4N43A

Human enterovirus 71 uncoating intermediate captured at atomic resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
225
structure length
225
Chain Sequence
SHSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Human enterovirus 71 uncoating captured at atomic resolution.
pubmed doi rcsb
molecule tags Virus
total genus 33
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n43A00
1V9U2 1QJY2 4RR3C 4WM7B 2RM21 1VRH2 1R091 4CDQC 1RMU3 3ZFEB 5BNNB 2XBO1 1AL21 1AR93 5AC92 5JZGA 2HWE1 2X5IB 1RUI3 1RUG1 1NOVA 4CDUC 1HRV1 2HWD1 1QQP1 4Q4V2 3VBUA 1C8M1 1AR71 1ND3B 1Z7S2 4IV3C 1HXS1 2VQ0A 2PLV3 4YVSA 3J8F1 1R1A1 1HRI2 1AR83 1RUD3 5ABJC 4QPGA 1RUE2 3VBSA 1TME1 2R041 1EAH1 4NWWA 4CDWC 5J96B 3TN91 4RHV1 2MEV3 4CDXB 1BBT3 3VDDC 1VBC2 1ND2A 4Q4Y3 1R082 1AR63 1BEV2 5L7OA 1EV11 1QJX2 4RS5A 1PO22 3NAPC 4JGZB 1NCQA 1RVF2 2WS93 2R062 2RMU1 1V9U3 1NA1B 1AL0G 3ZFFC 1FPN1 2WZR1 4BCUA 4FTSA 1RUF1 1AYN3 1FMD2 5DDJ2 3VBOA 4N43C 5ACA2 1OHFA 1VBA3 3JBG3 3ZFGC 4RQPB 3NAPB 2HWC2 4GH4C 2WFF2 4YVWA 1PO12 2ZZQA 2WWSA 4WM7A 5FMOS 1ZBA2 4AEDC 4WM8B 1ASJ1 1Z7S3 4GB33 1RHI1 5BNNA 1VB2A 5CFCA 5C4WA 1QJU1 4CEYB 5L7OC 1AR91 1RUE3 5CFDC 1CJDA 5C9AB 4RR3A 5A32A 1TMF1 1AYM3 2FZ2A 1COV2 1ND3A 1IHMA 2R073 1BEV3 4QPIB 4NWVA 3HAGA 2RS51 2PLV1 5D8AC 2HWB2 4CDUA 1M06G 4Q4W2 1AUYA 2HWF3 3VBFC 4YVWC 3JD73 1RUD1 2RR12 1RUJ1 4SBVA 4WM7C 5DDJ3 3JB4C 4IV3A 1H8TB 5ACA3 3DPRB 5GKAC 2MEV1 3ZFEC 5BNNC 1PGL2 1RUC3 1AR61 4LLFA 5D8AB 2X5IC 5K0UB 5FOJB 1PVC3 1FOD3 3VBRB 3VDDA 1ZBA3 1RUH1 4Y4YA 5A33A 4CDWA 5BNOB 1ND3C 1AYN1 1PIV3 3NAPA 1BMV2 1OPOA 2FZ1A 1ZBE2 1VBA1 3JBG1 3M8LA 3ZFFA 2DF7A 4FTEA 1MEC2 2RS33 4WM8A 2BFUL 2RM22 4N43A 4CDXC 1D4M3 1R092 4GMP0 1HX6A 3ZFGA 1CD3G 4GH4A 2XBO2 1AL22 4GB31 1VBD3 2HWB3 2HWE2 4JGZC 1VBE1 1RUG2 1HRV2 2RR13 1NA1C 4AEDA 1NG0A 2HWD2 4RFT0 1QQP2 1F8VA 1E57A 1AYM1 1SMVA 1C8M2 1AR72 4QPIA 1VBB3 1HXS2 1DDLA 2R071 3FBMA 5CFDA 2RS11 3J8F2 1R1A2 4RQPC 1MQTB 1TME2 2R042 1EAH2 4CEWB 1QJY3 2HWF1 1B35B 3TN92 4RHV2 3JD71 1VRH3 4WM8C 2ZAHA 1OOPB 2WLPA 1EV12 5AC93 5D8AA 2QQPA 2Y26A 1C8NA 4CEYC 5BNPB 3VBFA 1NY71 1RUC1 4GMP3 2RMU2 1MEC3 4PDWB 3VBRA 5C9AC 1PGW1 1FPN2 2WZR2 1PVC1 1RUF2 4Q4V3 1NCRC 1FOD1 3ZFEA 1ZBA1 1POV0 1VAKA 2GSYA 4QPIC 4Q4X2 1RMU1 1GFF2 2X5IA 1HRI3 1PIV1 2HWE3 4JGYC 2BBVA 1HRV3 1QQP3 1RUI1 1X36A 2RS31 1NCRB 1VBC3 1ASJ2 1AR73 1C8M3 1R083 1A6CA 1H8TC 1HXS3 3DPRC 1RHI2 1D4M1 1QJX3 1F2NA 1QJU2 1PO23 4JGYB 1AR92 1RVF3 1WCDJ 3CJIB 2R063 1VBD1 1X33A 4YVSB 5K0UC 1EAH3 2BFUS 1AR81 1TMF2 5LK7B 4CDXA 3VBRC 1VB4A 4QPGB 3VBSB 1FMD3 2IZWA 2RR11 5BNOC 4EJRA 1BBT1 1EV13 2RS52 4Q4Y1 4JGZA 1ND2B 1VBB1 2HWC3 2PLV2 2WFF3 1PO13 1POV3 3JB8A 1NA1A 1K5MB 4RS5B 2BUKA 1RUD2 1NCQB 1RUJ2 2WS91 1RUF3 1V9U1 1OOPA 1QJY1 2MEV2 1VRH1 4Q4X3 4RQPA 3LOBA 5BNPA 3VBOB 1AR62 5AC91 4FSJA 4N53B 4GMP1 1COV3 1RUH2 1ASJ3 3S6PA 1RHI3 4FTBA 4Q4V1 1AYN2 4CEYA 1RB8G 1Z7S1 1QJU3 4Z92B 1MQTC 1VBA2 3JBG2 3ZXAC 4Q4W3 5C9AA 5CFCB 2XPJA 1HRI1 5C4WB 1TMF3 1RUE1 5C8CB 4CEWC 1NCRA 1B35C 4RR3B 5A32B 4IV1C 1OOPC 1VBC1 4CDQB 2RS53 1R081 4GB32 1BEV1 4JGYA 3VBHC 1HQNA 3CJIA 5BNPC 1VBE2 1QJX1 1PO21 4PDWC 1RVF1 1RUJ3 2R061 4CDUB 2GH8A 1H8TA 3DPRA 1AYM2 4IV1B 1FMD1 5DDJ1 5J98B 4IV3B 5ACA1 2R072 3VBHB 2RS12 1ZBE3 5K0UA 1K5MA 2HWC1 2WFF1 5ABJB 1PO11 5JZGC 1POV1 1RUH3 2HWF2 5BNOA 2RM23 3JD72 4CDWB 1R093 3VDDB 2XBO3 1AL23 5A33B 3VBUC 4Q4X1 2TBVA 1NY72 1RUC2 4N53A 1RUG3 3CJIC 4YVSC 5JZGB 1PGW2 2HWD3 1QJZA 1PVC2 4QPGC 3ZFFB 3VBSC 1FOD2 2ZTNA 1COV1 4N43B 3VBUB 1RMU2 1ND2C 3J8F3 1R1A3 1PIV2 1VBE3 2BPA2 3ZFGB 4GH4B 1TME3 2R043 2HWB1 5C8CA 1K5MC 4RS5C 4Q4W1 1NCQC 1RUI2 3TN93 4RHV3 2RS32 4CDQA 4AEDB 1D4M2 1MQTA 3VBOC 2RS13 1PGL1 5L7OB 2RMU3 1VBD2 4CEWA 5CFDB 1AR82 4N53C 1B35A 1FPN3 2WZR3 4IV1A 1W39A 5FMOL 1BBT2 3VBHA 4Q4Y2 1VBB2 1BMV1 3IDEA 4PDWA 5ABJA 5CFCC 5C4WC 1ZBE1 3VBFB 4YVWB 2WS92 5C8CC 4Y5Z0 1MEC1
chains in the Genus database with same CATH superfamily
1SLLA 2EVXA 4GWNA 4CUBA 3Q8AA 4LA2A 4CCJA 1W6PA 3OD0A 4GKYA 4CDQC 5GM0A 1OSGA 3NJXA 1UKGA 1ZZ9A 4ZS3A 2E51A 2XBO1 2VXJA 4LMFA 2C5DA 4QWNA 3MIFA 1EYBA 2WNVC 2D98A 5JZGA 5CU1A 5GLVA 4AVSA 2X10A 5FR3A 4FPCA 4BWOA 1RUI3 1Q8OA 2YHJA 1XQNA 3IB3A 4NHXA 5T55A 1UF2C 3AL5A 3SH5A 3HBZA 1QQP1 2JKXA 4YGCA 4YGBA 4G9SB 4FBFA 5BY5A 4R52A 1AR71 5ISLA 1VP6A 3I2OA 3CDZB 1DFQA 3U4XA 5A7OA 3MFCA 3J7HA 3AKSA 3WUCA 1LODA 1W2UA 1GP5A 3BU7A 1TE1B 1R1A1 2C9AA 2YFUA 2JG8B 2UURA 3EO6A 2YV8A 3MIDA 3VDCA 2D6LX 4AE2A 3BVCA 4QDRA 4AL9A 3VBSA 3AP9A 3NQHA 1TME1 2R041 1LECA 2WSUA 5LRRA 3ZDVA 2A70A 3RJ2X 3WNLA 4XAEA 2VQTA 4CDWC 2CTVA 5J96B 3K3NA 3NV2A 2AENA 1X50A 3IDCB 1BBT3 4CDXB 1VBC2 3MEPA 4F7ZA 5FZ0A 4Q4Y3 1JHNA 2A6YA 1FNYA 3SCHA 5CZKA 2Q5TA 1ENXA 5FY8A 3T1MA 3VKMA 1YQ5A 3K75B 4JGZB 4XILA 1PZ9A 4UW5A 2VVFA 4M3CB 1O4ZA 2YPJA 2ZGOA 2JG9A 4CCOA 2RMU1 1QF3A 2P34A 1GP4A 1HQWA 1REEA 1YCIA 1H2KA 1LHVA 5I8SA 1AL0G 3ZFFC 2VOTA 4S2GA 4W6XA 4EN0A 2DVGA 4XBQA 1IOAA 4MOAA 1AYN3 4AWDA 4K9SA 3ZYJB 2NN8A 2R0HA 3WP3A 2WKKA 1C5IA 1HB4A 3IDAA 3ZX7A 5DMYA 2BEOA 3AJZA 4XDQA 2WFF2 4QX3A 3BIWE 1OFSA 1W8WA 