4QPGA

Crystal structure of empty hepatitis a virus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
225
structure length
225
Chain Sequence
PVGAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTFPITLSSTSNPPHGLPSTLRWFFNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTPWVEKESALQIDYKTALGAVRFNTRRTGNIQIRLPWYSYLYAVSGALDGLGDKTDSTFGLVSIQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNSNAMLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 37
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12944 HAV_VP Hepatitis A virus viral protein VP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgA00
3ZFGA 4AEDB 4CDUC 5AC93 4AEDA 1RMU3 1Z7S1 1AUYA 5ACA1 1AR62 2GH8A 1NCRC 1R1A1 2HWB1 1VRH1 1QJX2 1RUJ3 1ASJ3 1RUF1 1ND3B 1RB8G 5C9AB 3VBUB 1TME1 3ZFFB 4CDWB 3JBG3 1RUE2 4JGZB 1RUD2 5BNOC 1PO21 1VBD2 1RUI2 2BFUS 4YVSA 5L7OB 1RHI2 4YVSB 5DDJ2 1FPN2 1QJX1 4GH4C 5BNPC 1EAH1 1OOPC 2RS51 1OPOA 1ZBA2 4SBVA 4CEYB 2HWB3 2RM22 1MQTB 5JZGB 1RVF3 3VBUC 1MQTC 1POV3 2BBVA 1PVC1 4Q4Y3 1VBE2 1VBA2 3NAPA 4CDWA 4RS5A 1AR72 1NA1B 1NOVA 5BNOA 1AYN3 1PGW2 4GMP0 5BNOB 2ZZQA 3VDDC 4YVWB 1QQP1 2WS91 2R072 1AYM3 1BMV1 1QQP3 2HWC2 4QPIB 1HXS2 4LLFA 2HWF1 1M06G 1WCDJ 1NCQA 5C4WB 1X33A 2XBO3 4N53A 1FOD2 4RHV1 4WM7B 1MEC2 2GSYA 2FZ1A 1C8M1 4GB33 1C8M3 3ZFFA 1V9U1 1PIV2 4Q4W1 1F2NA 1H8TA 1NA1A 1EAH2 1H8TB 4PDWA 2TBVA 2VQ0A 2WFF3 4N53C 4CEWC 3TN93 1HXS1 2R061 1QJY1 4CEWA 5C8CA 4CEYA 5GKAC 1MQTA 5JZGA 3VBHC 1D4M2 4Y4YA 1AR82 1TME3 2R062 1HRV2 3JD73 4GMP1 1R1A3 3VBFB 4QPGA 5ABJA 4GH4B 1RUF2 4YVWC 1PVC3 4YVSC 1RUH3 2RS53 3ZFGC 1B35A 1Z7S2 3VBRA 5BNNA 4QPIA 5AC92 4CDUA 5C9AA 3VBUA 4FTEA 1AR92 4Q4X3 4CDXB 1AR63 5C4WA 3NAPC 2XBO1 2RMU1 1QJX3 1RUJ2 1ASJ2 1AR81 5CFCA 1PO22 4WM8B 1RUE3 2FZ2A 4Q4X1 1COV2 1RUD3 1VBD1 1RUE1 5L7OC 1NY72 4IV3C 4QPGB 4BCUA 5ACA3 1RUI3 1VBA1 5K0UB 2WLPA 5AC91 5K0UA 2WZR1 1FPN3 4RQPB 2X5IB 1POV0 1V9U2 1RVF2 5CFDC 5C9AC 1ND3C 2ZAHA 1AL21 3ZFEA 3VBHA 2HWD1 1RUI1 1FOD1 1VBA3 3VBHB 1VBC2 4CDQC 4FTSA 5ABJC 2Y26A 1EV12 1BEV2 2MEV1 1AYN2 3J8F1 5FOJB 4RR3B 4Q4V2 1PO13 5BNPA 1QJY2 2HWC1 1BEV1 2HWE3 1AYM2 2WFF1 1QQP2 2HWC3 5LK7B 3M8LA 1HXS3 1R091 1DDLA 1FMD1 3VBSA 4FSJA 3ZFEC 3VBSC 1AL22 2XBO2 1RUH1 2RS33 1FOD3 3CJIA 1K5MC 4IV1A 1IHMA 3CJIB 4JGZA 4WM7C 1PIV1 1POV1 1HRI1 4IV1B 4IV3B 4CDQB 4GB32 1C8M2 2BPA2 1FMD3 1C8NA 4WM8C 2HWF3 3JD71 4GMP3 2R041 3VBOB 1AYM1 4QPIC 2DF7A 2RS13 3VDDA 4RQPC 5BNPB 1AYN1 3J8F2 3VDDB 4GH4A 2WFF2 5K0UC 3TN92 4N43C 1NCQC 2X5IA 1NCRA 2RR12 1PGW1 5CFCC 5BNNB 1AR83 1TME2 2RMU2 1HRV3 2R042 3JD72 1RUC2 1VBC1 3FBMA 1TMF1 1R1A2 4Q4W3 1AR91 1SMVA 3VBFC 3VBOC 1HRI2 1OOPB 1PVC2 1ND2C 4WM8A 1R083 1AL0G 2WZR3 1TMF3 1HQNA 1ZBA1 1RUH2 2RS52 4Q4Y1 4N43A 1RMU1 1Z7S3 1VBB2 1QJU3 3ZFGB 5CFDA 4CEWB 2QQPA 1PGL2 1AR93 4N53B 4RHV2 1R092 4Q4X2 3VBSB 1ZBE2 2HWE1 2MEV3 5D8AC 1HRV1 5C8CC 2XPJA 2PLV2 1A6CA 4CDWC 3ZFFC 2R071 1D4M1 1VRH3 1BBT2 1RUG3 1PO23 1COV3 1QJU1 4NWVA 2WS92 4RR3C 4RS5C 2HWD3 4FTBA 1B35C 4CDUB 3DPRA 2BUKA 5ACA2 1B35B 1RMU2 3ZFEB 5D8AA 5A33A 5C4WC 4NWWA 1CD3G 5CFDB 1V9U3 3JB8A 3JBG2 1CJDA 4JGYB 1VB4A 4Z92B 1RUG1 2ZTNA 3IDEA 4JGYA 1RUC1 5DDJ1 4RR3A 2BFUL 1VBC3 1VBD3 1NA1C 1W39A 1EV13 5ABJB 1BEV3 4QPGC 2RS11 4RS5B 2PLV1 4IV3A 4Q4V3 1ND2B 4RQPA 1RHI3 1PO12 5DDJ3 1QJY3 1F8VA 4PDWC 1ZBE1 2HWE2 3VBRB 3ZXAC 3DPRB 1ZBA3 2HWB2 2RM23 4RFT0 5JZGC 1OHFA 4CEYC 2X5IC 1VBE1 1GFF2 4Q4Y2 5C8CB 5D8AB 5A33B 1VBE3 1AL23 1RVF1 2IZWA 2RS32 5CFCB 4GB31 1NG0A 4EJRA 1AR73 5L7OA 4WM7A 2WWSA 1X36A 1HX6A 2RM21 1VAKA 1FMD2 1RHI1 2R073 2HWF2 1PO11 4Y5Z0 2RS12 3DPRC 1ND2A 4PDWB 3NAPB 1NCRB 3J8F3 3TN91 4CDXC 1OOPA 3S6PA 5FMOL 5BNNC 1BMV2 1E57A 1ASJ1 1QJZA 1VBB1 4IV1C 3CJIC 1MEC3 1NCQB 1PGL1 3JBG1 2RR13 4N43B 1AR61 3JB4C 1AR71 5FMOS 2RMU3 1PIV3 2R043 1RUC3 3VBOA 4JGZC 4JGYC 2RS31 4Q4W2 1EAH3 3VBFA 1FPN1 5J96B 1HRI3 3VBRC 1VB2A 1MEC1 1R082 2RR11 2WZR2 1TMF2 1NY71 1VBB3 1QJU2 4AEDC 1K5MB 1ND3A 3HAGA 1BBT1 4CDXA 4Q4V1 1D4M3 1K5MA 1RUD1 4RHV3 1R093 2R063 1ZBE3 2MEV2 2PLV3 1COV1 4CDQA 1H8TC 1VRH2 1EV11 1BBT3 1RUG2 1R081 5J98B 5A32A 4YVWA 1RUF3 1RUJ1 3LOBA 5A32B 2WS93 2HWD2
chains in the Genus database with same CATH superfamily
3TNQA 3MGUA 3K3NA 3FN9A 5DAVA 5KBFA 2BP6A 3T2TA 2J7MA 3T0AA 4UI9L 4CDUC 4JTOA 4NVPA 1GP6A 1ULCA 1GP5A 3LEGA 4KQ7A 3E5UA 4C8DA 5JXIA 1ULPA 2UYAA 2GH8A 1NCRC 1PVXA 1TNFA 1YCIA 2RE9A 2HWB1 2IVJA 2BW8A 3ZIWA 4XFAA 4DPNA 3BODA 5C9AB 1TME1 4M0HA 1JW6A 4RA0A 4Y1YA 3DEMA 5IYYA 2Z79A 2Q8EA 1JYTA 4V2VA 1RUE2 2WNVC 2XUEA 5ANNA 1WUVA 2W95A 4LK7A 1SG3A 2C1FA 4AW7A 2VG9A 5DXDA 3FX3A 3NNJA 2Y6LA 1IOAA 3I8TA 1TQ5A 1UIKA 3LDBA 3GBFA 4XUPA 3WNOA 3EHKA 4LBQD 4W65A 2VVFA 5FPLA 4BHPA 1NZCA 3NWKA 1NKGA 1RC6A 2PFWA 3RG0A 4CCEA 1S4CA 2BFUS 4N9IA 3VDCA 3H8RA 3NV2A 2UY9A 3GJBA 4XW3A 1RTVA 5F3GA 4XHBA 3WDVA 2MPFA 3HWJA 4I0BA 4SBVA 4DINB 1WW6A 3GZUC 2BNMA 2D6PA 2JE8A 1MQTC 3KS7A 1POV3 5LA2A 1VRBA 3ZPOA 4MSVA 2BBVA 4BQ3A 4HETA 4UF0A 5FZOA 5JUVA 1LRHA 4Q4Y3 2VVDA 4B8EA 3CMGA 1IS4A 2E63A 4O9EA 1XNCA 2W08A 1UY3A 3M4FA 4HZFA 4LO7A 2OUHA 1VIWB 4E2GA 4IE5A 4CDWA 1JYWA 1LOFA 1WKYA 5D2AA 1SZBA 1OA3A 