POFA 2WA3A 2A5WA 3U0ZA 2XF5A 1BLZA 4DXZA 3VLBB 4DNYA 5J37A 2FBEA 2HYFA 1K45A 5JHFA 4ZZ5A 2J1RA 1LVAA 4UFIA 1OURA 2GXGA 4BY7J 5J3LA 3T0DA 1QNWA 4IX7A 4M6XA 2ZGPA 2CHHA 1OH4A 3KD4A 4KJZA 3HGGA 1JJ6C 1JZ7A 3BG9A 1FPN1 4XF0A 1OQ1A 3LSRA 4G6TB 4MUVA 5LGNA 2WR9A 3I3EA 2D1HA 4KN7X 5E88A 5IHRA 1FYKA 1YUDA 1HQLA 2O0YA 3J4UH 2HWF2 4OWRB 3CCMI 3OY8A 2Y6HA 3THPA 4EJRA 4NIHA 4KGQA 4PK4A 1IS3A 2M34A 3MW4A 4LG3A 3WW3A 3HN3A 2P3JA 2ZS6B 5EZHA 2J1AA 2NN8A 4B7EA 5FZ1A 1UHMA 1VQ6I 2C6SA 1SMTA 4NROA 4CZCA 3NQOA 2XJPA 3FBNB 4W97A 4PJYA 4X8PA 5FYHA 4A0YA 1RUG2 1PVXA 4LA2A 5A33A 3VKNA 3GLXA 3EYPA 4ZXEA 3GTQJ 2EZIA 4QKDA 5BNOB 3FZVA 3KLSA 1RL3A 4EM2A 3RJRA 2OIIA 3OR2C 2Q8EA 1W8ZA 2HQAA 3IH3A 4F83A 4P5YA 3VB2A 1IS4A 2VBPA 3VYTB 3RGBA 2W91A 1SANA 1R093 1CZSA 2KISA 2A6VA 1MMAA 4YG3A 2EXIA 2A1XA 3FLTA 5H2FC 2FZ1A 3AFKA 2EH3A 2W9XA 4JX0A 4V2FA 1EUTA 2DMUA 2MH2A 3SC7X 3X2QH 1XGNA 5IW0A 2W24A 2DURA 2WZR3 2H1LA 5D5XB 1IQAA 4FVVA 1BVVA 3ZQGA 2AEYA 2E33A 1ZN2A 2WNEA 3POWA 3LF7A 2LNBA 4YW6A 4NMIA 1P4WA 1VNDA 1U6GA 1HRI3 1XGSA 5EV7A 2DT7B 2OCCH 4M4PA 4LB6B 3AC0A 3ZQHA 1EAH3 4LK1F 1ASJ2 1YITI 4AC0A 4GAZA 5F5IA 3OJBA 4RB0A 1FNZA 2XAFA 2MA3A 1COV3 3CCEI 1BK0A 3A02A 2NRAC 3HMYA 3CCYA 5FZ8A 3ZN4A 4XTMA 2G19A 3PM1A 2NMOA 3KSCA 2WT2A 1MKMA 2R16A 4BMEA 2LYCA 1OCCH 3T09A 5FLXZ 3HEIA 4J19A 3RWNA 4JHTA 4I2OA 3VN4A 2BHYA 2STWA 5GAEJ 5G04L 5SV8A 1OCPA 4HDUA 2VODA 2D6PA 3HT2A 1MACA 2ZX2A 3S5AA 2PMZA 2Y0SA 4OU0A 4QKFA 2A5ZA 2VTXA 4MO3M 2BERA 1XB4A 4UV9A 3SYTA 2MSYA 1KGSA 3TDUC 3DYPA 3BTYA 3M1EA 2VO5A 4XSZF 1YC61 2CQ7A 4Z82A 4EGYA 3BZKA 4J01A 2Y0MA 4K40A 3BP8A 1ULDA 2RN7A 4E4SA 2BFUL 4QT6A 3NRUA 3VZNA 5KXDA 3BTJA 1AR83 3WTYC 3ACLA 1DGWY 3NV3A 3OD4A 3H0GJ 1HRV1 2CQKA 2RREA 2CG4A 3VZOA 1JUIA 1TT5B 3DPRA 4QXCA 4A0ZA 3VDDC 3HPHA 3ASIA 4M3CE 2CQXA 3QU6A 4S05A 1K6YA 5FXZA 2L9VA 1GR3A 1AXZA 1T98A 4Q5SF 3IDBB 4ISRA 2RS52 1XN7A 2VPLA 3LIHA 1ULOA 1G86A 1QO0D 3K1PA 1DYPA 4AL9A 1CAXA 4UHTA 1G9FA 