3LA7A

Crystal structure of ntca in apo-form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
209
Chain Sequence
DKALANVFRQMATGAFPPVVETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
molecule keywords Global nitrogen regulator
total genus 65
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la7A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la7A01
3IHUA 5F64A 2QBYA 1P4XA 2LSOA 2UWMA 1UD1A 4MUVA 4PIYA 3WE3A 1XGOA 1GHCA 1DZTA 3KETA 1YFXA 3ZMSA 4L0ZB 3FXUA 2BNNA 4BH9A 2GC2A 3WTSC 1F9NA 4Q47A 2VT3A 4O3MA 2CAVA 3EO6A 4HV5A 3RDIA 5DDGA 4JBAA 3ZMDA 2OA4A 3SCGA 4ON0A 3ES4A 4B09A 1V4RA 4XLPF 5FLHA 2MD5A 3QOPA 5DCMB 3LWCA 4J1XA 2L02A 1T39A 1U12A 3E6BA 1CAXA 4XFCA 2PHLA 2GAUA 5BPIA 2MHFA 3P7NA 5CADA 3RKYA 3DP7A 4A0ZA 2A07F 3MZHA 4IRGA 4BXUA 1O5UA 4LLLA 3JTGA 2DAOA 5FLIA 1R00A 4NVPA 3CL1A 1J1LA 1SFXA 4EQQA 2CWEA 1L3LA 1YYVA 2K27A 1O57A 1H1IA 4I0AA 2L4MA 1SMTA 2NS0A 4NHJA 3CJXA 4H7LA 2DU9A 5D8LB 2HR3A 4RD7A 3WGGA 4L9NA 3KP3A 2GZWA 1ZGAA 4QM9A 3NW4A 5DCMA 4KT5C 1I6XA 5I0SA 3QPHA 3CO2A 1MJ9A 3TO7A 2KKOA 2OPKA 1YIOA 3OGJA 2V09A 2XUBA 4HDUA 4KA4A 2AXLA 1MDMB 1G3TA 4XSZF 1P2FA 3G3ZA 1HW1A 3Q9VA 1FYLA 1IW7F 1ODDA 5HDKA 2RVCA 4G7HF 3P9IA 3RTRA 5JR3A 3ETQA 5CLSA 5J6XA 4IEXA 2IXIA 1TNSA 4ENNA 4KIGA 5EEGA 3WTXC 5CVVA 4IERA 3S0MA 2DQLA 2K7LA 3GFIA 3E3VA 3TNQA 1J58A 5KK1A 4RB3C 4IRIA 1HKTA 1HKQA 1L0OC 3OV8A 2QWWA 5J8FA 5HI0A 2V6CA 1O3QA 1ZGJA 1ZHFA 2W84A 3IIAA 1DZRA 4HF1A 3RNSA 1ON1A 4LD5A 2L3DA 1T0FA 4F8AA 1MZBA 4UHTA 4IHSA 4S05A 2D1HA 3H92A 4UV8A 2EA2A 3USSA 2V79A 4DNCA 3C18A 1XSXA 2PHDA 4HYEA 3GF2A 2IXLA 2O1QA 3KFWX 4FBFA 2K9ZA 4HX8A 2EA7A 3TNPB 4IETA 5K5RA 4MQVA 2AS5F 2A6HF 3IWFA 3FFQA 3C3VA 2R7FA 5BS6A 5KVRA 1XCVA 2QZ8A 1BI1A 2P6SA 5H20A 3LA3A 1QY4A 4FAHA 1K78B 2PBIA 4KWKA 1RI7A 2F5DA 3U9GA 4HF2A 5LLQA 2WWYA 2V1DA 2ADUA 2EFQA 4X6RB 2CFXA 2XLFA 5FGMA 5I93A 1TTYA 4AIKA 4RAZA 1RL3A 3DPTA 5FQ0B 3OOPA 2ISYA 4EM0B 1MJAA 3HSRA 3K1NA 3KLNA 4U88A 2QQ9A 1SD5A 1BN5A 2XAQA 3RPQA 1FX7A 1YO5C 4AXOA 4HBNA 5I0UA 3RKXA 5E8IA 3EQLF 3QU6A 1CAWA 2EA4A 5AVPA 3U11A 4WBBA 4MX3A 3FX3A 4EM2A 5D5WB 2YU3A 1H0MA 3TQNA 3HOTA 1XGMA 2C0ZA 1XSDA 1XE7A 2EFNA 3DV8A 2ET7A 3BJAA 2PI0A 1Q43A 4WXDA 4D7TA 1PUEE 1UFMA 4UNOA 2O61A 3ERED 5DEQA 5CVIA 4Z2YA 1HQCA 2DO7A 2PMHA 3JAMK 1Z9CA 3EQEA 1WI9A 3ZQ7A 3I59A 2Q0OA 5F6FA 5ILUA 3COAC 4I09A 3BDDA 3WTZA 2PFBA 1QWRA 4M6XA 2YSRA 4R79A 4HVQA 1QNTA 1F1ZA 1IPJA 2CSOA 3CDHA 4KU8A 1FC3A 3EBRA 3BZ6A 3V7SA 3FXQA 3D0JA 4I98B 4XSXF 4XFAA 2CW0F 1J5YA 1LEBA 5JHUA 3MYXA 1OD5A 1D8JA 1Z05A 2IC1A 5KHIA 3WGHA 1NZCA 3CO6C 2BNMA 4AVBA 4JK1X 2VE8A 2FRHA 3FZ3A 1X82A 1K78A 3BB6A 1FP2A 1IF1A 1FBQA 3L9FA 4HLTA 2BV6A 3ZDSA 3HHGA 3QRFF 3EJKA 2IJLA 2VOPA 3UKTA 2W57A 1BM9A 3GXOA 3M8EA 5L3EA 3S7IA 3K2ZA 2P7CB 4ONUA 3DKWA 1X8EA 3JW4A 2PLYA 1ZG3A 2B8MA 3VEPA 1OYWA 3W6KB 3DN7A 1B1BA 4CDGA 1XE8A 1Y9QA 3BWGA 2XKOA 3V4GA 1U5TC 1PP7U 2D5HA 4NB5A 1ZRFA 4MEXF 5IT9Z 1B9NA 3IRRA 3JAMZ 5KHKA 3GEZA 3ZN1A 3K1MA 3H7YA 5JSOA 1UCRA 4M74A 1MDMA 1KYWA 2JZYA 2F5CA 1CAUB 1LR5A 5FLXK 2W24A 1Z91A 1SD6A 1P6RA 5DYMA 1RGSA 1CAUA 1MD0A 3LQRA 4PGHA 1JHFA 1K79A 3I0TA 3WW3A 1EPZA 2HKXA 4YFKF 1QBJA 4YNIA 4AWXB 5C8WA 4B29A 1J3RA 4HVOA 3IWZA 4L0YB 3ISPA 4GO1A 3DQVC 1X8MA 4LLGF 2E1CA 4LUMA 2RKHA 2EFPA 5JVTA 4KNYA 3E5QA 1I1SA 1R5GA 3FE5A 2PAKA 2Q4SA 2EV0A 1SEFA 4IEWA 1STZA 1WRJA 4XF4A 3LZZA 5I8TA 5AIPA 4ZZDA 2ET1A 1SMYF 4XF9A 1XMAA 1R1VA 3BPXA 2MBFA 3V7RA 4LLOA 4U0WA 3CUQC 3WTTC 4BQAA 4N9HA 1B4AA 4UUVA 2OA2A 4RB0A 1U78A 3ZN0A 3OTFA 4ZYDA 5CJ9A 4LEJA 1QGPA 3NSTA 1PDNC 3JSPA 3I4PA 3WU1B 3O14A 4KICA 2GIVA 3NEUA 4LB5A 4OIPF 3I5UA 3R6SA 4GYIA 3JSOA 1DUXC 4IEYA 5FLXZ 3TKYA 1ON2A 4IEOA 2PYTA 3M70A 4O6JA 2FA5A 2HWVA 2MC3A 1Q1HA 3J81Z 1R36A 5DD8A 2K4JA 2FU4A 3F6VA 1XGNA 4DINB 2O8QA 3U2RA 1P92A 2VQAA 1HW5A 4YIFA 5LHIA 4Z07A 2EFOA 1FBSA 4WVZA 1CAXB 4YSFA 5HLIA 1GXPA 2VBYA 5FD6A 4HX7A 4XFIA 2J5PA 3LSTA 1CAWB 4L2NA 1REPC 4WXHA 1XGSA 3GLXA 1YFWA 2H27A 4JVAA 1TBXA 2ESHA 1H9TA 2RNJA 1WQ2A 2MA3A 5ILSA 1W7PD 5LHGA 2IVMA 4M73A 1H1MA 5HVQC 1LJ9A 4O5VA 3RKWA 3SHFA 2L4AA 2Z5UA 4OIOF 4MZUA 2ZMEB 3KEQA 2UYBA 4KIFA 1RZ4A 5D5XB 4Y15A 2DK5A 1X3UA 2K02A 2P5LC 1U6GA 2BNOA 2BGCA 2I45A 2DTRA 4KYWA 2P8TA 3CEWA 1YQAA 2GA2A 3M1EA 1XN7A 4ZYGA 4QWQA 1JE8A 2DQRA 3U10A 4P96A 1U2WA 1ZVFA 2JT1A 2Z9OA 4XETA 4OFGA 3UKNA 3HRMA 3L2HA 4A0XA 3J80Z 3RYPA 4UV9A 1ONVA 4JV4A 1S6LA 2FBIA 1VTNC 2QLZA 1X7NA 4UBHA 3FHZA 4LFUA 1J9IA 4S04A 4ENMA 2B9UA 3F72A 1YHFA 3ELNA 2XRNA 4CZZA 3QACA 4ESBA 1C0WA 1WWXA 4XLNF 5D5UB 2Z69A 3O3KA 2J5OA 2GC3A 4M72A 5FB2A 1HSTA 3ZMTA 2QVOA 2Q0AA 1ZYRF 3NQOA 2O8XA 4IEUA 3KZYA 4O9GA 1O4TA 3QP5A 4UVBA 1SFNA 3SQNA 2LF7A 5D1IA 4RGXA 2KXLA 3NKTA 2VC1A 4OIQF 1QQIA 4XEZA 1U3EM 5TJJA 3ABTA 5E20A 4G7ZF 4AIHA 2A3SA 3V7CA 5FPZA 3IDBB 3PVBB 4I7HA 4ZYEA 2VECA 2KJCA 2VBXA 2ZCWA 5HDNA 2HTJA 1YUDA 1IN8A 1JGSA 5BY5A 1RNLA 2DBBA 3QAHA 1SAXA 4KIBA 2EJRA 2Y0OA 3Q9SA 5IT3A 1WA4A 4ASNA 1OKRA 3SHRA 1E17A 1KGSA 2JPBA 4LA3A 3NVCA 3U0ZA 4WZCA 4PCQA 3I53A 3WU0A 1PM7A 4LLNA 3WW1A 2GQQA 4JTOA 5ILVA 2ESNA 2BE5F 2MLKA 