1UF2C 5BNOB 4YVWB 3IPVA 3CEWA 3VD5A 5FPBA 1AYM3 2AACA 1ULGA 3T4HB 3VZLA 4BLIA 4CP9B 4XOGA 4YZ5A 2YV8A 2QQIA 5A80A 4K8RB 5FIXA 5A1LA 4LMFA 5LK5A 4LHSA 5JR2A 2LM3A 1NCQA 2PHXA 5T5LA 1VMHA 4K40A 4MX3A 5EWSA 3AZZA 4IUGA 4Y1XA 3AZYA 3USSA 1FOD2 1RGSA 3H1MA 5T54A 3RRDA 4IW3A 4WM7B 3RZLA 1W9WA 2GSYA 4FFIA 1NAEA 5DAQA 4LA3A 1LKNA 1C8M3 1V9U1 3WQ7A 2KA3A 4AI0A 3WINE 1J1TA 1UN1A 3ASIA 3KCXA 5A7PA 2JB4A 3U11A 2DYCA 3PVEA 3WDXA 1V6JA 5EHDA 3TWIA 4D0QA 2QUOA 5FFOC 2XWJB 1EAH2 4YFWA 2B4KA 2Q1ZB 5EZWA 5I8SA 2YUEA 3THPA 3NW4A 4PDWA 3ZYJB 4FP3A 2W1UA 4XILA 1QOTA 1QKQA 1YIFA 3F95A 4G4FA 1HB3A 2E33A 2RV9A 4LBJA 2XOMA 4AHZA 2ZEYA 3S0MA 3RZMA 3FL7A 2VW0A 4QB6A 1F9KA 2OW4A 2WFF3 4N53C 4URAA 4XUQA 1W6PA 3I2DA 4QU1A 1D2SA 1NYWA 1QOOA 1GV9A 1QNWA 2R061 2YROA 2A73B 3AL5A 3KZ4C 5F5QA 5C8CA 5F1RA 2D98A 2ZCWA 4AFAA 2LRPA 5GKAC 3FLTA 1Q8PA 1WCQA 2RJLA 4GAZA 1D4M2 2OPKA 2QNKA 3ME2A 1Q5OA 4IE6A 4DY5A 4FAGA 3OCPA 4GZ9A 2WZ8A 5HBAA 1QH7A 3JD73 3VGIA 4S2DA 5LY1A 4DNYA 5CYYA 5F5IA 4M01A 4B3NA 2W92A 5LA0A 3EJKA 4QPGA 1BZWA 4PIYA 3KT1A 1W8FA 2H0VA 3PVNA 1JYXA 5FZBA 3ZXJA 2PTMA 4GKXA 2AYHA 4XFIA 4K1ZA 5JMCA 3PURA 2PHLA 2RG4A 3I7DA 4YVSC 5CKQA 1H6YA 1CX1A 4HXCA 1UMZA 3AYEA 2CTVA 1PK6B 1LU1A 1Y43B 2RS53 3HIFA 2VVEA 3N9LA 3ZFGC 4OYUA 4AVVA 1DZQA 4QPIA 4RD7A 1HN0A 4B7EA 2QKDA 4AI2A 5FZMA 4XF9A 4HSLA 4YNIA 1LHOA 4CDXB 4Y4RA 4D7SA 2XBO1 2CY6A 4IDZA 1GZWA 3RNSA 3EO6A 4Q0QA 1O5UA 5AFBA 1AR81 3P6BA 2QBXA 3LEMA 3M3IA 2UWBA 4ZU5A 3ZLIA 3GM8A 2CGOA 2BZDA 3ES1A 2JECA 3BYWA 5FP3A 2FZ2A 2WLQA 3A0KA 3LGRA 4CXYA 2VCCA 1TG7A 4JAAA 4UFMA 3I2FA 3A4UA 4BQYA 3KF5A 5F3EA 4GWIA 2ZX2A 3MUY1 4JV4A 4IEWA 3SKVA 4FFGA 3RI9A 3POIA 5FYIA 3MV01 4QQPA 4BCUA 5ACA3 1UAIA 1WD3A 3OYWA 5K0UB 3NL1A 4Q2FA 2CDPA 1STMA 2YGLA 3EYPA 5GZGA 3I54A 3UYJA 3NSTA 3VHRA 2A6ZA 4DRRA 3SH5A 2FCTA 1G6NA 3PIJA 2A3WA 1V9U2 3ITQA 4KGGA 2ET1A 2ZAHA 1H9PA 3PMSA 5LRSA 3POGA 1NLRA 3ZXLA 1GOFA 2KXLA 1L3JA 1VBA3 3IM0A 4FO9A 3VBHB 5A1AA 1UOJA 1G9AA 3WSOA 4JCKA 3ABZA 4DXRA 4XZUG 3KCCA 1YNAA 3NJZA 4QKNA 4IGOA 3WF4A 4AK3A 5IHRA 5FYSA 3FC0A 1NE6A 3JXSA 3NNMA 3J8F1 1SFYA 4A2UA 5EP9A 4YSFA 1PO13 1ENXA 1BEV1 2D93A 4XJWA 1BVP1 3Q8AA 3QCWA 3BU7A 3HQXA 2PHWA 3W21A 1DDLA 2ZHKA 1W8OA 1MS8A 1IPSA 1JMUB 3RS6A 4XF1A 4B7KA 4NROA 5LBFA 4YW1A 3F2ZA 3PJYA 1S2EA 2EXJA 2QQUA 4LJHA 4NHKA 5FLJA 4JDMA 1SPPA 1WW4A 4Y3OA 3W58A 2EA7A 3NNFA 4LO8A 2W1QA 1JZ3A 4IV1A 1HV1A 4A6OA 2EF6A 1PM7A 4BZ4A 1LOBA 1PIV1 1HRI1 1POV1 3CHXA 5JLVA 1DQ4A 4AHYA 4SLIA 1RXGA 3OUJA 3AC0A 4UW3A 5EQUA 3O0VA 1LHWA 4D7TA 1D0GA 2XGXA 3JD71 3IMMA 3AYDA 2R041 4OHXA 4QX8A 2P4EA 1LULA 3MW2A 1S55A 3OPTA 4GQ7A 4JRAA 3WV6A 1OUSA 4QPIC 1IQDC 3NKGA 4NHXA 4EROA 2ID4A 2QFEA 3J8F2 3OUHA 5FZ7A 2VNVA 1ZYBA 2DV9A 2HBUA 3DYOA 3GDBA 3KF3A 2EIGA 3N9MA 4GH4A 4OI2A 2B42B 3GBGA 1NCQC 1W90A 1H1IA 1CX4A 3ZN4A 5KC5A 3ACLA 3O1VA 1MZ6A 2F6BA 3P5BA 2VU9A 4Q26A 1NCRA 1VJ2A 2RR12 2Y64A 2ZGUA 4MG2A 4Z2AA 4A6SA 5L73A 5C70A 1TME2 2RMU2 4JQTA 1WBFA 1HRV3 4YW4A 1TVGA 4LLOA 2WR9A 2L9LA 4LHLA 1TMF1 1UY1A 4FPOB 4Y22A 3WHUA 5FZLA 1DQ2A 1DZTA 1OF3A 1QNYA 1SMVA 4GWJA 4XFFA 4AI9A 4AVBA 3NQHA 4ZPIA 2W91A 4YW5A 4Q5OA 1HRI2 2WABA 1OOPB 4K7JA 2UURA 1QMJA 5F2WA 2WT1A 3WG4A 5HV4A 2VOXA 1PVC2 1W2OA 4N9HA 4WM8A 1DGWA 3U07A 3D8CA 3RGBA 4DIQA 5A3NA 1RUH2 2RS52 1IS5A 2K0GA 1VBB2 4FPKA 3IDCB 4M4RA 1ACCA 2D3PA 3FLPA 2BVVA 4FPEA 2XDVA 1W6NA 3PL0A 1PGL2 1XXNA 4MGZE 4HFSA 4Q4X2 2XJSA 4LPLA 3T30A 3WW1A 1JODA 5JXGA 2XKPA 2V73A 5GLZA 2XPJA 1A6CA 3AZVA 5EPAA 3ZYBA 4H14A 3PUAA 4NN0A 1UKGA 2BNOA 4XQ4A 1MS5A 4ZS3A 4Q1RA 1QJU1 2CV6A 1UXXX 4R4ZA 2ET7A 5FLHA 3V56A 3BTZA 3H50A 3KHBA 2Q4SA 4RR3C 4CCCA 4AVAA 1AZDA 2JKBA 3E5XA 3T09A 4COUA 2FDKA 3DPRA 4MXWB 1KFUL 1ULOA 2WYFA 3I3MA 1B35B 1GYKA 1RMU2 4TZDA 4YG0A 5A6XA 3NRUA 4CSWA 3TNPB 3M7AA 2XJTA 3DCQA 3ZFEB 2W5FA 5A33A 5C4WC 2HH9A 3SEPA 1CD3G 5JMOA 3I2OA 3JB8A 5IJRA 1CPNA 1CJDA 1O6UA 4JGYB 1VB4A 3H8UA 1GZ9A 4EWDA 4JGYA 3UGFA 5DDJ1 2ZMNA 3A0NA 1H8VA 4RR3A 3S5QA 4COWA 1OI6A 3PHMA 3BOWA 4OHVA 3QLQA 4RSUA 3CNAA 4W8JA 2ZAAA 3ZDSA 1W39A 4P5HA 3DL3A 4AEJA 4QPGC 1HJFA 4QX7A 3CL1A 4EN7B 1JZ4A 5IVVA 4RS5B 1T6BX 1S0CA 5FZCA 2ZGKA 2GN7A 2VECA 4EWAA 3USUB 5DDJ3 4R52A 5KWRA 4PDWC 2HWE2 2JIGA 2ZABA 2ZGMA 2YBSA 3USUA 2HWB2 2QZ2A 2RM23 4IE7A 4EZ4A 3DECA 4R9CA 3THCA 5JZGC 5A1FA 4P5YA 1S0JA 3ORJA 5C8CB 2Y60A 4COZA 5D8AB 1VBE3 3LFMA 1AL23 3C3VA 2C24A 4OI1A 2IZWA 1VP6A 3B00A 2R0FA 4OZOA 5CADA 1US3A 1RJ7A 1KFXL 3E1F1 5HCAA 3UNPA 2C0ZA 1NUKA 2JG8A 4C1WA 4HVOA 2Q8OA 4WM7A 2EICA 1JZ2A 4YGEA 1JHJA 4Y5SA 4NO4A 4AI8A 3AZWA 4I01A 3LEKA 2DBIA 4BA6A 3LIGA 1J3RA 1H9WA 5AVAA 1W8WA 5A3UA 3ZMNA 5HXMA 2I45A 1J58A 1GMMA 1GSLA 1LHVA 2E7QA 4Y5Z0 4MV2A 1ZRDA 3MICA 5FTTC 4AWDA 2WO3A 2FMYA 2YC0A 3LDKA 2Q0AA 3J8F3 4LKSA 4QT6A 2P6CA 5EV7A 5FQ0B 5FYTA 1HLCA 1BMV2 1PZ8A 3N9OA 1HKDA 1BLZA 5A3OA 5J1XA 2KM2A 2P3YA 2OQ6A 3EMRA 4GWMA 4NPMA 4XF3A 2W1SA 3RMYA 2VCMA 4YW7A 5J48A 2IVIB 2RR13 3JBG1 2VMIA 4N43B 1H4GA 2WZEA 4J1XA 4UYBA 3S7EA 3ZYIB 1XC6A 4QHBA 1BYHA 2O8QA 1YXWA 2RMU3 3CU7A 2PHUA 3B02A 1F4AA 1UW8A 1YFXA 3FBYA 4KI5M 5EFUA 1UZYA 3WDWA 1MS0A 1PM4A 4DQAA 1EAH3 4FOVA 3S57A 