1RVF3

Fab complexed with intact human rhinovirus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
total genus 31
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf300
4CDQB 2WFF1 1VRH2 1HRI1 2TBVA 3JBG3 1EAH3 1RMU1 1POV1 1MQTC 1AR61 1IHMA 4N53B 4CDUB 2FZ1A 2ZAHA 5BNPB 3J8F1 1CJDA 3TN93 2R072 2RS11 4GMP1 1EV12 4QPIB 4QPIC 1RUC3 2ZZQA 2RS13 4GMP3 4CEYC 1R082 1K5MC 1HRI2 1QQP2 5JZGC 1VBA2 1B35B 4Y5Z0 5D8AA 5A33A 4JGYB 5AC92 1NCRC 2XBO2 4CEWB 2RR13 3VBUB 1ZBA2 1FMD2 2X5IC 1ND3A 4YVWA 1E57A 1NA1C 5C8CC 1HRI3 1BEV1 1Z7S1 1RUD3 1VBC3 4RHV3 5J96B 5ACA3 1RUD1 1VBC1 1EV11 5A32A 1H8TB 1K5MB 1H8TC 1AR93 3M8LA 5BNOC 4CEYB 1RUJ2 1VBD1 4IV3B 3J8F2 1R092 2MEV2 3VDDA 4Q4W2 1AR82 1RUE2 1AUYA 1MQTB 3VBFA 4NWWA 3VBRC 1D4M1 2X5IB 5CFDA 1C8M3 3ZFEA 2HWD2 1PO22 5JZGA 1C8M1 1PO23 4RR3A 4IV1B 1AL22 1QJX2 3HAGA 5L7OC 5L7OB 2HWF1 1AR91 5DDJ2 3J8F3 2HWE2 1NCRA 4CDXB 2HWE3 3ZFGB 5AC91 1POV3 1PVC3 5C4WB 1WCDJ 5BNOB 3ZFGC 4WM8B 4Q4V3 4FTEA 3DPRA 1C8M2 2HWD3 5C9AB 1FPN3 2XBO1 1PIV3 1QJX3 1RUG3 1PIV1 4CDWC 2RS31 1QJZA 2WWSA 1SMVA 4Q4W3 3VBSB 1BMV1 4IV1C 2HWC3 1COV1 1NCQC 1RUF2 2R071 5ABJB 5AC93 1ND2C 1ND3C 1RUC1 1FMD3 4CDWA 4AEDB 3FBMA 5FOJB 1VRH1 1RUE1 4FTSA 1VBB2 1RUC2 1ZBE3 1R091 2MEV1 1ZBE2 2RS33 1DDLA 4YVSB 4JGZC 2GSYA 1VBD2 1X36A 3JD71 2XBO3 3ZXAC 3JBG2 2HWB2 3NAPA 1D4M3 1BMV2 5D8AB 4SBVA 4JGYA 1PO11 2RS53 3VBUA 4CEWA 4GH4A 1R081 4N43B 1V9U1 1V9U3 3VBFC 2RM21 5BNNB 1AL21 3JD72 2RS51 2RM23 1NY72 4RS5B 1AYM1 1NOVA 1OHFA 1B35C 1GFF2 2RMU2 1VBB1 5CFCA 1R1A2 1MEC1 1TME2 4QPGB 4RFT0 4GMP0 5A32B 1H8TA 1R093 1MEC2 2MEV3 1QJU3 1HXS3 5ABJC 1QJU1 3JD73 2HWD1 3JB4C 1VBD3 4RQPC 1VB4A 1PVC2 4PDWA 3S6PA 2RMU3 1COV2 5K0UC 2X5IA 2GH8A 1OOPB 1AR63 4YVSC 5J98B 3JBG1 5ACA1 4GB31 4RHV2 4CDXA 1PGL2 1CD3G 1NA1B 1TMF2 2WZR3 4WM7C 1AYM3 2BFUL 1NCQB 4CDQA 2WLPA 3CJIA 1FOD1 1EV13 2R062 3NAPC 3VBRA 5K0UB 4WM7A 1ND2B 2DF7A 3TN91 1R083 1R1A1 4Z92B 5C9AC 5ABJA 1TMF3 1COV3 2HWC1 1RHI3 4BCUA 3VBUC 1PIV2 3TN92 4QPIA 2R073 2WFF3 1VAKA 2BUKA 1AR71 2PLV2 5DDJ3 1RUJ1 5BNPA 4Q4Y2 1FPN1 1B35A 1RMU2 3JB8A 1VRH3 1RVF3 4YVSA 1NG0A 1OOPC 3VBOA 1FOD2 4N43C 1TME3 1RUI1 1VBE3 4RHV1 1R1A3 1AL23 1NY71 1QJY2 2RS52 1FMD1 1BBT2 1PGW2 5CFDC 1ZBA1 4RQPA 1V9U2 1RB8G 1HRV1 4Q4X1 2BFUS 1QJX1 1PO12 5ACA2 4CEYA 4FTBA 4Q4Y1 1RHI2 3VBHB 2FZ2A 4IV3A 4NWVA 1RUJ3 4LLFA 1OPOA 4GB33 5CFCB 1BBT3 1RUF1 4Q4X3 4QPGA 1HQNA 1RHI1 5FMOS 1RUI3 3ZFFA 1VBB3 1RUD2 1VBC2 2R043 4N53C 2R063 1AR83 4CDUC 4RS5C 2R061 1TME1 5C8CA 1AYN2 4IV1A 1F2NA 1M06G 5CFDB 1X33A 3ZFEB 2BPA2 4JGYC 1RUG2 5JZGB 4QPGC 1RUI2 1HRV2 1BEV3 1Z7S3 2PLV3 3VBHC 2R042 4JGZB 1BEV2 1OOPA 5BNOA 1EAH1 2WZR1 4WM8A 1TMF1 1BBT1 1RUF3 5FMOL 2HWF2 4Q4V1 1QQP3 2WS93 1AYN3 1VBA3 3ZFGA 5C9AA 3VDDC 5C4WA 2BBVA 1RUH1 1FPN2 5BNPC 2RR12 2IZWA 3DPRB 1HRV3 5BNNC 3VBSA 1AR62 1AR81 4RR3C 2HWC2 1RVF1 3ZFEC 2XPJA 2HWB1 2RS12 1AR72 1RUG1 5C4WC 4N53A 4CDUA 4WM7B 3ZFFC 1AYN1 1D4M2 4CDWB 4AEDA 1MEC3 4Q4Y3 2RS32 2RMU1 5A33B 1ASJ3 1QJY1 1A6CA 1ASJ2 3NAPB 1FOD3 2RM22 4AEDC 4GH4B 1RVF2 1ND3B 4YVWB 4YVWC 1HXS1 3VBOB 1VBA1 1VB2A 4CDQC 1VBE2 1RMU3 1Z7S2 5BNNA 4N43A 2PLV1 4RS5A 1AR73 2WS92 3DPRC 1K5MA 4RQPB 1C8NA 1W39A 1ZBE1 2QQPA 2HWB3 2WZR2 1ZBA3 1AR92 5DDJ1 2WFF2 3VDDB 1PVC1 3VBHA 4IV3C 2Y26A 5LK7B 1HX6A 1MQTA 3VBFB 4PDWC 4PDWB 3ZFFB 3LOBA 3VBOC 4Y4YA 2HWF3 4RR3B 1PO13 1AL0G 5L7OA 4Q4W1 5C8CB 4FSJA 4Q4X2 1POV0 1AYM2 1NCRB 2WS91 4GB32 1HXS2 3IDEA 5D8AC 2RR11 1RUH2 5CFCC 1RUE3 4JGZA 4EJRA 2VQ0A 4CDXC 1VBE1 4Q4V2 2R041 2HWE1 4WM8C 1F8VA 1EAH2 5GKAC 1PGW1 2ZTNA 1NCQA 1NA1A 1QQP1 3CJIC 3CJIB 1ASJ1 1QJY3 1PGL1 1QJU2 4CEWC 5K0UA 4GH4C 3VBRB 1RUH3 1PO21 3VBSC 1ND2A
chains in the Genus database with same CATH superfamily
3AZYA 1K3IA 3AZXA 3DYMA 3KHBA 2ZGMA 3HNMA 2XHKA 3LDKA 2W9XA 3C7GA 4UW5A 3I4IA 5FZDA 3WQ0A 3IDAA 2ZGTA 3WNPA 3LOIA 4HMZA 3ATGA 1IHMA 4ASLA 2QQJA 1WD3A 3OD4A 2GAUA 3JCIA 1A34A 3RMYA 1XOYA 1A78A 2RS11 3GZTB 4P9LA 4QPIB 3I2KA 4QPIC 4YSFA 3CF6E 2ZZQA 1W3VA 4XFGA 1DQ0A 3OYWB 1W6OA 2JX9A 2B8MA 1QQP2 1HRI2 2ZX4A 4BU2A 2LW8A 4AQSA 1EP0A 3FX3A 4LBQD 1ZBA2 1GOGA 1MS5A 1O5LA 4IGOA 1YIFA 5IVYA 4M0NA 4GJYA 3VKNA 2ZEWA 1RIRA 1Y9GA 4YVWA 5FZCA 2ET7A 2XONA 4IEUA 4K1YA 5DPNA 1J3PA 3DUIA 4P9WA 4UXAA 1V6NA 5KBFA 2XXZA 3H42B 3UNPA 2OIIA 2BVVA 1SLAA 1W06A 2D3PA 2PXJA 1H8VA 4AGRA 2EVXA 5CVRA 5ACA3 4QXKA 2CYFA 3M1HA 3BTXA 1UWWA 2Q5TA 4EWAA 1H8TB 1AR93 1K5MB 1XQNA 4OZOA 5BV6A 4JTOA 2NN8A 4XFIA 3FJSA 5A6XA 4E9KA 3ON7A 4NHMA 2LS6A 4IV3B 5E16A 2HBUA 2PYTA 1UU4A 3MIFA 4QX3A 4R9BA 5ERLA 3CZJA 1X8MA 4XMAA 4DXRA 5FYHA 3CNAA 1KDKA 2E51A 2P4EA 1HB2A 1QNWA 1YLLA 5K4LA 4W6WA 5FZBA 5I0TA 5TSWA 4CCKA 4URAA 5JR7B 3SEPA 4WVVA 4QX0A 3P5BA 3A7QA 2R16A 5JPNB 2VQUA 1X50A 1W0NA 2H6CA 3IPVA 3ZFEA 4XHXA 4AI3A 4OUMA 3NNMA 1BCXA 2QQVA 2V5YA 5FXXA 3D0SA 3I2GA 1CAUB 4FVVA 4IV1B 4PF5A 3ZMOA 1QJX2 1UQXA 2JKXA 2QZ2A 2VZUA 4UFMA 1APNA 2NM1A 5LA1A 2Y34A 4Q0VA 2PELA 1AR91 4OI1A 1IS4A 5KHJA 2AACA 3ZFGB 5AC91 2PFWA 5C4WB 1UX7A 3MI8A 3EYPA 3FUOA 3ZFGC 4IXLA 1F31A 4WM8B 1W9TA 4XABA 4IE0A 3E5UA 3GZUC 