3LA7A

Crystal structure of ntca in apo-form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
209
Chain Sequence
DKALANVFRQMATGAFPPVVETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Global nitrogen regulator
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
total genus 65
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la7A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la7A01
1U8RA 2LKPA 5K1YA 4AVBA 2DT5A 4IEOA 1Q3EA 4O9GA 4CYDA 4ENJA 2CWEA 2B9UA 2VT3A 1P4WA 2HEOA 2FU4A 3IC7A 1R1VA 2DW4A 2XAQA 4HDUA 3GO5A 5ILSA 3FZVA 4DNCA 1QNTA 3RYRA 3F22A 4EVIA 1JUHA 4KNYA 2A3SA 3P9CA 3HHHA 1ZLKA 1I27A 2F5DA 5JHUA 1RIOH 2QJVA 3C1DA 3ZQ7A 2DLLA 1HKTA 3N97A 2Y0MA 1CAXB 1XCVA 3DV8A 5CLSA 2P7CB 2Y0OA 3BDDA 4IEWA 1MGTA 1X8MA 5HS7A 4QWQA 4OU0A 2BNMA 2ISYA 5E1ZB 2PBIA 4HSJA 1ULYA 5KVRA 1IPKA 4Z82A 3LAJA 2QCSB 4WXHA 3UKNA 5H20A 1O5LA 1UHWA 4XFIA 5H6RA 1DGRA 4PGGA 2MD5A 3CEWA 5DCMA 3FX3A 3RPUA 1V4RA 4X6QB 2VOOA 2EB7A 3G3ZA 4MNUA 1XE8A 3T1BA 1BC7C 1NE6A 3SHRA 2IXHA 5CU1A 3L00A 3F8CA 2RQPA 5E16A 1JHFA 3KP4A 3JSOA 5DCFA 5D6FA 1LDDA 3I53A 4EQQA 4HA8A 4N0BA 2CFXA 2VE9A 4A0XA 5F1RA 5I8SA 5K5OA 2PQQA 3I71A 3WGHA 4NB5A 2RGVA 3ZMSA 1O7FA 1MKMA 3ECHA 1SD7A 1SD5A 1RUOA 5BMZA 1S3JA 1K78B 1BIBA 3MQ0A 5F64A 4PJYA 2RNJA 4RGSA 1TTYA 2ZJ2A 3TNQA 4IPAA 3F8FA 3CO6C 1SFNA 1DGWA 3H1YA 4HVRA 3VOEA 3FMRA 2A61A 4RAZA 5CJ9A 1YHFA 1H1MA 3MZYA 1R22A 1FOKA 3QU3A 2ZFWA 1EH8A 1MZBA 2A5YB 2PG4A 4CHUA 4MTEA 4HVOA 3SCGA 4G9YA 3JAMK 2IXJA 2RC4A 2PYTA 3U0ZA 2XLAA 2FA5A 2NS0A 1PDNC 3SFZA 2OZUA 4AIKA 1H1IA 3MZHA 1VR3A 3VB2A 4GCVA 4ENKA 2OU2A 3I0TA 2XKOA 2M1BA 1U6GA 4EM0B 1HW2A 3EBRA 3WW2A 1K78A 4XF1A 1IAWA 4GYGA 4HAMA 1X3UA 1PMIA 4YFKF 4RB3C 1LB2A 2M30A 4TLFA 4FHTA 3TOBA 1UIKA 3IDCB 2X0LA 2GXBA 1XDSA 1T39A 5A2QK 2C0ZA 2D1VA 4UXAA 4UBGA 3T5XA 1QY4A 3ZP5A 2HJIA 3FE5A 2FBHA 4M74A 3DL3A 1KQ9A 1ZLJA 4Q47A 2PFBA 3U2RA 3GW2A 1YFXA 1T0FA 1I1SA 1KU9A 1EY2A 1UIJA 2XAFA 1IRFA 2E7XA 3I59A 4JK1X 1WA4A 4UBHA 4EM2A 3ES4A 3IRQA 2O8QA 2IT0A 1NXMA 1YUDA 4OIRF 2NNNA 4YIFA 3LSTA 4UV8A 1W7PD 1RC6A 5AONA 1LEAA 1NHAA 3BROA 1BIAA 4WVZA 2HDCA 2L4AA 1Y3TA 1SFUA 3L9FA 5D5XB 4JBAA 3LA2A 1LQ1A 2OZ6A 2EA2A 3UKTA 2CO5A 4J1WA 3T8RA 4I2OA 2PFWA 2XIGA 3DQVC 2EA4A 2MC3A 4HN1A 4YNIA 1HSTA 2DQLA 1PM7A 5EEHA 4HLXA 5LGNA 2W84A 4AIJA 5HLIA 3F6VA 1XGMA 2OQRA 2RDPA 4XSZF 3DXJF 1RTVA 1XD7A 4M9SA 3BP8A 4UV9A 5L3GA 2EWNA 4WCGA 4P96A 3ZMUA 4HDVA 1SFXA 5I0TA 2HTJA 3MEXA 4A6EA 3D82A 3P7NA 3N4MA 4L9TA 2H09A 3KP3A 2P5KA 1J58A 4IRHA 2CAUA 2Q1ZB 1G6NA 2O1QA 4LMYA 4QM8A 2XLFA 1J2XA 1J0RA 4YIIA 3C18A 4DINB 2VBXA 1YW7A 2QZ8A 3WW3A 1O4TA 2W85A 1B9MA 1ZGAA 1BI0A 3O3KA 4FX4A 3JW4A 1BM9A 3I58A 3T8TA 1V70A 3U11A 3W6KB 2L3DA 1MD0A 1QBJA 3ZMDA 4ESFA 1NE4A 1SD4A 3D5LA 4A12A 1ZRCA 2CQKA 4XETA 1KU3A 1FSEA 2HZTA 3EUHA 5C6CA 2KIMA 4G94A 4IEPA 3LAGA 3GYDA 4U7DA 1D8KA 1RNLA 3WE3A 3SZTA 2STWA 3L09A 4L5IA 3H3UA 2Q0AA 1Y9QA 1Z05A 1XGNA 2DK5A 1TNTA 2ZNZA 1ZX5A 1MJAA 5HLGA 3J81K 5L3FA 2ACJA 3M7GA 4HYEA 2QVSB 4XF9A 3KP2A 1UPIA 3OD0A 3H9AA 2H6CA 5HDNA 4IVNA 2QBYA 4LJZF 2XRNA 3F8BA 3BPZA 4LG0B 2QNKA 4MEXF 5I91A 4IEYA 1J9IA 4U0WA 3CUQA 2TDXA 3I64A 3K9TA 4ZZLA 2ADUA 3F3XA 2FF4A 4OLLA 1D3YA 1CGPA 4XFBA 5C8WA 3HRSA 3E6MA 4GXOA 4ZU7A 2PMUA 4BAYA 2Z69A 4EV0A 2OYZA 4M9XA 2V09A 2YSRA 1Y0UA 1X7NA 4IRIA 4MV2A 3P9IA 2DU9A 3KP6A 4G8XA 2K4BA 1J5YA 3BWGA 1KGSA 1T6SA 3VEPA 3WTVC 2P5VA 4QGNA 3SXWA 2Z9OA 1S6LA 3LA7A 4EJOA 3C3WA 2W25A 4Q0VA 3ELKA 4HBNA 1XCBA 2K7LA 2P6TA 2M5WA 4M71A 4GULA 1TQIA 4YARA 1J3RA 2PLYA 4PCQA 3HQXA 2DPDA 4L11A 2JTVA 2NYXA 4S05A 3EO6A 5J6XA 2DBBA 5CVIA 3ES1A 2R3SA 2LDUA 4MGIE 3WTYC 2HWVA 4YFNF 2LSOA 3HRMA 4QXKA 1REPC 5EEGA 4LG0A 3M3IA 4AVAA 2OA4A 3WGGA 1GXPA 3C7JA 3H1WA 1ONVA 4AQ6A 4PGHA 2K02A 2HKOA 3D0SA 1ZRRA 4G6DA 5FLJA 3ZMVA 2VONA 2DCTA 1F4KA 2VODA 3KLOA 1FP1D 2DO7A 4ASNA 2BEOA 3WW4A 2GA1A 1P6RA 4UNOA 1EP0A 2V79A 3RNSA 4YRDA 4KU8A 3MPBA 2F5FA 1G4DA 4ONUA 3GF2A 3BPVA 2BYVE 2Q30A 2PI0A 3K69A 3OOPA 3HOSA 2L02A 4IEXA 2EFPA 2BNNA 5ICGA 4D7TA 3ZDSA 2XL9A 5LGUA 3GBFA 1SMYF 1NYWA 4XLPF 3O2PE 3QRFF 4LA2A 5JCTA 3EHKA 1LNWA 1YFUA 1XGOA 2LF7A 3SHFA 3Q9VA 4Q48A 2A6EF 4F7ZA 4HX4A 4YYOA 1QO0D 3M70A 1D8JA 4RGRA 3S7IA 4R8HA 2D40A 2P4WA 4QX5A 2ZKZA 4R52A 2F2EA 4O9EA 1HKQA 5BOXA 4M9ZA 3TO7A 2EFOA 4MQVA 5FB2A 4N9IA 1HQCA 5FFXA 1TLHB 4XEZA 2HGCA 5D5UB 2ETEA 2JPCA 2ZMEB 3V8LA 5FLHA 3I7DA 3E6BA 4HLYA 2XUBA 1IRGA 4JV4A 2CYYA 4Z2YA 5I93A 4ZU5A 1J3PA 2ZO4A 2MLKA 1H9TA 1VTNC 3RPQA 3MYXA 4KU7A 4I09A 1XRUA 1IN8A 1QZYA 2IC1A 2OBPA 1YLLA 3KFWX 4EWAA 2Y48A 1SQ4A 3V7RA 2ZKLA 1R5HA 5ILUA 2VQAA 4HQMA 3BPXA 1STZA 1P4AA 3F8NA 3GXOA 4I01A 1SMTA 3WTXC 1XE7A 1IN7A 3ECOA 5HS9A 1ZN2A 3TDZC 5I8YA 3O6BB 3F8MA 1U5TC 5FD6A 3CDHA 1IPJA 4A0YA 1LDJA 3WU1B 5LHIA 3HT2A 1OYWA 2ZMEA 1J1LA 2XASA 3ULQB 3RTRA 5FLXZ 3E5QA 4A6DA 4MQ9F 3FXUA 4MEYF 1G3WA 1W5TA 2FNAA 5JR3A 3DFGA 3CTAA 4ETSA 4RGUA 2GC3A 4M6XA 3LWCA 4P9FA 1OPCA 1OI6A 2H0VA 2Q4SA 5BV6A 3GFLA 3RIRA 1WRJA 1B1BA 3V8KA 1SD6A 2VC0A 1YFHA 2IA0A 4KIBA 3FMQA 4KIFA 1ZYRF 2HKXA 4NHJA 2IXLA 4P5OA 1S29A 1IXSB 4XFFA 