3LA7A

Crystal structure of ntca in apo-form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
209
Chain Sequence
b'DKALANVFRQMATGAFPPVVETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Global nitrogen regulator
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
total genus 65
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la7A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la7A01
2D2WA 3IWZA 1KYWA 1ZAOA 4IEWA 2PLYA 1JUHA 4EJOA 3GZ6A 4I2OA 1Z7UA 2L54A 3SXYA 3TDUC 2XL7A 1SFUA 2BBYA 1YW7A 1O7LA 1O5UA 1QXJA 1BI3A 5JR3A 1R5GA 4I09A 5HVQC 5H6QA 2VECA 1YFHA 2H27A 5E1ZB 3JAMK 5TRDA 4RB0A 1Q1HA 1XCVA 2XLGA 3HOTA 2O6GE 3ETQA 3CUQA 4ESFA 1G3SA 4XLPF 1G3YA 3I64A 4BHBA 1CAUA 2Q30A 4Q0SA 3E6CC 4HZFA 4XEZA 1X7NA 2X0LA 1XMAA 4YSFA 1XB4A 5J8FA 3NEUA 4Y15A 4XF1A 2B0LA 1GXPA 4L18B 3E5XA 4FHTA 3RKWA 1YWKA 4PCQA 2MPFA 2ET7A 4M72A 2ZCWA 3E6DA 3R0AA 2R7FA 2VXZA 2EV5A 4P55A 5DYMA 4I98B 4PZJA 2QBYA 2P5KA 2Y48A 2D5FA 1GHCA 3KGLA 3I58A 1NYWA 5KHKA 2ISZA 4Q0QA 4LG0A 3CUQB 1SFXA 3HUGA 1SMYF 4IETA 2XKOA 2G7UA 2D40A 3R0JA 2QQ9A 2K7LA 4O6JA 1K79A 1FYLA 2Y75A 4META 4E2SA 3KP2A 3MAJA 4NVPA 2DLLA 3HIFA 2F5FA 4X6RB 4I0AA 2V1DA 4ENKA 4KDPA 1IXRC 4PDKA 1OYIA 4H7LA 2J5OA 2EV6A 4IEXA 4L5IA 1FWZA 2EFOA 2OZJA 3ES1A 1BI0A 1Z05A 4EWDA 1TW3A 5BOXA 2ZMEA 5BPIA 3HRUA 3WE3A 2DI3A 3GFLA 4EJWA 1OYWA 4PGHA 3ACLA 2ZXJA 1FZPB 4LG0B 2QLZA 2LKPA 1WKMA 1IZ1A 4HLYA 1BIBA 4AD9A 2HYFA 3D82A 5L3CA 1J2XA 4Z2YA 4G94A 2YR2A 3LWFA 5KHHA 2PYTA 4CDGA 4RGXA 5KBFA 2DK8A 2ETHA 2ZKZA 2E9QA 2EJRA 2ISYA 2PG4A 3EQLF 3GVAA 4O5VA 1ZHFA 4KMFA 3NW4A 2WC2A 1B1BA 3CO6C 2EA2A 2VBZA 4OU0A 2ZMEB 4ONUA 3H1WA 2OYZA 4MEXF 5JVTA 3IRRA 1TLHB 3TO6A 1LDKB 1W5SA 1DPRA 2PBIA 4RAZA 3C3WA 2FU4A 4DINB 3ST7A 4HV5A 2KIFA 5D5WB 5JSRA 2NNYA 4KIBA 2H94A 4KFCA 1XGSA 3FF5A 2FMYA 3BB6A 1G4DA 1HKTA 4OIQF 4S04A 3S0MA 2O8QA 5D1IA 2IP2A 3WG9A 1LKNA 3F8NA 1VTNC 2MD5A 3GEZA 3C7JA 1Z1DA 2PI0A 3LAJA 4HSJA 1P4WA 1LR5A 5CLSA 4RAYA 3JTGA 1XE7A 1I6XA 2FXAA 3MZYA 1R1UA 3ZMVA 2GC1A 2Z3YA 1JE8A 2Z99A 1U5TA 2WWYA 3DP7A 5DCFA 4IHSA 2KIMA 4XSXF 2VONA 2A69F 5I0TA 1RI7A 1HW1A 2K9ZA 4I0BA 1OI6A 3QU3A 2OPKA 3Q9VA 4KT5C 1YLFA 4HV6A 3RKYA 4AQ2A 4B09A 3E3VA 2ACJA 4HX4A 2RNJA 3H7JA 4L9NA 4LD5A 1MDMA 2PTMA 3J7AO 3OCPA 3ERED 4L9JA 1R1TA 1YIOA 2OU2A 3CJNA 4L5JA 2IA1A 3BOQA 4EGZA 4UVCA 1YO5C 2GWRA 3GYHX 4IVNA 5I93A 4ENNA 5DD4A 4JVAA 1G6NA 2W24A 5BUVA 2DQLA 2LF7A 1PM7A 2IXJA 3BPXA 1X3UA 1G3TA 3PNAA 3MPBA 1USSA 1Z9CA 4WK8F 3T5XA 4RGRA 1S8NA 4KWKA 2QUFA 1U78A 2HKOA 1ONVA 2EAAA 3F8CA 2UWMA 4KYWA 5KVRA 4I7HA 2EWNA 4IEOA 1FNNA 2IRFG 5BMZA 1TNTA 2HTJA 4Q47A 4DNCA 4WXDA 5E20A 3LWCA 4A6EA 2D93A 4HVQA 2K4JA 2OBPA 2XLAA 3FJSA 1CAXB 4NQWA 3JSPA 2JPCA 5FLXZ 3RNSA 2E1NA 2PHLA 1D5VA 4U88A 3K1MA 4LUMA 5CU1A 2LNBA 3AAFA 3BJOA 3TDZC 3JZVA 1LRHA 2QENA 2VC1A 3QACA 2ZJ2A 4HVRA 3M1EA 2NAZA 1R23A 3G3ZA 3KLNA 3L09A 1FBQA 1MD0A 1J7KA 3DPLC 4WF2A 2XVCA 5E1XA 4KL1A 4XRFA 4XFAA 3GZ5A 2XAQA 1REPC 1V4RA 1YQAA 1HXDA 1B4AA 1DGWA 5FDBA 4HX7A 5CYVA 3D0JA 4WXCA 3EO6A 4PIXA 4ON0A 4ESJA 1LDDA 4R52A 3KP4A 3H9AA 1RZ4A 3MZHA 3FMSA 4AIHA 1GQGA 4CXFA 3SCFA 4LULA 4AXOA 1R00A 3PQKA 2XAFA 4KU8A 4MH0E 1XGOA 3QP6A 5LRSA 3BPZA 2C6YA 4QWQA 2FBHA 2RC4A 4HQMA 5CVJA 1WWXA 5FQ0A 5E8GA 2YX7A 2QVOA 1LB2A 2AS5F 4LUKA 2VODA 3RZZA 1UHWA 5LLQA 1WLTA 1K78B 4YARA 3WTUC 1DP7P 1LDJA 3WW3A 5BXXA 4GYIA 3IHUA 5T3NA 2A6HF 4G6QA 3ABUA 2DPDA 2UZKA 5CADA 4ENJA 4UXAA 1E17A 1LVAA 4P96A 1WSUA 1QO0D 1CAVA 1FXZA 1U5TC 3WTZA 4ASNA 3JSOA 4OIPF 2P6SA 3EYYA 3HTSB 2MHFA 2HYGD 5A2QK 5FLJA 4HYEA 5IT3A 1QWRA 2VT2A 2Z69A 5AIQA 1B6AA 3LA7A 1LQ1A 2IXHA 3RKXA 1O4TA 4QLCU 5DV5A 1YFXA 3I5UA 5ICCA 1Q3EA 4BHPA 1H1IA 2ET1A 2JTVA 3MWMA 3KGZA 3L00A 3H7YA 1X82A 3I7DA 1L0OC 1IPKA 1CAWA 1ZVFA 2LSOA 5I0RA 5FFXA 4WBBA 5L3EA 3CEWA 2CYYA 1TTYA 4XF4A 2IPQX 2RQPA 2W85A 4ZYGA 1HBXG 3ECHA 4BNCA 2XIGA 5E1WA 5E16A 4IEPA 5AVPA 2O03A 4Q0VA 4L11A 1L3JA 1BI2A 1IUYA 3F6VA 4XFHA 1WRJA 3SXWA 2KRFA 3BDDA 3HT2A 5LGUA 3WGIA 3H50A 3RTRA 1TQMA 1JGSA 4XFCA 2G9WA 3PQJA 2VE9A 3LA3A 1SD5A 3SZPA 1UIJA 3KP3A 1ZNPA 2HOEA 4GYGA 2JZYA 4M74A 5HLHA 2M87A 5LHIA 2L4MA 5ED4A 2PMUA 1ZZ6A 3NKTA 4P5OA 5J48A 3KSCA 3QPTA 1GVJA 4A5MA 1SFNA 2ZKLA 4IEZA 4M6XA 1AWCA 4KNYA 3P7NA 4BQAA 1OKRA 4JBAA 5JFRA 2A68F 1XN7A 2P8TA 3NQOA 1YYVA 2V6CA 1ZH5A 3GFMA 2GC0A 3CF6E 2W84A 4M9ZA 3LSTA 1XSDA 4FAHA 2Y0OA 2STTA 4HSLA 3O6BB 3SZTA 3C3VA 4IEUA 4K8FA 3G7DA 3QRFF 1J75A 2CGPA 3ULQB 5F1RA 2Y0MA 5LEJA 3WTVC 4MTDA 3FMQA 5ILSA 4OIRF 1WA4A 2BNMA 4AIKA 4HW0A 1ZZ9A 3W6KB 5JHUA 2GC3A 3UKNA 2CSOA 3GYDA 5H20A 2STWA 3HQXA 4YNIA 3HSEA 2V09A 4YG2F 4LLOA 2ADUA 3ZMUA 4HQEA 4M71A 3EJKA 3V8JA 2FBIA 2A61A 1SD7A 4U0YA 1K7AA 4MGZE 3HRMA 5DD8A 1D8JA 3J81Z 4XLNF 4LK1F 2F5EA 3C18A 3T0YA 3I59A 5K8SA 1QBJA 4L2NA 1FP1D 3IKVA 4MTEA 4MGKE 2Q8KA 4EWEA 5DUIA 3DF8A 3M8FA 4N9IA 4OINF 2FEZA 1W5TA 3V8LA 4DQ2A 2CQKA 2QZ8A 3WTYC 4HF0A 4HOBA 2GXGA 4P9GA 2VBXA 4S05A 2K02A 4MZUA 4AQ6A 3FHZA 1IRGA 3H8UA 1UD1A 3ISPA 2I45A 5IT9Z 1BC8C 1CAUB 4YFKF 2PJPA 2VOPA 5J7MA 3HT1A 1J9IA 5E8IA 5FB2A 3USSA 4PGGA 3WTTC 1X8MA 