4BMBA 4YW6A 4YARA 1GOHA 1GR3A 2E33A 3MIBA 5HCBA 3KF3A 4FXGB 4OHYA 3I2HA 2JEMA 5FXWA 1RUG3 4K8FA 1O8SA 1RGSA 2R0HA 4DINB 2JDUA 2VZ3A 3VBSB 2IXJA 2HWC3 3N9NA 3RSJA 3AYAA 3AKPA 3D8CA 2YV8A 1CAWA 3IB3A 2VZRA 4I3GA 4TXWA 3BPZA 1LB2A 3PMSA 5F3EA 1UY0A 2GH2A 3HQXA 4DRRA 2VTFA 5IVEA 2WSUA 1LGCA 4NO4A 5F6LB 3RYKA 1XU2A 2FDIA 3B5LB 4EQVA 5FUNA 3RVHA 5FZAA 1DCSA 3KMHA 4GAZA 1SHWB 3FBMA 4A7KA 4C0BA 1JUIA 3MV01 1JOBA 1O7FA 1DGWA 3PUHA 4OI4A 3VD4A 1ONAA 1W6PA 4IE7A 2N7GA 1Y9QA 1JI6A 4AG4A 4FTSA 3ZR6A 5T5PA 5JWPA 3WT3A 1ALYA 1VMHA 1ZBE3 4GXLA 5E8AA 4FAGA 3ECQA 1DDLA 3A0NA 2A73B 2GSYA 4R52A 4CCOA 4D7YA 1VBD2 2VZSA 3GZAA 3PJYA 2XJUA 4XXAA 4BWOA 4B4RA 1PK6B 3FC0A 1ULOA 3T1MA 4QMAA 4IESA 1D4M3 5FREA 2YU1A 5D8AB 2WNUC 4HVQA 4AVCA 1OT5A 4ZKTB 4CEWA 1ZNPA 3VBUA 2WSVA 4AFDA 4QXCA 3LAGA 2JDNA 5FY9A 1US2A 2VD7A 2VZTA 3I2DA 4N7UA 3TEZA 5JXHA 3UJOA 2YGLA 2I2SA 1W2OA 2FCVA 4JHTA 3UETA 3N3HA 4W50A 3JD72 5EXOA 2WZEA 5FAXA 5LBBA 3LIHA 4TWTA 1NY72 4LOSA 1OHFA 2ZXQA 2H0BA 1B35C 2WABA 2P2KA 2OUJA 2J42A 4CU7A 1S4CA 1OQEA 4UFKA 2DTWA 5IAVA 3T2QA 1DP0A 4CCLA 5CKNA 1C57A 1H8TA 2VZQA 2QUOA 3GM8A 4PIYA 4N7IA 5FXVA 4U36A 3LEMA 5KXEA 4L99A 3O0VA 4Q0QA 4XXPA 1L7LA 2J7MA 3WF1A 3JB4C 1SBDA 3ST7A 1PVC2 1XE8A 1YHFA 3AYCA 2GALA 5FY4A 2VOXA 5C6CA 2BWCA 5FZ4A 5FXZA 4K8RB 1JZ8A 1D0GA 2D44A 5IVBA 3DXUA 4ONUA 4BPZA 2WZ8A 2V72A 4ISRA 2W1WA 4AFMA 1F15A 3FZ3A 4CXXA 3TBDA 3GNEA 3INAA 5J98B 5A7SA 1SBEA 2FCUA 4IEQA 5FLJA 3ZYIB 4HVRA 5L9RA 1JYTA 3USUB 2BGCA 1FV3A 4RHV2 4ASKA 4BZ4A 1ZZ9A 1VAMA 2VCMA 4E2SA 2IFRA 1NA1B 3A21A 4HVOA 1OFNA 1J1TA 4LXLA 1UN1A 4XUTA 4ZS2A 1LGBA 2BFUL 5JSRA 2PMWB 5GZDA 1LJ7A 2WLPA 1VJ2A 1P8JA 4MHRA 2BGOA 3AVRA 4H7MA 1EV13 3GALA 4XZUG 4YFWA 2R062 4ES8A 1WUVA 2DF7A 2QQWA 4J25A 4LTAA 4AQTA 2GN3A 2XL9A 2FDGA 1Y9MA 1W9FA 1TMF3 1COV3 2NPIA 3HBKA 3IMMA 5K7PA 4J6GA 4GWJA 4UFIA 1WCQA 3C7FA 4QPIA 3AXDA 2VMCA 1S2BA 1QMJA 1XSQA 3NKGA 5FJHA 4QDQA 1W6OB 1JOPA 5LY1A 3T2TA 4Q8KA 2XB6C 4GWIA 3RFRA 5C3SA 1S2KA 2E9QA 1B35A 3K3OA 1HW5A 3RS6A 4EWEA 3WDXA 2WQ8A 4FCAA 2Y33A 2A3YA 3ZSKA 1QXRA 3HNBM 5LEJA 2WNEA 1VRH3 4ISQA 1HIXA 2WN3A 3N7LA 1OFSA 2OX0A 3OPZA 1MR5A 4OVEA 5FK8A 2R1DA 1RVF3 3KV6A 2KR2A 4JHZA 4N43C 2VAUA 3NSTA 4BHPA 2ATFA 4GWMA 1R1A3 1QJY2 5DUWA 4D6RA 3MIEA 2VR4A 5IYYA 1FMD1 1LCLA 5L36A 3ACFA 2AENA 3A4UA 4INDA 5J36A 3BUCA 3I49A 4V2WA 3VD9A 1ZX5A 4KWKA 5GLWA 4GJZA 2O8QA 3MFAA 4P08A 1HRV1 4KBZA 4NIIA 2BFUS 3NNGA 1ODMA 4C8DA 1POQA 3WZ1A 4D0QA 5A1FA 1SCRA 5ACA2 4FTBA 1LOBA 5T52A 4QKBA 2QFEA 1K5JA 4CE8A 5LRRA 2FZ2A 3ZIWA 1AF9A 4IV3A 1Y4WA 4EE2A 1TE1B 1W6MA 3JQWA 3M70A 4LJHA 4LIUA 3TAYA 4L92A 2FBEA 1Q56A 4GB33 5FR3A 5FZ8A 3WY6A 5FO7B 1HQNA 3WHUA 4YM3A 2WJSA 3WG2A 1BLZA 1N47A 3L2HA 3MDPA 1RL3A 4LA3A 4AQ2A 2G19A 2LALA 3QLQA 3AM2A 1A8DA 1QF3A 2WA3A 4I30A 5JOXA 4JKKA 1IPJA 2R061 1TME1 4FFFA 3K3NA 3GZEA 4OHVA 3WINE 4YW2A 3UJQA 3VKMA 1GNZA 3WDVA 1CAUA 4IV1A 3WNLA 4LORA 1F2NA 4BDVB 1YEWA 2B7YA 2I45A 3PUIA 3T2OA 2D6LX 2ZGOA 4BQ3A 2BPA2 5JZGB 4QPGC 2VMFA 3M4FA 1I5PA 3LWCA 1J83A 1HRV2 1RUI2 1UYZA 3MYXA 4PT6A 3U4XA 4BK5A 2SLIA 4BIOA 2B5HA 5BNOA 5A80A 3NMBA 4WM8A 5T55A 4DFSA 1RUF3 1JHNA 1WCSA 3VN4A 5FKBA 2WS93 1AYN3 5T5OA 1JTZX 4BQXA 4E4DX 1W2TA 5CBLA 2DCZA 2BBVA 4P9YA 2VH9A 4ARXA 1WBFA 5IK7A 1FPN2 1W8ZA 4KWUA 4E8CA 3DPRB 2RDRA 1UMZA 2DU0A 2QBXA 1GP6A 3B9CA 1FX5A 1CIWA 4EN8B 1F5FA 3AZVA 1L7QA 1DQ1A 3MGUA 2QZ3A 4RR3C 4U2AA 2HEYF 1W0PA 3ZFEC 4R9CA 4TTGA 2XPJA 5JOZA 4AAXA 3MIHA 3WUDA 3SMHA 2PAMA 5F7UA 4DXTA 2J1RA 3VD7A 1CONA 4IE4A 1OURA 2X09A 3Q8AA 2KA3A 1S0IA 5EYYA 5JR2A 2FMYA 1AYN1 2R49A 2QQNA 2PQQA 1W6PB 2WQ4A 2A6WA 2W1SA 4XYXA 4CDWB 1J58A 2BQPA 5A1LA 3OYWA 2E63A 2BOIA 2XQXA 4QT6A 3Q8BA 1YNAA 4XUOA 2YU2A 2OQ6A 5LBCA 3S5AA 1UY3A 2ZGNA 2RMU1 4Q5OA 2ZGKA 5CEHA 3PIGA 2UWAA 1ASJ3 2ZEXA 1H9PA 4XBNA 4UBHA 1SZBA 5FZHA 1GNYA 4BLIA 4D69A 4XFAA 3OEAA 3LPGA 2WYFA 2GMMA 2RM22 4L0PA 4RFRB 3WVJA 4AEDC 1NXD1 1RVF2 4XFBA 3WUCA 3NNJA 5BY5A 3BIEA 2PAEA 4FPOB 2JB4A 2RJ2A 4YVWC 4R8HA 5GJ6A 3VBOB 5IJRA 3ZXEA 1Q5OA 2VY0A 4AEMA 4COWA 5F5CA 4ITCA 3S0MA 4LBNA 5D2AA 5IFPA 4IW3A 3ZSMA 3H8OA 2BWAA 1RMU3 4QXBA 5E1RA 4PLNA 2EF6A 4N43A 4M3CA 5A3OA 1G7YA 4PCRA 1ZZ8A 1LHVA 1X9PA 2XWBB 1TG7A 2DUPA 2E31A 3ILNA 4YM2A 4B4PA 5JOYA 3DPRC 1K5MA 5FYVA 5DUXA 4OFGA 1ZBE1 1CR7A 1DYPA 3E97A 1URXA 4LBJA 1HKDA 1WGPA 4HETA 3NV4A 4I09A 5DDJ1 1IS5A 4JKMA 1O4TA 2HEWF 2PHWA 1H2MA 3AP7A 1PVC1 4H55A 2O14A 4N9HA 2PHUA 5B4XA 2Y26A 1JYCA 5C8WA 5I8TA 2X29A 4KU7A 1OVPA 1LHWA 3MF9A 5FZ0A 1GUIA 2W5FA 3OGGA 3HVDA 1JZ6A 2WAAA 5IVJA 4PDWB 1CAXB 1V0AA 3ZFFB 4CU6A 3LOBA 1KS5A 1G9DA 1Y7BA 4UFJA 4AFBA 3CHXA 1AL0G 3NV2A 2ZX3A 1SLTA 5FIXA 1XNKA 4FSJA 4MX3A 3GHMA 4BXSV 1AYM2 3Q8EA 3R4DB 1W0OA 1HXS2 2OA2A 3WX5A 2QQLA 4QWNA 1V6MA 2QQIA 1GOFA 4FFGA 4JV4A 1WMFA 2VCCA 5CNAA 5IVCA 3ORJA 4GALA 2O8OA 1JYXA 4QHOA 4MOAA 2VQ0A 2VNGA 3AL5A 1NZIA 2D43A 3BTAA 2DCJA 2OKXA 3H8UA 2A7AA 2HYXA 1REDA 1MZ5A 4H3WA 4DMIA 1CN1A 2EAAA 4NAOA 5FYYA 4LE4A 5GKAC 2ZS6B 3BN6A 1NCQA 3LA2A 2BZDA 2OS2A 2RVAA 4WV8A 3USSA 3AP4A 3O5SA 4O9EA 1TVGA 1QJU2 4MG2A 2RJLA 