1FY7A 4MGYE 3ZPLA 2GC1A 4IEQA 1DZTA 1USSA 2EVXA 4HBLA 1DZRA 1ZZBA 3G73A 5LGTA 3GLXA 1IXRC 2EFQA 2L4MA 4ZYHA 1KYZA 2H94A 1YS7A 4O3MA 3O14A 4KIGA 4I0AA 4U0VA 5KHGA 2A68F 2PJPA 4EWDA 1FLIA 1W7PB 2HQNA 4LLLA 1B59A 2AXLA 3DF8A 2XROA 2KKOA 4EROA 1FZPB 1FC3A 1JGSA 5IT9Z 5KHHA 3E5UA 2IXIA 3F21A 1LKNA 5FO5A 4U88A 5KHIA 3I54A 4BIFA 3R6SA 4I02A 4ENNA 1WKMA 4LGWA 4YG2F 3K1MA 4OFGA 1TBXA 3JTGA 2P7VB 2ESNA 2FBKA 2JRTA 1R00A 1TW3A 4I0BA 1TW2A 4IERA 2QQBA 5JSRA 1AOYA 2A07F 3HIFA 3R61A 4EWEA 2WFPA 1SEFA 3MFKA 4MGRA 4FAHA 1L0OC 2M45A 1FXZA 1I1GA 4E2SA 3I59B 1EH6A 1WSUA 3R4KA 4IHTA 2IXKA 3BALA 5BPIA 2YX4A 1W7PA 4NVPA 2W24A 3GVAA 4IESA 4OMZA 3E3VA 2IA2A 1E17A 4XBFA 2N7GA 1O3TA 3K1PA 4HMZA 3IDBB 2X4HA 5BPXA 1TQMA 4LEJA 2HS5A 2XAGA 4XFHA 1HXDA 4KICA 4AWXB 5AIPA 3KGLA 2MBFA 2RV8A 2CSOA 1OYYA 1YFYA 3QP5A 3QPHA 4QGLA 1H9GA 1WGPA 2UY8A 3LA3A 3HHGA 2IJLA 1OD5A 1QZZA 5KK1A 4I98B 3CO2A 3HTSB 2XV4S 2OZJA 5CADA 2QQAA 2YX7A 3FHZA 4EJUA 5LRSA 1P92A 4OIQF 4L2NA 4ENMA 1BJAA 4KA4A 1FNNA 3H92A 4LUMA 3EQEA 1XSVA 3G7DA 4UHTA 3ERED 3J80K 1IF1A 2H27A 5ICFA 4OIPF 4HVQA 4ZYEA 5I0UA 2E1CA 5DUKA 3QPTA 1EYBA 3HUGA 4XF4A 3MCZA 4KN4X 3BU7A 3KEQA 4CZZA 5BQTA 4FBFA 3LWFA 5BPDA 1QQIA 4XF0A 5E1WA 5K8SA 2FQ3A 5TJJA 2GC2A 2UWMA 1QPMA 4G7OF 4WXCA 1ZVFA 2D45A 4RGXA 4YFXF 2HR3A 2EV5A 2PMHA 1QXRA 4JQFA 4L9VA 3GYHX 3DN7A 4G7HF 4UVAA 5E8GA 2EK5A 2O8XA 1LDKB 4KMFA 4L9NA 2KIFA 4ZYGA 2CGPA 1R1TA 4LK0F 1YYVA 3KLNA 3Q5FA 3CF6E 4N9HA 3RKXA 1TQPA 3QAHA 2HOEA 1I5ZA 3V7CA 1JXSA 2E9QA 5E20A 2QBYB 5CVRA 2FSWA 2J5OA 4XRFA 3RKYA 3LQQA 3ISPA 1UCRA 3CUQB 2JZYA 3FFQA 4Q0PA 4RAYA 2WV0A 1XN7A 1U2WA 4B29A 2D93A 1OMIA 4U7BA 2FMLA 2PHLA 3SQNA 2V1DA 2W57A 3IL2A 3J7AO 1GHCA 1R58A 3GX4X 4L0ZB 3UKVA 4Z07A 1YLFA 1DDNA 2IW5A 3MWMA 3V7SA 4QLCU 2R7FA 3PVBB 2GQQA 1XMAA 1BBYA 2BBYA 4Q0UA 1A04A 1EH7A 2V1XA 3H50A 2PEXA 5JSPA 3NKTA 5E1RA 4A5MA 4LLNA 4HX8A 3KP5A 2P6SA 3OV8A 1GQHA 2K27A 2FBIA 3ML6A 3E6CC 3CUOA 2ZBKA 3KZYA 5JSOA 5HOOA 3D0JA 2XL7A 4WK8F 4Y15A 5E17F 4OIOF 1HW5A 4UVBA 1F1ZA 2DFIA 3EYIA 5HS8A 2JSCA 4X6RB 1FYLA 4HF2A 1FBUA 1KQ0A 2VN2A 4QM9A 1R1UA 1EV7A 4KWKA 1BI2A 3NL1A 2Y75A 3R60A 2G7HA 2B8MA 4KMUX 2CG4A 1G3YA 1CAWA 2GWRA 4BH9A 1XDUA 3OCPA 4LUKA 3NJZA 1H0MA 2JPBA 1CAVB 1ON1A 5FPXA 3EJKA 3RJPA 1Q5OA 3NEUA 4A0ZA 1G3SA 1QXJA 4ZYDA 1YS6A 4O6JA 3V4GA 1FX7A 4RB0A 3E97A 1OFNA 4S04A 4META 1ZZ6A 1GVJA 3JAMZ 4IF4A 3TO6A 2NAZA 2KXLA 5DD8A 4WF2A 1ZZCA 1RUNA 3ZN0A 2B5HA 1O57A 5ICCA 5FFZA 2RVCA 3V8JA 1T38A 2EJRA 3DP7A 2D5FA 3WGIA 1BI3A 4WZCA 5HI0A 4GO1A 5L3CA 5D4RA 3IKVA 4IXAA 1L3JA 4TV7A 4R1HA 3C3VA 2GAUA 4MUVA 1XSDA 4ORFA 3HRTA 5AIQA 4HQEA 1Q1HA 4LD5A 5DEQA 2V1UA 4F8AA 2IRFG 2XLGA 4BXUA 2GA2A 5J7MA 2FQPA 1CAVA 4ZH4F 5LLQA 1YW8A 4RB2C 1IUYA 4UUVA 1Z6RA 4L5JA 5FQ0B 2WTEA 4AIHA 2Z33A 2ZXJA 3JSPA 1YFWA 1C0WA 3U9GA 4OOIA 4KN7X 1LEBA 3GFIA 5E18F 2DI3A 4IRGA 3SZPA 5KHJA 5FDBA 2R7DA 3DPTA 1ZAOA 4ESJA 3RZZA 2PAKA 1UFMA 1Z91A 3REOA 3HRUA 1ZG3A 3R0JA 3B02A 1OYIA 1KYWA 4BHPA 5HDGA 2F5EA 4HZFA 4RB1A 3KP7A 2HQRA 1RI7A 1V3FA 4HN0A 2ELHA 2FRHA 5BXXA 5J8FA 4KFCA 5HDKA 4XLNF 4Q29A 4AXOA 2CAVA 4IEUA 3KSCA 2Z3YA 3IWZA 5DUIA 1UB9A 1ZRDA 3OF1A 1FBQA 3JTHA 3IBMA 3TNPB 3S7EA 4I7HA 3NVCA 4B09A 1SAXA 2IPQX 1IN6A 2VBYA 4B8XA 5D1IA 2QENA 5FQ0A 3BY6A 4WXDA 1J3QA 3WTZA 4OMYA 3OGJA 3WTSC 3EYYA 2F5CA 3HSRA 4E70A 2STTA 3RYKA 2ZCWA 3R0AA 1VJ2A 1FWZA 5DD4A 2OPKA 3EETA 5ED4A 2KJBA 2LNBA 5KHKA 3FM5A 1R7JA 4QMAA 3CJXA 2IXCA 2GIVA 2FXAA 3WW1A 2HYGD 1T2KA 2Q2EA 3K2ZA 4IETA 2Z99A 1B6AA 2P8TA 5D5WB 2Z2SB 1O3RA 1YO5C 5JI6A 3K0LA 1G3TA 3RDIA 4FAGA 3BZ6A 4JTNA 4EJVA 5J48A 1FT9A 2VPVA 2XAJA 2OQGA 5ERIA 2MHFA 4KT5C 2PAMA 1WQ2A 5EFUA 1BN5A 2MNGA 2V9VA 1RZ4A 3S2WA 4WX9A 3I4PA 4IEVA 1FPQA 4XF3A 1XGSA 5DYMA 1UW8A 4LLOA 1UHMA 1LVAA 4AQ2A 3PFIA 4XFCA 3WTTC 1HKSA 5D8LB 4P9GA 4XFAA 3CO7C 1IZ1A 1VP6A 4ZZDA 1B9NA 1HW1A 4BYYA 3J81Z 3AAFA 1R23A 2VE8A 1FSHA 2D2WA 4O5VA 3WG9A 1ZREA 1B4AA 4CGZA 5LEKA 1Z1DA 1MJBA 1XB4A 1ZHFA 2I45A 1GXQA 3GWZA 2FE3A 6PAXA 2C6YA 5DV5A 2HTSA 4CO8A 2E1NA 1ZH5A 3KCCA 3KEOA 2B0LA 2GXGA 4AVPA 1YW9A 1CAUA 1KU2A 4K8FA 5AVPA 3QP6A 3SMHA 4Y17A 2EV0A 2BV6A 2WWYA 3WTWC 4L18B 3RKWA 2FOKA 1DP7P 3QACA 2DK8A 3TQNA 3DEUA 2XHKA 2VT2A 3H7YA 3GUDA 2GU9A 5I0SA 4IJAA 3Q9SA 3E6DA 3IRRA 4PIYA 2YU3A 2COMA 1CAXA 3GFJA 2GZWA 2DQRA 1IXCA 2FMYA 5FCCA 4KUMA 5E8IA 3W6JB 3U1DA 4UXNA 1Z9CA 3CL1A 5HVQC 4ZU4A 3SCFA 3VHRA 1HBXG 1P2FA 2M87A 1KA8A 2XVCA 4R79A 1HSJA 2V6CA 2P17A 4KWJA 2YPRA 3NRVA 2DAOA 4LULA 3ROUA 3H1MA 2BGCA 1J7KA 1OR7A 4H0EA 3IIAA 5E1XA 4Q0SA 4I3PA 4KL1A 3FHIB 1P4XA 2VXZA 3PNAA 2NNYA 1QWRA 1LJ9A 2BNOA 4ESBA 2UY9A 4MH0E 2CV6A 1W4MA 3KZZA 1MJ9A 4LFUA 3P9KA 1O5UA 4D0PA 1K79A 4LTAA 2OA2A 3MDPA 4CICA 4HOBA 4J1XA 3IKTA 4UVCA 3L7WA 3B73A 2ETHA 5J3UA 2PA7A 5LBQA 3VODA 4BQAA 4MTDA 3I5UA 3TKYA 4K2EA 3FF5A 3ZMTA 4Y13A 4YSFA 2E7WA 2BE5F 1O7LA 2D1HA 3KE2A 2EFWA 3PLQA 4LB5A 2IA1A 3WU0A 1J59A 2HFHA 3ST7A 5T3NA 2L01A 2ISZA 1FBSA 2Z5UA 3ABUA 4D7SA 5J8CA 3COAC 1AWCA 4PDKA 4HSLA 1YG2A 3M8EA 3RI4A 5FGMA 1F5TA 4HV6A 3HYIA 3CLPA 2QQ9A 3IWFA 1ZZ9A 1O3SA 1IN5A 2MA3A 5CVVA 