4QPGA

Crystal structure of empty hepatitis a virus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
225
structure length
225
Chain Sequence
PVGAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTFPITLSSTSNPPHGLPSTLRWFFNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTPWVEKESALQIDYKTALGAVRFNTRRTGNIQIRLPWYSYLYAVSGALDGLGDKTDSTFGLVSIQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNSNAMLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
total genus 37
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12944 HAV_VP Hepatitis A virus viral protein VP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgA00
3JBG3 1FOD2 4Q4X3 4QPGC 1VBC3 1AR83 1K5MA 4CDWB 5K0UA 1OOPC 2HWC1 4QPIC 3TN92 2RS32 5ABJA 1B35B 1RUF2 1R092 4RHV1 1QJU1 2X5IA 3VBUC 1CJDA 2XPJA 2TBVA 4JGZA 2RS53 2WZR3 4LLFA 5J98B 1VAKA 1FMD3 2R042 1AYN2 4RR3A 2XBO3 1RUI2 1IHMA 1FPN3 1MEC1 4RHV3 1H8TB 4WM8B 1EAH2 1RUE3 1E57A 5C8CA 5BNOA 4IV1B 1FOD1 5A32A 1RHI2 5C4WB 5C9AA 2HWF2 2RS31 1PGL1 1EV11 1AR91 4N43A 4CDXB 4CEWC 2R063 1MEC3 5D8AB 1RUG1 3VBFA 3J8F2 1RUI1 1AL21 3VBSB 5CFDA 1NCQA 1VBB2 4CDQA 3CJIB 4JGYA 2BBVA 2BFUL 2ZTNA 1RHI1 1RUC3 2HWD2 3DPRB 2RS11 1AYM1 5FMOL 2BUKA 5L7OA 4BCUA 3VBOA 1VBA1 3JB4C 4CDWA 1COV2 3VDDC 1B35A 1RMU1 1Z7S1 1R1A1 1C8M3 4AEDB 1VBE3 1PO22 1HRI3 1ZBA3 1QJY3 2RS13 4PDWC 2RM22 2MEV2 1VBA3 1AR71 3NAPB 1AL0G 4GB33 1BMV2 4Q4W3 3VBHC 5BNPB 2PLV1 1Z7S3 1ASJ1 1TME3 3VBFC 1R1A3 1NCRB 1H8TA 1ND2B 1ND3C 1RUJ1 1TMF2 2GH8A 4IV1A 1HRV3 5C4WA 4YVWB 4Y4YA 5FOJB 1BEV3 1RUD2 4Q4Y1 4CDXA 5CFCB 4RS5B 1QJX1 5D8AA 1BBT2 3JBG2 1V9U1 1NA1B 1VB4A 1BMV1 3VBRB 3VBSA 1PIV3 5ACA1 1R082 3CJIA 5DDJ2 4YVSB 2WZR2 2QQPA 2IZWA 2WFF2 4WM7C 1CD3G 1HXS2 3DPRA 4GMP0 4CDUB 1VRH1 1RUH1 1QQP1 1C8NA 2R071 5JZGB 1GFF2 5J96B 1F2NA 1PO12 1BBT1 1RUE2 2RR11 2WS93 1AR63 1NY71 4GH4B 4AEDA 3JD71 1MQTB 1X36A 1D4M3 4RQPB 4CEYC 1QQP3 1POV1 4Q4V1 1OPOA 3NAPA 1R081 1PGW1 2R062 3ZXAC 5BNPA 2ZZQA 1SMVA 2HWC3 1RVF2 1NCRA 3S6PA 3ZFEB 1HXS1 1ND2A 1QJU3 1ZBE2 5BNNC 4IV3C 3ZFGB 4YVWA 1PO11 3TN91 5CFCA 1RUF1 1R091 4RS5A 4N53B 4QPGB 1NA1A 2RMU2 4FTSA 4RFT0 1FOD3 1OOPB 4QPIB 1W39A 4GMP1 1K5MC 1VBD2 1AYN1 2R041 5K0UC 1C8M2 1HX6A 3TN93 2RS33 1VBE2 3ZFFA 5ABJC 1EV13 1HRI2 1AR93 1ZBA2 1RUF3 4NWWA 3VBUB 2X5IC 1EAH1 2WWSA 4CDUA 1RUG3 4GB32 4JGZC 4Q4W2 2HWF1 4GMP3 1TME2 4RR3C 5JZGA 1RUI3 1AL23 3HAGA 4GH4A 1HRV2 5C8CC 3J8F1 5GKAC 5BNOC 2VQ0A 1RHI3 1PVC2 5C9AC 1AYM3 4FTBA 4CEWB 1VBB1 4N43C 2HWB2 1RMU3 3ZFEA 5AC92 5FMOS 4WM8A 1PIV2 2HWD1 1POV0 2FZ2A 3ZFGA 1COV1 5CFDC 1RB8G 1NCQC 1AR73 4CDQC 4JGYC 2PLV3 1M06G 1PO21 1QJZA 1ASJ3 2HWE2 4N53A 1A6CA 4Q4X2 4QPGA 1PVC1 1VBC2 1AR82 1RUJ3 4Y5Z0 4Z92B 2RM21 5L7OC 1OOPA 2MEV1 3VDDB 4QPIA 3VBOC 4CDWC 1COV3 2WS92 1B35C 1D4M2 3VBUA 4SBVA 4Q4Y3 1PO23 2RS52 1TMF1 1QJX3 4PDWB 1FMD2 2MEV3 2XBO2 1V9U3 2HWC2 1FPN2 3VBHB 1DDLA 1RUD1 4RHV2 3VBFB 1QJU2 2GSYA 5ACA3 2HWE1 1ND3B 1H8TC 3JBG1 4WM8C 4Q4X1 1VBC1 1AR81 4IV1C 5CFDB 5C4WC 4CDQB 1VRH3 1RUH3 5A33B 2R073 1RUD3 1MEC2 5DDJ1 1HQNA 4CDXC 2RS51 2WZR1 5D8AC 1BBT3 2WFF1 2RR13 5L7OB 1X33A 1FMD1 3VBOB 3JD73 2XBO1 3LOBA 1PGL2 1FPN1 1NOVA 1EV12 1AR92 3VBSC 1POV3 2ZAHA 4Q4V3 1R083 3CJIC 1RUE1 5DDJ3 2WLPA 1RUG2 5LK7B 4WM7B 1RUC2 2WFF3 1HXS3 3DPRC 4EJRA 1AL22 3VDDA 2R061 3VBRA 1PO13 1RVF1 4YVSA 4AEDC 1QJY2 1R093 2RS12 1AYM2 4PDWA 4CEYB 1ZBE1 2FZ1A 1VBA2 3VBHA 3NAPC 1RMU2 1Z7S2 2R043 5BNPC 1AYN3 1R1A2 1RVF3 1RUC1 1ND3A 1NCRC 1ND2C 5BNNB 4IV3B 1ZBE3 1MQTA 1EAH3 1WCDJ 2RMU1 4RQPA 1AR72 4YVWC 1BEV2 1VBD1 5A33A 1C8M1 2PLV2 2HWF3 1VBE1 1ASJ2 1OHFA 5CFCC 1HRI1 1ZBA1 1QJY1 4RS5C 1RUJ2 2BFUS 4GB31 1NA1C 3J8F3 4Q4W1 1K5MB 2RMU3 5K0UB 3FBMA 4NWVA 3VBRC 1TME1 1VBD3 5ABJB 4FTEA 4Q4Y2 3ZFFC 4YVSC 1QJX2 4WM7A 1VBB3 2X5IB 1HRV1 3JB8A 4JGZB 1V9U2 4CDUC 1BEV1 2HWD3 4RR3B 5ACA2 2BPA2 5JZGC 1NG0A 1AR62 2Y26A 2HWB1 4GH4C 5C8CB 5AC91 5BNOB 5A32B 4CEYA 1MQTC 1VB2A 1VRH2 1PIV1 1RUH2 1QQP2 4RQPC 3M8LA 5C9AB 2R072 4FSJA 1PVC3 2RM23 1AUYA 1F8VA 4N43B 2DF7A 2RR12 1NY72 2HWB3 3JD72 3ZFEC 5AC93 5BNNA 4IV3A 3IDEA 1TMF3 4Q4V2 3ZFGC 3ZFFB 1PGW2 1NCQB 2WS91 1AR61 4JGYB 4CEWA 1D4M1 4N53C 2HWE3
chains in the Genus database with same CATH superfamily
3OBAA 3Q8BA 1GNHA 5FLHA 2VTFA 2XONA 4XF1A 2RS32 3O0XA 1DQ4A 2LTNA 2QNKA 3KWVA 4Z82A 4YW1A 5FUIA 2XGXA 5KHIA 1RUF2 3RSJA 4XF3A 4LKDA 3VD3A 2X5IA 2H6CA 3VBUC 4HVQA 5IT6A 2IXHA 1GOFA 3AC0A 4CP9B 5T5JA 1IOAA 1ZZ9A 2VUJA 2WZR3 2VUAA 3PUHA 4LIVA 3WNPA 4E2QA 3LWCA 5J98B 3OB8A 4IE7A 4KMQA 2EF6A 2R042 1AYN2 5F5AA 5H9QA 3WOGA 2XQRA 1RUI2 1MR5A 2DCTA 4FPHA 4W6XA 5FZGA 5CZKA 4ZXKA 3WQ0A 1CZSA 1OT5A 1CONA 1LULA 4AEJA 4FOYA 3D8CA 1AXYA 3UETA 1H8TB 1LOBA 3ZXKA 3AZXA 5JXGA 5C6CA 2ZHMA 4AVCA 5A32A 1GZ9A 1TG7A 5C3RA 1T2XA 5GZGA 5LY2A 2HWF2 3ILRA 3ZDSA 1PZ8A 4EE2A 1Y9GA 3GJBA 4QHZA 1OXCA 5KHGA 4N43A 5FQ0A 2R0HA 1OQ1A 4CDXB 1OLME 3KHCA 2XG3A 1CESA 1MEC3 1W6MA 2ZACA 3QLQA 3N7LA 4FVVA 4G9SB 2ZGOA 5FY4A 5GJ6A 4LK6A 5DAPA 5DZGA 4INDA 2D6OX 2QFEA 4QGNA 4CU9A 3HEIA 3UKNA 1US2A 3B01A 4QDSA 4PHZA 4AHXA 3FN9A 2UY8A 5LA1A 3KM5A 4GKXA 2CDPA 2VZ1A 1K45A 1QU0A 3T0BA 2DCKA 3BPZA 2D6PA 