3LA7A

Crystal structure of ntca in apo-form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
209
Chain Sequence
DKALANVFRQMATGAFPPVVETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Global nitrogen regulator
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
total genus 65
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la7A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la7A01
1KYZA 4OU0A 4Q0QA 1ZGAA 4HV5A 1K78B 1K6OA 3SZPA 3ZMZA 3ZMTA 3FJSA 5KHKA 1LB2A 4IEVA 5D6FA 3F8BA 1EYBA 1YTYA 5JFRA 3C3VA 3IHUA 4KFCA 2QQBA 1YLFA 3W6KB 3JTHA 1WLTA 2ET7A 1OFNA 4AVBA 2D5FA 5D8KB 1Q43A 1XB4A 3Q5FA 4G7ZF 1TQ5A 5LHHA 5D5VB 1J9IA 5IT9K 2OZUA 4HBNA 5FGMA 5KHGA 2D1VA 1B4AA 3SCGA 4LK1F 1DGRA 1NZCA 1ZZ7A 3LWFA 5I91A 3RYRA 1W4MA 2PAKA 2F5DA 3KGZA 2O6GE 3Q9VA 3L09A 5EFUA 4LB5A 4DINB 4WBBA 2XAHA 2W85A 2ISYA 5FFZA 5FO5A 2VODA 1ZRRA 3HTUA 2UYAA 1F9NA 1SMTA 5HS8A 2VPVA 2DPUA 5A2QK 3USSA 1U12A 4PIZA 1QNTA 3BPXA 1FSEA 4AQ6A 1BOAA 2VC0A 5K5QA 3EETA 3UKNA 2MH9A 4NQWA 1YUDA 3O14A 4Y17A 1I5ZA 5AIQA 4MEXF 4FHTA 5DV5A 1RUNA 1QXRA 1XCVA 2IPQX 3IIAA 1JHFA 1OD5A 2R7DA 1X8EA 4KWKA 5HS7A 3KP5A 1SFUA 1IN7A 3FX3A 1O57A 1O7LA 3E97A 2PFBA 5BY5A 2NAZA 2UYBA 1TQPA 5I93A 2KIUA 4A5MA 3U0ZA 4Q0SA 3HT2A 1Y9QA 5LEJA 1WKMA 4IEUA 4MTDA 3WTZA 5J6XA 1Y3TA 4XSZF 4GO1A 1ZG3A 2D5HA 2V9VA 1LR5A 3I4PA 3K1MA 3ZMSA 2HEOA 4M6XA 4HMZA 1ZRDA 2XLAA 1MD0A 4A0XA 1QQIA 1ZLJA 3U1DA 2X4HA 4ENJA 3L2HA 2B5HA 2DBBA 4XFFA 2R3SA 3BZ6A 3ROUA 5HI0A 3OOPA 4RAZA 2PFWA 1IXSB 4DNCA 1Q3EA 2CAUA 4HLXA 3NJZA 1U5TB 3GZ5A 3L7WA 4CO8A 3IRQA 4ASNA 5FQ0B 2DLLA 1TBXA 5LEKA 4XRFA 4H0EA 4GXOA 4D7SA 1YW9A 3HYIA 1UW8A 4I0AA 4KT5C 5AVPA 5CVJA 3F8FA 3CO6C 4P9UA 3GLXA 3CL1A 1J58A 1IZ1A 4YSFA 1O3SA 4MV2A 3FM5A 4FBFA 3HRSA 2PI0A 4HF1A 4CZZA 1KU7A 3SXYA 4AVCA 1FLIA 2O03A 3J80K 3T5XA 4PZJA 4QGMA 3S2WA 4L0ZB 3CUQC 1BC7C 1F4KA 1SMYF 2Z2SB 4A0YA 2DQRA 5HLIA 1LKNA 2C0ZA 1OPCA 2ZJ2A 4EV0A 4OINF 2Y48A 4OOIA 5JI6A 2XRNA 1ZG5A 1JE8A 5F64A 1ZG1A 2EVXA 4LGWA 3IKTA 2PAMA 3H92A 1KQ9A 5C8WA 2LDUA 1J3PA 3RPUA 4CICA 3BJOA 2ETEA 4OIQF 4AIKA 1HW1A 3FZVA 2QQ9A 2FBIA 3HRTA 1R58A 4MGKE 3DEUA 4XFAA 1QGPA 4Q0PA 2IXKA 4RB0A 1UHMA 3NRVA 4P55A 3F22A 1YQAA 3SFZA 5JSOA 1XMKA 3KEQA 2OYZA 5FB2A 2Z69A 1CGPA 5H20A 4DQ2A 3V8JA 5FD5A 3H1YA 2EAAA 1DGWA 1SFEA 1UB9A 1UHWA 2LF7A 5J7MA 3FXRA 5L3EA 3LA2A 1GQGA 1D5VA 3MDPA 5BV6A 5CYVA 3D82A 3O6BB 1MDMA 4ESBA 2IW5A 1BJAA 5ICGA 4XFHA 1TNSA 2GQQA 1YFHA 3C18A 5D6EA 3WE2A 3EJKA 3WW4A 2E7WA 4AXOA 2XLFA 1O3QA 3V8KA 3JSPA 5EZWA 1HQCA 4EVIA 4LG0A 1FZPB 4HQEA 1P4WA 5D4SA 1XGNA 3ELKA 1XMAA 2HKOA 4MUVA 2PA7A 2K0GA 2M5WA 3LQQA 3F21A 5TJJA 2V79A 1D3YA 4HVQA 2QBYA 1TQMA 1BBYA 4E70A 4PGGA 4L2NA 1DDNA 4EJOA 1IXRC 3GXOA 3D5LA 3KE2A 2DO7A 3S7IA 2E7XA 3GFJA 3V8LA 1H9GA 3ECHA 4N9IA 5KK1A 3KLOA 2F4PA 3WGHA 2PLYA 2CO5A 1J5YA 4LA3A 3KP7A 5JVTA 4GULA 5KVRA 1EH6A 1KGSA 1P4AA 4IPAA 2ZKLA 2P5VA 4WF2A 3CO7C 3E6BA 1FWZA 5H6QA 1IW7F 2YR2A 2KIMA 4S04A 3H7YA 2R7FA 1YG2A 4P5OA 1SFNA 5L3CA 1OYIA 2IA1A 3EQEA 2FMYA 4QLCU 2EV0A 2CYYA 2V1XA 1L3LA 4RGUA 3SMHA 2HTSA 2F5EA 2H09A 2XUBA 3MQ0A 2DK5A 1YLLA 1FP1D 1T6SA 4K2EA 5KHIA 5LLQA 1WI9A 2V6CA 1H1IA 2P7VB 4HLTA 2GIVA 2CSOA 1BN5A 2QWWA 5HLGA 2IXIA 4FT8A 4MZUA 2EV5A 3QPTA 5E1WA 1CAXA 3MAJA 4HW0A 4ZYHA 3QP6A 2DU9A 2H6BA 2GZWA 3NEUA 1CAUA 1VTNC 4IHTA 3HSRA 2VECA 4XF3A 4X6RB 1GXQA 3OTFA 1L0OC 2XAGA 3RTRA 5HDNA 3DKWA 2QYOA 5DD8A 2PMHA 2HQRA 2FXAA 1SEFA 2ESNA 3VEPA 3AAFA 3CJNA 1CAVA 4BYYA 4KA4A 2P5LC 4ZU4A 2LKPA 2MLGA 1NXMA 5FPXA 2CG4A 2OD5A 2DPDA 5JAXA 1FC3A 1HSTA 4KICA 5FFXA 3FXUA 1KU2A 1JGSA 4MNUA 3M3IA 5A2QZ 4UV9A 1XGMA 4N9HA 4XFCA 1KU9A 2FMLA 3KP3A 2P4WA 3F8CA 3GYHX 1RI7A 4XLNF 1GXPA 2BNNA 4M73A 3ES4A 2FOKA 5CLSA 2IXLA 2K4JA 2DAOA 3M9AA 4UVBA 2GC1A 4OMZA 2ISZA 2QCSB 1ZNPA 1HSJA 1FI2A 1OYWA 5FLHA 2VT3A 3DFGA 5K5RA 2ZMEA 3K0LA 1QZZA 2IJLA 1SD7A 5HDKA 3JZVA 1UPIA 1MJ9A 4HF2A 4ORFA 3ECOA 4BQAA 4E2SA 2A6EF 4KYWA 3LZZA 4OLLA 3TDUC 4XSXF 3C1DA 3WG9A 4UVCA 1G3YA 3TGNA 3JSOA 4J1XA 5E8GA 1IN5A 2L01A 2ATFA 2Z5UA 3FMSA 4A2UA 1DUXC 1F5TA 2RN7A 2HYGD 3K69A 4QGLA 3ZN1A 5D4RA 1FPQA 2NYXA 4UBHA 2JZYA 4MGIE 4CDGA 2MC3A 4Q5SF 1ZZ6A 3IDCB 1U78A 2PN6A 3TNQA 5E8IA 4J1WA 3LAPA 2XKPA 2IXCA 1USTA 3R0AA 2A3SA 1C0WA 1WRJA 3BCWA 2B9UA 1Z7UA 2P17A 2HQNA 2LSOA 2BNOA 3VOEA 1IPJA 4HDUA 2CW0F 3GUDA 4IRIA 5E1ZB 3KZZA 1MDMB 5D5XB 3S0MA 1H1MA 2I45A 2VBWA 4IEPA 4YRDA 2IRFG 1SAXA 1UFMA 2P7CB 1QY4A 2PMUA 1U3EM 1S7OA 4G6QA 4N0BA 4EROA 4TLFA 1HBXG 2A69F 3J80Z 3F72A 4ZU7A 1S6LA 4LG0B 4OFGA 1U2WA 3C3WA 3CTAA 2FNPA 2OQGA 5KHJA 1R1UA 3VODA 1FBQA 1O4TA 2QUFA 2YSRA 3RYPA 4PDKA 2UZKA 4M9ZA 3IDBB 4ZYGA 2IA0A 4HVOA 2EFWA 1RL3A 3D0SA 1B9NA 1S3JA 4HSLA 3D0JA 2QBYB 1FT9A 2OA2A 1LDJA 2W24A 2GC0A 2BGCA 4WXHA 1ZGJA 2O61A 5I8TA 1CF7A 4UHTA 4ETSA 2BNMA 4MEYF 4BIFA 3O2PE 4EJUA 2RDPA 3LAJA 1XRUA 4M9XA 2V1DA 5I0UA 1U6GA 4M72A 4Q0UA 5HOOA 4FAHA 3FWEA 1IN8A 3PNAA 4QX5A 1Q5OA 4P96A 1XSVA 1ULYA 2V09A 5FLIA 4CXFA 3HSFA 1KU3A 3CJXA 2YPRA 3M1EA 1X7NA 3M7GA 4YNIA 4MTEA 1ONVA 3WGIA 3FE5A 1Q1HA 4G8XA 3OD0A 4L18B 3PVBB 2IXJA 4E2QA 1G3SA 