3FM3A 3F8BA 3WW4A 2FF4A 4LJZF 2VC0A 4ORFA 3SZPA 3C3WA 1DDNA 2STTA 2VBWA 2IXCA 4U0YA 3IBMA 5E1ZB 1TQ5A 5E1XA 5A2QK 4A12A 2ACJA 1R58A 3WTYC 3ELKA 3EYIA 5KHGA 3ULQB 1NXMA 2K0GA 1EP0A 1LB2A 5JSRA 1IUYA 2PG4A 2D45A 2IXKA 3KP6A 4CO8A 2DCTA 2O6GE 4CICA 1HW2A 4ZYHA 4UXNA 2UY8A 1LEAA 1RUNA 1LNWA 1YWKA 1YFYA 4B8XA 5BPDA 2QBYB 1R5HA 3LA7A 1NHAA 5DUIA 3KGZA 3S7EA 4XF1A 1FYKA 3MPBA 2F5FA 3ABUA 1T98A 1S8NA 4FX4A 3HUGA 1G6NA 1NYWA 2GWRA 4YYOA 5KBFA 2BBYA 3GWZA 4KN4X 5BXXA 1F4KA 1HSJA 3U1DA 5E18F 3KP2A 4XF3A 2OYZA 5FO5A 5E16A 2DK8A 3GBFA 1VP6A 3KCCA 3WGIA 3SCFA 3KP5A 1E2XA 5I91A 1SFUA 5K1YA 4G8XA 4WWCA 2F4PA 1VR3A 3J7AO 3K1PA 1R23A 4EWDA 1LDDA 3IDCB 2CYYA 2WC2A 1KQ9A 2M8EA 4YFXF 2OZJA 1TW3A 3FMQA 2Q2EA 1K6OA 3CUQB 1Z1DA 3H3ZA 2H6BA 3PNAA 2IT0A 1LDKB 1U8RA 4PIXA 4QMAA 4WX9A 4MV2A 1OYYA 2P5VA 2W85A 4IXAA 5BUVA 1DGWA 3MWMA 5DUKA 4EVIA 3H3UA 2XKPA 4OINF 1YS7A 3IC7A 3WE2A 4IEZA 4X6QB 2LDUA 4IHTA 4Q48A 3TOAA 1DPRA 4R1HA 2MNGA 4M9SA 2FBHA 2ZMEA 1ZZ9A 2KIFA 1IN5A 3ZMUA 2M45A 4A5NA 2D2WA 3DL3A 3PFIA 2OBPA 5AIQA 1GQHA 1MKMA 2OQGA 4N0BA 3T0YA 4KU7A 4R8HA 3L00A 2PFWA 1O7LA 5J48A 2XGXA 4ZU7A 1ZZ7A 5H6RA 4WCGA 3T1BA 3ZP5A 2O0YA 4KFCA 3V8JA 3TDUC 1YFHA 1V3FA 3BPVA 4MGKE 2MH2A 1G3YA 3ECHA 1TNTA 1UCXA 5ICEA 5H6QA 1EH6A 4K2EA 2Z33A 1QXJA 4HN1A 3E6MA 4LMYA 5A2QZ 4EWEA 4HQEA 2FXAA 1QZZA 2MPFA 5D6FA 1JXSA 2Q8KA 5ICGA 2EAAA 2A6EF 1Y3TA 4N9IA 5DCFA 5D4RA 2KJBA 2FNAA 2Y75A 1FNNA 1QXRA 4G6QA 4AIJA 1BJAA 4LA2A 3RPUA 3CJNA 1R7JA 3D82A 3F8MA 1G3SA 3ST7A 4GYGA 5CYVA 4WXCA 2E7WA 1BI3A 2UYAA 3IL2A 4ZH4F 2IRFG 2VODA 5BV6A 4L18B 4XFFA 3GZ5A 2HZTA 4HZFA 1YLLA 4MH0E 4E70A 4PDKA 3KP7A 5FQ0A 5HDGA 3GW2A 2ZXJA 5I8SA 3FMSA 3LA2A 2E7XA 2CGPA 4RGUA 1LKNA 3R0AA 3N4MA 1ZZ6A 4QLCU 2HFHA 3QU3A 3FMRA 3D0SA 4XFBA 5J8CA 1CAVA 3FJSA 2D93A 5EEHA 3KZZA 1J3QA 3HQXA 2X0LA 4LK1F 1BI2A 1RUOA 3B02A 3LOIA 5JFRA 1ZAOA 4XRFA 3C7JA 4O9EA 4L9TA 1YLFA 3VODA 1BC8C 3CO7C 1R1UA 2WFPA 5E8GA 3HT1A 4I3PA 3I64A 3VOEA 2L01A 4NQWA 2VOOA 1AOYA 1SFEA 2OU2A 4M71A 1Z6RA 1WSUA 1ULYA 1XMKA 2PEXA 3K0LA 3F8NA 3BY6A 1SD4A 4P9FA 2Y0MA 1B9MA 4UVAA 3H9AA 1QO0D 3HHHA 1FI2A 1ZH5A 3BU7A 1IN4A 2PJPA 2E9QA 4TV7A 1Q3EA 3ZMZA 1IRFA 2CG4A 4ESFA 1EH7A 1ZRRA 1S29A 3M9AA 4YG2F 4QM8A 3F6OA 5K8SA 1FP1D 3DXJF 2ZO4A 4YRDA 2A69F 1HXDA 4P5OA 1USSA 4EGYA 1ZREA 2GC1A 4I01A 4MTDA 5FLJA 2LNBA 3HT2A 4PIZA 1O3TA 3HRTA 2GXBA 3ZMVA 3PQKA 2EWNA 3G73A 1MGTA 2F5EA 1S7OA 2QUFA 4Q4ZF 3H50A 4RB1A 5L3BA 5LBQA 2XLAA 3KP4A 2UXXA 2PTMA 1IZ1A 1BI0A 3OF1A 3HYIA 3J81K 2R7DA 2DPUA 4E2GA 5BMZA 2K86A 4GGGA 2D40A 1IXRC 3MDPA 2KIMA 3NL1A 4KWJA 5DD4A 2PAEA 4OIRF 4Q0UA 1T38A 3LWFA 3JTHA 1J59A 1DPUA 5L3FA 4P55A 1KQ0A 3HSFA 4EMSA 2V1UA 2H6CA 2QQBA 4JTNA 5LGNA 5HS7A 5C6CA 4L11A 1G4DA 5CVRA 1O3SA 1IXCA 2CV6A 2Q30A 4Q0VA 4KMFA 4CYDA 2DW4A 1J0RA 1UIJA 3TO9A 4HLXA 2XAHA 1GVJA 5BPXA 3V8KA 3SMHA 3ML6A 5EZWA 1FY7A 3DF8A 4KDPA 1IN7A 1ZNPA 2MH9A 1YS6A 2W25A 5L3GA 4J1WA 2P4WA 2G9WA 4M9ZA 2EVXA 4KL1A 1ZARA 1TLHB 4U0VA 1TQPA 4EROA 2NNYA 1UPIA 1NE4A 3GFMA 3M7GA 3H1WA 4MGIE 2M1BA 5D6EA 1U5TA 3ROUA 1PMIA 2GC0A 4IEQA 5K5QA 3I58A 1KU2A 4LTAA 4YFNF 5FFXA 2FOKA 2VONA 3SCHA 5K5OA 3S2WA 2PAMA 4DQ2A 1S3JA 4EJTA 4BNCA 2WTEA 5ERIA 2XASA 2RN7A 3F3XA 2P6TA 3BOQA 3V8LA 4RGRA 2FEZA 3UKVA 2HKOA 1J2XA 5CVJA 3LAPA 3B73A 3LAJA 2HS5A 1FSHA 1DGRA 1OR7A 2Y48A 4LB6B 1CX4A 5LGUA 1IAWA 3H7JA 2HYFA 3MAJA 4HN0A 3F8CA 2HEOA 4I2OA 4E2SA 4UBGA 2B0LA 3P9CA 4FX0A 2NNNA 3HTSB 4P9GA 5ICCA 2IPQX 1XRUA 3GVAA 3CLPA 3F8FA 3H8UA 4QXKA 2XAFA 5JAXA 4A2UA 2DT5A 1BIBA 3TOBA 1XB4A 4BHPA 2OZUA 1IPKA 3Q5FA 2YPRA 3DFGA 1KU3A 4OLLA 3OCPA 3CF6E 4MGYE 1O3RA 2FE3A 2FMLA 4KUMA 4ZU4A 2PMUA 1TQMA 5HOOA 2NRAC 2OD5A 2QJVA 3RYKA 4HDVA 4R52A 2QYOA 1KU9A 2Z3YA 2EV6A 1QZYA 2HDCA 4AD9A 2EB7A 4L9JA 4OU0A 4Q5SF 4ENKA 3LQQA 1CF7B 2ISZA 4CHUA 3SFZA 2M30A 2O3FA 1AWCA 2M87A 4FAGA 3K69A 3CUOA 2IA2A 4YARA 2JSCA 1I1GA 4ENJA 4EJWA 4IVNA 3VHRA 4HX4A 1FSEA 2LKPA 4PGGA 1QPMA 1UB9A 2VE9A 3W6JB 1IXSB 2XVCA 2IW5A 3ACLA 4IF4A 2RQPA 4LG0B 4EM1A 1O5LA 5E17F 2FQ3A 2UZKA 5FCCA 1ZLKA 3MFKA 4MEYF 3CTAA 3NRVA 2COMA 2FBKA 1CAVB 2RV8A 2IA0A 3FWEA 1YW8A 2H09A 4RS8A 2XLGA 3E5UA 3TDZC 1WGPA 1ZN2A 1MJBA 3AAFA 2HQNA 4CGZA 2GU9A 1D8KA 4HA8A 3ZPLA 3IKTA 4HV6A 4A6EA 4IESA 1FT9A 3R60A 3H1MA 2XV4S 5HS9A 4MTEA 2H0VA 2E1NA 5BOXA 3ES1A 2PN6A 4MHGA 4GULA 2G7HA 1ZG1A 2K4BA 2VBZA 5I8YA 4HQMA 4TLFA 2XIGA 2ETEA 1CF7A 4XF0A 3M3IA 3FF5A 1HBXG 4KMUX 3T5XA 2QCSB 3ECOA 2A5YB 3VB2A 3DPLC 3M8FA 1RTVA 5T3NA 2Q1ZB 1TW2A 4MGZE 2PQQA 3SZTA 4GXOA 4LUKA 1G3WA 5HS8A 2DLLA 4HBLA 4YIIA 4HF0A 3GX4X 1B6AA 4EWAA 2IXHA 3N97A 1YFUA 4IEVA 3D5LA 3PLQA 2OZ6A 1XDUA 1Y0UA 1UW8A 1OI6A 3KE2A 2ZFWA 2VXZA 3C1DA 4RGSA 3F23A 2RGVA 2EV5A 3CUQA 1U5TB 1P4AA 2IP2A 4U7BA 4PZJA 3HOSA 1SD7A 5L3DA 1A04A 4Y13A 1SQ4A 1VJ2A 4EJOA 3R4KA 4JQFA 3T8RA 3FHIB 1O7FA 2L54A 2ZJ2A 1ZZBA 2GA1A 3RZZA 2QVSB 3I59B 4I02A 4RB2C 3FM5A 1T6SA 1W7PB 5E1RA 4LULA 5KHJA 1V70A 2XL7A 2HGCA 3NJZA 1CGPA 5LEKA 1J7KA 2V9VA 6PAXA 4G6DA 2QENA 3FXRA 1NE6A 3FZVA 2VPVA 2Z99A 1OMIA 2CQKA 3WTUC 1YW7A 3MQ0A 1KA8A 5KHHA 5FD5A 4U7DA 4LGWA 1FOKA 