4OI2A 2HWD2 2WUHA 3DPRB 2PXJA 4DY5A 3H1MA 1AYM1 1UQXA 3W21A 3AYEA 1AX0A 3VBOA 4P9IA 4CDWA 3VDDC 1YXWA 4RGAA 4FAHA 4URAA 1B35A 2XJTA 3FC0A 1S1AA 3JCIA 4E4DX 4XUPA 1IG0A 1Z7S1 3AMQA 3TNQA 5CAZA 1RTVA 3OY8B 4XF9A 1CVNA 4AEDB 3FBYA 1PZ9A 3CL1A 2WNVB 2AH2A 1HRI3 1ZBA3 1QJY3 2JG8C 2FCVA 4D94A 4PDWC 4K21A 4CXWA 1GMMA 4YW3A 3FLTA 2WA3A 1J1LA 3D82A 4GQ7A 4GB33 4NPRA 4BHPA 1RJ8A 4K1ZA 3NVCA 4QGLA 2CL2A 5BNPB 1YO8A 3BPSA 2WO2A 2ERFA 4BJ0A 5IYYA 2XWBB 2B45X 2E63A 4NVPA 1TMF2 2QQLA 1UMHA 2GH8A 5G05L 2NN8A 4H7LA 4IV1A 3E1F1 1TZOA 5FK7A 2VNGA 2WJSA 3O0VA 1JHJA 4LIUA 1XNAA 5C4WA 4NR1A 3ZSLA 4NHXA 4Y22B 5FOJB 1W2AX 4C1WA 1SLIA 3BKZA 1KXGA 2PQQA 3ZSJA 2AREA 3KD4A 1HQWA 4Q4Y1 4TN7A 5A6ZA 2SLIA 2JE7A 5FZ0A 1H8VA 3I49A 1FI2A 1PGSA 2WNEA 4DXRA 1YIFA 1LB2A 1Q8SA 3OTFA 1BMV1 2IFRA 3JUUA 2BOIA 2VCCA 1UN1A 2VZPA 3KCXA 1I1EA 2E51A 4NIGA 5ACA1 3MLLA 3N35A 2Y6LA 1R082 2WSUA 3LQCA 1KGYA 2MHFA 3VDAA 1CX4A 2VU9A 5F2WA 4XMAA 3IPVB 4WM7C 1GWLA 3OGGA 5IVFA 4I2OA 4Y26A 4GMP0 4AQ6A 3CU7A 1JZ8A 2ZGLA 4F7ZA 4I3GA 5FP8A 4MH0E 5DZFA 3BTXA 3CZUA 3T09A 2P3JA 4JHTA 5FKCA 5B4XA 5J96B 2BTVC 5FZCA 3I2HA 1KEXA 3HNMA 1UAIA 2A3XA 2R32A 2ZEZA 1LJ7A 2D7FA 5C5UA 1GOHA 2ETEA 1W6QA 2AACA 1GZWB 3OGJA 3AL6A 4YGCA 4HVRA 3PU8A 4R8HA 3MIHA 4EN6B 5F7UA 1ULDA 2ZEWA 3ZXAC 1W9SA 2CSGA 3K77A 4QQOA 3VD5A 4UFLA 5KHJA 1GYKA 3ZN5A 1H4GA 1JZ3A 1NCRA 1TNFA 3S6PA 3WW4A 5I0DA 5JXJA 1AJKA 3BYWA 2XHKA 4X8PA 1OKQA 2BU9A 3GXUA 2WNUC 3PDQA 3OG2A 1PM4A 1XE8A 4Q8LA 3IMMA 1PO11 4M0NA 4OUMA 3I2OA 4ZY9A 4GALA 4QB2A 3ZPOA 5F8PA 3SCFA 1F31A 3LIGA 1O8SA 1RUF1 3PUIA 4MGYE 1APNA 1JU4A 2Y8KA 3FUQA 3THCA 1YJKA 4IETA 2UWBA 2VGDA 4IEZA 3SCHA 2B8MA 4LITA 5FPVA 5I8SA 5L9VA 4Q1RA 1LHNA 2V4VA 4M4RA 4RFT0 2XKOA 2YU1A 1CAWA 2ZHLA 3BU7A 1W39A 3GCWA 5GZCA 2R041 1AYN1 1LGBA 3ZO0B 4C1XA 5K0UC 1X9PA 3TN93 5CU1A 3ZFFA 1YUDA 4NWWA 4HK8A 5FPZA 4L0PA 4ZXEA 5LBEA 2X05A 3P5BA 3WG4A 3I59B 3EJKA 4QQ2A 5DUUA 4JGZC 1V6OA 5EP9A 4P5YA 4QQLA 4XJWA 4B4RA 4YFZA 4HN1A 1UOFA 3OBTA 4NROA 2WAOA 2HWF1 3VKOA 2WFPA 3I2KA 4YWAA 4HXCA 3OGVA 2PAKA 4FPYA 5L73A 2Z79A 3OPTA 3HAGA 5FZDA 3DKQA 1ZZ7A 2ILMA 4HFSA 4IXLA 4QD2A 1HRV2 2WWUA 3UL2A 4BXSV 1IQAA 2G4IA 4DRRA 4FCAA 3H8XA 5BNOC 4YW6A 5FJHA 5M0TA 4JZRA 3C3VA 5GLWA 4AWDA 1SFYA 3T4HB 5C9AC 1AYM3 5JAXA 3AMHA 3MEPA 2XOMA 4AAXA 3KVAA 1Y7BA 5KHKA 1W6NB 1JZ7A 4XZPA 1W0PA 3KF5A 2JD9A 2HEVF 2IWGB 3LAGA 2BYVE 4BQYA 2HWD1 2IXJA 2GMMA 3VKLA 1BZWA 1POV0 5E8AA 3I2FA 3ZFGA 1Y3TA 4FFHA 2FDHA 3T30A 4N7IA 4QX3A 1QEXA 2V4AA 3AMNA 1NCQC 1J1TA 3NNJA 4XOGA 1JN2P 4CDQC 4ZZ8A 2WYSA 5A7QA 4JGYC 3WV6A 5FOBB 4MGIE 5FZ3A 2DCZA 2G19A 3B9IA 3MIFA 4FO9A 3NO8A 4Q5OA 2HWE2 1KJRA 3VZMA 3AZWA 4MGTA 1X8MA 1HN1A 1XC6A 4E2GA 3M3CA 4IE4A 4QKNA 4MGZE 3JQWA 3CIHA 4FPGA 4Z92B 1OOPA 1Q56A 4QPIA 3LOIA 3ME2A 4O9EA 2D5FA 2WS92 4Q29A 2RJ2A 4A45A 5IAXA 1ZRFA 1G7YA 4DS0A 3A21A 1ULCA 1HV0A 2UU8A 1AZDA 4N7UA 2PHLA 4SBVA 4Q4Y3 4D6QA 4KWUA 1PO23 1TMF1 1VJ2A 2Y34A 4BMEA 3U4XA 2D6MA 5FZ4A 3RNSA 4BQ3A 4AHYA 4AEKA 2OPKA 1OLQA 1O3TA 4QB6A 5T3NA 1XJAA 2VMFA 1F9KA 5FYVA 3ZXLA 4BK5A 5JXIA 4LO7A 1U5YA 2BJSA 4FPCA 1C5HA 3R0RA 2YROA 4Y33A 3GHMA 3VZOA 1DDLA 1ZRIA 4XFBA 4OUSA 3VBFB 5C8WA 2GSYA 5ACA3 1KS4A 5GZDA 2WNOA 1OFSA 2NM1A 1H8TC 3OY8A 3WF1A 1QNYA 5E1RA 4RYDA 4UW4A 4QDQA 4RA0A 1WWYA 2VZSA 2P3IA 5CFDB 4GWNA 2BEOA 1REDA 3I2GA 4BQXA 1RYYA 2EICA 1F4AA 1ODNA 2A6VA 4N90A 4CTEA 1O7FA 2CNAA 4K3UA 2VUCA 4YFWA 4D7SA 2AEYA 1MEC2 3RZHA 1MS5A 1NAEA 4RN5A 4CDXC 3LE0A 3NV2A 5JSPA 1UPSA 1R64A 3AMMA 5FYTA 1WKYA 5F32A 4OCTA 2PHFA 4NIHA 2ZKLA 3T0AA 3OUJA 3PJYA 5I8YA 5LA9A 1XE7A 5CG8A 5LRSA 2W2IA 1LOGA 4AQSA 5JMOA 1FPN1 3EHKA 1NOVA 1KDMA 4A41A 5KBFA 3P3PA 5EYYA 5C5TA 5C71A 2JWPA 4QU2A 5ERLA 3AKSA 4Q0QA 4ZU7A 1F5FA 5BNQA 3L9JT 1ENQA 2DVAA 2C6SA 2ZAHA 4CCKA 4TYSA 1Q8QA 5JVVA 1ZZBA 2ZKNA 4XUTA 5FZHA 3G6JB 2MPFA 3O1OA 4YZ2A 2R30A 1KFXL 4UI9L 2ZX4A 4H3WA 1TVGA 2BGCA 4E4ZA 3DPRC 2C24A 4DXTA 4Z8BA 2QQNA 3BOWA 1GICA 1GP5A 2XLGA 4JV4A 2VW0A 3NKGA 4CXXA 4CU6A 1DYKA 1BXHA 4LA3A 2W5FA 3WQ7A 2I74A 4HKWA 3HBZA 3POEA 1OH3A 4JX0A 4AI8A 1JXNA 1PO13 3MIGA 5F5CA 3VB9A 2YBKA 2OIIA 5DG1A 1LKNA 4AEDC 3LFMA 1QJY2 3GZUC 3RGBA 3OBRA 2WNVC 4A7KA 4BPZA 2HKXA 4HPKB 4GXLA 3S5QA 1NZCA 3UK9A 1PZ7A 5HCAA 1NUKA 1LESA 1UW8A 3KQRA 4IEXA 3VBHA 3TEWA 4XW3A 4LBOA 2JDHA 2R043 5I0UA 1AYN3 4FT8A 4KU7A 4TXWA 4DXSA 4LKEA 4CVUA 5BNPC 1WUVA 1RVF3 3BN6A 2WINB 4I02A 3DECA 3M4FA 4UWDA 2GN3A 3AZVA 4QM8A 3FLRA 3OSDA 2JX9A 5JR7B 3P3NA 1O91A 1ZBE3 4Y20B 1Q8PA 4XQ4A 5F3CA 2W46A 1JYNA 4JRLA 3JZVA 3B7MA 3U11A 2YXSA 4LO6B 4E4HA 2FD8A 4F3JA 5A33A 2W39A 1XB9A 2HWF3 3SCGA 3AFKA 3KT1A 4IEVA 5T55A 4UT5A 4S2GA 3ES1A 3URFA 4Q8KA 5F2SA 5A7WA 3UV9A 2RMU3 4QMAA 3UJOA 1GZTA 4J6GA 2YZ4A 5CKMA 4P9LA 1S0IA 5J1XA 2CAVA 2DDUA 4LUKA 2X5IB 3H8RA 1HRV1 3MDPA 5I0SA 2AENA 1E5IA 4IEYA 1V9U2 3ZYPA 5T52A 1PX4A 1HIXA 1J3PA 5FZ6A 4CZSA 4YGDA 1NLQA 2GNMA 2HWD3 3K3NA 4AQ2A 5A1LA 1D7PM 2WQ4A 1UY1A 4CCCA 2N7GA 2VE1A 2XLAA 4FFFA 2RDQA 1JHNA 4NUBA 1LHOA 2JKBA 1W8HA 4W6YA 3E97A 4COVA 5C70A 2E7QA 5A32B 4ARYA 1RUH2 2QQWA 2DBNA 1GR3A 3WDVA 2C4XA 2R072 3KLSA 4WBBA 4FSJA 4QU1A 2I2SA 3T1LA 2BNOA 1UXXX 