1K79A 3QAHA 2Q8KA 2IXHA 4ON0A 5LGUA 4Q29A 1V3FA 5BPDA 2F5FA 4CGZA 1O5LA 2PAEA 1ON2A 2EFQA 4IJAA 4I3PA 1NYWA 4KIFA 2Y0MA 4LLOA 3ZMUA 1S7AA 5CVUA 3NW4A 3TKYA 2ADUA 1ZZBA 1J0RA 5JR7B 3GEZA 3NL1A 4X6QB 4EMSA 1XSDA 1BI3A 3WTVC 4RB1A 4MQ9F 5DUIA 4L9JA 1U5TC 4OIRF 4G7HF 1LQ1A 1P6RA 2M8EA 3I58A 1HKTA 2HWVA 4U7DA 1T0FA 1ZZCA 3E6DA 4YFNF 4Y13A 4EQQA 1TW3A 2VT2A 4WXDA 3V7SA 4BHPA 4OMYA 5E17F 1J2XA 1E17A 1EY2A 1V70A 3ABUA 4EWEA 1CAVB 2XAFA 4O9GA 1TLHB 3KFWX 5DYMA 1ZHFA 2J5PA 1ZYRF 3IBMA 2L3DA 3R60A 3DF8A 2XV4S 3MWMA 1FYLA 4XF1A 4A0ZA 6PAXA 4WZCA 4ZYDA 4HVRA 5AONA 5IT3A 4KIBA 3DPLC 2E9QA 5DEQA 5LGTA 1CAWB 2A5YB 4GGGA 4I02A 4I0BA 2NNYA 4EJWA 1XDUA 1IXCA 4M9SA 2E1NA 4EM1A 4LEJA 4JBAA 2VE9A 3OF1A 4IXAA 4RD7A 3BY6A 2RC4A 2CQKA 2MHFA 4IEYA 4RB3C 4EJTA 3ISPA 4IERA 4OIOF 2H27A 2PHDA 4O3MA 3J7AO 5CJ9A 2QLZA 1LDKB 1Z6TA 1IN6A 3TDZC 1R23A 1W7PB 2EFPA 5FLXK 4MGYE 2P8TA 3EO6A 3U2RA 1ZLKA 4GCVA 3F23A 3ML6A 3BP8A 2GWRA 1DZRA 3M70A 1Z91A 5K1YA 3RKXA 4KN4X 2DI3A 4G6DA 1JXSA 2L02A 3RPQA 1XGOA 4BH9A 3S7EA 4XF0A 4Q48A 2RGVA 1IRFA 4GYGA 2G7HA 4U0YA 1H9TA 4QWQA 5DCMA 4L5JA 1TNTA 4IRGA 1K78A 1DP7P 2MPFA 1EH8A 1ZRFA 4FX4A 5LBQA 5FCCA 3GYDA 2D45A 1OYYA 1FBUA 2EFNA 1BIBA 4ONUA 1O3RA 4A5NA 1Y0UA 5JSPA 3I0TA 1TW2A 2MD5A 3LQRA 2Q0OA 3K1PA 1G3TA 2ZNZA 1LNWA 2STTA 2DTRA 1FOKA 1J1LA 1FYKA 4PIXA 4HAMA 2VXZA 4XFBA 3H8UA 4KUMA 4EJVA 3CF6E 3OCPA 1YO5C 2XIGA 1J7KA 2V1UA 4ZZLA 5T3NA 3H7JA 2PYTA 3TNPB 4TV7A 1X8MA 3GF2A 1STZA 4HQMA 2ZO4A 4KNYA 1LVAA 1QWRA 5JR3A 3ABTA 1UD1A 1UCRA 4LFUA 2VBYA 1XD7A 4QM9A 1SD4A 3LA3A 1PP8F 1EP0A 1VP6A 5JCTA 1ZRCA 5D1IA 1ZX5A 1R1TA 2B0LA 1QPMA 4JQFA 3DV8A 1RZ4A 4HA8A 4UXAA 2A61A 2DFIA 4XFGA 2IP2A 1YS6A 2UXXA 2UY9A 4WK8F 2C6YA 4QGNA 4WVZA 2DT5A 3MFKA 1BI1A 1HXDA 2A6HF 2GH2A 1W5TA 5DDGA 3ELNA 3LOIA 5EEHA 2GA1A 2YX7A 2K4BA 2HDCA 1KA8A 4UV8A 5F1RA 5HDGA 5E1XA 5ICEA 4RGXA 4L9VA 4HV6A 2E1CA 2Q1ZB 1F1ZA 1J3QA 3I54A 4LLGF 4P9FA 3ES1A 4Q4ZF 4BHBA 1IUYA 3NKTA 3BROA 2MH2A 5BS6A 2O3FA 1YFUA 4KMFA 1YW8A 4LULA 4A6EA 2PJPA 1QXJA 3GFMA 4QM8A 1ZARA 4L11A 3I7DA 3ST7A 3F8NA 3T1BA 4CHUA 1XE7A 1Z6RA 2FF4A 5ED4A 2OQRA 4JTNA 4LTAA 4KN7X 4YIFA 2PG4A 4RGSA 1QBJA 4HOBA 5FQ0A 2BYVE 2DCTA 1ON1A 3CLOA 2P6SA 2OA4A 4U88A 4BXUA 3F6VA 2QZ8A 1BI0A 2M45A 2FRHA 4M6YA 4WWCA 1SFXA 4LA2A 4YFXF 5BPXA 4LLNA 4QMAA 1S29A 3GX4X 2XVCA 5HVQC 5FPZA 4EWAA 3I71A 4KU7A 1T38A 2CWEA 5DD4A 4HSJA 4I98B 2OZ6A 4ZZDA 3R61A 4U0VA 4AWXB 4HZFA 3TOAA 4MH0E 3U11A 1YIOA 1ZZ8A 4F8AA 2HKXA 2Z9OA 4AIHA 1RNLA 3CUQA 4AIJA 1W7PD 4LMYA 3HRMA 3W6JB 3T0YA 4IEXA 2OZJA 2CFXA 3RJPA 5CVVA 4WX9A 2VC1A 3FXQA 1MJBA 2GAUA 4AVPA 4P9GA 1JUHA 4U0WA 5BOXA 4L0YB 1ZAOA 4D7TA 2PHLA 3LAGA 1BI2A 1BIAA 5I8SA 3SCFA 2J5OA 3DP7A 5BUVA 2HTJA 3SQNA 4IF4A 1L3JA 3GVAA 5FD6A 1RIOH 3RKYA 3JAMZ 5K8SA 3V7RA 3HSEA 2K7LA 1PUEE 2UWMA 1AWCA 3WW3A 3QP5A 5ILVA 2JPCA 4MQVA 2VOPA 2CV6A 3COAC 4AD9A 5H6RA 1WSUA 1PM7A 2EK5A 5LGNA 3U10A 1T39A 4LJZF 1J59A 2FBKA 3HRUA 4IHSA 1I1GA 3IKVA 1GQHA 1YYVA 3HIFA 2W57A 2Q4SA 3GFIA 1HKQA 4UUVA 3TQNA 4ZYEA 4AVAA 2K86A 4I7HA 4UBGA 5ILUA 1X3UA 2EA4A 4ESFA 2K9ZA 3G3ZA 4ENMA 2JRTA 3GFLA 1TTYA 2XAJA 2GU9A 2M30A 2NRAC 1BM9A 4U7BA 3BPVA 3H50A 3HT1A 2GC3A 5TRDA 2VBZA 3ULQB 4CYDA 4MHGA 2WV0A 3LFKA 4RAYA 5DCMB 5DUKA 1E2XA 3LWCA 3SHRA 5JHUA 3ZPLA 3CEWA 1FNNA 3E5XA 4KU8A 3QACA 5CADA 4H7LA 3EYIA 2GC2A 4XETA 1RUOA 2RNJA 4B29A 3IL2A 3WTUC 3CDHA 2Z99A 2KIFA 4LD5A 2OPKA 2BBYA 1OI6A 2H6CA 5J8FA 5J3UA 1YFXA 2P5KA 3BDDA 4G9YA 5HS9A 1DZTA 3REOA 4BAYA 2FQPA 1R5HA 1EV7A 2UXNA 1REPC 1LDDA 3TOBA 3RIRA 3K9TA 2ZXJA 4KMUX 3G7DA 1LEAA 2B8MA 5LHGA 3WE3A 3EQLF 2EFOA 3WTSC 1IN4A 4IEZA 3EBRA 2VE8A 3WODF 5LRSA 1R5GA 2P6TA 1ZN2A 4PGHA 3ZDSA 3DXJF 2EWNA 3E5UA 1B6AA 1FP2A 4MGRA 2EA7A 3MCZA 1P2FA 3P7NA 1G6NA 4GYIA 2BE5F 4QXKA 5FLXZ 2ZFWA 2F5CA 2PQQA 1U8RA 3KZYA 4L9TA 1LEBA 4NVPA 2AS5F 2HOEA 5J48A 3FFQA 4R79A 5E20A 2QVOA 2Z33A 1B9MA 2XL7A 2EV6A 3FF5A 3E5QA 2RV8A 3TO9A 1R22A 2VBXA 2VN2A 2BV6A 2FA5A 3KMHA 3J81Z 4I2OA 2D2WA 2GXGA 5D5UB 3JTGA 4G7OF 3I59A 1VR3A 3BJ6A 3RI4A 3Q9SA 4R1HA 1MJAA 3B73A 4Q0VA 4FAGA 3G73A 4EWDA 2Q0AA 3K2ZA 1DPRA 2KKOA 2H94A 4UXNA 1XN7A 2EA2A 3C7JA 3HTSB 3TO6A 4HX4A 4MGZE 3MYXA 2DQLA 3WTWC 4EGYA 3RDIA 1VJ2A 2HYFA 2VOOA 2K02A 1MKMA 3JAMK 1QZYA 1SD6A 2EB7A 4WXCA 1I1SA 2FBHA 5I0SA 1FY7A 2WC2A 4Q47A 3O3KA 1KYWA 2WTEA 3V7CA 1XDSA 2ZCWA 1CAXB 3H3UA 3CUOA 1CAUB 2JTVA 2XASA 3NQOA 1PMIA 4PCQA 3MEXA 2W84A 4BNCA 1YFWA 5I0TA 5CU1A 3KP6A 3P9CA 3GZ6A 3QRFF 1P4XA 3H9AA 1BC8C 5L3BA 3HOTA 5FLJA 3T8TA 1J75A 5F6FA 4R52A 2OU2A 1R00A 2PEXA 1FX7A 1P92A 3QU3A 4IEOA 1IF1A 4JV4A 4YARA 1EPZA 3GWZA 4IESA 2JPBA 1LJ9A 3BJAA 4ENNA 4PJYA 3CLPA 4B09A 3BPZA 1XSXA 2FQ3A 2KXLA 5K5OA 1X82A 4XBFA 2VQAA 4LUKA 2HGCA 5C6CA 4EGZA 1OMIA 5LRRA 3ERED 3E6MA 2O0YA 5CVIA 1ZH5A 3EYYA 4LB6B 4I01A 3ZP5A 3H1WA 3PQJA 3QOPA 3CO2A 5BPIA 2OBPA 5KBFA 2Y75A 2ACJA 4YYOA 1G4DA 4ZH4F 2HR3A 2NNNA 4L9NA 4HF0A 2ZMEB 1IAWA 2PTMA 2Y0OA 1Z1DA 3CUQB 2MA3A 5KHHA 2FE3A 4LUMA 2YU3A 4R8HA 3PLQA 2XLGA 4XLPF 3ZN0A 2M1BA 2QNKA 1R1VA 1HW2A 3HQXA 2QJVA 1USSA 4XEZA 1HW5A 3QU6A 5ERIA 3NVCA 4IEWA 