3J4UH

A new topology of the hk97-like fold revealed in bordetella bacteriophage: non-covalent chainmail secured by jellyrolls
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
140
structure length
140
Chain Sequence
MIIDKLLQVSDGQAVTASAASTDVIDFGQANPNTGMDDRSKMVITVDESADAAGAATVTFSVQDSADNATFADVAATGAIGKANLAAGKQVVIPMPTKLRRYCRVYYTVATGPLTAGKFSAQVVTGIQQNVAYPDSPRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords major capsid protein
publication title A new topology of the HK97-like fold revealed in Bordetella bacteriophage by cryoEM at 3.5 A resolution.
pubmed doi rcsb
total genus 21
structure length 140
sequence length 140
chains with identical sequence I, J, K, L, M, N
ec nomenclature
pdb deposition date 2013-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1110 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3j4uH00
3J4UH
chains in the Genus database with same CATH superfamily
4COYA 1WZXA 5A6XA 2VMHA 4LQRA 5LATA 4XF3A 4AXOA 4OI0A 3EO6A 3BGAA 2Y6LA 1J3PA 5LEKA 4MG2A 3VL8A 1EV11 1NUKA 2ZEWA 3S5AA 1LEDA 1HDKA 2QTWB 4XTPA 2BGCA 2EXHA 4QHZA 3FBYA 4D6RA 1HRV1 5EXOA 4JDMA 3RPQA 2PLV1 2GN3A 2PHUA 3H8UA 4NPRA 4XJAA 3GJAA 4LO6B 4IEXA 1F4AA 5DDJ2 1MEC1 3JCIA 1QOTA 1UYYA 4YVWB 1MQTC 2DCZA 3MV11 5FYTA 1TNFA 3N36A 2MPFA 4FPJA 3POSA 2D44A 1R1A2 1OLQA 5FPZA 2VNGA 2VM9A 5IVCA 4KWJA 1CQ9A 2ZGRA 3ITQA 5ABJB 4NMIA 3I2OA 5BY5A 4PHZA 2XBO3 3LAGA 2JB4A 5E6HA 1QQP1 4FP2A 2WYSA 5DN2A 2XDVA 1AL21 1C3HA 4H55A 2SLIA 4B1MA 4XF1A 1PIV1 3VKMA 5A3MA 2G4IA 2QKDA 1Y43B 2PMWB 1ZZCA 3HJRA 4JVAA 4NUBA 5DXDA 3T08A 3WF2A 2WBKA 3WW3A 5C4WC 1WD3A 2YB7A 5KXDA 4XF4A 4LE4A 1IKPA 2CU5A 4M3CB 5L36A 4YSFA 5A6ZA 4BZ4A 3AVSA 4RR3C 2JENA 2OQ7A 3I2DA 3KGZA 4XURA 3ACIA 1ENRA 3ZXFA 5C7GA 3KSCA 4J1XA 4GMP3 1AX0A 3AMMA 3FHQA 5C3QA 1W9YA 1V6LA 2EXJA 1RXGA 3GBGA 2RMU1 5FXWA 1FMD3 4XZPA 3D0JA 5HCBA 2GZWA 3JBG2 3AVRA 2XL9A 2YFUA 4A7KA 2XVKA 5GLZA 1JTZX 2RS52 2CTVA 5EQUA 1WA4A 5FZ7A 3SNMA 2E6VA 1HXS3 2BOJA 4W6XA 3A22A 4YVWA 4E2QA 2B45X 3W9AA 3JZVA 4JHTA 5C9AA 2QQKA 1ENQA 4RSUA 4JTOA 4XIKA 1UOFA 4QM9A 4AE2A 5ABJA 5A1FA 5JSPA 1MVEA 1RINA 2ID4A 3ZKUA 1S2KA 2QFEA 5F39A 4EN6B 5EV7A 1MS5A 5FZBA 2D5FA 4MH0E 5FJKA 3NJZA 3OY8B 2B9VA 1RUE3 4MGYE 1US3A 1J1TA 2Y8KA 5A7SA 5FBJA 4M3CA 1TG7A 1ZBA1 3L2HA 5A3PA 5IATA 3VBOB 1QDCA 5JOXA 4S2GA 4XHBA 4L8QA 2N7GA 5DAWA 3QCWA 1WD4A 1NG0A 2VULA 2ADEA 4URTA 3V0AB 1UOJA 4MGTA 4BOWA 2QNKA 1OPMA 5FP8A 4LBMA 4UFMA 5FDBA 5IVBA 1YJLA 2JJ6A 2WSVA 4NHMA 4YG3A 2I45A 3MIDA 4HN0A 5GZFA 1AR91 1PGSA 4LLOA 3UJQA 3FL7A 3ECQA 4E8DA 3VHPA 1DQ5A 5J7MA 5C6CA 1AF9A 4FPLA 4H14A 2YROA 2RJKA 2K2SA 1NXD1 3UKVA 1FXZA 3MUZ1 3OD4A 1BZWA 1R093 4E8CA 2WFF1 4MX3A 5I8SA 4FPGA 4XXAA 2A1XA 2UU8A 1K3IA 2ZGLA 2JKXA 3BU7A 4HXCA 5HXVA 4N43B 5FYIA 3EHKA 5FZGA 3OY8A 2VUAA 3JU9A 4NHLA 5IYYA 1EAH2 2WO1A 1NCRA 3M70A 1IKQA 1G6NA 5CG9A 1X82A 3VZKA 1W0NA 2RM23 5LEJA 1S0GA 1YQ8A 2D98A 3SMHA 4ARXA 4CXWA 4LO5B 2JE8A 2P1BA 2WABA 4CEYB 4C90A 5FYBA 2K0GA 2RS11 1WLTA 1RITA 2VTXA 5FPAA 2MHFA 3VBOA 1QNYA 1LODA 4NIDA 5FYVA 2RG4A 1LESA 3VHNA 1N1YA 3LOBA 2R072 5LW9A 5JOWA 3NQHA 4FTBA 1GICA 3MFAA 4Z82A 1DDLA 5IK7A 2CHHA 1RUJ1 3V0AA 3JBG3 1QEXA 3H3UA 2EVXA 2CYFA 1ACCA 3RWKX 2RS53 4MOAA 4NN0A 4JKLA 4FFIA 1H30A 2VE1A 4RFT0 3ZFFB 1NYWA 1W0OA 2ET7A 5GLVA 1BXHA 2AR6A 2XJTA 2PHLA 1ENSA 3MDPA 5JR2A 5IT6A 5J09A 4IEZA 2HEVF 1OXCA 5APAA 4XOGA 2WZ8A 4QGLA 3ZFGC 1LGCA 1KS4A 3VZLA 4OULA 5EIYB 1VBA1 4AVVA 2RS33 3UK9A 4WVMB 4XDQA 5HV0A 1GANA 2W39A 4XETA 1HX6A 2PHTA 4PI0A 4N43A 3DPRC 5FOBB 5JLVA 2PAEA 3SEEA 4DIQA 3WY6A 4I3PA 3SCFA 2Q1MA 3H50A 3T4HB 5C71A 5AVPA 4FPKA 3GZTB 1IS4A 1NLSA 3A0NA 3C2UA 1OPOA 4XTMA 5L9BA 4X6RB 2J42A 3GYDA 4BYYA 1GYKA 5IAXA 4XAEA 1O3SA 3O1OA 2HWF2 3RI9A 1NA1C 4CEYA 3MZHA 1IHMA 1UU5A 3SLIA 3H7JA 2HWC2 2X10A 2ZMLA 3AKPA 1KGYA 1AJKA 2D7FA 1OD3A 1ASJ1 1IGOA 3DYMA 3RZZA 2XXZA 5GLTA 3ZXEA 2V4AA 1RVF2 1I5ZA 1O59A 1AYM2 4ZU5A 3ZO0B 3VUOA 3VZMA 2LTNA 3H1YA 2D6LX 1KQRA 2PYTA 3AP4A 4PQQA 2VCAA 3ZFFA 3OPWA 3DN7A 3T2OA 4COVA 4JX0A 3RSJA 2QZ2A 4QXCA 1QNWA 1H2KA 3WR0A 4KWUA 4PCRA 1BBT2 2NN8A 3FZ3A 3OEBA 5ANQA 4PDWB 5JMOA 1OH3A 4OHYA 1R081 2R7EB 2VL4A 3GCXA 3O0XA 1GQHA 2IWGB 2HH9A 2HWE1 5ACA2 4FPCA 4XILA 5DPNA 1WCSA 2YHJA 2BU9A 4WVMA 4K9SA 4PLMA 3CLPA 3ZXKA 4EYUA 3K3OA 4AEDB 1EV12 1HB2A 3KQRA 4FOWA 1GOFA 3PHMA 2VCCA 2WNOA 2BNNA 4XMAA 1HRV2 5CKNA 4WM8A 5BYNA 2IUWA 2PLV2 5KBFA 4CZSA 1KEXA 4D69A 2WFPA 3T0DA 1Z78A 4Y1YA 2QQWA 3AZXA 1MEC2 5JXGA 2X09A 1DYKA 2W9XA 3H1MA 2VCMA 3K77A 2R073 3IAPA 3LKJA 3PVOA 4CDXB 4DUVA 4YVSC 3OCPA 4IUGA 4FAHA 5I93A 5BXXA 1E5SA 3HWJA 5FPVA 1HQLA 1QQP2 3E6CC 1NE6A 5IVFA 2FDFA 4BLIA 3J4UH 5KXCA 1AL22 4DO0A 2WZEA 4C8DA 3QLQA 4OZXA 5FLJA 2PQQA 3JD71 4E2GA 3ZSLA 3T4VA 3AM2A 2P34A 1WMEA 3UNPA 4COZA 1IPJA 4Y24A 2C9AA 3HNYM 2NPIA 1R1ZA 2VZRA 4L9BA 2OZJA 2RV9A 2HEYF 4J6GA 4PDWA 4XBQA 1N1VA 1FOD1 2ZTNA 4BQ3A 3ASIA 2XPJA 1UY1A 1UO9A 3O0VA 1KJLA 2CWMA 4ISRA 1JYCA 1JBCA 1X8MA 1YFWA 2FDHA 5F1RA 2RMU2 2KR2A 4EE2A 1UU4A 3ZYFA 1JYIA 1UMIA 3POEA 1F8VA 4AEDA 1BEV2 4GWIA 2ZA9A 3SEPA 2EXKA 1OBNA 2DU0A 4LOTA 2GU9A 2W91A 5AC91 2FDKA 4IETA 1UKRA 4GKYA 2HYXA 4JAAA 