2BE5F 5D8LB 1MGTA 2EFQA 2F5DA 1QNTA 1YG2A 1S6LA 4A0YA 4HBNA 3WW1A 3O2PE 3HSFA 4LTAA 2ESHA 4L0YB 1FPQA 2TDXA 4UVAA 2RKHA 3I59B 1PUEE 1RGSA 3KZYA 5ICGA 1HW5A 4GCVA 2XROA 3SFZA 3T8RA 2CFXA 3SCHA 4LMYA 1O57A 5AIPA 4G7HF 1D8KA 5H6RA 4LA2A 4HN1A 1B59A 2DQRA 4R79A 2QBYB 3D5LA 1L3LA 4IESA 1XDSA 4CGZA 1RNLA 3ZN0A 4KA4A 2DPUA 3DQVC 2IT0A 4XF3A 3DPTA 3COAC 5F6FA 1FSEA 4OIOF 1DZTA 1RUOA 2HR3A 3IWFA 1T0FA 5D4RA 3JTHA 2M1BA 5ERIA 2V79A 1KA8A 3BZ6A 1VP6A 1XE8A 3K1NA 1FYMA 1STZA 1U6GA 3BY6A 3V7RA 2MLKA 1O3SA 5I0SA 4BH9A 5I8YA 3R60A 2Q0OA 2FSWA 1U12A 3LAGA 5FLHA 2XAGA 4RGUA 1JXSA 1O7FA 3F8MA 3WW2A 1OYYA 3CDHA 1JHFA 2PA7A 3WTSC 1T2KA 1XGMA 2EA7A 1R1VA 3HTUA 1TNSA 2FMLA 4WWCA 2ETEA 3EETA 5C6CA 2UXXA 4IPAA 3OV8A 2PAMA 1R5HA 5DDGA 3RYRA 4KWJA 4XETA 4LGWA 4XFGA 2QM3A 4MGIE 5K5OA 2WFPA 4XFFA 1ZZBA 1IN4A 3QAHA 2MA3A 1B9MA 1DDNA 1KU7A 1IN6A 2XL9A 1ZRFA 4IRGA 1GQHA 2GA1A 4H0EA 2UYBA 2OQRA 4IEQA 2WV0A 2YU3A 3H1YA 4FT8A 1W7PA 2UY9A 3WU0A 4N9HA 1I5ZA 4KN7X 1G3WA 4U7DA 2UY8A 5HI0A 3IL2A 2PQQA 3E5UA 4KWLA 2BGCA 2OD5A 4I01A 2RN7A 2K0GA 3Q9SA 4G9YA 3WODF 1QZZA 5I8TA 2FF4A 4Q48A 1V3FA 1J59A 2IVMA 5CVVA 3ZP5A 2EK5A 2P5VA 2VPVA 5D6FA 2OAZA 5CVRA 5BV6A 3U2RA 3NL1A 3E6MA 4KIGA 3PLQA 1IXCA 1J0RA 1ZX5A 4JV4A 3P9CA 2KJBA 1O3TA 2ZBKA 2FA5A 3RPQA 3M3IA 1P2FA 3BJAA 5LEKA 1U5TB 3BU7A 4LJZF 3WU1B 2P5LC 1XD7A 4MEYF 5J6XA 1O3QA 1RL3A 3VODA 3ZN1A 2FQPA 4XBFA 2A07F 2NS0A 3ZMSA 2VOOA 5BY5A 2GXBA 4D7SA 5HS8A 1S7OA 2M30A 3NJZA 5JAXA 3MFKA 3SCGA 3GO5A 1EPZA 3VEPA 5HDGA 1D3YA 4UV9A 4AVBA 3OD0A 4PIZA 4WXHA 2DFIA 1U2WA 2JSCA 1MDMB 2KIUA 4MQVA 1YS6A 1UCXA 4R8HA 1SFEA 1ZG5A 1H0MA 2VC0A 5HDKA 5E17F 5HS7A 3N4MA 4HF2A 1MZBA 3IC7A 3O14A 3K2ZA 1NE6A 4XF0A 1BM9A 1QQIA 3QU6A 2VBWA 5FLXK 2FRHA 3TO9A 2N7GA 1EH8A 4E2QA 3L9FA 2L3DA 4QM9A 1IRFA 1YFUA 2NRAC 3WGHA 3LFKA 5LBQA 5LRRA 5FFZA 1K6OA 1EY2A 2PN6A 2CV6A 4IRIA 1FSHA 4G6DA 5LGTA 1IXSB 2E7WA 2IA0A 3KEQA 4LFUA 4LEJA 3U9GA 3NSTA 2HQNA 1NXMA 4ENMA 4LA3A 4AVPA 1I1GA 4FBFA 4CHUA 5LHHA 4UNOA 3OGJA 3E6BA 2F2EA 3HYIA 1CF7A 3FE5A 5HLGA 4CZZA 2HZTA 4BXUA 5L3DA 2UXNA 3M7GA 1MJBA 2L01A 1XSXA 3ECOA 2NYXA 3JW4A 2QJVA 1FYKA 1PDNC 4GULA 4RB1A 5F64A 4IEYA 5HS9A 2XASA 2HFHA 5ICFA 5E18F 3HRSA 3SQNA 3TNQA 3CJXA 3BROA 2Z9OA 4XSZF 2R7DA 4KMUX 1OR7A 4E70A 4J1XA 1S29A 3C1DA 3J80Z 5EEHA 3WTXC 2Z2SB 3CL1A 1TQPA 1P92A 2W57A 1Z6TA 1I1SA 1Z6RA 1FT9A 2HWVA 1TW2A 2JRTA 4MGYE 3HSRA 4A2UA 1YW9A 3KZZA 3EDPA 1MKMA 4ZH4F 5JCTA 4UV8A 3GUDA 1Q5OA 3EQEA 2D45A 1ZLJA 5FQ0B 3H92A 4KN4X 3RJPA 2B9UA 5CVUA 4A0XA 1J1LA 3L7WA 2IXKA 4TLFA 2CG4A 3GX4X 4EWAA 5L3GA 4LB5A 5JSPA 2Q2EA 5I8SA 4X6QB 1DPUA 2FOKA 1FI2A 2XRNA 3SHFA 2QWWA 4AWXB 4HDUA 1B9NA 2JT1A 1IPJA 2PHDA 3F3XA 1OPCA 1UFMA 3IDCB 3ZPLA 3BCWA 5JSOA 2F5CA 2ZFWA 3ZDSA 2X4HA 3HHHA 2MBFA 4R1HA 1U3EM 2V9VA 1CAVB 4OFGA 1MJ9A 2IW5A 1PP7U 4L0ZB 1XGNA 3GLXA 4U7BA 4GO1A 1QZYA 3ELKA 5D8KB 2FQ3A 2KJCA 3HHGA 4UBGA 2YX4A 3T8TA 4EMSA 2DK5A 2FNAA 5DUKA 3I53A 5L3FA 5FCCA 2K86A 4YFXF 3GWZA 1SMTA 2QCSB 4NHJA 2ZNZA 2IA2A 2QVSB 3DXJF 4EM1A 3F21A 1T6SA 2FE3A 3LAPA 4ZYHA 4RGSA 2P17A 1W4MA 4AIJA 2GQQA 1SQ4A 1CAWB 5FGMA 1F5TA 3K1PA 1TQIA 2H6CA 4CYDA 4EV0A 2J5PA 3U0ZA 1F1ZA 3K9TA 3PFIA 4PIYA 3UKTA 5FPXA 5KHIA 2GH2A 2XKPA 1BIAA 4RB2C 1FY7A 5FLIA 3OF1A 2EFNA 3TNPB 2GC2A 4WZCA 1XRUA 1YFYA 2IXCA 3WTWC 1IN8A 3ELNA 2QDRA 2YPRA 4YRDA 2O3FA 3GFIA 3JAMZ 3G73A 3M9AA 2HJIA 4ZU7A 3BJ6A 3H3ZA 4EM0B 2Z5UA 1UPIA 1Y0UA 3BP8A 3BPVA 1IN7A 1YS7A 5AONA 5D4SA 1LEAA 4M73A 3W6JB 4Y13A 3REOA 1H9GA 1QPMA 5J8CA 3M70A 3FXRA 2ESNA 1HW2A 1QGPA 1ZGJA 4D0PA 4IEVA 2XGXA 1ZARA 1NHAA 4HAMA 4UHTA 3V7SA 3RI4A 3BALA 4EVIA 3EYIA 3WGGA 3DFGA 5BPXA 4WCGA 3ABTA 4HBLA 4RS8A 2HGCA 4BAYA 2DCTA 3F8BA 4A5NA 5BS6A 1DZRA 3K0LA 5KK1A 3HOSA 1YFWA 2H6BA 4OOIA 1JHHA 3MDPA 4LLLA 3QOPA 1A04A 3F8FA 1R58A 3J81K 2EFPA 1AOYA 4EJUA 2PAEA 4UXNA 3D0SA 2P4WA 2ZO4A 3BWGA 1QY4A 1SD6A 5C8WA 2HQRA 2CO5A 5DCMA 1I27A 3H3UA 3IKTA 3RIRA 1R7JA 2XAHA 1ON2A 3ZQ7A 2XAJA 3ES4A 3LA2A 4XFBA 4Z07A 3RDIA 3GW2A 3VB2A 4JK1X 5CJ9A 4YIIA 4I3PA 2MC3A 4Q0PA 1J3QA 3EBRA 3KEOA 5FD5A 2PQ8A 4Q29A 4KIFA 2MNGA 1VJ2A 3DV8A 5IT9K 3FM5A 5TJJA 2P7VB 4HX8A 1Z91A 2L4AA 1BI1A 3NVCA 5E1RA 1EH7A 2BV6A 3B02A 2EB7A 4TV7A 1YHFA 4RD7A 1BOAA 4B8XA 2VQAA 4KU7A 2KXLA 3DKWA 5D5VB 5J3UA 4LLNA 1TBXA 2FNPA 4OLLA 3IBMA 2D5HA 3SHRA 2DTRA 1KU9A 4LB6B 3CO2A 3L2HA 2NNNA 2EA4A 5DCMB 1ZREA 1V70A 2DT5A 1EYBA 1IN5A 4MQ9F 3FM3A 2HDCA 3OOPA 1FX7A 1WGPA 2JPBA 3HRTA 2IXLA 1FBSA 1ZG1A 4HF1A 4IHTA 3ZMTA 2CAUA 3DL3A 2DBBA 5K1YA 5ILUA 2R3SA 2H09A 1XMKA 1ZRRA 5EZWA 3V4GA 3ML6A 2GAUA 4A12A 4AVCA 1J3RA 2M8EA 4IXAA 5D5XB 1T39A 1S7AA 1E2XA 2GA2A 4E2GA 2FBKA 4EJTA 1KU2A 5EEGA 2O61A 4Q4ZF 2COMA 3FHIB 3P9IA 3ROUA 1C0WA 3GBFA 4O9GA 2ELHA 5CVIA 2BYVE 3B73A 4HLXA 3T1BA 1FBUA 2E7XA 4ORFA 1LJ9A 1UCRA 1Y9QA 1FP2A 1NZCA 5EFUA 5ILVA 1EP0A 4QGLA 2G7HA 3ZMZA 5KHJA 1F4KA 1FLIA 4UVBA 4U0VA 1XDUA 1ZG3A 2IXIA 4PJYA 2LF8A 2UYAA 4ETSA 3WW4A 1RUNA 3S2WA 4EJVA 1KQ9A 2B8MA 5HLIA 2BNOA 6PAXA 2OZUA 3FXUA 5ICEA 4Y17A 1ON1A 1LNWA 3FWEA 4JTOA 2KKOA 1XCBA 4UBHA 2HKXA 4M9SA 2VN2A 4A0ZA 3DN7A 1BJAA 