3LA7A

Crystal structure of ntca in apo-form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
209
Chain Sequence
DKALANVFRQMATGAFPPVVETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
molecule keywords Global nitrogen regulator
total genus 65
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la7A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la7A01
1YO5C 1UHWA 2XUBA 5LGTA 2IVMA 5D4RA 2CV6A 4MGYE 1I1SA 2JT1A 4YRDA 3FE5A 4WXDA 2XAJA 4BQAA 4AXOA 4IPAA 5D5UB 4F7ZA 2HDCA 4KU8A 2LKPA 2GZWA 2IP2A 3T8TA 2EK5A 3KP5A 3BOQA 3HUGA 1FP2A 2Z69A 1L3JA 5DD4A 1J7KA 1IRGA 5CVJA 1O3TA 1FWZA 1EP0A 1P92A 5BV6A 1P4XA 3BPZA 4XEZA 2FBHA 3KP3A 4HLYA 5LGNA 2EV6A 3CTAA 1KQ8A 4DQ2A 5E1XA 3TO7A 3KE2A 2PMHA 4YYOA 2F5CA 1D5VA 2O03A 2W84A 1NHAA 1ZZ7A 3O2PE 5AVPA 2UXNA 2Q2EA 2XL9A 2E1CA 2M1BA 1FYLA 2ISZA 2PTMA 1TNTA 4I3PA 2G7UA 1SD6A 2FNAA 3V8JA 4JK1X 1FSEA 2H94A 4HZFA 3JSOA 3NQOA 4AWXB 4Q0VA 1XSVA 1W7PA 4UV9A 1B1BA 4XLNF 3HIFA 3JAMZ 4M73A 3KZYA 4RD7A 2UZKA 4PIZA 3EDPA 3WE2A 2M87A 4L9NA 3ES4A 2QM3A 4HVQA 2DPUA 2MHFA 1SFEA 3F6OA 2QVOA 1TTYA 4OIPF 3LWFA 2P5VA 2QYOA 4OLLA 1EYBA 2F2EA 2XKPA 3SCHA 4KMUX 1AOYA 3KEOA 1I27A 1FXZA 2GC0A 4CO8A 1CAUA 2F5EA 5FFZA 4YG2F 5BOXA 4RB2C 5ERIA 2QCSB 2A3SA 1LDJA 5ICFA 4G94A 3KSCA 5BMZA 4UUVA 3BALA 4LLGF 4LUKA 2Z9OA 4XETA 2VECA 3KFWX 4EWAA 5FLXK 3E6BA 3L7WA 2HJIA 1BM9A 1LRHA 3IHUA 4A2UA 3SHRA 3CLOA 3VHRA 5KHGA 1KQ9A 2LDUA 2QENA 2ETEA 2D2WA 1JGSA 1V70A 3QU6A 3CJXA 4ENNA 2M30A 3C3VA 2DQLA 1FBUA 2VONA 2RVCA 4LB6B 4LA3A 1EV7A 5FFXA 1O5LA 5K5RA 2G9WA 4A0ZA 1G3TA 2H6BA 2UY9A 5I8SA 1FZPB 5JSPA 4MHGA 4LA2A 4A0XA 3VODA 3ZQ7A 1ZZ6A 2L4AA 2A6HF 3DEUA 5D8LB 3HOTA 4UXAA 3OTFA 4N9HA 5HOOA 2HS5A 1OKRA 3I58A 1QZZA 2VT3A 4BHPA 4K2EA 5D1IA 3EQEA 1S29A 4EWEA 3OOPA 2EFWA 4XF9A 2FRHA 3ZMUA 2K27A 5J7MA 1ZHFA 1XGNA 3TDUC 3E6DA 1YFXA 2COMA 3I0TA 4FT8A 5HDKA 4HOBA 3GUDA 1ZVFA 1ZZ9A 1T0FA 1LEBA 2OZUA 4ORFA 1R22A 4I02A 5ICCA 2EFNA 3V7SA 2Y75A 2DU9A 3SXYA 1MDMA 3WGIA 3R0AA 2Q30A 4RAYA 5HLHA 2R3SA 4MX3A 4EMSA 5HDNA 1U3EM 4Z82A 4GXOA 3FHIB 3D0JA 3RZZA 1J3QA 1U6GA 4FAGA 3EHKA 2OYZA 1HBXG 3DPLC 2GXGA 4JTOA 2JPBA 2IXKA 1CAXB 3HSEA 2VE9A 2W24A 4A5NA 1PUEE 4MQ9F 3QP5A 4GYGA 3RIRA 4A0YA 1UW8A 5H6QA 3GFMA 3ZPLA 1QWRA 2PHLA 2EJRA 2GA1A 2FEZA 2JZYA 1W7PD 1YS6A 4ZYHA 4AQ2A 2DBBA 1YW9A 5BQTA 3NEUA 3M7GA 1OYIA 1QZYA 4UV8A 5LHHA 3KLNA 2F5DA 4HLXA 3E6CC 5CYVA 3WW2A 4HYEA 1D3YA 2VN2A 5AIPA 4OINF 4I7HA 5D8KB 4XFAA 2KIMA 1TW3A 1J59A 4GGGA 1C0WA 3Q9VA 3WU0A 4RGSA 1F1ZA 3BP8A 3OCPA 2EA2A 1ODDA 3P9IA 3UKTA 5EEGA 1UCXA 1HKSA 3HOSA 4KFCA 3CF6E 3ACLA 2NAZA 3PLQA 1O3SA 4KNYA 3EQLF 4A5MA 4AD9A 3F21A 4UBGA 3ST7A 2PAMA 1FP1D 3H3ZA 1S7AA 4QWQA 4M74A 2DPDA 1HSJA 3HT2A 4JBAA 3IWZA 1LKNA 4F8AA 1JUHA 3Q9SA 4HAMA 3T0YA 1KU7A 1NE4A 1IXSB 5A2QK 2GA2A 1ONVA 2KIFA 1A04A 3V7RA 1X3UA 1QPMA 5BPIA 4EVIA 4P9FA 3RPQA 2M8EA 4WXHA 4FX0A 5LLQA 4EJWA 1T39A 1DZRA 2OQRA 2P8TA 2VXZA 2QQBA 3KETA 2ADUA 2BGCA 1RUNA 2BV6A 2DCTA 2HQRA 1WRJA 2Z2SB 1K78B 4O6JA 5CJ9A 1I5ZA 1BN5A 2PI0A 2XV4S 4AVAA 4XF0A 4D7TA 1PDNC 1ZN2A 4JQFA 1VJ2A 2EFPA 4IHTA 3ISPA 3QOPA 2HTSA 2GQQA 4RS8A 3CO6C 4Y13A 1ZREA 3SZPA 2PHDA 2K4BA 3GVAA 1WKMA 2W57A 3CLPA 1RZ4A 1CGPA 4WK8F 4HA8A 3WU1B 1UIKA 4R1HA 2GC3A 5E17F 4HQMA 1XMAA 2HWVA 1OI6A 4Q29A 1H9GA 1ZGAA 1ZGJA 2XLAA 3T1BA 2XVCA 3W6KB 3GO5A 3QU3A 4EM1A 3IKVA 3MQ0A 5JAXA 4XFFA 1X82A 2Q1ZB 2L4MA 2V1DA 4TV7A 2HKXA 3GFLA 3EBRA 3REOA 3RYPA 3BZ6A 3EETA 5I91A 2ESNA 3L9FA 1ON1A 2A07F 1CX4A 2HYGD 4CICA 3BPVA 1IN8A 2AS5F 2QZ8A 3QACA 3NVCA 5DEQA 1QQIA 1KYZA 2PFBA 1IPKA 5J8FA 1CAWA 5F1RA 3SCGA 2IPQX 3CUQC 2C6YA 1PP8F 5HDGA 2EA7A 2VPVA 4Q48A 3DV8A 3WTZA 4K8FA 3RNSA 3ABUA 2IXJA 5LEJA 5E8IA 4LB5A 1Z91A 4Y15A 3FZ3A 4G7OF 1XN7A 2EV0A 2PYTA 4I0BA 1J58A 3DQVC 2PAEA 1OR7A 3V8LA 1FPQA 5D5VB 4CYDA 2OA2A 4XFHA 3MAJA 3B73A 3Q5FA 1SD4A 3FMSA 2BBYA 3LAGA 4IEQA 3WTSC 2OZ6A 1ZNPA 1XCVA 4HLTA 1ZZ8A 2V9VA 3ZMVA 1JHHA 2VBYA 1YW8A 4KN4X 1ULYA 2FBKA 4BIFA 2FNPA 1S8NA 2OD5A 4EJOA 1FSHA 3G73A 4L9JA 3JAMK 4EM2A 1JXSA 1YYVA 5CVIA 3DFGA 1FLIA 3OV8A 3NL1A 4R8HA 4U7DA 3QPHA 4HF1A 5E1RA 5FB2A 1JE8A 5LHIA 4M9XA 5JHUA 1PMIA 5CVRA 3R0JA 1B9NA 1E17A 2BNNA 3MDPA 1IN7A 5I93A 4X6RB 4QXKA 4I01A 5FLXZ 3E5XA 1DP7P 2ZBKA 2K4JA 1H9TA 3S7EA 3WTVC 1CAXA 4EJTA 3PQJA 1RL3A 2NS0A 3I54A 3VB2A 5L3CA 1IN4A 2H6CA 3BPXA 3MZHA 2XAGA 2A6EF 2FE3A 4A6EA 1Z6RA 2EVXA 1D8JA 4CHUA 2EB7A 1J3PA 2VC1A 3FXUA 3R4KA 1QO0D 3HRUA 2PBIA 5BY5A 3BCWA 1W4MA 2LF8A 2EA4A 3V7CA 3BY6A 4GULA 4BXUA 3M1EA 2HR3A 3MFKA 2ZXJA 1J0RA 3FM3A 1K79A 3EYYA 3IRQA 1PM7A 3HTUA 4OMYA 1R23A 4YFXF 3E97A 1YFWA 5K8SA 2CWEA 3KLOA 4ZZLA 2DQRA 2O0YA 1R36A 2IA2A 3TDZC 5FCCA 1SEFA 5EZWA 2E1NA 3COAC 4Z07A 1EY2A 1YUDA 3JSPA 2P17A 2VBWA 4NQWA 4BHBA 3WE3A 2MD5A 5ICEA 1O3RA 1U8RA 2DFIA 3VFZA 4HW0A 4LK0F 5HS8A 4L5IA 4J1XA 3G3ZA 1U5TC 4IEPA 4Y17A 3MWMA 5JI6A 3WTWC 4HX4A 1TLHB 4LTAA 3LWCA 1XCBA 3VEPA 4QM8A 4L0YB 2D5HA 2QQ9A 3C1DA 4AIJA 1WGPA 3M3IA 2Q8KA 1XGMA 4EGZA 1USSA 3CUQB 3SXWA 1STZA 2B9UA 2A5YB 4XF1A 4LLNA 2FMLA 2ZMEB 2E7WA 1YFHA 3IDBB 2EV5A 2MPFA 3H1MA 1RUOA 2XHKA 