3LA7A

Crystal structure of ntca in apo-form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
209
Chain Sequence
DKALANVFRQMATGAFPPVVETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Global nitrogen regulator
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
total genus 65
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la7A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la7A01
3MQ0A 1TTYA 3VODA 4A6EA 4AVPA 4EM1A 2P17A 1DPRA 4N0BA 5HS8A 3DN7A 3I64A 1SMYF 1L3JA 4ONUA 2A07F 1AOYA 4ZZLA 2DTRA 2W57A 3PQJA 4MV2A 1ON2A 2A6EF 4PJYA 4IESA 1RIOH 3IL2A 2ACJA 3UKVA 4EJVA 2XLGA 1DDNA 5AONA 5D1IA 2EFOA 3J7AO 6PAXA 2CO5A 3EQLF 2HWVA 3HT2A 5CVRA 1FY7A 3R61A 1ZVFA 4LG0A 1LB2A 4A5NA 1QBJA 4EGYA 2ETHA 1RTVA 5JVTA 3S7EA 1X8EA 3V8LA 2VN2A 3KP7A 1EV7A 4M6YA 5BPXA 1WA4A 3R0JA 3WGHA 4EJOA 1ZRCA 3FXRA 3NW4A 3F23A 4XBFA 5J6XA 3LOIA 2WV0A 4UXNA 1TBXA 4RS8A 2J5PA 2CGPA 4AXOA 1X3UA 2IXLA 1W5TA 2EFPA 1Z9CA 2O8QA 4EWEA 2NS0A 3F8CA 1YLFA 2HQNA 1E17A 4OIOF 3CUQB 4HSJA 5D8KB 5ICGA 3WTXC 3GFMA 4IRGA 3CO7C 1EP0A 4M6XA 4X6QB 1YS6A 3FM5A 3K1NA 5BV6A 2EWNA 4LLOA 4P9UA 3F72A 4Z2YA 1FWZA 2HZTA 2D1HA 4BHBA 1IN4A 3JZVA 2HS5A 4KIFA 4GO1A 2M30A 3HRMA 5J48A 3VEPA 3KFWX 1K78A 5CADA 4MTEA 1DPUA 1TLHB 1EH8A 5EEGA 4LUKA 2H94A 2OZ6A 2IJLA 3E3VA 2MPFA 2M1BA 2BNNA 3SHFA 5J8FA 5E1ZB 5IT3A 4YNIA 4JQFA 1S29A 4HX4A 4ON0A 4CYDA 3COAC 3SCGA 4HZFA 1QQIA 5JR7B 2RV8A 5J7MA 3SZPA 3NEUA 3REOA 2GWRA 1YW9A 1BJAA 5EZWA 4HN1A 1U8RA 5LEJA 2ZJ2A 4IXAA 3FWEA 4MX3A 4MGYE 5LGNA 2XAFA 5KHGA 1MDMA 4XLNF 1J3PA 3IRRA 2O3FA 1MD0A 5HOOA 3H50A 2EJRA 1SFUA 3IKVA 4CZZA 4KFCA 2D2WA 2O0YA 3ABTA 1SD5A 1S8NA 2KIUA 2P6TA 2O6GE 3SFZA 3IIAA 4KICA 1IN5A 1EPZA 1XMAA 2NYXA 1PP8F 1FNNA 3USSA 1KU2A 3ABUA 4UNOA 1FYMA 2DAOA 3BDDA 2MHFA 4NQWA 4G9YA 2VOOA 5KHKA 3FM3A 3RPQA 2XHKA 2K7LA 2HR3A 1X8MA 1TNTA 3M1EA 3PNAA 3FZVA 1Z05A 2YX7A 3ECOA 4QM8A 2L4AA 4XFIA 5D5WB 2VBYA 4WXDA 4IERA 5F1RA 4HVOA 4S05A 2CWEA 1YFYA 2FQ3A 5LEKA 3QACA 2Y0MA 3NJZA 1TQ5A 2LNBA 2YX4A 4ZU7A 4I09A 5HDKA 2HEOA 3ETQA 5I0UA 5KHIA 4A12A 3KZZA 5DCMB 2QQAA 3FMRA 1L3LA 4J1XA 1OYYA 2O03A 5BPIA 3H7YA 2LDUA 3QPTA 4UBGA 1XGSA 4JTOA 3R4KA 3TOBA 3E5UA 2L01A 1J59A 1WSUA 4TV7A 3R6SA 5FLXK 3ES1A 3ISPA 1CAXA 1YS7A 2V1DA 4D0PA 1OPCA 4HF1A 3S0MA 3ZDSA 2RN7A 1OKRA 2V9VA 4B09A 1I1GA 2ELHA 4Y15A 5HVQC 2E7WA 1NYWA 4LTAA 2L3DA 4R8HA 1RL3A 4WXHA 4Q48A 2RDPA 4XEZA 3LAJA 1KQ8A 1LKNA 1DUXC 2XL9A 1KYZA 3HUGA 1JE8A 3EYYA 4EGZA 3L00A 3FXQA 3N97A 5I8SA 2UXNA 3F8BA 4I3PA 5ERIA 1RI7A 4O3MA 4M74A 1FYKA 2BYVE 2XL7A 1TQMA 4UVBA 1IXCA 5FO5A 1QZYA 4M9ZA 3BPZA 3H8UA 4CO8A 4M73A 2IA0A 1WQ2A 4Q29A 1R5GA 3WE2A 3WE3A 1PUEE 1VJ2A 3FF5A 4KU7A 1O3RA 3GFLA 1FBUA 2EAAA 4L18B 1ZREA 4M9XA 5H20A 2EA2A 2GIVA 1BN5A 3GEZA 1ZAOA 2AXLA 2XKPA 2EFQA 4KMUX 4PZJA 2V1XA 3LWFA 1ONVA 2FXAA 1QNTA 1VTNC 3DL3A 3RNSA 3F8MA 1ZZ7A 4ZZDA 1BI0A 3ZN1A 3IRQA 3JSPA 1A04A 2A69F 4Z82A 1FI2A 4META 4N9HA 5A2QK 4F7ZA 5K5OA 4EWAA 1R1TA 2DPUA 4LMYA 4U0VA 1Z6TA 4MGZE 1XDUA 2L54A 4LD5A 2W25A 1OYWA 2OD5A 4IETA 4FX4A 3LA7A 2VQAA 3GX4X 4I02A 1BOAA 1XE8A 1ZH5A 5FPZA 4YFNF 3GO5A 3ES4A 3E6MA 1LDKB 3RJPA 3C1DA 2GQQA 2VBXA 3MPBA 4EJWA 5HI0A 3EDPA 5BS6A 3WTTC 3NL1A 4Y17A 4OINF 1CAUA 4I01A 3KZYA 5DDGA 1P4AA 2PBIA 4FHTA 4PIYA 2XLFA 1QY4A 5LLQA 2H6CA 2X4HA 3AAFA 4U7BA 5HLIA 2F5CA 4KN4X 2ADUA 4MNUA 3IDBB 2GZWA 2IW5A 5J3UA 1Z1DA 1B4AA 2Q0OA 4A5MA 5H6QA 2XV4S 3FXUA 3F22A 1XSVA 5JSPA 2QWWA 3CL1A 2K02A 2Q8KA 2A3SA 2DPDA 4RAZA 4HQEA 2YU3A 4ZU4A 2KIMA 3JTHA 2V09A 5T3NA 3NRVA 3IKTA 1ZG1A 2BEOA 3W6KB 3EETA 2QJVA 4QGNA 4R1HA 3G73A 3IHUA 2ISYA 3HYIA 3K0LA 4HMZA 2XAJA 4IRHA 4CICA 4KIGA 1QWRA 2FSWA 1QO0D 5JR3A 4LG0B 3K1PA 1H9GA 1ZLJA 2QQ9A 5LGTA 3HT1A 3KGLA 1ZARA 5E8GA 1JHFA 3LQRA 4HV6A 3P9CA 2CV6A 3TO7A 4BH9A 1V3FA 1SEFA 1ZZBA 2FEZA 1IF1A 2Q4SA 4B8XA 4JV4A 1Q5OA 3I71A 2HDCA 4CXFA 2ZFWA 4EQQA 3H3UA 4NB5A 4ENMA 3GYHX 4HYEA 3QU3A 2H0VA 3RPUA 1T6SA 3SXYA 4AQ2A 5ICCA 2DI3A 1PP7U 3NQOA 3H92A 4L9JA 3ULQB 1HW1A 2XLAA 2N7GA 4ZYGA 3LFKA 2PMHA 4GULA 2MBFA 4WBBA 4Q0UA 3E97A 1SD6A 3ZN0A 4AQ6A 4WX9A 4BNCA 4ASNA 2LKPA 5D6EA 3KP5A 1K78B 5CYVA 3OGJA 3ST7A 2WC2A 4MEXF 1HSTA 4OFGA 5K5QA 5LHIA 1IN7A 1O57A 5K8SA 2OBPA 5LBQA 4IEXA 1KU9A 3P9KA 2QVSB 3DKWA 4LJZF 3C3WA 4IEWA 5LHHA 3HHHA 1ZGJA 2B9UA 3FE5A 4HQMA 3BROA 2IXCA 4AVCA 2GXGA 4Q5SF 5D4SA 4JVAA 2G7HA 2R3SA 2J5OA 4XETA 1EH6A 1UIKA 3JTGA 3DPLC 3CO6C 2VOPA 3KLNA 4XF1A 2Z69A 4LLLA 1MDMB 3RYRA 2F4PA 2MNGA 2Q30A 3BPXA 3JW4A 4AIHA 2XVCA 4EJTA 5I0TA 2E9QA 1HKQA 2MH2A 1WWXA 3GYDA 3GXOA 4B29A 2W85A 3CEWA 4G7OF 2XGXA 3RKWA 3KLOA 1G3SA 3BZ6A 5C8WA 1D3YA 2RKHA 3M9AA 1VR3A 3KSCA 2MA3A 1ZHFA 1LDDA 2EB7A 4KN7X 3CDHA 2OQRA 3OTFA 5DUKA 1CAVA 3HSFA 1AWCA 4H7LA 3I53A 2HKXA 1DP7P 4I0AA 3LSTA 3KP6A 1DGRA 3L2CA 2UY9A 1PM7A 4KL1A 2GXBA 1UW8A 4RD7A 1IW7F 5AIQA 4KDPA 1ZNPA 1USTA 1T0FA 2C0ZA 2DFIA 5LGUA 1OI6A 3L2HA 3OF1A 4IRIA 2G9WA 4A2UA 1XB4A 5KK1A 1REPC 4DNCA 3IDCB 5I93A 1YW7A 4MZUA 4IJAA 4XFCA 1R7JA 2PHLA 5FFXA 1F5TA 5FQ0A 2HTJA 5HLHA 3H7JA 3GFIA 2IVMA 1CAXB 1GQGA 2YPRA 2H6BA 4UVCA 2HYFA 1P4WA 3HOSA 1ZZ9A 