1MS9A 1GKBA 2BV4A 2O8QA 4FPHA 4AFMA 5C3OA 3T0BA 5K7PA 2BNOA 3S7IA 2PHDA 2X29A 2VW1A 2XDVA 3H1MA 3D5OA 4WM7A 2UU8A 4DXZA 5I91A 2WZ8A 1ZBA2 2D6KA 5B4XA 4MH0E 2OUJA 3RNSA 1Z7S3 1CAUB 4DNYA 3HMYA 1WGPA 2CU5A 5HCHA 3NNLA 1O5LA 4JV4A 4MXWB 2DFBA 3TYJA 1YFXA 3W5NA 3O0XA 1QJU1 1GZ9A 3VGIA 2JXAA 3PU3A 5KHIA 1QKQA 1AR91 2W1UA 3POJA 1SACA 1BYHA 4Y22B 4QX5A 5FP4A 1CJDA 4AI9A 5HXVA 3ZDSA 5I0RA 2W94A 4FOYA 3KQRA 2G4IA 1DGLA 1COV2 1AJOA 4QGLA 2KM2A 2DCZA 4NRMA 4AI3A 4NRQA 1FV2A 5A3PA 2WT2A 1VMFA 1WCQA 4QPIB 3LE0A 5FKBA 4KBZA 3HAGA 4ISQA 2QKDA 2WNVA 4LO7A 4BU2A 2NP0A 1DHKB 5JVVA 3WHUA 3KGLA 4L99A 1L3JA 1MACA 2HWB2 1UZVA 4MSVA 4ZU7A 1M06G 2JX9A 3VBFC 3MLLA 2ZS6B 3JD73 2ZGNA 2VNRA 5DQ0A 1Q43A 5E1RA 1VLNA 3VD3A 4ZU5A 4J1XA 1FV3A 5FY1A 5ACA3 3DPRB 1JYVA 1A8MA 3WNXA 3QOPA 2JIJA 3BPSA 2XOMA 4QKDA 3H1YA 5APAA 3D3AA 3I59B 4EWDA 1OQDA 3DN7A 1RUC3 1AR61 3FX3A 1OLMA 3WDWA 4E8CA 3OPZA 4LLFA 3T3YA 4K20A 1KDKA 1URXA 4LKSA 2B45X 1XB9A 3P3NA 4YW3A 3ZN5A 1ODNA 2ARAA 3VBRB 4D6QA 2BVBA 3SC7X 1OA2A 4ZHNA 3M3CA 1ZM1A 4Y4YA 3VKLA 4YW4A 3NNJA 1PGSA 3KT1A 1WCSA 3VD9A 1NUKA 2ADEA 1F4AA 1V6IA 2DURA 2HEYF 2VOKA 3ZXFA 3BKZA 4AYUA 2JG8C 1VBA1 1JYTA 1US2A 2CV6A 4QB1A 3ZFFA 1PZ8A 4P9LA 1MEC2 2RS33 3N9PA 3RVHA 4COYA 4COZA 3LCPA 1H6XA 4CDXC 2KD7A 2TUNA 4JDNA 3THCA 3WG2A 1DZRA 1YYNA 5CKQA 4QQ2A 1OD5A 4Q0UA 2EA7A 1OT5A 1Q3EA 4Q1PA 3PU8A 4JGZC 4AFCA 2I07B 4PF5A 1WW5A 4JKLA 2P3JA 5I0DA 1RUG2 1AJKA 2FD8A 4BM8A 3MLJA 1YEWA 2WQZC 1NG0A 1OPMA 2HWD2 4K1YA 4U36A 2W9XA 1C1LA 3ILFA 1UMZA 1DLLA 1JYWA 3MDPA 1DDLA 1HXS2 1W2AX 2SLIA 4NHKA 5KXEA 4XFFA 2OYZA 2AUYA 2R071 4LE4A 3UK9A 3ZSLA 5KR7A 4X6QB 1W8HA 1GWMA 4WV8A 4CCCA 1UIJA 5L9RA 4MGKE 1MZ6A 3PUIA 1O4TA 1N1TA 4CEWB 1W6NB 1UOGA 2HWF1 4NE9A 5EYYA 4CUAA 4X8PA 2C26A 3WW4A 3O1OA 5C3QA 1DCSA 4PF1A 1ST8A 4FFHA 1E5HA 2WA3A 1UYXA 1OOPB 2ZAHA 3CJXA 1RXFA 2Y6LA 3L2YA 5IAXA 1GMMA 5JLVA 2QTWB 2QBXA 3H8UA 4HSLA 4PBPA 4Z2WA 4AFBA 5FO9B 2YBKA 2V5DA 3UESA 3VBFA 1UZ0A 3AZZA 3I2IA 3TEXA 4GMP3 3LEIA 2P17A 1OKOA 4S2FA 2ZGMA 1HB2A 1W8ZA 3N9LA 3O1SA 1FPN2 3RZMA 4W4ZA 1O4YA 1PVC1 1RUF2 4MXVA 5F5IA 5LA2A 1YRZA 2XQRA 1FOD1 4M01A 1ZBA1 3EHKA 1POV0 2HJIA 4FOVA 1H1MA 4IEXA 4JX0A 1DGRA 4QPIC 1UY3A 4XQDA 3B9IA 4XVHA 4OMCA 4P9GA 3SHRA 4BMBA 1RMU1 5IVVA 1GFF2 4D0QA 5A3TA 2E33A 4UW3A 1NZCA 5CAZA 3H8OA 3N9MA 2BBVA 3NO8A 1CR7A 1HRV3 1VRBA 3WZ1A 5EV7A 3UL2A 1XNDA 1UW8A 2E7AA 1H4GA 3LPFA 4O9EA 1NCRB 1VBC3 2ZGKA 4YW7A 3WXPA 1A6CA 3DPRC 2FCVA 3C2UA 4ARYA 4IEUA 1O3QA 4MLOA 3WINE 3ZM8A 3PUSA 1F2NA 2JG8A 3GYDA 2OZJA 3LF7A 5LEKA 3Q9OA 4OUMA 1VBD1 2XQXA 1ENRA 1AR81 1KFUL 2W95A 3ACIA 3T2PA 1TMF2 4RN5A 5LK7B 1S0GA 4CDXA 2AGSA 1VB4A 4QPGB 3QLQA 4XXAA 4UFLA 3VBRC 3VKOA 5T52A 2XUEA 3KHBA 5IK8A 3NNFA 5J36A 4NHMA 3KGZA 5FP3A 4FQ4A 1BHGA 3WR0A 4Z2AA 2DWRA 2ZZJA 2ARBA 4JGZA 3E1F1 1WLDA 2PLV2 2WFF3 1T6BX 3ABZA 3BPZA 4M3CA 4P00B 3WCSA 1W9YA 3BOPA 4XDOA 2EAAA 4RS5B 1RUD2 3I2KA 1RUJ2 3I3QA 2DCKA 2WYSA 2JD9A 1V9U1 1UWWA 2ET7A 1JBCA 4M3CF 4ATFA 3NRUA 1O3RA 1X9PA 4HK8A 5FP7A 1H2MA 1W03A 4OI2A 3LOBA 1UY0A 3VBOB 2H6CA 1YI9A 2VJXA 1K42A 2QCSB 2UYBA 3M70A 3OGRA 3HIFA 5JOZA 3LD8A 4IE0A 5IYYA 5GZEA 1W8FA 1HV1A 3ACHA 3A4UA 1COV3 5FPBA 1AXZA 2UWAA 2YFZA 1ASJ3 4AVCA 2N7GA 1MZ5A 2YROA 4UI9L 4Q4V1 1VMHA 2QQUA 3FMGA 2GC0A 2ORZA 5HCFA 4F3JA 1JYXA 2Y33A 3MI8A 4BA6A 4Y22A 5DAXA 4K8RB 3J7MA 4R9CA 3JBG2 5JWPA 5CFCB 3LIHA 1SBDA 2Q4SA 5C4WB 1KRIA 3MGUA 4E4DX 1RUE1 1LHWA 4CEWC 3BCWA 2W87A 3CZJA 3LDRA 4LXLA 2IVJA 4QU2A 3T30A 2JE8A 3UT0A 1OOPC 1UY1A 3WCRA 1W0OA 5LWBA 4MUVA 3K3OA 5K4LA 3ZYHA 2RS53 2D6OX 5LW9A 2JDYA 1J1TA 2VW2A 2Z79A 2ZEWA 3I4IA 1BEV1 4GB32 4IESA 1RITA 4LR4A 2VH9A 1HQNA 3AMMA 2F17A 1ALYA 4M0HA 3WG4A 1RUOA 1QJX1 4QXHA 2BWCA 1AXYA 3AZVA 3CKHA 4UFJA 1HQLA 4WVWA 1Z78A 5DZFA 4AQSA 2Z5WA 4CTEA 3PDQA 3H8XA 4CDUB 2MHFA 1YO8A 2ZX2A 3WP4A 2C1FA 3MYXA 4ATEA 3DPRA 1QU0A 4MGQA 4DUXA 1AYM2 1GSLA 3AFKA 4B7EA 1D0HA 1UU6A 3I59A 2P3IA 4YG0A 4OHYA 1QIQA 5DAVA 4Y1UA 5H9RA 2VCMA 2X53S 3VBHB 3NNMA 1XNBA 2RS12 3VHPA 5FKCA 1US3A 2HWC1 4LTAA 1TZOA 3RJRA 3ELNA 4Y1YA 1J58A 4DZGA 3OPWA 4XZPA 3GHNA 3JUUA 5FMBA 1QDCA 3HQXA 2Y8KA 4MGSA 3ORJA 3U75A 2FDIA 1GOGA 3S0MA 1WMDA 2BJSA 3IPVA 4CSWA 1GNYA 2VBPA 3VDDB 3PVBB 1F35A 2OS2A 1MS5A 3ZO0B 1W6PB 3VBUC 3KCXA 1ZRFA 3OGGA 3V0BB 3O1RA 2TBVA 2NMNA 5JSRA 2BGOA 3NKTA 1F5FA 1IG0A 3GCWA 1RUG3 5CYYA 3HPNA 3TAYA 4MHUA 5JZGB 4CP2A 3MZHA 1DQ0A 2HWD3 5HV4A 1YQ8A 4QPGC 1JHJA 4PI2A 2Z42A 2DTYA 1N3PA 4UFMA 3FE5A 2W91A 3UV9A 1WW6A 4UF0B 2D44A 4NHYA 3MF6A 3ALQA 3OD4A 3ACGA 2ZHLA 4N43B 1H2LA 1BK0A 3N9NA 4QHOA 1D0GA 5F32A 2K46A 4XEZA 3CHXA 4HK9A 1PIV2 3ZFGB 1UXZA 4GH4B 2RJKA 2Q8OA 4FPEA 5LATA 5A6YA 5JMCA 4RSUA 2CYFA 5C8CA 1QWRA 4YRDA 4RS5C 5GZFA 2J1EA 1W06A 2JDUA 1RUI2 3U07A 5LY2A 3B69A 1YQCA 4Q5OA 3AMPA 3ZSEA 1EP0A 1LKNA 4NPLA 1I3HA 4AEDB 4W50A 3GBGA 5K9YA 1D4M2 2DBNA 1FT9A 2R7EB 5LRSA 4Z1VA 4YZ5A 1RUNA 3KV9A 3VBOC 1XSRA 1D2SA 1DU3D 2LS6A 3GZAA 4WBBA 3ZIXA 1SFYA 4QKBA 4CEWA 1W6NA 4XIOA 3O0VA 5CFDB 3C8XA 4A45A 1AF9A 1FPN3 4IGQA 4UBHA 3I3DA 2JG9B 1JZ6A 2WO7A 1DQ6A 4B1MA 5A7PA 2W92A 3B01A 1BBT2 4PIYA 5A1AA 