4QPGA

Crystal structure of empty hepatitis a virus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
225
structure length
225
Chain Sequence
PVGAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTFPITLSSTSNPPHGLPSTLRWFFNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTPWVEKESALQIDYKTALGAVRFNTRRTGNIQIRLPWYSYLYAVSGALDGLGDKTDSTFGLVSIQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNSNAMLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 37
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12944 HAV_VP Hepatitis A virus viral protein VP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgA00
3TN93 1ZBA2 2BFUL 2X5IB 5CFCA 1TME3 4CDQA 1AR92 1AYN3 2X5IC 5AC92 4YVWC 5A33B 1PGW2 1OPOA 4RS5C 3VBHA 2R062 2RR11 4CDQC 4JGYB 1VBE3 1POV3 3VBSC 1VB2A 2BFUS 1FPN3 2HWD2 4GMP3 1K5MB 5C4WC 1QQP1 4CEYC 5BNOA 2RS33 2RM22 4IV3A 2WLPA 1ND3A 1R083 1NCQC 1VAKA 2HWE1 4N53A 1EAH2 1RUJ1 4GMP0 4EJRA 3CJIA 1TME1 1R082 1CD3G 4GB31 5BNNC 2RMU1 4RHV2 1EAH3 1PO22 5CFDA 5D8AB 2FZ2A 1FOD2 4PDWC 4RHV3 2PLV1 3ZFGB 2DF7A 2RS52 4Q4W2 4AEDA 4RR3C 1C8M1 1PVC1 3NAPC 5K0UA 1RUG2 5C8CC 4LLFA 3JD73 1R091 5J98B 3VBOB 1BEV2 1R093 5C9AA 1EV11 2WS92 2Y26A 5L7OB 3JBG2 1VBA1 4QPGB 1RUD1 2WZR3 1AYM3 4CDWA 1RUG1 3VBOC 1NOVA 3VBFB 5ACA3 4RR3B 1VBC2 2RR13 4QPGA 4GB33 1VBE1 2BBVA 2RS12 1QJY1 1RUI2 2ZAHA 4Q4X2 1PIV2 1RUE1 4Y5Z0 1ASJ2 1AYN2 4CDXA 1D4M3 2RS13 1MEC2 4CEWB 1ZBA3 1RHI2 1AUYA 1AR81 3VBRC 1Z7S3 2WFF1 4Q4Y3 1Z7S1 1H8TB 1BMV1 1NA1C 4CEYB 1RUE2 5C4WB 1VBB3 1HRI2 1K5MC 1VRH3 4CEWA 2RS11 4N43C 4N53B 1COV2 3VBSB 4WM8B 5DDJ1 4RQPB 2X5IA 4CDQB 5K0UC 4CEYA 1RUF3 4AEDC 4RS5B 1PGW1 4RFT0 2TBVA 1HRI1 5GKAC 3JBG1 4YVWB 3JD72 1BMV2 1FMD1 1Z7S2 5FMOL 3VBSA 1R092 1QJU1 1RUJ3 2HWB3 1AYM1 1IHMA 1R1A3 4Q4W1 1RHI1 4BCUA 1V9U1 1AR62 4IV3B 2BPA2 1B35A 4Z92B 4WM7A 1A6CA 1SMVA 1QJX2 1PO21 4Q4X1 3J8F3 1AR71 3NAPA 3VBUC 3JB4C 2WFF2 1RVF3 1PO11 1QJX3 2FZ1A 1EAH1 3ZXAC 1E57A 4WM7C 4QPIA 5CFDC 4JGYA 2RM21 4NWVA 1AL23 1QJU2 1RUC3 1AYN1 1RUI3 1R1A2 1RUD2 1TMF3 4PDWA 1RUH3 1BEV1 2GH8A 5JZGA 1PO13 1QJX1 1K5MA 1NG0A 4YVSB 3LOBA 1VBE2 1NCRA 1C8M2 1BBT3 1OOPC 1PVC2 4QPIC 5C9AC 5DDJ2 1AR61 5BNPC 3ZFEB 1M06G 1MQTC 3VBHB 5DDJ3 4Q4V3 4CDWB 1VBA3 1POV1 4FTEA 4GH4C 1AL0G 5AC91 4GB32 3VBUA 1FMD2 2XBO1 1AR91 3ZFFA 5AC93 1VBA2 3JD71 5ABJA 4CDUB 1TME2 1R1A1 1VRH1 3ZFEA 1QQP3 1NA1A 4IV1A 2PLV3 3ZFGA 4RS5A 1FPN1 4NWWA 1PO12 2MEV3 1QQP2 1ASJ1 5ABJC 1BEV3 3VDDB 3CJIC 4CDXB 4FTSA 4FTBA 1W39A 3CJIB 4CDXC 3VDDC 1QJY2 1RUI1 1TMF1 1VBC1 1AL21 1RUC1 2RM23 1V9U2 1HRV3 5C4WA 5ACA1 1MEC1 3DPRB 2HWF3 1AR83 4N43A 1RUG3 1EV12 1QJZA 4CDWC 3J8F2 1RUD3 1X36A 1PIV3 1MQTB 1ND2B 1ZBE3 5BNPB 2R073 2R061 2RR12 1ND3B 1HX6A 4JGZB 4YVSC 1FOD1 4RR3A 5CFCC 4GH4A 1VBD1 5LK7B 2RMU2 1D4M2 2HWC1 4IV1B 1ASJ3 1ZBA1 1B35C 1HRI3 2R043 5CFDB 4Y4YA 1AR82 4JGZA 4WM7B 4Q4Y2 1BBT2 1NCRC 1OOPA 3M8LA 2RS51 4RQPA 5JZGC 1AR93 5BNNA 1HQNA 3VBUB 5FMOS 3ZFFB 3TN92 5BNOB 1VBB2 2MEV2 2RS31 1PGL1 1PIV1 2HWD1 1H8TA 5BNOC 4GMP1 3ZFFC 4IV3C 1COV3 1BBT1 5JZGB 4Q4Y1 3DPRA 1RUJ2 1POV0 1MEC3 1NCRB 3VBFA 2HWE2 1VBD3 1V9U3 1HXS3 1B35B 1D4M1 1ND2A 2WS93 2ZTNA 4IV1C 5BNPA 2HWB1 2WS91 1RUE3 2BUKA 4AEDB 5CFCB 5K0UB 4YVWA 1RVF2 4JGZC 4RQPC 1ND3C 4WM8C 1RMU3 1RVF1 5C8CA 1COV1 1NCQA 1AR73 1ND2C 4N53C 3J8F1 4N43B 2PLV2 1C8NA 1OHFA 2WZR1 1RMU1 1ZBE2 1NY71 1NA1B 1H8TC 1R081 2HWE3 1HRV1 3DPRC 1EV13 4WM8A 1HXS2 1WCDJ 3JB8A 1RUH2 3VBRB 1C8M3 1PVC3 2IZWA 4FSJA 2RS53 2R072 3VDDA 4Q4V1 2R042 4CEWC 1HXS1 1TMF2 1HRV2 5A32B 1AR63 2MEV1 2RS32 1PGL2 2WZR2 5J96B 2RMU3 5ABJB 1FPN2 2HWD3 1F2NA 2R063 4Q4V2 3VBFC 2R071 1MQTA 2XBO3 1RUF2 1VRH2 2GSYA 2XBO2 4CDUC 2ZZQA 4QPGC 5L7OC 4SBVA 1RB8G 1VBD2 1NY72 4GH4B 2HWF1 5C8CB 3NAPB 3VBHC 2HWC3 3ZFEC 3VBOA 3ZFGC 5C9AB 5L7OA 4PDWB 4QPIB 1OOPB 5D8AC 3VBRA 2HWF2 2VQ0A 1FMD3 5BNNB 2HWB2 1QJY3 3HAGA 4RHV1 3TN91 5ACA2 5D8AA 3FBMA 1RUF1 3IDEA 1GFF2 1DDLA 4YVSA 1NCQB 1AL22 1RUC2 2XPJA 1FOD3 2QQPA 4Q4X3 1PO23 1F8VA 2HWC2 1AR72 4CDUA 3S6PA 5FOJB 1VBC3 1RMU2 1ZBE1 1VBB1 1X33A 1CJDA 1RHI3 4Q4W3 5A33A 4JGYC 1QJU3 2R041 5A32A 1AYM2 2WFF3 2WWSA 1VB4A 3JBG3 1RUH1
chains in the Genus database with same CATH superfamily
4XJZA 2BFUL 3QH6A 1G9AA 1W6PA 1I6XA 2NLRA 4R52A 2BP6A 4F7ZA 4YVWC 5A33B 2GNMA 3NMBA 1OPOA 1W2OA 1U12A 4JRAA 2AACA 2PQSA 1TVGA 2E53A 4XQ4A 4A45A 3HOBA 5FZAA 2QUOA 4GWJA 2CV6A 1H2NA 3LA2A 2RR11 4KWJA 4DY3A 3ZLIA 3VB9A 5LY1A 1VBE3 1XE8A 5FY1A 5A1FA 1ULOA 4UXAA 3ZSLA 3BKZA 4YSFA 3HWJA 5FR3A 1VP6A 1WLCA 1J83A 3D0JA 4LHSA 4CCMA 1LHOA 3LWCA 4UW6A 2BFUS 4ZY9A 1FPN3 3WDWA 2ZEXA 4D6QA 5LZ6A 1MS3A 3FMGA 5H9SA 3UJQA 1O6UA 2XL9A 5L9VA 2K0GA 3TAYA 5FLIA 2OZJA 4AOCA 3FL7A 4P9IA 2JB4A 5JIAA 2BU9A 5DZFA 2ZJCA 5FBZA 4BWOA 1HN1A 5KC5A 1BVP1 4NHKA 2WLPA 3R6SA 1BVVA 4N53A 2UY9A 3WDYA 4XUTA 3ZR5A 2GP5A 4QHBA 1IQAA 1UYZA 4EJRA 5I0TA 3PVBB 1PMJX 4XE9A 4HL0A 5DPNA 4P9LA 4UF0B 3TOJA 1T2XA 3KVBA 5E16A 5T50A 2JDPA 4FPJA 4OI4A 5LATA 1EAH3 1PO22 1H1MA 3T0BA 4LTAA 2B4KA 4IEYA 5A7PA 2FZ2A 4LIVA 3AXEA 3TNQA 2XLFA 4RHV3 3GALA 4XDQA 3GDBA 4AAPA 1OVPA 2F6BA 1OMIA 4UBGA 1GP5A 2V5YA 3LEKA 3ZFGB 3H8OA 