2P37A 2VE1A 2WQ4A 2ZGLA 3ENRA 5ANQA 4NIGA 4YM0A 1W8NA 5A3PA 1UPIA 5FZ3A 3ACIA 1JI6A 2HBTA 4F83A 1GQPA 4AHWA 1A8DA 3JU9A 1SCSA 1K5MB 1W3VA 3WG1A 5LBBA 4AQTA 2CL2A 4Q4V1 1YFWA 1K5MA 3NO8A 2VCAA 2RJ2A 3FUQA 2GMPA 4QB2A 2ZACA 1TEIA 2VQAA 3PJQA 4CUBA 1W05A 1YQ5A 4BMEA 4KMQA 2GNTA 5BV6A 4YM2A 1W99A 2B46X 3POJA 3R05A 2BERA 1RUG2 1R081 5CEHA 2R16A 1UL9A 3T2PA 4QGLA 2OX0A 4UW5A 3I3BA 1W03A 3J7HA 1HJGA 2HEWF 4XACA 1W3XA 4KWLA 4CCKA 4LITA 4EN6B 2VOVA 2Q8DA 3ZFGA 3ZO0B 4NIIA 1F5FA 1XBFA 4XUOA 1BK1A 4QGMA 3ON7A 3LF7A 4WVVA 3GJAA 4L9BA 5LASA 2VW1A 1O3SA 4EZHA 1FXZA 2HKXA 2NPIA 1RMU3 1Z7S1 2XLAA 3CKHA 4LKFA 2GP5A 2YBPA 3DGTA 1MPXA 3FMGA 5F32A 3TEYA 3DKQA 1H2LA 2JICA 3A22A 2CAUA 3A7QA 1QJX2 1RUJ3 5FQ0A 1B09A 5FUNA 3NKTA 3IIAA 4OFGA 2DCTA 1SQ4A 2WQZC 3W59A 1ODNA 3JBG3 4CDWB 4ZXEA 4OQ8A 2W9XA 1V0AA 1YI9A 5FZGA 3V65A 3VDAA 5GZFA 4W6YA 3T3YA 1PO21 4C1XA 4CXWA 1MACA 4MUVA 3Q9OA 1ZZCA 3B01A 4XXPA 1EUTA 1WLTA 5FO9B 4KBZA 3T0DA 5FREA 4DZGA 2DVBA 4HK9A 1RL3A 1ZM1A 2WAOA 4H2AA 4QU2A 2JG8B 2WRAA 3GF6A 1JZ6A 4QHOA 4GH4C 1QY4A 2RVAA 1UOGA 1UY2A 3Q8EA 1OPOA 1CAUA 4LNVA 4CUCA 1W8ZA 2RM22 1MQTB 2JD9A 5C3QA 1RVF3 5JZGB 3N36A 1PVC1 4P9LA 1PNFA 2P5BA 5DG2A 3K4ZA 2DCJA 2K2SA 2ZEWA 4Y1UA 5I8YA 1O5LA 3WEZA 1ZREA 3MEPA 5E89A 2FMDA 4QXBA 2WDBA 4YFZA 1VBE2 1WA4A 2E7AA 2A6YA 4XURA 1QOSA 3B5LB 3D5OA 2VD7A 3NAPA 4D3WA 4PLOA 3BB6A 4Q27A 4QKFA 1V6MA 1S0GA 1KEXA 1LGBA 4RS5A 1AR72 1AX2A 3ILNA 3KQRA 3D4KA 5FZEA 2ORZA 4BXSV 1GWMA 1LEMA 1PGW2 3J4UH 5LATA 1W9SA 1GQGA 1DFQA 2QQNA 1WCKA 1W6MB 2CU5A 1UMHA 2C26A 2R072 3G6JB 4FPGA 5BXXA 1IS3A 1FX5A 3ZKUA 3GZTB 1HXS2 4KL1A 3UGHA 3RQ0A 4XMIA 1E5RA 1F15A 3WHTA 1OKOA 5C4WB 5LRRA 4AEDB 1IPJA 1Q43A 1OLQA 2XBO3 2Y6FA 4N53A 4UFIA 3HNYM 4YARA 5FZDA 3DYPA 5KHIA 4F7ZA 1M4WA 2DCYA 2XLFA 4FXGB 5J36A 2WNVA 4PT6A 4TYSA 1IPKA 3ZR6A 1DYKA 1MS3A 2ZHLA 3VZMA 1UXZA 1DG6A 3QH7A 1YRZA 1EYBA 4E8CA 4Q4W1 4PHZA 1QIQA 2VZPA 3IBMA 1NA1A 3VZJA 1IKPA 1PMIA 1UYXA 3BI3A 3RWKX 1LOGA 2WZPP 2YFZA 4BE3A 4P08A 4CE8A 3ACGA 5IVJA 4DB5A 4XETA 1JOBA 1DZRA 4IGPA 3HVDA 3LE0A 2D6KA 2FDGA 1OLRA 3C7FA 3TN93 4P9YA 3SEEA 3IKWA 2GN3A 1VLNA 3MIFA 4GWNA 3ZSEA 2GMMA 1JYNA 4IEOA 2E26A 1W6PB 5K7PA 5I0DA 4ZY9A 1YLLA 4BOWA 3WP3A 5H9RA 1AR82 5BNQA 1ZZ7A 5LBCA 3MI8A 2J1VA 4E9KA 1JOJA 4NHLA 3AB0A 1ZZBA 1KGYA 1PMHX 3O14A 5T52A 3VBFB 3WX5A 3OJBA 4C91A 1FV3A 2J42A 3AYCA 4LQRA 5SV5A 1WMFA 3HQUA 1E5IA 3PUSA 4GH4B 4LIVA 4XABA 5GZDA 1W2TA 2WYSA 1XPWA 2ARCA 3CZUA 4CCMA 3W20A 4AGRA 2Y6HA 3BCWA 1RUH3 3MDPA 4CPBA 4NAOA 2E7TA 1OVPA 2B9UA 3I49A 3WG2A 3TB0A 5C9AA 1HDKA 2FDIA 1AR92 3MLLA 3H1YA 4WVMB 3OGRA 3ZKYA 5A7QA 3VD7A 5JDBA 1PMJX 1W6OA 3ILRA 3WR0A 3U1XA 1RUJ2 3HBZA 3M3QA 2C4XA 3EQEA 1YFUA 2YGMA 1W9FA 3JQXA 3OTFA 4MGTA 2EXIA 2DFBA 1PX3A 1RUE3 4WM8B 5A7NA 1ONAA 4XDOA 1VBD1 1DCSA 4V2WA 4AL9A 5J09A 5H9SA 1OFSA 2YFUA 2LUWA 3KQ4B 4LO6B 2A5ZA 5L9BA 3URFA 4EYUA 3KB5A 4FXKB 1PX4A 4HKLA 3BTYA 1JZ8A 3NJVA 3PUIA 4Y20B 5AC91 1FNZA 5K0UA 5FY7A 4FPJA 1CVNA 4MH0E 2X5IB 2DFCA 2X09A 3QH6A 3INAA 4GA9A 2WL1A 2Y6JA 4QD2A 3BKZA 4FPYA 1RVF2 4QXHA 5CFDC 1UU4A 1AL21 4LT5A 3ZXDA 3POYA 4TWTA 3VZNA 2FDHA 4FQ4A 4R9AA 1RUI1 3AYAA 4DUXA 5GLWA 5DMYA 2SLIA 3OGVA 4DUWA 1L7QA 1DGWX 1EV12 4FOQA 5FY9A 4BISA 5IVCA 1O4ZA 1PZ9A 1CAWB 4OUSA 4H7LA 5FOJB 2R32A 4JC1A 3HN3A 4YYOA 3VV1A 4HKWA 5BNPA 1W8HA 3CLPA 5DPNA 2YDEA 3PIGA 2WFF1 3LDRA 3FUOA 4ISRA 2QQLA 3M8LA 1HXS3 4I30A 4LTAA 2AREA 1PK6A 1FMD1 1HIXA 1OFNA 3ELNA 4AZZA 5CA6A 2YYOA 1UWWA 5CKNA 4FSJA 2YPDA 4XAAA 2X05A 2NLRA 4UF0B 5FPUA 4XJZA 4B4PA 3H9AA 4QHZA 4KWJA 1O8SA 1I9RA 2VZ1A 5T55A 4ZU4A 3VKLA 3O5SA 4XC9A 3ROUA 1IHMA 1URXA 2KD7A 4WM7C 4Y24A 2CGPA 2ZGOA 4IV1B 5FP8A 5DQ0A 4QKBA 4LR4A 3NV1A 4HN1A 4WVZA 3WP5A 3TBDA 3B9CA 5A6YA 2EALA 1CPMA 1SBFA 3B9IA 3DF0A 1C8NA 2BDRA 4NRQA 5KXCA 1XU1A 1SBDA 5IW0A 5J3UA 1Y9MA 4IERA 3UKVA 3VBOB 5C5TA 4AI1A 4YGCA 1AYM1 2BQPA 2D6MA 4UFJA 1WW7A 1L7LA 2JX9A 4RQPC 4XF0A 4AHXA 2UWAA 1NE4A 3U10A 1HQWA 2ZMKA 2PQQA 4MVTA 2ARXA 2Y0OA 4QX2A 4OZXA 4D6QA 1X9TA 3OBAA 4GD4A 3MW4A 2FD8A 4N43C 2D40A 4ES8A 3LSEA 1CR7A 3N4MA 5GJ6A 4M0NA 5FWEA 5KR7A 4AFMA 3JCIA 5CFCC 2EXKA 4NR1A 3C7HA 5BNNB 3KMHA 1AR83 2LROA 2VXRA 3MV11 5FZKA 5FYMA 2I2SA 1CWPA 1QGLA 1V6IA 3OBTA 3JD72 1VBC1 4ZU7A 1R1A2 2WWUA 4YGBA 2B8MA 1W6OB 3ZMOA 1A78A 2VTXJ 2ETEA 2VOKA 3AM2A 1D4VB 4N7IA 4QPYA 2HJIA 3O0WA 1ENQA 2ERFA 5GLVA 4E4SA 1FNYA 3AXEA 2EIDA 3NJXA 3R4DB 2CNAA 4J25A 5LEJA 4LORA 2IXKA 1WCUA 1R083 3W5MA 1GWLA 2EAKA 2WZR3 1JU4A 1ZBA1 1HQLA 1HQNA 1Z0HA 4LEJA 5FYCA 4MLOA 4AE2A 4N43A 2WO7A 3D82A 4FFFA 1QJU3 5FMDA 1GZWB 2W68A 3ZFGB 1LB2A 3KGLA 1IZ3A 4JDOA 4OCTA 2QQPA 1AR93 2FQPA 3KM5A 2BV4A 3WP4A 3ZYFA 1DQ5A 1BQPA 4GALA 3ZFFC 2JWPA 1JTZX 2VTXA 3I4IA 4AEMA 4XMAA 4C90A 4AVCA 3OGJA 1RUG3 1OLMA 1MS1A 4OUMA 2J22A 2D3RA 3LD8A 2PYTA 5FY4A 3WQ0A 5FXZA 2WS92 3LZZA 3UL2A 4RS5C 3ETQA 2PELA 3IWZA 4BIFA 3RPQA 4AQ2A 2VNOA 4HPKA 4FTBA 1B35C 3GYDA 1VAMA 4UOJA 4RGGA 2AENA 2VQTA 3FFQA 5ACA2 1VR3A 1WCSA 3HR9A 4KWKA 4E2SA 1CGPA 4XPVA 3MIGA 2ZEXA 3ECQA 1D2QA 2YU1A 2WNUC 5D8AA 4CCNA 2TNFA 3C8XA 4OULA 3J7LA 3ST7A 3WCRA 5BYNA 1XNTA 1LCLA 2W46A 1V9U3 3H0OA 