4QPGA

Crystal structure of empty hepatitis a virus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
225
structure length
225
Chain Sequence
PVGAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTFPITLSSTSNPPHGLPSTLRWFFNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTPWVEKESALQIDYKTALGAVRFNTRRTGNIQIRLPWYSYLYAVSGALDGLGDKTDSTFGLVSIQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNSNAMLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein VP1
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
total genus 37
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12944 HAV_VP Hepatitis A virus viral protein VP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgA00
5DDJ3 2WFF2 4CDQB 2X5IC 1RVF2 1PO13 2R062 3ZFGA 1TME1 1VBB3 4NWWA 1VBE3 1RUI1 2RS53 3VBSB 2WFF3 1MQTB 1CJDA 1RVF3 1HX6A 1ND3A 2R063 4GMP1 5LK7B 5BNNC 5BNPB 2RM22 1RUH3 2ZZQA 1QJX2 2HWB2 1FOD2 4IV3B 4SBVA 1RUF3 1HRV1 4RQPA 1D4M2 1QJU3 1K5MB 2HWD3 4N53C 3JB8A 1RHI2 1BMV2 4PDWB 4Q4Y2 1POV1 2BPA2 1QJX3 4YVSA 4RHV2 4JGYA 1FOD3 3VBFA 1RUD1 4BCUA 2HWE2 1D4M3 1RUJ2 5C9AC 1R081 1RHI3 3ZFFC 1FPN1 3HAGA 4RHV3 4GH4B 2HWE3 1NA1A 1NCRC 4JGZB 5K0UA 2BFUS 5ABJA 1AR61 4GB31 3ZFEB 1VBD2 5D8AB 1NG0A 1VB4A 4WM8A 4CDWA 1COV1 4CDUB 3JD72 1ND2C 4QPGA 1V9U1 1C8NA 3VDDA 1VBD3 3VBHB 2WS92 3JBG1 3JD73 1PIV2 1BBT2 1VBA1 1F8VA 2X5IA 1QJY3 5JZGB 1NOVA 1RUC3 2DF7A 5ACA3 1QQP2 5CFCC 1VRH1 1W39A 5BNOC 2WS93 1PO22 4Q4V2 1PIV3 1QJZA 1BBT3 1HRI1 3VBRC 2XBO1 1TMF2 3J8F1 3FBMA 3VBFC 1QQP3 1B35B 2IZWA 3ZXAC 4RR3C 5BNNA 5C8CB 1PO23 2BFUL 4Q4V3 1ZBA2 1AL21 2HWF3 1EAH2 1TMF3 1MEC2 3DPRB 1VBB1 1VBE1 3CJIB 2GSYA 2RS51 4N53A 4CEWB 4GMP0 1ZBA3 1AYN2 1AYM2 1FMD2 4IV3C 1RVF1 3NAPC 4AEDC 2R061 5A33A 1EAH3 1MEC3 4CDXB 4CDWC 1VBC2 1ASJ2 1PVC2 1OOPB 5C9AA 1RUH1 1Z7S2 4RS5B 3ZFFA 1AYN3 1FMD3 4YVWB 5AC92 2R042 1RUF1 5L7OC 2WLPA 1QJU1 2HWD1 2RS32 3ZFGB 1ASJ3 1NCRA 1PVC3 2WZR2 4CEYC 1QJX1 1FOD1 3VBOC 5AC93 2R043 4JGZC 5J98B 1ND3B 2RS33 1ND2A 1BMV1 1RMU2 1NY72 4RHV1 2R072 4FSJA 1RUE1 1BEV2 5CFDC 1ZBE2 4QPIC 4RQPB 1DDLA 5A32A 1H8TC 4Q4W2 2MEV2 1RMU3 5CFCA 4CDQA 2R073 5BNOA 3IDEA 4YVSB 1E57A 4JGYB 1BEV3 5FMOS 3TN92 1ZBE3 3VBUC 3VBRA 2RM23 4EJRA 4N43B 1HXS2 2MEV3 4Q4W3 1VBD1 2HWB3 1MQTA 4IV1C 3JD71 4RR3A 5C4WB 1NCQB 2HWC2 1QJY1 1RUC1 1RUG2 1NA1B 4Q4Y3 5ACA1 5K0UB 2WS91 3M8LA 5J96B 1RUJ3 1BBT1 4WM7B 4IV3A 2HWC3 3CJIC 3NAPA 1RUG3 4QPGB 4AEDA 1QQP1 1AR71 2PLV1 3VDDB 1PGW1 2HWF1 1R092 1TMF1 2X5IB 5L7OA 2TBVA 5FMOL 4FTBA 4RS5C 1ZBA1 4YVWC 4CEYA 2RMU2 1R093 1EAH1 1MEC1 3VBOA 4CDQC 4JGZA 5GKAC 3S6PA 1AR92 1AYN1 1FMD1 5BNNB 1X33A 1FPN2 2RMU3 3VBSC 1AR82 1MQTC 5DDJ1 1ASJ1 5CFDA 1AUYA 1CD3G 1PVC1 4QPIA 1EV12 2RS12 1H8TA 4N53B 1AR93 1C8M2 1PO11 5AC91 2R041 1AR83 5A33B 5BNPC 1OHFA 2WFF1 4Y5Z0 3VBUA 1EV13 1VAKA 2RS13 4Y4YA 5C9AB 1C8M3 1K5MC 3ZFFB 2RR12 4NWVA 3JBG2 4IV1A 4PDWC 4N43C 1VBA2 1AYM3 1RMU1 1NCRB 4LLFA 5C4WC 1AL0G 1POV0 2RR13 1BEV1 1VBC3 1ZBE1 2RM21 1RB8G 1ND2B 1Z7S3 2MEV1 3CJIA 4GH4C 2HWB1 3J8F2 4Q4X2 1D4M1 4WM7C 3ZFEC 1RHI1 1AL22 5D8AC 2WZR3 2ZTNA 4Q4Y1 3LOBA 5A32B 4Z92B 4CDUC 4Q4X3 1VBE2 2VQ0A 2RS52 5CFCB 2HWE1 4RS5A 1RUJ1 5BNOB 4YVWA 3JB4C 2HWC1 1AL23 1RUG1 3VBHC 3VBRB 1R1A2 3VBFB 1X36A 2ZAHA 5JZGC 1RUH2 4RR3B 4FTEA 3VBSA 1RUF2 1PGL2 1QJU2 2HWD2 1R1A3 3TN93 1R091 1B35C 1HXS3 5ABJB 1TME2 5C8CC 3NAPB 1VB2A 4AEDB 2BUKA 1RUI2 5BNPA 1IHMA 1PIV1 4WM8B 4CDWB 2FZ2A 3DPRC 2RMU1 1K5MA 1TME3 1RUE2 4CEWC 5FOJB 4PDWA 1PO21 1RUI3 4Q4V1 5L7OB 4N43A 2Y26A 1AR91 4CDXC 1WCDJ 2FZ1A 1M06G 5C4WA 4CEYB 1NCQA 1OOPC 1HRV2 1AR81 1RUE3 4GMP3 3VBOB 1EV11 2RS11 1C8M1 4GH4A 3ZFGC 2QQPA 4RFT0 1RUD2 4WM7A 1HRV3 3ZFEA 1R082 5D8AA 5CFDB 1AYM1 1QJY2 1RUC2 4QPIB 5ACA2 1POV3 4CDUA 1H8TB 1ND3C 2RR11 1VBC1 1RUD3 1F2NA 1R083 1Z7S1 1AR62 4GB32 3VBHA 2XPJA 3VBUB 1FPN3 2WWSA 2BBVA 1AR72 4RQPC 2RS31 1COV2 2PLV2 1OPOA 1PGW2 5JZGA 2WZR1 4IV1B 1A6CA 1V9U2 1GFF2 2HWF2 1AR63 4GB33 4Q4X1 4YVSC 4JGYC 1AR73 1COV3 2PLV3 1V9U3 1B35A 1NY71 2R071 1VRH2 1NCQC 5C8CA 3JBG3 1NA1C 5K0UC 1HRI2 2GH8A 3DPRA 2XBO2 5ABJC 1VBA3 4FTSA 4Q4W1 1VRH3 1R1A1 4WM8C 5DDJ2 4CEWA 3TN91 1SMVA 1HQNA 4QPGC 1HRI3 4CDXA 2XBO3 1PO12 1HXS1 3J8F3 3VDDC 1VBB2 1PGL1 1OOPA
chains in the Genus database with same CATH superfamily
3UJOA 3EXUA 1DQ5A 2DVFA 1LEDA 1F35A 5KHKA 4INDA 1H9WA 1PZ9A 2W92A 3J7HA 4HKOA 4PF1A 4Q8KA 4NRMA 4W6XA 2R062 1RUOA 1VBB3 5FYZA 1GZ9A 4JTOA 4LR4A 1OA4A 4QXHA 4EYUA 2WDBA 2XJPA 4YM0A 4M0NA 1CJDA 1LODA 4LBMA 4HETA 4XAAA 4XQ4A 4XFIA 2R063 3IPVB 3MW2A 2XJSA 3VHPA 4NPMA 5FZ9A 4BK5A 4D6RA 2W9XA 2C26A 2DV9A 3MPBA 2XUEA 4IERA 5B4NA 1I1EA 2AEZA 4XAEA 1QJX2 3I2DA 2VXJA 3WQ1A 3C7OA 3OYWA 1QJU3 1K5MB 4J6GA 4COZA 2IVJA 2LW8A 1QXRA 5JOYA 3S57A 1BMV2 4NRQA 2J1RA 2ZGLA 4COWA 3UKVA 3AP4A 1AX0A 3IDCB 3Q8EA 4MYEA 5LBBA 3HN3A 1QJX3 1E5HA 3PUAA 2BPA2 3VBFA 3V56A 3I49A 1KRIA 5EIYB 2VVFA 1QJFA 5BYNA 3U10A 2O14A 1RUJ2 1QWRA 4NMIA 5FZHA 4PI2A 5C9AC 3A7QA 1UQXA 3KHBA 1RXFA 1XB9A 4LUMA 1H6XA 1FPN1 4MHRA 2UYAA 5F2WA 2HKXA 2JG9C 4R9AA 4W4ZA 1GMMA 4YG6A 5FZ6A 3ZDVA 1G9FA 1ULDA 2CNAA 4XPVA 4HFSA 5CA6A 1NA1A 4JGZB 5IFTA 1X8MA 4K3UA 