3VHOA 3VDCA 5FUPA 4AEDA 1J58A 4GWIA 1OH4A 4OUMA 4Z2AA 3NAPC 5K0UA 3BOWA 2EXKA 3C7FA 4JCKA 3VD3A 1WW5A 3MUY1 4Z82A 1ULFA 4A44A 3O1VA 1EV11 2WS92 4QPGB 1RUD1 3HNMA 1XOYA 4CDWA 3RI8A 4HETA 5GLWA 2XL7A 3M3OA 2NN8A 3PU8A 2W95A 5FYTA 4WVZA 4JZRA 2ZGSA 1VR3A 5ACA3 1RUNA 4Y20B 1UMHA 4YZ2A 2WQ8A 5M0TA 3CHXA 1VBC2 3KLSA 4LHLA 3AJYA 3WP4A 4LBMA 4MO3M 5HXMA 2XUEA 3WF4A 4CU7A 1YQCA 2I45A 4Q0VA 2LTNA 1PIV2 1XE7A 4QX3A 3T09A 4META 4YZ3A 5FZGA 1JW6A 1ASJ2 2EIEA 5FTTC 4K21A 1AYN2 4CDXA 1GZCA 4CPBA 1H0BA 2RS13 4CEWB 3U0ZA 4P08A 1RHI2 2AEYA 1ULCA 2LALA 1G9CA 4Y1UA 3HMYA 4W4ZA 3W9AA 5F9TA 5IVVA 5JIUA 2D6NA 3H1WA 4Q4Y3 3AC0A 2BDRA 2J1RA 3LD8A 1XU2A 2VZSA 3O0WA 5CU1A 1YCIA 2VCAA 2CYFA 3FC0A 5L9RA 1VRH3 4MGIE 1JMUB 5A3NA 1LHNA 2NQYA 2YC0A 1UY1A 4N53B 4OUEA 2ZA9A 2JE9A 2WO3A 1FAYA 1GZWA 2YDEA 3MLKA 3P1IA 3C7OA 4QD2A 1XRUA 1FXZA 4AHWA 2DDUA 3VD9A 4XTMA 1JZ3A 4UFJA 3H0OA 3WNNA 4LBJA 3ON7A 4AEDC 1MS0A 2OXBA 4RFT0 1U0AA 2D97A 2VZVA 3AZWA 5CZKA 4QQHA 4COZA 4F83A 3JUUA 4YVWB 3CQOA 5CKQA 1SLCA 5LEJA 1BMV2 3QACA 1FMD1 3KGLA 1UX6A 1H1IA 1LENA 3V64A 4Q26A 2XJTA 1UQXA 2HWB3 2XWBB 5F5QA 1DLCA 4FPHA 1AYM1 2JDHA 3MO4A 5I8SA 1IS6A 3GM8A 3RZMA 4ASLA 3ZDSA 2DCYA 1V9U1 2FBEA 2KD7A 3AKRA 4BQ4A 2A3XA 3NVCA 4GKYA 4QQ2A 3ELNA 4WM7A 1C1FA 1JXNA 1LOEA 5F5CA 1QMJA 4ISRA 4DMIA 5IFTA 1QJX2 1PO21 1VAVA 3T2PA 3ZYIB 2XKOA 2PYTA 1BHGA 2XH6A 4FXGB 1NZIA 2P1BA 5FY7A 4RFRB 3VBUC 1JYTA 1UZYA 3EB7A 2D3PA 2A73B 2WFF2 1RVF3 1PO11 1HB3A 3QBQA 1HB1A 3ZXAC 4FP3A 4FAGA 1CIWA 3JQXA 1Q5OA 3RMYA 2H0BA 1YFXA 5CFDC 3BI3A 4DXZA 4JGYA 3Q8FA 3AP9A 2ZX3A 4P02B 3M70A 1QJU2 4IETA 3HIFA 1MS8A 4P9YA 5GLVA 3MIBA 1A8MA 1R1A2 3H8UA 2VZPA 2KXLA 4V1PA 4LK6A 4AXOA 5CA6A 1UZ0A 2E26A 1CVNA 1QOTA 1IG3A 3K46A 1CAVA 3ZN6A 1KS4A 4V2VA 1TZOA 1VBE2 2ORXA 1PVC2 4QPIC 4E9KA 1GICA 5JUVA 5C9AC 4FPLA 1AR61 5BNPC 5JXJA 5LEKA 4Q0SA 5FZ3A 4ATFA 3MV01 1W8UA 4NVPA 2PHUA 4XTPA 3K75B 3ZYJB 1VBA3 1JZ2A 2D6KA 5FZDA 5CVRA 5FMCA 3IIIA 3IB3A 2YGMA 2XBO1 2ZGOA 2C9KA 2ADEA 3NNGA 1AX1A 2XGXA 4C0BA 4Q0UA 4AHZA 1R1A1 3N3HA 5F2SA 5B4NA 3H8XA 4AAXA 1JYIA 1PK6C 3LSDA 4IERA 3WW4A 3H1MA 3HBKA 5FO8B 3DUIA 3GNEA 5I0UA 1U5YA 2BZDA 4HN0A 1PO12 2MEV3 3I2HA 2GC1A 3FJSA 1SDDB 4R9BA 5FPBA 3BODA 3VDAA 5T5PA 1ENQA 1OFSA 1BEV3 4X6QB 3VDDB 4YGDA 4AFBA 4IQPA 4CDXC 4A7ZA 2G9FA 4NE9A 2WYFA 1S0BA 2J22A 3POSA 1LU2A 4IGQA 1LOFA 3LFIA 3PIJA 2VUJA 5JSRA 4QU2A 2WIIB 3U4XA 1Y9MA 4M00A 1CAWB 1V9U2 1QY4A 1O4TA 2ATFA 2XDVA 5TSWA 4FBFA 4FPGA 2JENA 2RE9A 3FHIB 2PAEA 4XFFA 1JYXA 4AG4A 4OZOA 2PN5A 1AR83 1YFWA 5FZ8A 5FZEA 2NMNA 3EQEA 2VQAA 3OUIA 5LBFA 1QJZA 1SEFA 1WCKA 4FCAA 4LBOA 3WLUA 3ZIWA 4AEJA 2JDAA 4CDWC 2JIGA 3P6BA 3ROUA 1SCSA 1PIV3 4ORFA 1OI6A 4RGAA 3T2TA 5A3MA 1MQTB 1NLQA 1ND2B 2QDNA 2D3RA 1URXA 1RL3A 3CMGA 4D7YA 4FAHA 1ZRDA 4XF3A 2UYAA 5FZ9A 1OUXA 4YM3A 2R061 2A5ZA 4MHRA 1APNA 1HX6A 5CNAA 2LW8A 4NR1A 4OULA 1WBLA 4FXKB 1X9TA 4BMBA 1DCSA 1Q56A 1BZWA 4HVOA 4I01A 4JQRA 4FPKA 4R4ZA 4RD7A 3URFA 1IGOA 4LR4A 5I8TA 1GWMA 4IV1B 5HV0A 1ZBA1 1LGBA 2WYSA 1B35C 4ISQA 4DUXA 2B45X 4QMAA 4AVAA 1PMHX 2G4IA 4JGZA 1CAUB 4Q4Y2 1ZZ9A 1BBT2 1SLTA 1NCRC 1SHWB 4K7JA 2OQ6A 3VL8A 1RINA 2VOXA 2RS51 3TEXA 5IFPA 2WC2A 4FT8A 2XQXA 3P3NA 4XQWA 3B7MA 5AVPA 3T0AA 2YGLA 3WG4A 4MH0E 3D82A 1W8OA 4IEWA 5DQ0A 1PIV1 4PLOA 2WDBA 1VRBA 2ZHMA 2ZAAA 1LKNA 1MZ6A 1SDWA 1HDKA 4W65A 4IV3C 5F2WA 5C3SA 2BWCA 4IXLA 1H2MA 5D2AA 5FOBB 1UXXX 4QDQA 4AI3A 5E89A 4LNVA 4COWA 2DCJA 1NCRB 1QIQA 1Y3TA 2P2KA 3USSA 2VG9A 1ZRFA 4B4QA 1YI9A 5JSOA 5BXXA 1IPSA 5KC6A 1HXS3 2NPIA 4PJYA 4D7SA 3THPA 3KZ4C 3NW4A 1ND2A 2ZTNA 2KR2A 1XPWA 1XJAA 4EZ4A 1DQ6A 3S5AA 5BUVA 2WS91 3LPGA 4JKKA 1TQ5A 2BUKA 4YFZA 2VXJA 5B2GB 1W3VA 3WZ1A 5K0UB 3X29B 3BB6A 3ZM8A 4XILA 5FQ0A 1LCLA 1MR5A 2RDQA 5FLHA 4AFMA 2HKXA 5LK5A 5C8CA 4N53C 1IPJA 4Q5OA 5JSPA 1N1VA 1ZNPA 3J8F1 4N43B 1C8NA 4WBBA 3MIGA 5A7WA 5E1RA 1REEA 2Z4FA 3OY8B 2QQKA 4MLOA 1NXMA 2R7EB 3A23A 5HPOA 2YFZA 1QH6A 4YGEA 1W9FA 2VOKA 5EXOA 4JQTA 2JDUA 4XFBA 2OIIA 2HWE3 2V72A 1MVEA 1WZXA 1UY2A 4A3ZA 3DPRC 2J1EA 1EV13 1V6KA 4LHNA 3DXUA 2GMMA 2XLGA 3HD8B 1AZDA 4MG2A 2RS53 5A6YA 4KGGA 5A6ZA 2AYHA 2YB7A 2IFWA 4Q4V1 3C8XA 3M3QA 1S0FA 4CYDA 4CEWC 1HXS1 1W6OB 3I8TA 5JAXA 1DZQA 5CG9A 3DL3A 3ETQA 1HRV2 2WZEA 2Q30A 1AR63 1GSLA 2D7FA 4DINB 3CKHA 2WNVC 1LODA 2DVFA 2QNKA 2XVLA 4OQ9A 4B1LA 4DOUA 1RXFA 2GC0A 3IBMA 4YZ4A 3OD0A 1CPMA 3WF1A 4AK3A 4AR2A 3RZKA 2RMU3 3AYEA 4UF0A 4MX3A 5ABJB 3SCHA 4QT6A 2FDKA 1AX0A 1H6XA 3POGA 5APAA 4Q4V2 4S2FA 4R4XA 4XVHA 1MQTA 4AQTA 4B4RA 3GHNA 2ZMKA 3RMXA 2XBO3 2CGNA 4PIXA 3PUSA 2Q5TA 5L9BA 3IMMA 5L73A 1DGWX 1YQ5A 2BERA 2B9UA 2ZZQA 1HV1A 4JAAA 1VBD2 2BNNA 2CL2A 5HCHA 4GH4B 2HWF1 4LKSA 1JOBA 1JI6A 3LF7A 1IG0A 3M3IA 4QU1A 5C8CB 2C0ZA 4LKDA 1H6YA 2OKXA 2JDMA 4D94A 2ZACA 5LY2A 1Y43B 3ZFEC 3VBOA 1D2QA 3USUB 2YU2A 3WG2A 5C9AB 3W58A 4IW3A 5L7OA 5A7NA 4PDWB 2A70A 4XEZA 1NQDA 3V0BA 4BHPA 2VAUA 5KHJA 5G04L 5A7OA 1K42A 4FOQA 1QJY3 2JX9A 4HT1T 3BOPA 3HAGA 2Y8KA 3NNLA 3TN91 2HH9A 2EIBA 1UZVA 2EAAA 5IVJA 4M3CB 1Y9GA 3O14A 5D8AA 3PVEA 1UD1A 5LRRA 3WNOA 1JOPA 3VUOA 4YVSA 2OQ7A 1NCQB 1H1AA 1KDKA 4E27A 1AL22 2N7GA 4MGQA 4DZGA 