2AR6A 2QQJA 4RL7A 2WBKA 1VR3A 2IXLA 1CIYA 1AUYA 4N43B 5FQ0B 4OI1A 2Y6JA 2DV9A 4IE5A 3RYKA 2WZ8A 4FPLA 4AVBA 4I09A 1W6MB 4QQHA 3H9AA 1NY72 1O8PA 1JZ6A 3JD72 1Q5OA 1W9YA 2DVBA 3KGZA 5K9YA 5AC93 4XACA 4PJYA 5BNNA 1MS4A 3O5SA 4IV3A 4JKKA 4K7JA 4P9GA 4BOWA 5J37A 3L2HA 3ST7A 3IIAA 4YM1A 1TMF3 1OF3A 2AUYA 1PGW2 5FPUA 3RI9A 4CSWA 4ZKTB 3SC7X 1JYWA 5EPAA 2WS91 3KT4A 1W2NA 2ET1A 5F3EA 5J48A 1YQCA 2Z2SB 3W59A 1F4HA 1MVEA 2E6VA 2Z69A 2DFBA 5J3UA 2VR4A 4CUGA 2UY9A 4MXVA 4OHZA 4R9AA 3AL5A 3THPA 3C7HA 3FHAA 2EAKA 2BZDA 2GZWA 2VG9A 1C3HA 4QB1A 5FMBA 4CDWB 4HBNA 3MYXA 5FPAA 3NW4A 3TN92 5FR3A 1S2BA 3N3HA 1B35B 4QAWA 1JU3A 2EIDA 1CAXB 3T0DA 4IL7A 4M0HA 5FTTC 1QWRA 1R092 3TOJA 4BDVB 4MSVA 3RJRA 1OURA 1CJDA 4MYEA 3WNXA 3RZJA 2TBVA 4XFFA 5CNAA 3I97A 3WNKA 5JR2A 1LEDA 3N7MA 5IVJA 2H6BA 4A6SA 3HT2A 3E6CC 3NV3A 1K3IA 1QXPA 2A6XA 2VPVA 4P9WA 1FPN3 4W50A 1B09A 5FKBA 2BOJA 1MEC1 2BGPA 4RHV3 5DAQA 5DMYA 3MPBA 4L11A 4LUMA 4JDOA 1EAH2 5C8CA 3ZYFA 4I0BA 4IV1B 1SLAA 1G6NA 1W3XA 2BVVA 4G4FA 5C4WB 4F83A 2ZGKA 1DHKB 1X7NA 3ALQA 1S0EA 2JB8A 2PHRA 2ZMLA 5BV6A 5K8SA 1GANA 5FO7B 2LROA 4P00B 3DKWA 3VDCA 1LODA 3LPFA 2A5ZA 3SKVA 3SQOA 3ZOIA 3WF3A 3INAA 4OZOA 3VBFA 4K9SA 3I2IA 3J8F2 4AEMA 1EPZA 2DWRA 4YARA 1BJQA 3WXPA 5CFDA 1W6OB 2Q5TA 4NRPA 3WDXA 2YFZA 4EZ4A 4CP0A 2BBVA 3THDA 5IAVA 2VY0A 3AM2A 3NSTA 3MO4A 1C1FA 3MUZ1 4NHKA 5BPXA 4Z1VA 1MS9A 2WDBA 2ZTNA 1RHI1 4QXHA 5GLTA 2VXRA 3WY6A 2RVAA 5B4NA 2QQOA 4XFGA 1D2SA 2XB6C 4BCUA 4EN8B 2VAUA 3V0AA 4NRMA 5FY9A 2WRAA 5KC5A 3VL8A 5IVYA 3RWNA 4ARXA 4LNVA 4QX1A 1FT9A 1NE4A 5GALA 5CB7A 4TTGA 2FDKA 4XCAA 1D0GA 2EXJA 3AP9A 2A6WA 4Q0SA 4QGMA 1UZ0A 2DYCA 4YYOA 1PO22 3V56A 1ZYBA 1N1SA 3J7LA 4QT6A 1JW6A 2GNTA 2P2KA 4JRAA 2WC2A 3VHNA 2ZJCA 1FXZA 3WP4A 2V72A 2YHJA 3NNLA 3T08A 1BMV2 3ELNA 3A23A 1OUSA 1SQ4A 2CDOA 2SBAA 3MPPG 4I0WB 4XILA 4XUOA 3X29B 4C0HA 4YG6A 2P3KA 1JS9A 3VBFC 5CISA 1R1A3 1NCRB 4LOSA 1IQDC 1N3PA 1G9BA 1UY4A 3WDTA 1HV1A 4XIKA 3UKTA 5DAXA 1QOOA 4CXYA 5CIRA 4MHRA 1HRV3 1LOCA 1UWWA 1W8NA 3IDCB 2P3YA 2QQMA 3NJXA 1CWPA 1OFNA 1H2KA 1S0FA 2H0VA 2VMIA 3K3OA 3O14A 3U10A 5FDBA 1IPJA 1HB3A 2JDZA 2R49A 4XFCA 3ZYRA 4QQPA 1DQ0A 2R1BA 5DQ0A 2WR9A 4IESA 3JBG2 2A6YA 3GM8A 3DV8A 4N8MA 4LBMA 4NIDA 4GWJA 1V9U1 5FRAA 2L9LA 1CAWB 4BLJA 3I3MA 4LO5B 3LEGA 1WMDA 1UIKA 1UKGA 2QQPA 4K8FA 5IWFA 4CPBD 1VIWB 1SDWA 2JJ6A 1C1LA 2UWAA 5FXZA 4AI2A 1RUH1 1C8NA 4FOVA 3D6EA 3MFCA 4LOTA 2R071 4TWTA 3THTA 3ASIA 3IAQA 2ARBA 1H2NA 1SHWB 3BIWE 3KCCA 1W8FA 5IATA 1XNKA 1UMIA 3VHPA 2FQPA 4TLFA 1PO12 1RUE2 1VMFA 2RHPA 2WS93 2CY6A 1SFNA 1NY71 3IBMA 3JD71 2A73B 2WO7A 4QX5A 3MZHA 4L9BA 3OEBA 2XL7A 5FZFA 2CWSA 1QQP3 4XAEA 5IVVA 2BVBA 1L3JA 1OPOA 2CV6A 2IVIB 1PGW1 2R062 3AYAA 3FX3A 3NAPA 3PURA 4C91A 4CE8A 1SEFA 2WIIB 2ZZQA 3S57A 1H1AA 1SMVA 4KQ7A 1RVF2 3BCWA 4KWLA 4JDMA 5APAA 5EJZB 3ZN4A 1AX1A 2YBPA 4KGGA 3MIEA 1GQPA 4MHUA 1PK6A 1WCUA 3E5XA 3Q8FA 1W8UA 2H0BA 3ZYBA 4BYYA 3H50A 1TEIA 1ZBE2 5FYIA 3SLIA 3GJAA 2VL4A 3LA3A 1OD5A 5E88A 1DGWA 5L9BA 3ZFGB 4B29A 1SZBA 4M3CA 1MVQA 2J1UA 3AP6A 4AE2A 4BWOA 4E27A 2Q8DA 3TN91 2ZZJA 5FV3A 1DZRA 3MUY1 2Y0OA 1N1TA 4KWKA 3H42B 3OGRA 4CCMA 2VTXA 1R091 3GNEA 2D97A 4FI9A 1JUHA 4MADA 2LW8A 5A3MA 3GF6A 1NYWA 1PX3A 4YW7A 4RGGA 2XJSA 1O3RA 1EPWA 1NA1A 3LFIA 2RMU2 1LHUA 1OOPB 2J1RA 3PIGA 4E8DA 4QPIB 4B1LA 3J9SA 5E6HA 4MVTA 1HX6A 1OH4A 2A3YA 2Y38A 5EHDA 2C9KA 5KR7A 1VBE2 4G3YC 3UYJA 3HJRA 4PLNA 1XNCA 4C90A 3B94A 3N9PA 4LQRA 1QXRA 4AVSA 3ABZA 1WCSA 1Y9QA 2X5IC 1EAH1 3VGIA 3JQXA 4CDUA 3IMNA 2Q4SA 3Q9OA 2CHHA 4Y5SA 1WLWA 1FNYA 1WLDA 3FZ3A 2BNMA 4XBNA 4A44A 3E6BA 3DYOA 3HN1A 5JZGA 1MS1A 3BOPA 3PU3A 4L97A 2D93A 1YYNA 2UURA 2YC2A 1CAXA 4GH4A 4NIIA 1U5ZA 2BNNA 5FP3A 2ATFA 4XUQA 4BIFA 3J8F1 5JOZA 1LTEA 2C5DA 2VZOA 1Q3EA 2P37A 4DINB 2VQ0A 4QWNA 2NZ9A 1HJGA 2YUEA 1RHI3 3ZPYA 2VZRA 3ZXFA 3BTYA 1MZ5A 3TBDA 1A8DA 2VOWA 3WDUA 1VE0A 1W8TA 4N43C 3LA7A 1YLLA 1V6NA 1D2QA 4LR4A 5D1IA 1RUNA 1NQDA 5AC92 4LHKA 5FMOS 1KFUL 1OKOA 2ET7A 1VP6A 3J4UH 5FY0A 1W2UA 2YGLA 2JENA 1WLTA 2VZTA 2I45A 1IPSA 4HANA 4GZ9A 3IWZA 1RB8G 4JVAA 5AVPA 2VNVA 3MW4A 1UY2A 1WMEA 2B42B 3NJVA 4CCLA 2ZMNA 1I5ZA 1ULPA 4CA9A 3RVHA 2EIBA 3LDRA 1PO21 3R4SA 4XETA 1F15A 3OUIA 4KGQA 4QPGA 4GD4A 4Y5Z0 4YRDA 3QBQA 4YG0A 4JDNA 2V5DA 3VBOC 4CDWC 1COV3 1M4WA 1B35C 4YM3A 1W6OA 4NJ4A 1QMJA 3D0SA 4LBNA 4NOTA 4AVAA 3U37A 5EJ1B 1LOFA 1LU2A 1RUOA 4PBPA 3ACFA 4CP1A 2Q1MA 2ADEA 3N9LA 4IUGA 5FZKA 2OZ6A 3ROUA 1V9U3 2HWC2 4AI9A 4BA6A 3TB0A 4XF0A 1FPN2 3VBHB 4GJZA 3V0BA 1C4RA 3AP7A 5F6LB 1NLSA 1GWKA 2A70A 2VO5A 2ZABA 1FV3A 1V6JA 1QKQA 4RHV2 4R4XA 3WDYA 4BE3A 3U4SA 4UW5A 2P4EA 3AJZA 1H4HA 3JBG1 1XU2A 5BY5A 1UZYA 4M3CF 1EYBA 4IV1C 3VKNA 2PN5A 1OSGA 2DBIA 5C4WC 1MZFA 1P8JA 4EWEA 1W2OA 1V0AA 4BQ1A 3OUHA 4D6SA 1RUH3 2PA7A 5A33B 1OA2A 2R073 3GZAA 1YFXA 3I3QA 5ANQA 3WLUA 4DNYA 4B3NA 1OQDA 1RGSA 4LBJA 2RS51 3VZLA 1W3VA 2BBAA 2VULA 5FYBA 5FXVA 2AYHA 2W0XA 5L7OB 3FL7A 1LGNA 4LTAA 1FMD1 1WW4A 5FZIA 3JD73 2XBO1 1DQ2A 3LOBA 4HKOA 4MZUA 4FP2A 4PF5A 5A7WB 2ZAAA 4ASKA 3KV4A 1GZCA 4ISQA 4KH9A 3GBFA 3PHMA 4ET7A 4MX3A 4YZ5A 3NNMA 5FYUA 1G9AA 1RUE1 2FMDA 1IS5A 3KB5A 