1RVF3

Fab complexed with intact human rhinovirus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 31
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf300
1C8M2 3VBRC 1VB4A 4YVWA 1R1A2 1V9U2 5DDJ1 2R072 2ZAHA 2HWF1 3VBUB 2VQ0A 1V9U3 1NA1B 4CEWB 4GB33 4YVWC 2X5IA 1F2NA 2BPA2 1QJU1 3JB4C 3TN91 3NAPA 1AR73 1FPN2 2HWE1 3ZFEA 1CJDA 5ACA3 1FMD1 1MEC2 2RM22 2X5IC 2HWF2 2IZWA 4FTBA 3NAPC 1R091 5DDJ3 2WFF1 2HWF3 1NCRB 4IV3A 1B35A 3ZFEC 3TN92 1AR61 2DF7A 1BBT2 1RMU2 2BUKA 1HX6A 1QJU3 3TN93 1Z7S2 1QJY1 4IV3C 4N43A 1B35C 2HWE3 5CFDB 1FMD3 2R061 1VAKA 3J8F2 4N43C 1R093 1VRH2 4Z92B 2WFF3 5BNNC 3VBOA 1SMVA 4GH4A 1D4M1 4YVSC 1AR63 4CDUB 3CJIB 2MEV1 4Q4Y1 3VBOC 1QJY3 1ZBE2 4GH4C 2QQPA 4PDWA 1H8TC 5K0UA 3VBHB 1RVF2 4RHV1 4CDXA 1RUD2 2RMU2 2R063 1RUI1 5J98B 3ZFGC 1TME1 4Y5Z0 5FMOS 1RUD3 1AUYA 5C4WA 1HQNA 2MEV2 4CDXC 1ND3B 1FOD1 4IV1B 2ZTNA 2MEV3 4YVSB 4AEDB 5C4WC 2RS51 1NY71 4JGZA 2RR11 1VBB1 1RUJ1 5CFCB 1PGL1 1AR81 4RHV3 2HWB1 4Q4X1 1RUI3 3ZFFB 1TME3 2WS92 4JGZC 1MQTB 1BEV2 1H8TB 1FOD2 2HWC2 4QPIA 1FOD3 1C8NA 1RUF2 2XBO1 1NY72 1VBE2 1PO21 4RQPC 1C8M1 4LLFA 1VBD1 5D8AA 1VBB2 3VBFA 1RUJ2 1EAH2 1PGL2 1AR82 1R1A1 1V9U1 2RS53 4JGYB 2R071 4Q4X2 4QPIC 4FTEA 2RR13 1VBB3 1RUJ3 1AR83 1E57A 1AYM1 3ZXAC 2HWB3 4Q4X3 5D8AC 1ND2B 3VBFC 1PIV2 1OOPC 1FPN1 2BFUS 5ABJB 1AYN2 1VBD2 4CEYB 1MEC1 2RM21 2XBO3 4NWWA 5AC92 1PO23 1C8M3 4RS5B 1GFF2 1VBD3 4WM7A 1R1A3 1AYM2 2R073 4WM8B 5L7OA 1NCQB 4RQPB 4RR3A 4Q4V1 5A33B 1AYM3 1BBT1 1RMU1 3HAGA 3LOBA 1RHI2 4WM7C 1RUC2 1Z7S1 5L7OC 1FPN3 4N53B 4RR3C 3VBSB 2BBVA 5C9AA 1MEC3 2RM23 1OOPB 3J8F1 4Q4V2 1VRH1 3VBRB 1IHMA 5C9AC 4Q4V3 1PVC1 1BBT3 1RMU3 1HRI2 1Z7S3 4YVWB 2FZ1A 3JD72 1ZBE1 3VDDA 2HWD2 1A6CA 1K5MA 1HRI3 1RVF1 3IDEA 4CDQA 1RUD1 2RMU1 2PLV2 1F8VA 2X5IB 3J8F3 5BNPA 1VRH3 1PVC2 3NAPB 1PGW2 1K5MC 3DPRA 4CDQC 1PVC3 1M06G 3ZFEB 4CDWA 2RS32 1RUE2 2GSYA 5BNOA 5BNPC 1ZBE3 4RFT0 1WCDJ 4QPGA 4IV3B 1B35B 4CDWC 1RVF3 3ZFFA 2RMU3 4PDWC 5K0UC 2WS91 1BEV1 2HWC1 4QPGC 4N43B 5C8CA 5BNNB 4Q4W2 3M8LA 1ASJ1 1RUF1 1VBA2 1VBE1 1HXS2 1QQP2 1EAH1 5A32A 1VBC2 5JZGA 1VBA3 3VBOB 1DDLA 1RB8G 4GH4B 1ND2A 1QJX2 1PIV1 5JZGC 2WS93 1BEV3 3ZFGB 2HWC3 4GMP0 1ASJ2 2Y26A 1AYN1 1QJX3 1AL0G 4PDWB 1TMF1 5K0UB 1COV1 3VBUA 1ASJ3 1RUF3 4CDXB 5AC91 5LK7B 1VBE3 5FOJB 1ZBA2 2FZ2A 1NA1A 1EAH3 4CEWA 4Y4YA 2WLPA 3JBG2 5C4WB 1OHFA 3VBUC 1NA1C 2ZZQA 3JBG3 1HRV2 1X36A 1RHI1 1PIV3 1VB2A 1RUC1 1TMF2 1COV2 1AYN3 4JGZB 1NCRA 1TMF3 1COV3 2WZR1 5AC93 1R082 2R042 1RUG2 2RS12 1AL21 1NCRC 4QPIB 4NWVA 2RS13 3JB8A 1POV0 5CFDA 1RHI3 1RUC3 5D8AB 1HRI1 3VBFB 3JD71 4GB32 2WZR2 1POV3 2HWD1 1AR72 5CFDC 2WZR3 2PLV1 1BMV2 5FMOL 1AL22 4CDUA 5ACA2 3CJIA 1PGW1 1AL23 1RUH1 5DDJ2 2RS31 1RUE1 4CDUC 3VBHA 3CJIC 3JD73 4WM7B 1PO11 2XPJA 1QJU2 2HWD3 5L7OB 1W39A 3VBHC 4RR3B 3VDDC 1CD3G 2PLV3 1ND3A 2HWE2 1RUH2 4IV1A 1FMD2 5BNNA 4YVSA 1RUH3 4AEDA 1R092 2WFF2 4Q4W1 1NG0A 1ND3C 5C9AB 1PO12 1RUE3 1VBA1 2RS33 4IV1C 5CFCA 3DPRC 1HXS1 1AR62 1QQP1 1VBC1 1PO13 5BNOC 4AEDC 3FBMA 1MQTA 1H8TA 1QJY2 1OPOA 4FSJA 5CFCC 5GKAC 3ZFGA 1QJX1 2WWSA 3ZFFC 2BFUL 4EJRA 1AR91 2R062 1MQTC 4GMP1 3VDDB 4JGYA 4Q4W3 1K5MB 1NOVA 1D4M2 4CDQB 5C8CC 1ZBA1 1HXS3 1X33A 1QQP3 1D4M3 1VBC3 5BNPB 1EV11 4JGYC 3JBG1 4Q4Y2 5ABJA 3DPRB 1AR92 4CDWB 4CEYA 4Q4Y3 1HRV1 5BNOB 1ND2C 4RHV2 4RS5A 1AR93 1RUI2 1TME2 4GMP3 5ABJC 4QPGB 4WM8A 4CEYC 1NCQA 1EV12 1R081 4RQPA 1ZBA3 5A33A 2R041 4RS5C 1RUG1 1QJZA 2RS11 4FTSA 1EV13 5C8CB 4WM8C 4CEWC 5J96B 4N53A 2RS52 1NCQC 3S6PA 2RR12 3VBSA 1HRV3 1POV1 1OOPA 2HWB2 5A32B 4GB31 5JZGB 4N53C 3VBRA 1AR71 3VBSC 4BCUA 2TBVA 1BMV1 1R083 2R043 1RUG3 5ACA1 4SBVA 2XBO2 2GH8A 1PO22
chains in the Genus database with same CATH superfamily
1C8M2 1ULGA 2WNVA 1WKYA 1OF4A 3VBRC 2P6HA 4A7KA 1O6UA 2WWJA 3WNOA 2ZAHA 2YZ4A 2HWF1 4INDA 1BK1A 3POSA 3RGBA 4BWOA 1DFQA 1IG3A 2NZ9A 4D0QA 4EN8B 3RZGA 1BXHA 3CIHA 2VCBA 1KXGA 1F2NA 2AYHA 2GMMA 3JB4C 4D8MA 3MICA 4W50A 1LHUA 3AL6A 4XFCA 3M3OA 1AR73 3WX5A 3LEMA 3E5XA 4MGIE 4PBOA 1FV3A 5HXVA 5I0DA 4D7SA 3NNGA 2FDKA 3MEPA 1UYYA 3NJXA 3D5OA 1CJDA 2I2SA 3PUHA 4UW3A 1Q8QA 1KQRA 3OEAA 4AFDA 2BBAA 3MFCA 4IL7A 3QACA 1R091 1YWKA 5DDJ3 1PMIA 1F15A 4KGGA 3FMGA 3D6EA 4XF0A 1OD3A 4QX7A 1B35A 4EE2A 5B4NA 2XXZA 3VDCA 5JSOA 1OH3A 2BUKA 4XJAA 4EN7B 1AX1A 1AF9A 3I2GA 1I6XA 1IOAA 2P6CA 3JQXA 1HX6A 5FZDA 5J1XA 3RPQA 4Y20B 2G9ZA 5FREA 3RJRA 4ZU4A 5FYTA 1OURA 4IXLA 2W1SA 3VD9A 5FZ1A 3RG0A 1H9WA 2XVLA 5K7PA 3PMSA 1EUTA 5KWRA 3GDBA 1HJFA 1YQ5A 3AFGA 5IJRA 4TLFA 5FO7B 4BZ4A 3AMNA 4DQAA 5DUWA 1LAJA 3WW1A 5JMCA 2DDUA 2RJLA 4N43C 1H2KA 3NJZA 4LBLA 5D21A 3VKOA 2X29A 3KV9A 5H9SA 4BE3A 4DPNA 3BCWA 3H1MA 2R0FA 1J59A 1MS1A 2EIDA 5A3UA 4CP9B 5FZ7A 2HEWF 4LTAA 1PK6C 1ULCA 1N1SA 3C7FA 2HJIA 4H7MA 3VL8A 2GMPA 3ZSLA 3VBOC 3QBQA 4Y22A 3WW4A 1XNAA 3CBNA 4QKFA 4XF3A 5FZEA 4BIOA 1Y9MA 4PDWA 5FQ0B 1H8TC 4ES9A 3S7IA 1CQ9A 1LESA 3AYDA 4GWIA 4RHV1 1ZNPA 5HV0A 1ONAA 1RUD2 1A34A 2D97A 5FUPA 3PIGA 2D3SA 5T5JA 4YNIA 1Z78A 3T1LA 3ZFGC 4FP3A 3RZJA 4Y5Z0 5F32A 2W46A 4NO4A 1LOEA 2DV9A 4UBGA 2P3IA 3MGUA 2NM1A 