4ONUA 3W58A 1IQAA 1D4VB 1S55A 4WVWA 4P02B 3E5UA 5D8AB 4FCAA 3LGRA 3MW4A 4DXSA 2YC2A 1WWYA 1W04A 4CDUB 3JD72 2E9QA 3FBYA 3OUJA 4M01A 1RL3A 4D94A 5EWSA 5LZ6A 1W9WA 3OCPA 1I6XA 3GM8A 4PIXA 3T1LA 4HOOA 2DVDA 3RDIA 1C8NA 3VDDA 3TEYA 2ARCA 4ITCA 1NE4A 4E8CA 4Y26A 3H3UA 4OI1A 1TVGA 3JD73 1SBDA 5FZOB 3TYJA 5I8TA 4HKLA 2ZHMA 2VH9A 3ACHA 2RDQA 5GLWA 1DHKB 3TEWA 5JPNB 1QJY3 1NOVA 1YEWA 3NNGA 2VQUA 3MHZA 1S0FA 1WMDA 2EXKA 3ZSMA 1LU1A 5I0RA 2Q1ZB 2BERA 3PL0A 5FK7A 2CL2A 2OA2A 2I74A 2L9LA 1PO22 5FYIA 4H2AA 1LGNA 3AJZA 3MF6A 2BGCA 2ZOEB 5FPZA 2P2KA 4CU6A 2XBO1 1H2KA 2Z79A 1WGPA 3G7DA 4Q8LA 4EWAA 1UU5A 3BTXA 4LLOA 3HIFA 4ZU4A 3VBFC 1Q8SA 4J1XA 4JRAA 1SCSA 1W8FA 4PLNA 3WINE 4U2AA 4RR3C 2PFWA 1PO23 1QU0A 2AC1A 1ZBA2 2A1XA 4QQ2A 1IPSA 2XOMA 3GBWA 5FK8A 2HWF3 4NHKA 1EAH2 3ZIWA 3AJYA 5IK8A 1XU1A 4LNVA 1VBE1 5FPLA 4AAPA 2XMLA 3FLPA 4N53A 4YZ3A 5F5AA 4P5HA 3K4ZA 1JYNA 1ZBA3 3QH7A 3EB7A 1W6MB 4CCOA 1RVF1 1ZRRA 4IEXA 4Q0VA 1EAH3 2JDNA 4CDXB 2QQNA 4YSFA 2W47A 2YROA 1O5UA 1O3TA 2TUNA 2F6BA 1LGBA 1ZRFA 1O8SA 1JN2P 2A3YA 4RS5B 1W3VA 4Z2AA 2EXJA 5EJ3A 5L7OC 1BVVA 1WW6A 3M3EA 4DXTA 1YRZA 2ZHKA 2G1MA 4GWMA 2BZDA 3ZN6A 5EJ1B 2JD9A 2JDUA 2OQ6A 3CEWA 3PLQA 1UU4A 3AL5A 2P3JA 1FOD1 4PT6A 4OMCA 2ZEXA 1LOEA 2VD7A 1NT0A 1OLQA 1ZZCA 4JGZC 3JUUA 5J98B 4MG2A 4LKSA 3ZOIA 2E7TA 5F9TA 2FDKA 3VKOA 2Y0OA 4XCBA 5IVYA 5CADA 4CSWA 4YW2A 5IFPA 3BODA 1IPJA 3WXPA 2VQAA 3KSCA 5CFDC 5GLZA 1LR5A 2CY6A 2XONA 4OVEA 1ZBE2 5E1RA 2Q8CA 1H9PA 2IXIA 2ZGQA 3EO6A 5A32A 2FCUA 2X10A 4LTAA 4Q4W2 1ZREA 1REFA 1BZWA 1Q3EA 5AVPA 4QKBA 4DPNA 5CFCA 5BNOA 4EWDA 1GZCA 1Y9QA 3WDXA 3WQ0A 4P9LA 1REDA 4GZ9A 2RV9A 1IPKA 1EUTA 1ZBE3 5IVEA 3KCXA 2OIIA 1UMZA 1KS4A 4BPZA 1DBNA 1KGYA 1GWMA 1MS0A 4UBHA 4Q4W3 4UW5A 3ZSJA 2HWB3 2P4EA 1CAWB 3I2IA 4UF0A 2E7AA 5FZKA 5BY5A 1ODMA 1NCQB 5T55A 1SLTA 5GLUA 4KMQA 2C1FA 4AOCA 2Q8EA 3WLUA 1RUG2 2W0XA 3C7HA 4HL0A 1U5YA 4Q4Y3 1I3HA 2XHKA 5JMCA 3M8LA 4I01A 2XL9A 3VL8A 4UXAA 3GCWA 2ORXA 4GKYA 2FDFA 4WM7B 3GNEA 3VD9A 3NAPA 5EYXA 1RUG3 4QPGB 3VL9A 3WDUA 1QQP1 5FDBA 4EQVA 2JDAA 3PMSA 2WT2A 3WG2A 5IK7A 4M4PA 4BQXA 1TNFA 2R6QA 5LRRA 2BP6A 4M3CE 2EVXA 1PK6B 3KVBA 1BCXA 1R092 2DCKA 3K3OA 3UV9A 3AKTA 4BQ1A 2JG8B 1DCSA 4BJ0A 3ZR6A 4FTBA 1HB3A 1U5XA 5HCFA 1YIFA 4RS5C 4TXWA 1OPMA 4GKXA 3OUHA 5A3MA 5KWRA 2Z42A 1V6KA 1GQGA 5FUIA 4EN9B 2RMU2 1R093 4QHOA 4B1LA 3AMPA 1EYBA 2D5FA 2Y64A 3K46A 4O9GA 2CDOA 3TOJA 2JKXA 2ZGMA 3BCWA 4MGKE 4ZKTB 4W8JA 5FY1A 1QGLA 4A3XA 3BB6A 3S6PA 3POJA 5J3UA 4MLOA 5GZDA 3NNJA 1FMD1 5BNNB 1FPN2 1W2NA 2HYKA 1W9SA 4CXYA 2RMU3 1BQPA 1XNKA 1QDCA 2V73A 1JI6A 4K21A 3VBSC 1MS1A 3H8UA 1VRBA 2ZKNA 1J84A 1O5LA 1QMJA 2NP0A 2JDMA 3I2GA 5L9BA 3DCQA 3HNBM 2DCZA 5FLHA 3N9OA 4LHKA 1W05A 1AZDA 1YYNA 2Q0AA 1KDKA 2RS12 4AEKA 4LKFA 2CAUA 1PO11 3P6BA 4S2HA 1UZWA 2YBSA 2NQYA 1OBNA 2TNFA 1OA3A 4OFGA 4XJAA 3ZR5A 5LEJA 5FJHA 3KV5A 1YQ6A 2W5FA 3AX4A 1UAIA 2PHUA 2W1QA 3BPZA 3LE0A 1JZ4A 1OHFA 2WFF1 2QQOA 3LD8A 5F7UA 4QX7A 1U0AA 3UYJA 1E5IA 4A2UA 4L99A 2VNOA 2RS13 2E7QA 3OG2A 4K7JA 2Y33A 4Y4YA 2P3YA 1KITA 3ZFFB 4NWVA 4AGGA 2JDYA 3KD4A 4IV1A 4LBQB 3AP7A 4XIKA 3WX5A 5KHGA 3KHCA 1MZ6A 3RVHA 5FY4A 3KCYA 2ZX1A 3FUOA 3AM2A 1RMU1 4MH0E 1KD7A 4D6QA 5F6KA 1QIQA 2D6MA 2V72A 1AL0G 3CF6E 3WF2A 2EALA 4EWEA 4K40A 3VZLA 1HN1A 1QH7A 1VBC3 2LTNA 4A7YA 1CGPA 4IE7A 1JZ3A 3PHMA 1IG3A 1CX4A 2CV6A 2RM21 4BU2A 1ND2B 1Z7S3 1WMXA 1OXCA 2ZXQA 2JJ6A 1BJQA 2B46X 2OPWA 1W6OB 2WT0A 2WYSA 3JU9A 1LNSA 4LA2A 5T50A 3AFGA 1UZ0A 4HONA 4P9XA 1YHFA 4WM7C 1WUVA 1U12A 2QQKA 4BZ4A 4COYA 1CJPA 2XJQA 4OI4A 3NRUA 5TSWA 1DZTA 2CWMA 2JECA 4IE5A 5FBZA 3PUIA 4N9HA 5BPXA 1SHWB 2XUMA 4QPYA 4DZGA 1VBE2 4WVZA 4HN1A 1OFNA 1LU2A 4XDPA 2JDPA 1FXZA 2VCAA 3RYRA 5J09A 2WWUA 3P3PA 2BU9A 2V5YA 4NR1A 4LITA 3LDRA 3VBRB 3VHRA 1W28A 5DAWA 4HG6B 2FMDA 2VZVA 5JIAA 4YM1A 5L19A 1C5HA 5JZGC 1JZ8A 4B4RA 3RNSA 1YCIA 3GZTB 2WO2A 5ERLA 4IGQA 3URFA 1BK1A 1DYPA 3AYAA 2FDJA 3ETQA 5I91A 1LEMA 3AP6A 3OBZA 3H0OA 4FTEA 4Q1PA 2Q4SA 4KL1A 3VDCA 2BJSA 5FMBA 2YFZA 4JX0A 3RMXA 5F5IA 3SEPA 1NLSA 3AYCA 4TYSA 2R1BA 1TZOA 5HCAA 5KHHA 4CXWA 1B35C 1EY2A 5D21A 1AX1A 1TME2 1WW7A 2O8QA 4FPEA 5ABJB 5JXJA 5F6LB 4AEDB 4IE6A 1IZ3A 4J1WA 5APAA 5BNPA 2VMGA 1IHMA 2GC2A 3OPTA 3MYXA 3V0AA 3O1MA 4WM8B 3T0BA 1T2XA 4CDWB 1Q8QA 4XMAA 1S0JA 2J1TA 3PU8A 2WNVC 4FPOB 5FMDA 2GDFA 1TME3 4KBZA 4OCTA 2VMCA 3SHRA 1OFSA 1WLWA 3N7MA 4N43A 4Q27A 4G4FA 1UYXA 2C5DA 3S30A 2VOVA 2ZHNA 4AFCA 1DQ0A 4R8HA 4PCRA 4XIOA 1JYIA 5C8WA 4QD2A 1MZEA 3I3EA 3USSA 3PJQA 4BHPA 4YARA 2GC1A 3NJZA 4DEVA 3W5NA 1S0BA 3LQCA 3SMHA 1DYKA 2ZCWA 4YGCA 2PAEA 3U1XA 3B94A 3K51A 4MGTA 3I2KA 1DU3D 1SPPB 2JENA 4ZXKA 1SDWA 1RUD2 4FI9A 4BXSV 4XTPA 4DB5A 4V1PA 2VZOA 3ZFEA 3ZKUA 1AHSA 3DF0A 3MGUA 3NV1A 2VAUA 2Y6FA 1AYM1 5FMCA 3WP4A 4QPIB 1W2TA 2GN7A 2VZPA 4IUGA 4XZUG 1H8TB 1ND3C 4M3CF 4NPRA 4CPBD 4TWTA 3H7JA 3R6SA 1RUD3 1XNTA 5KXBA 3BGAA 1YC61 2VZUA 3WF0A 1AR62 4GB32 3VBHA 4EV0A 2XPJA 1ULCA 3D82A 1H0BA 4L92A 4PI0A 1UOGA 1WCSA 1ULEA 1GSLA 1PM7A 3GYDA 3NV2A 3QBQA 4LUKA 2VUCA 4B1MA 2RS31 1COV2 5DZGA 4AR2A 5CG9A 3MZHA 4Y20A 5FPVA 5FP8A 4UFHA 2PHFA 3F95A 4L11A 2ARAA 3K4AA 4XE9A 4XJ9A 1GP6A 