2ZNYA 3TO7A 1KQ0A 1ULYA 1ZLKA 1YUDA 1J5YA 4MHGA 1EV7A 4UUVA 3CUQC 3LOIA 1H9TA 1IF1A 4QM8A 5K5QA 4MV2A 1DGRA 1NE4A 3DEUA 3CUOA 2HS5A 1QXRA 1PMIA 1TQ5A 3GF2A 1ZGAA 1XSVA 1OMIA 1ZZ8A 3M8EA 4YFNF 4MNUA 4F8AA 3MEXA 3QP5A 3WE2A 2LDUA 5FO5A 4XFIA 4ZU5A 2GU9A 2B5HA 1HQCA 5BQTA 4M6YA 2Q0AA 4G8XA 3Q5FA 2Z33A 1F9NA 4QX5A 2QNKA 4HLTA 1CAXA 1W7PB 4A6DA 1IW7F 1R36A 3KETA 1Q43A 1WI9A 5HDNA 1SAXA 4HA8A 3KP5A 1P6RA 2IJLA 4CO8A 4JQFA 2A5YB 2V1UA 3I54A 3F23A 3R6SA 2BEOA 4JTNA 4QMAA 1O3RA 2HTSA 1KU3A 4ZU4A 1HKSA 3FMRA 3V8KA 4EQQA 2O0YA 3CTAA 1P4AA 2P6TA 1HSTA 3N97A 4Q0UA 3EUHA 4G7ZF 2EFWA 4ZZDA 4BYYA 2BNNA 4U0WA 5D6EA 2YSRA 2D1HA 3O3KA 3KP6A 4RB3C 2RGVA 4QGNA 3I0TA 4KUMA 4IJAA 1U8RA 3I4PA 1YTYA 1ZN2A 4WVZA 2DO7A 3UKVA 2F4PA 4F7ZA 1RC6A 2PFWA 4EGYA 5LGNA 4MUVA 1OD5A 2K4BA 3F22A 3FXQA 4OMYA 2XLFA 1USTA 2MH2A 1KGSA 4J1WA 2MH9A 3CO7C 4B29A 2XHKA 3KCCA 4EROA 4BHCA 2Q1ZB 5FD6A 1K78A 2VBYA 4IF4A 4BIFA 1MJAA 3IRQA 1ZRDA 4XF9A 1ZYRF 4ESBA 3S7IA 4MX3A 5LHGA 4WX9A 4FX4A 1WQ2A 4G7OF 5FPZA 3TOBA 4YIFA 2V1XA 1HSJA 4IERA 3OTFA 1T38A 1LEBA 2L02A 3FZ3A 1SD4A 5JI6A 3U10A 4FX0A 5K5RA 1VR3A 1OFNA 3TQNA 3H1MA 4GGGA 3CLOA 2RDPA 3KE2A 2O8XA 4L9VA 2OA2A 3LQQA 4QXKA 3KFWX 3GFJA 3K69A 4Z82A 2DU9A 3P9KA 3R4KA 4IRHA 4N0BA 4KICA 1KQ8A 2C0ZA 2QQAA 1W7PD 3I71A 2VE8A 2PAKA 1Y3TA 1YW8A 5DEQA 3V7CA 2GZWA 4P9FA 3KLOA 5A2QZ 3J80K 1ZRCA 2O1QA 4ZZLA 5I91A 4LK0F 1CF7B 1KYZA 1O5LA 2CW0F 4NB5A 1UHMA 3MCZA 1H1MA 5L3BA 4GXOA 2CAVA 4M9XA 5I0UA 3E97A 3PVBB 1UIKA 1IAWA 4K2EA 1BC7C 2OQGA 4HDVA 4O3MA 2EVXA 1J58A 5HOOA 1FOKA 4HMZA 5JR7B 2M45A 3R61A 3FFQA 2XV4S 3FX3A 3VOEA 3VFZA 1RTVA 1HKQA 3VHRA 1BN5A 3LQRA 4L9TA 1SEFA 2QYOA 4CICA 2P7CB 2ATFA 2RVCA 3RYKA 3RYPA 2Q4SA 4MGRA 4FAGA 3IDBB 5BPDA 1T98A 1BBYA 2E1CA 3NRVA 2PEXA 2A6EF 3EHKA 5D5UB 2RV8A 3KP7A 4HVOA 3S7EA 2OA4A 1ZZ7A 2A3SA 1FC3A 1ODDA 2HEOA 3ZMDA 4ZYDA 2CWEA 1UW8A 3F72A 2IC1A 2PFBA 2D1VA 1CGPA 2VT3A 4OMZA 3L2CA 3CLPA 1EH6A 4P9UA 2OZ6A 1YLLA 3FZVA 1S3JA 2W25A 3MQ0A 4I02A 3SMHA 4ZYEA 2M5WA 5KHGA 3TGNA 1J3PA 2DW4A 1ZZCA 2PMHA 4AVAA 1UB9A 1P4XA 1CX4A 1PP8F 4O9EA 3TKYA 4Q5SF 2H0VA 2K27A 4EM2A 3F6OA 2WTEA 2MLGA 4LLGF 4D7TA 3RPUA 4QGMA 1GXQA 2AXLA 3U11A 3KMHA 2XUBA 3E5QA 3IIAA 4YYOA 3QPHA 1RIOH 3MYXA 1DUXC 3TOAA 3LZZA 1R22A 1X8EA 4HN0A 2EV0A 2DAOA 3U1DA 2GIVA 3GXOA 2QQBA
chains in the Genus database with same CATH superfamily
1ZAOA 1M1EB 2PLYA 2WN2A 5FZOA 2WBMA 2VZUA 1BR4A 1O91A 4I2OA 5FZ4A 4RQPC 2R6QA 1FX5A 2BBAA 3TDUC 5DABA 1YW7A 1O7LA 3I3BA 3I2IA 2JDKA 5JR3A 1VIWB 3S14J 4YIRX 1YFHA 5E1ZB 4GH4B 1LOAA 4Z2WA 5JXIA 3JAMK 5TRDA 3I3EA 2IGNA 1JGGA 4RB0A 4L8QA 3HOTA 2O6GE 1SACA 1SBFA 4P00B 4XLPF 1G3SA 1G3YA 2EIGA 4BHBA 4CEYC 4XUQA 2BWAA 2NZ9A 3ZIXA 1Y39A 3J4UH 2CUFA 2X0LA 4AGGA 1XB4A 5J8FA 1QPIA 2XBO3 1CZVA 5JOXA 1OLRA 4Q27A 1UY2A 1H1AA 2YUSA 4L18B 5JLVA 3E5XA 3RKWA 2P3IA 1YWKA 4HNTA 1IGOA 2MPFA 3GTQJ 3OL4A 2BGOA 2VJJA 2R7FA 4R9AA 5DUVA 3WG4A 2VXZA 3RVHA 5DTDA 5DYMA 1GLHA 1C57A 3B7MA 4PZJA 5FZ7A 1NTCA 2VPLA 3AL6A 1GHCA 4UF0A 2ZJRF 3KGLA 2JA2A 2H0BA 5KHKA 3ORJA 3CUQB 1NK3P 3HUGA 5EWSA 1SMYF 1VBC1 4IETA 2VMFA 2G7UA 2D40A 4AGRA 3V56A 2QQ9A 4O6JA 5LBBA 2Y75A 4E2SA 1YQCA 2M9HA 4MO7A 2DLLA 3QOEA 4UI9L 2O14A 4I0AA 1XS9A 1H6XA 4LIUA 5FUPA 5A33A 3LSDA 5FZHA 3VZMA 4PDKA 5GAEJ 4A3GJ 2EV6A 2GNBA 2Q5TA 1YX5A 1FWZA 4J25A 2EFOA 4D6QA 2QQOA 2ZMEA 4BLIA 2BQPA 2DI3A 2LLKA 2WABA 3FLTA 1TWFJ 3ZQIA 4AEJA 4PGHA 3ACLA 4D0QA 2ZXJA 1FZPB 2QLZA 2LKPA 3KF3A 1OBNA 2E1OA 4AD9A 2WQZC 2HYFA 2G4IA 2E7QA 2HVQA 3NJXA 1WCSA 3DKYA 2OIIA 3RPUD 2PYTA 4Q4W3 4GQ7A 1QJX1 1W2TA 2DK8A 3MD2A 1E5IA 5GZGA 2ETHA 3R4SA 1AR73 2ISYA 3PNYA 3CLQA 2QQ8A 4J00A 3NW4A 2WC2A 1B1BA 2XWJB 4UFJA 3CO6C 1OSGA 2EA2A 1US3A 3H1WA 3HWJA 1J84A 2E32A 2GN3A 2XRLA 2W47A 5JWPA 2HH9A 4CCCA 1QJZA 3LEMA 4RAZA 3KV5A 4QQPA 3BG3A 5DAWA 3WP3A 4XMAA 1OLMA 4DINB 2VNOA 2WS91 1HV1A 3ST7A 4UW6A 4HV5A 4HONA 1EAH2 2VNVA 1WCKA 1UXXX 1QQP2 5F27A 5JSRA 2H94A 1HV0A 1IGNA 3FF5A 4XTMA 1HKTA 3OBZA 2QFEA 3MIDA 2HQ5A 2O8QA 3DBRB 2HWC2 2MEV2 3F8NA 4L97A 4HANA 2KFDA 2MD5A 3WDYA 1HDPA 4NHKA 3WCSA 1IQDC 5EG0A 1R64A 1W39A 4DPNA 1LR5A 1OD3A 1V6OA 1W8WA 4QPWA 3C7EA 3ZMVA 2VCBA 2W95A 4OWRB 2L5QA 1ZBA1 2Z3YA 3TBIA 1SVMA 2Z99A 2WWYA 3DP7A 5DCFA 1H6YA 5GAHJ 1N47A 3X2QH 2KIMA 1GZWA 1HC8A 2VONA 5F37A 2Y0IA 1RI7A 2LD5A 1A35A 2K9ZA 1OI6A 3E1F1 3Q9VA 1GU3A 4CU8A 1YLFA 2NVTJ 2CDOA 3UETA 2RNJA 4L9NA 4XICA 4CXXA 4LD5A 4XE9A 4OAYA 1D4M2 3J7AO 5L7OC 5LA9A 2BW3B 1OF3A 2WZPP 2DDBA 4UVCA 1YO5C 4XIOA 2GWRA 3ASNH 2W24A 1FATA 2DQLA 2WLPA 1PM7A 4DQAA 2IXJA 5AVAA 3ZYBA 4HSRA 1ERDA 3PNAA 4XONA 1USSA 1Y8QB 1Z9CA 4RGRA 2QUFA 3P5JA 4LJHA 3VKMA 3LE0A 4KYWA 5KVRA 1W6QA 4ZS2A 4IEOA 1FNNA 1F2NA 3S2DJ 1UZCA 1W05A 1Q8SA 4FFIA 4WXDA 5E20A 3LWCA 1OOPC 1OQYA 4A7KA 2D93A 3E0JB 4NQWA 1X1DA 2JPCA 2G0EA 5FLXZ 3RNSA 3FHNA 1AYN1 1BL0A 2LNBA 3TDZC 1H9PA 1LEDA 2JD4A 3I97A 3CKHA 1VBD2 1LHOA 1KJLA 3T1LA 3G3ZA 3L09A 3C2UA 4LBQA 3AB0A 2XVCA 3LSGA 4CU7A 4XRFA 5FKKA 2B39A 3A1YA 3OOUA 2XC7A 4XFAA 3GZ5A 2XAQA 1ETKA 2A6XA 5EJ3A 1V4RA 1HXDA 2A6YA 5CYVA 4WXCA 2OF7A 4XZPA 2ZGLA 1F31A 