2JDHA 3S30A 1ZA7A 3RZKA 4Q4Y2 4UW6A 5KHJA 5IK5A 1VBB2 3H7YA 1HJGA 3PHMA 1BKZA 1BMV1 1JI6A 2CWSA 2W08A 3IBMA 4BIOA 5ABJA 5CFCC 2ZKNA 5F7UA 5C4WC 1ZBE1 1O5UA 3LFMA 3E5UA 4FOQA 5J48A 1GYKA 3DYMA 1WCKA 1YXWA 2QFEA 2ZHKA 4XDPA 5FZCA 4XJ9A 4WM7B 2ADDA 4ZS2A 2NMOA 5LA1A 4NO4A 4FPJA 1U5ZA 3DXUA 1LGCA 4X8NA 3X29B 3UNPA 3R4SA 4CU8A 1HN0A 4B4QA 4UYBA 4CYDA 1AL21 5AC92 1XYPA 2VTXA 3C7HA 4MYEA 4IEQA 5C6CA 2HWE1 2VZPA 1UX6A 3ZMOA 2Z4FA 3LA7A 5I93A 3AP5A 3AKPA 4COWA 3RS6A 4CDUC 4SLIA 4AHWA 5B4NA 4FFFA 5FOBB 3IIAA 2EICA 2JDKA 1I5PA 3VBUA 1LOFC 3H42B 1C8M1 1X8EA 1Z7S2 1O3TA 2VQ0A 4A7YA 5KHGA 2PLV3 1F9KA 2R49A 4FXGB 4NRPA 4E9KA 2VCBA 2GC2A 2LM3A 4IETA 1HRI2 3B00A 5FY5A 1NYWA 1RUD3 4QPGA 4XUNA 2JECA 4FQZA 1UZWA 4DOUA 1LAJA 2BYVE 3TRSB 3IMNA 1EAH1 2DYCA 3MW3A 4NWWA 1BJQA 3FFQA 4XF3A 1JZ8A 1W6QA 3OEAA 3TN91 4RHV1 4YARA 2JD4A 3CNAA 5BPXA 4W8JA 2IC1A 3WDTA 4EWEA 3VDDC 1IKPA 4DUWA 2A6ZA 1ULOA 5K8SA 4EROA 4P02B 5F3IA 2C24A 1AZDA 1EV11 5FZ8A 4DRRA 3VD4A 2OT7A 3THDA 4I3GA 3K4ZA 1PO22 2G9FA 4KI5M 4RS5A 4TLFA 1RVF2 3VDAA 2EXKA 2R062 2QDNA 1ULEA 5FZHA 2JB4A 1UOFA 5JCTA 2VTFA 3LA2A 1O8PA 5FY0A 1FMD2 1RTVA 5HXMA 3VBOA 4N43C 2DFCA 5ACA2 4BXFA 2X09A 3I2JA 4NIAA 4UFHA 1JZ4A 1XNAA 3JBG3 5GJ6A 1BZWA 1GR3A 3ZFGC 1LU2A 4QX2A 2WR9A 4GH4C 3VZJA 1PO12 5F3GA 4LHNA 1DF0A 1F31A 2YC2A 1QGLA 1A78A 4GZ9A 1MZFA 3TNPB 1DYKA 4AEDC 1I6XA 4DEQA 2VNVA 3BODA 2XJPA 2B9VA 2ORXA 3AP7A 3LSDA 4GB33 1RHI1 4XUQA 5BNNA 1VB2A 1XE7A 4H55A 2BWAA 3D0JA 2AACA 1DGWX 4LITA 5CFCA 1OF4A 5C4WA 4LHLA 1WLWA 2JIGA 3U4SA 1C4RA 5CFDC 1UQXA 2A3YA 4I0BA 3SQOA 1GNZA 1G8WA 2AR6A 4QXCA 1W3XA 3ITQA 2JG9C 1M4WA 2KXLA 2EIDA 3AC0A 4PQQA 1AYM3 3N36A 4D69A 4YSFA 3SKJE 2FZ2A 2GNDA 2P3YA 5FMDA 4AAXA 3AFGA 5FYHA 4HMZA 4NROA 4B4PA 3BU0A 1W0PA 4YPJA 1N3QA 2FMDA 2YGMA 4J25A 2VECA 2OVUA 1XNKA 3ZIWA 2XJSA 4XUTA 2ZX1A 2A6WA 2A7AA 2WAAA 3C7OA 1XU1A 5C3PA 5D8AC 4CDUA 1ACCA 4LT5A 1HKDA 3ACFA 1OQ1A 4FP2A 4Q4W2 5FP9A 2RHPA 3INAA 4EYUA 2D43A 3IM0A 2YBSA 4GULA 3RZJA 1OUSA 1CAVA 1W8UA 1LOFA 4JDMA 3AYCA 4ISRA 4L92A 3FLTA 4Q8LA 4WM7C 5DDJ3 1HV0A 5FYMA 1DZTA 2XXZA 3POSA 5EPAA 2K0GA 1O7FA 2YB7A 4Y1VA 3ZXKA 4A4AA 1PGL2 2CDOA 2W52A 3AXDA 3PUAA 4XF9A 5ERLA 3R4UA 1W28A 2VY0A 1S0JA 1KITA 5JR2A 2BNNA 1JOPA 2Q8EA 1OI6A 5K0UB 4QB2A 2AEZA 4IGOA 4DXSA 5LA0A 3C7EA 3GF6A 4CCNA 1W9SA 4DUVA 4XQ4A 3DXTA 4DQAA 3MUZ1 3VDDA 3D8CA 4EN6B 4LIVA 1RUH1 4KG0A 3ZSKA 4AI2A 5BNOB 2XWJB 1HB3A 5EQUA 3GM8A 3PL0A 4ASMB 3V0BA 1HB1A 3FUQA 2G9ZA 3POBA 1AYN1 4X6RB 5ANNA 1PIV3 2EIGA 2BVVA 2XVKA 4IERA 4OQ9A 4FPOB 5EWSA 4IEWA 4K6BA 1JN2P 5IWFA 5LB6A 2FZ1A 5AFBA 4OHVA 4AHYA 1RGSA 2DF7A 4F8AA 2ZEYA 3HQRA 1GANA 1LR5A 5G05L 5GZGA 3BTXA 4UF0A 1JU3A 1PMJX 2FBEA 1ULGA 4WM8A 4AXOA 2RM22 4N43A 1SLIA 1NLSA 1D4M3 5JSOA 4YZ2A 1R092 4WZCA 1IS3A 4URAA 4NHLA 1MS4A 2W1WA 3HQUA 3ZFGA 1G9DA 4ARXA 2QVSB 4GH4A 1Y4WA 2VXRA 4ASLA 1JYIA 4QT6A 5JIUA 4PIXA 2DCTA 4IEZA 4DIQA 2FDFA 2JENA 2VZOA 3BOWA 4E4HA 1VBE1 4YM0A 5C8WA 4BPZA 4DY3A 2VMHA 4KNCA 1LEDA 2F6BA 1WUVA 1FXZA 1HRV2 2XJVA 3CU7A 5IHRA 1RL3A 1KDMA 2GP5A 4AEDA 5GALA 1UAIA 1TG7A 4RFT0 4URTA 1FAYA 4R9AA 5LBBA 3L2HA 3H0OA 4FPKA 1VBB3 2VOWA 1KS5A 1NZIA 2J1AA 1QY4A 4XF4A 2XJQA 5JI7A 2CSGA 4YW5A 5FZKA 5CFDA 4CXYA 4LOTA 3J8F2 1DQ4A 3O1PA 4CXWA 2ZHMA 1D4VB 2LTNA 3ETQA 2LUWA 3MIHA 4UW4A 3JQWA 4AHZA 2OQ6A 2WQ8A 3JD71 4AF9A 4L2NA 5LASA 1OF3A 1QOTA 1REDA 4CU6A 4CVUA 3DYOA 1H9PA 5EXOA 2VOVA 4HN1A 1VAVA 1O8SA 2VD7A 3PIGA 5AC93 1W8TA 4NIHA 1N3OA 5D8AA 5JOYA 2PHTA 3NKGA 3H1WA 5FZIA 4P5YA 1REFA 1RUC1 4PBOA 5FP8A 3NJYA 3SH3A 2XLFA 2VCAA 5FAXA 3WG3A 1QEXA 2WZR2 1E5RA 4E2SA 3PTRB 2DCYA 4RGGA 5F37A 5CG8A 3ZYPA 1K45A 4BQXA 4V2VA 2Q1FA 2A6XA 2DVDA 2JKBA 4HETA 5FZ3A 3VN4A 1D2QA 4KGQA 3GBWA 3LB9A 2YYOA 2H0VA 1GQGA 1KXGA 4N7UA 5C71A 2W1SA 1HRI3 2YG0A 2WT1A 4XBLA 4MV2A 3WNNA 4EN9B 4JGYC 2OXBA 4Q26A 3IT8A 5FPZA 2TEPA 2D5HA 3RZGA 1DYPA 4MGZE 1QQP3 1X36A 2VZ1A 5EJ3A 3WQ0A 4AOCA 1Q8VA 2RS31 5DG1A 4BK4A 3AP6A 4FFGA 4XTPA 1ASJ2 1AR73 1ULPA 5A7WB 4XJWA 4OMDA 4ZU4A 2WSVA 1KJLA 3MV01 3H3UA 1PO23 2UY9A 1Y9QA 2OPWA 1RVF3 5FK7A 2R063 2JWPA 1C3HA 1OBNA 3WUDA 3F2ZA 5FXVA 4CZSA 5C5TA 5K0UC 1FNZA 5IVJA 3I3MA 4CE8A 5KXCA 2WZPP 4AAPA 1CAWB 3O7OA 5JAXA 1W2NA 3WF2A 4UFKA 1FMD3 2IZWA 3M2MA 3LEGA 4P9IA 4EQVA 5A70A 5BNOC 2PHWA 2OPKA 4CP9B 1MR5A 2RS52 1ND2B 3LAGA 3RWKX 2WUHA 1PO13 4C0BA 1IKQA 1YFWA 2EF6A 3HN3A 4HPKB 2KA3A 2BUKA 2V5YA 4BMEA 3OG2A 2WS91 4BQ5A 3V56A 4XCAA 1YHFA 3H3LA 3U0ZA 2ZPXA 4GWJA 2DUQA 2PFWA 1CX1A 1H8VA 1IS4A 1BXHA 4QX8A 3GXUA 5LY1A 2MEV2 3IPVB 3QACA 4NVPA 2A1XA 1MS8A 5BNPA 1IQAA 4D3WA 2WBKA 1MS1A 1SLAA 4IEOA 3VDBA 4WVMB 3AKRA 1BK1A 3HNMA 3OBTA 3ZN4A 4HT1T 2B4KA 3ZXEA 4P9JA 4LEJA 2JB8A 4QQHA 3POIA 1PMHX 1LCLA 1CZSA 1GQPA 3FHQA 1E5IA 4GMP1 4KU8A 4LBOA 4LKEA 3MHZA 1V6JA 2AH2A 1UN1A 3D0SA 4JHZA 1ZZ6A 3TEYA 4BOWA 2A3WA 3EXUA 4F83A 1CGPA 4XFCA 1XXNA 3W20A 3ZVXA 5IVBA 4V1PA 3DUIA 4N90A 1JYCA 4G3YC 1QJU3 1XBFA 1WW7A 3O5SA 4OVEA 5FBJA 2WJSA 5GLZA 5IAVA 4Z92B 2WO2A 2W5FA 4ZONA 4Q4W3 3VL8A 2WNUC 5FUIA 4IGPA 3WF0A 3Q8EA 3OUHA 5G04L 5C8CB 2PAEA 1O6UA 2RDNA 4YZ4A 3UKTA 2XGXA 4NPMA 