5KK1A 1ZLJA 2K0GA 4X6QB 3HHHA 4M9ZA 2YPRA 2GC1A 1IUYA 5I0UA 3W6JB 4HF0A 4PCQA 1R5GA 3L2HA 4L9TA 2CQKA 1GHCA 2DW4A 2HEOA 1ZG3A 5T3NA 4D0PA 2E7XA 2RN7A 4H0EA 5D4SA 3GEZA 1EH6A 2J5PA 1FYMA 3GLXA 1U5TA 1DPUA 4EROA 1ZRCA 1HW5A 1ON2A 3ELNA 1O7FA 4N9IA 1I6XA 1KQ0A 1QGPA 2MNGA 3QPTA 3ZDSA 4L0ZB 1MJBA 3K1MA 4LFUA 5E20A 4KUMA 2ACJA 2NRAC 4KYWA 2XL7A 1ZAOA 4OOIA 4U0VA 2FA5A 4RB3C 3V8KA 1V3FA 3MEXA 4G7ZF 2VOPA 4ESFA 5L3BA 4UNOA 2X0LA 3NJZA 2X4HA 4LMYA 4ESJA 2P6TA 2RV8A 4O3MA 4KIFA 1YIOA 2IW5A 3C7JA 3H50A 4UHTA 1HKTA 2H0VA 2D1HA 1NYWA 3R6SA 2V09A 5FGMA 4LEJA 2PG4A 5DV5A 3TO6A 5D5XB 1ZZCA 1O4TA 2PJPA 1WQ2A 3KP4A 2GAUA 1XRUA 2IRFG 1VTNC 3T5XA 3U9GA 5KBFA 1QNTA 1WWXA 4EGYA 1B6AA 1TBXA 2PN6A 4KA4A 2OBPA 3HHGA 2Z5UA 4M72A 3WTXC 3LQQA 2HZTA 5LRRA 1R5HA 1S3JA 4OIRF 5IT3A 3BWGA 2WV0A 4LLLA 5FLIA 4Q0PA 3TNQA 2GIVA 2V6CA 1X8EA 2FQ3A 2O1QA 1MDMB 2STWA 5E8GA 4RAZA 3BB6A 4MEXF 3P9CA 1MGTA 3H7YA 3LA2A 2ZMEA 3DKWA 5E1WA 2DLLA 5CLSA 2FF4A 1QXRA 1IN5A 3K0LA 1O7LA 1ZZBA 4ESBA 2EAAA 4WCGA 1XDUA 3U2RA 3O14A 2Z99A 3F3XA 1G3YA 3E5UA 2RGVA 1BBYA 4WVZA 3F8MA 3ZMZA 5JR3A 5HS9A 3V4GA 2IXIA 2PLYA 4KN7X 4S04A 1J1LA 1K6OA 2FMYA 2P5KA 4BH9A 1J3RA 3I4PA 2P4WA 1Q3EA 2ZFWA 1YHFA 5J3UA 3USSA 2L02A 3WTYC 3RJPA 5J8CA 3K1PA 5DCFA 1SMYF 2D93A 1OYYA 3FWEA 2KKOA 3ELKA 3RYRA 1W5SA 2MH9A 2ZCWA 1JHFA 5K1YA 1RNLA 3BDDA 5E1ZB 2JSCA 3FZVA 4WBBA 1B9MA 4XLPF 5ILVA 4I98B 4FBFA 2MA3A 1UFMA 1XSXA 2H27A 2Z33A 5E16A 3CO2A 5ED4A 3RDIA 2VOOA 1G4DA 3EYIA 2OZJA 2ETHA 5IT9K 2IXCA 3NKTA 4OMZA 4PGHA 3F23A 4BAYA 4G8XA 2YU3A 2PA7A 1OFNA 4O9EA 3KGZA 3QP6A 5TRDA 5LRSA 4PZJA 1W7PB 2QBYB 5BXXA 3GX4X 1MZBA 1EH7A 1KGSA 4ZU5A 4FAHA 3FXRA 3TGNA 3F72A 3I59B 4AVPA 2ATFA 5I8TA 1RI7A 3HSFA 4IVNA 3F8NA 2A68F 5I8YA 2QJVA 3ECOA 1U2WA 4Q4ZF 1HSTA 1YFUA 2PQ8A 1GQGA 3WODF 1BJAA 2XGXA 4YNIA 4IEVA 3TO9A 4O9GA 4RGXA 2DT5A 3QRFF 3D5LA 4P5OA 2ZJ2A 4B09A 5KHKA 5FD5A 1R1UA 1HQCA 3HSRA 1IXRC 4RB1A 1Z7UA 3DF8A 2KRFA 5D6EA 1H1IA 5KHJA 4HF2A 5KHIA 3KP7A 3RKWA 4HVRA 2UYAA 4HX8A 4QX5A 3S2WA 1KA8A 4D7SA 4E70A 5LBQA 4LG0A 1O5UA 5BS6A 4GCVA 2WC2A 2V1UA 2K7LA 3ZN1A 1WI9A 2MBFA 3OF1A 1U78A 1IPJA 4IESA 5ILUA 3RYKA 2B8MA 3EO6A 4M6YA 1ZRDA 1G6NA 6PAXA 1ZG5A 3IWFA 3FMRA 4I0AA 3ES1A 4HDUA 4AVCA 5L3DA 2QQAA 3K9TA 4WXCA 3EUHA 3UKNA 3I53A 1SQ4A 4IEXA 3ROUA 2P5LC 1FYKA 2O3FA 4YIIA 1CAUB 4Q0QA 1TW2A 4OIOF 4L5JA 4KT5C 4G6DA 1H1MA 1YW7A 3ULQB 3I64A 3J81Z 3CDHA 3F8FA 2O8QA 3WG9A 1UCRA 4XSXF 1P4WA 1LR5A 2DTRA 2KXLA 2D40A 5JSRA 1GXPA 3FXQA 4XF4A 5DD8A 2FXAA 3LZZA 5F64A 4IRIA 1T2KA 4YFKF 2FQPA 1RTVA 4IEUA 5I0SA 2P7CB 4AIKA 4HN0A 1YS7A 4R79A 4ZH4F 2YX7A 1LDKB 4IEYA 5LGUA 5HLIA 3F8CA 3F8BA 2MH2A 3WW1A 4XF3A 1T98A 2QNKA 1DDNA 3CO7C 3FJSA 2CO5A 1Y0UA 1S6LA 5KHHA 2P6SA 1XMKA 4P9GA 2K02A 4G6QA 5H6RA 1XDSA 5L3EA 4IEWA 4LD5A 1B4AA 1SD5A 2L01A 1OYWA 4KWKA 2PFWA 2D45A 1KU2A 4MQVA 3HQXA 2UYBA 2D5FA 2JRTA 2Q0AA 3ZP5A 2H09A 1DPRA 3LA7A 4MGKE 4R52A 3N97A 5LEKA 1UIJA 1TQMA 5C8WA 1HKQA 2IJLA 1QXJA 3B02A 4WX9A 3WGGA 4UXNA 4MNUA 1TQ5A 2XASA 3BJOA 2OAZA 2RNJA 2Z3YA 3O3KA 5IT9Z 2B0LA 1BI3A 3S0MA 3F6VA 4HVOA 3MZYA 3JZVA 3QAHA 1XGOA 2HKOA 1SD7A 5C6CA 3HRTA 2ZKZA 1AWCA 1BIBA 5FLHA 4XRFA 1W5TA 3PFIA 2HGCA 4CZZA 5FPZA 3AAFA 3MPBA 4LJZF 1LJ9A 1DUXC 3J80Z 4KMFA 1BC8C 3PVBB 5JFRA 4LGWA 1SAXA 1J2XA 1UB9A 1XD7A 2QVSB 2CW0F 3ZN0A 2XAFA 2ET7A 4I09A 1IZ1A 3HRSA 4WWCA 2XLGA 3SQNA 3BROA 5TJJA 2IC1A 4PDKA 1WLTA 2CAUA 4EJVA 4IEZA 1BI2A 3S7IA 2XAHA 1MJ9A 3DN7A 4XBFA 5HVQC 2XLFA 1ZRRA 1NZCA 2YX4A 3CL1A 5DUIA 1XE7A 4BNCA 3IRRA 3JTGA 5CADA 1BOAA 2MLKA 1YFYA 4QMAA 3PQKA 2EWNA 4KIBA 1Q43A 2O8XA 1SMTA 2O6GE 1CF7B 2UXXA 3TNPB 3MYXA 2HOEA 5J48A 2YSRA 4MV2A 4WZCA 4Q47A 3HRMA 3ZMSA 1Y9QA 4DNCA 4NHJA 3WGHA 2RKHA 2HYFA 4ZYEA 4CDGA 5JSOA 4E2SA 5CVUA 3KP6A 3L00A 2CG4A 5ICGA 5FPXA 2RQPA 4ZZDA 2XRNA 2JPCA 3GFJA 2GU9A 1HW1A 1H0MA 1BI1A 5ILSA 4U0YA 1CF7A 3SMHA 2M45A 4PIYA 2L3DA 1DZTA 3H1YA 4Q0SA 4B29A 3K1NA 3OGJA 3GW2A 3ABTA 1Z6TA 2YR2A 4B8XA 1YWKA 1FOKA 4P96A 4BYYA 2W25A 2FSWA 2IA0A 1OD5A 4NVPA 4M9SA 2CYYA 1EH8A 3IKTA 5DUKA 1VR3A 2ISYA 4EJUA 2R7FA 2L54A 4YFNF 2ET1A 2Q0OA 1I1GA 2HTJA 4A12A 4IRHA 1FY7A 5AIQA 3RKXA 4TLFA 1ZARA 1T38A 1CAVB 4KICA 2F4PA 4YSFA 3D82A 1IF1A 4BHCA 2BNOA 4I2OA 3F22A 2DI3A 2Y0OA 3BU7A 2N7GA 1J5YA 4IHSA 2GH2A 1Q5OA 3NW4A 1J75A 4QGNA 3O6BB 4G7HF 1B59A 1BI0A 4CXFA 4YIFA 3GXOA 1PP7U 1SFNA 2VODA 3OD0A 2PQQA 3KP2A 2CGPA 2MC3A 2VE8A 2M5WA 1YQAA 5CVVA 3FHZA 1YLFA 3CUOA 1ZRFA 1HXDA 4U7BA 4KWJA 5FLJA 1RIOH 1QBJA 4HX7A 2GC2A 3DXJF 1SFUA 1R7JA 5I0TA 4E2QA 1FBQA 1P4AA 4N0BA 3LOIA 1MD0A 1S7OA 2CAVA 4E2GA 4RGUA 2UY8A 3WW3A 2ZNYA 3KEQA 5I0RA 5KVRA 3GZ5A 4HV5A 2ELHA 2PAKA 1MJAA 3LSTA 4FX4A 3ZMTA 4H7LA 3I7DA 2R7DA 4XFGA 1NE6A 3K2ZA 3KCCA 3WTTC 3RKYA 1P6RA 4OIQF 2OPKA 2I45A 1RC6A 1U5TB 4MGZE 3IDCB 5HI0A 2VQAA 3RTRA 2FBIA 1LQ1A 4FHTA 2DO7A 4IJAA 4AVBA 3BJAA 1CAWB 1YTYA 3IIAA 1REPC 1K78A 2IA1A 2F5FA 4QLCU 2K9ZA 3GYHX 1P2FA 2NNNA 2KJCA 4LULA 2ZO4A 4KIGA 3L2CA 5D5WB 3U11A 4Q5SF 1R1TA 2LNBA 4UVCA 3GYDA 1Z9CA 1KYWA 2RDPA 3U1DA 3IBMA 2B5HA 4IETA 1TNSA 4HN1A 3WTUC 4IRGA 4KDPA 1OPCA 4IXAA 