4QPGA

Crystal structure of empty hepatitis a virus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
225
structure length
225
Chain Sequence
PVGAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTFPITLSSTSNPPHGLPSTLRWFFNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTPWVEKESALQIDYKTALGAVRFNTRRTGNIQIRLPWYSYLYAVSGALDGLGDKTDSTFGLVSIQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNSNAMLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
total genus 37
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12944 HAV_VP Hepatitis A virus viral protein VP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgA00
1FMD3 1C8NA 2RMU1 1VBE1 1POV3 4Q4Y1 5C9AA 5BNPA 1RMU2 1RUD2 1RUF3 1GFF2 1A6CA 5AC91 1OOPC 3ZFFC 4AEDC 1ND3A 5GKAC 1COV2 1HRV2 1PGL2 4CDQA 1FOD2 1K5MB 1F8VA 2MEV3 3VBRC 4N53C 1ASJ2 4WM7C 3JBG2 4LLFA 1QQP2 5J98B 4RQPB 2R073 1ZBE2 2BPA2 1MEC1 1RB8G 5CFDA 1NCQC 5ABJC 4Q4W3 1BBT1 1HXS3 1BMV2 1POV0 1CJDA 2X5IC 1MQTB 1QJX3 2RS51 4CDWA 2HWF1 5K0UC 4CDXB 1TME3 4GH4C 1VBD1 1X36A 2RMU3 1VBE3 2RM23 4Q4Y3 1HQNA 1NCRB 4YVSB 3CJIC 1QJY1 2RR12 5AC93 1OOPA 3ZFFA 4AEDA 1RHI2 1W39A 3DPRB 1AL23 2BUKA 1H8TC 3VBRA 4N53A 4WM7A 4Q4V2 1FMD2 3VBSB 5J96B 1F2NA 1HRI3 1VBA1 4RS5C 1EAH1 3FBMA 4GB32 4JGYB 1MEC3 1NCQA 1RUF2 1R091 1ND2C 1VBB1 1NG0A 5ABJA 5JZGC 3VBFB 3JB8A 4YVWC 1PIV1 5BNOC 1AR61 2X5IA 4WM8C 5K0UA 3VBUB 2RS53 4CDUB 2HWF3 1D4M1 1RVF1 3NAPC 3ZFGB 1WCDJ 4GH4A 1AYN2 2DF7A 1QJU2 1VBD3 1RUH3 1NA1C 3CJIA 1V9U2 3TN91 1QJY3 1PGW2 4Q4W2 2Y26A 1HXS2 1H8TA 5ACA1 2ZAHA 1QJX2 1VRH3 2ZZQA 2RS31 3HAGA 1TME2 4EJRA 5JZGB 1VBA3 2HWB2 1RUG1 1RUE2 2RMU2 1K5MC 3VBOB 4NWWA 1VBE2 4RS5A 4Y5Z0 2RM22 4Q4Y2 1RUJ3 1AR91 4IV3B 1ND2A 1R093 3J8F1 1E57A 1VAKA 5JZGA 1QJZA 4RQPC 2WLPA 2WFF2 4YVWA 1M06G 1AYM1 5BNOA 1PIV3 5BNNB 1AL22 1AR63 4WM8A 2HWD1 3NAPA 3JD71 1D4M3 1RVF3 1HRI2 1NA1A 1MQTC 3TN93 4CDXC 1MEC2 2WZR1 1NCRC 3LOBA 1AR71 4YVSC 1NOVA 2R063 2BFUL 5ACA3 5FMOS 2RS52 2HWF2 2GH8A 4CEYB 3DPRC 3ZXAC 3M8LA 1K5MA 4IV1B 1RUG3 1VBD2 1RUH2 1R1A1 1AR93 1B35B 1PO21 3VBSC 3J8F3 2FZ1A 1AUYA 4RQPA 1VBC1 2PLV3 1ZBA1 1PVC1 1AYM3 4JGYC 1B35A 2TBVA 1VRH2 2HWD3 3VBFC 3JD73 4RR3B 1PO12 1AL0G 1VBA2 1RUI1 4JGZB 5FOJB 1MQTA 4Y4YA 1RUJ2 3VBUC 4CDXA 4CDUC 3ZFGC 4QPIB 1FOD1 3VBHB 1NCRA 4RHV2 4YVSA 1ASJ1 2BBVA 1AR73 1BEV1 3JBG1 1PIV2 1QQP1 1AR62 1RUC1 1ZBE1 2HWE1 2WS91 4QPGB 1D4M2 3DPRA 4PDWB 3VDDB 1SMVA 4N43B 1R1A3 3VBSA 5L7OB 1BMV1 1PO23 5DDJ1 1X33A 1BBT3 1VBC3 3VBOC 1ZBA3 1PVC3 4JGYA 4IV3C 2MEV2 2R062 1DDLA 5ACA2 1R081 4Z92B 3VBFA 4Q4X1 2R041 2R072 1RUI3 1IHMA 2RR11 5BNNC 3VBUA 4GMP1 4CDUA 3ZFGA 1AR92 2XBO1 2PLV2 1FPN1 3ZFEB 5C8CB 4Q4V1 1AYM2 1BEV3 2RS11 1RUC3 2HWC1 2HWD2 2HWE3 2WS93 4GB31 3JD72 1EV11 1RUF1 4BCUA 1EAH3 5A33B 1VBB3 5AC92 4RFT0 4CEYC 5DDJ3 3VBOA 4IV1C 1AR72 4IV3A 4CEWB 1B35C 5CFCB 1AYN1 1QJU1 1Z7S1 5D8AB 4NWVA 1R083 1V9U1 4Q4X3 5A32B 2R043 5BNNA 2RR13 4GMP3 1NY71 1R1A2 1HXS1 4RR3C 1PO22 1TMF1 2XBO3 4JGZC 5C9AB 1BBT2 1VBC2 2IZWA 5BNPB 1ZBA2 1QJX1 1FPN3 1PVC2 5LK7B 4Q4V3 1VB2A 2RS13 2RS33 2HWB1 4QPIC 1C8M1 1RUE1 5C4WB 1ND3B 3VBHC 2HWC3 2RM21 4GB33 4CDQB 1EV13 1RUI2 4FTBA 1AR81 2WFF1 1QJY2 5C4WA 4QPGC 4CEYA 1AL21 4PDWC 4IV1A 1VB4A 3VDDC 4N43C 5CFDB 2ZTNA 1BEV2 5L7OC 1HRI1 4GMP0 1AYN3 1Z7S3 1QJU3 1RUC2 1RMU1 1RUD1 2HWE2 2WS92 1V9U3 2QQPA 1OPOA 4CDWB 1EAH2 4FTEA 1COV1 1HRV1 1PGL1 1R092 4RR3A 1VBB2 1TMF3 4JGZA 5DDJ2 2WZR3 1OOPB 3ZFFB 4QPIA 4AEDB 2HWB3 3VBHA 1C8M3 1RUE3 2BFUS 1RVF2 1RUH1 1R082 3S6PA 3ZFEC 4Q4X2 5C8CC 2R042 3VBRB 4N53B 4FTSA 4WM7B 3TN92 1AR83 2WFF3 4QPGA 4FSJA 4PDWA 3VDDA 2XBO2 4N43A 1FPN2 1NCQB 1VRH1 5L7OA 1PO11 5ABJB 2RS12 2RS32 2HWC2 1RMU3 1RUD3 1RUJ1 1RUG2 1EV12 2X5IB 4CEWC 5K0UB 1RHI1 5CFCC 1COV3 1HRV3 5D8AC 4GH4B 4RHV1 3J8F2 1FOD3 4SBVA 3CJIB 1ASJ3 1FMD1 3JBG3 1QQP3 1POV1 1ZBE3 2VQ0A 1Z7S2 5C9AC 5BNPC 2WWSA 3ZFEA 5C8CA 1H8TB 2FZ2A 5C4WC 1ND3C 3IDEA 1NY72 4CDQC 1OHFA 1TMF2 2MEV1 4RS5B 5FMOL 2GSYA 2R061 2WZR2 5A33A 3JB4C 1ND2B 1HX6A 1PO13 2R071 1C8M2 4YVWB 5BNOB 5CFDC 4CEWA 4WM8B 2XPJA 5CFCA 1PGW1 1RHI3 3NAPB 4Q4W1 1CD3G 2PLV1 5D8AA 1AR82 4RHV3 5A32A 1NA1B 4CDWC 1TME1
chains in the Genus database with same CATH superfamily
1FMD3 4XAAA 1OVPA 3AP6A 1BQPA 1C8NA 2VQAA 3RI9A 3NKGA 1POV3 4WVMB 4Q4Y1 1W9TA 2XQXA 4GJYA 1AVBA 4YM0A 5FPXA 5BNPA 4XBQA 3OJBA 2WINB 2PYTA 2ADDA 1RUF3 4V1PA 2W52A 5F5AA 1X9PA 2I74A 1ODMA 3AB0A 4AAXA 4A7KA 4QAWA 1COV2 1WA6X 2G19A 3HOBA 4NHXA 4EWDA 3P5BA 4MGQA 1PGL2 3BI3A 2BGOA 1C1FA 1FNYA 1FYUA 1W3XA 3A0NA 4XZPA 4I3PA 5E6HA 4AQ6A 3BKZA 3T09A 4HVOA 3GBWA 2WN3A 4NOTA 1LCLA 4LLFA 1OUXA 2F17A 4AI0A 2B46X 4ZU5A 2PELA 3WF0A 3T2PA 1LHVA 4NHLA 4Y1XA 3VKFC 5CFDA 3WDXA 4HPKB 4BQYA 2HBTA 2D5FA 4XFIA 1I6XA 1UIKA 4YNIA 2EALA 1HLCA 1H2NA 4E4HA 4XXAA 1OI6A 1RGSA 2ENRA 5FZKA 4QX8A 2X5IC 4LBLA 1MS0A 1CIYA 4BM8A 3J4UH 4ARYA 2C0ZA 5CG9A 4BLJA 4EWAA 5J3UA 5FLIA 2KD7A 5FZAA 1ZZBA 2DUOA 2D3PA 2RM23 3ILRA 1D0GA 1NCRB 3CJIC 4FPOB 1QJY1 3OSDA 5CKQA 3CQOA 2YZ4A 1LULA 1OOPA 2A75A 2NMOA 3KQ4B 5EIYB 5E1RA 4AEDA 1SFPA 2A6YA 3AKRA 1UOJA 2DVGA 2QQUA 1AL23 1SBEA 2I07B 2WKKA 4XFAA 3W5NA 