5CFDB 2P3KA 5FXVA 2FDJA 3CF6E 4GXLA 3AJYA 3JBG2 4H3WA 3Q8BA 5F3CA 3M3OA 1RUG1 4FFHA 4QX1A 5BY5A 4A42A 4Z92B 3ACHA 5EYXA 1RUC1 3WNNA 3DUIA 2BFUL 2ZJCA 1VBD3 3N9NA 4PI2A 3R4UA 1NA1C 3SC7X 2W0XA 2DWRA 2TEPA 5KXEA 5HCBA 5ABJB 2AH2A 1BEV3 1LR5A 2JDZA 5IVEA 4DO0A 3R6SA 5IVFA 3AX4A 1DGRA 4IV3A 5CG8A 1RHI3 3OYWB 3EB7A 5HI0A 2V5DA 3L2HA 2JENA 1F8VA 2BRTA 4C0BA 3N7LA 3ZXAC 5JOYA 1ZBA3 1W6MA 1H1MA 2XKOA 1SPPB 4PBOA 3U37A 4RFT0 3WP6A 2YMZA 5IK8A 5B4XA 1C28A 1GZTA 1HB1A 2JDKA 4E4ZA 1IG3A 4F8AA 1VBE1 4PF5A 3S5AA 3MUZ1 4AQ6A 1WLCA 1GU3A 1S2BA 4B4QA 5IT6A 1G9DA 4BWOA 2D97A 1CZTA 2OQ7A 4GB31 1XYNA 2Z69A 4BLJA 2WKKA 2GALA 3O0XA 5L7OA 2DVFA 2WA4A 1F4HA 2RDSA 1GANA 4ORFA 4CUGA 2WA3A 2Q8CA 1DQ1A 1VAKA 4X6QB 2IXLA 3HN1A 2HWF2 2NP0A 2ZMLA 1NQJA 1PO11 3T0BA 2JG9C 1CESA 2QQKA 3SNMA 5T5JA 1J83A 2CYFA 2GC3A 3POFA 2RS12 2PA7A 5CB7A 3DPRC 5FUIA 1W6QB 3RVHA 5CISA 4OHZA 3AKPA 3NAPB 2DCKA 3BGAA 3TN91 4CDXC 1CAXA 1XSQA 3LAGA 3S6PA 1JYIA 4WVMA 3IAPA 2Y8KA 1ASJ1 1AJKA 1E57A 1JUIA 1QJZA 3P1IA 4W50A 5EXOA 3WLUA 4A7KA 4BPZA 3CJIC 3ZXFA 5B4NA 1YIPA 2XHNA 2QDNA 3FWEA 2D43A 5LW9A 4HANA 1CAVB 2VMHA 1OT5A 1U5YA 3JB4C 1K3IA 1AR71 5C3PA 1O3QA 4UWDA 2SBAA 4XBQA 3ETPA 1RUC3 3VBOA 4JGZC 1SLIA 2HLEA 4AOCA 1WA6X 1O8PA 3VBFA 4EN0A 3N7JA 4IESA 2Q1FA 3I3DA 2WNUB 1MZ5A 4AI3A 1MEC1 3MW3A 4GULA 2DUOA 3LWCA 1R082 5I93A 4MYEA 1I1EA 2WNUA 4MO3M 1O4YA 1TMF2 5LBEA 3ZSLA 3M1HA 5K9YA 3IAQA 1NY71 1QJFA 1QJU2 4AEDC 1S1AA 4TN7A 5IATA 2IFRA 2QCSB 1BBT1 5FXWA 2JE7A 4ASLA 1D4M3 4META 1N47A 1ENSA 1R093 2BYVE 2WT2A 2P34A 2D6OX 3FHQA 3R4SA 3LIHA 3OPWA 2MEV2 4JVAA 4P9WA 5DZGA 4LXLA 3OSDA 2WSVA 3RZKA 4CDQA 3SCHA 4A3ZA 2W39A 4UBGA 5DZFA 2DUQA 4M3CA 4XYXA 5EYYA 1GKBA 1NZIA 5J98B 1IS6A 1N1VA 1RUF3 4OLLA 3KHCA 3LOBA 1QF3A 5M0TA 2A7AA 2P3IA 5JOZA 3DXUA 2HWD2 4BJ0A 5IFTA 4WV8A 1Q8SA 4M3CF 1YO8A 2QQOA 2BJSA 3GZEA 1NLSA 5DAXA 2ZX1A 3ZPYA 5A3LA 3CQOA 2G19A 4JX0A 3SMHA 4AEDA 5AC93 1ZZ6A 2D6NA 2ZX0A 4UW4A 4CUAA 2ZOEB 1C57A 1ULFA 1YQ6A 4DMIA 1W6NB 3ZX7A 1AR62 4QMAA 4YW3A 4KGQA 4Y26A 1JZ5A 1RUF1 2E32A 2ZKNA 4LULA 1ND3B 5FUPA 3THTA 1YQ2A 3P3PA 3VBUB 2VH9A 1OH3A 1KXGA 2OUJA 2QQMA 3DYMA 3ZFFB 4AQSA 2E9QA 3IN9A 1H2KA 1CIWA 2PHTA 5BNOC 4OMCA 2ENRA 3MHZA 5KHJA 1APNA 1GZCA 3N7KA 2B9VA 2BEOA 4EE2A 1OF4A 1S0IA 2VMFA 2VOTA 4XQWA 5FRAA 5KC6A 1W0PA 1WBLA 1AXYA 3MPBA 3WCSA 2YB7A 4ATFA 2D5HA 2ZGQA 4B29A 5L7OB 1F35A 3AMQA 4V1PA 3ZIXA 2AZ5A 3VUOA 1RHI2 5DDJ2 2Z42A 5DZEA 1LNSA 1QJX1 2RDQA 4BQ5A 4NIHA 2R49A 1OOPC 1XE7A 1TE1B 1ZBA2 2BNNA 2HWB3 1ALYA 1ZX5A 4ZS2A 4MGSA 1DYPA 2BTVC 4UW6A 1FI2A 5A7WA 3VBUC 4KWUA 3VKNA 5CU1A 4MXVA 1OBNA 1S0BA 1UY0A 4JTNA 1VMJA 4NHYA 3RWNA 2ZS6B 2WC2A 3SH4A 1VBA2 2B39A 3T08A 4HOOA 2VBBA 2Z4FA 4AGGA 5IFPA 5F8PA 1QXPA 2E6VA 2BGPA 4NE9A 3ZVXA 4KG0A 4DRVA 4YRDA 4O7XA 5C3SA 1QHDA 2ADEA 1AYN3 5LB6A 4GMP0 4R4XA 2AEYA 3WW2A 4C0HA 3ZYPA 4DOUA 1KS5A 4CU6A 1UX6A 4PI0A 4ET7A 2WS91 3AKSA 3LCPA 4R9BA 5FCCA 1IQAA 1REFA 4IEYA 5FYBA 2Y33A 1TNRA 2QZ3A 3SH3A 4AAPA 2WAAA 2W94A 3I59B 4Z2WA 4JRLA 2H6BA 4PQQA 1X33A 2PAKA 3K3OA 1LESA 4H55A 3I2HA 3UGGA 2IXIA 5JI9A 1LOCA 4NPLA 2G9GA 1LOAA 5TSWA 4JZRA 1GBGA 5JOXA 3KCYA 4A7ZA 1QDCA 1UO9A 1ZRRA 2FZ1A 4IEXA 4HSJA 4GB33 2F4LA 1W04A 1UZZA 4L11A 5C8WA 5FPZA 1PIV2 2RDNA 3C7OA 2R1DA 1WZXA 2OVUA 2IXCA 1UOBA 1A34A 4BK5A 1GOHA 4LE3A 4DXSA 2ATFA 3P3NA 2VMEA 4NRMA 4ZZ8A 4H7MA 1BCXA 3GXUA 1RJ8A 1OUXA 2TBVA 5EJ1B 2V4AA 3WZ1A 3VHNA 4EQVA 4F3JA 4AFCA 3HNMA 5LZ6A 2W1WA 1DLCA 2VQ0A 2WUHA 4KNCA 4XCAA 4CU7A 4NIDA 1QDOA 1AX0A 3HD8B 1SFPA 4Q8KA 4CEWC 4BH9A 2PMWB 3WNMA 2PN5A 3IT8A 1E5HA 3IDBB 3ZR5A 2ZGRA 4UXAA 1MQTA 4OQ9A 3BALA 5FYYA 4I3PA 3VBHC 5JZGA 4QQHA 4Y4YA 1TME3 1X8MA 2R062 3ZOIA 5T5PA 1J3QA 4GMP1 4PLMA 1I5ZA 3BTAA 1CQ9A 2JDYA 5CG9A 3WDYA 3ZYHA 2OIIA 3BIEA 3GHNA 4BB3A 4XEZA 5HCHA 4KH9A 4LKDA 2RDRA 4FOYA 1JOPA 2IXHA 4MGYE 3VN4A 5A6QA 3IIIA 2NM1A 4YVWC 5FJKA 1VAVA 1PVC3 2ARAA 5CZKA 3H42B 2JEMA 3WUCA 2DTYA 4YPJA 3AMMA 1SLBA 1UIJA 1C5HA 1KQRA 1X8EA 4HK8A 3VLBB 3WW4A 1DYOA 3I2GA 1I5PA 2WJSA 3S7IA 3WF3A 5L19A 5H9PA 4LUMA 3O1PA 5BNNA 4CDUA 3GBWA 1K42A 5F7UA 2VMGA 2X8KA 4IETA 5D21A 3FJSA 3HJRA 2CDOA 1GR3A 5C4WA 1N1SA 3ES4A 3NAPC 4MZUA 4QM9A 3O1MA 2F4PA 3N35A 1J59A 3APBA 2DBNA 1QJX3 5FP4A 3FFZA 1ASJ2 4HN0A 2WIIB 2ZHNA 4E4DX 1OC1A 4IL7A 4KU7A 4L97A 2W47A 1I3HA 1EPWA 2VGDA 4DEQA 4Q4X1 1XSRA 3T2OA 1COV2 1UYPA 1RUD3 3ZN6B 2W3JA 2GU9A 1UU5A 1VPHA 3K75B 3N9PA 4QWNA 5C3RA 3H8OA 2JG8C 2QQWA 2VZRA 3RJ2X 4IEUA 5AVPA 4IV3C 4CTEA 4X8NA 3K51A 2J1EA 3WQBA 4N7UA 1EP0A 1RUI3 2NZ9A 1XNAA 3OUIA 4QB1A 3RYKA 4LA2A 2PXJA 4TLFA 3V0AA 3CDZB 4ATEA 2IXJA 2WLPA 1W8TA 3HT1A 3JUUA 4N8MA 4YW6A 1ZVFA 2WZR1 1FPN3 3TEWA 1Y4WA 2BVBA 3VZOA 2BOIA 4L92A 2E53A 4A4AA 4LO5B 1KJRA 2R7EB 2GP3A 3C7EA 1SEFA 5FMBA 3KD4A 4NIAA 1PZ7A 1WWYA 3MPPG 4RGAA 1Q3EA 1VBC2 5FZ9A 5FYVA 1GQHA 2DCZA 4CDQC 4XBLA 4FTSA 4CCJA 1UY4A 1BEV2 2XVKA 2JDHA 2MEV1 3AZXA 1Q56A 2RJKA 2Y6KA 4RR3B 5EJZB 4Q4V2 4BQ2A 4FPLA 3POEA 4HVRA 1HV0A 4Z07A 1QQP2 2HWC3 5LK7B 2RHPA 4K1YA 1R091 4AF9A 3VHOA 5A3MA 2VZ3A 4ES9A 3VBSA 4FPHA 3ZFEC 4XXAA 4OHWA 2WSUA 4XTPA 3VBSC 4U36A 2Y6GA 1WD4A 4Q0PA 3QOPA 5KXBA 1FOD3 4LBLA 