1X50A 4Z92B 3RSNA 2WAEA 3SDBA 3T2TA 3VBHB 5AONA 3ZN6B 2VVDA 2EFPA 1UOBA 4H2AA 2IXCA 2W85A 3KV6A 2E2HJ 5JXJA 1U3EM 3ZSMA 2KA3A 3H7YA 4LXLA 1RI7A 3H0OA 3IC7A 3S17J 1EY2A 4DGWB 1W8NA 2KDZA 2F17A 1WJDA 4F3QA 2W2IA 2ZGLA 5T55A 1MH3A 2DMNA 3BLYA 2FE3A 4K7JA 1W90A 1WJEA 4E2SA 1GMMA 2WZEA 5HCHA 1GZCA 1SD7A 2AQFA 4GA9A 1R49A 1S7OA 2JA8J 4PCRA 4J6GA 3MHZA 3WODF 1RZ4A 4A6SA 5FY7A 3D0SA 3VBOB 5JVGF 2VBWA 4B4RA 3OUHA 2CUFA 3RQIA 1OLRA 1N3QA 3RZGA 2WZR2 4QPIC 5T54A 3AKZA 1VTNC 1CAWB 1Y3TA 2W1OA 1D0GA 4AVAA 3HOTA 3VDDA 5BNQA 5HCBA 3W58A 3W3CA 1MJBA 3DBRB 4BACA 1XCVA 2YC2A 5J48A 1SFYA 1ZBE2 1FPN2 3L2UA 1W3XA 5HV0A 4UF0B 4C3IJ 1ASJ3 3CQOA 3TRSB 3S8PA 3GZTB 4Y1UA 5E1RA 2YC4A 2ZJ2A 4C30A 3DP7A 3DWLE 2VOOA 5EZGA 3W6JB 1RINA 4QHZA 1F36A 3SNMA 5KHIA 5BV6A 4IE5A 5T5PA 5BS6A 4XFHA 3OYLA 2HWB2 2JKBA 2OBPA 5C4WB 3H92A 1P92A 1YQ8A 1FOWA 1Z7S2 3OL4A 2M2EA 1DU6A 1MGTA 1ENHA 1WKYA 3B94A 1JZ6A 1PZ7A 4W6XA 2IS4A 1UKRA 4AEJA 5D21A 4ESBA 4FTBA 3D3AA 3ZYGA 5ED4A 4XJAA 4Y15A 1VBD3 4QQOA 1D4M1 2YUEA 1AXKA 4URTA 2VULA 2KJCA 4C2TA 3V7RA 3QAHA 4P9FA 1H1IA 4Q4W1 3C3WA 1GXPA 2D98A 1N1TA 1UY3A 2VOPA 1L0OC 3MKWB 3HR9A 3M3EA 3E3VA 4Q0PA 4RM3A 3EDPA 4U7BA 3FLRA 4RAZA 5J40A 4Z2AA 2GC0A 1AXYA 3TEZA 2G9ZA 5FPZA 2VW2A 2EIEA 1WA4A 4N53B 5FYVA 3WOGA 2BBYA 1DGRN 5T5LA 3AP5A 4BJ5C 1R092 5APAA 3ZRGA 2RR11 3I2HA 3OB8A 2FA5A 1YS6A 4EGZA 5FY0A 1HW1A 2QQAA 1FIPA 3CEWA 2R92J 1W6PB 1GSLA 4A3ZA 3BTIA 4HX4A 4HSJA 4RHV3 3V4GA 5LRSA 1GU3A 4DMIA 1R7JA 1QU3A 3F8BA 2I5UA 2JPBA 1C28A 1IRZA 1LOFC 2V26A 5FZOA 1KQ8A 3NVCA 1GP5A 3RZLA 5A6QA 3R05A 3D82A 1SC7A 2NXNB 1LRHA 3T1BA 5ICGA 3HZJA 2Y9YA 3AZZA 2L4MA 3FHAA 4IV3A 4YGCA 3KZ4C 3S1RJ 5JXHA 2WJSA 5HBAA 3FWEA 1LENA 2J1TA 3IZOA 5CFDB 4CDQC 4BK4A 2J42A 2EFNA 4AOCA 2RVCA 3KE2A 4N9HA 1G6NA 2E34A 2VUAA 3F72A 3FKIJ 2XBO3 4WM7C 3MUZ1 1Z9CA 2R49A 1LNWA 4LKFA 1VQ8I 2VJ4A 2Q8CA 3S2WA 3RCOA 1L3JA 3ACGA 5K8SA 1AR62 1ACCA 3RJPA 4HNUA 2ETEA 2WLPA 2ARCA 2HYJA 5DDJ1 2LG4A 