1ZVFA 3KEOA 1OKRA 2L4AA 3MPBA 3ETQA 3GO5A 2Q2EA 1W5SA 5ILSA 3BALA 3DPTA 2Z3YA 2BEOA 1R7JA 2KJCA 2XL9A 3BB6A 3J81K 4JK1X 3KGLA 3LSTA 3ZMDA 4LK0F 3PQKA 2EJRA 3E3VA 4NB5A 4I09A 2YX4A 2WWYA 5FDBA 1K7AA 4WCGA 2A68F 3F8MA 4D0PA 1SD5A 4O5VA 3I5UA 2STWA 1WWXA 2L54A 5JSRA 3KP4A 1XCBA 1UIKA 4Z2YA 1J3RA 3IC7A 3KETA 3R0JA 4HX8A 1YWKA 3WW2A 2XKOA 4KL1A 3WU0A 5AIPA 3HUGA 1QO0D 5L3FA 3WTXC 4S05A 3B02A 3N97A 2WFPA 3IWFA 3L9FA 4YIIA 2FU4A 1NE4A 1NHAA 1FYMA 1HKSA 2RQPA 4M71A 4EM2A 1O3TA 4F7ZA 2ZBKA 4OIPF 2MNGA 2ESHA 2IVMA 2HS5A 1PP7U 2OAZA 3T8RA 2KRFA 1RTVA 4O9EA 1UCXA 3SCHA 3MZHA 4HBLA 5CVRA 4ZU5A 3H1MA 3WTTC 5ICFA 4MX3A 3P9KA 2GA2A 5D5WB 1GHCA 4JVAA 5L3DA 4PIYA 2JT1A 2K27A 2ZKZA 3I64A 3PFIA 4G94A 4XF4A 5BXXA 3RZZA 3F6OA 2QVSB 2X0LA 2L4MA 1CF7B 2QENA 3RKWA 1RC6A 3WTYC 4XF9A 3H3ZA 3R4KA 4HN1A 2XGXA 2LF8A 1FBSA 4AQ2A 2G7UA 4JTOA 2PQ8A 2DK8A 3WW1A 1S8NA 2LNBA 3DN7A 3IWZA 1TQIA 3KCCA 1ZZ9A 4META 2GXBA 3HHHA 3U9GA 3ACLA 3BU7A 3EHKA 3F3XA 2A07F 3I53A 4B8XA 5ICCA 2HFHA 2QM3A 1GVJA 3L00A 3RNSA 1T2KA 1T98A 3I59B 4O6JA 5D8LB 2O8QA 2O1QA 3TO7A 4ESJA 3K1NA 2ET1A 3KSCA 3WU1B 1MZBA 2H0VA 1B59A 3UKTA 4Z07A 2VONA 3VB2A 3FMRA 2G9WA 4UNOA 2NS0A 2Q30A 2XAQA 1IRGA 4IVNA 4UVAA 1AOYA 4HDVA 3FHZA 4HN0A 3DQVC 5BMZA 4K8FA 2UY8A 1O7FA 1B1BA 3EUHA 1NE6A 1I6XA 1MGTA 2ELHA 2FNAA 3OGJA 3KLNA 5I8YA 3VFZA 3N4MA 4E2GA 1OR7A 4BHCA 4ENKA 5J8CA 2IA2A 4KDPA 5IT9Z 1U5TA 3SHFA 1Z9CA 1V4RA 3WGGA 2IT0A 1YHFA 2W25A 5BQTA 3NSTA 3L2CA 4HX7A 1YFYA 1EH7A 2F2EA 4Y15A 1DPUA 1ZREA 4Z82A 3QPHA 3FM3A 3UKVA 2DW4A 4HLYA 1YW7A 1UIJA 1Z05A 5I0RA 5HLHA 1WGPA 3M8FA 1LRHA 4RGRA 3GW2A 5EEGA 3RYKA 2FEZA 4KWLA 4EM0B 2MBFA 1XGSA 4YFKF 4HYEA 3GBFA 2QDRA 3VHRA 1ODDA 3OV8A 3DL3A 1IPKA 1WQ2A 3M8EA 3JW4A 4KIGA 3HOSA 1JHHA 2XHKA 1CAWA 2ZNYA 4LLLA 1SQ4A 1RGSA 1PDNC 3P9IA 2HJIA 5L3GA 3E6CC 2RKHA 3SXWA 3EDPA 4L5IA 3FHIB 1H0MA 3SZTA 1D8KA 3ZQ7A 1R36A 2PBIA 3HHGA 1KQ0A 2MLKA 2ETHA 5LHIA 2M87A 2N7GA 3FZ3A 5DCFA 1CX4A 2D40A 2RVCA 3V4GA 3MZYA 2O8XA 2D93A 2KJBA 1W7PA 4IEQA 4KWJA 5E18F 4A6DA 4IETA 4RS8A 3LA7A 4XFIA 4RB2C 2HZTA 2FSWA 2TDXA 2IC1A 1XE8A 3IRRA 2XROA 4YG2F 4A12A 3FMQA 1YS7A 2QQAA 2AXLA 1FSHA 1KQ8A 2COMA 3KP2A 4IRHA 1D8JA 1WA4A 2CGPA 2CAVA 1A04A 3BWGA 3BOQA 4FX0A 4M74A 1G3WA 3ZMVA 4NHJA 1I27A 5E1RA 2JSCA 5E16A 1O5UA 3R6SA 2D1HA 1FXZA
chains in the Genus database with same CATH superfamily
4ATEA 4FFGA 4AYUA 4F83A 1H9PA 1K6OA 1VLNA 1JKRC 1MBEA 2ARBA 1S72I 2A6VA 4IEVA 3F8BA 4DUWA 1YTYA 3OOXA 5JFRA 5EG0B 2GALA 3C3VA 3HUGB 5EYXA 2R5ZA 4JKKA 4C1XA 1WLTA 4AVBA 2RR12 4ZC3A 1E3OC 1XB4A 5B4NA 1EAH1 1ZR4A 5D5VB 3JD73 2RM22 2NXNB 1NCRB 2ZXWH 4Z92B 4HBNA 1MS5A 2CDOA 3S1RJ 5KHGA 3OUHA 2WT1A 1B4AA 3WY6A 4X8NA 4LK1F 1YJLA 1DGRA 2KFDA 2A73B 2XQRA 3ZYIB 4OWRB 4NMIA 1C8NA 2Q1FA 3K4KA 4XONA 4RR3B 2O6GE 3L2RA 4LB5A 3VHOA 2CY6A 4DINB 3PIPF 2XAHA 4OMDA 4N43C 2LTNA 3I4MJ 3BU0A 4XN3A 3VDDB 2IWGB 1OQDA 1NCQB 3UGGA 3ZR5A 4HNVA 3USSA 4QDQA 4JHZA 1QNTA 3OYJA 5K5QA 3EETA 2BW8A 2MH9A 1TME1 3DPUA 4CDQB 3AKTA 3WDXA 4LO6B 5DV5A 3JRBA 1M1EB 1ENRA 3OSDA 2VUAA 2IPQX 1JHFA 1OD5A 3UGFA 5FKLA 3RS6A 2ERFA 1W06A 4KWKA 5HS7A 2VOKA 3KP5A 1PGW1 2FCVA 4HETA 1ETXA 2VOTA 1O7LA 1T95A 3ZFFC 1DHKB 5FZ7A 2BVLA 5BY5A 2UYBA 4WV8A 2KIUA 4A5MA 3MUY1 4IQJA 1ASJ1 2DCEA 4IEUA 3ZXJA 4MTDA 3DLAA 5FZ9A 1R6RA 5J6XA 3SLIA 3VZNA 1ZG3A 1UU6A 2RS52 5IYCJ 3ZMSA 3POJA 2D97A 1MD0A 4A0XA 1ZLJA 1WWYA 2X4HA 4GJYA 5CKQA 2W1SA 1H6XA 2WIIB 3BZ6A 2VBPA 1F9KA 1AR62 3VBSA 2PFWA 4CA0A 1Q3EA 4JGZA 4EN0A 1VE0A 1U5TB 4BDVB 3GZ5A 2J1EA 3IRQA 5FQ0B 2DLLA 1TBXA 4AR2A 4H0EA 3X2QH 4P5YA 4D7SA 3HYIA 1OOPC 4QPYA 5FYSA 1HJFA 1OPMA 3JCUC 2KA3A 4EATA 1D0XA 4GWMA 4HG2A 3OSGA 3PTYA 4P9UA 1J58A 1IZ1A 4A69C 5T55A 3VYTB 2EF6A 3WQBA 4MV2A 2M8GX 3TBIA 1AHSA 1GNYA 2PI0A 1R9TJ 1GZWA 4AVCA 5AVAA 4HPKB 2PLV3 1U5IA 3J7HA 2XQXA 5IT6A 4L0ZB 3CUQC 5J47A 4A3ZA 1COV3 1SMYF 1MVEA 1VNDA 2DQRA 1F36A 5HLIA 2C0ZA 1EKEA 5ABJA 3S2HJ 4EV0A 2Y48A 4XXAA 2XRNA 5GZFA 3A1YA 1MMGA 3PUSA 5F9TA 4FOQA 3H92A 4XMAA 1QIQA 3MPPG 4YVWB 5C8WA 1WA6X 2ETEA 3FHNA 1MVQA 3PSIA 3LOBA 1HW1A 3VZLA 5M3FJ 5BNOB 3CCEI 1A6QA 1D4M1 2M7BA 5BNNC 1R58A 3AG1H 1SDWA 2M3AA 1IG7A 2WSVA 2IXKA 4RB0A 2HYJA 2HXOA 1FJLA 3S14J 1YJ9I 5GZDA 1VI0A 4Z2WA 5DAWA 1GLNA 2OCEA 1CGPA 5FWJA 2WLQA 2A1XA 4PCRA 4WVMA 1GBGA 4F93B 1UB9A 2FOWA 1UHWA 5GTHC 1WVRA 3ZX7A 2LF7A 1RMU1 2D3RA 1RR8C 1QQP3 2LREA 2GNTA 1D5VA 2VVFA 3WZ1A 3DEWA 3IAS2 5A3MA 1MDMA 4ESBA 2IW5A 1BJAA 5ICGA 1WH7A 4KI5M 1YFHA 2HYKA 3WE2A 3EJKA 3WW4A 2E7WA 1TMF3 4BOWA 2BJSA 4LKFA 3V8KA 3R0RA 4CDUA 1A34A 1LCLA 4EVIA 4RFT0 5GLUA 2WNVC 2JN6A 1P4WA 4NUBA 4AHYA 3C7OA 4QB6A 5K4LA 3HZJA 2B9VA 2VXJA 1W0TA 1HC8A 2PA7A 2A05A 5L73A 3BTXA 1KZHA 3F21A 1HXS1 5TJJA 3ZPYA 1RUE3 2QBYA 2GSYA 4L2NA 2ZMLA 3GXOA 2IGMA 3D5LA 2J1TA 2AYHA 4XE9A 5C9AA 2DV9A 2R32A 1GDTA 1H9GA 3OGGA 2C9AA 5KK1A 4N53A 3WGHA 3LQCA 4LBJA 2PLYA 3K6GA 5JIAA 3HOVJ 4LA3A 3PJRA 1JMUB 4GULA 1AL23 1EH6A 2YDEA 1LEDA 1U9NA 1W2AX 4QHOA 3IPVB 1WMXA 3I3MA 3B00A 4H4KC 5G05L 1P8JA 1UZ0A 4QWNA 1RC9A 3S2DJ 4AF9A 2JSPA 4KJZA 2R7VA 4IZZA 2RQQA 4Z1VA 1S0FA 2FMYA 