5C4WA 4IETA 2ZGPA 4CCCA 4CDXC 4AI2A 2BGPA 5H9QA 2GP5A 1GWLA 2JDAA 1WW6A 2W92A 2ZTNA 2ZEZA 3AP6A 4IV1B 3WP5A 2Q8DA 1ZYBA 1T2XA 3ZXKA 1O5UA 4FPCA 3BKZA 4XCAA 4M00A 1GZWA 4BHPA 2P5BA 4AEDB 2PHXA 4JGZA 4P14A 2YY1A 3IB3A 5FDBA 1GBGA 1RUJ1 1PGL1 4U36A 3ZXDA 2A6WA 4BQ2A 3PMEA 1BCXA 2BERA 2HWB1 1W8WA 3J7LA 4XEZA 3ZFFB 2ARAA 2CWMA 4QU1A 1XXNA 3HN3A 4CCOA 3BTXA 1BEV2 1OI6A 4YZ4A 1FOD2 3ZIXA 3Q8FA 1HB2A 1V6NA 1UOJA 1YIPA 4QPIA 2PHRA 5FZOB 2Z42A 2DUOA 1F9KA 5EJ1B 4BXFA 1HKDA 4J6GA 1NY72 5E16A 3SH3A 4XZUG 4SLIA 4RQPC 1C8M1 5JSPA 4XZPA 3N9QA 3V0AB 2IXHA 1AR82 1VMHA 2GNTA 3ZMOA 1NXD1 5JLVA 4DUVA 1JUIA 2VVEA 4FTEA 3VHRA 5B2GB 4C91A 1W6MA 4NIGA 4I3GA 3RWNA 4XFFA 5IFTA 1ZZ9A 3QLQA 3I2IA 5CU1A 3ZXAC 4Q4X3 2ADDA 2GN3A 5C5UA 1ND2B 1A3KA 5F2WA 4OZOA 5FK7A 1PIV2 5ANNA 4V2WA 1OOPC 4I01A 5J3UA 2PAKA 3UT0A 5LA0A 1B09A 2VW1A 3LFIA 4UT5A 5KXBA 1S0CA 4AGVA 1IPKA 4Z82A 1IS4A 4X8PA 4TLGA 2DURA 3KF5A 4Y1ZA 5FPVA 4LT5A 2ENRA 1A8DA 4I0BA 2VVFA 2XBO3 4LO5B 1PO23 4TSVA 2E51A 2EAKA 1GFF2 1VBD3 2CGNA 4XDOA 3T2PA 3BI3A 3TNPB 4NPRA 4A45A 5J48A 4YGCA 1LENA 1R1A3 4BMBA 3I3QA 1AYM2 3ACIA 3OJBA 3CZJA 4NN0A 2DBNA 4BM8A 3GF6A 4COUA 1FT9A 3OY8A 4ZZ8A 1URXA 3B01A 2A71A 4WM7C 2CL2A 1Q8OA 5DUXA 4HKWA 3QH7A 3ZSMA 4N53B 2QQOA 4K40A 1UKRA 1DYPA 4HVOA 5FP7A 5LATA 4RR3C 4FOVA 1J3RA 3HWJA 2W9XA 4KL1A 3RZKA 2WC2A 2IVIB 1W6PA 1K45A 4EQVA 4Q4V2 1OFNA 2XL7A 2ZX4A 4HZFA 4CUGA 1IHMA 4MSVA 3WNNA 1LOBA 2LM3A 1K5JA 1QH7A 1PVC1 4Z2AA 4FXKB 4Z2WA 3N7LA 3SQOA 4LE4A 3MF9A 3VD5A 3IN9A 2WNVB 3OGSA 5CIRA 2Y6HA 3NQHA 1LU2A 1F5FA 3JD72 2ZGUA 3O5SA 3KGZA 1QMJA 1YIFA 1CZVA 1UYZA 2HWD2 4CRQA 1XYNA 3N9MA 3O7OA 1HRI3 5EQUA 2SLIA 1NYWA 3MFAA 1IGOA 4PJYA 4XFGA 4HXCA 1RUD1 4LBNA 4Y24A 2PLV2 5FPZA 4E4HA 4H3WA 2E53A 3ACLA 3DECA 2YMZA 1F8VA 1K42A 2JDPA 3VKFC 1TZOA 2D6LX 4EZHA 2BJSA 4JKKA 4MX3A 1UMZA 1GNZA 4CDQC 3TRSB 1N1YA 3UL2A 1WLTA 2W68A 4R9BA 3LA3A 3CL1A 5FKCA 4ZXEA 2GSYA 2VBPA 2JKBA 1STMA 2V09A 1S0GA 2VMDA 2J1TA 1IKQA 3SXWA 3MYXA 2ZEYA 1B35B 1CN1A 1UCXA 3SHRA 4CDWC 1MZFA 2JE7A 3PNAA 2Y0IA 4QKNA 3VHOA 5SV8A 1WD3A 3HJRA 3UGFA 1PNGA 2CGOA 1BEV1 1KFUL 4QPGC 4XTPA 2C9KA 1SLLA 3PTYA 2CHHA 5BNNB 2C5DA 1ZRCA 5A3TA 2RVAA 4Q4W2 3VLBB 3LQCA 2RHPA 3GCWA 3M8LA 5F5CA 1VRBA 1VBA2 4AGGA 4MV2A 1F5JA 3ECQA 1EPWA 4NPLA 1HXS2 1GWKA 3VDBA 1QQP2 4PI0A 3HVDA 4BISA 5A32A 1S2BA 3ZYRA 3W20A 4JRAA 1XNBA 3AJZA 4COVA 4I0AA 4YG6A 1WBLA 2CAUA 5HCHA 5F39A 1US2A 1SDWA 4LKDA 1KEXA 1W6QA 5GLTA 1PIV1 4FFHA 5FJKA 1F4AA 4AG4A 2WS93 2XGXA 3ZYHA 1Q5OA 1OH4A 2W87A 2HWC3 4Y22B 1ASJ2 3WCRA 3GALA 1QJX3 3WDTA 1CAVA 4PDWB 4P5YA 1QY4A 2PXJA 3VBUA 5LK7B 2D7FA 5FOJB 1ZBA2 1YQ8A 2OUHA 3DYOA 3RDIA 3HD8B 4BOWA 4QU2A 4YG3A 3RNSA 4MGQA 2MHFA 4R9DA 4XJZA 4XBLA 4IE6A 2BWAA 2P34A 4LNVA 2HH9A 1OHFA 4YZ2A 5C4WB 1UPSA 5A3MA 2OKXA 4I2OA 4N8MA 5I0TA 4BDVB 3FUQA 4G9SB 4BIFA 4F8AA 3AZXA 4B29A 3OF1A 3WV6A 1VB2A 1ENRA 2JDHA 5BNQA 3H3ZA 1GZWB 4BQ5A 1TMF2 5IK8A 1COV2 2BGOA 2VZ3A 3DKWA 3VDAA 4JGZB 1DCSA 1S0EA 2EXHA 4JRLA 4F3JA 1UY4A 4XC9A 3ACGA 4CP2A 1LEMA 2CSGA 5JAXA 1VMJA 2QBXA 2UWCA 5A3PA 2QFEA 3N9PA 1MPXA 1WD4A 2R32A 4XQWA 1OMIA 2OQ6A 3I3BA 3H0OA 3NWKA 4GKXA 4HKOA 5FKBA 4DOUA 4LBOA 4QPIB 1HDKA 4LBQA 4NWVA 1SBEA 2RS13 4NAMA 3KB5A 5GLWA 1G9AA 4QQLA 5A6QA 4BU2A 3U10A 1DGWX 4UWDA 1OLMA 1HQLA 3JD71 3QH6A 4NOTA 4WV8A 5FZGA 1N3QA 2XJVA 1MS9A 1POV3 4DEQA 2HWD1 4AVCA 3UJQA 3MLKA 3IPVA 2JIJA 1W6MB 2XUEA 3GZTB 5FRAA 2BU9A 1LODA 2PLV1 5LA1A 1AXZA 3AVRA 3PHMA 3IT8A 4HLTA 1AL22 1XB9A 3G6JB 5DG2A 3CJIA 3RYKA 4F83A 4HVQA 1DU3D 1UZYA 1BVVA 2VZRA 4WZCA 2XOMA 4EV0A 2EIGA 5FYZA 5F3EA 5IW0A 4XAEA 4PLOA 4RGAA 1PO11 1I5ZA 3AXDA 4MVTA 5DUUA 3ZKUA 2VOXA 4LK6A 4BB3A 1UMIA 3POIA 3TNQA 3POGA 3CF6E 4O61A 4OQ9A 4BLJA 4LHSA 1N1TA 4CCDA 2HWE2 3OY8B 1KS5A 1VJ2A 4YZ1A 5EPAA 3LB9A 4OHXA 2WO3A 5EYXA 3FLTA 4YVSA 4XURA 2VTXJ 3ZYGA 2WFF2 2WWUA 4Q4W1 1NG0A 4YGEA 4CA9A 1VBA1 1XSQA 2RS33 4IV1C 4JQRA 1CZTA 2W1UA 4LUKA 1LNSA 1HXS1 1AR62 4P9WA 1QQP1 4NIIA 5FAXA 4BLIA 2JE8A 1W6PB 4YW2A 5JIUA 5GLVA 2NLRA 1BJQA 4AEDC 1W6OB 5EV7A 4DZGA 1MQTA 4GZ9A 4RFRB 4ZXKA 5F5AA 2A6VA 2OYZA 2ZHLA 3ZFFC 1KS4A 2BFUL 4EYUA 1JZ5A 1PM4A 2R062 4OYUA 1W0PA 1PMHX 1SBDA 2VZSA 2WNEA 2WRAA 2OQ7A 3E5QA 4Y3OA 4AOCA 5GLZA 4ASKA 3TEYA 3AZVA 1C3HA 2QTWB 1D4M2 2QJVA 3RYRA 1ZBA1 3CHXA 3AKRA 1QHDA 1POQA 1MS3A 3MLLA 3KQ4B 1IG0A 4I02A 1VBC3 2JG8A 3D0JA 1IKPA 2WQ4A 2D6PA 1C4RA 4Q4Y2 4XILA 5F3IA 3T0DA 3F95A 5ABJA 5C6CA 3F2ZA 3U75A 5FJHA 1OLRA 2ZABA 4BQXA 5FLJA 4CCLA 1SEFA 2HEVF 3BALA 4CEYA 1ND2C 4YW5A 1K12A 5FO9B 2WNUA 1GP5A 3ABZA 4RS5A 4L9BA 4QB1A 2Q1ZB 4W6XA 5EIYB 5FR3A 1ZRRA 3GZUC 2CDPA 2R1DA 2VCCA 4ONUA 2X09A 1W8FA 3W9AA 4XUQA 1DYKA 1C5IA 1NCQA 2IVJA 3WNXA 2VMFA 5I0UA 5A33A 1YHFA 5LCWL 3ZDSA 1E5SA 1QJZA 5EJZB 3OGVA 4UW6A 4BQWA 1EV13 2XR4A 3PL0A 3VHNA 1BVP1 2D6NA 3OPZA 3Q8EA 3MIGA 3ZM8A 3N9OA 1RXFA 4M4PA 4CEWC 3DYPA 1X8MA 2CWSA 2RE9A 2RS52 3H1YA 2K9ZA 4IW3A 4YFZA 4ZS2A 4K21A 4X6QB 2VNOA 3KCCA 3SEPA 4AYUA 2VM9A 1MR5A 1W8NA 1GU3A 1SZBA 5T55A 1JMUB 2PHLA 1LTEA 3NNLA 5A32B 3HQXA 3TOJA 2G19A 4ZZ5A 3MIFA 2B4KA 4N53C 