1GHCA 1SBDA 3LOIA 1GOGA 3L7WA 3MV11 2VVFA 2VZSA 5A3WA 4IO9F 3M3CA 4XFGA 1SDDB 3WNKA 1WCDJ 2B8MA 4YW4A 2VC9A 2QYOA 1H30A 3TW6A 1RMU1 2VQAA 2BY2A 5I0UA 5J09A 4BCUA 2RS32 4YYOA 4UVAA 1Q8SA 3DPTA 5KXCA 4A3JJ 2QQMA 2DYSH 1RXFA 2XVKA 1EPZA 3WUDA 2H6CA 4RSUA 2W00A 3H3VK 4EJWA 4MVTA 5IK5A 4FPEA 1BYHA 4AYUA 5DDGA 3GCXA 3POBA 1AF9A 1D0ZA 4UBGA 1WLCA 1AX1A 1JHNA 3MV01 2FDFA 1AL0G 1LB2A 2FDJA 3HM5A 4EM1A 4Q4X1 4XQDA 2ZTNA 4XJWA 5L3GA 3U4SA 1Z77A 2VKVA 2K2SA 2NAZA 1QBJA 1RMU2 2V5YA 1K5MC 1AR73 2AYHA 4XKBA 4IV1C 3VBRA 1D0YA 2RNJA 1YWKA 4ZS3A 4ZPIA 4C91A 2UURA 4QXKA 3WR0A 2RM22 2DCKA 4P08A 4LJZF 5LBBA 2M4KA 2O03A 2YU9J 3RKWA 1W6OA 2X8KA 6PAXA 2V1UA 2HBUA 4S2DA 3I71A 1G9CA 3TDZC 4DZPA 4P02B 2DA5A 5KXBA 3QWLA 2P0WA 4XIDA 1W6MA 1IGNA 4N53A 1U5TA 1RUH1 4Q1PA 2QA4I 1YJ9I 4FP3A 3OD0A 5HNFA 3T3YA 2XRLA 4YFXF 4KFCA 1SFXA 2VXDA 1GT0C 4QSHA 2BOJA 5FZDA 1HA8A 1JKRC 5JVTA 3N9MA 1J9IA 4WBBA 1K5JA 3EYIA 4CYCA 1UD1A 1GYKA 3E1SA 1MBKA 3TNPB 2XONA 3MW3A 5E8AA 2ZGUA 4CZSA 2MGQA 1Q8OA 4CDGA 1GV2A 1A5JA 2X4HA 1N78A 2XKOA 3ONQA 4LNVA 1REDA 2VNOA 4AHWA 1LFBA 2NS0A 1O91A 1KS4A 2A6EF 2CS3A 2DCZA 1RIRA 5G05L 3BTLA 4V2WA 2X1EA 3H42B 4DRRA 2O8XA 1JYTA 4AHYA 2CAVA 3USUA 2VT3A 1T8IA 2HBTA 1EH8A 2AXTC 1WJFA 4JX5A 3R4UA 1KQ0A 3I2JA 1KU7A 1QQP1 4KIFA 2V4VA 4YZ3A 2WNOA 4OZXA 4XVHA 2X5IA 5FP7A 1PX4A 3UT0A 4NHXA 4D0QA 4YFZA 3L2HA 1PVC3 2P37A 2DYCA 4ZYAA 4NJ4A 3ES1A 1DP7P 4Q0VA 2FCVA 5FCCA 2WN3A 3FUQA 4IRGA 1HDKA 3H35A 3GGLA 3N3HA 1U12A 1ETOA 3DF8A 4BE0A 4CCNA 3FKJA 4AVZA 4HA8A 1DIWA 1Z7S3 2NOJB 3M3IA 2VNRA 1OD3A 5GTHC 1OPOA 1VE0A 4OVEA 1Z3XA 1U2WA 3FK6A 3IL2A 2BGPA 1D7PM 4KL1A 1QXRA 1YFHA 2VJIA 5IJRA 2YSRA 3HD8B 3EUHC 1E57A 3IH4A 1NXMA 4IEUA 2PELA 2M30A 2RS33 2EIKH 3MN2A 2Y0IA 4NB5A 2R0HA 5CIRA 1LPQA 4YVWA 2PBIA 5C5TA 1OHFA 2VOXA 2FDHA 5JZGB 3CL1A 1S4CA 4Y4YA 1JU4A 1XNBA 1CJPA 4EJVA 1ZZCA 2ZXQA 1O4TA 3HRTA 2LY9A 1CGPA 5GM0A 4FPCA 2VKHA 4BYYA 3HRSA 2W5FA 3BJ6A 5HS8A 1P9QC 3K2OA 4AGRA 