1RVF3

Fab complexed with intact human rhinovirus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/immune system
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
total genus 31
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf300
1AL0G 1NCQA 1TMF3 1R082 1V9U3 1BMV2 2XPJA 5J98B 1NA1C 5JZGB 4CDQB 1VBD2 3VBFB 1FPN1 1PGL1 3JBG2 1RUH1 3TN91 3ZFEB 1QJX1 5FMOL 1RVF2 1C8M1 1OPOA 1RUC3 1Z7S1 1RUD2 5AC91 1RHI2 2HWD1 1F8VA 2PLV2 1AYN1 4Q4Y3 1COV2 1D4M1 1HXS1 1AR93 2HWE1 4RS5A 3IDEA 3J8F2 1FMD3 5CFDC 1QJY3 1NA1A 3VBRC 5C4WB 3VBSB 1BBT2 1RUE2 4YVWB 1VBB1 2GSYA 1RUC2 1NCRC 5ACA2 1RB8G 5A33B 2RM22 2X5IB 1ASJ3 2RS33 2HWC2 2Y26A 4JGZB 1AL21 1PGW1 1OHFA 4FSJA 1OOPC 1R1A2 1QJU1 1VBC3 1ND2B 1VB4A 3ZFFB 5CFDA 1PO11 1AR83 1TMF1 1MEC2 3VBRA 1V9U1 4Q4X3 4CDXB 1EV13 1MQTB 1PIV2 1H8TB 1NCRA 1ASJ2 2RS32 1HRI3 3M8LA 5BNPB 1ZBA1 5A32A 1VBC2 1VRH3 5L7OB 3VBOC 1OOPA 3S6PA 1TME3 1AR91 5BNNC 1K5MA 1RMU1 3ZFGB 1AR71 1GFF2 1AYM3 4Q4X2 1EV12 3VBHC 1FMD1 3LOBA 1RUJ3 1QJY1 1RUF1 5C8CC 3ZXAC 3JB4C 1AR62 4SBVA 1FOD3 4Q4W2 4PDWC 5BNOC 2WZR3 1HRV1 4RFT0 1TME2 1RUG3 1VBA3 1M06G 2R041 5BNNA 1AYM2 4WM8B 3VBHA 4WM7B 1B35C 2DF7A 5C9AB 3NAPC 4Q4V1 4RR3C 2BBVA 5C8CA 1VBD3 2HWB2 2WZR2 4PDWA 5BNOA 3JBG3 2RS52 1EAH2 1NOVA 2WFF1 4YVSB 2RR11 1RVF3 3VDDB 1PVC2 1RUD3 4QPGB 2FZ1A 1RHI3 4QPIC 2RS11 3TN92 1R093 3J8F3 4Y4YA 1ND3C 1B35A 1C8M2 3NAPA 4RR3A 1PO23 5ABJB 5AC92 4YVWA 2HWD2 2RMU1 2ZZQA 4FTEA 2ZAHA 5A33A 2R071 4IV3C 1BBT3 1RUE3 4N43C 5D8AC 5ACA3 2RM23 1RUG1 1VBA1 2HWC3 4CEWB 4QPIA 4Y5Z0 5FOJB 1R092 1SMVA 1R1A3 1VBB2 1PO22 3CJIC 1ND3A 1MQTA 3DPRB 1AL22 4CEYC 1MEC3 1R081 1BMV1 3JD73 1QJU2 1A6CA 4RHV1 1VBD1 4IV3A 4CDUB 4N43A 1PIV3 5D8AA 3JBG1 4GH4C 4IV1B 5GKAC 4RQPB 1ZBE1 5CFCB 1RVF1 4AEDB 4CDWC 1K5MC 1NCQB 2PLV1 2WS92 1COV1 3CJIA 4FTSA 5K0UC 1WCDJ 1BEV2 3J8F1 3JD72 3JB8A 1ZBA2 4CEYA 4N53C 3VBUC 2HWF3 1VAKA 1RMU2 1E57A 1AR63 1AR72 1NG0A 4GH4A 1BBT1 1RUE1 4Q4W3 5DDJ3 1RUC1 1W39A 4JGYC 1RUF2 4RS5B 4Q4Y1 4CDWA 1RUI2 1HQNA 5JZGC 4CDQC 3VBFC 5K0UA 1NA1B 4GB33 2MEV3 2FZ2A 2HWF2 4N53A 3VBUA 2R063 3ZFEC 4NWWA 1MEC1 5DDJ2 4YVSA 2BFUL 1VBE2 2HWB3 1PIV1 3VDDA 2XBO2 2RS53 1EAH3 4JGYA 4NWVA 1ASJ1 2RS31 4Q4V2 1C8NA 1NY72 1IHMA 1PVC3 1VBC1 4GB32 5JZGA 4CDQA 3VBFA 5CFDB 2MEV2 1RUH3 3VBRB 3TN93 5C4WC 2R062 1AR81 1QJX3 3VBSC 4YVWC 1C8M3 1Z7S3 3ZFEA 4Q4X1 1EV11 2WLPA 1QQP2 5AC93 1NCRB 2HWD3 1AYN3 2X5IC 1HXS3 1D4M3 4JGZC 1HRI1 5A32B 5CFCC 4Q4W1 1VRH1 1FPN2 1ND2C 1PGL2 3ZFFC 1RUH2 1TME1 1CD3G 1QJX2 5FMOS 1VBB3 4CDXC 1AYM1 1Z7S2 1MQTC 5C4WA 3VBSA 1H8TC 1RUJ1 1AYN2 2ZTNA 1HXS2 1D4M2 2HWE2 1AL23 2BPA2 2X5IA 5BNPC 4JGZA 1FOD1 1QJU3 5L7OC 1HX6A 5CFCA 4FTBA 3VBOB 2WZR1 2RS51 1EAH1 1ND2A 1PO13 3ZFGC 5BNNB 3ZFFA 4RHV2 1PVC1 1VB2A 3VBHB 4CDXA 4LLFA 2WS93 5C8CB 1H8TA 5J96B 1PGW2 1BEV3 1ZBE2 1ZBA3 4PDWB 1F2NA 5BNOB 5BNPA 5L7OA 1RMU3 1PO12 1TMF2 1AR73 1V9U2 3ZFGA 4WM8C 1RUD1 1RUF3 1RHI1 4GMP3 4WM7C 5C9AC 1X33A 1B35B 1RUI3 3NAPB 4RR3B 1R091 1PO21 1AUYA 1HRV3 4Q4Y2 2GH8A 1AR92 4YVSC 2TBVA 2R043 3VDDC 4QPGC 1VBE3 1FMD2 5ACA1 1QJY2 2XBO3 4WM8A 4QPIB 2QQPA 2RM21 2HWC1 4Q4V3 4WM7A 5C9AA 1R1A1 5ABJC 1ND3B 1POV3 2BFUS 1DDLA 1HRV2 1CJDA 2WS91 2WFF3 2RR13 1BEV1 2R042 4IV3B 4N43B 3JD71 1QQP3 1QJZA 4GMP0 5D8AB 4QPGA 4CEWC 2RS13 3FBMA 1AR82 2VQ0A 1FPN3 3CJIB 2RMU3 3DPRC 5ABJA 4GMP1 2R073 1HRI2 2WFF2 3HAGA 2RR12 1RUI1 4CEYB 2WWSA 4CDUC 1VRH2 1X36A 4IV1C 2HWF1 3VBOA 2HWE3 4GH4B 2RS12 4RQPC 1AR61 4CEWA 4AEDC 1OOPB 1POV0 5DDJ1 1VBE1 4CDWB 1NCQC 1RUJ2 2RMU2 1K5MB 4BCUA 2XBO1 3DPRA 2R072 5K0UB 1R083 1FOD2 4RHV3 1NY71 2IZWA 4GB31 4N53B 1POV1 3VBUB 2MEV1 4CDUA 1RUG2 1VBA2 2R061 4IV1A 2BUKA 1ZBE3 4EJRA 4RQPA 5LK7B 4Z92B 1QQP1 2HWB1 4JGYB 4RS5C 2PLV3 4AEDA 1COV3
chains in the Genus database with same CATH superfamily
4XFAA 2CDPA 2ZMKA 4UW6A 1WGPA 5G05L 1J1TA 5HXMA 1R082 2NMNA 1U12A 3OUHA 4M0HA 1XE0A 5J98B 3KQRA 5JSPA 5JZGB 2VQAA 2WDBA 5IK8A 1UPIA 3O0WA 2VOVA 1AX0A 5J48A 3USUA 1HN1A 4FOYA 2ZGLA 1L7RA 3JBG2 3F2ZA 5BYNA 4CP1A 3TN91 1IPJA 3BGAA 2ZX1A 3EB7A 3MI8A 5FMOL 3ZFEB 4BHPA 1RVF2 2GNBA 5IK4A 3E1F1 4YM3A 1RUC3 4A7YA 4HK9A 3UK9A 3RJ2X 1F8VA 2CGNA 2LROA 1AYN1 1OFSA 1HXS1 4XFGA 5FAXA 3AXEA 5FZMA 4CXYA 3J8F2 1JW6A 1CPNA 1JZ2A 2A3YA 5FYUA 1C3HA 3UV9A 5A80A 2QQVA 1X50A 3SC7X 1UNBA 4IW3A 3VBRC 5LASA 2VZQA 4ES9A 5FP8A 5C4WB 4COUA 2ZKNA 3VBSB 1RUE2 4A45A 5A3WA 3U75A 1VBB1 1ZZ7A 2GSYA 2JDUA 3K48A 5F5CA 1ONAA 1UU6A 2VNOA 4QQPA 5JSOA 2RJKA 3ZYPA 1YQ2A 1SLIA 5A33B 4OUSA 2Y6HA 4R9DA 2RS33 3DECA 4QDRA 2QDNA 4JGZB 4XEZA 1AL21 1RGSA 1S0GA 1D0HA 2Q1FA 4MGQA 2WNUB 4Y22A 5LEKA 1OOPC 1DGRN 1AJKA 1VBC3 2CY6A 3I59A 3PURA 5C9AA 3VZKA 1MZ5A 4DXZA 1OQ1A 1V0AA 1S2KA 1VB4A 2JXAA 2CSGA 2X09A 3N9NA 3ZFFB 4IXLA 4RGKA 3LPGA 5DPNA 1AR83 1H0BA 1MEC2 3RGBA 2QKDA 4CCNA 3AMQA 4CDXB 4XETA 3Q8EA 5FYTA 1OUSA 4TWTA 1ZM1A 5GZEA 3TWIA 4ASKA 5C8WA 1ASJ2 1LU2A 3GYDA 4QMAA 4XDQA 3N9OA 1HRI3 2NYYA 3ZSEA 4OHWA 4NIDA 3G6JB 2W3JA 4RFRB 2A73B 5A3LA 3NVCA 4J1WA 1OMIA 5A32A 5I93A 3NNMA 5JOXA 1VRH3 5L7OB 3VBOC 3TEZA 1U5IA 3H1WA 5DMYA 2A3WA 3RMXA 