5FY4A 2D5FA 1UIJA 4LE3A 4ARYA 3JCIA 3POWA 4XIOA 4H55A 4YG0A 1R083 3LWCA 3AC0A 2BNMA 1IS5A 1W6QB 3WG1A 2VXRA 2X10A 4IGPA 4RGKA 3P1IA 3DV8A 1LOCA 1KFXL 1P8JA 4JC1A 4FOWA 3U78A 4YVWA 2D93A 1D4VB 3H7JA 4V1PA 1V9U2 1CAVB 3LDBA 5GZEA 2ZGOA 1UZWA 5FBJA 1PZ8A 1WLWA 2WA3A 3KF3A 3VBUB 4D6SA 4AEKA 5A3LA 2JKXA 1JZ7A 4M3CF 2WNVC 1V6LA 4YZ5A 3MDPA 2X5IA 4YW3A 2BPA2 3ZXJA 2YFZA 1VIWB 3TN91 5FYVA 3NAPA 1GP6A 1UU5A 4IE5A 2PHUA 1DHKB 4LUMA 1GNYA 2HWE1 4FP2A 3ZFEA 1D2QA 2GNMA 4NVPA 2HWF2 2A70A 5F9TA 1V0AA 4HT1T 4XFIA 4AQSA 3FLRA 2ATFA 1YI9A 2BVVA 2WFF1 1QH6A 3ALQA 5A80A 2VH9A 1Q8VA 2ZX0A 4IV3A 4OHWA 4DXRA 1W03A 4G4FA 4QWNA 3W59A 4XF9A 1AR61 2XHNA 3PUAA 2DF7A 5EWSA 1RMU2 2VZTA 5FYYA 2WZ8A 3HNBM 1QJU3 2ETEA 5A7SA 4CPBD 4NIDA 1Z7S2 4P9JA 2W91A 3AYEA 1B35C 1DQ4A 2WO7A 4HK8A 4LBQB 4L92A 4LO4B 4NHLA 4XHXA 5FXVA 1KITA 3D82A 3LPGA 2QQKA 5FZ3A 4LO7A 3C2UA 1ZZBA 4P9LA 2FMDA 1FMD3 4P5HA 5FIXA 2R061 1L7LA 1VAKA 4PLNA 5C3OA 2VVDA 1JXNA 2C9AA 2J1EA 2DVFA 4R52A 1VRH2 2F6BA 3IPVB 3KM5A 5BNNC 1UAIA 1D4M1 1BK0A 3FLPA 1YJKA 3AB0A 2UWBA 3GCXA 3ILNA 2ARXA 3NKTA 5A7NA 3K48A 2UYAA 2BV4A 3CJIB 2MEV1 3BIWE 3NV4A 2ZHKA 4BYYA 4N90A 4Q4Y1 1QJY3 1W90A 3M2MA 2KA3A 2W08A 3LE0A 3V0BA 4QB6A 4XDQA 3O1RA 1JYWA 1RVF2 4HANA 5LY2A 2RMU2 1QOSA 1YQ2A 2ID4A 5LBEA 5KXCA 3BU0A 2LUWA 3T09A 1UWWA 4FPKA 5FCCA 3O1OA 2NPIA 1KD7A 4JX0A 5FMOS 4TZDA 1RUD3 1HJGA 2P3KA 2VZOA 4QDSA 1GQGA 2GAUA 4MGYE 2E9QA 1WBFA 1HQNA 2VR4A 3ITQA 3PUQA 1SQ4A 4HVRA 1MS4A 2ZGKA 2C0ZA 1WUVA 5FV3A 4PIZA 1JH5A 1W9TA 5JMOA 5JXGA 1X7NA 2J1UA 3AP7A 5IAVA 3I49A 4CXYA 1YUDA 2YC4A 1DQ1A 2AZ5A 2XJTA 4XUTA 4CVUA 3GHMA 5DABA 4YVSB 4OI1A 4AW7A 5IT6A 5C4WC 2RS51 2VXJA 2FHRA 3HT1A 3CMGA 3KV6A 4MGTA 1VBB1 2BZDA 4LPLA 4E8DA 4ZHNA 1U5ZA 5KHHA 1O91A 2WZPP 3DYMA 3MO4A 3W58A 2CV6A 3VD4A 1RUI3 1WW5A 5DZEA 1TME3 4Y1VA 4M01A 1BHGA 4JGZC 1MQTB 2V5DA 3MW2A 1UY0A 4V2VA 1YQCA 2ORXA 1CX4A 2WDBA 4MXVA 4NR1A 4CU9A 4B4QA 5IK7A 2KXLA 1FOD3 2B8MA 1C8NA 2NMNA 4B8EA 4MHUA 1RIRA 1VBE2 1Q8PA 3WY6A 5BUVA 5D8AA 4A3XA 5CKNA 3VBFA 2JDUA 1RUJ2 1PGL2 1BKZA 4XHBA 1PHMA 4DIQA 1V9U1 2QQWA 4QPIC 2PAMA 2LROA 2XJQA 2RR13 4EWAA 5FY9A 1WGPA 1HN0A 4Y1XA 5C3PA 5EFUA 5FYIA 1CX1A 1AR83 3LCPA 1UOGA 4OUMA 1UZVA 5JVVA 4GD4A 2D6KA 1W99A 2WAAA 2JG8B 2B7YA 1RUOA 5LRSA 4AVTA 4YGBA 4MZUA 4AFMA 1US3A 3OG2A 5ABJB 3H8OA 1AYN2 2Q1MA 3FN9A 3VD3A 1YNAA 1OLME 2ILMA 4A7ZA 4CEYB 3BVCA 3K77A 4NWWA 4QM9A 2VMCA 5AC92 2CY6A 2WNUB 5T50A 4AVSA 4RS5B 4GWJA 4Q8LA 2QQUA 2YGLA 1JZ2A 1UXXX 3A4UA 4GJYA 1XE0A 2R073 1JZ3A 5LWBA 1F31A 2D3RA 2IXCA 1NCQB 2Y6FA 5A33B 1AYM3 1IZ3A 1RMU1 4EROA 2PN5A 3CQOA 1ULEA 4KWUA 3HAGA 3LOBA 3FHIB 4K7JA 3O1SA 1RUC2 4HG6B 4O65A 1Z7S1 2RJKA 4NRQA 5J37A 1FPN3 3C7OA 4PIYA 4HN1A 3CKHA 3FHQA 2RJ2A 4Y4RA 5DG1A 2BBVA 2E32A 2OZ6A 3FUOA 5C9AA 5K4LA 1MEC3 2RM23 2B45X 3H8RA 4RN5A 2D6OX 4JDOA 3UNPA 3ZN5A 4Z1VA 4YM1A 5CEHA 4L97A 3BOPA 1VRH1 2GH2A 1H6XA 2AGSA 1J1TA 3N7JA 5JXIA 5F7UA 2YYOA 3AK0A 2A3YA 1SLTA 4AHWA 2WR9A 4Q4V3 5CADA 1BBT3 2EA7A 1W28A 3U4SA 3ZXGA 3BU7A 4FQZA 5LZ6A 5FLHA 1D0GA 4YVWB 5C33A 3FJSA 1CVNA 1KDKA 4HN0A 3VZOA 3TB0A 2O1QA 4PLMA 5I8SA 4D7TA 3KVAA 3B9CA 1RVF1 3R0RA 2ZX1A 4Q0SA 3WQ1A 2RMU1 1GSLA 4LULA 3VV1A 1XJAA 1ACCA 1QGLA 4CYDA 2X5IB 3AMQA 3J8F3 2ZGRA 5BNPA 1PVC2 2P17A 3NAPB 4CP1A 3Q8BA 1PGW2 2E33A 2B9VA 3IDCB 3NVCA 4UI9L 4A44A 5T5PA 2DVDA 3WF1A 5DAQA 1MVQA 3GJAA 3TYJA 1M06G 2XL9A 1S0IA 3ZFEB 5BNOA 4QHZA 2Y6LA 3AL5A 4TTGA 3BOWA 5JI9A 4HETA 3DXTA 4QDQA 4YYOA 1ZBE3 4KQ7A 4RFT0 3KT1A 1YJLA 4WVZA 4IV3B 4OFGA 2LALA 2VQTA 1JYIA 4O9EA 4PBPA 5BXXA 3WW2A 1XQNA 5K0UC 3QD6A 4B7KA 3BN6A 1S1AA 1RJ7A 1UY2A 1K3IA 4LA2A 4Q8KA 2DCTA 3U0ZA 4JZRA 1PZ9A 5F8PA 1VBE1 1Y9GA 1G86A 2WN2A 3ME2A 3R05A 3SISA 2EIEA 4COWA 3WF0A 5K8SA 2WL1A 5C70A 1S55A 5JZGA 5K9YA 1VBA3 1UQXA 5CVRA 2N7GA 2Y33A 5T52A 3HQUA 5LY1A 1UD1A 1QIQA 2H6CA 2XUMA 5TSWA 5FMBA 3ES4A 1LHWA 4XQ4A 5F37A 5BV6A 4XACA 2ET7A 1NZIA 2R0HA 3NNMA 3QOPA 5A1FA 3MZHA 1GOGA 3NNJA 4J25A 1JI6A 2L9LA 2J7MA 1D7PM 1REDA 3KWVA 4GMP0 4JKMA 3GJBA 1AYN1 1QNYA 4HMZA 4Q0QA 5DQ0A 2ORZA 4NIAA 1AL0G 3V0BB 3T2TA 1UZ0A 1DGLA 1ASJ3 1RUF3 5DAWA 3RI9A 3OB8A 4KGQA 4COZA 4XJ9A 5AC91 3RZMA 3B7MA 2FZ2A 1NA1A 4CXXA 5CA6A 1EAH3 4XXPA 3S57A 1ULFA 1M4WA 2AH2A 3FE5A 3OBRA 4LO6B 1I3HA 4Y4YA 5CNAA 5ERLA 4C8DA 3JBG2 3A21A 1OA2A 3VBUC 3VKLA 4MH0E 1UYXA 4IE4A 4JTNA 1OA3A 2ZZQA 4Q5OA 5DPNA 3FWEA 5LASA 1RUC1 2B42B 3ZN6A 3HR9A 2A3XA 2E63A 3M3IA 5BY5A 4BQ4A 5FPUA 2UURA 5JOYA 3DKQA 1UF2C 3E6BA 3GBWA 1SCRA 3MLJA 1TMF3 2W3JA 1FAYA 4NMIA 2CAVA 1COV3 5DXDA 5LK5A 2WZR1 5I8TA 4I3PA 1DQ2A 2EVXA 2R30A 2Q1FA 2FMYA 1UMHA 3WD5A 1RUG2 2RDNA 2RV9A 1TQ5A 3ES1A 5E89A 4EWDA 1DGRN 3WNPA 2PAEA 1R64A 3PU8A 4AR2A 1Y9QA 5LBFA 3KT7A 4FFGA 4IEUA 1PX4A 1LB2A 3AFKA 4KG0A 4YM0A 2DVGA 2BOIA 2XWJB 2RDRA 3IBMA 5FBZA 3N35A 4E2GA 1RHI3 4GWMA 2KR2A 4UFJA 2ZA9A 3WVJA 1UO9A 5D8AB 4EN0A 4R8HA 3HN1A 3VBFB 5IVEA 1KRIA 5KHGA 1VLNA 3ELNA 1CAWB 2C24A 3P6BA 2VOKA 1AR72 4CCJA 5A70A 4AHXA 2BYVE 4HK9A 2VZ1A 4OZXA 5JIAA 4S2FA 3MPBA 1XOYA 4CDUA 1WWYA 3NL1A 3VKNA 3TWIA 3UK9A 4YLZA 3AKSA 2YU2A 