1RVF3

Fab complexed with intact human rhinovirus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
total genus 31
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rvf300
1VAKA 4RS5C 1VBC1 1VBB2 1PO12 5DDJ1 1R083 4N43B 3ZFEC 1AR61 4RR3C 4RHV1 3VBRA 1NY72 5BNOA 2RMU2 1RUF2 1QQP1 1QQP2 5BNOC 3VDDB 5LK7B 1HRI2 5C4WA 1PO23 1RUI2 1OOPB 5BNNB 1FMD2 3CJIA 1PO11 1VBB1 1NA1C 1A6CA 1VBE3 4QPIB 4CDUA 4CDWC 5C8CB 1HX6A 1POV3 5CFDC 2HWD2 4YVSA 1TME2 1RUC2 3NAPB 5BNPC 4CEWA 3VBSB 1X33A 2HWE2 5A33B 4Q4W2 5ACA2 2FZ2A 2RR13 4IV3A 1R1A1 1ZBE3 2R062 4RR3B 1X36A 4CDQA 1RUG3 4RHV3 1RUJ1 3HAGA 4NWWA 2DF7A 5K0UA 3JD71 1R092 1RUJ2 4RQPA 1ND2C 1F8VA 4SBVA 1PO21 5L7OB 1VBD3 4IV1B 4RS5B 1AYN3 1DDLA 5BNNC 1R1A2 3VBRB 1RUH2 2RM21 4GMP1 3TN93 4EJRA 2HWE1 5BNNA 1HRV2 1BMV1 4NWVA 4Y4YA 1RMU3 4FTEA 4AEDA 4GMP0 1RUG1 5BNPA 5JZGC 4CDUB 4N53A 1QJZA 3JBG3 3J8F3 1MEC3 2BUKA 1EAH1 2RMU3 1VRH3 1POV0 3VBSC 4JGZC 1AR71 4CEYA 1PIV3 3VBHB 1EV11 4PDWA 3ZFGA 3S6PA 1RUI3 1BMV2 1D4M3 2WZR3 5C4WC 2BBVA 3NAPA 1QQP3 5A32B 5AC92 5BNPB 1RUH1 4Z92B 3ZFFC 1MQTB 2HWF2 5DDJ2 4IV3B 4CDWA 1VBC2 1VBA1 3JBG2 4GH4B 3JD72 3TN91 5L7OA 2HWD3 4QPGC 1QJX3 2PLV1 1TMF1 1NOVA 5FOJB 1NCRA 5D8AB 4Q4X3 1RUI1 4JGZA 1HRI1 4Q4W1 1HXS2 3VBHA 2HWB3 4RQPC 1PVC3 1E57A 1CD3G 1AR91 1ASJ1 1RUE1 1RUC1 4RFT0 4RHV2 3ZXAC 2X5IC 1VBD2 2ZTNA 4AEDB 2MEV1 1QJU1 3JD73 1RHI3 1SMVA 2X5IA 1VB4A 3LOBA 2XBO2 4WM8C 1H8TB 1AR92 1CJDA 4WM7C 1K5MB 4YVWB 1RUF1 1VRH1 1PVC1 1PGW1 5A32A 1NCQC 5C4WB 1AR62 1ND3C 1AL21 1Z7S3 3FBMA 3ZFGC 5D8AC 1NG0A 2WWSA 1OOPA 1QJU3 3ZFFA 2WS92 1RHI2 5D8AA 3J8F1 2MEV2 4RQPB 1BEV1 1NA1B 1C8NA 2FZ1A 2R041 3JB4C 1F2NA 1RUE3 2X5IB 2WZR1 1BBT2 1RVF1 2VQ0A 5DDJ3 5A33A 3ZFEA 5AC91 4CDQC 4QPGA 1ZBA3 1AYN1 3VBFB 1IHMA 1TME3 1ZBE2 2GH8A 4Q4Y2 1EV12 4WM7B 4GB31 4FTBA 4Q4X2 1QJY1 4Q4W3 5C9AB 1COV2 4PDWB 3NAPC 2Y26A 1RUG2 1VB2A 5K0UB 1R082 2R072 1B35A 1FOD2 4Q4V2 4CDXC 5ABJB 2HWF1 1PGL2 1POV1 1RMU1 2RM22 1HRI3 1K5MC 2XBO3 1AYM2 4YVWA 4CEWC 1PGL1 1V9U1 3VDDC 2RS51 2RS53 1NCRC 1AR93 4N53B 1W39A 2RS11 1MEC2 3VBOB 3VBUB 1ZBA1 4N43A 2RS12 1D4M1 2RR12 1NA1A 1V9U2 1VBA3 2TBVA 2HWC3 3CJIC 2WFF1 5CFCA 1QJX1 1AL0G 2XPJA 4RR3A 1C8M2 2BFUS 2WZR2 1Z7S1 5L7OC 4LLFA 2R042 1VBC3 1COV1 1RHI1 4Q4X1 1RUJ3 1MEC1 1HRV3 4YVSB 1EAH3 1H8TA 4GH4C 1VBB3 1V9U3 1R1A3 1ZBE1 1WCDJ 4CEWB 5CFCB 5BNOB 5K0UC 1RUF3 1VRH2 1ND3A 1RVF2 1RMU2 4GMP3 1PIV2 2R073 4Q4V3 1FOD3 1TME1 3J8F2 2HWD1 2HWB2 2BPA2 1COV3 2HWB1 2RM23 4AEDC 1AL22 4GB32 1K5MA 3M8LA 1RUD3 1RUC3 1AR73 4IV3C 4Q4Y1 1PGW2 4N43C 3ZFEB 1AR83 3IDEA 4CEYC 1FPN3 1HXS1 2R063 1ND2A 4CDXB 3DPRC 5ABJC 5CFCC 5FMOL 3ZFFB 1BEV3 5CFDA 5ACA3 1QJU2 2WS91 3ZFGB 1VBD1 1PO13 1VBA2 3JBG1 1Z7S2 2WLPA 1FMD3 1PIV1 4JGYB 2RS33 1AR82 1R093 4WM7A 2BFUL 3VDDA 2WFF2 4CDQB 1H8TC 4GH4A 2IZWA 5C9AA 1RUD1 2RR11 1OHFA 2PLV2 4CDWB 3VBFC 4Y5Z0 1MQTA 1AUYA 3VBUA 1B35C 1ZBA2 3VBOA 4CDXA 1NCQA 1EAH2 2HWC1 5C8CA 3DPRB 1ASJ2 1C8M1 4JGYA 1QJY3 5FMOS 4BCUA 3VBRC 3JB8A 5J96B 4WM8A 2R071 1GFF2 4Q4V1 1NCQB 2HWF3 2PLV3 1AR72 1TMF2 4PDWC 1ND2B 1R091 2RS31 2WFF3 3TN92 1MQTC 1FPN2 1OOPC 2RS52 2ZAHA 1BBT3 4Q4Y3 4IV1A 1RUH3 1ASJ3 1HRV1 2RS13 5ACA1 4RS5A 5J98B 1QJX2 4CDUC 2GSYA 2HWC2 1EV13 1PO22 1BEV2 1FOD1 1HXS3 1FPN1 2R043 1D4M2 1TMF3 4WM8B 4FSJA 4CEYB 2RS32 5JZGA 5C9AC 5AC93 1B35B 5ABJA 1AYM3 4QPGB 1AYM1 1FMD1 1OPOA 3DPRA 5GKAC 1AR81 2HWE3 3VBUC 3VBOC 3VBFA 1ND3B 2RMU1 1AR63 1BBT1 1R081 4IV1C 3CJIB 5C8CC 1RB8G 2XBO1 4JGYC 4YVWC 4YVSC 1NCRB 4N53C 1QJY2 1RVF3 2WS93 2QQPA 1M06G 2MEV3 2ZZQA 4FTSA 4QPIA 1RUE2 1RUD2 5JZGB 1AYN2 3VBSA 2R061 4QPIC 1VBE1 1PVC2 4JGZB 1HQNA 1AL23 1VBE2 4GB33 1NY71 1C8M3 3VBHC 5CFDB
chains in the Genus database with same CATH superfamily
4BK4A 1VAKA 2GMPA 1O8PA 3K4ZA 1NKGA 1QMJA 5JVVA 4GD4A 4XEZA 1RINA 3B9IA 5DDJ1 1VMJA 4IEXA 4F3JA 1IPKA 2A6ZA 3OG2A 1AR61 2VMDA 2AEYA 2BV4A 1H30A 1HB2A 3V64A 5KC5A 1SLIA 4FQ4A 4HKOA 1IOAA 3VLBB 4FPEA 4EYUA 3APBA 3NL1A 4CCOA 1DQ6A 3EYPA 3Q8BA 1QH6A 5IVVA 2RJKA 1S2EA 1FNYA 1OOPB 1PMIA 2C6SA 4Q2FA 3I97A 3SCHA 2NMOA 4E27A 4MGTA 4A2UA 4COUA 1NA1C 2XLAA 1RC6A 5DUUA 1YQ2A 3Q8FA 1VBE3 4LKSA 4Q0VA 4BDVB 1MVQA 4JTNA 5JI7A 2VZUA 4R4XA 1V6JA 4FPJA 1APNA 1SLLA 3CU7A 3M3IA 4PIYA 4COYA 3ETPA 3RMYA 2R7EB 1AXYA 1GOGA 3P5BA 3THPA 4Q8LA 3WNMA 2J1VA 3VBSB 2OT7A 4ZXKA 4PBOA 1F5FA 1SLBA 4AVTA 3N7MA 2J1TA 3H3UA 4HVRA 5EJ3A 5H9PA 3OCPA 4E2GA 3IM0A 1VPHA 4HN1A 5A7QA 5JPMB 5LY2A 4XACA 2CWMA 1RJ7A 3HN1A 3AKSA 3POSA 4NWWA 3M1HA 1VMHA 4MVTA 2J1AA 4CU7A 1GNHA 2VAUA 5K0UA 4DIQA 2AREA 4UF0B 3SKJE 2OXBA 3TNQA 5F7UA 1C28A 2VY0A 4FOYA 4CP9A 1URXA 3OF1A 1LODA 3J9SA 4AHYA 4SBVA 4KGQA 5FY4A 3N7LA 5FYTA 3VKOA 1AYN3 1DDLA 4YG6A 1ACCA 2V4AA 4GWMA 5C3PA 2BOJA 5FZAA 2Q30A 4NIGA 4QPWA 2ZACA 2ES3A 4Y1ZA 5A7WB 4JVAA 5BNNA 5M0TA 1GWMA 1HRV2 2W47A 4JHTA 1LOFA 2RJ2A 2WRAA 3VZOA 4FTEA 1JH5A 2C4XA 3OJBA 4AF9A 3U4XA 4Y20B 3KF5A 3INAA 3RFRA 5JZGC 5JPNB 4CDUB 1ULDA 2VZVA 3J8F3 1MEC3 2VQTA 1IKPA 3POJA 1SPPB 1VRH3 3DL3A 4DO0A 2BP6A 4LNVA 2QE3A 2N7GA 4JGZC 4RGAA 5IVBA 4BQXA 2W92A 4FFIA 2VUJA 1W05A 