3WDTA 4FTEA 4RSUA 4R52A 4Z6YA 1BEV2 2EXHA 3LDRA 3MKWB 1R082 1VPHA 4JGYA 2LRPA 1FNYA 2JA7J 3SCFA 3ZGKA 3PQKA 3K77A 4JKLA 3W5NA 3VBOA 3OYFA 2DURA 1OKOA 2V7FA 1Z0XA 2MW8A 1FMWA 4SBVA 4XDPA 3J26N 2GLOA 3BPZA 1VBB2 1YXWA 3GZAA 2JA5J 4HQMA 4Y4YA 2BY0A 4Q1RA 2BPA2 3GZUC 2QVOA 1LB2A 3FMGA 2W94A 1WLTA 1V6IA 5IHRA 5FFOC 4WV8A 3WTUC 1DP7P 1JYWA 3WP6A 4GYIA 2ELKA 3IHUA 5T3NA 2A6HF 4XKCA 3NKGA 3T08A 3ABUA 4IX7A 3WNOA 1X1AA 2RAEA 2WV1A 1E17A 1LVAA 2QGUA 1DGRM 2HWB3 2ZKNA 5IAXA 5FYZA 1CAVA 2XVLA 3WQBA 5A32A 5APAA 2JX9A 4HYEA 5IT3A 1V6LA 5IK5A 2VT2A 5AIQA 4C90A 1LQ1A 3VBSB 5D8AC 1OHFA 1ODMA 3V65A 2MG4A 3W2AA 3I5UA 5CISA 3TRSB 1RVF2 1Q3EA 4UFHA 5DUWA 4BQ1A 4NJ4A 2MC4A 3KGZA 1HQNA 3UYJA 3BODA 1IPKA 3ZQLA 1CAWA 2I74A 4XLAA 3B5LB 3VZOA 3CEWA 1PIV3 2CYYA 4B48A 4GWMA 4ZYGA 1HBXG 5LD2C 2F5VA 1TNFA 2QQMA 3MIFA 1XB9A 2ZAHA 5FYUA 4AQTA 3B93A 2BWCA 4D6SA 5JI9A 1WCQA 1IUYA 4YVWA 4TWTA 1LE8A 4XJZA 4YM0A 2JJ7A 4LOCA 2X10A 1R1A1 4CDQA 3SXWA 2WO7A 2YXSA 1W1WE 3BDDA 4NN0A 3WOGA 3LSMA 3OYDA 3RTRA 4MXWA 5FZ3A 5IFPA 1JGSA 2R042 3HAGA 4HNVA 1SD5A 3SZPA 1PUFB 1JHNA 2KM2A 1JT6A 3WQ0A 2NXNB 4M74A 3POJA 4OHXA 5EJ1B 4MFDA 1VQMI 1MBGA 3IN9A 1YO8A 2Y34A 4F92B 4U87A 2J1SA 4DEVA 4A5MA 2ZKLA 1JYIA 4IEZA 4N53C 2HOSA 3JXSA 1T95A 1XN7A 1HB3A 3NQOA 1LHWA 5EIYB 4LBLA 2V6CA 2GC0A 3W59A 2W84A 2ZX3A 3BG7A 5FREA 2WWUA 3GM8A 1JXNA 1GOGA 2WNUA 4YW2A 1WLDA 3G7DA 3VBRB 1PNFA 1TWHJ 1XNKA 2RJLA 4MOAA 3O1MA 1YEWA 2IZWA 3KM5A 5ILSA 1WA4A 4U36A 1DIWA 2VMIA 5C4WB 4HW0A 2W82A 1ZZ9A 5JHUA 4PFPA 2GC3A 3UKNA 4W6XA 2ORZA 3HQXA 2LH9A 1B35A 4HQEA 4IL7A 1SD7A 5HCBA 4U0YA 1K7AA 4MGZE 1E3HA 2Y60A 5CKTA 1I50J 4XLNF 4RR3C 4LK1F 4BJ0A 5FTTC 3I59A 1N1VA 3VDBA 1ENHA 1VBA2 2HEYF 3D5SC 4DXTA 5M5WJ 2JDNA 2DA4A 4MGKE 1H9WA 1W5TA 2KHMA 3VV1A 3WUDA 2CQKA 3S32A 3VZNA 3K46A 3WHTA 3WTYC 4HF0A 3T2PA 3BGAA 4DJAA 3TEDA 2I45A 3CDIA 2OW4A 4YFKF 2PJPA 3HT1A 2VZVA 1VNDA 4KH9A 4E7LA 5FY1A 3KT7A 2EFQA 2F5DA 1XBFA 2P37A 3O2PE 1VZ0A 3VHOA 1V6MA 4I0WB 5CB7A 2HYJA 2R071 2RKHA 4PK4A 1PUEE 3ZQHA 4AEDA 1Z7S2 1HW5A 4GCVA 2XROA 3T8RA 4LMYA 1PGSA 2YFZA 4PI2A 4YELA 1D8KA 3FBMA 2DA1A 2EZLA 2DQRA 4F3QA 1BKZA 2PHRA 4UF0B 5J09A 4UYBA 2DPUA 3HNBM 1D7PM 3WXPA 2JICA 2B4KA 3OD4A 3HUGB 1B72A 4OIOF 3CESA 1RUOA 2GM4A 2HR3A 3IWFA 1WLWA 2ZGNA 5BNNC 5D4RA 3ABMH 5HXVA 1I3QJ 3PUBA 3RQ0A 4BMEA 1MEC2 2X6OA 3BZ6A 1UU6A 1VP6A 5FJ8J 3WHBA 3BY6A 5F0HA 1D0GA 3V7RA 4YW5A 3N7KA 1HN1A 1DLLA 1H4GA 1O3SA 5GTIC 4YGEA 2W7NA 2PHFA 2Q0OA 1U12A 4BY7J 3HKZA 1C8M1 1OYYA 3CDHA 1LNSA 2W68A 2PA7A 3MBWA 3RZGA 2D97A 1T2KA 2EA7A 1K5MA 1WCMJ 2ZZQA 5C6CA 1VAMA 4LHNA 3IT8A 4G12A 2X5IA 2HNHA 2RS33 1DFQA 2VZOA 5GZFA 3RYRA 1JYTA 1A6CA 4KWJA 4FPEA 2HWD2 1O8PA 3KIOA 1UAAA 2D6OX 1ZZBA 2KR2A 2MA3A 3S3OA 4GMP1 1KU7A 3VZLA 2A3XA 1H0BA 2XL9A 2K9LA 4IRGA 3IKWA 4LE3A 5FP7A 3MKZA 4LBOA 3O0VA 4B4CA 3DUIA 2YU3A 3WINE 2WZR1 3TL4X 1I5ZA 1QNYA 2E31A 4BBSJ 4FCAA 4KWLA 2BGCA 2RN7A 2P2KA 2K0GA 3ZKYA 3F95A 3WNNA 1VRBA 1C1LA 5A6ZA 4PF1A 1CR7A 4PDWC 1LESA 1VQ5I 1LOBA 2D7FA 2D44A 2EALA 1V9U2 3NAPC 2VPVA 1A6IA 3CU7A 2OAZA 2XDVA 5CVRA 2TEPA 1FOXA 1D2QA 1L7RA 3U2RA 1R6RA 4XIDA 3NL1A 1RIRA 2LALA 5FXZA 4KIGA 3ZFFC 4AQSA 3P9CA 3LPGA 2FCVA 1O3TA 3RPQA 3B9IA 1PZ9A 1IC8A 1US2A 1U5YA 1W0PA 1TT5B 4LLFA 5LEKA 2XPUA 3RMYA 3MKYB 2CTVA 1MNMC 2P5LC 4ZONA 4CDUA 1WH7A 1GZWB 4S2HA 1LFPA 2PMZA 1RL3A 2FQPA 5CFCC 4GJYA 2A07F 1AA7A 1COV2 2LOOA 2A3WA 1UYXA 2LR8A 4D7SA 5GJ6A 3VDDC 1IO2A 2V5DA 3VEPA 4UV9A 1G7YA 4QWNA 4BB3A 2L9LA 2ZA9A 4BQ4A 2JSCA 1AKHA 3ZSEA 1MVQA 4Q4X1 2KIUA 1YS6A 3PIPF 1VQ6I 1UCXA 4X1EA 2JG8A 3LOCA 4QHZA 2EIMH 1APNA 1PX4A 2EIJH 1Y8RB 3HJRA 5C4XJ 1T0FC 3MW4A 3K2ZA 1YIPA 1QQIA 2CW8A 3QU6A 4JKKA 1AL23 3HNMA 3OGVA 4DS0A 2JG9B 2VQUA 3DTEA 3OOXA 2DOFA 4V2FA 4DYCA 1APLC 1AR93 3WGHA 1UWWA 4LBKA 3VB9A 1W6QB 1E3PA 1EY2A 2PN6A 2L0KA 4JQTA 2L7FP 2NMNA 4G6DA 1BR1A 1AZDA 5LGTA 2WYFA 2E7WA 3KEQA 4LFUA 4II2A 4CCKA 4LHSA 3ONQA 1NXD1 3NSTA 4YZ5A 3W6VA 4ENMA 3FXMA 1ASJ3 1ZTRA 3K4DA 4YW3A 3E1SA 2JECA 1TME3 3WF2A 5HLGA 2ZEYA 4CEWA 5L3DA 4C2TA 3J7YJ 2RMU1 2WO3A 3NARA 4RB1A 5F64A 1D1BA 2ERFA 4GXLA 4LBQB 4AM3A 2HFHA 5ICFA 4IXLA 3HRSA 4E4ZA 2ZC2A 3BROA 1CZSA 5IYYA 3C1DA 4QXBA 3DYMA 3VYUB 1TQPA 1Z6TA 1PX3A 3FC0A 2R5YA 3OYKA 4BY1J 5GLUA 2FZ2A 4XOTA 2CV2A 1HN0A 3M2MA 1TW2A 2JRTA 4JGYB 4MGYE 2OQ6A 3HSRA 2HYXA 5FY8A 3L9JT 3VBOB 4ZH4F 2RR13 2YU1A 3RJ2X 5JCTA 1X4PA 4QX1A 1UKGA 4CU9A 1Q5OA 4PJ0C 1XNTA 1ODNA 4AVTA 3RJPA 4RHV3 1DP3A 2YPJA 4XR6A 1RUG3 4QPQA 2A6VA 2PLV3 2IXKA 2VI6A 5A7SA 2E19A 5LA0A 5AFBA 5L3GA 4YM3A 4LB5A 2QKMB 4XUPA 4TLGA 1DPUA 2FOKA 4AWXB 4HDUA 2TCTA 3B9CA 1B9NA 1IPJA 4Q8KA 2A5WA 1SLLA 3BCWA 3JBG1 5D2AA 2ZFWA 4P5YA 3FUQA 3HHHA 1U3EM 1N25A 2Y26A 3D3AA 1CAVB 3MW3A 1PP7U 5IW0A 4EYUA 5FMOS 4YZ1A 3ZXSA 4EN9B 3HHGA 4RAGA 2YX4A 4EMSA 5DUKA 3I53A 4EJRA 4YFXF 2G1MA 4AGVA 3OGSA 4Z2AA 2IVIB 2ZNZA 2NOJB 3OYLA 3WG7H 3F21A 1T6SA 2KMUA 1X1BA 4RGSA 1GOHA 2P17A 3DKQA 3DGTA 1LHNA 3KF5A 1ETOA 1CAWB 1R4MB 1RUC2 1F5TA 3K1PA 4B8EA 3OPZA 4XORA 4TTGA 4IE0A 2DWRA 1OQDA 2W3JA 2J5PA 3JRHA 2HWF1 1YNAA 1LU1A 3M4OJ 3PFIA 5FPXA 3OY8A 1JS9A 