3MBWA 5LK7B 4LO8A 5GZEA 3W5MA 3D4KA 3DUIA 1WMFA 1X50A 2WFF3 1E5SA 2D40A 1ALYA 3PLQA 4EJRA 1UU5A 3T2OA 5C7GA 2D6KA 4TZDA 5DUVA 1J3QA 2R061 3MICA 2BGOA 1DGRA 3OBZA 2ES3A 3BIEA 5FMCA 1ENRA 4IERA 1LOAA 1RVF1 3H8OA 2PAEA 1UYPA 1YCIA 1R093 4X6RB 1S55A 1CJPA 3H3ZA 3MW3A 5GLZA 1ZBE1 4P02B 1JZ4A 1H6YA 2CWMA 4ZS3A 1NQJA 1JOPA 4OLLA 4IE0A 4QHOA 3CJXA 1K42A 3TRSB 2UWCA 1BQPA 3WNLA 2ARAA 3UGGA 3T4VA 1RMU2 5A3TA 3H3LA 1R1A2 2FDFA 4CPBA 1Y43B 2D43A 1ND3A 1NCRC 1XNTA 3WQBA 2ZEXA 2ZXQA 3AP5A 4O7XA 4BH9A 2EIEA 5BNNB 5CA6A 2W92A 1BK0A 2FBEA 1SLCA 2AC1A 2WKKA 2PHDA 2W1SA 4IV3B 1XQNA 4GKYA 1QOSA 1EAH3 1YQ5A 4J1XA 1WCDJ 4K20A 2RMU1 3SH5A 2JIGA 3B00A 4XIOA 1WZXA 2VW2A 1W2TA 3IB3A 3ECQA 1VBE1 5KHHA 2FDIA 1ASJ2 1OHFA 2D3SA 2W47A 2JD4A 3ZX7A 4IEUA 5F9TA 4QDRA 4XQDA 2Y60A 1DLCA 5HCFA 1H2LA 1JBCA 3R6SA 3SISA 5AFEA 5GLUA 2D6LX 1KD7A 3ITQA 1G9DA 4Q27A 3KQ4B 3ILNA 3N9OA 1S0JA 1GQGA 3J8F3 1SFPA 2P34A 1RIRA 1JH5A 2QZ3A 5FY5A 4DY3A 2P1BA 1V00A 1VBD3 2DVGA 5FZOA 5FYMA 4FTEA 1AJOA 3ZFFC 4XURA 1QJX2 4BQ2A 5CKQA 3WX5A 3ZR5A 4MG2A 2E53A 1TNRA 1SLLA 3IIIA 2JDAA 1N3OA 3DXUA 1G8WA 1QH7A 2VW1A 3FE5A 3AXDA 4LHLA 4YZ4A 4O65A 4R4ZA 1UPIA 1SACA 2R6QA 2RJLA 2Y0IA 5I0TA 1W6PA 2VNOA 3PIJA 2HJIA 3K4AA 1NG0A 1VRBA 1QDOA 2JG9B 2Y26A 4N9IA 5CADA 2IUWA 1NKGA 5FBZA 5C8CB 5AC91 4CEYA 4B4PA 1VRH2 2GC0A 1QQP2 2ORXA 1WCQA 2E31A 5CG9A 1W8OA 5EQUA 2A71A 2V73A 4XMIA 4UFJA 2XUMA 3HWJA 5DZEA 1JODA 4Z2AA 1F8VA 2DF7A 3TWIA 2RR12 4AXOA 2WZPP 2X09A 3AMPA 4NRQA 4XHXA 3AK0A 3HOBA 3ES4A 3IDEA 2FDGA 4GA9A 5F37A 1CAUB 2R7EB 4Q4V2 1YC61 3ZFGC 2XH6A 2OT7A 4GIQA 4IQPA 1AR61 5BXXA 3KT7A 5JDBA 4LMFA 1UYZA 2Q1ZB 3AVRA 5EV7A 1EY2A 4O9GA 3VHOA 5C3QA 2W91A 4AHWA 5FCCA 2VUDA 2XJVA 2YC4A 3C8XA 4AVVA 4UW3A 5BYNA 1A78A 2XKPA 3JBG3 2VCAA 1K5MA 3V0AB 1OOPC 4HSJA 2HWC1 4QPIC 3Q8CA 2VD7A 1DGWX 4B8EA 5A6QA 5ABJA 2CGNA 5FPBA 1UD1A 2GC3A 2OKXA 2CYFA 3O0WA 3RFRA 3AVSA 3FUOA 4QX7A 4RHV1 3VKMA 3ZSEA 4D6RA 4JQRA 3ETPA 3ZMOA 4ATFA 4AL9A 5CBLA 1H9WA 3J7MA 3ZN6A 3LA2A 2RS53 3LSDA 1EP0A 3SEPA 3LPGA 5A3WA 1VAKA 2GAUA 4OI4A 1FMD3 4YGEA 2Z4FA 3B3QE 4N9HA 2XBO3 4RR3A 3A0NA 4XDQA 4BISA 1ZRCA 1FYUA 1IHMA 2DU0A 2OXBA 2VMHA 3B02A 3U75A 3W9AA 3ZYJB 1QH6A 1CPMA 1XU1A 2F4PA 1F35A 4CP2A 3VD9A 1VMHA 5A7SA 1JZ2A 1DZQA 1O59A 5ISLA 4QX2A 2W95A 1RUE3 1E57A 5KXEA 3VDBA 4AFDA 4L8QA 1FOD1 1WW6A 1RHI2 5CEHA 3B9CA 5A3LA 2FHRA 3JU9A 3LDBA 2C9AA 2W52A 1LR5A 4KNCA 3TAYA 5GM0A 4JQTA 2Z5WA 1ZRDA 1DCSA 3IKWA 4CU7A 1A8MA 4XJUA 1T6GC 2WLQA 2UYAA 4LK7A 1UOBA 2R063 4BQ5A 4COUA 1G86A 4DXZA 5A1FA 2P5BA 4J25A 2C26A 2G9GA 4CRQA 1H1MA 1QNWA 3GYDA 4NPLA 3WCRA 2ZS6B 4KWJA 5EWSA 1LNSA 2WT1A 1I3HA 4YLZA 1WGPA 4QXCA 2K9ZA 1SG3A 3PJQA 4JKLA 3S0MA 4V1PA 3ZYIB 1JZ5A 3FHQA 1CZTA 1VBB2 4UF0A 4E8CA 5ANNA 2DCJA 5LWBA 1FX5A 1JOBA 5A1AA 3IM0A 4FPJA 5JWPA 3NV1A 1S0CA 3QOPA 1JYIA 2DFCA 2YBSA 4YSFA 2B9VA 4EQVA 3N7KA 2GNBA 2RV9A 3OD0A 1LRHA 3I7DA 4LBLA 1IGOA 5L7OA 3BTZA 2HEYF 4NPMA 3DF0A 3WG3A 2E26A 3JB4C 1GKBA 2Z42A 1COV2 3ILFA 5FLIA 4H55A 3V64A 3ON7A 5KXCA 1RMU1 2QQIA 4P9XA 3MLJA 1R1A1 5T50A 1VBE3 4ZU4A 1W06A 4AW7A 1DQ1A 4O61A 3S30A 2VECA 2WQZC 1XE0A 2A6ZA 2RS13 5FIXA 3MI8A 2BRTA 2WN2A 5H9SA 1X8EA 5LBFA 3RI8A 1VBA3 2V09A 1AL0G 2QJVA 3NAPB 4MO3M 5FYHA 4FPEA 4OHXA 4WV8A 2RE9A 1XOYA 3VBHC 4K40A 4KU8A 2FDJA 1EUUA 4XBQA 1ASJ1 1HDKA 1OA4A 1RXFA 3BVCA 1PK6B 2DU1A 5LCWL 4BXFA 1H2MA 1OVPA 1LU1A 5JXHA 3WW1A 2DURA 4M3CB 1MACA 3RYRA 3FLPA 5JLVA 1UY0A 2YB7A 3I3EA 4S2DA 1J84A 1YI7A 2DTWA 1KITA 2FMYA 4UFKA 1QHDA 5D8AA 1QJX1 2ORZA 2JECA 4IGOA 5JOWA 3HT1A 3E5UA 4FFIA 3DYMA 4AG4A 3O1TA 1PM7A 1NA1B 4M3CE 2KD7A 3OCPA 5I8TA 2FCUA 2ADDA 4WVVA 1HW5A 2OQ7A 4GAZA 5FZEA 3VBSA 3KF3A 3OYWA 3WT3A 2Y6KA 4WVMA 3CJIA 3FFQA 1N1VA 5IK7A 4KI5M 5FJKA 2JDUA 3GGLA 1ACCA 1AVBA 2J1TA 1Z0HA 2HBTA 2RDSA 2W87A 2WFF2 3K4DA 3KV9A 4LKSA 4YW5A 5H9PA 3BU0A 4CDUB 5E16A 4YZ1A 4CUAA 3I2DA 1RINA 4GJYA 1VRH1 4COYA 1QQP1 5G04L 1DP0A 3T1MA 1CR7A 4DMIA 4DO0A 5JZGB 4EROA 1BVVA 3AYCA 2E7AA 4P14A 2LALA 1F2NA 2PAMA 1BBT1 1SBFA 2RR11 4ES8A 4XFIA 3MIDA 3ACGA 2O1QA 4HK9A 1AR63 5HXVA 5FMDA 4GH4B 2VMGA 5A6YA 3HPNA 2DUQA 1MQTB 1OQEA 1X36A 4H14A 1POV1 5FK8A 4L92A 4Q4V1 3C7GA 3UT0A 1NX9A 1GP4A 4GULA 4UFMA 1YFYA 1S0GA 1YWKA 2HWC3 5EIYB 4XFHA 2B9UA 3VKFC 2XXZA 1HXS1 4YGBA 1ND2A 4XFAA 2JG9A 2VNRA 2YC0A 3CEWA 5EXOA 5AVAA 5KXBA 3AXEA 2OX0A 5BNNC 4IV3C 2J22A 4MOAA 4YVWA 3CBNA 5I91A 1J3RA 3VHRA 2Y6GA 1W8WA 1L7RA 1O6UA 2ZGTA 3LD8A 3VZJA 5FAXA 4QKDA 3CZJA 4DRVA 1SLBA 1J83A 2IXKA 5CFCA 3UESA 3UNPA 2VQTA 1GP6A 4XE9A 5FZ9A 4RS5A 1OI6A 2VZUA 4HONA 4Q26A 4X6QB 2YDEA 1A3KA 2ZGMA 3E6DA 4YG3A 4YW2A 3ZYGA 5HBAA 4Y4RA 3WNOA 4QPGB 3CNAA 2QUOA 2LM3A 2BQPA 4FTSA 1FOD3 1WW5A 3M1HA 1REEA 4V2WA 1VBD2 2JE8A 3H1YA 1C8M2 3WD5A 1CAUA 3QD6A 1S0BA 3K48A 3SEEA 3PUAA 1N1YA 4LJHA 5T5LA 5IK4A 5F3IA 1Q8OA 1IKPA 4OMCA 5J09A 5FZBA 1ZNPA 4A7YA 2WWSA 3H1WA 3L2YA 2DUPA 1GNYA 5DXDA 4Q4W2 2F6BA 1U5IA 4QKBA 1PVXA 4GMP3 5FLJA 4B4QA 1TME2 4AFBA 2PMWB 5FZ8A 2VJXA 3V0BB 3BI3A 2EXKA 1PNGA 5I93A 4W4ZA 2A75A 4K6BA 1BCXA 4WZCA 1UKRA 5A3PA 3WW2A 2JG9C 3GZEA 1J58A 1UU4A 5C33A 3ZKUA 2WNUB 5C8CC 1ZA4A 4K1YA 2IXCA 4CYDA 3UGFA 