1C5IA 4ZZ5A 2HWF3 3PDQA 2RR13 2J1UA 4CU8A 3MIBA 3PMSA 4I01A 3C3VA 1W90A 3O1SA 2HWC3 4P9IA 3WHUA 1K42A 2XBO1 4Q26A 3OPZA 4CDXA 5BNOB 1DLLA 1XYNA 3HT2A 2GH8A 3IAQA 4EN7B 4SBVA 1O4ZA 3UGFA 1RVF3 3ZR6A 2Y60A 1UQXA 3AMNA 4FFHA 4GALA 2BRTA 2VTFA 5EYXA 2GP5A 2VZVA 4IEUA 4JGYB 4KI5M 2A7AA 1XPWA 5FY8A 1IOAA 3AK0A 3VDDB 1JI6A 1OKOA 1REFA 3RYRA 4B4RA 1CZVA 1GR3A 4MXVA 1GU3A 1NLRA 3KGLA 5J36A 1RB8G 4GJZA 1MS0A 5KHKA 2G19A 4LKSA 3WNOA 1BBT3 3N9PA 4P9JA 3FUOA 2BGPA 3DXTA 4DINB 3WP5A 5JZGB 4GMP1 1ZBA2 1Q5OA 3WOGA 4AFAA 3OUJA 1FMD1 5DUUA 3DEMA 2VMDA 3L9JT 1PK6C 1X7NA 4Q5OA 4WM7B 2ZPXA 4DXTA 4NPLA 1REEA 2ET1A 3OJBA 3PUAA 3U10A 5EJZB 3QOPA 1CX1A 5FYUA 2Q8CA 1W28A 2JDYA 2UYBA 4L0PA 4UBHA 1H6YA 1HRV3 1W6NA 1DGWA 3FLRA 1TQ5A 4ATEA 1J59A 2JDKA 2PLV3 4LHLA 4NWWA 1BYHA 5FCCA 1AR92 1DBNA 1HXS1 4FT8A 4GQ7A 3CMGA 1HRI1 2VZSA 1MEC3 4M00A 4XEZA 1HB4A 3WQ0A 2JG9B 1YRZA 4IEYA 5EP9A 1SFPA 1W3XA 4C91A 4YW3A 3VBRC 1WCQA 2JDPA 2XMLA 1H8TC 4BMEA 3FE5A 4KMQA 3WF4A 5BNOA 4XQWA 2IXLA 3WW1A 2Q8OA 3LWCA 2WFF2 4RGKA 5CA6A 1QQP3 2IXCA 1AX1A 4KWLA 1RUE1 3ACHA 1LAJA 3THDA 2VU9A 3AL6A 2J7MA 4JGYA 4QQHA 2IVIB 2CWSA 4AEMA 2XONA 3B02A 3J7NA 3P5BA 5LBCA 4FPHA 2ZOEB 3NNFA 5FFOC 1U12A 4EV0A 3MW3A 2PELA 3ES4A 4JDNA 5C8CA 3KV5A 2DBIA 5FUNA 2ZEXA 5GZDA 3WDVA 4BDVB 2RS12 4IW3A 5D21A 3LDBA 3OBAA 4WM7A 5B2GB 1U5IA 4EQVA 1YYNA 5CFCC 2RMU3 2JE9A 4N43C 1W8NA 3KF5A 2LW8A 4QM8A 3RDIA 2ES3A 1BEV3 1RUJ2 4AFBA 1QJEA 5G04L 1LGNA 4EROA 3R0RA 4KQ7A 4LUMA 3VHOA 3O1MA 1UY0A 4Y4YA 2WLQA 1YIFA 2AGSA 2W52A 3DECA 2XQXA 1NZIA 1H6XA 3GJBA 2AUYA 1LJ7A 3DYPA 4OLLA 1IQAA 4AAXA 3NV2A 1ZA7A 2JG9A 1R091 2VG9A 2ZX2A 2P3KA 3MW2A 4KNCA 2VNOA 4N53A 2D3PA 4RR3B 4QX0A 2YMZA 1RC6A 2ZGSA 3NNGA 1BQPA 5BNPB 1B35B 2JDAA 1QOSA 1LECA 5A7PA 3CEWA 1VBA2 3WUCA 1ZZBA 3OGVA 1SBEA 1ZRCA 1UYZA 3ZLIA 1ODNA 4IGPA 4Q29A 2FZ1A 4XJ9A 4W8JA 2RM21 3CO2A 4A3XA 3WP6A 2A5ZA 5FZCA 3B3QE 5FP4A 1W2UA 1LU1A 1CN1A 3VL9A 2WAOA 3WW2A 5C3PA 4V1PA 3KT4A 2HBTA 3UT0A 4Q2FA 2ZGOA 1MQTA 1DHKB 4HMZA 1ZBA3 2HWB1 3C7HA 2ORZA 2WNUC 3NL1A 2FHRA 2XJSA 2XJQA 2GN7A 4N9IA 3Q8BA 1YNAA 1WW7A 3HPNA 3FFZA 4Z07A 3AMPA 5JMCA 4NRQA 3N3HA 3JQXA 1ASJ2 5FMOS 2JICA 5A1LA 3KMHA 4AFCA 2ZCWA 1TEIA 1OUSA 3TB0A 4GJYA 1AR93 4XPVA 4QPIB 5F3GA 5A80A 5C4WA 3UESA 1CWPA 2R043 2ZBJA 4LA3A 4W6YA 1COV3 2A75A 3WEZA 3NV3A 3K3NA 2O8OA 2QUOA 2ZX0A 2SBAA 2Y33A 2O14A 3AYCA 4RR3A 4JRAA 2FQPA 2RS31 4DOUA 5BNPA 1GFF2 1R082 1XE7A 2WFF3 4Z8BA 5FV3A 2YYOA 2HWE2 1UCXA 4K3UA 3NJYA 4O9GA 5FP3A 3WNNA 3OSDA 4COWA 4ZKTB 2J1TA 2RJLA 5H9RA 1OA2A 1I1EA 3AYEA 5ANNA 1DFQA 1BMV1 3RFRA 5DAQA 1UXXX 3KM5A 4A42A 1W0PA 4DB5A 3D4KA 2P3YA 1WMFA 3I97A 1SLAA 2WYFA 2ZACA 3CNAA 3DYOA 2YU2A 3UKTA 5KC5A 2CY6A 4Q4Y1 5CZKA 2VGDA 5LRRA 1VP6A 4R9AA 4CTEA 5SV5A 2Z79A 1NT0A 2Z42A 4CRQA 1R64A 1GZTA 4YNIA 1BKZA 3SXWA 3BI3A 5C5UA 2W1QA 4JRLA 4AI1A 2IFWA 5LZ6A 4Z2AA 2I07B 4IE0A 4N8MA 1V0AA 2DBNA 3W21A 3WF3A 1SFYA 3RQ0A 3SH5A 4P5HA 3JD72 1D4M3 2RVAA 3AP6A 3WDTA 2IC1A 4E4DX 4N7UA 1OVPA 4Q4W3 5ERLA 4MO3M 1CAUB 1ZREA 1XNTA 3C7FA 3LB9A 4XE9A 4D7TA 3AYDA 5F5IA 1IPSA 2BWCA 1FOD2 3O14A 1VBA3 2Y6GA 1MZFA 3PL0A 1LHUA 2Q5TA 4XUOA 3VDAA 2A3WA 1SBDA 4B7KA 4BU2A 3BN6A 1Q8QA 5E1RA 5IVJA 3H9AA 2CSGA 4CUAA 4FVVA 4L11A 5FO8B 5AC92 1URXA 3OYWA 2EICA 4YG0A 4XUNA 3PU3A 1A6CA 4QKDA 2X53S 3B94A 3H0OA 4YW7A 1YJKA 1YFUA 2A73B 3I3MA 2VOTA 3H8RA 1LRHA 2A6VA 3CIHA 4HFSA 1F31A 5F5QA 2Z5WA 3DL3A 4J1WA 1XYPA 1ASJ3 2XBO2 3ETQA 5D2AA 5FYSA 3VLBB 4K6BA 1GZWB 2Q4SA 2WWJA 4Y5SA 2DTYA 4OHXA 2NYYA 2DTWA 3IIIA 4KL1A 1KXGA 1OHFA 2XVLA 3J7HA 4Y26A 5LBFA 2FDGA 3DPRB 3RZMA 4YM1A 1TMF2 2F17A 3F95A 4TLFA 4NHYA 3UKNA 4CP9A 5FY4A 4CYDA 4LBQB 3KT7A 5CFDB 5GZCA 2YPDA 3DKQA 2YC0A 1CIWA 1NA1B 3E5UA 1GNYA 2BUKA 4P02B 5FZHA 4EN0A 3AKRA 2RJ2A 1ZRRA 4LR4A 4DEVA 4GXLA 2HWE3 1FMD2 1K5MC 4KU7A 3PJYA 3RS6A 3T1LA 1V6NA 4ZY9A 3ES1A 2Z4FA 1AX2A 1DGLA 4GH4C 1UD1A 5FZIA 1HLCA 5KHIA 4JGYC 3VDDC 3VKNA 3VV1A 3JB4C 2BQPA 1OLRA 1US2A 1YQ2A 4IGOA 3AZYA 4HKWA 4XVHA 5T3NA 1RUF1 4EWDA 1W6QB 2RR11 2GNBA 5I0SA 1W8TA 2WAAA 4YZ3A 5J96B 1F5JA 2XLAA 4XJZA 5JZGC 4I2OA 1HXS2 1OLMA 4TTGA 4XYXA 1HRI2 2BBAA 3VBSC 3TEZA 1QOOA 3MIGA 4HT1T 3AMQA 5KXBA 1V6OA 2A70A 3ZFGA 2A6WA 3MEPA 3OGSA 4MGKE 4XACA 3K51A 3K4AA 4UW4A 1GZWA 4S2DA 3ZOIA 1FX5A 5FY5A 5IK8A 2D43A 1GWLA 2XJUA 4I02A 3ZXGA 2YDEA 1DG6A 3R05A 4CCLA 3DPRA 1RUE2 5CNAA 2ZKNA 5LASA 4YGBA 1OQDA 3RWNA 1W3VA 5D1IA 1DIWA 4XIOA 3K4ZA 4UFHA 2OT7A 4LBQA 2RDSA 4LTAA 1NA1A 3SKJE 2WN3A 4OI4A 1XB9A 4CPBA 5FLIA 4LXLA 1FOD3 3HVDA 5FKBA 1N3PA 1PMJX 5J37A 1GMMA 3KD4A 4L2NA 2Y0OA 3HD8B 4YVSB 4E2SA 5A3NA 4B4QA 2O8QA 4LBNA 1UOGA 3KQ4B 4TYSA 3VBHB 5JIUA 3ZYJB 1PX4A 1SLTA 3E5XA 3WNKA 4NR1A 4QQPA 2VPVA 3B00A 4IEPA 1PHMA 3NNMA 1GQGA 4CCEA 4F3JA 3LA2A 2W1WA 4RN5A 5AC93 1W6QA 1Y4WA 3NKGA 5FZ1A 1O3QA 2EIBA 1YQCA 1FT9A 1PO11 5IFTA 2PN5A 2X29A 3BTZA 1R092 4QQ2A 2JDNA 3EYPA 1L7QA 4Z1VA 4P9GA 4XBNA 1KD7A 1JYTA 3K2OA 4CCCA 2R1DA 2VOKA 4LBLA 4B29A 3I3BA 5K0UC 2OKXA 3T2TA 5CADA 3VD3A 4ORFA 1TMF3 1U5XA 1J58A 3E6DA 3HBKA 4ISQA 1WMDA 5DAPA 5A32B 3ZYPA 2PA7A 3N9OA 3ZKYA 5F3IA 1QWRA 1AHSA 2RM22 1Y9GA 4M3CE 4O61A 3MFCA 2JIJA 4I30A 5FP7A 4ASKA 1W9TA 