2DCJA 5F5QA 3THPA 1AR63 4GB33 4MGSA 2EICA 3AFKA 4Q4X1 4JGYC 2Z4FA 4YVSC 4AI0A 1YQ5A 4KWJA 2EXHA 1K12A 3BOPA 4TSVA 1COV3 4CCDA 4CE8A 5IAVA 4YZ2A 5F3EA 4NAOA 5JAXA 2ZX3A 3ALQA 5DAVA 3DGTA 2PTMA 4O65A 1A34A 4ZS3A 3VZKA 5C8CA 2ET7A 4LBOA 3JBG3 1JODA 2PHTA 2DCYA 3N9MA 3UETA 1BLZA 3OD4A 1ZRDA 2VTXA 3DPRA 5ABJC 2ZEWA 3N36A 4L97A 3WOGA 4DOUA 1UOFA 4Q1RA 4KQ7A 1QJEA 2XJTA 4AVAA 2BNMA 5HI0A 3O1RA 2DTWA 3BU7A 3HBZA 2VNGA 4LKDA 5FO9B 1R1A1 4WM8C 4AVTA 2OS2A 4FOVA 5JIUA 4I30A 2IC1A 4ZU5A 4LA3A 1SMVA 1W6NB 3TN91 4KWKA 5KXEA 1UY3A 1MZ5A 1HQNA 3AMHA 3POEA 1FT9A 3WNOA 1HB4A 4JAAA 4I09A 1PO12 4WVVA 1HXS1 2FDIA 3V64A 1GP4A 3HT1A 2ZGSA 2G4IA 3H1YA 5F32A 3CKHA 3SITA 2WFF2 2VU9A 1XJAA 5SV5A 4PF5A 5F1RA 5FCCA 5M0TA 2C0ZA 3N9QA 4BM8A 3I2FA 1HN0A 2X5IC 5A7WB 3WP5A 1KFXL 3ZSLA 4Y1UA 5ANQA 5EHDA 1PO13 3HT2A 1YO8A 4ZZ8A 3ZFGA 1I5PA 4QKFA 5A3OA 5FLJA 2VZRA 1UXZA 1RUI1 3OY8B 4QQHA 1LECA 5EQUA 3ROUA 4Q0UA 2WFF3 2ZX2A 4IEUA 1VAMA 3LZZA 3W20A 5IVVA 4MOAA 1OI6A 4RGGA 4XF3A 5FP9A 3K4DA 2FBEA 5EZWA 4GA9A 3PVEA 3ABZA 5LK7B 3O1SA 3K77A 4GULA 4QMAA 4N9IA 5F3CA 1YIPA 3DYMA 3MV01 5T5LA 2YDEA 1UZZA 3TB0A 2RM22 1RUH3 3WG3A 1ULPA 4NIHA 2D3PA 3T4VA 2QJVA 3MIFA 4JDMA 1X82A 1Q56A 4IV3B 1PGSA 1GZTA 3ATGA 4RQPA 4M3CB 2HWD3 4QX3A 3H8OA 3I97A 4D6SA 4CU8A 1UPIA 4TN7A 1YI9A 1UZYA 3JB8A 3WSOA 5E8AA 4PDWB 3KMHA 3SKJE 4AAXA 3LEIA 4D3WA 3LCPA 4RHV2 2XQRA 2WN3A 5LA0A 3BVCA 1PZ7A 4CYDA 3E97A 2NN8A 1GV9A 4XOGA 5A6QA 2EAAA 1D2QA 1N1SA 4RHV3 4GH4B 4R9BA 2RJLA 1HJGA 1W8TA 3ITQA 2YBKA 3VB9A 3RYPA 1NCRC 5K0UA 2ZABA 1S0EA 5FZ7A 4FXKB 5IW0A 1YWKA 1W9TA 4COVA 1VBD2 4DUVA 3M4FA 4HLTA 2VNRA 5FXWA 3DKWA 4OUMA 1RINA 3O0XA 3P3NA 4M4RA 5F3GA 3VKFC 3I59A 3ACIA 3AL6A 3UL2A 3O1PA 3CQOA 2HEYF 5FAXA 5FXVA 3N9PA 5A3NA 1H4HA 4FFHA 1V6IA 1V9U1 3BOWA 3LSDA 2WA4A 4LIVA 3WF1A 4B7KA 4E9KA 2HEWF 4LHNA 1O6UA 1VBD3 3RFRA 3S5QA 3FLRA 3D4KA 2WS92 2OYZA 4DY3A 2EAKA 4HVRA 3KV6A 5FY7A 1CPNA 1W2OA 1JZ5A 2Y38A 4META 1BBT2 5FJKA 4ZY9A 2CGPA 4W6YA 2MNGA 1ZRIA 4LT5A 4R4XA 4XVHA 1MS4A 5H9PA 1UKGA 2ZEZA 2VW2A 4JCKA 1ZZ7A 2WS93 1UOJA 3WNLA 3CO2A 3E6CC 2IXJA 3WT3A 4K9SA 2WFPA 1QJZA 2WZEA 1BBT3 4DO0A 1EP0A 2VTFA 1VMHA 3J8F1 4FP2A 1DZQA 4PQ9A 3WDTA 1IS6A 2CAVA 4Q0QA 1JZ7A 2IZWA 4XJZA 2H0BA 3ZXAC 1DGWA 4XMIA 4AW7A 3LAGA 5C3RA 1JTZX 5FZEA 4XEZA 1ZZBA 2WQ4A 4FXGB 2KM2A 2R0FA 1K45A 3WNKA 1MEC2 1T6GC 4OI2A 5JUVA 5KHJA 2GSYA 1D7PM 2RS51 4HBNA 1SLIA 4XCAA 4Q26A 3CLPA 2NPIA 3U4SA 1DQ1A 4CEWB 4GMP0 1AYN2 1AYM2 1CAXA 1DYOA 4IV3C 4WBBA 2HEVF 2QBXA 4C90A 4LO8A 4YYOA 4JDNA 3E6DA 4Y22A 3VHNA 3WUDA 3OGSA 2JXAA 4CZSA 1MEC3 1YFUA 2B7YA 5DZEA 4I3PA 1QXJA 5LWBA 3AMQA 3VZNA 3LB9A 1OOPB 5C9AA 2Z5WA 4Q0PA 3RS6A 4ZONA 1O4YA 3D8CA 1AYN3 2E53A 1XYPA 1VLNA 4NO4A 2JG9A 1RUF1 2WLPA 3J4UH 4CU9A 3QLQA 2ZGTA 2RS32 3RZKA 4AGRA 4IL7A 3BTYA 3MDPA 4XUQA 3MUY1 4FT8A 1JYVA 3NV3A 2FCVA 4Y1VA 4L9BA 5J1XA 1JYTA 4CEYC 3ELNA 2IFRA 1CQ9A 3LEGA 4LMFA 3VBOC 3OPZA 3GF6A 3AKSA 2RS33 2LROA 1XXNA 4AF9A 1ULFA 2WAAA 5FREA 4C8DA 4LO4B 5T3NA 1RGSA 4AFAA 5DG2A 4BE3A 5CZKA 2QZ3A 4XHXA 1QNYA 3POWA 1DDLA 1PNGA 2QKDA 5JR7B 2J22A 3T2TA 3NL1A 3WVJA 4IE4A 2X8KA 1YJKA 3POBA 1LRHA 1PHMA 3SNMA 2MHFA 3IDEA 5FY0A 1E57A 2VOWA 3ZXKA 4EN7B 4URAA 2D97A 3TN92 2OVUA 2UU8A 4XF0A 3VBUC 4NROA 4A41A 2Y34A 4B29A 3LF7A 4EJRA 1HXS2 3RPQA 4CP0A 1JOJA 1KJLA 3VLBB 2D6KA 2HH9A 1O8PA 4HSLA 4RR3A 5C4WB 4L8QA 5BNQA 3ZYGA 3M2MA 3HOBA 2QQUA 4XZPA 3WHUA 2HWC2 1HW5A 1RUC1 2W08A 1NA1B 4KG8A 4YW1A 5ACA1 4QB6A 4ORFA 2CYFA 1GQPA 4YPJA 3ZVXA 2A75A 3EBRA 1X50A 1AXYA 2BW8A 1RUJ3 2CGOA 2VG9A 2ZMLA 4S2DA 4Y1YA 1OLRA 2EA7A 2HWC3 1DP0A 4QXKA 5CNAA 3WW2A 2PHRA 1GZWA 5LBCA 1WA6X 2VUAA 4LHLA 5C71A 3INAA 2PLV1 3VDDB 5C7GA 1N47A 2XVKA 1PGW1 1CWPA 5FPXA 3RRDA 1E5RA 5FXXA 3I7DA 3PMEA 1ACCA 1TMF1 3IN9A 3NJYA 2GP3A 3POYA 5L7OA 2TBVA 3NO8A 1IGOA 2BEOA 1YFYA 5FWEA 3LOIA 5FZ1A 4LK6A 2BVBA 4OZOA 2QQIA 2P5BA 2VTXJ 5FOBB 1JUIA 4JRLA 2ARXA 1AJKA 4AQSA 1OQEA 1TE1B 1JU4A 5G04L 1LGCA 1HLCA 4JGZA 1I5ZA 1JYCA 4NHXA 2OW4A 3JCIA 5H9SA 1CX1A 3MLKA 1POQA 1DF0A 4B4QA 5JCTA 2A3WA 2D6LX 1AR92 1KQRA 4XURA 5CVRA 1UYPA 3H3LA 3ZDSA 1W9FA 3T0DA 4Y5TA 1OF3A 1V00A 5FYTA 1ASJ1 3IBMA 5CFDA 5A80A 2J1UA 1UX7A 1PVC1 4E4HA 4IE0A 2YZ4A 1XE0A 4N53B 1AR93 4NUBA 1C8M2 4V2WA 1XPWA 2Q5TA 1F4AA 1O59A 2ZA9A 5AC91 2R041 2DYCA 1OKOA 2PHWA 1NQJA 1ST8A 2DTYA 2GC0A 2PHLA 2YY1A 3E6BA 4Y5Z0 5CKQA 1RUNA 5FPBA 1BKZA 3M3CA 2E6VA 4UFIA 1W2UA 1VAKA 2BGPA 1V6OA 4LBLA 2VPVA 1C8M3 1H6YA 3R4DB 5FY9A 5GZFA 1K5MC 1OD5A 1XYOA 2RR12 5C6CA 3O1OA 3VUOA 2NMNA 2B9UA 2F4PA 2WZPP 2O0OA 2WBKA 4FPKA 3SH5A 2DU0A 3HWJA 2BQPA 2JICA 3CU7A 4S2GA 4W6WA 4AHXA 3WEZA 3G6JB 2UWBA 4L2NA 3AK0A 2VZ3A 3ZN6B 1WLDA 3OGGA 1OKQA 3N7KA 4XF4A 1V6LA 1FI2A 5C4WC 1LHOA 1W8HA 5LA2A 5KC6A 3POSA 2RR13 1BEV1 5LBEA 4YW6A 3ZPYA 2AGSA 3RJ2X 5B4XA 2C9AA 4H3WA 2ZACA 4JTNA 3MW3A 1RB8G 2MEV1 5FP7A 3J8F2 3KGZA 4LOTA 5DUXA 1A8DA 1UL9A 4R9DA 4ZZ5A 1HQLA 3BTZA 5JXGA 3MIDA 2WJSA 4IEWA 1ZRCA 4YGDA 1W6MA 2XR4A 3FLTA 4YFWA 2VY0A 4OLLA 5D8AC 2DUQA 1A8MA 2WAOA 4F83A 3AP9A 4LXLA 4BMBA 3LOBA 5A32B 4ARYA 2VE1A 3OD0A 4CDUC 4Z92B 3M3IA 1H2NA 2H6BA 2RS52 3JQWA 3MUZ1 3PVBB 1NXD1 5CFCB 