1JW6A 4QHBA 2WIIB 1HXS3 3PDQA 2IXCA 3PHMA 4C3HJ 3BTZA 5FRAA 4YVWB 3ZYRA 4DO0A 4CXYA 4GD4A 2YPRA 1RUD3 2R062 4CDQB 3JAMZ 2HJIA 3S1RJ 3DPRB 3H3ZA 4MXWB 2R7RA 2ZGMA 3PO3J 1D4VB 3O1UA 5FYYA 1IN7A 1HRI2 3WVJA 1WPKA 4FO9A 5AONA 1LEAA 1DQ0A 5FWJA 3CCVI 4BDZA 4XKWA 1JN2P 5J8CA 1UMZA 3M70A 3EXUA 1PK6A 3PL8A 1D1AA 1D0ZA 3BQYA 4IEVA 2XGXA 1OKQA 1ZARA 1NHAA 3TN93 3S3MA 3BALA 1HOMA 1F5JA 2FMDA 3ABTA 4OHWA 1RKWA 4RS8A 2DCTA 2W5FA 4A5NA 1DZRA 5LA1A 3HOSA 1YFWA 2G9ZA 1A78A 4AYUA 2WDBA 3ABLH 2WNUB 1SFKA 4LLLA 4DIQA 4UOJA 3ZFEA 2JXAA 3QOPA 1R58A 1AOYA 2EFPA 2PAEA 4UXNA 3LCPA 3E7LA 1W2OA 3OEAA 3CJQB 4M3BA 3AFGA 3IKTA 3RIRA 1R7JA 2XAHA 4BE3A 1WJCA 2D6PA 3GTGJ 1QA6A 3RDIA 2ZMLA 1B35B 4JK1X 4EN6B 3N3HA 1YQ8A 1JKOC 5C7GA 3O1VA 3PO2J 5IP9J 3JCIA 3RCOA 1SLCA 2MNGA 2A6TA 3M8LA 3DV8A 2VMEA 4MGSA 3R05A 5FJKA 2B9VA 1EH7A 2A75A 1V6JA 5C70A 1ND3B 1X19A 4GZ9A 1SLAA 1AXYA 4KU7A 4XACA 2KXLA 1YE9A 1UOJA 2WNVA 2XAUA 1VQ8I 3DKWA 2JD9A 1MMGA 2FNPA 3OG2A 3T0BA 3HGYA 3CO2A 5JLWA 2EA4A 2CJJA 4M0NA 1JMUB 1V70A 2CMPA 1IN5A 2R7TA 4Y20A 4MQ9F 3VBHA 2DCEA 5J96B 2NP0A 1WGPA 5F8PA 2R32A 2LY1A 1DQUA 1ZG1A 5A3MA 3PTRB 2HI3A 1HIXA 5CZKA 2Z42A 2VOXA 2R3SA 1ZRRA 2UWBA 4IV1A 3V4GA 5DG2A 4AEDB 3ML6A 3HZJA 3UV9A 2TRTA 4F3JA 5D5XB 1X33A 4BJTA 4QHOA 2GA2A 2FBKA 4EJTA 3J8F2 2M4GA 4Q4ZF 2COMA 4GH4C 5E3MA 1C0WA 1PZ7A 3F2ZA 1IRXA 4O9GA 3FDYA 5FZKA 3T4VA 5CVIA 2BYVE 3AMMA 1FBUA 1LJ9A 2VJXA 3GTOJ 1UCRA 4KBZA 1DGRN 2I5UA 1IV8A 5ILVA 3VN4A 5EYYA 4QGLA 3ZMZA 1OQ1A 1ZELA 1VBC3 2ZX4A 1H4HA 4S2GA 1EAH1 3S2WA 4XN3A 1CQTA 2Y6HA 1QQP1 3WQ1A 5HLIA 2LC2A 3SH5A 1OPOA 4ANJA 1LOGA 3AM2A 4NRMA 4YG6A 5ICEA 2ZJQF 2LK2A 5HLTA 2A5ZA 4LR4A 2HWC1 1XCBA 2MEV1 2HKXA 1UAIA 3DN7A 2DF7A 1DG6A 2DVDA 3K70C 4NIIA 5A6YA 5J40A 4DXRA 3CUQC 2WUHA 1K5MB 1IF1A 1OLQA 2XF7A 1WD4A 2X5IB 1W8OA 5FRNA 4JRLA 5HV0A 3OBAA 2A71A 2ICWG 1OMIA 1SLBA 1K45A 3ZR8X 2Y38A 3M8EA 2P3JA 4MNUA 4KMQA 3MEXA 4XOGA 2P81A 2LW8A 1QJX3 4A6SA 1X3WB 3QPLA 5BQTA 3ZIWA 1D4M1 1CD3G 4HLTA 5CKQA 1OPMA 4Y5SA 1RUI2 3A02A 1WI3A 1R36A 3KETA 1POV1 4HA8A 3KP5A 1XMXA 1WW4A 4CO8A 1TL8A 2YB7A 2A5YB 3J7AY 1C5HA 1QOSA 4QMAA 1O3RA 1OJLA 3V8KA 2WS93 2O0YA 1P4AA 2KRHA 1RB8G 2RJKA 3DEWA 4HPKA 2WFF2 4CP9A 4Q0UA 3CJIA 3S16J 4YGBA 2JKBA 1WA6X 4U0WA 1W8HA 3HXLA 2DMUA 1FMD3 1LGCA 2Y6GA 2WWJA 4OZXA 4NPLA 4QGNA 1RITA 4QPOA 5IYCJ 1E57A 4CDUB 5FP3A 3WD5A 3J9SA 1F9KA 1ZN2A 2DO7A 4M00A 4AFDA 3UKVA 2BXZA 3IV5A 1ZBE2 4F7ZA 1ZBA3 3GTMJ 2ELJA 2D3RA 4IQ4A 4MUVA 2K4BA 1MS9A 2DT6A 4XURA 1USTA 4J1WA 2MH9A 3CO7C 4B29A 4ISRA 4BHCA 2VBYA 4YZ4A 1AKHB 4BIFA 1ZRDA 4L9BA 2E5NA 1AYM2 1ZYRF 3N7JA 4MX3A 2AUYA 3POEA 1WQ2A 3TOBA 2JG8B 3RWKX 1BEV1 2V1XA 1EV12 5F2WA 2E1MB 4BOWA 1OA4A 1LEBA 4HRIA 3DXUA 1O8SA 3I2KA 3T2OA 4FPJA 2JIJA 3POYA 1GBGA 4B4QA 3C7FA 5LY1A 1VBB1 4QXKA 1UX7A 4Z82A 3T0DA 2JEMA 2DU9A 1XG1A 2XGEA 3P9KA 1MS0A 3O8HA 4IRHA 1UY0A 4H7MA 3KVAA 5A7WA 5GZDA 5T52A 4Y33A 1N3QA 2D6LX 3U14A 5F0CA 2VE8A 4JX0A 3ZRGA 3V7CA 3WV6A 4TZDA 1NK2P 3KLOA 2YC0A 4ZZLA 1ZA4A 4ZS3A 2GIZA 2C9KA 5L3BA 4GXOA 1JU4A 2CAVA 3PVBB 1UIKA 1IAWA 1U9NA 3I2HA 3FHQA 5EPAA 2EPFA 4K2EA 1AYN3 1WMDA 4HDVA 1MZ6A 2EVXA 5C5TA 1J58A 2M45A 4YFWA 1WHUA 1PZ8A 5FZ9A 4LHKA 4ARXA 4L9TA 1KONA 2R5YB 1LFBA 2XJSA 5FV3A 3TWIA 3ZFGA 1OCTC 1RVF1 4M3CB 2M3AA 4MGRA 3VLBB 2E1CA 2A6EF 5EYXA 1URXA 3S7EA 2A3SA 3ENRA 2XJPA 2P3YA 3ZMDA 2W1SA 2CWEA 5CPRB 2OVUA 2IC1A 2J1UA 4OMZA 3L2CA 4I3GA 3CLPA 3MLLA 1EH6A 4P9UA 2VUJA 3PUHA 1YLLA 3VHNA 4ZJZA 3LF7A 3SMHA 4ZYEA 1UY4A 2IFRA 3TGNA 1F35A 5FMCA 2DW4A 1ZZCA 5EQUA 1UB9A 4RDUA 1CX4A 3G2BA 3EUHC 3OUIA 1MS8A 2AXLA 4P9JA 3AYAA 4IHYA 3U11A 4GMP0 2R041 3GALA 2RS53 3RZHA 4FTSA 5FP8A 3QPHA 5FKMA 4Q4V1 4W1UA 2VTXJ 3WZ1A 4CUBA 1UXZA 3AYEA 5C3OA 2GMPA 3SDGA 1J1TA 4HN0A 2QA4I 4DZGA 3P5BA 2QQBA 3IWZA 1KYWA 4IEWA 4IW3A 2VO5A 1JUHA 3GZ6A 5AFEA 2L54A 3N7MA 2XL7A 2LY9A 3OEBA 2IFWA 4XKBA 5DZFA 3KT4A 1IQAA 1BI3A 2VQCA 3UK9A 4URAA 4R9DA 4IQPA 1VQOI 4XHXA 3I55I 4COYA 5H6QA 4LO4B 2H27A 2OUHA 5F5QA 5I0DA 1RUH1 2ZGOA 1XCVA 5FYHA 2W0XA 2VMHA 4LHLA 3KQ4B 1KXGA 3OY8B 3QH7A 2Q30A 1AVBA 2P5BA 1WMEA 3HPGA 1LTEA 2IXSA 5M5XJ 1VAVA 2W00A 1XMAA 4YSFA 4DBQA 3NEUA 3MW2A 5LCWL 2IWGB 3VBSC 3HJEA 4XF1A 1S0BA 2CW7A 3U1KA 1VBA1 1S0FA 2DMNA 4PCQA 3R0AA 4LOSA 1HF0A 1R1A3 4P55A 4JGZA 2ORXA 3N9MA 5HCFA 2QBYA 2D5FA 1PK6B 3IAPA 1MW7A 3RFRA 1W90A 4G6TB 4LG0A 4GWIA 1ZQ3P 2Q8CA 3SDBA 1MMAA 5TISC 4A3DJ 3R0JA 3BOWA 2K7LA 5K7PA 1FYLA 2RDNA 3D5OA 4GJZA 3MAJA 2EIKH 3BU0A 3I3DA 4X6RB 3Q8BA 3KWVA 3GGLA 2V1DA 5M3MJ 3K51A 1LUJB 3ZFEB 3RZLA 2EZKA 2FZ1A 4IEXA 2JWTA 1DYKA 1S55A 3WHCA 4M0HA 2OZJA 4EWDA 1TW3A 5F32A 3KV6A 1A3KA 3KV9A 5FZGA 1RUE2 4NOTA 2FHRA 1GVDA 1OYWA 1RMU2 2D43A 3NJYA 3DWLE 3S6PA 1IZ1A 1BIBA 2XG3A 5F5AA 4B4PA 2TNFA 5L3CA 4EATA 4Z2YA 5FZBA 4G94A 4FQ4A 5BNQA 3LWFA 1MEC1 4FFGA 4ZY9A 5KHHA 4XM3A 1XTAA 2WNVB 1REDA 4QB1A 1UY1A 1WZ2A 2W08A 3VBRC 4NE9A 2PG4A 4BE2A 4IGPA 5DMYA 4O5VA 1ZHFA 1IPSA 4KMFA 3HBLA 5IK8A 5C4WC 3QWLA 1T56A 5ERLA 2VBZA 4OU0A 3VBHB 4MEXF 3IRRA 3TO6A 2QSGX 3SEQA 3BCAA 3NMBA 4EZHA 4RLFA 1YJ9I 1MMNA 2LP0A 2FU4A 2D6KA 5GALA 1MNEA 