4QPYA 5JOYA 2XJRA 5BNNC 1X50A 4IERA 4AVCA 3I3DA 4DXRA 3FN9A 3WHTA 5I0TA 4HKLA 4O7XA 4BQ1A 4XFBA 2QDNA 1B35C 1H2LA 3AZWA 4G3YC 4EWEA 5BNPC 2HWB2 1QJY3 4O9EA 3P3NA 1JYVA 4IEQA 4MHUA 4YVSA 1SQ4A 1W05A 1BEV1 3CHXA 5FZKA 4EWAA 1S1AA 3SH4A 3PVNA 2BNMA 1WBLA 2OXBA 1GZ9A 5FJHA 1QIQA 2X5IB 1OT5A 1QXJA 1W2TA 3UYJA 2IFRA 2LRPA 3ILFA 3S0MA 3VB9A 1LOGA 4L97A 5EWSA 1CAXB 3DUIA 1HRI3 3MW4A 2NP0A 1KRIA 3V64A 4L99A 2WQ4A 4RHV3 3OOXA 1MPXA 5FY9A 3S6PA 1BVVA 5E89A 1JUHA 1HN0A 1AR81 3SQOA 2A6XA 2RS32 1PK6B 4Q1PA 3ZN6B 1J3RA 3ROUA 1DLCA 3CZJA 1RUI1 4QGMA 5I91A 3LIGA 4DQAA 3IT8A 3MYXA 3WDYA 3GCWA 3NWKA 5A32A 1NQJA 3U14A 4QPIC 4QB6A 2FMYA 2I2SA 1XNDA 5EJ1B 1HB3A 4OHVA 3WNXA 1BMV2 4XCBA 5FBZA 4AVTA 4HN1A 2J22A 3RZHA 1OVSA 2UWBA 4UXAA 5I8TA 1NE4A 1JZ2A 4AHXA 4GWJA 1BLZA 2DVGA 4H2AA 4KH9A 3M8LA 1W9FA 5A6QA 5J48A 4NRMA 3VBRB 2VC9A 5KHHA 2JB8A 1H8TB 4Q27A 4Q4Y2 3UGHA 3VGIA 3T1MA 1UYPA 3OUIA 5SV8A 5JXJA 3HT1A 1V6JA 1HW5A 3W5MA 2VZOA 1UMHA 3BALA 2Y6JA 1QJX1 2EALA 2GNMA 2OS2A 5T52A 3MPBA 3VBUC 2JD4A 1QJZA 4LIVA 3NV1A 4QX2A 5I0DA 2R041 2CGPA 5L9VA 4QXHA 2BPA2 3D5OA 4K8RB 3BB6A 1COV1 4LORA 4BHPA 5LY2A 2E7QA 1EUTA 2Y6KA 1KITA 1SLCA 2VMGA 2OX0A 1Z7S3 1UX6A 2W3JA 4HPKB 4R9CA 1IS6A 1CX4A 1V00A 4TXWA 2VD7A 2ZEZA 4KG0A 1PK6A 2E7AA 3EQEA 3LA7A 5CFCB 2PAKA 4JKKA 4JDOA 2P37A 2PTMA 2BEOA 3PJQA 1GZCA 1YQ6A 3WG1A 5FMDA 4Q4V2 1SLBA 2XKOA 4XJUA 2ZGPA 3M2MA 1WLWA 3H8XA 1ZM1A 1G9FA 1XU1A 3RZLA 3U4SA 3APBA 5LA0A 1JN2P 5FOJB 3ZPOA 1AXKA 5I8YA 5H9PA 1CGPA 2HKXA 1LOEA 1S4CA 3LPFA 4KWKA 3GZEA 4UYBA 2HWB3 1GKBA 3VBRA 2HEWF 1FV3A 1H8TA 1KFXL 1ULEA 1VALA 2DFBA 1AR63 1XE0A 3FX3A 4FOVA 4Q8LA 2PHFA 4YW6A 3B9CA 2ARBA 2UYAA 3O12A 4MV2A 4NIIA 3R4SA 2ZZJA 5FYYA 4ASLA 5GLWA 4YYOA 3WX5A 4CP0A 4BK4A 2Y38A 1RTVA 3M3EA 4HANA 3AL5A 4RD7A 4UFKA 2DYCA 1NAEA 1TVGA 1Q8PA 1D4M1 1QJU1 2BFUL 2F4PA 2AENA 1AXYA 4Q4W1 2FMDA 5JCTA 2O1QA 2P6CA 3PTRB 2LM3A 1H1MA 4HL0A 1FV2A 3O7OA 2QBXA 4XMIA 4XW3A 4ZPIA 4BJ0A 2WNUB 4HPKA 5F5CA 4XQDA 4M3CF 2EIGA 3DXUA 5JIAA 4A44A 4Q0VA 4ZS3A 2V4VA 5CFCA 5A3LA 1UMZA 4Y4RA 3HQRA 2GALA 4D94A 2ARCA 3VKFC 2H6CA 3G6JB 2ETEA 5IK5A 4FSJA 1Y3TA 2VVDA 3M4FA 4UWDA 1SLLA 4FI9A 3N7KA 5CFDC 3U4XA 3O0WA 2PHRA 2B42B 2Y6HA 2A71A 2ZHLA 1POV0 2X8KA 3HNBM 5F32A 4RGGA 3WLUA 2OUHA 4N7IA 1RUF2 5EHDA 2P4EA 2RR12 2J1SA 2J1RA 4YM2A 4ZU4A 1CR7A 3KB5A 1JU4A 4Q4Y3 5FYMA 4FTSA 1W8ZA 1W04A 1LHOA 2YZ4A 4DXSA 3HQUA 4NO4A 5JVVA 2DVAA 5A33B 3OB8A 1PZ7A 2XH6A 2XWBB 5JXHA 1CJPA 3GBWA 1VE0A 4LEJA 5DG1A 1PM7A 4DS0A 1ULDA 4P9XA 4DY5A 1S0IA 1HN1A 3IWZA 3NRUA 3LE0A 2GMMA 1OUXA 1ZBE1 3D6EA 1YI7A 4K20A 4QAWA 4XAAA 3THPA 1D2SA 5JSRA 1RUNA 4LITA 3BCWA 1XNCA 4LULA 3UGGA 1V9U1 2DV9A 4QXBA 3AKSA 3U1XA 3AP9A 1SDWA 3PUSA 1WMXA 3I59B 2CDPA 4P14A 2XQRA 3A21A 4HVRA 5I0RA 4LO8A 4C1WA 2WNUA 1ONAA 3RYPA 4HVQA 4AI0A 4IESA 1ALYA 2AC1A 2VMFA 5FPLA 3MIFA 4NJ4A 1AYN1 4W65A 1JOJA 3PU8A 2JG8B 2V5YA 5A7OA 3H1WA 4HBNA 4Q4V3 1OKQA 5ISLA 2ZHKA 1N47A 1DYPA 1RL3A 1WW6A 5K4LA 1ST8A 5A3TA 5D8AB 3RYKA 4YARA 1F35A 4BQ4A 3TEXA 2E26A 4LIUA 3RNSA 1LOAA 5FZ3A 5A3WA 2ZGMA 5DZEA 5FZ8A 2VBPA 4NWVA 1PO12 2AEYA 2Y0IA 1RMU1 2ZGNA 5T5LA 4AFDA 4HZFA 1UOBA 1SEFA 2W92A 2YFZA 5KXEA 3VBHC 3HBZA 1O3TA 3MPPG 5A33A 5CB7A 1O4YA 5HCAA 1ZX5A 2B8MA 2E63A 3BVCA 4CDUC 2V09A 4DMIA 1RHI1 1XE8A 2JECA 3BIEA 3FHAA 4DRRA 2P3JA 3GALA 1UNBA 1EUUA 4CCDA 4KU8A 3RZKA 2OZ6A 2WDBA 3R4DB 5BUVA 2YY1A 3VD7A 1GP5A 4KBZA 2UURA 4S2HA 5JSOA 2VNRA 2D93A 4NVPA 2RE9A 4FTEA 2AZ5A 4JCKA 5LB6A 5BNQA 5HCFA 1P8JA 1UY4A 4XJ8A 3WG3A 2KM2A 1W06A 3VDCA 2VOWA 1O4TA 2BFUS 4BH9A 2ARAA 4CEWB 2OUJA 1KDKA 3DF0A 3CF6E 1W2NA 2ZHNA 2WT0A 1OD5A 4AI2A 2B46X 3GBFA 4BLJA 4QKNA 4YZ2A 3AKTA 4GULA 2ZMKA 5D8AA 5FXZA 1RUF3 3KV6A 1V6KA 1HV1A 1W2OA 2QQIA 4OI1A 1JZ6A 1RUD3 4AR2A 3GM8A 1PO23 4AI3A 1YO8A 1SG3A 2VCBA 2UWCA 5HV4A 5CU1A 3AJYA 4UW5A 1PNFA 4JQTA 4KG8A 5DQ0A 3BODA 1MACA 4WVZA 5DABA 2YGMA 4FFFA 1ULOA 1K5MB 4CCNA 3FJSA 4FP3A 1TMF1 5E8AA 4CDQC 2W87A 4IXLA 2X5IC 4GH4B 4PF1A 1RUI2 3OBRA 3OPTA 1EYBA 3C8XA 4PI2A 1W03A 4YG6A 1FAYA 3B93A 1XRUA 4GKXA 1VAVA 5FMOL 2W0XA 4NROA 1ND2C 1VJ2A 2WZR1 3RMYA 2GH2A 3NMBA 2IXJA 3ME2A 3LCPA 2YV8A 4PQ9A 4YPJA 3ZYHA 2PXJA 3V0BB 3LEIA 1TME1 2ZX1A 1LULA 1QJY1 3M3OA 3N7LA 4TN7A 4Y1ZA 3VBSB 1VAMA 5FTTC 4BIFA 4E27A 2VTXJ 2WN2A 1QH7A 4XFGA 2X05A 1LTEA 2UWAA 5T5JA 2Q0AA 3USUB 2JDUA 4UFLA 2QQVA 1QU0A 2ZGUA 1AL0G 3P3PA 3WDWA 4CU6A 4OUSA 3W58A 1UZVA 1YHFA 3WV6A 2WQ8A 1SHWB 2RDNA 1ZZ8A 3RVHA 1QJX2 4R9DA 1JZ3A 4GAZA 4GZ9A 2Y34A 3LSEA 1N3QA 1UWWA 1ZRIA 2B39A 2R042 3JXSA 4QB2A 4RHV1 3GGLA 1COV2 5I0UA 1UU6A 2AH2A 1VBB3 1PO13 3RJRA 1LGBA 1JH5A 4M0NA 2ZAAA 4KGGA 3VHRA 4UAPA 5C33A 3O1PA 1HJGA 1GLHA 1XNKA 4BMBA 3KCCA 3AZZA 3ZXAC 3E5QA 5FXVA 1K5MA 3RMXA 1S2EA 2ZS6B 1RUH3 1ZZ7A 1C4RA 4GH4A 4QQLA 3IMMA 4BWOA 5K9YA 3UL2A 3VDDA 4IE6A 3DGTA 1D2QA 4AK3A 2UY8A 1DU3D 4YGEA 4CDWB 4RYDA 1I5PA 4P08A 3H8OA 2E9QA 2YBPA 1C57A 3ENRA 2UY9A 4XHXA 3WQBA 4D6SA 3IDAA 4PIZA 5T55A 5JZGA 5LBBA 4BM8A 3V0BA 3RG0A 1QF3A 3WSOA 4XCAA 1AR73 5IAVA 3VBFB 3VBSA 4MADA 3MI8A 4QPGB 3ZX7A 1SDDB 4LO7A 3NJVA 1QMJA 3FBMA 4Q1RA 5KHJA 1MVQA 3WNPA 1EP0A 1HV0A 4GB31 4D6QA 5K7PA 2WWSA 3PIJA 2VVEA 1XBFA 