2BERA 1EUTA 5FTTC 3W9AA 2WJSA 4KBBA 1CX1A 2A3XA 2PHDA 1FMD2 5J96B 1HRI3 3QH7A 3CNAA 3EO6A 4QXBA 5IK7A 4ZS3A 5CAZA 2IXKA 4P00B 1DZTA 1UKRA 3KVBA 1YQ2A 2CWSA 3S57A 3GCXA 1MEC3 1NCQA 3GJAA 1RUF2 1N1YA 4LHNA 4BQ3A 4E2QA 2IUWA 2HEWF 4FAGA 3I3DA 2GAUA 3E6BA 1Z78A 2JDPA 4GXLA 4KWLA 3VBFB 5JZGC 2CGPA 1S0BA 3FC0A 2XL7A 3ME2A 1BHGA 4XHBA 1PIV1 5BNOC 5FDBA 5IK5A 4CUBA 5I0TA 3B69A 5DN2A 3B7MA 2O8QA 1RXGA 4YW5A 1WCSA 5K0UA 2A1XA 2RS53 4JAAA 1G86A 3TAYA 3ZFGB 5JLVA 1UY2A 1HN0A 1WCDJ 3AZVA 3OPWA 1PNGA 1AYN2 3WNKA 1W9FA 1UY3A 4NUBA 1AZDA 1RUH3 1DQ1A 2JKBA 1H9PA 1JTZX 3THTA 5A7PA 4FQZA 1GANA 2UWAA 4WZCA 3SITA 1ZX5A 2HH9A 2Z79A 2OZ6A 1DQ2A 1Q8SA 3POIA 1OC1A 3AZZA 1UPIA 1XYOA 3I2DA 4NROA 2K46A 1WMDA 5JPMB 1H8TA 1HQLA 2JD4A 1IPJA 2VE1A 4GALA 3K4ZA 4FVVA 5FYTA 5JZGB 4YGCA 4A7YA 3WF4A 4D6SA 3V0BB 1VBA3 4ZZ8A 1RUE2 3WG3A 3ZN5A 4CCOA 4NWWA 3TEWA 2CHHA 2RM22 3F95A 3POGA 1JU3A 4K3UA 1CAWB 4QXKA 2A6XA 1ND2A 1J1LA 1R093 1J59A 1VALA 1C57A 1S0IA 4ONUA 5L36A 1H6YA 4YVWA 1Q3EA 3I7DA 1ZZ8A 3P3PA 2YGLA 4MGZE 4PF5A 1AL22 2RG4A 1ENSA 1AR63 3A4UA 3K4DA 4OVEA 4XDOA 5LRSA 3G6JB 4PBOA 2HWD1 4OQ9A 4Z2AA 4YGBA 2H6CA 2OW4A 1CZSA 2VUJA 2VO5A 4GKYA 4Y5TA 1JYXA 1HRI2 1XRUA 3R05A 5GZDA 3N7KA 4JTNA 1H8VA 2JJ6A 2ETEA 2VZ3A 4XILA 2JE7A 3TN93 4CDXC 1MEC2 4PCRA 3OY8B 1SLTA 4B7EA 4YZ1A 4MGSA 4NPMA 3O5SA 5FQ0A 2VUAA 4B7KA 3WLUA 4Z82A 3GF6A 4YVSC 2Y34A 4AGVA 3J7HA 3E6CC 3FN9A 3KF3A 1ZRFA 1VE0A 5FBJA 3ON7A 1W8UA 4LKFA 2JG9A 5ACA3 5I0RA 5FMOS 4HT1T 4ORFA 2RS52 5T52A 5KHJA 1ZVFA 4EN7B 1X8MA 2QQIA 4CEYB 3AYAA 2RDNA 3AMPA 4XFCA 4CP1A 3M8LA 5GZEA 1K5MA 2B5HA 2W2IA 3AM2A 4MX3A 1RUH2 3HBZA 2ARXA 1QKQA 2GZWA 3APBA 3WV6A 1NUKA 4K6BA 1AR93 3GGLA 5C5TA 2WO7A 2IFWA 1WLDA 2QQJA 3J8F3 3JUUA 4RQPA 2PLV3 2WO2A 1IKQA 4BYYA 3OB8A 4FO9A 5HI0A 3DECA 3U14A 1DHKB 2JDHA 4QPYA 3WX5A 5FFOC 4P02B 3MBWA 5FJKA 4LT5A 2QBXA 4NIIA 1OD5A 3JCIA 1VBA2 1RUI1 1RINA 4HMZA 3ABZA 4QKDA 5FOJB 1PZ9A 1MQTA 4Y4YA 4H2AA 5CKNA 3VBUC 3J9SA 2PHLA 4QDQA 5FBZA 1KRIA 5LCWL 3CBNA 1DGWX 1W03A 4HANA 4M00A 3RPQA 2I45A 2VJXA 1QEXA 3WQ1A 3V0AB 4NIAA 4RHV2 2NPIA 1Q8VA 1AR73 1BEV1 3JBG1 4OUSA 1L3JA 1YQCA 4JRAA 1AR62 2B39A 1D4VB 3VZNA 3HBKA 5CKMA 4YWAA 3PUQA 4XQDA 3DPRA 1N1SA 2DCZA 3T1LA 3ECQA 4PDWB 4YM2A 4CCLA 5C70A 3VDDB 1GMMA 1L7RA 2DBNA 5IVBA 3CU7A 1R1A3 1KGYA 1OLME 1XE0A 3ACGA 4M01A 4PIZA 5DUXA 1QY4A 2J1EA 1JOPA 4K21A 3BU0A 1PMHX 4MYEA 5IVEA 1ZBA3 2BP6A 2D6OX 3RYPA 4AHXA 2DV9A 3H1MA 3T0DA 1PVC3 4JGYA 1C5IA 1QU0A 1H4GA 2QZ2A 2R7EB 3ZR5A 2EAAA 2IC1A 2LW8A 2YBKA 4S2FA 3I2KA 4AGGA 5ACA2 5IVFA 1R081 4Z92B 4JC1A 4DINB 2Q0AA 1H4HA 1SFYA 4XETA 5LA0A 4C91A 2RR11 3AKSA 4Y4RA 4DOUA 1LAJA 2JG8B 2Q30A 4GMP1 1ULPA 2NLRA 1TVGA 2JB8A 2QTWB 1AR92 3LGRA 1DF0A 1JS9A 3KS7A 4X6QB 3ST7A 4W8JA 1WBFA 2XBO1 4P08A 2ORZA 2O14A 2XXZA 4QX5A 2PLV2 3ES4A 1LHWA 3GZAA 5C3OA 4XDQA 1STMA 3KT1A 4R4ZA 1ENXA 3WOGA 3MF6A 1SLBA 4QB1A 2LM3A 1W8HA 2XL9A 2QDNA 1DGWA 3PUIA 4QGNA 4CPBA 2WZPP 4K9SA 4Y22A 2XUEA 4XF3A 2A7AA 3RFRA 4GB31 3LPFA 4QXHA 2P4EA 3ACIA 4QM8A 1WZXA 2V73A 1H9WA 3OPTA 3ZN4A 2F6BA 1YEWA 3ZYPA 4D7SA 2RE9A 5D21A 3OYWB 2ID4A 1DQ5A 4GKXA 4UW3A 5LBFA 1G9DA 2J1RA 2CY6A 3KLSA 4IV1C 4JDOA 3B9CA 3ZXFA 1LB2A 5FZGA 1IS3A 4FOQA 3BB6A 2YY1A 4Q0QA 2JE8A 1AR72 4NHYA 4CEWB 5C5UA 4FT8A 3DL3A 2DU0A 3N7LA 2X05A 3DUIA 3LEKA 2WC2A 4PLMA 2VQUA 4E4DX 5JI9A 1V9U1 5B4NA 1E5IA 2X8KA 3JU9A 5A32B 3WP5A 3KSCA 3QCWA 2CU5A 4C1WA 3E6DA 4FBFA 5BNNA 1JZ5A 2FD8A 3WCRA 1QH6A 4QX3A 3IMMA 3MYXA 1GQPA 3O1MA 4MGTA 1NY71 1OD3A 1R1A2 4QHZA 5A80A 1HXS1 4RR3C 5HXVA 1GNZA 2IXHA 3ACHA 3P1IA 1TQ5A 3A0KA 4JGZC 4R9AA 2WZ8A 3FX3A 2BU9A 1ZBA2 1QJX1 1FPN3 2QQWA 1WA4A 1OSGA 1PVC2 3AMMA 5EJ3A 3VKMA 1NX9A 5EHDA 1KJLA 1VB2A 4QPIC 1C8M1 4AFMA 1UW8A 2VMEA 2RJKA 1CN1A 4LA2A 3NRUA 2VTXA 3GBGA 1AJKA 3OBRA 2ZAAA 2X29A 2P2KA 2HYKA 5EJZB 4E27A 4DUVA 4FTBA 2ZACA 1QJY2 1VRBA 5C4WA 2UYBA 1WGPA 1I1EA 4AQ2A 2P3YA 5JOZA 4MADA 3OUIA 1ZZ9A 3A21A 1UOGA 4NVPA 2WT2A 1LNSA 2GU9A 2WWJA 2YDEA 4W65A 3W21A 3POEA 1UPSA 2IXLA 4N43C 5LBEA 4QDSA 2ZTNA 4FP3A 1ENRA 4LIVA 2VVDA 1LODA 4XJUA 5T50A 4GMP0 3J7LA 5HPOA 1QJU3 1Y4WA 3BUCA 5LRRA 1W6MA 1LGNA 2FMYA 1QWRA 5DAPA 3TNPB 5K8SA 2PN5A 2VVEA 4UWDA 4CDWB 3M3QA 5FUPA 1COV1 3NVCA 4GWMA 4AFCA 1J83A 4M0HA 1PGL1 5A3OA 4COZA 2LROA 4ASKA 4TN7A 3I8TA 3FJSA 1RL3A 4N7UA 2YFUA 2ERFA 3IDCB 1W6NB 4RGGA 2BZDA 2FMDA 3ZFFB 1GV9A 1LU1A 3UETA 2HWB3 3ZXJA 3VBHA 3OBTA 3T3YA 4CVUA 2W08A 2GC3A 2WIIB 3ZFEC 5AVPA 5FOBB 1IG3A 2QNKA 4JVAA 5FZMA 1YXWA 3J7MA 5FZ9A 2W1SA 1X82A 2WNUA 4WM7B 1W2UA 3ALQA 2DURA 1W8ZA 4QPGA 1JN2P 3C7OA 4HVQA 5KC6A 2ARCA 2WNVA 1UNBA 3ZYHA 5CEHA 1FATA 1UZ0A 1FPN2 3SH3A 3WW3A 1Y9GA 5H9RA 1VAVA 2EXKA 2XB6C 3V64A 3CO2A 4R9CA 3PJQA 4XIOA 5ABJB 4R9BA 4E8DA 2PHWA 3M4FA 2JDKA 4NE9A 1RUD3 4KGQA 4MXWB 1OLQA 4FI9A 3LDRA 5FYYA 5FZOB 5DQ0A 3USSA 1HIXA 5CFCC 2OQ7A 4YG3A 4OI4A 4CP9B 5JR2A 1HRV3 3KGLA 2QVSB 4BA6A 2H0VA 4I09A 4XJWA 3RGBA 4KU8A 4ZPIA 3MLKA 5I93A 4FPFA 1DLLA 3OGGA 2YU1A 4KU7A 1FMD1 5T5PA 3JBG3 5FYVA 2XQRA 3DYPA 4K1ZA 5FPUA 1POV1 2VQ0A 4F8AA 3EJKA 3MHZA 2YPJA 4IL7A 5JXIA 4JQTA 2E33A 4IEQA 1DQ0A 3HPNA 4B4RA 5C9AC 3N4MA 4CXYA 3Q8EA 