3UJOA 5D5WB 4IV1B 5F2SA 3BIWE 1RYYA 1FOWA 2HWD1 3L2VA 2B7YA 2RNGA 1LOFC 1DYOA 1H2LA 3AK0A 3HOWJ 5D1IA 1MPXA 2BOLA 2M34A 3WG9A 2OCCH 5FZ6A 2R073 4LE4A 2WAQN 1H88C 2QDNA 3LAJA 3ZYPA 5ACA3 1BW5A 2E6VA 5CLSA 4RAYA 1XE7A 2VM9A 2FXAA 3MZYA 1R1UA 2ZGPA 2GC1A 3CNAA 1HA8A 1FAYA 2QQJA 1A8MA 1SCSA 4P14A 4JC1A 4JYKA 2LKSA 3AZWA 4AR2A 2IGOA 1GOFA 2JDMA 2RQQA 5I0TA 2A6ZA 3BTCA 2V4JC 1MS5A 3ILRA 3CF5F 3WDXA 4HV6A 4AQ2A 1V9U1 3BOPA 2BZDA 3E3VA 3SKJE 2KLOA 2ACJA 1AUYA 4FOQA 4HX4A 3ZPOA 3AZVA 3H7JA 5LY2A 1GLNA 2M0MA 1GV5A 2PTMA 2P34A 3GF6A 3S3NA 3BTAA 1P7JA 1X50A 4L9JA 5C9AA 1ENQA 1DQ5A 1R1TA 1PVXA 1XX5A 1YIOA 2JDYA 3DBLB 4L5EA 1MBJA 2ZJPF 5I93A 4ENNA 1C8M3 3DECA 3SZGA 1OC1A 5BUVA 5FPUA 3HEIA 4XJ9A 3BPXA 4K8RB 2LUWA 3VZJA 1X3UA 4NIHA 2EXIA 3VWBA 1COV1 1S8NA 4A3JJ 1Y1WJ 2EAAA 3F8CA 2JDPA 4A3BJ 1V5EA 2EWNA 3A01B 5DUXA 5FZ8A 1TNTA 2HTJA 5EJCA 5LASA 4LQRA 2IAIA 4IZZA 1KJRA 2OBPA 4GMP3 1WGXA 1WJBA 2YS9A 3FJSA 3JSPA 2GN7A 3AXDA 5JXGA 1JUIA 4DOUA 3CJRB 1RC9A 4NIDA 3JZVA 1LRHA 3JD73 1N1YA 4HVRA 3M1EA 5FZEA 2ZTNA 4WM8B 2WZR3 3HVDA 1FBQA 3WEZA 5E1XA 2Y8KA 4KL1A 2DXIA 1REPC 3OYNA 3OYIA 4HPKB 5FDBA 1DGWA 4PIXA 3L2QA 3CJIB 2GH8A 4ESJA 1AR62 5FKOA 4AU7A 3M07A 3FMSA 4KBBA 4RL7A 5C3QA 4WM7B 3S17J 2E7TA 3PFYA 2YROA 3RQIA 4AXOA 3J7NA 2BW8A 4MYEA 5DAQA 1W9FA 3H5NA 3W21A 1N3OA 4QD2A 4MH0E 1XGOA 3QP6A 2Z79A 3MKLA 3B00A 2C6YA 2FBHA 1WWXA 1YIJI 5FQ0A 2LROA 5J37A 3QCWA 5AC92 5E8GA 2JB8A 1REEA 3KYLA 2AS5F 4CZCA 1UHWA 2AGSA 1MZEA 2UURA 4QDSA 1GR3A 4YARA 3NV4A 4BDVB 3OIQA 2CUZA 1GKBA 4MHRA 1W9YA 3W9AA 4C1WA 3AG2H 2FDFA 5J47A 3N7LA 3BG5A 4FP3A 4ENJA 4UXAA 4P96A 3QD6A 3LL7A 3LEIA 1QJY2 1WSUA 3WLUA 1QO0D 2X48A 4Q4X3 1FXZA 3OR1C 4DRVA 1ITYA 2OKXA 4ASNA 3JSOA 4FFFA 2P6SA 4W8JA 1K4TA 3DYOA 3ZPYA 5A2QK 3HOZJ 1QWRA 2Z69A 1YYNA 4M4PA 3ZQFA 3H8XA 2WR9A 4KGGA 2WO1A 4CH7A 2AYHA 5JVVA 2EXKA 1O4TA 4QLCU 2YMZA 1X9TA 1POGA 5DV5A 5ICCA 1U5ZA 1VQLI 1GANA 2HDWA 5E6HA 4BHPA 5FOJB 3PU8A 3OYCA 3L00A 3H7YA 1X82A 1L0OC 2Z16A 4WBBA 5L3EA 1SFYA 2VQGA 1QU0A 1TTYA 2DFFA 4XF4A 2IPQX 2VAUA 4AYBA 2VNRA 4BNCA 2XIGA 2XSDC 3CC4I 4JX6A 5FYTA 2JKXA 5H9SA 5A3WA 2FUG2 2JG9C 4L11A 2EQRA 1BI2A 4BQ5A 2RMU3 3F6VA 1I3HA 4BEHA 3CCSI 4IE7A 1ETQA 4JCKA 4AHYA 3H50A 1TQMA 1RINA 1F8VA 3AYCA 2G9WA 1V5FA 4D8MA 3A03A 3KP3A 1ZNPA 1XE0A 1RUC1 4GYGA 3I2FA 2M87A 2HWE2 2DFBA 2L4MA 3AL0B 3AMQA 3NKTA 2JDHA 5J48A 3KSCA 1JZ4A 1WD3A 2V72A 4KNYA 4BQAA 2C24A 1OKRA 3ZXLA 2P8TA 2D5VA 3BVCA 2CH0A 3GFMA 3CF6E 3QH6A 1QJU2 3LSTA 4IV3C 4BE0A 4PSWA 1XYNA 2Y0OA 3O1TA 3H8OA 2R061 2VCCA 3SZTA 2LY2A 4K8FA 5J98B 2L2OA 3QRFF 1AXKA 1UY3A 2CGPA 3M3QA 1G9BA 2BVLA 2EZHA 4MTDA 1Y9GA 2BNMA 4JGYC 3VDCA 4AIKA 5IUQA 5JOYA 2VKDA 5H20A 4YNIA 3NWTA 1FTZA 3O12A 2V09A 3ZO0B 3G6JB 4UUTA 3O1PA 3HL2A 3V8JA 5IVVA 2FBIA 5IT6A 2DA3A 3KYCB 5DD8A 5IK4A 1MMSA 2V9KA 4IO9F 2F5EA 3T3YA 5BNOA 3C18A 1JYVA 5FMDA 3IM0A 5HCHA 4QX2A 4MTEA 5DUIA 3DF8A 2O8OA 3S5QA 1YJLA 4BS9A 5FKLA 2R0QC 3V8LA 4FPHA 1QH7A 3CZJA 4P9GA 2VBXA 4MZUA 4BQYA 3T30A 1IRGA 2NMOA 3ISPA 3MICA 5J7MA 2XUEA 5IYDJ 2HWF3 1GP4A 5FB2A 4Y52J 3USSA 3WTTC 1V54H 5D8LB 5B1BH 1PGL2 3K3NA 2DFEA 2ESHA 1JJ6C 4L0YB 1UZWA 2TDXA 1S0GA 1SHWB 4UVAA 4PHZA 1RGSA 3K48A 1R49A 2YUEA 3SCHA 3U07A 1OOPA 4Q26A 2A70A 1KFXL 4JGZB 1DGWX 4GRIA 2QBYB 2VMGA 3D5LA 4IESA 2F4MB 4QXHA 1TG7A 3LSPA 2W92A 2IT0A 4XF3A 3POGA 3DPTA 3COAC 5T55A 5F6FA 2MABA 5KXCA 1C3HA 1P9QC 3AZYA 4KQ7A 2GNDA 3OSGA 5ERIA 1YITI 1VQKI 4DYQA 1KA8A 1W0NA 5IWFA 1JHJA 5FPLA 4CDQC 3K1NA 1IDYA 1U6GA 2L9NA 3DPRC 2ZXHA 3AX4A 4OHVA 1NOVA 5IFTA 3GZTB 5I8YA 3R60A 5BNPB 2CUEA 3BR5A 3HOYJ 2JE9A 1U8BA 3J8F1 1LGNA 1MBHA 4B43A 4FOYA 2ZZJA 3F8MA 2KRCA 2EH3A 3WTSC 4AVSA 4UT5A 2DTZA 1FMVA 1XGMA 3HTUA 2TUNA 2FMLA 4Y1UA 1SFOJ 1AXZA 2UXXA 5FO7B 3BR0A 3MFCA 1JI8A 3CZUA 3BKZA 4ASKA 4LGWA 4BU2A 2C26A 1Q56A 2QM3A 4MGIE 2WNUC 2WFPA 5T5PA 1QH6A 3JRBA 1DDNA 3W58A 2HEVF 3PNTA 1AR81 4BWOA 2HOAA 2RDSA 4AUXA 1IN6A 1BLZA 1OCRH 1NQDA 4H0EA 3ASIA 4OUEA 2X6XA 1B35C 4BJ5C 4HT1T 3DLAA 4FT8A 2UY9A 5G05L 1REFA 4DOZA 4JHTA 2VGDA 4B1MA 1G3WA 2XPJA 2UY8A 5HI0A 3IL2A 2VE1A 2NVQJ 1AL0G 4I01A 2Y9YA 2NS7A 3Q9SA 1UOFA 3WODF 5I8TA 2Y6KA 1SPPA 2FF4A 5BNGA 3IH2A 4Q48A 1V3FA 2DCJA 5F04A 1ND3C 3IIIA 4FPCA 5FLMJ 2FCTA 3PLQA 1VALA 1IXCA 1RJ7A 1ZX5A 4JV4A 4A3CJ 1OISA 1PM4A 2BBVA 2VJIA 2FA5A 1LENA 5IVEA 3EMRA 1S72I 1K6YA 4NRQA 3BU7A 4LJZF 4CP0A 1Z7LA 3WU1B 1RUI1 4MEYF 5J6XA 1STMA 3OYAA 1EA3A 2H1KA 3ZN1A 5IPAA 3W3CA 2GXBA 1S4CA 2KISA 1NA1A 3VBFA 4YLZA 1S7OA 2M30A 3NJZA 3SCGA 1SG3A 3IDEA 4AEDC 1D3YA 1OVPA 3OBRA 2ZGQA 1P8JA 1GNYA 4WXHA 1EAH3 3AP6A 1YQ5A 2VL8A 1QQP3 2WFF1 4LO6B 5K0UC 1FIAA 2VC9A 3AVRA 3LIGA 4R8HA 1ZG5A 2Y69H 1H0MA 2HWC3 1NG7A 2MEV3 4QIWN 2E63A 2J42A 4FVVA 4HF2A 1RUF1 4BQNA 2V4VA 4XF0A 1Z3YA 3POSA 1BM9A 3JRGA 4DFSA 3CHXA 1H8TA 1JYXA 1EH8A 3OSFA 1ETYA 5GZEA 3QBQA 1ZBE1 3POIA 2ID3A 3L9FA 1MR5A 4QM9A 1IRFA 2NRAC 5FKNA 2RM22 4DY5A 1FSHA 1S2KA 1IXSB 3HN1A 1WCUA 1NXMA 2DU0A 2BU9A 4P02B 4CHUA 2RE9A 2G9GA 5LHHA 1EV11 3FE5A 2M7AA 2VUCA 4FASD 4BXUA 1K5MC 2UXNA 4MADA 1D4M3 1K12A 4A4AA 2QJVA 4GULA 3KEYA 2FDJA 