4KDPA 2GC0A 3SCHA 2D5HA 2FNPA 1F9NA 5ICEA 2JT1A 1ZG5A 2PQ8A 1NZCA 5KBFA 3NQOA 1KU7A 3BCWA 1PP7U 5DDGA 2K0GA 4P55A 2Q8KA 3NW4A 3LQRA 4ON0A 4BHBA 3EDPA 1YQAA 2QWWA 5D4SA 1ZZ8A 3T0YA 2K4JA 2KRFA 1BC8C 3K1NA 3M9AA 1ON2A 2L54A 1RL3A 1WI9A 5LHGA 3U10A 5L3DA 4H7LA 1EPZA 1IW7F 4MHGA 4L0YB 1U12A 2O61A 2PN6A 4Q5SF 3GFMA 4HLTA 2A6HF 3DKWA 4EJTA 5CVUA 2O03A 2UXXA 1DUXC 1K7AA 5FD5A 2LF8A 2EFNA 5BS6A 2H6BA 3TGNA 4RD7A 1D5VA 2KIUA 3HT1A 2UYAA 1O3QA 2P5LC 5L3BA 1DPUA 4EGYA 3BB6A 3TO9A 3OTFA 4CXFA 2XKPA 1FYKA 3TDUC 5TRDA 4KWLA 2J5PA 5EZWA 2K9ZA 3PQKA 2VBWA 4P9UA 1CAWB 1CF7B 4EM1A 5FLXK 4E2GA 2YR2A 1UCXA 4M73A 4MX3A 4AD9A 2UZKA 2QM3A 3ETQA 2AS5F 2O3FA 5LEJA 3F6OA 2G9WA 4PIZA 4EJWA 1JHHA 2ATFA 2QDRA 3BJ6A 3GEZA 5FLIA 2FEZA 1PP8F 2MPFA 1WLTA 3H8UA 2UXNA 3NSTA 4GYIA 1ZARA 1S8NA 2NRAC 3BJAA 3GZ6A 3BJOA 3FM3A 1YIOA 2QLZA 1TQ5A 3M8FA 5JFRA 2IP2A 1X8EA 4BHCA 3BOQA 1CX4A 4OINF 1YTYA 1IN4A 1U5TB 4PIXA 1Z7UA 3H7JA 4A5NA 4JTOA 2QUFA 4FT8A 3F23A 4E2QA 1FI2A 4LA3A 1ZZ7A 2G7UA 1ZNPA 3LAPA 3KGZA 3QOPA 3MAJA 1OKRA 1CF7A 1YWKA 5IT9K 5CYVA 2ESHA 4LK1F 1MDMB 5D6EA 1ZRFA 1KQ8A 3EQLF 4IEZA 4HX7A 3FZ3A 1USTA 1ZG1A 4NQWA 1GQGA 2ZNYA 1X82A 3HSFA 3QU6A 4QGMA 3L2HA 2MH9A 3VFZA 2A69F 2HYFA 3WODF 2OAZA 5F6FA 3SXYA 2VC1A 4KYWA 5HLHA 4Q4ZF 4A2UA 3HTUA 2GH2A 1Z6TA 5K5RA 1U5TA 3L2CA 3FXRA 5CVJA 5I8TA 4M6YA 4FX0A 1BOAA 3FWEA 2RN7A 5ILVA 1ZGJA 2EA7A 1UD1A 3LOIA 2ET1A 2DTRA 4Q0QA 2MH2A 1FP2A 1S7OA 5A2QZ 3HOTA 4EGZA 3KETA 4LLGF 4HF1A 3S0MA 3ELNA 1MDMA 1R5GA 3PQJA 2PTMA 3ZN1A 1TNSA 1BI1A 4RS8A 3KMHA 2Q0OA 5D5VB 1ODDA 3WTUC 2VECA 3USSA 3ZMZA 3LFKA 5JAXA 2VBZA 4XSXF 5LHHA 2CW0F 2M8EA 2RKHA 3M1EA 3IHUA 2PAEA 4MGZE 2QYOA 1FYMA 3HSEA 3CLOA 3LZZA 3J80Z 2ET7A 4HF0A 1W5SA 5JVTA 4IHSA 5H6QA 1SFEA 2KJCA 5BUVA 5BY5A 1U3EM 4U0YA 3CUQC 1R36A 4L9JA 4LB6B 3ABTA 4BNCA 2EAAA 1Q43A 1LR5A 2UYBA 4CDGA 5D8KB 1PUEE 1QGPA 1J75A 5L3EA 1JE8A 4EMSA 1T98A 4MGKE 5FPZA 5JR7B 5I0RA 4G7ZF 3DPLC 2XGXA 3ACLA 4HV5A 4JVAA 3RYPA 4XFGA 1L3LA 2XAHA 1U78A 1K6OA 4G6QA 4DQ2A 3CJNA 2MLGA 4WWCA 4WBBA 3GZ5A 2F4PA 1LRHA 3FJSA 2IVMA 2QVOA 4MZUA 2K86A 5IT3A 5K5QA 2DPUA 2VOPA 2O0YA 4AVCA 1XSXA 3FMSA 3H3ZA 2O6GE 3JZVA 4GGGA 3WE2A 1DPRA 1WWXA 4M72A 2PHDA 1S7AA 5LRRA 5DCMB 1I6XA 1RGSA 3E5XA 3FXQA 4PZJA 1XMKA 3TOAA 4HW0A 2OD5A 2WC2A 3F72A 1CAUB 2EV6A 1E2XA
chains in the Genus database with same CATH superfamily
2DT5A 1ETQA 3H42B 3POWA 3EUKL 1R1VA 1C1LA 4XUPA 1WVRA 2XAQA 3SDBA 3GO5A 3JD73 3RYRA 3EPZA 1JUHA 2A3SA 2EBIA 3HHHA 3BR0A 2M4GA 1TVGA 2F5DA 5JHUA 1U5XA 3C1DA 2DLLA 3VYUB 2HBTA 3BLYA 2XPUA 1XCVA 3DV8A 3BDDA 4IEWA 5LATA 2WN2A 1D2SA 3RZOJ 5HS7A 3V42A 5E1ZB 3ZDVA 4HSJA 1IPKA 2F4IA 2ZMKA 3WINE 3LSHA 4QD2A 2QCSB 4WXHA 4XJ8A 2JG8B 3DEWA 1R092 2MD5A 1PNGA 2CS3A 2G4IA 5ACA1 2WQZC 3ZSJA 3PNYA 3OR2C 2JA5J 2IXHA 3L00A 5DCFA 2YU9J 5T54A 5C5TA 1HRI3 1PX4A 4HA8A 4YM3A 2VE9A 4BQYA 1RUC1 5I8SA 1AKHA 4A3LJ 2PQQA 3NV4A 2RGVA 3ZMSA 4NUBA 3I3MA 3FFZA 1RUOA 4AU7A 1O91A 1K78B 3VKFC 2A6YA 4PJYA 3F8FA 3O1RA 2IS6A 4HVRA 1ETOA 4LO6B 4ATFA 2C9KA 2JIGA 3FMRA 3MLJA 5FZ4A 1DLLA 1LEMA 2VR4A 2JDZA 1LFBA 4EEFG 1W90A 3QU3A 3ACHA 1GUUA 1IS5A 5DUUA 3F95A 1FMD3 3U07A 1TME2 4BY7J 4G9YA 3S2HJ 5FLVA 1UO9A 3DBRB 2RR11 4YVSB 5F3IA 2HEVF 3K4MA 9ANTA 4QHOA 3VBRC 4BL0B 1HRV2 4COYA 3SFZA 1JYTA 3AL5A 3GLLA 1H1IA 2ZX4A 4AF9A 1V00A 2CWMA 1XPWA 4K3UA 3FDYA 1UZZA 1HW2A 1WFXA 3CMMA 5L7OA 2O7OA 4IGQA 4YFKF 4RB3C 4RBOA 5F9TA 2DJIA 3LEGA 1AYN2 1IS4A 1XNAA 3IDCB 3FMGA 3NV3A 1QY4A 3WT3A 1UMIA 5DQ0A 2P81A 3J4UH 2VXRA 3SEPA 1HV0A 1DGRM 4W6YA 1W8ZA 2UV1A 2JJ7A 1GDTA 5B66C 3AZYA 5C8CA 4GWIA 1X9PA 3WLUA 1VE0A 2X1CA 3AP9A 1VQ5I 2HVRA 3K6GA 1KU9A 1EY2A 3GJBA 4JK1X 2R16A 1WA4A 3JB4C 4OIRF 3LSTA 1HDPA 4BQ3A 2JDMA 4ZKTB 1LEAA 1NHAA 2XB5A 3BROA 4XQFA 3LSGA 2HDCA 2A71A 4WVZA 2FDHA 3AYEA 5C3OA 1SFUA 4BIOA 4UW6A 1LQ1A 5JIUA 1HXS1 5DXDA 4J1WA 2PFWA 3GZTB 3GTMJ 3VDDB 4YNIA 3A01B 1HDKA 1PM7A 1QU0A 1QJY3 4IV3B 1WJCA 3POIA 1JYVA 2E2HJ 1XD7A 3NV2A 2WKKA 4C0HA 3BQYA 1V9U1 1VRH1 1YJLA 4WCGA 4P96A 3ZMUA 1VQ9I 1SANA 2EH3A 4ASMB 3MEXA 4A6EA 5IP7J 3KP3A 4XUQA 2Q1FA 1IQAA 1GR3A 5J1XA 1IRXA 4GB33 4A7KA 4LMYA 3OJBA 1H8TB 4ZPIA 3VSLA 3H9GA 4YIIA 4UT5A 1KZHA 5JIAA 4E7HA 2ILMA 1MS9A 2WNVA 4OHYA 2VBXA 1YW7A 2QZ8A 1OQEA 3KCYA 3KF5A 3WW3A 2W85A 2HWE1 1B9MA 4NROA 4UFHA 5EG0A 2DMUA 3O3KA 1BM9A 1W06A 2VVFA 5E8AA 5FZGA 3KF3A 4N7UA 2DBNA 1BMV1 5EJ3A 3CP2A 1ZRCA 2CQKA 4LIVA 1KU3A 5FPLA 2R0FA 2C4XA 4U7DA 4V2WA 4EN9B 1FYUA 1F8VA 1D8KA 1RNLA 3WE3A 2PHUA 4COZA 1Y9QA 3INAA 2DK5A 1VBD2 1OUXA 2ORZA 2ARBA 1ACCA 4M3CB 5HLGA 2NMOA 3J81K 2ACJA 4IUGA 3P6BA 3O8GA 4AQSA 1GP5A 1W2TA 2QNKA 4MEXF 4IEYA 1I50J 4UW4A 5IYCJ 4AEJA 3I64A 3K9TA 5E79C 1SLTA 3JRAA 1NKGA 2RS52 3ZIXA 1D3YA 3ENRA 3E6MA 4BAYA 1Q1VA 4XHXA 1T56A 4J6GA 4EV0A 4V2FA 2AHQA 1QF3A 2V09A 2JA6J 3OIPA 3DTEA 3MIDA 3T2TA 2E2IJ 3KP6A 1A35A 1K3IA 3WX5A 1EPWA 1YI7A 3BWGA 3WTVC 1S6LA 4EJOA 2W25A 2ZX0A 1CZTA 3D5SC 4PF1A 1VF9A 2P6TA 3DYPA 4OWRB 1UJ8A 2JTVA 2NYXA 1RVF1 2RMU1 3ABMH 5CVIA 4BEHB 3ES1A 5FY7A 2WV1A 2LDUA 3SH4A 4XOPA 4AFMA 1EV13 1QA6A 4YFNF 1BEV2 1UZCA 3FBIB 