4AI2A 4RS5A 5LRSA 5KXDA 1W8OA 1QOSA 3HQRA 4QB1A 5BNOB 5C5UA 3JB4C 1JUHA 2RDNA 4UBGA 5J48A 3I3BA 1W8NA 3POGA 1NZIA 1V70A 4O9EA 1F9KA 1DQ6A 4N90A 3WNMA 1JZ6A 4OHXA 4M0HA 5K8SA 1K42A 3SKVA 2C24A 2VVDA 1G9CA 2YHJA 3RI8A 2PHDA 2ZAHA 5DQ0A 3FL7A 2H0VA 3KWVA 4UF0B 2EF6A 3U4XA 1LULA 3Q8AA 1JS9A 4QDQA 2VCMA 1Y9GA 1RUF2 3VBSA 1PGL2 5IWFA 4ASKA 1X7NA 3BU0A 2PA7A 3IWZA 2YBPA 1W99A 2RJKA 5CAZA 3ZYIB 4E4SA 1JYXA 3GZAA 1IS5A 2RDRA 2J1EA 1REEA 3SCFA 4CP2A 2G9FA 4B4PA 1CAUA 2GU9A 3R0RA 3NAPB 3GBFA 3ECQA 4Y33A 2W95A 4CPBA 4DINB 4QGNA 4FAHA 4QDRA 3RGBA 3GJBA 2B5HA 4H7LA 5CIRA 2QQLA 1BVP1 3D0SA 3UJQA 5I8YA 3ZXDA 1UX6A 1XC6A 4ZHNA 2KD7A 1SDDB 4KBBA 5EPAA 1MACA 4PQQA 4K6BA 5IK4A 2ZEYA 5FOJB 4AHZA 1J1LA 3C8XA 4YG3A 1QNWA 5FZ0A 5A1FA 2OUHA 4P5YA 4CDXC 5FP4A 1WCDJ 1MS3A 1CONA 1OC1A 1QY4A 5JLVA 1KS5A 1NCQA 1AR81 4BQ3A 4NIGA 2W1WA 4FPGA 5AFBA 1LHUA 2ZX0A 5HPOA 1EV11 4CUBA 4NIDA 3PIJA 2A6VA 1UWWA 2WT1A 4BH9A 2ORZA 4RYDA 1G9BA 2QQPA 4QX1A 3ZXGA 1UF2C 5CKNA 2WN2A 2JDKA 2W46A 1N3OA 3A0KA 3ILFA 2DUPA 4WM7A 3ZM8A 2QFEA 3CZJA 2DWRA 3OGVA 3T3YA 3NW4A 3V65A 5FKBA 2Q1MA 2X53S 1RUC2 4RGAA 3ZYHA 2OPKA 4CP1A 5ACA2 3KM5A 2QDNA 1NAEA 1HB2A 5AFEA 4NIAA 4I2OA 4KWUA 1DLLA 5LCWL 5LA1A 2JD4A 4KWLA 5L36A 4XETA 3RZHA 3DL3A 5C33A 3C3VA 2JG8A 3OGRA 3B9IA 5FZAA 1LKNA 2AREA 1FPN3 3MI8A 2WWSA 5C3QA 2BVVA 3HJRA 1UKRA 4BQ2A 2PLV2 2K0GA 1OPOA 2VNVA 3KZ4C 4GQ7A 1PGW2 4IEVA 5JZGA 2WZR1 4IV1B 1IS4A 1UIJA 3U07A 3VZJA 1GFF2 5JMOA 4YW5A 2KA3A 5BXXA 4CCKA 4PLOA 3T4HB 3A23A 2VBBA 2WNOA 1LHVA 3LIGA 1LOAA 3T1MA 3OBRA 5T5PA 5JXIA 1FATA 2UURA 2YPJA 1UNBA 4KH9A 3HD8B 4I3GA 1FNZA 2PLV3 4Q29A 2B39A 2X29A 3MFAA 4QQPA 1W6PA 2XLAA 2BV4A 1E5SA 2ES3A 4OI0A 1B35A 3THCA 1NY71 5FZGA 2R071 2IXHA 1NCQC 3FC0A 2W94A 4MGQA 3AVRA 1JOPA 5T5JA 4LO7A 1SLAA 2W1SA 4OULA 2OXBA 5LASA 5I93A 3UT0A 2QCSB 1HIXA 2XBO2 2DFCA 4X8PA 1UD1A 2ZBJA 5CG8A 2PAMA 2WNVA 4HXCA 3TBDA 5DUUA 4EN6B 2CTVA 2KR2A 4LBNA 5A7NA 2PAKA 3IKWA 2JB8A 3GGLA 2CHHA 4P9WA 4OYUA 4QPGC 4UW6A 1WMEA 1NLQA 3C7FA 3RWKX 2BGOA 2XBO3 4AVCA 1F5FA 2VQTA 5K7PA 2MPFA 3WD5A 3H3ZA 1R1ZA 2XLGA 4OUEA 3PUHA 4ZS2A 3T2OA 3N7JA 4HPKA 1PK6C 1OMIA 3PIGA 4UOJA 4CDQB 4ES8A 4ASMB 4HVOA 3KT1A 4DMIA 2XKPA 1EUUA 2JG8C 4KGGA 5E16A 1JOBA 1RVF2 1JHNA 2V4VA 4EROA 4TTGA 5JWPA 3H8RA 1SACA 3NNLA 2LS6A 4IDZA 3WQBA 3ZLIA 1VBE3 4YZ5A 5KC5A 5FBJA 1XNCA 2A6ZA 4I0BA 4A6SA 1MQTB 1CIYA 4AI9A 2DFBA 5FZFA 3MPPG 4GWJA 4JZRA 3VD7A 4BDVB 1RVF3 1HX6A 2LALA 1ND3A 1V6NA 5HBAA 4GALA 1Z78A 2W52A 4GMP1 4CU7A 2AUYA 3MLLA 5BNNC 3M1HA 3J7NA 3NJXA 4ATFA 5BNPB 4QWNA 4HN0A 1WW5A 2ZZQA 4MXWA 4YWAA 3V0AB 3DYOA 3KQRA 2DU1A 1NZCA 2DUOA 1FOD2 3CL1A 2NLRA 4Y5SA 1URXA 4QGLA 4RGKA 4SBVA 1HRV1 3UKTA 1SFPA 2JKBA 4QPWA 2WA3A 1GNZA 1DG6A 1TQ5A 3IDAA 4ES9A 1G86A 2ZS6B 2SBAA 1POV1 1H8VA 2P17A 4YVSA 4JGYA 4AFMA 1FOD3 1X8EA 3MIHA 5A6ZA 3TNQA 2VBPA 5A7PA 3V0BB 1S0CA 4A7ZA 3E5QA 5DG1A 4ET7A 3RZJA 1R081 1SLBA 3C2UA 3WP6A 3ZFFC 3R4SA 3MFCA 1UIKA 4XF1A 1BK0A 1YQ2A 4Y4RA 3UGGA 1Q5OA 3WG4A 4BQ4A 4BLIA 2BRTA 3MV11 3ENRA 3LIHA 4NN0A 3WQ7A 4AFDA 1YQ8A 1UXXX 5FP3A 4JQTA 2IWGB 4DIQA 5ABJA 2HJIA 3ZFEB 3HEIA 1C1LA 2XWJB 4CXXA 3UKNA 1IKPA 2A7AA 3ME2A 1NG0A 2E51A 4AHYA 1JBCA 4WM8A 4CDWA 4DUXA 4XFAA 3ES4A 1ND2C 5HCBA 3RJRA 3K2OA 3VZMA 1G8WA 1CZSA 5EV7A 2QQVA 4XQWA 5AVAA 5FZCA 3USUA 4E4ZA 3KS7A 4Z2WA 3VBHB 5FQ0A 3T2PA 2F4LA 3UGHA 1UY0A 3I54A 5KXCA 5FKCA 3O0WA 5LB6A 2GMMA 3APBA 3HQXA 1CZTA 1VBA1 1YLLA 4EN0A 4FOQA 2PQQA 2X5IA 3U11A 4Y20B 4LKEA 4RL7A 3ZMNA 1QQP2 1X9PA 1XYNA 3B93A 1VRH1 2XLFA 3GXUA 2VL4A 1W39A 3R4UA 3ZX7A 4Y24A 1IOAA 4EN8B 3MLJA 2D93A 3H1MA 1HRI1 3VBRC 3RMYA 2A6YA 1SPPA 4XABA 4UFJA 3MICA 3C7EA 4BXFA 1S2KA 3OTFA 4L0PA 2R49A 1QQP3 2BNOA 1OLMA 4MZUA 3EJKA 5T52A 3ZSKA 3F2ZA 1H2LA 1YNAA 5C8CB 2ZPXA 2XJVA 1AL21 2D98A 1UU6A 2IFWA 2VMDA 1RIRA 3DPRB 1VBB1 2B45X 3B7MA 3CJIB 2FCTA 1KDMA 1PMHX 2B8MA 3FHAA 4F7ZA 4H7MA 1FMD2 2UY9A 4CUCA 4DXRA 2ZKLA 4AEDC 2OUJA 2R061 1J3QA 2WNUB 5A33A 3NWKA 1GR3A 1DQ2A 4AGVA 1RITA 1S0DA 2Y6JA 4UFMA 4CDWC 2Y60A 4MGZE 2W87A 4UWDA 1WCKA 1WMFA 3O14A 2BOIA 5FPAA 1QOOA 2Y6LA 1FMD3 1V6JA 4TLGA 2LUWA 3FZ3A 4IGPA 4YVWB 5A3LA 4HKWA 1ZM1A 1QJU1 2C4XA 1L7RA 2W91A 5JVVA 3ZFGB 2ET1A 3J7MA 3ZXFA 1H1MA 1CPMA 1NCRA 2WZR2 3H1WA 3BYWA 4NHLA 1QHDA 4BMEA 1QJX1 4KGQA 4QU1A 3UK9A 5CKMA 5JSOA 3SXWA 3GZEA 4ARXA 3B5LB 1AVBA 4ZXEA 4PBPA 1GQHA 1BMV1 5CBLA 1YI7A 2W39A 1WLTA 2X09A 4P9IA 3ZO0B 2A6XA 1CESA 1A78A 1RMU2 1CN1A 1Y4WA 1JYWA 3WR0A 3OBTA 1NY72 1SQ4A 2R072 1G7YA 3PNAA 1N3QA 1W6NA 2I07B 1W2AX 3B3QE 4GWIA 2GNTA 3ASIA 1U5IA 3WW3A 2VO5A 4FPFA 4OHYA 1VP6A 4QPIC 4RQPB 3H42B 1H8TC 4IXLA 4Y1ZA 3KF3A 4D7TA 1RMU3 5JPMB 3L2YA 2R073 2WINB 3WW1A 4P00B 2A6WA 3IMMA 1L3JA 3NKGA 3WF4A 3PDQA 1LOFC 3GHMA 1C4RA 3ZYPA 3DUIA 3ES1A 1SLCA 3I3QA 4P14A 1LENA 2RM23 2BYVE 4LBQD 5A6XA 2W2IA 2GZWA 5A3TA 2Y6HA 4JHTA 1PMJX 3N3HA 4BIFA 4IEQA 2DVGA 3JD71 2ID4A 3S5AA 3SEEA 2GMPA 2JE9A 1JMUB 5FO8B 5GLTA 4NIIA 2AYHA 1QJY1 3J7LA 3CMGA 5F2SA 5EXOA 3DYPA 5GALA 4E4DX 5K0UB 2ZHLA 1C57A 3VZOA 2VZTA 2DDUA 4UFKA 3LFIA 3AVSA 1GOFA 3KT4A 1MR5A 4MSVA 3U75A 2FD8A 1DQ4A 2OT7A 1CAVA 3I2JA 4B3NA 2E32A 3I59B 2VR4A 