1J3PA 1G9FA 1GNHA 1XSQA 2YYOA 4RYDA 2JB4A 4YW4A 3NMBA 1NZCA 2VMHA 4YZ4A 3RZJA 2Y8KA 5C4WC 3IDEA 1OQ1A 3POFA 3AP5A 5A3UA 2EVXA 3N9LA 4CDQC 1SCRA 3BYWA 3I3EA 3PHMA 5LK5A 1XU2A 5EZWA 2GSYA 1APNA 5L73A 1JH5A 4CP2A 3EXUA 3VDAA 2C9AA 1CIWA 2WSUA 4JCKA 3JB4C 4NPRA 1LESA 4JKMA 1LJ7A 5LATA 4Z8BA 1Y43B 3PVOA 3E5UA 5IVCA 1XBFA 2Z69A 3GXUA 4JDNA 2BQPA 1DQ4A 5FLJA 2W1QA 4QU2A 2XPJA 1F4AA 3OBAA 3SXWA 3NAPB 1UIJA 3H1WA 4M3CA 4IE7A 4XURA 1H1MA 2B8MA 1EUUA 3I2FA 2A5ZA 1OH3A 1XOYA 2OA2A 1SG3A 3H50A 5F37A 1NA1B 1UL9A 4LIUA 3DF0A 3UV9A 4QB6A 4GAZA 1ZM1A 1ZRIA 2D6LX 2WQZC 3MF9A 5LB6A 5A7NA 1HN1A 2ZGOA 4J25A 3VKLA 3AYDA 1MS5A 2TEPA 3JZVA 1WUVA 4GWIA 2J42A 1YUDA 2WDBA 2EXHA 1RUD2 3HIFA 2FDGA 1O59A 3M3IA 3NV4A 1CAXB 1GFF2 2PFWA 1A6CA 3H3LA 4XUOA 3U1XA 1XB9A 2XUMA 3T0BA 4BISA 2JE9A 2OPWA 1SPPA 3MIEA 1W6QA 3WNMA 5C3RA 1ND3A 3HMYA 5GKAC 3VZOA 4YZ2A 1HRV2 3T4HB 2P3JA 5FY0A 2NMNA 1F8VA 4LE3A 4UOJA 5FUIA 3OTFA 5L9VA 3VBRC 2D3SA 5DUUA 4N53C 4BQ4A 5CZKA 4FXGB 3JBG2 4RGKA 3MPPG 1OLRA 3B3QE 4H7MA 2Y0OA 4DB5A 3TEZA 4EQVA 2R073 1IKPA 1NAEA 2WBKA 4F83A 2VNGA 1MEC1 1YJLA 3U11A 1RC6A 3T2QA 1LTEA 1O3QA 3LFIA 2UU8A 3WD5A 1LGCA 1OMIA 5C7GA 2PQQA 3PUSA 4COVA 4NRMA 1JZ8A 1BBT1 1HXS3 2I2SA 3LEMA 1POV0 1W6OB 4IESA 4CXWA 4K7JA 1CJDA 3BPZA 4OHXA 1U5ZA 4FPLA 5BY5A 1QJX3 2RS51 2ZX0A 4YW7A 1H30A 3WINE 4BU2A 2D98A 2AGSA 1W8OA 3OG2A 4PLNA 1I5ZA 1Q8PA 3AP9A 4GH4C 3U4XA 1X36A 4LQRA 3I2HA 1WBLA 4BIFA 5CYYA 2UWBA 4AQTA 2ZGPA 4KNCA 1W3VA 3E1F1 4FPEA 5CNAA 4CU8A 1XYNA 2RR12 3PTYA 5AC93 5BNQA 2XLFA 1E5RA 4RD7A 1OA3A 2P37A 2E53A 2W68A 1W39A 2PXJA 4OUEA 3O0XA 4UFKA 5F5CA 4LPLA 5FWJA 5JUVA 4KGGA 2P6CA 1F35A 1Y9QA 2BUKA 5HCBA 4C0BA 3LEGA 4C8DA 4NIDA 2QKDA 4GD4A 2AC1A 3IPVA 5C8WA 4W4ZA 3VBSB 1F2NA 1VBA1 3WDWA 2W1UA 4DXSA 4TLFA 3PIGA 4RS5C 3T30A 4KH9A 1EAH1 2V72A 4GB32 1RYYA 5BYNA 5CB7A 3B01A 4HG6B 4R9DA 4LHLA 1R091 1DGLA 5A7SA 4LO7A 1VBB1 2AUYA 2WFPA 5T54A 1JXNA 5FAXA 3FHQA 4P9JA 3ZN6B 1G6NA 4X8NA 1W90A 2YROA 3CIHA 4JKLA 1PK6B 2R32A 1GOHA 3KMHA 5FPVA 3WNNA 1AR61 1GBGA 1BLZA 4GWJA 4OMDA 2X5IA 4WM8C 2Z42A 2GMEA 4FAHA 1WD4A 5ANQA 4CDUB 5JIUA 3LDKA 5LA2A 1QHDA 2FQPA 5EQUA 3WUDA 4MG2A 2DTYA 2RJ2A 3VN4A 3ZR6A 4BQ5A 1VBD3 3VV1A 4N8MA 1LU2A 5GLTA 4D7YA 3GZEA 4LHKA 1XE8A 4W6XA 3CJIA 1V9U2 3WP3A 3TN91 2K2SA 5GLZA 2SBAA 4IEXA 1WW5A 1UX6A 4QWNA 3T2OA 2VVFA 4CE8A 1TEIA 4JKKA 4QQPA 2SLIA 1PGW2 2C6SA 5I0UA 1L7LA 4U2AA 3T2TA 3WF3A 3T4VA 2VNRA 3WP4A 1HXS2 3K51A 1DGRA 2VZOA 5KBFA 3I59A 5ACA1 2ZAHA 1OQDA 2XJTA 1QJX2 3POSA 4AI3A 4EJRA 5FZBA 4PQ9A 4A41A 1YJKA 1TG7A 2ZGUA 3VBOB 4XOGA 4Y5Z0 2XGXA 1PM7A 3HD8B 2QUOA 3FE5A 3FFQA 3I54A 1AR91 4IV3B 2QCSB 4LUMA 2B42B 2WO3A 4O9EA 3O12A 4UF0B 3URFA 3J8F1 2R49A 2NM1A 2CGNA 5JZGA 1O4YA 1QJZA 2BVBA 4LBQD 1DZRA 2J1SA 4EWEA 5JCTA 2RVAA 3MGUA 1J3QA 1JUIA 2JKXA 2KR2A 5BNOA 3AFGA 1OA4A 1G7YA 2Q8OA 3OPZA 4LBQB 3WG4A 2DCJA 5FZ6A 2GN3A 2RDRA 1I9RA 2CDOA 4Y20A 4OULA 1UY4A 4HK9A 4HN1A 4AL9A 1SZBA 5HBAA 4ISQA 1OFSA 2OPKA 2K9ZA 2TUNA 4EYUA 5KXCA 2DFCA 4LXLA 3R6SA 2D3RA 4S2DA 4QPWA 2VC9A 4LBJA 3I2OA 2ZX3A 3ZMOA 3VHRA 1UMZA 4IEZA 1NCRC 2XG3A 1AR71 3LOBA 3DV8A 1NOVA 1GZ9A 3DEMA 2VBPA 4B1LA 1W99A 4I30A 3UGFA 4IEOA 3D0SA 5GLUA 2B4KA 3WEZA 4QKFA 4JDMA 3KV4A 3OD4A 1UWWA 3ZXAC 3OBZA 4QQ2A 1WKYA 1VBD2 1NLSA 4L11A 4AZZA 3WDYA 1FXZA 1R1A1 1JW6A 4Q8KA 4QGMA 3G7DA 4H3WA 2NP0A 2EXIA 2YV8A 4Q0UA 4BMEA 2YC0A 2X09A 1AUYA 2FBEA 3NKTA 4OHYA 3MIGA 3H8UA 1ZBA1 3B02A 3ZYJB 4ES8A 1PVC1 3OEBA 1AYM3 3IKWA 2ZGQA 4YG0A 4AOCA 1DGRN 4Q29A 1W6PB 1KITA 3CDZB 1IQAA 4META 3VBFC 3JD73 3IT8A 3PVEA 2OQ6A 3ZDSA 3PTRB 5FJHA 4I3GA 3IN9A 2DBIA 2VH9A 5A6YA 2A3WA 5LBBA 4NMIA 4NIGA 1W2AX 2BGPA 2Z5WA 4CDXA 3ZOIA 4D7TA 3ZFGC 1D2QA 4BQXA 4QD2A 1ENQA 1GWKA 2OZJA 1FOD1 3H3UA 4ZY9A 3I4IA 1V6NA 1CESA 2R16A 5KWRA 4JX0A 4YVSA 5DAXA 4XUPA 5DZFA 2CSGA 4XABA 2ZZJA 2YC4A 2BBAA 4P5YA 3S5AA 5C3QA 1ZBE1 5DZGA 1VMFA 4K20A 2BNNA 2XWJB 2GN7A 3ITQA 1HB4A 3WHUA 3PVNA 2C9KA 1D7PM 3D8CA 1ZRCA 3S5QA 4P9GA 1X8EA 4Y1VA 1XQNA 1VAMA 2R0FA 5L7OB 5A3WA 1PO23 1W2OA 2WA4A 2DFBA 5G05L 3WW1A 4AFAA 1X33A 4DY5A 1BBT3 1VBC3 3KCYA 3S0MA 4DRVA 1F15A 3X29B 3T1MA 3CF6E 2VCBA 3NNLA 4PHZA 4XF0A 1EP0A 1ACCA 3BGAA 1EPWA 3WUCA 4FOVA 4LEJA 3WNOA 1DDLA 2HLEA 3IAPA 3S7IA 1ZNPA 2AH2A 3IM0A 3HEIA 3WDVA 1GQHA 2A3YA 3E5XA 3U07A 1NE6A 3NJYA 4LMFA 4CCMA 2LS6A 3D6EA 4LO5B 1SLCA 3AMHA 4QKBA 2V5YA 1NXMA 2YU2A 2Z4FA 2B9VA 3H42B 2UWCA 3VBUA 3IBMA 5IVJA 4JHTA 3MIHA 3Q8FA 4EE2A 2WYSA 3CMGA 1LR5A 4M3CE 5HCAA 2ZXQA 3L9JT 4XFGA 2VW0A 4P14A 5H9PA 1MS9A 3OGJA 1FPN1 4B4QA 5C8CB 1AYM2 4TLGA 5A7WB 1PGSA 4A7ZA 1MS1A 4HONA 3VHOA 2HWE3 3ZSLA 5FRAA 4KQ7A 5T5LA 3JD72 4XMIA 4HL0A 1EAH3 1RJ8A 2RDQA 4N9IA 4CZSA 4D8MA 4OI1A 2W91A 1VBB3 5GZGA 4UW5A 4FPKA 4RFT0 4CEYC 4BHPA 1N3OA 1C28A 5FIXA 5JIAA 5A6XA 1Q43A 3PL0A 4QX2A 2AYHA 4ZXEA 2XHNA 4Q1RA 3GYDA 2IFRA 5BPXA 2IXIA 5FYUA 1QJU1 1S0CA 3HQRA 5FZHA 1ZREA 1ZA4A 5D8AB 3QOPA 2ZABA 2Y6FA 4JV4A 2R043 4UFIA 3MW4A 2VXRA 3AKQA 2VNOA 4LLOA 2X53S 1CAUA 3ORJA 3SC7X 2OX0A 3WNXA 1VMJA 5FXXA 1XNDA 3W20A 2BDRA 1UOFA 1KXGA 3BTXA 1PO22 5SV5A 3O1PA 1H1AA 3C7EA 4B1MA 2QE3A 2D6KA 1BBT2 1VBC2 3NV2A 