2QDRA 3J81Z 5D6FA 4P9GA 5H6RA 1UHWA 3FZ3A 3SCHA 1EY2A 4HX7A 1U5TC 4MEYF 2Q2EA 2VXZA 3ZPLA 2CSOA 4DQ2A 3E6CC 1FP1D 1IAWA 1G6NA 4G6DA 2P7VB 5HS7A 2HOEA 2P7CB 5HS9A 4I7HA 4BIFA 1R00A 1V4RA 2IRFG 2IC1A 2C6YA 1G4DA 3SZTA 1WLTA 4IEYA 4IF4A 2RC4A 3D0SA 5E8IA 2MLGA 3J80Z 2PFWA 4HX8A 3WTYC 2CFXA 5ILSA 1Z7UA 2XAGA 3HIFA 4BYYA 2E1CA 2ESHA 3E5QA 3KETA 2IXHA 2LF8A 2ZKLA 5KHJA 2P6SA 3WW2A 1NXMA 2BV6A 3K69A 2IA1A 3PVBB 2NAZA 2A6HF 3L7WA 2P5VA 4EWDA 2IA2A 2JZYA 1QZZA 3WW3A 1SMTA 2ZNYA 2VC0A 4MQ9F 3BWGA 3U1DA 3M3IA 1K6OA 2WWYA 3MFKA 1U5TA 2P5KA 5IT9Z 1O5UA 1G3WA 1JGSA 3HRUA 1XGOA 2GA1A 4KUMA 2ET1A 4PIZA 4CHUA 4E70A 3V7RA 1W7PA 3MZHA 3WGGA 2FBIA 4QGLA 2BNMA 3I5UA 2EV0A 4A0ZA 1B1BA 4LB5A 2M5WA 3RDIA 3GF2A 3I58A 3T0YA 4Q0SA 4HA8A 2A61A 3QAHA 1Y3TA 4ZH4F 2PYTA 1H0MA 4XF4A 1BIBA 3P7NA 1CAUB 2HYGD 1L0OC 5E17F 1R5HA 2GAUA 3O2PE 4P55A 4CDGA 2FOKA 3SCFA 2DU9A 4BHCA 4ETSA 3FX3A 1SAXA 4G8XA 1YUDA 2QNKA 3E6DA 4N9IA 3BOQA 4IEZA 4Z07A 1UB9A 2K4BA 3LAPA 1WI9A 2H09A 4MGRA 3TDZC 1S6LA 5EEHA 3IWZA 3ROUA 2XROA 1UD1A 1HXDA 2NNYA 2O1QA 5FCCA 3WTSC 2VC1A 3EJKA 4UUVA 5L3FA 1YFWA 4GYIA 1ZRRA 4LEJA 3SXWA 3C18A 2PEXA 4HDUA 2L4MA 3I59A 5D5XB 1KQ9A 3J81K 3TQNA 3WW1A 3WW4A 3KGZA 2PTMA 2K86A 2H27A 1MJBA 2CYYA 5BY5A 1TW2A 1ZZ8A 2PFBA 4LK1F 3CO2A 3FMQA 4UXAA 4HLTA 1U6GA 4M71A 2MD5A 4D7SA 3MWMA 1XD7A 4YYOA 4L11A 1YWKA 2VT3A 1GQHA 4G7ZF 1WKMA 4LA2A 1LVAA 4RGSA 4OU0A 2Y0OA 3M8EA 5KHHA 2EFNA 3ZMZA 3KP2A 3WU0A 3M7GA 4WK8F 3GFJA 1UCRA 2JSCA 3GBFA 4PGGA 4KYWA 4LFUA 3RIRA 1Q1HA 1SQ4A 5D8LB 4XF0A 3BP8A 1ZGAA 2JRTA 3GZ5A 3EHKA 2VT2A 2LF7A 3CLPA 1HW2A 3WTWC 3TO6A 5L3CA 3RYKA 2NNNA 3DV8A 2UYBA 4JK1X 1LRHA 3KCCA 2P5LC 3TOAA 5LHGA 1UIJA 5E1RA 3RTRA 1YTYA 1IPKA 1YFUA 5IT9K 3HTSB 4O6JA 4XSXF 1XE7A 1B6AA 3QU6A 3N4MA 5E20A 3EQEA 3UKTA 5LRSA 3DXJF 1X82A 5FPXA 1ODDA 1EH7A 1S3JA 2VE9A 2STWA 2EK5A 4Q0VA 2ATFA 3ECHA 4OOIA 3P9IA 3CTAA 2E7XA 5FLHA 3ACLA 5JAXA 1T2KA 3WGIA 3U10A 4XSZF 3K2ZA 1FX7A 4KA4A 2O8XA 4CGZA 2VBWA 2IXJA 4O5VA 1P92A 2AS5F 2MH9A 4Q4ZF 4G6QA 3OCPA 1GXQA 1LEAA 4OMZA 3ZMSA 3S2WA 3HOTA 1ZX5A 3Q9VA 4LUMA 5D4RA 4HF0A 2JPBA 4OIQF 1I5ZA 4KWKA 4YG2F 1D8KA 3MZYA 1XCVA 2DLLA 1F9NA 3GW2A 4J1WA 3V7SA 4XLPF 1I27A 1NZCA 4S04A 1MGTA 1B9MA 3V8JA 2PN6A 2B0LA 1U3EM 1LJ9A 1BI2A 2VONA 4KWJA 1RZ4A 3GVAA 2Z5UA 3BPVA 1IXRC 3KEQA 2FBKA 4YIIA 2K0GA 3LQQA 5DV5A 3F8NA 1GHCA 2CW0F 2DW4A 2ET7A 4K2EA 1MJ9A 5JHUA 4UV9A 4YRDA 2R7DA 4ESJA 1J9IA 4QWQA 3RI4A 3WG9A 2KRFA 2Q0AA 1Z91A 4IEUA 5C6CA 2VE8A 1KGSA 2OQGA 3B73A 5FQ0B 4HAMA 1WRJA 1O4TA 4PDKA 1Q43A 4GGGA 3MAJA 4QX5A 5L3BA 2D5FA 3PQKA 1ZYRF 2FF4A 2PI0A 2GC2A 1XCBA 4HOBA 1CF7A 2PQ8A 2KKOA 4ENJA 2KJBA 2VECA 1FPQA 2FMYA 2FRHA 4L9NA 2W24A 2PAEA 1HBXG 3MYXA 4AIKA 5KVRA 1OR7A 1YYVA 1BM9A 3F8FA 4AD9A 2UZKA 5ED4A 4G7HF 1OD5A 1LDJA 3EUHA 4U88A 4QGMA 4I2OA 2BGCA 3BJOA 1SFNA 4QMAA 1GVJA 2BE5F 3ZMVA 3LAGA 4TLFA 2QLZA 3ELNA 1TNSA 1KA8A 3BU7A 2OZUA 4AIJA 2O61A 5FD6A 4IPAA 1QXJA 3HHGA 2UYAA 1B59A 1IXSB 1LNWA 3QP5A 1SD4A 2IXKA 1T39A 2RQPA 3ERED 3IC7A 3DFGA 3V8KA 2FU4A 1GXPA 1J3RA 2IPQX 3FFQA 1XSXA 3F3XA 3M8FA 3O3KA 1R36A 3RKYA 4E2QA 1V70A 1O5LA 4X6RB 3KEOA 4QM9A 1T38A 4MH0E 2FMLA 1CGPA 2XAQA 1F4KA 3ZMTA 4FAGA 2X0LA 2FBHA 4U7DA 3EO6A 1RUOA 3BY6A 2ZBKA 5ICFA 5DD4A 4U0WA 2PLYA 1PDNC 4IEVA 1U5TB 1IRFA 2EV6A 4HBNA 1DZRA 4XF9A 2D5HA 1W5SA 2QQBA 4EVIA 2OPKA 3DEUA 5D5UB 3LA2A 1W7PB 2K27A 4HF2A 3WTUC 4LULA 1YG2A 1H1IA 2EFWA 2IXIA 4ORFA 1CX4A 5KBFA 2KIFA 3RYPA 4MGIE 4OIRF 1TW3A 4L5JA 2D1VA 4KU8A 1Y0UA 2ZKZA 3O6BB 3F21A 4EROA 2DK5A 3U0ZA 2PAKA 4ESBA 4HLYA 1J0RA 1I6XA 2D40A 4HVRA 3SQNA 1Y9QA 4XFAA 2COMA 5JFRA 2STTA 5I0RA 1TQIA 2JPCA 1YW8A 1YIOA 4EM0B 3D5LA 1HKSA 4ZU5A 1X7NA 3FJSA 3EBRA 4BHPA 2PMUA 3HRSA 3PFIA 5HDNA 4LB6B 4HN0A 5ICEA 5JI6A 3KP4A 4KIBA 3VHRA 4I98B 1FOKA 4A6DA 2V1UA 4WVZA 2ZMEA 3WODF 1C0WA 2Z99A 1UCXA 3R0AA 2UY8A 2CG4A 4Y13A 1UFMA 5E18F 1BI3A 5I91A 4MTDA 3U2RA 2YSRA 2ETEA 1ZG3A 3C3VA 3I59B 5JSRA 5I0SA 5FLXZ 2G7UA 1XSDA 1YQAA 5E1XA 1HSJA 2HJIA 2P4WA 3CLOA 4EJUA 2FNPA 2VPVA 1ZN2A 2D93A 4IVNA 2QBYA 4ENNA 3T8TA 4WCGA 3SMHA 3CUOA 2XRNA 3PLQA 4KMFA 2F5FA 1IRGA 2OYZA 3ZQ7A 1W7PD 5AVPA 5BXXA 1R23A 1ZLKA 2F2EA 3I4PA 1RC6A 4RGUA 4Q47A 2Y48A 3FHZA 2Z3YA 2DQRA 4BQAA 4O9GA 5EFUA 1TQPA 1R1VA 1OFNA 1OYIA 2HGCA 4WZCA 3U11A 3SHRA 1LR5A 1KQ0A 1FYLA 3OD0A 3QP6A 3CJNA 4MHGA 2HQRA 2YR2A 3FMSA 2OA2A 3R60A 4YIFA 4NHJA 2RVCA 2XUBA 5I8YA 2RNJA 1BI1A 2B8MA 3DP7A 1O7LA 3V7CA 3F6VA 2BBYA 3U9GA 2KXLA 3BALA 3GUDA 1YFXA 3T1BA 1J75A 1FC3A 5FD5A 2GU9A 1G3TA 1P6RA 3KMHA 2TDXA 4ZYDA 1ZZ6A 1ZZCA 4AVAA 2ZCWA 4BXUA 1JHHA 3MEXA 3WU1B 4YARA 1U78A 3K9TA 4RB2C 4MUVA 4ENKA 4YFXF 3IBMA 1R1UA 5ILVA 2PHDA 1JXSA 2A5YB 2JT1A 1J7KA 4YSFA 4H0EA 5A2QZ 4IEOA 1CAWA 4WXCA 2PA7A 1ON1A 4ZYHA 1FLIA 4XFGA 1O7FA 4LGWA 3TGNA 5CVUA 3TNPB 2Z9OA 4RGRA 2E1NA 1IPJA 2XAHA 3C7JA 3H1WA 3CUQC 3F6OA 1JUHA 1RUNA 4A0XA 1KU3A 5FGMA 3BCWA 5HLGA 2EV5A 3BJ6A 2PG4A 1STZA 4RGXA 2QVOA 1BC8C 4OLLA 4FX0A 2HFHA 4HDVA 4GCVA 4PGHA 4R52A 2RGVA 3CF6E 5DYMA 1S7AA 1H9TA 5TRDA 5DD8A 1IZ1A 3FHIB 4EMSA 3ELKA 5F64A 5CVVA 5BOXA 5CVIA 4XFHA 4UVAA 