1DLCA 1UMIA 4IV3A 4SLIA 3CJIC 3PUSA 1QF3A 2YYOA 3FHQA 4LPLA 5K4LA 4HZFA 4DS0A 2ZGRA 1W90A 1AR71 3NVCA 2YUEA 3AZWA 1N3PA 3KCCA 5IVCA 4F3JA 2G19A 2D6NA 1HQWA 3OPWA 5ANNA 1RJ8A 2VMEA 2VZSA 3IAQA 2HWF1 1LOBA 2VJXA 2J7MA 2WQZC 5JSRA 4OHVA 3CJXA 1SEFA 3AB0A 3D5OA 3TNPB 3BALA 5FXZA 2FHRA 2WO7A 1ZBA1 4YVWC 2BOJA 4N7UA 1QEXA 4CEYA 1ALYA 3SLIA 3POIA 1EAH1 2P3IA 1DFQA 3VBOA 1N1YA 1VAVA 2A73B 4PIYA 4PHZA 3ILRA 4XFHA 1VMJA 4AHWA 1J58A 1B09A 2J1SA 1XNAA 3C7GA 2GC3A 3PUQA 4QQOA 3SH4A 2RHPA 3TAYA 2RG4A 4Z8BA 1GKBA 2D6PA 2VUDA 1AF9A 4XC9A 3O1TA 3CZUA 4A4AA 1HV1A 3H9AA 2GALA 3O0VA 4LO6B 5FV3A 4A45A 1OH4A 5A7QA 5DDJ1 3T08A 2WKKA 3MIGA 3LA3A 1W0NA 4QXCA 1PNFA 5IATA 1P8JA 5DXDA 5CB7A 3LFMA 4E8DA 5HV0A 5KBFA 1UO9A 3JQXA 4NAMA 4V2VA 5FIXA 3BUCA 1LCLA 2YC0A 3PU3A 2EIGA 1CAXB 1DGWX 4IQPA 3TWIA 3AYEA 5BV6A 4NHYA 1Q43A 4Y22B 5GZEA 2A71A 4D7YA 4XFBA 5EP9A 3VBUA 4JKKA 4BYYA 2O8OA 5D2AA 3J26N 1H2MA 5DAXA 5C9AB 1NLRA 4BK4A 1GLHA 4GWNA 3VDAA 2VCBA 2V09A 2VECA 3I2OA 4PDWC 4FP3A 2JG9B 1ZA7A 1SLLA 1W03A 2YXSA 1VBA2 5FZ3A 1AYM3 3WV6A 5G05L 2W68A 4FPYA 2VOXA 4HSJA 1POV0 5E6HA 3IM0A 1S0GA 3IIIA 1F5JA 4UFLA 1ZBE1 4LQRA 1GICA 1W6QA 3K75B 4O61A 4W50A 1WW4A 4GH4C 4CP9A 2HWB1 4Q4X2 3J9SA 4XBNA 5IVFA 3S0MA 5FZ8A 1D4M1 3AMNA 3QCWA 1RHI1 3SCGA 1AL22 1WLCA 2ZTNA 3WNNA 4A3ZA 5JSPA 3A0NA 4Q4Y1 2AEYA 1RXGA 4NHMA 5DAQA 4Q4X3 4LHSA 5FYCA 4W65A 2FDHA 2O1QA 4MO3M 2HWE1 4EZ4A 5IYYA 3OYWB 1VPHA 4QU2A 5I0TA 1PVXA 4FAGA 2WNEA 4URTA 1AL23 4Z82A 3GCXA 1RUG1 2P37A 2QQMA 3KVAA 4WVMA 4CCLA 3U37A 4Q0SA 2XB6C 2QVSB 1R1A2 3W9AA 3D3AA 4X8NA 4LOSA 2BTVC 2AR6A 4XJWA 3VBFB 4I02A 4NJ4A 5FZMA 2GNBA 3M7AA 4RR3B 5DAPA 5JOXA 3T09A 3OSDA 4DFSA 2A3XA 3ZYBA 2QNKA 1QJU2 2DCTA 5IVJA 1R1A3 2Y6KA 4ZPIA 5H9RA 3W5MA 3TN93 3WDYA 1UYYA 2SLIA 2LM3A 4QB2A 3HBKA 1R091 3IPVA 1W8WA 2YU1A 4AL9A 1HXS3 5H9QA 3AC0A 4XDOA 1T6BX 2P3KA 3LA2A 4P08A 4LBKA 1RUI2 5FFOC 1HDKA 1GZWB 4YM3A 4QQLA 1PIV1 1NKGA 2UY8A 5GLVA 1W9YA 4EZHA 2FZ2A 2VUJA 3WNXA 2RMU1 4XTMA 3T30A 3EHKA 1K5MA 3FJSA 3WCRA 3LDKA 3LPGA 2CSGA 2E26A 4CEWC 5EFUA 2VXRA 1RUI3 1GOGA 4Q4V1 5L7OB 5FYUA 4XUNA 4PIZA 4XYXA 3OF1A 3ZYJB 4YZ4A 2KXLA 2IUWA 1M06G 5C4WA 1JZ2A 4IEZA 2D3SA 1OOPC 4RA0A 2Y6GA 5DABA 3N4MA 1W0OA 4OHWA 1XQNA 5FY5A 3WDVA 5FPUA 1APNA 4Z1VA 2C9KA 1PX4A 2RS11 5DPNA 2Q1FA 4D8MA 2G9GA 2JEMA 4IW3A 3S7EA 1MVQA 4OQ8A 2V4AA 1LAJA 1CIWA 4AEJA 1UMHA 2OQ7A 1S4CA 3CDZB 3KQ4B 3MBWA 3FFZA 1M4WA 1U5ZA 4C1XA 5D8AA 5CFDB 4AZZA 1QJY2 1S0IA 1XBFA 3HNYM 3ILNA 3O12A 1XRUA 3MIEA 1NUKA 3PVOA 4CDUA 1LOCA 4UI9L 2RE9A 1VBC1 1AX2A 2ZMKA 3LDBA 3WP3A 3CBNA 3O5SA 4MX3A 4COUA 4S2FA 4YZ1A 1Z7S1 1EPZA 5CISA 1H30A 1MVEA 1XOYA 5FZOA 4F8AA 1AR72 3IZOA 1HB1A 2XWBB 2RJ2A 5J37A 1QDOA 2YU2A 4Q2FA 3QOPA 4QKDA 2WO1A 3K48A 3X29B 4D7SA 1A6CA 1V9U2 2PELA 2HWF2 3PTYA 4JKMA 3N9NA 1XE8A 2K9ZA 3OEAA 4YM2A 5E88A 4YW4A 2XXZA 4UT5A 3KV4A 1OH3A 1KEXA 4AFBA 2ADDA 1TG7A 1AR73 1MS9A 2WIIB 3M3QA 5IT6A 4FVVA 4C0HA 1FAYA 3DV8A 4WZCA 4AVSA 4LE3A 1OLME 4Q5OA 1V9U3 3AP5A 1ULOA 3DKQA 2EIBA 2XVLA 3KF5A 4QHZA 4DRVA 5CU1A 1V6MA 3NJVA 5FYHA 3OUIA 3T0AA 4YRDA 1NA1C 2ZGUA 4XUTA 2GH8A 3UESA 2XHNA 2TEPA 1ZX5A 4K8FA 1OUSA 3N9LA 3ZN5A 3RZMA 4R52A 2PN5A 2IXLA 1FNYA 4ASLA 5DDJ2 1ZZ8A 4QXBA 4QAWA 3VKNA 5J7MA 2QUOA 4MGYE 5FRAA 2XJUA 2ZJCA 3AZVA 3HN1A 4CDXA 2WL1A 1IG0A 2J42A 4JV4A 5FY8A 3J8F3 3VDDC 1JU3A 2R30A 3DECA 5DDJ3 1OSGA 2WZ8A 4GXLA 3W21A 3GHNA 3LA7A 5J36A 2ZGKA 2ATFA 4XXAA 2XKOA 5IUQA 3P5BA 1YXWA 1LHWA 4K1ZA 1TME1 5C3SA 5L73A 4NWWA 3H7YA 5A7SA 2VW1A 1DGRN 2RS53 3VBSB 4B8EA 3ACFA 3LSEA 5FYMA 3PJYA 1N1VA 3RI9A 2BWCA 5CEHA 3AXEA 1RYYA 2J1AA 3PTRB 4RN5A 4WZFA 3WG1A 1SCRA 1IKQA 1UY1A 4X6QB 1CAUB 2HLEA 2W1UA 4RD7A 5LBFA 3HMYA 3BPSA 3VKLA 1GUIA 4DQAA 2WRAA 3BIWE 3WZ1A 2HWB2 2AH2A 4K1YA 3U14A 3GDBA 3AZYA 3O1UA 3WHTA 3QD6A 2WUHA 1RUF3 2VZQA 1XNBA 1D4M2 4Y3OA 4BQWA 4UW4A 3BTAA 4N53C 5FZLA 5A3PA 1RHI2 4AXOA 3ETPA 4O7XA 4B7EA 3AXDA 4Q4Y2 3Q8BA 3FHIB 3VD3A 3ZPOA 5IK5A 5BUVA 1GU3A 1OF4A 3CNAA 2YGLA 3RZLA 2ZGNA 3HNMA 1RUD1 2F17A 1VALA 4BCUA 2XJRA 2HWE2 1D4M3 2X05A 1ZA4A 5GZCA 4OHZA 5DMYA 3BIEA 4KI5M 1RHI3 5HXVA 1YUDA 1CAWA 1ENSA 4CVUA 4D0QA 1QOTA 5C5TA 5KR7A 3HAGA 3Q9OA 1YFXA 4MXVA 1FX5A 1PX3A 2I2SA 4QM9A 5LW9A 3EMRA 2PYTA 3SH3A 1GNHA 1Z0HA 2R16A 2HWE3 5HXMA 4G3YC 2I45A 4XQDA 2VZ1A 2BFUS 5FZIA 3D6EA 1G9AA 1AR61 4GB31 1UY4A 2EIDA 4AVBA 3H50A 1WA4A 4YLZA 2ENRA 4DUWA 1QXPA 3VHOA 4CCEA 1VB4A 3U78A 4LIUA 4TZDA 1COV1 2WR9A 4CCMA 3BKZA 3IT8A 4RSUA 2VMHA 4KU8A 4QPGA 1JH5A 2WWJA 2VCCA 2VOTA 5F5CA 1SZBA 2XG3A 5T5OA 3I3MA 3B01A 5FZBA 2WYFA 1JHJA 1HJFA 4YG0A 1RTVA 1YQCA 4HMZA 3JBG1 2H6CA 1PK6A 2ZX4A 2R32A 1PIV2 4JQRA 1PZ8A 4QX2A 1ZZ6A 2JB4A 2JE8A 3OBAA 1F8VA 2HBUA 5C3OA 2YPDA 5JZGB 1AXZA 1C1FA 1RUC3 2DF7A 5ACA3 2G9ZA 3ST7A 5CFCC 4KNCA 5FUNA 3KGLA 4HANA 5BNOC 3K3NA 2VGDA 2Z69A 1VIWB 4Q4V2 4AG4A 1W0PA 3TEXA 1PIV3 1PMIA 3IDBB 4KU7A 4JHZA 3TEZA 3IIAA 1TMF2 3FWEA 1WKYA 1J3PA 1W6PB 4A44A 3FBMA 2WSUA 3AKRA 4BQ5A 4QGMA 1B35B 2Y0IA 3B69A 5BNNA 1F4HA 2BFUL 4LEJA 4JDOA 4Q4V3 3WDWA 2XGXA 1RJ7A 1WBLA 2DURA 2P6CA 2K46A 1W06A 1WD4A 4R4ZA 4CUGA 5I0DA 2W3JA 1TMF3 2FQPA 3IAPA 2ZGPA 2WNVB 2E33A 3RYKA 