1QNYA 1WLWA 4IUGA 2W47A 4L97A 4L92A 4MZUA 5BNPB 3I2IA 1EY2A 2BEOA 4Q4V3 1J3RA 1YNAA 3O1UA 2RS13 1PMIA 4YGDA 1XPWA 2ATFA 2HWB1 4BXFA 3LOIA 2HWC3 5IHRA 5A3PA 4DRRA 1Q8OA 2Y6HA 1URXA 3NNMA 1H2LA 2Y33A 4AF9A 1U0AA 1EV13 2R1BA 4QX0A 4EZHA 4FFFA 1QH7A 2E63A 3AP7A 2OUJA 4ET7A 2ZHLA 2BYVE 3NJXA 2XKPA 1POQA 4BQ1A 4PDWC 4IV1A 4QT6A 3GHNA 5B2GB 3VDDC 2VUDA 2XH6A 1AHSA 3USUA 4KWKA 5CFDB 5FPBA 1O5UA 1GOFA 3FLRA 4URTA 3SLIA 4HKLA 1Z7S3 4A4AA 1RUD1 2HWE2 1US3A 2BOIA 3AZXA 2OKXA 2LRPA 4AFDA 5A3NA 5JSOA 3MZHA 2JDNA 4ZXKA 4A2UA 4XBNA 1YQ8A 1EAH2 2A6ZA 1HRV1 5FYZA 1R092 1REEA 4RR3A 1VBB2 4COWA 1TMF3 4JGZA 3SH4A 2JG8C 2WR9A 4XFBA 1Y3TA 5A1AA 2VG9A 4DUXA 2HEVF 1MVEA 5K9YA 1OOPB 4UFMA 2X10A 4QPIA 4AEDB 3WNPA 2E7TA 4HSJA 4XCBA 1LOAA 2ES3A 2K0GA 4WVZA 3UT0A 4EN9B 5JOWA 3AJYA 2H6BA 4IEUA 3VDBA 2R042 1W6NA 4C90A 4FTSA 3TN92 1AR83 5E8AA 2WFF3 2E6VA 1L7QA 3N9OA 4FSJA 1S2EA 2HYXA 1KDMA 1NQJA 1QXRA 2YC2A 3SHRA 4CRQA 1XSRA 1OA2A 1JYWA 1LOCA 1CONA 2GNDA 1GU3A 4N43A 1NCQB 1VRH1 3OGVA 4YW6A 4DXRA 4G9SB 4OI2A 2A73B 2DDUA 5EFUA 2RS12 5FZFA 3SH5A 3UGHA 2VMFA 2WQ4A 1REFA 2VM9A 5FYCA 2HWC2 1RMU3 2XLGA 2VTFA 4BWOA 3PNAA 2B7YA 4ATEA 1JU4A 5GALA 1EV12 4CEWC 5K0UB 4Y1ZA 5HV0A 1W0NA 5FMBA 1W06A 2MPFA 4AI2A 3H9AA 4UFJA 1JHNA 4XJAA 5JXHA 3J8F2 1FOD3 4MLOA 4B3NA 1J58A 2WT1A 3P6BA 4SBVA 5C3SA 5IFPA 2G9GA 3S30A 3VD3A 1SLLA 5KXEA 4DO0A 1PMJX 2HJIA 5J37A 1MPXA 1ZBE3 3RSJA 3MO4A 4BPZA 3CKHA 3IIAA 3RJ2X 1Z7S2 1OUSA 1V6MA 1JZ7A 2EIGA 3HNYM 3BIEA 2VXJA 3POWA 4QX7A 3ZFEA 1DIWA 1BZWA 4YM1A 1H8TB 2A6WA 3NJZA 3GCWA 4GJZA 2VNVA 1GWMA 3TEXA 4C1XA 2NQYA 1UU6A 4RA0A 5HCFA 4FXKB 4FOWA 5K7PA 2ZKNA 1TMF2 4K40A 1GZWA 2R061 1DU3D 3M1HA 5A33A 2B9UA 4Q1PA 3EHKA 3JXSA 1GNYA 5F32A 3ZSMA 1LOFA 1ND2B 4P9WA 1XJAA 5FPAA 3V56A 2JD9A 5F1RA 1D2SA 1HX6A 1PO13 2JDMA 2R071 2UYAA 3BVCA 3Q8CA 4RSUA 2DVDA 1IG0A 5DZEA 3RYKA 3VHPA 4YVWB 4TZDA 4XMAA 1WW4A 4DUWA 3WG1A 3H1YA 5LW9A 1UAIA 5CFCA 1PGW1 2W9XA 4LKEA 4LO8A 4OMCA 3J26N 4XQ4A 1AR82 4OZXA 2D6PA 4XBLA 5FK8A 2EF6A 4E9KA 2XJVA 1V6IA 2CTVA 2BOJA 5D1IA 5A7OA 2L9LA 5C33A 4FP2A 4CDWC 3PMSA 3ENRA 3H0OA 2E32A 3W59A 4A3ZA 1XXNA 1PHMA 4O9GA 2G4IA 3EBRA 3NWKA 3BIWE 4JQRA 4LOSA 2Q1FA 4URAA 3ASIA 5C9AA 1U5IA 4Y5SA 1RMU2 4CUGA 2QQOA 2ZX4A 3R4DB 1KFUL 4KWUA 5AC91 2JG9B 4Q2FA 3ZFFC 2P1BA 5L19A 1ALYA 2YUEA 4I0WB 4XFHA 2E26A 4FFIA 3FFZA 1UO9A 1KDKA 3QH6A 4CDQA 3LKJA 1FOD2 1K5MB 4Y24A 4AWDA 1ZZ7A 5A3MA 1NQDA 2MEV3 1CAXA 1SDDB 4LE4A 3N7JA 4WM7C 1HB1A 2J1UA 3O0VA 5C71A 3U4SA 1YI9A 4D3WA 2FDHA 4AQSA 1R1ZA 2XVKA 3ELNA 4RQPB 5J98B 2Q1ZB 3LA7A 5HXMA 1ZBE2 4IDZA 3MW2A 3IWZA 3MUZ1 1V0AA 2GMPA 2BPA2 2ZGSA 4K8FA 4RGAA 3VD9A 4Z07A 1OT5A 3POJA 3RNSA 3S7EA 3ZYRA 1RB8G 3ILNA 5F3EA 3MFCA 1UYZA 2LUWA 5ABJC 2VPVA 1QNWA 4CCNA 2GH2A 3B93A 5EXOA 5DUWA 2XOMA 2Z2SB 3GJBA 1JHJA 4FFHA 4LBOA 5AVAA 1MQTB 3UKTA 1N3QA 1NE4A 1LOBA 1TME3 2MHFA 1Z0HA 1X9TA 1CAVA 1ULGA 1N1TA 1LHNA 1QJEA 1SLIA 1VBD1 2O0OA 2RMU3 1VBE3 1S0FA 3MW3A 4IE6A 5J36A 4AHYA 3LD8A 2DVAA 4BB3A 3SKJE 4AEKA 1JYCA 3P3NA 3VLBB 4QX1A 4OFGA 2GALA 1BCXA 4WBBA 2WNOA 1T2XA 4MSVA 5I8SA 5CBLA 2QQMA 3DPRB 1YRZA 3RJRA 3LIHA 5DXDA 1FV3A 5FZ1A 4D6QA 3VBRA 1CPMA 2EXJA 3WCSA 3AXDA 4CU9A 4N53A 5I91A 4XJ8A 1A3KA 3OGSA 4E2SA 1LOFC 5F6LB 5LEJA 4V2WA 5FREA 1DLCA 3C8XA 3GHMA 5CVRA 2JDUA 5FYHA 4I2OA 1HB2A 4AW7A 1EPZA 2VZUA 3FBMA 2JDAA 4JGYB 5IFTA 2ZCWA 2ZJCA 3KZ4C 4I01A 1ZA7A 3ZXEA 3RZLA 5FXWA 5GZCA 4P9YA 4YW2A 5IJRA 3B5LB 3JB8A 5IYYA 3WVJA 2ZGTA 2EICA 2N7GA 4W50A 5TSWA 4RL7A 4XC9A 3RWNA 3T08A 4LULA 4I02A 4DNYA 4Q27A 2HWF3 1H2MA 1K3IA 2NYYA 3NAPC 4GH4A 3KCCA 3KQRA 1QJU2 4CPBD 2WAOA 5F2SA 3ZMNA 2W94A 1NA1C 4IE4A 2VOWA 1C3HA 4FFGA 4ZZ5A 1PZ8A 1G8WA 1UXZA 5CISA 3ES1A 4MO3M 4HSLA 3SCGA 4E4SA 3POBA 4XFFA 4XPVA 3HT1A 3O0WA 2A6VA 4LJHA 1YC61 4OYUA 2Y26A 2WNEA 1YQ5A 4GWNA 3A7QA 5IWFA 4GIQA 1UOBA 2OIIA 4QMAA 5JDBA 4DMIA 5LASA 2XVGA 1VRH3 1O5LA 2RS31 4LBMA 3HAGA 1TME2 4XUTA 3WQ0A 4D0QA 4LK7A 4AEMA 4GA9A 1WMFA 2HWB2 1DYKA 2RMU2 2D93A 3BOPA 3OUJA 1VBE2 4RS5A 1WMXA 2PHUA 2W5FA 2ET7A 3BOWA 5GLWA 1Y9MA 5SV8A 5IK4A 1UN1A 2J1TA 1HQWA 1JZ4A 3BPSA 4YZ5A 1MVQA 2WLPA 4HVRA 3AL6A 1PX4A 1OURA 2YXSA 4X8PA 3VDCA 4E4ZA 1M06G 1AYM1 3PUAA 4JHZA 1JZ3A 1JOJA 4O7XA 5BNNB 3RMYA 4WM8A 4TYSA 1S2KA 1S0EA 3GALA 4ARXA 3JD71 1D4M3 1RVF3 1QDOA 4QDRA 3I2GA 1ONAA 4Z1VA 2FCUA 2ZBJA 3MPBA 2YB7A 3RZZA 2ZEZA 3MLJA 2P3KA 1GLHA 4MV2A 4KI5M 3ZXLA 3NW4A 3IZOA 1RJ7A 4CXXA 5EV7A 3M2MA 1UY1A 4LK6A 4UBHA 4AVCA 3GZUC 2VMCA 4LA3A 4WVMA 2WL1A 1GZCA 4XQWA 1DP0A 3ROUA 3ZXDA 3U0ZA 4S2GA 4IEPA 1IPSA 2BNOA 3TB0A 2R063 2BFUL 4NPLA 1JUHA 3AVRA 3WF1A 3OF1A 2ZMNA 1AX1A 4AHZA 2HWF2 3HN3A 2D44A 3CLPA 4F3JA 2GH8A 3DGTA 1OH4A 1NLQA 3LA3A 4PI0A 1RUG3 4PI2A 3VL9A 1H6XA 5KC5A 3WF2A 1NKGA 3LQCA 4EN6B 1MS4A 3WNLA 1SACA 1B35B 4COYA 1PO21 1W8NA 3VBSC 3RI8A 2FZ1A 4OCTA 3V65A 1KEXA 1VBC1 5FZEA 3AC0A 3KHCA 1PM4A 2F4PA 3GDBA 5G04L 1W6MB 1UZWA 3ZYFA 3AMQA 5A70A 5FYSA 4HPKA 1IZ3A 4DPNA 3D5OA 2TBVA 1ULEA 3TYJA 4AG4A 1VRH2 2ZGLA 3VB9A 2BW8A 1HV0A 3EYPA 1BK0A 1AL0G 1PK6C 2ZHNA 5T55A 3EQEA 1WCKA 4IEYA 4CCDA 3UGGA 1QXPA 2GDFA 1WW6A 4QQLA 4CDUC 4YM3A 3GNEA 1ULDA 2XR4A 4LBNA 