1RUH3 1PO21 3VBSC 2B42B 3NJVA 4OYUA 3U4SA 4LBOA 3ZMNA 2EIEA 2JIJA 5A3WA 4LK7A 4X8PA 5KXCA 3JBG3 1PZ9A 1AX0A 2A6ZA 2FQPA 1RMU1 1POV1 1MQTC 2VE1A 3W20A 1AR61 4CDUB 5F32A 3GYDA 3J8F1 3NNLA 4EWDA 3UGFA 2Y8KA 1I5ZA 4KNCA 3QACA 1E5RA 1JBCA 2R072 3HQUA 1RUC3 4Y3OA 3POBA 4GMP3 2D93A 5DZFA 3ZYPA 4CEYC 2K9ZA 2O1QA 2E53A 2OW4A 1VBA2 2CNAA 3FHQA 2BGPA 2Q4SA 4YG6A 5D8AA 1W9YA 3LSDA 4JGYB 2XMLA 3POJA 1W2AX 2GZWA 4LBKA 4CEWB 3VBUB 4EN6B 3R4UA 3UESA 1FMD2 2BV4A 1H9WA 3WDUA 2XL7A 3UL2A 5JSOA 3WP4A 3ZYBA 5FLHA 5DAWA 4NIAA 2QNKA 1E5IA 3RI8A 1PNGA 4M00A 1E57A 1NA1C 1SLIA 5C8CC 3HD8B 3ZLIA 1DIWA 1GZWB 4BYYA 2DVAA 5LWBA 3ZN6B 2YFZA 5HPOA 5HCHA 1CQ9A 4YM1A 1QXPA 3FFQA 4Q8LA 1GYKA 2Y6FA 4RHV3 5LBFA 3VZKA 1RUD1 1LRHA 1VBC1 5FLIA 5A3TA 3V65A 1FT9A 1QXJA 2K46A 3LEGA 3LDRA 4B1LA 1YQ5A 4FPCA 2ZZJA 5CU1A 4FQZA 4NR1A 1H8TC 4DIQA 5C3PA 5BNOC 1W8TA 3HOBA 1A3KA 3M3QA 3ZYRA 5CKQA 1ZRFA 1DBNA 2JDHA 3WW2A 4WZFA 4YG3A 4EYUA 3MHZA 3JU9A 3ZOIA 1NXMA 4TYSA 3C8XA 1R092 2LM3A 1Q8QA 4Q4W2 3UGGA 1HJFA 2BERA 4Z2AA 1EPWA 4MUVA 3SITA 4ATFA 1AUYA 1XE7A 1Y3TA 4L97A 1J3QA 1D4M1 4OUSA 2TUNA 4IERA 4OHZA 4DUVA 2HWD2 4KWJA 5JZGA 1DYOA 1Q3EA 5JLVA 2GNMA 4QM9A 2GC3A 2Y6GA 3BYWA 1AL22 1U5XA 5FMCA 4A6SA 4QKNA 4H2AA 4J1XA 1NQDA 4XJUA 2C24A 2JG8C 4D6QA 1O3RA 4ZONA 1S0DA 4EN9B 3ACHA 5EP9A 1HV0A 4QX7A 4YW5A 2AZ5A 1WCDJ 2GMEA 4IEOA 2B9VA 3K77A 4OI0A 2JIGA 5J48A 2WT1A 4FTEA 3AZZA 3POWA 1C8M2 2AUYA 3AL6A 2HWD3 4M3CE 5C9AB 2WKKA 4PIXA 4CP9B 3ZVXA 5DUVA 2JENA 3PHMA 4ES9A 2JICA 1RC6A 2AGSA 1JXNA 2D7FA 3H1MA 2J22A 3QD6A 4FPHA 1PIV1 4DQAA 2RS31 3A23A 4A41A 2GN7A 4ZZ8A 4OHWA 5CA6A 1O3SA 1SMVA 1OPMA 1X7NA 4Q4W3 1RYYA 4XDQA 2TNFA 1WA4A 1COV1 2YMZA 4C90A 4P02B 1BMV1 4JRLA 3LPFA 1RUF2 3K51A 3ZXKA 1W28A 2WNUB 5HXVA 2YXSA 3B69A 3ILRA 4PJYA 2D98A 1ND3C 4UFLA 1FMD3 4OLLA 4CDWA 3OB8A 3VZNA 3T2PA 3GDBA 4ZS3A 2ZMLA 2F17A 3J4UH 3MF6A 4ZY9A 5JXGA 3ACIA 2ZOEB 1ENSA 3OY8B 4FPLA 1G9AA 2GC1A 3TEYA 3DGTA 4OHXA 5F5QA 5FPAA 3RWNA 1VBB2 1RUC2 4YZ3A 3T4VA 3TNQA 3T08A 1R091 3WD5A 1WKYA 2WINB 1VMJA 3WLUA 1X36A 2IXLA 1CWPA 3JD71 3ZXAC 4CP1A 3VKLA 5F5AA 3J9SA 2HWB2 5G05L 3NAPA 3E6BA 3G6JB 1ZZBA 3SKJE 1BMV2 1LR5A 4Q0SA 3B7MA 4JGYA 1ENXA 2VQAA 3I59A 1S0FA 4M3CB 3NJZA 4N43B 4G9SB 4DEVA 3PMEA 4RD7A 1HB3A 3R0RA 5D21A 2R30A 4HKOA 4YGEA 4LPLA 5FMDA 4Q0UA 4XILA 1V9U3 2CSGA 4CUCA 4IE6A 2RM21 1YCIA 5BNNB 4QAWA 2RS51 4ZXEA 2RM23 2QQUA 2MNGA 4Q27A 1NOVA 3ZN6A 1W6MB 4CXWA 1C5IA 2B39A 3LSEA 5FY1A 3QBQA 1OBNA 1QGLA 1SLCA 5FO8B 2PHTA 5FKCA 3T0AA 5C71A 1CIYA 1BHGA 1JU3A 3K2OA 2FDKA 1ODNA 1GQHA 2JDPA 4QGNA 3KQ4B 4K9SA 1C1LA 2VVEA 2VGDA 4LBMA 5FPLA 5JI7A 4FT8A 1XNBA 2J1AA 3RZLA 4C1WA 2Z42A 5FCCA 4FPKA 5T54A 4AVAA 5ABJC 4KQ7A 1QJU1 3JD73 2HWD1 4ZU5A 3URFA 2WFPA 1F4HA 1PZ8A 4K21A 2HH9A 2WC2A 1XBFA 4LHKA 4F83A 1VB4A 4X8NA 5FTTC 2IXKA 1U12A 1Y43B 4NVPA 4A45A 2BNMA 2E6VA 3DL3A 3O14A 3SC7X 2VO5A 2WWJA 5JMOA 1A8MA 2X5IA 2DUOA 3AMHA 5C3QA 5EIYB 3RGBA 3N36A 4EN7B 1CGPA 4F8AA 5IK4A 2P3JA 4YVSC 1U0AA 4P00B 3LFMA 4NE9A 5A3PA 1C3HA 2JG9B 1GZTA 3ITQA 1G86A 2P37A 3K4AA 4DB5A 2R0FA 3ILFA 5FY7A 3M3IA 4Y4RA 2CAUA 3N7KA 3WP3A 2BVBA 3AP5A 1ZRIA 3KD4A 2JE9A 2YC2A 3FUQA 2RHPA 2VOVA 5HCAA 3O1VA 2XOMA 2ZKLA 5JSPA 1AYM3 1DQ6A 4AXOA 3BI3A 2F4PA 2HBTA 4XACA 4QPWA 1BYHA 2G9ZA 3VKFC 3IDCB 4UW3A 2VECA 1WCKA 1FOD1 3U10A 4I01A 3U11A 2YZ4A 3VBRA 3TEXA 2ARXA 2D6OX 2W0XA 1ND2B 2ZGQA 1CX1A 3LF7A 3POFA 4FI9A 1D4VB 4LK6A 1R083 1GANA 2VU9A 3SH5A 4Z92B 3HJRA 5C9AC 4R4XA 4LBLA 3LKJA 2HWC1 2P6CA 1ZRRA 2CAVA 2Y64A 2BRTA 3VBUC 1KFUL 1OH3A 4PLOA 2HKXA 2DVFA 2VMEA 5J09A 3T09A 1VAKA 1OUSA 2P17A 1V70A 3PU3A 4OQ9A 2PLV2 5BNPA 1RUJ1 4BQWA 2D5FA 1Q8VA 4Q4Y2 4F3JA 1RMU2 4UAPA 3JB8A 3PUQA 5FZGA 1VRBA 1OA2A 5E89A 5FYIA 2WNOA 4MLOA 4NRMA 4XIOA 2ZPXA 3O1RA 4YVSA 1OOPC 2Z5WA 3VBOA 5FP4A 3HQRA 2ZMKA 4LKDA 1TME3 3E5QA 3CJXA 5A7OA 4LQRA 1G9BA 1MS1A 4H14A 1S0JA 1VBE3 3MLLA 1AL23 4CCEA 4XTPA 1JYVA 1MS8A 2R1BA 5B2GB 2R6QA 1SBFA 2W3JA 4QQPA 5FZ3A 2CWMA 3WF2A 1H0BA 1BBT2 3I59B 2Q1FA 3WF4A 1IKPA 2D6NA 5FJKA 2VJXA 3LGRA 3PU8A 4D8MA 5KC6A 1YIPA 2VTXA 2YPJA 2J1UA 3GBFA 3H1WA 4M01A 4ZU7A 1QJX1 1PO12 1LENA 2GMPA 2XJRA 4RYDA 5FP8A 2ZX0A 3WR0A 5DQ0A 1RHI2 4KI5M 3VBHB 5JIAA 4LLOA 2A6XA 3PTRB 5FZFA 3MLJA 2VVDA 3SNMA 1RUF1 4MVTA 1REFA 2ID4A 4QPGA 2IUWA 4AQ6A 1PMJX 3LCPA 2NMOA 2R32A 5HBAA 3ZSEA 5J37A 1HV1A 1RHI1 4QGLA 1RUI3 1G9FA 2QVSB 3ZFFA 1VPHA 1RUD2 1VBC2 2ZABA 5A3LA 2UYBA 4HSLA 4N53C 3I97A 1WLCA 2D6PA 4FPEA 2EXHA 4HLTA 4RS5C 3ME2A 3WG1A 1X8EA 1V00A 2YPDA 1BVVA 3JUUA 3WCRA 1AYN2 1YQ8A 3WP6A 1UY4A 1W05A 1XSRA 4QU2A 1M06G 2FDJA 2GDFA 3ZN4A 1UPSA 1YFYA 5A7QA 4CU8A 3PJQA 1O6UA 3H7YA 2CDPA 1OH4A 1BEV3 2GC2A 1Z7S3 4K7JA 5A7PA 2DDUA 1C4RA 5A6ZA 2G1MA 4MGSA 1KQRA 1KJLA 4MH0E 2WZR1 4XFFA 5FZEA 3VB9A 1ZREA 1WLWA 4CU9A 3OGSA 5FMOL 4ARYA 1VR3A 4CUAA 4DPNA 2XJVA 2DBIA 1GICA 1KITA 2YYOA 4Q1RA 3M3CA 4CP9A 5F9TA 2CGPA 4M3CF 4Q29A 2DWRA 4L2NA 5HV0A 1RUH1 2VBPA 4JRAA 4QHBA 5BNPC 5FWJA 3NW4A 4O61A 5KXDA 5F8PA 2IFWA 3I3MA 4XQ4A 1HRV3 1NKGA 3OD0A 1UOJA 4LOTA 3VBSA 1S0BA 2DYCA 1IQDC 3KQRA 3H1YA 4XUQA 