4YFWA 3P9KA 3ERED 2R041 3GFMA 3CMEI 4A3EJ 2PLV3 3NV1A 1KU3A 1R22A 3UV9A 2V1XA 4E7IA 2DXIA 3OYFA 5E17F 5EEHA 5DM6F 4JOMA 2DTYA 3AJYA 4OMYA 2P34A 1ZAOA 4A3XA 1ND2B 3OIQA 3V0BA 3QBQA 3ENRA 2XHKA 3VL8A 3FN9A 1JW6A 4M4RA 2YGMA 5FZKA 2R1BA 4MHRA 2O8OA 1RUI2 1SAXA 2FOKA 1US2A 4ZC3A 3MIDA 2FMYA 5A1FA 3WDXA 1W04A 1MDMA 3CJXA 2QQ9A 2V5DA 2MNGA 3ZX7A 4YG0A 3ZXLA 3D5SC 4F52A 5FO8B 5DZEA 3L9FA 3IAPA 1XSQA 1MR5A 1BI2A 1RUI1 1Q3EA 5L3CA 2YGLA 1LEDA 2L01A 3AFGA 4XAAA 3FMRA 2Y6JA 3HOBA 2WKKA 1QMJA 2DVGA 4Q0QA 3A22A 1Z0HA 2VI6A 1UYZA 1ZRCA 5JLVA 1VBC3 5KBFA 3JBG2 2JG9A 1LGNA 3RPQA 2WBKA 2J1VA 3S3MA 1R1A3 4O9GA 1WCKA 4HZFA 2PI0A 2E26A 5D5VB 1PVC1 3P6BA 2HVRA 1BEV1 4UXAA 2AHQA 1ZA4A 3WU1B 2PHLA 4GMP0 1LDDA 2VM9A 2X6YA 4Y1YA 1GKBA 1YRNA 4DXTA 3E5XA 3ZR8X 4QM8A 2R7TA 2NNNA 4ZZ8A 4COZA 4LO4B 2J5OA 5AC92 1H8VA 1HB4A 1P4AA 4KU8A 3FL7A 3SFZA 3KT7A 4FPOB 2Y31A 4WXCA 2TRTA 4QD2A 3A01A 1B8IB 4G6DA 2UWAA 3LEMA 1OUSA 1UXZA 2QQJA 3F95A 2ZMNA 2XWBB 4YW5A 2LKXA 2IVMA 5C70A 3GJBA 5F5QA 2XAGA 3CDHA 2KKOA 4GULA 1MS3A 3GZ5A 1Y4WA 5HDKA 3SEPA 4UW4A 1TWCJ 1F15A 4M72A 3E6CC 4UV8A 2LALA 4LBQD 2WAQN 3FBYA 1R6RA 4L5IA 1IKQA 3UK9A 5L19A 3R60A 4DOUA 1X19A 4IGQA 3O5SA 3WW2A 1MVEA 1MBGA 2RHPA 1KRIA 5E18F 2HWD2 2R072 4OQ9A 1Z7S1 1US3A 4YPJA 1UNBA 4CEYC 2PA7A 3OF1A 3GZAA 5FD5A 3DYOA 5E1WA 5IATA 1BA5A 3RZZA 2HOTA 3ULQB 1VAMA 1A8MA 4QGMA 5F3CA 4B4PA 4I01A 1SFNA 2E60A 2HKOA 2X6WA 2JB8A 3ZXAC 2W95A 5EP9A 3ELKA 1C8M3 4LT5A 4AYBN 2XIGA 1ALYA 1ZGWA 3CF2A 3PNYA 1M1EB 4C2MJ 4QHBA 2CV1A 1L7LA 4WWCA 4UFLA 2WSUA 2DQRA 5KHHA 2CQQA 1F5TA 2L7FP 2CGNA 3PIGA 3G1OA 5IVEA 2WZR1 5B4NA 3I2KA 1FY7A 2R7VA 4X6QB 1I1SA 3A21A 2GXBA 1RVF3 2WB1A 5A7WB 2NS7A 5K0UB 2DO7A 4M00A 3C2UA 4CUBA 3I55I 4XBNA 4YZ2A 4PQQA 1BHGA 1VQPI 3J81K 1ZM1A 5K1YA 2YU2A 1WRJA 4I0AA 2GP5A 1JOJA 2Q30A 5JHUA 4YW7A 5FPAA 2PTMA 2IGMA 1HKDA 4M0HA 4PLMA 1LR5A 1WLDA 1ETXA 1DCSA 1LNSA 3K51A 4RFT0 2YPJA 3ZXFA 5HCAA 2GN7A 2K9LA 1V6MA 1CX1A 