4PDWA 1MZEA 3PURA 4K20A 3ACIA 2DBNA 2E26A 1BMV2 1ZA4A 5H9QA 3WY6A 2G1MA 4MZUA 2BBVA 4W4ZA 1V6IA 3TEYA 5AC92 2Y6LA 1RUH1 4BQ3A 5BNPB 3WNOA 5FUPA 3ZFFC 1QGLA 4Q0UA 4Y1UA 2E51A 2EIBA 1WMXA 2WZPP 2VMHA 2HWF2 1Z0HA 4YM2A 4CDWA 3G7DA 4MHRA 1VBC2 4AI0A 4TYSA 3JBG2 2ZHLA 4GH4B 4D7TA 2FQPA 4EWDA 2ZPXA 4INDA 5HXMA 4OQ9A 2WN2A 1H8VA 2PLV1 1S55A 1IKQA 3N36A 3LF7A 1NOVA 3S7EA 4CA9A 1DQ5A 3O1UA 3EBRA 1RUI1 4HK9A 5I0UA 2VXRA 1N1TA 4HPKB 5LBCA 1MS4A 2ERFA 4RL7A 2HWB3 5A6YA 1L7RA 1O3TA 1CD3G 5AFBA 5GZGA 1J59A 1O5UA 4JZRA 4CP1A 4DOUA 1AR91 1CPNA 1WBFA 2B9VA 5FLIA 1UW8A 4OUEA 4U36A 1W8NA 1S0BA 3POWA 1UY2A 2G9GA 2VL4A 5T5JA 1UY0A 1VBD2 5F6KA 4UW3A 2MEV1 1QJU1 1PGSA 3MIFA 4OMDA 4F8AA 5L9VA 1RHI3 3V0AB 2VBDA 1HB3A 4BIOA 4CCCA 4XFAA 3C7EA 1WWYA 5FMBA 1OLQA 3BIEA 1H8TB 3T30A 5FYUA 3WNLA 4Y26A 2LALA 5T55A 2UY8A 2GNMA 3PUAA 3U10A 3WQ1A 1CJDA 5FJKA 5IFTA 1PX4A 2Q8EA 4IEOA 2VQAA 3ILRA 4YVWB 4ZS3A 3I54A 2X09A 1UY3A 1PVC1 1XJAA 1PGW1 3ZN5A 2XMLA 4AHZA 4ISRA 1OKQA 2OVUA 2ARCA 1VAVA 1Z78A 3ACFA 3OD0A 1ND3C 1AL21 2VMEA 1DIWA 3FBMA 3MW3A 4FPHA 3B3QE 2C0ZA 4S2FA 4GJYA 4V2VA 5FP9A 2RHPA 3K46A 2D7FA 1OOPA 2X53S 4OZXA 3ZFFA 5D8AA 1HW5A 4XIOA 1SFNA 3AB0A 1KS4A 1BEV1 1UXZA 2P3KA 3HNMA 4RQPB 5IAVA 2VD7A 2ZX0A 3JB4C 4QHOA 5B4XA 1PNFA 5A3MA 2WZR1 1BBT2 3P1IA 2ZKNA 2PQQA 2VUDA 2FCVA 5FYHA 4PHZA 2YY1A 5DDJ3 4FXKB 5A33A 3HNYM 4MGIE 2Y38A 2ZGSA 1KRIA 4XW3A 4QQOA 4XCAA 4CCMA 1JYVA 1O59A 2WDBA 5F2SA 2XUMA 4QXCA 2BRTA 1TME3 1MZFA 1Q8PA 5FUIA 3BTYA 4MUVA 1EV12 3A7QA 4JAAA 2F6BA 4LBOA 4CUGA 3BU0A 1LEDA 4WBBA 2RJLA 3GXUA 5DUVA 2VTFA 3RI9A 1FT9A 2JB4A 5FMCA 4CCJA 4FTBA 3JQWA 4UW4A 5C9AB 1YQ5A 3GZAA 2PHWA 2JD9A 3PIJA 3WDTA 3I2IA 1FI2A 1RUG2 5HXVA 2W1UA 3SC7X 1AVBA 1BLZA 1DQ1A 1OLRA 2P34A 3Q8CA 4Q4V2 2HYXA 2W94A 1RTVA 1U5YA 1CAXA 2D6NA 4FAGA 5K9YA 2XVLA 2RM22 1GWKA 1T6BX 2NPIA 3BYWA 3I2KA 3KLSA 4HN0A 3TBDA 1F4HA 2FCUA 2JIGA 3CZUA 4XBQA 3ZIWA 1AHSA 5FFOC 3OSDA 4CEWC 1PGL1 1V9U1 1CAVB 4XCBA 1PHMA 2RS51 5JSRA 5KWRA 2XR4A 3C7GA 4G4FA 1UU4A 1OFSA 4LHLA 3RJRA 3H8XA 2K2SA 2ZGQA 2YG0A 1UYZA 1FV3A 1W9SA 1W06A 2B42B 3HT2A 2ZAAA 1LRHA 3N9LA 4PIZA 4F83A 3ZXLA 3RYPA 1WMFA 1TZOA 2RR12 2Y6JA 1VBA3 4IEZA 2OQ7A 5CZKA 2ADEA 1J3RA 2F4LA 2UURA 1U0AA 3LCPA 1NXMA 2WWJA 2WFF1 5C8WA 3N9NA 3MIDA 5CFCA 1UNBA 4LIVA 5GLZA 1A34A 1AL0G 3LA7A 1LGNA 3BB6A 4LMFA 2WO2A 2XJVA 5FY5A 5C71A 2VPVA 3ZYIB 1LECA 1LOFC 4BJ0A 1UOGA 1GV9A 2BU9A 2R042 3K3NA 1ENXA 2K0GA 2GMEA 1RHI1 1QDOA 5EIYB 2DU0A 1MEC1 1HRV3 1HN0A 1LCLA 2G19A 2IXCA 3PLQA 3POEA 4MADA 1HB1A 5FO8B 3MLKA 2KD7A 1F9KA 3ZN6A 1ZBE1 1WCDJ 3MGUA 3IDCB 4DQAA 3KV6A 5DAPA 5K0UC 3NWKA 2ZGRA 2GDFA 1QF3A 3WP5A 5LASA 1HLCA 2MHFA 1PVXA 1YRZA 5LA9A 1RMU2 4GMP3 1NE6A 2B8MA 2CV6A 4MV2A 3AZWA 3U14A 1DCSA 3DXUA 3VD7A 5IT6A 1MZ6A 1V6MA 2VZSA 2SLIA 1HQWA 4Q1RA 3HBZA 5FXXA 4OFGA 4Y1YA 3FBYA 2RM23 3WF4A 1KXGA 4GB32 4HXCA 3M8LA 5EJ1B 1RUC3 4XF3A 2QCSB 2ATFA 1W2AX 2DU1A 3H7JA 4HETA 4Q4Y1 5DG1A 4A7KA 5FYZA 4ZHNA 3H8UA 3ZFEB 3VL8A 4OLLA 3VKNA 4FPFA 1NLQA 3KCYA 2VNOA 2EF6A 3RWKX 3F95A 3AKQA 4OYUA 2ZGUA 2Z79A 1FPN3 1HXS1 1UYYA 1KDMA 2WO1A 3MPBA 1UX7A 4OI1A 2R063 2X10A 1JU4A 1ULOA 3ZXFA 5J09A 4K8FA 2D44A 4KBZA 5FMOL 4AFDA 1MS9A 4TWTA 1US2A 5LA2A 3LEGA 2NP0A 2X8KA 5HCAA 2H6CA 3I8TA 3P3PA 1UPIA 1ULCA 1RITA 5KHJA 4UFLA 4AFCA 5LATA 2XKPA 4NR1A 1KGYA 5DAXA 5JOXA 3L2YA 2HEVF 3S5AA 2PFWA 3A22A 3CEWA 4NRPA 2O8OA 5HCBA 3T0BA 5DAVA 4C8DA 2XLGA 4QGLA 4A3ZA 4M3CB 3UT0A 4R8HA 5FQ0A 4LULA 5EWSA 1W28A 3NKTA 3BODA 1GZTA 2YDEA 5FY9A 5FZBA 2H6BA 3ZYFA 1S2KA 4ZZ8A 1E5HA 2BFUL 2D6OX 2WNUB 1Q8VA 3VDDA 3I49A 2WFF2 2XDVA 5IVEA 4CDQB 1H8TC 1OUXA 2IZWA 2A6YA 2MNGA 3AMNA 4D6RA 2RR11 1OHFA 1YJKA 2BJSA 5JAXA 5C3OA 4CE8A 4CYDA 1JN2P 3SITA 1BK0A 3WDVA 2VU9A 4CDXA 3I2OA 2Z42A 1M4WA 1NCQA 4ZONA 2XL7A 3E6BA 3KSCA 1W8HA 1VRBA 2Q0AA 5A1AA 3ROUA 5ANNA 3WG2A 4MXWB 5A6ZA 5FPVA 3V0BB 2AH2A 4DS0A 4B4PA 4C1WA 4AFAA 1ULGA 1ZRIA 3U07A 3JB8A 1LGBA 2BVVA 3D6EA 4XF1A 1LTEA 4A45A 1V6KA 4LBQA 2VCMA 4Q4V1 3AP5A 1Q5OA 4IE7A 1C3HA 2ET7A 2VBBA 2PLV3 3CL1A 5FRAA 4PLNA 1TMF2 1CIYA 1JOJA 1R091 2VCBA 2WNUC 1LHNA 4ONUA 4EN6B 5C6CA 5FUNA 3PIGA 3HT1A 4YRDA 3WG4A 1RGSA 3RJ2X 4TSVA 4GWIA 1FPN2 4FP3A 4ES9A 2QZ2A 2ZAHA 1BBT3 3O7OA 2B45X 3GBGA 4AYUA 3K75B 1W6PA 1W90A 1XNAA 1VP6A 1NYWA 2EXIA 5JXHA 4EWAA 3ZPOA 2D5HA 3R4SA 3TEZA 1X82A 4CDUC 3CZJA 1LHUA 5DABA 1PO22 2BQPA 2HH9A 2GNDA 5DUXA 3WNXA 4BA6A 1JS9A 2YC2A 1BEV2 1PZ7A 3QOPA 4XUOA 3AKPA 4QAWA 2DUQA 1W3VA 2RDNA 2PHUA 3ME2A 1JMUB 3BCWA 3ZVXA 4AI1A 2RS32 4AI3A 4EE2A 3MPPG 4LO7A 3FL7A 2CU5A 3FZ3A 4YLZA 3IZOA 5AC93 1LKNA 3BPSA 5JZGA 4RGGA 1SPPA 4AI9A 1G9DA 3ON7A 4LKFA 4UF0A 3R6SA 1VAMA 2JEMA 1FMD1 1YXWA 4QMAA 3THCA 2D5FA 1OKOA 1Q43A 1D0HA 4AEJA 2FHRA 3IWZA 1GWLA 2B7YA 1GOHA 1W6PB 4M00A 5FBZA 4NMIA 2IXIA 4HOOA 3QH6A 1ND3B 1KD7A 2RMU1 5FXWA 1YWKA 1R081 2Y33A 3OUJA 5FR3A 1STMA 2EIGA 5C8CC 3RZLA 4P9IA 1H1AA 1S0EA 1YYNA 4YVSC 3VD4A 1CZTA 4D94A 1MS1A 2QQPA 3E5XA 1AJKA 3WSOA 4XABA 1BZWA 3WP4A 4N90A 3VGIA 3T1MA 1RUD2 1U12A 4PT6A 3B7MA 2CYFA 1AYN2 2R6QA 4XFBA 4E4ZA 4YZ4A 4QPIC 2P3IA 