1XSRA 3C7EA 4DNYA 1PGW1 4W65A 4A42A 1AL23 1RUH1 5KBFA 2FD8A 4AQ6A 2HBUA 1A78A 2VO5A 3ASIA 5DDJ2 2XWBB 3VBHA 3ZPYA 2WYFA 1UY1A 2XHKA 2HBTA 2H0BA 3AP4A 3LEIA 3CJIC 3PIJA 2YFUA 3JZVA 2Z5WA 5FYHA 3ZYJB 3OGJA 1W9SA 2VE1A 1Q56A 2WO1A 2X53S 3SCFA 1ST8A 3HIFA 2WQZC 3LGRA 1DZRA 4QGMA 4ZY9A 3A23A 2CGPA 3ZPOA 4OMCA 2D3PA 3VDDC 1O5LA 3AP9A 3GHNA 4K9SA 3HT2A 3I2DA 3T08A 2D44A 3AKTA 1OBNA 4D94A 4GAZA 1OUXA 5C3QA 3HMYA 4QXHA 3OYWA 3SEEA 4M0NA 1SLIA 4LO8A 1GR3A 3LIGA 2E6VA 1FV2A 2JX9A 3WP3A 4Y1UA 4DINB 5C9AB 1PO12 1RUE3 4NAOA 4LA3A 3DPRC 3NMBA 4QHBA 2IXKA 5JSRA 4AL9A 1ENSA 4GQ7A 5IVVA 3AM2A 3FBYA 2EXKA 1ULOA 2WSVA 1W8HA 3LDKA 3NJYA 3ZO0B 2PHDA 1H8TA 3L9JT 1AJKA 1U5XA 3OCPA 2VY0A 4I0WB 1OPOA 3ZR6A 4FSJA 4P9GA 1W9FA 2R6QA 5A3NA 3BTYA 2NP0A 2AACA 5FY7A 1XBFA 3ZFGA 2WWSA 4I30A 1JBCA 2DTWA 1LRHA 1FI2A 1LHOA 4MO3M 1AR91 5KR7A 1LHVA 1MQTC 1NX9A 4XFBA 4K6BA 5FPLA 3PVOA 1WW4A 4GMP1 4PF1A 3MI8A 4DFSA 2P37A 4ZONA 1U5YA 2DFBA 5C8CC 1YLLA 3IDBB 5GLUA 1KJRA 5FYUA 4QX1A 1TNFA 2WYSA 1D4M3 1SLBA 2GMEA 5LA9A 5BNPB 2O8QA 3PDQA 1WA4A 2PHFA 3JBG1 3T0BA 4DS0A 1CWPA 3IIAA 5A7WA 4AVVA 1QNWA 4L2NA 4Q4Y3 4LBQD 5BNOB 1ZZ7A 4CTEA 5HXMA 2JG8C 3K3NA 4TXWA 5FZLA 4A41A 3KSCA 4LBKA 4XYXA 2DCZA 2GNDA 3J7HA 5ABJC 1JN2P 2QVSB 2Y6JA 1W8UA 4LITA 5T5LA 3WXPA 1GOFA 1S0BA 3THTA 2VUCA 3L2HA 4WM8A 4IGOA 4CEYC 1NLSA 1EP0A 4DUXA 4RQPA 5F3GA 3A7QA 3RMXA 4RS5C 1RUG1 4OVEA 2VCMA 3QCWA 4XFAA 3TEXA 1LU1A 1H1MA 1NZCA 1AXKA 5J96B 2F17A 2PELA 1CIYA 4XDPA 5FFOC 1GKBA 1NCQC 2GC0A 4FFIA 5FUNA 3S6PA 3VBSA 4DEVA 3B9IA 3K3OA 1ZRIA 1G7YA 1TG7A 5KXEA 1HRV3 4MXWA 4W6WA 3KV4A 1E5HA 4YW4A 1OOPA 2E7TA 3RRDA 4UYBA 1WZXA 2YBKA 4E2SA 2XLFA 1YI7A 2O8OA 4NJ4A 5JZGB 1O3RA 2V73A 4HSJA 2D5HA 2GP3A 3BPZA 1AR71 4O9GA 4L99A 4BCUA 1WCQA 5GZDA 2TBVA 1ODNA 4XVHA 2JDNA 4CE8A 4ARXA 2R043 2FCVA 4SBVA 1V70A 2XBO2 4Q2FA 5EP9A 2OT7A 1PO22 2WBKA 3SCGA 2YV8A 2QNKA 3N9LA 2G9FA 1VB4A 2J1RA 1GV9A 1R1A2 5IVCA 5DDJ1 1Y43B 2DU0A 2JG9A 1I5PA 3LAGA 3O1MA 2A5ZA 2X8KA 2VQ0A 4IESA 5F1RA 2WSUA 3WF4A 4QGLA 4JQTA 4N7UA 1V9U3 4QD2A 1NA1B 2VMGA 2ZGLA 5FXWA 1C28A 4ZKTB 4GB33 2ZZJA 4YVWC 5HCAA 2A73B 1G6NA 2VNRA 3WW3A 3CLPA 1H1IA 4LKEA 4KBBA 5DAPA 1OQ1A 5FUIA 1LOFC 3I59A 2XQRA 1PZ7A 5ACA3 1VE0A 2H0VA 2X5IC 3ZN6B 2VZQA 1XE7A 4FTBA 3NAPC 3K4ZA 3Q9OA 4FPOB 1UPIA 1YO8A 2NYYA 5FTTC 2HWF3 3EQEA 5FY5A 2VJXA 2CTVA 2JB4A 3LSEA 3ZFEC 2ES3A 1T6BX 3TN92 3VUOA 3KZ4C 1BQPA 3CU7A 2VUAA 2BWCA 3OBTA 4Q1PA 5LA2A 2EIBA 2Y6KA 3ZYFA 4CU7A 4BQYA 2SBAA 4Y5TA 4IV3C 1OKQA 1XE8A 5A3OA 2V4VA 2ZKNA 3UJOA 3TAYA 2K0GA 3IWZA 5FZ8A 4RSUA 2YROA 3IZOA 2Z69A 4B3NA 2XLAA 5CYYA 2IWGB 1VAMA 1R093 1YFYA 2ZXQA 3RVHA 5HBAA 2WKKA 3B00A 1SMVA 3CNAA 3OPTA 4GH4A 2YHJA 1JUHA 3V65A 4D69A 2NQYA 2WT1A 3THPA 3ACFA 1U0AA 4AEJA 4QX3A 4DXZA 1JYNA 4CDUB 2XJUA 5FPAA 4XMAA 2AREA 2B39A 2WA4A 3MHZA 2ZACA 4QB2A 2D98A 4OHZA 2K46A 1APNA 5KC5A 4W4ZA 3AMMA 3VBHB 1LGBA 1XPWA 1GOHA 1H4GA 5A3WA 4BQ1A 5CBLA 3M1HA 4XPVA 3VZJA 4MG2A 3T1MA 2VNVA 4YZ3A 2MEV2 1NXMA 1C1LA 2Y38A 5LRRA 2VG9A 2DVAA 1W2UA 5GZGA 1ZRFA 1WMDA 3J7NA 1MS8A 1LR5A 3OYWB 2AR6A 4OLLA 3AP5A 4AI3A 4WVVA 4LBMA 1UX7A 1GZTA 2DUPA 3EHKA 3WDWA 4YGDA 4RHV3 4OUSA 1S0FA 3W5MA 2VTXA 4Q4X1 5FO8B 1I1EA 4R9CA 1HIXA 4JAAA 2WS92 1H8TB 2HWC2 1AHSA 3VL9A 4AWDA 5KHJA 2DVBA 2DWRA 2Y0OA 3AYCA 3MW4A 4GJZA 3ST7A 4DUWA 3WEZA 3O14A 1LKNA 1DGRA 4XFHA 4HPKA 1OA4A 1QJFA 2XBO1 1YYNA 1V6MA 2BNNA 1PO21 3CO2A 4HKLA 1AXYA 1VBD1 4LLFA 3RS6A 1G9CA 2ZJCA 1VBB2 2YBSA 2OUJA 4FQ4A 3RZHA 1R1A1 5A6XA 4L8QA 2J42A 2W0XA 4OI4A 4AI0A 2DBIA 4RYDA 3S5QA 1RUJ3 4XJWA 2WINB 2XB6C 1E57A 1JODA 4XBQA 3ZDVA 3WNKA 2HWB3 2AC1A 5D8AC 3WR0A 2FDJA 3VBFC 4IEZA 3J7MA 1QF3A 1EUUA 2QQMA 2JEMA 2VBBA 1SFPA 2EICA 5A7WB 1ZM1A 4A6SA 5I91A 3ETPA 1H9PA 3KV5A 1EY2A 1XYOA 4JDNA 4YFWA 2ZGMA 4Q1RA 4XUPA 4A4AA 4H7LA 2FDGA 1C8M3 1JOBA 2C6SA 4FCAA 2VZVA 3I3DA 2Y6GA 4L11A 5JUVA 1DGWA 2P2KA 3IMNA 2Q8OA 2VOVA 2YC0A 4WM8B 5L7OA 1O4TA 4AF9A 1OKOA 3AKPA 3CZUA 3ZYBA 4RQPB 4IGQA 2XG3A 2ZAAA 3OTFA 4XQDA 3J26N 4BPZA 2BTVC 3LDRA 4ZU5A 3WDXA 3N7KA 1RJ8A 1HQWA 3NNFA 1V6OA 4NHYA 3IM0A 3VBSB 1OOPB 4JKLA 4NUBA 5EHDA 2WJSA 3DXUA 1OFSA 1IPSA 3BODA 3D0SA 2Q8EA 4E4ZA 2HEYF 3TBDA 5EYYA 3WOGA 4A3ZA 4K1YA 3LFMA 2Q0AA 1BYHA 4RA0A 4E4SA 4UFIA 4KWKA 4LIUA 3CEWA 3KD4A 3V64A 3WLUA 5C9AC 4RL7A 3WHTA 4Q27A 2W94A 4QKDA 5IHRA 3PJYA 1X9TA 3RJ2X 1QXJA 2WUHA 1OT5A 4LOSA 4PIXA 3N7MA 4QT6A 2EAAA 4DO0A 3RZLA 4AQ2A 1S2KA 3M3CA 3EJKA 3O0XA 4YPJA 3POFA 2GZWA 1DZQA 5L73A 1OVPA 1DBNA 2JG9B 2CU5A 5IYYA 1N1VA 4ASMB 1A6CA 3USUA 1K5MA 3IDEA 5FY0A 1CIWA 1X9PA 1W0NA 5E88A 1CZSA 3P3PA 2G9GA 2XLGA 4P9XA 3WG3A 2A7AA 1GZ9A 2VZUA 2ZX2A 3WF2A 3VD7A 4AAXA 3B93A 1W05A 3DCQA 2JWPA 4GIQA 3I59B 1JS9A 3GBFA 1PVC3 5IVFA 1RUNA 4Y1YA 1UL9A 2RS32 2TNFA 5FYBA 3P3NA 2H6BA 4B1LA 4C90A 5BNPC 2NMOA 1SPPA 2DTYA 4Y26A 3X29B 4CUCA 3OOXA 4XTMA 5LW9A 2RDQA 4ATEA 4YW7A 4IEOA 1DQ5A 4CXWA 2JIGA 2ZMNA 2HYXA 4OMDA 4FPHA 4LBJA 3ZFFA 3SC7X 3T4HB 4IEPA 4PDWC 3D8CA 4XOGA 2EXJA 2JXAA 3TEWA 4E4DX 4WVMA 3NV1A 1C57A 2WS91 3MF6A 1L7RA 1W3XA 4LKSA 2HWC1 5L9BA 3GZAA 3SKJE 