3KX2A 2VOTA 5BXXA 1W2AX 3KETA 3M8FA 1IG7A 4CDUA 1WCSA 3ETQA 1AKHB 1WLWA 3BQYA 3G71I 3OGGA 2HI3A 1JMUB 3JBG3 2WQ4A 1RUC2 1X3WB 2IXKA 5DUUA 2F4IA 2F6CA 1A36A 5ABJA 4FPGA 1RUE1 2JENA 1F5FA 3LL7A 3U11A 2VH9A 2FU4A 2ZCWA 3ORJA 4IE6A 4BQNA 2NNYA 2BUKA 3BPXA 3GTKJ 1QJU1 3OYWB 3TGNA 1A8DA 2I2SA 3GZUC 1G3YA 1WW6A 5E3LA 2ILMA 4EWAA 4IEZA 4H14A 1G9DA 4XMIA 2VPRA 2F5VA 1RUOA 4EJTA 4CEWA 2HYKA 3D6EA 1JHJA 3PJRA 2E7QA 5FBZA 4LK6A 2WYFA 3VHNA 3I2OA 2M0MA 1DZRA 1UYYA 5C4WA 3F8NA 1G3WA 3JQWA 2WWSA 4RHV1 4LK7A 5IFPA 3RZHA 4L11A 5DMYA 3EB7A 5CVVA 2DFFA 2W0XA 2D43A 2BEOA 2JECA 3LFKA 1QQP2 3S3NA 1H2KA 4ES9A 4XN0A 2JDZA 4CP1A 3I3LA 4M71A 3K46A 2X6OA 2BPA2 4IXAA 1IPJA 2VBBA 4UVCA 1VQ4I 1SG3A 5HPOA 2E7AA 4RMNA 2JSCA 4D1QA 2GN3A 3JZVA 4Y1VA 5C3OA 1WI9A 5JAXA 3SKJE 1ZG3A 5BNPC 5JMOA 1OVSA 4IE0A 1HV0A 1PGL2 4DINB 1FTTA 1H2NA 2FDGA 5C9AB 4XFFA 1S8NA 2M1BA 2VXZA 3BG3A 3PSIA 3CJTB 4BXXJ 3DN7A 4CDWB 2XLAA 5C8CC 2JKXA 5A70A 1UL9A 5GLZA 3JBG1 1JT0A 2BGOA 4W1UA 1BVP1 1PX3A 5JPNB 5E3OA 3KCXA 5JUVA 3DKXA 3IAQA 2XGEA 4F92B 2WO1A 4IW3A 2PMHA 2P1BA 3SDGA 2CGOA 4AIKA 2D3SA 2GZWA 3HBZA 5F9TA 5EGOA 2WO7A 3I3MA 2WA4A 4KITB 4P5OA 3OS2A 4RGAA 5FREA 3ZQIA 3C8XA 3OUIA 3BR5A 1WKMA 1RVF2 4NC8A 4CCLA 1HXS2 1BIBA 2GSYA 5FWJA 2Q2EB 1Z78A 4GALA 2HEOA 1B1BA 3E6DA 1JTYA 2X85A 2WFF1 2Z99A 5KAFC 5BPIA 1PGSA 4NHLA 2WBMA 5J98B 5FO9B 1LOBA 3N7KA 1V5FA 5I93A 2Z9OA 1YLLA 5J36A 1I9RA 3BTXA 4A3IJ 4RS5C 2L4AA 1UAAA 4ZONA 2YX4A 4HKWA 4OAYA 1W8TA 2HWB3 3IMMA 3QP5A 2VL4A 2QM3A 1RUG1 3DXJF 3LSHA 2PAMA 2Q8DA 3LOCA 3KVAA 5EYXA 4IJAA 3GHMA 5B1BH 1OLME 1T38A 4QHOA 3HOXJ 1F4AA 3X29B 3FHZA 2WY8Q 3NWTA 3PJYA 4QQ2A 2AR6A 5L73A 1I3AA 1GQHA 3FM5A 3WTVC 2DVDA 3IDAA 2D6LX 2EBIA 3G7DA 2XB0X 3GDBA 4MEXF 4AZZA 3AMMA 5A2QK 2XBO1 2KZGA 5K9YA 4LKEA 3CUQA 2ZMEB 2HEWF 4S04A 1H4HA 3JR9A 1FMWA 5AVAA 1NLQA 1WZ2A 1PO13 5D8KB 4HNVA 1FX5A 3WT3A 4BQ2A 3NJXA 1TL8A 2IGKA 3RYPA 2PJRA 2GMEA 1PNFA 2QZ3A 4G4FA 3V0AB 4MX3A 4NHKA 5K5QA 