3H1WA 3H42B 3DECA 4JKKA 1HQNA 2A5ZA 3NMBA 4WZFA 1LHVA 2OPWA 4N8MA 5IVCA 5FDBA 3EQEA 3LDRA 4LQRA 4XILA 3T4VA 2V72A 3ASIA 5H9SA 1EY2A 1F31A 2P6HA 1JZ8A 3GCXA 5GZFA 4FPGA 4L2NA 3FLTA 1GZWB 3FHIB 4NOTA 1A8MA 1W8WA 3VN4A 4U2AA 2QQKA 4RS5C 1VBC1 4JTOA 4QX0A 1BXHA 1PO12 1VBB2 4ARXA 3ZDSA 4CPBA 4IXLA 4LK6A 4N43B 3OTFA 2WNVB 4RHV1 2WABA 2YC0A 3NJZA 4QKDA 4BQ5A 1GYKA 1XYNA 4OHZA 4BK5A 2JE7A 1NX9A 3MI8A 3DUIA 5DXDA 5DN2A 3C7HA 3ZSEA 3VL9A 4LKEA 2MPFA 2YXSA 4QX8A 2WKKA 4K1ZA 1PO23 1H9PA 5IUQA 1Q8SA 2C9AA 1OA4A 1O8SA 3CJIA 3V65A 2XQXA 3HJRA 2P4EA 2GNTA 2VE1A 3HQUA 3HIFA 2ZS6B 3WHUA 2Y0OA 4P9GA 1PM7A 4QGNA 4EV0A 2HWD2 4YVSA 4LTAA 3GM8A 1TME2 1RL3A 1RUC2 2DDUA 2Y60A 4H3WA 2GP5A 2KA3A 4P9XA 5FO7B 3OY8A 4CEWA 3OD4A 1PX3A 3FLPA 3E97A 1N1SA 4LA3A 3W20A 4FFHA 4Q4W2 4CPBD 1QU0A 3LEIA 5CNAA 2RR13 1ZBE3 5I8SA 4HANA 4YFZA 2NYYA 4MX3A 5FYCA 5J36A 3IMNA 1X36A 2ZGTA 1HJFA 3K77A 1WD3A 1SBDA 3WUCA 4FP2A 3ACGA 4RHV3 1XXNA 4YGDA 5J3UA 2GZWA 3PJYA 2I07B 2Q1MA 4BQYA 2JENA 3JD71 2G9ZA 3LPFA 4BZ4A 4AW7A 5LK5A 1F8VA 2BWCA 3P3NA 1OBNA 2QFEA 1GNZA 1PO21 1YUDA 1O7FA 5IVYA 4BH9A 1EP0A 4XDPA 5BNNC 4Y5SA 3VBRB 1ZRFA 4K7JA 4RD7A 2RM21 4QWNA 3GGLA 4AR2A 4COVA 3TN93 4QKNA 1N3OA 1DZQA 2P3JA 1QEXA 2IFWA 3H1MA 4Y1VA 4YW7A 3AZXA 4Y4YA 2ETEA 4AEDA 3ZXKA 1GQGA 3UK9A 2DUPA 4AAXA 4XAEA 1RUG1 1R64A 1YFXA 3WR0A 1JHNA 4COZA 2Y6GA 3IMMA 4LOTA 1IG3A 1EAH1 2JG9C 1W2TA 1VMFA 3ZYBA 4D6QA 4CEYA 4IEPA 1PIV3 2JX9A 4JDOA 5KHGA 3VBHB 4H7LA 1EV11 3MUY1 2ARXA 2JB8A 1D4M3 1AZDA 2BTVC 3DYOA 2R1DA 3K4DA 3MLJA 2DVAA 2VOWA 2UU8A 5C4WC 4OZOA 3VHOA 3NAPA 3NV3A 2XL9A 2XJTA 5FZIA 3DYMA 4B1LA 2D40A 4JC1A 4QPYA 1GP6A 2YBKA 2JG8B 2W1SA 5F6LB 3T2QA 2V5YA 5DDJ2 4D7YA 1QXJA 1PZ9A 5KXBA 4XYXA 3JD72 5CISA 4ATFA 3ZYGA 3NNFA 4LEJA 3TN91 4J6GA 2QTWB 3M3CA 5LRSA 1QJX3 2VJXA 2DCKA 3AKTA 5FZKA 3BIWE 5FOJB 4Q26A 1J1TA 1NCRA 1JBCA 4LBMA 1E5IA 1DP0A 1WW5A 3B93A 2BGPA 5AVPA 1HRI1 1SG3A 3RMXA 2YZ4A 1OQDA 4Q4W1 3VBHA 3M3QA 1WMDA 4B3NA 1UZZA 1E57A 1REFA 1UU5A 1UZYA 1DQ0A 3VZLA 4EROA 5GM0A 2D6KA 3AM2A 1ASJ1 1W6OA 2DYCA 1RUC1 3BU7A 3WW1A 2EIDA 3CIHA 1NE4A 4NHLA 3VKLA 4Z82A 3H8OA 2HBUA 4QXHA 4AFBA 2WAOA 4MXVA 1WLDA 1ZZBA 1VJ2A 4L8QA 4LJHA 2X5IA 1UZWA 1XNKA 3LOBA 3BOPA 5JOYA 2XBO2 4BMBA 2Z69A 1YFUA 4C0BA 1C1FA 2DBIA 4FPLA 3BVCA 3TYJA 4OHXA 2X29A 2OUHA 3AZZA 5FY1A 1AR92 3SH4A 2CDPA 2V09A 2VOXA 2VXJA 3T1LA 3TRSB 1O5LA 2ZMNA 1I9RA 1K42A 1VRH1 2PHRA 1S4CA 2BW8A 3QACA 1X9PA 2GAUA 3ACHA 2UYAA 1N3QA 4GAZA 2ORXA 4BB3A 5F8PA 3CLPA 4AE2A 1PMHX 2D97A 5D8AC 2ZGPA 3TWIA 2CL2A 1H9WA 2WWSA 1GU3A 1XOYA 5FZOB 3SH3A 4ASMB 4BLJA 4DY3A 2WS92 3KGLA 2OZ6A 1DZTA 3PDQA 1ENQA 2VNRA 3FFQA 1DGWA 2W08A 1V0AA 4JHZA 5JUVA 5IATA 1ZYBA 1X8EA 5F2WA 4AOCA 5JR2A 2B5HA 4LO4B 5F3IA 2VQ0A 5FXVA 4M3CA 5AC91 4CDQC 4QU2A 1VIWB 1ZBA3 3POYA 4DUVA 5FTTC 1AYN1 1IHMA 1ZBE2 4NRQA 5BY5A 1S0IA 2DTWA 2GH8A 5FY8A 5IK5A 4IERA 3AFGA 1AJOA 3WQ7A 3MW4A 4AGRA 4YARA 1V6LA 3JZVA 1MS3A 4MG2A 5DQ0A 2HEWF 1NQDA 4I0WB 4A41A 4DMIA 5KXDA 2FMDA 2EAKA 4ZPIA 3LOIA 3NAPC 2WLQA 2XQRA 5FYMA 1R082 4CDXC 5ABJB 4FPCA 1W3XA 4WVZA 3AZVA 4HSLA 1LNSA 1ZRCA 4BXFA 2BGCA 1ZZ9A 2DUOA 3H8RA 5DAWA 3WX5A 4NIAA 4AL9A 3U75A 3O0VA 4CUBA 1Y3TA 2D6LX 2HBTA 3RZZA 4CTEA 2XJSA 4RN5A 2ZJCA 3C2UA 4GKXA 2VMGA 3DF0A 5A1LA 1WMEA 1JYTA 4FO9A 1HJGA 4JQTA 4OMCA 3VDDC 4Z07A 1E5RA 3H1YA 1C5HA 4GIQA 2RS53 1YQ8A 2OA2A 2E31A 2JDZA 5IW0A 3WUDA 5FOBB 3U0ZA 3VBOB 4C91A 1I6XA 1W6NB 1I5ZA 1XNDA 2R49A 4OHVA 2WBKA 4S2HA 3EMRA 2L9LA 3ZKUA 1W9TA 2E32A 1PNGA 1LU1A 2EAAA 2JIJA 3GYDA 4JRAA 2WT2A 1VR3A 1NA1A 1V9U2 2BZDA 3BOWA 2TBVA 5FZDA 3USUB 4V2WA 4BLIA 2HWC3 4FAHA 4Z8BA 4CXYA 1SCRA 3FJSA 3JQXA 5KHHA 4PI2A 3D3AA 3LGRA 4KU7A 4N9IA 4NRMA 4A4AA 1W0PA 3NNGA 1CAXB 3J26N 2J1EA 5I8TA 3ZYJB 1UAIA 5IWFA 5IJRA 3K4AA 1NZCA 1S2BA 4FFFA 4FBFA 3BTZA 3JU9A 3S0MA 4QXBA 1L7LA 4BM8A 3LAGA 4CCLA 4LLFA 4COWA 5C3QA 3MHZA 3FHQA 5DZGA 5G05L 2JG8A 2XHNA 2OIIA 1BVP1 4QQ2A 3PUSA 2PN5A 1RUJ3 4XQ4A 1EAH3 3KS7A 2DVFA 3AP9A 3KVAA 4FT8A 4XBNA 1C5IA 4XAAA 1AX1A 4J1XA 2YYOA 5FCCA 3RZMA 1QDCA 3AXEA 2J42A 4XFFA 1GZCA 1H1IA 4XF0A 3GJAA 4JCKA 1VRH2 1S0DA 4IGQA 4UAPA 3ZR5A 3L9JT 3TEXA 1PIV2 2ADDA 4CRQA 5FYBA 1C57A 4OUMA 5A6QA 2R073 1OLMA 4RSUA 5IVJA 1G9BA 2R0FA 2QQIA 2HWB2 2WYSA 4ITCA 2BPA2 2EXKA 1COV3 1CAVA 2C1FA 1LOCA 4FOWA 4BOWA 3W9AA 3E1F1 4Q1PA 1JYCA 1UMIA 2BBAA 2GP3A 3M2MA 2ZGNA 4XDOA 1AL22 1OA2A 2C5DA 2KXLA 1K5MA 4ZZ5A 2H0VA 1PM4A 1UYPA 3EHKA 4AGVA 1KFXL 2GMMA 3OPZA 1FAYA 1PGW2 3IIIA 4BHPA 4MOAA 1AR83 3NW4A 2RDRA 3IDEA 4CEYC 2B46X 5FREA 4I01A 3NV2A 5FZ4A 5FAXA 5KXEA 3PUIA 1ND2A 1UO9A 3DPRC 3VKFC 3D0JA 1J58A 1DZRA 3DEMA 4BU2A 2G4IA 2WA3A 2ZEWA 2WFPA 2ZX2A 1BEV3 1LOAA 2BNOA 1SHWB 5EFUA 5K8SA 3HQXA 5AFEA 3CF6E 1QJU2 2ZGKA 3MF9A 4UOJA 3ZFGB 1VBD1 5F1RA 3VD9A 5FZEA 3KB5A 1FNZA 2XJRA 5FZOA 2YFZA 3D82A 4K21A 1Z7S2 3MUZ1 1LU2A 2PHXA 2W3JA 1IQDC 4UI9L 1YC61 5L19A 1GP4A 1PIV1 3I3QA 1TG7A 4UT5A 2ORZA 1E5SA 4YW2A 5LBBA 3V0BA 3J7NA 3L2HA 4KGGA 3WW4A 3LIGA 4HBNA 1W2UA 2D3PA 2EVXA 4Q0QA 3RG0A 5F3GA 2Y34A 4ZY9A 4GH4A 5A3NA 5HCFA 4KH9A 4LT5A 3PNAA 