3SCGA 5L9RA 5K0UB 5A7NA 3VD4A 2VOVA 5L7OB 1W6PB 4SLIA 1EPWA 4AOCA 3MLKA 2BTVC 1ULGA 4UW6A 5M0TA 2YC4A 3NO8A 1D4M2 1QJU2 4I0WB 1Z7S1 3DCQA 3N9MA 3N7MA 3MO4A 1DYOA 1LCLA 3CJIC 4Q4W2 5BNNB 1OI6A 1X9PA 4Q0PA 3NAPC 4LA2A 1W6OB 5CBLA 2VZ3A 4FPFA 4HKOA 3X29B 4YGDA 1DP0A 2BDRA 2QQOA 1NOVA 3GZAA 3R4UA 3S30A 3ZXDA 4E4HA 1Y9QA 1RUI3 3IDEA 1CVNA 4N9HA 1XOYA 3WP3A 4FFGA 2V5DA 1W39A 4JGZC 4K7JA 1UIJA 3I2KA 5CIRA 5KC6A 4Y22B 4CDWA 3NV4A 2CGNA 2VW2A 3IM0A 4HK8A 5JXIA 1JYWA 4AFMA 1JHNA 2DU1A 4QGNA 1JHJA 1JU3A 2EAAA 2YGLA 2J1AA 4RFRB 5FZFA 1E5HA 5DZFA 1AR61 2W68A 3VBFA 2E33A 2F6BA 3LD8A 2BW8A 1YC61 2WSUA 2BOIA 2EA7A 3PVEA 4ES9A 1BK1A 3THTA 4OI2A 4CUCA 3ON7A 5F5AA 1H2MA 1T6GC 2BZDA 4OFGA 1ND3C 3J7LA 1SCSA 3RZGA 4QPWA 3ZFEC 3ACLA 2BVBA 5K0UA 4AEKA 1GV9A 1QJX3 2B4KA 4M4RA 1W6PA 2HWD1 2CL2A 4NOTA 5A7WB 3W59A 4FQ4A 5L7OA 1WUVA 2QQMA 4MLOA 5H9QA 1ZBE2 5FXXA 4D3WA 1G9BA 3PUIA 2A3YA 1V9U2 3LA3A 1D0GA 2D6NA 3N35A 1K12A 4Y20B 5BNNA 2LROA 1GWKA 4AGVA 3WVJA 4AG4A 4BA6A 1B35A 2Q1FA 1Q3EA 2QJVA 4DY3A 1HIXA 1OURA 3P1IA 3AZVA 4HETA 2CAUA 4DXZA 1DGWX 3WF1A 2DWRA 1AYN2 1BHGA 5F6KA 5E16A 1W8OA 4M01A 2ZABA 4BB3A 2BGOA 1STMA 3VBUB 2P17A 3ILRA 1JZ7A 5FYZA 1UW8A 4JV4A 2TEPA 3SHRA 1ULPA 2WT2A 4IGQA 4LK7A 1QDOA 4QMAA 1GP6A 2E32A 3AKQA 3O5SA 4BQ5A 4EN9B 3KT1A 5F6LB 1ODMA 4R4ZA 4QDRA 4LBOA 1RMU2 5FWEA 3RI8A 3ZSJA 4WZFA 2PHXA 3H3LA 2XJVA 3MICA 2JG8C 4META 4FAGA 1A8MA 2OA2A 5JPNB 4XUTA 2XVGA 3OD0A 1HKDA 4A7ZA 1WCUA 2DCJA 1A3KA 1U5YA 3EB7A 5D8AC 1RHI2 5FZMA 1H9WA 2FCTA 4MHRA 4AYUA 4F8AA 5A7WA 4QPIA 4PLNA 3WDXA 2BBVA 1QJU3 2TUNA 3KVBA 5IJRA 1FNYA 1W8HA 1OQEA 1TZOA 3MIHA 1Q8SA 4E4ZA 2P6HA 3S7IA 4CCOA 3WG4A 4IEWA 3PUHA 1VIWB 3C7EA 3OUHA 5FZOB 2FZ2A 1UL9A 1I3HA 5FPXA 3SKVA 5FZAA 4FOYA 3FC0A 3LOIA 4IL7A 4YLZA 4Q4V1 1LR5A 3BOWA 4RQPC 2C4XA 2B9UA 3CBNA 5FY0A 4QDQA 5FO7B 5BPXA 2YU1A 3IIAA 2QZ3A 2BERA 3VBUA 2GMPA 1H4GA 2JWPA 4FBFA 1OLME 1WW4A 1J1LA 2WNVC 2CAVA 2KD7A 4INDA 2R32A 1YXWA 4TLGA 4IV1B 1NCQC 2DF7A 3HIFA 1VBE3 4XXPA 2VQAA 4O65A 4AAPA 4CEWC 5GM0A 1G8WA 2G1MA 3EXUA 1N1SA 4QWNA 4UW3A 4CPBD 4FQZA 2VY0A 2JDZA 4LNVA 3ZIXA 3AXDA 1PGW1 3WDUA 4TZDA 1DQ0A 3IMNA 4LMFA 1CPNA 1ZBE3 3ELNA 3BKZA 2FDIA 3E97A 5T54A 3UJOA 4OVEA 3RGBA 1V9U3 5T50A 2WZR2 4QB1A 2H0VA 1CAUA 4XFFA 3TRSB 4LKFA 1DQ6A 4CP1A 4YW2A 4HG6B 1TME2 1N3OA 1QJY2 2WT1A 3KF3A 2D40A 1F2NA 2XJPA 4QX7A 5FZOA 4A4AA 1WKYA 1YFYA 3ETPA 3U75A 2A6YA 4ZXKA 2BYVE 1AYN3 1RJ8A 1I6XA 3UETA 3H3ZA 3ZDVA 2E51A 3WNLA 4B1LA 4NIGA 3SH3A 5HCHA 4PBPA 1ENXA 3BPZA 3OGJA 1WA6X 5FUIA 1VB4A 2PAMA 1FPN3 1RUD1 1PO21 2PHDA 3H42B 3KS7A 4RHV2 5FKCA 1HQNA 2W47A 1K45A 1MZ6A 1PVXA 2VOXA 1YUDA 1RMU3 3U07A 2VUDA 4D0QA 1VBC3 3DKWA 1NZCA 1S55A 2HYKA 4QX5A 3NVCA 1UY2A 4BXSV 4DFSA 5DAVA 5CEHA 1UZZA 4W50A 1O6UA 1QH6A 4YW1A 4AW7A 3FFQA 2ZKLA 5GALA 1W8FA 2ZJCA 5A6YA 3RRDA 1JS9A 1RHI3 5DUXA 3CL1A 1RUC2 4P5YA 1CESA 2FCUA 1BVP1 4XF9A 2Q8DA 4HSJA 2G9GA 3CZUA 2G9ZA 4YRDA 1GUIA 2D6OX 1W99A 2D3SA 5CFDA 2XUEA 4BE3A 4A2UA 1KJRA 2P5BA 2QQUA 4Q0UA 3ZYGA 4B4PA 3K75B 1PX3A 4XFAA 3I54A 1A8DA 5FRAA 2ZX3A 3I2FA 4MGZE 3I3EA 5FP9A 1C8M1 1IQDC 3AB0A 3KV9A 2J1EA 5DG2A 1VAKA 2KA3A 4GIQA 4OMDA 2VZPA 2WNEA 2VW1A 3MBWA 4AQSA 2YPJA 2GC0A 3IPVB 1A78A 4LLFA 4MVTA 5A7QA 4CDUB 2VO5A 3A23A 4GB32 4CVUA 4CDWC 1OSGA 4AWDA 5F8PA 4HOOA 2ZMNA 4CCMA 2W95A 2HJIA 3Q8AA 4ZONA 4AQTA 5IVYA 3TN93 3I4IA 1VBB1 2H0BA 3VBFC 3MLLA 2L9LA 1VRH1 1H1IA 1Z7S2 1D7PM 1NKGA 2LS6A 1C1FA 1IS5A 4IV3C 4QPGC 1PZ9A 3AX4A 3THCA 3ZSKA 4CA9A 3EJKA 3I2JA 3ZXJA 4EZHA 3QD6A 4ZU7A 3LSDA 4IEVA 5L73A 1RUH1 4HSLA 2GC3A 1JUIA 1MS1A 2EF6A 1POV3 2MEV1 3J8F1 4MGSA 1IS3A 3BTXA 5T5PA 2CGOA 2Z69A 1G7YA 1GQPA 3B9IA 2JE7A 2WIIB 4NE9A 4PIYA 4COUA 4Z2WA 5F3CA 3TEYA 3OBTA 2WZR3 1DZTA 3EBRA 5C9AB 1QXPA 1AXZA 4K21A 2WUHA 4QT6A 1AR71 3V56A 1CZSA 1I9RA 2BP6A 1JZ5A 4ZXEA 1TME3 1O8PA 2A3XA 3Q8FA 3I7DA 5FAXA 1AR62 1XYOA 1GNHA 1Q8OA 4NHXA 2XLFA 4BQ2A 4LT5A 3VBHA 4CP2A 3A7QA 5IVVA 1EY2A 5IK4A 3GHMA 3IPVA 4JTNA 4CDUA 5FZLA 1LHVA 5GLUA 4QU1A 4CDQB 4D7SA 4F83A 5IFPA 2VECA 2HLEA 5FK7A 5GJ6A 2XGXA 4XDOA 1AJOA 1T6BX 4QX8A 2HWD2 4X6QB 4IQPA 4XFIA 4GWMA 5FYCA 1CPMA 3ZSMA 1ND2B 5FUPA 2WO2A 4CUGA 2R16A 5C8WA 4IDZA 5DUWA 3W5NA 4TSVA 1QHDA 1F4HA 2D6MA 3PNAA 4ATFA 3HAGA 1VMFA 3WW4A 4NAOA 4OCTA 3GF6A 4U36A 4XQ4A 3KCYA 1RGSA 3LEGA 1VBD3 5JPMB 1RUC3 1RJ7A 4C1XA 4HLTA 3M1HA 3ZSEA 3NNLA 1H2NA 2E53A 4B7EA 3KWVA 4QHBA 1O5UA 5FPUA 3T3YA 3ACFA 3S7EA 4RL7A 3POJA 3B69A 4UFIA 4YZ5A 3MF6A 1IG3A 5C3RA 1G9CA 4X8PA 4P9YA 5FK8A 1IG0A 3AJZA 4MZUA 5HPOA 1POQA 4GB33 1NCRB 2XHNA 4XDPA 4AI8A 4CDQA 2X5IA 3G7DA 1CAWB 1CZTA 1S0CA 1DGRA 1S0DA 1YEWA 1XC6A 1OQ1A 1AZDA 4PBOA 2H6BA 2EAKA 3ZMOA 1ND2A 1CAXA 2DCTA 1SLIA 3PMEA 3K4DA 3LFMA 1LOFC 3A4UA 4AI9A 2WR9A 5EYYA 3CJXA 2R061 5EZWA 1RUG1 2C6SA 3IKWA 4K1YA 2FDJA 1YIPA 5C3OA 3ZN6A 4QX1A 3O1VA 1PGL2 4FO9A 3SITA 2GNDA 2R30A 4BCUA 3NSTA 4E9KA 1VMHA 3ZXLA 1LHNA 4YWAA 2J1VA 2QQLA 5DDJ3 3TOJA 5JUVA 1JZ4A 2C1FA 1D4VB 2VXJA 3HOBA 4QDSA 1R1A3 1Q8VA 3ZN5A 4DZGA 5DZGA 3WUDA 4NRPA 3FLPA 4A45A 1RXFA 3CJIB 3TNPB 2QQPA 2ZEYA 4AHWA 1NLQA 3NAPB 1J83A 4E4SA 3KHCA 2DCYA 3N4MA 1BJQA 1XQNA 1WCDJ 4LKDA 2GC2A 1YFXA 4AL9A 4WZCA 