3WEZA 1OC1A 2A75A 4DXRA 4IV1C 2AZ5A 3BIEA 1XE8A 1ZZ8A 3SCFA 1VBC1 3HNYM 4QKNA 3SITA 3PMSA 2R0FA 3I7DA 3C7FA 4JGYA 3OPTA 4XJAA 3CJIA 1OVPA 2YMZA 4IEYA 5LBFA 5FFOC 1DQ5A 3LQCA 4LQRA 5BV6A 1KFXL 3WY6A 2AYHA 4OHWA 1WMFA 1PM7A 2VMEA 4NR1A 1RJ7A 4IE4A 2FDJA 4Q0VA 4YW2A 4GA9A 2LALA 4HXCA 5FXWA 5IT6A 1ZZCA 1MS0A 1LJ7A 4IV3B 3OYWA 5CNAA 3W5MA 3RYRA 1LGNA 5FYTA 1XOYA 1YIFA 3WW3A 4XZUG 5JI9A 4OUSA 5K0UA 3WDYA 1GP6A 2QQOA 5E6HA 1K5MA 4BQ3A 2EIEA 2WFF1 1NQJA 5ABJB 1OH3A 2WLQA 3A21A 1X8MA 1OH4A 1ONAA 5BNOA 2RM23 2D6PA 5A7SA 4EZ4A 4TWTA 4XUOA 1HIXA 1F4HA 1Q56A 1R093 3KD4A 5F6KA 3ZYFA 3WQ1A 3MIEA 5A33B 1YQ6A 1W04A 2HYXA 1R1ZA 1UYYA 3KQ4B 4I0WB 4ET7A 5JUVA 4UOJA 3JU9A 4IW3A 4O7XA 4ES9A 1NY72 2X8KA 4LORA 5DN2A 3AYDA 3D4KA 3OF1A 3TWIA 3HT2A 3TEZA 2J22A 3ES1A 1PGW2 4XUPA 1E5SA 3ZPOA 1STMA 1PHMA 1IG3A 1NLQA 3NVCA 1COV1 2IXHA 5BNQA 4HOOA 2UYAA 1AXKA 1AVBA 1YIPA 1WA6X 3GZTB 5FPXA 3I3BA 3VBUB 3GJAA 1JUIA 1IPKA 1ND2C 3J8F3 4CCKA 2BTVC 4JC1A 4JRLA 5A3OA 4E27A 2BPA2 4BB3A 1PNGA 1F5JA 1LEMA 3PNAA 2K2SA 2RG4A 4Y5TA 2HWB1 1Y9GA 5LBEA 3MLKA 4TTGA 4CP1A 4KBBA 4AVAA 4YW1A 1S55A 2WINB 2ES3A 2WL1A 4XFBA 2CAUA 4R4ZA 5H9SA 1W6QB 1S0BA 2XWBB 4LBMA 5HCAA 2QQLA 3T4HB 3KZ4C 4OHZA 1ENSA 2HYKA 3PVOA 2XHKA 3LGRA 2QZ3A 3ILRA 4QAWA 3ZYIB 2WNUA 4IEPA 4A3ZA 4NOTA 4YFWA 2VVDA 1F15A 1POQA 4CA9A 3AX4A 3T1LA 3VKNA 4P14A 1JODA 5KC6A 2WZR3 3GDBA 4OYUA 1QMJA 2ZAAA 2GU9A 3K4AA 2VNGA 2RV9A 1W39A 4IV1A 3APBA 1MVEA 4BLIA 1TEIA 2PHUA 4ZXEA 5FRAA 4LBNA 5FMOL 5FUNA 2QQWA 2IXCA 3ZMNA 3THPA 2BDRA 2E7QA 2PAMA 4IQPA 2V73A 1ZREA 4HSJA 1U12A 4H2AA 2WABA 4XC9A 4AG4A 2VZUA 1CPNA 1HDKA 4N8MA 4DINB 3VZOA 3NJVA 5J7MA 3SCGA 4LUKA 2K9ZA 3URFA 2Q30A 2JICA 4AR2A 5C8CC 5FQ0A 1MEC1 2FCTA 2E32A 2HEVF 2ZGTA 5FYBA 1S0DA 5TSWA 1UL9A 1QJY2 4PJYA 2JDMA 2VL4A 5CVRA 1LOEA 1W05A 4XCBA 3S5AA 3FN9A 2FDGA 3I97A 1VRH2 1V0AA 4TXWA 3CF6E 1RMU3 4OLLA 3ZFEB 3T08A 2VC9A 1YFUA 3RMXA 3PVEA 5BNNB 1A8DA 3CBNA 2ZHNA 4Y5SA 3CL1A 3P6BA 1WMXA 3MO4A 2A5ZA 3WNOA 2JDNA 1RUG1 1MVQA 2CNAA 1NOVA 3LPGA 2VU9A 5A7WA 5IW0A 2V4VA 4XHXA 1NE6A 2HWD1 3BTYA 4YM3A 2JDAA 1FYUA 5LCWL 2Z2SB 1W9TA 2I74A 4C90A 4IV3C 3B94A 1HXS1 3F95A 5FZEA 1H9WA 4AQ2A 3CO2A 1VR3A 5FZBA 4L11A 4A44A 4HKLA 2V09A 3PMEA 3P1IA 4OCTA 1IS6A 1UCXA 1AR83 1SZBA 4CCMA 5ABJC 1I1EA 1CAWA 2VZVA 1OD3A 4FPGA 4PCRA 2ET1A 1NE4A 3V0AA 3KV6A 5FZAA 2XJRA 2CDPA 4XQWA 3THTA 4CP9A 2MEV3 3O1UA 1CAVB 2QZ2A 4BHPA 1ND2A 1YFYA 5CEHA 1ULCA 1R082 2FDKA 1LULA 5L7OA 2QJVA 3T4VA 5JOWA 1HLCA 1JW6A 3SMHA 4BJ0A 4JTOA 2P37A 2XONA 4HPKA 3NAPC 4LIUA 3OOXA 1OA3A 4KGGA 4A2UA 1FX5A 2QQVA 1O59A 2ZMKA 5JXJA 3CMGA 5CB7A 2WA4A 4S2HA 1V9U3 1NA1B 1UU5A 5JMOA 1WWYA 1FPN1 2BZDA 4BCUA 4FTSA 1RUF1 3B5LB 2Y64A 1Y43B 4R9BA 2YBPA 5DDJ2 4BLJA 2BW8A 3T0AA 3O0WA 4CU9A 3FWEA 3KLSA 3WP5A 1VALA 1CZTA 4NIIA 4WVMA 1I9RA 1WBFA 5A3UA 3MIGA 4D94A 1EUUA 4QXBA 1LU1A 1NT0A 4OHXA 4YVWA 3WSOA 3KVBA 4QU1A 2ZZQA 3USUA 1ZVFA 2ZEXA 2A71A 4A7KA 5FZOA 3I54A 3RMYA 2OZ6A 5FMOS 4KU7A 2VTXJ 4D7TA 4FAGA 4LBQA 4M0NA 2CGPA 4WM8B 3V65A 2F4PA 3BALA 3ST7A 3IZOA 4HBNA 1IS5A 5T5JA 4K40A 4HL0A 1ZYBA 3TB0A 5T5LA 4YWAA 2YY1A 4CUGA 1RUE3 1UU4A 1IPSA 5A1LA 4D7YA 1K5JA 5C9AB 2FQPA 1JXNA 1H30A 1V6OA 1WZXA 1JTZX 2XHNA 1TMF1 3H9AA 4L9BA 1EY2A 2D6MA 5KXBA 3AMQA 5DPNA 4NMIA 1ND3A 1NXMA 4PIZA 4E2QA 5EYXA 1GLHA 2R1DA 1J83A 2JDZA 4OI0A 4W6YA 5A6QA 3MPBA 2XL7A 1BEV3 4XFGA 3RRDA 4AGGA 3DKQA 4EE2A 4NWVA 5HBAA 4BIFA 5FJKA 2PLV1 2WYFA 1NX9A 1VE0A 2Y6JA 4YGDA 5HPOA 3UKNA 1J3RA 1QNWA 4YZ1A 2KR2A 1S0IA 3PJQA 4OQ8A 1RUD1 4GWIA 1DIWA 1RUJ1 4M00A 5FV3A 5FCCA 4SBVA 2PTMA 3ASIA 4IV3A 4U2AA 5GKAC 1CX4A 3B3QE 3ZFEC 1XU2A 4O65A 4XYXA 5BNNC 2VO5A 4K1ZA 5M0TA 1Y3TA 3E97A 3NW4A 5D8AB 4TLGA 4Q8KA 4LK7A 4XFAA 4AEMA 1X7NA 5FOJB 3MF9A 1RIRA 5FZ7A 1Q8SA 3R4DB 1AX2A 4QX0A 2G9GA 2ILMA 4QX7A 5A33A 4XHBA 3BGAA 3LSEA 1GZWB 1G7YA 2VG9A 4LE3A 3RI8A 3UETA 1W6OA 2YU2A 4KWLA 2EAKA 3DL3A 2DBIA 1O91A 3NAPA 3ZN6A 5FDBA 2GC3A 3KSCA 3Q8CA 3WP6A 3HWJA 4DFSA 3JBG1 2PA7A 2TNFA 1JH5A 1GU3A 4FTEA 4FVVA 1SBFA 4MADA 4XABA 3PUQA 1VIWB 1X9TA 1GZTA 3B9CA 2BFUL 4W6WA 1P8JA 3T2QA 3M3EA 1HN1A 5DUXA 3ZYBA 4H7LA 4JRAA 3EJKA 5GZCA 1SBEA 2CWMA 3I2HA 4GMP0 4Y1XA 3CLPA 4FPFA 2XL9A 1CD3G 1V00A 2XBO2 3RWNA 1XRUA 4GB31 4KH9A 2VM9A 5D1IA 4HKOA 4ZPIA 5FWJA 2RR13 2ZMLA 1DGRN 1NA1C 3NMBA 3HVDA 1QQP2 1V70A 2JE9A 4QHZA 1F8VA 1E57A 1J84A 1AYM1 2DUPA 1SMVA 4GQ7A 3M7AA 1AR72 4HVOA 4CXXA 2YUEA 3ETPA 2PHFA 1W9WA 2QUOA 2ARCA 2FMYA 3KT7A 5JXGA 5KC5A 3BTAA 3FBMA 1ZRIA 2GH2A 2RS11 1WCUA 1R1A2 4NAOA 1QDOA 5LK5A 2BOJA 4YFZA 4Y20B 3TNQA 5JOXA 1CWPA 2Y6GA 3M4FA 2DCJA 4GALA 1SFNA 1TME2 2R042 1A3KA 3HOBA 3ZPYA 2X05A 4B8EA 1QJY3 1RYYA 2XJTA 5KXDA 1B35B 3T0DA 3WDUA 1VRH3 4WM8C 3POGA 3GGLA 3K77A 5F8PA 3B7MA 5A6XA 1QH7A 1YUDA 2B46X 3ZYGA 5A80A 2Q8DA 1Q8PA 2RJLA 4IXLA 4A6SA 1G9BA 4XF1A 1J59A 4EN8B 5BNPB 1JZ2A 1ZA4A 2Q1ZB 2ZEZA 4NJ4A 3IN9A 3T09A 3VHOA 1GOFA 4AVVA 2ZJCA 1T2XA 2RMU2 3A22A 4HFSA 3P5BA 4HVRA 4LBQD 4PDWB 3LWCA 2IUWA 4QB6A 5BXXA 5C9AC 5JXIA 4A42A 4META 2WWJA 4M4PA 5J1XA 3W58A 1RJ8A 4CPBA 5IJRA 3ZFEA 1GOHA 4RD7A 1PZ7A 5L73A 1BQPA 1VAKA 