1REPC 5EEGA 4LG0A 2CYFA 2Y6FA 2IS2A 2X85A 1Q8PA 1W6NA 4EJRA 4MYEA 4AQ6A 2WO7A 1ZRRA 4G6DA 5DAPA 5FLJA 2VODA 1AR82 2E7TA 3H9QA 3KLOA 3BZKA 3LSRA 4XPVA 3QLQA 3MLKA 3CQOA 3EB7A 2DA5A 3T4HB 1EP0A 2JUCA 4BB3A 2R061 2W1UA 3G1MA 3R0RA 1ZBE1 5FMCA 5FXVA 1IO2A 4URAA 4XN3A 2CV2A 2O9LA 4AVTA 2QQIA 3DWLE 5IK5A 3OYNA 1RETA 2BFUL 2BNNA 3PVOA 1POGA 4XJWA 3GALA 2XL9A 3DU5A 2LY9A 4Q2FA 5CFCC 5FY9A 2CHHA 1S7EA 3QRFF 1H2KA 4QX8A 5JCTA 1OCPA 3A4UA 1JTXA 2A6EF 4F7ZA 4YYOA 1W8HA 5GM0A 1ALYA 5ACA3 5GLVA 3UETA 3VZOA 3QYEA 1LKXA 3S7IA 2D40A 2ZKZA 1BZWA 5IYYA 1I5PA 1HKQA 2NP0A 2M8GX 2ZGLA 3OG2A 1HQCA 5FFXA 4XEZA 2HBUA 2JPCA 1W6QA 3I7DA 2B9SA 5BNNC 3A21A 3LE0A 2QTWB 1KDKA 2M9HA 2DWRA 4BY1J 4Z2YA 2VPLA 1J3PA 3KQRA 3JRHA 1VTNC 4CEWB 1VMJA 4Y1ZA 3CC7I 1PZ9A 3K4BA 2YBPA 1YLLA 1SQ4A 1Z3YA 2ZKLA 5IFTA 3HC7A 4URTA 5HV0A 1IN7A 4RAFA 3O0WA 1OOPA 4NN0A 4RHV1 3AMHA 5ISLA 3AL6A 1U5TC 3KWVA 1QDCA 1V6JA 5E6HA 3W21A 4BK4A 5A6YA 3J7LA 4CP9A 4C2UA 3GHNA 1PYVA 5FKLA 1OYWA 1ENHA 2JDPA 1J1LA 2XASA 1RUF1 1R1ZA 3E5QA 1MH4A 1REEA 4A6DA 5J96B 5CIRA 2VUJA 1NA1A 3AVSA 2FNAA 1S0CA 1V5FA 5JR3A 4RGUA 5B1BH 1DYPA 1OPCA 5E3LA 4F92B 1H89C 4BE2A 3RIRA 5T5PA 2E32A 4ZY9A 1Q8OA 5F5AA 1V5EA 4MHRA 5JUVA 4DXTA 3I2IA 1DHKB 4XKWA 3AG2H 3FMQA 1ZYRF 4PJ0C 3AFGA 2ZJRF 5F32A 1ULDA 2NS8A 3TAYA 1SLAA 1DZTA 3OS2A 3MW4A 1LPQA 5H9QA 4HBLA 2XBO2 2WNUC 5C4WA 3G73A 5FKBA 3IUOA 5ABJA 4Z92B 2R7UA 1IXRC 3UESA 1A5JA 3PUAA 2H94A 3CJIA 4O3MA 3O14A 4KIGA 1ODMA 4U0VA 2DFCA 4ES9A 3N05A 4EWDA 1FLIA 1L7RA 2HQNA 4B8EA 2AXLA 2XROA 5EZHA 4EROA 2PMZN 2JENA 2BRTA 3HMYA 3W58A 2ZA9A 4X1EA 2BHYA 1VI0A 2IXIA 5LK7B 4FQZA 2KZVA 4U88A 5KHIA 5DMYA 1V6IA 4LGWA 4LOSA 4IKFA 3TW6A 2PHRA 2VMHA 4YGCA 3WVJA 1GOHA 5T5LA 1PO21 2FBKA 4Y7NJ 4JGYA 1XSRA 3IB3A 2CGOA 3OEBA 4ZHNA 3AB0A 4IERA 2QQBA 1AOYA 2VUDA 3HIFA 3R61A 2XUEA 2ENRA 4MGRA 4ZYAA 2CNAA 2L0KA 2M45A 4QPIB 1V9U3 1I1GA 3H3VK 3G6JB 4BQQA 1UX6A 4BDZA 3IAM2 2CUFA 2YX4A 1YYNA 4Q4V2 1JOBA 2LLKA 2W24A 4CA0A 3AFKA 4IESA 3HUGB 2FJ1A 2DURA 4TWTA 2OQ6A 4HMZA 3IDBB 3MUY1 5BPXA 4DB5A 4AYBN 3K10A 4M3FA 2W52A 2VKHA 1YFYA 4F83A 1UMQA 2WY7Q 3AVRA 3LIHA 4QGLA 2UY8A 3P5BA 3BPSA 3TN92 1R091 1JKPC 4BMBA 3S15J 1OXCA 4I98B 1AF9A 4BXSV 1GU3A 2W00A 4P1WA 3HTSB 1GSLA 5KR7A 2IEKA 2XV4S 1AX2A 5CADA 4JX6A 4EJUA 3FHZA 2A5ZA 3RI9A 4E7SA 1AJKA 1UKRA 4HG6B 5C3EJ 2ZEWA 2SBAA 1XSVA 5A1AA 3B69A 2VAUA 3NAPC 5FZLA 2H27A 2ZBJA 4EYUA 2E1CA 4OMDA 3ZO0B 1IS6A 1RUJ3 3ME2A 3BU7A 5BQTA 4NRPA 4EN7B 5BPDA 3THTA 3WCSA 4P9JA 4KITB 3B5LB 2KR2A 3H8OA 1ZBA2 2DDUA 3VV1A 3SITA 3VBOC 1DYKA 1N3QA 1YQ8A 2NVUB 3AZVA 5FZIA 2HR3A 2EV5A 2VJJA 4BS9A 4LJHA 5FZDA 2PMHA 5FYBA 2EZIA 1F35A 3T08A 3POGA 5IVJA 3LB9A 4E4DX 3N9LA 3HNMA 4OI1A 5LD2C 4KMFA 2KIFA 4ZYGA 1TME1 1R1TA 2Y6GA 4CUCA 4DIQA 4XRMA 3RKXA 3QAHA 3NWSA 4CUAA 2EXIA 1JXSA 1Y9MA 1KS4A 3DBLB 2QBYB 2A73B 4MXWB 3BT9A 3BU0A 5JPNB 2KM2A 4Q4Y2 5JWPA 1WW5A 1IRZA 1X1CA 5C9AC 4ATEA 1U2WA 2MW8A 5F5IA 2D93A 4KGGA 4NC7A 3LFMA 2JE9A 1OMIA 4P08A 2FMLA 4OQ9A 2JN6A 4GQ7A 1AYN1 3T4VA 4PLNA 4K6BA 3J7AO 1R58A 3GX4X 3UKVA 2IW5A 4QLCU 3QYFA 4NHMA 3FKJA 2LKSA 4RGGA 4RS5A 1K45A 3N9OA 3HR9A 3SEEA 3L2WA 4L0PA 4Q5OA 2DCEA 5BNGA 3ZN6B 1UAIA 2YPDA 1DBNA 1NCRA 4KH9A 1KD7A 1EH7A 5E1RA 3I4NJ 4A5MA 2BV4A 1TWFJ 4HX8A 2P6SA 4FFHA 3E6CC 2EXJA 2ZBKA 1XU2A 2YUEA 1RR7A 2E2JJ 2XL7A 4WV8A 1LOEA 1EAH2 2RHPA 1MBFA 2L7ZA 2VW2A 5FY1A 1CJPA 1Z21A 1KQ0A 2VBPA 3T1LA 3Q0WA 3HBKA 1GT0C 1R1UA 3J7MA 4RR3A 5F6KA 4KWKA 2R7EB 3L2VA 3PFYA 2DUPA 5FYUA 1IDYA 1XJAA 4KMUX 2CG4A 4BH9A 1GV2A 1MBHA 3W9AA 4RQPA 1FOYA 1MMAA 5FPXA 4UUSB 4QXCA 3KB5A 2O8OA 2PLV2 5FZ3A 1A3KA 2WO2A 4RM3A 4CU8A 1FX7A 3QCWA 3PIGA 3OOUA 1GVJA 3WG3A 3JAMZ 2NVXJ 3N7JA 3APBA 1AR62 5FRNA 5LW9A 1RUNA 4CPBA 4D7MA 5AFBA 2WIIB 2DOEA 3V8JA 1GLNA 3IT8A 2D5FA 1HJGA 4IZZA 3BR1A 3V0BA 5HI0A 3DUIA 2M0CA 5D4RA 1SZBA 3IKVA 3WHCA 2F4LA 2WR9A 3UGFA 4HKLA 1XTAA 4TV7A 1K42A 4R1HA 2GAUA 3WP4A 4BKXA 4FE4A 4RHV3 1NH3A 5C4JJ 3U75A 1MMSA 4HQEA 4LD5A 2V1UA 5C44J 4BXUA 4IEJA 1CAVA 4ZH4F 5LLQA 5GAEJ 1IUYA 4L5JA 3KD4A 5KHDA 3HD8B 3ZYJB 2VOWA 1RUF3 1NLQA 2WA4A 1LEBA 2JA7J 4CU6A 2BFUS 2HWC2 4LE4A 5FDBA 2KQRA 5SV8A 3M07A 2EIBA 1LUJB 2VOVA 4OYUA 4XLEA 2XR4A 2ZGMA 3MBWA 2RS51 1YITI 3THPA 2G9FA 2DJNA 1RI7A 2HQRA 4IXLA 4CDXC 5BXXA 3FXKA 2ZGQA 5F39A 2O0OA 3LPGA 3RZDJ 2R92J 4NRQA 3OF1A 1WD4A 1FBQA 3JTHA 3DF0A 1YJNI 4M0HA 5GAHJ 3HGGA 2EIKH 5CB7A 4B8XA 3F2ZA 3BY6A 4WXDA 3ZSKA 1J3QA 4OMYA 5FFOC 1WKYA 3DPRB 3WTSC 2Z4FA 3EYYA 1F36A 3PL8A 2STTA 5DS9A 2C24A 3R0AA 1VJ2A 5DD4A 2OPKA 1ETYA 4Q4W2 5ED4A 3AMNA 5KHKA 1PGL1 2HEWF 2HI3A 3GTGJ 2GP5A 4B3XA 4QMAA 3CJXA 3AP6A 2IXCA 2FXAA 1ND3B 5GZGA 3AX4A 2Z2SB 2WA0A 4YGDA 3VZMA 1WGXA 3K0LA 2JD4A 4JYKA 3CCMI 4BK5A 4IOAF 1RYYA 2HU9A 1I9RA 2JDUA 2JKXA 4FXKB 1I3QJ 1HB4A 1JMUB 4XTPA 1HOMA 2ES3A 1W2UA 2OJED 1IG0A 5A7WA 1WJAA 3S2WA 4WX9A 2YDEA 2ZAAA 4K7JA 1FPQA 4LLOA 3JR9A 4IE7A 1HKSA 4FPOB 1HB2A 4XFAA 2X48A 3USUA 3BC8A 4WM7A 4BYYA 3VKNA 4LR4A 4QQHA 3AM2A 2D2WA 3WG9A 5LEKA 1Z1DA 1MJBA 1ZHFA 1WMXA 1QHHD 3GWZA 2FE3A 3ZX7A 4A3FJ 4Q27A 1S0BA 2HWD2 2E1NA 3KCCA 1HLCA 2Q8CA 1YW9A 