1W4MA 5LHHA 2DI3A 1FBUA 1KU7A 1EY2A 3TGNA 1Z7UA 3E6DA 5TRDA 4MGRA 1IRGA 1RIOH 2ETHA 4BAYA 4UXAA 1LQ1A 4OMZA 5HLGA 3GUDA 2PQ8A 4E2QA 2QNKA 3EHKA 1ZRCA 5HLHA 1J75A 5FPXA 4Q0PA 1R22A 5CVUA 1P4WA 4AVCA 4XFGA 3I54A 3R0JA 3KSCA 3GFLA 4AVAA 2XAJA 4ESJA 3E6CC 4XFHA 1TQIA 3BCWA 2TDXA 2JPCA 2HOEA 3BROA 3MEXA 3HTUA 3F21A 4KWLA 4QX5A 1K7AA 5J7MA 4H0EA 3RIRA 2FQPA 2FNPA 4Q0QA 1ZZ8A 2MLGA 2FSWA 2ZNZA 2HQRA 4ZU5A 1D5VA 2N7GA 2UY9A 3HRUA 3VFZA 1JUHA 1OPCA 1XSVA 4META 2V1XA 5E1WA 2DFIA 4M6YA 2IA1A 5LRRA 1I27A 2A61A 1DP7P 4G7OF 3OD0A 2ZKLA 4M9XA 3WODF 4IRHA 4OOIA 2M5WA 2CAUA 2ELHA 4BIFA 3REOA 2KIUA 5ED4A 4HOBA 2D5FA 1ZLJA 2PA7A 5CU1A 3HIFA 3T8TA 5D4SA 4EJVA 1YTYA 4D0PA 3GFJA 1YG2A 5DV5A 1I5ZA 2NAZA 2HTSA 3PQJA 4Y17A 2YX4A 3IRQA 3J80K 1ZRDA 5I0RA 4L5JA 5JCTA 2QM3A 4IJAA 3GYHX 3MZYA 4AQ6A 1OYIA 3TO6A 5F1RA 1BC7C 2WV0A 2R3SA 5JSPA 2EK5A 5D5VB 2JTVA 4MQ9F 2NYXA 4D7SA 1Z6TA 2C6YA 2P17A 4K8FA 4A0YA 3KGLA 2GH2A 1FZPB 4L5IA 3EETA 4HSLA 2RDPA 4I0BA 3O2PE 4GCVA 4BHCA 4Z82A 1D3YA 2OAZA 2A68F 2HJIA 1IN6A 1WKMA 5ICFA 2DPDA 3EDPA 5I0TA 4HMZA 3EUHA 4FT8A 2ZNYA 1R1TA 5JR7B 3HRSA 5EFUA 2XL9A 1FLIA 1FPQA 1ZZCA 1J3PA 4AQ2A 1HKSA 3BALA 1LDJA 4A5MA 4UVCA 5LRSA 4Q0SA 2JRTA 1OFNA 4QGNA 1BOAA 3L09A 3KEOA 4QGMA 5FFZA 4ZZLA 3BJ6A 2YR2A 1L3JA 3L2CA 5AONA 2BEOA 2XAGA 1F5TA 5J3UA 4EJUA 3L7WA 1RC6A 3MCZA 1GQGA 2VT2A 3K9TA 4IEPA 4G94A 4LG0A 1GXQA 3WW2A 4LK0F 1LVAA 1EYBA 3RJPA 3E97A 2XROA 4BYYA 3LAGA 2KRFA 5LGTA 1EV7A 3I71A 3R61A 2ZBKA 3BJOA 4IPAA 5FDBA 4MNUA 4WK8F 3I7DA 5L3CA 3GYDA 2OQRA 4AVPA 1ZG5A 2IXJA 2LF8A 1FWZA 1XDSA 2BYVE 1W5TA 2QQAA 3SXWA 4CXFA 2YX7A 2O03A 1B59A 2G7UA 3BPZA 1USTA 4RAYA 3GO5A 1XD7A 1W5SA 3BP8A 1PP8F 3E5XA 4HVRA 2HYGD 5LEJA 3KLOA 3DEUA 3LFKA 2ATFA 2FMYA 1KYZA 3QP6A 1Q5OA 4HAMA 3SXYA 1BBYA 2X4HA 2RC4A 1JHHA 2B5HA 1BIAA 1ZX5A 3JZVA 3IKVA 3F22A 4OMYA 5D8KB 3CLOA 3RYRA 4L9VA 2P5KA 4EGZA 4HSJA 3HSEA 2VN2A 3GZ6A 4BHBA 4FHTA 1T2KA 1WLTA 2P7VB 3EYYA 1EH8A 4A6DA 2ZKZA 4P9UA 4HLYA 1FXZA 3QPTA 3KMHA 1KQ8A 2UXNA 4KN7X 2H94A 2F2EA 1YW9A 2CO5A 2Z2SB 5JI6A 2D1VA 1S7AA 3WTWC 2XHKA 1UHMA 5IT9K 1UHWA 2STWA 1XCBA 4EV0A 1UIKA 4HW0A 4G9YA 1H9GA 5BQTA 1LRHA 1FYMA 3P9KA 3G7DA 3O6BB 3WG9A 4ETSA 4F7ZA 2QDRA 4Q29A 3WTVC 4XBFA 3RI4A 4PJYA 2EFWA 2GXGA 4QGLA 3H1YA 4WF2A 1W7PA
chains in the Genus database with same CATH superfamily
4CZCA 1UD1A 3W2AA 4CP2A 4HPKA 2P6CA 5GPAA 5LD2C 4FFIA 1XGOA 1V5EA 1VLNA 1DZTA 3KETA 4FPJA 4L0ZB 2HH9A 3FXUA 4ANJA 2ZXIA 2GC2A 5A1LA 2EILH 5TSWA 3V56A 3RDIA 2KZGA 5DDGA 1UOGA 1M4WA 3ZMDA 2OA4A 4QIWN 3ES4A 4B09A 3QPLA 5FKNA 1UY4A 1OPOA 5CEHA 4NJ4A 4N90A 3LSKA 3POEA 1CN1A 2I5UA 1F31A 2QQVA 1SLLA 3ZQIA 3BN6A 3UNGC 4NHXA 3U21A 3T2PA 3MF6A 2GAUA 1QJY3 3HD8B 3FBIB 5FRMA 4A0ZA 4IRGA 1A31A 4BXUA 2AEYA 4FE4A 1O5UA 5FY0A 2DAOA 5FLIA 4PDWA 4NVPA 4J19A 2C1FA 4EQQA 2CWEA 4N43B 4Y4RA 4LBMA 2ZGUA 4OHWA 2VU9A 4NHJA 3DBLB 4H7LA 5EHDA 4CA9A 4GALA 5FJKA 4QM9A 3MKLA 1Z7S3 4KT5C 2BP6A 1FIAA 1UL9A 3TO7A 2KKOA 2F4IA 1UU4A 2V09A 3FK6A 1P2FA 3G3ZA 3Q9VA 5FYIA 5H9SA 1MS9A 2UWCA 2W1UA 3IDAA 1GZCA 1YJ9I 4YVSA 4W6YA 3T3YA 5CQGA 2V73A 5GADJ 2XAUA 3ETQA 3OY8B 3ABLH 2CWSA 2IXIA 1LVKA 4LIVA 4E7SA 4QD2A 2JG8A 3VBHA 4YVSC 3L2VA 3E3VA 1JOBA 1PX4A 3TNQA 4IHVA 1V6MA 3UV9A 4IRIA 3LSEA 4QPGC 2DTZA 5FMCA 4MGTA 2V6CA 3PTRB 1MMNA 1ZGJA 1XTAA 4YZ5A 4IE0A 4BE0A 3FFZA 3RNSA 2A6YA 1W8NA 5A1AA 4DQAA 3CMAI 1MZBA 1GZTA 4S05A 3BPSA 3AXDA 2H8RA 3DXTA 3H92A 5EPAA 1CZSA 2EA2A 2ZHNA 4SBVA 3GF2A 5GZEA 4ZY9A 2QQOA 2PJRB 3VDCA 5KWRA 2K9ZA 1X19A 4G12A 3T1MA 4MQVA 4YFZA 4OHXA 2Y60A 3HOWJ 5KVRA 3ZQFA 3WQ1A 1C8NA 2P6SA 3ZQGA 4FAHA 1K78B 5CFCA 5FZMA 2PBIA 3K46A 2R062 4HF2A 3FBMA 1U8BA 3PIJA 2DFHA 4BB3A 2WA4A 1NTCA 1DGWY 2L9SA 3WY6A 3GDBA 2JDYA 4BLIA 4NIHA 3HSRA 4DUVA 5LBBA 1J83A 2XAQA 2BHZA 4OI2A 4HBNA 3EQLF 4D7NA 1Q56A 3MIGA 4UAPA 3WLUA 1MACA 2YZ4A 1NZIA 4BQOA 4MX3A 3FX3A 1H6XA 2XXZA 2RMU2 2E19A 4EM2A 3MW2A 2X09A 4N7IA 4YELA 2TBVA 5LK5A 3N9NA 4WM8A 3BTYA 1Q43A 2GMPA 3FHQA 4Q8LA 4D7TA 2XB6C 1HQCA 2C9KA 2PMHA 1Z9CA 3EQEA 5F6FA 3AKTA 3PUBA 3RZDJ 3WTZA 2C4XA 1DQ4A 3N7KA 1QWRA 2XF6A 4M6XA 1D4M2 4HVQA 1QNTA 1YQCA 1F1ZA 2CSOA 4KNCA 3CDHA 3ZFFA 4LO6B 1UYPA 4II2A 3OD4A 1LTEA 4XLAA 3WP3A 5A6ZA 1BR1A 2CW0F 1LEBA 1GICA 4DXSA 1BK0A 3SFIA 1Z05A 4S2FA 2IC1A 5KHIA 4QPGA 1NZCA 1ZBE1 5FYSA 4OAZA 2KIQA 3USUB 1VRH3 1JN2P 2VNVA 1V9U3 5GAGJ 1X82A 4LO7A 1RUG1 2HYJA 1IF1A 3L9FA 4HLTA 5CAZA 4M0NA 3UKTA 1GUUA 4M3BA 4N8MA 4AVSA 4MGSA 2R0QC 2DJNA 4EE2A 1VBB1 3O1VA 2B8MA 3F95A 3OIPA 3DN7A 2RG4A 1B1BA 1CQTA 1R5ID 1Y9QA 1YCIA 1BMV2 1U5TC 3O1OA 2D5VA 4DYRA 1ETWA 2D5HA 1ZRFA 5L19A 1B9NA 3IRRA 3M07A 4P9LA 5KHKA 3CJIC 2PHRA 2QQWA 3RWNA 1MDMA 1WLDA 1QMJA 4QPIA 1GBGA 1ETKA 1DYOA 1UAIA 1Z91A 1ENXA 3ZR6A 1P6RA 2JXAA 1OOPC 2KP6A 4E4ZA 5LA1A 3HN3A 1B35A 3LQRA 4PGHA 3I0TA 1YJKA 3WW3A 3MBWA 3AFGA 2HKXA 2B4KA 1CPNA 1RUI1 4GFBA 2AC1A 1D0XA 2R7VA 5C8WA 2ZZQA 5FWEA 2HXIA 1W6MB 4ET7A 3IWZA 3ISPA 2JDPA 3NRUA 4TSVA 4JGYC 4LLGF 4NBQA 3BKZA 4LUMA 2BXYA 2EFPA 1O6UA 5FZ1A 1I1SA 1I39A 2G9GA 2KQRA 4XBNA 1XNAA 4IEWA 2Y6HA 1XE0A 5I8TA 2IBDA 5AIPA 