5F6FA 4HBNA 1UHMA 2QLZA 4PJYA 4EWDA 4UVBA 1XGSA 1WA4A 4A6DA 3ECHA 1XB4A 4ZU4A 5BPXA 1IN6A 4HDVA 1R1VA 2OQGA 4EM0B 3R60A 5E18F 4ZYGA 4ENKA 1LDDA 4XFBA 3UKVA 4L11A 5L3GA 4UVAA 3D0SA 2XIGA 3R61A 3H92A 3LA3A 1BC7C 4AQ6A 2D1VA 3H3UA 2DK5A 2V1XA 3NRVA 4HBLA 1Z05A 3P7NA 1FX7A 2VC0A 3GF2A 2EFQA 4NB5A 5J6XA 2WTEA 5JCTA 1EPZA 4QGMA 1L0OC 1WSUA 4L2NA 1X7NA 4LLOA 2QWWA 5AONA 3J81K 2A61A 5CU1A 2XROA 4XFIA 5FDBA 1IRFA 2BE5F 1O57A 4JTNA 1LEAA 2TDXA 3G7DA 2ESHA 3GZ6A 3VOEA 2HFHA 4MUVA 2LF7A 1NXMA 3EJKA 1J9IA 3FM5A 1DGRA 3KZZA 1U12A 3M8FA 4J1WA 3P9KA 1T6SA 1O3QA 2QUFA 2Y0MA 3ML6A 4ENJA 1F5TA 3DL3A 4XFCA 3I5UA 3E6MA 3CEWA 3JW4A 5DCMA 3C18A 1YLLA 4KU7A 3TKYA 2UWMA 4HMZA 1YG2A 1ZYRF 1QY4A 5BUVA 2VBXA 2Y48A 1OMIA 1D8KA 1KU3A 3HT1A 2J5OA 1TQIA 2DK8A 4Q0UA 3I59A 3IL2A 1F4KA 4JVAA 5FO5A 3LAJA 1ZH5A 2O61A 4ZYDA 4YARA 4MEYF 2STTA 4M71A 3H9AA 4WF2A 3L09A 5DCMB 4UBHA 5L3FA 2NNYA 1LVAA 2VT2A 2W85A 2K86A 4CGZA 3J7AO 5D6FA 5EFUA 2CSOA 3DP7A 2XAQA 4ENMA 2IXHA 4MTDA 3WW4A 3H1WA 3M8EA 1ZX5A 4LK1F 2OA4A 3FF5A 1GVJA 3RPUA 3K69A 4META 3N4MA 3T8RA 2MLGA 1UD1A 1V4RA 1X8MA 2FU4A 1USTA 4PGGA 1K7AA 5HS7A 5LHGA 4HV6A 3CJNA 2IXLA 1SFXA 2VBZA 4MTEA 3J80K 4ETSA 4OFGA 3ERED 3FX3A 4QM9A 2E9QA 5BPDA 1G3SA 4RB0A 2FOKA 4U88A 3GFIA 5DYMA 3H8UA 1FC3A 4ON0A 4AIHA 3KGLA 3ZMDA 1LB2A 1Y3TA 3H7JA 1XSDA 4ONUA 3BJ6A 3DPTA 4HSLA 4L9VA 2A69F 4ZU7A 2C0ZA 4MH0E 4DINB 4G9YA 4S05A 2P7VB 2KIUA 4IERA 4QGLA 5JR7B 3PNAA 1F9NA 4IF4A 4PIXA 5K5QA 5FQ0B 4ASNA 4LG0B 2JTVA 1FBSA 1UPIA 3I71A 3LQRA 3FMQA 2NYXA 2ZKLA 2EFOA 2GWRA 2QDRA 4L18B 4MZUA 1GQHA 2XKOA 4KWLA 1G3WA 2KJBA 4P9UA 4LUMA 2RC4A 4RGRA 2BNMA 1TQPA 2WWYA 1GXQA 5H20A 2GXBA 1CAVA 1IAWA 5A2QZ 3E5QA 4Z2YA 3SFZA 3RI4A 1ZG1A 3HTSB 1RGSA 4OU0A 1BIAA 3KMHA 3GBFA 1Z1DA 2G7HA 2PMUA 3ETQA 2BEOA 4XSZF 5JVTA 1Q1HA 3M9AA 4MGIE 1LNWA 2PEXA 2ZNZA 4M6XA 3GWZA 1DGWA 2Q4SA 4IEOA 3LFKA 1R00A 3C3WA 2DAOA 5HLGA 3SCFA 3U10A 4O5VA 2OU2A 1HW2A 1L3LA 3NSTA 1IXCA 4HQEA 1KU9A 2CFXA 3JTHA 3U0ZA 1FI2A 4KL1A 4HSJA 2AXLA 4GO1A 5EEHA 1ZLKA 3FFQA 4P55A 3CUQA 3M70A 2IT0A 1E2XA 2LSOA 3MCZA 2WFPA 2HQNA 4EQQA 1FT9A 1MKMA 3E3VA 3TOAA 5FQ0A 4EV0A 2BYVE 1XE8A 3IC7A 4MGRA 4JV4A 1R58A 3TOBA 3LAPA 5FD6A 5K5OA 1FNNA 3SHFA 4GYIA 5DDGA 4U0WA 2QBYA 2V79A 1IW7F 3HYIA 1VP6A 3SZTA 3TQNA
chains in the Genus database with same CATH superfamily
4FE7A 2LKXA 4ITVA 2CU5A 4OZXA 4CDWA 3VD3A 4J19A 3AP4A 1I1SA 4YRDA 2AEZA 3FE5A 4WXDA 2XAJA 2E32A 1S0IA 2A7AA 3TN93 1LJ7A 4KU8A 2LKPA 2IP2A 3T8TA 2EK5A 3KP5A 4A3JJ 5EGOA 2O8OA 3ILNA 1QA6A 5DM6F 5DMYA 1RKWA 5BV6A 1YQ5A 2YG0A 4AFBA 3MW3A 2EV6A 3V0BB 2A3XA 2PMHA 3AYEA 1U9NA 1D5VA 3RQIA 4RR3A 1O8PA 1ZZ7A 3TB0A 4I0WB 1COV3 2ISZA 2W9XA 1VFCA 4I3PA 2VMDA 2DFHA 2ZTNA 2FNAA 3V8JA 1BOBA 4JK1X 4Q4Y1 1DLCA 3A4CA 2A05A 1NK2P 4G6TB 1T8IA 3SH5A 4AWXB 4CP9A 4Q0VA 2OUHA 3SYTA 1W7PA 1OQDA 1AXKA 3WDVA 3HIFA 4DZGA 3OG2A 1WZ2A 4Q4X3 2KHMA 1UY2A 1GNYA 2QM3A 1VMHA 1UU4A 4HKWA 3IDAA 2WJSA 3LWFA 2RDNA 2P5VA 4CSWA 4XCAA 1WKYA 4FOWA 3BT9A 3KEOA 5FJKA 1BK1A 2F5EA 5FXZA 1SFYA 5ERIA 4PHZA 1BBT2 5F3GA 5JXGA 4XYXA 5F5IA 3BTYA 1OQYA 4EWAA 2VQ0A 1JKPC 2M7BA 2TCTA 3F95A 2LDUA 2XJTA 1K5MC 1W6NA 1FATA 2D2WA 1D7PM 1VPHA 3LSMA 3QU6A 4AEMA 3CJXA 3X2QH 2GDFA 2DQLA 3PTYA 4LIVA 1ULEA 4LA3A 3AG3H 1T2XA 4AEDB 4ZHNA 1EV7A 5FFXA 4GA9A 5B2GB 4XUPA 5IVJA 2LTNA 3GBWA 1ETQA 4MHGA 2R061 4RGGA 3RSNA 5A7QA 1QJX3 3PTRB 2K9SA 3OTFA 3QWLA 1BBT1 2L9VA 5HOOA 1OD3A 4GB32 1OKRA 3LFMA 1ORKA 1ND2C 2HWC1 3VD7A 1COV2 4A6SA 4EWEA 1AYM3 1T6GC 5FK8A 1US2A 5FO7B 1TZLA 2WY8Q 2EH3A 5FYVA 4JC1A 3JCIA 3GUDA 3ZFFB 2XUEA 1LEBA 4Z2WA 2VXDA 1APNA 2NZ9A 2MABA 2EFNA 3V7SA 2Y75A 2DU9A 3SXYA 4AM3A 1Z7LA 3QODA 4D6RA 4GH4B 1MDMA 2HVQA 4RAYA 2DDUA 4JRAA 2YYOA 2HXIA 3ZXAC 2CQQA 2R3SA 5HDNA 1U3EM 1BLZA 3HZJA 5H9PA 3GCXA 2QEXI 3I4MJ 1HBXG 4INDA 1Q8OA 4JTOA 1EF4A 1CAXB 4N7UA 2GM4A 2VG9A 1NTCA 4A5NA 3Q0UA 2WB1N 1WD4A 4GYGA 4KWUA 3RIRA 1UW8A 1E5HA 1FIAA 1MS4A 3ZPLA 3N3HA 4GMP0 1Q8QA 1OCTC 1ASJ3 3ZR6A 4E8CA 2FEZA 2GMPA 2W48A 1W7PD 1YS6A 3NEUA 2FOWA 3M7GA 3THCA 5LHHA 3VDDB 2F5DA 3WNKA 1J09A 4JGYC 3DXUA 3B94A 5LBFA 3I2GA 4J00A 1D3YA 2WS91 4OINF 4D5CA 2BW3A 2KIMA 1LENA 3WU0A 1WCSA 5JMCA 1S2EA 2RJLA 3N9QA 4LBKA 3WU2C 2P0WA 4KFCA 1HB1A 1G86A 5DDJ1 3PNVA 1HRV2 2K3FA 4A5MA 2DVBA 3AP9A 3NV4A 3MIBA 3RQ4A 1TWAJ 1GUIA 2DBIA 1I3AA 5AC92 1HOMA 3H3ZA 3H35A 2C9KA 1K6YA 1AKHB 3POFA 1MW7A 3H36A 5FZMA 1RUC3 2CGOA 1CPMA 4Y20A 1JUHA 3A2KA 3P1IA 5FWJA 2DFEA 2Y30A 2M4KA 2ZJCA 3MKZA 1GOGA 4A69C 5HCFA 2KIFA 2VVEA 5L7OA 5J40A 3FUOA 3UETA 5DAQA 3SISA 2VXZA 4YGBA 1G9FA 4NHMA 1QJY3 2DCTA 2HQRA 1LGNA 1WRJA 3LSRA 2WNOA 4NE9A 5KWRA 1PYVA 1I5ZA 5HXMA 1YITI 3EUAA 2PI0A 2E7AA 3PUIA 4MGSA 3RRDA 4XF0A 3HJEA 5LWBA 3L2QA 4JQFA 1H4HA 2EFPA 2XGCA 3ASOH 4JX0A 2C5DA 4JKLA 2GQQA 4RS8A 3TOJA 2E26A 1YRNA 3BZKA 4XKVA 3SZPA 3VGIA 1RZ4A 2XQRA 3OSFA 1BKZA 1K4TA 3JRDA 5CPRB 4WK8F 3A03A 5LCWL 1C8NA 4Q29A 1ZGAA 3GXUA 4GH4C 3MF9A 2BHZA 1HQNA 4Q4V2 3MQ0A 5JAXA 4QPIB 1ENXA 3ZFGA 5FKOA 4QT6A 4N43C 2JG9B 1LFBA 4CICA 3AL0B 2R0FA 2AS5F 3MZ8A 4YELA 1JHJA 3TW7A 3NVCA 4E4SA 2PFBA 