4V2WA 1PGW2 5GZEA 2V72A 4JGZB 1CAWA 2TNFA 4CXXA 5FZEA 2HWD3 3NJXA 4A7YA 3LDKA 3VN4A 4ET7A 4JHZA 3MF9A 1UPIA 3WQ7A 3LQCA 4IV1C 1ZRFA 2XOMA 3MLJA 5FMBA 1UAIA 1W9WA 1H1AA 1CAVB 1SPPB 4HONA 4P9WA 4Q0SA 1EPZA 2CV6A 3CU7A 2EIEA 4QXKA 4NPMA 2XWJB 4OUEA 2ZZQA 4L92A 2W46A 2Y26A 2WA3A 3C7OA 1ZNPA 3K46A 1ND3B 2E31A 1JYNA 2FD8A 3ZFEB 2R0HA 3Q8CA 3POYA 1U5ZA 3I8TA 1O91A 2K9ZA 5IUQA 4Y1UA 4RS5C 4WVVA 1SBFA 5CG8A 5KWRA 4YW4A 1GSLA 1M4WA 1HJFA 1RUD2 1VBE1 2VJXA 4R4XA 5A3UA 3CJIA 4UI9L 1PO22 5LY1A 4XUPA 5JAXA 1ULFA 3NAPA 3QH7A 4Z92B 4V2VA 5DAXA 5JI7A 3DV8A 3ZM8A 2DUPA 2BWAA 4XABA 2VZUA 1X9TA 2VVFA 2WS91 1JYXA 2AYHA 4WM8B 3WCRA 1MR5A 4Q4X1 1MS9A 5FYHA 4Y5Z0 4FXKB 4JGZA 1F15A 2F4LA 2GC1A 1W8WA 3J9SA 3IBMA 2FBEA 1MZ5A 2R0FA 2YXSA 3MUY1 1CAVA 1SPPA 3K48A 1KDMA 1VRBA 3A0KA 3ZYRA 1DQ1A 3NNJA 3KVAA 4GMP0 2WL1A 1C8M2 1CIYA 4XC9A 2GDFA 1APNA 3AFGA 4FPOB 3HR9A 4R52A 4LUKA 1ND3A 3D8CA 3QH6A 3HQXA 5G05L 1W6MB 3ZFEA 2JIGA 2RDQA 1J84A 3OBZA 4OHWA 4MXWB 4DEQA 5F2WA 3OG2A 1JMUB 3GNEA 4ONUA 4EZ4A 4PLOA 1FPN1 3POIA 1WCKA 2W2IA 2VMCA 3LPGA 3WG2A 5K8SA 4I0BA 1ZA4A 3VKLA 3RZJA 3BIWE 1L7LA 4U2AA 1VBB2 3H7YA 4XZUG 3URFA 5FREA 4JC1A 1AR82 1ZZ6A 1VBC1 4UOJA 1VRH2 3AC0A 5FZ6A 1H0BA 1H8VA 1SFNA 2OPWA 4IE4A 2VZTA 3U0ZA 4QKFA 3KHBA 4FCAA 1J3QA 3S5QA 3USSA 1NY71 2D97A 4DUXA 3QBQA 1EAH3 2DVFA 3PIGA 1RUH2 3T2QA 4RQPB 4ARYA 1OOPB 2VUCA 4HK9A 1HQWA 2MEV2 2ZGKA 3J8F2 3LEKA 4H7MA 3JQWA 3OGRA 3ZPYA 3MIEA 2YUEA 2NLRA 1XU2A 2KXLA 2VH9A 2VXRA 5EFUA 2O0OA 1O5LA 4M0HA 1LKNA 2WNVB 5IHRA 2C9KA 3I59A 3BUCA 3V65A 2NM1A 2ZHMA 3ABZA 3MGUA 2DCKA 1NX9A 1AR72 2I74A 2ZX4A 4DUWA 1NCQB 4ITCA 2DUQA 1QXRA 1UZYA 1XJAA 4K8FA 3RJ2X 4OHZA 4UBGA 3FMGA 2AEZA 2JG8A 1PIV2 3Q9OA 4AQ6A 5LA1A 1W6MA 1GWMA 1L7RA 2WO3A 4MXWA 1UF2C 4YVWC 3T09A 3WZ1A 5LK5A 4A3ZA 2VBDA 2JX9A 3TN91 1PVC1 2IZWA 5C9AC 4H7LA 4N90A 3LIHA 5IVEA 5ABJC 2BV4A 4YFZA 1WGPA 5JDBA 2XG3A 3CKHA 5FMCA 4I3GA 1LB2A 4LK6A 3POGA 1GBGA 3POWA 1DF0A 3AP5A 4AHZA 2QQJA 4CU9A 4AHYA 5JOZA 4CCKA 3M7AA 5FO9B 4JQRA 1POV1 3ORJA 3SC7X 1W6NB 1C1LA 4RQPA 3ZR5A 3IDCB 3R6SA 3B5LB 5FZ9A 1OOPA 4BQYA 3IZOA 5F3EA 2YC2A 1QKQA 1ZYBA 2XLGA 1AUYA 2BVVA 3AMHA 1GP4A 4M4PA 5CKQA 5IW0A 4ZZ8A 3GDBA 2VW0A 4XFHA 5C3SA 3WD5A 3GZUC 5FPBA 2GP3A 5A70A 3NKTA 4YZ4A 2OIIA 4EJRA 5LWBA 2WNVA 2HBUA 3VZJA 3TEWA 4TWTA 2MNGA 3AP7A 3WXPA 1SMVA 4YZ1A 1NCQA 4RGAA 1F9KA 4LHNA 1AYM3 1VPHA 1C8M3 4YM3A 3VKOA 4CEWA 5CAZA 3BYWA 5EJ3A 1F5FA 1Y9MA 2Z2SB 3N9NA 4FPYA 4R9BA 5CKMA 4FXGB 1QGLA 5DUVA 4AZZA 5FLHA 4ES8A 4I0AA 1DGRN 2W1SA 2C5DA 5GKAC 4YFWA 2BJSA 2QQNA 3E1F1 4P00B 3TAYA 5JR7B 5C8CB 2GMEA 4BISA 2XHKA 4IEOA 4QU2A 5CYYA 1AR83 5ACA3 1VRH3 4LBKA 4CCJA 4NIAA 1HB1A 4K40A 2PHWA 1FATA 1SZBA 1LEMA 2R062 3LEMA 3TBDA 1EV13 1RUG2 3Q8EA 1OC1A 1NCRC 5F9TA 4GA9A 1VBD1 2YBSA 1RUC1 1FI2A 2VQ0A 4JKMA 3HN1A 4AEJA 1S0JA 5KR7A 1DZRA 2E7TA 4AVBA 1LOCA 2C26A 2VQTA 2MEV3 3J8F3 2NMOA 4IE7A 3ILNA 5FR3A 3VBOC 1RYYA 1H4HA 3VZNA 1DZQA 1G9AA 3BU0A 4N53B 3LDRA 3ST7A 1S0FA 1X36A 1LNSA 2A6ZA 2DUOA 4UT5A 1O7FA 1CJDA 4YGCA 4R8HA 3L2YA 3M3QA 2Q8EA 4AVAA 4C0BA 4EN8B 4ASMB 4IV3B 2ZAHA 4Y1XA 3USUA 4A6SA 3N9QA 4G4FA 1C5HA 1AL23 1PIV3 2DURA 1MS8A 3D3AA 4OQ8A 3KZ4C 1QJFA 3D82A 4MGIE 3BOPA 1Q43A 2LUWA 3WINE 1S0BA 1MS4A 1OA3A 1E57A 4LHKA 3PURA 5FZDA 3MV01 2OQ6A 1MQTB 1ZZ9A 3I2HA 4XFCA 4BXFA 1D0HA 4XF0A 4Y33A 5T5OA 1E5RA 1T2XA 5LK7B 3NW4A 2VMIA 3AYAA 1UKGA 4OUMA 3JB8A 1XSQA 4LPLA 3ZIWA 4PT6A 5FIXA 4GD4A 2ZXQA 3QACA 1M06G 4H3WA 3ALQA 5B4NA 2IVJA 4W4ZA 4NHKA 3POFA 5AVAA 2RHPA 2IXIA 5DDJ1 1WLCA 3I2GA 1V6MA 5FZ4A 5C4WB 1NXMA 1UPSA 5E88A 4CEYC 1R1A1 5DMYA 2G9FA 2WZPP 2EIDA 5HBAA 2VNVA 4QD2A 1PNGA 2W94A 1TNRA 5J1XA 1O3RA 4ZS2A 3EMRA 5JWPA 2JKBA 1WW5A 1VBE2 2QE3A 4FPEA 4IV3A 4QPGA 2OPKA 3AFKA 3HMYA 1JOPA 4K1ZA 1OFSA 2CNAA 2OVUA 4PF5A 5LCWL 3VD9A 3VDBA 4URAA 2P2KA 3S57A 2Y64A 3WT3A 4FOQA 3ZFFC 4BQXA 3C7GA 2WINB 5BV6A 2B7YA 2WS92 4B8EA 1MS3A 4LJHA 2ENRA 4Q4X2 5CISA 3O1UA 2D6PA 1JOBA 1UN1A 5J98B 5LA9A 2WWUA 4Q8KA 3WNMA 1V6IA 3HNMA 2YBKA 1RUOA 5F7UA 1Y7BA 5CVRA 1G9DA 4Y5TA 1C28A 1W6OA 1JXNA 1WLDA 3JBG1 1JW6A 2NMNA 4QX3A 4BPZA 1WBFA 2R063 2XKPA 1B09A 5LRSA 1RUG3 4AF9A 3O1TA 4UFJA 2RS51 1CD3G 2FCVA 4WM8C 1WWYA 2Q30A 1IZ3A 3WQ1A 1L3JA 5C5TA 1FYUA 3M3CA 3JUUA 1Z0HA 4UF0B 4BQWA 4Y22A 3PUQA 1REDA 3T0AA 1BK0A 1ULCA 4NAMA 4J25A 1UZWA 3B7MA 4LOSA 4AGGA 5FWJA 4DRVA 5J3UA 1W9SA 2XL7A 3LFIA 1FPN2 4X8NA 2ADDA 5FY7A 1V70A 1PM4A 2WLPA 3J26N 2QDRA 4S2FA 1UIKA 1E5IA 1QY4A 1OMIA 1JODA 1VBC2 3WF0A 4BK5A 1OF3A 4OZOA 2VR4A 3B01A 4MYEA 5TSWA 2XR4A 4XBLA 4DPNA 5AFBA 5HI0A 3GXUA 1NY72 3OF1A 3P6BA 2P3IA 1TE1B 4A6OA 2W08A 4C0HA 4Q0QA 2VMEA 5L19A 3POBA 3I3QA 3OYWB 1KFUL 1XSRA 1IPKA 2ZGQA 3PVBB 1JZ8A 2ERFA 2R49A 3OTFA 3I2IA 4PDWC 1UY3A 5EPAA 4A41A 3WP4A 3WCSA 1GOHA 2AREA 2WRAA 3HN3A 2RS13 4PIXA 2ATFA 2JXAA 3I49A 2W1UA 3N7JA 4Y20A 2TBVA 4LE3A 2JEMA 3INAA 5KHGA 2D5HA 4CE8A 4AEDC 2WJSA 1PGL1 3FWEA 4I09A 1RUJ3 3ZYBA 1PMHX 2LALA 5FZ0A 1UZ0A 4MGQA 1DCSA 1FNZA 3GHNA 3HEIA 2B5HA 2WQZC 2XB6C 5A1AA 2IXHA 1OOPC 4G9SB 4CP9B 3ZYIB 4DNYA 5H9SA 3FHIB 3W20A 1UYXA 4UF0A 2C24A 2NZ9A 5FY1A 1YQ5A 1OA4A 1CONA 3UV9A 2GSYA 3T0BA 4AGRA 5AFEA 3TN92 5L7OC 