1K5MC 2JDAA 3OB8A 2QQVA 4UFHA 2XQRA 4JGZA 3LA7A 2NYYA 4YZ4A 2C5DA 4IV3B 5JSOA 5LCWL 4XJ8A 1X9PA 1C8M2 4HONA 1CZSA 4CCOA 4QX3A 2ORXA 4S2FA 1FMD3 4BQ4A 2BPA2 3HT2A 2WN3A 4I09A 2HWF3 4G3YC 4GMP3 1ZZ8A 4IEZA 5FZ1A 3TRSB 3I59A 1W06A 2GAUA 1OD3A 2DVAA 2IUWA 2VUCA 5FP9A 3RFRA 3WDUA 1Q8QA 3ZSMA 2DF7A 2RS13 2P17A 3H3ZA 3VDDA 3ZN5A 4IEQA 3CO2A 3E6BA 4PQ9A 2FCVA 4GJZA 5HPOA 1XNKA 1EY2A 1XOYA 4P9GA 5K0UC 4HMZA 1BKZA 5FO7B 2WO1A 2B45X 4XFHA 2X5IA 1H2NA 3PTYA 1RXFA 4MOAA 3VD4A 3WNKA 1PGW1 5JAXA 2QJVA 3OF1A 1JH5A 2VO5A 1ZZ9A 4LBNA 4AGVA 1RUC2 3RDIA 5CVRA 1Q8VA 2O8OA 4RHV3 1LGNA 4XJUA 3U4XA 1AR91 5DABA 5K8SA 1UMIA 3QD6A 3VBFC 3PTRB 4Z1VA 2OT7A 3AP7A 4R8HA 4AG4A 5FAXA 1CZVA 4FVVA 4CP1A 4XBNA 1G8WA 5T50A 3PVBB 1AL0G 3M70A 1TMF3 5FZ4A 4DS0A 2VPVA 2ZZJA 4CP0A 4BM8A 4Q4Y1 4WZCA 1RMU1 1Z7S3 4XDPA 3WNPA 3CJXA 4URTA 4CYDA 4OHYA 1DGRN 4L2NA 1C1LA 5DUVA 4ASKA 5KXDA 4RGKA 4HG6B 3E6DA 4RHV2 1R092 3WOGA 1U5IA 4ARXA 3VBSB 3X29B 1ZBE2 4O9GA 2MEV3 2DUPA 4Y1ZA 5D8AC 1V6NA 4EWEA 2PLV2 2XB6C 3I3QA 5E6HA 4CDWC 2R071 1D4M1 5J7MA 3RZGA 1XB9A 3LB9A 1VRH3 4LOSA 1OA2A 5FR3A 3C2UA 4E4HA 4ZHNA 3B7MA 3D3AA 2PHRA 1GOGA 3GCXA 3PUHA 2A6XA 4QM8A 2DU0A 4D8MA 1KRIA 1A8MA 4FPFA 1LHUA 1UYYA 3M3EA 1MZEA 1QXJA 1HW5A 3VL8A 5GM0A 3UT0A 3HMYA 2VQUA 3DN7A 2VBPA 1HB2A 1X82A 3K2OA 4CDUB 1AF9A 4Q29A 3BTXA 1GWKA 2BGCA 2YY1A 4UFKA 2PHFA 2Q30A 3SISA 5L36A 1XYOA 4PJYA 1MVEA 1DF0A 3MIDA 1UZVA 2XH6A 3FLRA 4XUTA 1CN1A 1WMEA 5AFEA 1POQA 5JR7B 3V64A 3MIHA 5E8AA 1S0FA 3NJYA 3T1MA 2WO2A 4OMDA 5HXVA 2AGSA 3SQOA 1SHWB 4IQPA 2JXAA 4M3CB 5FY1A 4LK6A 3KV9A 5C33A 2VULA 3IMNA 1JZ7A 5FK8A 3FE5A 3EXUA 2HEVF 5G04L 3KSCA 2ZTNA 3IDEA 5FXXA 3UESA 4PF1A 5FV3A 1NT0A 2JJ6A 1V6KA 5LWBA 1G9CA 4CRQA 4RL7A 4IEVA 5E1RA 3VKFC 2VR4A 2ZKLA 1GUIA 3LPGA 4Q0VA 3TAYA 3BIWE 4AVSA 4IE0A 2W87A 4Z8BA 2Q5TA 3K48A 5F6LB 2D44A 4B1LA 2PLV1 4K9SA 1W6QA 3H1WA 2GC1A 4CU9A 2BBAA 2YPJA 1XRUA 3PUQA 4A3XA 4LIUA 3VBRB 4D94A 2VC9A 1WMXA 5E88A 3DPRB 2XJUA 4MXWA 5ERLA 1WW5A 4NPRA 5A7SA 2G4IA 5F39A 2R1BA 1OHFA 2JG9B 1JS9A 5CNAA 3GHMA 3GNEA 1K12A 4Q4Y2 4TSVA 1SLAA 2VM9A 4L99A 5JXJA 4HVQA 1XU2A 1RINA 2DU1A 4XE9A 1SLLA 3KWVA 5JOWA 3POWA 4NMIA 1G7YA 3D0SA 5CFCB 2ILMA 2EIBA 2XQXA 1O3TA 5FY8A 2G9FA 2VMDA 5IK5A 1UX7A 2CSGA 2WWSA 1X36A 2ZPXA 1HX6A 1UYZA 3NV3A 4YM1A 2VZUA 4IXLA 4I0WB 3U75A 3ZXKA 1CAWA 3OOXA 4MHUA 2VXJA 2FHRA 1ZNPA 3DXTA 1RHI1 1H0BA 4MADA 4P9XA 5JPMB 2DVDA 1OKQA 2B7YA 3MF6A 2XJVA 3KT4A 1G86A 3SLIA 1H6XA 2AC1A 4FQZA 3UKTA 4LKEA 4D7YA 3OPZA 5FKBA 5L9RA 2FBEA 1ND2A 2G1MA 4XF4A 4XDQA 2LALA 3TEXA 3TYJA 3H8XA 1YWKA 1NCRB 5IVYA 1WGPA 5F37A 5JVVA 1GP4A 3HBKA 5BNNC 5DAWA 3LQCA 4IV1C 2NN8A 5FZAA 5FWJA 2OZ6A 3FHAA 4QGNA 1MEC3 4E8DA 4Y22B 1NCQB 2C9AA 1UKRA 1AR61 1VALA 1PIV3 4KG8A 2XXZA 4L8QA 2WNVB 1LODA 4JGYC 4BQ1A 3O1TA 4Q4W2 3B3QE 3O1SA 3Q8CA 1S2KA 1V00A 2Z5WA 1FPN1 5J96B 2XR4A 1SDDB 5A6ZA 2E51A 1VB2A 1LAJA 2OYZA 2H0BA 3LOIA 1UZWA 3V0AB 3U14A 2RR11 2MHFA 4AEKA 1G9FA 1S0DA 4Y20A 4BK4A 4NAMA 2OA2A 5FBJA 1PGSA 2YXSA 2A3YA 2VNGA 2QQJA 2ZGTA 4EV0A 2I07B 5F9TA 2Y0IA 1ND3A 3KV6A 2PAEA 3HAGA 3WW3A 4CDXA 1RUD1 1Y9QA 4Q1PA 3NNLA 4LBOA 3MFAA 1OVSA 2A71A 2R063 1ZBE3 2VW2A 4ONUA 4OUEA 4FCAA 2P3JA 4BU2A 1N3OA 4XQDA 3A23A 4OI4A 3MIBA 4COYA 5ISLA 2GC0A 3J26N 2JIJA 3MF9A 3FHIB 4HPKB 4FPCA 4XJ9A 1EV11 3D0JA 4XHXA 3RMXA 3SXWA 5KHGA 3BVCA 1E5SA 5A32A 2ZA9A 1XNDA 5A70A 5FLIA 1LOEA 1FV2A 1RUJ1 5FY0A 1XE0A 1RYYA 5A32B 2WS93 5HV0A 3POSA 3IDAA 3FZ3A 1YEWA 3ZN6A 3PNAA 1KITA 3L2YA 2I74A 4Y5TA 2XVGA 3UK9A 3WT3A 4AXOA 1MVQA 1FT9A 2JD4A 2YBKA 2R30A 2VUJA 1SFNA 2BU9A 4DXTA 4B4RA 2IFWA 5CBLA 4PBPA 1AUYA 5ACA1 3IB3A 3T2QA 1R1A1 2WWJA 2GNMA 1VRH1 1CAXB 4PIZA 1W9TA 5E16A 1ASJ3 1ENRA 1NXD1 1ZA4A 4DFSA 1RB8G 2XUMA 1ZRCA 4OI0A 5K4LA 4JHZA 4AVTA 4L0PA 2X53S 1UPSA 4JGZB 1P8JA 3HQRA 1RUD2 3L9JT 1JUHA 3RZZA 3KGZA 1W9YA 4UFLA 2K9ZA 4MGKE 3PU3A 1VBD2 5I0TA 2MNGA 5C5UA 1UU6A 5IAXA 1KDKA 2WBKA 5FO8B 1RUI2 5BUVA 4YVSA 5JI7A 4KU8A 3WF2A 2XG3A 4YVSB 5I0UA 2Y34A 3U4SA 1FPN2 4HBNA 2VBDA 5BNPC 2PHDA 1EAH1 1QH6A 4EN9B 2RS51 2GH2A 4AAXA 4CEYB 2NQYA 2OKXA 2FCUA 3D6EA 2KR2A 2QTWB 2VL4A 4CZSA 2K46A 1GICA 3KLSA 4ZXKA 4P9JA 3N7MA 1BJQA 2YC2A 5C3OA 1RITA 3WDTA 3ZM8A 3M3CA 1V6OA 5IAVA 1R64A 4RN5A 2WINB 3HOBA 1U5XA 1O91A 5T5OA 1J3PA 1DBNA 1LU2A 3WF1A 1IKQA 2Q1MA 3IZOA 4N90A 1NA1B 1LENA 1NOVA 3W5NA 5BNOA 1DU3D 2XONA 4CU8A 2BGOA 3ZDVA 3V0BA 2BWAA 4HT1T 5F6KA 1T2XA 1WMDA 4A45A 2JDUA 2ZZQA 1XE8A 1REDA 2WQ8A 1QQP1 2CWMA 2VOWA 3VDDC 1BMV1 3MO4A 1QQP3 2HWC2 3OGGA 5FK7A 4QPIB 1CONA 5FBZA 5KHKA 5C71A 4LLFA 2HWF1 1IG0A 2J1RA 2LS6A 2UWCA 1EUUA 1W2AX 4GJYA 4XIOA 5DUWA 1M06G 3ZXGA 4J6GA 1WCDJ 2ZBJA 3PLQA 3TEZA 5FPXA 3O7OA 2OZJA 5LY2A 3AKRA 4MGQA 3KVAA 1CIYA 4A7YA 2TUNA 3R0RA 5FYHA 3M2MA 2A70A 1OMIA 4RHV1 5JIAA 5DUXA 5C6CA 5JIUA 3EBRA 1MEC2 1UQXA 2VUAA 5FPVA 4YZ3A 3MBWA 1C8M1 4QAWA 3WVJA 3VDBA 1W0OA 3ZFFA 1NLQA 5LA9A 5DN2A 1ZRFA 1SDWA 5IK4A 4XVHA 2WNOA 1F2NA 1H8TA 2GDFA 4YWAA 2PAMA 1H8TB 4BMBA 2XL7A 1OQEA 2GNBA 3ZXEA 5I0RA 1O3RA 1X7NA 2Z2SB 1BVVA 4YW2A 4A41A 3SCFA 2J1AA 4M4PA 3RSJA 3GGLA 2GZWA 3AP5A 4IEPA 1BK0A 1HXS1 2WFPA 1DQ0A 2VZTA 5JCTA 