1ZRDA 4Q0PA 1KYWA 5L3DA 1IUYA 1H1MA 5LRRA 4OIPF 5DEQA 5F6FA 3I7DA 1RGSA 2JTVA 3JAMZ 1J1LA 3NVCA 5FB2A 4RB1A 3V4GA 1FP2A 3S7IA 4IHSA 1SFEA 1HKTA 3D0JA 1MJAA 3MDPA 5L3EA 2P8TA 4XRFA 3TNQA 4K8FA 1RNLA 4UBHA 2DCTA 3K1MA 3O14A 1YFHA 2OU2A 1MKMA 4HLXA 1WGPA 1YO5C 4PIXA 1CF7B 3E5XA 2M8EA 3CUQA 2IT0A 2GA2A 2FQPA 2ZO4A 1O3QA 1MZBA 4XF3A 4L9TA 3L9FA 2IP2A 5HDGA 2CAUA 5FLJA 5CU1A 5FFZA 3HSRA 3M70A 1F1ZA 3JSOA 1T98A 4P96A 2PAMA 2L02A 4L0YB 5BUVA 2XKOA 3J80K 2QYOA 1SD7A 3G3ZA 2GC0A 3QPHA 4JBAA 1K7AA 5JSOA 1NE6A 1NE4A 1D5VA 1I1SA 4D7TA 1HQCA 3OOPA 3ZP5A 3HSEA 5ILUA 3CJXA 2CAVA 1R58A 2GC1A 2F5EA 4ESFA 4IEPA 4XFFA 1FT9A 4LK0F 4MGKE 3I0TA 3W6JB 2GC3A 4FAHA 1D8JA 3VB2A 2Q1ZB 5FDBA 4OMYA 3GWZA 4DINB 3LA3A 2QCSB 5TJJA 2DQLA 4MQVA 2Y75A 1QXRA 2F5DA 5K5RA 2DK8A 1FBSA 2XASA 4HSLA 4XFBA 1QPMA 1FSEA 4WF2A 5DUIA 1NHAA 2ZNZA 2HTSA 4L5IA 1KU7A 2DT5A 4JTNA 1XGMA 2FNAA 1XN7A 4HW0A 2FA5A 3WTVC 1BBYA 3KP3A 3I54A 1J3QA 4RAYA 2NRAC 1J2XA 2VBZA 3RZZA 1E2XA 4AWXB 3TO9A 5D5VB 3QOPA 3T8RA 1CAVB 5J8CA 1YLLA 5BMZA 2KJCA 4KWLA 4F8AA 1FXZA 2V79A 4O9EA 4AVBA 2WFPA 5FLIA 5I8TA 3BB6A 2A68F 1O3SA 3H9AA 1FSHA 2FE3A 2I45A 3H1MA 1FBQA 1ZRFA 3RKXA 2EA7A 5DCMA 4LA3A 1U12A 3LWCA 2ESNA 3B02A 3HTUA 4FT8A 2UWMA 5CJ9A 3T5XA 4QXKA 3LZZA 1B9NA 3IWFA 2B5HA 3TKYA 2PQQA 1IN8A 4NVPA 3E6BA 4KT5C 3JAMK 2ZMEB 2D45A 2DO7A 4KNYA 1XRUA 3HRTA 3MCZA 4M9SA 2QM3A 3DQVC 1XMKA 2VODA 4E2SA 1G3YA 3ML6A 4YFKF 3DF8A 2LSOA 1BC7C 3NSTA 5BPDA 1XDSA 2QBYB 4GYGA 2UXXA 4RB0A 1HW5A 1SFXA 4HBLA 1DGWA 4I0BA 1LEBA 3Q9SA 2QENA 5DCFA 1ULYA 1XGNA 5L3GA 4IEQA 5E1WA 4M72A 1UPIA 2QUFA 4PCQA 1K79A 1OMIA 2W84A 4ZYEA 1W4MA 4UHTA 4Q0QA 4FBFA 4L9VA 3OV8A 4LLNA 1S7OA 5JCTA 2M45A 5BQTA 3H1YA 2ZXJA 2EA4A 1FZPB 3ZMUA 2HKOA 3GZ6A 3VOEA 3BJAA 3H3ZA 1J58A 1EYBA 2K4JA 4EV0A 1YHFA 4HV5A 4RB3C 3UKNA 3ZMDA 1BIAA 4G94A 2OZJA 1QGPA 4GXOA 1Z6RA 4UV8A 1DZTA 1J5YA 5K1YA 1PMIA 4E2GA 1P4XA 2GH2A 4LLGF 2OAZA 4P9FA 2OA4A 5CLSA 5E16A 4QLCU 5AIPA 4A0YA 3EYIA 3VFZA 4WWCA 2MLKA 3G7DA 4BAYA 1IN6A 1VP6A 4HVQA 4R79A 3Q5FA 3QRFF 1R22A 2Z33A 1UHMA 3DPTA 1CAWB 3WTZA 2QZ8A 4U0YA 2DBBA 2V6CA 2M87A 2PJPA 2MC3A 2CQKA 1O3TA 1Q3EA 2WTEA 3KE2A 2K9ZA 5CVJA 2ISZA 3TDUC 3D82A 3GLXA 1U2WA 1USSA 1ZG5A 2XIGA 2EVXA 1P2FA 4L2NA 4EM2A 3HQXA 3NKTA 3L09A 2R7FA 2BNOA 4IHTA 4L0ZB 2Z2SB 4P5OA 1LQ1A
chains in the Genus database with same CATH superfamily
5EYRA 4FQGA 2JENA 3T2QA 5HS8A 3LFMA 1GDTA 4ONUA 1AOYA 4ITVA 3PQJA 1VBA3 1MZ5A 1R71A 4CDXB 1WMEA 2YPJA 4IESA 1XNAA 1RIOH 3UKVA 3A4CA 4EJVA 3SEQA 3OSDA 4RR3A 5D1IA 1NY72 1KEXA 2CRGA 1G59A 3HT2A 1FY7A 4RFT0 3R61A 3OEAA 4A5NA 1QBJA 1VNDA 3DBRB 2ETHA 5DAXA 5BNPA 3S7EA 1RUE3 5BNOA 3V8LA 2DV9A 1Z67A 4W4ZA 1TL8A 1E5HA 1WA4A 3NNLA 4PJJA 4X0GA 4V2VA 3VKFC 3WINE 4UXNA 1TBXA 4RS8A 5C8CA 2J5PA 2CGPA 2AREA 4DO0A 2EFPA 2K9QA 3F8CA 3B93A 4AHYA 1S0EA 5DDJ3 2YFUA 1AR92 4IRGA 3CO7C 1PGL2 3CF5F 3JUUA 3KLSA 2D1HA 5FJHA 2AHQA 2VQHA 3K75B 3VEPA 3KFWX 1K78A 2GIZA 3KV9A 3ORJA 2WWUA 2VASA 4AGGA 1Q56A 1OQ1A 1V0AA 5HCFA 4Y4YA 5FY7A 1HB1A 5EEGA 2E5ZA 4YRVA 1X36A 3E3VA 3GHNA 2GP3A 3H35A 5J8FA 5E1ZB 4QPIB 5FYHA 3R05A 2O8OA 4HX4A 1ASJ2 3SCGA 1QQIA 1BKZA 2RV8A 1WCSA 2BV4A 4JRLA 3SKJE 4HN1A 2XWBB 2Q8DA 1WMFA 4NIDA 1OQYA 1GICA 2ZGSA 4MGYE 1UZWA 2XAFA 5KHGA 4FPCA 2BP6A 4FOVA 3BCBA 4LNVA 3ZXGA 4ZDPA 3IRRA 1QJX3 1ZBE1 1SLAA 1H2MA 3WF0A 4W50A 3IKVA 4XN0A 1WA6X 4FCAA 2D2WA 2O0YA 5FYMA 5IW0A 1SD5A 5F7UA 3PNVA 4KICA 1XMAA 1PP8F 3O12A 3ABUA 4FFGA 4D9JA 2MHFA 2VOOA 1A6IA 5KHKA 3ZKYA 1EA3A 4C91A 1ZRIA 5FROA 2YX7A 4QM8A 2IGOA 1R4MB 4FPFA 2FQ3A 4OCTA 4COWA 1UKRA 2Y0MA 3NJZA 4XVHA 5A6YA 1ZA7A 2LNBA 2ECBA 3M8LA 3GZTB 1MMDA 2EQRA 4IE0A 3UNPA 5KHIA 4MSVA 4BWOA 2V9KA 2BWCA 2VUAA 3HBZA 3ZMOA 5DZFA 1OYYA 1VBB2 2RNGA 4QXCA 4URTA 1GLHA 4Q8KA 1LKXA 1PO13 4GWMA 4JX0A 3R4KA 3TOBA 2R4GA 3GCXA 1JZ4A 3V0AA 2RV9A 3KM5A 4R4ZA 4TV7A 1BR1A 5FLXK 1CAXA 1X4PA 2BW3A 3OYEA 2GLOA 2V9VA 4PQ9A 5A3PA 1D1AA 1JTYA 4Y15A 3BG3A 4JKMA 4NIAA 4UY8I 2JDZA 2CDOA 5IVFA 9ANTA 1KQ8A 5E8AA 1JW6A 1LKNA 1YE9A 2Z5WA 1DUXC 3C7HA 4H14A 2LM3A 1YX5A 4OUMA 2G4IA 1AJOA 5JI9A 5I8SA 2JE7A 4I3PA 3PVEA 3H3LA 5ERIA 1IOAA 4M74A 1NAEA 1PVC2 2AXTC 3DKYA 1NY71 1DGRN 3K4KA 1WH7A 2XMLA 4XRMA 3PM1A 3WE2A 1PUEE 4LO4B 2HWB2 3P5JA 2NOJB 2W1WA 3HOUJ 5H20A 4YW6A 5K7FA 1ETQA 4ATEA 2GIVA 2R041 4ZTJA 3VZOA 4MO3M 4A6OA 2EIDA 2FXAA 4BM8A 1QNTA 3RNSA 3DL3A 4MADA 3UYJA 1HRV3 1FI2A 5IVBA 4HNUA 4EWAA 1AR91 3M7AA 1R1TA 1PGL1 4U0VA 2L7ZA 2I10A 4MGZE 2L54A 5EG0B 2P3YA 4IETA 1HDKA 4FX4A 2HWE3 2VQAA 1H8AC 4I02A 3CMAI 2L9SA 3BTCA 1HB4A 1AR73 5FPZA 1SEUA 2VKHA 3ZFEC 1LDKB 1JTZX 3ZR6A 1FIPA 5HI0A 5A1FA 3WTTC 4M01A 3BTLA 2M0CA 1QNWA 3IDAA 2DURA 1PM4A 5DDGA 1MVEA 1JUIA 2WR9A 1TWAJ 4K1YA 2ZMKA 2X4HA 4U7BA 2E51A 1HXS3 4KN4X 2F4IA 2ADUA 2WZR3 1ASJ1 5J3UA 5H6QA 5C4WA 4NHMA 1XSVA 5JSPA 2QWWA 3S1MJ 2YU3A 1URXA 2DFCA 3NRVA 3IKTA 2BEOA 3EETA 2LK2A 3HYIA 2XAJA 4KG8A 2JDAA 1JI6A 5C70A 3VL8A 5JR3A 2VQLA 1ZLJA 2QQ9A 2D6NA 5E8GA 2JD9A 3ACGA 4HV6A 3P9CA 1HB3A 5ANNA 1V3FA 4MYEA 5F3IA 3LOBA 1V55H 1YQ8A 1UO9A 1ZZBA 5GAGJ 3LKJA 4B8XA 2D44A 1BZWA 4JV4A 