4CDXC 1PVC2 1OH4A 3O1RA 4OYUA 4LBQD 1LOFA 2GNTA 4HVOA 1RIRA 3N9LA 4QKBA 2ZGTA 2GAUA 1SCRA 3U78A 1DQ4A 5GZGA 4D8MA 4WBBA 4ZHNA 1EAH1 2R1BA 2WA4A 3TWIA 2V73A 2EXIA 4IE5A 3MHZA 4P9LA 1G86A 2WS93 3SISA 1K5JA 3BPSA 3FLTA 4WVWA 4F7ZA 1S2BA 4Q4X3 2D6KA 1VR3A 5F2SA 4BIOA 3CQOA 5FQ0B 3BTYA 1YLLA 2D3RA 2IXKA 3ZDSA 3KLSA 2R071 2DVDA 2CDOA 2PFWA 4RS5B 3ATGA 5C70A 1ZRDA 2AACA 4PJYA 1X8EA 3IDBB 3ZFGB 1C8NA 3E6BA 3ACGA 1LOBA 1MZEA 3LZZA 4MSVA 1VMJA 1YI9A 4GWNA 5B4XA 3M3IA 2W5FA 5JI9A 4CXYA 3ZN4A 3PLQA 3T2PA 2C0ZA 1GOGA 2PQSA 4W6WA 4KGQA 1U0AA 4LO4B 4YW5A 1NQDA 3SCHA 2WKKA 3KV4A 2VZ1A 4KBBA 2BNOA 1H9PA 3IB3A 4B3NA 2JDMA 4XUQA 3FUQA 3VZOA 3BTAA 5LA2A 1DQ2A 2OW4A 2VBBA 4YM0A 5BNOC 2R6QA 4Y3OA 1LU2A 4IV1A 4LBJA 1R083 2VAUA 3KCXA 3LF7A 5IWFA 1SACA 1UX7A 4WV8A 2WC2A 4OMCA 3OEAA 1ZVFA 1LENA 4XJWA 2DVBA 3TYJA 1GNZA 1N1TA 1YCIA 3PTYA 3VD5A 1XNAA 2Y6FA 1VBD2 4RA0A 3U37A 2WO7A 1Q56A 4AVSA 1OF4A 5F37A 2DDUA 2HWF1 2VZQA 1VB2A 4MUVA 4CSWA 2DFCA 2NQYA 3F2ZA 2OYZA 5C8CC 2HWC1 1LHWA 1O8SA 3IN9A 3T30A 5FQ0A 1YWKA 3CDZB 3AXEA 2ORXA 2Q1ZB 2XUMA 4CU7A 1PZ8A 1VLNA 3J7MA 4RS5A 3ZVXA 1A34A 4WM7C 2JDHA 4CUBA 1RVF1 2VQUA 1AYM1 1PMIA 3D0SA 2ARXA 1AVBA 4QHOA 2K46A 2RDRA 4LHSA 1KS5A 4QQOA 4LKEA 3OGGA 1XNBA 2QVSB 1S0EA 1W2AX 2VUJA 3TNQA 3U11A 4JZRA 4NIHA 1BCXA 4D7YA 4AQ2A 4OQ9A 1X33A 1OFNA 2QCSB 3JD73 1BBT1 3LGRA 2JG9C 2YG0A 5A3OA 5LBEA 2JD9A 4N53C 5HXMA 3ZMNA 4Y1VA 1W8UA 2ILMA 1PVC3 1XXNA 1UXZA 5ACA1
chains in the Genus database with same CATH topology
2VMHA 4XF3A 4AXOA 4OI0A 3EO6A 1J3PA 5LEKA 3VL8A 1EV11 1LEDA 1HDKA 4XTPA 2BGCA 2EXHA 3FBYA 1HRV1 5EXOA 4JDMA 3RPQA 2PLV1 2GN3A 2PHUA 3H8UA 4NPRA 4XJAA 4LO6B 4IEXA 5DDJ2 1MEC1 3JCIA 1QOTA 4YVWB 1MQTC 2DCZA 1TNFA 3N36A 2MPFA 4FPJA 3POSA 2D44A 1R1A2 1OLQA 5FPZA 2VNGA 4KWJA 1CQ9A 2ZGRA 5ABJB 5BY5A 2XBO3 3LAGA 1QQP1 4FP2A 1AL21 1C3HA 4H55A 2SLIA 4XF1A 1PIV1 3VKMA 5A3MA 2G4IA 2QKDA 1Y43B 1ZZCA 4JVAA 5DXDA 3WW3A 5C4WC 1WD3A 5KXDA 4XF4A 4LE4A 1IKPA 4M3CB 5L36A 4YSFA 4BZ4A 4RR3C 2JENA 3ZXFA 3I2DA 3KGZA 1ENRA 3KSCA 4J1XA 4GMP3 1AX0A 3AMMA 2EXJA 1V6LA 3GBGA 2RMU1 1FMD3 4XZPA 3D0JA 5HCBA 2GZWA 3JBG2 2XL9A 4A7KA 2XVKA 5GLZA 1JTZX 2RS52 2CTVA 1WA4A 3SNMA 2E6VA 1HXS3 4W6XA 4YVWA 4E2QA 2B45X 3W9AA 3JZVA 5C9AA 1ENQA 4RSUA 4JTOA 4XIKA 4AE2A 4QM9A 5ABJA 5JSPA 1MVEA 1RINA 1S2KA 2QFEA 4EN6B 5EV7A 1MS5A 2D5FA 4MH0E 3NJZA 3OY8B 1RUE3 4MGYE 1J1TA 4M3CA 1ZBA1 3L2HA 3VBOB 1QDCA 5JOXA 4S2GA 4XHBA 4L8QA 2N7GA 3QCWA 1WD4A 1NG0A 2VULA 4URTA 3V0AB 4BOWA 2QNKA 1OPMA 5FDBA 4LBMA 1YJLA 2JJ6A 2WSVA 4NHMA 4YG3A 2I45A 3MIDA 4HN0A 5GZFA 1AR91 1PGSA 4LLOA 3UJQA 3ECQA 3VHPA 1DQ5A 5J7MA 5C6CA 1AF9A 4FPLA 4H14A 2YROA 2RJKA 2K2SA 1NXD1 3UKVA 1FXZA 3OD4A 1BZWA 1R093 2WFF1 4MX3A 5I8SA 4FPGA 4XXAA 2UU8A 2ZGLA 3BU7A 5HXVA 4N43B 3EHKA 3OY8A 2VUAA 3JU9A 4NHLA 5CG9A 1EAH2 1NCRA 3M70A 1IKQA 1G6NA 1X82A 3VZKA 2RM23 5LEJA 1S0GA 2D98A 3SMHA 4LO5B 4CEYB 4C90A 2K0GA 2RS11 1WLTA 1RITA 2MHFA 3VBOA 1QNYA 1LODA 1LESA 3VHNA 1N1YA 3LOBA 2R072 5JOWA 4FTBA 1GICA 3MFAA 4Z82A 1DDLA 5IK7A 1RUJ1 3V0AA 3JBG3 3H3UA 2EVXA 2CYFA 2RS53 4NN0A 1H30A 4RFT0 3ZFFB 1NYWA 1W0OA 2ET7A 5GLVA 1BXHA 2AR6A 2XJTA 2PHLA 1ENSA 3MDPA 5IT6A 5J09A 4IEZA 2HEVF 4XOGA 4QGLA 3ZFGC 1LGCA 1KS4A 3VZLA 4OULA 1VBA1 4AVVA 2RS33 3UK9A 4WVMB 4XDQA 1GANA 2W39A 4XETA 1HX6A 2PHTA 5FOBB 4N43A 3DPRC 5JLVA 2PAEA 3WY6A 4I3PA 3SCFA 2Q1MA 3H50A 5AVPA 4FPKA 3GZTB 1IS4A 1NLSA 3A0NA 3C2UA 1OPOA 4XTMA 4BYYA 4X6RB 3GYDA 1G9DA 1GYKA 1O3SA 2HWF2 3RI9A 1NA1C 4CEYA 3MZHA 1IHMA 1UU5A 3SLIA 3H7JA 2HWC2 2ZMLA 3AKPA 1AJKA 2D7FA 1ASJ1 1IGOA 3RZZA 5GLTA 3ZXEA 1RVF2 1I5ZA 1AYM2 4ZU5A 3ZO0B 3VUOA 3VZMA 2LTNA 3H1YA 2D6LX 1KQRA 2PYTA 3AP4A 3ZFFA 3DN7A 4COVA 3RSJA 2QZ2A 1QNWA 1H2KA 3WR0A 4PCRA 1BBT2 2NN8A 3FZ3A 4PDWB 4OHYA 1R081 3O0XA 1GQHA 2IWGB 5ACA2 2HWE1 4FPCA 4XILA 1WCSA 2YHJA 4WVMA 4K9SA 4PLMA 3CLPA 3ZXKA 4AEDB 1EV12 3KQRA 4FOWA 3PHMA 2BNNA 4XMAA 1HRV2 4WM8A 5BYNA 2PLV2 5KBFA 4CZSA 4D69A 2WFPA 1Z78A 4Y1YA 3AZXA 1MEC2 1DYKA 3H1MA 2R073 3LKJA 3PVOA 4CDXB 4YVSC 3OCPA 4FAHA 5I93A 5BXXA 3HWJA 1HQLA 1QQP2 3E6CC 1NE6A 4BLIA 3J4UH 5KXCA 1AL22 3QLQA 4OZXA 5FLJA 2PQQA 3JD71 4E2GA 3ZSLA 3AM2A 2P34A 1WMEA 4COZA 1IPJA 4Y24A 2C9AA 4COYA 2NPIA 1R1ZA 4L9BA 4XBQA 2OZJA 4J6GA 2HEYF 4PDWA 5CB7A 1N1VA 1FOD1 2ZTNA 2XPJA 3ASIA 3O0VA 1KJLA 2CWMA 4ISRA 1JYCA 1JBCA 1X8MA 1YFWA 5F1RA 2RMU2 1JYIA 1UU4A 1F8VA 4AEDA 1BEV2 2ZA9A 2EXKA 2DU0A 5AC91 2GU9A 4IETA 1UKRA 4GKYA 4JAAA 1C5IA 2HWF3 2RR13 3MIBA 3PMSA 4I01A 3C3VA 2HWC3 4P9IA 3WHUA 2XBO1 4Q26A 3OPZA 4CDXA 5BNOB 1DLLA 1XYNA 3HT2A 2GH8A 4EN7B 4SBVA 1O4ZA 1RVF3 3AMNA 4GALA 5EYXA 4IEUA 4JGYB 3VDDB 2A7AA 1IOAA 3AK0A 1REFA 3RYRA 4B4RA 1GR3A 4MXVA 1NLRA 3KGLA 5J36A 1RB8G 1MS0A 5KHKA 1BBT3 4P9JA 3FUOA 5JZGB 4DINB 3WP5A 4GMP1 1ZBA2 1Q5OA 3WOGA 4AFAA 1FMD1 5DUUA 3L9JT 1PK6C 1X7NA 4WM7B 2ZPXA 1REEA 2ET1A 3OJBA 3U10A 3QOPA 2UYBA 4UBHA 1HRV3 1W6NA 1DGWA 3FLRA 1TQ5A 4ATEA 2PLV3 4LHLA 4NWWA 5FCCA 1BYHA 1AR92 1DBNA 1HXS1 4FT8A 4GQ7A 1HRI1 1MEC3 4M00A 4XEZA 3WQ0A 2JG9B 1YRZA 4IEYA 4C91A 4YW3A 3VBRC 1H8TC 4BMEA 3FE5A 5BNOA 4XQWA 2IXLA 3WW1A 2Q8OA 3LWCA 2WFF2 5CA6A 1QQP3 2IXCA 1AX1A 4KWLA 