3ZKYA 4YG6A 2VNGA 5FAXA 1FOD3 2R1BA 3U78A 5FP9A 5F6KA 1CZTA 4XJAA 1F8VA 1V6OA 3OGGA 1AR72 2XWJB 4CDUA 2ZZJA 1CIYA 4OZXA 3S6PA 1MVQA 2P37A 3R4SA 2OW4A 5FOJB 5JI9A 1RMU2 1YXWA 2A6YA 1RHI3 1G8WA 2BOJA 3D3AA 5IJRA 1SLIA 4A4AA 1SZBA 3PVOA 5JXGA 3OJBA 3BUCA 1MPXA 4JGYC 3WF3A 1K5JA 2R041 3N7JA 5A32A 2C1FA 2VMCA 3J7LA 1VB4A 3U10A 2Y6JA 4OLLA 3WP5A 1J59A 3ILRA 4QGMA 2WA3A 5FWEA 3VZLA 2R0FA 3UKNA 3B9CA 5JI7A 4BLIA 1ZBA2 1XBFA 2X5IB 5CFCA 4JV4A 1TME3 2A7AA 3RJ2X 1DGRA 1AR92 4XIKA 2EIDA 4HSLA 4EWEA 4XF4A 5C70A 1PGW2 3HEIA 3TRSB 1JZ8A 1Z78A 2DVBA 4LE4A 1LR5A 4EN7B 1HB4A 3MFAA 5IK8A 3LGRA 3HN1A 3VBHA 3ZR6A 2BGPA 4RA0A 2R062 4CDQC 2GALA 4XZPA 1UF2C 1UU5A 2ENRA 2YBKA 3OEBA 1POV3 2BVBA 3E6DA 3VBSC 3N9NA 5JPMB 1JYNA 4P9XA 2IVIB 3POBA 1QDCA 3U4SA 5KBFA 2VMHA 1DBNA 1DIWA 4BMEA 1LEMA 4CXWA 5J09A 3PMEA 1CAVB 1FYUA 4YLZA 3ZN6B 1K5MB 5SV5A 1EPWA 1ZZ6A 4DEVA 1I9RA 1QQP1 1I5ZA 2GMPA 2VM9A 2W52A 2VZOA 2GNTA 2Y64A 3FFZA 4ARXA 1GKBA 1DQ5A 1LEDA 2FDJA 2ZGNA 3SH4A 3ZYPA 1VAKA 1R083 2PQQA 2P3KA 1BK0A 2ZGUA 1W8WA 4S2GA 4GZ9A 2IUWA 3ACFA 4B4PA 1TNRA 1EAH2 1UY4A 2XHNA 5FFOC 2BQPA 4H3WA 2ZKNA 4JKLA 1W8ZA 2YFUA 2JICA 2JG8C 2W91A 3CJIA 3IN9A 5KHHA 1UXZA 2JJ6A 3WNMA 1TME1 1O8SA 4CZSA 4XHXA 4IEPA 3GZAA 2JWPA 4N9HA 3WW2A 4GB31 1YLLA 1ENRA 2D5FA 4OVEA 3EJKA 3RJRA 1A34A 4EWAA 4QXHA 5HCFA 2EXJA 1FOD2 3FX3A 4CUAA 2EIGA 4PDWC 3VHPA 2JD4A 2VNVA 3FUQA 1ZA7A 2OA2A 3GYDA 4CCNA 5LRSA 4BQXA 2D93A 1LOAA 4Q4W2 2CWMA 4XBQA 3PUQA 4EN8B 3N9QA 1RUG2 5C8CC 1QXJA 4NAMA 4FP2A 1DQ2A 4CU6A 1R091 5J98B 3VBOB 4NOTA 5CEHA 2DWRA 5C9AA 4JC1A 3JBG2 2W92A 3KWVA 1XQNA 2WZR3 1SLAA 3QOPA 1A78A 1ZZ8A 3TEYA 1W03A 5FP8A 2R6QA 2IXKA 3M1HA 3GZTB 3VBOC 5IUQA 3GJBA 4LBQA 2GAUA 5FZHA 4D8MA 2VECA 3Q8CA 4GQ7A 1WMEA 4QX5A 4RR3B 1V0AA 3ZPYA 3NKTA 2ZXQA 4XMAA 4ZS2A 3AYDA 4B7EA 1VBE1 1W2TA 2DVGA 1OPMA 2PHRA 4J1XA 1RUI2 2WQZC 1L7QA 5IWFA 1H2KA 2UWAA 3LIGA 4L92A 5FO9B 1VE0A 3UKVA 2ZHLA 4XYXA 1S4CA 2WFPA 1CZVA 2KA3A 3MV11 3T2OA 1UAIA 1NX9A 3AKTA 1ZBA3 1NYWA 2ARXA 1AUYA 1PHMA 4FFFA 4QQOA 1GP6A 4QM8A 2VVEA 1S0CA 1AR81 2W87A 4NRPA 3VBRC 2WFF1 4A7YA 1OQEA 2C9AA 3RZZA 1H8TB 1W0OA 3N9MA 3UK9A 2V4AA 3WP6A 3TBDA 1OF3A 3GXUA 3N9PA 5ANQA 1RIRA 4CEWA 2XJRA 4QXKA 2RS11 4Z07A 5EPAA 2Q4SA 3K4DA 3GBFA 1FATA 4DFSA 2VBBA 2VBDA 4WM8B 5DDJ1 1UOJA 1XYPA 4I09A 4ITCA 4IGOA 3MDPA 4CEYA 3DN7A 2I2SA 3KCXA 4CUCA 2D6OX 1L7LA 2R16A 3ZYFA 4ES8A 5K8SA 4AVBA 2VMFA 4MV2A 5KXCA 2NM1A 4G3YC 1TE1B 3RGBA 2XMLA 4K40A 3D0SA 4I02A 4LBQB 4TSVA 3JD72 2VMDA 2X09A 3O5SA 5FPAA 4MGKE 2QFEA 2X53S 1DF0A 5FP4A 3N9LA 4YG3A 1JTZX 5EV7A 4IEOA 1RUJ3 4OHYA 5DG1A 1ZRCA 1UU6A 3V56A 3WXPA 1R1A3 3AFGA 2W1UA 2RDRA 3GHMA 2DBIA 4XHBA 4IV3B 4IE5A 1HLCA 4GALA 4YM0A 5F5AA 3ZMOA 4Z92B 1YQ6A 5GM0A 1OQ1A 1W0NA 2YPDA 1FI2A 2ZPXA 5FPUA 4GIQA 4OHWA 2DU0A 3FZ3A 1CPNA 2J1AA 4C0HA 3J8F3 3EO6A 1NQJA 4COUA 4Z8BA 2IXCA 2B7YA 1DLLA 5KHGA 5C3PA 1C28A 1D0HA 4LO5B 1JZ5A 4L8QA 4M0NA 1W6OA 2VH9A 1QJX3 2FZ1A 2PHFA 4R9CA 3R05A 1AXYA 1KXGA 2XXZA 4QWNA 1O3SA 1E57A 1UKGA 4Q0QA 4WM7C 2VBPA 3AMMA 1RITA 1ULDA 2Y6GA 4QPIA 3NNFA 2RM21 4NIAA 4LKFA 4MZUA 1AYN1 4PLMA 4WV8A 3PJYA 1KS5A 3KMHA 4PDWA 2WJSA 3ECQA 5LASA 1QH7A 2V09A 4JVAA 2ORZA 2GH8A 3LEIA 5J7MA 4JTNA 1F5FA 4IUGA 1PO13 4EN6B 1BKZA 4XFGA 2EXHA 1NE6A 1G9FA 2ZEWA 1OOPC 4AQ6A 1BBT3 4UI9L 1DP0A 1XSQA 2WT1A 2Z42A 4GA9A 2YC2A 4O61A 3VKNA 1W04A 2XJUA 4LHKA 3WEZA 3KVAA 4ZZ5A 3CF6E 1S2EA 3SH3A 3ACLA 1M06G 1CQ9A 3M7AA 2Y0OA 4LE3A 3J26N 3HT1A 3ZIXA 3FLPA 4QM9A 2ADDA 4X8NA 4FPFA 4CDWB 3BTXA 4K1ZA 2WZ8A 3I2IA 4GB32 1UCXA 2VY0A 3AVRA 3BPSA 1Q8VA 1JS9A 4JX0A 3G6JB 4NPMA 2PTMA 3JD71 4R8HA 5A3PA 5ABJA 2D5HA 4BOWA 4CDUB 1TME2 1VRH1 2WNUC 4J6GA 2WUHA 5H9QA 3USUA 1J3RA 1Y7BA 3NV3A 4QX0A 1MZ5A 5JXIA 2VVFA 4PHZA 4YGCA 5FZ7A 4LJHA 3ZFGA 5LW9A 2JIJA 1FPN1 3LIHA 2D43A 2DV9A 1JZ7A 4U36A 3MUZ1 2GZWA 3UETA 2XQRA 1Y4WA 2WABA 3HNYM 4YGBA 3B00A 1QQP2 1OKOA 4MADA 4OHVA 4BXFA 1X8EA 3AJZA 3DGTA 2CNAA 2ZHKA 4FTBA 2VUCA 2FDHA 4QQPA 3H3ZA 2YBPA 1Q8SA 1QJY2 4OHXA 1W99A 4AHXA 4BPZA 2YROA 1TMF1 5G05L 2JG9B 3O1PA 1SG3A 4CU9A 4QGNA 1UOBA 3GBWA 3MICA 4K3UA 4QX2A 2QBXA 3C7EA 5K9YA 4G9SB 2RM23 4P5HA 3WHUA 2A6ZA 1PK6B 4KBZA 4CCCA 4BK4A 3N36A 1WA6X 1CGPA 3MIHA 5C4WA 2VQUA 2Y33A 3RZLA 4KWKA 4UFMA 5ACA1 2DTYA 5CG8A 2A3YA 4TLGA 3DPRB 3OSDA 3AZYA 4CCEA 5A1AA 1HV0A 1RUG3 4NHYA 2XJVA 3J9SA 4ZONA 5FY4A 2QZ3A 3PTYA 4H14A 1DQ4A 3LDRA 4TYSA 3O1SA 3T4VA 1RUD3 4CE8A 1X36A 3WDTA 3U14A 3WCRA 1Q43A 1ZVFA 3ATGA 4DO0A 2ZABA 4YFWA 4MOAA 2HBUA 4O9GA 2ZS6B 4AF9A 4GWNA 3OBTA 1NKGA 3SHRA 2NP0A 5A1LA 1GOGA 1WMFA 3VD4A 2D3SA 5C8WA 5EWSA 2RR12 4LOSA 5FP7A 3ZXGA 2JKXA 4BQYA 4JGZB 3L9JT 1OT5A 4YVSC 2XR4A 1X82A 3U1XA 4ET7A 2GP3A 4CP0A 2JECA 5FYIA 1W2NA 3B69A 5LK7B 3BIEA 2RMU2 2JKBA 1D4M2 1MZFA 4L9BA 1VMHA 1ASJ3 4NO4A 1JU3A 3NNMA 4XABA 1JODA 1HRI3 1US2A 2A71A 3AZXA 2WO7A 2GH2A 4KG0A 2Z5WA 4KMQA 3RWNA 4NIHA 1H9WA 1W8NA 3SISA 1E5RA 2YV8A 4JDOA 3N7MA 1OOPA 3EMRA 5KXBA 5JDBA 1F4HA 1Q8QA 1HQNA 3VBUB 1H9PA 1W6MA 4PIYA 5FMOS 2PFWA 2ZGMA 3TN92 5JVVA 1AXKA 5J48A 2MNGA 2MEV2 3J7HA 1WW7A 3U37A 2HWD1 4E2SA 3M4FA 3K4AA 4DRRA 2CU5A 4GMP1 4ZU4A 5I93A 3WUDA 