2FDFA 2A3XA 2BOJA 1QJY1 4CEWA 4YZ2A 3WF0A 1V70A 1W28A 4CEYA 3NVCA 4ZZ5A 4QXCA 1C1FA 5FY5A 3WNXA 4WBBA 2D7FA 4LOTA 1REEA 1LGCA 1YQCA 2VZSA 1HRV2 4X8PA 3K4DA 3OBRA 5GZCA 1R1A3 3T4VA 2VCBA 3HPNA 2YU2A 2ARBA 1VE0A 3OEAA 4LHNA 3UKNA 3MIEA 4RYDA 1K45A 1LJ7A 3ILFA 3H7JA 4U2AA 5ABJA 2D5FA 4AFBA 1RUF2 4ITCA 4ISQA 4K21A 2ADDA 3AK0A 2CAVA 1US2A 2DVGA 3U78A 2YG0A 1JYCA 3OD4A 4P14A 1AHSA 3QACA 1B35A 1Z7S2 3VBRA 1DIWA 1J1LA 5AC92 1W2UA 4JHTA 2V5YA 3AP6A 3MYXA 3VBUA 1XNBA 4FTEA 1OSGA 1HB4A 2ZGSA 2JB8A 1SLCA 2XJRA 4Q4X3 5FYUA 5GALA 1AR63 4P00B 4W4ZA 1YJLA 2RMU1 4XJAA 4INDA 2G9ZA 4QPWA 4MGIE 1OURA 1OLME 2W52A 3VL9A 1C4RA 1NXMA 5CFCA 1G9BA 4K20A 2J1UA 1PO22 3POBA 4M3CE 5A7OA 1SLTA 1GNYA 3KVBA 1RUE1 4ZONA 2OXBA 1MS4A 5EJ3A 3ZSJA 3AMPA 5FZ6A 1QXRA 5L7OC 1X50A 1NY72 2PQSA 1XYPA 5I91A 3Q8FA 3I2IA 4QPGB 1CAUB 4I02A 1AXZA 1U12A 4CXXA 1UCXA 1VBA1 1PK6C 4UT5A 4XAEA 2GC2A 4XFGA 1UD1A 3W9AA 5JSRA 3AKTA 3OEBA 3H7YA 1D7PM 4JKMA 4X6RB 3WY6A 1N3QA 5IK7A 3B69A 3AL6A 2A1XA 3ZSKA 4FBFA 3K46A 3LFIA 3BOPA 1FYUA 4GKYA 4RQPB 2HYXA 1POV0 1KD7A 1N3PA 5FMCA 4PLNA 5C9AC 3E6CC 1ND3C 2E31A 4FP2A 2P6HA 2XL9A 3J9SA 1KS4A 3AXDA 3RJRA 3ALQA 5FDBA 3ZFEA 1OH4A 3VBHA 1TZOA 3DV8A 2HWD1 3A21A 1FOD1 1RUOA 4YLZA 3GCWA 4S2HA 4YZ1A 4LUKA 3GZAA 5B2GB 1DP0A 4NRPA 5ABJC 5I8TA 2Y26A 2ZHMA 4JKLA 3KV5A 4ASMB 4YM3A 3BUCA 5GZEA 2JKXA 2GNDA 5FOBB 1AYN2 1QJEA 1N1YA 3BN6A 2CWSA 1XQNA 2WT0A 3UETA 3AP9A 1QJY2 4S2GA 2HWC1 3ZYGA 1ULDA 2N7GA 2HWE3 5IUQA 1AYM2 4AR2A 1J84A 1OPMA 4LO4B 1O59A 4Y1VA 4J1WA 1U0AA 3OG2A 1LHNA 4Q0UA 3PVOA 1A3KA 1R1ZA 3H3UA 5DUUA 4AYUA 2WNEA 2XJPA 2YZ4A 3VKOA 1U5ZA 1AL22 2XBO2 1RUH1 3I2JA 2DDUA 1H2MA 2RS33 1T6GC 3CJIA 1C5IA 4XCBA 4OVEA 2ZGNA 2OPWA 4JQRA 3RZJA 3MLKA 3CJIB 3UJQA 3DKWA 4CDQB 1LOFC 3SHRA 4RFRB 2XJQA 4GB32 3AJZA 4XIKA 1JU3A 3IPVB 5FP7A 1OD5A 3V0BB 4BQXA 5FZHA 4WM8C 1S0EA 1UZ0A 2JG9A 3TOJA 4Y33A 2P2KA 1AX1A 2CHHA 5LEKA 1ULEA 4W6XA 4M00A 2O1QA 3KV4A 2XWBB 3VD3A 4JDNA 2VNRA 1DHKB 1SACA 2A75A 5BNPB 1K5JA 1UNBA 4QKDA 3RYRA 4CP9A 1AYN1 2J1TA 3LSDA 3VDDB 4XTMA 3MZHA 2AR6A 5GLTA 2C9KA 4LBMA 5FZFA 2WFF2 1YUDA 1LTEA 2LW8A 3TN92 2A6VA 1ZRIA 4KBBA 4YGDA 2ES3A 4A44A 2X29A 5EIYB 1ST8A 2O0OA 4B1MA 4BXFA 4CCDA 2QDRA 5LA1A 2R042 4TXWA 5KHHA 2J1SA 3OY8B 5A3TA 1AJOA 3FBMA 4COVA 3CIHA 4R9DA 2HYKA 4Q4W3 1CAVA 1Z78A 2LTNA 5JPNB 3AMHA 4GIQA 4Q8LA 3LEIA 2UYBA 3VBOC 5FZ0A 5G05L 4XUNA 1BHGA 3I3EA 5H9QA 5APAA 1ND2C 4D69A 4K6BA 4CA9A 1OQDA 3AKQA 1JN2P 1OA4A 2V72A 1JHNA 1D0HA 3JQWA 5A3WA 1Y7BA 3RI8A 3O1RA 1H30A 1AXKA 1NX9A 4MHRA 3ZYRA 3MLJA 5FKCA 1DQ6A 1YFYA 2QVSB 5T3NA 2R6QA 2W2IA 1FAYA 5CFDA 2VZQA 4CEWB 5A7WB 4I3GA 4N53B 1VMFA 3AVSA 1QEXA 3B94A 3N9QA 4AFDA 4TTGA 1ZA7A 2HEYF 2HWE1 1BXHA 1WLWA 1YQ8A 5JSPA 2CGNA 1GNHA 4LBKA 1HRV1 5C8CC 5HCFA 4WVWA 2D6LX 4LE4A 4XZPA 1L7RA 2DURA 3GALA 3OBZA 4G9SB 4NHMA 4O61A 5CAZA 1BBT2 5FYZA 1PO23 3HEIA 2BWCA 3NV4A 1COV3 2V09A 5IWFA 4NWVA 2UY8A 2NMNA 3O12A 1QU0A 3AVRA 5JXHA 2HWD3 4K3UA 1O7FA 3VHPA 4QQ2A 1JYVA 2WN2A 5IVBA 2VUDA 4LBQB 3WUDA 2BUKA 5DG1A 3WD5A 2AUYA 3I2KA 2ZX3A 4LHKA 2GMEA 4JKKA 3BU0A 4DUVA 1QWRA 2JE9A 3WXPA 1Y9GA 4QDQA 5DAPA 1DLLA 1O4TA 4D6SA 4NWWA 4I2OA 1YJKA 1KDMA 2NMOA 3LPFA 4NUBA 4UBHA 1WLDA 2VZOA 2H6CA 3AP4A 5GLUA 3SITA 2OS2A 4QX0A 3NMBA 3KT7A 4WZFA 1SCRA 5L9VA 1VBC3 3AFGA 2C6SA 1RIRA 2IWGB 5CKMA 4NOTA 5F5AA 1XJAA 4D6RA 1MZFA 1EV13 2YC4A 2F17A 3BPZA 2VY0A 1C3HA 2X10A 2RS11 4K8FA 4CCLA 4E27A 3J7MA 4QX5A 1IGOA 4Q4V3 1ND2B 4RQPA 1PO12 1QJY3 5FZIA 4DEVA 1ZBE1 1CJPA 4QQOA 1Q8OA 3LKJA 2EXHA 3PDQA 3UJOA 4ARYA 3CZJA 4EN8B 1JXNA 2EVXA 4CEYC 4FAHA 1LEDA 4HLTA 2QE3A 2X5IC 3BPSA 5FZ8A 1OXCA 2XMLA 1GFF2 5FJHA 4YG3A 3THDA 4BQWA 5A33B 4W6WA 2VTFA 1N1TA 4Q0SA 3NNGA 1RVF1 3VB9A 3E97A 3VD9A 1RUNA 3QBQA 4DY3A 1W0NA 5CIRA 4QDRA 2RS32 4CVUA 2V4VA 1MS9A 1GNZA 3PMEA 1YYNA 3VKMA 1NG0A 1SBEA 1AR73 3WQ1A 1LECA 4EJRA 5F3IA 2VZVA 3J7NA 1HN1A 2RM21 3ACFA 4XFBA 4P9IA 4IGQA 3ATGA 4HL0A 1FMD2 2O14A 1AVBA 1V6LA 4PCRA 3LA2A 1MR5A 2XVLA 3OD0A 2R073 4I0AA 4QQLA 2JDPA 3SCGA 2VMCA 5J37A 4HKOA 4TLGA 3OY8A 1JBCA 4Z82A 3HNBM 4BYYA 3U0ZA 4QDSA 4ZKTB 4LBQA 2B5HA 2P1BA 4PDWB 4BDVB 1NQDA 1OOPA 3AFKA 1DGLA 2A6WA 2VJXA 2ZEZA 5FMOL 1FATA 3VZKA 4YG6A 1VBB1 1H1AA 2EAAA 3UV9A 4UAPA 3K77A 5D1IA 2ZX4A 3RZHA 3WG3A 2YHJA 3PU8A 1PGL1 1ODMA 3AMNA 5FMOS 4CP2A 1I6XA 1W2NA 4QXKA 5I0SA 2R043 1F5JA 5C7GA 2JDNA 4PIXA 2RS31 1F31A 4FOWA 3LA3A 1W8UA 1HRI3 3VBRC 1GLHA 3SKJE 2ZGPA 1UOFA 1KJLA 2XLGA 2R0HA 3WNLA 3B93A 1YHFA 3CBNA 2WZR2 4P02B 3JZVA 1OQ1A 3MFCA 4FI9A 4FT8A 5FZOB 1VBB3 3G7DA 3T1LA 3C7GA 2IC1A 2XHKA 3O1OA 3H3LA 4E2QA 4CPBD 3I97A 3N3HA 1YC61 3OGSA 4XFCA 4BIOA 2JDMA 5FPAA 1PNGA 4NJ4A 2AEZA 3K4AA 1YI7A 2PLV3 5JWPA 1COV1 3O1UA 3S30A 2Y38A 1H8TC 1VRH2 2VAUA 2EIEA 1BBT3 4DXZA 2ZXQA 4IE4A 1PHMA 1H4HA 2UU8A 4YVWA 5F5CA 5BPXA 1EPZA 2DTWA 2D3SA 5SV8A 5F2SA 3E5QA 3RYPA 4O65A 1Y3TA
chains in the Genus database with same CATH topology