3RZJA 2FD8A 1JZ2A 2Y38A 2ZJCA 2WNUA 3MEPA 2YBPA 1MS0A 4L9BA 1HJGA 2RS12 3T3YA 1AR72 5A6QA 1OC1A 1XNTA 5GM0A 4CDUA 1D7PM 2H6BA 3C3VA 1LULA 4WBBA 4JQTA 1GU3A 4ET7A 3ZKYA 1ULDA 4P9IA 5I8YA 1TNRA 2XDVA 1D4M2 4XE9A 3ZXFA 1MEC3 2NQYA 3IIIA 5C7GA 4FPJA 3T0DA 3VZLA 4AL9A 1ZZCA 5C70A 3KHCA 5F6KA 2Q0AA 5FZKA 5A33B 1PK6A 1QJY1 3HT2A 4BQ4A 3AB0A 2PHXA 1SG3A 3TOJA 3WNOA 2NMNA 1ASJ2 3NAPB 5J7MA 2OPWA 5HV4A 1EY2A 4C91A 4MGKE 3HPNA 4XCBA 4LEJA 1UXXX 4COYA 1LEDA 4S2HA 4XJ9A 3TNPB 1HXS1 2VNVA 3WNXA 1VBA1 5A3MA 1LESA 1ACCA 2Q1MA 4DO0A 5C33A 4XCAA 5I0DA 4E8DA 1YQ6A 1ZZ6A 4LO7A 2W08A 4KBBA 4FOQA 3SXWA 4BIFA 4FAHA 3VHOA 2SBAA 1FYUA 2OXBA 3C2UA 1AR73 4QKFA 4UBGA 5M0TA 4GA9A 2WS92 1CZSA 4QKDA 3DN7A 3WV6A 3ZSLA 3THPA 3BTZA 1C8NA 1W39A 4IGPA 1KEXA 1BXHA 1E5HA 3OTFA 2ARAA 4FFIA 3O1PA 3OUHA 1YYNA 3H3ZA 4YW1A 4XW3A 3KLSA 1JUHA 1AR92 2W1QA 4X6QB 5FYBA 4CCDA 2WLQA 2DCKA 3AMMA 3GBGA 2YGMA 3VBHA 5J3UA 2DCYA 5EZWA 2PHFA 5DUUA 2HYKA 3KV4A 2VZ1A 4JDOA 4LO4B 1QU0A 4YGBA 3UT0A 4YFZA 3TEWA 1UIJA 1M4WA 1RITA 2XVGA 3RJRA 1OLMA 4PDWC 3VBOC 4EV0A 3LQCA 1GKBA 3LD8A 2YC0A 1UMHA 1WMEA 4NRQA 3BCWA 4BK4A 2RV9A 4J1WA 2PHRA 1UCXA 4Q4X2 1POV0 3AMNA 1ULCA 3H7JA 5EV7A 1EYBA 3ZYHA 1GQGA 2JDMA 4XJ8A 4GB32 1GBGA 1UZ0A 4D7TA 2AEYA 3IAPA 3K4ZA 3USUA 3KCYA 1QHDA 2C4XA 4YW3A 5D8AC 2RR11 2A6YA 1RUH2 2QDNA 1K45A 3WG4A 4BQ1A 4Y1ZA 4OUEA 4MYEA 5B4NA 2BNOA 2C26A 3OG2A 4KMQA 4GULA 3FLRA 3FMGA 2B4KA 2ZKNA 3THCA 4CRQA 2HWE1 2XUEA 4COVA 4BXFA 1OLME 5L9BA 1PGW1 2EIGA 2G4IA 3KS7A 4QDSA 4COUA 1KXGA 4XF4A 1QQP1 5LBEA 4FBFA 1QNYA 3MV11 2K0GA 3AKSA 2BEOA 3MO4A 5DG1A 3NQHA 3B01A 3X29B 4CEWC 1LAJA 3H0OA 3IBMA 1W90A 1ND2A 5J1XA 1NLQA 5EYXA 3E1F1 4YW4A 4WVMA 2JE7A 2KD7A 3WP5A 4CDQB 3O1TA 1YWKA 1FNYA 4XBLA 1VRH2 5FO9B 3RZMA 1HRI1 4NAMA 3SCHA 2TBVA 4P14A 4AOCA 3IM0A 4AVSA 1WW4A 2DV9A 1WZXA 3I2FA 3WQ7A 2W92A 5FMBA 2OZ6A 3OY8A 4OQ8A 5BNPB 1OMIA 1W3XA 2ET1A 3NJYA 5LZ6A 1SFNA 2ORZA 3TN93 4OI2A 4GMP1 1LKNA 1WLDA 2OPKA 1XNCA 5L19A 4Y5SA 4X6RB 2B45X 4MO3M 1JZ5A 1R082 1S0EA 5JZGC 4YZ1A 4DRVA 3BTYA 2ZCWA 1NX9A 4HK8A 2ILMA 1H2KA 1HLCA 2WO2A 4QHZA 4Y5Z0 1QDOA 5A33A 3RDIA 5FY8A 2D97A 1NCRC 2XBO2 3VGIA 1D0HA 2X8KA 4CP0A 2ES3A 1WW7A 2XUMA 3MBWA 5A7NA 5I93A 3B93A 5GALA 3A22A 1PGSA 2LRPA 5FBZA 4JAAA 3DCQA 2ZHKA 1UO9A 3J7LA 1LOGA 2PTMA 1Z7S1 5KC5A 4MXVA 5D1IA 2BJSA 3NJXA 2A70A 5I0SA 5J96B 4YZ4A 4HSJA 2JD4A 4IUGA 4GKXA 2ZACA 1OQDA 1EV11 2BBAA 4DNYA 1JYWA 1U5IA 2VNRA 3G7DA 3M8LA 4BM8A 3DECA 1OF3A 4CEYB 2GNDA 1RUJ2 2ZX2A 4YLZA 4CUBA 1BKZA 2XJSA 3BVCA 1VBD1 1QWRA 2ZEYA 2WIIB 4DS0A 3U75A 2WRAA 4XBQA 2RDQA 2MEV2 1YQ2A 4O9GA 1W2UA 3TYJA 1W04A 1JOJA 3VDDA 4G4FA 3WNNA 1AR82 3CQOA 4FP2A 2D5HA 1UKGA 1YFUA 3HNYM 4MXWA 4A6OA 1MQTB 4NWWA 1UOBA 2X5IB 1PO22 1YFXA 2GNTA 1DQ2A 1FV2A 3GBWA 5FZ6A 4W8JA 1AVBA 1WW6A 4R9DA 2BW8A 4QPYA 3HAGA 1I3HA 3MICA 3I54A 5L7OC 3KVBA 1G6NA 4AVTA 1Z78A 2E7QA 4NMIA 4QX8A 2JG9A 1NCRA 3VHRA 4CDXB 2HWE3 3WDYA 1O8PA 3N9LA 1W03A 2Y0OA 4ORFA 1NLRA 3WW3A 1PVC3 5E88A 2WYSA 1PMIA 5FYZA 2B9UA 4Q4V3 4RN5A 1FNZA 3JQXA 3DF0A 1BK0A 3DPRA 3SISA 1IQAA 5AVPA 2EAKA 1QJEA 4OULA 1VMFA 3CLPA 4Y26A 4AZZA 4DY3A 1PIV3 4HANA 5IUQA 3BOWA 1Q8SA 1JU4A 2A6VA 2VMIA 2JJ6A 1QJX3 1SFYA 2Q8OA 2VXJA 4LBQA 2WWSA 1VIWB 1EPZA 3WCSA 3LEKA 4P9XA 2ERFA 2ZGPA 5C5TA 2QDRA 2VOWA 2WAOA 4XUPA 1SLLA 2Z4FA 3NV3A 2R071 3GJAA 3LA3A 3PUSA 1YO8A 4A3ZA 1ND2C 1VE0A 1WMDA 1O3TA 1D2QA 2AR6A 5KR7A 4AI2A 4CCJA 2I07B 3KGZA 5IVVA 3RJ2X 3V0AA 1ULEA 2V09A 3MUY1 3PURA 1STMA 4DEQA 4TLGA 4CUGA 3SHRA 1OKOA 1SDWA 2CGOA 3KSCA 1SFPA 5A7WA 2MEV1 4XC9A 3O1SA 4CP2A 3DXTA 4AWDA 4YVSB 3LEIA 4JGZC 1YXWA 5FBJA 2Q1ZB 4IGQA 5F3GA 3N7MA 5FZIA 1BVP1 2D6KA 1UYXA 3C7HA 2XBO3 3ZPOA 5CZKA 1WA6X 1TZOA 2ZAAA 2P3KA 3JBG2 3OPWA 3O12A 3S7IA 2JG9C 3LE0A 1SPPB 2MHFA 1MZEA 1CAVB 1GWKA 2BP6A 2RG4A 4SBVA 4KG8A 4Z07A 2K2SA 4XQDA 2DUQA 5CISA 1R081 1V6IA 2UYAA 4F7ZA 4LO5B 4HPKB 4WVZA 4Z82A 4BLJA 1CX4A 2D6MA 1H2NA 5DAVA 3C7EA 3UKVA 1OSGA 2XKPA 1W8FA 4RGGA 4RGKA 3VBFC 1O5UA 3SLIA 4B8EA 1U5ZA 2W91A 3I3EA 5IHRA 1AL21 3ALQA 3RG0A 2CDOA 2VVFA 1LEMA 4HK9A 5GLUA 4P9JA 4RS5B 1AYM1 4JDNA 2WQZC 1JODA 3U1XA 4AEJA 3CU7A 3P3PA 4LKSA 1OD5A 1VBB1 2XVKA 5CFCA 1R1A2 5LK5A 4QPGB 4RFT0 1H1MA 2DVGA 5C3RA 3V56A 4D94A 1MS9A 2FCTA 5BPXA 5A32B 4A2UA 4UWDA 3ES1A 4B3NA 2MEV3 1LHUA 1DZRA 5C5UA 1XE0A 1PHMA 1HXS3 3H3LA 2P3YA 3POGA 1AJKA 2QE3A 5CYYA 1XNAA 1GP5A 4Y24A 1VBD3 4AEKA 4FPGA 5HI0A 1W6NA 1ULFA 4A44A 4QB1A 3EQEA 4MXWB 3E6CC 4LE3A 1COV2 5K0UC 4Q26A 2A5ZA 2GH8A 3TWIA 1E5SA 4XF9A 3VDCA 1ULPA 1XYNA 2W68A 2XJTA 2IXHA 3VL9A 1UZZA 1AR63 5DAPA 5BYNA 1QH7A 2DTYA 1GQPA 1X82A 3KT7A 3JBG1 3N7JA 2OYZA 3S30A 3WXPA 4EROA 3MW2A 4DOUA 4N9IA 3CEWA 4XPVA 3H8XA 4GB31 2VMHA 3KWVA 4QQHA 4CDXA 4Y33A 1VLNA 2ADEA 2LTNA 5GZEA 3WNKA 1VP6A 5ANNA 3O1MA 4LNVA 4QDRA 2CU5A 1F4AA 3ZPYA 1TMF2 1IKQA 4BQYA 2WZR3 4ZU4A 4WM7C 4JTNA 1GMMA 3I3DA 2Z2SB 1UOGA 2A3WA 3B3QE 3CL1A 3J7MA 3ACLA 4ATEA 2YUEA 2XJQA 2Y6KA 3VLBB 4Q1PA 1GLHA 3SQOA 2J1SA 3HT1A 5BXXA 1UU6A 4PF1A 4XAAA 4W6YA 5K0UB 1FXZA 3WG3A 2BOJA 5BUVA 4WM7A 3J26N 3TN91 4FFHA 