3WQ0A 5J8FA 3DCFA 1CAWA 3TN91 2WNUA 4ABZA 2C6YA 1PP8F 2VPVA 3U37A 1WMEA 2VIXA 1NA1A 1IOAA 2IXJA 4YRVA 5E8IA 2VCBA 3NAPC 5LA9A 1XN7A 5F2WA 1VBE1 3QCWA 2JDUA 4R9BA 2K5CA 2ADEA 1AL0G 4I0BA 1MEC1 4IW3A 3C2UA 1OR7A 2DVGA 5D5VB 4R4ZA 4XFHA 3OPTA 3B73A 1NG7A 2VMEA 3TAYA 4FASD 3GM8A 2EILH 3VBRC 3LAGA 4IEQA 3A0HC 4YVWC 4LK7A 4Y3OA 1ZZ8A 3WY6A 4N4OB 2IFWA 4N43A 3ZMVA 2YFZA 5M0TA 1YW8A 3QQAA 2GXAA 2HEWF 3VKLA 2OD5A 2IVJA 4Y33A 4AR2A 1GMMA 2XSJC 1RUG3 4UW4A 1YYVA 5JR2A 3DFGA 3O8HA 5GALA 2ZSHB 4R8HA 4U7DA 5FYYA 4A6OA 3HR9A 5E1RA 1UF2C 5FB2A 1R082 2WQ8A 4QPGA 4PF1A 5CVRA 3R0JA 5CKNA 3JRIA 3ETPA 4M3CA 4BE1A 4FPEA 3PHMA 3RI9A 4IQPA 1V54H 1RUF1 3BTIA 3AYCA 3PURA 3KYDB 3PQJA 4LHSA 1UOGA 4UB8C 3R05A 3I54A 2E19A 3BPXA 1D0HA 3FN9A 2PHRA 3OEBA 2B7YA 1Z6RA 1QVUA 3T08A 1ZR4A 1J3PA 3U21A 4MXVA 2VQCA 4L5EA 1SDWA 4Q4W2 3BVCA 4RQPB 3I3BA 3BY6A 3M1EA 3IDEA 4KNCA 5C4WB 5A7OA 5LASA 1X3WB 1X50A 4AEJA 3EYYA 1S0FA 4OMYA 2HWF1 4Y24A 1R23A 2WFF2 3Q8CA 1YFWA 3W21A 1YI2I 4M3BA 3C8XA 2PMZA 2OX0A 5FCCA 5EZWA 3SJMA 3LPFA 2IGOA 3JSPA 4RGAA 2P17A 2VBWA 3WE3A 2B9VA 5JPMB 1O3RA 3OIQA 3BPSA 4L5IA 4Y26A 4AWDA 5J1UA 5HXVA 4QKNA 1U5TC 4FISA 1W3VA 2W47A 1CIWA 4HX4A 3OSGA 1K4SA 4LTAA 2W46A 1PO11 4DJAA 3VEPA 1PGSA 1RUJ1 3WF1A 4AVVA 4BBSJ 3GMEA 4L0YB 4F3JA 3L2UA 1DZQA 5KXCA 2Q8KA 4IGOA 2HZDA 1CN1A 2B9UA 1RINA 4P9WA 1HF0A 4XF1A 2NVTJ 2WS93 2FMLA 2ZMEB 2HOTA 1YFHA 1YNAA 3OUJA 1GR3A 2XHKA 5KK1A 1QDCA 3CP2A 3NAPB 3SC7X 2Y6FA 1D0GA 4HF0A 1R5GA 4XICA 2YBSA 3L2HA 5TSWA 1AX0A 2DW4A 5DN2A 1ZG3A 1RB8G 2YDEA 4Y1YA 3GLLA 2CS3A 2E7XA 3AZYA 2V1NA 1GU3A 1OUSA 2XJRA 1XX5A 5FZGA 5D4SA 3NNGA 3PSIA 1C28A 1TE1B 2F6CA 3H8XA 4ZJZA 3W59A 2CRGA 3BR1A 1ZRCA 3WG1A 3ZXJA 2DYRH 4D1QA 2PHXA 1I6XA 2MNGA 4AFAA 4CEWB 3ZDSA 2BY1A 1GZ9A 4LFUA 3ZYIB 4KYWA 1RUE3 2FA5A 3CP8A 1PZ9A 2OVUA 3HPNA 5FMCA 3TBIA 3CMEI 5LD2C 4LMYA 4YPJA 2BW3B 4E7SA 3P6BA 2DOFA 3FXKA 4KH9A 3GCWA 2Y6LA 4LEJA 2D5VA 3T1MA 5D5XB 3LGRA 4CDXA 2IFRA 4M00A 1WJDA 3VYSB 1AYM1 1H6YA 3BQZA 4B7KA 1G9BA 1RR8C 2IRFG 5FKMA 1VTNC 3OS0A 4PDWC 4EGYA 2ZMLA 1B6AA 5DTDA 4BXXJ 1VB4A 1TBXA 4BEHA 4XURA 2G9FA 2OBPA 2M34A 2A1XA 2Z5UA 2IUWA 4EN7B 2HZTA 5LRRA 2BVLA 3LQCA 5IT3A 1AYN3 4FP2A 3B01A 2GIVA 5ANNA 1MS8A 1V55H 1MDMB 2KM2A 2VCAA 1GOHA 5E1WA 4BMBA 1CR7A 4A3BJ 3CKHA 1QXRA 2VAUA 4Q1RA 3OYHA 1IN5A 5EWSA 1HV0A 4TTGA 4FQZA 2D43A 4FPCA 4WCGA 1JZ8A 3Q8EA 2VQTA 3A1YA 1BBYA 4JKKA 1B72B 4C90A 3F8MA 4IV1B 4DFSA 4AI0A 1N78A 1MS5A 1BR2A 4EATA 4MOAA 4CCJA 1Q3EA 3WF0A 2JEMA 5J3UA 1V9U1 2R7TA 5EZHA 2VQUA 5H9QA 4NO4A 1LNSA 1GUUA 1AJOA 5GJ6A 1B72A 3RYRA 3W20A 1W5SA 2L7KA 2ZCWA 1R71A 5K1YA 5E1ZB 2VLAA 3PNYA 4XLPF 5ILVA 2MA3A 4RS5C 2QGUA 2D6KA 2H27A 5ED4A 2VOOA 2CNAA 3DLAA 2E5ZA 5LBCA 2ETHA 3T2OA 3QLQA 3H5AA 5A7SA 4QDQA 3USUB 1SFOJ 1G2HA 4O9EA 4Q4Y3 2Z42A 3OD4A 4OULA 2HPIA 4BQ2A 4KBBA 1EH7A 2EIBA 4FAHA 1JJ6C 5GZEA 1A36A 2RMU3 3I59B 2ME0A 2CWSA 1VBE3 4CDQB 1AR61 2CV1A 3F8NA 1JHNA 2VJJA 1ZM1A 2PQ8A 4GH4A 3WODF 2XGXA 4YNIA 1EV12 4OHVA 4HG2A 2HOSA 3QYBA 4O9GA 4RGXA 3QRFF 3DU6A 5KHKA 5FD5A 4UW5A 2RS51 2R0HA 2KA3A 1QOSA 5FO8B 1JT0A 3JRHA 3IH4A 1Z7UA 3DF8A 3A21A 2BFUS 3MIEA 1BVP1 3FLTA 1H1IA 5KHJA 2ORZA 5KHIA 2BBVA 4I30A 3RKWA 2HLEA 2YU9J 2JE9A 4Z2AA 3VKMA 5LBQA 4LG0A 3J26N 4XDQA 3W5MA 5EJ1B 2GN3A 3DU5A 3V65A 4AEKA 4XXAA 1WI9A 3POBA 1N1TA 2QQNA 1BEV3 1MQTB 3ZN6A 2ZEWA 1E5SA 3RJ2X 2FDHA 3D5SC 2OTJI 3KWVA 2B42B 2R0QC 1ACCA 2YUSA 3ZSLA 3QPLA 1MIJA 3ES1A 4WZFA 2QQAA 5C4JJ 5EG0A 2XB5A 1F36A 1XS9A 1V6NA 3I53A 1SQ4A 4IEXA 3ROUA 1W8OA 5JLVA 4Q0QA 1LU2A 4BJ0A 5B4XA 1YI9A 3ABMH 4LBOA 3OSDA 1OPOA 2VBDA 1YW7A 2W68A 4XIOA 1QJY1 4ET7A 2R30A 2Y0SA 4XLCA 2D40A 3AXEA 2XHNA 3OWTA 2COBA 5F64A 4IRIA 4WM8C 5FYBA 5DG2A 3J8F2 1IZ3A 1RTVA 1HRV3 4AIKA 4RLQA 4R79A 4ZH4F 3NAUA 5LGUA 5HLIA 3F8BA 3G1MA 3E0JB 3NJXA 2C1FA 1HXS2 1T98A 1JYIA 2P1BA 1NY71 1S6LA 1MMSA 2P6SA 2CMPA 1H2KA 1RUE2 4P9GA 1YQCA 5H6RA 5L3EA 1FNYA 2KD7A 2ZGRA 1BQPA 1GV2A 1K5JA 2LY1A 3AKPA 1D0XA 2D5FA 2JRTA 1RETA 2Q0AA 3ZP5A 5FROA 3HQUA 1NXD1 5FYHA 1Y56A 4LT5A 5LEKA 1UIJA 1Y7BA 2IXSA 3MFCA 3POEA 4WX9A 2EZLA 3ZKUA 2WZ8A 2XASA 5C33A 4NC8A 2EZHA 2OAZA 5FZ4A 4XJAA 1RIRA 4CU8A 3G2BA 3MZYA 5E8AA 3JRAA 4M6VA 1BIBA 1F2NA 5L9BA 4P9YA 4XRFA 4YIRX 1LAJA 4XIDA 2HGCA 4IV1C 3AAFA 3AMMA 4LJZF 5IAXA 3HDDA 1DUXC 4HRIA 4KMFA 3PVBB 4N90A 4JQTA 2CW0F 4DRVA 5FZ3A 2XAFA 3A23A 2VE1A 4CDUA 1OLMA 3WDTA 2A5WA 1D4M2 1PNFA 1I3HA 3JBG1 4CCCA 1ZRRA 2FJ1A 3RZLA 4XR6A 4ANJA 3CL1A 5IYCJ 4OHXA 1XE7A 3A22A 3IRRA 2MLKA 1QIQA 4KIBA 5IVCA 3W9AA 2O6GE 2N8GA 2UXXA 2HOEA 3B6AA 4ZS3A 1A8DA 4MV2A 4W6YA 3ZMSA 3HRMA 4DNCA 4NHJA 2W52A 4Y22B 4ZYEA 4CDGA 4E2SA 2DVFA 4EZ4A 2CG4A 3MUZ1 1JI6A 4ZZDA 3HEFA 3M1CA 1H0MA 3K46A 4KITB 4UUSA 1IRZA 3UGGA 1H4GA 4XN3A 1DZTA 4RR3B 3ZSEA 3IMMA 2JG8B 2OTLI 2XH6A 1I50J 3K1NA 3OGJA 4QPQA 3GW2A 4RHV3 2R063 1A6IA 2QKDA 4P96A 4YVSB 1GLHA 3V0AA 1T33A 2FSWA 2IA0A 1OD5A 4NVPA 1LFUP 1EH8A 3CCEI 3IKTA 3H1CA 5KCMA 2ISYA 2L54A 4YFNF 1SACA 2UWCA 4QX0A 1I1GA 1WCDJ 2XUMA 1ZRIA 3ASIA 1FY7A 4TLFA 1T38A 4S2GA 3PVOA 1DIWA 2WO2A 5CFDC 3P3PA 1GNHA 4GAZA 4GWMA 