4K8FA 4IE5A 1S2KA 1WWYA 4AVSA 3SMHA 2BV6A 2WWYA 1IJWC 5GLTA 2M2EA 1DP7P 1RMU2 2DK8A 3TQNA 2XHKA 4LT5A 1MH3A 1KEXA 4IJAA 4JC1A 1RUI2 2YU3A 3VL8A 5DUXA 3SC7X 4IE6A 2YZ4A 3JRIA 1IXCA 1LOFC 5C3PA 3WCRA 3M8LA 4AEDC 4UXNA 3BUCA 2JG8A 3VHRA 2AEYA 3I2DA 2M87A 1SMVA 2YPRA 2W87A 3H1MA 4QXHA 1OR7A 4H0EA 4OI4A 1SVLA 3GTQJ 3AYAA 2UUZA 3FHIB 3PNAA 2NNYA 2F17A 2KMUA 3BCAA 2JVGA 2CFOA 1HRV3 1MJ9A 4LFUA 1RUD3 1O5UA 1OCOH 5CKNA 4D0PA 1K79A 2K9LA 1RUG2 2KA3A 4FFGA 4HOBA 1GV9A 3IKTA 5K7ZA 2ID3A 5F1JA 4PFOA 2D6PA 5J3UA 4MTDA 3BG7A 3FF5A 2E7WA 2B45X 2JRMA 3KE2A 4GH4A 1JYIA 2ZGRA 1BK0A 4YFZA 2MYSA 2ISZA 3AXDA 2Z5UA 2XBO1 3S30A 3GTKJ 5F5CA 3NARA 5J8CA 3COAC 5IVYA 4DEVA 2OF7A 3PMEA 2ZMNA 2XOMA 3ZOIA 2WZR2 1XNBA 1FIPA 2GC0A 2D5HA 2FNPA 1ZQ3P 3TOJA 2JE7A 3BZCA 3B3QE 1JKOC 4UY8I 5C3RA 4UFIA 1NCQB 1KU7A 1NY72 2VW1A 4HK8A 3M3EA 2K0GA 4JHZA 4P55A 2V6EA 2Q8KA 1I39A 3NW4A 2P3YA 1YQAA 4RA2A 2Z79A 3ZXSA 5A6ZA 5D4SA 1MACA 4BU2A 3FC0A 1BC8C 1SVOA 4XW3A 3O1UA 1HA8A 2L54A 1RL3A 1XNCA 3NKGA 1WI9A 5LHGA 1EPZA 1XPXA 1LHWA 1G8XA 1U12A 2O61A 1MIJA 1GZTA 1VQNI 2AENA 2A6HF 1I6HJ 5A32B 5FZHA 4Q4V1 1SACA 4DS0A 3W2AA 2IGNA 3P3NA 2KL4A 1NXD1 3DKXA 2V9PA 3TGNA 3NQHA 2VKVA 1TMF2 3HT1A 3W5NA 4EGYA 3RZLA 1FV2A 3VKOA 3TO9A 4CXFA 1R6RA 4FPEA 1FYKA 3VHNA 3OB8A 1S0EA 3TN91 2R7TA 4GMP3 2A6ZA 2WWSA 1CAWB 1UY1A 4YGBA 4QWNA 1NOVA 5JZGA 3C2BA 2MG4A 4M73A 4PDWC 3LSDA 3WF2A 2O3FA 5CZKA 1GQPA 4PIZA 4QPGC 4EJWA 3JBG3 3BJ6A 4CEYB 5LZ6A 2FEZA 3H8UA 3CESA 5C8CC 4M3EA 2NMNA 1VBD3 4IOCF 4DFSA 1QVUA 3PNTA 4TYSA 2NRAC 3GZ6A 2QLZA 4YW6A 4QX1A 5CKMA 5JFRA 4NIIA 2R072 3BOQA 1ZBA1 1VIWB 2Y0SN 1CX4A 1ETWA 1SBDA 5AC92 1LAJA 2RS53 4PIXA 2WAQA 3IPVB 2A75A 4JTOA 3WEZA 2DF7A 4FT8A 4E2QA 5FUNA 4AIDA 1SHWB 4K20A 4KBZA 3KGZA 3MAJA 1YWKA 3KV9A 1ND2C 3VBSC 2HH9A 5K0UB 2CL2A 2ESHA 5IVVA 5D8AB 4LK1F 3EQLF 1LHOA 4OHXA 4ISRA 2DU0A 3FZ3A 1RIRA 1R1A2 1YO8A 4CA9A 1QJEA 3POYA 1X82A 3GTJJ 3HSFA 3QU6A 4WM8B 3L2HA 3VYRB 1LESA 4NIAA 1LU1A 2OAZA 1DLCA 4Q4Y1 5JXGA 3SXYA 4UW3A 3ZFGB 3WUDA 1QNWA 3PU3A 3Q0VA 3PL0A 4KYWA 1BEV3 1GLHA 5FPBA 2PMZA 2JSPA 5KAFC 5GZEA 5A7SA 3S17J 4YZ5A 5KC5A 5KCMA 4AW7A 2RS12 5BNOA 4HEA2 3ZQFA 1Z6TA 1B72B 3QH6A 5CVJA 2WNVC 4GAZA 1C8NA 5FZ1A 2WJSA 2XRLA 2PX9A 1Z67A 2J42A 3RSJA 1VQ8I 2RN7A 1AR83 4N4NB 3LOIA 2AEZA 3WNNA 1MBGA 5AVAA 4Q0QA 5DABA 3ZFEB 2MH2A 1S7OA 1JT0A 2W1WA 1UU4A 1R5GA 5IHRA 3UL2A 2DOFA 2QKDA 1BI1A 3SISA 1MNMC 5JOZA 1WPKA 3USSA 4XSXF 1LGNA 2CW0F 3AJYA 3S1NJ 2BWAA 3GNEA 4R4XA 3IHUA 3AG3H 2QYOA 3MKZA 1N77A 4BEHA 4ZZ5A 1CWPA 3LZZA 2GBYA 4PJNA 1DU6A 3M3QA 3ZFFA 4DRRA 3MUZ1 5JVTA 1I3AA 4PJLA 4B44A 1PIV2 5BUVA 1U3EM 1VBC3 5FAXA 1GOGA 5CFDA 1R36A 4TXWA 2K5CA 3ABTA 4BNCA 2EAAA 1LR5A 2VO5A 2W1SA 3WP5A 1D0XA 3MF9A 2VM9A 1UYYA 3H9JA 3LSIA 1JE8A 4EMSA 4MGKE 3RQ0A 1W0PA 3ACLA 1ASJ2 3RYPA 1EF4A 2PLV1 4IHVA 4G6QA 4DQ2A 1TEIA 2YV8A 4M3CE 1LRHA 3FJSA 4LIUA 1N1TA 1AR61 5CNAA 5IT3A 3GCWA 3VBUA 1OLMA 4PI0A 2IAIA 3PIOF 3VKMA 3JZVA 3AMQA 4PHZA 1NG6A 1DPRA 1WWXA 1S7AA 1D7PM 1Z7S3 3ZOBA 4HNUA 4A3JJ 3I4MJ 4HW0A 2OD5A 1ZR2A 2VMGA 4AHWA 2J1RA 2F5VA 1E0EA 1CVNA 2LMDA 2Y2ZA 2LKPA 4RSUA 5K1YA 4IEOA 4CYDA 4LOCA 3AP4A 1K5MA 1VQPI 4HKOA 1JXNA 1P4WA 4ZTJA 2HEOA 1QDOA 1F4HA 2FU4A 3CJRB 5GLZA 4HDUA 5ILSA 1BVVA 4Q1PA 1AKHB 1QNTA 2EIGA 3F22A 4KNYA 1GVDA 3K4NA 3ZQ7A 1HKTA 1AR72 3N97A 2Y38A 5CLSA 1UXXX 1Y0NA 1SLBA 4QWQA 2BNMA 2ISYA 5BYNA 1ULYA 1OF4A 4A3GJ 4Z82A 3ZR8X 4CEWA 1W9TA 2K85A 5H20A 4YM1A 5A7NA 4DBRA 5H6RA 1DGRA 3R05A 2GN7A 2HLEA 4CDQB 2XWJB 2WNEA 3CEWA 3RPUA 5FXXA 3N7MA 2BJSA 4MNUA 4UWDA 1XE8A 3I3LA 3T1BA 1BC7C 4C30A 1NE6A 3F8CA 1UELB 5FYCA 3PTYA 2FDGA 2LROA 2YBSA 5D6FA 2R043 3ABLH 3I53A 4EQQA 1CX1A 3M7AA 2ZHKA 2PJRA 4HPKA 4JQTA 2CFXA 2VW0A 2ZKNA 4A0XA 5A1LA 4PK4A 2F6BA 3TEXA 2LOOA 4A3EJ 3J7HA 2PMWB 1O7FA 1MKMA 3M1CA 2VPRA 3ECHA 4FFIA 4B4RA 1W1WE 3KM5A 3WF0A 1OLME 5L7OB 1VQ7I 5BMZA 1S3JA 3GZEA 3CMYA 3MQ0A 4OUSA 1JGGA 3TNQA 3CO6C 4Q4W1 2VJXA 3S8PA 2QDNA 1OH4A 3SLIA 3ZXFA 4XOTA 4D5FA 1YHFA 5GTHC 2X29A 2UWCA 1ENRA 1R22A 2QGUA 5EPAA 3D1NI 2ZFWA 4AFBA 4YVWB 4XL9A 2H0BA 3SCGA 3JAMK 3L9JT 2IXJA 5A7PA 1YI9A 1OOPC 1W6OA 3FLRA 2JA8J 3U0ZA 1OVSA 5FXWA 1DP0A 4GWNA 2QQ8A 3A4CA 5JOYA 3LSMA 4DXRA 1RHI1 1A6QA 3CCJI 5FZEA 2CU7A 1DQ6A 2M1BA 3ZQQA 2BZDA 1Z0XA 1U6GA 4EM0B 3WW2A 3TEDA 3EBRA 4R9BA 1VBB2 1D2QA 2W68A 1SCSA 4XF1A 2QSFX 4R9CA 3AP7A 4GJZA 1Z78A 4QDSA 2HWF3 1UIKA 3TN93 5A2QK 2C0ZA 4AWDA 2D1VA 4CCLA 4UXAA 1S0JA 2WSUA 5FZ0A 3ZP5A 4RLQA 2HJIA 3K4KA 5FP8A 2DA2A 1GZWB 4CXWA 3PM1A 4NHYA 2FBHA 1ZLJA 1VAVA 2P0WA 4PI2A 2HWD1 4JKKA 1T0FA 1LNSA 2RE9A 4W97A 1JU3A 1I1SA 1COV1 1UIJA 4N7IA 5BNQA 4EM2A 4Z6YA 1NXMA 1YUDA 1RMU1 4ZJZA 1RC6A 5J40A 2VZTA 3DECA 3ERMA 4C8DA 1RUI1 3L9FA 3O1MA 2Y6KA 2CO5A 4M3GA 3H35A 3T8RA 3DQVC 4XJUA 4XACA 2HPIA 5EG0B 3QODA 2MC3A 3I8TA 2DQLA 5A3TA 5CA6A 4I6ZA 2A3WA 1CIWA 5LGNA 3ZYHA 2W84A 1Q8SA 4AIJA 5HLIA 2OQRA 2RDPA 1YX3A 4XSZF 3DXJF 1RTVA 2ZZQA 5A3PA 2GM4A 4QQLA 5M0TA 3NNJA 1YXWA 2IUWA 2YC4A 1SFKA 5FZKA 1CJDA 4M0NA 1WLWA 3WR0A 3N4MA 1URXA 4BQ4A 2P5KA 1J58A 1PZ7A 2A6WA 2CAUA 1G6NA 5JDBA 4QM8A 3WXPA 