3RSJA 2WLQA 2XASA 1MVEA 3TNQA 3CJXA 2F48A 2Z9OA 2W48A 1GWKA 1POV3 4LBJA 3M8JA 1OR7A 5FROA 4J1XA 1S29A 3PJRA 3WTXC 5LA2A 3CL1A 4B3NA 3ZSMA 2WBKA 3FIWA 3CCJI 4FTHA 1LHVA 3GCMA 1TE1B 1FT9A 2HWVA 4NC8A 5KCMA 1EJ9A 2C5DA 1UN1A 2JK3A 3KZZA 4GAZA 1JODA 3EDPA 4JZRA 3IPVA 4CYCA 1I3AA 2PN5A 3EQEA 3S1QJ 2AO9A 1ZLJA 5FQ0B 2VB6A 5CVUA 4Q8LA 1DCSA 1J1LA 2M7BA 2CG4A 2VZ3A 5J1UA 1VBD3 4X6QB 2ES3A 1LODA 4FQGA 2XRNA 4XLCA 4LO8A 3IDCB 3ZPLA 4OMCA 1NY72 3JBG2 1NCQA 3ZDSA 4NMIA 1A6QA 2X4HA 2MBFA 4R1HA 2YV8A 4V2VA 3K4NA 4OFGA 1MJ9A 5LBCA 2IW5A 4L0ZB 3JRIA 3ZYHA 3N9QA 3TEXA 4U7BA 3HBKA 4CDUC 1BEV3 4S2FA 2LBFB 5BNNA 1R083 4AF9A 2NS8A 4UBGA 2DK5A 2FNAA 5M3FJ 1F4AA 5FCCA 4D3WA 2E26A 1IS4A 4NHJA 5E3NA 2IA2A 4UFKA 1N1SA 1VBB3 4ZYHA 4NAMA 2ZGTA 3WR0A 3PUFA 4RM3A 4AIJA 2GQQA 2E33A 1SANA 2E51A 1SQ4A 4QX0A 2X1CA 2H6CA 4CYDA 2JG8C 4YW4A 3U0ZA 2OX0A 2E1MC 4KITB 3K9TA 1RETA 4PIYA 4E7KA 1SFPA 4OCTA 4HG2A 3BI3A 4RB2C 4XABA 3VYTB 4YWAA 3TNPB 4DUXA 3WTWC 3M7AA 1W0OA 4BXXJ 3BZKA 3GMEA 5LK5A 1JZ8A 1GSLA 5J3LA 5CEHA 4BEHB 3I4MJ 3GFIA 5LBFA 4XMYA 5CG8A 1GNZA 3LSEA 1UPIA 3BP8A 5IVYA 3RRDA 1UZYA 1YS7A 4C2UA 5D4SA 1X1PA 4ATFA 3W6JB 1H9GA 1QPMA 1RESA 2V26A 5IVCA 4K7JA 1RVF3 1DU0A 3WCRA 5KAIC 1SVLA 2ESNA 2BFUS 5C3PA 2R7OA 4BJ6C 4UHTA 2VCMA 1N78A 4EVIA 3EYIA 3DFGA 2R92J 4WCGA 1AR71 1W6MA 4PDWA 2HGCA 5BS6A 1UJ8A 5KK1A 4CCJA 4NC7A 2KPMA 3MDPA 5F3EA 4FI9A 4BQOA 3F8FA 3ZFFA 4OYUA 3J81K 3ZR6A 4EJUA 3D0SA 2P4WA 2ZO4A 5B5EC 1QF3A 5C8WA 2GOMA 2CO5A 5FBJA 3G1LA 5DCMA 1XPWA 2QF7A 1ETVA 3ES4A 1O4ZA 4X0GA 3LA2A 4XFBA 1WJ5A 2R043 3VB2A 4ES8A 4YIIA 5CKMA 3OSDA 3THTA 1J3QA 3VD5A 4HXCA 2ZAAA 3EBRA 1U0JA 3K4MA 5CFCA 5FD5A 3AXEA 1MS4A 4KIFA 1VJ2A 5BNOB 3VDDA 3FM5A 5TJJA 4HX8A 1Z91A 2L4AA 4B47A 1JI6A 5CQEA 1W0UA 2K9SA 3H0DA 1HLCA 3HEFA 4NHYA 3CC7I 4A6OA 1KU9A 4LB6B 3L2HA 2NNNA 5FZ0A 4Y1YA 1ZREA 2ZB9A 1RUE1 1SC7A 5GP9A 3FM3A 3OOPA 3KQRA 2QEXI 1ULGA 3U4XA 2VXJA 1RMU1 1RHI2 4IGOA 2C6SA 4CU6A 1U0AA 5EP9A 1JYCA 3DL3A 2HPIA 5JMOA 2Q8EA 3IH3A 1LJ7A 2H09A 4D7NA 3OGGA 4IGQA 5J1XA 3PIGA 4A12A 3PVOA 3OY9A 4AHWA 4E2GA 4AIDA 2WT0A 5DXDA 4A42A 3J7HA 3S93A 3FHIB 1VBA3 4QKDA 4E7JA 4IE4A 1UMQA 4NC6A 1QXPA 3ATGA 4W6WA 3OYBA 3T1BA 4PLNA 2E7XA 4ORFA 4GA9A 2X85A 2ID6A 3H9QA 3CMAI 3NNMA 5L9VA 1Y9QA 1FP2A 5EHDA 3T0AA 2K3FA 3O0WA 1EP0A 1ETWA 4JX4A 3H5RA 3K4LA 4JQRA 2XOMA 1XYOA 1XDUA 4Y22A 2MGQA 3ZN6B 3BIEA 3VYRB 1CWPA 3JRFA 1KQ9A 1HLVA 2B8MA 4J01A 1QVUA 2QTWB 3NNGA 1PYVA 1LNWA 3TEYA 4NHXA 5GADJ 2KKOA 5FRMA 3MGUA 4M9SA 2ZNYA 5LFAA 3LEGA 1PK6C 4LOTA 1Z7S3 3TO7A 2ZX0A 1KQ0A 1ULYA 2R7QA 1ZLKA 1YUDA 1J5YA 2NLRA 4UW5A 4MHGA 3VKOA 3JRDA 2AZ5A 4UUVA 3OL3A 4Y1VA 1H9TA 5K5QA 4MV2A 3VKNA 5C8CA 2WNEA 4MXVA 2JA8J 5F5IA 1XSVA 4INDA 4Y1XA 1NLQA 2K9MA 4P9LA 4Z1VA 3QPSA 3ZFEC 3I8TA 3HGGA 1MBEA 5SV5A 4YFNF 2G9FA 2XPVA 3QP5A 3I49A 2SLIA 1MEC3 4AG4A 1Q8QA 4GWNA 1OVSA 2RV9A 2XJRA 1A34A 4ZU5A 2WQ8A 5J1YA 1EUTA 3WDVA 1X4OA 3ESWB 2QNKA 1CAXA 5KR7A 4A6DA 1K83J 4HSTA 1DQ6A 1U5IA 1OCPA 5B1AH 1Q43A 3KZIC 4YVSB 3WNPA 2V1UA 1GZCA 1SPPB 4EEFG 3I54A 3F23A 1G8XA 3MO4A 2VLAA 1KU3A 2ARBA 3GTJJ 5FZAA 4E8DA 4CDWB 1HKSA 4Q2FA 3ZQGA 4X8PA 4MSVA 3WF1A 5KXEA 3CTAA 2WNVC 1E5RA 2P6TA 1O59A 2X1EA 5JZGA 2PXJA 4ZDOA 1R092 3JCUC 3USUA 2HXIA 4CE8A 4PJJA 2HWD3 1IG7A 3HQRA 2YSRA 2D1HA 1XXNA 2RGVA 4ZYAA 5FUNA 1H2KA 1BJZA 1U8RA 1YTYA 3RZDJ 2CU7A 2XUMA 3BPSA 5HODA 4EGYA 1VRH2 1Z21A 3VBUB 3VBFB 1NA1B 1OD5A 2PELA 3HC7A 3FXQA 2DVGA 2XLFA 3ZOIA 4IV1C 1KGSA 3JQWA 4P5HA 2CQQA 4YM1A 1GWLA 3I4IA 1W6OA 2XHKA 2DBIA 4EROA 2W4SA 2Q1ZB 1JT0A 4MO3M 1MJAA 4QQHA 5LHGA 4G7OF 1SCRA 1AR61 1V9U3 4YIFA 2J1RA 1WH5A 2R1DA 3FZ3A 2MSYA 2UUZA 1KFUL 1OFNA 2VKEA 4GGGA 3CLOA 2IGKA 1H8TB 4K40A 3R4DB 4L9VA 2OA2A 4TXWA 3GFJA 5FXXA 5FUIA 4PJMA 2DUOA 5AC91 2I2SA 2OXBA 2O0OA 2XF5A 4N0BA 2D6NA 1HB4A 3LGRA 1COV3 4QXCA 1PO22 1W7PD 4FPYA 3I71A 2PAKA 1Y3TA 2LTNA 2DMPA 1PO12 2VZPA 3O5SA 1XSRA 1JZ3A 2M4KA 5A2QZ 1ZRCA 1Y4WA 4NPRA 1W2UA 1KYZA 3I9V2 1HB1A 3LFUA 1QJEA 4BPZA 4NB5A 1QJY1 1UHMA 2WY7Q 3MCZA 2WRAA 3B94A 2WA3A 2WY8Q 4O3MA 1BHGA 1ULCA 4LK7A 5CAZA 2BTVC 2XV4S 1LOCA 3VFZA 1HKQA 1BN5A 1WUVA 4ZKTB 3A22A 2RDQA 1SEFA 2QYOA 2KD7A 2ATFA 2RVCA 3RYKA 2Q4SA 3IDBB 4XQDA 5BPDA 1T98A 4N43B 3SISA 4JRAA 4Y4RA 3NRVA 2PEXA 3EHKA 5D5UB 2RV8A 3BR2A 3KP7A 4HVOA 3IPVB 1MZFA 1YCIA 5FZDA 4CYCB 2WB1A 1JZ2A 3ZXGA 2HEOA 4EN7B 1F5FA 1G9CA 3H8RA 3F72A 4AOCA 5DDJ2 2D1VA 4WM8C 5T5JA 4COVA 1XU2A 1S3JA 3MQ0A 3S1MJ 1MZ5A 2YYOA 1NCRA 5CA6A 1SLIA 1QIQA 3HNYM 4AVAA 3OJBA 1JTXA 4GFBA 1PP8F 3TKYA 2H0VA 3DEMA 3AP5A 3Q8EA 3CJIC 4EM2A 2KDOA 4E27A 2WTEA 4D7TA 2GP5A 4QDRA 3M3YJ 4HK9A 3KMHA 4CP2A 1NCQB 1K61A 3LQCA 4BIOA 2W1UA 4XLEA 4WM7C 3IIAA 1L7QA 2VCAA 5FIXA 1VBE2 2K40A 2WAEA 2WN3A 3ZYIB 3MF6A 4Q4V2 3MYXA 2RDRA 2HWE1 3LZZA 4D7MA 2AEYA 2HZDA 3C2HA 2GIVA 1JYNA 3LFIA 2D2WA 1IKPA 2QZ3A 3M3CA 3G6EI 5T5LA 3DCFA 4EJOA 1Z7UA 3S15J 3GLLA 3SXYA 1SFUA 2BBYA 2KL4A 1QJU1 1O5UA 1QXJA 3PJYA 2VUAA 3V64A 2X53S 4XBLA 2L9SA 1YRZA 2XLGA 1RUH2 3ETQA 3CUQA 4ESFA 4D9JA 3TMOA 1CAUA 4R9BA 3SC7X 4A3ZA 3KS7A 4Q0SA 2O9LA 3RGBA 5A3PA 4XEZA 1X7NA 2VUDA 3QYBA 