1YQCA 1S4CA 1X58A 2ZHLA 3KT1A 3ZFEA 4LLFA 4DIQA 4Y5SA 1XB9A 2P34A 2MW8A 3FBYA 2QZ3A 1LHNA 5ICCA 3LD8A 1HRI1 3JD72 3MF6A 1PP7U 3J7NA 4MXVA 4IQPA 4L9JA 1HW1A 4NOTA 3NARA 2N7GA 1AX2A 2CY6A 4BJ5C 3OY9A 2MBFA 3PSFA 3RQ4A 3MW4A 2R5ZB 1VBB1 1JBCA 4FSJA 2L7MP 2LKPA 5A3WA 1OCTC 1JT0A 1WJEA 3ABKH 5F6KA 3JCIA 2DMTA 1HSTA 2CQXA 4OFGA 5C3QA 3HDDA 2VMIA 4BMEA 1O57A 3RMXA 3WNNA 2OBPA 2ZZJA 4V2FA 3DEEA 2W3JA 3C3WA 4IEWA 1W6QB 3HHHA 1ZGJA 5GPCA 2DTYA 3CDIA 1YHQI 4AEMA 3AK0A 3HN3A 1BR2A 4H7MA 2E33A 3V64A 4P9XA 3B9CA 3AG4H 2CYFA 3JTGA 3DPLC 1N3QA 3M3OA 4XIOA 3RSJA 3CO6C 4XF1A 2RDSA 2Z69A 4RS5B 5FO8B 3RYRA 2Y6FA 3T0DA 3VDDC 3MLKA 4JCKA 1IGOA 2XVCA 4YW2A 3PTRB 2Y60A 5CFCB 4Q4Y2 1ZK8A 4B29A 2RS52 1PVC1 3RKWA 4Q27A 5C8WA 2RKHA 3M9AA 2Z42A 1LDDA 4F91B 2RG4A 2OQRA 1EJ9A 4CXWA 3O1RA 2HWB1 3VYTB 2EXJA 4XKVA 3V65A 3I53A 4DRRA 2XXZA 1ZBE3 3LSTA 1DGRA 1OD3A 3UK9A 4FPEA 5FZ8A 3FHQA 5AIQA 1ZNPA 1USTA 1CJDA 4AAXA 4XONA 2C0ZA 2L5QA 2KDOA 1OI6A 4BB3A 4IRIA 5KC6A 5JVVA 4RLFA 1XB4A 4XK4A 2OC6A 4MOAA 1N47A 3PU3A 5I93A 5E89A 1YW7A 4MZUA 3POWA 5FZGA 5EXOA 1LENA 3PVNA 2HTJA 5HLHA 3H7JA 1UMQA 3GFIA 2IVMA 1APLC 2H6BA 3VDDA 4GQ7A 1P4WA 1UWWA 3A01A 4P9GA 5FYSA 4MEYF 1XC6A 2VQTA 2VXZA 3S57A 3V42A 4QHBA 3GXUA 2ZB9A 1UZZA 3O0WA 1IAWA 1WBFA 1OLQA 4HPKB 3PL0A 2IVIB 5GLWA 3G1MA 3N7LA 2ZGOA 4I7HA 3UETA 2C6YA 2RQQA 2GNDA 4MXWA 4JGYC 1H1AA 4BE1A 2RC4A 2I74A 3D0SA 3OIQA 1GZTA 4CZCA 3OYNA 3VKNA 3BUCA 3EB7A 3HBLA 1TWGJ 3WTYC 5DAPA 2Y0SN 2HLEA 3OJBA 4XLHA 2E1CA 2DODA 3E5QA 4QX7A 4FISA 2VXJA 1OVPA 5KHJA 2P6SA 3ZYIB 4EEFG 3OYWB 1UXXX 2WO1A 1NXMA 2LUWA 5B1AH 4EN8B 3L7WA 1KS4A 1B72B 2WNVB 3ZIWA 2VZTA 2IA2A 3URFA 2JZYA 3BPSA 1SMTA 1DU0A 4EYUA 1IG3A 4EQVA 1RB8G 2VC0A 2P37A 3VZNA 5IVYA 3CD6I 1ACIA 2M0MA 3M3IA 3MFAA 4YW3A 2AYHA 2D6KA 4P5YA 3JD71 4PJ0C 2ZABA 3IT8A 3ZN6B 2P3JA 2ET1A 3PIPF 1C3HA 3MZHA 2R043 3QBQA 4QGLA 2BVVA 1B1BA 1W9FA 4IL6C 2M5WA 1KONA 3I58A 2LBFB 4Y22A 2OS2A 3WY6A 4JGYA 2HPMA 3IAQA 4AVSA 4ZH4F 1H0MA 4CEYC 1PK6C 2IBDA 1L0OC 1J1TA 3O2PE 1TT0A 4P55A 5M0TA 2FOKA 3SCFA 2DU9A 4QX8A 2OW4A 4IOAF 4P00B 1SAXA 3ASIA 3DCFA 3BCAA 4L8QA 2A6WA 1RESA 1GP6A 1WW5A 3BOQA 1DZQA 4Z07A 1UB9A 2FDJA 3VYUB 4MGRA 3MGUA 4NC8A 4PSWA 2RS13 3HGGA 5EEHA 4JOMA 2KP6A 2XROA 1UD1A 2PQSA 2JRMA 2Q1MA 4WM8C 3E7LA 3EJKA 2Z79A 2ZXIA 4LEJA 2RS51 4HDUA 3AVSA 1HV0A 1WH5A 1PZ7A 3GZEA 2I07B 3PMEA 2FJ1A 2ZGTA 2E1MB 3TQNA 1C4RA 3WW1A 3AXDA 2KQRA 1MS0A 2M2EA 3BC8A 4PF5A 2IS2A 2K86A 1MJBA 2LP0A 5KNLA 1QU3A 3ATGA 3I2KA 2W5FA 5EIYB 1NH3A 1LUJB 3CO2A 4GFBA 4CEYA 1PK6A 2WS92 1AYN2 1ULGA 2OX0A 3TBDA 3MN2A 4D7SA 4TYSA 3MWMA 1T6BX 1XD7A 1QIQA 1RVF2 2ARBA 3SEEA 2HXOA 1LVAA 4OU0A 1LGCA 3ZMZA 2ZBJA 1D0ZA 2E26A 1KQRA 3GBFA 4B3XA 2R7XA 4XCAA 4YVWB 5J36A 4BEHB 3LIHA 4KYWA 1ZBA3 1TME2 5FYUA 3S1QJ 3N9PA 1SQ4A 5D8LB 1NCQB 3B9IA 3MFCA 1ZGAA 2KZVA 1W6OA 1HRI3 3EHKA 1Z3YA 2R7VA 1NTCA 1QH6A 2DMNA 5FZHA 1JUSA 4WM8A 2BY0A 3CLPA 2QQNA 2WA3A 5L3CA 2A3XA 4QPIA 2UYBA 2Y0IA 2V7FA 1LHVA 2WADA 1BVVA 1YTYA 5B66C 1D0YA 3BQZA 5JIAA 1MS5A 1B6AA 3QU6A 2GMPA 3N4MA 5E20A 2LLKA 5FZOB 4YG6A 1X82A 5FPXA 1ODDA 4KISA 3ECHA 1VRBA 3NAUA 2QBXA 3WG1A 2I2SA 5JAXA 1T2KA 4D7NA 2JVHA 1C1FA 4CGZA 3B6CA 2HDWA 1BYHA 2DCZA 2WINB 2AO9A 1QOSA 3ITQA 4QKFA 2AS5F 1X9TA 3FLTA 2YPDA 1GXQA 4LUMA 3HOTA 3ZMSA 4B4RA 4OI4A 5D4RA 4M3GA 4KWKA 4QXHA 1S0FA 4XLPF 2Y0SA 2ZTNA 3H3VK 2RVAA 4G3YC 3MLLA 1HQLA 1RZ4A 2ZXHA 2CS3A 1IUFA 3KEQA 1JHNA 2FBKA 3OS0A 5KCMA 3VBRC 5DV5A 3F8NA 3I4MJ 3KZ4C 3W5NA 4K2EA 4FPYA 5IK4A 1OCZH 4UV9A 3FMGA 1OVSA 4B48A 4QWQA 3RI4A 3WG9A 4LPLA 3IH4A 2RDRA 4Q2FA 2ZGMA 4IEUA 3NV3A 1UYPA 5FRMA 3VD7A 2EAKA 2OKXA 1UHSA 3PFYA 2NZ9A 1WRJA 4PDKA 3HQRA 3TN93 2Y6KA 5L3BA 1FPN2 3M8JA 1ZYRF 2JE9A 2FF4A 1RJ8A 2B42B 2GC2A 3IDEA 3HEFA 4AWDA 2PQ8A 2KKOA 4MG2A 4KH9A 2FMYA 1HBXG 3MYXA 4AIKA 1XPWA 1YYVA 2P3IA 1UZYA 3F8FA 2UZKA 4M3BA 1W28A 5ED4A 4G7HF 1C5IA 2V1NA 3H0GJ 4QGMA 4CUBA 1LAJA 1W36C 2VXDA 1T95A 3ELNA 2W1OA 5DUXA 3NKGA 2L9RA 4M0HA 1RUH2 1QXJA 5FZMA 3VZLA 1B59A 1OUXA 4JGZB 1MEC2 3QP5A 3AYEA 1APNA 2IXKA 2J22A 2F6BA 1T39A 1UXZA 3ERED 5FUNA 3IC7A 3VBRA 3DFGA 1GXPA 2IPQX 4OHXA 3FFQA 3OPWA 1JT6A 3F3XA 3UESA 2MYSA 3O3KA 3RKYA 4K7JA 4E2QA 1V70A 3KEOA 4BPZA 4HEA2 4GB32 2FMLA 3A2KA 3WNOA 4JDOA 3ZMTA 4DUXA 2COBA 5A6QA 4FAGA 2FBHA 3EO6A 5HLTA 3G1OA 2JKXA 3K48A 2VJIA 2ZBKA 2PHTA 2AGSA 3LDKA 4XABA 1U5TB 1LNSA 1IRFA 2EV6A 4YGEA 1MS3A 2WS91 2QQWA 1AYN1 3QH7A 3J7AY 2ADDA 5D5UB 1RVF1 2K27A 5DM7F 2GSYA 1U0JA 1W3XA 1YG2A 1D0XA 2EFWA 2ZX2A 4XLCA 3TEYA 3RYPA 3NQHA 2LY9A 4L5JA 1ENRA 1H8TB 4TLGA 4KU8A 1TME1 4NUBA 2XJQA 2ZKZA 3D3AA 3QH6A 2RS32 3PUQA 4AVZA 3VHPA 2GMMA 2PAKA 3JD73 1J0RA 4XJAA 2D40A 2VZOA 4BQ2A 3VHNA 3K2OA 4XFAA 4XNFA 5L19A 4A69C 3EUKL 1W99A 3JRCA 2V5YA 2QEXI 1KDMA 2Y2ZA 1H2LA 1W6PA 5I0RA 1V6IA 2A6VA 5C71A 4K20A 1G8XA 1HKSA 5J40A 1K61A 4BHPA 1OA2A 4A6DA 3RJ2X 4WVZA 3WODF 2Z99A 3R0AA 2CG4A 1UFMA 1BI3A 5JPNB 4C3IJ 4BGDA 5J47A 3ME2A 4QPOA 2BBVA 1IS3A 5E1XA 4C0HA 5E88A 1R092 2D93A 4BE3A 5J98B 3BOPA 1G2HA 4WCGA 1RXFA 3J9SA 4IO9F 4KMFA 3I55I 3ZQ7A 5BXXA 3LEKA 1ULPA 2QKLB 4Q47A 3ECQA 