4ZZDA 3VDAA 1SMYF 1OA3A 1XMAA 1ULGA 1U0AA 2ADEA 2Y26A 5FXVA 3OG2A 1I3QJ 3OR2C 1B09A 4Q5OA 4JP0A 5A3NA 4BQAA 2VASA 2P2KA 4UY8I 4Q2FA 3ABZA 4W50A 4F3JA 5FBZA 3GALA 5FZCA 4L97A 1QJU3 1V6LA 4Y20A 1SCSA 3NSTA 3GJBA 2H1KA 3O14A 5D8AA 4I0WB 4LG3A 4Q1RA 2E34A 3TN91 1DUXC 3TKYA 2PYTA 1ASJ3 3MV01 4V1PA 1OCPA 2RJ2A 1JKOC 4F55A 3ZXEA 1Q1HA 2RREA 3VBFA 1D1BA 1NG7A 1XGNA 4O61A 1X1CA 4A3MJ 4ZJZA 2AENA 2ELJA 2L9VA 3MIFA 4YIFA 1TZLA 1XJAA 1YI7A 4Z07A 3CZUA 2TCTA 1CAXB 4K21A 1NQDA 5HLIA 3TEDA 3ZKYA 2VQ0A 3J9SA 2YS9A 5FD6A 4AAPA 4NIDA 2JA8J 2DFFA 4XFIA 3LSTA 3POBA 1CAWB 4L2NA 3DTIA 5GPCA 4LO4B 1TWFJ 3GLXA 4NN0A 1YQ2A 3RMYA 2W47A 3WF1A 2H27A 3ZKUA 4JVAA 2LH9A 5JPMB 1UKGA 3B01A 1H9TA 3C8XA 2RNJA 4B43A 1OURA 5ILSA 1LECA 1VQMI 1RUF1 1LJ7A 5FP4A 4KMQA 1DP0A 5FOBB 2L4AA 4MZUA 3KEQA 3VBSA 2HWE1 4JZRA 2VM9A 2DK5A 1X3UA 1ULDA 1X4OA 2P5LC 5ACA2 2NPIA 4KG0A 1YQAA 1W6QB 2VW0A 3HN1A 1XN7A 4Q4W3 1JE8A 3QH7A 5FMOL 1W3XA 2K9QA 1VZ0A 1I6HJ 3BR1A 3SEPA 1U2WA 1ZVFA 2CWMA 2JT1A 2Z9OA 1XYPA 2R043 3I4IA 3OGSA 4OFGA 2X85A 1V5GA 3RYPA 1QJY1 2BJSA 2QLZA 4UBHA 3GCXA 3VKNA 4AM3A 3ON7A 5DUWA 2JIJA 1BR4A 1V6IA 1J9IA 3WNLA 4ENMA 3K70D 3ELNA 3M4FA 1C0WA 5DM6F 2WA0A 2VLAA 1HSTA 1C57A 3BR0A 3HGYA 2QVOA 2RE9A 4B7EA 2O8XA 4RLFA 4IEUA 3POSA 2UWBA 1X1BA 3ZYJB 3QP5A 4XCBA 3SQNA 2LF7A 5D1IA 1IGOA 4ZYAA 4K6BA 1VBE2 5F8PA 1QVUA 1SG3A 3V7CA 2DU0A 1OLME 2VECA 3O5SA 1MS5A 3FLTA 2JG9B 1MS8A 3PSFA 3RJRA 3KS7A 5JMOA 3VDBA 4JX5A 2DYSH 2EJRA 2Y0OA 3B7MA 3Q9SA 1QJU1 4CRQA 3SHRA 2A5ZA 4LA3A 3NVCA 4WZCA 3I53A 2XWJB 4DPNA 4HK8A 4JTOA 3THDA 3FM3A 3WW4A 2FF4A 4LJZF 4PHZA 2R5ZB 5AVAA 3NNGA 2VBWA 3IBMA 3MD2A 2YDEA 1NXMA 4LKDA 4LOTA 2K0GA 1LB2A 4CDXC 1IUFA 3VBOC 2E1MB 4AEDC 3KP6A 4PSWA 1HDKA 2DCTA 5CFCC 4NNJA 1QH6A 1AYN1 1R083 5FV3A 3J7YJ 1LEAA 4XPVA 1LNWA 3C7GA 1YFYA 3ZXSA 4B8XA 5BPDA 2QBYB 4P9IA 3ALQA 1DQ2A 1R5HA 1D2QA 1FV2A 3ECQA 4ATEA 4P02B 2L2OA 1FYKA 3OYLA 2F5FA 3DLAA 2JWTA 2O5RA 3IPVA 2LS6A 3IN9A 4JRLA 3CCMI 5IATA 1R71A 4FOQA 1QVTA 2GWRA 3LDBA 4YYOA 1H9WA 2WSUA 1KDMA 3FMGA 3LSJA 3KP2A 1SVLA 2LREA 2JA2A 1VE0A 4AI0A 4OVEA 2VOXA 1ONAA 4D6QA 2JDAA 4NDLA 1E2XA 3VKMA 1XPWA 4WWCA 2F4PA 2OF7A 2JVGA 2JB4A 4XLFA 1R23A 4EWDA 1KQ9A 2OZJA 1S0CA 3CD6I 1GOHA 4CCCA 2X5IC 1V00A 5GTIC 1GP6A 5BNPA 2MW8A 1N25A 2ZBJA 1BEV2 5EJZB 4CCJA 1DYKA 2P5VA 2W85A 1HDPA 2NN8A 5DUKA 4EVIA 3FKIJ 2YU2A 3OYKA 3WE2A 2ZGOA 3T08A 1DU3D 1QU0A 4IEZA 2W7NA 3TOAA 4R1HA 2MNGA 3LL7A 4V2FA 3KHBA 3ZMOA 5J37A 4BDVB 3IAS2 4BDYA 5IVVA 3QWLA 3DL3A 4P5HA 2ARBA 5A3UA 1GUIA 5AIQA 3LFMA 1MKMA 4IOCF 5EIYB 2KDOA 2KL4A 2WB1A 1BR2A 2ZX4A 3S3OA 4UYBA 3C2GA 4WM8C 2FZ2A 5J1XA 1DIWA 2WFF3 4S0HB 2O0YA 3ASNH 2ZB9A 1FTZA 2P0WA 1V3FA 3BPVA 1JYIA 3PFYA 5C3RA 5DN2A 2IS6A 3E6MA 5A2QZ 5A3LA 5IK5A 3J26N 1Y1VJ 2Q8KA 5JVVA 1I1EA 5KXBA 1U9OA 1W6PA 4FQZA 3LD8A 4N9IA 1FNNA 5EEAA 4G6QA 1XX5A 2QSFX 3ZOBA 2WABA 3CJNA 4MLOA 5B1BH 1RUI3 2XB0X 1PUFA 1K61A 4GYGA 5FRAA 1HKDA 2UYAA 3KYCB 3UR3C 4ZH4F 2DFCA 2VODA 1QJX2 4L18B 1TNRA 4GWIA 1G86A 2YROA 3ABKH 2HZTA 2M3AA 1YLLA 5FQ0A 5HDGA 4NAOA 5I8SA 4Z6YA 1Q8SA 1H89C 2RR12 1LKNA 3ZYIB 2BBAA 1VBA1 5EV7A 1CAVA 2D93A 4QDQA 4LK1F 4BE3A 3WXPA 4RA2A 4UW6A 4L9TA 1YLFA 4MADA 3VODA 3I3MA 1R1UA 5E8GA 1Z3YA 2RV9A 4I3PA 3K4JA 1SZBA 4D1QA 2XBO1 5L9RA 2L01A 2VH9A 1SFEA 5LA9A 1V55H 2ZEWA 5FBJA 1ULYA 3CIHA 3F8NA 1JJ6C 3MKWB 1ZBE3 4PBPA 3N35A 5FJ8J 1Z7S1 2A1XA 1MPXA 3H9AA 4ASKA 1FI2A 3ZXKA 1IN4A 2BW3B 4QQ2A 4MFDA 2JQ7A 3QLQA 4RQPB 3WNNA 1BJQA 3DF0A 5K8SA 2UURA 2W48A 5AC91 5DM7F 1HC8A 2VPLA 3ZRGA 1HF0A 4P5OA 3WQ0A 1EUUA 1USSA 3ZSMA 2WADA 2E31A 4XC9A 4MTDA 2KHMA 1OH4A 1AR81 3WG7H 1T33A 3G1OA 2EWNA 2JDUA 3AZWA 1AUYA 1RXGA 1FMD1 3J7AY 3LCPA 2QQMA 5LBQA 1LOBA 2L7ZA 5ABJC 1V9U1 2OIIA 4Y4YA 3VHOA 1ZBA2 2A6XA 3D5SC 2PTMA 3OYAA 2XHNA 3KWVA 2ZFUA 4WM8B 5E3NA 2WZR3 4ZXKA 2DPUA 1VBB3 4EZ4A 2JB8A 5HCFA 2ZJRF 3JRBA 3HEFA 4A3GJ 3GGLA 3NAUA 2ADDA 1QU3A 2Q1FA 4Q0UA 5IY5H 1T38A 4CCMA 3JTHA 2L7KA 1KQ0A 3HSFA 1ND3B 5TGTA 2FCTA 3IM0A 3UJOA 4JTNA 5HS7A 5C6CA 1G4DA 1O3SA 5DG2A 1OFCX 3J8F3 4C2MJ 1U0JA 1FMD2 2BFUS 2A3WA 1UIJA 1P8JA 1SDDB 3O0XA 3DU6A 4QWNA 1QA6A 3G4SI 3DF8A 1ZNPA 1YS6A 4J1WA 3AG3H 3OSGA 1ZARA 2W95A 1PVXA 3K4DA 1UPIA 3E1F1 4XQDA 1JZ4A 1RUD3 2Q8OA 3WG4A 3H9GA 3M7GA 2WLQA 5D6EA 5T50A 1DG6A 5FYBA 4EEFG 1NY71 4URTA 1PMIA 2JRMA 3LSRA 2GC0A 4IEQA 3BIEA 5K5QA 3LE0A 4LTAA 3S1MJ 2IXSA 2DUQA 2FOKA 4A93J 4DYCA 1QOTA 3PURA 3S2WA 2YFUA 2O8OA 5F2WA 4BNCA 1SPPA 1W8OA 3WD5A 2XASA 4HG2A 4IOAF 2P6TA 1V6KA 4YZ2A 4MIMA 5F0CA 1PZ9A 5IVBA 2I8DA 3BC8A 3R05A 3MHZA 3LAPA 1OH3A 5M0TA 3KVAA 4UF0A 1NCRA 1DGRA 2ZGRA 1CX4A 5LGUA 1IAWA 1HX6A 4XJAA 2OUMA 2W0XA 3NAPC 4LKFA 2V1NA 3IMMA 4UBGA 1W5CC 1WJDA 4FX0A 1MZFA 2NNNA 2WQ8A 1Q1VA 3HTSB 1WLCA 1AVBA 4A3FJ 2JG9A 2B39A 4BKXA 1XRUA 3TEWA 2DVAA 2W3JA 4BM8A 2FCVA 3CLPA 3CCVI 1YRNB 2XF5A 3TWIA 2XAFA 3AL0C 3ZDVA 2DFEA 2J1VA 2R072 1TWHJ 3BTZA 3K2AA 1IPKA 3DFGA 2JN6A 1OKOA 1YI9A 1KU3A 4Q4X2 1ODNA 2HWD2 5D21A 2VOWA 1K5JA 4QKNA 2NVYJ 1QJZA 2PMUA 2W00A 3EXUA 1DQ1A 1EV12 4A3ZA 3RYKA 1OUXA 2ZZJA 4QPOA 4IL7A 4Q4Y3 1E5HA 1QZYA 4ENKA 