1AXZA 3FXJA 2CYYA 1ND3B 4LNVA 3SKJE 1OA2A 4RGUA 3BYWA 4FE4A 3SMHA 3FLPA 2H09A 2M0MA 1TP4A 3WDYA 3MQ0A 2BXZA 2CU7A 4K2EA 4Y24A 5KHIA 1CQ9A 1JU3A 2WQ8A 2GBYA 1UOFA 2GIVA 2JJ7A 2CSOA 3CF5F 5HLGA 4NC6A 2IXIA 4FT8A 3AL0B 4OHWA 1AYM1 5DAQA 3WP4A 5C3RA 4OUEA 3N7MA 1VFCA 2XHNA 1WW4A 2H6BA 4QKBA 3FXOA 1ULDA 1GXQA 3OTFA 4QSHA 4KISA 2XAGA 3AL6A 5HDNA 2WNUA 1YX5A 1YO8A 3HJRA 3S3MA 3N3HA 2BUKA 4KA4A 2P5LC 1FMD2 2WN2A 1R1A3 3POIA 5B4XA 3GJAA 3WLUA 2CG4A 1JZ2A 1AR82 4DS0A 4HL0A 1NZIA 1X4OA 3N9LA 2HPMA 2HEWF 1WJDA 3RQIA 4LBQB 2WS93 4XKVA 3WF2A 1IPSA 1VBD3 4UV9A 1GNZA 3PURA 3FDYA 3CZ6A 1KU9A 2FMLA 1DQ5A 2E7TA 3QYFA 2XPUA 2UUZA 1IO2A 2DAOA 4OI0A 2GC1A 5KNLA 2ISZA 5BNGA 2VT3A 4Y22A 2R0HA 3I4IA 2EQRA 2ZMEA 3K0LA 4XOGA 5KC5A 1QZZA 3PIOF 2BZDA 1Z7S3 4HF2A 3SYTA 1WLDA 2A6EF 3KYDB 1U5XA 2QQWA 5FROA 1ZK8A 3TDUC 1XB9A 5M5YJ 3C1DA 3WG9A 3OGSA 5E8GA 1OC1A 2ATFA 2CDPA 3LPGA 2Z5UA 3CJRB 4S2FA 3FMSA 1F5TA 3AC0A 5C70A 3TN92 3ZQHA 2DFFA 2DJIA 2HWD1 3K69A 4QGLA 4N7IA 2Q8OA 1RUG1 4BGDA 1HQLA 1EPWA 2MC3A 2PN6A 3HAGA 4YPJA 3CDLA 5E8IA 5JI9A 3GZUC 2IXCA 5FBJA 1N1VA 1G8WA 3S30A 1IUFA 2A3SA 3RJRA 4UY8I 4NC7A 2M9HA 3ZSMA 1HOMA 2Y9ZA 2BZTA 2TUNA 2P17A 2E7QA 2BNOA 1TE1B 1DYOA 3J4UH 4K9SA 5F27A 1DZQA 2SLIA 3S0MA 1H1MA 4PHZA 3RFRA 4YRDA 1QNWA 1SAXA 2ZGNA 3BCBA 4OI4A 5GZEA 2PMUA 4G6QA 4EROA 1H30A 3J80Z 3F72A 3THTA 4QQ2A 3U21A 3W21A 1U2WA 4QAWA 4XIOA 1UYXA 1UELB 2AQFA 2YSRA 1XOYA 4PDKA 2UZKA 3D1NI 1W6NA 5A3UA 5F3GA 4B4CA 2L2OA 4ZYGA 4LBNA 3C7FA 3ILFA 4GB32 5F5CA 1B9NA 2VW1A 4MGQA 3OL4A 3OYEA 3VKNA 1LDJA 1VBA3 4JX4A 2W24A 2GC0A 3OYCA 4ES8A 1LOFC 2WKKA 4M3BA 4WXHA 2VNRA 2O61A 4IO9F 4ETSA 2ZEYA 2BNMA 4MEYF 4BIFA 1EV11 3O2PE 3KYLA 1XRUA 2L7FP 2DOFA 1HRI2 4NN0A 1U6GA 4FAHA 4IXLA 1N3QA 2F5VA 1XSVA 1PIV1 1UZZA 5FLIA 4HEA2 3QWLA 5FAXA 5FZGA 2YB7A 3CJXA 2WAFA 1X7NA 3LEMA 3M7GA 1WCSA 4R4ZA 1R081 3WGIA 3A0NA 1IQDC 1Q1HA 4G8XA 3OD0A 2P5BA 4BE1A 4BKXA 1LGNA 3PVBB 3TW7A 5FO8B 5FXXA 4AI2A 4QTRA 4LITA 3VBUC 4ON0A 3PMSA 3RMXA 5BPDA 2WY8Q 2F5FA 3AVRA 4IJAA 4I3PA 1ND2B 1NYWA 2W46A 1WJFA 2XBO1 4KIFA 1O4ZA 3ZFEA 5A6QA 5CVUA 3TKYA 2VIXA 1N1TA 1PO12 3ACHA 2XH6A 4W6YA 3UK9A 4XDOA 3ABLH 1J0RA 2X5IC 3DU6A 1B35C 3I8TA 3GEZA 4CEYA 3JD71 5B1AH 3V56A 3BPSA 2IFWA 2V4VA 2MG4A 1ULOA 2ZEXA 4M00A 3LDKA 3ZLIA 3C2UA 5K0UC 2COBA 4BB3A 4DRRA 4BXFA 3POBA 5T5JA 3E6DA 3ZKYA 4Y13A 3KT7A 1LESA 2DUQA 2G1MA 1OUSA 2IAIA 4GZ9A 4BHPA 5FY5A 1DYKA 4KBZA 3CZUA 1EY2A 4XLAA 3ABUA 2YMZA 2DT6A 2M4KA 5DYMA 4G4FA 2RDQA 3OB8A 2FMDA 3ZDVA 1K6YA 4CZSA 4BLJA 1RYYA 2PHTA 1W8OA 5JLXA 3R60A 3JRFA 3DF8A 2QZ2A 1FYLA 1OQYA 1K5MA 4ZZ8A 6PAXA 4ZYDA 1PK6C 1I1EA 3DPLC 4ARXA 2A6TA 4DXSA 4NNJA 2ARXA 3WP5A 1OA4A 5JR2A 1XDUA 1FMWA 1Z78A 4ZPIA 3ZYFA 1BJZA 4A7YA 2R7OA 2F4IA 2GMEA 4PJLA 1ZBA3 1Y4WA 4EM1A 4BDZA 2VE9A 4BE0A 3KWVA 3OF1A 3HQRA 1E0EA 4ATFA 4LT5A 4RD7A 3BY6A 5EGOB 1K12A 3DPRA 1QDOA 1QF3A 1RHI2 3ISPA 4IERA 4OIOF 4O3MA 5A1AA 4DNYA 2QLZA 1IN6A 1Z3XA 2EFPA 4COVA 1YE9A 2P8TA 5GAEJ 1MBGA 1F2NA 4CU8A 5F6KA 4QPIA 2ZBJA 1POQA 3F23A 3ML6A 3CESA 5L36A 1DZRA 2ZSIB 1W8UA 2W1QA 1JXSA 2EIKH 3OR2C 3S7EA 2OPWA 3WUDA 2K40A 3UGHA 4Q48A 2RGVA 1OKOA 1ZBE2 3I49A 1A8MA 1H9TA 3H8RA 4L5JA 4I76A 3M1CA 2R7UA 1Z0XA 1GZTA 3CP2A 2DYRH 1SLIA 4DYCA 4JAAA 1UX6A 5LBQA 2GMMA 3VD5A 5EG0A 3A03A 4ONUA 4C0HA 1BQPA 5JSPA 2MD5A 5HCHA 1YI7A 2Q0OA 4A3GJ 3K1PA 2PLV1 4UB6C 2STTA 1FOKA 2RMU3 3M3EA 4C30A 4H7MA 3HC7A 1NCRA 5LD2C 3BQZA 3CF6E 2V1UA 4M3FA 3H7JA 4FXGB 5IP9J 1VMJA 1Q56A 1RUC2 4TV7A 1LHWA 5AC92 4HQMA 2CH0A 5IVBA 1PGSA 3U07A 1LVAA 4D94A 1AJOA 3ABTA 2VKDA 4QPWA 1XD7A 3VDDA 2W9XA 1NCQA 5JCTA 4F91B 5GAGJ 1V6MA 4Y1VA 1R1TA 2VQGA 1SBEA 4CEWA 4IHYA 3RCOA 1IC8A 2B0LA 4JQFA 1VQMI 1HRV1 3QPSA 5CFDB 4HA8A 3K75B 4XFGA 5B66C 4CDQA 4MIMA 4XKCA 1S0GA 1YS6A 1I3HA 4BACA 4WK8F 4UOJA 2DCJA 1GWMA 4HNUA 1M4WA 2DT5A 2D3PA 5DAXA 4CCEA 1VRH2 4XBNA 4XDQA 3LOIA 3ELNA 2GA1A 4XNFA 1XSQA 5JOWA 5L9BA 5FZ8A 1NY72 2YFUA 5EQUA 5F1RA 5HDGA 3RQ4A 5IY5H 4ZY9A 2BOIA 2PMZA 5F5IA 3JREA 2AO9A 4EQVA 4YG0A 4W65A 4HKLA 4LBLA 2A3XA 3ES1A 5KHDA 3I2HA 3BROA 2RDRA 2O8KA 1YW8A 2PJPA 3GFMA 1ULEA 1GSLA 3KM5A 1CESA 2GP3A 3I7DA 2VW2A 4OAYA 3LF7A 2FF4A 4JTNA 1RVF2 4YIFA 1QJY1 4JGZC 3KD4A 3IMNA 4BMBA 3LFUA 5FQ0A 3BTAA 3M2MA 2BYVE 4U88A 4BXUA 3F6VA 2QZ8A 2E1MB 4S2HA 4M6YA 3MW3A 4XZPA 2E63A 1OPOA 5JOXA 4QMAA 1AL21 3ZYPA 2L7MP 5FK7A 2XVCA 5FPZA 4EWAA 3GTJJ 2OCCH 4KU7A 4BU2A 4HPKA 2AC1A 4MH0E 2NVUB 4XMYA 4P14A 1ZZ8A 1GU3A 2DCKA 1YEWA 5CNAA 1Y8QB 5ABJC 1W7PD 2ZMNA 1R4MB 4UFHA 2RV9A 3VBHB 4CVUA 4BQYA 5CFCA 2FCTA 2ZABA 5CVVA 4WX9A 4LG3A 1MJBA 5EWSA 5FRAA 1N47A 1Y9GA 4P5HA 1GUIA 4E8CA 1TNFA 4TSVA 2IEKA 3ZQGA 4E7KA 1ZAOA 4Y26A 3BG3A 2FDIA 3LAGA 1BI2A 5BNOA 1G8XA 3SCFA 2J5OA 3POFA 3H42B 3B93A 3SQNA 5JWPA 1JJ8C 2RJ2A 5FD6A 3CMYA 1Y0NA 5K8SA 2ZB9A 1Y1WJ 2DU1A 2UWMA 4WVVA 4IEJA 3QP5A 5ILVA 2JPCA 1S0IA 4L92A 2OQ7A 4XQ4A 1UL9A 2VCBA 5LGNA 2HWF1 2E2HJ 4OI1A 3KZ4C 1J59A 3AJZA 1DQUA 3HRUA 1BBT3 1QU0A 2Q4SA 3GFIA 1HKQA 1FYUA 4AI3A 2JDMA 4BY1J 4HNTA 1X3UA 1TTYA 4CP9B 2GU9A 2NRAC 4U7BA 5DDJ2 1QDCA 1TME2 5C4WA 2VBZA 3ULQB 2WV0A 3LFKA 