3QYBA 3OG2A 1J09A 3QYFA 2X1EA 2DQRA 5IYDJ 4O9GA 2E60A 4CDWC 1R1VA 4WZCA 2EPFA 2K9SA 3CP2A 4P5HA 1VBC3 3OD0A 3QP6A 4FPLA 4LHSA 3R0RA 2HQRA 2VW1A 3OR2C 4YIFA 4KQ7A 4AC0A 3HBKA 3PHMA 3CMYA 1YJNI 2Y6JA 2B8MA 4GALA 1O7LA 3V7CA 3F6VA 2BBYA 1IG0A 4NAOA 3GUDA 1FC3A 1MQTB 1FPN1 3Q8FA 2GU9A 4C2TA 2B7YA 2DJNA 3VZMA 2WAQN 2QQMA 4AVAA 3T2OA 1YI2I 1JHHA 4AM3A 1U78A 2ENRA 3HXLA 4NHXA 1DU6A 5DUVA 3W59A 2JA2A 5CPRB 3DBHB 3IBMA 2ZGQA 1UMZA 2XQRA 1R1UA 3P6BA 4BXSV 4CP2A 3HEIA 2VZ1A 1J7KA 4LKDA 4H0EA 5A2QZ 3THPA 1W04A 1D2QA 3CU7A 1OOPC 3CLQA 1MBEA 1O7FA 4OVEA 2WY8Q 3GTPJ 2IWGB 3L2QA 5FMDA 1LEDA 4ZY9A 1V6OA 5A7SA 1BW5A 1RUH1 3C7JA 4Y5Z0 1JUHA 3AP7A 1JU3A 1MEC1 4E4HA 1KU3A 4CDWA 4E4ZA 4B47A 2QSHX 2PG4A 1AL0G 2QVOA 1Y39A 1IC8A 2HFHA 4GCVA 4PGHA 1OCCH 3RZOJ 3JU9A 2JJ7A 1Y8QB 4GB31 5DD8A 1DGWX 4FVVA 2XBO2 4EMSA 4YGCA 3ELKA 5CVVA 3VBHB 5BOXA 2X5IB 4XFHA 5FZKA 2JJ6A 2RREA 3Q8BA 4Q0PA 4AG4A 1DYOA 2HOTA 5DEQA 2D97A 1ONAA 1R9TJ 4ISRA 3VDCA 2JTVA 2QQLA 5IHRA 4NN0A 3O7OA 1SC7A 1L7LA 2ZZQA 3S7IA 3ON7A 4IHSA 1SFEA 4K8FA 4UBHA 3OEBA 1UOFA 5B5EC 1OOPA 3H42B 4ARXA 5JWPA 2UV1A 2IEKA 3USUA 3K1MA 1CN1A 3MKWB 2R7UA 3O14A 3PNYA 1YFHA 4HLXA 2RS31 4C3HJ 1YO5C 5JI7A 1CF7B 1AXKA 1W0OA 2FCTA 2FQPA 1GZWB 1O3QA 1MZBA 1VQ6I 2EIKH 3L9FA 2IP2A 1IQAA 3J7LA 5DZGA 2GP5A 4AHWA 1T98A 4P96A 5A3NA 2QE3A 1PX4A 1XX5A 4V19K 2GC0A 3QPHA 4BQOA 1YCIA 2DYRH 2VNRA 1S72I 1WCMJ 4AHZA 2OCEA 2WZ8A 5ILUA 2DOEA 4X6AJ 3A4UA 2V72A 2F5EA 1RUD3 4PDWC 1S0GA 5DN2A 4XFFA 4GAZA 1FT9A 3JCUC 3W6JB 2GC3A 5F2WA 3BTYA 4MIMA 4BE0A 2Q1ZB 2Y31A 3VB2A 2JIJA 3KV4A 5EV7A 3HPNA 5CQGA 4WVWA 1R091 2QCSB 2DQLA 2JK3A 1FJLA 1AKHB 4HETA 4HSLA 4XFBA 1O8PA 4YGBA 1V5EA 5A6XA 3HJEA 5EYYA 4X8PA 5DUIA 1VMJA 4J19A 2HTSA 4L5IA 5EJCA 4PK4A 5FXWA 2TUNA 1N75A 5FPAA 1CZTA 3BR3A 2FNAA 1XN7A 2YU9J 3L2VA 4HW0A 5JXJA 1T08B 3I54A 1Z21A 1N1SA 1J2XA 3TO9A 3H5RA 4ZPIA 3QOPA 3T8RA 1CAVB 2JSPA 1YLLA 4FFFA 5BMZA 2QQ8A 5JMOA 3J4UH 4CEWC 2WS93 1FXZA 4ZS3A 3HMYA 2YYOA 4RQPB 2QQUA 3DPUA 3BB6A 1RVF3 2NYYA 1O3SA 1LU2A 5SV8A 3WHCA 4PDWA 3OGVA 2FE3A 2RHPA 1FBQA 3ZSMA 3RKXA 2E63A 3KCXA 4Y33A 3K4BA 2ESNA 4FT8A 5M5YJ 1Y1WJ 3LZZA 3IWFA 3DTEA 2JIGA 4CPBA 2RJ2A 1IN8A 2KL4A 1M4WA 4NVPA 4K21A 3E6BA 2ZMEB 2WAQA 2D45A 4P1WA 1XSRA 3RG0A 3NWKA 3C7OA 3MCZA 5F5CA 4AI0A 5C33A 2WIIB 1W8ZA 1DQ2A 1HQNA 1G3YA 1SPPA 4Q4V2 1YJWI 2L9NA 1VMHA 3DF8A 4AFBA 3NSTA 3GTJJ 1MMGA 1XDSA 1MMSA 5FMBA 5JLWA 2XUMA 4XLAA 5CFDB 3LEGA 2X53S 2XBO1 5DCFA 3GALA 2CW7A 1WHUA 2Y26A 4IEQA 4CEWA 5E1WA 4D0QA 1G86A 2VVFA 3OBTA 1OF4A 1W4MA 2R92J 4A93J 3W2AA 4GKXA 1M1EB 5EGOA 4CDUB 1S7OA 5JCTA 4XMYA 5IPAA 4XM3A 3ESWB 2BUKA 5BQTA 1CWPA 3AL0B 1CESA 1O91A 4JHZA 2ZXJA 4BS9A 2R32A 3MW2A 1FZPB 3VDXA 2RJLA 2DT6A 3VOEA 4AVVA 1UOGA 2X09A 4LK7A 5FZ4A 3CJRB 1YHFA 5IK8A 3I2IA 3LQCA 2W39A 3RZJA 5A3UA 3ZMDA 1BIAA 2VCAA 3S14J 3KCYA 3LFIA 1Z3XA 1PMIA 2ZGNA 4E2GA 1RKWA 3GBGA 2OAZA 3ERMA 3SH3A 2O14A 1VQKI 2OA4A 1PO22 2FCUA 5CLSA 5E16A 5AIPA 2MLKA 2W68A 1IGNA 2G9ZA 3WP4A 1IN6A 2D3PA 2HVRA 2ZHNA 4M4PA 1Y9MA 1B09A 3I2OA 2QZ8A 2ZOEB 2PJPA 2VE1A 2WTEA 1FPN3 5A1LA 2K9ZA 1BEV2 2F4MB 5ANQA 3U4SA 1GQPA 3HQXA 1QNYA 1WBLA 2LH9A 3E1F1 4LKFA 1ZR4A 2BNOA 4IHTA 3D5RC 4II3A 1LQ1A 3WHUA 4A6EA 3VODA 4QB6A 4EM1A 1DIWA 2P17A 3HN1A 1W0TA 1DPRA 3RVHA 4UF0A 3I64A 1POQA 3WG4A 1SMYF 3LSKA 4XMIA 3ZFFB 4MV2A 1ON2A 3ZGKA 3LEMA 4PJYA 5EHDA 2B9VA 3IL2A 2ACJA 2KMUA 4QPWA 1MEC3 2YU1A 5FZCA 5ABJC 4UFHA 2EH3A 2EFOA 3OR1C 3J7AO 2CO5A 3BODA 1K45A 4XZPA 1FMD2 4LG0A 1RTVA 4LXLA 1W9YA 5JVTA 3OL3A 4GB33 1JYCA 3KP7A 3VKLA 4M6YA 2VJ5A 3R0JA 2GOXB 3FXRA 2H1KA 2BW8A 3F23A 3A22A 5FJKA 5J6XA 1WZ2A 4QSHA 3FIWA 1EAH2 4BXFA 3D1NI 5C3OA 2HOAA 2VZQA 1E17A 2WFF3 3FHAA 3CJQB 4BQXA 1DP3A 2YGLA 3WTXC 3GFMA 5ERLA 4M6XA 3FM5A 1N25A 3K1NA 5FJ8J 4K3UA 5BV6A 4Y1XA 3HZJA 5CKNA 2EWNA 3FK7A 4LLOA 2HZTA 4B7KA 4BHBA 1JYNA 1IN4A 2ZGKA 2DMPA 3OYHA 2X85A 1SDWA 3HRMA 5J48A 1XNKA 2KFDA 1FNYA 3BTJA 4Y20B 4FQ4A 4URAA 4LHKA 1NZIA 2DBIA 3WG2A 2JB8A 2ES3A 5F0HA 4QQLA 3HOXJ 4LUKA 3ABLH 2PJRB 2IJLA 2MPFA 3U07A 2M1BA 1JKPC 1YNAA 3OYBA 4GJYA 4Q4V1 2O8KA 1TP4A 1S29A 3IH2A 2UWAA 3POYA 5JR7B 2XVKA 5H9PA 5E3NA 3ZO0B 3REOA 1QJU2 2GWRA 5IP6A 3T1LA 3I56I 1BJAA 5FP9A 3NWTA 2ZJ2A 4IXAA 4LT5A 1I39A 1RMU2 1RC9A 1MDMA 1K5MC 2V73A 2ZGPA 4J6GA 3I2DA 3KVBA 1V6KA 2EJRA 3MICA 3B3QE 4CZZA 1Q1VA 3VBOC 3ZXLA 4ZXEA 1R093 1IN5A 1EPZA 3QLQA 2NYXA 4JRAA 3MUY1 1FNNA 3USSA 3G4SI 1FYMA 5HBAA 4Y1VA 4XR6A 3C2GA 4LIUA 4XOTA 4D6RA 4G9YA 2RMU2 3FM3A 3POSA 2LRPA 4YVSB 4YG3A 4DXZA 1Z05A 3WHBA 1UYXA 4XFIA 5LBCA 4WXDA 4IERA 4HVOA 1SCSA 1T33A 3NNFA 2LY2A 1LVKA 1YFYA 3EXUA 3PL8A 2W92A 2EZLA 3QACA 3I3MA 4ZU7A 4NHLA 3HOWJ 3RZGA 5LA0A 3ETQA 3AZXA 1PO21 2VVDA 4K6BA 3KZZA 5DCMB 2QQAA 3FMRA 3PURA 2UWCA 1WLCA 1F5FA 3J26N 2VNVA 3WHTA 2LDUA 4UBGA 1XGSA 2LTPA 5KAIC 4WVMB 1J59A 3N35A 3GGLA 1VQ7I 4GD4A 5JZGB 3G2BA 1WSUA 4XBNA 2JWPA 3ISPA 1K5MA 2V1DA 1YRNB 1MZ6A 3K51A 4KMQA 4XJ8A 1BEV1 4LIVA 3OBRA 4HF1A 1W6MA 2RN7A 1OKRA 1K4TA 1W2NA 4B09A 4BMBA 3VBOA 3L9JT 2J1TA 2E7WA 2M4GA 1NYWA 4R8HA 2A3WA 4WXHA 3WXPA 1JKQC 4Q48A 4DY3A 2ARAA 