4RL7A 4Q27A 3KD4A 3RS6A 5FYZA 1CN1A 2UYBA 5IATA 3DPRA 3H1YA 3WNXA 2F17A 1GZTA 5JMCA 1XNKA 1D4VB 2EF6A 1V9U3 3BN6A 3GCWA 1OD5A 1O4YA 2Y6FA 1OD3A 1R1ZA 2D98A 1N3QA 1D4M1 2VW2A 3LA3A 4FOWA 4I0BA 5DZGA 1KJLA 3HN3A 4IV1C 1SFPA 1IOAA 2JEMA 4HSJA 3RI9A 2ILMA 4A41A 1YHFA 4J25A 5CFCB 1UPSA 5A3TA 3VV1A 3FWEA 4KWLA 4YVWA 5DN2A 1RVF2 3VKLA 4Y1ZA 2LRPA 1R64A 4AQSA 4WM8C 4DUVA 3JU9A 1IZ3A 3K77A 4QHZA 1VALA 4N7IA 4WVMA 4LT5A 1W8TA 1ZX5A 4LKEA 1AR73 1ND2C 2HBTA 4AI8A 5JR7B 3KV6A 5E8AA 1FNZA 2CHHA 1AX2A 1AJKA 4URTA 1RGSA 2Q0AA 3LZZA 3WQBA 5LA1A 1YEWA 2D6MA 4LO7A 3ZN5A 3O1RA 4A42A 3AFKA 1CX4A 1H8TC 3OG2A 4QB1A 1HRV1 5FPXA 1U5ZA 3RFRA 5T5JA 3I3DA 3ZXDA 4TWTA 2BEOA 1HXS2 1WCDJ 1PVC3 3IT8A 1LJ7A 2IZWA 1STMA 3AP5A 4EQVA 1N1TA 2QCSB 3VZKA 2R072 4IEVA 4FFIA 4DEQA 3HR9A 5JOXA 3MBWA 4INDA 1M4WA 2R042 3VDBA 4AZZA 1BJQA 1TMF2 3SITA 2B42B 5T55A 4Q8KA 1W6NB 4AFCA 3WQ0A 5EP9A 1XB9A 3OGVA 4ZKTB 3ZMNA 1HN0A 3LFMA 2RS32 2UWBA 4YW6A 3VKMA 1PGL2 2ET1A 1EUUA 1QGLA 2CWSA 4M3CE 2JDKA 1SCRA 2VMEA 1NLSA 1LAJA 4BQ3A 5JWPA 1DQ1A 4AVSA 1FPN2 5HV4A 3ACIA 4NHXA 4BZ4A 3WF2A 2OVUA 3IDAA 3CO2A 1TEIA 4GJYA 2W47A 5CIRA 4AGRA 4BDVB 2ZCWA 1TNFA 4QPYA 5FZ6A 2QQUA 4MGZE 1VRH2 1MS1A 1YRZA 4QB2A 3S7IA 5FZMA 4UWDA 5C5TA 3B02A 5DAQA 4CDUC 3TEZA 4QPGC 3WCSA 4ASKA 5KR7A 1RB8G 1WGPA 4PI0A 1NY72 4Z2WA 1NT0A 1PX4A 4LBQD 4CUBA 3U11A 3AM2A 1SPPA 2FQPA 4Y1XA 1ZRIA 2R1DA 3NAPB 2XVKA 1VMJA 2HWC3 4CCDA 3KHCA 3SCGA 4XCAA 3OD4A 1ENXA 2HEWF 4XZUG 2VOWA 2ZGRA 3H9AA 3CIHA 4HN1A 3I59B 5IK5A 2G1MA 3AMPA 4D6RA 3I49A 2BTVC 2HWF2 1FMD3 1HKDA 4H2AA 2HWB2 2QQWA 2XONA 2O0OA 2DYCA 3D5OA 3OYWA 4BYYA 2WBKA 3E5UA 3HQUA 2FDIA 2JG8B 2VOVA 3CBNA 2IWGB 3FN9A 5IVCA 1JOJA 5FPLA 4WVMB 1OLRA 3WQ7A 3N7LA 5KXDA 1GFF2 4EV0A 3GJAA 2GNDA 4I30A 4AI9A 1RUC2 2GDFA 4UW3A 2OUJA 1XNCA 1YIPA 1W8FA 4Q4X3 2D6LX 1V00A 2PELA 1IS5A 1CAWA 1C5IA 3OGRA 3A21A 3B01A 3BTZA 1JN2P 4IE0A 1VBC3 1WA4A 1VBB1 4ONUA 1FX5A 4U2AA 3WW1A 4S2DA 1CJDA 4Q4W3 1XNTA 2F4PA 5FLJA 1G7YA 2WN3A 1C3HA 3SEPA 1W2UA 2OPWA 4CU8A 1F9KA 1QJU3 2A6VA 4K6BA 2IXJA 4AEMA 1GUIA 1JYVA 1W6NA 4AHYA 4YWAA 4DRVA 1UN1A 2GU9A 3G7DA 3W21A 5DG2A 3PIGA 2F4LA 1WLTA 3WX5A 3OGJA 4K8RB 3PU3A 3RDIA 2FMYA 1K3IA 5GZDA 2CTVA 4OMCA 5AC92 5DUVA 3EBRA 3MPPG 4OCTA 2DURA 2UU8A 2UY8A 3NRUA 4XPVA 3BIWE 2G19A 2Y6LA 4BA6A 1H30A 1ZZCA 2VZ1A 3JQWA 4QX7A 4M01A 1LTEA 2DCTA 1J3QA 4Y22B 1IS4A 1LGCA 4BIOA 1REFA 5C33A 1H4HA 4BQ5A 1V6LA 3ZXKA 3INAA 1O5LA 3WQ1A 4YZ1A 2IXHA 1CAUA 3OBRA 2K2SA 3GF6A 1VB2A 2E9QA 2HWD2 4COYA 1XE0A 1Y9QA 4GMP3 1IKPA 2P34A 3R4DB 3LE0A 4YARA 5F3CA 1MS9A 5LA2A 2KM2A 2AUYA 3WG1A 3A7QA 4CEYC 3THDA 4QX8A 1D0GA 3H7YA 3IPVA 5K7PA 2WNVA 1ND3A 4BU2A 1NCQC 3UT0A 4XFAA 1WBFA 1GZWB 2TUNA 2W5FA 3IAPA 3POIA 4GMP0 3WUCA 3BTYA 2QZ2A 2E6VA 2FHRA 5FYHA 4XXPA 4UFHA 5FCCA 4AI2A 5I91A 4XETA 1R082 1CD3G 4QQLA 5BNNC 5A7WB 1DZRA 1JUHA 2RMU1 4RHV2 2GN3A 4M4RA 1LU1A 3OBAA 4M3CF 5GZEA 2WWJA 1LHWA 3I97A 2AH2A 1RC6A 5IAXA 2PLV1 4WZFA 3LB9A 4P00B 4BE3A 1GP4A 2O8OA 3H42B 1S2BA 2NMOA 3MPBA 1C1LA 2DF7A 4CCOA 2RS52 4DIQA 3AMNA 4DUWA 2E33A 1V6NA 2UWCA 5FPVA 1XYOA 3UESA 2A6WA 3VHRA 3BPZA 1PVC1 3MZHA 2PXJA 2WO1A 4HMZA 4E8CA 4GULA 4KWUA 5J1XA 1DGLA 1YFYA 2YY1A 3JD73 3S0MA 3ZN4A 3R4UA 1R093 4QDRA 2Y26A 1LB2A 3K2OA 4XUNA 3SLIA 4QXCA 4ZXKA 4BIFA 1CAXA 5FY8A 4JDNA 3O12A 1RUG1 2PA7A 1UMIA 2IVJA 4HKLA 5A7SA 3VBFB 1JH5A 4LOTA 4FOVA 4HZFA 2VNOA 1JZ6A 3UJOA 3HQXA 3N7KA 2RR13 4IGPA 3ITQA 5FK7A 3J4UH 4AL9A 5GZGA 1UYPA 2LUWA 2ZGQA 4GB33 2FMDA 3LPFA 4M0HA 2LM3A 3RPQA 2DFBA 1QJY1 1O4ZA 3I2GA 3CZJA 3JZVA 2VL4A 2Q8EA 2RVAA 1QU0A 1RUE1 2WNVB 2ZMNA 5FZOA 4XF9A 4Y5Z0 4N7UA 1GZ9A 1SQ4A 4QGLA 4DY5A 3PVNA 4DXTA 1VLNA 3B5LB 4B3NA 4Q1PA 3CL1A 2IXIA 1EY2A 1JHNA 2ES3A 4FQZA 3WV6A 1LECA 3LDKA 1Z7S3 3NJVA 5CAZA 1ZZBA 4XBLA 5JOZA 1ULEA 1BMV1 3VZMA 1KEXA 3BTAA 3DXTA 3ME2A 1RUE2 2G9GA 1VBB3 1ZZ7A 4H55A 1K5MC 1DU3D 2Y38A 5GJ6A 4AWDA 5C4WB 5KHIA 1KRIA 5IVFA 1VMFA 4P5YA 4N43C 1PX3A 4XC9A 1QJEA 3ILNA 5LBBA 1COV2 2ZKLA 4PQQA 2L9LA 4YW3A 5FP3A 2ZMLA 2X5IA 1XNDA 2HJIA 3PTRB 4K9SA 4XOGA 4AVTA 4CDQB 3I3MA 4UFIA 5GLUA 5CKNA 3O1TA 1OA2A 1T6BX 4RS5B 2YG0A 1PGW1 1DFQA 3UGHA 3AKPA 3P5BA 2TBVA 1YQ2A 4LIUA 4LXLA 3TWIA 5T5OA 4QKFA 1OQDA 2J42A 2ET7A 5GKAC 4DNYA 1UU4A 3FLTA 4XUOA 5FMOL 3VBSA 2VE1A 4MUVA 4BQ2A 3DV8A 4NHMA 2HYKA 3NWKA 4KBBA 5FZ0A 3WHTA 1IHMA 3TNPB 1U5XA 3NL1A 3BU0A 4Y24A 1S2KA 1LULA 4GXLA 3VD5A 4IEZA 1RHI1 4B8EA 2PHTA 4BB3A 1AR62 4UFLA 4YG0A 3SKJE 5FZOB 4FPEA 5FYMA 2BPA2 1A6CA 1JHJA 1SMVA 3OOXA 1CR7A 4PBPA 2CAUA 2MHFA 2WL1A 3KCYA 4P14A 1UY3A 5JMOA 1AR71 1PZ9A 4CP2A 5F7UA 2WT2A 1HJGA 2DUOA 4AW7A 4MGYE 5CISA 2Q1ZB 4MXVA 4MGTA 3MEPA 3PJQA 4O7XA 4W6WA 1CX1A 5FXXA 4H7MA 4AE2A 4CXXA 5F39A 4CCKA 4MHUA 1WLDA 4AEKA 1AXZA 1DGWA 1ODNA 3I54A 3V0BB 3B3QE 1RUC3 1QHDA 1TG7A 5EJ3A 3OGSA 1UIKA 1RUD2 3C2UA 5I8YA 3AXDA 1DYOA 2EAKA 2RJKA 4A6OA 1SBFA 3T3YA 1JUIA 4XIOA 4XJUA 4DXSA 2AC1A 1QJX1 5SV8A 2DCKA 1K5MA 1LOCA 4YVSB 3LOBA 1NCRA 2WSUA 4AI1A 1O5UA 4LBKA 5I0RA 3S30A 5FYYA 1UZZA 3CNAA 1IS3A 1SFYA 1WCSA 5DDJ2 1F31A 4AQ2A 2VULA 5GALA 3ZFEB 5C3RA 1MQTC 3RRDA 2JXAA 5J36A 3VBHB 5DDJ3 2WWUA 3GZEA 4Q4V3 5AFEA 