1IQDC 2GSYA 1XJAA 2FCUA 5E89A 4GJYA 5F5QA 1PIV1 2HWE3 2VMGA 1UOBA 2HEWF 4DY5A 2ZACA 4JZRA 5FYZA 3MIBA 3O1MA 4K21A 5FZDA 2E26A 3B93A 3OUJA 4BQ2A 2HBTA 1GQHA 3MICA 4QM8A 3SISA 1HJFA 1RUI1 1PM4A 3M1HA 2D40A 3GNEA 4N9HA 4IUGA 1C8M3 5IVYA 2ZBJA 1R083 3U14A 1LOGA 1CONA 1T6GC 2W2IA 1JU4A 1D4M1 2ZX4A 4QQOA 5DUUA 1ENQA 1V6KA 3S7EA 2PYTA 1QJU2 2GC1A 4MGIE 4JGYB 2VUAA 5DABA 1AR92 4QKFA 1WCDJ 3PURA 5DUWA 3CJIB 3MV11 2HKXA 3KCYA 4YVSB 4C0HA 3NV3A 1EAH3 2BFUS 3MW2A 3VL9A 3WDXA 3WF3A 4E8DA 1LOAA 4CRQA 2ZGRA 2DUOA 4L8QA 3RFRA 1ZRDA 2GALA 3JCIA 1WLTA 5FY9A 3HJRA 2VZRA 4XW3A 5I0TA 3UYJA 4E2GA 5DZEA 1NXD1 1SDDB 4UBGA 4NAMA 3S5QA 5LBCA 1BBT1 3VD5A 1EV13 1W2OA 1W2TA 3OEBA 4IE7A 2R30A 4Q4Y1 1AX1A 1VBB1 3OGVA 3QBQA 4ZXKA 3OYWB 2JE7A 3VHRA 2D3RA 1VJ2A 1POV3 4LBJA 2ZA9A 1NA1A 2D6NA 3JB8A 4YYOA 3ZXJA 5L19A 1K5MB 2BP6A 3LDBA 2R32A 1NCQB 4HG6B 1C1FA 2WQ4A 3UKVA 2VZTA 1JZ7A 4J1WA 3WW2A 1V6MA 2JDPA 3W59A 4WVZA 4Q2FA 5FTTC 3SEPA 4TSVA 1JOJA 3U10A 5C5UA 4Q4X3 3RGBA 2BERA 2BBAA 1Q5OA 5T50A 4AI1A 1AR62 2ZGQA 5AC91 2W0XA 4Q0QA 5DUVA 4UWDA 2O14A 2GAUA 3AMHA 1CIWA 4Y3OA 3I2DA 1QHDA 2ATFA 4YZ3A 1H0BA 2DTWA 3GZUC 2GNMA 2D97A 4Y33A 1WD4A 3OBRA 4FO9A 1SLTA 4IE5A 4G4FA 1WD3A 5CIRA 1K3IA 3S6PA 1RHI3 2ZOEB 4B7KA 3U37A 3R0RA 3DECA 5JR7B 4XFIA 1Z7S1 1RB8G 4BQ4A 1H6YA 2XJUA 1IZ3A 3LKJA 5FPLA 1ZX5A 4JCKA 4LUMA 1VBA2 5C9AA 1RC6A 3ZXAC 1LOBA 3NSTA 2XPJA 1HRI1 1S2BA 4Q0PA 5IVFA 1GWLA 3VB9A 4XE9A 4MGYE 2DV9A 2CGOA 4QXKA 3ENRA 4XETA 5FWEA 5DXDA 4FCAA 4OZXA 4Y1ZA 1B35C 4RR3B 5A32B 3E6BA 2C4XA 2YC0A 4YW6A 5LA9A 1NQDA 3P3PA 1CQ9A 2J7MA 1S0CA 3IWZA 3Q8FA 2Q8CA 5BNPC 4BE3A 3AJYA 3I2FA 2WNUB 2VQAA 5FPAA 1PO21 4RGAA 4AK3A 2Y6HA 4PDWC 1RVF1 4I09A 2R061 4XJZA 1XC6A 5C7GA 1UY4A 5DG2A 3RDIA 3KM5A 3R05A 2OIIA 4IV1B 3VZLA 2OQ7A 1FMD1 1UY2A 3OGJA 3WV6A 3LFIA 4BYYA 2R072 5ACA1 1ODMA 2D3SA 2IFWA 4J6GA 4FPYA 3HEIA 1U5YA 5AVAA 1OURA 4B1LA 2XVGA 2GNBA 3MBWA 4PLMA 5KHHA 5J09A 3D6EA 3KV5A 3I2GA 1OLME 3K48A 5AVPA 4A7ZA 1PO11 1LNSA 4CPBD 3OGSA 2Y0OA 1RUH3 2HWF2 2YC4A 3KT4A 1GZWA 1YWKA 1PMIA 4Q0SA 5FQ0B 2MNGA 5EP9A 2GDFA 5FZ6A 1GNHA 4OUEA 2P3KA 1JS9A 2GN3A 2XBO3 2P5BA 2Z69A 3H8RA 3GZEA 1XE0A 1TQ5A 4P5HA 1PX3A 1TVGA 4N53A 3KCCA 3CJIC 3N7LA 2VCCA 4YVSC 2AC1A 4LBKA 1NKGA 2XH6A 3W9AA 5HI0A 1VMJA 2BGCA 5FXZA 3VD7A 1QJZA 1PVC2 2QQMA 2B9UA 1RXGA 1G9AA 1FOD2 1NAEA 3ZKYA 1H2NA 3CQOA 2BQPA 4Z07A 1OXCA 3IKWA 4ZKTB 4RGKA 5IK7A 5GLWA 3BN6A 3GJBA 4AI0A 4RA0A 2PQQA 1RMU2 4YG3A 2ZABA 1R1A3 1OFNA 1VBE3 3PVNA 1OLRA 1ULFA 1BVVA 3AL6A 3POYA 5FMCA 1L7QA 3IAPA 4FOWA 4CU7A 3ZXGA 1TME3 2R043 3SEEA 4AVTA 4DS0A 1K5MC 4XACA 4XTMA 4Q4W1 1U5XA 1NCQC 3WQ7A 3HT1A 4I02A 2A3XA 3J7NA 5JSPA 1SLBA 3AMNA 5A3NA 1UO9A 1KS4A 3OCPA 3VKFC 3V0AB 3S57A 5D21A 4CDQA 4I30A 2RDSA 1VAMA 2LW8A 5FYSA 4Q29A 4LKDA 3ZSMA 3AYAA 3ME2A 2LROA 2QNKA 4LHKA 4Y20A 1G6NA 1PGL1 4HKWA 3TOJA 4CCLA 5L7OB 1BLZA 3B02A 4LO6B 2RMU3 5FZGA 1VBD2 3WX5A 4AFDA 1MZEA 1AR82 1B35A 4GKXA 5E8AA 3RI9A 1A34A 3AB0A 5GLUA 3E5QA 3OJBA 5FLJA 1QH6A 1SPPA 2QQNA 2I45A 3J7LA 3UGGA 4AVBA 4AZZA 5F39A 4QGNA 4BISA 1LGBA 1YJKA 2L9LA 4E4ZA 3RPQA 1OQEA 2P1BA 4PDWA 2E7TA 4QHBA 4JKMA 1QOOA 4BZ4A 1UOJA 5CG9A 4LO4B 1B09A 2P6CA 5DZGA 4YVWB 4CDWA 1JUHA 3NL1A 4Y5Z0 4I01A 4DEVA 3USUB 4PI0A 1V9U2 3ZXLA 5FZOB 1OA4A 5A3LA 5SV8A 4IE6A 4RR3C 1DZQA 2QE3A 2RM21 2FDHA 4LBQB 2W39A 1R091 3ECQA 1FI2A 1IGOA 3HD8B 4Y4RA 5SV5A 4NUBA 3AZXA 1LESA 1W0NA 1AR93 1Z0HA 3USSA 4LO8A 4FP3A 2IXIA 2X5IB 3VZMA 1J1LA 3HBKA 2A6VA 1SHWB 5EZWA 5EFUA 5FY7A 5FO8B 1HRV1 2J1UA 5IUQA 5EIYB 1SFPA 5FREA 2FHRA 4P08A 1NLRA 3KS7A 4Q4V2 4RFRB 2IVIB 5FY4A 4O61A 4JQRA 1ND3B 1UZZA 2WAOA 2ZGLA 4LO5B 4AQTA 2VZSA 4HZFA 2RE9A 3KV4A 1ZRCA 4QGMA 4IDZA 4I0AA 1JMUB 4YVSA 3WVJA 1J3QA 2O8OA 3J8F1 2AREA 3OBAA 2EIBA 3VZKA 3O14A 3VLBB 2SBAA 4IEVA 1RUE2 3SH4A 2GZWA 4H3WA 1N1YA 2OA2A 4JVAA 1DQ2A 2B7YA 3R6SA 2A73B 2GN7A 1L7LA 4COVA 3LEKA 4XJ8A 1EPWA 3ZLIA 4HONA 2D3PA 4FT8A 2AEYA 4Q27A 1W90A 1AR63 1BEV2 1XYNA 2W68A 2HBUA 2BOIA 2UY8A 1PX4A 3FBYA 1Q8QA 1QJX2 3JQXA 2PXJA 4UFIA 4DO0A 1NCQA 2GMEA 3H50A 2XKOA 4M3CE 4UXAA 5D2AA 1S2KA 2WS93 4XBNA 3GBFA 3OY8A 4LPLA 3AVSA 4CUCA 1N1SA 2J1SA 3WD5A 3LOIA 3KHCA 2WZR1 2E9QA 4PQ9A 3VV1A 4AEKA 5DAPA 4OULA 2CGNA 4FFIA 2I2SA 2R16A 3FHAA 2C0ZA 4XURA 5L9VA 4KWUA 1OHFA 1N47A 1XSQA 2H6BA 3K4DA 1W6OB 1VBA3 3NJZA 2WC2A 4RQPB 3NAPB 2HWC2 3ES4A 4YM2A 1YC61 3ZN6B 2XKPA 2CY6A 1LOCA 3LIGA 3DGTA 1UYPA 2WN2A 2WWSA 3FLPA 3WG1A 4C1WA 4TZDA 4JDOA 3GHMA 5F3EA 5BYNA 4B4RA 3WNKA 1DLCA 2YXSA 5FZLA 2ZGUA 4XMAA 1ASJ1 3AKTA 3K2OA 2VUCA 3AYEA 4OI4A 3KWVA 1UIKA 2C9KA 2JEMA 1PVXA 1JOBA 2CHHA 4ONUA 5I8YA 1AHSA 4CEYB 2BNMA 5L7OC 4KG8A 2D5FA 3DCQA 3MW4A 4AGRA 4GIQA 4AHXA 1FATA 3N7JA 3U78A 4E4SA 4RR3A 5A32A 5J37A 4DXTA 3N4MA 4QX1A 5EJ1B 3BUCA 4O9GA 4XIKA 5L36A 4R8HA 1IHMA 1YJLA 2R073 4MZUA 1YI7A 3M3OA 2WRAA 5CKNA 1GBGA 1ULDA 2LRPA 3AZYA 2RS51 4PLNA 3RSJA 3DF0A 5JPNB 2XVLA 4YNIA 1G9CA 1JZ5A 3HNBM 2PMWB 5H9QA 3IDBB 1AUYA 5T5PA 2HWF3 4YVWC 2OW4A 3LZZA 5A3WA 4KMQA 2RR12 1XYOA 5CKMA 4YLZA 3POWA 4JAAA 4BXSV 2RJ2A 3JB4C 1H8TB 5FZ1A 2XLAA 4JQTA 2MEV1 1SCSA 3ATGA 4V2WA 