4BLIA 3LPGA 2QDNA 2WDBA 4V2GA 1E0EA 1WW4A 4LHNA 3WEZA 1BR4A 3H9QA 1J1TA 4GH4C 4IQJA 4BLJA 3OEBA 4INDA 1BJZA 2IXSA 4BQWA 4JTOA 1NLSA 1OSGA 2HLEA 3NKTA 5D6FA 3E0JB 1HSJA 1NCRB 2VE9A 4I6ZA 1JN2P 3MAJA 1ACIA 2UY8A 1POV1 4JQRA 4RGGA 3H8XA 4XRFA 4JYKA 4ZDPA 4EE2A 2Y6GA 1FOYA 1H1MA 1Y9GA 1A6CA 1ND3A 5HLTA 5DCMB 1NZIA 1KITA 4YVSC 4KN4X 1ERDA 3DCQA 2L02A 2NS8A 4IOCF 1ZLKA 3ZMNA 3H9AA 2BVLA 4YIRX 1K3IA 5IY5H 3OGRA 3AZVA 5FYSA 1DUXC 4IQPA 2KZVA 3J7ZI 1W9WA 3HOSA 1AWCA 1W9YA 4P9LA 1XYNA 5CPRB 5F3GA 2ZKNA 2QQOA 2BOIA 3ZO0B 3VD9A 3OOPA 1OD5A 1PO11 4IE4A 1CAUB 3HB9A 4MZUA 1OKRA 2UY9A 1T95A 5BNNC 4GDFA 3K4KA 5GKAC 1GWLA 2KIFA 1MSEC 3BQZA 4OI0A 2FMDA 4R9CA 2X51A 3NEUA 2TDXA 3WE3A 1FNYA 4Q8LA 4D6RA 1W28A 5I8SA 4L9JA 2Z5UA 4XILA 2HWF1 2PQQA 5J6XA 3I2FA 3ZP5A 3V7CA 3VYUB 4D0PA 1EV7A 3OCPA 3L2CA 1UYXA 2Y34A 2BNNA 1LFUP 2JWTA 1DGRM 4HANA 4XPVA 2L9RA 3WP6A 4QIWN 3HC7A 2E5ZA 1D4VB 3T30A 3O7OA 2A73B 4PIXA 1W6NB 1YTYA 4O7XA 2DAOA 1VF9A 2DPDA 1LVKA 1BBT1 3Q0UA 4U87A 5A3LA 4BXSV 5FZ3A 2COMA 5H6QA 4A6EA 1CAWA 4CP9A 1QJY1 2KRCA 4LBQB 1LTEA 3M4FA 3JU9A 1YS7A 3CZUA 1IN5A 3TMOA 2OU2A 2D2WA 3LE0A 1CIYA 3IV5A 2YU3A 3D5LA 1EPWA 4QPGA 4PLOA 3FXJA 1F2NA 1W99A 1BZWA 4BHCA 1S2BA 2GNMA 4FAGA 2KIUA 2I74A 4DUWA 4C9YA 2B9SA 2MABA 2DU1A 3ECOA 1W0OA 2WS93 2OPWA 3RMXA 3UGHA 4A44A 1Z3YA 3D5RC 2KMUA 4DRVA 5A80A 1Y8RB 4R79A 3CF5F 1YYNA 1QJX1 3AVRA 5IPAA 3VPRA 3G3ZA 4Y52J 3VB9A 4G7HF 2IPQX 1BJQA 3EPZA 4FOVA 5HCFA 3ZPLA 5M3MJ 1ZA7A 4BQ3A 1VR3A 3VSKA 3BG5A 5DAWA 2E6VA 4B29A 4J1WA 3BG6A 3BR6A 5GZFA 3WU0A 2W08A 4Y24A 1MZ6A 2ZGNA 3Q9OA 1F35A 1R23A 3N9OA 2ME0A 2CL2A 4GXLA 4XQFA 2GH8A 5JFRA 1YHQI 3KEOA 2OPKA 4BBSJ 2DFHA 3KZYA 3HOWJ 1S3JA 5IYBJ 4OCTA 1UF2C 1UU6A 2E63A 2ZJQF 3ZGKA 3BALA 3FUOA 2RQQA 1JU3A 1NA1A 1CAVB 2PQSA 5BOXA 1JUHA 1UMIA 3LEGA 1D2SA 4P55A 2R3SA 3OWTA 4XYXA 2Z2SB 4YGBA 3CD6I 2YU1A 3CU7A 4LLNA 1ENSA 5C4XJ 4X6AJ 1Z67A 4CDWC 4PJLA 1H2LA 2P6TA 2YX7A 3NAPB 3V7SA 1YOVB 4JGZA 2XXZA 