1WCKA 3MPPG 4PQ9A 2YPJA 5IK5A 3PVBB 2KD7A 1YFUA 2UYBA 1S4CA 1ZZ8A 4AFAA 3WCSA 1XC6A 4CZSA 2R1BA 3AX4A 4FBFA 3V56A 2LTNA 3SH5A 2XONA 4YWAA 5JOWA 1DF0A 1NAEA 4FPGA 5GZCA 3OUIA 1VBC2 1VP6A 1WCUA 5JOXA 4Q0PA 1W06A 2O0OA 5JXJA 1DDLA 1RB8G 4GH4B 2JB8A 4CPBA 1ZX5A 1CPNA 1ND2A 4EZ4A 2XMLA 2Q8CA 2VZPA 4QXKA 2KM2A 1F35A 4FAGA 2LRPA 2IFRA 3IIIA 4AAPA 3BGAA 5JZGC 1BEV3 2VTFA 1SFYA 4M3CA 1XYPA 2BRTA 4AE2A 3J4UH 2DYCA 2YUEA 1NQJA 3ZVXA 1GANA 2VPVA 1RC6A 4URTA 3ZSJA 4KMQA 4K8RB 5IK4A 1SDDB 1X50A 3MUY1 3LD8A 4NIHA 4CEWA 2GN7A 3HPNA 2ZX3A 3VGIA 3EO6A 3WUCA 2WLPA 3O1PA 1IS3A 1YRZA 1QXPA 3BYWA 1LECA 4DY5A 1NA1C 3JBG3 4B1MA 1X36A 2FBEA 1PIV3 5IATA 4IUGA 4IDZA 5LB6A 3K2OA 3OBZA 4MHRA 3UGGA 4AZZA 1SLCA 1YCIA 2P3JA 2JDZA 3JQWA 2OPKA 3PTRB 1UOBA 3URFA 4AI1A 1NCRA 3WHUA 4OCTA 5GM0A 3AJYA 2VC9A 1R082 2OS2A 3GNEA 2GC3A 1W3VA 5F5IA 4ASLA 4DRVA 1KJLA 1V6KA 2BGCA 4XJUA 5L19A 5J09A 1J3PA 1YC61 1FNZA 2C26A 2QCSB 2VUDA 3K4DA 5F6LB 4QMAA 1D0HA 3UKNA 1HV0A 3H50A 4TYSA 4M4RA 1JYCA 3JB8A 2B5HA 4HPKB 4BXSV 5CFDA 2G1MA 2CDOA 1ALYA 1H8VA 2BVBA 4XCBA 5SV5A 3UV9A 4HOOA 4LIVA 5C71A 1W9WA 1ZREA 3ACHA 2WZR2 1LGCA 3GM8A 3PVEA 1PMJX 2BQPA 4E27A 5FZAA 4OUEA 4AGRA 1AJOA 1BMV2 3I3MA 4FFFA 4PF5A 2QQJA 2WFPA 1W8ZA 4YSFA 5FMOL 3RQ0A 1QXRA 1WLCA 5IWFA 3WG2A 3M3QA 1RL3A 1W9YA 1KDMA 5DN2A 1ZA7A 3ZSKA 4AI8A 1N3PA 4KU8A 4QX2A 1IPJA 3WP6A 5KC6A 1SCSA 2ZPXA 2XKOA 5CKMA 3K46A 3O0WA 3GGLA 3MBWA 2RS31 4CDUC 3KCXA 2WLQA 3UGHA 4U2AA 1G9BA 1PX3A 2ZGNA 5JR2A 1CJPA 2DCYA 2ARBA 3JD73 5A1LA 1LEDA 2JDMA 2XPJA 1W2OA 1QJU2 2VNGA 2HWD3 5L7OB 4TN7A 1W39A 2R16A 3C7HA 3VBHC 3IMMA 3KCYA 1CD3G 2PLV3 2FDIA 2DCKA 3ILFA 1ND3A 4NE9A 3KHCA 1DQ6A 3ZMNA 1RUH2 4YARA 5C3SA 1XNTA 4QPWA 1FMD2 2WNOA 2ZEXA 3DEMA 1Y7BA 3FHAA 5I93A 2D6MA 5BNNA 3UYJA 1OD5A 5FP3A 2Q5TA 2XH6A 3OD0A 5FWEA 5FZKA 5F3CA 3WINE 4ES8A 1OQEA 2DCJA 2R49A 3EMRA 2BW8A 2HLEA 5JPMB 4XJ8A 1SLAA 1T6GC 1GYKA 4Z07A 1YFXA 3I54A 3WQ7A 5CFCA 4L0PA 3ZOIA 4P9YA 4XIKA 3SMHA 4C1XA 1W6NA 3ZYPA 1VBC1 3P5BA 1PO13 1JHNA 4E2QA 1ULPA 3SH4A 5IFPA 2VOTA 1QJY2 2GC1A 4GXLA 3H8XA 3C3VA 2WAOA 2C4XA 5LBCA 3M7AA 3T2QA 4NRPA 1UY3A 2OIIA 4LHNA 2LW8A 3POEA 3M4FA 1F4HA 2DUQA 2OPWA 1L3JA 3LEGA 4NROA 4DXTA 5HI0A 3HOBA 5FZFA 3T0AA 1ZZ6A 4JGYA 5FP9A 3USUB 1DP0A 1K5MB 1NOVA 4Q4W3 4FAHA 3KLSA 3AMHA 5FZMA 1JYXA 1J58A 3C7GA 1HXS3 3AZZA 1FATA 1QQP3 3OPWA 5E6HA 3VZMA 1JTZX 2W1WA 1UU4A 1EV11 1OUSA 2I07B 5A7OA 1OVSA 3S30A 3LA2A 3AZWA 2NN8A 4NRMA 2VOWA 1AR92 4FI9A 2GALA 3PJQA 1RINA 2OZJA 2JDKA 4C0HA 4XE9A 1SPPB 1Y3TA 4AK3A 1GMMA 3NO8A 4B7EA 1RUI2 1HLCA 4R4XA 2ZGTA 3VN4A 4ZU7A 1TME2 4X6RB 4MUVA 2D43A 2X05A 3U37A 3ZN4A 2XJPA 4XABA 3T4VA 2ZCWA 3BPSA 5FPXA 5H9PA 1WA6X 1R081 1ZBA3 4ISRA 2IXLA 1PNFA 1W8TA 2OXBA 1XNKA 1SG3A 4WVMB 4P9IA 2PQQA 5FMCA 1QJEA 2Z79A 4D6RA 4FTSA 4XBNA 3OBAA 2GNBA 2JECA 4O7XA 4WM8C 3S7EA 1VR3A 3DN7A 2BDRA 3A0KA 1U12A 2RR12 5FYCA 4Q29A 4COYA 4PQQA 2VQUA 4KWJA 3MIHA 5JI7A 4LEJA 5J36A 2E26A 5HPOA 4FOQA 3HBZA 1Z0HA 3VBRA 2V5YA 3WDVA 5G04L 3VBSC 5AVAA 1A8MA 1W2TA 3GXUA 2HYKA 3OEBA 4A7YA 4JVAA 4UFLA 1BMV1 5DZGA 5FP8A 3WUDA 1XU1A 2G4IA 3O0VA 4Q0VA 1YQ6A 2XJSA 3MIEA 2GH8A 1QWRA 5F5QA 1ZRDA 4M3CB 4FO9A 4OQ8A 2YPDA 5JPNB 3U4XA 1CAXA 3AXEA 1ZVFA 2R072 5FLIA 4MGKE 3ZSEA 3NKGA 3O1UA 1ULDA 4QKBA 4P02B 3USSA 5JOZA 2UU8A 2F4PA 4QXBA 4IEVA 4CEWB 1CONA 2QUOA 4R4ZA 1YEWA 4P00B 3LIHA 1QJU1 4J1XA 5DZFA 3WT3A 2JG9C 4IEQA 1FPN2 2QDRA 5C5TA 3AZYA 3VZNA 3ZYIB 3POBA 4S2GA 3U14A 2XDVA 2VMEA 4JTOA 2IXJA 1VALA 4X8NA 4UOJA 4CUBA 1FMD1 1MEC2 2RM22 3HNYM 5L36A 2IZWA 4LHLA 2YG0A 1JYTA 2FQPA 4ET7A 1DLLA 4QX5A 2YDEA 1DLCA 1NCRB 4LR4A 4D3WA 4LQRA 4QHOA 5FZHA 5HV4A 3APBA 4PHZA 1O3TA 1UKGA 3OUHA 3U07A 1W6OA 1BBT2 3WSOA 4FPEA 5LBBA 3R6SA 1TEIA 2QQIA 4UFMA 1QEXA 4W8JA 3TN93 1JOJA 1UZZA 4OI2A 1QJY1 5AVPA 3PUIA 4N43A 4E9KA 1YFWA 4GA9A 4IE7A 1FXZA 3DUIA 4ITCA 4IQPA 1DYOA 1LJ7A 2HWE3 4Y33A 5CFDB 3E97A 3J9SA 4AXOA 2JICA 1EPZA 1HB1A 2ZHMA 2WQ8A 2ET1A 5CKQA 1PK6A 4AVAA 2IC1A 2XQXA 3VZLA 2J22A 3MIBA 3J8F2 4FPLA 3W5NA 4Z92B 2WFF3 3VBOA 1QKQA 5FYSA 2ZOEB 4YVSC 1GP4A 2WT2A 3A0NA 5DUVA 5KHKA 4QX0A 4UW4A 1AVBA 1AR63 5E8AA 1REEA 1LCLA 5BPXA 5M0TA 1UNBA 3RI8A 4LHKA 1H30A 2B9UA 5IVBA 1ZBE2 4GH4C 3H3LA 1E5RA 1XRUA 2K2SA 2QQPA 3E5UA 5GJ6A 1DG6A 1NLQA 1NQDA 1C5HA 3WNMA 5K0UA 4META 1TNRA 1LHNA 4CDXA 1HB3A 1ZA4A 4UFKA 4XETA 2R063 1RUI1 3FX3A 5J98B 4A2UA 1ENXA 1TME1 2OA2A 2XKPA 1AUYA 2J1AA 2E7AA 4IEWA 4CCEA 4OI0A 2YGMA 1QOTA 3MV11 2Y64A 1RXGA 5FPBA 3THDA 1ND3B 2XVKA 3H8UA 4M3CE 5I0SA 3LA7A 1FOD1 1UU6A 2TEPA 3FFZA 4OULA 4BK4A 2CNAA 2MEV3 2Y34A 3MIDA 5FZ6A 3B94A 1MVEA 4NHMA 2VMIA 5LEKA 1O59A 3I2HA 1CPMA 5FXXA 2JENA 1NY71 4FPJA 1MZ6A 2RR11 4XF4A 2W5FA 1OC1A 4AVBA 2Y60A 4ISQA 5A7PA 5CFCB 4XF1A 1AR81 1W8OA 1TE1B 5C8WA 4Q0UA 4YW1A 5GZFA 1W6NB 2QE3A 1GUIA 1QU0A 4F7ZA 4JV4A 3BTZA 4QAWA 1RYYA 2WNUC 3DL3A 4YRDA 1J83A 4H2AA 1IQAA 2WT0A 3ZXEA 2I74A 1H4HA 1UN1A 3IAQA 3R4DB 1CR7A 3PUSA 4K8FA 1RUF2 4LMFA 1JU3A 3C8XA 1W0OA 2AEZA 4UAPA 1N47A 4E8CA 3D3AA 1JZ8A 3ZXFA 2B46X 1EAH2 4J1WA 3INAA 3T30A 1UOFA 3GYDA 5L9VA 2RS53 