4XEZA 3VUOA 1UZVA 3NWSA 4NR1A 5HPOA 2XL9A 1T6GC 3HUGA 2B9SA 3N36A 4XBQA 1ZYBA 3RWKX 4A7KA 3T0AA 1QKQA 4AQTA 2UXNA 3F8BA 1POV3 3IPVA 4JAAA 1RI7A 3UJQA 2BXYA 3A21A 1FYKA 5J37A 1MPXA 1IXCA 1DYKA 1V5FA 3H8UA 1S0IA 5F32A 1RRJA 1FMD1 1AL22 2ZSIB 4QU1A 5CIRA 1VMFA 4PI2A 3DPRC 3ABZA 1I3HA 2XBO3 5FREA 4ES9A 4M9XA 1OT5A 2W46A 3GEZA 5FMCA 1KFUL 2AXLA 1PHMA 2XKPA 2EFQA 1QQP3 2CQ7A 1ONVA 5FP4A 1VTNC 3FXJA 3WEZA 5B4NA 1EAH1 1H30A 1REEA 5FY8A 3DXUA 2CQNA 4AYBN 3K4DA 4META 3BU0A 1UAAA 1STMA 4N9HA 1XXNA 3RQIA 1W39A 4F7ZA 1SVMA 5FZAA 2VOVA 5KXBA 4LD5A 2W25A 1OYWA 1Y6IA 2QQIA 2OD5A 2JDNA 4CSWA 2OTJI 4D5CA 3OL4A 3GX4X 1BOAA 1GOHA 4UOJA 4XQWA 3P1IA 3D5SC 3RJPA 3C1DA 2YUEA 4NWWA 4ZDOA 1HLVA 3ZXJA 4Q4W3 2VBXA 2NVYJ 3MPBA 1BK1A 5IVCA 5A7OA 4OINF 1CAUA 4N90A 3CCSI 4MFEA 1QU0A 5FO7B 2PBIA 4PIYA 2YBKA 1FV2A 5LLQA 3HAGA 3AAFA 2VGDA 3K4NA 1VI0A 1RUI3 2F5CA 4MNUA 3DPRA 1V00A 1UKGA 2XV4S 3F22A 1QJU1 1Y1VJ 2K02A 2Q8KA 2A3SA 2DPDA 4RAZA 3KV6A 4HQEA 3FXLA 2V09A 3AB0A 3CIHA 3H0OA 1MMNA 5APAA 2WAEA 3OYLA 2QJVA 1RMU1 5KHDA 4R1HA 3G73A 3IHUA 3K0LA 4HMZA 2WBKA 4KIGA 3PNTA 1LEMA 2F5VA 1H9GA 5FZBA 2VZRA 3HT1A 1H0BA 5BNPB 3S93A 4EN7B 3I3DA 4CUAA 3LQRA 4U36A 3O1VA 1MH3A 2CV6A 3K7AJ 4PFPA 2HVSA 4QB2A 5EJ3A 1SEFA 2ID4A 1LODA 2DT7B 5HCHA 4QHOA 1W9TA 1A5JA 2EXIA 1YJKA 2C5DA 2HDCA 3MIGA 5FIXA 2RMU1 5FBJA 1X9PA 2ZFWA 5C8CB 4EQQA 4NB5A 2DXIA 1XSQA 3CHXA 1OPMA 3VHOA 2H0VA 2PX9A 3RPUA 1ND2C 5IP7J 3HL2A 4A3LJ 2R062 3GMEA 2VPLA 3OSFA 4XRSA 1HC8A 2V4AA 1HIXA 2PMHA 1IRZA 5GKAC 2FDHA 3LCPA 3A0KA 4Q0UA 3E97A 1VQOI 4AQ6A 1D7PM 4BNCA 2QQOA 4ASNA 2HU9A 4TXWA 1K78B 1QOOA 3OGJA 4MEXF 4DQAA 2P6HA 2RDNA 4QX0A 4TN7A 4YZ3A 3WDVA 4HOOA 5T5JA 3KB5A 1IN7A 3MEPA 4AGRA 2DUOA 5K8SA 2FHRA 1KJLA 4UI9L 2YHJA 2QVSB 4LJZF 2VMEA 5LHHA 1XYPA 3NNJA 2NPIA 2IXCA 3MI8A 4AVCA 2GXGA 3Q8EA 2BGPA 4Q5SF 5J1UA 1OISA 4JVAA 4XETA 1VALA 1E3OC 1ND3C 2W94A 3MMYB 2CH0A 4AIHA 1VAMA 2WJSA 1ND2A 2W48A 5DG1A 1YO8A 5I0TA 4Q4V3 2M7AA 2MH2A 4U87A 3GYDA 3GXOA 2GNTA 2B63J 5JPMB 1OLME 2W85A 2J42A 2IUWA 2R7EB 1HKDA 3FBNB 3KLOA 3N9NA 3CCRI 5JMCA 3BZ6A 2V6EA 1ZHFA 1AL21 3N9LA 3CDHA 3AMNA 4YG0A 4I99C 1LFBA 1CAVA 3DEMA 5FY5A 4H7LA 3AFHA 5FZ1A 4I0AA 3AKSA 2IAIA 2UY9A 1PM7A 2GXBA 3BIWE 1H88C 1IW7F 2QUOA 4KDPA 3P3PA 1TZOA 5KR7A 3U37A 4TZDA 3GF6A 3NJXA 4IHVA 5JDBA 5KK1A 1REPC 5DUWA 1FMVA 1MW7A 4IJAA 4XFCA 1R7JA 4PCRA 4RGKA 5FFXA 2VNOA 3V0AB 3DYOA 4AYBA 3PJRA 2WNUC 5FR3A 4RHV3 4XUOA 1CAXB 4N4NB 1ND3A 4NPLA 2HYFA 1JJ8C 3HOSA 1ZZ9A 3FISA 1EY2A 2GOMA 1SLCA 1C8M2 2CSOA 1DHKB 5G05L 1FP1D 5H2FC 3DCQA 1G6NA 1HQWA 4G6DA 2P7VB 5HS7A 2Y6GA 2HOEA 4NHKA 3AYAA 4PLOA 1UY1A 4RM2A 3U1XA 1OLRA 4KITB 4BIFA 4S0HB 3ZSLA 1MIJA 2IRFG 4UFKA 4RMNA 2IC1A 1YITI 1D1CA 1YIFA 1BEV3 1ULDA 3SZTA 5F37A 2EIJH 1UPSA 3AKQA 4NIGA 3NAPC 4F3JA 4V2GA 4YPJA 2HBTA 1U8BA 2CFXA 5ILSA 3EMRA 4M3CE 1Z7UA 2LF8A 4ZXKA 3O1TA 2ZKLA 5GTIC 4FPGA 4LE3A 4LE4A 2BV6A 3K69A 1FOWA 2IA1A 4SLIA 3PVBB 2NAZA 1GUIA 1SLIA 3G6JB 5IYYA 2WNUA 1JYVA 1QZZA 1SMVA 3L2UA 1W2OA 4C30A 4CH7A 2DBNA 2DA2A 2Y8KA 3LNQA 3U1DA 3KX2A 3LMMA 2WWYA 1FMD3 5IT9Z 4IGOA 2J1AA 2R061 2XF6A 2GH8A 2LD5A 1JGSA 1XGOA 1LOAA 1R6RA 4CHUA 4OI2A 3V7RA 2VCCA 4MHUA 4KWUA 1ORKA 2XSJC 3I5UA 3ZXDA 3A7QA 2BWAA 5IVEA 4LB5A 1H9WA 3RDIA 4DBQA 3WF4A 3T0YA 5JOXA 3QAHA 1BVP1 1Y3TA 2PYTA 2M3AA 3P7NA 2V5DA 4E7SA 3NAPA 1R5HA 2GAUA 5JOYA 4YM2A 3DUIA 5FZ7A 4UUSA 3DYPA 1IG7A 2AENA 5FKBA 3W21A 4ETSA 3H8OA 2VKEA 4E7JA 1F4AA 1PNFA 4G8XA 1NX9A 2V9PA 3ALQA 1V6MA 4CP9A 3BR5A 4Y4RA 2K4BA 3SH4A 3J7MA 1WI9A 3GTMJ 1IJWC 1Z0HA 5K0UC 3LSIA 1W8OA 3OBAA 5FCCA 3WTSC 5FTTC 3F95A 4UFJA 4GYIA 1BMV2 1ZRRA 1XNDA 1U5IA 4DXRA 4C1WA 3SXWA 1PVXA 2WNOA 3I59A 1KQ9A 2FX0A 3KGZA 2PTMA 3ZQCA 4P9WA 2K46A 5KXCA 1QOTA 1RMU3 4BISA 3ZFEB 2JWTA 1RJ7A 2PMZN 2AACA 4CDQC 4XICA 3SLIA 2RDQA 3GZAA 4M71A 4GMP1 4Z2AA 5HNHA 2E19A 4YYOA 2VT3A 4RGSA 2Y0OA 3M8EA 1IV6A 2AEYA 2EFNA 3OS1A 3WU0A 2BY1A 2CMPA 2K3PA 1ETYA 4WK8F 4BQ3A 1UCRA 2P5BA 4LHNA 3PVOA 1LOCA 5F8PA 3RIRA 3AKRA 2PHFA 2NP0A 4XF0A 3BP8A 1V9U2 2XJRA 3S1NJ 5K0UA 3PIOF 1D4VB 4RGGA 3ZSKA 1UU4A 1OCPA 5LA2A 4NNJA 3M1HA 1MBFA 3RYKA 2W7NA 4WVVA 2BOJA 1GYKA 1WW6A 3IB3A 3THDA 3NMBA 2P5LC 1C8M1 2DVGA 1GP5A 3RTRA 3DLLF 1ST8A 4W6YA 4P9IA 4NRQA 2HI3A 4YIRX 2E34A 3T30A 3OYMA 5IT9K 3RZKA 2QQKA 1XOYA 4E9KA 5LRSA 4CDQA 3OWTA 1S3JA 2VE9A 2Y6LA 3TAYA 4JX5A 4BBSJ 4OOIA 1D0GA 5IY5H 4XAAA 3ACLA 1Q8SA 5FKLA 3WGIA 3U10A 3TEXA 4LK6A 2X6WA 1U5ZA 1FX7A 1GSLA 2JG8C 4KA4A 4M4RA 2O8XA 5C3RA 1AVBA 5A3OA 3PUSA 3RPUD 4XZUG 4LBOA 3AKTA 5IT6A 4RGAA 3CP8A 4Q4ZF 4OMZA 2WRAA 4M00A 4XHBA 4DXTA 2X48A 4OIQF 5GM0A 3MZYA 2NN8A 3V7SA 3VPRA 1H9PA 3BG6A 3ZMNA 1MGTA 1B9MA 3QPSA 5IFPA 2W47A 2DWRA 1US3A 1U3EM 2W0XA 2VONA 1BI2A 4KWJA 4Y1YA 2Z5UA 1UX6A 4CU7A 3LQQA 1W1WE 3IV5A 2CW0F 2DW4A 2QGUA 3A0BC 5CBLA 1COV2 1XMXA 4ZTFA 1MJ9A 2R7DA 3WVJA 4HSTA 3UNGC 5M5WJ 2XGDA 3BR2A 1I6HJ 3CQOA 2F4OB 5LASA 1MS1A 1ENSA 1SFKA 5C6CA 4UB8C 4IHXA 2OF7A 3VD3A 1YEWA 4HAMA 5CKTA 3P3NA 5H9RA 4BQWA 3VDDB 3A01B 5L9RA 2W4SA 2D5FA 3WQ0A 3PQKA 1AZDA 3WX5A 5CG9A 5J1YA 3OYAA 2HNHA 1O6UA 1A34A 1XCBA 