4NAOA 3TB0A 3BALA 2PLV2 2PXJA 3SEEA 3VBFC 1RJ8A 4B8EA 3ENRA 2IVIB 4C0HA 1B35C 1ZBA2 1I3HA 4WVVA 5FP7A 2IWGB 4MH0E 5T52A 3HPNA 4K8RB 1X8MA 1EAH2 2D3RA 2OX0A 4LK7A 5C70A 1YFWA 4PJYA 4E4HA 2B9UA 5T5PA 1ULEA 3M70A 3TNPB 5LRRA 4KQ7A 4JX0A 4R4ZA 2HWC1 5FZ9A 3E5QA 1PK6B 4PF5A 5LA1A 4M3CF 2VVDA 4K1YA 2QVSB 2WNVA 4RA0A 5FMOS 4Z2WA 5GLWA 3PVEA 2DCJA 4GWJA 4MGYE 2JG8C 3PL0A 1W8UA 2B4KA 2VTXA 3MIBA 5J96B 4D6SA 1XE0A 3SXWA 1NCQB 3E6CC 2PHDA 3J4UH 5CKQA 4PDWC 1GBGA 2W52A 1J3PA 3IIAA 1S0FA 3H9AA 2EICA 1HKDA 1UKGA 4AI2A 2WYFA 1UU6A 2WFF3 3A0NA 4QX2A 3KCCA 4XF9A 3R4DB 5KHIA 4J25A 1MQTC 4YNIA 4IEWA 1OOPC 1XU1A 1KFUL 3KM5A 3PU3A 2VUCA 2JE8A 2JICA 1WLWA 2BERA 2YB7A 4Q4Y3 1GSLA 4C1XA 1G7YA 5JSOA 4W6XA 3RQ0A 1ASJ3 1HRV1 3H3ZA 4UFMA 2RS13 3MEPA 4S2DA 3MLLA 3B69A 1QOSA 3KWVA 4META 1LR5A 4RS5A 4QGMA 3K3OA 5J98B 4RFRB 5FZ1A 4WZCA 3IBMA 1JZ6A 2VGDA 2YPJA 3KZ4C 4XIKA 1EV13 1H2LA 2JG9B 5ERLA 1SACA 1JOPA 4KG0A 4NHMA 1BCXA 3GZUC 4PLMA 5EYXA 1G9AA 4KWUA 3FLRA 1SLTA 4IESA 4IETA 5L9RA 3VDBA 1GP5A 2E7TA 1SDWA 2R043 2R0HA 3V56A 3W5MA 4B4RA 3B9CA 2Q8OA 2ZGMA 3J7HA 5C3SA 1UKRA 4ZS2A 4R9BA 2QQJA 1ALYA 5ABJA 2P17A 1AYM3 1UXXX 4Y33A 3CNAA 2QQNA 3UGHA 1XPWA 3DPRA 1ZVFA 3AL6A 4WVMA 5CG9A 2YU2A 3D5OA 5EZWA 2JDUA 1AR81 2HWE3 2A3XA 1UIJA 1WCQA 4KWLA 4HMZA 1DLCA 1W2NA 4L11A 4X6RB 2FDFA 4PIXA 4E8CA 1XE8A 4TZDA 1DG6A 1SZBA 3T2PA 3WV6A 5E89A 3VKMA 3D4KA 4XJ8A 1KEXA 5I0DA 1KDKA 3PTRB 1RB8G 3DKQA 1JODA 2QQLA 2VH9A 1SBFA 2QDNA 4JGYC 3D0SA 4AFMA 5BYNA 5HBAA 1NCRB 4QQLA 1XYPA 1IS3A 1O3SA 1YLLA 2XLFA 4LXLA 1UYXA 5A7SA 4EZHA 4QPIA 2Y6KA 3KT1A 5JZGB 4GZ9A 4CCKA 1W8OA 3R05A 4NPLA 4UWDA 2R061 2W87A 5FJHA 3VBSA 4HL0A 1IPJA 1CONA 4YG3A 1UY1A 5AVAA 3O12A 2XVGA 5APAA 4JGZB 3RVHA 2IC1A 3ZOIA 1T2XA 1C8M3 1ZRRA 2W95A 1CAWA 1H1MA 3POBA 2JE9A 2TNFA 1OD5A 1AX2A 2W0XA 3VHRA 3WW2A 1OQ1A 4RYDA 4YGCA 1JW6A 5JOWA 2NM1A 4LHKA 3TAYA 4YFWA 3UNPA 2VOVA 1CX1A 1MS5A 2PYTA 3IB3A 5CKNA 2FCTA 2IVJA 3VZMA 1HV0A 4CP2A 1OI6A 1NY72 1OH3A 3OBTA 2RMU2 5FY7A 4DZGA 4LUMA 4XFGA 1H4HA 2JDKA 2GC1A 3N3HA 1D7PM 3C3VA 1QQP1 1QQP2 5BNOC 3T0AA 2CGNA 2WNUA 3VDDB 1HQLA 1HRI2 2AUYA 4B29A 3UETA 3B5LB 1GANA 3HR9A 4DFSA 1FMD2 3WDXA 4AHWA 2Q8DA 2J1UA 5EHDA 3BPZA 4YW5A 2K9ZA 5FZHA 2RG4A 1A6CA 2EXJA 3NKGA 3POIA 3HN3A 1K45A 3KV4A 4CDUA 5C8CB 2E6VA 1HX6A 3OGVA 2IXJA 5CA6A 4NHYA 4NUBA 3U37A 5LWBA 4Q8KA 2BVBA 4BE3A 1V6OA 3RI8A 4CCEA 5A33B 2D6MA 4GQ7A 3PTYA 3UKTA 4OHYA 2WNEA 3K51A 1IS6A 1U5IA 4P9LA 1RUNA 1GNYA 2FZ2A 1EUUA 2R1BA 4IV3A 5T5OA 1W9YA 2VMIA 2R062 2YHJA 4OHWA 5FK8A 3WXPA 4CXWA 5A3UA 4CDQA 4NHXA 2XJUA 1Y9QA 3AYEA 1RUJ1 3HAGA 2DF7A 3NNMA 2V73A 1J83A 1Q8QA 1QXPA 2WC2A 5EP9A 2YBSA 2YROA 2QBXA 3VV1A 3ZYRA 5CU1A 5IK7A 1R092 2D43A 1UWWA 3SLIA 4RQPA 1ND2C 2JDYA 1QIQA 1YNAA 3O14A 5L7OB 4IV1B 4RS5B 1ODNA 3RSJA 1R1A2 3FMGA 4Q0SA 1RUH2 2D98A 2XJQA 5T3NA 1N47A 4LIUA 4AK3A 2HWE1 2DFBA 3VDCA 3I2HA 2ET1A 5KXCA 4E9KA 1BMV1 3LB9A 1RMU3 3QLQA 4LKDA 4DPNA 2ZCWA 4BWOA 4GMP0 4P14A 4Y24A 1UIKA 4N53A 5BNQA 1QJZA 3JBG3 1ENRA 3O1VA 2D3SA 2RMU3 2VZOA 2ZGLA 4HT1T 4O65A 1POV0 2YU1A 3ITQA 3VBSC 3ZYHA 3C7OA 4XUNA 1AR71 4P9JA 3AMPA 4E8DA 1O3QA 4XMAA 5A3TA 2VQUA 2FMYA 1UY4A 5FYVA 5FZLA 4YZ5A 4XUTA 2A3YA 4LBLA 5C3RA 1DU3D 1PK6A 1RUI3 1LEMA 4UW5A 1LJ7A 3VZKA 3B02A 3AP7A 1OLME 3O0XA 3AZYA 4EN8B 5C7GA 1OQEA 1GMMA 4NVPA 1LHWA 2AGSA 3UV9A 3NSTA 4Y22A 5FPXA 1UOFA 4FI9A 3HBKA 1L3JA 1MQTB 5GZCA 1JI6A 4CCNA 2BNNA 2W91A 4X6QB 1OXCA 4NIIA 2WWUA 4AQ2A 2Q1FA 1Y4WA 4ARYA 2WSUA 3A21A 4ISQA 2CNAA 2VZPA 2WQZC 3AMQA 3AC0A 4I0BA 4K9SA 2HWD3 4QPGC 1J1LA 1QHDA 2OZJA 3WNPA 1ZZ7A 4ET7A 5FLJA 5LEKA 2D6PA 1JYIA 4I2OA 3RPQA 2AR6A 4E2SA 2A1XA 3LDBA 4Q4X3 2VOKA 4JGZA 3UGFA 5LB6A 4XJUA 2XG3A 1HXS2 4IEUA 2YPDA 3LD8A 4Y5TA 4XXAA 4RQPC 5F5IA 3CMGA 1PVC3 4FFGA 1N3PA 4MHUA 3H0OA 5GLUA 5T50A 4GULA 2ILMA 1RUE1 5CEHA 5A3LA 3PUQA 4RHV2 1U5ZA 1UQXA 3ZXAC 5A3OA 2X5IC 5GLTA 3TOJA 4W50A 4R52A 3WEZA 1A78A 3JD73 2E7AA 1SMVA 2C24A 2UWBA 3AL5A 4L97A 3VD3A 4ATEA 4E4SA 3PU8A 4P5HA 4WM8C 3KGZA 1QY4A 3O1SA 4PQ9A 2WZEA 4XQDA 4M0NA 4XQWA 1LAJA 3UL2A 1HB4A 1K5MB 3IDAA 1D2QA 1WCSA 1IZ3A 3GHNA 3VB9A 3WLUA 4GJZA 3R4UA 5IFPA 5A32A 4QB1A 2ZOEB 1NCQC 1US3A 4O61A 4PQQA 5FLHA 1MZ5A 2PAEA 5C4WB 3MDPA 1AR62 1SFYA 3RZGA 1O4YA 1W9WA 1WUVA 1Z7S3 1UD1A 3G6JB 4FOQA 4UFIA 2Q8CA 3ZFGC 4XJZA 4BQ2A 4IDZA 1NG0A 4XTPA 2CGPA 4RGKA 2E63A 4OI2A 1QWRA 2VOTA 1UMHA 1QJU3 3Q8EA 1JTZX 4O9GA 4EWEA 1RHI2 2ZHNA 2O0OA 3DV8A 5L9BA 3I59B 1PZ8A 3J8F1 2VTXJ 4AVAA 3MV11 4DEVA 2FZ1A 2R041 4XHBA 2CWSA 1O91A 3S57A 1F2NA 1RUE3 2X5IB 3MBWA 1S1AA 1RVF1 2CSGA 4L0PA 4FCAA 3IKWA 3KVBA 3BGAA 4PLOA 4LR4A 5FZFA 4LHSA 5A6XA 1K12A 4QU1A 4QPGA 2LS6A 5I0TA 3UJOA 1OF4A 5DZFA 1H2MA 2ZHKA 3VBFB 2XOMA 3JXSA 3IPVB 5IYYA 3OBRA 1SDDB 4QHBA 3ZN4A 5LW9A 3QH7A 2JDHA 4Q4X2 1D0GA 4Q4W3 1QNYA 5FK7A 1A8DA 1COV2 3PVOA 4QQPA 2JDMA 1TQ5A 1EYBA 1VB2A 5IK8A 2R072 1B35A 3EJKA 5LZ6A 2KR2A 1UF2C 1DF0A 1CN1A 5J37A 1PGL2 4JV4A 3O1MA 2J22A 2E9QA 3A23A 2JKXA 2LUWA 3R0RA 3ZXDA 2V4VA 4E2QA 2DCYA 3OUHA 3N9PA 3I4IA 5SV8A 4IEVA 4CP0A 3ALQA 2W68A 1QKQA 2XBO3 3GALA 