3ZVXA 5FJHA 1POV1 2TNFA 3PUHA 1UO9A 4OI2A 1I1EA 4Q8LA 1AL0G 5AC91 1KGYA 5FZIA 1OBNA 3ST7A 1FMD2 1VBA2 4MVTA 2R49A 2Y0IA 2ARBA 4WVVA 3MW4A 3KS7A 2VZTA 5FYBA 1QQP3 5EYYA 4EN0A 2WR9A 1FV2A 1NA1A 1V6IA 2YBSA 5AVAA 1POQA 5FZLA 4HVQA 4IV1A 2VCCA 1RTVA 2CGOA 3CDZB 4RS5A 5IAVA 4NWWA 3ZSEA 5FZ1A 3OYWB 1GOFA 2IFRA 5ABJC 1FT9A 5DXDA 1E5HA 2VOTA 3MIEA 2JG8A 3CJIC 2XB6C 4BQ1A 4FTSA 1WCQA 1CZSA 2CSGA 3CJIB 3KQRA 4HPKB 3VDDC 4CRQA 2E7TA 1RUI1 4XDPA 5IYYA 4NIGA 4CPBD 3VLBB 2B5HA 3T0DA 2WA4A 1UYYA 4J1WA 1VPHA 1O91A 4IL7A 5I0DA 1RUC1 1WMXA 1H8VA 4HKWA 3MIFA 3POFA 2V73A 2O14A 1KJRA 2W08A 4KU8A 2Q8CA 2QQIA 3WY6A 4KG8A 4ASMB 4NMIA 1UX7A 2HWF3 2VXRA 3N9OA 1YIFA 2OYZA 1MZEA 4N43A 4D0QA 4ES9A 2C26A 5FK8A 5FZKA 1F35A 5CB7A 5EQUA 3T30A 4IEUA 3J8F2 3W59A 2WNUA 3N4MA 2WT0A 2VR4A 3EXUA 3RWKX 1OLQA 2H0VA 3CZUA 1B09A 3M3EA 3OF1A 3RSJA 1HJFA 4BK5A 5FV3A 2ZOEB 3ACGA 3KHBA 2EA7A 3IPVB 3CLPA 1ND3B 1XNAA 1P8JA 3I2DA 3MW3A 1ZREA 2A3WA 1AHSA 1FOD1 4RR3A 4XW3A 4OHZA 5CFCC 2E63A 4GH4A 5F3EA 1SLBA 1S0DA 5EJZB 4KH9A 1GU3A 1Q8PA 4LLOA 1REDA 3AMHA 5HBAA 3JCIA 1V70A 2R043 1RJ7A 4TLFA 4XF0A 4Y4YA 4B29A 1KQRA 1UPIA 5IVEA 4L2NA 2GN7A 1ACCA 5T3NA 5JZGC 4RQPA 1DZTA 3TEWA 1AR93 1H2LA 5BNNA 3HQRA 1NXD1 2FCUA 2P3JA 1W6PB 1UMZA 2OT7A 1JU4A 1O3QA 3RQ0A 3U07A 2RS31 4L99A 1W9WA 1OURA 2WAOA 4AFAA 3S57A 4E2QA 1PGL1 4HK8A 2W1SA 1H8TA 5L36A 5BNOC 4YM1A 3S7EA 2JDNA 5DABA 1WCUA 3VHNA 1CAXB 1BBT1 4AGGA 1C5HA 1US3A 4Q4Y1 1K12A 3FE5A 4I0WB 5IHRA 3W5MA 4CCJA 1POV0 5IVBA 3VBFA 2DCZA 1X8MA 5FMDA 1OXCA 5C7GA 2B46X 3LEGA 4OMDA 3HT2A 1I5PA 1QXPA 1W6QB 5F3GA 4LO6B 2B8MA 1S0JA 1B35B 2QTWB 3O0XA 4R9DA 4QXBA 5CKMA 1T6GC 4ZS3A 1L7RA 2YMZA 2WS93 1PNGA 1BXHA 3BYWA 4HKOA 3KGZA 5FUIA 1RUE3 4AEDB 2BVVA 2VGDA 3AP4A 2ZEYA 5KHKA 1S0GA 2VPVA 3WSOA 4UBHA 2NYYA 1BYHA 1OH3A 1RMU3 3MI8A 1UZWA 1RVF1 3D8CA 3MGUA 2W1WA 4AFDA 1NCQA 1QNYA 3ZX7A 2BGCA 2PLV2 1OHFA 5F5IA 5FY5A 2P3YA 2D6PA 2WZR1 1RMU1 5KWRA 3RYRA 1VJ2A 3AL5A 2VD7A 3BCWA 3ZSMA 4EN9B 1V6JA 1R081 1W3XA 3H3UA 4FPCA 2SBAA 1W90A 2E32A 2XLAA 2DBNA 3D6EA 2WRAA 4WM8A 5FKBA 1L3JA 3T4HB 3L2HA 1C8M3 1A8DA 2P6CA 3KM5A 3LSEA 4ZU7A 2CGPA 2VO5A 2O1QA 4GWMA 3EYPA 2BRTA 1IPKA 1XXNA 4XUPA 3GBGA 4RGGA 2R0HA 3RZGA 1HQWA 4O9EA 3DYOA 3K51A 5A32B 2JG9C 2JD9A 1QKQA 3THCA 1GWKA 4A7KA 2MEV1 1PZ7A 3M2MA 5B4XA 4K1YA 1G86A 5J96B 2DFCA 1WWYA 3FUOA 4G4FA 1CWPA 2BNOA 2XUMA 2ZGPA 2BWAA 1WD4A 2DVAA 1LGNA 1ODMA 2DU1A 3SCFA 2R063 4Q2FA 3DKWA 1UW8A 1U5IA 1ZRRA 5A80A 4YPJA 4NN0A 4RSUA 1GQHA 3I7DA 3AVSA 3WR0A 2XJQA 4BXSV 3AB0A 3KCCA 3PHMA 1S0IA 2H6BA 1BCXA 2XBO2 2XJSA 1OA4A 2QDRA 5JOWA 4CP9A 5FBJA 3POWA 4P9GA 5GZFA 3T08A 5FIXA 4P9WA 3SXWA 2BYVE 2QQJA 2B9VA 4W6XA 4BLJA 3AZVA 3PNAA 2W9XA 1YJLA 3K48A 1S55A 2D44A 2HEVF 5LBEA 3JXSA 5EZWA 4Y1YA 1ZYBA 1JYCA 5C3QA 1G9BA 4LBNA 1E5SA 3LOIA 4K8FA 3SKVA 5D8AC 3RZJA 1I3HA 1KITA 4RN5A 5BNNB 5C6CA 1SLLA 3AL6A 4HVRA 4IEXA 4MXWB 4B7KA 2ARCA 4JDMA 2LROA 5ACA2 5DUWA 3SQOA 1JBCA 5GLTA 4Q0PA 4C1XA 3WP3A 4DB5A 1RUF1 2DTWA 2WNEA 2AGSA 5CYYA 3WW3A 4MYEA 3CEWA 2W68A 4KNCA 4XUQA 1J1LA 3KQ4B 5DUUA 3VZOA 2E51A 5EFUA 2QQPA 2FCVA 1GQPA 1PO23 1G6NA 1X9PA 3CJXA 3MW2A 1YI7A 1PK6A 1W9TA 2HWC2 5CADA 1A3KA 1KDMA 4IE4A 1SACA 2BJSA 1RYYA 4NRMA 3WNLA 1W6QA 5FZ4A 1NAEA 2X10A 5F6LB 2QKDA 4HG6B 3WT3A 2YXSA 2WQ4A 1ST8A 3U75A 5A7QA 1J84A 1UL9A 3RZHA 4HLTA 5A33A 4XAEA 2XHKA 2Y6KA 3ES1A 5JCTA 2DUPA 2IXLA 2PHLA 3OEAA 1AYM2 2WWSA 3N35A 5HXVA 3AX4A 2WZPP 4HK9A 4LMFA 1F5JA 5IK4A 1RUH1 2VW1A 3GCXA 1S0EA 4OFGA 4PQ9A 3TN93 4XFCA 3B94A 1PZ8A 2ZGTA 4UYBA 2WSVA 3WF0A 4L97A 4CDQA 3VGIA 1X50A 3WDVA 2K46A 1AYN3 1N3OA 2X5IC 2JG9A 3IDBB 3LAGA 3NO8A 3Q8BA 1N1YA 2X05A 3V0AB 1H4GA 3FFQA 1ULPA 2GC3A 5J37A 4S2HA 1QWRA 1DGRN 4RS5C 1GMMA 3C3VA 4BH9A 1EP0A 2VTXA 1QDOA 1D2SA 3NV4A 4RYDA 3ZOIA 3J7MA 2ZEZA 4JGYB 1XU1A 5FXWA 5LB6A 4K20A 3HNBM 5BNQA 2CDPA 2VTFA 2WKKA 4E4SA 4LO4B 4NAOA 4I3GA 3OTFA 5FREA 5HCAA 4OI1A 5E6HA 4OI0A 4PLNA 1SBEA 4FVVA 1GYKA 2VUAA 3NJZA 5F32A 3NJXA 4GD4A 3RNSA 1YJKA 5C4WC 2QQVA 1EYBA 1YC61 5BNOA 2RS33 4NIDA 2RM22 3AKQA 2PHWA 1GWLA 4IV3A 5CBLA 3AMQA 1UYXA 4M4PA 5ANNA 2HWE1 5H9PA 4XACA 3PLQA 4MGSA 2ARAA 1XNBA 1RUJ1 5GLZA 1UNBA 3L2YA 3NV2A 2RJ2A 2J1TA 1SBDA 4XJ9A 5LBCA 5JLVA 1PMIA 2BOIA 3DCQA 2V4VA 3I3EA 3I3BA 2J1VA 4NPRA 4KU7A 4PT6A 5JPNB 2DUQA 5JR2A 3PL0A 3RVHA 1O3TA 3KB5A 5CFDA 4Y3OA 5D8AB 3NQHA 4QKNA 4HBNA 3OB8A 5A70A 5FYSA 2CAVA 2AEZA 2R32A 3ACHA 3Q9OA 3B9IA 5BYNA 2DVDA 1YYNA 2P5BA 1W06A 4QKBA 1W6MB 4RR3C 3I2JA 4XF1A 4OQ8A 1C8M1 5KXEA 3DKQA 1VIWB 4LO8A 4LLFA 4JHTA 2VC9A 1BEV2 2EVXA 4Y33A 2I07B 2VMIA 4KL1A 1OLMA 5BV6A 3QD6A 5L7OB 1VBA1 4YNIA 4QPWA 4JHZA 5HCBA 1AYM3 4EE2A 4LUKA 1GOHA 1GNZA 4OUSA 3MHZA 5DUXA 4W50A 1NOVA 1WD3A 2FCTA 1W9YA 4UW4A 2YZ4A 1HB2A 5IK7A 3AKSA 2J7MA 3VZNA 3ZYBA 5DZEA 3ZXLA 1NZCA 3WVJA 3VKFC 1UOGA 5JOYA 4QPGA 1YUDA 2VCMA 4NJ4A 2BBVA 1FNYA 3D4KA 2RS12 4Q29A 2ZAHA 3C7GA 3DF0A 1LNSA 2J1SA 3EHKA 1F15A 4Q4X2 3TYJA 4I2OA 5A6QA 2WINB 2WAAA 2AENA 4QX1A 2AREA 1D4M3 3HVDA 3R0RA 5FJKA 4RGKA 1MEC2 3UGFA 5FY0A 1RUOA 3ORJA 4UOJA 2W39A 3Q8AA 4QHOA 1CESA 4FPOB 3W20A 1QJFA 4YZ5A 2VMGA 3LDBA 4BJ0A 4IESA 1PGSA 