2DI3A 2X6OA 2N7GA 1J5YA 2WSUA 3NW4A 2JDPA 2BW8A 2WADA 1NLRA 2A73B 3O6BB 1W8TA 3CD6I 1BI0A 4NPMA 1S0EA 4GD4A 4YIFA 3ZR8X 3NARA 4IE7A 4TN7A 3EUHC 3OIOA 2PQQA 3JRFA 1VBB2 2CGPA 2DCEA 2MC3A 1KITA 1XOYA 2VE8A 2JDAA 4QAWA 3FHZA 1YLFA 1C5IA 4D7YA 2MFZA 1BZWA 1HXDA 2GOMA 1MS9A 5FLJA 1RIOH 1ULGA 1FPN2 3OY8A 2GMEA 1PK6A 2GC2A 3IAQA 1R7JA 5I0TA 1ETOA 1URXA 4CCKA 2HWB3 1S7OA 4E2GA 5BNPC 4RGUA 3POIA 3H8RA 3HN1A 5I0RA 3GZ5A 4HV5A 1FEXA 3PUAA 1MJAA 2F4LA 4FX4A 4AEDA 4A4AA 3K2ZA 3JU9A 2V26A 1P6RA 4A3LJ 3HKZN 2VQAA 2FBIA 4IJAA 3WG2A 1ASJ1 3JUUA 1YTYA 5JLWA 1H0BA 2P2KA 2IA1A 1OOPB 2NLRA 2NNNA 1YRZA 3U11A 2LREA 4UVCA 1OVPA 2WAFA 1Y9GA 5IVBA 3IBMA 5DDJ2 2B5HA 4CCMA 4IETA 4UF0A 1JTXA 2CW8A 1W90A 5BNPA 4AGVA 1FNZA 4HNTA 1LHUA 1OPCA 2R7RA 2AXTC 4M0HA 3U4SA 1LHWA 4UVBA 4U2AA 1LESA 1WA4A 3ECHA 2W39A 4DQAA 2EXJA 5A33B 1U0AA 4EM0B 3IPVA 1SZBA 3I2IA 1ONAA 1UMQA 1F4AA 2UUZA 4ZYGA 2DCYA 1POV1 2XVKA 3DYOA 3PVEA 3J7NA 2KISA 4JQRA 5L3GA 3HM5A 4L92A 4BBRJ 2XIGA 4LG3A 4HPKB 3H92A 4FXKB 1QJU3 2D1VA 2WV1A 3H3UA 1BCXA 2V1XA 3NRVA 1W6MA 2JICA 1Z05A 1SLTA 4MSVA 5M5YJ 4MHUA 2EFQA 1Y8QB 4L9BA 4LIUA 3ZM8A 2VC9A 5AONA 1C8M2 2XROA 3S2HJ 2W92A 1OH4A 1VF9A 3HPGA 3G7DA 4CTEA 2HFHA 2CUZA 2LF7A 4K3UA 3EJKA 1J9IA 4Q8LA 5IP9J 1UOJA 3PUHA 4XTPA 1XC6A 1H6XA 4J1WA 2UV1A 3C7HA 1UZZA 2NP0A 3ML6A 4UI9L 3R4UA 3JW4A 5DCMA 1J1TA 2CDPA 4E7LA 3KLSA 3TKYA 4Q4V1 3HOBA 2UWMA 4HMZA 4B3AA 5E88A 1ZYRF 4QHZA 2Y48A 1X1BA 5A3NA 1D8KA 4R4XA 3M8JA 1DDLA 2J5OA 1RUH1 3OBAA 5DZFA 1QJU2 4X0GA 5EZGA 3I59A 3IL2A 1AKHA 1F4KA 4JVAA 2OXBA 4ZYDA 5F2SA 4M71A 5FRMA 5DCMB 2YROA 4DZPA 5L3FA 2R7XA 3VKFC 2ECCA 1D5YA 3NWSA 1RMU1 2B63J 1C8M1 3S32A 2ECBA 1SLIA 1RVF1 3KPHA 4FVVA 3NJYA 3DP7A 2VUDA 4LKDA 2IXHA 2XB6C 2DURA 3PJQA 4GDFA 3HQRA 1XBFA 2HXOA 3FF5A 1Y43B 3E1SA 4IHXA 4BQ1A 2MLGA 1UD1A 2VKEA 1KJRA 5KR7A 1R091 2W91A 1X8MA 2FU4A 1USTA 1K7AA 2WYSA 1O8SA 4ZDLA 2VBZA 3J80K 2ZABA 2MW8A 4OFGA 3ERED 4LE4A 2R7WA 2A6YA 1H8AC 2E34A 3H8UA 3GFIA 3CJIC 1FC3A 3BR5A 1JGGA 1ZA4A 4ON0A 2XXZA 5FMOS 3KGLA 1TME2 2EINH 1XSDA 4YZ1A 3BJ6A 2JDYA 2DV9A 5F5AA 4MH0E 4JYKA 3CJQB 2P7VB 4S05A 3ZVXA 2KIUA 1OURA 3PNAA 1APLC 4ZC3A 1DBNA 3J9SA 2BTVC 3KYLA 5JZGB 5FQ0B 4ASNA 4W6WA 1X9TA 2WT0A 2L2OA 1NCRA 2Y33A 3VZLA 1REEA 3WNPA 3S3NA 3N9OA 4OQ9A 3IN9A 3ZFFA 3MKYB 3K10A 2ZKLA 2EFOA 1POGA 5J4YA 1PZ8A 1W0PA 4XVHA 1GQHA 2QQMA 3OR2C 3V0AB 1KJLA 4KWLA 4GB33 3HUGB 1LOFC 2VTXJ 3VD9A 2IS6A 4LUMA 3RZKA 3SH3A 1V00A 3MLLA 2Y6HA 2YC0A 1TQPA 1MNEA 1D2SA 1MS3A 3WHCA 4OCTA 2GXBA 1IAWA 4M3CB 1HX6A 2RJKA 3ILRA 1ZG1A 3HTSB 3OGRA 4M4PA 3PFYA 4D6QA 4OU0A 3TWIA 4AHZA 5KXBA 1BIAA 2YC2A 5F7UA 1Z1DA 3HNYM 2QKLB 2G7HA 1QNWA 3M9AA 4MGIE 1LNWA 1ZBE2 2PEXA 4L8QA 3GWZA 4IEOA 3OYEA 3WQ1A 4F3QA 5C71A 3C3WA 2WFF1 1FOYA 5FZDA 4XRMA 5HLGA 3U10A 4O5VA 2OU2A 1W0TA 2VH9A 1PVXA 3NSTA 3VHOA 1QDOA 3JTHA 4RN5A 4KL1A 4XTMA 5AC91 2D6MA 5C3PA 4GO1A 5EEHA 3ORJA 5C3OA 5IK7A 2IT0A 1DGLA 2LSOA 4ASMB 1FV2A 1GP6A 4EQQA 1YJ9I 4WVVA 2LK2A 2BP6A 1GZCA 2VNGA 5FQ0A 2BYVE 1SEUA 4QKDA 4MGRA 5K5OA 2JA7J 2ZX4A 2X09A 3CJIA 4D9JA 1R6RA 4U0WA 4II3A 3RFRA 3SZTA 1QQP3 1YO5C 1UHWA 5F32A 3HBKA 3OBTA 4XC9A 1A35A 2CV6A 4MGYE 4HPQA 5F9TA 1VQ8I 4IPAA 5KNLA 4NMIA 5D5UB 4A44A 1S2BA 1FP2A 2HDWA 1RRJA 5DD4A 1P92A 1JKOC 2HEYF 3BG9A 1H88C 2WZR1 4XL9A 1YOVB 4A45A 3TEYA 2FBHA 3FMGA 1HXS1 4DQ2A 4OMDA 1G9CA 4YYOA 1JUSA 4K6BA 4HL0A 1W8HA 3H42B 3AZXA 2UXNA 5A80A 4GKXA 5ISLA 3GZNB 4A93J 2E1CA 2VVFA 5F08A 4NIIA 3VL8A 3TW6A 2QSHX 2D3RA 4PBOA 4CXYA 5B66C 1FSEA 2H94A 1D4VB 4TWTA 1T6BX 3NQOA 3GTKJ 2ORXA 1WCUA 4HXCA 4XLNF 2AC1A 3KVBA 2Y69H 4Q27A 3KZYA 4RD7A 2PHWA 4PIZA 2YPJA 3CZUA 2B46X 4EN8B 1ENSA 4HVQA 2M8GX 5CB7A 3J7HA 4NQWB 3AKZA 4OLLA 3OYAA 2F2EA 4RAGA 4FXGB 3O7OA 2W1UA 3CF2A 4GRIA 1MZ6A 5BOXA 3A02A 1V9U3 5LFAA 2HWD1 2VQHA 4CU9A 1LDJA 5ICFA 4G94A 4FPGA 4N53B 3U78A 2K3PA 3WNMA 4BGDA 2DMQA 4UUVA 3HOVJ 5A32A 4XETA 4KMQA 4C3IJ 5EV7A 3SQOA 3MUY1 1RYYA 4LQRA 1BM9A 5E79C 1MZFA 2GNBA 2WZEA 3LDRA 1K45A 5KHGA 4JGZA 3A0KA 2ETEA 2LC2A 2BBAA 3U14A 1Z7S3 3G71I 4CXWA 1FBUA 2VONA 4CDWC 3VYUB 1NH3A 5J47A 4UWDA 5D2AA 2NVYJ 5K5RA 2NN8A 1ZK8A 2G9WA 1FTZA 2ILMA 1G3TA 3DF0A 1X1PA 1VQMI 2C24A 2X8KA 1ZZ6A 2L4AA 3HOTA 3UGHA 2YGMA 4N9HA 1QZZA 4BHPA 3KT4A 3T30A 1XE0A 1CVNA 4GMP1 3VL9A 5ABJB 4LO8A 3KYCB 3I3DA 3QBQA 1GWKA 3VZOA 2FBEA 5L9RA 1FOD1 5EF6A 1RPWA 3TDUC 1YFXA 1LUJB 2COMA 3I0TA 4FT8A 5HDKA 2ZZQA 2ZGSA 1T0FA 1UYXA 2DBNA 4I02A 2Y31A 5GPCA 1BEV2 2VULA 2VPLA 3VSLA 2DCKA 3RMXA 4BQQA 5HLHA 4D94A 4XQDA 5LBBA 3FHIB 2ZMEC 1W0NA 1J3QA 4IE4A 3LEMA 1UHSA 4CUGA 2R073 3FHQA 1M06G 1PVC1 5FKNA 4GQ7A 2XJPA 4AFCA 3MFAA 3QP5A 3S6PA 4XZPA 4JGYB 4A0YA 3CDZB 2I10A 1QWRA 1ZKGA 1ERDA 1YQ2A 2TEPA 3A0BC 2VMGA 1S0BA 3WG7H 2BQPA 3K4DA 2DBBA 1YW9A 1Z21A 1OYIA 1IPSA 1HN0A 3HJRA 1FV3A 5CYVA 5C4WA 3ZQFA 5FPVA 3WW2A 4PFOA 3UV9A 2O7OA 2VN2A 1UPSA 5D8KB 1AHSA 4XFAA 5DUWA 1W9YA 2VW1A 4YZ2A 1E5RA 4XK4A 2WT2A 1PO21 1C0WA 3MKWB 3KV6A 4W50A 3MVPA 1F1ZA 3BP8A 2HWB1 4S2FA 2Y0IA 2X5IA 3ME2A 1OF3A 2L9SA 4HANA 4UUSB 3I4IA 5AC93 2XPVA 4L0PA 3HOSA 2NAZA 1SBFA 2BOLA 2JG8A 1ULCA 