3PVNA 4Z2WA 2CHHA 2IVJA 2YDEA 1R1A1 4XVHA 4LO6B 5GLTA 4BMEA 4JQRA 3SEEA 1UIKA 5FRAA 1US3A 1XYOA 2R073 2ZHMA 2W2IA 2WFF3 3OPTA 3I3QA 3AX4A 4NHXA 5DDJ3 1KRIA 2W46A 1FPN1 1RXGA 3IT8A 4LUMA 1V6LA 4FO9A 2E26A 4QB6A 4D6SA 1XXNA 4Y1VA 3IZOA 2EIDA 5FPZA 1NG0A 3WSOA 5ANQA 4K6BA 1JHJA 4QXHA 1IS3A 2XVLA 1FOD2 3VDBA 3KV9A 1F35A 4QU1A 4E4HA 4TN7A 3ENRA 1RUI1 4JX0A 3IKWA 4QB2A 5EWSA 3V0BA 2VZVA 2NYYA 1NY71 2ZMNA 2ZHNA 3RRDA 1GZWA 3RYPA 3JXSA 2Q30A 1OLRA 1WCUA 1PGW2 4Z8BA 2WL1A 4YG0A 1TQ5A 1SLBA 4GWNA 5FK7A 4PIZA 4RQPA 2VMGA 2Y60A 1Z0HA 4P5HA 4CPBD 1XRUA 1MS4A 2QQOA 1V6JA 1LODA 3PL0A 1J84A 1MACA 3I8TA 4S2FA 3AKTA 3UKNA 5IT6A 4CEYA 4KU8A 5BNQA 2VUDA 4Y20A 1PVXA 2IVIB 4NWVA 5GZCA 2QJVA 5FYTA 5LCWL 1UD1A 2YY1A 1QEXA 4QM8A 3DYOA 5F3IA 1IPKA 1BBT3 2VOTA 1ZM1A 3CO2A 4Q4X3 4SLIA 5CFCB 2A1XA 3J7NA 5FMOS 4MGQA 4BE3A 1LHNA 3AFKA 4NIDA 1H4GA 1VBB3 1S2EA 2VQTA 5FP9A 2R043 2W1UA 4CXYA 5FZ1A 1AR83 2EA7A 1DU3D 5JDBA 1H6XA 3FWEA 4N90A 3W9AA 4AHZA 5A3UA 3ASIA 3RYRA 5C8CA 1HN1A 1RINA 5ISLA 4AI8A 3NRUA 2IXCA 1W6NB 2J1TA 5CFDB 2UWBA 1BK1A 3ZFEB 4JGYC 4IDZA 1T6BX 1W8HA 3IIAA 4QX2A 4M0HA 1QOOA 4LMFA 2WT2A 4V2VA 3O1UA 2PLV3 4GKYA 3VUOA 1W9SA 2ENRA 1BEV2 1QJFA 4JGZB 5FYMA 1N1VA 5FPXA 2NLRA 2VTXJ 1H6YA 4WVWA 4E4SA 5CG8A 2P34A 1QQP3 2P3IA 4XOGA 3ZFGA 5C9AA 4HONA 4XJZA 4R4ZA 5C4WA 1JZ3A 1W8OA 1GWLA 5FPVA 1N1TA 4AI9A 3ZKUA 5JAXA 2IZWA 2JDZA 3ZM8A 2GNBA 3OOXA 5CIRA 5BNNC 1FAYA 4XHBA 3ZDVA 1FATA 4JDMA 1LECA 2X53S 2XH6A 3W5MA 1AR81 4MZUA 3H8RA 3KZ4C 2W52A 2HWB1 2UY9A 5FFOC 2RJKA 5H9RA 4GZ9A 5IVFA 4HL0A 5EJ1B 1YJKA 3PNAA 4HT1T 2C9AA 1RUG1 3WF3A 4PBOA 5JUVA 1N3QA 3L2YA 4LUKA 4UI9L 4H7LA 3PLQA 4WM7B 2GC0A 1C1FA 3V0AB 1O3QA 5JXIA 1UY2A 2CL2A 2BNNA 3MW4A 3ZXLA 3NL1A 4EZ4A 4IL7A 4NIGA 3OBAA 1IOAA 4AEDA 2ZGSA 3UV9A 1GSLA 3OSDA 1JZ4A 1I6XA 3OBTA 3UGHA 1GP4A 2RS32 2VPVA 1NUKA 4CVUA 1ZVFA 1S55A 4BOWA 4FOVA 3KCXA 2EIBA 5LASA 4AW7A 3W58A 1SPPA 2BYVE 2OUHA 5I0RA 3WW1A 1FOD3 5AVAA 1UNBA 1WW5A 1UU5A 3RZGA 1ND3B 2CY6A 1UOFA 1L7RA 3FLTA 3OGVA 1VB2A 4AHWA 1T2XA 4MGTA 4D7SA 1SDDB 2OT7A 1W99A 4XJAA 2UWCA 2GP3A 4NN0A 1PZ7A 5FZ9A 1Z7S2 5BNNA 4AHXA 3S5QA 3O1OA 3AFGA 1W2NA 3WDWA 2E7TA 4Z1VA 2FMDA 2PLV1 4RS5A 3RZZA 2QTWB 1BJQA 1SQ4A 3AMQA 1J1LA 1G8WA 4NHKA 5FZLA 4B1MA 4RQPB 3P3NA 4A3XA 4IE5A 4KGQA 5DN2A 2QQPA 3KT4A 2WZR2 4NPLA 1BZWA 3CMGA 3DKQA 3MPPG 3VDDB 2YROA 4Y20B 3BIWE 4UOJA 1XB9A 2AYHA 4A4AA 2J1EA 3I2OA 4AE2A 4RA0A 1MQTA 1LU2A 3PTYA 3VBFB 1XPWA 3U78A 1YRZA 3HN3A 5CG9A 3VZMA 5DMYA 3EJKA 3KVAA 4AK3A 3OUIA 3JZVA 3R05A 2BTVC 2WR9A 2KXLA 2XKOA 3EMRA 5F39A 1GZCA 1KJRA 1HQWA 1PO13 2IC1A 3N9MA 4LITA 2XR4A 1YJLA 2ARCA 1KFXL 3PUAA 1N1SA 4Q4W1 2HEVF 5EJ3A 1D2SA 3WHTA 4BB3A 1HQLA 4C1XA 5C8CB 3D82A 3D3AA 4XAEA 2WN2A 5FDBA 1NCRB 1QH6A 2ZBJA 4BQ2A 3RZHA 2EXIA 1DHKB 3IAQA 3NO8A 2D3SA 2XLGA 3P6BA 3KCCA 4TZDA 1KDMA 3IDEA 5DZEA 4MGIE 4TLFA 4UFHA 1REEA 4AGVA 5CFCC 1RUE3 4PI0A 3FL7A 4JGZA 1W8NA 2C6SA 2FDFA 3MUZ1 5FV3A 3T4HB 2XG3A 2QQKA 1HN0A 1RUNA 4WM8C 3ZXJA 1F8VA 4MGYE 1VAVA 3CBNA 4XF3A 2JDAA 1H4HA 3OEBA 4LBQB 2VMDA 4QX5A 5EPAA 5H9QA 3ZYFA 1N1YA 4HFSA 1QOSA 1QJY3 2VM9A 3VL8A 1PGL1 1W6QA 3EB7A 3VBRB 4GH4C 1LTEA 2UURA 4KL1A 4Y22B 5IW0A 3SH4A 2P5BA 3Q8FA 4AGGA 1NZCA 2IWGB 3ZIXA 1LHOA 3AJYA 4JZRA 3VV1A 4P9GA 2WFF1 2AREA 3K4DA 1UL9A 3ETPA 4C0HA 5IFTA 1EAH3 4IEVA 4IQPA 1ZZ7A 4ZXKA 4S2DA 4N53B 2FZ1A 2ZAHA 4XF0A 3KV5A 1DGLA 4B7EA 1GWMA 5C3OA 1CJDA 2RE9A 1DF0A 3APBA 4KH9A 1XJAA 4I02A 2WBKA 4BJ0A 1EV12 2C9KA 3LB9A 3POIA 4MV2A 2YBSA 2RS13 1OF4A 3FHAA 1K5MC 2RDSA 3N9OA 2W47A 1B35B 5GLZA 1CAVA 1F5JA 1DGWX 5AC92 3V0BB 2RR13 2G9FA 5EHDA 3ZDSA 1DQ5A 2CGNA 1K12A 2EALA 5FUIA 4HPKA 5FZMA 4I0BA 4FXKB 3I3BA 2X5IC 3AK0A 1JH5A 3D4KA 1NQJA 1ND3A 1PMHX 1UF2C 4Y1YA 3V64A 2VZPA 2AEZA 3POEA 2J1VA 4W65A 1HRI3 5DXDA 4PQQA 1BEV1 2VG9A 3BB6A 1CPNA 2JD9A 1RUD3 1VBC3 2G9GA 4DXSA 3I2JA 3M3OA 4N8MA 4K1ZA 2Q8DA 1RJ8A 1AX2A 1UYYA 3D0JA 4FPYA 3THDA 1G9CA 2OZJA 5A32A 1BQPA 4P5YA 4RSUA 4HXCA 1LNSA 1RJ7A 1QOTA 2A71A 4LHLA 5FPUA 4XDOA 1LOFA 4LT5A 3DYPA 4NIHA 4PBPA 3U14A 3N4MA 3J8F2 2DFBA 2D3RA 4CCMA 2CWSA 3RNSA 1LOAA 5SV5A 2MPFA 4UW6A 1J3RA 1PX4A 1RUE2 2XQRA 2QKDA 3LIGA 2WT0A 4UF0B 2YBKA 3VBFA 3POYA 4YGDA 4XZPA 5EQUA 2WA4A 4CTEA 3VBRC 2Q8CA 5CFDA 1C8M3 2NZ9A 3HIFA 3HMYA 3VHPA 2PHLA 5HXMA 3B00A 3AVSA 4HG6B 4ZZ5A 3MFCA 1C8M1 4AF9A 1PO23 4RR3A 4O7XA 5FP3A 1AXYA 2DBNA 5AFEA 5JIUA 3QH7A 1SCSA 5L7OB 4CPBA 3H50A 2HWF1 3M3EA 1LOCA 2JB8A 1MPXA 5DDJ2 3J8F3 2HWE2 3WOGA 3WEZA 2JDKA 5JXJA 3OCPA 5LA0A 3E6DA 1XU1A 3FBYA 1POV3 2W87A 4PHZA 5BNOB 5FZOA 2ZGLA 2DVBA 4Y1UA 5CAZA 1QY4A 1XNDA 3PVBB 4QQOA 3OUJA 5SV8A 3PIJA 3PVOA 4K20A 1ENRA 4M4RA 1OI6A 2WNVC 1DZQA 4WZCA 4XFHA 1FPN3 1LU1A 1W8UA 4CA9A 2XBO1 1Q8OA 3D6EA 3AYDA 5FYSA 1ZA4A 3ZSJA 3ELNA 5EJZB 2WO1A 4YWAA 2WWUA 5FYUA 4CDWC 4NPMA 1CPMA 1QJZA 3UYJA 4PI2A 4IV1C 3CDZB 1NCQC 3B94A 3IDBB 4Y22A 1VALA 2PA7A 2VW1A 1ZRCA 5CB7A 3QCWA 5ABJB 1UW8A 2C0ZA 4HZFA 5LB6A 5AC93 4FPFA 1RUC1 3LA7A 1XC6A 4ZHNA 3AP6A 5DAXA 4AEDB 2ORXA 3AP9A 4QD2A 1MZFA 3A0KA 1IS6A 4YM0A 5KHIA 1UAIA 4NHLA 4MHUA 5FOJB 1VRH1 