3ACGA 2NM1A 2YG0A 3EYPA 3I8TA 4AEMA 4CCJA 1UN1A 3NAPC 5T54A 3FMGA 5SV8A 4H14A 4ATEA 2HYXA 4NE9A 1MS5A 4QX8A 4XF9A 1UCXA 1VBC2 1ASJ2 4E2QA 5GM0A 1PVC2 4LORA 1GNYA 4C0BA 1Q8OA 1RUH1 4MUVA 5ISLA 2UWCA 1Z7S2 4HPKB 3ZFFA 4CTEA 2ZGOA 2PHXA 4GIQA 4YGEA 2Q8DA 4I0WB 4LBQA 5JI7A 1AXKA 1J3RA 4ISRA 2R042 1UYZA 2BNNA 2RVAA 3DXTA 3NNFA 4LBJA 5AC92 2HWD1 2NMOA 5LA9A 4FFIA 1ASJ3 1UOBA 5F37A 1PVC3 3WW4A 1S2EA 1KJRA 3OJBA 1SG3A 3WCSA 3O1VA 1VE0A 4PBOA 3VD5A 1KFUL 4BB3A 4X6RB 5AC93 1BHGA 2R043 3FFQA 4FPJA 4NRPA 2OX0A 5C3PA 5JR2A 1GOHA 1NE6A 1ND3B 4XFFA 1H4GA 1ND2A 1Y43B 3D0JA 5LATA 1F15A 1Q8VA 1WD3A 2YB7A 1W6OA 3NKTA 4LJHA 2RDSA 4C1WA 5D1IA 2ERFA 1NQDA 2IXKA 4RHV1 4MXWB 1QH6A 5LY1A 2B42B 3BI3A 4XJUA 4FSJA 1RUE1 2ADEA 1BEV2 5FYSA 3MO4A 3NSTA 1W8UA 2D6OX 2D3RA 2WC2A 2QZ2A 2EIEA 3L2HA 1UW8A 2Q30A 4TLFA 3WY6A 4BIOA 4MV2A 5K9YA 1ENXA 1QKQA 2MEV2 3M70A 2GH2A 3B9CA 4XHBA 1Y3TA 3PVNA 1S2BA 4QDSA 2PMWB 1LOGA 4LK7A 4CDQA 4YVSB 4JGYB 1BEV3 2UWAA 5FMOS 2P1BA 2YMZA 2VULA 3W59A 3VBRA 1WCQA 4HK9A 5C8CC 1DZRA 4QX0A 2XVGA 4N43B 2MEV3 2AENA 1VBD1 4AVVA 2BBAA 5I0SA 1SFYA 1MQTA 2PXJA 3T2QA 1IS3A 4IV1C 1G6NA 2XL7A 3QH6A 5KHIA 1LESA 4XW3A 2E63A 5JXHA 2QDRA 1DGLA 4Z07A 3VN4A 2QQJA 1ENQA 2CGNA 2WS91 3L9JT 5J96B 3AKPA 1N1TA 5A3UA 2R1DA 1BBT1 1O4ZA 2UYBA 2BDRA 1D2SA 2VOKA 4AEDA 4FBFA 1TEIA 1CR7A 5FWJA 4XDQA 3USUB 2CU5A 5FZ4A 3AZZA 4BOWA 3GZUC 4YGBA 5FQ0B 2Z2SB 2YC4A 2AZ5A 3THDA 3OGJA 3H8XA 3B02A 2JIGA 1I9RA 3V0BA 2X5IB 1J1TA 1O3RA 4XUOA 5FMOL 2R0HA 2NYYA 3ZMOA 1ZZ9A 4AWDA 2VM9A 3E1F1 3LEKA 2AACA 2VC9A 4K20A 4E2SA 1YFWA 3VGIA 1LJ7A 3IMNA 2D7FA 1DGRA 2QTWB 3ACLA 1MEC1 5F39A 4CDQC 5JOZA 4P9JA 2OZ6A 3AMMA 3KB5A 3E5XA 4DRRA 3AZXA 3ON7A 3GJAA 3OOXA 2JDZA 5GKAC 3S7IA 5IHRA 1H1IA 1UPSA 1WBFA 2VBDA 1AYN1 4IGOA 4PLMA 5CYYA 3SQOA 1X33A 5DUVA 2JWPA 1OUXA 4DEQA 3NMBA 5GZGA 1XSQA 5GJ6A 4AI8A 1J83A 2GAUA 1AR82 1L7LA 1MQTC 3RWNA 4E27A 1MPXA 1AUYA 1CD3G 2WABA 3BN6A 3KLSA 4AQ2A 4QPIA 3NNMA 1EV12 2ARBA 1H8TA 1IQDC 2GNMA 5LK5A 3O7OA 1YJLA 3THTA 5JI9A 1NYWA 2DBNA 4FOYA 3A22A 4QX5A 2A70A 4XBLA 1NXMA 5I8SA 5A7OA 4A6OA 1GBGA 3ZN4A 1AR83 3ZYFA 5A33B 5BNPC 4UAPA 1LOFA 5F8PA 4G9SB 2E31A 4H55A 3MEPA 1EV13 4AI3A 4HT1T 1SBFA 4K8RB 3WF3A 2CWSA 1CVNA 4XFCA 5FLIA 3I4IA 3RZZA 4PJYA 1F31A 1D0HA 3CHXA 5FYBA 3JBG2 3AKQA 2NZ9A 1HKDA 2C6SA 4XJ8A 5A3WA 3SC7X 4N43C 2P34A 1CZVA 4FFGA 3I3DA 1FV3A 1NCRB 3FUQA 4IEYA 1OQDA 4LLFA 5HV4A 4NOTA 4MHUA 1Y7BA 3LKJA 2DBIA 1VMFA 1L7QA 2LRPA 5FR3A 1VR3A 1RC6A 4XBQA 4DY5A 1SFNA 4NPLA 3OEBA 3SCHA 4U36A 3CJIA 4BISA 2IXCA 3FE5A 1JW6A 3RSJA 1US3A 4GJYA 2ILMA 4J25A 3WNPA 3N7LA 2XQXA 1OVPA 2FMYA 4JC1A 3ZFEC 1STMA 3CIHA 2Y8KA 5FO7B 4CCNA 2WNUA 2WZR3 4QM8A 3R05A 4KG0A 5A70A 2DVAA 3ZXLA 1D0GA 2A5ZA 2VQ0A 2P6HA 3ORJA 3Q8FA 2V5DA 4QKNA 1C28A 1A3KA 1RUJ1 4FFFA 1UY2A 4Y1XA 4YVWA 4XILA 2JE7A 5DUWA 2HWC1 5FZDA 3ZYRA 3VBHC 3HVDA 4BWOA 4HVQA 4FOWA 3RQ0A 1LHNA 4AQTA 1OVSA 2GMEA 3LEMA 4LULA 2GN3A 1HV0A 2WQ8A 3AYDA 4FPCA 5HCHA 4C91A 1X36A 3TRSB 3HQUA 5A7WA 4AE2A 1O3QA 1RUH2 2D5HA 2IVIB 5EJZB 3ZXJA 3NV4A 4FPHA 4OQ9A 5IAXA 1ZYBA 1OT5A 2VMIA 2WO3A 1MZFA 4DNYA 3OY8A 1O7FA 5JOWA 1LTEA 1GWKA 1OQ1A 2HWD2 4CUAA 4N8MA 2ZMNA 4AI1A 5EYYA 5B2GB 4DXZA 1GYKA 1ZVFA 2QQWA 3HR9A 5LY2A 4YFZA 4IESA 1CAVB 4UW3A 5JDBA 2GNDA 5DN2A 3VV1A 1ENRA 1VB2A 3JXSA 2VMFA 2YV8A 3NQHA 2BUKA 4MGIE 1JXNA 4OMDA 1PM4A 3QACA 4QT6A 3ZIXA 4CCCA 3VD4A 3A21A 2N7GA 4XUPA 1W8ZA 1XSRA 3DPRC 3FX3A 4HK8A 2HBTA 4ZU7A 4M3CA 3Q8CA 2R7EB 2EXIA 2J1VA 2JX9A 1C3HA 1OURA 1RUE2 1WZXA 4FO9A 4FQZA 4PDWA 4AYUA 1PO21 4YW3A 3RZGA 1ZNPA 2Y26A 2ZAAA 4JVAA 5C70A 1AR91 2WNUC 2ZZJA 2DVBA 1VJ2A 3ZXEA 3POFA 1ULGA 4IEOA 4BA6A 2FZ1A 4CEYB 2PQSA 1HRV2 2CDPA 4MADA 5I0UA 1RUE3 5F3IA 5IVBA 4GMP3 3VBOB 3WUCA 4NVPA 1K3IA 4ISQA 1KXGA 4XACA 3IB3A 5FYVA 2BWAA 1WCUA 3M3OA 1C8M1 4GH4A 5IJRA 1NX9A 4GJZA 4OUSA 3N35A 3U0ZA 3ZFGC 1ODNA 4QHBA 5A6YA 3MIBA 2XH6A 4BLJA 4RFT0 3ZSEA 1HRV3 2XDVA 2VW0A 1J59A 1X9TA 3MF9A 4CRQA 5DZFA 3UGFA 1R082 4EE2A 3VDBA 2D44A 3GALA 3FN9A 1K5JA 2WLQA 1POV3 3RG0A 3UNPA 3PURA 3DEMA 4YNIA 2RR11 3B00A 2K2SA 4R9CA 1F2NA 1R083 4GD4A 1MS8A 5FYYA 4WV8A 3VBUB 5FUPA 1GWLA 4LE4A 1G9DA 4GAZA 2BBVA 2B4KA 1GANA 3GBGA 4RQPC 4A42A 4FPLA 2OKXA 2D40A 4MVTA 2OZJA 3DXUA 3HPNA 4P9GA 1ONAA 1V0AA 4P9YA 4CA9A 1FV2A 1O3SA 4AQ6A 4D69A 1C5IA 5L9VA 3EQEA 3LPFA 1O91A 4AK3A 1US2A 2YGMA 1OA2A 3KT7A 1Y9MA 2JIJA 4IETA 4N7IA 4XFGA 5A1AA 1Q8PA 3I2HA 1UZVA 1W6QB 1BXHA 2QE3A 4OZXA 4FQ4A 2Q8OA 1GP5A 2GP5A 3JZVA 1VRH2 4LO5B 4CP9B 2VVEA 5E89A 3ZKYA 1OD3A 3SISA 1XNDA 5FTTC 3OB8A 4E2GA 4RFRB 2D43A 5K0UC 3A4UA 1HRI2 1TNRA 4FTSA 1VBA3 4Q4W1 4JKLA 3VKMA 1FYUA 3DN7A 1S1AA 1AJOA 1O4TA 1H1AA 1SBEA 1VRH3 1XU2A 3P1IA 4CEWA 4BQYA 2FDGA 1EPWA 2WSVA 1W3XA 2YFUA 1LB2A 4IEPA 1BYHA 1XE7A 4M00A 1HRI3 5LEKA 2JDHA 4A7KA 1DIWA 3KV9A 4I0AA 4YW7A 4XXPA 5A1LA 1VBB2 1R64A 4UYBA 1PGL1 1OOPA 2B9VA 4WVMB 3LWCA 2ETEA 5L9RA
chains in the Genus database with same CATH topology