3B6CA 3WT3A 2BERA 3LQQA 4CHUA 2XSDC 3C7EA 3SFZA 2M87A 1PYVA 2VC9A 3K69A 3ITQA 3PUQA 1KXGA 1I1GA 3PJRA 4EJWA 4IVNA 3K4AA 2VJXA 1FSEA 2LKPA 3DKQA 4PGGA 2X1DA 3B00A 1UB9A 1IXSB 2RQPA 4EM1A 3GJAA 4OI4A 3K2OA 2LBFB 4MEYF 1SBDA 3EUHC 2COMA 2FBKA 2XVKA 5C8CB 4AU7A 1OKQA 5IK4A 5J40A 4EN6B 3JD71 3PJQA 1RETA 2KD7A 4K8RB 3J8F2 3AAFA 4V2VA 4GKXA 4IHYA 4CP0A 3ENRA 1N75A 2WN2A 2DCEA 2HWB1 2CQ7A 3IKTA 4OUSA 2GALA 4IESA 1FT9A 1R1A1 4MTEA 4YVWA 5BOXA 2DMPA 2PN6A 4GULA 1ZG1A 3TN93 3VKFC 2CH0A 3ZXFA 2R1DA 3DCFA 2VZ3A 4HQMA 2QSGX 4JKLA 3V0AB 3LDKA 3FF5A 1SFKA 4QB1A 3T5XA 3ECOA 1B72B 1BBT3 5A33A 5FR3A 2LD5A 4M4RA 3UGGA 4NIIA 1W9TA 3CJIA 3DTKA 1QJX1 1VBD2 2Q1ZB 3SZTA 5EP9A 3I2OA 1YNAA 3ILNA 5FY8A 4CDWA 2DLLA 1PVEA 3H42B 3Q8AA 4OI0A 1ZTRA 3TAYA 4HPQA 3N97A 1XYOA 1H8TB 1YYNA 3D5LA 2OZ6A 1UW8A 1X2NA 3KE2A 2AQEA 4GJYA 4IE5A 3CZ6A 2MSYA 1U5TB 2E32A 3AC0A 3OEAA 2XC7A 5T52A 4AGRA 4ISQA 3I49A 4EJOA 1OQEA 4A3DJ 3A0NA 1GV2A 2GA1A 3P1IA 5FUNA 2G1MA 5KHJA 1SHWB 2HGCA 1RUG2 1U5IA 6PAXA 2AQFA 1WHUA 1PZ8A 2VPVA 3VBHC 1YW7A 1S0DA 1W4MA 2DI3A 1KU7A 2NMOA 1IRGA 4MGRA 2DCYA 1UAAA 3RRDA 4AI2A 4D3WA 1PX3A 5JPNB 2PMWB 1WH7A 4BAYA 3BIWE 4CU6A 1LQ1A 3AKPA 1RUE2 5HLGA 4RBOA 4E2QA 1PGL2 4Y1XA 5LY1A 1E5RA 3E0JB 3H5AA 1CJPA 2LLKA 3CC4I 2DMUA 5H9PA 2Q8EA 3FBYA 3R0JA 4YW4A 5K0UB 9ANTA 4JOMA 2XAJA 3HOYJ 2GOMA 2HOEA 1TT0A 5FY4A 5J7MA 4Q0QA 2FSWA 2ZNZA 2HQRA 4BDZA 2M0MA 1Q8PA 4CXYA 2HWF2 3VFZA 1XSVA 4META 4RS5B 1NQJA 4XLHA 1A6QA 2AUYA 1LU1A 4M6YA 3Q8EA 4G7OF 2A61A 1BKZA 5KCMA 2ZKLA 3WODF 2A6ZA 5CKTA 1OBNA 3BQYA 4IRHA 4XKVA 2M5WA 2CRGA 2NVXJ 1FAYA 1P7JA 3REOA 2WR9A 3LFIA 1MH3A 3HIFA 3T8TA 1TG7A 1QH7A 2ZOEB 4MHUA 3S57A 3KCYA 2QGUA 2CUFA 2YMZA 1YG2A 5DV5A 2VBPA 3M3EA 1I5ZA 2NAZA 5GZCA 4HG6B 2YX4A 3IRQA 2VIXA 1AL23 4BY7J 3J80K 2E33A 2OV7A 1ZRDA 4UUSA 3DU5A 4IJAA 3GYHX 2WS92 5F1RA 4K20A 3FXMA 1WA6X 3OY9A 1W8ZA 5AFBA 5D5VB 4EYUA 3HNBM 2JTVA 1VFCA 1XSQA 1W3VA 5L36A 2P17A 1RUC2 1DQ0A 1FZPB 1AA7A 1VQNI 3EETA 2W1OA 2VZ1A 1VMFA 2RDPA 1ULOA 4WM7C 3VD4A 1MQTA 2J22A 1XMXA 4XORA 3JQXA 1N1VA 1A78A 4Y5SA 5CG9A 3BG9A 5JLVA 4XAAA 4Z82A 1VBB2 2HJIA 3F2ZA 3EDPA 2CUEA 3HBKA 2R93J 4WM7A 1MEC1 3HRSA 1U5YA 2XL9A 1UN1A 4NHYA 3TN92 1ZZCA 1SVOA 3CESA 3IZOA 2VXRA 1QQP3 4Q0SA 2WN3A 1BOAA 3L09A 4LOSA 4QGMA 1WCSA 1UG0A 5EYRA 3T0AA 2ZGPA 3L2CA 2LY9A 5IYDJ 5AONA 1F5TA 4EJUA 2KR2A 4RAFA 4CP9B 1S2BA 1LVAA 1O4ZA 1NA1C 3E97A 3BOPA 1YRNA 2B45X 4CDQB 3CCQI 1XXNA 3R61A 3W5NA 3HR9A 3WEZA 4L5EA 3AXEA 1OQDA 2IFWA 1UMIA 3VBFC 4EQVA 4MNUA 4ZZ5A 3K4LA 3I7DA 3GYDA 4AVPA 1ZG5A 3UESA 3OS2A 2HWD3 3B9IA 2MEV1 4V2GA 3GO5A 2QQIA 1PP8F 2MEV3 4HVRA 3KLOA 2DA1A 2FMYA 4Q4Y2 3PTYA 3RSNA 5K7ZA 4NHLA 1BIAA 1RUH3 3JZVA 3CLOA 4EGZA 4HSJA 3IAM2 2EF6A 2VMGA 4FP3A 4FHTA 3CCEI 3EYYA 1WLTA 1NG0A 1AR62 2J1TA 3LF7A 3JRDA 1JS9A 4FI9A 4QXBA 3CLQA 4C8DA 3QPTA 1S0EA 1IKPA 2UXNA 2H94A 1JUPA 1YW9A 5F5CA 5CA6A 1K42A 1YX5A 1PHMA 3PVOA 2VZVA 4J01A 4D7YA 5DQ0A 1UHWA 5HXMA 1LU2A 4HW0A 2JEMA 1XU2A 1MBKA 2NZ9A 1LRHA 1FYMA 4NAMA 2ZPXA 3H3VK 1LODA 3G7DA 3H3LA 2MEV2 2HNHA 1R1ZA 4Q29A 2WQ4A 3I3BA 3NNMA 3M3YJ 3ZSLA 3H1YA 1MBHA 5F64A 4X1EA 3BR3A 5A32A 2L5QA 4IKFA 5F0HA 4PIYA 2VKDA 1JKQC 4GA9A 1OLQA 4XIKA 4Z2WA 4A3JJ 5FO8B 2IVIB 1PIV3 3LSDA 4CDQC 4BH9A 1LHUA 3WTSC 2DTYA 1F9NA 4EN9B 5B4XA 4XIOA 3OS1A 3NQHA 3OYMA 4DZPA 1UXXX 4ON0A 1EA3A 5FLHA 4CSWA 3QOPA 5DCMB 2R7ZJ 1FJLA 2ZACA 2HBTA 4DBRA 1T39A 3AP9A 2AXTC 1VIWB 2QUOA 4XJ9A 3U1XA 4XN0A 1U12A 2VZOA 2ZKNA 3OY8A 1CAXA 3SEZA 1R4MB 3K4MA 2E5ZA 3OBTA 2A07F 2QDNA 1JTXA 3JTGA 2BU9A 4DB5A 5IUQA 1RHI3 4CPBA 2H1LA 3AJZA 1O57A 1BVP1 1SMTA 2QQ8A 1IDYA 5JDBA 4XJUA 5D8LB 5FO7B 4RGGA 3WGGA 4HNVA 4L9NA 1I3HA 3KP3A 2P3YA 3NW4A 2VL8A 3OWTA 2XJQA 1XOYA 5I0SA 3CO2A 1K3IA 1YIOA 5F5IA 4K40A 2XUBA 4KA4A 5GLWA 1JUMA 4XSZF 5CZKA 3OYJA 1UZWA 2VZRA 4YW5A 1FYLA 1IW7F 5IWFA 4CEWB 5HDKA 3U14A 5JOZA 1V6NA 2VQHA 5A70A 5EZGA 1AR93 2WAQA 5CLSA 1JTYA 3TMOA 4IEXA 3MKYB 1FOWA 4IQ4A 4KIGA 1QQP2 4GRIA 3AYDA 5EEGA 5A3PA 3WTXC 4IERA 2TUNA 1ERDA 2K7LA 1K4TA 1G9FA 4ZDLA 4LE3A 1F5FA 1OC1A 5JLWA 1J58A 1YXWA 2VJIA 2WT2A 2GNTA 1C3HA 5HI0A 4EJRA 1O3QA 1ZHFA 3AFHA 1XU1A 1ON1A 4GH4C 1T0FA 5FXWA 4F8AA 4Z92B 4RN5A 2BGOA 4UV8A 5C3OA 4IQPA 1RUC3 3S32A 1PIV1 1WJBA 4M3DA 4YLZA 3J4UH 2LY2A 2WNEA 5LCWL 4LBQA 1AXZA 4FBFA 1CD3G 2QKDA 4HX8A 2EA7A 4D6SA 4IETA 3P5JA 2GM4A 2A6HF 3IWFA 3AZYA 2R7FA 5BS6A 4AFDA 1MVEA 1A8DA 1VAVA 3LA3A 2BHYA 5SV5A 2BY1A 4KWKA 3WX5A 3U9GA 3VZJA 5LASA 2W2IA 5LLQA 2WWYA 2V1DA 4CP1A 5EJCA 2EFQA 4JDNA 5I93A 5FGMA 3T2TA 4AIKA 3WHBA 1Z7S2 3DPTA 3I97A 4ZHNA 4MXVA 5L7OA 3I55I 1REEA 5FPLA 5GLTA 3K1NA 3KLNA 4N4OB 4U88A 2WSVA 3K70C 1UY2A 4BXSV 5I0UA 3RKXA 5EDNA 3QU6A 4YEJA 1UO9A 3S8PA 5AVPA 2WNOA 4WBBA 1QHGA 2LYCA 1VALA 1AX1A 1H0MA 2XR4A 2CV1A 1XSDA 1XE7A 2X29A 2VNOA 3DV8A 2RS32 4UNOA 4FXKB 4Q1PA 5DEQA 4XCAA 4XE9A 3TB0A 3JAMK 2BGPA 3ZR5A 2G0EA 1W0UA 3ZQ7A 1K6YA 3MEPA 1S2KA 3VBUA 2CGNA 3VYRB 2YSRA 2QEXI 3JREA 2OUJA 1IPJA 4KU8A 5FKBA 3V7SA 3D0JA 3NAPB 1UOJA 3Q9OA 2B7EA 5JHUA 3MYXA 3RFRA 2LW8A 4AVBA 3DYOA 4C1XA 4YG6A 3FZ3A 3OIQA 3WSOA 3ZDSA 1JW6A 