1J2XA 2HYJA 1BXHA 3T1MA 2VCAA 1JUSA 5A3LA 4FOQA 2IFRA 1LEDA 4S2DA 1BLZA 4U2AA 3ZCOA 4UB6C 1BI0A 4CCNA 1AYM2 1WW7A 4AHXA 3T0BA 3W6KB 2L3DA 3H5NA 4ESFA 3BIEA 3D5LA 4RAGA 4XETA 4MFDA 4NQWB 3HDDA 4BE0A 3VBHA 5C6CA 1NAEA 4BE1A 4G94A 4LO5B 5A3NA 1MBJA 2VD7A 3HOBA 1Y43B 3SZTA 2C9AA 2STWA 3H3UA 2Q0AA 3RQ4A 2ME0A 2RDRA 2WZR1 1ZX5A 2XH6A 2BOIA 2QVSB 3M1HA 4XF9A 1UPIA 3OD0A 1MVQA 2H6CA 4IVNA 2QBYA 4MADA 4LJZF 2XRNA 3MV01 1JTZX 3F8BA 3BPZA 4LG0B 2XJVA 5KXBA 1OLTA 4O61A 2R0QC 1C57A 1UU6A 1EAH3 3AMPA 2TDXA 3E7LA 2E31A 4Z8BA 1W6NB 4C91A 2ZHMA 3F3XA 3ASNH 4XFBA 4D6SA 3K4JA 1TP4A 3CC4I 2JWTA 5FYHA 3CDIA 2YSRA 4LBLA 4N53C 5FPUA 5LY1A 2JECA 4XIOA 1U9NA 2DU9A 3LSPA 1D1CA 2K4BA 2VQTA 1NQDA 3EYPA 4UFMA 3LA7A 5LBBA 2QQPA 3C3WA 3O8HA 4HBNA 1LODA 2RS33 3D6EA 1U0AA 1UYZA 4XQDA 3PSFA 2TEPA 2VMEA 5FBJA 5J6XA 5FWJA 4E7ZA 4MGIE 3WTYC 1N3PA 3KCXA 3T3YA 1H6XA 3QH7A 3BG6A 1TMF1 4AVAA 1J84A 1MZFA 3M3IA 3F9KA 2OA4A 3WU2C 4ABZA 1WCQA 2ID6A 1HQWA 1GXPA 3C7JA 1U5IA 1ONVA 4LO8A 4PGHA 1X1PA 2K02A 2HKOA 4GXLA 5FK7A 3ZMVA 3O0VA 2VONA 3BR5A 1JH5A 5CAZA 3HGYA 2WRAA 4JGZC 2ERFA 3QWLA 1WUVA 4ASNA 1HB1A 1WJ5A 3OYCA 2VJIA 3FISA 3CZUA 4UNOA 3O5SA 5ERLA 1SBFA 2V79A 4NC8A 1P8JA 4LPLA 5FO7B 1W6QB 4YRDA 2R7VA 5DZFA 5E89A 3SQOA 5DAWA 1QH6A 3Q8EA 2LY1A 2YHJA 3OOPA 5DZGA 4Y1VA 1JYNA 2VNVA 3AMMA 4QKDA 2HWC3 5ICGA 3ABKH 3ZDSA 3OPZA 2JX9A 2BOLA 2V5DA 3MICA 1W8TA 1RJ8A 3IMNA 5FYTA 3O2PE 2R071 1T2XA 3JRDA 2ZJPF 3K2AA 3EHKA 1OC1A 2BY1A 5AC91 4D7YA 2R5YB 1W99A 5KXCA 2C5DA 4Q48A 2KT0A 4CPBD 1QO0D 1OOPB 2IXSA 2WFF3 4DQAA 4LKDA 4RGRA 5EWSA 2FDJA 3OYGA 1XU1A 2YGMA 2P3JA 5FROA 5BOXA 3TO7A 2EFOA 4MQVA 4RFRB 3CC2I 2HGCA 1UY3A 5FLHA 3V8LA 4NOTA 1R1A1 2X51A 1PO12 4A3ZA 1IC8A 2D3PA 4N43A 4JV4A 1VNDA 2BW8A 1RUC2 1NA1B 2W94A 5C3QA 5FYYA 4ZU5A 5EYXA 1Y6IA 4KU7A 4I09A 1C8M1 1QZYA 4CRQA 2IC1A 4II3A 2DYCA 1PVC2 1LU2A 4AI8A 2RS11 1R5HA 1A78A 2VQAA 4HQMA 3BPXA 1STZA 3GXOA 4UB8C 4I01A 4Q26A 5DN2A 2WWUA 1Y39A 4JAAA 1PVXA 3ZM8A 1RB8G 2B63J 5C4WB 1XBFA 1AJOA 5ABJB 2ZX2A 1JZ2A 1MS0A 3CJIB 4A0YA 5A70A 3T2PA 3WDYA 3WU1B 1GP6A 1IGOA 5LHIA 2RR12 3FBMA 1O4YA 2ZMEA 3IDEA 2LYCA 1WMEA 5HCFA 3ULQB 3DU6A 5FLXZ 1LTEA 4MQ9F 2RG4A 3PUIA 1W5TA 3QBQA 2VLAA 2Q5TA 3DPRA 4RYDA 4GRIA 5F04A 1X2NA 2GC3A 4M6XA 2IBDA 4P9FA 1OI6A 2Q4SA 2DBIA 3CU7A 2F6CA 1UAAA 2JD9A 2E19A 2QCOA 1PIV1 1YFHA 3GBWA 2MSYA 4L9BA 3K4LA 4KIFA 4JGYB 1E5RA 2HKXA 1MEC3 1HC8A 1IXSB 4XFFA 1FY7A 3CLQA 4MGYE 4KJZA 1ND3A 1W5CC 1PVEA 1USSA 4BACA 2EVXA 3M3CA 5LGTA 1PK6C 4FO9A 5L9RA 2L4MA 3HJRA 2TNFA 1YS7A 4I0AA 3JRBA 1HB3A 2ZB9A 2X6XA 4LLLA 3BODA 4KI5M 1ASJ1 2W4SA 3CCSI 1FZPB 3OBZA 2VMFA 3ZR5A 2ZGSA 1JGSA 1DGWX 3E5UA 2Y8KA 2Y9ZA 3F21A 3BR6A 1LKNA 3CJQB 1OQ1A 3HKZN 1RR8C 3GTPJ 4ENNA 2D98A 4D7NA 1HV1A 2ARCA 1CPMA 1TBXA 1XC6A 2P7VB 2WT2A 4NIDA 4GALA 1W0TA 4YW7A 4I0BA 1TW2A 2GXAA 3DXTA 3AYDA 4DRVA 2TCTA 4FQGA 4JDOA 5ANQA 1O4ZA 1SFPA 1EH6A 3A23A 2YMZA 2R7OA 1WSUA 4BQXA 2KDZA 3W6VA 4IHTA 2IXKA 5BPIA 2GNTA 4NVPA 2MFZA 1W0OA 4CP1A 2ZHNA 2IA2A 1E17A 2CSGA 4XBFA 2N7GA 3AL0C 4FOWA 1AR71 2VL4A 2X4HA 1NG0A 1VALA 1RUG3 1TQMA 4LEJA 4Z2AA 4V2GA 3MKYB 1HXDA 1B09A 4LKEA 3HOXJ 2ECCA 1OYYA 4WVMA 3QPHA 1H9GA 2A5WA 3ZXDA 1GZCA 3M2MA 4P9IA 3LGRA 2XB0X 4BZ4A 3HHGA 2HWE2 3W5MA 1OD5A 2DMTA 3G6EI 1QQP3 5KK1A 3BTYA 3UR3C 1VQLI 1QJX2 2OZJA 2QQAA 2RNGA 3R4DB 4OIQF 2LFBA 3C8XA 2IGOA 1RUH3 3H92A 4LUMA 5FY8A 4E6KG 4MSVA 4NO4A 1TT5B 3CNAA 1FMVA 4Y1XA 1IF1A 4WVVA 5I0UA 2AQEA 1XNTA 5DUKA 3ZXKA 3WG1A 4KN4X 1J09A 4JHTA 4CZZA 3VD9A 4KGQA 1IV6A 1NLRA 5K8SA 2VQCA 2WINB 3JRGA 2FCVA 1RESA 2UWMA 1QPMA 4G7OF 2Y9YA 4WXCA 4QSHA 3RFRA 2SLIA 3W59A 2D45A 4RGXA 5K7HA 4AFCA 1QXRA 4M3BA 3WHBA 1APLC 3GYHX 3DN7A 4G7HF 4BA6A 4RS5B 1EKEA 4CDWA 1ONAA 1EA3A 5IK4A 2RM23 1C28A 2EK5A 1X4OA 2O8XA 1LDKB 5DAQA 4L9NA 2CGPA 2DCKA 2JG8C 1NCRB 1TQPA 2COBA 1MS3A 3V7CA 1QGLA 3WF3A 5E20A 4RN5A 4XRFA 3VDBA 1OR7C 3LQQA 2CV0A 2D97A 3ISPA 3CUQB 2JZYA 1W39A 1UU5A 4IV1B 2WV0A 1XN7A 1VBB1 3OL3A 1TMF3 2RV9A 4Y22A 4XKVA 4U7BA 3WNOA 5J4VA 5IAXA 1XYPA 3RS6A 2V1DA 2W57A 5B3SH 4JP0A 3UV9A 4L0ZB 1BBT2 4RR3B 4YPJA 4Z07A 4LQRA 1DDNA 2PELA 2JJ6A 3BYWA 4XDQA 2VTXA 3I2JA 3RGBA 1SG3A 4CZSA 4N4OB 4XILA 2OPWA 4K1YA 4DZPA 4RQPB 1A04A 2CU5A 3NV1A 3I2OA 2XGDA 5DM6F 2WT1A 3SEZA 2V1XA 3S14J 2PEXA 3OIQA 5JSPA 1BR2A 2YU2A 5M5YJ 2W08A 2ZZJA 4CH7A 1DQ5A 5FKNA 5A32A 1LCLA 2K27A 4LBOA 3ML6A 1PMJX 3M3OA 5C5UA 2X09A 5H9RA 4YVSC 5HOOA 2BDRA 1MW7A 1VQ4I 1BJZA 4A44A 1HW5A 2DFIA 3EYIA 2H1LA 2JSCA 4E7LA 1FYLA 3J8F3 4CCMA 1R082 4HF2A 2A6TA 1YJWI 4QM9A 1EV7A 1BI2A 3PURA 1X3WB 2Y75A 1YCIA 1DQ0A 4CDUA 3O0XA 1S0GA 4LNVA 4XHBA 1CAWA 1XDUA 2E63A 1H0MA 1CAVB 5IK7A 4I76A 1ENXA 1LJ7A 2HDDA 4BBSJ 2W39A 4A0ZA 2OW4A 1OPMA 4QKFA 2DTZA 5LK5A 1MNDA 5TGTA 3TEZA 1ZZ6A 4XBLA 3VZJA 3GXUA 5DDJ2 4LITA 5F08A 1ZRIA 2KXLA 3ZN0A 1CR7A 5FFZA 2RVCA 4Y5Z0 1G7YA 1LECA 2C6SA 1T38A 2HPMA 5GALA 2RS13 4XBNA 1BI3A 3KZIC 4WZCA 2BTVC 4INDA 1ULEA 2IFWA 3IPVA 5FKMA 4JDNA 5FJHA 3HRTA 2R4GA 1G9DA 3O1OA 1Q1HA 5DEQA 4F8AA 5L9BA 3KYLA 5FMBA 1AL23 2GA2A 4BXFA 3VDDC 5IJRA 5JZGC 4RB2C 3POBA 1Z6RA 3T2QA 