2QFEA 1TZOA 4LHLA 1E2XA 2CQNA 2WS91 3SHRA 3HNYM 1VBD1 2LD5A 3TOJA 3QACA 5DPNA 3EYIA 2GC2A 4XETA 4QT6A 1RRJA 4AGVA 1PGW2 2KIFA 4ZYAA 5KXDA 1GFF2 1OI6A 2R073 1OQEA 3BTCA 1HN0A 3S16J 5H9SA 3AFKA 1YFXA 3IH3A 1SAUA 2ORXA 3REOA 4BAYA 1NOVA 1EV7A 3OYMA 1ASJ2 3K9TA 2ZXJA 4KMUX 3G7DA 4O65A 1Z7S1 5FJKA 4LKDA 3WTSC 3HOXJ 3USUB 4IEZA 3VYRB 1YIJI 4PGHA 3DUIA 4C2UA 2CHHA 4XJUA 5FK8A 4Y52J 1B6AA 4MGRA 4O7XA 3TB0A 2VMIA 3P7NA 4DY3A 2BE5F 1RUD3 5FLXZ 3FLRA 5G04L 1C1FA 3LSRA 5JPMB 5FYZA 1AYN1 3IPVA 4NVPA 2AS5F 3V64A 5J48A 4R79A 2RS11 3AXDA 5LBEA 2Z33A 1W6QB 2XL7A 5CKMA 3BG9A 5A7QA 2EV6A 2WJSA 3EPZA 4R9AA 2JD4A 3K70D 4MADA 4N43B 3KMHA 4XOPA 4I2OA 5J09A 5D5UB 3JTGA 3S6PA 1ND3A 2ZHMA 4C8DA 2FD8A 3L1PA 2WLPA 2W91A 2H94A 4YGDA 2HXIA 1XN7A 1IS4A 4BQNA 2NVXJ 2EXHA 4RS5B 4HX4A 4MGZE 3JBG2 5HODA 3VDBA 3EMRA 2DQLA 3WTWC 4EGYA 3RDIA 3W6VA 3Q0WA 1VB2A 3VD7A 2K02A 3JAMK 3EUHC 1ZKGA 4WXCA 3HKZN 1I1SA 2FBHA 1OR7C 5HNHA 3AL5A 1YC61 3ZFFB 4AM3A 1MS4A 4LBQD 2WDBA 1XDSA 3FXMA 2XGCA 3ITQA 1CAUB 1J83A 3NQOA 4PCQA 3MEXA 4AEDC 2JA5J 5CU1A 1ULFA 3JR9A 2LH9A 3DKYA 1PX4A 4FFHA 5FLJA 1LU1A 4A3JJ 2E1OA 1JHJA 1IDZA 5F6FA 2OU2A 2PEXA 1AR93 3J8F1 4IEOA 1RMU2 1H8TC 5ANNA 5FPUA 5EEAA 3NV1A 2RNGA 2MEV2 1LOEA 3JRDA 3ZQFA 3BJAA 1Y8RB 2UU8A 4Z6YA 1B09A 1GOGA 4OQ8A 3LL7A 1HV1A 2HGCA 4XUNA 5LZ6A 2W1OA 3A01B 2ZZJA 5C71A 1OMIA 2VNVA 1APNA 1ZH5A 5B5EC 3BCAA 3HPGA 3CO2A 3GZAA 1XPWA 1RUI2 5KBFA 4XKBA 2XUEA 1UWWA 2GN3A 2ACJA 5FZCA 2C9KA 4ZH4F 3D8CA 4LE4A 1WH5A 2J1RA 2V26A 1Z1DA 3CUQB 2HOAA 3GTPJ 4LUMA 2YU3A 3PLQA 4OYUA 4AYBN 2HPIA 4XLPF 3VZOA 3ZN0A 3VSLA 3K4BA 1S9HA 1R1VA 4KNCA 5IWFA 3B9CA 2PELA 1T6GC 3NQHA 5FJ8J 1V54H 4TZDA 3Q8CA 3CDZB 2BY1A 1K83J 5DM7F 1UY2A 2L0KA 4YG6A 1DBNA 4AUXA 3MPBA 1IGNA 3D5RC 1JZ7A 3FN9A 3OYGA 1CQTA 5ILSA 4OUMA 5BNNB 2KHMA 4DO0A 4EN6B 3NWKA 2XF6A 3LSTA 3MGUA 3PTRB 4LHNA 3PVOA 2R061 4LIUA 3PQKA 2DTYA 3E3VA 3WG1A 1BW5A 4IKFA 2Y60A 5FDBA 4WCGA 1V55H 3F8MA 1SD5A 4O5VA 3PIJA 2STWA 2L54A 1UMIA 1YRNA 4Z2YA 4HX8A 3D5OA 2EZLA 2XKOA 5JPNB 3WU0A 1QO0D 3N9OA 5L3FA 5FZOB 3KHCA 3RI9A 1AU7A 1YJKA 3L9FA 3K10A 1NHAA 1HKSA 4PLOA 5FO7B 1FPN3 1IS6A 1O3TA 4F7ZA 2ZBKA 5E6HA 2WNVB 4OIPF 1GUUA 1SCSA 1AYM2 3S8PA 1RTVA 3SCHA 5CVRA 1G59A 1V5EA 4ZU5A 2PHWA 3WTTC 1EA3A 4M4RA 3VBFC 4AEJA 1FMVA 2GA2A 4RGKA 3TEXA 4JVAA 3KYCB 1VAKA 4PIYA 1V9U3 2K27A 3WU2C 3PFIA 1FOXA 1JI6A 4LKSA 5GADJ 2X0LA 2L4MA 1CF7B 1PM4A 1RC6A 4LO8A 2OUJA 4OQ9A 1LGBA 3H3ZA 1XNAA 3LGRA 3WP6A 2D6NA 2Y31A 1MEC1 2DK8A 4FFFA 5FYTA 2VMEA 9ANTA 1S8NA 1RUF1 3KCCA 4QPQA 1RIRA 3NV3A 2GXBA 2JRMA 4ES9A 5LBCA 2B46X 3H8OA 2FDGA 2YUEA 2XB5A 5A3OA 1A3KA 1ND2A 2DUOA 3JQWA 3FLTA 1MZBA 3WF0A 4N8MA 1UG2A 3VB2A 5GPAA 1YQ5A 3ZFEC 1D4VB 4UNOA 3PHMA 2Q30A 3AFGA 4IVNA 4UVAA 4HDVA 5GLTA 3NJVA 4OHVA 1MGTA 3OUJA 2W08A 2ZJQF 4M0NA 5F3CA 3K4CA 3ZYHA 2FDKA 1E3HA 3SHFA 5IOZA 1Z9CA 1RUG2 3K4JA 1TWCJ 4C1WA 2LKSA 3WGGA 4A3LJ 3AMMA 5BQTA 2K9QA 3NSTA 3QD6A 1ZQ3P 4Y15A 4BXSV 2CV1A 1ZREA 4Z82A 3WNNA 2DA2A 3QPHA 4MGSA 4CCKA 1POV3 4Y1ZA 5FYVA 5HLTA 4P9IA 5I0RA 5HLHA 3T3YA 2XGDA 5IW0A 1D0YA 1XGSA 1MSEC 3OBTA 3MLLA 3CCUI 4ZTFA 2VC9A 3WHCA 4NBQA 3HOSA 4RDUA 5GTIC 5FUIA 2XHKA 4LLLA 3ZSLA 1PDNC 5L3GA 5AFEA 3ECQA 3EDPA 4NIIA 1WGXA 4A3KJ 3MLKA 1C5IA 3M1HA 4TWTA 2YV8A 2H8RA 4FE7A 3VKMA 5EGOA 2PHXA 3RQ0A 2Z4FA 4CUCA 1CX4A 4B7KA 2RVCA 3V4GA 2MGQA 3IDEA 2R0FA 2O8XA 2D93A 5LW9A 2BY3A 2WADA 5E18F 5E3MA 3GF6A 4RS8A 4XFIA 2HZTA 1ETYA 4W6XA 4EN8B 2K5CA 2IC1A 3GXUA 4BUPA 1VQ4I 3O1TA 1XE8A 1SVOA 2VGDA 4K40A 4A12A 4TTGA 1YS7A 2IUWA 3LNQA 2L9SA 1VBE3 1W39A 1KQ8A 4F52A 1Z3YA 1LE8A 2VTXA 4X1EA 1PX3A 1A04A 2XJUA 4WM7C 3BWGA 1UU5A 1IGOA 2F6BA 1YQ2A 2CUFA 1YQ8A 2GH8A 4I30A 5E1RA 2VZOA 5J1XA 1R082 1HLVA 3KVAA 1RUH2 1KYZA 4BQWA 4CXXA 1PNFA 1I5PA 1W6PA 1MNEA 4HV5A 1ACIA 1QVUA 4IV3C 2AREA 3FJSA 3ABZA 5KHKA 5C3PA 1LB2A 5D6FA 5FFOC 3U4XA 2YY1A 4RA0A 5IAXA 1K42A 1ULCA 2ZGSA 4NWVA 4W97A 4FCAA 1YLFA 4D5FA 2D5FA 1Q43A 3SDBA 2XBO2 2GNMA 3MUZ1 3Q5FA 1YYNA 4G7ZF 3H5NA 1FIPA 1J9IA 1OCTC 2OZUA 3AP7A 1V5GA 3PIGA 2E53A 2HWC1 2D1VA 3S3NA 2VCAA 1IG0A 1W2TA 3SCGA 5F1JA 4JYKA 1UG0A 2W82A 3A0KA 4NRMA 1NLQA 2F5DA 2GIZA 5EFUA 4NE9A 2YU9J 2XC7A 4CEWC 3K7AJ 4A3CJ 4KBBA 3E1SA 1KS4A 5HS8A 4NO4A 4W4ZA 4XHXA 3LSJA 2VQUA 1BOAA 2VLAA 2G19A 4UI9L 5C33A 3UKNA 4NQWA 1YUDA 4P00B 4Y17A 4LPLA 1GWLA 4QQHA 5ERLA 5AIQA 5EJ3A 4EZ4A 5LFAA 2QKMB 1RUNA 2EILH 3AG2H 1XCVA 1GT0C 3IIAA 3FIWA 4DYQA 1X8EA 1US3A 4BQOA 4LOCA 5C3QA 2PFBA 2NAZA 3U14A 3B7MA 3U0ZA 5F0FA 5ANQA 3HT2A 4FPKA 1Y9QA 3VBUB 2R071 1WKMA 5DAVA 1RUJ3 3WTZA 2B9SA 2JE8A 1Y3TA 4XSZF 1WCMJ 2VQ0A 4GDFA 1FV2A 3AX4A 3AZVA 3MF6A 1W8NA 3H0DA 4AFDA 4URAA 5JMOA 5CYYA 1LEMA 3OWTA 1ZRDA 2XLAA 3NV2A 4JGYA 1QQIA 3HNBM 3KF3A 4ENJA 3L2HA 2R3SA 2X5IB 1B35B 3OOPA 4FPJA 3ZXLA 4CCNA 4XUTA 3CC2I 4BQ3A 1VQPI 2A3WA 4DNCA 4YW2A 4HLXA 1MZ6A 2G4IA 3IN9A 1RPWA 1UHSA 3L7WA 1SPPA 4E27A 3AM2A 5K0UB 4XRFA 2WAQA 1W2NA 3ZFGC 3WUCA 3VBOC 4QPGC 5CVJA 1H6YA 1BKZA 4JX6A 3QH7A 4G12A 2R1DA 3MEPA 1U5ZA 2W2IA 3AG3H 4YGBA 4HF1A 1KU7A 1Z7LA 5A3PA 5GAHJ 2BW3A 2O03A 3J80K 3T5XA 4Q4X2 5DQ0A 4PZJA 