3ZXFA 5F1RA 1GLHA 1Z7S1 2EALA 4YYOA 3SC7X 3KV5A 3VD7A 1MACA 1NA1C 1OLME 3OCPA 4HXCA 4ZXEA 4E4HA 4X8PA 1HRI2 1Z0HA 3P3PA 1OSGA 2C5DA 2VCBA 3ES4A 1YFUA 2YPJA 3IDCB 4Y1VA 4C90A 1AVBA 1QF3A 2XVGA 3E6CC 2OX0A 2C4XA 3ZDVA 3I2FA 1XSRA 1RJ8A 3VBSB 4AYUA 3A0NA 2EICA 3IKWA 5DAVA 3POEA 4PIZA 4QDSA 4RQPB 1ZA4A 4NROA 2ZX4A 5A3OA 5K0UC 2RJLA 3FLRA 4Z1VA 3CU7A 1RUF3 3SMHA 1IKQA 4O65A 2XJPA 3WG3A 1JZ4A 3NV1A 3BVCA 2GC2A 4TN7A 1LOBA 2I74A 3F2ZA 4TXWA 1HRI1 3JBG1 3OBZA 1HIXA 3OPZA 4YW7A 1Z7S2 5DAWA 1W2AX 4CP1A 1R092 4YW4A 1ALYA 1QJU1 2PHXA 4W8JA 5FKCA 1KD7A 2E7QA 4Y4RA 5FXVA 2BNMA 5LA0A 1KFXL 2RDNA 4AVVA 5F3IA 4Q4W1 3I3QA 4BCUA 5ISLA 3ASIA 5T52A 4LK7A 3O1MA 1O3RA 2P3IA 3A22A 2AZ5A 3HBZA 1B35A 4FPYA 4NPLA 4JKMA 4FOYA 4AI0A 3B93A 2W46A 3MLJA 4FFGA 3GGLA 4Q4X1 1KFUL 4HONA 3ENRA 5FWJA 1EPZA 3NAPA 4HOOA 3OUJA 2QQNA 1NE4A 4TTGA 1OKQA 3KV9A 2J1UA 4LULA 2TEPA 4URAA 3JB4C 2OPKA 1GQGA 2WLQA 4NHLA 1WW6A 1EAH1 2PHDA 1SFNA 3VL9A 2AR6A 3OUHA 2Q1MA 2H6CA 3E97A 3T2QA 4Y22A 1ULGA 1QOSA 2XKPA 1GV9A 4E8DA 4NWVA 1AL23 2UURA 3BALA 1RUI3 1TMF3 1XYNA 3IWZA 2YYOA 1WKYA 1RUH3 1QNWA 1V6MA 4KQ7A 4XDOA 4YM2A 1BEV1 5FZFA 2P17A 2P6HA 5JZGA 2Q8OA 1NG0A 3K3NA 1C8M2 2JB8A 3TB0A 1FV3A 2Y60A 4BQWA 2ZX1A 5BY5A 3KT1A 2PMWB 4LPLA 4L11A 3H8RA 3I2OA 3UL2A 2X8KA 4R9AA 5T54A 3UGGA 4LORA 3DYMA 5FQ0B 2Z79A 3IM0A 5F8PA 4GH4C 4FTEA 3VZJA 3VBUA 1WMDA 3THTA 1AR91 1C4RA 3PDQA 3ZFFA 2X29A 5AC93 3WD5A 3WDXA 3OPTA 3S5QA 3AP6A 1ONAA 1UOFA 4QKDA 5T5LA 3ZFEA 1N47A 1QEXA 2RG4A 3KF3A 4XBNA 3NJYA 5FRAA 2VQTA 3E5QA 3MLLA 5A3WA 2PLV3 2ZX2A 2LS6A 1IQDC 3ZXJA 5EJ1B 4F8AA 4W6YA 4Y5TA 1LHVA 2RHPA 2V5DA 3DYPA 4XURA 3QCWA 2K9ZA 2VJXA 1ASJ1 4JTOA 4CP9B 1ENSA 1PM4A 4CCLA 4CDXB 4ATEA 1MS5A 4XJ8A 1W39A 1BQPA 3I4IA 4XXAA 4WZCA 5LCWL 4KI5M 4XQDA 2QQOA 1GR3A 2VZRA 3O7OA 2BBAA 1O59A 4LBLA 4A3XA 4FO9A 1GNYA 1VBC1 2ZGLA 1VAMA 4GKXA 2JDZA 3WOGA 2B39A 1AL21 4I3PA 1HRV3 3ZYHA 4LITA 1LRHA 3H7JA 2PAKA 4Y20A 1F4AA 1UWWA 1MEC1 3K3OA 3KT7A 4XCBA 1YWKA 3ZO0B 4CTEA 1JYWA 1EV12 3GZUC 4E4DX 4QB6A 1WW4A 2W94A 1OVSA 4IEQA 4M3CA 4XAAA 4EROA 1NLRA 3RG0A 3WNPA 2D40A 4EYUA 4CXYA 3ALQA 1ZBE3 5BNPB 2R073 3QH7A 2ZBJA 4ZZ8A 2OZ6A 5D1IA 5H9RA 3MFCA 2C24A 3ZYGA 4I0AA 5FO7B 4EZHA 4FI9A 1VBD1 4D69A 5FZCA 2Z2SB 3M3CA 5E88A 2HWC1 4AVCA 1HW5A 4IE6A 5C5UA 3VN4A 4IE7A 1LOFC 2XG3A 2ID4A 4BISA 5CFDB 3PMSA 2OS2A 2RV9A 4LUMA 1AR82 4UT5A 4XJWA 4FQ4A 2ZHNA 3ABZA 3F95A 2XOMA 4WM7B 3I59A 2VVDA 1Q8OA 3T1LA 3M8LA 1YQ8A 4XMIA 2W3JA 1DQ0A 3ILFA 1D7PM 1LOGA 3E6BA 3ZFFB 4MSVA 5BNOB 2VW0A 3LKJA 1VBB2 2QQLA 5IW0A 3VKOA 5AFBA 5FUNA 3O1UA 2E31A 4CUGA 2JDYA 5FYVA 1WUVA 3LQCA 4C1WA 4DS0A 3IAQA 3ZPOA 2FDFA 1HQLA 2Z69A 3KF5A 3ZFFC 3UKTA 4E2GA 3V65A 1COV3 1DYPA 3WINE 1UY0A 5JZGB 3HJRA 1RUJ2 3HPNA 1MEC3 1W05A 4B1MA 2E7AA 4NUBA 1YNAA 2HWE2 1NUKA 1VBD3 4UFKA 3H3LA 1LHUA 4DPNA 5FMBA 5C3OA 3IIAA 1RXGA 4AGVA 2HWB1 4COVA 5BNPA 2BW8A 3AP7A 4PI2A 5DMYA 5A3UA 2A6XA 3IZOA 1OFNA 2VU9A 3MF6A 4A6SA 4PBOA 4JGZC 4RQPC 1ND3C 4UW5A 4HANA 3PUIA 4XFIA 4LEJA 4E4ZA 4GAZA 4QAWA 5I0SA 1E5IA 4Y26A 3T1MA 3DEMA 5BPXA 1SPPB 1COV1 4LQRA 4YW1A 3UNPA 1Q3EA 2Y6HA 5FYUA 3AZZA 5EYXA 1DHKB 1X7NA 4D7TA 1J1TA 1ZBE2 2BV4A 2WNOA 2VNRA 4KGQA 3W5NA 1NY71 3O1OA 3FHAA 5ERLA 1NA1B 4CVUA 1CJPA 2R30A 5L19A 4YW2A 4WVWA 3ZSJA 4Y5SA 2W0XA 4ARYA 2VTXJ 3E5XA 1RUH2 1PNFA 1BLZA 1QXRA 3JB8A 3VBRB 1QOOA 4FSJA 3FHQA 4N9IA 3SNMA 4JRLA 1W8HA 2OUHA 2Q1FA 2MPFA 1DYKA 3VDDA 3FBYA 3MYXA 3OY8A 2A75A 4HPKA 4C8DA 2P4EA 5EIYB 2QE3A 3O0VA 3BU7A 4GJZA 2SLIA 5HI0A 2VZ3A 1OUSA 2EXIA 4YW5A 3NSTA 2QJVA 2IC1A 2VUDA 3KT4A 2WZR2 1XC6A 2HEYF 3APBA 5K4LA 4EWDA 3LEMA 3ZKUA 5A3LA 3LCPA 1AJOA 3WNKA 2VZUA 3AK0A 4PCRA 1O7FA 4V2WA 2HWD3 1S1AA 4Q1RA 3DECA 1PM7A 3RYKA 2RDSA 3A4UA 1F2NA 1CONA 5JXHA 3PURA 1G9DA 5FZBA 1W9SA 3VBFC 2R071 1OC1A 1YO8A 2ZGKA 3PUAA 4N8MA 5IVYA 1BK1A 4X6RB 5LA9A 1RUF2 4BM8A 4TZDA 1C57A 1N1SA 2GSYA 2YHJA 3SH5A 2WNUB 4CA9A 2BGOA 4LA2A 4F3JA 5L7OC 4SBVA 4N90A 3WDUA 1W28A 3J7NA 3RYPA 1MS4A 2HYXA 3AYCA 3QLQA 4P9JA 3ZYRA 3A0KA 2YC4A 1W0PA 2ETEA 3OPWA 2HLEA 4UAPA 3VBHC 3E1F1 4MXWA 5F37A 2FD8A 4LA3A 3ZFGC 5J3UA 3I2KA 1N3PA 4PF5A 5FY9A 3POYA 5FYCA 5FDBA 4QPIB 1OOPB 3Q8EA 3AYAA 4C91A 2W1QA 3KV4A 3SEEA 1WLWA 3H50A 4D3WA 5FPZA 3VBRA 5LWBA 2VQ0A 4L0PA 3BGAA 4FFHA 4SLIA 5D21A 4D6SA 2CDOA 1O8PA 4XFHA 1AF9A 2A1XA 1DG6A 4RHV1 4HFSA 3LA7A 1OF4A 2C6SA 3NNJA 5EHDA 5C71A 2JE8A 5DAXA 3FBMA 3ETPA 1OA3A 3IDEA 4DQAA 3ZXEA 5GZCA 1DDLA 2JE7A 1EUTA 2GMEA 4NRQA 4A2UA 2XPJA 1LESA 4ZHNA 2GNBA 2QVSB 2YU1A 1GBGA 2NZ9A 2QQMA 4YRDA 3ZSKA 1ZM1A 4IDZA 2WN2A 5IT6A 1GANA 1K45A 3UV9A 1ZBE1 4OYUA 3KSCA 2G9ZA 1J3PA 1UKRA 5FXZA 1X33A 2ZX0A 2CY6A 4CEYB 3NKGA 2Q8DA 4ZPIA 2O8QA 5A6XA 2YUEA 3V0AA 2WO2A 2PAMA 1PVXA 2VZQA 3MF9A 4NIIA 3K4ZA 3C7HA 5DAPA 2FDGA 2ERFA 3MIDA 4DXRA 2WFF3 2W2IA 4PF1A 3UYJA 3IMNA 4ZU5A 3JBG3 4CSWA 3POJA 4H7LA 1UIJA 1GNHA 2Y34A
chains in the Genus database with same CATH topology