4WZFA 3U11A 2B39A 2YPDA 3WNPA 2EXHA 1DG6A 4H14A 4Z82A 2VAUA 4KWJA 2W1QA 4LK6A 4L97A 2CL2A 4LHSA 4GJZA 3I49A 2W47A 2X5IC 2VUDA 3DYPA 2PHXA 4OZOA 1QXPA 1PVC3 2QQKA 1MS3A 4DPNA 4P9WA 4RL7A 1FOD3 3PIJA 3MFAA 3VUOA 1ZBA3 4EV0A 3JZVA 5JDBA 1WLCA 2B8MA 4H7MA 5C3SA 3OB8A 4M4RA 3T2TA 3A7QA 3EQEA 1KGYA 1ND3C 5L9BA 4DMIA 3MUY1 2PHLA 2VUJA 2B42B 2XMLA 3POEA 5F6LB 1BMV2 3FL7A 3OSDA 1OPOA 2EXJA 4WVVA 4UT5A 5FZMA 1ZBE2 4MHRA 5FYYA 3M8LA 2IXKA 4A3XA 4MX3A 1GZCA 5FLHA 2MPFA 3FZ3A 4N7IA 1JYNA 1UD1A 2G19A 4I3PA 1CAUA 1EUTA 3ZR5A 3O1TA 1G9FA 2QDRA 4MXWA 4AI8A 1HX6A 4FI9A 5FYIA 5DAQA 3FJSA 5FZ4A 5F2WA 4XOGA 2R6QA 1AL22 1UKRA 3N7MA 3NWKA 4K7JA 4XF0A 3ZKUA 2WT0A 1VBD3 3WLUA 2HWB3 2HWE2 4ZY9A 3ZSJA 3FFZA 2WFPA 5F9TA 3ACLA 1QJFA 2OKXA 1CIYA 1PK6B 2ZKLA 2WZEA 2VMFA 4MO3M 4Y24A 1C8M2 4QPIA 4ASKA 3WOGA 2P6HA 5CISA 1TNFA 4IL7A 1LHUA 4D6SA 1D7PM 1OUXA 4KQ7A 1OLQA 5T5OA 2Y38A 3E5XA 5JPMB 1W8NA 1S2EA 4OFGA 1XNCA 4RQPC 2NZ9A 1MQTB 3W21A 5IATA 1CESA 2J42A 3OUIA 1W99A 1TNRA 1U5IA 1CPMA 1C5HA 2QQJA 2GMMA 4DB5A 1EAH2 1CJPA 5F3CA 4QQLA 1UPIA 5FLIA 3TN92 4RHV2 5I8TA 2XG3A 2VBDA 3MPPG 1CAXB 2NM1A 3DKWA 5E88A 3RG0A 3TEWA 1BVP1 2IFRA 2WLPA 3A0NA 3AVRA 2ERFA 2NYYA 2E6VA 1EV12 1K12A 1QNYA 3J9SA 4QDQA 1KQRA 3CEWA 4R9DA 2QQPA 2Y26A 1C8NA 4ORFA 5A7QA 3TBDA 4CEYC 4GD4A 1W6MB 1S0EA 2WIIB 1NY71 2GNTA 5FYUA 2ARXA 5FPUA 2YDEA 4LA3A 4XJUA 3ILNA 3LDKA 1MEC3 2VBBA 3VBRA 3HR9A 5T3NA 1PGW1 4BQYA 2E31A 3N3HA 5A3MA 4LJHA 1S1AA 1SEFA 2VZ3A 3CZUA 4YGEA 4Q4V3 4ITCA 4NN0A 1NCRC 3I3EA 4RYDA 3E6DA 2F4LA 4D6RA 4GXLA 4PLOA 4TYSA 5FO7B 5CA6A 3KF5A 1GICA 5FZFA 4ZZ8A 2ZXQA 4W65A 5LZ6A 5KBFA 1LENA 1SG3A 4Q4X2 1G86A 2X5IA 3EB7A 3UGHA 3M3QA 5FJHA 3BYWA 2ENRA 4A41A 2OUHA 2PN5A 2XLGA 3ZXDA 1YLLA 3WQBA 3O12A 3K46A 3AKQA 2WN3A 1IPJA 4QMAA 4GAZA 5JIAA 4Y26A 3QH7A 4QQPA 5C3RA 5ANQA 1W3VA 3QD6A 5DAWA 1H8TC 1HXS3 1RHI2 4LOSA 4P9XA 2UWCA 5IVCA 5B2GB 4CCEA 3QCWA 1QJX3 2Q0AA 1OKQA 5FK8A 3ROUA 3RZHA 1UMHA 1S0FA 4XAAA 2ETEA 4BDVB 2DU0A 1KJRA 1W8OA 4QM9A 4YM1A 5C70A 1X33A 3SLIA 1L7RA 5IFTA 3VBSB 4HVQA 4MG2A 3AZWA 2RR11 3GALA 3VZNA 1Y7BA 1CVNA 2DVFA 2ZGPA 4EJRA 1V6LA 1KD7A 4K3UA 2VMDA 2ZX3A 3KF3A 3SXWA 4YG6A 5JXHA 2HWC3 2JJ6A 1MPXA 1DGWA 4BH9A 2WDBA 3AXEA 3UJQA 1DQ1A 3FLRA 5FPVA 2PQSA 1RUF3 3IIIA 1YQ2A 3KMHA 2PHRA 4XFHA 5GZDA 3ZOIA 4ES8A 1OOPA 4QDSA 5FBZA 4AGVA 3BI3A 2R1BA 1QJY1 3SNMA 3JXSA 2VNOA 1R64A 1KEXA 3IMMA 4XXPA 5AFEA 5J3UA 3RZLA 1DYOA 1VRH1 1QJEA 4NPRA 4XPVA 1W9FA 4RQPA 3O1VA 3ON7A 4C91A 1WKYA 1ZNPA 1UX7A 2VULA 2VMIA 5C33A 3EBRA 2DVAA 3E6CC 3U1XA 2HLEA 5T54A 2W3JA 2VQUA 4FSJA 5IVEA 4N53B 4C8DA 2D7FA 3GCXA 2W46A 5FZ9A 2YU1A 1RUH2 2BRTA 2QQIA 2VVEA 2P2KA 2VMCA 1PK6C 5A7NA 5HV0A 4S2DA 2PELA 2O0OA 1U0AA 4AQ6A 4FTBA 3D82A 3AP4A 5I0UA 3M3IA 1AYN2 2DDUA 4EN7B 5I0SA 4K8FA 4CEYA 2J1RA 2ZCWA 1OVSA 1S4CA 1APNA 2J1TA 2XR4A 2YGLA 2VOXA 1UZYA 3H3ZA 4HLTA 4JTNA 5A6ZA 4HANA 1CN1A 3G7DA 1MQTC 1QXRA 3RZZA 4PHZA 1DBNA 3WT3A 1C57A 3NV1A 4NIDA 1TMF3 4KL1A 1GV9A 3AK0A 2RDQA 3UJOA 1NCRA 5A1FA 1LHNA 1X82A 3AM2A 5EHDA 1HW5A 5F1RA 1WBLA 4LKFA 4HN0A 2E53A 4CDQB 1WMEA 2WO1A 1CZVA 2IXJA 2P4EA 1R081 1ZZ7A 5FUPA 3L9JT 5KHKA 3LEMA 1ZZBA 3K51A 4N9IA 2DU1A 3OBZA 4QPYA 3VBHC 2E63A 3EYPA 1VBE2 4DRVA 1GUIA 2VPVA 2WNVB 3WHTA 3WNMA 5FYVA 4FPLA 5E16A 1XPWA 4COUA 1RUJ3 2NPIA 4KWKA 4BQWA 2WNOA 1WA4A 3V64A 3DEMA 1UYZA 5CADA 2GH8A 1H8TA 2VZQA 1SLCA 1I5ZA 2EALA 2Y6FA 5DDJ1 4MGTA 5J98B 2RDRA 1SPPB 1AX0A 2EXIA 4AEJA 1UPSA 1DP0A 2XUMA 3ZR6A 2D93A 1BCXA 2NQYA 1J3PA 1ZBE3 2BGPA 3HN1A 3PLQA 5HCBA 3UGFA 1EPZA 3C3VA 4CCDA 2Y60A 3A23A 1POV1 2VE1A 1SQ4A 1ZRRA 5JZGC 3A0KA 1H4HA 3POFA 4JHTA 3JD72 1QXJA 3N35A 4CDWB 2V72A 1LRHA 3EMRA 4L0PA 4PT6A 3SKVA 2GP3A 3RYKA 2RVAA 3T2OA 1PNFA 2WWUA 3J26N 1UMIA 4FXKB 1QOSA 2DVBA 1AL23 3ZYRA 1LHOA 5IK4A 3FHIB 1WW4A 1SDWA 2IWGB 4Q4X1 3WF4A 5LEJA 3DV8A 1RUC2 2ZX0A 3NNGA 4QD2A 1VPHA 2O1QA 4BQ1A 3CIHA 2WNEA 1N1VA 1UNBA 3PTYA 3OTFA 2WO3A 2GMPA 3ZFFB 5F5CA 4P9YA 3VBSC 2OX0A 2PAKA 3N9OA 3G6JB 2ZTNA 5FYCA 3Q8BA 3WDVA 4FAHA 1C28A 4EZHA 3WF1A 1SCRA 1H1AA 4R4XA 2ZGSA 4LNVA 4Q1RA 4EWAA 5KWRA 2Y6KA 5F2SA 4MVTA 4XMIA 1LTEA 3N9QA 1YNAA 4C1XA 3BTZA 5EJZB 2ZMNA 2J1VA 3H7JA 2Q1MA 3NV4A 1Y9MA 4D8MA 4QPWA 4INDA 2VGDA 3PUHA 1PK6A 1XNTA 4RHV3 3TN93 5FXXA 4AW7A 2RS32 3RQ0A 1LB2A 2CAVA 4CP0A 2VW0A 1V6NA 4JKKA 4LBLA 4ZZ5A 2UWBA 3C7GA 3J4UH 5IFPA 4B29A 1MQTA 5BUVA 2RS13 1RINA 4BK5A 2ID4A 2XB6C 4LULA 1GWKA 3FC0A 2H0BA 2C6SA 5F5AA 4B3NA 2IXLA 4D7SA 3N7KA 4N53C 3IAQA 2Y0IA 1CAXA 3KVAA 1JZ3A 5H9PA 2NLRA 3OY8B 3I8TA 2Y34A 4Z8BA 4A6OA 1OMIA 3RYPA 3LA3A 4OI1A 3VBHA 4I2OA 1W6MA 2BU9A 5FIXA 4NIGA 5CBLA 3KB5A 2VR4A 4AFAA 1H1IA 3PJYA 2HH9A 3QH6A 4LLOA 3IDEA 5GLTA 3WW1A 4TN7A 2YZ4A 4GWMA 3FUOA 2B5HA 3VHNA 3BB6A 1O3SA 4UAPA 2V4AA 2G1MA 2WS92 3VBFB 1UXXX
chains in the Genus database with same CATH topology