1PZ8A 4NIIA 3S6PA 3TRSB 5FZ6A 1V6LA 1WD4A 2VU9A 3FN9A 3MGUA 1RMU1 2BP6A 5I0DA 1AR71 1AXZA 1JOJA 4QU1A 1AYM3 1UKGA 2J1EA 3VBHC 5JR7B 4K8RB 1XRUA 4IEUA 3LPFA 3A23A 3QBQA 1KFXL 1GZCA 1WZXA 4DOUA 4K1ZA 1ENSA 5DUVA 3M3QA 4INDA 2WNVC 4Q4W2 1CZVA 1UZ0A 3AB0A 2EIDA 1GWMA 5E6HA 4URAA 2H0BA 4CXXA 1HRV1 2VE1A 3FHIB 1GV9A 4NPMA 2B4KA 2NN8A 1KRIA 1H2KA 2G9GA 1JYWA 4GKXA 3QH7A 2WUHA 2R041 3RZKA 1YXWA 4IEOA 2AC1A 5AFEA 1OQEA 3B94A 2A6WA 1UX6A 2DU0A 3GCWA 1VIWB 4NPRA 1ULCA 3HIFA 2VCAA 4RR3C 2DURA 5C8CA 1ZYBA 1TE1B 4OHXA 3IDCB 2E33A 3WD5A 1I5PA 1GOFA 1YEWA 5C3OA 2VR4A 4PDWA 2DVFA 3JBG3 2FBEA 1EAH2 1XXNA 3NW4A 4IEXA 2JDMA 2Z79A 1HV1A 1RVF3 2RR11 4IE0A 3AL6A 3KMHA 4QPGB 3JCIA 5IJRA 1MS9A 3M3OA 2ZHLA 4QPIC 5H9RA 4QGMA 5L9VA 1W6PA 3L9JT 2PQSA 5FYMA 3TB0A 3P3NA 2PHXA 3FUQA 2VD7A 2JJ6A 3J8F3 1PGSA 5T52A 2BNNA 3AZXA 3UETA 2PHRA 5T55A 4COYA 3KV9A 3AYAA 4AI3A 2E63A 2JICA 3H7JA 4UFMA 2VTXJ 4QPYA 1O59A 4CUCA 2ZAHA 2ZXQA 3KZ4C 5FY4A 4MV2A 2DBIA 2Y33A 4KL1A 1RUE3 1UD1A 2XL9A 1NX9A 3WVJA 4GWNA 2HH9A 5APAA 5EJ1B 4Y20A 3POIA 3ZR6A 2W52A 4CCLA 3H8RA 5DUWA 1WCKA 2TEPA 3KT1A 3LA3A 3OPTA 5FOJB 1H2MA 5C70A 3GBGA 4JX0A 4OHZA 1O7FA 4OQ8A 1PO22 3FZ3A 3UKNA 2AACA 2OXBA 3KF3A 3G7DA 3DPRB 2VO5A 2D93A 4HPKB 4XFBA 4ATFA 2YBPA 2E31A 5EJ3A 4J1XA 3C7EA 3IAPA 4M4RA 3UT0A 1MEC3 1MS0A 1JOBA 1R081 1Q8OA 1X9TA 2OVUA 3JD73 3HN3A 1ZZ8A 2DDUA 3KVAA 4LKEA 4RHV1 3WP3A 2YXSA 4WVVA 4IV3A 2P3JA 3L2YA 4MADA 1NXMA 3GZEA 1WMXA 2BRTA 3JBG1 2WO7A 3PMSA 4GH4C 4PIXA 5FK8A 2RDNA 4CXWA 4E9KA 4PF5A 4RQPB 5B4NA 3RDIA 1RVF1 3AKRA 4XDOA 3UESA 5GZGA 3BUCA 3THCA 3MFCA 5CZKA 3R4SA 4NR1A 3H9AA 3ZPOA 1A78A 2VW0A 2NQYA 5SV8A 4AAXA 4CDWC 2NM1A 1NCQB 3N7JA 3AYCA 3ZIXA 2XJPA 2GH2A 1GQHA 3WEZA 4DXTA 1RL3A 4E4SA 1WCDJ 1YIFA 2ZEYA 3LD8A 3I54A 5FK7A 2JE8A 3J8F1 3VDAA 3JB8A 1N3QA 1ZBA2 3INAA 3LA2A 4E2QA 1GNYA 2Y6FA 5FQ0B 3TBDA 3R4DB 3A21A 2ZA9A 1ULFA 3AYDA 2AEZA 4IUGA 4JKMA 4WBBA 4YG0A 1XQNA 3LEGA 3H42B 5JOYA 1GZTA 2GN7A 1RUE1 2MNGA 2YBKA 4Q4W3 1OXCA 3IMMA 5DDJ3 5EWSA 3UGFA 3ZKYA 1YFWA 4FPGA 4AFDA 1ZZ9A 2N7GA 4JGYC 4ISQA 5FJHA 2ZS6B 2QQNA 5FLJA 2VPVA 2ILMA 4Q4Y1 4Y5TA 1UMIA 3A4UA 3OEBA 2EF6A 4XF3A 2IC1A 2ZKLA 4PBOA 1N1YA 3ZPYA 3BOWA 3VBFC 1O3SA 2XUEA 2Q8DA 3T0AA 4GB33 3IIAA 4RGGA 3K3OA 5EXOA 4XBNA 3VD4A 5FY1A 2HWF2 4TYSA 4LUMA 3VBUA 3ZOIA 1PNGA 2R063 4HL0A 1MEC1 3FUOA 3S5QA 2XB6C 5GZFA 2RDQA 1VP6A 1NQDA 4CCDA 1C1LA 5LWBA 4PQQA 4AEJA 3JU9A 3WDTA 4AI0A 1CAVA 3DL3A 3OF1A 1ZX5A 1EAH3 4QX7A 1LGBA 4NWVA 4ASMB 4OI0A 1ASJ1 1KQRA 4Q4V2 5GLUA 3ZXLA 1XYPA 2VW2A 3S30A 3T2TA 4E27A 1DQ5A 2W94A 4XFFA 4A4AA 1CJPA 3CLPA 3RYKA 4LIVA 2Y0OA 2OS2A 5JZGA 1W0NA 2ZX4A 2MEV2 4LITA 5KWRA 4OLLA 3TNPB 4NIAA 3VBRB 2BTVC 2DUPA 3QCWA 1GNHA 1U0AA 4IGPA 5T5LA 2R1DA 3PUSA 4OZOA 1GUIA 3MLJA 3ZFEA 5FTTC 1OLME 3B7MA 2ID4A 3RWNA 3VD3A 1QQP2 4XHBA 2LS6A 3LAGA 5DZEA 2X5IC 4GZ9A 1EPWA 4YYOA 1J3QA 4MVTA 5FYHA 5JVVA 2PHDA 2PHUA 2ENRA 1GLHA 4Y33A 2W08A 2WJSA 5CFCC 3AJZA 4Q4W1 5IFPA 1ZZCA 4HOOA 4PT6A 4A3ZA 4ZKTB 1W8UA 5CVRA 1PGL2 3HBKA 2Y64A 2VY0A 3DXTA 3HMYA 4OMCA 2YFZA 4QDSA 3QACA 4YFWA 1CAUB 2BBAA 4XF1A 4YW7A 5C4WA 3VLBB 3VBSA 5LZ6A 1H8TC 1I9RA 4B1MA 2ZTNA 4EWEA 1D4M2 2W1SA 2HWE2 4LK6A 3WOGA 4I30A 3OCPA 5FZOB 2WZPP 4JGZA 2IVIB 2WNUA 1YJKA 3A7QA 3KCCA 1UYPA 4FTBA 3LEIA 2JENA 4XUQA 3VBOB 4UFIA 3R4UA 1JYNA 3ACLA 2CAUA 1UY2A 1EAH1 3NNGA 5F6KA 4FPHA 4F7ZA 4TLFA 3ZFGC 2K2SA 3ZFFA 1W6MB 4LO7A 4P9YA 2D3SA 2JKXA 1F15A 4HFSA 4PHZA 2OYZA 3WHUA 1DLLA 4JKLA 3DF0A 2BYVE 5FWJA 4OI2A 3Q8CA 4HLTA 1SCSA 1VB2A 2LW8A 2R1BA 2VOTA 2VBDA 3LWCA 4P5HA 3VBHB 4CDXA 4CCMA 3N4MA 1IGOA 3ZXGA 3POBA 3OSDA 4HXCA 4YZ1A 5GZCA 2JE7A 3I97A 5IYYA 1HQLA 4YZ5A 3S57A 4JQTA 1ZBA3 2VCBA 1DBNA 2WNVB 5GJ6A 4QX8A 1F2NA 1O6UA 2VNRA 5F32A 4KGQA 1VRBA 1JTZX 5FBJA 3RNSA 4AEKA 3WX5A 2FCTA 1HJGA 2WQZC 4AQSA 5L7OA 1JYIA 4Z07A 2XWJB 1G86A 1PZ9A 1PO12 1YRZA 3RZGA 1N3OA 4WM8C 1UYYA 5IVYA 4K40A 4GMP3 3NMBA 3K3NA 4WM7C 5FJKA 2BZDA 2OZJA 4M3CB 4HKLA 4QX0A 2AH2A 5FO9B 1OH3A 3POYA 4RR3B 3OY8A 1JZ6A 1VR3A 3ZYBA 2Z2SB 2CU5A 4PLOA 1PO21 2P3KA 5KXBA 4ORFA 1W9WA 5D1IA 4MGZE 2GC3A 2UU8A 3ZDVA 4Q0VA 1TQ5A 3E97A 1VE0A 4MHUA 2QNKA 2DWRA 1FMD2 2PHTA 2BEOA 2DTWA 3HJRA 4BMEA 4QPIB 4XVHA 4YGEA 1W0OA 5FY7A 4FPJA 1W8TA 2A71A 4Q4V3 2WN2A 3PTYA 3MUZ1 4BXFA 4K9SA 3M7AA 4D6RA 3BTXA 3K4AA 3VZOA 2A70A 3WQ0A 4Y26A 5ABJC 2WWJA 3OBRA 2J1RA 2IXLA 3NNJA 1AXYA 2CV6A 5CAZA 5JI9A 4BLIA 2BOIA 4X8PA 2ES3A 5KR7A 4WVWA 4A7ZA 4NHLA 4LOTA 3AL5A 2EALA 3IPVB 1QQP3 4AF9A 4LMFA 3DCQA 4FXKB 4LBQB 2E9QA 4NAMA 4QPGA 2W87A 5C3SA 4CEWC 2RS13 4YM0A 5C3PA 5JIAA 4DEVA 4BQWA 1YI7A 4DZGA 5JAXA 4ZU5A 2DFCA 3SH5A 1LGCA 3T3YA 4CUAA 1A3KA 2RMU3 3JZVA 4GMP1 3S7EA 1GR3A 4LO5B 2XKPA 2A75A 4GA9A 4CZSA 1SCRA 2R073 1W6QB 3HVDA 4G3YC 2QFEA 2XR4A 3Q8FA 3I7DA 2WWSA 4XBLA 1UU4A 4KG8A 4CDUC 4LT5A 1KS5A 1IQAA 4ITCA 1T6BX 2JB8A 4LQRA 3CEWA 4Y1UA 5L9RA 2UYAA 2VUCA 1O4TA 2HWF1 4CYDA 4D7TA 2HWE3 4GH4B 4P9XA 5FOBB 5EJZB 2V73A 5F7UA 4AEDC 4COVA 3O1SA 1POV0 3O1MA 1REDA 2BVBA 5FZLA 4OFGA 4ZZ5A 1YQ6A 4CDWB 1RUJ2 4MG2A 1RIRA 4HKOA 2P5BA 3DPRA 2Y6KA 4HPKA 5CB7A 