2OQ7A 2WDBA 4QQ2A 4DXZA 2DURA 5F1RA 1RUE1 3HEIA 4XTMA 5E6HA 3GHNA 4XIKA 3FHIB 4LKEA 3LFIA 4UYBA 3B02A 1C5HA 3MZHA 1DLLA 1ZBE2 2RS33 2JE8A 4META 4Y5TA 5KWRA 4XQWA 2W94A 3FLPA 2JG8A 2WO7A 2QQMA 3NWKA 5LY2A 4Q0PA 3WQBA 3THTA 4BA6A 3EHKA 4YGCA 1PO11 2RS53 4GH4A 5EFUA 2ZEZA 2VUAA 5FPBA 2VCBA 5KXBA 5JI9A 4EZHA 3QOPA 1V9U1 5I0UA 3EXUA 1RTVA 4M4PA 4QQLA 2WNVA 4KWLA 1JN2P 5IK8A 1WLTA 3BKZA 3KM5A 3CIHA 1W9WA 4PQ9A 1H1IA 4LHNA 4DUWA 1TNFA 1GFF2 1OVSA 2RMU2 1EUUA 2EXKA 1MEC1 1TME2 3AKRA 4HKWA 4HBNA 3VD3A 4GMP0 3MW3A 1MVQA 1R093 1MEC2 3OGRA 3PVEA 4E27A 1DGRN 2AH2A 1QJU3 3C7OA 1JYIA 3GXUA 4L8QA 1OKQA 4CCNA 2PAKA 3J7HA 4A7YA 1F9KA 3AYEA 2Y0IA 4AI0A 2H0VA 4NRPA 1YUDA 5FYCA 4RQPC 5FQ0B 3EO6A 4UF0A 2R7EB 3S7EA 4PDWA 1CAXA 3RQ0A 3S6PA 3UK9A 2Y6HA 2RMU3 4YZ2A 5CADA 3EBRA 4UT5A 1UYPA 4K40A 1OD3A 1UZWA 1OOPB 1UPIA 1UZVA 3KF5A 2RDNA 4G3YC 3F95A 4HN0A 5LEKA 2WZPP 3BODA 4NOTA 2P1BA 2OVUA 4GD4A 5ACA1 2HLEA 1OA3A 2F6BA 2VULA 1V6KA 3OJBA 1PGL2 1CD3G 5DG2A 4FQ4A 4MSVA 3W21A 4OZXA 2JXAA 1YFWA 1ENQA 2JKBA 4KGGA 5FZ7A 1W6QB 2ZX1A 3R4SA 5F37A 2C5DA 1H2LA 4K3UA 4XURA 2W39A 3W5NA 1OQ1A 2AC1A 4LO8A 4YYOA 1NCQB 2XLFA 2VUJA 4WVMB 3IWZA 4CDQA 1O4ZA 3CJIA 3GJBA 5F3CA 2JDYA 4JVAA 3NAPC 5JPMB 4XFCA 4AI1A 4I2OA 4L11A 4QGMA 1J59A 1NE4A 4GIQA 3HN1A 2YHJA 2YB7A 1CAWB 1SACA 4BISA 1JW6A 5H9PA 1RHI3 4BCUA 5ABJA 4XUNA 3N9PA 1QKQA 2LROA 4HKLA 4XETA 1PIV2 3TN92 4E4ZA 3RWKX 1W8WA 3SKVA 4CSWA 4IEZA 2BUKA 2XGXA 1AR71 3O0XA 2PN5A 1V6OA 1UY1A 2YC4A 3ES4A 2TEPA 1DG6A 4Y1XA 3GCXA 3MLKA 3LZZA 1HDKA 1JS9A 2E7AA 2ADDA 2V4VA 3O0WA 5A1AA 3T0BA 1QIQA 2L9LA 2VUCA 2Z69A 1N3PA 2I74A 4AAPA 2VOKA 4ZPIA 4KG0A 3U37A 5JVVA 2VNOA 3VHNA 2VBBA 4GQ7A 3SH3A 1C28A 2PHDA 3ZR5A 4RHV1 5LATA 1X9TA 1JMUB 2RS52 2P6HA 3H9AA 1U5YA 5IATA 3WNMA 3AKQA 4QX1A 3BOPA 3SCFA 4IEXA 2DU1A 5CFDC 3BGAA 1ZBA1 4NUBA 5H9SA 4CZSA 2F4LA 1H30A 1V9U2 5GLVA 1RB8G 3NVCA 4NPRA 5A70A 4Q4X1 1CVNA 2CV6A 1HB1A 2DFCA 1NE6A 2HJIA 4YZ5A 2ZGUA 4LA2A 4Q4Y1 3AZWA 5A3NA 1NT0A 2IXIA 1RUJ3 4I0AA 3IMNA 2Y6JA 4E2QA 3O7OA 2ETEA 2FDHA 5IAXA 4HOOA 3FN9A 4YPJA 4LLFA 1OPOA 2ARBA 3RPQA 3T1LA 4B29A 5A6YA 1O4YA 1O91A 2Z79A 4LULA 1S0GA 3OGJA 1YC61 4AFAA 1DGRA 3ZX7A 3I7DA 4MADA 2VBDA 5LA9A 4CDUC 2R063 1IG0A 5T5LA 4XJWA 3ZYJB 2YG0A 4PLMA 1T6GC 2O0OA 4B7KA 2XJPA 2C1FA 1OA4A 5FWEA 3OBZA 3RMXA 1ST8A 2V5DA 3K75B 3U07A 1OLQA 3VZJA 2Y6LA 5FQ0A 4A42A 1X33A 3KB5A 1MZ6A 1NLSA 1MS3A 1PM7A 1ULGA 2EICA 3N9QA 3OBRA 4I0WB 1RUG2 4LHSA 5AFBA 5T5JA 4AHYA 1EUTA 3GF6A 3AC0A 1UKRA 2X10A 5JOWA 3VBHC 4NJ4A 5L73A 2R042 1OOPA 2GP5A 1I1EA 1EAH1 2VL4A 4AYUA 4MGZE 4A7ZA 1AXKA 1TMF1 3ZXDA 1BBT1 5G04L 2HWF2 3AMPA 4Q4V1 3LDBA 5L7OA 5DABA 1VBA3 1B09A 1QDCA 5KHHA 3VDDC 3TRSB 2LUWA 4AVBA 1NAEA 3NV1A 5JCTA 1R64A 4LIVA 1CZTA 2RR12 4JCKA 2Q8EA 4AVVA 1JZ7A 5LRSA 1S1AA 3ETQA 1DQ4A 4IEYA 3UKTA 3BU7A 1WMXA 3VD5A 3HBZA 4EN0A 1FI2A 4JC1A 4LKFA 2X05A 1AR62 2HWC2 5FOBB 2QCSB 3AXEA 1RVF1 3Q8CA 2V73A 4W4ZA 4ASMB 3GCWA 2KM2A 5GZFA 3S57A 4FOYA 2A3XA 3FFZA 5T3NA 3QH6A 5C4WC 4BH9A 5JMCA 1H1AA 4N53A 1WBLA 1SEFA 5FP7A 2JWPA 1PK6C 2XHNA 1WD4A 4JKLA 1DLCA 4NHYA 4W6XA 3ZFFC 5GZGA 5K9YA 5DAQA 3OF1A 3KT1A 2VC9A 1CZVA 3MIDA 3ABZA 4RGAA 3VDAA 1RXFA 4HN1A 4XF1A 4V1PA 1CESA 3RZKA 1AZDA 4S2GA 5A7WB 3ZN5A 5FY0A 1IG3A 1CJPA 4AR2A 1GV9A 1YI9A 1DFQA 1PNFA 3E5XA 4IEPA 5FUPA 4B4QA 4Q4Y3 4UW4A 1JYNA 1LGNA 3U0ZA 3K46A 4URTA 1A6CA 3R6SA 2JG8B 4NROA 2VW0A 2YFUA 3BALA 2BU9A 5FY5A 1AX1A 4XMIA 2ZHLA 2V4AA 4LR4A 4GH4B 4XEZA 3ZXGA 1O59A 1OUXA 3N35A 4YVWB 2FHRA 3ACGA 2CTVA 2W95A 1DZTA 3Q9OA 2B46X 4YRDA 4CDQC 2VW2A 1VBE2 3D5OA 2WNVB 3DEMA 4YNIA 2DCTA 1ZYBA 5APAA 3H3UA 3GGLA 5I91A 1R1ZA 4FOWA 3WF0A 3B9IA 5LW9A 3BPSA 2A75A 1AJOA 5F2SA 3K48A 3WW4A 4CCCA 5IK5A 1YI7A 3DKWA 1DYKA 1I9RA 4IETA 1GZ9A 4D3WA 3SCGA 2HWB3 4IEWA 1KGYA 1ZBA3 3MIGA 2DVDA 5LA2A 4CYDA 2UU8A 2WFF2 4IV3C 2XWJB 1UMIA 3I2IA 3ROUA 4DZGA 3KGLA 5L9VA 1PX3A 5LK7B 1HX6A 4E2GA 2PQSA 1ZA7A 3T30A 3MPBA 5KHGA 4COZA 1RUOA 4BQ5A 5K8SA 3AJZA 3IPVB 3M7AA 5DZGA 4Y4YA 2HWF3 4RR3B 2D40A 4OMDA 2BDRA 1AXZA 2E32A 3RI9A 3ZO0B 2VZOA 4DUXA 3BU0A 1WWYA 1UZYA 1XYPA 1YQCA 1K42A 2WO3A 3CZUA 3POSA 1UXZA 1MVEA 2UY8A 1L3JA 1IGOA 1OXCA 4I3PA 2NP0A 1TEIA 2WS91 3CKHA 5I8SA 1Q8PA 3DV8A 1LOFC 2ZGRA 2XLAA 3NKTA 1IZ3A 5FZOB 5CKMA 1NYWA 2VXRA 1AHSA 4OCTA 4AFCA 5KHKA 3NNFA 3ZYGA 4EJRA 1GNHA 4CDXC 2EXJA 1S0CA 3TB0A 3WDTA 1VBE1 2WUHA 4DY5A 1N3OA 4OMCA 4Q4V2 3PDQA 5F2WA 2R041 2GU9A 2JECA 5T50A 3HR9A 1ZRDA 5HCFA 1EAH2 1PM4A 2ZA9A 4XDPA 3M2MA 1HB4A 2ZTNA 4Q2FA 1NA1A 3W59A 4TSVA 4YW7A 5IWFA 5F5IA 3VKOA 3VZOA 1LOEA 3CJIC 3CJIB 1KS4A 3HWJA 1ASJ1 1UX6A 3F2ZA 3L9JT 2VCAA 3P1IA 1IPSA 5K0UA 4RL7A 4O65A 3WQ1A 1Q43A 4FP3A 1KD7A 3IN9A 3FE5A 4R9AA
chains in the Genus database with same CATH topology