3S2WA 4CCLA 1F4KA 1VBC2 3PO2J 5EZHA 2ZX3A 2E2JJ 4A0YA 3W20A 5CFCC 4ZTJA 5J96B 1ENQA 4IDZA 1OPCA 1GP4A 4GAZA 2F4MB 4GH4C 2RG4A 4U2AA 3FKJA 1SFOJ 4LGWA 2CL2A 3IKTA 1MR5A 4YZ3A 5IPAA 4CICA 3VL8A 2JDZA 2QQ9A 2FBIA 3HRTA 2QQUA 4AU7A 1CIYA 4UW5A 2VTFA 4XABA 2J1VA 3DEUA 3P5BA 2IXSA 2PXJA 3MV11 5IAVA 3MKZA 2JVHA 4Q0PA 4P55A 3F22A 1MSFC 2KQRA 5FXZA 3GBGA 2B39A 3KV9A 2Z69A 1CR7A 4DQ2A 3ZSKA 1JYXA 4QHBA 3H1YA 2EAAA 2JENA 1DGWA 1SFEA 1O4YA 1VBB3 3FXRA 3VD3A 4CP9A 3F9KA 1SEUA 1HRV2 3MDPA 2WZR3 1ZR2A 3ERMA 3WG3A 3D82A 3BG6A 5IVEA 1AR91 1GQPA 5C4WC 4EN9B 3L2UA 3LSDA 4FPYA 5DTDA 2ZXIA 2K3FA 1GP6A 3BQYA 4A3EJ 2OT7A 3SNMA 4HXCA 3TEYA 4LBMA 3M3CA 2VBDA 3JSPA 4IGQA 1NLRA 1CN1A 4HQEA 1HQWA 2VL4A 3N36A 2Q8EA 3GJBA 4KGGA 5FOJB 4MUVA 5J36A 3RI8A 3WVJA 1QMJA 2K0GA 3G1OA 2M7AA 3WNKA 1D3YA 4HVQA 2J1UA 1MIJA 2R5ZB 4JX5A 1TQMA 1BBYA 3J9SA 4AFMA 2EBIA 2KD7A 4X6AJ 4AYBA 1W9WA 3VDAA 3SKVA 2DO7A 3H9GA 4CYCA 3S7IA 1V6KA 1XJAA 3V8LA 1TC3C 2AENA 2NVQJ 4XOTA 3C7HA 1QJY2 3LDBA 4UUSA 2W47A 1J5YA 3QBQA 3KP7A 2CSGA 1G7YA 1W6QA 1P4AA 2P5VA 4WF2A 1H88C 3OSFA 4N43A 3E6BA 1OCRH 5H6QA 4E6KG 2WZEA 1KS5A 3H7YA 2FZ2A 1YG2A 1D0ZA 2A70A 1OYIA 4AZZA 1FEXA 2IA1A 1HDKA 2EV0A 2BBAA 3ASNH 1FOD1 3VLBB 2HTSA 2F5EA 1IG3A 5LLQA 1WI9A 2Z16A 3B01A 1WHUA 4Q1RA 2KZVA 2K2SA 2WINB 2ZZQA 3ZFFA 2EV5A 1C8M3 5E1WA 5FY1A 1FPN1 4HW0A 3DTEA 4ZYHA 4KQ7A 1FOWA 1WUVA 3NEUA 1CAUA 4UW3A 1S1AA 1VTNC 4P9LA 1WBLA 5DXDA 4F92B 2VECA 2J42A 4XF3A 3DBHB 4JRAA 3TP3A 1BVP1 3ONQA 1L0OC 5A7WA 4HFSA 4PJNA 4IE6A 4A44A 3DKWA 4B3XA 2HWF2 4AOCA 1SEFA 1PVEA 2JWTA 2VMGA 4CU7A 2JD9A 5JLWA 2XWBB 5KXEA 4BY7J 2W95A 2WA0A 1NXMA 5C3OA 1KD7A 5FYYA 2OD5A 1FC3A 2XOMA 5FP4A 4JGZB 2JKXA 1QJX3 1S7EA 2JDKA 3S57A 1JGSA 4NIGA 4MNUA 1W05A 3M3IA 4FP3A 1REEA 1LENA 1XGMA 1OOPA 3DKQA 3MN2A 3PFYA 4XFCA 3N9PA 3F8CA 4P9WA 1QZEA 4XLNF 3O1UA 3BC8A 1XG1A 4M73A 2IXLA 3ZN6B 4BQ1A 5FIXA 1XMXA 1W2UA 1HSJA 1ZNPA 1RJ7A 5FLHA 2PHRA 1GZWB 2WWSA 3W59A 4LE3A 2IJLA 2Y6LA 1SD7A 4ITVA 2BGPA 4W1UA 1UPIA 4ORFA 4BQAA 2EIBA 2N8GA 1OCOH 4II2A 4KYWA 3LZZA 5ABJB 2A6WA 5BNQA 3NWTA 4OLLA 4XSXF 1W9FA 1IJWC 4YM1A 4UVCA 5IYBJ 1G3YA 1N25A 3JSOA 4M6VA 1IN5A 2LOOA 5BNPC 1SFYA 4P9JA 3HPNA 2RN7A 2HYGD 3ZN1A 1FPQA 5BNNA 3ME2A 4QU1A 5FYIA 2JZYA 4MGIE 3HMYA 3R4UA 2WRAA 2I10A 4PF1A 1AYN2 4J1WA 3LAPA 2YU2A 2RS12 2ZX1A 4DPNA 1USTA 1PHMA 3R0AA 2V1NA 3DBLB 2ORZA 2Z79A 4R4XA 1RKTA 3BCWA 2WB1N 1JT6A 4D7YA 3UT0A 2HQNA 2LSOA 1POV1 1IPJA 4IRIA 5E1ZB 4A42A 1MDMB 1DU6A 5D5XB 2RR13 4RQPC 2OJED 2IRFG 3I9V2 2HWE2 2RM23 1X9PA 1HBXG 3KCXA 1S6LA 3CMMA 2WNVA 4OFGA 1O8PA 4G9SB 1HKDA 1GVDA 4B1RA 2VKVA 2JG9A 1FBQA 2QUFA 3PM1A 3M4OJ 4AIDA 4M9ZA 1DQ2A 1Y7BA 1W6OB 3IDBB 4GA9A 4UW4A 5F32A 2ZX0A 2EFWA 5J1UA 3CCJI 4HSLA 5CQEA 2QBYB 2P2KA 1C57A 2DDUA 3OYDA 1N1SA 5I8TA 1CF7A 4UHTA 2V5YA 1IV6A 2Y6GA 2LBFA 2R041 2RDPA 2J7MA 3MVPA 2R7QA 3LAJA 3APBA 5I0UA 3T0AA 1BHGA 4V19K 2WFF1 3W5NA 4Q0UA 2CRGA 3SH5A 2MD0A 4PFOA 5CZKA 3BG5A 3FWEA 3J8F2 1VQ7I 1Q5OA 4N53B 3B69A 1ULYA 2V09A 4LHSA 3ACIA 1F8VA 4MTEA 1WFXA 2GM4A 3FE5A 5KR7A 3PVEA 3UYJA 1A35A 3WP3A 2RS32 4HK8A 1P9QC 4AK3A 2KISA 4Q4V2 2QQNA 5KXBA 3QAHA 3ZIWA 3WG7H 3LSEA 3O1SA 2IXHA 2DA7A 2HDWA 3KZIC 2EXJA 2GP5A 4CGZA 3P3NA 2PAEA 2GXAA 5FPAA 2RS53 2KMUA 4PJJA 1GV9A 1X33A 2WO1A 1GKBA 3BGAA 2A7AA 3NW4A 4CP1A 2ADUA 1ZZBA 3DGTA 1Y6IA 3ZSEA 4FQ4A 4X6QB 3QPLA 1AR63 1BI3A 4RB1A 4NHMA 3LIGA 5FZHA 4OIRF 5IVCA 2P6HA 3WNPA 1XNBA 3WHBA 4PF5A 4U7DA 2HU9A 5IP7J 2OKXA 4YFNF 4QQPA 4EQQA 1H9WA 2WNUB 2R062 2KP6A 1REDA 4AEDB 4OMYA 1R091 5T5PA 1J2XA 5KWRA 4RGAA 3KFWX 2J5PA 1C28A 4XRSG 1H8TB 3CCLI 3LCPA 4KITB 2L3DA 3MWMA 2WO2A 4DIQA 3N7LA 2ILMA 4HVRA 4FSJA 1YXWA 5IJRA 2E9QA 2LM3A 5DEQA 4BEHB 2VZTA 4BM8A 5LGTA 5DUXA 3IIIA 1OLME 3TAYA 4I0BA 2Y0SA 2NNYA 3WDWA 3H3VK 2CQQA 1MPXA 4OVEA 4XQDA 3TEZA 2CWSA 2P6CA 2E1NA 3LSPA 3GLLA 1V6IA 4LEJA 4WVWA 4M3GA 4IXAA 2RC4A 2VUJA 3ALQA 2MHFA 2D6MA 4RB3C 4P9YA 1WJAA 2H27A 2X1CA 1RUJ1 4C2TA 1Z6TA 3VHPA 1ZM1A 4E7JA 4MGYE 5FLXK 3UJQA 3DYPA 3BR1A 4A3FJ 2DFCA 2XVKA 3EO6A 2QTWB 4YZ2A 3OD4A 2X6XA 3GCMA 4GCVA 2ZEZA 4RL7A 1V0AA 1WLCA 2GWRA 4D3WA 4ASLA 3SJMA 2Y26A 1Z91A 4PBPA 1D1AA 4KN4X 3RKXA 4Y5TA 1FOYA 2VY0A 2QSHX 5FZMA 1WZ2A 3MI8A 4XW3A 1MEC2 1CZTA 4CDWC 2DMNA 1RUF2 4QWQA 2W1UA 4IRGA 3L2YA 1NG0A 1SLBA 3MHZA 1XSRA 5IVVA 2D45A 5FTTC 2JECA 2I2SA 1OYYA 3KV5A 3MBWA 2OTJI 2JDUA 2F48A 1TW2A 1VQNI 4XVHA 3GM8A 4E4HA 1W0PA 4A3BJ 2WAAA 2DTRA 1L7LA 2HH9A 4PIXA 3ZQIA 2VXZA 4FO9A 1K5JA 2ZHLA 5A1LA 3ZSJA 1JZ3A 2XIGA 2DODA 5A80A 2PYTA 2JDYA 1X8MA 5A3TA 2ZO4A 2VBBA 1W6NB 2CNAA 1OJLA 2KPMA 2M0CA 3CMGA 4D8MA 3SITA 1UD1A 1UCRA 3IV5A 5GALA 4QM9A 2JICA 3LA3A 3VBFB 1WW6A 2C5DA 3VZKA 4IL7A 5D1IA 4EYUA 1QVTA 5SV8A 1RZ4A 2KLOA 1ZTRA 5C7GA 2WZR1 2I07B 5LCWL 1V6OA 1AX1A 4QGNA 4I0WB 3MFKA 1BI1A 1CZVA 2K3PA 3GNEA 1APLC 1Q8SA 3ZQCA 3PUIA 1HXDA 4XRMA 3FK7A 1W5TA 3O0VA 2YC2A 2LROA 3E1F1 4FI9A 4DY5A 1X9TA 2HDCA 3OYBA 4GIQA 2ZMKA 3VKLA 4HV6A 5J98B 1CIWA 1XPXA 2ADEA 5FLMJ 2ZX4A 1T2XA 4P9FA 2R7EB 5FY9A 1IUYA 3NKTA 2R5YA 2QQMA 2HWB1 1YFUA 4LULA 1W1WE 3I3BA 4A6EA 3ZFEB 1PNGA 2UWBA 