3W21A 1APNA 1RJ8A 1IS6A 1FOD2 5FBZA 3N3HA 2VECA 5IVJA 3OBTA 2MEV1 1RUG2 1VBA2 1W06A 3B5LB 3NNLA 4JV4A 4L9BA 1KXGA 3Q9OA 5E8AA 3K51A 3MIDA 1BZWA 3OTFA 1HQWA 2QUOA 2TUNA 3RG0A 4S2GA 5FZ7A 4RQPA 5JXHA 5LK7B 2ZEXA 1QQP1 3O0XA 1JBCA 1LJ7A 4JGYB 4RS5C 5I0UA 3U14A 3WHTA 5J7MA 4K21A 1ZVFA 2JDKA 4J25A 4B29A 4BYYA 1NCQA 5CBLA 1QMJA 4BK5A 1WW4A 2R7EB 2QQLA 4AHWA 2XPJA 2C26A 1NA1C 1SLBA 4EN9B 3VBFB 4JTOA 5LB6A 5DAQA 3ZO0B 4ZPIA 2A5ZA 2JKBA 1MPXA 5FQ0A 2RJ2A 4Y1XA 1PGL1 4MZUA 4PIYA 4FPYA 1Y4WA 4FPFA 4XQDA 3SXWA 1QY4A 4A7KA 5CIRA 4XOGA 1W9FA 1C8M1 2VBBA 2JDPA 2W47A 4AI9A 1DYOA 1RHI2 3QLQA 3WG3A 4C0BA 1G9DA 2PLV2 1ZNPA 4YGDA 1COV2 1D4M1 2LRPA 2HWE1 2VG9A 4JDMA 3AKTA 2GN3A 3AP7A 4GQ7A 4MSVA 1W6OA 3FL7A 5FP3A 3VKNA 2J1TA 2AZ5A 5IWFA 5BY5A 5FPXA 1FMD3 3KLSA 4NROA 1DYPA 3I2JA 2ARXA 2HEVF 3SEEA 1LOEA 2E7QA 1MVEA 3N9QA 1BBT2 3BTAA 3PDQA 4LKSA 1LOCA 1RUC2 1US2A 1NCRC 3BALA 1ACCA 3N7KA 1Y3TA 2EICA 3ETPA 1RB8G 3Q8BA 5FO8B 2X5IB 4RN5A 4BQXA 3AP5A 4AGVA 5LW9A 1UYXA 2HWC2 2VAUA 1RITA 3CZJA 5CEHA 5DUXA 1COV3 1ULEA 2J22A 1BVVA 3PVEA 4AI8A 1QJU1 2F17A 3FBYA 4UBHA 2W46A 3KT7A 2XL7A 4YW2A 4XYXA 1NXD1 3VZNA 1Q8QA 2IXKA 2PHWA 1PO11 3ATGA 1IZ3A 1MS5A 3ZM8A 1H2NA 3VBRA 2MPFA 3J7HA 4XILA 4XZPA 4LBQD 5C7GA 3ITQA 2AGSA 2WQ4A 1H1AA 3I2DA 2A7AA 1PIV2 4OUMA 1DCSA 1I6XA 1H8TB 3KQ4B 4NRMA 4A6OA 4N7UA 4DRRA 3RZLA 2H6CA 2RS32 3N35A 4XJWA 5FO7B 1LHUA 4KWLA 4ZU4A 1VLNA 2BU9A 4ARXA 2RDRA 3M8LA 3ETQA 1VBC2 1AVBA 3K2OA 1OOPA 1REFA 3L2HA 4KMQA 5F3IA 1SLCA 3POGA 1CN1A 5BNNC 3QOPA 3PNAA 4FPKA 3ZFGB 4FAGA 4EZHA 1C1FA 3HNYM 1GFF2 3KCYA 1DHKB 3VD9A 1HJFA 1WCUA 4EWDA 4QU2A 3T4HB 2XGXA 3ZSKA 4P08A 4LJHA 1FMD1 1CAUA 1WLTA 2YZ4A 4GALA 1RUJ3 1VJ2A 4YG3A 3LOBA 1NQJA 3OD0A 3SKVA 1HDKA 3ZYJB 4RA0A 3MV11 3ZXAC 1AR62 3E6BA 2D44A 5LA9A 1YFUA 1NT0A 1QWRA 1FOD3 4BJ0A 4O7XA 4AAPA 5FZOA 5E88A 2VOXA 5FYBA 4LHKA 1H30A 5FZEA 5BNOC 3VKLA 2B5HA 4E8CA 1DZTA 4Q5OA 2DV9A 4F83A 1M06G 1RUG3 1VBA3 2FDJA 4IEZA 4CCKA 1OF4A 2B7YA 1Y43B 1VMJA 5C6CA 3HQUA 4QXCA 4QGNA 1AYM2 1W6MA 5IUQA 1H6XA 4WM8B 1CWPA 1YNAA 1XU1A 2VBPA 4XUPA 4H7MA 4JC1A 5A3OA 5DZGA 2OKXA 1VMFA 3VBHA 3RVHA 4LOSA 4WM7B 1C57A 1F4AA 1OVPA 5FYIA 2XVKA 2ZJCA 3HEIA 3M3IA 3RJRA 3T0DA 1QGLA 4XJAA 1UN1A 2HWB2 2WNVA 5DUUA 3H3ZA 2C24A 2L9LA 3AC0A 4NRQA 1V6JA 3LZZA 3V64A 3WDXA 5K8SA 2JDZA 3LA7A 1FNYA 3WNKA 3H0OA 3LDBA 5DXDA 2RG4A 1CAVB 1PVC2 2Q8CA 2DVBA 2FZ1A 1RHI3 3HPNA 2V4VA 4CSWA 1STMA 3N9LA 2J1VA 3SKJE 1R093 1S0IA 4A42A 4M3CA 5FY0A 1XSQA 4D69A 4DNYA 4RR3A 4QHZA 5I8TA 4AZZA 5ABJB 5AC92 4Q1PA 2HWD2 4YVWA 5F5AA 1WCQA 2ZZQA 3V0BB 5LRSA 3THTA 4FTEA 3WV6A 4IEQA 3UL2A 1EYBA 3BTZA 2X10A 5EPAA 3WCRA 1BBT3 1W9YA 2XJVA 2PQQA 2VMCA 4N43C 2UYBA 4N7IA 1H1MA 4QB6A 5D8AC 2Z69A 2ZGSA 1QNWA 4ZXEA 1E5SA 2R49A 3WSOA 1FV2A 3ABZA 3UJOA 1RUG1 1VBA1 1XC6A 2HWC3 3PVNA 4PF1A 4QPIA 4CEWB 4Y5Z0 4N9HA 3ZN4A 1ALYA 1UOGA 1GANA 1OVSA 3J26N 3AZYA 3O1RA 2Y0IA 1JYXA 3H8XA 1HB3A 1MQTA 2OZ6A 4DY3A 3GHMA 4AVCA 2PXJA 1WW5A 1GWLA 4CEYC 1GQPA 3MIGA 4YW6A 4MYEA 4D7YA 4CDUB 1PIV3 1ZREA 3IPVA 1UMHA 1DGRA 4LBNA 4LBQA 5AVPA 3AVRA 2WWUA 1XNDA 2JD4A 4GD4A 5F5IA 1ZBE1 4MGIE 3ZIWA 1SLTA 3W5MA 1LECA 4AEDB 3EHKA 4EV0A 2EAAA 2DUQA 5HV0A 1RXGA 2PLV1 4RL7A 1LAJA 1COV1 1U5XA 3C8XA 3THPA 3C7HA 4LTAA 4XTPA 4FTSA 1BK1A 2ZGUA 4LEJA 4YW5A 5JPNB 2Q4SA 1LOFC 3GNEA 3JD72 1W6QA 3GJBA 5A7NA 4ARYA 1J84A 3VHPA 4N53C 2PTMA 4AFCA 4YZ2A 1V6KA 4D8MA 1DQ6A 4TN7A 2P37A 4FOWA 4AHZA 2CDOA 2Y38A 4HBNA 2X29A 1E57A 2X53S 2D3RA 1QOOA 1AR63 1XPWA 3P6BA 4GH4A 2GMMA 1OPMA 1BBT1 4QAWA 1XNAA 2ADEA 4EN6B 3LCPA 5A3TA 1RUC1 1W39A 1H2LA 1S0DA 1RUF2 4DUXA 4XAAA 2GZWA 4RS5B 5DN2A 1FXZA 3WZ1A 4JCKA 5EFUA 4CDWA 5FZCA 3D3AA 2HEYF 3ZLIA 5F9TA 1RUI2 1O5UA 3MW4A 1CZSA 2WO3A 4DRVA 1G9BA 3OGGA 1NA1B 5A3NA 4XURA 2PELA 3AZZA 3SHRA 3VUOA 4JZRA 2VZOA 4R4ZA 5J1XA 3OY8B 4DUWA 4OYUA 1JUIA 1LTEA 4E2GA 4NWWA 3WNOA 3LSDA 4UI9L 5DDJ2 2WAOA 2VMHA 2ZEZA 1MZ6A 1YUDA 1WD3A 2HWB3 4O61A 1PIV1 5JUVA 5A6QA 2R30A 4QM8A 2F4LA 4JGYA 1SG3A 5I8YA 1MACA 2RS31 4FPEA 4I3PA 4FT8A 3O5SA 5FZ9A 4ES8A 4BB3A 5K7PA 4QXHA 4S2HA 2D43A 2A6ZA 1DZRA 3MFAA 1PVC3 1VBC1 1NUKA 4GB32 1LKNA 4CE8A 3WDUA 5FZFA 3VBFA 2JWPA 3VV1A 3AYEA 1RUH3 2I2SA 3A22A 4UFJA 2R062 4BQ5A 1AR81 1QJX3 1D2QA 4P9GA 3TEXA 1W0PA 4YVWC 1YJLA 1Z7S3 5C5TA 5AC93 4Z2AA 1NCRB 2HWD3 3MPBA 1W8OA 1JH5A 4L8QA 5I8SA 2W1UA 3RSJA 5IVEA 4IEWA 5EHDA 2JE9A 5C71A 3PUQA 4Y24A 4CPBD 1HRI1 5FPVA 3ZYRA 1YO8A 5H9SA 1S55A 3J7MA 2O8QA 2VUJA 5E89A 5FR3A 1VRH1 3B01A 1FPN2 2HJIA 4XBQA 5FMDA 5BV6A 3FJSA 3RFRA 3KM5A 1WW6A 1GU3A 1O3RA 1IPSA 3U1XA 5A6ZA 4XF4A 1AYM1 1MQTC 1JYVA 3WINE 1JZ3A 1TNRA 4RSUA 1O91A 3B93A 3THDA 3BU0A 1WA6X 4DPNA 1V6NA 2X5IA 2BPA2 2HYKA 1QXJA 3ILFA 1IG0A 2DVAA 4E4DX 2VNVA 1H4GA 5CFCA 2SBAA 2ZGNA 4A41A 5JIUA 4QKDA 2A6XA 2AYHA 4KGGA 3BIWE 3BVCA 1J3RA 3VZLA 4R9AA 5FMBA 5BNNB 2E7TA 4B4QA 2ATFA 3E5UA 1VMHA 2VOKA 1DQ0A 1PVC1 4IDZA 5HCHA 3AP6A 1JZ5A 2XG3A 2VZPA 5ANNA 1SDWA 4NO4A 3VZJA 1XU2A 5IAVA 1HB4A 1H8TA 1OT5A 4BE3A 5J96B 1O3TA 1PGW2 4H14A 4AI1A 3PVOA 1X8MA 2RJLA 4GKYA 4HSLA 4PLNA 3WUCA 1UIKA 5BNOB 2FQPA 