1SLLA 2EVXA 4GWNA 4LA2A 1W6PA 3OD0A 4GKYA 4CDQC 5GM0A 1OSGA 1UKGA 1ZZ9A 2E51A 2XBO1 2C5DA 3MIFA 1EYBA 2WNVC 2D98A 5JZGA 5CU1A 5GLVA 4AVSA 4FPCA 4BWOA 1RUI3 1Q8OA 2YHJA 1XQNA 3SH5A 5T55A 1UF2C 3HBZA 1QQP1 4YGCA 4YGBA 4G9SB 4FBFA 5BY5A 4R52A 1AR71 1VP6A 1DFQA 3U4XA 3MFCA 3AKSA 3WUCA 1LODA 1W2UA 3BU7A 1TE1B 1R1A1 2C9AA 3EO6A 2JG8B 2UURA 3MIDA 2YV8A 4AE2A 2D6LX 3VBSA 3AP9A 1TME1 2R041 1LECA 2WSUA 5LRRA 2A70A 3RJ2X 4CDWC 2CTVA 5J96B 3NV2A 2AENA 1X50A 3IDCB 1BBT3 4CDXB 1VBC2 3MEPA 4F7ZA 4Q4Y3 1JHNA 2A6YA 1FNYA 3SCHA 2Q5TA 1ENXA 3T1MA 3VKMA 4JGZB 4XILA 1PZ9A 4UW5A 2VVFA 4M3CB 1O4ZA 2YPJA 2ZGOA 2JG9A 2RMU1 1QF3A 2P34A 1HQWA 1YCIA 1REEA 5I8SA 1H2KA 1LHVA 1AL0G 3ZFFC 4S2GA 4W6XA 4EN0A 2DVGA 4XBQA 1IOAA 1AYN3 4AWDA 4K9SA 3ZYJB 2NN8A 2R0HA 3WP3A 2WKKA 1C5IA 3ZX7A 2BEOA 3AJZA 4XDQA 2WFF2 3BIWE 1OFSA 2O8QA 1MS9A 1GKBA 4FPHA 4AFMA 5K7PA 2BNOA 3S7IA 2PHDA 2X29A 2VW1A 3H1MA 4WM7A 3D5OA 2UU8A 5I91A 1ZBA2 2D6KA 4MH0E 2OUJA 3RNSA 1Z7S3 1CAUB 4DNYA 3HMYA 1WGPA 1O5LA 4JV4A 4MXWB 2DFBA 3TYJA 1YFXA 3O0XA 1QJU1 1GZ9A 3VGIA 2JXAA 5KHIA 1QKQA 1AR91 1SACA 1BYHA 4Y22B 4QX5A 1CJDA 5HXVA 3ZDSA 4FOYA 3KQRA 2G4IA 1DGLA 1COV2 1AJOA 4QGLA 2KM2A 2DCZA 4AI3A 1FV2A 2WT2A 4QPIB 3HAGA 4ISQA 2QKDA 2WNVA 4LO7A 2NP0A 1DHKB 5JVVA 3WHUA 3KGLA 4L99A 1L3JA 1MACA 2HWB2 4MSVA 4ZU7A 1M06G 2JX9A 3VBFC 3MLLA 2ZS6B 3JD73 2ZGNA 2VNRA 1Q43A 5E1RA 1VLNA 4ZU5A 4J1XA 1FV3A 5ACA3 3DPRB 1A8MA 3WNXA 3QOPA 3H1YA 4EWDA 3I59B 1OQDA 3DN7A 1RUC3 1AR61 3FX3A 3WDWA 3OPZA 4LLFA 4K20A 1KDKA 1URXA 2B45X 3P3NA 4YW3A 3ZN5A 3VBRB 2BVBA 1OA2A 3M3CA 1ZM1A 4Y4YA 3VKLA 4YW4A 1PGSA 3KT1A 1WCSA 1V6IA 2DURA 2HEYF 2VOKA 3ZXFA 4AYUA 2JG8C 1VBA1 2CV6A 3ZFFA 1PZ8A 4P9LA 1MEC2 2RS33 4COYA 4COZA 3LCPA 4CDXC 2TUNA 4JDNA 3WG2A 1DZRA 1YYNA 4QQ2A 1OD5A 4Q0UA 2EA7A 1Q3EA 4Q1PA 4JGZC 4AFCA 2I07B 4PF5A 1WW5A 2P3JA 1RUG2 1AJKA 4BM8A 3MLJA 2WQZC 1NG0A 1OPMA 2HWD2 4K1YA 4U36A 1C1LA 3ILFA 1UMZA 1DLLA 3MDPA 1DDLA 1HXS2 4NHKA 2SLIA 4XFFA 2OYZA 2AUYA 2R071 4LE4A 3UK9A 3ZSLA 4X6QB 4WV8A 1UIJA 4MGKE 1MZ6A 1O4TA 1N1TA 4CEWB 1W6NB 2HWF1 5EYYA 4X8PA 3WW4A 2WA3A 2ZAHA 1OOPB 3CJXA 3L2YA 5JLVA 3H8UA 4HSLA 4PBPA 4Z2WA 4AFBA 3VBFA 3AZZA 4GMP3 2P17A 4S2FA 2ZGMA 1FPN2 1O4YA 1PVC1 1RUF2 4MXVA 1YRZA 1FOD1 4M01A 1ZBA1 3EHKA 1POV0 2HJIA 4FOVA 1H1MA 4IEXA 1DGRA 4QPIC 4XQDA 3B9IA 4P9GA 3SHRA 4BMBA 1RMU1 1GFF2 4UW3A 1NZCA 5CAZA 2BBVA 3NO8A 1CR7A 1HRV3 3WZ1A 5EV7A 3UL2A 1XNDA 1UW8A 2E7AA 1H4GA 4O9EA 1NCRB 1VBC3 2ZGKA 3WXPA 1A6CA 3DPRC 3C2UA 4IEUA 1O3QA 4MLOA 3WINE 1F2NA 2JG8A 3GYDA 2OZJA 5LEKA 3Q9OA 4OUMA 1VBD1 1ENRA 1AR81 1KFUL 1TMF2 5LK7B 1S0GA 4CDXA 2AGSA 1VB4A 4QPGB 3QLQA 4XXAA 3VBRC 3VKOA 5T52A 5IK8A 5J36A 4NHMA 3KGZA 4FQ4A 3WR0A 2DWRA 2ZZJA 2ARBA 4JGZA 1WLDA 2PLV2 2WFF3 3BPZA 4M3CA 3WCSA 3BOPA 2EAAA 4RS5B 1RUD2 1RUJ2 2DCKA 1V9U1 2ET7A 1JBCA 4M3CF 4ATFA 1O3RA 4HK8A 1H2MA 4OI2A 3LOBA 3VBOB 2H6CA 1YI9A 2QCSB 2UYBA 3M70A 5JOZA 3HIFA 5GZEA 1HV1A 3A4UA 1COV3 1AXZA 2UWAA 1ASJ3 4AVCA 2N7GA 1MZ5A 2YROA 4Q4V1 3FMGA 4F3JA 5HCFA 2GC0A 3MI8A 4BA6A 4Y22A 4R9CA 3JBG2 5JWPA 5CFCB 1SBDA 2Q4SA 5C4WB 1KRIA 3MGUA 1RUE1 1LHWA 4CEWC 3BCWA 4QU2A 1OOPC 3WCRA 1W0OA 4MUVA 2RS53 2D6OX 2Z79A 1J1TA 2VW2A 3I4IA 4GB32 1BEV1 4IESA 1RITA 4LR4A 2VH9A 1HQNA 3AMMA 3WG4A 1ALYA 4M0HA 1RUOA 1QJX1 4WVWA 2BWCA 1AXYA 3AZVA 5DZFA 1HQLA 4AQSA 1Z78A 4CTEA 2Z5WA 4CDUB 2MHFA 1YO8A 2ZX2A 3WP4A 2C1FA 3MYXA 4ATEA 3DPRA 1QU0A 1AYM2 1GSLA 3AFKA 4B7EA 1D0HA 1UU6A 3I59A 2P3IA 4YG0A 4OHYA 4Y1UA 5H9RA 3VBHB 2X53S 1XNBA 2RS12 3VHPA 2HWC1 4LTAA 3RJRA 3ELNA 4Y1YA 1J58A 4DZGA 4XZPA 3GHNA 3JUUA 1QDCA 3HQXA 3S0MA 1WMDA 3IPVA 3VDDB 3PVBB 1MS5A 3ZO0B 1W6PB 3VBUC 3KCXA 1ZRFA 3OGGA 3V0BB 2TBVA 2NMNA 5JSRA 3NKTA 1F5FA 1RUG3 3TAYA 5JZGB 3MZHA 4CP2A 1DQ0A 2HWD3 4QPGC 2Z42A 2DTYA 1N3PA 3FE5A 3UV9A 1WW6A 2D44A 3MF6A 3ALQA 3OD4A 2ZHLA 4N43B 1H2LA 1D0GA 4XEZA 4HK9A 1PIV2 3ZFGB 4GH4B 2RJKA 2Q8OA 4FPEA 5JMCA 4RSUA 2CYFA 5C8CA 1QWRA 4YRDA 4RS5C 5GZFA 1RUI2 3U07A 3B69A 4AEDB 3AMPA 3ZSEA 1EP0A 1LKNA 1I3HA 3GBGA 5K9YA 1D4M2 1FT9A 5LRSA 4Z1VA 4YZ5A 1RUNA 3VBOC 1D2SA 1DU3D 3ZIXA 3GZAA 4WBBA 1SFYA 4CEWA 1W6NA 4XIOA 3O0VA 5CFDB 1AF9A 1FPN3 4UBHA 2JG9B 1DQ6A 3B01A 4PIYA 1BBT2 3S30A 4Q4Y2 4UW6A 5KHJA 5IK5A 1VBB2 3H7YA 3PHMA 1BKZA 1BMV1 3IBMA 2CWSA 2W08A 4BIOA 5ABJA 5CFCC 2ZKNA 5C4WC 1ZBE1 1O5UA 3E5UA 4FOQA 5J48A 1GYKA 1WCKA 1YXWA 2QFEA 2ZHKA 4XJ9A 4WM7B 2NMOA 4NO4A 4FPJA 1U5ZA 4X8NA 1LGCA 3X29B 3R4SA 4B4QA 4CYDA 1AL21 5AC92 1XYPA 4MYEA 4IEQA 5C6CA 2HWE1 1UX6A 3ZMOA 5I93A 3LA7A 3AP5A 3AKPA 4COWA 3RS6A 4CDUC 4SLIA 4AHWA 5FOBB 3IIAA 3VBUA 1LOFC 1C8M1 1X8EA 1Z7S2 1O3TA 2VQ0A 4A7YA 5KHGA 2PLV3 1F9KA 2R49A 4FXGB 4E9KA 2LM3A 2GC2A 4IETA 1HRI2 3B00A 1NYWA 1RUD3 4QPGA 2JECA 4FQZA 4DOUA 2BYVE 3TRSB 3IMNA 1EAH1 2DYCA 3MW3A 4NWWA 1BJQA 3FFQA 4XF3A 1W6QA 3TN91 4RHV1 4YARA 2JD4A 3CNAA 5BPXA 5J3UA 2IC1A 3WDTA 4EWEA 3VDDC 1IKPA 2A6ZA 5K8SA 4EROA 1AZDA 1EV11 4DRRA 4I3GA 4RS5A 1PO22 2G9FA 4TLFA 1RVF2 2EXKA 2R062 2QDNA 1ULEA 5JCTA 3LA2A 1FMD2 1RTVA 3VBOA 4N43C 2DFCA 5ACA2 3JBG3 4E4DX 5GJ6A 1BZWA 1GR3A 3ZFGC 1LU2A 4GH4C 3VZJA 1PO12 4LHNA 1DF0A 1F31A 1QGLA 1A78A 1MZFA 3TNPB 1DYKA 4AEDC 1I6XA 3BODA 2XJPA 3AP7A 3LSDA 4GB33 1RHI1 5BNNA 1VB2A 1XE7A 4H55A 2BWAA 3D0JA 1DGWX 5CFCA 5C4WA 4LHLA 1WLWA 1C4RA 5CFDC 2A3YA 4I0BA 1GNZA 1G8WA 2AR6A 2JG9C 1M4WA 2KXLA 4D69A 1AYM3 3N36A 4YSFA 2FZ2A 2GNDA 