4JGYC 1ZARA 4L11A 2VAUA 3TBDA 4K21A 1FMD3 3ST7A 2X5IA 4COUA 4CHUA 1W04A 1XE7A 3AP4A 1AR83 5ED4A 4HKWA 4XM3A 4LTAA 2PG4A 2XRLA 3G71I 1H8AC 1VQ8I 2P6SA 1GOHA 2OA4A 4CU6A 1HA8A 2M45A 4IQ4A 2FRHA 1VQ6I 2OC6A 5BPXA 4LLNA 4CP2A 3H0GJ 3GX4X 2DFBA 3HD8B 4U0VA 4AWXB 4FFIA 1OVSA 2NS8A 3PUQA 2PX9A 2Z9OA 4AIHA 2VULA 4Q4Y1 1RNLA 3HRMA 2BERA 4N4NB 1H0BA 1PK6A 2CFXA 3FXQA 5LA2A 3JU9A 2GAUA 1JUHA 4L0YB 5H9RA 2VVDA 3TN93 4D7TA 2PHLA 3I2DA 4CUGA 2HWC2 1XYNA 3DP7A 4FQZA 2HTJA 3FUQA 4IF4A 5JXGA 4DJAA 3JAMZ 3WNXA 1C8M1 1JYCA 3T2PA 4IL6C 3V65A 1AWCA 2A71A 2TRTA 5CEHA 3COAC 2O7OA 1K45A 1Q8QA 1S0DA 1T39A 3LPFA 5EIYB 2FBKA 4IHSA 4FPFA 3S3OA 1YYVA 1XNCA 4XBLA 4ZYEA 4YW7A 4Y20B 1XQNA 2YBSA 3G3ZA 4ENMA 4AHZA 2XAJA 3DTIA 2NZ9A 5JDBA 3LD8A 2XXZA 3IZOA 4U87A 3H50A 2YC4A 3OIPA 5TRDA 4KMQA 5DUKA 3A21A 3LWCA 4WM7B 2EZIA 1X58A 1C4RA 4KU8A 5CADA 4JQRA 1RUOA 2RNJA 4B29A 1S55A 2Y64A 1OHFA 3CDIA 1QNYA 1VB4A 1ONAA 1S5LC 4LD5A 2BBYA 4A6SA 1YJNI 4IV3B 4A45A 3S32A 3SZGA 4XLEA 4DOZA 4GB33 3B9IA 2P5KA 4G9YA 5HS9A 2W4SA 1DZTA 1F4AA 4M4PA 3C2BA 3ESWB 1REPC 2A6XA 5M5XJ 3KT4A 1OXCA 3RIRA 2YPJA 3Q3SA 3NNFA 3EQLF 2OIIA 1IN4A 1HRI3 2VE8A 3WODF 2VZVA 3MIGA 5JUVA 1R5GA 3ZDSA 3B6CA 3MCZA 1P2FA 1G6NA 4Q4W2 1AJKA 4QXKA 4TN7A 1WCKA 5J1YA 3WD5A 1DU0A 4MYEA 1VQOI 1JTXA 2WSUA 2R30A 2HQAA 3AG4H 2XG3A 4HSTA 5FXWA 3TO9A 4CEWB 2VBXA 2VN2A 2FA5A 3ZR8X 3T1LA 3W2WA 4XCBA 3RWNA 3I3DA 1VR3A 2E34A 1DYPA 2DMUA 3J7MA 2FBEA 3LB9A 2Q0AA 3AP5A 1OSGA 1DPRA 1UXXX 2ECCA 1HF0A 5JLVA 2QKDA 4RHV1 2YYOA 2L9LA 1MMDA 1PO13 3TO6A 1W90A 1YIPA 1US2A 5GLWA 2ARAA 4JX0A 2QQVA 3OGRA 4CE8A 4IX7A 2RDNA 4NWWA 4Q47A 1KYWA 3EUKL 4DBRA 1CAXB 3H3UA 1DU3D 4GWNA 4ITCA 4NC8A 1JBCA 2P4EA 3WV6A 4GWJA 2XASA 4RFRB 5DZGA 3ATGA 5I0TA 3OIOA 3I2GA 1BK1A 3RGBA 1GMMA 3ZN4A 2ZX2A 3RKQA 4XBQA 4FXKB 1QA6A 3UESA 4R52A 1R00A 2V7FA 1IF1A 4YARA 3H0OA 1EPZA 2XVGA 1MMNA 2VQLA 4K1YA 5JOZA 5FP7A 3CLPA 5FY7A 5F6LB 1TWAJ 4B09A 3GZEA 2Y2ZA 2DTWA 2FQ3A 1OT5A 5DN2A 1AR71 4D7MA 2WN3A 4BJ6C 4XBFA 1H89C 2NS7A 3ZN6A 2A5ZA 3ZFGB 1E3PA 4EGZA 4QPGB 3OYFA 2EIDA 4ABZA 2R1BA 3E6MA 5FJHA 5CVIA 4LB6B 3AKZA 2W68A 2OBPA 1RHI3 4YYOA 2HR3A 4HF0A 1W0OA 1N75A 4M3CE 4GALA 4YRVA 5LBBA 1YITI 5FUPA 2XF7A 2P3JA 2RS51 5CFCB 4YIRX 1S0JA 4GH4B 1HW2A 3ZCOA 1NT0A 2QJVA 4R9DA 3HBLA 1CVNA 1X1BA 4XEZA 1HW5A 3U37A 3NVCA 1AR61 1ZVFA 2BTVC 1ZBE3 3ETQA 2IBDA 1W5SA 3BALA 4GFBA 2Z3YA 2BEOA 1R7JA 4ZXKA 2XL9A 2Y0IA 3J81K 4JK1X 1LHVA 1GV5A 3ZYGA 4CTEA 2EJRA 3M8LA 2GDFA 2WWYA 2ZGMA 3VD9A 1D7PM 4D0PA 2BOJA 2JWPA 2VKEA 2WWJA 3H9JA 3MKLA 5H2FC 3IC7A 3R0JA 1J84A 2FHRA 3WW2A 1NAEA 1ETOA 1NG7A 1FOD2 3OUIA 2Q8CA 5C4WB 4E4SA 4A7ZA 1BMV2 1K61A 1AKHA 1W5CC 3N97A 2WFPA 1POV0 2KDZA 3JCIA 3AYAA 1WMEA 4YIIA 1XTAA 1X3WB 1LFUP 5C3SA 1RR7A 2O8OA 1RUC3 2JG9C 1NK2P 5AC93 5EYYA 4V2FA 2MNGA 2ESHA 1W6OA 2IVMA 2HOTA 2HS5A 4COWA 1PP7U 4P9XA 1DF0A 3BR3A 3ZRGA 2KRFA 3HPHA 2XUMA 4ZDOA 4HBLA 5ICFA 4MX3A 4E7ZA 1UNBA 3WNMA 5JMCA 3G1LA 5BXXA 4OHYA 4MHUA 3WR0A 1UMHA 3PNYA 2QENA 4XMIA 1LJ7A 1OKQA 3AVSA 1IQAA 1PJRA 1FBSA 1B72A 1NQJA 3HOYJ 4JTOA 3WDVA 3WW1A 1VRH3 2LNBA 2VJIA 3IWZA 3B5LB 3W5MA 4CCOA 3U9GA 2PJRB 3OIQA 4BK4A 5K7ZA 3JRHA 2JQ7A 2OX0A 2W1WA 3ILRA 5M5WJ 3S1QJ 1HLCA 1XXNA 3K70C 1T2KA 3AL0C 3CIHA 1DQ6A 1UJ8A 1BXHA 5APAA 5C4JJ 1LNSA 3TO7A 2ET1A 1YI9A 4RMNA 4YLZA 3K51A 5T5OA 4OHZA 3DBRB 1B59A 3OR1C 2LMDA 1FAYA 2YZ4A 1S2EA 4UAPA 2G9WA 2XAQA 1AA7A 3DQVC 4K8FA 3WF3A 5EJ1B 1RVF3 1B1BA 3EUHA 1WKYA 2E2IJ 1NE6A 1I6XA 4RYDA 5I8YA 4BQ2A 1OR7A 5CIRA 1PVC1 5IYDJ 5FXVA 4OHXA 1UYPA 4Q26A 1DFQA 2ELKA 3KVBA 1PMJX 3VSKA 4XDPA 2VJ5A 2W25A 3I56I 1SLCA 3L2CA 4AEDA 1AX2A 1QPIA 1LOBA 2NN8A 1MS9A 1DPUA 3DF0A 4OMCA 3O1VA 3I2OA 4GKXA 1ETQA 3UKVA 2UWCA 4BDYA 1A8DA 5JHFA 1UIJA 3GDBA 1BCXA 1WGPA 2Y30A 3FBIB 1H8TA 2AZ5A 5EEGA 4QKNA 3RYKA 4KWLA 4ZDPA 3GBFA 3P5JA 4QU2A 1ODDA 3OV8A 1IPKA 3BTIA 1WQ2A 1JYVA 3M8EA 2YG0A 2ZOEB 3PMEA 5E79C 4BEHA 1JHHA 2ZNYA 1B8IB 1RGSA 5HCFA 2RKHA 3NNJA 1U0AA 3NAPC 3SXWA 4V1PA 4L5IA 1H0MA 1PVXA 4M01A 3P1IA 4XUQA 4OZXA 5L9RA 1DGRN 1R36A 2PBIA 5ACA1 5D8AC 4CU9A 4B7EA 3MKYB 3T2OA 2X6WA 3LFIA 2D40A 2P81A 1A6IA 2DBIA 3BZCA 3MZYA 5FO9B 2KJBA 4KWJA 3MICA 2QQLA 1Q1VA 1H2MA 4IETA 3LA7A 4FPLA 1IRXA 1QH7A 4RN5A 5A6YA 5IFTA 2TDXA 4Y5Z0 2M4GA 1YX3A 1JYWA 2XROA 4YG2F 2R042 1JUSA 4X8PA 3ACGA 1FMD1 4YFZA 3DTKA 2WFF2 2AXLA 5BNPB 1FSHA 5DDJ3 1TME3 3FHAA 1LPQA 1T08B 1PZ8A 1WCDJ 4FOVA 1H2LA 2COMA 2WT0A 2CAVA 2CGPA 2NMNA 4FX0A 3ZMVA 2CYFA 2WO3A 3R6SA 2D1HA 1FXZA 2EIJH 1DGWX 4L99A 4Q0QA 1ZGAA 4FISA 4FPCA 2OQ6A 3SZPA 4NIAA 3ZMZA 3CCQI 4Q1PA 5LASA 3LEIA 3N7JA 4QDRA 1YRNB 1F4HA 3LEGA 1EYBA 2JE7A 4J25A 1ASJ3 4IQPA 2HVRA 1UZCA 3AP9A 3ENRA 5FZ3A 4BS9A 2X53S 5CA6A 2QQBA 4PDWA 3W6KB 3JTHA 2ET7A 4PI2A 1OFNA 2A75A 3OYKA 2XSJC 1TQ5A 5LHHA 2JDHA 1FTZA 2E36A 5IT9K 1F15A 4DUXA 2WY7Q 4LQRA 4AVVA 4QX3A 4RM3A 3T2TA 2WO7A 1JTYA 3NNMA 1ZZ7A 5I91A 3RYRA 2DDAA 2RJLA 3Q9VA 1TEIA 3L09A 4CZCA 3VBFA 3MLJA 4CA9A 2W85A 2ISYA 1QJEA 5GLVA 3WDTA 4PSXA 1ZRRA 3QYEA 1F9NA 1SMTA 3CF2A 5FZDA 1WD4A 1R092 2Q5TA 3IT8A 1U12A 4PIZA 2W39A 1V6LA 2VCMA 3HNMA 1BOBA 3BPXA 