1W05A 2ZMNA 5DZFA 5FY9A 5T5OA 3SITA 1NZCA 4LNVA 3ORJA 4K20A 2EIEA 2D5HA 2OQ6A 2Q30A 2Z5WA 3CMGA 4UFLA 4D94A 1H6YA 3ZFGA 3S0MA 3ZN5A 5LRRA 1RUF3 2ZABA 2JDAA 2PN5A 1UQXA 5GLTA 3OGVA 3WR0A 2A6VA 2IXIA 3MHZA 1RUI3 1PX4A 4DS0A 2ET7A 3POJA 4FI9A 2GP3A 1AUYA 4QKFA 5H9PA 2D7FA 1OFNA 3I4IA 3OB8A 2WN3A 3U07A 1JYCA 1PNFA 2TBVA 2WABA 5IHRA 4L97A 5HCFA 1GOGA 2VZTA 4GJYA 4YPJA 4IQPA 1BKZA 1O8PA 1QJY2 3N7MA 4KI5M 3DYMA 4WM8A 1W3XA 5JDBA 1GMMA 1W9TA 1W6OB 3SLIA 2BWAA 1PMJX 2PFWA 2VMIA 4HSJA 3T1LA 3FE5A 4MH0E 2EVXA 4WM7A 5A7QA 1A8MA 2R6QA 2BJSA 2K46A 4FP3A 4CCCA 3IDAA 5JR2A 2Q5TA 3MIBA 1UWWA 4LHLA 2DBNA 5FLHA 3SMHA 4PJYA 4EWAA 4JHZA 5A70A 4BQ1A 3RI9A 5FPLA 4CCEA 5F2WA 2O14A 2VNGA 1K45A 4GAZA 1UY4A 4OMDA 4P5YA 2WFF3 4XJZA 2ZMLA 3OBAA 3JD71 4N43B 2JX9A 1QJZA 3WF1A 4L11A 1MS1A 4LPLA 5D8AB 3UKVA 3AMNA 4KBBA 4XC9A 4XXPA 1W8HA 5A1AA 2QQOA 3KD4A 2DCZA 4DXSA 2WO2A 3E5QA 1NYWA 4UFKA 2BQPA 2VCCA 2XUMA 2B42B 3C7OA 1BJQA 3FHAA 4UWDA 2AEYA 4JVAA 1BLZA 5DG1A 1IKPA 3PL0A 4CPBA 1FPN3 2R32A 2UWBA 2WFPA 5ABJA 2ZX2A 2BNOA 3J7LA 2O8OA 4CU9A 4AQ2A 4NMIA 3V0BA 3MPPG 1AX2A 3HAGA 5AVAA 1RUI1 4CEYB 4HMZA 1EPZA 3BU7A 4B4PA 3JQXA 1X36A 3ZN6B 4BIOA 2YB7A 5FZKA 4IV1C 4YSFA 3CF6E 2RS12 5KC5A 1UW8A 4LUKA 4AVAA 5LCWL 1LNSA 4AHYA 4CEWA 2O1QA 5CYYA 3ZSLA 3OUIA 1OOPB 1N1VA 1YYNA 2CTVA 5DDJ1 2Z4FA 4GULA 4QGLA 1O5LA 2ZHNA 4FOQA 4YM1A 1NKGA 2RMU2 2XDVA 2OIIA 3CIHA 1US3A 5F1RA 4YGCA 3PLQA 1OQDA 1UY3A 2VQTA 3IB3A 1W2NA 2R072 4DB5A 1DYKA 4QD2A 5FXWA 4OHYA 5HXVA 4QX2A 1QOSA 2D98A 3WDVA 4GB31 4N53B 1JHJA 4XUNA 4CP9B 4JDOA 5DABA 4CDUA 1LCLA 4HK8A 2GU9A 3J4UH 4NIGA 1N47A 2W39A 2ZGKA 4ISRA 4F8AA 1CIWA 2PHFA 2R061 3NKGA 4XXAA 4ATEA 2DFBA 2FCVA 4EE2A 3WP4A 5LBBA 2EIBA 2P3YA 2VGDA 3GF6A 4P9WA 2XJTA 4AEDA 1DF0A 4FBFA 5KXDA 3PUAA 1ZZ6A 1WKYA 4AFMA 2JEMA 2CWMA 2VM9A 4HKWA 3QH6A 5A7SA 2B39A 1YWKA 4LKDA 2NP0A 4D0QA 1VBD2 2XH6A 3POSA 5KXEA 1FPN1 1SACA 2AREA 1YQ8A 2ARAA 3W59A 5GALA 4KWKA 5FZ8A 4H3WA 4OULA 4QB2A 2LTNA 2F4PA 1ULPA 5T5PA 1SBEA 3CNAA 2VVDA 4Y3OA 3BTYA 1RUD2 2YROA 1SFPA 3BPSA 3T09A 3WQ7A 3ZMNA 3ES1A 3O1PA 3VD7A 4FQZA 1KD7A 3D82A 2IXJA 5A7OA 3EJKA 3TYJA 2XJUA 4RS5A 3NWKA 3NNFA 1XSRA 3MF6A 4Z82A 5FYZA 3R6SA 1X8EA 2VULA 2UY9A 2IFRA 5CFDC 1O3QA 1QJY3 1NA1A 3I2KA 3I3DA 1W04A 5DAWA 3IKWA 1W99A 2B46X 3M70A 3WDYA 2ZHMA 3ZXFA 5A6YA 2YGMA 5FP4A 2EXKA 1U5ZA 3BYWA 1FATA 3LKJA 4YVWB 3NKTA 1XE7A 1KFUL 1Q8VA 3MUY1 5ACA2 1QDOA 1ODMA 3KHBA 4V1PA 5E16A 1G7YA 2RM22 3M4FA 5L36A 3ZMOA 2Y26A 2W0XA 4XMIA 2W92A 4QXBA 2VTXA 1PGW1 5DG2A 3WW2A 2FDHA 4FSJA 3ZXEA 3E6CC 1BQPA 1R1A2 2K0GA 4EN8B 1IG3A 2ZX3A 1FX5A 3ALQA 5F5QA 4D6QA 2IXCA 3PIJA 3GZAA 1SFNA 1RJ7A 3IDBB 1W3VA 4K8FA 5CNAA 3H50A 1F4HA 5KHHA 2W2IA 4Q4X3 4XUTA 1EV13 3RYPA 1MQTB 5HCAA 3KS7A 4XJ9A 3K46A 4Q8KA 2C9AA 3MIEA 4I09A 1NCRA 4P00B 2GNMA 4E8DA 4WVMB 2A3XA 1H1IA 1JU4A 1ZBA1 3O0VA 4HVOA 5FWEA 1AXKA 3SH3A 4DUVA 3HT1A 1OLQA 2ARCA 4IL7A 1JUHA 1TME3 1K5MA 1WMEA 4K3UA 3OG2A 3WQ1A 1E5IA 1PMIA 2DCJA 4IE7A 4JRLA 1WW7A 1URXA 1DZQA 1ZA4A 3NV2A 2D40A 1QJY1 3TEYA 3H3LA 2P3IA 3BCWA 4BDVB 4M4PA 3VHRA 1KITA 2XWBB 1UZYA 3BN6A 3JB4C 2WR9A 1OSGA 5I0TA 5FZDA 4O65A 2P2KA 4FXGB 3AX4A 1WLCA 2G1MA 3QD6A 4JKKA 4PLMA 1U5YA 2VVEA 4DO0A 5JMOA 2XXZA 2IUWA 2KR2A 2WZR3 4RFT0 1V6IA 2QJVA 4MGTA 3KSCA 1T2XA 3M3EA 2YMZA 2GMPA 4KH9A 1UXXX 3KV4A 3P3PA 3NV3A 4X6QB 3DUIA 5BNNA 4G4FA 3UNPA 2PMWB 2VZ3A 1YQ5A 3LQCA 4L99A 4IEPA 1B35C 1IQDC 2DF7A 2JDHA 3NAPC 4Q4V1 2HBUA 2G4IA 5FUPA 1HV0A 1LHOA 3CHXA 4IE5A 3SISA 1JMUB 4RGAA 4FFGA 1XE8A 1VBD3 2EXJA 1SHWB 1TZOA 2XHKA 4OI4A 1HN0A 4XCBA 2OA2A 4NUBA 4XIOA 5BNOA 2OUJA 4L92A 2JDNA 3NRUA 5KXCA 4QM9A 2YU1A 1UL9A 1N1TA 3U78A 4EN7B 1LHWA 1OLMA 3EO6A 2BERA 2J1SA 1RUD3 1XNCA 5F3EA 5T54A 4CUBA 4B1LA 5FDBA 5B2GB 4BWOA 2XVGA 2YPDA 2LUWA 3HBZA 2RS11 3TN92 3N7LA 1AHSA 1KGYA 2J42A 4LE4A 4MGSA 4Y4YA 2VW1A 1ND3C 4AQ6A 2CAVA 2ARBA 3LE0A 3MLKA 4XZUG 2RMU1 2D6PA 5FKCA 5FZIA 5FCCA 2R071 1UOJA 4Q2FA 3S5AA 2K9ZA 2CYFA 3OYWB 4LBKA 4GXLA 1JXNA 3FLTA 5ACA3 2VQUA 4XFHA 5IT6A 1VAVA 2XVLA 5CKQA 1JI6A 2RM23 1SFYA 3LEKA 5J3UA 3OUJA 1ULOA 5L9BA 5BXXA 1KJLA 1UMZA 1R092 1SMVA 3HOBA 1R1A3 4DQAA 1VBB2 5A7PA 5FMCA 2QQUA 3AZVA 1Q3EA 3CBNA 3CJIC 1OLRA 1UU5A 2J7MA 1J1LA 3IN9A 4BQ4A 5TSWA 3B9IA 1W2AX 4Y5SA 5L19A 1AL22 3VB9A 1A6CA 1UF2C 5FUNA 1VBD1 4NAOA 4V2WA 5A1LA 4WZFA 4N43A 1S0EA 3AVSA 1AX1A 2ZACA 3WNNA 4MO3M 2WQ8A 5D8AA 4IV1B 4NVPA 2W1QA 3GBFA 3LDRA 1UZVA 3MYXA 3V65A 1GP4A 3GBWA 5CFCB 4LIUA 1O8SA 2QQJA 4IEVA 1DIWA 3D0JA 3O12A 2ZGRA 4LA2A 1K5MC 4YZ3A 5LY2A 2D97A 4XFCA 1LENA 3IBMA 2WYFA 2QQMA 5K0UC 2HBTA 1BEV2 3RPQA 2PHLA 1HW5A 4CEYA 4BA6A 5DAVA 3HR9A 5FZ0A 3KV5A 2XQXA 4FPCA 1RC6A 2VJXA 3POEA 4Q0SA 2DCTA 3ZN6A 1CESA 1RMU2 2QQKA 3I2GA 1AR72 1QF3A 4NIHA 2BGOA 1Q8SA 3RZHA 4K1YA 1FAYA 4Y4RA 2WA3A 5IW0A 5ERLA 1CX4A 1PVXA 1R64A 2WSUA 1BCXA 3AK0A 4ASLA 1Y9QA 1UZWA 1LOAA 3MV01 3PMEA 4OVEA 2XLFA 2B9UA 4W65A 5FZAA 5JSRA 3KT4A 4CP2A 3URFA 1Q56A 4MLOA 1HQNA 4YW4A 4CDQC 1GOHA 3EMRA 2FHRA 5HV4A 1XJAA 4AYUA 1LOFA 3KB5A 2FZ2A 2ZX0A 4GJZA 4N53A 3PIGA 5JMCA 4CP9A 3I3EA 4TLGA 1S1AA 