3UJOA 3EXUA 1DQ5A 2DVFA 1LEDA 5KHKA 4INDA 1H9WA 1PZ9A 4HKOA 4Q8KA 4W6XA 2R062 1RUOA 1VBB3 1GZ9A 4JTOA 4LR4A 1OA4A 2XJPA 4YM0A 4M0NA 1CJDA 1LODA 4LBMA 4HETA 4XQ4A 4XFIA 2R063 3IPVB 3MW2A 2XJSA 3VHPA 2DV9A 3MPBA 4IERA 1I1EA 1QJX2 3I2DA 3WQ1A 3OYWA 1QJU3 1K5MB 4J6GA 4COZA 1QXRA 5JOYA 1BMV2 2ZGLA 4COWA 3UKVA 3AP4A 1AX0A 3IDCB 4MYEA 2BPA2 1QJX3 3VBFA 3V56A 1KRIA 2VVFA 5BYNA 3U10A 1RUJ2 1QWRA 5C9AC 4LUMA 1FPN1 2UYAA 2HKXA 2JG9C 4R9AA 4YG6A 1G9FA 1ULDA 2CNAA 4XPVA 4HFSA 5CA6A 1NA1A 4JGZB 1X8MA 4K3UA 4ONUA 3W58A 1IQAA 1D4VB 1S55A 4WVWA 3E5UA 5D8AB 4FCAA 3LGRA 3MW4A 4CDUB 3JD72 2E9QA 3FBYA 4M01A 1RL3A 4D94A 5EWSA 3OCPA 1I6XA 4PIXA 3T1LA 2DVDA 3RDIA 1C8NA 3VDDA 4ITCA 1NE4A 4Y26A 3H3UA 4OI1A 3JD73 1SBDA 3TYJA 5I8TA 4HKLA 2ZHMA 2VH9A 5GLWA 1DHKB 5JPNB 1QJY3 1NOVA 1S0FA 1WMDA 2EXKA 3ZSMA 1LU1A 5I0RA 2Q1ZB 2CL2A 2OA2A 2I74A 1PO22 1LGNA 3AJZA 3MF6A 2BGCA 2ZOEB 5FPZA 2P2KA 2XBO1 1H2KA 2Z79A 1WGPA 3G7DA 4Q8LA 4EWAA 1UU5A 4LLOA 3HIFA 4ZU4A 3VBFC 1Q8SA 4J1XA 4JRAA 1SCSA 3WINE 4PLNA 4U2AA 4RR3C 2PFWA 1PO23 1QU0A 1ZBA2 4QQ2A 3GBWA 2HWF3 4NHKA 1EAH2 3ZIWA 3AJYA 5IK8A 1XU1A 4LNVA 1VBE1 3FLPA 4N53A 4YZ3A 4P5HA 1ZBA3 3QH7A 1W6MB 1RVF1 1ZRRA 4IEXA 4Q0VA 1EAH3 4CDXB 4YSFA 2YROA 1O5UA 1O3TA 2TUNA 2F6BA 1LGBA 1ZRFA 1JN2P 2A3YA 4RS5B 2EXJA 5EJ3A 5L7OC 1BVVA 1WW6A 3M3EA 1YRZA 2ZHKA 4GWMA 3ZN6A 3CEWA 3PLQA 1UU4A 2P3JA 1FOD1 1LOEA 1OLQA 1ZZCA 4JGZC 3JUUA 5J98B 2E7TA 5F9TA 3VKOA 2Y0OA 5CADA 4YW2A 3BODA 1IPJA 3WXPA 2VQAA 3KSCA 5CFDC 5GLZA 1LR5A 2CY6A 4OVEA 1ZBE2 5E1RA 1H9PA 2IXIA 2ZGQA 3EO6A 5A32A 4LTAA 4Q4W2 1ZREA 1REFA 1BZWA 1Q3EA 5AVPA 4DPNA 5CFCA 5BNOA 4EWDA 1GZCA 1Y9QA 3WDXA 3WQ0A 4P9LA 1REDA 1IPKA 1ZBE3 3KCXA 2OIIA 1UMZA 1KS4A 4BPZA 1DBNA 1MS0A 4UBHA 3ZSJA 4Q4W3 4UW5A 2HWB3 1CAWB 2E7AA 5BY5A 1NCQB 5T55A 1SLTA 5GLUA 2C1FA 3WLUA 1RUG2 2W0XA 4HL0A 4Q4Y3 1U5YA 1I3HA 2XHKA 5JMCA 3M8LA 4I01A 2XL9A 3VL8A 4UXAA 4GKYA 4WM7B 3GNEA 3NAPA 5EYXA 1RUG3 4QPGB 3VL9A 3WDUA 1QQP1 5FDBA 3PMSA 2WT2A 3WG2A 5IK7A 1TNFA 2R6QA 5LRRA 4M3CE 2EVXA 1PK6B 1BCXA 1R092 2DCKA 3UV9A 3AKTA 4BQ1A 2JG8B 4FTBA 1U5XA 5HCFA 1YIFA 4RS5C 1OPMA 4GKXA 5A3MA 5KWRA 2Z42A 1V6KA 1GQGA 4EN9B 2RMU2 1R093 3AMPA 1EYBA 2D5FA 4O9GA 3TOJA 4MGKE 2ZGMA 3BCWA 4ZKTB 1QGLA 4A3XA 3BB6A 3S6PA 5J3UA 4MLOA 5GZDA 1FMD1 5BNNB 1FPN2 2HYKA 2RMU3 1BQPA 1XNKA 1QDCA 2V73A 4K21A 3VBSC 1MS1A 3H8UA 2ZKNA 1O5LA 2NP0A 1QMJA 2DCZA 5FLHA 4LHKA 1AZDA 1YYNA 2Q0AA 1KDKA 2RS12 4AEKA 2CAUA 1PO11 4S2HA 2NQYA 2TNFA 4OFGA 1OA3A 4XJAA 5LEJA 3AX4A 1UAIA 2PHUA 3BPZA 1OHFA 2WFF1 1U0AA 4A2UA 4L99A 2VNOA 2RS13 2E7QA 4K7JA 4Y4YA 1KITA 3ZFFB 4NWVA 4AGGA 3KD4A 4IV1A 4LBQB 4XIKA 3AP7A 3WX5A 5KHGA 1MZ6A 3KCYA 2ZX1A 3FUOA 3AM2A 1RMU1 4MH0E 1KD7A 5F6KA 2D6MA 3CF6E 1AL0G 2EALA 4EWEA 4K40A 3VZLA 1QH7A 1VBC3 2LTNA 4A7YA 1CGPA 3PHMA 1CX4A 2CV6A 2RM21 1ND2B 1Z7S3 2JJ6A 1BJQA 2B46X 2WT0A 1W6OB 4LA2A 3JU9A 5T50A 3AFGA 4P9XA 1YHFA 4WM7C 1WUVA 1U12A 4BZ4A 4COYA 1CJPA 2XJQA 4OI4A 5TSWA 1DZTA 2CWMA 2JECA 5FBZA 4N9HA 5BPXA 2XUMA 4QPYA 4DZGA 1VBE2 4WVZA 4HN1A 1OFNA 1LU2A 1FXZA 3RYRA 5J09A 3P3PA 2V5YA 4NR1A 3VBRB 3VHRA 2FMDA 5JIAA 4YM1A 5L19A 1C5HA 5JZGC 4B4RA 3RNSA 1YCIA 3GZTB 3URFA 1BK1A 1DYPA 3AYAA 3ETQA 4FTEA 1LEMA 3AP6A 3H0OA 4Q1PA 2Q4SA 4KL1A 3RMXA 1NLSA 3AYCA 4TYSA 2R1BA 5HCAA 5KHHA 1B35C 1EY2A 1AX1A 1TME2 1WW7A 2O8QA 4FPEA 5ABJB 5F6LB 4AEDB 1IZ3A 4J1WA 5BNPA 2VMGA 1IHMA 2GC2A 3V0AA 3MYXA 4WM8B 4CDWB 1Q8QA 4XMAA 1S0JA 2WNVC 4FPOB 2GDFA 1TME3 3SHRA 1OFSA 1WLWA 3N7MA 4N43A 4Q27A 4G4FA 2C5DA 3S30A 2VOVA 2ZHNA 4AFCA 1DQ0A 4R8HA 4PCRA 4XIOA 1JYIA 5C8WA 4QD2A 1MZEA 3USSA 3PJQA 4BHPA 4YARA 2GC1A 3NJZA 1S0BA 3SMHA 1DYKA 2ZCWA 4YGCA 2PAEA 3B94A 3K51A 1DU3D 2JENA 4ZXKA 1SDWA 1RUD2 4XTPA 4DB5A 4V1PA 3ZFEA 1AHSA 3DF0A 3MGUA 3NV1A 1AYM1 3WP4A 4QPIB 2GN7A 1H8TB 1ND3C 4M3CF 4NPRA 4TWTA 3H7JA 3R6SA 1RUD3 5KXBA 1AR62 4GB32 3VBHA 4EV0A 2XPJA 1ULCA 3D82A 1H0BA 4L92A 1WCSA 1ULEA 1GSLA 1PM7A 3GYDA 3NV2A 3QBQA 4LUKA 2RS31 1COV2 5DZGA 5CG9A 3MZHA 4Y20A 2PHFA 4XE9A 4L11A 4XJ9A 3THPA 2DCJA 5F5QA 1AR63 4GB33 3AFKA 4Q4X1 4YVSC 4JGYC 4AI0A 4KWJA 2EXHA 3BOPA 4TSVA 1COV3 4YZ2A 5JAXA 2ZX3A 3ALQA 3DGTA 2PTMA 3VZKA 5C8CA 2ET7A 4LBOA 3JBG3 2PHTA 2DCYA 3OD4A 1ZRDA 3DPRA 5ABJC 4DOUA 3N36A 4L97A 3WOGA 4Q1RA 4KQ7A 4AVAA 2XJTA 5HI0A 2BNMA 2DTWA 3BU7A 3HBZA 2VNGA 5FO9B 1R1A1 4WM8C 4AVTA 4FOVA 5JIUA 4I30A 2IC1A 4ZU5A 4LA3A 1SMVA 1W6NB 3TN91 4KWKA 5KXEA 1MZ5A 1HQNA 3AMHA 1FT9A 4JAAA 4I09A 1PO12 4WVVA 1HXS1 3V64A 3HT1A 2ZGSA 2G4IA 3H1YA 3SITA 2WFF2 2VU9A 5SV5A 4PF5A 5F1RA 5FCCA 2C0ZA 4BM8A 2X5IC 3WP5A 1KFXL 3ZSLA 4Y1UA 1PO13 3HT2A 1YO8A 3ZFGA 5FLJA 1RUI1 3OY8B 4QQHA 1LECA 3ROUA 4Q0UA 2WFF3 2ZX2A 4IEUA 1VAMA 3LZZA 1OI6A 4RGGA 4XF3A 2FBEA 5EZWA 4GA9A 3PVEA 5LK7B 4GULA 4QMAA 4N9IA 1YIPA 5T5LA 3TB0A 3WG3A 2YDEA 1UZZA 2RM22 1RUH3 2D3PA 2QJVA 3MIFA 4JDMA 1X82A 1Q56A 4IV3B 1PGSA 3ATGA 4RQPA 4M3CB 2HWD3 1UPIA 1YI9A 1UZYA 3JB8A 5E8AA 4PDWB 3KMHA 4D3WA 3LCPA 4RHV2 1PZ7A 4CYDA 3E97A 2NN8A 1GV9A 4XOGA 2EAAA 1D2QA 1N1SA 4RHV3 4GH4B 4R9BA 2RJLA 3RYPA 1NCRC 5K0UA 2ZABA 1S0EA 4FXKB 1YWKA 4COVA 1VBD2 3M4FA 4HLTA 2VNRA 3DKWA 4OUMA 1RINA 3O0XA 3P3NA 3VKFC 3I59A 3UL2A 2HEYF 5FAXA 1H4HA 1V6IA 1V9U1 3BOWA 3LSDA 2WA4A 4E9KA 4B7KA 2HEWF 4LHNA 1VBD3 3FLRA 3D4KA 2WS92 2OYZA 4DY3A 2EAKA 4HVRA 1CPNA 2Y38A 4META 1BBT2 2CGPA 4W6YA 2MNGA 