4QX3A 1XXNA 2NLRA 1IZ3A 1OA2A 1WJAA 1POGA 4BMBA 3UL2A 4HKOA 5LBFA 2YHJA 3TN93 4CDWA 1RESA 5FFXA 1OLQA 5ACA2 3LFMA 4HVQA 2VB6A 2XLGA 3VBOA 5F1JA 3OYAA 2KFDA 2HEVF 4CPBD 3MLKA 4H55A 1MMNA 2XVCA 3DPRC 2K0GA 4GMP3 1K4TA 2RV9A 1V6IA 5KK1A 2KJBA 4YM2A 1JUSA 3WNXA 4LO6B 3FXMA 1KZHA 4E2GA 3Q8EA 1SFKA 2JG9C 2P5BA 1WD4A 1BR2A 2FQPA 4PDWA 3QODA 4LBOA 4H7MA 4N7IA 3O1VA 2BW3A 3L2VA 1YIFA 4FETA 1JUPA 3MVPA 3U10A 3KVBA 1QHDA 4E7LA 3RG0A 3KHCA 2C6YA 1X8EA 3BCAA 2HPIA 1ND3B 2CDOA 1H8TA 1FMD3 2QTWB 1Y1VJ 2YUSA 1MS4A 5BNNB 1J84A 2XG3A 4YFNF 1S0JA 1AHSA 2ZEYA 4UXNA 1F9NA 2VQ0A 5DAPA 1SLCA 4LGWA 1H0BA 3GYDA 2OV7A 3ZFFB 4CE8A 4JKKA 4YARA 4W6WA 4GKXA 2EF6A 4NOTA 2MEV1 1U5ZA 4WV8A 3NNGA 4HQEA 2Q4SA 3JD72 2G9FA 2BVMA 4MQVA 3FLPA 5A6YA 5FZIA 1FI2A 4DPNA 1CQTA 1JGSA 2LVSA 3SEZA 3ZFEB 1C4RA 1TQIA 3HOVJ 2L0KA 5DD4A 1NCQB 3RZMA 3TWIA 4MHUA 2X29A 4GWMA 5KAIC 1NG6A 3K2AA 4LK0F 1GV9A 4ZU4A 1LJ7A 2XMLA 5BPXA 1GVDA 4CTEA 4II3A 4ZTFA 1MH4A 2ZFUA 1HXS1 5F0HA 3LSTA 4CA0A 1AR91 3VWBA 1M06G 1KYWA 1VJ2A 1N1VA 2OW4A 4AQ6A 3RS6A 2OA2A 1HDDC 1AR82 2ISYA 4Y5TA 3CIHA 3ZMTA 2PMUA 2W3JA 3WHTA 5J3UA 3BOWA 2ZSHB 5I0SA 2H0VA 5FMBA 5LK5A 2A6ZA 2P6CA 2ZC2A 1JYVA 3WINE 5FZ6A 4BDYA 2A05A 1ZG5A 3VD7A 3TOJA 3PMEA 2RKHA 3M3QA 3KLNA 4D7YA 3KHBA 3ON7A 1SAUA 3ZSKA 4A3BJ 5FKKA 2JICA 4LO5B 4AEKA 3ZFGB 2E71A 1SPPA 4AEDC 4M3DA 2DWRA 4RYDA 3O8GA 4N8MA 1H8TC 2JDMA 3A0BC 4LG0B 1IRXA 2VE1A 3QH7A 3VBHC 4QKNA 1BJAA 3TO7A 2VZ3A 3H1YA 4OQ8A 3NO8A 1CQ9A 1SVOA 2CW8A 3I2DA 3EQLF 3ZDVA 4OMCA 2LFBA 1RIOH 2DMQA 4IQ4A 3U2RA 1QRYA 2DU0A 4Q2FA 4F7ZA 4KBBA 4AAPA 1BL0A 3LKJA 3J8F3 3HSFA 4FX0A 4B7KA 3TP3A 5KWRA 3MZ8A 2CFXA 3ZQ7A 3MICA 5FZFA 1OFCX 5FP3A 2LSOA 2H1KA 2NM1A 2AGSA 3A0HC 1NX9A 1PM7A 5I8YA 3BODA 1V5EA 4MGTA 1FPN3 1IXCA 2UWMA 2XF7A 3U07A 3U1KA 5FZCA 4XABA 2K5CA 3D5OA 3ABLH 5FY5A 5LA2A 1QOOA 3CCRI 1D5VA 4FPHA 4WZFA 4I99C 3HTSB 2CH0A 2UXXA 1C0WA 4OLLA 5A6XA 5HODA 2DA6A 2JG8B 2MD5A 4ENNA 4O5VA 3WXPA 3J80Z 5JVVA 