3ASIA 4LHSA 4NHMA 3R05A 1XNTA 4AGGA 4CTEA 4UF0A 4YVSA 2ZGQA 1LHVA 1VBE2 2BFUL 4ZS3A 4PI2A 3EXUA 5SV5A 3VDDA 4W6YA 4LULA 4EROA 4Z8BA 2PAEA 1LULA 1TNFA 1WLWA 3PHMA 4UOJA 3X29B 4E4HA 3I3BA 5AFBA 5BUVA 1C8NA 3A0NA 4AR2A 1C5HA 1NY72 2VCMA 2ZZJA 2WT2A 4JHTA 4UBGA 5F8PA 1W8FA 2WNOA 4A6SA 4ZHNA 5C3QA 3UGGA 2D6LX 2QTWB 3WF2A 3ZX7A 5CFDB 4JQRA 3BB6A 3K4ZA 1OA4A 4AVSA 2AR6A 2BGCA 3TN93 1OH4A 4K6BA 1PM4A 4I0BA 3H1YA 4LBOA 3GCXA 1CAWB 2D3PA 1LB2A 2E26A 1VPHA 2BWCA 3B3QE 3VHNA 1LEMA 4R9BA 2JB4A 4TTGA 5A6XA 2BOJA 2F6BA 4MGKE 5EYXA 1AYN3 1CIYA 1HXS3 4Q0PA 4W6XA 1SLLA 4META 4DEQA 5CA6A 1CAXB 1G9AA 4FPOB 4BM8A 2I45A 3OPZA 3RI8A 5H9QA 4E2SA 3NQHA 5KC6A 1GICA 1K5JA 1ND2C 2TNFA 4E4ZA 3APBA 3ACIA 1A34A 1RUH2 3VDCA 3O1UA 4N9IA 3KV6A 1SZBA 5FYSA 1QJX2 1GZWB 5L73A 3ZYHA 1PHMA 1UOFA 5FMOS 1VBB3 2HKXA 4ZZ8A 1Z7S2 3ENRA 3GHNA 4QX3A 4CP0A 1MVQA 1RUJ1 1WA4A 4NN0A 4XQWA 4HVRA 4KBZA 1AL23 2PA7A 5FREA 1V6OA 2CGOA 2EA7A 2VZUA 1DGWA 5BNPC 1PMHX 1FOD1 1BYHA 1XYOA 3RZMA 1J3PA 3MF9A 4A3XA 1J58A 1C5IA 5FZHA 1SLAA 2Y34A 4PI0A 5E1RA 5JOWA 1LGNA 3ACGA 1S0FA 2E51A 4I01A 1RYYA 4YARA 2GC0A 4LKFA 4RHV2 1L3JA 3TAYA 5BPXA 1IPKA 4JRAA 2GNTA 3GXUA 1EUUA 5C33A 2E32A 4LLFA 3DEMA 3VKOA 2FDGA 2RVAA 2J1AA 5LK5A 1YIPA 5IVBA 1BEV3 5JLVA 1DP0A 3T2PA 2W1WA 4Z1VA 1H8VA 5FP7A 5A3MA 3FWEA 3WNPA 3B02A 4WVMA 3W5NA 1O4YA 3OGJA 4URTA 3V56A 4RD7A 3SNMA 5FPAA 3T1MA 4QXKA 1D4VB 3U11A 1RMU3 1SQ4A 1TMF2 1I1EA 1OA3A 1AR73 2V4AA 1V9U2 3AKQA 3I2HA 3BIEA 2NMOA 2NPIA 5EYYA 2EXIA 5LATA 4H7LA 5HBAA 1F5JA 1PK6C 2WL1A 4AE2A 1RHI1 2YC2A 3I8TA 4KG0A 1YCIA 2CGPA 4C0HA 1QEXA 2YYOA 5C9AC 2V09A 4OCTA 3RYRA 1B35B 3B9CA 3WNLA 3NAPB 4LO4B 2VVFA 1R091 3K4DA 3LB9A 3LEMA 1CONA 4XTMA 1HKDA 3KWVA 1NLSA 1X82A 1HRV3 3IWZA 4DXRA 1CX1A 5KHIA 4NRPA 4Q4Y2 3D6EA 1CGPA 4S2FA 1AR92 3W58A 4QHBA 3HQXA 1GQGA 1DQ2A 3LIGA 2YU2A 4YVSC 4EYUA 2R043 3ES4A 4COZA 3I3MA 5LY1A 3VDDC 2CWSA 4QT6A 1DQ4A 1VBE3 4I02A 3A0KA 4IETA 4FAHA 1L7LA 4BLJA 1GNZA 1WBLA 2HYXA 3I2FA 5FXVA 4XHXA 2WT1A 2PAKA 1BXHA 2HWC1 2Q0AA 4V2VA 4G9SB 4DINB 4YG6A 3B69A 1GP5A 1ND3B 2A6YA 1POV3 1DGWX 1XBFA 4KWUA 3H8OA 5DAXA 1DDLA 1CJDA 1H4HA 3J7NA 2YC4A 3CQOA 3H8UA 5T5JA 4M0NA 4LHNA 4UXAA 2ZHKA 2C5DA 2ZOEB 3AMMA 1NLRA 2LM3A 2RR13 1MS3A 1BEV1 2PYTA 2YGLA 2GDFA 4GWIA 4Q8LA 2IWGB 1W6NB 2JG9C 5A7WA 5M0TA 4MOAA 4GMP0 2Z42A 5JPMB 4HVQA 4BXSV 5J09A 4AVTA 3FBMA 5IAXA 4XE9A 2VQ0A 5IFTA 1DG6A 3RWKX 1KEXA 1M4WA 2YBSA 3NO8A 3ZYIB 2GAUA 4AFBA 3CJIB 5JXIA 1D0GA 1SBDA 1B09A 2DU1A 2KD7A 3RRDA 2XOMA 2W68A 5CKNA 3RZZA 1W28A 1QDCA 5D21A 2WFF2 2A1XA 3SCFA 4S2DA 1KS4A 4UT5A 4L2NA 4I3GA 4UW3A 4Q0QA 5BNQA 1W8ZA 2DTYA 2VZSA 3DYOA 1ENXA 3OYWA 1JU3A 4YRDA 1CZTA 1LESA 4MGYE 2JG8C 1W8WA 1AR61 1UY1A 4L0PA 2V72A 1I5ZA 4C8DA 2GP5A 2DVDA 3CKHA 3CJXA 4LR4A 3WF4A 3OBZA 1VBE1 1TG7A 5B4XA 4LORA 2ZGTA 3AKPA 1K5MB 4YWAA 4BCUA 2UY8A 2XONA 2YHJA 5KHKA 4FFHA 1OF3A 4M01A 3CO2A 3OEAA 2P34A 5J36A 2BV4A 5K0UB 1R083 4HN1A 3BPZA 2P17A 3GZTB 2RHPA 1NY71 4FCAA 4RHV3 4Y1ZA 3ZYGA 2IZWA 4R8HA 1W90A 2DVGA 5FYYA 4BU2A 3TEWA 1POV1 3HN1A 3TOJA 4HN0A 3JQWA 1MR5A 5F37A 4QX1A 2GC1A 4A2UA 3MBWA 2YUEA 2ZCWA 4ZS2A 2AENA 3ILRA 1LODA 4TSVA 4IV1A 2BUKA 3NJVA 3AXDA 2CHHA 4EJRA 1FT9A 1G6NA 2WO1A 1QIQA 4Z92B 5FZBA 4BISA 2HWB1 5KHJA 1N3PA 3SCGA 3C7FA 3JXSA 3T2QA 3U37A 1AL0G 3CU7A 2D6MA 1TMF3 4H55A 2LALA 3B00A 1V9U3 2OW4A 5GLWA 1BMV2 1JODA 2Q1MA 1Q8PA 4CDQB 2Q8OA 2G9ZA 4NJ4A 3WP6A 3HQRA 3E5XA 3MO4A 4QB1A 2P6HA 1RUH1 2OPWA 2E7AA 1IKQA 1G8WA 1LOGA 1QJX1 1V00A 1QXPA 2FMYA 2ORZA 4IESA 1OKOA 3WF0A 1S4CA 1OPOA 5IVCA 1Z7S1 5AC91 3DKWA 2FDIA 2HWD1 4P9JA 3FC0A 4Q4Y3 2J1UA 5FYCA 2VTFA 1AR93 1UY0A 4R52A 5LA1A 1WCSA 1Y9GA 5JI7A 1O4ZA 4O9GA 3IDEA 1ZZBA 5EV7A 5FPZA 3WG1A 4C1WA 3PTRB 2WC2A 4XFIA 5I0SA 2I07B 1XNKA 2XHNA 3IAQA 5FY8A 5LBCA 4OI1A 3ZXDA 3O1OA 3D5OA 3KGZA 1GYKA 4B7KA 4P02B 4CRQA 2E53A 2OPKA 1QJEA 2WKKA 5FXZA 2WSVA 3D0SA 3N9PA 3ON7A 2XMLA 3PUHA 3V0AB 1YHFA 2IVJA 1UO9A 2KXLA 1ASJ3 1CPMA 2W5FA 1IS5A 3ILNA 4RYDA 4BMBA 1OHFA 2BVVA 1QJFA 1JN2P 5K9YA 1S0BA 3HNMA 1J83A 4Y1VA 2OQ7A 1ZA7A 2Q1ZB 4CU8A 1UYZA 1ND2B 4YGBA 5IK5A 4UYBA 5IK7A 4NOTA 5CFDA 2WYSA 2MHFA 3WQBA 4QQ2A 1TMF1 5GM0A 4Z2WA 4Q27A 3ZVXA 1V9U1 3GGLA 2YPJA 1ENRA 4AVVA 2ZGOA 1XB9A 1OUXA 1CAWA 2Y6GA 1ST8A 2ZGMA 4PQ9A 1UZZA 3T2OA 1W2TA 3AP4A 4W4ZA 4DY5A 2QZ3A 5F39A 2G9FA 4MXVA 4QQHA 1OKQA 1CAXA 5FPUA 1UCXA 3K75B 4YW3A 5BNPB 3WP5A 3PJYA 1MZEA 3AMPA 5JCTA 1UXZA 3PUIA 2XKOA 5DAPA 4YZ4A 2OUHA 4UAPA 1AR91 5CISA 3WW4A 1SBFA 4LA3A 2V5YA 4TZDA 2W95A 2GALA 1YQCA 4KU7A 4LBLA 4XUOA 2V5DA 1PM7A 1EY2A 1GZWA 4FVVA 4Q4X2 1EV12 5JXGA 2QQIA 3VDBA 1RUF1 2WAAA 4BIFA 4GWJA 4OZXA 5C8CC 5HI0A 4MXWB 5FKBA 1UAIA 2WLQA 3T08A 2C0ZA 4SBVA 2XJQA 3CZUA 4K7JA 3USSA 5FV3A 4PDWC 1OD3A 1CQ9A 4XW3A 1QH7A 4U2AA 3WNMA 2VL4A 3U4XA 3KHCA 1TME2 2B8MA 4M3CF 1MS8A 5JWPA 5LBEA 2VUAA 1PZ7A 4EQVA 4XCAA 4AL9A 3O7OA 4XJUA 3ACHA 3NV1A 3PJQA 1ZRRA 1K3IA 1ODNA 2NLRA 5IATA 1PK6B 3NV4A 3WCSA 3EYPA 3NJZA 5GZDA 4BH9A 1W2OA 2XLGA 4HANA 4LE3A 1X9PA 1QXRA 3VKMA 3S7IA 2IFWA 3WUDA 3ZKUA 2D6OX 4B4RA 5C9AB 1S2EA 2XJRA 3TNQA 5FZGA 