3E1F1 1W6QA 3KF3A 3LD8A 4LBJA 4AD9A 3JB8A 1X4PA 3ST7A 3UJQA 1Y0NA 4ISRA 1S7AA 2ZGKA 4QHOA 2RDQA 1VQ6I 4TSVA 3HT2A 2RJ2A 1LKNA 3A4UA 1KU7A 1NE4A 4XJUA 1UL9A 3WV6A 4DXTA 5BNGA 1ZBA1 3UJOA 4QU1A 3JD73 3V7RA 1QPMA 4EVIA 4YVSC 2DA2A 2LUWA 4QX2A 2KP6A 2QQBA 5T54A 1MBGA 1RUNA 1UELB 3RI8A 4C1WA 3CHXA 5A7WA 2QSFX 1UG0A 3IB3A 3VBHB 4EZHA 1IGOA 5C8CB 4HKLA 2Z2SB 1W9FA 1K78B 4O6JA 1VBB3 1W8WA 1SFPA 4E4ZA 5AVAA 2D7FA 2XV4S 3OUIA 4AVAA 4O7XA 5CQGA 1ZN2A 3HD8B 5ANQA 4NRQA 1ACIA 1PZ7A 1UN1A 2MEV2 4E7JA 3ISPA 2HTSA 3CO6C 1ODNA 1JU3A 1SVMA 2PHDA 4B48A 1AX1A 2WWSA 3GVAA 1UX6A 1JYNA 2X05A 3V42A 1H9PA 1X19A 3WNNA 2RE9A 3WU1B 3ZPOA 1L7LA 1XMAA 1OI6A 2BERA 2QZ3A 1AL21 4Y5TA 1ZGJA 2A6VA 4KBZA 5L7OC 4EM1A 3GO5A 5CQEA 2ZEXA 1W1WE 2PHTA 3QPSA 5C4XJ 1UMHA 1WI3A 2DFCA 3OY9A 1XNBA 1VAVA 2Q1ZB 1BR1A 2HYXA 2HWE3 5ACA3 5F0CA 3EBRA 3RYPA 3EETA 5H2FC 3MBWA 2ID4A 4ASLA 1IS4A 4Y5SA 2WAAA 1QU3A 5FV3A 2P4EA 1IN8A 4D7MA 1OOPA 2RS31 1KYZA 1LE8A 1IPKA 2O0OA 3PMSA 3MLJA 1MBHA 2EA7A 5KHDA 3DV8A 1QQP2 4DXSA 3WTZA 3RG0A 3AG1H 1F5JA 5LEJA 2X6WA 5DUVA 4DOZA 2LBFA 2AREA 1U8BA 5J1YA 1Z91A 4Y15A 1WCMJ 1W2OA 5CNAA 2ZMKA 4G7OF 1NX9A 1XU2A 2JA5J 2LROA 1JTYA 1U5ZA 3FXMA 1JODA 2XF6A 2F17A 4CYDA 4X8PA 2OA2A 3IAPA 3MAJA 2WNUB 3CJRB 3Q5FA 3K4KA 4K21A 2EPFA 1F8VA 1OH3A 2NMNA 3FMSA 2BBYA 4CDUB 3WTSC 1DP3A 1W2AX 1YHQI 2DXIA 5CIRA 1BBT3 4KN4X 1ULYA 2FBKA 3MIDA 1W6QB 2KFDA 5JXJA 1FSHA 3I3EA 5CVIA 3OV8A 3K7AJ 5HCHA 1JE8A 5LHIA 5FOJB 3RZMA 3S17J 5F39A 1PMIA 1B9NA 1FMD3 1E17A 2CDOA 2BNNA 1GZTA 2XPUA 1QHGA 3GALA 1LHVA 3RKQA 4QB6A 2VMIA 3POSA 3NV1A 2FZ2A 1DP7P 2ZGMA 3AL6A 3BTLA 5IHRA 2K4JA 1S0DA 3S7EA 2VOWA 3UT0A 1RL3A 4XCBA 2W82A 5L3CA 3K70D 1XSRA 1IN4A 1QZEA 2A6EF 3ERMA 5JOXA 5C8CA 2F4IA 4CHUA 4P5HA 4A41A 3OYDA 2TNFA 4I76A 3WNLA 1QO0D 3HRUA 2PBIA 5DM7F 5BY5A 2VI6A 2WBMA 2VD7A 1QXPA 4BXUA 3NNJA 3KD4A 3NRUA 3TRSB 1Z3YA 2IS4A 3IRQA 4HPKA 3HOWJ 3LL7A 4PSWA 1YIPA 3RWKX 2RNGA 3KLOA 4ZZLA 4XACA 2ZJRF 4N4NB 4QWNA 2IA2A 3PJYA 4E9KA 3CCVI 1YE9A 1FAYA 1GZWA 2E1NA 4QPIC 5GLTA 5M5XJ 3COAC 4Z07A 1LOAA 1EY2A 2YB7A 2LY2A 3WHUA 5FYZA 2MD5A 3DPRC 1U8RA 3VFZA 1D0ZA 3ZO0B 4LK0F 5HS8A 3CCRI 4QQLA 1TME3 4HKOA 3WTWC 2JG9C 4R9AA 3T2PA 1JYXA 2WZR3 3IMNA 3BIEA 2QTWB 1NAEA 1VQNI 4M3GA 3M3IA 1RUG2 4R9DA 4ARXA 5IOZA 1PVC3 4FSJA 1XGMA 4Y5Z0 2Y0SN 1LHOA 3LPGA 1STZA 4FPJA 2OPTA 5IW0A 4CUBA 1VRH1 4IE0A 5IPAA 1ZLJA 1B09A 4ZXEA 3VBFB 1GLNA 3U4XA 1UOBA 2GC1A 1IUYA 3OB8A 3W6JB 3I2OA 5FXVA 3GTGJ 3FLRA 2CQKA 2HEOA 2R072 4D0PA 3W5NA 3HEIA 3U07A 2RN7A 3I2HA 3JR9A 4HG6B 1EH6A 1FYMA 2HU9A 1U5TA 1AR91 4EROA 3OL3A 5IP6A 4YWAA 2GALA 1NOVA 2VKHA 4JGYA 2J1UA 1AUYA 2DOEA 3ELNA 1O7FA 1JOPA 1HRI3 2JKBA 4XUTA 4XAAA 2E1MC 1VALA 1YX5A 1MJBA 4L0ZB 3K1MA 3LSJA 4KUMA 2EALA 2ACJA 2VASA 2NRAC 1PM4A 2XL7A 5FMDA 5JHFA 1KGYA 4RB3C 1N77A 2HWE1 1C8M3 4G7ZF 3DTKA 2RREA 4ESFA 2VOPA 4I3GA 3MV01 4IE6A 4OVEA 2X4HA 1BHGA 1X2MA 3ZYJB 4YM2A 2RV8A 2EIMH 3KZIC 2ZXHA 3HPHA 2E5NA 1Q56A 2HEVF 3H50A 5B4NA 2H0VA 3HL2A 3VBHA 2V09A 2FDKA 3CC2I 5J96B 2ZX1A 3LOBA 3TO6A 1EAH2 3C7GA 3K4JA 2BZDA 4YLZA 1WQ2A 5FP4A 3HMYA 4Q4V3 5BNOB 4NDLA 3PIPF 3U9GA 5KBFA 5FZFA 4QPGB 2PN6A 5CG9A 4KA4A 1D4M1 2WT1A 3K3OA 3LQQA 2QQLA 2EIKH 1Z7S2 3H0GJ 2V9KA 1Q1VA 4LLLA 3S2DJ 4Q0PA 2VQGA 2V6CA 3OYBA 1X8EA 1LULA 5A3WA 3BI3A 4RBOA 2FQ3A 1OBNA 2STWA 4RAZA 3ABKH 1TWFJ 4XRSA 2ZMEA 4OQ8A 2DLLA 5CLSA 1ETVA 4WM7C 4DOUA 4QX7A 1XPWA 2LP0A 2M4GA 5IT6A 3K0LA 4AVSA 5FMBA 3KV5A 1O7LA 2EBIA 4XJWA 4YW1A 4M3EA 3ZFEB 4AQSA 2EAAA 3CCSI 3KCYA 3N35A 1TG7A 2RGVA 4PI2A 2UURA 3ZMZA 1UG2A 3WUCA 3NNMA 4S04A 1J1LA 2CL2A 1K6OA 2FMYA 3I4PA 4MVTA 3K4AA 1DGWX 2ZFWA 2OUMA 1P7IA 2XJVA 1YHFA 2L02A 3RJPA 3ONQA 1SMYF 2W1SA 3WNXA 1HIXA 2D93A 2KKOA 4HOOA 3ELKA 3FXLA 2RVAA 3BG3A 2MH9A 3VYTB 1YYNA 1RNLA 4BPZA 5FKBA 4WBBA 4HNVA 4I98B 3CESA 1UFMA 5FZ0A 4CZCA 2Z33A 4P00B 1G4DA 5IT9K 4FOVA 4EN0A 4PGHA 4BAYA 2YU3A 1TT5B 3H9QA 1JZ5A 1LEMA 5DAXA 1MZBA 5CKTA 3APBA 3ZN4A 3O12A 1RMU3 5FKKA 1SAUA 3VDXA 3ZFGB 3JCUC 1RI7A 2VUJA 4LO5B 2A68F 1U2WA 1TMF1 3B5LB 1A6CA 3OYLA 1YFUA 4X8NA 1BJAA 1S1AA 3GZAA 4PLOA 4RR3C 2VZUA 3TO9A 2XB0X 5C7GA 3D5LA 3ZQHA 2YC4A 4P5OA 2ZJ2A 5DG1A 1JBCA 1R1UA 1LOEA 1QF3A 2J1EA 1JUPA 1JZ4A 3HSRA 4NC6A 1OR7C 2R6QA 1Y1VJ 1QNYA 2KRFA 5D6EA 4LBQA 3O1MA 2UYAA 3ZYRA 3LSPA 3S2WA 1KA8A 1NG6A 4E70A 1QJFA 1O5UA 2FDGA 5BS6A 4DEQA 2WC2A 4BIOA 2KT0A 2V1UA 2YBPA 3ZN1A 3L1PA 4HEA2 4UUTA 2PMZN 5FRAA 1W6NB 3VZNA 3S1RJ 1GICA 4MHRA 4AGRA 2K9LA 4IESA 4DO0A 3BLYA 4P02B 4E27A 2UU8A 1QU0A 1ZRDA 1VQ9I 3IWFA 3H5RA 1AX2A 1PO22 1HB4A 3K4NA 4NPLA 4IEJA 4K1ZA 5HLTA 2P5LC 1DLLA 4IO9F 3RZGA 4L5JA 1WJAA 3M3EA 4W6XA 2WL1A 1H1MA 2QE3A 3CDHA 3F8FA 4IHVA 5F37A 2EICA 1UCRA 1GDTA 1B35A 4H14A 4BJ5C 3AG4H 2KXLA 3BIWE 4RGKA 3FXQA 5DD8A 5CFCC 2FXAA 1BMV1 2LR8A 3K4MA 1VBA1 2FQPA 3JB4C 4IEUA 5I0SA 2P7CB 3CMMA 4E7HA 3VSKA 4YW4A 1LDKB 4XPVA 1G8WA 1YEWA 3ZXGA 2MH2A 3WW1A 1RUI2 5JOZA 1DDNA 5ACA2 3DWLE 3WDYA 2WAQN 3TYJA 4BDVB 1Y0UA 1RKTA 1XMKA 2ZHMA 4JKMA 3WEZA 4G6QA 4H2AA 4RQPA 4IEWA 3AMQA 1IO2A 1OYWA 4KWKA 4Y1VA 3Q8BA 4GWNA 2D45A 1W8NA 3HQXA 2UYBA 2JJ7A 