1SCSA 3RYPA 1XNDA 3U1XA 3HMYA 1SPPA 3I3BA 3GALA 1I5PA 3G7DA 4CEWB 1VBB1 1W0NA 3WQ1A 4ZZ5A 4ES9A 2JICA 3GHNA 1O4YA 1CZVA 3DL3A 5LASA 1CAVA 1RMU3 3ZFEA 5LBBA 4W6WA 2QTWB 4JC1A 4PF1A 4AFMA 1LHWA 3ZYHA 3B5LB 4OI0A 4ITCA 3SNMA 4D69A 1PIV2 3NKTA 1X82A 5JUVA 2FZ2A 1ZVFA 5A3UA 4MLOA 3W20A 2ZPXA 3N9MA 1COV1 3S7EA 2VC9A 1OA3A 3W58A 3ZMNA 5CFDC 1G9CA 1OVSA 2OA2A 1RC6A 3C7OA 3D3AA 5JOYA 3RRDA 1PMJX 2B7YA 4OFGA 5F1RA 2F17A 3O1RA 3C7FA 4PI0A 1LCLA 4W8JA 3POGA 1QJZA 1ASJ3 4N53A 5DAVA 1A6CA 1PVC1 1DF0A 3MLKA 3AKRA 5TSWA 2CU5A 1PMHX 3ZIWA 4AI3A 3DYPA 1VAMA 2O0OA 3HQXA 1YQ2A 1H0BA 3OOXA 1POQA 1DIWA 1OD3A 4A3ZA 1TE1B 1D4M2 1TQ5A 3GCXA 3VBUA 3WF2A 2EVXA 3AKPA 4NHYA 2RS52 2ZA9A 1QJX3 1S4CA 2O14A 4HT1T 4LORA 4QM9A 1KDKA 1FMD2 4ASLA 1WD4A 2MEV3 2XBO2 5LW9A 1IS6A 2RG4A 1ZZ6A 2NPIA 2ZGNA 4EZHA 3AX4A 4OHYA 1UU6A 3KV6A 1K12A 2HYXA 4LPLA 1JUIA 1QJU2 3U14A 3SKJE 1ND3B 2VZQA 4DUVA 3K4ZA 4Q4X1 3K75B 1VBC1 1AR81 3TEYA 5HCBA 1KS5A 2WA4A 1KJLA 2GN7A 4MXWA 3OJBA 3LEIA 1ZZCA 3O7OA 5DN2A 3O12A 4CDQB 1SLTA 3BGAA 3PVOA 4XABA 1VRH3 2E33A 1L7QA 2VQUA 1RUD3 4Y1VA 2PHWA 5A80A 1HQNA 3DXTA 2YU2A 5JPMB 2A7AA 2VMEA 5J7MA 4EWAA 1HB4A 2D44A 2GU9A 1BBT3 1T6BX 2RR13 2WFF1 1CN1A 4V2VA 1WBLA 3NQHA 4OHVA 1WCKA 4E4SA 2PYTA 1AHSA 3ZIXA 4WVWA 2EXHA 3ZXDA 4XZUG 3R4UA 4I0AA 4OZXA 4NIAA 1MZEA 1PGL2 4OVEA 3AB0A 4LBQA 1EV12 4XTPA 5EZWA 1AR92 4UBGA 1RL3A 4HKLA 3BALA 5FZOB 1POV3 2E9QA 4YNIA 2CGOA 4Q4V3 3UGHA 2X29A 2X10A 4L2NA 2XVGA 3LB9A 5DDJ3 5LRRA 3CDZB 5L9RA 4CCDA 1RUG2 5FY8A 4Q0PA 2WQ8A 3I4IA 2VTXJ 5C3OA 3HIFA 1AXKA 3POSA 4OULA 2VCMA 1HXS3 2XLFA 2VXJA 3M3EA 4DEVA 2PHTA 1AL22 2CAUA 1W90A 4XF4A 3QH6A 3VDDA 4DQAA 3APBA 4FXKB 5JI7A 5HPOA 1W28A 4PLOA 1W6PB 1LGCA 3AP4A 5J36A 2JIJA 1DYPA 5LATA 3IAPA 2ARCA 5F6KA 5IK8A 1YFWA 2JG8A 2RS12 4PDWA 1XBFA 4LE3A 2NLRA 4CEYB 1RJ7A 3MHZA 3MV01 4EN0A 1VBA2 3O1UA 4QKFA 4QX8A 4Z07A 4EWDA 1KQRA 1UX6A 3NAPC 3K46A 2P6HA 3FFZA 4NN0A 5FBJA 4I3PA 4RFRB 1RUC1 3FHIB 4P08A 4Y3OA 4YM2A 3RZGA 4PQQA 4UFIA 3MW2A 4SLIA 5GZFA 4A42A 1DU3D 1PK6C 2QZ2A 3EBRA 4LHNA 3KSCA 4Y5TA 3SXWA 2ARXA 1NXD1 4EV0A 4DFSA 3IN9A 1O5LA 5HV4A 1MQTA 1MPXA 3PUQA 1IZ3A 1UOJA 2X8KA 4IW3A 4FPFA 5JIAA 3VZNA 1AR72 3PTYA 1NT0A 4IEPA 4ATEA 1W9TA 5JSOA 1VBD1 3KS7A 1C8M1 3NNGA 2PLV2 4XJ8A 2CGPA 1O5UA 4PIYA 4ISRA 4PT6A 4M00A 4IE6A 1ST8A 3J7NA 3R05A 2ENRA 4MUVA 1SDDB 1RUJ2 3WUCA 2XR4A 2BFUS 4OMDA 2B39A 2WO1A 2JE9A 1HLCA 1NA1C 1W8ZA 4Q4W1 5EYXA 1K5MB 3USUA 1REFA 5A3OA 2C0ZA 3ZXGA 3OGSA 1ZRRA 1TME1 5ABJB 1DQ6A 1X9TA 4A2UA 5JSRA 3TNPB 2QVSB 5A6XA 4BK4A 1AF9A 1GWMA 4FFGA 5FYYA 4WM7A 1VBB3 5A7OA 2GP3A 2D3RA 4XHBA 2KM2A 3A4UA 3R4DB 4LXLA 3RS6A 3ZN6B 1QJFA 1UMZA 1WA4A 4HL0A 1N3QA 4CDUC 2VZVA 1IKQA 4QHBA 1BEV1 3WCSA 1NE6A 2QDRA 4RR3B 4DPNA 2G1MA 4LEJA 3MGUA 4FPKA 4YW4A 4KBBA 1IS4A 5T5PA 3MF9A 2XDVA 4A7ZA 1UY3A 3J7HA 5JZGC 1AR62 4CUBA 5DABA 4AZZA 4A3XA 3Q8AA 4GH4C 1CGPA 4COWA 2ZBJA 1MQTC 1VB2A 3ACLA 3C2UA 4U2AA 1PIV1 4BB3A 3TEZA 4RGKA 5IK5A 4BQWA 1O4TA 5FZAA 2OZJA 1E5HA 3J26N 1PVC3 4IEQA 4UW6A 4LT5A 3N7JA 3WDWA 2C1FA 1BKZA 2EAAA 2PELA 3T2PA 3WP3A 3PUSA 3WVJA 2HWB3 5DUXA 3LZZA 2XMLA 4XCBA 3RWKX 4XEZA 3LIHA 1PMIA 3A7QA 4CCEA 4HVOA 2WNUA 4AGRA 1DZTA 3TYJA 4HMZA 3POBA 3EQEA 5FY1A 4FBFA 4UF0B 1W05A 1DGLA 2RDRA 3ZVXA 4LO4B 4CEWA 1D4M1 3FMGA 1UX7A 1YJLA 5DPNA 4WVZA 1UOGA 3T3YA 2JDPA 2ZEYA 4IGPA 2OYZA 2QDNA 2WL1A 1FOD2 1OMIA 2JDYA 4Q4X3 1VBC3 1AR83 4QPGC 4DB5A 5K0UA 1C57A 3VLBB 2JEMA 1JYVA 5FYZA 4C8DA 2GALA 3WUDA 2W68A 1QJU1 2BERA 4W65A 1CX1A 2XPJA 5IVBA 1YFUA 4JGZA 3B93A 1LOFC 1CPNA 1W04A 2KR2A 2W94A 4LLFA 4XJAA 5FP4A 3SITA 1QIQA 3T2TA 4LLOA 3E5QA 4M4PA 3NMBA 2NMNA 4Q1PA 1CQ9A 1ZM1A 4XAAA 2R16A 3ENRA 3OPWA 5T5OA 4QXBA 3S7IA 1S0DA 4OYUA 3DCQA 3NJYA 4WM8B 3A0KA 1WW7A 1LAJA 5BNOA 3N4MA 4S2FA 4B7EA 5DUWA 5C9AA 1IS3A 1DYOA 1QF3A 1GSLA 2RS31 1XNBA 4XC9A 1XYNA 1PGL1 4ZPIA 4OHWA 1EV11 2ZGPA 4MGSA 1AR91 4ZHNA 3ZXEA 5CYYA 4CEWC 4B7KA 2ZX3A 3AYDA 5D8AB 4DZGA 3POJA 1RUG1 3SH3A 2EXIA 4BU2A 5IVEA 2W1QA 2HBUA 5BUVA 4JHZA 5FUNA 3EXUA 3VD7A 2ZCWA 1RUI1 2KXLA 4LE4A 3WEZA 1AL21 2E7TA 1V6IA 2XWJB 3VBSB 4FQ4A 3OYWB 3S5AA 3KGLA 1NCQA 1UZWA 2WSVA 4R9BA 4R9CA 4WZFA 3CJIB 4QPWA 4WVMB 4XTMA 5GLVA 4JGYA 4CDQA 4DOUA 5LB6A 4XUNA 1DGRN 2J42A 3P6BA 3FWEA 5A7NA 2BFUL 3EMRA 1RUC3 2RS11 5FMOL 1UZZA 3ACIA 2BUKA 4I01A 5IHRA 4NE9A 5LBCA 4FPOB 2ZGSA 4AQTA 3CF6E 3RDIA 1VBA1 2GMPA 2RDNA 5JIUA 1MZ6A 3WR0A 3WW3A 3U78A 2KA3A 3M2MA 1U0AA 1MS3A 5JPNB 5KXDA 2OQ6A 1QGLA 4QX0A 3DN7A 1C8M3 3DGTA 2TUNA 1I6XA 2ZHKA 3HVDA 2PQSA 5FY7A 3ZM8A 5D21A 1D4VB 4B1MA 4CP9A 1JOJA 1NZIA 2ID4A 2W1UA 2TEPA 1YRZA 2J1VA 2RM22 1GQHA 2MEV2 3KVBA 4EYUA 4NAOA 3SHRA 1QDCA 1URXA 1AR71 2MNGA 4LBQD 5EJ3A 4CCJA 4XXAA 3RZZA 4Q4W3 1YEWA 2R0FA 2PLV1 2VMDA 2YV8A 1UCXA 1Z7S3 1O4ZA 2ZOEB 5FPLA 1FNZA 1TME3 3CMGA 3GZTB 1OLMA 2WO3A 1H8TA 2XUEA 1V70A 3C7EA 4ZS2A 1ND2B 1ND3C 1RUJ1 2QQKA 3NV4A 2YPJA 3AJYA 4FOWA 5LZ6A 3RQ0A 5IFPA 4YVWB 3ZXJA 1WMXA 5AFBA 4LBKA 4Y4YA 4KG8A 1BEV3 1RUD2 1WBFA 1L7LA 5DAWA 3LF7A 4CDXA 3M3IA 5CFCB 3N9QA 1UF2C 4XQWA 4RS5B 3IZOA 2J1EA 1BBT2 4NHMA 3POYA 1XYOA 4GWIA 4GWMA 2DUOA 2IVJA 4H2AA 2VVDA 3HQUA 1ULOA 