4XJZA 2BFUL 3QH6A 1G9AA 1W6PA 1I6XA 2NLRA 4R52A 4F7ZA 4YVWC 5A33B 2GNMA 1OPOA 1U12A 4JRAA 2E53A 4XQ4A 2QUOA 2CV6A 1H2NA 3LA2A 2RR11 4KWJA 4DY3A 1VBE3 1XE8A 4UXAA 3ZSLA 4YSFA 3HWJA 1VP6A 1WLCA 3D0JA 1LHOA 3LWCA 4UW6A 2BFUS 1FPN3 3WDWA 1MS3A 3FMGA 5H9SA 3UJQA 2XL9A 2K0GA 3TAYA 5FLIA 2OZJA 4P9IA 5JIAA 5DZFA 2ZJCA 5FBZA 4BWOA 5KC5A 1BVP1 4NHKA 2WLPA 3R6SA 1BVVA 4N53A 2UY9A 3WDYA 4QHBA 1IQAA 4EJRA 5I0TA 3PVBB 4XE9A 4HL0A 4P9LA 3TOJA 5E16A 5T50A 4OI4A 4FPJA 1EAH3 1PO22 1H1MA 4LTAA 4IEYA 2FZ2A 3AXEA 3TNQA 2XLFA 4RHV3 3GALA 4XDQA 2F6BA 1OMIA 4UBGA 3ZFGB 2V5YA 3VHOA 4AEDA 1J58A 4OUMA 3NAPC 5K0UA 3BOWA 2EXKA 4JCKA 1WW5A 4Z82A 1ULFA 1EV11 2WS92 4QPGB 1RUD1 4CDWA 3RI8A 4HETA 5GLWA 2XL7A 3M3OA 2NN8A 4WVZA 2ZGSA 1VR3A 5ACA3 1RUNA 4Y20B 4YZ2A 1VBC2 3KLSA 4LHLA 3AJYA 3WP4A 4LBMA 2I45A 4Q0VA 2LTNA 1PIV2 1XE7A 4META 4YZ3A 1JW6A 1ASJ2 5FTTC 4K21A 1AYN2 4CDXA 1GZCA 1H0BA 2RS13 4CEWB 3U0ZA 1RHI2 1ULCA 2LALA 1G9CA 4Y1UA 3HMYA 3W9AA 5F9TA 5JIUA 2D6NA 3H1WA 4Q4Y3 3O0WA 1XU2A 5CU1A 1YCIA 2CYFA 3FC0A 1VRH3 4MGIE 1LHNA 2NQYA 2YC0A 4N53B 2ZA9A 2JE9A 1FAYA 1GZWA 2YDEA 3MLKA 4QD2A 1XRUA 1FXZA 4AHWA 4XTMA 3H0OA 4LBJA 4AEDC 1MS0A 4RFT0 4F83A 1U0AA 2D97A 3AZWA 4COZA 4QQHA 3JUUA 4YVWB 1SLCA 5LEJA 1BMV2 3QACA 1FMD1 3KGLA 1UX6A 1H1IA 1LENA 3V64A 4Q26A 2XJTA 2HWB3 2XWBB 5F5QA 4FPHA 1AYM1 5I8SA 1IS6A 4ASLA 3ZDSA 2DCYA 1V9U1 2FBEA 3AKRA 2A3XA 3NVCA 4GKYA 4QQ2A 3ELNA 4WM7A 1C1FA 1JXNA 1LOEA 1QMJA 4ISRA 4DMIA 1QJX2 1PO21 1VAVA 3ZYIB 2XKOA 2PYTA 2XH6A 4FXGB 3VBUC 1UZYA 2D3PA 2A73B 2WFF2 1RVF3 1PO11 3QBQA 4FAGA 3ZXAC 4FP3A 1CIWA 3JQXA 1Q5OA 3RMYA 2H0BA 1YFXA 5CFDC 4DXZA 4JGYA 3AP9A 2ZX3A 3M70A 1QJU2 4IETA 3HIFA 1MS8A 4P9YA 5GLVA 3MIBA 1A8MA 1R1A2 3H8UA 4V1PA 2KXLA 4AXOA 5CA6A 1CVNA 1QOTA 1CAVA 3ZN6A 1KS4A 1VBE2 1PVC2 4E9KA 4QPIC 1GICA 5C9AC 4FPLA 1AR61 5BNPC 5LEKA 4Q0SA 4ATFA 4NVPA 2PHUA 4XTPA 3ZYJB 1VBA3 2D6KA 5CVRA 2YGMA 2XBO1 2ZGOA 1AX1A 2XGXA 4C0BA 4Q0UA 4AHZA 1R1A1 3N3HA 1JYIA 1PK6C 3LSDA 4IERA 3WW4A 3H1MA 5FO8B 3DUIA 3GNEA 5I0UA 1U5YA 4HN0A 1PO12 2MEV3 2GC1A 3FJSA 4R9BA 3BODA 5T5PA 1ENQA 1OFSA 1BEV3 4X6QB 3VDDB 4YGDA 4AFBA 4IQPA 4CDXC 4A7ZA 2G9FA 1S0BA 3POSA 1LU2A 1LOFA 5JSRA 2VUJA 4QU2A 2WIIB 3U4XA 4M00A 1CAWB 1V9U2 1QY4A 1O4TA 2ATFA 5TSWA 4FBFA 4FPGA 2JENA 2RE9A 3FHIB 2PAEA 4XFFA 4AG4A 2PN5A 1AR83 1YFWA 2NMNA 3EQEA 2VQAA 1QJZA 1SEFA 1WCKA 4FCAA 4LBOA 3WLUA 3ZIWA 4AEJA 4CDWC 3ROUA 1SCSA 1PIV3 4ORFA 1OI6A 4RGAA 3T2TA 5A3MA 1MQTB 2QDNA 1ND2B 2D3RA 1URXA 1RL3A 4D7YA 4FAHA 1ZRDA 4XF3A 2UYAA 4YM3A 2R061 2A5ZA 1APNA 1HX6A 5CNAA 4NR1A 4OULA 1WBLA 4FXKB 4BMBA 1Q56A 1BZWA 4HVOA 4I01A 4JQRA 4FPKA 4R4ZA 4RD7A 3URFA 1IGOA 4LR4A 5I8TA 4IV1B 1ZBA1 1LGBA 1B35C 4ISQA 2B45X 4QMAA 4AVAA 2G4IA 4JGZA 1CAUB 4Q4Y2 1ZZ9A 1BBT2 1SLTA 1NCRC 4K7JA 3VL8A 1RINA 2VOXA 2RS51 2WC2A 4FT8A 3P3NA 4XQWA 3B7MA 5AVPA 2YGLA 3WG4A 4MH0E 3D82A 4IEWA 1PIV1 4PLOA 2ZHMA 2ZAAA 1LKNA 1MZ6A 1SDWA 1HDKA 4W65A 4IV3C 2BWCA 4IXLA 1H2MA 5FOBB 4AI3A 5E89A 4LNVA 4COWA 1NCRB 2DCJA 1Y3TA 2P2KA 3USSA 2VG9A 1ZRFA 4B4QA 1YI9A 5JSOA 5BXXA 5KC6A 1HXS3 2NPIA 4PJYA 4D7SA 3THPA 3KZ4C 3NW4A 2ZTNA 1ND2A 1DQ6A 5BUVA 2WS91 1TQ5A 2BUKA 4YFZA 5B2GB 3WZ1A 5K0UB 3X29B 3BB6A 4XILA 5FQ0A 1LCLA 1MR5A 5FLHA 4AFMA 2HKXA 5LK5A 5C8CA 4N53C 1IPJA 5JSPA 1N1VA 1ZNPA 3J8F1 4N43B 1C8NA 4WBBA 3MIGA 5E1RA 1REEA 4MLOA 3OY8B 1NXMA 1QH6A 4YGEA 2VOKA 5EXOA 4XFBA 2HWE3 2OIIA 1MVEA 3DPRC 1EV13 1V6KA 4LHNA 2GMMA 2XLGA 3HD8B 1AZDA 2RS53 4KGGA 2AYHA 2IFWA 4Q4V1 3M3QA 4CEWC 1S0FA 4CYDA 5JAXA 1HXS1 1W6OB 3I8TA 1DZQA 5CG9A 3DL3A 3ETQA 1HRV2 2Q30A 1AR63 1GSLA 2D7FA 4DINB 2WNVC 1LODA 2DVFA 2QNKA 2XVLA 4DOUA 3IBMA 2GC0A 4YZ4A 1ZREA 3OD0A 1CPMA 4AK3A 2RMU3 3AYEA 4MX3A 5ABJB 3SCHA 4QT6A 1AX0A 4Q4V2 4S2FA 4R4XA 1MQTA 4AQTA 4B4RA 3GHNA 2ZMKA 3RMXA 2XBO3 2CGNA 4PIXA 2Q5TA 5L73A 1DGWX 2B9UA 2ZZQA 1HV1A 4JAAA 1VBD2 2BNNA 2CL2A 4GH4B 2HWF1 3M3IA 5C8CB 2C0ZA 4D94A 2ZACA 1Y43B 3ZFEC 3VBOA 1D2QA 3USUB 3WG2A 5C9AB 3W58A 5L7OA 4PDWB 2A70A 4XEZA 1NQDA 3V0BA 4BHPA 5KHJA 4FOQA 1QJY3 2JX9A 4HT1T 3BOPA 3HAGA 3TN91 2EAAA 4M3CB 3O14A 5D8AA 3PVEA 1UD1A 5LRRA 3VUOA 4YVSA 1NCQB 1H1AA 1KDKA 4E27A 1AL22 2N7GA 4DZGA 4YG6A 2VNGA 5FAXA 1FOD3 2R1BA 5F6KA 4XJAA 1F8VA 1V6OA 3OGGA 1AR72 2XWJB 4CDUA 2ZZJA 3S6PA 4OZXA 1MVQA 2P37A 3R4SA 2OW4A 5FOJB 5JI9A 1RMU2 1YXWA 2A6YA 1RHI3 1G8WA 1SLIA 3PVOA 3OJBA 4JGYC 2R041 3N7JA 5A32A 2C1FA 1VB4A 3U10A 4OLLA 1J59A 3WP5A 3ILRA 4QGMA 2WA3A 3VZLA 2R0FA 3UKNA 3B9CA 5JI7A 4BLIA 1ZBA2 5CFCA 2X5IB 4JV4A 1TME3 2A7AA 3RJ2X 1DGRA 1AR92 4XIKA 4HSLA 4EWEA 4XF4A 1PGW2 3TRSB 1Z78A 2DVBA 4LE4A 1LR5A 4EN7B 3MFAA 5IK8A 3LGRA 3HN1A 3VBHA 4RA0A 2R062 4CDQC 2GALA 4XZPA 1UF2C 1UU5A 2ENRA 1POV3 2BVBA 3E6DA 3VBSC 5JPMB 4P9XA 1QDCA 5KBFA 2VMHA 1DBNA 1DIWA 4BMEA 1LEMA 5J09A 3PMEA 1CAVB 1FYUA 4YLZA 3ZN6B 1K5MB 1EPWA 1ZZ6A 1I9RA 1QQP1 1I5ZA 2GMPA 2W52A 2GNTA 3FFZA 1GKBA 1DQ5A 1LEDA 2ZGNA 3SH4A 3ZYPA 1VAKA 1R083 2PQQA 2P3KA 2ZGUA 4S2GA 4B4PA 1TNRA 1EAH2 5FFOC 2BQPA 4H3WA 2ZKNA 2JICA 2JG8C 3CJIA 3IN9A 5KHHA 2JJ6A 1TME1 4CZSA 4XHXA 4IEPA 3GZAA 4N9HA 3WW2A 4GB31 1YLLA 1ENRA 2D5FA 4OVEA 3EJKA 3RJRA 4EWAA 5HCFA 2EXJA 1FOD2 3FX3A 2EIGA 4PDWC 3VHPA 2JD4A 3FUQA 2OA2A 3GYDA 5LRSA 2D93A 1LOAA 4Q4W2 2CWMA 4XBQA 4EN8B 1RUG2 5C8CC 1QXJA 4FP2A 1DQ2A 1R091 5J98B 3VBOB 4NOTA 2DWRA 5C9AA 4JC1A 3JBG2 1XQNA 2WZR3 1SLAA 