4HBNA 5IW0A 3OEAA 4UXAA 3VBHB 3DYOA 1AF9A 1WW7A 1IS6A 1NCRA 1ASJ1 3D3AA 3UK9A 4DIQA 2BBVA 5FZ7A 3RDIA 4PIXA 1A34A 1QQP1 3R4SA 2WNUB 2W0XA 1ZZ6A 2ZX2A 4RN5A 5EYXA 2HWE1 4O61A 4M3CF 4QPGB 4Q26A 1D4M2 4AAPA 2GC2A 2WQ8A 4LHSA 1YFYA 2WNVB 4LO6B 2G9FA 2Y0IA 3C2UA 4P9XA 5JXJA 3FZ3A 4AHWA 5JSPA 1F4HA 3IAQA 3B00A 4FPHA 2Y6JA 1BMV1 2GNTA 4LO4B 1A8DA 3FLPA 3NJVA 4L0PA 1BKZA 3VBOC 5F3GA 2HBUA 4F7ZA 2VZRA 2Y38A 3H8RA 2PAEA 3MICA 1NZIA 2ZEWA 1LOGA 2BRTA 3KF5A 4IV3C 4WV8A 2R062 3KWVA 5BXXA 4IQPA 4J1WA 4AI9A 4ZKTB 2CGOA 2ZOEB 1QIQA 3VBFA 5LY1A 1RUOA 1S55A 1YFUA 2R041 2R072 1UF2C 1UYXA 4OQ8A 1HW5A 4MHRA 1N3PA 3RG0A 3O7OA 4X6RB 4IEVA 3FL7A 2WAAA 3ZFGA 3A23A 5FP8A 5JR7B 2ZEYA 4Y1UA 3ZO0B 1QOOA 5B4XA 4DZGA 1K12A 2VTXJ 5FY4A 2DU1A 1LECA 1CVNA 5FWEA 2VBDA 4Q4V1 3LPGA 2J1VA 2RS11 5DABA 3PJYA 1RUC3 4I0AA 2VOTA 3M70A 2BTVC 2GC1A 2HWC1 3EB7A 2DWRA 1WLCA 4XDPA 5JXGA 4FPYA 2WS93 4O65A 1IS4A 2IWGB 2XJRA 2YGMA 5IK8A 1EV11 5JVVA 3DXTA 4CCEA 1M4WA 2GC0A 2YFZA 3MI8A 1JODA 2D43A 2EA7A 4IEWA 4K1YA 5FPLA 1K45A 2UY8A 5APAA 4YFZA 4Z2WA 1GICA 4AVBA 5IUQA 4EV0A 4UBGA 5AC92 5F8PA 1G9BA 3BTAA 1O3RA 3V0BA 5DDJ3 1VLNA 2O1QA 4AI1A 2XHKA 1H0BA 2OS2A 3GBFA 5KR7A 4XF4A 4HOOA 1U5XA 4GULA 1CAWA 4A45A 4MGYE 3H3ZA 5F5IA 1AXYA 1Z7S1 2VR4A 1Q8QA 3FHAA 4UFHA 5E16A 3ACLA 3IMNA 3TOJA 1PVXA 1V6LA 4Q4X3 4XHXA 1YFXA 4LITA 1OF3A 4MGIE 1S1AA 2WO1A 4HZFA 4B29A 1DBNA 4MHUA 4NHKA 3L2HA 3FHIB 2KXLA 3N7MA 4R8HA 3WDUA 1VMHA 4HKWA 1TMF1 1YI7A 2ZMLA 4LR4A 2BWCA 2KA3A 1O8PA 1VP6A 2FDJA 5BUVA 4OI0A 2QQNA 2ZX1A 4B8EA 3OY8A 5CU1A 4IERA 2RS33 1SPPB 2W87A 1W6QB 1ND3B 1LEMA 5A3TA 3UKVA 3VD5A 5J09A 3KCXA 4UT5A 3WHTA 4CYDA 1GSLA 1N1VA 5A7QA 3KM5A 3ATGA 4OLLA 1AR81 2YBPA 2WFF1 1R64A 1LEDA 2A71A 3LB9A 4CEYA 3NL1A 4FCAA 3PLQA 3OUHA 4U36A 1VB4A 4P9IA 2B45X 1XNKA 2H0BA 3K48A 5ANNA 4AXOA 2AENA 3DKWA 3E5QA 3MFAA 4CTEA 5BV6A 5L7OC 1AYN3 3HNMA 1RUC2 2D6MA 5GLVA 3AKPA 1RMU1 1WLTA 2VBBA 1GOGA 5FLHA 2WS92 5IT6A 1CGPA 1QDCA 2PAMA 2KM2A 3WZ1A 3SCFA 4QB2A 5E89A 1G9CA 2VGDA 1GYKA 1RTVA 1WWYA 2C4XA 4OUMA 4HETA 5J48A 5FXVA 2UY9A 5DDJ2 2HKXA 1S4CA 5I0SA 3AJZA 3A22A 4J6GA 4HXCA 3LWCA 1V6OA 4COUA 4HFSA 1YIPA 3L2YA 1OKQA 1W9SA 4IE5A 1IS5A 1AXKA 2C24A 4CSWA 1RUE3 2BFUS 3PVBB 5FV3A 3V0AA 2G9ZA 1JOBA 3TNQA 3DYMA 1JMUB 4Q4X2 4AK3A 4C0HA 5C8CC 4G3YC 3ZYBA 3VUOA 3SQOA 5JWPA 1IOAA 3IPVB 2JECA 5F6KA 3LAGA 3VL8A 2ZPXA 2D97A 3CJXA 4NRQA 1MACA 3RMXA 1SEFA 1Q5OA 2CDPA 1UQXA 4PDWA 3VDDA 3I3BA 2GNMA 5KHKA 1LRHA 5FY9A 4CUAA 2E9QA 4P9LA 3M3EA 4AE2A 3ZX7A 1PO11 2Y60A 3N35A 2BNMA 3MV11 2RS32 2ARBA 5JOXA 4UW6A 1RUJ1 5T5JA 3NNFA 2Q8EA 4XAEA 2R30A 3FMGA 1A8MA 4KWJA 1QGLA 2X5IB 4FQ4A 2PHFA 3NQHA 1AX2A 3KD4A 1VPHA 5FPZA 2WUHA 2V5DA 5D8AC 3FWEA 3SKVA 4QXCA 1W0OA 1LKNA 2WLQA 4OZOA 4M4RA 5IVVA 4J1XA 3CJIB 1ASJ3 2JG8A 3MUY1 1SQ4A 4UFLA 3AXEA 5EP9A 2WA3A 1Y7BA 1QQP3 3OD0A 1YIFA 2VMGA 2QJVA 2DCTA 2WYFA 5BNPC 4KG8A 3AYCA 3I59B 3ZSEA 1E5SA 5FP9A 1JBCA 1W04A 3F2ZA 5GJ6A 3RQ0A 2XJPA 1SCSA 4Q0SA 1QJFA 2VZ1A 5F7UA 3K2OA 3H8XA 2C5DA 1OHFA 1XNCA 2MEV1 4YW3A 5FKCA 2W46A 1AXZA 4WVVA 3K3OA 3MLLA 4XVHA 3LCPA 3LA2A 5T3NA 1JYIA 1KS5A 1MS3A 3OYWA 4HK8A 4PLOA 5LEKA 4IW3A 1K5JA 3E97A 4QM9A 5CADA 4NRPA 5BNOB 2UURA 5CFDC 5DAQA 4CEWA 3WSOA 4A44A 1RHI3 2HEYF 2AEYA 2NN8A 3FUQA 1ULCA 3CZJA 4Y20B 3DXUA 4QQOA 4BOWA 5CA6A 4RHV3 5I0DA 1YCIA 4QHBA 1BXHA 1OBNA 5A32A 1F31A 1UKGA 2VW1A 3AKTA 3FBYA 4L99A 4QHOA 1RITA 3RRDA 1TME1 3K3NA 1XC6A 3LFMA 3D4KA 1K42A 3INAA 3VKOA 4S2HA 2RMU1 4XTPA 5DMYA 2WSVA 1VBE1 2YMZA 4PF1A 2CNAA 3RZGA 1SLAA 3HT2A 1KS4A 1OF4A 3K4AA 5JPNB 3OCPA 1MS8A 3SEPA 3SISA 3THCA 5F9TA 4I0BA 2OVUA 3VZLA 3UNPA 1W8WA 1YHFA 1OOPC 1SHWB 3VZKA 2CAVA 4AEDC 2XVLA 1U12A 4CCKA 2XKOA 3TBDA 3O1RA 1TZOA 1NXD1 3JQWA 1UMIA 3BODA 1SBDA 4N90A 4N9HA 1OVSA 1W9YA 1YWKA 1BVP1 2EIBA 3LF7A 5I8YA 5LA1A 1ASJ2 4KG0A 1O4ZA 1UCXA 3SMHA 5LWBA 4ATFA 2D40A 3AP4A 1QQP2 4L2NA 3TRSB 2VY0A 1X7NA 1GP6A 2Q1MA 1NCQC 4IGOA 2IVJA 2VAUA 2GMMA 3C3VA 2QZ3A 4YLZA 1JYNA 2GP3A 4BJ0A 3K46A 4IXLA 4XF1A 4Q4W3 3RZHA 3K77A 1SBFA 1BMV2 2WN2A 5DPNA 1LHOA 4CU6A 1VJ2A 2VMIA 2XWBB 4BH9A 4CDWA 5K0UC 2HWF1 4XJ9A 4CDXB 4CUCA 1W9WA 2F4LA 4BZ4A 4XCAA 1GR3A 3UJQA 2PHTA 4L9BA 3MEPA 4IGQA 4WZFA 1RXFA 2WABA 2XMLA 4BQ2A 1MZ6A 1PNFA 4Q4Y3 1HQNA 2JIGA 4YVSB 1RIRA 1V70A 2QDRA 1UU5A 5FO8B 1UY0A 4L8QA 1F9KA 3ZFFA 2CAUA 4EN8B 4XE9A 4W6YA 1A78A 2J7MA 1RHI2 2YBSA 2PHXA 4BK5A 4ZU7A 5FY5A 2EIEA 2ZKLA 1H8TC 1DYPA 4DEVA 5A6QA 4ZS2A 2GNBA 4M4PA 4PJYA 3JQXA 4WM7A 2MNGA 3IDAA 4Q4V2 1UD1A 4A6SA 3VKNA 4Q0VA 4XXPA 5KHIA 2DCYA 4Y1YA 4UYBA 1BVVA 1XU1A 2EAKA 5F39A 4BDVB 1P8JA 4PQQA 5FR3A 5HV4A 1ND2C 3BALA 5A3LA 1NG0A 5ABJA 1VIWB 1JZ2A 4TSVA 1MZEA 4YVWC 2V4VA 4ZHNA 3KV9A 4MXWA 1D0HA 3BU7A 3NSTA 2ET1A 2ADEA 5FZOA 2LTNA 3VBUB 4QGLA 1D4M1 1RVF1 4CP9A 1V6JA 2ZS6B 5JMCA 3ZKYA 2DF7A 1YLLA 3B94A 2FHRA 1KJRA 4BQWA 3O1VA 4YRDA 4DS0A 5FXZA 5EYYA 1QOTA 4UI9L 2OUHA 3OGRA 4FPGA 4H7LA 1QJY3 3U10A 4EROA 5C6CA 1CQ9A 4LKDA 4MGKE 2VZSA 3O1TA 2VOVA 2J1AA 2P5BA 4Q4W2 4V2VA 5T5OA 3R0RA 2Q4SA 1TE1B 2WT0A 2VZTA 4Y33A 1W28A 2JG9C 3PIJA 5M0TA 2ZZQA 1O3TA 4ISRA 1O6UA 1XNBA 4B4PA 1ZRRA 2P34A 5IVYA 3R4UA 