4JGYB 2R071 4Q4X2 3U11A 1JYVA 2WN3A 2PYTA 1VBB3 2FDFA 3N9NA 3WP4A 4XAAA 2FDHA 1WLDA 3HEIA 1Q43A 5I8YA 1AYM1 2QQVA 4GALA 2EXIA 2VCAA 5DAVA 2ZS6B 5FXZA 3WQ0A 1H1AA 1PVXA 2PFWA 3JUUA 2EF6A 2W47A 2ZGQA 3TEZA 4P08A 5F6KA 3E6CC 2ZMKA 2VL4A 5FZ9A 1FPN1 2BFUS 3POYA 5ISLA 3ATGA 3S5AA 3LEKA 5JCTA 4FPYA 5GALA 4H14A 1VBD2 2ERFA 5CG9A 2V4AA 4MLOA 1GLHA 1MEC1 2RM21 5C7GA 4GWNA 3BB6A 4QX8A 3WDYA 2ZGSA 4ZS3A 4DY3A 3LSDA 1V6IA 1FX5A 4DMIA 4CSWA 4WM7A 4UF0A 5FP4A 1WMFA 4IE0A 2GDFA 3ZIWA 1WCSA 3NSTA 3N3HA 3RSJA 4EN9B 1LOAA 2WZEA 4RR3A 4Q4V1 3RMYA 1BBT1 1L7QA 1RGSA 2P4EA 2Y8KA 4LKFA 4XW3A 3WDUA 1NLRA 1RHI2 1YXWA 3Q8AA 3SKVA 1Q3EA 3KMHA 3UKTA 2YBPA 4UW5A 5A7QA 5L7OC 4LLOA 4MYEA 3NV3A 4BJ0A 2Z2SB 4KNCA 3ZLIA 3FL7A 2OW4A 5JR7B 1C1FA 3PURA 1XNCA 4M0HA 2WIIB 1OLQA 4LORA 1AX0A 2AEYA 4AQTA 1IQDC 2ZBJA 5EXOA 1LGNA 3UESA 2UY8A 3VHPA 4NHKA 1H6YA 2YXSA 3J8F1 3WQBA 1OPMA 3VBRB 5FYMA 2QZ2A 5DAXA 1PGSA 3KT4A 4QDRA 1GWMA 3H3UA 1MZ5A 4KWLA 1RMU3 3FC0A 3SCHA 4ZPIA 1JW6A 5FMDA 4Z8BA 1O8SA 1HRI2 1Z7S3 1ENQA 1J3QA 5A1AA 2FZ1A 5KHIA 1ZBE1 3SITA 2GC2A 3M3EA 3PLQA 1CAXB 3VDDA 3RZZA 3UETA 1CAUA 4PI2A 4CU8A 3SLIA 5CZKA 3VB9A 4CDQA 1EYBA 4NPMA 3N4MA 1R1ZA 1JU4A 3LOIA 3PU3A 3O1TA 3W21A 1NKGA 2VULA 1VPHA 3ZX7A 3H7YA 2R7EB 4HFSA 1VRH3 1X82A 1K5MC 5A6YA 3DPRA 5JXHA 2F4LA 1JOPA 1H0BA 2RG4A 3KHBA 2LS6A 3EXUA 4N9IA 5J7MA 3R4UA 4CDWA 1RUE2 4XMIA 5FY8A 1QDCA 3GZEA 1MZEA 2QQNA 4AFBA 5D2AA 1RTVA 4URAA 3KGLA 3I2OA 5FZCA 4HONA 3B5LB 2YC2A 1GNHA 4QPYA 1WCDJ 1BLZA 1H2MA 2ZHNA 4QPGA 3U1XA 1RVF3 3BIEA 4C1WA 2PHTA 2RMU3 2VUJA 4BK5A 1DZTA 4N9HA 3JXSA 2EALA 2ZEWA 3DGTA 2J1SA 3FFQA 3R4SA 1REFA 2E31A 5FK8A 1MACA 3MUZ1 4N43B 5C8CA 4QQPA 1HW5A 5IAXA 3BTAA 1LULA 3OSDA 2TUNA 5CG8A 3NRUA 1ASJ1 1RUF1 2A3WA 2AENA 2ZKLA 3MW3A 5FZIA 2P1BA 1ODMA 4DXSA 4CCNA 1PK6B 1EAH1 2RDSA 1O4ZA 3UKVA 3VBOB 4EWEA 2ARCA 2QKDA 2E7QA 4JCKA 1H2NA 1XNDA 3VZKA 3VKMA 4C0BA 5BYNA 1NE6A 3EB7A 3H42B 1OSGA 2QZ3A 1SBFA 3KVBA 5CB7A 4K20A 1QJX2 1S2EA 5C3RA 4YM3A 4K1ZA 4MADA 2GU9A 3HQRA 2VD7A 5EJ3A 3NV2A 3ZFGB 1UXZA 4B4RA 3I2FA 2Y26A 2ADEA 4QGNA 5FZ0A 3N36A 2Z4FA 1LOGA 1TMF1 4OHVA 3AKQA 5K0UB 4OHYA 1COV1 4CDXB 1VBE3 5G05L 2IUWA 2Q30A 3I97A 3IKWA 5CISA 2OX0A 4QQOA 3S0MA 4TWTA 5T54A 4KBZA 3KQRA 4CUAA 1WMXA 4IEXA 3IAPA 1X8EA 3B02A 2CYFA 2C1FA 2W52A 1HRV2 1AZDA 1RHI1 4I09A 3SNMA 4GKYA 3RYPA 2JE9A 4W6YA 4CU6A 1MS0A 5APAA 3IDAA 3ORJA 4LXLA 1AYN3 3DF0A 2A6XA 4FT8A 2I45A 3I3EA 2VMHA 2BNOA 3CJXA 3WZ1A 5I0RA 2V72A 2IFWA 5AC93 4Q26A 2VQAA 4HBNA 4WBBA 5FZ4A 2R042 2ZMLA 4LJHA 1GQHA 4A6OA 4DRRA 1G9FA 4Y5SA 2RS12 4K3UA 4MGZE 1O7FA 2WO2A 2O14A 2A1XA 1UX6A 3E6DA 4Y20A 4NHXA 1AL21 1DQ0A 1NCRC 4XUOA 3THCA 3ZR5A 1WMEA 2VGDA 1V00A 3EYPA 3WF3A 1BZWA 2XVGA 3AMPA 1JHJA 3LKJA 4UBHA 1POV0 4BH9A 5CAZA 2PHWA 4WVWA 1RUC3 1HRI1 2W1QA 1G8WA 3HBKA 4CP0A 4MXWB 2PQSA 4GB32 1J1LA 1HN1A 1LOFA 1UIKA 5B4XA 4IEYA 3H1WA 5CFDC 5FWJA 2A6ZA 2OVUA 2WZR3 4FVVA 2QQLA 5FOBB 4CP9A 1S0JA 4QQ2A 5ACA2 5A6ZA 3GBGA 3I2JA 3NJVA 2D40A 2AUYA 4BQ3A 1O4YA 3LPFA 3B3QE 1CESA 4XXAA 1WW7A 3EBRA 4QM8A 2A75A 4UFHA 5FQ0A 1RUE1 5IUQA 2MNGA 4R9AA 1VAVA 3BUCA 4S2DA 2YB7A 1GZCA 1SHWB 4D7YA 4G3YC 1FNYA 1KGYA 4WM7B 1DIWA 4UF0B 4B4PA 3NW4A 4YM2A 2IXIA 4BA6A 2QDNA 4RR3B 2MPFA 1O3QA 5D1IA 3Q8CA 3OGGA 3RFRA 4IV1A 4PCRA 2P3YA 1Y4WA 4HL0A 4JHTA 4LOTA 4QXCA 3ZXLA 1QOOA 5T3NA 4KG8A 1O3SA 1NE4A 1RUH3 4AEDA 1R092 2BEOA 3POJA 1GQPA 1W2NA 3LZZA 5EZWA 3H9AA 1ND3C 3RWKX 5F2SA 2VW0A 4GULA 2W95A 1D2SA 2A6YA 1I9RA 4BMEA 3I8TA 1E5IA 1CGPA 4S2HA 2XJRA 1GICA 1U5IA 2W39A 5BNOC 5IVYA 4AHZA 1W04A 2W2IA 3FBMA 4WZFA 2BP6A 3ENRA 1NUKA 5CFCC 1IS6A 3LF7A 4CCKA 2VBDA 5FZOA 3FZ3A 5FZBA 5GKAC 5HCBA 1OF3A 4MGSA 2FCTA 5IVJA 1QJX1 5E1RA 2VECA 3MV01 3L2YA 1JZ4A 1HV1A 4FPFA 4EJRA 2FCUA 4IERA 1OXCA 4YW6A 3V0AA 3ROUA 4AHYA 2PTMA 4ATFA 3VDDB 1O8PA 5FY1A 1CAUB 1V6JA 1SFNA 1NT0A 1HB4A 1TVGA 4CDQB 3PVNA 3OD4A 5H9RA 1X33A 3I4IA 3O1VA 4ORFA 3JU9A 1VMFA 5AFEA 5JWPA 1SACA 3CDZB 1N3OA 3KS7A 4JGYC 4UXAA 5DMYA 4EN6B 1MS5A 4FOYA 3DPRB 1OQDA 2WABA 3OGRA 4RD7A 1H2LA 1S0DA 4CCMA 4CDWB 3E1F1 1HRV1 1UYPA 4MOAA 4RHV2 3AYAA 3G7DA 1AR93 4PT6A 2J1VA 2BOJA 1J84A 4GMP3 1W2AX 3K51A 3M70A 4LK7A 3ON7A 4QPGB 4XUNA 2JD9A 3K4AA 1JZ6A 2UY9A 4KU7A 3D4KA 4D6QA 4JDMA 1G9DA 3WG4A 1EV12 5T5OA 4AFCA 5HCFA 2VW2A 2R041 3HNMA 3ZKYA 5JDBA 1ZZCA 4DB5A 2JD4A 2RS11 5LEJA 4RGGA 5ANQA 2JJ6A 2YU1A 5C8CB 2Q4SA 3T3YA 3O12A 4N53A 3T2OA 2DFCA 2PA7A 4N7IA 2JDYA 3ETQA 3AVSA 1AX2A 3I7DA 1QDOA 3ILRA 4JHZA 4HSLA 1POV1 3I2KA 1FYUA 5AFBA 4AEMA 2DU1A 5KXDA 1CAWA 2VU9A 2HWB2 1PM7A 3K75B 4GB31 5L9RA 1UW8A 2UWAA 1RITA 2PMWB 4FXGB 4QQHA 3OUJA 4KI5M 1XU2A 3B69A 4AI9A 3WNLA 2VAUA 1Q8SA 2HKXA 3A22A 1RUG3 4KH9A 5ACA1
chains in the Genus database with same CATH topology