3LA7A 5BNQA 5FREA 4PSXA 4QKFA 1HLCA 3KV4A 4R52A 3VDCA 1R9TJ 2IJLA 3B02A 3SEEA 4MNUA 1TQ5A 2CW7A 3O3KA 2B0LA 4BS9A 2WLPA 3BN6A 2AEYA 5IK8A 4JZRA 3JZVA 3OS1A 3HRTA 5B5EC 1AWCA 5FLHA 2KZVA 5GTHC 3B00A 2MG4A 5GP9A 2Q8OA 1HV1A 1JXNA 2RS12 2DTZA 5JFRA 4LGWA 3U1KA 1B8IA 4E7ZA 5JZGA 1SAXA 1UB9A 2RDSA 2QVSB 5HCBA 1HXS3 4N43B 1ND3B 3ZN0A 3BYWA 2JDMA 5GAGJ 5F04A 1IZ1A 1NCRB 3HRSA 4WWCA 4LNVA 4E6KG 1ZGWA 4PDKA 2HH9A 4OZOA 4CDQA 3ZGKA 1IG7A 3BTZA 4NJ4A 1UWWA 3DEMA 4IEZA 1BI2A 2XAHA 3CMYA 3DN7A 4XBFA 3LEKA 1CJPA 1NG0A 1NZCA 4FETA 1S72I 1BA5A 2W1WA 3MF6A 4QX1A 2VZQA 2WSVA 3AG2H 4XLFA 3DGTA 1Q43A 4FTEA 2O8XA 1W8UA 3AYAA 1FIPA 1SMTA 1MNDA 5FZOA 3TNPB 3O1RA 4WZCA 1Y9QA 1KDMA 5FK7A 3O1TA 1S4CA 1AR62 1W6OB 2JG8C 5JSOA 1U0JA 3KP6A 3WT3A 2R93J 4CXXA 2JPCA 3GFJA 4UW6A 1O6UA 2ZGTA 5CKQA 4XUOA 2M0CA 3I55I 5EPAA 3PUSA 3CDIA 2GU9A 1HW1A 1BI1A 2CFOA 3SMHA 2M45A 2V5DA 4N53A 2XBO2 2ZGOA 2L3DA 5HCAA 2RM21 3ZIWA 2JSPA 3HGYA 2ZXQA 5LA2A 1W6OA 1KD7A 1OHFA 3JBG2 2VZPA 2E6VA 1Z6TA 3VBUA 2YR2A 3ZN6B 3N9NA 1R4NB 4M9SA 1NQJA 2GIZA 1S5LC 1QRYA 4PUSA 4ZTFA 4EJUA 1ENHA 4XIKA 3HOYJ 4DUWA 1ST8A 1SANA 2BVMA 3DTEA 3AM2A 1N3PA 4CDXB 5J37A 1NCQB 2HTJA 4IRHA 3H9GA 1DHKB 1ZARA 5APAA 4KICA 2F4PA 3S8PA 4X6AJ 1S0CA 4Y52J 3CCUI 3D82A 4BHCA 1PUFB 3LF7A 3B6CA 4I2OA 3KQRA 3F22A 2D3PA 5CAZA 5E3MA 3BU7A 2D6NA 1ZYBA 3AK0A 3GTPJ 1L7RA 4QGNA 4AHXA 4C0HA 3A7QA 2QQPA 1OLTA 3ZXKA 1PO12 5JZGC 3V56A 3EPZA 3IT8A 4ZONA 3PSFA 4A3CJ 1ZBE1 3CC7I 2KDOA 3CUOA 5DDJ3 2JECA 1ZRFA 4KWJA 1VI0A 5IUQA 1QBJA 1QEXA 5BYNA 2J22A 3VDDC 3DXJF 4N0BA 1VAKA 2NVQJ 3AB0A 2UY8A 2ZNYA 2RS53 5KVRA 4AAXA 2JA8J 2ELHA 2EIGA 2PAKA 4XBLA 1HLVA 1HDPA 3LSTA 3ZMTA 4AYBN 1ODMA 4H7LA 4HFSA 1JU4A 2JWPA 2OJED 2R7DA 4XFGA 4B1RA 1Y9MA 1TWGJ 1Z67A 1R1A1 4YM1A 5A6QA 4CEWC 1IS5A 4NIGA 4JDMA 3KB5A 1RC6A 4MYEA 3UNPA 3ZDVA 1DQ4A 3IDCB 5HI0A 1LQ1A 4AVBA 1WW7A 3S1QJ 2AQFA 5CISA 3AKQA 2WWUA 4ARYA 2HYJA 5LA1A 4QLCU 3FFZA 2KJCA 2ZO4A 4KIGA 5D5WB 1FYUA 1R1TA 1H2MA 1Z9CA 1RUJ2 1QH7A 4UFMA 5A3UA 3AMPA 4UY8I 1TNSA 1SHWB 4IRGA 1OA4A 2JWTA 2WLQA 2HPMA 4QB2A 3RZDJ 1WUVA 4KDPA 4IXAA 2B4KA 5F6FA 4ZTJA 4LBLA 3K3NA 3KM5A 1SLLA 2MGQA 2QLZA 1HB3A 5C3EJ 1NLQA 4AI3A 1XGSA 3OPWA 4A6DA 3SITA 1XB4A 4ZS2A 1AYN2 5FPBA 5BPXA 1SDDB 2VXRA 5CFDA 1R1VA 3WINE 3GZEA 3R60A 4RHV1 1Z3XA 1K5MB 3I49A 4XFBA 4L99A 3MPPG 3D0SA 2WNEA 2CWMA 2AENA 4AQ6A 3P5BA 2DK5A 1MBFA 1VBD2 4HK9A 3P7NA 1FX7A 2VC0A 5FZKA 2AGSA 2LOOA 5JCTA 3J7AY 3UL2A 2BPA2 1EPZA 5A32B 1MS1A 2NOJB 4L2NA 1UKGA 3J81K 5CU1A 1GT0C 1NCQA 4XFIA 1IRFA 4JTNA 3GZ6A 1W0OA 4YW3A 2D3SA 1PK6B 4QX3A 3FM5A 1DGRA 4W65A 1U12A 3M8FA 4OAZA 3P9KA 2CQ7A 1T6SA 1O3QA 2Y0MA 4ENJA 4ITCA 3DL3A 4XFCA 5IWFA 3C18A 3MLKA 2JD9A 2MSYA 4G4FA 1OMIA 1KU3A 5DABA 1V5FA 3ESWB 2Y6GA 1HJGA 2R5ZA 1DGRN 1ND3C 3FBYA 2EXIA 4JAAA 3QYFA 1VQPI 1UY3A 4YVSA 4MEYF 2WN2A 2ZHLA 1AR63 1JYTA 4HNUA 2WR9A 1LVAA 3TEWA 2VT2A 1WJCA 3ZXSA 3J7AO 3MIFA 4BWOA 1FMD2 1R1A3 3INAA 5EFUA 1GWLA 3FHAA 2XF7A 1DG6A 4S2HA 3RGBA 5IYBJ 2XAQA 3O1VA 4HONA 4OI0A 1JOBA 3QH6A 1OXCA 4FFHA 5JWPA 4LK1F 2VJ5A 3PIJA 1GVJA 5FYIA 3OBRA 4META 2ELJA 1V4RA 2ERFA 3MICA 3PIOF 3OYJA 5HS7A 3HAGA 1WJEA 5EEAA 4HV6A 5FY7A 3IUOA 1SFXA 4MTEA 3LOCA 4ETSA 4KISA 2DT6A 3FX3A 2E9QA 1TT0A 2Z5WA 3FDYA 2XGEA 5FY1A 4RB0A 4U88A 5DYMA 2DMNA 5CA6A 1CIYA 2XPJA 2IS1A 1RUH3 3NKGA 1LB2A 4YZ5A 4LO6B 1VB2A 5FZLA 3VBSA 3FKIJ 1PGW2 2A69F 4MXWB 2E71A 4G9YA 2A3YA 4IERA 4RSUA 3CMGA 4U36A 1F9NA 4PIXA 4XKBA 2OQ7A 5J1RA 5K5QA 2P3KA 2QUOA 2G0EA 3GJBA 3D1NI 1UY1A 2XJQA 2HQAA 2FCTA 3VD5A 4UF0B 5DUXA 3GZUC 4L18B 5CFDB 2LVSA 2SBAA 4TLGA 4DYQA 4XILA 3M1HA 4LBQD 1LVKA 4BCUA 2HVSA 4NHXA 2BNMA 2CU7A 2DA4A 5M3MJ 4XONA 5A3PA 2WWYA 3FBMA 1CD3G 4XJ9A 1GP4A 1EA3A 3VBHC 5A2QZ 2NM1A 3E5QA 4Z2YA 3J7ZI 4OI1A 1G9AA 3RI4A 1RGSA 5FZOB 3ACGA 2JVGA 2LD5A 4DY3A 1SLBA 1I9RA 2DFBA 4FTBA 3KV9A 5FP3A 4A3GJ 1U5XA 4XSZF 1Q1HA 2NYYA 2KL4A 2H1KA 1RJ7A 2ZOEB 2ZNZA 3LSHA 1HCRA 1MNMC 1OCRH 2WNVA 1KZHA 4H4KC 1AJKA 3ENRA 2YPDA 2F6BA 4XAEA 1IXCA 2CFXA 5HODA 2AXLA 1VBC1 5L7OB 1ZLKA 1H2LA 1PJRA 2LS6A 4DXZA 4A3EJ 3CUQA 1RUF3 1RUD1 1D1AA 2DDAA 1FT9A 3E3VA 1JZ2A 1R1ZA 1MMNA 4JV4A 1W6MB 3TOBA 5FD6A 3KCXA 2OPWA 5L36A 4GYIA 3BTJA 1X4OA 5DDGA 2QBYA 5FY0A 4ZDPA 5C4WC 1W0UA 2RDRA 2DUPA 3TQNA 1LOGA 2RMU1 1WW5A 3USUA 3N36A 5LGTA 2IVMA 1OKQA 1YRNB 4XOPA 3CZJA 4FPFA 1F31A 2DA1A 1GFF2 1GBGA 3CCJI 3FHNA 1A5JA 4F7ZA 1UZCA 2HDCA 2BWCA 5KAIC 2Q8EA 3BOPA 3LSDA 4RS5A 4XQWA 1BMV2 3HUGA 1AR81 2Z69A 4W4ZA 5CVJA 4BJTA 2VZVA 3ZQIA 1CWPA 1FWZA 1EP0A 4CP9B 1VBE2 1P4XA 3BPZA 3LDKA 4XEZA 3VBOC 5FZIA 3G1OA 4QHBA 3KP3A 1CQTA 5LGNA 1KQ8A 3CTAA 4XOTA 3KE2A 2D97A 4B1MA 2F5CA 4Q4Y2 2O03A 2W84A 1NHAA 2FDIA 1DQ2A 4HT1T 3IP4B 5T5LA 2ZHNA 2JDNA 2XL9A 1FYLA 1TNTA 2G7UA 3K77A 4F93B 4YVWA 3GDBA 2X1DA 1FOD3 3MO4A 4HZFA 3JSOA 3URFA 2OF7A 4FPOB 2JVHA 2OCCH 3HBZA 5FZ6A 4UV9A 4AF9A 5D8AB 3V0BA 1POV0 1QJEA 5A6XA 3BUCA 3EDPA 3WE2A 2M87A 1QJX1 3EXUA 3ES4A 4AGGA 3WF3A 4FPHA 1LTEA 3PMEA 2DPUA 3F6OA 4NN0A 1XQNA 2W5FA 1TTYA 2WDBA 1RHI2 5C9AB 4OIPF 3AP7A 1QQP1 2QYOA 1EYBA 3SCHA 2DMPA 4KMUX 1AOYA 1JMUB 