1UMHA 5DG1A 2DTWA 3SCHA 1I5PA 1S2BA 4BK4A 1LHUA 1RUG1 2VMDA 1K5MC 2VZVA 3PURA 4Q4Y2 1RUJ3 1FNZA 3NO8A 3ZPOA 4P5HA 3I49A 3KGZA 1OFNA 2CWMA 5FO7B 4ASLA 2AREA 3C7GA 1GZTA 4LTAA 4BE3A 1E57A 2JDZA 4LUKA 1VAKA 3U75A 4RQPC 1E5HA 1H2KA 2WFF2 1O8SA 3HJRA 3QLQA 3WW4A 3N9MA 3TEYA 1T6BX 2ZHKA 4NAMA 1PIV3 4NAOA 5FO9B 3B9IA 1CAUB 2BWAA 3KV5A 3ZXGA 4CCJA 2DCKA 4DXZA 3NAPA 4YSFA 5FKBA 2QQKA 5FP3A 5FQ0B 2BVVA 1MZ5A 3KVAA 1NA1A 5D2AA 4HN0A 2OYZA 1JYTA 1MQTC 2WWUA 2XONA 4AVAA 4AVTA 4JRLA 2Y64A 3BCWA 3LSDA 4MXVA 5FK7A 2VL4A 2WZR1 2PA7A 2VCMA 4XF9A 2W92A 4Q0PA 3H8OA 4CCCA 4LBKA 4A3XA 3PU8A 4D94A 3THPA 2C1FA 2JX9A 3VGIA 3MDPA 3N36A 2Q8CA 1F5FA 1PX3A 2VD7A 4Y3OA 5CIRA 3KV6A 1OPMA 5DUVA 3LEIA 4HKOA 3HQXA 3DPRC 3VD7A 2QQVA 3ZM8A 2YPDA 2LALA 2ZGMA 4IV1B 1OKOA 5FZ3A 3O1SA 4ZONA 1SFNA 3USUB 4AYUA 5DAVA 1FV2A 2BGCA 4LORA 1IPKA 1CWPA 3N9PA 2ZHMA 2E51A 3ZVXA 1ZRDA 4TWTA 5LZ6A 3HVDA 1XYPA 3NV3A 4DQAA 1XNAA 1XE7A 4JGYC 1V00A 2E7QA 4GZ9A 1DFQA 1QOSA 3HWJA 5DG2A 5KHGA 1B35A 2RJLA 5JSRA 2HWD3 4YYOA 4BLIA 1XNTA 1OQEA 4RR3B 5GZFA 5EWSA 1HKDA 1PO12 3O14A 1W6OA 4PBPA 4JGZB 3ZLIA 4XJZA 2FDIA 1US2A 4N7IA 2QQLA 1RUJ2 1YFWA 2IXCA 2W39A 3ZDVA 5H9SA 2RDSA 1HJGA 4AEJA 3WP6A 4CA9A 4QPIB 1NT0A 2YHJA 5FMDA 4NN0A 4EN0A 3WXPA 1ULOA 5IATA 1W2NA 1B09A 3M3OA 1PIV2 1FT9A 3LE0A 1RUC1 2VCAA 2IXJA 4LNVA 4XUNA 1AX0A 5FY8A 4YARA 4BXSV 3HR9A 4KMQA 2WS91 3MV01 3C7FA 2OT7A 1GKBA 4YZ3A 5K4LA 3RYRA 1LENA 4SLIA 3T0AA 2VU9A 1SMVA 2C26A 3AMNA 4M0NA 5FYIA 3W5MA 1GUIA 2VECA 4N43B 1WD3A 3GM8A 3VBSA 1MZFA 2W95A 5DDJ1 1UZZA 1TNFA 3ETQA 4QQHA 3J7NA 1HDKA 1U5YA 5EPAA 5GM0A 4R52A 2MEV2 4Q5OA 1VR3A 2PTMA 2VZQA 1T6GC 3WR0A 3WW2A 2DVFA 3ZN6A 1UYPA 4R4XA 4DFSA 2R6QA 4Q4X1 1YYNA 1PK6A 2RV9A 5CG8A 2VZPA 3SNMA 4PT6A 1RUI3 1IHMA 1F5JA 2AR6A 2ZGNA 5BNNC 3U78A 4CDUA 5LY2A 3AX4A 4OHZA 3I3MA 5FYMA 1W8FA 2Y6GA 1IGOA 2CV6A 4RFRB 2D6NA 4Y22B 1LGBA 5FZIA 3WG2A 4AVVA 5A6ZA 3MIBA 2BV4A 3H7JA 4XZUG 4YG6A 3ZFEB 2O8OA 5KXDA 2JEMA 2CL2A 3VHNA 1BEV3 3DN7A 4XACA 4NR1A 3EMRA 2PHRA 4ASMB 5LBCA 2AACA 3N9NA 2HWD2 1ST8A 3KT4A 2JIJA 1WCUA 2DUPA 2ZMKA 1RUF1 5FYBA 4BCUA 2J22A 1GZWB 1GWLA 2RHPA 2ARAA 5A33B 2VOKA 5JAXA 5FZCA 1GP4A 5A1FA 4NO4A 5FZ0A 4JZRA 3KT7A 1YO8A 2Y6KA 1O3SA 4NIHA 2FCTA 4AVSA 3VBOA 3AL5A 3PUHA 3ZPYA 1WCQA 4FOYA 2XJQA 4CP0A 1PZ7A 4IV3A 1QF3A 1NLRA 1OXCA 4UF0A 4AGRA 1B35C 1UXXX 5CFCB 1AYN1 2Y6LA 2JXAA 3OOXA 3PMEA 5AFBA 4NWVA 5FY7A 1R083 1MR5A 2WRAA 3LZZA 5F3CA 3M3CA 1QMJA 2VUCA 4JTOA 1HB3A 3Q8AA 4XIKA 2Q5TA 4IETA 3UESA 4DEQA 2RR13 4IE0A 4LBQA 3BTYA 4QU1A 1TNRA 2WZEA 4GMP3 3MIFA 3ZIWA 3AZYA 3IDBB 1NYWA 4MH0E 1O7FA 5LA9A 1REDA 2JENA 2XBO3 3SEEA 5C9AB 2IZWA 5C3PA 2VQTA 4NHMA 5EJ1B 3PU3A 4YW1A 5LK7B 3AK0A 3LDBA 2VOXA 1LOEA 2A70A 5C4WB 1RUE1 2GP5A 4AI8A 3VBHC 2RM21 3I97A 1KQRA 1S0GA 4GB33 4CDQB 1C1LA 3U37A 4LKSA 5E88A 3ZYGA 1RUI2 5FP7A 2BJSA 1FI2A 3CEWA 4UW4A 2WNUC 3ILFA 2XDVA 3ZYIB 3UL2A 1C5HA 4XTMA 3ZIXA 1V6KA 3ZSKA 3FUOA 3AFKA 4QPGC 5FMCA 3QD6A 3RVHA 4YGEA 2VCCA 4TTGA 4QKNA 1AL21 2ZGKA 2P17A 2WNVC 1CZVA 1CX4A 1ZYBA 3N3HA 1O91A 3Q9OA 4WVWA 3UJOA 1YQ6A 2XLAA 4ZU4A 5ERLA 2VW2A 1BEV2 5J7MA 3W58A 1WMEA 1HRI1 1JI6A 3VD4A 1HJFA 2XJUA 1UYYA 3D82A 4CU7A 5FUNA 3WY6A 4W6WA 4YFWA 1H1IA 1V9U3 4HLTA 4XW3A 1KD7A 1KFXL 1GQGA 2AEZA 4MUVA 2QQPA 1OPOA 2D7FA 1I3HA 2ILMA 3FLTA 5HCHA 1S0DA 1W6PA 4FTEA 3H7YA 1J84A 1UZVA 1CAVB 3ETPA 3VZMA 2TNFA 3WQBA 1DQ6A 2ZGRA 2Q8DA 2WZR3 4YPJA 2DYCA 1ZZCA 5I8TA 5IAXA 2E31A 2PAKA 1DZQA 4OHWA 4KBZA 1C8M3 3RS6A 1RVF2 1RUH1 2VULA 2W3JA 1R082 3KB5A 3WT3A 2P6HA 4MOAA 3QBQA 3S6PA 4DXTA 3UKNA 1EYBA 4TXWA 5F2WA 3VBRB 5JMOA 1QXJA 4N53B 5KXBA 3ACFA 3RZKA 1DYOA 5JOYA 3N9QA 3I3QA 5FY1A 3ZKUA 1BJQA 4LOTA 2JICA 2PQSA 4PIYA 2XJSA 1GP5A 5FCCA 4A6OA 4BMBA 4DY3A 3AVSA 2XBO2 3M7AA 3UYJA 3C7HA 1UZYA 5L9BA 1IQDC 2FCVA 3IIIA 5L7OA 4H14A 2ZA9A 1UX7A 3NNJA 3AYEA 3CL1A 5A1LA 4AFBA 3KHBA 1CPNA 4UAPA 3TWIA 1RUG2 5JI7A 2YG0A 2CYFA 1BK1A 1RHI1 3HN1A 3WQ7A 5AFEA 1O4TA 1SDWA 2E7AA 1COV3 5L9RA 4XEZA 4EZ4A 4GH4B 1N47A 3MIDA 2DVBA 4RHV1 5FP4A 3RWKX 3ZXKA 4ES9A 4MVTA 3O1OA 2V4AA 2OXBA 2V09A 3NV1A 1S0JA 2P3IA 5F3IA 4E8CA 2ZEXA 4FPCA 4K8RB 3THDA 1DG6A 4IGPA 3POYA 4AR2A 4KL1A 4OHVA 1AJOA 1ULFA 1W2TA 2AZ5A 2FDKA 4INDA 1W0PA 3GZTB 2WWSA 3NNGA 5C8CA 2R0HA 4NJ4A 4H55A 1G9AA 2NZ9A 3Q8BA 2D5HA 2W1WA 3I2JA 3AZWA 1OLMA 5A7WA 3VZJA 2FZ2A 1HV1A 4ITCA 3D0JA 1ND3C 3CZUA 1NY72 2QFEA 3PDQA 5IAVA 5F5QA 3BN6A 4D69A 5FMOL 4RS5B 3DKQA 3ZSJA 4D6RA 3BTZA 1FAYA 5J1XA 3IB3A 2WZR2 4BIOA 1RUNA 2G1MA 1DCSA 4Y26A 3RZMA 2DUQA 1W05A 3LIGA 5FZ4A 3WDTA 5DAWA 4M3CB 3HQUA 4G4FA 2PMWB 2R1DA 1CR7A 5FZDA 1C8M2 1FX5A 1CJPA 2IVIB 3HNBM 3K75B 2FDFA 4FPJA 1X50A 2JDYA 4WM8B 2EIDA 1J1TA 4XYXA 5FZ8A 4GQ7A 3LSEA 3CHXA 1BYHA 1C4RA 4Q4W1 4XUQA 1JZ6A 1CD3G 2PLV1 5D8AA 1CZTA 3DCQA 4E2GA 3QACA 5H9QA 1W8TA 5FZLA 2JWPA 4Q8LA 1Q56A 1ODNA 1JYVA 5ISLA 5KHHA 1UU4A 2ORXA 4A42A
chains in the Genus database with same CATH topology