1VB4A 3LSEA 2GC2A 4UFHA 2AZ5A 3VBRB 1XSQA 2IFWA 1PIV3 4NAMA 1GOGA 4RD7A 2NMOA 5KC6A 1JI6A 5DDJ2 4YVSB 1YQ8A 2I07B 2YG0A 3AZYA 4I30A 2J7MA 1XYPA 2WZR2 5FFOC 4Y1ZA 2D98A 2IZWA 2G9FA 4A6OA 1CD3G 4BQ4A 4Q0UA 1HXS2 3DPRA 1UIJA 2PTMA 4KG0A 3WF0A 2W3JA 4L99A 4URTA 4CU8A 3GBGA 1YI9A 2QE3A 1IG3A 1FAYA 2QCSB 2UYBA 3CO2A 2WT2A 1W9FA 5T54A 1LECA 2YGMA 3JXSA 4XDPA 2FCTA 1GFF2 1OF4A 4FXGB 2OUHA 2QQUA 1UYXA 1YIPA 2PHXA 2NYYA 4AEDA 2LRPA 4U36A 2WNVA 4X8NA 4AGVA 1J59A 3H0OA 5B2GB 1ULFA 2ZX2A 1D4M3 4RQPB 3LDKA 5A3NA 4CEYC 2Y33A 1S2KA 3P1IA 1UNBA 5K4LA 2X53S 1BVP1 1R081 1SPPB 2HEWF 1BK1A 2DTYA 3D5OA 2PHUA 4Y24A 5BNPA 2K0GA 2CTVA 2OVUA 4IEOA 2BW8A 3UKVA 4MGKE 1SCRA 4AI0A 4RSUA 1PHMA 5FUPA 1LHVA 1CAVB 1NLRA 4R9DA 3ZFEB 2LUWA 1A34A 2NQYA 4XPVA 1QJU3 4J1WA 1SBEA 1HN0A 1LENA 4BLIA 3CKHA 3NL1A 2Q30A 2Q8OA 3B69A 1Q43A 2Y6HA 3USSA 1AX2A 1UZVA 3H8UA 2EIGA 2GDFA 2R1DA 4Y22A 1STMA 2Q1FA 3F95A 4AYUA 1C28A 3ETQA 4PIXA 1UO9A 4D3WA 4TSVA 2D3PA 4HOOA 4NMIA 2GMEA 4NHLA 4S2HA 5FYSA 5LA0A 2VZ3A 4N53B 2WT0A 3NJZA 2GP5A 3NRUA 4AI1A 2JB4A 4E2SA 5JOXA 1HJFA 1O3QA 2YFUA 2B4KA 3MFAA 2Y6FA 4AAPA 2JDKA 3HD8B 2VOXA 3EYPA 4M01A 3CQOA 1MS0A 3D0JA 4GMP1 1K5MC 2O8QA 4D7TA 1ZREA 3LKJA 3M3QA 2RS33 3AZZA 5ABJC 2Y64A 4LHSA 5FZLA 1EV13 1HRI2 1AR93 1Z78A 1OUXA 1RUF3 1ZBA2 2VCBA 4YZ3A 2ZGRA 2D5HA 4QPYA 1HKDA 3VBUB 3IPVA 5L36A 5LY1A 1AXZA 3WNMA 2ZX0A 2YYOA 1RUG3 4ZONA 4GB32 1ZZ8A 2J1AA 3M7AA 4Q2FA 1ENXA 3CHXA 4ZU5A 2AEZA 2W9XA 3M70A 3PMSA 4HLTA 1OC1A 4BIOA 1H30A 4RR3C 3CLPA 3WG2A 4HN0A 1RUI3 4LKFA 1AL23 4XVHA 4Y1YA 2OUJA 4AFAA 3PTRB 4A4AA 3LEKA 3H7YA 1DG6A 3BB6A 5E89A 1RXGA 5EFUA 3KCYA 3O1PA 5GKAC 4QXKA 5L19A 1GZWA 4DUXA 2XVKA 1YQ6A 3AKQA 4MXWB 1PVC2 4AR2A 4IDZA 2QBXA 4FTBA 1C5IA 5IJRA 2J1SA 4DUWA 1OBNA 1WA6X 2ZHNA 3PL0A 4K8RB 4AF9A 5FWEA 1VPHA 4BM8A 3KHBA 4D7YA 5IW0A 1QXJA 2JXAA 2HWB2 1S2EA 3F2ZA 2VBBA 4OUEA 5JCTA 3ZDVA 3HNBM 2TNFA 4Y1XA 1OPMA 4F8AA 1W0OA 1GUIA 4WM8A 1XXNA 3ACHA 2A1XA 2HYKA 3ATGA 2VBDA 1PNFA 1HB2A 1XSRA 1D0HA 4LBQB 3ZSKA 1XRUA 3WINE 1ODMA 5CVRA 4Y1UA 1ONAA 2GNDA 3AKTA 1W9WA 2QKDA 4PIZA 1AR73 3QH7A 5FZ7A 4AHZA 3PMEA 4EN9B 4Z2WA 2ZGUA 5LEKA 1BLZA 2PLV3 3V65A 1M06G 1MS8A 2VOKA 4P9JA 1CIWA 2BWAA 4Q4X2 3ZR6A 1I9RA 1AR82 1RUJ3 1VBC2 2RM21 3NWKA 2MEV1 5SV8A 3TEXA 3VDDB 5L7OC 2XJUA 1DBNA 1YNAA 4BMBA 1VMJA 4FAGA 2JDMA 1ENSA 1JTZX 1N47A 2K2SA 5A7PA 2V5YA 2VBPA 4N53C 1VALA 4UBHA 3UJQA 2JG8B 3FJSA 3RZMA 2OW4A 3I59A 4PDWB 3EB7A 3OD4A 3BODA 2VOVA 2G9ZA 4XYXA 3RZKA 2W08A 5FWJA 1GV9A 4HZFA 5A70A 5C3SA 2B46X 2WABA 1BHGA 2NP0A 2IC1A 3BUCA 4UAPA 2A3WA 3ORJA 1RUD1 2VVEA 3MV11 2Q8CA 2HWE1 1GU3A 2WWJA 3WP5A 2BDRA 2VM9A 4WM8C 1UXZA 4AGGA 5FP9A 3AFGA 3K2OA 1HB1A 2VOTA 5KWRA 1ULEA 1Y4WA 2PFWA 3VUOA 1V6MA 3RZLA 5F39A 3O1VA 4COZA 2VQAA 4MV2A 5HV0A 2HH9A 1W6NA 3N9NA 2JDNA 3K51A 4PLMA 2LS6A 5DDJ1 3I2JA 2GC1A 2GH2A 2VMCA 1LOEA 4KL1A 3RJ2X 5CKNA 5JI9A 2WZR1 5D8AC 2O8OA 1X33A 1IPKA 3T2QA 3VBOB 1DQ5A 4AFCA 4FQZA 3ZSMA 2XJQA 5LA2A 4C0BA 3USUB 4R52A 1KRIA 4XXPA 4YPJA 3IDAA 3VBSC 2ZX1A 1WD3A 4XDOA 1JMUB 1WLCA 4P9YA 4TLGA 1R083 2ZGQA 1ZA7A 3CJIC 4PCRA 2WLPA 4DIQA 2AGSA 5FZ1A 4WM7B 4AK3A 5FYCA 3VN4A 4EN7B 5HCHA 1JYXA 1RUC2 3H3UA 2ZMKA 1DFQA 4FP3A 1R1ZA 5F5IA 4HG6B 2XL9A 4ONUA 4JTOA 5FO8B 2YPDA 3IDBB 3VD4A 2DVDA 3I54A 4NO4A 3VBRA 2P6CA 1ULGA 2XJPA 1V6LA 1W03A 3POFA 5IVCA 1US3A 2EALA 2BP6A 3H7JA 5FREA 5H9RA 4JKMA 2YMZA 4YVSA 4D8MA 4OQ8A 3PVEA 1AYM2 2JKXA 3OF1A 2FZ1A 4META 3VL9A 1RITA 3OEAA 5I0RA 4LULA 1Q8VA 1NXMA 3EO6A 5FXWA 3VZKA 3BTAA 1GLHA 3WNNA 4JTNA 1Z7S2 3LCPA 3ZKYA 3PNAA 1OLRA 3O1MA 1V6KA 4BZ4A 4D0QA 4AOCA 3ZLIA 5LEJA 1DLLA 3HN3A 1ND2C 3POIA 1JYCA 4CCOA 4YM0A 4IEWA 3SMHA 1UL9A 3RPQA 2VVFA 1SBDA 2WAAA 2BV4A 3GDBA 3N36A 4LA2A 4P5HA 1FATA 2XQXA 4PQ9A 2OPWA 4RQPA 4YVWC 5FP7A 4DEQA 3DEMA 1BEV2 4Q0VA 4XJZA 1K5JA 3NNFA 4UXAA 2OS2A 2DVFA 1HRI1 5CFCC 1ZBA1 1QJY1 2YY1A 4ORFA 3U0ZA 4RS5C 2P17A 2F4LA 4FOQA 1EUTA 3LEMA 5IFTA 3POWA 4MGQA 3W5NA 2D6NA 3PVNA 4GB31 1LEMA 3WHTA 3A22A 1VAVA 5JMCA 5K0UB 3FBMA 4NWVA 4JCKA 5SV5A 3VBRC 2RJKA 4Q4Y2 3SH4A 4AVTA 3VV1A 4YVSC 1QJEA 3HQRA 3QACA 5D2AA 1U12A 1W6QB 4HSLA 1XPWA 3WG1A 1GBGA 3LGRA 3JB8A 3MF6A 4JGZB 4H7MA 2WYFA 5LK5A 3QCWA 2EA7A 3I8TA 3OPZA 2Q8EA 4ASMB 1W99A 3HNYM 3KMHA 2IXIA 1Y9MA 4OQ9A 5ACA2 1QOTA 4HETA 4E9KA 2BPA2 1ZX5A 3KV5A 3RMYA 3WHUA 2E32A 2XVLA 2QQVA 5FXXA 4UOJA 1U5XA 5FPXA 3HBKA 3MIBA 2HWB1 1BYHA 2XJRA 4KBZA 4XBLA 3WZ1A 2Q0AA 5BNOB 4CUCA 5FZMA 3GBWA 2XHNA 4HPKA 5IUQA 5F3GA 4PBOA 4RQPC 3M8LA 5C9AB 2VH9A 1JYTA 5DG2A 5K7PA 5HXMA 1GNZA 1G9FA 5FO9B 2BWCA 2RM23 5F5QA 3U07A 4XJ9A 3Q8EA 5C3PA 4IGQA 1FV2A 1YHFA 2K46A 3RMXA 1O3SA 4PI2A 3ZFEC 3WF4A 3O1SA 3WSOA 5HI0A 3WP6A 3M3OA 4CCNA 2DCYA 4Y20A 3KZ4C 2B5HA 1UYYA 3IT8A 3ZFFB 3RG0A 1HQLA 3I3DA 1NCQB 2W1WA 2WZEA 1F5JA 4JGYB 4UYBA 1VLNA 4JAAA 3HR9A 3PVBB 2WN3A 1QY4A 1E5RA 2HLEA 2HWE3 1H9PA 1H1IA 1H6XA
chains in the Genus database with same CATH topology