3WG3A 5FZOB 4Y15A 3HOXJ 4OUMA 2DBNA 3KZ4C 2ET7A 4M72A 3UESA 3E6DA 2EV5A 5K7HA 4I98B 5EEAA 2P5KA 4M4RA 5B3SH 2RS31 1G9AA 5L73A 1GMMA 2DJIA 3I58A 4AW7A 4N4OB 4S2DA 1UYZA 2FDKA 1LOEA 1ZR2A 1RUC3 3JB8A 3K6GA 3THCA 2BXYA 1W6MB 1K79A 4META 4RLQA 4QTRA 3HIFA 4FE7A 5FJHA 1PGL1 4BKXA 4ENKA 2OPTA 4AEMA 4AI0A 1IXRC 2ZXIA 3I2DA 1BW6A 1OYIA 4H7LA 5JDBA 3HBZA 5C4JJ 4IDZA 4L5IA 1BI0A 4E7IA 1JH5A 5IOZA 5C33A 2R063 1VFCA 4NROA 5KAFC 2LG4A 5BPIA 5CG9A 2ME6A 2CHHA 3I3QA 3WDUA 3WE3A 3SKVA 3KD4A 5FZMA 3ZQQA 1BK1A 3GFLA 3AL0C 3FUOA 1QOTA 3PUSA 2TBVA 1HRI3 2J1TA 3URFA 2D98A 2ZJCA 5CFCB 2P3KA 4N7UA 1UQXA 4CRQA 3FHAA 4OZOA 1J2XA 4DUVA 4GB32 2YR2A 5EZHA 1IS5A 4RAFA 4RGXA 4CCEA 5KBFA 5A33B 1SVOA 1W6PA 5IY5H 3QYFA 1OCCH 3EQLF 2DVBA 1FOD2 1S0EA 3OGRA 2SBAA 5C71A 3NAUA 2ZMEB 5FYIA 5JVTA 3IAQA 1T08B 1DPRA 1FYUA 2Q8OA 5K4LA 2CU5A 4CVUA 2KIFA 1FPN2 2C4XA 3UR3C 1CZTA 3U21A 1RRJA 2NNYA 1K3IA 4A7YA 4WVMA 4Q5OA 5FKCA 1G4DA 5B66C 4CSWA 2R30A 4S04A 2M2EA 3K70D 1RUJ2 4H14A 4R4ZA 1Z67A 1LKNA 4UWDA 5GLTA 1UYYA 3GEZA 2OS2A 5GKAC 3LSHA 1Z1DA 2CS3A 2PI0A 3G1OA 3FK7A 3J7MA 3JTGA 2R49A 4XUTA 2ZACA 2VOVA 1U5TA 4QT6A 1M4WA 4Q1PA 4IHSA 1DQ4A 4NUBA 4XSXF 1SLTA 1NT0A 1HRV2 1WZXA 4QPIA 4Y22B 2LKXA 4I0BA 3P1IA 4FPOB 1TMF2 2JQ7A 3BCBA 3RKYA 1NLRA 2E35A 4B09A 2WYSA 5DN2A 1DGWY 1OT5A 1OURA 1G2HA 4JGZC 1MDMA 1YI2I 2VQ0A 3H0GJ 2C1FA 5A6XA 5EG0B 2DMTA 1EKEA 2GNTA 2OU2A 2Z5WA 3ERMA 3J8F3 4LKDA 4E7HA 1W8NA 2WAFA 2GSYA 1LULA 1G6NA 4JVAA 5C8CB 1DDLA 1H8AC 3PTYA 1G3TA 3MPBA 4CXWA 4KWKA 1BCXA 4XAAA 1U78A 1ONVA 3FFZA 5IATA 4HETA 3LPFA 4QPYA 4I7HA 2RR11 1TZLA 1GUUA 3VD9A 4Q47A 1S2BA 4DNCA 5J4YA 3NV2A 4A6EA 5BNPC 4HVQA 1P7IA 3OIOA 4RHV1 1CAXB 2CQ7A 1RUG1 1UU4A 4XUNA 1D0HA 1HDKA 3I2OA 4U88A 3BZCA 2W91A 3CMGA 3BJOA 1I1EA 2VW1A 3QACA 2AQEA 3P3NA 2VBBA 4GKYA 3POWA 1TVGA 3KLNA 4YW7A 3FKIJ 3DPLC 1ULPA 1E0EA 2HVSA 1T6GC 4BA6A 2JENA 2DFHA 4YZ2A 2AEZA 4CCNA 1YQAA 5JZGB 2RM21 1B4AA 2WQ4A 5FO8B 3USUB 2X09A 1LDDA 1LAJA 2WINB 1IZ3A 3KHCA 5FK7A 3MZHA 2V9PA 4P9IA 4AIHA 4B1RA 1Y7BA 5FK8A 3AKZA 2UU8A 2LFBA 4CXFA 1SDDB 4A3LJ 4RMNA 1YQ6A 4NQWB 2XAFA 4KU8A 3O7OA 5A3TA 5LRSA 2X6WA 1X2MA 3MVPA 4QWQA 4HG6B 2RC4A 5CVJA 2YX7A 1RUI3 1SAUA 1IOAA 1JJ8C 2RG4A 3RZZA 5LLQA 1W6OB 2IUWA 4GDFA 5FZCA 4B7EA 3WW3A 4IUGA 5KXBA 3LKJA 2JE8A 3MN2A 2R4GA 2WFF3 2VJ5A 5GLWA 3WF0A 1HQLA 3WTZA 4A3KJ 1A5JA 3EYYA 5L9BA 3CBNA 2QKDA 1MBKA 5FLJA 4DEQA 1B6AA 1C5IA 2Y0SN 2IXHA 3RKXA 2VVEA 1JZ6A 1OLME 1YJWI 1E5SA 1YFXA 1ZBE3 1MH3A 4C1XA 1PUFA 1UZZA 3WDWA 5KC5A 4CA0A 5I0RA 1NY71 4RS5A 2WNOA 1Y1VJ 5DG1A 1AYM3 1BYHA 2RS12 2RQPA 2W85A 2Y64A 4O61A 5E16A 1EV13 4IEPA 2ZGSA 5A32B 3ZSLA 4AEKA 4Q0VA 1L3JA 4YG3A 5C3EJ 4ZDPA 4OVEA 2IBDA 2FDHA 2Y30A 2X1DA 1HJGA 4OMDA 3VBRA 3O8GA 3HT2A 5LGUA 4ET7A 3WGIA 1LHUA 3PQJA 2XGCA 2VE9A 3GTKJ 3LA3A 2A73B 5C4WA 4D5FA 5A3OA 3L1PA 2HOEA 3N9NA 1KITA 1XC6A 5HLHA 4YGDA 5LHIA 1UMHA 3NRUA 4P5OA 3QPTA 2LS6A 2OQ7A 3EUKL 5FYMA 1SFNA 3WF3A 3QLQA 4JBAA 1CX1A 2NVXJ 2XGDA 1NCRB 3SITA 2DN0A 4KG8A 1AJOA 4P9WA 3M3OA 1XSDA 4FAHA 5ANQA 1KDMA 3LSJA 2STTA 1LOFA 1QMJA 1LE8B 4NIGA 3C3VA 4IEUA 1OF4A 1CN1A 5DAPA 3ULQB 3TW6A 1KS5A 4M3DA 3WTVC 4BK5A 4OIRF 1IG3A 5KHDA 3W6KB 4YZ3A 2CSOA 1GV9A 3OYHA 2ZXQA 5A7QA 3HSEA 4LLOA 3FLPA 1HQWA 2A61A 4E7ZA 1RJ8A 3HRMA 4ASLA 3J81Z 4BGDA 2Y6FA 3T0YA 5K8SA 4LIVA 5KWRA 4W97A 1QBJA 4L2NA 1WW6A 4F93B 3MI8A 4EWEA 4N9IA 4OINF 4AHZA 4PBOA 4C3IJ 4DQ2A 4DGWB 3T4HB 3EPZA 1PVC2 4S05A 2K02A 3A0BC 2R7SA 3FHZA 3H8UA 1UD1A 3UGHA 1T2XA 5A1FA 4LKFA 3OS2A 4KGQA 5E3LA 2WO2A 3K2AA 1BC8C 1CAUB 2JDZA 2EILH 2Q1MA 1OFCX 2F6CA 4KNCA 1J9IA 2Q8DA 2VQLA 2JWPA 2O8KA 3NNLA 1ULFA 4PGGA 1X8MA 2BE5F 1MGTA 3M1HA 1HDDC 4D7YA 3AYDA 3VHPA 1QNTA 4HBNA 1UKRA 3GBGA 1BOBA 3AFHA 5EF6A 1FPQA 5ABJA 2NPIA 4A93J 4PCRA 3P6BA 3I59B 3ME2A 1QNWA 2GBYA 4C3JJ 2VJ4A 3T2QA 2EF6A 3SFZA 2CFXA 3BTXA 1NLSA 1O57A 4G7HF 3S1NJ 4LA2A 4GKXA 5G04L 3Q8CA 3NV3A 4LK6A 2R7UA 5FXWA 1RNLA 3HKZN 3ZN0A 3T09A 3GHNA 5HXMA 1MIJA 3LIHA 1FSEA 3AP7A 1JUMA 4LO7A 1RHI1 3OB8A 3ZOBA 2R7EB 2VW0A 1XE8A 3TW7A 1UHSA 1WJFA 1FYMA 1STZA 4HNUA 5FMOL 3PSFA 5I0SA 4BH9A 1GYKA 3LAGA 1JUPA 2XAGA 3DTKA 3ZXDA 2V4AA 3WW2A 1JHFA 4BE1A 1BXHA 5B4XA 2NQYA 1MS3A 3SYTA 1W0TA 1B72B 1TNSA 1ONAA 1QOOA 4BXSV 3OYMA 4BUPA 2BZTA 3B01A 2PAMA 3WQ7A 4PJNA 1ENXA 4XETA 3Q0VA 5ISLA 1FMD1 4XFGA 3B6CA 2P1BA 5K5OA 1W6PB 1IN4A 1UU5A 2GNMA 4XLHA 1ND2A 2CWSA 3GZNB 2OV7A 1B9MA 3A4CA 4BQXA 4K1ZA 3HN3A 1AR82 4K20A 4W6YA 1ZRFA 2VD7A 5GLZA 3B6AA 4EE2A 4KJZA 1OLTA 1VI0A 2OQRA 4LPLA 2FOWA 2WV0A 1S2EA 3H3LA 2ILMA 3H1YA 2ADDA 5FY0A 3ILFA 4N9HA 4KN7X 4WVVA 3AMHA 4U7DA 1ZM1A 2PHWA 5FY7A 2PQQA 4CCLA 2PMZN 1RUE3 2JIGA 3Q3SA 4IHVA 4G9YA 1GDTA 5BNOC 1QZZA 4UUSA 2VKVA 1OA3A 2J1AA 1NH3A 3S57A 1J59A 2IVMA 3BTIA 1LCLA 1RMU3 4WVMB 5CVVA 3ZP5A 2EK5A 2P5VA 5A3UA 4LKEA 5D6FA 5BV6A 1A8DA 3HR9A 4XRMA 3E6MA 3LEKA 1W8ZA 1J0RA 2NN8A 1UO9A 4Q4Y2 2JN6A 4V2WA 4PJLA 2ECBA 2ZBKA 4CUAA 1Z78A 2XPWA 3M3IA 1P2FA 1C1FA 3BJAA 4J6GA 1U5TB 1W9TA 3A0KA 3ZXAC 4HK8A 3PJQA 5JI7A 1H2NA 1XD7A 5DZGA 1O3QA 2KZVA 5T50A 2JG9A 4I99C 4AFCA 4QPIB 2B9SA 2NS0A 2VUMJ <