4LITA 4YZ3A 4YVWA 5FBJA 2BNMA 2QUOA 3ST7A 4I09A 1X7NA 5FKBA 1NCRC 1AR93 1OURA 2RS11 3O1RA 3VBUB 1ZX5A 2DVDA 2E7QA 1D4M1 2D93A 5K4LA 3UESA 3ZDVA 4YW3A 1W0NA 4NIDA 4OULA 2EA7A 2Q1ZB 3KV5A 2AACA 1YIPA 3PMSA 4YW1A 2FBEA 1JHJA 3CJIC 5FYIA 5A7PA 1O4ZA 3J7LA 3SNMA 3CJXA 3ZR6A 4HPKA 2FDGA 3CKHA 1QJX1 5LY1A 2W2IA 1XE7A 3WW3A 2XPJA 3T09A 3N35A 1OMIA 3CBNA 3IAQA 3SQOA 4RR3A 1CQ9A 1DLLA 5GLVA 2VVEA 4K3UA 4UBGA 2CAUA 2WZR2 5JIUA 2ARAA 1JZ5A 5L7OC 3MFAA 1DYOA 5E16A 4KWKA 1G8WA 1KQRA 2Y64A 5D2AA 3W21A 1SEFA 1X50A 3W58A 3M4FA 5IVFA 3KHCA 1HN1A 2IXKA 3LKJA 3NO8A 3OGRA 4QXKA 4YVSB 1H8TA 2ZGOA 3VZJA 3WNKA 1RXGA 2JDPA 1V9U3 4GKYA 4Q0PA 1MVEA 5CKMA 4NJ4A 1R1A3 2YGMA 3I3MA 1IPSA 4CEWB 3VUOA 1JXNA 5BNOB 2P3YA 4WVMB 4B4QA 1XSQA 4TLGA 4LHNA 4QKFA 5JLVA 2FD8A 5BUVA 3URFA 4AQ6A 1ZM1A 3I2GA 1W6QA 4LA2A 4KNCA 2PAMA 4XJWA 3B94A 1JOBA 4WV8A 4KL1A 4EQVA 1ZRDA 1W6NA 3NJYA 1S0GA 1TME1 3ZX7A 1UMZA 3PUHA 4UYBA 2HWD1 1B09A 1GKBA 4N7UA 1DYKA 3AXDA 3T3YA 2VZ3A 4MGZE 3WG3A 4CP9B 1UN1A 2HJIA 3E5UA 3VD5A 4AEDC 3RYKA 4SLIA 1JU3A 1RUD3 5LBFA 2SBAA 1FYUA 3ZSMA 2P2KA 2VG9A 2PHLA 2PAKA 4TXWA 2VW2A 3O5SA 4N43C 5C5UA 3BUCA 2W5FA 1CZVA 4H2AA 3OBZA 2HKXA 4Q29A 4ZKTB 2YV8A 4HZFA 2WINB 1XYOA 4LO8A 1X9TA 4FPOB 1CESA 5EXOA 4HK8A 2BEOA 4F7ZA 3WNNA 3WZ1A 3WVJA 1W8ZA 1GICA 1NUKA 1ZZ8A 3ZXGA 2WR9A 2QQUA 2ID4A 1LOGA 2XVKA 4P9WA 3OEAA 5CFDA 5ACA3 1UZ0A 3C8XA 2WS91 3AJZA 2VMFA 4XMIA 3ZMOA 2VECA 1S0JA 1PO13 3JBG1 2HYKA 4IEQA 5CYYA 3U78A 2WO3A 2IUWA 3LA2A 5FIXA 3WDUA 4WVWA 5FXZA 2W1QA 2P37A 2PMWB 1ST8A 2VC9A 3I3BA 1JYXA 5F5CA 2YGLA 4DINB 5CB7A 2RS33 2R32A 2QZ3A 1R093 1I1EA 4YW6A 5FZ8A 5JMCA 3QD6A 3KV9A 4XPVA 4NHKA 5BPXA 3RGBA 1WW7A 3CDZB 5F9TA 3AFKA 1RUD1 5J48A 1GOFA 3W59A 2DURA 3WCRA 4XFCA 3GBFA 1DQ2A 1MS8A 2OS2A 5CAZA 1OD3A 3GCWA 3VBOA 3FX3A 1NT0A 5LBEA 3USSA 3HOBA 1XU2A 2YMZA 2Y0IA 4LO6B 5BXXA 2A73B 2GH2A 3LFIA 5C8CA 4XDQA 2WT1A 1ASJ2 4NIHA 4JGYA 3FWEA 1LULA 1QJY3 3LSDA 4Q5OA 4BCUA 3WQ0A 3VBRC 3T08A 2NQYA 4D3WA 4A44A 4Y22B 2LRPA 2XKOA 2JJ6A 4WM8A 2R071 1GFF2 2VZ1A 4LE3A 5FY0A 2HWF3 2ZEXA 2JD4A 2XXZA 1OVSA 1IGOA 1ND2B 4PI0A 2CY6A 2W9XA 4CUAA 2RS31 4EN7B 3TN92 3AVRA 2IXHA 1YJLA 4QDRA 1LENA 1W8TA 3AJYA 4A7YA 2RS52 2G9FA 4LBJA 1OH4A 1SBEA 4AEMA 2QNKA 5JDBA 1UPSA 4IGPA 3HVDA 2FDHA 1QJFA 1VLNA 2BDRA 5T54A 1HDKA 2LROA 3PVBB 2VW1A 4XVHA 5FQ0B 5DZEA 3ZXEA 3BTAA 4KMQA 1JUIA 4JRLA 5FYSA 2CAVA 1FPN1 1HXS3 3I7DA 4D7SA 3BI3A 1OUSA 1R1ZA 2Y6HA 1F4AA 3N9MA 1TMF3 4GXLA 5A70A 1S0CA 4WM8B 5FZMA 4FSJA 3SMHA 2HLEA 5A1FA 4K40A 2PTMA 4ES8A 3N4MA 4OI0A 5EQUA 4KBBA 2OUJA 1B35B 2CHHA 3LFMA 2QQMA 2WO7A 4JDNA 1AYM1 4FVVA 4CXXA 4R9CA 4AEKA 4MXWA 4HKLA 3T2OA 1F15A 2EIEA 3I2FA 2UYBA 1MR5A 1O6UA 2OQ6A 1XC6A 5GKAC 3VBUC 4E4DX 3T4HB 1PK6C 3VBFA 4ORFA 5EYYA 2ENRA 5TSWA 1OA3A 1BBT1 3SEPA 2Z4FA 3CJIB 3ZKYA 5HPOA 5GZEA 2K46A 2ZX1A 4M01A 1CPMA 1GQPA 3M3EA 5HCHA 1Q56A 4B7KA 4BQ4A 4N53C 1QJY2 1RVF3 1I5PA 2WS93 5KC6A 3D8CA 4IL7A 2O8QA 3I59A 1M06G 2WQ4A 3QCWA 2ZZQA 1TEIA 1RUE2 5FO9B 1LHOA 5FP3A 2DFCA 3O1OA 3MYXA 5FPZA 3O0WA 1G86A 4XBLA 4AAPA 4CU8A 4OQ8A 1QNWA 4MGQA 2JG9A 3DKWA 1PVC2 5A80A 1OF3A 1VBE2 2BWAA 1WCKA 3LEKA 4G9SB 1CX4A 3VBHC 5CFDB 1G9CA 3UYJA 3OGGA 4AVSA 1NZIA 3IT8A 4YM0A 4NAMA 5FZ7A 5J7MA 4KWJA 1AXKA 2E33A 4BXSV 2XONA 3IAPA 1KITA 2XWBB 2I45A 2VW0A 1R083 1ULPA 2NZ9A 2VZTA 3ZFEC 4RR3C 1BYHA 4P5YA 4DRRA 1OSGA 2ZBJA 2ZMLA 3POFA 3VBRA 3WD5A 4URAA 4LBQD 5BNOA 1U5XA 4X8PA 1V6NA 4DNYA 5EPAA 1RUF2 3H50A 5CADA 3NJVA 2A6WA 5I93A 5J1XA 1DGRN 1FX5A 3VDAA 5F3CA 1W6QB 5G04L 2BOIA 3ABZA 3ORJA 1Y7BA 4D8MA 5C4WA 5LK7B 2JDNA 1RUI2 4IE0A 3SISA 5BNNB 5DAQA 3T2TA 3HWJA 3ZM8A 2R16A 3OPTA 3B01A 3ECQA 5K7PA 2VULA 1PO11 1VBB1 3TEWA 2HEYF 1W99A 5KR7A 5FPUA 4QPIB 3PMEA 1W6MB 4CDWC 4NN0A 2RDSA 1POV3 2XUEA 2VO5A 3U4SA 5CFDC 3UJQA 3ZYPA 4KG8A 3NAPB 2W46A 1TNRA 4YWAA 5BNPC 4M3CE 2RVAA 1X33A 2HWE2 1WW4A 4OVEA 4XF4A 2WJSA 4DUXA 4LO5B 5ACA2 1R1A1 3K2OA 4J1WA 1JYWA 4RR3B 1CIWA 3GJBA 3VBOC 1RUG3 3NV1A 5C33A 3GNEA 3S5QA 1BJQA 4MO3M 4XE9A 1IS5A 1VALA 3HD8B 5JOZA 1F35A 2JECA 4TN7A 1IQAA 3GDBA 4I0AA 1BKZA 4FXGB 2GN7A 3GZTB 1ZZ6A 3FE5A 4YW4A 1RUJ2 5IK4A 4YYOA 1GZ9A 4LE4A 3LPGA 1WD4A 4TLFA 1ZNPA 2VMCA 1VBD3 3WOGA 1UZVA 4UFKA 5F3EA 3EXUA 5I8YA 4XURA 1G9FA 3FUOA 4GMP1 5A7NA 3RZHA 4EJRA 2ZA9A 5HV0A 1F5JA 4YG0A 4BPZA 2UWAA 4CU6A 4H7MA 4NWVA 2O1QA 4I3GA 1J3QA 2LTNA 4AG4A 1XQNA 5GZDA 4M4PA 5BNPA 4Z1VA 3EB7A 1LGCA 5L73A 2BUKA 3U11A 2I74A 2A75A 2Q4SA 2RE9A 2O14A 3WCSA 3KT4A 1V00A 2FDJA 4DEQA 3GBWA 2OKXA 1LOBA 1WLCA 4XFIA 5FWJA 2PQSA 3ZFGA 3S6PA 2PELA 5JI9A 2WZR3 3O1TA 2A70A 1GLHA 4W65A 1DGLA 1QQP3 1GR3A 2OYZA 4DXRA 2C9KA 1XNTA 2EALA 5A32B 3UKNA 1JZ3A 3ZMNA 2WT0A 5C5TA 1CAWB 4Z92B 1UX6A 1EPZA 2DCZA 3LZZA 2PHTA 4A6SA 1YQCA 4NPMA 4N9HA 4UFJA 4QX5A 1OFNA 1W0OA 2WL1A 3NNJA 4IV3B 5B4NA 5IAXA 3JCIA 3RYRA 2VZQA 4BMEA 5JXIA 1LOEA 1VBA1 1GZWA 5D21A 3ZO0B 5F37A 2QQVA 3IDBB 5L7OA 4ZXEA 5LCWL 4LPLA 3NNLA 1TMF1 4S2GA 1O3RA 3T0DA 4Y1XA 5D8AB 3GHMA 4AVBA 2W39A 3FC0A 1IG0A 4PF1A 4IW3A 4QT6A 4FQZA 1D2SA 3AK0A 5F5QA 5EJZB 1A3KA 2A3WA 3A4UA 2E53A 4L9BA 