1GNHA 5FLHA 4XF1A 2RS32 3O0XA 1DQ4A 2LTNA 2QNKA 4Z82A 4YW1A 2XGXA 5KHIA 1RUF2 3RSJA 4XF3A 2X5IA 2H6CA 3VBUC 4HVQA 5IT6A 2IXHA 5T5JA 1IOAA 1ZZ9A 2VUJA 2WZR3 2VUAA 4E2QA 3LWCA 5J98B 2EF6A 2R042 1AYN2 5H9QA 3WOGA 1RUI2 1MR5A 2DCTA 4FPHA 4W6XA 4ZXKA 3WQ0A 1CONA 1LULA 4AEJA 4FOYA 3D8CA 1AXYA 1H8TB 1LOBA 3ZXKA 3AZXA 5C6CA 2ZHMA 4AVCA 5A32A 1GZ9A 5GZGA 2HWF2 3ILRA 3ZDSA 1PZ8A 5KHGA 4N43A 5FQ0A 2R0HA 1OQ1A 4CDXB 2XG3A 1CESA 1MEC3 1W6MA 2ZACA 3QLQA 3N7LA 4FVVA 4G9SB 2ZGOA 5GJ6A 5DZGA 4INDA 2D6OX 2QFEA 4QGNA 3UKNA 3B01A 4AHXA 2UY8A 3KM5A 4GKXA 1QU0A 2DCKA 3BPZA 2D6PA 4OI2A 2HWD2 3DPRB 4DY5A 3H1MA 1AYM1 3AYEA 1AX0A 3VBOA 4P9IA 4CDWA 3VDDC 1YXWA 4RGAA 4FAHA 1B35A 2XJTA 3FC0A 1S1AA 3JCIA 4E4DX 5CAZA 1Z7S1 3AMQA 3TNQA 1RTVA 3OY8B 4XF9A 1CVNA 4AEDB 3FBYA 1PZ9A 3CL1A 2WNVB 2AH2A 1HRI3 1ZBA3 1QJY3 2JG8C 4D94A 4PDWC 4K21A 4YW3A 3FLTA 2WA3A 1J1LA 3D82A 4GQ7A 4GB33 4NPRA 4BHPA 1RJ8A 4K1ZA 3NVCA 4QGLA 2CL2A 5BNPB 1YO8A 2ERFA 2XWBB 2B45X 2E63A 4NVPA 1TMF2 2GH8A 2NN8A 4H7LA 4IV1A 2VNGA 2WJSA 3O0VA 5C4WA 4NR1A 3ZSLA 4Y22B 5FOJB 4C1WA 1SLIA 1KXGA 2PQQA 3ZSJA 2AREA 3KD4A 1HQWA 4Q4Y1 2SLIA 2JE7A 1H8VA 1FI2A 1PGSA 2WNEA 1YIFA 1LB2A 1Q8SA 3OTFA 1BMV1 2IFRA 3JUUA 1UN1A 3KCXA 1I1EA 2E51A 5ACA1 3MLLA 3N35A 1R082 2WSUA 2MHFA 1CX4A 2VU9A 4XMAA 3IPVB 4WM7C 4I2OA 3OGGA 4Y26A 4GMP0 4AQ6A 3CU7A 2ZGLA 4F7ZA 4I3GA 4MH0E 5DZFA 2P3JA 5J96B 2BTVC 1UAIA 2A3XA 2R32A 1LJ7A 2D7FA 2ETEA 1W6QA 1GZWB 3OGJA 4YGCA 4HVRA 4R8HA 3MIHA 4EN6B 1ULDA 3ZXAC 4QQOA 5KHJA 1GYKA 3ZN5A 1H4GA 1NCRA 1TNFA 3S6PA 3WW4A 1AJKA 2XHKA 4X8PA 1OKQA 2WNUC 4Q8LA 1XE8A 1PO11 4M0NA 4OUMA 4GALA 3SCFA 1F31A 1RUF1 4MGYE 1APNA 3FUQA 1YJKA 4IETA 2UWBA 2VGDA 4IEZA 3SCHA 2B8MA 5I8SA 4Q1RA 1LHNA 4AYUA 4RFT0 2XKOA 1CAWA 2ZHLA 3BU7A 1W39A 5GZCA 2R041 1AYN1 1LGBA 3ZO0B 4C1XA 5K0UC 3TN93 5CU1A 3ZFFA 1YUDA 4NWWA 4HK8A 5FPZA 3WG4A 3I59B 3EJKA 4QQ2A 5DUUA 4JGZC 1V6OA 4YFZA 4QQLA 4XJWA 4B4RA 4HN1A 3OBTA 2HWF1 3VKOA 2WFPA 2PAKA 4FPYA 5L73A 2Z79A 3HAGA 1ZZ7A 2ILMA 4HFSA 4IXLA 4QD2A 1HRV2 3UL2A 1IQAA 2G4IA 4DRRA 4FCAA 5BNOC 3C3VA 5GLWA 4AWDA 1SFYA 5C9AC 1AYM3 5JAXA 3AMHA 3MEPA 1Y7BA 5KHKA 1W6NB 4XZPA 1W0PA 2HEVF 2IWGB 3LAGA 2BYVE 2HWD1 2IXJA 2GMMA 3VKLA 1BZWA 1POV0 5E8AA 3ZFGA 1Y3TA 4N7IA 3AMNA 1NCQC 1J1TA 4XOGA 1JN2P 4CDQC 3WV6A 4JGYC 4MGIE 2DCZA 3B9IA 3MIFA 4FO9A 3NO8A 2HWE2 1KJRA 3VZMA 3AZWA 1X8MA 4E2GA 3M3CA 4MGZE 3JQWA 4FPGA 4Z92B 1OOPA 1Q56A 4QPIA 3LOIA 3ME2A 4O9EA 2D5FA 2WS92 4Q29A 1ZRFA 1G7YA 4DS0A 1ULCA 1HV0A 2UU8A 1AZDA 4N7UA 2PHLA 4SBVA 4Q4Y3 1PO23 1TMF1 1VJ2A 4BMEA 3U4XA 2D6MA 3RNSA 4AHYA 4AEKA 2OPKA 1OLQA 1O3TA 5T3NA 1F9KA 3ZXLA 4LO7A 1U5YA 4FPCA 1C5HA 3R0RA 2YROA 3VZOA 3GHMA 1DDLA 4XFBA 4OUSA 3VBFB 5C8WA 2GSYA 5ACA3 1KS4A 5GZDA 1OFSA 2NM1A 1H8TC 3OY8A 1QNYA 5E1RA 4UW4A 4RA0A 2P3IA 5CFDB 4GWNA 1REDA 2BEOA 2A6VA 4N90A 4CTEA 1O7FA 2CNAA 4K3UA 4YFWA 4D7SA 1MEC2 1MS5A 4CDXC 3NV2A 5JSPA 1UPSA 3AMMA 2PHFA 2ZKLA 3PJYA 5I8YA 1XE7A 5CG8A 5LRSA 4AQSA 1LOGA 1FPN1 3EHKA 1NOVA 1KDMA 5KBFA 3P3PA 5EYYA 4QU2A 4ZU7A 5BNQA 3AKSA 4Q0QA 1F5FA 3L9JT 1ENQA 2DVAA 2ZAHA 4TYSA 1Q8QA 5JVVA 1ZZBA 2ZKNA 3G6JB 2MPFA 4YZ2A 2R30A 1KFXL 2ZX4A 4H3WA 4E4ZA 2BGCA 4Z8BA 3DPRC 3BOWA 1GICA 4JV4A 2XLGA 2VW0A 3NKGA 1DYKA 1BXHA 4LA3A 3WQ7A 2I74A 4HKWA 3HBZA 4AI8A 1JXNA 1PO13 3MIGA 2OIIA 5DG1A 1LKNA 4AEDC 1QJY2 3GZUC 3OBRA 2WNVC 2HKXA 4HPKB 4GXLA 1NZCA 3UK9A 1PZ7A 5HCAA 1LESA 1UW8A 3KQRA 4IEXA 3VBHA 4XW3A 4LBOA 2R043 5I0UA 1AYN3 4FT8A 4KU7A 5BNPC 1WUVA 1RVF3 2WINB 4I02A 3M4FA 2GN3A 3AZVA 4QM8A 3FLRA 2JX9A 5JR7B 3P3NA 1O91A 1ZBE3 4Y20B 1Q8PA 4XQ4A 4JRLA 3JZVA 3B7MA 3U11A 2YXSA 4LO6B 4F3JA 5A33A 2W39A 2HWF3 3SCGA 3AFKA 3KT1A 4IEVA 5T55A 4S2GA 3ES1A 3URFA 4Q8KA 3UV9A 2RMU3 4QMAA 3UJOA 4J6GA 2YZ4A 4P9LA 1S0IA 2CAVA 4LUKA 2X5IB 1HRV1 3MDPA 5I0SA 2AENA 4IEYA 3ZYPA 1V9U2 5T52A 1HIXA 1J3PA 4CZSA 4YGDA 2GNMA 2HWD3 4AQ2A 2WQ4A 2N7GA 2XLAA 1JHNA 1LHOA 2JKBA 4W6YA 3E97A 4COVA 2E7QA 5A32B 1RUH2 3WDVA 1GR3A 2R072 3KLSA 4WBBA 4FSJA 2I2SA 3T1LA 2BNOA 2AR6A 4RL7A 1VR3A 2IXLA 1AUYA 4N43B 5FQ0B 4OI1A 2DV9A 3RYKA 4AVBA 4FPLA 4I09A 1W6MB 4QQHA 3H9AA 1NY72 3JD72 1Q5OA 2DVBA 3KGZA 5K9YA 5AC93 5BNNA 4PJYA 5J37A 1MS4A 3O5SA 4IV3A 4P9GA 4K7JA 4BOWA 3L2HA 3ST7A 3IIAA 4YM1A 1TMF3 2AUYA 1PGW2 3RI9A 4ZKTB 2WS91 3KT4A 2ET1A 5J48A 2Z2SB 3W59A 1MVEA 2E6VA 2Z69A 2DFBA 5J3UA 2UY9A 4MXVA 4OHZA 4R9AA 3THPA 2EAKA 2GZWA 2VG9A 1C3HA 4CDWB 4HBNA 3MYXA 3NW4A 3TN92 1S2BA 3N3HA 1B35B 1CAXB 4IL7A 4M0HA 5FTTC 1QWRA 1R092 3TOJA 4MSVA 3RJRA 1CJDA 4MYEA 3WNXA 2TBVA 4XFFA 5CNAA 1LEDA 3N7MA 2H6BA 3E6CC 3HT2A 3NV3A 1QXPA 2A6XA 2VPVA 4P9WA 1FPN3 1B09A 1MEC1 4RHV3 3MPBA 4L11A 4LUMA 4JDOA 1EAH2 5C8CA 4I0BA 4IV1B 1SLAA 1G6NA 2BVVA 4G4FA 5C4WB 4F83A 2ZGKA 1DHKB 1X7NA 3ALQA 1S0EA 2PHRA 2ZMLA 5BV6A 5K8SA 1GANA 5FO7B 3DKWA 1LODA 2A5ZA 3INAA 3VBFA 4K9SA 3J8F2 4AEMA 1EPZA 2DWRA 4YARA 1BJQA 3WXPA 5CFDA 1W6OB 2Q5TA 3WDXA 4CP0A 2BBVA 2VY0A 3AM2A 3NSTA 4NHKA 1C1FA 5BPXA 4Z1VA 1MS9A 2ZTNA 1RHI1 5GLTA 3WY6A 2VXRA 4XFGA 1D2SA 2XB6C 4BCUA 4EN8B 3V0AA 5KC5A 3VL8A 3RWNA 4LNVA 5GALA 1FT9A 1NE4A 5CB7A 1D0GA 2EXJA 3AP9A 2A6WA 4Q0SA 4QGMA 2DYCA 4YYOA 1PO22 3V56A 1ZYBA 1N1SA 4QT6A 1JW6A 2GNTA 2P2KA 4JRAA 2WC2A 3VHNA 2ZJCA 1FXZA 3WP4A 2YHJA 1BMV2 3ELNA 4I0WB 3X29B 1SQ4A 2SBAA 3MPPG 4XILA 5FOBB 4C0HA 4YG6A 2P3KA 3VBFC 1R1A3 1NCRB 1G9BA 1N3PA 