4HOBA 4ENJA 1GNHA 2VECA 2JG8A 2Y64A 2FRHA 4L9NA 2L0KA 1ETOA 1X1BA 2H0BA 2IS4A 3HOBA 3H8XA 1BM9A 2NVUB 4ZC3A 2VKVA 2LG4A 1F8VA 3OYGA 1LFUP 1MBGA 3Q3SA 1LDJA 3EUHA 1H6XA 4I2OA 3BJOA 4QMAA 1GVJA 4MXWB 3VBSC 5FYYA 2BE5F 4B1RA 1KA8A 5FPBA 4AIJA 3V0BA 2VZVA 1PGW2 2VOKA 2UYAA 1IXSB 1RUF2 1QXPA 4CXXA 4UW5A 4F92B 1UZCA 1BMV1 1XSXA 1X1AA 3M8FA 2BERA 2WO3A 1R36A 4QM9A 1A3KA 3ACIA 4EZ4A 4MH0E 3WDUA 4XXAA 2PMWB 3A1YA 1F43A 1OFCX 3QOEA 4U7DA 3POFA 1K3IA 5DMYA 2X05A 3BY6A 5BNNC 2WAOA 4OQ8A 2LVSA 3OUHA 1PDNC 4IEVA 5A70A 2LROA 2W08A 1MSEC 3RZMA 1EF4A 2D5HA 1SBEA 4EVIA 3ZYPA 1ALYA 2OPKA 4CU6A 1ODNA 1GNZA 4AFDA 2VTXJ 4A3CJ 3LA2A 3FKJA 1FATA 1HOMA 3JXSA 3O1OA 3WTUC 2PMZA 3GTQJ 1UY0A 2DU1A 1CPMA 5KBFA 4MGIE 4L5EA 1EV12 4HNTA 4Y22B 3AVRA 3VBSA 1Y0UA 4JGYB 3O6BB 4EROA 1MBKA 1OH4A 3MV01 1V9U1 4AEKA 2DK5A 3JQWA 2EZHA 3U0ZA 2R063 1D4M3 1AX0A 3OBZA 1I6XA 2X10A 3O1MA 4BL0B 3W6VA 1Y9QA 2OTLI 2COMA 2STTA 5J3LA 4C2UA 1YW8A 1ZA4A 4EM0B 3D5LA 4XUNA 2K9LA 1X7NA 3EBRA 3VD9A 4M3EA 1W2AX 3HRSA 3PFIA 3WT3A 1RR7A 5HDNA 4M6VA 4HN0A 5ICEA 2CGOA 5FFOC 3KP4A 2XC7A 4I98B 2V1UA 4HFSA 2GM4A 4N4OB 5BNNA 1C0WA 2UY8A 4I0WB 1F2NA 4FP3A 2VTXA 3VLBB 2J1SA 2ETEA 4NPRA 3C3VA 5I0SA 3TW7A 5FLXZ 1XSDA 1HSJA 3FLPA 3OYJA 2QBYA 1FIAA 2D43A 3T8TA 1ZKGA 5FXXA 3BZKA 3MF9A 3SMHA 3MD2A 2VBBA 2VZUA 4LOSA 1RITA 4CEYB 2XB5A 2OYZA 1PK6B 4XKCA 1ZLKA 1D2SA 5FOBB 3ZSJA 3S30A 2ZJCA 3KQRA 2Y48A 1GZCA 4S2DA 3FHZA 2FDIA 1TQPA 1OYIA 4IXLA 3J7YJ 2RAEA 3ZYRA 1COV1 3PUFA 3O1PA 3MIHA 2R1DA 4LBKA 4GIQA 2H1LA 5CAZA 4BQYA 3U4XA 4P9JA 3R60A 2HQAA 1S1AA 2XUBA 2PHUA 4QB1A 1W6OB 3I4IA 1HV1A 3W2VA 4WM8B 3I8TA 4PUSA 3BALA 2WB1N 3G71I 4X1EA 5LW9A 1JODA 2JA5J 4RN5A 2TDXA 2ZCWA 2D3RA 1XU1A 3MEXA 4YARA 4Q4X2 5JIUA 4ENKA 2WN2A 1TWFJ 4XRSG 5ILVA 1JXSA 3PMSA 2A5YB 2AH2A 5DAWA 3AP9A 5A7WA 1CAWA 4NIIA 2M8GX 4ZYHA 1FLIA 1X1DA 4I76A 3TGNA 4CCNA 4XFGA 4ES8A 4PFOA 2R1BA 3PO3J 2P0WA 4FXGB 1LE8B 3OY8A 1PGW1 5A6ZA 3CUQC 1RUF1 3RRDA 5FGMA 2M4KA 3IM0A 5HLGA 3DWLE 4L99A 1WW7A 5L36A 1FOD2 5E3OA 5FKOA 3IAM2 4OMCA 5DYMA 3FHIB 1SLLA 5F64A 3QD6A 3FKIJ 1ERDA 5A1AA 5F3EA 4PHZA 1ZELA 2BFUL 4A3ZA 2Y6HA 5EPAA 3I97A 5L3DA 4KNCA 1S2EA 2RR12 3BGAA 1W8TA 1WMXA 3GM8A 5DM6F 1XTAA 2DU0A 2R072 1WGXA 4CCMA 4L9BA 3JAMZ 5FB2A 2VKDA 2CV0A 4RB1A 4RFRB 3AKZA 3V4GA 1S5LC 3RSNA 1MJAA 1I50J 4RSUA 4DB5A 2ZJPF 4XRFA 1RNLA 4DEVA 2DCTA 3MBWA 5GAHJ 4XTMA 1EV11 3C8XA 4AHXA 3SZGA 2XR4A 2CUJA 2P81A 4PIXA 3K70D 3CUQA 3FC0A 1REDA 4Z92B 2GA2A 3S3OA 2ZO4A 5AC93 2WWSA 5FYTA 4IQJA 1VRH2 3AZWA 4N43C 4XF3A 4L9TA 1CD3G 2OUHA 1R64A 5FBZA 5HDGA 4BA6A 4HSRA 5FLJA 3HSRA 3NO8A 1F1ZA 2PLV3 1LESA 1AR62 1SBDA 3J80K 2QYOA 1AR83 3OYDA 4JBAA 1K7AA 3WQ1A 2E2JJ 4H2AA 3S1RJ 4Y1ZA 2X1DA 1NE4A 1I1SA 3ZLIA 3KV5A 5IATA 4Y7NJ 2HXIA 1FAYA 3SDGA 3OOPA 3ZP5A 2WSVA 3RZDJ 3VBRB 2CAVA 5DG2A 2GC1A 1SANA 1JZ3A 5GZFA 5CB7A 1OH3A 1T2XA 2RM23 1HA8A 4FAHA 3RCOA 4ARYA 4K8RB 3LA3A 3I2GA 5FOJB 3ZXSA 1K4SA 1QXRA 2XASA 3THTA 2ZNZA 3VBUC 4F55A 4V2WA 1RHI2 2DT5A 3T09A 4FE7A 2H8RA 4LG3A 1O59A 2R30A 2FBEA 2FA5A 4N43A 2HBUA 1BBYA 3MZ8A 1J3QA 1LTEA 2CDPA 4DOZA 2VBZA 3LE0A 4AWXB 1US2A 5D5VB 1NK2P 5SV5A 5J8CA 4DZJA 2KJCA 1J83A 3K4LA 1Z7S2 1NKGA 3CCLI 2W1SA 4O9EA 4W1UA 4YELA 5GALA 1NLQA 5D8AC 3RZLA 3X29B 3ZR5A 4DJAA 3H9AA 5FP8A 1W6PB 1GFF2 2R0FA 4CTEA 2I45A 2O7OA 1ZRFA 5BYNA 4XE9A 4Q4X1 1WPKA 1IV8A 4LBQD 1OA4A 2B5HA 2PQQA 1UX7A 2WB1A 4IQ4A 3VV1A 1VQNI 3JRAA 4QPQA 4KT5C 3JAMK 2L9VA 2MSYA 4P9YA 2Y30A 2VR4A 5GP9A 3VBUA 3WP3A 1B8IA 3HRTA 4CU8A 2DOAA 1TVGA 2Y33A 3ML6A 2A6TA 2Q2EB 3ILFA 2LSOA 2O5RA 5BPDA 2VJJA 4XJWA 1FOD1 2UXXA 1HW5A 1DGWA 4OZXA 4TTGA 3Q9SA 3WNMA 1ULYA 1PZ8A 2ZPXA 5L3GA 5IK5A 4KT6A 1W8NA 4G9SB 4E7KA 3BLYA 1K79A 5D8AA 1OMIA 2W84A 4ZYEA 2RR11 3HKZN 4P02B 3OV8A 4LLNA 1XU2A 2R071 2M45A 2MEV2 2BOLA 2ZMLA 2PN5A 1JH5A 4DXSA 3H1YA 4Q1PA 3WUCA 4BDVB 3K4JA 4Y26A 3GZ6A 3TRSB 1GLNA 1IDZA 1QRYA 1POV0 3ZDVA 1E3HA 3AP5A 3Q0UA 3SC7X 4GXOA 1Z6RA 2ZX3A 1J5YA 5T5PA 5K1YA 1VB2A 4TWTA 1WD3A 1CQ9A 3TOJA 3BG5A 5KC5A 4P9FA 4L92A 3VDAA 4GWIA 4ABZA 3O0XA 5BNQA 3BI3A 4BAYA 4QHZA 3AG1H 3Q5FA 5GADJ 3ZQQA 2Z33A 2UWBA 3LDBA 2EIBA 4U0YA 5GLZA 1AR61 3J8F2 4XUQA 1ETWA 2MC3A 2CQKA 1O3TA 1Q3EA 1QZEA 1TE1B 1X19A 2VMDA 5CVJA 3GLXA 1U2WA 4QPGC 3ILRA 4L2NA 2KRCA 3JREA 4CRQA 1LHOA 4A42A 3NKTA 4TSVA 1RPWA 2R7FA 2Q5TA 4CDWB 2Z2SB 2VQ0A 4P5OA 2YMZA 5FXZA 5J4VA 1TTYA 3GTGJ 1C1LA 4AVPA 2VJ4A 3CC7I 1HLCA 4N0BA 4AUXA 3QODA 1W8HA 2QQVA 3AJYA 2GBYA 2NM1A 5K7PA 2YUSA 1L3JA 4JX6A 4FOYA 2F48A 4BQ1A 3WDTA 2JDHA 2W57A 3I3QA 1KRIA 2A6EF 2UURA 4GZ9A 1Q8QA 1WZXA 4YW5A 2XLGA 3VKOA 4Z8BA 2LTNA 2HEYF 1DDNA 1OKOA 1RHI1 6PAXA 4CP0A 3EQLF 2ARXA 5CVRA 1FTTA 1VQ8I 1GV2A 1ZVFA 2QA4I 1LB2A 2LS6A 4F3QA 4FOQA 2CUFA 1X8EA 1EV7A 2ZEWA 1RIRA 3WGHA 5KXDA 4EJOA 3NW4A 1X1PA 1OOPB 2JDUA 2WV0A 3USUB 3CJIC 4AXOA 2OXBA 1W5TA 1Z9CA 2O8QA 4QPGA 4EWEA 1MNDA 2HQNA 1Z7S1 5JLVA 4OIOF 1AX1A 4HSJA 3OYKA 5ICGA 4XDQA 4YZ1A 2XJUA 4JKLA 3RZHA 4X6QB 1YS6A 4O7XA 5C9AC 3BG9A 3F72A 3MLJA 1VQ4I 3AP6A 2NMNA 3JZVA 2HS5A 1Y0NA 1REFA 2JG9C 2M30A 1ZM1A 5IYBJ 2ELJA 4NBQA 3LSPA 5CADA 1G9CA 2CV2A 