5JXGA 2A7AA 5DMYA 3MZHA 4GA9A 3HNBM 1JYNA 5H9RA 5FWEA 4X8NA 2VUAA 3WF2A 1PMJX 2BGOA 2VCCA 4RFT0 2P1BA 1RIRA 1SLCA 4L99A 2WZ8A 4UBHA 2Y8KA 2YFUA 1FV2A 4ZU7A 1CWPA 2VVFA 2ZTNA 3AX4A 4AEDB 5FKCA 3FFZA 2AEZA 5DPNA 4CUCA 2JXAA 3W5NA 1VB4A 2ZEZA 2VR4A 2F4PA 2KM2A 5DG2A 4DUWA 2YUEA 5HV4A 1SFPA 2WIIB 2CGOA 2YC4A 2LW8A 3I3EA 4Z2AA 2WSVA 3ETQA 2H0BA 3AVSA 4I30A 1AXZA 4WM7C 4XOGA 5SV5A 4HVOA 4K6BA 3N7JA 4BISA 5GJ6A 4QKBA 3PVNA 1RUF1 3J7MA 4AI8A 1CJPA 3RZJA 1MACA 5F5AA 2ZKLA 4KU8A 3U1XA 4MGSA 2RV9A 1RUOA 3WDWA 4OCTA 3H7YA 3DGTA 1DFQA 4R9DA 2IFRA 4IUGA 3RWNA 3AP6A 1QOOA 2AENA 1C4RA 4QD2A 3Q9OA 3I2DA 4QQHA 3ZSKA 3OYWA 1TVGA 2MEV2 2WNVC 2ZEYA 4YGEA 4AVCA 1NA1B 4BIFA 1C8NA 5CBLA 5FPBA 4TTGA 4XUPA 4IE5A 3OY8B 1WCUA 2J1SA 5FZ6A 3WHTA 3ZFEA 4UW6A 4QDQA 3ZSJA 4IEYA 4B7EA 5E88A 1RYYA 4HONA 4IQPA 3POGA 4LBNA 1CGPA 1QH7A 3QBQA 2J7MA 4Q4Y2 3ZXJA 5JWPA 3GZEA 4PCRA 1OVPA 3P6BA 4HSJA 4MSVA 2VCAA 4WM7B 1NLRA 4BQWA 4OUSA 3EO6A 4GB31 4QX3A 1QJY1 2A71A 5CIRA 4MGKE 5ANQA 4CCDA 4G3YC 5FZGA 4OI4A 3VZNA 1ODMA 4PDWB 1H4GA 3OYWB 1GUIA 2X05A 2Y26A 5FZCA 3AYDA 4EN9B 5K0UB 3M7AA 1FOD2 1Y43B 1DGRA 1ZREA 3X29B 1C1LA 2HWF1 5E1RA 5A7WA 3SCGA 4DXTA 1POV1 3OEBA 1RMU1 1DQ4A 1YI7A 4EN0A 4LUKA 2LM3A 4FPYA 3LA3A 4KI5M 4YM1A 4YSFA 1G6NA 2ZX4A 1HRI3 2QKDA 1XBFA 5L36A 1K5MC 1AYM2 3KMHA 2GC0A 2WNOA 1KS5A 1K3IA 4LBKA 3MFCA 5FMDA 3OOXA 3B00A 4N53B 2VBPA 2QQOA 1TNFA 2IXLA 1W39A 2B39A 1MEC2 3PHMA 5I0RA 3ACLA 1QOTA 1ZBA1 4N43A 3ELNA 1T6GC 2RS12 4W8JA 3OGSA 5HI0A 4P02B 1JZ4A 3UGGA 1NAEA 3S7IA 4LLOA 3LEMA 2EXHA 5JR7B 4Y3OA 5JXJA 3AMHA 1ONAA 4D0QA 1BHGA 1K5JA 2PA7A 4W6YA 2XB6C 3WG1A 1H6XA 5FZ0A 5JMOA 3KCXA 3AMMA 1YCIA 3MO4A 3S30A 1C8M2 3GF6A 3NQHA 4M0HA 5FV3A 2BFUS 4W6WA 2VNGA 4P9YA 1CAUB 1Z7S1 4MLOA 3BN6A 4NO4A 3ES1A 2Y6FA 3KT7A 1VBC3 4HG6B 1HV1A 4A7ZA 3IPVA 3BKZA 4I02A 1COV1 1W03A 3ILFA 4Q27A 4Y4RA 1YHFA 3N9QA 2OW4A 1XSRA 5F39A 5FP4A 4Q4X1 2J1RA 1W8FA 2WA4A 1YEWA 4XZUG 4A42A 4GH4C 1VBB3 3ZIXA 3HQRA 2PHFA 3KD4A 2V5DA 1H2NA 1ZA7A 2A6VA 2VNVA 3LWCA 1UCXA 2DV9A 2OPKA 5CFCB 2CDOA 1JZ7A 3FHAA 1RUF3 5BV6A 1JUHA 1CAUA 1WA6X 1YQ6A 5LA0A 1IS4A 1H6YA 1ND3A 1RVF2 1XRUA 4UXAA 1GQHA 1AX0A 1W6OB 1WW6A 2GC3A 2XH6A 3SHRA 3V0AA 1FATA 4AQTA 2VZRA 1Q3EA 1FOD3 2Q5TA 4Q4V3 3J8F2 3RRDA 2XHKA 3F2ZA 3FN9A 4UFHA 4AWDA 4HKWA 4DB5A 4QX7A 5T5LA 3SCFA 2HWB1 3WF0A 4HFSA 1WKYA 1XNCA 4NROA 4D69A 4BYYA 1DHKB 2DVGA 1RXFA 3ZSLA 3WT3A 1AR73 1YFYA 3LSEA 2YBPA 3OBAA 4IV3C 4P08A 1EUTA 5E6HA 1NLSA 3LIHA 3O1PA 3RZKA 1VE0A 2XGXA 4XHXA 2A6XA 5A3WA 1QJEA 1QXRA 1EPWA 5B2GB 1MPXA 1WGPA 3DXTA 3Q8AA 1BK1A 4QM8A 3MV01 4IE4A 4NE9A 1LESA 3CHXA 1CZSA 4CDXB 5ABJC 4XETA 5CFCC 4YPJA 3ZFFB 5E8AA 3WINE 1FXZA 4H14A 3HEIA 4LBQB 4DRVA 2AZ5A 2DTYA 3WP6A 5LEJA 2I2SA 4URTA 2ZZJA 1VBA2 2Z2SB 3OUIA 4C90A 2ZHMA 1L7QA 1ZZCA 5FYYA 5EV7A 3MIGA 4CVUA 4PBPA 2QJVA 4N7IA 4ZU4A 3RDIA 2WLPA 2UWCA 1FMD3 2CTVA 3MIHA 3SKVA 5CG8A 2AC1A 4YGBA 3OGJA 4JGYB 3MF6A 4L92A 5A3PA 5JCTA 4HVQA 1AR82 1O4TA 1SQ4A 1REDA 3H3LA 1YIFA 3OPWA 4WM7A 3AKRA 2NN8A 4QB6A 4ASKA 3PJQA 5C9AA 3DYPA 4FPKA 1DGWX 3AP4A 3KF3A 4QDSA 4CDWB 3UKVA 4M4RA 4Y5Z0 1MQTA 1AUYA 3VBUA 2QDRA 3ES4A 3NRUA 2JWPA 3M3OA 1UL9A 4AHXA 3ZLIA 4XTMA 3DCQA 4JQRA 2DWRA 4QB2A 4LOSA 4YZ1A 1UOJA 2GNBA 1CR7A 3THDA 1BVVA 1KJRA 3DPRB 4YM3A 1XNBA 4IGOA 1C8M1 1DYPA 2R30A 5D1IA 3DN7A 1LB2A 5ISLA 1D4VB 4GALA 1CVNA 1OC1A 3SH5A 3THTA 2WAAA 3E6DA 2W1WA 3WF3A 1OT5A 1NQJA 4XFHA 1H0BA 1W04A 2BYVE 5F32A 1TE1B 1KJLA 1W2OA 1H2KA 3KQRA 2P6CA 3I2JA 1P8JA 1XB9A 2RDQA 1AR72 1REEA 4ASLA 2FDKA 4XC9A 1BQPA 4AVVA 1J84A 4DXSA 2DCTA 4JKMA 4O7XA 2WUHA 2QQWA 2P5BA 2AYHA 2WQ8A 3FUQA 4XUQA 4MYEA 4QHZA 3USUA 3A0KA 1NXD1 1SLAA 1WLTA 1W6MA 3MIEA 3MW2A 4IV1A 2ZMKA 1RUH3 4IE6A 4AQSA 4AXOA 1POQA 2TEPA 4GWNA 1ULFA 3WF1A 5ACA1 2VM9A 3VHPA 1QJX2 5GALA 4LORA 3RS6A 3BTXA 3OB8A 3N9OA 2GSYA 1V70A 3NJXA 4JDMA 2HWC2 4ZU5A 4V1PA 4EZ4A 1WBLA 2GN3A 2NLRA 2DVBA 2TUNA 5FP8A 1HIXA 4B1MA 1FOD1 3K48A 3C7FA 1AF9A 1D4M2 3WDYA 2FDIA 1N1VA 5CVRA 3NVCA 4Y20A 4I3PA 2C26A 3RNSA 4CEYB 3KHBA 5C9AC 1WA4A 5KBFA 1Y9GA 5I91A 3ATGA 3WQBA 5KHKA 2XJPA 4QPGB 2Z5WA 5FPAA 4R9AA 4XXPA 1OPOA 2JDAA 3AYAA 4AGGA 4NPRA 3KQ4B 5IHRA 3ZN6B 1MS0A 5DUWA 3CQOA 4A3XA 3LE0A 4QM9A 1Q8OA 3CO2A 5A7OA 4XZPA 1AR63 4CU9A 1WZXA 4IV1C 4XJ9A 4XJAA 3ZPYA 2GU9A 2JKBA 4A6OA 4YZ2A 5I0SA 3LDKA 2XBO1 3WP3A 3AYCA 3N7KA 4FOVA 4YVWC 4H55A 2ARBA 2ZXQA 5FZ3A 2NMNA 1ENSA 4P00B 1OPMA 2UY9A 2MEV3 2ZX3A 4AZZA 3NV4A 4CSWA 4DXZA 4FTSA 4BQ1A 1JZ2A 2GC2A 5FPLA 1YI9A 3ILNA 1SCSA 3LQCA 1UOBA 4JKLA 3HMYA 3MICA 1VBE1 2ZABA 4O9EA 1N1YA 2WN3A 4HLTA 1YO8A 1DBNA 2F17A 5JSPA 1AL23 2GALA 4GB33 1NY71 3JUUA 5JIAA 3I3DA 1Y9MA 2XWJB 4QX1A 4CZSA 4DY5A 1W9FA 3IN9A 3VHNA
chains in the Genus database with same CATH topology