1FMD3 3AP6A 1BQPA 1C8NA 2VQAA 3RI9A 3NKGA 1POV3 4WVMB 4Q4Y1 1AVBA 4YM0A 5FPXA 5BNPA 4XBQA 3OJBA 2WINB 2PYTA 1RUF3 4V1PA 2W52A 2I74A 3AB0A 4A7KA 1COV2 4EWDA 1PGL2 1C1FA 1FNYA 1FYUA 3A0NA 4XZPA 4AQ6A 4I3PA 4HVOA 3GBWA 4NOTA 1LCLA 4LLFA 4AI0A 2B46X 4ZU5A 2PELA 1LHVA 4NHLA 4Y1XA 3VKFC 5CFDA 3WDXA 4HPKB 2D5FA 4XFIA 1I6XA 1UIKA 4YNIA 2EALA 1HLCA 1H2NA 4XXAA 1OI6A 1RGSA 2ENRA 2X5IC 4LBLA 1MS0A 4BM8A 3J4UH 2C0ZA 5CG9A 4BLJA 4EWAA 5J3UA 5FLIA 1ZZBA 2DUOA 2D3PA 2RM23 3ILRA 1D0GA 1NCRB 3CJIC 4FPOB 1QJY1 2YZ4A 1LULA 1OOPA 2A75A 2NMOA 5E1RA 4AEDA 2A6YA 3AKRA 2DVGA 2WKKA 1AL23 1SBEA 2I07B 4XFAA 5FTTC 3W9AA 2WJSA 4KBBA 2A3XA 2PHDA 1FMD2 5J96B 1HRI3 3QH7A 3CNAA 3EO6A 5IK7A 5CAZA 2IXKA 1DZTA 1UKRA 2CWSA 1MEC3 1NCQA 1RUF2 1N1YA 4LHNA 4E2QA 2HEWF 4FAGA 4KWLA 2GAUA 3E6BA 1Z78A 5JZGC 4GXLA 3VBFB 2CGPA 1S0BA 3FC0A 2XL7A 3ME2A 4XHBA 5FDBA 1PIV1 5BNOC 5IK5A 5I0TA 3B69A 3B7MA 2O8QA 4YW5A 5K0UA 1WCSA 2RS53 4JAAA 1G86A 3TAYA 3ZFGB 5JLVA 1WCDJ 3AZVA 1PNGA 1AYN2 1AZDA 1RUH3 1DQ1A 2JKBA 1H9PA 1JTZX 3THTA 4FQZA 1GANA 2UWAA 4WZCA 3SITA 1ZX5A 2Z79A 2OZ6A 1DQ2A 1Q8SA 3AZZA 1UPIA 1XYOA 3I2DA 1WMDA 1H8TA 1HQLA 2JD4A 1IPJA 4GALA 4FVVA 5JZGB 4YGCA 4A7YA 3V0BB 1VBA3 1RUE2 3WG3A 3ZN5A 4NWWA 2RM22 4K3UA 1CAWB 4QXKA 2A6XA 1ND2A 1J1LA 1R093 1J59A 1VALA 1C57A 1S0IA 4ONUA 5L36A 4YVWA 1Q3EA 3I7DA 1ZZ8A 3P3PA 2YGLA 4MGZE 4PF5A 1AL22 3A4UA 1ENSA 1AR63 4OVEA 5LRSA 3G6JB 4PBOA 2HWD1 4YGBA 2H6CA 2OW4A 2VUJA 4GKYA 1HRI2 1XRUA 3R05A 5GZDA 3N7KA 4JTNA 1H8VA 2JJ6A 2ETEA 4XILA 2JE7A 3TN93 4CDXC 1MEC2 4PCRA 3OY8B 1SLTA 4B7EA 4YZ1A 3O5SA 5FQ0A 2VUAA 4B7KA 3WLUA 4Z82A 3GF6A 4YVSC 4AGVA 3E6CC 1ZRFA 2JG9A 5ACA3 5I0RA 5FMOS 4HT1T 4ORFA 2RS52 5T52A 5KHJA 1ZVFA 4EN7B 1X8MA 4CEYB 3AYAA 3AMPA 4XFCA 4CP1A 3M8LA 5GZEA 1K5MA 2B5HA 3AM2A 4MX3A 1RUH2 3HBZA 2ARXA 1QKQA 2GZWA 3APBA 3WV6A 4K6BA 1AR93 3JUUA 2IFWA 1WLDA 3J8F3 4RQPA 2PLV3 1IKQA 4BYYA 4FO9A 5HI0A 1DHKB 3WX5A 4QPYA 5FFOC 4LT5A 1OD5A 3JCIA 1VBA2 1RUI1 1RINA 4HMZA 5FOJB 1PZ9A 1MQTA 4Y4YA 3VBUC 3J9SA 2PHLA 5FBZA 1KRIA 1DGWX 4HANA 4M00A 3RPQA 2I45A 3V0AB 3WQ1A 4RHV2 2NPIA 1Q8VA 1AR73 1BEV1 3JBG1 4OUSA 1L3JA 4JRAA 1AR62 2B39A 1D4VB 3VZNA 4XQDA 3DPRA 1N1SA 2DCZA 3T1LA 3ECQA 4PDWB 4YM2A 3VDDB 3CU7A 1R1A3 4M01A 4PIZA 5DUXA 1QY4A 4K21A 4MYEA 1ZBA3 2D6OX 3RYPA 4AHXA 2DV9A 3H1MA 1PVC3 4JGYA 1C5IA 1QU0A 1H4GA 2QZ2A 4AGGA 2EAAA 2IC1A 4S2FA 5ACA2 1R081 4Z92B 4JC1A 4DINB 2Q0AA 1H4HA 1SFYA 4XETA 4C91A 2RR11 3AKSA 4DOUA 2JG8B 2Q30A 4GMP1 2NLRA 1AR92 3LGRA 1DF0A 3KS7A 4X6QB 3ST7A 1WBFA 2XBO1 4QX5A 2PLV2 3ES4A 1LHWA 3GZAA 4XDQA 3KT1A 4R4ZA 1ENXA 3WOGA 3MF6A 1SLBA 2LM3A 2XL9A 2QDNA 1DGWA 4QGNA 2WZPP 4K9SA 4Y22A 4XF3A 2A7AA 4GB31 4QM8A 3ZN4A 2V73A 1H9WA 2F6BA 3ZYPA 4D7SA 2RE9A 3OYWB 1DQ5A 4GKXA 4UW3A 1G9DA 2CY6A 3KLSA 4IV1C 4JDOA 3B9CA 3ZXFA 1LB2A 1IS3A 4FOQA 3BB6A 2YY1A 4Q0QA 1AR72 4CEWB 4FT8A 3DL3A 2DU0A 3N7LA 3DUIA 2WC2A 4PLMA 4E4DX 5JI9A 1V9U1 2X8KA 3JU9A 4C1WA 5A32B 3WP5A 3KSCA 3QCWA 4FBFA 3E6DA 5BNNA 3WCRA 1QH6A 3MYXA 1NY71 1R1A2 1HXS1 4RR3C 5HXVA 1GNZA 2IXHA 1TQ5A 3A0KA 4JGZC 4R9AA 3FX3A 1ZBA2 1QJX1 1FPN3 1WA4A 1OSGA 1PVC2 3AMMA 5EJ3A 3VKMA 1KJLA 1VB2A 4QPIC 1C8M1 4AFMA 1UW8A 2RJKA 1CN1A 4LA2A 3GBGA 1AJKA 3OBRA 2ZAAA 2X29A 2P2KA 2HYKA 4E27A 4FTBA 2ZACA 1QJY2 5C4WA 2UYBA 1WGPA 1I1EA 4AQ2A 5JOZA 1ZZ9A 4NVPA 2WT2A 2YDEA 2GU9A 4W65A 1UPSA 2IXLA 4N43C 2ZTNA 4FP3A 1ENRA 2VVDA 1LODA 4XJUA 5T50A 4GMP0 1QJU3 5LRRA 1W6MA 1LGNA 2FMYA 1QWRA 3TNPB 5K8SA 2PN5A 2VVEA 4CDWB 3M3QA 1COV1 3NVCA 4GWMA 4AFCA 4M0HA 1PGL1 4COZA 3I8TA 3FJSA 1RL3A 4N7UA 2ERFA 3IDCB 1W6NB 4RGGA 2FMDA 3ZFFB 1GV9A 1LU1A 3ZXJA 2HWB3 3VBHA 3OBTA 2W08A 2GC3A 2WIIB 3ZFEC 5AVPA 5FOBB 4JVAA 2QNKA 1YXWA 1X82A 2WNUA 4WM7B 1W2UA 3ALQA 2DURA 4QPGA 1JN2P 5KC6A 4HVQA 2WNVA 1FATA 1FPN2 3SH3A 3WW3A 5H9RA 1VAVA 2EXKA 2XB6C 3V64A 3CO2A 4R9CA 3PJQA 4XIOA 5ABJB 4R9BA 2PHWA 3M4FA 1RUD3 4KGQA 4MXWB 1OLQA 3USSA 1HIXA 5CFCC 4YG3A 4OI4A 1HRV3 3KGLA 2QVSB 4BA6A 2H0VA 4I09A 4XJWA 4KU8A 3MLKA 5I93A 4FPFA 1DLLA 3OGGA 4KU7A 1FMD1 5T5PA 3JBG3 4K1ZA 1POV1 2VQ0A 4F8AA 3EJKA 4IL7A 2YPJA 3N4MA 4IEQA 4B4RA 1DQ0A 5C9AC 1J3PA 1G9FA 1GNHA 2YYOA 4YW4A 1NZCA 2VMHA 4YZ4A 5C4WC 3IDEA 1OQ1A 3AP5A 2EVXA 4CDQC 1SCRA 3PHMA 5LK5A 1XU2A 5EZWA 2GSYA 1APNA 5L73A 1JH5A 4CP2A 3EXUA 2C9AA 1CIWA 2WSUA 4JCKA 3JB4C 4NPRA 1LESA 1LJ7A 4Z8BA 1Y43B 3PVOA 3E5UA 2Z69A 4JDNA 2BQPA 1DQ4A 5FLJA 4QU2A 2XPJA 3SXWA 3NAPB 1UIJA 3H1WA 4M3CA 1H1MA 2B8MA 2A5ZA 2OA2A 3H50A 1NA1B 1UL9A 3DF0A 3UV9A 1ZM1A 3MF9A 2D6LX 2WQZC 2ZGOA 3VKLA 3AYDA 1MS5A 2TEPA 3JZVA 1WUVA 1YUDA 2EXHA 1RUD2 3HIFA 3M3IA 3NV4A 1CAXB 1GFF2 2PFWA 1A6CA 2XUMA 2JE9A 3MIEA 1W6QA 1ND3A 3HMYA 5GKAC 3VZOA 4YZ2A 1HRV2 2P3JA 2NMNA 1F8VA 4LE3A 3OTFA 3VBRC 2D3SA 5DUUA 4N53C 4FXGB 3JBG2 3MPPG 1OLRA 3B3QE 4H7MA 2Y0OA 4DB5A 2R073 1IKPA 4F83A 2VNGA 1MEC1 1YJLA 3U11A 1RC6A 1LTEA 1O3QA 2UU8A 3WD5A 1LGCA 1OMIA 2PQQA 4COVA 1BBT1 1HXS3 2I2SA 1POV0 1W6OB 4IESA 4K7JA 1CJDA 3BPZA 4OHXA 1U5ZA 4FPLA 5BY5A 1QJX3 2RS51 2ZX0A 1H30A 3WINE 2D98A 2AGSA 4PLNA 1I5ZA 1Q8PA 3AP9A 4GH4C 3U4XA 1X36A 1WBLA 4BIFA 2UWBA 4AQTA 2ZGPA 4KNCA 4FPEA 5CNAA 1XYNA 2RR12 3PTYA 5AC93 5BNQA 2XLFA 4RD7A 1OA3A 2P37A 2E53A 2W68A 1W39A 3O0XA 4KGGA 1Y9QA 5HCBA 2BUKA 4C0BA 2QKDA 5C8WA 3IPVA 3VBSB 1F2NA 1VBA1 3WDWA 4TLFA 4RS5C 4KH9A 1EAH1 4GB32 5BYNA 5CB7A 3B01A 4R9DA 