3AFGA 4HMZA 4B4PA 1W0PA 1N3QA 2FMDA 2YGMA 2VECA 2OVUA 1XNKA 3ZIWA 2XJSA 2ZX1A 2A6WA 2A7AA 1XU1A 5D8AC 4CDUA 4LT5A 1HKDA 4FP2A 1OQ1A 4Q4W2 2RHPA 3INAA 2D43A 3IM0A 4GULA 1CAVA 4JDMA 1LOFA 4L92A 3AYCA 4ISRA 4WM7C 3FLTA 4Q8LA 5DDJ3 1HV0A 1DZTA 3POSA 2K0GA 1O7FA 4Y1VA 3ZXKA 1PGL2 2W52A 4XF9A 3AXDA 3R4UA 2VY0A 1S0JA 1KITA 2BNNA 1OI6A 5K0UB 3GF6A 4XQ4A 4DQAA 3VDDA 3D8CA 4EN6B 1RUH1 4KG0A 3ZSKA 4AI2A 5BNOB 2XWJB 4ASMB 3V0BA 3FUQA 4X6RB 1AYN1 5I0RA 1PIV3 2EIGA 2BVVA 2XVKA 4IERA 4FPOB 5EWSA 4IEWA 4K6BA 1JN2P 5AFBA 2FZ1A 4OHVA 4AHYA 1RGSA 2DF7A 4F8AA 1GANA 1LR5A 5GZGA 2FBEA 4WM8A 1ULGA 4AXOA 2RM22 4N43A 1SLIA 1NLSA 1D4M3 5JSOA 4YZ2A 1R092 4WZCA 1IS3A 4NHLA 1MS4A 1G9DA 3ZFGA 2QVSB 4GH4A 4ASLA 2VXRA 1JYIA 4QT6A 5JIUA 4PIXA 2DCTA 4IEZA 2JENA 3BOWA 1VBE1 4YM0A 5C8WA 4BPZA 4DY3A 2VMHA 4KNCA 1LEDA 2F6BA 1WUVA 1FXZA 1HRV2 2XJVA 3CU7A 1RL3A 1KDMA 4AEDA 5GALA 1UAIA 4RFT0 4URTA 1FAYA 4R9AA 3L2HA 3H0OA 4FPKA 1VBB3 2VOWA 1KS5A 1QY4A 4XF4A 2XJQA 5JI7A 4YW5A 5CFDA 3J8F2 1DQ4A 2ZHMA 1D4VB 2LTNA 3ETQA 2LUWA 3MIHA 4UW4A 3JQWA 4AHZA 3JD71 4AF9A 4L2NA 1QOTA 1REDA 1H9PA 5EXOA 2VOVA 4HN1A 1VAVA 5AC93 1N3OA 5D8AA 5JOYA 2PHTA 3NKGA 3H1WA 1REFA 1RUC1 4PBOA 3SH3A 2XLFA 5FAXA 3WG3A 2WZR2 4E2SA 2DCYA 4RGGA 5CG8A 3ZYPA 2A6XA 2DVDA 2JKBA 4HETA 3VN4A 1D2QA 4KGQA 3GBWA 3LB9A 2YYOA 2H0VA 1GQGA 1KXGA 4N7UA 1HRI3 2WT1A 4XBLA 4MV2A 4EN9B 4JGYC 4Q26A 3IT8A 5FPZA 2TEPA 2D5HA 1DYPA 4MGZE 1QQP3 1X36A 5EJ3A 3WQ0A 1Q8VA 2RS31 5DG1A 5KXEA 3AP6A 4XTPA 1ASJ2 1AR73 4XJWA 4ZU4A 2WSVA 1KJLA 3H3UA 1PO23 2UY9A 1Y9QA 1RVF3 2R063 1C3HA 3WUDA 5K0UC 4CZSA 1FNZA 5KXCA 2WZPP 1CAWB 3O7OA 5JAXA 1FMD3 2IZWA 3M2MA 4P9IA 5BNOC 2PHWA 2OPKA 1MR5A 2RS52 1ND2B 3LAGA 1PO13 4C0BA 1IKQA 1YFWA 2EF6A 4HPKB 2KA3A 2BUKA 2V5YA 4BMEA 2WS91 3V56A 1YHFA 3U0ZA 2ZPXA 2DUQA 2PFWA 1H8VA 1IS4A 1BXHA 2MEV2 3IPVB 3QACA 4NVPA 1MS8A 5BNPA 1IQAA 4D3WA 1MS1A 1SLAA 4IEOA 4WVMB 3AKRA 1BK1A 3OBTA 3ZN4A 4HT1T 3ZXEA 4P9JA 4LEJA 4QQHA 1LCLA 4GMP1 4LBOA 4KU8A 1V6JA 2AH2A 1UN1A 3D0SA 1ZZ6A 4BOWA 2A3WA 3EXUA 4F83A 1CGPA 4XFCA 1XXNA 3ZVXA 4V1PA 3DUIA 4N90A 1JYCA 4G3YC 1QJU3 5GLZA 1WW7A 3O5SA 4OVEA 4DXZA 2WJSA 4Z92B 4Q4W3 3VL8A 2WNUC 5C8CB 2PAEA 4YZ4A 3UKTA 2XGXA 2A75A 4IV1C 2AZ5A 1XE8A 1ZZ8A 3SCFA 1VBC1 3SITA 3PMSA 2R0FA 3I7DA 4JGYA 4XJAA 3CJIA 2YMZA 4IEYA 5FFOC 1DQ5A 5BV6A 1KFXL 3WY6A 2AYHA 4OHWA 1WMFA 1PM7A 4NR1A 1RJ7A 4Q0VA 4YW2A 4GA9A 2LALA 5IT6A 1ZZCA 1MS0A 1LJ7A 4IV3B 3OYWA 5CNAA 3RYRA 1LGNA 1YIFA 3WW3A 5JI9A 4OUSA 5K0UA 3WDYA 1K5MA 2WFF1 1NQJA 5ABJB 2WLQA 1X8MA 1ONAA 5BNOA 2RM23 2D6PA 4TWTA 1HIXA 1Q56A 1R093 3KD4A 5F6KA 3WQ1A 3MIEA 5A33B 1R1ZA 4I0WB 3JU9A 4ES9A 1NY72 2X8KA 3AYDA 3D4KA 3OF1A 3TWIA 3HT2A 3ES1A 1PGW2 1PHMA 3NVCA 1COV1 2IXHA 5BNQA 2UYAA 1AXKA 1AVBA 1YIPA 3GZTB 5FPXA 3VBUB 1JUIA 1IPKA 1ND2C 3J8F3 2BTVC 4JC1A 4JRLA 2BPA2 4E27A 1PNGA 1F5JA 1LEMA 3PNAA 2K2SA 2HWB1 3MLKA 4CP1A 4KBBA 4AVAA 4YW1A 1S55A 2WINB 2WL1A 2ES3A 4XFBA 2CAUA 4R4ZA 5H9SA 1W6QB 1S0BA 2XWBB 4LBMA 5HCAA 3KZ4C 4OHZA 1ENSA 2HYKA 3PVOA 2XHKA 3LGRA 2QZ3A 3ILRA 3ZYIB 2WNUA 4IEPA 4NOTA 4YFWA 2VVDA 3AX4A 3T1LA 3VKNA 4P14A 5KC6A 2WZR3 1QMJA 2ZAAA 2GU9A 2VNGA 4IV1A 1W39A 3APBA 1MVEA 4BLIA 1TEIA 2PHUA 5FRAA 4LBNA 5FMOL 3ZMNA 2IXCA 3THPA 2E7QA 2PAMA 4IQPA 2V73A 1ZREA 4HSJA 1U12A 4AG4A 1CPNA 1HDKA 4DINB 3VZOA 5J7MA 3SCGA 4LUKA 2K9ZA 3URFA 2Q30A 2JICA 5C8CC 5FQ0A 1MEC1 2HEVF 2ZGTA 1S0DA 5TSWA 1UL9A 1QJY2 4PJYA 5CVRA 1LOEA 1VRH2 3CF6E 1RMU3 4OLLA 3ZFEB 1YFUA 3RMXA 3PVEA 5BNNB 1A8DA 2ZHNA 3CL1A 2A5ZA 1RUG1 1MVQA 2CNAA 1NOVA 2VU9A 4XHXA 1NE6A 2HWD1 4YM3A 1FYUA 2Z2SB 2I74A 4C90A 4IV3C 3B94A 1HXS1 1H9WA 4AQ2A 3CO2A 1VR3A 4L11A 4HKLA 2V09A 3PMEA 1IS6A 1UCXA 1AR83 5ABJC 1I1EA 1CAWA 4FPGA 4PCRA 2ET1A 1NE4A 3V0AA 2XJRA 4XQWA 3THTA 2MEV3 1CAVB 2QZ2A 4BHPA 1ND2A 1YFYA 1ULCA 1R082 1LULA 5L7OA 2QJVA 5JOWA 1HLCA 1JW6A 3SMHA 4JTOA 2P37A 4HPKA 3NAPC 1OA3A 4KGGA 4A2UA 1FX5A 2ZMKA 5CB7A 2WA4A 4S2HA 1V9U3 1NA1B 1UU5A 1FPN1 4BCUA 4FTSA 1RUF1 3B5LB 1Y43B 4R9BA 5DDJ2 4BLJA 2BW8A 3O0WA 3FWEA 3KLSA 3WP5A 1VALA 4WVMA 1I9RA 1WBFA 3MIGA 4D94A 1LU1A 4OHXA 4YVWA 2ZZQA 3USUA 1ZVFA 2A71A 4A7KA 3I54A 3RMYA 2OZ6A 5FMOS 4KU7A 4D7TA 4FAGA 4LBQA 4M0NA 2CGPA 4WM8B 3V65A 2F4PA 3BALA 3ST7A 4HBNA 1IS5A 5T5JA 4K40A 4HL0A 1ZYBA 3TB0A 5T5LA 2YY1A 1RUE3 1UU4A 4D7YA 5C9AB 2FQPA 1JXNA 1H30A 1V6OA 4L9BA 1JTZX 3H9AA 1TMF1 1EY2A 2D6MA 5KXBA 3AMQA 1ND3A 1NXMA 4PIZA 4E2QA 5EYXA 1GLHA 2R1DA 2JDZA 4OI0A 4W6YA 3MPBA 2XL7A 1BEV3 4XFGA 3RRDA 4AGGA 4NWVA 5HBAA 4BIFA 2PLV1 4YGDA 3UKNA 1J3RA 1QNWA 4YZ1A 1S0IA 3PJQA 1RUD1 1DIWA 1RUJ1 4M00A 5FCCA 4SBVA 2PTMA 3ASIA 4IV3A 4U2AA 5GKAC 1CX4A 3B3QE 3ZFEC 1XU2A 4XYXA 5BNNC 4K1ZA 1Y3TA 3E97A 3NW4A 5D8AB 4Q8KA 4XFAA 4AEMA 1X7NA 5FOJB 3MF9A 1RIRA 1Q8SA 3R4DB 1AX2A 2G9GA 2ILMA 5A33A 4XHBA 3LSEA 1GZWB 1G7YA 2VG9A 4LE3A 3RI8A 1W6OA 4KWLA 2EAKA 3DL3A 1O91A 3NAPA 3ZN6A 5FDBA 2GC3A 3KSCA 3WP6A 4DFSA 3HWJA 3JBG1 2PA7A 2TNFA 1JH5A 4FTEA 4FVVA 1SBFA 1VIWB 3B9CA 2BFUL 4W6WA 3M3EA 5DUXA 4H7LA 4JRAA 3EJKA 5GZCA 1SBEA 2CWMA 4GMP0 4Y1XA 3CLPA 4FPFA 2XL9A 1CD3G 1V00A 2XBO2 3RWNA 1XRUA 4GB31