1VAKA 2GMPA 1QMJA 5JVVA 4XEZA 1RINA 3B9IA 5DDJ1 4IEXA 4F3JA 1IPKA 2A6ZA 1AR61 3V64A 1H30A 5KC5A 1SLIA 4FQ4A 4HKOA 1IOAA 3VLBB 4FPEA 3APBA 3NL1A 1DQ6A 1QH6A 2RJKA 1FNYA 1OOPB 1PMIA 4Q2FA 3SCHA 2NMOA 4E27A 4A2UA 4COUA 1NA1C 2XLAA 1RC6A 5DUUA 1VBE3 4Q0VA 1MVQA 4JTNA 5JI7A 4R4XA 1V6JA 4FPJA 1APNA 1SLLA 3CU7A 3M3IA 4PIYA 3RMYA 1AXYA 3THPA 4Q8LA 3VBSB 4ZXKA 4PBOA 1F5FA 1SLBA 4AVTA 3N7MA 3H3UA 4HVRA 5EJ3A 5H9PA 3OCPA 4E2GA 3IM0A 4HN1A 5JPMB 2CWMA 1RJ7A 3HN1A 3AKSA 3POSA 4NWWA 3M1HA 4MVTA 1GNHA 5K0UA 2AREA 3TNQA 1C28A 2VY0A 4FOYA 1URXA 3OF1A 1LODA 3J9SA 4AHYA 4SBVA 4KGQA 3N7LA 3VKOA 1AYN3 1DDLA 4YG6A 4GWMA 2Q30A 2ZACA 2ES3A 4Y1ZA 5BNNA 4JVAA 1HRV2 1LOFA 3VZOA 4FTEA 1JH5A 3OJBA 4AF9A 3U4XA 4Y20B 5JPNB 3INAA 5JZGC 4CDUB 1ULDA 3J8F3 1MEC3 1IKPA 1VRH3 3DL3A 4LNVA 2QE3A 2N7GA 4JGZC 4RGAA 2VUJA 4PDWA 1MZEA 4K20A 1BMV2 1ZA4A 5H9QA 3WY6A 4MZUA 2BBVA 1V6IA 5AC92 5BNPB 1RUH1 3ZFFC 1QGLA 4Q0UA 4Y1UA 2E51A 2WZPP 2VMHA 2HWF2 1Z0HA 4YM2A 4CDWA 3G7DA 1VBC2 4AI0A 4TYSA 3JBG2 2ZHLA 4GH4B 4D7TA 2FQPA 4EWDA 2ZPXA 4INDA 1H8VA 2PLV1 1S55A 1IKQA 3N36A 3S7EA 1NOVA 1DQ5A 3EBRA 1RUI1 4HK9A 5I0UA 2VXRA 1N1TA 4HPKB 1MS4A 2ERFA 4RL7A 2HWB3 1O3TA 1CD3G 5AFBA 5GZGA 1J59A 1O5UA 4CP1A 4DOUA 1AR91 1CPNA 1WBFA 5FLIA 1UW8A 4U36A 3POWA 1S0BA 2G9GA 5T5JA 1VBD2 5F6KA 4UW3A 2MEV1 1QJU1 1PGSA 3MIFA 4F8AA 3V0AB 1RHI3 4BIOA 4XFAA 1OLQA 1H8TB 4Y26A 2LALA 5T55A 2UY8A 2GNMA 3U10A 3WQ1A 1CJDA 4IEOA 2VQAA 3ILRA 4YVWB 3I54A 4AHZA 1PVC1 1PGW1 3ZN5A 4ISRA 1OKQA 2OVUA 1VAVA 1Z78A 3OD0A 1ND3C 1AL21 3FBMA 1DIWA 3MW3A 4S2FA 4FPHA 3B3QE 2C0ZA 2RHPA 2D7FA 1OOPA 2X53S 4OZXA 3ZFFA 5D8AA 1HW5A 4XIOA 1SFNA 3AB0A 1KS4A 1BEV1 4RQPB 2P3KA 2ZX0A 3JB4C 1PNFA 5A3MA 2WZR1 1BBT2 2ZKNA 2PQQA 5DDJ3 2YY1A 4FXKB 5A33A 4MGIE 2Y38A 2ZGSA 1KRIA 4XW3A 4QQOA 2XUMA 1TME3 1MZFA 1Q8PA 4MUVA 1EV12 4JAAA 2F6BA 4LBOA 1LEDA 4WBBA 2RJLA 5DUVA 3RI9A 1FT9A 4FTBA 3JQWA 4UW4A 5C9AB 3GZAA 2PHWA 3WDTA 5HXVA 1FI2A 1RUG2 1AVBA 1DQ1A 1OLRA 2P34A 4Q4V2 1RTVA 1U5YA 1CAXA 2D6NA 4FAGA 5K9YA 2XVLA 2RM22 2NPIA 3KLSA 4HN0A 3TBDA 3ZIWA 4XBQA 1AHSA 5FFOC 4CEWC 1PGL1 1V9U1 1CAVB 1PHMA 2RS51 5JSRA 5KWRA 4G4FA 1UU4A 1OFSA 4LHLA 3RJRA 2K2SA 2ZGQA 1FV3A 2B42B 4PIZA 3HT2A 2ZAAA 1LRHA 4F83A 3ZXLA 3RYPA 1WMFA 2RR12 1VBA3 4IEZA 2UURA 1J3RA 3LCPA 1U0AA 1NXMA 2WFF1 5C8WA 3MIDA 5CFCA 5GLZA 1AL0G 3LA7A 1LGNA 3BB6A 2XJVA 2VPVA 3ZYIB 1LECA 1LOFC 1GV9A 2R042 1ENXA 2K0GA 2GMEA 1RHI1 1QDOA 2DU0A 1MEC1 1HRV3 1LCLA 2IXCA 3PLQA 5FO8B 3MLKA 1F9KA 3ZN6A 1ZBE1 1WCDJ 3MGUA 3IDCB 4DQAA 5K0UC 3NWKA 2ZGRA 2GDFA 1QF3A 3WP5A 1HLCA 2MHFA 1PVXA 1YRZA 1RMU2 4GMP3 1NE6A 2B8MA 2CV6A 4MV2A 3AZWA 5IT6A 1MZ6A 1V6MA 2SLIA 1HQWA 4Q1RA 3HBZA 4OFGA 4Y1YA 3FBYA 2RM23 1KXGA 4GB32 3M8LA 1RUC3 4XF3A 2QCSB 2ATFA 3H7JA 2DU1A 4HETA 5DG1A 4Q4Y1 4A7KA 3H8UA 3ZFEB 3VL8A 4OLLA 3VKNA 4FPFA 3KCYA 2VNOA 2EF6A 3AKQA 2ZGUA 2Z79A 1FPN3 1HXS1 4OI1A 1KDMA 3ZXFA 3MPBA 2R063 5J09A 4K8FA 2D44A 5FMOL 4AFDA 1MS9A 4TWTA 2NP0A 2X8KA 5HCAA 2H6CA 3I8TA 3P3PA 1UPIA 1ULCA 1RITA 5KHJA 4AFCA 2XKPA 4NR1A 5JOXA 3L2YA 2HEVF 2PFWA 3CEWA 2O8OA 5HCBA 2XLGA 4QGLA 4M3CB 4R8HA 5FQ0A 4LULA 5EWSA 3NKTA 3BODA 2YDEA 2H6BA 1S2KA 2BFUL 2D6OX 2WNUB 1Q8VA 3VDDA 2WFF2 4CDQB 1H8TC 2MNGA 2IZWA 2A6YA 3AMNA 2RR11 1OHFA 1YJKA 5JAXA 4CYDA 1JN2P 3SITA 4CDXA 3WDVA 2VU9A 2Z42A 1M4WA 1NCQA 2XL7A 3E6BA 3KSCA 2Q0AA 3ROUA 3WG2A 4MXWB 3V0BB 2AH2A 4DS0A 4B4PA 4C1WA 4AFAA 1ULGA 3U07A 3JB8A 1LGBA 2BVVA 3D6EA 4XF1A 1LTEA 1V6KA 4LBQA 4Q4V1 3AP5A 1Q5OA 1C3HA 2ET7A 2PLV3 3CL1A 5FRAA 4PLNA 1TMF2 1JOJA 1R091 4ONUA 2WNUC 1LHNA 4EN6B 5C6CA 3WG4A 4YRDA 3HT1A 1RGSA 3RJ2X 4TSVA 1FPN2 4FP3A 4ES9A 2QZ2A 2ZAHA 1BBT3 3O7OA 2B45X 3GBGA 4AYUA 1W6PA 1VP6A 1NYWA 2EXIA 4EWAA 2D5HA 3R4SA 1X82A 4CDUC 1LHUA 1PO22 2BQPA 3WNXA 2GNDA 5DUXA 4BA6A 1BEV2 1PZ7A 3QOPA 3AKPA 2DUQA 3ME2A 4AI1A 2PHUA 4AI3A 3E6CC 3BCWA 3ZVXA 2RS32 3MPPG 4LO7A 3FZ3A 4YLZA 5JZGA 5AC93 1LKNA 4RGGA 1G9DA 3R6SA 1VAMA 2JEMA 1FMD1 1YXWA 4QMAA 2D5FA 1Q43A 1D0HA 4AEJA 2FHRA 3IWZA 2B7YA 4M00A 1W6PB 5FBZA 2IXIA 3QH6A 1ND3B 1KD7A 2RMU1 1YWKA 1R081 2EIGA 5C8CC 4P9IA 1H1AA 1S0EA 1YYNA 4YVSC 4D94A 1MS1A 2QQPA 3E5XA 1AJKA 1BZWA 3WP4A 4N90A 3VGIA 3T1MA 1RUD2 1U12A 3B7MA 2CYFA 1AYN2 2R6QA 4XFBA 4E4ZA 4YZ4A 4QPIC 2P3IA 3H1WA 1HQNA 2A5ZA 4WZFA 1LHVA 5FDBA 3EQEA 4XILA 3ASIA 5H9SA 1EY2A 1F31A 5GZFA 4FPGA 4L2NA 3FLTA 1GZWB 3FHIB 4NOTA 1A8MA 3VN4A 4U2AA 4RS5C 1VBC1 4JTOA 1BXHA 1PO12 1VBB2 3ZDSA 4IXLA 4N43B 3OTFA 2WNVB 4RHV1 2YC0A 3NJZA 1GYKA 1XYNA 4OHZA 2JE7A 3MI8A 3DUIA 5DXDA 3ZSEA 3VL9A 2MPFA 2YXSA 2WKKA 4K1ZA 1PO23 1H9PA 5IUQA 1Q8SA 2C9AA 1OA4A 3CJIA 3V65A 2GNTA 3HIFA 2ZS6B 3WHUA 2Y0OA 4P9GA 1PM7A 4QGNA 4EV0A 2HWD2 4YVSA 4LTAA 1TME2 1RL3A 1RUC2 4H3WA 2KA3A 4P9XA 5FO7B 3OY8A 4CEWA 3OD4A 3FLPA 3E97A 1N1SA 4LA3A 4Q4W2 1QU0A 5CNAA 2RR13 1ZBE3 5I8SA 4HANA 4YFZA 2NYYA 4MX3A 5J36A 3IMNA 1X36A 2ZGTA 1WD3A 1SBDA 3WUCA 4FP2A 4RHV3 1XXNA 4YGDA 5J3UA 2GZWA 3PJYA 2I07B 2Q1MA 2JENA 3JD71 4BZ4A 4AW7A 5LK5A 1F8VA 2BWCA 3P3NA 2QFEA 1GNZA 1PO21 1YUDA 1O7FA 4BH9A 1EP0A 5BNNC 3VBRB 1ZRFA 4K7JA 4RD7A 2RM21 4COVA 3TN93 1N3OA 1DZQA 2P3JA 2IFWA 4Y1VA 3H1MA 3AZXA 4Y4YA 2ETEA 4AEDA 3ZXKA 1GQGA 2DUPA 1RUG1 1YFXA 3WR0A 1JHNA 4COZA 2JG9C 1EAH1 4CEYA 4IEPA 1PIV3 2JX9A 4JDOA 5KHGA 3VBHB 4H7LA 1EV11 2ARXA 1D4M3 1AZDA 2BTVC 3MLJA 2R1DA 2DVAA 2VOWA 2UU8A 5C4WC 3VHOA 3NAPA 3NV3A 2XL9A 2XJTA 2D40A 4JC1A 4QPYA 