1X1PA 3HWJA 4J00A 2Q8DA 2WRAA 1SBFA 3AMQA 1TWGJ 1YITI 4NWVA 1KS4A 2G9FA 1JU4A 5LWBA 3W6KB 4XTPA 5EG0B 4CTEA 4CDGA 4U36A 4FSJA 3BWGA 2XKOA 4AGGA 3V4GA 1S4CA 3AX4A 3ZXLA 5K4LA 4NB5A 4UUTA 1XNCA 2K2SA 3JAMZ 1RVF1 1VQ4I 2AR6A 3GEZA 3ZIWA 4LBKA 1Z3XA 3K1MA 3A0KA 2W82A 3H7YA 5BYNA 1UCRA 4M74A 2F5CA 4CEYC 5B66C 3HOVJ 1LR5A 5FLXK 4TWTA 1SD6A 5DYMA 1RGSA 2QKMB 3FBNB 2XWBB 5FPUA 1OHFA 4L99A 5IK8A 2E63A 1MD0A 2CW7A 4BMBA 2R16A 1H8TA 3APBA 1W6NA 1MIJA 1X9PA 4LMFA 5H9RA 2MYSA 3WF2A 1W9WA 4AWXB 4DJAA 2WV1A 1PO12 1H2NA 3VHPA 3UL2A 4BK5A 4XM3A 3DQVC 1VAMA 2EINH 2CNAA 3VBHB 2OS2A 4M3FA 4FFFA 3LIHA 4KNYA 5JVTA 2WNVC 4ATFA 3KPHA 3HPNA 1WCDJ 3FE5A 1PO21 4AC0A 2Q4SA 5E3OA 2P3JA 2ZXWH 4XQ4A 3LZZA 4IE6A 1LGCA 4XF9A 3RZJA 3DBHB 1R1VA 2MBFA 3V7RA 3W20A 3ZQHA 1MSFC 1COV2 3WTTC 2HEWF 4N9HA 1B4AA 4UUVA 4QXHA 1O8SA 5A6XA 1RUE1 1UYYA 3POJA 1LHWA 3ZN0A 2ZEZA 4Q4V3 5F37A 5C33A 1PDNC 1OFSA 3WU1B 4FCYA 1A35A 2GIVA 3NEUA 1IRZA 2JWPA 4LB5A 3RGBA 5C4WB 4KGGA 3A0HC 2L9NA 3CDIA 3JXSA 2ID3A 3QBQA 1CIYA 5FLXZ 5GKAC 3WCSA 2BOJA 4IEOA 4O6JA 5T5JA 4TYSA 2FA5A 1HV1A 4NC8A 2HWVA 1I5PA 1U5ZA 1L7LA 1R36A 2HU9A 2EICA 4B4PA 4JX0A 2ZEYA 1OCCH 4IV3C 3HOBA 2F48A 4MG2A 3LSGA 2KMUA 2R6QA 3DGTA 1NAEA 2VQAA 1HW5A 4FFHA 2EFOA 4QU1A 1FBSA 1S2EA 1PM4A 3MN2A 2J1UA 3CMMA 1A8MA 1BZWA 4PT6A 5IYCJ 2W9XA 4HX7A 3OYHA 2A5WA 1WCUA 1IOAA 1REPC 4WXHA 5KXEA 1VBC2 4COZA 4KBBA 2E36A 2OCEA 1JHJA 1RINA 2ESHA 3S17J 3WINE 1H1MA 4O5VA 1HV0A 2LKSA 5D5XB 4NMIA 2K02A 2BNOA 4XABA 2JJ6A 1OVPA 1X36A 1VBA3 3DEEA 3NV2A 5FKOA 4X8NA 2VBDA 5FK8A 2Y8KA 5FY7A 4P96A 3OL3A 1WBLA 3FIWA 3UKNA 3RMXA 3J80Z 5DZFA 3ZMNA 3SDGA 3N9QA 1S6LA 2FBIA 2LG4A 1HXS2 1IG7A 3FHZA 1UPSA 2MC4A 3AG1H 4LFUA 5IPAA 4S04A 4IE4A 4A41A 5J36A 3F72A 1YHFA 2XRNA 4AEJA 1KGYA 5IHRA 1D4M3 4XLNF 3T0BA 3O3KA 4I99C 2GC3A 3MZ8A 2TEPA 2BVBA 1LHNA 4UOJA 3NQOA 3S15J 5APAA 1YRZA 1DU0A 1W8HA 4XTMA 4Y24A 1IGNA 4TXWA 3KZYA 2PN5A 1N3OA 2ZXHA 1NUKA 1AR73 4NHKA 4O9GA 2A6WA 4OWRB 5FZGA 3OYDA 1RESA 4FO9A 2R7OA 3BQZA 1U3EM 1SBEA 5TJJA 2JE8A 4TZDA 1DHKB 4CCLA 1GOFA 4GB32 2A71A 4XVHA 5FPZA 1QZEA 4DRVA 3PIOF 4I7HA 5BNPC 2AEZA 2KJCA 2ZCWA 4LBQB 5HDNA 2HTJA 1YUDA 2EZKA 5BY5A 2CQNA 1AL21 2B46X 3OYNA 2VUAA 2JPBA 1AXKA 2IGKA 4C9YA 4ABZA 4PCQA 3WU0A 4H4KC 4RQPA 1CX1A 4CU7A 3M8JA 1JT0A 2ESNA 2BE5F 2B9VA 2VOTA 3CHXA 3VD7A 3F8BA 3I56I 1LNSA 5A7WB 3SZPA 3VBOA 4M3GA 1KEXA 2IXCA 5FZFA 3WF3A 3HMYA 3WTYC 2X48A 3EYIA 5KHGA 3IB3A 1EP0A 3A22A 1T08B 2PG4A 2J1AA 4CO8A 4CXWA 5AC92 1Y56A 4ZYHA 3LEKA 2UY8A 1RXFA 4FPCA 1RUNA 1Z0HA 1PGL1 4OYUA 1OOPB 2WWJA 3ZYBA 5GM0A 3MPBA 4E4SA 2HOSA 1T98A 2WQZC 1ZK8A 1S8NA 2HWC1 4XDQA 2XPUA 3AMNA 2ZMNA 2R32A 1VMJA 1YX3A 2BBYA 4KN4X 1W90A 2TNFA 1UZVA 2JD9A 5BXXA 2V9PA 1F4KA 2WNVB 1HSJA 4M00A 4QPIC 5FO5A 1I50J 1VBC1 1U5XA 5E16A 3WV6A 5DZGA 5D2AA 1VPHA 3SCFA 2X5IA 4XL9A 4G8XA 3S16J 1NT0A 1ZGWA 1A6IA 2EBIA 1LDDA 1YOVB 2CYYA 2WC2A 4YFXF 1W8WA 4R4XA 4BEHB 2R92J 4URAA 3THPA 2IT0A 1U8RA 1ZBE2 3BUCA 5M5YJ 3KV5A 2M2EA 3S6PA 1OYYA 4HK9A 3MICA 4Z1VA 2LROA 1HJFA 4OINF 3BG6A 4X6QB 2LDUA 4K3UA 3B6AA 3MLKA 1W6OB 4M9SA 1JYCA 2DT6A 2DA2A 2ZMEA 1ZZ9A 1M06G 1LENA 3P3PA 4LO5B 5C3SA 4A5NA 4QQHA 1AR71 2OBPA 1AJOA 1YC61 3H0OA 4RMNA 3OYIA 1GZWA 3U4SA 4E9KA 4WVVA 2E1MC 3T0YA 4AEDB 4PF1A 3RQ4A 4AR2A 4ITCA 2TRTA 2VXDA 3HXLA 2VKEA 3L00A 4P1WA 2PFWA 3L2QA 2VAUA 1LFPA 1O7LA 3K4BA 2XGXA 3BTAA 5A7PA 1ZZ7A 5H6RA 4WCGA 4BQWA 4JC1A 4KFCA 3V8JA 1Z7LA 1ITYA 3IUOA 2X1CA 3HNMA 5ICEA 4JRAA 2X6WA 1QXJA 4LMYA 1MMAA 1F4HA 1PJRA 4E4DX 2VMDA 2UU8A 2HQAA 3H5NA 2FOWA 2FX0A 4WVMA 1R1A2 4P00B 5BNNC 5FZAA 1MS0A 2EAAA 1Y3TA 5E8AA 5ABJA 4IV3B 5FK7A 2ZGNA 5CFDB 1JKRC 4AIJA 1BJAA 1POQA 3RPUA 2QKLB 4YRVA 4CYCB 1R7JA 3H8XA 3ST7A 5CYVA 1YEWA 3R0RA 4AHZA 2QZ3A 2E7WA 1BI3A 3G2BA 4BA6A 3ZQCA 3VBFB 5BV6A 4CDUA 4R9CA 3L2YA 5C3QA 1LCLA 3OOUA 4PDKA 3SKVA 1YIFA 3FMSA 2E7XA 3BTCA 4FETA 5DUXA 3N4MA 2BZTA 4RHV1 4D6RA 1UHSA 3FMRA 1AYM1 1EV11 1ULEA 5J8CA 2DUPA 1S0FA 3GCMA 3PDQA 1JZ8A 5EEHA 1J3QA 1BI2A 3BU0A 4YZ3A 1ZAOA 4XRFA 2WFPA 4Q4W2 3HT1A 3I64A 3NV4A 2WAQN 2VOOA 1AOYA 2CW8A 1WH5A 2E53A 2OU2A 3MFCA 1Z6RA 5CKQA 2GXAA 1WSUA 2RDQA 2EIDA 1TWCJ 4XUQA 5FP3A 4A7YA 2J7MA 1T8IA 1B9MA 4UVAA 5GAEJ 2P37A 1QO0D 3K4KA 1TMF2 1UMQA 1SLAA 2BOLA 4TV7A 1N77A 1IRFA 1EH7A 1ZRRA 3RKQA 2FD5A 3P6BA 2WNVA 1ZBA1 1H2MA 3MIEA 2KISA 2ZO4A 5B2GB 1LFBA 4EGYA 3O1PA 1ETQA 1W8FA 5LFAA 1AR91 2GC1A 3BTIA 3JUUA 2LNBA 3HT2A 1O4XA 4LT5A 1LE8B 3HRTA 4A45A 2GXBA 3I2IA 1XC5A 2JG8B 2F5EA 2QUFA 2X6OA 3VPRA 4CCEA 1RVF3 4BBSJ 2Z16A 3H8RA 1UZYA 3HBLA 1YJNI 3VLBB 3PNVA 4QB6A 2XLAA 1RMU3 1C1LA 3VDDB 4XUNA 2DF7A 3OF1A 3A2KA 3ERMA 2E2JJ 1ENSA 2JG9C 4H14A 2DOFA 4E2GA 4LK6A 4GGGA 1DQUA 4KG8A 1BEV1 1MNDA 2KIMA 3LIGA 2VCAA 4BQ5A 3M1HA 3VL9A 4GH4B 4COUA 1C5HA 3ZFEA 3LWFA 4AI1A 5LW9A 4IO9F 5L3FA 1OCZH 4P55A 1ACIA 2C5DA 4EMSA 4RDUA 2V1UA 3V0AA 4A3CJ 4IQJA 1QOOA 3FHAA 1APLC 1URXA 4DO0A 3LKJA 3AMHA 3W21A 4QXCA 1W06A 1RUJ1 3J7ZI 3PVNA 2IFRA 1R4NB 5HCHA 1VRH1 1IPSA 1MS1A 3PO3J 4A3KJ 3TO9A 1HQWA 2XQRA 1KITA 1NA1B 5BPXA 4A7ZA 3IAPA 5EZWA 2EZIA 5GZDA 2KDZA 4KDPA 1IN7A 