1RUE1 2VU9A 4JGYA 4QQHA 2CWSA 4AEMA 3B02A 4FPHA 2ZOEB 5FFOC 1U12A 4EV0A 3MW3A 2PELA 3ES4A 4JDNA 5C8CA 5GZDA 3WDVA 2RS12 4WM7A 5B2GB 1U5IA 1YYNA 5CFCC 2RMU3 2JE9A 4N43C 4QM8A 3RDIA 2ES3A 1BEV3 1RUJ2 4AFBA 1LGNA 4EROA 3R0RA 4KQ7A 4LUMA 3VHOA 4Y4YA 2WLQA 1YIFA 2AGSA 2W52A 2AUYA 1LJ7A 4OLLA 1IQAA 3NV2A 2JG9A 2VG9A 1R091 2ZX2A 3MW2A 2P3KA 4KNCA 2VNOA 4N53A 2D3PA 4RR3B 2YMZA 1RC6A 2ZGSA 1BQPA 5BNPB 1B35B 1QOSA 1LECA 3CEWA 1VBA2 3WUCA 1ZZBA 1SBEA 1ZRCA 4Q29A 2FZ1A 4XJ9A 2RM21 3CO2A 4A3XA 3WP6A 2A5ZA 3B3QE 1W2UA 1LU1A 1CN1A 3VL9A 3WW2A 4V1PA 3KT4A 4Q2FA 2ZGOA 1MQTA 1DHKB 4HMZA 1ZBA3 2HWB1 3S7IA 2WNUC 3NL1A 4N9IA 2XJSA 2FHRA 2XJQA 2GN7A 1YNAA 1WW7A 3FFZA 4Z07A 3AMPA 5JMCA 3N3HA 3JQXA 1ASJ2 5FMOS 2JICA 3KMHA 4AFCA 2ZCWA 1TEIA 3TB0A 1AR93 4XPVA 4QPIB 5C4WA 2R043 2ZBJA 4LA3A 4W6YA 1COV3 2A75A 3NV3A 2O8OA 2QUOA 2ZX0A 2SBAA 4RR3A 3AYCA 4JRAA 2FQPA 2RS31 4DOUA 5BNPA 1GFF2 1R082 1XE7A 2WFF3 4Z8BA 2YYOA 2HWE2 1UCXA 4K3UA 4COWA 4O9GA 4ZKTB 2RJLA 5H9RA 1OA2A 1I1EA 3AYEA 1BMV1 1DFQA 3KM5A 1W0PA 4DB5A 3D4KA 1WMFA 1SLAA 2ZACA 3CNAA 3UKTA 5KC5A 2CY6A 4Q4Y1 2VGDA 5LRRA 1VP6A 4R9AA 4CTEA 5SV5A 2Z79A 2Z42A 4CRQA 4YNIA 1BKZA 3SXWA 4JRLA 4AI1A 2IFWA 2I07B 1SFYA 3RQ0A 3SH5A 4P5HA 3JD72 1D4M3 3AP6A 3WDTA 2IC1A 4E4DX 4N7UA 4Q4W3 1CAUB 1ZREA 4D7TA 3LB9A 4XE9A 3AYDA 2BWCA 1FOD2 3O14A 1VBA3 1MZFA 1LHUA 2Q5TA 2A3WA 1SBDA 4B7KA 1Q8QA 5E1RA 3H9AA 4FVVA 4L11A 5FO8B 5AC92 1URXA 3OYWA 4YG0A 1A6CA 2X53S 3B94A 3H0OA 1YJKA 1YFUA 2A73B 1LRHA 2A6VA 4HFSA 1F31A 5F5QA 2Z5WA 3DL3A 4J1WA 1XYPA 1ASJ3 2XBO2 3ETQA 3VLBB 4K6BA 1GZWB 2Q4SA 2DTYA 4OHXA 2NYYA 2DTWA 4KL1A 1KXGA 1OHFA 2XVLA 4Y26A 3DPRB 4YM1A 1TMF2 4TLFA 3UKNA 4CYDA 4LBQB 3KT7A 5CFDB 5GZCA 2YC0A 1CIWA 1NA1B 3E5UA 2BUKA 4EN0A 3AKRA 1ZRRA 4LR4A 4GXLA 2HWE3 1FMD2 1K5MC 4KU7A 3PJYA 3RS6A 3T1LA 1V6NA 3ES1A 1AX2A 1DGLA 4GH4C 1UD1A 1HLCA 5KHIA 4JGYC 3VDDC 3VKNA 3VV1A 3JB4C 2BQPA 1OLRA 3AZYA 4HKWA 5T3NA 1RUF1 4EWDA 1W6QB 2RR11 2GNBA 5I0SA 4YZ3A 5J96B 1F5JA 2XLAA 4XJZA 5JZGC 4I2OA 1HXS2 4XYXA 1HRI2 3VBSC 1QOOA 3MIGA 4HT1T 3AMQA 5KXBA 1V6OA 2A70A 3ZFGA 2A6WA 3MEPA 4MGKE 3K51A 4UW4A 1GZWA 4S2DA 1FX5A 5IK8A 2D43A 2XJUA 4I02A 3ZXGA 2YDEA 1DG6A 3R05A 3DPRA 1RUE2 5CNAA 2ZKNA 4YGBA 1OQDA 3RWNA 5D1IA 1DIWA 4XIOA 4LBQA 4LTAA 1NA1A 4OI4A 5FLIA 1FOD3 1N3PA 5J37A 3KD4A 4L2NA 2Y0OA 3HD8B 4YVSB 4E2SA 4B4QA 2O8QA 4LBNA 3VBHB 4TYSA 5JIUA 3ZYJB 1SLTA 3E5XA 4NR1A 4QQPA 2VPVA 3B00A 4IEPA 1PHMA 4F3JA 1GQGA 5AC93 3LA2A 1W6QA 3NKGA 1O3QA 1FT9A 1PO11 2PN5A 2X29A 1R092 4QQ2A 4Z1VA 4P9GA 4XBNA 1KD7A 2R1DA 2VOKA 4LBLA 4B29A 5K0UC 3T2TA 5CADA 4ORFA 1TMF3 1U5XA 1J58A 3E6DA 4ISQA 5A32B 1WMDA 3ZYPA 5L7OC 2PA7A 1QWRA 1AHSA 2RM22 4M3CE 3MFCA 4I30A 4QPYA 5JOYA 2XJRA 5BNNC 1X50A 4IERA 4AVCA 3WHTA 5I0TA 4HKLA 4BQ1A 4XFBA 2QDNA 1B35C 1H2LA 3AZWA 4G3YC 4EWEA 5BNPC 2HWB2 1QJY3 4O9EA 3P3NA 4IEQA 4YVSA 1SQ4A 4EWAA 1BEV1 1S1AA 3SH4A 3PVNA 2BNMA 1WBLA 1GZ9A 2X5IB 1QXJA 2IFRA 3ILFA 3S0MA 1LOGA 4L97A 5EWSA 1CAXB 3DUIA 1HRI3 3MW4A 2NP0A 1KRIA 3V64A 4L99A 2WQ4A 4RHV3 3S6PA 1BVVA 5E89A 1JUHA 2A6XA 2RS32 1PK6B 4Q1PA 3ZN6B 1J3RA 3ROUA 1RUI1 4QGMA 5I91A 4DQAA 3IT8A 3MYXA 3WDYA 3NWKA 5A32A 1NQJA 4QPIC 2FMYA 2I2SA 1XNDA 4OHVA 1BMV2 3WNXA 5FBZA 4AVTA 4HN1A 2UWBA 4UXAA 5I8TA 1NE4A 4AHXA 2DVGA 4KH9A 3M8LA 5J48A 3VBRB 5KHHA 4Q4Y2 1H8TB 4Q27A 3VGIA 3T1MA 5SV8A 3HT1A 1V6JA 1HW5A 3BALA 1QJX1 2EALA 2GNMA 5T52A 3VBUC 3MPBA 2JD4A 1QJZA 3NV1A 2CGPA 2R041 2BPA2 3D5OA 3BB6A 1COV1 4BHPA 2E7QA 1KITA 1SLCA 2VMGA 1Z7S3 1UX6A 4HPKB 4R9CA 1IS6A 1CX4A 1V00A 4KG0A 1PK6A 2E7AA 3EQEA 3LA7A 5CFCB 2PAKA 4JDOA 2P37A 2PTMA 2BEOA 3PJQA 1GZCA 3WG1A 4Q4V2 1SLBA 2XKOA 4XJUA 2ZGPA 3M2MA 1WLWA 1ZM1A 1G9FA 1XU1A 3APBA 1JN2P 5FOJB 5I8YA 1AXKA 5H9PA 1CGPA 2HKXA 1LOEA 4KWKA 2HWB3 1GKBA 3VBRA 2HEWF 1FV3A 1H8TA 1KFXL 1ULEA 1VALA 2DFBA 1AR63 3FX3A 4FOVA 4Q8LA 2PHFA 3B9CA 2ARBA 2UYAA 3O12A 4MV2A 3R4SA 2ZZJA 4ASLA 5GLWA 4YYOA 3WX5A 4CP0A 2Y38A 1RTVA 3M3EA 4HANA 4RD7A 2DYCA 1Q8PA 1D4M1 1QJU1 2BFUL 2F4PA 2AENA 1AXYA 4Q4W1 2FMDA 5JCTA 2O1QA 2LM3A 1H1MA 4HL0A 1FV2A 3O7OA 4XMIA 4XW3A 2WNUB 4HPKA 4XQDA 4M3CF 2EIGA 5JIAA 4Q0VA 5CFCA 5A3LA 1UMZA 2GALA 4D94A 3VKFC 2H6CA 3G6JB 2ETEA 5IK5A 4FSJA 1Y3TA 2VVDA 3M4FA 1SLLA 3N7KA 5CFDC 3U4XA 3O0WA 2PHRA 2B42B 2ZHLA 2A71A 3WLUA 1POV0 2X8KA 1J59A 4RGGA 2OUHA 4N7IA 1RUF2 2RR12 4YM2A 4ZU4A 1CR7A 3KB5A 4Q4Y3 4FTSA 2YZ4A 1LHOA 4NO4A 5JVVA 2DVAA 5A33B 1PZ7A 2XH6A 2XWBB 1CJPA 3GBWA 4LEJA 5DG1A 1PM7A 4DS0A 1ULDA 4P9XA 4DY5A 1S0IA 3IWZA 4K20A 3THPA 2GMMA 1ZBE1 3D6EA 5JSRA 1YI7A 1D2SA 1RUNA 3BCWA 1XNCA 4LULA 1V9U1 2DV9A 3AKSA 3AP9A 1SDWA 4P14A 3I59B 4HVRA 5I0RA 4LO8A 4C1WA 2WNUA 1ONAA 3RYPA 4HVQA 4AI0A 4IESA 1ALYA 3MIFA 1AYN1 4W65A 1JOJA 2JG8B 2V5YA 3H1WA 4HBNA 4Q4V3 1OKQA 2ZHKA 1N47A 1DYPA 1RL3A 1WW6A 5D8AB 3RYKA 4YARA 3RNSA 1LOAA 2ZGMA 5DZEA 4NWVA 1PO12 2Y0IA 1RMU1 2ZGNA 5T5LA 4AFDA 4HZFA 5KXEA 1SEFA 3VBHC 3HBZA 1O3TA 3MPPG 5A33A 1O4YA 5HCAA 1ZX5A 2B8MA 2E63A 4CDUC 2V09A 4DMIA 1RHI1 1XE8A 2JECA 4DRRA 2P3JA 3GALA 4KU8A 2OZ6A 3R4DB 5BUVA 2YY1A 5JSOA 4S2HA 2UURA 2VNRA 2D93A 4NVPA 2RE9A 4FTEA 2AZ5A 4JCKA 5BNQA 5HCFA 4XJ8A 3WG3A 2KM2A 2VOWA 1O4TA 