1W9TA 3I2FA 4CO8A 1CAUA 2VBPA 3P5JA 5FFZA 1WH7A 2D44A 3FXOA 3ZMOA 1HKDA 4CP2A 4RB2C 4LE3A 1AL23 3MIHA 4M3CE 2XDVA 4LLFA 2E7TA 4V2GA 2QCSB 2A3SA 5EDNA 1RITA 3PO2J 3BALA 1AR73 4LLGF 4LUKA 2JD4A 5J4VA 1YXWA 4EYUA 3KFWX 5FAXA 1VLNA 2ZAAA 5FLXK 3E6BA 3L7WA 2HJIA 3HB9A 4XUNA 3ILFA 4ZKTB 3IHUA 3MV11 3CLOA 2L5QA 3S1NJ 1VBC3 1WH5A 2QENA 4QXCA 1CZSA 2ZC2A 3SKJE 2ZXWH 2VZOA 1JGSA 4LO7A 4OUSA 2M30A 3C3VA 4IGPA 4C8DA 2RVCA 3HC7A 4IV3B 4LB6B 1FMWA 5JXHA 4CUAA 5K7FA 2DCZA 5LY2A 4N8MA 2OUJA 2W95A 2H6BA 5JI7A 5I8SA 4E4DX 1FZPB 5JSPA 4LA2A 2O5RA 5LK5A 3DEUA 1Y6IA 5D8LB 1R081 1STMA 3OYNA 2DA7A 4D7NA 4CEYB 2HS5A 3BZCA 1DYKA 3IH3A 4ES9A 5AFEA 1V5EA 3B9IA 5D1IA 1OFCX 1S29A 1WLWA 3EQEA 1FPN3 3VHPA 2A75A 4YGEA 3ZMUA 2K27A 2V9PA 4QB1A 1XGNA 3OR1C 1CZVA 4XZUG 2B9SA 2RS13 4HOBA 1ZVFA 2J42A 2OZUA 1R22A 3LIGA 3Q9OA 5F3CA 2F4OB 4CDUC 4IDZA 3R0AA 2QQOA 4CDQC 1W6PA 3LMMA 1JUIA 2Q1FA 2Z16A 5A7PA 1DQ0A 1V9U2 4EMSA 2PLV3 4PJ0C 4Z82A 3D0JA 4QX8A 1U6GA 1B8IB 4GZ9A 2OYZA 1D1CA 3OS2A 1GANA 2ADDA 3VPRA 4A3FJ 2JPBA 2IXKA 3HSEA 2VE9A 2W24A 1UU5A 2Y38A 3GTJJ 1TNFA 4YGDA 2LBFB 5H6QA 3K4CA 2FD8A 2GP5A 2PHLA 3RS6A 2WS92 1EJ9A 2GA1A 4CZSA 3TMOA 2JZYA 4BE0A 4AQ2A 4ZYHA 5KXEA 5BQTA 3LB9A 4F83A 3WXPA 1QZYA 4UV8A 4CPBD 4O61A 3KLNA 3UNGC 1RUI3 2PHFA 2Q2EB 3K4LA 4HLXA 3E6CC 5AIPA 1ETYA 2WB1A 4I7HA 3ZPYA 3OYWB 5FZ9A 3W6VA 2I5UA 3POJA 3OCPA 4CP0A 1OPMA 4XUQA 1ODDA 3P9IA 3C2GA 2P37A 5EEGA 1UCXA 3D5OA 4DGWB 1WPKA 2VVDA 3ACLA 2FCUA 3S3OA 3PLQA 4Q26A 4KNYA 2CY6A 2JKXA 4IL6C 1BR4A 1VIWB 2WABA 4UBGA 4ES8A 1JN2P 1H2NA 1FP1D 4QWQA 4M74A 3F0CA 2DPDA 1HSJA 1WLCA 3IWZA 4F8AA 5FY5A 3Q9SA 4HAMA 3T0YA 1D4M3 1IXSB 1N3OA 2X6YA 1TC3C 1UXZA 1VBA3 2W08A 1X3UA 5BPIA 4CCLA 1H8TA 1PGL1 1RUC1 3PO3J 3OOXA 5LY1A 2M8EA 1JZ7A 5LLQA 1DU6A 1T39A 5A3LA 2R1DA 2P8TA 3QYEA 3I9V2 2ADUA 2BGCA 3R0RA 1R64A 1QHHD 1OT5A 1U5IA 1GOFA 4AK3A 1S9HA 2QQKA 3OYMA 5IVEA 1XPXA 2HDDA 4BACA 4CEYA 2JB4A 1VJ2A 4LKSA 2V72A 3QOPA 1UMZA 2H1LA 4IOCF 3H0OA 1EAH1 4Y13A 1H30A 1ZREA 2V5YA 1FMVA 5GTIC 3K2OA 3CLPA 2JDHA 3VUOA 3DTIA 4HA8A 2G19A 1UIKA 2GC3A 3ECQA 5E17F 1GKBA 4Q4X2 2HWVA 4QDSA 1RESA 2XVCA 3W6KB 3QU3A 5K7ZA 5F5CA 3M7AA 3NNLA 4BLIA 5FPAA 2ZFUA 2R043 2YMZA 5DAVA 2L4MA 2EIEA 2XSDC 2RS32 2HKXA 5JVVA 5D8AC 1RUE1 2IZWA 4COVA 3BZ6A 4XLHA 1UY4A 3ZMNA 5I91A 3L9FA 3OJBA 1ON1A 3C7OA 3W58A 5IVYA 2B45X 3BPVA 4W97A 2QZ8A 2FCVA 1QQIA 3VDAA 2G9GA 3VBRB 3SEPA 1PHMA 2VW0A 3DECA 1UKRA 3CQOA 3CUQC 2CUEA 2VCCA 2R7UA 4SBVA 1US3A 4AI9A 3RNSA 2ZGUA 2JE7A 2X1EA 4LK6A 1JOJA 2HBTA 1G8XA 2R5ZB 3M3OA 5E3NA 1S7EA 3TN92 3FZ3A 4BQNA 2EV0A 3K51A 5J98B 3CC4I 1PMHX 2PYTA 3DQVC 2V6EA 3NAPA 2PAEA 3WDWA 2EZIA 2MYSA 4HETA 4Y4YA 1Q8PA 2ZX2A 4ZPIA 4JGZC 3V64A 3ZLIA 1XNTA 5C3RA 2XRLA 1ZNPA 4PJJA 4HLTA 2C26A 4IV3C 4XQFA 1MEC2 3LDBA 5J36A 4AFDA 2WNVC 4BDZA 2QQUA 5T5JA 4BE3A 2KMUA 1U5YA 1VBD3 3HOXJ 4L9JA 4EM2A 3PDQA 3MI8A 4Y1ZA 4HF1A 1LOBA 3DLLF 4M9XA 3R4SA 2WO7A 3N7LA 1I6HJ 5I93A 3D4KA 1DGRM 4ZY9A 3VV1A 3ZXEA 1LGBA 1BL0A 4I01A 5FLXZ 4XXPA 1EAH3 1H9TA 4EJTA 4QPOA 4RQPC 4O65A 4A7YA 2NS0A 5DQ0A 4CCNA 2MEV3 2H6CA 1MZEA 2ZBJA 2BY0A 3L2WA 2FE3A 4A6EA 1AXZA 1ZTRA 2IAIA 1LE8B 1H8TC 4XDPA 2EB7A 2YY1A 4C30A 4A7ZA 2VC1A 3FXUA 2ID6A 3R4KA 2NVUB 1UU6A 4F55A 4YGCA 3BCWA 2LF8A 1UMIA 3V7CA 3H8OA 3ZOBA 5IP7J 5EYXA 2HR3A 2ZX3A 3MFKA 1VAMA 2VOKA 2ZXJA 3M4FA 4AG4A 2B7EA 2NPIA 2RHPA 4YFXF 4AEDC 3E97A 2JIJA 4I99C 5FYSA 1V6OA 2RM23 4BQ4A 5K8SA 1GP5A 3M3YJ 2KRCA 2DQRA 2O0YA 1DGWY 1SEFA 4NOTA 4XLEA 2HWD3 4YFWA 4JX6A 2A71A 1YUDA 3KQ4B 3AP5A 4NAOA 4BQWA 5EQUA 2K9QA 4Y20B 5ICEA 2VTXA 3VBUC 4AZZA 3OOUA 2DFIA 1WW4A 5IY5H 4Y7NJ 3G3ZA 1NUKA 4IEPA 4Y17A 2VMCA 2YXSA 1E5IA 3MWMA 1RR7A 3VBSC 4L97A 5JI6A 1PIV1 5DPNA 3LWCA 5FLMJ 1PMJX 2D5HA 5B1BH 1VRH2 1LHNA 1VBC2 1VQ4I 1USSA 3CUQB 3M8LA 4CUCA 1LU1A 2XWJB 3IDBB 3FKJA 2MPFA 1RUI1 2X53S 1GVDA 2K0GA 3T2TA 3OGVA 1NK3P 1QPIA 1AR92 1KFXL 2GNDA 3FLPA 1A78A 3K48A 3VB9A 5F3IA 1GHCA 4B44A 4E4HA 5T3NA 4K1YA 2VUMJ 1P8JA 4H0EA 1BVVA 4QIWN 5FZ8A 3VKNA 2ZEZA 5EIYB 2DVDA 3HG9A 3POGA 4PF5A 1OKOA 4QQOA 4CCEA 1D2QA 1ON2A 3H3LA 1EKEA 1X3ZB 4N9IA 5KC6A 1OSGA 2GMMA 2D6OX 1TNRA 2J1VA 3L2YA 4U0VA 1V3FA 3MEXA 5L3BA 4UNOA 3UGFA 2X0LA 4P14A 4FFFA 4ESJA 2R7VA 4XE9A 2A6TA 4JHZA 4KIFA 2KQRA 2Z1DA 1GNZA 3K2AA 1YIOA 2M7AA 4TXWA 4UFIA 5GPAA 1WLDA 1OC1A 4J01A 3R6SA 1NYWA 2LW8A 4B7EA 3IM0A 2PG4A 5DV5A 2E1OA 4NBQA 3CMAI 1XRUA 5GM0A 4BUPA 3CJTB 3T5XA 1WWXA 2VJ4A 2P6CA 1GZWB 5J09A 1JTZX 2XONA 3WTXC 1H8VA 3DPRA 3BWGA 2GP3A 4JGZB 1WW6A 4FOQA 1MH4A 1MQTC 1B35C 2LMDA 3VZMA 5E8GA 4MEXF 2XJUA 1MGTA 3H7YA 4A3MJ 2ZGPA 2BDRA 2FF4A 2ZMNA 2KDZA 4XJZA 1R49A 1ND2A 4QSHA 2WAQA 2EIDA 5BNOC 3ZN5A 4MO3M 1ZZBA 3U2RA 1XDUA 2IEKA 1PX3A 2Z99A 2XQXA 4WVZA 1AXYA 1G9DA 5JR3A 3AFHA 2PLYA 1V6MA 1W39A 4KN7X 2WUHA 4BH9A 2GOXB 2X48A 1RUF2 2P4WA 5B1AH 1WJ5A 1HDDC 4ZXKA 3K1PA 3O0WA 1OYYA 2IGKA 3FWEA 3AMNA 4CU6A 2D6PA 2P34A 1JHFA 3T09A 3PJRA 4XKWA 2LY9A 2EZKA 4FBFA 4Q4W1 3HNMA 1XSXA 5FZ7A 2ARXA 4IE5A 3CO2A 3RDIA 1ETWA 5D21A 2OZJA 2WN3A 5FFOC 1T95A 3BU0A 4OMZA 3F23A 5A7NA 4G8XA 1A8MA 2A5ZA 2WA0A 1OQ1A 1OFNA