4IV3C 2WTEA 5D8AA 1YFWA 3D3AA 3U9GA 3J7NA 3U37A 2GDFA 1I3HA 5KHJA 4MG2A 4BCUA 1ZA4A 4NRMA 1ZAOA 4GD4A 5C70A 4A3DJ 3FN9A 4JRAA 1Z91A 3U78A 5EZGA 5EV7A 5C4XJ 3REOA 1ZG3A 3O1VA 2Y30A 1OYIA 1KYWA 4XXPA 2FCTA 5HDGA 2DMPA 1QJU2 1FOD3 2F5EA 2Q1MA 4HZFA 4RB1A 1H8TC 3FHAA 4DXSA 2ELHA 1UX7A 2FRHA 4CP0A 4KG8A 4XLNF 3DCQA 2LD5A 3H0GJ 1UWWA 5IOYA 5DUIA 3ZN5A 2D3RA 2QQJA 5E3MA 4I7HA 3NVCA 4B09A 2L2OA 2IPQX 1W3XA 4A3BJ 3NNFA 1OA4A 5FQ0A 2QENA 4AM3A 4XBQA 2VKEA 5A7WB 3WTZA 3OGJA 3OD4A 2LS6A 3TYJA 3WG7H 4D94A 2F5CA 5IP6A 3HSRA 1FNZA 2XQXA 3GCXA 4XUOA 1HKDA 1FWZA 3ETPA 1O6UA 1VPHA 3EETA 2CQQA 1YIJI 2XHNA 2MEV3 4WM7B 2VZVA 3WW1A 2HYGD 3K2ZA 1S72I 2CTVA 1B6AA 1ODNA 2WWJA 1O3RA 2RJLA 1YO5C 4CCCA 4A3KJ 4KNCA 3BZ6A 4JTNA 5F37A 1FT9A 3JD72 1X3ZB 5FTTC 5IOZA 3HOYJ 5ERIA 2MHFA 1RC9A 2E60A 2ZAHA 2PAMA 5FZFA 4AGGA 2VI6A 4XLFA 4RGAA 3B6AA 5EFUA 2GP3A 4CCKA 1SLIA 4YG3A 1D4M1 4EN0A 1WH7A 1GICA 3VDCA 1MPXA 3BKZA 1UW8A 1LVAA 1MS4A 3CBNA 2DODA 4LOTA 4AQ2A 3SH5A 4S2GA 4P9GA 1IZ1A 1VP6A 1FOXA 4ZZDA 2G1MA 2DTWA 4Q1RA 1U9OA 1R23A 1FSHA 2ICWG 4K40A 3V65A 2XSJC 3H5RA 2NVYJ 1B4AA 4YW4A 1AL0G 3H5AA 2D43A 2I45A 1GXQA 3CCYA 1UYPA 4COUA 6PAXA 1NQJA 2C6YA 1GNYA 3K2OA 1KU2A 4AEKA 3TEWA 5AVPA 3QP6A 5T55A 2KD7A 2QEXI 3A1YA 3HJEA 1PO11 3A03A 1UG0A 3WTWC 1WCDJ 1AR91 4Y5SA 4JRLA 3DEUA 2VT2A 3FUQA 5FBZA 3E6DA 4WVWA 3LD8A 1W05A 2LBFB 3TL4X 1JOJA 2GZWA 5CEHA 2L9RA 4XMAA 1ETVA 1PVC1 3B93A 2DQRA 3ATGA 2MD0A 4KUMA 4GH4B 3DEMA 1FMD2 4ZU4A 4X0GA 5IYBJ 4CDQA 2XXZA 2G19A 4R79A 2VQLA 1HSJA 3GGLA 3ROUA 1UY2A 1J7KA 2OQ7A 2CQXA 1Z0HA 1WCSA 4DEQA 3Q8BA 3CMGA 3ZQCA 1WI3A 4KL1A 3CF2A 2NZ9A 2VXZA 4E4ZA 4LLFA 5JR2A 4NPMA 3KZZA 3P9KA 2DFBA 2V9KA 4D0QA 2K3FA 4DOUA 4HSTA 1AHDP 3OYFA 4TZDA 3IM0A 4J1XA 4Y3OA 2ZGOA 2QBXA 4Y13A 3H8RA 4YM0A 1O7LA 3PDQA 5LCWL 1G9AA 2FDFA 4CEWC 5F0CA 1SFOJ 3FXOA 1MVEA 1AWCA 4IGPA 1XE0A 1YG2A 1WH5A 3RI4A 3THCA 4IHXA 4YVWA 1OHFA 2K46A 3GMEA 2JDHA 3CLPA 2QQ9A 3BVCA 5EIYB 1PGSA 3SH3A 1IN5A 2DA4A 3D5OA 3WF4A 5CVVA 2OX0A 5F5QA 2JT1A 1ZG5A 2B4KA 2KDOA 3K51A 3BCWA 1FX5A 2QSGX 5FP3A 1YQ2A 4JQRA 2OIIA 4NAMA 2L9LA 3LQRA 4ON0A 1JKRC 1QJY2 3EDPA 4H3WA 1X50A 2HOSA 2KFDA 2WO1A 2AXTC 1RKTA 2WS93 2K4JA 2KRFA 3K1NA 2E34A 3SNMA 3JRCA 5JZGB 3OR1C 4II2A 1IW7F 3IAS2 1IS3A 2K40A 1GZWA 2D6NA 3HWJA 1SC7A 2CGNA 2PN6A 3DCFA 2ZX3A 4QPYA 4BJ0A 2VE1A 4PSXA 2UXXA 1K7AA 3Q8AA 3MIHA 2EFNA 5BS6A 1JN2P 4PFPA 4RD7A 4DYRA 3L2RA 1D5VA 2KIUA 4IE4A 4BMEA 1QU3A 5L3BA 1DPUA 1WHUA 3MIBA 2E33A 2GSYA 1TC3C 4G4FA 3W2VA 3O1SA 1W9SA 2X1EA 4XDPA 4OHWA 2KRHA 3BOPA 1OKOA 4FP2A 4Q8LA 4XLHA 2OCCH 3PQKA 2VBWA 1AYM3 4EM1A 5FLXK 4E2GA 2D44A 1OQDA 2NLRA 1POV0 1QJX1 4DUWA 5FWEA 2RQQA 2E7QA 3ETQA 2AS5F 1X9TA 1YOVB 5H2FC 2QDRA 3CZJA 1KS5A 4P5HA 1GV5A 1K5JA 2XDVA 3DEEA 2UXNA 2JMWA 3K3OA 1UMHA 1ZARA 4QPIC 3BG9A 1CPNA 3BJAA 3BJOA 3C2UA 5EQUA 1YIOA 3LFUA 2IP2A 1R71A 4YLZA 2DA1A 5BNOB 2OUJA 5KXEA 2D6OX 3H7JA 1JYXA 2TUNA 4LA3A 3WDXA 1ZZ7A 1HN0A 3G4SI 3ZQGA 4KG0A 2FZ1A 1OKRA 1W8UA 3N7LA 4ASLA 1SFYA 1KRIA 3HOZJ 1AXZA 1ZRFA 1KQ8A 5DG1A 4IEZA 2YPJA 4F3QA 5IVEA 4GA9A 4NQWA 5JXJA 1VBE1 2F4OB 1FPN3 3BCBA 1W9FA 3LDKA 1EV12 1BCXA 3S3OA 1NK3P 5T52A 2MH9A 3VFZA 2A69F 2HYFA 1W03A 4LBNA 2R49A 2IVIB 4FXGB 2VC1A 3ZSLA 1F5JA 1D0GA 3ZFFB 4V1PA 1U5TA 4UFLA 2R7WA 3RZMA 5L19A 1PGL2 1V0AA 3Q8FA 3HBLA 5CFDB 5I8TA 4F3JA 3HKZA 3RKQA 5ANNA 1BBT1 5FZ9A 4OHVA 5HXVA 4PQ9A 3FWEA 1G9FA 5ILVA 1ZGJA 1RUE3 4FOYA 5FKKA 2ET1A 2DTRA 3I97A 1FP2A 2ZMLA 3S0MA 1MDMA 3PQJA 4RS8A 2Q0OA 5D5VB 1NX9A 1XNKA 2VECA 4Y5TA 3VB9A 4DOZA 3WNMA 2YFZA 3FUOA 3LFKA 4BDVB 2RKHA 3I2HA 5FK8A 3VBUB 1FYMA 1CZVA 4LBQA 1AZDA 3P1IA 4LHLA 3CLOA 3J80Z 2Q2EB 4HF0A 2A6XA 1W5SA 2WNUA 4IHSA 3C2GA 5H6QA 3FLPA 3KV4A 4F91B 3UT0A 1US3A 1R081 4P14A 3HOWJ 3NNMA 1PGW2 4LB6B 4AG4A 2C1FA 3ZXAC 2JDNA 4LKFA 1MBKA 1JTYA 3DKYA 3OYKA 5L3EA 1K5MB 4Y1YA 1W9WA 3WG2A 2KHMA 4IHWA 5I0RA 2AYHA 4PJJA 4JVAA 5FLMJ 1IUFA 3VLBB 1L3LA 1ULPA 3POFA 1PO13 2VZSA 2R7ZJ 3CJNA 2MLGA 4B1RA 1RUC3 3K75B 2VCBA 5DDJ1 1V5GA 2XF5A 4HRIA 2O0YA 2A05A 4AVCA 4NC6A 1XSXA 2W82A 2X53S 4AFDA 3WE2A 5F0FA 4M72A 4V2VA 2UU8A 2QQWA 3E5XA 2OPTA 3A2KA 3WP3A 2R5YA 1T08B 3UYJA 2XONA 2ZJQF 2XC7A 1LE8B 4IE0A 1CAUB 1E2XA 4Q4X2 4AVBA 1QEXA 1Q3EA 2DCZA 3MVPA 4EN8B 4ENJA 2CWEA 2B9UA 5IT6A 3T09A 2PJRB 2WN3A 4HPKB 3IC7A 1DDLA 3ZPOA 2ORXA 2RR13 2XVLA 3FZVA 4XNFA 4YM2A 2N8GA 1I27A 3PO3J 2Y0MA 1CAXB 2Y0OA 1GANA 1MGTA 1X8MA 4H7MA 4OU0A 2WAQN 4AI3A 2PBIA 3OIOA 5KVRA 4PBOA 4AHZA 3UKNA 4Y33A 3LPFA 1QJU1 3U1XA 1VB4A 4PGGA 2HYXA 4X6QB 3WSOA 5FYMA 3NAPA 1N1YA 3CF5F 3G3ZA 2JICA 2UWBA 5HCAA 5KC6A 3GTLJ 2VZUA 1UOBA 3I49A 3S3MA 2QSHX 2RQPA 3KP4A 3FL7A 4C1WA 5JXIA 1W6OB 4CCDA 1LDDA 3K46A 4DBQA 5FKCA 5HBAA 1MSEC 3IIIA 4N0BA 3VBOA 3ALQA 3I71A 4J00A 4NB5A 4ZC3A 1SD7A 1SD5A 1UQXA 3CCUI 1MSFC 1BIBA 4G12A 1T8IA 1W28A 4PBPA 5F64A 3CCQI 2VU9A 1TTYA 2ZJ2A 3QPSA 1SFNA 3VOEA 5L73A 2A61A 4RAZA 3BTIA 5CJ9A 4BPZA 2LRDA 3ZQLA 1HXS3 2RDQA 2W92A 3MZYA 1FOKA 5B1AH 4GIQA 3URFA 1NT0A 1MZBA 2A5YB 3ZYIB 3RZGA 1ENQA 2CUEA 2BUKA 2VGDA 4MTEA 2XJSA 4LBJA 3M4FA 4YW3A 3SEQA 3CCVI 3X29B 5C9AA 3JD71 