4LT5A 4R4XA 1MS4A 5H9PA 1UKGA 2VW2A 4JCKA 1ZZ7A 2WS93 3CO2A 3E6CC 2IXJA 3WT3A 4K9SA 2WFPA 1QJZA 1BBT3 1EP0A 3J8F1 4FP2A 1DZQA 4PQ9A 3WDTA 1IS6A 2CAVA 4Q0QA 2IZWA 4XJZA 2H0BA 3ZXAC 1DGWA 4XMIA 4AW7A 3LAGA 1JTZX 4XEZA 1ZZBA 2WQ4A 4FXGB 2KM2A 2R0FA 1MEC2 1T6GC 4OI2A 5KHJA 2GSYA 2RS51 4HBNA 1SLIA 4Q26A 3CLPA 2NPIA 1DQ1A 4CEWB 4GMP0 1AYN2 1AYM2 1CAXA 4IV3C 4WBBA 2HEVF 4C90A 4LO8A 4YYOA 4JDNA 3E6DA 4Y22A 3VHNA 3WUDA 4CZSA 2JXAA 1MEC3 1YFUA 2B7YA 5DZEA 4I3PA 1QXJA 3AMQA 3VZNA 3LB9A 1OOPB 5C9AA 2Z5WA 4Q0PA 3RS6A 1O4YA 3D8CA 1AYN3 2E53A 1XYPA 1VLNA 4NO4A 2JG9A 1RUF1 2WLPA 3J4UH 3QLQA 2ZGTA 2RS32 4AGRA 4IL7A 3MDPA 4FT8A 3NV3A 4Y1VA 4L9BA 4CEYC 3ELNA 2IFRA 1CQ9A 3VBOC 3OPZA 3GF6A 3AKSA 2RS33 1XXNA 4AF9A 1ULFA 5FREA 4LO4B 5T3NA 1RGSA 4AFAA 5DG2A 4BE3A 2QZ3A 4XHXA 1QNYA 3POWA 1DDLA 1PNGA 2QKDA 5JR7B 3T2TA 3NL1A 3WVJA 2X8KA 1YJKA 1LRHA 1PHMA 3SNMA 2MHFA 3IDEA 4EN7B 1E57A 2VOWA 3ZXKA 2D97A 3TN92 2OVUA 2UU8A 4XF0A 3VBUC 4B29A 4EJRA 1HXS2 3RPQA 4CP0A 1JOJA 1KJLA 3VLBB 2D6KA 4HSLA 4RR3A 5C4WB 4L8QA 5BNQA 3ZYGA 3M2MA 4XZPA 3WHUA 2HWC2 1HW5A 1RUC1 2W08A 1NA1B 4KG8A 4YW1A 5ACA1 4ORFA 2CYFA 3ZVXA 2A75A 3EBRA 1X50A 1AXYA 2BW8A 1RUJ3 2CGOA 2VG9A 2ZMLA 4S2DA 4Y1YA 1OLRA 2EA7A 2HWC3 3WW2A 4QXKA 5CNAA 2PHRA 1GZWA 2VUAA 4LHLA 3INAA 2PLV1 3VDDB 1N47A 2XVKA 1PGW1 5FPXA 3RRDA 3I7DA 3PMEA 1TMF1 3IN9A 3POYA 5L7OA 2TBVA 3NO8A 1IGOA 2BEOA 1YFYA 3LOIA 2BVBA 5FOBB 1JUIA 4JRLA 2ARXA 1AJKA 4AQSA 1OQEA 1TE1B 1LGCA 1HLCA 4JGZA 1I5ZA 1JYCA 2OW4A 3JCIA 5H9SA 3MLKA 1DF0A 4B4QA 5JCTA 2A3WA 2D6LX 1AR92 1KQRA 5CVRA 3ZDSA 1V00A 1ASJ1 3IBMA 5CFDA 1PVC1 2YZ4A 4N53B 1AR93 1C8M2 2Q5TA 2ZA9A 5AC91 2R041 2DYCA 2PHWA 1NQJA 2PHLA 2DTYA 2GC0A 2YY1A 3E6BA 4Y5Z0 1RUNA 1BKZA 3M3CA 2E6VA 1W2UA 1VAKA 4LBLA 1V6OA 2VPVA 1C8M3 5GZFA 3R4DB 1K5MC 1OD5A 1XYOA 2RR12 5C6CA 3VUOA 2NMNA 2B9UA 2F4PA 2WZPP 2O0OA 4FPKA 3SH5A 2DU0A 3HWJA 2BQPA 2JICA 3CU7A 4S2GA 4W6WA 4AHXA 3G6JB 2UWBA 4L2NA 3AK0A 3ZN6B 1WLDA 3OGGA 1OKQA 3N7KA 4XF4A 1V6LA 1FI2A 5C4WC 1LHOA 5KC6A 3POSA 2RR13 1BEV1 3ZPYA 2AGSA 3RJ2X 2C9AA 4H3WA 2ZACA 4JTNA 3MW3A 1RB8G 2MEV1 3J8F2 3KGZA 5DUXA 1A8DA 1UL9A 4R9DA 1HQLA 1ZRCA 3MIDA 2WJSA 4IEWA 4YGDA 1W6MA 3FLTA 4YFWA 2VY0A 4OLLA 5D8AC 2DUQA 1A8MA 4F83A 3AP9A 4BMBA 3LOBA 5A32B 4Z92B 3OD0A 4CDUC 3M3IA 1H2NA 2H6BA 2RS52 3JQWA 3PVBB 1NXD1 5CFCB 4AI2A 4RS5A 5LRSA 5KXDA 1QOSA 5BNOB 3JB4C 1JUHA 4UBGA 5J48A 4O9EA 1V70A 1F9KA 1DQ6A 4N90A 4OHXA 4M0HA 5K8SA 2VVDA 1G9CA 2YHJA 3RI8A 2PHDA 2ZAHA 2H0VA 2EF6A 3U4XA 1LULA 3VBSA 1RUF2 1PGL2 1X7NA 2PA7A 3IWZA 2RJKA 5CAZA 3ZYIB 4E4SA 3GZAA 1IS5A 3SCFA 4CP2A 1REEA 2G9FA 4B4PA 1CAUA 2GU9A 3R0RA 3NAPB 3GBFA 3ECQA 4DINB 4QGNA 4FAHA 4H7LA 2B5HA 5CIRA 3D0SA 1BVP1 3UJQA 5I8YA 3ZXDA 1UX6A 4KBBA 1MACA 4K6BA 5IK4A 5FOJB 4AHZA 1J1LA 4YG3A 1QNWA 2OUHA 4CDXC 1WCDJ 1MS3A 1CONA 1QY4A 5JLVA 1KS5A 1NCQA 1AR81 4FPGA 5AFBA 1LHUA 2ZX0A 1EV11 2A6VA 2WT1A 4BH9A 1G9BA 2QQPA 3ZXGA 1UF2C 3A0KA 1N3OA 3ILFA 4WM7A 2DUPA 2QFEA 2DWRA 3NW4A 3V65A 4CP1A 2Q1MA 2X53S 1RUC2 4RGAA 2OPKA 5ACA2 3KM5A 2QDNA 5AFEA 4I2OA 1DLLA 2JD4A 4KWLA 5L36A 4XETA 3DL3A 5C33A 3C3VA 2JG8A 3B9IA 1LKNA 2AREA 1FPN3 3MI8A 2WWSA 2BVVA 1UKRA 2PLV2 2K0GA 1OPOA 3KZ4C 4GQ7A 1PGW2 4IEVA 5JZGA 2WZR1 4IV1B 1IS4A 1UIJA 3U07A 3VZJA 1GFF2 4YW5A 2KA3A 5BXXA 1LHVA 1LOAA 3T1MA 3OBRA 5T5PA 1FATA 2UURA 2YPJA 4KH9A 3HD8B 4I3GA 1FNZA 2PLV3 4Q29A 2B39A 2X29A 3MFAA 4QQPA 1W6PA 2XLAA 2ES3A 4OI0A 1B35A 1NY71 2R071 2IXHA 1NCQC 3FC0A 5T5JA 4LO7A 1SLAA 5I93A 4OULA 2QCSB 1HIXA 2XBO2 2DFCA 4X8PA 1UD1A 2ZBJA 5CG8A 2PAMA 2WNVA 3TBDA 5DUUA 4EN6B 2CTVA 4LBNA 2PAKA 3IKWA 4P9WA 4QPGC 4UW6A 1WMEA 2XBO3 4AVCA 1F5FA 5K7PA 2MPFA 3WD5A 3H3ZA 1R1ZA 2XLGA 3N7JA 4HPKA 1PK6C 1OMIA 4CDQB 4ES8A 4ASMB 4HVOA 3KT1A 4DMIA 2XKPA 2JG8C 4KGGA 5E16A 1RVF2 1JHNA 4EROA 5JWPA 1SACA 1VBE3 4YZ5A 5KC5A 1XNCA 2A6ZA 4I0BA 1MQTB 2DFBA 3MPPG 1RVF3 1HX6A 2LALA 1ND3A 1V6NA 5HBAA 4GALA 1Z78A 2W52A 4GMP1 2AUYA 3MLLA 5BNNC 3M1HA 4ATFA 5BNPB 4HN0A 1WW5A 2ZZQA 4MXWA 3V0AB 3KQRA 2DU1A 1NZCA 2DUOA 1FOD2 3CL1A 2NLRA 1URXA 4QGLA 4SBVA 3UKTA 1HRV1 2JKBA 2WA3A 1GNZA 1DG6A 1TQ5A 4ES9A 1G86A 2ZS6B 2SBAA 1POV1 1H8VA 2P17A 4YVSA 4JGYA 4AFMA 1FOD3 1X8EA 3MIHA 3TNQA 3V0BB 1S0CA 4A7ZA 3E5QA 5DG1A 1R081 1SLBA 3C2UA 3WP6A 3ZFFC 3R4SA 3MFCA 1UIKA 4XF1A 3WG4A 1Q5OA 4BLIA 3ENRA 4NN0A 3WQ7A 4AFDA 2IWGB 5ABJA 2HJIA 3ZFEB 1C1LA 2XWJB 3UKNA 1IKPA 2A7AA 3ME2A 1NG0A 2E51A 4AHYA 1JBCA 4WM8A 4CDWA 4XFAA 3ES4A 1ND2C 5HCBA 3RJRA 3VZMA 1G8WA 5EV7A 5AVAA 4XQWA 3USUA 4E4ZA 3KS7A 4Z2WA 3VBHB 5FQ0A 5KXCA 3I54A 3O0WA 2GMMA 3APBA 3HQXA 1VBA1 1YLLA 4EN0A 4FOQA 2PQQA 2X5IA 3U11A 4Y20B 4RL7A 3ZMNA 1QQP2 1XYNA 3B93A 1VRH1 2XLFA 1W39A 3R4UA 3ZX7A 4Y24A 1IOAA 4EN8B 3MLJA 2D93A 3H1MA 1HRI1 3VBRC 3RMYA 2A6YA 3MICA 1S2KA 3OTFA 2R49A 1QQP3 2BNOA 4MZUA 3EJKA 5T52A 3ZSKA 1H2LA 1YNAA 5C8CB 2ZPXA 2XJVA 1AL21 2D98A 1UU6A 2IFWA 1RIRA 3DPRB 1VBB1 2B45X 3B7MA 3CJIB 1KDMA 2B8MA 4F7ZA 4H7MA 1FMD2 2UY9A 2ZKLA 4AEDC 2OUJA 2R061 1J3QA 2WNUB 5A33A 3NWKA 1GR3A 1DQ2A 4AGVA 1RITA 1S0DA 4CDWC 4MGZE 1WCKA 1WMFA 3O14A 1QOOA 1FMD3 1V6JA 2LUWA 3FZ3A 4YVWB 5A3LA 4HKWA 1ZM1A 1QJU1 3ZFGB