5IUQA 1PO12 5EP9A 4ZZ5A 3JB8A 5K4LA 1DPUA 1EH8A 1GOFA 2DUQA 4IDZA 4AI1A 1BA5A 2BVLA 3FN9A 2H94A 3MHZA 2X8KA 4QKBA 1JZ2A 1PMJX 3SHFA 3EPZA 5IT3A 2GALA 4CYDA 1GUUA 4ON0A 4BK5A 3COAC 4NMIA 4HZFA 4IEJA 5J7MA 3CCYA 3SZPA 4ZKTB 2JX9A 3O8HA 1NT0A 1YW9A 2E2HJ 5EZWA 2ELKA 2J1RA 2D6LX 1OSGA 4MX3A 3CJIA 5LGNA 5CYYA 3MIDA 3T2PA 1BBT2 4XLNF 5T55A 1KDKA 3B6AA 3VSKA 2R0QC 1QDCA 1FYUA 2O3FA 1MD0A 1GR3A 3H50A 1SFUA 4CA9A 4LO6B 4BU2A 2ZKNA 3R4UA 5C9AA 2WN3A 1S8NA 3WF1A 1S0JA 2MEV1 4Z2WA 2DOFA 2LY1A 4E7HA 1GU3A 4OI0A 4YW7A 4NQWA 4QAWA 1A6QA 2K7LA 2JG9A 5JXHA 2HR3A 2C9KA 1TNTA 1JGGA 2XPVA 3PNAA 3FZVA 3ZN4A 3VBFC 3ZYFA 5F3CA 2L4AA 3IP4B 3HKZA 5KAFC 2VBYA 2A75A 2GNMA 5F1RA 1AR93 4PJNA 1YXWA 1UU5A 2KR2A 1TQ5A 4MGTA 1AJKA 2YX4A 2HQ5A 3ZOBA 1W05A 4PDWB 3K6GA 1HRV2 2R7SA 1L3LA 5K9YA 1A6CA 2WKKA 4J1XA 2O03A 2R0HA 3H7YA 1SZBA 3QPTA 5FPUA 2DVAA 3WG7H 2JDPA 2VD7A 3E5UA 3TWIA 1XQNA 3J8F1 2EINH 2HWE2 4H55A 3R6SA 1W06A 4S2FA 1AR72 4D0PA 3LF7A 1N3PA 2PHXA 2X29A 4Q4Y1 1SPPB 1AYM2 1ASJ3 5GZCA 3S0MA 4IKFA 4Q4X3 3OPZA 2ELHA 3BTZA 3N9OA 4DY5A 5IVVA 2L3DA 3UKGA 1RL3A 3R4SA 4LBJA 2RDPA 5FZLA 4G12A 2YDEA 2VMCA 4AFAA 4PJMA 1FEXA 2WZR2 1UAIA 3VBFA 4CEWB 2FUG2 3EYYA 2VOTA 2CJJA 4EGZA 3L00A 1BLZA 3CBNA 3IZOA 3N97A 2B7EA 3HB9A 2ZHMA 4O3MA 4DUVA 2B46X 1R1A2 1ENHA 1NCRC 5EGOB 1QZYA 2W91A 2R93J 4CO8A 2IA0A 1WQ2A 4Q29A 1R5GA 3T3YA 1UYYA 2VXRA 3CCMI 1TNFA 4KU7A 5GLTA 1HN1A 1FBUA 2KM2A 1Y8RB 5FLVA 2EA2A 5JLXA 1BN5A 5B4XA 2JEMA 4PZJA 4KMUX 1VAVA 5JHFA 3CCJI 2XAUA 1ZZ7A 2RR13 2R5YA 2ZA9A 3IRQA 5C5TA 1BR4A 2A69F 5L9VA 4HANA 4IGPA 3C7GA 2DCKA 4XW3A 2R073 5IK7A 5GAEJ 1CX1A 1VBB3 4AI3A 5K5OA 3I2JA 2VTFA 2DPUA 4IV1C 4A44A 3LSHA 1Z6TA 1XDUA 2DA7A 1TC3C 3U78A 1WCDJ 4XJUA 1XE8A 1ZH5A 4YFNF 3GO5A 4M3CF 3LSGA 3S6PA 1LE8A 3EDPA 2A1XA 3BIEA 5EDNA 1ZR2A 1PO11 3NL1A 3KHCA 4Y17A 2HH9A 2YXSA 4I01A 3KZYA 3NNGA 1P4AA 1NCRA 1TZLA 2XUEA 1U9OA 4UF0B 3I2FA 4E6KG 3JRIA 5HLIA 3IIIA 3A0NA 4IE7A 3IDBB 1AR63 2P6CA 1YIPA 2V4VA 1LU1A 1BCXA 2XHNA 5FO9B 2W1UA 5T3NA 3W58A 1PVC3 3CCQI 3FHNA 4RM3A 3W6KB 4COUA 4YZ4A 1BBT1 3HPGA 4NJ4A 3B5LB 2FSWA 2DMQA 3H36A 2YC4A 4C8DA 1DCSA 4LG0B 3CCVI 5JOZA 5LGTA 2HWB3 4NO4A 1Q8OA 4LMFA 2ORXA 1R082 4IV1A 2YY1A 4BY1J 4E27A 2FEZA 4V1PA 1IF1A 5LA9A 1Q5OA 3I71A 1K6YA 1JYXA 4CXFA 3H3UA 2OVUA 4CCOA 4ENMA 5A3MA 3QU3A 4HPQA 4FPKA 3FBIB 1Q8PA 5C3SA 3AFKA 2DI3A 3HC7A 4XILA 3UL2A 3W20A 3OUIA 3RS6A 3ULQB 1OLMA 2DCEA 3H0DA 4ZYGA 2TRTA 3LFKA 2FZ1A 1E0EA 4BDYA 1HRV1 5GJ6A 3B7MA 1SD6A 2OPWA 3ZN0A 1OHFA 4QQHA 1MZEA 5D6EA 4E4SA 5CYVA 1TMF2 3J7ZI 3ST7A 2WC2A 1V5GA 5ABJB 1O8SA 2HWE1 3AMPA 1IO2A 1C8NA 3HNBM 3OGGA 1RUG2 1LOGA 3FUOA 3POBA 1MSFC 1IKQA 1AR71 3UV9A 4IEXA 1KU9A 1AYM1 3P9KA 4A3GJ 1AXYA 4COVA 3BROA 4OHWA 5JR2A 1IKPA 3MKLA 1JMUB 3W3CA 2JUCA 3OGSA 1WLDA 1EH6A 1ODMA 3AJZA 4FTBA 3BZCA 2VOPA 3KLNA 3KIOA 4CCLA 1MDMB 2F4PA 2WZR1 4XKWA 3BPXA 2DF7A 4AF9A 4UB6C 4EJTA 2A7AA 2E9QA 1HKQA 2AUYA 1UNBA 2VW2A 4AEDC 5GLVA 2FDGA 1UOJA 1R1A1 5DS9A 3AL5A 1JXNA 3LOCA 1G3SA 3C2HA 1LJ7A 1D3YA 3O0VA 4DW6A 1VR3A 3KSCA 2MA3A 2EB7A 4KN7X 2NS8A 1N1YA 5FKNA 3HSFA 1VE0A 5G04L 1AWCA 4FTEA 4B7EA 1GKBA 4A3MJ 2HKXA 4CCEA 1DP7P 2P4EA 3KP6A 2TBVA 3L2CA 2OQ6A 4KL1A 1UW8A 1OA3A 3F2ZA 4QX3A 3WP6A 4O65A 5F1JA 3QWLA 4Y5TA 2IXSA 3WP5A 4KG0A 3FL7A 3CQZJ 2VQGA 2DFIA 5LGUA 2R7QA 3OF1A 2MEV3 1A35A 4M3CA 4CXYA 4XACA 1YJ9I 3CC2I 1SLBA 3IDCB 3MKZA 4DPNA 2W95A 2PHLA 2VW0A 2GDFA 5FQ0A 2R042 1X2NA 4X8NA 1NA1C 5FKCA 1K5MB 3DKQA 2VZSA 2QDRA 3J81Z 5D6FA 4XQ4A 5H6RA 1UHWA 3SCHA 4HX7A 1W6MB 1IDYA 2Q2EA 4AEDA 3VBOB 2IGKA 5C3EJ 4Y1UA 3E6CC 2YGMA 2BRTA 3ZFGC 2BTVC 4K40A 3KEYA 3O5SA 5CKMA 3ZX7A 2P7CB 2VC9A 3J8F3 3AMHA 2WAAA 3HPHA 3HUGB 1V4RA 3H1CA 1ITYA 3KYCB 1G4DA 1WLTA 4Q4Y3 2Y34A 2XWJB 1VLNA 2RS53 4FOWA 3IPVB 3VD4A 1F31A 5E8IA 2MLGA 2RS12 5IOYA 2PFWA 1Y9GA 4HX8A 2X51A 2XAGA 3HIFA 3UGFA 3FDYA 1LFPA 4ZDLA 2CU7A 1R081 5FYVA 3HNYM 3CCUI 4J00A 1QJY2 2A6HF 3BKZA 2P5VA 2YS9A 3RMYA 3PUHA 1QVTA 3N7MA 3PIJA 4Q26A 5FY0A 4LQRA 1NA1A 4B1MA 3ZPOA 5HXMA 2ZNYA 3BWGA 3H9QA 1CZSA 2LFBA 3K3OA 1K6OA 3D8CA 4E7ZA 2P5KA 4B1LA 4L0PA 1O5UA 3M1CA 4YM0A 3HRUA 2GA1A 2XF5A 2A71A 3ZFGA 1XJAA 3LEIA 3Q0VA 4PIZA 1DF0A 2VVEA 3KF5A 4E70A 2OPTA 1W7PA 2FZ2A 3WGGA 2FBIA 2JVGA 4BXXJ 2VL4A 1BOBA 2BNMA 1RUC2 4NIHA 4H4KC 3KWVA 4LHLA 4YWAA 3T4HB 2EV0A 4A0ZA 5A33A 1SFYA 4HA8A 5EF6A 2E5NA 2A61A 4XQFA 2JICA 2TEPA 3DYMA 1TMF1 3MW3A 3R4DB 1JUPA 1ZBA2 3LSDA 2R6QA 4DZPA 3AX4A 1CAUB 4HK8A 4A3XA 3TL4X 2HDDA 1WWYA 5E17F 2XPJA 2CSGA 3RJRA 1HRI2 1RUG1 2DVDA 3WNXA 4BHCA 4PQQA 1VIWB 3DPRB 5GZGA 3DBLB 1LOEA 3E6DA 4N9IA 4Z6YA 4GJZA 3JR9A 4XL9A 5FY1A 1S6LA 1UY4A 1HF0A 2A3YA 2HWF2 3ROUA 4PLMA 2WT1A 2VC1A 5L9BA 5L3FA 1YFWA 5HV0A 1OPOA 1NG0A 2IS6A 3L2RA 5D5XB 3J81K 5D21A 3S5QA 1JHJA 1JYTA 4DYCA 3WW4A 1YQ6A 5JXIA 1YJLA 4UW6A 5HNFA 3IAPA 1BBT3 1TW2A 4MFDA 2PFBA 2DA1A 2WSUA 3PJQA 4LK1F 1B35C 4AQSA 4HLTA 4XBLA 2ZHKA 3CKHA 1U6GA 2WUHA 1N1TA 4XUPA 1IRXA 4D6QA 1SAUA 1ETXA 4L11A 1GQHA 2DTWA 1X33A 2J1EA 4G7ZF 2A6YA 1WKMA 3WU2C 4GH4C 4YZ2A 2ZC2A 3U21A 1E5RA 2ZGRA 2NOGA 3KP2A 2JSCA 4A3IJ 1GNYA 3SYTA