2BFUS 4BH9A 4CEWB 2OUJA 1KDKA 3DF0A 3CF6E 2ZHNA 2WT0A 1OD5A 4AI2A 2B46X 3GBFA 4BLJA 4YZ2A 3AKTA 4GULA 2ZMKA 5D8AA 1RUF3 1V6KA 1HV1A 4OI1A 1RUD3 1PO23 4AI3A 1YO8A 2UWCA 5CU1A 3AJYA 4UW5A 1PNFA 4KG8A 3BODA 1MACA 4WVZA 2YGMA 1K5MB 3FJSA 4FP3A 1TMF1 5E8AA 4CDQC 4IXLA 2X5IC 4GH4B 1RUI2 3OBRA 1EYBA 4YG6A 1FAYA 3B93A 1XRUA 4GKXA 1VAVA 5FMOL 2W0XA 1ND2C 1VJ2A 2WZR1 3RMYA 2GH2A 2IXJA 3ME2A 3LCPA 2YV8A 4PQ9A 3V0BB 1TME1 2ZX1A 1LULA 1QJY1 3M3OA 3N7LA 4Y1ZA 3VBSB 4BIFA 1VAMA 5FTTC 4E27A 1QH7A 4XFGA 1LTEA 2UWAA 5T5JA 2Q0AA 3USUB 1QU0A 2ZGUA 1AL0G 3P3PA 3WDWA 4OUSA 3W58A 1YHFA 3WV6A 1ZZ8A 1QJX2 4R9DA 3LSEA 1N3QA 2B39A 2R042 4RHV1 1COV2 5I0UA 1UU6A 2AH2A 1VBB3 1PO13 3RJRA 1LGBA 1JH5A 4M0NA 2ZAAA 4KGGA 3VHRA 5C33A 1GLHA 1XNKA 4BMBA 3KCCA 3AZZA 3ZXAC 3E5QA 1K5MA 3RMXA 2ZS6B 1RUH3 1ZZ7A 1C4RA 4GH4A 4QQLA 4BWOA 5K9YA 3UL2A 3VDDA 3DGTA 1D2QA 4AK3A 2UY8A 1DU3D 4YGEA 4CDWB 2E9QA 1C57A 3ENRA 2UY9A 4XHXA 4PIZA 5T55A 5JZGA 4BM8A 3V0BA 3RG0A 1QF3A 3VBSA 1AR73 3VBFB 3MI8A 4QPGB 3ZX7A 4LO7A 1QMJA 3FBMA 4Q1RA 5KHJA 1MVQA 1EP0A 1HV0A 4GB31 5K7PA 2WWSA 2VVEA 3SCGA 5K0UB 2VOVA 5L7OB 1W6PB 4SLIA 1EPWA 3MLKA 2BTVC 1ULGA 4UW6A 3NO8A 1D4M2 1QJU2 4I0WB 1Z7S1 3N7MA 4Q4W2 3CJIC 1LCLA 5BNNB 1OI6A 4Q0PA 3NAPC 4LA2A 1W6OB 5CBLA 4FPFA 3X29B 4HKOA 4YGDA 1NOVA 3GZAA 3R4UA 3S30A 3ZXDA 1Y9QA 1RUI3 3IDEA 1CVNA 4N9HA 3WP3A 1W39A 4JGZC 4K7JA 1UIJA 5CIRA 5KC6A 4Y22B 4CDWA 3NV4A 2CGNA 2VW2A 3IM0A 4HK8A 4AFMA 1JHNA 2DU1A 4QGNA 2EAAA 2YGLA 5DZFA 1AR61 2W68A 3VBFA 2F6BA 2BW8A 2WSUA 2EA7A 3PVEA 4ES9A 1BK1A 3THTA 4OI2A 1H2MA 1T6GC 4OFGA 1ND3C 1SCSA 3ZFEC 3ACLA 2BVBA 5K0UA 4AEKA 1GV9A 1QJX3 5L7OA 1W6PA 2HWD1 2CL2A 4NOTA 3W59A 4FQ4A 1WUVA 4MLOA 5H9QA 1ZBE2 4D3WA 1G9BA 2A3YA 1V9U2 3LA3A 1D0GA 2D6NA 3N35A 4Y20B 5BNNA 4AGVA 3WVJA 4AG4A 4BA6A 1B35A 1Q3EA 2QJVA 4DY3A 1HIXA 3AZVA 4HETA 2CAUA 4DXZA 1DGWX 2DWRA 1AYN2 5F6KA 5E16A 4M01A 2ZABA 3VBUB 2P17A 3ILRA 1UW8A 4JV4A 2TEPA 3SHRA 2WT2A 1QDOA 4QMAA 3AKQA 3O5SA 4EN9B 3KT1A 5F6LB 4R4ZA 4LBOA 1RMU2 3ZSJA 3RI8A 4WZFA 2PHXA 2XJVA 3MICA 2JG8C 4META 4FAGA 1A8MA 2OA2A 5JPNB 4A7ZA 2XVGA 3OD0A 1HKDA 5D8AC 2DCJA 1A3KA 1U5YA 1RHI2 4F8AA 1H9WA 4AYUA 4QPIA 4PLNA 3WDXA 2BBVA 1QJU3 2TUNA 1FNYA 1OQEA 3MIHA 1Q8SA 4E4ZA 3WG4A 4IEWA 2FZ2A 1VIWB 1UL9A 1I3HA 5FPXA 4FOYA 3FC0A 3LOIA 4IL7A 4YLZA 4Q4V1 1LR5A 3BOWA 4RQPC 2B9UA 5FO7B 5BPXA 3IIAA 2QZ3A 3VBUA 2GMPA 1H4GA 4FBFA 1WW4A 1J1LA 2WNVC 2CAVA 4INDA 2R32A 1YXWA 4IV1B 1NCQC 2DF7A 3HIFA 1VBE3 4XXPA 2VQAA 4CEWC 5GM0A 1G8WA 3EXUA 1N1SA 4UW3A 4FQZA 2VY0A 2JDZA 4LNVA 3ZIXA 3AXDA 1PGW1 3WDUA 4TZDA 1DQ0A 3IMNA 1CPNA 1ZBE3 3ELNA 3E97A 5T54A 3UJOA 4OVEA 1V9U3 5T50A 2WZR2 2H0VA 1CAUA 4XFFA 3TRSB 1DQ6A 4CP1A 4YW2A 1TME2 1N3OA 1QJY2 2WT1A 2D40A 1F2NA 2XJPA 1YFYA 2A6YA 4ZXKA 2BYVE 1AYN3 1RJ8A 1I6XA 3H3ZA 2E51A 3SH3A 4PBPA 1ENXA 3BPZA 3OGJA 1VB4A 2PAMA 1FPN3 1RUD1 1PO21 2PHDA 3KS7A 4RHV2 1HQNA 1MZ6A 1PVXA 2VOXA 1YUDA 1RMU3 3U07A 1VBC3 3DKWA 1NZCA 1S55A 2HYKA 4QX5A 3NVCA 4DFSA 1UZZA 1QH6A 4YW1A 4AW7A 3FFQA 2ZKLA 5GALA 2ZJCA 3RRDA 1RHI3 5DUXA 3CL1A 1RUC2 1CESA 1BVP1 4XF9A 4HSJA 2G9GA 4YRDA 2D6OX 2D3SA 5CFDA 4BE3A 4A2UA 1KJRA 3ZYGA 4Q0UA 4B4PA 4XFAA 3I54A 1A8DA 5FRAA 2ZX3A 4MGZE 1C8M1 3AB0A 5DG2A 1VAKA 2KA3A 4GIQA 2WNEA 2VW1A 4AQSA 2YPJA 2GC0A 3IPVB 1A78A 4LLFA 4MVTA 4CDUB 4GB32 4CDWC 1OSGA 4AWDA 2ZMNA 2HJIA 4AQTA 3TN93 3I4IA 1VBB1 2H0BA 3VBFC 3MLLA 1VRH1 1H1IA 1Z7S2 4QPGC 1C1FA 1IS5A 4IV3C 1PZ9A 3AX4A 3ZSKA 3EJKA 3ZXJA 3QD6A 4ZU7A 3LSDA 4IEVA 5L73A 1RUH1 4HSLA 2GC3A 1JUIA 1MS1A 2EF6A 1POV3 2MEV1 3J8F1 1IS3A 5T5PA 2CGOA 2Z69A 1G7YA 3B9IA 2JE7A 2WIIB 4PIYA 4COUA 4Z2WA 3OBTA 2WZR3 1DZTA 3EBRA 5C9AB 1QXPA 1AXZA 4K21A 4QT6A 1AR71 3V56A 1I9RA 1TME3 2A3XA 3I7DA 5FAXA 1AR62 1XYOA 1GNHA 1Q8OA 4LT5A 2XLFA 3VBHA 4CP2A 1EY2A 5IK4A 3GHMA 3IPVA 4JTNA 4CDUA 1LHVA 5GLUA 4CDQB 4D7SA 4F83A 2VECA 5GJ6A 2XGXA 1AJOA 2HWD2 4X6QB 4IQPA 4XFIA 4GWMA 3ZSMA 1CPMA 1ND2B 2R16A 5C8WA 5DUWA 4TSVA 1QHDA 2D6MA 3PNAA 4ATFA 3HAGA 3WW4A 3GF6A 4U36A 4XQ4A 3KCYA 1RGSA 5JPMB 1VBD3 1RUC3 1RJ7A 4C1XA 4HLTA 3M1HA 3ZSEA 1H2NA 2E53A 4B7EA 4QHBA 1O5UA 3S7EA 4RL7A 3B69A 4YZ5A 3MF6A 1G9CA 4X8PA 4P9YA 3AJZA 4MZUA 4GB33 1NCRB 4AI8A 4CDQA 2X5IA 3G7DA 1CAWB 1S0CA 1DGRA 1S0DA 3ZMOA 1OQ1A 1AZDA 4PBOA 2EAKA 2H6BA 1ND2A 1CAXA 2DCTA 1SLIA 3PMEA 1LOFC 3A4UA 5EYYA 3CJXA 2R061 5EZWA 1RUG1 3IKWA 4K1YA 1YIPA 3ZN6A 1PGL2 4FO9A 3SITA 2GNDA 2R30A 4BCUA 3NSTA 4E9KA 3ZXLA 1LHNA 3TOJA 5DDJ3 2C1FA 1D4VB 1R1A3 1Q8VA 3ZN5A 4DZGA 5DZGA 3WUDA 3FLPA 3CJIB 3TNPB 2QQPA 4AHWA 3NAPB 4E4SA 2DCYA 3N4MA 1BJQA 1XQNA 1WCDJ 2GC2A 1YFXA 4WZCA 1PGW2 5GZEA 4JGZB 1CAWA 2TNFA 2HWD3 4A7YA 3VN4A 3MF9A 1UPIA 3WQ7A 4IV1C 1ZRFA 3MLJA 1UAIA 1H1AA 1CAVB 4P9WA 4Q0SA 1EPZA 2CV6A 3CU7A 4QXKA 2XWJB 2ZZQA 4L92A 2Y26A 2WA3A 1ZNPA 1ND3B 3ZFEB 2R0HA 3POYA 1U5ZA 3I8TA 1O91A 2K9ZA 5IUQA 4Y1UA 4RS5C 4WVVA 1SBFA 5CG8A 5KWRA 4YW4A 1GSLA 1M4WA 1RUD2 1VBE1 4R4XA 3CJIA 1PO22 5JAXA 1ULFA 3NAPA 3QH7A 4Z92B 5JI7A 3DV8A 2DUPA 2BWAA 2VVFA 2WS91 2AYHA 4WM8B 3WCRA 1MR5A 4Q4X1 1MS9A 4Y5Z0 4FXKB 4JGZA 2GC1A 3J9SA 3IBMA 2FBEA 1MZ5A 2R0FA 2YXSA 1CAVA 3ZYRA 3K48A 1KDMA 3A0KA 1DQ1A 4GMP0 2WL1A 1C8M2 2