5L3GA 2P4WA 3PUIA 3BTXA 5DAWA 2EVXA 4KL1A 2EALA 5BNPB 4KT6A 1CONA 1SFPA 2NM1A 2VTFA 1DZQA 3WDXA 3S2HJ 2W92A 3RVHA 2Y2ZA 3H5RA 2V7FA 1UX6A 3VD9A 1Z78A 3GZUC 1SLBA 1POGA 3H1WA 3I2HA 1G9DA 4MGIE 5EG0A 1OLTA 2DDBA 2ARXA 3D5OA 2RDSA 4FPOB 2DJIA 3S1RJ 4JX4A 2D6KA 5FFXA 2HOAA 3D3AA 4IGQA 2VONA 5A3MA 3SCHA 4KQ7A 2PAMA 4QTRA 4EJTA 5T5LA 1D0HA 4IHWA 1NA1A 2R0FA 4P9XA 3F3XA 5FZHA 1MNMC 5CNAA 5E88A 4D94A 5LK7B 3UKVA 1GVDA 3B73A 3NV1A 2YYOA 1BA5A 1OR7A 4NR1A 2Z1DA 4ZPIA 4XOTA 3KIOA 5EYYA 4BBRJ 3MAJA 3AYAA 3ZR8X 1ENRA 4XW3A 3ZX7A 2B0LA 3U07A 1EF4A 4P9GA 3LMMA 3S5AA 2YGLA 4AYBN 1OA4A 4Q27A 1VAKA 3F8FA 3H8UA 2B63J 1TP4A 3HPGA 1DF0A 4HSRA 2V4VA 1UZ0A 2C9AA 1MS3A 4AHXA 4E7HA 4JYKA 2DT5A 1BIBA 3TOBA 3CC7I 3IIIA 5FYTA 2YPRA 4CH7A 4OLLA 3OCPA 3CF6E 1K12A 1F8VA 3ZSKA 1T0FC 2FE3A 2FMLA 2C26A 1TQMA 5HOOA 2O8KA 2NRAC 4OULA 3CJIB 4E8DA 2HDCA 4QHZA 4AD9A 3GZAA 4L9JA 4OU0A 1ND3A 4TN7A 2ISZA 1VF9A 2M30A 1AWCA 4FAGA 3CUOA 2IA2A 4YARA 1IV8A 3VYSB 5K9YA 3TW7A 3VHRA 4HX4A 3ZXAC 1QJFA 4NRPA 3BG7A 1HCRA 3C7OA 2WNUA 2VE9A 4OMCA 1N1YA 4OUMA 2IW5A 3ACLA 2FQ4A 4Y26A 2WAOA 4HKWA 5E3LA 5F6LB 3CQZJ 3CTAA 5F32A 3NRVA 3POIA 1JGGA 3HC7A 2A3XA 5IVJA 1NLRA 3FWEA 4C30A 3INAA 1YW8A 4RS8A 3JCUC 4CUCA 2XSJC 1WGPA 4D9JA 4CGZA 4QX2A 1D8KA 2RM22 5C8CA 4PFOA 1NLQA 1KD7A 4HV6A 3R60A 4MVTA 1IZ3A 3JU9A 5ACA1 4G3YC 5I8YA 3VBUC 2WNUB 3GHMA 3AZZA 4TLFA 1HRV2 3M3IA 3KVBA 3ZOIA 4XMYA 4KMUX 4Q4X3 5FZ6A 4AW7A 2WAEA 3AL0B 3M8FA 1W1WE 2VMCA 4MGZE 3ORJA 4GXOA 5FMDA 4PQQA 3VBSC 1OPMA 5HS8A 3OPTA 4YIIA 4HF0A 3O1MA 1UWWA 2Y9ZA 1B6AA 1H6YA 4PBOA 2VR4A 4NPMA 3PLQA 5F3EA 1TNFA 2DFBA 2ZGMA 2VQLA 3C1DA 4RGSA 2DT7B 2K40A 3GTPJ 2QQLA 5CFCB 2RGVA 4YGCA 2HWB2 1P4AA 2IP2A 4PZJA 3AM2A 5CG8A 5L3DA 3JQWA 3GM8A 2XBO3 1A04A 4Y13A 1SQ4A 1ENHA 2JA7J 3PUFA 3T8RA 3CCSI 1O7FA 1ZZBA 2WL1A 1MQTC 4YG3A 3K51A 4I02A 5DAVA 1X9TA 4UFMA 2Y9YA 5DUVA 1SC7A 1CGPA 5G05L 4FTHA 1J7KA 4XHBA 2XJSA 1EJ9A 5KAFC 1IJWC 1Y6IA 3FXRA 3MI8A 3RZKA 1BCXA 2QTWB 3W9AA 3SYTA 1CZTA 1MSEC 1OMIA 4NUBA 3MQ0A 5HODA 1KA8A 4LGWA 5LHHA 3VZMA 1FBUA 2ZGTA 3TGNA 1Z7UA 5FP7A 4DUXA 1RIOH 4YGEA 5BNGA 2N8GA 2FMDA 3AYEA 1JZ5A 4LOCA 2K85A 4UXAA 2YPDA 4FPKA 4BCUA 5HXVA 4Y22B 3SITA 2LBFA 4P9JA 2X51A 3GUDA 1YQ6A 2KZVA 2JK3A 3AFKA 2QNKA 3EHKA 2VUJA 1ZRCA 1RHI1 2VBBA 4Q0PA 4QB2A 4DOZA 1X58A 2R7XA 1N47A 4K9SA 1HRI2 4OZOA 3KSCA 4L92A 3GFLA 5M3FJ 2E2HJ 1R081 1TQIA 3WCRA 3CP2A 4YPJA 1GP4A 3BROA 4DEVA 3RZMA 4KWLA 4QX5A 1AR82 3GBWA 3PSIA 4C91A 2MLGA 1DQ6A 5KAIC 5EGOB 4ZU5A 4GMP3 1D5VA 5J98B 3HRUA 1JUHA 1OPCA 2BW3A 1RITA 2VZPA 1QDOA 1W2UA 3CC2I 2RDNA 1WMDA 5E1WA 5FTTC 1DP7P 4PJLA 1I27A 4ZTFA 4RHV2 3UNPA 1PGW1 4N43C 5TISC 1PK6C 2JDNA 1VQLI 2HZDA 4OOIA 2CAUA 2ELHA 4QPGB 2WS91 4BIFA 5IVCA 4AAXA 5ED4A 2M34A 4HKLA 3Q0UA 2D5FA 1ZLJA 4QX7A 2RS53 4PLMA 2HLEA 3UJQA 3GLLA 1YTYA 2WAAA 1WW6A 4D0PA 3GFJA 5GZFA 2CUJA 3HQUA 4YM3A 2XBO2 3A4UA 2A70A 1GV5A 4Y17A 1WJCA 3M1CA 3HBZA 2ICWG 4L5JA 1ASJ2 2GIZA 2QM3A 4ARYA 1LGNA 2WBMA 2WYSA 2WV0A 2BZDA 2XGCA 2ZX3A 3CJRB 1H8TC 3OIOA 2DDUA 4IGPA 4UFJA 4DS0A 4K8FA 2GH2A 4DZGA 1N3QA 4L5IA 2LTNA 3CDZB 5K7FA 4CU8A 4A6OA 1PO23 1NXD1 4I0BA 1S0JA 3ACHA 4GCVA 5C5TA 2A68F 1WGXA 5ICFA 1W6OA 2WZ8A 4FT8A 3TYJA 5FMBA 5EFUA 3AG2H 1FLIA 1SFYA 2QQUA 2FHRA 4BK4A 1W0NA 1J3PA 4FPHA 5FZIA 4EZHA 1HKSA 4HSTA 1ULCA 1LDJA 1JYXA 4Q8KA 2BVLA 4UVCA 5LRSA 1RVF2 2JRTA 1NK3P 3KEOA 3IV5A 1RJ7A 5IOYA 1NLSA 1R091 2ECBA 5C9AC 3GHNA 3L7WA 2DDAA 3MCZA 1V5FA 3K9TA 4G94A 1GXQA 3KQ4B 3AP5A 3OGVA 3PUAA 5BNQA 1E0EA 4E4HA 4RFT0 2XROA 4BYYA 5FZBA 5FJHA 1HRV3 3GBGA 4A3IJ 2CDPA 4OHZA 4R4ZA 4IPAA 1CPMA 2EIBA 3A01A 2JE7A 5IFPA 3W59A 2JDHA 5LBCA 1DBNA 2V5DA 2PMZN 2VQTA 5L3CA 3RZLA 4RSUA 2VMHA 1IS4A 2LF8A 1FWZA 1XDSA 4QPQA 2ORZA 4CXFA 2XH6A 3OSFA 2YX7A 3UGHA 1NCQB 5B4NA 4RAYA 5F5QA 1XD7A 2F4OB 5K7HA 2RJKA 5LEJA 5A7SA 2HVQA 1G8XA 3DEUA 2VUDA 4AI3A 2ATFA 4B4RA 2D3PA 4HAMA 3HNYM 4XZUG 2R4GA 1JHHA 2CFOA 1A3KA 2A05A 1PO13 4OMYA 2CYFA 4QKBA 4L9VA 1ULPA 4P9WA 2D6PA 2XQXA 4FOYA 3GZ6A 5KXCA 4BHBA 4ES9A 3JRFA 4UI9L 2JECA 3HVDA 2ME0A 1ZYBA 3KZIC 3AZVA 4M3CF 1RUJ2 2QE3A 4XZPA 5A3WA 3KMHA 1F4AA 4JHTA 1R6RA 2MFZA 2F2EA 3DPRC 2NLRA 2Z2SB 3MW4A 5FFOC 4FCAA 2FZ1A 2XHKA 3D8CA 5IT9K 3WVJA 4AUXA 1FPN2 4P14A 1XCBA 1UIKA 4G9YA 1GV9A 1H9GA 3I3LA 3P9KA 1LUJB 3O6BB 3WG9A 5GALA 1LOFA 1K45A 4PSXA 2PXJA 2QDRA 1GNHA 2P1BA 1HDDC 1WD4A 4BISA 2EFWA 2GXGA 4M3CB 4QGLA 4WF2A 1W7PA 3IDEA 1WJAA 3AG4H 1BEV3 4JKKA 2QBYA 5IK7A 1BOBA 1N78A 1DU6A 1P4XA 2LSOA 2WZPP 4MUVA 1UMHA 3B3QE 3CMEI 2WFF1 5DXDA 2R071 2ERFA 1NKGA 5C3EJ 2KLOA 4LQRA 1FOD2 1GHCA 1YFXA 1JXNA 3BGAA 1RUJ3 3POWA 5BNOC 2CAVA 3EO6A 4HV5A 2NXNB 1EAH3 1NX9A 5FP8A 1DFQA 2VVEA 1BQPA 2R49A 3BG5A 3CDLA 3ZXGA 1C4RA 1V4RA 3I2FA 1TL8A 3ZYRA 2V4JC 2JD4A 3L2RA 5IOZA 1GNYA 1G9CA 3O0VA 4XFCA 1S55A 2DURA 5HV4A 3J7HA 2QQPA 3OEBA 2CQQA 3OBAA 4LLLA 1OT5A 1J1LA 2HDWA 4QU2A 2K27A 4RS5C 1H1IA 2NS0A 5HBAA 1WMXA 2W39A 4G6TB 2IS1A 3VBUB 3JB4C 5JIAA 4QT6A 2A6TA 2GBYA 4IUGA 2J42A 1LE8A 2BUKA 5B3SH 2OPKA 1VB2A 2JA6J 4HDUA 1MDMB 2AXLA 1MZEA 5JWPA 1G3TA 1KQRA 1HW1A 3DKXA 3HQRA 