4LHLA 1R091 1DGLA 4LO7A 1VBB1 2AUYA 2WFPA 5T54A 1JXNA 5FAXA 3ZN6B 4P9JA 1G6NA 4X8NA 2YROA 1PK6B 2R32A 3KMHA 1AR61 1GBGA 2X5IA 4WM8C 2Z42A 2GMEA 4FAHA 1WD4A 4CDUB 5JIUA 1QHDA 2FQPA 3WUDA 2DTYA 3VN4A 1VBD3 3VV1A 1LU2A 5GLTA 4D7YA 4LHKA 1XE8A 4W6XA 3CJIA 1V9U2 3WP3A 3TN91 2K2SA 5GLZA 2SBAA 4IEXA 1WW5A 1UX6A 2VVFA 1TEIA 4QQPA 2SLIA 1PGW2 5I0UA 4U2AA 3T2TA 2VNRA 3WP4A 1HXS2 3K51A 1DGRA 5KBFA 3I59A 5ACA1 2ZAHA 1OQDA 2XJTA 1QJX2 3POSA 4AI3A 4EJRA 4PQ9A 1YJKA 3VBOB 2ZGUA 4XOGA 4Y5Z0 2XGXA 1PM7A 3HD8B 2QUOA 3FE5A 3FFQA 3I54A 1AR91 4IV3B 2QCSB 4LUMA 2B42B 4O9EA 3O12A 3URFA 3J8F1 2R49A 2NM1A 2CGNA 5JZGA 1O4YA 1QJZA 2BVBA 4LBQD 1DZRA 5JCTA 4EWEA 3MGUA 1J3QA 1JUIA 5BNOA 3AFGA 1OA4A 1G7YA 2Q8OA 3OPZA 4LBQB 3WG4A 2DCJA 2GN3A 1I9RA 4Y20A 4OULA 4HK9A 4HN1A 5HBAA 4ISQA 1OFSA 2OPKA 2K9ZA 2TUNA 5KXCA 2DFCA 3R6SA 2D3RA 4S2DA 4LBJA 2ZX3A 3ZMOA 3VHRA 1UMZA 4IEZA 1NCRC 2XG3A 1AR71 3LOBA 3DV8A 1NOVA 1GZ9A 4I30A 4IEOA 3D0SA 5GLUA 4JDMA 3OD4A 3ZXAC 4QQ2A 1VBD2 1NLSA 4L11A 3WDYA 1FXZA 1R1A1 1JW6A 4Q8KA 4QGMA 3G7DA 4H3WA 2NP0A 2EXIA 2YV8A 4Q0UA 4BMEA 2YC0A 3NKTA 1AUYA 2FBEA 4OHYA 3MIGA 3H8UA 1ZBA1 3B02A 3ZYJB 4ES8A 1PVC1 1AYM3 3IKWA 2ZGQA 4YG0A 1DGRN 4Q29A 1W6PB 1KITA 1IQAA 4META 3VBFC 3JD73 3IT8A 3PVEA 3ZDSA 4I3GA 3IN9A 2VH9A 2A3WA 2Z5WA 4CDXA 4D7TA 3ZFGC 1D2QA 4QD2A 1ENQA 2OZJA 3H3UA 1FOD1 3I4IA 1V6NA 1CESA 2R16A 5KWRA 4YVSA 5DZFA 2ZZJA 1ZBE1 5DZGA 4K20A 2BNNA 2XWJB 2GN7A 3WHUA 3PVNA 3D8CA 1ZRCA 4P9GA 1X8EA 4Y1VA 1XQNA 1VAMA 2R0FA 5L7OB 1PO23 2WA4A 4AFAA 2DFBA 3WW1A 1X33A 4DY5A 1BBT3 1VBC3 3KCYA 3S0MA 4DRVA 3X29B 3T1MA 3CF6E 4XF0A 3WUCA 1EP0A 1DDLA 1EPWA 4FOVA 4LEJA 3S7IA 1ZNPA 2AH2A 3IM0A 3WDVA 1GQHA 2A3YA 3E5XA 3U07A 1NE6A 4LO5B 3D6EA 1SLCA 3AMHA 2V5YA 1NXMA 3VBUA 2UWCA 3IBMA 3MIHA 1LR5A 4M3CE 5HCAA 3L9JT 4XFGA 2VW0A 4P14A 5H9PA 1MS9A 3OGJA 1FPN1 4B4QA 5C8CB 1AYM2 1PGSA 4A7ZA 1MS1A 3VHOA 2HWE3 3ZSLA 5FRAA 4KQ7A 5T5LA 3JD72 4XMIA 4HL0A 1EAH3 1RJ8A 4N9IA 4CZSA 4OI1A 1VBB3 5GZGA 4UW5A 4FPKA 4RFT0 4CEYC 4BHPA 1N3OA 1C28A 5JIAA 1Q43A 2AYHA 4Q1RA 3GYDA 2IFRA 5BPXA 2IXIA 1QJU1 1S0CA 1ZREA 1ZA4A 5D8AB 3QOPA 2ZABA 4JV4A 2R043 3MW4A 2VXRA 3AKQA 2VNOA 4LLOA 2X53S 1CAUA 3WNXA 1XNDA 1KXGA 1PO22 5SV5A 1H1AA 2QE3A 2D6KA 1BBT2 1VBC2 3NV2A 1QNYA 1WLWA 4L92A 4MZUA 4L97A 5BNPB 1EY2A 2BEOA 4Q4V3 1J3RA 1YNAA 2RS13 1PMIA 4YGDA 2HWB1 2ATFA 3LOIA 2HWC3 4DRRA 1Q8OA 1URXA 4AF9A 1H2LA 1U0AA 1EV13 2R1BA 1QH7A 2E63A 3AP7A 2OUJA 2ZHLA 2BYVE 2XKPA 4BQ1A 4PDWC 4IV1A 4QT6A 3GHNA 5B2GB 3VDDC 2XH6A 1AHSA 3USUA 4KWKA 5CFDB 1O5UA 3FLRA 4URTA 3SLIA 4HKLA 1Z7S3 1RUD1 2HWE2 4AFDA 3AZXA 5JSOA 3MZHA 4ZXKA 4A2UA 4XBNA 1EAH2 2A6ZA 1HRV1 1R092 1REEA 4RR3A 1VBB2 4COWA 1TMF3 4JGZA 3SH4A 2JG8C 4XFBA 1Y3TA 2VG9A 5K9YA 1MVEA 2HEVF 1OOPB 4QPIA 4AEDB 2E7TA 4HSJA 1LOAA 2ES3A 2K0GA 4WVZA 4EN9B 5JOWA 3AJYA 2H6BA 4IEUA 2R042 1W6NA 4C90A 4FTSA 3TN92 1AR83 5E8AA 2WFF3 2E6VA 4FSJA 1KDMA 1NQJA 1QXRA 3SHRA 4CRQA 1OA2A 1LOCA 1CONA 2GNDA 4N43A 1NCQB 1VRH1 4G9SB 4OI2A 2A73B 5EFUA 2RS12 3SH5A 2WQ4A 1REFA 2HWC2 1RMU3 2XLGA 4BWOA 3PNAA 2B7YA 4ATEA 5GALA 1EV12 4CEWC 5K0UB 4Y1ZA 2MPFA 4AI2A 3H9AA 4XJAA 1JHNA 3J8F2 1FOD3 4MLOA 4B3NA 1J58A 2WT1A 4SBVA 2G9GA 3S30A 1SLLA 5KXEA 2HJIA 5J37A 1ZBE3 3RSJA 4BPZA 3IIAA 3RJ2X 1Z7S2 1V6MA 2EIGA 3POWA 3ZFEA 1DIWA 1BZWA 4YM1A 1H8TB 2A6WA 3NJZA 4C1XA 2NQYA 1UU6A 4RA0A 5HCFA 4FXKB 4FOWA 5K7PA 2ZKNA 1TMF2 4K40A 1GZWA 2R061 1DU3D 3M1HA 5A33A 2B9UA 4Q1PA 3EHKA 3ZSMA 1LOFA 1ND2B 4P9WA 5F1RA 3V56A 1D2SA 1HX6A 1PO13 2R071 2UYAA 4RSUA 5DZEA 3VHPA 2DVDA 4TZDA 3RYKA 4YVWB 4XMAA 1WW4A 3WG1A 3H1YA 1UAIA 5CFCA 1PGW1 4LO8A 3J26N 4XQ4A 1AR82 4OZXA 2D6PA 4XBLA 2EF6A 4E9KA 2XJVA 1V6IA 2CTVA 5D1IA 5C33A 4FP2A 4CDWC 3PMSA 3ENRA 3H0OA 3W59A 1XXNA 1PHMA 4O9GA 2G4IA 3EBRA 3NWKA 3BIWE 4JQRA 5C9AA 3ASIA 1U5IA 1RMU2 2ZX4A 3R4DB 1KFUL 5AC91 2JG9B 4Q2FA 3ZFFC 5L19A 1ALYA 2YUEA 4I0WB 4XFHA 3FFZA 3QH6A 1KDKA 4CDQA 3LKJA 1FOD2 1K5MB 4Y24A 4AWDA 1ZZ7A 5A3MA 1NQDA 2MEV3 1CAXA 4LE4A 3N7JA 4WM7C 3O0VA 1YI9A 4D3WA 4AQSA 1R1ZA 2XVKA 3ELNA 4RQPB 5J98B 2Q1ZB 3LA7A 1ZBE2 3MW2A 3IWZA 2GMPA 2BPA2 2ZGSA 4K8FA 4RGAA 4Z07A 3ZYRA 3RNSA 1RB8G 3ILNA 3MFCA 2LUWA 5ABJC 2VPVA 1QNWA 2GH2A 3B93A 5EXOA 5DUWA 2Z2SB 5AVAA 4LBOA 3UKTA 1MQTB 1N3QA 1NE4A 1LOBA 1TME3 2MHFA 1Z0HA 1CAVA 1ULGA 1N1TA 1LHNA 1VBD1 1SLIA 2O0OA 2RMU3 3MW3A 1VBE3 1S0FA 5J36A 4AHYA 2DVAA 4AEKA 1JYCA 3P3NA 3VLBB 4OFGA 2GALA 1BCXA 4WBBA 4MSVA 5I8SA 5CBLA 3RJRA 3DPRB 1YRZA 5DXDA 1FV3A 3VBRA 1CPMA 2EXJA 3WCSA 3AXDA 5I91A 4N53A 4XJ8A 1A3KA 4E2SA 1LOFC 5F6LB 5LEJA 5FREA 3GHMA 5CVRA 4I2OA 4AW7A 1EPZA 3FBMA 4JGYB 2ZCWA 2ZJCA 3KZ4C 4I01A 3ZXEA 5GZCA 4P9YA 4YW2A 3B5LB 3JB8A 3WVJA 2ZGTA 3RWNA 2N7GA 5TSWA 4RL7A 4LULA 4I02A 4DNYA 4Q27A 2HWF3 1H2MA 2NYYA 3NAPC 4GH4A 3KCCA 3KQRA 1QJU2 3ZMNA 1NA1C 2VOWA 1C3HA 1PZ8A 1G8WA 3ES1A 4HSLA 3SCGA 4E4SA 4XFFA 4XPVA 3HT1A 3O0WA 2A6VA 2Y26A 2WNEA 4GWNA 4GIQA 2OIIA 4QMAA 5JDBA 4DMIA 2XVGA 1VRH3 1O5LA 2RS31 4LBMA 3HAGA 1TME2 3WQ0A 4AEMA 4GA9A 1WMFA 2HWB2 1DYKA 2RMU2 2D93A 3BOPA 1VBE2 4RS5A 2PHUA 3BOWA 2ET7A 5GLWA 5SV8A 5IK4A 1UN1A 1HQWA 4YZ5A 1MVQA 2WLPA 4HVRA 4X8PA 2YXSA