3WG2A 5CADA 2C9KA 2ERFA 4PBPA 4SLIA 2JECA 5F3GA 4PCRA 4AVBA 2DUOA 3RMYA 2BBVA 2WZR2 3EBRA 1K42A 3OJBA 4MX3A 2RS52 4JDNA 3VKFC 1NOVA 3AKSA 4QDQA 3J9SA 3I3QA 2WFF1 4UF0B 4YVSB 2VXRA 1F31A 2C6SA 1RTVA 3VDDB 4KU8A 3CL1A 4AOCA 2R0HA 4ET7A 2VH9A 5FRAA 1GKBA 1VAMA 5GLZA 1X7NA 1RUNA 4XDPA 1C28A 3SH4A 3WLUA 1OC1A 4BOWA 5LA2A 4BQ2A 5I91A 5ISLA 5FZ1A 3ECQA 1B35A 1C8M2 3NAPA 1BHGA 1H9PA 1PO23 2PAMA 2WZEA 1KDKA 2D6NA 2YFUA 3DGTA 1OA2A 2BGPA 2VZVA 3PVBB 2WA4A 4FFFA 4FP2A 4Q0UA 3SEPA 1QH6A 2CL2A 3ZSJA 1OI6A 3I2IA 1C4RA 5A33A 5KBFA 5KHGA 3UGHA 3VN4A 3WXPA 2HEWF 4IV3C 3T4VA 4O9EA 1YFYA 2FMDA 4XPVA 1YI9A 4NHYA 5EZWA 2JG9B 2YC0A 1POQA 3RS6A 1J59A 4J6GA 5F6LB 5C5UA 1D7PM 2WBKA 1JZ4A 1NZIA 3O1TA 4LLOA 4XABA 4KWJA 4YFZA 3JUUA 4UFHA 4XAEA 3NJYA 3UJQA 2YDEA 3VL9A 1XOYA 2QVSB 4KQ7A 4AW7A 4I0AA 1ND3A 2EIGA 3BOPA 1SPPB 1ULGA 3IT8A 4ONUA 4WVZA 4BZ4A 3OGRA 4W50A 3FLPA 4IE4A 3AJYA 1W8NA 3O14A 1OD5A 4QHOA 5K4LA 1BMV1 1W03A 3H3UA 1QJU2 2R16A 2JIJA 2AUYA 3KF5A 5GLVA 3M1HA 3ELNA 4OQ9A 1IS4A 5JXJA 4AFAA 1W6NA 1UX7A 2I74A 3MDPA 1HB1A 1JOPA 2QE3A 3LOIA 2JG8B 4W6WA 4DFSA 3IIIA 5GKAC 5LBFA 1AF9A 2Y6LA 1LEDA 4NPLA 5D2AA 4LO8A 4BQYA 1WLDA 1NE4A 4MUVA 2ADDA 3MW3A 1H9WA 4OHVA 3K77A 2WS92 1G9CA 3FFQA 3H7YA 3CJIA 3FX3A 3WG4A 1W9SA 3W9AA 2E6VA 4NE9A 1FNZA 3OPWA 1Z0HA 2W9XA 1DLCA 3UKTA 1WBFA 3FHQA 3USUB 3I49A 3BI3A 3VBUC 3IZOA 2HWF3 1VAKA 3AZWA 4IEYA 3P5BA 3HNBM 2FCUA 1NG0A 3ZSMA 2H0VA 2QCSB 3HD8B 3ZXJA 1WWYA 1VALA 4KNCA 4U36A 3N9MA 4NHXA 4C91A 3NL1A 5FY5A 4XIKA 3WNXA 4AK3A 1CVNA 4CA9A 3N36A 4FQ4A 4CU6A 5FFOC 1D2SA 2ET1A 3FMGA 3PU3A 2QQWA 4UW4A 5JZGC 1AZDA 1F35A 5K0UA 4WV8A 4CCOA 3DV8A 2OX0A 4FO9A 3WY6A 2MEV3 4YM2A 2SLIA 3GZUC 2XJSA 4GWMA 3ROUA 1ZRDA 4B3NA 3ZFEC 2UWCA 3U4SA 1EP0A 1G9FA 3EQEA 1FI2A 4D3WA 4HZFA 1TVGA 4NHKA 1UIJA 2YV8A 2XBO2 3M3CA 2RS53 4IE6A 4MHRA 1HB2A 2QZ2A 2W91A 4DIQA 2WT0A 4Y22B 4IGOA 4XF0A 4YNIA 3DYPA 5ANQA 2DCKA 3I59B 4W8JA 3OD4A 1IHMA 4LK7A 3DN7A 1QKQA 4CDQA 4B8EA 1GP6A 1JS9A 1Y7BA 2QBXA 4P9IA 5T50A 1GBGA 3RQ0A 5C4WC 1R1ZA 2UURA 1ZRIA 4ZY9A 3VBSC 4D7SA 3VHOA 1C8M3 3AFGA 3AM2A 4H2AA 4Q29A 3SCHA 4AHXA 4Q4X1 3W20A 3GM8A 1EV11 2WLPA 2G19A 5T3NA 3ZDSA 3VGIA 2QDRA 3OOXA 5CG9A 1D4M3 2D6KA 3KCXA 4ZONA 2VOWA 1OBNA 4JGZC 2C4XA 5A1FA 2C1FA 3ME2A 2WNUC 1EUTA 3AFKA 3POWA 2VZRA 5FLIA 5A32B 5A7WB 2ZAAA 3LFIA 2WINB 5F3CA 4M3CE 3SQOA 2Q8EA 4QQOA 4QPWA 2OT7A 1QU0A 1A8DA 3RZJA 1CR7A 5IVVA 1P8JA 4C90A 3C3VA 4HG6B 3ZFFC 4B7EA 1TME1 4IGQA 2BNMA 1CD3G 1S2BA 4D6SA 2XLAA 3D8CA 3GALA 1SEFA 4LXLA 5JOZA 4CDXC 4M00A 1LRHA 3I2OA 2IXHA 3AP9A 1HIXA 3POFA 4BPZA 1AYN2 1HXS2 4Y1YA 4Q1RA 4ZU7A 3V0AA 1S0JA 1ULDA 5A3PA 1JHNA 1SDDB 3FLRA 3WDWA 2FDKA 3WT3A 5EP9A 1QJU3 1GZ9A 1YLLA 2X8KA 5L7OC 2ZEWA 1HX6A 3MZHA 4CCJA 5FIXA 2WZR1 4FOVA 3LIHA 4YLZA 2RS51 1F5FA 1LR5A 1ND2A 1PO13 4LBMA 5IVFA 4UW5A 4QQLA 4QX5A 4TXWA 3LGRA 1WUVA 2VC9A 2VMDA 4WZCA 2JDYA 1QHDA 1GSLA 2R0FA 4P14A 4XJ8A 3GDBA 3E6DA 2WS93 2Y60A 4A44A 1RINA 1RUOA 3CDZB 5C8CB 4XF9A 3R0RA 4LO6B 3WW3A 3LSEA 1ZBE2 1DU3D 4R9CA 1UPSA 5FXXA 1JYTA 1FYUA 4PDWB 5CKMA 1DFQA 1V70A 5BNPA 5J37A 4JAAA 2P1BA 4QKNA 2DCYA 4DMIA 1JZ8A 2JIGA 2P4EA 2WZ8A 3P1IA 5LA0A 1DQ1A 3C7GA 2FD8A 4C1XA 1OURA 1XNBA 3M2MA 4N90A 1RUD1 3MW2A 1W6PB 4AEMA 4YW1A 1FV3A 1AJOA 3F95A 1X33A 3BODA 4HONA 4BQ3A 1JZ7A 4MXWA 2FDFA 1ZRFA 2EXHA 3LDKA 3ZR5A 4XQ4A 2RV9A 5HPOA 2ORXA 2GMEA 1E5HA 2XQRA 3IMNA 2KA3A 3T0BA 2GH8A 5G04L 5EIYB 2P6CA 3KVBA 4AG4A 1I3HA 4Y20B 2ETEA 1WMFA 1YC61 4QPGC 5ACA1 2ZPXA 2XBO3 2VMEA 2QQPA 2RM21 4XMAA 4AGRA 4HETA 1KDMA 1PK6A 4I2OA 2UWAA 1MZFA 1GWKA 2O0OA 2X05A 4Q26A 1Y9MA 1ENQA 1L7QA 1R1A1 3VZMA 4AQTA 5FP9A 1LOBA 2BDRA 2VMFA 3NSTA 4QWNA 3T30A 3Q8AA 3O1VA 2BFUS 1HRV2 1UKRA 2WNEA 1NLQA 4N8MA 2VUDA 5FUIA 3AMHA 1NAEA 2WS91 3UYJA 2JD9A 2BW8A 4R4XA 3ST7A 4CUGA 3D4KA 5FPBA 2R042 1BK0A 1DGLA 4IV3B 3VD5A 2RE9A 1IS3A 4LBJA 1PX3A 4IERA 3OGSA 4AI2A 3U0ZA 5FZ4A 1UOBA 4HT1T 2HLEA 1REEA 2YG0A 4QKBA 5A3UA 3KGLA 3ZXKA 3DKQA 4X8NA 1W2UA 4JTNA 5CU1A 5FZ3A 3WF3A 1AR82 3VL8A 4GIQA 1Z78A 1V6MA 3MICA 3DPRC 2H6BA 1RXFA 3MIHA 2GNDA 2WRAA 2GC2A 4PIZA 2ZGPA 4AWDA 1HRI2 2VMGA 2RR12 5LEJA 2VXJA 1F9KA 1Q43A 3ACFA 3DXUA 1QOTA 3ZYFA 1HLCA 1VRH2 2CNAA 1BVP1 3HT2A 3PU8A 1Q5OA 4BK4A 2JG9A 5C3RA 5HCBA 3WW1A 3VBOA 5F2SA 4FPLA 3NJXA 3H1MA 4RQPC 4FFIA 2Y8KA 1S0CA 3FFZA 1QNYA 1NE6A 2KM2A 3GJAA 1LHNA 1NCQC 2YY1A 4EZ4A 2Y6JA 2XBO1 4P9LA 1E5RA 1YFXA 1SPPA 4I0WB 5DQ0A 4OUEA 4EN0A 4CVUA 2VZ1A 3U10A 1WMDA 4CU7A 3MLLA 4X6RB 5EQUA 1ZRCA 2RDSA 3C2UA 1N1SA 1MS4A 3VBUB 4ZXKA 3BKZA 2ZBJA 5I0RA 1IOAA 2B9VA 3MIFA 3IM0A 1XYNA 2D5FA 2NZ9A 4COWA 1KJRA 2JG8A 5FYVA 5CG8A 1ZBE3 1T6GC 4XACA 2EAKA 3HWJA 4AXOA 3MEPA 1TEIA 1LU1A 2DYCA 2PLV3 3LF7A 4F3JA 3LFMA 1K12A 2B45X 2WIIB
chains in the Genus database with same CATH topology