3QOPA 1A78A 1ZZ8A 2R6QA 2IXKA 3M1HA 3GZTB 3VBOC 5IUQA 4LBQA 2GAUA 2VECA 4QX5A 4GQ7A 1WMEA 4RR3B 3ZPYA 3NKTA 4XMAA 3AYDA 4B7EA 1VBE1 2DVGA 1OPMA 2PHRA 4J1XA 1RUI2 2WQZC 1H2KA 2UWAA 4L92A 5FO9B 3UKVA 2ZHLA 4XYXA 2WFPA 2KA3A 1UAIA 3AKTA 1ZBA3 1NYWA 2ARXA 1AUYA 1PHMA 4QQOA 4QM8A 2VVEA 1S0CA 1AR81 3VBRC 2WFF1 4A7YA 1OQEA 2C9AA 3RZZA 1H8TB 1W0OA 3UK9A 3WP6A 3TBDA 1RIRA 4CEWA 2XJRA 4QXKA 2RS11 4Z07A 2Q4SA 3GBFA 1FATA 4DFSA 4WM8B 5DDJ1 1XYPA 4I09A 4ITCA 3MDPA 4CEYA 3DN7A 2I2SA 3KCXA 2D6OX 2R16A 4ES8A 5K8SA 4AVBA 4MV2A 5KXCA 2NM1A 4G3YC 1TE1B 4K40A 4LBQB 3D0SA 4I02A 4TSVA 3JD72 3O5SA 4MGKE 2QFEA 2X53S 1DF0A 4YG3A 1JTZX 5EV7A 4IEOA 1RUJ3 4OHYA 5DG1A 1ZRCA 1UU6A 3V56A 3WXPA 1R1A3 3AFGA 3GHMA 4XHBA 4IV3B 4YM0A 1HLCA 4GALA 3ZMOA 4Z92B 5GM0A 1OQ1A 2ZPXA 1FI2A 4GIQA 4OHWA 2DU0A 3FZ3A 1CPNA 4C0HA 3J8F3 3EO6A 1NQJA 4COUA 4Z8BA 2IXCA 2B7YA 1DLLA 5KHGA 1C28A 1D0HA 4LO5B 4L8QA 4M0NA 1W6OA 2VH9A 1QJX3 2FZ1A 2PHFA 4R9CA 3R05A 1AXYA 1KXGA 1O3SA 1E57A 1UKGA 4Q0QA 4WM7C 3AMMA 1RITA 1ULDA 4QPIA 2RM21 4MZUA 1AYN1 4PLMA 4WV8A 3PJYA 1KS5A 3KMHA 4PDWA 2WJSA 3ECQA 1QH7A 2V09A 4JVAA 2GH8A 5J7MA 4JTNA 1F5FA 1PO13 4EN6B 1BKZA 4XFGA 2EXHA 1NE6A 1G9FA 1OOPC 4AQ6A 1BBT3 3VKNA 2WT1A 2Z42A 4GA9A 2XJUA 4LHKA 3CF6E 3SH3A 3ACLA 1M06G 1CQ9A 3M7AA 2Y0OA 4LE3A 3J26N 3HT1A 3ZIXA 3FLPA 4QM9A 4X8NA 4FPFA 4CDWB 4K1ZA 4GB32 1UCXA 2VY0A 1Q8VA 4R8HA 3G6JB 2PTMA 3JD71 5ABJA 2D5HA 4BOWA 4CDUB 1TME2 1VRH1 2WNUC 4J6GA 5H9QA 3USUA 1J3RA 1Y7BA 3NV3A 1MZ5A 2VVFA 4YGCA 3ZFGA 1FPN1 2D43A 2DV9A 4U36A 2GZWA 4YGBA 3B00A 1QQP2 4OHVA 1X8EA 3AJZA 3DGTA 2CNAA 2ZHKA 4FTBA 4QQPA 3H3ZA 4AHXA 1Q8SA 1QJY2 4OHXA 4BPZA 2YROA 1TMF1 2JG9B 4QGNA 3GBWA 3MICA 4K3UA 5K9YA 4G9SB 2RM23 4P5HA 3WHUA 2A6ZA 1PK6B 3N36A 1CGPA 3MIHA 5C4WA 4KWKA 5ACA1 2DTYA 5CG8A 2A3YA 3DPRB 3AZYA 1HV0A 1RUG3 2XJVA 3J9SA 2QZ3A 3PTYA 4H14A 1DQ4A 4TYSA 1RUD3 1X36A 3WDTA 3WCRA 1Q43A 1ZVFA 3ATGA 2ZABA 4YFWA 4O9GA 2ZS6B 4AF9A 4GWNA 3OBTA 3SHRA 2NP0A 1WMFA 2D3SA 5C8WA 5EWSA 2RR12 3ZXGA 4JGZB 3L9JT 4YVSC 1X82A 4CP0A 2JECA 3B69A 5LK7B 2RMU2 2JKBA 1D4M2 1MZFA 4L9BA 1ASJ3 4NO4A 1HRI3 2A71A 3AZXA 4KG0A 2GH2A 2Z5WA 3RWNA 1H9WA 3SISA 2YV8A 4JDOA 3N7MA 1OOPA 5KXBA 5JDBA 1Q8QA 1HQNA 3VBUB 1H9PA 1W6MA 4PIYA 5FMOS 2PFWA 2ZGMA 3TN92 5JVVA 1AXKA 5J48A 2MNGA 2MEV2 1WW7A 2HWD1 4E2SA 3M4FA 4DRRA 4GMP1 4ZU4A 5I93A 3WUDA 4RL7A 4Q27A 3KD4A 3RS6A 1CN1A 2UYBA 3DPRA 3H1YA 3WNXA 5JMCA 1XNKA 1D4VB 2EF6A 1V9U3 1OD5A 1O4YA 5SV5A 1R1ZA 2VW2A 2D98A 1N3QA 1D4M1 3LA3A 4FOWA 4I0BA 5DZGA 1KJLA 4IV1C 1IOAA 2JEMA 4HSJA 2ILMA 1YHFA 5CFCB 1UPSA 3VV1A 3FWEA 4KWLA 4YVWA 3VKLA 1RVF2 4Y1ZA 4AQSA 4WM8C 4LT5A 3JU9A 1IZ3A 1VALA 4N7IA 4WVMA 1ZX5A 4AI8A 1AR73 1ND2C 5JR7B 5E8AA 1FNZA 1AX2A 1AJKA 4URTA 1RGSA 2Q0AA 3LZZA 2D6MA 4LO7A 3ZN5A 3AFKA 1CX4A 1H8TC 1HRV1 5FPXA 1U5ZA 5T5JA 3ZXDA 4TWTA 2BEOA 1HXS2 1WCDJ 1PVC3 3IT8A 1LJ7A 3AP5A 2IZWA 1N1TA 2QCSB 3VZKA 2R072 4IEVA 3HR9A 5JOXA 4INDA 1M4WA 2R042 1BJQA 1TMF2 3SITA 2B42B 5T55A 4Q8KA 1W6NB 4AFCA 3WQ0A 4ZKTB 3ZMNA 2RS32 2UWBA 3VKMA 1PGL2 2ET1A 1QGLA 2CWSA 4M3CE 1SCRA 1NLSA 5JWPA 1DQ1A 4AVSA 1FPN2 4BZ4A 2OVUA 3CO2A 1TEIA 5CIRA 4AGRA 2ZCWA 1TNFA 4QPYA 4MGZE 1VRH2 1MS1A 1YRZA 3S7IA 3B02A 4CDUC 4QPGC 3WCSA 1RB8G 1WGPA 1NY72 4Z2WA 4LBQD 3U11A 3AM2A 2FQPA 4Y1XA 2R1DA 3NAPB 2XVKA 2HWC3 3SCGA 3OD4A 1ENXA 2HEWF 2VOWA 2ZGRA 3H9AA 4HN1A 3I59B 5IK5A 3AMPA 2BTVC 2HWF2 1FMD3 1HKDA 2HWB2 3D5OA 2O0OA 2DYCA 3OYWA 4BYYA 3E5UA 2JG8B 2VOVA 2IWGB 1JOJA 3WQ7A 4WVMB 1OLRA 3N7LA 5KXDA 1GFF2 4EV0A 2GNDA 4I30A 1RUC2 2GDFA 4UW3A 2OUJA 1XNCA 1YIPA 4Q4X3 2D6LX 1V00A 2PELA 1IS5A 1CAWA 1C5IA 3B01A 1JN2P 1VBC3 1WA4A 1VBB1 4ONUA 1FX5A 4U2AA 3WW1A 4S2DA 1CJDA 4Q4W3 2F4PA 5FLJA 1G7YA 1C3HA 1W2UA 1F9KA 1QJU3 2A6VA 4K6BA 2IXJA 4AEMA 1W6NA 4AHYA 4DRVA 1UN1A 2GU9A 3G7DA 5DG2A 1WLTA 3WX5A 3OGJA 3RDIA 2FMYA 5GZDA 2CTVA 5AC92 5DUVA 3EBRA 3MPPG 2DURA 2UU8A 2UY8A 4XPVA 3BIWE 4BA6A 1H30A 1ZZCA 3JQWA 4Y22B 4M01A 1LTEA 2DCTA 1J3QA 1IS4A 1LGCA 4BIOA 1REFA 5C33A 1H4HA 1V6LA 3ZXKA 3INAA 1O5LA 3WQ1A 4YZ1A 2IXHA 1CAUA 3OBRA 2K2SA 3GF6A 1VB2A 2E9QA 2HWD2 4COYA 1Y9QA 4GMP3 1IKPA 2P34A 3R4DB 4YARA 1MS9A 2KM2A 2AUYA 3WG1A 4CEYC 1D0GA 3H7YA 3IPVA 5K7PA 2WNVA 1ND3A 1NCQC 4XFAA 1WBFA 1GZWB 2TUNA 3WUCA 4GMP0 2QZ2A 2E6VA 2FHRA 4XXPA 5FCCA 4AI2A 5I91A 4XETA 1R082 1CD3G 4QQLA 5BNNC 1DZRA 1JUHA 2RMU1 4RHV2 2GN3A 1LU1A 4M3CF 5GZEA 1LHWA 2AH2A 1RC6A 2PLV1 4WZFA 3LB9A 4BE3A 2O8OA 1S2BA 2NMOA 3MPBA 1C1LA 2DF7A 2RS52 3AMNA 1V6NA 2UWCA 3VHRA 1XYOA 2A6WA 3BPZA 1PVC1 3MZHA 4HMZA 4GULA 1DGLA 1YFYA 2YY1A 3JD73 3S0MA 3ZN4A 3R4UA 1R093 2Y26A 1LB2A 3SLIA 4ZXKA 4BIFA 1CAXA 4JDNA 3O12A 1RUG1 2PA7A 4HKLA 3VBFB 1JH5A 4FOVA 4HZFA 2VNOA 3UJOA 3HQXA 3N7KA 2RR13 5GZGA 3J4UH 2LUWA 2ZGQA 4GB33 2FMDA 4M0HA 2LM3A 3RPQA 2DFBA 1QJY1 1O4ZA 3JZVA 1QU0A 1RUE1 2WNVB 2ZMNA 4XF9A 4Y5Z0 4N7UA 1GZ9A 1SQ4A 4QGLA 4DY5A 3PVNA 1VLNA 3B5LB 4B3NA 4Q1PA 3CL1A 2IXIA 1EY2A 1JHNA 2ES3A 4FQZA 3WV6A 1LECA 1Z7S3 5CAZA 1ZZBA 4XBLA 5JOZA 1ULEA 1BMV1 3VZMA 5D1IA 3BTAA 4CEYB 3ME2A 1RUE2 2G9GA 1VBB3 1ZZ7A 4H55A 1K5MC 1DU3D 2Y38A 5GJ6A 4AWDA 5C4WB 5KHIA 1KRIA 4N43C 3ILNA