4QWQA 1B9NA 1SBEA 3SZGA 1DGRA 3NARA 1JE8A 4DZJA 1W2OA 4WF2A 3RNSA 4PJJA 2JUCA 2VZ1A 1X1CA 1YQAA 5EG0B 4AFCA 1VBE1 1X33A 2G7HA 4BA6A 1WMFA 1TNSA 5CKTA 4GZ9A 4M9XA 2RG4A 3NJYA 5CKNA 5FK8A 3CZJA 5FZ9A 3M2MA 4UUTA 3GFLA 4U36A 2BNMA 4LULA 1RUC1 5FRNA 3F2ZA 5J47A 4Q47A 1NT0A 3C7GA 2R5ZA 1RUJ2 4BE1A 1NY72 1RPWA 3T0BA 1MQTA 2AS5F 1A6IA 1C57A 4XUNA 2OC6A 1W5CC 1CONA 1I39A 2FDKA 1FOD3 1ND2C 1D8JA 3IT8A 1RR7A 4K1ZA 4HSTA 4LPLA 4GRIA 4BL0B 1UY2A 1W6QA 2XAUA 1GWKA 4CEYB 5B66C 4AQ2A 4IV1B 4R9BA 4DBQA 4C3JJ 1FBSA 1PUFB 5I0TA 3POYA 4RAYA 4YFKF 2W92A 4BGDA 3S1QJ 1NTCA 2P4WA 1QH7A 1VBD2 3WTUC 5AC91 1ITYA 3ZDSA 1CF7B 4MGIE 1A3KA 1APLC 1WCMJ 5C3SA 3EQEA 2QBYB 4GKYA 3AFHA 1MMDA 1S1AA 3PNTA 2ZX3A 5HVQC 4DYQA 1EH6A 5HXMA 1QZZA 4AI9A 1LQ1A 5EHDA 3CMGA 3T2OA 3LOBA 3NJVA 4UUVA 3HVDA 2V9VA 2KHMA 3GXUA 5A1LA 4UBHA 3IRRA 1R36A 3T08A 3BYWA 3NV4A 3KEYA 4D8MA 5GZGA 1Y56A 1B35B 2KD7A 5KC5A 3HDDA 5A3PA 1XNTA 5CG8A 4ZDLA 2FHRA 3ZXGA 2E1MC 1RTVA 2F5EA 1DG6A 3OOUA 4LOCA 2LM3A 5EQUA 3VYSB 2R1DA 2DOAA 3ZKYA 1OISA 3WW4A 4XJUA 2ET7A 4BWOA 5GAHJ 3SEQA 1ZZBA 5AIPA 4ZJZA 2VONA 2DDUA 2WAAA 1XE7A 4URAA 5FRAA 4OIPF 2DBNA 2XSDC 3TYJA 3N9NA 3KP4A 1UX6A 4PT6A 1UZ0A 4PLNA 3ZXEA 2DW4A 1N3PA 5T5JA 3J8F2 4AXOA 3P9CA 3T5XA 4J00A 4R4XA 3FXQA 2P8TA 1B4AA 1ZH5A 2V79A 2RS12 1Y39A 4CYCB 4F8AA 1I50J 4UAPA 1VAKA 4K1YA 2VCMA 1TC3C 3CMAI 2H6BA 2JN6A 2QQVA 1S7EA 5FPUA 1HW5A 2Y33A 3CCSI 3SH5A 4L9NA 4MTEA 4GB33 1JYNA 4YRDA 2PMZN 2QQLA 3ABUA 1SD5A 2NZ9A 1JBCA 3L2YA 4QU1A 3RMYA 2R7UA 2WS91 4Z6YA 2CU7A 1HXDA 4K8RB 1TMF2 4FPJA 1JS9A 1AR93 4NRQA 5IWFA 3HYIA 4QB1A 2J5PA 2QNKA 3RTRA 3N97A 2JB4A 4QPIA 3BR2A 2OX0A 4LOSA 4GO1A 4LA3A 1GXQA 3K4BA 1DF0A 3UGFA 4N43C 1W5TA 4XETA 1ST8A 4YM0A 4GB31 1FPQA 4XOTA 2D1VA 4MXWB 4HAMA 1AL22 3VBHA 1WJ5A 3KYCB 1OPCA 3NWKA 3T2QA 3ESWB 3HXLA 4FISA 2MYSA 2NVUB 3M7AA 4FO9A 1VZ0A 3DCFA 2Y2ZA 3WG2A 4UUSB 2HQNA 1WMXA 1UXXX 2X53S 2ZEZA 4O65A 5LWBA 4BS9A 2AH2A 4QPGB 1CF7A 1W4MA 3GZEA