3TNQA 3MGUA 5KBFA 3T2TA 4CDUC 4JTOA 4NVPA 1ULCA 4KQ7A 3E5UA 2UYAA 2GH8A 1NCRC 1PVXA 1TNFA 1YCIA 2RE9A 2HWB1 2BW8A 3ZIWA 4XFAA 4DPNA 3BODA 5C9AB 1TME1 4M0HA 1JW6A 4RA0A 4Y1YA 2Z79A 1RUE2 2WNVC 1WUVA 2C1FA 4AW7A 2VG9A 5DXDA 3FX3A 1IOAA 3I8TA 1TQ5A 1UIKA 3GBFA 3EHKA 4LBQD 4W65A 2VVFA 4BHPA 1NZCA 3NWKA 1RC6A 2PFWA 3RG0A 2BFUS 4N9IA 3NV2A 2UY9A 4XW3A 1RTVA 4XHBA 3WDVA 2MPFA 3HWJA 4DINB 4SBVA 1WW6A 3GZUC 2BNMA 2D6PA 3KS7A 1MQTC 1POV3 2BBVA 4MSVA 4HETA 1LRHA 4Q4Y3 2VVDA 4B8EA 1IS4A 2E63A 4O9EA 1XNCA 2W08A 4HZFA 3M4FA 4LO7A 2OUHA 1VIWB 4E2GA 4CDWA 1LOFA 1OA3A 1UF2C 5BNOB 4YVWB 3IPVA 3CEWA 1AYM3 1ULGA 4YZ5A 3VZLA 4BLIA 4XOGA 2YV8A 5LK5A 2LM3A 1NCQA 2PHXA 5T5LA 4K40A 4MX3A 5EWSA 3AZZA 3USSA 4Y1XA 3AZYA 1FOD2 1RGSA 3H1MA 5T54A 3RRDA 4WM7B 2GSYA 4LA3A 1LKNA 1C8M3 1V9U1 3WQ7A 2KA3A 4AI0A 3WINE 1J1TA 1UN1A 3ASIA 3KCXA 3U11A 2DYCA 3PVEA 3WDXA 1V6JA 3TWIA 2QUOA 5FFOC 2XWJB 1EAH2 4YFWA 2Q1ZB 5EZWA 5I8SA 2YUEA 3THPA 3NW4A 4PDWA 3ZYJB 4FP3A 4XILA 1QOTA 1QKQA 1YIFA 4G4FA 4AHZA 3S0MA 4LBJA 2VW0A 1F9KA 2OW4A 2WFF3 4N53C 1W6PA 3I2DA 1D2SA 1NYWA 2R061 1GV9A 1QNWA 1QOOA 2YROA 2A73B 3KZ4C 5F5QA 5C8CA 5F1RA 2D98A 2ZCWA 4AFAA 5GKAC 3FLTA 1Q8PA 1CGPA 2RJLA 1D4M2 2OPKA 2QNKA 3ME2A 1Q5OA 4DY5A 4FAGA 3OCPA 5HBAA 1QH7A 3JD73 3VGIA 4S2DA 4DNYA 4M01A 4B3NA 3EJKA 4QPGA 1BZWA 4PIYA 3KT1A 3PVNA 2H0VA 3ZXJA 2PTMA 4GKXA 2AYHA 4XFIA 4K1ZA 5JMCA 4YVSC 2PHLA 3I7DA 1UMZA 3AYEA 2CTVA 1PK6B 1LU1A 1Y43B 2RS53 3HIFA 2VVEA 3ZFGC 4AVVA 1DZQA 4QPIA 4RD7A 4B7EA 2QKDA 4AI2A 4D7SA 4XF9A 4HSLA 4YNIA 1LHOA 4CDXB 2XBO1 2CY6A 1GZWA 3RNSA 3EO6A 4Q0QA 1O5UA 5AFBA 1AR81 4ZU5A 3M3IA 5GZGA 2UWBA 2CGOA 3ES1A 2JECA 2FZ2A 2WLQA 3A0KA 3LGRA 4JAAA 3A4UA 2ZX2A 4JV4A 4IEWA 3RI9A 4QQPA 4BCUA 5ACA3 1UAIA 1WD3A 3OYWA 5K0UB 3NL1A 4Q2FA 2YGLA 3I54A 3NSTA 3VHRA 2A6ZA 4DRRA 3SH5A 1G6NA 2A3WA 1V9U2 4KGGA 2ET1A 2ZAHA 1H9PA 3PMSA 5LRSA 1NLRA 3ZXLA 2KXLA 1L3JA 1VBA3 3IM0A 4FO9A 3VBHB 1G9AA 4JCKA 3KCCA 1YNAA 3NJZA 4AK3A 3FC0A 1NE6A 3J8F1 1SFYA 4A2UA 4YSFA 1PO13 1ENXA 1BEV1 2D93A 4XJWA 1BVP1 3QCWA 3BU7A 3HQXA 2PHWA 1DDLA 2ZHKA 1MS8A 3RS6A 4XF1A 4B7KA 4YW1A 3PJYA 2EXJA 4NHKA 5FLJA 4JDMA 1WW4A 3W58A 2EA7A 4LO8A 4IV1A 1HV1A 2EF6A 1PM7A 4BZ4A 1LOBA 1PIV1 1HRI1 1POV1 5JLVA 1DQ4A 4AHYA 4SLIA 4UW3A 3O0VA 1LHWA 4D7TA 1D0GA 2XGXA 3JD71 3AYDA 2R041 4OHXA 1LULA 3MW2A 1S55A 4GQ7A 4JRAA 3WV6A 4QPIC 3NKGA 4EROA 2QFEA 3J8F2 1ZYBA 2DV9A 4GH4A 2EIGA 4OI2A 2B42B 3GBGA 1NCQC 3ZN4A 1H1IA 1CX4A 5KC5A 3ACLA 1MZ6A 2F6BA 2VU9A 4Q26A 1NCRA 1VJ2A 2RR12 2ZGUA 5L73A 1TME2 2RMU2 1WBFA 1HRV3 4YW4A 4LLOA 4LHLA 1TMF1 3WHUA 4FPOB 4Y22A 1DQ2A 1DZTA 1QNYA 1SMVA 4XFFA 4AVBA 4YW5A 1HRI2 1OOPB 4K7JA 2UURA 1QMJA 3WG4A 2WT1A 2VOXA 1PVC2 4N9HA 4WM8A 1DGWA 3U07A 3D8CA 1RUH2 2RS52 1IS5A 2K0GA 1VBB2 4FPKA 3IDCB 2D3PA 3FLPA 2BVVA 4FPEA 1W6NA 1PGL2 1XXNA 4MGZE 4HFSA 4Q4X2 2XJSA 3WW1A 2XKPA 2V73A 5GLZA 2XPJA 1A6CA 3AZVA 4H14A 4NN0A 1UKGA 2BNOA 4XQ4A 1MS5A 4Q1RA 1QJU1 2CV6A 4R4ZA 3V56A 2ET7A 5FLHA 3H50A 4RR3C 2Q4SA 4AVAA 1AZDA 2JKBA 3E5XA 4COUA 3DPRA 4MXWB 1KFUL 1B35B 1GYKA 1RMU2 4TZDA 4YG0A 3TNPB 3M7AA 2XJTA 3ZFEB 5A33A 5C4WC 1CD3G 3JB8A 1CPNA 1CJDA 4JGYB 1VB4A 3H8UA 1GZ9A 4EWDA 4JGYA 5DDJ1 2ZMNA 3A0NA 1H8VA 4RR3A 4COWA 1OI6A 3PHMA 3BOWA 4OHVA 3QLQA 4RSUA 3CNAA 2ZAAA 3ZDSA 1W39A 4P5HA 3DL3A 4AEJA 4QPGC 4EN7B 3CL1A 4RS5B 1S0CA 2ZGKA 2GN7A 2VECA 4EWAA 3USUB 5DDJ3 4R52A 5KWRA 4PDWC 2HWE2 2ZABA 2ZGMA 3USUA 2HWB2 2QZ2A 2RM23 4R9CA 5JZGC 1S0JA 5C8CB 4COZA 5D8AB 1VBE3 1AL23 3C3VA 4OI1A 2IZWA 1VP6A 3B00A 2R0FA 5CADA 5HCAA 1RJ7A 1KFXL 2C0ZA 2JG8A 4C1WA 4HVOA 2Q8OA 4WM7A 4YGEA 4NO4A 4AI8A 3AZWA 4I01A 4BA6A 1J3RA 1H9WA 5AVAA 3ZMNA 2I45A 1J58A 1GSLA 1LHVA 2E7QA 4Y5Z0 4MV2A 1ZRDA 3MICA 5FTTC 4AWDA 2YC0A 2FMYA 2Q0AA 3J8F3 4QT6A 5EV7A 5FQ0B 1HLCA 1BMV2 1PZ8A 1HKDA 2KM2A 3RMYA 4GWMA 4XF3A 5J48A 3JBG1 2RR13 4N43B 2VMIA 1ZRFA 1H4GA 4J1XA 3ZYIB 3S7EA 4QHBA 1BYHA 2O8QA 1YXWA 2RMU3 3CU7A 2PHUA 3B02A 1UW8A 1YFXA 3FBYA 5EFUA 1UZYA 3WDWA 1MS0A 4DQAA 1EAH3 4FOVA 2P37A 2WQ4A 2ZGLA 3ENRA 4YM0A 1UPIA 4F83A 4AHWA 1A8DA 3JU9A 1SCSA 1K5MB 3WG1A 4AQTA 2CL2A 4Q4V1 1YFWA 1K5MA 3NO8A 3FUQA 2GMPA 2ZACA 1TEIA 2VQAA 3PJQA 4BMEA 2GNTA 5BV6A 4YM2A 2B46X 3R05A 1RUG2 1R081 2R16A 1UL9A 4QGLA 4UW5A 2HEWF 4KWLA 4EN6B 2VOVA 3ZFGA 3ZO0B 4AEDB 1F5FA 4AI3A 1BK1A 4QGMA 4WVVA 4L9BA 2VW1A 1O3SA 1FXZA 2HKXA 2NPIA 1RMU3 1Z7S1 2XLAA 3DGTA 3FMGA 1H2LA 2JICA 2CAUA 1QJX2 1RUJ3 5FQ0A 1B09A 3NKTA 3IIAA 4OFGA 2DCTA 1SQ4A 2WQZC 3W59A 4CDWB 3JBG3 1YI9A 3V65A 5GZFA 4W6YA 4C1XA 1PO21 1MACA 4MUVA 3Q9OA 1ZZCA 3B01A 4XXPA 1WLTA 5FO9B 5FREA 4DZGA 2DVBA 4HK9A 1RL3A 1ZM1A 4QU2A 2JG8B 3GF6A 4GH4C 1QY4A 1OPOA 1CAUA 4LNVA 2RM22 1MQTB 5JZGB 1RVF3 3N36A 1PVC1 4P9LA 1PNFA 5DG2A 2DCJA 2K2SA 4Y1UA 5I8YA 1ZREA 1O5LA 3MEPA 5E89A 2FMDA 4YFZA 1VBE2 1WA4A 2E7AA 2A6YA 1QOSA 3B5LB 3D5OA 3NAPA 4D3WA 4PLOA 3BB6A 4Q27A 1V6MA 1S0GA 1LGBA 4RS5A 1AR72 1AX2A 3ILNA 3KQRA 3D4KA 1PGW2 1LEMA 3J4UH 1GQGA 1DFQA 1WCKA 1W6MB 4FPGA 2R072 3G6JB 5BXXA 1IS3A 1FX5A 3GZTB 1HXS2 4KL1A 3RQ0A 4XMIA 3WHTA 5C4WB 5LRRA 1IPJA 1Q43A 1OLQA 2XBO3 4N53A 4YARA 5KHIA 4F7ZA 1M4WA 2DCYA 2XLFA 4FXGB 5J36A 2WNVA 4TYSA 1IPKA 1DYKA 1MS3A 2ZHLA 3VZMA 1DG6A 3QH7A 1YRZA 1EYBA 4Q4W1 3IBMA 1NA1A 3VZJA 1IKPA 1PMIA 1LOGA 2WZPP 4BE3A 4DB5A 4XETA 1DZRA 2D6KA 1OLRA 3TN93 4P9YA 3IKWA 2GN3A 1VLNA 3MIFA 4GWNA 