4XFAA 2ZMKA 4UW6A 1WGPA 1J1TA 1R082 2NMNA 1U12A 5J98B 3KQRA 5JSPA 5JZGB 2VQAA 5IK8A 1UPIA 3O0WA 2VOVA 1AX0A 5J48A 3USUA 4FOYA 2ZGLA 3JBG2 5BYNA 4CP1A 3TN91 1IPJA 3MI8A 2ZX1A 3ZFEB 5FMOL 4BHPA 1RVF2 2GNBA 5IK4A 4YM3A 1RUC3 4A7YA 4HK9A 3UK9A 3RJ2X 1F8VA 2CGNA 1AYN1 1OFSA 1HXS1 4XFGA 5FAXA 3AXEA 3J8F2 1JW6A 1CPNA 2A3YA 3UV9A 1C3HA 1X50A 3VBRC 4ES9A 5C4WB 4COUA 2ZKNA 3VBSB 1RUE2 1VBB1 1ZZ7A 2GSYA 3K48A 1ONAA 1UU6A 2VNOA 4QQPA 5JSOA 2RJKA 3ZYPA 5A33B 1SLIA 4OUSA 4R9DA 2RS33 2QDNA 4JGZB 4XEZA 1AL21 1RGSA 1S0GA 1D0HA 5LEKA 2WNUB 4Y22A 1OOPC 1DGRN 1AJKA 1VBC3 2CY6A 3I59A 3VZKA 1MZ5A 4DXZA 1OQ1A 1S2KA 1VB4A 2JXAA 3ZFFB 4IXLA 1AR83 1H0BA 1MEC2 2QKDA 3AMQA 4CDXB 4XETA 4TWTA 1ZM1A 5GZEA 3TWIA 5C8WA 1ASJ2 1LU2A 3GYDA 4QMAA 4XDQA 3ZSEA 1HRI3 2NYYA 4OHWA 3G6JB 2A73B 5A3LA 3NVCA 4J1WA 1OMIA 5A32A 5I93A 5JOXA 1VRH3 5L7OB 3VBOC 1U5IA 3H1WA 2A3WA 3RMXA 1PZ8A 3S6PA 3TRSB 1V6LA 1WD4A 2VU9A 3MGUA 1RMU1 1AR71 1AXZA 1JOJA 1AYM3 1UKGA 3VBHC 5JR7B 1XRUA 4IEUA 3QBQA 1KFXL 1GZCA 4K1ZA 1ENSA 5DUVA 3M3QA 4INDA 2WNVC 4Q4W2 3AB0A 2H0BA 1HRV1 3FHIB 1GV9A 2NN8A 1KRIA 1H2KA 2G9GA 4GKXA 3QH7A 2R041 1YXWA 4IEOA 5AFEA 1OQEA 3B94A 2A6WA 1UX6A 2DU0A 1VIWB 4NPRA 1ULCA 3HIFA 4RR3C 2DURA 5C8CA 1ZYBA 1TE1B 4OHXA 3IDCB 3WD5A 4PDWA 2DVFA 3JBG3 2FBEA 1EAH2 1XXNA 3NW4A 4IEXA 2Z79A 1HV1A 1RVF3 2RR11 3KMHA 4QPGB 3JCIA 1MS9A 3M3OA 2ZHLA 4QPIC 5H9RA 4QGMA 1W6PA 3L9JT 3TB0A 3P3NA 2PHXA 3FUQA 2JJ6A 3J8F3 1PGSA 5T52A 2BNNA 3AZXA 2PHRA 5T55A 4COYA 3AYAA 4AI3A 2E63A 2JICA 3H7JA 4QPYA 2ZAHA 3KZ4C 4MV2A 4KL1A 1RUE3 1UD1A 2XL9A 3WVJA 4GWNA 4Y20A 2W52A 5DUWA 1WCKA 2TEPA 3KT1A 3LA3A 5FOJB 1H2MA 3GBGA 4OHZA 1O7FA 1PO22 3FZ3A 3UKNA 3G7DA 3DPRB 4XFBA 2D93A 4HPKB 4ATFA 5EJ3A 4J1XA 1MEC3 1MS0A 1R081 1Q8OA 2OVUA 3JD73 3WP3A 1ZZ8A 4RHV1 2YXSA 4WVVA 4IV3A 2P3JA 3L2YA 1NXMA 3JBG1 3PMSA 4GH4C 4PIXA 4E9KA 4PF5A 4RQPB 3RDIA 1RVF1 3AKRA 5GZGA 3MFCA 3R4SA 4NR1A 3H9AA 4CDWC 1A78A 2VW0A 2NQYA 5SV8A 2NM1A 1NCQB 3N7JA 3AYCA 3ZIXA 2XJPA 2GH2A 1GQHA 1RL3A 4E4SA 1WCDJ 1YIFA 3I54A 3J8F1 3JB8A 1N3QA 1ZBA2 3INAA 3LA2A 4E2QA 5FQ0B 3TBDA 5AFBA 3R4DB 2ZA9A 1ULFA 3AYDA 4WBBA 4YG0A 1XQNA 5JOYA 2GN7A 1RUE1 2MNGA 4Q4W3 5DDJ3 5EWSA 4AFDA 1YFWA 4FPGA 1ZZ9A 2N7GA 4JGYC 4ISQA 2ZS6B 5FLJA 2VPVA 2ILMA 4Q4Y1 3A4UA 2EF6A 4XF3A 2IC1A 2ZKLA 4PBOA 1N1YA 3ZPYA 3BOWA 3VBFC 1O3SA 4GB33 3IIAA 4RGGA 5EXOA 4XBNA 2HWF2 4TYSA 4LUMA 3VBUA 1PNGA 2R063 4HL0A 1MEC1 3FUOA 2XB6C 5GZFA 1VP6A 1NQDA 1C1LA 4AEJA 3JU9A 3WDTA 4AI0A 1CAVA 3DL3A 3OF1A 1ZX5A 1EAH3 4ASMB 1LGBA 4NWVA 4OI0A 1ASJ1 1KQRA 4Q4V2 5GLUA 3ZXLA 1XYPA 2VW2A 3S30A 3T2TA 4E27A 1DQ5A 4XFFA 1CJPA 3CLPA 3RYKA 2Y0OA 5JZGA 2ZX4A 2MEV2 5KWRA 4OLLA 3TNPB 3VBRB 2BTVC 2DUPA 3QCWA 1GNHA 1U0AA 5T5LA 2R1DA 3MLJA 3ZFEA 5FTTC 3RWNA 3B7MA 1QQP2 4XHBA 3LAGA 5DZEA 2X5IC 1EPWA 4YYOA 1J3QA 4MVTA 5JVVA 2PHDA 2PHUA 2ENRA 1GLHA 2W08A 2WJSA 5CFCC 3AJZA 4Q4W1 1ZZCA 4ZKTB 5CVRA 1PGL2 2VY0A 3HMYA 3QACA 4YFWA 1CAUB 4XF1A 5C4WA 3VLBB 3VBSA 1H8TC 1I9RA 2ZTNA 4EWEA 1D4M2 2HWE2 3WOGA 4I30A 3OCPA 2WZPP 4JGZA 2WNUA 1YJKA 3KCCA 4FTBA 2JENA 3VBOB 3R4UA 3ACLA 2CAUA 1EAH1 5F6KA 4F7ZA 4FPHA 4TLFA 3ZFGC 2K2SA 3ZFFA 1W6MB 4LO7A 4P9YA 2D3SA 4HFSA 2OYZA 3WHUA 1DLLA 3DF0A 2BYVE 4OI2A 4HLTA 1SCSA 1VB2A 2R1BA 3LWCA 4P5HA 3VBHB 4CDXA 3N4MA 1IGOA 3ZXGA 5GZCA 2JE7A 1HQLA 4YZ5A 1ZBA3 2WNVB 1DBNA 5GJ6A 1F2NA 2VNRA 3RNSA 4AEKA 4KGQA 1JTZX 3WX5A 5L7OA 2WQZC 4AQSA 1JYIA 4Z07A 2XWJB 1G86A 1PZ9A 1PO12 1YRZA 1N3OA 4WM8C 4K40A 4GMP3 4WM7C 2OZJA 4M3CB 5FO9B 4HKLA 2AH2A 3POYA 4RR3B 3OY8A 1VR3A 2Z2SB 4PLOA 1PO21 2P3KA 5KXBA 4ORFA 5D1IA 4MGZE 2GC3A 2UU8A 4Q0VA 1TQ5A 3E97A 2QNKA 2DWRA 1FMD2 2PHTA 2BEOA 2DTWA 4BMEA 4QPIB 4YGEA 1W0OA 4FPJA 2A71A 4Q4V3 3PTYA 4K9SA 3M7AA 5ABJC 3VZOA 2A70A 3WQ0A 4Y26A 3OBRA 2IXLA 5CAZA 1AXYA 2CV6A 5JI9A 4BLIA 4X8PA 2ES3A 4WVWA 4A7ZA 4NHLA 2EALA 3IPVB 1QQP3 4AF9A 4FXKB 4LBQB 2E9QA 4QPGA 4CEWC 2RS13 4YM0A 5JIAA 1YI7A 4DZGA 5JAXA 4ZU5A 2DFCA 3SH5A 1LGCA 1A3KA 2RMU3 3JZVA 4GMP1 3S7EA 1GR3A 4LO5B 2XKPA 2A75A 4GA9A 4CZSA 1SCRA 2R073 1W6QB 4G3YC 2QFEA 3I7DA 2WWSA 4XBLA 1UU4A 4KG8A 4CDUC 4LT5A 1KS5A 1IQAA 4ITCA 4D7TA 3CEWA 4Y1UA 2UYAA 1O4TA 2HWF1 4CYDA 2HWE3 4GH4B 4P9XA 5FOBB 2V73A 4AEDC 4COVA 1POV0 1REDA 2BVBA 4OFGA 4CDWB 1RUJ2 1RIRA 4HKOA 3DPRA 5CB7A 4HPKA 1APNA 1RJ8A 1IS6A 1FOD2 5FBZA 3N3HA 2VECA 3OBTA 2MEV1 1RUG2 1VBA2 3B5LB 4JV4A 4L9BA 5E8AA 1KXGA 3Q9OA 3K51A 3MIDA 1BZWA 3OTFA 1HQWA 2QUOA 2TUNA 3RG0A 4S2GA 4RQPA 5LK7B 1QQP1 3O0XA 1JBCA 1LJ7A 4JGYB 4RS5C 5I0UA 3WHTA 5J7MA 4K21A 1ZVFA 4B29A 4BYYA 5CBLA 1NCQA 1QMJA 1WW4A 4AHWA 2XPJA 1NA1C 1SLBA 3VBFB 4JTOA 3ZO0B 2A5ZA 2JKBA 5FQ0A 4Y1XA 1PGL1 4MZUA 4PIYA 4FPYA 4FPFA 4XQDA 3SXWA 1QY4A 4A7KA 5CIRA 4XOGA 1C8M1 1G9DA 4C0BA 1RHI2 3QLQA 3WG3A 2PLV2 1ZNPA 4YGDA 1COV2 1D4M1 2HWE1 2VG9A 4JDMA 3AKTA 2GN3A 3AP7A 4GQ7A 4MSVA 1W6OA 3VKNA 5BY5A 2AZ5A 5FPXA 1FMD3 3KLSA 1DYPA 2ARXA 2HEVF 1LOEA 2E7QA 1MVEA 1BBT2 3BTAA 1LOCA 1RUC2 1NCRC 3BALA 3N7KA 1Y3TA 1RB8G 5FO8B 2X5IB 3AP5A 4AGVA 2HWC2 1RITA 5DUXA 1ULEA 3PVEA 1BVVA 4AI8A 1QJU1 3FBYA 4UBHA 3KT7A 2XL7A 4YW2A 4XYXA 1NXD1 3VZNA 1Q8QA 2IXKA 2PHWA 1PO11 3ATGA 1IZ3A 1MS5A 1H2NA 3VBRA 2MPFA 4XILA 4XZPA 4LBQD 2AGSA 2WQ4A 1H1AA 3I2DA 2A7AA 1PIV2 4OUMA 1I6XA 1H8TB 4N7UA 4DRRA 2H6CA 2RS32 3N35A 4XJWA 5FO7B 1LHUA 4KWLA 4ZU4A 1VLNA 4DOUA 4YZ1A 3M8LA 3ETQA 1VBC2 1AVBA 1OOPA 1REFA 3L2HA 1SLCA 1CN1A 