3THPA 4AQ6A 2XONA 2VC0A 4J6GA 2JIJA 3IH4A 2WA4A 2FQ4A 3O14A 1I5ZA 4MEXF 4FHTA 3JBG3 1QXRA 4GMP3 2Y38A 4INDA 1S0BA 2WAOA 3OYHA 3K2AA 4MFEA 2X8KA 4B3NA 1SFUA 1IN7A 2ZS6B 3BIWE 1BR1A 2W0XA 5FYMA 1O57A 4K6BA 1YNAA 1GANA 5FZ4A 1VF9A 2LRPA 2VZUA 1TQPA 3FFZA 4Q0SA 1KJRA 1ULPA 4UT5A 5BYNA 1MBJA 1CD3G 2R7SA 4GB31 1EF4A 4K7JA 1GWKA 4GO1A 2D5HA 4COZA 2NMOA 2V9VA 2JK3A 3N05A 1MMSA 3GHMA 5L7OC 2G0EA 3I4PA 1L7QA 3K1MA 5LY2A 2HEOA 3K4MA 4HMZA 1J09A 1DP0A 2WZ8A 2KZGA 3VGIA 1RMU3 4OZOA 2W48A 1BJQA 2MEV3 2B5HA 4XFFA 1I3QJ 4PSWA 3ROUA 1JW6A 1NQDA 4B4QA 3BIEA 4Y1UA 1IXSB 1IDYA 1W99A 2C1FA 1WW5A 3NJZA 1CPMA 4CO8A 1TWGJ 4ASNA 2YXSA 3MD2A 2R7XA 1YW9A 4QX2A 1UW8A 4I0AA 5F5QA 2WA3A 5AVPA 1WJCA 3BT9A 2DWRA 2P1BA 3F8FA 2DF7A 3CL1A 5JOYA 3W2VA 4KGQA 4YSFA 1O3SA 2HQ5A 3CKHA 3FM5A 1AZDA 1RUI3 1QOTA 2ZJRF 4RAFA 3CLQA 3THCA 1JTZX 4I6ZA 1FLIA 2H8WA 2CV0A 2JA2A 4QGMA 1BC7C 4D1QA 3N7KA 3ZOIA 2MABA 1G9DA 4OOIA 1W36C 5JI6A 5F64A 1ZG1A 4DEVA 3A7QA 1PO11 3BOPA 2OF7A 3DWLE 2PAMA 2AHQA 3ETPA 1FNYA 2JJ6A 2LDUA 1J3PA 3RPUA 3BJOA 2E31A 4OIQF 2DVGA 3GHNA 4LBKA 1TL8A 2NOGA 4Q2FA 4XFAA 3RZHA 1QJU2 5T5LA 2Z42A 1DLCA 1UHMA 3DCQA 3NRVA 1XMKA 2K9MA 4E7HA 4XLFA 3KEQA 5FB2A 3I4NJ 4BIOA 3V8JA 3HEFA 1OD3A 5FUNA 4Y20A 4FTEA 3U1XA 3W2AA 5L3EA 3LA2A 2LC2A 4WZFA 5BV6A 5CYVA 3O6BB 1JKQC 4CPBA 4FVVA 5FP3A 2XSDC 1AVBA 2UURA 1LE8B 1QHHD 1TNSA 2Y34A 4WM7A 1RXFA 3C18A 5D6EA 1O59A 4B1MA 4N7UA 4CDWB 2QQPA 2XJPA 1O3QA 1W3XA 3RZDJ 1W6PB 4LG0A 4UWDA 3UETA 5D4SA 3ELKA 2VPRA 4IV3A 3VWBA 3AJYA 3VHNA 1AYM3 3PSFA 2IZWA 2M5WA 3PNVA 3KLSA 2VM9A 3HB9A 1RHI1 2V79A 5FZLA 5L9VA 1COV1 5A6XA 2HWB2 4MSVA 1MS1A 1DQ0A 4E70A 4PGGA 2CWMA 2VOXA 1BR4A 1PO22 4JCKA 3KIOA 4EJOA 5FYCA 4XLHA 4QX8A 3MO4A 2E7XA 4IGOA 3GFJA 5CFDC 1UMQA 4IHWA 3R4SA 3ECHA 4AI8A 4DXTA 3OEBA 1OF3A 3KQRA 1X4PA 2L7ZA 2CO5A 4EN7B 5A3LA 2YHJA 1KGSA 4IPAA 1WJBA 3CO7C 1FWZA 3NV4A 1NLSA 3PNTA 2YR2A 3PUAA 3NARA 2KIMA 2QEXI 3C2GA 4E9KA 2R7FA 3W58A 3PDQA 1IHMA 3EQEA 4QLCU 1QQP1 3KPHA 2VNGA 4NQWB 3BZKA 4AAPA 3OYLA 2OV7A 1C3HA 4Q4Y2 4IE5A 2XUBA 2DK5A 3MW4A 1YLLA 4CXWA 5FY4A 1TMF1 1QHDA 2VZRA 1DCSA 1H1IA 4S2DA 4HLTA 2E5NA 4BLIA 1V5FA 4NDLA 1U5YA 2QWWA 4B4RA 2XJQA 4MZUA 4Y3OA 1RUC1 1CAXA 1RUG3 5AC91 5E88A 3MAJA 3QP6A 1YQCA 4HONA 2KL4A 4XJZA 4IHTA 3HSRA 2E1MC 5EYRA 4X6RB 3RMYA 3A0BC 5FZ6A 2ZGPA 4A6OA 1RUE1 3WT3A 3GTMJ 3RTRA 2QYOA 5DD8A 2PMHA 2HQRA 2FXAA 1UY3A 3VEPA 2JG8C 3QLQA 2QQKA 4JGYB 1CAVA 3CJNA 1A5JA 4ZU4A 5JVVA 2DA5A 2MLGA 1PGL2 3EUAA 3DCFA 1BEV2 1HSTA 2DVFA 4BJ5C 1MZ5A 3B3QE 3FXUA 5GKAC 2V6EA 1DIWA 1SPPB 1HB3A 5A2QZ 4MXVA 4N9HA 3VBHC 3ZFGA 3VBOA 3QOEA 4C3JJ 4QPGA 3VKOA 2P4WA 2WL1A 3F0CA 3L2QA 3ORJA 3M9AA 4C0BA 4UVBA 4AI0A 4OMZA 1T33A 2TCTA 3GMEA 1CJDA 1OYWA 1W6MA 1OQ1A 3T4HB 5J4VA 4XLCA 5K5RA 3OBRA 2BW3B 5KAIC 1MQTC 5KAFC 5HDKA 1AUYA 4DUVA 1VQ5I 3ECOA 2VTXJ 2XJRA 3I3EA 4GH4A 1T56A 1EAH2 2D6OX 1PZ9A 1YRZA 5JIUA 2YROA 2XJTA 3TGNA 2Y6JA 4BQ5A 2L01A 2MC4A 1UMZA 4A2UA 1DUXC 2GOXB 1RVF1 5LB6A 5D4RA 1ENSA 1S2BA 4FPEA 1Q8VA 4CDGA 4Q5SF 1ZZ6A 3IDCB 1U78A 5FY8A 1LVKA 1R083 1RUH3 2XKPA 2VPLA 2EALA 3HVDA 2P37A 2BRTA 1STMA 4AAXA 4DXZA 4DZGA 3WNOA 1G9BA 2WABA 1Z7UA 5TSWA 1WJEA 1ST8A 1R1A1 1LHUA 3VOEA 2HI3A 1IKQA 2XPWA 2Q8DA 3FK6A 3MZ8A 2CW0F 1MH4A 1WLWA 4BQXA 2NP0A 3NJYA 1G9AA 4IEPA 3ABKH 1EUTA 2XBO3 5T50A 3ZR6A 4RHV2 3BR2A 1S7OA 1JGGA 1SBFA 2A69F 2EZHA 1IZ3A 3S17J 2K46A 3J7AY 2R7ZJ 1XBFA 4LK6A 3VBRC 1R1ZA 2WUHA 4AVSA 5KHJA 3HOUJ 4KH9A 1O4TA 3A2KA 3ACFA 2A5WA 1SLLA 4HVOA 3ZQQA 2VUCA 3RZGA 1RL3A 4WM8C 1S3JA 4YG3A 2OA2A 1I9RA 3WX5A 1NG6A 3BODA 2ID3A 2VXDA 1JKPC 5CKTA 1ZGJA 3HOZJ 4B44A 2LR8A 2VQHA 1W3VA 4CYCB 2A6ZA 2V1DA 5HV0A 1S4CA 4E8DA 5HOOA 1AXKA 3RVHA 4CXYA 2XB0X 5H9QA 1ITYA 4UUSB 2R92J 4IGPA 5FZ0A 2VE1A 3HSFA 1KXGA 5DDJ1 2PJRA 4YNIA 1A36A 4RS5C 4QIWN 4PLMA 1ONVA 1AR72 1YIFA 3BG7A 1TWFJ 5CB7A 2IXJA 1G3SA 2NLRA 3WHUA 3KX2A 2J1SA 5LGUA 5C44J 2X10A 4Q29A 5F0HA 1JT0A 1O5LA 3CCRI 2CMPA 1JOBA 1ON2A 2EFQA 2P3YA 4BJTA 1W8HA 3WQ0A 4QXHA 3ZGKA 2Y0MA 2GOMA 2YFZA 4LLOA 3ZMUA 5HV4A 2VVEA 3OOUA 3H35A 3NL1A 1OBNA 4EMSA 1UPSA 5FRMA 4BBRJ 4MQ9F 2JB4A 3I2JA 1D4M2 4G7HF 2XPJA 1JN2P 3FC0A 3LSKA 1SFKA 3CNAA 3CJTB 4BK5A 2HWVA 1T0FA 3DLLF 5F7UA 1QXPA 1ZZCA 2E35A 3OYNA 5C8CC 5A7WB 2OXBA 1VBA1 5LA1A 3V7SA 2LK2A 2MW8A 3X29B 4COYA 5E17F 1V70A 3OJBA 3DXUA 1X2MA 1JXNA 2XAFA 2GMPA 4O9GA 1TLHB 4Q4X3 2VL8A 2EIGA 1OF4A 4C90A 1VBC3 4IUGA 4LIVA 1X3ZB 2VOWA 5FYUA 1ZYRF 2EZKA 4CDXA 2D7FA 4QKFA 1E5HA 2XV4S 3BLYA 1B8IA 4XF1A 2P0WA 4A0ZA 1OOPB 2Z1DA 5AONA 3HWJA 3JBG1 4YGEA 4ZXEA 5K7PA 4XRSA 1CAWB 2A5YB 4GMP1 1VQ9I 4GGGA 4I02A 1G9FA 1IKPA 5KXCA 1W0NA 4B8EA 4EJWA 1IXCA 2BOLA 1XC5A 4MXWB 1ETKA 1OCPA 2F4LA 2E7AA 3HOBA 1HXS2 2CQKA 3J7YJ 2Y33A 4IEYA 4PI0A 1OCCH 4EJTA 1QH6A 2PHDA 4W50A 1ZA4A 4NR1A 1F5JA 3J7AO 4QB1A 4E7LA 1W7PB 1JUIA 1R4NB 1OUXA 2JX9A 3U2RA 2BQPA 3TL4X 1HRV3 5BNPA 3BP8A 2ME0A 5JZGA 3M70A 3NWSA 5K1YA 2DI3A 2MEV1 2JA7J 2AUYA 4QPOA 1XGOA 2IGOA 4XF0A 3O12A 5DUWA 4ZHNA 5EZGA 4N90A 4GYGA 4NHXA 4U0YA 2IVIB 5DCMA 2VI6A 1TNTA 1HX6A 3R05A 4ZJZA 5HXVA 2MPFA 1ZRFA 3SH3A 4FX4A 4NRQA