3AZYA 3AZXA 2ZGMA 2XHKA 4UW5A 3I4IA 3WQ0A 2ZGTA 3LOIA 4HMZA 3ATGA 1IHMA 4ASLA 1WD3A 3OD4A 2GAUA 3JCIA 3RMYA 1A78A 2RS11 3GZTB 4P9LA 4QPIB 4QPIC 4YSFA 3CF6E 2ZZQA 4XFGA 1DQ0A 3OYWB 1W6OA 2JX9A 2B8MA 1QQP2 1HRI2 2ZX4A 4AQSA 1EP0A 3FX3A 4LBQD 1ZBA2 1O5LA 1MS5A 1YIFA 4M0NA 3VKNA 1RIRA 4YVWA 2ET7A 4IEUA 4K1YA 1J3PA 3DUIA 4P9WA 4UXAA 1V6NA 5KBFA 2OIIA 2BVVA 1SLAA 2D3PA 4AGRA 1H8VA 2EVXA 5CVRA 5ACA3 4QXKA 2CYFA 3M1HA 2Q5TA 4EWAA 1H8TB 1AR93 1K5MB 1XQNA 5BV6A 4JTOA 2NN8A 4XFIA 3FJSA 4E9KA 4NHMA 4IV3B 5E16A 2PYTA 1UU4A 3MIFA 4R9BA 1X8MA 4XMAA 3CNAA 1KDKA 2E51A 1QNWA 1YLLA 4W6WA 5I0TA 5TSWA 5JR7B 4WVVA 5JPNB 2R16A 1X50A 2H6CA 3IPVA 3ZFEA 4XHXA 4AI3A 4OUMA 1BCXA 2V5YA 3D0SA 1CAUB 4FVVA 4IV1B 4PF5A 3ZMOA 1QJX2 2QZ2A 1APNA 2NM1A 4Q0VA 2PELA 1AR91 4OI1A 1IS4A 5KHJA 3ZFGB 5AC91 2PFWA 5C4WB 3MI8A 3FUOA 3ZFGC 4IXLA 1F31A 4WM8B 3E5UA 3GZUC 4BMBA 4YARA 1GR3A 3MIBA 5HCBA 4FXGB 4OHYA 2JEMA 1RUG3 4K8FA 1RGSA 2R0HA 4DINB 3VBSB 2IXJA 2HWC3 3RSJA 3AYAA 3AKPA 3D8CA 2YV8A 1CAWA 4I3GA 3BPZA 1LB2A 3PMSA 2GH2A 3HQXA 4DRRA 2WSUA 1LGCA 4NO4A 5F6LB 3RYKA 1XU2A 3B5LB 4C0BA 3KMHA 3FBMA 4A7KA 1JUIA 1O7FA 1DGWA 4OI4A 1ONAA 1W6PA 4AG4A 2N7GA 1Y9QA 4FTSA 5T5PA 5JWPA 3WT3A 1ALYA 1ZBE3 4GXLA 5E8AA 4FAGA 3ECQA 1DDLA 3A0NA 2A73B 2GSYA 4R52A 4D7YA 1VBD2 3GZAA 3PJYA 2XJUA 4XXAA 4BWOA 4B4RA 1PK6B 3FC0A 3T1MA 4QMAA 4IESA 1D4M3 5FREA 5D8AB 2WNUC 4HVQA 4AVCA 4ZKTB 4CEWA 1ZNPA 3VBUA 2WSVA 4AFDA 3LAGA 3I2DA 4N7UA 3UJOA 2YGLA 2I2SA 3N3HA 5EXOA 3JD72 5FAXA 4TWTA 1NY72 1OHFA 2H0BA 1B35C 2P2KA 2OUJA 1OQEA 2DTWA 1C57A 1H8TA 2QUOA 4PIYA 4N7IA 4U36A 5KXEA 4L99A 3O0VA 4Q0QA 4XXPA 3JB4C 1SBDA 3ST7A 1PVC2 1XE8A 1YHFA 3AYCA 2GALA 2VOXA 5C6CA 2BWCA 1D0GA 2D44A 4ONUA 4BPZA 4ISRA 4AFMA 3FZ3A 3TBDA 3GNEA 3INAA 5J98B 1SBEA 4IEQA 5FLJA 3ZYIB 4HVRA 3USUB 2BGCA 1FV3A 4RHV2 4BZ4A 1ZZ9A 1VAMA 4E2SA 2IFRA 1NA1B 4HVOA 1OFNA 1J1TA 1UN1A 1LGBA 2BFUL 5JSRA 5GZDA 1LJ7A 2WLPA 1VJ2A 4H7MA 1EV13 3GALA 4YFWA 4ES8A 2R062 1WUVA 2DF7A 4LTAA 4AQTA 2GN3A 2XL9A 1TMF3 1COV3 2NPIA 5K7PA 4J6GA 4QPIA 3AXDA 1S2BA 1QMJA 3NKGA 1W6OB 3T2TA 4Q8KA 2XB6C 1S2KA 2E9QA 1B35A 4EWEA 1HW5A 3RS6A 3WDXA 4FCAA 2A3YA 3ZSKA 1QXRA 5LEJA 2WNEA 1VRH3 4ISQA 1HIXA 3N7LA 1OFSA 3OPZA 4OVEA 1MR5A 2R1DA 1RVF3 4N43C 3NSTA 4BHPA 2ATFA 4GWMA 1R1A3 1QJY2 5DUWA 3MIEA 1FMD1 1LCLA 5L36A 4INDA 2AENA 3A4UA 5J36A 1ZX5A 4KWKA 5GLWA 2O8QA 3MFAA 1HRV1 2BFUS 3WZ1A 1SCRA 5ACA2 4FTBA 1LOBA 5T52A 2QFEA 5LRRA 2FZ2A 3ZIWA 1AF9A 4IV3A 1TE1B 1W6MA 3JQWA 3M70A 3TAYA 4L92A 2FBEA 1Q56A 4GB33 3WY6A 5FO7B 1HQNA 3WHUA 4YM3A 2WJSA 3WG2A 3L2HA 1N47A 3MDPA 4LA3A 1RL3A 4AQ2A 2LALA 3QLQA 3AM2A 1A8DA 1QF3A 2WA3A 4I30A 5JOXA 1IPJA 2R061 1TME1 3WINE 4OHVA 4YW2A 3UJQA 3VKMA 1GNZA 3WDVA 1CAUA 4IV1A 1F2NA 2B7YA 2I45A 2ZGOA 2D6LX 2BPA2 5JZGB 4QPGC 3M4FA 3MYXA 3LWCA 1RUI2 1HRV2 3U4XA 2SLIA 4BIOA 2B5HA 5BNOA 4WM8A 5T55A 4DFSA 1RUF3 1JHNA 1WCSA 3VN4A 5CBLA 2WS93 1AYN3 5T5OA 1JTZX 4E4DX 2DCZA 2BBVA 4P9YA 2VH9A 1WBFA 5IK7A 1FPN2 3DPRB 1UMZA 2DU0A 3B9CA 1FX5A 1CIWA 4EN8B 1F5FA 3AZVA 1DQ1A 3MGUA 2QZ3A 4RR3C 4U2AA 2HEYF 1W0PA 3ZFEC 4R9CA 2XPJA 5JOZA 3MIHA 3WUDA 3SMHA 2PAMA 1CONA 2KA3A 1S0IA 5EYYA 2FMYA 1AYN1 2R49A 4XYXA 2PQQA 1W6PB 2WQ4A 2A6WA 4CDWB 1J58A 2BQPA 3OYWA 2E63A 4QT6A 1YNAA 2ZGNA 2RMU1 2ZGKA 2UWAA 1ASJ3 1H9PA 4XBNA 4UBHA 4BLIA 4D69A 4XFAA 2GMMA 2RM22 3WVJA 4AEDC 1NXD1 1RVF2 4XFBA 3WUCA 5BY5A 2PAEA 4FPOB 4YVWC 4R8HA 5GJ6A 3VBOB 3ZXEA 4AEMA 1Q5OA 2VY0A 3S0MA 4COWA 4ITCA 4LBNA 3ZSMA 2BWAA 1RMU3 5E1RA 4PLNA 2EF6A 4N43A 4M3CA 1G7YA 4PCRA 1ZZ8A 1LHVA 2XWBB 2DUPA 3ILNA 4YM2A 4B4PA 5JOYA 3DPRC 1K5MA 5DUXA 4OFGA 1ZBE1 1CR7A 1DYPA 3E97A 1URXA 4LBJA 1HKDA 1WGPA 4HETA 3NV4A 4I09A 5DDJ1 1IS5A 1O4TA 2HEWF 3AP7A 1H2MA 2PHWA 1PVC1 4H55A 4N9HA 2PHUA 5C8WA 2Y26A 1JYCA 5I8TA 2X29A 4KU7A 3MF9A 1LHWA 3OGGA 4PDWB 1CAXB 3ZFFB 3LOBA 1KS5A 1G9DA 1Y7BA 4AFBA 1AL0G 3NV2A 2ZX3A 1SLTA 1XNKA 4FSJA 4MX3A 3GHMA 1AYM2 3R4DB 1W0OA 1HXS2 2OA2A 3WX5A 1V6MA 4JV4A 1WMFA 5CNAA 4GALA 2O8OA 2VQ0A 2VNGA 2D43A 3BTAA 2DCJA 3H8UA 2A7AA 1REDA 1MZ5A 4H3WA 4DMIA 1CN1A 2EAAA 4LE4A 5GKAC 2ZS6B 1NCQA 3LA2A 4WV8A 3USSA 3AP4A 3O5SA 4O9EA 1QJU2 2RJLA 1RUH3 1PO21 3VBSC 2B42B 4LBOA 3ZMNA 4X8PA 5KXCA 3JBG3 1PZ9A 1AX0A 2A6ZA 2FQPA 1RMU1 1POV1 1MQTC 1AR61 4CDUB 3GYDA 3J8F1 4EWDA 1I5ZA 4KNCA 3QACA 1JBCA 2R072 1RUC3 4GMP3 2D93A 5DZFA 3ZYPA 4CEYC 2K9ZA 2O1QA 2E53A 2OW4A 1VBA2 2CNAA 2Q4SA 4YG6A 5D8AA 3LSDA 4JGYB 2GZWA 4LBKA 4EN6B 4CEWB 3VBUB 3R4UA 1FMD2 1H9WA 3WDUA 2XL7A 3UL2A 5JSOA 3WP4A 5FLHA 2QNKA 3RI8A 1PNGA 4M00A 1E57A 1NA1C 1SLIA 5C8CC 3HD8B 4BYYA 1DIWA 1GZWB 2DVAA 3ZN6B 1CQ9A 4YM1A 1QXPA 3FFQA 4Q8LA 1GYKA 4RHV3 3VZKA 1RUD1 1LRHA 1VBC1 5FLIA 3V65A 1FT9A 1QXJA 4FPCA 2ZZJA 5CU1A 4FQZA 4NR1A 1H8TC 5BNOC 1A3KA 3M3QA 3ZYRA 1ZRFA 1DBNA 3WW2A 4WZFA 4YG3A 3JU9A 1NXMA 4TYSA 1R092 1Q8QA 2LM3A 4Q4W2 1EPWA 4MUVA 3SITA 4ATFA 1AUYA 1XE7A 1Y3TA 4L97A 1J3QA 1D4M1 4OUSA 2TUNA 4IERA 4OHZA 2HWD2 4KWJA 5JZGA 1Q3EA 5JLVA 2GNMA 4QM9A 2GC3A 1AL22 1U5XA 4J1XA 1NQDA 4XJUA 1O3RA 2JG8C 1S0DA 4EN9B 1HV0A 4YW5A 2AZ5A 1WCDJ 2GMEA 4IEOA 4OI0A 5J48A 2WT1A 4FTEA 3AZZA 3POWA 1C8M2 2AUYA 2HWD3 4M3CE 5C9AB 2WKKA 4PIXA 3ZVXA 5DUVA 2JENA 3PHMA 4ES9A 1RC6A 2AGSA 1JXNA 2D7FA 2JICA 3H1MA 3QD6A 4FPHA 1PIV1 4DQAA 2RS31 2GN7A 4OHWA 5CA6A 1O3SA 1SMVA 1OPMA 1X7NA 4Q4W3 4XDQA 4C90A 2TNFA 1WA4A 1COV1 2YMZA 4DS0A 1BMV1 4JRLA 1RUF2 3K51A 3ZXKA 