1VRH3 3HZJA 4L8QA 3RMXA 1APNA 5EEAA 2XLAA 5CQGA 4HNTA 3DTIA 5J3LA 4H14A 3QD6A 1QJFA 1PDNC 4FP3A 5KXDA 2ZTNA 2WDBA 2PQSA 1ZELA 1VR3A 3D5RC 4GCVA 1MQTB 3AJZA 3HNYM 1WJFA 4XQWA 5FO8B 2ADEA 1WBFA 2JEMA 3JQXA 1IAWA 1XOYA 1WW4A 4GYGA 2X5IA 2GOXB 1TG7A 1X3UA 1PMIA 4F55A 1LB2A 2M30A 4TLFA 1M1EB 3DPRC 2QQVA 3TOBA 4YWAA 2GXBA 1T39A 2HWE3 4UBGA 3T5XA 2GMMA 3FE5A 1HRI1 1KQ9A 5GAGJ 4A3CJ 3SKJE 2B39A 1J83A 1BW5A 1P7JA 3LF7A 1ND3C 5A6QA 1MR5A 2V26A 1E57A 3FHNA 2R5ZB 2ME6A 5GZFA 5F7UA 3ES4A 4CYCA 2O8QA 3NNGA 4P02B 5J1YA 2CUZA 2NNNA 4YIFA 4UV8A 1BA5A 4YZ2A 1BIAA 3S1QJ 3ZMOA 1Y3TA 1OJLA 5D5XB 1A8MA 1IG3A 4B43A 2OZ6A 2EA2A 3UKTA 5K9YA 3UJQA 2W3JA 2AREA 2A6VA 2ZXIA 4HN1A 1HSTA 1F5FA 2EINH 1FMD1 1VAKA 3B00A 1BVP1 3EMRA 4M9SA 1VLNA 3BN6A 3BP8A 4UV9A 3VBHB 5L3GA 3U4XA 1REDA 1E5SA 3HPGA 2KISA 4CU9A 1YHQI 4HDVA 2JWPA 3VHPA 4NDLA 2VXJA 3I2FA 1AX0A 3VZLA 4W6WA 4L9TA 2I2SA 2H09A 2XGCA 1POQA 4ZXKA 1S1AA 1KGYA 3UKGA 2I74A 1GWLA 4A6OA 1J0RA 1RVF3 2RMU3 2ZJCA 3C18A 1M06G 4DINB 1TWGJ 4M4PA 3IAPA 2ZGPA 4XYXA 2GMEA 2M34A 3VBFA 3FLTA 1DGRN 4BLJA 1O4TA 2H8WA 3OUHA 2XWBB 3SZGA 1ZGAA 4FX4A 3I58A 1GWMA 2LY2A 1OFSA 3U11A 3ZMDA 1NE4A 3OBRA 1SPPA 2IZWA 1SD4A 4A12A 4DYQA 2QKMB 2QUOA 1FSEA 2HZTA 3UNGC 1AX1A 1JBCA 3GYDA 2KIQA 2HQ5A 3A0NA 3KV6A 4BM8A 5TSWA 4L5IA 3WNPA 2R063 1Z05A 1N75A 2DA6A 2ZNZA 4R4ZA 1MJAA 3CDLA 1SLCA 5L3FA 1ZBE3 5FYZA 5JMCA 3H9AA 2XUMA 2WA3A 3ILNA 1UZYA 2EIMH 2GIZA 3Q3SA 5I91A 4GFBA 4I0WB 4U0WA 3CUQA 1LOCA 2NYYA 4FPCA 3VHOA 2Y69H 3BTAA 3ZYBA 5LA9A 4IV1A 5FZCA 5KNLA 2DT7B 2YGLA 1QJY1 1CGPA 2R6QA 5C8WA 1R083 4GXOA 4ZU7A 2PMUA 2CY6A 2Z69A 4M9XA 1X7NA 4MV2A 3CQZJ 1J5YA 1YRNA 5IK8A 1T6SA 1LOAA 2P5VA 2NQYA 3SXWA 2Z9OA 1JYCA 3IN9A 5FIXA 3ZMNA 4ZXEA 4UF0B 3K4CA 1ZK8A 4Q0VA 3ELKA 2M5WA 1FTZA 4GB31 5FYVA 1G59A 4YARA 1J3RA 1FV3A 2NXNB 4PCQA 4A45A 2DCYA 2EICA 2ELJA 1IV8A 2DBBA 1OCRH 1XYNA 2HNHA 2ZEZA 5JXHA 2XPVA 1UY4A 3FBNB 4HG2A 2V4JC 4K9SA 2X6OA 5FRMA 5FY4A 1SAUA 3WGGA 1L7LA 4DXZA 1YJKA 1U5ZA 1OVPA 2VY0A 3AYCA 5DG2A 1FJLA 4BDYA 4OHZA 4GKYA 2YB7A 2BVMA 2DCTA 1F4KA 3PUBA 2FZ2A 1NCQC 4BUPA 2L9NA 2W48A 3TRSB 1W04A 2BEOA 4QXBA 5CYYA 3PTRB 3MGUA 4B4PA 3RNSA 4ITVA 5JOWA 3FK6A 3MPBA 1OPOA 1G4DA 4ONUA 1AUYA 1H2LA 4N43B 3BPVA 5FZ7A 4HETA 2BYVE 2Q30A 3K69A 1VRBA 5F3GA 3HOSA 4IEXA 2EFPA 4NMIA 4DY5A 2JQ7A 5LGUA 3WZ1A 2DFEA 4XLPF 4LA2A 1UF2C 1XGOA 4D69A 1MMGA 3AK0A 2LF7A 2AUYA 3SHFA 3Q9VA 1QJU3 3S1RJ 5JI9A 1H88C 4XM3A 4OAYA 4IW3A 4QKBA 4ASKA 3M70A 1UN1A 1D8JA 4ZDLA 2WZEA 4CE8A 3ZLIA 3MZ8A 4QX5A 2F2EA 3ILRA 4AI0A 2LG4A 3B94A 4EATA 5EJCA 2BXYA 4CDUC 5D5UB 2ZMEB 3E6BA 4HLYA 2XUBA 4MO7A 1EV11 1KDMA 1W6MB 4XZUG 5I93A 1LOFA 5T5JA 4EQVA 4CEYC 5C71A 3RPQA 1XRUA 1IN8A 2OBPA 3T0AA 3KFWX 4A6SA 3S5AA 3V7RA 4FTHA 4ES8A 5ILUA 5EGOA 1P4AA 4DZJA 1SMTA 3WTXC 3HBZA 1JS9A 4PCRA 3DYOA 3LCPA 3MO4A 1PO23 5I8YA 3KX2A 4BQ5A 2A3YA 3O6BB 2R7XA 2NOGA 3F8MA 4XN0A 1U5YA 4H4KC 1LDJA 4IO9F 2ZXQA 3K7AJ 4CUBA 1KXGA 2E26A 2WAEA 2XGEA 2YYOA 4ZDPA 2JG9B 2UWAA 2L5QA 4FI9A 4E7IA 5GP9A 5K0UC 1G3WA 2XSDC 3VPRA 3WHTA 1RHI2 5D8AC 2RDSA 1PNFA 4B48A 2H1KA 3LWCA 3T2OA 4W65A 1IKQA 2ZX1A 5BV6A 4QX7A 1B1BA 3OGSA 3V8KA 2Q8DA 1SD6A 1W2AX 2VC0A 4LMFA 2YROA 3TWIA 4WM8C 2IA0A 2CMPA 4KIBA 1H0BA 4NHJA 2IXLA 4A3MJ 1WW6A 1S29A 1PGW1 1HQNA 2X10A 3ZPLA 3ZFGC 5EHDA 1W3VA 2FX0A 1R093 4KWUA 2XPJA 1DZRA 3HQRA 2R7RA 3GLXA 4ZYHA 1KYZA 4MOAA 2X05A 5A80A 5KHGA 4LO7A 3IV5A 2A68F 2PJPA 2AACA 4P5YA 4K21A 5FUPA 3DF8A 2KKOA 3A02A 3OL4A 4IHYA 3K3NA 1COV2 1DGWY 1VQOI 2DFFA 1FC3A 3I4IA 2WAAA 2EILH 3ZFEC 4D8MA 3AZXA 5C33A 4QIWN 3MHZA 5FO5A 2ARXA 2FCUA 3I54A 4BIFA 1WKMA 5IPAA 4WVMB 4YG2F 3K1MA 2BY2A 4OFGA 2E1MB 3JTGA 4XLCA 2BOJA 2ESNA 1R00A 3E0JB 2L7FP 2VVDA 1GWKA 1OKQA 4EWEA 2JKBA 2WFPA 4Y26A 3MFKA 4FAHA 3E1F1 1YNAA 1YQ5A 4Q4X1 4GJYA 3O1TA 3I59B 5J1UA 3R4KA 3MF6A 1RUD2 1TME3 3HPNA 1UY0A 4XAAA 1ZA7A 1W7PA 3N3HA 3GVAA 4OMZA 2LALA 2DUQA 2HS5A 4DMIA 2XAGA 2DTYA 2JIJA 3UGHA 4KICA 2AQFA 5IY5H 2MBFA 1ULGA 2RV8A 2MC4A 2CSOA 3QP5A 4PDWA 1WGPA 4XOGA 2EXKA 2LBFA 2IJLA 4AE2A 4QPGA 4PQQA 1SCRA 4DNYA 1QZZA 1AYN3 2Y31A 2I07B 4YZ3A 3EUAA 4CDWB 4AZZA 3S2DJ 5FZ8A 2FDKA 5LA2A 2E6VA 2LRPA 5LRSA 4U87A 1P92A 1QOOA 2J1EA 4GZ9A 5FXZA 4CUGA 4L2NA 2YS9A 5F8PA 1BJAA 1FNNA 2OUHA 3N9PA 3ZPYA 1OSGA 3EQEA 3G7DA 4UHTA 1PMHX 4CXYA 3J80K 4Y4RA 4ZYEA 2QZ3A 3THDA 3WQBA 1EYBA 3QPTA 2WL1A 3OPTA 4XF4A 3OYWA 4FBFA 1JKQC 5LY2A 5J47A 2ZGTA 2PHFA 3TBIA 4PF5A 4XF0A 3CP8A 3GZAA 4Y22B 3CMAI 3OPWA 1C1FA 5F3EA 1ND2A 4CP2A 3VBSA 1ZVFA 1HF0A 1WJDA 4XICA 3LSJA 3JCIA 1NLSA 5IWFA 3KHBA 1DYOA 3B6CA 1S0IA 2OKXA 5F2WA 1H4GA 3BIWE 2VXDA 1JJ8C 1O8SA 3OGGA 3CD6I 4LK0F 1YYVA 4QPQA 3KLNA 3Q5FA 3CF6E 2E53A 4CDQC 1CQTA 2W47A 1I5ZA 3H8XA 1HIXA 2E9QA 4CSWA 5FZBA 1OF3A 5CVRA 2FSWA 4XCAA 2DYRH 2V73A 2K9SA 1TWAJ 3OYIA 4Q0PA 4RAYA 3MKWB 1J1TA 3PUHA 2GH8A 4YW5A 1JI8A 2XMLA 4XR6A 3HEIA 1HQLA 3BI3A 3IL2A 4XRSA 5CKQA 5L7OC 1YLFA 4DO0A 4CDUB 2W2IA 2XVGA 3BR2A 3PVBB 2GQQA 1LHUA 3ACFA 3OY9A 3JBG2 3MIEA 1BBYA 2BBYA 4Q0UA 4AL9A 1W36D 2D7FA 2P6HA 1RUJ1 3H50A 4RFT0 3NKTA 2LREA 4LLNA 3KP5A 2DYSH 1GQHA 4GWMA