3Q8FA 2RVCA 3OL4A 4G7HF 3P9IA 3RTRA 1JTZX 2W87A 1HXS1 5IP9J 4DZJA 5M5XJ 5J6XA 2XJTA 4KI5M 4ENNA 5JI9A 4UT5A 2CQXA 2G4IA 5L7OB 5CVVA 5HCAA 3S0MA 2DQLA 3GFIA 2WY8Q 3AK0A 2M9HA 4HANA 1A6CA 5KK1A 2M4KA 3VBOB 4YM2A 3ACIA 3OV8A 4QKDA 5J8FA 3KLSA 2CV2A 3CQOA 5BNNA 3PU8A 4YGBA 4CXXA 5FZOB 3CJQB 3KYLA 4BQYA 3OYGA 2L3DA 3FDYA 4UHTA 4BXXJ 2D1HA 1GR3A 2OCCH 1D2SA 2V79A 1AR83 1XB9A 3C18A 4LNVA 2PHDA 4HYEA 1AL0G 1B35B 2O1QA 1V54H 4AVZA 3KFWX 1AR92 4XXPA 5HV0A 3UGFA 4IHXA 5K5RA 2AS5F 3FFQA 3FXOA 3WDYA 2JUCA 3AMPA 4QPIB 2QZ8A 4W65A 4B47A 1BI1A 4XXAA 2AACA 3O1RA 4WZFA 2CSGA 4C0BA 3RZOJ 1RI7A 3WHTA 3QD6A 3LDRA 5GLVA 4XDPA 1TTYA 1RL3A 3RS6A 3OOPA 1PZ7A 4BLJA 4EM0B 1MJAA 1TME3 1NK2P 5D8AC 3RPQA 3WNKA 1FX7A 2LUWA 5E8IA 3K10A 4A42A 1EAH2 1CIWA 3U11A 4GDFA 3K4CA 3DTEA 3LSHA 2OJED 5J1RA 2W52A 5JZGC 3TQNA 5JZGB 2C0ZA 5C8CC 4BEHA 4IDZA 2EFNA 2ET7A 3BJAA 3OPZA 1QGLA 4KISA 1UFMA 3ERED 5J47A 5CVIA 4Z8BA 2DO7A 1Q8VA 3I59A 4AEMA 2W08A 3P5BA 1COV3 3BYWA 4XBLA 2PFBA 5CYYA 5LY2A 1RB8G 3ZFEC 1FC3A 3EBRA 1T95A 3BZ6A 2BVMA 3LSPA 4XSXF 4XFAA 2A7AA 2QFEA 4PI2A 2W5FA 4COWA 4R9AA 2OPWA 1A5JA 5FYYA 1LPQA 1D8JA 4DOUA 2OVUA 3NNFA 3CO6C 3OYWB 2HWF1 4JK1X 2FRHA 4LK7A 2VW1A 3BB6A 1FP2A 3D4KA 2NP0A 3HHGA 3EJKA 2IJLA 1BM9A 2FCUA 1YI2I 1VBA2 3O12A 5L3EA 3M8EA 1Y4WA 2WB1N 3MV11 4ONUA 4N43A 1X8EA 1C8M2 2PLYA 3A02A 4Y1UA 3BCBA 3J7MA 1ZG3A 3VEPA 5C9AB 1OYWA 3CCJI 4GJZA 1W05A 5ANNA 1XE8A 1VMHA 3S2DJ 3O1UA 2E51A 2RMU1 1M1EB 1RYYA 2GH8A 4C3HJ 5IT9Z 4R9BA 1MS4A 3MKZA 4UFHA 2A3YA 4XRSG 2OW4A 1KYWA 5FOJB 1CAUB 1US3A 4LHNA 3V65A 2W24A 3QPSA 4I76A 3N9MA 2ZABA 4BJ0A 3LPGA 1CAUA 2JDZA 3KD4A 1JHFA 1EPZA 5F39A 4BJ6C 3WDWA 2EZLA 1QBJA 4YNIA 5FPVA 4UWDA 1J3RA 4Y22A 4HVOA 2E71A 1LHVA 4LITA 3ZYPA 2B9SA 2VMFA 1X8MA 2E1CA 2VUMJ 1E5SA 4FFGA 5FKCA 1R5GA 3S1NJ 1Z21A 3HJEA 1JZ7A 4ZS2A 4E27A 4P08A 5FZ3A 2ET1A 2VJ5A 3ZFGB 3BPXA 3VZNA 2LR8A 3CUQC 1PVC3 4XNFA 4RB0A 5IFTA 1U78A 4NE9A 3OTFA 5CJ9A 4RQPC 4LEJA 3JSPA 3I4PA 3BLYA 4KICA 1LKXA 3TL4X 1MNEA 3I5UA 2R30A 1E3OC 1NOVA 2CS3A 2LKXA 2SLIA 4UW4A 3WR0A 1PGSA 4IEYA 3WDUA 1AHSA 2LMDA 5F3GA 1ON2A 3H35A 2WUHA 2NVTJ 2E7AA 2MC3A 1LFUP 4HKOA 1LOAA 2HBUA 5FAXA 3UYJA 5DD8A 2X53S 4PFPA 5A6QA 4NO4A 3F6VA 4DINB 3FC0A 2ECCA 3CNAA 3U2RA 1P92A 1IQAA 4AE2A 1FIPA 3JD72 2VOVA 3AVRA 2K3PA 3MVPA 4MO3M 5JIUA 4WVZA 5KR7A 3W6VA 3F0CA 4H2AA 5EWSA 4CZSA 1GXPA 2VBYA 4AFMA 3ZXJA 2DYRH 1W36C 1XGSA 1YFWA 2V6EA 4TLGA 3WP4A 3Q8BA 4UW3A 1AR72 1TBXA 3RPUD 3WNPA 4HRIA 1W7PD 1O4YA 1UY0A 4M73A 4DW6A 2OKXA 1X2MA 3RKWA 1DQ5A 3SHFA 1GZ9A 2Z5UA 4OIOF 3VD3A 2ZMEB 2UYBA 4AG4A 4KIFA 1AX0A 2VE1A 4RHV3 2D6OX 4KGQA 1U6GA 3N7MA 4YVWC 2K5CA 4CCDA 5SV8A 4KYWA 2P8TA 2IS4A 3CCRI 1AYM3 2LVSA 1S0IA 3SH5A 1K5MC 5J09A 1ZBA3 2XPWA 4QWQA 3NNLA 4CE8A 2DQRA 4FOWA 2NS8A 1CJDA 4XETA 3HRMA 3L2HA 1RC9A 4UV9A 3HUGB 4JV4A 5CIRA 5GZGA 1VTNC 1Y1WJ 2YC4A 2SBAA 4OHYA 1XQNA 4CDQA 1WVRA 4ES8A 2ENRA 5EYXA 4A7KA 1MZ5A 2R1BA 2X5IB 4NPLA 4WV8A 1PNFA 2FUG2 2DCKA 2VPRA 4UUSB 4CP9A 1WWXA 5D5UB 4DYQA 2J5OA 4XMIA 4Y52J 1B35C 3VL8A 4DY3A 1KONA 3KZ4C 1ZYRF 2W4SA 4I3GA 3ILRA 1OD3A 1O4TA 4PF5A 1SFNA 4ITVA 4RGXA 1VQOI 3FLRA 2KXLA 2H0BA 3NKTA 5A6YA 2VC1A 4OIQF 1BVVA 1BW5A 3WF4A 3ABTA 4IE7A 1HOMA 1QNYA 3FN9A 1OCTC 2Q5TA 2YG0A 1HXS3 2QA4I 1KS5A 1F15A 2J1RA 3QAHA 2LALA 4QSHA 2DTWA 1SAXA 3M8LA 4BS9A 4KIBA 1WA4A 1OKRA 3GZTB 2IZWA 3U0ZA 1PM7A 4LLNA 3WW1A 1DCSA 2MLKA 4DFSA 3TP3A 1DGRN 2VJ4A 4DXTA 2VC0A 3BVCA 4ORFA 1N3PA 3C3WA 2STTA 4AZZA 4LBJA 3QODA 3VBRB 4U0YA 3NKGA 1VQKI 4A12A 4YVWB 3ELKA 2HWC2 5JUVA 1JU3A 3OBZA 5JSRA 2RAEA 2D45A 5DDJ2 2O6GE 4CICA 5FZ4A 2VQUA 4CEYB 4Q4Y1 4P9YA 3ZM8A 4UXNA 4YZ4A 1PMHX 3A23A 3M2MA 1YWKA 1GWLA 3LA7A 1NHAA 5DUIA 1GZWB 3S7EA 3N9PA 1GP5A 2ZMEC 5F3CA 3ABUA 3RWKX 4W6XA 4FX4A 3HUGA 1CVNA 1G6NA 4UFKA 5JXGA 2Y38A 4GZ9A 5KBFA 3OJBA 1MBFA 2EXJA 1G9BA 4JKMA 4FP2A 2XJPA 2EPFA 4C0HA 2DK8A 3B9CA 3MUZ1 3BOWA 3KP5A 4PK4A 5I91A 3AJYA 5K1YA 1SMVA 5F1JA 1VR3A 3J7AO 2PQSA 2EIGA 1D7PM 1RUH2 3VBRA 2M8EA 2RS13 1TMF3 4LBQD 2Q2EA 1K6OA 3MPPG 2ZJCA 3H3ZA 1H4HA 4GKYA 4PIXA 4MV2A 3KV9A 4JGYA 4IXAA 2VG9A 5BUVA 1VI0A 3MWMA 4RR3A 1ZA7A 1POV1 1OISA 2XKPA 1YS7A 3SZGA 3IC7A 1N1TA 4Q48A 3LEMA 1DPRA 2Y6FA 2FBHA 4INDA 5A32B 1SLTA 2FBEA 4YIRX 4N53B 4BQ2A 2P3KA 4X0GA 5FXZA 4QKFA 1JMUB 3MW3A 2D2WA 1F35A 3PFIA 4TTGA 1KFUL 4HONA 1GQHA 3I2GA 3HB9A 2OQGA 2VVFA 3BR6A 2DV9A 4N0BA 3CP8A 4AFCA 2IGMA 4XKBA 1SDWA 2E7TA 4XUTA 3AVSA 3ABMH 5DZEA 5JXHA 2VUCA 2BW8A 1UY3A 3T1BA 3KCXA 3P3NA 3TDUC 1YFHA 2MH2A 1G3YA 4QAWA 5ISLA 1UCXA 4IV3A 3VZOA 1EH6A 3LSMA 1HRI1 3SLIA 2YBPA 4HN1A 4NQWB 4EWEA 4HQEA 2FXAA 2LK2A 5ERLA 4Q4V1 1JXSA 5FZKA 2PLV3 1NCQA 1JI6A 2WIIB 1O59A 2HEVF 3K48A 4RA0A 5CKMA 2RR11 2FNAA 1ETYA 2ZHMA 1QXRA 1PUFB 4NRMA 4UFLA 1X3WB 3J7NA 5C4WA 4LA2A 5FYMA 1UELB 3HOZJ 3I2JA 5DPNA 4Y20B 1G3SA 4U87A 1TE1B 4LPLA 2CGOA 1VQ9I 2WWSA 1G2HA 2FDGA 2HPIA 3IL2A 1YIJI 1RUF3 4NIAA 2QF7A 3WNXA 4KITB 4DBQA 3L2UA 3GZ5A 1SACA 4MH0E 3U37A 4JAAA 2YBSA 4E70A 3RQIA 2L9LA 1AR63 3GW2A 3GTOJ 1JOJA 3LQCA 3LB9A 2CGPA 1IS6A 3R0AA 1ZZ6A 2Y0SN 2HFHA 3QU3A 1R64A 3K3NA 1ND2C