3ZSEA 2GMMA 4IEOA 1W6PB 5K7PA 1YLLA 4BOWA 3WP3A 5H9RA 1AR82 5BNQA 1ZZ7A 3MI8A 4E9KA 1JOJA 4NHLA 3AB0A 1ZZBA 5T52A 3O14A 3VBFB 3WX5A 3OJBA 4C91A 1FV3A 3AYCA 5SV5A 1WMFA 4GH4B 5GZDA 4AGRA 3BCWA 3MDPA 1RUH3 2E7TA 2B9UA 3WG2A 3TB0A 5C9AA 1HDKA 1AR92 3MLLA 3H1YA 4WVMB 5JDBA 1W6OA 3ILRA 3WR0A 1RUJ2 3HBZA 3M3QA 3EQEA 1YFUA 2YGMA 3JQXA 3OTFA 2EXIA 2DFBA 4WM8B 1RUE3 1ONAA 1VBD1 5J09A 5H9SA 1OFSA 2LUWA 4LO6B 2A5ZA 3URFA 3KB5A 4FXKB 4HKLA 4Y20B 5AC91 1FNZA 5K0UA 4FPJA 1CVNA 4MH0E 2X5IB 2DFCA 3QH6A 3INAA 4GA9A 2WL1A 4QD2A 4FPYA 1RVF2 5CFDC 1UU4A 1AL21 4LT5A 3ZXDA 3POYA 4TWTA 3VZNA 4FQ4A 4R9AA 1RUI1 3AYAA 5GLWA 2SLIA 1DGWX 1EV12 4FOQA 1O4ZA 1PZ9A 1CAWB 4OUSA 4H7LA 5FOJB 2R32A 4JC1A 4YYOA 3VV1A 4HKWA 5BNPA 3CLPA 2YDEA 2WFF1 3FUOA 4ISRA 3M8LA 1HXS3 4I30A 4LTAA 2AREA 1PK6A 1FMD1 1HIXA 1OFNA 3ELNA 5CA6A 2YYOA 4FSJA 2NLRA 4XJZA 4B4PA 3H9AA 4KWJA 1I9RA 5T55A 4ZU4A 3VKLA 3O5SA 3ROUA 1IHMA 1URXA 4WM7C 4Y24A 2CGPA 2ZGOA 4IV1B 4LR4A 3NV1A 4HN1A 4WVZA 3WP5A 3TBDA 3B9CA 2EALA 1CPMA 1SBFA 3B9IA 3DF0A 1C8NA 5KXCA 1XU1A 1SBDA 5J3UA 4IERA 3UKVA 3VBOB 4AI1A 4YGCA 1AYM1 2BQPA 2D6MA 1WW7A 4RQPC 2JX9A 4XF0A 4AHXA 2UWAA 1NE4A 3U10A 1HQWA 2ZMKA 2PQQA 4MVTA 2ARXA 2Y0OA 4OZXA 3MW4A 4N43C 2D40A 4ES8A 3LSEA 1CR7A 3N4MA 5GJ6A 4M0NA 4AFMA 3JCIA 5CFCC 2EXKA 4NR1A 5BNNB 3KMHA 2VXRA 1AR83 2I2SA 1QGLA 1V6IA 3OBTA 3JD72 1VBC1 4ZU7A 1R1A2 3ZMOA 4YGBA 1W6OB 2B8MA 3AM2A 1A78A 2ETEA 2VOKA 1D4VB 4N7IA 4QPYA 2HJIA 3O0WA 1ENQA 2ERFA 5GLVA 4E4SA 1FNYA 3AXEA 3R4DB 5LEJA 2CNAA 2IXKA 1R083 2EAKA 2WZR3 1HQLA 1HQNA 1Z0HA 1ZBA1 4LEJA 4MLOA 4AE2A 4N43A 3D82A 1QJU3 1GZWB 2W68A 3ZFGB 1LB2A 3KGLA 1IZ3A 4JDOA 2QQPA 1AR93 2FQPA 3KM5A 3WP4A 1DQ5A 1BQPA 4GALA 3ZFFC 1JTZX 3I4IA 4AEMA 4XMAA 4C90A 4AVCA 3OGJA 1RUG3 1MS1A 4OUMA 2D3RA 2PYTA 3WQ0A 2WS92 3LZZA 3UL2A 4RS5C 3ETQA 2PELA 3IWZA 4BIFA 3RPQA 4AQ2A 2VNOA 4HPKA 4FTBA 1B35C 3GYDA 1VAMA 4RGGA 2AENA 3FFQA 5ACA2 1VR3A 1WCSA 3HR9A 4KWKA 4E2SA 4XPVA 3MIGA 3ECQA 1D2QA 2WNUC 5D8AA 2TNFA 4OULA 3ST7A 5BYNA 3WCRA 1LCLA 3H0OA 1V9U3 5CFDB 2P3KA 3CF6E 4GXLA 3AJYA 3JBG2 4H3WA 4Z92B 3M3OA 1RUG1 5BY5A 5EYXA 1RUC1 3DUIA 2BFUL 2ZJCA 1VBD3 3R4UA 1NA1C 2W0XA 2DWRA 2TEPA 5KXEA 5HCBA 5ABJB 2AH2A 1BEV3 1LR5A 2JDZA 3R6SA 3AX4A 1DGRA 4IV3A 5CG8A 1RHI3 3OYWB 5HI0A 1F8VA 3L2HA 2JENA 4C0BA 3N7LA 3ZXAC 5JOYA 1ZBA3 1W6MA 1H1MA 2XKOA 5IK8A 4PBOA 3WP6A 4RFT0 2YMZA 1C28A 4E4ZA 4F8AA 1VBE1 4PF5A 4AQ6A 1WLCA 1S2BA 4B4QA 5IT6A 1G9DA 4BWOA 2D97A 4GB31 1XYNA 2Z69A 4BLJA 2WKKA 2GALA 3O0XA 5L7OA 2DVFA 2WA4A 1GANA 4ORFA 2WA3A 1DQ1A 1VAKA 4X6QB 2IXLA 3HN1A 2HWF2 2NP0A 2ZMLA 1NQJA 1PO11 2JG9C 1CESA 3SNMA 5T5JA 2CYFA 2GC3A 2RS12 2PA7A 5CB7A 3DPRC 1W6QB 4OHZA 3AKPA 3NAPB 2DCKA 3TN91 4CDXC 1CAXA 3LAGA 3S6PA 1JYIA 4WVMA 3MZHA 1ASJ1 1AJKA 1E57A 1JUIA 1QJZA 5EXOA 3WLUA 4A7KA 4BPZA 3CJIC 3ZXFA 1YIPA 2QDNA 3FWEA 2D43A 4HANA 1CAVB 2VMHA 1U5YA 3JB4C 1AR71 1O3QA 2SBAA 4XBQA 1RUC3 3VBOA 4JGZC 1SLIA 3VBFA 4EN0A 3N7JA 4IESA 2WNUB 1MZ5A 1MEC1 3MW3A 4GULA 2DUOA 3LWCA 1R082 5I93A 4MYEA 1I1EA 2WNUA 1O4YA 1TMF2 3ZSLA 3M1HA 5K9YA 1NY71 1QJU2 4AEDC 1S1AA 2IFRA 2QCSB 1BBT1 2JE7A 4ASLA 1D4M3 4META 1N47A 1ENSA 2WT2A 1R093 2BYVE 2P34A 2D6OX 3R4SA 4I0BA 4JVAA 4P9WA 2MEV2 5DZGA 2WSVA 4CDQA 3SCHA 2W39A 4UBGA 5DZFA 2DUQA 4M3CA 4XYXA 5EYYA 1GKBA 5J98B 1IS6A 1N1VA 1RUF3 4OLLA 3LOBA 1QF3A 2A7AA 2P3IA 5JOZA 2HWD2 4WV8A 1Q8SA 4M3CF 1YO8A 1NLSA 2ZX1A 3ZPYA 5A3LA 3SMHA 5AC93 4AEDA 1ZZ6A 2D6NA 2ZX0A 4UW4A 4DMIA 2ZOEB 1C57A 1ULFA 1W6NB 3ZX7A 1AR62 4QMAA 4YW3A 4KGQA 4Y26A 1RUF1 2ZKNA 4LULA 1ND3B 3THTA 3P3PA 3VBUB 2VH9A 2OUJA 1KXGA 4AQSA 3ZFFB 2E9QA 3IN9A 1H2KA 1CIWA 2PHTA 5BNOC 2ENRA 5KHJA 1APNA 1GZCA 3N7KA 2BEOA 1S0IA 5FRAA 5KC6A 4XQWA 1W0PA 1WBLA 1AXYA 3MPBA 3WCSA 4ATFA 2D5HA 2ZGQA 4B29A 5L7OB 3AMQA 4V1PA 3ZIXA 2AZ5A 3VUOA 1RHI2 5DDJ2 2Z42A 5DZEA 1QJX1 2R49A 1OOPC 1XE7A 1TE1B 1ZBA2 2BNNA 2HWB3 1ALYA 1ZX5A 4UW6A 1DYPA 2BTVC 3VBUC 1FI2A 3VKNA 5CU1A 4MXVA 1S0BA 4JTNA 3RWNA 2ZS6B 2WC2A 3SH4A 1VBA2 2B39A 4AGGA 1QXPA 2E6VA 3ZVXA 4KG0A 4DRVA 4YRDA 1QHDA 1AYN3 4GMP0 4R4XA 3WW2A 4C0HA 4DOUA 3ZYPA 1KS5A 1UX6A 2WS91 3AKSA 3LCPA 4R9BA 5FCCA 1IQAA 1REFA 4IEYA 1TNRA 2QZ3A 3SH3A 3I59B 4Z2WA 4JRLA 2H6BA 1X33A 2PAKA 1LESA 4H55A 5JI9A 2IXIA 1LOCA 2G9GA 1LOAA 5TSWA 1GBGA 5JOXA 3KCYA 4A7ZA 1QDCA 1ZRRA 2FZ1A 4IEXA 4HSJA 4GB33 1UZZA 4L11A 5C8WA 5FPZA 1PIV2 2R1DA 2OVUA 2IXCA 4LE3A 2ATFA 3P3NA 4H7MA 1BCXA 1RJ8A 2TBVA 3WZ1A 3VHNA 4F3JA 4AFCA 4KNCA 2VQ0A 1QDOA 1AX0A 3HD8B 4Q8KA 4CEWC 4BH9A 2PN5A 3IT8A 3IDBB 2ZGRA 4UXAA 1MQTA 5JZGA 3BALA 4I3PA 3VBHC 4QQHA 4Y4YA 1TME3 1X8MA 2R062 5T5PA 1J3QA 4GMP1 4PLMA 1I5ZA 3BTAA 1CQ9A 5CG9A 3WDYA 2OIIA 3GHNA 4XEZA 4KH9A 4FOYA 4MGYE 2IXHA 3VN4A 2NM1A 4YVWC 1VAVA 1PVC3 3WUCA 2JEMA 2DTYA 3AMMA 1SLBA 1UIJA 1C5HA 1KQRA 1X8EA 4HK8A 3VLBB 3WW4A 2WJSA 5L19A 3S7IA 5H9PA 4LUMA 5BNNA 4CDUA 3GBWA 2VMGA 2X8KA 4IETA 3FJSA 1GR3A 5C4WA 1N1SA 3ES4A 3NAPC 4MZUA 4QM9A 1J59A 2F4PA 3N35A 3APBA 1QJX3 3FFZA 1ASJ2 4HN0A 2WIIB 2ZHNA 4E4DX 4IL7A 4KU7A 4L97A 1I3HA 1EPWA 2VGDA 4Q4X1 1COV2 1RUD3 3ZN6B 2GU9A 1UU5A 2JG8C 3RJ2X 4IEUA 5AVPA 4IV3C 4CTEA 4X8NA 3K51A