2WNUB 5HXVA 2YXSA 3B69A 3ILRA 4PJYA 2D98A 1ND3C 1FMD3 4OLLA 4CDWA 3VZNA 2ZMLA 3J4UH 3MF6A 2ZOEB 1ENSA 3OY8B 4FPLA 1G9AA 2GC1A 3DGTA 4OHXA 5F5QA 3RWNA 1VBB2 1RUC2 4YZ3A 3TNQA 1R091 3WD5A 2WINB 3WLUA 1X36A 2IXLA 3JD71 3ZXAC 4CP1A 3VKLA 3J9SA 2HWB2 3NAPA 3E6BA 3G6JB 1ZZBA 1BMV2 1LR5A 4Q0SA 3B7MA 4JGYA 1ENXA 2VQAA 3I59A 1S0FA 4M3CB 3NJZA 4N43B 4G9SB 3PMEA 4RD7A 3R0RA 2R30A 4HKOA 4YGEA 4Q0UA 4XILA 1V9U3 2RM21 1YCIA 5BNNB 2RS51 2RM23 2MNGA 4Q27A 1NOVA 3ZN6A 1W6MB 1C5IA 2B39A 3LSEA 3QBQA 1QGLA 1SLCA 5FO8B 2PHTA 4QGNA 1GQHA 4K9SA 1C1LA 2VVEA 2VGDA 4LBMA 5JI7A 4FT8A 1XNBA 4C1WA 2Z42A 5FCCA 4FPKA 5T54A 4AVAA 5ABJC 4KQ7A 1QJU1 3JD73 2HWD1 4ZU5A 3URFA 2WFPA 1PZ8A 4K21A 2WC2A 4LHKA 4F83A 1VB4A 4X8NA 5FTTC 2IXKA 1U12A 1Y43B 4NVPA 2BNMA 2E6VA 3DL3A 3O14A 1A8MA 2X5IA 2DUOA 3AMHA 3N36A 4EN7B 1CGPA 4F8AA 5IK4A 2P3JA 4YVSC 1U0AA 1C3HA 2JG9B 1G86A 2P37A 4DB5A 2R0FA 3ILFA 3M3IA 2CAUA 3N7KA 3WP3A 2BVBA 3AP5A 3KD4A 2JE9A 3FUQA 2RHPA 2VOVA 5HCAA 2ZKLA 5JSPA 1AYM3 1DQ6A 4AXOA 2F4PA 1BYHA 3VKFC 3IDCB 4UW3A 2VECA 1WCKA 1FOD1 3U10A 4I01A 3U11A 2YZ4A 3VBRA 2ARXA 2D6OX 2W0XA 1ND2B 2ZGQA 1D4VB 1R083 1GANA 2VU9A 3SH5A 4Z92B 5C9AC 4R4XA 4LBLA 3LKJA 2HWC1 1ZRRA 2CAVA 3VBUC 1KFUL 4PLOA 2HKXA 2DVFA 5J09A 1VAKA 2P17A 1V70A 2PLV2 5BNPA 1RUJ1 2D5FA 1Q8VA 4Q4Y2 4F3JA 1RMU2 3JB8A 1OA2A 5E89A 4MLOA 4XIOA 2ZPXA 4YVSA 1OOPC 2Z5WA 3VBOA 2ZMKA 1TME3 3E5QA 3CJXA 1G9BA 1MS1A 4H14A 1S0JA 1VBE3 3MLLA 1AL23 4XTPA 1MS8A 2R1BA 5B2GB 2R6QA 1SBFA 4QQPA 2CWMA 1H0BA 1BBT2 3I59B 1IKPA 2D6NA 5KC6A 3LGRA 1YIPA 2YPJA 3GBFA 3H1WA 4M01A 4ZU7A 1QJX1 1PO12 1LENA 2GMPA 2XJRA 3WR0A 2ZX0A 1RHI2 3VBHB 5JIAA 4LLOA 2A6XA 3MLJA 2VVDA 3SNMA 1RUF1 4MVTA 1REFA 4QPGA 4AQ6A 3LCPA 5HBAA 2NMOA 2R32A 3ZSEA 5J37A 1HV1A 1RHI1 4QGLA 1RUI3 1G9FA 2QVSB 3ZFFA 1RUD2 1VBC2 2ZABA 5A3LA 2UYBA 4HSLA 4N53C 1WLCA 2D6PA 4FPEA 2EXHA 4HLTA 4RS5C 3ME2A 3WG1A 1X8EA 1V00A 1BVVA 3JUUA 3WCRA 1AYN2 3WP6A 4QU2A 1M06G 2GDFA 3ZN4A 1UPSA 1YFYA 3PJQA 3H7YA 1BEV3 2GC2A 1Z7S3 4K7JA 1C4RA 1KQRA 1KJLA 4MH0E 2WZR1 4XFFA 1ZREA 1WLWA 5FMOL 1VR3A 4DPNA 2XJVA 1GICA 1KITA 2YYOA 4Q1RA 3M3CA 2CGPA 4M3CF 4Q29A 2DWRA 4L2NA 1RUH1 5BNPC 4JRAA 4QHBA 5KXDA 3NW4A 2IFWA 4XQ4A 1HRV3 3OD0A 3VBSA 1S0BA 2DYCA 3KQRA 3H1YA 2Y38A 2ZJCA 2WNUA 3MEPA 1MS0A 4L9BA 2RS12 1AR72 5GM0A 4CDUA 2H6BA 3C3VA 1LULA 4WBBA 1ULDA 4P9IA 5I8YA 1TNRA 1D4M2 4XE9A 3ZXFA 1MEC3 2NQYA 4FPJA 3VZLA 1ZZCA 5F6KA 2Q0AA 5A33B 1PK6A 1QJY1 3HT2A 3AB0A 2PHXA 3TOJA 2NMNA 1ASJ2 3NAPB 5J7MA 1EY2A 4C91A 4MGKE 4LEJA 4COYA 1LEDA 4S2HA 4XJ9A 3TNPB 1HXS1 3WNXA 1VBA1 5A3MA 1LESA 2Q1MA 5C33A 1ZZ6A 4LO7A 2W08A 4KBBA 4FOQA 3SXWA 4BIFA 4FAHA 3VHOA 2SBAA 1FYUA 4UBGA 3C2UA 1AR73 4GA9A 2WS92 3WV6A 3DN7A 3ZSLA 3THPA 1C8NA 1W39A 1BXHA 3OTFA 1YYNA 3H3ZA 4YW1A 4XW3A 3KLSA 1JUHA 1AR92 4X6QB 2WLQA 2DCKA 3AMMA 3GBGA 2YGMA 3VBHA 5J3UA 2DCYA 5EZWA 2PHFA 5DUUA 2HYKA 4YGBA 4JDOA 4LO4B 1QU0A 4YFZA 1UIJA 1M4WA 1RITA 2XVGA 3RJRA 4PDWC 3VBOC 4EV0A 1GKBA 2YC0A 1WMEA 3BCWA 4J1WA 2PHRA 1UCXA 4Q4X2 1POV0 3AMNA 1ULCA 3H7JA 5EV7A 1EYBA 1GQGA 4XJ8A 4GB32 1GBGA 4D7TA 3USUA 3KCYA 1QHDA 4YW3A 5D8AC 2RR11 2A6YA 1RUH2 2QDNA 3WG4A 4BQ1A 4Y1ZA 4MYEA 2BNOA 4GULA 3FLRA 3FMGA 2ZKNA 4CRQA 2HWE1 4COVA 1PGW1 2EIGA 2G4IA 3KS7A 4COUA 1KXGA 4XF4A 1QQP1 4FBFA 1QNYA 2K0GA 3AKSA 2BEOA 5DG1A 3X29B 4CEWC 3B01A 3H0OA 3IBMA 1ND2A 5EYXA 4YW4A 4WVMA 2JE7A 3WP5A 4CDQB 1YWKA 1FNYA 4XBLA 1VRH2 5FO9B 1HRI1 3SCHA 2TBVA 4P14A 3IM0A 4AVSA 1WW4A 2DV9A 3WQ7A 2OZ6A 3OY8A 5BNPB 1OMIA 2ET1A 1SFNA 3TN93 4OI2A 4GMP1 1LKNA 1WLDA 2OPKA 1XNCA 5L19A 4X6RB 2B45X 1R082 1S0EA 5JZGC 4YZ1A 4DRVA 2ZCWA 4HK8A 2ILMA 1H2KA 1HLCA 4Y5Z0 5A33A 1QDOA 3RDIA 2D97A 1NCRC 2XBO2 3VGIA 1D0HA 2X8KA 4CP0A 2ES3A 1WW7A 2XUMA 5I93A 3B93A 5GALA 1PGSA 5FBZA 4JAAA 2ZHKA 1LOGA 2PTMA 1Z7S1 5KC5A 4MXVA 5D1IA 2A70A 5I0SA 5J96B 4YZ4A 4HSJA 2JD4A 4GKXA 2ZACA 1OQDA 1EV11 4DNYA 1U5IA 2VNRA 3G7DA 3M8LA 4BM8A 4CEYB 2GNDA 1RUJ2 2ZX2A 4YLZA 1BKZA 2XJSA 1VBD1 1QWRA 2WIIB 4XBQA 4O9GA 2MEV2 3TYJA 1W2UA 3VDDA 1JOJA 4G4FA 1AR82 4FP2A 2D5HA 1UKGA 1YFUA 4MXWA 1MQTB 4NWWA 2X5IB 1PO22 1YFXA 2GNTA 1DQ2A 1FV2A 3GBWA 1AVBA 1WW6A 4R9DA 2BW8A 4QPYA 3HAGA 1I3HA 3MICA 3I54A 5L7OC 1G6NA 4AVTA 1Z78A 2E7QA 2JG9A 1NCRA 3VHRA 4CDXB 2HWE3 3WDYA 2Y0OA 4ORFA 1NLRA 3WW3A 1PVC3 5E88A 1PMIA 2B9UA 4Q4V3 1FNZA 3JQXA 3DF0A 3DPRA 3SISA 1IQAA 5AVPA 2EAKA 4OULA 3CLPA 4Y26A 4DY3A 1PIV3 4HANA 5IUQA 3BOWA 1Q8SA 2A6VA 2VMIA 2JJ6A 1QJX3 1SFYA 2Q8OA 4LBQA 2WWSA 1VIWB 1EPZA 3WCSA 4P9XA 2ERFA 2ZGPA 2QDRA 2VOWA 1SLLA 3NV3A 2R071 3LA3A 1YO8A 1ND2C 1WMDA 1O3TA 1D2QA 2AR6A 4AI2A 2I07B 3KGZA 3RJ2X 3V0AA 1ULEA 2V09A 3SHRA 1SDWA 2CGOA 3KSCA 2MEV1 4CP2A 4AWDA 4YVSB 4JGZC 1YXWA 2Q1ZB 3N7MA 1BVP1 2D6KA 2XBO3 3S7IA 2ZAAA 2P3KA 3JBG2 3O12A 2JG9C 2MHFA 1MZEA 1CAVB 4SBVA 4KG8A 4Z07A 2K2SA 4XQDA 2DUQA 1R081 1V6IA 2UYAA 4F7ZA 4LO5B 4HPKB 4WVZA 4Z82A 4BLJA 1CX4A 2D6MA 1H2NA 3UKVA 1OSGA 2XKPA 4RGGA 3VBFC 1O5UA 3SLIA 4B8EA 1U5ZA 1AL21 3ALQA 3RG0A 2VVFA 4HK9A 1LEMA 5GLUA 4P9JA 4RS5B 1AYM1 4JDNA 2WQZC 4AEJA 3CU7A 3P3PA 1OD5A 1VBB1 2XVKA