3WDTA 1HV1A 4XIKA 3UKTA 1QOOA 5CIRA 1HRV3 1LOCA 3IDCB 1OFNA 1H2KA 1S0FA 2H0VA 2VMIA 3O14A 3U10A 5FDBA 1IPJA 2JDZA 2R49A 4XFCA 3ZYRA 4QQPA 1DQ0A 2R1BA 4IESA 3JBG2 2A6YA 3DV8A 4LBMA 1V9U1 5FRAA 1CAWB 4BLJA 4LO5B 1WMDA 1UIKA 1UKGA 2QQPA 4K8FA 1VIWB 1SDWA 2JJ6A 1C1LA 2UWAA 4AI2A 1RUH1 1C8NA 4FOVA 3D6EA 3MFCA 4TWTA 2R071 3THTA 3ASIA 2ARBA 1H2NA 3BIWE 3KCCA 1XNKA 3VHPA 2FQPA 4TLFA 1PO12 1RUE2 2RHPA 2WS93 2CY6A 1SFNA 1NY71 3IBMA 3JD71 2A73B 4QX5A 3MZHA 4L9BA 2XL7A 2CWSA 1QQP3 2BVBA 1OPOA 2CV6A 2R062 1PGW1 3AYAA 3FX3A 3NAPA 4C91A 1SEFA 2WIIB 2ZZQA 1H1AA 1SMVA 4KQ7A 1RVF2 3BCWA 4KWLA 4JDMA 3ZN4A 1AX1A 4KGGA 3MIEA 1PK6A 3E5XA 4BYYA 2H0BA 3H50A 1TEIA 1ZBE2 3SLIA 3LA3A 1OD5A 5E88A 1DGWA 3ZFGB 4B29A 4M3CA 1MVQA 3AP6A 4AE2A 4BWOA 4E27A 3TN91 2ZZJA 1DZRA 2Y0OA 1N1TA 4KWKA 3GNEA 1R091 2D97A 1JUHA 5A3MA 3GF6A 1NYWA 4RGGA 2XJSA 1O3RA 1EPWA 1NA1A 2RMU2 1LHUA 1OOPB 4QPIB 3J9SA 4MVTA 1HX6A 2A3YA 2Y38A 1VBE2 4G3YC 4PLNA 1XNCA 4C90A 3B94A 1QXRA 4AVSA 1WCSA 1Y9QA 2X5IC 1EAH1 3VGIA 3JQXA 4CDUA 3IMNA 2Q4SA 3Q9OA 1WLWA 1FNYA 1WLDA 3FZ3A 2BNMA 4XBNA 3E6BA 3HN1A 5JZGA 1MS1A 3BOPA 4L97A 2D93A 1YYNA 2UURA 1CAXA 4GH4A 1U5ZA 2BNNA 2ATFA 4BIFA 3J8F1 5JOZA 1LTEA 2C5DA 1Q3EA 2P37A 4DINB 2VQ0A 2NZ9A 2YUEA 3ZPYA 1RHI3 3ZXFA 1MZ5A 3TBDA 1A8DA 2VOWA 3WDUA 4N43C 3LA7A 1YLLA 1V6NA 1D2QA 4LR4A 5D1IA 1RUNA 1NQDA 5AC92 4LHKA 5FMOS 1KFUL 2ET7A 1VP6A 3J4UH 1W2UA 2YGLA 2JENA 1WLTA 2I45A 4HANA 3IWZA 1RB8G 4JVAA 5AVPA 3MW4A 1WMEA 2B42B 2ZMNA 1I5ZA 1PO21 3R4SA 4XETA 4KGQA 4QPGA 4Y5Z0 4YRDA 3QBQA 4YG0A 4JDNA 3VBOC 4CDWC 1COV3 1M4WA 1B35C 4YM3A 1W6OA 1QMJA 3D0SA 4LBNA 4NOTA 4AVAA 1LOFA 1LU2A 1RUOA 4PBPA 4CP1A 2Q1MA 2OZ6A 3ROUA 1V9U3 2HWC2 4BA6A 3TB0A 4XF0A 1FPN2 3VBHB 3V0BA 1C4RA 3AP7A 5F6LB 1NLSA 4RHV2 2A70A 2ZABA 1FV3A 1V6JA 1QKQA 3WDYA 4R4XA 4BE3A 4UW5A 3AJZA 1H4HA 3JBG1 1XU2A 5BY5A 1UZYA 4M3CF 1EYBA 4IV1C 3VKNA 2PN5A 1OSGA 5C4WC 1MZFA 4EWEA 4BQ1A 1RUH3 2PA7A 5A33B 1OA2A 2R073 3GZAA 1YFXA 3WLUA 4DNYA 4B3NA 1OQDA 1RGSA 4LBJA 2RS51 3VZLA 2VULA 2AYHA 2W0XA 5L7OB 4LTAA 1LGNA 1FMD1 1WW4A 3JD73 2XBO1 1DQ2A 3LOBA 4HKOA 4MZUA 4FP2A 4PF5A 2ZAAA 4KH9A 1GZCA 4ISQA 3GBFA 3PHMA 4MX3A 4YZ5A 1G9AA 1RUE1 2FMDA 1IS5A 3KB5A 5LK7B 4LO8A 5GZEA 3D4KA 3DUIA 1WMFA 1X50A 2WFF3 2D40A 1ALYA 3PLQA 4EJRA 1UU5A 2D6KA 4TZDA 5DUVA 1J3QA 2R061 3MICA 1DGRA 2ES3A 1ENRA 4IERA 1LOAA 1RVF1 2PAEA 1YCIA 1R093 4X6RB 1S55A 1CJPA 3H3ZA 3MW3A 5GLZA 1ZBE1 2CWMA 1NQJA 4OLLA 3CJXA 3TRSB 2UWCA 1BQPA 1RMU2 1R1A2 1Y43B 2D43A 1ND3A 1NCRC 3AP5A 4BH9A 5BNNB 5CA6A 4IV3B 1SLCA 2FBEA 2WKKA 2PHDA 4J1XA 1XQNA 4GKYA 1QOSA 1EAH3 4K20A 1WCDJ 2RMU1 3SH5A 3B00A 4XIOA 2VW2A 3ECQA 1VBE1 5KHHA 1ASJ2 1OHFA 2D3SA 2JD4A 3ZX7A 4IEUA 5F9TA 4XQDA 5HCFA 1H2LA 1JBCA 3R6SA 3SISA 5AFEA 5GLUA 2D6LX 1KD7A 1G9DA 4Q27A 3ILNA 1S0JA 1GQGA 3J8F3 2P34A 1RIRA 1JH5A 2QZ3A 4DY3A 1V00A 1VBD3 2DVGA 4FTEA 1AJOA 3ZFFC 1QJX2 3WX5A 1TNRA 1SLLA 2E53A 1N3OA 1G8WA 1QH7A 2VW1A 3FE5A 3AXDA 4LHLA 4YZ4A 4R4ZA 1UPIA 1SACA 2R6QA 2RJLA 2Y0IA 5I0TA 1W6PA 2VNOA 2HJIA 1NG0A 1QDOA 2JG9B 2Y26A 4N9IA 5CADA 5FBZA 5C8CB 5AC91 4CEYA 4B4PA 1VRH2 2GC0A 1QQP2 5CG9A 2A71A 2V73A 4XMIA 2XUMA 3HWJA 5DZEA 1F8VA 2DF7A 3TWIA 2RR12 4AXOA 2WZPP 3AMPA 4XHXA 3AK0A 3ES4A 3IDEA 4GA9A 1CAUB 4Q4V2 3ZFGC 2XH6A 4GIQA 4IQPA 1AR61 5BXXA 3KT7A 5JDBA 2Q1ZB 5EV7A 1EY2A 4O9GA 3VHOA 4AHWA 5FCCA 2XJVA 5BYNA 4AVVA 4UW3A 1A78A 2XKPA 3JBG3 1K5MA 3V0AB 1OOPC 4HSJA 2HWC1 4QPIC 4B8EA 1DGWX 5ABJA 2CGNA 4A7KA 1UD1A 2GC3A 4BPZA 2CYFA 3O0WA 3VKMA 3FUOA 4RHV1 3ZSEA 4JQRA 3ZMOA 4ATFA 5CBLA 1H9WA 3ZN6A 3LA2A 2RS53 3LSDA 1EP0A 1VAKA 2GAUA 4OI4A 1FMD3 4YGEA 3B3QE 4RR3A 4N9HA 2XBO3 4XDQA 3A0NA 1ZRCA 1FYUA 1IHMA 2DU0A 2VMHA 3B02A 3W9AA 3ZYJB 1QH6A 1CPMA 1XU1A 2F4PA 4CP2A 1DZQA 1RUE3 1E57A 5KXEA 4AFDA 4L8QA 1FOD1 1WW6A 1RHI2 3B9CA 5A3LA 2FHRA 3JU9A 2C9AA 2W52A 1LR5A 4KNCA 3TAYA 5GM0A 2Z5WA 1ZRDA 3IKWA 1A8MA 4XJUA 1T6GC 2WLQA 2UYAA 2R063 4COUA 1G86A 4DXZA 2G9GA 4CRQA 1H1MA 1QNWA 3GYDA 3WCRA 2ZS6B 4KWJA 5EWSA 2WT1A 1I3HA 4YLZA 1WGPA 2K9ZA 3PJQA 3S0MA 4V1PA 3ZYIB 1VBB2 2DCJA 1FX5A 3IM0A 4FPJA 5JWPA 3NV1A 1S0CA 3QOPA 1JYIA 2DFCA 4YSFA 3N7KA 2GNBA 3OD0A 1LRHA 3I7DA 4LBLA 1IGOA 5L7OA 2HEYF 3DF0A 3WG3A 3JB4C 1GKBA 2Z42A 1COV2 3ILFA 5FLIA 4H55A 3V64A 5KXCA 1RMU1 4P9XA 3MLJA 1R1A1 5T50A 1VBE3 4ZU4A 4AW7A 1DQ1A 3S30A 2VECA 2WQZC 2A6ZA 2RS13 3MI8A 5H9SA 1X8EA 3RI8A 1VBA3 2V09A 1AL0G 2QJVA 3NAPB 4FPEA 4OHXA 4WV8A 2RE9A 3VBHC 4K40A 4KU8A 4XBQA 1ASJ1 1HDKA 1OA4A 1PK6B 2DU1A 1H2MA 1LU1A 3WW1A 2DURA 4M3CB 1MACA 3RYRA 3FLPA 5JLVA 4S2DA 1YI7A 2DTWA 1KITA 2FMYA 1QHDA 5D8AA 1QJX1 2JECA 5JOWA 3HT1A 3E5UA 4AG4A 1PM7A 1NA1B 4M3CE 3OCPA 5I8TA 4WVVA 1HW5A 3VBSA 3OYWA 3WT3A 4WVMA 3CJIA 3FFQA 1N1VA 5IK7A 1AVBA 1Z0HA 2WFF2 5H9PA 4YW5A 4CDUB 5E16A 4YZ1A 3I2DA 1RINA 1VRH1 4COYA 1QQP1 3T1MA 1CR7A 4DMIA 5JZGB 4EROA 1BVVA 3AYCA 2E7AA 4P14A 2LALA 1F2NA 2PAMA 1BBT1 1SBFA 2RR11 4ES8A 4XFIA 3MIDA 2O1QA 4HK9A 1AR63 5HXVA 4GH4B 2VMGA 2DUQA 1MQTB 1OQEA 1X36A 4H14A 1POV1 4L92A 4Q4V1 4GULA 1YFYA 1S0GA 1YWKA 2HWC3 4XFHA 2B9UA 3VKFC 4YGBA 1HXS1 1ND2A 4XFAA 2JG9A 2VNRA 2YC0A 3CEWA 5EXOA 5AVAA 5KXBA