1C8M2 1ULGA 2WNVA 3VBRC 4A7KA 2ZAHA 2YZ4A 2HWF1 4INDA 1BK1A 3POSA 4BWOA 1DFQA 2NZ9A 4EN8B 1BXHA 1KXGA 1F2NA 2AYHA 2GMMA 3JB4C 3MICA 4XFCA 1LHUA 3M3OA 1AR73 3WX5A 3E5XA 4MGIE 4PBOA 1FV3A 5HXVA 4D7SA 3MEPA 3D5OA 1CJDA 2I2SA 4UW3A 1Q8QA 1KQRA 4AFDA 3MFCA 4IL7A 3QACA 1R091 1YWKA 5DDJ3 1PMIA 4KGGA 3FMGA 3D6EA 4XF0A 1B35A 5JSOA 2BUKA 4XJAA 4EN7B 1AX1A 1AF9A 1I6XA 1IOAA 3JQXA 1HX6A 3RPQA 4Y20B 5FREA 3RJRA 4ZU4A 4IXLA 3RG0A 1H9WA 2XVLA 5K7PA 3PMSA 5KWRA 3AFGA 4TLFA 5FO7B 4BZ4A 3AMNA 4DQAA 5DUWA 3WW1A 5JMCA 2RJLA 4N43C 1H2KA 3NJZA 4LBLA 3VKOA 2X29A 5H9SA 4DPNA 4BE3A 3BCWA 3H1MA 2R0FA 1J59A 1MS1A 2HEWF 4LTAA 1PK6C 1ULCA 1N1SA 2HJIA 4H7MA 3VL8A 2GMPA 3ZSLA 3VBOC 3QBQA 4Y22A 3WW4A 4BIOA 4XF3A 4PDWA 5FQ0B 1H8TC 4ES9A 3S7IA 1CQ9A 1LESA 3AYDA 4RHV1 1ZNPA 1ONAA 1RUD2 2D97A 2D3SA 5T5JA 4YNIA 1Z78A 3T1LA 3ZFGC 4FP3A 4Y5Z0 4NO4A 1LOEA 2DV9A 4UBGA 2P3IA 3MGUA 2NM1A 5C4WA 4IETA 2ZGPA 4CDXC 4AI2A 5H9QA 4IV1B 1WW6A 2ZTNA 3AP6A 3WP5A 3ZXKA 1ZYBA 1O5UA 4FPCA 4M00A 1GZWA 4BHPA 4AEDB 2PHXA 4JGZA 4P14A 2YY1A 5FDBA 1GBGA 1RUJ1 1PGL1 4U36A 3ZXDA 2A6WA 3PMEA 1BCXA 2HWB1 4XEZA 3ZFFB 2CWMA 1XXNA 1BEV2 1OI6A 4YZ4A 1FOD2 3ZIXA 1V6NA 1YIPA 4QPIA 2PHRA 2Z42A 2DUOA 1F9KA 1HKDA 4J6GA 1NY72 5E16A 3SH3A 4SLIA 4RQPC 1C8M1 5JSPA 4XZPA 3V0AB 2IXHA 1AR82 2GNTA 3ZMOA 5JLVA 1NXD1 1JUIA 2VVEA 4FTEA 3VHRA 5B2GB 4C91A 1W6MA 4I3GA 3RWNA 4XFFA 1ZZ9A 3QLQA 5CU1A 3ZXAC 4Q4X3 2GN3A 1ND2B 1A3KA 1PIV2 1OOPC 4I01A 5J3UA 2PAKA 1B09A 2VW1A 5KXBA 1S0CA 4AGVA 1IPKA 4Z82A 1IS4A 4X8PA 4LT5A 2DURA 4Y1ZA 2ENRA 1A8DA 4I0BA 2VVFA 2XBO3 4LO5B 1PO23 4TSVA 2E51A 2EAKA 1GFF2 1VBD3 2CGNA 3TNPB 4NPRA 5J48A 4YGCA 1LENA 1R1A3 4BMBA 1AYM2 3OJBA 4NN0A 4BM8A 3GF6A 4COUA 1FT9A 3OY8A 1URXA 3B01A 2A71A 4WM7C 2CL2A 1Q8OA 5DUXA 4HKWA 3QH7A 3ZSMA 4N53B 4K40A 1UKRA 1DYPA 4HVOA 4RR3C 4FOVA 1J3RA 3HWJA 4KL1A 2WC2A 1W6PA 4Q4V2 1OFNA 2XL7A 2ZX4A 4HZFA 1IHMA 4MSVA 1LOBA 2LM3A 1QH7A 1PVC1 4FXKB 4Z2WA 3N7LA 4LE4A 3MF9A 3IN9A 2WNVB 5CIRA 1LU2A 1F5FA 3JD72 2ZGUA 3O5SA 3KGZA 1QMJA 1YIFA 2HWD2 4CRQA 1XYNA 3O7OA 1HRI3 2SLIA 1NYWA 3MFAA 1IGOA 4PJYA 4XFGA 4Y24A 1RUD1 4LBNA 5FPZA 2PLV2 4H3WA 2E53A 3ACLA 1F8VA 2YMZA 3VKFC 2D6LX 4MX3A 1UMZA 1GNZA 4CDQC 3TRSB 1N1YA 3UL2A 1WLTA 2W68A 4R9BA 3LA3A 3CL1A 2GSYA 2JKBA 2V09A 1S0GA 1IKQA 3SXWA 3MYXA 1B35B 1CN1A 1UCXA 3SHRA 4CDWC 1MZFA 2JE7A 3PNAA 2Y0IA 3VHOA 5SV8A 1WD3A 1PNGA 2CGOA 1BEV1 1KFUL 4QPGC 4XTPA 1SLLA 3PTYA 5BNNB 1ZRCA 2C5DA 4Q4W2 3VLBB 2RHPA 3M8LA 4AGGA 1VBA2 4MV2A 1F5JA 3ECQA 1EPWA 1HXS2 1QQP2 5A32A 1S2BA 3ZYRA 4JRAA 1XNBA 3AJZA 4COVA 4I0AA 4YG6A 1WBLA 2CAUA 1SDWA 1W6QA 4AWDA 5GLTA 1PIV1 4AG4A 2WS93 2XGXA 1Q5OA 2HWC3 4Y22B 1ASJ2 3WCRA 3GALA 1QJX3 3WDTA 1CAVA 4PDWB 1QY4A 3VBUA 5LK7B 2D7FA 5FOJB 1ZBA2 2OUHA 3RDIA 3HD8B 4BOWA 4QU2A 4YG3A 3RNSA 2MHFA 4R9DA 4XJZA 4XBLA 2BWAA 2P34A 4LNVA 5C4WB 1OHFA 4YZ2A 4I2OA 1UPSA 5A3MA 5I0TA 3FUQA 4G9SB 4BIFA 4F8AA 3AZXA 4B29A 3OF1A 3WV6A 1VB2A 1ENRA 5BNQA 3H3ZA 1GZWB 1TMF2 5IK8A 1COV2 3DKWA 4JGZB 1S0EA 2EXHA 4JRLA 4F3JA 4CP2A 1LEMA 5JAXA 2UWCA 2QFEA 2R32A 1WD4A 4XQWA 1OMIA 4GKXA 3H0OA 3NWKA 4HKOA 4DOUA 4LBOA 4QPIB 1HDKA 4LBQA 4NWVA 1SBEA 2RS13 3KB5A 5GLWA 1G9AA 4QQLA 3U10A 1DGWX 3JD71 1HQLA 3QH6A 4NOTA 4WV8A 1N3QA 2XJVA 1MS9A 1POV3 2HWD1 3UJQA 3MLKA 3IPVA 1W6MB 3GZTB 5FRAA 1LODA 2PLV1 1AXZA 3PHMA 3IT8A 4HLTA 1AL22 3G6JB 5DG2A 3CJIA 3RYKA 4F83A 4HVQA 1DU3D 1UZYA 1BVVA 4WZCA 4EV0A 2EIGA 4PLOA 4RGAA 1PO11 1I5ZA 3AXDA 4MVTA 5DUUA 2VOXA 3TNQA 3CF6E 4BLJA 1N1TA 2HWE2 3OY8B 1KS5A 1VJ2A 4YZ1A 3LB9A 4OHXA 5EYXA 3FLTA 4YVSA 3ZYGA 2WFF2 4Q4W1 1NG0A 4YGEA 1VBA1 2RS33 4JQRA 4IV1C 4LUKA 1HXS1 1AR62 4P9WA 1QQP1 5FAXA 4BLIA 5JIUA 1W6PB 4YW2A 5GLVA 2NLRA 1BJQA 4AEDC 1W6OB 5EV7A 4DZGA 1MQTA 4ZXKA 2A6VA 2OYZA 2ZHLA 3ZFFC 1KS4A 2BFUL 2R062 1W0PA 1SBDA 4BQ1A 3E5QA 2WNEA 5GLZA 3AZVA 1C3HA 1D4M2 2QJVA 3RYRA 1ZBA1 3AKRA 1QHDA 1MS3A 3MLLA 4I02A 1VBC3 2JG8A 3D0JA 1IKPA 2WQ4A 2D6PA 1C4RA 4Q4Y2 4XILA 5ABJA 5C6CA 1OLRA 2ZABA 4E4ZA 5FLJA 4CEYA 1SEFA 2HEVF 3BALA 1ND2C 4YW5A 5FO9B 2WNUA 4RS5A 4L9BA 4W6XA 2Q1ZB 1ZRRA 3GZUC 2R1DA 4ONUA 3W9AA 1DYKA 1C5IA 1NCQA 3WNXA 5I0UA 5A33A 1YHFA 3ZDSA 1QJZA 4UW6A 1EV13 3VHNA 1BVP1 2D6NA 3OPZA 3MIGA 4CEWC 1X8MA 2CWSA 2RE9A 2RS52 3H1YA 2K9ZA 4YFZA 4K21A 4X6QB 2VNOA 3KCCA 4AYUA 1MR5A 5T55A 2PHLA 1LTEA 3TOJA 5A32B 3HQXA 3MIFA 4N53C 2D5FA 1UIJA 4LE3A 3JCIA 3POWA 4XIOA 4H55A 4YG0A 1R083 3LWCA 2BNMA 1IS5A 1W6QB 3WG1A 2VXRA 3DV8A 1LOCA 1KFXL 4JC1A 4FOWA 4YVWA 2D93A 1D4VB 3H7JA 4V1PA 1V9U2 1CAVB 5GZEA 2ZGOA 3VBUB 1PZ8A 1WLWA 2WA3A 4AEKA 5A3LA 4M3CF 2WNVC 1V6LA 4YZ5A 3MDPA 2X5IA 4YW3A 2BPA2 3ZXJA 1VIWB 3TN91 3NAPA 1UU5A 2PHUA 1DHKB 4LUMA 2HWE1 4FP2A 3ZFEA 1D2QA 2GNMA 4NVPA 2HWF2 2A70A 5F9TA 4HT1T 4XFIA 4AQSA 3FLRA 2ATFA 1YI9A 2BVVA 2WFF1 1QH6A 3ALQA 2VH9A 1Q8VA 2ZX0A 4IV3A 4OHWA 4G4FA 3W59A 4XF9A 1AR61 5EWSA 2DF7A 1RMU2 1QJU3 2ETEA 1Z7S2 4P9JA 3AYEA 4HK8A 1B35C 1DQ4A 4LBQB 4NHLA 4LO4B 4L92A 4XHXA 4Z8BA 1KITA 3D82A 4LO7A 3C2UA 1ZZBA 4P9LA 2FMDA 1FMD3 4P5HA 2R061 1VAKA 4PLNA 2VVDA 1JXNA 2C9AA 2DVFA 4R52A 1VRH2 2F6BA 3IPVB 3KM5A 5BNNC 1UAIA 1D4M1 3FLPA 1YJKA 3AB0A 2UWBA 3ILNA 3NKTA 2ARXA 3K48A 2UYAA 3CJIB 2MEV1 3BIWE 3NV4A 2ZHKA 4BYYA 4N90A 4Q4Y1 1QJY3 3M2MA 2KA3A 2W08A 3V0BA 4XDQA 1RVF2 4HANA 2RMU2 1QOSA 5KXCA 2LUWA 4FPKA 5FCCA 2NPIA 1KD7A 5FMOS 4TZDA 1RUD3 2P3KA 1GQGA 2GAUA 4MGYE 2E9QA 1WBFA 1HQNA 1SQ4A 4HVRA 