4D7YA 2JG8B 5F6LB 2V5YA 5DDJ2 1QXJA 1PZ9A 5KXBA 4XYXA 3JD72 4ATFA 3ZYGA 4LEJA 3TN91 4J6GA 3M3CA 5LRSA 1QJX3 2DCKA 3AKTA 3BIWE 5FOJB 4Q26A 1J1TA 1NCRA 1JBCA 4LBMA 3B93A 1WW5A 5AVPA 1HRI1 3RMXA 2YZ4A 1OQDA 4Q4W1 3VBHA 3M3QA 1WMDA 4B3NA 1UZZA 1E57A 1REFA 1UU5A 1UZYA 1DQ0A 3VZLA 4EROA 5GM0A 2D6KA 3AM2A 1ASJ1 1W6OA 2DYCA 1RUC1 3BU7A 3WW1A 1NE4A 4NHLA 3VKLA 4Z82A 4AFBA 4MXVA 1WLDA 1ZZBA 1VJ2A 4L8QA 2X5IA 1XNKA 3LOBA 3BOPA 5JOYA 2XBO2 4BMBA 2Z69A 1YFUA 4C0BA 1C1FA 4FPLA 3TYJA 4OHXA 2X29A 2OUHA 3AZZA 1AR92 3SH4A 2V09A 2VOXA 3T1LA 3TRSB 1O5LA 2ZMNA 1I9RA 1VRH1 2PHRA 2BW8A 3QACA 2GAUA 2UYAA 1N3QA 3CLPA 4AE2A 2D97A 5D8AC 2ZGPA 3TWIA 2CL2A 1H9WA 2WWSA 3SH3A 4ASMB 4BLJA 4DY3A 2WS92 3KGLA 2OZ6A 1DZTA 1ENQA 2VNRA 3FFQA 1DGWA 2W08A 1ZYBA 1X8EA 2B5HA 4LO4B 2VQ0A 4M3CA 5AC91 4CDQC 4QU2A 1VIWB 1ZBA3 3POYA 5FTTC 1AYN1 1IHMA 1ZBE2 5BY5A 1S0IA 2DTWA 2GH8A 5IK5A 4IERA 3AFGA 1AJOA 3WQ7A 3MW4A 4AGRA 4YARA 1V6LA 3JZVA 1MS3A 2HEWF 1NQDA 4I0WB 4DMIA 5KXDA 2FMDA 2EAKA 3LOIA 3NAPC 2WLQA 1R082 4CDXC 5ABJB 4FPCA 4WVZA 3AZVA 4HSLA 1ZRCA 2BGCA 1ZZ9A 2DUOA 3WX5A 3O0VA 1Y3TA 2D6LX 3RZZA 4CTEA 2XJSA 2ZJCA 3C2UA 4GKXA 2VMGA 3DF0A 1WMEA 4FO9A 3VDDC 4Z07A 3H1YA 1C5HA 4GIQA 2RS53 2OA2A 3WUDA 2JDZA 5FOBB 3U0ZA 3VBOB 4C91A 1I6XA 1W6NB 1I5ZA 2R49A 1XNDA 4OHVA 4COYA 4S2HA 1PNGA 1LU1A 2EAAA 3GYDA 4JRAA 2WT2A 1VR3A 1NA1A 1V9U2 3BOWA 3USUB 2TBVA 4Z8BA 4BLIA 4FAHA 2HWC3 1SCRA 3FJSA 3JQXA 5KHHA 3LGRA 4KU7A 4N9IA 1W0PA 1CAXB 3J26N 5I8TA 3ZYJB 1UAIA 1NZCA 1S2BA 4FBFA 3JU9A 3S0MA 4BM8A 3LAGA 4LLFA 4COWA 5DZGA 2JG8A 2OIIA 1BVP1 4QQ2A 2PN5A 1RUJ3 4XQ4A 1EAH3 3KS7A 2DVFA 3AP9A 4FT8A 4XBNA 1C5IA 1AX1A 4J1XA 2YYOA 5FCCA 1QDCA 3AXEA 4XFFA 1GZCA 1H1IA 4XF0A 4JCKA 1VRH2 1S0DA 3L9JT 1PIV2 4CRQA 1C57A 4OUMA 2R073 4RSUA 1G9BA 2R0FA 2HWB2 4ITCA 2BPA2 2EXKA 1COV3 1CAVA 2C1FA 1LOCA 4FOWA 4BOWA 3W9AA 4Q1PA 1JYCA 3M2MA 2ZGNA 1AL22 1OA2A 2C5DA 2KXLA 1K5MA 2H0VA 3EHKA 4AGVA 1KFXL 2GMMA 3OPZA 1FAYA 1PGW2 4BHPA 1AR83 3NW4A 3IDEA 4CEYC 2B46X 5FREA 4I01A 3NV2A 5FAXA 5KXEA 1ND2A 3DPRC 3VKFC 3D0JA 1J58A 1DZRA 2G4IA 2WA3A 2WFPA 2ZX2A 1BEV3 1LOAA 2BNOA 5EFUA 5K8SA 3HQXA 5AFEA 3CF6E 1QJU2 2ZGKA 3MF9A 3ZFGB 1VBD1 5F1RA 3KB5A 1FNZA 2XJRA 3D82A 4K21A 1Z7S2 1LU2A 2PHXA 5L19A 1PIV1 4YW2A 3V0BA 3L2HA 4KGGA 3WW4A 4HBNA 4Q0QA 1W2UA 2D3PA 2EVXA 3RG0A 4GH4A 5HCFA 4KH9A 4LT5A 3PNAA 3TB0A 3BALA 2PLV2 3VBFC 1RJ8A 4B8EA 3ENRA 4C0HA 1B35C 1ZBA2 1I3HA 4WVVA 2IWGB 4MH0E 5T52A 1X8MA 1EAH2 2D3RA 1YFWA 4PJYA 2B9UA 5T5PA 1ULEA 3M70A 3TNPB 5LRRA 4KQ7A 4R4ZA 2HWC1 3E5QA 1PK6B 4PF5A 4M3CF 2VVDA 4K1YA 2QVSB 2WNVA 4RA0A 5FMOS 4Z2WA 5GLWA 3PVEA 2DCJA 4MGYE 2JG8C 5J96B 3MIBA 3SXWA 1NCQB 2PHDA 3J4UH 4PDWC 1GBGA 2W52A 1J3PA 3IIAA 1S0FA 3H9AA 1HKDA 1UKGA 4AI2A 1UU6A 2WFF3 3A0NA 4XF9A 3KCCA 3R4DB 5KHIA 1MQTC 4YNIA 4IEWA 1OOPC 1XU1A 1KFUL 3KM5A 2JICA 1WLWA 4Q4Y3 4C1XA 5JSOA 1GSLA 1G7YA 4W6XA 3RQ0A 1ASJ3 1HRV1 3H3ZA 2RS13 3MEPA 4S2DA 3MLLA 3B69A 1QOSA 4META 4RS5A 1LR5A 5J98B 4QGMA 4WZCA 3IBMA 2VGDA 2YPJA 3KZ4C 4XIKA 1EV13 1H2LA 2JG9B 1SACA 4KG0A 4NHMA 1BCXA 3GZUC 4PLMA 5EYXA 1G9AA 3FLRA 1SLTA 4IESA 4IETA 2E7TA 1SDWA 2R043 2R0HA 3V56A 4B4RA 3B9CA 2Q8OA 2ZGMA 1UKRA 4R9BA 1ALYA 5ABJA 2P17A 1AYM3 3CNAA 3DPRA 1ZVFA 4WVMA 5CG9A 3D5OA 5EZWA 1AR81 2A3XA 2HWE3 1UIJA 4L11A 4KWLA 4HMZA 3VBOC 4X6RB 4PIXA 1XE8A 4TZDA 1DG6A 3WV6A 5E89A 3VKMA 3D4KA 4XJ8A 1KDKA 1RB8G 2VH9A 1SBFA 2QDNA 4JGYC 3D0SA 4AFMA 5BYNA 5HBAA 1NCRB 4QQLA 1XYPA 1IS3A 1O3SA 1YLLA 2XLFA 4QPIA 3KT1A 5JZGB 3R05A 3VBSA 2R061 4HL0A 1IPJA 1CONA 4YG3A 5AVAA 3O12A 2XVGA 4JGZB 2IC1A 1C8M3 1ZRRA 1CAWA 1H1MA 2JE9A 2TNFA 1OD5A 1AX2A 2W0XA 3VHRA 3WW2A 1OQ1A 4YGCA 1JW6A 5JOWA 2NM1A 4LHKA 3TAYA 4YFWA 2VOVA 1MS5A 2PYTA 3VZMA 1HV0A 4CP2A 1OI6A 1NY72 3OBTA 2RMU2 4DZGA 4LUMA 4XFGA 1H4HA 3N3HA 2GC1A 3C3VA 1QQP1 1QQP2 5BNOC 2CGNA 2WNUA 3VDDB 1HQLA 1HRI2 2AUYA 4B29A 3B5LB 1GANA 3HR9A 4DFSA 1FMD2 3WDXA 4AHWA 3BPZA 4YW5A 2K9ZA 1A6CA 2EXJA 3NKGA 4CDUA 5C8CB 2E6VA 1HX6A 2IXJA 5CA6A 4Q8KA 2BVBA 4BE3A 1V6OA 3RI8A 4OHYA 5A33B 2D6MA 4GQ7A 3PTYA 3UKTA 2WNEA 3K51A 1IS6A 1U5IA 4P9LA 1RUNA 2FZ2A 2R1BA 4IV3A 5T5OA 2VMIA 2R062 2YHJA 4OHWA 3WXPA 4CDQA 2XJUA 1Y9QA 3AYEA 1RUJ1 3HAGA 2DF7A 2V73A 1Q8QA 1QXPA 2WC2A 2YROA 3VV1A 3ZYRA 5CU1A 5IK7A 1R092 2D43A 3SLIA 4RQPA 1ND2C 1YNAA 3O14A 5L7OB 4IV1B 4RS5B 3RSJA 1R1A2 3FMGA 4Q0SA 1RUH2 2D98A 2XJQA 5T3NA 1N47A 4AK3A 2HWE1 2DFBA 2ET1A 5KXCA 4E9KA 1BMV1 3LB9A 1RMU3 3QLQA 4DPNA 2ZCWA 4BWOA 4GMP0 4P14A 4Y24A 1UIKA 4N53A 5BNQA 1QJZA 3JBG3 1ENRA 2D3SA 2RMU3 4HT1T 2ZGLA 1POV0 3VBSC 1AR71 4P9JA 3AMPA 1O3QA 4XMAA 2FMYA 4YZ5A 2A3YA 4LBLA 1DU3D 1PK6A 1RUI3 1LEMA 4UW5A 1LJ7A 3VZKA 3B02A 3AP7A 3O0XA 3AZYA 4EN8B 1OQEA 4NVPA 1LHWA 2AGSA 3UV9A 3NSTA 4Y22A 5FPXA 1L3JA 1MQTB 5GZCA 2BNNA 4X6QB 4AQ2A 2WSUA 4ISQA 2CNAA 2WQZC 4I0BA 3AMQA 4K9SA 2HWD3 4QPGC 1J1LA 1QHDA 2OZJA 5LEKA 1ZZ7A 1JYIA 5FLJA 4I2OA 2D6PA 3RPQA 2AR6A 4E2SA 4Q4X3 2VOKA 4JGZA 4XJUA 2XG3A 1HXS2 4IEUA 4XXAA 4RQPC 1PVC3 1N3PA 3H0OA 5GLUA 5T50A 4GULA 2ILMA 1RUE1 5A3LA 4RHV2 1U5ZA 3ZXAC 2X5IC 5GLTA 3TOJA