5BNNC 3QOPA 3PNAA 4FPKA 3ZFGB 4FAGA 1C1FA 1GFF2 3KCYA 1DHKB 4EWDA 4QU2A 2XGXA 3ZSKA 3LOBA 1FMD1 1CAUA 1WLTA 2YZ4A 4GALA 1RUJ3 1VJ2A 4YG3A 1NQJA 3OD0A 1HDKA 3ZYJB 4RA0A 3ZXAC 1AR62 3E6BA 2D44A 1YFUA 1QWRA 1FOD3 5E88A 2VOXA 5BNOC 4LHKA 1H30A 3VKLA 2B5HA 1DZTA 2DV9A 4F83A 1M06G 1RUG3 1VBA3 4IEZA 2B7YA 1Y43B 5C6CA 4QGNA 1AYM2 1W6MA 4WM8B 1YNAA 1XU1A 4H7MA 4JC1A 5DZGA 3VBHA 4WM7B 1C57A 2XVKA 2ZJCA 3M3IA 3RJRA 1QGLA 4XJAA 1UN1A 2HWB2 2WNVA 5DUUA 3H3ZA 3WDXA 1V6JA 3LZZA 3V64A 5K8SA 2JDZA 3LA7A 1FNYA 3H0OA 5DXDA 1CAVB 1PVC2 2DVBA 2FZ1A 1RHI3 1R093 1S0IA 4M3CA 4D69A 4DNYA 4RR3A 5I8TA 5ABJB 5AC92 4Q1PA 2HWD2 4YVWA 2ZZQA 3V0BB 5LRSA 3THTA 4FTEA 3WV6A 4IEQA 3UL2A 1EYBA 3WCRA 1BBT3 2XJVA 4N43C 2PQQA 4N7IA 2UYBA 1H1MA 5D8AC 2Z69A 2ZGSA 1QNWA 2R49A 1FV2A 3UJOA 1RUG1 1VBA1 2HWC3 3PVNA 4CEWB 4QPIA 5JOZA 4Y5Z0 4N9HA 3ZN4A 1ALYA 1GANA 3J26N 3AZYA 2Y0IA 1MQTA 2OZ6A 4DY3A 3GHMA 4AVCA 1WW5A 4CEYC 3MIGA 4MYEA 4D7YA 4CDUB 1PIV3 1ZREA 3IPVA 1DGRA 4LBNA 4LBQA 5AVPA 1XNDA 2JD4A 1ZBE1 4MGIE 3ZIWA 1SLTA 1LECA 4AEDB 3EHKA 4EV0A 2EAAA 2DUQA 2PLV1 4RL7A 1COV1 1U5XA 4FTSA 3THPA 4LTAA 4XTPA 1BK1A 2ZGUA 4LEJA 4YW5A 5JPNB 2Q4SA 1LOFC 3GNEA 3JD72 1W6QA 3VHPA 4N53C 2PTMA 4AFCA 1V6KA 1DQ6A 2P37A 4FOWA 4AHZA 2Y38A 4HBNA 2X29A 1E57A 2X53S 2D3RA 1QOOA 1AR63 4GH4A 1OPMA 2GMMA 1BBT1 4EN6B 3LCPA 1RUC1 1W39A 1H2LA 1S0DA 1RUF2 2GZWA 4RS5B 1FXZA 3WZ1A 4JCKA 5EFUA 4CDWA 2HEYF 5F9TA 1RUI2 1O5UA 3MW4A 4DRVA 1G9BA 3OGGA 1NA1B 2PELA 3AZZA 3SHRA 4R4ZA 3OY8B 1JUIA 1LTEA 4E2GA 4NWWA 3LSDA 5DDJ2 2VMHA 1MZ6A 1YUDA 1WD3A 2HWB3 1PIV1 2R30A 4QM8A 4JGYA 5I8YA 1MACA 2RS31 4FPEA 4I3PA 4FT8A 3O5SA 4ES8A 5K7PA 4S2HA 2D43A 2A6ZA 1DZRA 3MFAA 1PVC3 1VBC1 4GB32 1LKNA 3WDUA 3VBFA 3VV1A 3AYEA 1RUH3 2I2SA 2R062 1AR81 1QJX3 1D2QA 4P9GA 1W0PA 4YVWC 1YJLA 1Z7S3 5AC93 1NCRB 2HWD3 3MPBA 1JH5A 4L8QA 5I8SA 3RSJA 4IEWA 2JE9A 4Y24A 1HRI1 3ZYRA 1YO8A 5H9SA 1S55A 2O8QA 2VUJA 5E89A 1VRH1 3B01A 1FPN2 2HJIA 4XBQA 5BV6A 3FJSA 3KM5A 1WW6A 1O3RA 4XF4A 1AYM1 1MQTC 3WINE 1TNRA 4RSUA 1O91A 3B93A 4DPNA 2BPA2 1V6NA 2X5IA 2HYKA 1QXJA 3ILFA 2DVAA 4E4DX 1H4GA 5CFCA 2SBAA 2ZGNA 5JIUA 2A6XA 2AYHA 4KGGA 3BIWE 1J3RA 3VZLA 4R9AA 5BNNB 2E7TA 4B4QA 2ATFA 3E5UA 2VOKA 1DQ0A 1PVC1 3AP6A 2XG3A 1SDWA 4NO4A 3VZJA 1XU2A 1H8TA 4BE3A 1O3TA 5J96B 1PGW2 4H14A 4AI1A 3PVOA 1X8MA 2RJLA 4GKYA 4HSLA 4PLNA 3WUCA 1UIKA 5BNOB 2FQPA 2ZMNA 5DZFA 5T5OA 3SITA 1NZCA 4LNVA 4K20A 4D94A 2D5HA 2Q30A 2Z5WA 3ZFGA 3S0MA 3ZN5A 5LRRA 1RUF3 2ZABA 2PN5A 5GLTA 3WR0A 2A6VA 2IXIA 1RUI3 4DS0A 2ET7A 1AUYA 5H9PA 2D7FA 1OFNA 3I4IA 3U07A 1JYCA 1PNFA 2TBVA 4L97A 5HCFA 4IQPA 1BKZA 1QJY2 3N7MA 4WM8A 5JDBA 1W6OB 3SLIA 2BWAA 2PFWA 2VMIA 4HSJA 3T1LA 3FE5A 4MH0E 2EVXA 4WM7A 1A8MA 2R6QA 4FP3A 2Q5TA 3MIBA 4LHLA 5FLHA 3SMHA 4EWAA 4PJYA 4BQ1A 3RI9A 2VNGA 2WFF3 4XJZA 2ZMLA 4N43B 3JD71 2JX9A 1QJZA 4L11A 1MS1A 5D8AB 3UKVA 3AMNA 4KBBA 4XXPA 3KD4A 2DCZA 3E5QA 1NYWA 2BQPA 2XUMA 2B42B 1BJQA 4JVAA 5DG1A 1IKPA 1FPN3 2R32A 2UWBA 2WFPA 5ABJA 2ZX2A 2BNOA 2O8OA 4AQ2A 3V0BA 3MPPG 1AX2A 3HAGA 5AVAA 1RUI1 4CEYB 4HMZA 1EPZA 3BU7A 4B4PA 3JQXA 1X36A 3ZN6B 4BIOA 4IV1C 4YSFA 3CF6E 2RS12 5KC5A 1UW8A 4LUKA 4AVAA 4AHYA 4CEWA 2O1QA 3ZSLA 4YZ2A 1OOPB 1N1VA 1YYNA 2CTVA 5DDJ1 4GULA 4QGLA 1O5LA 2ZHNA 4FOQA 4YM1A 2RMU2 2OIIA 5F1RA 4YGCA 3PLQA 1OQDA 4DB5A 2R072 1DYKA 4QD2A 4OHYA 5HXVA 1QOSA 2D98A 3WDVA 4GB31 4N53B 4JDOA 4CDUA 1LCLA 4HK8A 2GU9A 3J4UH 1N47A 2W39A 2ZGKA 4ISRA 4F8AA 1CIWA 2PHFA 2R061 3NKGA 4XXAA 4ATEA 2DFBA 3WP4A 3GF6A 2VGDA 4P9WA 2XJTA 4AEDA 1DF0A 4FBFA 5KXDA 4AFMA 1ZZ6A 2JEMA 2CWMA 4HKWA 3QH6A 2B39A 1YWKA 2NP0A 1VBD2 2XH6A 3POSA 5KXEA 1FPN1 1SACA 2AREA 3W59A 5GALA 4KWKA 4H3WA 4OULA 2LTNA 2F4PA 5T5PA 1SBEA 3CNAA 2VVDA 1RUD2 2YROA 3WQ7A 3ZMNA 3ES1A 4FQZA 1KD7A 3D82A 2IXJA 3EJKA 3TYJA 2XJUA 4RS5A 3NWKA 3MF6A 4Z82A 3R6SA 1X8EA 2VULA 2UY9A 2IFRA 5CFDC 1O3QA 1QJY3 1NA1A 3IKWA 2B46X 3M70A 3WDYA 2ZHMA 3ZXFA 2YGMA 2EXKA 1U5ZA 1FATA 3LKJA 4YVWB 3NKTA 1XE7A 1KFUL 1Q8VA 5ACA2 1QDOA 4V1PA 5E16A 1G7YA 2RM22 3M4FA 5L36A 3ZMOA 2Y26A 2W0XA 4XMIA 3WW2A 1PGW1 5DG2A 4FSJA 3ZXEA 3E6CC 1BQPA 1R1A2 2K0GA 4EN8B 2ZX3A 1FX5A 3ALQA 5F5QA 2IXCA 3GZAA 1SFNA 1RJ7A 3IDBB 4K8FA 5CNAA 3H50A 5KHHA 4Q4X3 1EV13 3RYPA 1MQTB 5HCAA 3KS7A 4XJ9A 4Q8KA 2C9AA 3MIEA 4I09A 1NCRA 2GNMA 4WVMB 2A3XA 1H1IA 1ZBA1 3O0VA 4HVOA 1AXKA 3SH3A 3HT1A 1OLQA 4IL7A 1JUHA 1TME3 1K5MA 1WMEA 4K3UA 3WQ1A 1PMIA 2DCJA 4JRLA 1WW7A 1URXA 1DZQA 1ZA4A 3NV2A 2D40A 1QJY1 2P3IA 3BCWA 3VHRA 1KITA 2XWBB 1UZYA 3JB4C 1OSGA 5I0TA 2P2KA 4FXGB 3AX4A 1WLCA 4PLMA 3QD6A 1U5YA 2VVEA 2WZR3 4RFT0 1V6IA 2QJVA 3KSCA 3M3EA 2YMZA 2GMPA 4KH9A 3P3PA 3NV3A 4X6QB 3DUIA 5BNNA 4G4FA 4L99A 4IEPA 1B35C 2DF7A 2BBVA 3NAPC 4Q4V1 2G4IA 1HV0A 1LHOA 3SISA 4RGAA 1XE8A 1VBD3 2EXJA 4OI4A 2XHKA 2OA2A 4XIOA 5BNOA 2OUJA 4L92A 5KXCA 4QM9A 1UL9A 1N1TA 4EN7B 1LHWA 3EO6A 1RUD3 1XNCA 5T54A 5FDBA 5B2GB 4BWOA 2XVGA 2LUWA 3HBZA 2RS11 3TN92 3N7LA 1AHSA 4LE4A 4Y4YA 2VW1A 1ND3C 4AQ6A 2CAVA 2ARBA 3MLKA 2RMU1 2D6PA 5FCCA 2R071 4Q2FA 2K9ZA 2CYFA 3OYWB 4LBKA 4GXLA 1JXNA 3FLTA 5ACA3 4XFHA 5IT6A