1MS4A 2ZGKA 2C0ZA 1WUVA 4PIZA 1JH5A 1X7NA 3AP7A 1YUDA 1DQ1A 2AZ5A 2XJTA 3GHMA 4YVSB 4OI1A 5IT6A 4AW7A 5C4WC 2RS51 2FHRA 3HT1A 1VBB1 1U5ZA 5KHHA 1O91A 2WZPP 3W58A 2CV6A 1RUI3 1WW5A 5DZEA 1TME3 4Y1VA 4M01A 4JGZC 1MQTB 3MW2A 1CX4A 4MXVA 4NR1A 4B4QA 5IK7A 2KXLA 1FOD3 2B8MA 1C8NA 2NMNA 4B8EA 1RIRA 1VBE2 1Q8PA 3WY6A 5BUVA 5D8AA 4A3XA 3VBFA 1RUJ2 1PGL2 1BKZA 4XHBA 1PHMA 1V9U1 4QPIC 2PAMA 2XJQA 2RR13 4EWAA 1WGPA 4Y1XA 5EFUA 1AR83 3LCPA 4OUMA 5JVVA 2D6KA 2JG8B 2B7YA 1RUOA 5LRSA 4AVTA 4YGBA 4MZUA 4AFMA 5ABJB 1AYN2 2Q1MA 1YNAA 2ILMA 4A7ZA 4CEYB 4NWWA 4QM9A 5AC92 2CY6A 2WNUB 5T50A 4AVSA 4RS5B 4Q8LA 2YGLA 3A4UA 2R073 1F31A 2D3RA 2IXCA 1NCQB 5A33B 1AYM3 1IZ3A 1RMU1 4EROA 2PN5A 1ULEA 3HAGA 3LOBA 3FHIB 4K7JA 1RUC2 1Z7S1 2RJKA 5J37A 1FPN3 4PIYA 4HN1A 5DG1A 2BBVA 2OZ6A 3FUOA 5C9AA 1MEC3 2RM23 2B45X 2D6OX 4JDOA 3ZN5A 4Z1VA 4YM1A 4L97A 3BOPA 1VRH1 2GH2A 2AGSA 1J1TA 3N7JA 2YYOA 3AK0A 2A3YA 1SLTA 4AHWA 4Q4V3 5CADA 1BBT3 2EA7A 3ZXGA 3BU7A 4FQZA 5FLHA 1D0GA 4YVWB 5C33A 3FJSA 1CVNA 1KDKA 4HN0A 3VZOA 3TB0A 2O1QA 4PLMA 5I8SA 4D7TA 3B9CA 1RVF1 3R0RA 2ZX1A 4Q0SA 3WQ1A 2RMU1 1GSLA 4LULA 3VV1A 1QGLA 4CYDA 2X5IB 3AMQA 3J8F3 2ZGRA 5BNPA 1PVC2 2P17A 3NAPB 4CP1A 1PGW2 3IDCB 3NVCA 5T5PA 2DVDA 1MVQA 3TYJA 1M06G 2XL9A 1S0IA 3ZFEB 5BNOA 3BOWA 5JI9A 4HETA 4YYOA 1ZBE3 4KQ7A 4RFT0 3KT1A 1YJLA 4WVZA 4IV3B 4OFGA 2LALA 1JYIA 4O9EA 4PBPA 5BXXA 3WW2A 1XQNA 5K0UC 3QD6A 4B7KA 1S1AA 1RJ7A 4LA2A 4Q8KA 2DCTA 3U0ZA 1PZ9A 3SISA 1VBE1 1G86A 3ME2A 3R05A 4COWA 5K8SA 2WL1A 1S55A 5JZGA 5K9YA 1VBA3 5CVRA 2N7GA 5T52A 1UD1A 2H6CA 2XUMA 5TSWA 3ES4A 1LHWA 4XQ4A 5BV6A 2ET7A 3QOPA 2R0HA 3MZHA 1REDA 4GMP0 1AYN1 1QNYA 4HMZA 4Q0QA 1AL0G 3V0BB 3T2TA 1DGLA 1ASJ3 1RUF3 3RI9A 4COZA 4KGQA 5AC91 4XJ9A 3B7MA 2FZ2A 1NA1A 5CA6A 1EAH3 4XXPA 1ULFA 1M4WA 2AH2A 3FE5A 3OBRA 4LO6B 1I3HA 4Y4YA 5CNAA 3JBG2 1OA2A 3VBUC 3VKLA 4MH0E 4JTNA 1OA3A 2ZZQA 3FWEA 1RUC1 2B42B 3ZN6A 3HR9A 2A3XA 2E63A 3M3IA 5BY5A 2UURA 5JOYA 1UF2C 3E6BA 3GBWA 1SCRA 3MLJA 1TMF3 1FAYA 2CAVA 1COV3 5DXDA 5LK5A 2WZR1 5I8TA 4I3PA 1DQ2A 2EVXA 2R30A 2FMYA 3WD5A 1RUG2 1TQ5A 3ES1A 5E89A 4EWDA 1DGRN 2PAEA 1Y9QA 3KT7A 4IEUA 1LB2A 3AFKA 4KG0A 4YM0A 2DVGA 3IBMA 2XWJB 5FBZA 4E2GA 3N35A 1RHI3 4GWMA 3WVJA 2ZA9A 5D8AB 4R8HA 3HN1A 3VBFB 1KRIA 5KHGA 1VLNA 3ELNA 1CAWB 2VOKA 1AR72 4AHXA 2BYVE 4HK9A 4OZXA 5JIAA 4S2FA 3MPBA 4CDUA 3NL1A 3VKNA 3TWIA 3UK9A 4YLZA 3AKSA 4DNYA 1PGW1 4W65A 1AL23 1RUH1 5KBFA 4AQ6A 1A78A 3ASIA 5DDJ2 2XWBB 3VBHA 3ZPYA 2XHKA 3AP4A 2H0BA 3CJIC 3JZVA 2Z5WA 3ZYJB 3OGJA 2X53S 1Q56A 3SCFA 3LGRA 3HIFA 2WQZC 1DZRA 4QGMA 2CGPA 2D3PA 3VDDC 1O5LA 3AP9A 3GHNA 4K9SA 3HT2A 3I2DA 2D44A 3AKTA 4D94A 3HMYA 3OYWA 4M0NA 1SLIA 4LO8A 1GR3A 3WP3A 2E6VA 1FV2A 2JX9A 4DINB 4Y1UA 5C9AB 1PO12 1RUE3 4LA3A 3DPRC 4QHBA 2IXKA 5JSRA 1ENSA 4GQ7A 3AM2A 3FBYA 2EXKA 2WSVA 3ZO0B 2PHDA 1H8TA 3L9JT 1AJKA 1U5XA 3OCPA 2VY0A 4I0WB 1OPOA 4FSJA 4P9GA 2R6QA 2NP0A 3ZFGA 2WWSA 4I30A 1JBCA 2DTWA 1LRHA 1FI2A 1LHOA 1AR91 1LHVA 1MQTC 4XFBA 4K6BA 3PVOA 1WW4A 4GMP1 3MI8A 4DFSA 2P37A 1U5YA 2DFBA 5C8CC 1YLLA 3IDBB 5GLUA 1KJRA 1TNFA 1D4M3 1SLBA 2GMEA 5BNPB 2O8QA 1WA4A 2PHFA 3JBG1 4DS0A 3IIAA 4AVVA 1QNWA 4L2NA 4Q4Y3 4LBQD 5BNOB 1ZZ7A 4CTEA 2JG8C 3KSCA 4LBKA 4XYXA 2DCZA 2GNDA 5ABJC 1JN2P 2QVSB 5T5LA 3WXPA 1S0BA 3THTA 3L2HA 4WM8A 4CEYC 1NLSA 1EP0A 4RQPA 3RMXA 4RS5C 1RUG1 4OVEA 3QCWA 4XFAA 1LU1A 1H1MA 1NZCA 1AXKA 5J96B 2PELA 5FFOC 1GKBA 1NCQC 2GC0A 3S6PA 3VBSA 4EN0A 5KXEA 3B9IA 1G7YA 1HRV3 4MXWA 4W6WA 4YW4A 1OOPA 2E7TA 3RRDA 4E2SA 2XLFA 1YI7A 2O8OA 5JZGB 1O3RA 2V73A 4HSJA 2D5HA 3BPZA 1AR71 4O9GA 4L99A 4BCUA 5GZDA 2TBVA 2R043 4SBVA 2XBO2 1V70A 4Q2FA 1PO22 3SCGA 2YV8A 2QNKA 2G9FA 1VB4A 1GV9A 1R1A2 5DDJ1 1Y43B 2DU0A 2JG9A 3LAGA 2A5ZA 2X8KA 2VQ0A 4IESA 5F1RA 2WSUA 4QGLA 4N7UA 1V9U3 4QD2A 1NA1B 2VMGA 2ZGLA 1C28A 4ZKTB 4GB33 2ZZJA 4YVWC 5HCAA 2A73B 1G6NA 2VNRA 3WW3A 3CLPA 1H1IA 4KBBA 1OQ1A 1LOFC 3I59A 1PZ7A 5ACA3 2H0VA 2X5IC 3ZN6B 1XE7A 4FTBA 3NAPC 3Q9OA 4FPOB 1UPIA 1YO8A 2NYYA 5FTTC 2HWF3 3EQEA 2CTVA 3LSEA 3ZFEC 2ES3A 3TN92 3VUOA 3KZ4C 1BQPA 3CU7A 2VUAA 2BWCA 3OBTA 4Q1PA 2SBAA 4IV3C 1OKQA 1XE8A 2ZKNA 3UJOA 3TAYA 2K0GA 3IWZA 4RSUA 2YROA 2Z69A 4B3NA 2XLAA 2IWGB 1VAMA 1R093 1YFYA 5HBAA 2WKKA 3B00A 1SMVA 3CNAA 4D69A 4GH4A 2YHJA 1JUHA 3V65A 2NQYA 2WT1A 3THPA 1U0AA 4AEJA 4DXZA 4CDUB 2XJUA 4XMAA 2AREA 2B39A 2WA4A 2ZACA 2D98A 4OHZA 1APNA 5KC5A 3AMMA 3VBHB 1LGBA 1H4GA 5CBLA 3M1HA 4XPVA 3VZJA 3T1MA 4YZ3A 2MEV2 1NXMA 1C1LA 2Y38A 5LRRA 2VG9A 2DVAA 1W2UA 5GZGA 1ZRFA 1WMDA 1MS8A 1LR5A 3OYWB 2AR6A 4OLLA 3AP5A 4AI3A 4WVVA 4LBMA 2DUPA 3EHKA 3WDWA 4YGDA 4RHV3 4OUSA 1S0FA 4Q4X1 5FO8B 1I1EA 4R9CA 1HIXA 4JAAA 2WS92 1H8TB 2HWC2 1AHSA 3VL9A 5KHJA 2DVBA 2DWRA 2Y0OA 3AYCA 3MW4A 3ST7A 3O14A 1LKNA 1DGRA 4XFHA 4HPKA 1OA4A 2XBO1 1YYNA 1V6MA 2BNNA 1PO21 3CO2A 4HKLA 1AXYA 1VBD1 4LLFA 3RS6A 1G9CA 2ZJCA 1VBB2 2OUJA 4FQ4A 1R1A1 4L8QA 4AI0A 2W0XA 4OI4A 1RUJ3 4XJWA 2WINB 2XB6C 1E57A 4XBQA 2HWB3 5D8AC 3WR0A 3VBFC 4IEZA 1QF3A 2JEMA 1ZM1A 5I91A 1H9PA 1EY2A 1XYOA 4JDNA 4YFWA 2ZGMA 4Q1RA 4H7LA 1C8M3 4FCAA 4